2EIGA

Lotus tetragonolobus seed lectin (isoform)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
VSFNYTRFKDDGSLIFQGDAKIWTDGRLAMPTDPLVNRTTSHALYATPVPIWDSATGNVASFITSFSFIVSNVQRYPPTDGVVFFLAPWGTEIPPNSQGGYLGITDSSNSQNQFVAVEFDSHPNVWDPKSLRSSHIGIDVNSIMSLKAVNWNRVSGSLEKATIIYDSDTKILTVVMTHQNGQITTISQEIDLKTVLPEKVSVGFSATTWNPERERHDIYSWSFTSTLKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a new quaternary association for legume lectins
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 50
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eigA00
5AVAA 1A78A 3AZVA 4LBQD 3AZYA 3BTAA 3ILFA 3V0AA 3PVNA 1AXYA 1BZWA 1VLNA 1JW6A 1LU2A 2WNEA 1UPSA 2R0FA 1ULFA 2ZGTA 3PVOA 1HLCA 4K20A 1CR7A 1G9FA 2YXSA 3FBYA 4HL0A 3N36A 3WHUA 4BOWA 5BYNA 3ILRA 4K1ZA 1NXD1 2RHPA 4R9AA 4P9YA 3AP5A 2D6KA 1KJRA 2OUHA 3L2YA 2A3YA 4FP3A 3ASIA 4GA9A 3GNEA 4XE9A 1N47A 2ES3A 1VAVA 4YM3A 1GICA 1HKDA 3R4SA 4XTPA 1V6LA 2EAKA 5T5PA 3JU9A 3M1HA 1QNWA 1W6PA 1ENRA 3A0KA 1BQPA 4YW5A 1S0IA 4SLIA 1SLIA 1N1VA 2R49A 4Q2FA 4XYXA 1IS5A 1YRZA 1QF3A 2JKBA 1LHWA 3VKLA 1ZA4A 3AXEA 5CBLA 3TAYA 3GALA 1H9PA 3ZXKA 3FLRA 2DU1A 4PBOA 4XJAA 4HANA 1UMZA 3AZZA 1PZ9A 2DVGA 1Q8SA 1LECA 3O0WA 3SLIA 1FNZA 3LSDA 3ZSMA 4DQAA 1MVEA 1QDOA 3RMYA 3ATGA 3OBTA 1LOEA 2PHRA 4P9XA 5GLWA 4Y1XA 1MS0A 2ZMKA 1RIRA 1KITA 3WDXA 2TEPA 1C4RA 1W0OA 3IKWA 3MEPA 5JOXA 2UWCA 4WZFA 1IS4A 2ZGPA 3WV6A 1S0CA 1GSLA 4JRAA 4LBJA 4YW1A 1EPWA 1DQ6A 2UWBA 2P3JA 1A8DA 2V5YA 4RA0A 4UW3A 1DYKA 2CL2A 3RSJA 1SACA 4YGDA 4FOQA 3AP7A 3VKFC 1LOFC 1O4ZA 4YFWA 1F9KA 1WBLA 2NM1A 2PHXA 4YW4A 3V0BB 1WLCA 4F83A 3POWA 3FLPA 4DRRA 4FQ4A 1V6JA 4PBPA 1UZZA 4LBLA 1W0PA 3HN1A 4Y22B 3AJYA 1N1TA 1HQLA 3AYDA 1LEDA 3UJOA 1LTEA 3D4KA 5IK4A 5KXBA 3R05A 4YGCA 1LODA 2OW4A 1H9WA 1CVNA 4C1WA 1N3OA 3U4XA 3POYA 2NMNA 2DUPA 2ZHLA 4Q1RA 5IK8A 4RL7A 1DQ0A 1FATA 3WG3A 2E7TA 2YV8A 3UL2A 5GLVA 2PHUA 2OVUA 4KBBA 1CPNA 3OYWA 5T55A 3B9CA 5T5OA 4FPJA 5DG2A 5JLVA 1UAIA 1W6MB 2A6YA 2ZGKA 2ZMLA 4L8QA 4Y1ZA 4BPZA 1S0FA 1ENQA 1GNHA 2PHTA 2GNMA 3FUOA 2DVFA 5DUXA 1AXKA 2CTVA 3WG1A 2ZHMA 1UZYA 1GZWB 2ZBJA 1DQ1A 1GANA 1DFQA 1LESA 2G4IA 2EXIA 4W65A 1IKQA 4YZ3A 1D0HA 4WV8A 4XJ8A 4AVSA 4ATEA 2WSUA 3ZYPA 3M2MA 1S1AA 2NYYA 1ZM1A 2ERFA 4K21A 4XJUA 3SH4A 3IN9A 3AFKA 3B69A 3ILNA 2ZZJA 3PVEA 4XTMA 4BM8A 4CRQA 1SLCA 1Z78A 1AZDA 2D6OX 2FHRA 4FPLA 4XZPA 2VW2A 5DG1A 1YIFA 3W58A 5EYYA 3WUDA 2WLQA 4M3CA 3N3HA 4AVTA 3O0XA 2WSVA 3WDWA 1QOOA 1N3QA 1JHNA 1W6MA 5E89A 1N3PA 5GLZA 5GZDA 1MS8A 1O4YA 2JE7A 3IM0A 1KDKA 5DZGA 2GMPA 2A70A 2WT0A 1AX1A 2ZGSA 3ENRA 1S0JA 2VY0A 1FV2A 4UW6A 2DV9A 2VH9A 3WLUA 2A6VA 3V0BA 5GZFA 1KQRA 1RITA 3HR9A 3AP4A 4P14A 3V64A 4YZ4A 1Q8PA 2ENRA 4Q26A 4D69A 2YZ4A 1SLLA 3FFZA 1AVBA 4I30A 4XXPA 2A3XA 3N7LA 4UW5A 1XQNA 4AGRA 1S0DA 3NV1A 1GBGA 5E8AA 1G7YA 3PJQA 2A7AA 4Y1UA 4ZXKA 3T1MA 1LGNA 1SLTA 1UX6A 2YMZA 3CNAA 1QOTA 1YXWA 4GALA 4YZ2A 4NOTA 2LALA 1QMJA 2A6ZA 3BIWE 4YGEA 1LENA 2W39A 3FLTA 1LGCA 4YM0A 1PZ7A 2ZHKA 1VIWB 4AGGA 5JVVA 2XB6C 2UU8A 3IMNA 2VU9A 2JD4A 1JUIA 3ZVXA 1CIWA 3NWKA 4XOGA 3ZSLA 5GALA 2DUOA 3PMEA 3I8TA 4DRVA 2DUQA 3SISA 1WW6A 1ULCA 3C2UA 1JN2P 2ZGOA 1JYCA 3RQ0A 3USUA 2R1BA 4OZXA 3WDUA 1AF9A 2ZABA 2JECA 4FPGA 4ISRA 4JC1A 5CAZA 1HQWA 1LOAA 5JDBA 2DYCA 1LU1A 1QDCA 3LSEA 4ATFA 5JMCA 2VW0A 1F5FA 5KXCA 1IOAA 2DVDA 3B3QE 1QU0A 3MPPG 1JXNA 5GLUA 3M3EA 4XMIA 1B09A 1C1LA 4Y1VA 5E88A 1W6QA 2P37A 4FPOB 3RG0A 2R1DA 3DGTA 3ZXLA 4FPKA 1WW7A 3JUUA 1G8WA 3RRDA 1SLBA 3WDTA 1S0GA 3N7KA 2A71A 4YW2A 3T1LA 3AK0A 3FUQA 4GXLA 1WLWA 3DUIA 5EWSA 4TZDA 1YYNA 1WD3A 1FNYA 2CWMA 1DYPA 1G86A 3O5SA 4M3CF 1ULDA 3WCRA 2WKKA 5GM0A 1JOJA 1URXA 2JDZA 4M3CE 4XBLA 1LCLA 3A0NA 3WDYA 1RINA 2JJ6A 4FP2A 4FPHA 4Q8LA 3ZSJA 1SCSA 2AH2A 2ZGMA 3WDVA 1Z0HA 1C1FA 2CWSA 2PHFA 4Y26A 2H0BA 3ZXJA 2EALA 2OUJA 3V65A 4DPNA 2KM2A 1G9AA 4CZSA 1W6NA 3R4UA 4R9BA 1W6NB 2ZGNA 2HYKA 3HMYA 4BLJA 5H9RA 3O0VA 1ULEA 4AVVA 1JYIA 1SFYA 3SH3A 4Q1PA 4NO4A 2Q5TA 4Z8BA 2ZGUA 5SV8A 3AP6A 1MS5A 1MZ5A 1V6NA 5FREA 3SNMA 1GNZA 4Y20A 4BMBA 2GMMA 2NZ9A 1G9BA 4GKYA 4XILA 1LGBA 2EIGA 3QLQA 4FPFA 1MS1A 2UURA 2D44A 4YW3A 1LHUA 4BQ1A 4Y24A 4ITCA 2P3KA 3N35A 3APBA 5JOZA 3BOPA 4ZKTB 2GALA 3BODA 1YO8A 2A3WA 2YROA 2ZA9A 5T5LA 3M3QA 2WQZC 3MW4A 3WZ1A 2E51A 4XBNA 1D2SA 2GMEA 2PELA 4YG0A 1G9CA 1FAYA 2E53A 4UW4A 2GN7A 1MR5A 5EXOA 1WW4A 1IS6A 1G9DA 3UK9A 5LK5A 4Q27A 2W68A 5DZEA 2NMOA 2D6LX 4BLIA 5GJ6A 2ZKNA 3USUB 2DTYA 4DFSA 4XHXA 2EXKA 3NV3A 1WW5A 4PCRA 1AJOA 4LBKA 5IT6A 2CY6A 2AGSA 1DQ5A 2W08A 2FMDA 1LHNA 4Y1YA 3WHTA 4M01A 5GZCA 2D3SA 5JOWA 5JOYA 1VAMA 5IK5A 1Q8VA 4FQZA 1GLHA 2NN8A 1Q8QA 2ZMNA 3AYAA 4PF5A 4XIOA 5DXDA 3D6EA 4R9DA 1Q8OA 3MW2A 5H9SA 1WLDA 1WD4A 2AENA 1DIWA 2DURA 4YZ5A 1MS9A 2WT1A 1H30A 3N7MA 3VUOA 3OBRA 1SBEA 2DU0A 4LBQA 1AX2A 1FYUA 2AYHA 1A3KA 2WT2A 3N7JA 1QGLA 4YZ1A 4GWMA 2V73A 2LTNA 4DS0A 1KJLA 1LULA 1MS3A 1S0EA 4IQPA 4GWNA 5IK7A 4XBQA 3KQRA 2A6XA 2EXHA 1Y7BA 2R0HA 3AX4A 3M3OA 3H0OA 5CA6A 2B7YA 3IPVB 1TEIA 1W6OA 3I4IA 1W6OB 2D6NA 2C9AA 1GZ9A 4FPEA 3AZXA 5T52A 1GZCA 2ZGQA 3RS6A 2GDFA 3AXDA 3VKMA 3KM5A 1OKQA 5DUWA 5GLTA 4FPYA 1MS4A 5CB7A 3MW3A 1BXHA 