2EIGA

Lotus tetragonolobus seed lectin (isoform)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
VSFNYTRFKDDGSLIFQGDAKIWTDGRLAMPTDPLVNRTTSHALYATPVPIWDSATGNVASFITSFSFIVSNVQRYPPTDGVVFFLAPWGTEIPPNSQGGYLGITDSSNSQNQFVAVEFDSHPNVWDPKSLRSSHIGIDVNSIMSLKAVNWNRVSGSLEKATIIYDSDTKILTVVMTHQNGQITTISQEIDLKTVLPEKVSVGFSATTWNPERERHDIYSWSFTSTLKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Identification of a new quaternary association for legume lectins
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eigA00
1URXA 4AWDA 3W59A 1BYHA 1FX5A 4JCKA 4ATEA 4BMBA 1R1ZA 4YG0A 1MR5A 3O0WA 2ZMNA 1G9DA 1ULDA 2W68A 3R05A 4I30A 5IK5A 5IK8A 2DVBA 3WCRA 1W6NB 4FPYA 1YXWA 2D3RA 1JBCA 5IK4A 1GYKA 1G7YA 1S0IA 4XDQA 1F31A 4D69A 1V6MA 2ZGPA 4M3CB 1N1YA 5EWSA 5GZCA 5E8AA 4XHBA 3USUA 3ZXEA 2ZHLA 2WKKA 5DUXA 2ZA9A 3WDUA 3FFZA 4XIOA 3NV4A 1WD3A 1WW6A 1GZCA 2VW2A 2AYHA 3IMNA 3Q9OA 1QOSA 2WNEA 4XIKA 4LBQB 3O0VA 3NV3A 2ZMLA 1LU2A 4YGEA 1S0BA 5T52A 4CRQA 2DVGA 4XBLA 3B9CA 3ZSLA 1BXHA 1OKQA 4W65A 1W6MB 2A6YA 1QU0A 3AXEA 4IQPA 1JYCA 2GALA 4LBKA 2NM1A 1ENQA 4K1YA 4WVVA 3SISA 3V64A 3T2TA 5JOZA 3O5SA 4FPLA 3V0BB 2Z42A 1DFQA 3C2UA 2ZHMA 4TZDA 1GZWB 4P9XA 4PBPA 3V65A 3NV2A 1IOAA 1NLSA 1MS1A 2W52A 1IS3A 2R1DA 4Y1UA 4YZ3A 3WG4A 4ATFA 5JVVA 3FLPA 2A6VA 5LK5A 1QGLA 1V6LA 4XJ8A 2A70A 3R4UA 1YO8A 2D3SA 4AVVA 1LHOA 1N1VA 2DU1A 4C1WA 2A75A 4XXAA 1AJOA 5JOWA 3A4UA 2PHXA 2A7AA 4CTEA 4F83A 1MS3A 5SV8A 4RL7A 1QOTA 4XBQA 4JC1A 5T5OA 1DQ5A 1GV9A 2V73A 1YI7A 3N7JA 4P9WA 3VKOA 2C5DA 1JXNA 1LU1A 3OYWA 4AVSA 2ARXA 1C4RA 4YW4A 1DIWA 4YFZA 1G9CA 1G8WA 1LOFA 3N7KA 1MS8A 1VLNA 1W6PA 3M1HA 4BM8A 4YFWA 2NN8A 3AP9A 1I3HA 5T54A 1LJ7A 1AX1A 1QMJA 1GNHA 5GZDA 1MZ5A 5IT6A 2GNBA 3AXDA 3ZXKA 4CZSA 4Y1XA 1PZ7A 1MS4A 4Y22B 3APBA 3N35A 2A5ZA 1G9FA 2CNAA 4GALA 4YM0A 1W6QA 4FQ4A 4YGBA 4FOWA 1QOOA 2V5YA 4ITCA 3ZPYA 2W08A 1ONAA 1JOJA 2UWAA 3AYDA 5GLUA 4ASMB 3N36A 3PMEA 3BIWE 3M3OA 3N3HA 1H9PA 4NOTA 5DZEA 1LGBA 3WOGA 1LOCA 5DZFA 4P9YA 3WHTA 2A6ZA 2ZABA 3D4KA 3KQRA 2CWSA 5T5PA 1MS5A 1LOEA 3POYA 2D6OX 1DQ1A 2A71A 3RRDA 3MW2A 1Z0HA 2DUQA 4BQ1A 2ZZJA 1IS5A 4K1ZA 4YG3A 2D7FA 4DFSA 2ZACA 4Q8LA 1FATA 2ZHKA 3UJOA 5CAZA 1AX0A 4FQZA 2DV9A 4GA9A 1CONA 2ES3A 4XJWA 1LGCA 1MS9A 4PQ9A 1FYUA 2JKBA 1GNZA 2E51A 3ZVXA 1GSLA 2CTVA 4NO4A 4FP2A 3M3QA 1GLHA 3FUOA 1W6NA 2EF6A 5GJ6A 4P14A 4XTMA 5T55A 5GZGA 3V0AB 1A8DA 2NMOA 4AGGA 3VUOA 4YGCA 1AZDA 2A6XA 2SBAA 2ZGQA 1B09A 1SBDA 3KM5A 4M3CA 3ZYRA 2CY6A 5H9RA 4FPJA 3ZSJA 3DUIA 5DXDA 4ISQA 1RINA 3ATGA 1UPSA 4LBQA 2PHTA 4M3CF 4BLIA 5GZFA 3AZZA 1LESA 1PZ8A 4WV8A 1F9KA 3WNXA 4FPHA 2EXHA 3SLIA 4AGVA 3LSDA 4YG6A 4Q8KA 2VW0A 1N1TA 1QF3A 1W6MA 5EYYA 1A78A 2EIGA 3A0NA 3WV6A 2LALA 3V0BA 2WJSA 1SLCA 2P37A 2YY1A 1WW7A 1GZWA 4FP3A 4XBNA 5GZEA 1LODA 1Q56A 1Q8VA 5KXEA 3OJBA 1O4ZA 4R9AA 1IS4A 3N7MA 5GLWA 1X50A 4XXPA 4XMIA 4XE9A 3VKNA 1IS6A 4XJUA 3AZXA 2DURA 1GBGA 4R9CA 3WDTA 1NXD1 1S0CA 3WUDA 3ASIA 4U2AA 2H0BA 3U4XA 4XHXA 1SCSA 2AENA 2CYFA 1V6OA 2WLQA 4LBJA 2CL2A 2A3WA 1VAVA 5CBLA 1WCSA 4R9DA 2R0FA 1S1AA 1QNWA 3PVEA 2EXKA 4PBOA 4TYSA 1V00A 2AGSA 2DTYA 1Q8PA 3HMYA 4AGRA 4Q1PA 2E6VA 3L2YA 4UW3A 3ZSMA 3WUCA 4K20A 2E53A 2EAKA 4YZ4A 1DQ0A 3AX4A 2ZGRA 3AK0A 4PCRA 5CA6A 1YYNA 3UL2A 1H9WA 4BLJA 3WG1A 4DPNA 1KRIA 1KITA 2PHFA 1UN1A 3T1LA 1S0FA 4FPGA 5FRAA 1UAIA 3QCWA 4Y22A 4AYUA 1V6JA 4ZXKA 5JLVA 4FPFA 2D3PA 4YW2A 3D5OA 3HN1A 2UURA 3PVOA 3A0KA 5H9SA 3NV1A 4YW1A 3B01A 1UZZA 2Q5TA 1DYPA 5F5QA 1D2SA 3W58A 2AREA 3WDXA 1LHVA 1KQRA 3FLRA 2ZGOA 3M3CA 4FPEA 3OY8B 3WLUA 1LULA 4FOQA 5E88A 3LCPA 2PELA 1QDCA 2D6NA 4YM2A 2ZGMA 4JRAA 5EYXA 3WDWA 4U36A 3ILFA 1EPWA 4YGDA 5DUVA 5DUWA 4BMEA 3B00A 4Y24A 2AH2A 5GLVA 2ZGKA 1LOAA 4XJZA 4Z8BA 3FUQA 2YXSA 3BOPA 1LGNA 1ZM1A 1MVQA 4M00A 3NWKA 2GN7A 2VY0A 1DZQA 4Q2FA 5GM0A 3SNMA 1QNYA 2TEPA 3AFKA 3QLQA 3AZYA 4XTPA 4M3CE 3V0AA 3POSA 2R16A 3AYEA 1C57A 2UWBA 3PJQA 3PVNA 5DG2A 1HKDA 2VXRA 2A3XA 1TEIA 5E89A 1C1LA 1HQWA 5JMCA 1S0DA 1CJPA 1LOBA 2AUYA 3ILRA 1N3PA 1PZ9A 2FMDA 5H9QA 1LHNA 1HLCA 2ZGTA 3RG0A 2EXIA 1FV2A 2VW1A 3POWA 3IM0A 1CVNA 3IPVB 2D6KA 1UKGA 4XJAA 1AXYA 4UW4A 1LECA 4XOGA 1LOFC 2P34A 4SLIA 1U0AA 2ZHNA 2VU9A 1CPMA 3MW4A 5CB7A 3FLTA 4XYXA 1Q8OA 1SBFA 1W0OA 1ZA4A 5H9PA 3B3QE 4GKXA 1WUVA 3ZYPA 1WBLA 1LEDA 1SLAA 1ULFA 4FPCA 2WSUA 3O12A 1LCLA 2DUPA 4FOVA 2JDZA 1WBFA 2P3JA 4FPKA 1WLCA 1DYKA 1WLDA 2YROA 1APNA 1MVEA 1RIRA 2A3YA 4K21A 1WD4A 3SH5A 4L8QA 3VV1A 1LOGA 1LTEA 2SLIA 4XILA 1BQPA 3RS6A 4R9BA 1MZ6A 4KBBA 3ZXFA 1Z78A 1Q8QA 2W39A 1J1TA 3AP4A 1VIWB 3SITA 3ZXLA 1LEMA 2GNTA 2I2SA 2FHRA 1GKBA 2G4IA 4AVTA 4LBLA 4YZ1A 2YV8A 3MW3A 3BODA 1G9AA 2GMEA 2GMPA 3HR9A 1N3OA 3WG3A 1JN2P 2DYCA 2ARBA 4FOYA 3ZXJA 1FAYA 2DVDA 2YZ4A 4LBQD 1CN1A 1ULGA 2PHWA 5T50A 2JJ6A 1LHUA 3ILNA 3BTAA 1SLLA 5DZGA 2LTNA 2NP0A 1GICA 1KDKA 2ENRA 2ZKNA 2ZGUA 4WVWA 5AVAA 4DRVA 1A3KA 2HYKA 1WW5A 5KXCA 3AZWA 3GNEA 1WLWA 1HQLA 4YM1A 1CR7A 1CQ9A 1N47A 3RQ0A 5IK7A 1UZYA 1Y7BA 1D0HA 2WT0A 2R49A 2XG3A 1V6NA 2GNMA 1H30A 3OY8A 3SH3A 3VKLA 3WG2A 5HCAA 3O0XA 1AXZA 1LHWA 2ZGLA 4Y20B 1W6OB 2OVUA 2NZ9A 2VUAA 3M3EA 1G9BA 2D6PA 2P3IA 3H0OA 1DQ6A 