4W6WA

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf6
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 31
structure length 141
sequence length 142
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4w6wA00
4W6WA 4W6YA 4B4RA 4BWOA 4W6XA 4B4QA 4B4PA
chains in the Genus database with same CATH superfamily
3PJYA 1Y43B 5GLWA 3J7NA 4GB33 2HEVF 2Y8KA 3WDXA 5CFCA 2W92A 3P3PA 4XC9A 5FPUA 4Q4V2 5HXMA 2HWE1 4Q4Y3 5EFUA 5A6QA 3N36A 4QXBA 2G9FA 4EN8B 2EIDA 4RA0A 4BMEA 3LDBA 3WP6A 1JYNA 4SBVA 2PHDA 5FZDA 5DDJ2 3RQ0A 1MS4A 4MXWA 2XMLA 3LCPA 1ULCA 1Q8OA 5A33A 3VZLA 3VBFC 2OKXA 4CTEA 1GANA 4JV4A 1D0GA 4PQQA 3OD0A 4Y1VA 2J1TA 4FI9A 4LK6A 2F6BA 2HWF2 4Y24A 5FO9B 4N53C 3PJQA 1AF9A 1NUKA 3AJZA 1W28A 2JXAA 4BDVB 3VKLA 4A41A 4XETA 2D7FA 1RHI1 5JOZA 5T54A 4HL0A 2W52A 2VOKA 2R042 1LENA 1V9U2 2V5DA 1C8M1 2PYTA 4XIKA 5FY8A 4YZ2A 2ZEYA 4BQXA 4DIQA 2BOJA 4DRVA 3TBDA 4NHLA 2D6MA 1JYVA 5FY9A 2EAAA 3CLPA 4UAPA 4QPGA 4RS5A 4RR3B 4BOWA 5FZOB 4B7KA 4XOGA 1Y9GA 1VAKA 3NJZA 2NMOA 1GMMA 5SV8A 1S2KA 4F8AA 1AXZA 4QXKA 5BNNA 1QNWA 1S55A 3OBZA 1OOPC 2VG9A 4PIXA 4Y20B 1O8SA 3J8F3 1LNSA 1N1VA 3J7HA 4Q0PA 1IKQA 4IXLA 4CEYA 4AEDB 3EQEA 1FV3A 5K0UB 4ZPIA 4Z07A 4CXYA 1VBE2 2Z79A 1N1SA 1R1A1 4Y5SA 1BK0A 1D2QA 1X50A 3KT7A 4Q8LA 4TWTA 5C9AA 4EV0A 2H6BA 2ZKLA 2VMDA 1W8WA 3D6EA 2D6PA 3DUIA 1C5HA 4AE2A 1ENQA 1MZFA 2Y0OA 3D3AA 1AR93 3LSDA 4J1WA 1TME1 1HN1A 4NJ4A 4BE3A 1EV12 5I93A 1S2EA 1DZTA 3SXWA 4OHZA 2E53A 1WGPA 1HRI3 4DUVA 4Q1PA 5CFCB 4MHUA 1GOHA 5FO7B 5F9TA 3VL8A 1SBEA 1SDWA 4ASKA 3KV6A 3GZTB 4JKMA 4TTGA 1LGCA 1XU1A 5A3UA 5LWBA 4MGSA 4OHXA 1N47A 1RJ8A 5CKQA 3AXDA 3KT1A 3PIGA 4MXWB 3RWNA 4XUQA 3AMNA 5ISLA 3AP6A 2VY0A 3OEBA 4GWNA 1GP5A 4O9GA 3QLQA 4RD7A 3C2UA 3SCHA 1TNRA 5EXOA 3MO4A 4XZPA 4Y26A 1GP4A 2YC0A 2I07B 2Y6JA 2YPDA 3WD5A 1ND2C 1W06A 2GALA 2RDNA 1ULFA 1RVF2 2QQIA 2B5HA 4HK9A 1BBT2 2ZZJA 3FL7A 1UOJA 4GJZA 4YGCA 1ZRCA 3Q8AA 1LOGA 1O4ZA 2OA2A 2HWE3 4GMP1 3L9JT 3ZN5A 4AVAA 2Z42A 4OLLA 1UYZA 4NPMA 2YBSA 3J7LA 4IGQA 4RHV1 3WZ1A 4IEWA 4DEVA 3POJA 2GNBA 5BNPB 3FZ3A 3MZHA 3OUHA 4W6XA 2A5ZA 3I2JA 1QJY2 4C91A 4WVMA 2OW4A 4UW6A 1QKQA 2DURA 3NMBA 4LKEA 5HI0A 1O59A 1MZEA 2BUKA 4P9XA 3T2TA 1ND3C 4QGMA 4ZZ5A 5LZ6A 1RHI3 2QE3A 4NRPA 1WMEA 1GZWA 4TLFA 1FOD2 3V56A 4P9IA 1C8M3 2HWC2 5HV0A 3MI8A 1S1AA 5IJRA 3WQ7A 3AP5A 4XFFA 3IT8A 3ZDSA 1QWRA 1S0FA 4Q0UA 1W8OA 3O0VA 1CX1A 1MS3A 4NIIA 4META 3I97A 4QGNA 1U5XA 1GLHA 1REFA 1RUE2 3AVRA 3KS7A 3RFRA 3NV4A 3VBOC 4COWA 5A3NA 4W50A 4CU8A 1X8MA 5IK7A 1QJX1 4ZHNA 1LOFA 3MICA 3R6SA 4WM8A 3UJQA 2DCTA 4IEOA 4L0PA 4CCCA 2PAKA 1NCQB 3K77A 2BU9A 1PO21 1R1A3 4N43A 1W8FA 1SLCA 2R16A 4JC1A 2JIGA 2W1WA 1D4M3 4LHSA 4I02A 1NA1C 1UYXA 3NSTA 5T5JA 2JD9A 1S0EA 4H14A 1OH3A 2VUAA 1D0HA 3POWA 5D8AA 4Q8KA 3BN6A 3WG2A 2OS2A 3WP3A 3WNPA 1XNDA 1VMJA 2JJ6A 3H50A 3KVBA 4Z2AA 2QZ3A 2J1RA 3LFMA 1UYYA 3JD73 5G04L 1AX1A 2XOMA 5IK4A 3C7HA 5J96B 1EYBA 3N3HA 4LITA 4PHZA 2WZPP 3K75B 3H0OA 5DAPA 4YVSB 3ZIWA 3VD9A 1AXKA 1KGYA 4J25A 1ENXA 1OVSA 4S2GA 5A80A 3LIGA 1WCSA 3MBWA 4QX2A 4Q4W1 2ZJCA 1QH6A 2Z2SB 4AXOA 2RR12 1H1AA 2R0FA 4H3WA 5FTTC 3RZLA 1RUI2 3WR0A 3JBG2 3J26N 1MS1A 4QQOA 4AI9A 5CEHA 5IUQA 1G9CA 5IVCA 2PQQA 2YU1A 2GZWA 3ACGA 4PIYA 3VZKA 1LGNA 3CQOA 3VUOA 1UY2A 4RQPB 5DZFA 1SHWB 4RHV3 5FPXA 2EXKA 3POEA 5F6KA 3U4XA 4CUBA 4EQVA 4QKDA 5FJKA 1ZRFA 1CPNA 5IT6A 4DFSA 2W2IA 3KSCA 2PTMA 1KQRA 3DPRA 3ITQA 4D7TA 2CDOA 3POIA 2DVGA 2GC0A 4IUGA 4P5YA 4UI9L 4CDXA 3SCGA 3BPZA 4Z1VA 3I2IA 3BI3A 5FYTA 5A7WB 2P6HA 5FZFA 5LBEA 5G05L 3OB8A 3D82A 3UL2A 3WG3A 5AFEA 2VULA 5GZDA 3MGUA 4QXCA 2DUPA 1TQ5A 3BU7A 1Y9MA 2ADDA 3SCFA 3N9NA 1J84A 4JGZC 3QH7A 1OLMA 1GKBA 4IGPA 5DAWA 4UXAA 3IDCB 4HKOA 4DY5A 4EN7B 1IPKA 4PDWA 1NCRB 3MFAA 5GZGA 4AR2A 2BGPA 4Y4YA 4BM8A 5FZ3A 2A3XA 5ERLA 1OF4A 1WWYA 1CZTA 4JHTA 3HPNA 1MQTA 1CAUB 1FPN2 2VUDA 2I74A 2HWD2 3MIBA 2NN8A 1O8PA 2D3PA 1NY72 2VNVA 4URAA 1LOBA 2VAUA 5BNOC 4K8FA 2Q30A 1UOGA 1C8NA 2BW8A 4ASMB 1QJX3 4IEUA 2HBUA 4QKBA 3TEYA 3F2ZA 1Q56A 4MO3M 4CEWC 4LBOA 5FR3A 2GN7A 4M0HA 3M3EA 1QOSA 3EYPA 1YFXA 5F5QA 4C8DA 1E57A 2VC9A 4YPJA 1UMZA 1W0PA 2WZEA 4XBNA 2Y6HA 4ZU5A 4UWDA 2LUWA 3W5MA 4WVZA 5JMCA 3C7FA 2IWGB 3P6BA 2EIEA 1VALA 1LOAA 1RUD1 2GNTA 2WINB 4CDQC 2W87A 2W91A 1PK6A 3ACLA 5CNAA 4FPCA 5FMCA 2DU0A 3MV11 4ZXEA 2JENA 2WN2A 2X10A 4XFAA 2A70A 2IZWA 1VE0A 2RMU2 3KM5A 3ZXJA 2FDHA 2ZCWA 1REDA 1AR81 1WA6X 3HEIA 5I0SA 5A6ZA 2KR2A 2VNGA 3AKSA 3ZXFA 4IV3C 3H7JA 1ULGA 1SQ4A 2XL9A 1VBB3 5DUXA 2VBPA 2D3RA 4IV1B 1F9KA 4CYDA 1HN0A 1STMA 2QZ2A 1HXS1 3WNXA 2ZX4A 1OBNA 1ZZ6A 4L8QA 4WV8A 3GCWA 2WZ8A 2P2KA 3H9AA 4U36A 1UXXX 1OXCA 2EXHA 3M4FA 4Q4W3 1DYKA 1PVC1 5E6HA 2RS51 2CDPA 2ID4A 1ZM1A 4DXTA 4A4AA 2D6KA 2ZACA 1QJU1 2O1QA 3BALA 4NRQA 4KNCA 2YBKA 4MVTA 3ME2A 2W46A 3V64A 1YFYA 4BQ2A 1TG7A 1VBD3 4KH9A 3ZOIA 4JZRA 5F2WA 4CCEA 3B93A 5ABJC 2ZHKA 3KB5A 1J83A 3AFGA 3KQRA 1DFQA 3E1F1 5JOWA 1O3TA 2ZAAA 1QXPA 1G9AA 4RFRB 5HV4A 2WQ8A 1JOBA 4M01A 1UZWA 2UYAA 1QF3A 1ULPA 3J7MA 1XC6A 3K51A 5FAXA 4DEQA 2C9KA 2IFWA 5DPNA 3X29B 2XBO1 2QDNA 4AHYA 2VCAA 2RJKA 4AFAA 