2PA7A

Structure of wild-type dtdp-4-keto-6-deoxy-d-glucose-3,4-ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
ENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAHKKLEQVLVCLNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNFKKYIAKINLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray Structure of dTDP-4-Keto-6-deoxy-D-glucose-3,4-ketoisomerase.
pubmed doi rcsb
source organism Aneurinibacillus thermoaerophilus
molecule tags Isomerase
molecule keywords DTDP-6-deoxy-3,4-keto-hexulose isomerase
total genus 27
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 5.3.2.3: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2pa7A00
5KHGA 4IEYA 4IEUA 2XLFA 5KHKA 3VHRA 2IXLA 4MGKE 1EP0A 1CAVA 5CVRA 5LRRA 5E1RA 4O9GA 2UY8A 4XFFA 2PYTA 4J1XA 1RUOA 2XGXA 4OFGA 3NL1A 3DKWA 1QXJA 3JZVA 4QGLA 4I0BA 2PHLA 4HN0A 5AVPA 3IWZA 1LR5A 3PLQA 5JR7B 2PAMA 2Q4SA 4GULA 1Q3EA 3E6CC 3BPZA 2QNKA 3E5UA 3EBRA 3CO2A 4D7TA 1O3TA 3I7DA 4FT8A 2V09A 5JSRA 3EO6A 4MZUA 4TLFA 4YARA 1OFNA 2H6CA 3E6BA 4Z82A 2P17A 3DL3A 1OMIA 1XRUA 3CJXA 3RZZA 5FPXA 1EY2A 5FDBA 3KGZA 4JTOA 4AVCA 5FCCA 2QDRA 5BV6A 3I54A 4DINB 1ZVFA 4RD7A 3ACLA 3NW4A 1XE7A 3WW4A 1IPJA 2H6BA 3M70A 4IEVA 2E9QA 3USSA 1RGSA 3LZZA 1CX4A 4I02A 5BXXA 2OA2A 3SMHA 5CU1A 3ETQA 2CV6A 3HT2A 4OLLA 4XF0A 5JSOA 3KGLA 2GC3A 4META 1NYWA 4EV0A 3CLPA 3H7JA 5J48A 4LUKA 3ZDSA 3RDIA 2H0VA 4QM9A 2BNOA 2PAKA 1ZREA 1NZCA 2EAAA 4Q0SA 4QX5A 2IXJA 4QGNA 4MX3A 4MGYE 1VJ2A 4Z07A 4HBNA 1RTVA 1YFUA 4X6RB 3M3IA 4XF3A 2ET1A 2GZWA 4FAGA 2Q0AA 4HLTA 4KWLA 4XFCA 5BY5A 4AQ6A 1J1LA 1X8EA 3BU7A 1L3JA 4Q0QA 3E6DA 2MPFA 3IDBB 1FT9A 4MH0E 4UBGA 4LUMA 4R8HA 3ROUA 3D0SA 3MZHA 4WBBA 1FI2A 1NE4A 2PHDA 1TQ5A 3LA3A 4UBHA 4P9GA 2CAVA 4BHPA 4L2NA 3O14A 4HN1A 3SCGA 3H7YA 4IERA 2BEOA 3FJSA 2XLGA 3H50A 4XF4A 3U10A 3L2HA 2QJVA 1LRHA 3D0JA 5JSPA 1UIJA 1ZRRA 4HZFA 4XFHA 2HKXA 3ELNA 2CGPA 5LEJA 2XHKA 4ONUA 1J59A 3H8UA 5FQ0A 4UXAA 3FX3A 4LULA 1Y9QA 2D5FA 4YSFA 2PTMA 3E97A 3MPBA 4IEXA 2ET7A 1J3RA 3H3UA 2XL7A 4MGZE 4Q0UA 3RYPA 1SQ4A 4E2GA 4N9HA 4ZU7A 4X6QB 4AVBA 1LKNA 3MYXA 2Q30A 2B5HA 4LEJA 3G7DA 3LA2A 2O1QA 2IC1A 2GC2A 2MHFA 1CAUA 5C6CA 5JCTA 5J7MA 4YYOA 4IEPA 3MDPA 4BH9A 2IXHA 1CAXA 1YWKA 1UIKA 2PFWA 1YFXA 4IETA 4XFIA 2EVXA 5I8YA 5BUVA 3S7EA 4AQ2A 1H1MA 1CAXB 1GQHA 2XKPA 4QXKA 3WW1A 1J58A 2WFPA 4JV4A 5I8TA 4NVPA 2ZKLA 2VECA 2ZCWA 3SHRA 5K8SA 2BGCA 3C3VA 5LRSA 3BB6A 5JAXA 1ZZCA 2ATFA 3E5XA 4KU8A 1ZZ6A 4HMZA 3GBFA 4HSJA 4KWKA 1FXZA 2IXKA 3PNAA 4EROA 1RL3A 4MV2A 4XFAA 1ZZ7A 2EA7A 2PA7A 2BYVE 2VPVA 3LWCA 3HIFA 1X82A 4XF1A 4XEZA 3H9AA 2GC0A 5I0UA 2C0ZA 3E5QA 4XFGA 1WLTA 5FQ0B 1OI6A 1VR3A 1LB2A 2XLAA 1WGPA 1DZRA 1YLLA 4O9EA 4QM8A 1VP6A 2UYAA 5EFUA 2F4PA 3FWEA 1DGRA 4AVAA 2OYZA 2DCTA 3OCPA 5CADA 5LEKA 1RC6A 1ZRFA 3I59A 1GQGA 4PIYA 1SFNA 1UW8A 4N9IA 3EQEA 2PQQA 3ES4A 4IESA 4L11A 3QACA 4XF9A 1Q43A 2Y0OA 4Q0VA 2GAUA 4I09A 4LLOA 4KL1A 4MGIE 3N4MA 3OF1A 5D1IA 2K9ZA 2WC2A 1NXMA 3D82A 1O3QA 3DN7A 5I93A 3LAGA 2Q1ZB 3WW2A 4IEZA 4LTAA 1ZRCA 2QCSB 1HW5A 3H1WA 4LA2A 2GH2A 2QVSB 1SEFA 2D40A 4ORFA 1X7NA 3CEWA 2O8QA 2OPKA 3FZ3A 1J3PA 3LA7A 2HJIA 3RYRA 2OZ6A 3GYDA 5I0TA 1O7FA 2IXCA 2OZJA 1O3RA 1ZZ9A 4Q29A 4PJYA 4AXOA 4XFBA 5FPZA 4F8AA 5KHHA 4IEWA 1Q5OA 1CAWA 2GU9A 1ZX5A 4J1WA 1O3SA 4HVOA 3OGJA 5HI0A 4BYYA 4CYDA 3CF6E 4I01A 1JUHA 3IDCB 4JTNA 2B8MA 3IIAA 4JVAA 3TNQA 3BALA 3HQXA 2GC1A 5EZWA 5F1RA 1EYBA 3HT1A 3ST7A 4IEQA 2UYBA 3R6SA 4K8FA 2CAUA 1DZTA 5I8SA 4ZU4A 4ZU5A 3SCHA 1H1IA 1NE6A 3B02A 4WZCA 1QY4A 1WA4A 3S7IA 5I0SA 1PM7A 1CGPA 2FMYA 4I3PA 4EWEA 1QXRA 3QOPA 5I0RA 1I5ZA 4YRDA 1CAUB 3ES1A 3FFQA 5KBFA 5T3NA 4D7SA 3KSCA 3WW3A 5FLJA 4Q0PA 1ZZ8A 3U0ZA 1ZZBA 1EPZA 1CAVB 1YUDA 2D5HA 4F7ZA 3H3ZA 1O4TA 1UD1A 2VQAA 4KWJA 4EWDA 4HVQA 1IPKA 3BCWA 1PMIA 3U11A 2BNNA 5C8WA 2K0GA 3IBMA 2I45A 4H7LA 1RUNA 1UPIA 3OTFA 5FLHA 1U12A 4I0AA 4HSLA 4R52A 3DV8A 4QGMA 2IXIA 2N7GA 3EHKA 5KHIA 4PIZA 4WVZA 3NVCA 5FLIA 3NKTA 3LOIA 4IEOA 2PAEA 4B29A 1YFWA 2XL9A 4E2SA 1G6NA 1DGWA 3RPQA 5BPXA 3H1YA 1O5UA 3CL1A 1V70A 3I59B 1ZNPA 2FQPA 5J3UA 3S0MA 1XE8A 4YNIA 3FE5A 2Z69A 4PIXA 1YHFA 1CAWB 4FBFA 1X8MA 2D93A 3SCFA 5E16A 3UKTA 3SXWA 2Z2SB 1UCXA 2ETEA 1OD5A 4LA3A 3RNSA 5I91A 4MUVA 1ZRDA 1J3QA 2B9UA 3UKNA 3H1MA 4A2UA 1Y3TA 4HVRA 1O5LA 4I2OA 3NSTA 3NJZA 4XETA 1I6XA 1QWRA 2BNMA 4E2QA 3KMHA 4EWAA 4FAHA 2UY9A 3OD0A 3FHIB 4KU7A 3EJKA 2KXLA 3PVBB 3TNPB 4BIFA 2XKOA 3KCCA 3RYKA 5KHJA 3UKVA 1YFYA 2MNGA 4QMAA
chains in the Genus database with same CATH superfamily