2YY1A 4Y22A 1UL9A 5KXDA 2ZAAA 3T2TA 1MVQA 4JCKA 1LOGA 1MACA 3VKNA 2VUAA 1WUVA 1Q56A 2GNDA 4XIKA 5IUQA 4K1YA 1CPMA 2ZGLA 1N1SA 4U36A 4BMEA 4XDQA 2GNBA 1QOSA 1W6QB 1W6PB 3ZXFA 4YFZA 1LJ7A 1NLSA 1CESA 4XXAA 1ENSA 2CNAA 1DBNA 3M3CA 4ASMB 2AUYA 1R1ZA 1DHKB 3AYEA 3RMXA 1APNA 1YI7A 2XG3A 4P9WA 1DQ4A 1S0BA 4M3CB 5H9PA 1OQ1A 4YGBA 4R9CA 1VALA 3ZXEA 4AGVA 2DWRA 3OYWB 4LBOA 5F9TA 1JBCA 2UWAA 1QKQA 2DVAA 1AXZA 1C57A 2ARBA 4GKXA 4XMAA 4Y20B 2JE9A 3TB0A 1LHVA 3WG2A 4WVVA 5KXEA 4XHBA 1GYKA 2E6VA 3IPVA 5DUUA 1FX5A 1WBFA 2AR6A 2D6PA 3NV4A 4YM2A 3VV1A 1U0AA 4MYEA 2D7FA 3OGGA 1ONAA 2ZHNA 1LHOA 1GZWA 3O12A 2NP0A 3ZYRA 4LBMA 1IS3A 2AREA 2A5ZA 3B01A 5F5QA 2P2KA 1QNYA 2GNTA 1F31A 5T50A 1LOFA 5T54A 1J1TA 1CQ9A 1BKZA 1V6OA 5GZEA 5L73A 4FOYA 3D5OA 1LEMA 3OPZA 1LOBA 1BJQA 1IKPA 1PZ8A 1DZQA 1V6IA 3QCWA 2E7QA 2VW1A 4H55A 1V00A 2CYFA 5FRAA 2R16A 2Z42A 1MZ6A 5DUVA 4AYUA 1CJPA 1SBFA 3AJZA 3AP9A 1I3HA 1HDKA 1SCRA 3POSA 3WOGA 3ZSKA 2D6MA 2ZGRA 3WVJA 4XJWA 3B00A 2ZACA 2EF6A 2P3IA 2A6WA 3OY8A 3WNXA 4Q8KA 1SBDA 1GV9A 4FVVA 3OY8B 4U2AA 4XJ9A 4AWDA 5GZGA 3NV2A 1DGLA 3LCPA 3WUCA 5HCAA 4YG6A 1KDMA 4LBNA 1V6MA 1AJKA 1ULGA 3UJQA 5HCBA 2C5DA 3V0AB 2ARXA 4YM1A 2D43A 4LBQB 4CTEA 3AYCA 3OJBA 3VKOA 2GN3A 4M00A 5DZFA 2SBAA 2D3PA 4XJZA 1V6KA 1GKBA 2D3RA 2I2SA 3W59A 5EYXA 1DQ2A 4FOVA 3AZWA 3WCSA 1X50A 3Q9OA 2A75A 5CNAA 4YG3A 5T5JA 3INAA 1FV3A 5H9QA 4TYSA 1AX0A 1SLAA 2P34A 4FOWA 2PHWA 1UKGA 2DVBA 2WJSA 1DLLA 2DTWA 3WG4A 1KRIA 4WVWA 2EXJA 3ZPYA 1UN1A 3SITA 1WCSA 1LOCA 1I1EA 2SLIA 3A4UA 1CONA 4PQ9A 5HCFA 2BQPA 1N1YA 2W52A 4ISQA 2VXRA 4C1XA 4FPCA 1CN1A 4YLZA 1OFSA 3SH5A 1BYHA
chains in the Genus database with same CATH superfamily
3WW4A 5KC6A 3B5LB 1PNFA 4KGQA 4E8CA 1OMIA 5AC93 3GCXA 1LU2A 2OQ7A 4XF3A 5IAXA 3GDBA 4WVMB 2ZX0A 1OOPA 1ULFA 1GFF2 4K20A 4AEDA 4I02A 3N36A 3LFMA 2JDKA 5IW0A 1RUF3 2OUHA 5FXXA 4N9HA 1ZZ7A 3FHAA 4ZZ8A 2FZ2A 1GICA 5A3OA 3T4HB 1JZ7A 2NQYA 1SDDB 4LIVA 1V6LA 2C26A 2VJXA 3M1HA 3QOPA 1BK1A 2X8KA 1ZVFA 2HWE1 2XGXA 4YW5A 3GZTB 1S0IA 5D21A 3SHRA 5F2WA 2WNUB 4AW7A 1N1VA 4XYXA 4AI3A 2OX0A 3ACHA 1Y9GA 1ENXA 3KD4A 3PVBB 3PTRB 2W1QA 4RFRB 1DCSA 1LHWA 1RUG2 1HN1A 1H9PA 3ZXKA 4YW6A 3FLRA 5L36A 2DU1A 2R32A 2WZR3 4MX3A 5CU1A 4E2GA 3SLIA 1OI6A 5AFBA 2VC9A 5C6CA 4W8JA 3BIEA 4JTOA 1ZX5A 1MVEA 1OXCA 1UYXA 3FWEA 1QDOA 3ATGA 1UF2C 3OBTA 1R081 2PAKA 3J7LA 4FFFA 3BU7A 5KHHA 4P9XA 1YCIA 5GLWA 1MS0A 3B9IA 3WNOA 5EP9A 3LD8A 3WDXA 2VGDA 2JXAA 3LEMA 4PI2A 1QH6A 1C4RA 4NHMA 2BZDA 3HBZA 1RUF2 1UU4A 3HJRA 3WV6A 1VRH1 2JDNA 3E97A 4RA0A 2V5YA 2PMWB 3RZKA 3CEWA 3RSJA 3C3VA 4YGDA 3ZFFA 4CDUA 4FOQA 3AMNA 4GMP1 4QX1A 1VRH3 1LOFC 4XCAA 3UESA 3TEYA 4EE2A 5JZGA 4F83A 1X7NA 2E26A 4QHZA 4N8MA 4L2NA 2B39A 1YUDA 1SFPA 3I3MA 3AYDA 4YVSB 3S6PA 1LEDA 2UY9A 1AYM3 1IPJA 2IXKA 3K2OA 4AI1A 4RR3C 4PDWC 4YGCA 1LODA 2OW4A 4DXTA 1B35B 1WMEA 1BK0A 1PVC2 2WO2A 4MXWB 3H8RA 5AFEA 3POYA 2XWBB 2DUPA 5FMOS 2F4PA 4QQ2A 3HNMA 4RL7A 2CGOA 2E7TA 1PO12 1BEV1 3UL2A 1UZWA 4MG2A 3IDCB 4AFMA 5APAA 2OVUA 3J9SA 2IFWA 1V9U1 3CIHA 4C8DA 2VZVA 5FIXA 1UAIA 1W6MB 2ZGKA 4L8QA 4Y4YA 3U14A 1C5HA 2RMU2 3VBRB 3WP5A 1XXNA 3DXUA 3THTA 2PHTA 2GNMA 4NJ4A 5L9VA 2DVFA 1CIYA 4XC9A 5DUXA 1IPSA 1LRHA 3PJYA 3WG1A 2ZHMA 1QJEA 2XLAA 4Y5TA 2JB4A 1RUJ2 4IDZA 4QHOA 4HBNA 3Q8CA 1QJU1 1IKQA 4COZA 5CKMA 1TNRA 4AVSA 1W2OA 4GWIA 3M2MA 4N53B 3ZYPA 1WCKA 1K42A 1L3JA 2ERFA 3QACA 5FZHA 3SH4A 3WX5A 3IN9A 3MO4A 3PVEA 1V9U3 4OHZA 4CRQA 3VZMA 3AFGA 2L9LA 2HBUA 1ND3B 2D6OX 3C8XA 5FKCA 5FY8A 1YIFA 3W58A 4HLTA 5EYYA 3QBQA 4XAEA 3WUDA 3H50A 3I2GA 3O0XA 5FYHA 1CAVB 4TWTA 1UOJA 3N4MA 1Z7S1 4H3WA 5LBCA 1NX9A 1N3PA 5GLZA 5GZDA 4AHYA 1MS8A 2JE7A 1OA3A 2XQXA 2Q1ZB 2GH8A 2GMPA 5FQ0A 3ENRA 2CDOA 2JICA 2FDFA 3WNNA 2VUCA 4JKKA 4UW6A 1ZYBA 2DV9A 5FLJA 1K12A 4QM8A 4LLFA 1KQRA 3JB8A 5I91A 3AP4A 3V64A 1U5YA 2J1RA 2ENRA 4Q26A 3T0BA 5G04L 2YDEA 4IE0A 5I0UA 4DUWA 4Q29A 3FBMA 1W8UA 4XXPA 1QH7A 4UW5A 1XJAA 1UOBA 4AGRA 1CAXA 3KCXA 5C5UA 2E31A 3NV1A 1T6BX 5F6LB 3RI8A 4OQ8A 5EJZB 4O9GA 1UX6A 2YMZA 3VBSA 2G19A 4NOTA 1NCRB 4NMIA 1QMJA 5FXVA 5J98B 3CHXA 3BIWE 5JI7A 3VDDB 4MO3M 1TE1B 3JBG3 4EN9B 5ACA1 2ZHKA 4N9IA 1CZSA 4CP9A 5C3QA 4W50A 1J58A 4CPBA 4XQ4A 2XB6C 3T2PA 3EO6A 1MEC3 1KS4A 3JQXA 3BI3A 1TME2 4EWDA 4IW3A 4XOGA 3VL9A 2VECA 2YC4A 3I7DA 5E16A 3I8TA 1AR81 4JAAA 2XVGA 1MEC1 1VBE1 1ULCA 2VBPA 3LA2A 1PIV2 4YWAA 3TN93 3O1PA 4DXZA 2JECA 4ISRA 2ORZA 3OCPA 4KG8A 5LASA 1HQWA 5A32A 5FZAA 1LOAA 5LEJA 5FMCA 5JDBA 1W2TA 2XLFA 1LU1A 1NKGA 1AR63 4ONUA 3G6JB 2VW0A 2BFUS 3R6SA 4JKMA 3ZYIB 3MPPG 1A6CA 5FPAA 3E6BA 1VBE3 1NCQB 1AYN3 1UX7A 2F6BA 3M3EA 2CGNA 4CP2A 4I0AA 2PQQA 3RG0A 1TME1 3L9JT 3LAGA 1SQ4A 1NT0A 3RRDA 1SLBA 4XZUG 4CCKA 1S0GA 4ZONA 4LK6A 3NJYA 1HJGA 4LKFA 2HWF3 2VULA 2ZEYA 2A73B 4CUBA 3FUQA 4P9GA 4GXLA 1QJFA 2XJTA 1WD3A 5FY5A 2HWB3 1DYPA 1UY1A 2I07B 3KF3A 1V9U2 3MUZ1 1ULDA 4L0PA 4NROA 2ZX1A 2WKKA 1O3RA 5GM0A 5KWRA 2JDZA 4XBLA 4BH9A 3ZSJA 2PXJA 3RZZA 1O4TA 2XJRA 4UFKA 3BYWA 1OOPB 4A2UA 4XW3A 4N43B 1J59A 4Y26A 3ZXJA 1RHI3 5A80A 1WA6X 3N9OA 3QH6A 5LA1A 2JE8A 2D97A 1RVF3 4LK7A 1G9AA 4EN6B 4CZSA 1UXXX 3R4UA 3J8F2 