5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
molecule keywords Subtilase SubHal from Bacillus halmapalus
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
1SBNE 2E1PA 3A3NA 1BE8A 1MEEA 1GTJ1 1AH2A 2W2OA 3GT4A 4FONA 2Z2YA 1CSEE 4ZOQI 1WMFA 4LVOA 5JMOA 1SIUA 1TM3E 2XVLA 1T1EA 5SICE 1AU9A 2Z2ZA 4KPGA 1JEAA 3DE4X 4NE9A 2X8JA 5AMXA 2IY9A 2ID4A 3BOWA 3TI9A 3LXUX 1BFKA 1VSBA 3F7OA 3AFGA 3F49S 2Z57A 1YU6A 1HT3A 3CO0S 1NQDA 5AVJA 1KDVA 2ID8A 2DP4E 2IXTA 4DWWA 1TM7E 1NDQA 3DVQX 1CNMA 4H6XA 1KE2A 1BFUA 1MPTA 5I9SA 3F7MA 3P5BA 1SELA 2XVGA 1Y3FE 1ZVKA 1KFXL 4MZDA 1GA1A 3QFHA 2QFEA 3I37X 1PEKE 3AJ9A 3QTLA 5JXJA 1DUIA 3DW1X 1SH7A 3GCXA 2ZWOA 3Q40A 4KG7A 1SIOA 3DE0X 1S02A 1YJCA 3DWEX 4DY5A 3CNQS 4I0WB 2DQKA 5AQEA 1ZVJA 1UBNA 5K7SA 4DZGA 1BJRE 1BE6A 4DY3A 1Y3CE 4B5LA 4M1ZA 1TM1E 5ARCA 1Q5PA 4LVNA 3DVSX 2LUWA 4Z2AA 2SECE 1SUPA 4DJ5X 1Y9ZA 3GT3A 4OMCA 4CFYA 1TMGE 1S2NA 4WOBA 4OV6B 3VTAA 4HPKA 2GKOA 1P7WA 2DUJA 4I3GA 1EGQA 3A3PA 2SNIE 2V8BA 2PQ2A 1PFGA 3DE7X 5FFNA 1Y4AE 1T1IA 1PTKA 1LW6E 1C9JA 3H42B 1C9MA 1YJAA 3LPAA 1Y4DE 1GTG1 3BPSA 3EIFA 1SCNE 1WMDA 3DE2X 4KB5A 5B1EA 2O8OA 4OMDA 3WHIA 3OSZA 3LPCA 3GCWA 1OT5A 1GNVA 1SUAA 3DE1X 1C3LA 4AKTA 5JXHA 2Z56A 3TI7A 1AVTA 2P4EA 3WQBA 2ZWPA 1R64A 4K8RB 1SN7A 3I30X 4AKSA 1Y1KE 2WV7A 5FBZA 2PWBA 1SCDA 1C9NA 3DE5X 1AK9A 1Y48E 1T1GA 2ZRQA 4DZTA 1U5IA 1AF4A 3I2YX 3BGOS 3Q5GA 1AQNA 3ZXXA 1SCBA 1NLUA 4J94A 4C3VA 1YJBA 1DF0A 1KDYA 3VSBA 1SBCA 1KDZA 3TECE 4NMXB 3PTLA 3D9QX 1V6CA 1WSDA 4CG0A 4DXZA 3T41A 4G9SB 1TM5E 2XTJA 2W2NA 1PJ8A 1AV7A 1DBIA 3L1KA 1SCJA 1SUBA 3DF0A 1SPBS 2B6NA 3HJRA 3DYBA 4H6VA 3UNXA 1BH6A 2X8JB 3DVRX 1THMA 1IAVA 2W2MA 1GCIA 1Y3DE 1V5IA 1P8JA 3VV3A 3DE3X 1SVNA 1TO1E 2WUWE 1TECE 5JXGA 1SCAA 4H6WA 3I34X 4JP8A 1NQJA 1SIBE 1GA4A 1S01A 2Z58A 2ST1A 4HVLA 3WIUA 1EA7A 1ST2A 1TM4E 3ZXYA 1OYVA 2QTWB 2SICE 2G4VA 3DDZX 4GI3A 3EDYA 2HPZA 1GA6A 5CW1A 1SUDA 2WUVA 3A3OA 3LPDA 1NDUA 5SV5A 1WVMA 3VYVA 1KFUL 1SUCA 5ARDA 4HX2A 3AJ8A 2WWTA 2XVKA 2W2QA 5FAXA 2Z2XA 3VHQA 1IC6A 2PMWB 1TK2A 1Y33E 2PWAA 5JXIA 1GNSA 1KE1A 5AVKA 3WIVA 1A2QA 3QMPA 3SQOA 2XRMA 1SBHA 3VV2A 4CFZA 4C3UA 1GT91 3JQWA 1SBTA 2HD4A 3DE6X 1P7VA 4YN3A 2PKCA 4BWGA 3PRKE 1ST3A 5B1DA 2SBTA 1SUEA 1OYOA 4RYDA 1WMEA 1GTL1 1QXPA 2PYZA 5ARBA 4NE7A 3JQXA 3DW3X 1R0RE 3EE6A 2Z30A 2W2PA 1SBIA 4WOCA 4ZARA 2TECE 1Y3BE 3SICE 1R6VA 3D43A 1TO2E 2PRKA 1XF1A 1Y34E 3BX1A 4HPKB
chains in the Genus database with same CATH superfamily
5CA0B 2OO5A 4RSUA 3I32A 4OM8A 1H1MA 2O5EA 3I97A 4JAVC 5C2JB 3U39A 1YB1A 2C92A 3B5EA 4RIHA 1L5OA 4N7MA 1KFKB 4F96A 2CVPA 4QXBA 1EUYA 4IEOA 1COV3 5AOAA 3SIXA 5GOTA 4YIKA 3VBCA 4FFWA 2VCHA 2PX5A 3MJRA 2J7KA 1P60A 2X6RA 3D0KA 1GZWA 5TT0A 4N43B 4Q3DA 3HDTA 1T36B 2VQ3A 3W2TA 1K7FB 1TM7E 3OX3A 3ABZA 3ZMOA 1Y9GA 1U8AA 2NWQA 5EZ6B 2PD4A 3H3JA 2M6LA 1YQWA 4FFBA 4DR5B 4PCAA 1YNOA 3EHEA 1V8PA 1MU0A 4ZAFA 1QH1A 2J87A 5CU7A 1JS1X 2AUNA 4G1BA 5IJAA 1PFKA 4JUCA 1XJ5A 1U3DA 4YR7A 1R0LA 1YD7A 4GU5A 1UP7A 4LHSA 1SG9A 3M9XA 2V1UA 3WB0A 2X5OA 4OJQA 3ZN4A 5G02A 1FP4B 2W83A 4REQB 2RGWA 1I4TD 4L99A 2R8ZA 3CDZB 1DZ3A 5EIEA 4UAVA 4F46A 5KUTA 5ALOA 3MJSA 4XJZA 2H7CA 2UYQA 3UJHA 1M83A 1MRNA 2JZNA 4TL6A 5EIYB 4LORA 4RF4A 1KQFA 2HWF2 4AJHA 3VBOC 4YEDA 3MHPA 3SYNA 5GLZA 4E6EA 2HKXA 1Z0UA 2EIDA 3CRMA 1P72A 3E5RA 3V3KA 2VDWB 5AHOA 1LLFA 3AOEC 2R86A 2JD0A 3F4LA 4L3OA 3AV0B 3EXHA 4ZZIA 5KSPA 1E2HA 5DYIA 2B35A 3OJEA 1LDGA 1XU7A 3DONA 4C7VA 4RKWA 3EQ7A 2P9JA 1CGPA 3RMXA 3I3EA 3WQRA 3AHEA 4LBZA 4EHAA 4B7CA 1X3SA 3GRAA 1YV9A 5ESRA 1OA3A 3RRYA 3N3HA 1G6OA 4W8OA 3LQ2A 4CF3A 4HSEA 1X6VA 4YZ3A 2QHXA 1LPPA 5FLYA 1W5BA 2ONKA 4N5NA 3AF2A 3LX6A 4C1WA 1QGUB 5FI3A 2H4FA 1PFWA 1Q1GA 4RFLA 1W5TA 1BHO1 1JB9A 5F5AA 1BX1A 1EGVB 3PVOA 1EZ4A 1NLMA 3AZQA 4REMA 3LM8A 1IPSA 3OAAA 4AZ3B 1DKUA 2QOEA 4R31A 2QN9A 1HG0A 1YOVA 2CWMA 2BTVC 3Q11A 4MWDA 3AY3A 2RHGB 2YJGA 2AXEA 4R4XA 2Y6FA 4RLHA 1VG1A 3W05A 3MWYW 2O8QA 4P08A 1RMQA 4LY3A 4ARYA 2PHZA 1WCIA 2WHXA 3JQDA 2ONCA 4C76A 1OY1A 3QU7A 4MVTA 4JQTA 1XMPA 3OKAA 3EVCA 2XDAA 4ZZ2A 4J0QA 4QGBA 1XLTC 4RC9A 3DDZX 2AJBA 1VBMA 2OE2A 1O6GA 5JNUA 3HUTA 5ESXA 5K0UA 4DFDA 4YVWC 4JB3A 2WNVC 1DIBA 1KF0A 5DGTA 1VYTA 1HF3A 2JI8A 3N35A 3D1LA 4FX2A 1KS4A 1SWVA 2XHEA 2WWTA 4RZUA 3K6KA 3UJ8A 1QG6A 621PA 4OP3A 4YZ2A 1K0UA 2F1IA 5HCHA 4HP8A 2CEAA 3UOWA 4CUJA 1ADCA 5C3QA 5E4JA 2MSKA 5GVRA 1FEZA 3WGUA 3DPRC 4D74A 2VZ9A 4JI8B 3OTOB 3SQOA 4CFZA 4CETA 4EX6A 3W0LB 4HANA 1EVJA 2WZDA 1OT3A 1TJ4A 3CYFA 3DKVA 4LFCB 4PQ9A 1FW8A 3OQMA 5BNWA 3HV0A 2ZUWA 1QXPA 3RRFA 2O57A 3Q15C 4HB0A 2QX8A 3K5IA 3IIKA 4JB0A 4OKSA 1Q74A 2W47A 1Y4UA 4B85A 3UMFA 1XDWA 1U2RA 4LDNA 5LWHA 4JI5B 5K8UA 3L6EA 3V42A 4CF7A 4BVKA 3IVGA 4F4HA 1J0XO 5JSHA 4JSYA 1UDAA 3WSOA 3DEJA 