2EIGA

Lotus tetragonolobus seed lectin (isoform)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
VSFNYTRFKDDGSLIFQGDAKIWTDGRLAMPTDPLVNRTTSHALYATPVPIWDSATGNVASFITSFSFIVSNVQRYPPTDGVVFFLAPWGTEIPPNSQGGYLGITDSSNSQNQFVAVEFDSHPNVWDPKSLRSSHIGIDVNSIMSLKAVNWNRVSGSLEKATIIYDSDTKILTVVMTHQNGQITTISQEIDLKTVLPEKVSVGFSATTWNPERERHDIYSWSFTSTLKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a new quaternary association for legume lectins
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 50
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eigA00
1ZM1A 3GALA 4C1WA 2A70A 3OYWB 1MZ6A 2CWMA 1XQNA 4M00A 4XBQA 3WDVA 2GNDA 4YM0A 4BPZA 1AXZA 1LECA 5DZFA 3RRDA 2AYHA 2PELA 4WV8A 4AVSA 2DTYA 3V0BA 1SBEA 5GLUA 3ZYRA 1LOBA 3MW4A 4YZ4A 1DZQA 1V6JA 3INAA 1MS8A 1GZ9A 1W6MA 4Y26A 2A6YA 2JECA 2A75A 1N1TA 4K1YA 4PCRA 2NYYA 4YG6A 1U0AA 5HCBA 4CRQA 5JLVA 1PZ9A 4XXPA 4BM8A 4YM3A 4MYEA 2DUPA 1MS3A 1QDOA 1S0CA 4LBJA 2D3PA 1JYCA 1SLAA 1UN1A 2WSUA 4R9AA 3DUIA 2PHFA 2D7FA 1FX5A 1CN1A 3ILFA 3W58A 3WCRA 1QU0A 2KM2A 1OKQA 2P3KA 4GWNA 2CTVA 2R0HA 1LENA 3ILRA 2UWAA 1A3KA 1SLTA 4FPHA 2ZKNA 3AP6A 3LSEA 3PMEA 1YXWA 4HANA 1FNZA 2DYCA 4DPNA 1FAYA 1G7YA 4LBNA 2AH2A 3OPZA 4BLIA 3IPVA 5DG2A 3O0XA 5T52A 2EAKA 3OBTA 3WDXA 1FV2A 2R1DA 4CZSA 3RG0A 1I1EA 3V64A 4ISRA 1LOEA 2ZGNA 4FOWA 4M3CB 4YZ2A 3M2MA 1LOFC 2DUQA 1V00A 1VIWB 1G9FA 5T50A 2ZZJA 1IOAA 2NZ9A 4K21A 1JYIA 5JOXA 3CNAA 3M3CA 4W65A 1LODA 2A3YA 4LBOA 5IK8A 1GNHA 5JOYA 3SH4A 5GZCA 1DFQA 2NN8A 3WDTA 2UWBA 1ENSA 5CNAA 1D2SA 3OJBA 1UMZA 3RSJA 4DFSA 2P37A 4LBMA 4ATEA 4K20A 1YYNA 4Y1YA 3IMNA 1R1ZA 4R9DA 1C1LA 2WLQA 2EALA 4FPEA 4ZKTB 1C1FA 3ZXFA 5GZEA 3W59A 2OVUA 4F83A 5JMCA 3ZSMA 3NV1A 2A6VA 1LHWA 1OFSA 3WHUA 5BYNA 3WUDA 4LBQB 3OY8A 1NXD1 3AZZA 4Q1PA 1BJQA 1V6KA 5EYXA 4BMEA 3AZVA 1J1TA 3AYCA 2W52A 1MACA 2Q5TA 3SISA 3OY8B 2DV9A 2D43A 4ASMB 1EPWA 5CB7A 4PBPA 1F31A 3B9CA 1LGNA 2GALA 3RMYA 3UK9A 2CL2A 2ZGPA 2R1BA 5IK5A 2ZGKA 3Q9OA 4XZPA 1B09A 1Q56A 2A3WA 4Y20B 2VY0A 4BMBA 2D3SA 5L73A 2D6PA 3AZWA 2GDFA 4YG0A 1QMJA 3R4UA 2WKKA 2ARBA 1QOSA 2VW0A 2VW1A 3A4UA 2E7QA 2RHPA 1LCLA 4NOTA 4PBOA 1QGLA 1UX6A 2JKBA 3QCWA 1BYHA 5IUQA 1MS1A 1DQ2A 1W6OA 1ULDA 4DQAA 1YO8A 3WZ1A 2EXIA 1GV9A 5KXDA 1I3HA 2ZHKA 2R0FA 3FLTA 3USUB 2C5DA 2HYKA 3AJYA 4YG3A 3MPPG 5DUXA 5T55A 1G9BA 1C57A 5GLTA 4Q8KA 1AX1A 3UJOA 1WCSA 5EYYA 4BQ1A 2P3JA 5JOZA 1AX2A 2OUHA 3N36A 4FQ4A 3WHTA 3OGGA 5H9SA 5CBLA 1CQ9A 1V6NA 3FFZA 4AWDA 1ULCA 1CESA 1FATA 2AR6A 3OBRA 3ZPYA 1MVEA 1IKPA 5H9RA 1GKBA 4FOVA 4XYXA 2W39A 2ZA9A 2EXJA 3AZXA 1LEDA 3BTAA 3POWA 3ZYPA 3AK0A 3MEPA 1W6PB 1BXHA 3JU9A 2SBAA 4YW2A 3PJQA 3VKLA 1UZYA 2VW2A 3AP9A 5KXCA 1UAIA 1UPSA 3USUA 1MVQA 3SLIA 2Z42A 3N7KA 1LHNA 2CNAA 1LEMA 1LOAA 2JDZA 1MS5A 3M1HA 4YZ1A 3BODA 1DYPA 1G8WA 1WLDA 1CIWA 2EXHA 3WLUA 3ENRA 1ENQA 2VU9A 3B69A 1ONAA 4YZ3A 3AYAA 3FLPA 4XHXA 1SLIA 2LALA 3AFKA 4Y1ZA 1O4YA 2P34A 1UZZA 1SLBA 1S0EA 2D6NA 2ZHMA 4XBNA 5E89A 1KRIA 1N1YA 2LTNA 1C4RA 1CJPA 4U2AA 2FHRA 2OW4A 4WZFA 4DRVA 2UURA 2ZGLA 2GNBA 5E8AA 2XB6C 3SH5A 1MS4A 3NV2A 1DLLA 1URXA 1MS9A 3ZXEA 1DQ4A 1W6PA 2GNTA 1KQRA 2JE7A 1HKDA 2NMNA 2VH9A 4FPJA 3QLQA 3IM0A 3V0BB 1WLCA 2D6MA 1KJRA 1CVNA 1GANA 3ZSKA 1A8DA 1ZA4A 3JUUA 4H55A 3O5SA 2DVAA 5GZFA 3WDYA 1CPNA 2EIGA 4AVTA 3B3QE 1S0IA 2GN3A 1WW4A 1LGBA 2DVFA 3C2UA 1BQPA 2CY6A 4XIKA 1QOTA 5GM0A 2DUOA 3ZXJA 4GKXA 3AP4A 4DS0A 2EF6A 1WW5A 3WCSA 3AX4A 3AZYA 1GZWA 4Q8LA 4YLZA 1VAVA 4P14A 4AGVA 3V0AB 1VLNA 4Q2FA 1DQ1A 5IK4A 1RITA 2WT1A 3N3HA 3WG1A 2NP0A 1CONA 1N47A 4TYSA 3D5OA 4JC1A 4RA0A 3WDUA 1W6OB 3WG2A 4XJUA 5KXEA 1LHVA 2ZGQA 3AP5A 3HMYA 1AF9A 4FPFA 4LBQD 4WVVA 2E7TA 5DG1A 5DZEA 2BQPA 2P2KA 3WNXA 2DWRA 5F9TA 1SFYA 4M3CE 1GZCA 1W0OA 1SCSA 1FYUA 1JBCA 3AP7A 4YM2A 1ENRA 3ILNA 4GA9A 2A7AA 1SLCA 1SLLA 2D6KA 2GMPA 2ZGUA 4M3CA 5SV8A 4Z8BA 1H30A 1G86A 4LBQA 2PHRA 1YRZA 2AENA 1AJOA 5GLWA 5IK7A 4SLIA 5AVAA 3N35A 3FBYA 1W6NB 2AREA 3WG3A 3O12A 1UKGA 3ZXKA 5JVVA 2YXSA 4JRAA 1ULEA 1LGCA 5DUUA 2WJSA 5DZGA 2V5YA 2VXRA 4U36A 3AXDA 4XIOA 3TAYA 2AGSA 4FPKA 4JCKA 4KBBA 4OZXA 3OYWA 4C1XA 2ES3A 1Q8QA 3A0KA 1WBFA 2WSVA 1V6MA 2H0BA 3R05A 5JOWA 4WVWA 4Y22A 3M3OA 1V6LA 5KXBA 4FPLA 1S0FA 3WOGA 2ZGRA 1DQ5A 3ATGA 1QKQA 3M3EA 1AZDA 1GYKA 2E53A 3MW3A 1G9DA 2WQZC 4ATFA 1V6IA 4AVVA 2ZAAA 2R49A 4M01A 2PHTA 2JD4A 1AJKA 4FPYA 1N1VA 1Q8OA 1WW7A 1YI7A 3TB0A 3N7MA 5EXOA 1W6NA 4FOYA 4LBKA 1IS5A 2DVGA 4YW5A 5T54A 3V0AA 1QNWA 1SBFA 3I8TA 1PZ7A 3D6EA 2ZGOA 2NMOA 3N7JA 4Q26A 4AGGA 4LBLA 1GZWB 1WD4A 1BKZA 4UW3A 2ZABA 3DGTA 1AVBA 2DU1A 2A5ZA 2V73A 4XHBA 3L2YA 1LHUA 3M3QA 4FPOB 4YM1A 1QF3A 3KM5A 1IS6A 1S0BA 2GMEA 4PQ9A 2FMDA 1LOFA 3VKOA 3IPVB 1G9CA 5GLVA 4XILA 2NM1A 3IKWA 1Q8VA 5GJ6A 2DURA 3VKMA 4YZ5A 4UW6A 1LTEA 1N3OA 5FRAA 1N3PA 1IS4A 2WNEA 2ZHNA 4YFWA 4R9BA 1W6QA 3AXEA 1DIWA 4DRRA 2A3XA 4YGCA 3NWKA 4XMAA 4YW3A 2ZGSA 2C9AA 1FNYA 3AJZA 4XJ8A 1MZ5A 4RL7A 3RQ0A 2OUJA 1F9KA 3LCPA 4BLJA 1H9WA 3NV4A 2JJ6A 1F5FA 1IKQA 2ZMKA 3HR9A 4YGEA 5H9QA 2WT2A 1DBNA 4UW4A 1APNA 1OQ1A 4UW5A 3BOPA 4Y24A 4GKYA 5T5OA 1LHOA 2SLIA 1JHNA 5EWSA 4XBLA 5CA6A 4YW4A 3KQRA 1DHKB 1W6MB 2E51A 4XJWA 5LK5A 