2RJ2A 2D93A 1TE1B 3AM2A 1WKYA 1GU3A 5H9SA 2C4XA 5EZWA 2NYYA 2WWJA 3VBHA 4A45A 1AR63 3LEIA 4FOWA 3B00A 4QMAA 3BPSA 5B2GB 1BEV1 2HWB3 2X09A 3VBUB 4RGKA 3NAPC 4XUOA 1YQ2A 2YB7A 4AFDA 1RUF1 5FKBA 3PL0A 4FQ4A 4E9KA 1PHMA 1G7YA 2IC1A 2OUJA 2O0OA 2XVKA 2ET7A 1EAH2 5FYCA 1K5MB 3M3CA 1WD3A 3I2GA 4OMDA 3NW4A 1HRV1 2QCSB 1YJKA 2WA4A 2W08A 4QPIA 1TZOA 4FBFA 1ZZCA 5FV3A 5FYHA 1H2LA 3DGTA 5AC93 3AXEA 4MGQA 2VZSA 4FP2A 5EQUA 3VDDB 3N7KA 4Q0SA 1WCDJ 4WVVA 3ZSKA 1LKNA 1GICA 4A44A 5FZ6A 2C1FA 3FLPA 4R9CA 5FZHA 4LOTA 3W5NA 1W9FA 3ALQA 1DGRA 1MACA 4XAEA 4BPZA 4OMCA 4LIUA 4LIVA 1PM7A 3ENRA 1Q8PA 2JDZA 4Y1XA 5JZGA 3O1SA 4FFFA 2G4IA 2JG8B 1E5IA 5F7UA 2XJVA 3ZFEA 5HBAA 5FXZA 3DEMA 1HQLA 3VBSA 1AR83 2C9AA 2W47A 1IOAA 2AENA 3BVCA 1W9YA 5LA9A 3UKVA 5CADA 2E26A 3DKWA 1EY2A 2L9LA 3F95A 2WDBA 2WIIB 2WNVC 2JDUA 4XBLA 5FBZA 5K4LA 1U5YA 5FYVA 3MW3A 1O5LA 2ILMA 2A6VA 3P3NA 2IXKA 3K4AA 5EJ1B 5BPXA 2G1MA 3WG4A 3ZFFA 1UPSA 5BY5A 3VKOA 1T6BX 1FAYA 2D6LX 4CCDA 5FPLA 2A6XA 5J48A 2PHUA 2YMZA 3UGHA 1N1TA 4LKFA 1PVC3 2GH8A 2RS53 4XFGA 3GBFA 2VNOA 5FZIA 2WBKA 2Z4FA 3E5XA 4MHRA 4V2WA 3RI8A 2R041 1V9U1 1QJEA 1XQNA 3QACA 3I2OA 4PQ9A 1JI6A 1JU4A 1T2XA 1FNZA 4R4ZA 4LA2A 2VCBA 4GA9A 4AEJA 2H6CA 3WF4A 5CFDB 3POBA 4FPLA 4CCMA 1IZ3A 4CU9A 4XJUA 5A3WA 1VRBA 3USSA 1W6PB 3OOXA 1BVVA 4LHLA 3WNMA 3DL3A 4UFMA 3PLQA 4LLOA 4BWOA 2R1BA 2VCCA 1S0DA 4LULA 3U4SA 4JDNA 4PLMA 1ACCA 3WDTA 3WW4A 1LCLA 4A3XA 2XBO3 4G3YC 3T4HB 1SLBA 3PUHA 3H3LA 5C3SA 3LD8A 4IERA 4RN5A 4OQ8A 1X36A 2WA3A 4ZS2A 4ZU4A 1CVNA 4Q1RA 2QQLA 3BCWA 4YG0A 5L7OA 5FYMA 1VBE1 3R0RA 1H4HA 3NO8A 3R4SA 2CTVA 3OGJA 1BEV3 4LOSA 4FTBA 4H2AA 4QPGC 4RS5C 4AW7A 3WLUA 1RUF3 4LE4A 4F3JA 3FUOA 2XUMA 1W39A 4CDWB 2NMNA 1PGW2 5BNNC 1EV11 1OH4A 4UW4A 3TEZA 3H8UA 1HRV3 3ZFEB 2QJVA 3M3IA 1AYM2 5EJZB 5KHKA 1JOJA 5I0RA 2PLV3 2VMGA 4DOUA 4QT6A 3WDVA 4CEYC 1VBA2 2BFUS 2JDMA 2VMIA 2ZX2A 4Q0QA 2XUEA 3HNBM 1RJ7A 3NQHA 1I5PA 4L2NA 4NE9A 3NL1A 3FHIB 5C9AC 2X05A 5JIAA 1UIKA 3N9MA 3CJIA 3PNAA 4H55A 2IXCA 2PHFA 1BXHA 1W8ZA 2CAVA 1AR73 2WR9A 3MPBA 5JOXA 4DXRA 5LK7B 1FV2A 1UN1A 3CZJA 5L9RA 4E4ZA 2R072 1ZZBA 3DYPA 3BTAA 1ODNA 3QH6A 4I01A 1DGLA 5K7PA 2XQRA 5EIYB 1DGWA 3H1WA 3PDQA 5HPOA 1JS9A 3V0BA 3JQXA 2VZQA 3WQ1A 3HJRA 1W6OA 3M70A 4I3GA 3TB0A 3MUZ1 1GQPA 4JGYB 3VHOA 5KHIA 2W0XA 2RS32 4CDUB 2DFBA 2HYXA 4QDQA 5LB6A 3ZR6A 1U0AA 2R1DA 1ASJ3 1DLCA 2C6SA 3NKTA 1WMXA 2AYHA 3LGRA 1PX4A 2NZ9A 2Y6FA 1W99A 4K7JA 3USUA 1WW5A 1QJY1 2VW0A 4OUEA 2DCZA 4RGGA 3I3DA 4AL9A 2X5IB 3I3MA 3VDBA 1AX2A 5CZKA 1F2NA 1IS3A 1S4CA 1VRH3 4YW6A 2IFRA 4MH0E 1T6GC 2NM1A 4NAOA 1UOFA 4R4XA 2R043 3ES4A 2Y0IA 4QKNA 4W6YA 2HWC1 3GBGA 4XTMA 1QQP3 2VZUA 5JSRA 4NN0A 2WN3A 2J1AA 5FOJB 1RMU3 1UKRA 2XHKA 3HVDA 3AP4A 3GZEA 5DUVA 3ZYFA 4AK3A 3HOBA 2BVVA 3D5OA 3I59A 5LA2A 4YYOA 3VKFC 2O14A 5A32A 3JUUA 1X8EA 4CUCA 1RUE1 4D6SA 3AFKA 3A23A 5C71A 1HDKA 4R9AA 3ZXKA 3KGZA 2ES3A 4LUKA 4OFGA 4BYYA 3KQ4B 4IL7A 3H8OA 1CONA 4Y1YA 3ZN6B 3ILFA 1J1LA 1S0CA 1W2OA 3MF6A 2MPFA 4AFCA 1W04A 3SISA 1VBE3 4XILA 5FZ8A 4XUPA 3C3VA 1BHGA 1V6MA 1IS5A 1JH5A 1NT0A 1L7QA 1ZVFA 4IE7A 4JRLA 1YYNA 3VBRB 5IVVA 3INAA 4K8RB 2YGLA 2A71A 2VL4A 1UCXA 1PIV2 4UT5A 5IYYA 1O3RA 2DVDA 4FPFA 2E33A 3AMHA 4FTSA 4KG8A 1J3PA 2GC3A 5CBLA 4FO9A 1J1TA 5E8AA 3MW4A 3NNMA 4E27A 1XNAA 2BV4A 1LOFC 3PVEA 4WM8C 5GLVA 1ST8A 1RUC2 2QUOA 1UD1A 4KWUA 3WP5A 1PVXA 1W8UA 5J98B 2JDPA 3SH4A 4N43C 4OULA 3KHBA 3PURA 4BIOA 2MHFA 1BKZA 1IPSA 4OQ9A 4AQTA 3ACHA 1RINA 5CKNA 5F37A 1RB8G 1OURA 4AI0A 5D8AC 1SLAA 4B4RA 4PT6A 4KGQA 4AGVA 1SZBA 2DBIA 1V0AA 1CJPA 3DECA 2DBNA 2LW8A 2RR11 4RR3A 1WZXA 3UJOA 5FZOA 5FZGA 3NRUA 1AXYA 1RUI1 4DXSA 3JBG1 3WDYA 2EXIA 4B3NA 4I09A 2Y6GA 3LIHA 3PTRB 5KXDA 4X6QB 2JKBA 2PELA 1OKQA 1RL3A 4AVSA 4Y20A 4L92A 1FMD2 3AMMA 2P6CA 2C0ZA 5LRSA 4W4ZA 4AEDA 4BH9A 3AP9A 4DUWA 5A3OA 2BBAA 5K0UA 1H8TC 1QJY3 4R9BA 4ES8A 2WZR2 1AUYA 1ZA7A 2JDKA 2AZ5A 2RM23 1COV3 3FWEA 2VOXA 2GC2A 3CDZB 1OPMA 3OBRA 1NE6A 4XF3A 5FUIA 4HSLA 1JUIA 4Y1UA 3UK9A 3ETPA 3RI9A 4EN0A 2A6WA 2X8KA 3VKNA 2RV9A 1S0IA 3BTYA 2OX0A 4XQDA 3AYDA 3ILRA 1LAJA 3E5QA 5DAVA 4Q26A 4YGEA 3ZR5A 5FXXA 4NIAA 1TMF2 1YFWA 2Q0AA 2VW2A 2YROA 4YW7A 4K6BA 4AVVA 1RUJ2 2P3KA 4L99A 3DPRC 1ZBE2 3BU0A 1RUE3 3ZXDA 1FPN1 4IQPA 4FXKB 5E88A 4AGGA 2IXJA 1HJFA 4CDXC 5A3MA 4Q4X2 4NIDA 5C4WB 1NY71 2WO7A 4M3CF 1W9WA 3KV4A 4X6RB 1G9FA 2FZ1A 3FFQA 4E2GA 3FHAA 4UYBA 3MIHA 5FLHA 5DXDA 1ENRA 5FPAA 3LDRA 1F35A 2JDYA 1N3OA 3L2YA 2ARBA 1RUNA 5IVJA 2B45X 5FXWA 4E4SA 4PDWC 1JYXA 2OVUA 2ZHLA 4WZCA 1XXNA 3Q8EA 4E8CA 2ATFA 1PGL2 2DUQA 1YNAA 4XVHA 3EHKA 1NXD1 2D5HA 5FP8A 1SCRA 1O7FA 3LAGA 4YZ1A 1MQTC 2AUYA 1ULOA 3BODA 5DZGA 1OFSA 5BNPA 2RMU1 2GH2A 2WT1A 3PUIA 1MEC2 4BQ5A 3DXUA 5EP9A 1QU0A 1X33A 1NX9A 5JIUA 1JYWA 4HN0A 3WDUA 4AFBA 2XGXA 2DTYA 2ZZQA 5FZ9A 1EPWA 3T08A 2C26A 4NAMA 5CB7A 1PMIA 1GYKA 2GMMA 4QX0A 5IAVA 5I8TA 1IG3A 1PK6C 3JXSA 4XJ8A 2ZMKA 1DCSA 2B9VA 3S5QA 2B9UA 2RR13 3W58A 3ECQA 2WO1A 1XBFA 1RUI3 3KCCA 4O65A 5CU1A 5C8CB 1WLWA 2QQUA 4FQZA 3AMQA 4LNVA 3AKPA 3DYMA 5FZCA 1HJGA 4IEZA 4BIFA 1GZ9A 2E32A 1YJLA 2RDRA 