2XYGA 5F78A 4FPCA 2QIPA 4GBJA 4OKNA 4DRZA 2G7ZA 5D8AC 3HVRA 1U8ZA 5DYGA 1M73E 3PX7A 2R7NA 1JHOA 4IYRA 5FADA 4P2BA 1IY9A 4RY0A 4FYWA 4YG6A 1MQ9A 4IQFA 1RHRA 2P9FA 4W6XA 5AKJA 5AD1A 1EBFA 1SD2A 2Q21A 5IVEA 5DAQA 1AF9A 4IMRA 2GHIA 1U5BB 2QX7A 3WG4A 1TL7C 1XTUA 1KFJB 1NL3A 3R20A 4MLOA 2HMAA 1RWPA 3I4CA 1R7RA 1LZLA 1LQUA 1ODNA 5DNAA 2IWHA 3O1JC 1KSJA 1Z2PX 1OKKA 1SKMA 1AS3A 3HXMA 3LZCA 2CV2A 1VL6A 2ET6A 2R041 4N8MA 5EZ5A 4TM7A 4TKLA 3A36A 3FLAA 3IKVA 1BVUA 3NHAA 4TKVB 2XB2A 2LPMA 4YV1A 3HGQA 2WE7A 2JDNA 5A5GA 4ZQGA 1Q3EA 3WQ1A 3RVDA 3WAKA 5U4XA 4OUMA 2P7IA 2XUKA 3LW7A 3VDDC 3K09C 1EB9A 2GN0A 5HRUA 4DOUA 5TGDA 1P3JA 1NXD1 1OH7A 2HTEA 5KMGB 3O0WA 3RS0A 2X7XA 4RHEA 1GO2A 2F2TA 1TME1 4M8LA 3KJIA 5U4QA 1S89A 1ZS9A 3LUHA 4BB0A 4QDQA 1U0HC 3BDVA 1PS8A 5CK4A 4FUQA 4CWAA 3K7EA 1Q17A 4IW3A 4H3SA 4DDTA 3LPGA 5FNZA 2RS12 5J48A 5KYNA 3RVNA 4BGUA 4QKNA 4GE3A 3ZSMA 1RBZA 3KPYA 4LVUA 1H5QA 1LI5A 2TSYB 3ZSJA 3ZIAD 5A6SB 4IE7A 3PVBB 4XQEA 2WJJA 2ZT8A 3WOGA 1GHTA 5DTEA 5AJUA 1JECA 1A9YA 3KHUA 4H0NA 4X24A 1EYZA 3PURA 4IZOA 2ZUBA 5JECA 1U98A 1N4AA 3GA5A 2YXNA 3LY5A 3O1SA 3JXEA 4DVJA 1LDYA 4FYJA 5F52A 2IU0A 3OESA 5HFNA 5D21A 2X42A 5FPYA 1HC7A 3L43A 3GGPA 4R16A 1W3XA 3WNOA 1D6MA 2IBSA 4GPAA 1RWQA 3PUAA 4XF1A 4UF0A 1J59A 1GWMA 4FIZA 4ZGWA 3B00A 2QDNA 1GIAA 4BE3A 1U5IA 3ME2A 1CAWA 2O8NA 4YW3A 3I2YX 3OOSA 1CERA 5A6VA 2EFHB 2X0FA 1VRVA 4RGAA 1MVQA 2PJUA 1JFVA 3K9GA 2E89A 4Q0MA 5HCNA 4GMXA 3TE7A 4YLZA 2BFAA 3MS4A 2YUIA 4DADA 4CP0A 3MUZ1 3T3HA 4BXSV 3DAFA 1ABFA 3RKUA 5JR7B 4PPFA 2J7PD 3ECSA 2H00A 4BB9A 5BNNA 3LT5A 1N2IA 3LVRE 3TYXA 2R84A 5DUUA 1E2NA 5EJ4A 3HKEB 5T52A 3A1UA 4IVRA 1NVXQ 1J33A 3KQUA 4ILKA 1RYYA 1PK8A 2I2BA 4M99A 3H9JA 4CMHA 1E1QD 3AI3A 1MFZA 1R6TA 1N33B 1JSRA 3AWIA 4L2IA 1IPEA 3NUGA 4FPFA 4UZSA 2VQFB 2ZG6A 4DMCA 5CBLA 2O8BB 4XJUA 1YI1A 3KZ4C 1SIWA 4RENA 1CQPA 1GP6A 2GQ0A 3EB7A 4JQZA 2J5KA 4BLSA 3CMGA 4C4ZA 4YJHB 2YJ3A 4WN9A 1GT91 4Z7OB 4C7OA 1XZMA 5FZGA 1YASA 2KM2A 2ZT5A 2QMZA 1WLSA 2OORA 3RGWS 3H8SA 2IEAA 1JZ7A 3J8F3 1PK6A 2LUOA 3EE6A 1YNAA 2IOFA 3MUY1 1T43A 3AXSA 1VCHA 2Q28A 3B6EA 4KUHA 2V55B 3R3SA 1PUJA 3K1ZA 2RE8A 1ZBQA 5LMZA 3BIXA 2CGEA 1P2DA 2ASEA 5C8XA 1GQPA 4P9XA 3VKLA 1II0A 1Z82A 4AL4A 4NXMB 3NTLA 5J5VA 3TTVA 1BGXT 3KHKA 3A3NA 4YMVA 2QX6A 1X82A 4QX0A 4BQEA 4QHOA 4YJDA 1FXSA 3INYA 5FBHA 4C0AC 3K92A 4IH1A 4JL8A 4KQFA 3VPAA 3JQ9A 2J0UA 1TPYA 3RVHA 3BIJA 5JDIC 4IQPA 3DZCA 4INZA 4KQ9A 2O3JA 3DEZA 4ZP1A 4MP8A 4DDWA 2OGSA 3CZRA 1SJ9A 1QE0A 1M2OA 4NFLA 2JENA 3TGPA 4ECAA 1NOKA 4OY3A 4G86A 1J5EB 4D9GA 2XXBA 4LPKA 1XBTA 2O6LA 3VPBA 4WM7B 1IMOA 1WZNA 2H65A 4F6RA 4PRLA 3O8QA 1QOPB 1J3PA 5A32A 3JATA 3OC0A 3OF1A 1EESA 2XVGA 4Z9FA 1FXZA 1PI3A 3ZR4B 3GN2A 4NDAA 2I3GA 5T3YA 1XEWY 3QVKA 4EJFA 1NLZA 2DEUA 3FCUB 2QN1A 1QPZA 2EHJA 3SNKA 1E6WA 3PXDA 3GRPA 2Y1CA 2OAP1 5EP4A 4OYUA 4YGCA 4RIFA 1PBTA 4L95C 1F2VA 4UEJA 4B74A 3ONVA 4XABA 4R9SA 5A3VA 3ODPA 3DMRA 3RS2A 4X63A 2HA5A 3EVZA 3L6UA 5EZYF 4DSOA 5DT2A 1HN1A 3C3WA 4DNXA 3TBHA 3TIIA 5C71A 6ADHA 3ZLVA 4BASA 1TEHA 3W5DA 4TV8B 5CJ2A 4A03A 4I1YA 5JLVA 1G38A 1TTHA 1KETA 4D97A 4BEJA 2WO2A 3VTAA 4CNQA 1H85A 1PNQA 2N46A 1RFLA 2GPWA 1ULGA 1NUTA 4B3GA 3GEHA 3ZX4A 3TCKA 2J3QA 1IOLA 3SSMA 1TXGA 3PQ6A 4MV2A 3DBLB 2P2YA 1FJXA 4ZO6A 1LX7A 3EGOA 4HN1A 4CEYA 4NHLA 4Q4Y3 5D1IA 5LP1A 4NH0A 1ONAA 1P45A 5FUIA 3OCWA 4OLAA 2Q1YA 4J03A 4QE3A 2VZ0A 4MKIA 2AHRA 1XX6A 4IIDA 2WMNB 5KCMA 4PLCA 2JH8A 5K6AC 2F8TA 2Q29A 4MB2A 3ZC3A 3T09A 2A0KA 3U37A 3A9RA 1G1MA 1T2XA 3IAM1 1JHQA 4HKWA 5A4DA 3OJ0A 1OTYA 2A78A 5T5LA 2FVXA 3VI4B 4XVCA 3UFBA 1VYUA 2ET1A 3CUWA 4ENUA 4DN6A 2ZR8A 2D44A 4JUIA 3TLXA 4Q0UA 3LKBA 1V37A 1HL7A 3H0CA 3LFTA 5BMVF 1KI7A 5KX5B 5BNPB 4IESA 3THPA 3DBHB 4EYSA 1BHJA 2XWBB 2C24A 2D0IA 4BOYA 3WLNA 3A8TA 3RYHA 2EBWA 2DPMA 1NRWA 1GAEO 5IF3A 1N2CB 1OFVA 4DSZA 1KMMA 4N90A 3Q0IA 3KB8A 1D7OA 1YYNA 2UYGA 4M89A 4X6LA 3E53A 2IS6A 3AR3A 1HX7A 3ZWOA 4ERXA 3Q41A 4J0DA 4KVAA 4C7JA 2B45X 1H2BA 2CD7A 1ZH6A 2WDZA 4QOIA 3CLTC 3BICA 3C3YA 3WZ2A 1XDGA 3FTQA 3MTJA 2PGDA 3TD2A 2BYVE 4KPUB 5AOVA 4CV1A 1MLDA 2AK2A 2GYYA 1L4KA 5CH3A 2C00A 1EJ6A 2WTEA 2XLAA 2DBVO 2Z4TA 4B3TB 4UW6A 3K4DA 2BFBB 5HF5A 1RYFA 4QU5A 1GGKA 2PLNA 2UZIR 2Q3EA 1A8HA 1JHUA 2N47A 4Z0NA 3MTQA 5K3FA 3TNDA 4JCKA 4MMXB 3F5DA 2JARA 1IS6A 4XDGA 3EZ9A 2VZ8A 4O4LA 1SUEA 4GW3A 4XXHA 1CD5A 4US0R 4QASA 4GOLD 3GZEA 4CFSA 1WUHS 2PAKA 4LKDA 5FMOL 4BRWA 5FKCA 3RUCA 5JBQA 1ODSA 4GP9A 1YH3A 3ZWVA 1QOTA 4CKCA 2ZB3A 1LOFA 4AZ0A 5IDQA 3SC2A 3UT6A 1RE1A 1PO21 2XODA 2VK2A 3RVSA 3RWBA 3E7WA 3CWQA 3GRKA 4BKPA 4N5DA 3R9WA 3NR2A 1L8AA 1PL8A 3BCSA 5DB4A 2EZTA 3WW3A 1ZONA 3DPRB 3A6HA 4X8HA 5IJXA 1FFHA 4AS3A 3CT4A 4Z92B 5FMBA 4XSGA 1IBRA 4QPNA 5JMOA 5I3ZA 2RGXA 3WAJA 3O1OA 2NU6A 5GV8A 