2WQZC 2JECA 1IKQA 1SLBA 1KDMA 2XB6C 3WHUA 2A6WA 2NMNA 5KXBA 1KJLA 1UX6A 1CPNA 3GALA 1S0EA 3TB0A 4HANA 5BYNA 1RITA 5GLZA 4Q27A 2P3KA 1SFYA 3VKFC 3MEPA 2E7TA 4GWMA 1MS0A 1O4YA 1DQ2A 3MPPG 4YW5A 3OGGA 2P2KA 1DGLA 1FV3A 5JDBA 2EXJA 3I8TA 2KM2A 3USUB 4XMAA 1AVBA 4MYEA 5CNAA 1DHKB 2UWCA 2B7YA 4YZ5A 2WT1A 2AR6A 1QDOA 3AYCA 1UMZA 2PHUA 4UW5A 3WVJA 5EXOA 5FREA 1KJRA 1AF9A 2DVAA 4LBNA 1XQNA 1ENSA 1WW4A 5F9TA 1N1SA 2D43A 2E7QA 2GMMA 3WZ1A 4GXLA 2UU8A 1GANA 4YW3A 3SH4A 3VKMA 2GN3A 3IPVA 5T5LA 3TAYA 3LSEA 1BKZA 3B69A 3IN9A 1S0JA 5DG1A 1DQ4A 2ZGSA 4Q26A 2JD4A 1JUIA 1Q8SA 2BQPA 5GALA 4LBMA 1W0PA 1G86A 2PHRA 1V6KA 3ZSKA 4Y1YA 1DBNA 5KXDA 4GWNA 1CESA 4YLZA 1I1EA 4ISRA 4LBOA 2C9AA 3RMYA 2JE7A 3AJYA 2GDFA 1FNZA 4RA0A 1F5FA 2WSVA 5GLTA 4DQAA 1JYIA 3AYAA 5HCBA 4YM3A 1YRZA 4Y26A 1V6IA 2ZBJA 2EALA 3CNAA 3OYWB 3WDYA 1DLLA 1GZ9A 1SLTA 2VH9A 4UW6A 2RHPA 1JHNA 3WCSA 4ZKTB 3DGTA 4Y1ZA 1OFSA 1W6PB 4DS0A 1C1FA 1QKQA 4Y1VA 1ENRA 1SBEA 2ZGNA 3JUUA 1SACA 3IKWA 5DUUA 2YMZA 3JU9A 2GNDA 2OW4A 3AJZA 3I4IA 2ERFA 3INAA 4DRRA 1SLIA 1LENA 5T5JA 2DTWA 4XJ9A 1S0GA 3FBYA 3RMXA 1IKPA 4YZ2A 1ULEA 2D6MA 3AP7A 1HDKA 3WDVA 4OZXA 4BOWA 1W6QB 2DVFA 1BJQA 2DUOA 3UK9A 2DWRA 2R1BA 3N7LA 4HL0A 5HCFA 3R4SA 1UL9A 2R0HA 1VAMA 2D6LX 2ZAAA 4H55A 4XZPA 5L73A 2D44A 1AJKA 3ENRA 4FVVA 3OBRA 1N3QA 4M01A 4C1XA 5JOYA 4BPZA 1JW6A 2OUJA 3OBTA 2OUHA 4Q1RA 1MACA 2DU0A 3AP6A 1SCRA 1VALA 1CIWA 2NYYA 3T1MA 4WZFA 3UJQA 1OQ1A 1YIFA 1ULCA 4GKYA 4Y20A 1AX2A 1W6OA 3D6EA 2ZMKA 1AXKA 2WT2A 3AZVA 3M2MA 1BZWA 3OPZA 1FNYA 4PF5A 4FPOB 3RSJA 2JE9A 2CWMA 5JOXA 5IUQA 3AP5A
chains in the Genus database with same CATH superfamily
1XOYA 1AYM1 1URXA 2VZ3A 2Y60A 5LBBA 4I3GA 4RD7A 2R30A 1BYHA 5LRSA 2XLFA 4JCKA 1Y43B 3Q8AA 4RN5A 4BMBA 1NLRA 4CPBA 4OYUA 4BK5A 5IK5A 5F1RA 3ZFFB 2JE8A 3WQ7A 4AFDA 2D3RA 3CZJA 2P6HA 4CP9B 2Q1ZB 5IK4A 5HXMA 4CCMA 1S0IA 1V6MA 3HNMA 4M3CB 1N1YA 4N53C 4XHBA 2ZCWA 5C7GA 2C6SA 4LJHA 4BK4A 1MEC3 4S2DA 3NV4A 1ZRFA 4XIKA 1FT9A 2FBEA 3Q9OA 1QOSA 2WNEA 4A3XA 1HV0A 4LBQB 2ZMLA 1LU2A 2QQLA 3DPRC 3O1MA 4XBLA 2XQXA 3AL5A 4H14A 1BXHA 2FZ1A 3ZSLA 5J36A 5L9VA 2BV4A 1OKQA 4HN1A 2A6YA 2XL7A 3VBSC 1SEFA 5CU1A 3A23A 3O5SA 4WM8A 4EWDA 2Z42A 5K0UA 5DAQA 3AB0A 4DINB 4AAPA 2QJVA 2VMDA 2X5IA 5FZ3A 1BBT1 2PAEA 3V65A 3NV2A 4DY5A 1IOAA 1ODNA 3OF1A 1NLSA 5J09A 2PQQA 3HQUA 3LGRA 4J6GA 1JOBA 1NCRC 1XNTA 1XPWA 2R1DA 4S2GA 4C0HA 3FLPA 1RUJ1 3LEMA 2ID4A 2XJQA 4LA2A 5LK5A 5IHRA 3KB5A 3DYPA 2A70A 3R4UA 3WP5A 1K5MA 1HRI1 1N1VA 2E26A 2DU1A 2YGLA 4URTA 4XXAA 2Q8EA 3A4UA 4MX3A 2A7AA 2J22A 5FY0A 4EYUA 4CTEA 1MS3A 4XBQA 1H4GA 2RE9A 4F7ZA 3CJIC 2OT7A 2GP3A 4QPGA 1R64A 1G6NA 2C5DA 2PQSA 3OYWA 3JD72 1PIV3 5A80A 1C4RA 2AEZA 1RB8G 1G8WA 4PDWC 2WAAA 2B5HA 4I0AA 2I74A 3M1HA 4BM8A 4AHZA 3AP9A 4ONUA 2HBUA 4GD4A 1LJ7A 1DZTA 1CX4A 1UZVA 1ZBE1 3OD0A 1GNHA 4Q0PA 3WP3A 1LKNA 4JGYC 4W6YA 3F2ZA 2P17A 5GZDA 5G04L 4MSVA 4Y1XA 3A21A 1PZ7A 2X8KA 2Y33A 3ZMNA 3N35A 1G9FA 5CKQA 1VBE1 4FQ4A 2V4VA 1H8TB 2RDNA 4YGBA 4FOWA 2V5YA 2O0OA 1MPXA 3T3YA 2W08A 5GLUA 1JZ2A 3BU7A 3AYDA 1UYXA 1WCQA 3LDBA 2YBSA 4PLMA 5FZ4A 3N3HA 1JTZX 4LHLA 1LGBA 1YQ8A 1LOCA 2G9GA 2WZR1 1UOFA 1ODMA 1W9TA 4KL1A 4P9YA 1GQGA 2FDFA 3KQRA 4RGKA 5J96B 2XLAA 4K3UA 1JZ6A 2Y64A 2XJVA 2RS32 2VECA 4LIVA 2A71A 4P9LA 4XFHA 3RRDA 1XJAA 2E63A 2DUQA 5FKBA 1WWYA 1IS5A 1W90A 5F39A 5ABJC 1POV0 2D7FA 3SCGA 1W2AX 2VZSA 1CD3G 4G4FA 2ZHKA 4HETA 4EE2A 1AX0A 4N7IA 5CAZA 4FQZA 1YFWA 4GA9A 5BUVA 2ES3A 2DCJA 4JVAA 4PQ9A 3I3MA 2JKBA 5FZHA 3KCCA 3ZVXA 4FI9A 1VR3A 1RUE2 4FP2A 2Y6LA 2RJ2A 4C8DA 2OQ7A 3NO8A 3FUOA 2EF6A 3V0AB 3VZJA 3RZLA 3JBG3 2NMOA 1COV2 3ZYIB 3VUOA 3AFGA 1AZDA 2VOTA 1SBDA 4BQXA 1GOFA 3M3IA 5C8CA 4LT5A 3H42B 1RUH2 1JI6A 3GZTB 3NAPB 4OI4A 1IHMA 3FZ3A 4IUGA 2LUWA 4FPJA 5CFDB 4BIFA 1W06A 4TXWA 5DXDA 2MEV1 3LE0A 4QHZA 1A6CA 4CDQC 1Y9MA 2LROA 4SBVA 3BOWA 1LESA 4JX0A 3WNLA 1AYM3 1F9KA 1V9U3 1XYOA 5F2WA 4E4HA 1QJY3 4AGVA 4YG6A 4FCAA 1N1TA 1W6MA 4KG0A 5JSPA 5LY1A 2ET1A 2EIGA 4S2FA 1W9YA 3A0NA 3V0BA 3RZJA 1BMV1 2PN5A 1ACCA 1GZWA 4XBNA 1LODA 1YC61 4HZFA 3S7EA 4AEDA 1O4ZA 2XBO1 3PTRB 2MHFA 3PMSA 1RUG1 5GLWA 1X50A 3RFRA 4B7KA 2V72A 4XE9A 3VKNA 2VZ1A 4CVUA 4XJUA 5KHGA 2JG8C 2DURA 1XNDA 2QQMA 5J7MA 2Z4FA 4R9CA 3UETA 3WDTA 5JI9A 4HT1T 4U2AA 4A42A 1SCSA 2CYFA 3ECQA 4TSVA 1HJFA 1W8TA 5A33A 2XKOA 4GZ9A 3WINE 4K9SA 2JIJA 4LLOA 4LXLA 4NHXA 4E4SA 2R0FA 1NQDA 4MG2A 5C3QA 4PBOA 1HXS3 1V00A 2DTYA 4ET7A 3WEZA 2E6VA 1GP4A 1Y3TA 3ZSEA 2Z69A 2EIBA 1ND2A 4AEDB 5AFEA 2E53A 1RVF2 1KGYA 2EAKA 5IFPA 3WD5A 1DQ0A 3A22A 2ZGRA 1QJX2 3QOPA 3AK0A 4PCRA 5EP9A 3VHRA 2W95A 2BNNA 3VDDA 5C5TA 2RM22 3DXTA 3OEAA 2K2SA 1H9WA 4UBGA 3UL2A 1LB2A 4DPNA 1KRIA 1KITA 5ANNA 1H2KA 1S0FA 1HRI3 4PIYA 4Y22A 4AYUA 3PUQA 4ZXKA 4FPFA 4NHKA 4XFGA 2D3PA 4A7ZA 5AC92 4Q4V3 5FZEA 4D0QA 3LAGA 3PVOA 4GIQA 4OZOA 1EAH2 1ZRCA 2GH8A 3VHOA 4EZHA 5A3MA 2JB8A 1DYPA 3U0ZA 3RZKA 5LBCA 5BNPB 2AREA 5FY4A 1UCXA 2WZEA 1LHVA 4LE3A 5J48A 2ZGOA 3M3CA 3OY8B 1UY4A 3IAPA 3KCXA 4AQ6A 4R4ZA 1AR81 3LIHA 2JWPA 1R1A2 4GWIA 4PT6A 4FSJA 1ZBE3 4RS5A 3WDWA 5EYXA 2RG4A 3ILFA 4HBNA 3U11A 3C8XA 4HOOA 3RYPA 