2EIGA

Lotus tetragonolobus seed lectin (isoform)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
VSFNYTRFKDDGSLIFQGDAKIWTDGRLAMPTDPLVNRTTSHALYATPVPIWDSATGNVASFITSFSFIVSNVQRYPPTDGVVFFLAPWGTEIPPNSQGGYLGITDSSNSQNQFVAVEFDSHPNVWDPKSLRSSHIGIDVNSIMSLKAVNWNRVSGSLEKATIIYDSDTKILTVVMTHQNGQITTISQEIDLKTVLPEKVSVGFSATTWNPERERHDIYSWSFTSTLKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin
publication title Identification of a new quaternary association for legume lectins
pubmed doi rcsb
total genus 50
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eigA00
2DU0A 1FNYA 2A6YA 4XTMA 1S0IA 1WD4A 3ZSLA 1LGNA 2C5DA 2EIGA 2ENRA 2GMMA 1YYNA 3B69A 2R0FA 4WZFA 2YROA 2VW2A 2GNTA 1V6IA 4XBQA 3VUOA 3R05A 3T2TA 1B09A 2A3XA 3LCPA 1HKDA 1QNYA 4YM0A 2GNBA 1SLTA 3AZZA 3FUOA 1F31A 1N47A 2E6VA 4Y20B 5E89A 3WHTA 1Q8OA 2ARBA 2LTNA 1GYKA 3AP9A 5GM0A 5DUVA 4DFSA 3ENRA 1AF9A 5GLWA 3OYWB 1KJLA 1KITA 4FPJA 5L73A 1W6NA 4PF5A 4XOGA 4BLIA 1S0CA 2OUHA 1SBFA 1OKQA 2NM1A 1UZYA 1ZA4A 2JJ6A 4R9CA 1DZQA 3L2YA 1H9PA 1BXHA 1Q8QA 3AXDA 4AYUA 4BMBA 1PZ9A 2D6KA 2VW1A 1FYUA 3M3CA 3FFZA 2A6ZA 5SV8A 2YY1A 1AJOA 1RIRA 1WLCA 2P37A 2DUPA 3LSDA 1V6OA 5GLUA 1QOSA 2VXRA 4FPYA 4GXLA 4BPZA 1MS4A 4YZ1A 3OJBA 1CQ9A 3ZSKA 4XXAA 2D3RA 1SLIA 4XMAA 4DPNA 5H9RA 4CZSA 3FLPA 2NP0A 4XTPA 4IQPA 1CJPA 2VU9A 4BMEA 1GNHA 5E8AA 4BLJA 4U2AA 1GZWB 1DQ4A 1LGBA 1O4YA 3N7MA 1JOJA 4XDQA 2A6VA 2CWSA 3JUUA 3A0KA 1CPMA 3AP5A 3ILRA 4XBLA 4W65A 4Y22A 2E7TA 3WDWA 5T50A 1MS8A 4M00A 4AVVA 1UMZA 1G86A 4YLZA 3WCRA 5CAZA 1N3OA 4ZXKA 2GDFA 2JE9A 1SACA 4FPFA 1DYPA 1JXNA 2ZMLA 3ZXLA 3USUA 1DBNA 1LJ7A 5T5OA 5GLVA 1QU0A 2GN3A 1LOCA 3RMYA 4L8QA 3WVJA 3ZXKA 2SBAA 1VAVA 1LTEA 4XHXA 4R9DA 4FPEA 2GALA 2D6PA 1BKZA 1W6OB 2R1DA 1QOTA 4GA9A 5IK7A 1QMJA 3MW2A 1MZ6A 1W6PB 1QDCA 2PHFA 1N1VA 4YGDA 3UL2A 1DQ0A 3AP4A 1W6MB 4P14A 2DVFA 4M3CE 2E53A 5JOZA 1MS1A 2CWMA 4JRAA 2EXKA 5KXDA 5HCAA 4GALA 1GLHA 3V0AB 1JYIA 1QDOA 2UU8A 1V6JA 3ILNA 4ITCA 1WD3A 4LBQB 2ZABA 2ZMNA 4FP2A 5JLVA 2ZACA 4GKYA 1I1EA 3VKOA 1I3HA 2ZMKA 1H9WA 5DZFA 3ZXJA 1QOOA 3WUDA 3WUCA 1CESA 4Q27A 2ZBJA 3WDYA 1GV9A 4C1XA 1N3QA 2PHUA 1WCSA 3QCWA 2PHXA 5EWSA 1X50A 3WLUA 5GZCA 2ARXA 4XIKA 1JYCA 3WV6A 2DVBA 1LHVA 2DVGA 2ZGTA 3GNEA 4BOWA 3W59A 4Y1ZA 1GNZA 3IPVA 1MS0A 1S0BA 2UWBA 5H9SA 4YW3A 1WLDA 2C9AA 1YIFA 2AH2A 1DGLA 3RQ0A 2GNMA 3I8TA 4P9XA 4ATEA 5DZEA 4YZ5A 4LBOA 4TZDA 2ZGPA 4Q1RA 3SLIA 2OUJA 1SLLA 4PBOA 4LBJA 2GNDA 1BQPA 3AZVA 3OY8B 1LOFA 4ISQA 4KBBA 4Y20A 4CTEA 3RG0A 4XJ9A 2XG3A 3MPPG 5CB7A 3OBTA 4OZXA 4K1YA 2LALA 2AGSA 3OYWA 5IK5A 4JC1A 2WQZC 1IS3A 2ZGUA 4HL0A 3AP7A 3POYA 1FV2A 1LGCA 1ULFA 1YXWA 3MW4A 2YZ4A 2D6NA 3PVOA 4FQZA 5AVAA 1UN1A 1Y7BA 3PJQA 1ENRA 4BM8A 1CN1A 1C1LA 1QNWA 1UL9A 3N7JA 2E51A 3M3QA 3O0WA 1AX0A 4I30A 4UW6A 3M2MA 4DS0A 1W0PA 5T5PA 4YGEA 4UW3A 5DG1A 5EXOA 1SLCA 1F9KA 3ILFA 2GMPA 1LODA 2D7FA 4XZPA 5DUXA 2H0BA 4YFZA 2DTYA 5BYNA 4SLIA 2ERFA 1GZWA 5HCBA 1N1TA 4FPGA 4XIOA 3WDXA 1XQNA 4UW4A 3QLQA 4DQAA 4ATFA 3HN1A 1LESA 2ZGMA 2PHTA 4Q1PA 1SCSA 1PZ8A 2ZKNA 5JVVA 1WBFA 3TB0A 4ASMB 3WG3A 2DWRA 1ULEA 2VH9A 2CNAA 2AUYA 3N36A 4Y1XA 3LSEA 1AX1A 4Y1UA 2DVDA 4LBKA 1YO8A 4PCRA 2ES3A 1IS5A 3SH4A 5IK8A 2GMEA 3WNXA 2HYKA 1UZZA 2ZHMA 4P9WA 1FATA 1ENQA 3TAYA 2PELA 1LECA 1LEDA 1YI7A 1IS4A 3BOPA 5H9QA 4MYEA 1DHKB 2WT1A 1W6PA 2BQPA 5KXCA 3N7KA 3D6EA 5GLZA 4AGVA 1W6MA 1WW7A 1WBLA 1V6NA 3AK0A 1MACA 4FPCA 3AP6A 5DXDA 1J1TA 1G8WA 3V0AA 3N3HA 1JHNA 1V6LA 1UAIA 5H9PA 1HDKA 1CR7A 2A6XA 3KM5A 4AVSA 1C57A 1C1FA 3AZYA 1PZ7A 4K1ZA 1WUVA 3AJYA 4XJUA 1G7YA 2EXJA 4Q26A 1LOEA 2Z42A 3T1MA 4BQ1A 1G9DA 4YG6A 1V00A 4XXPA 3BTAA 2GN7A 4DRRA 1WLWA 4YG3A 1AXYA 2V73A 4YM3A 2JKBA 4JCKA 3AYAA 4LBNA 4M3CB 3U4XA 4NO4A 5CA6A 4GKXA 1AXKA 2FMDA 1FX5A 3HMYA 1G9BA 1S0DA 1H30A 2DUQA 1GICA 5E88A 2JECA 3VKFC 1V6KA 2ZZJA 1DFQA 2WSVA 4M01A 3N35A 4FPLA 3INAA 1KDMA 1Z78A 3RRDA 1CPNA 4U36A 2ZHKA 5F9TA 2ZHLA 3OBRA 2AREA 2DTWA 5CBLA 1VAMA 3O0XA 2A7AA 2VY0A 1QGLA 2D44A 4Y24A 3V0BB 4FP3A 3WG2A 2WLQA 5IK4A 2ZA9A 1TEIA 3FLTA 3BIWE 3PVNA 5DG2A 3M1HA 1SFYA 3ZYPA 4F83A 2AR6A 3IKWA 2D6LX 4XJ8A 3GALA 1AJKA 1MS5A 3ASIA 1Q8PA 3W58A 2W39A 4HANA 5DZGA 1LU1A 1WW5A 4LBLA 4R9AA 4FOQA 1GZCA 2PHRA 1APNA 2R16A 1IOAA 3AYDA 2E7QA 1AZDA 3OY8A 5EYXA 1AX2A 3WHUA 1NXD1 2DU1A 5FRAA 3ZVXA 1G9FA 5GALA 1DYKA 4XBNA 1Q8VA 1CVNA 5JOWA 4FOVA 1OFSA 1F5FA 2CL2A 3NV2A 4YFWA 1N1YA 2W52A 2P34A 3ZPYA 4D69A 1SBDA 1BYHA 4C1WA 1HLCA 2FHRA 4Y1VA 1QKQA 1DQ5A 1V6MA 1FAYA 5LK5A 4YW5A 2PHWA 4YG0A 1Q56A 3B00A 3O12A 1SBEA 1ULCA 4GWNA 4ZKTB 2D6OX 1Q8SA 3FLRA 4LBQD 4P9YA 3IM0A 4WVWA 1LU2A 3POWA 3B3QE 2YV8A 1LOAA 1MS9A 1SLBA 1DQ2A 2YMZA 3BODA 3NV4A 1W6QB 2I2SA 3OGGA 5GJ6A 5GZEA 3UJOA 3H0OA 4AGGA 4PBPA 4K21A 3IN9A 1IKQA 1URXA 4PQ9A 5DUWA 2A75A 2D43A 5F5QA 3AJZA 2AYHA 3AX4A 5KXEA 4XJAA 1G9AA 2EXHA 4XJWA 2B7YA 2NMNA 4XMIA 3WG4A 1JBCA 1UKGA 2W68A 1KQRA 2ZGNA 4YM1A 4Z8BA 1CIWA 1DLLA 3AZWA 3O5SA 3SH3A 2NZ9A 2UURA 2ZGOA 5GZDA 5GLTA 2R49A 1JW6A 1C4RA 2ZGKA 3AFKA 1ULGA 3AZXA 3OPZA 4RA0A 4YZ2A 1KRIA 2P3KA 2WSUA 1HQLA 1IS6A 3D5OA 1WW4A 3ZXFA 5T54A 5IT6A 3M3EA 1CONA 3POSA 1AVBA 4H55A 2CY6A 