4D69A 2ZHMA 1MZEA 1SBFA 1O4YA 2IUWA 2VOKA 3MIEA 5ACA3 5T5JA 1NQJA 2ZX2A 3P3NA 4KGQA 2HWF3 4MGQA 3RRDA 3A22A 5C5UA 3VBUC 4LORA 4ZHNA 1W2AX 2VH9A 4AEDB 1HB4A 1PNFA 3DGTA 2D3RA 1CESA 2W1WA 3K75B 4QXCA 1AR81 4AEJA 2QTWB 2WO3A 5E1RA 3QCWA 3BIWE 3KT1A 1YXWA 1AR82 3ME2A 4GB32 3W5NA 4DXSA 1Q8OA 1C3HA 4GWIA 1OQDA 1QXJA 2QUOA 1UO9A 1WMXA 1NT0A 1YQ6A 5FPBA 4CCCA 3QLQA 2AEZA 4NR1A 2B9VA 1UY3A 1DQ0A 2ZGRA 3WG2A 3EMRA 1CIWA 3VLBB 4LBQA 5DUWA 4ZPIA 5A3NA 1DCSA 3IWZA 4NWVA 3JBG1 4RQPA 4DXZA 3V0AA 3E6CC 5FZ9A 2W91A 2E32A 5IWFA 2R061 1PGSA 1S0FA 3CO2A 3T30A 5FPUA 1MVEA 3M7AA 3O1SA 4NE9A 1SACA 3LFIA 4JKMA 1D4VB 1RHI3 4YARA 4MZUA 5CNAA 3N9LA 2XXZA 4FXGB 4Z82A 1RHI2 2WNEA 3GGLA 3NV2A 3CJXA 2ADDA 3F95A 3I8TA 4DS0A 5IT6A 5FDBA 3MUY1 5A7NA 4AVCA 1ULFA 4GKYA 1GZ9A 3NMBA 3I3BA 1WCDJ 3K4DA 1XNCA 1S0GA 4MXWA 4AF9A 4LT5A 1D4M3 4FPKA 4NMIA 1JBCA 1VALA 1IPJA 1F5FA 2JD4A 5FREA 2RS13 3FFZA 3M70A 2FDHA 1W8ZA 1GICA 2G4IA 4IEVA 5FPLA 5EJZB 2E9QA 3VZKA 2C1FA 3JB4C 1RUF1 5B4NA 4YM0A 1RUI1 3LEGA 4JDNA 2PXJA 5BXXA 3SMHA 1HJFA 2EXHA 1S2EA 1BEV3 2CV6A 3SKVA 2Q1MA 3THPA 3BTXA 4META 5F6KA 4RGKA 1WCKA 3ZDVA 5LA0A 3N9NA 1MQTC 4FQZA 2RS33 3AKRA 4JZRA 4TN7A 4A42A 5AC91 3TB0A 3RJRA 3ZSEA 1PMJX 3PTYA 2BNOA 4Y20A 4ZXEA 1VRH3 1NZCA 1H2KA 2IXJA 4B4PA 4LXLA 4MX3A 1B35C 1HXS3 1WCQA 1ZBE1 1RVF1 4YVWB 5SV8A 3ENRA 3AM2A 1WKYA 3NAPB 4XF3A 5CZKA 5BNOA 2KA3A 4L0PA 1ACCA 1X9PA 1W6OA 4XE9A 4A3XA 1VBA3 5FYZA 5JVVA 2Q5TA 1VE0A 3AZXA 4PI2A 5DQ0A 5FK8A 3AZYA 3DYPA 3KF3A 1D0GA 1MACA 1GBGA 4QX2A 5FFOC 5DUXA 4ES9A 5BY5A 3I49A 4KWUA 1PO12 4D6QA 1UZYA 5C33A 1OH4A 1TNFA 2R062 3GBWA 4Q0QA 4AI0A 1SZBA 1F8VA 5JMCA 3GZEA 1BJQA 2YY1A 1RUG2 4YW1A 1BMV1 1YI9A 3HBZA 1HV0A 5FYHA 4ASKA 5IFTA 4XCAA 1ZRIA 4R9AA 3ABZA 3I2HA 2XVLA 3ZMOA 1REDA 5FZ4A 4E4SA 3AYEA 3CKHA 5LK7B 4R8HA 4FPHA 4V2VA 3O1PA 1TQ5A 1R1A3 4IXLA 2K46A 4YGDA 2CAVA 3Q8FA 5CIRA 4EZHA 2WZ8A 3B5LB 2BW8A 3NV3A 3ZVXA 2FD8A 3NAPA 1OLMA 2PLV1 4IDZA 4OHXA 1OQ1A 4IERA 1QH7A 1VBC1 3ACHA 1AYN3 2LM3A 2MEV3 3FJSA 4E4ZA 5F8PA 2ZAHA 3H50A 4XF4A 3VDDB 2BTVC 3DPRB 3O1TA 3IDEA 1W2UA 2ADEA 2ZX3A 1OA3A 2D44A 1LRHA 5H9PA 1QJZA 1MEC2 2G9FA 1OVSA 5K7PA 1ZRRA 1GOHA 1SHWB 5DAQA 3UL2A 4L99A 4XFHA 4LBMA 4P08A 3OOXA 4YPJA 2XHKA 5IVBA 4ONUA 1J59A 2C9KA 2R0FA 1PNGA 2XJQA 3B7MA 2NMOA 1HLCA 4PLOA 1WA6X 4UXAA 3OGGA 3A0KA 4LULA 3OD4A 4Y4YA 1EV12 4CEWB 1MS3A 1I9RA 1LGNA 2JICA 2W9XA 4XAEA 4OUMA 2BRTA 3MPBA 1C8NA 2WINB 3URFA 4CCDA 1NZIA 3KV6A 2XB6C 2KM2A 4MGZE 2XL7A 3RYPA 4M0NA 1UPSA 3D6EA 4M0HA 5LY2A 3OG2A 4LE4A 3VBOA 1QJY1 2CWMA 4PF1A 3ZN4A 3ZXJA 2FCTA 1APNA 4NWWA 4X6QB 1JYNA 1W9TA 4IL7A 3ZXAC 2Q30A 2YFZA 3K51A 1QJFA 1UOBA 1BYHA 2F6BA 1XYNA 1W06A 1JHNA 2RDNA 2ENRA 2Y6LA 4UW3A 5FMOL 4E8DA 2IC1A 4HPKA 4YM1A 1PX3A 4IV3C 4KGGA 3WLUA 2JDAA 5C6CA 5JCTA 1S1AA 1FMD3 5GM0A 2R0HA 3VD9A 4IEPA 3MDPA 4AEDA 4IGQA 2VD7A 1CAXA 1YFXA 4GH4C 5JPMB 3DF0A 2EVXA 1NCRC 1OHFA 1S0CA 2YZ4A 4Y1XA 1W6QB 4HL0A 5BUVA 3PUHA 2VZOA 2XKPA 3WF2A 2E31A 5FZ3A 3ZSKA 4CTEA 5IVFA 3WW1A 1J58A 4UW5A 1W9YA 1WW4A 5I8TA 4NVPA 1HV1A 4EN6B 2YC0A 1QJEA 4YZ1A 2X5IC 4P00B 1SCRA 5CKNA 4S2FA 5EP9A 1YRZA 3SHRA 2RDSA 3PVNA 5LASA 4BQ5A 3C3VA 5LRSA 5C3OA 4LOTA 1E5RA 4C1WA 4CDUA 1ZZ6A 4E9KA 4KWKA 4HSJA 5L7OC 1QIQA 1FXZA 1O4ZA 3AYAA 1RL3A 4QPYA 4N7IA 3POIA 5DXDA 1ZZ7A 1N3OA 2XVGA 1H8VA 2WSUA 2Y6JA 1AR63 4LBJA 4XEZA 4YW4A 4AG4A 4LBQB 4N43A 4R4XA 1JYXA 5LA9A 4BLJA 2Y6HA 3RZGA 2C0ZA 4XFGA 2Y6KA 2JG9B 1XNKA 4C90A 1NLQA 1ASJ2 1LB2A 1VR3A 5IK8A 1JOBA 2JKBA 2E63A 1PGW2 2XLAA 3FLTA 1YLLA 4QDRA 4UFMA 1VP6A 2UYAA 2VQ0A 3K3OA 4P9WA 1PVC2 3FWEA 5LATA 4AVAA 2QQIA 4RHV3 3SEEA 2D3PA 1AVBA 1ZA7A 4FCAA 3LB9A 5FY8A 2HWE1 1B09A 3VBSC 5FV3A 5LEKA 1ZRFA 4PQ9A 3WUCA 2A7AA 2VM9A 4M3CA 4IV3A 1UW8A 2KD7A 2TEPA 5A7WB 1LOEA 1N3PA 3EQEA 2PQQA 1E57A 3MLJA 3ES4A 4IESA 1AR93 4AR2A 2RMU2 1QH6A 1HXS2 4Q0VA 1JUIA 2GAUA 5JOXA 4KL1A 4YW2A 1CJDA 1X36A 2WC2A 3ZFEC 5ABJB 5F5CA 4BQXA 3D5OA 4MLOA 3N7MA 4XQDA 1GZTA 1QOSA 1DLLA 2Q1ZB 3SKJE 5GKAC 5LBEA 4Y5SA 5F32A 1UU6A 3RMYA 1MPXA 1BBT1 4LA2A 2R1BA 1TZOA 1YC61 4Q4W3 2VBPA 1Q8SA 3KD4A 5F6LB 2FMDA 3J7MA 1WBLA 5FZAA 2Q8CA 3WUDA 5A1AA 3POYA 3L9JT 1UQXA 5DG1A 2JG8C 3AP9A 4RS5B 1O7FA 1CJPA 1RUG3 3IKWA 4Y26A 1UKGA 4W50A 1PK6C 4M01A 3TEXA 2RV9A 4Q29A 4CVUA 2W1SA 1EAH2 3C2UA 4YGCA 1E5HA 4NAMA 4B1MA 4IEWA 3LPFA 1Q5OA 4QPGC 5L7OA 1TNRA 2BJSA 4GMP0 1R083 1W6OB 2XJUA 4YW5A 1NKGA 4J1WA 1WCUA 3LCPA 4WM7A 1R082 3J8F1 3OPZA 3OGJA 1J83A 4XW3A 1Y9MA 3VV1A 5A3MA 4QHOA 4RR3C 3OUIA 3HVDA 4FFHA 2W1UA 4JGYA 1W6NA 2RS51 4Y20B 1RUC3 5FZHA 4BQYA 1C5IA 2P5BA 4JTNA 3TNQA 4Q4V3 1V9U2 4K6BA 3OEAA 1REFA 2VBBA 1PIV1 1R092 3RG0A 3WEZA 1SMVA 3N36A 2BERA 2ERFA 4CU7A 3VHPA 1IQAA 5A7SA 1EYBA 5J37A 4XTMA 1V6LA 5D8AA 2G19A 2XHNA 4UW4A 5IK4A 4LHNA 2UYBA 3ALQA 5HXMA 3LFMA 4Z8BA 2Y64A 3J7NA 4Y3OA 1JYCA 5BNPA 1K5MC 4PBOA 2A6ZA 1TG7A 2J1SA 5KC5A 1F31A 3FL7A 4Y4RA 5A80A 3VN4A 4LMFA 2J1VA 2VW2A 4AFAA 4MXVA 1NE6A 2JXAA 3ZFGC 4FOYA 5FYIA 4N90A 2IVJA 1QY4A 3IT8A 4WZCA 3S7IA 1PM7A 1BBT2 3UGHA 1U5ZA 5FYMA 3V0BB 3B93A 5FZMA 4A6SA 3QOPA 1ULOA 2C24A 4YM2A 1I5ZA 3ZMNA 4ZXKA 3FFQA 3IPVB 3OY8A 5FWJA 1C28A 5GZEA 5LCWL 4DEVA 5CBLA 4BMBA 3UJOA 1WLDA 3SQOA 1MS1A 4MGTA 1IQDC 3M3CA 4FPOB 3AJZA 4BE3A 5FOJB 4YLZA 2TNFA 1JYIA 1GWLA 1AUYA 1O4TA 2FDKA 2ZGKA 1FMD2 1JN2P 2VQAA 1V6KA 5E89A 2CSGA 4BPZA 3NAPC 2HYKA 5D8AC 4CUCA 2BQPA 5F5QA 3IDAA 5IK7A 2Q1FA 1JZ7A 5EIYB 1CN1A 4LQRA 2WL1A 4H7LA 2DCYA 1UPIA 4Q5OA 1PHMA 1UZ0A 1RUNA 3J8F2 5FLHA 1WW5A 2WQZC 4NROA 5CFCA 4AQTA 1RUI3 1PK6A 1VBC3 4ZS2A 1YEWA 1ULDA 2ZGTA 2VMHA 5JLVA 5T50A 4R52A 1B35B 2ZAAA 4GWJA 1VBE3 1AXZA 2HWC1 4OHZA 2IXIA 2N7GA 2YGMA 4XPVA 5FZGA 3VKLA 2ZHLA 1VBE2 4PIZA 1SBDA 2VVFA 2VAUA 2VULA 4HT1T 5FLIA 3NNJA 2WZPP 3RS6A 3NKTA 