2VY0A

The x-ray structure of endo-beta-1,3-glucanase from pyrococcus furiosus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
264
structure length
264
Chain Sequence
MVPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1,3-GLUCANASE
publication title Crystal Structure of a Family 16 Endoglucanase from the Hyperthermophile Pyrococcus Furiosus-Structural Basis of Substrate Recognition.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 62
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vy0A00
1W6QB 2ZHLA 5EYYA 1W6MA 4AGGA 1EPWA 1GZWA 1LEMA 1G7YA 4YM2A 3FBYA 1AJKA 1KDKA 1S0IA 1N1YA 1AX2A 5DXDA 5EWSA 1UL9A 2LTNA 4M00A 1MR5A 4Q27A 1CQ9A 2D6LX 3O0VA 2ZZJA 3RRDA 2EXIA 1AZDA 1VALA 5JMCA 3VUOA 4XJUA 4YM3A 5E8AA 3ZXFA 3I4IA 1YYNA 3CNAA 4MYEA 4UW5A 2A70A 1N1TA 3ZVXA 1FV2A 2ES3A 3WV6A 1ULFA 3JUUA 2CTVA 2ZGTA 2ZGPA 1IS5A 4AVSA 4LBQA 2ZAAA 1QDOA 1ULCA 4XDQA 1SLCA 5GZEA 3AK0A 3ZSKA 1B09A 4WVVA 1G8WA 5JOWA 3V0BA 2NYYA 1W6PA 1MS3A 4XOGA 5E89A 4M3CE 3ENRA 2D3SA 2NMOA 4FOQA 2ZACA 4K20A 1LU2A 1N47A 2Z42A 1LODA 1Q8SA 1Z78A 2CY6A 1C4RA 4XJ9A 1GZWB 4K1YA 1JYCA 1UMZA 1VLNA 3B3QE 4BOWA 1ENSA 1A3KA 5HCBA 5T55A 2KM2A 1LOBA 1Z0HA 3PVEA 4Y1UA 3IM0A 3AYAA 1LOCA 3AX4A 4ATEA 4BM8A 3WDXA 3D6EA 4W65A 1QKQA 1GNHA 1A8DA 3RS6A 2JECA 1YIFA 1O4ZA 2R49A 2ZGNA 5DUUA 1LOAA 3FUOA 4R9CA 3RMXA 1TEIA 2VW0A 2OVUA 1V00A 4K1ZA 2D3PA 2VU9A 3WDYA 5KXEA 1JXNA 4XYXA 3VKFC 4LBQB 1ENRA 4YGCA 2GMEA 4CTEA 1BKZA 1V6NA 3ILFA 2VW2A 2DWRA 1SBFA 3MPPG 3WG4A 1WBFA 3PVOA 5L73A 3V0BB 1IS3A 1DQ4A 2YXSA 4XHBA 5EYXA 2GNDA 1W6PB 2BQPA 1AX1A 2WT0A 4XBNA 4XBQA 5HCAA 5H9QA 2CWSA 2VY0A 2R16A 4Y1ZA 5LK5A 3N3HA 4IQPA 4XXPA 1KITA 3N35A 4FPJA 3AYEA 1ULGA 5GM0A 1MVQA 1KJLA 3B9CA 2NP0A 4UW4A 3VKLA 4PF5A 1NXD1 2DTYA 2WT1A 1LGBA 3O0XA 4FPLA 4YZ2A 1DHKB 4H55A 2ZGUA 3N36A 1SLBA 1G9BA 4YZ3A 2DVFA 2YV8A 2JKBA 3NV4A 3OBTA 2WKKA 3M2MA 4FQ4A 3WLUA 1S0DA 3RG0A 4BMEA 1LECA 3WG1A 2ZBJA 4FP3A 4HL0A 1V6OA 1DBNA 3V0AB 5JDBA 2P2KA 1DIWA 1LHWA 1S0JA 5H9PA 2YY1A 3WDUA 3AZYA 5KXCA 3NV2A 2VW1A 1LESA 3AYDA 1WCSA 1G9AA 3HMYA 1LHNA 3AYCA 1QF3A 4GKYA 5EXOA 1HKDA 3UK9A 1ULEA 1CN1A 2UWBA 5HCFA 4Y26A 1BQPA 1DYPA 1JN2P 3OY8A 4NO4A 4NOTA 5GALA 4DFSA 1GYKA 2ZABA 1SLAA 2DUQA 3AZWA 4YW2A 2FMDA 2P3IA 2DVGA 2E51A 3AJYA 3DUIA 1FNZA 1PZ7A 5GLWA 3WUCA 4Q1RA 1FYUA 4FPCA 3AXDA 4YW5A 2V5YA 2JE7A 2DVBA 2YMZA 1JBCA 4YZ1A 2YROA 5DUWA 2W52A 1FATA 1XQNA 2JD4A 3HN1A 3WCRA 1I3HA 3SH5A 2EF6A 2A3XA 3U4XA 4FPOB 3ILNA 2DUOA 4U36A 3UJOA 1URXA 3AP6A 1WW4A 1WBLA 1MS9A 3WHTA 4XMIA 1C1FA 2ZMNA 2EXHA 4XXAA 2D6OX 1WW5A 2ENRA 3MW3A 4XBLA 3OPZA 3M1HA 4YG6A 3ZXJA 2P3JA 3MEPA 5JOZA 4GWNA 2Q5TA 1Q8QA 3AFKA 3V64A 3WNXA 2DTWA 1DYKA 3ZSJA 1PZ9A 1KDMA 3UJQA 1MS4A 1V6LA 4YM0A 2PHWA 3OY8B 4RA0A 4ZKTB 4FPFA 1BJQA 2H0BA 1UN1A 5DG1A 1OFSA 3NV3A 4R9BA 1SLLA 1FNYA 2SBAA 3A4UA 5F9TA 3BIWE 4YW1A 1MS5A 3WUDA 5DZGA 2PHFA 3VKMA 4FOYA 2DURA 5AVAA 1ZA4A 1C57A 4LBOA 2FHRA 1N3PA 1Y7BA 1DQ6A 1RITA 3O12A 1UZYA 4M3CA 1S0CA 1DQ5A 1DLLA 4XMAA 1OQ1A 4FPHA 5CB7A 5GLUA 1UZZA 2GN7A 4Q26A 3ZYPA 2A5ZA 3AZZA 2ZGOA 1LGCA 2D3RA 4UW6A 1MS1A 1AXZA 3VV1A 2RHPA 1UKGA 4FP2A 5H9SA 4DPNA 1SBEA 1AF9A 4L8QA 3OBRA 4Y24A 5CBLA 3ZXEA 2VXRA 1FX5A 4I30A 1LHVA 3B00A 1LHUA 3LSEA 1ENQA 4DRVA 2ZMKA 3V0AA 5GLTA 4C1XA 2ZGSA 1CR7A 1AVBA 3T1LA 4AWDA 3OYWA 1PZ8A 1GZ9A 2EXKA 4XTMA 4Y1VA 2XG3A 1JUIA 1F5FA 4FVVA 2ZHMA 4XTPA 3IKWA 1LJ7A 2R1BA 1LEDA 3OGGA 1ONAA 4XE9A 1IS4A 3ZXKA 2ARBA 5T52A 3W59A 1LGNA 2ZGKA 4XZPA 2DYCA 4TYSA 3BTAA 2AH2A 3LCPA 1LENA 2DUPA 5GLZA 1WLCA 1SCSA 4JC1A 3ZYRA 2A6XA 3B69A 2UURA 3M3EA 3SH3A 3WDVA 3SH4A 2D6NA 4P9WA 4M3CB 4BQ1A 2C9AA 4U2AA 3HR9A 1VAVA 3VKNA 2V73A 4GKXA 1QOOA 3D4KA 3BODA 2D44A 1SFYA 4BMBA 1HQWA 2C5DA 1JOJA 1GBGA 1MACA 4AYUA 1CESA 1N1SA 3DGTA 2ZGLA 4C1WA 3UL2A 3V65A 3POWA 5DG2A 1N3OA 3INAA 2EXJA 1YRZA 4Y1XA 2ZMLA 1AX0A 1Q8PA 1WUVA 4LBNA 1DQ1A 3M3CA 4P9XA 4Y22A 4ZXKA 4ATFA 3OYWB 2OUHA 2E53A 1A78A 1UPSA 1KRIA 3ZPYA 3SISA 4TZDA 1QMJA 1IKQA 1C1LA 1DFQA 2W39A 3BOPA 4FPEA 2I2SA 4YW3A 5IK5A 2D43A 5JOXA 5JOYA 1LOGA 3ZXLA 5FREA 1JYIA 1AJOA 2EALA 4XHXA 1S0GA 2W08A 1S0EA 4LBKA 1SLIA 2D7FA 5IK8A 1WD3A 3WZ1A 1G86A 5DUVA 1SACA 5IT6A 2DU0A 3USUB 1SCRA 2R0FA 2W68A 4M3CF 1LOEA 2CWMA 2WT2A 2GNMA 5GJ6A 5T5LA 1CJPA 4XJAA 4YZ4A 2A6VA 3R4UA 1DQ0A 2DVDA 2R1DA 1I1EA 1WLWA 3O5SA 2G4IA 2A3WA 2A75A 3A0KA 4XJWA 4FPKA 4XIKA 4KBBA 3L2YA 4AGRA 4Q8KA 3Q9OA 1DQ2A 1S0FA 3D5OA 2XB6C 1S0BA 4LBJA 3TAYA 3W58A 2P37A 1UX6A 1G9FA 4YGEA 1HQLA 1WW7A 1DZQA 4Q8LA 4BLJA 3KQRA 4JCKA 4Y22B 4PBPA 2WQZC 1H30A 5CAZA 5T50A 2PHUA 1G9CA 4ITCA 5T5JA 1LULA 5CA6A 3WDTA 3QCWA 4XIOA 1W6OA 3NV1A 1F9KA 3AP4A 1RIRA 4FQZA 5GZFA 1Q8VA 3IPVA 4PBOA 4SLIA 3ATGA 2E6VA 1ULDA 2DVAA 1H9WA 3POSA 2B7YA 5DZFA 3N7KA 1QOTA 1F31A 2E7TA 5KXBA 2WJSA 4HANA 3SNMA 4Y20A 5SV8A 1R1ZA 1V6IA 2EIGA 1GV9A 3GALA 1BZWA 1V6JA 4WZFA 1AXKA 2ZHKA 1IOAA 1KJRA 2GALA 2NMNA 3N7MA 2GNTA 4P9YA 1V6KA 3WG3A 2TEPA 1GLHA 1W0PA 2HYKA 1LU1A 1GNZA 1X50A 3RMYA 4AGVA 1CONA 3A0NA 1VIWB 3PMEA 4LBQD 4DQAA 2OW4A 3JU9A 2VUAA 4ASMB 5T5OA 3LSDA 1DGLA 1GSLA 1WW6A 2EAKA 4BLIA 4WV8A 4R9AA 1HLCA 