4DV2B 1LHUA 4KWIA 3ENWA 1R5BA 2R16A 1X70A 4HD8A 3LXUX 1NE4A 4WMLA 3U4DA 4YVSC 5TGTA 3DEYX 3K3PA 1SRQA 4QYTA 5F76A 3IPRA 3OQBA 3EO6A 2B5WA 3P20A 2IV2X 3T9FA 1XAIA 1IEXA 4ER7A 4YFWA 3JQAD 1LEHA 3KCNA 2I54A 4E2GA 1MPTA 3HACA 4NRDA 5KOHB 3FDIA 5A9TA 4MUVA 3PXAA 2Z95A 2RI1A 2FP4A 1PJQA 4IG4A 3SU8A 2YMPA 1HDKA 1ZBA2 1VALA 5LRRA 1G8HA 4O1HA 3FDZA 4FLFA 3VPXA 2Y64A 1Z8DA 2CAVA 3EWIA 5TPWB 4N7IA 3GLFA 1R9GA 1SOMA 4EV0A 3RJZA 1T9AA 1WXGA 4FPJA 3ZWAA 4P34A 4YRCA 4PZLA 1WDKA 2K7FA 3BIFA 4KFCA 3UWDA 1J0EA 4GL4A 3G89A 5KBFA 3HYNA 2GVZC 3SIWA 2JAOA 5KNDA 1C1FA 5LLTA 5KNCD 1S2IA 2VHZA 4Z82A 4MUAA 4OHOA 1UT8A 3R9XA 4X95A 3RJ5A 4FC6A 1UXZA 4JGYB 2UZ3A 4BYMA 3SQNA 1LKNA 5IT5A 1W3VA 3CZQA 4FD2A 2DFPA 2WUHA 3CX8A 1REEA 4KWKA 3DH0A 5B1YA 4UTPA 1E79D 4CR7A 4LI0A 2RS11 1COZA 2NP6A 1PTKA 3BSFA 4HB2A 3HYLA 3JQ8B 4HWSA 5DHUA 2O07A 3QH6A 1V6IA 2DQ4A 2DSTA 3KB2A 4HDNB 6ABPA 3LLVA 4KQGA 4TWTA 1DTWB 5K3BA 3OPXA 3D31A 5JWRA 4JYMA 3QVSA 3N7KA 3PPVA 4RA0A 2OILA 5A3JA 2BF4A 3MNFA 2Q3BA 4YJKA 2OVFA 1N2SA 2ZDQA 4I3HA 5JCTA 1ENYA 1YFLA 2XUZA 2IW1A 4E03A 4TUYB 1WDMA 3QG5A 3AYAA 3ASUA 3E27A 3ACFA 1NBOA 4HWTA 2PBZA 3S7EA 2PTHA 3A21A 1U0BB 3EVTA 1W25A 4C3VA 2DBQA 4EZIA 3HHEA 2CMFA 1US2A 2IZ1A 1JEOA 1W5FA 5JAMA 3FLPA 5K0UC 2XTNA 4O59O 1GGEA 2XTJA 4L85A 2VHVA 4EWDA 2X2FA 3OMXA 2AOVA 2B8NA 2VUIB 4YROA 5JIUA 4RABA 2O8FA 1WSBA 4CEHB 1I0LA 1QO0A 2Y3IA 1X13A 4BVJA 3G6KA 1I4DD 2HMYB 4E08A 4UTRA 2A71A 4DCMA 2OFOA 1DZQA 4FHDA 1JXOA 1E1RD 3E2PA 3CMMA 1SLBA 4G81A 4LWOA 4NPAA 3J26N 1PSZA 1IOAA 4ZU4A 3IAQA 4N54A 2A6PA 1GZ6A 3FETA 4G0YA 3MPUA 4WOPA 4M0NA 1GYRA 5BN3A 2FDHA 3SHOA 1OWPA 3CIFA 3HUFA 1K86A 1OJ7A 3UW1A 3GNQA 4LO4B 5AKHA 1H23A 5ECGC 3MDPA 5KU7A 1X7ZB 3K53A 4XGIA 2R7EB 1H2LA 3OF3A 3GLUA 3WNZA 4Q4LA 3EHDA 1P33A 1H2RS 5IBRA 3K4PA 5HG0A 1ZQ9A 4MLCA 2ATXA 1IVYA 2QJFA 1UJCA 4CN8A 5IM4A 3RQ0A 3PDIB 1BDHA 4TT3D 3HKEA 1EU1A 1P7CA 1UYZA 1V43A 1V6LA 1NF2A 1NF3A 2JAHA 3O03A 5LRSA 2CCGA 5BUVA 3O8QB 3SICE 1ECLA 1CAVA 1A9QA 2E5FA 4Y1ZA 2GPBA 2QX9A 3K9NA 2LROA 3A1NA 4EKGA 1SCIA 3CBQA 5EP9A 3LDKA 3RQSA 3E15A 3LF2A 2RM22 4WVMB 2O5RA 4IRXA 3O2QB 1BCRA 5A3OA 3NVMB 5LJLA 3U75A 5K3SA 3QWFA 4JELA 1PT7A 3KL4A 1E61A 4YJ3F 1ZUHA 2OAQ1 2VR4A 2G4IA 5DBOA 4BVAA 2BTEA 3WI7A 1EFUA 2QAGC 1FTQA 4D96A 2TS1A 1F5FA 5IEJA 2JDIA 3R05A 4AZVA 3BJIC 5LZ5A 4DXDA 3L4JA 4XIOA 1H5NA 3UJ3X 2NYRA 3CWCA 1N2CA 3LY8A 3NBAA 3VTZA 4D5GA 1JR6A 3H1PA 2O0OA 2XUIA 4W1SA 4GWKA 3VR2A 4L4RA 4I6EA 3B5JA 5F37A 2D2FA 6LDHA 1Z8NA 4C5BA 3OIYA 2QE7A 3COSA 2GZ1A 5B7PA 2VZSA 3V4FA 3B5LB 3MOGA 1KEZA 4OU5A 3BCRA 3MPBA 3PI6A 4X20A 1E9BA 4Z1MA 3R2JA 4MPJA 3WINE 3WVJA 4FHFA 4KYVA 3ZU4A 3PE3A 3WK9A 3AG6A 2OYZA 1WU8A 3BFVA 4MEBA 3F3MA 4CQJA 3EFOA 1WEKA 2WF5A 3IAHA 2WZPP 1MO3A 1Q15A 4Y2JA 4F3JA 3GCXA 1DINA 1P17A 3WRVA 1BZWA 2HQ1A 5HZGA 3ND9A 3G79A 3L8MA 5CFLA 2J5BA 1X9TA 1FBTA 2CT8A 4OF4A 2AOWA 1H2YA 2Y1XA 3HR8A 2WT0A 2QYTA 3KSBC 3QQ5A 1GGJA 1XYYA 3N05A 2IC1A 2XMDA 1RWMA 2B8JA 3EDOA 5AFSA 4M1WA 2C9ZA 1H9WA 3KUKA 4L6IA 5B3AA 1E9CA 5CFDA 3UGFA 3EJWA 1G66A 4ND4A 5JZGB 2BZGA 3OLCX 3WGOA 4CCSA 2V6FA 1JG1A 2B98A 4WHMA 4V1CI 4EI7A 3CRW1 4HZIA 4G3YC 3HC7A 1E0DA 3ZK7A 2ADMA 5GTDA 2GLXA 1FVFA 5KYWA 4IV1A 4ZHQA 1JDTA 4IY1A 1PO11 3CT6A 3R40A 1H2AS 1SLAA 3S5UA 2BFMA 4ALKA 5FYHA 2ECFA 2I2XB 4UQPA 1NZIA 3QTTA 1S7GA 9ABPA 1A0OA 4IMPA 4HADA 4RESA 1YEWA 1QK4A 3IE1A 3KT6A 4Z0TA 5CYFA 3ZQJA 1NNEA 1C3HA 1RUG1 3AVTA 4INDA 1OZAA 2DTDA 3JPYA 1PGSA 1T3ZA 4IIVA 1QF9A 3EPHA 3JTMA 4V38A 4BIOA 4XAEA 2A5ZA 2DPXA 2XCRB 2J59A 1FFWA 3CCBA 2AXNA 3SYLA 4CDGA 5L95A 2CV0A 2FWAA 2FEOA 4E07A 4WFQA 4GPBA 5FR3A 2P79A 4M9CA 4X65B 4RXMA 1U7ZA 4XVUA 2H0VA 1DGWX 2HMWA 1G3QA 1CUVA 3D2AA 2HSWA 3GFRA 5LM3A 3U7HB 2QT1A 3PUSA 3KJQA 4H6WA 1NR7A 4L8FA 1R0ZA 3D8UA 3AK0A 1ZOOA 3CEJA 1EA7A 3B1YA 2FHRA 5K45A 2HT6A 3OQIB 3Q8EA 2XB6A 5L6MB 5IASA 5BV6A 3T5TA 3QTBA 4YT4A 2X4LA 4NJEA 4BO9A 3A05A 1RUJ1 3NUQA 2YNMD 1NKVA 5SV5A 1FDSA 3V00A 1W6PA 1ADJA 2Q4SA 4MVWA 1SUCA 4AX8A 4MV5A 2AMYA 1NBMD 3UUGA 4XUEA 4K9OA 3R3WA 3FYUC 2UVQA 4HZUB 3AHJA 5FHQA 1GADO 2PHLA 3V4SA 1GLVA 1OAOA 2JFUA 3RCBA 2IZ5A 1JX6A 4L8GA 3JZVA 3HCDA 4KEAA 3VC3A 3K94A 6YASA 2D43A 3DJFA 4P2GA 5KDLA 2HADA 2PKCA 1YONA 4OMFG 5IFKA 3GU3A 1NLFA 3OOWA 3LQ1A 1EVYA 2OPKA 3C6QA 1KDMA 2V7BA 1CF9A 1RTKA 3C6KA 1CN1A 3RC8A 3Q9SA 3PD7A 4DXRA 2EA7A 1R1A1 3AZPA 4Q1BA 4FFDA 1NXWA 4CQMB 4LV6A 4BP3A 2Q0SA 4DXTA 4J91A 1JT2A 5TX7A 3M7IA 2MMCA 3OZIA 5E4YA 5BXYA 1U12A 2P9HA 4YI3A 2BGLA 3ET4A 3K72B 4KN9S 4A26A 3R6DA 1ZIYA 1E5DA 1PJ2A 1QNLA 1W8IA 4XDOA 3ZFGA 4BZXA 4Y4RA 4PGGA 5TS3A 2WS92 1MOSA 2PSFA 1EVZA 4QQRA 4MRVA 1L5GB 3N2KB 1WQ3A 5JCJD 4JJGA 2ZZNA 5F5CA 2BFBA 3MELA 4QUBA 3WO0A 3WS7A 4ZDIA 3TI9A 3ZKWA 1KRWA 2OQVA 2J42A 3BB3A 3NNLA 