3LOIA 2FDFA 2VG9A 4RFRB 2ES3A 2ZOEB 2DWRA 2XL9A 3WF3A 2P3JA 2R6QA 3ZX7A 4XJZA 5KXEA 2UU8A 5ERLA 1D4M2 2EALA 2PHTA 1ZNPA 4QPIA 4B3NA 4NN0A 5CG8A 1FPN3 1XE8A 3S0MA 1DYPA 4YNIA 3OUJA 4FOQA 4NO4A 3FE5A 5KXDA 2J1EA 3C7HA 2OQ6A 3H42B 4XHBA 4N53A 4QT6A 4FBFA 4Z2WA 4PLNA 2D93A 2O14A 4QQLA 5E16A 3UKTA 4C8DA 5DAPA 3T3YA 2CL2A 3SXWA 3I3DA 4Q4Y2 2RJKA 5A1LA 1AR72 1LU2A 4GQ7A 2B45X 1US2A 3D4KA 2RDQA 1FX5A 4HXCA 1AYM2 3THDA 5I91A 5IHRA 1H6XA 2B9UA 2VMFA 5G04L 1GFF2 2BVBA 5JI7A 4I2OA 2PELA 1JHJA 4JDMA 5FTTC 3MI8A 1H0BA 4OMCA 3RGBA 2XBO3 3I3MA 1IKPA 2LRPA 2A5ZA 3OPWA 4E2QA 3MF6A 3FHQA 3N35A 1SFYA 4DOUA 1ND3C 4HANA 3USUB 2UY9A 4Q2FA 2P3IA 2EF6A 3POJA 3WR0A 3T2PA 2JG9A 4QWNA 4B4RA 1SLBA 1XYOA 2GSYA 3C7EA 1HDKA 2P6HA 4BIFA 5EJ1B 3RYKA 5FXXA 1VB4A 3FN9A 1OLQA 1YQ5A 4FPCA 2R043 4COYA 2E6VA 4KI5M 3AP6A 3ZR6A 4CU8A 1PZ7A 3K3NA 4FFIA 2IVIB 1OBNA 5GJ6A 2WZR2 4IEYA 5DN2A 3GHNA 3T1LA 2J1UA 4Y22A 4QU1A 4YZ3A 2WYSA 3BPSA 1UZZA 4YWAA 2LS6A 1RUD3 4AYUA 1GOFA 5FXZA 4BISA 4ATFA 3BVCA 4IV1C 5A33B 3B3QE 2RS31 1BLZA 3MFCA 3MLKA 3JD71 2HWD1 5LRRA 2I07B 4O9GA 3ZYBA 4C0BA 1XNAA 2PYTA 3ZXFA 3AMNA 3O12A 4XILA 4AOCA 1I5PA 3ZFFC 2QBXA 4NPMA 4Y1ZA 1T6BX 1G8WA 2GMPA 3AKPA 3ZYPA 1RVF3 2XJTA 2ZABA 4QGLA 3PJQA 4I0BA 4A44A 4HN0A 3BODA 3PURA 4XUTA 2G9GA 2LALA 5AVPA 2VOWA 3MGUA 3S30A 5JR7B 4FI9A 3N7KA 2VTFA 1RITA 4GULA 1Q3EA 3VZLA 4BQ2A 2OPWA 5IATA 3E5UA 2WQ4A 1MZ6A 4NHYA 2D97A 5CFDB 4Q4V1 3CBNA 5IVYA 1A6CA 1DQ2A 3I7DA 4FT8A 1NG0A 3WF4A 5JSRA 3EO6A 1DG6A 4TLFA 1OVPA 2DUOA 3OBZA 4C91A 2XUMA 3DL3A 1XRUA 3OBRA 4OHWA 4CU6A 4A6OA 2RJLA 2XJRA 3KGZA 2AACA 5ANQA 5C9AB 1OUSA 2OIIA 2OUHA 3I2IA 2X5IB 2ZGUA 5DAWA 1W6MB 1A3KA 4OUEA 4RD7A 3FBYA 5IVJA 4FOVA 4XDOA 4XJ9A 2JG9C 3WG1A 4XUPA 1OLME 2HH9A 3LD8A 4RQPB 3W58A 1GV9A 4P5HA 3B9CA 4UF0A 4XHXA 2XH6A 3USSA 5FYYA 4BXSV 2HBTA 2NP0A 4QB2A 5AFEA 2VMDA 3PU8A 4I02A 1OC1A 2P1BA 2OA2A 3RZMA 4XC9A 3ETQA 4HKLA 3LEKA 4F3JA 4P9LA 2FDJA 4YG3A 5C4WA 1U5XA 4M4PA 4XF0A 5JOZA 4BK5A 1MQTA 2OKXA 3T2QA 5FZFA 3H7JA 5J48A 2UWBA 4LUKA 2JE9A 4UFHA 5KWRA 3ZDSA 5FP3A 2H0VA 3SH4A 4QM9A 5H9RA 2VUJA 1N1VA 3J7LA 4GMP1 4GB33 3GBGA 4JC1A 4YZ2A 5D21A 4Y22B 2D6MA 1W6NB 2EAAA 3PVEA 5FMBA 4QGNA 4SLIA 4WM8B 4MGYE 3AVSA 1COV2 4P02B 4Z07A 3BTZA 3H0OA 3ZSJA 3VBFC 4HBNA 1RTVA 1UX6A 2A75A 4AVVA 3GCXA 4BLIA 5FO8B 1SG3A 1G9FA 2PHRA 5FWEA 3AMQA 4FAGA 2Q0AA 4ISQA 3WSOA 2VMEA 4JRLA 4CP2A 5GLZA 2A6WA 5A1FA 5EXOA 2BPA2 4QHZA 2GNDA 4GALA 2GMEA 4RHV1 4A3ZA 1NLSA 2R32A 3BU7A 3PHMA 4HKWA 2GNMA 1L3JA 4RGGA 3T0AA 4AEMA 4D8MA 2WAAA 3E6DA 5C8CA 1LODA 4CUGA 1XU1A 4HKOA 1W8HA 3QBQA 1S2BA 1AX2A 2PHUA 3UESA 3W21A 4CEWC 1EAH1 3NNFA 4UBGA 3MIFA 1A78A 5GLUA 2VR4A 2ZPXA 5L9RA 3ROUA 3D0SA 3RZKA 3MZHA 1MQTB 2JDYA 3U37A 4RL7A 3W20A 2PHDA 3O1MA 3LA3A 2XPJA 4CRQA 3OBTA 4P9GA 3DXTA 4BHPA 4OULA 4TLGA 1Z7S3 4YFWA 3I2DA 1PK6B 4LLFA 1MS0A 5FAXA 4XYXA 3SCGA 3W9AA 1ZM1A 1GZWA 1KEXA 1ENXA 2RS53 1L7QA 4AHXA 1GU3A 1UMIA 1PZ9A 4FXKB 3U4SA 5ACA2 1UKRA 1RHI1 2HEVF 4FQ4A 2ILMA 1AYM3 3L2HA 4I0WB 4AHWA 5JZGC 5LY1A 1G7YA 3POBA 2QJVA 1Y7BA 2XJPA 1W8FA 1CPNA 3D0JA 5C8CB 3N7LA 1REEA 3KHCA 2JDKA 4JKLA 1RMU1 2RR12 1ENQA 4XUOA 2HKXA 4DXTA 3LSDA 1UY1A 3TEYA 1RIRA 2DYCA 3HAGA 3T2OA 3AFGA 2JDUA 2ZXQA 1RUH3 2ZX4A 4GWNA 3HWJA 3VBFB 3X29B 3FX3A 5JXHA 5CEHA 1LOFC 4JHZA 1OURA 2PQSA 4L8QA 2JEMA 3WF0A 3AB0A 1RUF2 2DVAA 5GLVA 2GNTA 3H8XA 2W92A 3AL6A 1FV3A 1ONAA 3QH6A 4YVWA 3H3UA 1RUF3 2ZGNA 1UN1A 4BIOA 2Y38A 1PGW1 5L9VA 4Q4W1 2OVUA 4K1ZA 3T0BA 2YPJA 4AVBA 4ASLA 1LKNA 5JR2A 1WBFA 3KZ4C 2XMLA 4PDWA 1V6MA 3IAPA 1SPPB 3PUIA 2B5HA 4LEJA 1N1TA 3NNMA 3A0NA 3LA2A 1RUG1 5TSWA 4BA6A 5GZCA 1BMV2 5F3GA 1HRV2 2GC2A 3NJXA 3VBHB 5BNPC 5D8AB 1GWKA 2MHFA 5EV7A 3VDDC 1QJX3 3FUOA 1CAUA 5F2SA 4YYOA 3WHUA 1HXS1 2EIEA 1WMFA 2EXJA 1QGLA 2NYYA 5A3TA 1YWKA 1IKQA 2PFWA 5JOWA 1V00A 3ZLIA 3DPRA 4YG6A 3WT3A 1BK1A 2DVBA 4LBNA 3ZR5A 2AC1A 1MVQA 3HN3A 5EHDA 3S7EA 5LW9A 4AQ2A 2MEV2 1AYN2 1CAXB 1GQHA 2VO5A 3LGRA 2YPDA 1GYKA 2JENA 3PL0A 4QXKA 3GCWA 4MXWB 4ZONA 3KQ4B 4AI2A 3AP4A 3BGAA 5CA6A 2XDVA 1VBE1 2HWC3 2ZKLA 3KS7A 1STMA 3NV4A 3I2KA 4B4QA 4V1PA 2ZCWA 5HBAA 3R4UA 1AYM1 2OXBA 5FMDA 4RSUA 3BB6A 2JWPA 2R16A 1K42A 2A73B 2FHRA 4NIIA 2ATFA 2RS32 4JCKA 2BWAA 3TN92 1Z78A 3N9OA 1MEC3 2JE8A 3GBFA 5FRAA 3VKMA 3SH3A 2WBKA 4E27A 4CCKA 3TN93 3K4ZA 4XFAA 1VMHA 2BYVE 2VPVA 4GA9A 3MIHA 4ZKTB 3BOPA 2R7EB 2ZGLA 4JGYB 4QAWA 2GALA 2GC0A 3ZN6A 5FZEA 3ZFEA 1HB3A 1Q8VA 3TWIA 4NIHA 3WNMA 1DBNA 3S5QA 3E5QA 3C7OA 2X8KA 2UURA 3WNLA 2P3KA 3WXPA 2VXRA 3ILNA 4ITCA 1YIFA 1VLNA 1OI6A 3FBMA 1L7RA 2QFEA 2P34A 1L7LA 1WGPA 1DZRA 1XBFA 4JKKA 4KG8A 4NOTA 1GP6A 4QM8A 4BQ3A 2BV4A 1FV2A 2F4PA 1DGRA 3AFKA 4IW3A 5EFUA 4DRRA 2FDGA 1CWPA 5K0UB 2OYZA 2DCTA 3OCPA 5CADA 5L73A 1JI6A 4DIQA 4IE6A 3WF1A 3SEPA 1QMJA 3MV11 3NQHA 1SFNA 3ACFA 4Y1YA 2WS92 1JOPA 5FZKA 3BU0A 2YBSA 3A23A 3CIHA 4L11A 3QACA 4JGZB 2Y0OA 3WDVA 2D6OX 2RMU1 3N4MA 3OF1A 4URAA 2R1DA 1RUJ2 2YFUA 5D1IA 1R1A2 5A3PA 4N43C 4QKDA 3MEPA 5IVCA 1LOCA 4D6SA 1O3QA 5I93A 1UF2C 2DTWA 3LAGA 4BK4A 4H7MA 4IEZA 2BP6A 4LTAA 1W8UA 2QCSB 1HW5A 5T54A 1QEXA 1V6NA 2GH2A 1SEFA 1QJY3 2WWJA 3RI9A 4DB5A 1PO11 