4W6WA

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf6
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
141
Chain Sequence
SAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSINESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSGDLKGSFSLTNKEVNWSASIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 141
sequence length 142
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1210 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4w6wA00
4B4PA 4B4QA 4BWOA 4W6WA 4W6YA 4B4RA 4W6XA
chains in the Genus database with same CATH superfamily
1VBE3 3HD8B 1RUD2 4GD4A 2P3JA 5FXWA 4KMQA 3VZJA 1X8EA 3J8F3 2WNUA 5KWRA 3HIFA 4EN6B 4XJWA 5IK8A 2G19A 1YQ8A 1PIV1 4O9EA 5FR3A 4AF9A 1NCRA 1LU2A 1XNAA 4XQDA 2QDNA 2D3SA 2D98A 3ZSMA 1GNZA 4FP2A 1V6MA 5I0SA 2WQ4A 2Y6HA 1O8PA 3QOPA 2WL1A 5F9TA 1HRI1 2K2SA 2VG9A 4XETA 3PJQA 4I2OA 5L7OB 5A7PA 5C8CA 1LOGA 2BYVE 2VBBA 5CKMA 3M70A 3VBFC 4E8DA 3UNPA 2A6ZA 2VCBA 3ZO0B 3BU7A 1IPSA 2JE8A 2VMGA 1ENXA 3NWKA 4AQTA 3NSTA 2GU9A 2ZHNA 1TQ5A 3DXUA 1NXD1 4R9BA 3K4ZA 3C7HA 1L3JA 4N53A 2RM21 4BK5A 1PIV2 4I3GA 1VBB3 4L99A 4CDQC 1VR3A 1GR3A 1LAJA 4XFIA 2H0BA 3WDTA 4B29A 1BLZA 2XKPA 2E6VA 3Q9OA 5FQ0B 3AP9A 1REEA 4NHYA 1HRI2 4RHV3 3U78A 4B7EA 3POIA 1XSQA 1S4CA 2VCMA 3VDDC 4D6SA 5C4WC 3DL3A 1K3IA 1SZBA 1FOD3 1S0FA 4M3CB 1M06G 1UU4A 2VM9A 4IV3C 1KFXL 5L73A 2ZA9A 3AMMA 4UW4A 5LBFA 2TUNA 2ZGTA 5J96B 1UPIA 3RYKA 3VBUA 3IZOA 2YBSA 3OBZA 3ZYFA 1ZYBA 2BQPA 2RG4A 3EXUA 2BBVA 1VRBA 2PHTA 1RUI2 2W1WA 3NAPB 2VOKA 3PVOA 4UOJA 4BK4A 4XJAA 4UF0B 3VDAA 4Y1VA 1D4M1 3O1SA 4LHNA 1O4TA 3JD73 4ONUA 5IT6A 4CPBA 3ZXJA 1GWMA 2GNMA 2I45A 5CYYA 2JDPA 1XNTA 2ZGUA 4LNVA 2XL9A 4A42A 2E51A 4H14A 4ZZ5A 1NYWA 4AI9A 3OGVA 1WLTA 4CP0A 2LW8A 2A71A 2VZOA 2XMLA 2YYOA 4XFCA 3ENRA 2VQTA 3USUB 4ASLA 5KXEA 2ADDA 4JDNA 2WN3A 3LZZA 1VAKA 4UI9L 3WCRA 3LDKA 3D0SA 2D6OX 4HKLA 3AFGA 3RFRA 2QQNA 3C3VA 4P5YA 3VHOA 2QQUA 4DY5A 3JB8A 3PTRB 1JZ6A 3RZKA 1SLAA 2JICA 3LSEA 4Y22A 4IV1A 4YPJA 1S0JA 1SG3A 1HKDA 3OGGA 3ZXDA 5FWEA 4HK9A 1CAWB 1X9TA 2VTFA 1QMJA 1OKQA 5DPNA 2F6BA 2WC2A 4LBQA 2Y6FA 1VE0A 2BWCA 3WNPA 4HVQA 4CA9A 2ZEYA 1S0IA 1DQ2A 4N8MA 1UOGA 2WYSA 1NQDA 3C7OA 3WW3A 1YXWA 1VBB2 4DXSA 1RUC3 3NRUA 4RS5C 3VBRB 1DQ5A 4TZDA 1O4YA 2ZS6B 2ETEA 5K7PA 5D8AB 2NMOA 5FP9A 2IC1A 4RHV2 2JDAA 3UGFA 1ZRRA 2PAMA 3OBTA 3S30A 3TYJA 3VBOC 2CV6A 4JKMA 4ZKTB 4CSWA 4J25A 5EJZB 3MIDA 4YSFA 5K9YA 1PVXA 1QJX1 3W20A 1JZ3A 1C1LA 3WF4A 3I3EA 1WWYA 3ZYIB 1WW4A 2C9AA 3HNMA 1UOBA 1NCQC 2VZUA 3J26N 4Q4V1 2XUMA 4Z2AA 3N36A 1WGPA 2Q1FA 3PVBB 3OTFA 3I7DA 1VALA 3TAYA 2A70A 3OSDA 2GDFA 4GIQA 2O14A 3N9MA 4BQXA 3VBSA 1MS5A 1I1EA 2VMCA 1JZ8A 2R16A 4L9BA 1RJ7A 4F7ZA 5IAVA 4YW5A 1WLCA 2VZRA 3B9IA 4D7SA 1F4HA 1GWLA 5FY0A 3QCWA 5A6YA 2AREA 4YFWA 3LIHA 4K9SA 1ENRA 2RR11 4YM3A 4Q4X3 4GJZA 2I07B 4D6QA 3B9CA 3I59B 1FV2A 2VMHA 2WNVC 1GZWB 5KHJA 5LRRA 1RUE3 1SCRA 1JZ4A 2W94A 5L7OA 1VMFA 2VNVA 1CIWA 2ZX0A 3MYXA 1NE4A 3J7NA 4LK6A 4EROA 5B2GB 4RGAA 3ZSLA 1RIRA 5FZ1A 3KCCA 2IWGB 2ZGLA 1HXS1 4CXYA 5FZAA 3BTXA 4OYUA 3P6BA 2IUWA 3DKQA 2PYTA 3KCXA 1YLLA 4YVWB 4RR3C 1RUG3 2A5ZA 4CCJA 1OQEA 3PIJA 2QUOA 5F8PA 5FQ0A 1QQP1 1RUC2 3M7AA 4MG2A 5F37A 2ARAA 2JD9A 5CG9A 3TN91 1DZTA 4KI5M 3C7GA 4LULA 3WDYA 1HV1A 4M3CA 3M3QA 1XE7A 3UGHA 3GZTB 4Q1RA 4D7TA 4Z92B 5C3SA 4IEXA 4LLOA 4XMAA 2AENA 3ZMOA 4AYUA 4BXSV 2W46A 1US2A 4LA3A 5IFTA 3U4XA 3VD5A 3BPSA 3NAPA 2VXRA 2BNMA 1BEV3 3H3ZA 5CISA 4FFHA 3TRSB 1OOPC 2YDEA 2VMIA 3GDBA 4UF0A 4JGYC 5C9AC 5CBLA 5ERLA 1JYIA 1NKGA 2RS33 4XPVA 4NPRA 5FRAA 5FYSA 4ASKA 4JDMA 2YY1A 5FMOL 1OH3A 2ATFA 1B09A 1HQNA 2D3RA 2YMZA 4K20A 1QQP2 4UFHA 4ES8A 1BBT3 1ZBE3 4AOCA 1SFYA 4Q8LA 1UOFA 4MGQA 1LJ7A 1ASJ1 2JIJA 1E5SA 1TVGA 3BALA 2PXJA 3VGIA 1NOVA 1H8TC 2A1XA 3MLJA 4CUGA 4QX2A 3CNAA 5FLIA 2GMMA 1MS1A 5FZ0A 1O91A 2R1BA 2AUYA 1US3A 2QBXA 1NG0A 1PMHX 2ES3A 5M0TA 5IK5A 3IB3A 4E2SA 5IFPA 1J1TA 1Y9GA 3OUHA 4Q4X2 1EUUA 1ZREA 1LHVA 4XUTA 3HEIA 5T54A 1IPKA 4FPJA 3U4SA 2VCAA 1RUE2 5FKBA 3ZYHA 3THPA 5IVYA 1OXCA 2OX0A 3LA7A 4U36A 4YARA 3ETPA 4NHKA 4TXWA 1L7RA 5DDJ1 2GN7A 3ZPOA 3BOPA 3MIBA 4PI0A 3ZFEB 4RYDA 1ULOA 4HVRA 1W9FA 2JX9A 1OC1A 3R4SA 4NWVA 4YW4A 3U14A 2OUJA 3K77A 5BNNC 4ARYA 2BEOA 5J3UA 1YJKA 3PUQA 1GICA 4TSVA 3LEMA 2FDJA 1DCSA 4LEJA 4O65A 4COVA 4AQ6A 4D69A 5EPAA 4PLMA 1NAEA 1RUG2 1YQ6A 4I0AA 4HL0A 3SH4A 5G04L 3VBRA 1AX2A 2LUWA 4QDRA 2PLV3 2XGXA 5D8AA 3A0NA 4G3YC 1QJFA 3RGBA 5B4NA 3EBRA 5C8WA 2IXJA 3ZXLA 1QNWA 1PO23 3LIGA 4P5HA 2XJVA 1AL0G 4WBBA 3ZLIA 2D6PA 1R1A3 1YFUA 2QQOA 1LULA 3PHMA 3BN6A 4K6BA 3W5NA 4S2FA 1BEV2 5A3MA 2RS11 5IVCA 5JI7A 1OQ1A 1MEC1 2XVKA 5DAVA 2VL4A 1PO11 2RS32 3AVRA 1H2NA 5HCFA 3BIWE 2ZTNA 5CIRA 1WA4A 5EP9A 4H7MA 5LBBA 4TLFA 5KHHA 2PHXA 4A41A 1DDLA 1BBT2 1K5MB 1RUF3 1ZBE2 1V0AA 1QKQA 1Y4WA 1OHFA 2NN8A 2QJVA 1SBDA 4Y3OA 2ARBA 4BQ2A 5C3OA 1WLWA 3U37A 5FPUA 4NAOA 1AR83 2VVFA 2ZZQA 2YGMA 4WM7C 1YI9A 4UBGA 3I59A 4P9GA 4P14A 2V5YA 1GZWA 2K9ZA 3O7OA 2VO5A 1VAVA 2RS12 3H1MA 4K40A 1VBD1 4WM8B 5AFEA 4AVBA 1YNAA 2YBPA 1I5PA 3J4UH 3O0WA 1PO12 4QX0A 5FV3A 5ACA1 2ZEWA 3THCA 4XHBA 2EALA 1A34A 4NAMA 