2PA7A

Structure of wild-type dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
ENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
molecule tags Isomerase
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pa7A00
3H50A 4I3PA 4ORFA 4XFGA 2Q0AA 3TNPB 2OA2A 4A2UA 2BGCA 1EPZA 4I2OA 3PLQA 3S0MA 2XL9A 1YHFA 3BPZA 3WW1A 2IXHA 1VJ2A 5I91A 3I59A 2PAKA 3NSTA 1SQ4A 2QVSB 3H3UA 3E5UA 3RNSA 1X8MA 1LB2A 1UCXA 4I0BA 3WW4A 2PHLA 2CV6A 2C0ZA 4IEWA 2XKOA 1ZZ6A 3LA7A 4HZFA 2FMYA 2H6BA 1ZRFA 2PYTA 3E6CC 2UYBA 5I0UA 3CO2A 3RDIA 1WLTA 5I0RA 3UKVA 2ETEA 5FLJA 4F7ZA 3EBRA 4DINB 2D93A 4BYYA 1NZCA 5BY5A 5EZWA 4ZU7A 1ZNPA 3MYXA 1UD1A 4Q0PA 3VHRA 1EYBA 4LA3A 4BHPA 4QM9A 3IIAA 1G6NA 2OYZA 4OFGA 1QWRA 2BNOA 3WW3A 1CAVA 3M3IA 1O4TA 1WGPA 5J7MA 3SHRA 2PTMA 5BXXA 3GYDA 3FJSA 4ONUA 1GQGA 1U12A 1O3SA 5JAXA 1ZZ7A 4PIYA 4XFAA 1I6XA 4MGIE 1O3RA 5BV6A 4KWKA 4MGYE 2O8QA 1X8EA 3KGZA 3BU7A 3ES1A 3OCPA 1ZRCA 4J1XA 5AVPA 4Q29A 4UXAA 4KU7A 3HQXA 4NVPA 3FX3A 2XHKA 5JSPA 4O9EA 4XFBA 1I5ZA 2GC3A 5LEKA 1YFWA 1NYWA 3S7EA 2FQPA 1CAUB 3KSCA 4AQ6A 3IDBB 4LUKA 3I54A 4Q0VA 4E2SA 4PIXA 4AVBA 1SFNA 1LKNA 2OZ6A 4QXKA 2WC2A 1PMIA 3SXWA 1YUDA 1YWKA 1IPJA 3H1WA 3H3ZA 2ZKLA 1ZZBA 4IEOA 1Y9QA 3FFQA 3PNAA 4CYDA 1EY2A 3RYPA 5JSOA 3WW2A 4MV2A 3D82A 4XFCA 4FAHA 4EROA 4EWEA 5FLHA 2VQAA 4I0AA 2H6CA 2B9UA 4QX5A 3U11A 2BYVE 4XFIA 3S7IA 3U0ZA 1RC6A 5C6CA 4D7SA 3E97A 4KWLA 3ZDSA 4Z82A 4MGZE 2Q1ZB 4B29A 2MPFA 1DZTA 1CAXB 1VR3A 3H9AA 4Q0SA 5FQ0B 3DV8A 4AXOA 4D7TA 2D5FA 1LR5A 2PAEA 4JV4A 2OZJA 4MUVA 4IEUA 5K8SA 4QGLA 2O1QA 4AQ2A 3D0JA 4HLTA 2GC1A 3DL3A 3H7JA 3ST7A 3LZZA 3KMHA 3DN7A 4EWAA 3UKTA 2CAVA 1J58A 3R6SA 4MX3A 4XF0A 4LLOA 4MZUA 3CEWA 5EFUA 2B5HA 3H1MA 4IEPA 3KCCA 5BUVA 4Q0QA 2V09A 4GULA 2QCSB 5LRSA 4P9GA 1GQHA 4HN1A 4YNIA 4E2GA 4FAGA 4XFFA 4JTOA 2UYAA 4UBGA 2E9QA 4HN0A 4YYOA 2N7GA 3CL1A 3E6DA 1DZRA 4IEZA 3OTFA 5KHGA 5FLIA 3D0SA 4N9HA 2ATFA 2ZCWA 4QMAA 4O9GA 4JVAA 5HI0A 3ES4A 3C3VA 1EP0A 5F1RA 4XEZA 1L3JA 4MH0E 3EHKA 4BIFA 2PFWA 2PQQA 5KHIA 2PA7A 1ZVFA 4KU8A 3JZVA 3I59B 2XLFA 4H7LA 4QGNA 1DGWA 3RZZA 4IEVA 4QM8A 2XLGA 1V70A 3E5QA 1ZRDA 3H1YA 1FI2A 4R52A 4J1WA 5T3NA 4AVCA 4AVAA 3NJZA 3BALA 4LEJA 4IEXA 1YFXA 3NVCA 3IWZA 1H1MA 4META 1OI6A 3DKWA 4OLLA 2I45A 2PAMA 4EV0A 3PVBB 1WA4A 5E1RA 5I8SA 4ZU5A 4LTAA 1XE8A 2MNGA 2D5HA 4X6QB 1X82A 2P17A 4Q0UA 1O5LA 3E5XA 4PIZA 5FCCA 1J1LA 2Q4SA 4KWJA 3E6BA 4HVQA 1CGPA 2UY8A 3KGLA 3CF6E 1CAWA 4WBBA 1FXZA 5FDBA 1O5UA 3U10A 3H8UA 1XE7A 1Q43A 2K9ZA 3GBFA 5I8TA 2PHDA 1CAVB 4JTNA 5LEJA 1UPIA 5FPZA 1JUHA 3FE5A 1J3PA 4R8HA 4ZU4A 4FBFA 2Z2SB 4LUMA 1IPKA 1FT9A 2WFPA 2Q30A 1RUOA 2HJIA 1VP6A 5C8WA 4PJYA 1OD5A 1ZX5A 1O3QA 1SEFA 2KXLA 1RGSA 4HSJA 2VECA 2UY9A 4HVRA 3CLPA 4IEYA 4HSLA 4IETA 2GC2A 4BH9A 1LRHA 1O7FA 3M70A 4TLFA 4UBHA 4WVZA 4XF4A 4XFHA 1Q3EA 4N9IA 2CAUA 2BNNA 4E2QA 5LRRA 1UW8A 5CU1A 1QY4A 4XF3A 1ZRRA 1YFUA 3B02A 1NXMA 3NL1A 3O14A 1DGRA 3LWCA 3FWEA 2IXJA 5BPXA 2VPVA 3CJXA 2OPKA 2GU9A 2GZWA 5JCTA 1H1IA 4XF1A 3MPBA 4FT8A 5I8YA 1J3RA 3N4MA 2IXIA 3ROUA 3LA3A 2BNMA 2CGPA 5E16A 3G7DA 2IXLA 2DCTA 2QDRA 1HW5A 3OF1A 2Z69A 4I02A 3ELNA 2IC1A 1CX4A 3FZ3A 4YRDA 1Y3TA 3OGJA 4K8FA 4EWDA 3NKTA 3OD0A 4YSFA 1RL3A 1XRUA 3SCFA 5JSRA 3TNQA 1PM7A 3EO6A 3MDPA 4LA2A 1ZZ8A 4MGKE 3QOPA 3NW4A 1CAUA 3L2HA 3RYRA 2XLAA 5KBFA 2XKPA 1ZREA 5CADA 1RUNA 4L11A 1J59A 2HKXA 5D1IA 4YARA 2K0GA 2EA7A 2QNKA 4I09A 1X7NA 1YLLA 3BCWA 1J3QA 1RTVA 4XETA 4KL1A 3UKNA 2XGXA 2B8MA 2H0VA 1OMIA 4QGMA 3USSA 3IBMA 1UIKA 3HIFA 4XF9A 3HT2A 1ZZ9A 5CVRA 4RD7A 4HVOA 2ET1A 3LA2A 1TQ5A 2GH2A 3LOIA 4F8AA 2QJVA 3SMHA 5KHJA 2Y0OA 5I0SA 3SCHA 3FHIB 1CAXA 3H7YA 5I93A 2GAUA 5FQ0A 1NE4A 5JR7B 3HT1A 1NE6A 3BB6A 2IXKA 2F4PA 3SCGA 5KHKA 4Z07A 3MZHA 2ET7A 1OFNA 2IXCA 2EAAA 3EQEA 1YFYA 2XL7A 4I01A 2BEOA 5KHHA 1O3TA 1QXJA 4HMZA 4IESA 4X6RB 5J3UA 5FPXA 2D40A 2GC0A 1UIJA 3ETQA 3RYKA 3EJKA 4IEQA 1Q5OA 4L2NA 3RPQA 1ZZCA 4IERA 3I7DA 1QXRA 2MHFA 2EVXA 4HBNA 5I0TA 4WZCA 1CAWB 3LAGA 3ACLA 4LULA 5J48A 3QACA 3IDCB
chains in the Genus database with same CATH superfamily
1AR63 1CQ9A 4B7KA 1KFXL 5GZEA 5FZHA 4XBNA 1DGRN 3BIWE 3OYWB 1WCQA 1ODMA 1SACA 4J25A 3J7MA 4RQPA 5FP8A 3JD73 1EPZA 2IUWA 4I2OA 1W8OA 1W6PA 2WWJA 4OZXA 2WZR3 5APAA 1NG0A 1UYXA 5T55A 3J4UH 3UJQA 2XL9A 2JDZA 1RMU3 4BQ5A 4CUAA 1VJ2A 2A70A 1ULOA 2HEVF 3NSTA 2R1DA 1W06A 3E5UA 4K9SA 1X8MA 3WNLA 1LB2A 4OQ8A 1W2UA 1HXS3 3R4UA 1Q8QA 1JTZX 3KF5A 5FFOC 3WW4A 4B1LA 5KC6A 5F5AA 2PHLA 1UOBA 2CV6A 2R062 4XVHA 1OQDA 2C0ZA 1VBE3 1N3PA 3AL6A 3NV1A 4H3WA 4HZFA 5JI9A 2KR2A 3WNPA 4EJRA 3WLUA 2UYBA 1R1A1 4L8QA 1WLWA 2NP0A 1WLTA 3CBNA 3TAYA 1QJX3 3AP4A 1O6UA 2WDBA 1UY1A 4IE7A 4BK5A 1SG3A 2D93A 2GNMA 2WQ4A 1RUG2 4Y1UA 1AVBA 1T2XA 1IG0A 4LOTA 1IPSA 1NZCA 1J83A 1VAMA 2DVAA 1QHDA 4WM8B 4OMDA 2YFZA 1F4AA 3I2DA 2CDOA 5ERLA 1ZNPA 3UV9A 3ZYRA 1K12A 4R4ZA 1F31A 3Q8EA 3VHRA 2KD7A 4XIOA 2EAKA 4BCUA 4WM7C 3VB9A 1EYBA 3ZYHA 2X29A 4LA3A 4QM9A 5IFPA 2P37A 4N53B 5FPLA 2EXIA 2Y64A 5FIXA 3ACGA 5IJRA 1X50A 2D3SA 1QF3A 1W6QA 3WW3A 3TRSB 1CAVA 1TEIA 1ACCA 3LKJA 2PXJA 2XJSA 1O4TA 1LHOA 