2EIGA

Lotus tetragonolobus seed lectin (isoform)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
VSFNYTRFKDDGSLIFQGDAKIWTDGRLAMPTDPLVNRTTSHALYATPVPIWDSATGNVASFITSFSFIVSNVQRYPPTDGVVFFLAPWGTEIPPNSQGGYLGITDSSNSQNQFVAVEFDSHPNVWDPKSLRSSHIGIDVNSIMSLKAVNWNRVSGSLEKATIIYDSDTKILTVVMTHQNGQITTISQEIDLKTVLPEKVSVGFSATTWNPERERHDIYSWSFTSTLKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of a new quaternary association for legume lectins
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 50
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2eigA00
1GYKA 2DWRA 1CN1A 1SFYA 3MEPA 4YZ3A 1WUVA 1CPMA 2DTYA 1ENRA 1WLCA 3R05A 4M01A 1BJQA 4AGGA 5CNAA 5IK4A 1BQPA 4FPJA 1SLAA 1NLSA 1SLLA 2WT2A 1AJOA 5F5QA 3RRDA 5F9TA 3ZXEA 2P2KA 1HQWA 2V73A 1CVNA 1Q8OA 4C1XA 1GKBA 1LODA 5JOYA 1AX0A 1Z0HA 2ZMLA 1FAYA 2GMPA 1WD3A 2ZKNA 3JU9A 4UW6A 1V6NA 1HKDA 2D43A 2SLIA 1CQ9A 5T52A 1SLCA 2ZMNA 4XJWA 3WHTA 2GN7A 3AXDA 1W6MA 2GNBA 3AYAA 4U2AA 3PVOA 4XMIA 3U4XA 2ENRA 1D2SA 1MZ6A 2DYCA 1GNHA 3N36A 4Q26A 2GNMA 1FATA 3FLPA 1DFQA 1APNA 2P3JA 2TEPA 4XJZA 5FRAA 5GZFA 1KDKA 2ZGRA 2YMZA 3W58A 1LHUA 2EF6A 4WV8A 1W6NA 1H30A 2D3PA 3AK0A 1JBCA 3AYEA 4FOQA 1LEDA 2AH2A 4YLZA 3VV1A 3RG0A 1WW7A 3IMNA 4XHXA 2D44A 4BMEA 3A4UA 4JC1A 1W6PA 2A3XA 2EXKA 2Q5TA 3ILFA 1N1VA 4M3CF 4XXAA 4YM1A 4DPNA 3WHUA 1S0GA 3Q9OA 5JVVA 1GNZA 1HDKA 1ULFA 4BLIA 1ZA4A 1HQLA 2VUAA 3ZXJA 4AVTA 4DS0A 3USUA 4GWMA 2NZ9A 1IS5A 1GLHA 3SH4A 2C9AA 2WQZC 1F5FA 5IK5A 4YG0A 3FLTA 2DURA 4Y22B 1FV3A 2YZ4A 1AZDA 4FPHA 2UWCA 1WD4A 1GZWA 2VW1A 2ARBA 4UW3A 1PZ8A 1LJ7A 2ZHMA 4DRVA 1GZWB 1CPNA 1A78A 3OY8B 1ULDA 2XG3A 3SH3A 2DVFA 2EXIA 3MW2A 3I8TA 4Y1YA 2DV9A 2EAKA 5DZEA 3OYWB 1UZYA 2A6ZA 1V6KA 2GN3A 2ZGSA 1DQ4A 4XJUA 1W6QB 1MS0A 3AZYA 5DZFA 5CB7A 1JN2P 3B69A 4W65A 3B01A 3POWA 4UW4A 2AYHA 2CYFA 3OBTA 4XTPA 2E7QA 5CAZA 1G9DA 1AX1A 3FUQA 3L2YA 4UW5A 4K21A 3AP6A 3AJYA 1LESA 5GJ6A 5H9RA 3M3QA 4Y20A 1UMZA 4ASMB 3SNMA 1WLDA 4DRRA 2NP0A 4ISRA 3GALA 4PCRA 4Q1PA 4FQZA 1LGBA 1N3PA 2JE7A 2ZGMA 4GXLA 4XBQA 1KRIA 5GZEA 1W6NB 2ZGQA 4Y1VA 2VXRA 4Y1XA 1BKZA 3WNXA 2NYYA 3B3QE 4BM8A 4BQ1A 3BTAA 2G4IA 3V0AB 2WT0A 5KXBA 1SACA 4IQPA 2D3RA 4AVSA 1DBNA 1LHWA 2A75A 3WG4A 1BYHA 4AWDA 1H9WA 1UN1A 2R49A 4M3CA 1Q8PA 3WVJA 1RINA 5DUWA 2R0HA 2D6MA 4R9BA 3NV4A 1UKGA 5JOWA 3V64A 3POYA 1WW6A 4H55A 1JYCA 1LEMA 1CIWA 3AP4A 1LOBA 2WLQA 2DVGA 3APBA 4YW1A 1W6MB 3IN9A 1AVBA 1WLWA 4RA0A 1VALA 1Z78A 1GV9A 3N7MA 1WCSA 2E6VA 1CJPA 2OUHA 1GSLA 2LALA 4JRAA 3T1MA 2ZACA 1VAVA 1ULEA 4ATFA 2PHXA 5CBLA 1S0BA 2AREA 2UWBA 5FREA 2NN8A 3ZSKA 4K20A 1WBLA 2FHRA 1QOSA 2KM2A 2I2SA 3UK9A 1QDOA 1IKQA 2ZGPA 2WT1A 2ZZJA 3N3HA 1U0AA 4XBLA 4XXPA 1QNYA 3WDTA 3D5OA 1ULCA 4HL0A 3RMYA 2W52A 4XIKA 1UAIA 5GLUA 3ILRA 1W0PA 4XE9A 5AVAA 2WSVA 4Y20B 1W6OB 1G86A 4ISQA 1D0HA 3B9CA 3ZYPA 2DVAA 4Y1UA 1ULGA 5IUQA 1KJRA 3USUB 3ZXLA 1MS1A 4FPKA 4YM3A 4FPGA 1V6JA 3N7LA 4K1ZA 2BQPA 2VU9A 1DGLA 4PF5A 5BYNA 1QOOA 3FFZA 2WSUA 3ENRA 4XYXA 1SLBA 2JKBA 2HYKA 1QGLA 2WJSA 3VKNA 1HLCA 2P34A 4Q2FA 5SV8A 1Q8QA 2JDZA 3RSJA 3IPVA 4LBQA 2ZHKA 5H9PA 1S0IA 2LTNA 3ASIA 4ZKTB 5L73A 5JLVA 1MVQA 2JD4A 4P9WA 4XILA 2D6OX 1LOAA 4LBQD 1C1FA 5EYYA 2P37A 2PELA 3RMXA 2EALA 1JOJA 1ZM1A 3V65A 1LHVA 1NXD1 1GANA 2A6WA 4FOVA 3WDWA 2W39A 3W59A 1QMJA 2ZMKA 4FPEA 3AP7A 2ARXA 3AYDA 3NWKA 3WG2A 5E88A 1GBGA 4XJAA 2DU1A 1C4RA 1KITA 1LECA 1OKQA 2ZHLA 1DQ6A 3SH5A 1DLLA 5DG2A 2FMDA 1QF3A 2R0FA 5DZGA 4XBNA 1JXNA 3WDXA 5T50A 3OPZA 2A5ZA 2GNDA 3MW3A 4Y26A 1N3OA 1S0FA 2B7YA 3AYCA 1O4ZA 1PZ7A 2PHUA 5EYXA 3BODA 1V6LA 4TYSA 1GICA 2EXJA 1IS4A 1J1TA 4YW3A 3AFKA 3D4KA 3RS6A 5E89A 1QKQA 1FX5A 2ERFA 5H9SA 2A3YA 3MPPG 1MS3A 2UWAA 3ILNA 1SLTA 3AJZA 2H0BA 4LBKA 1I1EA 2OUJA 1X50A 2A6XA 4M3CB 4LBNA 5T5PA 1TEIA 3T2TA 4D69A 1EPWA 4GWNA 3ZSMA 2JJ6A 2OVUA 3VUOA 1JHNA 3NV3A 3WCRA 1DYKA 4XDQA 1ONAA 4YGDA 3V0BA 2A6YA 5EWSA 1SBEA 2PHTA 4FPLA 1G9AA 4R9CA 3WDVA 2R1BA 2VW0A 3M3EA 4CTEA 1RITA 1GZCA 2ZHNA 1A8DA 1DYPA 2VY0A 4ITCA 2CNAA 1MVEA 2ZGLA 5H9QA 3T1LA 3ZSJA 4DFSA 1LU1A 2DUOA 2VW2A 1N1YA 2ZAAA 1MR5A 2D6LX 2D6KA 4XMAA 1CESA 5EXOA 4YG6A 2P3KA 5T54A 4CRQA 3WDYA 1JYIA 1FNYA 1Y7BA 2DVBA 3UJOA 4FVVA 1LOFA 1DQ0A 1WW4A 4BLJA 3HR9A 4FPYA 2A71A 4XJ9A 4YGEA 4FPOB 3WOGA 2D7FA 2GALA 3INAA 3RQ0A 4YZ2A 1V6OA 1AJKA 2NMNA 1C1LA 1KQRA 2PHRA 1W6QA 3ZVXA 2ZGTA 3VKOA 5DUXA 5IK7A 4GKXA 3WV6A 4YZ4A 1A3KA 1MS5A 1N1SA 4BOWA 1UX6A 4P14A 2CY6A 2DU0A 1LOCA 1O4YA 1MS4A 3LCPA 1WBFA 1SCSA 1QNWA 4HANA 1BXHA 2JECA 1LOGA 1FV2A 4WZFA 3H0OA 4YM0A 2XB6C 4PBOA 3C2UA 2AUYA 3I4IA 2WKKA 3M2MA 3ZYRA 4L8QA 1G8WA 3B00A 3ZXKA 5KXCA 5T5JA 1LOEA 2DUPA 4BPZA 1LHOA 4XIOA 1Q8VA 4R9AA 1R1ZA 3BOPA 5GZGA 1MS8A 4XJ8A 1WW5A 1MZ5A 3IPVB 2A6VA 2CTVA 3KM5A 4FPFA 4LBQB 4LBJA 1LOFC 1YYNA 3O5SA 3WUDA 3ATGA 3R4SA 2E7TA 4CZSA 4DQAA 3V0BB 3MW4A 4AGVA 2CWMA 3M3CA 3V0AA 1VIWB 4U36A 5JDBA 3TAYA 4I30A 3OJBA 2VH9A 4LBLA 2ZGOA 5HCAA 5DXDA 3SITA 3UJQA 1AXZA 2E51A 5JOXA 1DIWA 3WUCA 3PVEA 3O0WA 1GZ9A 1LENA 1I3HA 2RHPA 1JW6A 3QLQA 5E8AA 1C57A 3TB0A 2E53A 4YFWA 5GALA 2OW4A 4YGCA 5GLWA 3N35A 2A7AA 2P3IA 5GZDA 3FUOA 1DQ1A 3IKWA 1G9BA 1PZ9A 5IT6A 1ENQA 