1N3PA 1OF3A 2X5IC 2JDNA 5EWSA 1NZIA 1OLQA 3GJBA 1E5HA 3PNAA 5EJ3A 1CJPA 1PVC3 3BPZA 1XJAA 1ACCA 2VTXJ 1GNHA 3AB0A 3FLTA 4UW6A 4Q29A 5DUUA 4YVWA 1DYOA 2B5HA 1F15A 5LASA 3MFAA 2QQVA 1AF9A 3GZUC 3MIHA 4META 4C0HA 1CX4A 3EQEA 1FMD3 2X10A 4LO8A 2RDQA 2YC2A 5FBZA 4O9GA 4Y5TA 3RWKX 3NKGA 3DYMA 1ZRCA 1AJKA 3Q8CA 1LCLA 5BXXA 1S2KA 2EAKA 3WHUA 4AK3A 1I6XA 5A3LA 4XCBA 4AEDB 4XDPA 1C8M1 5F6KA 1RTVA 3LA2A 1WBFA 5FZ4A 2NYYA 2ZKLA 1PO22 1YUDA 4AFAA 2XPJA 2ZEZA 4Q0UA 3OBRA 1MS0A 1Y3TA 2HWF1 2IXIA 3ACIA 4IE7A 4GB31 3DN7A 4J1XA 3SQOA 5LWBA 2H0VA 4IEPA 1LRHA 1W2AX 1CESA 3QBQA 1DU3D 2UY9A 5A1AA 5LEKA 4FPCA 1UX6A 2XB6C 2WLPA 3CIHA 3LSDA 3G6JB 1W8UA 1LHOA 4YW2A 5BNOC 4EYUA 2I74A 1UY0A 2JE7A 2QQLA 4XFHA 1EAH3 3PURA 5FDBA 4IQPA 3JUUA 2JDUA 4LT5A 3BKZA 4AVCA 2ZGMA 3H3UA 2G4IA 1C8M2 4FPHA 1W2UA 2EXHA 1RUF2 4IEOA 2XLFA 2D40A 3WP5A 3NQHA 2IFRA 3HT1A 1QJY1 2XLGA 3B3QE 5IVVA 2BNNA 3RZZA 5IK7A 5F5AA 2OQ6A 2HWF2 3PL0A 2VOVA 2R0FA 1V9U3 2UWAA 1O5UA 4FCAA 4UFIA 1J1LA 4BA6A 5F7UA 4LUMA 2GAUA 2WSVA 1Y7BA 4IEVA 2KD7A 2XBO1 3OY8B 2F17A 2Z79A 1SHWB 4ISRA 5KXBA 2ILMA 5FMBA 1ND2B 4JGZC 1UIKA 3MFCA 3T2PA 4QB2A 2MPFA 5DAQA 5APAA 1AYM3 2HWB1 3K3NA 1ZRIA 2RMU1 2O0OA 4QB6A 4K1ZA 3O14A 1O4ZA 3ZFEA 3DPRB 4D3WA 2WFF1 4LMFA 1MQTC 1OKOA 1WCKA 1RXFA 1LODA 2IFWA 4R9AA 4COUA 5F5QA 2HH9A 1CD3G 4GJYA 2P1BA 1PVC2 3VKNA 5GM0A 4QQ2A 1KEXA 2C5DA 4S2HA 3V64A 1GBGA 1IQAA 1UZWA 2UYBA 3POWA 3NJZA 2IZWA 2WYFA 1H6XA 4JTOA 4QX8A 1ZZ8A 1W0OA 1FMD2 1ENSA 3K3OA 5H9RA 2NM1A 4PJYA 5FY4A 3WF3A 4AI8A 1RVF1 4GQ7A 3EB7A 3MPBA 4KG8A 4Y33A 4DXRA 2VJXA 3WSOA 2CDOA 2E53A 3HAGA 3I2KA 2HWB2 2R30A 3FBYA 3NV1A 1OPMA 2DBNA 4Y5SA 4CEWB 2VUJA 1UY1A 2VR4A 4AVTA 2WFF2 3IDBB 4C90A 4SBVA 1D0HA 2Q0AA 4CE8A 3URFA 1W8NA 3P5BA 1XYNA 4FP3A 1TME1 3WG4A 3NKTA 5CFDC 3SCGA 2DDUA 4BJ0A 2BDRA 2VPVA 4WZFA 4GMP1 4F8AA 4P00B 2FCUA 2SBAA 3GXUA 1FV3A 5F5IA 4QD2A 4A3ZA 1EAH2 1K5MA 3QACA 1RMU1 4JAAA 4NR1A 2HWC1 2YC4A 2E7TA 1LNSA 2Q1ZB 4M00A 1AYN1 3C7FA 1AR63 1VMJA 3IIAA 1PHMA 3POFA 4QKFA 3VZOA 3Q8BA 3VKMA 1XU2A 2G9GA 4NWWA 3PTYA 3RS6A 3KM5A 2WR9A 1CX1A 3UESA 1V9U2 2YBKA 3E5XA 4MXWB 4PCRA 4IGOA 1Y9QA 2PHRA 3IAQA 5CFCB 4WM8A 3VHPA 3GJAA 4QM9A 1B35B 2DVGA 3QH7A 3AKPA 1SLLA 4FI9A 1QH7A 5CKQA 4W8JA 1ST8A 1AYM2 1F35A 4Q4W3 5AVAA 2BBAA 2FDFA 2RDRA 2HWD1 4XXPA 3I2GA 5F2WA 4AHYA 1S0CA 5F3CA 1RC6A 5FPLA 3H9AA 3WNLA 4XW3A 1A8MA 1O5LA 3V56A 2RS51 4D0QA 2R041 1NY71 3T30A 3WQ0A 1OLRA 1DBNA 1ULDA 3R05A 1W0PA 2A6XA 2R7EB 1N1VA 2BGOA 3N9NA 3T2OA 2R071 2QTWB 1XRUA 3FZ3A 5K0UB 2XJRA 3DEMA 2AR6A 1UWWA 1PNFA 3JQXA 4AEDA 1UNBA 4XAAA 5DMYA 4LE3A 4ATEA 5LATA 3FWEA 2Y0IA 2LALA 4FT8A 3WDXA 4AW7A 1NLRA 3JBG3 3L9JT 5D1IA 3AYAA 3B01A 2PAKA 1PGW1 2YPDA 4LO6B 2ZHKA 4JQTA 3GGLA 4XE9A 5FZFA 4CTEA 4DUXA 3O1OA 2ZKNA 4XQ4A 4A45A 4CCCA 5ABJC 1H1MA 1FT9A 5ANQA 4K8FA 3HN3A 4NIDA 1SFNA 3JB4C 3R6SA 4BLIA 4CEYC 2HYKA 4FFGA 2D44A 3E6DA 2VE1A 1W8TA 4OMDA 4CP1A 3HWJA 1F2NA 5C6CA 4QX7A 3NO8A 3QH6A 3WHTA 4RQPC 2YG0A 2NLRA 2YB7A 3Q8EA 4CUAA 1R1ZA 4BLJA 2JKBA 3CHXA 4OI1A 1N1TA 4X8NA 1R081 5FK8A 3LQCA 4CDXB 4XCAA 2WZR3 2ZABA 4I02A 3VZLA 3KF3A 3V0AB 4A44A 1UO9A 4CXWA 2PHUA 2XOMA 4RD7A 3M3CA 5JR2A 1G7YA 2GH2A 4OVEA 3MF9A 1U5XA 4HLTA 1MVQA 3OY8A 3H8XA 2YC0A 2D93A 1ND2A 4OQ8A 2OA2A 1W3XA 5A3TA 5JZGB 4QHOA 2R0HA 3ZVXA 2H6CA 1ULEA 3K4AA 2Q8OA 3MUY1 3D5OA 1ND3B 1RUH3 2QE3A 3DPRA 2GMEA 4IEWA 4D6RA 2GC2A 2QQKA 4Q4W2 2E33A 4AI0A 3PMSA 4YNIA 2WNUC 5CKNA 1UY2A 4Y1ZA 3BB6A 2SLIA 1WW7A 3ST7A 4QT6A 2NMNA 3GCXA 1ZZ9A 3HBKA 4OZOA 4XXAA 4DEVA 1NCRC 4YG3A 5CA6A 5J1XA 4M0HA 4HANA 1BMV1 2EICA 1W8OA 1YYNA 4M4RA 4KWKA 2TNFA 5IHRA 3RWNA 4BXFA 2DVDA 5C8CC 1C57A 2WT1A 1BXHA 3LB9A 4GZ9A 4CU8A 4CEWA 2WDBA 5ISLA 4M01A 3H7JA 3I4IA 4JVAA 5A3PA 4LKDA 3ZDVA 3JBG2 4IE5A 3KVBA 4EN9B 3ZFGB 3PDQA 4QQHA 4NIAA 5IAXA 2BWAA 2X05A 4DRVA 2Z69A 3S5AA 5E6HA 4N53C 2Q8CA 2C0ZA 4AQSA 1RUD1 4FAGA 4NRMA 1QJZA 1RGSA 4EN0A 3WDVA 5FZGA 1CAXB 1BK1A 2P3IA 5FZKA 1YCIA 1W8WA 3LEGA 4WV8A 3T2TA 3M8LA 3MO4A 3A0KA 1WMXA 3SH5A 3KD4A 1HB2A 3ALQA 3J7HA 4XF1A 3ROUA 2YPJA 4MGKE 3SMHA 4CU6A 2DVBA 2R061 4IE6A 1UYXA 4B3NA 1W9TA 2A6WA 4KNCA 3VBUC 1REDA 1FAYA 1OUXA 3HVDA 4MXWA 2WZR2 5JMCA 3ZYPA 1DYKA 1SBFA 3MLLA 3QLQA 5CFCA 3WNMA 2QKDA 3RMYA 3V65A 2WZPP 1DIWA 3DF0A 1B35A 2W52A 1POV0 3JCIA 2IVIB 2P17A 5JIAA 1XU1A 2E63A 2Q4SA 1H6YA 1W06A 2A7AA 4IE0A 2DBIA 2W68A 2XWJB 4W6YA 1RHI3 4YG6A 5FZDA 3WZ1A 1QU0A 1PMIA 3AMPA 4AG4A 1RB8G 4LBKA 1RUH2 4QPWA 2F4LA 2VD7A 5GLTA 1VBC3 1W03A 2UWCA 3LPFA 2R062 3N7KA 3PUHA 3ZSKA 3ELNA 3IT8A 3AK0A 2ZX3A 1O7FA 4FXGB 1F4AA 4Z1VA 1G9DA 2FDKA 1Q8PA 4ORFA 1PZ9A 4GALA 4YZ2A 3LE0A 1UU6A 4XYXA 1UXZA 5K0UA 1D2QA 3O1MA 4IV1C 1UX7A 3R4DB 1JU3A 3BOWA 3OGSA 5J7MA 3THTA 2ZGQA 2L9LA 3O1TA 5FPBA 3WQBA 1OH4A 2V09A 1RUI1 3MV01 4JC1A 5TSWA 1I5ZA 3WXPA 2HJIA 1EUTA 3AZXA 2DCKA 4X6RB 3D8CA 4AZZA 4CDWB 4LE4A 3SKJE 1HN0A 1CIYA 1NA1B 1I3HA 3I54A 1DG6A 5FZOB 1UCXA 5J48A 5FYHA 3FN9A 3CJXA 5JXGA 3LDBA 4OULA 1O3QA 1VBE1 4L0PA 4DXTA 1F8VA 2ET7A 2DCTA 5JLVA 1AR73 2B4KA 3J8F1 3MGUA 1JOJA 5EYYA 5AVPA 5A7WA 2W9XA 2ZOEB 4GAZA 2QQIA 1KJLA 3GZAA 3OB8A 5A7QA 2PHDA 3D6EA 