1WLDA 1IS6A 3WG2A 4YG3A 5H9RA 5GZGA 3FLTA 4CRQA 3C2UA 2SLIA 1IKPA 3T2TA 1W6OB 3WHUA 3IN9A 4ISRA 2ZGQA 2PHXA 1RINA 3IPVB 4F83A 4Z8BA 2WSVA 4K21A 4R9DA 4XILA 1YI7A 2AGSA 3ILRA 2UU8A 2CL2A 1S1AA 2GMPA 3PVNA 5FRAA 1OKQA 1QDCA 2AYHA 1D2SA 1BXHA 1W6MB 4YFWA 5DZEA 2A71A 4BPZA 1CIWA 2WSUA 4Y20B 5DUXA 2ZKNA 3MW2A 4AVTA 4P14A 3KM5A 3R05A 2GN3A 1N3QA 2ZA9A 4ISQA 2GDFA 3M3QA 1W6NA 1YXWA 1SBDA 2CNAA 3AZXA 3O0WA 4UW3A 1JHNA 3VKOA 1GZCA 4YW4A 1GICA 4WVWA 4M01A 1SLTA 1Q56A 1WD4A 2A6ZA 5GZCA 3USUA 1UAIA 2YZ4A 3AXEA 5F5QA 1V6MA 3RQ0A 4FPGA 3FLRA 3I8TA 3AP9A 2A3YA 1YO8A 2A6YA 3AZVA 1JW6A 1W0OA 2OUJA 5BYNA 1GANA 2UWAA 3WDWA 2D6KA 1Q8OA 2NZ9A 1J1TA 4YG0A 4GWMA 2ZGRA 4LBMA 1U0AA 4FOVA 2GMMA 4OZXA 2AREA 5T54A 3FLPA 3SLIA 4CZSA 1LHOA 2A6WA 4YGBA 4Y1YA 5IK4A 1ZM1A 2JE9A 1FAYA 1HDKA 3NWKA 1QGLA 1VAMA 2WNEA 3AJZA 4XJ8A 2CYFA 2NN8A 4YM1A 5KXDA 4D69A 3N7JA 4YZ5A 5JLVA 2PHTA 1MZ6A 2LALA 4FOWA 3SITA 4YFZA 1BYHA 4Q2FA 3AP7A 1G9DA 1QNWA 1W6QA 2DV9A 1MS0A 1W6NB 2WLQA 4GA9A 4AVVA 1KQRA 3GNEA 4LBLA 1H9PA 3MW4A 2D6MA 3WVJA 2D6PA 2P34A 3QLQA 1GKBA 3ZSLA 3POYA 1O4YA 3R4SA 4DRRA 1LOFA 4RL7A 2VH9A 4YGDA 1QNYA 3WCSA 1QOSA 1MZ5A 3WOGA 1FV3A 2AENA 4PQ9A 3PJQA 3M3OA 2ARXA 3N7LA 4Q1PA 1MS8A 4PCRA 3AP5A 2UWCA 1LTEA 1LCLA 3ZSMA 5CNAA 1QU0A 3FUQA 3OJBA 2ZHNA 4XJZA 2AUYA 2E7QA 2ZGMA 4JRAA 2DU1A 2GNBA 2PELA 1CPNA 1APNA 3ASIA 4GXLA 3T1MA 1AXYA 1D0HA 1LOFC 5GZDA 2ERFA 5IUQA 2P3KA 5GLVA 2A7AA 3TB0A 1CPMA 5IK7A 2JJ6A 4DS0A 2NM1A 3RSJA 1NLSA 3B01A 1N1VA 4GALA 3H0OA 5JVVA 2PHRA 3IMNA 5T5PA 4YLZA 3FFZA 4FPYA 1CVNA 3APBA 2R0HA 2JDZA 2AR6A 5E88A 1MVEA
chains in the Genus database with same CATH superfamily
1GQPA 1OBNA 2CGNA 1CD3G 5EYYA 4QHZA 2ZCWA 1GZWA 1LEMA 1G7YA 4YM2A 2JG9C 4Q4V1 3DPRC 5EWSA 4CEWA 1WMXA 5FY7A 5JPMB 2FCTA 4Q27A 2BBVA 1KD7A 1KFUL 4OHXA 2Q1ZB 3RRDA 5A7OA 3OGSA 2FDHA 2EXIA 1VALA 4JGZA 1RUOA 1US3A 1C8M2 3BOWA 4KG0A 1UX7A 4N7IA 2WN2A 3WP4A 1R1A3 2ES3A 4QD2A 1UY0A 1ULFA 5DMYA 2ZGTA 4LR4A 3WF1A 4YVWC 2V5DA 4AI0A 2ZAAA 4LHKA 1SLCA 4PLNA 2EIBA 1B09A 4OFGA 3V0BA 2NYYA 2B5HA 2EIEA 5A80A 3THTA 1ZREA 5ANNA 1M06G 5FZ6A 2WZR1 1IHMA 5HPOA 1VE0A 4WM8A 2NMOA 4AG4A 3FHAA 3MUZ1 1GWKA 2Z42A 1N47A 1NT0A 2VUJA 5C33A 2WS92 3ACHA 1Q43A 2CY6A 2BTVC 4KBZA 5CFDB 4BU2A 4XJ9A 4BA6A 2PA7A 1XJAA 1GOHA 4BOWA 1ENSA 3ZPOA 4NAMA 1Z0HA 3IM0A 2W1UA 2WWSA 2QQWA 4K3UA 5FXWA 3T0BA 4ATEA 4BIOA 3WDXA 4BM8A 1B35B 3LFIA 1QKQA 1GNHA 2BV4A 1A8DA 3LIHA 1YIFA 2VE1A 1O4ZA 1XNCA 2XONA 2ZGNA 4JHZA 4W6YA 5DUUA 3UESA 1D4M1 3HPNA 4BXFA 1TEIA 4ZZ5A 2JDNA 4DMIA 1IG0A 2VW0A 2OVUA 5FZGA 1GR3A 2D3PA 3WDYA 4HKLA 2BUKA 1BKZA 3MLKA 3D3AA 3CL1A 3QACA 3LA3A 3ILFA 3NNMA 4MGKE 4E9KA 4Q0PA 3OTFA 4S2FA 5D8AC 5FYUA 4DEVA 1DG6A 4ONUA 4G9SB 4PLOA 5C8CC 2IXIA 2VY0A 1TNFA 4YPJA 4Q0VA 5IVJA 1RUC2 3VZMA 1UYYA 4XUTA 4XXPA 1KITA 4FPJA 2PN5A 4C0BA 2X53S 1ULGA 1UOBA 4KMQA 4XDPA 4E2SA 4GMP1 4FI9A 5A6QA 3CF6E 1AL21 4AEJA 4HVOA 3LPGA 2ZXQA 1ZBA2 2D93A 2VQAA 3BPSA 3LWCA 4LHLA 3MV11 1G9BA 5C4WB 1SZBA 2E26A 2G9FA 3K77A 2WKKA 3PHMA 4BMEA 4C90A 1MQTB 1ZZ7A 3NJVA 4CYDA 4FP3A 3OUIA 2AEYA 3MPBA 4GD4A 3WP5A 4QGNA 1AR62 3K46A 5EIYB 5IATA 1W8ZA 5KHHA 3U0ZA 3B7MA 1H6XA 4JX0A 3HMYA 4DXZA 1NQJA 1QF3A 5EXOA 4Z1VA 5FZ0A 1HKDA 4LO4B 3H1WA 4OUEA 1CN1A 3CQOA 1I5ZA 1FOD2 1BQPA 3FX3A 2VR4A 3I3BA 2OPWA 1JN2P 4NO4A 4B4RA 3TN93 4XFGA 5GALA 1PIV2 4DFSA 1VR3A 1SLAA 2DUQA 3S7IA 3AZWA 4QHBA 5F37A 2FMDA 2R071 1NCQA 2P3IA 2W95A 5FYBA 1ZX5A 1ND2B 1PGL2 2FD8A 1VBB3 2VNVA 4CDQC 2DVBA 3MO4A 2WDBA 4QGMA 3CJIC 1HRV3 2WFF3 4K6BA 4KGQA 5FZHA 2GZWA 2Y6LA 3MGUA 2WA4A 3FC0A 4RN5A 3U4XA 3OBAA 4XF0A 4LKEA 1UOJA 2Q0AA 1ZRRA 1COV1 1WBLA 1MS9A 1WW4A 2YDEA 3M7AA 3MYXA 3N9PA 4MGSA 4CXYA 2EXHA 1XNTA 1OKOA 2D6OX 4XXAA 5A33A 2BP6A 2ENRA 3NW4A 3RPQA 5BY5A 1FPN3 4KL1A 3OPZA 4P5HA 1GP6A 4GWNA 3AVSA 4BQ2A 1TMF1 4QM9A 1DYKA 3SCFA 2N7GA 4PIXA 4Q0SA 1KS5A 1UD1A 3HWJA 3I97A 4TN7A 2YU2A 3V56A 1ZZ6A 3UJQA 4PI2A 2CAUA 3HNBM 3OB8A 4IE0A 4LUMA 2PHWA 2X05A 3RWNA 3UGHA 3VZKA 2D98A 2BRTA 5L9VA 1AR81 1BJQA 5DG1A 5FYYA 3K2OA 3VD7A 5DAPA 4JZRA 3NV3A 1DZRA 4R9BA 2VNGA 4LEJA 3VL9A 4BK4A 1FNYA 3TEYA 5F9TA 3BIWE 2P6CA 4CDXA 3P1IA 5HV0A 4Z92B 1K42A 2WO7A 3K48A 2EAAA 3H3LA 4Q5OA 1L7RA 3VKMA 1W9FA 5AVAA 4O65A 3WNOA 4DXTA 4QKFA 4W50A 1C57A 4LJHA 3H8OA 1MPXA 2CHHA 1RITA 3CHXA 3K51A 5LEKA 1DQ5A 4Z82A 5FZOA 3K4ZA 1X36A 1DCSA 3KVAA 4RFT0 1OQ1A 3NRUA 5DDJ3 2ATFA 1NY72 5GLUA 2XOMA 2RJ2A 3TEXA 3AKQA 2H6CA 4LULA 1BMV1 4Q26A 1POQA 2A5ZA 3PTRB 1OUXA 5EV7A 3DYPA 3ZYPA 1LGCA 4CDXC 2VJXA 3J26N 3GZUC 2R063 3NJYA 4H14A 3VV1A 5IAXA 4DPNA 5FZ8A 1SBEA 2XL7A 4CU7A 4Y24A 5APAA 3EMRA 3WNPA 5CBLA 4OCTA 3N4MA 2VXRA 4EN6B 5C5TA 4FSJA 4WM7A 3LA2A 3B00A 4URTA 4AFAA 1D4VB 5J48A 2BOIA 1GQGA 3GBFA 1KGYA 4EZ4A 2X10A 5GLTA 3V0AA 2FDIA 3I3DA 4C1XA 1CR7A 1RUH3 2HEVF 5FYMA 2WO1A 2XHKA 4FVVA 4K9SA 1FMD1 4PDWA 3ZR5A 1W8UA 1ZZ9A 3OGGA 1ONAA 3OGVA 4KG8A 1Y9MA 5LK7B 2ARBA 5T52A 3W59A 3VBFC 1O8SA 4XF9A 5A3UA 3OEAA 5LA2A 5FYZA 1WLCA 4WM7C 2CDOA 2VECA 4FXGB 4CUAA 3B69A 5A3MA 1R1A1 5IW0A 4GWIA 4IGPA 4BQ1A 4RD7A 3WF3A 4U2AA 4E4SA 1UMIA 1BBT3 1PMJX 2V73A 4GKXA 5C3SA 