1ZBA2 3NNJA 4YGDA 5HBAA 1ZZ8A 3ACIA 3B00A 5F8PA 3I2IA 3HNYM 3IB3A 4AQ2A 4D7SA 5CEHA 1O6UA 2QCSB 4ZXEA 3LOBA 3S6PA 1LGNA 2CSGA 4DUXA 3TBDA 1MVQA 3NWKA 1HB1A 2VY0A 1DZQA 3H3LA 2WZR3 4RQPA 3QLQA 5B2GB 3I3BA 4IEQA 1OLRA 4WM8C 5IWFA 3LPFA 4DEQA 4M3CE 2HJIA 1QXRA 1QQP1 3IWZA 1WCDJ 4D7YA 5A6XA 2JDAA 1RHI2 1NA1B 1SFPA 3DECA 3MV01 3PUSA 3VBRA 5A3UA 1AYM2 1GWLA 2A3XA 3I2JA 2WABA 2XUMA 2R071 3VBFB 1HQWA 4TWTA 5JAXA 4M4RA 2QTWB 5L7OB 4OMDA 1CJPA 3BU0A 4QMAA 1UY2A 1VBD3 3WR0A 1K5MC 4WM7B 2WS91 5H9QA 1WCKA 2FQPA 5LATA 5FYVA 3JQWA 2WDBA 4XUOA 1R081 2ZOEB 3JQXA 4OFGA 4HMZA 2VMHA 4LA3A 4EZ4A 4QPGC 1OVSA 1US3A 4HK9A 4LHNA 4XJAA 1D0GA 4A7YA 1K42A 2ZS6B 4Z82A 2O8QA 2P34A 1U0AA 1TE1B 5FJKA 3MW4A 3FLTA 4D6RA 3DKWA 2VVFA 1ZA4A 5H9PA 4FO9A 3VBUA 3NKTA 4Z07A 2BNMA 5CYYA 3N9OA 4A41A 1HN0A 1W03A 3S5QA 2W3JA 4JZRA 4LPLA 4J25A 1LCLA 2MEV3 4MXVA 4PJYA 5C9AB 3BKZA 1TMF2 1DYKA 4ZU7A 2YROA 3GGLA 1RUC3 2GZWA 3ALQA 3VZLA 3X29B 2IVJA 3PVBB 4OHYA 3P3NA 1BBT2 3DKQA 4LO5B 4P02B 2VXJA 1RTVA 2F6BA 1WD4A 4K21A 2KA3A 5FO7B 3O1SA 2SLIA 4R9BA 1MZ6A 3ZXFA 4JKMA 1YQ5A 1Z78A 1RUJ2 4CDUA 3AP4A 3H1MA 5A7WB 4DXTA 1DGWA 2YPDA 5FLJA 1LEMA 1HRI2 3UGFA 1GKBA 3H3UA 4AVTA 2IFWA 2N7GA 3MO4A 5EHDA 1G9AA 2XBO3 4QQ2A 3H9AA 1RUG3 5IVYA 3POEA 1C8M1 1ZRIA 2CAUA 4QHOA 4XUQA 4ZS2A 1FAYA 4K6BA 4LBQD 1WCUA 3THDA 1CZTA 1OFNA 2VMIA 2ZEZA 4XCAA 5FZ9A 3ILNA 3HQXA 5DQ0A 1NXMA 1BLZA 4EN8B 2ZKNA 2ZGUA 1WA4A 1OF3A 1ZBE2 4MXWB 3IDCB 4CPBD 1TG7A 4XDOA 1K45A 4GJYA 4P00B 4YM1A 4LE4A 1N47A 2XG3A 5I8SA 4N43A 4PHZA 1H6XA 2R49A 4OVEA 3WG2A 1H30A 2UY9A 3VKLA 4ZZ8A 3PURA 1VBE2 2ZGLA 1W6OB 1K12A 2D6PA 3FL7A 1RMU3 1REDA 3I2DA 3GHMA 4ASKA 3VBOA 1KDMA 2XB6C 2ORZA 5FY1A 4BE3A 5KXBA 2WZR2 4KI5M 1IGOA 4YNIA 4MGTA 5GLZA 3OPWA 5FYMA 3HIFA 1SFYA 2VCMA 2W94A 1OC1A 3L9JT 3FHAA 4OUMA 1QJEA 1KFXL 5K8SA 2E7TA 3E97A 4CCDA 4CEWA 3NJXA 4GWMA 1MS0A 1DQ2A 3OGGA 5C8WA 4NIHA 4OUEA 1DGLA 1CAXA 2EXJA 2XQRA 3I8TA 3KLSA 1AR83 3USUB 2XVGA 5BY5A 1AVBA 4AEDC 4MGQA 3T2OA 2B7YA 4CUCA 3AVSA 1ZZ7A 4RSUA 1Z7S1 2WT1A 3AYCA 3NNFA 4Q4W1 3DYOA 2BGPA 4FFFA 3VBOB 4AHYA 5LEKA 2Y8KA 3WVJA 5F37A 1XRUA 5EXOA 4HKOA 5FREA 1ZREA 1H2NA 1W2OA 5BXXA 1AF9A 4E9KA 1ENSA 1WW4A 4RHV1 4QX5A 5FZBA 1D4M1 3WZ1A 5FQ0A 3SH4A 5IVEA 2PAKA 4EWEA 3IPVA 1C5IA 3ZDSA 2R041 2VNRA 3LSEA 5FYZA 1FPN3 3B69A 4HLTA 4FFIA 4QX8A 5FZ8A 5K9YA 4PQQA 3H1YA 1DQ4A 2XGXA 3CL1A 3ACGA 1QQP3 1Q8SA 2WBKA 4XC9A 2BQPA 5BNOB 2JICA 4UF0B 1PO21 1ND2C 4LBMA 4ZONA 1Q3EA 1W0PA 2F4PA 5FXWA 2BBVA 1G86A 4O7XA 2R073 1DBNA 3VDDC 4GWNA 4ISRA 2XWBB 4EQVA 2C9AA 2JE7A 1I9RA 3D3AA 4F3JA 1OH3A 2W46A 5LA2A 4ASLA 2YC0A 2BPA2 1BMV2 3AYAA 5HCBA 1AUYA 3FJSA 4HVQA 2TUNA 5FLHA 4URAA 2W1UA 2EALA 4IV3B 3WDYA 4AI0A 4D7TA 4P9IA 3ZN6A 2VUCA 1RUG2 1SLTA 1OMIA 2J1TA 4M0HA 4Y1ZA 3HWJA 4NWVA 3WNOA 4W4ZA 1SBEA 1W05A 1SACA 5DUUA 5FIXA 4Z92B 1AYN3 3INAA 3I4IA 3AJZA 4FXKB 3ZFGA 1SLIA 1LENA 4EJRA 2Z2SB 5FBZA 5KHHA 1S0GA 3P5BA 2GH2A 3WNNA 5KBFA 2RS11 2J7MA 4EWAA 5L7OC 2D6MA 3ACFA 3ZXAC 1T6BX 2QQIA 4OUSA 3NVCA 1OQDA 1CAWA 4WM7C 5BNOA 2DWRA 5FMBA 4HL0A 2JB4A 4CDXB 1POV1 2R0HA 4H55A 4IV1A 4XZPA 2IWGB 1MZFA 1DGRA 5L73A 2B45X 3VGIA 4BA6A 3OBRA 1N3QA 4M01A 2OX0A 4C1XA 4YSFA 1JW6A 1O3RA 1NQJA 3AP6A 4AFMA 3PJYA 3RPQA 2XONA 2QQPA 4O9EA 2DBNA 4A3ZA 2AZ5A 4N9HA 1QJU3 4HPKA 2DFBA 2ORXA 5BNQA 3ZFGB 4Y20A 3VBRC 3D6EA 2BU9A 4MLOA 1AXKA 2G9ZA 4YW6A 3VBHB 1BZWA 2VBPA 3ACHA 5FMDA 3S7IA 1HN1A 2JE9A 1R091 4QGMA 1W8NA 4OHWA 4GB33 4DY3A 4LO4B 2XJTA 4AWDA 3H8OA 3W59A 4AI1A 1AR82 3ON7A 4GWJA 2Y6GA 2IC1A 2QUOA 2Y6HA 5FY9A 1MR5A 3O0WA 1OKOA 2VZVA 2ZMNA 5LCWL 2ZTNA 3B5LB 5IK8A 1W6NB 5A1FA 4N9IA 4B4QA 1JBCA 2P4EA 4C90A 4GQ7A 4D69A 4LO7A 2ZHLA 5DUXA 3VBUC 2ZA9A 2UYAA 1CIYA 3ZXDA 1MEC1 1WD3A 5FZMA 1YJLA 2AYHA 2HYXA 4R52A 4YGEA 1S0BA 1S2EA 4LULA 4GH4A 1JZ5A 2FDKA 3TEXA 4AG4A 3K51A 2W9XA 3WY6A 4IEVA 2FDHA 4W65A 1QQP2 2J1UA 3AXEA 3V64A 2WR9A 3NJYA 4K1YA 2QFEA 3T2TA 3OB8A 1HRV3 4OHXA 3LQCA 1YQ6A 1CAUB 3MYXA 1KS4A 4I09A 1SZBA 2ZHMA 2ILMA 4P9XA 4CDUC 1YUDA 3LB9A 5I0DA 2JDUA 1MS1A 4Q4X1 2WS92 1QJZA 1FMD3 1W8WA 4ATFA 4DUVA 1MQTB 5FTTC 5J37A 1KD7A 1Z7S3 3P3PA 4C91A 1R082 2GC1A 4XJ8A 5FK7A 2HEWF 1VPHA 2D3SA 3AVRA 4E2GA 1GMMA 1EV12 5D8AA 3EMRA 1AJOA 4NMIA 4AK3A 1REEA 2PHXA 4KNCA 3MF9A 5JI7A 3AKRA 4XURA 3ZYJB 1NAEA 3HPNA 2V73A 1TNFA 1YI7A 4P9WA 3VKOA 3IBMA 5BPXA 2EIEA 4YW4A 1DIWA 2EA7A 1AR63 5DAPA 4DMIA 5EIYB 1CAVA 4Q0SA 5FPXA 2OZJA 5CKNA 1W6PA 2Q4SA 2ZZQA 4YVSA 5T54A 1I3HA 1L7QA 2R7EB 2UYBA 4E8CA 2QDRA 1SQ4A 2OA2A 3WXPA 1MZ5A 2JX9A 4FFHA 1JYXA 4BQ5A 2IZWA 1VE0A 3ZXKA 3TEWA 5FPLA 3VBOC 1XYNA 4GMP3 1PNGA 2A5ZA 4IE6A 1X7NA 2CNAA 4YM0A 5I93A 3O1TA 3BUCA 1W6QA 4Z2WA 1O4TA 1WLTA 4ITCA 1XYPA 2AC1A 1W04A 1NG0A 1ONAA 2UWAA 5EFUA 3RI8A 1UW8A 3ZPYA 5IAXA 3PMEA 1YWKA 4JGZB 1AR71 4YZ3A 3F95A 3BIWE 4CU6A 3LEKA 5FZKA 1H9PA 4NOTA 5DZEA 2OKXA 5DZFA 4AQSA 3WHTA 1U5XA 1C8M2 4YVWA 4CEWC 3C7EA 4J1WA 1ASJ3 4LKSA 5FZIA 3FBMA 3POYA 2D6OX 4CDWA 3NRUA 2HWC1 3BIEA 3LKJA 4BQ1A 4CCEA 4NHYA 1OH4A 1JUHA 4N8MA 1GWKA 2X53S 4MUVA 2WL1A 5LA0A 5HV4A 3DCQA 4L97A 5HPOA 4XF0A 1CONA 1W8FA 2QZ2A 1MS9A 3PIJA 4XJWA 1FYUA 1XE7A 