2CGOA 5H9SA 4ORFA 4N53C 5C3SA 4EN9B 2DCJA 1X7NA 5EQUA 2OPKA 3LA7A 1H30A 1KJLA 2HWB3 4LBLA 5A7WA 4CXYA 1PMHX 4M3CF 2JIGA 3ZFFB 4M00A 4K21A 4AXOA 4ISRA 3WDUA 4F8AA 5HCHA 1KD7A 2BOIA 2W5FA 1BZWA 1OUXA 5FJHA 4BDVB 3J4UH 2WR9A 1CAWA 3KV5A 4ZY9A 4ET7A 1UXZA 5GLTA 3TYJA 4AGGA 2CWSA 3WNXA 1LULA 1JYWA 3I2OA 1O3SA 3IMMA 3M1HA 1VMFA 4G4FA 5I0DA 1PGL1 1LECA 5C4WC 2XR4A 4LO6B 3H3LA 5LWBA 1TME3 4LIUA 2NN8A 2ZGPA 4CYDA 4I01A 1JTZX 2YB7A 1JUHA 3EB7A 3IDCB 2B8MA 3IIAA 2AEYA 4X8PA 5GZFA 3BALA 4FFGA 2NLRA 4XZUG 5EZWA 4XZPA 3CHXA 5CB7A 3FLPA 3MFAA 3T4VA 2OUJA 5IJRA 3HT1A 5LBFA 4Q4X3 4D3WA 1PM4A 2P6CA 2FZ1A 1VRH2 4L92A 3R6SA 4NHMA 4BB3A 5CFDC 3WZ1A 1NQDA 2PMWB 3POFA 2VUAA 3U4XA 2CAUA 3HEIA 2J1TA 1O91A 4UWDA 1IZ3A 1W9SA 2A6YA 2RMU3 3THTA 5E8AA 1FPN1 5C7GA 4FTEA 4RN5A 4ZU4A 3TOJA 3GM8A 3WCRA 4JHTA 3WY6A 5T5LA 1BVVA 4WVVA 2Y34A 4QDSA 3FHAA 4RA0A 4ZS3A 2CDPA 4LJHA 1SLAA 2D6LX 4ASMB 1CGPA 1W90A 2FMYA 2HEYF 3N3HA 2PHXA 4I3PA 4CCLA 1PO13 2WZR3 2A70A 3PUSA 3WNNA 4CEWA 4Q4W2 4YRDA 3ES1A 3KHBA 1NLRA 4BM8A 1PVXA 1BVP1 1O6UA 5T3NA 2WS91 2XWJB 1QF3A 3POSA 1DZQA 1ZZ8A 2DUQA 4AAXA 1ULPA 5KXCA 5A33A 2XVKA 4F7ZA 1AL23 5A7OA 1ULCA 3ZFFA 3KVBA 3LKJA 4FSJA 1UD1A 4WM7C 2JDMA 4FFFA 4AI3A 1JZ5A 4DRVA 1IPKA 4YM3A 4HVQA 5CG9A 1KITA 1DQ6A 1PMIA 2EAKA 4MYEA 2AREA 2AZ5A 2BNNA 5DZGA 1ZRDA 2DBNA 2ZHNA 5D2AA 3AXEA 4P9YA 2DCKA 2J1RA 1OA4A 1GZWB 3T09A 2ZZQA 4PBPA 5FMOS 2WO7A 2I2SA 4Q27A 4DZGA 3SITA 1QJU3 2GN7A 4OQ8A 4H3WA 2NPIA 4I0AA 4AGVA 4QGMA 4GXLA 2EICA 4XAAA 4CDXA 4XIKA 1W28A 1VBD2 2NQYA 3V64A 5KHIA 4LO4B 4J6GA 1W6PA 1XU2A 1KFXL 1NCRA 3NVCA 4WVZA 2WNVA 5H9QA 1UNBA 4CU9A 1O8PA 1MS4A 1ND3B 4D6RA 4FTSA 3KLSA 1LOFA 5AC93 4MVTA 1J84A 3ZSLA 1UX7A 4Q4X1 2VBDA 4GB31 1O5UA 4CCMA 4DXRA 2DDUA 3DCQA 1RINA 3AZZA 3I3EA 4LBKA 2Q8DA 3VBRA 4DPNA 5KR7A 3ZFGA 2FQPA 3RZLA 2CYFA 2JG8A 3KM5A 5EWSA 5A6ZA 3O1VA 4CSWA 3WVJA 2CY6A 3S6PA 1B35A 5DZFA 1X8MA 4UFLA 4WVMB 3PDQA 1KQRA 3RWNA 2YU2A 1X33A 5FZ1A 4S2DA 3ZKUA 1CD3G 1JYVA 2R063 1N1SA 2Z2SB 2G1MA 2R073 3FLRA 5L9BA 1YIPA 4LA3A 3VL9A 4JAAA 1WZXA 3U78A 1J3QA 4I3GA 2F17A 4DUWA 3ZOIA 5IFPA 2BOJA 3GZUC 1LHUA 1Y3TA 4HVRA 3IM0A 5FJKA 3C7GA 3VGIA 2C4XA 4LO8A 2Z5WA 4XETA 4K3UA 3B01A 2X09A 4CDWC 1V6JA 3JUUA 5DDJ1 4B1LA 1CPMA 1W9FA 1COV3 1CZVA 3KMHA 4LK7A 4BQ1A 1GNYA 5HV4A 4UOJA 2KXLA 1CR7A 5C8CC 1XQNA 1RUI2 2JG8B 1POQA 3PUQA 5FZBA 3T1MA 4QPIB 5KC6A 5IAVA 5KHJA 2GN3A 3RMXA 1H2LA 1YFYA 1C1LA 3ZN6B 4AVTA 4JX0A 4Y5Z0 3TBDA 1MZ5A 1UOJA 1JZ2A 5FY7A 5C9AC 1NCQB 3VD7A 4MOAA 1OOPC 5KHGA 1H8TB 1VIWB 2WRAA 2P37A 4IEUA 1F35A 1LGBA 3I4IA 1DDLA 2HWE2 3HN1A 2XLFA 1OF3A 5EPAA 1J1TA 2IXLA 1IS6A 4MGKE 2E51A 5A3UA 5A3WA 1EP0A 3ON7A 2WWUA 3AMHA 4CDQC 1WW6A 1LEMA 2HWD3 3NJVA 2E7QA 4GMP3 3P1IA 4XOGA 1GOGA 1M4WA 4Y24A 5FY9A 4AFCA 1JMUB 5FYBA 3TRSB 3LIGA 4H14A 3DKWA 3PIJA 3JZVA 2PHLA 2SBAA 2W68A 4QPGB 5HCFA 3NNGA 3VBHC 3PLQA 1LR5A 3VBOB 4AFMA 1ULEA 2Q4SA 1ASJ3 3O0XA 5FKBA 1AZDA 2QNKA 3ZPYA 1JXNA 1LHVA 3AL5A 1BBT3 1C8M1 1UY0A 1SFPA 2Y6FA 1HX6A 2Z42A 4XVHA 4D7TA 1TMF3 3K77A 5FOBB 1IS3A 1FYUA 3H8OA 5GZDA 4IGPA 3E6BA 4HPKB 2ZEZA 4PCRA 5JI9A 5GLWA 3DXUA 4MG2A 3OY8B 1G86A 2P17A 1LEDA 1DGRN 1OMIA 1G9BA 1SLIA 3VD5A 1WCSA 1RMU3 5FP4A 1LTEA 1W0OA 2XBO1 4JTOA 5BNNA 2IFWA 2QDRA 2BFUS 2QQNA 1AR91 4JGYC 5BV6A 1FOD3 3LSEA 2ZHKA 3I54A 2YUEA 2VZUA 4LKFA 1LOAA 5CFDA 4GD4A 1W05A 3ACLA 2A6XA 1FOD2 1CVNA 1XE7A 3NW4A 2WA3A 3WW4A 5F3CA 2VE1A 2JDNA 3WG3A 3PU3A 3MUZ1 1GQPA 3O1OA 3ETPA 2RS11 2KR2A 1RUE2 5F3IA 1HQLA 2VJXA 2VNVA 4CP9B 1VBC2 4COZA 2XUEA 4BU2A 1OOPB 1C8M3 1MS9A 1S2KA 3IMNA 4WV8A 3VBHA 2WDBA 1HRI2 3HT2A 5FZ6A 4CUBA 1DF0A 3GALA 4RR3A 4XACA 5JSOA 1NYWA 2JDPA 4XUQA 1SPPA 4QKBA 1WUVA 4LKSA 4NJ4A 2Y60A 4JGZC 3RDIA 2E26A 2PAKA 1KXGA 3OYWA 5IW0A 2ZKNA 5A32B 4D94A 1ZREA 1HRV1 2ZMKA 3P3PA 1AR62 3ACIA 3I3QA 1RXFA 1RUH1 4YVSA 3AP7A 2VCMA 2VUCA 1FPN2 4X6RB 2WJSA 3M3IA 2GMMA 2VW0A 1S0EA 2P2KA 2VZTA 5A7PA 4F83A 5JPNB 1OPOA 3NNLA 2WAOA 3RWKX 2W1QA 4HETA 1F2NA 4N53B 3B9IA 2WT2A 4HLTA 3RJ2X 1K5JA 2J1AA 2BUKA 3HNMA 1ULGA 4DUVA 4A45A 4AQ6A 5IVVA 1J1LA 4Q4V2 1H2NA 4JQRA 4M4RA 3U1XA 1WW7A 5BNOB 2GP3A 4GH4A 4N43B 3LE0A 1LOBA 1H2MA 1UZWA 4A4AA 2YG0A 2FCVA 3IDBB 4LNVA 5FXVA 4RFT0 2X10A 1QOOA 1UZVA 1NA1C 1WMEA 2NM1A 1FT9A 2VU9A 3CMGA 3UGFA 3KT4A 4QQHA 1QOTA 3K4AA 3AKTA 3KB5A 2WLQA 3CU7A 1W0PA 1FMD1 3ZIXA 2EIGA 4O7XA 4WVWA 3WNPA 2XOMA 2BVVA 2YMZA 5K0UA 4INDA 4PF5A 4WBBA 5A7QA 1V6OA 3HJRA 1S4CA 3JXSA 4A7ZA 1GLHA 4PLMA 4UBHA 4OVEA 5C4WB 1UYYA 4SBVA 3GHMA 5GALA 1HB1A 2Z4FA 4HN1A 4YZ5A 2V4AA 3H7YA 5F37A 4Z1VA 1V9U1 3GJBA 1N3QA 4QKFA 5EJ3A 4CEYC 2YC2A 1RJ8A 2YBKA 2PN5A 3AC0A 3UV9A 4UFIA 2DF7A 2OS2A 3U10A 4Q8KA 2DV9A 2DVFA 5A32A 4KNCA 1VBB2 5JSPA 2JKXA 1UIJA 4HOOA 1Y4WA 1JZ4A 2QQPA 1ND2C 3AZVA 1EAH3 4HZFA 3WP6A 1VBB3 2YYOA 3A21A 3CZJA 2PHWA 2ZEWA 3AZWA 5DUVA 5FY0A 1VRH1 1GUIA 2J22A 1Y43B 5FZOA 4OZXA 4NRMA 1H4HA 5IK5A 1XNTA 1NA1A 2ZBJA 1W9WA 2Z79A 1Y9QA 4Q8LA 5JXGA 2D5FA 4YSFA 5F9TA 5JIUA 1R1A1 5BYNA 2PTMA 2AUYA 1XNDA 4GKXA 4R9CA 2DUPA 2ZACA 4CDXC 2ET7A 1J3RA 3BUCA 3WP4A 1HN1A 5KXBA 4IV1B 1RUC2 1SQ4A 4E2GA 3WX5A 4GJZA 2FZ2A 4N9HA 1AJOA 1R093 1AR71 