4HANA

Crystal structure of galectin 8 with ndp52 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
293
structure length
293
Chain Sequence
b'GSMMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Structural basis for recognition of autophagic receptor NDP52 by the sugar receptor galectin-8.
pubmed doi rcsb
total genus 64
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hanA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hanA02
2GALA 2VXRA 1Z78A 3KQRA 3M2MA 3WDTA 2NP0A 5GZDA 2ES3A 1JBCA 2DVBA 3U4XA 2WT1A 3D5OA 3POSA 1UZYA 4NOTA 1F9KA 1WBLA 1GICA 1Z0HA 4PBOA 4YG3A 4HL0A 1V6KA 2ARBA 4FPOB 3N7LA 5H9SA 2DTWA 1GANA 1CPNA 4XBQA 3AXEA 3GNEA 1AZDA 3APBA 4R9BA 1LHWA 2AENA 3UK9A 1G9FA 2EXKA 4YFWA 2ZABA 4XJ9A 1LHNA 4YG0A 1GSLA 1QOTA 1VALA 2A6WA 5JDBA 4RA0A 1W0OA 2A3YA 3ZXJA 2R49A 2JDZA 3N35A 3Q9OA 4XE9A 5IK4A 1N47A 4GALA 1YIFA 2ZMKA 3HN1A 4W65A 5KXEA 1X50A 3SH4A 1AX0A 1N3PA 3AZVA 1EPWA 1LOCA 3SISA 1LODA 3WCRA 4LBLA 1Q8PA 1LU2A 4GWNA 3AP7A 4YW2A 3V0AB 3B69A 2GNTA 1J1TA 2SLIA 3LSDA 2HYKA 4XJAA 1JW6A 4K1YA 1S0BA 2ZGOA 4OZXA 5GZEA 4ITCA 1QGLA 1UAIA 1LULA 2ZHMA 1ULDA 1PZ8A 2AR6A 2WKKA 4GKXA 5CAZA 1RIRA 2P2KA 2BQPA 1W6NA 1C1LA 4LBKA 2D6OX 1BXHA 4M3CB 5JLVA 3HMYA 3T1MA 1DBNA 5T54A 2D3RA 1C1FA 1KJLA 1IS5A 4XMIA 2H0BA 5T5JA 4ASMB 1N3OA 2JE7A 4Y26A 3WG2A 1OFSA 1SBDA 1GZWB 3UJOA 5GLZA 2ZGPA 3PVEA 3W59A 4Q1PA 2DURA 1AJOA 2E51A 3OBTA 4M00A 5IK5A 4FQZA 1BKZA 1UZZA 4BQ1A 2ZA9A 1GZCA 4YZ3A 1DZQA 2E53A 3O12A 3WDXA 4FPEA 1MS4A 1JXNA 1G8WA 1W6PB 2XB6C 1UKGA 2A3WA 3ZXLA 3AZYA 4Q1RA 2VW1A 1Y7BA 2CYFA 3ILFA 3B9CA 4YZ4A 4YW3A 1WD3A 4Q27A 2PHWA 2NZ9A 2ZGSA 4PQ9A 2VUAA 4FOQA 2GMPA 2ZGRA 3M3QA 3FUOA 2G4IA 3NV2A 4U36A 3USUB 1IKQA 5F5QA 1B09A 2DV9A 2UURA 1UMZA 2E7TA 3SNMA 5EWSA 2ZHLA 3PVNA 1W6QA 2R16A 3LSEA 1GZ9A 3SLIA 4DFSA 1S0JA 1DYPA 1FNZA 1HKDA 2Q5TA 4AGVA 1V00A 2ERFA 3VKMA 3ZYPA 4DQAA 5T55A 4DRVA 4D69A 1Q8SA 4YZ2A 4Y1YA 3BIWE 4Q8LA 1V6JA 1GYKA 4YM0A 4FPJA 1DQ0A 1O4ZA 5HCFA 4ATFA 2JE9A 4C1XA 2DUOA 1LGBA 5T5LA 2D3SA 5JOWA 5GJ6A 5DG1A 3VUOA 2AUYA 1W0PA 3ZSKA 3WG3A 1QKQA 3AZZA 1LHOA 1AVBA 1Q8OA 3O0VA 2SBAA 3AYDA 5E88A 2W52A 1PZ9A 3ZSMA 1BZWA 3SH3A 1QF3A 1SBFA 1I3HA 1S0IA 2GMMA 1QOSA 4YM3A 1JN2P 1G86A 4YLZA 2TEPA 3V65A 2JECA 4DRRA 1SFYA 2DVGA 4ATEA 4XXPA 4AVSA 4P9YA 1O4YA 4PCRA 1MS8A 1W6OB 3M1HA 2VW0A 5JOZA 3M3EA 1FYUA 1S0GA 5JMCA 1QMJA 3WDVA 1ENQA 3WDUA 2ZACA 3NV1A 3R4UA 2A6VA 1V6NA 1Q56A 2LALA 2WT0A 3AYCA 4LBMA 1S0FA 1AXYA 3VKFC 4FPYA 2AREA 4YM2A 5DG2A 1RINA 3V0BB 4R9AA 5GALA 1LOFC 1W6MA 4ZKTB 3AZXA 4TZDA 2YZ4A 3WG4A 1CIWA 1LEDA 3A0KA 2D43A 5DUWA 1DQ2A 1N1VA 4KBBA 5F9TA 1KRIA 4GWMA 1A8DA 1H9WA 3OYWB 4JCKA 4P9XA 5DZFA 4YW4A 5GLWA 4JC1A 3VKOA 3ZXFA 2YXSA 3UJQA 3AJZA 2A5ZA 1LENA 1V6MA 1NXD1 1YXWA 1LEMA 4LBQD 2OUHA 3C2UA 5LK5A 3V0BA 3OY8A 2PHUA 5H9QA 3ILNA 2E6VA 2ZKNA 2EXHA 1V6LA 4XOGA 1DQ4A 1G9DA 1LOGA 1DYKA 2EIGA 4XHXA 4YW1A 1D2SA 2ZGQA 2DVFA 4YZ1A 4R9CA 3FLRA 1W6QB 1AXZA 5EXOA 4AYUA 1QDCA 3V0AA 2W08A 1MS1A 4CRQA 1UPSA 2ZGKA 4WVVA 2WLQA 3FLPA 1ULFA 1VAVA 1V6IA 1BJQA 4BLJA 4ISRA 4XIKA 1DGLA 2P37A 2W68A 4Y1XA 4Y1UA 4DS0A 2D7FA 4BPZA 1CR7A 2R0HA 4FPCA 4K21A 3RMYA 2PELA 1DQ6A 2ZMLA 3INAA 4BMEA 4M3CE 1MS9A 1DQ1A 3RSJA 1LOBA 1MS3A 4Y24A 4BLIA 2EF6A 1F31A 1JOJA 1S0CA 3SH5A 4P9WA 4WZFA 4YGEA 2WT2A 2DU1A 3WZ1A 1URXA 1KITA 1VIWB 3ZVXA 5DUUA 1G9AA 4AVTA 4XIOA 4ZXKA 5FRAA 2WSUA 4Y20A 5AVAA 5IK8A 1CVNA 3MPPG 1DHKB 3TAYA 5DZGA 5CBLA 2WQZC 2ZBJA 3R4SA 3ZSLA 4XJ8A 1MZ5A 1A3KA 2EXJA 1APNA 1DIWA 1WBFA 2P3IA 3CNAA 2GDFA 2WJSA 5KXCA 3AYEA 3DUIA 5KXDA 2D6NA 1AXKA 4XILA 2Z42A 2DTYA 3L2YA 2CL2A 2NMNA 4XJZA 2ZGUA 1LCLA 2VU9A 2JJ6A 2C5DA 1N3QA 1WLDA 2P3JA 2UU8A 2ZGLA 4AGGA 3WUCA 2UWCA 1DFQA 5DUXA 5CNAA 1SLLA 4XDQA 4R9DA 3AP9A 2GN7A 2OW4A 3WUDA 4FPHA 1VLNA 5HCAA 3QLQA 1W6PA 4Z8BA 3WOGA 1LHVA 3OJBA 1ULCA 1WCSA 3WLUA 2EAKA 1GBGA 3TB0A 1S1AA 1TEIA 3ZPYA 1LU1A 1SLAA 2R0FA 5FREA 1GV9A 3ZXEA 4YZ5A 4TYSA 3WV6A 4Y22A 4YGDA 5GLTA 4YG6A 1WLCA 2ZAAA 4Q26A 1ONAA 1LHUA 3AK0A 3AP6A 3POYA 3VKNA 2OVUA 1HQWA 2AGSA 2XG3A 1LJ7A 4FOYA 4ISQA 5IK7A 1MR5A 3DGTA 4WV8A 2DUQA 4M3CA 2VY0A 1WW6A 3N3HA 1CONA 1ZM1A 4GXLA 4GA9A 1SCSA 4XZPA 3AP4A 4C1WA 4Y22B 1KDKA 3B3QE 3NV4A 1ZA4A 4BM8A 3RG0A 3NV3A 4FOWA 3MW3A 2DYCA 3WG1A 1KJRA 2YMZA 1GZWA 1SCRA 2GN3A 4GKYA 1C4RA 4XHBA 2NMOA 2ZGMA 4Y1ZA 1QDOA 1MZ6A 3AFKA 1YRZA 1IS3A 1SBEA 1H9PA 1SLBA 2A3XA 3SITA 3WNXA 2V73A 3AZWA 1N1TA 2ZMNA 3W58A 4BOWA 2R1BA 1FV2A 3MW2A 1WUVA 4Y1VA 1CN1A 3IKWA 2EALA 4AGRA 2OUJA 1LTEA 4P14A 2UWBA 5IUQA 5T52A 4YFZA 2CY6A 4CZSA 1FATA 1Q8VA 2JD4A 1IKPA 2AH2A 4PF5A 1A78A 1UL9A 2CWMA 1OKQA 3H0OA 2PHFA 3I8TA 2CNAA 4Y20B 3B00A 2A6YA 1W6OA 2A6ZA 2YY1A 3FLTA 3N7KA 3QCWA 5GZGA 1R1ZA 2AYHA 2YROA 4FVVA 4XMAA 4LBJA 3JUUA 2ARXA 1ENRA 3ZSJA 5JVVA 3ATGA 1WW4A 1GNHA 4DPNA 2V5YA 1KDMA 1G9BA 1ENSA 1G9CA 2GNBA 2A75A 3A0NA 3RQ0A 3PMEA 4XJWA 1WD4A 4M3CF 3BTAA 1NLSA 3AYAA 4UW4A 1YYNA 3O0WA 2DVDA 5H9PA 3AP5A 3OPZA 3VKLA 1CPMA 5T5OA 3ZXKA 4YM1A 2D3PA 1ULGA 3WHUA 3M3OA 3GALA 2B7YA 4FOVA 5IT6A 3IPVA 1I1EA 1DQ5A 1N1SA 2C9AA 3B01A 2WNEA 4LBOA 1SACA 1ULEA 4XXAA 