4REQA 1FP4A 1CIVA 2CL6X 2FP3A 3IPVB 4P54A 1SMVA 2WO3A 2ODEA 4QM6A 2HMTA 4UFIA 3RFCA 3CN7A 3L0YA 1FMCA 4QPGC 1WZEA 2F43A 4HNHA 3NC1C 4F9EA 1SUFA 3I04M 2GM5A 4AC9A 1NVUQ 2ZRFA 3DFFA 2NZVG 5DMXA 5FPPA 4OUSA 3TSOA 4KGQA 2QNIA 3OE7D 4MR9A 3ZGNA 2IXJA 4XD7D 1ZI8A 4PYNA 4YGEA 5B4UA 4AYWA 2NYYA 2J3EA 2F59A 3RV4A 2AZ4A 1NXTA 3GLFE 2RH5A 4ZTBA 4I81A 3OZSA 2C03A 4JU8A 4R71A 1V1MB 5DYNA 4XFHA 2OKGA 1JHRA 1E3SA 4HDRA 4E46A 4GM1A 4LK7A 1X80A 2WNVA 3P3PA 2IVZA 3G0HA 3AGQA 2CB9A 1VPVA 4YB8A 4TYPA 3DZFA 2WP0A 5JHGB 2RS52 1ZVFA 1WSWA 3G49A 3S2FA 2VNKA 4JKOA 2FW9A 1TYDE 3MUNA 4DCPA 4IIHA 3KTAA 5K0EA 2AN3A 3WP4A 1XNTA 3VI3B 5HQ3B 4ER6A 2VXJA 1UFRA 3GUZA 1OAKA 3UMYA 1MQTB 2UUPA 2AKAB 4J76A 4IDEA 4U7GA 5CMLA 4PM4A 1SNYA 2XYHA 4EHFA 1P1HA 5EWJB 1SBYA 4QOGA 4YLGA 1JQKA 3LA6A 5FTTC 1JOJA 3KD4A 1QO9A 4Y2PA 3GEPA 4UEOA 4RTSA 1FQJA 4LPLA 1NLYA 4RETA 5I6DA 2YASA 2DPHA 1U5CA 3DE2X 4MQ4A 1SOWA 2YW9A 1RUD2 3EC2A 5FI1B 5AI4A 2XNDD 4F5DA 3CQOA 1TTQB 3BTZA 2C3YA 4FQ8A 3CUKA 3PENA 3SCZA 4DMLA 3Q3IA 4Y6RA 1X0VA 3FN9A 4U5XA 2R8PA 4EZEA 1SQFA 2EIEA 4FMBB 3MK31 5J43A 1FFGA 2ADFA 3GEIA 4JT4A 4KOAA 4BE7B 3B1JA 1L7PA 1YJBA 1PZ7A 4LKRA 4ZOAA 5J4KA 4EN0A 1KDZA 3OFND 3MFQA 1ECBA 5I9IA 1G42A 4GX1A 3IBSA 1ATIA 1YKSA 1XD2A 1JP7A 3EFOB 1MORA 2B8WA 3G23A 4ASLA 2YQZA 3I28A 3WYEA 2PAEA 3B89A 5CDUA 3C1AA 3DMFA 1SA0B 3GAZA 5F2OA 3OP4A 4ISCA 2Q0QA 2XOEA 2VZVA 2GK4A 1V0JA 1VIDA 3NHRA 1HDRA 2NUAB 1RMU1 1BS9A 4BO4A 2IDMA 5TQ2A 4NBRA 5CDFA 4G25A 1R66A 3D4IA 3ADCA 3E9MA 2HUNA 4O0LA 2L82A 1BXZA 4IIJF 4Q1RA 3PXEA 2GMMA 3MF6A 1R88A 3QX9A 4G9BA 3SF8B 3ZFGB 2A0UA 2YN4A 4C0SA 4PSUA 1J8DA 2Q4BA 3CG4A 3SC2B 1Y5RA 1O4WA 4XX1A 2WNIA 3OLXA 1X36A 5JALA 4H7FA 1MZ6A 4Z49A 3VBFC 3I9JA 1YI0A 1CAXB 3LL4A 3AJAA 3E5HA 3Q7PA 3ROFA 1VP9A 4Q7MB 3HWSA 2XRZA 2HM7A 4FKBA 2VCMA 4XWKA 4BVHA 1VB3A 1A9OA 1J21A 1N3BA 1UXXX 5EWLA 4M0UA 2H1CA 3RVMA 4FLMA 1YDFA 1GM5A 3CZCA 3T54A 4WWHA 3ZLUA 3IJPA 5KDDA 5KYYA 1N1VA 3PJFA 2I4NA 1SU8A 2FE1A 3BWYA 4YWAA 2W2VA 4JA2A 1KQOA 4URYR 3MYRA 1Y1QA 1T34A 1E2DA 3ZE8A 1ZRFA 3LF1A 2HQRA 3KVYA 2WWWA 4EROA 3MT0A 2NLRA 3PA8A 1KK3A 3PF9A 2A0WA 2NADA 3BA1A 3I6QA 1ZA1A 1OUSA 3ASIA 1I01A 1V26A 2QBXA 2DVGA 3T7SA 4HH1A 2PO5A 5BWOA 5I91A 2PD6A 1SVSA 1JIKA 3GP3A 2Z09A 1P81A 2I1VB 1VSBA 4CM6A 5GONA 1JA9A 3NH9A 5FWXB 4COUA 2XTZA 2IIQA 4COYA 3M9WA 4MQFB 1SLIA 5JPDA 2EJVA 1Z0JA 3E4CA 3QE4A 2C0PA 3P9QA 4L02A 1E5XA 4JBIA 1EUUA 4LUMA 4YGBA 3U5ZB 3S7ZA 4EJ0A 4I3FA 4O0MA 2G06A 3WWEA 4URFA 5CX4A 4D8MA 1B0AA 1DWQA 5IM5A 5FFMA 3SYKA 3TLCA 5KNDD 4GIBA 5GV7A 3JRXA 5ALGA 3I01M 3W7BA 1U0RA 4D9NA 1ML3A 4PNHA 1QU3A 1JXNA 4MW9A 5FUQA 4RCYA 5FY0A 5BQ3A 4EJMA 4PZDA 3DPSA 1L8OA 3Q6IA 3HY4A 2HXSA 2IGBA 4CIAA 4D5EA 4NF2A 3V9AA 2NNWB 3BWMA 1WY7A 3T3DA 4ENRA 3T7CA 4RQUA 4MYHA 3P45A 3ETJA 2B9VA 5T64A 3C16C 4KFTA 5I7AA 1PE0A 4X60A 1QG4A 1S0UA 2HWE3 2HH9A 1KMHB 3ZGYA 4NJMB 3LRTA 4OAPA 1IQRA 2LUWA 3QBQA 3K2IA 4Z2AA 3EMKA 1TZJA 1VBKA 5HIAA 3J8F2 4O2BA 3F6BX 4ABYA 3RC7A 1SVOA 5KKCA 1DS6A 3FSGA 1GZCA 4BIIA 1QC5A 4MTLA 2VCYA 4A41A 4AY3A 5F3CA 2V8BA 1AMUA 4RFVA 4PIPA 3D6TB 1CX1A 2RHJA 5FUNA 1Q7RA 4H1TA 2WUEA 4DMGA 1RZ3A 3SD7A 2OHXA 3GLHB 3LPMA 1UAGA 1CONA 2BEUB 3N9OA 3HYTA 3LC7O 3LD9A 3EXG2 3WHIA 1P2VA 1LK0A 4JJEA 3NNJA 3IIIA 4N3CA 3G3EA 3EIQA 1XZFA 1W94A 4CEHA 2A6VA 4DS3A 5IVKA 1FVOA 4JI7B 1C7FA 3NW9A 4C08A 3FSEA 1FV3A 1Y1KE 1LRHA 3D8TA 4XBLA 1TZMA 1OA0A 1ZCJA 3RLIA 3OSUA 3HXPA 3NYQA 1PQYA 1RYBA 3U4CA 3FOBA 5DTMA 4QHSA 3ZVKA 1OTXA 1DGLA 2OBNA 3ZIAA 5JD4A 1JFLA 3IELA 4EFKA 5TQVA 1P80A 1G6Q1 4WLEA 4A10A 2E32A 3E4DA 3ZEAA 3GVCA 1R27A 4AOCA 3AVPA 4PDWA 3GIWA 2F8SA 4IF4A 4KQ2A 1Z36A 3ZNNA 4FOSA 1RFGE 1CY1A 4NIAA 1TYAE 1HV0A 2OQRA 2FQYA 1HV1A 4OMUA 4YVWB 4ZDJA 4JVOA 3KTFA 1UEIA 1KZ4A 4XJWA 5KC8A 1I7LA 2GZWA 2AFHA 3SLGA 1OXCA 2BKLA 3UCXA 3RSSA 4E70A 2GAUA 4RV5A 2C0CA 1MEOA 1Q19A 1DO0A 4Y1YA 5ABJA 3F9IA 3EDYA 1V8ZA 3SE7A 4B43A 3WG3A 4NG4A 1TGVA 1II9A 3CVUA 3H1EA 1LU1A 1UP6A 4GXRA 4Y9RA 3FBWA 2QLMA 2EVXA 5F2EA 3OZAA 2XJRA 2HA3A 3DF9A 3EAFA 3HM2A 3KQKA 4UDYX 4WBNF 4QWNA 5HEKA 5DLDA 2Y6UA 4IP0A 1B09A 3A2LA 1PZ9A 4LTDA 2ZCUA 3GA0A 3L6OO 3N6VA 2CW5A 2FX5A 2QPAA 3U14A 2BT4A 2H51A 1NA1A 3WLJA 3UJBA 1IS3A 3KKLA 1CQIA 3EF1A 1VGVA 1W9FA 2KM1A 2P62A 2AG5A 5H4GA 3ETEA 3MJTA 1QRUA 1X8LA 3VR5D 3AF3A 2H85A 3ORQA 3T3GA 3EIEA 1MT0A 3CNNA 3USUA 5LXTF 2D6KA 3QVMA 3CUSA 1FDUA 1F4AA 2OB1A 4J1NA 2B20A 3H5AA 3IOMA 2GZ2A 5JOZA 1K8QA 3IULA 4KE6A 2C8VA 2F00A 2QP9X 2H18A 1AKMA 2BLNA 3JYLA 4MYTA 4IGEA 3B13B 2KA3A 2YGLA 2JW5A 2ADEA 5KQLA 3FNIA 2BGTA 4IL5A 3PT5A 3UKNA 4CZ2A 4WNAA 1U2PA 2YWHA 5HCUA 3RWNA 2CNOA 1GPDG 3VDMA 4EGJA 2M9MA 2LDXA 4MI1A 4RAOA 2EG9A 2QDXA 4ES9A 4M38A 4AFNA 4W7HA 1H2ZA 3DA8A 4HY3A 4Y6QA 4J0IA 4QUJA 2WA4A 4HAZA 2NO6A 