1SCRA 4AGRA 2CL2A 2EXHA 3NV1A 1IOAA 2GMEA 3DGTA 3WDUA 3HMYA 1ENSA 3VKMA 1IKPA 1XQNA 1AF9A 2GNTA 4LBOA 5DUUA 4YZ1A 5JMCA 3AZXA 1V6MA 1LULA 2NMOA 4XZPA 3CNAA 2AR6A 4ZXKA 1S0DA 1S0CA 3D6EA 1LGCA 1QDCA 1W0OA 2A70A 3PJQA 1QOTA 1FNZA 1F9KA 1W6OA 4BMBA 1IS6A 2YV8A 2D6NA 2V5YA 4SLIA 3VKLA 1MS9A 4AYUA 1MACA 1VLNA 1N47A 4K1YA 2EIGA 3AX4A 1CR7A 2GDFA 4WVVA 3AP5A 1DZQA 2R16A 2DVDA 3GNEA 4Q8KA 4Q1RA 2NM1A 1LCLA 2CWSA 3AP9A 3OYWA 5GLVA 1DQ2A 1YXWA 4MYEA 3JUUA 1S1AA 1UZZA 1SBDA 1Q8SA 1SLIA 3M3OA 5T55A 1N3QA 5KXDA 2DTWA 4Z8BA 5GZCA 4F83A 4FQ4A 4XHBA 4FOYA 1G9FA 2AGSA 5KXEA 3AZZA 2SBAA 4Y1ZA 1BZWA 4M00A 4M3CE 2YXSA 4NOTA 5DUVA 4LBMA 2ZGKA 3PMEA 3O0XA 2C5DA 5LK5A 3O0VA 2D6PA 1YRZA 3AZVA 4FP3A 4XTMA 1UL9A 2ZGNA 1F31A 3FBYA 3NV2A 2PHWA 4YW4A 1AX2A 1JUIA 3FLRA 4PBPA 1SBFA 1B09A 3POSA 4Q8LA 4YM2A 2D3SA 2UU8A 1AXYA 1LTEA 1YO8A 2Z42A 4AVVA 1W6PB 3N7KA 1DHKB 3OGGA 1V00A 3QCWA 5IK8A 3AXEA 4Q27A 1AXKA 2W68A 4YW2A 2ZA9A 1YI7A 3WG1A 1N1TA 1G7YA 1QU0A 3R4UA 4PQ9A 4XOGA 4FOWA 5HCBA 1RIRA 5CA6A 1OQ1A 3ZXFA 2JE9A 5T5OA 4TZDA 1UPSA 2W08A 1FYUA 1CONA 2WNEA 3WLUA 5JOZA 3ZPYA 4GALA 5HCFA 4OZXA 4Y22A 1LGNA 1LU2A 3UL2A 2YY1A 3O12A 4P9XA 5GLZA 5T5LA 2DUQA 4YGBA 3OBRA 4JCKA 2YROA 4GA9A 3SLIA 3AZWA 1DQ5A 2A3WA 2GMMA 1LHNA 3OY8A 3DUIA 3A0NA 3BIWE 3HN1A 1KDMA 2UURA 5GLTA 1VAMA 3WG3A 2PHFA 1IS3A 2R1DA 3LSDA 3PVNA 4YZ5A 1V6IA 4ATEA 4WVWA 3N7JA 4KBBA 4Y24A 4C1WA 2ES3A 2AENA 2ZGUA 2ZBJA 3WCSA 4YG3A 3VKFC 1Q56A 4P9YA 1KJLA 1S0EA 4FP2A 4GKYA 3ZSLA 3IM0A 4NO4A 5DG1A 1H9PA 4FPCA 3WZ1A 3A0KA 3SISA 3M1HA 4R9DA 1OFSA 5GM0A 1G9CA 3KQRA 2ZABA 1S0JA 4YW5A 1URXA 3LSEA 1YIFA 4RL7A 4YFZA
chains in the Genus database with same CATH superfamily
2J1SA 1SFYA 3P3PA 1W2TA 1CAVB 4YZ3A 5FOBB 2D5FA 2XWBB 4TTGA 4LA2A 1BJQA 3KCYA 4AGGA 5IK4A 4HN0A 4MZUA 1SLAA 1SLLA 2Y0OA 1AJOA 5F5QA 5JI7A 5EQUA 3HN3A 3U4SA 2P2KA 4MADA 2V73A 1XE0A 5HXVA 3IZOA 4C1XA 1GKBA 1GZTA 1FOD2 1H2KA 2IVJA 4QX1A 1AX0A 2QZ2A 2W95A 4QPIA 1DCSA 1FMD1 1C28A 1WD3A 4GZ9A 5FZHA 4AI9A 1RGSA 1V6NA 4UW6A 2WO2A 4AG4A 4KWJA 2IXIA 1SLCA 2ZMNA 2HBUA 3JQWA 3UKNA 3AXDA 4KL1A 3WSOA 3AYAA 4U2AA 4AI8A 4XMIA 4CDQC 2H6CA 2YC2A 1FATA 2GP3A 4BE3A 1VBE1 4IGQA 1JS9A 1XYOA 5CEHA 4PF1A 2ZX0A 3VD7A 5FY0A 2ZX1A 4O61A 1H30A 2GC2A 1YLLA 2LUWA 3J7MA 2WQ4A 1Z7S3 5L7OC 5LW9A 5J37A 4AW7A 2XJSA 4XHXA 4GULA 3MIGA 1YFXA 1PIV2 2XBO3 1W6PA 3PNAA 1N1VA 4YM1A 3TN92 1VBD2 3WHUA 1HRV1 1J59A 4A41A 1TQ5A 4R52A 4WBBA 4DY3A 1E57A 4IE6A 1NE4A 1GNZA 1ULFA 3D82A 4XQDA 1BEV1 3TN91 2YPJA 3MIDA 2HJIA 2QQLA 1ZA4A 2ET1A 2VUAA 2FCUA 2FDGA 1W3VA 5A33A 1GLHA 3C7GA 3EB7A 1BBT1 4PHZA 1HXS1 4KWKA 2YZ4A 4EQVA 1QJZA 2UWCA 4D8MA 1Q3EA 3F95A 1GZWA 3ZR6A 4HETA 1BCXA 1PZ8A 1E5RA 1R1A2 5FZGA 3M3IA 1UO9A 1OVPA 2Z69A 1A78A 1SG3A 2GU9A 1J58A 3RZJA 3BI3A 1AR73 1JU4A 2DVFA 4Y1YA 4CP1A 4CEWA 3FMGA 4Y4RA 4NIHA 1SDDB 2QQJA 1RUF1 4BQWA 1I9RA 2A6ZA 2GN3A 2VOXA 2ZGSA 1DQ4A 3LEKA 5AFBA 4HPKB 1LKNA 2RR13 1JN2P 4W65A 4QGNA 1L7QA 3WQ7A 4UW4A 5LA1A 1HRI3 2CYFA 1GP4A 3OBTA 4WVZA 1AR93 3HAGA 3PURA 4UW5A 2VULA 3AJYA 3AP6A 4HSLA 5JIUA 3BUCA 4CDWB 4IEXA 4ASMB 3SNMA 3UGHA 2NP0A 4ISRA 4JQTA 1RHI3 4GMP0 4Q1PA 4FQZA 4Y5TA 1LGBA 1N3PA 2ZGMA 4GH4B 4EN9B 1SMVA 5GZEA 1W6NB 2PTMA 1RL3A 4Y1XA 5FPBA 3WNXA 2NYYA 4BM8A 4BQ1A 1UIJA 1AYM2 2WS92 2VNVA 2G4IA 4ZZ5A 4XCAA 2XVGA 5E16A 4JRLA 1RXFA 1DBNA 3I2JA 3BTZA 3P3NA 3VGIA 5FO8B 5A3OA 4NIIA 5BUVA 5JIAA 3TBDA 4OHWA 3AMMA 1J1LA 5FLJA 2R49A 2YFZA 4M3CA 5FOJB 1DGWA 4HXCA 2W9XA 1RINA 1W9TA 2ZTNA 2R0HA 3T3YA 3MGUA 4QPGC 5CVRA 4CPBD 3LE0A 5E1RA 1K5MB 3LDRA 4QHZA 1XSRA 1PIV3 4V2WA 2V5DA 3LOIA 5HV4A 1WW6A 3WINE 1ODNA 3OGVA 1LOBA 3ELNA 5C3OA 1AVBA 4LHKA 4AXOA 1Z78A 5DDJ2 3DYMA 2IXCA 4XUQA 4UFHA 3T08A 1Y43B 2WNVC 2OUHA 2EA7A 1GSLA 2LALA 4YYOA 4LQRA 1US3A 2WUHA 2WINB 3T4HB 2IXKA 2BFUL 4LHSA 2X29A 4MX3A 2AREA 3CF6E 1ZZ9A 4K20A 2XDVA 1VR3A 2WN2A 2KM2A 2R7EB 1NCRA 3I59A 3J7LA 1WA6X 2ZGPA 3UK9A 1R092 1NAEA 2ZZJA 3FBMA 2X8KA 3FHIB 4XXPA 4CVUA 4LEJA 3QD6A 2HEYF 5FZ4A 1RVF1 4ES8A 4HL0A 2YBSA 5IATA 1RUC1 3E6BA 1JOBA 3ILRA 3MUY1 3K3NA 4I0AA 4QXBA 1AHSA 2VTXJ 1C3HA 1MEC2 3IDAA 3B9CA 3S6PA 3ZYPA 1OLME 3W5NA 3KHCA 3RZGA 2XLFA 2OS2A 3LIGA 1RUI2 5IUQA 1MS1A 3VHOA 1Y3TA 4FPKA 4FPGA 1V6JA 4WZCA 2FDIA 2BQPA 2R041 4AI3A 1CAWA 2W92A 1Q5OA 2BZDA 1W8ZA 4NPMA 5BYNA 5L9BA 1QOOA 2RS51 2W47A 2WSUA 3FFZA 4Q4W3 2JKBA 1H8TC 4LKSA 4BISA 3O1SA 2WR9A 1PO22 3RSJA 4H2AA 1Q8QA 3VBOB 2VOTA 3BGAA 4JKLA 1QJU1 3U07A 3I3MA 2LTNA 3ASIA 2LROA 4OMCA 1ND3C 3GXUA 5C3RA 1NOVA 3N9PA 2E31A 2BERA 1FI2A 2PELA 5FIXA 1AL23 3FE5A 3RMXA 3WDWA 4AF9A 5LEJA 1LHVA 4BQ2A 4FOVA 3ZFFC 4W6YA 5HV0A 4IEZA 4NRMA 3IB3A 2WIIB 1VRH2 2WA4A 4FXGB 4P02B 4NPLA 3OB8A 1TZOA 5A6ZA 5I8TA 1XJAA 5FXZA 4OVEA 1G6NA 2Q0AA 5F5CA 2EVXA 1KITA 5F8PA 3TWIA 1OUXA 5HCHA 4COWA 4XBNA 2H6BA 2YYOA 1PM4A 5BNNA 5FR3A 2WWJA 2A5ZA 4JTOA 4Y26A 1S0FA 2QFEA 1PZ7A 2OXBA 4QX2A 2OPWA 1QJX1 3ZFGB 5I93A 4TYSA 4NWWA 2G1MA 2EXJA 1IS4A 1J1TA 3AL5A 4WM8C 5E89A 1FX5A 1JYVA 3KF5A 1JH5A 2WYFA 2UWAA 3ILNA 4META 3AJZA 5AC92 3N9QA 3WQBA 4AEDC 5A6XA 1X50A 1KGYA 4LBNA 4M3CB 5JPMB 4LT5A 1EPWA 3VUOA 5FYYA 2JJ6A 1Y9MA 3NV3A 