3ZSEA 3BODA 3ELNA 4PDWC 5DAQA 1QH6A 2D44A 4BMBA 3IIIA 4COWA 4R4ZA 4CXWA 5IHRA 1HQWA 1JOJA 1GBGA 3VBOA 2W1WA 4IEZA 1YQ8A 4D0QA 1N1SA 4BZ4A 4MXVA 3DGTA 4IEUA 4AOCA 4C1WA 4YVSB 2ZZQA 4JDOA 2XUEA 1R093 5J09A 2ZMLA 4QDSA 3O1VA 4MGQA 3KCXA 3LAGA 2E53A 2I07B 2B39A 4X6RB 1IKQA 4FPEA 5FY4A 4UFHA 3OPWA 5ERLA 1WWYA 4YW3A 1JUHA 2HWB3 3FJSA 2D43A 4NRMA 4L92A 2VZRA 1WCQA 2C6SA 1XE8A 1JYIA 2X29A 4XHXA 1SPPB 3JD73 1E57A 4IV1B 5FQ0A 1PMIA 1SLIA 4UYBA 3VZOA 3SKJE 2R32A 1G86A 2QTWB 4EQVA 1UWWA 3POGA 2DU0A 3USUB 4QDQA 1QJX2 2IZWA 1RMU3 3KZ4C 4M3CF 4QMAA 3TOJA 4GZ9A 2GNMA 4OULA 3LEIA 5FXXA 4QB1A 3ZYBA 3I59A 5FZIA 1CJPA 1Q5OA 5FMBA 2LW8A 4JQTA 2A6VA 2V09A 2DVDA 1HV1A 2RMU1 3GZAA 4FFHA 4IUGA 5A3PA 3A0KA 2A75A 5IYYA 5JI9A 1D2QA 3ZDSA 3T2PA 3DF0A 4HETA 4GJZA 4XJWA 4QX2A 5B4XA 2ZEWA 1UU6A 4AGRA 2VZUA 4GAZA 2J1AA 2WIIB 2WYFA 4OHZA 3OGRA 1VBA3 1WW7A 1DZQA 5F2SA 1Q3EA 2ZX3A 4JAAA 3KT1A 1H8TA 3WXPA 4V2VA 2PHUA 1G9CA 1LULA 1CAXA 4GH4B 1VBD2 4NRQA 4Q4X2 3WDTA 4AL9A 2XKPA 1JZ3A 3E6DA 3NV1A 1RIRA 3N9QA 5L36A 4Q4W3 5C3RA 1W8FA 3LEMA 4QPGA 3FN9A 4JKKA 2HWD2 5CZKA 5JSOA 2VMCA 1S2BA 5CYYA 2XQRA 1QOTA 2OYZA 5KXBA 1XYPA 2XBO3 1H8TC 4LT5A 1V6IA 4HONA 1CGPA 1V9U2 3LKJA 2Y64A 1NCRA 3ZR6A 1BZWA 5FK7A 5LA0A 5F32A 4D3WA 4MOAA 5FY5A 4NWVA 5J37A 4FO9A 1CAVB 4KWJA 4FFGA 3VGIA 1E5RA 3RFRA 2HYKA 2R7EB 4NHXA 1VIWB 3PMEA 5K9YA 1VBB1 3ZFFA 2VUAA 5CFDC 3SQOA 5T5OA 4ASMB 3LSDA 1HRV1 2WFF1 1GSLA 2EAKA 2WYSA 2RS32 2RS12 4RHV3 1IS6A 3WG2A 5H9RA 1GFF2 5F3IA 3FLTA 4AEDB 4CU8A 4E8CA 1WCUA 3CO2A 1W2TA 4K40A 4PI0A 1PO13 4CA9A 3T2TA 1NA1A 1W6OB 4TXWA 3NNLA 3IN9A 2PAMA 5B2GB 2F4LA 2HWE2 5A6XA 4UFIA 2W3JA 3ZXDA 3OG2A 2OIIA 1FPN1 3CZJA 1OKQA 1ND3B 1CAWA 2A71A 2P4EA 1CIWA 5F2WA 3O1PA 4Y20B 5CG9A 4P14A 1RUI2 4QPIB 1J1LA 1UPIA 2ZA9A 4CEWB 4CCDA 1W6NA 2CNAA 1SBDA 4D94A 3AMHA 1NA1C 1QHDA 4UW3A 4XF4A 3VKOA 1SDWA 1Q56A 3WNKA 2A6ZA 2Y33A 4PHZA 5FZEA 4ASKA 2IVIB 2B45X 3RQ0A 3R6SA 3M70A 3L9JT 3PUAA 2A6YA 4N43B 2MNGA 5FCCA 4CU9A 2OUJA 3BIEA 4COYA 4R8HA 4P02B 5JSRA 1Q8OA 2NZ9A 1RL3A 4XFIA 5FPZA 4YG0A 5IWFA 4XFCA 1U0AA 1O5UA 5DDJ1 4OZXA 1HJFA 5CFCA 4HN1A 3VBSB 4CZSA 4JGYA 1YFXA 2XWBB 2VZ3A 4WM8B 4Y1YA 4AQTA 3NWKA 4NHKA 1W8HA 2R061 1UMHA 1VAMA 1S4CA 1ZZ8A 4CCKA 4CCNA 3AJZA 5I8TA 1D0GA 2CYFA 1QJZA 1I6XA 3VDAA 2RS52 3ZN5A 3DXUA 4UT5A 4WVMB 1DGWX 2XVKA 1OVPA 1RVF3 1PGW2 1VB2A 2O14A 5EQUA 3LDKA 5LY2A 4CP0A 3SITA 2ZAHA 1BYHA 1XOYA 4H7LA 1RUH1 1MS0A 2WLQA 5FBZA 1QH7A 2PAEA 4Q0QA 2Q4SA 4AVVA 4ES9A 5CFCC 1I1EA 4AHWA 4JGYC 2D6MA 5D1IA 1OA2A 3WVJA 2D6PA 2XH6A 4W6WA 3U07A 3R4SA 1ND2C 3T09A 3DXTA 1LOFA 1RUC3 2YHJA 3FWEA 4YGDA 3WF4A 4Y3OA 3NNFA 1ACCA 4CDWA 4LO7A 3VBUA 3WOGA 1PK6A 5BV6A 2AENA 3VBHB 3FZ3A 1F35A 3ES1A 2P1BA 1Z7S2 4CUBA 1KEXA 4PCRA 3SMHA 1LTEA 1LCLA 3H8UA 1ZBA3 2ZJCA 5JZGA 3KV5A 2VL4A 3UKNA 1AR72 1TE1B 2B9UA 1BBT1 3AMQA 3OJBA 4CDUB 4E8DA 4EE2A 2AUYA 4AI1A 3RZHA 2DU1A 4IXLA 2PELA 1CPNA 4MXWB 1APNA 4Q0UA 5ABJA 1IPKA 4F7ZA 1LOFC 3I7DA 1XNDA 5CVRA 2DCZA 4KGGA 1STMA 1AR63 1R64A 2A7AA 3LF7A 1F4HA 1BLZA 1FXZA 4CDWC 3RSJA 3VBUC 1PK6C 1W9SA 4AHZA 3B01A 1WCDJ 3X29B 4AXOA 5JVVA 2PHRA 5T5PA 2YFUA 4JTOA 1R091 3ACIA 1W3XA 2QQMA 4KU7A 3PJYA 4Q4Y2 5IVVA 1C28A 1W0NA 5JZGC 2AR6A 5FYTA 2O8QA 4IEVA 4ZU7A 1EP0A 3HN3A 4MVTA 2XR4A 3AKRA 4MSVA 3TBDA 4BK5A 1W6MA 1UCXA 1OD5A 3WEZA 5AC93 4COUA 5FZ3A 5J7MA 4UXAA 2VCCA 5EJ3A 1S0IA 4EN0A 1BHGA 1RB8G 1AR92 1RUD2 2XLAA 1AX2A 3TRSB 2HWB1 5JCTA 1BK0A 2LTNA 3E5UA 3GZTB 3O0VA 3JD71 2O8OA 1PMHX 4CUGA 4YWAA 2WRAA 5JMCA 3I3QA 2BZDA 4P5YA 4ASLA 3CNAA 4MYEA 5A32A 5BNOB 4DXRA 3FL7A 3ZVXA 1RMU1 1HB2A 2VOTA 4CE8A 5EHDA 1NCQB 4IEWA 2VXJA 4K7JA 1YWKA 4LBQA 1DDLA 4XDQA 5EJ1B 1PVC2 3UKTA 2HWF3 3ZSKA 1OXCA 4IERA 4HZFA 5G05L 2FQPA 3KWVA 1AL23 2RR12 5CIRA 1K5MC 2VULA 2Z69A 4GWJA 3VBRB 3ZO0B 3ENRA 3UNPA 1VBA1 2HWC1 4IV3A 4HVQA 1MZFA 4QXKA 4NIAA 2XQXA 3AMMA 4KWKA 4QXCA 3WSOA 1Z78A 3J8F2 2RJKA 1DGRA 2JB8A 3J4UH 1VLNA 1F8VA 3ZFEC 1QQP3 5T55A 2KM2A 4Q4W1 3PVEA 4XQWA 1LOCA 3GGLA 1RGSA 2D5FA 2J1UA 3D6EA 4W65A 2HBTA 3ZYHA 4UOJA 2HBUA 2W87A 1J58A 4IV3C 2WNVB 4LQRA 1EY2A 5EPAA 5FMOL 3RI8A 4R9CA 3UT0A 5B4NA 3HNYM 5FPLA 1GP4A 3C3VA 5KXEA 1RUJ2 1UIJA 3ZN6B 5A3WA 4FTBA 4XETA 2GP3A 1HJGA 3MBWA 1ENRA 3VKFC 4TLGA 2GMEA 4YGCA 4DUVA 3ZMOA 3WG4A 1HXS3 4CU6A 3PVOA 5L73A 3SCHA 5C7GA 2QQUA 1GU3A 5HCAA 1W6PB 1RUG3 4YSFA 1JS9A 1WMEA 1BCXA 2CWSA 3GXUA 2R16A 3DKQA 2VOWA 4URAA 4XF1A 1YFUA 3N35A 4RHV1 3AYEA 3POJA 4OI2A 1PNFA 1YQCA 3B9CA 1I9RA 4UW4A 3E6BA 5LBEA 4LPLA 3VKLA 4PF5A 4FPLA 3TEWA 1LGBA 5C3QA 4H55A 5C71A 3W5MA 1WGPA 5FZ1A 4YZ3A 4IV1C 3Q8FA 4FQ4A 1ULOA 5FFOC 1S0DA 5HXVA 3RG0A 1LECA 5FZ7A 3WG1A 2ZBJA 2ZEYA 4A2UA 3VL8A 4HL0A 4A7ZA 4CVUA 1DBNA 5ACA2 3V0AB 1LHWA 1S55A 1S0JA 4AHXA 3JQXA 2NPIA 2VC9A 5DAWA 3NVCA 1NAEA 3AZYA 4IW3A 4N90A 3AYDA 1AYN2 3J7HA 4C91A 3POEA 3KV6A 3OUHA 2C9KA 3LA7A 3ZFGA 3S5AA 3B02A 3VLBB 1RJ8A 2C26A 1UO9A 4NOTA 3THCA 2YG0A 4E27A 1GYKA 4CSWA 1OQDA 1T6BX 1OOPB 2QQIA 3FFQA 3VB9A 5I8YA 2DVGA 3S30A 4PT6A 5E1RA 1NLQA 3WUCA 2JG9A 1FYUA 1QJEA 3AXDA 2IUWA 1W03A 2VAUA 3MIBA 5FYSA 2V5YA 1XBFA 5F3CA 1G6NA 2GC0A 5DQ0A 1JBCA 