4ZU7A 2VNGA 4CXWA 3MYXA 3RZHA 3ORJA 1VRBA 2BU9A 2HWE3 5B2GB 1Q8PA 2VOTA 2BBVA 1GSLA 1W8OA 3BIEA 2D6KA 3WQ1A 1QHDA 2A6VA 4X8NA 2O1QA 4CP0A 1T6GC 4XQ4A 1OXCA 4IGOA 4B8EA 4LIVA 3LEIA 1QXPA 1W0NA 3NRUA 4BH9A 4UFKA 1SDWA 2C26A 3POGA 3RI8A 5T5PA 3ZYHA 1QNWA 4NRQA 4NIAA 3W59A 1GNHA 3KVAA 4IETA 1KJRA 4XFIA 4EQVA 1H8TA 4XBQA 3O0VA 2V4VA 3I2GA 1OD3A 5K0UC 1PO23 1N47A 3P6BA 1U5YA 1OH3A 2PLV3 4WM7B 1DGLA 3D8CA 2VMIA 4CEYB 4E4DX 1VBD1 3GZAA 2E7TA 2PLV2 1HQNA 3CZUA 2EIBA 3WG4A 2RS52 1K45A 2JIJA 1WLCA 4AVSA 2BGCA 2QQMA 2AGSA 1JYTA 1Q8QA 5JAXA 1ZZCA 2DFBA 3PVOA 1RMU2 2LUWA 2RR11 2A3XA 3MBWA 5A3LA 4K7JA 5GZGA 1VMJA 5JUVA 1IG0A 3PNAA 4DO0A 4EROA 5IVEA 5DPNA 2V5YA 2EA7A 2WFF3 2PA7A 3B00A 3LWCA 3MW2A 4XJUA 5G05L 5K9YA 3NV1A 1X82A 1H9WA 4XF1A 2ZEYA 3H9AA 3ZSMA 1G9AA 4QPGA 4XXPA 1OT5A 1W3XA 5I0UA 4AZZA 4NHXA 4OCTA 3CJIB 1RUE3 2BFUL 2CTVA 2VY0A 1AX0A 2WNOA 2BGOA 2X05A 4P9IA 1W8WA 3WINE 5FYUA 2DVDA 4MSVA 4NUBA 1S55A 5FZLA 1D2QA 4BWOA 1C1FA 2BZDA 2JECA 3WP5A 3Q8CA 1WWYA 2WKKA 3AMMA 4ZZ5A 3CDZB 5FP8A 1RC6A 5T55A 1MZFA 5LZ6A 3I59A 1GQGA 4IE5A 1I3HA 4IV3B 1UYPA 4M3CB 4BZ4A 1A8MA 5DMYA 3VHOA 3TEZA 4MO3M 1AL22 1AJKA 1HRV3 4QU2A 4AWDA 4QDQA 3OBAA 1Q43A 5CKMA 4I09A 2RJ2A 4LLOA 4MGIE 1NCRB 1OKOA 4S2HA 4RYDA 5J98B 5JIAA 2K9ZA 2VZ3A 3HNBM 4EN7B 2QQLA 1K5MB 3D82A 1CX1A 3DN7A 2XJSA 3GNEA 4N8MA 4OYUA 1ENSA 1W2TA 4OI0A 3USUA 1OLRA 3WW2A 3JBG2 4IE4A 3VKNA 4CCNA 4DMIA 4NPRA 2ARAA 2JJ6A 3TAYA 4FVVA 3OGSA 3UYJA 3ZFGB 4KBBA 4CPBA 5JXIA 3OSDA 1D2SA 5DZEA 1NX9A 2D40A 3VBUB 5M0TA 4YVSB 2O8QA 2HWC2 4WM8A 2HJIA 3RYRA 4OMDA 3GYDA 4GWMA 4IUGA 3JD72 3U14A 5AC92 3ZO0B 2OZJA 1ND3A 2RDRA 4H55A 1E5SA 1XNBA 1O3RA 2BDRA 1ZZ9A 1NY72 5B4XA 2VNRA 4PJYA 1LHWA 1C57A 4XFBA 5FPZA 2W87A 3SH5A 1BK0A 1S0IA 5KHHA 1RUH2 3WCSA 3ZPOA 1H6YA 4CA9A 1YI7A 2QQOA 3VKOA 1NUKA 4KBZA 1ZX5A 1GP4A 1EV13 4W6WA 4FP2A 3K2OA 4G3YC 1LOGA 2E53A 5FP9A 4DFSA 5HI0A 1RUE1 3L2YA 1KGYA 5LK5A 2HLEA 3WV6A 3O1RA 2YROA 4AL9A 3WQ7A 2P3YA 3OYWB 1YQ8A 2ZEXA 5C3QA 3JQXA 4JRAA 1HIXA 1ALYA 2VXJA 5ISLA 1R1ZA 2ZGQA 1SLCA 3ILRA 1Q56A 1YO8A 2R30A 4AGRA 1QQP1 2WNVB 2WS93 3VD4A 1CZTA 5LBBA 3ZYRA 3VD3A 2VCBA 3ST7A 4OUSA 2VZQA 3VZNA 5FY5A 3OGRA 1EUTA 1YQCA 5FPAA 4W65A 2VQTA 2BGPA 5A70A 1HJGA 5DDJ2 1DZTA 5I8SA 1W2OA 2A3YA 3N9QA 3SC7X 4XMAA 1NCQA 3SCHA 1RUJ3 1K3IA 3ZXDA 3ZYFA 5FPVA 5JXJA 1H1IA 1OKQA 1LJ7A 2DU1A 4URTA 2CU5A 3V65A 4YZ4A 1TME1 2JB8A 3RQ0A 3ZYJB 1S0JA 5BNPB 5FK7A 1UU4A 4DY3A 3KCXA 4EWEA 3VDBA 1DU3D 1PVC1 4UI9L 2YGLA 5I0RA 1QJY2 1CAUB 3VBFA 2VQUA 4PHZA 2HWF1 3WD5A 3ZN5A 3I2JA 1QKQA 2D6NA 5A6QA 1SLLA 4Q0PA 2VMGA 1YUDA 3N7JA 3H3ZA 5IUQA 1W39A 2VVDA 3LDBA 2QQVA 3AVRA 4PDWB 1ZBE2 3KWVA 4LO7A 4XCBA 3BCWA 5DAXA 4V2WA 1A8DA 1AXYA 1ZBE3 3U11A 2V73A 4FPGA 5FZCA 2Y6GA 4W8JA 4IE7A 2V5DA 2VOXA 2K0GA 3IBMA 3Q8BA 1YJKA 2W39A 2I45A 2WIIB 5L19A 4LE3A 2VVEA 3VBUA 4UFJA 3MW3A 1PGL2 4COVA 3VBRC 1SCSA 4FPYA 4I30A 1UOGA 2VZ1A 4HSLA 4CE8A 3DV8A 3R05A 3T0DA 2AH2A 4YVWC 3MV01 5FZOB 5JZGA 1PZ8A 2RM23 2WNVC 2B4KA 4LO5B 1GZCA 1X9TA 5F3EA 3WDWA 3LQCA 2PAEA 3UT0A 4B29A 1YFWA 2TUNA 2RR13 3GF6A 4E2SA 3ZM8A 5BNNC 1AR83 1WLWA 4PT6A 1G9CA 2JD9A 4Q4X2 2W95A 4Q1PA 1V70A 5CYYA 3H8RA 2BWCA 3R0RA 4Y33A 1HKDA 3R4DB 3AYDA 5CISA 2OW4A 1VAMA 2F4LA 4OI1A 1UWWA 1H8TC 1XB9A 2Z69A 4K9SA 4PIXA 1YHFA 1PO21 5ABJA 4BJ0A 2BBAA 3SCFA 2VGDA 1R64A 2WNUB 2XONA 1RYYA 4XUNA 3HQUA 3B94A 2WO1A 2TBVA 1UCXA 5LBCA 3RNSA 4MUVA 2D98A 4EJRA 1HRI1 3H1MA 1O8SA 1VAKA 2A1XA 4A2UA 5JMOA 2DURA 4QX7A 2VZVA 3HOBA 4YFZA 2O8OA 1QWRA 1BQPA 1FNZA 2BNMA 2WA4A 3ASIA 2QQUA 2W2IA 4R9BA 1JZ6A 1DYOA 4P9JA 5FYVA 4BQWA 2RS12 4EYUA 4FAHA 5HXVA 4CDXB 1GANA 1CIYA 2XWBB 1AR61 3FHIB 4PI0A 4KU7A 3TNPB 2JDZA 1QJU2 1RUJ1 2XKOA 4YGEA 3M4FA 4IQPA 4CEYA 1IOAA 4XABA 1LENA 2MNGA 4GZ9A 3Q8EA 1UMZA 5HCBA 4FPEA 1AF9A 2A3WA 4MHRA 1TME2 4UYBA 5F39A 4BMEA 2P4EA 4XTPA 2JB4A 4HFSA 1CONA 1PVC3 5C3RA 3BOWA 2VCAA 3LDRA 4QX0A 5HCAA 3JU9A 1QDCA 1W99A 4DNYA 5KHKA 3VHRA 4COUA 3J26N 2ARXA 3K48A 2E7AA 3AP5A 3KCYA 1CAVA 1W8TA 3C7FA 1ODMA 3HD8B 4QHBA 5CVRA 5FKCA 4XBNA 2LTNA 3N9PA 1CZSA 2UY8A 1QJX1 4XFFA 2AYHA 1S0DA 4J1XA 2XGXA 1RUOA 4OFGA 4QX1A 4E8CA 1Z0HA 2WUHA 2IFRA 3NL1A 3ZXKA 5LA1A 4QPWA 4WM8C 4UT5A 2W46A 4DY5A 2WQ8A 4BCUA 3AKSA 4UF0B 1A34A 1UAIA 2WNUC 1VBA1 1W3VA 2PAMA 4W6XA 5FUIA 3T2TA 3THCA 2VOVA 3BPZA 3S5AA 3RFRA 1ASJ1 3PUAA 1AHSA 4EZ4A 2WLPA 3EBRA 3BYWA 4FPJA 2WYFA 1DQ5A 1O3TA 2VZSA 2FCUA 2V09A 4QPIC 1NAEA 1OFNA 2H6CA 3LDKA 3R4SA 4ATEA 2I74A 2K2SA 4XURA 2JX9A 2RVAA 3RZZA 4AFDA 3OEBA 1EY2A 1NOVA 3KQRA 5FPXA 4LPLA 5FCCA 5A3OA 1KFUL 2X53S 2QQKA 5C5TA 2C9AA 3KV4A 5FP7A 3V0BA 2YHJA 2L9LA 1ZA4A 1ZVFA 2UWAA 4G9SB 4QX3A 1ST8A 4DINB 4AW7A 1LCLA 4YG0A 2H6BA 4P5YA 4CDQB 2YU1A 1UY4A 3HR9A 1DLCA 1GNZA 1RGSA 3LZZA 1F5JA 1MS5A 1CX4A 5JOYA 1QJU1 1S0BA 5FO7B 3O1UA 2EIDA 1ZBA3 5ANNA 1NA1B 3VUOA 5CU1A 3QH7A 4YGBA 2D6PA 2X29A 2XG3A 3RSJA 3VBSB 4U36A 3WDXA 4A7KA 3MW4A 4CUAA 3DKQA 3OB8A 4OLLA 3FC0A 2DCZA 3KGLA 4FO9A 4KQ7A 2GC3A 2E33A 4CCJA 4EV0A 2WN3A 1V6IA 2D43A 3CLPA 2VCCA 5F5AA 1Y9GA 4AHYA 4YW7A 1U0AA 2QDNA 3TEWA 1OQEA 5FUNA 1TE1B 5CKQA 4W4ZA 4Q0SA 4QX5A 4J25A 4K40A 4LHSA 