1WUVA 4XTMA 4FPCA 2DVDA 1N3QA 4CTEA 4XE9A 1IS3A 1TEIA 3MW2A 3PVEA 2B7YA 4IQPA 1WD3A 4YGBA 1GNZA 1NLSA 1VAMA 3HN1A 3O0VA 1QNYA 1G9AA 1W0PA 2G4IA 1Z78A 3B00A 1LOGA 3SH3A 4PF5A 2GN7A 4XXAA 4AYUA 2ZHLA 1WBLA 1Z0HA 5DXDA 3B01A 1W6QB 2W68A 2XG3A 4ZXKA 3PVNA 4XJ9A 5GLZA 2W08A 4AGRA 1X50A 4NO4A 2YV8A 3FLRA 5IT6A 1MS0A 1PZ8A 1GSLA 1SCRA 3I4IA 2A6WA 1BZWA 4XJZA 2YY1A 2DTWA 1H9PA 5GZDA 1LESA 2JE9A 1QOOA 1VALA 4XTPA 4Q1RA 2D44A 3V65A 1LJ7A 3FUOA 3SITA 2ZMLA 1KITA 1LOCA 1YIFA 5GALA 1HQWA 2PHXA 3BIWE 1DQ0A 5HCFA 2DU0A 4Y20A 4P9XA 2ZGMA 2E6VA 3O0WA 3UJQA 3AYEA 4FVVA 1O4ZA 4FQZA 2CYFA 3WVJA 2R16A 1LU1A 4ITCA 1V6OA 4XMIA 2CWSA 2UU8A 1S1AA 1D0HA 1S0JA 3PVOA 2P3IA 2I2SA 3FUQA 3IN9A 2A6XA 3RS6A 1HQLA 1RIRA 3APBA 1GLHA 2WT0A 3WG4A 5JDBA 3U4XA 4XDQA 3T2TA 3ZSLA 4FP2A 3POYA 4L8QA 3R4SA 4Y22B 3ASIA 4TZDA 3NV3A 5GZGA 3WDWA 3N7LA 4I30A 4Q27A 4Y1XA 1S0GA 4YW1A 3WV6A 2A71A 3VV1A 4YFZA 4M3CF 3GNEA 3WUCA 2TEPA 1AXYA 1RINA 2YMZA 4XJAA 3VKFC 1S0DA 3VUOA 1CR7A 5FREA 4K1ZA 5E88A 2GNMA 3ZSJA 5DUVA 2ARXA 1JXNA 2D6OX 3A0NA 1HDKA 1KDMA 5T5PA 2PHWA 4BOWA 4GXLA 3D4KA 2YZ4A 4XOGA 1Q8PA 2AUYA 4P9YA 5H9PA 1CPMA 1GBGA 2ENRA 1Q8SA 1GICA 3T1LA 4ISQA 1KDKA 3VKNA 4HL0A 1DGLA 5T5LA 1MR5A 1HLCA 4D69A 2VUAA 1WW6A 1JOJA 1AX0A 4FPGA 1ULFA 1N1SA 1LULA 1WLWA 3LSDA 1KJLA 1JUIA 3T1MA 4R9CA 1JN2P 4P9WA 2DVBA 2D3RA 2YROA 4Y1UA 1DQ6A 2D6LX 4FP3A 5HCAA 1LU2A 4GALA 1DYKA 2A6ZA 1A78A 5T5JA 2PHUA 3UL2A 3ZVXA 3SNMA 4FOQA 4YGDA 2ZMNA 1UL9A 1ULGA 1JW6A 4GWMA 3H0OA 5DUWA 1SBDA 2ZGTA 1SACA 5CAZA 2ZACA 3AYDA 4Y1VA 3RMXA 1AXKA 1FV3A 2GMMA 3ZXLA 1Y7BA 2UWCA 3POSA 2EXKA 2ERFA 2ZBJA 1QDCA 5F5QA
chains in the Genus database with same CATH superfamily
1KGYA 3U37A 4DEQA 3AL5A 1V70A 4XBQA 1PX3A 4OHZA 1LECA 2UY9A 4QX2A 3RRDA 2ET1A 2G1MA 1A6CA 3D82A 3H42B 5EPAA 3ZYRA 4CU7A 2BWCA 2PHDA 3MW4A 4UFJA 3VGIA 3W9AA 1OF3A 4OHVA 2QZ3A 1GZ9A 3TEZA 3PUAA 2H6BA 3IAQA 4LO4B 2A6YA 2LS6A 4V2WA 3UETA 2XL7A 3ELNA 2JDMA 4PCRA 1U0AA 4CRQA 4BM8A 3C3VA 5HV4A 5I8YA 4MYEA 1E57A 2ZX2A 2DUPA 1YWKA 2IFWA 4JAAA 1QDOA 4P9JA 4R9AA 1SHWB 2HWD2 2BPA2 2QQMA 1CN1A 4PDWB 3W58A 1QU0A 5EJ3A 1QJY3 4LIUA 5F7UA 4EE2A 4AFBA 3E1F1 1A3KA 3H9AA 4FPHA 3M8LA 4WM7A 5FZ9A 3PMEA 1YXWA 3TBDA 2DYCA 2GC2A 2VGDA 2FDKA 2HJIA 3MLLA 3WQ7A 1OKOA 3MFAA 4AEJA 2G9ZA 4CSWA 1HIXA 3IPVA 5T52A 3WEZA 3PHMA 1TNFA 2ZEWA 3WDXA 4JV4A 4OLLA 3BTXA 4NR1A 2N7GA 3V64A 4YZ2A 1S2KA 3K75B 1RUE3 5AFBA 4OVEA 1FOD1 1R082 2BU9A 4ZZ8A 5I91A 4Q4W2 2NZ9A 4D7TA 2ZEYA 1F35A 2Y60A 2JX9A 3VHNA 1OC1A 3CNAA 4RFRB 3LGRA 1T2XA 4CA9A 5IK8A 1ZZ9A 5FXVA 4CEYC 1DFQA 2NN8A 1PVC3 2D97A 2XWJB 3KMHA 4LORA 4UFLA 1RUH1 5CNAA 3DXTA 3M7AA 3ZFFA 1AL22 1C8M1 1D2SA 1XYPA 1YHFA 3ZXAC 1KS4A 2ZX0A 4PI0A 4IEPA 4LBMA 1RJ7A 4YVSC 4E8DA 3R0RA 1XJAA 1GZTA 4GWJA 4HVOA 1PIV2 1NE4A 2JG8B 2K46A 4NPRA 2AEYA 4LMFA 4R9DA 3I2JA 3SHRA 1VBD3 2WLQA 5FKBA 1S55A 1DGWX 3NKTA 1H2LA 5B4NA 1VMJA 4XURA 5BYNA 1HB4A 1US3A 4MGYE 5F2SA 2VOKA 1NUKA 1NZIA 1RUC2 2VZOA 1RJ8A 2ZCWA 1QWRA 3AZZA 4JTNA 5G05L 3X29B 2CSGA 3AZVA 5LBBA 4WM8A 4GULA 5LB6A 4AF9A 3KQ4B 5JSOA 4UFMA 1Q5OA 4N9HA 4RR3B 2R072 3GCWA 3IIIA 4ASMB 1H2NA 1YFYA 1PM4A 5CB7A 4Z2AA 1F31A 2J42A 1LGNA 2JDUA 3B9CA 2OS2A 5FMBA 3PDQA 2VM9A 1OH4A 2BNOA 2ZGPA 2HWB2 2R1BA 3J7NA 5IK5A 1RUF1 4XZPA 4IDZA 1W2NA 4IE4A 1KFXL 4Y20B 1PM7A 2D3SA 5EIYB 2D6PA 1VBA2 4LKSA 4MG2A 1ASJ2 1CAWB 1CD3G 3AC0A 3MIHA 5FZIA 1JZ3A 1QJEA 5FAXA 4N9IA 1QOSA 2VW1A 3A4UA 2CAUA 3HPNA 2R32A 4NOTA 3ZYFA 5FJKA 3ZYJB 4HKOA 5LBEA 1TQ5A 3J9SA 4XPVA 1PX4A 1GQGA 5I0RA 4KWLA 3UYJA 1DQ2A 2VZUA 3KB5A 5C4WB 3WZ1A 2EXIA 5HBAA 4E4SA 3ZXDA 2PAKA 2XVGA 5IW0A 2R0FA 2W87A 3FLTA 2TUNA 2WAAA 2C5DA 3AKSA 4ONUA 1DYOA 3AJYA 4PLNA 2VVEA 5DUXA 1G6NA 5ACA1 3JZVA 1REEA 4AFAA 3WF3A 3VZMA 1AR92 1RL3A 2W1WA 4PJYA 4YPJA 3OBZA 3EHKA 2QQKA 4BQ1A 2C4XA 2Q1MA 5JOZA 3U0ZA 1PK6C 1XC6A 2VZ3A 3OGGA 3TNPB 3OTFA 3OPTA 3WHTA 1V6NA 2DCJA 1HJFA 4ZS3A 1FATA 1OXCA 1MVEA 2ZOEB 3ZPYA 3W5NA 5H9RA 1GKBA 1SMVA 1QJX2 2B45X 2VL4A 4FOVA 1U5YA 4XAAA 3C7GA 3P5BA 1Z7S3 2WFPA 4FT8A 2RV9A 3ZYPA 3HQRA 4YVSB 3CJXA 2SBAA 1FMD1 4YWAA 3VKLA 4BK5A 4B7EA 1UAIA 2NPIA 2PAEA 4NIIA 3BVCA 1ULOA 3N7KA 1LEMA 3SXWA 1LOAA 1QJU1 1OD5A 4CEYB 3P3PA 4FFGA 5FKCA 1DYPA 3N9NA 1CIWA 3CIHA 2W1UA 1C8M3 3IAPA 4JRLA 5KHKA 2IXCA 4AAPA 3ZR6A 2YFUA 4UF0B 3B69A 1WWYA 4RR3A 3AFKA 3AKTA 3BN6A 4XBNA 5IAVA 3VN4A 4FBFA 3H8XA 1N1YA 2C26A 2JDAA 1TZOA 2LTNA 2QNKA 4QKNA 1RUI2 1NCRB 4XFCA 2BW8A 3IT8A 1ZZ8A 2XB6C 3SH5A 3ZXEA 4CP2A 1URXA 4Y5Z0 2JE7A 2NMNA 1KQRA 1X36A 4S2GA 2VH9A 2IXLA 3IM0A 3I2HA 2VTXA 3V0BB 2E9QA 1GANA 2NQYA 2X53S 3S30A 3ZSKA 4AE2A 4H55A 3JUUA 3ZSEA 5KHGA 3SEEA 1HJGA 2EIGA 3Q8CA 4JKMA 1WW4A 2DVFA 4CDWB 4HVQA 3G6JB 3C2UA 4IGQA 1ZRDA 3GBWA 4O7XA 5FZLA 3VDDA 1NX9A 3WCSA 4E2SA 5BNPB 1HV1A 5FY4A 4AGVA 3H7YA 1BBT1 5LATA 4YYOA 4CUCA 1RITA 2E26A 3N3HA 3WG1A 5JSRA 5A7NA 4TYSA 2VVDA 3D5OA 4XETA 2PN5A 4LBQD 5DDJ1 3W21A 4CCNA 1VBC2 2E7TA 4XACA 4P9GA 5DZEA 4AOCA 1JZ8A 2BQPA 3WNXA 4JGZC 2WIIB 1L7QA 1VBD2 4M3CE 4CP0A 3MICA 5L9BA 1FYUA 4KL1A 4YM2A 5IVEA 1POV0 2P6HA 2WYSA 1E5IA 1SLLA 4QQ2A 1G86A 1RUI1 2PHRA 1YRZA 1C8NA 3T30A 5IK7A 