2VY0A

The x-ray structure of endo-beta-1,3-glucanase from pyrococcus furiosus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
264
structure length
264
Chain Sequence
b'MVPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,3-GLUCANASE
publication title Crystal Structure of a Family 16 Endoglucanase from the Hyperthermophile Pyrococcus Furiosus-Structural Basis of Substrate Recognition.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 62
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vy0A00
4DRRA 3D6EA 5FRAA 3MW2A 2AH2A 3JU9A 1DIWA 2CYFA 2ZMLA 2R1BA 1GSLA 4YLZA 3AXEA 5GZEA 1U0AA 5F5QA 4PCRA 5JVVA 1Q8OA 2WLQA 4LBQA 3BOPA 2A6XA 1MS1A 2CTVA 3WUCA 3AYCA 4ZKTB 1GYKA 4WVVA 3ZXJA 1Q8SA 3WZ1A 1X50A 2AGSA 3ATGA 1V6IA 2NMNA 1GICA 3IPVB 4XZPA 1LESA 1Q8VA 2GDFA 3B3QE 1N3QA 2ZGTA 5IK5A 2ERFA 4PBOA 4DPNA 1GZCA 2D6PA 1LOFC 3ILFA 1DZQA 3N7KA 1IS6A 1HLCA 4Y1VA 4BQ1A 2OW4A 3O0VA 4FQ4A 2D6KA 4YM0A 4JRAA 5E88A 1N1SA 3AZXA 4YG6A 4FPFA 1UN1A 4GWNA 1GV9A 2ZGQA 3M3QA 3TAYA 3IMNA 2TEPA 4XHXA 1KDKA 1A78A 1S0GA 2GN7A 1GNHA 2P34A 2WKKA 5KXCA 2DV9A 4GWMA 1MS3A 1YRZA 4GALA 4M01A 3RSJA 4K20A 1IS4A 2AUYA 2VY0A 2EXKA 3FLRA 4YW4A 1HQWA 2XG3A 2ES3A 5GALA 5EYXA 1V6JA 1QOOA 4I30A 1SCRA 3N7LA 1F9KA 4LBNA 2VH9A 3OYWA 1VAVA 2B7YA 2BQPA 3ILNA 4XJAA 1HDKA 3OBRA 4Q1PA 3WCSA 1V6NA 2VW1A 2ZGUA 1G9BA 1WLDA 2D6MA 2JJ6A 1G8WA 4UW5A 5CAZA 2AREA 1N3OA 4AWDA 4FOWA 1UAIA 2JKBA 2W39A 4NO4A 4AVTA 3POSA 2DUPA 1J1TA 2H0BA 4FOQA 5JMCA 1MS4A 4WVWA 2JECA 3T2TA 3AX4A 2A3WA 4FPEA 4C1XA 2VW2A 4TYSA 4DRVA 1MZ5A 3B01A 1SCSA 1D2SA 1G9DA 1AX2A 2YV8A 1PZ9A 3WLUA 3ZXKA 1UX6A 4P14A 1MR5A 4BM8A 3AXDA 1D0HA 2DVBA 1APNA 2DU0A 4M3CE 5E89A 4CTEA 1DQ1A 1JBCA 2PHWA 1QNWA 5HCBA 1BZWA 5IK4A 5IT6A 1W6NA 4SLIA 3RS6A 5GLTA 1N47A 3ZVXA 1BQPA 3Q9OA 1GANA 4DFSA 1AVBA 1VAMA 2DVGA 3N3HA 5DXDA 4K1ZA 1LCLA 4UW6A 4YGEA 2PHFA 3USUB 2CWSA 1JOJA 1KDMA 4P9XA 1WW4A 3FLPA 1AJKA 2DYCA 4FOYA 3WVJA 5L73A 4GKYA 5JOXA 5H9RA 3MPPG 4LBOA 4Q26A 5DG1A 2P3IA 4Q27A 5T52A 2Z42A 3AYEA 3LSDA 3OY8A 4FPKA 4Q2FA 3WDWA 4AGVA 1G7YA 1W6PB 2JE7A 1B09A 2GMMA 4XBQA 4BLJA 2ZMNA 2E53A 3AP9A 1MS5A 1DYPA 1LULA 1G9AA 4K1YA 3ZPYA 1GZWA 1W6OB 3WDVA 1H30A 4XXAA 3RMXA 4YFWA 3AK0A 5LK5A 4Q1RA 2E6VA 4XYXA 1WUVA 4TZDA 4YGDA 1Z78A 2LTNA 1GKBA 4OZXA 2UWAA 4GXLA 2NMOA 4HL0A 5JDBA 4ZXKA 1LENA 5T5LA 4YZ1A 5KXBA 4ATFA 1V6LA 2FMDA 4PF5A 1MVQA 2KM2A 4DQAA 3V0AB 1DQ0A 5JOWA 1IKPA 3C2UA 5GLVA 3HMYA 3O5SA 5DZFA 3MW4A 3V0BB 3R4SA 1H9WA 2GALA 4YM1A 3KM5A 1AJOA 2ARBA 3WUDA 1G9CA 1EPWA 1LHUA 1N3PA 1SBEA 1Y7BA 2P3KA 3CNAA 3IPVA 2R1DA 4XJUA 5GJ6A 3SITA 3WG3A 5CA6A 1V6KA 5IUQA 2LALA 1ULFA 2DTWA 1FX5A 4XJ8A 2ZMKA 3PJQA 3R4UA 1BKZA 3WV6A 1AZDA 5DZGA 3WDUA 1ENRA 4KBBA 2A75A 3ASIA 1DQ6A 1CQ9A 4YG3A 4YZ5A 4Y1XA 4XHBA 4Y22B 3H0OA 3WG1A 1N1YA 2ZGLA 4FPYA 4AGRA 3VKNA 4XTMA 3DUIA 3MEPA 2YZ4A 1LOBA 3AYAA 3O0XA 1XQNA 2PELA 1MZ6A 1TEIA 3GALA 2D43A 3VKLA 2A6YA 2EXIA 3ZXFA 2C5DA 2ZBJA 3AZYA 3OJBA 4XDQA 2GNMA 1JHNA 1WBLA 2D7FA 4YW3A 1QKQA 3FBYA 1Q56A 2DVFA 4IQPA 5AVAA 1AXZA 2EXHA 1WCSA 1F5FA 3SISA 2A7AA 4GKXA 3ZSLA 2P3JA 4L8QA 1CPNA 2DWRA 1QMJA 1C1FA 2VUAA 2EF6A 4P9YA 1LGBA 1QF3A 5DUWA 2V5YA 1SBDA 1AX1A 3QLQA 3INAA 3WDTA 2JDZA 3M2MA 4K21A 4XBLA 4Y1ZA 1KITA 1GLHA 1DLLA 1LOEA 1FATA 1RIRA 2ZZJA 2PHUA 5IK8A 1IS3A 4RL7A 2A3XA 5BYNA 1SLCA 2ZHKA 4CRQA 2ZABA 4PQ9A 2C9AA 2OUHA 4YFZA 1CR7A 3UL2A 3POWA 3AZWA 4D69A 1QOTA 1URXA 3WG2A 2DU1A 3WNXA 1JN2P 3M3EA 4XOGA 2R0FA 1AXYA 4XE9A 5SV8A 1S0IA 1W6QB 5KXDA 4AGGA 4HANA 4FPHA 3AP4A 1SLBA 5EWSA 4DS0A 4R9BA 1DBNA 1CN1A 3LCPA 2SLIA 3UJQA 1CESA 1WW5A 2W68A 3O12A 2CWMA 2WQZC 2WSUA 2HYKA 5T55A 4Y24A 1MS0A 4Q8LA 4Y20B 3USUA 5KXEA 2GN3A 3NWKA 4P9WA 2A71A 4UW3A 2AR6A 1N1TA 1Q8PA 3W59A 4Y1YA 3VUOA 1AX0A 2P2KA 1FV2A 3AJZA 5CB7A 2ARXA 1Z0HA 4WZFA 3UJOA 2YXSA 1SBFA 1ENSA 1ZA4A 2NP0A 1O4YA 1O4ZA 4U36A 2ZAAA 1MS8A 2UWCA 2OUJA 3APBA 4PBPA 4XILA 4YG0A 3ZSMA 4M00A 4MYEA 1LGCA 5CNAA 4FPOB 4R9CA 1W6PA 3MW3A 4YM2A 2DTYA 2NM1A 3AYDA 4M3CB 1GNZA 1UKGA 2XB6C 3VV1A 1PZ7A 3FFZA 1W6OA 2DUOA 4AVSA 2JE9A 1LECA 4BPZA 3V64A 1QOSA 2W08A 5GLZA 1UMZA 4ISRA 3ZYRA 4ASMB 2R16A 5HCAA 2DUQA 1DYKA 3B9CA 2EIGA 4LBJA 4YZ3A 4YW5A 3QCWA 2JD4A 1N1VA 5H9QA 1A3KA 2CNAA 4BMBA 2A3YA 4YGBA 4R9DA 1WW6A 1OFSA 1QNYA 1S1AA 2A6VA 4XJ9A 3T1LA 1CIWA 3SLIA 3V0AA 3D5OA 3PVEA 5EXOA 3VKFC 1SFYA 2CL2A 3OBTA 1MS9A 1JW6A 4YGCA 3N7JA 3V0BA 3BODA 3IM0A 1BJQA 1LTEA 1CVNA 2ZGRA 2DURA 2D6OX 2ZGMA 1ENQA 1FNZA 3RG0A 1HKDA 1MACA 3W58A 3RMYA 2CY6A 1CPMA 1LOCA 1V6MA 1YIFA 4FOVA 4UW4A 3KQRA 2WSVA 2A6WA 4RA0A 1LODA 3WDXA 1OKQA 3A0NA 2NZ9A 3ZSKA 3B69A 2PHTA 1S0BA 1VALA 1LEMA 3VKMA 2ENRA 1QGLA 3ZSJA 1NXD1 3B00A 4JC1A 4Y22A 2R49A 1ULEA 4FP2A 1DQ2A 5JLVA 5IK7A 5T5PA 1W6MB 1S0CA 2DVDA 1UPSA 2YY1A 2I2SA 5T5OA 3AP7A 2GMPA 1Q8QA 2E7QA 2YMZA 2D3PA 1FNYA 3PVOA 4Q8KA 2EALA 1S0EA 2D3RA 3BTAA 3ILRA 3PMEA 2ZGSA 5GZDA 5DUUA 1UZZA 3NV4A 4BOWA 4W65A 1WLCA 1LU2A 1LHNA 2A70A 3JUUA 4LBQD 3OGGA 2NYYA 1WD4A 3VKOA 1C4RA 1HQLA 1CJPA 2GNBA 3AZVA 2WJSA 2YROA 4LBQB 5H9PA 1RITA 4AYUA 3AP5A 3AFKA 2VU9A 3M3OA 2W52A 4XMAA 5FREA 2R0HA 3D4KA 