4HANA

Crystal structure of galectin 8 with ndp52 peptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
293
structure length
293
Chain Sequence
GSMMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Structural basis for recognition of autophagic receptor NDP52 by the sugar receptor galectin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 64
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hanA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hanA02
1TEIA 2V73A 5HCBA 1VAMA 5EXOA 1DZQA 1UKGA 3WCRA 4YFZA 2KM2A 1SBEA 2WSUA 1WD3A 2AENA 1S0JA 4FPHA 3AXEA 4YFWA 4DQAA 4AGRA 1HDKA 2ZGPA 1VIWB 3SH3A 1YRZA 1SLTA 1LHOA 1CN1A 2A3YA 1GZWB 3QLQA 3RQ0A 4BLJA 4DRVA 1RITA 1WD4A 1AJOA 2ENRA 1QNWA 5JMCA 5EYYA 1LOBA 1GBGA 1JHNA 2DYCA 4Y1ZA 2FHRA 4YW5A 5GLZA 3AZWA 1DQ1A 4YGBA 3OY8B 1W0PA 2DTWA 1W6MA 1N1YA 5KXCA 2E51A 1HQWA 1MS5A 2YMZA 4OZXA 2P3IA 4Z8BA 3NV3A 1DLLA 3WCSA 2A6XA 4YG0A 3FFZA 3JU9A 4FVVA 3AXDA 2A7AA 4JRAA 2UURA 1IS6A 1KJRA 3ILRA 4PQ9A 4BMEA 3PJQA 1JUIA 2ZGOA 4K1YA 1U0AA 1X50A 2C9AA 2D3PA 2EAKA 4WV8A 1V6NA 4YW3A 3ZPYA 1LJ7A 2A3WA 1LU2A 3WDVA 2B7YA 2DTYA 2PELA 4RA0A 2NMOA 1YIFA 2ZBJA 2D6PA 4UW6A 5JOWA 5KXBA 3RMYA 4GKXA 5DZGA 2CTVA 3M1HA 4FP2A 4XOGA 1ENSA 1S0IA 4FPCA 3C2UA 1F31A 1WUVA 3IPVA 4Q8LA 4BM8A 4XZPA 5JOZA 4FPKA 4P9WA 1Q8OA 4PF5A 5E88A 1Y7BA 1S1AA 5CNAA 3LSDA 1DQ0A 5BYNA 4YZ4A 3WDXA 1LGNA 2GN3A 1BXHA 2EXIA 1C1LA 1S0EA 2R16A 4M01A 5E89A 1APNA 1GYKA 4JCKA 4SLIA 4XYXA 4F83A 4M3CF 3PVOA 1BYHA 1W6NA 5GLVA 4Q8KA 3Q9OA 4FP3A 2P34A 1LEDA 1VLNA 3SNMA 3AZVA 1WCSA 1OKQA 3H0OA 1W6PB 3O0XA 4XBLA 2JDZA 1LOAA 3LSEA 4WVVA 4AVVA 4YM3A 1QU0A 4Q2FA 2YROA 5H9PA 1UN1A 3B69A 1G9BA 1LEMA 4Q1RA 2D6LX 3M3QA 5DG1A 1W6OB 4YG6A 3V0AB 2YY1A 5DUXA 2Q5TA 1LENA 1Q56A 3AYDA 3MEPA 4XIOA 2OUHA 3VKLA 2RHPA 5IK8A 5SV8A 1QKQA 4UW4A 3WHTA 4AVSA 2OW4A 4ISQA 1MS3A 2UWBA 1O4ZA 3UJOA 3BOPA 1IS3A 4BLIA 1DYKA 1S0GA 1WW6A 2A6YA 5LK5A 5IT6A 3OJBA 5DXDA 4YM0A 1MS8A 2JKBA 1IKQA 3BIWE 3ZVXA 1SBDA 1FAYA 4M3CE 1JBCA 1EPWA 3N7KA 2GMEA 5GLTA 2E6VA 2CWMA 1LGBA 1A78A 3PMEA 2UWCA 5GLWA 4Y24A 3FLTA 1D2SA 1DYPA 2DU0A 1LOEA 1URXA 1N1VA 4XBQA 1W6QB 2YV8A 3FLRA 3ILNA 1S0CA 1AVBA 2A3XA 3ENRA 1WW4A 3OYWB 4Y1YA 3ZXFA 1KRIA 1MS9A 1PZ8A 1V6LA 1CR7A 3RSJA 4Y1VA 2DUOA 3D6EA 3IMNA 1JN2P 1ONAA 5CBLA 3M3CA 2R0FA 2E7QA 4YGDA 1KDMA 3VKMA 3ZYPA 3USUA 3V65A 3VV1A 4DS0A 5CAZA 3VUOA 2EIGA 3GALA 4FPLA 1MVQA 4FPOB 1RIRA 1UZYA 1WW5A 2E7TA 2GNDA 3A4UA 1B09A 1QDCA 5FREA 1N3QA 2ZHMA 3RMXA 1IS4A 4XILA 2C5DA 4C1WA 1G9AA 2DVDA 2GNTA 3N3HA 3T2TA 1BQPA 1MR5A 2ARXA 3W59A 4LBQD 4C1XA 1AXZA 2ZGSA 1JYCA 2BQPA 1QOOA 4AGVA 4DFSA 1GNHA 1CJPA 1GZ9A 2ZGUA 1H9PA 4XJWA 5E8AA 5H9RA 1GICA 2AREA 1LOCA 1V00A 4KBBA 4Q1PA 4Y20A 3LCPA 4U36A 3WG4A 3POWA 1QGLA 3O0WA 3WV6A 1DQ5A 1KJLA 1I1EA 1BJQA 3SITA 3WDTA 2WLQA 3FLPA 4FQ4A 1SFYA 2DWRA 2GALA 4MYEA 3ILFA 4DRRA 1CQ9A 2ZHNA 1LHNA 2AH2A 2VW0A 1QF3A 5H9QA 5KXDA 3MPPG 1AZDA 2DVBA 2NM1A 1O4YA 1C4RA 4XJUA 4FQZA 5HCAA 3WOGA 2GMPA 3POYA 1GZWA 2ZACA 1Q8VA 2A6VA 2P2KA 1ZA4A 2A5ZA 1CPMA 4YZ5A 5DUWA 4Q26A 1HLCA 3OY8A 4JC1A 1LECA 3O12A 2WNEA 3N35A 3OPZA 2ZGLA 1MVEA 1YI7A 2AGSA 3OBRA 5DG2A 2D3RA 1V6MA 2Z42A 3R05A 4XE9A 4U2AA 3VKOA 2JECA 1ULDA 1SACA 5JOXA 1WLDA 3R4SA 5CB7A 3AZYA 3AP6A 1S0FA 3O0VA 3WNXA 4AYUA 3HR9A 1LODA 1GV9A 4ATEA 4PBPA 4XJ9A 2D43A 1PZ7A 1LU1A 2R49A 4TYSA 3AK0A 3AP7A 3B3QE 2D6MA 1QOTA 4XXPA 2DURA 1PZ9A 3GNEA 3N7JA 4FPGA 4WZFA 3WHUA 1GZCA 3PVEA 1F9KA 3DUIA 2A70A 2VH9A 3DGTA 4ISRA 4UW3A 5GJ6A 3WZ1A 3V64A 3ZSKA 1H30A 1LTEA 3AX4A 1N3OA 1KITA 4H55A 2DV9A 3ZSLA 1DFQA 1AXKA 4XMAA 3N7LA 1UZZA 4K20A 2ZGQA 4WVWA 4XTMA 1LGCA 1QMJA 5JVVA 3W58A 2DUPA 2PHTA 3AP5A 1YXWA 1DQ6A 1ULGA 1ZM1A 3NWKA 1YYNA 4XDQA 2JD4A 3ZXKA 4DPNA 3U4XA 2NMNA 2VUAA 4LBQB 4Y26A 2D7FA 3AYEA 1WW7A 2PHWA 1GANA 2SBAA 3AZZA 3N36A 1SLLA 1AX1A 1W6PA 3NV4A 4M00A 4YGEA 1MS1A 2ZMLA 3B00A 4Y1XA 1OFSA 2OVUA 3WUDA 3ZXEA 4CTEA 2WJSA 2A6WA 1W6OA 4FPFA 4ASMB 3V0AA 2VW1A 4PCRA 3TAYA 4AGGA 1SLBA 5T54A 1LOGA 2FMDA 4R9AA 2AUYA 2D6OX 2LTNA 3ATGA 3VKFC 4LBQA 4XJ8A 1LOFA 1V6KA 2JE7A 2VW2A 2D3SA 1LOFC 4Y22B 4P14A 4XJZA 4YW2A 5H9SA 4BPZA 1CPNA 4FPEA 2CL2A 1XQNA 1Z78A 2PHUA 2UWAA 1AX2A 1VALA 2GNMA 4CRQA 1V6JA 5EYXA 3I8TA 4BMBA 2ZMNA 1FNZA 1WLWA 2W52A 2XG3A 3AZXA 3VKNA 4R9CA 2YZ4A 4D69A 4W65A 1GKBA 4K1ZA 1G8WA 3WDUA 2JE9A 3N7MA 3NV2A 3SH5A 1W6QA 2ZZJA 1H9WA 4XIKA 3OYWA 3M2MA 2D6KA 1IOAA 3B9CA 1WBLA 2EXHA 5GZCA 1ULFA 1BKZA 1A8DA 1S0DA 1R1ZA 3V0BB 5GLUA 2CYFA 4YM1A 3A0NA 1IS5A 1UPSA 1NLSA 5L73A 1DIWA 5IK7A 1AX0A 2DU1A 2W68A 2ZHKA 5IUQA 2ZA9A 3ZSMA 2E53A 4ITCA 4R9DA 2P3KA 1QOSA 1Z0HA 3O5SA 4XBNA 1JXNA 5AVAA 4LBNA 1W0OA 2NP0A 1ENRA 2ZKNA 4XXAA 2PHRA 4YZ3A 4P9XA 1YO8A 1QDOA 2I2SA 3HMYA 1FX5A 2W39A 3TB0A 3FUOA 4ATFA 2WKKA 1DBNA 1CVNA 1GLHA 4YLZA 1MZ6A 2OUJA 2ES3A 1HQLA 5GZEA 2CWSA 1J1TA 3T1MA 1F5FA 4GALA 4P9YA 4Q27A 4BOWA 4CZSA 3WG1A 1W6MB 1GSLA 2GNBA 4TZDA 2VXRA 2TEPA 1BZWA 1MACA 3CNAA 3L2YA 3A0KA 5GZDA 2A75A 5DUVA 1LESA 3I4IA 3HN1A 1ENQA 1NXD1 3UL2A 1CESA 1WLCA 5GZFA 3AYCA 3MW2A 5T5PA 3RRDA 2WT1A 2P3JA 1LHVA 3D5OA 3ZXLA 1SCRA 2YXSA 