2PA7A

Structure of wild-type dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
ENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pa7A00
2CAUA 1I5ZA 4HMZA 3D0JA 5K8SA 3I54A 2QNKA 5BPXA 4WZCA 2O8QA 4XFBA 4IESA 2IXHA 3MZHA 3S0MA 3E97A 3KGLA 4HVQA 5LEKA 2XLGA 4ZU5A 3MPBA 4IETA 1WLTA 5LRSA 4MGZE 1G6NA 2F4PA 3KMHA 1TQ5A 2QVSB 4ORFA 4BH9A 1H1IA 4E2GA 5BXXA 4Q0QA 4LA2A 2MHFA 1NE6A 1YLLA 2DCTA 3PLQA 5BV6A 4B29A 2XL7A 1Y9QA 2MPFA 4KWJA 1O3TA 1ZREA 4HVOA 5D1IA 4QM8A 4J1XA 1NYWA 3NL1A 1U12A 4PIZA 5I91A 1X82A 4EROA 1YUDA 5AVPA 4HN0A 1ZZ7A 5F1RA 2GU9A 2GC1A 4P9GA 5FLHA 3EHKA 4A2UA 3NW4A 4PIXA 2O1QA 5FQ0B 3HT2A 3E6DA 5J7MA 2GH2A 4UBGA 2CAVA 3RDIA 3ELNA 4TLFA 1ZVFA 4Q0PA 4IEPA 4XF1A 4FAGA 4LLOA 5JCTA 4BIFA 1LB2A 5LEJA 5BUVA 4F8AA 3H3ZA 1CAXB 2PYTA 4HVRA 1QY4A 3WW1A 2PAEA 4XFFA 4XFAA 3N4MA 4GULA 3RYRA 2H6BA 3BPZA 2FQPA 3IDBB 2BEOA 4YARA 2BYVE 2ET7A 2HKXA 3CO2A 3FHIB 3WW4A 1O3RA 1XRUA 3HT1A 2PTMA 3C3VA 3IIAA 5KBFA 4HLTA 3SXWA 4ZU7A 2UYBA 2Z69A 4XF4A 1NE4A 4BYYA 2XLAA 1YHFA 3B02A 4OFGA 2UYAA 2PHDA 1WA4A 1L3JA 2VQAA 1FI2A 5CADA 1CAWB 5KHKA 4QX5A 3GBFA 1ZRFA 1DZTA 4K8FA 4IEOA 4MUVA 1Q5OA 4PJYA 1ZRDA 2BNNA 5JAXA 3U11A 1UPIA 2GC3A 3TNQA 3S7EA 1ZZ9A 3SCHA 2OPKA 1LR5A 3U0ZA 4FAHA 2ETEA 3IBMA 1RTVA 3ES1A 3JZVA 4LUKA 4EWDA 2XHKA 3M70A 3R6SA 2PAKA 3VHRA 3H50A 4IEUA 5I0UA 4CYDA 2GC0A 4XFHA 3RYKA 4HSJA 1PM7A 5JSRA 4AQ6A 4QMAA 3EJKA 1Q43A 4KU8A 5FPXA 1O3QA 1J58A 2HJIA 3QACA 3H3UA 3CEWA 2PFWA 2C0ZA 4YYOA 4LEJA 4O9EA 4XFIA 3SCGA 1ZRRA 2XL9A 5E1RA 1OD5A 2QCSB 4KL1A 1RGSA 1ZRCA 3RNSA 3EO6A 3WW2A 3RZZA 4WBBA 3DL3A 4WVZA 3SHRA 2CGPA 1SQ4A 4LULA 3L2HA 3ZDSA 3SMHA 5FQ0A 5JSPA 2GC2A 1ZZ8A 3ACLA 4BHPA 3MYXA 3DN7A 2B5HA 4X6RB 2PQQA 1J1LA 3IWZA 1RC6A 2B9UA 1FXZA 2D40A 1X8MA 4JTOA 1Y3TA 5I93A 4Q0UA 1OFNA 1CX4A 2Q30A 1UW8A 3PNAA 3H9AA 4I02A 2KXLA 4I3PA 1ZNPA 3H1MA 1CAXA 1FT9A 3IDCB 1LKNA 4EWEA 4Z07A 4MV2A 1CAUB 1J59A 5J48A 3NSTA 1O4TA 4R52A 1CAVB 4RD7A 3RPQA 4NVPA 2MNGA 2QJVA 4FBFA 4AQ2A 2ZKLA 2Y0OA 2PAMA 3OD0A 3O14A 1JUHA 4LTAA 3BALA 4FT8A 3FX3A 4XF3A 1H1MA 2ZCWA 1IPJA 3D0SA 4N9IA 2BGCA 4PIYA 5JSOA 2IC1A 5I0SA 3FZ3A 5LRRA 2H0VA 1ZZCA 3OGJA 2XKOA 4MGIE 4AVCA 1NZCA 3SCFA 3OTFA 4E2QA 1I6XA 2ATFA 5FCCA 2BNMA 5FDBA 4Q29A 4MGKE 1WGPA 2XLFA 4I09A 3QOPA 1VJ2A 1DGRA 3NJZA 4HSLA 5I8YA 3H7JA 4D7SA 1VR3A 1IPKA 4LUMA 4XETA 3ROUA 3LA7A 4H7LA 2GAUA 1ZX5A 1UCXA 2BNOA 2XGXA 5C6CA 1J3PA 1EP0A 3CJXA 1EYBA 2D5FA 4QGNA 2Q4SA 3CLPA 1NXMA 5J3UA 1QWRA 5EZWA 3MDPA 2VPVA 3U10A 1Q3EA 4I0BA 4XF0A 3WW3A 1EY2A 1X8EA 3NKTA 1OMIA 3BB6A 3I59B 4META 2IXKA 1YWKA 1EPZA 2V09A 1OI6A 3HIFA 4LA3A 2OA2A 4XFCA 4MH0E 1YFUA 4XFGA 5I0RA 1YFYA 2B8MA 3ETQA 3ES4A 3G7DA 4J1WA 4L2NA 5CU1A 2IXCA 3E5XA 2WFPA 1O5UA 3KGZA 3H7YA 3NVCA 4ZU4A 4IEWA 2EVXA 2OZ6A 4UBHA 5BY5A 3E6BA 1UIJA 2UY8A 3EQEA 4MGYE 2P17A 1J3QA 4KU7A 1V70A 1SEFA 3FFQA 1UIKA 5CVRA 3LA3A 2IXLA 4X6QB 1UD1A 5KHHA 4R8HA 4UXAA 5KHIA 3E5UA 2CV6A 3I7DA 3FE5A 3S7IA 1RUOA 2UY9A 4QGLA 2K0GA 2FMYA 4O9GA 4AVBA 5I0TA 2D5HA 3LZZA 4ONUA 4QGMA 1VP6A 2WC2A 2XKPA 4IERA 3BCWA 1GQHA 5HI0A 3H8UA 1CAUA 3ST7A 5T3NA 1QXJA 3OF1A 5E16A 1CAVA 4MX3A 4XEZA 3E5QA 1RL3A 4L11A 4IEVA 4AXOA 3FWEA 2N7GA 2ET1A 3UKVA 4IEXA 3BU7A 5FPZA 3EBRA 4I01A 1LRHA 4JTNA 4IEQA 3FJSA 4JV4A 4XF9A 4Z82A 4Q0VA 2EAAA 2QDRA 3LWCA 3CF6E 3H1WA 3UKNA 1ZZ6A 1GQGA 2EA7A 4EWAA 4I2OA 1SFNA 4HZFA 1J3RA 2GZWA 1RUNA 3OCPA 1O7FA 4KWLA 2K9ZA 1CAWA 5JR7B 2PHLA 4YSFA 3H1YA 3PVBB 4IEZA 3KSCA 4KWKA 3LOIA 5KHJA 5KHGA 5I8TA 4MZUA 5C8WA 3DV8A 1X7NA 5EFUA 4JVAA 3D82A 3E6CC 1O5LA 3TNPB 2D93A 4HBNA 3LA2A 1O3SA 4N9HA 4DINB 2Q0AA 4OLLA 3KCCA 3UKTA 4AVAA 4YNIA 4I0AA 1QXRA 1DZRA 2VECA 3M3IA 2IXIA 1XE7A 1ZZBA 2Z2SB 3LAGA 4YRDA 2OYZA 4HN1A 4QXKA 3I59A 1PMIA 2IXJA 1YFXA 4IEYA 3DKWA 1XE8A 5FLJA 2E9QA 4E2SA 4QM9A 4D7TA 1CGPA 2PA7A 2OZJA 4Q0SA 3HQXA 5I8SA 3RYPA 3CL1A 1YFWA 2H6CA 1DGWA 2Q1ZB 4F7ZA 4EV0A 2I45A 3USSA 1HW5A 5FLIA 3GYDA
chains in the Genus database with same CATH superfamily
3AFKA 4FPCA 5A33B 3LEGA 1QGLA 3QLQA 3A23A 2XR4A 2J42A 3FN9A 2JWPA 2O8QA 1A78A 3ZXAC 1SFPA 3W59A 4BQ2A 1RMU2 5HXVA 1MS4A 3KGLA 4PDWA 4ZU5A 1VRH1 3MIFA 4GQ7A 1W8UA 2ARCA 4LBMA 1PM4A 1WLTA 1C1FA 4MGZE 5A3WA 1JHJA 2ZHMA 4ORFA 3C7FA 1HJGA 2CGNA 4BH9A 4BE3A 4FOVA 5BXXA 4Q0QA 3AZVA 2MHFA 2V5DA 4IV3C 3K4ZA 3O1OA 1Z0HA 5FZBA 1XYOA 4P00B 1I1EA 5F6KA 4AVVA 4B29A 1MZFA 4HXCA 3ZYBA 5FPUA 3WDXA 3PVNA 3FLRA 4KWJA 5FMBA 3LOBA 1PMHX 3BIEA 3PURA 4P08A 5D8AB 1AYN1 1C28A 4TTGA 2B9VA 3NL1A 2VBDA 4PIZA 1VBD2 1DQ0A 3PL0A 5I91A 3TWIA 4YG3A 4WM8B 5C4WC 2GU9A 4A7KA 5JXIA 2GC1A 4W6XA 2XQRA 1TZOA 3JCIA 3BTXA 3EHKA 2VVFA 5AC91 2AENA 2X05A 4RS5C 5SV8A 3TN93 4BDVB 3OEAA 5F3IA 4PIXA 4A2UA 3URFA 3V0BA 2FCTA 2BJSA 4LBJA 5FQ0B 2WNEA 5FPVA 2WNUB 4AI1A 2JICA 4PLNA 5APAA 4L9BA 2VZQA 1ZVFA 2RR12 3JBG2 4FAGA 4MHUA 4LLOA 4Y22A 5CFDB 4QKBA 5JXGA 4QD2A 3INAA 5A7SA 1LJ7A 4AHWA 5LEJA 3IAQA 1N1VA 4QDRA 5CFCB 4F8AA 5T50A 4N43B 5FKCA 2YG0A 4RHV1 1ULGA 1OKQA 2PYTA 1T2XA 3V0AB 1X50A 4HVRA 4CEWB 2C26A 1COV1 3HVDA 3GNEA 2R073 2PAEA 5EV7A 2GMEA 2GSYA 4NJ4A 4OQ8A 