4FPLA 1LOGA 1NLSA 1C57A 1LOAA 1LHVA 2ZA9A 1H9PA 4LBLA 1JYCA 2SBAA 4YW2A 4XBNA 4Y1UA 4FPCA 3BIWE 3I4IA 5GZCA 2D6LX 1RINA 3RQ0A 1ULGA 3ZXLA 1LHOA 1ONAA 4FVVA 4XJZA 1R1ZA 4H55A 1FV3A 1S0JA 2UU8A 3OPZA 1KQRA 3O0WA 1G9FA 2ZGNA 3IKWA 4FPJA 3SH4A 1W6QA 4ITCA 1QU0A 4FPGA 3PVNA 5T50A 3LSEA 1IKQA 1JXNA 1YYNA 4Y26A 5DG2A 4F83A 2AYHA 1QDOA 1SLLA 3GNEA 2PHRA 5E8AA 4ATEA 4XTPA 2G4IA 2P37A 2D6NA 4Y20A 2RHPA 1G86A 2NN8A 1CONA 1LU1A 3FUOA 1BYHA 1AXKA 1DQ5A 2DVAA 1IS5A 3ZYPA 3WCRA 2E51A 3IN9A 3TB0A 1IOAA 1OQ1A 4C1WA 3SH5A 1WD3A 2ZKNA 3N7MA 3OYWB 1S0FA 4AVVA 1WBFA 1VLNA 5GZFA 2EXJA 1YO8A 2D3SA 3HN1A 3WG4A 3R05A 2OVUA 5GM0A 4FQZA 2WNEA 5JOYA 1FAYA 2WT0A 4JCKA 3L2YA 3U4XA 2GNDA 5CBLA 3WDYA 4U2AA 3A4UA 1GBGA 4WV8A 1UZYA 1V00A 1VIWB 3V65A 3ENRA 3AP6A 5JOZA 4LBMA 4M3CA 1GZ9A 4CZSA 2FHRA 2UWBA 2VW0A 1KRIA 3AZZA 1F31A 4GA9A 3WHTA 1ULDA 3HR9A 1DFQA 3FUQA 2GNTA 2WT1A 1C1LA 1DGLA 3N36A 4FP3A 3ZXEA 4NOTA 1BXHA 2VXRA 1QDCA 1FYUA 2ZGOA 4XXPA 3DGTA 1UL9A 3NV3A 4LBKA 1I3HA 5GZGA 3NV1A 5H9SA 5HCFA 1LOFA 2E7TA 1YXWA 2GMEA 2V73A 1W6NB 1LEDA 5DUVA 5T54A 3POYA 3FLTA 4ISQA 5EYYA 5T5JA 1I1EA 1ZM1A 4R9AA 1LGNA 3M1HA 2ZHMA 4XMIA 4YZ4A 1DHKB 1WW7A 2AENA 3A0KA 3RRDA 3WHUA 4Z8BA 5GLWA 3SNMA 1MVEA 3T1MA 4YW1A 4XIKA 2EAKA 1V6OA 2Q5TA 5F9TA 1ULCA 1JYIA 5DZEA 3I8TA 2A5ZA 2ZACA 3M3CA 3SH3A 3AJYA 1KJRA 4XIOA 3OY8B 2PHXA 2ZHNA 4YM3A 1A8DA 1WLWA 4YZ2A 1AF9A 1JUIA 2ZHLA 1KJLA 4BMEA 1SLTA 1W6MA 1W0PA 2ZGKA 3N35A 1DQ4A 2A6ZA 3WOGA 1SACA 3UK9A 2WT2A 2UURA 4XJWA 1GZWB 3NV2A 4BLIA 5GLUA 1LJ7A 1SLIA 5DUXA 1W0OA 1SLAA 2ZGPA 4M3CF 1PZ8A 1S0DA 1YI7A 1LHWA 2D44A
chains in the Genus database with same CATH superfamily
4DRRA 3J9SA 4RR3A 4YVSA 2DBIA 4BE3A 2XJTA 4GAZA 2H6CA 2R1BA 5LBCA 3U10A 2ADDA 1OQEA 2J42A 4OHWA 2I45A 3BOPA 2QQOA 1MS1A 2CTVA 4GH4C 4Q4Y1 1K5MB 2V5DA 1ZA7A 4ARXA 4ZKTB 4EN6B 1CAUB 5K0UC 4Q4Y2 3I97A 2YBPA 4OQ9A 3VN4A 1D7PM 3WZ1A 1X50A 3ZYHA 3ATGA 1GR3A 2AC1A 3DF0A 3IPVB 1QXJA 1UU6A 1LESA 1Q8VA 1REDA 2B5HA 4BQ4A 4PHZA 5FYHA 4LO6B 4PBOA 4DPNA 1EAH2 2D6PA 3ILFA 2F6BA 4XF3A 3WW4A 4JGYA 3TEZA 3ZDSA 4BQ1A 2VJXA 3K46A 3O0VA 5FBJA 4D3WA 1YNAA 4N43B 4AI2A 5C71A 4XFFA 4GMP0 4CP2A 2BU9A 5A3OA 1I9RA 2FCUA 3AZXA 4QHZA 1HJFA 3B5LB 4LHSA 4RD7A 4YG6A 4N9HA 3TAYA 4BQ5A 3RZLA 5FP7A 4I0BA 5A3TA 3OGRA 1XJAA 2ZEZA 4MXWA 4LKSA 2TBVA 4CDUA 2WWUA 2GN7A 5FMCA 5FCCA 1MS3A 3ZIWA 1IS4A 3EB7A 2QFEA 3HNBM 4CDUB 1ND3A 1HQNA 1VBB3 2HBUA 2XGXA 2WBKA 3FLRA 4CU7A 1E5SA 5EFUA 2Y0IA 4AHZA 5ISLA 1UXZA 4TN7A 4XFIA 5FLJA 5FMOL 1ZRCA 3WEZA 2VH9A 4V2VA 2B7YA 4D0QA 2TUNA 2WN2A 3ILNA 1O8SA 3OBRA 4Q1PA 3WCSA 4CDXB 5LA0A 2VW1A 4MADA 1R64A 1AYN3 3LGRA 1B35A 1WLDA 2JJ6A 2TNFA 4NVPA 4PT6A 2WFF3 4A2UA 4AL9A 4CCMA 5AC91 1VBD3 4AWDA 2OQ7A 4F7ZA 1SDDB 1UAIA 5AC92 3C8XA 2JKBA 1WCKA 5A7SA 3I2OA 3E6CC 1W05A 1TME3 2H0BA 4FOQA 5JMCA 4HBNA 1MS4A 1X8EA 2QDNA 4IE0A 2XWJB 1WZXA 3T2TA 1H8TB 2C4XA 2A3WA 2WUHA 4Z92B 5DAPA 4UBGA 5K9YA 1NUKA 2ET1A 3IDCB 3OCPA 1MZ5A 1ULPA 2GH8A 1SCSA 1R1A3 3B01A 3NNLA 3TOJA 1ZYBA 1O59A 2VVDA 3DKQA 3OGSA 3ZXKA 4NUBA 4B1MA 3MIGA 1JI6A 1L7QA 3B9IA 1EYBA 4BM8A 1D0HA 2DVBA 1APNA 2QDRA 3DXTA 2DU0A 4M3CE 4XUNA 1POQA 5EHDA 5FZ7A 3L9JT 1W6NA 4SLIA 4FXGB 5GLTA 4ZU5A 4HK8A 3ZVXA 4D6RA 2G19A 4MXVA 5FUNA 2YYOA 3N3HA 5A1LA 3MICA 2VGDA 2ZJCA 4K1ZA 2VR4A 3C7HA 3LIHA 1RUJ3 5FXXA 3USUB 2JX9A 1UOGA 3TN93 1QH7A 4NIIA 2CV6A 3HN3A 2PHDA 4MGIE 4NROA 4QQHA 3MPPG 4DEVA 4Q26A 4B4PA 2WNUC 3VGIA 1WLTA 1PIV3 3POFA 4UFIA 2P3IA 4PLNA 1QJZA 4Q27A 3I3EA 2W0XA 4QT6A 3FL7A 4UFMA 3WDWA 5J96B 4AGVA 1W6PB 4BLJA 2YFZA 3M7AA 4QQ2A 4KI5M 1LULA 2XMLA 4AQ6A 1G9AA 2AEYA 2VQ0A 5FZDA 3ZPYA 5A1AA 4C0HA 4XUTA 4RGKA 1WMDA 3KT7A 3D8CA 4HK9A 1US2A 3AK0A 4O9EA 4Q1RA 5LK5A 4ARYA 3NQHA 2PQQA 2E6VA 1HXS3 2PA7A 1W0NA 1D4M1 4OZXA 5F3GA 1HW5A 2UWAA 2NMOA 1O91A 3E5XA 4GXLA 1BVVA 2VUJA 1D4M2 2X5IA 1WKYA 4ATFA 4AQSA 1AR71 2KM2A 3AC0A 3UT0A 3ZX7A 1AR72 3B93A 4YW6A 3VBHB 5L7OA 3M70A 3O5SA 5KHKA 1YJKA 3U37A 1RB8G 3MW4A 1X7NA 3M3IA 5FPLA 1C8M3 3KV5A 4RQPC 5FZGA 4LO5B 3KWVA 5A33A 2JDKA 1IGOA 4NWWA 1G9CA 1LHUA 4GWJA 1KD7A 3WG3A 2HWF1 5FXWA 2Y26A 4EZ4A 3PVBB 1FOD3 2RMU3 1ZZ6A 4IE6A 2HWF2 2YB7A 5IUQA 5C8WA 1ULFA 1GMMA 3F95A 2QQMA 4OLLA 1BKZA 3WV6A 3VLBB 3WQ0A 3L2HA 5BNOC 5CFCA 4KBBA 1PGW1 2A75A 3ASIA 5FZKA 3VBUA 4YZ5A 3B7MA 3I2IA 1PGW2 3VBSA 2DBNA 1GQPA 5F5IA 2JB8A 3MF9A 5LY2A 5CADA 4AGRA 3LOIA 1UMHA 1VBA3 4MHRA 3O0XA 4AHXA 2PELA 4D7SA 4CU9A 3ME2A 3J7LA 2IVIB 3KCYA 2RDRA 3QBQA 4WM8C 4AXOA 5C70A 4X6RB 2ZBJA 3POJA 4UFKA 2VL4A 1QJFA 2GNMA 2RJLA 3TEYA 1CAXA 3H7JA 4YW3A 1RUG3 2Z4FA 3FBYA 1QJY3 3I49A 1CZTA 4AFDA 2DVFA 2BVBA 2E32A 2JDHA 4OI1A 3WW1A 1WCSA 4E2GA 2OA2A 4QPGB 2ETEA 4KWKA 2NQYA 1C1FA 2WS93 2PTMA 2VUAA 4L11A 4P9YA 4D6SA 2VNVA 4WM7A 4QX2A 1SBDA 1J84A 3C7FA 4OUSA 3WDTA 4K21A 3S5AA 2VCBA 5BNPC 1IG3A 4Y1ZA 1L3JA 5FY8A 4COVA 4IETA 3KQ4B 1RIRA 1TG7A 5FLHA 1WMFA 2MPFA 1SLCA 2ZHKA 2ZABA 1OVSA 4PQ9A 1W9TA 4BXSV 1DGWA 1CR7A 2O0OA 1RTVA 3K77A 1OF4A 1Q43A 1ASJ3 3LFMA 3CQOA 3OBAA 1PVC1 3UL2A 3WP4A 1K5MC 3EYPA 4ZS2A 4DXTA 1PVC2 4XE9A 4IV1A 5IWFA 4AR2A 2XLAA 4J6GA 3RI8A 1AYN1 1SLBA 5A80A 2WFF1 