1DYOA 3K4DA 4HFSA 2ZGNA 5J1XA 3MLJA 1YFUA 5B2GB 2K46A 2YBKA 3O0VA 4P9LA 4AVVA 2RV9A 2VZOA 3SH3A 4Q1PA 4YVSC 2W1WA 1NYWA 5I8SA 4D7YA 1YQ8A 4RR3B 3ZKYA 2R071 2BW8A 3AP6A 1PIV3 1MS5A 3KF5A 4WM7C 4KGGA 2Q8OA 4GWJA 3UKVA 2VOWA 2W9XA 1YQCA 4RS5B 5IYYA 3POEA 4WZCA 4GKYA 2W1SA 3H9AA 4CDXA 4XFHA 1GOFA 1BLZA 2JG9C 1JOBA 1JS9A 2D44A 2UURA 1YFWA 1LHUA 4BQ1A 3DCQA 1OLRA 1US2A 3BOPA 4ZKTB 1PGSA 4EZ4A 2WZR2 2YROA 2ZA9A 2Q1FA 3CLPA 5T5LA 4OI0A 4XDOA 1QJU2 2Y60A 2GMEA 1W04A 3NKTA 3SXWA 2JDPA 1CAUB 1HRI1 1XYOA 2VMCA 5J96B 2D5HA 1X82A 4BWOA 1J3RA 3UK9A 2D40A 2WL1A 2BPA2 3POBA 2R30A 1W8FA 4B1MA 5GJ6A 4D3WA 3UGGA 1C28A 3USUB 1XPWA 2YYOA 2EXKA 4N53C 2EA7A 4XHXA 4OYUA 2XDVA 5G05L 3HBKA 2RJLA 1AL0G 3RI9A 4AFBA 3NJZA 1D4M2 4Y1YA 3VBHB 5JPMB 2QQMA 5IK5A 2J42A 2ZMNA 1Q8QA 4PF5A 5IVFA 2WAAA 1ND3C 4XIOA 2MHFA 2WN3A 4NPMA 5F5CA 4AI2A 3MW2A 5H9SA 5CFDB 2VQUA 1DIWA 5BUVA 2ZS6B 3ES4A 3M3IA 5DAQA 5SV5A 2WT1A 4CDQB 1H30A 1XNTA 5DAPA 2DU0A 2PTMA 4LBQA 1FYUA 5FJHA 4CCEA 4J1WA 1U12A 1EUTA 3POFA 4JQTA 2LTNA 1KJLA 1S0EA 2X09A 4IQPA 4M0NA 3TEXA 1SEFA 2W91A 3MUY1 1BVVA 3NVCA 2R0HA 4Q4W1 5LBEA 3VZNA 2R041 1O5LA 3I3EA 2VOTA 1TEIA 1NY72 3D0JA 4Q4W3 5FYTA 1W6OB 5J3UA 2WWJA 2C9AA 1GZ9A 3MZHA 2IVJA 5LBFA 4G4FA 1H2MA 2WYFA 4AR2A 3VKMA 5DUWA 1PK6B 5GLTA 4FPYA 5IVVA 3LIGA 1RTVA 4Y22A 5KXDA 1MVQA 4JCKA 4HN0A 3HN3A 1LKNA 3P6BA 4LO5B 5EQUA 3T0AA 2GNDA 1JOPA 4XIKA 2O1QA 4BMEA 4CSWA 3URFA 1H6XA 3AC0A 1V0AA 1W6QB 4Q4V3 5K0UC 3ZXAC 1NLSA 1NY71 2WNUA 3I2FA 3M3CA 3I97A 3H7JA 1UIKA 2R042 2ZZQA 1R1ZA 2ZPXA 1YI7A 4K8RB 4P9WA 1RUG1 4M3CB 5H9PA 5C9AB 1EYBA 4YGBA 5C70A 2JG9A 5F9TA 3OYWB 4EN8B 1DF0A 4AEJA 2DVAA 1AXZA 1C57A 2LUWA 4MXVA 1HB3A 1R093 2JE9A 4XMAA 3WG2A 1ZBE3 4WVVA 1DP0A 4XHBA 2ATFA 2E6VA 1GYKA 5BNOC 2AR6A 3NV4A 2C0ZA 1ULOA 1U0AA 1YJLA 3GXUA 4MYEA 1IQDC 5F7UA 3N9QA 4NHLA 5HPOA 5IHRA 2BGPA 1ONAA 3D0SA 4O9EA 5F3IA 4CXXA 3KV4A 3S0MA 2YPDA 2F17A 4HKLA 1QQP2 3ZYRA 3TOJA 2WZ8A 5F5QA 2A5ZA 2JX9A 3SCFA 1RMU2 2RDQA 2BU9A 4IEXA 5J09A 5GZEA 1BKZA 3RJ2X 4QQLA 3H3LA 4LKEA 1L7QA 2ETEA 3ACFA 1LOBA 1BJQA 4IEYA 1DZQA 2CV6A 4H55A 4I01A 5FRAA 1CAXB 5HXVA 2JEMA 1MZ6A 2B9UA 5FYCA 1REDA 1VMHA 1HDKA 5A3TA 3DYMA 1GP5A 4XJWA 3VDAA 5FDBA 3TN92 1RHI1 3VBFB 2A6WA 2CSGA 1ODMA 2QCSB 4Q0UA 1GU3A 2G1MA 2QFEA 3OPWA 3OY8B 1NZCA 4XJ9A 4AWDA 4EN7B 5GZGA 5L19A 5DAVA 5FZKA 1VBC3 3WUCA 4OFGA 3R4DB 4A3ZA 5JUVA 1S55A 2WC2A 4LBNA 2VZ3A 4CE8A 5A70A 1JZ2A 1DGWX 1YEWA 2VNGA 1AYN2 2HWD3 3OJBA 4DNYA 1AR92 1RUH2 2HWB1 4CP1A 5JIUA 2GP5A 3W59A 4IGOA 1PK6A 4MLOA 4Q4V2 4TTGA 3S5AA 3AZWA 1R083 2OQ6A 2VG9A 3AMPA 3OOXA 2R063 3Q9OA 2XPJA 3U07A 4B29A 3A22A 1FV3A 4MGIE 2Y0OA 2V4VA 4DINB 1ASJ2 1T6GC 4QX3A 1SLAA 2P34A 4FOWA 4KNCA 4NHXA 2MNGA 4XEZA 5FZ7A 5D1IA 2DTWA 4BQ2A 4IE7A 1OQDA 1DG6A 4MXWA 4Q0SA 1F2NA 1I5ZA 3ZPOA 3CZUA 2QQLA 2R6QA 3RYRA 1X8EA 5B4XA 4RS5C 2XBO1 1W8TA 5FOBB 3K77A 5C9AA 2VMHA 2CAVA 1W3XA 2JG9B 1WCDJ 1N1YA 2HWE3 2VZ1A 4IE5A 5IVEA 4YVWA 5FMOL 2BDRA 2NYYA 4XF1A 1OFSA 5LBBA 3VKNA 4C1XA 5AVAA 1A78A 2HWC3 3I2KA 4GH4A 4LBQD 4S2HA 4V2WA 3BTAA 3ILFA 3W9AA 4EN0A 1AXYA 2WS91 3GZAA 4QDQA 2ZGTA 5FR3A 3EXUA 2VOXA 3PVOA 1AR93 1RUH3 1SPPB 4B7KA 2YXSA 1POV1 3BALA 2O0OA 4GIQA 1UU5A 3ILRA 4A6OA 5M0TA 4AHWA 3THDA 3AP5A 1ND2A 2FCUA 2D6KA 2JG8B 4V2VA 5F8PA 1OD5A 3ASIA 5EZWA 2Y6LA 3GYDA 3R4SA 2CHHA 3NAPA 3ZYJB 2B42B 3UT0A 1W6PA 5FOJB 4CCLA 1C8M3 4XF0A 2Q4SA 4QGLA 4BIFA 2Y38A 3K51A 4A7YA 4LR4A 5CFDC 2CGPA 2JKBA 4XF9A 5JAXA 3MI8A 1ZA4A 5LRSA 3O1OA 1WCQA 2HWD2 3RFRA 4JX0A 4A41A 4GQ7A 1F8VA 4PBOA 4HANA 1SMVA 1UMZA 3AZZA 3WEZA 4XAAA 1PZ9A 2DVGA 3ACIA 4MGYE 3O0WA 5I0TA 2HWC2 5I8YA 1HRV1 1Z7S3 1FNZA 1CAWB 3LSDA 3ZSMA 3KV5A 3ST7A 3GM8A 5A6QA 1LOEA 1CX4A 1RC6A 4XVHA 2ZMKA 1W8OA 3CBNA 1ZNPA 1PO13 1OT5A 4PQQA 2B8MA 2WN2A 2QNKA 2TEPA 3TNQA 5CFCB 4RYDA 5HCHA 1JZ8A 1H8TB 1OF4A 3MEPA 2UWCA 4G3YC 3LOIA 2QQIA 4AEDC 1IS4A 5A7SA 4QX2A 3E5UA 1GSLA 3LA7A 1DQ6A 3O7OA 2EVXA 3JD72 1SACA 2W46A 3RJRA 2IC1A 3VKFC 1ULPA 4JGYB 2ZOEB 4K3UA 1E57A 3ZMOA 1XU1A 2VUDA 1WBLA 5LB6A 4Z92B 1XSQA 1WLCA 1A34A 3MIEA 3POWA 4DRRA 4PBPA 1UZZA 4KWJA 3ETQA 4RD7A 1N1TA 3MIFA 4KU7A 2PHDA 1NCQA 1PX4A 3UJOA 3MGUA 1LTEA 3KV9A 3PIJA 4E2SA 5KXBA 5C9AC 3MDPA 3FX3A 1H9WA 2PFWA 1N3OA 5A1FA 1NA1B 3J26N 5L7OA 1K5MA 2BWCA 2W87A 2Q8EA 3A21A 4Q1RA 5DABA 4YYOA 2VNVA 5IK8A 1ASJ1 1DQ0A 1FATA 1PIV1 4KWKA 3UKTA 5BNOB 3BPSA 2KA3A 2Y6GA 4IERA 5GLVA 3H1WA 1OFNA 4S2FA 1CPNA 5F5AA 1GUIA 5FY0A 2ARAA 5JLVA 2VBDA 1UCXA 2ZMLA 3UGHA 3HAGA 1C8NA 1ENQA 3KLSA 1OA2A 3FUOA 4LO4B 4LNVA 5FPLA 4EV0A 3D3AA 1AXKA 5LATA 2CTVA 4XABA 1E5HA 3BTYA 3BUCA 4QT6A 4B1LA 1GZWB 1UZYA 1DQ1A 3LQCA 1GANA 4N43A 1R1A2 4YZ3A 3DPRC 4Q4Y2 3VZJA 5FP4A 4XJ8A 5JXJA 1G6NA 1OA4A 2WS92 2WSUA 5FUPA 4KH9A 1Y4WA 5FPBA 3AFKA 4PIZA 3MYXA 2XHKA 3B69A 3ILNA 2ZZJA 3GJAA 4QU2A 1EAH2 3W5MA 3VBFC 3NL1A 3IAPA 3AMHA 2KD7A 3CO2A 3OGJA 1AZDA 4Z2WA 3H8OA 2JB8A 2VW2A 4RR3A 4LUKA 2XJQA 3S57A 2WFF1 1PO21 2DF7A 2WLQA 4M3CA 2QVSB 5BNNB 3ZYFA 4KWUA 3KHBA 4BA6A 2X5IA 5C8CC 1JHNA 1W6MA 4QQHA 1VBD3 5E89A 3VZKA 2PQSA 4FO9A 4NPRA 2ZGSA 2A70A 4K6BA 1RUI3 4XFAA 3ITQA 1CZVA 1WA4A 2IUWA 2VY0A 