2NN8A 2G4IA 1QF3A 2P3JA 1GBGA 4XJZA 1BJQA 4AWDA 5T52A 1HQWA 4UW5A 3ATGA 2VW0A 3I4IA 1VLNA 3RSJA 1JUIA 3NV3A 1MVQA 1N3PA 1S0EA 1LCLA 2ZHNA 1LHUA 1ONAA 3CNAA 2P2KA 1JN2P 4YW2A 3N7LA 3VKMA 1OQ1A 2XB6C 1DIWA 2JD4A 1W6OA 4YGBA 5FREA 1W6NB 2EAKA 1MVEA 2EALA 3O0VA 3JU9A 2W08A 2OVUA 4XE9A 5DUUA 1LHOA 2A3WA 2UWAA 5KXBA 4WV8A 3V64A 1A78A 3DGTA 2WKKA 4M3CA 3B9CA 4NOTA 2TEPA 1S0FA 4Q8LA 4LBQA 4YZ4A 4DRVA 3ZSJA 5JOYA 1DQ6A 2DUOA 4RL7A 3SISA 3DUIA 3A0NA 5IUQA 1WW6A 2YXSA 2ZAAA 1O4ZA 1VIWB 4AVTA 4GWMA 4XHBA 2Q5TA 3ZXEA 1S0GA 2V5YA 3VKNA 1A8DA 1GZ9A 3WCSA 2A3YA 2KM2A 1S1AA 4ISRA 1S0JA 1LOGA 4YGCA 5T5JA 1RITA 4Y22B 1KDKA 1W0OA 3V0BA 3RMXA 4YW4A 4FPHA 3AXEA 3D4KA 5JDBA 2R1BA 4M3CF 1LULA 2WNEA 3AYCA 2CTVA 1LEMA 4FPOB 4FPKA 2WT2A 1DQ1A 5GZFA 3WOGA 3ZYRA 4Q8KA 1MS3A 3T1LA 3C2UA 1ULDA 1UX6A 3UK9A 4AGRA 3USUB 1R1ZA 3B01A 4FOYA 3PMEA 3Q9OA 5HCFA 2NYYA 3V65A 2WT0A 1GANA 4K20A 5T55A 2A70A 3NV1A 2EF6A 1G9CA 3FUQA 2D3PA 1GKBA 1Z0HA 2JDZA 1KJRA 4R9BA 2A6WA 4WVVA 4Y26A 3R4SA 3UJQA 2ZGLA 5GZGA 2OW4A 1SLAA 3NWKA 4CRQA 3M3OA 3WDTA 2CYFA 5T5LA 3SNMA 1LOBA 1MR5A 3AYEA 4LBMA 3SH5A 2ZGRA 4XYXA 3MW3A 1IKPA 1LENA 1SCRA 2SLIA 2DYCA 3ZSMA 4YM2A 1AXZA 1U0AA 2D3SA 3IMNA 3R4UA 1W6QA 2DVAA 1D2SA 1N1SA 3SITA 2P3IA 2DV9A 1A3KA 1FV3A 3WZ1A 1GSLA 3FBYA 1FNZA 1UPSA 3KQRA 3APBA 2VUAA 4YZ3A 2A71A 1MZ5A 2WJSA 1ZM1A 2A5ZA 2AENA 2ZGQA 4Y1YA 1BZWA 4FQ4A 3RS6A 5JOXA 4FOWA 3MEPA 4YW1A 2EXIA 1LOFC 2RHPA 4TYSA 5EYYA 3WDUA 3PVEA 3A4UA 3VKLA 3WDVA 1RINA 1VALA 1LHWA 1ENSA 2JE7A 1YRZA 3HR9A 5JMCA 2NMOA 4Q2FA 2R0HA 4FVVA 4XILA 2D6MA 5CNAA 1NLSA 2DURA 2UWCA 3VV1A 3WG1A 1EPWA 2ZGSA 1D0HA 3IPVB 1LHNA
chains in the Genus database with same CATH superfamily
2ARAA 5HBAA 1F4HA 5FP8A 4COWA 1GQHA 4NRPA 3KMHA 4XTMA 1WD4A 4RHV2 4LUKA 1O8PA 5F3IA 5A3LA 4DOUA 3MIBA 3JB8A 2GNTA 3G6JB 3R0RA 4RR3B 2CSGA 2QKDA 5G05L 1B09A 3HAGA 1HW5A 1RUH2 2E9QA 3HQUA 1HQNA 5J3UA 1ZBA2 4YM0A 2GNBA 1SLTA 2C24A 3AZZA 4LO6B 2E6VA 4Y20B 5E89A 1Q8OA 5LBEA 4BQXA 2GC1A 1NOVA 2RMU2 4Q4X3 3AP9A 1GYKA 2RE9A 2OXBA 3DXUA 3W21A 4CPBA 1AF9A 1JODA 4KU8A 1PK6C 1UXXX 1KITA 3LGRA 1H0BA 4QHZA 5F2SA 1W6NA 5FTTC 5FYHA 3VD7A 4XOGA 3S0MA 4E8DA 3VBOC 2OUHA 2NM1A 4AEJA 4B29A 4Q4V3 4BMBA 4AYUA 3BPZA 3FFZA 2YY1A 1AJOA 3RWNA 1WLCA 2GP5A 2QCSB 3FE5A 1V6OA 3H3ZA 2VXRA 5GLUA 3KB5A 4BPZA 4JQRA 1CAXB 4XMAA 4LPLA 1SLIA 3ECQA 4NJ4A 1AYM2 2JICA 3VBUC 2ID4A 1CJPA 2FDKA 1D4M2 2Z79A 1GMMA 2YUEA 5CADA 1GNHA 5E8AA 3U0ZA 5FIXA 4BLJA 2QDNA 3K3NA 4CCDA 2RS32 1DQ4A 3DPRB 3K75B 3HOBA 5FP3A 1H4GA 2RS11 3A21A 4MOAA 4A3XA 4Y22A 4BQYA 3PUIA 1OF3A 5T50A 1MS8A 2RG4A 4M00A 2WZR3 3WP3A 1UMZA 4NIIA 3K48A 5FYCA 3MZHA 5CAZA 4ZXKA 4I2OA 2JE9A 3OUIA 4TSVA 2YU2A 3LDBA 1VBA3 2C0ZA 1H2LA 3SHRA 1W8WA 2HKXA 1XE7A 4FXGB 4RN5A 4BB3A 2A73B 1ALYA 3USUA 2KA3A 4IEQA 5GLVA 4E8CA 2G9ZA 4OFGA 2GN3A 1G6NA 3HN3A 1UYZA 2R7EB 5CFDA 3ZXKA 1UU5A 1RUI2 5DDJ1 3H8RA 1AR92 1LTEA 2OA2A 4LLFA 4FPEA 4R9DA 4XHXA 4LO5B 2XBO2 2GALA 3WY6A 1W6OB 1QOTA 4GA9A 4AQSA 5FY8A 1QDCA 4QU2A 2VMFA 5FZBA 3VZOA 3AP4A 3FBMA 1PMJX 4QHOA 1J3QA 2DVFA 3OB8A 5FZ9A 4MX3A 1MQTA 2CWMA 2GH8A 4JRAA 2Q8CA 2FDHA 1RYYA 3WF0A 5EPAA 4YSFA 2RDRA 5BNNA 4GALA 2WABA 3SCFA 5HCAA 4FTEA 4MG2A 1V6JA 2QVSB 3B94A 2XLAA 4LBQB 3KQ4B 4SBVA 4AF9A 2ZACA 3CZUA 4FXKB 4F7ZA 5LEJA 5KC5A 4BYYA 1I1EA 3TNQA 4ZY9A 1DLCA 2VZ1A 3ZYHA 1BMV1 3OGRA 1WCKA 1I3HA 2QQUA 2ZMKA 5DZFA 5ANNA 5FK7A 1QOOA 2W5FA 1CESA 2GAUA 2LROA 1ZRIA 3UYJA 4MV2A 5FZOB 3B02A 2PHUA 1IQAA 1X50A 4QPGB 3DN7A 2BFUL 1OLQA 3GGLA 3WLUA 1PO12 5IVBA 5A1FA 4CP1A 2VOVA 4WBBA 1LHVA 4D6RA 1VR3A 1JZ6A 1ZRDA 4W6WA 3GNEA 1BBT1 4HKOA 4LKEA 5C8CC 1XYOA 3W59A 2O8QA 3ROUA 2CDOA 3HNYM 1PO23 1FT9A 2C9AA 4JGYC 1DGLA 4NUBA 1ZX5A 1W8HA 4P9XA 5LRRA 1PGW1 4EROA 5C70A 3ZFGC 4LBOA 4RR3A 4TZDA 2ZGPA 4FBFA 2V5DA 3KWVA 4CDXB 1JI6A 1YJKA 2OUJA 1SLLA 4CUGA 3ACFA 4PBOA 5FYTA 4LBJA 1RUE2 3L2HA 5LATA 4MGYE 3QACA 1LOFA 4Y20A 3TYJA 1T2XA 4CTEA 2VMGA 5CB7A 1DGWX 4EN6B 4K1YA 5M0TA 1UX7A 2AGSA 2I45A 3GJBA 5I0RA 5IK5A 1RVF2 2Y60A 4OHYA 2WQZC 1IS3A 2HWB1 5ISLA 3H8UA 1AYN1 1I6XA 4HL0A 4COYA 2C1FA 3EYPA 3HEIA 3EXUA 2UY8A 1F2NA 2JENA 2D6NA 5JIUA 2D97A 3VL8A 4GULA 5AVAA 1UN1A 3PJQA 4HFSA 1QNWA 2Q8EA 3JD73 1H8TB 3K4ZA 3ABZA 4MGTA 2J7MA 4ES8A 1RUG3 3O0WA 1HRV3 4DS0A 2VCAA 1FPN3 2WUHA 1FXZA 3CQOA 2WYSA 3RYPA 3T0DA 2WAOA 1R091 5DUXA 1JYXA 2YFZA 5FZEA 1EAH1 3N9LA 4SLIA 2ERFA 3LFMA 3LZZA 1N1TA 1W2OA 5DAXA 5HCBA 4AW7A 2WZPP 1POV3 1X7NA 3N4MA 3QD6A 1RL3A 2XMLA 3HN1A 4YVWC 4Q1PA 2ZKNA 5JVVA 4LJHA 3TB0A 4AHXA 2XPJA 3POBA 3LD8A 1KEXA 2RS52 1ASJ3 1RUC1 3J7LA 4HN0A 1BEV2 3OGVA 4N53B 1U5ZA 5F39A 4HK8A 4LBKA 5KHKA 4EN8B 5A3MA 1OPOA 2B9VA 1UZ0A 3J8F2 1MEC1 3KD4A 4XUOA 2GMEA 2XVKA 5HXVA 1UZZA 2ZHMA 2J1EA 3VHOA 4GB31 4LEJA 1JHJA 2OIIA 5A7SA 3C3VA 5GKAC 1LEDA 1W28A 1ZBE3 4XFBA 3JBG2 2AC1A 4IV3C 1D0GA 4UXAA 1J3PA 3SKVA 3LKJA 3MIEA 4PHZA 5LK7B 1C8M3 1COV3 2VOKA 2IVIB 1PX3A 5HV4A 3D6EA 5GLZA 4AGVA 5JSOA 4D6QA 3AMMA 3OGJA 5IVFA 3AK0A 2WS93 2PXJA 4L2NA 1QQP2 3KV6A 2VVFA 3UGHA 1JHNA 3OD4A 2WFF1 1Q5OA 2A6XA 4QX8A 3VGIA 1EV12 1HXS2 1WKYA 2CHHA 2W1SA 2UYBA 3I2FA 1WUVA 2HBUA 3MGUA 