4ZZ8A 5FYUA 3SH5A 1BVP1 3O1VA 2FZ2A 1W2NA 1HV0A 2QQPA 1WLTA 1A3KA 1NCQA 5LW9A 2VM9A 5A3TA 2F17A 4DS0A 2RHPA 4PF5A 4TXWA 1B35B 4COZA 1FYUA 3KT4A 5FK7A 2PA7A 5FZAA 3NVCA 2P3IA 3GXUA 4GIQA 2P4EA 4NPLA 1I3HA 2X29A 1DF0A 3BTXA 3OJBA 1ZBA2 3WNNA 5FUPA 1LR5A 3B7MA 4LA3A 4MGTA 1KRIA 3FUQA 2V72A 1OA3A 1AX0A 3KMHA 1IKPA 5T5OA 2QDRA 4QB2A 4OI0A 1EAH1 1FPN3 3NKGA 3OGRA 4KL1A 2ZPXA 3H1YA 5AFBA 1LULA 4YVSA 2V09A 2V4VA 1U5IA 1W2AX 3HD8B 3I3EA 1J58A 4GZ9A 4XMIA 4XE9A 1G9BA 3IB3A 1LHOA 1HB3A 2RVAA 5FMDA 3VBHC 1S0GA 2Y26A 3VHRA 4DO0A 2BOIA 4NROA 1DGRN 2VW1A 4ATEA 5LA1A 1N3QA 4JRAA 4A7YA 1J3RA 2JDHA 1Q3EA 1O91A 3KV9A 2RS12 3MLKA 4M3CE 3THPA 1DZRA 1LHUA 1MZ6A 2WFPA 4RQPA 3S5AA 3JQWA 2JG9B 2MEV2 1Z7S2 3HWJA 3BB6A 3WF0A 4KG0A 2QTWB 2YC2A 5A7NA 1QGLA 4QPIC 2RMU3 3O1UA 3RZHA 2UWAA 1LEDA 5FY7A 2BPA2 1CJDA 4GH4A 3RYRA 4PJYA 3T2OA 1PO12 1HV1A 3KGLA 4P9JA 2FCVA 5A7WA 2D40A 2CGOA 3APBA 4DQAA 3FX3A 2CWSA 2Q5TA 3OGSA 1X9PA 3NV3A 2ZGRA 3A22A 3TNQA 3OPTA 4AHZA 1QIQA 4IE4A 3U78A 1TVGA 2GMPA 1WA4A 3K48A 3N7MA 4XCAA 4MGZE 3DN7A 2CV6A 4AG4A 4ET7A 5JZGC 4GB32 2W5FA 1L7RA 1YO8A 1OSGA 4JKKA 5FY5A 3D0JA 1NCRA 2PHXA 4I30A 2GMEA 5E1RA 4ZXKA 2ZS6B 3C7GA 4Q4Y2 3TN91 4M4PA 4N8MA 3VBSC 4KQ7A 2TUNA 4WM7B 4INDA 1CAUA 2A3WA 3TRSB 1D2SA 1TME3 4COVA 3WOGA 1PZ8A 2Y33A 4BK4A 4GD4A 3ZYRA 3ORJA 4EN6B 2CGPA 4ONUA 3DCQA 4XDQA 3ZFFC 1ZNPA 2DVBA 1O5UA 2OPWA 3OG2A 4NPRA 4XAAA 4NIHA 2W1SA 4IGOA 2O8QA 1CGPA 2WS91 4QPYA 3AYCA 1UMIA 5C3QA 2BNMA 2GDFA 1VMHA 2KA3A 3W21A 4HT1T 4HVQA 4NHXA 5FIXA 3WV6A 4AEKA 1OLQA 1CQ9A 4Q29A 5TSWA 4LT5A 5DUUA 2A73B 1UAIA 2CYFA 4S2DA 3VV1A 4AOCA 2VQAA 2WYFA 5F6LB 4B1MA 1XSRA 2PHWA 2XHNA 1UY3A 1GFF2 3RJRA 3O7OA 1JHJA 4XFBA 2VO5A 1WCUA 1ZZ8A 2JD4A 2HEYF 4GMP3 4QHOA 5FJHA 4XBQA 4LHKA 3E6CC 1PGW1 4QD2A 5H9RA 3VDCA 1K3IA 1EAH3 3HN3A 2WFF1 4I2OA 2R7EB 3B01A 4LO5B 5FMOS 4IV1A 5IVFA 3UESA 3WQ0A 2J22A 1AYM1 1L3JA 3HQRA 2VR4A 1PM4A 3GZAA 1VBA1 4GH4B 4OI2A 4O9EA 5FMBA 1E5RA 1NLRA 3ASIA 5L7OC 4YVWB 3PVBB 1KFXL 2AEZA 3ZYIB 3AVSA 4QHZA 4QM9A 4B29A 3TNPB 4GWMA 2BERA 3WNLA 1CESA 4A7ZA 3VHPA 5JOYA 3ACIA 1AR92 2ORXA 2J1UA 4EZHA 2R071 2B8MA 1UWWA 2UU8A 3JU9A 2BNOA 1DQ5A 2HH9A 3LOBA 1POV0 2E7AA 1VAMA 4FFIA 2XVGA 1RUG1 1C4RA 2WWSA 3SLIA 4D7SA 3T0DA 1DYPA 2BZDA 3NNJA 2CWMA 3WW3A 4XUTA 5LA0A 1UZVA 1VB4A 1XPWA 3ZFGB 2VZ1A 3HIFA 1JZ7A 3U07A 3CJIC 4CXWA 1XB9A 1OFNA 3QD6A 2WNUB 4J6GA 3OUIA 4CP2A 2IVJA 5C5UA 4N53A 5GALA 4K3UA 1WCKA 3A4UA 1U5ZA 5J7MA 1PO23 1SPPB 3VBUA 4D6RA 4QQHA 1OPOA 4E4DX 3UV9A 4BK5A 3MDPA 2HWE2 2Y34A 3GZUC 5GM0A 3TN93 2WLPA 5FXVA 2JE8A 4AYUA 1KITA 4AHWA 4ARXA 2W1QA 1K5MA 1MS5A 1KXGA 2X53S 2XJRA 3G7DA 4MGYE 3ZMOA 5LY1A 4QDSA 1BK1A 4CRQA 4TN7A 5FYSA 3BIWE 5FY4A 1JZ3A 4UBHA 4YZ5A 5JCTA 1AYN2 1QMJA 1NZIA 1YUDA 2OYZA 3B9CA 4PI2A 3VDDA 4K1ZA 2WS93 4KU7A 3DV8A 1MR5A 4MXVA 2ZKNA 1YC61 4YM0A 1CPMA 1RHI2 3GYDA 2Y6LA 3NV1A 2FD8A 1EPZA 4ARYA 4MOAA 1C8M2 1I5ZA 1KS5A 4LLFA 1IS4A 1UO9A 1I1EA 1LB2A 2YC4A 5EPAA 3CZUA 5FP3A 2CHHA 2JG8A 4CZSA 3HMYA 3B5LB 3D8CA 2DCJA 1UY1A 3QBQA 3T0AA 1US2A 3IM0A 3M2MA 4UFIA 4CUGA 4BQ1A 4OHWA 1H30A 2Y38A 2B42B 3SKVA 3UGGA 4XZUG 4GQ7A 1PIV1 4AZZA 4EWAA 3UKNA 2WFF3 5FOBB 4CXXA 3AZWA 2G9ZA 2WSUA 3W20A 3DKQA 1H8VA 2A3YA 4KU8A 1OQ1A 1AYM3 5IVBA 4UBGA 1JOPA 2XJUA 2YHJA 1AJKA 4HKLA 1RUC1 4V2VA 4LO4B 3BUCA 3NJVA 2BRTA 1M06G 2OIIA 3LDKA 1Q8QA 1A34A 1D4M2 5JDBA 3VBFB 1KD7A 2WSVA 2VMHA 3FN9A 4A6OA 4CP9B 4G4FA 2FBEA 1QJFA 1UIJA 2HKXA 2UY8A 2ZBJA 5LEKA 4HPKB 5CFDA 1FXZA 4N53B 1ND2A 1VB2A 2R49A 3POFA 4NWVA 1W6PA 2EAKA 3JD72 3K3OA 4HONA 4OZXA 5JI7A 3VDAA 1A8MA 2QQMA 4AVBA 4P00B 3FJSA 3I2DA 4FOQA 2JIJA 4UF0B 1UZYA 3AYEA 1G6NA 4P5HA 1RUG3 1WMDA 3RJ2X 1FI2A 5JSOA 1XNBA 2VZVA 4Y33A 5FK8A 1JZ2A 4PI0A 1G9DA 2D3SA 1G8WA 2ETEA 1FMD1 4GKXA 2ZHMA 1NG0A 4OZOA 4V1PA 4Y3OA 5GZCA 3PIJA 3RRDA 2EIBA 4R52A 1KS4A 1CN1A 2Q1ZB 1LU1A 1WBLA 4A2UA 4Q5OA 4BQ3A 2FMDA 3NJYA 1PNFA 2WZR1 4Y22B 3RZMA 3R4UA 1OOPB 2IXIA 2E31A 1G86A 1K45A 2WAOA 3T1LA 2ZOEB 1HQNA 4RR3C 1RUOA 1H1IA 2XKPA 4O7XA 1H4GA 3VL9A 4CDWA 5F3IA 4LUMA 1RUD3 3W9AA 2JE9A 2VPVA 5KC5A 3N9OA 1UU4A 5FP4A 4BJ0A 2YDEA 5CG8A 4YZ3A 4JX0A 3HN1A 4BISA 2GNMA 2ZXQA 2JICA 4LEJA 1TMF1 4Q4V1 1IGOA 3FHQA 3HQUA 3ON7A 3POYA 4AEDC 1RUJ1 1WMFA 2CL2A 5K0UC 5LBBA 1ZBE1 2BP6A 5A7OA 5FZKA 1RIRA 1W6NB 3LPGA 2SLIA 3I7DA 4XJAA 5F1RA 4Q4X1 5DDJ1 3K46A 4XDOA 4CUAA 1HXS3 4Y5Z0 4YSFA 4P9WA 4AEMA 1H0BA 3I3BA 3JCIA 4MUVA 3O0XA 2CNAA 1R082 3THCA 2HWF1 1LECA 5KC6A 1X9TA 1GNHA 5IVEA 1NQDA 3RNSA 3SC7X 5DQ0A 5CFCC 4FVVA 4YG3A 2ZEZA 3KVAA 3AC0A 4JGYA 4URTA 3ZXEA 5IFTA 1PGL1 4CDUA 1QJU3 1Q5OA 2JB4A 3WHUA 4AHXA 3BOPA 4NHMA 4DY3A 1PIV3 1ND2B 4EWDA 3V0AB 3WVJA 3ZO0B 1Y9QA 2YG0A 1QJX2 4W8JA 1KJRA 4YW1A 3K4DA 4K1YA 1MEC1 3ETQA 3RPQA 1OKOA 1UZZA 2X5IA 2K9ZA 1YFUA 3FFZA 5FLIA 2NQYA 3H1MA 5B4XA 5JPMB 5D1IA 1H2MA 2FQPA 5KHGA 4AQ2A 3BKZA 4LMFA 5C3OA 3GDBA 1CAXB 1PGSA 3TWIA 3WSOA 3ZSLA 2WQZC 4I3PA 2UY9A 4FPYA 1VIWB 2DVFA 1NAEA 2WYSA 1ND3B 3O0WA 1MVEA 1Q8VA 5FWEA 5BNPC 2XB6C 1SCSA 2WJSA 2VE1A 2QQJA 2R062 3POGA 2YUEA 3AL5A 4XF4A 3WEZA 5IAXA 2E7QA 1IS6A 1DGWX 