2HWD2 4CDWA 4IV1A 1VJ2A 4NIDA 1YFUA 1VAVA 3T4HB 1POV0 2ORXA 2RE9A 1Z7S1 1KRIA 4P9XA 5FZ8A 1O59A 2ET1A 2GZWA 1LAJA 3LIHA 2ZA9A 4KWLA 4XFCA 1POV1 4AFBA 1JU3A 3POWA 4RS5C 1FAYA 4Y5TA 1X8EA 1XXNA 3MPPG 2WWSA 2C5DA 3ZFEB 4Q4Y3 4H2AA 1IS4A 5ABJC 2ZGOA 3AX4A 4KG0A 5E6HA 5FYCA 5DAVA 1TVGA 2MPFA 2ZX1A 3DYOA 4TZDA 4LBOA 5FZ0A 3NO8A 3SISA 3T08A 1IG3A 4MH0E 1FNYA 4XQWA 1AR92 4LUMA 4GAZA 3TN91 4EE2A 1D4M1 1W6PB 2XBO2 2HEWF 3WNOA 2PHFA 1K12A 3UETA 2YDEA 1FI2A 4OI2A 1NE4A 3UNPA 3G6JB 4OHVA 4CCEA 5C70A 4RR3B 4AAPA 2VTXJ 4BXFA 1NXD1 4L2NA 3VBSA 2QKDA 5LB6A 3J8F3 1OOPA 3O14A 4ES8A 2ORZA 5J96B 5FZ7A 1C8M2 1DYKA 4O65A 2BEOA 1POV3 4XMIA 2ZMLA 5FY1A 3WQBA 1LHOA 1XSRA 4CDWB 2XLGA 5FBZA 1E5IA 3ECQA 3HPNA 5FR3A 5FO9B 4CDQA 1KS5A 3PTRB 2O0OA 1HRI3 3U75A 1IPSA 5FZDA 3JCIA 3ZXLA 4HK9A 1OPMA 4GH4B 2X5IA 1VBB1 3NWKA 4LKEA 1RJ7A 2JDHA 1AL21 2GDFA 3ELNA 1JZ8A 1OF4A 2CGPA 5LEJA 5AFBA 4WZFA 3NKGA 3H8UA 3M3OA 3PIGA 3UK9A 4HK8A 3LEMA 1WMDA 4ARYA 5FQ0A 3ZXEA 5FMCA 2YBPA 1XJAA 4YW6A 1TEIA 5FIXA 1XOYA 3E97A 2WSVA 1RVF2 3JB8A 4BQ4A 4Q1RA 4IEXA 3GDBA 4Q0UA 4QB6A 4XJAA 4AEDC 4EN0A 3A7QA 3JBG3 4DQAA 4Z92B 1W6QA 1ZBA1 2ID4A 3GXUA 5FBJA 1RUC1 4LK6A 3BN6A 3MIDA 3RZJA 1GP5A 1AL0G 4XJ8A 1PX4A 3MHZA 3WOGA 4JQTA 1AR73 1BHGA 2V72A 4QXHA 5EYYA 4OQ9A 1CQ9A 2Q8OA 3K46A 3ILFA 1G9DA 4OZOA 1NCQC 2W3JA 2A71A 3AK0A 4TWTA 3G7DA 1OA2A 3W5MA 4GIQA 3GJAA 2VW1A 1DHKB 1XC6A 5EYXA 1YQ2A 2VMCA 5J7MA 5FUPA 3ZYGA 1W2NA 3FUQA 4B7KA 2IXHA 3B69A 2Y33A 1KDMA 1UIKA 2DU0A 4L97A 3VHNA 5DUUA 3O5SA 2CHHA 2VTXA 4D7YA 5I8YA 4LKDA 2IZWA 5F7UA 2QE3A 4PQQA 1VBA2 1H1MA 2GNBA 4FPLA 1YYNA 3OPTA 3A4UA 3SLIA 1W6MA 2WFPA 1RXGA 1AXKA 1OFSA 2R042 4JV4A 5FY4A 3WP3A 3VBOC 2Y8KA 2R072 2RHPA 2ZZJA 5FZIA 2VECA 5K8SA 1W04A 1SDDB 3I97A 2WO2A 4CPBD 2ARCA 1RUD1 4AQSA 3ZXGA 4Z2AA 4A41A 3E5XA 5FYTA 4C0HA 1UXXX 1H4GA 4KU8A 3WDTA 3PJYA 4HMZA 4BOWA 1LU1A 4CDUC 1MEC1 2IXKA 2WABA 2XQXA 2ZTNA 1HQWA 3AJYA 2WFF1 4UW6A 3AMPA 4MV2A 2HYXA 4NHKA 2B39A 4P14A 3HIFA 4NHLA 4FOWA 3E1F1 2ZJCA 4A7YA 5E88A 2W0XA 4C1XA 1JZ3A 5C3PA 4YVSC 2CNAA 1N1YA 3FMGA 2NMNA 4K20A 5DG2A 5L36A 1F4AA 1C5HA 1WLTA 4QQ2A 5FQ0B 1US3A 4U2AA 1ZBA2 1V9U3 4FP3A 4O61A 1VBD3 1D7PM 4O9EA 1QU0A 1BEV1 2XQRA 4QQPA 1LGCA 3GZTB 2RG4A 1LESA 3ITQA 1F9KA 3MIGA 2B7YA 2W94A 3BKZA 1DP0A 3CQOA 2QZ3A 4PIYA 1F4HA 5IYYA 3IB3A 1RB8G 1DFQA 4N9IA 4RS5A 5JWPA 2ZS6B 3RVHA 1VB2A 2LW8A 2NZ9A 4OI4A 4NAOA 2GH8A 1GR3A 5J1XA 4LHLA 4XF9A 4XBLA 1JS9A 4S2GA 2VNOA 4AHZA 1LHNA 3INAA 1UY2A 2YV8A 2WT0A 1NXMA 5F5IA 3EYPA 3U07A 3HMYA 4N7UA 2VC9A 1Z7S2 4AEKA 1ZRCA 4CP9A 1UYZA 3H1WA 2XJVA 3OUHA 2R041 1HB2A 2QVSB 2MEV1 1AYN1 1QDOA 1C4RA 2DBIA 1F15A 1TMF2 1FATA 3CEWA 3CJIC 3HQRA 3Q8AA 3FZ3A 1J3PA 2RM22 3KF5A 3M3EA 2HWF2 4QXBA 2EXKA 2OZ6A 1DIWA 2YC4A 3CNAA 2LROA 5I0TA 5BNOC 3M3QA 1ZYBA 2IXCA 2W47A 2DVGA 3DUIA 3VDAA 4CDUB 3VDCA 5F2WA 2WN2A 3UJQA 4R9DA 2VZPA 1KS4A 4QX8A 1WD4A 3SNMA 4ZZ8A 1SBEA 4Q26A 4NIGA 2VZRA 2WFF2 3O7OA 2GU9A 4QD2A 3DPRC 1X50A 1YCIA 3MICA 4B7EA 4HVOA 3ZKYA 1XYPA 3C8XA 2WZEA 3OJBA 2HBUA 5BNQA 1HN0A 1ND2B 3O0WA 3V0AB 4BYYA 3M8LA 4MADA 3S57A 2FDIA 3CF6E 5JDBA 5ACA1 2ZMNA 2J42A 2R071 4JVAA 5J09A 3HQXA 4FTBA 1IHMA 1QQP2 2GC1A 5APAA 1URXA 2OQ7A 3ZIWA 1I1EA 5F1RA 1BXHA 1QQP3 1JODA 2UWCA 5C9AA 3VZJA 4TTGA 4DEQA 3AKQA 1JH5A 4IEQA 4QKNA 4LBQD 2QQJA 1IGOA 2FBEA 4L9BA 1FOD1 4M3CE 2VUDA 2ZGMA 4K8FA 3IAQA 5LA2A 3VB9A 5CFCB 1OSGA 4XJWA 2OX0A 1GWMA 1EV11 4ZU5A 4AE2A 5T52A 4TXWA 3ATGA 4XDQA 2DFCA 4HONA 3Q9OA 1PO22 3VZMA 1V0AA 3MF9A 5T5OA 4NRPA 3F2ZA 2D3SA 2CGNA 3B02A 4KH9A 1WA4A 2DTYA 1UMHA 4IE0A 4CZSA 2EXIA 5I0SA 1VPHA 3HNYM 4AI8A 5BNNB 4LR4A 2W52A 1QXRA 3PMEA 1BEV2 1XPWA 4RHV2 5A6YA 1M06G 2HWB1 4RQPC 2W08A 2R49A 2RM21 1U5IA 3WDYA 4YW3A 4CXXA 1DQ1A 2B42B 4AI1A 1BCXA 3IZOA 4D7SA 5KBFA 1JOJA 3KSCA 3IPVA 5FLJA 3POEA 3WQ0A 3WW3A 2D7FA 5A6XA 3U0ZA 3AYCA 1ZZBA 4TYSA 1EPZA 1CAVB 2D5HA 3JD73 2GP5A 1ODNA 1IS5A 1NY71 1AX1A 1UOFA 4CP1A 4QQOA 4KWJA 4EWDA 2G9ZA 1GKBA 1COV1 3PMSA 3DECA 1ND2A 3BI3A 4OHYA 1T2XA 2AR6A 4AK3A 5C8WA 1YJLA 1UL9A 1WD3A 3KV9A 3MIBA 3OTFA 5HV0A 4KMQA 3HBKA 1JW6A 3EXUA 1JU4A 1U12A 3JQWA 4WVMA 5L7OB 2OT7A 1EPWA 3MO4A 5CAZA 2H0BA 2WZR1 2Y26A 1D0HA 2YXSA 3IN9A 3EHKA 1TMF1 4GJYA 4DUXA 3VL8A 4JDOA 2VL4A 1DQ4A 1PIV3 2Y0IA 3ACGA 3APBA 1BKZA 3OGVA 4IEOA 5FXWA 5HPOA 1PIV2 2ZX0A 3UGGA 1G6NA 1RUD2 1DGWA 2ARBA 3RPQA 2C6SA 5BPXA 3BTYA 1P8JA 2IWGB 3H1YA 1QJX2 4XDPA 3CL1A 3VDDA 5DDJ3 3LF7A 4D0QA 1W8NA 5IAXA 5CFCC 1UU5A 3I59B 3ZYIB 4LOSA 2CDOA 3IIIA 5C71A 5J3UA 4Y1UA 1R081 4COWA 3NJYA 5J36A 4AI9A 4CCOA 4FPFA 4K1YA 4PDWC 4R4ZA 1UYXA 1CAWB 4RGAA 5FYSA 3DYMA 3AXDA 4Y1VA 2WT1A 3LOBA 1H1AA 1SLTA 1R091 2AENA 1YNAA 2QQWA 4JGZA 1LNSA 5K4LA 2ETEA 1OD5A 4Q4Y1 4K8RB 4UAPA 2QZ2A 3VBRB 4E4HA 3D3AA 3WNKA 4TSVA 1QNYA 4W6YA 4EN8B 3BTAA 2B46X 3J7HA 3UKNA 4NPLA 3WHTA 1O5LA 2HWB2 3KT7A 3J9SA 2J7MA 3MLLA 1H9PA 3VKFC 1KDKA 3NSTA 1ENRA 3NJZA 2SLIA 2JE7A 5DABA 1GMMA 1I6XA 1MR5A 5SV5A 3I2FA 3V56A 2WNUA 1DGWX 3DEMA 1XSQA 5JZGB 4QB1A 4EWAA 3P5BA 4XIOA 3M2MA 5AVAA 3OD0A 4MHUA 2ZGSA 4LITA 3EJKA 2Q8EA 1XE0A 4ARXA 1EUUA 1MS8A 1W03A 1K5MA 3N9MA 3PVBB 4HG6B 4LHKA 3CJIA 3KCCA 3VZOA 4XXAA 3UKVA 3QD6A 4MGSA 4QMAA 3LPGA