4K1ZA 5FCCA 3T30A 1G7YA 4QAWA 2JB4A 1OBNA 1TE1B 4Q26A 1G9DA 3UV9A 1VBE1 3H9AA 4N7UA 4XPVA 4YG3A 1RUD1 1STMA 2V73A 1NY72 3VD3A 2HWE2 5FZOA 3AYAA 1UY0A 2OQ6A 4LOTA 4BZ4A 4OHXA 2FMDA 4QPGA 4C0BA 5D2AA 1RC6A 1XBFA 2QQOA 3KV4A 1V6KA 4N9IA 1UOFA 3PUSA 1XNDA 3N35A 3T08A 3VD9A 2YC0A 3RRDA 2P6HA 2LW8A 4U36A 3CDZB 3OBRA 2AREA 4CCEA 1W2NA 1YFXA 2RR11 1RGSA 2VY0A 3MI8A 4NROA 4CXYA 4FP3A 3WG2A 1XE0A 5I8YA 1HRI2 3BIWE 3M1HA 4META 2F6BA 3ZYPA 4OI2A 3NNGA 2MEV3 4G9SB 3TWIA 3W58A 3ZYJB 1GP4A 5L7OB 3OTFA 1LU1A 2WL1A 5L9BA 4CDXA 1BK1A 4E4ZA 4LKFA 5JAXA 4QU1A 1GWLA 3CO2A 4F8AA 5K4LA 1APNA 5FDBA 3NKGA 1OF4A 1AZDA 1FMD1 1NXD1 2RMU1 1RHI3 1TME1 1DU3D 2DU1A 1AR83 2E33A 4KH9A 4QKBA 5FZ3A 5GALA 5F1RA 1DYKA 4XBNA 5JUVA 1JZ7A 1CVNA 5JOWA 4FOVA 4D69A 4YFWA 3ZPYA 1SBDA 1QXJA 3RPQA 1SHWB 2W1UA 3IB3A 1ND2B 5DAVA 1HLCA 2FHRA 3UKNA 1OT5A 5HCHA 4EZ4A 1FAYA 4DXZA 4BISA 4ASKA 4YG0A 5DMYA 4G4FA 3H7YA 3O12A 1SBEA 5E6HA 2RJKA 2WLPA 2ZPXA 4WVWA 2ZAHA 1GUIA 1JYVA 1H8TA 4RD7A 5A3TA 2YV8A 3OGGA 1MS9A 1SLBA 3IDBB 3BODA 3DKWA 5GZEA 5KHGA 5JPMB 5GJ6A 3WNKA 3H0OA 1NZIA 2PMWB 4YW6A 3VZNA 4PBPA 5IAVA 2BNNA 4UYBA 4XFCA 4A41A 4JDMA 1JZ2A 1OQEA 1VBD1 3CZJA 1FOD2 1NT0A 2RS31 3H7JA 1C3HA 1OH4A 1VBB3 1YQ6A 2A75A 1JZ8A 1X8MA 3AX4A 3MHZA 5KXEA 4XJAA 2EXHA 4MUVA 1W9TA 3IWZA 2Y6GA 4URAA 3TN92 1YFWA 4MADA 1QJY1 2F17A 4LR4A 1EUTA 5JZGB 1WA6X 1KFUL 2ET1A 1GQPA 1C4RA 1NXMA 1QJX3 2W47A 2W87A 1J83A 3POFA 4W8JA 4YZ2A 3C7FA 3D5OA 1SMVA 4IEOA 2VULA 3M3EA 4NAMA 5FLJA 3POSA 3S7IA 5BNPB 4H55A 2DCZA 4GJYA 1V70A 3IDAA 5IWFA 1K5JA 2XL7A 5T52A 3N9OA 4UW5A 3LE0A 1VLNA 4BIOA 1CAUB 3NV3A 1MVQA 5JR2A 3N9MA 4LORA 1BHGA 2ZHNA 3HIFA 4XURA 5KHHA 2Y0IA 1W8OA 3VBUA 5A7OA 4LK6A 2KR2A 3U07A 1RXFA 3N7LA 4GWJA 4HN1A 3SCGA 4CCJA 4TTGA 3UGFA 3ZDVA 2OVUA 1DGRA 2FBEA 3KCCA 3RGBA 3WEZA 3KCYA 4WVMB 4Z2AA 2J22A 1W2AX 1A78A 3WT3A 3DGTA 1K45A 2TEPA 2VZ3A 5CIRA 2Y33A 3N9QA 4YZ4A 5CFDC 3CMGA 3PTRB 2BW8A 2DUOA 4KI5M 4AG4A 4RL7A 1K5MB 2PLV3 5IVJA 1OVPA 1WW6A 2ZAAA 4LA2A 2DFBA 1NG0A 4XHBA 2VTFA 2AZ5A 2Y34A 2JDUA 2V5YA 2V4VA 3OOXA 1GZ9A 4Q4X1 1MQTC 2IFWA 3WNMA 4D7YA 2QQPA 5T5JA 1OUXA 2TNFA 2P5BA 1KDKA 5FWJA 2PTMA 2VQTA 5BNNC 3O1VA 3RI8A 1F35A 2VTXJ 3AXEA 3SMHA 1GZTA 1LULA 3AYCA 2CTVA 2R30A 1LEMA 4CEYB 4ZU5A 4DUXA 3GF6A 4Q4V1 4Q4W1 2B39A 2RS12 4FOYA 2JX9A 5J96B 5HCFA 3V65A 4QXHA 4MSVA 5FXWA 1U5YA 1WZXA 1ZZ6A 2WO1A 2PAMA 2R063 3ZLIA 1PIV3 2A6WA 3PUHA 5FY1A 1XRUA 1HJGA 3P3PA 4TLGA 3THDA 3ZM8A 3M3OA 4OI0A 3AYEA 4LBMA 4RGAA 3ZXDA 3IZOA 4I0WB 2ZGRA 1RUF3 3QH6A 1ZRRA 2Z5WA 1H1IA 4XYXA 5F5CA 3TBDA 1IKPA 2DFCA 2SLIA 2B5HA 2QQNA 4YNIA 1HN1A 3S30A 4A42A 5DDJ2 5J98B 4C0HA 3MPBA 4Q29A 4HPKA 4Y4RA 5FLHA 4FAGA 3SITA 2R043 1J1LA 1VBA1 3LIGA 1AR61 5JCTA 1GSLA 1Z7S3 4E9KA 3BKZA 4RR3C 2J1AA 4G3YC 3HQRA 3RJRA 4B7EA 2ZOEB 1ZM1A 4PLNA 4PQQA 3WF4A 4CU8A 5JOXA 4FOWA 4OMDA 1F4AA 2ZX1A 3POGA 4QQPA 3WINE 1LOFC 2YGMA 4LO4B 1HX6A 3WDUA 4GMP3 3VKLA 1LR5A 1VPHA 5D1IA 3SCHA 1LHWA 1YRZA 1Y9MA 2VZPA 3HR9A 1TMF3 4Q2FA 4TN7A 2BGPA 5FY5A 2XHNA 1JYWA 3BUCA 3HWJA 4KGQA 1BMV2 2D98A 1NLSA 3DYOA 5CNAA 1R083 3VV1A 5JZGA 3A23A 2WBKA 1LHNA 3OPWA 3T09A 5A3NA 4PI2A 1L7LA 2BVVA 3LPFA 1US2A 5I0TA 1LGNA 2GMMA 2K0GA 2W46A 3B69A 4LHNA 4LHKA 5FYSA 5DAPA 5IVEA 2VW2A 1ZZ8A 1NLRA 3HD8B 4A7YA 1AL21 2VL4A 1UW8A 1HB3A 4XBQA 5BNPA 2XQXA 1BBT2 1S2BA 3T2TA 3WXPA 3KGLA 1ST8A 1TZOA 1QNYA 2VTXA 4S2FA 1N47A 5F2WA 5FMCA 3DPRC 2LTNA 3DEMA 5C9AB 3KVAA 3MICA 4UFLA 5DUVA 3KVBA 5GLWA 3OYWB 1OLRA 1PGW2 4AQ6A 3I49A 2W92A 5FZKA 4DMIA 2Q4SA 5CKQA 4AL9A 4NR1A 5ANQA 1VRH3 4BLIA 1JU4A 5C4WB 1L7RA 4ORFA 2IXIA 1SBFA 1OKQA 3OUHA 1UZWA 3MFCA 3ZDSA 2VZUA 4R52A 4WVMA 1Q8QA 3WQ1A 3IDEA 3WX5A 1W9SA 1GOFA 1RIRA 2CV6A 3IAPA 2YC2A 3OJBA 1CQ9A 1J3RA 2D3RA 2HWB2 1K5MA 2J1VA 5H9RA 4CZSA 4EN7B 2VU9A 1PVC3 4IEXA 1XNBA 4BMEA 2HH9A 2R32A 2VOTA 2WNOA 2WZ8A 4YVSB 4U2AA 3J7MA 5A7NA 2FCVA 1W99A 5JI7A 1S55A 1JOJA 1JTZX 2CWSA 3B5LB 5LBBA 3WQ7A 1I5PA 3CHXA 4KBZA 5FZHA 1M06G 4QB1A 5E16A 3WDWA 5A6QA 4QGMA 3MIFA 3O1SA 2PYTA 3EBRA 4UI9L 5K0UB 3FHQA 4FFIA 3DXTA 3UGGA 1UY3A 1EAH2 2W0XA 4NMIA 2WWUA 4RS5B 2Y8KA 4FPFA 1JZ3A 1DYPA 4FSJA 1W03A 1DBNA 5FY4A 5T5OA 3WNNA 1RUG1 5I93A 1QU0A 1YQCA 4BU2A 2VD7A 1QJU1 3WVJA 4LLOA 2WNVB 1RUH3 5D21A 5A33B 1VAVA 3LAGA 3VBHB 5FO7B 3KV9A 4GH4B 4ES9A 1FPN1 4QPGC 4BWOA 5IK7A 4ASLA 2R1DA 1RUC2 2CAUA 1O4TA 3MW2A 1UU6A 1N1VA 4YGDA 3E5XA 1DQ0A 4AFDA 1JH5A 4KG0A 3PDQA 4M3CE 1MEC2 1POV1 2E53A 3FHAA 3ZIWA 1MS1A 2HYXA 4Z82A 3WD5A 3GM8A 4Q4Y3 4GB32 4DEVA 2I74A 3ZFEB 1QDOA 2UU8A 3ILNA 4R8HA 4ITCA 3S57A 1RUJ3 2JDHA 2ZMNA 3J7HA 4FP2A 5F6LB 3RZZA 5ACA1 1SEFA 4GKYA 2BP6A 4CCKA 4DY3A 5IFTA 2D5HA 4IE0A 4JV4A 4LULA 3PLQA 2JG9B 4NE9A 4A44A 1AYM3 3L9JT 4Q27A 1NQJA 4CUAA 3PURA 3WDYA 1UNBA 4V2WA 3E1F1 5EWSA 2P3YA 2WFF2 3AKSA 3TN91 2C4XA 5JR7B 1C8M1 1COV1 2DVBA 2DVGA 4QQOA 2ZGTA 4Y5SA 3ME2A 2WS91 1RUD2 4FFGA 4L92A 4BHPA 1W9YA 2JG8B 2Y6LA 3NQHA 3THTA 5A6YA 5H9SA 1YI9A 1YIFA 2AH2A 1H8TC 2P17A 2YU1A 2IWGB 2YBKA 2BYVE 5I8SA 2GNMA 4B4QA 4EE2A 4DUVA 4ATEA 1UOJA 2QZ3A 5CVRA 4K7JA 3MV01 4NRQA 2VMCA 4BQ3A 1AR93 3K3OA 4LTAA 1RXGA 3SLIA 2E31A 2GNDA 2RR12 