1DBNA 3AMHA 5LEKA 1VBD1 4FXKB 1AYN2 4SBVA 2MEV1 4CSWA 2WFF2 1CAVB 1VBD2 3WNMA 1UIJA 4MGKE 1TME1 2MEV2 2QQKA 1MS0A 2VMGA 2VTXA 1TME2 2VOTA 1OOPB 5A7OA 5KXEA 5CEHA 2XJUA 5DAXA 2JDMA 4Q0UA 4N43C 1R1A1 1PX4A 4IW3A 4BU2A 3CMGA 3ZYFA 1R1A2 4L0PA 1XNKA 4KGQA 4EWDA 5KC5A 2ARXA 3BOWA 2BYVE 2ZX1A 2ET7A 2NP0A 4QAWA 1KFXL 4U36A 4XQWA 1MS8A 1YI9A 2OUJA 3SCGA 1XU1A 4M00A 1W99A 3MW3A 1JYNA 5LASA 2DTYA 2K2SA 4AI8A 2NM1A 3AYDA 3VBFB 2IC1A 5FV3A 2K46A 1RUJ1 1UMIA 3H1MA 4AVSA 1W6OA 2WZPP 3ABZA 4LXLA 1RUJ2 1QOSA 5FKCA 1XE7A 3TN91 5IVVA 3GF6A 3ZYRA 2Y64A 4XETA 5DAVA 4CDXC 3MFCA 3DL3A 4AHWA 3TN92 4LBJA 2EIGA 4GMP3 3E5UA 4QPIB 2C26A 3GYDA 2AACA 4LHNA 1PIV1 3EMRA 3GZTB 2A3YA 4YGBA 2BP6A 3VDDB 4CVUA 1WW6A 2A6VA 1QJX2 5BNQA 1POV0 5F3CA 4TXWA 5EXOA 1H8TC 2J1EA 3LA7A 1K3IA 2ARAA 3OBTA 3FJSA 3I59B 4K8FA 4V1PA 5AFEA 3V0BA 5HCHA 2FDKA 1BJQA 4YVWB 2CDOA 1JOBA 2DURA 2ZGMA 1ENQA 3J7NA 3K4AA 1HKDA 4HVRA 4OI2A 5FWJA 1UKRA 2MNGA 4IESA 4S2DA 1W90A 5FQ0A 2WO3A 1HXS1 4FOVA 4XCBA 1UO9A 4CU6A 2A6WA 2HBTA 4XUOA 3WXPA 1UD1A 2W47A 4QDSA 3WNNA 1HXS2 2NZ9A 3ZSKA 4M4PA 5FR3A 3ACIA 3B69A 1W8OA 4META 1LAJA 1LEMA 2B45X 2I74A 5M0TA 1V9U3 2C0ZA 3NAPB 4AFBA 2WZR3 4JC1A 1J83A 4HG6B 4QX1A 3DN7A 5F1RA 1DQ2A 1W9WA 2BFUS 3VD9A 2VZVA 1PNGA 3DXUA 5HV4A 4W6WA 2B8MA 1UPSA 2B9UA 3IWZA 3AP7A 5CKMA 2GMPA 4BK5A 3ZPOA 2YMZA 4HVOA 2ZEYA 3FHQA 2Y0OA 3I2FA 3PVOA 2EALA 1S0EA 4NPLA 4XPVA 1FOD1 2RMU1 3PIGA 1JZ4A 3BTAA 3ILRA 3ZFEA 2ZGSA 4MSVA 1UY3A 4HONA 1FOD2 2RMU2 4NPMA 4RS5A 4BOWA 1HRV3 3PURA 1LU2A 1LHNA 4AFAA 2NYYA 4A6OA 1NA1B 1Z7S3 4GZ9A 4HSLA 3RZKA 4Y5Z0 3VDCA 2GNBA 2WJSA 1XE8A 3AP5A 3AFKA 3ES4A 3H7YA 3M3OA 5FZLA 2W52A 2QQUA 3D4KA 4CXXA 1LOGA 1JMUB 3RI9A 3NJZA 1LHVA 2SBAA 4I2OA 3ZDVA 1XSQA 4JTOA 4XBNA 1PGL1 2QBXA 4E27A 4LA2A 1PGL2 1C8NA 1ULGA 3CDZB 2CAUA 4CCLA 4EV0A 1RUG1 4OHVA 2WA4A 3RJRA 5EIYB 1RXFA 1QJY1 1SPPB 4XUQA 4IV3B 3VBHC 1RUG2 2WYFA 1QJY2 3V56A 5FPBA 2QQJA 4FI9A 1PK6B 2VQUA 3PVNA 5T50A 3LSEA 1I5ZA 1UQXA 1ND2A 5HBAA 5LA1A 4N9IA 1NCRA 3BPZA 1YYNA 2XOMA 1VPHA 4IGOA 3GNEA 1EPZA 2FMYA 2FDHA 1C28A 4TSVA 2G4IA 4XTPA 5F2WA 2JDUA 4Y20A 3P3PA 1OKOA 5J09A 5FYYA 5A1FA 4IUGA 3PUQA 2DVAA 1RXGA 4KG8A 3T4VA 1ASJ1 3IN9A 4DMIA 2Y6JA 2BWAA 2XUMA 1ASJ2 1WD3A 2ZKNA 1COV3 3N7MA 2Y6GA 3OYWB 4K40A 5C4WA 1RVF3 4H14A 2EXJA 3HN1A 5EPAA 4CCEA 1ACCA 5GM0A 1X33A 1NLQA 4QGNA 4FQZA 2CGNA 1SEFA 1KXGA 5JOYA 1QXPA 3L2YA 3U4XA 3BUCA 1W2UA 5FIXA 5CBLA 5FPVA 4U2AA 3A4UA 5L36A 3UKTA 5E16A 2ORXA 2W5FA 1YUDA 3OPTA 5LA9A 3ETQA 3KMHA 1QH6A 1JTZX 5K0UA 5JR2A 3VBOB 1H2MA 3WF4A 1CWPA 2VXJA 2BNMA 4A41A 3KHCA 2UY8A 4QPGC 3GXUA 4AE2A 1JH5A 3VHPA 3JB8A 5L9VA 4NOTA 5CG9A 4GH4B 3U4SA 1WA4A 4COZA 2JIJA 2BFUL 3BTXA 2BGPA 1YXWA 2GMEA 3LE0A 5IFTA 1L7RA 1QXRA 1UY2A 2PHLA 2W95A 2OIIA 4LULA 1LGNA 4XW3A 4YZ4A 1DHKB 1D2QA 2ORZA 1WW7A 2AENA 4XF9A 1VR3A 3GCXA 3RRDA 2OPWA 1MVEA 4GMP1 3GBWA 5F9TA 2VBBA 3I3MA 2VMDA 4OCTA 5C3SA 5DZEA 5FO8B 3FBMA 2A5ZA 2ZACA 1UYXA 3SH3A 2XVKA 3A7QA 5LY1A 4KMQA 3AL6A 2D40A 4QKFA 3JD73 3RWKX 3UKVA 4YM3A 1A8DA 1AF9A 1OOPC 1XRUA 4HFSA 2RV9A 1HV1A 4FBFA 2YBKA 2Q8EA 5HI0A 5FJHA 5FYCA 1SLTA 3N35A 2A6ZA 2JDYA 3UK9A 4COUA 3HNYM 3NV2A 4BLIA 2GC3A 3PTRB 5F3EA 1ZBE1 5GLUA 1H8VA 2XWBB 3WF2A 3MZHA 1GU3A 4COYA 5IHRA 2GC2A 3FMGA 2ZGPA 4O61A 4OMDA 1PZ8A 1ZBE2 4QX0A 2JDAA 3O1PA 5CAZA 3QOPA 3FWEA 5FRAA 3MW2A 4CPBA 3JU9A 3I3QA 3N9LA 4YLZA 1GSLA 4QU1A 3AXEA 5GZEA 1U0AA 1V9U1 4PCRA 5F5QA 5JVVA 4IEZA 3VBFC 2AEZA 4ZHNA 2WZR1 2V72A 4I3PA 1CAWB 1V9U2 3LOBA 4A42A 1Y4WA 1GYKA 5FZOB 4ASLA 4WVVA 3POIA 1Y9QA 4DXRA 2WN3A 5LBEA 2WC2A 2WAOA 3WF0A 2NMNA 4XZPA 4QPIC 2VNGA 3FZ3A 3B3QE 2ZGTA 5IK5A 1K5JA 1EUUA 3OB8A 3VDDC 1EV13 1HRV1 1OXCA 2R073 3BYWA 4EN8B 1HLCA 4Y1VA 4LHLA 4UF0A 2WZ8A 1Z7S1 4FQ4A 4P5YA 3SC7X 5JCTA 4IEOA 1O4TA 1Z7S2 4YVWC 4YARA 3TNPB 3LDBA 3MLLA 1UN1A 1ZZ9A 3C7OA 1WCDJ 3BB6A 4CUAA 3E6BA 1VJ2A 5E6HA 1AL23 5A3UA 3LF7A 3EHKA 1A78A 2WNUA 4KQ7A 3IBMA 1GNHA 4LNVA 4NRPA 3ZN6A 1OMIA 4NRQA 5KXCA 3RSJA 5EZWA 4GALA 1K42A 4Y4YA 5B4NA 3T3YA 1OURA 4K20A 5BPXA 3MO4A 1NOVA 4QGLA 5BXXA 3NAPC 4YW4A 4WVZA 1V6JA 4I30A 1UX7A 1QWRA 4JKMA 1KS4A 1POV3 2BQPA 3MV11 1HDKA 3NJYA 1TNRA 2IXKA 3MLJA 1V6NA 2Q1ZB 3PLQA 4FFFA 2VZOA 2ZGUA 4H7MA 3KS7A 4W50A 2D6MA 4UW5A 1DU3D 1G8WA 3K4DA 4NHMA 3D3AA 2AREA 2C6SA 3OEAA 3TRSB 1GQGA 1JOPA 5IFPA 4S2GA 1CJDA 4CE8A 2W39A 4KL1A 5FDBA 1ZX5A 2DUPA 2D93A 5DAQA 1GWKA 2D5FA 5AVPA 4CUGA 1NG0A 2JECA 3AX4A 1JHJA 2P6HA 3ZN5A 4C1XA 2VW2A 1NA1C 2O14A 4RQPA 2EICA 4Z1VA 1D2SA 2RVAA 4LITA 2RR13 3WLUA 1COV1 3U07A 3BCWA 2XXZA 5FPAA 4NHLA 4ZS3A 2Q1FA 3AXDA 1COV2 1W8TA 4Z82A 5ANQA 3C3VA 3ZFGB 1DQ1A 1VRH1 2IXJA 1QNWA 2PHWA 4CTEA 5IT6A 1ZZ7A 5I0RA 3RS6A 5DQ0A 1VRH2 5BNOA 1BQPA 4BYYA 3Q9OA 5DXDA 4A6SA 2W1SA 1OA4A 3ETPA 5C3PA 5KHGA 5FY9A 1UZ0A 4E2QA 4IV3C 5B2GB 1PMJX 1ZZCA 5FMOS 4JZRA 1KDMA 1RUE3 2BZDA 4LE3A 5JR7B 1AJKA 4LHKA 2YGMA 1PK6C 2DCZA 3WY6A 4EN7B 3WVJA 5IAVA 2C1FA 2YBSA 3GZAA 5L73A 4WM8A 1RUD3 2QNKA 2H6BA 5JOXA 5LCWL 5H9RA 1UY0A 4LBOA 2VCMA 4IE4A 3T0DA 3OUJA 5A7QA 1A34A 4FPKA 4D6QA 3MI8A 4HN1A 4DINB 2JE7A 3AP9A 1OQDA 4Y3OA 1MS5A 2CSGA 5FUPA 3HOBA 