1HIXA 1LTEA 4EN9B 1VBB2 1WLCA 5ACA2 2CY6A 4P9LA 1WUVA 1SFPA 3J9SA 3T4VA 1GWMA 1H6YA 3ZN6A 4IE6A 3SITA 4GMP0 2LS6A 4XDPA 2WZR3 4RSUA 4X8PA 4E8DA 2BTVC 2AEYA 1JN2P 1XYOA 2YFZA 4ZS3A 5FKCA 3VBOB 3R05A 4D94A 2BDRA 3Q8BA 5H9QA 5BXXA 2WWUA 3VBRA 5LRRA 5I0DA 1DQ6A 1YI7A 1XE8A 4OUMA 3LA7A 1UPIA 2LRPA 1JZ4A 3ROUA 4HMZA 1N1YA 5L36A 2ZMLA 1ZBA1 3DF0A 1VBD2 1VAVA 4UW5A 5DUWA 1RVF1 5F8PA 3V65A 1BBT1 1NA1B 2Y64A 4YG6A 2W9XA 5GLUA 2PXJA 3ZSJA 4Q4V3 3HQXA 5JXJA 5FBJA 1KJLA 1RUJ3 4LK7A 3TOJA 4QX8A 1FATA 1I6XA 1NCQC 4B8EA 2BFUL 3VD7A 5J09A 4Q4X3 2OPKA 5DDJ3 3T1MA 2B4KA 4AF9A 2IVIB 3N4MA 4XEZA 5A6XA 5BUVA 1IPJA 2XPJA 1PZ7A 2VMEA 1AR62 1S0JA 4OCTA 5A7QA 1NE4A 4ZKTB 2HWF3 3MIFA 1FNYA 1RITA 2ZGKA 1LOEA 2HWB2 5DAXA 3WW1A 1OQDA 4D6QA 3AMPA 1XJAA 4R9DA 1QHDA 3RDIA 3A7QA 4NO4A 3BIEA 1LGBA 1FOD1 1UZ0A 1V9U3 2XVLA 4PIZA 2OXBA 2RS11 3U10A 2Q8OA 2BGOA 4ES9A 1JHNA 1JMUB 4Y1ZA 1V70A 1LESA 2E6VA 4CU6A 2MEV1 1Z7S1 3MEPA 5IWFA 1ONAA 2YV8A 3ZYJB 2LM3A 4XXPA 3GCXA 4N9HA 4YVSC 2NPIA 3ELNA 5AC92 3MF9A 2PFWA 3PTYA 2HLEA 2BWCA 1XOYA 1CIWA 1PO11 1YIPA 2VVEA 4CVUA 3KV5A 3OF1A 1H2KA 4TYSA 4CA9A 1H6XA 2ZEWA 4M4RA 3RMYA 1POV1 3P1IA 3VHNA 1K12A 2LALA 3O14A 4M3CB 4XQWA 3ZIXA 4BHPA 2PHLA 3TEXA 4LPLA 2GAUA 3DXTA 1WW4A 4M00A 3WT3A 1VP6A 3A0NA 3U14A 3RZKA 3ZXLA 3FE5A 1IQDC 1BZWA 4RQPC 4XIOA 3RYPA 3IAQA 1UF2C 3ZLIA 3T3YA 3T09A 1N3PA 4LO6B 4NR1A 4JQRA 1AR82 2QQWA 3GNEA 1DYOA 4XHBA 5A1LA 1F4AA 1W6MB 3LZZA 3OPWA 4JGZB 1W6QB 1F5JA 1EV13 3AKTA 2YGMA 3LKJA 4FP3A 4LBMA 4S2HA 3MPPG 4XURA 5L9BA 2AR6A 1OLME 5DG1A 5C4WA 5ABJA 2N7GA 4H7MA 3UKTA 4JQTA 2PAMA 4COYA 1YEWA 3M3OA 2ADEA 3NWKA 1TEIA 1IQAA 4JHZA 4UFHA 4HANA 4NHYA 4XYXA 3WNOA 5HCBA 3C8XA 1LHWA 3ZMNA 3LQCA 1F5FA 2UWBA 2K46A 4QXHA 3SH3A 2RS52 3EB7A 3I3QA 4AQSA 5BNOB 1NCRC 4DNYA 3UGFA 3ZDVA 4YW4A 1ZRIA 4CEWB 3OYWB 4XMAA 2VTFA 1NOVA 2P3JA 4P08A 3T2PA 3UYJA 1VMFA 1OQEA 3K3NA 5LCWL 3OTFA 2B46X 4LO7A 1F8VA 3JZVA 3NAPA 4RGAA 1JW6A 1R092 1RVF3 4MV2A 2XH6A 1BBT3 1V6NA 3M7AA 4N7IA 1HB2A 3KD4A 4D69A 1QDOA 3A0KA 1AL0G 1WD4A 4Q0VA 4CDQB 3THTA 1YI9A 3MV01 3THDA 5JLVA 2GNDA 3PU8A 1JYTA 3I8TA 1JUHA 1MS8A 3WF3A 4IEVA 1TNFA 1QXJA 4WVWA 2XBO2 4AAXA 5CG9A 2ZX3A 2O8OA 3OY8B 3RZZA 3SHRA 3ZSMA 4LBQB 2F4PA 4IV3B 5DZEA 2RE9A 3VZOA 4O61A 2ENRA 5T52A 4J1XA 4FXGB 5J37A 4P14A 3M3QA 3ILNA 4QX1A 4JTOA 1RYYA 4YWAA 1RUF2 5C8CA 4MLOA 2VZOA 1FOD3 2WL1A 2KXLA 1PMHX 2HWC3 1AR91 2DFCA 5KXCA 2XJTA 3ES1A 1UU6A 2YBPA 4BB3A 2HYKA 3E5UA 3CF6E 2UYBA 4FPKA 1QXRA 2VVFA 1Z7S3 5A70A 5CVRA 1Y7BA 1H1MA 5HXVA 2C24A 4IV1C 4Z92B 5FZMA 3HBZA 4Z82A 4QX7A 1DG6A 2PLV2 5F3GA 1H9WA 3EXUA 4HFSA 4LHNA 4AQ6A 4C1XA 5JUVA 2VD7A 5L73A 3LF7A 1PO13 4HOOA 3BGAA 4YRDA 3T2QA 1JODA 5F3EA 2HWD1 2Q1FA 1B35A 3D4KA 5ABJB 3S7IA 4EWEA 1SLTA 3WUDA 4HVRA 4QX5A 4DMIA 1GQHA 4YARA 2OZJA 1Z0HA 1AR72 2W95A 4UFKA 2P34A 3T30A 1DQ4A 1CX4A 5BYNA 3RVHA 4CPBA 4LBNA 4OUSA 4BQ4A 1VBC2 3ZYPA 2W1UA 3CMGA 5FZ0A 3SKJE 4XFHA 5F3CA 5KHHA 4BXSV 3TEWA 3EBRA 4K9SA 1IHMA 4QGLA 4S2FA 1NZCA 4XJZA 4F83A 4FSJA 1OD5A 5L19A 2WLQA 1ASJ2 5JR7B 3VZMA 1MS9A 3ZM8A 3NAPB 4JDMA 5FQ0B 3ZPOA 2IXHA 1AYN1 4PBOA 2GN3A 1AHSA 4QQLA 1GV9A 5GLTA 1QEXA 5FO8B 4NIGA 3TYJA 1VRH2 3RMXA 5FDBA 2ZGSA 4C0BA 5DMYA 2QQOA 2JDAA 3VBUC 4XFIA 1JXNA 5E16A 2VZ3A 5T50A 3ZXAC 1CAWB 1QQP2 4KGGA 4I0BA 1DIWA 1RMU2 5HCAA 1V6OA 2VMFA 2JG9A 5C6CA 2BQPA 2WUHA 1V6IA 4LTAA 4NHKA 3S7EA 1K5MC 3B9IA 3AZVA 5FP9A 4JDOA 2XR4A 1YLLA 2XXZA 3JBG3 4XXAA 5LBFA 4P9YA 1URXA 5JR2A 2ZGQA 3VDDC 3T0BA 4G9SB 2XQXA 1DHKB 4NWWA 4D0QA 5JMOA 5KXEA 4KI5M 1A8DA 2EXJA 5DN2A 1AVBA 1Q43A 3BYWA 3ZYBA 4KWKA 5A1FA 3MIDA 4A6SA 2JKXA 4B7EA 4BLIA 3PU3A 3OSDA 2WNVB 5F2SA 2VMCA 2DCYA 5CISA 4IEPA 2VUJA 2JG8C 1KEXA 1D4M1 1HLCA 2ZX0A 5FY1A 1OT5A 2GSYA 2TBVA 2YZ4A 1WW7A 5F5IA 5IK5A 1BMV2 4IEQA 4WM7A 3H3ZA 2ZABA 1YIFA 3IAPA 3RG0A 5H9PA 5I8YA 1WW6A 1W0OA 2G9GA 1MZ5A 4FPEA 4QKFA 1H9PA 4CPBD 2EALA 3JD71 3Q9OA 4B1LA 3NJXA 2A6YA 5FRAA 5A3LA 3ST7A 3MFCA 4JCKA 2DF7A 3N7JA 1W03A 1D7PM 3BTZA 4OI4A 1FT9A 3UETA 2HWD3 1LHNA 5EHDA 1GQGA 5A33B 4LQRA 3H8XA 1RXGA 1GOGA 4GKYA 1ALYA 3O1OA 2BWAA 2ZGNA 1AL22 1GOFA 3W59A 5CFDC 1W2TA 2V73A 4QU1A 1PZ9A 4DRRA 3AJYA 2D43A 1ULDA 2VTXA 5AVPA 1GP6A 2VXRA 1SDDB 2VZRA 4NUBA 1RUH2 5FZEA 4HN1A 3GHNA 3N9LA 3MLLA 5FZ1A 5GLZA 5LY2A 4BZ4A 2V5YA 5LBCA 3B94A 1K5JA 2VQUA 3O1TA 2DV9A 3O5SA 4XFCA 3CHXA 3NNLA 4CCLA 5C3RA 4QPGB 4RS5B 1HW5A 3LA3A 4NOTA 4CCNA 4DUXA 2EF6A 4YGBA 5KXBA 5JXHA 1AYN3 2XLAA 4LKDA 4XPVA 5C70A 1FX5A 2HBTA 3KWVA 4YVWA 5FP7A 5BNNB 4A7KA 2RM22 1COV2 1XE7A 4FFHA 1AZDA 4PBPA 4QAWA 5JVVA 4MG2A 1ZREA 2XWBB 4QWNA 1NXMA 2AGSA 4K20A 5APAA 1OUXA 3AL6A 1AJOA 4CEYB 1UL9A 5FZ4A 3WY6A 2RJLA 4CDWC 3U75A 4U2AA 3I2KA 2OZ6A 1R081 3IZOA 4AI1A 3OPZA 4I0AA 2QNKA 1VPHA 2VH9A 2YXSA 4LO8A 1WBFA 1HKDA 3KF3A 5C9AB 4LKSA 5HCHA 3ZFEC 3LPFA 3SEPA 5GZEA 3HT2A 2RDSA 1W2UA 5A7SA 3LEMA 5JAXA 4XJWA 4XQ4A 4FPOB 3ZVXA 2ZTNA 3IPVA 4GXLA 5FREA 5FZBA 3WCSA 3ZFGA 2DU1A 1XNTA 2DCKA 3GF6A 2A75A 2MNGA 3WNKA 3N35A 2YU2A 5CAZA 2WNUA 4MGKE 3WUCA 5T5PA 4AVTA 2ARCA 2TNFA 3FMGA 4ZY9A 1GWKA 5LK5A 3RGBA 2VBDA 1SPPA 1KFUL 