chains in the Genus database with same CATH topology
4D69A 2ZHMA 1MZEA 1SBFA 1O4YA 2VOKA 3MIEA 5ACA3 5T5JA 1NQJA 2ZX2A 3P3NA 4KGQA 2HWF3 3RRDA 3VBUC 2VH9A 4AEDB 1PNFA 3DGTA 2D3RA 1CESA 4AEJA 1AR81 5E1RA 3QCWA 3BIWE 3KT1A 1YXWA 1AR82 3ME2A 4GB32 1Q8OA 1C3HA 1OQDA 1QXJA 2QUOA 3QLQA 4NR1A 2ZGRA 1DQ0A 3WG2A 4FSJA 1CIWA 3VLBB 4LBQA 5DUWA 3IWZA 4NWVA 3JBG1 4RQPA 4DXZA 3V0AA 3E6CC 2R061 1PGSA 1S0FA 3CO2A 1MVEA 3M7AA 1SACA 1D4VB 1RHI3 4YARA 4MZUA 5CNAA 4FXGB 4Z82A 1RHI2 2WNEA 3NV2A 3CJXA 3I8TA 4DS0A 5IT6A 5FDBA 4AVCA 1ULFA 4GKYA 1GZ9A 1WCDJ 1XNCA 1S0GA 4MXWA 4AF9A 4LT5A 1D4M3 4FPKA 1JBCA 1VALA 1IPJA 1F5FA 2JD4A 5FREA 2RS13 3FFZA 3M70A 1GICA 2G4IA 4IEVA 2E9QA 3VZKA 2C1FA 3JB4C 1RUF1 4YM0A 1RUI1 5BXXA 4JDNA 3SMHA 2EXHA 1BEV3 2CV6A 2Q1MA 3THPA 4META 5F6KA 1WCKA 1MQTC 4FQZA 2RS33 3AKRA 5AC91 3TB0A 3RJRA 3ZSEA 3PTYA 2BNOA 4Y20A 1VRH3 1NZCA 1H2KA 2IXJA 4B4PA 4MX3A 1B35C 1HXS3 1ZBE1 1RVF1 4YVWB 5SV8A 3ENRA 3AM2A 3NAPB 4XF3A 5BNOA 2KA3A 4XE9A 1W6OA 4A3XA 1VBA3 5JVVA 2Q5TA 3AZXA 3AZYA 1D0GA 1MACA 1GBGA 5FFOC 5DUXA 4ES9A 5BY5A 1PO12 1UZYA 5C33A 1TNFA 2R062 3GBWA 4Q0QA 4AI0A 1F8VA 5JMCA 1BJQA 2YY1A 1RUG2 4YW1A 1BMV1 1YI9A 3HBZA 1HV0A 4R9AA 3ZMOA 5LK7B 2XVLA 4E4SA 1REDA 3AYEA 4R8HA 4FPHA 1TQ5A 1R1A3 4IXLA 4YGDA 2CAVA 5CIRA 3B5LB 2BW8A 3NV3A 3ZVXA 3NAPA 2PLV1 4OHXA 1OQ1A 4IERA 1QH7A 1VBC1 1AYN3 2LM3A 2MEV3 3FJSA 4E4ZA 2ZAHA 3H50A 4XF4A 3VDDB 2BTVC 3DPRB 3IDEA 1W2UA 2ZX3A 1OA3A 2D44A 1LRHA 5H9PA 1QJZA 1MEC2 2G9FA 5K7PA 1ZRRA 3UL2A 4L99A 4XFHA 4LBMA 2XHKA 4ONUA 1J59A 2R0FA 1PNGA 2XJQA 3B7MA 2NMOA 1HLCA 4PLOA 4UXAA 3OGGA 3A0KA 4LULA 3OD4A 4Y4YA 1EV12 4CEWB 1MS3A 1I9RA 1LGNA 2JICA 4OUMA 3MPBA 1C8NA 2WINB 3URFA 2XB6C 2KM2A 4MGZE 2XL7A 3RYPA 4M0NA 1UPSA 3D6EA 4M0HA 4LE4A 3VBOA 1QJY1 2CWMA 3ZN4A 3ZXJA 1APNA 4NWWA 4X6QB 4IL7A 3ZXAC 2Q30A 3K51A 1BYHA 2F6BA 1XYNA 4UW3A 1JHNA 5FMOL 2ENRA 2IC1A 4HPKA 4YM1A 4IV3C 4KGGA 3WLUA 5C6CA 5JCTA 1S1AA 1FMD3 5GM0A 2R0HA 4IEPA 3MDPA 4AEDA 1CAXA 1YFXA 4GH4C 5JPMB 3DF0A 2EVXA 1NCRC 1OHFA 1S0CA 2YZ4A 4Y1XA 1W6QB 4HL0A 5BUVA 2XKPA 3ZSKA 4CTEA 3WW1A 1J58A 4UW5A 1WW4A 5I8TA 4NVPA 1HV1A 4EN6B 2YC0A 4YZ1A 2X5IC 1SCRA 4S2FA 3SHRA 1YRZA 3PVNA 3C3VA 5LRSA 4C1WA 4CDUA 1ZZ6A 4E9KA 4KWKA 4HSJA 5L7OC 1FXZA 1O4ZA 3AYAA 1RL3A 4QPYA 4N7IA 5DXDA 1ZZ7A 1N3OA 2XVGA 1H8VA 2WSUA 4LBJA 1AR63 4XEZA 4YW4A 4AG4A 4LBQB 4N43A 4R4XA 4BLJA 2C0ZA 4XFGA 2JG9B 1XNKA 4C90A 1ASJ2 1LB2A 1VR3A 5IK8A 2XLAA 2JKBA 1PGW2 2E63A 3FLTA 1YLLA 1VP6A 2UYAA 2VQ0A 4P9WA 1PVC2 3FWEA 4AVAA 4RHV3 2D3PA 1AVBA 4FCAA 3LB9A 2HWE1 1B09A 3VBSC 5LEKA 1ZRFA 4PQ9A 3WUCA 2A7AA 4M3CA 4IV3A 1UW8A 2TEPA 1LOEA 1N3PA 3EQEA 2PQQA 1E57A 3MLJA 3ES4A 4IESA 1AR93 2RMU2 1QH6A 1HXS2 4Q0VA 1JUIA 2GAUA 5JOXA 4KL1A 4YW2A 1CJDA 1X36A 2WC2A 3ZFEC 5ABJB 3D5OA 4MLOA 3N7MA 4XQDA 1QOSA 1DLLA 2Q1ZB 5GKAC 3RMYA 1UU6A 1BBT1 4LA2A 2R1BA 4Q4W3 1Q8SA 3KD4A 5F6LB 2FMDA 1WBLA 3WUDA 3POYA 3L9JT 5DG1A 2JG8C 3AP9A 4RS5B 1O7FA 1CJPA 1RUG3 3IKWA 4Y26A 1UKGA 1PK6C 4M01A 4Q29A 1EAH2 3C2UA 4YGCA 4IEWA 1Q5OA 4QPGC 5L7OA 1TNRA 4GMP0 1R083 1W6OB 2XJUA 4YW5A 4J1WA 3LCPA 4WM7A 1R082 3J8F1 3OPZA 3OGJA 3VV1A 4XW3A 5A3MA 4RR3C 4JGYA 1W6NA 2RS51 4Y20B 1RUC3 1C5IA 4JTNA 3TNQA 4Q4V3 1V9U2 4K6BA 1REFA 1PIV1 1R092 3RG0A 1SMVA 3N36A 2ERFA 3VHPA 1IQAA 1EYBA 5J37A 4XTMA 1V6LA 5D8AA 4UW4A 5IK4A 4LHNA 2UYBA 3ALQA 4Z8BA 1JYCA 5BNPA 1K5MC 4PBOA 2A6ZA 5KC5A 1F31A 3VN4A 2VW2A 4AFAA 4MXVA 1NE6A 2JXAA 3ZFGC 4FOYA 4N90A 4WZCA 1QY4A 3IT8A 3S7IA 1PM7A 1BBT2 3V0BB 1U5ZA 3B93A 3QOPA 4YM2A 1I5ZA 3ZMNA 4ZXKA 3FFQA 3IPVB 3OY8A 1C28A 5GZEA 5CBLA 4BMBA 3UJOA 1WLDA 1MS1A 4BE3A 3M3CA 4FPOB 3AJZA 5FOJB 4YLZA 2TNFA 1JYIA 1AUYA 1O4TA 2ZGKA 1FMD2 1JN2P 2VQAA 1V6KA 5E89A 4BPZA 3NAPC 2HYKA 5D8AC 2BQPA 5F5QA 5IK7A 1CN1A 2WL1A 4H7LA 2DCYA 1UPIA 1RUNA 1PHMA 3J8F2 5FLHA 1WW5A 2WQZC 5CFCA 4AQTA 1RUI3 1PK6A 1VBC3 1ULDA 2ZGTA 2VMHA 5JLVA 5T50A 4R52A 1B35B 2ZAAA 1VBE3 1AXZA 2HWC1 4OHZA 2IXIA 2N7GA 2YGMA 4XPVA 3VKLA 2ZHLA 1VBE2 4PIZA 1SBDA 2VULA 2VVFA 4HT1T 5FLIA 2WZPP 3RS6A 3NKTA 3LOIA 2VG9A 2ES3A 2ZOEB 2DWRA 2XL9A 2P3JA 2R6QA 3ZX7A 4XJZA 5KXEA 2UU8A 1D4M2 2EALA 2PHTA 1ZNPA 4QPIA 4B3NA 4NN0A 5CG8A 1FPN3 1XE8A 3S0MA 1DYPA 4YNIA 4FOQA 4NO4A 3FE5A 5KXDA 4XHBA 4N53A 4QT6A 4FBFA 4Z2WA 4PLNA 2D93A 5E16A 4QQLA 3UKTA 2CL2A 3SXWA 4Q4Y2 2RJKA 1AR72 1LU2A 4GQ7A 2B45X 3D4KA 1FX5A 5I91A 1AYM2 2B9UA 1GFF2 2BVBA 5JI7A 4I2OA 2PELA 4JDMA 5FTTC 3MI8A 1H0BA 2XBO3 1IKPA 2A5ZA 4E2QA 3MF6A 3N35A 1SFYA 4DOUA 1ND3C 4HANA 3USUB 2UY9A 4Q2FA 2P3IA 2EF6A 3WR0A 2JG9A 4B4RA 4BIFA 1SLBA 1XYOA 2GSYA 1HDKA 3RYKA 1VB4A 1OLQA 4FPCA 2R043 4COYA 2E6VA 3AP6A 1PZ7A 5GJ6A 2WZR2 4IEYA 3GHNA 3T1LA 4Y22A 4YZ3A 1UZZA 1RUD3 4AYUA 4ATFA 4IV1C 5A33B 3B3QE 2RS31 3MFCA 3MLKA 3JD71 2HWD1 5LRRA 2I07B 4O9GA 4C0BA 2PYTA 3ZXFA 3AMNA 3O12A 4XILA 3ZFFC 4Y1ZA 2GMPA 1G8WA 3ZYPA 3AKPA 1RVF3 2XJTA 2ZABA 4QGLA 3PJQA 4I0BA 4HN0A 3BODA 2G9GA 2LALA 5AVPA 2VOWA 3MGUA 3S30A 5JR7B 3N7KA 1RITA 4GULA 1Q3EA 3VZLA 3E5UA 2WQ4A 1MZ6A 5CFDB 2D97A 4Q4V1 1A6CA 1DQ2A 3I7DA 4FT8A 1NG0A 5JSRA 3EO6A 1DG6A 4TLFA 2DUOA 