3AZVA 5LW9A 1QEXA 4Q0VA 2XG3A 3FX3A 5C9AA 3N9NA 3KGZA 4DZGA 2LALA 3OYWA 4XDPA 2WA3A 1FV2A 1ULFA 2RDNA 1W9WA 1YXWA 1ZYBA 3LDKA 3NSTA 4UF0B 5C4WA 4ARXA 1YLLA 4IEPA 3PVOA 4Q0UA 3BOWA 4N53C 1D2QA 4V2VA 1FMD2 4AI8A 2W91A 5AVPA 4P5HA 1CZTA 1CN1A 1TME2 1CX4A 4BM8A 4P08A 4PLMA 4DNYA 2JDAA 4QWNA 2BOIA 1AX0A 2MEV1 4UW6A 1DG6A 2XDVA 2ZZQA 4CDUB 2ET7A 5EXOA 3HPNA 2JIGA 4IEUA 2BDRA 2GC3A 4AFCA 2BRTA 2D7FA 2EIEA 1O6UA 5C6CA 1EUUA 2DTYA 5BYNA 3D82A 1PO13 4UAPA 4YVSA 2GZWA 1A34A 3WDXA 1VB4A 1XQNA 1H6XA 1AR81 2JDKA 1PM4A 2X5IB 3ELNA 3U75A 2ZGMA 3GBGA 5FZCA 4CP2A 2PHTA 3I3MA 3NAPB 4QX5A 2BV4A 5FQ0B 5K0UA 3WG3A 1WCUA 2DWRA 2CNAA 2AUYA 3LSEA 4NHYA 1VBD2 4UFHA 5LBFA 1NKGA 4AK3A 4RS5A 1MZEA 4XUTA 5IK8A 3S5AA 1WCDJ 3AVSA 2HYKA 3RYRA 4XAEA 1WLTA 5A33A 2WNVA 2J1TA 2XKOA 1ZRCA 4GH4A 4P02B 1QJY2 1IS4A 3BOPA 1ZA7A 1Y4WA 2BNOA 3PVBB 4MYEA 5H9QA 3LFIA 1M4WA 2WT1A 3T4VA 2BQPA 4QX7A 5KXCA 2YYOA 3BN6A 3N7KA 2JDMA 4K3UA 3LA2A 3PHMA 1WBLA 1VMJA 1MACA 4H7MA 3HQXA 1NCQB 4C91A 4AOCA 4OI4A 4V1PA 3ZFEA 5F32A 5AC91 5H9PA 4QQHA 2H6BA 1RUOA 2P1BA 5FPXA 3K46A 3O7OA 2Z42A 3T1MA 5L7OC 3VB9A 1DF0A 1V00A 3H8XA 3O1TA 2XWBB 4YM3A 1AXYA 5C8WA 3G7DA 1VAKA 2HWF3 4LBNA 3U4XA 3THPA 4JKKA 5CA6A 4GKXA 1AXKA 3T3YA 5IHRA 3VBFB 1FX5A 1XE8A 3WF2A 2DUQA 2JD9A 1GICA 3O1PA 1UYPA 4NRMA 5E88A 1LAJA 5C3PA 4FT8A 5CISA 2HEVF 1KDMA 1CPNA 1ND2C 4CXWA 3OEAA 3M70A 5F9TA 5CBLA 4PDWB 1VAMA 2JG8A 2A7AA 4P00B 2D44A 1H2KA 3I97A 3MLKA 4MVTA 2W95A 5FZMA 3FLTA 2QE3A 3J8F3 4F83A 1GOGA 3IKWA 1AJKA 3ASIA 3I54A 4LK7A 5JMOA 3VLBB 4Q4X2 1SDDB 1QH7A 3IIIA 1GZCA 2PHRA 3AYDA 4QXKA 5FXZA 5EYXA 2VNOA 4OMCA 3WSOA 2WQ4A 3ZVXA 4CCNA 4XFAA 3LPGA 2IXHA 2RVAA 5CZKA 5FZ0A 5K8SA 1F5FA 3CJXA 3NV2A 2W52A 2P34A 4Q4V2 1QQP3 5C3RA 2O8OA 3DKQA 4Q4W2 1QKQA 1U5IA 2IFRA 4UF0A 5LA0A 1SG3A 2VUJA 4A2UA 1A6CA 1EV13 3ZN5A 4I09A 4N43B 4QB6A 1XU1A 5JZGC 2D6OX 1Q8SA 4P9YA 4ZZ5A 4W6YA 3IM0A 3GZAA 2VC9A 3B3QE 2YMZA 1WCQA 4JTOA 3NV4A 1W6QB 3I2JA 4X6RB 2Y6JA 3PNAA 4QKFA 5BV6A 3NJXA 4CDUA 2VNGA 4K6BA 3ITQA 5BNPC 3H1WA 2IXJA 1DDLA 1TVGA 4RSUA 4OHWA 3OEBA 2J1SA 2CGOA 4OZOA 2D43A 5F5QA 4EWEA 1YFYA 3AJZA 1UOBA 2R061 2X5IA 4NHKA 5L36A 1G9AA 3NO8A 4W50A 3AMNA 4XMIA 1CAXA 2FDFA 2CU5A 1VBA2 2KD7A 1AR62 5FZ4A 4L99A 4IE5A 4K9SA 4H3WA 4IW3A 5FQ0A 1RUF1 3BVCA 1W04A 4AVBA 4YYOA 1DLLA 2WR9A 4NWWA 4CUCA 1HRI3 1K42A 1OA3A 2UURA 2NZ9A 2ZGOA 4EWDA 2IUWA 3Q8CA 1ZZ7A 1JW6A 3AFKA 3DPRA 3OPZA 1ULGA 4RA0A 3WW4A 2ARCA 3U37A 3I7DA 4XFIA 5IFPA 2PQSA 5ABJB 1H2MA 1O59A 5SV5A 4HSLA 3DL3A 4OQ8A 3K4AA 4JX0A 4URTA 1DP0A 3U78A 1GOHA 4XQDA 5FYUA 4XJZA 4AWDA 1BJQA 2DCYA 4JGZB 1K5MC 3ATGA 1DYOA 2VW0A 3KHBA 4QPWA 5F3GA 4AAXA 1JUIA 3BTZA 1OOPB 1UO9A 2ZCWA 1LHUA 1ONAA 1UY2A 3CNAA 1JN2P 4LE3A 4KWLA 4B8EA 1KFXL 3VKMA 1AL22 1PVXA 2XB6C 3VHNA 1O5LA 3M7AA 1W6OA 1D7PM 3ORJA 5E1RA 1MVEA 1LNSA 2W08A 2G1MA 3JU9A 1R081 2ZS6B 2XLGA 2XUMA 3EQEA 5FY0A 1E5RA 3VZMA 3S7EA 4CEYC 1X8EA 1RTVA 1LHOA 3ACIA 3I3BA 4E2GA 1RUNA 3BU0A 2UWAA 5KXBA 2XJRA 2VJXA 5DQ0A 4B1LA 4MHRA 1H1AA 4NOTA 5FYYA 4GMP0 4Q8LA 4LBQA 1PGSA 1FOD3 3ZSJA 3VBFA 1W8FA 2WA4A 2G9FA 4FI9A 2HLEA 2EA7A 2VQUA 1J58A 1VBC1 2YXSA 3NKTA 4PIZA 3RWKX 1O4ZA 2F4PA 5BNOB 3F95A 2VAUA 2Q5TA 2X09A 3BALA 3CJIB 3ZXEA 2EVXA 3WCSA 2A3YA 3U1XA 1UIKA 4A7KA 2XHKA 4ISRA 4PDWA 2WO2A 1TNRA 1LOGA 1CZSA 4EYUA 5AFBA 2BJSA 3AM2A 1VRH1 3LEMA 4LITA 5JDBA 2CDPA 2HWD3 4FPOB 2VO5A 1GFF2 1DQ1A 2WT2A 5GZFA 1CAVB 4Q8KA 1MS3A 2JE8A 1VRBA 2L9LA 4XCAA 3JCIA 1XNAA 2H0VA 2V09A 4YW7A 4AGRA 4CPBD 2QQWA 3PMEA 2NYYA 2WT0A 3NV1A 3TEZA 1X9TA 1HB1A 4UBGA 5A32B 3U11A 2D3PA 1GKBA 4R9BA 4LO7A 2YFUA 3KF3A 5LY1A 5F8PA 5LBCA 4IGPA 2OW4A 3WDTA 2VMIA 5T5LA 1MR5A 2LRPA 4QX2A 4X6QB 4XUNA 3SH5A 1V0AA 2BBVA 1LENA 1RUG2 4MXVA 3UT0A 4AQ2A 2J42A 4N43A 3LOIA 1QJU2 3ZSMA 2Q8OA 2QQJA 4AZZA 1QIQA 3KZ4C 3IMNA 4CCMA 4P9IA 1FPN2 4TXWA 3R4UA 2D93A 1W6QA 4M4RA 2Y0OA 4MGZE 1D2SA 1JS9A 3FBYA 1OA2A 4NPMA 2IXKA 1FNZA 1O7FA 4UFKA 5EJZB 3APBA 5FPLA 1MZ5A 2WJSA 3JQWA 4RGKA 2Y38A 2ZGQA 4Y1YA 1UD1A 5A80A 3ZFFB 3U14A 2RHPA 4NN0A 5EYYA 3AKPA 5C5TA 3PVEA 5ACA2 3A4UA 5C9AC 4AR2A 1VALA 1ENSA 2JE7A 1XNKA 3THCA 2BU9A 2NMOA 2GU9A 2R0HA 2GH2A 5A3OA 4NHXA 2DURA 1IPKA 1ULOA 4FPLA 4Q4Y1 3IPVB 2WKKA 5C4WC 2CGPA 1FNYA 3VBRB 2A6YA 5C33A 3E97A 4CEWB 3POIA 2ZJCA 1AHSA 2C5DA 3NNFA 1RUJ1 2R0FA 4OUEA 4WZFA 4A45A 4X8NA 2RS13 1C8M2 1COV2 3SEPA 4MGQA 3AFGA 2ADDA 3VUOA 3PTYA 4JGZA 4I3PA 3HBKA 1EPZA 2A3XA 2HEWF 4N53A 3LCPA 2WS92 3EJKA 1HKDA 4I01A 2BUKA 2VOWA 4YVSC 4GZ9A 5C71A 2E26A 2R073 3E5QA 1LKNA 2HWC1 3ZR5A 4L11A 2ARBA 5GM0A 4CE8A 4CCOA 2WDBA 3ENRA 4FAHA 2Q0AA 2VZRA 3DCQA 1B35B 4KNCA 3OUJA 1RB8G 4FPJA 4HKWA 5L73A 5FKCA 4H14A 3X29B 1E5HA 1JOPA 2XJVA 5DDJ3 5LRSA 3K2OA 1UKRA 1CX1A 5K0UC 1POQA 3VHRA 1F15A 3ZIXA 3BTXA 2JJ6A 1X36A 3CL1A 2IVJA 1S2EA 2Q1ZB 1H9PA 1BXHA 3AXDA 1YQ5A 2VG9A 3L2YA 4M0NA 4RS5C 1FYUA 3M3CA 2A6ZA 2ORXA 2VZQA 2YDEA 3OGSA 4LIVA 2DUPA 2UY9A 2BGCA 2VUDA 1LB2A 4YZ1A 2WRAA 1QOSA 4OYUA 5DABA 4GXLA 4AI1A 2WNVC 4XXAA 4DPNA 3MYXA 2K2SA 3VBHC 3WP4A 3FLPA 3MUZ1 4GH4C 4IQPA 4XTPA 5FR3A 2NP0A 2B4KA 2PA7A 5EHDA 4AEDB 2XUEA 3OG2A 1GZWB 4KMQA 2WO7A 5LA2A 