3BOPA 4YGBA 1QU0A 2R1DA 1WW5A 1WLWA 5EYXA 1FX5A 3MEPA 4YW5A 4UW3A 3RMXA 1BQPA 3ASIA 4XBNA 1CESA 3WHTA 3OY8B 3OGGA 2NN8A 2W39A 4UW6A 4FP3A 1LOFA 5SV8A 1GNZA 1JUIA 3HR9A 1S0EA 1OQ1A 3AXDA 4L8QA 1G7YA 1XQNA 2P3KA 3AX4A 3USUA 2D6MA 4XBLA 1V6OA 2FMDA 5JOYA 3RRDA 4FPFA 2DWRA 2NM1A 1LOEA 1W6MB 1U0AA 4LBQB 4BMBA 4SLIA 5L73A 2LTNA 3I4IA 2DVAA 2ENRA 1IS4A 1LGNA 3WDYA 3JU9A 4LBNA 1JYIA 3ZYRA 3WDWA 1VAMA 4I30A 5GLUA 5JOXA 5CA6A 3IM0A 2PHRA 1RITA 3PJQA 5T50A 1FAYA 2NYYA 1AX1A 3IPVB 1MS5A 2A6XA 4JRAA 1UN1A 4XTPA 1S0DA 3FUQA 5H9RA 2P34A 5KXBA 3VV1A 3D4KA 1FNYA 1YI7A 3WVJA 3FBYA 2E7QA 1DLLA 1F5FA 3M3CA 4XYXA 1JHNA 2ZHKA 4LBQA 3AJYA 2PHXA 4FQ4A 1GKBA 2VW2A 2ZGTA 4Q8KA 5GZCA 4RL7A 1BYHA 1N1YA 3R05A 3ENRA 3ILRA 1KQRA 3NWKA 1CJPA 1JYCA 2PHTA 3OBRA 5GZFA 3WCSA 4AVVA 1SLTA 3O5SA 1W6NB 3IN9A 2CTVA 2ZGNA 1LGCA 4CTEA 3LCPA 4HANA 4U2AA 5DXDA 2ZZJA 1GLHA 4FPLA 1AJKA 4FPKA 2UWAA 5GLVA 5BYNA 1QNWA 4AWDA 1Q8QA 2FHRA 3KM5A 1AX2A 3T2TA 2DUPA 1HDKA 4YGCA 4H55A 2EXIA 3A4UA 2CWSA 4M01A 1HQLA 1SLIA 5GM0A 1YO8A 4Q2FA 3N7JA 1WW7A 2WSVA 3V64A 2D44A 2YV8A 3PVOA 1C57A 1AF9A 5E89A 5CB7A 4XJUA 4XTMA 3N36A 1IOAA 5HCBA 1MS0A 2JKBA 2DU0A 4K20A 1LECA 2A71A 1HLCA 5DZEA 1MACA 3D6EA 1IS6A 3FFZA 3MW4A 1UX6A 5T5PA 3OYWA 4IQPA 4UW5A 4WVWA 3N7MA 1H30A 2D6PA 4NO4A 1LOAA 3IMNA 1LESA 5EYYA 4FPGA 2GNMA 5E8AA 1MVEA 5DUVA 1FV3A 3POWA 2KM2A 2I2SA 2A70A 4MYEA 3T1LA 3RS6A 2GMEA 1QOOA 1PZ7A 2A7AA 2GNDA 4PBPA 1MVQA 2ZHNA 1SLCA 2VH9A 1D0HA 1QNYA 3BODA 3O0XA 4K1ZA 2RHPA 3UL2A 4FP2A 4F83A 2D6KA 2D6LX 1CQ9A
chains in the Genus database with same CATH superfamily
1XE0A 2VNGA 3FE5A 5BUVA 3KQRA 3VDBA 2NP0A 1J84A 1VBE2 2VBBA 1NOVA 1UKRA 4IEYA 3GCXA 2BZDA 3BYWA 2UYBA 4IV3A 1Z0HA 2OS2A 4ZU7A 1PVXA 1V6KA 1JZ8A 4FPOB 3N7LA 5C5UA 2VMGA 5FZ8A 2ZJCA 1GANA 2VUJA 4OCTA 2RDNA 4R9BA 1LHWA 4BIOA 2EXKA 4AI9A 1GSLA 1OPOA 1YQ5A 1QOTA 4AFMA 1CGPA 4PLNA 1V9U1 4Q0VA 1D4VB 2XLGA 2DDUA 2JDZA 4A45A 4LULA 2GH8A 2TUNA 3CJIA 1N47A 2ZMKA 1ZZBA 4A4AA 4AFAA 1IPKA 3AZVA 2XJVA 4IV3B 4GWIA 4NPMA 2DCKA 1Q8PA 4GWNA 4YW2A 1Y4WA 3MZHA 3WNKA 1AYM1 3BTXA 2PXJA 3T3YA 4BZ4A 4LKFA 5A3WA 2W0XA 4IUGA 3RPQA 3LSDA 4XFHA 4P9JA 2R063 4C91A 1C5IA 2VBDA 4K1YA 1HRV1 1S0BA 3USSA 3ACIA 4A7ZA 1FXZA 2WNVA 2W5FA 2ZGOA 3CEWA 3DECA 2WZ8A 3NKGA 3VN4A 2YC0A 4V2VA 1DGWA 2HWF3 1RUC2 2ZHMA 4XVHA 1LRHA 2OKXA 2R6QA 4NWVA 5A32A 1RIRA 4WVMB 1XU1A 4KU8A 2BQPA 1W6NA 2R041 2XJTA 1NX9A 5CU1A 2D6OX 1JZ3A 1SG3A 3CBNA 2BERA 1C1FA 2H0BA 2G1MA 1NG0A 1AR92 1O8SA 2BUKA 3ZMOA 2JE7A 3H7YA 4Y26A 3VBSB 3M4FA 1ZNPA 3UJOA 3W59A 4Y4YA 5A7OA 4COYA 2YBSA 2E51A 4AFBA 3OBTA 1YQ6A 2O8QA 1BKZA 1AL21 4AEMA 2WWJA 4WM7A 1GZCA 1OXCA 3SCFA 4Z1VA 4EN0A 3O12A 2VXJA 1GP6A 3Q8EA 1MS4A 2VNVA 1JXNA 1UW8A 3N9OA 1W6PB 5C8CC 2XB6C 2YDEA 4DEVA 3LGRA 3H3ZA 2A3WA 3CQOA 5AFEA 3TEXA 4Q27A 2VECA 2XMLA 3AL6A 4PQ9A 5L7OA 2GMPA 3VBFA 4OFGA 4P9GA 4UF0B 5C8WA 3WP5A 4B1MA 2XXZA 2G19A 4OHYA 2DV9A 3ACHA 1UMZA 2PAKA 2RVAA 1XNTA 1I9RA 2ZHLA 3JD71 1W6QA 4EWDA 1XNCA 3K51A 1RUJ2 3C7EA 4KNCA 1GP4A 2WS92 4DFSA 1S0JA 1Y9MA 3ECQA 1HKDA 3MF6A 3O14A 1QEXA 1V00A 2ERFA 1AYM2 3IAPA 3VDDA 4DQAA 1PO22 3FWEA 1UOJA 3OF1A 4DRVA 4Q4Y2 4D69A 1Q8SA 4YZ2A 4Y1YA 5EFUA 1SPPA 2ADEA 2YBKA 3VL9A 2ARCA 2R061 1X8EA 5FZGA 2JWPA 3OPTA 5C4WA 2XVKA 3RYRA 1VR3A 4ATFA 3BVCA 5DAQA 3ZKYA 4C1XA 5FZFA 1HB3A 4IV1C 3RI9A 1W8WA 5FY0A 5DG1A 2AUYA 1W0PA 3PUIA 4GB32 4JRLA 1QKQA 2JENA 4Z2AA 5L7OB 4CE8A 3J7MA 2SBAA 1UCXA 2QDNA 3PMSA 3NW4A 3NNJA 3MFCA 5FZBA 5FZAA 2VQTA 4Q4Y1 2IC1A 3WNOA 3ZSMA 2XPJA 1QF3A 2K9ZA 2BV4A 3T4HB 2IXLA 2VZVA 4YLZA 2WFF2 3WD5A 3WT3A 2OPKA 4K6BA 4QWNA 3V65A 5BNOB 5FZMA 4GMP1 5I8YA 4OI2A 4P9YA 4L99A 4PCRA 1FMD3 1W6OB 4RQPB 3IWZA 2ET7A 4FBFA 1J83A 3J26N 3KVAA 2J1SA 1ENQA 5K8SA 3S57A 3OGRA 5DDJ3 2XVGA 5F1RA 1UY1A 2O0OA 4XABA 1VB2A 1U5YA 2VVFA 1QXPA 2TNFA 1RINA 4PIXA 5L36A 3V0BB 1A34A 1REDA 5L9BA 1ZREA 3POJA 4QHZA 3AZXA 3ZKUA 5IAXA 2YZ4A 5LA0A 4OQ8A 4JHTA 4S2FA 3BPZA 4HG6B 1TE1B 1NY71 5F6LB 2JDAA 4P9XA 3OYWB 5C3QA 5GLWA 1W9TA 4JC1A 4RR3A 2YXSA 1ZA7A 1LENA 4PDWB 1QJEA 5B2GB 3Q8AA 1ASJ1 3UKVA 5LK5A 4KWUA 3AC0A 3V0BA 1HIXA 3IAQA 4ES8A 5F2SA 3AMHA 1ZRFA 4HT1T 3VZNA 3ILNA 2E6VA 4JZRA 2EXHA 2VPVA 2JIGA 1LOGA 2XQXA 4CDQB 4CUBA 1PK6C 4FTEA 1W6QB 4CDUB 1QDCA 2VZRA 4I0BA 1MS1A 4HSLA 1UPSA 1AYN2 3IIIA 4WVVA 5J37A 1RUF2 4MXWA 1AHSA 5G04L 3WY6A 1BJQA 4A3XA 1ZZ9A 4BH9A 1JU3A 1LNSA 2Q4SA 2W68A 1Z7S1 3VBFB 5BNOA 3U10A 2D7FA 4LKDA 5JSPA 3S5AA 1CR7A 2WAAA 2PELA 1O59A 3MBWA 4B1LA 3INAA 3PNAA 1T6GC 2Y0IA 4M3CE 1DCSA 1RUI3 4N7IA 1IG0A 3RSJA 5C71A 3RZMA 1LOBA 4MADA 5FZ7A 3S7EA 3WQ0A 2QTWB 1F31A 4MOAA 4YARA 4D6SA 1UY0A 4P9WA 4HK8A 4WZFA 3BU0A 4NRPA 4W50A 5A7NA 4JTNA 2Y6LA 1URXA 1KITA 1VIWB 1ZBE1 2QZ2A 1PGL2 2Q1MA 3KV5A 4XIOA 4ZXKA 5FV3A 1M4WA 2GP5A 4O65A 1DHKB 5B4NA 1JYVA 3K2OA 2Y8KA 4XFIA 2WQZC 2VZ3A 1AR63 1MZ5A 1A3KA 2EXJA 4MO3M 4Y33A 3DYMA 3F95A 2WIIB 3HIFA 1S55A 3OPWA 4YRDA 4CCLA 2D6NA 3E1F1 2HEYF 3GDBA 4QX7A 1RUOA 2QVSB 3KT7A 1X7NA 4CCJA 1NAEA 2Z42A 5J3UA 2ILMA 1YFWA 4OI0A 2JJ6A 2PLV1 2UU8A 3AMMA 1GMMA 1OQEA 1O8PA 4AGGA 5CFCA 5FJHA 1OF3A 2QKDA 4KGGA 