2WIIB 2XVGA 3VHNA 1LKNA 4ZXKA 5SV8A 2C4XA 2VBDA 3ZMNA 5FUIA 1HB3A 4CDXA 3WLUA 4YGBA 3AP5A 3RI9A 3DV8A 4O7XA 3ZXFA 3V0AA 2B39A 4E4DX 1DFQA 3NNGA 3I2OA 1AL23 3UJQA 4YM0A 3D82A 4AGGA 1SPPB 5BNQA 3SC7X 1JHJA 1VBE2 5T5LA 2ZX1A 2WFPA 4Y26A 5JZGA 4P9IA 3VBSC 1OSGA 1H9PA 1W6MB 4H55A 3J8F2 3BUCA 3ES4A 2PN5A 2Y6JA 1DQ1A 3I2IA 4DZGA 1ND3A 1QXJA 3OJBA 2VQAA 1H8VA 2ZGNA 1RHI2 4N43B 1AXYA 2TEPA 4E4HA 1VBB1 2BOJA 3KLSA 1T6BX 1VBC2 2CL2A 1ULPA 2DCYA 3LAGA 4MV2A 4V2WA 1VBA3 1IS6A 3TEWA 1GUIA 4RHV1 1JZ2A 3WUDA 4YLZA 2VZVA 3TB0A 3CQOA 2WAAA 3L2HA 4LBOA 3RZHA 2VCCA 1OT5A 1FOD1 1HQWA 3I2JA 1FXZA 3R4UA 2WO7A 1ZBA3 4P9LA 3A4UA 5L7OC 5JMOA 4KH9A 1G9BA 4AGRA 5FPAA 3S57A 4I30A 3CKHA 3IDAA 4S2DA 4XEZA 4EJRA 5FYMA 1XOYA 3TOJA 3ZFGA 5LW9A 4NIHA 4GKYA 4PQ9A 4YW1A 2GSYA 1OMIA 2VVDA 3JD71 3KCYA 2D3PA 3ZFFB 3N9LA 4A2UA 5D2AA 4RGKA 3AM2A 5K4LA 3AVSA 5IW0A 5HV0A 4XVHA 1CAXA 1VB4A 1FOD2 1G86A 1VRH3 3JU9A 2CY6A 2QDRA 1QY4A 2PQQA 1AR72 2OUHA 5DUXA 5J98B 3VBHB 1NX9A 1EV13 1T2XA 1ZA4A 3FHIB 2JG8B 1SMVA 2X8KA 2PTMA 4YZ5A 1C4RA 5LA0A 1W9WA 1XNDA 2EA7A 2FHRA 1D4VB 2D43A 2P37A 3WW2A 1REFA 1YFXA 5CZKA 3JD72 4EZ4A 5C71A 4MGSA 1OVSA 3NAPC 4FOWA 4RA0A 4BQ5A 5JWPA 2DWRA 1AL22 4CP2A 2WLQA 4JTNA 5FJHA 1KS5A 1V00A 2MNGA 2BERA 2C26A 2VNOA 3T0BA 3FX3A 2VUCA 4MLOA 3VLBB 2MEV3 2XWBB 3HQRA 3BI3A 1QEXA 3RQ0A 4ATFA 5LB6A 1RUC1 5EIYB 3B7MA 2BW8A 4N90A 4ES9A 1HB4A 1NLQA 1VBA2 3UK9A 2OYZA 4FOVA 2VOTA 1PNGA 1ZZ6A 3ZKYA 1HLCA 2FZ2A 4AEKA 5C4WA 3WUCA 4QB1A 2FCTA 4LLFA 1ZBA2 3GALA 1QJU3 3SCFA 1AJOA 4LBJA 1UMZA 2BTVC 4BMBA 2OXBA 2W1SA 4UWDA 1JUIA 2J1TA 5FO9B 1UIJA 2J7MA 2VMDA 4PHZA 3OUJA 1WZXA 3I2FA 4CDWA 3H50A 5GLVA 1NA1A 1QGLA 5B4XA 3WNNA 3LD8A 1EYBA 4LHLA 5FZOA 5FYUA 5FWJA 1DQ4A 2WNOA 2WSUA 3KHBA 3PUAA 4YWAA 3WCSA 4CUBA 3WINE 3MDPA 4MX3A 4UBHA 3I3DA 4OHXA 5HCBA 3VBRC 2PELA 2VULA 1KFUL 2VZPA 3GHMA 3SNMA 3D0JA 2EXIA 1VRH2 5D8AC 3MPPG 1ZRDA 5AC93 4X6QB 2PHLA 3BYWA 5F5CA 5FREA 1EV12 3RSJA 4DUVA 4A7KA 4Q4X1 3UKNA 4UAPA 1PK6B 5F2SA 3BU0A 3K4DA 1DGRA 1RUE1 2VW2A 4HVOA 3DYPA 2WABA 3USSA 2Y38A 1GNYA 1C8NA 1V70A 1DHKB 2VOWA 3H42B 2JJ6A 1J58A 2C6SA 1FPN3 5GLZA 4R4XA 4UFLA 1SPPA 5HCHA 5A1FA 4HT1T 1D0GA 2C1FA 2FDGA 4MGYE 1JW6A 2O8OA 1W6MA 4QGMA 3UV9A 3I3MA 4AFBA 4YW6A 4N43A 4QGLA 1S0BA 3OF1A 1RUG1 4LO7A 4BOWA 4AI2A 1DQ0A 2MEV2 2XONA 1LOBA 2H6BA 4GWIA 4QXBA 5IWFA 3O1UA 2WQZC 2GC3A 1SDDB 2VH9A 4HPKB 4QPGB 5F32A 5I0UA 5IJRA 4COZA 1SQ4A 3LFMA 2BGPA 1LR5A 4G4FA 5FZ3A 5C3QA 3MZHA 3OGRA 5FP4A 5FLHA 3SH3A 4TN7A 1T6GC 5EV7A 1WW6A 4PF1A 5FO8B 5K8SA 4GXLA 1JYNA 4MO3M 5LZ6A 1OLME 1AHSA 1QJU2 2YUEA 4OFGA 4UFJA 2B42B 1IS5A 1DGLA 3I3QA 3T1LA 1BEV1 2QQWA 3CJIB 1JI6A 1YQ2A 1R093 2XUEA 1ULCA 3GF6A 4HONA 5GZFA 3ZM8A 2ZJCA 1APNA 2RS31 3POEA 4D94A 4YZ1A 3NJYA 2V5DA 1WMDA 2KA3A 4URTA 3UKTA 3ZFFA 4TTGA 1O3RA 1ENQA 4LO5B 1L7QA 2OVUA 2D6KA 4IL7A 4LHKA 4A6OA 4YVWC 2ERFA 1BBT1 1W39A 1KRIA 1ZBE1 4L2NA 4YVSB 1W3VA 5FP3A 1Z7S3 5T3NA 1SLIA 3J9SA 3AMHA 1RXGA 3VBHA 5J36A 2FBEA 1BJQA 3C7EA 2DVFA 4GWMA 1XNBA 4JZRA 5FXZA 2JG8A 4ZZ8A 3TNQA 5AC92 1YEWA 4A7ZA 1OA4A 4QU2A 3O12A 4DINB 4ZONA 1YQ5A 4IGPA 3TEZA 4OHVA 1CVNA 5FY5A 1MZEA 1DZQA 1COV3 5IVJA 3UT0A 4F3JA 5A7OA 1GV9A 3FFZA 4XFFA 5DZFA 2ARXA 1FPN2 1S2BA 1QJEA 2W1QA 3VD4A 3O1PA 1UW8A 1IQDC 2R1DA 2WWSA 5GLUA 4XBQA 5JSPA 4N9HA 4E9KA 4GH4A 3T09A 5GZCA 1CR7A 2UWBA 4P9JA 4BQWA 2ZMNA 4BQ4A 4UYBA 4RL7A 3MI8A 3VN4A 4IERA 1EY2A 4WVWA 1GP6A 5GZGA 4J6GA 2ZX2A 3BGAA 4Q8KA 2R32A 3L2YA 2QNKA 4CPBD 5FZCA 4N7UA 3F2ZA 2DV9A 2PLV1 4AVSA 3H3LA 3VL8A 3ASIA 4ZU4A 5KBFA 5JI9A 1XE8A 4LPLA 3LKJA 5D21A 5A7SA 3T3YA 1PO21 3VV1A 2NPIA 1URXA 3HQUA 3WG3A 1WLDA 2LS6A 5DABA 1R1A1 4HK8A 1F5FA 2EVXA 1UZZA 1N47A 5FP7A 3T2QA 4QXKA 2DCZA 1BKZA 1RUJ3 3VD3A 1JU4A 2A6VA 1DQ6A 3AZZA 1TMF3 1VP6A 5GKAC 1S0GA 1PZ8A 2JEMA 3WW1A 1LOFA 3ZFEC 1R092 5HV4A 2XQXA 4K8RB 3AL5A 3FC0A 3B93A 1W9YA 5FZLA 3PU8A 4B4RA 2PLV2 3FJSA 3SITA 2IXCA 2YGLA 4UXAA 5BPXA 5FYVA 1TG7A 2ZMKA 2GNBA 4AEJA 4BQ3A 4LBQD 4JCKA 2HWE3 1RUF1 3ME2A 2CAUA 4AI3A 1Z7S2 1CONA 2EIEA 5FBJA 4BDVB 2VW0A 3KV5A 1AR81 1R1A2 4BQYA 2ADEA 4ZXEA 4UFKA 2GP5A 4NHXA 4XDQA 2P3KA 1PK6A 1WA6X 2XVLA 2ZAHA 4Z07A 2FDIA 2V73A 3WG2A 4LKSA 2J1UA 4IEQA 5GZDA 1COV2 1RJ8A 2WQ8A 2P2KA 3AKRA 3A21A 2D7FA 2Y26A 4LITA 5IVBA 5GZEA 3EYPA 3OYWA 4AEMA 5FPXA 4W50A 2ZEXA 5HBAA 4HFSA 2VBPA 3ACGA 1D2SA 1PVC1 1UN1A 2WO1A 1JMUB 4BHPA 2B45X 1AR82 3HNYM 4XURA 1MS4A 1K5MC 4NMIA 1NT0A 5CG8A 1HJGA 1X33A 4ITCA 4FSJA 4FPLA 4HPKA 1FMD1 4QPGA 2OW4A 3SEPA 2JG9B 2YV8A 2YFUA 1WW5A 4QPYA 3V0BB 5H9PA 3IKWA 2RJ2A 3ACLA 3POJA 1U5YA 2DCJA 1ZZCA 2DURA 2W47A 1OFNA 4TLGA 4XJZA 2VNRA 3LEKA 4K21A 4CDUB 2OQ7A 1ZZBA 4OLLA 2W3JA 4WM8C 1E5RA 4CYDA 4ISQA 5LBCA 1CPMA 1H1AA 1CPNA 3NV3A 4WZCA 3WF2A 1R64A 1LOCA 3CJIA 4IETA 1RUJ2 3PMEA 4KBZA 3AX4A 3WF0A 3MICA 2VQUA 4NRPA 3FMGA 5DXDA 4BMEA 1BVVA 4OUEA 5IATA 2VOXA 5L9VA 1EAH1 4NPMA 2ZACA 4YVSA 1AUYA 3ECQA 1FI2A 1K5JA 1UU5A 2A3YA 2XJUA 4KU8A 4Q4Y3 3WW4A 4CCMA 4Y20B 3ILNA 2XR4A 3ZSEA 2GNDA 3AKSA 1GU3A 2HLEA 2W39A 4BIOA 3SEEA 3N7LA 4C8DA 1DP0A 4HSJA 3PIGA 4CU9A 4AEDC 3FLPA 5HCAA 1ONAA 1NE6A 1V9U1 2WZEA 