2NYYA 2WSVA 3APBA 1FV3A 5GZGA 4NOTA 3IM0A 3ASIA 3WG2A 5DZEA 4FOYA 1DHKB 1UAIA 4UW5A 3WDWA 1UMZA 5T5OA 3INAA 1S0BA 1HKDA 1FYUA 2WT2A 2CY6A 3AP9A 3WG3A 5T55A 1V6OA 1FV2A 1CIWA 3WDYA 5CA6A 1N1TA 3IPVB 5KXEA 3QCWA 3NV1A 4ZXKA 4GA9A 4PBOA 4XHXA 1IKPA 2EXKA 3AYAA 3FBYA 3AP4A 4HANA 1I3HA 3BODA 4FOVA 4M3CB 1CONA 1SCSA 4R9BA 3RS6A 1DQ4A 2V5YA 1UL9A 1AXYA 3OGGA 4YZ1A 3B01A 1LULA 3AJZA 4Y1UA 1W6NB 4LBKA 3POSA 3ZXJA 5DZFA 3UK9A 5JLVA 5GM0A 2HYKA 2GMMA 1ULEA 2PHXA 2R0HA 3ZSJA 2CNAA 4YG3A 5T5LA 1KQRA 1N3PA 3AJYA 2D6NA 1D0HA 2DVFA 4M3CA 5T50A 1MS4A 2EALA 3WVJA 1A3KA 3AFKA 4GKYA 4HL0A 5GALA 2AYHA 1SLAA 1UX6A 5HCFA 3ZYRA 1C57A 4XTPA 5DUUA 3T1LA 4AVTA 3IN9A 4IQPA 2A71A 5FRAA 5IK5A 1Q8PA 3KM5A 4I30A 1V6IA 3IKWA 2R1DA 4XHBA 2GN7A 4RL7A 2DVAA 5T5JA 1QNYA 4GWMA 2P37A 3SH4A 2JJ6A 2EXJA 4FOWA 4YZ2A 4YW4A 4LBLA 4GXLA 3SLIA 3PVNA 1WBFA 4YGCA 5IK4A 4XJAA 1LHUA 2ZAAA 2A6ZA 1JOJA 1AJKA 4L8QA 2ZGRA 4YM2A 1G9CA 3MW3A 1SLIA 1DQ2A 1MZ5A 2ERFA 3WUCA 3M3OA 4LBOA 1JYIA 1Q8QA 1LCLA 5F9TA 1KDKA 5T52A 3USUB 1G9DA 3MW4A 2DUQA 1LHWA 2NZ9A 4Y22A 1G86A 3FUQA 2W08A 4LBJA 2ZABA 2AR6A 4AWDA 4BQ1A 2ZHLA 2H0BA 2WT0A 3UJQA 1N47A 4ZKTB 2NN8A 3BTAA 2G4IA 1DGLA 2XB6C 1SLCA 2EF6A 2ZGNA 4FPJA 1VAVA 2VY0A 1MS0A 1Q8SA 3SISA 1JW6A 2SLIA 4FOQA 2PHFA 4K21A 3JUUA 3M3EA 3R4UA 1G9FA 2DVGA 2VU9A 2ARBA 3RG0A 5EWSA 2WQZC 2ZGKA 4FPYA 1FATA 1ULCA 3D4KA 1FNYA 1GNZA 2ZGTA 4XMIA 1OQ1A 4GWNA 4NO4A 2ZMKA 5JDBA 3KQRA 2R1BA 3V0BA 5JOYA 1AF9A 2GDFA 2LALA 2ZGMA 4YW1A 1G7YA 4Y20B 1RINA 2D44A 1SBFA 3WLUA 4LBMA 2UU8A 5F5QA 1C1FA 1N1SA 3OBTA
chains in the Genus database with same CATH superfamily
1TEIA 4OI1A 2VOKA 1PGW1 2F17A 1U5IA 4RFT0 2VR4A 1UKGA 3NO8A 4COVA 1VBC1 4OUMA 5D8AC 5FPAA 1AYN2 1FMD2 4C90A 1D4M2 4RQPB 3ZM8A 2IFWA 1FOD3 3JD71 3O1SA 1SLTA 3C7FA 1XU1A 4HN1A 5DDJ1 5FY0A 4BDVB 3K48A 1RITA 1AJOA 1HXS2 2ENRA 3C7OA 2QDRA 3TN93 4Q29A 1O7FA 1LOBA 2IUWA 4LTAA 4Y1ZA 5LEJA 2H6CA 2VE1A 2JIJA 4HZFA 4ZU4A 4GH4B 1OT5A 4LOTA 1W6MA 3GZUC 4GB33 5IFPA 3LWCA 2E26A 4NHXA 4Z8BA 1DLLA 3WCSA 3USSA 4YG0A 3JU9A 2BEOA 4NHMA 3IT8A 5LBEA 3PJQA 3T4VA 1JUIA 3VDDA 3HBZA 2VTXJ 1X50A 2C9AA 2QJVA 4YW3A 4A44A 5B2GB 4RR3C 1LJ7A 1DP0A 1OUSA 3WDVA 2Z79A 2AEYA 5FO7B 2PELA 2HWB3 4AAPA 4IE4A 1YIFA 2CGPA 2JEMA 4UW6A 4C0HA 1EAH3 4OCTA 5JOWA 5KXBA 2Y26A 2WQ8A 1VRH3 1COV2 4FP2A 4IEUA 4J1XA 1S0IA 4FPCA 4I09A 4OMDA 4D0QA 1J83A 1OHFA 1ND3C 2AACA 4S2FA 3HN3A 3J8F2 3IWZA 3NRUA 1W8HA 5C9AC 3K51A 2XJVA 1Q3EA 2DCKA 3K46A 4PF5A 4DUWA 5E88A 3ZKYA 4PI0A 2RMU1 1S1AA 5FO8B 3LSDA 1DQ0A 3ZYGA 4YZ4A 2RV9A 3WDXA 4PT6A 2YHJA 1UD1A 5KHGA 4XF0A 4BQ3A 1XSQA 4LLFA 2MNGA 3HPNA 4Q8KA 5GLVA 1FPN2 2R073 3OG2A 5SV5A 3W21A 1OKQA 3H0OA 3O0XA 2JDZA 2PTMA 4WVVA 5LATA 4AVVA 1QU0A 4AE2A 5A33B 4HOOA 1G9BA 3SMHA 3CU7A 3KV9A 3M3QA 2XKPA 4Q1RA 4TLGA 4YG6A 2JDYA 2D98A 4H3WA 4K9SA 2Q5TA 3O1PA 1Q56A 1H4GA 5IK8A 3A22A 4YNIA 4YWAA 3SEEA 4JGZA 3WHTA 4B7EA 4LORA 1MS3A 3UJOA 4KNCA 3S30A 3IDEA 4ZS2A 5CFCB 3TYJA 1CAVA 1S0GA 1YQ5A 2A6YA 1C8M3 1J3PA 1REEA 4YM0A 1E5SA 1GQHA 2JKBA 2V5DA 3JB8A 4X8PA 1SQ4A 2WNUC 1RUF2 4LNVA 3HQXA 5C4WB 4N7UA 3ITQA 5APAA 2GMEA 3KV5A 3MUY1 1JYVA 1C5IA 1JZ2A 1A78A 3O1UA 1TME3 1GUIA 1XYOA 1DYPA 2DU0A 2OQ6A 3S5AA 3NKTA 2JB8A 1URXA 4JTOA 4XBQA 4CDUC 1TQ5A 1KFUL 4UFIA 4A6SA 4CUGA 2A3XA 4P9LA 4Y1YA 4CXYA 1PO21 5FIXA 1KRIA 2VNVA 1MS9A 4KWJA 4MXVA 1BEV3 4Y1VA 5FCCA 4CEWC 1JN2P 5AC92 5A80A 2E7QA 1KDMA 2PAKA 2XHNA 4HBNA 3VV1A 1UMIA 4BU2A 4DS0A 3SCHA 5FOBB 3UYJA 4K8FA 4AI3A 2XH6A 4F7ZA 2VZOA 3P1IA 4ET7A 3GHNA 2ARAA 4JGYA 5AFBA 5C3PA 3NAPA 4M4PA 4EN6B 2WZPP 1PVC3 3A4UA 1B09A 5FREA 2D5FA 2PQSA 3RMXA 1XB9A 5FJKA 3EO6A 2XJUA 4L97A 5FZAA 1AL21 3T2TA 4LKDA 1X9PA 2GZWA 2K0GA 3VDAA 5I8TA 3T08A 1UIJA 4AEMA 4AGVA 1AR61 3RYKA 4QPIA 1U5XA 2RM22 2VZTA 1GNHA 1GZ9A 2ZGUA 3ZXGA 1AR72 3AKSA 4RGGA 5L7OC 1GICA 1W8UA 2AREA 3FC0A 4GAZA 3DKWA 3R0RA 3M70A 2PN5A 3PUAA 4U36A 3OSDA 4K7JA 1DQ5A 1KJLA 2VAUA 1BJQA 4FAGA 4XVHA 1B35A 4FQ4A 2ZOEB 3ILFA 5AVPA 4DRRA 2ZHNA 3KVBA 1J3RA 3C7GA 5FXWA 5H9QA 4CP0A 5KXDA 2RVAA 4P02B 4AFAA 1HB1A 4FFGA 4FTBA 3O7OA 3WOGA 3S0MA 2GMPA 2RS32 5JPMB 2XHKA 4A45A 4D7SA 2ZACA 4QQ2A 2A6VA 2P2KA 4HG6B 1T6BX 2EVXA 4OYUA 1EV12 3CLPA 1CPMA 1G6NA 1UXZA 5CISA 3IAPA 3RZJA 1ZRDA 4EQVA 2YG0A 2BFUS 3BB6A 3VGIA 1HLCA 3K4AA 1SG3A 3OY8A 3E6BA 5DAXA 4D6SA 5BNNC 1GOGA 3FFQA 5FPXA 5L9BA 4GMP0 2ZGLA 1UU4A 2AGSA 3OBRA 2XR4A 2OPKA 4XE9A 4A4AA 3TNQA 3SC7X 3MF9A 3J7LA 5JOXA 1AUYA 2IWGB 4L99A 5CB7A 1DGWX 1OF3A 3QACA 4AYUA 1LODA 2VZQA 4MGYE 2J1TA 2ZTNA 4CDWB 4RS5B 4ZU7A 1PZ7A 3ME2A 2R49A 4EJRA 1J84A 1Q5OA 3OEAA 1OH3A 3BU7A 2WZEA 4Q4W1 4CCLA 4A42A 2Y33A 2PLV1 1UY1A 1MQTA 1RUJ1 3MFAA 4IV1B 4XFBA 2WFF1 2OX0A 4XUNA 4BH9A 2DURA 3GNEA 1RHI1 5F5AA 1GZCA 4QU1A 1VR3A 3DUIA 3ZFGA 4UW3A 3WNMA 4A3XA 4LR4A 3AM2A 5A6ZA 4HKLA 2R063 1PK6B 1LR5A 4H55A 3ZSLA 1DFQA 1XOYA 4QPGC 4YVWA 3WF2A 1VBB3 4WVWA 5JVVA 2XL9A 5F5IA 1AR83 5F3EA 3ROUA 3VD5A 1UQXA 5JCTA 1DQ6A 3WQ0A 2JD4A 2XJPA 3AYEA 2VUJA 4MXWB 4UFMA 4A7KA 2RS13 2SBAA 3N36A 3S5QA 4L9BA 5FKCA 1XYPA 1RMU2 4UAPA 2WINB 4MX3A 3ZXEA 1OFSA 3OGVA 2IXHA 5BNPA 3SCFA 2P5BA 