4YSFA 2Q0AA 2XJVA 2QQLA 3LEIA 1G6NA 3WDVA 1VAKA 2HWB3 1ENXA 1TMF2 2WYSA 1H4GA 5J98B 1AUYA 4B8EA 1PMHX 1WUVA 5DPNA 2LTNA 2ZXQA 4AEKA 3SCHA 4ES9A 5JDBA 1YC61 2E26A 4ZXKA 5T5LA 5KXBA 3RZMA 3Q8EA 3U78A 1V6LA 2BGCA 4PF5A 2DDUA 1MVQA 2WA3A 1IQAA 1W9YA 3JD71 5FY7A 5LB6A 3T08A 4DQAA 5BNPB 3V0AB 4P00B 1IKPA 2VULA 3JD72 1K5MA 3VBOC 3LQCA 1CAUA 5IVBA 3VZMA 4YM1A 1Y9MA 3LDKA 1AR63 5C3RA 3WUDA 5L19A 4CA9A 1EPWA 4BISA 3PUAA 2R063 3CNAA 3IPVA 3H8RA 3SITA 1NY71 5CA6A 3UGFA 3FHAA 1V6KA 1HRI3 1YEWA 1NY72 2XLFA 3T4HB 1XSRA 1W2AX 2JG9B 3AMQA 3PJQA 3WP3A 4BIOA 1H1MA 3HQUA 2WNVB 2OZ6A 2ZX4A 2VNRA 1NXMA 2CHHA 1CQ9A 1DGWX 4N43A 4Y1XA 1TE1B 3NJVA 3H8UA 5FYTA 4DXSA 4HVQA 4PF1A 4Y22B 4QM8A 3BKZA 1UF2C 3I3DA 5F3IA 1ZVFA 2IFWA 3VKNA 3J8F3 4XTMA 3OG2A 5FXVA 3QH6A 4LKFA 5SV5A 4B4QA 1YFUA 2ZKLA 2W1QA 1EP0A 2A6YA 2PMWB 3OBZA 1VMFA 4X8PA 3BTZA 2ZAHA 2XJQA 5FZIA 3ZXFA 3LEKA 4XDQA 2D7FA 1UU4A 2R071 5A3PA 1SMVA 1QKQA 4AFCA 1XNTA 2R072 4JVAA 3NNGA 1W8WA 4I3GA 5C3OA 5F2SA 4L99A 2A7AA 1LR5A 4GKXA 4CDXA 2P3JA 2OKXA 1UIKA 1BVP1 2BUKA 3RYPA 1G9BA 2EF6A 1AL21 3CEWA 2V5YA 1IPJA 5KR7A 3QLQA 4C90A 3NKTA 2PLV3 3IDEA 1AL22 1KITA 3O1MA 1GLHA 4BIFA 1W2OA 2ZZJA 3JQXA 1UNBA 2BJSA 5BYNA 1H8TA 2C9AA 4YFZA 3KCCA 5F39A 5A3LA 3POWA 5A6XA 3O14A 1QOTA 2DU1A 3WNXA 2JDPA 3M3EA 5FYBA 1POV1 3RYRA 4BQWA 3OOXA 1KEXA 4IEXA 5SV8A 2ADEA 4JKLA 1K12A 1W6QB 1NAEA 4HANA 4INDA 5EWSA 3PL0A 2X53S 3ZFFB 2Y8KA 1Q5OA 1IPSA 2IVJA 4QQOA 4D8MA 1CESA 1WW5A 3BVCA 3LIGA 1BMV1 3B02A 2UYBA 2ZTNA 5HV0A 2WSUA 2HYKA 1RUOA 4Y24A 2XPJA 4P9JA 5T3NA 1O3QA 1D4VB 3USUA 4NE9A 4Y33A 2GN3A 2UY9A 4NN0A 4UAPA 2AR6A 4LIUA 1FMD1 4EJRA 3PU3A 3VUOA 3VZLA 2RR11 1FV2A 4QHOA 1RGSA 1FMD2 4LOTA 4QB1A 5CZKA 3P6BA 1JYWA 5FYMA 5CB7A 2RR12 3VD3A 2YXSA 1OUXA 2WNOA 4FAGA 2VZ1A 1ENSA 1O4YA 5FBZA 1O4ZA 4EWAA 2YU1A 3ZSMA 3APBA 3E6DA 4XILA 4Q0VA 5J48A 2RE9A 4FPOB 1SFNA 1JZ8A 1W6PA 3BI3A 1W2NA 4YM2A 2Y38A 2VNOA 4M3CB 1GNZA 1UKGA 4HZFA 3VV1A 1PZ7A 4MV2A 2DUOA 3V64A 1RUE1 2W08A 5ABJB 3LEGA 5GLZA 5A6ZA 1RUE2 4Q4V3 2YUEA 5F8PA 2L9LA 1RUD1 4YZ3A 1DG6A 3PMSA 3QCWA 2JD4A 3LPGA 3T30A 1U5XA 5KWRA 4BMBA 1HN1A 5FZMA 1OFSA 1S1AA 3T1LA 1CIWA 1GOHA 3SLIA 4AEJA 5FP9A 3D5OA 3VBHA 5FY1A 3VKFC 1SFYA 3S0MA 4XFHA 2CL2A 1MS9A 1JW6A 4YGCA 2EA7A 5FYSA 3IM0A 4LE4A 5FO7B 5C3QA 1O7FA 4E4SA 2D6OX 4ZY9A 1MACA 2HWB1 3MIFA 4JGZC 4UWDA 2BEOA 3HPNA 1LOCA 1V6MA 2HWB2 1W06A 4UW4A 4XAAA 3BALA 3ZFGC 2R6QA 1W28A 1LODA 3MGUA 5FPUA 2VPVA 4UI9L 5I8SA 2QUOA 5A70A 5C8CB 3R4DB 1T2XA 2Q8DA 1KGYA 2Z69A 1ULEA 4B7EA 3H42B 1NT0A 2H0VA 5FZEA 3WT3A 4DOUA 5T5PA 2VBPA 2XONA 3VZJA 2C9KA 2YY1A 1WCUA 1S2BA 2VOVA 5JAXA 3I2HA 4Q4W3 2VMEA 2FCVA 2D3PA 2VMHA 3H3UA 3KGLA 2D3RA 4XF1A 2IUWA 2PAMA 3VZKA 3TNQA 1OPMA 2PFWA 5DUUA 3OGJA 4W65A 1A6CA 1WLCA 2A70A 3NKGA 4JTNA 3VKOA 5BY5A 4QPGA 4AYUA 4LBQB 5H9PA 2EVXA 4FFHA 4AAXA 3OUHA 2VU9A 2GZWA 3D82A 1OPOA 2GC0A 1OC1A 2OX0A 3J8F1 3AB0A 2QTWB 2W92A 4BZ4A 4DO0A 4WBBA 5JMOA 2JENA 3J8F2 5FXZA 4YW7A 1F4AA 2WIIB 3I4IA 1REFA 2ATFA 5GZCA 2D6LX 1XYOA 1RINA 4DY5A 4Q0SA 4E8CA 3GBFA 4XJZA 5HXVA 3WP6A 4EN9B 1S0JA 2WAAA 3ACHA 5L9BA 3OTFA 1G9FA 3IKWA 1PO13 4XEZA 4XFAA 3J26N 5IW0A 1GQHA 1VBB1 4ITCA 1W9FA 4GWIA 1IKQA 3USSA 1F8VA 1VB4A 4W6XA 1VBB2 1JXNA 5I0SA 3W5NA 4F83A 3CJIC 2PLV1 1CAVA 3J7HA 2JKXA 5CFDC 4ATEA 4Q4X3 3W20A 5FK8A 3POGA 3K3OA 3ZN4A 2HWD3 1PMIA 2PLV2 2JG9C 1W3XA 2ZEXA 1PHMA 4B1LA 1VE0A 1PGSA 2RHPA 2VQTA 2XVGA 2WNVC 3K2OA 3QACA 4QKNA 1OOPA 3SKJE 5F5CA 4R4ZA 2ILMA 5IVJA 3KV9A 4NPRA 3ZXDA 3WNLA 2E51A 2KA3A 4L9BA 2FDIA 1IOAA 1OQ1A 4HMZA 5FMDA 4C1WA 4LJHA 2JICA 4E9KA 5FZ6A 3SH5A 1O8PA 4MGTA 4EN0A 2D3SA 2IFRA 5EQUA 3R05A 1UU5A 2OS2A 4LMFA 2XHKA 3MIBA 4RR3C 4WV8A 3AKRA 4JAAA 4BXFA 3V65A 2JWPA 3GZEA 1OVPA 3VBFA 5JOZA 1QIQA 2FHRA 2UWBA 2VW0A 4A7KA 1KRIA 4X6QB 4MOAA 3VHOA 1ULDA 1DFQA 3FUQA 2GNTA 4QB2A 1DGLA 4AZZA 4O9GA 5FP8A 4IEUA 3O1OA 1H6XA 2VXRA 3DCQA 5FOJB 2BGOA 4K7JA 1Y3TA 4QKDA 4XDPA 3S7EA 4EE2A 4QPIA 1UL9A 4FSJA 1TQ5A 5D21A 3VDDA 1ZRFA 2E7TA 5C5UA 5LZ6A 3DPRB 2BDRA 1LEDA 1L7LA 2FCTA 4AVBA 3FLTA 4L97A 4S2HA 1CGPA 1XYPA 3I59A 4YVWA 2E33A 1T6GC 2R32A 3IDAA 1PIV2 2ZHMA 1OSGA 1QHDA 1RL3A 1RMU3 2BOIA 3ZO0B 5GLWA 3EJKA 3URFA 4A7YA 4Z8BA 3GJAA 2EAKA 1V6OA 4QM9A 3ZFFC 4AAPA 4DUWA 1JZ5A 2DFCA 3OSDA 1YQCA 3TEWA 3RZGA 4M4RA 3RJ2X 2PAKA 5I8TA 2JG8B 1KJRA 4XIOA 2JB4A 3NAPA 3NRUA 1AHSA 4LKEA 3OY8B 1VBE3 4ASKA 1F2NA 1ZNPA 1WLWA 2JE8A 3HD8B 1JUIA 4NHXA 2LM3A 1KJLA 3Q8CA 3U0ZA 1W0PA 2ZGKA 2J1RA 3GBGA 4Q5OA 2WT2A 3MF6A 4W6YA 3ST7A 1GZWB 4F8AA 4ZONA 1V70A 4JQRA 4F3JA 1PO23 5IATA 1XPWA 1C8M1 5DUXA 3SCFA 1SLAA 2G9FA 3I2GA 1S0DA 1YI7A 3ON7A 4BJ0A 1C8M2 4P08A 4DNYA 3D6EA 4LQRA 1DYOA 1DIWA 3CKHA 2CYFA 2ZMLA 2J1TA 5A7WB 3RVHA 2IXIA 1NA1A 5LBBA 1I5PA 4OUMA 4CPBD 4HN0A 1Q8OA 3WF1A 2QJVA 2A6XA 2VZSA 4N90A 1U5YA 4HT1T 4CDQB 1RUF3 1WGPA 3ZOIA 5ABJC 3PJYA 1Q8SA 2PXJA 4LIVA 4Q4W1 4QDRA 1V6IA 1GICA 1IG0A 3U1XA 4Q4W2 3UYJA 4OHXA 4B29A 4CUBA 2GDFA 3WW2A 4K6BA 2VZTA 2ERFA 1VBA1 1LOFC 1SG3A 1DZQA 3LB9A 2QQPA 3KB5A 1GWMA 4CEWB 1SPPA 1VBA2 3RZZA 4IV3A 2OW4A 2D6KA 3N9OA 4YM0A 3DKWA 4N53B 4JRAA 3K51A 1PK6A 1N1SA 