5B4NA 1BK1A 1QJFA 3RYRA 2QE3A 1R64A 3BPZA 3C7GA 5F2SA 4IV1A 2WNVA 1WD4A 2D6MA 3RZMA 4Y3OA 4H14A 1JU3A 3MF9A 4YARA 2BYVE 2HKXA 3WW4A 1OD3A 2EIDA 2FDGA 2ZX1A 3ZYJB 1R1A3 4AFBA 2BGOA 1SBEA 2R0FA 2PTMA 5FYYA 3U1XA 3PUIA 2RJ2A 5ABJA 2Z69A 3IPVB 1XJAA 1NE4A 1YI9A 3E1F1 1YHFA 4QT6A 4NAOA 1ULFA 1H4GA 2BFUS 4OVEA 4RQPA 5J98B 5HV4A 1EAH3 4Q4X2 5FZ0A 5FZDA 1CAWB 2Z4FA 2Y6HA 4LT5A 1CPMA 4LKDA 3KVAA 4GZ9A 2VNRA 4HFSA 5JZGA 1GOGA 4W4ZA 2QQUA 3UK9A 4FFHA 3EXUA 1WCSA 1F5FA 1ZRFA 2VNOA 5FY4A 1DZTA 1ONAA 4K8FA 2NP0A 4NUBA 1ASJ2 2RS52 3ZSEA 1QJX1 3NV1A 2RMU2 2MEV3 1C5HA 5FIXA 1I9RA 3T2OA 4AEDC 4PJYA 4D94A 1DBNA 2RDNA 2RS32 3VBUB 3VKFC 1LOBA 3VZLA 5KXBA 3LKJA 1UPIA 4H55A 1RUE2 5C33A 1BVP1 4COUA 4IE5A 3ZXGA 3S7EA 1ZZ9A 2P5BA 3I2FA 4FAHA 2YBKA 2X5IB 3AMPA 3JZVA 2WAOA 5IVYA 2BW8A 2XHKA 1W6NB 1FX5A 2PAKA 4YVWA 4YGBA 2Y26A 5J96B 1NCQA 3NV4A 1KRIA 1BEV3 3AVSA 1YO8A 2YHJA 4QPWA 4PF1A 3RYKA 1VRH3 3LCPA 2WYSA 2TEPA 4CPBA 1XYNA 3LIGA 4JRAA 4BK4A 4HOOA 4LHSA 1Q43A 2JG8C 5BYNA 1AL21 1Z78A 2LALA 2XMLA 3M3CA 4C1WA 3TEYA 2JDKA 5J37A 4ES9A 3LPGA 4CRQA 1J58A 1LEDA 1WKYA 1YQ8A 5HCAA 3H3UA 1H0BA 2PFWA 3CKHA 3CIHA 5J09A 2C0ZA 1OF4A 5A1FA 1V6LA 4LEJA 3F2ZA 3LEIA 3ZXDA 1URXA 2CTVA 3HD8B 2JDHA 1JH5A 4IE7A 1HLCA 1AYN3 3ZN6B 1OD5A 2QCSB 4XACA 5HBAA 1S0GA 4KL1A 2C6SA 5KWRA 1ACCA 1YCIA 1V6JA 5FY1A 3A0KA 1PGW2 1PK6A 1J1TA 5A7PA 2C1FA 5LK5A 4YW5A 3DL3A 4WVZA 1ULDA 4LULA 2A75A 2HEVF 1TVGA 5FZOA 5AC93 1PGSA 3ZDSA 1GNHA 2GN7A 2RHPA 3SMHA 4DIQA 3ACLA 2J22A 3VBFA 1XC6A 1IQDC 1J1LA 1ENXA 4AWDA 5FYSA 1D0HA 4K6BA 4P9YA 3T2QA 1RC6A 4H2AA 4MGSA 1GP5A 1BK0A 1RMU1 5F5IA 3U37A 4FTEA 1PO12 4RFRB 1FXZA 4P02B 3T08A 3ZLIA 4PHZA 4QX0A 2XG3A 3KT1A 4N53B 4CCCA 4D8MA 4EN0A 5A32B 4BB3A 1HB2A 1ODMA 2ERFA 3VDDA 5F3EA 3NWKA 1SLCA 1BVVA 4NIIA 2WAAA 2ZZJA 1JZ2A 4RHV3 4W6YA 4QQPA 4NR1A 4AI0A 1COV3 1UWWA 4RR3B 2XUEA 1OOPC 2TBVA 3DPRA 1J59A 1S4CA 3K4AA 5IK8A 5J48A 1WW4A 3AP9A 1CAVB 4RD7A 3NAPA 4NHYA 3WD5A 3KCXA 5DUUA 3AXDA 5CG8A 1EPWA 1APNA 2RM22 5FXXA 4CDQC 1VBD1 2W39A 1F8VA 5IAVA 5IFPA 2VAUA 3RMYA 3VBHB 1JUHA 3RZJA 4Y1VA 3NNFA 3FX3A 2HEWF 1H1MA 3WQBA 2F4LA 1UU6A 3O0XA 4BLJA 1H8TA 3AK0A 2ZGUA 4E27A 1NUKA 4N8MA 2E63A 2BFUL 1Q8SA 2PQSA 1IKQA 1WBFA 3MIHA 3S6PA 5I0SA 3FZ3A 1OLRA 5A3NA 2XJTA 1Q8PA 5BNPA 2R49A 1SFYA 2WZPP 1ZZCA 5BNOA 2RR11 3JBG1 4AVCA 2FCUA 1ODNA 4M3CE 1Y9MA 4Q4Y3 5T52A 3W5MA 1Y4WA 3PMSA 5EJZB 2WZ8A 5FR3A 1ND2A 4CP2A 5LZ6A 1ULEA 4LIVA 1WGPA 2B4KA 3THTA 4EJRA 2WT0A 1B35A 3QOPA 2ZACA 3ZMNA 5C8CC 3J7HA 4HSLA 4X8NA 2VMDA 3I3DA 4LUMA 2FMDA 4XETA 4XBLA 2PXJA 4UFLA 1C57A 3MO4A 4H7LA 2GAUA 1FPN2 2GP5A 1ENRA 3BOPA 3AMQA 5C6CA 5L7OA 3BIWE 1PVXA 2WJSA 1AR82 1W0NA 1EYBA 4FXGB 2D5FA 2GNDA 2KA3A 2TUNA 5EWSA 3BUCA 1MZEA 4R9CA 1I5PA 3CJIA 3K77A 3WNNA 4K20A 4FP2A 1VIWB 1AF9A 2BQPA 1Q3EA 3WV6A 3I2OA 3WW3A 3DXUA 1W6OB 1TEIA 1AL23 3NKTA 4GWNA 4QQHA 3MPPG 5SV5A 4LQRA 2BOIA 2ILMA 3WP5A 1G86A 1OSGA 2BDRA 3ACGA 1H6XA 1US2A 5T5JA 3HIFA 1DU3D 2A3XA 3PHMA 4CSWA 2ZEWA 1HJFA 4RGKA 4XFCA 3G6JB 1W8WA 5T55A 3PU3A 3J7NA 1JOJA 1MS9A 5I0RA 2B8MA 3ETQA 3FMGA 2EXJA 3GHNA 4J1WA 4NAMA 1ASJ1 1XB9A 2RS51 1OH3A 3H8OA 3QH7A 1OLMA 3HN3A 2RMU1 2W95A 1FMD3 3H7YA 4DFSA 2WQZC 5DUVA 2YBSA 4ZU4A 5FZ7A 2WUHA 1K5MA 1LGBA 2RS31 2VNVA 5FV3A 2OZ6A 4DXSA 2WO3A 5CA6A 2GP3A 5FYCA 3ILFA 1RUE1 2VUCA 3E6BA 2UY8A 4P9XA 1WBLA 3EQEA 1J3QA 4KU7A 3WQ0A 3PVOA 4Q1PA 1SEFA 5KXDA 3FFQA 1S0FA 5DPNA 1UOFA 3VZKA 4X6QB 3I3BA 1MQTA 1UZZA 4PDWB 1RMU3 3M4FA 2K2SA 1BJQA 1UKRA 1S0DA 4QQ2A 3I7DA 3MIGA 3UNPA 2Y33A 3Q9OA 1RUOA 4GH4A 2EIGA 5DAPA 4AVBA 4JKLA 2YFZA 5JOXA 1HIXA 1PIV3 3AZYA 3GHMA 1N3QA 4UI9L 2QDNA 4CXWA 2FDKA 1OUXA 1S0BA 2VG9A 4ONUA 4HKWA 1SLAA 2XKPA 3T3YA 1HB3A 4IERA 1POV1 4GJZA 2ADEA 4FQ4A 5A3OA 3ST7A 5T3NA 1O91A 3IZOA 5A6XA 3OF1A 3VN4A 4NO4A 4R9DA 2W08A 1RL3A 3E5QA 4XEZA 3SEPA 3ZFFA 3HQRA 2QBXA 4AI2A 1UYYA 2JE9A 4XOGA 3J26N 3WNKA 3WF3A 5KC5A 1VBD3 4IEXA 2OUJA 4K40A 4KMQA 3RZLA 1OQEA 3EBRA 5FREA 1PGW1 4JTNA 4IGPA 2QQMA 3FJSA 5L19A 1N1YA 1CN1A 2JE7A 2Q1MA 3HPNA 4LBQA 5FXWA 1DP0A 2JKBA 4Q0VA 2EAAA 2OKXA 3V0BB 2EXHA 2VXRA 5ABJC 2DVAA 3CF6E 3H1WA 4XZUG 1DLLA 4OULA 3WR0A 4A6OA 1AHSA 2C9KA 4XDOA 1OLQA 1SFNA 2VC9A 4MLOA 3TAYA 4I2OA 2Y6LA 3UV9A 1Z7S2 5FWJA 5LA1A 5A7WA 4Y22B 3H8XA 2ARBA 5ACA2 2ZX4A 4PT6A 3MF6A 1PO11 1CAWA 1AX2A 1POQA 3JBG3 2BGPA 1CQ9A 2P3YA 2PHLA 5CKNA 3JB8A 3KQ4B 4NHLA 3DGTA 3VLBB 3VZMA 2JENA 2ID4A 4CTEA 3MUZ1 3JU9A 2MEV2 3LOIA 5KHJA 3J7MA 2VVDA 5G05L 3ZYIB 2Q8DA 5EIYB 4OMCA 4YW2A 4ATEA 1DG6A 4DUVA 1AR63 4CXYA 4FTBA 4FQZA 4KGGA 4G4FA 4QDSA 4BLIA 1DF0A 5CG9A 3TNPB 4IV1B 3LFMA 2WNVB 4JAAA 4LJHA 3CMGA 2DBNA 1YIFA 2Q0AA 3I2GA 4E4DX 3UKTA 4P9LA 4AVAA 2Y6JA 2WO7A 4C90A 1IQAA 4I0AA 2RM21 2X5IA 2IVJA 2X10A 4LK6A 1QXRA 2DCYA 5HCHA 2IXIA 3N7KA 3UJOA 2ZMNA 1OOPB 2XB6C 1S55A 3WDWA 5FJHA 4XCAA 5EPAA 3WG4A 1BEV2 1W6NA 2Z2SB 1QJZA 2PELA 4L97A 2CHHA 2XPJA 4RQPB 2P3IA 2ZHNA 2WRAA 2JDYA 1LOFC 5EJ1B 3V56A 2G9FA 5F6LB 4ZXEA 1GICA 5DZGA 5BNNA 1PVC2 5JI9A 4GALA 4AGRA 5LA0A 4Q4X3 4LHNA 1XU1A 1YFXA 2D43A 4P5YA 5JZGB 1CX1A 3DKWA 