3AP5A 4IE0A 5DUUA 5FZAA 1WGPA 4AW7A 5J7MA 3I2FA 3RJRA 4CEWC 1LENA 1WW4A 2BVVA 2NQYA 3B7MA 3AC0A 4LXLA 4NPLA 4MADA 1LODA 2WQ8A 1O3SA 4KNCA 4CVUA 2HWB1 4YG0A 4B4QA 2VNRA 3CJIB 4A7ZA 1CR7A 2DFCA 3SH3A 4MGYE 1VMHA 2O8QA 2W1UA 3GXUA 4LKFA 4MXWB 5FZCA 2QQWA 5I0DA 1G9FA 3KB5A 1Y7BA 5FJHA 3F2ZA 1ND3C 4BE3A 2ZZJA 2R061 3BU7A 4GB32 4BZ4A 1YQ6A 4P08A 1W2NA 1OLRA 2E7TA 3O1SA 2JE9A 1NCQB 5A3MA 5AVPA 3CMGA 2DVBA 2WNUA 4LIVA 3HNYM 5IUQA 1W8WA 4NOTA 4AHXA 3VD5A 2F17A 3GHMA 1YEWA 4BQXA 2R073 1W03A 3JXSA 4O9EA 4BISA 1UY2A 1I5ZA 1OQ1A 3VBFC 4U2AA 2PLV2 2VUJA 2AREA 4XBQA 1A8MA 2Q8DA 5M0TA 5FYCA 5FV3A 1NYWA 2ARAA 2FQPA 3S7EA 1NA1C 2BBAA 3BU0A 4K21A 1XU2A 5LASA 4AK3A 4NMIA 5GLVA 4AQ6A 3I54A 5EPAA 2HH9A 2ZX1A 1W9WA 4XDOA 5FY7A 4IV1A 2DFBA 2E32A 2XMLA 2OQ6A 1POV1 1TNFA 1PMIA 2JENA 4LBQA 3H3ZA 1IPJA 3H1WA 4XUPA 1ZZBA 4XBLA 4PDWC 5L9RA 1MEC2 1Y9QA 3CZJA 4DNYA 1W9FA 3PNAA 4QKFA 3O1MA 4C8DA 4OCTA 4FAHA 4EROA 3SKJE 3JQWA 2XUMA 1WW6A 1BVP1 4JRAA 1YIFA 5LY1A 4BWOA 4QPGB 3RWKX 2VY0A 3VBHC 3V64A 3TB0A 5LA9A 1RC6A 4Y22B 1COV2 1RUH3 3ZDSA 1KS4A 1OVPA 4MGZE 2R0HA 4B29A 3AZXA 4Q0SA 4D7TA 1VR3A 3OY8B 1EAH3 1YCIA 2D6LX 4LIUA 5L7OC 2B46X 2D5FA 2JDHA 1LR5A 2QBXA 3OGSA 2R49A 4GB31 4IV3C 4LKEA 2PAEA 3CIHA 3ZFGC 5K8SA 1JZ8A 4MXVA 2VD7A 4AEDA 1AZDA 5F2SA 2GP3A 2JIJA 1T6GC 2VZPA 5FZBA 2VH9A 2OX0A 5C8CC 5JOYA 3VDBA 1OA2A 3ACFA 3E1F1 3DL3A 4CZSA 2DTYA 2PLV1 3LZZA 5CAZA 3KMHA 3DN7A 2CAVA 3DKQA 3MUY1 1H9WA 1OA4A 1XYPA 4OI0A 3CEWA 1IZ3A 3K77A 2UURA 4E4DX 1D0GA 4XPVA 1AJKA 5FPUA 1W8FA 5BUVA 4NR1A 4OHWA 2V09A 3HMYA 3T08A 4GULA 4JCKA 3BUCA 5LRSA 5JLVA 1NXD1 3VHNA 2DUQA 1GQHA 1UYYA 4P9GA 1N3QA 2VZ3A 5BYNA 2EIEA 1AR93 1LTEA 1MEC1 1PIV3 2X09A 3U4SA 5AC91 4YNIA 4E2GA 4YM3A 2J22A 3C7GA 1AXZA 2E9QA 4HN0A 3T09A 1UKGA 4CU9A 3S6PA 2B7YA 1C8M2 1STMA 2Y6FA 3E6DA 5H9SA 4AEKA 3KV9A 3K4ZA 1RUF3 4LO5B 1QXPA 5FLIA 3LSEA 2ATFA 4YW6A 4D69A 3ASIA 1FMD3 1Y43B 4AQSA 4CEYC 3NRUA 4DUXA 2RS52 1NLQA 1UY4A 1COV1 2BGPA 5FYMA 3ZFEA 5CEHA 1G9BA 5FZ4A 4L99A 2RMU3 1Z78A 4TLGA 2BVBA 1A6CA 2KA3A 1BKZA 1UU4A 4UYBA 5F1RA 1L3JA 1ULDA 2AYHA 3EHKA 4C1XA 1GWKA 4XAEA 1ZA7A 2VMDA 1XNAA 2HWC3 2PQQA 2PA7A 4JGYC 1GZWB 4RGKA 4I30A 4O65A 4ZZ8A 2JG8A 1OHFA 5KXDA 5LBCA 4UWDA 3RZZA 1I3HA 3HN3A 5JZGB 1V70A 4MHRA 3T2PA 1SCSA 2PHRA 4QDRA 2EXJA 5T3NA 4R52A 5FWJA 3NJZA 4YGDA 4IEXA 2EF6A 2RDRA 2FCTA 5FPVA 1H1MA 1FV2A 1PK6A 3IWZA 5DG1A 4META 1LOCA 1NOVA 1OI6A 2G4IA 2Y8KA 4A6OA 4N7IA 4XQWA 1NCRB 1QU0A 1FOD1 4YZ1A 2QZ2A 3T0BA 2PAMA 1JS9A 3ZR6A 1KGYA 5A33B 3KHCA 3PVBB 1WA4A 3ZSJA 3P3PA 2HLEA 1UXZA 3PJYA 4ZU5A 4ARYA 2MNGA 1JODA 2D5HA 1HN1A 3CZUA 4QX3A 2WUHA 1SHWB 2RS32 1XPWA 3MF6A 2P17A 1BBT1 5FZGA 3O1OA 1O5LA 5FXZA 1K45A 1FX5A 4LO7A 1J1LA 3KVAA 4RQPC 4AFMA 3AKPA 2ZGMA 1WLDA 5DN2A 4RHV2 4HFSA 1DHKB 2E26A 3B5LB 1VLNA 3AMQA 3KGLA 2ZA9A 3CF6E 3PU8A 5K0UA 1S0GA 2AEYA 3J7LA 1WBFA 2RM22 4HOOA 4WBBA 5FDBA 3VD9A 1AYM2 2RS51 2K9ZA 2ZGRA 3Q8FA 3AJZA 3VKNA 3ACHA 2YU1A 2OW4A 5FOJB 2VNGA 4A41A 4K1ZA 4ZXEA 5JMOA 3VBOA 2WIIB 5JMCA 2XDVA 1JUHA 4QB1A 3FE5A 2A3XA 4LO4B 1SPPA 1J3PA 4NRMA 2BV4A 4N43A 2ZAHA 4O7XA 4V2VA 2ZZQA 5ANQA 3SITA 3MW3A 5CKMA 4YZ2A 2SLIA 1BMV2 5LK7B 1FT9A 1FPN3 4RR3B 4D8MA 1RUOA 2JB8A 5C8WA 2HWE3 1SEFA 2KXLA 4QB6A 5FREA 4HSJA 1CPNA 2WO3A 1G9AA 1M4WA 4BQWA 4FI9A 5HXMA 1ZBA2 4LE3A 2J1EA 3W59A 4AGRA 1QQP3 1O4ZA 5EXOA 3WF2A 1SLCA 2VQUA 5C3PA 2X5IA 4W4ZA 2GC2A 4BH9A 2OXBA 2JDMA 3USUB 1O7FA 3M70A 4KG0A 5C5TA 2GP5A 1MS3A 4XFHA 1GQPA 4A3ZA 2ZTNA 1D2SA 4ZS2A 3VDCA 4CRQA 2HEYF 2I74A 3LDRA 1VRH2 2J1AA 4E8DA 3R0RA 1SLTA 2BNNA 2G9FA 3GHNA 4UF0B 5LA0A 1MR5A 5LRRA 1OF3A 1REFA 4QX0A 5A7PA 1MPXA 2BGOA 3J8F2 4RHV1 1A34A 4LBKA 3H8RA 3B02A 1NXMA 2WFF2 1DGRA 5J09A 4OHZA 5FZ1A 2FCUA 3ZYBA 5GZGA 1AYM1 4OI2A 3LWCA 2WA3A 4DB5A 4BMBA 3FHAA 3WDXA 2WABA 5GKAC 2GU9A 4Q27A 2VCAA 2W47A 1JYXA 1EV13 3WZ1A 2E63A 5I8YA 2JD4A 1IS3A 1J3RA 3T30A 3IDEA 4CUBA 4DUWA 3VBRA 1QJY3 3ROUA 1BMV1 3DPRB 4LHSA 2WNUC 3UGHA 3GM8A 2BNMA 3THDA 3VBSA 3DF0A 4KH9A 3OEBA 1NAEA 4OYUA 2XB6C 4XUNA 1CJPA 2QQJA 2WAAA 4CDUB 1IKPA 4MO3M 4YLZA 4GZ9A 3OF1A 4FQZA 1ZBA1 1NLRA 2Z69A 4BLIA 2WQZC 3A0KA 4FPHA 4LO8A 1DZQA 2P34A 4OHYA 2ZJCA 5EWSA 2IC1A 3K4DA 2XJRA 4YRDA 2WS92 4K8FA 1GFF2 2RE9A 3NKTA 1AHSA 4LORA 5FZFA 4CUGA 4IV1C 3OD0A 4YSFA 5DZGA 4A7KA 3NAPC 1JYTA 1PM7A 2GSYA 1UY3A 1K5MB 1WUVA 4LA2A 5GZDA 1VRH1 1UPSA 3NV2A 1RXGA 2XVGA 4UAPA 1HQLA 5JXJA 3B00A 5FY4A 2G1MA 2ES3A 5KBFA 3J8F1 2B4KA 2JJ6A 2JX9A 5CFDA 4Y4RA 2HKXA 4FFHA 2WFF1 3ZN6A 5C33A 5D1IA 4YARA 2K0GA 3SH4A 3NNJA 1IS6A 4PQ9A 4A3XA 2FDGA 1W3XA 2GNBA 4XHBA 3NWKA 5FKCA 1XB9A 1J3QA 1RTVA 1XNBA 3PVOA 4KL1A 1JYCA 3HQUA 3S30A 3VKOA 5C3QA 3MI8A 1UYPA 4QGMA 4PCRA 2Y60A 4WVWA 4OZOA 1UIKA 2E7AA 2WSUA 5IW0A 3C7FA 3ILFA 3PTRB 4CP9A 1JN2P 1TME2 5CVRA 4AGGA 3CNAA 4DEVA 3K51A 4AEDC 5A3WA 3LA2A 1V6MA 3ZXEA 4AQTA 1LHVA 4EN6B 1ND2A 1TQ5A 1AL0G 2GH2A 2P6HA 2YDEA 3OSDA 4F8AA 3SMHA 5HPOA 4AL9A 4IGOA 1RJ7A 1XXNA 1W6MB 4Q5OA 3FHIB 3WHTA 3ZYGA 2GAUA 1AR73 3RZLA 1BXHA 4DO0A 3IAPA 3VDDA 1NE6A 2VOXA 4CA9A 2IXKA 2WS91 3QCWA 2VBBA 2VL4A 2FDKA 