4N53B 4TN7A 1E57A 3ORJA 2GN7A 1A6CA 3PTYA 4L92A 2ET1A 1VLNA 1CJDA 4FPHA 5HCAA 4KL1A 4LTAA 1QH7A 3GHNA 3P1IA 4E2GA 3RZJA 5LASA 3K77A 5HCHA 2IVJA 3X29B 1GBGA 2CSGA 1S1AA 4ZU4A 4YSFA 3H50A 4E27A 1WZXA 2QQMA 4RQPA 4JHZA 1HV0A 1GV9A 1UYXA 4AHZA 4PJYA 5LWBA 2ZX1A 2YYOA 1W8HA 4ES9A 2ZAAA 3VZOA 3VKNA 3WP4A 1VRH2 4PDWC 5BV6A 4M0HA 1RUH3 4FFGA 2AGSA 2YFUA 4IE7A 2HWB2 2JG9C 4FOYA 4QM9A 1Z7S3 3OB8A 4ISQA 1QJZA 2WZR1 1MR5A 3DGTA 4WV8A 2JDUA 1B35B 2DUQA 3VZJA 2HWC3 2QBXA 5FPUA 4YPJA 2XWJB 1UXXX 1YEWA 2ZS6B 3NAPA 3CLPA 1SCSA 5C4WB 3PDQA 5A7WA 4QQ2A 4PT6A 5LA1A 3KSCA 4Z07A 1ZA4A 2GAUA 1BEV1 3NRUA 4XUTA 2NQYA 4EWAA 4N9IA 3MIFA 3GZAA 3MPBA 5FR3A 1OT5A 2VOKA 1AYN1 1YQ8A 1JOBA 2GN3A 1REFA 1Y9QA 4MH0E 2RE9A 4P08A 2ZGMA 5F32A 4CDWA 2RJKA 1MZ6A 5BNPB 1YRZA 2WO1A 4CPBA 3IZOA 3D3AA 2A3XA 2PAEA 4QQLA 2HH9A 5IWFA 5IFPA 1RMU2 2WAOA 5FY4A 4FFIA 2WYFA 3AZWA 2BRTA 5FBJA 1X82A 2DF7A 3B93A 2B42B 1UYPA 3MW2A 4HZFA 1CN1A 3O7OA 4Y1VA 5E16A 4AGRA 3VD9A 1D2QA 1W99A 4OHXA 3PVBB 5IUQA 4B3NA 1PIV2 5CFCC 1X9PA 2WLPA 1PGL1 3A23A 2CY6A 3O1TA 1C5HA 1Q8VA 1QJX1 3BI3A 5JIUA 2AH2A 5FDBA 4PIYA 4PF5A 4AW7A 1A78A 2FCUA 1WWYA 1ZBA1 2RDRA 5FMDA 3H0OA 5C3PA 3OCPA 2BVBA 2JE8A 1VBB3 4I3PA 4NHXA 4Q4X3 4YW7A 5JI7A 2DFCA 5GZGA 3FLTA 3N7KA 5DPNA 4FVVA 4DOUA 3EQEA 4XMAA 2X8KA 4GH4C 3JD73 4NIIA 5SV5A 5JUVA 4KWKA 3ZFEC 1JUHA 1WW4A 1GNHA 5JOXA 1L3JA 3MUY1 3LPFA 4HVQA 1UF2C 5FXZA 1CD3G 4LLFA 4M3CF 1NE6A 4N53A 1NLSA 1GWMA 3KCYA 4UW4A 4FSJA 1PMIA 2N7GA 3O0WA 2F4PA 3OG2A 3VKLA 1AL23 3EO6A 1FOD1 3CL1A 4YM1A 4B7KA 4DXZA 3WHUA 4LLOA 4CPBD 2CAUA 4FOVA 2R071 2F4LA 3MYXA 1QJY2 4IEZA 1JH5A 4JGZB 2RS11 2C9AA 2Y64A 1O3TA 2FDGA 5A6ZA 4BIFA 2LM3A 4CCKA 2PHDA 2WNEA 1RXFA 4KI5M 4CCMA 5K0UB 4YGBA 4FAHA 1QU0A 4N53C 3T30A 5JXIA 1WW5A 1WLWA 1FX5A 1VBD2 3PL0A 4YW5A 5FYSA 3RMXA 3WHTA 1GUIA 2HWF2 4QPGC 4AK3A 5I93A 3S6PA 4FP3A 3ZYFA 1US3A 3OGSA 2VAUA 2WINB 4QXKA 3KS7A 1NCRB 1EY2A 3VDDC 4XBLA 1V6OA 3BGAA 3FBMA 4MZUA 1OLRA 5JSRA 3RRDA 4FPFA 2DWRA 5J48A 3OBAA 1AR71 1ZRDA 2J1RA 1RYYA 3POIA 2LTNA 4UXAA 2I07B 3UYJA 1PX4A 3ZFFC 2BJSA 1HRV3 2ZTNA 3JU9A 4I3GA 1JYIA 5IYYA 4I30A 3MICA 4JQTA 2R062 3OGVA 2VQUA 4OZOA 1BK0A 3JCIA 5T50A 3EBRA 3VHPA 3MI8A 1UOGA 1S0DA 1QJY1 2P34A 1RUC3 3GXUA 4K40A 3VV1A 1D0GA 3WVJA 3QD6A 2VZPA 3FBYA 5FUNA 2YPDA 5BNNC 1F5FA 3FJSA 2WO3A 4A41A 5J36A 2ZHKA 5FZDA 1YHFA 5C4WC 2P3YA 4B8EA 5FWJA 2HWE2 2ZGTA 5FXXA 3MLKA 2WNUC 4Q8KA 1BYHA 4AEDB 3R05A 2VVDA 3KLSA 2RS53 4NUBA 3ENRA 1KQRA 3NWKA 3Q8BA 4E4HA 5DXDA 2ZX4A 3DCQA 4QXBA 4FPLA 1Y9GA 2OYZA 3TEZA 3VHOA 2VMCA 1ULPA 4GH4B 3I59A 5ACA3 2HBUA 1P8JA 2XONA 1RUD1 4IGOA 3T2TA 2YC4A 1PNFA 4YGCA 1CAUA 2EXIA 1MZEA 3MIHA 4UFLA 2CWSA 3KB5A 4M01A 1HQLA 5GM0A 3ZN6A 5JSOA 4Q2FA 3N7JA 5FYUA 2WSVA 2D93A 2GC3A 1T2XA 3EMRA 5F3GA 3SKVA 1R093 4K8RB 5FZHA 3BTYA 3MLLA 1ND2A 1IOAA 3AKQA 2JKBA 3POGA 2DU0A 4K20A 2RDQA 4AXOA 5IHRA 3DN7A 5DZEA 1IS6A 4MVTA 1UX6A 4ZONA 2WZR3 4NN0A 1UU4A 2C6SA 1LOAA 1LESA 3WF0A 1RUI2 4E2QA 1MVEA 5DUVA 5FMOL 4DNYA 1OFNA 1Q3EA 3RFRA 4D8MA 3JBG3 2A70A 4XCBA 3AKSA 1H4HA 2ID4A 4XF3A 2B39A 2GNDA 3FHIB 4PBPA 2HWE1 2VMFA 3O0XA 5FQ0B 1D0HA 1QNYA 3UL2A 4ET7A 2RHPA 1VE0A 4F83A 2ZGPA 5EZWA 2GALA 3FC0A 3M2MA 3T2OA 4XDOA 1YQ2A 3P6BA 3QOPA 2LRPA 1JMUB 1UZYA 3N9QA 4QXHA 1JZ6A 4HL0A 2WYSA 1CZTA 1KFUL 1CPNA 1V0AA 5K4LA 2R30A 2ZX3A 3FL7A 4CCCA 1G9FA 2W3JA 4IV3C 4YFWA 4D7SA 4B4RA 2QQLA 1VALA 2A6WA 3KHCA 2HWB3 1W0OA 2A3YA 3ZR5A 1DZRA 2R49A 2BU9A 3LEIA 3N35A 4XE9A 4ZZ5A 5IK4A 2MPFA 1AR72 1AR83 1W8OA 3L9JT 2W1QA 4GZ9A 1QJU1 4H7MA 5ANQA 5C3SA 1F15A 4RFRB 3OUIA 3MLJA 1MPXA 4GALA 4ARYA 3VBRA 3VDCA 5JIAA 2O1QA 4RN5A 1W9SA 1LODA 3SCHA 4LBLA 3GBFA 2B46X 5C9AA 1COV3 3UGGA 5FBZA 3P3NA 4GAZA 2J42A 2XKOA 5EJZB 2OT7A 4HETA 3DPRA 1RUF3 1UX7A 2ATFA 2RV9A 4UFKA 1CAWB 5A3MA 4ITCA 1QGLA 5D8AB 2IWGB 4AZZA 5J96B 1H8TC 2RS51 5CFCB 4GKXA 3VBRB 5F37A 1YQCA 4PIZA 4AI2A 1RUH2 1C1LA 4TTGA 1RUG1 1CWPA 1BXHA 5C5TA 4Q4W2 3T1MA 3WW4A 1KJLA 1IS5A 5T5JA 3DKWA 1O4TA 3OUJA 4NIAA 1OKOA 1W8TA 2FCVA 2YGMA 4HFSA 3WG2A 4D6QA 3THPA 2WNUB 2DURA 4F8AA 4M00A 4MGTA 3LFMA 1H1MA 1RHI3 2WZEA 2J1AA 2WFF1 4UAPA 3T2QA 4BQ1A 4YZ3A 3DKQA 1DZQA 1AYN3 4QU2A 1BMV2 4H3WA 2WFPA 2WWSA 4MSVA 1UYZA 2VL4A 3H8RA 2Z2SB 2VG9A 1UKGA 3OBZA 4KH9A 4OMCA 1FMD1 1POV1 3CJXA 4Q1RA 1K45A 2CYFA 2H6BA 3O1RA 1PGW2 4YZ4A 3K3NA 2ZGSA 2VUAA 3U14A 4FOQA 5DAPA 4OI4A 4HN0A 5FY1A 4IEOA 1H6XA 3NV2A 4U36A 4WM8C 1ASJ2 5DQ0A 4UT5A 5F5QA 1B09A 3DXTA 5A7QA 3SNMA 5EQUA 5EWSA 1OLMA 2BTVC 5F39A 1WMXA 3VBOC 2R16A 4NWWA 1SDDB 4L9BA 5IVJA 4CDQA 1GQHA 2GSYA 2W92A 4XAAA 3WNLA 5EP9A 4CUGA 4Y5Z0 4R4XA 4CCEA 3BIWE 2FZ1A 2V4AA 1GYKA 1DGRN 1VBA2 4FPJA 4JDOA 3RJ2X 5FLJA 4AAPA 4DINB 2QQWA 3WQ7A 1L7RA 1W9FA 1WA4A 3EJKA 4XCAA 4QKNA 1ZBA3 3KD4A 3ZXAC 5FO8B 4RGKA 2WQ4A 1VMFA 4UFHA 3NSTA 2R043 3VUOA 5LA9A 3ZSKA 3WG3A 4IE0A 1LHOA 1AVBA 1Q8OA 4YVSA 1H2KA 1UD1A 1OURA 2VUCA 2W52A 4EZ4A 4UYBA 4BQYA 2PTMA 1BZWA 3N9PA 5LEJA 1SBFA 2VQ0A 1WCKA 1I3HA 4ZY9A 1S0IA 4PI2A 2CHHA 2BGOA 4MGQA 1CIYA 3RGBA 2BNMA 1TVGA 3HQRA 3JQWA 3Q8FA 4F3JA 1XNDA 1JYXA 4DRRA 2GH2A 1MS8A 1HB4A 2VW0A 4RHV2 