3IM0A 5FYMA 5FLJA 1HXS2 5FZCA 4EE2A 4E2SA 3FC0A 2XJQA 1UX7A 1CGPA 2W68A 3OGVA 1OVSA 2RVAA 3HQXA 1FNYA 3NNGA 3POWA 1UNBA 2DWRA 3RYPA 2VR4A 1ASJ3 3OYWB 2RS53 3ZSMA 5F3CA 3POGA 4AFAA 4A3XA 2L9LA 2Y0IA 3WP3A 5A3LA 3K3NA 5FZKA 2A1XA 5F5AA 3NJVA 2YU1A 4Y4RA 2RS33 3T30A 3ZO0B 4K9SA 1U0AA 4FCAA 2CAUA 1WCDJ 3GM8A 3OPWA 1US3A 5T5PA 4AEKA 3RWNA 1RXGA 2G9GA 3K48A 4BQ5A 1X36A 1WMDA 4W65A 3MZHA 2A73B 1BLZA 1FPN1 1MS5A 2DFBA 3HJRA 3E97A 4YVWB 3MW4A 4CUAA 4OHYA 3FFZA 3R4UA 2IWGB 1W6QA 4ISRA 1AR81 5L73A 4XMAA 1Q8OA 5LRSA 2BBVA 4NWVA 5A7OA 4CU7A 1H1IA 4E2GA 1W6MA 4OZXA 4Z2AA 5CISA 4LOSA 4EZ4A 1PMJX 1RIRA 2E6VA 1NE6A 4FPEA 1JOPA 5B2GB 2AREA 4LPLA 5BV6A 1MACA 2ZGSA 1GV9A 4IDZA 1OPOA 1XE0A 1Y9QA 1POV3 3LB9A 2ZABA 5D1IA 5DMYA 4GMP0 3B00A 3AZXA 3M3QA 2DF7A 5DAWA 1NYWA 1OURA 3BODA 3M3EA 4NIHA 4MXVA 4EROA 4HN0A 1QQP2 1SG3A 3IIIA 5F1RA 4LO4B 3IDEA 4ZONA 1PK6B 4BQWA 3GCXA 5FLHA 1UX6A 4IV3A 1QDCA 2VTXJ 5FZOB 2JB8A 3VBSC 1AYM2 3ZYRA 5HXMA 5CIRA 2WQ8A 3HT2A 4BWOA 4DRVA 2P37A 3UGFA 2ZEZA 5J7MA 1PX4A 2PLV2 5K7PA 1HRI3 2DURA 4IUGA 5A1LA 4CCDA 5FRAA 4Q0PA 2G9ZA 2J1RA 1MS8A 5JCTA 1TME2 4NOTA 1UMIA 2VUAA 4YZ3A 1PO13 5C4WA 3KVBA 4OMDA 1XNBA 4L92A 4M0HA 4CCJA 1VPHA 3U78A 1SBDA 1V9U2 1W0OA 3AFGA 4Q4Y2 3VDDB 5FY7A 5C3OA 1JW6A 5BUVA 2WKKA 3H3ZA 4RS5A 2VMGA 3FLPA 5F32A 2VXJA 4JGZC 4Y20A 5J1XA 3WW1A 4KG8A 3ZYFA 4MVTA 3DPRB 1OHFA 1ULOA 5JMOA 2H6BA 3GBGA 4OUEA 5L36A 4UW3A 4BU2A 3CZJA 3NAPB 2BWAA 2WO1A 2VTXA 2BWCA 3K75B 1LHOA 2WBKA 4HK9A 5AFEA 2VOTA 2BEOA 3IDBB 4CDXC 1O3RA 2ET7A 1H2KA 1ND3C 3FHIB 4W8JA 1U5IA 2UWBA 3HT1A 4ZS2A 3OPTA 2RM23 4ZU7A 4XPVA 1W8OA 2QUOA 1H2NA 1RJ7A 1O4ZA 5IWFA 4XF4A 4YFZA 2R32A 5LBBA 1IKPA 5A3TA 1BHGA 1XNTA 3VBRC 1F9KA 1H8TB 4L99A 3C7OA 1WA4A 4G3YC 3LD8A 1L3JA 2ARAA 4ES8A 1UOBA 3K3OA 1FI2A 4QHZA 3D4KA 4M00A 3M2MA 4B8EA 4D69A 2FCVA 4GA9A 3FBMA 4QPIC 3WNOA 5E89A 5BNPB 5KHKA 4QX5A 4QB2A 4OYUA 5JPMB 3CDZB 5BNOB 1Z7S1 4BQ1A 1LESA 4XHBA 4BCUA 3FL7A 4DS0A 5ACA1 1S0EA 2EAKA 1Q5OA 1AR72 2YC0A 1ND2B 5JIAA 3NNMA 5DG2A 2VVEA 3WNPA 1GZWA 2B45X 1U5ZA 1ZRDA 1E5SA 1ENSA 2BNNA 3THPA 1NZIA 1B35B 3APBA 2MEV1 4Q5OA 1FMD2 4AHYA 2ZHLA 2I07B 2VO5A 5FZ1A 3TNQA 3JB4C 2DV9A 2O0OA 3SCHA 3U0ZA 4BQ3A 1RUG2 2DUOA 4UFMA 4XDQA 4CUBA 3AYEA 4LUKA 3J8F3 3JD73 3OOXA 4YW4A 4K7JA 1S0JA 2ZGPA 4EWDA 2WSVA 3M70A 3O7OA 5L7OB 2FDHA 1FPN3 3VHRA 4DY3A 1ZA4A 3FUOA 3OEBA 4RN5A 4TYSA 1OH4A 3WX5A 5DAQA 4AEDA 3CJIB 2AEYA 1AR83 4LNVA 1DHKB 1HRV2 3RI8A 4KU8A 4BPZA 1OXCA 3WCSA 1BEV1 3THCA 1WD3A 1YJLA 2B46X 1O3QA 3AB0A 3WHTA 2VCCA 2VM9A 4SLIA 2HJIA 2WNOA 1D4M3 1PVC1 2FHRA 4NRMA 1PIV2 3P3NA 4AI9A 5IVBA 3AMNA 1F15A 2WZR2 2W1WA 5T5LA 4YYOA 2RDRA 3H42B 1OVPA 4O9EA 3MV11 4XFIA 1HXS1 4NIGA 4G9SB 3GJBA 2WWSA 2YXSA 3AP6A 4WM7B 4QU2A 2W46A 3RNSA 2VJXA 2JG8A 3S30A 4IE4A 5CB7A 2ZA9A 5CAZA 3DF0A 1K5MB 5J36A 2LS6A 1LU1A 4E9KA 2W1SA 4Q4W3 1C5IA 3HNMA 1FAYA 3AKQA 4CE8A 4AR2A 2ZAAA 1CZVA 1ZZ8A 4BHPA 5B4XA 1X9PA 2SLIA 2PQQA 3NO8A 2GNBA 5FZ3A 1MQTB 3CNAA 4TSVA 4YGCA 2OX0A 4YM1A 4Q26A 1AUYA 2D40A 3Q8EA 4C1XA 4JTOA 2DBIA 5I93A 5EQUA 1KEXA 4JDMA 4FFIA 1WCQA 2Q30A 2FDIA 3PNAA 1SCRA 4GH4B 3KV4A 3H9AA 4I02A 1MS0A 1OFSA 2XVKA 3H1MA 1VAMA 2HBUA 1CAXA 2NMNA 2VMHA 3RRDA 3DCQA 2R1BA 1JYCA 3IDCB 1LKNA 4A45A 1W28A 3C7HA 4ZHNA 1PO22 2VQ0A 1NKGA 5LBCA 1DGWX 1LHUA 1LGNA 1H4HA 2LM3A 3BVCA 5FP8A 4FPHA 5CYYA 5E88A 2VMIA 4R52A 1AR62 3MIBA 3HNBM 4NPMA 2MNGA 4NVPA 3ZFFB 1ZM1A 4CP9B 3WF4A 3AMMA 3MW2A 2QJVA 3PDQA 4FPOB 4R4XA 4DUXA 4AQ2A 2ZKLA 3GXUA 1GNYA 1YC61 3O14A 1G9CA 1QQP1 4NMIA 4LTAA 4HT1T 4FPGA 4QPGC 3I2HA 1DDLA 2EXIA 2QZ2A 1DQ5A 3KHCA 5H9QA 1IGOA 2ZCWA 3IN9A 4LBQB 1CPNA 3PUQA 1DGRN 4N9IA 3ZSLA 1AYM1 3ZPOA 4LIUA 1OOPA 3QD6A 1OQ1A 3OJBA 2IC1A 3ECQA 4QXBA 5FP7A 5FWEA 2PLV1 3AMHA 4MXWA 4GB32 1W3VA 3V64A 1H1AA 1VBA2 2LUWA 1PX3A 1QKQA 2YPJA 3AZZA 2ZBJA 3D3AA 1J84A 5A7WB 4QX2A 3D5OA 4CDQA 5GZEA 3KD4A 1Z7S3 1QJEA 4LKSA 1QMJA 2X8KA 3VBSB 2WABA 5ACA3 1NAEA 1TME1 4CDWC 4H3WA 4WVMA 4MGTA 5FCCA 2BNMA 2VGDA 1DLCA 1MEC3 3W20A 5FDBA 2DVBA 5A6QA 1V9U1 1WLCA 4Q4Y1 2GNMA 4MGKE 1H6YA 2A7AA 4FTSA 5DAXA 3QBQA 5A3UA 5HCFA 1DGRA 1MZ6A 3NJZA 4O61A 4YW6A 4UW5A 3SH5A 3VHNA 2WN3A 3H7JA 4QWNA 5A7NA 5A6ZA 3OYWA 3X29B 4D7SA 1XBFA 3ATGA 3HMYA 3ON7A 4XW3A 2EIEA 1X9TA 3LA7A 4QKDA 4XUTA 5FP4A 1W39A 2HWB2 2YGLA 2D3PA 1YRZA 4OQ9A 1C4RA 1XNCA 1ZX5A 4FOWA 1F4AA 5F39A 4CDUC 1WW7A 4FPKA 2BNOA 4GKXA 1W8HA 5IAXA 3GF6A 4BK5A 1OUSA 3CJXA 4AL9A 1V00A 4QGNA 2P6CA 3CLPA 1TMF2 1QWRA 5C3SA 2QQLA 2VMCA 3JXSA 5EZWA 5FO9B 2HEYF 4I0BA 3N9MA 2Q8EA 3KWVA 4XF0A 1EY2A 4GXLA 5C8CA 1DGLA 4XTMA 4R9AA 5BNNB 1PNGA 3POEA 1ND3B 2JE8A 4OUSA 4KG0A 4UFIA 1EPZA 2XWJB 4Q1RA 2UU8A 1PVC3 4IE0A 5DUWA 1VE0A 4OI4A 1YFUA 3ILNA 3KQRA 1WLWA 5F37A 1UO9A 2CL2A 4XFGA 3Q8CA 1YFYA 3I3QA 5GALA 3VBRB 1HXS3 2IFWA 3G7DA 4UF0A 1FATA 1C8NA 4XABA 4L2NA 4RGAA 2ZOEB 5CU1A 1MZ5A 1AR71 2IXCA 4FI9A 4YW3A 1O5UA 4S2HA 3DUIA 5K0UC 3ZKUA 3GJAA 1PZ8A 3ITQA 4B4PA 2EVXA 2JIJA 2ZGQA 1CJPA 4F83A 4UBHA 1FMD1 2HWF2 3N9LA 1F35A 2CNAA 4Y26A 1LB2A 5A6YA 3BOWA 4MGYE 1RUG1 4HETA 1KFUL 5BNQA 4LBLA 