2BBVA 4MADA 4HKWA 3VZNA 1Z78A 4MX3A 3JB4C 1F15A 5FYZA 1LODA 1RTVA 2C5DA 3U0ZA 4JGYC 4B4QA 4CDUC 3IDEA 4W65A 1UY0A 1EP0A 2VUCA 3AX4A 2B39A 2OUHA 4XJ9A 4RYDA 1UYPA 2R32A 3H42B 3POSA 5ANQA 5T55A 4QQ2A 3EMRA 4ZU7A 1SACA 3DYOA 1EUUA 1DLLA 3AK0A 2R061 1YXWA 1YQCA 4DPNA 4ISQA 3O1RA 4OHYA 2X5IC 3WQBA 3OUJA 5JSPA 5B4NA 1VBB1 2B7YA 1DBNA 1YRZA 3H7YA 5ACA1 3J8F2 2D98A 3ZPYA 4C0HA 2QVSB 3J4UH 1RC6A 3KZ4C 1LEMA 4QM8A 1YQ8A 1H8TA 5FUNA 5A3PA 5D2AA 1YWKA 2PQSA 4WVMB 1BYHA 4CP0A 1CZSA 3I49A 2XJPA 4BQWA 1GZWB 1NLSA 2XL7A 2PAEA 2DWRA 4Y5TA 1DU3D 2WO2A 4CCKA 2AREA 4TLGA 4AI8A 1UOBA 1JZ6A 1VBD1 3VD5A 1HRI2 1DQ2A 2Y6KA 3ZXGA 1F31A 5FMOL 2ZGTA 2UURA 3LA2A 1O3QA 2WNEA 4NMIA 3LSEA 4A3ZA 5CIRA 3MYXA 2RS31 4QB6A 5CA6A 3QCWA 1XU2A 5DAQA 5FPBA 2ARAA 3IDBB 3VBFA 1A78A 3IPVB 3L2HA 4HSJA 3VBRC 4EROA 3IBMA 3ZKYA 4CP9A 2JB8A 3LEGA 1SLLA 5D21A 4JVAA 4WM8B 3GM8A 5FY0A 2ZGOA 4R8HA 4HPKA 2IXLA 1CWPA 2E63A 2PN5A 4HVOA 4I0WB 1AR61 3MIGA 3I54A 3PVNA 4N90A 1R083 3OEAA 4B4PA 1VJ2A 4KBZA 4N43B 1LJ7A 2HWB1 3LOIA 2TEPA 2ZMNA 4XABA 1GZCA 5SV5A 2Q8CA 4BU2A 4E2QA 2LTNA 2AH2A 4IE0A 5FPZA 2QQNA 4JTNA 4UF0A 5D8AB 1R64A 1SFYA 4A42A 4C90A 1SFNA 3IIAA 4E4HA 5ANNA 3I4IA 1CAVA 4FT8A 1NQJA 2P37A 5IHRA 3UT0A 5KBFA 3S57A 4FFGA 5AC91 4M0NA 2VOVA 4XTPA 2WQ4A 2CSGA 3OGVA 2DVAA 4Y22A 4AI2A 2K0GA 1OOPA 4HG6B 2XKOA 3S0MA 2JWPA 2GP5A 2I45A 2Q1MA 3IN9A 1OI6A 3IWZA 2P5BA 3M8LA 3ZKUA 1W8NA 1C3HA 3CO2A 1H8TB 5GKAC 4NVPA 3ATGA 3KLSA 4XHXA 5JPNB 1O6UA 1JYIA 4KMQA 5FCCA 4FAGA 4SLIA 2CU5A 4XW3A 1UQXA 3HNYM 4HLTA 1DQ0A 2D44A 4WZFA 3U1XA 2GU9A 5C8WA 1OC1A 2D97A 4LR4A 1ZRDA 4F7ZA 2R063 3IIIA 2BVBA 1W6NA 4OYUA 4XF0A 1SMVA 4P9GA 5ACA3 4EE2A 1V6LA 2BYVE 2P17A 4COUA 1MS0A 4QQPA 3KF5A 5LEJA 3S30A 1VBA3 3DPRB 4K21A 4YFWA 4PLOA 1Q8SA 2VCMA 1R1A2 4CDXB 1JU3A 3LEKA 4YZ4A 2GP3A 4KWLA 1ODMA 2JECA 4BMBA 2NP0A 1GBGA 4UOJA 2VOWA 4BXFA 1TME2 3SMHA 1OA4A 3ZN4A 2R073 2ZA9A 1A6CA 4YNIA 3C7EA 3FLRA 2I2SA 2UWCA 3CU7A 4D8MA 3V0AA 3O1MA 3I2FA 5EYYA 1R091 1QOTA 4PDWB 5C4WC 3H8RA 5DABA 1XNKA 2ZGLA 4LBLA 3WXPA 1ZYBA 1BCXA 3HAGA 5LASA 2VZTA 1C57A 1W0NA 1GZTA 2RS33 1HB1A 2OQ6A 1MQTB 5F39A 3EO6A 3D0SA 1JZ5A 1MVQA 1OVPA 3SEEA 1APNA 1XNCA 2FMYA 3RS6A 2QQKA 3RZGA 2ERFA 1CAVB 2E51A 4RL7A 1W05A 5GZFA 3E97A 1M4WA 1CAXA 1VR3A 5FZLA 1UY4A 1S2BA 4IEYA 4N7UA 5KWRA 5FLJA 4Y4RA 3C7OA 4X8NA 3WF1A 1ND3A 3O12A 2WT0A 4MZUA 5KHJA 2ZGMA 1E5SA 1BLZA 1OUSA 3P5BA 1I9RA 2HJIA 2EVXA 3WP4A 4E2SA 4YM1A 5C33A 2RDQA 1PK6B 4QPWA 4RHV2 2F4LA 1Y3TA 2HEWF 2JDNA 1VLNA 5LATA 4DZGA 1CD3G 2PLV1 3VLBB 3FBYA 2Q8DA 4Z8BA 4LORA 5F5AA 4CU7A 2FDKA 4L11A 3AZZA 2XDVA 4ITCA 3RYKA 2PMWB 3CIHA 4W6WA 2W39A 4GALA 3VBOA 4TSVA 1REEA 1SBDA 2J1VA 4L9BA 1CR7A 2YYOA 1IG0A 4HETA 4JAAA 2PHTA 5K8SA 1AR71 1O4TA 4HXCA 4NRMA 5C8CC 1LHVA 3E6BA 1LOCA 3GJBA 3JB8A 2ZEXA 2V4AA 1VBC1 3VGIA 3LE0A 3B02A 5IVYA 4YM3A 1NA1A 3ZSEA 3AZXA 5BV6A 3B3QE 3ACFA 4PLNA 4BQYA 3WHTA 2DYCA 4FTEA 4XF1A 2ZAHA 5EV7A 2WT2A 2XONA 3CKHA 4FOYA 4LBJA 2QFEA 5C7GA 5BNQA 4LJHA 1ASJ1 2J1SA 2XLFA 1B35C 2D5FA 3PHMA 3QOPA 2RG4A 1JZ8A 4DXZA 5L9VA 4HK8A 5DG2A 3O1PA 4DB5A 4K40A 1UX7A 2A7AA 4IDZA 1PMJX 3PUSA 1RUC3 3URFA 3VD3A 2VNRA 3CBNA 4QU2A 4GWJA 1PO22 4OHVA 3RZJA 1VRH1 5F32A 2D6NA 3LWCA 5CYYA 4L97A 3TN92 2VECA 1X7NA 2WKKA 2BGCA 1QOOA 1QQP1 3WCRA 2XJQA 3WW2A 3PVOA 3GHMA 1RMU1 4MYEA 2FDGA 3VBHB 1W3XA 2K2SA 2PHRA 1W9TA 1RXFA 2WABA 3A21A 2BJSA 3EJKA 3N9PA 4PF1A 2BEOA 1R093 1U12A 1WCQA 2H0BA 2FCTA 4LBKA 2VBBA 1LRHA 3CEWA 3HBKA 3RWKX 2FHRA 4AFMA 1ZRRA 2CGNA 2R6QA 1XSQA 4P02B 3PUQA 4ZONA 4CE8A 1YQ5A 1XYPA 2Z5WA 5IK8A 5JI9A 5I0UA 2WS92 3WG1A 3VB9A 3MW2A 3Q8FA 1R1ZA 1UX6A 2ZGUA 4HBNA 3OD4A 5J1XA 4AWDA 3IMMA 4AAPA 1FMD3 4QHBA 4UFLA 4BLJA 4QPIB 4M3CA 4TZDA 3WDWA 3FBMA 3CL1A 1NYWA 3SNMA 5J36A 1O3SA 4FOVA 1V00A 3AB0A 1C5IA 1HX6A 1QNYA 5F5CA 4IW3A 3WINE 1OA2A 3VZJA 4AVCA 4CP1A 2SBAA 2EICA 4Q4W2 3WF2A 2JG9C 1YQ6A 2ZX1A 4JKLA 4YW5A 5JXIA 1GSLA 4QB1A 3IKWA 1UNBA 2J1EA 5I8SA 4EZ4A 2E7TA 3PUAA 3MIEA 1UXZA 4CCJA 4IETA 5IFPA 4YW3A 1BMV1 4OI1A 1W6MA 3BOWA 2AC1A 2JE7A 4JGZA 2FDJA 1W6QA 1XE0A 4CCOA 4AGRA 3R4DB 2D6OX 5JZGB 2YY1A 1DQ1A 2WFF2 2R0HA 3M1HA 5EWSA 3S6PA 2VTXJ 3ZYGA 4ASLA 5E89A 1ENSA 3PMEA 1QJZA 2FDFA 1TMF3 3VBSB 1F4HA 2VZPA 4XACA 3VN4A 3GGLA 1NKGA 3OBTA 3LFIA 4YW2A 3OGGA 1GNZA 4FAHA 1ZBE3 5KR7A 1O4YA 2OQ7A 1DZQA 1QY4A 3N7LA 5BNOA 1NLQA 1CZVA 3SQOA 5M0TA 4IE5A 1CIYA 2ORZA 3ZFFB 1MPXA 1J59A 5FZ7A 5CKMA 4CEWA 3OYWA 2WAAA 2XG3A 1AL21 1J3QA 1OHFA 4RFT0 4WM7C 1ZZ9A 3IMNA 1XYNA 2EIGA 2G19A 1VBC3 2XWJB 3ABZA 4GULA 3U37A 2J42A 3K4ZA 1HQWA 2AACA 3HNMA 5C3PA 4XCBA 2Q8EA 1EUTA 3HT1A 1RUH1 1GNYA 4CDQA 1PX3A 2W68A 1JBCA 2JX9A 2W94A 1RUG2 3AKQA 4YGDA 5I0TA 1C1LA 3K2OA 1K42A 4LE3A 4CSWA 1L7LA 4KBBA 5FFOC 1W3VA 5AVAA 4FPGA 1C1FA 4D7YA 2Z69A 3VD4A 4UW3A 3FC0A 3OBAA 2VVDA 4EJRA 2DTWA 3OY8A 4QDRA 2P1BA 4LBQA 3NV2A 1MEC3 2A1XA 2VXJA 4IV3A 4UFJA 5C5TA 3KCXA 3GJAA 1OF3A 2A6ZA 1UKGA 1H2NA 1RGSA 2ZGPA 2RM21 1COV1 1Y4WA 2CAUA 4Z2WA 3N9QA 4FPHA 2ARXA 3AKRA 2VU9A 1XRUA 2KD7A 3B69A 1OD3A 3Q8CA 3AZYA 1BJQA 2DDUA 3TAYA 1RUD2 3GALA 3WX5A 2H0VA 