2VW1A 4WM8A 3TAYA 5B4NA 1SLBA 3ZLIA 4LHSA 1SMVA 2ADDA 2D6OX 3ATGA 4S2GA 4ASLA 3K3OA 2VW2A 1LOFC 4P14A 3OUIA 3KV6A 4HPKB 2BBAA 2FMYA 4XJZA 3ES1A 1FOD2 4X6RB 4FPEA 2OKXA 2FBEA 5JMOA 4CDQA 2FCTA 2QFEA 4FBFA 4QU2A 5DMYA 3BUCA 1W2AX 3I3EA 1VALA 4IV3B 3TN92 3VBFA 2GNMA 4N43B 4RHV1 5K0UA 2P17A 2XG3A 1W39A 3L9JT 4D69A 3LDRA 1VE0A 4GB32 1GKBA 4K1ZA 1ND2B 3CL1A 3WDUA 2Q1FA 3MHZA 3NV2A 3Q8AA 4PHZA 2VTXA 1TG7A 1W03A 2EIBA 4UBHA 3VBUB 3PU8A 1VBA3 4W6WA 4C91A 2W5FA 4NE9A 3M8LA 2ZEYA 5GZCA 1BKZA 2QQJA 1A8DA 1JTZX 5F32A 3WNKA 5GLUA 3V0BB 1BK1A 3J4UH 5J1XA 2HWC1 3ZFEC 1OH4A 1NLSA 1DIWA 1ZNPA 1OLRA 2JG8C 2HWB2 4ITCA 4MV2A 4Q4X1 2P3KA 4R9DA 4MSVA 4CU8A 4S2DA 1W0OA 5D8AB 2NP0A 1EAH2 1QH7A 1ENRA 1K5JA 1VRH2 2R6QA 1X36A 3LIGA 4IE6A 3TEWA 2VMCA 2XONA 4P9XA 1BK0A 1Y4WA 1YO8A 1H8TA 2Y6HA 4QKNA 5CYYA 5FUNA 3DKQA 4ATFA 5FZ1A 1HRI3 4A7ZA 4FAHA 3IB3A 4YLZA 5JPNB 2Q8EA 1W3XA 3WINE 5GZEA 3T1MA 1J1TA 4WM7C 5CVRA 1PMHX 4URTA 1OQDA 5FYIA 5LBCA 3ZYJB 1GSLA 2GNBA 1W2TA 5IATA 1BZWA 3S7IA 3AMNA 4BXSV 2X05A 5I0DA 3A0KA 2R072 3E5XA 3S7EA 5C3SA 4JVAA 1ST8A 1MZFA 3ACGA 4QT6A 4CP2A 3UL2A 1WMDA 2LUWA 3MO4A 1ZRRA 4Q4Y1 3MW2A 4KQ7A 5CFDB 2CGOA 4FXGB 4HK9A 4RR3B 4ARYA 5KHIA 2GU9A 4GH4C 2BNOA 3GM8A 1GP4A 2YPJA 1IG3A 2NYYA 2WSVA 2YXSA 4IEVA 1FV3A 1OA3A 1ZZCA 5GZGA 3ASIA 1OVPA 4XF9A 3ZXDA 1UAIA 4FTEA 2UY8A 1UMZA 4DEVA 4META 3INAA 1HKDA 1RUE1 2YPDA 3MI8A 3RFRA 3AP9A 1NT0A 5ABJA 5T55A 4CXWA 4SBVA 2W9XA 1C8M2 3SEPA 5KXEA 3NV1A 1OI6A 2RDSA 4CP1A 1JYTA 3AP4A 3VBOB 3KZ4C 1TME2 1AYN1 1FMD1 1OQEA 3JQWA 1D4M1 2IXJA 4M3CB 3N9PA 1DQ4A 2V5YA 3CQOA 1AXYA 4NVPA 4H7LA 1OURA 3WQ7A 3IIIA 3KWVA 2JG9B 3AB0A 2VQ0A 3KV4A 2NLRA 2CAUA 1O5LA 3ZXJA 3POSA 1QEXA 2VM9A 4LO7A 2HLEA 1BEV2 1HXS1 1OOPA 4QKBA 4CEYA 3SKJE 2GMMA 2PHXA 3ZSJA 4YG3A 3JBG3 1RVF3 5I0TA 5JR2A 2QQNA 2RJKA 5JZGC 2D6NA 1D0HA 2EALA 4MGIE 3UV9A 4GKYA 4DZGA 2AYHA 2ILMA 2R043 3T1LA 2R30A 1PVC2 2YGLA 4QMAA 5FRAA 2G19A 2X10A 3DXTA 3EYPA 1NCRB 2F4PA 2WNUB 5A6XA 3AVSA 1MPXA 1BVVA 1XC6A 4WZCA 1E5IA 5T5JA 1QNYA 2BWAA 5HBAA 3ZFFB 3GZAA 5K4LA 2WLPA 2EXJA 4FOWA 5C70A 2XVGA 3L2HA 4LBLA 4GXLA 2K46A 3S6PA 3IDBB 1COV1 3ETQA 3KGZA 1NA1A 1WBFA 3NW4A 5FZMA 1D7PM 1LHUA 2ZAAA 4JV4A 3ZFFA 4CDUB 2VNRA 1QHDA 3BALA 3OF1A 4L8QA 2UY9A 3J8F1 4FT8A 3NMBA 2QTWB 4HN0A 4AAXA 3MW3A 5JXGA 1POV0 5F37A 3PVBB 2WZ8A 3POBA 1F2NA 2ERFA 3WUCA 2J1VA 5C33A 2W47A 5C4WC 4LBOA 1JYIA 1LCLA 5C3OA 3RYPA 1QJY3 3USUB 4W6YA 3ZN6B 2VTFA 2NZ9A 3P3PA 4BQ1A 3BN6A 1I5PA 2CU5A 1N47A 1KD7A 2NN8A 5C3RA 2G4IA 1WA6X 1SLCA 1FPN1 4FPJA 3VZJA 4E2SA 1CX4A 2VY0A 3GZEA 1MS0A 3VL9A 1EUTA 1Q8SA 3SISA 3SXWA 4OMCA 1W9WA 4BQ2A 2D40A 1QQP3 1G9FA 3FHAA 3LD8A 3PTYA 5F2WA 2DVGA 2XQRA 5EWSA 4C8DA 2WQZC 1C28A 4XABA 5LWBA 1VJ2A 4FTSA 4KWUA 2BGOA 2QQWA 4XMIA 1OQ1A 4GWNA 1YIPA 5L7OB 3TOJA 5JDBA 4CA9A 4NIAA 2WWUA 5FY8A 3T30A 1SDWA 1G7YA 1UOGA 4XAAA 4JDNA 2D44A 4L0PA 4XCAA 4P9WA 2WN3A 2N7GA 3AKQA 1RUF1 5FZIA 4LMFA 5HCBA 1VAMA 4AG4A 4CDXB 2ZX1A 3KHBA 4DNYA 1REFA 2KM2A 3I3MA 1JUHA 2AENA 1S0JA 4BISA 3AMPA 4LQRA 1YFUA 5F3IA 3W20A 3ZPOA 4AGRA 3LA3A 1H6YA 1HDKA 5C8WA 1VIWB 4O7XA 1YRZA 1GNYA 4B1MA 3UT0A 1RUNA 3QH6A 4C0BA 1LHOA 2A3YA 2R062 3H8UA 3RQ0A 1WD4A 4UBGA 4LKSA 2WL1A 1QNWA 3WT3A 4QDQA 3K75B 1C3HA 5AC91 1VBB2 2BW8A 4QAWA 5LASA 2FHRA 5FZ3A 4P9GA 1AR82 4OZOA 3GBFA 4R52A 5GLZA 4BE3A 4YGBA 4MGZE 3F2ZA 3U10A 2FDFA 2X09A 2E51A 4N9HA 1HQWA 1HQNA 1MS5A 2JENA 2YMZA 4OZXA 1V0AA 2RS12 3NV3A 3WW4A 2A6XA 4QDSA 4FVVA 4W50A 4IEZA 4DMIA 4LO5B 1NUKA 4COUA 2ZGOA 1WKYA 3P6BA 3SKVA 5C5TA 4N53B 3E6DA 1CAWB 2JDKA 2UYAA 3PHMA 2BOIA 1LU2A 4WVMB 2DTYA 2WR9A 2BV4A 1GQPA 5BNOA 2ZBJA 4KU8A 2D6PA 1DGRA 2RM21 3B94A 5JSOA 2Q8DA 1ULOA 2VG9A 4QX8A 5DZGA 3RMYA 1AR71 1ZVFA 3M1HA 4DY3A 4CU6A 2VVEA 4FSJA 4LE4A 3WF0A 1JODA 4AI2A 2HEWF 1WUVA 1QJU3 2V4VA 5JOZA 4XZPA 1JZ5A 1L7RA 3THDA 3CJIB 5A3OA 1RUH3 4QPGB 4CDWC 1CZSA 4LJHA 1RUI3 2RG4A 2VCAA 4QKFA 4CTEA 5IVBA 2QE3A 2W94A 2X8KA 4CE8A 2GN3A 1BXHA 2GH2A 3P3NA 3UGFA 4FI9A 5E89A 1VB2A 1V9U3 2B42B 3VB9A 1APNA 4JCKA 4SLIA 4F83A 2IVJA 3T09A 2VBBA 3IZOA 2RS31 1VBA2 1Y9MA 5FY4A 2P34A 1PK6C 4HK8A 1LEDA 1VLNA 2IVIB 3KF5A 1EV11 1U12A 4XBLA 1LOAA 4DIQA 1VBD3 4GMP3 4Q2FA 1STMA 2WWJA 1XSRA 3ZIXA 4RGKA 3LGRA 3GJAA 3BOWA 4XFCA 1UYZA 1O5UA 3I2HA 3MZHA 1X7NA 3VHPA 1LENA 4OFGA 4XIOA 3MEPA 1VP6A 2OUHA 4D8MA 2RHPA 3RZZA 4HSLA 1JZ7A 4UW4A 4BQXA 1H6XA 2ORZA 2OW4A 4ISQA 5FK8A 4AVSA 2P4EA 3BOPA 3WNPA 4K3UA 3THPA 4CU9A 1QJEA 1HRI2 4IUGA 3BIWE 2WZR3 1OBNA 1EPWA 5GLTA 3N7KA 2EICA 2E6VA 2XJSA 1WMXA 1WCQA 1OMIA 2R7EB 4QM9A 5A3PA 4E4SA 1H2KA 1W9YA 4GULA 3N9NA 2QQOA 3EJKA 4DB5A 1W6QB 5CFCA 1GQGA 1S0CA 3JB4C 4BZ4A 4I02A 4QXBA 5FR3A 1PZ8A 3RSJA 1CR7A 4QHOA 1GWKA 3RDIA 3IMNA 3ZFEB 2ADEA 2QQKA 4BXFA 4PLNA 4CP9B 2W92A 3V65A 4CCDA 1EY2A 3ES4A 4LIUA 3U1XA 4EWAA 4IETA 3PTRB 1GWMA 3GALA 2ZKLA 1MVQA 4FPLA 4MOAA 1LB2A 1K5MB 1NQDA 1RIRA 2Y6LA 2YC2A 4NJ4A 2Z2SB 5JUVA 3PUIA 1RMU1 2GNDA 3NJVA 4AXOA 1N3QA 3HT2A 4AFBA 1J3QA 3ZFGB 4B29A 1A6CA 1RXFA 2DVDA 3RZHA 1BQPA 3WP5A 3PDQA 4IGQA 2Y6JA 5FQ0A 1AHSA 1AXZA 2ZGSA 1JYCA 2Q4SA 2BQPA 1QOOA 4WM7B 1RL3A 3F95A 