4CP0A 2BPA2 2Y0OA 4AVCA 4EQVA 2R32A 5E6HA 4LO8A 4TSVA 3WDVA 3RZGA 3LA3A 5KHKA 2ZACA 3R4UA 3T2PA 2LALA 1V6NA 3VKFC 4CP9A 3LD8A 5LRRA 1S0FA 1AXYA 4O9EA 4CP2A 4YM2A 4IE4A 3L2HA 3IMMA 1RMU3 5DG2A 4LORA 1VBE1 5C8CA 4R9AA 4DUXA 1W6MA 1GWLA 1PO21 1E5IA 2BBAA 2IXHA 1PK6B 4IDZA 5D1IA 5FCCA 3SQOA 3T0BA 1CIWA 2QUOA 3WG4A 2QZ3A 4BE3A 2VULA 1LEDA 2D43A 4O61A 4RS5B 5DUWA 1NCRA 4KBBA 4KMQA 5KR7A 4JCKA 2C9KA 4BQXA 4LXLA 4DUVA 1V6MA 2PAMA 2Y6KA 5FFOC 1CX1A 1UY3A 2BEOA 4QPIC 5H9QA 2XVLA 1X36A 2ZKNA 5K0UA 5DAWA 4XHXA 5FMBA 1D2SA 4INDA 1RTVA 4R9CA 4BXFA 3CKHA 1LKNA 3AM2A 2W08A 4A6SA 3FLPA 3BUCA 1ULFA 1VAVA 5FP9A 5AVPA 3MUZ1 1NCQC 1V6IA 3ZYJB 2FDKA 5C7GA 3THDA 4MHUA 4ISRA 2ARAA 4XIKA 1ZBE2 4Y1XA 3HBKA 1STMA 3R6SA 2R0HA 4FPCA 3VBHB 4MGYE 1DQ6A 3CHXA 1HJFA 1JTZX 2BNNA 4BMEA 1B35A 2HWD3 2X53S 3W5NA 4AQ2A 1MS3A 4A2UA 2BBVA 1RXGA 4LT5A 4YNIA 2EF6A 1JOJA 1MEC1 1MEC3 1S0CA 1W8ZA 4QPGB 3TNQA 3OEAA 3JBG1 4DY5A 4AEJA 1OHFA 4DUWA 3J7LA 3PIGA 1KD7A 1YLLA 3ZVXA 2R7EB 4CVUA 3CJIC 5FRAA 1RJ7A 2WSUA 5BNPA 5AVAA 4NIDA 1CVNA 3MPPG 3TAYA 3ZM8A 5DZGA 5BY5A 2XUMA 2J1EA 2J1UA 4A44A 4QX3A 1I6XA 4COWA 1U5XA 2E26A 3CNAA 2AEZA 1DIWA 3I3QA 2VOVA 4K9SA 2C0ZA 4KU7A 4G3YC 4M0NA 1H8VA 2WDBA 3CF6E 2RM22 1L7QA 4MGIE 3UKNA 1ZRIA 1XJAA 2DTYA 3L2YA 4XJZA 5CYYA 3LDBA 4QQHA 2VU9A 1L7LA 5FK8A 1AR73 1AR82 5ANNA 1N3QA 1WLDA 3IBMA 1BBT1 1PIV1 2UWCA 4N8MA 3WUCA 1DFQA 4Z2WA 5JMOA 1QJY3 1EUUA 2LROA 4R9DA 4QB6A 2MEV3 2OW4A 3WUDA 3TWIA 2D5FA 4IGPA 1OOPC 3M70A 1J3RA 3VDDB 5DN2A 4FAGA 4FFFA 5FY7A 1OMIA 1H4GA 3OJBA 4J25A 4UI9L 3NO8A 1ULCA 3H7JA 4OI1A 2EAKA 3K4ZA 1TEIA 1VBD3 3ZPYA 4DXRA 5A7SA 3WF2A 1UO9A 5DDJ1 4JKKA 4YZ5A 2FD8A 3WV6A 4Y22A 4YGDA 4LNVA 4YG6A 1WLCA 4COZA 1JYNA 1ONAA 1VP6A 3POBA 1TMF2 2D40A 2OVUA 2ZCWA 2JDMA 4LMFA 4UFMA 4BYYA 1EAH2 4X6RB 5JR7B 1W2NA 2G9GA 3RZLA 3NNFA 4XFFA 2E7AA 4WBBA 1VMJA 2C26A 2MHFA 3KT1A 3GZUC 4DXTA 2Y60A 5HPOA 3NNGA 2W46A 3C7FA 2DCJA 3C7GA 3DV8A 3QH6A 4H2AA 4Y22B 3RG0A 2RR12 2HKXA 4FOWA 2LUWA 4CDUA 3GBGA 3WG1A 4CUAA 1KJRA 2Y38A 4IE5A 3O1PA 4IEUA 1MQTB 4OUEA 1SCRA 1NA1A 5FMCA 1ST8A 3HN3A 1NE4A 2NMOA 2OX0A 1QDOA 5FLHA 2Q1FA 1SBEA 1H9PA 4BQ3A 3VBSC 4FTSA 4E4DX 3U07A 1N1TA 2ZMNA 2P17A 2KD7A 3U1XA 4AAXA 4WVMA 4BOWA 4URAA 4CXWA 1FV2A 1WUVA 2GU9A 2OUJA 2IXKA 1POQA 1PHMA 3B02A 2EVXA 4QGNA 5KC5A 1BEV3 5T52A 2YB7A 2CAVA 3CMGA 1FATA 2W47A 2JD4A 1HRI3 1OLME 1DYOA 1RGSA 3BCWA 1IQDC 3Q8CA 4QT6A 4V2WA 1RHI2 3VZMA 1OA4A 4BK5A 1ND3B 1OKQA 3H9AA 1TG7A 1HN1A 2CNAA 3I8TA 1VJ2A 3B00A 3VD7A 4YYOA 1W6OA 3QCWA 1OLQA 1QHDA 2QQKA 2BGCA 2YROA 3N9NA 4P9IA 2E32A 4AF9A 2EIEA 4FO9A 5FPXA 2ARXA 2XHKA 3C7HA 3H8XA 4K3UA 4P02B 1O3QA 3ZSJA 5JVVA 4I2OA 3ATGA 1FOD2 1LR5A 4DPNA 1R64A 1G9BA 1ENSA 2GNBA 5F7UA 2XUEA 2QJVA 2WBKA 4WVZA 2XLAA 4OHWA 1IGOA 1GP5A 1QJU3 3NJZA 4LUKA 3KT4A 4IXLA 5H9PA 3AP5A 5ABJA 2DCZA 1O91A 1AL0G 1QXJA 4AHYA 1R082 4C0BA 1XYOA 3M3OA 1E5SA 3MGUA 2B7YA 1WGPA 4CU9A 4I0AA 4QX2A 5FPBA 1DQ5A 4HKLA 2VR4A 4R4ZA 4NVPA 3VD3A 3HVDA 3QACA 2E33A 3OGJA 3BPSA 1SPPB 4LBOA 4Z82A 4CDWB 5A3PA 4XXAA 3RWKX 1GU3A 3WEZA 4EN8B 3I7DA 5LY1A 2R1DA 5A3TA 2FQPA 3NQHA 4UW3A 4BCUA 4JV4A 4BQWA 5FPVA 1QXRA 3URFA 5DAXA 3OGGA 2DCYA 4LITA 1ZBA2 2J7MA 4HXCA 4QHBA 4NAOA 2XH6A 3HNMA 5ERLA 1GNZA 3PHMA 5LY2A 2ORXA 4MGKE 4RSUA 4L0PA 2GC2A 2D5HA 4OUSA 1G7YA 1XQNA 2P3KA 1DGWX 5GZFA 5HI0A 5JI9A 4XPVA 1HB1A 4Q4W3 1NYWA 4UF0A 4RS5A 4YVWB 4HONA 4QKBA 4ARXA 2NM1A 3B5LB 3KV6A 4CU6A 1C8M2 1W6MB 3FHQA 3VBUC 4LBQB 2BWAA 4BMBA 4SLIA 3HT2A 5L73A 3RJRA 5LB6A 2ZZQA 1IS4A 5D8AC 1XYNA 1VB4A 3RYKA 3WF4A 1VAMA 4CEWC 3ZIXA 5CKMA 3NNLA 5C9AB 5L9VA 1GR3A 1JZ5A 4BISA 1FAYA 1AX1A 3IPVB 1MS5A 4XTPA 1W04A 5FYYA 1LB2A 4YWAA 4N43B 5EV7A 4C0HA 2X5IB 3S0MA 4LR4A 2IVIB 2IXJA 1YI7A 3MV11 5LBFA 1O7FA 3JZVA 3M3CA 1JHNA 3PUQA 4LBQA 4W4ZA 5KHGA 4M4PA 3K48A 1M06G 1R1A3 2VW2A 4CCOA 4Y5TA 3F2ZA 5I0RA 2ZXQA 4IGQA 5EIYB 1D4M1 1XE8A 4C8DA 2HYXA 4YVWA 3ILRA 3VBHA 1AR93 4PLOA 1NKGA 1CJPA 1JYCA 2F17A 1EP0A 2VJXA 2VD7A 3B7MA 1SLTA 3ES4A 1W6NB 3K46A 2CTVA 2ZGNA 1LGCA 3O5SA 4U2AA 1MEC2 1FI2A 1OVSA 2C4XA 1GLHA 2ZZJA 4GD4A 4IE6A 2HWB1 1C8NA 2UWAA 5BYNA 4D6RA 1J1LA 1VAKA 1Q8QA 2MNGA 2RDSA 4KG0A 5C6CA 1X8MA 5BXXA 3RZZA 4H55A 1SFPA 1ZZ7A 5LK7B 5LBCA 1WW7A 3AVSA 4LA2A 3N4MA 3TRSB 2YV8A 4KBZA 2QQIA 3HEIA 4L2NA 4MUVA 5E89A 4ZS3A 4XJUA 5CB7A 4D3WA 4YW6A 2YHJA 4GIQA 1W28A 1MACA 3GJAA 1H2MA 3FFZA 1E5RA 3NJXA 4XEZA 5T5PA 4IQPA 1W39A 1HV1A 4QGLA 2HWD2 2XLFA 1ND2C 4FPGA 4IEVA 2VNOA 1UXZA 4Q4W1 4TLGA 4GB31 4LIUA 1RUD3 4MYEA 3T1LA 3RS6A 2GMEA 5JXGA 2A7AA 1AR91 1MVQA 2ZHNA 2JX9A 1FPN2 2VH9A 3A7QA 3CO2A 4K1ZA 3OOXA 3VBUA 4N7UA 4E8CA 5JAXA 4FP2A 2D6KA 3J7NA 4QKDA 1CQ9A 4ATEA 4NRMA 2VXRA 1Z78A 2JICA 3LE0A 4A7YA 4Q4Y3 1R091 1JBCA 1REEA 2Z79A 5A3NA 1MZFA 2WT1A 3POSA 3UNPA 3R0RA 3ZYBA 3TOJA 2Y34A 1RUC1 2ARBA 2G9FA 4B7EA 3PUAA 4MX3A 2DTWA 2NPIA 4XBQA 4P9LA 3GNEA 3APBA 4FXKB 1OSGA 1UZ0A 5FXVA 4XJ9A 3UK9A 4QPYA 1LHNA 4YG0A 3I54A 2RM23 2YFZA 4LEJA 5LBEA 5BNNA 4RA0A 1EPZA 2XQRA 2QDRA 3O1OA 1ZZCA 3LA7A 1UZWA 2IXIA 2W1UA 2JG8B 3ABZA 1R1A1 3Q9OA 4QB2A 4EN6B 3OSDA 1TMF1 4ONUA 5FO9B 1OF4A 3HN1A 