1S1AA 2W92A 5CVRA 1GBGA 3NJXA 4AVSA 4CCEA 2ZEYA 3B94A 3CU7A 4BM8A 3VKMA 1HRI2 1RUI2 1W6QB 4R8HA 5FMDA 5FJKA 1YIPA 4N7UA 3JQWA 3U75A 5GLUA 2A6YA 5A70A 2CV6A 3I2JA 5C3RA 1W2TA 4PBPA 3FE5A 3S7IA 1HRV1 1W6MB 2FMYA 2K0GA 3IAPA 5DAVA 3EYPA 2HWC3 2JD4A 3SH3A 1LOGA 1G9DA 4QGMA 1VP6A 4EYUA 5IYYA 4LO7A 3O1SA 4URAA 3NJYA 3FHQA 5FYTA 1PIV1 3WQ1A 4ARYA 1CAUA 3ZXEA 2OUHA 5HI0A 2WZR1 1ST8A 1PZ7A 4CU6A 1QXJA 1V6NA 4XUQA 2XHNA 3U4SA 4L11A 2J1TA 3OPZA 2DU1A 1LODA 4XTPA 3MBWA 5EJ3A 5FPAA 3T2PA 4AXOA 3O1TA 2N7GA 4YVSC 4AK3A 5D2AA 2GDFA 1UY0A 2QTWB 3VHPA 2A6WA 3BU7A 4PI0A 1QQP3 2RDQA 1LRHA 2GMPA 1AX0A 4IV3B 3VD9A 1JZ8A 3I8TA 4XF9A 2NM1A 2ZEXA 1N3OA 4A3ZA 1JI6A 2QDRA 5A7QA 1UMHA 2AZ5A 2DCJA 1AYM3 2V72A 1NCRC 1ZBA2 1LHWA 3BTYA 1IS5A 2DCZA 1GQGA 1QH6A 5C3PA 1JYWA 3POSA 2VCMA 2WDBA 1LOEA 4HZFA 3VHOA 1J3RA 2PLV3 1HV1A 1SLIA 1E5IA 1DYOA 4KWLA 4ITCA 1W9WA 4O65A 2K9ZA 4YW7A 5C4WB 4CXXA 2EALA 3J4UH 4YGDA 5K9YA 2VZ3A 1TME3 4HG6B 3H1YA 4JQTA 4YGEA 4EQVA 5IK7A 5GZCA 4RS5B 5LASA 1V9U3 4HPKA 2C5DA 4Y20B 4CEYC 4M01A 5KHGA 1G9BA 5E6HA 3DV8A 5C8WA 3ZSJA 1VMFA 1REDA 1X7NA 3PMEA 1YXWA 1GKBA 3POYA 5EFUA 4DPNA 2XXZA 1PO21 3AKPA 5FY9A 3E6CC 2W0XA 1O5LA 1V6MA 2W1UA 3QH6A 5L9BA 2D93A 3B01A 2WO2A 2VMFA 3M7AA 1AR61 4ET7A 3WXPA 4N90A 3WP6A 5A80A 1QF3A 4XXAA 3J8F2 3JD72 3HNYM 4JQRA 2RDSA 1R093 1VBE3 2VECA 1DZRA 2YDEA 4UAPA 4AOCA 3PUHA 5JUVA 2BU9A 3J9SA 1JYVA 2D97A 1SDDB 2J1EA 2BRTA 3PVEA 3TEWA 3W5NA 1ZZBA 1RUJ3 5C70A 2CY6A 2YROA 3LAGA 4QB6A 3O0VA 4OHZA 5C9AC 5ERLA 1JZ6A 4EN9B 4NIAA 1QJY2 1PMIA 2NN8A 1JTZX 1QEXA 2WQ4A 4NRQA 1VAVA 5FK8A 4C0HA 4DY5A 3HBZA 4JKKA 3BGAA 1ZA7A 4IEYA 4UWDA 1B09A 4EN7B 2CSGA 1D4M2 1XE8A 3T4HB 4GB31 3O1PA 4P9WA 1VBA1 4Q4X1 1OA3A 4QM9A 4JCKA 2BERA 3N35A 4RSUA 5I8SA 1CZTA 1UOJA 3AP7A 2YYOA 4LR4A 1GZWB 1KXGA 4XVHA 2H6CA 1AR73 4S2DA 4GKYA 2Q1ZB 5FZ6A 4F7ZA 1GZCA 2I45A 5JPNB 3USSA 2W3JA 1LOFA 3MFAA 4XDPA 1N1TA 2WIIB 2NQYA 4WM7A 1TE1B 5ANNA 1I3HA 2A71A 1I5ZA 2F6BA 4HMZA 2PMWB 4CEYA 3WUDA 2JIGA 4Q4W2 3D0JA 3I54A 5FXZA 1W6PB 5BPXA 5CZKA 1UY3A 1RUG3 2HWB1 4LKEA 1S2KA 4IESA 3UGGA 1D2SA 4LBOA 1OF3A 1GUIA 1XNKA 2XJRA 1O8SA 2BZDA 3SQOA 4PI2A 4EN8B 4IETA 4HVQA 3FBYA 4AEDB 5IVVA 1G6NA 2F4PA 3BYWA 3FHAA 1TQ5A 2R1DA 3VDBA 4SBVA 4MADA 1TMF1 2ORXA 1J83A 4X8PA 5T54A 1UYZA 3VD5A 1HRV3 4LA2A 2DDUA 4QQLA 3VBFC 2VE1A 5JI7A 2JDPA 4CP0A 2XJVA 2DCTA 4K1YA 3KT4A 1CVNA 3OG2A 3PU8A 2VZSA 2XL7A 4LBNA 1T6BX 1G9AA 4FOYA 4K8RB 4H7MA 2MPFA 1O3TA 3WNMA 2A70A 3PJYA 1W8ZA 2WZR3 5FZGA 5LBEA 4J1XA 4NIDA 2GN3A 5FKBA 1X82A 2WSUA 2VZPA 2ZAHA 4MSVA 1OKOA 2JG9C 1K5JA 3ACIA 3T4VA 4OZOA 3GZTB 2JG8B 3AXEA 5GLZA 4KI5M 3T09A 4B1LA 2QQPA 4CP9A 3OSDA 3GDBA 1OC1A 2GNTA 1XXNA 3M1HA 3NNJA 3AJZA 2HWF1 1W2UA 2O1QA 2NZ9A 2I74A 3HOBA 5IVEA 1BQPA 1VMJA 4PLOA 4YZ4A 5HCBA 4CCKA 4FPLA 3ZFEC 4NN0A 4QXCA 4RL7A 4UBGA 1LNSA 2XBO2 5DQ0A 2CAVA 2ZX3A 3RDIA 4ASLA 4DUWA 3ELNA 4TLFA 2Y6KA 1JU4A 2HWD2 3ILRA 2R062 5FYIA 2C24A 2V5YA 5A3PA 1UXZA 1XYPA 2JEMA 4LITA 5FZLA 4V1PA 1F5JA 1HRI1 1RUI1 2OQ7A 1JZ7A 2E51A 3RMXA 5TSWA 2XONA 4XUNA 3T2TA 1OA2A 5JOZA 3RS6A 3VDAA 5FBZA 1CAXB 3VBSA 1MEC2 1QY4A 1RUH2 2P1BA 2I2SA 1U5YA 3CHXA 4XFFA 4XFAA 3I49A 2VW0A 4L8QA 3SH4A 1PO23 2P2KA 3IKWA 3HBKA 4GULA 4AW7A 1K42A 2YFUA 1QNYA 5FO7B 1CD3G 3VDCA 3I2IA 1VB2A 3CO2A 2R0HA 1HN0A 2KM2A 3A22A 3IIAA 2VCBA 4HLTA 4Q8LA 1IS4A 3SXWA 1C3HA 2ENRA 4IL7A 3HQUA 1RITA 2ES3A 1BMV2 1AJOA 1UY4A 3B02A 4JGZA 3OGRA 4LE3A 1UAIA 2BUKA 2ZGTA 1JYXA 2R30A 2VCAA 4LO8A 3Q8FA 4LORA 3OB8A 5FK7A 3AM2A 4W6WA 1ZBA1 3VD7A 5DG1A 3USUA 3WDVA 2LRPA 1HQLA 4MXWB 3JQXA 3WSOA 3GBFA 4XJ9A 4CDXA 3ZXLA 1ND3A 3VBOC 2V73A 4GB33 3SKJE 3VZNA 3DYOA 4CDQB 4EN6B 1VBA3 1L7LA 5JWPA 1UY2A 3ZXFA 4IEOA 3S5AA 1FOD2 4WVMB 3VZOA 2UURA 5EHDA 5IK4A 2Y38A 3Q8BA 4XE9A 1YQCA 5GM0A 4KBBA 3VBRA 2VZ1A 1MVQA 3OD4A 3BI3A 1GP6A 2WYFA 2ZX2A 3HR9A 3U11A 3C2UA 2YC4A 4A42A 2PHWA 4I3GA 1S2BA 5FZ8A 1YYNA 2OPKA 1LR5A 1L7RA 3DECA 3IMMA 4QDQA 5K4LA 4QPIA 2VULA 1W06A 1JXNA 2D3SA 4XMIA 5H9PA 3I97A 1JOBA 1WW5A 2PHTA 5FZEA 2HWB3 3MW3A 1KJRA 3PUAA 1E5RA 1UYXA 4AQSA 1RB8G 5D8AC 2E7TA 2UWAA 4ISQA 4U2AA 2FZ1A 1DQ6A 2GC0A 2ZZQA 3J8F1 1NT0A 2E7AA 2Y64A 3JD71 3LF7A 3P3PA 4XFHA 1W0PA 4XUPA 2JDUA 1NXD1 5JMCA 3EJKA 4WM8C 5C8CB 2BV4A 2XWBB 1TMF3 3OUHA 5FPXA 2WN2A 3ZVXA 4XUOA 4DEQA 4Z1VA 2DYCA 4JRLA 3RQ0A 1QJY1 3N9QA 3QACA 1D0GA 1UU5A 1VBC2 2HWC2 2E31A 2VZUA 5IK5A 2WNUC 3B9IA 4LHKA 2WA3A 3P6BA 1AX1A 1WZXA 1D4M1 2D7FA 3MUY1 1X33A 3SCGA 4Y4YA 4MG2A 1ZRRA 2A3WA 2ZGLA 2XL9A 4UF0B 4CVUA 2X29A 4Q2FA 1QOSA 1PGL2 5CFDC 2A6ZA 2DVFA 1RGSA 2VTFA 2R042 3EO6A 3WW2A 3RZZA 2ZKNA 2CDPA 3SLIA 3LPFA 4WBBA 4KQ7A 3DEMA 4NHKA 2VUJA 3NV3A 2WS92 4AG4A 4JHTA 2ARXA 4OHVA 3L2HA 2FBEA 5CFCC 4N43C 2YGMA 1AXKA 4CEWC 3B9CA 2HWF3 5FPLA 5JSPA 1REEA 3U07A 4Q4W1 4NPRA 3MYXA 4P5HA 3DN7A 2B5HA 2FDFA 4X6RB 1EV12 1GMMA 4M3CF 5EP9A 3UESA 3OBAA 1SHWB 1W9SA 5DDJ3 2E53A 3WF0A 2B9UA 1T6GC 3UL2A 4ZZ8A 1JODA 1X8MA 2VBBA 1A8MA 1W99A 3AL6A 1OA4A 3PUSA 1VLNA 5F5QA 3PIGA 4A7YA 1RUI3 1CX4A 3MHZA 1G9FA 1UW8A 1HB4A 2EICA 2AYHA 4XURA 1M06G 4C8DA 3A4UA 