2EA7A 4XDOA 4A41A 3ON7A 1IPJA 2UYAA 4LKSA 5DUWA 1QY4A 3BVCA 3WCRA 5LCWL 3HD8B 3IAQA 4DNYA 3LD8A 2JEMA 2ZX2A 4XABA 3T3YA 5J3UA 4FPOB 4ZONA 1SG3A 1W9TA 4ZY9A 1YLLA 3H9AA 3AP6A 1NZIA 3WHTA 3U1XA 3U37A 2BGOA 2BNOA 4BXSV 4YVWA 2BJSA 1X8MA 2TNFA 1WW5A 2Q8EA 4AHYA 3B94A 1RVF1 2Q1MA 2OQ7A 3AB0A 1FMD3 1X82A 3KV4A 3M1HA 4HXCA 4J6GA 4LORA 3MEPA 3ZXJA 5JOZA 2Q5TA 3I54A 4QXBA 3AFKA 3WNXA 2YYOA 1W8TA 3O14A 4V1PA 4I02A 3IZOA 5BPXA 3MIGA 1UYXA 1V6LA 4YM0A 1XRUA 2ZEZA 3JBG2 3HNMA 4DXSA 3OY8B 3TEZA 4UWDA 4N53B 1RUC1 1PX3A 1ODMA 5FIXA 2H0BA 1EAH3 2XJVA 5FQ0B 5L9BA 1OFSA 1X8EA 4MO3M 4XFBA 1WCKA 4BH9A 1SLLA 2WN3A 4GB33 4IGQA 4LLFA 1RUF3 3WUDA 2FBEA 5DZGA 4AEDC 1UW8A 2OA2A 2XJPA 3ECQA 2DURA 4XF3A 1VBE2 1ZBA1 4Q4X3 3U75A 2RE9A 1ZA4A 2H6BA 2YB7A 2FHRA 1N3PA 1DQ6A 3O12A 4FFFA 4M3CA 3QD6A 1S0CA 4NIIA 4NPRA 4XMAA 5KHJA 3AKPA 5CB7A 1AR61 2HWD3 2Y6FA 2QVSB 2OKXA 5FYIA 2IWGB 4BE3A 4XQDA 3AZZA 2D3RA 5L7OC 4UW6A 1NX9A 5LZ6A 2RHPA 4FP2A 4HLTA 2CV6A 3VD5A 2PHDA 2XJQA 1FOD1 2GC3A 2V72A 4LE3A 5D8AA 5KHKA 2RDNA 4I30A 1LHVA 3LSEA 3ORJA 4DRVA 2YFZA 4D7SA 1BEV3 5AC91 1WMDA 1UXXX 2ZGSA 1AVBA 3F2ZA 4XZUG 2RJLA 3OYWA 2QQNA 2XG3A 1F5FA 4Y4RA 1PGL1 3IKWA 1R082 4HSJA 1LJ7A 2R1BA 1LEDA 1TQ5A 4RS5A 3WW1A 3O1SA 2XVGA 2AEZA 3ZXKA 2MPFA 3BTXA 1NZCA 2DYCA 1RHI3 3E97A 1MEC3 1HN1A 3PUIA 5FWEA 2DUPA 3SXWA 3ZXGA 1SCSA 2J7MA 1OH4A 1KXGA 2A6XA 2W47A 3M3EA 3KT4A 1IPSA 2RMU3 3WDVA 2WNUB 2VZ1A 3L2HA 2XJUA 3NAPA 4H2AA 4YRDA 2GH2A 3VKNA 1CJDA 2HWF1 3LOBA 4IE7A 1NE4A 3ZIXA 2DBIA 3QBQA 4RS5C 1UYZA 3EO6A 1EV12 4AYUA 4CCOA 4X8NA 5A70A 4QB6A 2VUDA 1OA3A 2QUOA 2JDAA 1PGSA 4YW6A 5C9AB 1C3HA 4HBNA 5DG2A 1JYVA 3TWIA 1N3OA 4QX1A 2JX9A 2EXJA 1ZZCA 3NAPC 5I0RA 3OD0A 3UGGA 4HPKA 4Y22A 4P9XA 4LIVA 4NMIA 5JI7A 2Q30A 1SHWB 4M0HA 2VCMA 3MIDA 3RYKA 1QQP1 3NMBA 5GKAC 4RR3A 4TZDA 5FYVA 4XPVA 1QMJA 4CDQA 1DFQA 5BNNB 4CP9A 3BOPA 3Q8CA 3CJIA 5KC6A 1CAWB 2QCSB 5FP3A 5IK5A 2KD7A 4ZS3A 1AL0G 4HOOA 3ZXLA 1W90A 4PIZA 1AJOA 3CDZB 1O5LA 5JUVA 3IWZA 2W08A 3I2IA 3EBRA 5I0UA 4LKFA 5LBFA 2WZR2 2P3YA 4BQYA 2Z2SB 4AZZA 5IK8A 3TYJA 4XUPA 2DCTA 2R0FA 4RR3C 2BU9A 4RFRB 2PLV2 4QAWA 4XAAA 3KS7A 1HXS1 4UBGA 5GJ6A 5T5LA 1RUG1 4EN8B 2R1DA 3LE0A 1PM4A 3J9SA 3GBWA 3O5SA 3ZIWA 3ZN4A 4A6OA 1UZ0A 2BWAA 4XIKA 3FMGA 1DQ2A 3D5OA 4LLOA 2XB6C 1JYXA 4KH9A 1REEA 2Y26A 1D4M2 1CZSA 2YBSA 3KQRA 3EXUA 2WQZC 1H30A 1OFNA 5EP9A 4ZHNA 1JOPA 4ITCA 5CA6A 5FZBA 4Y5Z0 3WW3A 4LE4A 2R043 5CKNA 4MGIE 4A7YA 2G9ZA 2JIJA 1F9KA 1DLCA 5A3NA 3IPVA 4CXXA 4OVEA 5LBBA 4J1WA 1ULDA 1H9WA 3POSA 2QFEA 3N7KA 1O3QA 3P3NA 2Y0IA 3AMPA 4HANA 5SV8A 2QDNA 1R1ZA 4D6SA 1XYOA 1XC6A 2YC2A 2BDRA 4CEYC 1V6JA 4WZFA 1AXKA 2RVAA 2ZHKA 4E4ZA 4Q29A 3CJXA 5JWPA 3VHOA 1YHFA 3VDCA 3MLLA 4LIUA 1OLQA 5FKBA 2BFUL 3I2GA 3BU7A 2TEPA 1LU1A 4QX5A 1X50A 4AGVA 2NP0A 3A0NA 4LBQD 4S2HA 2OW4A 1H2NA 3UETA 3JU9A 2XLFA 5LASA 1CAUB 2R30A 2X5IA 1DGLA 2WL1A 2HKXA 2D97A 3EHKA 5HI0A 1LRHA 2JG8A 3KHCA 4IEOA 1RUD3 3VBFA 1W04A 4CRQA 2XJRA 3C2UA 2SLIA 4GQ7A 5FPXA 3OGJA 4MLOA 2XVLA 2WINB 4I3GA 1RINA 1XE0A 1RC6A 3ROUA 1UY1A 4K21A 5A6ZA 4R9DA 4XILA 4Z07A 4EN7B 5JOXA 2LS6A 4YYOA 5JXIA 2AYHA 2R072 1BXHA 1ASJ3 2X5IC 1OHFA 1W6MB 2W92A 4MH0E 5DZEA 5A7WB 5FLIA 2JG8C 3AM2A 2ZKNA 1W9YA 1RUE3 3IT8A 2GDFA 3M3QA 4IEQA 3AMNA 1YXWA 5CADA 3MDPA 5FPUA 1JHNA 2B4KA 3FHIB 5C3OA 1EAH1 1GZCA 2RR13 2VCAA 4WVWA 2UYBA 4X6QB 1DGRN 5FTTC 4GB31 1UAIA 1V0AA 2YZ4A 3HT1A 1RUF1 1COV2 4FPGA 5LY1A 3GDBA 2XWJB 3ACLA 4P00B 3AZVA 2QKDA 4Q4X1 1UY2A 5BYNA 2WR9A 3C7EA 3WDWA 4O9EA 3JCIA 2PMWB 3VHRA 1TMF2 2ZGRA 4NRPA 4UI9L 4FOVA 2GMMA 1GMMA 2HWD1 1H1MA 3ES4A 5T54A 3NL1A 5CU1A 3H3ZA 1LHOA 1GUIA 1YCIA 2A6WA 5IK4A 2JE9A 3O1RA 1XSRA 1AR82 1HDKA 2VNRA 4XC9A 2HJIA 3O7OA 1IZ3A 1DF0A 3LFMA 4OI1A 4B3NA 2Z4FA 4BDVB 4YM1A 4BQ3A 5CKMA 1RUJ3 3N7JA 2VBBA 4D69A 2P17A 4YZ5A 3KV9A 4O9GA 2VBDA 2LALA 3GJBA 2F17A 1BEV1 4YFZA 2VM9A 4Q2FA 1ZBE3 2IFRA 5K0UB 2QZ2A 1L3JA 3ZKUA 1PM7A 4E4HA 4LBLA 1QJU3 3QLQA 1ZA7A 3POYA 1O4YA 3PUHA 4OUMA 1EPZA 2VH9A 1GOGA 1NYWA 2VMIA 1QNYA 4WBBA 5IVFA 1RHI1 4RGKA 1BMV2 2RS31 2VZSA 3WCSA 5KHIA 3U10A 1MEC1 4RQPC 4NROA 2VQTA 4AQSA 3PJQA 2ARXA 3SEPA 3AP5A 1U5XA 2DCYA 2A1XA 5I0TA 5FP4A 3JZVA 1UU4A 3LGRA 2LM3A 3FUQA 3E1F1 1YJLA 4XJZA 2BNNA 2E7QA 4JRAA 4XCBA 1OQEA 1TVGA 2GNBA 2HWC3 3VDDB 4COZA 2QBXA 2Y60A 4IGOA 2HH9A 2DCKA 1AXYA 1D0HA 3TB0A 4B1LA 3ZM8A 2JE8A 4DS0A 3BKZA 1RUI1 1OPMA 2WA3A 4NAOA 5DAVA 3S6PA 3FFZA 4I3PA 1CVNA 2ZTNA 3K75B 2R0HA 4P08A 4MHRA 1W2UA 3R4DB 4LXLA 4N53C 1W6QB 5A1AA 5I0DA 5CFDA 1EPWA 1XU1A 2J22A 2OZ6A 5BNPB 3ABZA 3B5LB 1KDKA 1N1YA 2DCJA 5DXDA 5EZWA 1TME2 3A23A 4QX7A 1MR5A 3W20A 1CQ9A 4AE2A 3BB6A 5HBAA 2RM23 1J83A 3WNMA 1RUNA 1AZDA 4IETA 1SFNA 5LEJA 1W99A 4XJUA 5A7PA 4YM3A 3O1UA 2VZPA 3I4IA 1ULPA 1YYNA 2VNOA 4F3JA 4UW5A 2XMLA 1N1TA 3ZMNA 1FV2A 1TG7A 3WV6A 3JUUA 2CTVA 1Y43B 1POV0 1HRI2 3EB7A 1IS5A 4AVSA 4JVAA 1JI6A 5C8CA 4FTSA 4B4PA 1K45A 1ULCA 2VTFA 2BGPA 3AK0A 4LMFA 4QDRA 5C70A 2Q1FA 3DPRB 4WVVA 4CPBA 1G8WA 5JOWA 5FDBA 1B35C 2VMFA 2YPJA 4N9HA 1MS3A 4XOGA 4B7KA 1HB3A 3T2QA 2D3SA 1C8M3 4K20A 4BHPA 2XJSA 1LODA 3QH7A 4W4ZA 1Q8SA 4AQ6A 2IXJA 