4ZY9A 4ZXEA 2PLV2 4URAA 2RS31 3TEWA 1U12A 5I8SA 4FAHA 5EWSA 4QDSA 1S55A 1SZBA 4FPLA 1A8MA 2OZ6A 4LMFA 3WDVA 3ZDSA 4KMQA 5C4WB 3OUIA 1RITA 4CPBA 2ZHNA 1A8DA 5FCCA 5LBFA 3WP6A 1NT0A 2J1UA 2CNAA 2ZGLA 3OPWA 4S2FA 2ZAAA 1UX7A 4OI4A 1LAJA 4XMAA 1FPN3 4H7MA 2XGXA 1GQGA 4CRQA 1YHFA 4EZ4A 3HNYM 2I07B 1PO13 3JCIA 2BBVA 1IQDC 2Y0IA 3NNJA 4YGEA 2X09A 4XJ9A 4OZOA 4FPOB 1PVC1 1AUYA 4Q0SA 4EN8B 2F6BA 4FBFA 2QE3A 4EWDA 4DXZA 4YZ2A 2VMHA 4F8AA 3AVSA 3GBGA 2OA2A 1YNAA 5L9RA 4CP2A 1R083 1N1SA 3WT3A 2L9LA 1WCUA 3ZKYA 2WA3A 4FTSA 1UPIA 2JECA 3ZFEA 5FYVA 3I2GA 2HEWF 5BNOB 2XHNA 3SXWA 1IPJA 4AFBA 1YQ6A 3ETPA 3ES1A 4N53B 3T2OA 4LIVA 1IG0A 1RUF3 3ECQA 1G8WA 1H2MA 3RWKX 1W28A 3S5AA 4AL9A 5A70A 4JTNA 4QKNA 1AR83 2MEV2 5GZGA 2W1QA 1MS8A 1MZ5A 2CTVA 4FPFA 4UFLA 5L19A 1PNGA 3OGJA 2FDJA 4IESA 3R4SA 4CZSA 1VBC1 2BPA2 4AGVA 1TMF3 2XJQA 3M3CA 1ZRFA 3KGLA 4S2HA 5JDBA 4I30A 3OUHA 1NG0A 4NHXA 3OBAA 5D8AB 3UJQA 1AXZA 2ZKLA 4B7KA 4L0PA 5D8AA 1DIWA 3THDA 3VD3A 3VBHA 4A42A 4K40A 2RHPA 1JW6A 1JZ8A 5FZBA 2D93A 5IAVA 4RS5B 1HXS2 1BBT2 2OW4A 2WZR2 4DUXA 1W8NA 1C8M1 2C9KA 2Q1FA 4ZONA 5A6YA 4N9HA 2XHKA 1JZ5A 1DQ1A 3LA3A 2Y6LA 1RHI2 3ITQA 4P5HA 4Q4V1 5FPAA 4ZZ8A 2N7GA 4XF0A 4V2VA 1AR92 4L99A 1NQJA 2RDRA 3DGTA 4LOSA 5FZLA 3H8XA 1AF9A 3ACFA 4LA3A 2ADDA 3CNAA 1EAH3 1VBA1 4QB1A 4E4ZA 4UF0A 1OLMA 1LGCA 2VCMA 2VECA 2X53S 2A70A 4JVAA 1FNZA 1F9KA 1W6OA 1HB2A 1J3RA 1PMJX 4RHV2 2C0ZA 2D6NA 4JGYB 5FZAA 4I09A 5A3WA 3VKLA 4AYUA 2JG8B 4EN7B 1N47A 1TME3 4LIUA 2W87A 3GZAA 2GDFA 1SQ4A 4CYDA 4XUNA 2JDUA 2AEZA 3P5BA 3ZYJB 1FT9A 2NM1A 2OIIA 3BALA 2Y60A 2ZEZA 5AC93 2IFWA 2QBXA 5LA0A 1DQ2A 3O14A 4XFGA 1YXWA 3JUUA 4UBGA 4CDXC 1SBDA 1S2BA 1DDLA 1GFF2 2BNOA 3BPSA 1SLIA 2WYSA 4A44A 5L7OB 1FMD2 2VCBA 2B46X 2DTWA 3LQCA 4Z8BA 1ZX5A 1R64A 5JR2A 5L36A 5DAXA 4XZUG 2JX9A 1ASJ1 2AGSA 4LITA 2WLPA 2B9VA 4AI1A 2PA7A 2RDNA 1MEC3 4GIQA 5DUVA 1NCQC 4FAGA 5LCWL 2D6PA 1YRZA 4LJHA 5FYIA 4DZGA 5FWJA 4XTMA 5I0RA 1UL9A 2ZX3A 5JZGB 4LKFA 2VMGA 2VZTA 1AX2A 1NQDA 2XXZA 1QQP2 3PLQA 1SBFA 1OA2A 5IYYA 1R093 2Y6KA 4NIAA 3ZYFA 5BNNB 2XPJA 1U5ZA 3J9SA 1LTEA 3KCXA 3VBSA 2VPVA 4A6SA 3I3BA 3OGGA 3I2OA 3AXEA 4M4RA 4D3WA 1WCKA 2W68A 4X8PA 1VB2A 4YW2A 1EYBA 2WL1A 2FBEA 1D4M3 2QQUA 2RS12 3R4UA 5FZ1A 3Q8BA 4CCCA 1RUG1 2QQNA 4PLOA 4F7ZA 5CA6A 1WMDA 2JE9A 3VBSC 3TEYA 4IDZA 5J98B 4GALA 1EPZA 1HJFA 2IXJA 3P6BA 4MG2A 3RJRA 1SHWB 1M06G 1RUF2 3OBRA 4CU9A 5FXXA 4JCKA 4NAOA 1W8TA 1OOPC 2JB4A 1AYN2 4HOOA 1HIXA 3MYXA 2FZ2A 3A0NA 3AC0A 3DV8A 3K46A 4H14A 1KDMA 3LB9A 1H8VA 1CX1A 2IXLA 3PIJA 1R081 3LSDA 3L2HA 1EV13 1WMEA 4ZU7A 3H3ZA 4KBBA 4HVOA 4XFCA 1O5LA 3LF7A 1HRI1 1TME2 4CUCA 2WO3A 1BK0A 1EAH1 4JV4A 2WWSA 1S0EA 3DKQA 3MLJA 4FP2A 4GKYA 4RHV1 4CCJA 1K12A 1TVGA 4CDQA 3POIA 4GWIA 5F2SA 5FK8A 1AR63 5FYTA 3E6CC 1D4M1 1GUIA 4QKBA 1RUD2 1YC61 3KS7A 4M0HA 5FMDA 3T0DA 1YQ5A 2JG8C 1X8EA 3HIFA 3VBHC 1OFSA 5GM0A 4D6SA 4IV3A 1ZYBA 2Z79A 2XUMA 1DZRA 1ZZ7A 1YIFA 1OQDA 4KWUA 5APAA 4BXSV 2RM21 2XQXA 1DGRN 1U5YA 5FP7A 1CN1A 2VZRA 4PLMA 3R05A 1UY1A 4Q4V2 4K8FA 5A7SA 2VNOA 1JOPA 1BQPA 3RRDA 2Y64A 1NLSA 4DIQA 2WO1A 4A4AA 2VVEA 1H4HA 2YFUA 4MGKE 3PU8A 5LB6A 1RTVA 1HV1A 2XWJB 1GOFA 4NRQA 3ZKUA 2Y33A 5KXDA 3VZKA 3MIHA 5KR7A 1XE7A 1S2EA 1NCQB 3AKTA 3GGLA 4Q0VA 1QJFA 3K4DA 4H7LA 2GMPA 5FUPA 1UXZA 3JBG3 2TNFA 2VTXA 3UV9A 1RUNA 1CQ9A 5T52A 2I45A 4ORFA 1ZZ6A 5AVPA 1JZ6A 4NPRA 3W5MA 2WRAA 3DL3A 3ACHA 5CFDB 1D2SA 1NYWA 4CCLA 3VBUB 4Q26A 1D2QA 2GNMA 2Y26A 4HBNA 1QJY3 2K2SA 3ZX7A 4AOCA 4EN0A 2K9ZA 4XJZA 5FRAA 2ZGRA 4EJRA 4GAZA 3W58A 3M4FA 3PUHA 1PGW1 3IIIA 4YVSC 1UMHA 2D3PA 2MEV1 1JBCA 4AAXA 2AH2A 1ZBE3 3KV6A 3VV1A 3RG0A 1WW7A 3I49A 3NMBA 1HB3A 3CBNA 2Q8CA 4BDVB 1H2NA 3A4UA 4JC1A 2JKXA 4CP9B 2A3XA 2EXKA 2Q5TA 3ILFA 4XXAA 5A7OA 1DLCA 2VJXA 4X8NA 1F4HA 1HB1A 3Q9OA 3TEXA 1JTZX 1AR72 1HDKA 3KV9A 2OKXA 1ND3B 2XJTA 3NJYA 4CCOA 4YSFA 3KV5A 3NNMA 5B4NA 1JI6A 2BUKA 5FYBA 5F2WA 2NZ9A 1IS5A 2VZVA 3HD8B 5FP3A 3SH4A 5CU1A 1UU4A 4Y22B 1SFNA 2JXAA 1AZDA 4FPHA 4PT6A 4UI9L 3S7EA 4GB31 1WD4A 5JXGA 4UW3A 2ARBA 3I7DA 2ZCWA 1GZWB 1YJLA 4P9IA 2VD7A 4L11A 1ULDA 3SH3A 3LA7A 3NO8A 3MZHA 5FP9A 3MW2A 3I8TA 3IT8A 4M0NA 2W3JA 2VMDA 4CU6A 1IGOA 3VLBB 1T2XA 2DV9A 1VBD3 3DYPA 2EAKA 5DZEA 2DFCA 1UYXA 4CEWB 1COV3 1JYNA 3OCPA 2CGPA 4QXHA 1W6QB 2V4AA 3WY6A 5FMOS 4EZHA 4CCKA 3HPNA 4BHPA 2FQPA 4P9LA 3EBRA 1MQTC 3NVCA 5CFDA 4XTPA 1WCDJ 5GKAC 3VBUA 3H1WA 3L2YA 1XRUA 5GJ6A 3PTRB 2OX0A 1ND2A 4HONA 4K21A 3M3QA 4XQ4A 3RYPA 2RS13 2R072 1RUH1 3LA2A 4NR1A 4QB6A 4DRRA 3IWZA 4BK5A 4XDPA 3E5QA 1AR71 2HWB3 2VZ1A 4XBQA 5AC91 2ORZA 2ZGQA 2YDEA 1XU2A 2CGNA 2WWUA 3EHKA 3B3QE 4HT1T 3RNSA 2ZEWA 3V0AB 4FFIA 2VUCA 1NLQA 3Q8FA 5IVBA 4IQPA 2D3RA 2WFF1 1RUD1 2VZPA 4AWDA 3NRUA 1UN1A 1J3QA 1H1AA 2P6HA 4WM8A 2BGOA 3WVJA 5DUWA 3CLPA 2QQIA 1K5JA 2CGOA 4WM8B 1X7NA 4CCNA 3SHRA 1X82A 4S2DA 3WW2A 5A33B 4C8DA 3K75B 2DCYA 1HN1A 2W5FA 4P08A 2HWD2 1X8MA 4FI9A 3VBRA 1LEMA 1CIWA 5DN2A 3THCA 2RE9A 3APBA 3D0JA 1W6MB 4YW1A 2Y38A 3WP5A 1W03A 1RUC3 5LY1A 4W8JA 1GWLA 3K4ZA 1AL22 1CJPA 1ST8A 5D21A 4HFSA 1CIYA 1VAVA 1AL0G 2E7AA 1XE8A 4UAPA 1X36A 3FJSA 5CBLA 5IW0A 2XJPA 