3N35A 2VOXA 2VZPA 3LKJA 3LB9A 1ND3B 3WG3A 3O12A 3KZ4C 1XNDA 2RS12 3E5XA 2YXSA 1REFA 4R4XA 2X09A 1ULEA 2VVFA 1GMMA 4XEZA 1BLZA 4OHYA 1Y4WA 3ZX7A 2JG9A 2WJSA 4D8MA 4P02B 4U36A 5FZ8A 4XIOA 4FPKA 1FPN1 1XOYA 2ES3A 4QAWA 1OA4A 3WNKA 1O3QA 2CGPA 1JODA 4WVWA 3M3OA 4KBZA 4AL9A 3CL1A 3K3NA 2R042 2ZGRA 3ATGA 1WMDA 1ZBE3 4NROA 3M3EA 1GYKA 3ZFFC 5EQUA 4P08A 5I0TA 2B4KA 1ZZBA 1LB2A 4ATFA 1XNKA 3JQWA 4YVWA 4RFT0 4GQ7A 1ZX5A 2JD4A 3KLSA 5CISA 2BWAA 3O1RA 3PMSA 4JTOA 5C9AC 1OUSA 2XXZA 5DQ0A 3J4UH 4EYUA 4OI0A 1ZZCA 4FOYA 1BBT2 1POV1 1IS5A 4LA2A 4B4QA 5A3WA 3HQUA 4LHSA 4XQWA 1AR93 3D6EA 1JYWA 1YC61 4LBLA 1NT0A 2X10A 2ZXQA 1BKZA 4CCJA 2VMGA 2ZABA 4D3WA 1AVBA 5JIUA 1VB4A 1FMD3 3L2YA 4J25A 1NLQA 2ZS6B 4O61A 5FZHA 3KM5A 3MF6A 4IE0A 1ZREA 5HPOA 2GMEA 2WR9A 1JYVA 5LEKA 5D2AA 1LOFA 3I7DA 3SQOA 3IPVB 1DF0A 2Q4SA 5FJHA 3WXPA 4TLGA 2BJSA 4L11A 4BA6A 1D4VB 5C3SA 2GZWA 5CADA 4CEYA 1IGOA 3PIGA 3U75A 1SDWA 1JS9A 3VKMA 1GOFA 4C0BA 3M70A 4OHXA 2FDFA 4UW6A 1N3OA 3EMRA 3NNFA 2W2IA 4YFWA 1YQCA 4R9BA 1W3XA 3DXUA 1OVSA 5C6CA 4FO9A 4YGCA 4QX3A 5FYTA 1U5IA 3AJZA 4LKDA 4RL7A 2BOJA 3H8UA 5FQ0A 2UYAA 2QQIA 4OULA 3R6SA 1NA1A 1OLRA 4L9BA 3HR9A 4NWVA 4QX5A 1DBNA 3J8F3 4UW4A 3H1YA 1APNA 1D7PM 4NHYA 3BOPA 1JYTA 3LQCA 4XUOA 5EWSA 5CFCB 2JG9B 4FTSA 4XJWA 1W6MB 1UF2C 1WUVA 4XTMA 4PIYA 1N3QA 1W9SA 3AMNA 4W6YA 3V56A 3CEWA 1RUOA 1PNFA 3S0MA 1PMHX 3RDIA 4YGBA 1VAMA 3MV01 3HN1A 4Y4RA 5DABA 3SH3A 3IIAA 4S2HA 3ZKYA 4LLFA 5FMDA 2VQAA 2YU1A 2P1BA 2ZHLA 1WBLA 1Z0HA 4BQ4A 3B01A 2XG3A 3WNPA 3PVNA 5I0DA 3VD5A 2GC3A 1HN0A 3WP6A 1MS0A 3POEA 2HWC2 3OGRA 4IV3C 2W1SA 2A6WA 2XBO1 3VZKA 4KH9A 2DTWA 1H9PA 5GZDA 3TOJA 3ZYIB 5HV0A 1VALA 1JHJA 2JIJA 3MLKA 4XTPA 2L9LA 3WY6A 4DNYA 4K8FA 1TMF2 3FBMA 5C9AA 1KITA 4D7YA 1HQWA 4QPGA 2WQ8A 1OPMA 4LR4A 3SEPA 4AQSA 2DU0A 2WFF1 1UCXA 4FXGB 4GAZA 4FXKB 3BCWA 4IV1C 3WR0A 3N4MA 1X9PA 1JYNA 3O0WA 1B35C 3UJQA 4UYBA 1UIJA 4FVVA 1O4ZA 3BOWA 4JGYC 3G7DA 1LU1A 3H8RA 4AI0A 4PF1A 3URFA 4LNVA 3DKWA 4N53B 5FYHA 2A73B 4NHKA 4BHPA 1D0HA 1S0JA 1U5XA 4J1WA 4OMCA 1XNCA 3IN9A 5F37A 5LA1A 1CZVA 3RS6A 2G19A 2XLAA 2GC1A 1RUJ2 1RHI3 1O3SA 3WF1A 4CP1A 1QEXA 5A3OA 3LIHA 3POYA 4XF0A 3VD7A 1UY3A 5L7OB 2VZVA 2PHLA 3ASIA 1GUIA 3VHOA 3RZLA 4Y1XA 1Y3TA 4M3CF 3GNEA 1AXYA 2YMZA 4X8NA 5F32A 2RJ2A 1S0DA 3N9MA 2VZTA 2ILMA 1DP0A 4CDXB 3D0JA 2VMIA 4RHV3 4ZPIA 5DUVA 2YGLA 1JU3A 2JDPA 3CMGA 1QJX3 1BK0A 2ARXA 1POV3 4QMAA 1KDMA 1Z7S2 2PHWA 1W0NA 4IEYA 3GBGA 5FWEA 4CCLA 1GICA 4HKLA 4XC9A 2OKXA 5K0UB 1KDKA 2QQUA 4ZXEA 1VBB3 5FCCA 1DGLA 4BISA 2WNVA 2J7MA 5T5LA 5CG8A 1HLCA 3LA2A 2VUAA 3S5QA 4FPGA 2RR12 2Z4FA 4CPBD 3JBG3 4LPLA 3A7QA 2X05A 2DCZA 2D3RA 2YUEA 1UU6A 5FP9A 2WAOA 4BQWA 2D6LX 2ZZQA 5HCAA 1DYKA 4UI9L 4CDWC 1RUD2 2DCKA 5T5JA 4META 1TNRA 3SNMA 4FOQA 2QZ2A 2ZMNA 3T09A 1UMHA 3DPRC 4FAGA 1ULGA 4COWA 4IE6A 4L0PA 4CDUC 2K9ZA 4NN0A 2FBEA 4QHBA 1JOPA 2FDJA 4Y1VA 1AXKA 3MIFA 3ZXLA 1P8JA 2EIEA 2OZJA 3AMPA 4ORFA 4E4DX 1FI2A 5F5QA 4DUXA 1HB2A 1ZM1A 2BDRA 2A70A 3OYWB 5IVBA 4AHZA 3KV9A 3OUHA 3HVDA 4BXFA 1RB8G 3GGLA 2OQ7A 1NA1C 2MEV1 5GLUA 2R043 1LOBA 3JCIA 4A6OA 1OOPC 2FDIA 1MS8A 1W6MA 2A75A 2PLV3 2NYYA 5HCBA 2GSYA 4C91A 1ZRCA 1PZ9A 3C7OA 4XDOA 4G3YC 5KWRA 5F6KA 4YM3A 2CU5A 4CCKA 2WZR2 5C3PA 4UFKA 1MS3A 2MEV2 5C8CA 2PQQA 5C5UA 2GP5A 4QKBA 1UN1A 3WT3A 2VZ1A 4B1MA 4LEJA 3H3LA 3DUIA 1QHDA 2D7FA 2PHFA 3JD73 1OFNA 4J6GA 3WCRA 3ACGA 1OKQA 4QGMA 2ARCA 2HH9A 4E8CA 4GWNA 5D21A 2EIDA 2E7AA 1LENA 4UXAA 4LOTA 1CAXB 3QH6A 2BP6A 1FNZA 2YPDA 4MOAA 4DPNA 4WVZA 3VBRA 5FZOA 3MUY1 3AFGA 2AH2A 3BALA 1ACCA 1ZVFA 4AEDB 3ZMOA 3HIFA 1UY0A 5DG2A 2EAKA 3VBSB 5KHHA 1EY2A 4RHV1 3ZN6A 2PXJA 2R1DA 3CKHA 5A80A 3OGJA 2YBKA 4Q4X2 5F3CA 3NRUA 1VAKA 2QJVA 3EYPA 2B46X 3K51A 1RUC1 1LOFC 3LZZA 4M3CB 1V00A 4OCTA 1VIWB 4W6WA 1KD7A 2XGXA 1YUDA 5L9RA 2WO3A 1O8PA 2ZZJA 3HT1A 4R52A 3I2OA 1IOAA 4EN9B 4K21A 1JYIA 1DGRN 2A3YA 4IETA 3IWZA 4LBOA 3ES1A 1UYYA 3SH4A 1PMJX 1U5ZA 1ENSA 3WF4A 4I0BA 2ZX1A 5FPZA 1UY4A 1UMZA 2XVKA 4XFIA 1JU4A 3RSJA 1K5MA 2GAUA 2P37A 2V4AA 4CCDA 1FPN3 4ATEA 4XUNA 2XVLA 1XYNA 4Y1YA 3IMNA 4D0QA 5A6ZA 4J1XA 4QD2A 3CQOA 4TLFA 4GMP3 5CVRA 3S6PA 4IV3A 4YVWC 5GZEA 1ZRRA 2G9FA 3VBUA 4A2UA 5JMCA 4HPKB 4GB31 3CF6E 1RGSA 1VRH2 1CWPA 2BTVC 3K77A 4LBQB 3VHPA 1W8NA 2XJPA 3C8XA 4KWJA 4LE4A 4MX3A 4BMEA 1MEC2 1C28A 4QPIB 2HEVF 2W52A 1EAH3 3AYCA 3KS7A 3LEMA 2XJTA 4G4FA 5B4XA 4E2QA 2DV9A 4IE7A 5CFDC 1EPWA 4LUKA 1OMIA 4H2AA 4EZ4A 3AVRA 3I97A 4G9SB 4PBPA 4CXWA 1KFUL 2JG9C 5FUPA 3UK9A 3MI8A 4CP9B 5ABJB 4B1LA 1H2KA 2Y64A 4AXOA 4RHV2 2ZGKA 1MEC1 3WD5A 1ND3A 5LBFA 3KV6A 4EN6B 1BK1A 5A6QA 3UGFA 5CZKA 1R64A 1VR3A 1Q56A 2K0GA 2A3WA 3ZYBA 4JQRA 4BMBA 2JXAA 4OUSA 1RUNA 1K5MB 4Q0UA 5F3EA 3U07A 2VUDA 2Y6HA 3LPGA 2GH8A 2WKKA 2ARBA 4EWEA 2JKXA 4JGZB 4W8JA 5FMOS 3NAPA 1LCLA 1Z7S1 2XL9A 2CV6A 1RUJ3 1GR3A 1QGLA 1UX6A 1W3VA 2RMU2 5FZMA 4HPKA 4WM7C 3QCWA 3VBHA 1BYHA 4BB3A 3KV5A 5HCHA 4DQAA 4MXVA 3N9OA 5JZGA 3L2HA 5FY5A 1GV9A 4LJHA 3VL9A 1CAVA 1WMXA 4JVAA 4GH4A 3ZXGA 4EN0A 3ES4A 1PK6B 2WN2A 2VNOA 4MHUA 2DFCA 2HYKA 1O5UA 3USUB 4CCEA 3O1VA 3F95A 5C8CC 1QQP1 5BY5A 1VRBA 2BZDA 1G9BA 1C57A 