4NPLA 2R041 1GZWB 4K1YA 3T30A 1UMZA 2E63A 4YVWB 4P9JA 1A3KA 2E33A 2RG4A 4Y1UA 1UZVA 4I0BA 5C4WA 2EVXA 1P8JA 3I2HA 1VBE3 5JXJA 1RXGA 1MQTA 2WNUC 3R0RA 1UOFA 3RS6A 2JECA 4JGZB 4AK3A 3T08A 1IGOA 1LOAA 5FY9A 4J1XA 5CISA 1DZTA 3M8LA 4K1ZA 2WS93 5AVPA 1JXNA 3AL6A 2I74A 3HQRA 4XYXA 4ARYA 4CUCA 4EYUA 4BQ4A 5JAXA 4KNCA 4I2OA 1SMVA 3N9OA 3G7DA 1QJY2 2J1SA 1W2OA 1X7NA 2VW2A 3MPPG 5C4WC 5ISLA 2ARAA 1WBFA 1YIPA 3V0BB 1IS3A 1DQ4A 2YXSA 3W21A 3M3IA 1HB1A 1MQTC 2PYTA 2GNDA 4XHBA 1H0BA 1AX1A 2WT0A 5EYXA 3IBMA 4NJ4A 5H9QA 1VP6A 4DUXA 5I0SA 1ND2A 2CSGA 3BCWA 2YBPA 4M4RA 3S5QA 3HJRA 1RUD1 1XSQA 1US2A 5ANQA 2DF7A 4ZS2A 2K46A 3BPZA 1KJLA 3KD4A 5IVBA 2WAOA 1OLMA 1NXD1 4IEPA 2VCBA 3N36A 3OEBA 3IMMA 3TN92 4H3WA 2QQPA 2DVFA 4ZU5A 2YV8A 1OD3A 1YNAA 2FZ1A 2JWPA 2YGMA 3M2MA 5J1XA 4OZOA 5FZ9A 4AVAA 1MZEA 1ASJ1 3D0SA 5C8CB 2P2KA 3GHMA 2E9QA 2YY1A 3J7NA 5FP8A 2GC1A 3AKSA 5JR2A 3ALQA 2AC1A 3SEEA 1RUE1 2BERA 4H7MA 1HRV2 1WCSA 2WFF2 2F4PA 1NUKA 3AC0A 1LHNA 4NWWA 3AYCA 5F39A 4COVA 5C8WA 1G9AA 1ZRCA 1UXZA 3UK9A 1EV13 1ULEA 3KCYA 5FZCA 2BGCA 2RR11 4A3XA 1DYPA 3WP6A 2Y6GA 4UFJA 4RGAA 2Q8OA 5JPNB 2IXHA 4QQPA 4Y5TA 5FLJA 2YU1A 2W46A 3BTYA 3KCCA 4YW2A 4BJ0A 5JR7B 4LO6B 2E51A 2QQVA 3AJYA 1QXRA 5GLWA 1VAKA 3ZYIB 1FPN2 5A7SA 4G3YC 2JE7A 3T2OA 2YROA 2J1VA 3IAPA 2W52A 1XQNA 4CP1A 2WC2A 5FMOS 2JD4A 3BN6A 4OHWA 1I3HA 1ZYBA 4XUOA 3SH5A 1FOD3 5A3TA 3WQ0A 1J3PA 1URXA 1PIV3 2J42A 4XMIA 4N7UA 3RJRA 1GQHA 1RUJ1 2FZ2A 3MW3A 1OF4A 4XBLA 3A22A 5FOJB 3MF9A 2B8MA 5T3NA 2P3JA 1H2LA 1Q8QA 1ZBE1 2PLV3 1FT9A 4CDQB 2WBKA 2DTWA 4QB2A 3EQEA 3FE5A 2BWCA 3C7GA 4M0NA 1VBC2 3RNSA 3ZSJA 1K5MA 1VRH2 2QE3A 3I3EA 2W0XA 2MEV2 1QJU1 3IDCB 5FUNA 3N9NA 4RA0A 5DDJ2 2VD7A 3GYDA 3D8CA 3A7QA 4QKBA 1RTVA 2JDHA 2PQQA 3DN7A 2FDFA 1CZVA 3ACGA 3PIGA 2SBAA 2R062 3A4UA 5FKCA 4FTEA 1O3TA 4YW1A 1MS5A 2YUEA 3U78A 3ZFEA 2ZS6B 3Q8BA 1W05A 1OSGA 4UF0A 4LBOA 2I45A 4ZXEA 1UZYA 1YQ6A 3KHBA 1RUH2 1DLLA 1HIXA 4BQXA 5I8SA 4DY5A 1S2EA 3ZYJB 1ST8A 4AFMA 1U5ZA 1UKRA 3MFAA 1W2AX 1O4TA 2ZGOA 3UV9A 5A33B 1MS1A 1DGWA 1AXZA 5FYCA 1UKGA 5H9SA 4DIQA 1AF9A 4LOSA 3OBRA 3ZXEA 4JKLA 5K4LA 1FX5A 5FP9A 2W9XA 1ENQA 4GMP0 4OMDA 5FYHA 3WX5A 5A6YA 1UYPA 2ZMKA 1ZRDA 3T1LA 2K9ZA 1BBT2 4AWDA 1GZ9A 3DL3A 3H7JA 4Y1VA 2ZHMA 3OPTA 2VQUA 4QQHA 3NJZA 3OD4A 5JIUA 1JYTA 2RM21 3A21A 4CDXB 3E5QA 2ZGKA 2WO3A 3NKTA 3DKWA 1YQ2A 1F5JA 2AH2A 2DDUA 3IDEA 3LCPA 4LKDA 4YVSC 1SPPA 3OF1A 2PFWA 2WZPP 4JC1A 4IV1A 3CU7A 3VD9A 3LOIA 1H2MA 5FY0A 2D6NA 4P9WA 5FZOB 3WR0A 1JZ2A 3HR9A 3RZGA 2VOKA 4OI0A 4AFCA 3D4KA 1UZWA 1SFYA 1JZ8A 1I5PA 1OVSA 2CAVA 2X09A 1S2KA 1CZTA 1VB4A 5IAVA 2HWB2 1K12A 1CESA 2VBPA 3VBFB 1C8M1 2ZGLA 1JYNA 4P9LA 3INAA 4WM7B 4Y1XA 1YRZA 2Y6HA 2IXKA 1WA6X 4LBNA 1Q8PA 1RJ7A 1WUVA 5E6HA 1U5IA 3O1OA 1XNKA 3ST7A 1LNSA 1A78A 1RMU2 4GH4A 3ZPYA 3SISA 1KRIA 1C1LA 1PO22 2HEYF 1UY4A 2W39A 4PDWB 1H1IA 5F6LB 1VBE1 3WT3A 4HK8A 2ZEXA 4YNIA 1PX4A 3OSDA 3NQHA 2R6QA 3P3PA 5JOYA 4V2WA 3E5XA 3WD5A 4HKWA 4TSVA 4AEKA 4EWAA 2WO2A 1S0GA 5LA1A 4XVHA 4TWTA 3VDDC 1VBA2 2WS91 1XNAA 2H0VA 2L9LA 4LHSA 5DUVA 3WZ1A 5FXZA 1KFXL 2AACA 2FCUA 4FXKB 3WW2A 2FDJA 3LPFA 3H7YA 4GH4C 4HVRA 2CWMA 4M4PA 4PLMA 5CG8A 4HK9A 5A3OA 1A34A 1EUTA 1RYYA 3THDA 4YZ4A 1PNGA 3VBOB 1FI2A 2NLRA 1DQ0A 4Q4W2 4DY3A 2G4IA 1XB9A 3T4VA 3HIFA 4LBJA 3TAYA 1S0FA 1S0BA 5BXXA 3W58A 3ACFA 4META 1UX6A 1G9FA 2YPDA 4YGEA 1HQLA 4XFFA 2XBO2 4Q8LA 4RSUA 4AF9A 4BLJA 4JCKA 1OPOA 5CAZA 4NUBA 4AEDA 1UOGA 5IVEA 1QJX3 1J59A 1H1AA 2VTXJ 1JU4A 3KGZA 1HV0A 1J3QA 1CIYA 4LA3A 2BVBA 1W6OA 2VOVA 4OHVA 5FPVA 4LUKA 4PQQA 1Q8VA 1UNBA 4PBOA 4SLIA 2LUWA 3ATGA 2E6VA 4IL7A 1O6UA 2DVAA 1CX1A 3H8XA 4HT1T 4IESA 3MZHA 4IEXA 2B7YA 5DZFA 1ND3A 4UFKA 1NQDA 1F31A 2E7TA 2WJSA 4IEYA 5L7OA 3SNMA 1OF3A 4Y20A 3WQ7A 2EIGA 1A6CA 1EV11 1GV9A 4QPIA 4RHV2 5FY8A 2IFWA 2Y38A 1HB4A 3M4FA 3F95A 4N9IA 5FO9B 1VBD3 3WF0A 1PO12 1IOAA 1KJRA 3BUCA 5FR3A 3HEIA 2GALA 3I59B 1JZ7A 1UIKA 1Y9GA 2NMNA 4E2QA 3WG3A 3PURA 4OUSA 4XUNA 1PHMA 3S0MA 3CMGA 3PU8A 1LKNA 2WZ8A 4IE5A 2ORXA 4QHOA 3RMYA 2W91A 1ND3C 4N43A 4XQ4A 1WLTA 4CPBD 1L7QA 5FUIA 1H6YA 3NNJA 4BLIA 1XU2A 1H8TB 4QPIC 4R9AA 4CEWC 1V9U3 2NQYA 4YG3A 5LRRA 1CAXB 1NOVA 1TME3 3D0JA 4RYDA 3ZKYA 2VVFA 3MICA 3AVRA 1IQDC 1PIV1 2GP5A 4K8FA 2IXCA 3RDIA 3PTYA 3VBSA 4MG2A 4JGZC 4ISRA 5IJRA 1HN0A 2PHXA 4QWNA 3ZDVA 4BISA 4Z8BA 2VMHA 2WSVA 3PUSA 5FOBB 1C8NA 4LOTA 4QPGB 1YI7A 3ILRA 2UU8A 1ALYA 1S1AA 2GMPA 5FRAA 1QDCA 2XLGA 4N43C 1HW5A 4WVMA 4PJYA 2PLV1 4JRLA 1HRI3 4BPZA 4IDZA 2WSUA 1AYM2 3S7EA 5DUXA 3MW2A 4AVTA 2RS33 1SDDB 2RS13 1N3QA 1NCRB 2ADDA 3R05A 3LEGA 4ISQA 2ZX4A 4QKNA 1ZVFA 2C0ZA 3KF5A 4LTAA 5F5CA 3VBSC 5AFBA 2ZOEB 3IIAA 4YW4A 1GICA 3HAGA 3KLSA 5A3LA 5FY1A 2HWE3 1SLTA 4WM8C 1H8VA 1WD4A 3HBZA 4AI9A 2B46X 2D5HA 2WNOA 3AXEA 3CLPA 5F5QA 5JXGA 1V6MA 3FLRA 3VZLA 3AP9A 1YO8A 3ZFFB 4SBVA 3T4HB 2CDPA 3VBHA 4Q4V2 3DECA 1RVF2 1W8WA 3UGFA 1NXMA 1GANA 2UWAA 4A42A 1J1TA 1RUI3 2QZ3A 5FZKA 2QQJA 5JIAA 5F8PA 2VZQA 2Y6JA 4CDUA 3FLPA 1NA1B 2WABA 1O59A 2GH8A 4MXWA 3N9MA 4TLFA 2O0OA 2DBNA 4Y4YA 4YGBA 3G6JB 5I93A 5C5UA 3BI3A 2BPA2 1QGLA 2WNEA 2FDGA 2GU9A 2W1QA 3VBHC 