5L9RA 1POV3 2OPWA 1GNZA 2Q30A 5HV0A 1NZIA 1NCQB 3IDAA 1DF0A 2CTVA 4NO4A 2AACA 2O1QA 5A6YA 3ZFFA 4PLNA 4P08A 4IEZA 5C3OA 1X8EA 2QNKA 2C26A 4XTMA 1C3HA 5T55A 4AGGA 1HB4A 3GJAA 3JBG1 4CP9A 4YGCA 2A6XA 3VD5A 3FFQA 1W9SA 3MHZA 4AZZA 1B09A 3KM5A 4M3CA 1UYZA 2CY6A 5H9RA 5C3PA 4B7EA 2BVBA 2YFZA 2ETEA 2IUWA 3H7JA 5FYIA 2HWE1 1UPSA 4LBQA 2PHTA 4M3CF 4BLIA 4L9BA 5GZFA 2HWF3 5JIUA 4CU7A 1PZ8A 2YUEA 3CU7A 4WV8A 4WVZA 2EXHA 1V9U1 3SLIA 3CBNA 4RFRB 1QJY1 2BW8A 3LOIA 4Q8KA 2WYFA 5A7PA 4HSJA 2ZX0A 5JSRA 1NLQA 3SEEA 3PU3A 4HK8A 4AHXA 5F32A 3BPZA 4OCTA 5CZKA 2LALA 4W8JA 2WJSA 4Q4W2 3IIAA 3IMMA 3KGZA 2P3YA 1S4CA 3KZ4C 4FP3A 5KXEA 1Q8VA 3ACLA 4KWLA 3THCA 5C4WB 2VL4A 3ABZA 4I3PA 4COZA 1UPIA 4RHV2 5L9BA 3T30A 3ZFGC 1D4M2 4XXPA 3ROUA 3WQ1A 1J3RA 3OUIA 2I45A 1W2TA 4UAPA 2PHLA 5DDJ2 5FZ7A 4FAHA 4BDVB 5C33A 1NXD1 3KT7A 2HWB3 3ASIA 2R042 5CG8A 3CF6E 3ES4A 3HBZA 2AENA 5DAXA 2EAAA 3BYWA 3EXUA 1I5PA 2H0VA 4IV1C 3BI3A 1JYVA 1PO22 1O3QA 4XABA 1JH5A 4R9DA 1QNWA 3PVEA 5FXZA 4TYSA 2GP5A 3UV9A 1Q8PA 1HXS1 4B29A 4Q1PA 3JZVA 2OS2A 1RUI2 3ZSMA 2RDSA 1OPMA 3WUCA 1IG3A 1QXPA 3WW2A 4Q4X3 4YZ4A 3TN93 4LKFA 3NW4A 4K7JA 5LA9A 3ZMOA 5FLIA 1XNCA 1H6YA 1YYNA 3I7DA 3ZOIA 5CFCB 4IL7A 3WG1A 1O8SA 3MIDA 4IXLA 2RMU3 1TME1 3FHIB 4ZY9A 3H8RA 1UAIA 3K3OA 4CCCA 1F5JA 4IEPA 4CCJA 1BEV3 3GJBA 3D5OA 3HN1A 1H8TA 5ISLA 3KV6A 4Q4V1 1US2A 3G6JB 4S2HA 5FYSA 5FMOS 3VZOA 1UXXX 4BZ4A 1KQRA 2RS12 3EYPA 3SCFA 4D6SA 2HH9A 3JCIA 3MLKA 3RVHA 4XAAA 3LCPA 4D6QA 4BXFA 4HFSA 4FFGA 5ACA2 2ZGMA 4U36A 4GMP0 1TNRA 1EPWA 4AFCA 5DUVA 5F6KA 3RWNA 3BB6A 4XFIA 4XFBA 4BMEA 2KR2A 1UZWA 1OA2A 2DCYA 4OI0A 4GH4C 3D8CA 1ZNPA 3FUQA 2WZ8A 1X9PA 2QE3A 1M06G 1PX4A 3K4DA 1AR73 2GN7A 5DN2A 2IXIA 4Q2FA 1FOD2 5GM0A 3SNMA 4E4ZA 1UNBA 1E57A 1KS5A 1LR5A 1OURA 3V0AA 1GZTA 2JKXA 2R16A 1R092 2VBDA 3AYEA 4B4RA 2UWBA 3PJQA 4AVAA 3PVNA 1PNFA 5DG2A 2VXRA 2HWC3 4W6XA 5FZFA 3NAPA 2HEYF 4AW7A 1NY71 5JMCA 2FDIA 3MIHA 5CFDA 1ZZBA 3BTXA 4Y4YA 3C3VA 3ILRA 1VBD1 1OLQA 1XSQA 3TYJA 3PLQA 5D8AC 4CEYB 2ZGTA 2WNVB 2VPVA 4Q4Y1 5CG9A 1JYTA 2VW1A 4CXWA 1POQA 4BHPA 4HXCA 3VZMA 3MBWA 1SFNA 2BEOA 1P8JA 2RJKA 5IFTA 1YLLA 1MEC2 1LECA 2DF7A 2X09A 4SLIA 2ZHNA 1CPMA 5IATA 4XYXA 4YVSC 4KG8A 3B3QE 3KQ4B 5EZWA 1U5IA 4YARA 4MH0E 4PF1A 4ZU4A 1LEDA 1ULFA 4L11A 4X6RB 4XQDA 3VLBB 2WSUA 5FO8B 3J7NA 4FOVA 2HWE3 1AL23 2XXZA 1WLCA 1WLDA 1XBFA 3SCHA 3ZIXA 1RIRA 1RUC1 1CGPA 2PLV3 5FYTA 5F3CA 3C7HA 3POIA 4Q4X2 3SH5A 2D97A 3SC7X 1W8UA 1W9WA 3RS6A 1SMVA 3KV9A 3BTYA 4KBBA 5LBFA 1X33A 2BWAA 4DEVA 2G19A 1W3XA 4OQ9A 3LFIA 2CDOA 4XUPA 3SITA 4NRPA 4UFHA 4YVWC 2I2SA 3S5AA 4LBLA 2YV8A 3MW3A 5KC6A 3GXUA 2B9UA 2GMEA 4CDWC 3HR9A 5KC5A 3H7YA 1JN2P 2WFF1 4Q29A 5FK8A 1RUNA 5C3RA 2DVDA 1D4VB 2MPFA 5T50A 2ZJCA 1PIV2 1WMXA 3QACA 4QHBA 3SEPA 5KHKA 1SLLA 4AFBA 5IVJA 4BQ3A 4TN7A 2LTNA 3PUIA 4IGPA 2NP0A 4XEZA 2ENRA 1PGSA 4IEYA 5HCHA 5A7OA 1HX6A 1GP6A 5AVAA 1NZCA 2HYKA 3GNEA 3PUHA 4LIUA 1HQLA 3POFA 4QXKA 3ZFFC 5BNPA 5I8YA 5FYUA 3RQ0A 5IK7A 1UZYA 4RGAA 3U1XA 3OY8A 1OA3A 3N9LA 1AXZA 2WLPA 3W21A 4QKBA 2NZ9A 2VUAA 3WF3A 1QH6A 2P3IA 2Z5WA 3H0OA 3MPBA 1DQ6A 1RMU1 2E33A 2WQZC 4K40A 3T0AA 2DBIA 1AR72 1SLBA 4CYDA 4FAGA 5LEJA 4HVRA 1TME3 2NMNA 3RDIA 3T2PA 1W2UA 3J8F1 3TB0A 1S0EA 4HANA 2RR11 4HSLA 4ARXA 3FWEA 4DO0A 1DLCA 1VB4A 4ZHNA 4AEKA 1HB2A 1W0NA 3MEPA 2K46A 2HWC2 2KXLA 1NYWA 2VR4A 2EICA 3LF7A 3MIGA 3MFAA 4IGOA 2VMCA 3UGGA 1DU3D 1XC6A 3KGLA 1XE0A 2TNFA 5F3IA 4NRQA 2KM2A 2YPJA 3C7FA 1YHFA 1FI2A 1NA1A 2UWCA 2MNGA 2PXJA 2WO1A 3W20A 3VBFA 1QDOA 3CO2A 5L7OA 1GWMA 3USSA 3B9IA 3SQOA 2C9KA 1QJFA 4WM7A 5A7NA 1EP0A 1KJRA 3T4HB 4LBNA 2VMFA 1X36A 2TBVA 5F9TA 1N1SA 2ADEA 2D43A 2WUHA 1D7PM 1F35A 1K3IA 1SDDB 1PO11 2E7QA 2GMMA 2VQTA 3JBG2 4GXLA 1VMHA 2UU8A 1GANA 4MO3M 4PI0A 4UFIA 4UYBA 4XETA 4YW3A 3VKMA 5KHJA 4CUAA 2GN3A 3CQOA 2F4LA 3TAYA 1DDLA 2XKPA 4UFMA 3VD3A 1FPN1 2BFUS 1H0BA 5DG1A 5K7PA 2HWE2 5CIRA 3RYKA 3OPTA 5CA6A 5FWEA 4QU1A 3ZLIA 1BVP1 1CWPA 1V9U2 5BV6A 5KXDA 2WWJA 1QJY2 4JTOA 1I1EA 5FUNA 4XUTA 1C5HA 5JUVA 2FDGA 3K4AA 5FZ6A 3RMYA 5C9AA 5KHIA 3OCPA 2IVIB 4RA0A 3NNLA 5F5AA 3K3NA 5GLTA 4Q4Y3 3ZYBA 1VRH1 4B1MA 2Y38A 4KQ7A 3PU8A 4CCLA 2BOJA 2ZKLA 1H8TC 1JODA 2B46X 4IE5A 2QBXA 3OGJA 1DGWX 3DV8A 1HJGA 2BGCA 3I49A 4ZKTB 2VZRA 1JHNA 4L2NA 3WCSA 2BBAA 5G05L 5A7WA 4DS0A 1ENRA 2ZGNA 3Q8FA 1QEXA 3ZO0B 3AKQA 1AYN1 1E5SA 1RJ8A 1RXFA 5T5JA 1H2LA 2DTWA 4UBHA 3FBYA 4XJ9A 5FP9A 3RMXA 4YZ2A 4NIDA 4GJZA 1ULEA 4NUBA 3AP7A 4V2WA 3WDVA 1OOPB 2OIIA 3SKJE 2R32A 1BJQA 4N7UA 3FE5A 3UK9A 1HXS2 5HCFA 2D93A 1UL9A 1VAMA 3DXUA 3I3QA 3QH7A 5CISA 5FDBA 3BTZA 5A3OA 3J7MA 3ENRA 3HJRA 4LNVA 3ZYFA 4MXWA 5JOYA 2W2IA 2FMYA 2PHDA 2OUJA 4Q1RA 2OUHA 3I59B 2PTMA 1MACA 2WWSA 3B94A 4G3YC 3ZN4A 1ENXA 3U75A 1VALA 1ULOA 2D98A 5A1LA 3BALA 3T1MA 3NMBA 2YGMA 3E5UA 4BWOA 1YIFA 4LLFA 1QJU1 3FN9A 2GC0A 1AX2A 1VJ2A 1W6OA 1YIPA 3GM8A 4NAMA 1NX9A 4Q4V2 1SDWA 3NAPC 3ZN5A 3RWKX 2WFF3 4YYOA 3UKNA 5FZAA 4FBFA 5CFDC 3FMGA 3MGUA 3M7AA 1E5IA 3N9NA 4QX7A 4LORA 5FP7A 3N9PA 4AI3A 2VOWA 4GB31 1W8HA 1X9TA 2XJPA 1SHWB 4ZU5A 3K48A 4ATEA 1R1ZA 4IE7A 5FMCA 4MGKE 1G9DA 2W68A 2E9QA 2VMGA 