2VY0A

The x-ray structure of endo-beta-1,3-glucanase from pyrococcus furiosus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
264
structure length
264
Chain Sequence
MVPEVIEIDGKQWRLIWHDEFEGSEVNKEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTSSRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHEPRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEVTKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-1,3-GLUCANASE
publication title Crystal Structure of a Family 16 Endoglucanase from the Hyperthermophile Pyrococcus Furiosus-Structural Basis of Substrate Recognition.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 62
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2008-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vy0A00
2ZABA 1LU1A 4U2AA 2E7TA 1OKQA 2A7AA 2CWMA 1MVQA 4F83A 4LBQA 4K20A 3M1HA 2DTYA 3NWKA 4Y1VA 4YG0A 3HMYA 3AJZA 1IS4A 1CVNA 1N1VA 4WVVA 3AZVA 4LBNA 1FYUA 2P3IA 3FLRA 2ZHNA 4RL7A 1V6MA 4WZFA 2UURA 3FFZA 2NN8A 2GMPA 3AYAA 1YI7A 3U4XA 1UKGA 1W6OA 3ZXFA 5JOWA 1IS3A 2AENA 1W6QA 2DWRA 1AX0A 2ZBJA 1G9CA 1Z78A 3RMYA 1LOFA 2D6NA 2D6KA 3N7KA 1Q56A 1KITA 1GNZA 1QDOA 1BQPA 1S0EA 1MZ5A 2D43A 5HCAA 1W6OB 1AZDA 1AJOA 1UPSA 2AUYA 1W6QB 2VH9A 4FOYA 4FOVA 1ULEA 1ENRA 5KXCA 2EXJA 2YMZA 1YYNA 1DFQA 1V6NA 1F9KA 1D2SA 1V00A 1WLCA 1ZA4A 2CL2A 2YV8A 4L8QA 1ONAA 2A71A 4XJWA 3M3QA 3TAYA 1LHOA 1HQWA 4FPKA 2ENRA 2KM2A 2A6XA 3AK0A 4Y1UA 5E8AA 5GZFA 2OW4A 1SFYA 1SACA 4CZSA 3ZXKA 3V65A 1AF9A 1ULGA 1JHNA 3N3HA 3OGGA 2D3RA 4Y26A 5T52A 4YW5A 2B7YA 2ZGRA 4Y22A 4XMAA 3WVJA 3WNXA 4XJ8A 1CONA 1HDKA 4K1YA 2DU1A 2GNTA 5BYNA 3NV3A 4ZKTB 2GDFA 1WUVA 5JMCA 2A6ZA 3WOGA 1FAYA 1DLLA 4UW5A 2YXSA 4NO4A 4Y22B 3T1LA 1MVEA 2ZGPA 3HR9A 3LCPA 4XXAA 3VUOA 3AZXA 3ENRA 3N7JA 2R0HA 4I30A 4Y1ZA 5DUUA 3T2TA 2Q5TA 1UZZA 2D3PA 5AVAA 3A4UA 5IK8A 4HL0A 4BOWA 4C1XA 3WCSA 2P3KA 2TEPA 1G7YA 1MS8A 5GZCA 2VW2A 4UW3A 4YG3A 4BMBA 1VIWB 1JUIA 2A3YA 2YY1A 5F9TA 4AGRA 1ULFA 1KRIA 3N35A 5KXBA 3AP5A 2DYCA 1H9PA 1N3OA 3PVEA 1LHVA 4XXPA 1CN1A 1N47A 1CQ9A 1LOBA 2WSVA 1MS1A 4PCRA 3ILNA 3OY8A 5E89A 2ARBA 5DUWA 5KXEA 4LBKA 1CESA 1WD3A 2DVGA 3AXEA 5JVVA 4YZ2A 3W59A 1EPWA 2D6LX 1PZ7A 1WBFA 2GMEA 3M3EA 2RHPA 4M3CF 4R9BA 4FPFA 5HCFA 1V6JA 2G4IA 3VKLA 4FPEA 1S0JA 1LECA 2GN7A 2EALA 2WNEA 1MS5A 1UMZA 3IPVA 4YGBA 3AZWA 3USUA 3BIWE 1N3PA 1MS3A 1CIWA 1QF3A 1LOEA 2NMOA 3OY8B 1G9FA 4XYXA 3WLUA 1V6OA 4ISQA 5EXOA 4FPYA 1FATA 4P9XA 4Y20A 1LOCA 1UZYA 1MS9A 3ZXEA 5DXDA 5DUVA 2PELA 3AYEA 2ZA9A 1TEIA 2OUHA 2ERFA 2PHUA 2DVFA 3HN1A 3USUB 3IPVB 1I3HA 1V6LA 3WDTA 4Y24A 4XDQA 1IS5A 4XILA 1Q8QA 5GLTA 5IK5A 4YGEA 3Q9OA 3M2MA 1S0DA 5DZEA 1MACA 5GZGA 4Y20B 5T5LA 1WLWA 1JOJA 5CB7A 4AGVA 1LGCA 4FOWA 5FREA 1Q8VA 1G9BA 2R49A 2ZGSA 4LBLA 4R9DA 1DGLA 4DS0A 1I1EA 2ZGMA 2D7FA 4GALA 3RSJA 4FQZA 3AFKA 5E88A 3POWA 2GMMA 4PBPA 1Z0HA 2ZZJA 5GM0A 1Y7BA 4Q8LA 2ZMLA 3ILRA 2JJ6A 2E7QA 4M01A 1IKPA 1QU0A 1ULCA 1A78A 3H0OA 4Q1RA 1B09A 2AGSA 1N1YA 2CNAA 3ZXLA 2NYYA 2VU9A 3V0AA 5CA6A 4XBQA 3PJQA 4LBMA 1WW4A 3MEPA 5LK5A 4PF5A 5DZGA 2A75A 2XB6C 5EYXA 2GALA 3INAA 1AXKA 3MW2A 5GLZA 3RG0A 2I2SA 5KXDA 1GZWA 5IK7A 2GNMA 3V0AB 1MZ6A 4YZ3A 5EYYA 3WG1A 2R0FA 4PQ9A 3OPZA 3POSA 4YM1A 4BLIA 2DTWA 2R1BA 1A8DA 4OZXA 4YFZA 4YM2A 2ARXA 3DUIA 3BODA 3BOPA 3WDVA 1APNA 1GBGA 4P14A 3KQRA 1GZWB 1FNZA 1DQ6A 3APBA 5GLUA 4ATFA 5JOXA 1H9WA 2OUJA 4BMEA 3FLTA 1MS4A 1QKQA 4GWNA 1IS6A 5GZEA 1RITA 4IQPA 4KBBA 2D44A 5T5OA 1A3KA 2JECA 5CAZA 4TZDA 1FV2A 1AJKA 4XJAA 5JOZA 3SH3A 1GZCA 1ULDA 2A3XA 2E6VA 2E53A 1SLIA 4ITCA 4UW6A 3V64A 3WDXA 3WHUA 1LEMA 4U36A 4AWDA 4D69A 3LSEA 3SISA 4Q8KA 1URXA 3D4KA 3ZSMA 3VKMA 1W6NA 2OVUA 4XBLA 3ASIA 3FBYA 2ZMKA 1QOSA 2FHRA 3AZYA 3WDWA 4YFWA 3OJBA 4YW4A 2UWAA 4DFSA 2GNBA 1U0AA 4GXLA 4DRRA 2UU8A 4AVTA 2DVDA 1DQ1A 2NP0A 5F5QA 2A6YA 3ILFA 5DUXA 4GKYA 2ZHMA 4XZPA 1KQRA 1LTEA 1AVBA 3AYCA 2PHRA 1W6NB 3AYDA 1SBFA 1FNYA 2W08A 2XG3A 3QLQA 3RS6A 1LOGA 2DVBA 3OBRA 2VY0A 3PVOA 3GALA 1VAVA 1JW6A 2PHTA 4R9CA 2WKKA 2PHXA 3N7LA 2WT1A 2ZGOA 1QOTA 2EXIA 1NLSA 1ENQA 3POYA 4YW2A 4DPNA 1DZQA 1G8WA 1LGBA 3R4UA 2GN3A 3MW3A 4AYUA 1DIWA 1W6PA 1OFSA 3NV1A 1LHUA 3VKFC 1C57A 3D5OA 3O0XA 2A6VA 5DG2A 2P3JA 2C5DA 4XE9A 1S0CA 3I8TA 4W65A 1KJRA 1GANA 2CY6A 4P9YA 3QCWA 2W52A 4YG6A 2NMNA 1HLCA 3LSDA 2P2KA 1F5FA 2SLIA 1V6KA 4BM8A 1SLBA 2JDZA 1WW7A 5CNAA 1S1AA 1AX1A 1S0BA 2WJSA 1W6PB 4XMIA 3O12A 2VW1A 5DZFA 1X50A 3O0VA 1CJPA 3AP4A 3R4SA 3R05A 4GWMA 5GJ6A 4YW1A 2DURA 5T54A 2DUQA 5T50A 1DBNA 1WCSA 1AX2A 4FOQA 5H9PA 3WCRA 1AXZA 1BKZA 4XHBA 4YLZA 4FVVA 3WG3A 1JN2P 1UX6A 4XIKA 2UWBA 4FQ4A 3RQ0A 1DQ0A 4P9WA 1GSLA 3ATGA 3WG4A 1SLAA 1DYPA 1WD4A 2P34A 1BZWA 1W0PA 2NM1A 3C2UA 1KDMA 4YM0A 4PBOA 2DU0A 1GYKA 3WDUA 4XTPA 3AP7A 4JC1A 3WUDA 4FPJA 1CPNA 1D0HA 1Q8OA 1NXD1 3RRDA 2WSUA 1OQ1A 2CYFA 3WHTA 1RIRA 3ZVXA 2WLQA 2ZGNA 3T1MA 3V0BA 1DQ4A 2WQZC 1LESA 4CTEA 1AXYA 2HYKA 2JE9A 1N1TA 3D6EA 1O4YA 1WW5A 2ZGQA 4GKXA 1YIFA 2UWCA 4JCKA 5T55A 3PMEA 4YGCA 4YZ1A 1S0GA 4FPOB 1FV3A 2ZACA 1R1ZA 3B9CA 1Q8SA 5H9RA 1KJLA 1GICA 4Y1YA 1QDCA 3V0BB 2P37A 4DRVA 1SLTA 5GLWA 1N1SA 1G9DA 3UJOA 1VLNA 3SLIA 1YXWA 4XJ9A 