3D82A 2UYBA 2VH9A 3BN6A 3WLUA 4CEYB 1S2BA 2J22A 1RITA 3F2ZA 2LRPA 4FFIA 4NHYA 4P14A 4R8HA 1Q8PA 1AR62 2XBO3 2YZ4A 4QXBA 1SLLA 2VZTA 4RGGA 2ID4A 4N53A 3W5NA 4QX0A 1YFYA 2VBBA 1JODA 3TEZA 1J83A 3IB3A 3WP6A 2XOMA 5A6XA 1XQNA 5C7GA 2IXJA 5BNPA 5E8AA 4K8FA 3PJQA 3NNMA 4ZXKA 1SDWA 1LGNA 4L99A 2ET7A 3I2IA 1JH5A 1BBT1 1SLTA 2VOKA 1QOTA 2WRAA 1RUJ1 4DO0A 5JWPA 3O1MA 5A7NA 2C9KA 5FXZA 3J8F3 3HNBM 4IV1C 1XNAA 3KHCA 3VD7A 1DZTA 5J36A 3GZEA 3VHRA 1LENA 2W39A 5A33B 3NNJA 2Y6HA 2Y6KA 3UV9A 4UOJA 4IESA 4EWAA 1YQ5A 5AC91 1H1MA 5JVVA 1XYPA 5FLHA 2FDIA 2JD4A 4JGZA 1ZBE2 2RE9A 3AKPA 3NWKA 3ZSLA 1PMJX 2DUOA 1RGSA 1W8NA 2XUEA 3PMEA 5J37A 3K48A 1AR72 1WW6A 2YPJA 3C2UA 4GULA 4QPIB 3RQ0A 2W92A 3AL5A 2JDAA 3S5QA 3USUA 2R1BA 3LDKA 3WDUA 3I59A 3SKVA 4FPGA 1UY4A 2IXHA 2XONA 3ZSEA 3JBG1 2E9QA 3EMRA 4PHZA 3LSEA 5JMCA 1F5FA 5KXCA 1IOAA 2HWF2 1JYTA 1JXNA 5GLUA 2BOIA 4IL7A 1AYM2 5E88A 2GC2A 1OLQA 5HV4A 3CU7A 3ZXLA 1FMD2 4FTEA 4JDOA 2WFPA 2IXLA 3N7KA 3VBOC 5FZ6A 1H0BA 1VMFA 3T1LA 1FOD3 4LLOA 5A3LA 5BNNA 2XJUA 1UPIA 1OVSA 3C7GA 1WLWA 4TZDA 1YYNA 5EIYB 3CKHA 1D4M1 2AEYA 4N7IA 2CWMA 3WR0A 4EYUA 1GMMA 1VB4A 1Q3EA 1D4M3 5AC92 4A45A 4M3CE 4GB33 1H8TC 1LCLA 3HD8B 2P3YA 1RINA 2JJ6A 4FPHA 4XQDA 3NNLA 4Q8LA 5FLIA 2ZGMA 4CEYA 1C1FA 4Q0VA 2WDBA 5C33A 4BDVB 1IQAA 4BHPA 3H1YA 4HVRA 1QJU3 3MLKA 4WBBA 4DPNA 1XYNA 2W1UA 4JGYC 4ES9A 3TEWA 2OXBA 4K7JA 2JDMA 1W6NB 2DFCA 1UKRA 4HT1T 1RUNA 4Y5SA 2HYKA 5H9RA 3ZFFB 4QXCA 3USSA 4A7ZA 2JENA 1AR61 1D2QA 5FZ4A 1PX3A 3MIGA 5ABJA 5JZGB 1IGOA 5FUIA 5K9YA 3ZYHA 5EJ3A 5BNPC 2ZGUA 3PUAA 1X33A 4RFT0 4AI8A 4ARYA 1WMXA 4DUXA 4UF0B 1MZ5A 1V6NA 4HXCA 2TBVA 1AR83 3IZOA 2BRTA 1OF3A 5FREA 4HZFA 5EPAA 5F32A 2VNOA 4OI1A 3LKJA 3NW4A 2D5FA 2NZ9A 1FMD1 4HK8A 3HWJA 4QKBA 1LGBA 1TNFA 2D98A 2EIGA 3QLQA 1DLCA 4FPFA 4XILA 5LW9A 1MS1A 4LXLA 1W39A 3RNSA 2B45X 3WP4A 4D8MA 2QZ3A 2VAUA 2P3KA 4QX8A 3MIDA 1HIXA 3APBA 1TZOA 5JOZA 3BODA 1IHMA 2X10A 2A3WA 3M3QA 2WQZC 5CZKA 2E51A 4TLGA 4YG0A 1OVPA 5B4NA 1G9CA 1OHFA 1FAYA 3POJA 3M4FA 5T3NA 5DDJ2 1MR5A 3BGAA 1WW4A 3BPZA 5EXOA 3FJSA 4IE6A 4HMZA 4Q27A 2K0GA 3NKGA 2D6LX 4DB5A 1QXPA 5IWFA 1ZREA 4FTSA 3NV3A 1MQTA 2W0XA 4IEVA 1BMV2 3I3BA 5IT6A 1R1A1 2CY6A 3CMGA 1W2NA 3OB8A 4JDMA 3MBWA 3GHNA 3I49A 3PUHA 2IWGB 3WHTA 2XQRA 4BIOA 3HQRA 4M01A 4I2OA 2ARCA 2DBIA 4COYA 5JOYA 5JOWA 5FPVA 4BJ0A 1LAJA 2NN8A 4LQRA 5LK7B 3AYAA 5DXDA 2AACA 1F4HA 2WINB 2ZTNA 3VBOA 4OQ9A 4YRDA 1WLDA 2H0VA 4COUA 5BNNC 2OIIA 3K3NA 3ZFEB 2DURA 4YZ5A 2XJSA 2R043 1HRI3 1RUC2 2XJPA 3OBRA 3WF3A 3BTXA 1RJ7A 4P9JA 2AYHA 2Z69A 3N7JA 4KWLA 4GH4C 4LKDA 3T2QA 4YZ1A 3HQXA 3AL6A 3PHMA 4P00B 4EJRA 4QB2A 3S7IA 3NJVA 4QAWA 1R092 3IIIA 5CG9A 2YBSA 3H0OA 4EZHA 1F5JA 2B7YA 3SKJE 2FCVA 3MHZA 3VB9A 3I3DA 3I4IA 1T2XA 4FPEA 1AR82 5F39A 2RS32 2WAOA 2H6CA 5T52A 1HB4A 4XUTA 1GZCA 2ZGQA 5ABJB 5LA0A 2GDFA 4S2DA 4IGPA 1XNDA 1OKQA 3JQWA 1ODNA 1OURA 3KM5A 4XFIA 1MS4A 5FZ1A 5CB7A 3MW3A 3E1F1 2YY1A 4AQSA 1UL9A 2ZAAA 3T2TA 1GP4A 4NRPA 4LT5A 2YU1A 4RQPA 5LA2A 4KU8A 4A42A 4K1YA 3S7EA 1N1SA 4U36A 5CFDA 4DIQA 3O1SA 4YFZA 1W6PB 1LJ7A 4GJYA 4WVZA 2YBPA 1FPN2 1YQ6A 3C7HA 1NCRA 1PNGA 4LIUA 4QMAA 3KS7A 4AQ6A 5LY1A 3O1UA 1H8VA 4CCCA 4PDWB 2VCAA 1OQ1A 4FSJA 1B35C 1VALA 1W9WA 2DWRA 2WNVB 4LBOA 5FTTC 1JBCA 4Q4Y1 4E8DA 4X8NA 1O91A 3IIAA 5C71A 1ND2B 3ZM8A 1LHVA 2W95A 4ASKA 3ZVXA 1CAWA 4ASMB 1FX5A 3P3PA 2D6PA 4W6WA 3RWKX 2J7MA 3VV1A 3N9PA 3WY6A 4Z07A 2D7FA 2ZHNA 1I6XA 1LHOA 2BGOA 4XUOA 4FAGA 2GC1A 2EIDA 2NP0A 1BEV3 3TBDA 1PGW1 5FZGA 2PYTA 2VMIA 2P2KA 3K46A 1UY3A 4MGQA 1QNYA 2GNTA 2VCBA 1J1TA 2VTFA 1RUC3 3HOBA 2WR9A 4FOYA 1LEMA 4ZS2A 2HYXA 3FL7A 1IKPA 2E7QA 3BKZA 2CYFA 3OSDA 3OGVA 2QUOA 2R16A 1J1LA 2Z42A 4MVTA 4MZUA 5FZOB 5JPNB 1XNKA 5KR7A 3FC0A 1A8MA 4RGAA 5FK7A 4CEWB 5I0SA 2BNMA 2ET1A 1NLRA 1POV3 3LB9A 2P4EA 2ZGRA 2EICA 3ZX7A 1VMJA 4OZOA 4ES8A 4YPJA 1AR73 4QQOA 3B00A 1LB2A 2GP3A 3T0DA 5CKQA 2EF6A 2P3IA 1VBB2 4QD2A 2QQKA 1PM4A 3ON7A 4CDWB 4FVVA 3WF0A 1RUJ3 3FE5A 4IV3B 1KDMA 1WMDA 4IXLA 1POV0 4UFHA 2TUNA 3UJQA 3V0AB 3BCWA 4O65A 4KL1A 4NUBA 1RUI2 5AVPA 3JD71 3ZR6A 4JGYA 4BISA 4LHSA 3THPA 4BQWA 5DZFA 3ZLIA 4RSUA 4INDA 4R4ZA 4X8PA 2I2SA 3ZFFC 4FOVA 4CU8A 5A3MA 2VZSA 5F37A 4XFFA 1IG3A 1RUD1 4N7UA 2ILMA 1YJKA 3Q8BA 5JZGC 5CG8A 4I0WB 5H9QA 4CU7A 1XOYA 2DCKA 3H8UA 5A7QA 2WJSA 2DVBA 5FZEA 4NR1A 2XWJB 3OTFA 5FZ8A 3RYKA 2ZJCA 1HRV2 1QWRA 1OPOA 1UY2A 2PN5A 3ZPYA 1UN1A 5A7OA 3AM2A 3R0RA 2BVVA 3ZMNA 5J7MA 1VP6A 2P1BA 4PDWA 2PLV3 4PQ9A 3RZGA 1XNBA 3H3ZA 4FAHA 2ZEXA 2BQPA 3SCGA 4FTBA 2JDYA 3BB6A 2W52A 4L92A 4TXWA 4LUMA 4MOAA 3DXTA 1VAVA 1CN1A 2XL9A 2E63A 3VDDC 3AKQA 3AZVA 4GJZA 3VDCA 3LEGA 3PVNA 1BZWA 1VLNA 2ZEZA 3HVDA 1JW6A 4J6GA 1WMFA 4ZXEA 5C8CA 2R0FA 2GH2A 2O14A 3EYPA 1J3QA 2W5FA 4Y4RA 5FO9B 1CR7A 1G9FA 3FBYA 3TYJA 4HPKB 5ACA3 2XLGA 4K1ZA 2BUKA 2Y34A 3LWCA 4P9YA 4R9AA 4HN1A 3ROUA 4PIXA 3L2YA 1ZRRA 5FYMA 2YFUA 3ORJA 4HONA 3GNEA 2ES3A 1RUI1 1HKDA 1XNCA 1COV2 3MPBA 5FZFA 2EAKA 2VZQA 3JU9A 3TRSB 1O8SA 4AOCA 5F3CA 3A0KA 1GOHA 3BVCA 5FY7A 3E5XA 5BV6A 4CCDA 3VBUC 1D7PM 4L9BA 2R49A 4Q2FA 4QXHA 1NCQC 2MPFA 5FY4A 4LO8A 1YRZA 1QF3A 5CBLA 1EP0A 3AXEA 