1O4YA 2XJQA 3J26N 5DAWA 1NE6A 5JSPA 4XACA 1OLMA 1WA4A 3A0KA 3WP5A 4RFRB 4XBLA 2G19A 4EWAA 4W65A 3A7QA 2E7TA 2MEV2 5B4XA 3VN4A 1QJZA 1G86A 1NA1B 1OURA 1VB2A 4YLZA 3ZFEC 3WCRA 1N3OA 4NIHA 4AHWA 3MF6A 4DB5A 3D0SA 4FFHA 1R1A3 1CAVA 4NIGA 3FN9A 3W5MA 3IDCB 4JQTA 5KHIA 4BQ2A 1ZZ9A 1AR82 1IQDC 1GWMA 2VECA 4QGNA 3FZ3A 4N90A 5FXXA 5FZ8A 5IVYA 5A7PA 4BJ0A 5A3UA 1BBT3 2JG9C 3B93A 3LQCA 1LOCA 2VMHA 2DBNA 2V4AA 4L8QA 5J37A 2BGOA 5L9VA 1ZNPA 2BPA2 4WM8B 5A32A 1SFNA 4CSWA 5FP7A 2D6PA 1ND3B 3BPSA 3OBZA 1HV0A 3F2ZA 1AR73 2YHJA 4HBNA 3TOJA 5L7OA 2PHFA 4QB2A 3UL2A 4XFHA 2MPFA 4IDZA 3C7GA 4XAAA 1H6YA 4P14A 2DBIA 3RZLA 5IYYA 1J59A 5I8TA 2EXKA 4JDNA 5KXDA 4L9BA 1QWRA 1GLHA 2JG8C 1W8TA 3VDDB 3Q8EA 1RMU3 3ZXGA 4P9LA 3V0AB 2FCUA 4O61A 5JLVA 2A1XA 4YPJA 4BDVB 2RM23 1ND2A 2ZX4A 3ZOIA 4X8PA 1JYTA 4CDQB 1UYXA 1FI2A 4P9GA 2F4LA 3LEKA 3ZYGA 4I3GA 2HWB3 1H9WA 5FUNA 1AYN3 4KGGA 4CA9A 3NJVA 3WUDA 4CUBA 2J1UA 2WZR1 4O65A 3ZFFA 2OPWA 4C1XA 1N3QA 2C26A 3QCWA 1XPWA 2PHXA 2YBSA 4XC9A 2E63A 5AC92 2HJIA 4OUMA 4UT5A 4XIKA 1KD7A 5CKNA 3O14A 5GZCA 1OHFA 1JYCA 1MPXA 2B45X 3WV6A 5HXMA 4AQTA 3FJSA 3P5BA 2Y6KA 2VCMA 2LUWA 3TNPB 3T4HB 2K46A 4Y1ZA 4N7IA 3IPVA 1HN0A 3RDIA 3VBRA 1R093 1DGWA 1NCRB 4UBHA 2Y26A 3MBWA 4IERA 4CEWA 4YW3A 3VDCA 2PHLA 5FPBA 1CJDA 3RQ0A 1QXRA 1PNFA 4JZRA 5DZEA 3WNPA 1S4CA 4C90A 3MFAA 4PLOA 3J4UH 3ZYFA 4CDUC 5FYVA 4MLOA 4CU7A 4B1MA 4IGQA 1NQDA 4OUSA 5FJHA 3Q8AA 5FZIA 4OCTA 2OQ7A 3HJRA 3RG0A 4XJ9A 3MPPG 3KT1A 3VZJA 2BNMA 3OBTA 5FBZA 2X5IC 2DCKA 1GWKA 4GD4A 1F8VA 4PJYA 4XF1A 1B35A 4JC1A 3NVCA 1CAWB 4ZZ8A 4GB33 1OD3A 2Y6FA 3I2DA 3NAPC 4AI9A 4K8FA 3POYA 4XZUG 1LGCA 4B4PA 4EZHA 1YQ2A 5EZWA 2YZ4A 3ES4A 1CAUA 4IEWA 2JEMA 4FQZA 3NW4A 3E6CC 1Y7BA 3AB0A 4AHYA 5LA1A 3GCWA 1ENRA 3HBZA 2RJ2A 1C1LA 1X9PA 3H42B 5HPOA 4E2QA 5J48A 4HKLA 1OMIA 1QHDA 2WWJA 3W5NA 2E51A 3M3QA 1I9RA 5IW0A 5FPZA 3KHCA 4I30A 3KT7A 2C6SA 4S2HA 4BIFA 3M2MA 3PUAA 2FMYA 1W0PA 3OCPA 1OH3A 1LODA 1V9U3 3KLSA 4YFZA 1GZWA 1PO21 3GXUA 4XIOA 1QXPA 5EP9A 2QFEA 5KWRA 3QLQA 2XVLA 3CIHA 1VBE3 1LESA 3C7EA 4QQLA 1RUD3 2XQRA 3IT8A 2XJSA 1NCQC 3I3QA 2EAAA 2PAKA 4ASMB 1OKOA 1QY4A 4Y1XA 3ZPOA 1AX1A 5FO8B 3ETPA 1JMUB 2ZEXA 1Q3EA 1BVP1 2D5FA 3I3DA 4I02A 4XW3A 4PCRA 2ES3A 1IS5A 2R062 2CAVA 3TEXA 4ZU4A 1IHMA 4P9WA 4AVAA 3OF1A 4WM8A 4XVHA 2VPVA 5FYIA 4QMAA 2QQMA 1XC6A 1ND3A 1RUF2 1NLQA 4RHV3 3IAQA 4TWTA 3VBFC 1DHKB 4CEYA 4A3ZA 3AMQA 1HIXA 5EJ1B 4AFBA 3JD71 5I91A 2LM3A 5JPNB 1WW7A 5FPUA 2ORZA 4QX1A 4C8DA 3FWEA 1HRV1 1XSQA 3I3EA 4JKMA 5DXDA 4XEZA 2R042 1G8WA 1ZBA3 3D8CA 4PDWC 3VZKA 3VZLA 3VDAA 5FY9A 4QM8A 4XETA 3WF1A 4TLFA 3V0AA 3FC0A 3N3HA 3ZSEA 2RMU3 3KM5A 1CR7A 2BEOA 4CYDA 2G9GA 1C1FA 3AZYA 4MH0E 2DCJA 1W05A 1PHMA 1VMFA 3AJYA 1AL0G 4IEZA 2EXJA 3U10A 4CDQA 5TSWA 3GCXA 4NVPA 4XXPA 3WR0A 3BTAA 4DRRA 5ERLA 2RDSA 4LOSA 3LOBA 4NO4A 1RJ8A 2CGNA 1DCSA 2VCBA 1ASJ1 4OLLA 1G9BA 1S0DA 1H30A 1R082 5A6XA 2RDQA 1NYWA 1REDA 4QT6A 1W9FA 2JECA 4FFFA 1DFQA 4IEYA 4ZPIA 1RJ7A 1Z78A 1F5JA 4H7LA 2J1RA 1ZRFA 2B42B 1D4M3 3UETA 4F3JA 3TEYA 3O0XA 4LNVA 1QGLA 1NCRA 1ZBE1 3V0BB 4N43C 4QDSA 3ZMOA 2RS33 2WLQA 5IK4A 2FD8A 1UOGA 5DG2A 2W9XA 1UPIA 2IXCA 5DN2A 5FYZA 5F3EA 2WNUB 4ZU7A 1VBC2 3TRSB 2D6LX 4DO0A 5FUPA 3I2KA 3GALA 5C3OA 1Q8PA 2DF7A 4HANA 4JAAA 4GIQA 3E5UA 1TNFA 4LBLA 1QJY3 4COVA 1ZZCA 2FDJA 5A3PA 4NIDA 3WHUA 3BYWA 1AX2A 4I0AA 1IGOA 3WW3A 5FRAA 1G9FA 3VD5A 1VRH2 4HK9A 4QPIB 1IPSA 3RZGA 1OFSA 4INDA 4HG6B 1CAWA 5LB6A 4Z1VA 4LE4A 1RUI3 3T2PA 1BYHA 4COZA 4C1WA 4Y1VA 2XBO3 1V6MA 1UQXA 4JRLA 4RQPB 5LK5A 4YW5A 1IZ3A 2GC2A 2PHWA 3WW1A 4GWNA 3C8XA 1ULCA 2VVDA 3DF0A 4B7KA 4ZKTB 3FLRA 2RJLA 1LU2A 3POWA 1GR3A 1LOAA 2HWD1 2VMDA 2ATFA 2VR4A 4NPLA 3UJOA 5ABJC 3LIHA 3BU7A 2XOMA 5KHJA 1O3TA 4K21A 3IN9A 4Q0SA 5A70A 3OPTA 1IKQA 4JGZC 1YCIA 4QKDA 1OSGA 1UF2C 5DUWA 3CKHA 2OZ6A 4HVOA 2K9ZA 1OOPC 1C8NA 4DINB 2VZTA 4PIXA 2ZEZA 3EMRA 3MV11 4KQ7A 4IXLA 2Z69A 3AL5A 4QHBA 2VZSA 4WVZA 3WG4A 4QXBA 3SEEA 3I59B 4XFFA 1JYNA 4XUQA 2ZGNA 3AKTA 4YM1A 2QZ2A 3LF7A 1A8MA 2JDPA 1D4VB 4Z8BA 2BBAA 4OULA 5FMDA 5GZDA 1RHI1 1CZVA 2R49A 3AZXA 4KWJA 4AXOA 3VD4A 3HNMA 4XF9A 2P3KA 2NQYA 1HQLA 2Q1FA 1WW4A 2QNKA 5FPVA 5T54A 3ZXFA 4AAPA 5CG8A 4A4AA 3SC7X 5KBFA 1O5UA 5CFCB 4BCUA 1AVBA 2CY6A 1QF3A 2P3JA 1GBGA 2JDNA 5LCWL 5FMOS 3VDBA 3O1MA 3I4IA 3UNPA 3RSJA 4Q4Y2 3H3LA 5F6KA 2VCCA 5BNOC 2GSYA 5BUVA 4AI3A 3CJIC 4R4ZA 5J7MA 4Q4W3 1RUJ2 2P2KA 2ZX2A 3B9IA 4UFMA 1O91A 3VBHA 4A6OA 2PQQA 3LEIA 1RUE3 2BZDA 4K8RB 4BQWA 5D8AB 5FXVA 1DIWA 3AC0A 3E6DA 2EAKA 4HMZA 3FHIB 2B46X 3POEA 2YPJA 1UMIA 2YC4A 3JXSA 1O3SA 1VBB1 1YHFA 4XE9A 3ZX7A 1XSRA 1RVF3 5FZ6A 2VBPA 5DUUA 2A3WA 3BGAA 4O9GA 4QX3A 2HWC2 4LXLA 3Q8BA 4WV8A 5JIAA 4AFAA 1IG3A 3I2GA 4LHSA 5A6ZA 3ETQA 5FO9B 4ZXEA 5LA9A 1S0FA 1L3JA 1R64A 2BWCA 2HBTA 2IC1A 1PM7A 4DRVA 1YFUA 2JXAA 2VM9A 3KSCA 3SISA 4RGGA 4CDWB 4KL1A 4D8MA 5FYMA 5IUQA 1QJX1 4LO8A 4IV1B 3VBSB 4AI2A 4BXSV 4AVTA 2FZ2A 4GWMA 4EJRA 2JG9A 4J1XA 2R071 1AR63 3BCWA 1L7QA 3VKNA 4LKDA 1SDWA 1T6GC 3RFRA 4YGCA 3PUQA 4NHMA 1W0OA 5JI9A 3MLLA 2WYFA 3RMXA 3NNMA 3V0BA 3CBNA 4GJZA 2V72A 4FPHA 1S2KA 2WFPA 4M3CF 2WNEA 2WNUA 4Q5OA 