2KXLA 3J7HA 3BU7A 4LKEA 1X50A 5KXEA 1AX0A 2XJUA 1N3PA 4PHZA 1LOCA 4KGQA 4QGMA 3AKPA 3SISA 3AKTA 4QMAA 5CEHA 3WNMA 3V0AB 5D8AA 5EJ1B 2GNTA 3R4DB 3VHRA 3ZFFA 2ZEXA 2W91A 1J1TA 2SLIA 2CDPA 2HYKA 4XJAA 1UMHA 4IETA 5I91A 1EUTA 1VBE3 3GHMA 1W9YA 3SC7X 3TEYA 3M8LA 1XBFA 3E5XA 4XDPA 3SHRA 4XQDA 1LULA 1RUE3 2RMU1 5CVRA 1BBT2 1PZ8A 3ZXGA 2AR6A 4I09A 4CA9A 2B45X 3GM8A 2ZOEB 4Q0QA 4QPGA 5FY9A 5GKAC 3I3MA 4M3CB 5JLVA 1GQPA 2D3RA 2VO5A 5T54A 3KHBA 3OD0A 2WUHA 4XMIA 4ASMB 4AQTA 1N3OA 1Y3TA 1VBB1 4Q4X1 1W3VA 3J8F3 1SBDA 1V70A 3DYOA 5FY5A 1EV12 1HB2A 5GLZA 4CDXB 4Q1PA 1NXMA 2VZSA 1AJOA 5LA2A 3OTFA 1HRI1 2RR13 4EE2A 5FZ0A 2ETEA 4HPKA 4JGYC 1QJX2 2VZTA 1ENXA 4LOTA 3WDXA 3OEBA 3VLBB 1G8WA 1UIJA 3SCGA 1QWRA 1J3PA 4HKWA 1POV0 3AKRA 5JCTA 1FOD3 2JEMA 3ILFA 4MV2A 3I2DA 2KA3A 2NZ9A 1YJKA 4J6GA 3ZYIB 3M3QA 3FUOA 2G4IA 2BVVA 4IL7A 4XUNA 3ACGA 2Q8EA 4X8NA 3USUB 1QQP2 3WP3A 1R083 3HNBM 2Q8CA 1UQXA 2UURA 3CZUA 3RWNA 5D21A 3O1SA 1F5JA 1RVF3 5IW0A 5JPMB 1CAXB 3PVNA 5FK7A 1ND2B 3LSEA 4NMIA 3MO4A 1GZ9A 4CXYA 4JVAA 1RC6A 1F4AA 3I3DA 1FNZA 2B4KA 2YU2A 3ZYPA 4DY3A 5T55A 5LCWL 4CU7A 3IDCB 3DEMA 5FIXA 4EV0A 3NJYA 1POV3 2Y33A 4Q8LA 3ZO0B 4LIVA 1UWWA 2JDHA 2PHLA 3I59B 3TEWA 4RD7A 5HCFA 3T09A 1PO11 4LO6B 4O7XA 3RVHA 5BNQA 3DYPA 2LW8A 2RMU2 5T5LA 3AL5A 5GJ6A 1U5ZA 4OMDA 3VHNA 1O6UA 3TBDA 3AZZA 1JHJA 3KV9A 1XE7A 1VRH1 4CDWC 4LK7A 4NRQA 5D2AA 1PZ9A 2Q1ZB 3IT8A 1IZ3A 3ZYHA 4FFHA 2Z4FA 3M7AA 2OZ6A 1ULOA 3SH3A 1W90A 2XOMA 2ZEZA 4AHXA 3MHZA 4CDUC 2VMDA 3TN93 2GMMA 1XNAA 1ZYBA 4C90A 4YM3A 1X33A 1K42A 2VQAA 5K9YA 1G86A 4W8JA 4Q4V1 1GFF2 2JECA 3N9MA 1PMHX 4I02A 2DVGA 4XXPA 1HJGA 2HWC1 1O4YA 2K0GA 1UNBA 3M1HA 5JOZA 1QQP1 3M3EA 4IEQA 4KWJA 1W03A 1FYUA 3SMHA 1S0GA 5JMCA 3PUHA 2PLV3 5FYBA 1JYTA 3N9LA 4LBMA 1HN0A 2WT0A 3AYCA 1UIKA 2E63A 1TMF3 1C3HA 4FPYA 3ON7A 3VBOB 5FP7A 4LO5B 5GALA 1W9WA 1LOFC 3UGHA 5FZCA 4ZKTB 2R072 3S5QA 4EN9B 3I3BA 4B4PA 4TZDA 3A0KA 4GMP0 4RYDA 5CFDC 5IVFA 3VZLA 1DQ2A 4BWOA 4GB33 5DZFA 1A8DA 1H9WA 4YW4A 3PU8A 3VKOA 2PYTA 1SFNA 1W2UA 3AJZA 1HXS2 4CCDA 2UY9A 4NAMA 4LBQD 1HRI2 5IJRA 2VZQA 5A6XA 3U4SA 1TME1 2PHUA 4IESA 1RJ8A 4XOGA 1V6LA 3ACFA 1DQ4A 1DYKA 2EIGA 4YW1A 2EA7A 2GZWA 1WKYA 5FAXA 4MGZE 5FYHA 4AEDC 4E9KA 4AYUA 2ZAHA 2EICA 1FMD2 1PVC1 4RHV1 1AR62 5IFTA 4CRQA 3V0AA 1K12A 4S2GA 2ZGKA 1U5IA 3ZFGC 2PMWB 1UU6A 4JGZA 2X09A 4CYDA 4XQWA 1DGLA 2P37A 2Y26A 1F2NA 3WF1A 4FI9A 4BPZA 4K21A 2CDOA 3BN6A 3RMYA 1MQTC 5LEKA 3AMPA 3C8XA 4AEDA 2VNRA 3C7OA 4UFIA 2RJLA 5FYCA 1NLRA 5A70A 4LO7A 4XQ4A 5TSWA 2K2SA 1DU3D 4W6WA 3BOWA 3FFQA 4BLIA 2VCAA 3O1VA 1H1IA 3HJRA 3MIGA 3UGFA 4DEQA 2FDFA 3SH5A 1H2LA 5FUIA 1ZZ8A 2GC1A 3QBQA 1WMEA 2X05A 2FDJA 1XSQA 1ACCA 4AI8A 4QKFA 4XF1A 5DUUA 5FZOA 4AR2A 1G9AA 3E97A 4MLOA 4QPWA 2XWBB 2P4EA 4Y20A 1AYM3 1QY4A 4H7LA 5IK8A 2IUWA 5A3UA 3VB9A 1D4M2 3R4SA 1JYWA 1XNKA 2DFBA 5A6YA 2C1FA 4XJ8A 2VZOA 1WBFA 2P3IA 3LEMA 5JZGC 2GDFA 5KXCA 4NROA 3AYEA 3NNMA 5JWPA 3DUIA 2L9LA 3W20A 5AFBA 4SBVA 5BNOC 1OOPB 2CL2A 2NMNA 5CISA 1LCLA 2WR9A 5LBBA 2P3JA 2ZGLA 2JDNA 3P5BA 4CU8A 1QIQA 2PQQA 1W3XA 3GGLA 4OHVA 5CNAA 1LAJA 5JR2A 3EYPA 4XUPA 3AP9A 5I8SA 3LF7A 1FPN3 1XXNA 4ZS2A 5CG9A 2FZ2A 2Q8DA 1DLCA 4FXGB 4IV1B 1SEFA 2VM9A 2IFRA 1LHVA 3WLUA 3TB0A 2JG9B 4AEKA 1LU1A 3D0JA 2YBPA 2W2IA 3CDZB 3ZYGA 4CEYC 5HBAA 1SLAA 3WNNA 2R0FA 3I2OA 3IIAA 2WA3A 3GBWA 4TYSA 1OI6A 5FZ6A 1RMU1 4EWEA 3HAGA 1XPWA 5J7MA 1T6BX 2PA7A 4LA3A 4BQ4A 1YUDA 2XG3A 3BTZA 1LJ7A 3E6BA 5AC91 1OH4A 2VCCA 2VGDA 4LO4B 1K5MA 2X5IC 1NZIA 3H3LA 4M3CA 2VY0A 2WN2A 1WW6A 3N3HA 4AHWA 1CONA 1I5PA 4HK9A 3H8OA 1K5MC 2X5IA 3ELNA 4GA9A 1BK1A 3AP4A 5JZGB 2XHNA 4IEXA 3B9IA 1KDKA 3NV4A 4BM8A 4QD2A 5FMOS 3TNPB 1RUI1 3NV3A 4URTA 3DPRB 1ODNA 2Q30A 2YU1A 5FO7B 3TYJA 2YMZA 1GZWA 3VBUB 3JD72 3KF5A 1C4RA 4XHBA 2ADDA 5DDJ2 1IS3A 1RUE2 1W05A 2JD9A 2WS91 1GNYA 1OQDA 1RB8G 3P3PA 1CAXA 2BWCA 3SITA 3ETQA 5I0TA 1H1AA 1OA2A 2JXAA 3ETPA 2YUEA 1VRH3 3W9AA 2QQNA 2QQOA 1W06A 5FTTC 1JS9A 1W8UA 3LA2A 2RS13 1EAH1 1EAH3 2OQ7A 4N43C 3JBG2 2WZPP 3PU3A 3KGLA 4HBNA 4O9GA 4P14A 2UWBA 5FPAA 3W21A 5KHJA 5BNNB 1H8TB 5FZEA 5ACA2 1RVF2 4CZSA 1XU2A 1US2A 1WCUA 4AI3A 3JQXA 5E1RA 4IEWA 3K75B 4GMP3 1HX6A 3J9SA 1W2TA 5FY8A 3NKTA 1UL9A 2CWMA 2QNKA 3OUHA 1RUF1 5CFDA 4RS5C 3WW2A 4AG4A 2YY1A 4AL9A 2HJIA 2ZEYA 4HPKB 1R1ZA 2AYHA 3BIEA 1VMHA 2JG9A 4UBGA 1B35C 1K5JA 3JUUA 4LBJA 4QQOA 3VDAA 1ENRA 4CP1A 3UETA 1RUG3 4CDXA 2VTFA 2JB4A 1KDMA 1ZVFA 5FOJB 2A73B 2YC2A 2A75A 3SEEA 1GOFA 5ABJB 1ALYA 3A0NA 4JGZC 5G05L 3RQ0A 3PMEA 4XJWA 4XUQA 1WD4A 3BTAA 4LHNA 4TLFA 4A7KA 3AYAA 3THCA 3IDAA 1YYNA 4DZGA 4MXVA 1AR81 1DDLA 2DVDA 4ZZ8A 3OPZA 5T5OA 4NPRA 1NZCA 4HVOA 1SHWB 5F2WA 2D3PA 4AVAA 2RG4A 4LHLA 4UBHA 1JZ4A 1VBC3 4N43A 3GALA 3K3OA 3TN92 1HRV2 2PN5A 3IPVA 3OD4A 1BEV2 1I1EA 1RUH1 3ZSEA 1COV2 1UY4A 4MXWB 3RNSA 1JODA 5FKCA 3LAGA 4IERA 4FCAA 4BQ2A 5IVEA 1CZSA 1RHI1 1SACA 3BOPA 5APAA 3MF9A 1GOHA 1NCQA 3MEPA 1BQPA 3ASIA 4XBNA 3ZFGA 1CESA 3ZFFB 4LHKA 2W1WA 4X6QB 4LKSA 1WCQA 2NN8A 2W39A 1V9U3 4K7JA 4CDXC 1LOFA 2IXCA 2HWE3 2J1VA 3LPGA 4QB1A 1JUIA 1OVPA 3HR9A 1OQ1A 4L8QA 2D6MA 3WSOA 4W6YA 