3IDAA 5L7OB 1QH7A 2ZHNA 4GB31 1OLRA 2J7MA 3NNGA 2GC1A 4D3WA 2EA7A 3MLJA 4YFZA 1E5HA 3OCPA 1W9SA 4Q4Y1 2Y60A 1LU2A 5EJ3A 2XLGA 4GH4C 1KDKA 4GJYA 2NLRA 4GAZA 1ZA4A 2FCUA 2OT7A 1UW8A 2WC2A 3MHZA 4FCAA 4YVWC 3AP7A 4EYUA 4BCUA 2BNNA 2WRAA 3LB9A 1D4VB 5JXGA 1HXS2 1POQA 1SBFA 5IATA 3FLTA 2QQVA 3E6DA 3G6JB 2VQTA 4YLZA 5T5LA 4LXLA 5FPVA 2IUWA 4C1WA 1GUIA 1GWLA 2P3YA 4XUNA 5JWPA 1PVC2 4HZFA 3GBWA 1SEFA 4ISRA 5A1AA 4AI3A 4XF9A 1W8HA 3CJIB 5FYIA 2WNOA 4Q27A 1JYCA 1QJU2 2JEMA 3ZX7A 2VOTA 4Q2FA 1QDCA 1P8JA 1ZBA3 2FDIA 4BA6A 1OMIA 5FQ0A 3ZFGC 1YHFA 4ORFA 1UU5A 4IESA 3V0BB 1SLIA 1ZX5A 1X82A 3ZYHA 5J3UA 5EYXA 1W6OB 1S0BA 2WNUC 2YPJA 4KWJA 1JTZX 4OVEA 4N9IA 1BQPA 3I2HA 3RSJA 4DINB 1ZZ7A 2VJXA 4YM2A 5A7PA 1DDLA 1W90A 1B09A 3CJXA 3J8F1 3MUY1 2QKDA 5HCFA 3UNPA 3CNAA 1W8TA 1CAWA 2W3JA 3PMSA 4IEXA 3USUB 1AL23 3KHCA 2E9QA 2VQ0A 1UMHA 5FYYA 4LBQD 1BEV2 1V6KA 4MGIE 2QBXA 5FYBA 3NNFA 3U11A 2KM2A 1RUH3 3HR9A 5A6YA 4MSVA 1US3A 2RS13 1GR3A 2ET1A 3VKMA 4QX3A 2DUOA 2MEV3 1HRV2 1KDMA 1HRI1 3KCYA 2WO3A 1WLDA 4H7LA 4WBBA 4FPJA 1SG3A 5T3NA 3I59B 2VGDA 4ATFA 2XJSA 2YFUA 5A32B 2R30A 1YCIA 2WNVA 1C28A 1ULEA 2Q4SA 4PCRA 1POV3 5GJ6A 1DP0A 5IW0A 5FWJA 1PNGA 1V6JA 5K9YA 3H3UA 1HB4A 2LROA 5I91A 4GWIA 3AYAA
chains in the Genus database with same CATH topology
3PJYA 1Y43B 5GLWA 4GB33 2HEVF 3WDXA 5CFCA 3P3PA 4Q4V2 2HWE1 4Q4Y3 5EFUA 3N36A 2G9FA 4EN8B 4RA0A 4BMEA 3WP6A 4SBVA 2PHDA 5DDJ2 3RQ0A 1MS4A 4MXWA 3VZLA 3LCPA 1ULCA 1Q8OA 5A33A 3VBFC 4CTEA 1GANA 4JV4A 1D0GA 3OD0A 4Y1VA 2F6BA 2HWF2 4Y24A 5FO9B 4N53C 3PJQA 1AF9A 3AJZA 2JXAA 3VKLA 4XETA 2D7FA 1RHI1 5JOZA 5T54A 4HL0A 2W52A 2VOKA 2R042 1LENA 1V9U2 1C8M1 2PYTA 4XIKA 4YZ2A 4DRVA 3TBDA 4NHLA 2D6MA 2EAAA 3CLPA 4QPGA 4RS5A 4RR3B 4B7KA 4XOGA 1VAKA 3NJZA 2NMOA 5SV8A 1S2KA 4F8AA 1AXZA 4QXKA 5BNNA 1QNWA 1S55A 1OOPC 2VG9A 4PIXA 4Y20B 3J8F3 1N1VA 4Q0PA 1IKQA 4IXLA 4CEYA 4AEDB 3EQEA 1FV3A 5K0UB 4Z07A 1VBE2 2Z79A 1N1SA 1R1A1 1D2QA 1X50A 3KT7A 4Q8LA 4TWTA 5C9AA 4EV0A 2H6BA 2ZKLA 3D6EA 2D6PA 3DUIA 1C5HA 4AE2A 1ENQA 1MZFA 2Y0OA 1AR93 3LSDA 4J1WA 1TME1 4BE3A 5I93A 1EV12 1DZTA 3SXWA 4OHZA 2E53A 1WGPA 1HRI3 4Q1PA 5CFCB 5FO7B 5F9TA 3VL8A 1SBEA 1SDWA 3GZTB 1LGCA 1XU1A 4OHXA 1N47A 1RJ8A 3AXDA 3KT1A 4MXWB 3RWNA 3AMNA 3AP6A 2VY0A 4GWNA 4O9GA 3QLQA 4RD7A 3C2UA 3SCHA 1TNRA 5EXOA 4XZPA 4Y26A 2YC0A 2I07B 3WD5A 1ND2C 2GALA 1ULFA 1RVF2 2B5HA 4HK9A 1BBT2 2ZZJA 1ZRCA 4YGCA 1LOGA 1O4ZA 2OA2A 2HWE3 4GMP1 3L9JT 3ZN5A 4AVAA 2Z42A 4OLLA 3WZ1A 4RHV1 4IEWA 2GNBA 5BNPB 3FZ3A 3MZHA 4W6XA 2A5ZA 1QJY2 4C91A 4WVMA 2OW4A 4UW6A 1QKQA 2DURA 5HI0A 1MZEA 2BUKA 4P9XA 3T2TA 1ND3C 4QGMA 1RHI3 2QE3A 1WMEA 1GZWA 4TLFA 1FOD2 3V56A 4P9IA 1C8M3 2HWC2 3MI8A 1S1AA 3WQ7A 3AP5A 4XFFA 3IT8A 3ZDSA 1QWRA 1S0FA 4Q0UA 3O0VA 1MS3A 4META 4QGNA 1U5XA 1GLHA 1REFA 1RUE2 3KS7A 4COWA 3NV4A 3VBOC 1X8MA 5IK7A 1QJX1 1LOFA 3MICA 3R6SA 4WM8A 3UJQA 2DCTA 4IEOA 2PAKA 1NCQB 1PO21 1R1A3 4N43A 2R16A 1SLCA 4JC1A 1D4M3 4I02A 1NA1C 3NSTA 5T5JA 1S0EA 4H14A 5D8AA 2VUAA 1D0HA 3POWA 4Q8KA 3WG2A 3WP3A 1XNDA 2JJ6A 3H50A 2QZ3A 3JD73 1AX1A 5IK4A 5J96B 1EYBA 3N3HA 2WZPP 3H0OA 4YVSB 3ZIWA 1AXKA 1ENXA 4S2GA 1WCSA 4Q4W1 2ZJCA 1QH6A 2Z2SB 4AXOA 2RR12 1H1AA 2R0FA 4H3WA 5FTTC 1RUI2 3WR0A 3JBG2 3J26N 1MS1A 4QQOA 1G9CA 5IUQA 2PQQA 2GZWA 4PIYA 3VZKA 1LGNA 3VUOA 4RQPB 5DZFA 4RHV3 5FPXA 2EXKA 5F6KA 3U4XA 1ZRFA 1CPNA 5IT6A 4DFSA 3KSCA 2PTMA 1KQRA 3DPRA 4D7TA 2DVGA 2GC0A 4Z1VA 4CDXA 3SCGA 3BPZA 3D82A 3UL2A 3WG3A 5AFEA 2VULA 5GZDA 3MGUA 2DUPA 1TQ5A 3BU7A 3SCFA 4JGZC 3QH7A 1GKBA 4UXAA 3IDCB 4HKOA 4DY5A 4EN7B 1IPKA 4PDWA 1NCRB 3MFAA 5GZGA 4Y4YA 4BM8A 2A3XA 1MQTA 1CAUB 1FPN2 2I74A 2HWD2 3MIBA 2NN8A 2D3PA 1NY72 1LOBA 5BNOC 4K8FA 2Q30A 2BW8A 1C8NA 4ASMB 1QJX3 4IEUA 1Q56A 4CEWC 4LBOA 2GN7A 4M0HA 3M3EA 1QOSA 5F5QA 1YFXA 1E57A 1UMZA 1W0PA 4XBNA 4ZU5A 2LUWA 4WVZA 5JMCA 2IWGB 1VALA 1LOAA 1RUD1 2GNTA 2WINB 4CDQC 1PK6A 3ACLA 5CNAA 4FPCA 2DU0A 2JENA 4XFAA 2A70A 2IZWA 2RMU2 3KM5A 3ZXJA 2ZCWA 1REDA 1AR81 5I0SA 2VNGA 3AKSA 3ZXFA 4IV3C 3H7JA 1ULGA 2XL9A 1SQ4A 1VBB3 5DUXA 2D3RA 4IV1B 1F9KA 4CYDA 3WNXA 2QZ2A 1HXS1 2ZX4A 1ZZ6A 4L8QA 4WV8A 2P2KA 3H9AA 4U36A 2EXHA 3M4FA 4Q4W3 1DYKA 1PVC1 2RS51 1ZM1A 2D6KA 2ZACA 1QJU1 2O1QA 3BALA 4KNCA 4MVTA 3ME2A 3V64A 1YFYA 1VBD3 4KH9A 5ABJC 3B93A 2ZHKA 3KB5A 3AFGA 3KQRA 1DFQA 5JOWA 1O3TA 2ZAAA 1QXPA 1G9AA 4M01A 2UYAA 1QF3A 5FAXA 3K51A 2IFWA 3X29B 2XBO1 2QDNA 4AHYA 2RJKA 4AFAA 2D93A 1TE1B 3AM2A 5H9SA 5EZWA 2NYYA 3VBHA 1AR63 4FOWA 3B00A 4QMAA 5B2GB 1BEV1 2HWB3 3VBUB 3NAPC 4AFDA 1RUF1 4E9KA 4FQ4A 1PHMA 1G7YA 2IC1A 2OUJA 2O0OA 2XVKA 2ET7A 1EAH2 1K5MB 3M3CA 1WD3A 3NW4A 2QCSB 1HRV1 1YJKA 2WA4A 2W08A 4QPIA 4FBFA 1ZZCA 1H2LA 3DGTA 5AC93 3AXEA 4FP2A 3VDDB 3N7KA 4Q0SA 1WCDJ 4WVVA 3ZSKA 1LKNA 1GICA 2C1FA 3FLPA 4R9CA 3ALQA 1DGRA 1MACA 4BPZA 5JZGA 1PM7A 3ENRA 1Q8PA 2JDZA 4Y1XA 2G4IA 2JG8B 2XJVA 3ZFEA 5HBAA 1HQLA 3VBSA 1AR83 2C9AA 3UKVA 1IOAA 2AENA 5CADA 3DKWA 1EY2A 2WIIB 2WNVC 4XBLA 5FBZA 1U5YA 3MW3A 1O5LA 2ILMA 2A6VA 3P3NA 2IXKA 5BPXA 3WG4A 3ZFFA 5BY5A 1UPSA 3VKOA 1FAYA 2D6LX 2A6XA 5J48A 2PHUA 2YMZA 