4CP9A 4Q8KA 1R081 1WCSA 3N9PA 1ZBA2 2P3JA 3MV11 3VHRA 1HQNA 3N36A 4FQ4A 1WCKA 1O6UA 4ZY9A 2VMCA 4JGZA 1ULCA 5JCTA 1CESA 2AR6A 3T0BA 1W05A 4HXCA 1FXZA 3NSTA 4RGAA 5A3LA 4CYDA 3MO4A 2W94A 4QPWA 2W39A 2RS51 2WO2A 4M0HA 5BV6A 1LEDA 4KGQA 3AK0A 3MEPA 4YW2A 4F8AA 1AYN1 2H0VA 3PJQA 4GJYA 1UZYA 4AFDA 5KXCA 2WFF2 2VBBA 1GP4A 1MVQA 3SLIA 3USUA 1YI9A 3BIEA 1QY4A 1RVF2 1QXRA 2BVVA 5JZGB 1MS5A 3C7EA 3MZHA 4DIQA 2X5IB 4QXBA 3BODA 2FCTA 3EO6A 1WLDA 2VNVA 4JHZA 4NRMA 3WLUA 3ENRA 1K5JA 3WQBA 4GIQA 3JB8A 3OGVA 1T6BX 1RYYA 1VB2A 2IZWA 1ONAA 2HWE1 3AYAA 4COUA 4XHXA 3ZLIA 2LALA 3IDCB 2BFUS 1GWMA 1O4YA 1KRIA 4QB6A 3ACIA 5A3UA 5F5IA 2RS31 2J1RA 1A8MA 2XJQA 1JZ6A 5FY9A 4NUBA 4Z92B 1Y9GA 2OW4A 1J84A 2DBIA 4ZONA 3UESA 4GB33 1JI6A 2IXHA 2GNBA 1VBB1 2WDBA 2ZGLA 5E8AA 1DLLA 2Y38A 3ZN6B 4ET7A 2HWF1 4H7LA 5KR7A 3PU3A 4A7YA 3OGSA 1HKDA 2Q1FA 2P3YA 3NVCA 2D5HA 1WLCA 2D6MA 5ERLA 3VDCA 4C8DA 4Q4W1 1A8DA 3CHXA 3WSOA 1ZA4A 5B2GB 4B4PA 1CAVB 1UZ0A 5ABJC 4Y33A 4EJRA 2PMWB 2GN3A 1BQPA 2CY6A 3I3DA 1FOD3 1GWLA 4MADA 1J83A 4IEWA 4DS0A 4DY3A 2EF6A 1WW5A 2LUWA 3AZYA 4Q8LA 5T3NA 4YLZA 5I0SA 2BERA 4IE5A 1CAUA 2XR4A 4P14A 3I2DA 3V0AB 3IBMA 3J7HA 4DXZA 3MIGA 2WNVB 5IK4A 4AQTA 2JB8A 4XFHA 4D6RA 2JE8A 1N47A 3GJAA 4JC1A 3WDUA 2R6QA 1W6OB 4XCBA 1CAXA 4XJUA 3VBRC 1QJY2 3VD4A 1AF9A 3VZOA 1UU4A 1W8FA 3MPBA 3T2OA 4QT6A 3ZIXA 4EWDA 3QH7A 5ACA2 1R1A1 1RMU3 4L2NA 1W28A 1JTZX 3ETPA 1XXNA 1BMV2 4P5YA 1SFYA 2ETEA 1W0OA 1SCSA 4P5HA 1JBCA 3AP7A 4CEWC 1AL23 1RHI2 1ENRA 4OMDA 3S7IA 2A7AA 3PUHA 1ST8A 4BQXA 3SCGA 5AVPA 4M3CA 5SV8A 4MGZE 1DLCA 5A32B 1VBC1 1WZXA 3THDA 2OZ6A 1QH7A 2AREA 5LW9A 1Y9QA 2W3JA 1PHMA 1UKGA 3ZXKA 1AR81 1YCIA 4PT6A 4JRAA 2KD7A 1LGCA 2O0OA 3LD8A 3CZUA 2HWD3 4LO7A 1XRUA 2V5YA 2VXRA 1NCQB 3OD0A 2BGCA 2LW8A 4JCKA 4OZXA 1V9U2 3OYWA 5IWFA 5CFDA 2VOVA 4C1XA 4DXSA 1WBFA 2WA4A 2H0BA 4LQRA 2XKOA 1R091 4ES8A 5LY1A 4FPLA 1BHGA 1PVC1 4COZA 1DQ5A 1HRV3 1DG6A 5ANQA 5I8SA 1AZDA 2E53A 3MW3A 3VBFB 1V6IA 1UZWA 5C3QA 4QPYA 4SBVA 4M01A 1F15A 1ASJ3 1Q8OA 2XJRA 5FZ1A 2VOTA 2WC2A 1RUC3 5IFPA 3KCYA 4WM8C 1C5HA 5JWPA 5FYIA 1JZ7A 5T54A 3BPSA 1QNWA 1SBFA 2NMOA 2VOWA 4ARYA 4AGGA 1GZWB 5LK7B 2C6SA 2DF7A 4QQPA 2DU1A 2V73A 3UGHA 4XHBA 4XAEA 5EP9A 1H8TC 1LHUA 4TTGA 4W50A 1CIYA 2ZJCA 3N9LA 1IS6A 5J98B 5K9YA 3FZ3A 2PQSA 3M4FA 3OB8A 4AHYA 4PQ9A 1QJU3 5CKMA 1G9CA 5FP8A 1QJZA 4BH9A 2J1UA 4LHNA 4L92A 1UXXX 4XILA 3D8CA 3IKWA 1ZNPA 3GZUC 2NLRA 4YVWB 4W6XA 4CXXA 5GJ6A 2DURA 1F4AA 4YZ5A 3KSCA 5DAVA 4X6RB 5FRAA 1LNSA 3WF2A 4AI1A 1IS4A 2WNEA 4GH4C 5A6YA 5A3PA 1HV0A 3IB3A 3AXEA 2XPJA 2J1EA 2VD7A 4CDQA 5A32A 1YEWA 4DOUA 3T2QA 4CCMA 1NY71 3NWKA 4OFGA 1FNYA 4XJ8A 2MEV3 3VBHC 1MZ5A 5IFTA 2OUJA 1DGWA 2V5DA 4KWUA 1O5LA 1H9WA 4S2DA 1Y43B 4Q29A 5FZ7A 3D3AA 2ADDA 4GWIA 5D1IA 2LM3A 1TG7A 4Y24A 4E2GA 3EJKA 4IV3B 1CZTA 3MIEA 1HXS1 1OD3A 4QM9A 4XBLA 5A7WB 3KQRA 4QDSA 4FPCA 2R041 1RXGA 4DUVA 1TEIA 2ET7A 2R071 1R092 3MW2A 2WZ8A 2WS91 1COV1 4IQPA 2VJXA 2YBPA 4XFBA 3I3EA 4XFGA 1XU1A 2R7EB 3MDPA 1W0PA 3CJIC 3I59A 3W5MA 2RR11 3S5AA 5A33A 1LOGA 1RXFA 1W8OA 1SEFA 4AYUA 2XUMA 2VMEA 5FV3A 5DXDA 3OEAA 3FHQA 3T3YA 2WN3A 3VBOB 3LAGA 4E27A 3POFA 1OHFA 3Q8EA 4H3WA 3BU7A 4RQPB 4Z07A 1ASJ1 4XJ9A 5GLZA 3H8OA 2D40A 2YC2A 2RVAA 3AMHA 3RZKA 2TBVA 4NO4A 3FLRA 1MEC3 1PZ8A 4NWWA 3MF9A 1GSLA 4IGOA 1SCRA 5KHJA 5ISLA 1DCSA 2YY1A 3VDBA 1E5HA 4EV0A 2W9XA 1UKRA 4YVSA 1QOOA 5FWJA 1EAH1 4QPGB 1W90A 4RSUA 5KC5A 1LJ7A 4NMIA 4NIAA 1RUI3 2R30A 3CO2A 4QXCA 1LOCA 3K48A 5FYMA 4RQPC 5FPAA 1W99A 1W2AX 1BEV2 3GF6A 2FMYA 4CU8A 3VBOC 1AYN2 3IDBB 5A33B 2YBSA 2AACA 3ZIWA 4CU6A 5J3UA 2B9VA 2E6VA 3PL0A 4KGGA 4XUQA 2RS52 1H6YA 3AYEA 4IEVA 2CYFA 4I0WB 3GZTB 2Y34A 3WVJA 2P6CA 1NCQC 1V6OA 1QJX1 5K0UA 4MZUA 1CX1A 1F2NA 5FZ3A 2P3IA 1R083 1AR71 3FUQA 1AR62 2EA7A 4GMP0 4URTA 1GLHA 2WT0A 4UBHA 3U4XA 4XDQA 2BGOA 3ZSLA 1PO11 2VQTA 4AAXA 5JUVA 1H6XA 5EFUA 4TZDA 1MZEA 3FJSA 3N7LA 4LHKA 3WDWA 2R073 4YW1A 2VXJA 4XJAA 1WA6X 4HT1T 5C9AB 4K1ZA 3OEBA 4Q0VA 5E88A 2RE9A 2WLPA 3GBFA 1HDKA 4OI2A 4BOWA 4JDNA 4OQ8A 4GXLA 4KMQA 4CVUA 1I6XA 2VCMA 4HLTA 3A21A 4D94A 2ORXA 4P9YA 2ENRA 1GBGA 3T1LA 1AHSA 4ISQA 3ETQA 1POQA 3WQ0A 4MLOA 4RS5C 2ZEXA 1MR5A 2YPJA 4CPBA 1WW6A 1JOJA 2VCCA 2WNOA 3GXUA 3H3UA 3WINE 3GZEA 1N1SA 1LULA 5IHRA 1O3RA 1L7RA 1SPPA 1VBE2 3JD71 5JXIA 3T1MA 1K42A 2RS33 4KNCA 1ZBA3 3NJZA 2BVBA 1TME3 4P9WA 1QIQA 4I2OA 5FTTC 2ZEZA 4EROA 2XQXA 1H8TB 2WQ4A 3E6BA 1LU2A 2HWB3 5D8AC 1Q43A 1AR73 1UX7A 1O3TA 2ZTNA 1AR91 3U78A 5A1LA 5LRSA 2PHUA 2RM21 4RGKA 2K2SA 3RWNA 3I3BA 1UL9A 2HYXA 1JW6A 1ZZ7A 4N7UA 1UMIA 4UOJA 5DUWA 1SBDA 2ZGTA 1SACA 5FYYA 2HBUA 1FV3A 2GMMA 2WABA 1Y7BA 1LRHA 2UWCA 1XSRA 4BQ5A 3GALA 3AL6A 2XHKA 4QGLA 3LIGA 1XQNA 4QKFA 4K9SA 5FQ0B 4AI3A 4YM0A 1AXZA 1O7FA 5G04L 3E5UA 5CG9A 2AYHA 2PELA 2WS93 3H3ZA 2J1VA 3V0BA 5A7QA 3GYDA 1HX6A 4YZ4A 1DZQA 4IEXA 2WZPP 3INAA 5K7PA 4O9GA 4Y26A 3MFCA 2JECA 5FZGA 1N1TA 4DB5A 4XW3A 4QGNA 4WVMA 2BRTA 4A41A 4S2FA 3DKQA 4JHTA 3RI8A 1S0CA 3WP5A 4BZ4A 1SLAA 3RGBA 1NAEA 2JB4A 1IG0A 2XLFA 5GKAC 1SG3A 3RNSA 1EP0A 1HXS2 1O4TA 2ID4A 2RMU1 3ILFA 1NZCA 5J7MA 4IEZA 2P3KA 3O1PA 5C8WA 1XSQA 