5KC6A 2FMDA 2OPWA 2Y6GA 4Q0UA 5JOYA 1BMV1 1O3SA 2BGPA 3DPRC 1QJU2 1S2KA 1YI9A 4JDNA 1AUYA 5A33B 3J8F2 3H1WA 5IVCA 4KG8A 3O1UA 1RUNA 2V72A 3E5UA 4ZXEA 3T08A 2DVAA 5KHIA 3WDYA 3CZJA 1YFUA 5J09A 1NA1B 4LBNA 4V1PA 5J1XA 3ZYRA 3S30A 1HXS1 4ASKA 1RITA 2Y6HA 3ALQA 1DGRA 2P5BA 5IT6A 2A6XA 5H9RA 1R092 1UN1A 2PLV2 4RGGA 3SKJE 4EZHA 1TZOA 2ORZA 3AMNA 1XOYA 4XFCA 1FNYA 4CEYA 4BJ0A 2CGOA 4A6OA 3S7IA 1X9TA 1RUJ1 2WZR2 3QH7A 4OYUA 4JKLA 2ZX0A 4GWJA 2B5HA 4JAAA 3LIHA 1N1YA 1PVC3 5FXWA 4PI0A 4AQSA 3OBRA 4AVVA 3WCSA 2HWC2 1BHGA 5KHHA 1EV13 2EIDA 4CUCA 1G6NA 4QPIA 4NR1A 5GLVA 1JI6A 3I2JA 1QNWA 3FZ3A 5FP4A 4AWDA 2FHRA 3T4VA 2DUPA 3VBOA 1HDKA 3VBHC 3AMQA 3ACLA 3E5QA 4Q29A 4Q0PA 3ZOIA 2VZ1A 4I01A 5CFDB 3D82A 1SLIA 2WNUA 3GJBA 3HT1A 4IEPA 4EN7B 3U75A 3PVOA 5FYMA 1C57A 2JG8C 2I74A 1MS0A 3RZHA 1UZVA 2A71A 3LQCA 4D94A 3OYWA 4WVWA 2D6PA 3IMNA 3E6DA 2JDYA 2GNMA 5FYTA 1TME2 3KMHA 4R52A 2W1SA 1QQP3 3BB6A 1GQGA 5F3EA 2KM2A 5A1FA 1OBNA 4NPLA 1QOOA 1NCQB 4WM8A 4P5HA 2E9QA 1SLCA 3BODA 1XC6A 1ODMA 1CAVA 5ISLA 1EV11 4UFJA 3LKJA 4XETA 3WDTA 5GZDA 2ES3A 3HNYM 4XC9A 4F7ZA 2DVBA 4WM7B 2BOJA 5FZIA 3U4XA 3D5OA 3H3UA 3PTRB 4NOTA 1D4M3 5ACA1 1F9KA 1WBLA 1GICA 4YG3A 4PBOA 1NY72 1J58A 4OULA 5H9SA 1NLQA 3AXEA 3H1YA 2I45A 1AZDA 1W2OA 2AENA 2BOIA 2ZABA 4LJHA 2R073 3H8UA 1S4CA 4QDRA 4QX1A 2WO2A 5JDBA 3JB4C 2NLRA 1C8M1 4X8PA 5AC92 3ZXJA 1NQDA 2VMHA 1FT9A 4EYUA 2WRAA 4UOJA 1AL22 3KVBA 3ME2A 1YIFA 1HXS3 4W65A 4LHSA 3SH4A 1I5ZA 4XFBA 5FZLA 1EPWA 5A32B 3ZFEB 3AB0A 3WCRA 1RUD2 2HBTA 1LU2A 2RS32 3AP7A 4XFAA 4E4ZA 4G9SB 1IQAA 5F3IA 3FN9A 3B69A 1C28A 3PURA 2VOWA 5F5IA 2XGXA 1PM7A 1JW6A 3ZN5A 3LWCA 2PFWA 1MQTA 2QE3A 1H8TA 5EPAA 2OA2A 3PJYA 4OZXA 5GZEA 1UYYA 1UAIA 3MIEA 3ZFEA 1BVVA 1ULDA 4NE9A 2P1BA 1ZX5A 2WKKA 4XZUG 5CAZA 2LS6A 4MG2A 4BA6A 2P2KA 4DXSA 1H2NA 2C24A 1PO12 1OPMA 1YC61 1O5LA 1KXGA 4LBKA 3HMYA 5EJ3A 2ZKLA 1UOBA 1ASJ3 1DBNA 1WMDA 5L19A 2RS52 4OVEA 2P6HA 3MIBA 2VMEA 1OFSA 4XF0A 1CX4A 1GZWB 3ZDVA 3PVEA 1A8MA 2XJRA 5IK5A 4FQZA 1PO23 3HD8B 2H6CA 5HV4A 1UZZA 3NJVA 4TXWA 1VRBA 2ZA9A 3ZN4A 5CZKA 5HXVA 2CGPA 3LB9A 2E53A 4XURA 2D98A 2UYAA 4FPEA 1ND3A 5FYVA 4AOCA 3NMBA 5B4XA 1WA6X 2WC2A 3VBSA 1K5MB 1ZRRA 3U0ZA 2Z5WA 2A1XA 2O8OA 3MV01 3ZXLA 3AZYA 2VW1A 1Y7BA 4MHRA 1YCIA 3RI8A 5A33A 3B9CA 1NA1C 4YW3A 1WD3A 3LDRA 2PHWA 3RDIA 2W87A 4D7TA 5CIRA 2GC0A 5LZ6A 2ZGRA 1IHMA 2OZJA 4RR3B 5I0UA 1OD5A 1PM4A 5BNPC 1IKQA 5FZKA 3WXPA 2E7TA 5CKQA 5FOBB 2FDIA 2AZ5A 5I8TA 1PMJX 3NAPC 4COUA 3FMGA 4QM8A 3SLIA 2CV6A 1IPSA 3D8CA 1DYPA 3LDKA 5DAVA 2Q5TA 4AGVA 1W2AX 3VKMA 3EB7A 4QU1A 1H0BA 2WL1A 1QH6A 3IDBB 4QX8A 5IATA 1QJX3 3KZ4C 3LEGA 1V6JA 4YM0A 4W6XA 1DQ0A 4L11A 1O4ZA 3WR0A 5LRSA 2JE9A 3ZLIA 2DUOA 1LGBA 5FYIA 1GOGA 3ZIWA 3VL8A 2D3SA 4P00B 4BU2A 5JOWA 3GZTB 3JB8A 1VBA1 4Q4V2 3UV9A 3O0VA 4AI1A 3AYDA 1RVF1 5E88A 2BFUL 1Q43A 5CADA 4OHZA 3IB3A 2YG0A 1VBC1 3J8F1 4CEYB 1QOSA 1JN2P 2K46A 1XRUA 2TEPA 4PF1A 4RGAA 5ABJC 2VCMA 1NQJA 2IFWA 5A1AA 1SFYA 4HVRA 4E2SA 4AVSA 2JDKA 3ZMNA 4N9HA 1O5UA 2ZEWA 3POEA 3ROUA 3U78A 5FP8A 2J22A 5F6KA 5FKBA 1QMJA 4J1XA 3WDUA 3AVRA 3NV1A 2A6VA 1Q56A 1W8NA 5CKNA 3MIDA 1ZBE3 1V9U2 5FZ4A 2AREA 1PGW1 1PGSA 4PDWA 2FBEA 3I3EA 1RUE1 2RMU3 3KF3A 5I0DA 4ORFA 2H0VA 1RL3A 3A21A 4Y4RA 2WABA 3I2FA 4AQ6A 1COV1 2YPJA 1AR61 1N1VA 1PVC2 5F9TA 4GWMA 1KRIA 4B29A 4Y3OA 2W95A 3ZXFA 3UJQA 1W0NA 3WINE 2A5ZA 1YXWA 5L9RA 1NXD1 1PX3A 1LEMA 1SQ4A 2OUHA 3C2UA 1SMVA 3ITQA 4HKOA 4ASLA 3ZFGB 5C8CB 3OY8A 4GJZA 4ZU5A 5EHDA 2QQPA 4JQRA 1G9DA 3FHAA 2XL7A 2JDPA 3I49A 2ZGQA 2DVFA 3ES1A 4YZ1A 5F5AA 3FLRA 4NIGA 1AXZA 5EXOA 1YJLA 3SEPA 3RZKA 4Q5OA 2WLQA 5A3OA 1TNFA 2XBO2 1UY2A 4OQ9A 1SZBA 1RUG2 2WA4A 4META 2QQJA 1S2BA 1OA3A 2WN3A 4BLJA 5M0TA 3E6CC 4Y1UA 1CAVB 4DS0A 1J59A 2D97A 2ZX2A 3KQ4B 1BCXA 3UT0A 2ZMLA 3KWVA 4HLTA 1MS9A 4CXXA 1DQ1A 3HQXA 3I2HA 2RS12 5FPZA 4COVA 5C3OA 3M3IA 4JGYB 5K0UC 4BB3A 5FZ9A 3MDPA 4Y24A 3HBZA 4M4RA 4ZPIA 4YVSB 3THTA 3WP6A 2MEV2 2HWF1 1UPIA 1HW5A 4IW3A 2ZPXA 3HWJA 1DF0A 1VBD1 4QHOA 4YGEA 2WT2A 2V09A 2DU1A 4B4QA 3WZ1A 5A6QA 4JTOA 1YNAA 4XAEA 2VBPA 1RUJ3 4NHLA 4PLMA 2JIJA 3D0SA 4AVTA 3H1MA 5A7WB 1FPN1 3WQ1A 4KWLA 1JOPA 5CBLA 2W94A 2WQ8A 2ZBJA 1KEXA 4QX0A 2B9UA 4QDSA 1TNRA 3ZSLA 1TQ5A 4BK4A 1APNA 4UWDA 1NT0A 2WJSA 3CU7A 4S2HA 5KXDA 3K4DA 1OUXA 1AXKA 3AFGA 4QPIB 2JKXA 4XILA 1TME3 2XL9A 2YGLA 5DABA 1YFXA 2ZGUA 3PLQA 5A80A 2C5DA 1VBC2 2X10A 4BQ5A 2KR2A 2XR4A 1YIPA 1PK6A 5DUXA 1CAWA 1SLLA 2VMIA 4AFCA 5A1LA 2AACA 4XDQA 5HV0A 3I97A 1K3IA 1J3QA 3QLQA 4CP9B 3H42B 4QXCA 1W6PA 2DBNA 4Z8BA 3WOGA 2EAAA 3B94A 2EIBA 3ZN6B 1WCSA 4GQ7A 2VC9A 5BPXA 2B9VA 2VZUA 4RHV3 2VVEA 1ZRCA 3PUSA 5FREA 5JZGA 3PIJA 3ZXEA 1VBA3 3HQUA 3VD5A 5GLTA 3WNPA 4I0WB 4Q26A 4NIHA 1LHUA 3AK0A 3AP6A 1NUKA 3POYA 3U11A 5KBFA 1HQWA 5C33A 1KS5A 4OLLA 3UESA 1PO13 2O14A 2WNOA 2R042 4NHKA 2QFEA 4TWTA 5FZ1A 4BXSV 3ZDSA 5F3CA 4HOOA 5IK7A 3WF3A 1DZTA 5FUPA 1XSRA 3ZR6A 2BP6A 3T0DA 5A7PA 1ZM1A 4GXLA 2V4VA 4XZPA 5FWEA 3VZKA 2Y6JA 4C1WA 3TN91 2P6CA 3B3QE 5LATA 4BHPA 2BYVE 2HWD1 1VBB2 3JXSA 4Q4X2 3VBFC 4DO0A 3MW3A 4XF9A 1OC1A 4YVWC 2DYCA 5L7OC 2VUDA 5LW9A 1UU5A 