4C91A 2XUMA 3DL3A 1XRUA 3OBRA 4OHWA 2RJLA 2XJRA 3KGZA 5C9AB 2OIIA 2OUHA 2X5IB 2ZGUA 1W6MB 1A3KA 4RD7A 3FBYA 4FOVA 4XJ9A 2JG9C 3WG1A 4RQPB 3W58A 1GV9A 4P5HA 3B9CA 4XHXA 2XH6A 3USSA 2NP0A 5AFEA 4I02A 2OA2A 3ETQA 4HKLA 4F3JA 4P9LA 4YG3A 5C4WA 1U5XA 4XF0A 5JOZA 1MQTA 3H7JA 5J48A 2UWBA 4LUKA 2JE9A 5KWRA 3ZDSA 2H0VA 3SH4A 4QM9A 5H9RA 2VUJA 1N1VA 4GMP1 4GB33 3GBGA 4JC1A 4YZ2A 4Y22B 2D6MA 1W6NB 2EAAA 3PVEA 4QGNA 4SLIA 4WM8B 4MGYE 1COV2 4Z07A 3H0OA 3ZSJA 3VBFC 4HBNA 1RTVA 1UX6A 2A75A 4AVVA 4BLIA 5FO8B 1G9FA 2PHRA 3AMQA 4FAGA 2Q0AA 4ISQA 4JRLA 4CP2A 5GLZA 2A6WA 5EXOA 2BPA2 2GNDA 4GALA 2GMEA 4RHV1 1NLSA 2R32A 3BU7A 3PHMA 4HKWA 2GNMA 1L3JA 4RGGA 4AEMA 5C8CA 3E6DA 1LODA 1XU1A 4HKOA 3QBQA 1S2BA 1AX2A 2PHUA 4CEWC 1EAH1 4UBGA 3MIFA 1A78A 5GLUA 2ZPXA 3ROUA 3D0SA 3MZHA 1MQTB 4RL7A 2PHDA 2XPJA 3LA3A 4CRQA 3OBTA 4P9GA 4BHPA 4OULA 1Z7S3 4YFWA 3I2DA 1PK6B 4LLFA 1MS0A 5FAXA 4XYXA 3SCGA 3W9AA 1ZM1A 1GZWA 1ENXA 2RS53 4AHXA 1PZ9A 4FXKB 5ACA2 1UKRA 1RHI1 2HEVF 4FQ4A 2ILMA 1AYM3 3L2HA 4I0WB 4AHWA 5JZGC 1G7YA 2QJVA 1Y7BA 2XJPA 3D0JA 1CPNA 5C8CB 3N7LA 1REEA 1RMU1 2RR12 1ENQA 2HKXA 3LSDA 1RIRA 2DYCA 3HAGA 3AFGA 1RUH3 2ZX4A 4GWNA 3HWJA 3VBFB 3X29B 3FX3A 1LOFC 4L8QA 2JEMA 3AB0A 1RUF2 2DVAA 5GLVA 2GNTA 3QH6A 1FV3A 1ONAA 4YVWA 3H3UA 1RUF3 2ZGNA 1UN1A 4BIOA 2Y38A 1PGW1 4Q4W1 2OVUA 4K1ZA 2YPJA 4AVBA 4ASLA 1LKNA 1WBFA 3KZ4C 4PDWA 1V6MA 2B5HA 4LEJA 1N1TA 3A0NA 3LA2A 1RUG1 5TSWA 4BA6A 5GZCA 1BMV2 1HRV2 2GC2A 3VBHB 5BNPC 5D8AB 2MHFA 5EV7A 3VDDC 1QJX3 3FUOA 1CAUA 4YYOA 3WHUA 1HXS1 1WMFA 2EXJA 1QGLA 2NYYA 1YWKA 1IKQA 2PFWA 5JOWA 1V00A 3DPRA 4YG6A 3WT3A 1BK1A 2DVBA 4LBNA 1MVQA 3S7EA 4AQ2A 1AYN2 1CAXB 1GQHA 2MEV2 3LGRA 1GYKA 2JENA 4QXKA 4MXWB 4AI2A 3AP4A 5CA6A 1VBE1 2HWC3 2ZKLA 3KS7A 3NV4A 4B4QA 4V1PA 2ZCWA 5HBAA 3R4UA 1AYM1 4RSUA 3BB6A 2R16A 2A73B 2FHRA 2ATFA 2RS32 4JCKA 2BWAA 3TN92 1Z78A 1MEC3 3GBFA 5FRAA 3VKMA 3SH3A 4E27A 3TN93 4XFAA 2BYVE 2VPVA 4GA9A 3MIHA 4ZKTB 3BOPA 2ZGLA 4JGYB 2GALA 2GC0A 3ZN6A 3ZFEA 1Q8VA 3TWIA 1DBNA 3E5QA 2X8KA 2UURA 2P3KA 3WXPA 2VXRA 3ILNA 4ITCA 1YIFA 1VLNA 1OI6A 3FBMA 2QFEA 2P34A 1WGPA 4KG8A 1DZRA 4NOTA 4QM8A 5EFUA 1FV2A 2F4PA 1DGRA 3AFKA 4DRRA 5K0UB 2OYZA 2DCTA 3OCPA 5CADA 5L73A 1QMJA 1SFNA 4Y1YA 2WS92 4L11A 3QACA 4JGZB 2Y0OA 3WDVA 2D6OX 2RMU1 3N4MA 3OF1A 2R1DA 1RUJ2 5D1IA 1R1A2 4N43C 3MEPA 1LOCA 1O3QA 5I93A 1UF2C 2DTWA 3LAGA 4H7MA 4IEZA 4LTAA 2QCSB 1HW5A 5T54A 1V6NA 2GH2A 1SEFA 1QJY3 3RI9A 4DB5A 1PO11 2CGOA 5H9SA 4ORFA 4N53C 4EN9B 2DCJA 1X7NA 2OPKA 3LA7A 1H30A 1KJLA 2HWB3 4LBLA 4M3CF 3ZFFB 4M00A 4K21A 4AXOA 4ISRA 3WDUA 4F8AA 1KD7A 1BZWA 3J4UH 1CAWA 5GLTA 3TYJA 4AGGA 2CWSA 3WNXA 1LULA 1O3SA 3M1HA 4G4FA 1PGL1 1LECA 5C4WC 4LO6B 1TME3 2NN8A 2ZGPA 4CYDA 4I01A 1JTZX 1JUHA 3IDCB 2B8MA 3IIAA 4X8PA 5GZFA 3BALA 2NLRA 5EZWA 4XZPA 5CB7A 3FLPA 3MFAA 2OUJA 3HT1A 4D3WA 4Q4X3 2FZ1A 1VRH2 4L92A 3R6SA 4NHMA 5CFDC 3WZ1A 1NQDA 2VUAA 3U4XA 2CAUA 1O91A 1IZ3A 2A6YA 2RMU3 3THTA 5E8AA 1FPN1 4FTEA 3TOJA 4ZU4A 3WCRA 3WY6A 5T5LA 1BVVA 4WVVA 4RA0A 1SLAA 2D6LX 4ASMB 1CGPA 2FMYA 2HEYF 3N3HA 4CEWA 2PHXA 4I3PA 1PO13 2WZR3 2A70A 4Q4W2 4YRDA 3ES1A 1NLRA 4BM8A 1PVXA 1BVP1 5T3NA 2WS91 2XWJB 1QF3A 3POSA 1DZQA 1ZZ8A 2DUQA 5KXCA 5A33A 2XVKA 4F7ZA 1AL23 1ULCA 3ZFFA 3LKJA 1UD1A 4WM7C 4AI3A 4DRVA 1IPKA 4YM3A 4HVQA 5CG9A 1KITA 1DQ6A 1PMIA 2EAKA 4MYEA 2AREA 2AZ5A 2BNNA 5DZGA 2ZHNA 3AXEA 4P9YA 2DCKA 1OA4A 1GZWB 2ZZQA 4PBPA 5FMOS 2I2SA 4Q27A 4DZGA 3SITA 1QJU3 2GN7A 4H3WA 2NPIA 4I0AA 4AGVA 4QGMA 4GXLA 4CDXA 4XIKA 1VBD2 2NQYA 3V64A 5KHIA 4LO4B 4J6GA 1W6PA 1XU2A 1KFXL 1NCRA 3NVCA 4WVZA 2WNVA 5H9QA 4FTSA 1MS4A 1ND3B 3KLSA 1LOFA 5AC93 4MVTA 3ZSLA 4Q4X1 4GB31 1O5UA 1RINA 3AZZA 4LBKA 3VBRA 4DPNA 3ZFGA 2FQPA 2CYFA 2JG8A 3KM5A 5EWSA 3WVJA 2CY6A 3S6PA 1B35A 5DZFA 1X8MA 4WVMB 1KQRA 3RWNA 1X33A 4S2DA 1CD3G 2R063 1N1SA 2Z2SB 2R073 3FLRA 1YIPA 4LA3A 3VL9A 4JAAA 1J3QA 4I3GA 3GZUC 1LHUA 1Y3TA 4HVRA 3IM0A 3VGIA 4LO8A 2Z5WA 4XETA 4K3UA 3B01A 4CDWC 1V6JA 3JUUA 5DDJ1 1CPMA 1COV3 3KMHA 4BQ1A 2KXLA 1CR7A 5C8CC 1XQNA 1RUI2 2JG8B 3T1MA 4QPIB 5KC6A 5KHJA 2GN3A 3RMXA 1H2LA 1YFYA 1C1LA 3ZN6B 4AVTA 4Y5Z0 3TBDA 1MZ5A 5C9AC 1NCQB 5KHGA 1OOPC 1H8TB 1VIWB 2P37A 4IEUA 1LGBA 3I4IA 1DDLA 2HWE2 3HN1A 2XLFA 1J1TA 2IXLA 1IS6A 4MGKE 2E51A 1EP0A 3AMHA 4CDQC 1WW6A 1LEMA 2HWD3 2E7QA 4GMP3 4XOGA 1M4WA 4Y24A 4AFCA 3TRSB 4H14A 3DKWA 3JZVA 2PHLA 2SBAA 2W68A 4QPGB 5HCFA 3VBHC 4AFMA 3PLQA 1LR5A 3VBOB 1ULEA 2Q4SA 1ASJ3 3O0XA 1AZDA 2QNKA 3ZPYA 1JXNA 1LHVA 1BBT3 1C8M1 1HX6A 2Z42A 4D7TA 1TMF3 5FOBB 1IS3A 1FYUA 5GZDA 3E6BA 4HPKB 5JI9A 4PCRA 5GLWA 3OY8B 1G86A 2P17A 1LEDA 1DGRN 1OMIA 1G9BA 1SLIA 1WCSA 1RMU3 1LTEA 1W0OA 2XBO1 4JTOA 5BNNA 2IFWA 2QDRA 2BFUS 4JGYC 1AR91 5BV6A 1FOD3 3LSEA 2ZHKA 3I54A 2YUEA 1LOAA 5CFDA 3ACLA 2A6XA 1FOD2 1CVNA 1XE7A 3NW4A 2WA3A 3WW4A 3WG3A 2RS11 1RUE2 1HQLA 1VBC2 4COZA 1OOPB 1C8M3 1MS9A 1S2KA 3IMNA 4WV8A 3VBHA 1HRI2 3HT2A 1DF0A 3GALA 4RR3A 5JSOA 1NYWA 1WUVA 4JGZC 3RDIA 2PAKA 1KXGA 3OYWA 5A32B 2ZKNA 4D94A 1ZREA 1HRV1 2ZMKA 3P3PA 1AR62 1RUH1 4YVSA 3AP7A 1FPN2 4X6RB 2WJSA 3M3IA 2GMMA 2VW0A 1S0EA 2P2KA 4F83A 5JPNB 1OPOA 4HETA 1F2NA 4N53B <