4LULA 3WF0A 3C7HA 2E33A 3ILRA 3OBAA 2ZKNA 3LSEA 4HANA 2JG8A 3B9IA 1UYZA 4N53A 3PU8A 2VC9A 2RMU3 4QQOA 3OPZA 3P1IA 4EWAA 3UGGA 1OSGA 3PUIA 4BLIA 4IEQA 2VQ0A 2XHNA 1VMHA 2CGNA 3OBTA 4HVRA 4IXLA 1FV2A 4HZFA 3HNMA 3UT0A 4CZSA 1RUF3 3RG0A 1AL21 4AEDA 4ISRA 1LOEA 3VD9A 3DF0A 5L36A 1WLTA 4JGYA 2DUQA 2ZAHA 4COVA 1G9FA 5AFEA 5K8SA 2EICA 2C0ZA 5CFCC 4A7ZA 3NKGA 4UT5A 1OA2A 2QVSB 3FHIB 3J8F2 4Q4Y1 3M3CA 3SC7X 3RJRA 4QU1A 1VJ2A 1GNHA 5GZCA 4UF0A 4XUPA 2XOMA 3GDBA 3HEIA 4LIVA 4NPMA 3O1MA 3WDTA 5F3IA 2P4EA 1AR82 2X29A 1SDDB 3NNGA 2DBNA 4XFFA 2EAAA 5FXXA 2VQUA 1YQ2A 2RDSA 5FLJA 3BGAA 1X8EA 2E31A 4K20A 4X6QB 5LA9A 3KCCA 5FZ0A 5FP4A 1C1LA 2Q30A 1C1FA 2GU9A 2OVUA 4F83A 5FZEA 2A6VA 1AR63 3WHUA 1R093 1IQAA 3WUDA 1JUHA 1NXD1 2W47A 4PIXA 1V6KA 5EYXA 3WP4A 1F8VA 1AYM2 2GH2A 4ZZ5A 4Y5SA 5BNPC 4FSJA 1MACA 3LA3A 3SISA 3OY8B 4A44A 1HRI1 4LT5A 4I3PA 5AC91 1TME2 3RJ2X 4K6BA 5IAXA 2CL2A 2PFWA 1PMIA 2QUOA 1ZRFA 1NCRA 4X8PA 3O1TA 2WWUA 1XB9A 3LOIA 3HWJA 4PHZA 4L99A 2VY0A 5DDJ3 3TWIA 2D5FA 3AZWA 2GDFA 4KU8A 4UFHA 4RD7A 2XMLA 1QMJA 4L97A 1O59A 3JB4C 2VW0A 2E7QA 2Q1ZB 2FDHA 4PBOA 2JDYA 5J48A 2JKBA 3H50A 2WRAA 3Q8BA 4LO6B 3UKTA 1EV11 4FI9A 5HI0A 1MS1A 5FZBA 2J1TA 2DCYA 2JDNA 1YO8A 2VBPA 3ZPOA 4BE3A 1FOD2 3OF1A 1EUUA 5KXDA 1AYN3 2ZHKA 1E5SA 4NRQA 3HNBM 4HN1A 1J1LA 5FK7A 3J7LA 3UV9A 4YG3A 3MPPG 5C4WA 3UNPA 3PURA 1H0BA 3NJXA 4BQ3A 3L9JT 4GJZA 2HEWF 3AM2A 5GLTA 1AX1A 1A34A 5EYYA 3USSA 3VB9A 1WGPA 1AX2A 3ZN5A 1JH5A 5CBLA 5H9SA 1CQ9A 2E63A 3FFZA 4Q4X1 4UFIA 4Q0QA 4AWDA 1IZ3A 3ZM8A 3OBRA 4LOSA 3IDAA 1IKPA 1PO22 1W03A 5SV5A 3HOBA 4DUWA 5A3MA 4XYXA 2B42B 3EQEA 5FYSA 2HBTA 2ZA9A 3AZXA 2HWC3 3SCFA 4A42A 3POWA 3OCPA 3ZFGB 5J96B 1W6PB 3T4VA 5F2WA 3OUJA 4RGGA 2WZR1 1I5ZA 1LHNA 3NQHA 4HSJA 5M0TA 3ZFGC 2FDGA 3I2GA 3M1HA 4A4AA 3AB0A 4ZS2A 3ROUA 4YZ1A 5DN2A 1K12A 2QQNA 3PNAA 1G8WA 5FPVA 5FZ6A 5AC93 2V72A 1XE8A 2YDEA 1ENQA 4RN5A 3SCHA 2Y33A 4DEVA 1UY1A 1WMEA 2KXLA 5I0UA 3VDDB 2Z5WA 3DEMA 1X7NA 1NA1B 2QTWB 2RS11 1YQ8A 1EV12 4DY5A 5E89A 5CFDB 1UZZA 1SLBA 1PO12 2D6NA 3OOXA 1WCDJ 1C4RA 1AL0G 2RS32 2PYTA 5FZKA 1XNAA 5A7PA 4AI2A 5HXVA 3FFQA 2YG0A 3LA7A 4XF9A 2J1AA 4HK9A 4IEUA 1H1AA 3ECQA 4KG8A 2QCSB 2F6BA 1MS9A 5LBCA 3I2IA 4R4ZA 4DO0A 1W6PA 5FZAA 4M4RA 3WW3A 4CDUB 1OA3A 4FPJA 4N8MA 4BJ0A 5J09A 1KJRA 1UXZA 3FE5A 2MHFA 2YC4A 3RI9A 3O5SA 4LITA 4XFAA 3WDYA 1F4HA 1CPNA 1J58A 4AVTA 3U14A 2IXKA 3TN91 2BV4A 4P00B 4YRDA 4QQHA 5A7SA 1X82A 2QKDA 2DUOA 3KV4A 3ZXJA 3AP4A 5HXMA 2VTFA 3AX4A 1PGW2 2C1FA 2C9KA 4QX7A 3BUCA 3ACFA 1PO21 2D98A 2J1SA 1BEV3 4Q2FA 1AR72 1DQ1A 3I3QA 3VDDC 3P3NA 4A3XA 3RYKA 1CONA 4RA0A 1VBE1 3JD72 4WM7B 4CE8A 1LHVA 3ABZA 5CFCA 2ATFA 1CGPA 3HAGA 3FC0A 1TMF3 5FZOB 3Q8AA 2JIGA 4AEDC 5JSPA 3VL8A 2XWBB 2B9UA 3MLJA 5E16A 3N9QA 3RZZA 5F9TA 5DAWA 1MQTC 1VRH1 4N90A 2OT7A 5LASA 4CDQC 3ZMNA 1RUG2 5LZ6A 3ILNA 2D6KA 1SLCA 3S7EA 5A1AA 2GMPA 2ZGUA 2Q0AA 1FPN2 3ZFEC 4AVBA 1UWWA 5GLWA 5AVAA 3FBYA 1W6NB 3O1OA 2RJLA 3UKNA 3PJYA 1I5PA 5E6HA 2CAVA 2Z69A 4B29A 3GCXA 2FCUA 3WNOA 4NAOA 5CEHA 4Y5TA 5FYUA 3U11A 2IWGB 1OUXA 4RYDA 5JXJA 4LHLA 5FYBA 5BNOA 5DZGA 3NNJA 3ZKUA 2R061 3AXDA 1RUJ1 2AGSA 1RUF2 1NKGA 4I01A 2WSVA 1V6MA 4V1PA 4Y22A 3BTYA 4WBBA 4PLOA 1V6LA 1UYXA 1S0FA 4OZOA 2MNGA 1QKQA 2VUCA 1AUYA 5A1FA 1D4M1 1G9DA 2VULA 3K4AA 3KGLA 2W95A 5C71A 1W04A 2IC1A 2R49A 2ZAAA 2PHTA 2HWF2 3U1XA 1IPKA 1AJKA 1W2TA 4CDUA 1N1VA 4JZRA 4JX0A 3N7MA 2ZX3A 1VBB2 3NW4A 2J22A 4H14A 1OLQA 2RDQA 1OURA 3DPRB 2VCBA 3AMMA 2JDKA 1PZ7A 3I8TA 2ZGOA 3N7JA 4PDWC 3SKVA 4BXSV 2JDHA 1ALYA 3DGTA 5IVJA 3LFMA 1UU5A 1W39A 4Q4V2 5C33A 1WA4A 1RUE1 2BYVE 2PLV2 4I09A 2XH6A 5C7GA 4D6SA 1S0BA 5FZFA 3SMHA 1CAWA 1ENXA 1HXS3 1ODMA 2FMDA 4I3GA 3VKOA 2KR2A 5GLVA 2NM1A 2WS92 1RMU2 3WW2A 1K45A 3ZDVA 3ZO0B 1Q8VA 2VMHA 3WQ1A 1K3IA 1LTEA 1R1A2 2JG8C 3KGZA 1VRH3 2ZHNA 3QBQA 4MH0E 5FO7B 4AK3A 4NIDA 5FOJB 3WX5A 5K4LA 1GQPA 2W46A 2CDPA 1QJY1 1DIWA 1H4GA 2WNUC 1VBA3 5FXZA 3TRSB 4AW7A 3FL7A 5C5TA 4YW3A 2ZGSA 2C9AA 5JI7A 3RQ0A 1ND2B 2HWE2 1F9KA 3LCPA 1NLRA 1UY2A 5A6XA 1ND2C 4Z2WA 4I0AA 1F5FA 4HMZA 5L7OA 4YGEA 4HFSA 2WT2A 4HSLA 3ST7A 4UW5A 1PO23 2WNUB 4GKYA 4QWNA 5EV7A 2SLIA 1GOHA 1W8ZA 4YW4A 3RZJA 5BNOB 5LK5A 2YU2A 3PIJA 4QXKA 1PVC2 2DVDA 2JD9A 2VNGA 3UKVA 4CTEA 2DCTA 3JXSA 3PVEA 2B7YA 3EXUA 3PVBB 2VO5A 5KHIA 1WD3A 4IV1A 1G9AA 2VECA 4MO3M 2G4IA 2GP3A 5JXHA 1B35B 2GN7A 3ON7A 2O8OA 4GB32 1RUE2 1W6QB 1HRI3 2PAMA 1RVF3 2XONA 1SPPB 5LCWL 1NXMA 3DV8A 1SZBA 2BFUL 2LROA 5F1RA 4HETA 4AHXA 3RZHA 1X50A 5IT6A 4EQVA 5JPMB 1OI6A 1S2BA 1AR61 1UW8A 4XJZA 1BZWA 4Q4Y2 4BU2A 3ZFGA 2JE9A 3H7JA 4IEOA 3T4HB 2RS13 4IERA 3VBHB 1PGW1 2OA2A 2IXIA 2D44A 1PIV3 3E5QA 4Q0SA 3V65A 4XVHA 2MPFA 4QXHA 5CU1A 2ZMLA 3SITA 3WW4A 5DDJ2 5EHDA 4LE3A 3KHCA 1HN1A 1DQ0A 1TME1 4AI8A 3JBG1 1KS5A 3CLPA 4Z82A 4AHWA 4P9XA 5FZ4A 1VMFA 3ZYHA 4CUGA 4FQZA 1OVPA 2JWPA 4ITCA 5IVCA 1DGRA 5FPLA 2W1QA 2PTMA 2FZ2A 5FK8A 5FIXA 1H8VA 1O91A 1JMUB 2A6XA 1LAJA 3LEGA 1RIRA 4ZU7A 3BU0A 4AZZA 2YYOA 3FWEA 5AC92 5JDBA 2QBXA 4MGTA 2QQJA 1QXPA 4LK6A 4L8QA 5JAXA 5E1RA 3NV3A 4NPLA 2HWD1 4UWDA 5GZGA 2JICA 2W5FA 3LPFA 4KG0A 3WV6A 1NCQA 1US2A 