4AVBA 4GULA 1WCDJ 4EROA 4BDVB 4GKYA 2XKPA 4E8DA 3SXWA 1DP0A 3ZXDA 4Y1ZA 3A22A 3AFKA 1SLBA 2BDRA 2VTXJ 2TBVA 3WNXA 1R1A2 1U12A 3UKTA 2FDHA 2V73A 3T0AA 4A3ZA 3J4UH 4LE4A 1BLZA 3W58A 4R8HA 1CZVA 3CJIB 2R1BA 3DL3A 1OOPA 1OUSA 4NHYA 4D7YA 2RS31 2Y6FA 2CGNA 2QQUA 3IKWA 2EALA 4CEWA 1YFYA 1LTEA 5FP3A 1EYBA 2JB8A 1D7PM 4YFZA 2OIIA 3RYPA 1UMIA 4AFDA 3O1MA 4GJYA 1IKPA 3EXUA 1OD3A 1JZ2A 4Y20B 3FX3A 3I2KA 2PHFA 2DCTA 4XFGA 4HN1A 3WX5A 2W9XA 2A6YA 5JXJA 2V5DA 2A6ZA 1DG6A 4D0QA 1UOFA 2CU5A 5DMYA 3NVCA 5JPNB 1JZ7A 5IVBA 1IPJA 2V5YA 2WNVC 1G9CA 1KFXL 5FQ0A 1W8FA 5A3LA 5JXHA 4FT8A 4G4FA 4QAWA 2RJ2A 2XJPA 4RQPC 4Q4V3 3ZX7A 4HMZA 1YWKA 1ND3C 4L97A 1CPMA 3WW3A 5C9AC 3ZXKA 1ULGA 4Z92B 3LIGA 1F35A 3KGZA 5C70A 1N1SA 3VD4A 2WS93 5J98B 4QDQA 4XACA 3B01A 4HSJA 2X29A 2Q8OA 2VOTA 1ULEA 4CSWA 1HQNA 5EYXA 2J1TA 2OQ6A 1Y43B 2HEWF 2XJQA 2XJSA 2UY8A 3DF0A 3NL1A 3OY8B 1XB9A 4UW6A 2Z69A 5SV8A 1VPHA 5HXMA 5F5CA 5FJKA 1Q5OA 2G9ZA 4GH4A 1S0EA 3AXDA 3IDEA 5AC93 4FTBA 4XF4A 3USUA 5CG8A 3AX4A 3ZPOA 3GYDA 3C3VA 2E31A 3G6JB 3KCXA 4LUMA 4CDQC 1Z7S2 3GZEA 3EHKA 4QQPA 3MFAA 1SDWA 1KGYA 1LOEA 1IG3A 3HOBA 4ZHNA 1U0AA 1OH3A 1R081 2RS33 3GCWA 3I4IA 5IVYA 2FMYA 1NCRC 2ENRA 1LGNA 2WFF3 5FZ3A 3POFA 1PNGA 5C3RA 4MGSA 3K4AA 4WZCA 5IAVA 2RR11 5GLUA 3LEKA 3WDWA 1BVP1 4LK6A 2RM21 3IM0A 2PHRA 5FPLA 2AC1A 4XW3A 4N90A 5CA6A 1E5HA 3PJQA 3V56A 4Q0SA 2NYYA 4OUMA 4JRAA 2VCBA 5KXBA 3FUQA 4YVSC 1BBT3 3D4KA 1GZTA 1H6YA 4LPLA 3NAPB 2E7QA 1DLLA 4IV1A 2HLEA 2OXBA 2VOXA 4XYXA 1QJFA 3I2GA 4AE2A 3I2IA 4XUOA 3AJYA 2PHXA 2XDVA 1GKBA 4FQ4A 4JGYA 5GZCA 2DBIA 4RL7A 1KS4A 2WO7A 4CEWB 2PHTA 2Q0AA 2QQVA 3LOBA 4RFT0 3WQBA 3IN9A 1XNBA 4S2DA 2FCTA 2B8MA 2MEV1 3LCPA 4HANA 4CTEA 1ZZ6A 3VGIA 5T3NA 1C8M3 2AEYA 1AJKA 2BNOA 4FPKA 4QX5A 3WW1A 5F8PA 4A42A 1PIV3 1WLTA 2BW8A 3KM5A 4EJRA 1AX2A 1O3RA 4Y5SA 1F8VA 4LOSA 4LE3A 4RR3C 3A4UA 1XYPA 2F6BA 2QCSB 4JX0A 2VTXA 2BFUS 1YO8A 2GP3A 3W5MA 5FLIA 3LFIA 4PQQA 4DIQA 3V64A 4WM8B 1CAUB 2D44A 4JDMA 3KCCA 1JU4A 2IZWA 2XBO1 2XBO3 3LZZA 1AF9A 3DXUA 5FYZA 3U37A 4XTMA 4J1WA 3N36A 4AI0A 5FZOB 5HCBA 3LOIA 3KV4A 5KWRA 1LECA 1HLCA 3D6EA 3MW4A 4JKMA 5I0SA 1GWKA 4DMIA 4UW5A 2VE1A 1H30A 3HPNA 3N7MA 4NJ4A 4NO4A 1F4HA 4KQ7A 5EYYA 3GF6A 5IVVA 5E8AA 3ST7A 2JG8A 2WWUA 4CCNA 1FV3A 2HEVF 5K7PA 1WMFA 1S2EA 2PQSA 4DB5A 4LQRA 3CIHA 4H14A 4WM7C 3POWA 2I2SA 3BALA 2WNVB 4NHMA 4P5YA 1PZ7A 3BKZA 3VBRC 4E4SA 4K8FA 2D6LX 3G7DA
chains in the Genus database with same CATH topology
2VNGA 3FE5A 5BUVA 3KQRA 2NP0A 1VBE2 1NOVA 1UKRA 4IEYA 4IV3A 2UYBA 1Z0HA 4ZU7A 1PVXA 1V6KA 4FPOB 3N7LA 2VMGA 2ZJCA 1GANA 2VUJA 4R9BA 1LHWA 4BIOA 2EXKA 1GSLA 1OPOA 4AFMA 1QOTA 1CGPA 4PLNA 1V9U1 4Q0VA 1D4VB 2XLGA 2JDZA 4LULA 2GH8A 2TUNA 3CJIA 1N47A 2ZMKA 1ZZBA 4AFAA 1IPKA 3AZVA 2XJVA 4IV3B 2DCKA 1Q8PA 4GWNA 4YW2A 3MZHA 1AYM1 4BZ4A 2W0XA 3RPQA 3LSDA 4XFHA 4P9JA 2R063 4C91A 1C5IA 4K1YA 1HRV1 1S0BA 3USSA 4A7ZA 1FXZA 2WNVA 2ZGOA 3CEWA 3NKGA 3VN4A 2YC0A 1DGWA 2HWF3 1RUC2 2ZHMA 1LRHA 2R6QA 4NWVA 5A32A 1RIRA 4WVMB 1XU1A 4KU8A 2BQPA 1W6NA 2R041 2XJTA 5CU1A 2D6OX 1C1FA 2H0BA 1NG0A 1AR92 2BUKA 3ZMOA 2JE7A 3H7YA 4Y26A 3VBSB 3M4FA 1ZNPA 3UJOA 3W59A 4Y4YA 4COYA 4AFBA 2E51A 3OBTA 2O8QA 1BKZA 1AL21 4AEMA 3SCFA 4WM7A 1GZCA 4Z1VA 4EN0A 3O12A 1MS4A 1JXNA 1UW8A 1W6PB 5C8CC 2XB6C 2YDEA 3LGRA 3H3ZA 2A3WA 5AFEA 4Q27A 2VECA 5L7OA 4PQ9A 2GMPA 3VBFA 4OFGA 4P9GA 5C8WA 3WP5A 4OHYA 2DV9A 1UMZA 2PAKA 1I9RA 2ZHLA 3JD71 1W6QA 4EWDA 1XNCA 3K51A 1RUJ2 4KNCA 2WS92 4DFSA 1S0JA 3ECQA 3MF6A 1HKDA 3O14A 1V00A 2ERFA 1AYM2 3VDDA 4DQAA 1PO22 3FWEA 4DRVA 3OF1A 4Q4Y2 4D69A 1Q8SA 4YZ2A 4Y1YA 5EFUA 3VL9A 2R061 1X8EA 5C4WA 2XVKA 3RYRA 1VR3A 4ATFA 4C1XA 4IV1C 3RI9A 5DG1A 2AUYA 1W0PA 4GB32 4JRLA 1QKQA 2JENA 5L7OB 2SBAA 1UCXA 2QDNA 3PMSA 3NW4A 3ZSMA 3MFCA 4Q4Y1 2IC1A 2XPJA 1QF3A 2K9ZA 2IXLA 3WT3A 4YLZA 2WFF2 3WD5A 5BNOB 2OPKA 4K6BA 3V65A 4GMP1 5I8YA 4OI2A 4P9YA 4L99A 4PCRA 1FMD3 1W6OB 4RQPB 3IWZA 2ET7A 4FBFA 3J26N 1ENQA 5K8SA 5DDJ3 2XVGA 5F1RA 2O0OA 1VB2A 1U5YA 2VVFA 1QXPA 2TNFA 1RINA 4PIXA 5L36A 3V0BB 1REDA 1ZREA 3AZXA 2YZ4A 4S2FA 3BPZA 1TE1B 1NY71 5F6LB 4P9XA 3OYWB 5GLWA 4JC1A 4RR3A 2YXSA 4PDWB 1LENA 5B2GB 1ASJ1 3UKVA 5LK5A 3V0BA 1HIXA 4ES8A 3AMHA 1ZRFA 4HT1T 3VZNA 3ILNA 2E6VA 2EXHA 2VPVA 1LOGA 4CDQB 1PK6C 4FTEA 1W6QB 4CDUB 1QDCA 4I0BA 1MS1A 4HSLA 1UPSA 1AYN2 4WVVA 5J37A 1RUF2 4MXWA 1AHSA 3WY6A 1BJQA 4A3XA 1ZZ9A 4BH9A 5BNOA 2Q4SA 3VBFB 2W68A 1Z7S1 3U10A 2D7FA 5JSPA 1CR7A 2PELA 3INAA 3PNAA 1T6GC 2Y0IA 4M3CE 1RUI3 4N7IA 3RSJA 1LOBA 3S7EA 3WQ0A 1F31A 4YARA 4P9WA 4HK8A 4WZFA 4JTNA 1URXA 1KITA 1VIWB 1ZBE1 2QZ2A 1PGL2 2Q1MA 4XIOA 4ZXKA 1M4WA 1DHKB 4XFIA 2WQZC 1AR63 1MZ5A 1A3KA 2EXJA 2WIIB 3HIFA 1S55A 4YRDA 1RUOA 2D6NA 2HEYF 2QVSB 3KT7A 1X7NA 2Z42A 5J3UA 2ILMA 1YFWA 4OI0A 2JJ6A 2PLV1 2UU8A 3AMMA 1OQEA 4AGGA 5CFCA 2QKDA 4KGGA 4N53B 1E57A 2GN7A 1A6CA 3PTYA 4L92A 2ET1A 1VLNA 1CJDA 4FPHA 5HCAA 4KL1A 4LTAA 1QH7A 3GHNA 4E2GA 3X29B 1GBGA 4ZU4A 1S1AA 4YSFA 3H50A 4E27A 4RQPA 1HV0A 1GV9A 4AHZA 4PJYA 2ZX1A 2YYOA 4ES9A 2ZAAA 3VZOA 3VKNA 3WP4A 1VRH2 4PDWC 5BV6A 4M0HA 1RUH3 2AGSA 2HWB2 2JG9C 