1JHZA 1RC0A 5FPBA 2X1VA 3OECA 3HCNA 1UT5A 1IG0A 1BE0A 4IQGA 2FAXA 2ES3A 1GRCA 1H30A 2G71A 4BNGA 1ZY2A 1KEUA 2IUFA 2XT0A 4Q34A 2CLIB 3I62A 3TZKA 1C41A 5CB6A 2QQIA 2YWCA 4MX3A 1PG0A 5FZCA 3IQFA 1CY6A 3DECA 3DW1X 3Q0EA 4EVSA 1H9CA 3LT4A 1CZKA 5BYJA 4OBEA 3SIRA 2A70A 2ZHMA 1HKHA 4HAIA 1W6MA 3HNPA 4X7RA 4B3HA 1RT9A 1F9AA 2Q1MA 1FUKA 4QG3A 4AM8A 1FB5A 2XZPA 3MXOA 1YAHA 2DUPA 2FSUA 1PZNA 3POEA 1JR2A 4RMJA 2V0NA 4K86A 2E7ZA 1E89A 1HORA 4MW0A 4PTYA 2C5DA 1T9KA 2XAUA 5CFOA 1X1EA 3TR6A 3J81k 1QIKA 2P1ZA 3M6UA 4LR4A 4PGMA 5FUVA 4E5DA 4QPIC 4KGXA 1ATZA 2NSDA 3RNOA 3H1WA 2TRSB 1P7WA 1NATA 5A4IS 1NRIA 4DARA 1Q0LA 1X8XA 3TIGA 2V0GA 4MA5A 2ZB4A 5LQDA 1YJAA 5M3BA 1M2FA 4M0CA 3L4KA 4FFNA 4LQRA 1X1DA 4ZI7B 3OEEA 4XGQA 3IEXA 4LJ9A 1VSTA 4AJEA 2O7NA 4XCQA 1IFXA 3IV6A 2D1TA 1AZWA 4ZCPA 1R64A 4E2XA 2P6HA 2DH6A 2I34A 4BX3A 4NY1A 2V9CA 4MQFA 1ZINA 2XZTA 3HN2A 5H9SA 2C2MA 1X7GA 4GI7A 2FZ5A 2Y0DA 1Y48E 4J1TC 2ORVA 4K9MA 2RDSA 2CLFB 3SVLA 4JJFA 1WW2A 1JTVA 2BBOA 3ETLA 3C4JA 3E3LA 4OGWA 2WU4A 3HFGA 3FGOA 3KQLA 4RA6A 1E7QA 1LVHA 5I51A 1PJ8A 5D6NA 1HE5A 1B3RA 5BYBA 1GD1O 3BAFA 3KEOA 4WKBA 4ATFA 4KGDA 1F4VA 1JU4A 2GEDA 1D0HA 4EY5A 4LBVA 3HJTA 3LDBA 2B2NA 4KMRA 5JTTA 1FTYA 1KSHA 3DXTA 4X1IA 2ZWMA 2CY6A 2W3JA 1L5HB 3V33A 2Y76A 2I2WA 2XQRA 1U3WA 1VA4A 2P78A 2R7LA 1J0BA 1RXVA 2XONA 4FPYA 5SY4A 1FDOA 1SG6A 4DV6B 1F06A 3W3AD 4PI0A 1X1AA 1C50A 2Q07A 1VKJA 3WFJA 4CN9A 2G9QA 1LI7A 3MRTA 3IQHX 4IEIA 1TD9A 5ALHA 1QDOA 2BE7A 3HNOA 2FMKA 1QMGA 4GAEA 2MSLA 3EPPA 4BX8A 2QB5A 4KOEC 1KDRA 3BKXA 2NO7A 5EEHA 2ZJFA 1QIJA 2DTWA 1V4VA 3UB2A 5LQCA 3FGNA 3ZV7A 1P7VA 1PVDA 4WGFA 3EC1A 2ORED 4C89A 5HYVA 4LZOA 1POXA 4NE7A 3B6MA 2YIVX 3RYCA 2JEMA 3EIWA 1R0RE 3KQNA 4GRDA 1O9GA 2AOUB 5FV4A 4MVJE 3H75A 4XW3A 1XCMA 1PNRA 4Y2TA 1J90A 1FY2A 1LRKA 5AESA 5K8VA 3ADOA 3BERA 3M5PA 2VDWA 5C1DA 5AJXA 3L0BA 2O0MA 4OQPA 3D4PA 4Q4X3 3OT1A 3WRXC 3RF7A 3TRDA 3PPWA 1UF2C 1VBA2 4WZBB 4OYLA 1BWQA 3H7JA 2H16A 1QHHA 3K30A 4NIIA 1V9U1 4D81A 4R1MA 1QGYA 4BOWA 1LLUA 1QX3A 5LQNA 2J9FA 4XCXA 3OF2A 1QQP1 4G5QA 2F48A 3FMVA 4LGVA 1U4NA 2II6A 3TWIA 1QO7A 2IRWA 5DW0A 2XPJA 2R1VB 1TJ3A 2ZDHA 3V1YA 2XJPA 3ICVA 3IIAA 4MRMA 1RXGA 4XB2A 4F8YA 4ET7A 4YCNA 2YMLA 5EIXA 2HSZA 2ZJ6A 2FDRA 1ZRHA 4B32A 4UU1A 5CKNA 2XLFA 1QQ6A 2IXDA 1NMEA 1ULDA 1XQ6A 4ARZA 4J0HA 2XMPA 4GMGA 5DSTA 2A14A 4QT0A 4OKIA 4D9BA 4EYQA 1OWMA 1UNBA 2CVFA 4QKBA 4RO0A 4QEZA 1MCZA 4Q4W2 1V9U2 4IDOA 4MGYE 5CPFA 3TO5A 2IPAB 2HFKA 4CCOA 4L0CA 5KNBA 2ZE6A 1DC6A 4B29A 2DYKA 4RVFA 3DAYA 3IOEA 3S29A 4R3NA 3OOEA 1T9HA 4KIUA 2J9RA 1SFPA 1XDDA 1I1HA 4CEIA 5HS6A 4L5BA 4IF6A 3IMNA 4UHEA 4C9BA 3AUSA 4CEYB 1Z5ZA 1KD7A 2RC6A 4B5LA 2P9QA 3Q9LA 4U9HS 2YWRA 1ZX5A 3OBTA 4BMPB 4OFXA 5A1LA 4FIDA 1Q84A 4KYUA 4R8VA 4MQEA 2C54A 4RSMA 5EERA 3JALB 4DR2B 2BI8A 2GERA 1IZ8A 4GZ3A 1W6RA 3VMMA 3E18A 2Y1KA 3BF8A 2A9FA 3E9DA 1ND2B 2R1UA 1Q22A 1N77A 2GASA 4JDOA 5KAPA 1AQJA 3CRVA 3E1F1 3AL0C 4OHKA 4AJ9A 3ETDA 4O61A 3QIVA 1TYCA 3NHYA 2Y6VA 3PRYA 3L46A 4W6YA 3R4SA 5E16A 2W6JD 2YU2A 4EGQA 3LYAA 5DDJ1 4YCJA 3U6BA 1L7DA 3SMVA 2J67A 3DLBA 4AZZA 2LW8A 2ZSUA 4OGGA 2FWBA 3E58A 1WF3A 3H8VA 2XBO3 1DXHA 2ETXA 1KP3A 1G98A 3ZPXA 1YFJA 1W4LA 2EXIA 3EG9B 5BNOB 2XKJE 2WIBA 3ZNQA 3KAPA 3KDPA 3LQQA 3WTBA 4YT5A 4IVPA 4LKFA 1HFEL 1OV6A 3A26A 1II8A 3HGTA 3AU9A 3JQPA 1PO22 1TU3A 4RJIA 1EIZA 3IUNA 5JY6A 3KE8A 3MJVA 2RHOA 3IIJA 3IHKA 5C18A 5LBEA 2NNLD 2E85A 1X7XB 3AMHA 5HBAA 2XB4A 4D0RA 4HCJA 4LUCA 3I12A 1PQPA 3PLQA 4G5OA 3UCFA 3WGMA 2C9OA 4UFKA 1UKGA 5CGQB 4JVAA 5BSWA 4KZPA 3LKDA 4KE9A 4ETMA 1RNLA 2NM1A 3KMHA 1D0IA 1ANKA 2QNKA 3CF4G 4R9AA 4AQYB 4COOA 5LQJA 1OXBB 4IDGA 4F92B 2FWIA 3L4EA 2Z2XA 1S8FA 3KXDA 3BWBA 3A6EA 1Y4ZA 3OX1A 4ES8A 3A6FA 5BPXA 3R7NA 5ALPA 5FOQA 1UY0A 3LDRA 1ENZA 1KU0A 2GEVA 4JHLA 5L51A 3EDCA 2QDRA 1ZC4A 2WW8A 3ZIUA 3Q6NA 1US8B 1OHFA 1ZM7A 1NOJA 3U11A 1ZFNA 3NM6B 4EW3A 4HNQA 3GFPA 1FRVA 2VE1A 1QPGA 2YZGA 1HUQA 4WECA 4D92A 5HV0A 2HCTA 4N53B 1DXQA 5JI2E 1NRXA 4IJQA 1XNAA 4ZZ0A 2AUMA 2WTBA 4BV8A 4R4ZA 3H8OA 3EH2A 5EJ3A 4UW9A 3H5TA 2OXBA 4FN4A 3RG8A 2YBDA 2Y9MB 3AIKA 1G21B 3N0TA 2Y6JA 1FDWA 3BMCB 2CMKA 3KKNA 1ZD2P 3VD3A 5IK8A 3M4ZA 4RJLA 1PV1A 1J5PA 4PHZA 4WKOA 2PCLA 2Q5FA 1XU1A 4AY4A 3V65A 1ODKA 5DK4A 2KD7A 4RXUA 3QENA 2ID4A 1BK1A 4QEDA 5I48A 5F3RA 2X76A 4CR6A 2VPZA 2O8DA 5FULA 1ZNQO 4SLIA 5CX1A 2DBYA 4DSNA 5JI7A 1RXYA 2XJ9A 3LBFA 5F5IA 5D87A 4FFOA 3BOSA 3R6WA 5HRAA 1I0IA 5IUQA 3DB2A 1W9MA 2EXXA 3G88A 5DSZA 4YYOA 1NTRA 3VBHB 2X86A 5CBPB 4HLCA 3JR3A 1X94A 4YAIA 3KR2A 4LJYA 4B09A 2WJWA 1YTUA 5KHHA 3NC4A 4GZMA 3SBXA 1PJCA 4IL7A 3ESBA 5BNNC 3KL2A 1QIIA 1GRQA 2VOTA 2C7OA 4TTAA 1DE0A 3WFZA 3H2IA 3AJ9A 4QXQA 4YXWA 1LPMA 1FU8A 3RYRA 4R5HA 2VP9A 1N1EA 3FF4A 1KEEB 2PMDA 4HKTA 2HT1A 4BNZA 