3TAYA 3GALA 4YVWB 1OKOA 3MF6A 4V1PA 1R091 1Y9QA 3FHIB 4IV3A 3O1TA 4URTA 2JDUA 5FP7A 3LE0A 3W21A 4A6SA 3RMYA 1RXFA 4JRLA 2V4AA 2X29A 4Q5OA 3DYOA 3DKQA 5BY5A 2EAAA 2VTXJ 4WZFA 2VMFA 1O8PA 4D0QA 3MIHA 1QJX3 1S0CA 4JRAA 4LBJA 4XETA 4YW1A 4MHRA 1EPWA 2J1SA 1UU6A 4HKOA 4N43C 4TSVA 1DYKA 2CL2A 1PMHX 1GR3A 3AP7A 5LRRA 3MICA 2YG0A 3KMHA 3PU8A 5JI9A 1ZRFA 4BK5A 3KQ4B 3MFAA 3GF6A 3GZUC 1PM7A 1H1AA 1R082 2WZPP 3ZN4A 1W0PA 3RGBA 1RB8G 4IEUA 1NG0A 4Y22B 3AJYA 1AL23 1HQLA 1GQPA 2RR12 3JXSA 4KMQA 4DZGA 3AKSA 4KI5M 1LR5A 3D4KA 4RHV1 1HQNA 5D8AC 2OYZA 5DDJ1 2OA2A 3R05A 3VZOA 1HRV3 1CVNA 1GQHA 4C1WA 1DGRA 1DDLA 3ES1A 2XBO2 1BCXA 1B35A 3CZJA 4QPIA 4WM7B 2ZHLA 4CCMA 1XB9A 4E27A 3WG3A 3I59B 4CCNA 3SMHA 2YV8A 4META 2RS33 1NXMA 3O14A 4GZ9A 4NAOA 1E5IA 3LDBA 5A7WA 3OYWA 4OHWA 2XVKA 5FV3A 5T5OA 4ZU7A 1UZVA 2Y8KA 1VPHA 4Y1ZA 4KG0A 2XH6A 3OG2A 4IEOA 4PF1A 4DXSA 2XHNA 1S2EA 1AYM1 2RS13 4C91A 5FCCA 1DFQA 2G4IA 3FN9A 4IEQA 2EXIA 1WGPA 4P08A 4WV8A 1QJY2 3M8LA 3LGRA 4MADA 2QQPA 4ZU5A 1S1AA 1VRBA 1ZM1A 2BTVC 4K21A 4XJUA 2DCYA 5FO7B 5FY1A 3H1MA 5C3OA 5F2SA 4COVA 1ZRCA 4DXRA 3VBHC 4XTMA 5BPXA 2DDUA 1K5MB 2RM22 4B4QA 3KGLA 2WZR1 4CYDA 1SLCA 5CISA 1Z78A 2FHRA 4XZPA 2WNOA 1F15A 5DG1A 3SQOA 4IV3C 2JWPA 1X9TA 3VDBA 4EQVA 1WKYA 1R64A 1UW8A 4CDQC 5ISLA 1KGYA 3CJXA 1CAVA 1ZA7A 1N3QA 4FFGA 1JUHA 3WF1A 4KBZA 5FK8A 4BXFA 5C5TA 2NPIA 1BMV1 3IM0A 4LO7A 1KDKA 5DZGA 1W2AX 1QEXA 1S0JA 3VD5A 5C4WC 3ZXGA 1P8JA 2ZX4A 4I09A 3UYJA 3HR9A 4UBHA 2QBXA 3CJIA 4LA3A 4F3JA 2BFUL 1ACCA 2ADDA 1EV11 1NZIA 3KVAA 3PUSA 3P5BA 4GB32 1MQTC 4NVPA 3ZIXA 4I30A 4RGKA 3WW2A 2A3XA 3N7LA 4B7EA 1S0DA 2J1TA 4GB31 3OEAA 5FZBA 4IE4A 3WF4A 3CNAA 2LM3A 1YXWA 4GALA 1MZEA 4HKWA 4BB3A 4CEWA 5JSRA 3VD3A 3H3UA 3W20A 5LY2A 5D8AA 2A6ZA 3THCA 5F1RA 1S2KA 1AL22 4YGEA 4OHXA 5K0UA 1AR71 4QGNA 3ZXDA 4K40A 4YM0A 1PZ7A 5ANQA 1VIWB 2FCTA 2G9GA 2IZWA 2OT7A 2Q0AA 3C7EA 3DKWA 1Q43A 4AGGA 2UU8A 2VU9A 3WNKA 4BE3A 5F5IA 1OH4A 1FT9A 1KXGA 1H6YA 5GALA 5I0DA 1KEXA 3I3QA 4DRVA 2DUQA 2FZ1A 3Q8EA 2ZGOA 1JYCA 1OD3A 2XJVA 1C3HA 3U10A 1AF9A 4RHV2 3AVSA 2WO3A 4PJYA 2RS53 2XKOA 2VNRA 3LA3A 5JCTA 5A32B 2DYCA 3ZFGC 1FOD1 1H1IA 2NLRA 3MV01 1HV1A 4NHKA 5L9BA 3VHNA 4ATFA 1TQ5A 1Y9MA 1JMUB 4BXSV 4C90A 3CQOA 1XC6A 1IPKA 1J3PA 3K4ZA 5CYYA 2J1UA 1QU0A 1XE0A 2WIIB 3MIBA 1W6QA 1W9TA 4OCTA 3ZIWA 2BBVA 2PAMA 4FPKA 1WW7A 3JUUA 3WDTA 5BNQA 5LCWL 2A71A 4OHVA 3AK0A 4QB1A 1VBE2 2MEV1 3DUIA 2P6HA 5EWSA 5A3UA 2P5BA 5FMBA 5FBZA 1NE4A 1SFNA 3MFCA 4GMP0 4NWWA 2YGLA 5IJRA 3WCRA 3PNAA 2GSYA 4J25A 1GZTA 1JOJA 2JIJA 4Q4X2 3A0NA 3WDYA 1Q5OA 1PO22 1O7FA 4FP2A 2E32A 1SCSA 2HWF1 1UOGA 2PHFA 3J8F1 2H0BA 2QDRA 5IVBA 2EALA 1YNAA 2OUJA 3V65A 4Q8KA 1EAH1 2KM2A 1VBD2 1AUYA 1VE0A 3TNPB 4CP0A 1RUE3 4COWA 4IEPA 2R062 4MV2A 4R9BA 2K2SA 1HRI2 2QKDA 3VBRA 2RR11 3Q8FA 4B4RA 1DGWA 3FMGA 3HIFA 3IDEA 1ULEA 4NRMA 3AB0A 5FWEA 1QQP3 5CADA 1JYIA 4OULA 2YB7A 2YGMA 4E9KA 4NO4A 4Z2AA 2VZUA 4IEWA 3M7AA 3OGRA 3PTYA 5D8AB 4Z8BA 4MGSA 5SV8A 1EV13 1TVGA 4L11A 4X6RB 4A4AA 2FBEA 2PLV2 2WFF3 4NRQA 3VBSC 1SHWB 3VBFA 4H7LA 5HBAA 1SG3A 4QKDA 1COV3 3OUJA 2RS11 1J84A 3SNMA 5CEHA 1VR3A 3AMQA 3RPQA 2JD9A 5EFUA 3J7NA 4Y3OA 5FZOA 3ZKUA 2W47A 3A23A 4BMBA 4E4DX 5DDJ3 5J48A 3FZ3A 4LITA 4ET7A 4LHKA 1H4GA 4Y24A 1YLLA 3N35A 5IVJA 4Z1VA 2JIGA 2RS51 4MUVA 2GALA 5T5PA 1YO8A 3WZ1A 4N90A 3GCWA 4AE2A 2KR2A 4UW4A 4KQ7A 3DEMA 1WLTA 2P6CA 1QJZA 2IFRA 1ZZCA 3LIHA 1ZRDA 4P02B 5DZEA 3ZFGA 1W90A 1ZZ6A 2J1AA 4BLIA 4EROA 2ZKNA 1WZXA 3AVRA 4IUGA 2DTYA 3VBOB 4BCUA 2RDRA 1IG0A 2YC0A 1HB1A 4LO6B 4PCRA 4AZZA 3RZHA 2WLPA 4LBKA 1DZRA 2AGSA 1DQ5A 2W08A 3ZYBA 3NAPC 2FMDA 1LHNA 4O61A 5IVYA 4HVOA 4UFJA 3LF7A 2WA4A 3POIA 3NO8A 2WFF2 1Q8VA 1ASJ3 3H7YA 1TMF2 3VHPA 5LWBA 1NUKA 4XQWA 4R9DA 4QB6A 2WYSA 3KSCA 4BU2A 1FMD3 4AF9A 1ZBA1 1BVP1 3GBWA 2VTXA 1MS9A 4D6SA 4P5YA 5HXMA 3ACLA 1O3TA 1OPMA 1SBEA 4M4PA 1UY0A 2WT2A 1VB2A 1QGLA 4LKSA 4AQ2A 4GWNA 2HKXA 1UD1A 2RS31 4XBQA 2EXHA 1Y7BA 1RUOA 3AX4A 2EIEA 3I54A 3M3OA 3ME2A 3H8XA 4OHYA 1RL3A 3OGSA 2WZEA 1W03A 3U0ZA 2XL7A 1W6OA 3IPVB 3T09A 1QHDA 5CFCC 4IETA 4NAMA 3GBGA 2LS6A 5I8TA 4AI9A 4D7SA 1H2KA 4HK9A 2VMGA 2VQAA 3RS6A 1S4CA 1CX1A 3AXDA 3ALQA 2WWUA 3MF9A 2QQUA 4QX5A 1Z7S2 1MEC2 2ZAHA 1BXHA 1JZ4A 3LOBA 1Y3TA 1W06A 4DUVA 1MACA 4DMIA 2JDHA 2BERA 1NQDA 3JZVA 5LEKA 2VUAA 3E5QA 4Q4V1 1WUVA 5FZDA 3BTZA 1Q56A 1RJ8A 1YIPA 2VMEA 2OKXA 1CPMA 2ZGLA 1OLMA 3J4UH 2GNBA 2QQVA 5IFTA 1CESA 1KFXL 4CVUA 3BOWA 1AHSA 2AUYA 2V5DA 1DHKB 3RMXA 4MGTA 4G9SB 2XG3A 1VBB3 3ZN6B 4R9CA 5L7OC 5KBFA 1OLME 1RHI2 1QKQA 1XU2A 2UWAA 3HT1A 4QX7A 5ANNA 5I0RA 2ARBA 4GKXA 4Y20B 4AVBA 5IATA 1C8M1 1QXRA 1VJ2A 2RM23 2OPWA 1LNSA 1UOFA 3M70A 4JGZB 1WBFA 4YM2A 5A6YA 1OBNA 5DAXA 3ZFGB 4AK3A 1JI6A 4OUEA 1ZBA2 3OBAA 5FYVA 1QY4A 3O12A 4D7TA 4XDPA 1FXZA 5FPZA 4LBMA 4XUPA 1TMF1 4P9IA 3B01A 2A1XA 1ZZ8A 1LOFA 4D94A 1CQ9A 5DMYA 5L73A 1OUSA 3DL3A 3OPZA 2BP6A 1PZ8A 3T4VA 1V6IA 3QCWA 2VW1A 3ABZA 3PMSA 4BZ4A 3ACGA 4BQXA 3SEEA 3HNYM 2BJSA 1CJPA 1SBFA 4XFCA 3AJZA 2OZJA 1EAH3 4CUAA 2HWC1 1I3HA 1PGL1 1NA1A 1JU4A 3U1XA 1SCRA 3POSA 3ZSKA 4FI9A 1GP6A 3WVJA 3WP3A 2ZACA 1GWKA 3OF1A 