1N1TA 1PVC3 2GH8A 2RS53 4XFGA 3GBFA 2VNOA 3RI8A 3E5XA 2R041 1V9U1 3QACA 1XQNA 4PQ9A 1FNZA 4R4ZA 4LA2A 4AEJA 4GA9A 2H6CA 5CFDB 4FPLA 1IZ3A 4XJUA 3USSA 1W6PB 1BVVA 4LHLA 3DL3A 3PLQA 4LLOA 4BWOA 2R1BA 1S0DA 4LULA 4JDNA 4PLMA 3WDTA 3WW4A 1LCLA 4A3XA 2XBO3 4G3YC 1SLBA 4IERA 1X36A 2WA3A 4ZU4A 1CVNA 4Q1RA 3BCWA 4YG0A 5L7OA 1VBE1 3R0RA 1H4HA 3NO8A 3R4SA 2CTVA 3OGJA 1BEV3 4FTBA 4QPGC 4RS5C 4AW7A 3WLUA 1RUF3 4LE4A 4F3JA 3FUOA 2XUMA 1W39A 4CDWB 2NMNA 1PGW2 5BNNC 1EV11 4UW4A 3H8UA 1HRV3 3ZFEB 2QJVA 3M3IA 1AYM2 5KHKA 1JOJA 5I0RA 2PLV3 2VMGA 4DOUA 4QT6A 3WDVA 4CEYC 1VBA2 2BFUS 2VMIA 2ZX2A 4Q0QA 4L2NA 1RJ7A 3NL1A 3FHIB 5C9AC 5JIAA 1UIKA 3CJIA 3PNAA 4H55A 2IXCA 2PHFA 1BXHA 2CAVA 1AR73 3MPBA 5LK7B 5JOXA 1FV2A 1UN1A 4E4ZA 2R072 1ZZBA 3QH6A 3BTAA 4I01A 5K7PA 1DGLA 1DGWA 3H1WA 3V0BA 3JQXA 3WQ1A 3M70A 1W6OA 4I3GA 3TB0A 3VHOA 4JGYB 5KHIA 2W0XA 2RS32 4CDUB 2DFBA 1U0AA 2R1DA 1ASJ3 3NKTA 2AYHA 3LGRA 2NZ9A 4K7JA 3USUA 1WW5A 2VW0A 1QJY1 4RGGA 2DCZA 2X5IB 1AX2A 1F2NA 1IS3A 1VRH3 2IFRA 4MH0E 1T6GC 2NM1A 4R4XA 2R043 3ES4A 2Y0IA 4W6YA 2HWC1 3GBGA 4XTMA 1QQP3 5JSRA 4NN0A 5FOJB 1RMU3 1UKRA 2XHKA 3AP4A 5DUVA 4AK3A 2BVVA 3D5OA 3I59A 4YYOA 3VKFC 5A32A 3JUUA 1X8EA 1RUE1 3AFKA 1HDKA 4R9AA 3ZXKA 3KGZA 2ES3A 4LUKA 4OFGA 4BYYA 4IL7A 1CONA 4Y1YA 3ZN6B 3ILFA 1J1LA 1S0CA 3MF6A 2MPFA 4AFCA 3SISA 1VBE3 4XILA 3C3VA 1V6MA 1IS5A 1JH5A 3VBRB 1ZVFA 4JRLA 1YYNA 3INAA 2YGLA 2A71A 1UCXA 1PIV2 1O3RA 4FTSA 2DVDA 4FPFA 3AMHA 4KG8A 1J3PA 2GC3A 5CBLA 4FO9A 1J1TA 5E8AA 3MW4A 4E27A 1LOFC 3PVEA 4WM8C 5GLVA 1RUC2 2QUOA 1UD1A 3WP5A 1PVXA 5J98B 3SH4A 4N43C 4OULA 4BIOA 2MHFA 1BKZA 4AQTA 1RINA 1RB8G 4AI0A 5D8AC 1SLAA 4B4RA 4AGVA 4KGQA 1CJPA 2RR11 4RR3A 3UJOA 1AXYA 1RUI1 3JBG1 3WDYA 2EXIA 4B3NA 4I09A 5KXDA 4X6QB 2JKBA 2PELA 1OKQA 1RL3A 4AVSA 4Y20A 4L92A 1FMD2 3AMMA 2C0ZA 5LRSA 4AEDA 4BH9A 3AP9A 5K0UA 1H8TC 1QJY3 4R9BA 4ES8A 2WZR2 1AUYA 2AZ5A 2RM23 1COV3 3FWEA 2VOXA 2GC2A 3OBRA 1OPMA 1NE6A 4XF3A 4HSLA 1JUIA 4Y1UA 3UK9A 4EN0A 3RI9A 2A6WA 2X8KA 3VKNA 1S0IA 4XQDA 3AYDA 3ILRA 3E5QA 4Q26A 4YGEA 4AVVA 1TMF2 1YFWA 2Q0AA 2VW2A 2YROA 4K6BA 1RUJ2 2P3KA 4L99A 3DPRC 1ZBE2 1RUE3 3ZXDA 1FPN1 4IQPA 4FXKB 5E88A 4AGGA 2IXJA 4CDXC 5A3MA 4Q4X2 5C4WB 1NY71 4M3CF 4X6RB 1G9FA 2FZ1A 3FFQA 4E2GA 3MIHA 5FLHA 5DXDA 1ENRA 3L2YA 1N3OA 2ARBA 1RUNA 2B45X 4E4SA 4PDWC 2OVUA 2ZHLA 4WZCA 1XXNA 2ATFA 1PGL2 2DUQA 1YNAA 3EHKA 1NXD1 2D5HA 1SCRA 1O7FA 3LAGA 4YZ1A 1MQTC 2AUYA 3BODA 5DZGA 1OFSA 5BNPA 2RMU1 2GH2A 2WT1A 1MEC2 1QU0A 1X33A 5JIUA 4HN0A 3WDUA 4AFBA 2XGXA 2DTYA 2ZZQA 1EPWA 5CB7A 1PMIA 1GYKA 2GMMA 5I8TA 1PK6C 4XJ8A 2ZMKA 2B9UA 2RR13 3W58A 3ECQA 1RUI3 3KCCA 5CU1A 5C8CB 1WLWA 4FQZA 4LNVA 3AMQA 3AKPA 4IEZA 4BIFA 1GZ9A 1YJLA 3SH5A 1BVP1 2FZ2A 1HV0A 2QQPA 1WLTA 1A3KA 1NCQA 4DS0A 2RHPA 4PF5A 4COZA 1B35B 1FYUA 3KT4A 2PA7A 3NVCA 2P3IA 4GIQA 1I3HA 2X29A 1DF0A 3OJBA 1ZBA2 1LR5A 3B7MA 4LA3A 1KRIA 3FUQA 1OA3A 1AX0A 3KMHA 1IKPA 5T5OA 2QDRA 4OI0A 1EAH1 1FPN3 3NKGA 4KL1A 2ZPXA 3H1YA 5AFBA 1LULA 4YVSA 2V09A 1U5IA 3HD8B 1J58A 4XMIA 4XE9A 1G9BA 1LHOA 3VBHC 1S0GA 2Y26A 3VHRA 1DGRN 2VW1A 4ATEA 1N3QA 4JRAA 4A7YA 1J3RA 3MLKA 1Q3EA 1O91A 4M3CE 2RS12 3THPA 1DZRA 1LHUA 1MZ6A 2WFPA 4RQPA 3JQWA 2JG9B 2MEV2 1Z7S2 3HWJA 3BB6A 4KG0A 1QGLA 4QPIC 2RMU3 2UWAA 1LEDA 2BPA2 1CJDA 4GH4A 3RYRA 4PJYA 1PO12 1HV1A 3KGLA 4P9JA 2D40A 2CGOA 3APBA 4DQAA 3FX3A 2CWSA 2Q5TA 3NV3A 2ZGRA 3TNQA 4AHZA 2GMPA 1WA4A 3K48A 3N7MA 4MGZE 3DN7A 2CV6A 4AG4A 5JZGC 4GB32 1YO8A 1OSGA 3D0JA 1NCRA 2PHXA 4I30A 2GMEA 5E1RA 4ZXKA 2ZS6B 4Q4Y2 3TN91 3VBSC 4KQ7A 2TUNA 4WM7B 4INDA 1CAUA 2A3WA 3TRSB 1D2SA 1TME3 4COVA 3WOGA 1PZ8A 3ZYRA 4EN6B 2CGPA 4ONUA 4XDQA 3ZFFC 1ZNPA 2DVBA 1O5UA 4NPRA 2O8QA 1CGPA 2WS91 4QPYA 3AYCA 2BNMA 2GDFA 2KA3A 4HT1T 4HVQA 3WV6A 4AEKA 1OLQA 1CQ9A 4Q29A 5TSWA 4LT5A 5DUUA 2A73B 1UAIA 2CYFA 4S2DA 3VV1A 2VQAA 5F6LB 2PHWA 1GFF2 3RJRA 3O7OA 1ZZ8A 2JD4A 2HEYF 4GMP3 4XBQA 4LHKA 3E6CC 1PGW1 4QD2A 5H9RA 1EAH3 2WFF1 4I2OA 3B01A 4LO5B 5FMOS 4IV1A 3WQ0A 1AYM1 1L3JA 3GZAA 1VBA1 4GH4B 4OI2A 4O9EA 1NLRA 3ASIA 5L7OC 4YVWB 3PVBB 1KFXL 3ZYIB 4B29A 4QM9A 3TNPB 4GWMA 1CESA 4A7ZA 3VHPA 5JOYA 1AR92 2R071 2B8MA 2UU8A 3JU9A 2BNOA 1DQ5A 3LOBA 1POV0 2E7AA 1VAMA 2XVGA 1RUG1 1C4RA 2WWSA 3SLIA 4D7SA 1DYPA 2CWMA 3WW3A 1VB4A 3ZFGB 3HIFA 3U07A 3CJIC 3QD6A 1OFNA 4J6GA 2WNUB 4CP2A 4N53A 5GALA 4K3UA 1WCKA 3A4UA 1U5ZA 5J7MA 1PO23 3VBUA 4E4DX 4QQHA 1OPOA 3UV9A 3MDPA 2HWE2 3GZUC 5GM0A 3TN93 2WLPA 4AYUA 1KITA 4AHWA 1K5MA 1MS5A 1KXGA 2X53S 2XJRA 3G7DA 4MGYE 3ZMOA 1BK1A 4CRQA 3BIWE 4UBHA 4YZ5A 5JCTA 1AYN2 1QMJA 1YUDA 2OYZA 3B9CA 3VDDA 4K1ZA 2WS93 4KU7A 3DV8A 1MR5A 4MXVA 2ZKNA 4YM0A 1CPMA 1RHI2 3GYDA 3NV1A 1EPZA 1C8M2 1I5ZA 1KS5A 4LLFA 1IS4A 1LB2A 1I1EA 2JG8A 4CZSA 3HMYA 3B5LB 3D8CA 2DCJA 3QBQA 3IM0A 3M2MA 4BQ1A 4OHWA 1H30A 2Y38A 2B42B 4GQ7A 1PIV1 4EWAA 3UKNA 2WFF3 5FOBB 3AZWA 2WSUA 1H8VA 2A3YA 4KU8A 1OQ1A 1AYM3 4UBGA 2XJUA 2YHJA 1AJKA 4HKLA 1RUC1 4LO4B 1M06G 2OIIA 1Q8QA 1D4M2 5JDBA 3VBFB 1KD7A 2WSVA 2VMHA 4G4FA 2FBEA 1UIJA 2HKXA 2UY8A 5LEKA 2ZBJA 4HPKB 5CFDA 1FXZA 4N53B 1ND2A 1VB2A 2R49A 4NWVA 