4AI1A 4DFSA 2BERA 4PDWB 5DN2A 1H9PA 2ZEXA 1FOD1 1F8VA 4AZZA 1S4CA 1UZ0A 2I45A 4KBBA 4Y20A 5HCHA 2K2SA 3V56A 3LCPA 2WNVA 1W8TA 3TN91 1LKNA 2HBTA 3CO2A 3O0WA 4EN7B 3I2DA 4YVSA 3PIGA 3SITA 1IGOA 4LPLA 3Q8EA 4XCBA 3O1MA 1RVF2 1B35C 2ZX4A 3VHNA 1BMV2 1CQ9A 2WFPA 4AHXA 4XW3A 2AH2A 2WYSA 3CDZB 4GB31 2VW0A 1QF3A 2EAAA 3RYRA 2DVBA 4GQ7A 1O4YA 2BP6A 2YC0A 1F15A 1IG0A 4MADA 4XJUA 5IWFA 3VBSB 4CSWA 1YFWA 1XXNA 3POYA 4LIVA 2R042 3Q8CA 1GZWA 3POEA 5FBZA 4I0AA 1Q8VA 4Q5OA 1EYBA 1FI2A 3AMMA 3PL0A 5CFDC 2WO3A 1H2LA 4Q26A 1HJGA 2G9FA 1R64A 2HWB1 3M7AA 2O8OA 3O12A 1NZIA 2WNEA 3OTFA 5GKAC 3DV8A 5BXXA 3WP3A 2WUHA 1MVEA 5DG2A 1EAH1 5LRSA 1ZYBA 2PQQA 3R05A 1HIXA 1VRH1 4BYYA 4BWOA 4XDOA 3WW1A 1ULDA 4JDOA 1XE7A 3FL7A 3R4SA 2BBVA 2BUKA 2JB4A 2JIGA 2Q1ZB 2FDJA 3KF3A 1NYWA 3O0VA 3OB8A 3QOPA 3CKHA 3HR9A 3KMHA 1GV9A 4ATEA 5KHJA 2BPA2 3AMHA 5FZOA 1R1A3 1RJ7A 3Q8FA 3VBOC 1HRV3 3OGRA 4E2GA 2BOJA 1QJY2 2GC0A 3AK0A 3LAGA 5D2AA 1KS5A 2KXLA 4ZU5A 5JZGB 2JWPA 1QOTA 1GZTA 3K77A 4KWKA 1HN0A 1MQTC 4PI2A 4XXPA 4WZFA 2JG9C 2XMLA 1GU3A 1F9KA 2A70A 2VZUA 4ISRA 2R071 5A3NA 1UYPA 3JCIA 2W1UA 4KGGA 5C7GA 1KITA 5FWJA 1WZXA 1AXKA 2LRPA 3I2IA 1UZZA 1QQP2 2VQUA 1SPPA 2ZGQA 1CAXB 1CIYA 1LGCA 1QMJA 4DEQA 4HVQA 1X8EA 2DUPA 2PHTA 3MLKA 1YXWA 4QB6A 1ULGA 4DPNA 4IV1A 3I54A 4GD4A 3U4XA 2XBO3 2NMNA 5A32A 1E5HA 4PIYA 4Y26A 5A3MA 1H0BA 2PHWA 1KXGA 3AZZA 2XL7A 2VUDA 1SLLA 2XLGA 1REDA 5DABA 4NRPA 3RZMA 4F3JA 1W6PA 3KD4A 2WRAA 3BTXA 4M00A 1C8M1 4O9EA 3WUDA 1NCRC 2WJSA 1W6OA 4ASMB 3V0AA 2WO1A 4PCRA 3VBRB 4Z1VA 2FMDA 4R9AA 3TWIA 2AUYA 1ZZ7A 3D82A 1TME1 2ETEA 4R4ZA 4Y22B 1R083 4HT1T 3ZYHA 4NIDA 2X5IB 2AC1A 4EN8B 5I0RA 1CPNA 5IAXA 3FHQA 2VZSA 5DAPA 4ZS3A 5F39A 1BEV1 4P9IA 5IVFA 1DCSA 5M0TA 3ZR6A 3HNBM 3OCPA 4CRQA 1V6JA 3MLLA 1UXXX 2W52A 2RJLA 3AZXA 1W8WA 2YZ4A 1XE8A 3WQBA 5C71A 1G8WA 4HPKA 3IDCB 3SH5A 3DCQA 3U0ZA 2ZZJA 4IL7A 3ON7A 1H9WA 5ANQA 1E5RA 3T0DA 2Q30A 3VBHA 3OYWA 5FLHA 1W9FA 1IOAA 5ISLA 1PVC1 3E5UA 3VD3A 2WABA 2V72A 2GC1A 1V70A 1IS5A 5HI0A 4OI2A 5L73A 4M4RA 1Z7S3 2J1AA 5A7PA 2W68A 5IUQA 4Z82A 3ZSMA 4NMIA 2E53A 5AVAA 5A7WA 1JXNA 1RXGA 1OLMA 3ACIA 4B8EA 5A1FA 1PM4A 2B9VA 4ORFA 2ZKNA 1POV3 4CCOA 3T0BA 1YJKA 4PLOA 5EQUA 3CHXA 1BBT3 4GJYA 1QJU2 3HMYA 3RI8A 4RGAA 2XXZA 2W39A 2KR2A 4FFFA 4AQ6A 2QQUA 3FUOA 5I0SA 4CDXC 3WF1A 1CVNA 1RUI2 1AL23 1X9TA 4WVZA 1ZBA3 4GALA 5LA0A 1AL0G 1V9U2 2Y34A 2XWBB 4CZSA 4AK3A 1W6MB 1SFNA 2QQVA 2GP3A 2J1EA 4XACA 2VXRA 3T3YA 4ARXA 2XUEA 3KHCA 1PIV3 2A75A 2FCVA 2VZ3A 3I4IA 3HN1A 1XRUA 2W3JA 1VBD2 1WLCA 2OQ7A 4Q0VA 3VD7A 3J26N 4Y4YA 4I3GA 2VCMA 3VDDB 2WT1A 1Y43B 4RN5A 3FMGA 4KI5M 4UFHA 4XUTA 5C8CA 4QPYA 3VZOA 3C7EA 1TZOA 4P08A 2B4KA 4Q4V3 5A7OA 1NQJA 3D0JA 5DZEA 2BDRA 1HB4A 4UW5A 2I07B 4XDPA 4BCUA 3KLSA 1JZ6A 1VBE2 3NSTA 2CY6A 4NPLA 3WG3A 5A3LA 2CDOA 5ABJC 3WF3A 3GXUA 4IERA 3TNPB 1N1TA 2VUCA 2JDNA 3BCWA 4N53C 4RR3A 4HLTA 2WZR2 4NHKA 2VOXA 2WAOA 3MIHA 4HANA 5EJZB 3ZIWA 2C1FA 1SCSA 4AQTA 3MGUA 1UL9A 4BK4A 3OGGA 1UOJA 3MIEA 5FY7A 4DXZA 1PO13 2XQXA 5I8YA 3AJZA 1ND3A 3M3IA 1YQ2A 2R061 3NNJA 3CJIC 2IZWA 5C9AA 3DECA 2HYKA 1VBB1 3I2JA 1K42A 2MHFA 1AR81 5FZ7A 1OLQA 3LEMA 4CEYC 4AEDC 3AJYA 1I9RA 3AFGA 3I2GA 3LB9A 4M3CA 4E8CA 4Q4W3 2IXLA 2PLV3 3H1WA 2D97A 5IVYA 2RS11 3NNGA 1A3KA 4UT5A 5HCFA 3HQRA 4JGZB 3ZYRA 2QQPA 2OXBA 1C57A 4XTPA 5DUUA 2BGCA 5I8SA 5LCWL 3IN9A 1O4TA 3J7NA 4HONA 2GC2A 4NUBA 3VL8A 2CDPA 5LY2A 4CXXA 3PUHA 1Q8PA 1CAVB 5B4XA 3W9AA 2QZ3A 1JZ4A 3IKWA 4NIGA 2J7MA 2R1DA 4XPVA 4GJZA 3H9AA 3URFA 2GN7A 1CJDA 1O3SA 4BJ0A 1XNCA 3SH4A 4EN9B 2YBKA 4YZ2A 5IVVA 3MICA 3K4ZA 2MEV3 1J1LA 1PNFA 3T2OA 5IK4A 3ST7A 4D94A 3IDAA 2A6ZA 5DAQA 1AJKA 3ZFFC 5IW0A 5J98B 2Q8OA 1FT9A 1GWLA 5FP7A 3ABZA 4LO4B 4CCJA 2WNUA 1MZ5A 4IGPA 3IBMA 1XU2A 3BPSA 3KSCA 1VRBA 4RFRB 5FV3A 1W99A 4OVEA 1LHWA 2JE8A 3CZJA 1G86A 3VN4A 2WWSA 3FUQA 5J7MA 3CMGA 4AWDA 2XWJB 2AR6A 2ZABA 1UNBA 4I01A 2H0BA 4TN7A 5F3GA 4ZKTB 1VBA1 4CDUA 2YBPA 5A7NA 4I0BA 1DGLA 1DDLA 2Q0AA 4JGYB 3J7MA 3NAPB 5JAXA 1JW6A 4CEWA 1NCQC 1JMUB 3JUUA 3BTZA 1O3QA 1JH5A 1F4HA 2TBVA 2VU9A 4HSJA 4AL9A 3U75A 2E9QA 3I59A 4QKDA 3N9OA 3I3BA 5CZKA 5ACA3 5JXJA 4MHUA 1NKGA 1R093 5FYUA 4B1LA 3O1VA 1K5MC 2B45X 4PIZA 1GNZA 5FPUA 4QPIB 3ACHA 2RS53 3KQRA 2R1BA 1ZZ8A 1ASJ3 2GDFA 5JOYA 1JS9A 1WCDJ 1HRI1 2UU8A 4LBMA 1C1FA 2RE9A 4COZA 2XJQA 2V73A 1OUXA 1UY3A 1R1A2 1HRV2 1ZRIA 2VJXA 1B35B 3J7HA 3POGA 3ZYFA 3WCRA 2WSUA 4QQHA 1WD3A 3MF6A 4PDWC 3MPBA 4D3WA 3AXEA 2XGXA 5LB6A 3BIEA 2Y60A 3K4DA 3LIHA 5KHKA 4B4RA 4XUPA 1QJZA 1DGWA 2LW8A 4DRVA 4XQ4A 4BLJA 3VHOA 5AFEA 2KD7A 5JMCA 2A73B 1E57A 5FJHA 4MHRA 1MZEA 1GBGA 3WNNA 2G9ZA 1JHNA 1AR93 1M06G 5FP9A 4AFMA 4YARA 3AZWA 1OLME 1DQ1A 3OY8B 3EB7A 5FZHA 4CYDA 2DTWA 5KHHA 1XNAA 1U5ZA 3POIA 5K8SA 2XBO2 1N1YA 5KXCA 3VBSC 1P8JA 3KCYA 2P3IA 2B46X 1X33A 1PNGA 3LA2A 5FZGA 4CPBD 3FFZA 2WS93 2HEVF 3AXDA 3T2PA 2A7AA 2VULA 4JRAA 1QJX3 1IS6A 2B39A 3ILRA 3FN9A 4PQ9A 2BYVE 4K1YA 2EAKA 4URAA 1V6NA 3ZN4A 5BNNA 3W5NA 3E6CC 4COWA 3NJYA 3UESA 2FZ2A 4RA0A 2QZ2A 3R4DB 2DDUA 3JXSA 4I2OA 5BNOC 1IQDC 1R082 3HBKA 3I3QA 5J3UA 5CG8A 1MQTB 1UWWA 4GKXA 4HXCA 