4RA0A 4XBNA 2A6WA 1LJ7A 5IK4A 3OBTA 1LEDA 1DQ5A 2JKBA 1BYHA 3GNEA 1LHWA 4NOTA 4ASMB 2WT0A 4CRQA 1YO8A 2ZAAA 4FPCA 2DUPA 5H9QA 1G9AA 2AH2A 3SH5A 3B01A 2ES3A 4BLJA 1GV9A 1W6MA 1LU2A 3CNAA 2ZGTA 2CWSA 2PHWA 3KM5A 4LBQB 2Z42A 5FRAA 4YM3A 4XJUA 1BXHA 2CTVA 1QMJA 3L2YA 4YZ5A 1J1TA 3M3OA 3NV4A 2EXHA 3FUOA 1VALA 1UAIA 4JRAA 1S0IA 2EAKA 3AX4A 1WBLA 3SITA 2LALA 3SNMA 1PZ9A 1W6MB 4M00A 3JUUA 3JU9A 3AJYA 5JLVA 3TB0A 5JDBA 1JBCA 2V5YA 1JXNA 3IM0A 2AYHA 3N36A 1BJQA 5SV8A 1JYIA 1C4RA 1Q8PA 1ZM1A 1SCSA 4XTMA 3W58A 4ATEA 1MS0A 3ZPYA 2ZGKA 3UK9A 1WW6A 5CBLA 2LTNA 5DG1A 1SLLA 1F31A 3VKOA 2PHFA 2W68A 1N3QA 4H55A 1LCLA 4XOGA 3ZSKA 3WG2A 1S0FA 2FMDA 2VXRA 4AGGA 3AXDA 4Q2FA 3PVNA 1SBDA 1DHKB 4LBOA 4BPZA 4Y1XA 1SCRA 3A0NA 2EF6A 2ZKNA 3SH4A 3B69A 5IUQA 4ZXKA 1IKQA 4FPHA 4XHXA 3I4IA 3ZYRA 3VV1A 4Z8BA 1FX5A 3A0KA 1DYKA 1SBEA 3AP6A 2EXKA 2WT2A 2EIGA 3MPPG 2V73A 1W0OA 3ZXJA 1LGNA 1XQNA 5H9SA 2DV9A 3IMNA 2D6PA 1WLDA 3WZ1A 3BTAA 2A5ZA 2NZ9A 2VUAA 3RMXA 1MR5A 3DGTA 2DVAA 4ISRA 2YROA 4SLIA 2R1DA 4HANA 1LHNA 3B3QE 4YW3A 3ZYPA 3WDYA 2A3WA 4LBJA 4XJZA 4K1ZA 2C9AA 1LOFC 1QNWA 1RINA 2ZHKA 3N7MA 1LENA 1PZ8A 1C1FA 2H0BA 1LULA 2ZHLA 3MW4A 3IN9A 1KDKA 3O0WA 5GLVA 4YGDA 2AREA 1G86A 4R9AA 1V6IA 4XIOA 2DUOA 4AVVA 4FP3A 4M3CA 3AP9A 4TYSA 2E51A 4WVWA 4AVSA 1SLCA 2ZMNA 1UN1A 2BQPA 2JD4A 2GNDA 5JOYA 3UL2A 2YZ4A 2D3SA 1UL9A 3ZSJA 1LODA 1QGLA 1HKDA 3OYWA 1GKBA 1GZ9A 3B00A 4WV8A 1C1LA 1GNHA 4DQAA 1QNYA 1GLHA 3VKNA 4FPGA 5HCBA 4FP2A 4MYEA 4BQ1A 4M3CB 4LBQD 1QOOA 4YZ4A 4FPLA 1CPMA 3FUQA 3ZSLA 2A70A 2ZGUA 2D6MA 3FLPA 3O5SA 3UJQA 1ENSA 1JYCA 4M3CE 4Q26A 5T5JA 3OYWB 1VAMA 4GA9A 2JE7A 5EWSA 2D6OX 1CR7A 3WV6A 2SBAA 2R16A 2W39A 4C1WA 1YRZA 3NV2A 5IT6A 1O4ZA 5GALA 3WUCA 3AZZA 5T5PA 4UW4A 3M3CA 1IOAA 4K21A 2AR6A 1HQLA 3IKWA 5GZDA 4Q1PA 5L73A 4Q27A 1DQ2A 2VW0A 1H30A 1LOAA 2ZGLA
chains in the Genus database with same CATH superfamily
1VBB2 2E7AA 2G19A 4U2AA 2E7TA 2A7AA 1OXCA 3U0ZA 4AZZA 1PNFA 1UOBA 1X8MA 4Y1VA 2XVGA 1UZVA 3AJZA 5FPUA 3AZVA 2P3IA 3FLRA 2ZHNA 4RL7A 5FPZA 4WZFA 1D4M2 1RUG2 2NN8A 3MIEA 2CDPA 2GMPA 1CAVB 3AYAA 3U4XA 1O3RA 5JOWA 1VBD2 2O8OA 2YC0A 1OLQA 2AENA 2HYXA 2DWRA 1HW5A 2VOXA 3WY6A 3IT8A 4L9BA 3MV11 1JZ6A 2D40A 1LOFA 2D6NA 4UT5A 2OQ6A 3OBAA 3LDRA 4Y4RA 3FC0A 3N7KA 1KITA 5FLHA 1ODMA 2VMGA 1AL0G 1QH7A 2D43A 1YFUA 1W6OB 1AJOA 1AZDA 1PVXA 2IXIA 2QQWA 4QQLA 4LHLA 4DUVA 2ZPXA 2HWF1 4H3WA 1W6QB 3A22A 2HJIA 4OI0A 1QJY2 3K46A 1VMFA 2EXJA 2YMZA 2K9ZA 1YYNA 1DFQA 3N9MA 4LK7A 1OD5A 1D2SA 2WZ8A 3DF0A 4Q0QA 5LA9A 4E4ZA 1NZCA 3ZLIA 5K7PA 1PM4A 4XJWA 1HQWA 5J7MA 3MGUA 4KL1A 3AVRA 1DZTA 1ZX5A 3HPNA 3O1UA 1W3VA 3KGZA 3U1XA 1AF9A 1ULGA 4QPIA 4AFCA 5T52A 1W9TA 3OGGA 2D3RA 3VL9A 5A6ZA 4YW5A 2ZGRA 5FTTC 4Y22A 3WVJA 3ZN6A 2FDIA 1AYN1 3ZKUA 1CONA 2Y6HA 3DKWA 3ZFGA 4QXHA 3KSCA 4OHWA 1RUH1 4K1YA 2DU1A 1WZXA 2E63A 2GNTA 3A21A 4N43C 1JH5A 1VE0A 5BYNA 1POQA 4O61A 2DBNA 3EMRA 1QXRA 2BU9A 2YGLA 1UXZA 1H0BA 4HK9A 2PFWA 4NIIA 2IC1A 2RM21 4Y4YA 3WF1A 1DLLA 1W9WA 3PUSA 2Q8OA 2YXSA 4NO4A 3B93A 1AR83 3LCPA 1I5ZA 2MHFA 2XL7A 4FFHA 3RI9A 4CXYA 1H8TB 3VUOA 3ENRA 4AHYA 2B42B 2R0HA 3HNBM 4HONA 4NN0A 3VBOB 1RMU3 1UZZA 3A4UA 1XNTA 1XE0A 4BOWA 3POEA 5LATA 2P3KA 3KV4A 3WCSA 1ASJ2 4BCUA 2VW2A 4UW3A 1DCSA 1PK6A 1MQTA 5FZIA 1JUIA 3O1VA 2XL9A 5D8AC 3I2KA 2CSGA 4W50A 4AGRA 5DAQA 2VBPA 3W5MA 1AR82 3VBUB 5A80A 1TE1B 3MF6A 3AP5A 3I49A 3PVEA 2Y6JA 2JG9B 1YWKA 2W1SA 3OSDA 2RMU3 1UPIA 2G9GA 5FO8B 4ZS3A 1DGRA 5E89A 5DUWA 2LW8A 3C3VA 4PQQA 3OGVA 3W59A 5JMOA 1AR91 4N9IA 2ADDA 2JDPA 2X5IC 4R9BA 4FPFA 4RR3B 2WNUC 4Q0SA 3VKLA 4CDUB 1H6YA 1S0JA 2ARCA 5IWFA 2EALA 2WNEA 3IBMA 1W8OA 3BIWE 1N3PA 3NAPA 4CP9B 1OSGA 3M8LA 3WLUA 2RMU2 2X05A 4ISQA 1XB9A 2A1XA 2ATFA 5EXOA 2GC1A 1FATA 3ZR5A 1UZYA 4ZZ8A 2P3YA 5L9RA 2ZA9A 2PHUA 2DVFA 4NRMA 4NIAA 4B1MA 1HB3A 3KT4A 1YJKA 5FBJA 5GLTA 3ZOIA 3FHQA 5DZEA 5KHGA 5GZGA 1W8UA 1Y9GA 4AGVA 5FP3A 4IGQA 1D2QA 4FOWA 3VBUC 2QZ2A 1H2NA 2J1TA 2OIIA 1Q8VA 3PJYA 1UU5A 3CMGA 3K77A 1G9BA 1D4VB 1WLTA 2D7FA 3A23A 3AKRA 3QBQA 1GQPA 4GALA 1YNAA 4IGPA 5L9VA 4KNCA 1W90A 2RDQA 3POWA 1O8PA 4PBPA 5LEJA 1Y7BA 4Q8LA 4LO8A 3ILRA 2JJ6A 1B35A 1REDA 2YC4A 3I3QA 4CUGA 1IKPA 5BNOA 1RL3A 4ONUA 3H0OA 4Q1RA 1PMHX 2HH9A 2W5FA 5A7SA 3VHRA 4EN9B 1F4AA 1VBE3 5LBEA 4J1XA 2CNAA 4CDUC 4HVRA 4XAEA 4E4HA 2ZEXA 5F6KA 4XURA 3WXPA 2XKPA 3PJQA 4LBMA 5CG8A 2FDFA 2RDRA 2QCSB 4PF5A 5CISA 5IVJA 2GALA 3INAA 4QPGB 1AXKA 1HX6A 2JIGA 3MW2A 1X82A 2Q1FA 4L11A 4YVWA 5GLZA 3T4VA 4LT5A 4AR2A 4K8RB 2WFF2 3R4DB 4SBVA 1Y9QA 2Y6GA 2ZX1A 2ORXA 3ETQA 3LF7A 3GZUC 4GJYA 2GP5A 4NUBA 3OPZA 4HKLA 4OHVA 2WUHA 4BLIA 1A8DA 5I0SA 4QD2A 5KC6A 2ARXA 4V1PA 4LE3A 4L97A 4LO5B 3S7EA 1RUI1 2WN2A 2Y33A 3KQRA 5FYYA 4XFFA 1G6NA 1QXJA 3OBZA 4LO7A 1DQ6A 3H1YA 4B4QA 4NHMA 2IWGB 1H9WA 5HCHA 2DCTA 1MS4A 1IS6A 1UNBA 2F4PA 5GZEA 4GWIA 1RITA 2RS52 4KBBA 2J1UA 2D44A 2VMHA 4BB3A 5IAXA 3SCGA 2JECA 5CAZA 1FV2A 4MGTA 1GZCA 1ULDA 2A3XA 2E6VA 3WDXA 2FCVA 2VO5A 4AWDA 3WHUA 1LEMA 3T30A 1RVF3 1CD3G 3LSEA 4AHXA 4D6RA 2W2IA 2OVUA 1QHDA 4Q4V1 3FBYA 4C8DA 2ZMKA 2QQIA 3V56A 4CDQC 4D94A 3WDWA 3I59A 5ACA1 3TEXA 4PI2A 5L9BA 5CADA 5JZGB 2GNBA 1U0AA 