2Y0OA 2Q5TA 4QQPA 3SLIA 4B4PA 4XMIA 2XH6A 2ZMLA 4FFFA 4YG0A 5FYZA 1J3QA 2WS93 3W9AA 1S2EA 3PVEA 1DZRA 3INAA 4AHWA 5JPMB 2W95A 2ZXQA 3MW4A 4CVUA 3B69A 3OD0A 4IESA 4XAEA 5T5JA 2CGOA 3KT4A 2LTNA 3LEIA 3C8XA 1AYM1 4Y1YA 1RITA 1J3RA 2JDYA 2YXSA 4HSLA 3KT7A 4M3CF 4R9CA 2BGCA 5T5PA 3GCWA 1J84A 3A7QA 2VXJA 4RGGA 3WY6A 4DEQA 2BFUS 2BVBA 3KV4A 3TBDA 1H2LA 4FOQA 4TYSA 5KC6A 4AR2A 5H9SA 3I8TA 1N1YA 4YZ3A 2WINB 3ILRA 1ULFA 4XTMA 3RVHA 1IS4A 1WKYA 5E16A 3QD6A 3RNSA 5KHIA 3OBAA 1MZFA 4XF9A 2XJSA 3BVCA 3HT2A 5EXOA 5KHKA 3M1HA 2BU9A 5A70A 3K75B 1ND2C 1XNKA 2ORXA 2FD8A 4ET7A 4MH0E 4OUSA 3AP7A 1HW5A 5JOXA 4KWLA 1X50A 4YW3A 5F3GA 5BNPB 1OPOA 4LBNA 1OLMA 1ULGA 4ARXA 3DPRC 2ENRA 3MV11 2FMDA 4G9SB 3H1YA 3T0AA 2VAUA 2UURA 4CCNA 3S5QA 4CCOA 2FCVA 3MHZA 3H8RA 3BTZA 1OBNA 5L19A 5E8AA 2P6CA 4Z82A 1V6IA 1LGBA 1POV3 3CEWA 2RHPA 1LENA 1U5IA 5DQ0A 4Q4Y2 2XLAA 3LWCA 4NO4A 1HN1A 1AR61 2R49A 1NUKA 2ZGRA 3VB9A 4Y4YA 4M4PA 4LK7A 1R083 1Y9MA 2GC0A 4MYEA 4DY3A 4EQVA 4B7KA 4PDWB 4ZHNA 2EXKA 5FUPA 3HR9A 5I93A 4CEWC 2EF6A 3MIEA 2EIDA 1LU1A 3KGLA 1SFPA 4MOAA 4OMCA 2D5HA 4X8PA 4AAPA 4BH9A 2WS92 5FOBB 1TEIA 3ZR6A 2DTWA 4GKXA 2XQRA 3R0RA 3KQRA 4MADA 2B7YA 4Y1UA 4CCKA 5A7WB 2DUQA 1AZDA 2HBTA 2Y8KA 1LGCA 3WV6A 2BUKA 4YGEA 1KXGA 4Q4W1 2WA3A 2WN2A 3KQ4B 4XACA 4H3WA 4XBNA 4JHZA 4LIUA 1RINA 5JSOA 1AR62 3WVJA 3LCPA 1OQDA 4GMP0 3N4MA 1C1FA 2RDSA 3IWZA 3N7MA 1VB2A 3OG2A 1AXKA 2JB8A 1KD7A 1AR93 1GKBA 2WT2A 3VKOA 2JG9A 2NQYA 4XF4A 1TZOA 3V0BA 1GYKA 1OA2A 3I3BA 1YI7A 3J7LA 5A3UA 1FATA 2C24A 5LA2A 4BIFA 5J37A 1YFWA 4CDUA 5CFCC 1W6QB 4BYYA 4BZ4A 3JBG1 2YU1A 1HX6A 4UFMA 3ZN5A 1B35C 5A32B 1RUOA 5DG2A 3SCHA 3HN1A 2A3WA 1M4WA 5LA9A 2QQMA 3P1IA 5L36A 1G9AA 1JOBA 1XE0A 4B4QA 2WO2A 1CN1A 3A23A 2VGDA 5A33B 1IKPA 4JKLA 4YRDA 3AXEA 4R8HA 1CQ9A 1QDCA 1JYTA 2EIGA 1UZ0A 3ZKUA 3AZYA 1SBEA 1SLCA 4RFRB 1H0BA 4Y20A 1OI6A 2DUPA 2OZJA 3GM8A 3VBFB 3WP3A 4PLOA 2W08A 5K0UC 4QDSA 4LO4B 5FYYA 1HQLA 1GZ9A 1LTEA 3EJKA 3WQ7A 3S7EA 5T50A 4LORA 1HRV3 3I49A 2WZR1 1DYPA 1I9RA 3N35A 1SLTA 2Z2SB 4KL1A 2JXAA 4Y4RA 5DG1A 2JWPA 5DUVA 1JZ5A 4CDQB 1G8WA 2VNGA 3KB5A 5GJ6A 5IYYA 5A1LA 1X7NA 2K46A 4WVMB 5FO7B 1WCSA 3B00A 3MW3A 3RDIA 2XXZA 1PIV3 3NNJA 2E26A 3GZEA 1W2OA 1RUH1 2F4PA 5FY8A 3VDDB 4P08A 5C4WB 2J1AA 3AYCA 5A3WA 1BK0A 4I0WB 1QNYA 4MSVA 5FZ7A 4IV3B 2VUAA 1HRI3 4LBLA 4AL9A 5EQUA 2CGPA 3N9QA 3ZX7A 5FZ6A 3AJZA 4EE2A 2Y64A 2A6YA 4DO0A 2GP3A 5LA1A 2E31A 4IDZA 3W21A 1AR92 1Q3EA 4MUVA 5FOJB 4CDXC 4FPKA 5JDBA 3FFQA 1POQA 1OD3A 1V6NA 2UY8A 4BM8A 3H1WA 1VJ2A 4NIIA 5FY7A 5BYNA 3VZKA 3WX5A 1BZWA 5LEJA 1UAIA 2RM23 4LA2A 4XZUG 5FYIA 1ZRFA 5E89A 2Y6KA 3HOBA 4AXOA 3WNOA 2XL7A 5JZGC 1XSRA 2RVAA 1YHFA 2WWUA 3GBFA 3NV2A 4OHZA 1PMJX 1HJFA 5BNPA 3AYEA 3U10A 1ND3C 1NXMA 1KJRA 2IXLA 2CYFA 1U0AA 1YIFA 2D6LX 3VKFC 5FJKA 5H9QA 1GMMA 2JE9A 3AYDA 2WO3A 3UL2A 2VZ3A 3WF1A 3P3PA 4Q0VA 4FTSA 1VLNA 4QPIA 1N3OA 3KGZA 1LHNA 1LEMA 4W6WA 3Q8FA 4ZU7A 1S0DA 4ASMB 1Q8OA 4LIVA 1D4M3 4NN0A 2CAVA 1WCDJ 4RFT0 3IBMA 1GQPA 2RV9A 1DGWA 1V6OA 4PDWA 5FZ9A 4W65A 2WA4A 3AL6A 3SXWA 3E5UA 3UYJA 2P34A 1HRV2 4COWA 2Z42A 2IXKA 2BZDA 2GZWA 2XHNA 5I91A 1PGSA 1YRZA 3BCWA 3ZFGC 1C3HA 3AZWA 3CDZB 4RS5B 2ZX4A 2AC1A 5FCCA 2LM3A 1ZZ7A 2CWMA 4LJHA 5FTTC 2QQJA 3N3HA 4OI0A 1RHI1 2N7GA 1QXPA 4NJ4A 5C3PA 3OOXA 2HYXA 2BVVA 1JYVA 4FQ4A 1C5IA 1VBC1 1W8HA 2D5FA 3CL1A 4YZ4A 5BV6A 1L7LA 3VBOB 3ZXAC 1A78A 4A7YA 3RZLA 1AX1A 1CAUA 1W6PB 4HBNA 5LBEA 2Y6LA 4Q5OA 1NCQB 2BJSA 3MW2A 4BPZA 3RYPA 4XDOA 5FLJA 4AAXA 3LPGA 1NLSA 4HMZA 4BE3A 4Q2FA 3IMMA 4QM8A 1OURA 5CEHA 4WVZA 1O59A 5FY1A 4KU7A 3G7DA 3I2HA 1QF3A 3GYDA 4OI2A 1W6QA 2CTVA 4Q1PA 2VZTA 2RM22 4JRAA 5A6QA 3RG0A 5LK7B 3ITQA 4XJ8A 3FE5A 5A32A 3E6CC 2Q30A 4SLIA 2CSGA 4GWJA 3IIIA 1W8ZA 2E32A 4OZXA 5C3RA 4ZPIA 4K7JA 2VU9A 1EPWA 4I09A 1UY3A 3S6PA 1W90A 1J59A 4HXCA 4LTAA 3ILFA 3DCQA 5A33A 2JIGA 2WJSA 2FZ1A 1PX4A 4PIYA 2WNVB 1AR71 3FUQA 1UYZA 1QJX3 3DUIA 3KVAA 5FZIA 3OEAA 1HB1A 1BHGA 4FFIA 3VBFA 4Q4V3 1LECA 1S55A 1VAMA 3KV9A 1UZVA 3KWVA 2G9ZA 2OIIA 2W92A 2GC1A 2VECA 1D4M2 1IG0A 3IDCB 4QKBA 5LCWL 4KGQA 5I8SA 3TEXA 3C2UA 3KF5A 4AFMA 1AL21 2PHFA 2W1UA 4CRQA 2QQPA 1SDWA 4RR3B 4CDQA 4Y24A 4CDWC 4YM2A 1NA1C 1XPWA 4QQLA 2GN3A 4E8CA 4WVMA 4AVAA 2RDNA 3P3NA 5T55A 5DZEA 2RR13 1Z0HA 1SACA 1LESA 2QZ2A 3E5QA 3K51A 3B94A 3NVCA 1WD4A 4NHMA 4QU1A 3VDDA 4B1LA 5KXCA 1WUVA 3CU7A 1ZX5A 2QCSB 4YM1A 4IV3A 1W0NA 3U07A 4O61A 3U75A 5JSRA 4NHLA 1YFYA 2CHHA 1VBA1 4GA9A 4BWOA 5JXJA 3UKVA 5T52A 4Y5Z0 3TNPB 2X29A 1HXS3 3GNEA 1Q5OA 4IEYA 1MACA 1OOPB 4AGVA 4QX5A 5C9AB 4JGYB 4I0BA 3POSA 4QXCA 5EJ1B 1ZBA1 1JODA 2D6MA 2JB4A 1Q56A 2Z5WA 4GH4B 1JZ7A 3POBA 3VUOA 4FBFA 3WR0A 1OF4A 1Q8VA 4HETA 3ES1A 3ZIWA 1UPSA 3ZYRA 5A6ZA 3NW4A 3HQXA 3DGTA 4C1WA 1K42A 1J3PA 5DZGA 2P6HA 4AHXA 1QQP3 1KITA 1H8TB 2P3YA 5DAPA 2BFUL 1CJDA 3ATGA 1YC61 5FY9A 3TN93 3LOBA 4N43C 4JRLA 1LHWA 3M2MA 4YYOA 4OHWA 4QWNA 2OS2A 2RE9A 1CAVB 1JS9A 3NNMA 3AMNA 4P9YA 5A80A 3RJ2X 1VRH1 3WD5A 4XTPA 1HDKA 4R9DA 3ON7A 2ARCA 4EWEA 1EV11 1QJX2 3H8UA 3AJYA 1UKRA 2I2SA 4Z8BA 1KDKA 3NNLA 3ZXKA 4EWAA 1H1IA 4Q4V2 3ZPYA 2HBUA 1KQRA 5FZEA 1U5ZA 