1KFUL 1X9PA 2VTXA 5FZ8A 1OFNA 1W6NB 2VZSA 2DBIA 2PHWA 3B94A 2EAAA 4HK9A 4JDNA 3ZFGB 4BXFA 4M3CE 1SDDB 1HQWA 2XL7A 5EQUA 5HV0A 3OJBA 5CYYA 1LAJA 2YROA 3BTYA 5KHHA 1R083 3AVSA 2YY1A 5JVVA 5FYSA 1SLLA 3RGBA 4HMZA 4IESA 1LECA 4K6BA 4RS5B 3IM0A 5JDBA 1US3A 2FHRA 1Y9MA 1AX0A 4LBNA 3VZMA 4B1MA 1MZFA 3V0AB 4AHYA 3WF4A 1AX2A 2BPA2 2F6BA 4YVSB 5J3UA 3ZYJB 3MLLA 2D40A 2OT7A 1G8WA 1V6OA 4PHZA 4R9CA 3ZFEC 1IHMA 1FV3A 5D8AB 1D4M2 4CU7A 4IEQA 3PMEA 4GH4A 2WWUA 3RPQA 3WP3A 2OIIA 1UNBA 5K4LA 4IERA 3AM2A 3VD4A 5FY9A 2Y6LA 4WVMA 5I0TA 5JOXA 4WZCA 1W0PA 5FR3A 1W2AX 1ULPA 3WR0A 1W0OA 3FBYA 5E88A 5J48A 4NO4A 5SV8A 2WWSA 1XE0A 2JG8C 3IDCB 5H9RA 4I3PA 1GUIA 1RUC2 4TWTA 4AVVA 2Q0AA 3WNMA 5DAPA 5K7PA 1V9U3 1Y4WA 4YW4A 3L2YA 5FBZA 2C9KA 1Z7S2 3TOJA 3RJ2X 2BGCA 1OUSA 1SZBA 4TZDA 1RUI3 1PK6C 2ZX0A 3S0MA 3I3MA 4YW5A 1YHFA 1RUJ2 2IXHA 2H0BA 1F9KA 1X9TA 2XONA 4QX7A 3UETA 2ORZA 2X05A 3GCWA 4XXAA 4NIIA 4Q4X3 1UCXA 2VAUA 1HQNA 5IATA 4I0BA 4G9SB 4DOUA 3SEEA 2MEV3 5CNAA 3HEIA 1S2EA 1OURA 3VLBB 4IEWA 1VBA3 3AKQA 3DYPA 3N7LA 1ZZ6A 5A6QA 2WO1A 4KBBA 4LE4A 3E6CC 4AAXA 5I0UA 2LUWA 2RR13 1HX6A 1B35A 2VZQA 3CO2A 1OXCA 1RVF3 2A6WA 3RDIA 1FYUA 5I0RA 3UKVA 2ETEA 1R093 2VOVA 5K0UC 2C24A 1VAVA 3JBG3 3LIHA 3SEPA 2R30A 3ZVXA 4RGAA 3U37A 5BNPB 2D44A 1DG6A 4XACA 3RMYA 2J42A 4PLOA 5B2GB 4UW3A 1GOFA 3VBOC 4AHZA 4UFIA 3N9QA 4Q4V2 4Y26A 5GJ6A 1G86A 2GMEA 1UD1A 3MYXA 4N43C 2BOJA 2XH6A 5A70A 1GU3A 3J9SA 3T1LA 2P6CA 2YB7A 4FTBA 1PMHX 5CB7A 1E5RA 4Q8LA 3KT1A 1RUC1 1QJU3 2OYZA 1MQTA 2B39A 3W9AA 1QEXA 1RB8G 2FDIA 1Z7S1 5ABJB 1UZ0A 2ZHKA 1YQ2A 3JUUA 3M3IA 2QQKA 1AR82 4PLNA 1XC6A 4IE6A 4XJUA 2DVGA 2YPDA 4Y1YA 3SHRA 2PTMA 3AMHA 2R32A 1OKOA 3GYDA 4PBOA 4M3CA 3OGRA 3FC0A 1GQGA 1RUJ1 4LHKA 5DDJ2 4E4HA 2X5IC 1ZZ7A 5JAXA 3U78A 1HLCA 2DUPA 1Q8VA 1UX6A 2XBO2 5E6HA 3ORJA 4M4PA 3RRDA 1RHI3 1H6YA 1HIXA 1PO22 2ZHNA 3T1MA 3GZUC 3I2KA 3T4HB 4CP0A 5CZKA 2WZ8A 4Q4W2 1I1EA 3OCPA 3FMGA 1H9PA 4GWJA 1LULA 1ASJ2 2W0XA 2P3YA 4GWIA 3LQCA 2D7FA 2C6SA 1D0HA 3HQXA 4S2HA 4AFBA 4WV8A 3FX3A 4X8NA 2XHKA 4MGQA 2P5BA 4LJHA 1LOGA 3OUIA 4MSVA 1QNWA 1XJAA 5C4WB 5FKBA 5LEKA 3OPZA 3VL9A 4JHTA 1CAUB 3TEYA 1AYN2 3R4DB 1QDCA 4Q4Y3 4XQDA 3M4FA 3NNLA 2IFWA 5A32B 1APNA 1GV9A 4Q4V1 4LUKA 2CNAA 2XOMA 4PIXA 4XJ9A 1UAIA 2VGDA 2QZ3A 4AVBA 3VBRC 3TN92 3SXWA 1HN0A 2JXAA 2WC2A 4B8EA 3N9MA 5LW9A 1BZWA 3VBSC 1S0JA 4SBVA 5KXEA 3MICA 1DLLA 1R1A3 3D5OA 4ZZ5A 1YNAA 1EY2A 4YM1A 2RJKA 5JSOA 1OOPA 4XW3A 1R1ZA 5LY2A 4MV2A 3D82A 4YVWB 4XAAA 3BN6A 2W5FA 3RG0A 3ZIWA 2RJ2A 1HDKA 4C91A 3KCXA 4EWEA 1O8SA 5FLHA 4EE2A 2GMMA 2HWD1 2VQAA 2YGMA 4I0AA 4Y20B 2A3YA 4F83A 1U5IA 3WUDA 3OBAA 5FWEA 5DDJ1 5FY1A 3WT3A 4MYEA 3S7IA 3ATGA 3DECA 3N36A 2XBO1 4E27A 4D7SA 3NJYA 2A6XA 3E97A 4KWLA 1PO21 4RGGA 1HRI3 2ZGTA 4XMAA 2VE1A 5HCBA 1GLHA 2Q1ZB 5JXGA 2I07B 1CAXB 1ENXA 2XXZA 3RS6A 4LNVA 3I2JA 4AXOA 4X8PA 4Q4W1 3HQRA 1UX7A 1U5XA 4XDPA 1AL22 3I97A 2OZJA 2CWSA 5DAQA 1ASJ1 4MUVA 4IEUA 1LGNA 3O0VA 3Q8CA 3BTXA 2RS12 3N9PA 2C1FA 3FL7A 5CFDC 3AZVA 3T3YA 3U1XA 1W9SA 3VZLA 3CQOA 4EZ4A 1GICA 1CVNA 3HN1A 1IQAA 4HONA 3M3CA 4C90A 1LJ7A 3ST7A 3S5AA 3GZAA 5FPBA 2HWB3 2D6NA 4EN0A 1AR62 1J58A 3ZKYA 3VBUA 3AL5A 4XF0A 3PMSA 3I3BA 1CJDA 1AYN1 1C1FA 1H2LA 3H1MA 5JPNB 4QPIA 4YGCA 5CG9A 1H1AA 5IFTA 1C28A 3KCCA 3LD8A 3JD72 4Q0QA 5F3IA 5BNNB 1OPOA 1WMEA 2R063 2ZBJA 3MIEA 1S1AA 1VE0A 2XG3A 1CPMA 4QHBA 3ZOIA 5L36A 1ND2C 3HBZA 4LBLA 4FAGA 1D4VB 3KLSA 3WEZA 3VD3A 3DXTA 2ZPXA 5FRAA 3CL1A 1UOGA 3KV6A 3OTFA 5C9AA 1QOOA 3I2GA 4MHUA 5FYHA 1VBB2 3HD8B 2YBPA 3VDDC 5IYYA 1VBE2 4IE5A 5JIAA 3LF7A 1CN1A 4O9GA 2VZOA 4BPZA 1AUYA 2PHFA 5HI0A 4JKLA 3ES4A 1WCUA 4YFWA 3UESA 4CDWA 5E8AA 4NHLA 3ZMNA 3O1RA 1QJX2 4CU8A 2DVDA 5FK7A 1POV3 4HKLA 1WMXA 2ZX4A 1W99A 4FFFA 1EP0A 4P5YA 3ZXGA 4AR2A 3I4IA 3WP5A 4AI3A 2ZAAA 3QLQA 4MH0E 3LPGA 2CWMA 4XJZA 5B4NA 1AL21 4CDQB 5JOZA 4MVTA 5FZMA 1ULFA 3RVHA 3T0AA 1ZBE3 4KU8A 3JZVA 3I59B 2RS11 3O0WA 4H7LA 4QGNA 4RFT0 1DGWA 2VJXA 3T2TA 4QM8A 3ZFFA 3VKMA 1ZRDA 2HWF3 2VVDA 3H1YA 3ZKUA 4D6SA 4AVCA 5ACA2 1O91A 5AVAA 1AR61 2V73A 1YFXA 2ZX3A 5FYZA 4JC1A 4RFRB 2WT0A 3ZXKA 3AYDA 3POEA 4COYA 5FO9B 4GH4C 5T5OA 3MV01 3IT8A 1REEA 1G9DA 1H2NA 2GMPA 3CU7A 1POV0 5LB6A 5F9TA 4GB33 2JKXA 2YG0A 5HCFA 1GOHA 5FYIA 1AF9A 3Q8AA 4CCJA 1W6OB 4ZPIA 1XE8A 2VZ1A 2O0OA 1GZCA 3WNNA 1JZ7A 1X82A 3AX4A 2WYFA 4ZHNA 4Y4YA 1RUG1 1BVVA 4FCAA 3MFCA 1LOFA 2PLV3 2Q4SA 3KM5A 5HV4A 3E6BA 5FYUA 2C5DA 4HVQA 1VBB1 5GLZA 3WVJA 4FQ4A 1SBFA 2PHTA 1CZTA 5FP9A 1VBE1 4AF9A 1VMFA 1CAWA 4KGGA 4CCLA 4DFSA 5L19A 1EPWA 5JIUA 3KS7A 3N7MA 3PUIA 3U10A 4F3JA 2W1WA 2PHDA 3LFIA 2R072 1YXWA 1H4GA 2VC9A 1W90A 2E31A 3OYWA 4FP2A 5LEJA 2QE3A 3NKGA 5FPZA 5IAVA 4BQ2A 1C3HA 1MEC3 5A1FA 1FNZA 3POIA 5AC93 2J1RA 1SBDA 4FBFA 4BQ1A 5A80A 5FUNA 2WFPA 2Q30A 3BTZA 1VP6A 4DXSA 1B35C 4OUSA 1ZX5A 5F7UA 1O3QA 4A45A 4CP1A 1RGSA 3POGA 1JUIA 2A7AA 5FY5A 2DU0A 2C26A 3N9NA 5ACA1 4AFAA 3CLPA 5FXXA 5F8PA 4COWA 3M1HA 1J84A 1JYWA 1C1LA 4UFHA 4IEYA 1COV3 1K5JA 3PVEA 5EYYA 1O59A 4DXTA 1KITA 2QQLA 1SDWA 4PI0A 3BYWA 5DXDA 5FPAA 5SV5A 3DYMA 4PF1A 3WCSA 