4A41A 5DZEA 1NY72 1ZNPA 3OUIA 3PIJA 2WT2A 4AQTA 2XOMA 5IT6A 3HEIA 1JHNA 3WZ1A 5CNAA 4QX1A 5CKMA 1UYPA 2J7MA 4EWEA 1RYYA 2XJUA 2YV8A 3VB9A 1JZ4A 2A6VA 3W21A 4KBZA 2VZOA 1RJ8A 3EB7A 1CAUB 2J1AA 1W03A 4UOJA 1O4TA 3PTRB 4KNCA 2JECA 3WDUA 2D6PA 3L2YA 3RPQA 4BZ4A 2PHFA 5FZ4A 2PHRA 2ZHKA 4FBFA 3UGHA 1JBCA 4FXKB 2OQ6A 4YZ5A 1STMA 3OD0A 4DXZA 2QZ3A 1BBT2 1WMXA 4XF3A 1W9YA 1R092 1VBE2 2DUPA 3R0RA 1IPJA 5GKAC 3VBUC 4HL0A 3LDKA 3DYMA 1RUJ2 2W9XA 3MIDA 2BGCA 4TWTA 5FY5A 4PIYA 5JSOA 3W9AA 1CIWA 1ZBA3 1SCSA 5LRRA 2XBO1 4E4HA 1W8TA 2H0VA 4IGQA 2W47A 3OGJA 2XKOA 4J25A 4XJZA 1RINA 4COWA 2HWD1 2VOVA 4M3CA 2R061 3SCFA 4E2QA 2A3YA 2OVUA 4M0NA 1K3IA 3OY8A 4QPGA 3JUUA 1UU4A 3N7JA 5IVCA 3CBNA 3N7LA 5FOBB 4TXWA 4TZDA 4HPKB 5LWBA 3ORJA 3LE0A 4I09A 5EYYA 2Z5WA 4FFFA 5LB6A 1VJ2A 3MLLA 5ABJB 1KDKA 4F3JA 1MEC1 5I8YA 1HV0A 3RZGA 1RUH1 4ZY9A 4Y5Z0 1DIWA 3WVJA 1XU2A 1VR3A 1UKGA 1AXYA 2BPA2 1IPKA 4JX0A 4I30A 1JMUB 4WVVA 4CPBD 2W87A 3DYPA 4Y1YA 1MS3A 1QJU2 2X53S 2QQNA 3UETA 4D6QA 3SITA 1RUC2 1J3PA 2NMOA 2XJSA 4FPJA 1GWKA 1P8JA 1DCSA 3H3LA 4J6GA 1WWYA 4CDWA 4DRRA 1LAJA 1W6PA 3BTAA 2JX9A 4MHRA 5C7GA 1NXMA 5J3UA 3I4IA 4GWJA 1H9PA 1N3PA 3F95A 1SLBA 4LLFA 4XQWA 1WW6A 2BTVC 2A5ZA 2W2IA 3HAGA 4Q27A 4D3WA 1BMV1 1OMIA 4META 2DTWA 3VKLA 2IXKA 2X09A 3O5SA 5L9RA 1LHVA 2WR9A 1QJY3 1REFA 2V09A 4XQDA 1E5HA 1OI6A 3AJYA 4TLGA 4CU8A 3O1RA 1ULCA 3RWKX 5A3MA 3SKVA 1W9FA 5F3GA 3RGBA 3KF5A 1C8M2 1H9WA 2HYKA 4KWUA 5AFBA 5I0DA 4OHWA 4XBQA 1XNAA 1IG0A 4OI1A 3IMNA 2V4AA 3WDYA 4LO5B 1FOD1 1K12A 2C9AA 4N53C 1OLME 2VZVA 4LXLA 3ZXJA 4Z92B 1W90A 2G1MA 3NVCA 2DVDA 3L9JT 4ZXKA 4DXRA 3T1LA 4B7EA 2YU2A 1QHDA 1LGCA 5F7UA 4P9JA 3VBOB 2O8OA 2Y60A 3SISA 3MI8A 1LHNA 1UIJA 2P17A 2YPDA 3VKNA 1V70A 4D7YA 1YQ2A 1XPWA 2XVGA 4RR3C 4AGGA 1NQJA 2LW8A 1IHMA 1KS5A 2VD7A 4YWAA 2VOXA 4YZ1A 5KHIA 1RVF2 3E5UA 2E33A 1RHI2 2VQTA 4JDOA 4S2FA 1SLLA 5K0UA 4HK8A 3VBHC 4HKOA 3A0NA 3VUOA 4QGLA 5LY1A 1WCUA 3BKZA 1LU2A 5I0TA 4GD4A 3AYCA 2AUYA 2D5HA 3LZZA 1AVBA 2RS12 2WC2A 4IQPA 1GOFA 3ZIWA 4Y24A 3S57A 1YI7A 2DU0A 1VBC1 4B4RA 1GQHA 2R16A 2HWC1 2C4XA 3U4XA 1OBNA 1YQ5A 2DFCA 3B69A 4CUGA 1GFF2 5JOWA 4P14A 4FPYA 1AL0G 2B39A 2NYYA 3N9OA 3FWEA 3WF1A 1PGL1 1TG7A 4WV8A 1XNDA 4YZ2A 4CUCA 1H2LA 4BIOA 5FPZA 1OPMA 1R082 2R041 4N7IA 1Y43B 2ZX0A 4I01A 3T0AA 4CZSA 3LEKA 3SC7X 2YMZA 2Y6GA 4Y1UA 3ZM8A 1LOAA 2WS91 3RG0A 1JZ5A 2ZGKA 1IS6A 4B4QA 5IATA 3POBA 3LWCA 1VB4A 5LA9A 4YPJA 2YC2A 4AF9A 3UKNA 2EA7A 3TEXA 1D4VB 4FFGA 4EWAA 2VMEA 4AI8A 1EV11 2DVGA 2YY1A 2GZWA 4PLMA 4YM0A 3NKGA 1RUNA 2DTYA 1NG0A 2XBO3 4MGQA 3RVHA 3WP4A 1O7FA 1QU0A 2ORZA 3AYAA 5IUQA 4D0QA 4YVSA 1W8FA 2HWD3 1CWPA 3B7MA 2R063 2VZTA 4K1ZA 2P3JA 4YSFA 1XSQA 2NPIA 3PVBB 3W58A 1HX6A 4IEZA 2VOWA 1KFXL 2AH2A 4XJ8A 5LA2A 1XOYA 2K46A 1NY71 4JC1A 4FP3A 3R4DB 5I8TA 2W52A 3WHUA 4D6SA 4JGYC 1NCRA 3AKSA 5JLVA 5FO8B 1AR92 1RUH3 3D82A 2AC1A 3LGRA 4BJ0A 1IZ3A 4Z2WA 1UPSA 5LATA 1CIYA 2FD8A 1Q8QA 4HBNA 3D8CA 1O3SA 2VY0A 1LECA 1DQ1A 4QX7A 5FZHA 4DINB 1DFQA 2JJ6A 5FZIA 3ZFGC 5GZFA 4AFCA 4OLLA 3KCCA 4YNIA 5LBFA 2JKXA 3C7EA 1S0IA 3RJ2X 1NA1C 5E8AA 4Y1ZA 3RZKA 2QQVA 2UWCA 2XUMA 1BBT1 3AL5A 4XAEA 4UFHA 5LY2A 3BPSA 3WCRA 4JGZB 4JZRA 1R091 1VBE1 4IW3A 4YRDA 2OYZA 4ATFA 4BXFA 4HANA 2HWE2 4HN1A 4XQ4A 3I59A 4JKMA 4LMFA 4QXHA 3WF2A 1RUJ1 1CR7A 1W2OA 2IXJA 3ZKYA 4FVVA 4B7KA 3USUB 2Y34A 2AACA 5JOYA 2WA4A 3LSEA 4CDXB 1GANA 2E9QA 3GCWA 3ZN5A 4D7TA 2ZGOA 4QAWA 1PHMA 4FOQA 1H30A 4PDWC 1VBB2 4LKFA 3MV01 1NQDA 4ASMB 1EUUA 5JVVA 4ZPIA 3WDTA 3QCWA 3ZYGA 4BQYA 4COYA 2BVVA 1FOD3 1DGWA 3KV6A 3LDBA 1GWLA 3AVRA 4EV0A 5C9AA 4Q4V2 3H8RA 4A7ZA 5A1AA 2B42B 3AKTA 4I0WB 5LK7B 3ACFA 2JDMA 3GYDA 3GBWA 1XQNA 3KV5A 1W2AX 4QHOA 5C71A 1ZBE2 2VNGA 4OI2A 2QNKA 1LEMA 2BP6A 4QPIB 5K8SA 4WZCA 1KQRA 1O59A 2KR2A 2WFF2 1U5XA 3MLJA 3VL8A 3ZSKA 1HB1A 4XFBA 2IXHA 1QJU1 4XIOA 3S0MA 1WUVA 1UXXX 2EIBA 5GLVA 1RUC1 3V65A 2RE9A 4AFDA 2XLGA 1MR5A 1GNZA 3MPBA 4XYXA 2FZ2A 2QQWA 4R9BA 5DDJ2 3VZJA 3AP4A 3KMHA 5H9SA 2QVSB 4A4AA 3BTZA 4COZA 4EZHA 5H9RA 1UZ0A 4OI0A 4BQ4A 2JD9A 1YLLA 3NMBA 1ZRIA 3NNLA 3PLQA 1CONA 4QU1A 1A3KA 3ZYHA 1Q56A 2BBAA 1VBC3 3UT0A 5EYXA 3VD4A 3ZIXA 3TEZA 1ZREA 4HVOA 1OQDA 3NQHA 4QQOA 2P6HA 4XHXA 4D6RA 1DZQA 4QM8A 1ENQA 1C8M1 2J1UA 3O1MA 1U12A 1A6CA 1YUDA 2E32A 4LBQD 4Y5TA 5AVPA 1UOGA 5FZAA 1ZZ7A 4JHZA 3T0DA 4YLZA 3O0WA 1TNFA 5F9TA 4P9GA 5FZ9A 2GMMA 2R043 1IG3A 1SPPB 2CDOA 3O12A 3RFRA 2VBPA 3NW4A 4Q8KA 2ZMKA 2WS93 3M8LA 1KITA 4NHMA 3MGUA 1MS1A 2VW1A 3E6DA 1JYNA 2GH2A 1JS9A 1BCXA 4XILA 3VGIA 4IV1C 1NLSA 2B7YA 1EV13 2WNVC 2WWJA 4IEPA 1DYPA 4XF1A 4RFT0 4AAPA 4ZZ5A 5M0TA 2JG9A 4Z8BA 4GWIA 1LTEA 2WWUA 1RVF1 1RHI1 3A7QA 1SACA 4DOUA 4BIFA 4UW6A 2XH6A 3WINE 1HQNA 1HDKA 2AR6A 3NRUA 1AJKA 4RQPC 5FPBA 3ACHA 1PNFA 2RS11 4BOWA 3DXTA 4XZPA 1GWMA 3POFA 4LBKA 3ZFEA 3KHBA 3N4MA 1W9TA 1KJLA 4GAZA 5KR7A 5FMOS 1LCLA 1UMZA 5JZGC 1O8PA 4M4PA 3TOJA 3KV9A 2JXAA 3ZDVA 2FQPA 4CCMA 5DABA 2GH8A 1GZ9A 5G04L 2AEZA 1XRUA 3C3VA 4AHZA 4E4SA 5KBFA 3N36A 5LEKA 4ARXA 4PCRA 2UYBA 4GMP1 4CCLA 1R081 1RUD2 1W2NA 1W3XA 4BYYA 1BBT3 