4BHPA 1W05A 3FWEA 4XOGA 5ANNA 5BPXA 4B4QA 1RYYA 3HVDA 2Y38A 1W9TA 4MG2A 3C2UA 5C3QA 1F31A 2C0ZA 1XE0A 1JHJA 2VMGA 1UU5A 1OF4A 2X53S 3IPVA 4FCAA 4Q8LA 4BM8A 3OD4A 1NLRA 1Q8OA 1D4VB 1Y7BA 1SHWB 5CNAA 1XBFA 4YVWB 1RVF1 1BMV1 2CSGA 4OHZA 5FZKA 4UF0A 5BYNA 1NX9A 3BU0A 1LGNA 5HPOA 1I6XA 4IEYA 1CZTA 1C1LA 3BKZA 2PXJA 2R16A 1DYOA 4M01A 2ZX0A 1LRHA 3GJBA 1VMHA 2WA3A 4M3CF 3KQ4B 3NJZA 1W6NA 2R041 4XETA 5L9VA 1MEC3 3Q9OA 1LAJA 3ACFA 4QQPA 4X8NA 5FY9A 5FZ0A 4N7IA 3SNMA 4DXSA 3AZVA 3RJRA 4Q0PA 4YM3A 3NKGA 5A7SA 5H9PA 1UN1A 2OIIA 3B69A 5IJRA 2RDQA 1LEMA 1Z7S2 2WO2A 3DPRA 2CV6A 5FLJA 5BNPB 4WM8B 4Q0UA 4R8HA 2DCJA 4JZRA 3GDBA 1US3A 4MUVA 3THTA 2O8QA 3O1RA 1CGPA 2TUNA 3VKLA 4LT5A 1QKQA 3N9QA 4AFCA 2WA4A 3OGSA 5FMCA 1IS3A 2V4AA 1BBT2 1DYKA 5CKMA 5LK5A 1WW6A 4AHZA 1PX3A 2ET7A 2JD9A 1TE1B 3OJBA 1TVGA 4UI9L 5FPZA 1DZRA 3VBRC 4BIOA 3VBFB 3ZVXA 1SBDA 1FAYA 4M3CE 2W1SA 1ZREA 1QJY1 1ZBA2 2CWMA 5K0UB 3KT7A 3PMEA 1T2XA 1RC6A 4XFIA 2UWCA 3IAQA 5GLWA 4JQRA 3FLTA 2X5IC 5FZ8A 4AF9A 2OZJA 1HN1A 2VZVA 1LOEA 1PIV2 4QHZA 2YV8A 3B9IA 3BTYA 1PMJX 1NG0A 2VZPA 3FLRA 3ILNA 1AVBA 3SQOA 3ENRA 1WW4A 3WXPA 4XFFA 3ZXFA 2LROA 3U11A 1Y9QA 5A6YA 4IESA 4E4HA 1OKOA 1KS4A 2PMWB 1ONAA 1QQP1 1HB2A 3I7DA 2O14A 3M3CA 2R0FA 4GWIA 4RYDA 4YGDA 3ZYPA 2QCSB 1OD3A 4BIFA 4V2VA 3MV11 4HETA 4WBBA 3VUOA 2YFUA 4Q4V2 4KMQA 5L9RA 2JXAA 4LHNA 1GOFA 4CUBA 3FBMA 2JDHA 2QUOA 3WY6A 2IXCA 1UZYA 1WW5A 1W04A 3E1F1 3NNFA 1FPN3 1QDCA 2C24A 3PIJA 1IS4A 1CAUA 1H8TB 1O8SA 3C3VA 3AKPA 4XILA 2C5DA 3ZSEA 5DQ0A 5IAVA 4C1WA 4CP9A 3OEBA 4Z2AA 2GNTA 1K3IA 3N3HA 1Q43A 4GZ9A 2JG8A 1W8ZA 2Y0OA 4LBQD 2G1MA 4Z2WA 3D8CA 2EA7A 4M0HA 4XJWA 5H9RA 4LHLA 1PO12 1RUD3 3LA7A 1LOCA 4Q1PA 1JYXA 2VOVA 1YWKA 2CHHA 4NN0A 3POWA 1H1IA 1QGLA 4LULA 2WNVC 1AYM3 1UZVA 5G05L 1JYWA 4NPMA 3ORJA 4OUSA 3FLPA 3WDTA 4UWDA 1PX4A 4YVSC 3U78A 2FDIA 4AVAA 4MYEA 3GCXA 2HWE3 5E1RA 1H8VA 2HWF3 5FMOS 2QVSB 1C5HA 4RQPA 4XUQA 1AZDA 2NM1A 2PAMA 2PLV2 1GMMA 3EBRA 1C4RA 3GCWA 1WCUA 2VZ1A 5T3NA 3SHRA 3LDKA 2VO5A 3LFIA 4P5HA 4W6XA 4D6RA 1ZA4A 4AVCA 5ABJB 1Y3TA 2A5ZA 2C26A 1J58A 4LLOA 5DAWA 1ODNA 2EIDA 3VDDC 4XFHA 4XF4A 4YZ5A 4GH4A 2E32A 2PHDA 1RUC3 5E16A 2RR13 3N35A 3OPZA 5CG9A 1YI7A 1O59A 2D3RA 1V6MA 1GOHA 1QH6A 1YHFA 2Z42A 4U2AA 2MEV2 5FMOL 2WBKA 3A21A 3I2OA 2XLAA 1WLDA 1XNKA 3AZYA 1QJU1 1ZZ9A 4CCKA 2Q1MA 1S0FA 2WNOA 5K7PA 4E4ZA 3FJSA 4PBPA 4XJ9A 1RUI1 2D43A 3H50A 5FZFA 4CEYB 2W1QA 2YU2A 4JHTA 4AEDB 3AP7A 2J22A 2XKOA 3B3QE 2HBUA 3OBZA 4KWLA 1V9U1 2D6MA 4F8AA 5CEHA 4XFGA 3N7JA 5FZDA 4FPGA 4HMZA 1F35A 4X6QB 2VH9A 3WZ1A 2NQYA 4Y4RA 1SFPA 5HXMA 3V64A 1H30A 1LTEA 1YJLA 2Y6FA 5CAZA 3WW2A 1VBD1 4GMP1 4CVUA 4IEOA 4XMAA 3MBWA 3N7LA 4K20A 1C8NA 1UYYA 2HH9A 4YPJA 3U14A 1YUDA 1OFNA 3LQCA 5JZGA 3AP5A 4QGMA 3NWKA 1ZZBA 5ACA2 1HW5A 4AVBA 3H7JA 4G9SB 5FYHA 4LBQB 1R092 3OPTA 4DXRA 1WW7A 4JGZC 5FP4A 1GANA 4NIHA 4ZONA 1D0GA 4BB3A 1VBE1 2RS52 2RS33 2VZRA 3CJXA 1AX1A 4IE5A 1ASJ2 3HAGA 4JAAA 4QWNA 1CWPA 2BNNA 2YGMA 3D3AA 4KU7A 4XC9A 1MS1A 1OC1A 2ZMLA 1YFXA 2OVUA 2WQ4A 4Y1XA 2JDPA 3CF6E 1EV13 1BLZA 3WNOA 2FZ1A 1PMIA 3OGJA 5L36A 2WZR1 4XFAA 2YUEA 2H6BA 3AVRA 5T54A 5FOJB 3E5QA 4D7TA 1UYXA 2LTNA 3VKFC 5K9YA 4LK6A 4XJ8A 1V6KA 1W2UA 3WQ1A 1SDDB 1RUG3 5EJ3A 2YU1A 1M4WA 1NXMA 2VOTA 2VD7A 3OUJA 4YW2A 4BQ4A 4LO8A 5F8PA 1YFYA 4E9KA 3DEMA 2WAAA 4KL1A 5FZEA 5JIUA 2CL2A 1XQNA 1Z78A 2UWAA 4LO6B 2XLFA 1H1MA 1TMF3 4TLFA 2HWD3 1NCQB 3QBQA 5C4WA 1AR92 5F6LB 1A8MA 1WLWA 4BQYA 2ARCA 4R9CA 4W65A 4NHLA 2JDUA 4P00B 3EXUA 2K9ZA 1JU3A 4QGLA 2VL4A 4DO0A 4A41A 3LDBA 1S2KA 5KC6A 1UKRA 4AI9A 3NQHA 2WS92 4JGYC 3VBHC 1NOVA 3NAPC 2GAUA 1QJX2 4LKFA 4UOJA 1US2A 1S0DA 1R1ZA 4AI8A 1XNBA 2VMEA 3NNMA 3WX5A 1QXJA 5IK7A 1EPZA 1TNRA 1W8OA 1BCXA 2DU1A 4AOCA 2ZA9A 3C7HA 2VBPA 3ZOIA 4HFSA 5FYBA 4HKOA 3UNPA 4QPIC 5CKNA 3DN7A 4LUMA 2W87A 1ZBE3 1OD5A 2PA7A 4MVTA 3ZO0B 2VQAA 1K45A 5DAVA 2WKKA 1DBNA 4BK5A 2WO7A 4DUVA 4DXTA 3JBG2 1GLHA 1MZ6A 2OUJA 2YFZA 1QWRA 3HT1A 1YQ6A 3HNMA 3TEZA 1VBC3 4P9YA 4BOWA 3VD9A 3WG1A 1JZ8A 3W5MA 4LEJA 4PIXA 4AW7A 5LRRA 1XYNA 1MACA 3CNAA 4O61A 1MEC2 2ZCWA 5GZDA 3JD73 4QHBA 5IYYA 3N4MA 1UCXA 1W9SA 1LESA 5DUVA 4Z92B 5DDJ3 3BI3A 1NXD1 4PQQA 4JTNA 3ECQA 5GZFA 3ZXAC 5IVCA 1ODMA 2J1RA 3RRDA 3RWKX 3N9LA 5IFTA 3I49A 5FXVA 2P3JA 3D5OA 3PUSA 5FFOC 3ZXLA 1SCRA 3A7QA 1KGYA 3APBA 5C8CC 5BNOB 4AI0A 4FOYA 3LPFA 1WGPA 4JX0A 4P9JA 3RGBA 3WDWA 1OA4A 5FZCA 3PNAA 5EJ1B 1OA2A 4RSUA 5EPAA 5T5OA 1FYUA 1IHMA 4QX2A 2BVBA 2VNGA 2QQIA 5FYSA 1V6OA 1FV2A 1CIWA 1ULPA 4N8MA 4AR2A 5CA6A 3QCWA 4Y5SA 1R1A1 3CIHA 2CAVA 4GA9A 4PBOA 2F6BA 1HRV1 1SEFA 1W2NA 3GYDA 3LZZA 1IKPA 2EXKA 4AHYA 3AYAA 1NY72 2OYZA 3DYMA 1I3HA 4FOVA 5EIYB 4NPRA 1CONA 1ACCA 4R9BA 5D1IA 4ZZ8A 3TEXA 2Z4FA 4OHVA 3B01A 1LULA 3ZFGC 4LBKA 5A6QA 5JI7A 4CCEA 4LXLA 4KG0A 4V2WA 3UK9A 5JLVA 4CDWA 4RS5A 5IVJA 5FYVA 4QXKA 4EROA 4YVWC 2XVKA 3PURA 1O3TA 2RMU3 2CNAA 2ZAHA 3OBAA 5T5LA 4O9GA 1N3PA 5F5CA 2XBO1 3CEWA 3RZKA 4ZXEA 1MS4A 2QNKA 1DG6A 3WVJA 1IPJA 4HL0A 5GALA 2CGNA 1SLAA 1UX6A 3ZX7A 1PK6A 2BWCA 4IQPA 3WD5A 5F2SA 5IK5A 1IZ3A 1H1AA 1V6IA 5FXZA 5BNPC 4LE3A 1JOPA 4WM8C 1O6UA 