3ZPOA 1GNYA 1IG3A 1REDA 4P9YA 1LRHA 3WF3A 4TLFA 5DPNA 2DBNA 4UBHA 1OC1A 1MQTC 1Q3EA 3M3QA 2DU1A 3PHMA 5A3NA 4KGQA 5CFCC 5JOWA 3U75A 4FXKB 1I5PA 1JOJA 4IGPA 2CDPA 3RMXA 4M0HA 2PELA 2DWRA 2VTXJ 2VVEA 4NWWA 3D6EA 1PNGA 1V00A 2JECA 4Q2FA 4Q26A 3VHOA 2JG9B 3K75B 4KG8A 1QY4A 3ZMOA 3MGUA 5JXIA 4XF3A 4Q8KA 1FNYA 2JWPA 5F5CA 3O14A 4LITA 3TEZA 2OVUA 2ZGKA 3N3HA 1LOEA 4QU1A 1PMJX 2P3JA 3AMPA 3FWEA 4N53A 5L73A 5LBBA 5A7WB 4HKWA 3VKFC 1FOD3 3CJXA 2NYYA 5LA1A 2OPKA 4UW4A 3MPBA 3RZGA 3N4MA 1UL9A 4NHKA 1WW5A 2NZ9A 3AVRA 4JGZB 1U5YA 1BBT3 2EXKA 2XQXA 3ZSEA 1BEV3 4B3NA 2D6MA 4FPYA 4CCDA 3WQ0A 1FATA 4WVVA 2UWCA 5E16A 3CJIA 2IXLA 3AP9A 5BNOB 1H0BA 3AJYA 4MXWA 4CDXC 2D98A 4AVSA 1XYOA 1PIV2 2RS53 3U07A 4E8CA 1CX1A 1VB2A 3JQXA 3H42B 2VQTA 2XJVA 3LCPA 4K3UA 3PVNA 1NCQA 4YW3A 1QDOA 4QX2A 1OVSA 1E5IA 2BERA 1H6XA 1RUF2 4QAWA 5F39A 2Y6HA 5JSRA 2Y38A 2CHHA 4CTEA 1FMD2 1HB1A 5FXVA 2P3KA 4I3GA 1PM4A 4B4PA 5CISA 3QOPA 1OOPC 5A6YA 1W05A 5HXVA 5T54A 3B93A 4IXLA 3LEMA 3ZN4A 1RUNA 4L11A 1F4HA 1S0BA 3PIJA 3ZXLA 2CL2A 4UFLA 5L9BA 2W52A 2HWC2 1XSRA 2QNKA 1J1TA 4I09A 2A6ZA 5TSWA 3OPTA 1SMVA 1W04A 1YLLA 3N35A 5KXCA 3WCRA 4CXXA 1ZA4A 4P00B 3AMMA 2B8MA 1YJLA 2H0VA 3IBMA 4DS0A 1UO9A 2WNVB 4YPJA 5IK8A 2W94A 4OUEA 3HIFA 4P9JA 3WOGA 1JYNA 4JDOA 1VMJA 1ZZ9A 1AXYA 2WAOA 1C8M1 4YZ3A 5JUVA 1HJGA 2ZGSA 2V4VA 4QPGA 4IL7A 1IS5A 1XNDA 4RA0A 4NIGA 4RHV3 4Y22A 3LOBA 4Q1PA 3J7HA 4Y24A 3W20A 4KBZA 4MG2A 4L9BA 4R9DA 5I0SA 1I9RA 2LROA 1CZVA 3OY8A 1PIV1 1AYM3 3VBUC 3WY6A 2VMFA 1H8TB 3I8TA 1ENSA 3GCXA 3LE0A 3BB6A 2W1SA 1RIRA 3RZJA 1UF2C 2AC1A 5A7QA 5KHKA 2VTFA 4M0NA 4E4ZA 2VU9A 2IXCA 1DU3D 3QH7A 4LHLA 5GZCA 4PF5A 3EQEA 2ILMA 3H8OA 4QU2A 4Z2AA 1UYZA 4I01A 4AWDA 2WJSA 5JPMB 2BW8A 3IPVB 3P1IA 1JZ5A 1VBC2 1WCSA 4NRQA 3SISA 1OT5A 5C9AC 1ZBA3 5DUXA 5FZEA 4Y5SA 4QXBA 3ZM8A 4X6RB 3FBMA 3N7JA 3TEXA 2HWC1 2VMHA 2VZTA 5J96B 1DYOA 1LHWA 5FPXA 3WINE 1FPN2 3R05A 3W58A 2DCJA 3O12A 4CDWC 3NNFA 4UFJA 3VZOA 2HWE2 3BODA 1JZ2A 1Q5OA 3GZEA 4ISQA 2ZGOA 3AZWA 2EICA 3NNMA 1ZZCA 4UW6A 3CKHA 4DRRA 1JZ3A 5IT6A 5J98B 1LHNA 2RS31 1MS0A 2BJSA 4Q1RA 2ZX2A 3OBZA 1QQP2 2XWJB 4J6GA 1US2A 4P9XA 1VRH3 5HBAA 3BIEA 2VXRA 1KD7A 5K9YA 1G9CA 3QACA 1WWYA 4AEMA 5DABA 4XFGA 4W8JA 2RDQA 3ZFFC 2LS6A 2PN5A 3KF3A 3TNPB 4QKNA 2RM21 4FPOB 2OA2A 2WFF3 3PUHA 1HV0A 1RINA 4QWNA 4K20A 4BQ3A 1JYIA 5KC5A 1OPMA 1ALYA 1SBEA 4GA9A 2DDUA 1EUTA 2E6VA 3KD4A 3PLQA 2C9AA 4HXCA 4WM7B 2W91A 2XVKA 2DYCA 3BPZA 1GZWA 3P5BA 3WW1A 4A44A 5I91A 3LEIA 4AI9A 4BIOA 2YBKA 2VNOA 3FLRA 4NRPA 2XWBB 4RN5A 4XYXA 1ZYBA 3ON7A 1NQDA 5JZGA 2WYSA 4DQAA 2X8KA 4BM8A 3MF9A 3JU9A 3PURA 2R043 5B4XA 2OKXA 2BTVC 4ES8A 3HBKA 4CEWB 3OUJA 2JE8A 2TNFA 2XKOA 3LA7A 4ZS3A 1DLCA 2YPJA 2ID4A 4GWMA 2Q8EA 1VB4A 2PYTA 1ZRFA 1VBC1 1PGL2 1LOFC 1OFSA 4P02B 1C8NA 2ZHMA 5FMBA 3VKLA 1NCRA 5FMOL 5A33A 1E57A 4NN0A 1DF0A 1QJY2 4MGSA 2A6VA 2ZS6B 4DINB 1FPN1 1ND3B 2OUHA 5F5IA 2UWAA 4BYYA 2TUNA 4U36A 4A42A 5BY5A 4G3YC 3ZXDA 1SFPA 4CCMA 1LCLA 2QQUA 1DP0A 2A3WA 2BQPA 3J26N 1OLQA 1EUUA 4Q0PA 3IAQA 1QQP1 3N9LA 3EXUA 1UY0A 3VBFB 3HNBM 5F6LB 1O4YA 3IIAA 2R0FA 2D3PA 4OFGA 4KWUA 2BNOA 4TXWA 3GNEA 1NA1B 2FDJA 1PHMA 2WNEA 4XABA 5ISLA 3H8XA 1NLSA 1TMF2 2G19A 4R4XA 4E4SA 1KXGA 4QXHA 3RWNA 3VN4A 1GWMA 2RHPA 5FXWA 1F5JA 4ONUA 4PDWB 1DQ1A 4PIYA 4RR3A 4Z1VA 3OBRA 4NE9A 4K7JA 5FP3A 3O1VA 2VOTA 2Y6JA 3V0BB 2WLQA 5F3GA 1DQ4A 3KQRA 3PTYA 4GKXA 3AYCA 4M01A 2A73B 1QOTA 2QQMA 3ES1A 4XOGA 4EN9B 2DVFA 3ZSKA 1V6NA 4WM8C 1PGL1 4J1XA 1PO13 3VBHB 2VCCA 4JAAA 4UXAA 2XJPA 2Y0IA 3OB8A 5G05L 5FJKA 5LA2A 4FSJA 1HRV2 1OH4A 3WP6A 2YYOA 3USUA 4MGTA 2GC3A 5L7OB 3THTA 3DEMA 4N53C 3NQHA 4AFCA 2AACA 2R7EB 4G4FA 4IV3B 1YFWA 3T0DA 1RJ8A 4NIDA 1MZ5A 4PI2A 4BDVB 5DQ0A 1V6JA 4UF0A 1HV1A 4XJ8A 4E2SA 3HAGA 4QKDA 1GP6A 5C8CB 4DPNA 5CFCB 2BZDA 1KDKA 2VBPA 2PQSA 4QXKA 1YUDA 1YWKA 3IKWA 4IEOA 2ZKLA 3MIBA 1JI6A 4C0HA 3FFQA 4Y3OA 3GBWA 3CJIC 3RYPA 2RV9A 5H9QA 4S2FA 4EN7B 1JYVA 4UFMA 1IOAA 1TMF1 2AEZA 1LGBA 4NAMA 1OD3A 2BRTA 1BLZA 2ENRA 5IVJA 1R082 4CPBA 2B45X 4QX5A 4BK4A 1OH3A 1NCQC 2FCVA 3DPRA 5IWFA 3U4XA 3KWVA 2BDRA 2LRPA 1F2NA 3U0ZA 1B09A 1MS1A 1TME1 2RDSA 2YC4A 4LQRA 2V5YA 1MS8A 4CDUA 3W5NA 3WX5A 1DZTA 3H9AA 5FQ0B 1WD3A 3UGGA 2D97A 2QQIA 3UT0A 3WF1A 5AFEA 1D7PM 1RUC3 4NHYA 1F5FA 3Q9OA 5IVVA 1OKQA 3UL2A 1WCDJ 4COUA 4CEYB 1OLME 4GALA 1N1SA 2VOWA 1RXFA 2ZGUA 5DZEA 4CDXB 1NX9A 1OSGA 5F3CA 1DBNA 1HRV1 3LIGA 5A6XA 3I3DA 4AEJA 1S55A 3DGTA 1RUJ3 5FZLA 4EWAA 3OG2A 2VVFA 1UZZA 1W8HA 1K5MA 5FO7B 3M2MA 3LGRA 4JGYB 4LLOA 5EFUA 1V9U2 5A6ZA 3MBWA 4RYDA 1Q8SA 1Z0HA 2QUOA 3PUAA 4FFIA 4H55A 1WD4A 2VW2A 1BK0A 3NNGA 4INDA 2QCSB 4HPKB 4XTMA 3BI3A 1AJOA 2A1XA 4HN1A 4Z8BA 1JXNA 4E9KA 4QPGC 3O1UA 4ASMB 5A3UA 1S2BA 3FHQA 4BLJA 5A1AA 4TN7A 4JTOA 4HETA 1YI7A 5GM0A 2G9GA 5A3OA 2JB4A 4ISRA 3UJOA 2N7GA 2MEV2 3MIDA 5DAWA 4IEZA 1D4M1 3THCA 5LWBA 1N3OA 3IMMA 4OHXA 4QD2A 4D6RA 1R081 2GN7A 2VMEA 3D0SA 4N9HA 1XSQA 2V4AA 5J36A 4JRLA 1JZ6A 1YC61 2WT2A 4GWNA 2JDNA 3X29B 4Q4V3 4YG6A 3WG4A 2RR12 1IS4A 2JD9A 3C3VA 3FN9A 1R092 4YW7A 4RQPB 2WINB 3JBG2 1W6PB 1W6MA 