3I2IA 3NO8A 2DVDA 5EHDA 2NLRA 2Y0OA 5BY5A 3ILFA 5JR7B 3CKHA 3DKQA 4QPYA 2YB7A 4NWWA 4OLLA 1LTEA 3H1MA 2PHRA 1RVF2 2FCTA 3J7HA 2ADEA 1PO22 3CJIC 2JG8C 3AYDA 1SBFA 3RS6A 2C24A 4LKSA 3VBFB 3OBRA 3PVOA 1OOPB 1VAVA 3GALA 4XQWA 3KV5A 2WKKA 2ORZA 2P5BA 3N7LA 2WT1A 3SMHA 3WW2A 2EXIA 5FZ9A 5A3PA 4AW7A 3POYA 4DPNA 2GC2A 1LGBA 2JENA 4P00B 4NPRA 3MW3A 4I3GA 1JYTA 2J1RA 1DIWA 1ACCA 3T3YA 4ARYA 1OFSA 1W8WA 4NHXA 5FZOA 3TN91 1EV11 3RJ2X 1KD7A 4OUMA 4KH9A 1GR3A 3O0XA 1HB1A 1E5SA 4GZ9A 2BZDA 4CDWA 4YG6A 4P9YA 3QCWA 2W52A 1HLCA 3AL5A 2P2KA 3M70A 5FLIA 1V6KA 4JTNA 1RMU1 3VZLA 2JDZA 4M4PA 1HRI3 3PDQA 4XMIA 3BN6A 1PIV1 5JZGC 5GJ6A 3R4SA 4RS5B 1HIXA 3K4ZA 3T09A 4MGIE 1H6XA 2F6BA 1YEWA 2DCJA 4MADA 2GSYA 4PIXA 3WCRA 1FT9A 4FTEA 1YC61 1CZTA 4BZ4A 4YLZA 2JDMA 1UX6A 1HXS1 1RUE3 4FQ4A 2Q1ZB 5J98B 1OF3A 4BE3A 2IXLA 4UFHA 1GSLA 1J58A 1HRI2 4BJ0A 1SLAA 1DYPA 2VTFA 3C2UA 4A3ZA 4YM0A 1PO12 1X33A 4XAAA 1X36A 1O3TA 1GYKA 2QNKA 3WW1A 3I3EA 1DP0A 3WUDA 4Q0UA 2RJKA 4WM8A 1Q8OA 1SDDB 1JZ3A 2XGXA 1OQ1A 2VG9A 2B8MA 3T0AA 1RUE2 4QKDA 2OZJA 3PLQA 2WQZC 2W1WA 1LESA 1PX4A 3OF1A 4MLOA 4Y5TA 2LROA 2R043 5FV3A 5FZEA 4QMAA 3LE0A 2UWCA 3PMEA 4FPOB 4CU9A 3MF9A 4GH4A 5CFDA 5FXZA 3I3MA 2HWD1 2X53S 2XBO2 4Y1YA 4UI9L 1QJX1 4DRVA 1SLTA 5JWPA 2EA7A 5FDBA 1BEV3 2TBVA 4QPWA 1HJGA 1YXWA 4E4DX 2J1VA 4RA0A 2R042 5FZ3A 5A33A 3UGFA 4LORA 1C8M3 4OQ8A 4CP2A 1ND3A 2VE1A 2JKBA 2VOWA 2X8KA 1I6XA 4NOTA 5F3GA 2XQXA 1RUC2 4RN5A 4IEXA 5BNPA 3LOBA 4XUTA 3MI8A 4FPCA 2K2SA 4UFJA 3WEZA 4KGGA 5H9QA 3HD8B 4LHKA 4IUGA 4CEYB 4EN7B 3BTZA 1UY2A 3DCQA 3ZXDA 1JZ7A 2Y60A 5C9AC 3H8RA 3KM5A 1M4WA 4DZGA 3HNYM 3KLSA 4CUAA 2XQRA 4E9KA 1VBE1 2H6BA 3DPRA 4JGYB 3L2YA 3B02A 5FO9B 2Q0AA 3NV4A 1K5MC 3TRSB 3ZYBA 4BIOA 5IW0A 3AX4A 5FK8A 3E6CC 1W03A 4COUA 1OLRA 1W6MB 3TNPB 3JU9A 3E1F1 4N9HA 1ZBE2 3AJYA 3TB0A 2V5YA 3MUY1 1FPN3 5SV8A 1HV1A 1ZM1A 1Q8PA 2IXCA 2X29A 5FY7A 1IQAA 3BTYA 4INDA 1JTZX 1MS0A 1YQ5A 4G4FA 1AYM1 1MEC1 4FFFA 4UBHA 3TWIA 4B7EA 5C8CB 3JXSA 5F3EA 3JD71 4Q29A 3NJXA 1I5PA 4QDRA 1SLLA 1OHFA 4KWJA 5JUVA 3WP4A 3KVBA 3ES1A 2HBUA 1LCLA 4H55A 3ZSKA 1NCQA 3WG2A 3S57A 3E97A 4Q2FA 2D5FA 1POV3 5F3CA 1D7PM 3IDEA 1DHKB 5ABJB 1XE8A 1SCRA 5K0UA 3ZYHA 3K3NA 4AVCA 1DYOA 4GQ7A 4XF9A 4CSWA 1V0AA 4YNIA 4EZHA 4A3XA 4AFAA 4BWOA 1DYKA 5JSOA 2UYBA 3AP6A 2EXKA 2I74A 1VRH3 3ZXJA 1LGNA 5H9SA 2VULA 4OULA 5APAA 2XPJA 4HXCA 1WLDA 4HZFA 2A5ZA 1OLME 2YHJA 5T3NA 3RMXA 5F5AA 4AE2A 2YU2A 1WMEA 3P1IA 3EO6A 3MYXA 4E27A 4YW3A 4COYA 5DAXA 2A3WA 2WS93 3GCXA 4FCAA 4LBJA 2CV6A 3LEKA 2C9AA 1LOFC 1RINA 5L7OA 4IE7A 1VRH2 1LENA 4AEDB 3VLBB 3POIA 5C3QA 5CFCC 1LULA 2ZHLA 3MW4A 3VD3A 2R32A 3KB5A 1OI6A 4IW3A 4KGQA 4YGDA 2AREA 4Q4Y2 4R9AA 1QQP3 4QGNA 2DBIA 1REEA 3LZZA 4FP3A 2XWJB 3H7YA 4M3CA 2E51A 2UY9A 1PVC1 2QDNA 4WVWA 2ZMNA 4CPBA 3SCHA 2BQPA 2JD4A 2GNDA 2JDYA 4EWDA 5KR7A 2VZTA 3K48A 2BWAA 4QDQA 4QQPA 5C8WA 1QGLA 1HKDA 1GZ9A 3PU8A 1K42A 2JXAA 1W04A 2B9VA 1W2OA 5FPAA 3JCIA 3WP6A 1OC1A 2Q30A 2H0VA 2WFPA 3J9SA 3UKNA 1QQP2 1QOOA 4O9EA 1RUOA 4OHXA 2J22A 3VBSA 3VBRA 1YFWA 4QPIC 2D6MA 3FLPA 4JAAA 2VVEA 2XJTA 3J7MA 3P5BA 1ND2A 1UOJA 3UJQA 2C9KA 3OYWB 1VAMA 2Z5WA 4GA9A 5EWSA 5IJRA 2D6OX 2ZOEB 3PL0A 4I01A 5F2WA 3WV6A 3BIEA 2R16A 3KV6A 3ZN5A 1K5JA 1TMF1 1US2A 3P3PA 3BB6A 4B3NA 1YRZA 2VOVA 4Y5SA 1VB2A 3BUCA 2V4VA 4BQ5A 4COZA 4DUWA 2EICA 2YFUA 3M3CA 2AR6A 3IKWA 2BYVE 3NMBA 4Q1PA 3NW4A 2ZKLA 2P17A 2QQJA 5LASA 1DQ2A 2XHNA 1H30A 3Q8BA 1ST8A 3PTRB 2ZABA 3UGGA 4C91A 1RUF1 5F37A 3LAGA 3RZZA 1MVQA 2G9FA 3ABZA 4RQPA 2F4LA 1PK6C 3O7OA 1UD1A 3ES4A 2DTYA 1VB4A 1MQTC 3FFQA 3M1HA 4YG0A 3ZFFA 3HMYA 3NNGA 1ULOA 2ZJCA 3DYMA 4IXLA 1WKYA 5K9YA 1FYUA 2FZ1A 2XJRA 4MXWA 3I7DA 1V6MA 2ZTNA 3I2FA 4QU2A 1UKGA 3ZXFA 1H4HA 4QU1A 4MH0E 4UFMA 2VOTA 3CLPA 5JR2A 3LKJA 1UWWA 1G9CA 2HWF2 3ZXGA 1UZ0A 1RJ7A 1CGPA 4Q4X3 4TLGA 5FQ0A 1VRBA 1AYN3 1XOYA 5AVPA 1F4HA 5DDJ3 1MZ5A 2AACA 2EIBA 5FO7B 5LA1A 1F15A 4AI3A 5FPXA 3VZNA 1CAXA 3NAPC 2VH9A 4YRDA 3RZKA 2WBKA 3PVBB 4BHPA 1ZA4A 2OQ7A 3T0DA 4L8QA 1YFXA 3PNAA 1LHOA 1AYN2 1NYWA 3MUZ1 2KM2A 3AK0A 2A6XA 2R072 4FPKA 4JDMA 4N8MA 4L0PA 4QKFA 4Y1UA 1RUH2 2OW4A 1SFYA 1SACA 3KV9A 1ZRDA 4D6SA 5E6HA 3V65A 5I8SA 3GZAA 3UETA 4AHZA 1JHNA 5FYMA 3OUJA 4Y26A 3OUIA 1T2XA 2RM22 3BALA 3ZDVA 4META 2IXHA 3VL8A 4FBFA 4I3PA 2BOJA 4D7SA 1VBA3 2QQNA 4PDWA 1AUYA 1QJU2 3NV3A 3OD4A 2HEWF 3T2QA 2VTXJ 5LW9A 1WUVA 5AC91 3BPSA 1ZVFA 5JMCA 3IZOA 2A6ZA 2WR9A 1FAYA 4PJYA 3WOGA 4UW5A 5A6XA 5HXVA 2FQPA 1MVEA 3SCFA 1B35C 3W9AA 1HQNA 4X8PA 4C0BA 5BNOC 1PGSA 4GMP0 4ZU4A 3RYKA 4I30A 4LITA 2D3PA 3HAGA 4UF0A 2KXLA 4WBBA 4HL0A 4XF0A 4C1XA 1OQDA 4HKOA 3THTA 3WR0A 2C0ZA 2TEPA 4LXLA 1W9SA 3B5LB 2YGMA 4HSLA 1VIWB 5CFCB 1J3QA 1POV1 2YY1A 5FJHA 2O8QA 4YVSB 5A7NA 1JS9A 4PT6A 4LNVA 3N35A 4YVWC 4BDVB 5C4WB 3O1MA 1H9PA 2VGDA 1AR92 4DEQA 5I93A 4YPJA 4XXPA 2WWUA 1CN1A 5J48A 1CQ9A 4DXSA 4IEZA 3O1SA 1RC6A 3AMMA 5K8SA 3ILNA 3Q8AA 3PUQA 5KXEA 2LUWA 3KHCA 1WD3A 4RFT0 4MGQA 2YFZA 1PZ7A 1QXPA 2ZXQA 2GMEA 4LHNA 2BBAA 2K0GA 2RHPA 4M3CF 3H7JA 3WQ0A 1V6JA 2G4IA 4EYUA 5KHIA 4CCLA 5C5UA 3AZWA 4ORFA 5KHKA 1CIWA 4AFMA 1I9RA 4HPKB 4EN8B 1LOEA 2WS91 3OY8B 1G9FA 3VDAA 