3HBKA 1S0BA 1VBE3 2JE8A 2EIDA 2RJKA 3IAQA 5FREA 5FZCA 1UYZA 1PO23 2QQMA 2G19A 2Q1ZB 4QU1A 5I0TA 1OT5A 1QDOA 4AFDA 4HK9A 2ZS6B 2WT1A 3N3HA 4NHKA 1QNYA 3CU7A 5FZIA 3I59B 3ZLIA 5A3LA 1W06A 4XCBA 1RUG2 1UY4A 4DMIA 3D5OA 1ZBE2 4Q4W1 1ULCA 4R4ZA 4RD7A 4E9KA 3NQHA 2XVLA 5C3QA 4KI5M 4CDWA 1ODMA 2BU9A 3SCHA 1YIPA 2JWPA 1RC6A 4NWVA 3PTYA 1UOBA 4Z1VA 4Y1UA 3U78A 1KJRA 3CZJA 2VUJA 2RDSA 1AR61 1RVF2 3G6JB 3N7LA 4K1ZA 1NA1A 1XXNA 1DGLA 3MV01 5FY5A 1BBT3 2W91A 2VNGA 2HYKA 3TOJA 4YVSA 1HLCA 2VVDA 4Q2FA 5SV8A 4HLTA 4BWOA 4K3UA 4J25A 3JD71 5FUIA 3BYWA 3PHMA 4ZKTB 1BEV3 1MVQA 3I2IA 2D6OX 2VC9A 3UETA 2P37A 3RI8A 3LDKA 5JMOA 3V65A 1JOJA 1F2NA 2A6WA 2ZX2A 2YU2A 4GWJA 2W39A 4QAWA 1VRBA 2AEYA 3OD0A 4N8MA 4Z2AA 4XJAA 4QM9A 4OYUA 2DU1A 3KCCA 1LECA 1HQNA 4KGQA 1WMFA 5FZEA 3T0BA 3VBFB 4RGGA 1OPMA 3S30A 4PQQA 3CIHA 4DB5A 1CAXA 1UWWA 1VBB3 5T50A 4Z07A 5LA2A 2DBNA 2RS33 4OI0A 3MW3A 5F3GA 4AQ6A 1G9DA 1GWKA 1BEV2 1H2LA 1O4ZA 4OLLA 5EYXA 1W90A 1ZRRA 3BODA 3GJBA 3PUQA 4N53A 1VBA2 3URFA 1GICA 4NUBA 1CAUA 4QPGB 2VZQA 2XLAA 3TRSB 4B29A 2HWF1 2XH6A 4E2QA 1MS3A 1AYM1 2WS91 5F6KA 4DUVA 1SLTA 5F3IA 1AR91 2QUOA 3T2QA 2H0BA 1CZVA 1UU5A 1XYPA 5FK7A 1I1EA 4EROA 1EP0A 3MFCA 1NY72 1XC6A 4QM8A 3BIEA 3I2FA 1JZ3A 2OVUA 4QHOA 1JHNA 3ZM8A 1RUJ1 4XDQA 3DXTA 2XJUA 2A6YA 2GC1A 4AEDB 1W3XA 2VL4A 4RGKA 4AR2A 4CCDA 5C4WA 4AVCA 1SBEA 1WKYA 1ZA7A 3FX3A 3JB4C 3ORJA 2R1BA 4MGZE 4CTEA 1GZCA 3I54A 4FXKB 4XFIA 3AFGA 3VZNA 4ITCA 4Q4Y3 2D97A 4KNCA 4TXWA 4AVBA 5LBEA 3T1LA 3ZSJA 5A3UA 2W1UA 2FCTA 2MPFA 1RJ8A 4N90A 1N1YA 3ACIA 3VBOA 3U37A 3BOWA 4JGZB 5T54A 5KC6A 4YG6A 2VZ3A 3HEIA 1FNYA 1W2NA 1AYN1 2DVBA 5B4XA 5L7OA 4XF4A 2WZ8A 1DQ0A 4B3NA 4LE3A 4A7ZA 4PDWA 5CKNA 3DKWA 4GJYA 3U75A 3VHNA 4KQ7A 2RMU3 2CSGA 4BXFA 4QMAA 1C1LA 1KQRA 3B9IA 3D3AA 4D94A 2ZGTA 1BHGA 2P1BA 4OFGA 4HPKA 2O8QA 5DUXA 2UY8A 3K4AA 5IVYA 5IFTA 2J1RA 2XUEA 4LXLA 4YZ4A 4BOWA 1W2UA 2A1XA 1UKRA 1UX6A 4BIOA 3CHXA 1D0GA 2CY6A 2XBO1 4B7EA 5AFEA 1SCSA 1QNWA 5FY4A 3J8F3 4HANA 1LOGA 5DAQA 1FV2A 1I6XA 4DO0A 5A7NA 1PHMA 3H0OA 4YM0A 2QQPA 2JDMA 1OKOA 3TN93 3ZYRA 3VD5A 4ASKA 1RUH2 3B00A 1OSGA 3ME2A 4XACA 5K7PA 1W8WA 1LOEA 2QCSB 4K8RB 1OVSA 1I5PA 2FMYA 2R043 4BYYA 4BPZA 1C8M2 1JODA 1MQTA 5J48A 1KS4A 1Q8VA 2WZR1 3BOPA 1W0NA 3KM5A 3CJIC 3B94A 1Z7S1 4LBJA 4XAAA 4YVWB 1LR5A 2DCJA 2WNUA 2Q8DA 3GZTB 2F4LA 4O65A 5HPOA 2E7TA 3MW4A 2JIGA 2WNUB 3GBWA 3RZKA 1U5IA 4MXWB 4U36A 3TAYA 3KF3A 4AK3A 1QXRA 3POEA 4L9BA 5LATA 3VL8A 5DXDA 4EN6B 4NRPA 3A21A 4CUGA 3LWCA 3GCXA 4QDQA 1YQ8A 4TWTA 5IVCA 1I3HA 2PYTA 3K77A 5FPXA 1W2OA 5E8AA 1FOD3 1COV2 1GQHA 4YFWA 4AQTA 4AI2A 5GALA 5A3PA 4YGCA 2JG9B 1IPSA 2RM23 2DBIA 3K2OA 1XBFA 1O5UA 4BK4A 5ABJA 1AR62 4UT5A 3IKWA 3RZLA 5IT6A 1SCRA 1UMIA 4LUKA 4AGRA 5F39A 1O8SA 3NV1A 2WFF2 4JQRA 3EO6A 3MF9A 5CG8A 3J7HA 3BPZA 3WDUA 4LBOA 5DUUA 1UZWA 1LULA 1REEA 2D40A 1X9PA 4NAMA 2WAAA 4LOTA 1QDCA 1W0OA 5DABA 1WA4A 1IS6A 5J09A 2YV8A 4GMP1 1QJX3 3KMHA 1W8OA 2V5YA 2VVFA 4LK6A 3OSDA 5FTTC 5K0UA 1VBB2 4UBHA 4EYUA 2E32A 2DDUA 2HEVF 3AP5A 4JGYC 4Q1RA 2CV6A 1UYPA 2CWSA 2Y6GA 1S1AA 3WXPA 1A34A 1XSQA 3OEAA 2FDKA 2C26A 4IEPA 3ZN5A 5GZCA 5BV6A 4E8DA 4BZ4A 4XHBA 1GQPA 4FOYA 1NA1C 1PVXA 4W50A 5T3NA 4AHZA 2SBAA 3KVAA 4Y1ZA 3V56A 4M3CE 2YXSA 3C7FA 4QXCA 3PMEA 4XQWA 3S0MA 4FP3A 4IERA 3MICA 3VHPA 5BNNC 2ZGNA 1FPN1 1GOHA 4D7SA 2PHWA 2ZOEB 4ARYA 1JUIA 3FLRA 4PBPA 5D2AA 2VQTA 3EXUA 3POSA 4Q8LA 4YM2A 2ARAA 3H7YA 5C71A 4G9SB 4ZS3A 4BJ0A 4BH9A 4AVVA 3UGFA 2QQWA 5BNQA 5IK8A 2FD8A 2DCZA 2Q4SA 2E63A 1AXKA 3VZLA 3BTYA 2ZEYA 4HG6B 4FTEA 2YHJA 2ZA9A 3ZYBA 2XQRA 3VDCA 2DF7A 1ND3A 4XC9A 1RIRA 1OQ1A 2BRTA 3D8CA 1UY3A 1EAH2 2PQQA 3ZXFA 1FPN2 1HRI2 1TME1 1UPSA 1CONA 5EPAA 5KHHA 3WLUA 2E33A 1COV1 4BA6A 1X9TA 4KBZA 4D6QA 4GMP3 4N43A 2BYVE 1LGNA 3JB8A 2YY1A 3IMMA 1T6GC 2VBDA 1NUKA 3KGZA 5FJHA 1YQCA 1VRH1 2Y34A 4N53C 5ANNA 4KU8A 4OHYA 1VMJA 5CG9A 3HQXA 3IDBB 3IAPA 1RJ7A 2A3WA 4Z92B 3ZOIA 1SFPA 3ABZA 4J1XA 3HN1A 3HWJA 1RUE3 4XUTA 2UY9A 1XYNA 3FWEA 1C8NA 3SMHA 1HXS3 3WG3A 4ZS2A 5LY2A 1IS3A 4CCMA 5ABJC 4RS5A 3PVNA 5FV3A 1CZSA 4ATEA 4WVWA 3N7JA 4C1WA 3NAPA 4UFMA 4C0BA 2ZXQA 1RXGA 4IV1C 1RUJ3 3CKHA 3VKFC 3WF1A 5KBFA 4OI1A 2I74A 2R042 3H42B 3AMPA 4JZRA 3VBFC 2PAEA 4XVHA 5C70A 5A6QA 1W9FA 5FZOB 1D7PM 5CIRA 4XFBA 1H9PA 3WZ1A 1QY4A 2X5IA 3GZEA 2PQSA 4Q4Y1 5K8SA 2X5IB 3TYJA 2VQUA 1S0JA 3D0SA 4RSUA 5CFCC 2WDBA 2XBO2 3LSEA 2VCCA 1UW8A 4NROA 1CAVA 3MIFA 4QDRA 1YFWA 3CL1A 3OG2A 1ZRCA 1BLZA 1D4M2 2DTYA 1ENRA 4CEYA 2J22A 3RYKA 5C6CA 5CYYA 5CNAA 2QDRA 2XVKA 4FT8A 4MGQA 1TNFA 3WF2A 4GJZA 3ZXEA 1HQWA 1ASJ2 2ET7A 2JB8A 5JXJA 3VD9A 3CDZB 1REDA 4B8EA 2JDNA 3NJXA 3OPTA 4HKLA 1Z0HA 1WZXA 1JMUB 4NHLA 1FAYA 1R082 3JU9A 2VZUA 5FY1A 1HKDA 2CDPA 2HWE1 4CUBA 1OF3A 4N7UA 4XJWA 3WHTA 2GN7A 4INDA 2CHHA 2GNBA 1D4VB 1PX4A 5BNPB 2WFF3 3PVOA 3PL0A 5KHGA 3VD4A 3U4XA 2ENRA 1MZ6A 1W39A 2HLEA 2DYCA 1ACCA 4E8CA 5EFUA 3NSTA 3WNLA 3IDCB 2VBPA 4KGGA 1APNA 2P3JA 2TEPA 1DZTA 1R1A1 5FQ0B 5GZFA 1KDKA 2YMZA 1DF0A 3TNPB 1FMD3 2EF6A 2VQAA 4WV8A 4I02A 5LASA 3ZXDA 1W6NA 1ENXA 2GH2A 1UXXX 2YGMA 4LHLA 4QT6A 1LEDA 2BW8A 4YLZA 5C8WA 2LM3A 4C90A 2D44A 