4YARA 3PU3A 2ZKLA 3HOBA 3H1YA 3ZYGA 1MZ6A 2BFUS 5IFPA 4MADA 4F8AA 4YW7A 2WUHA 1QJY3 1G9DA 4CDUC 1W6NB 3P6BA 1W8OA 1NY71 2IXLA 3CEWA 3GNEA 3IDBB 4DINB 4EWDA 4NIDA 3U4SA 3WF2A 3ZSLA 4OMCA 1X33A 3CIHA 4QQLA 4DRRA 2W5FA 5IVCA 1LAJA 3ME2A 1O3SA 3IDAA 1QOSA 3HQUA 2RS53 1UU5A 1YEWA 4PQ9A 4R4XA 4L0PA 3M3OA 4QQ2A 3N7LA 4Q1PA 2OZJA 1OC1A 5LW9A 1T2XA 2Y8KA 3ZSMA 5CNAA 4D6RA 2FCVA 5BNOA 2WQ8A 2ZHNA 2JDPA 2ZGMA 3RI9A 5CFCB 5AC92 4P9GA 4XACA 2OS2A 4JGYB 4GXLA 5L9RA 3RZJA 3RWKX 5GZDA 4NR1A 1F2NA 5IUQA 2P3KA 5GLVA 5IK7A 1CPMA 3VZNA 4CEYA 1TNRA 2HLEA 4GIQA 4K8RB 4NN0A 1NLSA 1N1VA 4GALA 2AZ5A 4EROA 3VBRA 2XL9A 4YLZA 1Z7S3 4KI5M 1QEXA 5BNOC 2C24A 3I2JA 5E88A 4EJRA 1MVEA 2ZHLA 1AR73 3GM8A 3H50A 1NCQC 4AGGA 3BU0A 3CKHA 3I49A 4XCAA 3NO8A 3SKVA 1SQ4A 3FBYA 1W9WA 1AJKA 1NE6A 2LRPA 3H3UA 1C5HA 2HWF2 4AFDA 2QJVA 1UL9A 2Q8CA 2ZX0A 2BEOA 4L9BA 2E32A 4M00A 1YUDA 2D6LX 1OUSA 3VBUB 4CDWB 1PK6B 1AL22 3LIGA 3VBRC 2ZZJA 4DZGA 3T0DA 4KWUA 3VUOA 4JHTA 4Q4Y3 2WNVA 5E8AA 4BQ5A 3ZXFA 1GNYA 2Z5WA 3D82A 2G9GA 4HSLA 5JMOA 5JZGB 1XYNA 2A70A 1HQNA 3K4DA 3ZN6A 3PDQA 2PXJA 1E5IA 2ZGPA 3RVHA 5ABJB 3MFCA 5IFTA 4UFMA 4WVZA 1QDOA 3PL0A 1QQP2 2WLPA 5GZEA 1AR93 5FP7A 2FDKA 5FZAA 4B1MA 2JB4A 1H2KA 4BB3A 1OT5A 1W6PA 4DOUA 5E89A 1CX4A 1VBC3 2WNVC 4M3CE 5CEHA 1VRH3 2IC1A 4ET7A 2MEV3 3OCPA 4JV4A 4FOQA 4XFAA 2ZACA 4KQ7A 1LU2A 3WY6A 2UY8A 4HMZA 5JXHA 5D21A 1QJX1 3KB5A 2WWUA 3SHRA 1C4RA 4BQWA 1REDA 1JYCA 4FCAA 3B3QE 5J98B 1PVC3 4MZUA 5FO7B 1BVVA 5FUPA 5HCBA 1JZ6A 1HXS2 1LOBA 3T0AA 5DAXA 3AYAA 4C0HA 3AX4A 4B8EA 3LEKA 5C6CA 1RUG2 1D7PM 4S2DA 3KQ4B 4FFIA 4P9IA 1OI6A 3DV8A 1K5MB 3B93A 2R49A 3FUOA 3RMXA 3O1MA 2GSYA 3WINE 3P5BA 5A32B 4LA2A 3VHPA 1V00A 4B4QA 2VU9A 1VBD1 3DCQA 1NG0A 4LBQB 3VHNA 3J8F3 1VMFA 1OURA 2VOXA 4CTEA 1V6NA 3C8XA 4XFHA 1YJKA 4DEQA 1DU3D 3ZFEB 3SC7X 2DWRA 1SBFA 2XJTA 4INDA 4QX8A 4ZPIA 2XPJA 2JENA 5KWRA 4UF0B 2BQPA 2V4VA 4XBNA 2JKXA 1OOPA 4XBQA 4EV0A 5JSPA 2XKOA 2YC4A 3NKGA 5FPBA 1U5YA 1QXJA 2XGXA 4Y1ZA 4IV3B 3BTZA 1W8NA 1RXFA 3N3HA 5LATA 5LK5A 4IQPA 5F3EA 1V9U1 3ZOIA 3WW4A 5GM0A 1MVQA 1TME1 4RQPA 1VJ2A 3O0XA 2DTYA 2WT1A 3K3NA 4R52A 4YZ2A 2A73B 1DHKB 1DP0A 2ZGUA 2IVJA 2CGPA 1SLBA 4MGYE 1E5HA 3BGAA 2Y34A 4AW7A 1VRBA 5F1RA 3RZZA 1A8MA 2JDYA 1JTZX 2JKBA 3NV4A 3OBTA 3WLUA 1OOPC 3WNNA 3MUY1 4D6QA 4HG6B 2W1SA 2RDQA 1V6OA 5JDBA 1HRI1 4IE4A 1DIWA 5A7NA 3TNQA 5H9PA 3WDUA 2C4XA 4XW3A 5FJHA 2RS11 3NV2A 4OQ9A 2VW1A 1LESA 2FMYA 5KXCA 4I01A 4KWLA 4A6SA 4GKYA 3I2KA 1YQ5A 3VBOC 3ZLIA 3HT2A 2OX0A 2UWBA 4UAPA 4Y26A 5HCFA 4LNVA 4B7EA 2XDVA 2WZEA 2XHNA 5FZDA 2HWE1 4JDMA 3OY8A 4MV2A 4BIFA 4N53A 1GOFA 2ZABA 1U12A 4GJYA 2PTMA 5SV5A 1T6GC 5K8SA 4I09A 3S57A 3DUIA 1Y3TA 5ACA3 1FNZA 1PZ7A 3RZLA 4Q1RA 4FPCA 4YW5A 3HQXA 1FMD2 2ID4A 2YMZA 1XE7A 4MHUA 2Q8DA 4YZ1A 1ZZBA 2QQOA 1PO23 1AYN3 1X9PA 2XUMA 3RZKA 1FATA 1REFA 3HN1A 2KA3A 1WA4A 4AR2A 4QPYA 2EF6A 2A3XA 4CCEA 3VD4A 3ILNA 3BALA 4E2GA 3Q8AA 2DUOA 1F15A 1R1A2 4U36A 4XAEA 3UJOA 1EAH2 3W5NA 3DYMA 5DPNA 4TTGA 2B9VA 1C1FA 2QQLA 4OYUA 3VZJA 2ZMNA 3KMHA 4GB32 3GHNA 1CWPA 1RUF2 3POBA 3ETPA 4YG6A 5E16A 5I91A 1JYWA 2VVEA 1QJY1 3V64A 2YBKA 2VPVA 3GF6A 1B35A 1PZ9A 2VO5A 1KDMA 3LDRA 3ZFGB 1JZ4A 1MS4A 4A44A 3GZEA 4ZKTB 4ZU4A 1POV3 4FPFA 4NE9A 1UN1A 5KC5A 4AAXA 2VMDA 3EJKA 3DEMA 2RS51 4EZHA 4JTNA 4JQRA 2JG9B 1LB2A 1UY3A 4AI8A 2PHFA 1PGW1 2QDRA 4FOYA 5EJZB 3TN91 1Y7BA 1K3IA 2WNUA 3CZUA 5J36A 1BEV2 3RYPA 2LROA 4OHYA 3ZX7A 3JBG3 4QPGC 2ARCA 5FWJA 2TBVA 2X8KA 2DFBA 4FPHA 4FAHA 3LQCA 1UZZA 2GN7A 3C7OA 3K4AA 1RHI2 4LITA 1Z7S1 2TUNA 1NCRC 1MEC2 1DYOA 1WKYA 2HEWF 4L8QA 4ORFA 1GWLA 5C9AA 4A7KA 1AR71 2RMU2 1KS4A 1LHUA 3HBKA 4XEZA 1JODA 2VZVA 1GP5A 2YGLA 5G04L 3NNGA 4AQ2A 4NIGA 1NLRA 1GZTA 1PZ8A 2EXKA 2VG9A 3GCWA 3JB8A 4XTMA 1JUIA 4NIHA 2GAUA 3OOXA 4L97A 4XTPA 3PMSA 3ZFFC 5BNNA 3OUJA 5HXMA 1OMIA 3FBMA 3J7MA 4NHMA 4XE9A 3UYJA 1OA4A 4BWOA 1IS4A 4AEMA 5L7OB 1LGNA 1BK1A 2JD9A 4TYSA 4LK7A 3BTAA 3NJXA 4Q4Y1 4XZPA 3KSCA 5C9AC 2ETEA 1LENA 5GLZA 1W2NA 5KR7A 2VMEA 3ZYRA 3IB3A 2UURA 3SH3A 2ORZA 3SH4A 4M3CB 1ZNPA 4PF1A 2C9AA 3C7FA 2JDKA 3AKTA 3KF3A 1HX6A 3BYWA 1VAVA 3I2DA 3K3OA 3RGBA 2PQSA 3WP3A 1AR91 1QOOA 5BNNC 1YFYA 5LRSA 1R083 2C5DA 5FLHA 1MACA 5IVYA 1JU3A 3ITQA 1AYM3 1VBC1 5FMCA 1VRH1 1LR5A 1YFWA 2MEV1 4A3ZA 3SCGA 3UL2A 2BNMA 3V65A 3POWA 5D8AB 3O1TA 1JHJA 2E31A 3JXSA 3N9LA 3U11A 2Z79A 1EYBA 1AX0A 4ZXKA 1DQ1A 1O91A 2UY9A 3M3CA 4ATFA 3I2OA 3OYWB 4OI4A 1W06A 2OUHA 1PVC1 1VBB2 1UPSA 3VDBA 4QKDA 3MIEA 4LHNA 1NKGA 4RS5B 2I2SA 1VMHA 4LO8A 1VMJA 4Q4V3 5FO8B 3AL5A 4QU2A 1PVXA 4CCLA 3ETQA 1WMFA 1LOGA 4A45A 2BBAA 2HYXA 5FREA 1SEFA 4ES8A 3WQBA 1C5IA 2EALA 1XXNA 3CBNA 3POIA 3VD3A 5K7PA 1S0EA 4LBKA 4Y5SA 1JH5A 2D7FA 1ZRIA 1WD3A 3NAPB 2RDSA 3HVDA 1SACA 4MGTA 5IT6A 3J8F1 1OLRA 2BYVE 2JDUA 2ZX1A 1SCRA 2W68A 3MI8A 4AVBA 1LOEA 2JDMA 2WT2A 3FHQA 2R042 4IE6A 2OT7A 2Y6KA 4AI3A 5FJKA 3GCXA 1QIQA 1J84A 1Y9QA 2W94A 4JKMA 3R4UA 4XJAA 4AI2A 3RZMA 2OQ6A 1WLWA 2A3WA 4HFSA 1SFPA 3JQWA 3MHZA 4FPKA 2ILMA 2OXBA 2VGDA 3L2YA 4KBBA 3Q9OA 5A7QA 4DB5A 4Q8KA 2KR2A 4EWEA 1CAUA 3OBZA 2P37A 4Y33A 2WZR3 4OQ8A 2ET7A 4HPKB 4PIYA 