3LSDA 2XLAA 5FOJB 2W94A 3AP5A 4NRPA 4OFGA 2UYAA 2PHDA 1RUF2 1QOTA 2E26A 1JUIA 3WG3A 2D6OX 2VQAA 3GZUC 4XC9A 1VAKA 5CADA 4U36A 2Y8KA 2QQKA 2WL1A 4UYBA 1IS3A 2PHXA 2J1VA 2IVIB 4GWMA 4FO9A 3AC0A 5FP9A 1QJX3 5EXOA 3WNXA 3ZOIA 3THDA 5FUNA 4XJAA 2NLRA 4M3CB 3ZN4A 5GLWA 2Q8CA 2W91A 4CCNA 4HKLA 4P9IA 4DB5A 4YVWC 3TB0A 3OY8B 1NCQC 4INDA 4MUVA 4KGQA 4QPGB 2ZJCA 3Q8AA 2ZXQA 2OT7A 4UW4A 1A8DA 3GZAA 1DQ2A 1L7QA 5JAXA 1O6UA 4WVWA 3ALQA 3OBTA 4OHXA 2DUQA 2W1QA 3N9PA 2P4EA 2GC3A 4PF5A 5A33A 5C5UA 4AZZA 2XDVA 1AR91 2ETEA 3IBMA 1RTVA 2D44A 3ES1A 1F4HA 1KS4A 1PZ9A 1K45A 4E8DA 3VBOA 2WINB 3R6SA 2RG4A 1QJU3 3H50A 4IEUA 4CDWB 4V2VA 5HV0A 5I0UA 4CYDA 1RUC3 4JGYB 5CKQA 2PN5A 4HSJA 1PM7A 5JSRA 3FUQA 4QMAA 3KZ4C 4AQ6A 1NLRA 3KF3A 1QH7A 4ASKA 1PK6C 3POIA 1BZWA 4R4ZA 3KS7A 1LULA 5FY0A 3WLUA 4GIQA 3ZFGB 2ZGRA 1QOOA 2HWE1 1E57A 1KDMA 4CP1A 3B3QE 3CEWA 3LIHA 4AFMA 1NA1B 4W50A 1WLDA 3IB3A 4CDUB 3O1VA 1UN1A 1GR3A 4NHXA 2R6QA 4V2WA 3BN6A 1V6IA 5D8AA 1FV3A 2Z79A 4YM2A 1CZSA 5E1RA 5FYUA 5LW9A 1C8M3 4AAXA 3RZHA 3I3MA 1VBB1 1ZRCA 4WM8A 5FUPA 4QX3A 3PJQA 4UT5A 3CZUA 3TN92 5IFTA 3VDDC 3SHRA 2OXBA 3GGLA 3LFIA 3I2KA 4Q4V1 4URTA 2CGPA 1SQ4A 5FYZA 2VW2A 3K51A 5FFOC 2JDNA 5FQ0A 3A21A 2GC2A 1WMEA 2WNUA 1ZBE1 4AE2A 1LOCA 2XVLA 3DPRC 2EF6A 5ANQA 2WFF1 4COVA 3IWZA 2IZWA 5FYHA 1R1ZA 1F2NA 3HN1A 3NAPC 5CFDA 4RA0A 1F31A 1Y3TA 2CU5A 2CWSA 2D6KA 2OIIA 3LEMA 4Q0UA 3BU0A 5GJ6A 3MEPA 1OFNA 5CBLA 3CQOA 1BYHA 2TNFA 1RVF3 5DDJ1 5K0UB 1RHI3 1JYTA 1SLTA 2P3KA 2KXLA 4I3PA 5CFCA 1S0CA 1SDWA 2G19A 4N43A 2R072 3V0AA 1FT9A 1SZBA 1GQPA 1H8TC 2ZMLA 4CEWA 4Z07A 3ENRA 4A6SA 2RV9A 5F5CA 2RS13 4MV2A 4CU9A 5DXDA 3UJQA 3NSTA 2WT1A 2IUWA 2V4VA 4LK7A 3WEZA 2IFRA 1GSLA 1R1A2 1W8NA 5BNPC 5FMOL 3WOGA 5FAXA 5BNOC 3KM5A 1M4WA 2PAMA 2Y0OA 2HYXA 3PTYA 3UYJA 1KD7A 3T0BA 3BALA 1ND2C 4AVTA 4FT8A 4RGGA 2LROA 3IPVA 2HBTA 4GMP3 3VD3A 3MFCA 4YFWA 1EAH2 1R083 1N1SA 5FZMA 3D0SA 1QDOA 1B35C 2BOJA 2F17A 3WT3A 5IHRA 2ZGMA 3K4DA 2HLEA 1MVEA 1QNWA 2RR13 4QPYA 2O14A 5FY8A 5DUXA 4ZKTB 1WMFA 3ZXKA 2JDZA 5L9VA 5KXEA 4MGIE 5DN2A 1VALA 1NZCA 4YVSB 3OTFA 5L7OC 3OBZA 5KXCA 3TBDA 1I6XA 2ATFA 3B93A 1MPXA 4RYDA 3CJIC 1S2EA 3ETPA 2YBPA 3H0OA 4Q29A 3ZR6A 2XLFA 1XSRA 4HONA 3VBUA 5JXHA 1FYUA 2QFEA 4BXSV 1D7PM 1NCRB 1W04A 2DCKA 1FNZA 2OPWA 1UF2C 3ZR5A 1W05A 2CYFA 2CWMA 3ROUA 1GZTA 2H0BA 2VU9A 1AR93 4XIKA 3AYDA 4LHLA 3P5BA 4XBNA 1V0AA 1UCXA 2OW4A 3LDRA 1IOAA 2HH9A 2XGXA 1YEWA 4BQXA 2SBAA 5FUIA 3ZPYA 1EP0A 1H2MA 1VRH2 2YUEA 5F2WA 4YM3A 5IVFA 1OT5A 1YJKA 2Q4SA 2VOKA 3P1IA 4K21A 4A44A 1GU3A 4WM7C 4L0PA 4OUMA 3U10A 3MDPA 2VPVA 1C1LA 4MYEA 2D6NA 4CEYB 2EXKA 1RUD1 5JDBA 2Y6FA 1X8EA 3OBRA 1K5MC 1UY1A 4C0BA 1YNAA 3BB6A 3I59B 4DEVA 2OS2A 3TYJA 3I2DA 1GP4A 1RUF1 1V6KA 4XJUA 1QIQA 2HWE3 2VZRA 5DZFA 3RSJA 4AEJA 1YWKA 4DMIA 4QKNA 3EMRA 1WA6X 1UQXA 1H8VA 2WLPA 4LA3A 2OA2A 4S2GA 4UFJA 5HPOA 4MH0E 1AYN2 3M3OA 2RMU3 4FPFA 3ES4A 1MQTC 2Z42A 4E8CA 4YW1A 4FSJA 2JDAA 2VH9A 5FYBA 5FYVA 3ZN6A 4XCBA 3E5XA 1LENA 2VQUA 2WFPA 3KGZA 1RUE3 1VBB3 3MICA 3KLSA 3VV1A 5C9AB 3OGGA 1CJDA 4IEWA 5AC92 2WLQA 4GH4C 4IGOA 4Y5SA 2BVBA 4O7XA 4Q4V3 3WUCA 4B1MA 5BY5A 4KH9A 3IT8A 4AHXA 1NCQB 3NV2A 3D6EA 2A6XA 1O4YA 2D3RA 4AEMA 4XAAA 5FTTC 1KGYA 1UIKA 4UFKA 1ZBE3 3ZMOA 3LA3A 4MO3M 3ABZA 1WCKA 1NOVA 2IXLA 1SPPA 4LO6B 2WFF3 1UD1A 3GALA 3N9NA 2CGOA 5CEHA 3T1MA 5KHHA 2D6LX 2P34A 2ZGNA 3OGSA 3ZFFC 4UXAA 4WZFA 3OUJA 4N53A 4BA6A 1G8WA 3DKQA 4Y33A 3MIEA 5FP3A 2YB7A 2J1SA 4NPLA 3TRSB 3WG2A 5A32A 2R7EB 2UY9A 4IE6A 3LQCA 4TN7A 1A34A 1HN1A 4O9GA 4RHV2 3HWJA 5JR2A 4LE4A 1COV2 2QQOA 3WQ7A 1HKDA 3WNLA 4DXTA 5AVAA 4LOTA 5KC6A 4RR3A 3BCWA 1HQWA 1Q8VA 3H8UA 4BMBA 2WZEA 1UZWA 2VUDA 4XXPA 3POJA 5E16A 1YQ6A 3SEEA 3MLKA 1CAVA 3K46A 4NWWA 1GOHA 4MX3A 1RXFA 4IEVA 4QKFA 5FBJA 3R4SA 2ET1A 1GLHA 3UKVA 3ASIA 2W5FA 3VBHA 1JN2P 4B3NA 2YZ4A 3KT7A 1UZYA 2D98A 2QKDA 3VBFB 1IPSA 3TN91 5IJRA 4IEQA 1FV2A 4JV4A 3ZX7A 4Z82A 4DQAA 5GZDA 4AYUA 1DQ4A 2FDJA 4C91A 2ZPXA 3AX4A 1UZVA 2ZS6B 3R05A 3SNMA 4M4RA 1ZZ6A 3O1UA 1ULPA 4YG6A 4AI3A 4Y1XA 3IDAA 3OCPA 1NLQA 1Y7BA 2JG9B 1EUTA 3J7LA 1N47A 1QJX2 5JR7B 4QB1A 1ZYBA 2X5IC 5ISLA 1JYIA 3WG1A 3KSCA 4DNYA 1GYKA 4NE9A 5D21A 4KWKA 2VL4A 3AKRA 2XJPA 4PQ9A 4MZUA 2R071 5IVJA 5GLTA 4E4ZA 5FZFA 3B5LB 4K3UA 2KD7A 5BNNC 4JDNA 3ZFEB 4JVAA 1AZDA 1TNRA 4OCTA 2RJKA 4PQQA 1AXZA 1VRBA 2QQJA 3GZEA 4IXLA 4DZGA 3FLTA 3LA2A 5JXJA 1VMHA 1BKZA 3K2OA 4N9HA 3S5QA 1D2QA 1R1A1 1DYKA 2GALA 3VKOA 2LTNA 4ZS3A 2AGSA 5FMCA 3ZYPA 3ME2A 2Q1FA 3C8XA 3M3IA 1G7YA 2PHUA 5GZGA 5JIUA 4GJYA 1XE7A 1QXPA 4PBOA 1AL22 2E7QA 2RJLA 4NROA 3N3HA 1SBFA 5IW0A 4YG0A 2QQIA 1EAH1 1RUD3 1W6OA 4QXKA 4XJWA 1Y9GA 1UL9A 4JGYA 1JZ3A 1CESA 4CCOA 4MOAA 5FXVA 2G4IA 1RUF3 1POV0 3AZWA 1V6OA 4DO0A 3KCYA 5C3QA 1SMVA 4AGVA 1NX9A 2Q5TA 3ZFGA 3N7MA 2Q8OA 2ZTNA 5F8PA 3RI9A 2PA7A 2OZJA 4QX8A 4Q0SA 1ALYA 1NA1A 2ADDA 4BISA 3KB5A 4CDUA 5C5TA 2XQXA 3CL1A 1YFWA 3VL9A 4BMEA 3I3EA 1BXHA 5LCWL 4CA9A 5T5OA 3RJRA 2JB4A 3WY6A 1HW5A 5FLIA 4QHBA 3U14A
chains in the Genus database with same CATH topology