1NQXA 1Q7BA 2VDRB 4N5HX 4YAKA 1GKBA 4P02B 4FMCB 3SH3A 3RK0A 3VZDA 5H81A 1P0QA 4PYLA 4M8IA 1BJTA 1BHQ1 5JD5A 4EGAA 5T5OA 4S0XA 4D8XA 1U80A 5ERLA 1KP9A 3L0CA 5LNK6 3HCBA 1K3FA 4X54A 3GF4A 3ZSKA 2MHCA 4OFZA 3AVWA 5A7WA 3AP4A 2IXGA 3O12A 3QUQA 2XT6A 4FQ7A 1FL9A 3K77A 3AR2A 2BONA 4FTWA 5IAKA 1NJ5A 2IZWA 2X2PA 3THCA 4ERNA 3DOOA 1KXZA 4OULA 3DZBA 3HNYM 3RRNA 2CHUA 3D6UA 4HGQA 4Q7LA 5CVUA 1AIPA 1XTBA 3RFVA 3VA7A 3M6LA 4UUNA 4LMBA 3R5FA 3WMGA 1KAEA 4NULA 4HO1X 4IGIA 2BM8A 3T12A 1GGVA 2YZKA 2QZ4A 3HBAA 1JZ4A 4OM7A 1S8NA 1C3JA 4Q4W1 3Q2OA 4RS5A 1ASJ1 2PS1A 3G0BA 3UAWA 3HO6A 3ABSB 2ZYRA 5CFCA 3JQAA 5CM8B 3TQHA 3WYCA 5AI8A 4IV3C 1FZTA 1MMFB 4B3JA 5I7EA 1VI6A 2H7VA 3FWYA 4QPIB 3U3DA 1K42A 3S2GA 3ZXXA 3B69A 3W4KA 1YS9A 2HLDA 4XFKA 3ELYA 1ZU4A 3DFKA 5J2UA 4XTMA 4R9DA 3AFOA 3VBEA 2BFCA 2HEIA 3JCZA 3FUTA 5C5CA 4EHHA 1IOVA 3MAAC 2EFYA 4RF5A 4YRQA 3T34A 5E7JA 2UUBB 2C82A 3I9V6 1WB4A 1GQ2A 2C5LA 4RTKA 3V1MA 2QROA 4DBLE 2W94A 1C2YA 1AX1A 5LQKA 2FOLA 4J9UE 4AW9A 1GKKA 3CRNA 2ZGOA 1HPLA 2FF7A 3G5AA 4EFMA 3ZFGC 1TQ2A 5HM6A 5CLFA 5LDDC 4O4HF 3MYXA 1W2GA 4UU8A 3E22A 3BGVA 1QVAA 4PQFA 5C31A 1ZHFA 3HJNA 2VF4X 4EAAA 5FYTA 4IJKA 5KREA 2XCSB 1J1TA 1CVLA 4XF3A 1VXRA 1K9VF 2OXIA 3OQIA 2VBPA 5E3IA 2ZOEB 3HVDA 2QU7A 2GJAA 3FRIA 5A3MA 2O8BA 4OSOA 4WCDA 4QU1A 4ZJPA 2D13A 1U7DA 3NJ8A 1E79A 3OHMA 1ZX1A 4PIXA 5JUVA 1EPUA 1QP8A 1KE1A 4DB5A 4WY2A 5ALSA 3I6IA 4JRAA 3PQCA 3A1VA 1XCPA 3T4XA 2F1JA 3GJ5A 2PGAA 4L74A 1N5JA 4RN5A 3PUQA 1XLTA 1T9DA 1UPSA 5JRDS 3UB3A 5JFGA 1Q8VA 2K5UA 3PRKE 1UIJA 1MW9X 2C2WA 3DLAA 3EC7A 1YU9A 1D07A 2ZR7A 4NXNB 1MAVA 2TECE 2HTFA 1QS0A 1WIWA 4CM9D 3BMQB 2ERYA 3PEEA 2VTFA 3I45A 2RGYA 2C1ZA 3BX1A 3UY4A 2ZUTA 1ENRA 2BTOA 2RGBA 4JBNA 3EDRA 2YBPA 1PYOA 3VZNA 3KR0A 2WTXA 1KGSA 3OU2A 1UFOA 2QM0A 5DULA 2ZM5A 1PMJX 2ECPA 3OCUA 5TLSA 4EE2A 2QQVA 2ZQ5A 3ITEA 4FUTA 3D59A 1U8TA 5JSPA 3HR7A 1G7YA 1TM3E 4MHUA 1ZD5A 3QG1A 1LNQA 2Z5WA 3UJCA 1CC1S 4QTUB 1CJMA 2B1IA 2ZIFA 1VSQA 2XAAA 5IMSA 5K4HA 3N8GA 2DHDA 2XQJA 1YL5A 1K6IA 1F0KA 3ZTTA 1FLAA 5F1YA 2IVIB 3DEAA 1OBFO 5ICMA 4RS5C 4KMQA 4MULA 1YU6A 1O4TA 4RZIA 4V0NA 1CE8A 2NGRA 5BW4A 1GG2A 4FGSA 4HEQA 4ZQBA 4AWBA 4GAZA 2R44A 1NF8A 2W2LD 1GNYA 1C1HA 4JZYA 1CS0B 2QQMA 2CXXA 3Q3JB 1E0JA 2Q9BA 1W73A 5AM5A 2PLV2 4M3CE 3PPXA 3LK6A 1ESNA 2P9BA 4BNKA 3HLKA 4Q21A 5I93A 1IHMA 3IB6A 3LH5A 4H0CA 2CNBA 2G5PA 3W3ZB 3N87A 2W98A 3T1HB 4YXFA 3IDEA 1DTSA 1ECGA 2JFNA 1THZA 1QRAA 4K1YA 2DWRA 5AXCA 3ASVA 3BTVA 3PL1A 4V0KA 1K8XB 1BMFD 4G5RA 4E33A 4R41A 4R7GA 2NVWA 1H1DA 3WYDA 3JBG3 2HIAA 3A37A 5AQEA 2OTCA 5FWAA 4ZZ3A 1STMA 1JHDA 2XMQA 3THDA 3WKCA 2EXKA 4AURA 2K2QB 4DSUA 1JG2A 2H5LA 3I2DA 4QRDA 2ZUUA 5C51B 3IUQA 3NETA 5D5PA 2E1RA 2GEJA 1LRJA 4HZGA 5T4FA 4CM4B 5FP9A 4BDVB 4MJLA 3OLQA 1XUOA 3BWXA 3W90A 2CVHA 4MICA 2OBMA 2R0QC 421PA 3F3KA 3A3PA 1VIWB 1SQ0A 2BFCB 4P58A 4IS2A 4BNLA 3QQPA 3GLHA 2OKCA 1Y4AE 1TJ5A 2GSYA 2GXAA 3S2UA 1K8RA 5D3ZA 3FN4A 1DG3A 2YPJA 5JZSA 2VMCA 2IZOA 3IQEA 1ISPA 4PIYA 4JSTA 5B1EA 2O5CA 3K48A 3QOFA 1TNRA 1C9KA 1X7DA 3G2HA 3KHCA 2Y67A 4G3XA 3MJFA 1DOAA 1Z35A 1QGED 1E3QA 4MKFA 3VU8A 1HEUA 2GUWA 1TMYA 3SHQA 2DWOA 3I30X 1BKZA 3E2MA 1XTSA 4YJFA 1M34A 3QELB 3STTA 3VUOA 3RT7A 5CBKA 3QX7A 1H2KA 2XITA 2HR1A 2PGJA 3WB9A 4JXXA 1AKQA 1JVNA 3MTIA 4JBXA 1NBEA 2C2ZA 4J94A 2V54A 3TQOA 2POQX 2JD9A 4F5WA 4ID9A 4ZU1X 4TS3A 3MS7A 4JLJA 1A2KC 1NI5A 2JGIA 2WYIA 3NRBA 2W48A 1K8ZB 1A2OA 3N75A 3ZFFC 3V64A 4YRAA 1OH4A 4Q82A 1CUCA 4C8DA 1LHVA 5I7HA 4UWDA 1YB6A 3OYWB 1VMAA 2HQOA 2G1KA 1P5RA 1G8FA 4I2NA 3UGKA 1V4BA 3U19A 1CZNA 2VP4A 1U7HA 1RZUA 5IVPA 4J2OA 2ZZKA 1DKMA 1CRPA 3RM3A 1LF5A 5JISA 1SPXA 4AICA 2BU9A 3W58A 1UANA 3CGGA 4CBVA 5CB8A 4FC7A 3UK7A 3RUDA 5BN3B 1T3LA 3VHPA 4N0PA 3QH4A 1DEKA 1E69A 1CDZA 4BQ2A 3SITA 1L4MA 4YASA 5BSRA 3EMRA 1Y6ZA 3L8YA 1JLLA 1AQ6A 1R0WA 1CPNA 3I76A 3LDAA 2DU8A 1C1YA 4Z1VA 3UV3A 4HTFB 2B4RO 3QVGA 3H7AA 2XQFA 4V2VA 2K4MA 2CXNA 1RLTA 1QVVA 4WBSA 2B4AA 3NKVA 4GOMD 3ZFEC 3ECQA 4YMWA 4YY3B 1TU0A 5E1MA 2QUZA 2O6HA 1H0RA 5BY5A 1YZNA 2VHUA 1JUHA 1EDDA 4IDAA 1Z4JA 3R44A 3BA6A 3IPLA 5E9WA 2J45A 1Z56C 4GOXA 1GZSA 4AG6A 5IVVA 3D3JA 3FHCB 2ZX2A 1RM4A 3K35A 3T7RA 1KRXA 2WFMA 4QELA 1D5WA 5FWJA 2RJ2A 3T1TA 4FFSA 1Y3BE 3N8DA 3KG2A 5SYAA 2W6ZA 1MR5A 3T94A 1FX0B 4XF0A 1XZEA 1PVVA 1TO2E 3EYPA 2NXWA 5KYYB 3AKPA 5BR7A 2QR5A 2D5BA 1Y8QB 1HE4A 4EJSA 5JI3E 5KXDA 1P18A 4PO9A 2GETA 3WGNA 3ZE1B 3OG2A 1XQXA 1TQ4A 3GVXA 3QLUA 1YULA 1CUZA 1KK2A 3GEBA 2G5TA 4DDKA 4O2AF 1O5UA 3R3VA 1ODTC 2ANBA 4CPBA 2BFUS 4HZFA 4YVWA 4NYJQ 4CGYA 4RV4A 5BUCA 1CDOA 1OGJA 1NSTA 4I4NA 3CNAA 4E2YA 3BE8A 3MMZA 1H1TA 3MLAA 5K01A 5C0OE 2HHHB 2FWNA 3P2YA 1TEIA 5F9MA 3T4UA 4DA4A 4Y67A 5AKZA 2IFWA 1PYGA 1Y1TA 4CU6A 2IX3A 4I8IA 4B71A 1MACA 3K0AA 