1E5IA 2ZEYA 3I2IA 5FP9A 3WOGA 5J1XA 4ZS3A 3C2UA 1TQ5A 4MXWB 3DV8A 5I0DA 2RS53 1XJAA 1R1ZA 3RZMA 1TG7A 1ZZBA 5FAXA 5DPNA 1BEV3 1OPMA 4AVCA 4LQRA 1GANA 4MGKE 5T55A 2A70A 4DXSA 2EF6A 5KR7A 3ZFFC 1G9CA 2WN2A 2VXJA 3FUQA 1Z0HA 2JDZA 4J1WA 1KJRA 4HT1T 2R6QA 4QPIA 4Y26A 3R4SA 3UJQA 4IETA 5GZGA 3OD0A 1SLAA 3NWKA 3OBAA 2CYFA 4E4HA 3NMBA 1AL23 3UESA 3JBG3 1XB9A 4RQPA 4BXFA 2YB7A 1K12A 3GJAA 4P9JA 4LMFA 3P1IA 2DYCA 1BLZA 1XOYA 1AXZA 4RYDA 1U0AA 4YM2A 2D3SA 5JXIA 5FZDA 3VBRC 2PLV1 4E4SA 2XL9A 4CEWC 1ZVFA 2JKXA 4IGOA 5JWPA 3M4FA 2DVAA 1N1SA 3K4DA 5C3SA 2P3IA 1CD3G 1R1A1 2DV9A 3WP6A 1A3KA 4M0HA 1FV3A 3WZ1A 3PJYA 5A7WB 4PF1A 4EN9B 1WWYA 3KQRA 5K9YA 1WMDA 2VUAA 5FFOC 1NAEA 2A71A 4BQ5A 1HXS3 4QD2A 1Y9GA 2AENA 4M4PA 4NAOA 5B2GB 1BZWA 4FQ4A 1H1MA 3RS6A 5FZAA 4R4XA 3PU8A 4JVAA 4D94A 3ZO0B 4DIQA 1AR71 5JSRA 1VP6A 1RINA 2HWE3 5FK8A 4UWDA 5L9RA 3I59A 3WDVA 1B35C 1YQ8A 3ST7A 4XILA 5F5IA 2XGXA 4LUMA 4WM7B 2ZXQA 1EPWA 1D0HA 4XABA 2DU0A 2WZR2 1ODMA 2WZEA 3PMSA 3R4DB 5C7GA 3UKTA 1ODNA 1RMU1 1PIV1 3MDPA 1S0IA 4XF3A 2QDRA 2EIGA 3ZSLA 2ENRA 2VOXA 3CEWA 1YYNA 3NAPA 1US3A 4ONUA 4DXTA 2YROA 2RM21 2IZWA 4IEVA 4HXCA 5CFCA 1V6IA 3GBFA 2VBDA 1ACCA 2WN3A 1W2UA 4JKLA 4AEMA 3R05A 4IE6A 3QOPA 4MGSA 1WGPA 4IL7A 1JZ4A 5DAQA 5EV7A 2E7AA 2HEYF 3FUOA 5FZGA 1F31A 1UIJA 4AEDC 3WHTA 4OI1A 2EIBA 4DFSA 2R041 1W3XA 1UU4A 4E27A 1Z7S1 3D0JA 1KJLA 4ET7A 1CWPA 4QX0A 4QPYA 5D8AA 1QJU3 3HVDA 4PF5A 3ZMNA 5F7UA 2YG0A 1NA1C 1U5XA 1S0CA 3HNBM 2BOJA 2HWF2 1UZYA 1ZA4A 3NNJA 2O1QA 4R9CA 1UY1A 5FBJA 1DZQA 1W8ZA 1PZ9A 2D6KA 2FZ1A 2VW1A 2ZTNA 4GMP1 3KS7A 5SV8A 1QJEA 3U4SA 1W8NA 2XWJB 4D6SA 1NCQA 5A1LA 2P37A 3LSDA 5FZ1A 1SFPA 3ACLA 4FPYA 1TMF1 1MS4A 3WQBA 2PN5A 2GC0A 5BNQA 4WM8C 4CDWA 1ND3C 3EHKA 4KG8A 4IV1A 3VBSA 2Q8DA 5ACA3 3PL0A 3BB6A 5CU1A 4S2GA 4D3WA 3JQXA 2XVGA 3N7MA 1LGBA 3IMMA 4XDQA 2A6VA 3JUUA 4ZS2A 1O8SA 1QH6A 2QUOA 1CPMA 3AP5A 1PK6B 3ILRA 3KV5A 3LDRA 3K77A 4CP9B 2FQPA 5A3WA 4HETA 4AVVA 3VDDC 4FO9A 2WO3A 5FOJB 3VBOB 4CP0A 2WC2A 1IG0A 1W90A 2GDFA 1SACA 4KWUA 3ZYIB 3TN93 4DEQA 1PO22 3EO6A 4ZHNA 1E5SA 1JXNA 2ZMLA 4MXWA 3ZXLA 4CDQC 1LJ7A 3VL9A 4PIYA 3M8LA 4BH9A 2WIIB 4QDQA 5CYYA 3RMYA 4AFMA 2SBAA 3WNLA 3VBUB 5LASA 4EN0A 1EP0A 3MIDA 4GQ7A 4Y4YA 1BKZA 1YUDA 1V9U1 2EICA 3WNOA 1BK0A 1Q43A 3AL6A 1QMJA 1PGL2 1MZ6A 1W6PB 2ADEA 4JHTA 1W6MB 4LHLA 1XYNA 4GAZA 5A1AA 4XCBA 1NZCA 5EFUA 3H50A 5JOZA 1GP6A 3ZKUA 1C5HA 3HT1A 5F37A 2B9UA 1W0NA 1NCRC 1GU3A 1JYIA 1PVC1 3TEWA 1WD3A 1O3RA 3K51A 2ZABA 2EIDA 1ULPA 5F5AA 3MUY1 5A7WA 1W2TA 3JD72 2AEYA 3VKOA 2VZOA 2W1WA 3FMGA 3GDBA 3PIGA 5FPAA 2VQ0A 4PI0A 2OT7A 1HRV2 4NHLA 3WUCA 2ZBJA 5CEHA 3O1UA 3HT2A 1GV9A 5FLIA 2FDIA 1REFA 1WCSA 4RHV1 1KS4A 2Q1MA 4UFJA 5CKMA 5EQUA 4JHZA 2ARXA 2VE1A 3MIHA 1EY2A 2YBPA 5IVVA 2ILMA 4J6GA 2PAEA 3W20A 4WM7A 4BOWA 2JDYA 1RUH1 1GNZA 1MS0A 1S0BA 1ZBA1 2QJVA 2UWBA 2XJPA 3ES1A 4N8MA 5FZFA 1ASJ2 1WLDA 3N9PA 2BFUS 4YRDA 5FOBB 3LB9A 3I8TA 1SZBA 4YZ5A 1UCXA 2TBVA 5LY2A 3UKVA 4XF0A 4Q1RA 3VHPA 4D0QA 1J84A 1Y3TA 1NUKA 2X53S 5IJRA 2N7GA 4CU9A 2RV9A 1UYYA 2XH6A 1BCXA 1BQPA 1ZBE2 3DYPA 2BERA 3OY8B 4ISQA 4KBBA 4W6XA 2ZX0A 5ABJA 3RZHA 4OZXA 5I0UA 4HPKB 1SQ4A 2MNGA 2ZGUA 1C5IA 2X8KA 1AYM1 3AP7A 3FFQA 4FTSA 5C8CB 3MW4A 2BWAA 3BIEA 2X29A 3H8OA 1OOPA 4FCAA 4S2DA 1D4M1 1YIPA 2O0OA 3WW2A 3LEGA 3SKJE 3ZKYA 5IAXA 1PMHX 1UL9A 1OVSA 4HONA 4JGYB 2IXLA 3N7JA 2PFWA 2TUNA 3D3AA 3ZFGB 3GBWA 3S6PA 2LS6A 4Z2WA 1Y43B 4CU6A 5T5PA 4YGEA 5EJ3A 4UW3A 5DG1A 1HV1A 4DY5A 1SLCA 1F9KA 3ZR6A 1WMFA 3ILFA 2GMPA 5AC93 4XZPA 1KS5A 4EV0A 2O14A 2H0BA 2ETEA 3DYMA 3ON7A 4O9EA 4XQ4A 4HSJA 5FV3A 4FPGA 1X33A 4UW4A 3GHNA 3AVRA 5LWBA 5K7PA 1W39A 4DQAA 1EYBA 2HWD2 2OX0A 3AKQA 1PK6A 4ATFA 2JWPA 4Q0PA 1UZVA 4CP9A 2XR4A 5EIYB 4PT6A 1W06A 1SCSA 1PZ8A 1RUI1 3M3IA 1AR91 1WBFA 3ZXJA 2XBO1 3VBOA 2VH9A 1ULEA 3ZYBA 3N36A 2E32A 4YARA 5BNOA 4LKSA 4Y1UA 2DVDA 3CJIA 1WMEA 3P6BA 2JB8A 4QQ2A 1YO8A 3RI9A 3JB4C 4Y33A 5FZLA 2UYAA 3FL7A 3SH4A 3WNXA 3POJA 3AMPA 3W9AA 2I07B 1FATA 1ENQA 3TAYA 2PELA 1LECA 1YI7A 4Y5Z0 3SQOA 1OC1A 2W1QA 1W6PA 2NLRA 1RHI2 4IESA 1W6MA 3AMHA 2Z4FA 4QXCA 1GP5A 4YVWB 1V6NA 2QQLA 5FMBA 3T2QA 4FPCA 3AP6A 4P5YA 1J1TA 4HZFA 3H1YA 4CXXA 3J9SA 4DUWA 1UXZA 1PNGA 1OQDA 1UMHA 1V6LA 1UAIA 1HDKA 4AVSA 5JXJA 1C57A 2QQIA 1PO11 1PZ7A 4CVUA 1XXNA 3MF9A 3NJZA 2WNUC 4XJUA 4QM9A 4AE2A 2P6CA 1HB2A 1LOEA 1OLME 2WAAA 4BQ1A 5FUIA 4YG6A 4DXRA 4IE7A 2P4EA 2GN7A 1WLWA 1OUSA 3C7OA 2JKBA 4JCKA 4M3CB 1YNAA 2VZVA 3Q8FA 4L0PA 1ZREA 1UWWA 4IV3B 4XUPA 3HMYA 2XJTA 3GZEA 4QPIC 4BK4A 1VBB2 3VKFC 2ZZJA 2WSVA 4M01A 2QTWB 3CLPA 3KCXA 3INAA 3MLJA 1DGRN 1GNYA 4E4DX 2ZHKA 2ZHLA 4RQPC 2DTWA 3GYDA 4LIUA 1RUE1 2H6CA 4Y24A 2ZA9A 1TEIA 3PVNA 5APAA 5L19A 1SFYA 2AR6A 1QJX2 4B4RA 1XNTA 3H1MA 1RVF1 4XF4A 4QKNA 1MS5A 4NWVA 4XJ8A 2VBBA 2W39A 5DZGA 1WW5A 3ZN6B 2R072 3MIGA 3KF5A 4OHVA 4R9AA 3LA3A 4FOQA 2R16A 1VE0A 1IOAA 4WZCA 1AUYA 4ARYA 1EAH3 2E7QA 2W3JA 2BVBA 3OY8A 5I0SA 4Z92B 3ACGA 3RZJA 1YC61 4OQ9A 4MGIE 4CCLA 1Q8VA 3AKRA 2CL2A 3QBQA 1N1YA 2WWSA 2QBXA 1H2NA 2VNVA 5C8CA 1DQ5A 1H4HA 2ZX3A 4A7ZA 2HWF1 4D7SA 1RUC3 3WF3A 4MZUA 4XDOA 3CU7A 1Q56A 2X10A 