2EIDA 4Y22B 4PBPA 2JICA 2XXZA 5T50A 3QH6A 5DABA 2KXLA 1EUUA 5T5JA 4AAPA 5A1LA 5FZLA 4RR3B 4WZCA 3QCWA 4XIOA 4CP9B 3CJIB 2BVVA 4D7YA 1ODNA 3AP4A 1XNBA 4FQZA 2VQ0A 4QT6A 5FPAA 1VPHA 5GZFA 4D8MA 2BOJA 1O3RA 1E5SA 2P6HA 5L19A 1AUYA 2VUCA 4QXHA 1IG3A 3I3MA 2RDRA 3DYOA 4HKOA 2J1EA 5A7WA 5ABJC 4ARXA 1D4M3 4NVPA 3C7HA 3H42B 1H4GA 2P5BA 4MGZE 4QU1A 4BYYA 5BUVA 3GALA 5DN2A 3GJAA 4N8MA 2G1MA 5FZMA 1H4HA 4G4FA 1O8PA 4FBFA 5LWBA 3PLQA 3N7MA 4P9YA 2GNTA 1V6KA 4AVCA 4QPWA 5ACA1 1GLHA 1W0PA 5FMDA 3LB9A 1GNZA 3USSA 4QX0A 1CONA 1L7LA 4DQAA 4QX3A 2WAAA 2F6BA 1ASJ2 3PNAA 2WWJA 4A4AA 1PO21 1AYN1 2YC0A 4JDNA 1WW6A 4WV8A 4W8JA 1HLCA 1RUE2 1WLDA 3PIJA 4LK6A 5GZGA 4GMP3 4YVSA 4CEYB 4CCCA 2C1FA 1IKPA 4KU8A 4O61A 4L99A 4W6XA 1TZOA 4Z2WA 3WHUA 4CCMA 1W28A 2ZGQA 4GULA 2K0GA 3IPVB 4F83A 2ADEA 4BCUA 5F3GA 3MLJA 2AGSA 2G19A 1JOBA 2CL2A 3PVNA 4RGGA 3WQ1A 2JXAA 1X9TA 3MV01 1D2SA 3ZXAC 4NHLA 4AFBA 5F5IA 5BNQA 4YFWA 4DO0A 3WNLA 1WZXA 3ZYFA 1XPWA 1YI9A 3KM5A 2OPKA 2GN3A 2K2SA 3AZXA 1BVP1 3I2FA 3O0WA 5K0UA 1POV1 1R092 1AHSA 2PAKA 3B9IA 3MF6A 5C3PA 3KT7A 3LDBA 5F7UA 4M01A 5AFEA 4XURA 4L2NA 1K5JA 2VTXA 4O7XA 5F5AA 2XBO1 5F6KA 5FK8A 3UKVA 4MX3A 3USUA 5GZCA 2PHLA 3I8TA 3POFA 1GWMA 4S2GA 5HCHA 1UF2C 2A3YA 2R073 2ZPXA 3H8RA 2W2IA 1JW6A 4CP2A 1W0OA 2X5IB 5KHGA 3QOPA 4DUWA 3GBGA 4XUQA 2JG8B 2J1TA 2D6KA 5LA9A 1O7FA 1ZBE2 5K0UC 4GWMA 3MIHA 4L11A 3JBG1 3JD72 4LBMA 4NHYA 5CKQA 5HV4A 4FAGA 3E6CC 2AREA 1OH3A 5FBJA 2QNKA 3SLIA 1QJU2 5KBFA 3VDDA 3W9AA 4ZZ8A 4NPMA 5M0TA 1YC61 3RYRA 2ET1A 1ZM1A 4MUVA 1FAYA 4J25A 4CCJA 4Z2AA 1J3RA 1COV3 4OLLA 4XJ8A 3EYPA 3RJ2X 2NN8A 1ENXA 3KVBA 4D7TA 5JLVA 5KXDA 2Y0OA 1OLME 1W3VA 4LO5B 2PHTA 2WQ4A 1PO11 2VZOA 4E4DX 4X8PA 3J7LA 2VZTA 4FOWA 5LBCA 5D2AA 3AP7A 1JMUB 1QNWA 3NSTA 1W6QA 1TMF3 2DV9A 1IQAA 4GA9A 1KQRA 1V70A 4QM8A 1H9PA 2HWC2 3MW4A 1QWRA 5BNPA 2P34A 1GKBA 2JIGA 3URFA 4FT8A 5FV3A 5FZFA 2VMGA 1W39A 2E7AA 4RL7A 1AR83 1M4WA 3KGLA 3Q8EA 3LZZA 1MZ5A 4B29A 1ZRFA 1Y4WA 2B42B 1CAVA 1FV3A 3JB4C 5EFUA 4QGLA 4C8DA 5FZ4A 3THPA 1MS8A 1QXPA 2J1RA 4EN9B 3PUQA 2RV9A 3TNPB 2UWCA 2D40A 2GC2A 3AFGA 3U14A 1QU0A 3H1MA 4QQOA 4HN0A 2EICA 5BNPC 1UQXA 4I0AA 3PVBB 3ASIA 5A1FA 1R081 5FAXA 3T1MA 4I0WB 5TSWA 2ERFA 5FXVA 3VN4A 2CU5A 2DFCA 3MIFA 2JJ6A 1AYM1 3DPRA 1JZ5A 2NM1A 2MHFA 1F4AA 2CGOA 5LB6A 4RQPB 2RM22 3H0OA 1QJFA 2VVDA 3IMNA 4UFLA 3ZFGC 4FPYA 4UBHA 2O1QA 3APBA 5J96B 2QQKA 2JDZA 2V4AA 2WFPA 2BW8A
chains in the Genus database with same CATH topology
2CGNA 1CD3G 5EYYA 2ZCWA 1GZWA 1LEMA 1G7YA 4YM2A 2JG9C 4Q4V1 3DPRC 5EWSA 4CEWA 5JPMB 4Q27A 2BBVA 1KD7A 1KFUL 4OHXA 2Q1ZB 3RRDA 2EXIA 1VALA 4JGZA 1RUOA 1C8M2 3BOWA 4KG0A 4N7IA 3WP4A 1R1A3 2ES3A 4QD2A 1ULFA 2ZGTA 4LR4A 4YVWC 4AI0A 2ZAAA 4LHKA 1SLCA 4PLNA 1B09A 4OFGA 3V0BA 2NYYA 2B5HA 3THTA 1ZREA 1M06G 2WZR1 1IHMA 4WM8A 2NMOA 4AG4A 2Z42A 1N47A 2VUJA 5C33A 2WS92 1Q43A 2CY6A 2BTVC 5CFDB 4XJ9A 4BA6A 2PA7A 4BOWA 1ENSA 1Z0HA 3IM0A 2WWSA 4K3UA 4BIOA 4ATEA 4BM8A 3WDXA 1B35B 1QKQA 1GNHA 1A8DA 1YIFA 4W6YA 1O4ZA 1XNCA 2ZGNA 5DUUA 5C8CA 4FTSA 1D4M1 1TEIA 4DMIA 2VW0A 2OVUA 1GR3A 2D3PA 3WDYA 4HKLA 2BUKA 1BKZA 3MLKA 3QACA 3CL1A 3LA3A 3ILFA 4MGKE 4E9KA 4Q0PA 3OTFA 4S2FA 5D8AC 1DG6A 4ONUA 4G9SB 4PLOA 5C8CC 2IXIA 2VY0A 1TNFA 4Q0VA 1RUC2 3VZMA 4XXPA 1KITA 4FPJA 2PN5A 4C0BA 2X53S 1ULGA 4E2SA 4GMP1 3CF6E 1AL21 4AEJA 4HVOA 3LWCA 1ZBA2 2D93A 2VQAA 4LHLA 1G9BA 5C4WB 2G9FA 4BMEA 2WKKA 3PHMA 4C90A 1MQTB 1ZZ7A 4CYDA 4FP3A 3MPBA 3WP5A 4QGNA 1AR62 5KHHA 3U0ZA 3B7MA 3HMYA 4DXZA 1NQJA 1QF3A 5EXOA 4Z1VA 1HKDA 4LO4B 3H1WA 1CN1A 1I5ZA 1FOD2 1BQPA 3FX3A 1JN2P 4NO4A 4B4RA 3TN93 4XFGA 5GALA 1PIV2 4DFSA 1VR3A 1SLAA 2DUQA 3S7IA 3AZWA 4QHBA 2FMDA 2R071 1NCQA 2P3IA 1ZX5A 1ND2B 1PGL2 1VBB3 4CDQC 2DVBA 4QGMA 3CJIC 1HRV3 2WFF3 4K6BA 4KGQA 2GZWA 3MGUA 2WA4A 3FC0A 3U4XA 4XF0A 2Q0AA 1ZRRA 1COV1 1WBLA 1MS9A 1WW4A 2YDEA 3M7AA 3MYXA 2EXHA 4XXAA 5A33A 2D6OX 2ENRA 3NW4A 3RPQA 5BY5A 1FPN3 4KL1A 3OPZA 4P5HA 4GWNA 1TMF1 4QM9A 1DYKA 3SCFA 2N7GA 4PIXA 4Q0SA 1KS5A 1UD1A 3HWJA 3V56A 1ZZ6A 3UJQA 2CAUA 4LUMA 2PHWA 3RWNA 3VZKA 2D98A 1AR81 1BJQA 5DG1A 3NV3A 1DZRA 4R9BA 2VNGA 4LEJA 3VL9A 1FNYA 5F9TA 3BIWE 4Z92B 4CDXA 3K48A 2EAAA 3VKMA 5AVAA 1C57A 1RITA 3K51A 5LEKA 1DQ5A 4Z82A 4RFT0 1X36A 1OQ1A 5DDJ3 2ATFA 1NY72 5GLUA 3AKQA 2H6CA 4LULA 1BMV1 4Q26A 3ZYPA 2A5ZA 5EV7A 1LGCA 4CDXC 3J26N 3GZUC 2R063 4H14A 3VV1A 4DPNA 1SBEA 2XL7A 4Y24A 5CBLA 3N4MA 2VXRA 4EN6B 4FSJA 4WM7A 3LA2A 3B00A 4URTA 4AFAA 1D4VB 5J48A 1GQGA 3GBFA 3V0AA 5GLTA 4C1XA 1CR7A 1RUH3 2HEVF 2XHKA 4FVVA 4K9SA 1FMD1 4PDWA 1ZZ9A 3OGGA 1ONAA 4KG8A 5LK7B 2ARBA 5T52A 3W59A 3VBFC 4XF9A 1WLCA 4WM7C 2VECA 4FXGB 5A3MA 3B69A 1R1A1 4BQ1A 4RD7A 4U2AA 4E4SA 1BBT3 2V73A 4GKXA 3ZSEA 3BODA 3ELNA 4PDWC 1QH6A 2D44A 4BMBA 4COWA 4R4ZA 1HQWA 1JOJA 1GBGA 3VBOA 4IEZA 1N1SA 4BZ4A 4MXVA 3DGTA 4IEUA 4C1WA 4YVSB 2ZZQA 4JDOA 1R093 5J09A 2ZMLA 3KCXA 3LAGA 2E53A 2I07B 2B39A 4X6RB 1IKQA 4FPEA 4YW3A 1JUHA 2HWB3 3FJSA 2D43A 4L92A 1XE8A 1JYIA 2X29A 4XHXA 3JD73 1E57A 4IV1B 5FQ0A 1PMIA 1SLIA 3VZOA 2R32A 1G86A 2DU0A 3USUB 1QJX2 2IZWA 1RMU3 3KZ4C 4M3CF 4QMAA 3TOJA 2GNMA 