2RVAA 3H50A 3JZVA 3SEPA 5HBAA 1UOFA 2XOMA 1XNDA 4DPNA 1O91A 1X33A 5J7MA 1JZ7A 4HVQA 4CSWA 1S0GA 2W2IA 4UWDA 5JVVA 3LDBA 2Z5WA 4RYDA 1HRV2 4BLIA 1BMV2 1RHI1 2VCAA 3W21A 3BN6A 3EYPA 5FZ3A 4N43C 4AVTA 1KFUL 5EJ1B 2CAVA 3USUA 3PUAA 4W4ZA 2C9AA 2WQZC 4AEJA 1F5FA 4AFMA 5ISLA 1W99A 2DURA 2R062 4COVA 3UKTA 3O1VA 4CU7A 2VW1A 2VGDA 1LJ7A 4MOAA 1ZZBA 4DRVA 1DGWX 2VOKA 5DAPA 4ET7A 3OY8B 4QQOA 2XG3A 4URTA 4OULA 4CU8A 4AQ2A 1RYYA 2J1VA 3NAPC 1GWMA 3ST7A 2BNMA 1UIKA 1GOGA 4RS5C 3OYWB 5C8CC 1IPKA 3DPRC 2YC0A 3JD72 3NAPB 1PK6A 3Q8EA 4HZFA 5FO7B 3Q8CA 4IGPA 3AZYA 5CB7A 5DZFA 1FOD1 4CDWC 3B01A 4MVTA 1L7RA 1RUE2 3PJYA 5CAZA 1AX1A 4MGYE 1JHJA 5H9RA 5BY5A 1QJU3 1LESA 5CFCA 2VG9A 4LLOA 1UMZA 1RMU1 2HBTA 4P9GA 4A3XA 1PNFA 4PCRA 3H8RA 1KRIA 1UZ0A 4GXLA 3UL2A 4G4FA 2ATFA 4LPLA 4Y1VA 4XURA 1W8UA 1OA3A 3QACA 1W9YA 1POQA 4AZZA 3BTAA 3SCFA 4Q4W2 5C4WC 5KXBA 1O3RA 4AVSA 5I91A 1OUSA 1I5ZA 3HVDA 1LHWA 4Q4Y2 4XUPA 2JEMA 1MPXA 1VRH3 3T0AA 3U11A 2WABA 2ZZQA 1SPPB 5A1LA 3GDBA 2HWC1 5JCTA 2EIEA 2KR2A 1WMXA 1VBE2 4R9BA 2OZJA 1RUE1 2P4EA 2VXJA 1UKGA 4KH9A 5FYUA 2XKPA 5FZKA 1NCQA 4QPIB 5JOWA 1XPWA 1J3PA 5KHJA 1EY2A 3MFAA 4R8HA 3POYA 4JDMA 4H55A 3G7DA 2IZWA 3AP4A 3OBZA 4RQPA 2WLQA 3SCGA 5LBCA 1O3TA 2QJVA 3IN9A 4IETA 1OOPA 4MXVA 3ZDVA 3KB5A 4RA0A 3WQ1A 3LAGA 4ZPIA 1GV9A 2ZAHA 3N7MA 1WCSA 5KHKA 3VZJA 3ZIXA 4JRAA 3T1MA 4E4SA 2ZACA 5A3MA 2JDAA 2EIBA 3WF0A 1K3IA 2XKOA 3W20A 1MZFA 2UWBA 2NN8A 2XR4A 3ZSKA 3GBFA 2Y6JA 2I2SA 4LKEA 1CAUB 5F32A 2PXJA 1XNTA 2V4VA 2PMWB 1OC1A 3RMYA 2V72A 1IG3A 4KG0A 5GLUA 2VQ0A 5C33A 4CE8A 1W0PA 2VTFA 4XF3A 2WSVA 1WGPA 4H3WA 4FFHA 4Y20B 2J1EA 3Q8AA 1W6OB 4ISQA 4IGOA 4E2GA 4ES9A 3HT1A 2X10A 4Q0PA 1ULGA 3ZXLA 3USUB 4MSVA 5FZ9A 2BFUS 5LA9A 1PIV1 4YM3A 5JUVA 1ZBE1 2VZSA 2VNRA 1QQP3 4IV3B 3VBOC 1NE6A 4AI0A 3IDEA 1KEXA 1XB9A 2QQOA 5F7UA 1U5XA 1SLBA 3SC7X 1QGLA 2WJSA 3VKNA 3AKQA 5IJRA 3O1MA 2JDZA 2HKXA 3VDDB 3BU7A 4I0WB 4LBQA 1H6YA 1PVC2 2C4XA 5K4LA 5JLVA 2BP6A 1YFYA 2JD4A 4NJ4A 4P9WA 4IW3A 3ZO0B 5JI9A 3HJRA 2P6CA 2CDOA 2PHDA 4GD4A 2BWCA 3J8F2 4TSVA 1W05A 4B4RA 4FPEA 4Q4X3 1OLRA 1FXZA 4GH4C 3AYDA 2OYZA 3WG2A 5E88A 1GBGA 3C7OA 4BU2A 2XL7A 2HWF3 1OKQA 2AACA 2C6SA 2ZHLA 4GB32 4QPYA 5CKQA 3SH5A 3T30A 3U14A 2FMDA 2R0FA 3LZZA 4A2UA 4F3JA 3CQOA 4Q0UA 3I3DA 3HQUA 3OPZA 4JKKA 2GNDA 4IEQA 4FO9A 5FQ0A 2B7YA 3AYCA 4QPGA 2PHUA 3GCWA 1V6LA 1MEC1 4ZHNA 3D4KA 5FP8A 2ERFA 5FZDA 5H9SA 4RGAA 3ZN4A 3MPPG 3U0ZA 1NZCA 5FYHA 2B9UA 1MQTB 4PI2A 4LO7A 1C8M3 2OUJA 2WFPA 3POJA 2JD9A 1JUHA 2J1AA 4MH0E 2NPIA 5DPNA 1SPPA 2G9FA 5T5PA 1TEIA 1VMHA 3T2TA 1W9WA 3WW1A 2R071 1DYKA 1ONAA 4O9EA 5FP4A 2GC0A 1A6CA 3BKZA 1E5HA 1P8JA 5KHIA 4MGTA 1S4CA 4D6RA 3R0RA 3WNPA 2WZR3 4QGLA 1NA1B 1YJKA 3AKSA 4R9CA 2X05A 3OD4A 3M3EA 5FYSA 2VY0A 2BOJA 5IFPA 4MGIE 1VP6A 4QX8A 3U10A 4BB3A 5DDJ1 1MVEA 1JZ2A 5H9QA 3OTFA 3H1YA 1LU1A 4UYBA 3W9AA 2D6KA 2ZEXA 3J8F1 4LORA 3VHRA 2ORXA 4A7KA 3ACLA 3WDYA 3TNQA 1VBA3 2BEOA 3DPRA 4FVVA 1YUDA 1TMF2 3FL7A 4I0BA 4OUSA 3HR9A 4FPYA 4NMIA 5BNPC 2D7FA 5K9YA 2GALA 4CDQB 5JXIA 4B1MA 2PLV1 2W1WA 3INAA 1V6OA 1AJKA 3I3QA 5DDJ3 4PI0A 5FUNA 3ZVXA 1OQEA 2RS53 3VKOA 2VOVA 4QQPA 5FZMA 3ZR5A 4AQSA 5F3EA 4P14A 1ULPA 2DU0A 1O4YA 1AR81 1MS4A 1PX3A 1WBFA 1GR3A 3LCPA 3MBWA 3QH6A 4YWAA 1ND2B 4Y4YA 4DINB 3E1F1 4WZFA 4UOJA 1QJX2 2XB6C 3DN7A 3NJZA 3C2UA 2AUYA 5BNOA 2WKKA 2GH8A 3HBZA 2FDHA 1ULOA 4OHZA 5G04L 5KXCA 4AFCA 4XF9A 5T5JA 2RMU1 3NNLA 5J3UA 2DUPA 2GZWA 2WAOA 5I0SA 1LHOA 3OGSA 4XIOA 3SKJE 3C8XA 3PUSA 4UXAA 1ZREA 4XJ8A 1WW5A 2HH9A 4DUWA 2TUNA 1WCQA 1Q43A 3IPVB 1ZZ8A 4JX0A 5J96B 3MI8A 1LOFC 4QX7A 3DYOA 3WUDA 1H1IA 1EUTA 4P5YA 4XFFA 1VIWB 3MUZ1 4YVWC 2H0VA 1UOGA 3JQXA 4JDNA 3BU0A 3IBMA 2VH9A 3KHBA 2ZGOA 3OJBA 3PVBB 2BGCA 3THPA 4FFGA 1SDWA 2E51A 2F17A 2K0GA 3MF6A 5JOXA 3GM8A 3PVEA 3O1RA 3KQ4B 1GZ9A 1LENA 3QLQA 4LUMA 4DOUA 3VBHB 3I2DA 4A6OA 3A7QA 3KVBA 2RS52 3BCWA 5GLWA 3DEMA 3N35A 1VBB1 3SEEA 4CP9A 5JSRA 1KFXL 4TLGA 5GZDA 2RS11 1CX4A 4CCEA 1XNKA 3FUOA 5LRSA 3ZFFB 1PZ9A 1ENQA 1UD1A 2JG9C 5FO9B 4X6RB 5ERLA 2CL2A 4Z2WA 4HKOA 1IOAA 4B4QA 1OXCA 5ACA1 5FMOL 4AHWA 4OHVA 1IKPA 2GNTA 5F6LB 5FJKA 3WP3A 5JMCA 2HYXA 3JBG2 2HWF2 1V6MA 3AZXA 4GB33 4UF0B 4XZPA 1V9U3 2AR6A 3FHQA 1B35A 3JD73 3D6EA 4P9JA 3PJQA 2HWE3 1K5MC 1WLTA 5L9VA 1W9SA 4CEYB 3N4MA 4EWEA 3N9MA 4SLIA 1MS9A 1MACA 2K46A 2G9ZA 3J7NA 2Y6HA 4K1YA 3AX4A 2JG8A 4WVVA 1DZQA 1C5HA 2DVDA 1HW5A 2W94A 1UF2C 2VMFA 1V0AA 3AL6A 3OYWA 4OCTA 5GLVA 4IV1A 1CZTA 2TBVA 2YBPA 3NL1A 4MYEA 3N9LA 4LHNA 4IEYA 4CDUA 1O59A 4CA9A 3POBA 3P1IA 3TEZA 1CJDA 4C0HA 4FQ4A 5FZ7A 3S5QA 5KWRA 2B42B 5FAXA 5BNPA 3ZIWA 5FXVA 5KXEA 3AZZA 1HRV3 1BZWA 1W8HA 3AB0A 4M00A 4NOTA 3VDAA 5EIYB 2C5DA 4AFAA 2J1TA 2F4PA 3CJIA 2VMCA 1NY71 4YW4A 3RPQA 1CWPA 2QQKA 3T09A 1B09A 4LTAA 3LEMA 3R6SA 4Q29A 1AXYA 3I2HA 3KLSA 5JAXA 1ZBA3 4E4HA 3N7KA 1DHKB 1V00A 3QCWA 1NCRC 4DEVA 3GYDA 4Q27A 3POFA 4QQLA 2Q8OA 3WG1A 3BTXA 1N1TA 5D1IA 1G7YA 4PQ9A 1H8TB 4FOWA 3NKGA 1IHMA 2P17A 1PMHX 5LEKA 2JDYA 5T5OA 1UNBA 1ZRDA 4LO5B 2WNEA 4LR4A 4YVWA 3QOPA 3UGGA 3HNMA 5JOZA 3ZPYA 5FZ0A 4O7XA 5HCFA 1OBNA 4OZXA 1YCIA 4FCAA 3SKVA 1JU3A 3ZN6B 