3KZ4C 2XLGA 3LFIA 5FJKA 2B5HA 4FPYA 1PNGA 4LR4A 5FZFA 3ZR6A 1LOCA 1MS9A 3PTYA 5DUVA 2PELA 3AYEA 4D7TA 3TEYA 5LRSA 4MVTA 3LA7A 1TEIA 2OUHA 1C3HA 3ALQA 1LB2A 1NXMA 2ERFA 2VZOA 5E16A 3U4SA 4C90A 5FYTA 3USUB 3IPVB 1I3HA 5IYYA 2K46A 4XDPA 3CZUA 1XRUA 2D98A 3Q9OA 2R30A 3RGBA 4OUEA 5JSRA 3FE5A 1DLCA 2AEYA 4Y20B 3RZMA 1OFNA 1LGCA 2WNVA 5F7UA 5G05L 5FREA 1V9U3 4M0NA 4N90A 1DGLA 1UYPA 4QB6A 2ZGMA 3HQXA 4QX2A 5EZWA 5FZAA 2XXZA 4HK8A 4HVQA 4FQZA 3OEBA 5JIAA 3AMNA 3LA2A 5GM0A 2ZZJA 4K8FA 4F3JA 2YPDA 2ZMLA 5DMYA 3KT7A 3E5QA 1RUI3 1UF2C 1FMD1 2RE9A 3NNFA 3OOXA 4N43B 4TWTA 3ZYFA 2AGSA 1GP5A 3CIHA 3ZXLA 2NYYA 2VU9A 3V0AA 3LD8A 2ZX2A 2XJPA 4D3WA 5CA6A 1JZ2A 3CHXA 3S5QA 2GU9A 2Q4SA 4N7IA 2XJQA 4OFGA 5FYUA 4PI0A 1UZWA 2XB6C 3KCCA 4B4RA 4CDWC 3HQUA 1U5XA 5CEHA 3RG0A 2IXJA 1NY72 5DPNA 1GZWA 2ZX4A 2PLV1 5FZ0A 3I54A 4AEKA 1IGOA 1Q3EA 1MZ6A 2E31A 4Q4V3 1F5JA 4YZ3A 5EYYA 5LBFA 2R0FA 3WG1A 4AEMA 2XR4A 5ACA3 5FXWA 5D8AB 5I8YA 2JX9A 5FY0A 4AQTA 3DUIA 3DV8A 3HT1A 1APNA 4P14A 2VCBA 3ACGA 3NJVA 4NMIA 5A1AA 5IVBA 4ATFA 1MZEA 3AB0A 4DXRA 2OUJA 3FLTA 2Y8KA 4GWNA 1RB8G 5KBFA 5T5OA 1W0NA 4E8DA 5A3MA 3URFA 5L19A 4QX5A 4AK3A 1F2NA 1AJKA 4Q4X1 4B7KA 4DIQA 3SH3A 5ACA2 2C26A 3S7IA 2PTMA 4Z92B 4U36A 4WM8C 3K4AA 5DDJ1 3RZLA 2PXJA 2X5IB 4NAOA 3H50A 2WNUB 4BXFA 3VKMA 1W6NA 4L99A 4DXZA 3UGHA 4BISA 2FZ2A 4D0QA 1XE7A 4V2WA 3POGA 2KA3A 1EV13 4YFWA 3TN93 3DXUA 5ERLA 4I0AA 4AHWA 2UU8A 4DFSA 1UY4A 1RHI1 3E5XA 5FY5A 3BI3A 5F5QA 2A6YA 5DUXA 1UU6A 5BNNA 4JTOA 1JU3A 4W6WA 1W8TA 1O4TA 3AYCA 5BV6A 2CGPA 4GH4C 5CFDC 1KGYA 1OMIA 3S6PA 3M4FA 4LA2A 1FNYA 3Q8EA 3QLQA 2XG3A 1LOGA 2HKXA 3HWJA 1EUUA 1PIV3 1E5RA 1EV12 4R9CA 4WM7A 3WT3A 1EPZA 3C7OA 2VZ3A 1PMIA 2ZGOA 1ND3C 3SXWA 2VNGA 3WF3A 4YW2A 4DMIA 1G8WA 1VBA1 3QOPA 3R4UA 1HXS3 1E5IA 1OH3A 1RMU2 5BNPC 1COV1 3OD0A 3HVDA 3NV1A 2QUOA 4ZY9A 3VKFC 4LLFA 3EXUA 2I07B 3D5OA 2ILMA 2ZX3A 3LB9A 5DG2A 2P3JA 1O8SA 4XE9A 3MIBA 1PIV2 1WCDJ 2O14A 2RG4A 4LK6A 1OA3A 2ZAHA 4W65A 5KHHA 1JZ4A 2JDNA 2NMNA 1KXGA 4FAGA 2WLPA 4BM8A 2W47A 3DPRC 2OPKA 1WW7A 1H8VA 1S1AA 4JDOA 1XNBA 3FBMA 3KMHA 4QHBA 1W6PB 4B4PA 2G9ZA 2VW1A 4X6RB 5A7WA 3O0VA 1CJPA 3USSA 1UIJA 4GWMA 4YW1A 1KS4A 2DURA 2DUQA 5T50A 2HEVF 1WCSA 4AQSA 4K3UA 1YUDA 1X7NA 5ANNA 3WX5A 1BKZA 5A3UA 4MUVA 4QQHA 3VDDA 4P9WA 2YYOA 2HWD3 1VAKA 4XF1A 4O9GA 1QJX3 2P34A 2BP6A 2NM1A 1KDMA 1S2KA 1ZNPA 2DU0A 2PMWB 2BGPA 5FZ6A 5C71A 1DF0A 2VZSA 3C7EA 3RRDA 4QX1A 1NXD1 1NCQC 1KFUL 3POBA 3WHTA 3H8XA 2RR11 2WLQA 3T1MA 3OPWA 2V5DA 2HWD2 4QXCA 3K51A 1CAUA 2HYKA 3TOJA 1QJX2 1N1TA 3FWEA 3JQXA 3NNLA 4XFIA 3WSOA 4CCOA 4IE0A 4GKXA 3FN9A 4MX3A 3ZYJB 4JCKA 4JZRA 4YGCA 4W8JA 1S0GA 4AG4A 2EIDA 2ZACA 5HV0A 1W8NA 2GC3A 2HWC3 1XSQA 4GD4A 5H9RA 3VDBA 3D82A 2WABA 4HBNA 2XONA 4CDQB 3V0BB 5EP9A 3I2GA 1DZRA 4IEYA 2B9UA 1L7QA 1VLNA 3Q8FA 3OB8A 3UJOA 1BBT1 4YSFA 2XLAA 4XPVA 4QDSA 5IK4A 1MPXA 3C7HA 5J3UA 1V9U1 2VMDA 4O7XA 3UYJA 3TYJA 1RGSA 3GNEA 4Q0PA 3CJIB 2JG8B 4ASMB 1VBE2 2VNVA 3GCWA 4IV1A 2JKXA 5L7OC 3L2HA 4BXSV 1UO9A 1YO8A 2VMCA 5FPVA 1GP4A 4NHLA 1AYM3 1MEC3 1LNSA 1Y43B 2AH2A 2XOMA 3JD73 4ASKA 4BLJA 4IV3A 2FDGA 2W0XA 5DQ0A 5D1IA 3POJA 2CWSA 1W05A 3NVCA 2PQSA 1H4GA 4GB31 3HIFA 1OT5A 2UY8A 3UKVA 2QKDA 2VUJA 5ANQA 4RGKA 4YZ5A 2VZUA 2J1EA 3IB3A 3M3OA 3MLJA 2EXHA 3OCPA 3FUOA 1UAIA 3QACA 1RUG1 1RTVA 2EAKA 2JDKA 5I0TA 4EV0A 3SITA 1VBD1 1AYM2 1MEC2 1ENXA 1PZ9A 1UYZA 1PGW2 3JD72 4J1WA 3JUUA 4O65A 3S0MA 5EPAA 3C7FA 3VBSC 3VBRC 4H14A 4OUSA 5FMOL 1E5HA 4JGZA 2OXBA 2HLEA 3N36A 3ZFEA 1BJQA 3IWZA 1ND2C 1SCSA 1L7LA 4BYYA 3UK9A 1WW6A 5B4NA 1DU3D 2LTNA 4WVMA 5CKMA 2WWSA 2WZEA 5FP8A 3MFCA 3VKOA 3EJKA 5FZHA 4XOGA 2JE8A 4AQ6A 2UYAA 1OLMA 4XUQA 2FDKA 4AGGA 3PVNA 3AFGA 4CP1A 5LBBA 4Y1XA 3NJZA 4KU7A 2LM3A 4EE2A 5JXIA 3ITQA 3OGJA 4ZXKA 4XABA 1IKQA 4UWDA 4QKNA 3NRUA 4XW3A 2XUMA 2B39A 5A7PA 3QH7A 4N53A 3RZHA 3VV1A 1J3RA 3PIGA 1PVC3 2WT2A 4E4SA 1LKNA 2GC0A 2V73A 1SPPB 3EBRA 3JZVA 1STMA 5HXMA 3IMNA 4UYBA 4FAHA 2BFUS 4LUKA 3RZGA 2EVXA 3J26N 5SV5A 1WA6X 2GP3A 1KEXA 1BCXA 1AHSA 1UYYA 2CU5A 1JOPA 4PDWB 4YARA 5HBAA 4CU7A 3DGTA 2DVAA 2IXKA 2YROA 2R1DA 1UY3A 2E26A 4CCMA 1O59A 2I45A 1H2MA 2QQMA 5FYHA 1PVC2 3OG2A 1UIKA 3HT2A 4XQ4A 3LIGA 1QNWA 4ZU5A 3U75A 2OT7A 1C1FA 3N4MA 2VCCA 5FPLA 2FD8A 5GLVA 5HPOA 1ASJ1 2IFWA 3B7MA 1TMF3 4AVVA 4CEWA 4AVSA 4C0HA 1JMUB 1REFA 5IATA 1SLCA 3CZJA 4K7JA 4XCAA 5LCWL 5JOYA 1DDLA 2D3SA 1YQCA 5F39A 4I09A 4WV8A 1WCKA 4P9GA 1SFPA 1QNYA 4FPGA 5EQUA 5HCBA 3K4DA 4FP2A 5C9AB 1RUF3 1R081 5E8AA 4QXKA 4BQ1A 2QQOA 4YZ4A 1TMF2 1TG7A 5EJ1B 4FTSA 3WW3A 2ZGUA 3IDBB 2R061 1OPOA 1WCQA 1K5MB 3O5SA 1ENSA 4XFHA 5D21A 2PYTA 3BGAA 2P6CA 1IZ3A 1Y3TA 2JE7A 4KWLA 3FHIB 4IE4A 1HB2A 3POFA 4C1WA 2FMYA 5JSPA 4F8AA 4PDWC 2XJUA 3MIDA 4NPMA 1XNCA 3NV2A 1LRHA 5IT6A 3ST7A 3KD4A 2W1UA 2WA4A 4A7KA 1HJFA 2VPVA 1XBFA 4UW4A 3RYPA 4AAXA 5IFPA 5J96B 3UESA 5L73A 4URTA 1OKOA 2WQ8A 4Q27A 4ZZ5A 3M3IA 1LOAA 2ZGLA 5T5LA 2RS31 4W6YA 3CJXA 1BVVA 1CAVA 5JCTA 4F83A 3KCYA 4QT6A 4K20A 3IIIA 1NQDA 2D5HA 1TVGA 2JB8A 1ZBA1 3NWKA 5KWRA 4AI1A 3TEZA 3OGSA 1IS4A 1CVNA 3BYWA 3PMSA 4WVVA 1J59A 4LBNA 1UW8A 3JQWA 3R6SA 1BK0A 5C3OA 4MXVA 4PLNA 3FFZA 4Y5Z0 