1VBA1 2DVBA 3WNMA 4FPYA 5LZ6A 4XFAA 4FTEA 1GYKA 1G7YA 5FP3A 4XDQA 1F31A 5EWSA 1JHJA 1L3JA 5GZCA 3USUA 5F5IA 3WDUA 2QQJA 2WNUB 1BK1A 3NNGA 3RGBA 3T0BA 2YBKA 3M70A 3NV3A 2UY8A 5FXXA 4COWA 5T52A 4CRQA 3J8F3 2DVGA 4FTBA 3B9CA 2RR13 4TLFA 4A4AA 3WF4A 1PVC1 4IEUA 3VB9A 4IQPA 3FX3A 3THPA 5FZLA 4AF9A 2NM1A 1ENQA 2QKDA 2JXAA 5A3TA 3TEYA 5FOBB 4FPLA 1HRV1 1KFUL 1NY72 3IDBB 5CADA 4MGYE 4PIXA 2E32A 2EVXA 4HVOA 4A45A 3IZOA 3Q8CA 1VBD2 2DDUA 3WP4A 2V5DA 4CSWA 2VC9A 3LA2A 1U12A 2NPIA 1IS3A 4HN0A 1FMD1 4Q4Y2 1PM4A 3CIHA 4UF0A 4Y1UA 2VJXA 3E6BA 2AEYA 3WG4A 1ND3B 2A6VA 2W87A 1QGLA 5FZDA 4AVVA 2VM9A 1TVGA 4NE9A 3ME2A 1PHMA 2XDVA 5JOWA 2P5BA 4QAWA 3T0DA 1J3PA 2BDRA 4F83A 1QOTA 3VDBA 1PO13 4JC1A 5T5OA 3WNPA 3KF3A 4IV3A 1JXNA 1LU1A 4UI9L 4AVSA 1U5YA 2ARXA 1YFXA 1AR61 1PGL1 5E1RA 5BNPC 3N7KA 1MS8A 1RUF3 2ZPXA 1VLNA 3J7HA 1O3SA 2MEV2 3EQEA 3K46A 1PX3A 2NN8A 2Y26A 1AX1A 1GOGA 1QH7A 4ARYA 1QMJA 1E5HA 2HWD1 1SPPB 1RUC2 3GHNA 2Y6KA 5IYYA 3GCWA 3AXDA 4CZSA 4H7LA 5CVRA 2XHNA 4QQHA 4GMP1 3VD9A 4GALA 5C71A 4CXYA 5EJ3A 1VRH3 4ASMB 4MZUA 1JOJA 4YW7A 2IXCA 3N36A 4CDXA 5JXIA 3WOGA 1HIXA 3KHCA 2XBO2 2YFUA 3VDAA 5JXJA 2ZABA 1PK6B 3LIGA 3D4KA 3WW3A 2WFF2 4CCNA 1JYWA 3JXSA 1ASJ1 1MS5A 4OLLA 4NPMA 5FPZA 3NNMA 1LOEA 2VQAA 3T4VA 5JPMB 1UX7A 1DQ1A 4JDNA 5IVVA 3MW2A 1Z0HA 1DGRN 3ZXGA 3K77A 1NA1C 2ZZJA 4QXCA 3AL6A 3VBFC 4YG3A 3VBHA 4KMQA 4R4XA 4DFSA 4Q8LA 4JDOA 2J42A 3UJOA 2EIDA 3OOXA 4FXGB 2C0ZA 2DV9A 4DXSA 5L36A 5FMOL 2VZTA 2W1QA 4HKWA 4E2SA 2E51A 4QM8A 4AI8A 1GSLA 2QDNA 3O1PA 1O7FA 2P1BA 3GDBA 3WQ0A 4RR3B 1I5ZA 1O8PA 1VAKA 1RMU2 1W6NA 4BJ0A 5GZGA 1H2MA 1LRHA 2BYVE 2F17A 1LAJA 1UYYA 1IPKA 1ALYA 3J8F2 3ZYRA 2RR12 4AI2A 3AKTA 4NHLA 4QDQA 1PMJX 4BQ2A 1JS9A 3ATGA 3T09A 2D5FA 2WYSA 4MHUA 3UT0A 1OOPC 3MV11 5C9AC 3OBAA 2HWF1 1O59A 5FWJA 4FPHA 1REFA 4IERA 1KXGA 1QF3A 4GULA 4IGQA 4DUWA 2GU9A 2WA4A 1F4AA 5EYYA 2WO2A 1A78A 4RFT0 1VBA3 3WV6A 1SLCA 2D5HA 1JMUB 1WGPA 4N53B 1CAUA 2OXBA 1UMHA 2GSYA 1ZZCA 5GZEA 3OJBA 3KMHA 4R9AA 1IS4A 1PM7A 5E6HA 2XL9A 1MQTA 1PO12 3NKGA 2Y6JA 1IS6A 2WN3A 3DPRB 2RDRA 1GBGA 1EYBA 1S0CA 3WUDA 2V4AA 2HWB1 2XMLA 5FAXA 2BUKA 3RNSA 2BOIA 1FPN2 1UZ0A 3BGAA 3VBSB 1V6OA 4MADA 1RC6A 3NL1A 4Q0VA 1PVC3 4E8DA 5JR2A 3THTA 3WX5A 5CBLA 3H50A 5IVCA 1X8MA 1K5JA 3LWCA 1VBC3 1OF4A 1JYNA 1OPOA 2AGSA 2R072 4AGRA 3OD4A 1DG6A 3L2YA 1VRBA 5JPNB 1NCRB 2WC2A 4XF3A 5JZGB 1ZYBA 4F8AA 3TN91 2HLEA 2ZEWA 4MGSA 1GU3A 2QVSB 3H8XA 3AKPA 4DXRA 2PHFA 3T1LA 1UN1A 3DF0A 4FPGA 1UU4A 2RMU1 4X8NA 4XQWA 2LW8A 5I8TA 4P9JA 3I3EA 1UQXA 1BEV1 4YW2A 3WSOA 1W99A 2JDYA 3CJIB 2UURA 2YB7A 3D0JA 3A0KA 4H2AA 5FZGA 1ZRRA 4YW1A 3ES1A 4JGZA 2Q5TA 1AYN2 4QX2A 4PDWB 3OSDA 2JD9A 1V0AA 2JG9B 5F5QA 3WDXA 3VDCA 3CJXA 3FLRA 3OTFA 4DB5A 3O1OA 4FOQA 5E88A 5FP8A 1J1LA 4NJ4A 4JGYB 3LFMA 1QDCA 1XXNA 2B8MA 2HWD3 4JRAA 3I3DA 2J1VA 3ZKYA 3BVCA 4NHMA 3AMPA 2QQKA 4Y24A 1EUTA 3A7QA 2LS6A 5GLVA 2ZGKA 3VL9A 1LOAA 1M4WA 4XJZA 4Z8BA 1Q43A 4LUKA 3RI9A 1ZM1A 3R6SA 2XJSA 3U78A 1NCQA 3WNKA 1QJU2 4LKEA 1QNYA 2TEPA 2WNOA 3AFKA 3AZYA 4XTPA 4O61A 1RXGA 2JDKA 3POBA 3POSA 2G1MA 2VOVA 2WFPA 3D82A 4I02A 5J1XA 4GB32 5BNOC 5ABJB 3UYJA 1TEIA 5A6ZA 5IAVA 1C1LA 2O8OA 1OT5A 4LOSA 1S0DA 3U07A 2YBPA 5LK7B 1QHDA 3GCXA 1EY2A 1DP0A 1LOBA 4BIOA 1N3PA 4XF9A 1PZ9A 2FMDA 1LHNA 1IQAA 1GQHA 1HLCA 2EXIA 2WAOA 4RGGA 3WQBA 2JDPA 1T6GC 2WIIB 2W1WA 5LASA 3IAQA 1OD3A 3PHMA 3OGVA 3IM0A 1PGW1 4XUNA 5FP4A 1CVNA 2D40A 3GBFA 3PTYA 4RYDA 2D6KA 3ZFEB 4IV3C 2W5FA 4CP1A 4B8EA 4XOGA 3PUAA 4AVCA 4DNYA 1Q8OA 1SBFA 1W0OA 5C4WA 1H1MA 4W50A 5AVPA 3ZR5A 3K2OA 5BNNB 3ZKUA 1RUD1 1PVC2 3E1F1 3LEGA 1WBLA 1SLAA 4FPCA 1GOHA 3RZZA 1JZ4A 2H6CA 4CDQB 2DUPA 4M4PA 1WBFA 2P3JA 4FPKA 4E4DX 1AL21 1HRV2 4EN7B 1APNA 1MVEA 2FCVA 2A3YA 2PLV1 5JXGA 3AMHA 2VZOA 4L8QA 4QPWA 3S30A 1LTEA 5FZOB 4XILA 4ZS3A 3VV1A 4CDXC 2BFUL 1FMD2 5DPNA 5FFOC 1Q8QA 1JZ3A 3TNQA 1VIWB 3RJRA 2Q0AA 1VMJA 1Z7S2 3ZXLA 2GNTA 2WN2A 2FHRA 1UF2C 2G4IA 3SKVA 3W5NA 2QQUA 1X82A 5JR7B 3BODA 3I2GA 2X29A 3ETPA 5DAVA 1W2NA 2GMPA 5APAA 2JG8B 2PFWA 1JZ8A 5J98B 3VN4A 1NKGA 3WG3A 5FPBA 4NIIA 4BQ4A 2DYCA 2ARBA 5CFCA 4FOYA 3ZXJA 2YZ4A 3H3ZA 5F5CA 4I01A 2RS33 2Y0OA 1RHI1 1ULPA 4WVMB 2JJ6A 3VBHC 5JSOA 1AR62 1PGL2 1B35B 5DZGA 4AE2A 2QQWA 2BERA 4CU8A 4TLGA 5A32B 4LO8A 2BJSA 4AQTA 2CAVA 3OUJA 4WVWA 4Y4RA 2HWD2 2JDHA 3FHQA 5KXCA 1A3KA 5FUIA 3AZWA 4V1PA 4Y5TA 1ZA7A 5FZ0A 2ZEXA 1CQ9A 1W8ZA 1Y7BA 3E5XA 2WT0A 5GKAC 4A2UA 1UU5A 1V6NA 3POJA 4G9SB 3AC0A 4ES8A 5HCAA 3O0XA 1LHWA 1RUE3 1XE8A 3OBZA 2XVKA 4IEWA 2OVUA 4IEXA 3FC0A 5HXVA 4BU2A 3IT8A 5A3LA 1G9BA 4C0BA 1UOBA 4V2VA 5FPVA 3RZHA 2JECA 1IKQA 1COV3 1F4HA 2A6WA 3G7DA 1STMA 3ZYGA 3M8LA 1KJLA 5D1IA 4IETA 1RUH3 3GALA 4QXHA 5BYNA 2VE1A 3E6DA 4Q27A 1XU1A 2BP6A 1BHGA 1ASJ2 2VNOA 1TZOA 1W3VA 4LKDA 1TMF1 1UO9A 2FCTA 4MHRA 3MPPG 2XR4A 5JIAA 5EJZB 4OQ8A 4UWDA 1FV3A 5JDBA 3KHBA 5F6LB 4COUA 4XMAA 4BQYA 2VUDA 5JZGC 4LR4A 4O65A 4YZ5A 4D8MA 2AR6A 1MQTC 3R4DB 4UW5A 3ZDVA 1YQ2A 5DAWA 5A3PA 4QX1A 1DZRA 2JENA 1XNKA 4JKLA 4CEYA 2BTVC 2WNVA 2J1SA 3E6CC 4KGGA 1W28A 3V56A 1J59A 4ZZ5A 1VBB1 4WM8B 5K0UB 2W92A 5T5LA 4JQTA 4LHKA 5IVFA 1BKZA 