3B00A 3JZVA 1PX4A 4EQVA 2VUCA 4QDRA 2KXLA 4LBQD 4JGYA 2W94A 4XFGA 1MEC3 2OKXA 1W3VA 1CIYA 1DQ2A 5LEKA 1YEWA 1MZFA 2I2SA 4MHUA 3ZFGA 1P8JA 3SXWA 1NE4A 1REEA 3LWCA 4AGGA 2B8MA 2AEZA 4W4ZA 5CFCC 1IPJA 2C9KA 5FJKA 2RS51 3NRUA 4PQ9A 1URXA 2OYZA 3B7MA 1BEV1 1LRHA 3T2OA 3ACHA 5HI0A 4E2SA 5J36A 1HB4A 4FTBA 2PLV2 3J8F1 2AYHA 3RZKA 3RVHA 1W8UA 4XJWA 2B7YA 2NMNA 1QJFA 1JBCA 1R1A2 1UKGA 4AHZA 2W68A 1KQRA 2AACA 4D7TA 5D8AC 5FZ7A 3JBG1 4I0BA 1CIWA 2WFF3 1SPPB 5FMOL 5CG9A 3P3NA 2FDGA 3AZWA 3O5SA 3S5QA 4AEDA 3SH3A 1GQGA 1WMXA 5GLTA 1VBC3 2ZGKA 3O1OA 3O1RA 5FY7A 3RYKA 3GZTB 4HVQA 1KRIA 2WSUA 1IS6A 2WQ8A 3T0BA 4BK5A 1AR72 1QQP1 4Y3OA 5IT6A 1CONA 1NA1A 4O7XA 5FKBA 4Y5TA 5JXGA 2NN8A 2VGDA 2G4IA 4A6SA 1BVVA 1PGL1 3ZXAC 3CF6E 2DCTA 4IUGA 5FYBA 1HQWA 1EV11 1HXS1 4CDWC 4IE4A 1KGYA 2YGLA 3LA7A 2BTVC 4IV1C 1N3PA 1S0EA 3VBSC 5G04L 1T6BX 1LCLA 1RMU2 5KC6A 1PIV2 4HLTA 4YVWA 5FWEA 4QGLA 1NY71 3T0AA 2HWE1 3A22A 4YW2A 1JU3A 2RM22 3BTYA 1XYPA 2RR13 3PIJA 3URFA 3PU3A 2DDUA 1OQ1A 2JD4A 5FREA 1CGPA 4YGBA 3KT4A 1W6NB 5LZ6A 3O0VA 2EALA 1AYN2 2OZJA 3DECA 3RNSA 2Y64A 3EB7A 3RJ2X 1YWKA 4J25A 2JIJA 4CCCA 4N9HA 3V64A 1VMHA 1XU2A 2D40A 1OXCA 3QH7A 1JUHA 3IBMA 3VDDA 4M3CA 4AEKA 3B9CA 1Z7S2 4Q0QA 1OFNA 1FMD3 3IIAA 4IV3A 1TME3 5JOYA 1DQ6A 1PMIA 5IVCA 1HRI1 2ZEWA 3DUIA 3A0NA 4KWKA 3I2OA 4LT5A 3ALQA 5C3QA 5BPXA 1VIWB 1OI6A 2Z2SB 1R092 5IATA 4BQ4A 2QQVA 1HJFA 1S0GA 4COUA 3R6SA 1A8DA 2KM2A 3NNLA 4KU7A 2ZKLA 1S1AA 1S0JA 1RITA 4Y22B 1TMF2 3NJYA 4YW4A 5BY5A 4B3NA 3D4KA 4K40A 2R1BA 1XNCA 4L97A 3GHMA 5AFEA 4FPKA 2XXZA 3ZYRA 3T1LA 3ZN6A 1ULDA 1UX6A 4H2AA 3UK9A 5A7QA 3USUB 3B01A 2VQAA 1JZ5A 2QQKA 1VBD3 3Q9OA 4MO3M 4BE3A 5BXXA 5HV0A 4K20A 2WINB 3OSDA 3C7HA 5CFDB 5F3CA 2XJUA 5J09A 4LA3A 3I2HA 4HOOA 2XONA 3ZSKA 4NIAA 4WVVA 1I5ZA 2FCTA 2ZGLA 4HVRA 2XKPA 4YWAA 4CRQA 2Q30A 3SNMA 1LOBA 3GZUC 1H8VA 4OHZA 4BA6A 1YJLA 4GWIA 3USSA 1MQTB 3MW3A 1C28A 1DZRA 1SCRA 4WM7C 4XQWA 4CDXC 4NPRA 1FOD1 4JDOA 4AI0A 5BNNB 2VMEA 5JXHA 1POV0 2YPDA 1NX9A 2VVEA 5T3NA 1ENXA 1X82A 4ZONA 1E57A 3NL1A 4RFT0 2HWC3 1KXGA 1V9U2 1Y9QA 1U12A 3MO4A 5C5UA 2GP3A 2W2IA 3J7NA 2XLFA 3V56A 1UPSA 4Z07A 3BI3A 2NPIA 4YZ3A 1VBE2 2A5ZA 2X05A 3H3UA 5FP4A 1O3QA 3MEPA 4UOJA 1JOBA 2EXIA 2VNRA 4UFIA 4YW1A 1PVC2 3WQ0A 4TYSA 3ZN4A 5B4NA 1OA4A 4JTNA 1DZTA 1UY4A 5JMCA 3E6BA 4OVEA 2OS2A 4FVVA 1OD5A 1SPPA 2D6MA 2Y6HA 2PHDA 1K3IA 1VJ2A 3WG1A 2UWCA 2ZGSA 2OPKA 2MHFA
chains in the Genus database with same CATH topology
5HBAA 4COWA 1GQHA 3KMHA 4XTMA 1WD4A 4RHV2 4LUKA 5A3LA 4DOUA 3MIBA 3JB8A 2GNTA 3G6JB 3R0RA 4RR3B 2QKDA 1B09A 3HAGA 1HW5A 1RUH2 2E9QA 5J3UA 1HQNA 1ZBA2 4YM0A 2GNBA 1SLTA 3AZZA 4LO6B 2E6VA 4Y20B 5E89A 1Q8OA 2GC1A 1NOVA 2RMU2 4Q4X3 3AP9A 1GYKA 2RE9A 1AF9A 4KU8A 1PK6C 1KITA 3LGRA 1H0BA 5FTTC 1W6NA 3S0MA 4XOGA 3VBOC 2OUHA 2NM1A 4AEJA 4B29A 4Q4V3 4BMBA 4AYUA 3BPZA 3FFZA 2YY1A 1AJOA 3RWNA 1WLCA 2QCSB 3FE5A 1V6OA 3H3ZA 2VXRA 5GLUA 3KB5A 4BPZA 4JQRA 1CAXB 4XMAA 3VBUC 1SLIA 3ECQA 1AYM2 2JICA 1CJPA 1D4M2 2Z79A 2YUEA 5CADA 1GNHA 5E8AA 3U0ZA 4BLJA 2QDNA 2RS32 1DQ4A 3DPRB 1H4GA 2RS11 4A3XA 4Y22A 5T50A 1MS8A 4M00A 2WZR3 3WP3A 1UMZA 3K48A 3MZHA 5CAZA 4ZXKA 4I2OA 2JE9A 4TSVA 1VBA3 2C0ZA 1H2LA 3SHRA 2HKXA 1XE7A 4FXGB 2A73B 1ALYA 3USUA 2KA3A 4IEQA 5GLVA 4OFGA 2GN3A 1G6NA 5CFDA 3ZXKA 1UU5A 1RUI2 5DDJ1 1AR92 1LTEA 2OA2A 4LLFA 4FPEA 4R9DA 4XHXA 4LO5B 2XBO2 2GALA 3WY6A 1W6OB 1QOTA 4GA9A 4AQSA 1QDCA 4QU2A 3VZOA 3AP4A 3FBMA 1J3QA 2DVFA 4MX3A 1MQTA 2CWMA 2GH8A 4JRAA 4YSFA 5BNNA 5HCAA 4GALA 3SCFA 4FTEA 1V6JA 2QVSB 3B94A 2XLAA 4LBQB 4AF9A 4SBVA 2ZACA 4FXKB 4F7ZA 5LEJA 5KC5A 4BYYA 1I1EA 3TNQA 1BMV1 1WCKA 1I3HA 2ZMKA 5DZFA 1QOOA 1CESA 2GAUA 4MV2A 3B02A 2PHUA 1IQAA 1X50A 4QPGB 3DN7A 2BFUL 1OLQA 3WLUA 1PO12 4CP1A 2VOVA 4WBBA 1LHVA 1VR3A 1ZRDA 4W6WA 3GNEA 1BBT1 4HKOA 5C8CC 1XYOA 3W59A 2O8QA 3ROUA 1PO23 1FT9A 2C9AA 4JGYC 1DGLA 5LRRA 1ZX5A 4EROA 4P9XA 1PGW1 3ZFGC 4LBOA 4RR3A 4TZDA 2ZGPA 4FBFA 4CDXB 1YJKA 2OUJA 1SLLA 4PBOA 4LBJA 1RUE2 3L2HA 3TYJA 4MGYE 3QACA 1LOFA 4Y20A 4CTEA 2VMGA 5CB7A 1DGWX 4EN6B 4K1YA 2I45A 2AGSA 5I0RA 5IK5A 4OHYA 1RVF2 2WQZC 1IS3A 2HWB1 3H8UA 1AYN1 1I6XA 4HL0A 4COYA 2C1FA 3EXUA 2UY8A 1F2NA 2JENA 2D6NA 5JIUA 2D97A 3VL8A 4GULA 5AVAA 1UN1A 3PJQA 4HFSA 1QNWA 3JD73 1H8TB 4ES8A 1RUG3 3O0WA 1HRV3 4DS0A 1FPN3 1FXZA 3RYPA 1R091 5DUXA 1EAH1 4SLIA 2ERFA 3LZZA 1N1TA 5HCBA 4AW7A 2WZPP 1POV3 1X7NA 3N4MA 3QD6A 1RL3A 4YVWC 3HN1A 4Q1PA 2ZKNA 5JVVA 3TB0A 4AHXA 2XPJA 2RS52 1ASJ3 1RUC1 4HN0A 1BEV2 4N53B 1U5ZA 4HK8A 4LBKA 5KHKA 4EN8B 5A3MA 1OPOA 3J8F2 1MEC1 3KD4A 2GMEA 2XVKA 5HXVA 1UZZA 2ZHMA 3VHOA 4GB31 4LEJA 2OIIA 3C3VA 5GKAC 1LEDA 1ZBE3 4XFBA 3JBG2 4IV3C 1D0GA 4UXAA 1J3PA 3LKJA 3MIEA 5LK7B 1C8M3 1COV3 2VOKA 5JSOA 3D6EA 5GLZA 4AGVA 3AMMA 3OGJA 3AK0A 2WS93 4L2NA 1QQP2 2VVFA 1JHNA 3OD4A 2WFF1 1Q5OA 2A6XA 3VGIA 1EV12 1HXS2 2UYBA 4K1ZA 1WUVA 3MGUA 5FCCA 1G7YA 4Q26A 1TE1B 1G9DA 3UV9A 1VBE1 3H9AA 4N7UA 4XPVA 4YG3A 1RUD1 2V73A 1NY72 2HWE2 3AYAA 4BZ4A 4OHXA 2FMDA 4QPGA 4C0BA 1RC6A 1V6KA 4N9IA 1XNDA 3N35A 2YC0A 3RRDA 4U36A 3OBRA 2AREA 1YFXA 2RR11 1RGSA 2VY0A 3MI8A 4FP3A 3WG2A 5I8YA 1HRI2 