4MGSA 1YI7A 1BEV2 1W6OA 4QX3A 4UFIA 5FMDA 3JB8A 2Q8CA 1C8M2 1W6QA 2ZBJA 3QD6A 3VN4A 4HG6B 4B29A 2HWC1 1AR73 3RMYA 2MEV3 3NKGA 1AL21 2D6KA 1X9TA 4ARXA 5IK8A 5FMBA 4UOJA 3J8F3 5CVRA 1GNZA 4D8MA 1BQPA 1VBC1 1S0EA 3J4UH 5HCAA 3FMGA 2LRPA 1UPSA 2PQQA 2AUYA 1XU2A 2VTXA 3MIHA 4PIYA 5CIRA 4FOVA 5AC93 1ENRA 4XDOA 3ELNA 2HWB3 1ZZBA 3IDCB 4OMCA 4EJRA 1WLCA 2YV8A 3WF2A 1ONAA 3GJBA 4OQ9A 2HBTA 3GBWA 5F3IA 2XJSA 3ZXKA 3PHMA 3RYRA 4NAMA 5CKNA 1QJZA 1RUD1 3N3HA 3DXTA 3DL3A 5AC92 4XMAA 4DUXA 5FOBB 2WC2A 1FPN2 1HDKA 2WNVC 1H8TA 3NQHA 1PHMA 2Y6LA 1NLRA 1H2LA 3VBOA 3ON7A 1OUXA 2AEZA 4JVAA 4P08A 2ARAA 5FZ8A 2GDFA 4QPIB 3U07A 4CPBD 1IPSA 4XUNA 1UOGA 4ES9A 4Y22B 3ZN6B 4KWUA 1TNFA 2QDRA 1IPKA 3HOBA 1W06A 3ZFGB 4XXAA 1PGL1 3VBUA 3T2TA 3F2ZA 3Q8CA 5DUUA 4E2SA 2VZRA 5AVAA 3KWVA 1MS8A 5GZCA 2JG9A 3P3NA 4A44A 2A3YA 5F9TA 2Q1MA 4JHTA 1UU4A 4ZPIA 1ULFA 2DFCA 1Y9MA 1W9FA 4PHZA 1ULPA 5LBCA 3I97A 1TQ5A 4RR3A 1A8MA 3KCXA 3MIGA 4H7LA 4Y33A 1N47A 1LOBA 2WSVA 4EN0A 1PK6B 4JDNA 4CP9A 2QJVA 1MQTB 5FWJA 4MGKE 2ARBA 3CDZB 4JRLA 1MZFA 2BOIA 2WS92 3CEWA 4AVAA 2D6LX 2QQLA 1K12A 4Q4W1 4NR1A 3S30A 4FPEA 3FX3A 4RSUA 3VD9A 1GQGA 1LECA 2GN7A 2VUDA 3O1TA 4YGBA 1UMZA 1W8ZA 4GAZA 4RGGA 4MZUA 5IVVA 1CZVA 4XYXA 1V6OA 5LA0A 4OMDA 4P9XA 4QB2A 3ZFGC 2GH2A 1FMD3 4BQXA 1CIYA 2HEYF 3UV9A 4KG8A 4CCEA 3PIJA 1AR61 4FTBA 3HN1A 2BGOA 5FUPA 5I0DA 3NAPB 4RYDA 4X6QB 3WDTA 4Y24A 4ES8A 4XDQA 1IS5A 1Q8QA 2DDUA 4CYDA 3WNLA 3U78A 5A3LA 3EQEA 1WLWA 5FZ1A 5BNNC 4NIGA 1UYXA 3NNJA 3EB7A 2PLV3 1FMD2 4CUCA 4LBLA 4DS0A 1I1EA 3AKPA 2J7MA 4Z2WA 1T6BX 4LKEA 2GMMA 1Z0HA 2MPFA 2BEOA 4LKFA 4WM7C 1EAH1 3UNPA 4NIDA 4QPGA 1QU0A 1ULCA 1A78A 4HLTA 3H9AA 3WF4A 2X10A 1U12A 1B09A 5M0TA 1N1YA 3AC0A 2OX0A 2PLV2 1EP0A 4OI4A 1WW4A 1XXNA 2W91A 2J1AA 5LK5A 1FOD1 1UOFA 2WO2A 5DZGA 4LQRA 2A75A 3O1PA 5EYXA 1B35B 4FXKB 5DAPA 4MGZE 3LWCA 5BNOB 1QH6A 2I2SA 5KXDA 2KD7A 3HJRA 4LLOA 5GKAC 2GNMA 5IK7A 1GOFA 2YBSA 1X8EA 3P6BA 2FDJA 5IFTA 2D97A 1QJEA 4JKMA 3H42B 3GXUA 4YM1A 4YFZA 1HB4A 3T0BA 3PURA 4YM2A 1RHI3 2DFBA 3BODA 3BOPA 3KVAA 3THPA 4A7ZA 1GBGA 4Q4X2 1BLZA 2BVBA 4OZOA 4YVWB 3A7QA 2EAAA 4CU6A 1RJ8A 4G9SB 2CAVA 4IERA 1FNZA 3AMPA 1PM7A 4XFBA 5FZBA 5GLUA 1NE4A 5C33A 1UX7A 5DDJ2 1E57A 1XC6A 5FZ7A 3VDDC 1F8VA 4K40A 4R52A 1YCIA 1C8NA 1NAEA 4IQPA 5JZGA 4Z07A 1A3KA 2XUEA 3MPBA 1AR71 1PMJX 2MEV1 2VQ0A 5JOZA 4I02A 2E53A 1SLIA 1RHI2 2X09A 3J8F1 5FFOC 3WW4A 1W8FA 3WNOA 5A32A 3SISA 3RDIA 1GOHA 3U10A 5A3NA 1UXXX 1W2AX 3D4KA 1T6GC 2BRTA 1RXFA 4I0BA 4XBLA 1RYYA 2QQKA 3ASIA 5I0UA 3VZKA 1XJAA 4EWAA 2XMLA 3VBFA 2VVFA 3AZYA 1COV3 2Z4FA 4DRRA 4GXLA 1OOPA 4NPLA 4COWA 2HWB1 1ZBE1 4DXTA 2N7GA 1UCXA 2CHHA 2Y0IA 2QBXA 2WO1A 1ZA7A 4XFAA 4XZPA 2BV4A 3LEGA 2TUNA 1AVBA 1OPMA 2PA7A 1O3SA 1VBA2 4AXOA 3QH6A 2DVBA 2R6QA 3I59B 3VZMA 2VY0A 3LEIA 3RZJA 3H8UA 3L9JT 1COV2 1JW6A 2PHTA 4DINB 2PHXA 5FYVA 1QOTA 1V70A 4D6QA 3GZEA 1DG6A 2Y64A 2GN3A 2WO3A 3EYPA 1W3XA 1SZBA 3H3ZA 4BQWA 4IV1C 4JX0A 4QB1A 1R1A1 4TSVA 3ECQA 2LS6A 2QE3A 4CCJA 2XWBB 3BU0A 2EIEA 4I0WB 1WCUA 2A6VA 2XVKA 4RS5A 5FUIA 3RFRA 1R091 4IV3C 1QJFA 3I8TA 1GANA 1GU3A 4BQ3A 3LSDA 1F5FA 1ZYBA 2XDVA 4TTGA 5CNAA 4NRQA 1S0BA 4DB5A 1L7RA 2ET7A 2RR13 2XJVA 3O12A 5FZOB 3TEWA 5DZFA 1X50A 1NZIA 3PUIA 2V72A 4R8HA 2BGCA 4DY5A 2C6SA 3ORJA 5CG9A 1VR3A 4CDWB 5T54A 1H1IA 4FOQA 4FSJA 3JBG1 2JDHA 4DNYA 4JGZC 4AQ2A 1JN2P 4NHKA 4XIKA 2UWBA 3ZFEC 3RQ0A 1KS5A 3AVSA 1JYXA 5EFUA 3WG4A 4NE9A 1WD4A 4Q4Y1 2RR12 4LA3A 4P5HA 1BZWA 1W0PA 1H2KA 3J7LA 4CP0A 2VAUA 4HN0A 2V4AA 4YW7A 3WDUA 4XTPA 1BBT3 3AP7A 4NVPA 4BH9A 4JC1A 1UKRA 5J37A 1CPNA 4MOAA 2WDBA 4K9SA 3WP3A 2J42A 4A45A 3BPZA 3CQOA 2CYFA 2WIIB 5EJZB 3ZVXA 2ZEZA 1PX3A 2YBKA 2ZGNA 3GBFA 2HWE1 1M06G 1Z7S1 3IAQA 1AXYA 2JE9A 2RS11 4CDXA 1TZOA 3BCWA 2BDRA 1WW5A 2ZGQA 5FXXA 5KC5A 1SDWA 2W95A 1YIFA 4N53C 3W5NA 1SHWB 1RUJ1 1BBT2 2JD9A 1XYNA 2Z69A 4QAWA 4WM8B 4YZ1A 1HRV1 1SQ4A 4GB33 1FV3A 2P4EA 1UY1A 5FIXA 1R1ZA 3B9CA 1Q8SA 1KJLA 4BQYA 1FXZA 1V9U2 4ZONA 4BU2A 1NX9A 1QDCA 4QGLA 3ZYGA 2QFEA 1ZRIA 2BERA 2JICA 5GLWA 1RUG3 4YYOA 4CEYA 3SLIA 1C5IA 1VBD3 4XJ9A 4A41A 4QX7A 4W4ZA 5C70A 1NA1A 5JPNB 1DQ5A 2FDHA 4PLMA 5ISLA 4A6OA 1RUI2 1BYHA 3HNMA 4JGYA 5FZGA 1A6CA 1LHWA 4GH4B 5CFDB 4GB32 1SEFA 2OA2A 4CRQA 1Q5OA 1ZZCA 2BUKA 1L3JA 2E9QA 2GAUA 5F2SA 2ZAAA 2DUPA 1GFF2 4LEJA 3SH5A 2PHLA 5FZDA 1Q43A 1BK1A 5A33B 1NKGA 1W6MA 3SHRA 1LU2A 3CNAA 1UQXA 4ZXEA 4CEWC 4ZHNA 1QJY3 1ND3B 2Z42A 1JZ8A 4L92A 2CTVA 1QMJA 3AM2A 5A3OA 3HEIA 1IG0A 1J1TA 4GWJA 3T4HB 5BNPB 4QM9A 5CFCA 4JRAA 4ZU7A 1W99A 4Q4V2 5C8CA 1WBLA 1OH4A 2A73B 2LALA 1YI9A 2JB4A 5JI7A 1W9YA 4JQTA 2E32A 3BTXA 5JDBA 1JBCA 1UMIA 3DPRB 5LEKA 3H8OA 1JXNA 3F95A 1YQ6A 3WQ7A 5A1FA 1JYIA 1OBNA 2W87A 3GBGA 3MO4A 2AZ5A 4XTMA 5EV7A 1TME1 5FYIA 3W58A 3B9IA 5ABJA 4JKLA 4Z82A 2ZGKA 3CF6E 3IMMA 3AMHA 2VR4A 2D93A 5FMCA 3ZPYA 5DG1A 5CBLA 3X29B 2WN3A 3T2OA 4HN1A 1N3QA 1ALYA 1IG3A 2FMDA 3DYPA 2VXRA 2WQ4A 4CCNA 1K45A 3AXDA 1SBDA 5F32A 1O6UA 2VMEA 3MZHA 4LBOA 2W92A 3A0NA 2R071 2EF6A 3SKVA 5FY1A 3B69A 5F6LB 4UAPA 2W94A 2Y34A 3TN92 2MNGA 1ASJ3 4XHXA 3I4IA 4CUBA 3ZYRA 5DAWA 1FX5A 3A0KA 3ZM8A 1NCQB 2Y6KA 2EIGA 1J3PA 3M7AA 