2VHEA 3FWEA 2NTEA 2YV1A 4EUEA 4A6DA 1I51A 1JI6A 2Z8YA 4GKYA 2R6GA 2EP8A 3EVEA 1NG9A 4JL5A 1AKYA 3SSOA 4KI0A 3SJ7A 1F7VA 4MR7A 5ITSA 4CCAA 5FBVB 4PLNA 4C07A 4CQLA 4LY6A 5DCLA 4CV0A 1PEYA 3I37X 3IMEA 4QTYA 1SG0A 4HAVA 4OAOA 4PZYA 3AWDA 1DUIA 1UF9A 2FPLA 3WVNA 5U9CA 3U4AA 4IO1A 1EEHA 4IERA 3V97A 4Z0PA 3RKSA 4BO8A 1JH5A 3WL5A 2XT9A 4JASB 3N7MA 4GX5A 3WKAA 2FVYA 2NUPA 3KT3A 2I87A 3WLLA 4DIEA 2HWC3 1AZSC 2BGKA 3MINB 3QPDA 2R00A 1SBZA 4JHXA 3KQVA 2YJ5A 3MMSA 4Q6BA 2QYHA 3HKBB 1SHKA 1NMQA 1V8DA 3O4HA 2GKOA 1OHHA 3T1YB 5KX5F 4PO3X 5CLQA 1U1CA 1PQWA 4NAOA 2CXQA 2RE9A 3FYDA 4D6PA 3T15A 4HKLA 2DVAA 4OHFA 1ZBE3 1RC8A 2YG0A 2RGRA 2YXDA 4IILA 3PLRA 3HEIA 4UBLA 1J83A 3G2OA 4BK5A 2C99A 4NZNA 1SVIA 1SWWA 1IIBA 3E3AA 2VK4A 3IODA 4ARIA 2PT5A 3A6GA 4NFHA 4BQPA 5KB3A 3AVXA 3FA2A 5JZMA 3JQBC 4TSFA 3HNBM 4ISQA 3T7AA 1NPYA 3OQJA 3CKLA 3DGFC 2LM3A 5FY7A 2ACKA 5FYBA 1HJGA 1GGNA 2YROA 4J49A 4DS0A 5B4NA 3QM1A 4XJVA 4UAPA 3T4VA 5LK7B 3OURA 3SOZA 2BL4A 3RS4A 1UQRA 2QN2A 2PFGA 4E6PA 2P6UA 5CA0A 4H14A 4D3DA 2D2XA 4MVJI 3TCXB 2NO5A 3SHFA 1DMSA 3SQDA 2CKMA 1ODIA 5KHKA 1WETA 3LJKA 1WUJS 4QUGA 1DCFA 1XYOA 4YNIA 4WM8B 2WKKA 1IEQA 5J4YA 2FNAA 4LWQA 1AUQA 2R072 1W19A 2BKVA 3N9PA 1YDMA 1CJVC 2VYFA 1NVDA 4QFMA 5KXCA 5JD3A 5GVSA 1CETA 3EVFA 3KVVA 4G4IA 3KDSE 3ECCA 5PGMA 4AMYA 1TKCA 4BBPA 3MRVA 4XIJA 1HIXA 3N59A 4Q9HA 1TM4E 4Z2WA 2JLCA 2SICE 4LE1A 3DT8A 4CEWA 3ONFA 3PNBA 2G7MC 5K0ZA 3E9EA 3E3OA 4LSGA 1CB0A 4L3WA 1LULA 1XXHA 3UATA 5HGJA 5FAXA 4F7DA 2JC3A 1R37A 3B9PA 2O2CA 5KOYA 4FBMA 4W5NA 2LIVA 1Y33E 2PU5A 1UFVA 1KMNA 2WWIA 1Q91A 1Y7TA 2GCNA 4MGZR 5DGDA 4U1RA 4PG5A 1D2EA 5INTA 2BEUA 2VPVA 5JMWA 3S2YA 2O3RA 2RCNA 4B6FA 2PH5A 3HDGA 1ZIOA 2R1DA 1CIWA 2FX3A 1U2ZA 2R751 4BMOB 4JJ4A 2A6YA 1DPFA 4YARA 1OI2A 1SBIA 3WGIA 3P9ZA 2GF2A 3TTTA 5F32A 1ZJYA 2I6XA 3GLIE 1G8KA 4LXHA 4KIFA 2GEBA 5CDTA 5CXXA 5K3AA 4D4LA 1K5MA 1ZNXA 3JQFA 2WD8A 2RG7A 3U0ZA 2P3YA 1JF8A 2BR5A 3A4UA 5IAGA 4ZIRB 5T7BA 4FEEA 3RHTA 1F2DA 1INLA 5A0FA 4F1WA 3GA7A 2QT9A 3WB2A 3QKWA 5IXJA 5LIPA 2BN4A 3C3VA 3L41A 5M5BA 1Z6XA 3DMNA 1C80A 2ECKA 2F3SA 4M37A 5IHXA 1GQSA 1W76A 2PLAA 2HBQA 3MOSA 3I6BA 2GMWA 1ULZA 2FEXA 1JHYA 5AK0A 4WZAA 2QJVA 4FVTA 3KSDO 4LY0A 4XIGS 1EWKA 1E7WA 4CLEA 3G9UA 3FJSA 3WW4A 1QCZA 5L3SB 1E20A 4IOKA 1RCTE 3N2GB 2Q6LA 5KNDH 3AZZA 1FNSA 3PNQA 5FO8B 2QJOA 3KT8A 4GGPA 4NMHA 5L9RA 5B55A 2Y6KA 2XCIA 4FXOA 5EEGA 4FI9A 4XTPA 2QFEA 4E32A 3K4ZA 2P0AA 1U4SA 4PNEA 5TARA 5CG8A 1QTRA 4G36A 5F5QA 2WTUA 1FC0A 3FVRA 1CR6A 4MA4A 3DE0X 3OGVA 1RXWA 4ZJZA 5C3UA 3TJZA 3JVUA 3ACLA 4GB31 4L9RA 1W2NA 4LW8A 1NVWQ 1G2PA 2COKA 3HZZA 3RYCB 1NX9A 1UBGA 2WNUB 1TZOA 2PDAA 3EGDA 2BFOA 2R32A 4QYSA 2EYQA 4OXYA 4BZ4A 4RH3A 3K8YA 5EE0A 4MRAA 3F4KA 2GK7A 2P30A 1UYXA 4MV3A 1YB7A 4BWYA 5ER6A 2D06A 3ZUGA 3R24A 1ZWLA 2YVUA 2GZDA 4CDQC 2HPVA 2FG5A 5IKPA 5ENVA 3L8CA 1HRI1 5DBEX 5BYAA 4P4UA 2FYTA 1TUGA 4F84A 4BK4A 4NEQA 3JU9A 2G08A 2AR0A 3E5QA 3LIIA 2SCUA 3QVVA 4G0VA 1G2QA 1KO4A 3P26A 2NPIA 3FCXA 3F7NA 2P3IA 4DB4A 1RMTA 3MPPG 5BVHB 2G72A 1T15A 1E5TA 1U7OA 2ARBA 1I33A 3HB4X 4GSYA 2P3QA 1MC5A 4C0JA 4OSPA 1HNNA 2HREA 1YXWA 1QO0D 4JLUA 3NHJA 4LDPA 3KR9A 1NLUA 1M7HA 3VPFA 1SB9A 2EDCA 5BPHA 4TWRA 4WKPA 3K0EA 3ETGA 3GPDG 1SXIA 1U5ZA 3W06A 1JQBA 3SEZA 1S1AA 4JLMA 4IEVA 2JL1A 5KOJA 2YZMA 4E7PA 2D98A 1ZITA 3VKFA 2VATA 2R5NA 4LHEA 4RD4A 2GD6A 1VIAA 4CM9A 3EEBA 3OI7A 2IHUA 5ALJA 4KRFA 3M4XA 4NV3A 4DMFA 2RDMA 1FLNA 4DUGD 4L8VA 2JFXA 3ILNA 2BFFB 1RGSA 3RPQA 2GXUA 5F64A 1RWXA 1EQAA 3SNMA 4KAFA 3GCZA 4E31A 3E61A 2ZIEA 3HN7A 2D5IA 2CGPA 3S6PA 2QTWB 1F5SA 3NV4A 3V1LA 4PANA 1JR4A 1IB6A 3TRKA 2FMYA 1QJZA 1ISJA 1Z88A 5DN9A 1ISMA 1TNDA 4HX2A 1J7KA 1RUE3 4JKLA 5IVYA 4QAQA 2RIPA 4IIFA 1P1KA 2HX1A 5JBIA 2CE7A 4E3ZA 1V96A 1DT5A 4L9AA 5F39A 2PQSA 3UPDA 2QLNA 1Q1BA 4C87A 1SO8A 2V4MA 4H7IA 4MI9A 2FUG6 1PO7A 2YQ4A 3RSHA 2Q4DA 1WLYA 4PQQA 4H4EA 2AC7A 3IX7A 2MNGA 4IH9A 2V6BA 2J1TA 2EHDA 3JQXA 3ESRA 2YINC 1JJAA 3K0AB 2IPLA 2BJHA 1HQDA 3HB0A 1T8UA 4GJZA 2E7QA 1UMCA 3OZUA 4HC4A 1E8NA 4N6GA 3OO0A 2ZRNA 2RGNC 3KTAB 2GD2A 1QZZA 5GZGA 3F46A 1YFXA 1G8JA 3D8RA 1G6HA 4WY5A 3ABOB 3S2IA 1Q5OA 3F3YA 1K5GA 3COZA 3HGMA 4DR6B 5JYEA 3H1YA 2J41A 1W8NA 3BGSA 1AT1A 2HHJA 2QA5A 3LE8A 3IPCA 4M3CB 4IRUB 5JSZA 3T4HB 3LLMA 4RPCA 4AX4A 2WHPB 4UPEA 1UBSB 4R8RA 4D4IA 1BRMA 2IW3A 1USIA 4MS3B 1Y9AA 1R0SA 1ELOA 5HBGA 3PNLA 1WVIA 1K27A 1T0HB 3AKDA 1RUOA 1UZUA 2HSGA 4ZCRA 4TLMB 1T2NA 2HBYA 5FO1A 1BQ3A 3K1YA 2F43B 4G56A 1Q43A 5CYPA 4PGAA 3UFXA 4I50F 3UG7A 2OZEA 4RJJA 1SVLA 1PR0A 4J16A 4X1OA 4ZQFA 3TQSA 1PT6A 5M2QA 3NDBB 2V6MA 2NQTA 5L7YA 3I7DA 4C05A 1SXJE 1A3KA 1PX4A 4WBNB 4RL6A 1W75A 2O0LA 3K73O 3H9BA 2QKDA 3UKTA 3EPLA 5MN5A 1A7AA 3SWWA 3ESYA 2HA7A 1BSVA 1WX1A 2ZREA 1JMVA 3VKFC 