3BIWE 3M1HA 4META 2F6BA 3ZYPA 4OI2A 2MEV3 4G9SB 3TWIA 3W58A 3ZYJB 5L7OB 3OTFA 1LU1A 2WL1A 4CDXA 1BK1A 4E4ZA 5JAXA 3CO2A 4F8AA 5FDBA 1APNA 3NKGA 1AZDA 1FMD1 1NXD1 2RMU1 1RHI3 1TME1 1DU3D 2DU1A 1AR83 4KH9A 5GALA 5F1RA 1DYKA 4XBNA 1CVNA 5JOWA 4FOVA 4D69A 4YFWA 3ZPYA 1SBDA 1QXJA 3RPQA 1ND2B 1HLCA 2FHRA 3UKNA 1FAYA 4DXZA 4YG0A 4G4FA 3H7YA 3O12A 1SBEA 2RJKA 2WLPA 2ZPXA 4WVWA 2ZAHA 1H8TA 4RD7A 2YV8A 3OGGA 1MS9A 1SLBA 3IDBB 3BODA 3DKWA 5GZEA 5KHGA 5JPMB 5GJ6A 3H0OA 3VZNA 4PBPA 2BNNA 4XFCA 4JDMA 1OQEA 1VBD1 1FOD2 2RS31 3H7JA 1C3HA 1VBB3 2A75A 1X8MA 3AX4A 5KXEA 4XJAA 2EXHA 4MUVA 3IWZA 3TN92 1YFWA 1QJY1 4LR4A 5JZGB 1KFUL 1QJX3 1C4RA 1NXMA 2ET1A 4YZ2A 3D5OA 1SMVA 4IEOA 2VULA 3M3EA 5FLJA 3POSA 3S7IA 5BNPB 4H55A 2DCZA 1V70A 2XL7A 5T52A 4UW5A 1VLNA 4BIOA 1CAUB 3NV3A 1MVQA 2ZHNA 3HIFA 5KHHA 2Y0IA 3VBUA 3U07A 3N7LA 4HN1A 3SCGA 2OVUA 1DGRA 2FBEA 3KCCA 3KCYA 4WVMB 1A78A 3WT3A 3DGTA 2TEPA 5CIRA 4YZ4A 5CFDC 2BW8A 2DUOA 4AG4A 4RL7A 1K5MB 2PLV3 1WW6A 2ZAAA 4LA2A 2DFBA 1NG0A 4XHBA 2AZ5A 2V5YA 1GZ9A 4Q4X1 1MQTC 2IFWA 4D7YA 2QQPA 5T5JA 2TNFA 1KDKA 2PTMA 5BNNC 3RI8A 3AXEA 3SMHA 1LULA 3AYCA 2CTVA 2R30A 1LEMA 4CEYB 4ZU5A 3GF6A 4Q4V1 4Q4W1 2B39A 2RS12 4FOYA 2JX9A 5J96B 5HCFA 3V65A 4MSVA 1U5YA 1ZZ6A 2PAMA 2R063 1PIV3 2A6WA 1XRUA 3P3PA 3M3OA 4OI0A 3AYEA 4LBMA 4RGAA 3ZXDA 4I0WB 2ZGRA 1RUF3 3QH6A 1ZRRA 2Z5WA 1H1IA 4XYXA 3TBDA 1IKPA 2DFCA 2SLIA 2B5HA 4YNIA 3S30A 5DDJ2 5J98B 4C0HA 3MPBA 4Q29A 4HPKA 5FLHA 4FAGA 3SITA 2R043 1J1LA 1VBA1 1AR61 5JCTA 1GSLA 1Z7S3 4E9KA 4RR3C 4G3YC 3RJRA 4B7EA 2ZOEB 1ZM1A 4PLNA 5JOXA 4FOWA 3WINE 2ZX1A 4QQPA 1LOFC 2YGMA 4LO4B 1HX6A 3WDUA 4GMP3 3VKLA 1LR5A 5D1IA 3SCHA 1LHWA 1YRZA 3HR9A 1TMF3 4Q2FA 1BMV2 3HWJA 4KGQA 2D98A 1NLSA 5CNAA 3VV1A 1R083 5JZGA 1LHNA 2BVVA 5I0TA 1LGNA 2GMMA 2K0GA 3B69A 4LHNA 4LHKA 2VW2A 1ZZ8A 1NLRA 3HD8B 4A7YA 1AL21 5BNPA 1UW8A 4XBQA 1BBT2 1S2BA 3T2TA 3WXPA 3KGLA 1QNYA 4S2FA 1N47A 3DPRC 2LTNA 5C9AB 5DUVA 3MICA 5GLWA 3OYWB 1OLRA 1PGW2 4AQ6A 4DMIA 2Q4SA 4NR1A 1VRH3 4BLIA 5C4WB 4ORFA 2IXIA 1SBFA 1OKQA 3MFCA 3ZDSA 4R52A 4WVMA 1Q8QA 3WQ1A 3IDEA 3WX5A 1RIRA 2CV6A 3OJBA 1CQ9A 1J3RA 2D3RA 2HWB2 1K5MA 5H9RA 4CZSA 4EN7B 2VU9A 1PVC3 4IEXA 1XNBA 4BMEA 2R32A 4YVSB 4U2AA 5JI7A 1S55A 1JOJA 1JTZX 2CWSA 3B5LB 3WQ7A 1M06G 5E16A 3WDWA 4QGMA 3MIFA 2PYTA 3EBRA 5K0UB 1EAH2 2W0XA 4FSJA 4RS5B 4FPFA 1DYPA 1DBNA 5T5OA 5I93A 1RUG1 1QU0A 1QJU1 3WVJA 4LLOA 2WNVB 1RUH3 5A33B 1VAVA 3LAGA 3VBHB 5FO7B 4GH4B 4ES9A 1FPN1 4QPGC 4BWOA 5IK7A 4ASLA 2R1DA 1RUC2 2CAUA 1O4TA 3MW2A 1UU6A 1N1VA 4YGDA 3E5XA 1DQ0A 4AFDA 1JH5A 4KG0A 4M3CE 1MEC2 1POV1 2E53A 3ZIWA 1MS1A 4Z82A 3WD5A 4Q4Y3 4GB32 2I74A 3ZFEB 1QDOA 2UU8A 3ILNA 4R8HA 4ITCA 1RUJ3 2ZMNA 4FP2A 5F6LB 5ACA1 3RZZA 1SEFA 4GKYA 2D5HA 4JV4A 4LULA 3PLQA 2JG9B 1AYM3 3L9JT 4Q27A 1NQJA 3WDYA 5EWSA 2WFF2 3AKSA 3TN91 5JR7B 1C8M1 1COV1 2DVBA 2DVGA 4QQOA 2ZGTA 3ME2A 2WS91 1RUD2 4L92A 4BHPA 2JG8B 3THTA 5H9SA 1YI9A 1YIFA 2AH2A 1H8TC 2P17A 2IWGB 2BYVE 5I8SA 2GNMA 4B4QA 4ATEA 2QZ3A 5CVRA 4K7JA 1AR93 4LTAA 3SLIA 2GNDA 2RR12 3AZVA 4Q0VA 2XG3A 3FX3A 5C9AA 3KGZA 4DZGA 2LALA 3OYWA 2WA3A 1FV2A 1ULFA 3NSTA 1YXWA 1ZYBA 5C4WA 1YLLA 4IEPA 3PVOA 4Q0UA 3BOWA 4N53C 1D2QA 4DY3A 1FMD2 4AI8A 4BM8A 5AVPA 4P5HA 1CN1A 1TME2 1CX4A 4PLMA 4DNYA 1AX0A 2MEV1 4UW6A 1DG6A 2ZZQA 4CDUB 2ET7A 5EXOA 4IEUA 4AFCA 2GC3A 2D7FA 5C6CA 2DTYA 5BYNA 3D82A 1PO13 4YVSA 2GZWA 3WDXA 1VB4A 1XQNA 1AR81 2X5IB 3ELNA 2ZGMA 3GBGA 4CP2A 2PHTA 3NAPB 4QX5A 5FQ0B 5K0UA 3WG3A 2DWRA 2CNAA 2AUYA 3LSEA 1VBD2 4AK3A 4RS5A 1MZEA 5IK8A 1WCDJ 2HYKA 3RYRA 1WLTA 5A33A 2WNVA 2XKOA 1ZRCA 4GH4A 1QJY2 1IS4A 3BOPA 3PVBB 2BNOA 5H9QA 4MYEA 1M4WA 2WT1A 2BQPA 5KXCA 2YYOA 3N7KA 4K3UA 3LA2A 3PHMA 1WBLA 1MACA 4H7MA 3HQXA 1NCQB 4C91A 4OI4A 4V1PA 3ZFEA 5AC91 5H9PA 4QQHA 2H6BA 1RUOA 5FPXA 3O7OA 2Z42A 3T1MA 5L7OC 1DF0A 1V00A 2XWBB 4YM3A 1AXYA 5C8WA 3G7DA 1VAKA 2HWF3 4LBNA 3U4XA 3THPA 5CA6A 4GKXA 1AXKA 3VBFB 1FX5A 1XE8A 2DUQA 1GICA 5E88A 4FT8A 2HEVF 1KDMA 1CPNA 1ND2C 3M70A 5F9TA 5CBLA 4PDWB 1VAMA 2JG8A 2A7AA 2D44A 1H2KA 3MLKA 4MVTA 3FLTA 2QE3A 3J8F3 4F83A 3IKWA 1AJKA 3ASIA 3I54A 3VLBB 4Q4X2 1QH7A 4QXKA 1GZCA 2PHRA 3AYDA 5EYXA 2VNOA 2WQ4A 3ZVXA 4XFAA 2IXHA 5K8SA 1F5FA 3CJXA 3NV2A 2W52A 2P34A 4Q4V2 1QQP3 2O8OA 4Q4W2 1QKQA 1U5IA 2IFRA 2VUJA 4A2UA 1A6CA 1EV13 3ZN5A 4I09A 4N43B 5JZGC 1XU1A 2D6OX 1Q8SA 4P9YA 4W6YA 3IM0A 3GZAA 3B3QE 2YMZA 4JTOA 3NV4A 1W6QB 4X6RB 3PNAA 5BV6A 4CDUA 2VNGA 4K6BA 5BNPC 3H1WA 2IXJA 1DDLA 4RSUA 4OHWA 2CGOA 4EWEA 2D43A 5F5QA 1YFYA 3AJZA 2R061 2X5IA 4NHKA 1G9AA 3NO8A 3AMNA 4XMIA 1CAXA 1VBA2 1AR62 4L99A 4K9SA 4H3WA 5FQ0A 1RUF1 4AVBA 4YYOA 1DLLA 4NWWA 1HRI3 1OA3A 2UURA 2NZ9A 2ZGOA 4EWDA 1ZZ7A 1JW6A 3AFKA 3DPRA 3OPZA 1ULGA 4RA0A 3WW4A 3I7DA 4XFIA 5ABJB 1H2MA 5SV5A 4HSLA 3DL3A 4URTA 4XQDA 4AWDA 4XJZA 1BJQA 2DCYA 4JGZB 1K5MC 3ATGA 2VW0A 1JUIA 1OOPB 2ZCWA 1LHUA 1ONAA 3CNAA 1JN2P 4LE3A 4KWLA 4B8EA 1KFXL 3VKMA 1AL22 1PVXA 2XB6C 3VHNA 1O5LA 3M7AA 1W6OA 5E1RA 1MVEA 3JU9A 2W08A 1R081 2ZS6B 2XLGA 2XUMA 3EQEA 4CEYC 3VZMA 3S7EA 1X8EA 1RTVA 1LHOA 4E2GA 1RUNA 2UWAA 5KXBA 2XJRA 1H1AA 4NOTA 4GMP0 4Q8LA 4LBQA 1PGSA