1ZZ6A 4MGTA 3ALQA 4AQ2A 4RL7A 4AQSA 4ZZ5A 5FK7A 3LE0A 5A70A 4GWMA 4XEZA 5EFUA 2P37A 4MXWA 2JJ6A 1R081 5FO9B 3LEGA 4YW4A 2B9UA 3ELNA 4IEXA 3SLIA 3TRSB 4BQ5A 3PVNA 4EYUA 4YGCA 1RUD2 2XUMA 1UO9A 4XJAA 5EP9A 4CU7A 5BY5A 2IXIA 1JOJA 3G6JB 4CDQC 2ZGRA 4YM2A 5A1AA 1G9CA 1GP6A 4JKKA 1AYM2 1SLIA 5J96B 3VBFC 1IPKA 3BYWA 2Z69A 3M3OA 1XPWA 1YI9A 2HWE2 4GWJA 5K0UC 3ETPA 2HWF2 4UXAA 3MW4A 4YRDA 4E2QA 1SZBA 4NAMA 2W08A 4LBJA 1O3RA 2WT0A 3UJQA 1I5ZA 4B7KA 2O1QA 2XB6C 2EF6A 4IV3A 4J1WA 1PO23 4N43A 5EZWA 3WW3A 2SLIA 1WMEA 4K21A 4IW3A 2OS2A 3R4UA 1Z7S1 2IC1A 4FFIA 5C5UA 5IHRA 3H8OA 1RUC2 1DZTA 2ARBA 1ND2A 3HWJA 3RG0A 4QB1A 2D93A 1HV0A 2RR12 2VCCA 5FQ0B 3B5LB 4A7YA 1QXPA 2OZ6A 1L3JA 2DFBA 2W46A 2YC4A 3AL5A 2W1WA 3D4KA 3MFCA 1FNYA 5FMBA 3VBUA 1W90A 3K2OA 2Y8KA 3H3UA 1POV1 4ES8A 4IDZA 1HX6A 3EQEA 2ORXA 2VMFA 2G9GA 2ZMKA 1BBT1 3V0BA 1HB3A 2ZGMA 3AC0A 1H8TC 4YW1A 1L7QA 4Y20B 1RTVA 4H7MA 1NZCA 5JXHA 1RUH2 1SBFA 1VMFA 3SCGA 2XOMA 2WNVB 5F5QA 3O1OA 1N1SA 4J25A 4B4PA 5FMDA 3RI9A 5EXOA 4YVSB 1DZQA 5JIAA 5C6CA 5D8AA 4YFZA 4S2HA 1ZBA1 1SBEA 5FZLA 2WC2A 2H0VA 1XJAA 1RJ8A 4FPHA 1AR63 4YFWA 1UIKA 4DQAA 2ZGPA 1O91A 1QIQA 1PIV1 2VXJA 3GBWA 4LHKA 3SH3A 3UKVA 5BNQA 2D5HA 3ZN5A 1CN1A 3QLQA 1GZWB 4UFLA 4JQTA 3LF7A 5EYYA 4A6OA 1L7LA 2O0OA 2DYCA 4YW5A 2E63A 3THCA 1H2MA 1W0PA 4Q4V1 3E97A 5A7QA 4NIIA 4BQWA 3KCXA 3HOBA 2UURA 5JSRA 1KJRA 3N9MA 4BMEA 3HJRA 5CFDA 1U0AA 2D3PA 4WV8A 3ZPYA 3WP4A 3TBDA 2A3WA 3FHIB 4UFJA 2B7YA 3MUZ1 5FZOB 2W95A 3RPQA 2EIEA 2NMOA 4GIQA 4P5YA 1UX7A 3KVAA 1F4AA 1RUG2 5I91A 1OVSA 3RZLA 3BPZA 2I74A 3DL3A 4NWWA 4V1PA 2CTVA 1ENSA 1PO11 1S55A 2YB7A 1OXCA 1TNFA 3B7MA 4MLOA 4JHZA 4QB2A 3A23A 2IFRA 1BVP1 1TMF2 2W2IA 2JX9A 2W91A 4FPKA 2HWD2 2YDEA 1OOPC 4ZHNA 2ATFA 2Y0IA 3K3NA 2XJTA 3VBOA 3R6SA 1H2NA 1SPPB 2P6CA 4XF3A 4ONUA 5G04L 2EXIA 4W8JA 3KGLA 1S0EA 2BFUL 1RUJ3 2ZS6B 4TWTA 1IPSA 2Y64A 4XYXA 1GYKA 2WFF3 2JG9A 4QPWA 2ZEZA 5I93A 5A32B 3PVOA 1RHI3 1BYHA 4QQOA 4FP3A 5LZ6A 2VBDA 1W06A 2AEZA 2FQPA 4XF1A 5F3CA 3RZGA 5JXIA 1WCSA 4PF1A 2FDGA 1W6PB 3RNSA 3LSEA 5FPLA 2YROA 1S2EA 1PGL2 4TZDA 2V09A 5DG1A 2D6LX 1W6OB 2QBXA 1JU4A 2OPWA 2YY1A 3DPRC 3HQUA 4H2AA 5DUXA 4E4DX 3V0AB 3POFA 3AYDA 4NRQA 4K6BA 2BZDA 5SV8A 2FD8A 1JYNA 3DYPA 4HVRA 3VHRA 2MEV1 4DY5A 2WN2A 4DINB 2UWBA 1O4ZA 4BA6A 1NA1C 2VVFA 2BRTA 1ZBE2 2QKDA 4BLIA 4DUXA 1RUOA 3C8XA 3DXUA 1W2OA 3D0SA 1NCRA 3VZKA 5IT6A 5DXDA 4LA3A 1UOFA 1MS8A 4IGOA 1IKQA 2WYFA 2IXKA 3ZMNA 4NHYA 1PGW2 5DPNA 2VPVA 1JBCA 3P5BA 1RB8G 1VBC2 5BUVA 1LGBA 1ALYA 3VZMA 4MGKE 5FPBA 5LA2A 2C9KA 4Y24A 1D2SA 4TSVA 4NROA 2WIIB 1N1VA 2PFWA 2BU9A 3JD72 1JZ3A 5DDJ2 3OYWB 5A33A 3VBHB 3AMQA 3LOBA 1V6LA 1ZX5A 5KWRA 5L19A 3ZKUA 2VGDA 1O8PA 2DUOA 3D6EA 3WR0A 5FYCA 4RHV3 3T4HB 5CBLA 1UOBA 2DCTA 3AKRA 3LKJA 3VKMA 3ZN6A 3USUA 5HV4A 4L2NA 2E7AA 4ASKA 3HIFA 5ACA1 2EIGA 5FBJA 5A7WB 1R091 1VAKA 1UMHA 1PVXA 2BGPA 4XUOA 4FPOB 3JQXA 1W8FA 4O65A 1U5YA 2RS51 2NPIA 2E7TA 3Q8BA 4CPBA 1ASJ1 4XQWA 4QX1A 2ZHMA 3WSOA 2R32A 3H3ZA 3IMMA 3UKNA 3LEKA 2TNFA 2QDNA 2HWC3 4A2UA 1G9AA 3KS7A 3W59A 1MR5A 2ARXA 3X29B 4C1XA 4Q4X3 3GZTB 3PUQA 2DCZA 5CKQA 5L7OA 4N9IA 1CJPA 5E8AA 1VMJA 1UW8A 1V00A 4LKEA 5CIRA 4FFHA 4LITA 3WG4A 1S2BA 3MIDA 3WV6A 4XAEA 4CDXA 3QH7A 1I1EA 4NAOA 1AR91 2WLQA 5IVEA 2RMU2 4YYOA 1GFF2 1SFYA 4Y3OA 2DWRA 2GALA 2BNMA 4LK7A 4I3PA 5HV0A 2FDKA 1LHNA 4IEWA 4HVOA 5C8CB 4UFKA 5EHDA 4NWVA 3MPPG 5EV7A 2XJRA 1UY2A 4RQPC 2ZXQA 4FQZA 1ZRCA 5HCAA 2QQMA 3I3DA 1VB4A 5FDBA 2F4LA 2L9LA 2P6HA 2WS91 4G3YC 3IIAA 1QJX1 3G7DA 4L11A 5FWEA 4AEJA 5KC5A 3M4FA 4OI4A 3MYXA 4Q4Y3 5DUWA 1W0NA 5F7UA 4JC1A 1LECA 4Z07A 2MPFA 1WCKA 4EV0A 3I97A 4NRMA 4I0WB 4JKLA 3ZDSA 3VKOA 3MV01 2JECA 1GR3A 4JRLA 1SACA 1RUE3 3EMRA 5FY5A 2J1SA 4QDRA 1YQ8A 2JDAA 2RDNA 4LUKA 4ZPIA 2PHLA 3AP6A 4DOUA 1F5JA 1ND3B 4N53A 3WNXA 1CAWA 1IQAA 2KA3A 5C9AB 4WVMA 3JBG1 1EUUA 1LU1A 4TYSA 2FDHA 2VMHA 3H8RA 2GH8A 2PYTA 3RJ2X 2PAEA 4LOSA 5A3WA 1AYN3 1FMD3 1D4M3 1W8NA 4G4FA 1PZ9A 2DCYA 3HEIA 3WHUA 3ZMOA 4AEKA 1A34A 3CBNA 4YW7A 3PVEA 4R4XA 1MEC1 3DGTA 3H1MA 2DBIA 5GJ6A 2B8MA 3UKTA 1DU3D 2BTVC 3MIFA 1PO22 3CJIA 1OPOA 4LA2A 3AX4A 4QPGA 1N3OA 5FZ6A 3VDCA 2DV9A 3ZSKA 1HXS3 1UPIA 1XNTA 3TEYA 1VPHA 4CCMA 4XTMA 3W58A 4AEDA 4QX7A 4OHWA 4MGQA 3EHKA 2B5HA 1ZM1A 2ET1A 1YYNA 4XDQA 3ZXKA 1CD3G 3LEIA 1K12A 3UGGA 2VUAA 4OHXA 5LY1A 5FYYA 2D7FA 2VOWA 1WLTA 3NJXA 3UETA 3S57A 3RWNA 1NLQA 4XURA 1YC61 3NV4A 1ENXA 4YGEA 3H42B 4CDQB 3B00A 1CX1A 1PGSA 3VD4A 4D7YA 1HV1A 2A6WA 3GBGA 4FPFA 4PLMA 4AGGA 1BHGA 1AL22 1QJFA 1RGSA 4IE0A 1LOGA 4UYBA 1NY71 4IEQA 2ZX2A 2Y6KA 2ID4A 4LBQA 1LOFA 2JE7A 2D3SA 4CUAA 1AR62 3ZDVA 3PU3A 5H9SA 4BPZA 1COV3 3VZNA 1KFXL 1X8MA 2VMDA 2VQTA 2PHUA 5CFCC 5FUIA 3J9SA 1WMFA 3J8F3 1AX2A 4CCCA 4EN0A 3H8XA 5EYXA 4BMBA 3I8TA 5A1LA 1ZA7A 2ZMNA 5LBFA 4CEWB 3T2QA 1FNZA 4INDA 3VZLA 3VKNA 1CZVA 2LM3A 2WDBA 5JR7B 5J36A 4KBZA 2JE9A 3N7MA 3ACLA 3I59B 4OUEA 3UGHA 1NAEA 3O14A 4AHWA 1W6QA 1FXZA 1UF2C 3MLJA 4YSFA 5JWPA 1DF0A 4XIKA 5FUPA 3M2MA 2C4XA 2D6KA 2HEYF 3B9CA 3DYOA 1WBLA 2EXHA 3HNYM 1ULFA 4IE7A 4KH9A 4EWDA 2ZZQA 3DF0A 4M0NA 3ZFEA 1NCQA 2CYFA 4YM1A 