3IDBB 1H4HA 3DECA 4HETA 3OY8A 4F8AA 1SBDA 2WBKA 2RS52 4U2AA 2VUJA 3NV2A 1DGLA 1OOPC 3KCYA 5HCAA 4YG6A 1PVC3 1KS5A 1AJKA 1MPXA 1ULGA 2G9ZA 2C5DA 5FQ0B 2ARXA 4W6XA 5HCBA 5CVRA 5A1LA 2AEZA 2ADEA 1BHGA 4YM1A 2D43A 4CTEA 3AYCA 1VRH2 2GN3A 2ZXQA 5EHDA 5FYBA 2SBAA 4PLNA 3GBFA 2LROA 2WUHA 1V6KA 1OUXA 2D3RA 4FCAA 3PL0A 2PLV1 1V70A 5KHGA 2A75A 3DV8A 4YG3A 2RMU1 3IMMA 4OMDA 2QJVA 5T5JA 4NE9A 3INAA 3OPTA 3KT1A 2WO1A 5ERLA 3VBUA 3KVBA 4AEMA 3O1VA 4OVEA 4E4ZA 2R7EB 3I2JA 3VBSB 2OZ6A 3P3NA 3ZDVA 2RDSA 2VCCA 2EXJA 4WVWA 1VBC1 2Y0IA 5FZ0A 4AG4A 4PIYA 4Q4Y3 3SITA 1WCSA 5HI0A 2R061 3VD9A 1VBB1 1I1EA 3A4UA 4IEZA 3ECQA 5HCFA 2BYVE 2DCTA 4QXKA 1XE8A 2VXRA 2VVDA 4FPCA 2EIBA 4CPBD 4IV1B 1BYHA 4XUQA 1YQ2A 3KWVA 4HSJA 2Y6JA 4A44A 5JSOA 3AZYA 3V0AA 1RUE2 2RMU3 1O5UA 4CDQA 2VMDA 1I9RA 2WNEA 1UPSA 3OD4A 3DF0A 4XACA 1OQEA 2AC1A 4QU1A 1HLCA 1RUC1 3N9LA 5E1RA 2Q8DA 1VBA2 4HL0A 4MGZE 4QQPA 3WHUA 3WF2A 4BOWA 5BYNA 3LDRA 1NXD1 2RHPA 1BBT3 2JG8A 3I2HA 3EJKA 3B93A 4FP3A 1KJRA 2ORXA 2A3YA 1POQA 1DGRN 1ZZBA 5BXXA 4GA9A 2GC0A 2HEWF 4XE9A 1N47A 1WWYA 4YM3A 5JXHA 3NAPB 4QPYA 4XTPA 2PA7A 4MHUA 3EBRA 1Y43B 1QNWA 3IWZA 1ENRA 1BQPA 1GQGA 3QH7A 4SLIA 3LFIA 3PIGA 1SLIA 4W6YA 5K7PA 3CJIB 1W0NA 1IS5A 1YFXA 4ZZ5A 2V72A 3UETA 3TN91 5IAVA 4D6QA 4DFSA 4E2QA 2GU9A 4Q0PA 1FOD2 3VKLA 4BQ3A 1UO9A 4ZS3A 3OBZA 4LHLA 3RVHA 3LEIA 4XJAA 4F7ZA 1Q8SA 1LECA 1VBD1 2QE3A 4NIAA 3RWNA 4DQAA 2ZX3A 1JYVA 3ZFEA 2GC3A 1UYPA 3Q8AA 5C3PA 2PHRA 5FY9A 1CJDA 4L97A 4Y1XA 1RIRA 5FYYA 1KITA 2Q30A 4HG6B 1UMHA 4C0BA 1W0OA 3NQHA 3IKWA 5CFCA 5JOXA 3U78A 1ST8A 2R072 3ZO0B 2ZGPA 2VE1A 3IBMA 3T30A 1PK6C 2UWBA 2P3JA 1A8DA 3J7MA 4FXGB 3B02A 4UW3A 4NIIA 4NPLA 4OUMA 4QDSA 3HEIA 1O4ZA 4YFWA 1F9KA 2NM1A 2PHXA 4YW4A 3V0BB 2X53S 5KHIA 2FQPA 1X9PA 1XSRA 2VR4A 3FLPA 4FQ4A 1V6JA 4LBLA 3HN1A 4AFCA 2BVBA 1REEA 5K0UB 4YNIA 2DBNA 4QKNA 4LORA 4RQPB 4JZRA 5IK4A 5K8SA 1JZ6A 1VBC2 3F95A 3GHMA 5L7OB 1KFUL 5E6HA 4YSFA 3U4XA 2NMNA 2VCMA 4HVQA 4LTAA 3WQ7A 1MZFA 4Y5Z0 3KT4A 2CU5A 1UWWA 2QQNA 4JGZC 3VL8A 2QTWB 5BNOA 2QQOA 2VXJA 2PHUA 2ZCWA 4UT5A 4KBBA 5T55A 3B9CA 2WWSA 4FPJA 5DG2A 1CAUA 2BGCA 1R1A3 2W2IA 5C4WA 3U37A 3WNLA 2A6YA 5KHKA 2FDGA 4BPZA 3ZR5A 2GZWA 3I2OA 4DOUA 3KZ4C 1S0FA 2LW8A 1GNHA 2Y26A 2RM21 2WQ8A 4A3XA 4E4SA 1W28A 4S2GA 2IXIA 4WVMA 2QQJA 1F35A 4AHXA 4OMCA 2O8QA 4LE4A 1ZRIA 2ZBJA 4GAZA 1LESA 2BNNA 1UXZA 2BOJA 4UYBA 1U5XA 4W65A 2RJ2A 1RYYA 4ZY9A 4J1XA 4CDUC 4M0HA 1D0HA 1NOVA 3U4SA 1UYYA 5FYZA 4ATEA 1C5IA 1GWMA 2Y6FA 1HB2A 3TWIA 5A6ZA 3UNPA 5A3WA 3PURA 2ZEWA 3KT7A 5FYIA 4RHV3 2J1EA 3WNMA 1QJX1 4AEKA 1F4AA 3B7MA 2WQ4A 4MGKE 3T3YA 1XBFA 2E7AA 4BM8A 3C7FA 4AAXA 3SCHA 1W05A 1JTZX 1UNBA 4FPLA 1HXS1 5IFPA 1ZZ9A 1HX6A 5C8WA 3VDDA 2VQTA 1TG7A 2Q1MA 3OD0A 5JMOA 3N3HA 5FBJA 4AVTA 3ZFEC 5C3SA 2WSVA 3WDWA 5ACA2 1QOOA 4OI2A 5FYUA 2HJIA 1RVF2 2X5IB 5DAWA 5K4LA 1O4YA 4CUGA 4GH4B 1JZ5A 4DEQA 1YC61 2DCZA 2WT0A 1AX1A 1PVXA 5IVCA 1FV2A 1HW5A 5TSWA 1W8WA 4LOSA 3SEPA 1L7RA 2A6VA 4JDNA 4PLOA 4UI9L 5GZFA 4AAPA 3V0BA 1C8M2 1JYWA 4YZ4A 4D69A 5FMDA 3KGZA 5F3GA 2IVIB 3FFZA 1AVBA 4Q4X3 1FI2A 2YFZA 1PMIA 4GD4A 3ZYGA 2W94A 5ABJC 4XUNA 2VM9A 5JR2A 4LA2A 2ZKLA 3T1MA 1GBGA 4Z82A 1G7YA 4Y1UA 2A7AA 3OUHA 3GGLA 2B4KA 4LPLA 5FFOC 4YZ2A 3N9NA 3IAQA 2FD8A 3A7QA 1H2NA 4Q0QA 2LALA 4LULA 5CKNA 3POGA 2GAUA 4BYYA 5FJKA 3L2HA 1PGL2 3FLTA 5JXGA 3WQBA 1LGCA 1X8MA 2RG4A 3H42B 1RXGA 4OUSA 1E5SA 3IMNA 2BBAA 4XFGA 1JUIA 5F6KA 2TNFA 2VVFA 1DU3D 4WM8C 1CIWA 1D0GA 1YWKA 1RUD2 1RUE1 1W9YA 4ZPIA 2WNVC 5A7PA 3SISA 4CXYA 1JN2P 5FPUA 1M4WA 2JG8C 3LPFA 3T08A 4OZXA 1ND2C 2ZABA 4HOOA 1GOGA 4AHZA 4QM9A 4JC1A 4JV4A 2G9FA 5CAZA 3JB4C 4HPKA 1QDCA 5F3EA 3ZOIA 2XVLA 4XFBA 2RVAA 4NWVA 4FXKB 2Y64A 2DVDA 3B3QE 1NLQA 1X36A 3CJIC 2RR13 4LMFA 3PUIA 3DPRA 4XMIA 1B09A 4BQ4A 1JYNA 4ORFA 1C1LA 4Y1VA 2P37A 4FPOB 4FFHA 1COV1 1ZBE1 2H6BA 2R1DA 3DGTA 4I3GA 5FP9A 1G8WA 4B3NA 3VLBB 3CDZB 4QHBA 1PO23 4I0BA 4YW2A 2I74A 3PDQA 3S30A 3RDIA 4CEWC 4AQTA 3NSTA 3WD5A 3VD4A 2QZ2A 1FNYA 4XCBA 1BEV2 1G86A 3O5SA 4M3CF 1IZ3A 4BQ5A 1BBT2 2KXLA 4AVCA 4MH0E 2C24A 4QDRA 3IT8A 1URXA 4CDXB 3UGFA 3RZMA 1RUD3 4CDWC 1PVC1 4QPGC 3MV11 4EWEA 3UKNA 3OUIA 4PI0A 4AEDB 2AH2A 3WDVA 1PGW2 1VAKA 1OC1A 1Z0HA 5A3PA 2CWSA 2BWAA 2BV4A 3ZN6A 2HWB2 1AR91 1RUH1 2HWD1 1STMA 4IGQA 4ARXA 2K9ZA 3P1IA 2WABA 1CZTA 4UFMA 2HBTA 3RYPA 1W6NA 3RZJA 1ALYA 2PAEA 1U5ZA 4AI0A 5LZ6A 3AKTA 1I5PA 1W3VA 3HMYA 2DFBA 4BLJA 2J1VA 4JTNA 2XR4A 2AZ5A 4DY3A 1SFYA 1UZ0A 2W3JA 4XURA 2YHJA 1H2LA 1UQXA 4RQPC 2C6SA 2Q5TA 2YUEA 2D93A 1FPN1 3VBHA 5I93A 1W9SA 1W9FA 1NA1C 1E5RA 1TMF3 4UF0A 2YC2A 3HPNA 5FAXA 1REFA 1GNZA 5EJ1B 3KB5A 3WT3A 4Y20A 2GMMA 1G9BA 1YI9A 3EHKA 1JU3A 2FMYA 2WO7A 3AMMA 1QJY3 1RMU1 1O6UA 4UFIA 3VN4A 4YW3A 2E33A 3G7DA 3ZN5A 2IXCA 4ITCA 3J7HA 1RUG3 1HJFA 2F4LA 2FDJA 1SPPA 1HXS3 4YARA 4WM8A 5JIAA 4BK4A 4NN0A 1GWLA 2B5HA 2VZRA 3E6DA 1XE7A 5DPNA 5LA9A 2RDNA 3MW4A 4XBNA 1D2SA 2PELA 4CUCA 3CF6E 2E53A 3SC7X 2GN7A 4JQRA 4JVAA 1IS6A 5FP3A 1G9DA 5FP8A 5LK5A 4CDUB 2W68A 2VOVA 2NMOA 3MLLA 3DPRB 1L7LA 5A3NA 5JXIA 4D6RA 2FDKA 2HWE2 1CGPA 4Q4X1 1WW5A 1AJOA 2QQWA 4M4RA 4NIHA 4TN7A 4AXOA 3BU0A 