3AFKA 4FPCA 5A33B 1QGLA 3QLQA 2O8QA 3ZXAC 1A78A 3W59A 1RMU2 5HXVA 1MS4A 3KGLA 4PDWA 4ZU5A 1VRH1 3MIFA 4GQ7A 4LBMA 1WLTA 1C1FA 4MGZE 2ZHMA 4ORFA 2CGNA 4BH9A 4BE3A 4FOVA 5BXXA 4Q0QA 3AZVA 2MHFA 4IV3C 1Z0HA 1XYOA 1I1EA 5F6KA 4AVVA 4B29A 1MZFA 3WDXA 3PVNA 3FLRA 4KWJA 3LOBA 5D8AB 1AYN1 1C28A 3NL1A 4PIZA 1VBD2 1DQ0A 5I91A 3TWIA 4YG3A 4WM8B 5C4WC 2GU9A 4A7KA 2GC1A 4W6XA 3JCIA 3EHKA 2VVFA 5AC91 2AENA 4RS5C 5SV8A 3TN93 4A2UA 4PIXA 3V0BA 3URFA 4LBJA 5FQ0B 2WNEA 2WNUB 4AI1A 2JICA 4PLNA 4L9BA 1ZVFA 2RR12 3JBG2 4FAGA 4LLOA 4Y22A 5CFDB 4QD2A 3INAA 1LJ7A 4AHWA 5LEJA 1N1VA 5CFCB 4F8AA 5T50A 4N43B 3V0AB 4RHV1 1ULGA 1OKQA 2PYTA 1X50A 4HVRA 4CEWB 1COV1 3GNEA 2R073 2PAEA 5EV7A 2GMEA 2GSYA 1BK1A 3RYRA 2QE3A 3BPZA 4IV1A 2WNVA 1WD4A 2D6MA 4H14A 3MF9A 4YARA 2BYVE 2HKXA 3WW4A 2ZX1A 3ZYJB 1R1A3 4AFBA 1SBEA 2R0FA 2PTMA 2Z69A 3IPVB 1NE4A 1YI9A 1YHFA 4QT6A 1ULFA 1H4GA 2BFUS 4OVEA 4RQPA 5J98B 1EAH3 4Q4X2 1CAWB 4LT5A 1CPMA 2VNRA 4HFSA 5JZGA 3UK9A 3EXUA 1WCSA 1F5FA 1ZRFA 2VNOA 1DZTA 1ONAA 4K8FA 2NP0A 1ASJ2 2RS52 3ZSEA 1QJX1 3NV1A 2RMU2 2MEV3 1C5HA 1I9RA 4AEDC 4PJYA 4D94A 1DBNA 2RS32 3VBUB 3VKFC 1LOBA 3VZLA 5KXBA 3LKJA 1UPIA 4H55A 1RUE2 1BVP1 4COUA 3ZXGA 3S7EA 1ZZ9A 4FAHA 2X5IB 3AMPA 3JZVA 2BW8A 2XHKA 1W6NB 1FX5A 2PAKA 4YVWA 4YGBA 2Y26A 5J96B 1NCQA 3NV4A 1KRIA 1BEV3 1YO8A 2YHJA 3RYKA 1VRH3 3LCPA 2TEPA 1XYNA 4JRAA 1Q43A 2JG8C 5BYNA 1AL21 1Z78A 2LALA 3M3CA 4C1WA 5J37A 4ES9A 4CRQA 1J58A 1LEDA 5HCAA 3H3UA 1H0BA 2PFWA 5J09A 2C0ZA 1V6LA 4LEJA 3ZXDA 1URXA 2CTVA 3HD8B 1JH5A 1HLCA 1AYN3 3ZN6B 1OD5A 2QCSB 5HBAA 1S0GA 4KL1A 5KWRA 1YCIA 1V6JA 3A0KA 1PGW2 1PK6A 1J1TA 5LK5A 2C1FA 4YW5A 3DL3A 4WVZA 1ULDA 4LULA 2A75A 2HEVF 5AC93 1PGSA 3ZDSA 1GNHA 2GN7A 2RHPA 3SMHA 3ACLA 3VBFA 1J1LA 1ENXA 4AWDA 1D0HA 4K6BA 4P9YA 1RC6A 1RMU1 4FTEA 1PO12 1FXZA 2XG3A 3KT1A 4N53B 4EN0A 5A32B 2ERFA 3VDDA 3NWKA 1SLCA 1BVVA 2ZZJA 4RHV3 4W6YA 4QQPA 4NR1A 4AI0A 1COV3 4RR3B 1OOPC 2TBVA 3DPRA 1J59A 5IK8A 5J48A 1WW4A 3AP9A 1CAVB 4RD7A 3NAPA 3WD5A 3KCXA 5DUUA 3AXDA 5CG8A 1EPWA 1APNA 2RM22 4CDQC 1VBD1 2W39A 1F8VA 3RMYA 3VBHB 1JUHA 4Y1VA 3FX3A 2HEWF 1H1MA 1UU6A 3O0XA 4BLJA 1H8TA 3AK0A 2ZGUA 4E27A 2E63A 2BFUL 1Q8SA 1IKQA 1WBFA 3MIHA 3S6PA 5I0SA 3FZ3A 1OLRA 2XJTA 1Q8PA 5BNPA 2R49A 1SFYA 2WZPP 1ZZCA 5BNOA 2RR11 3JBG1 4AVCA 4M3CE 4Q4Y3 5T52A 3PMSA 1ND2A 4CP2A 1ULEA 1WGPA 3THTA 4EJRA 2WT0A 1B35A 3QOPA 2ZACA 3ZMNA 5C8CC 4HSLA 4X8NA 4LUMA 2FMDA 4XETA 4XBLA 1C57A 4H7LA 2GAUA 1FPN2 1ENRA 3BOPA 3AMQA 5C6CA 5L7OA 3BIWE 1PVXA 2WJSA 1AR82 4FXGB 1EYBA 5EWSA 2D5FA 2GNDA 2KA3A 2TUNA 1MZEA 4R9CA 3CJIA 4K20A 4FP2A 1VIWB 1AF9A 2BQPA 1Q3EA 3WV6A 3WW3A 1W6OB 1TEIA 1AL23 3NKTA 4GWNA 4QQHA 3MPPG 5SV5A 2ILMA 3WP5A 1G86A 1OSGA 5T5JA 3HIFA 1DU3D 2A3XA 3PHMA 4XFCA 3G6JB 5T55A 1JOJA 1MS9A 5I0RA 2B8MA 3ETQA 3FMGA 2EXJA 3GHNA 4J1WA 1ASJ1 2RS51 3QH7A 2RMU1 1FMD3 3H7YA 4DFSA 2WQZC 5DUVA 4ZU4A 1K5MA 1LGBA 2RS31 2OZ6A 5CA6A 3ILFA 1RUE1 3E6BA 2UY8A 4P9XA 1WBLA 3EQEA 1J3QA 4KU7A 3WQ0A 3PVOA 4Q1PA 1SEFA 5KXDA 3FFQA 1S0FA 3VZKA 4X6QB 1MQTA 1UZZA 4PDWB 1RMU3 3M4FA 2K2SA 1BJQA 1UKRA 1S0DA 4QQ2A 3I7DA 3MIGA 3Q9OA 1RUOA 4GH4A 2EIGA 4AVBA 5JOXA 1HIXA 1PIV3 3AZYA 3GHMA 1N3QA 2QDNA 1S0BA 2VG9A 4ONUA 4HKWA 1SLAA 2XKPA 4IERA 1POV1 4FQ4A 3ST7A 5T3NA 1O91A 3OF1A 3VN4A 4NO4A 4R9DA 2W08A 1RL3A 3E5QA 4XEZA 3ZFFA 4AI2A 2JE9A 4XOGA 3J26N 5KC5A 1VBD3 4IEXA 2OUJA 4K40A 1OQEA 3EBRA 5FREA 1PGW1 4JTNA 3FJSA 5L19A 1N1YA 1CN1A 2JE7A 2Q1MA 4LBQA 3ZYIB 3V0BB 2JKBA 4Q0VA 2EAAA 2EXHA 2VXRA 5ABJC 2DVAA 3CF6E 3H1WA 1DLLA 4OULA 3WR0A 1AHSA 3TAYA 4I2OA 1OLQA 1SFNA 4MLOA 3UV9A 1Z7S2 4Y22B 2ARBA 5ACA2 2ZX4A 3MF6A 1PO11 1CAWA 1AX2A 3JBG3 1CQ9A 2PHLA 3JB8A 4NHLA 3VLBB 3DGTA 3VZMA 2JENA 4CTEA 3JU9A 2MEV2 3LOIA 5KHJA 2VVDA 4YW2A 4ATEA 1DG6A 1AR63 4FTBA 4FQZA 4KGGA 4G4FA 4BLIA 1DF0A 5CG9A 3TNPB 4IV1B 4JAAA 2WNVB 2Q0AA 1YIFA 4E4DX 3UKTA 4P9LA 4AVAA 1IQAA 4I0AA 2RM21 2X5IA 1QXRA 2DCYA 2IXIA 3N7KA 3UJOA 2ZMNA 1OOPB 2XB6C 1S55A 3WDWA 3WG4A 1BEV2 1W6NA 2Z2SB 1QJZA 2PELA 4L97A 2XPJA 4RQPB 2P3IA 2ZHNA 3V56A 5BNNA 1LOFC 2G9FA 5F6LB 1GICA 5DZGA 1PVC2 5JI9A 4GALA 4AGRA 4Q4X3 4LHNA 1XU1A 1YFXA 2D43A 5JZGB 3DKWA 3IM0A 5FLJA 1HXS2 4E2SA 3FC0A 2XJQA 1CGPA 2W68A 3HQXA 1FNYA 3POWA 2DWRA 3RYPA 3ZSMA 1ASJ3 3OYWB 2RS53 4AFAA 4A3XA 3WP3A 2Y0IA 5A3LA 3ZO0B 2RS33 4K9SA 1U0AA 4FCAA 2CAUA 1WCDJ 5T5PA 4AEKA 3RWNA 2G9GA 3K48A 1X36A 1WMDA 4W65A 3MZHA 2A73B 1FPN1 1MS5A 2DFBA 3E97A 4YVWB 3MW4A 4OHYA 3FFZA 3R4UA 2IWGB 1W6QA 4ISRA 1AR81 5L73A 4XMAA 1Q8OA 5LRSA 2BBVA 4NWVA 1H1IA 4E2GA 1W6MA 4OZXA 1RIRA 2E6VA 1NE6A 4FPEA 5B2GB 2AREA 5BV6A 1MACA 2ZGSA 1GV9A 1OPOA 1Y9QA 1POV3 3LB9A 2ZABA 5D1IA 4GMP0 3B00A 3AZXA 3M3QA 2DF7A 1NYWA 3BODA 3M3EA 4MXVA 4EROA 4HN0A 1QQP2 5F1RA 4LO4B 3IDEA 1PK6B 5FLHA 1UX6A 4IV3A 1QDCA 3VBSC 3ZYRA 1AYM2 5CIRA 3HT2A 4BWOA 4DRVA 2P37A 5J7MA 2PLV2 5K7PA 1HRI3 2DURA 5FRAA 4Q0PA 5JCTA 1MS8A 1TME2 4NOTA 2VUAA 4YZ3A 1PO13 5C4WA 1XNBA 4L92A 4M0HA 1LB2A 3VDDB 1SBDA 1V9U2 1W0OA 3AFGA 4Q4Y2 1JW6A 5BUVA 2WKKA 3H3ZA 4RS5A 2VMGA 3FLPA 4JGZC 4Y20A 3WW1A 4KG8A 4MVTA 3DPRB 1OHFA 2H6BA 