4FOYA 4QM9A 1Z7S3 4ISQA 1QJZA 2WZR1 1MR5A 3DGTA 4WV8A 3VZJA 1B35B 2DUQA 2HWC3 2XWJB 2ZS6B 3NAPA 3CLPA 1SCSA 5C4WB 4QQ2A 3KSCA 4Z07A 1ZA4A 2GAUA 1BEV1 4EWAA 2NQYA 4N9IA 3MIFA 3GZAA 3MPBA 2VOKA 1AYN1 2GN3A 1REFA 1Y9QA 4MH0E 2RE9A 2ZGMA 4CDWA 2RJKA 1MZ6A 5BNPB 1YRZA 2A3XA 2PAEA 4QQLA 1RMU2 3AZWA 1X82A 2DF7A 3B93A 2B42B 3MW2A 4HZFA 1CN1A 3O7OA 4Y1VA 5E16A 4AGRA 1D2QA 4OHXA 3PVBB 5IUQA 4B3NA 1PIV2 5CFCC 2WLPA 1PGL1 2CY6A 1C5HA 1Q8VA 1QJX1 5JIUA 2AH2A 5FDBA 4PIYA 4PF5A 4AW7A 1A78A 1ZBA1 3H0OA 3OCPA 2BVBA 1VBB3 4I3PA 4Q4X3 5JI7A 2DFCA 5GZGA 3FLTA 3N7KA 4FVVA 4DOUA 3EQEA 4XMAA 2X8KA 4GH4C 3JD73 5SV5A 4KWKA 3ZFEC 1JUHA 1WW4A 1GNHA 1L3JA 4HVQA 1UF2C 1CD3G 4LLFA 4M3CF 1NE6A 4N53A 1NLSA 4UW4A 3KCYA 4FSJA 1PMIA 2N7GA 3O0WA 2F4PA 3VKLA 1AL23 3EO6A 1FOD1 3CL1A 4YM1A 4B7KA 4DXZA 3WHUA 4LLOA 2CAUA 4FOVA 2R071 3MYXA 1QJY2 4IEZA 1JH5A 4JGZB 2RS11 2C9AA 1O3TA 4BIFA 2LM3A 2PHDA 2WNEA 5K0UB 4YGBA 4FAHA 1QU0A 4N53C 1WW5A 1WLWA 1FX5A 1VBD2 4YW5A 3RMXA 3WHTA 2HWF2 4QPGC 4AK3A 5I93A 3S6PA 4FP3A 2WINB 4QXKA 3KS7A 1NCRB 1EY2A 3VDDC 4XBLA 1V6OA 3FBMA 4MZUA 1OLRA 5JSRA 3RRDA 4FPFA 2DWRA 5J48A 1AR71 1ZRDA 2LTNA 4UXAA 2I07B 3ZFFC 1HRV3 2ZTNA 3JU9A 4I3GA 1JYIA 4I30A 3MICA 2R062 3JCIA 5T50A 3EBRA 3VHPA 3MI8A 1S0DA 1QJY1 2P34A 1RUC3 3VV1A 4K40A 1D0GA 3WVJA 3QD6A 3FBYA 5BNNC 1F5FA 3FJSA 5J36A 2ZHKA 1YHFA 5C4WC 4B8EA 2HWE2 2ZGTA 3MLKA 2WNUC 4Q8KA 1BYHA 4AEDB 3R05A 2VVDA 3KLSA 2RS53 3ENRA 1KQRA 3NWKA 5DXDA 2ZX4A 4FPLA 2OYZA 3VHOA 4GH4B 3I59A 5ACA3 3T2TA 1RUD1 1PNFA 4YGCA 1CAUA 2EXIA 1MZEA 3MIHA 2CWSA 3KB5A 4M01A 1HQLA 5GM0A 3ZN6A 5JSOA 4Q2FA 3N7JA 2WSVA 2D93A 2GC3A 1R093 3MLLA 1ND2A 1IOAA 3AKQA 2JKBA 4K20A 2DU0A 4AXOA 3DN7A 5DZEA 1IS6A 4MVTA 1UX6A 2WZR3 4NN0A 1UU4A 1LOAA 1LESA 1RUI2 4E2QA 1MVEA 5DUVA 5FMOL 4DNYA 1OFNA 1Q3EA 3JBG3 2A70A 3AKSA 1H4HA 4XF3A 2B39A 2GNDA 3FHIB 4PBPA 2HWE1 5BNPA 3O0XA 5FQ0B 1D0HA 1QNYA 3UL2A 2RHPA 4F83A 2ZGPA 5EZWA 2GALA 3FC0A 3M2MA 3QOPA 1UZYA 4HL0A 1KFUL 1CPNA 2R30A 2ZX3A 1G9FA 4IV3C 4YFWA 4D7SA 4B4RA 1VALA 2A6WA 2HWB3 1W0OA 2A3YA 1DZRA 2R49A 3N35A 4XE9A 5IK4A 2MPFA 1AR72 1AR83 3L9JT 4H7MA 1QJU1 4GALA 3MLJA 3VBRA 5JIAA 2O1QA 3SCHA 1LODA 4LBLA 3GBFA 2B46X 5C9AA 1COV3 5FBZA 3P3NA 2XKOA 4HETA 3DPRA 1RUF3 2ATFA 1CAWB 5A3MA 4ITCA 1QGLA 5D8AB 2IWGB 5J96B 1H8TC 2RS51 5CFCB 4GKXA 3VBRB 4PIZA 4AI2A 1RUH2 1C1LA 1RUG1 1BXHA 4Q4W2 3T1MA 3WW4A 1KJLA 1IS5A 5T5JA 3DKWA 1O4TA 3WG2A 2YGMA 4HFSA 3THPA 2WNUB 2DURA 4F8AA 4M00A 1H1MA 1RHI3 2WFF1 4BQ1A 4YZ3A 1DZQA 1AYN3 4QU2A 1BMV2 4H3WA 2WFPA 2WWSA 4MSVA 2Z2SB 2VG9A 1UKGA 4KH9A 1FMD1 1POV1 3CJXA 4Q1RA 2CYFA 2H6BA 1PGW2 4YZ4A 2ZGSA 2VUAA 4FOQA 4OI4A 4HN0A 4IEOA 3NV2A 4U36A 4WM8C 1ASJ2 5F5QA 1B09A 3SNMA 5EWSA 3VBOC 2BTVC 2R16A 4NWWA 4L9BA 4CDQA 1GQHA 2GSYA 4Y5Z0 4R4XA 3BIWE 2FZ1A 3RJ2X 1GYKA 1DGRN 1VBA2 4FPJA 4JDOA 4DINB 5FLJA 3WQ7A 3EJKA 1WA4A 5FO8B 3ZXAC 1ZBA3 3KD4A 2WQ4A 3NSTA 2R043 3VUOA 3ZSKA 3WG3A 1LHOA 1AVBA 1Q8OA 4YVSA 1H2KA 1UD1A 2W52A 2PTMA 1BZWA 5LEJA 1SBFA 2VQ0A 1WCKA 1I3HA 1S0IA 2BNMA 3JQWA 4F3JA 1XNDA 4DRRA 2GH2A 1MS8A 2VW0A 4RHV2 4CP0A 2BPA2 2Y0OA 4AVCA 2R32A 4LO8A 4TSVA 3WDVA 3LA3A 5KHKA 2ZACA 3R4UA 1V6NA 2LALA 3VKFC 4CP2A 5LRRA 1S0FA 1AXYA 4O9EA 4YM2A 3L2HA 1RMU3 5DG2A 1VBE1 5C8CA 4R9AA 1W6MA 1PO21 2IXHA 1PK6B 5D1IA 5FCCA 3WG4A 4BE3A 1CIWA 2QUOA 2QZ3A 2VULA 1LEDA 2D43A 4RS5B 5DUWA 1NCRA 4KBBA 4JCKA 1V6MA 2PAMA 5FFOC 2BEOA 4QPIC 5H9QA 2XVLA 1X36A 2ZKNA 5K0UA 4XHXA 1D2SA 4INDA 1RTVA 4R9CA 1LKNA 3AM2A 2W08A 3FLPA 1ULFA 1VAVA 5AVPA 1NCQC 1V6IA 3ZYJB 4ISRA 4XIKA 1ZBE2 4Y1XA 3R6SA 2R0HA 4FPCA 3VBHB 4MGYE 1DQ6A 4BMEA 1JTZX 2BNNA 1B35A 2HWD3 2X53S 4AQ2A 1MS3A 4A2UA 2BBVA 4LT5A 4YNIA 2EF6A 1JOJA 1MEC1 1MEC3 1S0CA 4QPGB 3TNQA 3JBG1 4DY5A 4AEJA 1OHFA 1KD7A 1YLLA 3ZVXA 3CJIC 5FRAA 1RJ7A 2WSUA 5AVAA 1CVNA 3MPPG 3TAYA 5BY5A 5DZGA 2XUMA 1I6XA 4COWA 1U5XA 3CNAA 1DIWA 2VOVA 4K9SA 2C0ZA 4KU7A 4G3YC 4M0NA 1H8VA 3CF6E 2RM22 4MGIE 3UKNA 2DTYA 3L2YA 4XJZA 4QQHA 2VU9A 1AR73 1AR82 1N3QA 1WLDA 3IBMA 1BBT1 1PIV1 2UWCA 3WUCA 4Z2WA 1DFQA 1QJY3 4R9DA 2MEV3 2OW4A 3WUDA 3TWIA 2D5FA 1OOPC 3M70A 1J3RA 3VDDB 4FAGA 1OMIA 1H4GA 3OJBA 4OI1A 3NO8A 1ULCA 3H7JA 2EAKA 1TEIA 1VBD3 3ZPYA 5DDJ1 4YZ5A 3WV6A 4Y22A 4YGDA 4LNVA 4YG6A 1WLCA 4COZA 1ONAA 1VP6A 1TMF2 2D40A 2OVUA 2ZCWA 4BYYA 1EAH2 4X6RB 5JR7B 2G9GA 4XFFA 2E7AA 4WBBA 2MHFA 3KT1A 3GZUC 3DV8A 3QH6A 2DCJA 4Y22B 3RG0A 2RR12 2HKXA 4FOWA 2LUWA 4CDUA 3GBGA 3WG1A 1KJRA 2Y38A 4IEUA 1MQTB 1SCRA 1NA1A 1NE4A 2NMOA 1QDOA 5FLHA 1SBEA 1H9PA 3VBSC 4FTSA 4E4DX 3U07A 1N1TA 2ZMNA 2P17A 4WVMA 4BOWA 1FV2A 1WUVA 2GU9A 2OUJA 2IXKA 1PHMA 3B02A 2EVXA 4QGNA 5KC5A 1BEV3 5T52A 2CAVA 1FATA 2JD4A 1HRI3 1RGSA 3BCWA 4QT6A 1RHI2 3VZMA 1OA4A 1ND3B 1OKQA 3H9AA 3I8TA 2CNAA 1VJ2A 3B00A 4YYOA 1W6OA 3QCWA 1OLQA 1QHDA 2BGCA 2YROA 4P9IA 4AF9A 5FPXA 4FO9A 2ARXA 2XHKA 4I2OA 4K3UA 1O3QA 3ZSJA 5JVVA 3ATGA 1FOD2 1LR5A 4DPNA 1G9BA 1ENSA 2GNBA 2QJVA 4WVZA 2XLAA 4OHWA 1IGOA 1QJU3 3NJZA 4LUKA 3KT4A 4IXLA 5H9PA 3AP5A 5ABJA 2DCZA 1O91A 1AL0G 1QXJA 4AHYA 1R082 4C0BA 1XYOA 3M3OA 3MGUA 2B7YA 1WGPA 4I0AA 1DQ5A 4HKLA 4R4ZA 4NVPA