4C91A 4I3GA 4LE4A 4BQXA 2Y6FA 3O12A 3HNBM 2DUQA 1XNAA 4YGBA 1J84A 4XETA 1PGL2 2Q1MA 4JKMA 2R073 2FCVA 3NNGA 1DQ5A 3LOBA 2GMMA 1AL21 2YB7A 5A7WA 1OURA 3C7HA 3RZZA 5JPNB 3VL9A 2UURA 5GLTA 2W46A 4Y33A 4UFKA 5A1FA 3ROUA 4HSJA 4B4PA 2YGLA 4ASLA 4YZ5A 3FN9A 1DU3D 2JG9A 3WNMA 5C3PA 3ZFEC 2ZGUA 3DF0A 2ZBJA 1RUOA 4YG3A 5FMBA 5ABJB 1V9U1 3WW4A 3O1TA 1KJLA 3ZFFA 5BPXA 3ZFGC 3GHMA 2QDNA 1M4WA 2O8OA 3AKRA 2WZPP 3ACGA 3QH7A 4BQ3A 3B02A 1QXJA 4TN7A 4WM7B 5CFCB 4IE7A 2JDHA 4YARA 5JXHA 3A0KA 1JZ4A 4MUVA 4WM7A 3ZYIB 3M1HA 1Y9GA 1VBD1 4R9DA 3OGRA 2LS6A 1QHDA 2W0XA 2ZABA 4QPIC 4IEVA 3GHNA 1E5IA 3IIAA 2Q30A 3KV4A 4YW5A 1ZBA1 1B35C 4RL7A 5FFOC 4DNYA 5JSPA 4KG8A 1GYKA 4WVMB 1S2KA 2DWRA 2NLRA 2PAMA 2YBKA 5HI0A 1RVF3 4PIXA 3MEPA 4NIDA 1WUVA 1K42A 1CPMA 1WLCA 4M01A 4WVMA 3USSA 3VDDA 4N9IA 2DCTA 4MV2A 3VN4A 4FPJA 2WT2A 4XW3A 3WNKA 3CJXA 4D0QA 5F9TA 4KU7A 3BVCA 5FBJA 1PMIA 4LKDA 1KXGA 2IVIB 4B1LA 4BQ4A 1CVNA 1Q8OA 3J4UH 4NHMA 2XLGA 3NJVA 4JGZC 1LODA 2XJVA 3WR0A 5JOYA 2ZMLA 4QQHA 1BVVA 2ZKNA 2DFBA 2GC3A 4RR3A 2D43A 5TSWA 2SLIA 3ZN6A 5LK7B 4RR3B 1UOJA 1W6MA 1RUD3 4FTBA 4XAEA 3AM2A 2J7MA 4MLOA 1NKGA 1OA4A 4L97A 1GNHA 3N36A 4EV0A 3UNPA 4IXLA 2KA3A 5C9AB 5IVVA 3FLPA 1YWKA 1DFQA 2ID4A 2BTVC 3S7IA 5C9AA 3RZMA 4IUGA 1LHUA 2PLV3 1BK1A 3DCQA 4XFAA 2BDRA 1CD3G 2PAKA 5A3TA 1HB4A 3AK0A 3AYEA 4FOQA 2WZEA 3IMNA 1OH4A 1Y4WA 2JDPA 3ZMOA 4BMEA 3VBSB 3LEGA 4M3CF 1O7FA 4IL7A 4Q0QA 1GP5A 4RFT0 3LGRA 3H7JA 2W1SA 3VDDC 2GAUA 4XABA 2B45X 1OD3A 4IE5A 4Q4V3 1OF4A 5JZGC 1HQLA 2VR4A 1TG7A 3N9NA 3ZXJA 2O0OA 4DS0A 4ZU5A 4GWMA 3VZMA 2R6QA 2B8MA 1XU1A 1E5SA 2OQ6A 3DXUA 2RG4A 1IZ3A 1O4TA 3FLTA 4YG0A 4N43B 5EJZB 5IK5A 1FV3A 1VE0A 3AMHA 3LKJA 4AEMA 4DXSA 1OI6A 1VAKA 2RR11 2ZHMA 5FY8A 2QVSB 4CUAA 5D8AC 2D98A 3O1OA 1CPNA 5FMCA 4QWNA 3WNNA 3WNOA 4V1PA 4AHYA 2B4KA 5A7WB 4R4XA 2EXIA 2VZOA 2XJRA 3LEIA 1REFA 5A80A 5KC5A 1WWYA 3ZXGA 1UZYA 1V6KA 3LIHA 4XJUA 1DP0A 1K45A 2VUDA 4LNVA 1EV12 1XOYA 4QHBA 3PMSA 4CP0A 2A73B 1HX6A 3PU3A 1MS0A 2RJ2A 4QGMA 5HXMA 1H0BA 3B69A 3O7OA 3ZSEA 3POWA 2AYHA 1YEWA 1HV0A 1ZNPA 2E7QA 3FUQA 4QB2A 1JYWA 5FZOA 1CGPA 1CAXB 4D7YA 1ALYA 4Y20A 1JYXA 4CXYA 1WLDA 4GH4A 5C5TA 4I2OA 3GALA 1OH3A 4NN0A 4X6QB 2PFWA 2JE7A 3S57A 2R32A 3RWNA 2KXLA 2ILMA 2RM22 1BKZA 2IFRA 1ZBA2 2VXRA 1VB4A 5M0TA 2WQ8A 5FY7A 3RYRA 3T4VA 2WT0A 4IEOA 1SACA 4LO8A 1YFUA 4L92A 4EWAA 2A75A 4MGSA 3WG4A 1BYHA 1OHFA 2R30A 3H1MA 5F37A 1H9WA 1RMU3 1PGW2 3A23A 4JHTA 4QD2A 4XF1A 1Q8PA 3LFMA 1K5MA 1O6UA 2D6MA 4PIZA 3N9OA 1H8TA 3NV4A 3VBUC 2CAUA 5FPLA 4XEZA 3V64A 3U1XA 2VO5A 1UYYA 5A32A 2VBBA 1VPHA 3PIGA 1JYCA 4XPVA 3I2KA 1L3JA 2C24A 4HN1A 2DVGA 3AVRA 4Q4X2 2UYAA 4XDOA 2YC4A 2O14A 2Z2SB 1WLWA 1VALA 3EJKA 4O9GA 4QQ2A 5FYZA 4Q5OA 2E6VA 3AKPA 4HKWA 1F5JA 3A22A 3M8LA 2LRPA 3ZYGA 5SV5A 2XONA 1ULEA 1QJY2 1RUH3 4ATFA 2PHXA 3MIBA 5F3CA 2DCKA 4NE9A 4PLNA 3WX5A 1PVC3 5FPUA 1QJU2 1LB2A 5A7PA 1WBLA 5I0DA 1BVP1 2FHRA 1QOSA 3ZFGA 4FSJA 1UY2A 4LK7A 4E2SA 1IKQA 5A7QA 4QKDA 2GP5A 1U0AA 4XBLA 3BB6A 4RR3C 3WDTA 2ETEA 3KZ4C 4QKFA 4QX0A 2BGPA 2OT7A 2W52A 4XIKA 1AYM3 1UAIA 2VAUA 2WS93 5IAXA 4XE9A 5G05L 5AVAA 2BVBA 1G86A 1D0HA 2QTWB 1UQXA 3MLKA 4YNIA 2DVAA 2B39A 3GJAA 4QX3A 1RMU2 2ZJCA 1CAWB 2IWGB 1VMFA 1KS5A 5FDBA 3CEWA 1OLQA 2C1FA 5DAWA 2VU9A 5ACA3 5J36A 3KT4A 1GNYA 3CO2A 4PF5A 2R063 4XYXA 3ENRA 5FY9A 2ZPXA 3I3EA 2MNGA 4E4DX 4IV3C 2P34A 1F15A 1LNSA 3IPVA 4UFJA 2AZ5A 2ZHKA 1S0IA 2JICA 5H9PA 2ADEA 4CXXA 4J1WA 5L73A 2PN5A 1QEXA 3KT1A 4XILA 4IEWA 5EHDA 1LOAA 1W2AX 1C1FA 4LBQD 2QQVA 5EYYA 4CDXA 2EALA 4PDWB 1ZM1A 5A3NA 1NXD1 1GANA 4MXWA 3RDIA 3C3VA 3W59A 1QMJA 5FLHA 1PGL1 2ZMKA 1PK6B 4COZA 3CZUA 3AP7A 5DMYA 2ARXA 3NWKA 3CJIB 4A3ZA 1ZRIA 1C4RA 1W04A 4Y5SA 1POV1 3F2ZA 1DQ6A 1XNBA 1DLLA 2VM9A 5DG2A 1QF3A 1EUUA 3SQOA 2P5BA 2WNUC 3WP4A 5DZGA 1JXNA 3WDXA 1KD7A 1O3QA 3KT7A 1AYN3 4PIYA 3H9AA 4BQYA 2HWC2 3RVHA 2QNKA 4HVRA 3ZFEB 1POV0 3M70A 1N3OA 3JXSA 4J6GA 1BMV1 4CEYC 2VE1A 4YW3A 3RS6A 5LZ6A 3AFKA 3V0AA 1POV3 1QKQA 3JBG1 2A3YA 5A1AA 4AHXA 1NLRA 1PGSA 3E6DA 2MEV3 3ON7A 4G3YC 1UY0A 4MHRA 5ACA2 3ZMNA 2YPDA 1VJ2A 4LBKA 1OFNA 4A45A 2X5IC 2A6XA 5CADA 1PM7A 5FYCA 5FZFA 4GWNA 4D69A 1B35B 3ZSMA 3LPGA 3V0BA 4K6BA 3WCRA 1RB8G 4YGDA 5FZ8A 5I0UA 4XUOA 3C7EA 2PHTA 3AMQA 1G9AA 4S2GA 1XNCA 4AEDA 4A7YA 2VW0A 4M4PA 4RQPB 3K3OA 1DYPA 1GP6A 3MLLA 4OQ8A 2ZX4A 4JGZA 5CFDC 3FC0A 4DFSA 2DUOA 2VW2A 2XMLA 2FZ1A 4OUMA 1MR5A 2D6LX 4RQPC 5EXOA 1CESA 3RZHA 2P3KA 1JYIA 1Y7BA 1DYOA 2UYBA 3R4DB 3FHAA 3OUJA 3UJOA 3HOBA 1LOFA 1WW4A 3UT0A 2D5HA 4LO4B 4P00B 3WEZA 4BLJA 2A71A 3KWVA 3LFIA 1US2A 3WOGA 3MDPA 5B2GB 3FFQA 1NCRB 3RQ0A 1RUJ2 5C8CA 2NMNA 2PHRA 3LPFA 1W6QA 1F35A 5E6HA 3NKTA 2R061 4OQ9A 4DEQA 5IK7A 1MZEA 4GKXA 2VMIA 5FKCA 3WV6A 1A3KA 1MS5A 1RUG3 5BNOC 3LD8A 2O1QA 5F5IA 1LOCA 2PHLA 1BXHA 4QU2A 4DXTA 2YU1A 5LBBA 3RGBA 4Y3OA 4RHV3 2BWAA 4PBOA 3NW4A 5IVEA 3I4IA 3M2MA 4I01A 3KSCA 4L8QA 4E27A 3ZXKA 1F8VA 4YW6A 1HN0A 2HWB1 3H3UA 5LRRA 1R1A3 4PDWC 1ZZCA 2AC1A 1QQP1 4K9SA 3QBQA 5IHRA 5EV7A 4D7TA 5CZKA 3WF3A 4R9AA 1R1ZA 4COUA 1OD5A 4LBQB 2A6VA 3OOXA 4JAAA 1QXPA 2JENA 3MPBA 4RN5A 3ZYHA 3H8OA 2HWD3 1GMMA 3KD4A 