1UKRA 1BK1A 1IQDC 2CY6A 2DF7A 1DYPA 2WL1A 2QTWB 4BIFA 3A7QA 3BOWA 2PFWA 5LK5A 4NIAA 1TZOA 5KHIA 5L9VA 2YMZA 4LBQD 4FPJA 3B9IA 1CIYA 1N1VA 3B3QE 4FFGA 4KI5M 1PVC2 3V56A 4IEVA 4M00A 1DQ5A 2D43A 1RUE3 2HWD3 1LU2A 1W6NA 3GDBA 4DIQA 2FZ2A 5FZ7A 1FI2A 4J1WA 5T50A 1VBD3 2L9LA 4XMIA 5F2WA 2UU8A 3BALA 4LEJA 3ZFGA 2Q1FA 3ZYPA 5LBFA 4CXWA 2W92A 3NVCA 2XBO3 4Y1ZA 1WZXA 5IK5A 4M4RA 1PO23 1F35A 4OLLA 2JDYA 5T52A 2Q8OA 1D2QA 1JU4A 2Q8CA 3H3LA 4RS5A 2AH2A 1L7LA 3V0AA 1PZ9A 1SLBA 2JDUA 1BHGA 4XZUG 5F3EA 5I8SA 5KXBA 1ASJ3 1OBNA 1YI9A 3M3OA 4N7UA 4YVSA 4YFZA 4X6QB 4D6QA 1WMDA 2G9ZA 1RHI2 3WDYA 3E5XA 5D8AA 1WCKA 2P1BA 3LDKA 1GZ9A 3IDAA 5FCCA 4NPRA 4KWJA 3NMBA 4QHZA 1QMJA 1GP4A 2ORXA 1SFYA 2W9XA 3UNPA 1CGPA 4DUVA 1LGCA 1URXA 1AX1A 2UY8A 5A1LA 3QD6A 1FXZA 4P14A 4AI8A 3VL8A 1O5UA 5DZFA 2Y26A 2RR11 3GBFA 5I8TA 5JZGC 1W6QB 1R091 1CAVB 5FZDA 4B4RA 1UPIA 3JBG1 4URAA 2ZEXA 3T2QA 1A8DA 5T5LA 4DMIA 1UMZA 1E5HA 1VIWB 3AP7A 1RUD2 1GSLA 3ZDVA 1QGLA 3ZR5A 2Z2SB 4LUMA 4Q4Y2 1AR81 4S2GA 4CCCA 5CKQA 4UW5A 4P5HA 2ZGPA 3POJA 3ENRA 4QQOA 1PVC1 1NCRC 5EHDA 5FZ6A 5CIRA 5C5UA 3POSA 1SCRA 1ENQA 1HJFA 3WG2A 3EMRA 4BQYA 4C1WA 2Q5TA 4LHNA 2VW1A 3H0OA 1M06G 3B01A 1UZVA 4ZONA 2NLRA 2BUKA 4HANA 3KVBA 2AGSA 3A21A 1W8NA 4GMP1 4HSLA 4ASLA 1GNZA 4IETA 1Y9GA 2WNUB 3MLJA 1WMFA 4CXYA 3HWJA 2ADDA 3PUSA 5A7OA 5FUIA 3POWA 5FP7A 2XR4A 2VM9A 4WVZA 4XF4A 1W3VA 3WDWA 3WUCA 3RSJA 5CA6A 2XPJA 4A7YA 3HPNA 5FP4A 3SH5A 2IWGB 3K46A 1RHI1 4LMFA 1BCXA 2O14A 3D8CA 2VG9A 5BNPA 4HL0A 1HRI2 5DMYA 1K3IA 2W95A 1NT0A 1O8PA 2OS2A 4QB2A 5CU1A 4XHXA 4IV1B 3WQ7A 3MO4A 1YFUA 5DUVA 4QQ2A 3W5MA 3WQBA 4LBQB 4SLIA 5FBJA 2BWCA 2W87A 3NAPB 2YC0A 4RR3C 1JHJA 3P6BA 2WZEA 3WD5A 2IXJA 2WZR2 5F32A 5BPXA 3TN91 3IIIA 5C7GA 2VPVA 1WLCA 2XUEA 4Y5TA 1RMU2 2J1VA 4XF1A 5ABJA 4FPKA 1K42A 1KEXA 2HWB2 4QT6A 1MS4A 1NQJA 3FUQA 5GALA 1RUD1 2BBVA 1HXS2 4Q4Y1 3ILNA 2FDHA 2WNOA 1RUG3 4GXLA 3BGAA 4XJAA 2EXHA 1PX4A 4BOWA 5FZIA 1YQ5A 3ZN5A 2CGPA 1KQRA 3GJBA 1VBB3 2GALA 4NWVA 3ZLIA 1MS9A 3C7HA 3WV6A 3WNKA 4OVEA 1A3KA 4AFDA 3CDZB 4OI1A 2TEPA 3CHXA 1L7QA 3WSOA 4AEDB 1CX4A 3FZ3A 4FPFA 1Y3TA 1YQCA 3OGJA 5FY0A 4C0BA 5FZ0A 3AP6A 3OPWA 4CP2A 4EWDA 1ZRIA 1ENRA 3RI9A 1YIPA 2JDPA 2WSVA 2P3IA 4W6XA 4AI2A 3SCFA 1ODNA 4JX0A 3ALQA 3MIGA 2RDNA 2W2IA 3MDPA 5C4WA 4LKDA 2DUOA 3URFA 4MGKE 4XJWA 2ZKNA 3NW4A 1MACA 3RFRA 1CAUA 1HRI1 1VAKA 2AZ5A 2VOKA 2W3JA 2XLAA 3L2HA 3RYRA 5A32A 3MHZA 5ACA3 4NPMA 4BMEA 5CADA 1GBGA 2VCBA 4QQPA 2CYFA 2LW8A 2EA7A 2W39A 3DPRC 4XZPA 1ZBE2 1X7NA 3JD71 1XYNA 5F6KA 3BTAA 3LEGA 2WZR1 3QBQA 3F95A 5FYYA 3BCWA 3D3AA 2VQ0A 4XETA 2YFUA 4OHVA 2VMIA 4CDUC 3ACIA 3UKNA 1RMU1 2XGXA 1S2KA 2HWF2 1S0FA 1U0AA 4YVWA 2LALA 5T5PA 2CSGA 4TTGA 1V6KA 2J1TA 1LEDA 2V5DA 3HT2A 1HXS1 3GJAA 4Y20A 2YXSA 3DUIA 2NMOA 4TSVA 4N8MA 2XJQA 3POFA 1UU6A 3VD7A 3ZFEB 2LTNA 2DV9A 2QJVA 3AYEA 4S2DA 2SBAA 1N47A 4LBJA 2Y0OA 4ARXA 5I93A 1CAXA 3H7YA 1UXXX 3KT4A 4GQ7A 2NM1A 1K5MC 1QJX1 5JR7B 4DXZA 3O7OA 4NAOA 2K2SA 2EALA 1W28A 2IZWA 1QIQA 2AUYA 2EIGA 2QQPA 2JG8B 1XQNA 4COZA 1GZTA 2WA4A 3DYOA 2Z5WA 3B69A 1LESA 4Z07A 3A23A 5EYXA 1V6IA 3SNMA 3VGIA 1KDMA 4JKMA 1WKYA 2QQOA 2J1SA 1RYYA 2BEOA 4WM8A 3RZMA 1UU5A 3NO8A 3KV4A 1GANA 3O1TA 1PK6B 4H2AA 3WDUA 3PJQA 4YGEA 5LATA 3AXEA 1O3TA 1W9YA 4LBMA 1IGOA 4JZRA 3NAPA 3S5QA 5EJ1B 3AKTA 2IVJA 5AC92 4FOWA 5BNNA 3P3NA 1L7RA 2CGOA 2W1QA 3NJVA 1ZBE1 2PHUA 3ZIXA 1W8ZA 3LB9A 2JDAA 2HYKA 4DY3A 3VUOA 1PGW2 2DCZA 3ETQA 3SLIA 2D3RA 4L2NA 3HR9A 2E7QA 2HWF1 2O8OA 1PZ8A 3I7DA 1QXRA 3LSDA 2EVXA 1OQEA 1GR3A 3PDQA 1RUH2 4W65A 3ACLA 2YU2A 4LULA 5K0UB 2YGLA 4Y1XA 1EAH2 3NJXA 5FLJA 3H50A 4ORFA 2YHJA 2XQRA 2NN8A 2WN3A 4A2UA 3VBOB 1GWLA 1SPPB 2E33A 4N43B 3DCQA 5EJ3A 2R071 5FMDA 1GP5A 1KS5A 4BXSV 2QQVA 1DGLA 1S0EA 4CDQA 5FO8B 5D2AA 2VW0A 3I59A 2PAKA 1KJRA 3HNMA 4RS5C 4YW1A 1SQ4A 2AENA 2QVSB 1FAYA 3H3UA 3RNSA 4EQVA 4FPCA 3UK9A 2GN3A 2WN2A 4YWAA 4YVSC 1C8M3 3OBTA 2WR9A 5F37A 4LO6B 2WT1A 3IB3A 4XUOA 4YM0A 1FOD2 5D8AC 5GLWA 1UWWA 2FMYA 2H6BA 4LKSA 2X5IB 4NIHA 1AR92 1LHUA 4EYUA 2BOIA 4LK6A 4RL7A 1DYKA 4YGBA 3ZSMA 3ZXFA 3C7EA 4LOSA 1JU3A 5FYBA 5D21A 1BBT2 5A7SA 4F7ZA 5IAXA 1BEV2 3EBRA 3MUZ1 1W6OA 1YYNA 4P9IA 5C3RA 3AKRA 1SLAA 1PGW1 5G04L 1S0CA 4W6WA 2OPWA 3SKVA 1OF4A 1TNRA 2TBVA 5EZWA 1H30A 1XBFA 4ZU7A 5IVFA 2JDKA 3AFKA 1C4RA 4DRVA 4V2WA 1RUH1 1H8VA 3K2OA 4OUMA 4LT5A 2RMU2 2ARBA 2D6KA 2W08A 3IN9A 4PQQA 5BNQA 1EAH1 4BHPA 3W21A 4Z2WA 1G6NA 3K4AA 2W68A 3AYAA 1CD3G 1QWRA 3EYPA 1MVQA 2CGNA 3GBGA 4YW2A 3APBA 4FVVA 4P9LA 4UOJA 1UOFA 2ZHLA 3KT7A 4KQ7A 5FYTA 2VBDA 2KM2A 4FOVA 5A3LA 4LBOA 4YM2A 5KWRA 5A7NA 5BXXA 4A6SA 3T2OA 4W6YA 1R64A 3VBRB 4D0QA 1JOBA 3FJSA 1ULCA 2ADEA 1U12A 2DTWA 3ETPA 4H14A 2Z42A 4YG3A 3VBSB 1JMUB 3JCIA 4ITCA 4XFAA 2RS33 1I6XA 4MGIE 1O3RA 2JEMA 4KWKA 4P9WA 4XIKA 5BV6A 1LU1A 1NUKA 4AI1A 4CPBD 3B9CA 3INAA 1ULGA 2ARCA 2FD8A 4ASKA 3HOBA 1GYKA 1X8EA 1ULEA 2QKDA 3KGZA 3ECQA 4O61A 3WDVA 5FZOB 5BNPC 3FLPA 4LK7A 1ZRCA 1CESA 2OQ7A 2JKBA 2RM23 1AR91 4Q29A 1V0AA 3LPFA 1QH6A 4KU7A 5EJZB 5IVCA 4NVPA 1ST8A 3WG3A 2R16A 4N90A 3TBDA 4AAPA 5A3TA 