1QIQA 3NRUA 3QD6A 2B46X 3PUQA 3RZLA 5GZCA 2MEV2 2D3SA 4BQYA 1VAMA 4FT8A 1UMIA 4YVSA 2C1FA 4FQZA 1GLHA 1NE6A 4C0HA 4LOTA 2Q8CA 2WNUC 4CP9B 3VBUB 3D6EA 1Q8OA 1PHMA 1GNYA 3B94A 1WD4A 2AENA 4R52A 4UAPA 1NAEA 2WA3A 5FZ3A 3N7MA 4DEVA 2VD7A 3VUOA 2XMLA 3K4AA 4YVWC 3IDAA 5C8CB 4O7XA 5DN2A 2RJKA 3NJXA 2X5IC 1AX2A 4OLLA 1A3KA 4GWMA 5A33A 2V73A 5EV7A 1UIJA 1LULA 1MS3A 4DS0A 5IK7A 1H8TA 4CCOA 3KQRA 2A6XA 2V09A 4QPGA 4X6QB 1OSGA 3AKRA 3CL1A 4CEYC 4NIGA 2HEVF 5CA6A 5L9RA 3WQ0A 3WINE 4GMP3 1ZBA3 5FPXA 2D6NA 1CWPA 5DQ0A 3DN7A 3VGIA 4LEJA 2O8OA 3N9MA 3V56A 2FDHA 3WW3A 3AZXA 2VL4A 3KCCA 1RVF1 4UWDA 1O3SA 3WXPA 3WNPA 1FPN3 3K75B 1D4VB 5FYSA 1LOGA 1PO11 2OS2A 4CCJA 4R4XA 3KV6A 3PLQA 5CIRA 1HXS2 5FZLA 4UBGA 4ZU4A 1YHFA 1QQP1 5IUQA 4CU6A 3OEBA 2XUMA 4IV1A 4XDQA 5KHJA 2CDPA 1QOSA 3ZXFA 4NIDA 1OH3A 2VVEA 5FZ9A 2Z5WA 2P17A 4AFAA 1ND3A 3LEKA 1ENSA 2CNAA 1DBNA 1QJX2 4K9SA 3D8CA 4UXAA 4XXAA 3AYEA 4LHNA 1APNA 1K5JA 3NNGA 1DQ4A 1S0BA 4WM8B 4AL9A 4JKLA 3ZXEA 4B4PA 4AGVA 2BNOA 5FO8B 4QPIC 2WNVA 4A7KA 1W2UA 2HH9A 2HEYF 4JHZA 1SZBA 3TB0A 3WSOA 4AVAA 1O3QA 1TME3 4ASLA 5KXEA 3IPVA 5DUUA 4TLFA 4URAA 1HV0A 3OGGA 2XXZA 4JHTA 4XPVA 5FZIA 3VHOA 4B8EA 1GZWA 3HT2A 3FFQA 2N7GA 2XKPA 4H14A 5FUNA 3GJBA 2RS12 5FZMA 1RUF1 3VZLA 3VBRC 2Z4FA 1IS3A 2AREA 5FXWA 4OI4A 5JSPA 1US3A 5T50A 2VZPA 1F31A 4H7MA 2PHLA 5T54A 4LE3A 1HN0A 1KD7A 1V6OA 2Z79A 3DYPA 1NQJA 3D5OA 4P5HA 5GKAC 3T2OA 4CXWA 3JD73 2UY8A 2Z2SB 3C7OA 4HSLA 4XF4A 1EY2A 1V00A 1QXJA 2VO5A 2ZX2A 5DUVA 3ZDSA 4RS5A 4AYUA 2UYAA 4DY5A 3AP9A 4UFLA 3HQUA 1AL21 4PLMA 2JKXA 1JHJA 4QPWA 3WOGA 2BEOA 2HLEA 4WM7A 4AFDA 5KC5A 2D6MA 1VBA1 4W4ZA 2DCJA 4CA9A 2MEV3 3NNFA 2YU2A 5A1AA 1W99A 2I45A 4Q4W2 4YW7A 1CD3G 5A7WB 3EQEA 4CDXC 1QJY1 1K5MC 3WNXA 4QPGB 5FKBA 1GV9A 4CDWA 1M06G 2X05A 4FBFA 3ETPA 3LCPA 3NMBA 3WQ1A 4QWNA 2VQ0A 5D2AA 1XRUA 1WCUA 1V6MA 3X29B 2WS93 1EV12 3EB7A 3O1RA 3FHQA 3JBG2 2Y33A 4LBQB 5FWJA 5FZCA 3VKOA 4M00A 2D3PA 4XJZA 1GKBA 5C3RA 5EYXA 1DQ2A 1W8HA 3U11A 4CU9A 1EUUA 1EPZA 4MSVA 4PT6A 3WCSA 1X50A 5CNAA 4RN5A 1RMU3 5C4WB 4LJHA 1JYXA 2OPKA 5JR7B 1AYN1 1U5IA 3U75A 1K45A 5BNPB 2QDNA 1AX0A 4TYSA 3PU3A 3I2DA 1O59A 1UKGA 2PHWA 3WW1A 1DLLA 1W8ZA 2B9VA 3JCIA 4I3PA 4QKFA 3WG4A 1MQTB 3K3OA 4E4HA 1KRIA 4H2AA 3E6CC 2R073 3LPGA 3LZZA 4Y33A 2VPVA 5HV0A 1LOCA 1UYZA 2SLIA 1CONA 1JZ3A 4ZHNA 2C4XA 1K3IA 1NCRC 1VBA3 4ISQA 4SBVA 4QGMA 4YLZA 3SH5A 2CAUA 3ELNA
chains in the Genus database with same CATH topology
3WW4A 5KC6A 3B5LB 1PNFA 4KGQA 1OMIA 5AC93 1LU2A 4XF3A 4WVMB 2ZX0A 1OOPA 1ULFA 1GFF2 4K20A 4AEDA 4I02A 3N36A 1RUF3 2OUHA 4N9HA 1ZZ7A 2FZ2A 1GICA 2NQYA 1V6LA 3M1HA 3QOPA 1BK1A 2X8KA 1ZVFA 2HWE1 2XGXA 4YW5A 3GZTB 1S0IA 3SHRA 2WNUB 4AW7A 1N1VA 4XYXA 4AI3A 3PVBB 3KD4A 1ENXA 1LHWA 1RUG2 1H9PA 3ZXKA 5L36A 3FLRA 2DU1A 2R32A 2WZR3 4MX3A 5CU1A 4E2GA 3SLIA 1OI6A 5AFBA 5C6CA 4JTOA 1ZX5A 1MVEA 3FWEA 1QDOA 3ATGA 1UF2C 3OBTA 1R081 2PAKA 5KHHA 4AFBA 3BU7A 4P9XA 1YCIA 5GLWA 1MS0A 3B9IA 3WDXA 2VGDA 2JXAA 1QH6A 1C4RA 4NHMA 3HBZA 1RUF2 1UU4A 3WV6A 1VRH1 3E97A 4RA0A 2V5YA 3CEWA 3RSJA 3C3VA 4YGDA 3ZFFA 4CDUA 4FOQA 3AMNA 4GMP1 1VRH3 1LOFC 5JZGA 4F83A 1X7NA 4L2NA 2B39A 1YUDA 3AYDA 4YVSB 3S6PA 1LEDA 2UY9A 1AYM3 1IPJA 2IXKA 4AI1A 4RR3C 4PDWC 4YGCA 1LODA 2OW4A 1B35B 1WMEA 1PVC2 4MXWB 5AFEA 3POYA 2XWBB 2DUPA 5FMOS 2F4PA 4QQ2A 4RL7A 2CGOA 2E7TA 1PO12 1BEV1 3UL2A 3IDCB 4AFMA 2OVUA 3J9SA 2IFWA 1V9U1 5AC92 1UAIA 1W6MB 2ZGKA 4L8QA 4Y4YA 3WP5A 1C5HA 2RMU2 3VBRB 1XXNA 3THTA 2PHTA 2GNMA 2DVFA 5DUXA 1LRHA 3PJYA 3WG1A 2ZHMA 2XLAA 1RUJ2 4HBNA 1QJU1 1IKQA 4COZA 1TNRA 4AVSA 3ZYPA 3M2MA 4N53B 1WCKA 1L3JA 2ERFA 3QACA 3SH4A 3WX5A 3IN9A 3PVEA 1V9U3 4OHZA 4CRQA 3VZMA 3AFGA 1ND3B 2D6OX 1YIFA 3W58A 4HLTA 5EYYA 3QBQA 3WUDA 3H50A 3O0XA 1CAVB 4TWTA 3N4MA 1Z7S1 4H3WA 1N3PA 5GLZA 5GZDA 4AHYA 1MS8A 2JE7A 1OA3A 2Q1ZB 2GH8A 2GMPA 5FQ0A 3ENRA 2JICA 4UW6A 1ZYBA 2DV9A 5FLJA 4QM8A 4LLFA 1KQRA 3JB8A 5I91A 3AP4A 3V64A 1U5YA 2ENRA 4Q26A 2YDEA 5I0UA 4Q29A 3FBMA 4XXPA 1QH7A 4UW5A 4AGRA 1CAXA 3KCXA 3RI8A 3NV1A 5F6LB 4O9GA 2YMZA 1UX6A 3VBSA 4NOTA 1NCRB 1QMJA 5J98B 3BIWE 5JI7A 3VDDB 1TE1B 3JBG3 4EN9B 5ACA1 2ZHKA 4N9IA 1J58A 4XQ4A 2XB6C 3EO6A 1MEC3 1KS4A 3JQXA 1TME2 4EWDA 4XOGA 3VL9A 2VECA 3I7DA 5E16A 3I8TA 1AR81 4JAAA 2XVGA 1MEC1 1VBE1 1ULCA 3LA2A 1PIV2 3TN93 4DXZA 2JECA 4ISRA 3OCPA 4KG8A 5A32A 1HQWA 1LOAA 5LEJA 5JDBA 2XLFA 1LU1A 1AR63 4ONUA 3G6JB 2VW0A 2BFUS 3R6SA 3ZYIB 3MPPG 1A6CA 3E6BA 1VBE3 1NCQB 1AYN3 2F6BA 3M3EA 2CGNA 4CP2A 4I0AA 2PQQA 3RG0A 1TME1 3L9JT 3LAGA 1SQ4A 3RRDA 1SLBA 1S0GA 2HWF3 2VULA 2A73B 3FUQA 4P9GA 4GXLA 2XJTA 1WD3A 2HWB3 1DYPA 2I07B 1V9U2 1ULDA 2ZX1A 2WKKA 1O3RA 5GM0A 5KWRA 2JDZA 4XBLA 4BH9A 3ZSJA 3RZZA 1O4TA 2XJRA 1OOPB 4A2UA 4XW3A 4N43B 1J59A 4Y26A 3ZXJA 1RHI3 3QH6A 2D97A 1RVF3 1G9AA 4EN6B 4CZSA 3R4UA 3J8F2 4HFSA 2ZGNA 3MLJA 1YFUA 5B2GB 3O0VA 4P9LA 4AVVA 3SH3A 4Q1PA 4YVSC 1NYWA 5I8SA 4D7YA 4RR3B 2R071 3AP6A 2BW8A 1PIV3 1MS5A 4WM7C 4KGGA 2Q8OA 3UKVA 2VOWA 4RS5B 4WZCA 4GKYA 3H9AA 4CDXA 4XFHA 2JG9C 2UURA 2D44A 1YFWA 1LHUA 4BQ1A 1OLRA 3BOPA 4ZKTB 1PGSA 2WZR2 2YROA 2ZA9A 5T5LA 3CLPA 4OI0A 1QJU2 