2PFWA 1FNYA 1YQCA 3ZN6B 2XHKA 3H8OA 5F3IA 4XOGA 5FXVA 5JR7B 5BNNB 5CADA 3ZR5A 4L92A 4FTEA 1YIPA 2ZZJA 5A3NA 1K45A 1ASJ3 5FZHA 3F95A 3E1F1 1FX5A 1BYHA 5JXHA 1UD1A 4BQ1A 5L9BA 2JDHA 1OVPA 3CZUA 4KBBA 2XJPA 4RS5A 3ZFFC 4B8EA 4AI1A 4C0BA 1GP4A 3WDUA 4V1PA 2ZGKA 2D6NA 3MBWA 2MEV1 3RI8A 2GMPA 2RR12 1PM7A 2A75A 1G6NA 4Q27A 4Z2WA 1WCUA 1QWRA 3I2DA 4AFDA 5I0RA 3VBOA 4QHZA 3DECA 5G05L 3NNFA 4DQAA 1XYPA 3VBHC 3KS7A 4JQRA 3O1RA 1GOHA 2JG8C 1W6PA 1ZVFA 2WWJA 3ETQA 4MHRA 4IEZA 1NCQA 4DRRA 4FPYA 3T4VA 4Y1XA 3OYWB 5DDJ3 1HXS2 1ZM1A 2IXHA 5E1RA 1W8FA 4XF0A 2XKOA 1QJU1 2DYCA 5DN2A 3EMRA 4XQWA 4QX3A 3BTYA 4PBPA 3H0OA 2BP6A 5L9RA 1W04A 1UMHA 4GWNA 2KXLA 4GH4C 1YWKA 4YW7A 3UJOA 3VZMA 2OZ6A 1PX3A 4OQ9A 5EZWA 1EP0A 3KT1A 4FPOB 4CCDA 5IVEA 3AKTA 4LXLA 3RZMA 2CNAA 3TN92 3W59A 3WNKA 2JDZA 4WM7B 2NZ9A 3USUA 1X9PA 1H4HA 3NL1A 2WNVA 4XILA 3LFIA 4DOUA 1WD3A 4XFGA 1CZVA 4L8QA 1XBFA 1CWPA 4E2GA 4MXVA 1V6JA 3UETA 4CUCA 5AC91 2FDHA 2ZGPA 4CZSA 3RMXA 5FKCA 5JPNB 2WBKA 4DB5A 2RS13 2X5IB 2PQSA 2JDKA 2E7QA 1MEC3 4KG0A 5JOWA 1PO13 1WMEA 1AX0A 5AFBA 4NRQA 3S7IA 5C7GA 4JKKA 4B1MA 4K1YA 4XIOA 5HPOA 1SEFA 2DU0A 4DPNA 1CZTA 5C33A 1CAWA 1FPN1 1G9FA 5JOYA 4YFZA 3O0VA 4RR3A 4I3PA 4A3XA 1LOFC 4MHUA 5J09A 4ZY9A 1ASJ2 1W2TA 1HV0A 1PM4A 3MF6A 3MIFA 4DS0A 2Z4FA 4Q0SA 3KZ4C 1MZ5A 3OPTA 3ZYBA 1H2MA 3D3AA 3PJYA 1GQGA 1F9KA 4DIQA 1CZSA 1JYCA 1UL9A 1Y43B 2A73B 4XF3A 3W58A 4MGTA 4URAA 2LRPA 5DUWA 3O5SA 3ZDSA 1A6CA 2W0XA 1LOEA 1ZNPA 1VBD3 5IUQA 3FLRA 5EYXA 4MZUA 3HPNA 4NROA 4AHZA 3H7YA 5ACA3 3CO2A 2HEVF 2XJTA 4FPGA 3LGRA 1JN2P 4PIXA 4COYA 4AVVA 1PK6C 1OOPA 4MVTA 5C9AA 4JGYA 3MLKA 2CU5A 5DDJ2 1XNCA 4JDOA 4KWUA 1H30A 2EXJA 4YGDA 1W05A 1ALYA 3ACHA 4CP9B 5BNOB 2YROA 2Y33A 1AXZA 5DAWA 2XJQA 2VVEA 2ORZA 1R091 5DAXA 3IM0A 3AP4A 3NJVA 4ZS3A 3JZVA 3LA3A 4FO9A 5FIXA 4DNYA 5FZBA 3ZXEA 1CGPA 1H8TA 2VZQA 3FBMA 5FXXA 3WT3A 4FAHA 1XC6A 2V72A 1C8M3 2JDMA 4XBLA 4J1WA 2Q8DA 2ZGOA 3RPQA 2VQ0A 5BUVA 1N3QA 1CAVA 1Z7S1 1F5JA 2HEYF 4I01A 4QPGC 5C5TA 1KS4A 2AZ5A 5FPVA 4HKWA 5F3EA 1LB2A 3E6BA 2Q8EA 4BU2A 1TE1B 2HWF3 4H2AA 2W2IA 1OA3A 4NVPA 1UYPA 2J1VA 1X82A 2HEWF 3VZNA 4JGZB 4GB33 1ODNA 1H2KA 1GLHA 3CZJA 1YO8A 4PLNA 5JCTA 3T0DA 4K3UA 5FAXA 2RJKA 2ZPXA 1COV1 1MEC2 2CGNA 1MQTB 2WKKA 3ZN6A 3ZYJB 4LHSA 2NP0A 1O3SA 3O0XA 5BNNA 4LKEA 2VZSA 3CJIC 1W99A 2O1QA 3GBWA 2DFCA 2PA7A 2G1MA 5EHDA 1GWKA 1YJLA 2CWSA 1JHNA 2AYHA 4E4ZA 4FQZA 1QJY3 3OUIA 3CMGA 4HZFA 5FZMA 1IS3A 4INDA 4YVSC 2P4EA 4EV0A 2GALA 5EFUA 3U1XA 1MZ6A 2ZHMA 5KHGA 2R6QA 2X53S 1TNRA 1Q8QA 1XB9A 4UT5A 2XBO3 4E2QA 3CLPA 3JQWA 2PAEA 2D97A 2VUDA 4KGGA 4F83A 1S1AA 1VBD2 2PMWB 1XXNA 2ZCWA 3FHQA 4QKDA 1J83A 2HWB3 4LBMA 5FP8A 1UOJA 2RMU3 4MGZE 4HKOA 5ACA2 1IPJA 2PHWA 1W2NA 5JUVA 1IG3A 4PQQA 1STMA 2WFF3 1GZTA 4YGCA 5CFDB 4PT6A 3IPVB 3WP6A 4BCUA 3LF7A 4W6XA 4E4SA 1PZ7A 2XDVA 1VPHA 5C5UA 2DFBA 5JXIA 2B9UA 2AACA 1RUJ1 4XUQA 3VDBA 3SKVA 4N9IA 1TMF1 5F6LB 4C91A 3NMBA 3WDWA 1X8MA 5IK4A 4OUMA 3CBNA 1BVP1 4LQRA 2Y34A 3U11A 5I8TA 3WP4A 4CXXA 4A4AA 1RVF3 3AP6A 2WAOA 1DLCA 4LKFA 4AFCA 1E5IA 3U0ZA 4CCEA 3DXTA 4WM7A 2HWE1 4QX1A 2FMYA 3NV4A 3PUIA 1Z78A 3FL7A 2YU2A 2DTYA 3Q8AA 4Q26A 2VTXA 1DF0A 4M0NA 2RJLA 4U2AA 2VW1A 4OI4A 1TME3 5BY5A 4NOTA 2X5IA 3M3OA 4GB32 5JVVA 1TMF2 1DGRN 4XUOA 4GMP3 3K2OA 3ZXGA 2BPA2 2K0GA 2OPKA 2W87A 5E88A 1KDMA 1MPXA 1F31A 4RSUA 2YHJA 4NE9A 5FPZA 4XUNA 4DXZA 2E9QA 1IZ3A 1RMU3 2WT0A 5LK5A 2HWC3 3T1MA 1QDOA 3TWIA 1AYN3 2HWE2 3PU3A 1BQPA 4PIZA 1O3TA 1IKQA 3HMYA 4C1XA 2JENA 1P8JA 3N7JA 2DU1A 1QJY2 4PI2A 1LOAA 4XZPA 4R52A 5GALA 3W5MA 2ID4A 1QXRA 3BODA 3HJRA 3LDRA 1Q43A 3ZYGA 3ORJA 3HNBM 1MS9A 4FPEA 4CCLA 4AQ2A 1QOOA 4TWTA 1XYOA 1A3KA 1GFF2 3GHNA 5HXVA 4D8MA 1EPZA 4LR4A 4BB3A 2QZ3A 2VMFA 2ZAAA 5I8YA 5KXDA 2JKXA 2XBO2 3S0MA 3O1VA 1AVBA 2MHFA 5GLWA 4FXKB 5FMCA 2ZHLA 3APBA 3MIGA 4LOSA 1H9WA 1QHDA 4IUGA 4P9XA 1JUHA 2RMU2 4PF5A 5CU1A 3RYRA 5ABJB 2AEYA 1HIXA 1UXXX 2HWD3 3WNXA 2DF7A 1UYYA 5BNOA 1D7PM 4CEYB 4CP9A 1JYWA 3M3IA 4IW3A 1FNZA 2RS53 2R043 2CDPA 4HG6B 5JIUA 4IXLA 4E27A 1JH5A 2R073 3VHRA 2VZ1A 4RQPB 1W6NB 2OT7A 4HOOA 3OPWA 5JOZA 2P5BA 2BNOA 2KM2A 3J7MA 1RVF2 1VIWB 3KSCA 4N7IA 3VD7A 1GOGA 4Q4Y1 5FYCA 1X36A 4ZU5A 2EIBA 2JG9C 5FYBA 4XHXA 1W6OB 1GANA 4QQOA 4WVVA 3POYA 4JGZA 4MGIE 3VD9A 4JV4A 1GP5A 1IOAA 4QMAA 5JAXA 4XIKA 4FTBA 4PBOA 1TME2 1S0EA 3D4KA 3VKLA 3ZSJA 4CDUC 3UGGA 2WS91 2FQPA 1W28A 1MQTA 1U12A 2GNTA 2QVSB 3AXDA 5ANNA 5F39A 4CU7A 4V2VA 4EZHA 1O6UA 4QXHA 5T5OA 2WNUB 3WEZA 1WCQA 3ZN4A 1G9CA 3LOIA 4QPIB 1RMU2 2A3XA 2B9VA 1QIQA 2HWC2 3MEPA 3OPZA 1NCRB 2VMEA 5CNAA 3WG1A 3IDEA 1LEDA 1AYN2 1DGWX 1KGYA 1MR5A 1UY4A 4BISA 4NIGA 1ZA7A 5IVFA 3KV6A 4LOTA 5A3OA 4UW5A 4IEUA 3X29B 5A6XA 3T4HB 3ABZA 3KMHA 5C8CB 3WOGA 2VY0A 2Y60A 4AWDA 1GQHA 1H4GA 2BRTA 2VC9A 1A8DA 1RUNA 1ODMA 3M4FA 3AC0A 2C9KA 2WNEA 3MUZ1 1RL3A 2X09A 5FUNA 3PUSA 3WQ1A 3RZGA 2YZ4A 4N53B 5CFDA 4L11A 2AEZA 1OFSA 2TBVA 3IN9A 3IPVA 4L97A 4EWDA 2OKXA 3N9PA 2HWD2 2OPWA 5CAZA 1UF2C 2ZBJA 1FYUA 4KWJA 4W4ZA 5FMOS 1O8SA 4D7YA 3POGA 2JD4A 1TNFA 2RS52 2R042 1NY72 4XFAA 1CAUB 5LRSA 3VDCA 4XJ9A 4DFSA 4FOYA 5I0TA 1IGOA 2W5FA 2V4VA 