3I3QA 4QPIC 4BJ0A 5JSPA 4R9BA 2UWBA 2VUDA 4HG6B 4XFBA 5FY8A 1BEV1 1PVXA 2ZMKA 1RUF1 1A78A 2XJTA 5IHRA 4ZKTB 2GH8A 5DAXA 3KSCA 2ZEZA 1FMD1 1TVGA 5ABJC 2ZGNA 3IDBB 5CG8A 4Q0VA 5CFDB 2JG9A 2VMCA 3ZN6B 3KHBA 4YZ5A 2RMU1 1SFNA 4FO9A 1LKNA 2OZ6A 3MV11 1W39A 3KZ4C 3WDTA 1GMMA 5C70A 1PNFA 1VBC3 2VUAA 1N1YA 1BJQA 1IKQA 4BB3A 5FZKA 5A7WA 4V1PA 2WBKA 4CYDA 1QJZA 2Y6KA 3OGVA 3WW2A 1RITA 3NV4A 1W8TA 3MIHA 4IGQA 4XFCA 3I3EA 3WG1A 4CP9B 2CTVA 3UYJA 1G7YA 1X33A 5FK8A 4JGZA 4W50A 4AE2A 2H6CA 2B9UA 1UN1A 2VZVA 2BYVE 3U11A 4XFIA 1VPHA 2NMNA 4XE9A 4ES9A 4PT6A 2A75A 3MIFA 2HYXA 3LEKA 2EIBA 1ND2B 1S0IA 3RI8A 1XOYA 5C6CA 4EZHA 3VV1A 1DQ0A 2HEWF 4XUQA 4Z82A 5BNOA 2MPFA 1Q56A 3DV8A 2Y34A 3J8F3 5C3SA 5C4WC 3K48A 4I0WB 3T4VA 4H7MA 3VDDB 4JV4A 2IVIB 4COVA 1W0NA 4IDZA 3FUOA 4LPLA 4QGLA 1YJKA 4JKKA 2BWAA 2JICA 2O1QA 1H4HA 2ZMNA 1YRZA 3MLKA 4XCBA 4AQ2A 3D0JA 2XJUA 4HLTA 1GNHA 2WZPP 2GC1A 1W2TA 2PHXA 3QH6A 4RSUA 4QDSA 3H7JA 2JE7A 1QOSA 3UKTA 1XU1A 4ATFA 4CU6A 4DY5A 1AXKA 3R6SA 4MX3A 5H9PA 4MZUA 3RQ0A 2B5HA 3NV3A 3OOXA 4M3CF 4YVWC 4IEPA 1V6LA 4FXGB 2W46A 1TE1B 3POBA 2QQNA 2IFRA 1DGWX 4NUBA 1EV12 1T6BX 2A5ZA 1HB3A 1N1TA 3IZOA 1MS5A 2DCKA 4KMQA 3WNOA 2YBSA 1DQ2A 4GH4B 1PX3A 4XFFA 5IK7A 5JR2A 3TEWA 2GNDA 2UYAA 4UBGA 3GGLA 4YYOA 2WS93 2I2SA 2XVLA 1WA6X 3BOPA 2R042 2JIGA 1QJFA 1DZRA 1UZYA 2HWE1 4WVMB 1UMHA 2C4XA 2WNVA 5KHGA 1CWPA 4JDMA 5FOBB 4CE8A 5FAXA 2ZCWA 4QMAA 2ARXA 3MEPA 3MW4A 4MLOA 1X36A 3C8XA 2BFUL 2ZACA 4JVAA 3ZXJA 5LCWL 2YC2A 1QJEA 1OA3A 2VMGA 4FPEA 4IW3A 4L0PA 5CBLA 4JHZA 4QX8A 4DEQA 2Y6GA 5FZOA 2Z79A 4DXRA 4XEZA 3L9JT 1H8TA 1JW6A 1ZVFA 2ZOEB 4UI9L 3ZX7A 3I49A 5DUWA 2XLFA 1SLIA 1TMF3 1Q8PA 4PLMA 2CU5A 2XLGA 3HVDA 4MOAA 4XUTA 5BNNC 3RZHA 3E5QA 1ZM1A 5IK4A 3AK0A 4AVAA 1MZ6A 5FMCA 3VZKA 3ZSLA 5GZFA 3KCYA 1PZ7A 1TME3 2R6QA 3IPVA 3WP4A 3GF6A 3AXDA 3DKWA 2R1BA 3K3NA 2I45A 1B35B 5AFBA 4EV0A 3FLTA 4WZFA 1BQPA 5LZ6A 5E1RA 4D3WA 1EV11 2QFEA 4LTAA 2XHNA 3TWIA 3ZXAC 4LR4A 1POQA 5A3PA 1QJY1 1MVEA 4Q0UA 4QXCA 3ZYFA 4FOQA 4PIZA 5IVEA 1HRV3 3GALA 3RZKA 2BU9A 3JB8A 3AFGA 4FP3A 3S57A 5HCHA 1XNKA 2R041 1LNSA 4JQRA 4FOYA 3BPSA 4QPYA 1JOPA 4OMCA 4CDQC 3V65A 4UT5A 2ERFA 2K46A 1PO12 3M8LA 3VZJA 1MQTB 1AR72 2HBTA 3H8UA 1XE7A 1DIWA 3IMNA 1C57A 1Q43A 1QKQA 3N9OA 4AZZA 4BU2A 5FZ9A 3ME2A 5FYVA 2J1UA 5FZ3A 4JTNA 2WLPA 5C3OA 1TG7A 3OD4A 3OGGA 1CIWA 4R8HA 3ZPYA 4M3CB 4ZU4A 4PBPA 1IPKA 4WM7A 1ONAA 2FZ1A 4QQLA 3BKZA 3FFZA 2HJIA 3SC7X 1BYHA 2YV8A 4PJYA 1OD5A 1D4M3 2FMDA 2A71A 2RJLA 3SQOA 2VXJA 2VECA 4IUGA 2VCMA 2UY9A 4HVRA 4L92A 4AI0A 4ZY9A 4BA6A 1UZWA 1E5SA 2VUCA 4JQTA 2VO5A 4CEWA 3KV5A 2ZGQA 4IE4A 3C2UA 3N7KA 1U5ZA 1UOJA 3A0NA 1QNYA 3AZYA 1NZIA 4R9AA 2FBEA 4B7EA 4Y5Z0 5JXHA 2B9VA 1WW7A 4GD4A 3ITQA 5T5JA 3TYJA 2ZGLA 3WXPA 2P4EA 3WHUA 1Z7S3 2BP6A 1S0DA 4L97A 3OUHA 1DDLA 5EIYB 1ND3A 5FMOS 2DCYA 2VULA 2NPIA 3MW2A 4N9IA 2CAUA 2VR4A 1W2OA 5J37A 1UW8A 4XDQA 2J7MA 3MFAA 1ZRRA 4XILA 1DFQA 1W9TA 2A6YA 3NL1A 4FPGA 1H2MA 4A4AA 4XCAA 3VBFA 4K40A 1PO11 2P2KA 1AR71 2PMWB 1RUI2 2BFUS 2YUEA 1F15A 1LOBA 3K3OA 4AGVA 1OOPB 4GJYA 4FTEA 4GKYA 1NA1A 4AOCA 1P8JA 2GZWA 5JCTA 3THPA 1H1IA 3J7NA 2FDFA 4FT8A 4K1YA 1XNCA 3GZTB 1NKGA 4Q4X2 2IXIA 2Y33A 2VZUA 4ET7A 3LA3A 4QDQA 4OULA 2EIDA 4PDWA 3JB4C 4CUCA 1VRBA 3PUQA 5JI7A 4CCEA 1VBA2 3WQ1A 3ABZA 2ZEWA 3I2IA 4GIQA 3G7DA 2DCTA 2B42B 1HKDA 2QDRA 3O5SA 1HW5A 4GJZA 3VHPA 3BVCA 1H2KA 3M3EA 3V0BA 1RVF2 5J1XA 4I02A 2X10A 2ZMLA 3POYA 3AKSA 3VDAA 2RVAA 2Q1MA 4Y33A 1LOAA 3ELNA 5HCAA 5IVYA 5E89A 3VBHA 1JBCA 5FUPA 2JG9C 5FTTC 1MZEA 3I2OA 4NHXA 4CCKA 4HT1T 4EN8B 4CSWA 3OEAA 5ANNA 2LM3A 3PL0A 1RL3A 1XRUA 4AHWA 4ZXKA 1AR83 3TNQA 5L7OA 1JH5A 3EO6A 3VBUB 5CKNA 1ZZ8A 2Z4FA 4E2QA 1PVC3 4IV3A 1VALA 4QPIB 2YZ4A 2WKKA 3Q8BA 5DDJ3 4OQ9A 1GOGA 1QJU2 5JWPA 2ZEYA 2XKPA 1ZREA 2X53S 1S4CA 3AMNA 3ILRA 4QHOA 3ZO0B 3KQ4B 1J59A 1V9U1 4JGZC 5C8CA 1Q8OA 2E53A 5CFCA 4GMP3 5IVBA 4FTSA 2VNVA 5F5QA 2F4LA 4K8RB 4Q4W3 1RUI1 1UMIA 1NY72 1W8UA 4FPLA 5EP9A 3O0XA 2D6OX 2HWD2 4TYSA 1RUE2 2GDFA 5BNOC 4HK8A 4QKBA 1OMIA 3USSA 4D7YA 1VBD2 4D94A 1KJLA 3G6JB 5C9AB 5KR7A 4IQPA 1CZSA 1JZ4A 3C7OA 4XC9A 2ZABA 4Q4X1 4XF9A 3PU3A 3A4UA 1LEMA 2WRAA 2HBUA 2MEV1 3M7AA 4RD7A 1HB4A 4HVOA 4XURA 2ET1A 3O1PA 1C5HA 4CDWB 4XQ4A 1VBA1 1DQ6A 4AVTA 3EB7A 4DZGA 4BQ4A 3LOIA 1AYN3 4XTPA 5EV7A 3U14A 2RG4A 1JHNA 5KHJA 4GMP0 2ZXQA 4NROA 3SCHA 4NHMA 3ZYIB 5FQ0A 1RVF1 1NE4A 3MPPG 4XXPA 1OLMA 1GKBA 3TN93 3WF0A 3HT1A 3WNXA 4AG4A 4AYUA 2F4PA 1OUXA 3DXUA 2WO2A 4QQHA 4CEYA 4Z92B 3SCGA 4QX1A 3ZFFB 2E51A 4CDXA 3MZHA 2VZRA 2ET7A 4YZ4A 3PIGA 4NJ4A 1RUD3 2GNTA 1YFYA 4QPWA 4Y1VA 3AB0A 2QDNA 4HKOA 4JGYA 1QXJA 1C5IA 1PGSA 1XNTA 4ATEA 1QJU1 2WO7A 1R1A2 2V72A 2WNVC 3UGFA 1DCSA 2OUJA 1F8VA 3I2HA 4HPKA 1HB2A 2D6PA 2DURA 4UFKA 2GC0A 1UIJA 4URTA 4CCNA 4LLFA 3A22A 1NY71 3RYKA 3VZNA 1AL23 3EJKA 1QH7A 1YQ8A 1RUE1 3LFMA 1KRIA 1CONA 2AR6A 2RS13 3HJRA 3AZZA 1VBD1 2MHFA 4HBNA 3R4SA 3LDBA 5DAVA 5GLUA 5C71A 1CAWB 1UQXA 1H8TC 1WBLA 1YO8A 3LAGA 5DG2A 5LBEA 4CCOA 5GLTA 4GAZA 3D4KA 4OI4A
chains in the Genus database with same CATH topology