4MOAA 2JG9C 2X5IB 3KT1A 4CA9A 4CP2A 1S0JA 2A73B 2XUEA 4Q26A 4OULA 4META 1QIQA 1OBNA 5LWBA 4Y33A 5GALA 3ZM8A 1IPJA 2HWF2 3SMHA 3ZSKA 4QKFA 1K5MB 4NPRA 4YLZA 3EBRA 4LBOA 3AJYA 3LA3A 3QD6A 1RVF3 2GDFA 5L19A 1SG3A 1FNZA 2CU5A 1F5FA 1QJX3 3HT2A 4NPLA 2C1FA 5EJ1B 4NRMA 4YM3A 1WMDA 2C4XA 2RM23 3ETQA 2K0GA 4Y26A 1Q5OA 1GFF2 1V6IA 1OHFA 4QPGB 3OYWB 4QQLA 1UY1A 3O1VA 2VH9A 4JGZC 4M0NA 5EPAA 4CU9A 2RHPA 3HN3A 5AC93 5LA1A 3WF1A 3DGTA 1OFSA 4DZGA 1LNSA 1C1FA 2Y6FA 2GC2A 1EAH3 4L0PA 4EN9B 2RS51 3IKWA 5FYHA 1YNAA 2HWB2 2OW4A 3MIEA 4DRRA 5KWRA 2PAMA 1RUD3 4A7KA 4QT6A 2CDPA 2PMWB 4XDPA 1Y9QA 2XJUA 1EPZA 3POGA 4OZXA 4BOWA 3DL3A 1R1A3 2DVFA 2DUOA 4QKDA 4CXXA 4KWJA 2R1BA 3N7LA 3KV4A 1OUXA 1ZBA3 2D6LX 2ARCA 2ZAAA 4QDRA 4Y5SA 1BK0A 1VP6A 3AMQA 1AJKA 2ARAA 3SHRA 4FVVA 2Q8DA 2ZAHA 3TN92 1GUIA 3HD8B 2PYTA 1NCQC 2WO7A 4PIZA 4QB2A 3ZFEC 2O14A 2HEVF 2RJLA 2DU0A 3PNAA 2XVLA 4QWNA 1W8OA 2RMU2 5CKMA 4EN6B 3I2OA 3ELNA 2ZEYA 1A34A 1OD5A 1H1AA 4WZFA 3UJQA 2X05A 1OQ1A 3B93A 1V70A 4GKYA 1BEV2 2ZMKA 4IEOA 5BNNC 2WT2A 3AZVA 3OPZA 4HKLA 3WT3A 4DOUA 1PMHX 4PF5A 1J84A 3RSJA 4J1XA 3CKHA 1RHI3 2CWMA 2I07B 5JOXA 3WP6A 3AP5A 3PL0A 4PBPA 1WMFA 4QDSA 2E31A 1L7RA 1FX5A 2YU2A 3I2FA 3OG2A 4I0WB 1RUOA 3GZEA 1Y9GA 3J9SA 4Q0UA 2FD8A 4YG0A 1DYOA 1ULDA 3R05A 4I30A 5LW9A 3WCRA 1YXWA 1UY0A 1GR3A 5C8CB 2ZGPA 2ET7A 4QX0A 5E8AA 2LRPA 4A44A 3ZXEA 3ZX7A 1IZ3A 2WKKA 2WINB 3EJKA 5C4WC 1IQDC 1JOPA 3FFZA 4XIOA 5C70A 5J3UA 1WW6A 4BB3A 1GZCA 2VW2A 2Q1FA 3IMNA 1HQNA 4BCUA 3B7MA 1GQPA 3O0VA 1HW5A 3RJ2X 4K8FA 1A8MA 3N9MA 3TEZA 3IDEA 1H8VA 4YPJA 1B35C 1W6MB 2LM3A 1QU0A 4LBKA 2FDJA 1JYCA 2GALA 4WVVA 2WO3A 3SISA 2BGOA 3O14A 4HONA 5JOZA 1TMF3 3KS7A 3V0BB 3GBWA 4I0BA 1UYPA 1DFQA 1C28A 2CGNA 3C2UA 4A6SA 5SV5A 1BBT3 1GZWB 4KBZA 3LDRA 4N90A 4TZDA 3MUY1 3Q8EA 3HBKA 3J26N 1UOJA 2W52A 2Z79A 2ZXQA 1UOGA 1RUJ3 5JVVA 5I0SA 3C7GA 5FZ1A 1V6LA 4KU7A 1PGW2 1YO8A 2CV6A 1LHOA 3ZR6A 5CFCC 4Q0QA 4C1WA 2A75A 2B9VA 3MIFA 4XQ4A 4EROA 3MFCA 1U5ZA 3J4UH 1JU3A 3SXWA 3NJZA 5A33B 4IW3A 5SV8A 1TQ5A 4RL7A 1YFYA 5A1AA 1ZZ6A 1DQ5A 1GV9A 3HNBM 3N7JA 4NWWA 1VBB3 3JB4C 4YFZA 1G9CA 1RUD2 1LOFA 2X10A 2YC2A 4KU8A 4XVHA 2VCCA 4QX3A 1ND2B 1RUF1 2Q8OA 4YFWA 3K75B 5FY5A 1AL22 1S2KA 1KEXA 3VDDB 4X8PA 2NLRA 3U10A 1OLMA 4CUBA 2PLV2 5IT6A 2GNBA 3EB7A 3KT4A 1S55A 1E5RA 1MS4A 2W47A 4Y22B 3APBA 3ORJA 1OOPA 1VBE3 3O7OA 4BQWA 3K4ZA 2NQYA 1QOOA 3BN6A 1OVPA 3M3OA 3T2QA 1OXCA 3KWVA 2VCAA 1F15A 5FBJA 2PA7A 4LUMA 1GNYA 4H7MA 2A6ZA 2WQ4A 5K0UC 5D21A 4B3NA 4YWAA 3BPSA 3TRSB 3I59A 2CWSA 2X5IC 3T08A 5T5PA 1XNAA 5FJHA 4QB6A 3W5MA 2RS53 2VZUA 4RS5B 2R6QA 1UD1A 4AI9A 4COYA 3P6BA 1PMIA 4HG6B 4K1ZA 1HB3A 2ATFA 2VVEA 1WMEA 2ZACA 1FATA 4UXAA 5I0TA 4P5HA 3CMGA 4JHZA 3WW1A 4WZCA 1LGCA 2K9ZA 1YFUA 4CEYC 2WNVC 5LY2A 4AHWA 4Y3OA 5B4NA 1EV11 4LK6A 4RQPB 3M3QA 1IPSA 1GLHA 1AR91 4H3WA 4AL9A 2ZX3A 1AL0G 1UIKA 3DYMA 5GJ6A 1H1IA 4P14A 4QB1A 5KR7A 1MZEA 1A8DA 4WBBA 1TME2 2SBAA 2ZGQA 3VBRB 2WA3A 4OI1A 4AEMA 4L92A 3C7OA 5FV3A 4B4PA 3ZSJA 2WNUA 3DUIA 3CDZB 5B4XA 1O5LA 1XSRA 2IXHA 4ISQA 1RINA 1YI9A 4BYYA 3AZZA 5FCCA 2C24A 3M4FA 2RVAA 2HBTA 5FY8A 3VZNA 2B39A 2OQ6A 3LSDA 4JAAA 5FYYA 2VW0A 3D0SA 3E5QA 4QD2A 5F2SA 2P6CA 4ZPIA 2BRTA 3HAGA 3ZPOA 4W6WA 3S0MA 1O91A 2P37A 1C8NA 2YY1A 3RYRA 5LB6A 3VHNA 1WW7A 4NVPA 3VBUB 1Q56A 1QXJA 2E7AA 2VOXA 3NJVA 4JQRA 3WF0A 1FXZA 4XZUG 2VQ0A 3N7MA 3UKVA 4CCKA 3P1IA 1HV1A 4LO6B 4QPIA 4XMIA 2FZ2A 1ND3A 4KGQA 3AZXA 4D94A 2OZ6A 1VBB2 4PLOA 2IXJA 5DABA 4MVTA 4UFLA 3EHKA 2H0BA 3U4XA 4XHXA 3R0RA 4COVA 2WLQA 4LBJA 3KVBA 2CL2A 2A3WA 1VAVA 4XF1A 4QKNA 1UIJA 1WCSA 4QXBA 4AOCA 3I97A 1RGSA 2H6BA 4EN0A 4NROA 2JDNA 3TNPB 1S1AA 4CDUB 1J3QA 2EXKA 2VNGA 3WF2A 3VD7A 1VBC1 3HMYA 2VBBA 4UW3A 4LITA 4CCOA 4K20A 1VMFA 3LZZA 4LTAA 4OMCA 5C8CC 4UOJA 3AX4A 2JDMA 2R061 3PIGA 2VAUA 1SPPA 5A3WA 2VTFA 5C6CA 3LD8A 4QPIB 4BLJA 4EV0A 1UXZA 5FY7A 4K8RB 4LHSA 3KD4A 3KF5A 5FRAA 5FOJB 3H1WA 5JXHA 3QCWA 3KCYA 5JWPA 1V6JA 5JLVA 3MIBA 5HI0A 4Z2AA 3OUHA 1ST8A 2DCZA 3MLLA 4MGIE 1DCSA 2J1AA 3CLPA 3IIIA 5H9SA 2RS52 3NV1A 3B01A 2VTXA 4O9GA 1UZZA 2A1XA 2RV9A 4X6QB 4E27A 1D2SA 3I54A 5FYCA 3W58A 4ES9A 3RZMA 2ZX4A 3WLUA 1PK6A 4N43B 2WRAA 4FPEA 5LRRA 1LULA 2JIGA 3URFA 2PELA 2VVDA 2VTXJ 4JHTA 3ITQA 1H4HA 2D6NA 2VZQA 4YM2A 3O1RA 1I6XA 2ADDA 5T3NA 1CJDA 5DUWA 2B4KA 5FUPA 1JU4A 2YG0A 2AH2A 4XPVA 1Y4WA 1XB9A 3AMMA 1T2XA 4L99A 2DFCA 3CZUA 1W39A 4QQOA 2YXSA 3BOPA 5DDJ1 4M00A 2VUJA 1YEWA 2BNOA 2VGDA 3QBQA 1NT0A 4CEWB 1BVVA 5FKCA 1OQEA 2QQOA 1OI6A 4RR3A 4ORFA 4JDMA 2CGOA 3LEIA 1CAXB 1WZXA 4LK7A 4XF4A 2DCTA 3MICA 1C57A 2VOKA 2W0XA 4AEJA 3HT1A 3KVAA 3TOJA 1HKDA 3GF6A 4DXZA 4AR2A 4AFAA 5E89A 2CGPA 4YRDA 5FXVA 1EUUA 1RUI1 5A7QA 2VO5A 3W9AA 2AUYA 4XACA 4Z1VA 2WS93 1IG0A 2B42B 3RG0A 5E16A 4AAXA 4IE0A 1FV2A 3U4SA 1R083 3POWA 5FQ0B 5M0TA 2VMEA 5C5UA 4LEJA 1W9FA 3IPVB 1EV13 4INDA 1AR93 4NN0A 2Q8CA 1UKGA 5JMOA 1UWWA 1AXYA 3HVDA 4UW4A 1LOFC 2XOMA 2VU9A 4N53A 4IDZA 5CB7A 2W1SA 4QPYA 4GAZA 5I91A 3DN7A 1NOVA 3JD71 4RS5C 4GKXA 1WUVA 5FYBA 3ZYPA 4IESA 2VD7A 4JTNA 3DPRA 3O12A 1ZZ9A 3AM2A 2JDZA 1UKRA 4XFCA 4QM9A 2YHJA 5ACA1 3UNPA 