1YYNA 3O5SA 4DQAA 3ATGA 3UESA 3V0BB 1H6XA 3O1UA 1RUI3 3CMGA 2CWMA 4CEWC 1OMIA 3GF6A 1SEFA 4LBLA 3X29B 5HCAA 5IVFA 1O3SA 5CKMA 3SITA 5BXXA 4GQ7A 2HWE2 3HQRA 3WUCA 4Q4X1 3O0WA 5F1RA 1UCXA 3VBFA 5J1XA 2HWD1 4YPJA 4L2NA 2LW8A 3FZ3A 1NXMA 1C57A 3TB0A 1QH6A 2E53A 1YQ2A 1ASJ3 1DGRA 3E5XA 5C3SA 1UZVA 2WO7A 3DPRB 4NHYA 1QWRA 2A7AA 2P3IA 4IE4A 2RMU2 5FBZA 1G9BA 4LULA 4SBVA 4XFHA 2B5HA 3RJ2X 5FYMA 2EXHA 2NQYA 3VDBA 1L7LA 2WBKA 2GMEA 3HMYA 1ENSA 3GZUC 3THTA 5DQ0A 3T2PA 1XQNA 3VKMA 4NIGA 1AR82 4UFIA 5EP9A 4YZ1A 2NMOA 3DECA 3WW3A 2EICA 4ZXKA 2EAAA 4W6XA 3OF1A 1S0DA 1IQAA 1S0CA 3EMRA 4BQ5A 2BV4A 5F5AA 4DY5A 1QOTA 4TLFA 3E97A 5JR7B 4BMBA 2YG0A 5FZ6A 3K51A 3VZOA 2HWC3 4QXKA 4W6WA 4AE2A 1VLNA 2BNNA 4N7IA 1VBC3 4FFFA 5LWBA 4YRDA 1NZIA 4JGYA 5ANQA 2MHFA 4ZU4A 4CDUC 1QJY1 2EIGA 1CR7A 4QPWA 3H8UA 4ARXA 4MO3M 2R16A 3GNEA 3UYJA 4Q8KA 2FDFA 1LCLA 3AP9A 4AEKA 2WNVB 4CDUB 3I97A 4YVSB 1UZZA 5EJ3A 2ARCA 2WNVA 1Q8SA 1OPOA 3ZXAC 3M3OA 3H3LA 1N3QA 5T55A 2RV9A 3MO4A 1V70A 2OQ7A 1LRHA 5IWFA 4F83A 4OHXA 4OMDA 4CDXB 2JDKA 1YI9A 5FLIA 1ND2C 1G9FA 2J42A 3ALQA 3WF4A 5JSOA 2G9GA 1PO12 3O1PA 1VBC2 4OI2A 2RS32 4LBMA 2ZGKA 3HT2A 1PO21 3O0XA 5LK5A 5FPVA 3O0VA 5FWEA 3M7AA 1GU3A 3AZVA 3B93A 4JHZA 1F31A 3FBYA 3NV2A 3RFRA 5IVJA 5I8YA 2BJSA 1W8FA 4RFRB 3RI9A 3MV11 4NVPA 2KD7A 2CU5A 4IE0A 3J26N 2IXHA 4OUEA 2D3SA 3EQEA 4COYA 2GSYA 2IUWA 2UU8A 1RUI1 4ONUA 4DXRA 1YO8A 5C9AC 2Z42A 1J83A 3ZPOA 4IEUA 1W6PB 2RJLA 3VB9A 1O8PA 3ETQA 4I3PA 4LO6B 3POGA 1Y9QA 4Z82A 1YI7A 1QU0A 4XOGA 2E26A 5HCBA 5CISA 5FXWA 4Y5Z0 1V9U2 4JDOA 3ES4A 5JWPA 4MHUA 4TZDA 2W08A 1FYUA 4LLFA 1R091 5FKBA 2WN3A 3MHZA 4QX5A 5A32B 3VBRB 4AVAA 5K0UC 3B5LB 3L9JT 1F4AA 1EV11 1OOPB 1UU6A 4K7JA 4Y22A 1LU2A 1H1MA 4PJYA 3MIEA 3NNFA 1PO11 1STMA 4P9XA 5GLZA 1C5IA 5T5LA 3VBRC 4BCUA 2P3YA 4HMZA 1TMF1 1PK6C 5FPZA 4EE2A 2XL9A 5K0UB 2YROA 4GA9A 1TE1B 2Y8KA 3AZWA 4KWLA 3SLIA 3UKVA 1LHNA 2V09A 3OY8A 3DUIA 3BIWE 5C7GA 1QH7A 1VAMA 5C5UA 2PHFA 5EZWA 2RR12 2VMEA 1HJGA 2R1DA 4IV1B 2JIJA 1V6IA 1Z7S2 2BOIA 2QZ3A 3B7MA 1DG6A 4Y24A 2WNOA 2ES3A 1H4GA 2AENA 2WC2A 3E5UA 3PUIA 2Q8EA 4BIFA 1ZVFA 5DAVA 3WCSA 4WM7C 4CXWA 1QIQA 3OEBA 1Q56A 2RDQA 4P9YA 2HWB2 3ZSLA 2BBAA 2BVVA 2QKDA 3IM0A 4YW7A 1QJEA 4NO4A 5DG1A 2E9QA 3AMNA 2IC1A 4AAPA 5C8CB 2YUEA 3PDQA 4FPCA 1TNRA 3SISA 5JZGA 2Z4FA 2OPKA 1G9CA 3WQ0A 1RUC2 3KQRA 2VOWA 3K48A 1URXA 4HK8A 1T6BX 1JYTA 3WD5A 4YFZA 1NX9A
chains in the Genus database with same CATH topology
1SFYA 3P3PA 1CAVB 4YZ3A 5FOBB 2D5FA 2XWBB 4LA2A 1BJQA 3KCYA 4AGGA 5IK4A 4HN0A 4MZUA 1SLAA 1SLLA 2Y0OA 1AJOA 5F5QA 5JI7A 2P2KA 2V73A 5HXVA 4C1XA 1GKBA 1FOD2 1H2KA 1AX0A 2QZ2A 4QPIA 1FMD1 1C28A 1WD3A 1RGSA 1V6NA 4UW6A 4AG4A 4KWJA 2IXIA 1SLCA 2ZMNA 3JQWA 3UKNA 3AXDA 4KL1A 3AYAA 4U2AA 4AI8A 4XMIA 4CDQC 2H6CA 1FATA 4BE3A 1VBE1 1XYOA 2ZX0A 2ZX1A 1H30A 2GC2A 1YLLA 2LUWA 2WQ4A 1Z7S3 5L7OC 5J37A 4AW7A 2XJSA 4XHXA 4GULA 3MIGA 1YFXA 1PIV2 2XBO3 1W6PA 3PNAA 1N1VA 4YM1A 3TN92 1VBD2 3WHUA 1HRV1 1J59A 1TQ5A 4R52A 4WBBA 4DY3A 1E57A 1NE4A 1GNZA 1ULFA 3D82A 4XQDA 1BEV1 3TN91 2YPJA 3MIDA 2HJIA 1ZA4A 2ET1A 2VUAA 5A33A 1GLHA 1BBT1 1HXS1 4KWKA 2YZ4A 1QJZA 2UWCA 1Q3EA 1GZWA 4HETA 1BCXA 1PZ8A 1R1A2 3M3IA 2Z69A 1A78A 2GU9A 1J58A 1AR73 2DVFA 4Y1YA 4CP1A 4CEWA 3FMGA 1RUF1 1I9RA 2A6ZA 2GN3A 2VOXA 2ZGSA 1DQ4A 5AFBA 4HPKB 1LKNA 2RR13 1JN2P 4W65A 4QGNA 3WQ7A 4UW4A 1HRI3 2CYFA 3OBTA 4WVZA 1AR93 3HAGA 4UW5A 2VULA 3AJYA 3AP6A 4HSLA 5JIUA 4CDWB 4IEXA 4ASMB 3SNMA 2NP0A 4ISRA 1RHI3 4GMP0 4Q1PA 4FQZA 1LGBA 1N3PA 2ZGMA 4GH4B 4EN9B 1SMVA 5GZEA 1W6NB 2PTMA 1RL3A 4Y1XA 3WNXA 2NYYA 4BM8A 4BQ1A 1UIJA 1AYM2 2WS92 2G4IA 5E16A 2XVGA 4JRLA 1DBNA 3P3NA 3VGIA 5FO8B 5BUVA 5JIAA 3TBDA 4OHWA 3AMMA 1J1LA 5FLJA 2R49A 4M3CA 5FOJB 1DGWA 2ZTNA 1RINA 2R0HA 3MGUA 4QPGC 5CVRA 5E1RA 1K5MB 1PIV3 3LOIA 1WW6A 3WINE 1LOBA 3ELNA 1AVBA 4LHKA 4AXOA 1Z78A 5DDJ2 2IXCA 1Y43B 2WNVC 2OUHA 2EA7A 1GSLA 2LALA 4YYOA 2WINB 2IXKA 2BFUL 4MX3A 2X29A 2AREA 3CF6E 1ZZ9A 4K20A 1VR3A 2KM2A 1NCRA 3I59A 3UK9A 2ZGPA 1R092 3FBMA 2ZZJA 2X8KA 3FHIB 4XXPA 4LEJA 3QD6A 2HEYF 1RVF1 4ES8A 4HL0A 1RUC1 3E6BA 3ILRA 4I0AA 1AHSA 1C3HA 1MEC2 3B9CA 3S6PA 3ZYPA 2XLFA 5IUQA 1RUI2 1MS1A 3VHOA 1Y3TA 4FPKA 4FPGA 1V6JA 4WZCA 2BQPA 2R041 4AI3A 1CAWA 1Q5OA 5BYNA 1QOOA 2RS51 3FFZA 2WSUA 4Q4W3 2JKBA 1H8TC 1PO22 3RSJA 1Q8QA 3VBOB 1QJU1 3U07A 2LTNA 3ASIA 1ND3C 1NOVA 2PELA 1FI2A 3RMXA 1AL23 3FE5A 3WDWA 4AF9A 5LEJA 1LHVA 4FOVA 3ZFFC 4W6YA 4IEZA 4FXGB 2WIIB 1VRH2 2WA4A 5I8TA 4OVEA 1G6NA 2Q0AA 2EVXA 1KITA 3TWIA 4COWA 4XBNA 2H6BA 2YYOA 5BNNA 2A5ZA 4JTOA 4Y26A 1S0FA 2QFEA 1PZ7A 1QJX1 3ZFGB 5I93A 4TYSA 4NWWA 2EXJA 1IS4A 1J1TA 4WM8C 5E89A 1FX5A 1JH5A 2UWAA 3ILNA 4META 3AJZA 5AC92 4AEDC 1X50A 4M3CB 4LBNA 5JPMB 4LT5A 1EPWA 3VUOA 2JJ6A 3NV3A 2PLV2 2RS31 1U12A 5I8SA 4FAHA 5EWSA 1S55A 4FPLA 1A8MA 2OZ6A 3WDVA 3ZDSA 5C4WB 1RITA 2ZHNA 1A8DA 5FCCA 3WP6A 2CNAA 2ZGLA 4S2FA 2ZAAA 4OI4A 4XMAA 1FPN3 4H7MA 2XGXA 1GQGA 4CRQA 1YHFA 2I07B 1PO13 3JCIA 2BBVA 2Y0IA 4YGEA 4XJ9A 4FPOB 1PVC1 1AUYA 4Q0SA 4EN8B 2F6BA 4FBFA 2QE3A 4EWDA 4DXZA 4YZ2A 2VMHA 4F8AA 3GBGA 2OA2A 1YNAA 4CP2A 1R083 1N1SA 