1W6PA 2EAKA 3JD72 4OZXA 5JI7A 4BOWA 1A8MA 4AVBA 3FJSA 3I2DA 4FOQA 1UZYA 3AYEA 1G6NA 4P5HA 1RUG3 1WMDA 3RJ2X 1FI2A 5JSOA 1XNBA 1G9DA 2D3SA 1G8WA 2ETEA 1FMD1 4GKXA 2ZHMA 1NG0A 5GZCA 4V1PA 3RRDA 4R52A 1KS4A 1CN1A 2Q1ZB 1LU1A 1WBLA 4A2UA 2FMDA 4Y22B 1PNFA 2WZR1 3R4UA 1OOPB 2IXIA 3T1LA 1G86A 2ZOEB 1HQNA 4RR3C 1RUOA 1H1IA 2XKPA 1H4GA 3VL9A 4CDWA 4LUMA 1RUD3 3W9AA 2JE9A 2VPVA 5KC5A 1UU4A 2YDEA 5CG8A 4YZ3A 3HN1A 2GNMA 2JICA 4LEJA 1TMF1 4Q4V1 1IGOA 3POYA 4AEDC 1RUJ1 1WMFA 2CL2A 5K0UC 1ZBE1 1RIRA 1W6NB 2SLIA 3I7DA 4XJAA 5F1RA 4Q4X1 5DDJ1 1HXS3 4Y5Z0 4YSFA 4P9WA 4AEMA 1H0BA 3JCIA 4MUVA 3O0XA 2CNAA 1R082 2HWF1 1LECA 5KC6A 1GNHA 1NQDA 3RNSA 5CFCC 4FVVA 4YG3A 4URTA 3ZXEA 1PGL1 4JGYA 4CDUA 1QJU3 1Q5OA 3WHUA 4AHXA 3BOPA 4NHMA 4DY3A 1PIV3 1ND2B 4EWDA 3V0AB 3WVJA 3ZO0B 1Y9QA 1QJX2 1KJRA 4YW1A 4K1YA 1MEC1 3ETQA 3RPQA 1UZZA 2X5IA 2K9ZA 1YFUA 3FFZA 5FLIA 2NQYA 3H1MA 5JPMB 5D1IA 1H2MA 2FQPA 5KHGA 4AQ2A 1CAXB 1PGSA 3TWIA 3ZSLA 2WQZC 4I3PA 2UY9A 4FPYA 1VIWB 2DVFA 1ND3B 3O0WA 1MVEA 1Q8VA 5BNPC 2XB6C 1SCSA 2WJSA 2R062 2YUEA 4XF4A 2E7QA 1IS6A 1DGWX 1HIXA 1LTEA 4EN9B 1VBB2 1WLCA 5ACA2 2CY6A 4P9LA 1WUVA 3J9SA 3ZN6A 3SITA 4GMP0 2WZR3 4RSUA 4X8PA 2BTVC 1JN2P 1XYOA 3VBOB 3R05A 4D94A 5H9QA 5BXXA 3VBRA 5LRRA 1DQ6A 1YI7A 1XE8A 4OUMA 3LA7A 1UPIA 3ROUA 4HMZA 1N1YA 5L36A 2ZMLA 1ZBA1 3DF0A 1VBD2 1VAVA 4UW5A 5DUWA 1RVF1 3V65A 1BBT1 1NA1B 4YG6A 5GLUA 3ZSJA 4Q4V3 3HQXA 1KJLA 1RUJ3 3TOJA 1FATA 1I6XA 1NCQC 4B8EA 2BFUL 5J09A 4Q4X3 2OPKA 5DDJ3 3T1MA 4AF9A 3N4MA 4XEZA 5BUVA 1IPJA 2XPJA 1PZ7A 1AR62 1S0JA 4ZKTB 1NE4A 2HWF3 3MIFA 1FNYA 1RITA 2ZGKA 1LOEA 2HWB2 3WW1A 1OQDA 3AMPA 4R9DA 1QHDA 3RDIA 4NO4A 1LGBA 1FOD1 1V9U3 2XVLA 4PIZA 2RS11 3U10A 2Q8OA 4ES9A 1JHNA 4Y1ZA 1V70A 1LESA 2E6VA 2MEV1 1Z7S1 3MEPA 1ONAA 2YV8A 3ZYJB 2LM3A 4XXPA 4N9HA 4YVSC 2NPIA 3ELNA 5AC92 3MF9A 2PFWA 3PTYA 2BWCA 1CIWA 1PO11 1YIPA 2VVEA 3OF1A 1H2KA 4TYSA 3RMYA 1POV1 3VHNA 2LALA 3O14A 4M3CB 4XQWA 3ZIXA 4BHPA 2PHLA 2GAUA 1WW4A 4M00A 3WT3A 1VP6A 3A0NA 3ZXLA 3FE5A 1BZWA 4RQPC 4XIOA 3RYPA 1UF2C 1N3PA 4LO6B 4NR1A 4JQRA 1AR82 3GNEA 4XHBA 1W6MB 3LZZA 4JGZB 1W6QB 1F5JA 1EV13 3AKTA 2YGMA 3LKJA 4FP3A 4LBMA 4S2HA 3MPPG 5C4WA 4C90A 2AR6A 5ABJA 5DG1A 2N7GA 4H7MA 3UKTA 4COYA 2PAMA 3M3OA 3NWKA 1TEIA 1IQAA 4HANA 4XYXA 5HCBA 1LHWA 3ZMNA 1F5FA 2UWBA 3SH3A 4AQSA 2RS52 5BNOB 1NCRC 4DNYA 4YW4A 4CEWB 3OYWB 4XMAA 1NOVA 2P3JA 1OQEA 3OTFA 2B46X 4LO7A 1F8VA 3JZVA 3NAPA 4RGAA 1JW6A 1R092 1RVF3 4MV2A 2XH6A 1BBT3 1V6NA 3M7AA 4N7IA 3KD4A 4D69A 1QDOA 3A0KA 1AL0G 1WD4A 4Q0VA 4CDQB 3THTA 1YI9A 5JLVA 2GNDA 3I8TA 1JUHA 1MS8A 4IEVA 1TNFA 1QXJA 4WVWA 2XBO2 5CG9A 2ZX3A 2O8OA 3OY8B 3RZZA 3SHRA 3ZSMA 4LBQB 2F4PA 4IV3B 5DZEA 2RE9A 3VZOA 2ENRA 5T52A 4J1XA 4FXGB 5J37A 4P14A 3M3QA 3ILNA 4JTOA 1RUF2 5C8CA 4MLOA 1FOD3 2WL1A 2KXLA 2HWC3 1AR91 2DFCA 5KXCA 2XJTA 3ES1A 1UU6A 2HYKA 3E5UA 3CF6E 2UYBA 4FPKA 1QXRA 2VVFA 1Z7S3 5CVRA 1Y7BA 1H1MA 5HXVA 4Z92B 4IV1C 3HBZA 4Z82A 1DG6A 2PLV2 1H9WA 3EXUA 4HFSA 4LHNA 4AQ6A 4C1XA 5L73A 1PO13 4YRDA 2HWD1 1B35A 3D4KA 5ABJB 3S7IA 4EWEA 1SLTA 3WUDA 4HVRA 4QX5A 4DMIA 1GQHA 4YARA 2OZJA 1Z0HA 1AR72 2P34A 1DQ4A 1CX4A 5BYNA 4LBNA 4OUSA 1VBC2 3ZYPA 4XFHA 5KHHA 3EBRA 4K9SA 1IHMA 4QGLA 4S2FA 1NZCA 4XJZA 4F83A 4FSJA 1OD5A 5L19A 2WLQA 1ASJ2 5JR7B 3VZMA 1MS9A 3NAPB 4JDMA 5FQ0B 2IXHA 1AYN1 4PBOA 2GN3A 1AHSA 4QQLA 1GV9A 5GLTA 5FO8B 3TYJA 1VRH2 3RMXA 5FDBA 2ZGSA 4C0BA 3VBUC 4XFIA 1JXNA 5E16A 5T50A 3ZXAC 1CAWB 1QQP2 4KGGA 4I0BA 1DIWA 1RMU2 5HCAA 1V6OA 5C6CA 2JG9A 2BQPA 4NHKA 1V6IA 4LTAA 3S7EA 1K5MC 3B9IA 3AZVA 4JDOA 1YLLA 3JBG3 4XXAA 4P9YA 1URXA 2ZGQA 3VDDC 4G9SB 1DHKB 4NWWA 5KXEA 1A8DA 2EXJA 1AVBA 1Q43A 4KWKA 3MIDA 4B7EA 4BLIA 2WNVB 2DCYA 4IEPA 2VUJA 2JG8C 1D4M1 1HLCA 2ZX0A 2GSYA 2TBVA 2YZ4A 1WW7A 5IK5A 1BMV2 4IEQA 4WM7A 3H3ZA 2ZABA 1YIFA 3RG0A 5H9PA 5I8YA 1WW6A 1W0OA 2G9GA 1MZ5A 4FPEA 1H9PA 2EALA 3JD71 3Q9OA 2A6YA 5FRAA 5A3LA 3ST7A 3MFCA 4JCKA 2DF7A 3N7JA 4OI4A 1FT9A 2HWD3 1LHNA 1GQGA 5A33B 4GKYA 1ALYA 2BWAA 2ZGNA 1AL22 3W59A 5CFDC 2V73A 1PZ9A 4DRRA 3AJYA 2D43A 1ULDA 5AVPA 2VXRA 1RUH2 4HN1A 3GHNA 5GLZA 3MLLA 4BZ4A 2V5YA 3B94A 2DV9A 3O5SA 4XFCA 4QPGB 4RS5B 1HW5A 3LA3A 4NOTA 5KXBA 2EF6A 4YGBA 1AYN3 2XLAA 4XPVA 1FX5A 5BNNB 4YVWA 4A7KA 2RM22 1COV2 1XE7A 4PBPA 1AZDA 5JVVA 1ZREA 2XWBB 1NXMA 2AGSA 4K20A 1AJOA 4CEYB 1UL9A 3WY6A 2RJLA 4CDWC 4U2AA 2OZ6A 1R081 4AI1A 3OPZA 4I0AA 2QNKA 2VH9A 2YXSA 4LO8A 1WBFA 1HKDA 5C9AB 3ZFEC 5GZEA 3HT2A 1W2UA 5JAXA 4XJWA 4XQ4A 4FPOB 3ZVXA 2ZTNA 3IPVA 4GXLA 5FREA 3WCSA 3ZFGA 2DU1A 2DCKA 3GF6A 2A75A 2MNGA 3N35A 5CAZA 2WNUA 4MGKE 3WUCA 5T5PA 4AVTA 2TNFA 3FMGA 5LK5A 1KFUL 2BBVA 4HKWA 3VZNA 1Z78A 4MX3A 3JB4C 1LODA 1RTVA 2C5DA 3U0ZA 4JGYC 4B4QA 4CDUC 3IDEA 4W65A 3AX4A 1EP0A 2B39A 2OUHA 4XJ9A 2R32A 3POSA 5T55A 4QQ2A 4ZU7A 1SACA 1DLLA 3AK0A 2R061 1YXWA 4DPNA 4ISQA 4OHYA 2X5IC 5JSPA 1VBB1 2B7YA 1DBNA 1YRZA 3H7YA 5ACA1 3J8F2 2D98A 3ZPYA 4C0HA 2QVSB 3J4UH 1RC6A 3KZ4C 1LEMA 4QM8A 1H8TA 1YWKA 4WVMB 1BYHA 4CP0A 2XJPA 1GZWB 1NLSA 2XL7A 2PAEA 2DWRA 1DU3D 2AREA 4AI8A 1VBD1 1HRI2 1DQ2A 3ZXGA 1F31A 5FMOL