4LMFA 2RDSA 2DV9A 5K0UB 2D6PA 1CAWA 4AEDA 3WZ1A 4E8CA 4XVHA 5IVEA 3FZ3A 2ETEA 1NOVA 1QJU1 2IVJA 2VUAA 4L2NA 1XYPA 2J1SA 2VECA 1MR5A 4B1LA 5EIYB 5B2GB 2VQUA 4B8EA 1R083 2VZVA 5JAXA 5JI9A 3DN7A 3MDPA 1LHNA 4DY3A 2VC9A 3WDYA 3ZYIB 3VHOA 5B4XA 2PAMA 3ME2A 4K1ZA 1HV0A 2ZHKA 2R063 3N7MA 1IPJA 3N9OA 4M0HA 4XJZA 1HXS2 2VMFA 4KWKA 2H0BA 3HQRA 1GWLA 1QEXA 3OEAA 3IN9A 3BOWA 5FY4A 3WF0A 1CX1A 2RDNA 5FZCA 1V6IA 2ZEYA 3H1WA 2DCYA 2DUOA 3HBZA 3AP9A 4IE6A 4TYSA 5CKQA 1R082 1UY0A 3AL6A 4IETA 1UN1A 4S2FA 1BMV1 1NCRA 2WYSA 3N9LA 1NT0A 3RWKX 3UL2A 5L7OB 5FYBA 3RPQA 3ZSJA 1LODA 4OI2A 2R062 3OYWA 1GKBA 3RJRA 4XFCA 1O91A 4BQ4A 2VOKA 4DQAA 1C1LA 4H2AA 4WVZA 1GLHA 5D2AA 3VKNA 2RS33 4CCDA 4EQVA 4M3CB 4LBQD 1CPMA 1ZZ9A 3ZSLA 2A70A 1ZBA3 3AKQA 3GDBA 4KU8A 4XACA 4EZ4A 1BHGA 1GMMA 1JYCA 2RVAA 5T5JA 5K0UC 1H8TC 5FKCA 3N9PA 4A2UA 1CR7A 2WYFA 2WZR1 3VBOC 4GMP3 4M4RA 1VMJA 3J7NA 4JKKA 5A70A 2RS32 4WZCA 3D0SA 1NQJA 1ZRFA 5FZMA 3VBSB 2WWJA 4TLFA 5GALA 3VBRB 2ZX0A 1JHJA 3MLLA 3D8CA 4XC9A 2Q8EA 3WINE 1IOAA 3MFAA 4HETA 3WUCA 1HQLA 4CE8A 2YDEA 1ND2B 5FZKA 1GUIA 3NKTA 1ZBA2 3LDKA 4LULA 1YQ2A 1AL23 5A6QA 3SC7X 3CL1A 1KFXL 4LJHA 2VW0A 4Q26A 4QQ2A 1DGWX 1LU1A 5I91A 4XCBA 2W9XA 4XEZA 3WNNA 1VBC3 1OKQA 1J1LA 2CWMA 2RV9A 2PN5A 4LBQA 5F8PA 2DCZA 2JG9C 1POV0 5FPBA 5LY1A 1YIPA 1YLLA 5JPMB 1S55A 3KS7A 4CCCA 3UKTA 4IEQA 4RHV1 5AFEA 4AF9A 1N1VA 2O0OA 2V09A 4QM8A 2HWC2 1VBB1 4NJ4A 2WFF3 2VL4A 1AL22 4BA6A 1C28A 2UURA 1DGWA 4QGMA 4RR3C 2B4KA 2ID4A 3KQ4B 1VBC2 1IS3A 4RQPB 3VZOA 4QXBA 3FJSA 3O14A 3ZFFB 1AX0A 2QQUA 1Z78A 4Y3OA 5CYYA 1RUD3 1QWRA 4XZUG 4OI1A 1D4M1 5JXHA 4MXWB 3VBHA 1Q56A 4AAPA 5EJ3A 1QDOA 2RS53 2G1MA 4BIFA 4A4AA 4RD7A 4FOYA 1ULEA 3R0RA 5KXCA 1JYNA 5LWBA 4A42A 1V6NA 3KT1A 1F9KA 1NY71 1V00A 2CL2A 5FQ0B 1RUD2 3ZX7A 4XFGA 3EHKA 2A71A 3TAYA 3M3QA 4KMQA 1OQEA 5IVCA 2ENRA 3ZIXA 5GZFA 1OURA 3LPFA 5FLJA 1QIQA 2TNFA 4XF4A 4CZSA 1QJY1 2NQYA 1CAXB 4BK4A 1D0GA 2B7YA 4QHOA 3ZSEA 4AFBA 3WNXA 4XJ8A 3WQ1A 5FMOS 4MHUA 1A34A 4EWEA 1PO23 3ACIA 1PGL2 2F17A 4OCTA 4QHZA 3WQBA 4ZKTB 2YC2A 4RQPC 1S4CA 1ZZ7A 3THCA 3ZFFC 4CVUA 3I2OA 5HV4A 3ZN4A 4YVSA 3T1LA 4AI8A 2ZGPA 3HR9A 5FY8A 4RGAA 4QPGC 3GF6A 5F1RA 4A7YA 5A32B 3AZXA 5FZ4A 3N7JA 4Y1ZA 2BFUL 5C4WA 4AVBA 2Q5TA 4Q4W3 4AL9A 3AKTA 2VZPA 2XKOA 5JXGA 4LO6B 1O7FA 1XYOA 1G7YA 4AI2A 4QQOA 4YG3A 4A6SA 4BMBA 4N7UA 4NIHA 1HN0A 1KRIA 5KXBA 5C7GA 2DYCA 4YW6A 1N3OA 1SFNA 4UF0B 1LHVA 3O1RA 3ACFA 3CO2A 4XQDA 1AR63 1WMFA 3KGLA 4Q4W2 3VZJA 1MS1A 2O1QA 3VHPA 3GYDA 4PCRA 4HPKA 2VCAA 5E1RA 3OY8A 2XVLA 1ZRCA 4LBKA 1F35A 1CESA 1AR81 1GWKA 2DVGA 3AXEA 4P9LA 5JVVA 2VCMA 1VP6A 3D3AA 3VB9A 1EPWA 4YZ2A 5FR3A 1WBFA 3ACHA 3M3EA 3CU7A 5FYZA 3MBWA 1U5IA 5HCFA 1J83A 2VVDA 4JQRA 4CCKA 1MS5A 3USUA 3IPVA 4ET7A 1AR62 1QF3A 1MS3A 1PO13 4IE5A 2NMOA 3OUHA 4LKDA 4XETA 3W20A 1EAH3 3MHZA 4Y20A 2WNOA 5LRRA 3ZXEA 4KBZA 5DXDA 2BVVA 5FY9A 2WAAA 2BBVA 3GZTB 3DEMA 5FZLA 5I0RA 4GULA 2Y6FA 1RUF2 1V6LA 1WWYA 2RMU1 1WGPA 2E33A 4X8NA 3VBFC 3VGIA 4XILA 5LA2A 5IK5A 1OOPC 4XF3A 3T2PA 4CA9A 1FOD3 3OTFA 4YGEA 3M2MA 1S0DA 1MACA 5C3PA 3LFMA 1JOJA 5CB7A 1JYWA 2ZZQA 2QQVA 1EAH2 3NNMA 2WZPP 4XUPA 4N43A 4HSJA 1QY4A 2VBDA 2R49A 2XBO3 3D0JA 2ZGSA 4R9DA 4CXWA 3AKSA 3C7GA 4JV4A 2YU1A 5F5IA 1XNDA 2OS2A 2VQAA 2CDOA 3RSJA 3AFKA 2P1BA 2P6HA 5E88A 4LPLA 1JUHA 2KR2A 2WL1A 1YJLA 2E7QA 4M01A 1FOD2 2WNVB 1OD3A 4Q5OA 1CX4A 5LK7B 2XHKA 3GM8A 1GNYA 3TNQA 1EUTA 1RUC3 2B46X 4GMP1 2YPJA 5C5TA 4IEOA 4JHZA 1ZREA 1W39A 4XBQA 3LPGA 1GWMA 4KG0A 3MEPA 1VJ2A 2VJXA 4RS5C 5D8AA 4CDXB 2BPA2 3DECA 4P9IA 5LZ6A 5IAVA 1YFYA 3RI8A 4V2VA 4LIUA 2OKXA 5JIUA 3IAPA 3RVHA 2JDUA 1WMDA 3V0AB 1BVP1 1GZTA 5BUVA 4PQ9A 1K3IA 5JXJA 3POSA 2NPIA 2DTWA 2R1BA 4OZXA 2QVSB 3W21A 1ZBE3 3WDVA 1AR72 2MEV2 2WFF1 4IEPA 1NA1B 1RXGA 4QWNA 1RUNA 2Y26A 2CGNA 1GZWB 2L9LA 3N9QA 5A7OA 3ROUA 4TXWA 2X5IA 3APBA 3J8F2 5JOXA 2WNUA 4AI0A 1W2UA 4BMEA 3H3LA 1QKQA 5HI0A 3GJAA 5FYCA 2CAUA 1O5UA 2CGOA 4TZDA 3C8XA 3IIAA 5FOJB 4XJAA 5FCCA 4AI9A 3V64A 3LEMA 2HWB2 4UW6A 3LA3A 4ITCA 4Q8KA 4LOSA 3VD5A 4CXXA 4D69A 4DOUA 1URXA 3ZSMA 4Z1VA 1IHMA 2RS51 2GH8A 3RNSA 4MV2A 1QOSA 1R1A3 2FHRA 3G7DA 3ZMOA 2RJ2A 3OJBA 1LR5A 2UWAA 3LQCA 1PGW1 4FXGB 4UFLA 4YW4A 5K4LA 5LB6A 4AVTA 3ZO0B 4CDXC 1DQ1A 4LE4A 5AFBA 2NP0A 1R093 1NE6A 5IVYA 3HBKA 1OUSA 4GKYA 3VHNA 2ZHMA 1KQRA 1WA4A 4IL7A 1W6NB 1Y4WA 5FAXA 2ZS6B 2W08A 4URAA 4KQ7A 4QX8A 5FP7A 4DEVA 1R1A2 1NUKA 4BK5A 4CEYC 3ZIWA 4G3YC 1NG0A 2QZ3A 3UT0A 5BNNB 5IVFA 1R092 1NA1C 1RVF1 1NLSA 1ENQA 5DABA 1PO21 3JBG3 1DZQA 2BNMA 4JGYC 4CDUA 4AYUA 1OF4A 1W6PA 1W8HA 2OPWA 4OHYA 1LHUA 4R4ZA 1C57A 4Q4Y3 3BU7A 5LY2A 4HT1T 2IVIB 3DYOA 4WM7B 2C5DA 2XLFA 2FBEA 1S0CA 4AFDA 1KJRA 1GQHA 2CY6A 4EN6B 2SLIA 1SLBA 4AEJA 1C5HA 1VMHA 2QTWB 3JBG2 5KHJA 1AX1A 2WJSA 3B94A 5J36A 1CAWB 4DO0A 1EY2A 2HWE3 1Z7S3 3MLKA 5C8CC 1W2TA 2IFRA 3AP4A 4LUMA 3R05A 5A3WA 3WP5A 4COVA 2RS13 2IZWA 4MGYE 1JOBA 4KI5M 3U14A 2W46A 1DBNA 1SMVA 1AX2A 5H9PA 1RUJ3 1AXZA 3RWNA 3O1OA 1S2EA 4XHBA 1HRV3 4FVVA 3E6BA 4P5YA 3WG3A 2VXJA 4I2OA 5A1LA 1DQ0A 5DAVA 2B45X 3ATGA 3H3UA 5ABJC 3I2DA 4XUOA 4IESA 5A7WB 4S2DA 1W2NA 5F5CA 2HWE2 4FI9A 1Z7S2 4NHYA 4NWVA 