1HJGA 1XBFA 4FPFA 3VBRB 5C7GA 4GWNA 1CZVA 4GD4A 4TWTA 4OI4A 3ZR5A 1DZTA 3WQ7A 4XHXA 3RWNA 1XNCA 5C9AB 3D0SA 4JHTA 2Y34A 5E1RA 4DUXA 1YRZA 2RM23 1AYM3 1IPKA 2WS91 5A6YA 1RHI3 2WS92 2R30A 5IJRA 4CP1A 2VY0A 3N9NA 4E8DA 5C8CC 4K8RB 1ST8A 4HOOA 4AVCA 2ES3A 1UOJA 1QOOA 1PO11 1SCRA 4KNCA 1OLQA 3OYWA 1VAVA 5DAWA 4BH9A 2B46X 2QCSB 1PO12 3MDPA 4QX7A 1YFXA 1GP5A 1ULOA 4HLTA 3WINE 5AFBA 1N3OA 4FOWA 2VMCA 4Q4X1 5F6KA 2HWD1 4NO4A 3VDAA 1RC6A 4AVTA 3POSA 1MZFA 5BNNA 1W9SA 2MHFA 3CL1A 4Q4X2 5L7OC 2HWD2 4UFLA 1F35A 1UY4A 4D7TA 4FPEA 3VBOA 2P4EA 5JPNB 2VOKA 2D97A 2FZ2A 3EXUA 1G9DA 1AX2A 2YV8A 5KBFA 2Y60A 4IEPA 1UX6A 4GH4A 2KD7A 3AMPA 3JBG3 3MFAA 2VC9A 5FZCA 3T2QA 4XFGA 5E89A 3ZLIA 1JBCA 2WABA 5DN2A 3Q8FA 4GULA 1BZWA 5HCBA 4HPKB 3SHRA 5EJ1B 1BBT3 1GANA 4K3UA 2RDQA 1SDWA 2R043 5JIAA 4DXZA 1VAMA 2DVGA 3LDRA 1XB9A 5JI9A 3WNPA 4CP9B 1JZ3A 4QWNA 1VRBA 3OEBA 4UW6A 2PHFA 3U75A 1H0BA 2CWSA 3T09A 1JOJA 1OLRA 1HB2A 5K4LA 3DYMA 1GWLA 3FLPA 3W21A 5FY5A 5F37A 3UNPA 4J1WA 1QJU3 3S30A 5CISA 5FAXA 4GKYA 4WZCA 4AHYA 5HPOA 4QGMA 4PI2A 1NZIA 2R7EB 5DG1A 4QX8A 2W2IA 5T52A 2JIGA 5ERLA 3LSDA 1W03A 4Q2FA 4OHZA 3UESA 3KV4A 2EIDA 1B09A 2GMMA 1FPN3 1VB2A 2ZMNA 5A3WA 2HEVF 3DECA 3NNFA 3AMNA 3OUIA 4K1YA 2V09A 4M0HA 2FDJA 1H30A 1RMU1 3RMXA 4IEVA 1RMU2 4QX3A 3PUSA 4XYXA 4TZDA 2FD8A 4NHKA 4YGDA 1NCQB 1Z78A 4K9SA 3CHXA 4HL0A 3RFRA 3AKTA 5FZAA 3TWIA 4XFBA 3MIDA 1ZRRA 4HKLA 4Q0QA 5A7PA 3G6JB 3GGLA 1DQ0A 2P3YA 1GNYA 4P9GA 1DGRA 1CAWA 3C2UA 4AOCA 1ODMA 4E4DX 3HMYA 5FP3A 4IV1C 3P5BA 5FZOA 3KLSA 3TEXA 3ZSEA 3R4SA 4CP0A 1H9WA 2GALA 1UOFA 3KM5A 3WSOA 1AJOA 2ARBA 5A6QA 1Y7BA 2P3KA 1GP6A 1PO21 2R1DA 2Y33A 2YC0A 1XNDA 4XJUA 2WZR2 5GJ6A 1PO22 2LALA 4PI0A 5D8AB 4LLFA 1FX5A 3DPRC 2ZMKA 3R4UA 4XJ8A 2W94A 5DZGA 3WDUA 4AG4A 1ENRA 2UYAA 4UYBA 4BQYA 1YLLA 4C8DA 1WCQA 4NIDA 2ZX0A 2W3JA 1NZCA 2VTFA 3OGVA 2VTXJ 4XHBA 5LRRA 2XBO3 1RUF1 2E31A 3WG1A 1EAH3 2ZGLA 3PIJA 3AKQA 1HRV2 4FPYA 4QHBA 3ZXAC 1S4CA 1RUF2 3DUIA 3MEPA 5FWEA 5JI7A 1MZ6A 3AVSA 2YGLA 4QMAA 1TEIA 1RJ8A 3GALA 3WR0A 4IDZA 3VKLA 5JXHA 4WVMB 2EXIA 5JSRA 2DCJA 4DUVA 1CX1A 3I3BA 2VZ3A 1H4HA 2C5DA 3AZYA 1U5IA 4MHUA 4UFJA 3H3ZA 5ACA3 2JG8C 2FDGA 1MQTB 2BNNA 3DV8A 2VZUA 4QPWA 1IQDC 4JQTA 5IAXA 1AXZA 2EXHA 5FPXA 3BGAA 4KU7A 3SISA 4V2WA 3CU7A 4IXLA 1ZBA3 2CAVA 4L8QA 2DWRA 4CYDA 1QMJA 2OZJA 4AI0A 3ALQA 4Y5SA 3N9PA 1LGBA 5DUWA 3O1SA 2ID4A 3INAA 2JDZA 4QQPA 4CDWB 4KWJA 4XBLA 1UW8A 2RM21 1AYM1 1DLLA 1LOEA 3RNSA 4QXCA 3POBA 5IK8A 1IS3A 4RL7A 2A3XA 1AYM2 1RHI1 3BIEA 4CEYB 4RGGA 4Z07A 2QZ3A 4TLGA 5FZ4A 1RHI2 4DIQA 3SEPA 4R4XA 3AZWA 3KHBA 3WG2A 1JN2P 5A3NA 4MGYE 4CDQC 2R0FA 3J7MA 3WW3A 1S0IA 5DDJ3 4PLOA 3KF5A 4AGGA 4FPHA 3AP4A 3ZFGA 2LW8A 3A23A 4DS0A 5JZGB 1CN1A 1AL0G 3LCPA 1O3RA 3UJQA 1PVXA 4BWOA 1RVF1 4JGZB 3O12A 1CD3G 1YQ2A 3F2ZA 4QU2A 2WQZC 1UZWA 1HB4A 1M06G 5T55A 1RVF2 3JXSA 4Q8LA 3LFIA 1UWWA 3ZIXA 4CEWC 5JXIA 1J3RA 1CZSA 1AR83 3H1YA 2A71A 3NWKA 4IEYA 1N1TA 1Q8PA 4P9WA 4N53C 4UW3A 4Y1YA 5G05L 3ZYBA 1JU3A 2FBEA 1UXXX 3BN6A 2BBAA 3VBRC 3AJZA 5EP9A 3WNOA 3RDIA 3JBG1 3NMBA 3ZYJB 5FZ8A 5EV7A 1ZA4A 4MUVA 3UKNA 3JBG2 5FZ1A 5C9AC 2ZAAA 1W8UA 5C5TA 2CU5A 3X29B 4YG0A 4A45A 1LGCA 1BBT1 3CZUA 3UV9A 4AQ2A 4R9CA 4CUCA 1BBT2 5FUIA 4OULA 3FC0A 3HVDA 4R8HA 2Q8CA 4BPZA 1LECA 5K7PA 5J7MA 1OF3A 5FZ0A 1UMZA 4ISRA 4BCUA 3RYKA 2R16A 5HCAA 5CIRA 3E5QA 4YW5A 2J1VA 2G9GA 2Q4SA 5H9QA 1NYWA 2CNAA 1O3SA 3ZM8A 2GAUA 3RGBA 1QNYA 5BNPA 4XJ9A 3W9AA 3V0AA 4P5HA 1J1LA 3PVEA 3ZYGA 1AR93 1FPN1 4IE7A 4AW7A 2VZPA 1W39A 4RYDA 4MGZE 4AEDB 5F7UA 1MEC3 4KBZA 3VB9A 1FPN2 1CVNA 4YPJA 2PAEA 1R083 2ZGRA 2WQ8A 2XH6A 2VOXA 3NNJA 3E1F1 3A22A 3RG0A 3CJIA 3AKSA 4P9IA 2CY6A 2KR2A 3LAGA 3I2DA 3AM2A 3KQRA 3IZOA 2JG9A 2HH9A 2VUCA 1OKQA 4RA0A 1UYPA 1VMJA 1PM4A 2WNVA 1HB1A 2Q1MA 2BVVA 2PHTA 1S0BA 3WF3A 3WX5A 1YQ5A 2VECA 3CJIB 1KS5A 2ENRA 5CFDB 1DGRN 2LUWA 5I91A 5A7NA 3BU7A 1NXD1 4Y22A 4TTGA 2R49A 4XDOA 3AL5A 4FP2A 2WFPA 4LO7A 3UGGA 1W6MB 1BK1A 3T2PA 5T5OA 4E4HA 2I2SA 4MGQA 3O1UA 1Q8QA 1ZZBA 2E7QA 1RYYA 3M8LA 4G4FA 2WQ4A 1TNFA 2HJIA 3LA3A 2IZWA 3ITQA 2GH2A 5GZDA 3H8OA 3K4ZA 3NV4A 1XYNA 2AZ5A 4RR3B 4YVSB 4LBQD 3JUUA 2X09A 2ZZQA 1OT5A 1CJPA 5JSPA 2I07B 3AZVA 4JDMA 2YROA 1EV11 3LZZA 4NRMA 1RITA 2XBO1 2YDEA 1YWKA 4XMAA 1EAH1 1EV12 2R0HA 5LWBA 2XBO2 4FPLA 3PUIA 4LBLA 1H9PA 4XQDA 1JYCA 4QXBA 2IXCA 4Y1UA 1NCQC 4X8NA 4FPCA 2VVFA 5LRSA 4XUPA 2XQRA 3I7DA 5FZFA 5ACA1 3OD4A 3KVBA 3VL9A 3ZXLA 1XOYA 2J1UA 1ONAA 1BEV3 4IEWA 4H55A 5ACA2 4JGYB 5B4XA 2XVLA 3O0WA 4NHYA 2ZGNA 1QQP3 3FX3A 3WP5A 5DMYA 4MX3A 2VM9A 1W6QA 1ZBA1 3C7EA 1QU0A 1HV0A 3LA2A 4FPGA 4LOSA 1F15A 5GKAC 3ZFFA 2PYTA 1ZBA2 4GIQA 2C24A 4Y26A 5DG2A 1W2TA 3E97A 3ZXGA 4PIYA 4MXWB 1QDOA 1JODA 1YQ6A 4CCOA 1REEA 4H7LA 2WR9A 5E8AA 5D8AC 3S6PA 1BHGA 4EYUA 2Z5WA 1ODNA 1PVC3 2X10A 4QKBA 3KV6A 3IB3A 1G86A 2NN8A 1CONA 5CYYA 3U11A 3FUOA 1BYHA 5TSWA 1DQ5A 3VZNA 4C0BA 2IWGB 1ND3B 3WCRA 3T0AA 4OQ8A 3TB0A 1X36A 2VG9A 1BMV2 5CVRA 1RUI3 2MEV3 1S0FA 1DZRA 4XQ4A 1OD5A 1WBFA 5DDJ1 4AVVA 1X9PA 2ZOEB 2VD7A 4O7XA 2OVUA 4QPYA 3R6SA 5DDJ2 1B35B 2VMIA 2WNEA 4JCKA 2WT0A 1NE4A 3H3LA 1O3TA 4M0NA 