3A0NA 4E8DA 1UPSA 3I2KA 5FZBA 2DBNA 1AX0A 2ZHKA 2P3YA 4JDMA 2Z5WA 3O5SA 1QOSA 1Z0HA 2VNOA 3I2FA 4MO3M 4XBNA 4H14A 4LBNA 4ZY9A 2RJ2A 4MH0E 4KGQA 1K5MA 4XXAA 4K8RB 5FYZA 3QD6A 1RUD1 2PHRA 4YZ3A 4Y33A 3VDBA 1QDOA 4D6QA 2I2SA 3U07A 1FX5A 3TB0A 1AYM1 3PJYA 3PMSA 2YBSA 1RUF3 3MDPA 3FZ3A 3LOIA 2HWE1 2ES3A 4WM7A 1HQLA 3GGLA 2CWSA 2HWF1 5F6KA 1F5FA 4Q4W2 4PDWA 4COYA 4EZ4A 2VECA 1RUJ2 4Q27A 4PJYA 2WFF2 3KB5A 5F1RA 2XVLA 2J1UA 3KT4A 2TEPA 1RHI2 3L2YA 2P1BA 4QX0A 5KBFA 1ENQA 1CESA 1QXRA 5FAXA 3AYCA 5CU1A 4YW6A 2FCUA 4QQLA 5T5PA 5AC93 1UZWA 1LHVA 1RUC1 5BNNB 3JZVA 3NNLA 2RR11 4A3ZA 1DLCA 5A3TA 4HKWA 2E33A 4NOTA 3IM0A 4QM8A 3VBSA 3WF4A 3WG2A 4Q0QA 3H3LA 1DHKB 4XQDA 3VLBB 1S0BA 5LA9A 4ES9A 2WT2A 3KT1A 3FX3A 1GP5A 2Y6GA 3KCCA 3ZYIB 3WDYA 1RUH1 5J48A 2JKXA 2QQLA 3B93A 3IPVB 1YEWA 1WA4A 2VCBA 1W3VA 4OULA 1OOPB 4ZXKA 3BVCA 3MIBA 1KEXA 1OSGA 2YYOA 4IXLA 4W4ZA 4XHXA 3WNLA 1X82A 3AKTA 3FBYA 5FZ9A 2UYBA 1UY0A 1NE6A 4UF0B 2LS6A 1WWYA 1QY4A 1YNAA 3BODA 2GC3A 3AL6A 5I0UA 4OQ9A 2RM23 2ZPXA 2ZX3A 3RS6A 2OA2A 4Y5TA 1AR73 3GHMA 4YZ1A 5LBBA 3POJA 2HYXA 3ZR5A 4Y1UA 1EP0A 1W6NB 3GF6A 4TTGA 1T6GC 4OQ8A 5DZFA 3FE5A 5J09A 4OLLA 5GM0A 2GSYA 2A1XA 4RHV2 2AZ5A 5A3UA 4RS5C 5LK7B 1ULEA 5FTTC 1JOBA 2JDMA 2R0HA 1H4HA 4TXWA 5JSPA 1KQRA 3DPRB 3OOXA 5FZ4A 2C6SA 2DVFA 3HD8B 4IV1C 2XDVA 4CCNA 2E31A 5T50A 4CUCA 5HXVA 5BV6A 3AFKA 3RVHA 3ZYBA 4AVTA 2VMIA 1NA1B 2OT7A 2DFCA 2Q8CA 5CADA 2A71A 3B02A 2XPJA 3NL1A 3KM5A 1CAXA 4I30A 2HWC2 3U37A 4JKMA 4QX5A 3OUHA 2HKXA 4XHBA 5FP3A 1Y9GA 1PM7A 2DVAA 4Q4X2 5D21A 1ZRFA 1JI6A 3O1TA 3OPWA 1RUG1 5FY1A 3T0AA 1OPMA 5FYMA 1YQCA 4QXCA 3LFMA 1D2QA 3U4SA 3LPGA 4XZUG 5FLIA 4QXHA 1VBE3 1HJFA 1YCIA 1YLLA 4QGNA 1J59A 1TMF1 5FYTA 4IEPA 4OI0A 2HJIA 4EZHA 5LEKA 3WP6A 2HWD1 1DQ2A 3NVCA 3VBRA 4QD2A 2BVVA 4QX3A 5FKBA 1LNSA 2W0XA 4B3NA 1Q8QA 1UU6A 3MIGA 1W28A 1POQA 4EE2A 5F9TA 1KDKA 5T52A 1XNDA 4RD7A 1G9DA 4Y22A 2DUQA 5FPVA 2GP5A 2X5IA 4Y5Z0 2VVDA 2ZHLA 4MGSA 5J37A 4FXKB 1PHMA 3BTAA 5ERLA 4K40A 5TSWA 4AFDA 2ZGNA 1UY4A 2J42A 3OD0A 1VAVA 3H7YA 5FXXA 4E27A 2RDRA 4IV3C 4KG8A 5JI9A 4FOQA 2PHFA 4N43C 3WEZA 4Q0SA 1CAUB 3M3EA 4Q4Y2 1PGL1 5FP8A 2BJSA 2JG8B 4FO9A 2DF7A 1ND2C 2JICA 2ZGKA 4FPYA 5E6HA 4N90A 5KR7A 2ZEWA 4MZUA 4J6GA 1FATA 1ULCA 2ZGTA 3VBUC 2VC9A 2X29A 2ZJCA 1NE4A 4NO4A 1RUE2 4OHYA 1ZBE1 1DGRN 4L92A 1AF9A 1RMU3 2LALA 3BGAA 4EWEA 3PLQA 3H1YA 1RINA 3WLUA 5LW9A 3CZUA 4NR1A 3OBTA 5LA1A
chains in the Genus database with same CATH topology
1TEIA 4OI1A 2VOKA 1PGW1 1U5IA 4RFT0 4COVA 1UKGA 3NO8A 1VBC1 4OUMA 5D8AC 1AYN2 1FMD2 1D4M2 4RQPB 2IFWA 1FOD3 3JD71 1SLTA 1XU1A 4HN1A 5DDJ1 3K48A 1RITA 1AJOA 1HXS2 2ENRA 3TN93 2QDRA 4Q29A 1O7FA 1LOBA 4LTAA 4Y1ZA 5LEJA 2H6CA 4HZFA 4ZU4A 4GH4B 1W6MA 3GZUC 4GB33 3LWCA 4Z8BA 1DLLA 3WCSA 3USSA 4YG0A 3JU9A 2BEOA 4NHMA 3IT8A 3PJQA 1JUIA 3VDDA 3HBZA 4YW3A 1X50A 2C9AA 2QJVA 5B2GB 4RR3C 1LJ7A 3WDVA 2Z79A 5FO7B 2PELA 2HWB3 1YIFA 2CGPA 2JEMA 4UW6A 4C0HA 1EAH3 5JOWA 5KXBA 2Y26A 1VRH3 1COV2 4FP2A 4IEUA 4J1XA 1S0IA 4FPCA 4I09A 1OHFA 1ND3C 4S2FA 3J8F2 3IWZA 5C9AC 3K51A 2XJVA 1Q3EA 2DCKA 4PF5A 5E88A 5FO8B 2RMU1 1S1AA 3LSDA 1DQ0A 3ZYGA 4YZ4A 3WDXA 2YHJA 1UD1A 5KHGA 4XF0A 4LLFA 2MNGA 4Q8KA 5GLVA 1FPN2 2R073 5SV5A 1OKQA 3H0OA 3O0XA 2JDZA 2PTMA 4WVVA 4AVVA 1QU0A 4AE2A 5A33B 1G9BA 3SMHA 3CU7A 4Q1RA 3M3QA 2XKPA 4YG6A 2D98A 4H3WA 4K9SA 2Q5TA 1Q56A 1H4GA 5IK8A 4YNIA 4B7EA 4JGZA 3WHTA 1MS3A 3UJOA 4KNCA 3S30A 3IDEA 5CFCB 3TYJA 1CAVA 1S0GA 2A6YA 1C8M3 1J3PA 1REEA 4YM0A 1GQHA 3JB8A 2JKBA 4X8PA 1SQ4A 2WNUC 1RUF2 4LNVA 3HQXA 5C4WB 4N7UA 2GMEA 1C5IA 1A78A 1TME3 1XYOA 1DYPA 2DU0A 3NKTA 1URXA 4JTOA 4XBQA 4CDUC 1TQ5A 1KFUL 2A3XA 4P9LA 4Y1YA 1PO21 1KRIA 1MS9A 4KWJA 4MXVA 1BEV3 4Y1VA 5FCCA 4CEWC 1JN2P 5AC92 2E7QA 1KDMA 2PAKA 4HBNA 3VV1A 5FOBB 4DS0A 3SCHA 4K8FA 4AI3A 2XH6A 4F7ZA 3GHNA 4JGYA 5AFBA 3NAPA 4EN6B 2WZPP 1PVC3 3A4UA 1B09A 5FREA 2D5FA 3RMXA 3EO6A 2XJUA 4L97A 1AL21 3T2TA 5I8TA 2GZWA 2K0GA 1UIJA 4AEMA 4AGVA 1AR61 3RYKA 4QPIA 1U5XA 2RM22 1GNHA 1GZ9A 2ZGUA 3ZXGA 1AR72 3AKSA 4RGGA 5L7OC 1GICA 2AREA 3FC0A 3DKWA 3R0RA 3M70A 2PN5A 4U36A 4K7JA 1DQ5A 1KJLA 1BJQA 4FAGA 1B35A 4FQ4A 2ZOEB 3ILFA 5AVPA 4DRRA 2ZHNA 1J3RA 5H9QA 4CP0A 5KXDA 4FTBA 3O7OA 3WOGA 3S0MA 2GMPA 2RS32 5JPMB 2XHKA 4D7SA 2ZACA 4QQ2A 2A6VA 2P2KA 2EVXA 1EV12 3CLPA 1CPMA 1G6NA 1ZRDA 2BFUS 3BB6A 3VGIA 1HLCA 3OY8A 5BNNC 3E6BA 3FFQA 5FPXA 4GMP0 2ZGLA 1UU4A 2AGSA 3OBRA 2OPKA 4XE9A 3TNQA 3MF9A 5JOXA 1AUYA 2IWGB 4L99A 5CB7A 1DGWX 3QACA 4AYUA 1LODA 4MGYE 2ZTNA 4CDWB 4RS5B 4ZU7A 1PZ7A 3ME2A 2R49A 4EJRA 1Q5OA 3BU7A 4Q4W1 2PLV1 3MFAA 1MQTA 1RUJ1 4IV1B 4XFBA 2WFF1 4BH9A 2DURA 3GNEA 1RHI1 1GZCA 1VR3A 3DUIA 3ZFGA 4UW3A 4A3XA 4LR4A 3AM2A 4HKLA 2R063 1PK6B 1LR5A 4H55A 3ZSLA 1DFQA 4QPGC 4YVWA 1VBB3 4WVWA 5JVVA 2XL9A 1AR83 3ROUA 5JCTA 1DQ6A 3WQ0A 2JD4A 2XJPA 3AYEA 2VUJA 4MXWB 4A7KA 2RS13 2SBAA 3N36A 4L9BA 1XYPA 1RMU2 2WINB 4MX3A 3ZXEA 1OFSA 2IXHA 5BNPA 3SCFA 2VW1A 4WM8A 3TAYA 1SLBA 1SMVA 2D6OX 4S2GA 3ATGA 4ASLA 2VW2A 1LOFC 4P14A 4HPKB 4XJZA 2FMYA 3ES1A 1FOD2 4X6RB 4FPEA 2FBEA 4CDQA 2QFEA 4FBFA 4QU2A 1VALA 4IV3B 3TN92 