3I2JA 4PBOA 4TN7A 3ZMNA 1VPHA 3GHMA 3ZDSA 2BNOA 2RS12 4P02B 4FPJA 4GIQA 2Z79A 1D0HA 5FXVA 2WO7A 5FWEA 1NCRB 2WSUA 1RUJ2 3FL7A 2YG0A 1LAJA 1RIRA 2OYZA 3VDDB 1HRI1 1HRV2 5FUNA 1JYVA 4R4XA 5IHRA 3V0BA 4CDQA 1DQ4A 1PO11 4CTEA 2WA3A 1JODA 3SKJE 3D6EA 3KF3A 3N9NA 1O4YA 3WD5A 2BJSA 2RJLA 4AOCA 2DF7A 5T55A 4D7YA 4E2GA 3BKZA 1CWPA 1J84A 2YBPA 1O5LA 4S2HA 1RUE1 4PF1A 5A7QA 3CJIA 2JG8A 1GICA 5BPXA 5A6YA 3SEPA 2P37A 4AEDC 1CAUB 1GOGA 1N1SA 2W3JA 2JDAA 1G9DA 5A3TA 3E5UA 5FYSA 4XBNA 1OVSA 2A6WA 2Q8DA 1LJ7A 3OBTA 1LEDA 2HWF3 1GP6A 2XBO1 2Z2SB 2XH6A 2WT0A 3NJYA 4HOOA 1FI2A 2VNRA 1H1AA 2BTVC 3KHBA 1TME3 1DGRN 4OHZA 1G9AA 2R041 3MICA 4GJZA 2BNNA 2ES3A 3B01A 4MO3M 1GV9A 2ZGTA 2PHWA 3MIFA 4LBQB 5FRAA 4ASLA 2PAKA 4YM3A 4HFSA 1BXHA 2BW8A 4XJUA 1RUC1 1NCRC 1IQDC 3OGRA 4IV1B 3VD4A 1XPWA 4RFRB 4IDZA 1VALA 3BVCA 2C4XA 2R073 3I3DA 1S0IA 4UFKA 2PAEA 1BEV1 1EYBA 1TME2 1RUH3 1WMXA 3LGRA 3U37A 3ZPOA 3SNMA 3CBNA 3IDAA 3JB4C 4IV3B 4S2GA 1W28A 1C8M1 4M00A 4LHSA 5BNQA 1ZRRA 5FP9A 1NLQA 3SQOA 5JLVA 2WRAA 3IM0A 1P8JA 2RM23 2AYHA 1XU1A 2DCKA 1C4RA 4IEWA 3WNPA 4ATEA 2W1QA 3OPTA 3VBHB 1ZZ6A 4PIZA 4K6BA 1JU4A 1XSRA 2VZ1A 1QJU3 4F7ZA 5C6CA 2QQPA 1OA2A 3E6DA 3AMQA 1F31A 4NROA 2VBBA 2PHFA 3LOIA 2W68A 2R7EB 3GGLA 5J1XA 2FCUA 3WNKA 3MV01 1S0FA 4JGZB 3PU3A 1HN1A 3ZFEB 3HN3A 4OYUA 1SPPA 2YUEA 4J6GA 1R64A 4BPZA 2VMIA 5FBZA 4CU8A 2ZKNA 3SH4A 4FO9A 4WVMB 5IUQA 3WNMA 2H6CA 1ODNA 4FPHA 3VDCA 4LOTA 3THDA 4Z8BA 5C3RA 2WINB 1JZ5A 1SBEA 3I3BA 2AC1A 3MPPG 1FPN1 3TBDA 1W0OA 2VUCA 1XQNA 4IEVA 4LO4B 3BTAA 1U5YA 1AR93 4HVOA 4H7MA 2JEMA 2NZ9A 4YWAA 4P9JA 3LIHA 4MSVA 5FKBA 4LIVA 3T08A 2Y38A 3S5AA 4N53B 4ZS2A 3K2OA 5BXXA 4ISRA 1O3QA 4SLIA 2GZWA 4HANA 4UXAA 3B3QE 3ZYPA 4FFGA 1CJDA 3PUAA 1BMV2 3NL1A 2BWCA 3U11A 3I2HA 1PZ8A 1S2BA 1US3A 1X9PA 3SEEA 3VBHC 3ZXAC 1KDKA 1XNKA 4FFIA 2WZR3 3ACLA 3FHAA 3K3OA 3O0WA 4IEUA 2VD7A 3VD7A 1G86A 5C9AA 4J25A 4XIOA 2OZ6A 5FP4A 2VNOA 1UMHA 2VM9A 2VZQA 3KF5A 1H1MA 3LDBA 5G04L 1VRH1 3ZKYA 4NRPA 2YZ4A 1K5MA 5I8TA 1UL9A 4PLOA 5CZKA 2JWPA 3NSTA 2PHDA 4UBGA 3B00A 3K75B 1GNHA 1U5ZA 3G6JB 4Q0VA 4BQ2A 2WZR2 4MYEA 4CEWB 1JI6A 1TNRA 2JIJA 4FPLA 2IUWA 3FUQA 2C1FA 2ZCWA 3GHNA 4IGOA 4E2QA 5DN2A 5J09A 5FK7A 4RHV3 4M3CE 1VBB3 4OVEA 1YQ8A 2ZEWA 3PUHA 5CU1A 4W6XA 2SBAA 2W39A 1QQP1 4Z2AA 5L36A 4MG2A 1ZZ8A 4HKWA 1O4ZA 4EROA 1OA4A 4FT8A 5TSWA 4QKBA 4LTAA 2VQTA 3AZZA 5T5PA 4HMZA 4K21A 4MHRA 5GZDA 1SG3A 4YVSC 1YHFA 5C3SA 2WAOA 4QX0A 2ET1A 1CZSA 1OVPA 3ETPA 4RHV2 1D4M3 1XNAA 5C4WC
chains in the Genus database with same CATH topology
1VBB2 2E7AA 4U2AA 2E7TA 2A7AA 3U0ZA 1PNFA 1X8MA 4Y1VA 2XVGA 3AJZA 3AZVA 2P3IA 3FLRA 2ZHNA 4RL7A 5FPZA 4WZFA 1D4M2 1RUG2 2NN8A 3MIEA 2GMPA 3AYAA 1CAVB 3U4XA 1O3RA 5JOWA 1VBD2 2O8OA 2YC0A 1OLQA 2AENA 2DWRA 1HW5A 2VOXA 3WY6A 3IT8A 4L9BA 2D40A 1LOFA 2D6NA 3FC0A 3N7KA 1KITA 5FLHA 2VMGA 1AL0G 1QH7A 2D43A 1YFUA 1W6OB 1AJOA 1AZDA 1PVXA 2IXIA 4QQLA 4LHLA 2ZPXA 2HWF1 4H3WA 1W6QB 4OI0A 2HJIA 1QJY2 2EXJA 2YMZA 2K9ZA 1YYNA 1DFQA 4E4ZA 1OD5A 1D2SA 3DF0A 4Q0QA 5K7PA 1NZCA 4XJWA 1HQWA 5J7MA 3MGUA 4KL1A 1DZTA 1ZX5A 3KGZA 1AF9A 1ULGA 4QPIA 4AFCA 5T52A 3OGGA 3VL9A 2D3RA 4YW5A 2ZGRA 5FTTC 4Y22A 3WVJA 3ZN6A 1AYN1 1CONA 3DKWA 3ZFGA 3KSCA 4OHWA 1RUH1 4K1YA 2DU1A 2E63A 4N43C 2GNTA 1JH5A 5BYNA 1QXRA 2YGLA 1H0BA 4HK9A 2PFWA 2IC1A 2RM21 4Y4YA 1DLLA 2Q8OA 2YXSA 4NO4A 3B93A 1AR83 3LCPA 1I5ZA 2MHFA 2XL7A 3RI9A 1H8TB 3VUOA 3ENRA 4AHYA 2B42B 2R0HA 4NN0A 3VBOB 1RMU3 1UZZA 3A4UA 4BOWA 3WCSA 2P3KA 1ASJ2 4BCUA 2VW2A 4UW3A 1PK6A 1MQTA 1JUIA 2XL9A 5D8AC 4AGRA 1AR82 3VBUB 1TE1B 3MF6A 3AP5A 3PVEA 2JG9B 1YWKA 2RMU3 1UPIA 2G9GA 5FO8B 1DGRA 5E89A 5DUWA 3C3VA 3W59A 1AR91 4N9IA 2X5IC 4R9BA 4FPFA 4RR3B 2WNUC 4Q0SA 3VKLA 4CDUB 1S0JA 2EALA 2WNEA 3IBMA 3BIWE 1N3PA 3NAPA 1OSGA 3M8LA 3WLUA 2RMU2 4ISQA 2ATFA 5EXOA 2GC1A 1FATA 1UZYA 2ZA9A 2PHUA 2DVFA 3KT4A 1YJKA 5GLTA 5DZEA 5KHGA 5GZGA 4AGVA 1D2QA 4FOWA 3VBUC 2QZ2A 1H2NA 2OIIA 3PJYA 1Q8VA 1G9BA 1UU5A 1D4VB 1WLTA 2D7FA 3AKRA 3QBQA 4GALA 1YNAA 4KNCA 3POWA 4PBPA 5LEJA 1Y7BA 4Q8LA 4LO8A 3ILRA 2JJ6A 1B35A 1REDA 5BNOA 1IKPA 1RL3A 4ONUA 3H0OA 4Q1RA 4EN9B 3VHRA 1VBE3 4J1XA 2CNAA 4CDUC 4HVRA 5F6KA 3WXPA 2XKPA 3PJQA 4LBMA 5CG8A 2QCSB 4PF5A 2GALA 3INAA 4QPGB 1AXKA 1HX6A 3MW2A 4L11A 1X82A 5GLZA 4LT5A 4YVWA 2WFF2 3R4DB 4SBVA 1Y9QA 2ZX1A 3ETQA 3GZUC 4OHVA 3OPZA 4HKLA 4BLIA 1A8DA 5I0SA 4QD2A 5KC6A 2ARXA 4V1PA 4LE3A 4L97A 4LO5B 3S7EA 1RUI1 3KQRA 4XFFA 1G6NA 1QXJA 4LO7A 1DQ6A 3H1YA 4B4QA 4NHMA 2IWGB 1H9WA 2DCTA 1MS4A 1IS6A 5GZEA 2F4PA 5JWPA 1RITA 2RS52 4KBBA 2VMHA 2D44A 3SCGA 2JECA 5CAZA 1FV2A 1GZCA 1ULDA 2A3XA 2E6VA 3WDXA 4AWDA 3WHUA 1LEMA 1RVF3 1CD3G 3LSEA 4AHXA 2OVUA 1QHDA 4Q4V1 3FBYA 4D94A 2ZMKA 3V56A 4CDQC 3WDWA 3I59A 5ACA1 5CADA 5JZGB 2GNBA 1U0AA 3NO8A 2DVDA 2NLRA 2Y0OA 5BY5A 3ILFA 5JR7B 4QPYA 4NWWA 4OLLA 1LTEA 3H1MA 2PHRA 1RVF2 1PO22 3CJIC 2JG8C 3AYDA 1SBFA 3RS6A 3VBFB 3OBRA 3PVOA 1OOPB 1VAVA 3GALA 4XQWA 2WKKA 3N7LA 2WT1A 3SMHA 3WW2A 2EXIA 4AW7A 3POYA 4DPNA 2GC2A 1LGBA 2JENA 4NPRA 3MW3A 4I3GA 1DIWA 1OFSA 3TN91 1EV11 3RJ2X 1KD7A 4OUMA 4KH9A 1GR3A 3O0XA 4CDWA 4YG6A 4P9YA 3QCWA 2W52A 1HLCA 2P2KA 3M70A 5FLIA 