4OULA 3I59A 1CJPA 1Q5OA 2A6VA 2V09A 2DVDA 1HV1A 2RMU1 3GZAA 1I1EA 3A0KA 2A75A 5JI9A 1D2QA 3ZDSA 3DF0A 4HETA 4XJWA 4AGRA 1UU6A 2WIIB 4OHZA 1VBA3 1WW7A 1DZQA 1Q3EA 2ZX3A 4JAAA 3KT1A 1H8TA 3WXPA 2PHUA 1G9CA 1LULA 1CAXA 4GH4B 1VBD2 4Q4X2 3WDTA 2XKPA 3E6DA 3NV1A 1RIRA 5L36A 4Q4W3 4QPGA 2HWD2 5JSOA 1S2BA 1QOTA 2OYZA 5KXBA 1XYPA 2XBO3 1H8TC 4LT5A 1V6IA 1CGPA 1V9U2 3LKJA 1NCRA 1BZWA 4D3WA 4NWVA 5J37A 4FO9A 1CAVB 4KWJA 3VGIA 2HYKA 1VIWB 3PMEA 5K9YA 1VBB1 3ZFFA 2VUAA 5CFDC 4ASMB 5T5OA 3LSDA 1HRV1 2WFF1 1GSLA 2EAKA 2RS32 2RS12 4RHV3 1IS6A 3WG2A 5H9RA 1GFF2 4AEDB 3FLTA 3CO2A 4K40A 1PO13 3T2TA 1NA1A 1W6OB 3IN9A 2PAMA 5B2GB 2HWE2 3ZXDA 2OIIA 1FPN1 1OKQA 1ND3B 1CAWA 2A71A 1CIWA 4Y20B 5CG9A 4P14A 1RUI2 4QPIB 1J1LA 1UPIA 2ZA9A 4CEWB 1W6NA 2CNAA 1SBDA 4D94A 3AMHA 1NA1C 1QHDA 4UW3A 4XF4A 3VKOA 1SDWA 1Q56A 2A6ZA 2B45X 3RQ0A 3R6SA 3M70A 3L9JT 2A6YA 4N43B 2MNGA 5FCCA 2OUJA 4COYA 4R8HA 5JSRA 1Q8OA 2NZ9A 1RL3A 4XFIA 5FPZA 4YG0A 4XFCA 1U0AA 1O5UA 5DDJ1 4OZXA 5CFCA 4HN1A 3VBSB 4CZSA 4JGYA 1YFXA 2XWBB 4AQTA 4WM8B 4Y1YA 3NWKA 4NHKA 2R061 1VAMA 1ZZ8A 5I8TA 3AJZA 1D0GA 2CYFA 1QJZA 1I6XA 3ZN5A 2RS52 4WVMB 1DGWX 2XVKA 1RVF3 1PGW2 1VB2A 4CP0A 3SITA 2ZAHA 1BYHA 4H7LA 1RUH1 1MS0A 2WLQA 5FBZA 1QH7A 2PAEA 4Q0QA 2Q4SA 4AVVA 4ES9A 5CFCC 4AHWA 4JGYC 2D6MA 5D1IA 1OA2A 3WVJA 2D6PA 2XH6A 4W6WA 3U07A 3R4SA 1ND2C 1LOFA 1RUC3 2YHJA 3FWEA 4YGDA 4CDWA 4LO7A 3VBUA 3WOGA 1PK6A 5BV6A 2AENA 3VBHB 3FZ3A 3ES1A 1Z7S2 4PCRA 3SMHA 1LTEA 1LCLA 3H8UA 1ZBA3 2ZJCA 5JZGA 3UKNA 1AR72 1TE1B 2B9UA 1BBT1 3AMQA 3OJBA 4CDUB 2AUYA 4AI1A 2DU1A 4IXLA 2PELA 1CPNA 4MXWB 1APNA 4Q0UA 5ABJA 1IPKA 4F7ZA 1LOFC 3I7DA 1XNDA 5CVRA 2DCZA 4KGGA 2A7AA 1AR63 1FXZA 4CDWC 3RSJA 3VBUC 1PK6C 4AHZA 3B01A 1WCDJ 3X29B 4AXOA 5JVVA 2PHRA 5T5PA 4JTOA 1R091 4KU7A 4Q4Y2 3PJYA 1C28A 5JZGC 2AR6A 2O8QA 4IEVA 4ZU7A 1EP0A 4MVTA 3AKRA 4MSVA 3TBDA 1W6MA 1UCXA 1OD5A 5AC93 4COUA 5J7MA 4UXAA 5EJ3A 1S0IA 4EN0A 1RB8G 1AR92 1RUD2 2XLAA 1AX2A 3TRSB 2HWB1 5JCTA 2LTNA 3E5UA 3GZTB 3O0VA 3JD71 2O8OA 5JMCA 4ASLA 3CNAA 4MYEA 5A32A 5BNOB 3ZVXA 1RMU1 1NCQB 4IEWA 4K7JA 4LBQA 1YWKA 1DDLA 4XDQA 1PVC2 3UKTA 2HWF3 3ZSKA 4IERA 4HZFA 2FQPA 1AL23 2RR12 5CIRA 1K5MC 2VULA 2Z69A 3VBRB 3ZO0B 3ENRA 1VBA1 2HWC1 4IV3A 4HVQA 1MZFA 4QXKA 4KWKA 3AMMA 1Z78A 3J8F2 2RJKA 1DGRA 3J4UH 1VLNA 1F8VA 3ZFEC 1QQP3 5T55A 2KM2A 2BW8A 3PVEA 4Q4W1 4XQWA 1LOCA 1RGSA 2D5FA 3D6EA 4W65A 5FMOL 1J58A 4IV3C 2WNVB 3RI8A 1EY2A 4R9CA 3C3VA 5KXEA 1RUJ2 1UIJA 3ZN6B 4FTBA 4XETA 3VKFC 1ENRA 4YGCA 2GMEA 3ZMOA 3WG4A 1HXS3 3PVOA 5L73A 3SCHA 5HCAA 1W6PB 1RUG3 4YSFA 1WMEA 1BCXA 2CWSA 2R16A 2VOWA 4XF1A 1YFUA 3N35A 4RHV1 3AYEA 4OI2A 1PNFA 3B9CA 1I9RA 4UW4A 3E6BA 3VKLA 4PF5A 4FPLA 1LGBA 4H55A 1WGPA 4YZ3A 4IV1C 4FQ4A 5FFOC 1S0DA 5HXVA 3RG0A 1LECA 3WG1A 2ZBJA 4A2UA 4A7ZA 3VL8A 4HL0A 5ACA2 1DBNA 3V0AB 1LHWA 1S55A 1S0JA 4AHXA 3JQXA 2NPIA 3NVCA 3AZYA 4N90A 3AYDA 1AYN2 4C91A 3LA7A 3ZFGA 3B02A 3VLBB 1RJ8A 4NOTA 4E27A 1GYKA 1OQDA 1OOPB 3FFQA 5I8YA 2DVGA 3S30A 5E1RA 3WUCA 2JG9A 1FYUA 3AXDA 3MIBA 2V5YA 1G6NA 2GC0A 1JBCA 2EA7A 5DUWA 1IPJA 2UYAA 1QY4A 3WCRA 3HD8B 4DNYA 5J3UA 2JEMA 2ZX2A 4FPOB 1YLLA 3H9AA 3AP6A 3WHTA 2BNOA 4YVWA 1X8MA 2TNFA 1WW5A 4AHYA 3B94A 1RVF1 2Q1MA 3AB0A 1FMD3 1X82A 4J6GA 3M1HA 3ZXJA 5JOZA 3MEPA 2Q5TA 3I54A 3AFKA 3WNXA 2YYOA 3O14A 4I02A 5BPXA 3MIGA 1V6LA 4YM0A 1XRUA 3JBG2 3OY8B 4N53B 1RUC1 2H0BA 1EAH3 2XJVA 5FQ0B 1OFSA 1X8EA 4XFBA 1WCKA 4BH9A 1SLLA 4GB33 4LLFA 1RUF3 3WUDA 2FBEA 5DZGA 4AEDC 1UW8A 2OA2A 2XJPA 3ECQA 2DURA 4XF3A 1VBE2 1ZBA1 4Q4X3 2RE9A 1ZA4A 2H6BA 2FHRA 1N3PA 1DQ6A 3O12A 4M3CA 3QD6A 1S0CA 4NPRA 4XMAA 5KHJA 3AKPA 5CB7A 1AR61 2HWD3 2QVSB 2IWGB 4BE3A 4XQDA 3AZZA 2D3RA 5L7OC 4UW6A 2RHPA 4FP2A 4HLTA 2CV6A 2PHDA 2XJQA 1FOD1 2GC3A 4LE3A 5D8AA 5KHKA 4I30A 1LHVA 3LSEA 4DRVA 4D7SA 1BEV3 5AC91 1WMDA 2ZGSA 1AVBA 2RJLA 3OYWA 2XG3A 1F5FA 1PGL1 3IKWA 1R082 4HSJA 1LJ7A 2R1BA 1LEDA 1TQ5A 4RS5A 3WW1A 2XVGA 3ZXKA 2MPFA 1NZCA 2DYCA 1RHI3 3E97A 1MEC3 2DUPA 3SXWA 3ZXGA 1SCSA 2A6XA 1KXGA 3M3EA 3KT4A 2RMU3 3WDVA 2WNUB 3L2HA 2XJUA 3NAPA 4YRDA 2GH2A 3VKNA 1CJDA 2HWF1 3LOBA 1NE4A 3ZIXA 3QBQA 4RS5C 3EO6A 1EV12 4AYUA 4X8NA 1OA3A 2QUOA 1PGSA 5C9AB 1C3HA 4HBNA 5DG2A 3TWIA 1N3OA 2JX9A 2EXJA 1ZZCA 3NAPC 5I0RA 3OD0A 4HPKA 4Y22A 4P9XA 5JI7A 2Q30A 4M0HA 3MIDA 3RYKA 1QQP1 5GKAC 4RR3A 4TZDA 4XPVA 1QMJA 4CDQA 1DFQA 5BNNB 3BOPA 5KC6A 3CJIA 1CAWB 2QCSB 5IK5A 1AL0G 3ZXLA 4PIZA 1AJOA 1O5LA 3IWZA 2W08A 3EBRA 5I0UA 2WZR2 2Z2SB 5IK8A 3TYJA 2DCTA 2R0FA 4RR3C 2PLV2 3KS7A 1HXS1 4UBGA 5GJ6A 5T5LA 1RUG1 4EN8B 2R1DA 3J9SA 3O5SA 3GBWA 3ZIWA 3ZN4A 2BWAA 4XIKA 3FMGA 1DQ2A 3D5OA 4LLOA 2XB6C 4KH9A 1REEA 2Y26A 1D4M2 3KQRA 3EXUA 2WQZC 1H30A 1OFNA 4ITCA 5CA6A 4Y5Z0 3WW3A 4LE4A 2R043 4MGIE 4A7YA 1F9KA 3IPVA 4OVEA 4J1WA 1ULDA 1H9WA 3POSA 2QFEA 3N7KA 1O3QA 3P3NA 2Y0IA 3AMPA 4HANA 5SV8A 2QDNA 1R1ZA 1XYOA 4CEYC 1V6JA 4WZFA 1AXKA 2ZHKA 4E4ZA 4Q29A 3CJXA 5JWPA 3VHOA 1YHFA 3MLLA 1OLQA 2BFUL 3BU7A 2TEPA 1LU1A 4QX5A 1X50A 4AGVA 2NP0A 3A0NA 4LBQD 4S2HA 2OW4A 1H2NA 3JU9A 2XLFA 1CAUB 2R30A 2X5IA 1DGLA 2WL1A 2HKXA 2D97A 3EHKA 5HI0A 1LRHA 2JG8A 4IEOA