2A71A 3VV1A 1REDA 3ZFEB 2TEPA 3OG2A 3VD3A 2WO1A 1RHI1 1XU2A 4WM8B 4AFMA 3PUQA 2JEMA 3VKFC 2CDOA 1W8HA 1CR7A 3B93A 5FREA 4BQYA 4ARXA 3TEYA 1PO13 3VUOA 2VR4A 2KA3A 4MGQA 3DYOA 4CDQB 2Y0IA 3LDKA 4JDMA 4LKEA 4JGYB 2O14A 3CJIB 3A0NA 5T5PA 1NOVA 4BIFA 3VBFC 3PUSA 2YZ4A 4XOGA 4MUVA 1V9U3 2AUYA 5A3TA 5H9PA 1CPMA 1UD1A 2W92A 1Q8SA 3QOPA 3NJVA 4NRPA 3VKNA 2UY8A 3HN3A 4Q0PA 4RQPA 1R1A3 1ULFA 5IYYA 2ARAA 1OH3A 4R9CA 1JN2P 2DVBA 2TNFA 4Z1VA 2HWB1 4OQ9A 2YROA 4P9IA 4EZHA 1NYWA 1DQ6A 2W91A 1O8SA 4FP3A 4DXTA 3I59B 3K4ZA 1A78A 5I93A 2C24A 3VBUC 2VPVA 3ZVXA 4ZHNA 4DZGA 5C70A 2JENA 1GNYA 2RM22 5DAQA 4CUAA 4GH4B 2DDUA 3B5LB 4GWMA 4Y3OA 3TN92 2P5BA 1OLMA 1UOGA 5FR3A 2ZACA 3AYDA 3RMXA 4OUMA 2ZPXA 1PGL2 1PGSA 2YHJA 3IMMA 3MGUA 3WNMA 2EXKA 2ERFA 1QDCA 1VBC3 5FY1A 5CKNA 3RYPA 4C1WA 2OIIA 1MZ6A 2CWMA 4M00A 4HBNA 3WDVA 2GNDA 3HT2A 4BPZA 5DPNA 5DZFA 3KD4A 4PI2A 5FP3A 3S57A 5JPNB 4WV8A 4AVSA 2DTYA 2HKXA 1RTVA 1SBEA 1X8MA 2Y6GA 1V6JA 2E32A 1COV3 1ZZ6A 2BEOA 4K1YA 4YG6A 5JLVA 2ORZA 3DECA 4XXPA 4FFIA 4XZUG 2WNUA 3J26N 4JDOA 5ACA3 3AKPA 5FUIA 1JZ2A 3EBRA 4LK7A 3HBKA 4YSFA 4Q4Y3 1GFF2 1TVGA 2IVIB 2D3PA 2WA3A 3K3OA 1JYCA 1S2EA 2WSUA 4LBJA 4XABA 2VCAA 5L7OC 4I02A 5FPBA 1FX5A 3B7MA 4N43C 2KM2A 1X33A 3ALQA 2WWSA 1ZYBA 1XBFA 4OI4A 3RWKX 4AR2A 3FHAA 4ZU5A 1QQP3 2CTVA 2R0HA 5L19A 2I45A 2UWAA 2WFF3 1SLTA 1J3RA 5FMCA 3AP6A 1UOBA 2RDRA 2XDVA 1V9U1 4AQ2A 2XLGA 5FYZA 1ZBE2 1FAYA 2WO7A 2Y6JA 3GM8A 1G7YA 4K7JA 4LBNA 4MVTA 4XCAA 1J59A 1WKYA 4XUTA 4IL7A 4NHMA 4W4ZA 3O0XA 3THPA 4XF4A 4AVAA 5JR2A 5FZDA 4A3ZA 1I1EA 2ZGNA 1MPXA 1RUH2 2P17A 4FOWA 3M2MA 4IGPA 3CDZB 4K40A 2HEYF 2Y0OA 1OOPA 1NQDA 3KF5A 1YJKA 4XDPA 5T50A 5JMOA 1ZA7A 3KT1A 4QPIA 1H8TA 1VE0A 5F39A 1GP5A 2XJVA 2OXBA 1SFPA 4LA3A 1EPZA 1OF4A 4QB2A 5CIRA 5BUVA 5C4WC 4W65A 1LODA 5JOXA 1YQ5A 4IESA 1W9TA 4PDWA 5JOYA 5FLHA 4PQQA 4MHRA 4O65A 4QU2A 4YARA 2UWBA 3RVHA 2QQPA 1C5IA 2WBKA 1RUG3 4HKWA 5DAXA 1QH6A 3OJBA 4DFSA 3E97A 2IFRA 1PIV1 4B8EA 1IPSA 1UO9A 5BNNB 1YYNA 1R1ZA 3VBRB 2EVXA 4FPEA 2QQWA 1W8UA 2EALA 3QACA 3OPWA 4P9LA 3VZJA 4ZKTB 2WUHA 3W59A 3ZXFA 4CEWB 4E4ZA 3ZSMA 3NV1A 5JR7B 1LHWA 1OFSA 4XQ4A 5D8AA 3POGA 3OY8A 1F5JA 5F5AA 4Q1PA 4B7KA 1BJQA 2F4PA 1VBD1 1DDLA 4GMP1 1J1TA 1D4M2 2QDNA 4RR3C 5JIAA 1QJU2 1Y9MA 2Q5TA 1AYM1 3VLBB 2FCVA 4LO8A 3KCXA 2D43A 5LY2A 3Q8FA 5C8CB 5LA0A 5BNOC 3NL1A 2QQOA 2GALA 1HRI2 4R8HA 4TXWA 3RMYA 1OQDA 2WNVC 4N7IA 3U4SA 1FT9A 4Q4V3 3TEXA 4D6QA 3POBA 4QDQA 1L3JA 3Q9OA 4C90A 1GU3A 2FD8A 4B4RA 1B09A 4A45A 1WCUA 1ZBE1 5L73A 5BNNA 2IUWA 3E6DA 5BXXA 3NNMA 1MQTB 4HN0A 4YG0A 5FDBA 3R4UA 3AKRA 2HWC1 2RHPA 4BIOA 2AEZA 4QQLA 4WZCA 2GC0A 5EZWA 4AG4A 4RS5A 5IUQA 4XF3A 5F6LB 2G9GA 1W6OA 1ULDA 5FY8A 1SQ4A 1D2QA 1VP6A 1OPOA 1RMU1 4MXWB 4N43A 1I3HA 3MIDA 3QD6A 4FTBA 1XNTA 4MGSA 1RUD3 4AI9A 5BNQA 4Y4YA 1TE1B 4UAPA 3WNNA 5T55A 1CAUB 3H1WA 4LO5B 2X5IC 4HG6B 3UJOA 1JOBA 2WL1A 1W06A 5F3GA 2DFBA 2OUHA 2OX0A 5FY7A 4D7SA 1C3HA 1H1MA 5FOBB 1VBA1 4V2VA 4EN8B 3VBOA 1DZTA 3FN9A 2EIBA 3NAPC 1M4WA 3AKQA 3DL3A 5FLIA 4TWTA 5F8PA 2EXJA 1HRV1 2W0XA 3NAPB 3BTAA 3CBNA 5JZGC 3CU7A 1BXHA 3JU9A 1PGL1 3LEKA 5FBJA 3JBG2 2VW2A 3AP9A 3GJBA 4KI5M 1UPSA 2QE3A 3GZAA 4PIZA 1S4CA 1CX4A 4E9KA 2Z42A 4WVMB 2CNAA 2V09A 4CCCA 2B8MA 2JDZA 2BNMA 1YFXA 2OPKA 3TYJA 4CDXA 2QDRA 1EYBA 2R062 2EXHA 3IZOA 3VZNA 2QQVA 3PTYA 2ZKLA 2VU9A 4INDA 3ZOIA 5ABJA 2D93A 2WZR3 1PNGA 3I54A 3LFIA 4YZ3A 3FLPA 2VG9A 1SLIA 3CZJA 2FZ1A 3DCQA 3M3IA 3ME2A 2P34A 4Y1ZA 1NY72 1S0EA 2ZHMA 1OT5A 4KWKA 4AEKA 5FMOL 3A22A 1IPJA 1CJPA 5J37A 4U2AA 2FHRA 1WCQA 3ZR5A 2VMDA 4WZFA 4DRVA 2I74A 4MGKE 5FFOC 2UURA 1LR5A 1MS4A 3I2KA 3NV2A 2WWJA 1PVXA 1DQ4A 1W2UA 2GNTA 3ZDSA 3QLQA 4Q5OA 1CVNA 2O1QA 1GOGA 4BDVB 1JZ4A 1COV2 4MXWA 4N43B 2DVAA 1RUG1 5GZFA 4JKLA 3VBFA 1OLME 1RUD1 4C0HA 3B3QE 1ODNA 3T08A 1S0IA 1LGBA 1BBT3 2RS53 5CKQA 2YGMA 1IQDC 1IG3A 4XIKA 1QOTA 5FYVA 5GM0A 5JXGA 4GKXA 3BB6A 1UNBA 1GZWA 5BPXA 1VAVA 1X9TA 2OYZA 2BBVA 3RZGA 1VLNA 4OUEA 5IVFA 2WT1A 2NP0A 1YLLA 2Y26A 3WG2A 5KXEA 3AP5A 2ZGQA 3HMYA 4FPFA 4WVVA 5FXWA 5DG1A 1VBE3 4YNIA 4JKKA 3PLQA 2P2KA 4IW3A 4MV2A 2DWRA 4CXYA 2O8QA 1GZCA 4AVCA 4NAMA 2UYBA 3MIBA 4O9EA 4XQDA 2AC1A 4NIHA 1W8TA 4GA9A 1TMF1 4Z8BA 3RYRA 2XBO2 1H30A 4JQTA 4LBQA 4F7ZA 2AENA 1Q3EA 1AJOA 3ACLA 4SLIA 3B02A 2B39A 2HWE3 2PLV1 4HK8A 2IXJA 1NCRC 2PA7A 1VPHA 1J3PA 1C8M2 2VUJA 3J7MA 5JVVA 3THTA 3T2PA 2Q8OA 4Q4W3 1RC6A 1YJLA 2Q8EA 2WYFA 4AFCA 1UZVA 4QKDA 3ZYGA 1AYM3 5DUUA 5A7WA 1WMFA 4ASLA 3TAYA 5FY0A 4KBBA 1ULPA 3T0DA 1H1IA 1Q8QA 5FO9B 3DYMA 3A0KA 2HLEA 1YIPA 2LRPA 3R05A 3TN93 4DINB 5JOWA 4HOOA 5KXBA 3LDBA 4PLMA 3WOGA 1HB1A 4DXRA 2YC0A 4FCAA 1KEXA 4GZ9A 2WQZC 2Y8KA 4AVVA 3MBWA 3I3MA 1D4M3 3HJRA 2AZ5A 1BCXA 4LXLA 4A6SA 4FPYA 4NIGA 4CDXC 1WW7A 1YI7A 1K5MC 5JI9A 3KHBA 3TB0A 2Y6KA 5TSWA 4UBGA 3F2ZA 5EXOA 3O14A 1W6NA 3TEWA 5BNPA 3RFRA 1U12A 3KF3A 4LBKA 4LLOA 5LRRA 3AMQA 1PK6A 2DVGA 1YFWA 3ACHA 4YW5A 3V0AA 2RM23 1HW5A 3BTZA 4Q26A 4ASKA 5FZCA 1W9YA 1RUH3 4EN7B 1QJFA 2R063 1WD4A 3MUZ1 5IVVA 4UW3A 2VAUA 3JQXA 2A5ZA 2F4LA 3DN7A 5D8AB 3M3QA 4FPOB 3W20A 4YM1A 4BQ2A 1QF3A 4CEWA 1AR83 1UOFA 2WINB 4NHLA 4QPIC 