3WDYA 1BLZA 3CZJA 3HQXA 2A1XA 1BCXA 3QD6A 2Y6FA 1JYVA 3ENRA 1MQTC 3AP6A 4M3CA 3TYJA 1GZ9A 4I09A 4ZU7A 1AR81 4DZGA 3IAQA 3JCIA 4GA9A 5LBFA 5ABJA 1GZTA 4FP3A 2WT1A 1AR82 1C1LA 3N36A 5JPMB 3HJRA 4CXWA 1YHFA 2O8OA 1QDCA 1FYUA 2ZGOA 3JB4C 2VCCA 2Z2SB 3I2JA 4KGGA 1IHMA 3NV3A 1X82A 3O1RA 1YJLA 3KVAA 3NV1A 4CDWC 5HCFA 3VL8A 1LOFA 2JEMA 1HIXA 1W6NB 2V73A 3NJXA 5T54A 3POYA 3FE5A 1SHWB 4CEYC 3NNMA 1OUSA 5EYYA 4NR1A 1RUD2 1YFYA 5ANNA 5FLIA 4HXCA 4AQTA 2RDNA 5T5JA 2CGPA 1J58A 1DDLA 4RN5A 1O5LA 1WMEA 2NPIA 3H9AA 1XNBA 3M1HA 1FI2A 4J25A 4XMIA 3ZKYA 4B4RA 4MG2A 2E7AA 2DFBA 2Y6HA 1QJX3 3PU8A 2O1QA 3LWCA 5FTTC 2ZEWA 3WD5A 3WHUA 2F4PA 1JYTA 3SNMA 3T1MA 4IERA 2WINB 2XJRA 4YW1A 4LEJA 4QD2A 5JZGC 2BW8A 2Q5TA 1VBC3 4FCAA 4BDVB 1FXZA 1JYIA 1OHFA 3AJYA 2ZX3A 5C8CA 1ZRIA 1PX3A 4LK7A 2ZHNA 1SFPA 4N8MA 4YZ2A 1AR91 2EAAA 4FTEA 2BTVC 2D5HA 2VAUA 4BMEA 3HIFA 4UT5A 1MEC1 1AR92 4Z2WA 1DQ4A 4IE5A 1SACA 1R081 2J1AA 1MEC2 4BQXA 1CX4A 2UURA 4KWUA 3FFQA 4DB5A 1R082 4AF9A 4HETA 1LJ7A 1SLIA 3HT1A 1W0OA 1QEXA 4XFCA 4M3CF 4AFMA 4BK4A 1AR61 2D44A 1NQJA 3POEA 1E5HA 2XLGA 2R061 1AR62 2AH2A 2XR4A 1DCSA 3ES1A 5FK7A 2VQAA 2BV4A 2CGOA 2X5IB 2R062 1HRI1 2XKOA 1V0AA 1H2NA 2WLQA 4LUMA 4LBQA 4D7YA 5BV6A 1HRI2 3WUCA 4QXKA 5L7OB 3AYCA 4ZZ8A 3ZXJA 5A33B 5I93A 5FZBA 5BNNC 4QXHA 4OFGA 2AGSA 2XJSA 2OXBA 4R52A 4E4ZA 2BRTA 1N3QA 2B42B 3MIEA 4NIGA 4Q0PA 1GZCA 3PUHA 3ZMNA 4PLMA 3N7KA 4GB33 1IS6A 2W9XA 4AI1A 1S2EA 2Q8OA 1JZ6A 5CFCB 3HQRA 4CCCA 4XACA 4BA6A 3VBUB 4AEDC 3UGHA 1F5JA 1OD3A 4KU8A 5E88A 2F4LA 3VBSB 1GV9A 2ZGQA 3M3QA 3NW4A 3CIHA 2TEPA 3IMNA 4ORFA 4W8JA 1KDKA 3IT8A 3VD7A 1S0GA 3MYXA 5FY0A 2P34A 4A44A 2WKKA 5FZ9A 2DV9A 3HNMA 4GWMA 1OI6A 2XHNA 2E9QA 4KWLA 4M01A 4XAEA 1W3VA 2AUYA 3THDA 3G7DA 2EXKA 1BEV1 1CAXB 1H1IA 3MUZ1 3ACFA 1HQWA 2XG3A 3B94A 4URTA 1YCIA 5GALA 1BEV2 4LBNA 5EYXA 1DP0A 1QQP1 1F9KA 2RG4A 2XDVA 3FN9A 3N7LA 4HKWA 5FZ3A 4BQ2A 4XJAA 5HXMA 4QDQA 1QQP2 5KHJA 1H6YA 1KFUL 2A73B 2RS13 2XKPA 3T2OA 2WLPA 4LO8A 5J1XA 4WM7B 1IZ3A 2LRPA 3BU0A 3UETA 5A32A 1J1TA 5F6LB 2RS53 1EUTA 1M4WA 1K45A 1A8MA 3IIAA 4WVWA 4YVSC 4CU8A 3ACGA 4XZUG 2J22A 5I0UA 3S5QA 4RGAA 2LS6A 4TYSA 4DRVA 4PDWB 3THPA 5A32B 1F4HA 1PZ9A 1RUI1 4COWA 1OA2A 4P14A 1RUC3 4L2NA 4IV1B 1RUI2 1MR5A 5J3UA 3J4UH 5IK4A 3DPRA 4PQQA 1N47A 5FMBA 2NLRA 1US3A 3VDBA 3MIHA 3MHZA 4LTAA 4DFSA 1AVBA 1BK0A 4IL7A 5EJ3A 1GFF2 1LCLA 4YGEA 2Z79A 4JGYC 4W4ZA 4A4AA 2HYXA 2VCAA 4P9XA 1WW4A 3OF1A 4JHZA 1OFNA 2DYCA 4FOYA 4I0WB 5L9RA 2HWE3 3AFGA 3A21A 3CJXA 3GM8A 2WDBA 4EQVA 5JUVA 4CDUC 5FYUA 4RFT0 3PDQA 3WQBA 2JG8A 3PTYA 4FFGA 4Q4V1 2Z42A 4LLOA 3AYEA 2OPKA 3OY8A 3LEMA 3OPWA 5CU1A 1H2KA 1XNAA 4Q4V2 1G7YA 4XBQA 1QY4A 2F17A 3S57A 4XF4A 1OBNA 2E53A 4C91A 1ND3C 1DYPA 2ZS6B 5JWPA 2QQWA 1GZWA 1W6OB 3KSCA 5LK7B 4XXAA 1QJX1 2YG0A 2QE3A 2HWC3 4YFWA 2JDNA 4ES8A 4G9SB 1TZOA 3H50A 4NJ4A 2QZ2A 3HBKA 1B35C 1VBC1 3I2KA 5DABA 4CCNA 5I0TA 1GKBA 4MLOA 4UXAA 3MUY1 1JU4A 1VBC2 1LENA 1U5ZA 4ONUA 5A7WA 4YZ1A 2FMDA 4IEQA 4NAMA 4XF0A 5JOWA 5GLVA 5LA2A 2FZ1A 5DZFA 1ZBE3 2YU2A 4CDQA 4CXYA 1GOGA 4TLFA 3V0BB 4BB3A 1N3PA 3DYOA 1SBEA 3AMMA 4N7IA 1JS9A 4ZZ5A 5FQ0B 2Y6KA 2J7MA 5J37A 2DTWA 1E5IA 3T0BA 4CEWA 1AZDA 2VZQA 4JV4A 3QH7A 1YFWA 1O5UA 4Z2AA 5FPZA 1DQ6A 4N53A 4PIXA 1PM7A 4YG3A 3I54A 2HEWF 2N7GA 3VBRA 2RS33 4QQLA 1H2LA 4URAA 3H0OA 1N1YA 5LW9A 4GJYA 5K8SA 4BQ3A 5C6CA 2YZ4A 1LOBA 3AYAA 1TVGA 1MZEA 3IDBB 4LUKA 1XQNA 1ALYA 4RHV3 5C9AA 2WRAA 5CKQA 2D43A 1JYXA 2ARCA 3U14A 2QKDA 3DYPA 1X9TA 3OJBA 3ZFEB 5BNNB 1NX9A 3K3NA 1JHNA 1WBLA 4GB31 4OVEA 4OZOA 4RS5B 3BTYA 3RZJA 1Y9GA 1RUNA 1D0GA 4MO3M 4GB32 1Q56A 4IQPA 4XCAA 5AVAA 2WZEA 1XE0A 2VOWA 1F5FA 4OUEA 3KF3A 1JUHA 2XJPA 3VD5A 2YPJA 4KH9A 5FJKA 3NSTA 3OD0A 3ZSLA 5JIUA 1CPNA 3KGZA 5FP4A 3LKJA 1QF3A 2G9ZA 5FKBA 3IIIA 1OA3A 1AX1A 5FZHA 2XL9A 5FYZA 3M2MA 4Y4RA 3ZYIB 1NKGA 2P1BA 2JXAA 1UCXA 2RJKA 3BPSA 1FATA 1NQDA 1T6BX 2PHUA 2E63A 4GQ7A 3ROUA 4CRQA 2W91A 2X5IC 2OUHA 1ZRDA 1DF0A 1GP4A 2B9VA 3CO2A 4H3WA 4D69A 1URXA 4XOGA 1AXYA 1R093 4YYOA 3GDBA 5JSOA 5KXDA 2RS11 2V4VA 3KD4A 2IXLA 4JX0A 1ND2B 2IXHA 2QQVA 4R9BA 2EIBA 2WL1A 4S2FA 2RS12 1NCRB 2YC4A 4HPKA 3MBWA 2SLIA 1QJEA 2W68A 4FAHA 5JXJA 1RUH3 2CWMA 2BWCA 2BPA2 2GSYA 5C33A 2RS51 3SMHA 4Y20B 3MLKA 4CP9A 3PHMA 4EZHA 2RS52 5CFCC 3R0RA 3W59A 3VBUC 1AX0A 2GP5A 2P2KA 2XUEA 1VRH3 1XU2A 2P17A 4XC9A 3THCA 3VBSC 4XABA 5IK7A 5LEJA 1S55A 2W1UA 1OH4A 1RUC1 1Z0HA 3MV01 4WZFA 3UJOA 3H1WA 5BUVA 5C4WB 3JQWA 1SBFA 3P3NA 1SQ4A 1RUC2 2P6CA 4G3YC 3EQEA 2UWCA 4PBPA 1J59A 2FDFA 1RJ7A 4MYEA 5CNAA 4LT5A 4LKDA 5KC6A 1GOFA 4BHPA 4D94A 3K48A 4Y5TA 2XB6C 2W87A 5K0UB 3FFZA 3IAPA 3ZMOA 1XXNA 2JE9A 3CLPA 1S2KA 5CG8A 4ASMB 1MPXA 2HWE1 5JXGA 2DUQA 1W8ZA 1NLRA 2K9ZA 5FOBB 1DYKA 2PQSA 3B9CA 4NIHA 1NCQA 1SZBA 1UZVA 2HWE2 4WM7C 4ZPIA 1C5HA 2JD9A 4NWVA 1N1VA 1A3KA 4FFIA 1UYYA 2QQNA 3VHNA 4R9DA 2QVSB 3ECQA 3C7GA 4FO9A 3FHIB 1OLMA 4FTSA 1TMF3 3M4FA 2DF7A 4QX5A 3HT2A 3CBNA 1YQ8A 4NIAA 1U12A 2V4AA 4PDWC 3N7JA 3HEIA 1C3HA 3BODA 2B39A 4FT8A 1LTEA 1OLME 4N7UA 4ET7A 1VBE1 2B4KA 5KHHA 4PIZA 1FNZA 2G1MA 2HWC1 1VBE2 2GU9A 3W58A 3RMYA 1X8MA 1JZ2A 