3GBGA 5L36A 4UW3A 3NAPB 2BWAA 2BWCA 4HK9A 1LHOA 2FZ2A 5AFEA 2BEOA 3IDBB 4CDXC 1O3RA 2ET7A 1H2KA 1ND3C 3FHIB 1U5IA 2UWBA 3HT1A 2RM23 4ZU7A 4XPVA 2QUOA 1H2NA 1RJ7A 1O4ZA 4XF4A 4YFZA 2R32A 1IKPA 3VBRC 1F9KA 1H8TB 4L99A 1WA4A 4G3YC 1L3JA 4ES8A 1FI2A 3D4KA 4M00A 3M2MA 4B8EA 4D69A 4GA9A 3FBMA 4QPIC 5E89A 5BNPB 5KHKA 4QX5A 5JPMB 5BNOB 1Z7S1 4BQ1A 1LESA 4XHBA 4BCUA 4DS0A 5ACA1 1S0EA 2EAKA 1Q5OA 1AR72 2YC0A 1ND2B 5JIAA 5DG2A 2VVEA 1GZWA 2B45X 1U5ZA 1ZRDA 1ENSA 2BNNA 3THPA 1B35B 3APBA 2MEV1 1FMD2 4AHYA 2ZHLA 2I07B 3TNQA 3JB4C 2DV9A 2O0OA 3SCHA 3U0ZA 1RUG2 2DUOA 4XDQA 3AYEA 4LUKA 3J8F3 3JD73 4YW4A 4EWDA 4K7JA 1S0JA 2ZGPA 2WSVA 3M70A 3O7OA 5L7OB 1FPN3 3VHRA 4DY3A 1ZA4A 3FUOA 4TYSA 3WX5A 4AEDA 3CJIB 1AR83 4LNVA 1DHKB 1HRV2 3RI8A 4KU8A 4BPZA 3WCSA 1BEV1 1WD3A 1YJLA 2B46X 1O3QA 3AB0A 3WHTA 4SLIA 2HJIA 1D4M3 1PVC1 2FHRA 1PIV2 3P3NA 3AMNA 2WZR2 5T5LA 4YYOA 4O9EA 4XFIA 1HXS1 4G9SB 2WWSA 2YXSA 3AP6A 4WM7B 4QU2A 3RNSA 3S30A 2JG8A 5CB7A 2ZA9A 5CAZA 3DF0A 1K5MB 5J36A 1LU1A 4E9KA 4Q4W3 1C5IA 1FAYA 3AKQA 2ZAAA 1ZZ8A 4BHPA 2SLIA 2PQQA 3NO8A 2GNBA 1MQTB 3CNAA 4TSVA 4YGCA 4YM1A 4Q26A 1AUYA 2D40A 4C1XA 4JTOA 5I93A 4JDMA 2Q30A 3PNAA 1SCRA 4GH4B 3H9AA 4I02A 1MS0A 1OFSA 2XVKA 3H1MA 1VAMA 2VMHA 1CAXA 2NMNA 3RRDA 2R1BA 1JYCA 3IDCB 1LKNA 1PO22 2VQ0A 1DGWX 1LHUA 1LGNA 1H4HA 2LM3A 4FPHA 5E88A 2VMIA 4R52A 1AR62 3MIBA 4NVPA 2MNGA 3ZFFB 1ZM1A 3AMMA 3MW2A 2QJVA 4FPOB 4R4XA 4AQ2A 2ZKLA 1G9CA 3O14A 1QQP1 4LTAA 4HT1T 4FPGA 4QPGC 1DDLA 2EXIA 2QZ2A 1DQ5A 5H9QA 1IGOA 2ZCWA 3IN9A 4LBQB 1CPNA 4N9IA 1DGRN 3ZSLA 1AYM1 1OOPA 3QD6A 1OQ1A 3OJBA 2IC1A 3ECQA 2PLV1 3AMHA 4MXWA 4GB32 3V64A 1H1AA 1VBA2 2LUWA 2YPJA 1QKQA 3AZZA 2ZBJA 3D5OA 4CDQA 5GZEA 3KD4A 1Z7S3 3VBSB 1QMJA 2X8KA 5ACA3 1TME1 4CDWC 4H3WA 4WVMA 5FCCA 2BNMA 2VGDA 1MEC3 5FDBA 2DVBA 1V9U1 1WLCA 4Q4Y1 2GNMA 4MGKE 2A7AA 4FTSA 3QBQA 5HCFA 1DGRA 1MZ6A 3NJZA 3SH5A 3VHNA 4UW5A 3H7JA 3OYWA 3X29B 4D7SA 3ATGA 3HMYA 4XW3A 3LA7A 1W39A 2HWB2 2YGLA 2D3PA 1YRZA 1C4RA 1XNCA 1ZX5A 4FOWA 4CDUC 1WW7A 4FPKA 2BNOA 4GKXA 3GF6A 3CJXA 1V00A 4QGNA 3CLPA 1TMF2 1QWRA 5EZWA 5FO9B 2HEYF 4I0BA 4XF0A 5C8CA 1EY2A 4GXLA 1DGLA 4XTMA 4R9AA 5BNNB 1PNGA 1ND3B 4OUSA 4KG0A 1EPZA 2XWJB 4Q1RA 2UU8A 1PVC3 5DUWA 4OI4A 1YFUA 3ILNA 3KQRA 1WLWA 2CL2A 4XFGA 5GALA 1YFYA 3VBRB 1HXS3 2IFWA 3G7DA 1FATA 1C8NA 4L2NA 4RGAA 2ZOEB 5CU1A 1MZ5A 1AR71 2IXCA 4YW3A 1O5UA 4S2HA 3DUIA 5K0UC 1PZ8A 4B4PA 2EVXA 2ZGQA 1CJPA 4F83A 4UBHA 1FMD1 2HWF2 2CNAA 4Y26A 3BOWA 4MGYE 1RUG1 4HETA 1KFUL 5BNQA 4LBLA 1S1AA 5CVRA 1GBGA 3B94A 3CU7A 4BM8A 3VKMA 1HRI2 1RUI2 1W6QB 4R8HA 1YIPA 4N7UA 3JQWA 5GLUA 2A6YA 2CV6A 4PBPA 3FE5A 3S7IA 1HRV1 1W6MB 2FMYA 2K0GA 2HWC3 2JD4A 3SH3A 1LOGA 1G9DA 4QGMA 1VP6A 4LO7A 1PIV1 3WQ1A 5HI0A 1CAUA 3ZXEA 2OUHA 2WZR1 1PZ7A 1QXJA 1V6NA 4L11A 3OPZA 4XTPA 2DU1A 1LODA 4AXOA 5EJ3A 2N7GA 4YVSC 4AK3A 2GDFA 3VHPA 2A6WA 3BU7A 1QQP3 1LRHA 2GMPA 1AX0A 4IV3B 3I8TA 4XF9A 2NM1A 1N3OA 2QDRA 2AZ5A 2DCJA 1AYM3 1NCRC 1ZBA2 1LHWA 1IS5A 2DCZA 1GQGA 1QH6A 3POSA 1LOEA 4HZFA 3VHOA 1J3RA 2PLV3 1HV1A 1SLIA 4KWLA 4ITCA 2K9ZA 5C4WB 2EALA 3J4UH 4YGDA 5K9YA 1TME3 3H1YA 4YGEA 5IK7A 5GZCA 4RS5B 1V9U3 4HPKA 2C5DA 4Y20B 4CEYC 4M01A 5KHGA 1G9BA 5C8WA 3DV8A 3ZSJA 5ABJA 1REDA 1X7NA 3PMEA 1YXWA 1GKBA 3POYA 5EFUA 4DPNA 1PO21 3AKPA 3E6CC 2W0XA 1O5LA 1V6MA 3QH6A 2D93A 3B01A 3M7AA 1AR61 3WXPA 4N90A 3WP6A 1QF3A 4XXAA 3J8F2 3JD72 4JQRA 1R093 1VBE3 2VECA 1DZRA 2YDEA 3J9SA 2D97A 3PVEA 1ZZBA 1RUJ3 2CY6A 2YROA 3LAGA 3O0VA 4OHZA 5C9AC 4EN9B 1QJY2 1PMIA 2NN8A 1JTZX 2WQ4A 4C0HA 4DY5A 1VAVA 3HBZA 4IEYA 1B09A 4EN7B 1D4M2 1XE8A 4GB31 4P9WA 1VBA1 4Q4X1 1OA3A 4QM9A 4JCKA 3N35A 4RSUA 5I8SA 3AP7A 4LR4A 2YYOA 1GZWB 1KXGA 2H6CA 1AR73 4S2DA 4GKYA 2Q1ZB 4F7ZA 1GZCA 2I45A 5JPNB 3USSA 1LOFA 3MFAA 2WIIB 1N1TA 2NQYA 4WM7A 1TE1B 1I3HA 2A71A 1I5ZA 2F6BA 4HMZA 3WUDA 4Q4W2 3D0JA 3I54A 1W6PB 5BPXA 1RUG3 2HWB1 1S2KA 4IESA 1D2SA 4LBOA 1XNKA 4EN8B 2XJRA 4HVQA 5LEKA 4IETA 3FBYA 4AEDB 1G6NA 2F4PA 1TQ5A 2R1DA 4SBVA 1TMF1 4X8PA 5T54A 1HRV3 4LA2A 4QQLA 3VBFC 5JI7A 4CP0A 2XJVA 2DCTA 4K1YA 3KT4A 1CVNA 2XL7A 4LBNA 1G9AA 4FOYA 4H7MA 2MPFA 1O3TA 2A70A 3PJYA 2WZR3 4J1XA 2GN3A 1X82A 2WSUA 2ZAHA 4MSVA 2JG9C 3GZTB 2JG8B 3AXEA 5GLZA 2QQPA 2GNTA 1XXNA 3M1HA 3AJZA 2HWF1 1W2UA 2O1QA 2NZ9A 2I74A 1BQPA 4PLOA 5HCBA 4YZ4A 4FPLA 3ZFEC 4NN0A 4RL7A 4UBGA 2XBO2 2CAVA 2ZX3A 3RDIA 4ASLA 3ELNA 4TLFA 2HWD2 3ILRA 2R062 2V5YA 1XYPA 2JEMA 4V1PA 1F5JA 1HRI1 1RUI1 2E51A 3RMXA 5TSWA 3T2TA 1OA2A 5JOZA 3RS6A 5FBZA 1CAXB 3VBSA 1MEC2 1QY4A 1RUH2 2I2SA 1U5YA 4XFFA 4XFAA 2VW0A 4L8QA 3SH4A 1PO23 2P2KA 3IKWA 4GULA 4AW7A 1QNYA 5FO7B 1CD3G 1VB2A 3CO2A 2R0HA 2KM2A 3IIAA 4Q8LA 4HLTA 3SXWA 1IS4A 1C3HA 2ENRA 4IL7A 1RITA 2ES3A 1BMV2 1AJOA 3B02A 4JGZA 4LE3A 1UAIA 2BUKA 2ZGTA 2R30A 4LO8A 3AM2A 4W6WA 1ZBA1 3WDVA 5DG1A 3USUA 1HQLA 4MXWB 3JQXA 3GBFA 4XJ9A 4CDXA 3ZXLA 1ND3A 3VBOC 2V73A 4GB33 3VZNA 4CDQB 4EN6B 1VBA3 5JWPA 3ZXFA 4IEOA 1FOD2 4WVMB 3VZOA 2UURA 5IK4A 2Y38A 4XE9A 5GM0A 4KBBA 3VBRA 1MVQA 3OD4A 2ZX2A 3U11A 3HR9A 3C2UA 2PHWA 4I3GA 1S2BA 1YYNA 2OPKA 1LR5A