4CU9A 4N53C 2XKPA 3PTRB 3T0AA 1KXGA 4CCOA 2QFEA 1OOPB 1GP6A 1XE7A 3IDEA 3J8F1 1JZ5A 2FQPA 3E6CC 4FTEA 2RG4A 2X5IA 4BYYA 4NHXA 2BGPA 3O1UA 2VTXJ 5CYYA 1JYXA 2X8KA 3LOBA 2Z2SB 3MHZA 1N3PA 3SKJE 4YW6A 2YFZA 4M0NA 2ADEA 4IUGA 4ES9A 2V4VA 1W2OA 2Q8DA 1W6QA 3H1MA 5BNNC 5FPXA 1HB3A 4DRRA 2A3XA 3FX3A 5IJRA 1J3QA 2H6CA 2CGOA 4XMAA 1B35A 4Q4X3 1CJDA 2F17A 5C3OA 4BLJA 4K3UA 4KU7A 1XYOA 3WP3A 3KT7A 3NV4A 2JJ6A 2XJUA 1XE0A 1IKQA 2I07B 2ZMKA 5H9QA 1V0AA 4MSVA 1OQ1A 5T5OA 5FPUA 4ZU4A 2VE1A 3VZLA 1LHOA 1QQP2 1JHNA 4FFFA 3VBUB 5LEJA 5CA6A 4AQ6A 1DHKB 2E51A 4H7MA 4OYUA 4XE9A 1IS3A 2A1XA 5LA2A 3OSDA 3VBSC 1EV13 3GHMA 3LWCA 1GNZA 1NLSA 3O0VA 3DYPA 1QNYA 3BKZA 1UYPA 1Z78A 2VNRA 3B00A 3OUIA 4PF5A 3MYXA 1NE6A 3OD4A 4XXAA 4B3NA 5FUNA 3WNLA 3I2FA 3VDAA 1QXJA 1XPWA 5FBZA 2W68A 4FFHA 2CHHA 2VZQA 3LE0A 2VBDA 2HWF3 4ZXKA 2QQLA 3BI3A 1XNBA 3HQXA 4CDWA 1I9RA 2W08A 4BWOA 2RR13 4AGRA 1ZBA1 2YV8A 3K2OA 1YFUA 2XBO3 3KT4A 3DPRA 4QPGC 3I4IA 2BNNA 4Q4V1 4TN7A 2RDNA 3AVSA 3LDRA 1L7LA 1LESA 1H2MA 3O7OA 3VBSA 3LEIA 4LUMA 4NE9A 4QB1A 3KVAA 4E4HA 4NVPA 1GQHA 4Q1RA 4DMIA 1W9WA 2BBAA 4QDRA 4COYA 5J1XA 3I49A 3NO8A 3LF7A 3FUOA 3P6BA 5EJZB 1SFNA 4YW7A 1GWKA 1YIFA 3NJYA 1RVF1 5GALA 4RS5B 2PHXA 2Y6FA 4IV1B 3BIWE 4QX0A 5HCFA 4BK4A 4TSVA 3ZFEA 1MZFA 5J36A 2OQ6A 4Y20A 1OBNA 4OI1A 1BMV1 3THCA 2ZGMA 1BVVA 1HRV2 1MQTA 5IATA 3RPQA 1EAH2 2R16A 4XMIA 3K4DA 4GD4A 5ANNA 2CWSA 2UU8A 1S1AA 4NJ4A 4K8RB 1NQJA 3PVOA 1EUTA 2I2SA 3K46A 4QHZA 4FAHA 1HQLA 3APBA 3HBZA 1BEV1 1H4HA 1ND2A 3NNLA 5EJ1B 3WG4A 4A7KA 3TNQA 3T2TA 1DU3D 1E5RA 1LKNA 4FP2A 3R4SA 1T6GC 5F5CA 2Y6LA 4Y22B 1ZRIA 4I30A 3R4DB 4Q27A 2IVJA 1S0GA 4QHOA 5IVYA 4YFZA 2YB7A 5LWBA 1DZRA 3WUCA 1RINA 1OQEA 4LTAA 2OPWA 2XJSA 5APAA 3POIA 3KWVA 1YNAA 4M4PA 2GNMA 2Z79A 3ORJA 3ZSJA 2WZEA 2RJKA 2D6OX 1JXNA 5A7OA 3O1SA 1UIKA 3A23A 4AEMA 3B94A 3D4KA 1Q8PA 3ZFFB 1W9FA 5K0UC 5KBFA 1UQXA 3WW1A 3EB7A 4KQ7A 4HL0A 4QX1A 5A70A 4D69A 1IHMA 1D0GA 1AX0A 2XUEA 2Q8CA 5I8TA 3RZMA 4F3JA 1WLWA 1BVP1 1KJLA 1JUIA 3LSDA 3POJA 5L9VA 4BCUA 1W8WA 4QM8A 1STMA 1UPIA 2VZRA 4CUBA 3C7FA 3HD8B 5C3RA 3ZN4A 2VZSA 2XQRA 4Y1UA 4XF1A 3NMBA 5DAPA 4GALA 3ITQA 3GHNA 2A6ZA 1M06G 3BPZA 5FO8B 1ND3C 3FMGA 3UL2A 4YGDA 1YQ6A 3HNYM 4OHWA 4HONA 4URAA 4MGIE 2VMFA 3H0OA 3U10A 5FYCA 5CAZA 3CJIA 2BUKA 3KVBA 1UOJA 2BOIA 3D0SA 4LKFA 5FP7A 1FMD2 1CZSA 2ZX4A 2B5HA 5A3NA 1NG0A 4QX8A 3POSA 5DMYA 5KC6A 3BYWA 2ZBJA
chains in the Genus database with same CATH topology
1V70A 4XBQA 4OHZA 1LECA 2UY9A 3RRDA 2ET1A 1A6CA 3D82A 3ZYRA 2BWCA 2PHDA 3MW4A 3VGIA 3W9AA 4OHVA 2QZ3A 1GZ9A 2H6BA 4LO4B 2A6YA 2XL7A 3ELNA 4PCRA 1U0AA 4CRQA 4BM8A 3C3VA 5I8YA 4MYEA 1E57A 2ZX2A 2DUPA 1YWKA 2IFWA 4JAAA 1QDOA 4P9JA 4R9AA 2HWD2 2BPA2 1CN1A 4PDWB 3W58A 1QU0A 5EJ3A 1QJY3 4AFBA 1A3KA 3H9AA 4FPHA 3M8LA 4WM7A 3PMEA 1YXWA 3TBDA 2DYCA 2GC2A 2VGDA 2HJIA 3MLLA 3WQ7A 3MFAA 4AEJA 1HIXA 3IPVA 5T52A 3PHMA 1TNFA 3WDXA 4JV4A 4OLLA 4NR1A 2N7GA 3V64A 4YZ2A 1S2KA 1RUE3 5AFBA 4OVEA 1FOD1 1R082 5I91A 4Q4W2 2NZ9A 4D7TA 3VHNA 2JX9A 3CNAA 3LGRA 5IK8A 1ZZ9A 4CEYC 1DFQA 2NN8A 1PVC3 2D97A 2XWJB 3KMHA 1RUH1 5CNAA 3M7AA 3ZFFA 1AL22 1C8M1 1D2SA 1XYPA 1YHFA 3ZXAC 1KS4A 2ZX0A 4IEPA 4LBMA 1RJ7A 4YVSC 3R0RA 4HVOA 1PIV2 1NE4A 2JG8B 4NPRA 5I93A 3SHRA 4R9DA 1VBD3 2WLQA 1S55A 1DGWX 3NKTA 1H2LA 5BYNA 4MGYE 2VOKA 1RUC2 4JTNA 2ZCWA 3AZZA 1RJ8A 1QWRA 3X29B 3AZVA 4WM8A 4GULA 4AF9A 5JSOA 1Q5OA 4N9HA 4RR3B 2R072 4ASMB 1H2NA 1YFYA 5CB7A 1F31A 3B9CA 1LGNA 2BNOA 2ZGPA 2HWB2 2R1BA 5IK5A 1RUF1 4XZPA 1KFXL 4Y20B 1PM7A 2D3SA 2D6PA 1VBA2 1ASJ2 1CAWB 1CD3G 3MIHA 5FAXA 4N9IA 1QOSA 2VW1A 3A4UA 2CAUA 2R32A 4NOTA 3ZYJB 4HKOA 1TQ5A 3J9SA 4XPVA 5I0RA 1GQGA 4KWLA 1DQ2A 3KB5A 5C4WB 3WZ1A 2EXIA 5HBAA 4E4SA 3ZXDA 2PAKA 2XVGA 2R0FA 3FLTA 2TUNA 3AKSA 2C5DA 4ONUA 3AJYA 4PLNA 2VVEA 5DUXA 1G6NA 5ACA1 3JZVA 1REEA 4AFAA 3VZMA 1AR92 1RL3A 4PJYA 3EHKA 4BQ1A 2Q1MA 5JOZA 3U0ZA 1PK6C 3WHTA 3OGGA 3TNPB 3OTFA 1V6NA 2DCJA 1FATA 3ZPYA 1MVEA 2ZOEB 5H9RA 1GKBA 1SMVA 1QJX2 2B45X 4FOVA 1U5YA 1Z7S3 2WFPA 4FT8A 3ZYPA 4YVSB 3CJXA 2SBAA 1FMD1 3VKLA 4B7EA 1UAIA 2NPIA 2PAEA 3N7KA 1LEMA 3SXWA 1LOAA 1QJU1 1OD5A 4CEYB 3P3PA 1DYPA 1CIWA 1C8M3 4JRLA 5KHKA 2IXCA 3B69A 4RR3A 3AKTA 3AFKA 3VN4A 4XBNA 4FBFA 1N1YA 2LTNA 2QNKA 1RUI2 1NCRB 4XFCA 2BW8A 3IT8A 1ZZ8A 2XB6C 3SH5A 3ZXEA 4CP2A 1URXA 4Y5Z0 2JE7A 2NMNA 1KQRA 1X36A 4S2GA 2VH9A 2IXLA 3IM0A 3V0BB 2E9QA 1GANA 2NQYA 2X53S 3S30A 3ZSKA 4AE2A 4H55A 3JUUA 3ZSEA 5KHGA 2EIGA 1WW4A 2DVFA 4CDWB 4HVQA 3G6JB 3C2UA 1ZRDA 3GBWA 3VDDA 4E2SA 3WCSA 5BNPB 1HV1A 4AGVA 3H7YA 1BBT1 4YYOA 1RITA 3N3HA 3WG1A 5JSRA 4TYSA 2VVDA 3D5OA 4XETA 2PN5A 4LBQD 5DDJ1 1VBC2 2E7TA 4P9GA 5DZEA 2BQPA 3WNXA 4JGZC 2WIIB 1VBD2 4M3CE 4CP0A 3MICA 1FYUA 4KL1A 4YM2A 1POV0 1SLLA 4QQ2A 1G86A 1RUI1 2PHRA 1YRZA 1C8NA 5IK7A 3N35A 2VOXA 3LKJA 3LB9A 1ND3B 3WG3A 3O12A 3KZ4C 1XNDA 2RS12 3E5XA 2YXSA 1REFA 4R4XA 1ULEA 2VVFA 4XEZA 4OHYA 3ZX7A 2JG9A 2WJSA 4U36A 4XIOA 4FPKA 1FPN1 2ES3A 1OA4A 1O3QA 2CGPA 4WVWA 3M3OA 3CL1A 2R042 2ZGRA 3ATGA 1WMDA 1ZBE3 3M3EA 1GYKA 3ZFFC 5I0TA 1LB2A 1ZZBA 4ATFA 1XNKA 3JQWA 4YVWA 4RFT0 4GQ7A 1ZX5A 2JD4A 3KLSA 