4HN1A 2R072 3FHAA 1WMFA 4XJUA 1SCSA 1GSLA 4DMIA 1PGL1 5FFOC 3DKWA 3SISA 1XQNA 3JXSA 3VBUB 1C28A 3GBGA 3NJXA 1Q8SA 3OD4A 4XUPA 1POV1 3ACFA 1LGNA 3ZIXA 3RZJA 3KHCA 2Q1MA 1UZYA 1SLBA 5C70A 1W9SA 1GOFA 1JBCA 1V6LA 2XG3A 4UW3A 1PGW2 4P02B 2WUHA 1NZCA 3A22A 1DLLA 1MVEA 1UMIA 2B46X 2EAAA 2G9FA 1K12A 4QDQA 1RUD3 2UYAA 2WZ8A 3AKQA 5FYTA 5HXMA 3M3EA 2J1EA 3DYOA 2AGSA 3B02A 2LROA 4HN0A 3E97A 5BNPC 1PGL2 2BOIA 4Q0QA 3OGJA 4NUBA 4P9WA 3T08A 5F1RA 4LUKA 4AE2A 2W91A 4ZS2A 1QOSA 2R063 2UU8A 3K46A 1JYXA 3EHKA 1JXNA 2DUOA 3CF6E 3I97A 4IV1B 1JOPA 4Y22B 2KR2A 2ZGSA 1VMHA 4A6SA 3HBZA 5A7NA 3N9OA 1R082 4R4ZA 1E57A 4XABA 4FVVA 1MS3A 1UKGA 4IGQA 4QPIC 4H7LA 4XFBA 1OD5A 2V4AA 3IMNA 3OEBA 3B5LB 1AR91 4S2GA 1RYYA 2J1RA 3K48A 4LBQB 4JX0A 1OUSA 3BIEA 4PDWC 4JHTA 4OCTA 2O8QA 2QFEA 5ABJA 2IVJA 3PLQA 2Y6GA 3IAPA 3BTAA 5FZ8A 1IHMA 3SHRA 1N1SA 3EO6A 1LHUA 2J42A 5CB7A 1QH6A 3PVNA 3AFKA 4CEYA 2AH2A 3VL9A 2E7AA 2GH8A 2B8MA 4EN7B 5LY2A 4M3CE 1BCXA 5CVRA 4RN5A 5FK7A 5KC5A 4RQPA 5HI0A 4KQ7A 5FMDA 1BMV2 1W6NA 4Q0PA 4QKNA 5SV5A 2WRAA 4NPLA 2JECA 1WBLA 3AMQA 3THDA 2BV4A 5I0DA 4FPFA 1RUI3 2J22A 1GZCA 4XC9A 4GULA 4QHBA 2J1SA 3FUOA 3RJRA 5KR7A 2ET1A 1W6OA 2YFZA 5LY1A 3ZOIA 1MS8A 1JTZX 3TEYA 2HKXA 1C5HA 3OCPA 4DUWA 4OHYA 1NQJA 1UQXA 1HRV1 1QOTA 3VBSB 3AZVA 4QGNA 4QAWA 4EN8B 4IE4A 1V6KA 3RRDA 2DVAA
chains in the Genus database with same CATH topology
1VBE3 3HD8B 1RUD2 2P3JA 3VZJA 1X8EA 3J8F3 2WNUA 5KWRA 3HIFA 4EN6B 4XJWA 5IK8A 4O9EA 1PIV1 4AF9A 1NCRA 1LU2A 4XQDA 2QDNA 2D3SA 2D98A 3ZSMA 1GNZA 4FP2A 1V6MA 5I0SA 2WQ4A 3QOPA 2WL1A 5F9TA 1HRI1 2K2SA 2VG9A 4XETA 3PJQA 4I2OA 5L7OB 5C8CA 1LOGA 2BYVE 3VBFC 3M70A 2A6ZA 3ZO0B 3BU7A 2VMGA 1ENXA 3NWKA 4AQTA 3NSTA 2GU9A 2ZHNA 1TQ5A 1NXD1 4R9BA 4N53A 1L3JA 2RM21 1PIV2 4I3GA 1VBB3 4L99A 4CDQC 1VR3A 1GR3A 4XFIA 2H0BA 3WDTA 4B29A 2XKPA 2E6VA 3Q9OA 5FQ0B 3AP9A 1REEA 4B7EA 1HRI2 4RHV3 5C4WC 3VDDC 3DL3A 1FOD3 1S0FA 4M3CB 1M06G 1UU4A 4IV3C 1KFXL 5L73A 2ZA9A 3AMMA 4UW4A 2TUNA 2ZGTA 5J96B 1UPIA 3RYKA 3VBUA 1ZYBA 2BQPA 3EXUA 2BBVA 2PHTA 1RUI2 3NAPB 2VOKA 3PVOA 4XJAA 4Y1VA 1D4M1 4LHNA 1O4TA 3JD73 4ONUA 5IT6A 3ZXJA 2GNMA 2I45A 2ZGUA 4LNVA 2XL9A 2E51A 4H14A 1NYWA 1WLTA 4CP0A 4XFCA 2A71A 2YYOA 3USUB 3ENRA 4ASLA 5KXEA 4JDNA 3LZZA 1VAKA 3WCRA 3D0SA 2D6OX 4HKLA 3AFGA 3VHOA 3C3VA 4DY5A 3JB8A 1SLAA 2JICA 3LSEA 4Y22A 4IV1A 1S0JA 1HKDA 3OGGA 3ZXDA 4HK9A 1CAWB 1QMJA 1OKQA 2F6BA 2WC2A 4LBQA 4HVQA 2BWCA 1S0IA 1DQ2A 1NQDA 3WW3A 1YXWA 1VBB2 1RUC3 4RS5C 3VBRB 1DQ5A 4TZDA 1O4YA 2ZS6B 2ETEA 5K7PA 5D8AB 2NMOA 2IC1A 4RHV2 1ZRRA 2PAMA 3OBTA 3S30A 3TYJA 3VBOC 2CV6A 4ZKTB 3MIDA 4YSFA 5K9YA 1PVXA 1QJX1 1C1LA 3ZYIB 1WW4A 2C9AA 3J26N 5KXBA 1NCQC 4Q4V1 2XUMA 3N36A 1WGPA 3PVBB 3OTFA 3I7DA 1VALA 3TAYA 2A70A 4GIQA 2GDFA 3VBSA 1MS5A 1I1EA 2R16A 4L9BA 1RJ7A 4F7ZA 4YW5A 1WLCA 3B9IA 4D7SA 3QCWA 2AREA 4YFWA 4K9SA 1ENRA 2RR11 4YM3A 4Q4X3 2I07B 3B9CA 3I59B 1FV2A 2VMHA 2WNVC 1GZWB 5KHJA 5LRRA 1RUE3 1SCRA 5L7OA 3MYXA 4EROA 1CIWA 2ZX0A 1NE4A 5B2GB 4RGAA 3ZSLA 1RIRA 3KCCA 2IWGB 2ZGLA 1HXS1 2PYTA 3KCXA 1YLLA 4YVWB 4RR3C 1RUG3 2A5ZA 1OQEA 2QUOA 5FQ0A 1QQP1 1RUC2 3M7AA 3TN91 1DZTA 3WDYA 4LULA 1HV1A 4M3CA 3M3QA 1XE7A 3GZTB 4Q1RA 4D7TA 4Z92B 4IEXA 4LLOA 4XMAA 2AENA 3ZMOA 4AYUA 4LA3A 3U4XA 3NAPA 2VXRA 2BNMA 1BEV3 3H3ZA 3TRSB 1OOPC 2YDEA 2VMIA 5C9AC 5CBLA 4JGYC 1JYIA 2RS33 4XPVA 4NPRA 5FRAA 4JDMA 2YY1A 5FMOL 2ATFA 2YMZA 1B09A 1HQNA 2D3RA 4K20A 1QQP2 4ES8A 1BBT3 1ZBE3 1SFYA 4Q8LA 1LJ7A 1ASJ1 3BALA 3VGIA 1NOVA 1H8TC 3MLJA 3CNAA 5FLIA 1MS1A 2GMMA 1O91A 2R1BA 2AUYA 1NG0A 2ES3A 5IK5A 4E2SA 1J1TA 4Q4X2 1ZREA 1LHVA 5T54A 1IPKA 4FPJA 1RUE2 3THPA 3LA7A 4U36A 4YARA 4NHKA 5DDJ1 2GN7A 3BOPA 3MIBA 3ZFEB 4HVRA 2JX9A 3R4SA 4NWVA 4YW4A 2OUJA 5BNNC 2BEOA 5J3UA 1YJKA 4TSVA 1GICA 4LEJA 4COVA 4AQ6A 4D69A 4PLMA 1RUG2 4I0AA 3SH4A 4HL0A 3VBRA 1AX2A 2LUWA 2PLV3 2XGXA 5D8AA 3A0NA 4G3YC 3EBRA 5C8WA 2IXJA 3ZXLA 1QNWA 1PO23 4P5HA 2XJVA 1AL0G 4WBBA 2D6PA 1R1A3 1YFUA 1LULA 3PHMA 4K6BA 4S2FA 1BEV2 5A3MA 2RS11 5JI7A 1OQ1A 1MEC1 2XVKA 1PO11 2RS32 1H2NA 5HCFA 3BIWE 2ZTNA 5CIRA 1WA4A 4H7MA 4TLFA 5KHHA 2PHXA 1DDLA 1BBT2 1K5MB 1RUF3 1ZBE2 1QKQA 2NN8A 1OHFA 2QJVA 1SBDA 2ARBA 1WLWA 1AR83 2VVFA 2ZZQA 2YGMA 4WM7C 1YI9A 4UBGA 3I59A 4P9GA 4P14A 2V5YA 1GZWA 2K9ZA 3O7OA 1VAVA 2RS12 3H1MA 4K40A 1VBD1 4WM8B 5AFEA 4AVBA 1YNAA 3O0WA 3J4UH 1PO12 5ACA1 4XHBA 2EALA 1N3PA 2X5IC 5EWSA 1OLQA 3PNAA 5EJ3A 1CJPA 1PVC3 3BPZA 3FLTA 4UW6A 1GNHA 3AB0A 5DUUA 4Q29A 4YVWA 2B5HA 3MFAA 3GZUC 1AF9A 3MIHA 4META 4C0HA 1CX4A 3EQEA 1FMD3 5FBZA 4LO8A 4O9GA 3NKGA 1ZRCA 1AJKA 3WHUA 1LCLA 5BXXA 1S2KA 2EAKA 4AK3A 1I6XA 5A3LA 4AEDB 1C8M1 5F6KA 1RTVA 3LA2A 1WBFA 2NYYA 2ZKLA 1PO22 1YUDA 4AFAA 2XPJA 4Q0UA 3OBRA 1MS0A 1Y3TA 2HWF1 2IXIA 4GB31 3DN7A 4J1XA 2H0VA 4IEPA 1LRHA 1CESA 3QBQA 1DU3D 2UY9A 5LEKA 4FPCA 1UX6A 2XB6C 2WLPA 3LSDA 3G6JB 1LHOA 4YW2A 5BNOC 2I74A 2JE7A 4XFHA 1EAH3 5FDBA 4IQPA 3JUUA 4LT5A 4AVCA 2ZGMA 3H3UA 2G4IA 1C8M2 4FPHA 1W2UA 2EXHA 1RUF2 4IEOA 2XLFA 2D40A 3WP5A 2IFRA 3HT1A 1QJY1 2XLGA 3B3QE 2BNNA 3RZZA 5IK7A 2HWF2 2VOVA 2R0FA 1V9U3 2UWAA 1O5UA 4FCAA 4BA6A 1J1LA 