3WT3A 4FTSA 2WA3A 1UPIA 2JECA 3ZFEA 5BNOB 2HEWF 3SXWA 1IPJA 4AFBA 4N53B 3ES1A 1RUF3 3ECQA 1G8WA 1H2MA 4JTNA 1AR83 2MEV2 5GZGA 1MS8A 1MZ5A 2CTVA 4FPFA 5L19A 1PNGA 3OGJA 4IESA 3R4SA 4CZSA 1VBC1 2BPA2 4AGVA 1TMF3 2XJQA 3M3CA 1ZRFA 3KGLA 4S2HA 5JDBA 4I30A 1NG0A 5D8AB 3UJQA 1AXZA 2ZKLA 4B7KA 5D8AA 1DIWA 3VBHA 4K40A 2RHPA 1JW6A 2D93A 4RS5B 1HXS2 1BBT2 2OW4A 2WZR2 1C8M1 4N9HA 2XHKA 1DQ1A 3LA3A 1RHI2 4P5HA 4Q4V1 2N7GA 4XF0A 1AR92 4L99A 1NQJA 3DGTA 1AF9A 4LA3A 3CNAA 1EAH3 1VBA1 4E4ZA 1LGCA 2VECA 2X53S 2A70A 4JVAA 1FNZA 1F9KA 1W6OA 1J3RA 4RHV2 2C0ZA 2D6NA 4JGYB 4I09A 3VKLA 4AYUA 2JG8B 4EN7B 1N47A 1TME3 3GZAA 2GDFA 1SQ4A 4CYDA 3ZYJB 1FT9A 2NM1A 2OIIA 3BALA 5AC93 2IFWA 1DQ2A 3O14A 4XFGA 1YXWA 3JUUA 4UBGA 4CDXC 1SBDA 1S2BA 1DDLA 1GFF2 2BNOA 1SLIA 5L7OB 1FMD2 2B46X 2DTWA 4Z8BA 1ZX5A 5L36A 2JX9A 1ASJ1 2AGSA 2WLPA 4AI1A 2PA7A 5DUVA 1MEC3 4GIQA 1NCQC 4FAGA 2D6PA 1YRZA 4DZGA 5I0RA 4XTMA 5JZGB 1UL9A 2ZX3A 2VMGA 1AX2A 1NQDA 1QQP2 3PLQA 1SBFA 1OA2A 1R093 5BNNB 2XPJA 1U5ZA 3J9SA 1LTEA 3KCXA 3VBSA 2VPVA 3OGGA 3AXEA 4D3WA 1WCKA 2W68A 4X8PA 1VB2A 4YW2A 1EYBA 2WL1A 2FBEA 1D4M3 3R4UA 2RS12 1RUG1 4PLOA 4F7ZA 5CA6A 1WMDA 2JE9A 3VBSC 5J98B 4GALA 1EPZA 2IXJA 3RJRA 1M06G 1RUF2 3OBRA 4JCKA 1OOPC 1AYN2 1HIXA 3MYXA 2FZ2A 3A0NA 3DV8A 4H14A 1KDMA 3LB9A 1H8VA 2IXLA 1R081 3LSDA 3L2HA 1EV13 1WMEA 4ZU7A 3H3ZA 4KBBA 4HVOA 4XFCA 1O5LA 1HRI1 1TME2 1EAH1 4JV4A 2WWSA 1S0EA 4FP2A 3MLJA 4GKYA 4RHV1 4CDQA 3E6CC 1AR63 1D4M1 1RUD2 3KS7A 4M0HA 2JG8C 1X8EA 3HIFA 3VBHC 1OFSA 5GM0A 4IV3A 1ZYBA 2Z79A 2XUMA 1DZRA 1ZZ7A 1YIFA 1OQDA 2RM21 1DGRN 1U5YA 1CN1A 4PLMA 3R05A 4Q4V2 4K8FA 2VNOA 1BQPA 3RRDA 1NLSA 2VVEA 1H4HA 4MGKE 1RTVA 1HV1A 2XWJB 3VZKA 3MIHA 1XE7A 1NCQB 3AKTA 4Q0VA 4H7LA 2GMPA 3JBG3 2TNFA 3UV9A 1RUNA 1CQ9A 5T52A 2I45A 4ORFA 1ZZ6A 5AVPA 4NPRA 3DL3A 5CFDB 1D2SA 1NYWA 3VBUB 4Q26A 1D2QA 2GNMA 2Y26A 4HBNA 1QJY3 2K2SA 3ZX7A 4EN0A 2K9ZA 4XJZA 5FRAA 2ZGRA 4EJRA 3W58A 3M4FA 1PGW1 4YVSC 2D3PA 2MEV1 1JBCA 2AH2A 1ZBE3 3VV1A 3RG0A 1WW7A 1H2NA 3A4UA 4JC1A 2A3XA 2EXKA 2Q5TA 3ILFA 4XXAA 4X8NA 3Q9OA 1JTZX 1AR72 1HDKA 1ND3B 2XJTA 4YSFA 2BUKA 2NZ9A 1IS5A 3HD8B 3SH4A 5CU1A 1UU4A 4Y22B 1SFNA 2JXAA 1AZDA 4FPHA 3S7EA 4GB31 1WD4A 4UW3A 2ARBA 3I7DA 2ZCWA 1GZWB 1YJLA 4P9IA 4L11A 1ULDA 3SH3A 3LA7A 3NO8A 3MZHA 3MW2A 3I8TA 3IT8A 4M0NA 1IGOA 3VLBB 2DV9A 1VBD3 2EAKA 5DZEA 2DFCA 4CEWB 1COV3 3OCPA 2CGPA 1W6QB 3WY6A 5FMOS 4BHPA 2FQPA 4P9LA 3EBRA 1MQTC 3NVCA 5CFDA 4XTPA 1WCDJ 5GKAC 3VBUA 3H1WA 3L2YA 1XRUA 5GJ6A 4K21A 1G9DA 1ND2A 3M3QA 4XQ4A 3RYPA 2RS13 2R072 1RUH1 3LA2A 4NR1A 4DRRA 3IWZA 3E5QA 1AR71 2HWB3 4XBQA 5AC91 2ZGQA 2YDEA 1XU2A 2CGNA 3EHKA 4HT1T 3B3QE 3RNSA 3V0AB 4IQPA 2D3RA 2WFF1 1RUD1 4AWDA 1UN1A 1J3QA 1H1AA 4WM8A 3WVJA 5DUWA 3CLPA 2CGOA 4WM8B 1X7NA 3SHRA 1X82A 4S2DA 3WW2A 5A33B 2DCYA 2HWD2 1X8MA 3VBRA 1LEMA 1CIWA 3D0JA 2RE9A 3APBA 1W6MB 4YW1A 2Y38A 3WP5A 1RUC3 1AL22 1CJPA 4HFSA 1VAVA 1AL0G 2E7AA 1XE8A 1X36A 3FJSA 5CBLA 2XJPA 1S0BA 1VBE3 2RJKA 5FREA 1PO23 2Q1ZB 5I0TA 1QDOA 4AFDA 4HK9A 2ZS6B 2WT1A 3N3HA 4NHKA 1QNYA 3CU7A 3I59B 5A3LA 1RUG2 4DMIA 3D5OA 1ZBE2 4Q4W1 1ULCA 4R4ZA 4RD7A 4E9KA 2XVLA 4CDWA 3SCHA 1YIPA 1RC6A 4NWVA 3PTYA 4Z1VA 4Y1UA 1KJRA 2VUJA 1AR61 1RVF2 3G6JB 3N7LA 4K1ZA 1NA1A 1XXNA 1DGLA 1BBT3 2VNGA 2HYKA 3TOJA 4YVSA 1HLCA 2VVDA 4Q2FA 5SV8A 4HLTA 4BWOA 4K3UA 3JD71 3PHMA 4ZKTB 1BEV3 1MVQA 2D6OX 2P37A 3RI8A 3V65A 1JOJA 1F2NA 2A6WA 2ZX2A 2W39A 3OD0A 4XJAA 4QM9A 2DU1A 3KCCA 1LECA 1HQNA 4KGQA 1WMFA 3VBFB 4RGGA 1OPMA 3S30A 4DB5A 1CAXA 1VBB3 5T50A 4Z07A 2RS33 4OI0A 3MW3A 4AQ6A 1BEV2 1H2LA 1O4ZA 4OLLA 5EYXA 3BODA 1ZRRA 4N53A 3URFA 1VBA2 1GICA 1CAUA 4QPGB 4B29A 2XLAA 3TRSB 2HWF1 2XH6A 4E2QA 1MS3A 2WS91 1AYM1 5F6KA 1SLTA 1AR91 2QUOA 2H0BA 1UU5A 1XYPA 1I1EA 4EROA 1EP0A 3MFCA 1NY72 4QM8A 2OVUA 1JHNA 1RUJ1 4XDQA 2XJUA 2A6YA 2GC1A 4AEDB 5C4WA 4AVCA 1SBEA 3FX3A 3JB4C 2R1BA 4MGZE 4CTEA 1GZCA 3I54A 4FXKB 4XFIA 3AFGA 3VZNA 4ITCA 4Q4Y3 2D97A 4KNCA 4AVBA 3ZSJA 3T1LA 2MPFA 1RJ8A 4N90A 1N1YA 3VBOA 5KC6A 3BOWA 4JGZB 5T54A 4YG6A 1FNYA 1AYN1 2DVBA 5L7OA 4XF4A 1DQ0A 4B3NA 4LE3A 4A7ZA 4PDWA 3DKWA 3VHNA 4KQ7A 2RMU3 4QMAA 1C1LA 1KQRA 3B9IA 4D94A 2ZGTA 4OFGA 4HPKA 2O8QA 5DUXA 2UY8A 4YZ4A 4BOWA 1W2UA 1UKRA 1UX6A 4BIOA 1D0GA 2CY6A 2XBO1 4B7EA 5AFEA 1SCSA 1QNWA 3J8F3 4HANA 1LOGA 1FV2A 1I6XA 1PHMA 3H0OA 4YM0A 2QQPA 3TN93 3ZYRA 1RUH2 3B00A 1OSGA 3ME2A 5K7PA 2QCSB 1LOEA 2FMYA 4BYYA 2R043 4BPZA 1C8M2 1MQTA 5J48A 1KS4A 1Q8VA 2WZR1 3BOPA 3KM5A 3CJIC 3B94A 1Z7S1 4LBJA 4YVWB 1LR5A 2DCJA 2WNUA 3GZTB 2E7TA 3MW4A 2WNUB 3GBWA 1U5IA 4MXWB 4U36A 3TAYA 4AK3A 1QXRA 4L9BA 3VL8A 5DXDA 4EN6B 3LWCA 4TWTA 1I3HA 2PYTA 5FPXA 5E8AA 1FOD3 1COV2 1GQHA 4YFWA 4AQTA 4AI2A 5GALA 4YGCA 2JG9B 2RM23 1O5UA 5ABJA 1AR62 3IKWA 5IT6A 1SCRA 4LUKA 4AGRA 3NV1A 2WFF2 4JQRA 3EO6A 3MF9A 5CG8A 3WDUA 3BPZA 4LBOA 5DUUA 1LULA 1REEA 2D40A 1QDCA 1W0OA 1WA4A 1IS6A 5J09A 2YV8A 4GMP1 1QJX3 3KMHA 2VVFA 2V5YA 5FTTC 5K0UA 1VBB2 4UBHA 2HEVF 3AP5A 4JGYC 4Q1RA 2CV6A 2CWSA 1S1AA 3WXPA 4IEPA 3ZN5A 5GZCA 5BV6A 4BZ4A 4XHBA 4FOYA 5T3NA 1NA1C 1PVXA 4AHZA 2SBAA 4Y1ZA 3V56A 4M3CE 2YXSA 3PMEA 4XQWA 3S0MA