2BWAA 3PMSA 4JTOA 5C9AC 3J4UH 4OI0A 1ZZCA 4FOYA 1BBT2 1POV1 1IS5A 4LA2A 4B4QA 4XQWA 1AR93 3D6EA 4LBLA 4D3WA 1BKZA 2VMGA 2ZABA 5JIUA 1AVBA 1VB4A 1FMD3 3L2YA 2ZS6B 3KM5A 3MF6A 1ZREA 2GMEA 5LEKA 1LOFA 3I7DA 3IPVB 1DF0A 2Q4SA 3WXPA 4L11A 4BA6A 1D4VB 5CADA 2GZWA 4CEYA 1IGOA 1SDWA 3VKMA 4C0BA 3M70A 4OHXA 4UW6A 1N3OA 4YFWA 4R9BA 5C6CA 4FO9A 4YGCA 1U5IA 3AJZA 4RL7A 3H8UA 5FQ0A 2UYAA 4OULA 3R6SA 1NA1A 1OLRA 4L9BA 3HR9A 4NWVA 4QX5A 1DBNA 3J8F3 4UW4A 3H1YA 1APNA 3BOPA 5EWSA 5CFCB 2JG9B 4FTSA 4XJWA 1W6MB 1UF2C 1WUVA 4XTMA 4PIYA 1N3QA 3AMNA 4W6YA 3V56A 1RUOA 3CEWA 1PNFA 3S0MA 3RDIA 4YGBA 1VAMA 3HN1A 3SH3A 3IIAA 4S2HA 4LLFA 2VQAA 2ZHLA 1WBLA 1Z0HA 3B01A 2XG3A 3PVNA 2GC3A 3WP6A 1MS0A 2HWC2 4IV3C 2A6WA 2XBO1 3VZKA 4KH9A 2DTWA 1H9PA 5GZDA 3TOJA 3ZYIB 1VALA 4XTPA 3MLKA 3WY6A 4DNYA 4K8FA 1TMF2 3FBMA 5C9AA 1KITA 4D7YA 1HQWA 4QPGA 1OPMA 4LR4A 4AQSA 2DU0A 2WFF1 1UCXA 4FXGB 4IV1C 4FXKB 3BCWA 3WR0A 3N4MA 3O0WA 1B35C 3UJQA 1UIJA 4FVVA 1O4ZA 3BOWA 4JGYC 3G7DA 1LU1A 4AI0A 3URFA 4LNVA 3DKWA 4N53B 4BHPA 2A73B 4NHKA 1D0HA 1S0JA 1U5XA 4J1WA 1XNCA 3IN9A 3RS6A 2XLAA 2GC1A 1RUJ2 1RHI3 1O3SA 4CP1A 3POYA 4XF0A 5L7OB 2PHLA 3ASIA 3VHOA 4Y1XA 1Y3TA 4M3CF 3GNEA 1AXYA 2YMZA 4X8NA 1S0DA 2ILMA 4CDXB 3D0JA 2VMIA 4RHV3 5DUVA 2YGLA 1QJX3 2ARXA 1POV3 4QMAA 1KDMA 1Z7S2 2PHWA 4IEYA 3GBGA 1GICA 4HKLA 5K0UB 1KDKA 1VBB3 5FCCA 1DGLA 5CG8A 2WNVA 5T5LA 1HLCA 3LA2A 2VUAA 4FPGA 2RR12 3JBG3 2DCZA 2D3RA 2YUEA 1UU6A 2D6LX 2ZZQA 5HCAA 1DYKA 4CDWC 1RUD2 2DCKA 5T5JA 4META 1TNRA 3SNMA 4FOQA 2QZ2A 2ZMNA 3DPRC 4FAGA 1ULGA 4COWA 4CDUC 2K9ZA 4NN0A 2FBEA 4QHBA 4Y1VA 1AXKA 3MIFA 3ZXLA 3AMPA 2OZJA 4ORFA 4E4DX 1FI2A 5F5QA 1ZM1A 2A70A 3OYWB 4AHZA 1RB8G 1NA1C 2MEV1 5GLUA 2R043 1LOBA 3JCIA 1OOPC 1MS8A 1W6MA 2A75A 2PLV3 2NYYA 5HCBA 2GSYA 4C91A 1ZRCA 1PZ9A 5KWRA 4G3YC 5F6KA 4YM3A 2WZR2 1MS3A 2MEV2 5C8CA 2PQQA 1UN1A 3WT3A 4LEJA 3DUIA 1QHDA 2D7FA 2PHFA 3JD73 1OFNA 4J6GA 3WCRA 1OKQA 4QGMA 4GWNA 2E7AA 1LENA 4UXAA 1CAXB 3QH6A 1FNZA 4DPNA 4WVZA 3VBRA 3AFGA 2AH2A 3BALA 4AEDB 1ZVFA 3ZMOA 3HIFA 5DG2A 2EAKA 3VBSB 5KHHA 1EY2A 4RHV1 3ZN6A 2R1DA 3OGJA 4Q4X2 1VAKA 2QJVA 3K51A 2B46X 3LZZA 1RUC1 1LOFC 4M3CB 4W6WA 1V00A 3THPA 1VIWB 1KD7A 2XGXA 1YUDA 3HT1A 2ZZJA 4R52A 1IOAA 4EN9B 4K21A 1JYIA 1DGRN 2A3YA 4IETA 3IWZA 4LBOA 3ES1A 3SH4A 1U5ZA 1ENSA 4I0BA 2ZX1A 5FPZA 1UMZA 2XVKA 4XFIA 3RSJA 1K5MA 2GAUA 2P37A 1FPN3 4ATEA 2XVLA 1XYNA 4Y1YA 3IMNA 4J1XA 4QD2A 4TLFA 4GMP3 5CVRA 3S6PA 4IV3A 4YVWC 5GZEA 1ZRRA 2G9FA 3VBUA 4A2UA 5JMCA 4HPKB 4GB31 3CF6E 1RGSA 1VRH2 2BTVC 4LBQB 3VHPA 2XJPA 4KWJA 4LE4A 4MX3A 4BMEA 1MEC2 1C28A 4QPIB 2HEVF 2W52A 1EAH3 3AYCA 3KS7A 4G4FA 2XJTA 4E2QA 2DV9A 5CFDC 1EPWA 4LUKA 1OMIA 4PBPA 4G9SB 1KFUL 2JG9C 5ABJB 3UK9A 3MI8A 1H2KA 4AXOA 4RHV2 2ZGKA 1MEC1 3WD5A 1ND3A 4EN6B 1BK1A 1VR3A 1Q56A 2K0GA 2A3WA 4BMBA 4JQRA 2JXAA 4OUSA 1RUNA 1K5MB 4Q0UA 3U07A 2GH8A 2WKKA 2ARBA 4EWEA 4JGZB 5FMOS 3NAPA 1LCLA 1Z7S1 2XL9A 2CV6A 1RUJ3 1GR3A 1QGLA 1UX6A 2RMU2 3VBHA 4HPKA 4WM7C 3QCWA 1BYHA 4DQAA 4MXVA 5JZGA 3L2HA 1GV9A 3VL9A 1CAVA 4JVAA 4GH4A 3ZXGA 4EN0A 3ES4A 1PK6B 3USUB 2VNOA 2DFCA 2HYKA 1O5UA 5C8CC 1QQP1 5BY5A 1G9BA 1C57A 4Q8KA 1R081 1WCSA 1ZBA2 2P3JA 3VHRA 1HQNA 3N36A 4FQ4A 1WCKA 4JGZA 1ULCA 5JCTA 1CESA 2AR6A 1FXZA 3NSTA 4RGAA 5A3LA 4CYDA 2W39A 2RS51 4M0HA 5BV6A 1LEDA 4KGQA 3AK0A 3MEPA 4YW2A 4F8AA 1AYN1 2H0VA 3PJQA 4AFDA 1UZYA 5KXCA 2WFF2 3USUA 1MVQA 3SLIA 1YI9A 1QY4A 1RVF2 1QXRA 2BVVA 5JZGB 1MS5A 3MZHA 2X5IB 3BODA 3EO6A 1WLDA 3WLUA 3ENRA 4GIQA 3JB8A 1VB2A 2IZWA 1ONAA 2HWE1 3AYAA 4COUA 4XHXA 2LALA 3IDCB 2BFUS 1O4YA 1KRIA 2RS31 1A8MA 2XJQA 4Z92B 2OW4A 4GB33 2IXHA 2GNBA 1VBB1 2ZGLA 5E8AA 1DLLA 2Y38A 3ZN6B 2HWF1 4H7LA 4A7YA 1HKDA 3NVCA 2D5HA 1WLCA 2D6MA 4Q4W1 1A8DA 5B2GB 1ZA4A 4B4PA 1CAVB 5ABJC 4EJRA 2GN3A 1BQPA 2CY6A 1FOD3 4DY3A 4IEWA 4DS0A 2EF6A 1WW5A 2LUWA 3AZYA 4Q8LA 5T3NA 4YLZA 5I0SA 1CAUA 4P14A 3I2DA 3V0AB 3IBMA 4DXZA 3MIGA 2WNVB 5IK4A 4AQTA 4XFHA 1N47A 4JC1A 3WDUA 2R6QA 1W6OB 1CAXA 4XJUA 3VBRC 1QJY2 1AF9A 3VZOA 1UU4A 4EWDA 3MPBA 4QT6A 3ZIXA 3QH7A 5ACA2 1R1A1 1RMU3 4L2NA 1JTZX 1BMV2 1XXNA 1SFYA 2ETEA 1W0OA 1SCSA 4P5HA 1JBCA 3AP7A 4CEWC 1AL23 1RHI2 1ENRA 3S7IA 2A7AA 3SCGA 5AVPA 4M3CA 5SV8A 4MGZE 5A32B 1VBC1 2OZ6A 1QH7A 2AREA 1Y9QA 1PHMA 1UKGA 3ZXKA 1AR81 1YCIA 4JRAA 1LGCA 2O0OA 2HWD3 4LO7A 1XRUA 2V5YA 2VXRA 1NCQB 3OD0A 2BGCA 4JCKA 4OZXA 1V9U2 3OYWA 5CFDA 4C1XA 2VOVA 1WBFA 2WA4A 2H0BA 2XKOA 1R091 4ES8A 4FPLA 1PVC1 4COZA 1DQ5A 1HRV3 1DG6A 5I8SA 1AZDA 2E53A 3MW3A 3VBFB 1V6IA 4QPYA 4SBVA 4M01A 1ASJ3 1Q8OA 2XJRA 2WC2A 1RUC3 3KCYA 4WM8C 1C5HA 5JWPA 5T54A 1QNWA 1SBFA 2NMOA 2VOWA 4AGGA 1GZWB 5LK7B 2DF7A 4QQPA 2DU1A 2V73A 4XHBA 1H8TC 1LHUA 2ZJCA 1IS6A 5J98B 5K9YA 3FZ3A 3M4FA 4AHYA 4PQ9A 1QJU3 1G9CA 1QJZA 4BH9A 4LHNA 4L92A 4XILA 3D8CA 3IKWA 1ZNPA 3GZUC 2NLRA 4YVWB 4W6XA 5GJ6A 2DURA 4YZ5A 3KSCA 4X6RB 5FRAA 4AI1A 1IS4A 2WNEA 4GH4C 1HV0A 3AXEA 2XPJA 5A32A 4CDQA 4DOUA 1NY71 3NWKA 4OFGA 1FNYA 4XJ8A 2MEV3 3VBHC 1MZ5A 2OUJA 1DGWA 1O5LA 1H9WA 4S2DA 1Y43B 4Q29A 5D1IA 2LM3A 4Y24A 4E2GA 3EJKA 4IV3B 3MIEA 1HXS1 4QM9A 4XBLA 3KQRA 4FPCA 2R041 1TEIA 2ET7A 2R071