4LORA 3TBDA 1CPMA 2HWC2 1YIFA 1W8NA 2VBDA 5D8AA 3VHRA 2WSVA 4CCJA 1FT9A 3WDXA 3A0NA 3AVRA 2YFUA 3EO6A 1O6UA 2DCTA 3PNAA 3JZVA 1VALA 3VKMA 1OH3A 5FFOC 3GZUC 4FTBA 4OMCA 4MH0E 1JZ7A 1QGLA 2GC1A 3ZSJA 3B00A 3GHNA 3SEEA 5A3MA 2BBVA 4Q4Y3 1LKNA 5IYYA 2YHJA 5I0DA 5JLVA 1WA6X 1S0CA 2DVDA 1WWYA 2J1SA 4PJYA 5I8YA 2BNOA 1FNYA 4LA3A 2WWSA 2QQIA 2W46A 3IMMA 2BOJA 3MPBA 4WVMA 2YC2A 4E2SA 4Q8KA 2HEYF 2VMFA 4J1XA 2XQXA 3PMEA 3RZHA 3SQOA 1HN0A 1MQTA 1UZZA 2DCKA 4H2AA 2X29A 3KT1A 5APAA 5IVCA 3OGGA 1Q3EA 1UOBA 1WD4A 1C4RA 1HQLA 4QB6A 3GJBA 1VMHA 5J36A 3WQ1A 1GUIA 2KXLA 2DCYA 2RS31 4GJZA 4A3ZA 5FREA 4IGPA 2ZCWA 2RS32 3NO8A 4HSJA 1NLSA 1C57A 4RHV1 1LOAA 2ZA9A 4I01A 4CDWA 2CDPA 4YW2A 4RHV2 3LD8A 4UOJA 3BIWE 3S7IA 4MZUA 1EY2A 4A7ZA 2FQPA 5FY4A 4CEYA 1LNSA 2RJ2A 3RQ0A 1LHOA 4FVVA 4DY3A 1HX6A 1R1ZA 4LPLA 1FV3A 5EJZB 5IVYA 2UU8A 3OPZA 1KQRA 4UF0B 4ZXEA 2RM22 4FPJA 3SH4A 1J3QA 2X8KA 3ACLA 1E57A 4XURA 5F32A 4YNIA 2WWJA 5JZGA 2O8QA 2HKXA 4AI3A 4UFHA 5AC93 4AK3A 2AYHA 1H1AA 1SLLA 2WNUB 2PHRA 4JGZA 3THTA 2P37A 2D6NA 3ZN6B 4KG0A 4O65A 3CF6E 3HAGA 1LU1A 1PNFA 2YPDA 3Q8AA 2GP3A 1AXKA 2VE1A 1IS5A 5FYVA 3ZYPA 2VO5A 3K75B 3VD4A 1DLCA 2ZX2A 3N9QA 1R091 3GCWA 1VLNA 5GZFA 3WG4A 1YO8A 3KCXA 1P8JA 1R092 2EIEA 4IGQA 1FAYA 2Q30A 2GNDA 3O7OA 4MGSA 3W5MA 1GBGA 1RUH1 2ZPXA 1W8FA 1E5RA 1UZYA 1FMD3 1V00A 1VIWB 3NVCA 4I0AA 3Q8BA 4OYUA 5D1IA 4RS5C 5LATA 3ZFEC 1RUH2 2PN5A 4LBMA 3GHMA 3ZR6A 4CZSA 3KZ4C 4OHYA 3AZZA 4LK6A 3HBZA 1STMA 1F31A 3NL1A 3WHTA 4JKKA 1I6XA 2WO2A 2R041 2OQ6A 3HR9A 4RQPB 1UY1A 2VVEA 3ZKUA 4JRLA 3AKPA 4YWAA 3ZXEA 2BERA 4RSUA 1BXHA 1LRHA 2R042 3EBRA 4XXPA 2VUDA 1J3PA 3VZOA 4CCKA 4B3NA 4AI9A 3DGTA 1WMXA 3N4MA 4MVTA 4LBKA 3ELNA 1I3HA 5GZGA 4EWEA 3H8XA 4OI0A 1ZREA 5H9SA 5FO9B 1QJU1 1ZZ8A 5IVEA 1Y43B 3O1TA 5DUVA 2HLEA 4Q29A 5FYIA 4B7KA 5BNOB 2WO7A 1QJU2 4CCDA 1HB3A 4XVHA 4ISQA 4EROA 3HWJA 2LROA 4AEDA 2WO1A 2RDSA 5D2AA 5IVFA 1I1EA 3N9MA 1ZM1A 4P9LA 4R9AA 1W8HA 1UPIA 3SXWA 4NAOA 4YRDA 4HKOA 4LR4A 5KHIA 2Y6LA 1W04A 3A0KA 4NMIA 1XC6A 2K0GA 5F5AA 4XIKA 1ND2C 4WM8B 1NCRC 1D4M3 4P02B 1ULCA 4AVAA 2W1WA 3O1VA 3ORJA 3I8TA 1YIPA 3M3CA 4L92A 2XL7A 1AR73 5CFDA 2X05A 1C5IA 1UYZA 2PHXA 3D0JA 1TMF1 4DEQA 2P5BA 3KT4A 4PDWA 2OT7A 2ZHLA 1W6MA 4LO4B 2OYZA 3RPQA 3SKVA 3WOGA 4A3XA 1LB2A 3P1IA 5CKNA 4RFRB 1CIYA 4UBHA 4XJWA 4JDNA 3WNKA 4AEMA 4I02A 1NE6A 4JDOA 3LPFA 5C4WC 2HWF3 4ZU4A 3DEMA 1VP6A 1LHWA 2D98A 2VZRA 5G04L
chains in the Genus database with same CATH topology
4DRRA 3J9SA 4RR3A 4YVSA 4BE3A 2XJTA 2H6CA 2R1BA 3U10A 1OQEA 4OHWA 2I45A 3BOPA 1MS1A 2CTVA 4GH4C 4Q4Y1 1K5MB 5K0UC 4ZKTB 4EN6B 1CAUB 4Q4Y2 3VN4A 3WZ1A 1X50A 3ATGA 1GR3A 3DF0A 3IPVB 1QXJA 1UU6A 1LESA 1Q8VA 1REDA 2B5HA 4LO6B 4PBOA 4DPNA 1EAH2 2D6PA 3ILFA 2F6BA 4XF3A 3WW4A 4JGYA 3ZDSA 4BQ1A 3O0VA 4D3WA 1YNAA 4N43B 4AI2A 4XFFA 4GMP0 4CP2A 1I9RA 4YG6A 3AZXA 3B5LB 4RD7A 3TAYA 4N9HA 4I0BA 4MXWA 2TBVA 4CDUA 2GN7A 5FCCA 1MS3A 3ZIWA 1IS4A 2QFEA 4CDUB 1ND3A 1HQNA 1VBB3 2XGXA 3FLRA 5EFUA 2Y0IA 4AHZA 4XFIA 5FLJA 5FMOL 1ZRCA 2VH9A 2B7YA 2TUNA 3ILNA 3OBRA 4Q1PA 3WCSA 4CDXB 2VW1A 1G9BA 1AYN3 3LGRA 1B35A 1WLDA 2JJ6A 2TNFA 4NVPA 4A2UA 2WFF3 5AC91 1VBD3 4AWDA 4F7ZA 1UAIA 5AC92 3E6CC 2JKBA 1WCKA 1TME3 2H0BA 4FOQA 5JMCA 4HBNA 1MS4A 1X8EA 2QDNA 2XWJB 3T2TA 1H8TB 2A3WA 4Z92B 5K9YA 4UBGA 2ET1A 3IDCB 3OCPA 1MZ5A 3B01A 2GH8A 1SCSA 1R1A3 3TOJA 1ZYBA 2VVDA 3ZXKA 3MIGA 3B9IA 1EYBA 4BM8A 1D0HA 2DVBA 1APNA 2QDRA 2DU0A 4M3CE 3L9JT 1W6NA 4SLIA 4FXGB 5GLTA 4ZU5A 4HK8A 3ZVXA 4MXVA 2YYOA 3N3HA 3MICA 2VGDA 2ZJCA 4K1ZA 1RUJ3 3USUB 2JX9A 3TN93 1QH7A 2CV6A 2PHDA 4MGIE 4QQHA 3MPPG 4Q26A 4B4PA 2WNUC 3VGIA 1WLTA 1PIV3 2P3IA 4PLNA 1QJZA 4Q27A 2W0XA 4QT6A 3WDWA 5J96B 4AGVA 1W6PB 4BLJA 3M7AA 4QQ2A 1LULA 4AQ6A 1G9AA 2VQ0A 3ZPYA 4C0HA 4DOUA 1WMDA 3KT7A 3D8CA 4HK9A 4O9EA 3AK0A 5LK5A 4Q1RA 2PQQA 2E6VA 1HXS3 2PA7A 1D4M1 4OZXA 1HW5A 2UWAA 2NMOA 1O91A 3E5XA 4GXLA 1BVVA 2VUJA 1D4M2 2X5IA 4ATFA 4AQSA 1AR71 2KM2A 3ZX7A 1AR72 3B93A 3VBHB 5L7OA 3M70A 3O5SA 5KHKA 1YJKA 1RB8G 3MW4A 1X7NA 3M3IA 5A33A 1C8M3 4RQPC 4LO5B 1IGOA 4NWWA 1G9CA 1LHUA 1KD7A 3WG3A 2HWF1 2Y26A 3PVBB 1FOD3 2RMU3 1ZZ6A 2HWF2 5IUQA 5C8WA 1ULFA 4OLLA 1BKZA 3WV6A 3VLBB 3WQ0A 3L2HA 5BNOC 5CFCA 4KBBA 1PGW1 2A75A 3ASIA 3VBUA 4YZ5A 3B7MA 1PGW2 3VBSA 3MF9A 5CADA 4AGRA 3LOIA 1VBA3 3O0XA 4AHXA 2PELA 4D7SA 3ME2A 3KCYA 4WM8C 3QBQA 4AXOA 4X6RB 2ZBJA 2RJLA 2GNMA 1CAXA 3H7JA 4YW3A 1RUG3 3FBYA 1QJY3 4AFDA 2DVFA 2BVBA 4OI1A 3WW1A 1WCSA 4E2GA 2OA2A 4QPGB 2ETEA 4KWKA 2NQYA 1C1FA 2WS93 2PTMA 2VUAA 4L11A 4P9YA 4WM7A 1SBDA 4OUSA 3WDTA 4K21A 5BNPC 4Y1ZA 1L3JA 4COVA 4IETA 5FLHA 1RIRA 1WMFA 2MPFA 1SLCA 2ZHKA 2ZABA 4PQ9A 1DGWA 1CR7A 2O0OA 1RTVA 4PDWA 1Q43A 3UL2A 1ASJ3 1PVC1 3WP4A 1K5MC 1PVC2 4XE9A 4IV1A 2XLAA 4J6GA 3RI8A 1AYN1 1SLBA 2WFF1 1DBNA 3AMHA 5LEKA 1VBD1 4FXKB 1AYN2 4SBVA 2MEV1 2WFF2 1CAVB 1VBD2 1UIJA 4MGKE 1TME1 2MEV2 1MS0A 2VMGA 1TME2 1OOPB 5KXEA 2XJUA 4Q0UA 4N43C 1R1A1 1R1A2 1XNKA 4KGQA 4EWDA 5KC5A 2ARXA 3BOWA 2BYVE 2ZX1A 2ET7A 2NP0A 1KFXL 4U36A 4XQWA 1MS8A 1YI9A 2OUJA 3SCGA 1XU1A 4M00A 3MW3A 2DTYA 2K2SA 4AI8A 2NM1A 3AYDA 3VBFB 