4LUMA 2GAUA 2WSVA 1Y7BA 4IEVA 2XBO1 3OY8B 4ISRA 2Z79A 2ILMA 1ND2B 4JGZC 1UIKA 3MFCA 2MPFA 1AYM3 2HWB1 2RMU1 2O0OA 4K1ZA 3O14A 1O4ZA 3ZFEA 3DPRB 4D3WA 2WFF1 1MQTC 2IFWA 1WCKA 1LODA 4R9AA 4COUA 5F5QA 1CD3G 3VKNA 1PVC2 5GM0A 4QQ2A 3V64A 2C5DA 4S2HA 1GBGA 1IQAA 3POWA 2UYBA 3NJZA 2IZWA 4JTOA 1ZZ8A 1W0OA 1FMD2 1ENSA 5H9RA 2NM1A 4PJYA 4AI8A 1RVF1 4GQ7A 4KG8A 3MPBA 2E53A 3HAGA 2HWB2 2R30A 3FBYA 3NV1A 1OPMA 4CEWB 2VUJA 4AVTA 2WFF2 3IDBB 4C90A 4SBVA 1D0HA 2Q0AA 3URFA 1XYNA 4FP3A 1TME1 3WG4A 3NKTA 5CFDC 3SCGA 2VPVA 4WZFA 4GMP1 4F8AA 2SBAA 1FV3A 4QD2A 1EAH2 1K5MA 3QACA 1RMU1 4JAAA 4NR1A 2HWC1 2E7TA 2Q1ZB 4M00A 1AYN1 1AR63 3IIAA 1PHMA 3VZOA 3VKMA 1XU2A 2G9GA 4NWWA 3PTYA 3RS6A 3KM5A 1V9U2 3E5XA 4MXWB 4PCRA 1Y9QA 2PHRA 5CFCB 4WM8A 3VHPA 4QM9A 1B35B 2DVGA 3QH7A 3AKPA 1SLLA 1QH7A 1AYM2 4Q4W3 5AVAA 4XXPA 2HWD1 4AHYA 1S0CA 1RC6A 3H9AA 4XW3A 1A8MA 1O5LA 3V56A 2RS51 2R041 1NY71 3WQ0A 1OLRA 1DBNA 1ULDA 3R05A 1W0PA 2A6XA 1N1VA 2R071 1XRUA 3FZ3A 5K0UB 2XJRA 2AR6A 1PNFA 3JQXA 4AEDA 4LE3A 4ATEA 3FWEA 2Y0IA 2LALA 4FT8A 3WDXA 4AW7A 1NLRA 3JBG3 3L9JT 5D1IA 3AYAA 3B01A 2PAKA 1PGW1 4LO6B 2ZHKA 4XE9A 4CTEA 2ZKNA 4XQ4A 5ABJC 1H1MA 1FT9A 4K8FA 1SFNA 3JB4C 3R6SA 4BLIA 4CEYC 2HYKA 2D44A 3E6DA 4CP1A 3HWJA 1F2NA 5C6CA 3NO8A 3QH6A 3WHTA 4RQPC 2NLRA 1R1ZA 4BLJA 2JKBA 4OI1A 1N1TA 4X8NA 1R081 4CDXB 2WZR3 2ZABA 4I02A 3VZLA 3V0AB 2PHUA 4RD7A 3M3CA 1G7YA 2GH2A 4OVEA 3MF9A 1U5XA 4HLTA 1MVQA 3OY8A 2YC0A 2D93A 1ND2A 2OA2A 5JZGB 2R0HA 3ZVXA 2H6CA 1ULEA 2Q8OA 3D5OA 1ND3B 1RUH3 2QE3A 3DPRA 2GMEA 4IEWA 2GC2A 4Q4W2 4AI0A 3PMSA 4YNIA 2WNUC 4Y1ZA 3BB6A 2SLIA 1WW7A 3ST7A 4QT6A 2NMNA 5CA6A 1ZZ9A 4XXAA 1NCRC 4YG3A 4M0HA 4HANA 1BMV1 1YYNA 4KWKA 2TNFA 3RWNA 2DVDA 5C8CC 1C57A 2WT1A 1BXHA 3LB9A 4CEWA 4M01A 3H7JA 3I4IA 4JVAA 3JBG2 4EN9B 3ZFGB 4QQHA 2BWAA 4DRVA 2Z69A 4N53C 2C0ZA 4AQSA 1RUD1 4FAGA 1QJZA 1RGSA 4EN0A 3WDVA 1CAXB 1BK1A 2P3IA 1YCIA 4WV8A 3T2TA 3M8LA 3A0KA 3SH5A 3KD4A 3ALQA 3ROUA 4XF1A 2YPJA 4MGKE 3SMHA 2DVBA 2R061 4B3NA 2A6WA 3VBUC 4KNCA 1REDA 1FAYA 4MXWA 2WZR2 5JMCA 3ZYPA 1DYKA 1SBFA 3MLLA 3QLQA 5CFCA 2QKDA 3RMYA 3V65A 2WZPP 1DIWA 3DF0A 1B35A 2W52A 1POV0 3JCIA 2P17A 5JIAA 1XU1A 2E63A 2Q4SA 2A7AA 4W6YA 2W68A 2XWJB 1RHI3 4YG6A 3WZ1A 1QU0A 1PMIA 3AMPA 4AG4A 1RB8G 4LBKA 1RUH2 5GLTA 1VBC3 2UWCA 2R062 3N7KA 3ZSKA 3ELNA 3IT8A 3AK0A 2ZX3A 1O7FA 4FXGB 4Z1VA 1G9DA 1Q8PA 4ORFA 1PZ9A 4GALA 4YZ2A 1UU6A 4XYXA 5K0UA 1D2QA 4IV1C 3R4DB 3BOWA 5J7MA 3THTA 2ZGQA 2V09A 1RUI1 4JC1A 5TSWA 1I5ZA 3WXPA 2HJIA 3AZXA 2DCKA 4X6RB 3D8CA 4CDWB 4LE4A 1NA1B 3I54A 1I3HA 1DG6A 1UCXA 5J48A 3CJXA 4OULA 1O3QA 1VBE1 1F8VA 2ET7A 2DCTA 5JLVA 1AR73 3J8F1 3MGUA 1JOJA 5EYYA 5AVPA 2ZOEB 1KJLA 3GZAA 2PHDA 3D6EA 2WIIB 2XVGA 3VHNA 1LKNA 4ZXKA 5SV8A 3ZMNA 4CDXA 3WLUA 4YGBA 3AP5A 3RI9A 3DV8A 3ZXFA 3V0AA 2B39A 4E4DX 1DFQA 1AL23 3UJQA 4YM0A 3D82A 4AGGA 5BNQA 1VBE2 5T5LA 2ZX1A 2WFPA 4Y26A 5JZGA 4P9IA 3VBSC 1OSGA 1H9PA 1W6MB 4H55A 3J8F2 3ES4A 2PN5A 1DQ1A 4DZGA 1ND3A 1QXJA 3OJBA 2VQAA 1H8VA 2ZGNA 1RHI2 4N43B 1AXYA 2TEPA 1VBB1 3KLSA 1VBC2 2DCYA 2CL2A 3LAGA 4MV2A 1VBA3 1IS6A 4RHV1 3WUDA 4YLZA 3TB0A 3L2HA 4LBOA 1FOD1 1HQWA 1FXZA 3R4UA 1ZBA3 4P9LA 3A4UA 5L7OC 4KH9A 1G9BA 4AGRA 4I30A 4S2DA 4XEZA 4EJRA 3TOJA 3ZFGA 4GKYA 4PQ9A 4YW1A 2GSYA 1OMIA 2VVDA 3JD71 3KCYA 2D3PA 3ZFFB 4A2UA 3AM2A 1CAXA 1VB4A 1FOD2 1G86A 1VRH3 3JU9A 2CY6A 2QDRA 1QY4A 2PQQA 1AR72 2OUHA 5DUXA 5J98B 3VBHB 1ZA4A 1EV13 3FHIB 2JG8B 1SMVA 2X8KA 2PTMA 4YZ5A 1C4RA 1XNDA 2EA7A 2FHRA 1D4VB 2D43A 2P37A 3WW2A 1REFA 1YFXA 3JD72 3NAPC 4FOWA 4RA0A 5JWPA 2DWRA 1AL22 4CP2A 2WLQA 4JTNA 1KS5A 1V00A 2MNGA 2VNOA 3FX3A 4MLOA 3VLBB 2MEV3 2XWBB 3RQ0A 4ATFA 1RUC1 3B7MA 2BW8A 4N90A 4ES9A 1VBA2 3UK9A 2OYZA 4FOVA 1PNGA 1ZZ6A 1HLCA 2FZ2A 4AEKA 5C4WA 3WUCA 4LLFA 1ZBA2 3GALA 1QJU3 3SCFA 1AJOA 4LBJA 1UMZA 2BTVC 4BMBA 5FO9B 1JUIA 1UIJA 4CDWA 3H50A 5GLVA 1NA1A 1QGLA 1EYBA 4LHLA 1DQ4A 2WSUA 3WCSA 3WINE 3MDPA 4MX3A 4UBHA 4OHXA 5HCBA 3VBRC 2PELA 2VULA 1KFUL 3GHMA 3SNMA 3D0JA 2EXIA 1VRH2 5D8AC 3MPPG 1ZRDA 5AC93 4X6QB 2PHLA 5FREA 1EV12 3RSJA 4A7KA 4Q4X1 3UKNA 1PK6B 1DGRA 1RUE1 2VW2A 4HVOA 3USSA 2Y38A 1V70A 1C8NA 5GLZA 1DHKB 2VOWA 2JJ6A 1J58A 1FPN3 4R4XA 4HT1T 1D0GA 2C1FA 4MGYE 1JW6A 2O8OA 1W6MA 4QGMA 3UV9A 4AFBA 4N43A 4QGLA 1S0BA 3OF1A 1RUG1 4LO7A 4BOWA 4AI2A 1DQ0A 2MEV2 1LOBA 2H6BA 2WQZC 2GC3A 5I0UA 2VH9A 4HPKB 4QPGB 4COZA 1SQ4A 1LR5A 4G4FA 3MZHA 5FLHA 3SH3A 1T6GC 5EV7A 1WW6A 5FO8B 5K8SA 4GXLA 1AHSA 1QJU2 2YUEA 4OFGA 2B42B 1IS5A 1DGLA 3T1LA 1BEV1 3CJIB 1R093 1ULCA 3GF6A 5GZFA 2ZJCA 1APNA 2RS31 4D94A 1WMDA 2KA3A 4URTA 3UKTA 3ZFFA 1O3RA 1ENQA 4LO5B 4LHKA 2OVUA 2D6KA 4IL7A 4YVWC 2ERFA 1BBT1 1W39A 1KRIA 1ZBE1 4L2NA 4YVSB 1Z7S3 5T3NA 1SLIA 3J9SA 3AMHA 3VBHA 5J36A 2FBEA 1BJQA 2DVFA 4GWMA 1XNBA 2JG8A 3TNQA 5AC92 4A7ZA 1OA4A 4QU2A 3O12A 4DINB 4OHVA 1CVNA 1MZEA 1DZQA 1COV3 4F3JA 1GV9A 3FFZA 4XFFA 5DZFA 2ARXA 1FPN2 1S2BA 1UW8A 2WWSA 2R1DA 5JSPA 5GLUA 4XBQA 4N9HA 4E9KA 4GH4A 5GZCA 1CR7A 2UWBA 4P9JA 2ZMNA 4RL7A 3MI8A 3VN4A 4IERA 1EY2A 4WVWA 5GZGA 4J6GA 2ZX2A 4Q8KA 2R32A 3L2YA 2QNKA 4N7UA 2DV9A 2PLV1 4AVSA 3VL8A 3ASIA 