1V6KA 4JTNA 1RMU1 3VZLA 2JDZA 1HRI3 4XMIA 1PIV1 5JZGC 5GJ6A 3R4SA 4RS5B 1HIXA 4MGIE 2F6BA 2DCJA 3WCRA 2GSYA 4PIXA 4FTEA 1FT9A 4BZ4A 4YLZA 1UX6A 1HXS1 1RUE3 4FQ4A 2Q1ZB 5J98B 4BE3A 2IXLA 1GSLA 1J58A 1HRI2 1SLAA 1DYPA 3C2UA 4YM0A 1PO12 1X33A 1O3TA 1X36A 1GYKA 2QNKA 3WW1A 3WUDA 4Q0UA 2RJKA 4WM8A 1Q8OA 2XGXA 1OQ1A 2VG9A 2B8MA 1RUE2 2OZJA 3PLQA 2WQZC 4MLOA 1LESA 3OF1A 2R043 4QMAA 2UWCA 3PMEA 4FPOB 3MF9A 4GH4A 5CFDA 2HWD1 2X53S 2XBO2 4Y1YA 1QJX1 4DRVA 1SLTA 2EA7A 5FDBA 1BEV3 2TBVA 1YXWA 4E4DX 4RA0A 2R042 5A33A 1C8M3 4CP2A 1ND3A 2JKBA 2VOWA 2X8KA 1I6XA 4NOTA 1RUC2 4IEXA 5BNPA 3LOBA 3MI8A 4FPCA 2K2SA 4KGGA 5H9QA 3HD8B 4LHKA 4EN7B 4CEYB 3ZXDA 5C9AC 3KM5A 1M4WA 4DZGA 3KLSA 4E9KA 1VBE1 2H6BA 3DPRA 4JGYB 3L2YA 3B02A 5FO9B 2Q0AA 3NV4A 1K5MC 3TRSB 4BIOA 3AX4A 3E6CC 4COUA 1OLRA 1W6MB 3TNPB 3JU9A 4N9HA 1ZBE2 3AJYA 3TB0A 2V5YA 1FPN3 5SV8A 1HV1A 1Q8PA 1ZM1A 2IXCA 2X29A 1IQAA 4INDA 1JTZX 1MS0A 4G4FA 3TWIA 1AYM1 1MEC1 4B7EA 4UBHA 5CFCB 5C8CB 3JD71 4Q29A 1SLLA 1OHFA 4KWJA 3WP4A 3ES1A 4H55A 1LCLA 3ZSKA 1NCQA 3WG2A 3E97A 4Q2FA 2D5FA 1POV3 3IDEA 1DHKB 5ABJB 1XE8A 1SCRA 5K0UA 4AVCA 4XF9A 4GQ7A 4YNIA 4A3XA 4AFAA 4BWOA 1DYKA 5JSOA 2UYBA 3AP6A 2EXKA 2I74A 1VRH3 3ZXJA 1LGNA 5H9SA 2VULA 4OULA 2XPJA 1WLDA 4HZFA 2A5ZA 2YHJA 5T3NA 3RMXA 4AE2A 1WMEA 3EO6A 3MYXA 4E27A 4YW3A 4COYA 2A3WA 2WS93 4FCAA 4LBJA 2CV6A 2C9AA 1LOFC 1RINA 5L7OA 1VRH2 1LENA 4AEDB 3VLBB 5CFCC 1LULA 2ZHLA 3MW4A 2R32A 3KB5A 1OI6A 4KGQA 4YGDA 2AREA 4Q4Y2 4R9AA 1QQP3 4QGNA 1REEA 3LZZA 4FP3A 2XWJB 3H7YA 4M3CA 2E51A 2UY9A 1PVC1 2QDNA 4WVWA 2ZMNA 4EWDA 3SCHA 2BQPA 2JD4A 2GNDA 3K48A 2BWAA 5C8WA 4QQPA 1QGLA 1HKDA 1GZ9A 2JXAA 3JCIA 3WP6A 2Q30A 2WFPA 2H0VA 3J9SA 3UKNA 1QQP2 1QOOA 4O9EA 1RUOA 4OHXA 3VBSA 3VBRA 1YFWA 4QPIC 2D6MA 3FLPA 4JAAA 2VVEA 2XJTA 3UJQA 1ND2A 3OYWB 1VAMA 2Z5WA 4GA9A 5EWSA 2D6OX 2ZOEB 3WV6A 4I01A 2R16A 3ZN5A 4B3NA 1TMF1 3P3PA 3BB6A 1YRZA 2VOVA 1VB2A 4COZA 3M3CA 2AR6A 3IKWA 2BYVE 4Q1PA 3NW4A 2ZKLA 2P17A 1DQ2A 1H30A 4C91A 2ZABA 1RUF1 3LAGA 3RZZA 1MVQA 2G9FA 4RQPA 1PK6C 3O7OA 1UD1A 3ES4A 2DTYA 1VB4A 1MQTC 3FFQA 3M1HA 4YG0A 3ZFFA 3HMYA 2ZJCA 4IXLA 5K9YA 1FYUA 2FZ1A 2XJRA 4MXWA 3I7DA 1V6MA 2ZTNA 4QU2A 1UKGA 3ZXFA 1H4HA 4MH0E 3CLPA 3LKJA 1G9CA 2HWF2 3ZXGA 1RJ7A 1CGPA 4Q4X3 5FQ0A 1AYN3 5AVPA 5DDJ3 1MZ5A 5FO7B 4AI3A 5FPXA 3VZNA 1CAXA 3NAPC 2VH9A 4YRDA 3PVBB 4BHPA 1ZA4A 4L8QA 1YFXA 3PNAA 1LHOA 1AYN2 1NYWA 4FPKA 2KM2A 3AK0A 2A6XA 2R072 4JDMA 4Y1UA 5E8AA 1RUH2 2OW4A 1SFYA 1SACA 1ZRDA 3V65A 5I8SA 3GZAA 4AHZA 1JHNA 4Y26A 2RM22 3BALA 4META 2IXHA 3VL8A 4FBFA 4I3PA 4D7SA 1VBA3 4PDWA 1AUYA 1QJU2 3NV3A 3OD4A 2HEWF 1WUVA 5AC91 1ZVFA 5JMCA 2A6ZA 4PJYA 1FAYA 3WOGA 4UW5A 5HXVA 2FQPA 1MVEA 3SCFA 1B35C 3W9AA 1HQNA 4X8PA 4C0BA 5BNOC 1PGSA 4GMP0 4ZU4A 3RYKA 4I30A 2D3PA 3HAGA 4XF0A 2KXLA 4WBBA 4HL0A 4C1XA 5IK8A 1OQDA 4HKOA 3THTA 3WR0A 2C0ZA 2TEPA 4HSLA 3B5LB 2YGMA 1VIWB 1J3QA 1POV1 2YY1A 2O8QA 4YVSB 4LNVA 3N35A 4YVWC 5C4WB 1H9PA 2VGDA 1AR92 5I93A 4XXPA 1CN1A 5J48A 1CQ9A 4IEZA 1RC6A 3AMMA 5K8SA 3ILNA 5KXEA 2LUWA 1WD3A 4RFT0 1PZ7A 1QXPA 2GMEA 4LHNA 2K0GA 2RHPA 4M3CF 3WQ0A 3H7JA 5KHIA 1V6JA 2G4IA 3AZWA 4ORFA 5KHKA 1CIWA 4AFMA 1I9RA 4HPKB 4EN8B 1LOEA 2WS91 3OY8B 1G9FA 3KZ4C 2XLGA 2B5HA 4FPYA 1PNGA 4LR4A 1LOCA 1MS9A 3PTYA 5DUVA 2PELA 3AYEA 4D7TA 4MVTA 3LA7A 1TEIA 2OUHA 1C3HA 3ALQA 1LB2A 1NXMA 2ERFA 5E16A 4C90A 3USUB 3IPVB 1I3HA 1XRUA 2D98A 3Q9OA 2R30A 5JSRA 3FE5A 4Y20B 1OFNA 1LGCA 2WNVA 5FREA 1V9U3 4M0NA 4N90A 1DGLA 2ZGMA 3HQXA 5EZWA 4HK8A 4HVQA 4FQZA 5JIAA 3AMNA 3LA2A 5GM0A 2ZZJA 4K8FA 4F3JA 2ZMLA 3KT7A 3E5QA 1RUI3 1UF2C 1FMD1 2RE9A 4N43B 4TWTA 2AGSA 3ZXLA 2NYYA 2VU9A 3V0AA 4D3WA 2ZX2A 2XJPA 5CA6A 2GU9A 2Q4SA 4N7IA 2XJQA 4OFGA 2XB6C 3KCCA 4B4RA 4CDWC 1U5XA 3RG0A 2IXJA 1NY72 1GZWA 2ZX4A 2PLV1 3I54A 4AEKA 1IGOA 1Q3EA 1MZ6A 4Q4V3 4YZ3A 1F5JA 4AEMA 5EYYA 3WG1A 2R0FA 5ACA3 5D8AB 5I8YA 2JX9A 4AQTA 3DUIA 3DV8A 3HT1A 1APNA 4P14A 4ATFA 1MZEA 3AB0A 2OUJA 3FLTA 4GWNA 1RB8G 5KBFA 5T5OA 5A3MA 3URFA 5L19A 4QX5A 4AK3A 1F2NA 1AJKA 4Q4X1 4B7KA 5ACA2 3SH3A 3S7IA 2PTMA 4Z92B 4U36A 4WM8C 5DDJ1 2X5IB 3H50A 2WNUB 3VKMA 1W6NA 4L99A 4DXZA 2FZ2A 1XE7A 4YFWA 3TN93 2KA3A 1EV13 4DFSA 5LRSA 4AHWA 4I0AA 2UU8A 1RHI1 3E5XA 5F5QA 2A6YA 5DUXA 1UU6A 5BNNA 4JTOA 4W6WA 1O4TA 3AYCA 5BV6A 2CGPA 4GH4C 5CFDC 1OMIA 3S6PA 3M4FA 4LA2A 1FNYA 3QLQA 2XG3A 1LOGA 2HKXA 3HWJA 1PIV3 4WM7A 1EV12 4R9CA 3WT3A 1EPZA 1PMIA 2ZGOA 1ND3C 3SXWA 2VNGA 4YW2A 4DMIA 1G8WA 1VBA1 3QOPA 3R4UA 1HXS3 1RMU2 5BNPC 1COV1 3OD0A 3NV1A 2QUOA 3VKFC 4LLFA 3EXUA 2I07B 3D5OA 2ILMA 2ZX3A 3LB9A 5DG2A 2P3JA 4XE9A 3MIBA 1PIV2 1WCDJ 4W65A 1OA3A 2ZAHA 5KHHA 2NMNA 1KXGA 4FAGA 2WLPA 4BM8A 3DPRC 2OPKA 1WW7A 1H8VA 1S1AA 4JDOA 1XNBA 3FBMA 3KMHA 4QHBA 1W6PB 4B4PA 2VW1A 4X6RB 3O0VA 1CJPA 3USSA 1UIJA 4GWMA 4YW1A 1KS4A 2DURA 2DUQA 5T50A 2HEVF 1WCSA 4AQSA 4K3UA 1YUDA 1X7NA 3WX5A 1BKZA 4MUVA 4QQHA 3VDDA 4P9WA 2YYOA 2HWD3 1VAKA 4XF1A 4O9GA 1QJX3 2P34A 2NM1A 1KDMA 1S2KA 1ZNPA 2DU0A 1DF0A 3RRDA 1NXD1 1NCQC 1KFUL 3WHTA 2RR11 2WLQA 3T1MA 2HWD2 3K51A 1CAUA 2HYKA 3TOJA 1QJX2 1N1TA 3FWEA 3JQXA 4XFIA 4MX3A 4GKXA 3ZYJB 4JCKA 4YGCA 4AG4A 1S0GA 2ZACA