3NQHA 4R8HA 5F7UA 3CEWA 3N9QA 3VBSA 3JB8A 1NE6A 1LOGA 2BWCA 3ZN6B 3ST7A 1BQPA 1F2NA 2QQNA 3LPGA 3U14A 4RQPC 3VHPA 2W39A 1J1TA 3BCWA 2IXLA 4E2QA 4YZ1A 3OEBA 1D2QA 1NCRA 5F3GA 4UFJA 1OA4A 4QU2A 1FOD1 1CZVA 2GC3A 5FO9B 5DMYA 2BZDA 3MUZ1 5JZGA 4CE8A 2YU1A 4KH9A 4JV4A 2XPJA 1C8M3 1N3OA 3I2KA 1O5UA 3CHXA 5D2AA 1J83A 1CAWB 1CN1A 1ULGA 2PHWA 5FR3A 2RS31 1LHUA 4D3WA 4KWKA 3BTAA 4IV1B 3U37A 1J58A 1RUF2 1GICA 1KDKA 1BCXA 3CJIA 1O3TA 5A3NA 5ANQA 3PDQA 4MGZE 3I2HA 3MZHA 4XFFA 4DRVA 1VB2A 4PDWA 1WW5A 2W91A 4JKKA 2XJRA 1WLWA 5JCTA 2JG9A 1CR7A 5IVBA 4I2OA 1YJKA 3WNXA 1D0HA 3LDKA 4IE4A 3SH3A 2GNMA 4P5YA 2DCKA 4HPKB 1RUE1 4JGYA 4Y20B 1OLME 3M3EA 2XWJB 3RZGA 1VRH2 2KD7A 2R063 3ZIWA 3QH6A 2JEMA 4OHVA 2WNUC 3WHUA 1COV1 2VULA 3J7LA 2CHHA 1UX6A 1CPNA 1RUH1 3HQRA 1QY4A 1RITA 5A6QA 3GBGA 2P3KA 4QGLA 4UT5A 3L2HA 1NUKA 3VKFC 4AXOA 3S57A 2WWUA 1WKYA 1YCIA 2XH6A 4PI2A 4NIAA 2J1EA 1L7LA 3HEIA 2IFRA 1RJ7A 2QQVA 3VD4A 2IXKA 2ZX2A 2YDEA 1O4YA 3MI8A 4YW5A 1XU2A 1JZ7A 2P2KA 1UY3A 4XW3A 4NIGA 3H8UA 2V09A 5A7SA 4MYEA 5CNAA 1DHKB 4XAEA 3WW4A 1PVXA 4BISA 5ABJA 1ZRDA 5EQUA 5FZCA 4Q4W3 2VG9A 4Q5OA 5A70A 1UMZA 2PHUA 3OGSA 4QPIC 4CUGA 1ND3C 4GH4B 5C3SA 1AR92 5IJRA 2DVAA 1XQNA 2Q1MA 4RHV3 1D4M3 4TTGA 1ZX5A 2L9LA 5I0UA 5DDJ3 4P9GA 1PIV1 4KWUA 3UESA 2R043 5EV7A 3ZFEA 5ERLA 4LQRA 3IN9A 3MDPA 1AHSA 5F3EA 2ZGSA 4N43C 2JD4A 1JUIA 2FCUA 1RYYA 1PO23 3HOBA 2OPKA 5IW0A 1RL3A 2PHRA 1V6KA 4QGNA 4NAOA 4Y1YA 5BNNA 2BVVA 1CESA 1RUI3 4UFKA 5D8AB 3KSCA 3MLJA 4A6OA 4CDQA 4FTSA 2XHKA 1RVF1 4DQAA 2VCBA 2WSVA 1VBA2 4B1LA 1JYIA 1QJX1 1XNBA 1YRZA 4MV2A 2RM21 1S2BA 2HKXA 2ZBJA 3CNAA 4JRLA 1OUSA 3KV5A 5FPUA 5FZOA 1DLLA 1GZ9A 3OGRA 4UW6A 1CAVB 1YQCA 2WQ8A 3Q8BA 5AC91 1CZSA 1W6PB 1QKQA 4YVSB 1PK6C 4Y1VA 2WZPP 3GYDA 1EAH1 2G9FA 2Y34A 3JUUA 3O1UA 4BXSV 1ZVFA 2YMZA 3JU9A 2GNDA 4QQPA 2ERFA 3JD73 3ZYHA 4FT8A 3VL8A 1OSGA 2JG8A 4LOTA 2RS13 1IKPA 5FPAA 5LBEA 1UU6A 1CX1A 3GZAA 1HDKA 3TWIA 3AMNA 1W6QB 1R1A1 3AKSA 5AFBA 2J1RA 1WA6X 4WVMA 5ACA3 1VBC2 3B02A 4XCBA 4OI2A 3UKTA 3R4SA 4Y5Z0 1B35A 3UGHA 1ZBA1 4DIQA 2Y0IA 2D44A 5A32A 3NSTA 3LA7A 5TSWA 3N4MA 2R062 4BPZA 4YVWB 3DEMA 4AVBA 4OHZA 3OBTA 2VZPA 4LMFA 2GAUA 3VZKA 4CP0A 4RR3C 2OYZA 1SCRA 3GZUC 1F8VA 1CIWA 1GP5A 2NYYA 4NR1A 1NE4A 4CDWB 1UMIA 1FOD3 1ULCA 3EO6A 3MF6A 2YYOA 2YC4A 3M2MA 2XLGA 2ZX1A 4BH9A 1FNYA 2VNVA 1QWRA 4FPOB 1R093 2QZ3A 2RDQA 5I0RA 2VQUA 5IUQA 5K4LA
chains in the Genus database with same CATH topology
1AYM1 1URXA 4I3GA 4RD7A 2R30A 1BYHA 5LRSA 2XLFA 4JCKA 1Y43B 4BMBA 1NLRA 5IK5A 5F1RA 3ZFFB 3WQ7A 4AFDA 2D3RA 2Q1ZB 5IK4A 1S0IA 1V6MA 4M3CB 1N1YA 4N53C 4XHBA 2ZCWA 1MEC3 4S2DA 3NV4A 1ZRFA 4XIKA 1FT9A 2FBEA 3Q9OA 1QOSA 2WNEA 4A3XA 1HV0A 4LBQB 2ZMLA 1LU2A 3DPRC 4XBLA 4H14A 3ZSLA 1BXHA 2FZ1A 5J36A 1OKQA 4HN1A 2A6YA 2XL7A 3VBSC 1SEFA 5CU1A 3O5SA 4WM8A 4EWDA 2Z42A 5K0UA 3AB0A 4DINB 2QJVA 2X5IA 1BBT1 2PAEA 3V65A 3NV2A 4DY5A 1IOAA 3OF1A 1NLSA 5J09A 2PQQA 3LGRA 4J6GA 1NCRC 2R1DA 4S2GA 4C0HA 3FLPA 1RUJ1 2XJQA 4LA2A 5LK5A 3KB5A 2A70A 3R4UA 3WP5A 1K5MA 1HRI1 1N1VA 2DU1A 2YGLA 4URTA 4XXAA 3A4UA 4MX3A 2A7AA 4CTEA 1MS3A 4XBQA 1H4GA 2RE9A 4F7ZA 3CJIC 4QPGA 1G6NA 2C5DA 3OYWA 3JD72 1PIV3 1C4RA 1RB8G 1G8WA 4PDWC 2B5HA 4I0AA 2I74A 3M1HA 4BM8A 4AHZA 3AP9A 4ONUA 1LJ7A 1DZTA 1CX4A 1ZBE1 4Q0PA 3OD0A 1GNHA 3WP3A 1LKNA 4JGYC 4W6YA 5GZDA 2P17A 4MSVA 4Y1XA 3ZMNA 1PZ7A 2X8KA 3N35A 1G9FA 1VBE1 4FQ4A 1H8TB 4YGBA 4FOWA 2V5YA 2O0OA 2W08A 5GLUA 3BU7A 3AYDA 4PLMA 3N3HA 1JTZX 4LHLA 1LGBA 2WZR1 1LOCA 2G9GA 4KL1A 4P9YA 1GQGA 3KQRA 5J96B 2XLAA 4K3UA 2XJVA 2RS32 2VECA 2A71A 4P9LA 4XFHA 3RRDA 2E63A 2DUQA 1IS5A 5ABJC 1POV0 2D7FA 3SCGA 1CD3G 4G4FA 2ZHKA 4HETA 5CAZA 1AX0A 4N7IA 4FQZA 1YFWA 4GA9A 5BUVA 2ES3A 2DCJA 4JVAA 4PQ9A 2JKBA 3KCCA 3ZVXA 1VR3A 1RUE2 4FP2A 3NO8A 3FUOA 2EF6A 3V0AB 3VZJA 3JBG3 2NMOA 1COV2 3ZYIB 3VUOA 3AFGA 1AZDA 1SBDA 5C8CA 3M3IA 4LT5A 1RUH2 3GZTB 4OI4A 3NAPB 1IHMA 3FZ3A 2LUWA 4FPJA 5CFDB 4BIFA 5DXDA 2MEV1 1A6CA 4CDQC 4SBVA 3BOWA 1LESA 1AYM3 1F9KA 1V9U3 1XYOA 1QJY3 4AGVA 4YG6A 4FCAA 1N1TA 1W6MA 4KG0A 5JSPA 2ET1A 2EIGA 4S2FA 3A0NA 3V0BA 1BMV1 2PN5A 1GZWA 4XBNA 1LODA 4HZFA 3S7EA 4AEDA 1O4ZA 2XBO1 2MHFA 3PMSA 1RUG1 5GLWA 1X50A 4B7KA 3VKNA 4XE9A 4XJUA 5KHGA 2JG8C 2DURA 1XNDA 5J7MA 3WDTA 4R9CA 5JI9A 4HT1T 4U2AA 1SCSA 2CYFA 3ECQA 4TSVA 5A33A 2XKOA 3WINE 4K9SA 4LLOA 4E4SA 2R0FA 1NQDA 4PBOA 1HXS3 1V00A 2DTYA 2E6VA 1Y3TA 3ZSEA 2Z69A 1ND2A 4AEDB 5AFEA 2E53A 1RVF2 2EAKA 3WD5A 1DQ0A 3QOPA 2ZGRA 1QJX2 3VHRA 3AK0A 4PCRA 3VDDA 2BNNA 5CA6A 2RM22 3UL2A 2K2SA 1H9WA 4UBGA 1LB2A 4DPNA 1KRIA 1KITA 1H2KA 1S0FA 1HRI3 4PIYA 4Y22A 4AYUA 4ZXKA 4FPFA 4NHKA 4XFGA 2D3PA 4A7ZA 5AC92 4Q4V3 3LAGA 3PVOA 4GIQA 1EAH2 1ZRCA 2GH8A 3VHOA 5A3MA 1DYPA 3U0ZA 5BNPB 2AREA 1UCXA 1LHVA 4LE3A 5J48A 2ZGOA 3M3CA 3OY8B 3KCXA 4AQ6A 4R4ZA 1AR81 1R1A2 4FSJA 1ZBE3 4RS5A 3WDWA 5EYXA 3ILFA 4HBNA 3U11A 3RYPA 1ZBA2 4YGDA 5HBAA 1ZZ8A 3B00A 4AQ2A 4D7SA 2QCSB 3LOBA 3S6PA 1LGNA 3TBDA 1MVQA 3NWKA 2VY0A 1DZQA 2WZR3 4RQPA 3QLQA 5B2GB 4IEQA 1OLRA 4WM8C 4M3CE 2HJIA 1QXRA 1QQP1 3IWZA 1WCDJ 4D7YA 1RHI2 1NA1B 3VBRA 1AYM2 2A3XA 3VBFB 2XUMA 2R071 