3VBFA 2GNMA 4N43B 4RHV1 5K0UA 2P17A 2XG3A 1W39A 3L9JT 4D69A 4GB32 1GKBA 4K1ZA 1ND2B 3CL1A 3WDUA 3NV2A 4UBHA 3VBUB 1VBA3 4W6WA 4C91A 3M8LA 5GZCA 1BKZA 1A8DA 1JTZX 3V0BB 5GLUA 1BK1A 3J4UH 2HWC1 3ZFEC 1NLSA 1DIWA 1ZNPA 1OLRA 2JG8C 2HWB2 4ITCA 4MV2A 4Q4X1 2P3KA 4R9DA 4MSVA 4S2DA 1W0OA 5D8AB 2NP0A 1EAH2 1QH7A 1ENRA 1VRH2 2R6QA 1X36A 4P9XA 1YO8A 1H8TA 4ATFA 4FAHA 1HRI3 4A7ZA 4YLZA 5JPNB 3WINE 5GZEA 3T1MA 1J1TA 4WM7C 5CVRA 4URTA 1OQDA 3ZYJB 1GSLA 2GNBA 1BZWA 3S7IA 3AMNA 3A0KA 2R072 3E5XA 3S7EA 4JVAA 1MZFA 4QT6A 4CP2A 3UL2A 1WMDA 2LUWA 1ZRRA 4Q4Y1 3MW2A 4KQ7A 5CFDB 2CGOA 4FXGB 4HK9A 4RR3B 5KHIA 2GU9A 4GH4C 2BNOA 2YPJA 2YXSA 2NYYA 2WSVA 4IEVA 1FV3A 1OA3A 1ZZCA 5GZGA 3ASIA 4XF9A 3ZXDA 1UAIA 4FTEA 2UY8A 1UMZA 4META 3INAA 1HKDA 1RUE1 3MI8A 3AP9A 5ABJA 5T55A 4SBVA 1C8M2 5KXEA 3NV1A 1OI6A 4CP1A 3AP4A 3VBOB 3KZ4C 1TME2 1AYN1 1FMD1 1OQEA 3JQWA 1D4M1 2IXJA 4M3CB 1DQ4A 2V5YA 4NVPA 1AXYA 4H7LA 3WQ7A 2JG9B 3AB0A 2VQ0A 2NLRA 2CAUA 1O5LA 3ZXJA 3POSA 4LO7A 1BEV2 1HXS1 1OOPA 4CEYA 2GMMA 2PHXA 3ZSJA 4YG3A 3JBG3 1RVF3 5I0TA 2RJKA 5JZGC 2D6NA 1D0HA 2EALA 4MGIE 3UV9A 4GKYA 4DZGA 2AYHA 2ILMA 2R043 3T1LA 2R30A 1PVC2 2YGLA 4QMAA 5FRAA 1NCRB 2F4PA 2WNUB 1BVVA 4WZCA 5T5JA 5HBAA 1QNYA 2BWAA 3GZAA 2WLPA 2EXJA 4FOWA 2XVGA 3L2HA 4LBLA 4GXLA 3S6PA 3IDBB 1COV1 3ETQA 3KGZA 1NA1A 1WBFA 3NW4A 1LHUA 2ZAAA 4JV4A 3ZFFA 4CDUB 2VNRA 1QHDA 3BALA 3OF1A 4L8QA 2UY9A 3J8F1 4FT8A 4HN0A 3MW3A 1POV0 3PVBB 1F2NA 2ERFA 3WUCA 5C33A 5C4WC 4LBOA 1JYIA 1LCLA 3RYPA 1QJY3 3USUB 4W6YA 3ZN6B 2NZ9A 3P3PA 4BQ1A 1N47A 1KD7A 2NN8A 2G4IA 1SLCA 1FPN1 4FPJA 3VZJA 4E2SA 1CX4A 2VY0A 1MS0A 3VL9A 1Q8SA 3SISA 3SXWA 2D40A 1QQP3 1G9FA 3PTYA 2DVGA 5EWSA 2WQZC 1C28A 4FTSA 1VJ2A 4XMIA 1OQ1A 4GWNA 1YIPA 5L7OB 3TOJA 5JDBA 1SDWA 1G7YA 4JDNA 2D44A 4P9WA 2N7GA 3AKQA 1RUF1 4CDXB 5HCBA 1VAMA 4AG4A 2ZX1A 4DNYA 1REFA 2KM2A 1JUHA 2AENA 1S0JA 3AMPA 1YFUA 4AGRA 5C8WA 3LA3A 1HDKA 1VIWB 1YRZA 1RUNA 3QH6A 4C0BA 1LHOA 2A3YA 2R062 3H8UA 3RQ0A 1WD4A 4UBGA 3WT3A 2WL1A 1QNWA 1C3HA 5AC91 1VBB2 2BW8A 4C90A 2FHRA 4P9GA 1AR82 5GLZA 3GBFA 4R52A 4BE3A 4YGBA 4MGZE 3U10A 2E51A 4N9HA 1HQWA 1HQNA 1MS5A 2JENA 2YMZA 4OZXA 2RS12 3NV3A 3WW4A 2A6XA 4FVVA 4DMIA 4IEZA 4LO5B 4COUA 2ZGOA 4N53B 3E6DA 1CAWB 3PHMA 2UYAA 1LU2A 4WVMB 2DTYA 5BNOA 2ZBJA 4KU8A 2D6PA 1DGRA 2RM21 3B94A 5JSOA 4DY3A 2VG9A 3RMYA 5DZGA 4FSJA 1AR71 1ZVFA 3M1HA 2VVEA 4LE4A 4AI2A 2HEWF 1WUVA 1QJU3 5JOZA 4XZPA 3CJIB 1RUH3 4QPGB 4CDWC 1RUI3 2QE3A 2X8KA 2GN3A 1BXHA 2GH2A 3P3NA 5E89A 1VB2A 1V9U3 2B42B 1APNA 4JCKA 4SLIA 4F83A 2RS31 1VBA2 2P34A 1PK6C 4HK8A 1LEDA 1VLNA 1EV11 1U12A 4XBLA 1LOAA 1VBD3 4GMP3 4Q2FA 3ZIXA 3LGRA 3BOWA 4XFCA 1O5UA 3MZHA 1X7NA 3VHPA 1LENA 4OFGA 4XIOA 3MEPA 1VP6A 2OUHA 2RHPA 3RZZA 4HSLA 4UW4A 4AVSA 2OW4A 4ISQA 3BOPA 4K3UA 3THPA 1HRI2 3BIWE 2WZR3 1EPWA 5GLTA 3N7KA 2E6VA 2XJSA 1OMIA 4QM9A 4E4SA 1H2KA 4GULA 3EJKA 4DB5A 1W6QB 5CFCA 1GQGA 1S0CA 3JB4C 4BZ4A 4I02A 1PZ8A 3RSJA 1CR7A 3RDIA 3IMNA 3ZFEB 4PLNA 3V65A 1EY2A 3ES4A 4EWAA 4IETA 3GALA 2ZKLA 1MVQA 4FPLA 1LB2A 1K5MB 1NQDA 1RIRA 2Z2SB 1RMU1 2GNDA 4AXOA 1N3QA 3HT2A 4AFBA 1J3QA 4B29A 1A6CA 2DVDA 1BQPA 3WP5A 5FQ0A 1AHSA 1AXZA 2ZGSA 1JYCA 2Q4SA 2BQPA 1QOOA 4WM7B 1RL3A 4AI1A 4DFSA 4PDWB 1H9PA 1FOD1 1F8VA 2I45A 4KBBA 4Y20A 2K2SA 3V56A 3LCPA 2WNVA 3TN91 1LKNA 3O0WA 3CO2A 4EN7B 3I2DA 4YVSA 3SITA 1IGOA 1RVF2 1B35C 2ZX4A 3VHNA 1BMV2 1CQ9A 2WFPA 4AHXA 4XW3A 2AH2A 4GB31 3RYRA 2VW0A 1QF3A 2EAAA 2DVBA 4GQ7A 1O4YA 2YC0A 4XJUA 3VBSB 1YFWA 1XXNA 3POYA 2R042 1GZWA 5FBZA 4I0AA 1Q8VA 1EYBA 1FI2A 3AMMA 5CFDC 1H2LA 4Q26A 2G9FA 3O12A 2HWB1 3M7AA 2O8OA 3OTFA 2WNEA 5GKAC 5BXXA 3DV8A 3WP3A 1MVEA 5DG2A 1EAH1 5LRSA 1ZYBA 2PQQA 3R05A 1HIXA 1VRH1 4BYYA 4BWOA 3WW1A 1ULDA 4JDOA 1XE7A 3R4SA 2BBVA 2BUKA 2Q1ZB 1NYWA 3O0VA 3QOPA 2BPA2 3HR9A 3KMHA 1GV9A 4ATEA 5KHJA 3AMHA 1R1A3 1RJ7A 3VBOC 1HRV3 4E2GA 3AK0A 1QJY2 2GC0A 3LAGA 4ZU5A 1KS5A 2KXLA 5JZGB 4KWKA 1QOTA 1MQTC 4XXPA 4WZFA 2JG9C 1F9KA 2A70A 4ISRA 2R071 3JCIA 4KGGA 1KITA 1AXKA 1UZZA 1QQP2 2ZGQA 4HVQA 1CAXB 1LGCA 1QMJA 1X8EA 2DUPA 2PHTA 3MLKA 1YXWA 1ULGA 4DPNA 4IV1A 3I54A 3U4XA 2XBO3 2NMNA 5A32A 4PIYA 4Y26A 5A3MA 1H0BA 2PHWA 1KXGA 3AZZA 2XL7A 1SLLA 2XLGA 1REDA 4F3JA 1W6PA 3KD4A 4M00A 1C8M1 4O9EA 3WUDA 1NCRC 2WJSA 1W6OA 4ASMB 3V0AA 4PCRA 3VBRB 4Z1VA 2FMDA 4R9AA 3TWIA 2AUYA 1ZZ7A 3D82A 1TME1 2ETEA 4R4ZA 4Y22B 1R083 4HT1T 2X5IB 4EN8B 5I0RA 1CPNA 1BEV1 4P9IA 3OCPA 4CRQA 1V6JA 3MLLA 2W52A 2RJLA 3AZXA 2YZ4A 1XE8A 1G8WA 4HPKA 3IDCB 3SH5A 3U0ZA 2ZZJA 4IL7A 1H9WA 2Q30A 3VBHA 3OYWA 5FLHA 1IOAA 1PVC1 3E5UA 2GC1A 1V70A 1IS5A 5HI0A 4OI2A 5L73A 1Z7S3 2W68A 5IUQA 4Z82A 3ZSMA 2E53A 5AVAA 1JXNA 4B8EA 4ORFA 2ZKNA 1POV3 1YJKA 4PLOA 1BBT3 1QJU2 3HMYA 3RI8A 4RGAA 2W39A 4AQ6A 3FUOA 5I0SA 4CDXC 1CVNA 1RUI2 1AL23 4WVZA 1ZBA3 4GALA 1AL0G 1V9U2 2XWBB 4CZSA 4AK3A 1W6MB 1SFNA 4TZDA 2VXRA 1PIV3 2A75A 3I4IA 3HN1A 1XRUA 1VBD2 1WLCA 4Q0VA 3J26N 4Y4YA 4I3GA 3VDDB 2WT1A 1Y43B 3FMGA 5C8CA 4QPYA 3VZOA 4Q4V3 1NQJA 3D0JA 5DZEA 4UW5A 2I07B 4BCUA 3KLSA 1VBE2 3NSTA 2CY6A 3WG3A 5A3LA 5ABJC 4IERA 3TNPB 1N1TA 3BCWA 4N53C 4RR3A 4HLTA 2WZR2