2IC1A 1RUJ1 3H1MA 4AVSA 1W6OA 2WZPP 1RUJ2 1QOSA 1XE7A 3TN91 3GF6A 3ZYRA 4XETA 4CDXC 3MFCA 3DL3A 4AHWA 3TN92 4LBJA 2EIGA 4GMP3 3E5UA 4QPIB 3GYDA 4LHNA 1PIV1 3GZTB 2A3YA 4YGBA 3VDDB 1WW6A 2A6VA 1QJX2 5BNQA 1POV0 5EXOA 1H8TC 3LA7A 3OBTA 3FJSA 3I59B 4K8FA 4V1PA 5AFEA 3V0BA 1BJQA 4YVWB 2DURA 2ZGMA 1ENQA 1HKDA 4HVRA 4OI2A 1UKRA 2MNGA 4IESA 4S2DA 5FQ0A 1HXS1 4FOVA 2A6WA 3WXPA 1UD1A 1HXS2 2NZ9A 3ZSKA 3B69A 4META 1LEMA 2B45X 2I74A 1V9U3 2C0ZA 3NAPB 4AFBA 2WZR3 4JC1A 5F1RA 3DN7A 1DQ2A 2BFUS 5IK7A 1PNGA 4W6WA 2B8MA 1UPSA 2B9UA 3IWZA 3AP7A 2GMPA 2YMZA 4HVOA 2Y0OA 3PVOA 2EALA 1S0EA 4XPVA 1FOD1 2RMU1 3BTAA 3ILRA 3ZFEA 2ZGSA 4MSVA 5BNNA 1FOD2 2RMU2 4RS5A 4BOWA 1HRV3 1LU2A 1LHNA 4AFAA 2NYYA 1NA1B 1Z7S3 4HSLA 4Y5Z0 2GNBA 2WJSA 1XE8A 3AP5A 3AFKA 3ES4A 3H7YA 3M3OA 2W52A 3D4KA 1LOGA 3RI9A 3NJZA 1LHVA 2SBAA 4I2OA 1PGL1 4JTOA 4XBNA 4E27A 4LA2A 1PGL2 1C8NA 1ULGA 2CAUA 4EV0A 1RUG1 4OHVA 2WA4A 1QJY1 3VBHC 4IV3B 1RUG2 1QJY2 3V56A 1PK6B 3PVNA 5T50A 3LSEA 1I5ZA 5HBAA 1ND2A 4N9IA 1NCRA 3BPZA 1YYNA 3GNEA 1EPZA 2FMYA 1C28A 4TSVA 2G4IA 4XTPA 4Y20A 3P3PA 5J09A 2DVAA 4KG8A 1ASJ1 3IN9A 4DMIA 2BWAA 2XUMA 1ASJ2 1WD3A 2ZKNA 1COV3 3N7MA 3OYWB 4K40A 5C4WA 1RVF3 4H14A 2EXJA 3HN1A 5GM0A 1X33A 4QGNA 4FQZA 2CGNA 1SEFA 1KXGA 5JOYA 1QXPA 3L2YA 3U4XA 1W2UA 5CBLA 4U2AA 3A4UA 5L36A 3UKTA 5E16A 1YUDA 3ETQA 3KMHA 1QH6A 1JTZX 5K0UA 3VBOB 1H2MA 2BNMA 2UY8A 4QPGC 4AE2A 1JH5A 3VHPA 3JB8A 4NOTA 5CG9A 4GH4B 1WA4A 4COZA 2BFUL 1YXWA 2GMEA 1QXRA 2PHLA 2OIIA 4LULA 1LGNA 4XW3A 4YZ4A 1DHKB 1D2QA 4XF9A 1WW7A 2AENA 1VR3A 3RRDA 1MVEA 4GMP1 3GBWA 5F9TA 5DZEA 5FO8B 3FBMA 2A5ZA 2ZACA 3SH3A 2XVKA 2D40A 3JD73 3UKVA 4YM3A 1A8DA 1AF9A 1OOPC 1XRUA 4HFSA 4FBFA 1HV1A 5HI0A 1SLTA 3N35A 2A6ZA 3UK9A 4COUA 3NV2A 4BLIA 2GC3A 5GLUA 1ZBE1 1H8VA 2XWBB 4COYA 3MZHA 2GC2A 3FMGA 2ZGPA 1PZ8A 1ZBE2 5CAZA 3QOPA 3FWEA 5FRAA 3MW2A 3JU9A 4YLZA 1GSLA 3AXEA 5GZEA 1U0AA 1V9U1 4PCRA 5F5QA 5JVVA 4IEZA 3VBFC 2WZR1 4I3PA 1CAWB 1V9U2 3LOBA 1GYKA 4ASLA 4WVVA 1Y9QA 2WC2A 2NMNA 4XZPA 4QPIC 2VNGA 3FZ3A 3B3QE 2ZGTA 5IK5A 3VDDC 1EV13 1HRV1 2R073 4EN8B 1HLCA 4Y1VA 4LHLA 1Z7S1 4FQ4A 5JCTA 4IEOA 1O4TA 1Z7S2 4YVWC 4YARA 3TNPB 3MLLA 1UN1A 1ZZ9A 1WCDJ 3BB6A 3E6BA 1VJ2A 1AL23 3EHKA 1A78A 2WNUA 4KQ7A 3IBMA 1GNHA 4LNVA 3ZN6A 5KXCA 1OMIA 3RSJA 5EZWA 4GALA 4Y4YA 4K20A 5BPXA 1NOVA 4QGLA 5BXXA 3NAPC 4YW4A 4WVZA 1V6JA 4I30A 1QWRA 1KS4A 1POV3 2BQPA 1HDKA 3PLQA 1TNRA 2IXKA 3MLJA 1V6NA 2Q1ZB 4XF1A 2ZGUA 4H7MA 3KS7A 2D6MA 4UW5A 1DU3D 1G8WA 4NHMA 2AREA 3TRSB 1GQGA 4S2GA 1CJDA 2W39A 4KL1A 5FDBA 1ZX5A 2DUPA 2D93A 2D5FA 5AVPA 1NG0A 2JECA 3AX4A 3ZN5A 4C1XA 2VW2A 1NA1C 4RQPA 4Z1VA 1D2SA 2RR13 3WLUA 1COV1 3U07A 3BCWA 4NHLA 3AXDA 1COV2 4Z82A 4CTEA 3C3VA 3ZFGB 1DQ1A 1VRH1 2IXJA 1QNWA 2PHWA 5IT6A 1ZZ7A 5I0RA 3RS6A 1VRH2 5BNOA 1BQPA 4BYYA 3Q9OA 5DXDA 1OA4A 5KHGA 4E2QA 4IV3C 5B2GB 1ZZCA 5FMOS 1KDMA 1RUE3 4LE3A 5JR7B 1AJKA 4LHKA 2YGMA 1PK6C 2DCZA 3WY6A 4EN7B 3WVJA 2C1FA 3GZAA 5L73A 4WM8A 1RUD3 2QNKA 2H6BA 5JOXA 5H9RA 4LBOA 4FPKA 3MI8A 4HN1A 4DINB 2JE7A 3AP9A 1OQDA 1MS5A 4YSFA 2Q0AA 2XJVA 1G6NA 3WDVA 1VAKA 2HWB3 1ENXA 1TMF2 1H4GA 5J98B 1AUYA 4B8EA 1WUVA 2LTNA 4AEKA 4ES9A 3SCHA 5JDBA 4ZXKA 5T5LA 5KXBA 1V6LA 2BGCA 4PF5A 3JD71 1MVQA 2WA3A 1IQAA 4DQAA 5BNPB 3V0AB 1IKPA 2VULA 3JD72 1K5MA 3VBOC 1CAUA 3VZMA 4YM1A 1AR63 3WUDA 5L19A 1EPWA 2R063 3CNAA 3IPVA 3SITA 1NY71 5CA6A 1V6KA 1HRI3 1NY72 2XLFA 2JG9B 3AMQA 3WP3A 3PJQA 4BIOA 1H1MA 2WNVB 2OZ6A 2ZX4A 2VNRA 1NXMA 1CQ9A 1DGWX 4N43A 4Y1XA 1TE1B 3H8UA 4HVQA 4Y22B 4QM8A 1UF2C 1ZVFA 2IFWA 3VKNA 3J8F3 4XTMA 3QH6A 5SV5A 4B4QA 1YFUA 2ZKLA 1EP0A 2A6YA 4X8PA 2ZAHA 2XJQA 3ZXFA 4XDQA 2D7FA 1UU4A 2R071 1SMVA 1QKQA 4AFCA 2R072 4JVAA 4I3GA 4L99A 2A7AA 1LR5A 4GKXA 4CDXA 2P3JA 1UIKA 1BVP1 2BUKA 3RYPA 2EF6A 1AL21 3CEWA 2V5YA 1IPJA 3QLQA 4C90A 3NKTA 2PLV3 3IDEA 1AL22 1KITA 1GLHA 4BIFA 2ZZJA 3JQXA 5BYNA 1H8TA 2C9AA 4YFZA 3KCCA 5A3LA 3POWA 3O14A 1QOTA 2DU1A 3WNXA 3RYRA 3M3EA 1POV1 4IEXA 5SV8A 1W6QB 4HANA 4INDA 5EWSA 2X53S 3ZFFB 1Q5OA 4QQOA 1CESA 1WW5A 1BMV1 3B02A 2UYBA 2ZTNA 2WSUA 2HYKA 1RUOA 4Y24A 2XPJA 4P9JA 5T3NA 1O3QA 1D4VB 3USUA 2GN3A 2UY9A 4NN0A 2AR6A 1FMD1 4EJRA 3VUOA 3VZLA 2RR11 1FV2A 1RGSA 1FMD2 5CB7A 2RR12 2YXSA 4FAGA 1ENSA 1O4YA 5FBZA 1O4ZA 4EWAA 3ZSMA 3APBA 3E6DA 4XILA 4Q0VA 5J48A 2RE9A 4FPOB 1SFNA 1W6PA 4YM2A 2Y38A 2VNOA 4M3CB 1GNZA 1UKGA 4HZFA 3VV1A 1PZ7A 4MV2A 2DUOA 3V64A 1RUE1 2W08A 5ABJB 5GLZA 1RUE2 4Q4V3 2YUEA 1RUD1 4YZ3A 1DG6A 3PMSA 3QCWA 2JD4A 1U5XA 5KWRA 4BMBA 1OFSA 1S1AA 3T1LA 1CIWA 3SLIA 4AEJA 3D5OA 3VBHA 3VKFC 1SFYA 3S0MA 4XFHA 2CL2A 1MS9A 1JW6A 4YGCA 2EA7A 3IM0A 4LE4A 5FO7B 1O7FA 4E4SA 2D6OX 1MACA 2HWB1 3MIFA 4JGZC 2BEOA 1LOCA 1V6MA 2HWB2 4UW4A 3ZFGC 3BALA 2R6QA 1LODA 3MGUA 2VPVA 5I8SA 2QUOA 5C8CB 3R4DB 2Z69A 1ULEA 4B7EA 2H0VA 3WT3A 5T5PA 3VZJA 2YY1A 2VOVA 1S2BA 5JAXA 4Q4W3 2D3PA 2VMHA 3H3UA 3KGLA 2D3RA 2PAMA 3VZKA 3TNQA 1OPMA 2PFWA 5DUUA 3OGJA 4W65A 1A6CA 1WLCA 2A70A 3NKGA 4JTNA 3VKOA 5BY5A 4QPGA 4AYUA 4LBQB 5H9PA 2EVXA 2VU9A 2GZWA 3D82A 1OPOA 2GC0A 3J8F1 3AB0A 4BZ4A 4WBBA 2JENA 3J8F2 2WIIB 3I4IA 1REFA 2ATFA 5GZCA 2D6LX