1HQWA 4TWTA 5JAXA 5L7OB 1CJPA 4QMAA 1VBD3 3WR0A 1K5MC 4WM7B 2WS91 5H9QA 1WCKA 2FQPA 3JQWA 1R081 2ZOEB 3JQXA 4OFGA 4HMZA 2VMHA 4LA3A 4QPGC 4LHNA 4HK9A 4XJAA 4A7YA 1D0GA 2ZS6B 4Z82A 2O8QA 2P34A 1U0AA 1TE1B 3MW4A 3FLTA 3DKWA 2VVFA 1ZA4A 5H9PA 4FO9A 3VBUA 3NKTA 4Z07A 2BNMA 5C9AB 1LCLA 2MEV3 4MXVA 4PJYA 1TMF2 1DYKA 4ZU7A 2YROA 1RUC3 2GZWA 3ALQA 3VZLA 3X29B 3PVBB 4OHYA 3P3NA 1BBT2 4LO5B 1RTVA 2F6BA 1WD4A 4K21A 2KA3A 5FO7B 2SLIA 4R9BA 1MZ6A 3ZXFA 1Z78A 1RUJ2 4CDUA 3AP4A 3H1MA 1DGWA 5FLJA 1LEMA 1HRI2 1GKBA 3H3UA 4AVTA 2IFWA 2N7GA 1G9AA 2XBO3 4QQ2A 3H9AA 1RUG3 1C8M1 2CAUA 1FAYA 4K6BA 4LBQD 1OFNA 2VMIA 3ILNA 3HQXA 1NXMA 4EN8B 2ZKNA 2ZGUA 1WA4A 1ZBE2 4MXWB 3IDCB 4YM1A 4LE4A 1N47A 2XG3A 5I8SA 4N43A 3WG2A 2R49A 4OVEA 1H30A 2UY9A 3VKLA 1VBE2 2ZGLA 1W6OB 2D6PA 1RMU3 1REDA 3I2DA 3GHMA 4BE3A 3VBOA 1KDMA 2XB6C 5KXBA 2WZR2 1IGOA 4YNIA 5GLZA 3HIFA 1SFYA 3L9JT 4OUMA 1KFXL 5K8SA 2E7TA 3E97A 4CEWA 4GWMA 1MS0A 1DQ2A 3OGGA 5C8WA 1DGLA 1CAXA 2EXJA 3I8TA 3KLSA 1AR83 3USUB 2XVGA 5BY5A 1AVBA 4AEDC 2B7YA 1ZZ7A 4RSUA 1Z7S1 2WT1A 3AYCA 4AHYA 4Q4W1 5LEKA 3VBOB 3WVJA 1XRUA 5EXOA 4HKOA 5FREA 1ZREA 1H2NA 4E9KA 5BXXA 1AF9A 1ENSA 1WW4A 4RHV1 4QX5A 1D4M1 3WZ1A 5FQ0A 3SH4A 2PAKA 4EWEA 3IPVA 1C5IA 3ZDSA 2R041 2VNRA 3LSEA 1FPN3 3B69A 4HLTA 5K9YA 3H1YA 1DQ4A 2XGXA 3CL1A 1QQP3 1Q8SA 2BQPA 5BNOB 2JICA 1PO21 1ND2C 4LBMA 1Q3EA 1W0PA 2F4PA 2BBVA 1G86A 2R073 1DBNA 3VDDC 4GWNA 4ISRA 2XWBB 2C9AA 2JE7A 1I9RA 4F3JA 4ASLA 2YC0A 2BPA2 1BMV2 3AYAA 5HCBA 1AUYA 3FJSA 4HVQA 2TUNA 5FLHA 2EALA 4IV3B 3WDYA 4AI0A 4D7TA 4P9IA 3ZN6A 1RUG2 1SLTA 1OMIA 4M0HA 4Y1ZA 3HWJA 4NWVA 1SBEA 1SACA 5DUUA 4Z92B 1AYN3 3INAA 3I4IA 3AJZA 4FXKB 3ZFGA 1SLIA 1LENA 4EJRA 2Z2SB 5FBZA 5KHHA 1S0GA 2GH2A 5KBFA 2RS11 4EWAA 5L7OC 2D6MA 3ZXAC 4OUSA 3NVCA 1OQDA 1CAWA 4WM7C 5BNOA 2DWRA 4HL0A 4CDXB 1POV1 2R0HA 4H55A 4IV1A 4XZPA 2IWGB 1MZFA 1DGRA 5L73A 2B45X 3VGIA 4BA6A 3OBRA 1N3QA 4M01A 4C1XA 4YSFA 1JW6A 1O3RA 1NQJA 3AP6A 4AFMA 3PJYA 3RPQA 2QQPA 4O9EA 2AZ5A 4N9HA 1QJU3 4HPKA 2DFBA 5BNQA 3ZFGB 4Y20A 3VBRC 3D6EA 4MLOA 1AXKA 3VBHB 1BZWA 3S7IA 2JE9A 1R091 4QGMA 4OHWA 4GB33 4DY3A 4LO4B 2XJTA 4AWDA 3W59A 4AI1A 1AR82 2IC1A 2QUOA 1MR5A 3O0WA 2ZMNA 5IK8A 2ZTNA 3B5LB 1W6NB 4N9IA 4B4QA 1JBCA 4C90A 4GQ7A 4D69A 4LO7A 2ZHLA 5DUXA 3VBUC 2ZA9A 2UYAA 3ZXDA 1MEC1 1WD3A 1YJLA 2AYHA 4R52A 4YGEA 1S0BA 4LULA 4GH4A 4AG4A 3K51A 3WY6A 4IEVA 4W65A 1QQP2 3AXEA 3V64A 4K1YA 2QFEA 3T2TA 1HRV3 4OHXA 4I09A 1CAUB 3MYXA 1KS4A 4CDUC 2ZHMA 2ILMA 4P9XA 1YUDA 3LB9A 1MS1A 4Q4X1 2WS92 1QJZA 1FMD3 4ATFA 1MQTB 5FTTC 5J37A 1KD7A 1Z7S3 3P3PA 4C91A 1R082 2GC1A 4XJ8A 2HEWF 2D3SA 4E2GA 5D8AA 1EV12 1AJOA 4AK3A 1REEA 2PHXA 4KNCA 3MF9A 5JI7A 3AKRA 3ZYJB 2V73A 1TNFA 1YI7A 4P9WA 3VKOA 3IBMA 5BPXA 4YW4A 1DIWA 2EA7A 1AR63 4DMIA 1CAVA 4Q0SA 5FPXA 2OZJA 1W6PA 2Q4SA 2ZZQA 4YVSA 5T54A 1I3HA 2UYBA 2QDRA 1SQ4A 2OA2A 3WXPA 1MZ5A 2JX9A 2IZWA 3ZXKA 3VBOC 1XYNA 4GMP3 1PNGA 2A5ZA 1X7NA 2CNAA 4YM0A 5I93A 1W6QA 4Z2WA 1O4TA 1WLTA 4ITCA 1XYPA 3ZPYA 2FZ2A 1NG0A 1ONAA 2UWAA 5EFUA 3RI8A 1UW8A 3PMEA 1YWKA 4JGZB 1AR71 3BIWE 1H9PA 4NOTA 5DZEA 5DZFA 4AQSA 3WHTA 1U5XA 1C8M2 4YVWA 4CEWC 4J1WA 1ASJ3 3FBMA 3POYA 2D6OX 4CDWA 2HWC1 3LKJA 4BQ1A 1JUHA 2X53S 4MUVA 2WL1A 4L97A 4XF0A 1CONA 2QZ2A 1MS9A 4XJWA 1FYUA 1XE7A 1POV3 1GNZA 2Q30A 1NCQB 1DF0A 2CTVA 4NO4A 2O1QA 3ZFFA 4PLNA 4IEZA 1X8EA 2QNKA 4XTMA 5T55A 1C3HA 4AGGA 3JBG1 4YGCA 2A6XA 3FFQA 1B09A 3KM5A 4M3CA 2CY6A 5H9RA 4B7EA 2BVBA 2ETEA 3H7JA 2HWE1 1UPSA 4LBQA 2PHTA 4M3CF 4BLIA 4L9BA 5GZFA 2HWF3 5JIUA 1PZ8A 2YUEA 3CU7A 4WV8A 4WVZA 2EXHA 1V9U1 3SLIA 4Q8KA 1QJY1 2BW8A 3LOIA 4HSJA 2ZX0A 5JSRA 4HK8A 4AHXA 3BPZA 2LALA 2WJSA 4Q4W2 3IIAA 3KGZA 3KZ4C 4FP3A 5KXEA 1Q8VA 3ACLA 4KWLA 5C4WB 4I3PA 4COZA 1UPIA 4RHV2 3ZFGC 1D4M2 4XXPA 3ROUA 3WQ1A 1J3RA 2I45A 2PHLA 5DDJ2 4FAHA 5C33A 1NXD1 3KT7A 2HWB3 3ASIA 2R042 5CG8A 3CF6E 3ES4A 3HBZA 2AENA 2EAAA 3EXUA 2H0VA 4IV1C 1PO22 1O3QA 1JH5A 4R9DA 1QNWA 3PVEA 4TYSA 3UV9A 1Q8PA 1HXS1 4B29A 4Q1PA 3JZVA 1RUI2 3ZSMA 1OPMA 3WUCA 1QXPA 3WW2A 4Q4X3 4YZ4A 3TN93 3NW4A 4K7JA 3ZMOA 5FLIA 1XNCA 1YYNA 3I7DA 5CFCB 4IL7A 3WG1A 3MIDA 4IXLA 2RMU3 1TME1 3FHIB 1UAIA 1F5JA 4IEPA 1BEV3 3D5OA 3HN1A 1H8TA 4Q4V1 3G6JB 4S2HA 5FMOS 3VZOA 4BZ4A 1KQRA 2RS12 3SCFA 3JCIA 3MLKA 3LCPA 4HFSA 5ACA2 2ZGMA 4U36A 4GMP0 1TNRA 1EPWA 4AFCA 5DUVA 5F6KA 3RWNA 3BB6A 4XFIA 4XFBA 4BMEA 1OA2A 2DCYA 4OI0A 4GH4C 3D8CA 1ZNPA 3FUQA 2QE3A 1M06G 1AR73 2GN7A 2IXIA 4Q2FA 1FOD2 5GM0A 3SNMA 4E4ZA 1E57A 1KS5A 1LR5A 3V0AA 2R16A 3AYEA 1R092 4B4RA 2UWBA 3PJQA 4AVAA 3PVNA 1PNFA 5DG2A 2VXRA 2HWC3 4W6XA 3NAPA 2HEYF 4AW7A 1NY71 5JMCA 3MIHA 5CFDA 1ZZBA 4Y4YA 3C3VA 3ILRA 1VBD1 1OLQA 3TYJA 3PLQA 5D8AC 4CEYB 2ZGTA 2WNVB 2VPVA 4Q4Y1 5CG9A 2VW1A 4BHPA 3VZMA 1SFNA 2BEOA 2RJKA 1YLLA 1MEC2 1LECA 2DF7A 4SLIA 2ZHNA 1CPMA 4XYXA 4YVSC 4KG8A 3B3QE 5EZWA 1U5IA 4YARA 4MH0E 4ZU4A 1LEDA 1ULFA 4L11A 4X6RB 4XQDA 3VLBB 2WSUA 5FO8B 4FOVA 2HWE3 1AL23 1WLCA 1WLDA 3SCHA 3ZIXA 1RIRA 1RUC1 1CGPA 2PLV3 3SH5A 4Q4X2 2D97A 3RS6A 1SMVA 4KBBA 1X33A 2BWAA 3SITA 4YVWC 2I2SA 4LBLA 2YV8A 3MW3A 5KC6A 2B9UA 2GMEA 4CDWC 3HR9A 5KC5A 3H7YA