1AR63 1CQ9A 4B7KA 1KFXL 5GZEA 4XBNA 1DGRN 3BIWE 3OYWB 1SACA 4RQPA 3JD73 1EPZA 4I2OA 1W6PA 4OZXA 2WZR3 1NG0A 5T55A 3J4UH 3UJQA 2XL9A 2JDZA 1RMU3 1VJ2A 2A70A 2HEVF 3NSTA 2R1DA 3E5UA 4K9SA 1X8MA 1LB2A 1W2UA 1HXS3 3R4UA 1Q8QA 1JTZX 5FFOC 3WW4A 5KC6A 2PHLA 2CV6A 2R062 1OQDA 2C0ZA 1VBE3 1N3PA 3NV1A 4H3WA 4HZFA 5JI9A 4EJRA 3WLUA 2UYBA 1R1A1 4L8QA 1WLWA 2NP0A 1WLTA 3TAYA 1QJX3 3AP4A 2GNMA 2D93A 4Y1UA 2WQ4A 1RUG2 1AVBA 1NZCA 1VAMA 2DVAA 1QHDA 4WM8B 3I2DA 1ZNPA 3UV9A 3ZYRA 4R4ZA 1F31A 3VHRA 4XIOA 2EAKA 4BCUA 4WM7C 1EYBA 2X29A 4LA3A 4QM9A 2P37A 4N53B 2EXIA 1X50A 2D3SA 1QF3A 1W6QA 3WW3A 3TRSB 1CAVA 1TEIA 3LKJA 5CG8A 2XJSA 5DUUA 1O4TA 1LHOA 3AP5A 4AW7A 1WGPA 5J7MA 3RJRA 4CEWC 1LENA 1WW4A 2BVVA 2NQYA 3B7MA 1LODA 1O3SA 4KNCA 2HWB1 4YG0A 4B4QA 2VNRA 3CJIB 4A7ZA 1CR7A 2DFCA 3SH3A 4MGYE 2O8QA 4MXWB 1G9FA 3KB5A 1Y7BA 1ND3C 4BE3A 2ZZJA 2R061 3BU7A 4GB32 4BZ4A 1OLRA 2E7TA 2JE9A 1NCQB 5A3MA 5AVPA 2DVBA 2WNUA 5IUQA 4NOTA 4AHXA 3GHMA 2R073 4O9EA 1I5ZA 1OQ1A 3VBFC 4U2AA 2PLV2 2VUJA 2AREA 4XBQA 1A8MA 1NYWA 3S7EA 2FQPA 1NA1C 4K21A 1XU2A 4AK3A 5GLVA 4AQ6A 3I54A 2ZX1A 4IV1A 2DFBA 1POV1 1TNFA 1PMIA 2JENA 4LBQA 3H3ZA 1IPJA 3H1WA 1ZZBA 4XBLA 4PDWC 4DNYA 1MEC2 1Y9QA 3PNAA 4FAHA 4EROA 3JQWA 2XUMA 1WW6A 1BVP1 4JRAA 1YIFA 4BWOA 4QPGB 2VY0A 3VBHC 3V64A 3TB0A 1RC6A 4Y22B 1COV2 1RUH3 3ZDSA 1KS4A 4MGZE 2R0HA 4B29A 3AZXA 4Q0SA 4D7TA 1VR3A 3OY8B 1EAH3 1YCIA 2D6LX 5L7OC 2B46X 2D5FA 1LR5A 4GB31 2R49A 4IV3C 2PAEA 3ZFGC 5K8SA 4MXVA 4AEDA 1AZDA 1T6GC 2VH9A 5C8CC 5JOYA 1OA2A 4CZSA 3DL3A 2DTYA 2PLV1 3LZZA 5CAZA 3KMHA 3DN7A 2CAVA 1H9WA 1OA4A 1XYPA 4OI0A 3CEWA 1IZ3A 2UURA 4E4DX 1D0GA 4XPVA 1AJKA 5BUVA 4NR1A 4OHWA 2V09A 3HMYA 4GULA 4JCKA 5LRSA 5JLVA 1NXD1 3VHNA 2DUQA 1GQHA 4P9GA 1N3QA 5BYNA 1AR93 1LTEA 1MEC1 1PIV3 5AC91 4YNIA 4E2GA 4YM3A 1AXZA 2E9QA 4HN0A 1UKGA 3S6PA 2B7YA 1C8M2 3E6DA 5H9SA 4AEKA 1RUF3 4LO5B 1QXPA 5FLIA 3LSEA 2ATFA 4D69A 3ASIA 1FMD3 1Y43B 4AQSA 4CEYC 2RS52 1COV1 3ZFEA 1G9BA 4L99A 2RMU3 1Z78A 2BVBA 1A6CA 2KA3A 1BKZA 1UU4A 5F1RA 1L3JA 1ULDA 2AYHA 3EHKA 4C1XA 2PQQA 2HWC3 4JGYC 2PA7A 1GZWB 4I30A 2JG8A 1OHFA 5KXDA 3RZZA 1I3HA 5JZGB 1V70A 1SCSA 2PHRA 2EXJA 5T3NA 4R52A 3NJZA 4YGDA 4IEXA 2EF6A 1H1MA 1FV2A 1PK6A 3IWZA 5DG1A 4META 1LOCA 1NOVA 1OI6A 2G4IA 4N7IA 4XQWA 1NCRB 1QU0A 1FOD1 4YZ1A 2QZ2A 2PAMA 5A33B 3PVBB 1WA4A 3ZSJA 3P3PA 3PJYA 4ZU5A 2MNGA 2D5HA 2RS32 3MF6A 2P17A 1BBT1 1O5LA 1FX5A 4LO7A 1J1LA 4RQPC 4AFMA 3AKPA 2ZGMA 1WLDA 4RHV2 4HFSA 1DHKB 3B5LB 1VLNA 3AMQA 3KGLA 2ZA9A 3CF6E 5K0UA 1S0GA 4WBBA 1WBFA 2RM22 5FDBA 1AYM2 2RS51 2K9ZA 2ZGRA 3VKNA 3AJZA 2OW4A 5FOJB 2VNGA 4K1ZA 3VBOA 2WIIB 5JMCA 1JUHA 3FE5A 2A3XA 4LO4B 1J3PA 4N43A 2ZAHA 2ZZQA 3SITA 3MW3A 4YZ2A 2SLIA 1BMV2 5LK7B 1FT9A 1FPN3 4RR3B 1RUOA 5C8WA 2HWE3 1SEFA 2KXLA 5FREA 4HSJA 1CPNA 1G9AA 1M4WA 1ZBA2 4LE3A 3W59A 4AGRA 1QQP3 1O4ZA 5EXOA 1SLCA 2X5IA 2GC2A 4BH9A 3USUB 1O7FA 3M70A 4KG0A 1MS3A 4XFHA 2ZTNA 1D2SA 4CRQA 2HEYF 2I74A 1VRH2 3R0RA 1SLTA 2BNNA 2G9FA 3GHNA 1MR5A 5LRRA 1REFA 3J8F2 4RHV1 4LBKA 3B02A 1NXMA 2WFF2 1DGRA 5J09A 4OHZA 5GZGA 1AYM1 4OI2A 3LWCA 2WA3A 4DB5A 4BMBA 3WDXA 5GKAC 2GU9A 4Q27A 1EV13 3WZ1A 2E63A 5I8YA 2JD4A 1IS3A 1J3RA 3IDEA 3VBRA 1QJY3 3ROUA 1BMV1 3DPRB 2WNUC 2BNMA 3VBSA 3DF0A 4KH9A 2XB6C 4CDUB 1CJPA 1IKPA 4YLZA 3OF1A 4FQZA 1ZBA1 1NLRA 2Z69A 4BLIA 2WQZC 3A0KA 4FPHA 4LO8A 1DZQA 2P34A 4OHYA 2ZJCA 5EWSA 2IC1A 2XJRA 4YRDA 2WS92 4K8FA 1GFF2 2RE9A 3NKTA 1AHSA 4IV1C 3OD0A 4YSFA 5DZGA 4A7KA 3NAPC 1PM7A 2GSYA 1K5MB 1WUVA 4LA2A 5GZDA 1VRH1 1UPSA 3NV2A 2XVGA 1HQLA 3B00A 5KBFA 2ES3A 3J8F1 2JJ6A 2JX9A 5CFDA 2HKXA 2WFF1 3ZN6A 5C33A 5D1IA 4YARA 2K0GA 3SH4A 1IS6A 4PQ9A 4A3XA 4XHBA 2GNBA 3NWKA 1J3QA 1RTVA 1XNBA 3PVOA 4KL1A 1JYCA 3S30A 3VKOA 3MI8A 4QGMA 4PCRA 4WVWA 1UIKA 2E7AA 2WSUA 3ILFA 1JN2P 1TME2 5CVRA 4AGGA 3CNAA 3K51A 4AEDC 3LA2A 1V6MA 3ZXEA 4AQTA 1LHVA 4EN6B 1ND2A 1TQ5A 1AL0G 2GH2A 2YDEA 4F8AA 3SMHA 1RJ7A 1XXNA 1W6MB 3WHTA 3FHIB 3ZYGA 2GAUA 1AR73 1BXHA 3VDDA 1NE6A 2VOXA 2IXKA 2WS91 3QCWA 1KFUL 1OFNA 1W6NB 2PHWA 3B94A 2EAAA 4HK9A 4JDNA 3ZFGB 4M3CE 2XL7A 1HQWA 3OJBA 2YROA 5KHHA 1R083 2YY1A 5JVVA 1SLLA 4HMZA 4IESA 1LECA 4K6BA 4RS5B 3IM0A 5JDBA 2FHRA 4LBNA 1AX0A 3VZMA 3V0AB 1MZFA 4AHYA 1AX2A 2BPA2 2F6BA 4YVSB 5J3UA 3ZYJB 3MLLA 2D40A 1G8WA 1V6OA 4R9CA 3ZFEC 1IHMA 1FV3A 5D8AB 1D4M2 4IEQA 3PMEA 4GH4A 3RPQA 3WP3A 2OIIA 4IERA 3AM2A 4WVMA 5I0TA 5JOXA 4WZCA 1W0PA 3WR0A 1W0OA 3FBYA 5E88A 5J48A 4NO4A 5SV8A 2WWSA 3IDCB 2JG8C 5H9RA 4I3PA 1RUC2 4TWTA 4AVVA 2Q0AA 5K7PA 1V9U3 4YW4A 3L2YA 5FBZA 3TOJA 1Z7S2 3RJ2X 2BGCA 4TZDA 1RUI3 1PK6C 2ZX0A 3S0MA 4YW5A 1YHFA 1RUJ2 2IXHA 2H0BA 1F9KA 4XXAA 4Q4X3 1UCXA 1HQNA 4I0BA 4G9SB 4DOUA 2MEV3 5CNAA 3VLBB 4IEWA 1VBA3 3AKQA 3N7LA 1ZZ6A 4KBBA 4LE4A 3E6CC 5I0UA 2LUWA 2RR13 1HX6A 1B35A 3CO2A 3RDIA 1RVF3 2A6WA 1FYUA 5I0RA 3UKVA 2ETEA 1R093 2VOVA 5K0UC 1VAVA 3JBG3 2R30A 3ZVXA 4RGAA 5BNPB 2D44A 1DG6A 3RMYA 4PLOA 5B2GB 4UW3A 3VBOC 4AHZA 4Q4V2 4Y26A 5GJ6A 1G86A 2GMEA 1UD1A 3MYXA 4N43C 4FTBA 2XH6A 3J9SA 3T1LA 5CB7A 4Q8LA 3KT1A 1RUC1 1QJU3 2OYZA 1MQTA 2B39A 3W9AA 1RB8G 