2GMEA 3NKTA 3SXWA 1CAUB 1HRI1 1XYOA 5J96B 2D5HA 1X82A 4BWOA 1J3RA 3UK9A 2D40A 2WL1A 2BPA2 2R30A 5GJ6A 4D3WA 3USUB 1C28A 2YYOA 4XHXA 2EXKA 4N53C 2EA7A 2RJLA 1AL0G 3RI9A 3NJZA 1D4M2 4Y1YA 3VBHB 5JPMB 5IK5A 2ZMNA 1Q8QA 4PF5A 1ND3C 4XIOA 2MHFA 4AI2A 3MW2A 5H9SA 5CFDB 1DIWA 5BUVA 2ZS6B 3ES4A 3M3IA 5SV5A 2WT1A 4CDQB 1H30A 2DU0A 2PTMA 4LBQA 1FYUA 4J1WA 1U12A 2LTNA 1KJLA 1S0EA 4IQPA 4M0NA 1SEFA 1BVVA 3NVCA 2R0HA 4Q4W1 3VZNA 2R041 1O5LA 1TEIA 1NY72 3D0JA 4Q4W3 1W6OB 5J3UA 2C9AA 1GZ9A 3MZHA 4G4FA 1H2MA 3VKMA 5DUWA 1PK6B 5GLTA 4FPYA 1RTVA 4Y22A 5KXDA 1MVQA 4JCKA 4HN0A 1LKNA 4LO5B 2GNDA 4XIKA 2O1QA 4BMEA 3URFA 1W6QB 4Q4V3 5K0UC 3ZXAC 1NLSA 1NY71 2WNUA 3M3CA 3H7JA 1UIKA 2R042 2ZZQA 1R1ZA 2ZPXA 1YI7A 4P9WA 5H9PA 1RUG1 4M3CB 5C9AB 1EYBA 4YGBA 2JG9A 5F9TA 3OYWB 4EN8B 1DF0A 4AEJA 2DVAA 1AXZA 1C57A 2LUWA 4MXVA 1R093 4XMAA 2JE9A 3WG2A 1ZBE3 4WVVA 4XHBA 5BNOC 2ATFA 1GYKA 2E6VA 2AR6A 3NV4A 2C0ZA 1U0AA 1YJLA 4MYEA 4NHLA 1ONAA 3D0SA 4O9EA 3S0MA 4HKLA 1QQP2 3ZYRA 3TOJA 5F5QA 2A5ZA 2JX9A 3SCFA 1RMU2 5J09A 4IEXA 5GZEA 1BKZA 3RJ2X 4QQLA 2ETEA 4IEYA 1LOBA 1BJQA 1DZQA 2CV6A 4H55A 4I01A 5FRAA 1CAXB 5HXVA 2JEMA 1MZ6A 2B9UA 1REDA 1HDKA 4XJWA 5FDBA 3TN92 1RHI1 3VBFB 2A6WA 2QCSB 4Q0UA 4Q8KA 5GZGA 2QFEA 4XJ9A 3OY8B 1NZCA 4EN7B 4AWDA 5L19A 1VBC3 3WUCA 4OFGA 3R4DB 2WC2A 1S55A 4LBNA 1DGWX 2VNGA 1AYN2 2HWD3 3OJBA 4DNYA 1AR92 1RUH2 2HWB1 4CP1A 5JIUA 3W59A 1PK6A 4MLOA 4Q4V2 3AZWA 1R083 2VG9A 3AMPA 3Q9OA 2R063 2XPJA 3U07A 4B29A 1FV3A 4MGIE 2Y0OA 4DINB 1ASJ2 1T6GC 1SLAA 2P34A 4FOWA 4KNCA 2MNGA 4XEZA 5D1IA 2DTWA 1OQDA 1DG6A 4MXWA 4Q0SA 1F2NA 1I5ZA 2R6QA 3RYRA 1X8EA 4RS5C 2XBO1 5FOBB 5C9AA 2VMHA 2CAVA 1WCDJ 2JG9B 1N1YA 2HWE3 4YVWA 5FMOL 3VKNA 2NYYA 4XF1A 1OFSA 4C1XA 5AVAA 1A78A 2HWC3 4GH4A 4LBQD 4S2HA 3W9AA 3BTAA 3ILFA 4EN0A 1AXYA 2WS91 3GZAA 2ZGTA 3EXUA 2VOXA 3PVOA 1AR93 1RUH3 4B7KA 2YXSA 1POV1 3BALA 2O0OA 4GIQA 1UU5A 3ILRA 4AHWA 3AP5A 1ND2A 2D6KA 2JG8B 1OD5A 3ASIA 5EZWA 3GYDA 3R4SA 3NAPA 3ZYJB 2B42B 1W6PA 5FOJB 1C8M3 4XF0A 2Q4SA 4QGLA 4BIFA 2Y38A 3K51A 4A7YA 4LR4A 5CFDC 2JKBA 4XF9A 5JAXA 3MI8A 1ZA4A 5LRSA 2HWD2 4GQ7A 1F8VA 4PBOA 4HANA 1SMVA 1UMZA 3AZZA 5I0TA 1PZ9A 2DVGA 4MGYE 5I8YA 3O0WA 2HWC2 1HRV1 1Z7S3 1FNZA 1CAWB 3LSDA 3ZSMA 3ST7A 1LOEA 1CX4A 1RC6A 2ZMKA 1ZNPA 1PO13 2B8MA 2QNKA 2TEPA 3TNQA 5CFCB 1H8TB 3MEPA 2UWCA 4G3YC 3LOIA 4AEDC 1IS4A 3E5UA 1GSLA 3LA7A 1DQ6A 3O7OA 2EVXA 3JD72 1SACA 3RJRA 2IC1A 3VKFC 4JGYB 2ZOEB 4K3UA 1E57A 3ZMOA 1XU1A 4Z92B 1WBLA 1WLCA 3MIEA 3POWA 4DRRA 4PBPA 1UZZA 4KWJA 3ETQA 4RD7A 1N1TA 3MIFA 4KU7A 2PHDA 1NCQA 4E2SA 3UJOA 3MGUA 1LTEA 5KXBA 5C9AC 3MDPA 3FX3A 1H9WA 2PFWA 1N3OA 1NA1B 3J26N 5L7OA 1K5MA 2BWCA 4Q1RA 4YYOA 5IK8A 1ASJ1 1DQ0A 1FATA 1PIV1 4KWKA 3UKTA 5BNOB 2KA3A 4IERA 5GLVA 3H1WA 1OFNA 4S2FA 1CPNA 5JLVA 1UCXA 2ZMLA 3HAGA 1C8NA 1ENQA 3KLSA 1OA2A 3FUOA 4LO4B 4LNVA 4EV0A 1AXKA 2CTVA 4QT6A 1GZWB 1UZYA 1DQ1A 1GANA 4N43A 1R1A2 4YZ3A 3DPRC 4Q4Y2 3VZJA 4XJ8A 1G6NA 1OA4A 2WS92 2WSUA 4KH9A 3AFKA 4PIZA 3MYXA 2XHKA 3B69A 3ILNA 2ZZJA 4QU2A 1EAH2 3VBFC 3NL1A 3AMHA 3CO2A 3OGJA 1AZDA 4Z2WA 2VW2A 4RR3A 4LUKA 2XJQA 2WFF1 1PO21 2DF7A 2WLQA 4M3CA 2QVSB 5BNNB 4BA6A 2X5IA 5C8CC 1JHNA 1W6MA 4QQHA 1VBD3 5E89A 3VZKA 4FO9A 4NPRA 2ZGSA 2A70A 4K6BA 1RUI3 4XFAA 1WA4A 2VY0A 3D82A 2UYBA 2VH9A 4CEYB 3WLUA 1S2BA 1RITA 4P14A 4R8HA 1Q8PA 1AR62 2XBO3 2YZ4A 1SLLA 4RGGA 4N53A 1YFYA 3WP6A 1XQNA 2IXJA 5BNPA 5E8AA 4K8FA 3PJQA 4ZXKA 1SDWA 1LGNA 4L99A 2ET7A 1JH5A 1BBT1 1SLTA 2VOKA 1QOTA 5JWPA 1RUJ1 3J8F3 4IV1C 1DZTA 5J36A 3VHRA 1LENA 2W39A 5A33B 3UV9A 4IESA 4EWAA 5AC91 1H1MA 5JVVA 1XYPA 5FLHA 2JD4A 4JGZA 1ZBE2 2RE9A 3AKPA 3NWKA 3ZSLA 5J37A 1RGSA 2DUOA 3PMEA 3K48A 1AR72 1WW6A 2YPJA 3C2UA 4GULA 4QPIB 3RQ0A 4BHPA 3USUA 2R1BA 3WDUA 3I59A 4FPGA 2IXHA 3ZSEA 3JBG1 2E9QA 3LSEA 5JMCA 1F5FA 5KXCA 1IOAA 2HWF2 1JXNA 5GLUA 4IL7A 1AYM2 5E88A 2GC2A 1OLQA 3CU7A 3ZXLA 1FMD2 4FTEA 4JDOA 2WFPA 2IXLA 3N7KA 3VBOC 1H0BA 3T1LA 1FOD3 4LLOA 5A3LA 5BNNA 2XJUA 1UPIA 1WLWA 4TZDA 1YYNA 3WR0A 1D4M1 4N7IA 2CWMA 1VB4A 1Q3EA 1D4M3 4M3CE 4GB33 1H8TC 1LCLA 3HD8B 1RINA 2JJ6A 4FPHA 4XQDA 4Q8LA 5FLIA 2ZGMA 4CEYA 1C1FA 4Q0VA 5C33A 1IQAA 3H1YA 4HVRA 1QJU3 3MLKA 4WBBA 4DPNA 1XYNA 4ES9A 4JGYC 4K7JA 1W6NB 2DFCA 1UKRA 4HT1T 1RUNA 2HYKA 5H9RA 3ZFFB 3USSA 4A7ZA 2JENA 1AR61 1D2QA 5JZGB 3MIGA 5ABJA 1IGOA 5K9YA 5EJ3A 5BNPC 2ZGUA 1X33A 4RFT0 4AI8A 1MZ5A 1V6NA 2TBVA 1AR83 5FREA 4HZFA 2VNOA 4OI1A 3LKJA 3NW4A 2D5FA 2NZ9A 1FMD1 4HK8A 3HWJA 4XILA 1LGBA 1TNFA 2D98A 2EIGA 3QLQA 4FPFA 1MS1A 3RNSA 1W39A 3WP4A 2B45X 2QZ3A 2P3KA 3MIDA 1HIXA 3APBA 5JOZA 3BODA 1IHMA 2A3WA 3M3QA 2WQZC 2E51A 4YG0A 1G9CA 1OHFA 1FAYA 5T3NA 3M4FA 5DDJ2 1MR5A 5EXOA 1WW4A 3BPZA 3FJSA 4HMZA 4Q27A 2K0GA 3NKGA 2D6LX 4DB5A 1QXPA 1ZREA 4FTSA 3NV3A 1MQTA 2W0XA 4IEVA 1BMV2 5IT6A 1R1A1 2CY6A 4JDMA 3GHNA 2IWGB 3WHTA 4BIOA 4M01A 4I2OA 5JOWA 4COYA 5JOYA 2NN8A 5LK7B 3AYAA 5DXDA 3VBOA 2WINB 2ZTNA 4COUA 4YRDA 1WLDA 2H0VA 5BNNC 2OIIA 3ZFEB 2DURA 4YZ5A 2XJSA 2R043 1HRI3 1RUC2 2XJPA 3OBRA 1RJ7A 4P9JA 2AYHA 2Z69A 3N7JA 4KWLA 4GH4C 4YZ1A 3HQXA 3PHMA 4EJRA 3S7IA 1R092 5CG9A 3H0OA 1F5JA 2B7YA 3I4IA