4ZU4A 5KBFA 5JI9A 1XE8A 3LKJA 1PO21 3VV1A 2NPIA 1URXA 3WG3A 1WLDA 1R1A1 4HK8A 1F5FA 2EVXA 1UZZA 1N47A 4QXKA 2DCZA 1BKZA 1RUJ3 2A6VA 1DQ6A 3AZZA 1TMF3 1VP6A 5GKAC 1S0GA 1PZ8A 2JEMA 3WW1A 1LOFA 3ZFEC 1R092 3FC0A 3B93A 4B4RA 2PLV2 3FJSA 3SITA 2IXCA 2YGLA 4UXAA 5BPXA 4AEJA 2ZMKA 2GNBA 4LBQD 4JCKA 2HWE3 1RUF1 3ME2A 2CAUA 4AI3A 1Z7S2 1CONA 2VW0A 1AR81 1R1A2 4XDQA 2P3KA 1PK6A 2XVLA 2ZAHA 4Z07A 2V73A 3WG2A 4IEQA 5GZDA 1COV2 1RJ8A 2P2KA 3AKRA 2D7FA 2Y26A 5GZEA 3OYWA 4AEMA 5FPXA 5HBAA 4HFSA 1D2SA 1PVC1 1UN1A 4BHPA 2B45X 1AR82 5CG8A 1MS4A 1K5MC 1X33A 4ITCA 4FSJA 4FPLA 4HPKA 1FMD1 4QPGA 2OW4A 2JG9B 2YV8A 1WW5A 4QPYA 3V0BB 5H9PA 3IKWA 3ACLA 1U5YA 2DCJA 1ZZCA 2DURA 1OFNA 4XJZA 2VNRA 4K21A 4CDUB 4OLLA 1ZZBA 4WM8C 4CYDA 4ISQA 1CPMA 1H1AA 1CPNA 3NV3A 4WZCA 1LOCA 3CJIA 4IETA 1RUJ2 3PMEA 3AX4A 3MICA 3FMGA 5DXDA 4BMEA 1BVVA 2VOXA 1EAH1 2ZACA 4YVSA 1AUYA 3ECQA 1FI2A 1UU5A 2A3YA 2XJUA 4KU8A 3WW4A 4Q4Y3 4Y20B 3ILNA 3ZSEA 2GNDA 3AKSA 2W39A 4BIOA 3N7LA 4HSJA 4AEDC 3FLPA 5HCAA 1ONAA 1NE6A 1V9U1 2Y0OA 4QQPA 2Q5TA 3SLIA 4B4PA 4XMIA 2XH6A 2ZMLA 4YG0A 1J3QA 2WS93 3W9AA 3PVEA 1DZRA 3INAA 4AHWA 5JPMB 3MW4A 3B69A 3OD0A 4IESA 5T5JA 2CGOA 3KT4A 2LTNA 1AYM1 4Y1YA 1RITA 1J3RA 2YXSA 4HSLA 3KT7A 4M3CF 4R9CA 2BGCA 5T5PA 4RGGA 3WY6A 2BFUS 2BVBA 3TBDA 1H2LA 4FOQA 4TYSA 5KC6A 5H9SA 3I8TA 1N1YA 4YZ3A 2WINB 3ILRA 1ULFA 4XTMA 1IS4A 5E16A 3QD6A 3RNSA 5KHIA 1MZFA 4XF9A 2XJSA 3HT2A 5EXOA 5KHKA 3M1HA 1ND2C 1XNKA 4MH0E 4OUSA 3AP7A 1HW5A 5JOXA 4KWLA 1X50A 4YW3A 5BNPB 1OPOA 4LBNA 1ULGA 3DPRC 2ENRA 2FMDA 4G9SB 3H1YA 2UURA 5L19A 5E8AA 4Z82A 1V6IA 1LGBA 1POV3 3CEWA 2RHPA 1LENA 1U5IA 4Q4Y2 2XLAA 3LWCA 4NO4A 1AR61 2R49A 2ZGRA 4Y4YA 1R083 2GC0A 4MYEA 4DY3A 4B7KA 4PDWB 2EXKA 3HR9A 5I93A 4CEWC 2EF6A 3MIEA 3KGLA 1LU1A 4BH9A 5CG9A 2D5HA 4X8PA 2WS92 5FOBB 1TEIA 2DTWA 4GKXA 3R0RA 3KQRA 2B7YA 4Y1UA 2DUQA 1AZDA 1LGCA 3WV6A 2BUKA 4YGEA 1KXGA 4Q4W1 2WA3A 4H3WA 4XBNA 1RINA 5JSOA 1AR62 3WVJA 3LCPA 1OQDA 4GMP0 3N4MA 1C1FA 3IWZA 3N7MA 1VB2A 1AXKA 1KD7A 1AR93 1GKBA 2WT2A 3VKOA 2JG9A 2NQYA 4XF4A 3V0BA 1GYKA 1OA2A 1YI7A 1FATA 4BIFA 5J37A 1YFWA 4CDUA 5CFCC 1W6QB 4BYYA 4BZ4A 3JBG1 1HX6A 3ZN5A 1B35C 5A32B 1RUOA 5DG2A 3SCHA 3HN1A 2A3WA 1M4WA 5L36A 1G9AA 4B4QA 1CN1A 2VGDA 5A33B 1IKPA 4YRDA 3AXEA 4R8HA 1CQ9A 1QDCA 2EIGA 3AZYA 1SBEA 1SLCA 1H0BA 4Y20A 1OI6A 2DUPA 2OZJA 3VBFB 3WP3A 4PLOA 2W08A 5K0UC 4LO4B 1HQLA 1GZ9A 1LTEA 3EJKA 3WQ7A 3S7EA 5T50A 1HRV3 2WZR1 1DYPA 1I9RA 3N35A 1SLTA 2Z2SB 4KL1A 2JXAA 5DG1A 5DUVA 4CDQB 1G8WA 2VNGA 3KB5A 5GJ6A 1X7NA 4WVMB 5FO7B 1WCSA 3B00A 3MW3A 3RDIA 1PIV3 1RUH1 2F4PA 3VDDB 5C4WB 3AYCA 4MSVA 4I0WB 1QNYA 4IV3B 2VUAA 1HRI3 4LBLA 2CGPA 3ZX7A 3AJZA 2A6YA 5FOJB 1AR92 1Q3EA 4MUVA 4CDXC 4FPKA 5JDBA 3FFQA 1V6NA 2UY8A 4BM8A 5BYNA 3H1WA 1VJ2A 3VZKA 3WX5A 1BZWA 5LEJA 1UAIA 2RM23 4LA2A 1ZRFA 5E89A 4AXOA 2XL7A 5JZGC 3NV2A 1YHFA 3GBFA 4OHZA 5BNPA 3AYEA 3U10A 1ND3C 1NXMA 1KJRA 2IXLA 2CYFA 1U0AA 1YIFA 2D6LX 3VKFC 5H9QA 2JE9A 3AYDA 3UL2A 3P3PA 4Q0VA 4FTSA 1VLNA 4QPIA 1N3OA 3KGZA 1LHNA 1LEMA 4W6WA 4ZU7A 1S0DA 4ASMB 1Q8OA 4NN0A 1D4M3 2CAVA 1WCDJ 4RFT0 3IBMA 1DGWA 1V6OA 4PDWA 3SXWA 4W65A 2WA4A 3E5UA 2P34A 1HRV2 4COWA 2Z42A 2IXKA 2GZWA 5I91A 1PGSA 1YRZA 3BCWA 3ZFGC 1C3HA 3AZWA 4RS5B 2ZX4A 5FCCA 5FTTC 2LM3A 1ZZ7A 2CWMA 3N3HA 4OI0A 1RHI1 2N7GA 1QXPA 2BVVA 4FQ4A 1C5IA 1VBC1 2D5FA 4YZ4A 3CL1A 5BV6A 3VBOB 3ZXAC 1A78A 4A7YA 1AX1A 1CAUA 1W6PB 4HBNA 1NCQB 3MW2A 4BPZA 3RYPA 5FLJA 1NLSA 4HMZA 4BE3A 4Q2FA 4QM8A 4WVZA 4KU7A 3G7DA 1QF3A 3GYDA 4OI2A 1W6QA 2CTVA 4Q1PA 2RM22 4JRAA 3RG0A 5LK7B 3E6CC 4XJ8A 3FE5A 5A32A 2Q30A 4SLIA 4OZXA 4K7JA 2VU9A 1EPWA 4I09A 3S6PA 1J59A 4LTAA 3ILFA 5A33A 2WJSA 2FZ1A 4PIYA 2WNVB 1AR71 3FUQA 1QJX3 3DUIA 3VBFA 4Q4V3 1LECA 1S55A 1VAMA 2OIIA 2GC1A 2VECA 1D4M2 3IDCB 4KGQA 5I8SA 3C2UA 4AFMA 1AL21 2PHFA 4CRQA 2QQPA 1SDWA 4RR3B 4CDQA 4Y24A 4CDWC 4YM2A 1NA1C 4QQLA 2GN3A 4WVMA 4AVAA 3P3NA 5T55A 5DZEA 2RR13 1Z0HA 1SACA 1LESA 2QZ2A 3E5QA 3K51A 3B94A 3NVCA 1WD4A 4NHMA 3VDDA 5KXCA 1WUVA 3CU7A 1ZX5A 2QCSB 4YM1A 4IV3A 3U07A 5JSRA 4NHLA 1YFYA 4BWOA 1VBA1 4GA9A 3UKVA 5T52A 4Y5Z0 3TNPB 2X29A 1HXS3 3GNEA 1Q5OA 4IEYA 1MACA 1OOPB 4AGVA 4QX5A 5C9AB 4JGYB 4I0BA 3POSA 1ZBA1 2D6MA 2Z5WA 4GH4B 1Q56A 3VUOA 4FBFA 3WR0A 1Q8VA 4HETA 3ES1A 3ZIWA 1UPSA 3ZYRA 3NW4A 3HQXA 3DGTA 4C1WA 1J3PA 5DZGA 4AHXA 1QQP3 1KITA 1H8TB 2BFUL 1CJDA 3ATGA 3TN93 3LOBA 4N43C 4JRLA 1LHWA 3M2MA 4YYOA 4OHWA 2RE9A 1CAVB 4P9YA 3AMNA 3RJ2X 1VRH1 3WD5A 4XTPA 1HDKA 4R9DA 4EWEA 1EV11 1QJX2 3H8UA 3AJYA 1UKRA 2I2SA 4Z8BA 1KDKA 3ZXKA 4EWAA 1H1IA 4Q4V2 3ZPYA 1KQRA 1U5ZA 2PFWA 1FNYA 3ZN6B 2XHKA 4XOGA 5JR7B 5BNNB 5CADA 4L92A 4FTEA 1YIPA 2ZZJA 1ASJ3 1FX5A 1BYHA 1UD1A 4BQ1A 4KBBA 4RS5A 2XJPA 3ZFFC 4B8EA 4AI1A 4C0BA 3WDUA 4V1PA 2ZGKA 2D6NA 2MEV1 3RI8A 2GMPA 2RR12 1PM7A 2A75A 1G6NA 4Q27A 4Z2WA 1QWRA 3I2DA 4AFDA 5I0RA 3VBOA 4DQAA 1XYPA 3VBHC 3KS7A 4JQRA 2JG8C 1W6PA 1ZVFA 3ETQA 4IEZA 1NCQA 4DRRA 4FPYA 4Y1XA 3OYWB 5DDJ3 1HXS2 1ZM1A 2IXHA 5E1RA 4XF0A 2XKOA 1QJU1 2DYCA 4XQWA 4PBPA 3H0OA 3VZMA 4GWNA 2KXLA 4GH4C 1YWKA 3UJOA 2OZ6A 5EZWA 1EP0A 3KT1A 4FPOB 3AKTA 2CNAA 3TN92