1Z7S1 5ABJB 2ZHKA 3M3IA 4PLNA 3JUUA 1AR82 4XJUA 2DVGA 4Y1YA 3SHRA 2PTMA 3AMHA 2R32A 3GYDA 4PBOA 4M3CA 3FC0A 1GQGA 1RUJ1 4LHKA 5DDJ2 2X5IC 1ZZ7A 5JAXA 1HLCA 2DUPA 1Q8VA 1UX6A 2XBO2 3RRDA 1RHI3 1HIXA 1PO22 2ZHNA 3T1MA 3GZUC 4CP0A 4Q4W2 1I1EA 3OCPA 3FMGA 1H9PA 1LULA 1ASJ2 2W0XA 2D7FA 1D0HA 3HQXA 4S2HA 4AFBA 4WV8A 3FX3A 4X8NA 2XHKA 1LOGA 4MSVA 1QNWA 5C4WB 5LEKA 3OPZA 3VL9A 1CAUB 1AYN2 3R4DB 1QDCA 4Q4Y3 4XQDA 3M4FA 2IFWA 5A32B 1APNA 1GV9A 4Q4V1 4LUKA 2CNAA 4PIXA 4XJ9A 1UAIA 2VGDA 2QZ3A 4AVBA 3VBRC 3TN92 3SXWA 2WC2A 2JXAA 4B8EA 1BZWA 3VBSC 1S0JA 4SBVA 5KXEA 3MICA 1DLLA 1R1A3 3D5OA 1YNAA 1EY2A 4YM1A 2RJKA 5JSOA 1OOPA 4XW3A 1R1ZA 3RG0A 4MV2A 3D82A 4YVWB 3ZIWA 4C91A 1HDKA 3KCXA 4EWEA 5FLHA 2GMMA 2HWD1 2VQAA 2YGMA 4I0AA 4Y20B 2A3YA 4F83A 1U5IA 3WUDA 5DDJ1 3WT3A 4MYEA 3S7IA 3ATGA 3N36A 2XBO1 4E27A 4D7SA 2A6XA 3E97A 4KWLA 1PO21 4RGGA 1HRI3 2ZGTA 4XMAA 5HCBA 3THTA 1GLHA 2Q1ZB 2I07B 1CAXB 1ENXA 3RS6A 4LNVA 4AXOA 4X8PA 4Q4W1 1U5XA 1AL22 2OZJA 2CWSA 1ASJ1 4MUVA 4IEUA 1LGNA 3O0VA 2RS12 2C1FA 5CFDC 3AZVA 3VZLA 1GICA 1CVNA 3HN1A 1IQAA 3M3CA 4C90A 1LJ7A 3ST7A 3GZAA 2HWB3 2D6NA 4EN0A 1AR62 1J58A 3VBUA 4XF0A 3PMSA 1CJDA 1AYN1 1C1FA 1H2LA 3H1MA 5JPNB 4QPIA 4YGCA 5CG9A 1H1AA 1C28A 3KCCA 3JD72 4Q0QA 5BNNB 1OPOA 1WMEA 2R063 2ZBJA 3MIEA 1S1AA 2XG3A 1CPMA 4QHBA 5L36A 1ND2C 3HBZA 4LBLA 4FAGA 1D4VB 3KLSA 2ZPXA 5FRAA 3CL1A 5C9AA 3OTFA 1QOOA 1VBB2 3HD8B 3VDDC 1VBE2 5JIAA 1CN1A 4O9GA 4BPZA 1AUYA 2PHFA 5HI0A 3ES4A 4CDWA 4YFWA 5E8AA 4NHLA 3ZMNA 1QJX2 2DVDA 1POV3 4HKLA 2ZX4A 3ZXGA 1EP0A 3I4IA 3WP5A 4AI3A 2ZAAA 3QLQA 4MH0E 4XJZA 2CWMA 1AL21 4CDQB 5JOZA 4MVTA 1ULFA 1ZBE3 4KU8A 3JZVA 3I59B 2RS11 3O0WA 4H7LA 4QGNA 4RFT0 1DGWA 3T2TA 4QM8A 3ZFFA 3VKMA 1ZRDA 2HWF3 2VVDA 3H1YA 4AVCA 5ACA2 1O91A 5AVAA 1AR61 2V73A 1YFXA 2ZX3A 4JC1A 2WT0A 3ZXKA 3AYDA 4COYA 5FO9B 4GH4C 5T5OA 3IT8A 1REEA 1G9DA 1H2NA 2GMPA 3CU7A 1POV0 5F9TA 4GB33 5HCFA 1AF9A 1W6OB 1XE8A 2O0OA 1GZCA 1X82A 3AX4A 4Y4YA 1RUG1 1BVVA 4FCAA 3MFCA 1LOFA 2PLV3 2Q4SA 3KM5A 3E6BA 2C5DA 4HVQA 1VBB1 5GLZA 3WVJA 4FQ4A 1SBFA 2PHTA 4AF9A 1VBE1 1CAWA 4KGGA 4DFSA 5L19A 1EPWA 5JIUA 3KS7A 3N7MA 3U10A 4F3JA 2PHDA 2R072 1YXWA 1H4GA 3OYWA 4FP2A 5LEJA 2QE3A 3NKGA 5FPZA 1C3HA 1MEC3 1FNZA 5AC93 1SBDA 4FBFA 4BQ1A 2WFPA 2Q30A 1VP6A 1B35C 4OUSA 1ZX5A 1O3QA 4CP1A 1RGSA 1JUIA 2A7AA 2DU0A 5ACA1 4AFAA 3CLPA 4COWA 3M1HA 1C1LA 4IEYA 1COV3 3PVEA 5EYYA 1KITA 1SDWA 5SV5A 5DXDA 3WCSA 1REDA 4P9YA 1LRHA 4TLFA 4UBHA 1MQTC 1Q3EA 3M3QA 2DU1A 3PHMA 5JOWA 4KGQA 5CFCC 4FXKB 3RMXA 1JOJA 4M0HA 2PELA 2DWRA 2VVEA 4NWWA 4WM8A 3D6EA 1PNGA 1V00A 2JECA 4Q2FA 4Q26A 3VHOA 2JG9B 4KG8A 1QY4A 3ZMOA 3MGUA 4XF3A 4Q8KA 1FNYA 3O14A 2OVUA 2ZGKA 3N3HA 1LOEA 2P3JA 3AMPA 3FWEA 4N53A 5L73A 3VKFC 4HKWA 1FOD3 3CJXA 2NYYA 2OPKA 4UW4A 3MPBA 3N4MA 1UL9A 4NHKA 1WW5A 2NZ9A 4JGZB 1U5YA 1BBT3 2EXKA 3ZSEA 1BEV3 4B3NA 2D6MA 4FPYA 3WQ0A 1FATA 4WVVA 2UWCA 5E16A 3CJIA 2IXLA 3AP9A 5BNOB 1H0BA 3AJYA 4MXWA 4CDXC 2D98A 4AVSA 1XYOA 1PIV2 2RS53 3U07A 1VB2A 3JQXA 2XJVA 3LCPA 4K3UA 3PVNA 1NCQA 4YW3A 1QDOA 1RUF2 5JSRA 2Y38A 4CTEA 1FMD2 2P3KA 4I3GA 4B4PA 3QOPA 1OOPC 5HXVA 5T54A 3B93A 4IXLA 3ZN4A 1RUNA 4L11A 1S0BA 3ZXLA 2CL2A 2W52A 2HWC2 2QNKA 1J1TA 4I09A 2A6ZA 5TSWA 1SMVA 1YLLA 3N35A 5KXCA 3WCRA 1ZA4A 3AMMA 2B8MA 1YJLA 2H0VA 3IBMA 4DS0A 2WNVB 5IK8A 3HIFA 4P9JA 3WOGA 4JDOA 1ZZ9A 1AXYA 1C8M1 4YZ3A 2ZGSA 4QPGA 4IL7A 1IS5A 1XNDA 4RA0A 4RHV3 4Y22A 3LOBA 4Q1PA 4Y24A 4L9BA 4R9DA 5I0SA 1I9RA 3OY8A 1PIV1 1AYM3 3VBUC 3WY6A 1H8TB 3I8TA 1ENSA 3BB6A 1RIRA 1UF2C 5KHKA 4M0NA 4E4ZA 2VU9A 2IXCA 1DU3D 3QH7A 4LHLA 5GZCA 4PF5A 3EQEA 2ILMA 4QU2A 4I01A 4AWDA 2WJSA 5JPMB 2BW8A 3IPVB 1VBC2 1WCSA 3SISA 5C9AC 1ZBA3 5DUXA 4X6RB 3FBMA 3N7JA 2HWC1 2VMHA 5J96B 1LHWA 5FPXA 3WINE 1FPN2 3R05A 3W58A 2DCJA 3O12A 4CDWC 3VZOA 2HWE2 3BODA 1Q5OA 4ISQA 2ZGOA 3AZWA 4UW6A 4DRRA 1ZZCA 5IT6A 5J98B 1LHNA 2RS31 1MS0A 4Q1RA 2ZX2A 1QQP2 2XWJB 4J6GA 4P9XA 5HBAA 1VRH3 2VXRA 1KD7A 5K9YA 1G9CA 3QACA 4AEMA 4XFGA 3ZFFC 2PN5A 3TNPB 2RM21 4FPOB 2OA2A 2WFF3 1HV0A 1RINA 4K20A 1JYIA 5KC5A 1OPMA 1ALYA 1SBEA 4GA9A 3KD4A 2E6VA 3PLQA 2C9AA 4WM7B 2XVKA 2DYCA 3BPZA 1GZWA 3WW1A 5I91A 4BIOA 2VNOA 3FLRA 2XWBB 4XYXA 1ZYBA 1NQDA 5JZGA 4DQAA 2X8KA 4BM8A 3MF9A 3JU9A 2R043 2BTVC 4ES8A 4CEWB 2TNFA 2XKOA 3LA7A 2YPJA 1PGL2 4GWMA 1ZRFA 1VB4A 2PYTA 1VBC1 1LOFC 1OFSA 1C8NA 2ZHMA 3VKLA 1NCRA 5FMOL 5A33A 1E57A 4NN0A 1DF0A 1QJY2 2A6VA 2ZS6B 4DINB 1FPN1 1ND3B 2OUHA 2UWAA 4BYYA 2TUNA 4U36A 5BY5A 4G3YC 3ZXDA 1LCLA 2A3WA 2BQPA 3J26N 1OLQA 4Q0PA 1QQP1 3EXUA 3VBFB 5F6LB 1O4YA 3IIAA 2R0FA 2D3PA 4OFGA 2BNOA 3GNEA 1NA1B 2WNEA 1PHMA 1NLSA 1TMF2 4R4XA 4E4SA 1KXGA 3RWNA 3VN4A 2RHPA 1F5JA 4ONUA 4PDWB 1DQ1A 4PIYA 4RR3A 4Z1VA 3OBRA 4K7JA 3V0BB 2WLQA 1DQ4A 3KQRA 3PTYA 4GKXA 3AYCA 4M01A 2A73B 1QOTA 3ES1A 4XOGA 4EN9B 2DVFA 3ZSKA 1V6NA 4WM8C 1PGL1 4J1XA 1PO13 3VBHB 4JAAA 4UXAA 2XJPA 2Y0IA 4FSJA 1HRV2 3WP6A 2YYOA 3USUA 2GC3A 5L7OB 4N53C 4AFCA 4IV3B 4G4FA 1YFWA 1RJ8A 1MZ5A 1V6JA 1HV1A 4XJ8A 4E2SA 3HAGA 5C8CB 4DPNA 5CFCB 1KDKA 4QXKA 1YUDA 1YWKA 3IKWA 4IEOA 2ZKLA 3MIBA