4GPD1 2C9AA 4YRJA 5TVGA 3ZE6A 2QN6A 5JU6A 4AAYA 2VNVA 3FOZA 1J8QA 2DBRA 2F9LA 3HCFA 4CMIB 4X1KB 2CDBA 3DMDA 1YQCA 2YC4A 1FFXA 3KHTA 3BODA 4YR9A 3TDNA 1FFYA 4MUGA 4ZOBA 2F4PA 1QHYA 4D6QA 1JG7A 3QHQA 1Z7S2 2Y1FA 3AZWA 1D4FA 4YCBA 4QDZA 2VAMA 3RVOA 3QELA 1LNZA 2R8YA 5JDCC 3UF0A 3E7XA 2GZMA 4BO1A 4I1IA 1BOOA 1E4EA 1H1IA 1IJFA 2QV7A 2HCBA 1RAIA 4QYIB 5HCFA 4Q4HA 1U9YA 4YRZA 4LOAA 2VXYA 3PR2B 1UQTA 4JDNA 4QREA 1R1A3 1GPKA 2XMZA 4GWJA 2P4HX 3R9IA 1W39A 4IUCS 4NCAA 2P4EA 1P2GA 3DO6A 4OPMA 4P33A 3TUIC 3DL3A 1MW8X 3LUAA 3I3OA 1ACCA 3MCAA 5E1OA 4EENA 1HRI2 5GLUA 2FMDA 3NIBA 3JD3A 1NSYA 5EWLB 1FXUA 4FQ4A 5EPEA 3FUXA 1VPEA 3HL4A 3UV7A 3NJZA 4I4LA 4BX9A 3DMHA 3OJWA 3PV0A 5BQOA 2DULA 2ZS7A 2OPBA 2B7YA 4IFTA 4YJ2A 5DE3A 1E3WA 1DF0A 1AVBA 2RVAA 1CJUC 3FSJX 4N4AA 1QIMA 1JSZA 3CLHA 1MQTC 1U9JA 4M9SA 4Q1PA 5AHKA 4C43A 4QUIA 3PEUA 5KTRA 4FPGA 2QT0A 1RPZA 3N0RA 2XJUA 2A75A 2J0UB 2ZAHA 4J7UA 1BKYA 4BAGA 2SHKA 1NW9B 4EABA 3DBLA 1OLSB 2I6UA 3GOQA 2JIPA 2ZBDA 4N6NA 5FEMA 1BWPA 4N3NA 4QJIA 2OV4A 2RV9A 1P6UA 4IXNA 1O5TA 4EO7A 1QJU3 2C1FA 3EZ2A 3A6PC 5FK7A 1HDCA 3PRHA 3BGIA 4Y22A 4PIZA 2NUTA 3UOAB 1TTPB 3VR5A 2DUOA 5IYYA 1GFSA 3L8DA 5LYJF 4M36A 1Z15A 4FO9A 3A2MA 3PXGA 3ISVA 4ZWNA 3BD9A 5A1JA 4FFPA 2P65A 1CJCA 2TMGA 3RHSA 1GR1A 4B9EA 1S55A 1VBC3 2QZJA 2AC1A 3V2IA 3JQWA 4G07A 4QGGA 1DQ1A 2BR4A 2B1QA 3U16A 3AI7A 4ZA2A 5GIOE 4BAZA 1OQDA 4ZT7A 1TZCA 2GXQA 2L19A 2CB0A 4FE3A 4YWHA 2WZCA 3OD1A 3KEGA 3WNKA 1GQGA 2WNUC 4DUZB 4XM0A 2AT1A 1P9OA 4C2BA 3ZHRA 3AERA 5EPOA 1YZKA 4Y9UA 1AS2A 4BKQA 3QWBA 1ZI6A 1JZ2A 1FFSA 4LE2A 1MIOA 3LKZA 3HCWA 1TMF3 1CVIA 3V48A 3F2IA 3LX5A 3QPVA 1XZAA 3EOAI 1VECA 2Z2ZA 2WVAA 4W99A 4MHSA 3IEUA 3ZDXB 3K9LA 3QRWA 3DDNA 1RVF3 1DKNA 5G40A 1OLUB 1WZ2A 3NFYA 4FMDB 3TZCA 4LUKA 1CYEA 1YNSA 3H2JA 3MBKA 2WA1A 5D00A 2XVXA 3QEMB 3RFUA 1GZ3A 5AW3A 4P0PB 3T0DA 2ZSEA 3U31A 2JVJA 3FTEA 4UJ5A 2HU2A 2ATVA 1R50A 4CMKA 4XLLA 2BI4A 5EMKA 2EFEB 3CXRA 2CFCA 4X90A 2VH1A 1JIVA 2GTHA 3S8MA 3AEKB 1MS5A 5IJ0B 2JLUA 3QFRA 4U00A 2AD1A 3MIEA 2FZGA 3HKBA 4C29A 5JNWA 4C5CA 2GT1A 4JI3B 2Y6GA 1VJRA 4TLCA 1UBMS 5FV7A 4EVQA 4FSDA 3TFWA 5FBLB 2BFNA 2V9ZA 5GGYA 3BRWD 5FPKA 4R1TA 3U3OA 4F12A 5H3LA 3V1KA 1NP7A 2PS3A 1RAAA 4GT1A 4LF4B 4GGMX 4KFRA 4CDXA 3UXMA 4L07A 1C8VB 4OI2A 1JG3A 4C01A 2PRJA 2E6VA 4IDCA 4DZGA 1FBNA 1Z74A 2QJTA 4IUDS 1HLCA 1E7YA 2DCMA 3VR3D 3NBKA 1EDBA 8AT1A 4TRMA 2XD4A 2REXB 1A3CA 5DM4A 2PLV1 2GAFA 3VDRA 2Q5LA 1ZW1A 3TOXA 2B9UA 4HEA1 4CLHA 2W95A 3U9TA 5B7GA 3JAKB 4WZZA 3I58A 4I3GA 3IMMA 1QNWA 3A2NA 2QIOA 3B38A 3FTCA 4PO1A 1HDIA 5J37A 3W04A 3FFZA 1HRV1 2PGLA 4FNGA 2WDPA 1UX6A 2ZJZA 3WCRA 7MDHA 3N74A 2ADOA 3JWHA 4OCZA 3U09A 1MA3A 1WG8A 5C9AB 2E48A 4CCYA 2P6PA 4OB7A 1H8TC 2AOTA 4P5PA 3JD4A 3LC0A 1M1YA 3H1AA 4PLOA 4FYIA 3AMVA 2PGNA 3G2NA 4PICA 4WJLA 5IDWA 1VE6A 3O0DA 4A0GA 1R083 3N76A 1GU0A 4BP1A 1T4MA 4C1XA 4QX5A 1WXXA 1AF4A 1NIPA 5FK8A 1PL7A 3LAWA 1PKXA 1K5HA 1EXVA 1VMIA 4URUR 3I2KA 2BGCA 1XG5A 2IUYA 1YF3A 2GTIA 1KY5A 3O8CA 4PHGA 4TWIA 5AKGA 2XBUA 2YFQA 3A7EA 2V5AA 3D7RA 2GCIA 1JLRA 3V4RA 5D8AA 2V1XA 4ZV4A 1GTZA 3HJUA 2DWCA 4G0PA 2E4UA 2JK1A 2NO4A 3K15A 1TVEA 3GLGA 4EG1A 1DEXA 2YIJA 1BH6A 2XVZA 2BMWA 2QENA 2ZBGA 4WNAB 1S2GA 5L3RA 4GUAA 3JXSA 1KFEB 2ZAIA 2JJ2A 2XDYA 1JVBA 1L4YA 2AGVA 2PAAA 1TO1E 1W93A 5A7NA 3R7WA 3POJA 4NL4H 5I8SA 2MYNA 1VBE3 3R7AA 4P14A 1HFJA 4H3KB 1UMDA 5FY1A 4K6BA 3MSCA 4JQRA 3O8RA 4KWJA 1GYPA 5B12A 3BJRA 3ZWBA 3C14C 2WAMA 5J7MA 2FUCA 1JIIA 1QQ5A 5CH5A 1OFUA 4BQFA 2X9QA 1BXGA 3DDSA 4KPUA 3TZEA 2JFPA 5JV5A 2AD5A 1Z4QA 1KZ1A 1OKQA 2XIJA 1M8GA 3OCYA 3ZK9A 4KH9A 4L78A 4JJZA 2FK8A 4YW2A 2ENUA 1VIMA 3HVKA 1FQOA 2WJGA 4M88A 5K05A 4RLFA 3OZXA 5F6KA 4C7KA 3BORA 1J2YA 3ESAA 2ATCA 3WNQA 2RI0A 3EZFA 2AYHA 3POYA 2GOYA 5K0GA 5K8TA 4MQUA 1O5IA 1XZHA 3TAXA 4QDTA 3BPZA 4ZARA 1R6XA 1U1IA 1ETUA 2OXFA 3U3ZA 4PV7A 3MC1A 1ILWA 2ATIA 4ASKA 4AQTA 1EE1A 3FNGA 3QKIA 4N5LA 1OB2A 3G0GA 4URWR 4QFDA 4RTPA 1V9U3 4RYLA 5I0DA 2CBXA 3C8MA 4DCTA 1EVLA 1AH2A 5BSTA 2J3HA 1I7PA 4B3XA 4AI3A 4PLTA 2PUHA 2P3SA 1DLJA 3D81A 4ZO9A 4UI9L 1R1ZA 5SICE 4QBTA 2AR6A 4F2WA 1AUYA 3V8QA 2WSUA 2VPPA 4DL9A 2A1XA 1H6AA 2GCGA 2ISCA 2DFKB 1G64A 1XP8A 1F6WA 2H1SA 2JLBA 4CDNA 1YS2X 1DV2A 4X8NA 1G9AA 1YA6A 3G59A 5HXAA 5DP1A 3L8ZA 4AVAA 2GHQA 3PKZA 5F4BA 3S2ZA 4HFJA 2A3NA 3TN92 2IYNA 3ZHSA 2RK6A 3QW2A 4KH1A 4KH0A 5DAVA 1S4QA 3W8FA 3C7AA 4U6NA 2XE7A 2MYPA 3UKOA 3PIGA 4KXNA 4D4GA 2HLPA 5CFQA 2DX7A 3KEMA 1JDBB 5I4BA 4XVHA 4W5OA 3IVRA 5IBCA 4MLPA 4O9GA 2G88A 5KNCA 1M2WA 4DIUA 1XJCA 4R1PA 2Z6QA 2Y38A 5G0WA 4IINA 4YMHA 1GGMA 3UBMA 3KPJA 3T7IA 1L5LA 5KTYA 5LA1A 1F5JA 4HH0A 3OZFA 5TPWA 4RPGA 2PY6A 3WWCA 3GLFB 4UFJA 2IE0A 1DV1A 4HGZA 3IBYA 4BZWA 2QUHA 4LZAA 2QLLA 1KFBB 5E6SA 3WRYA 3H5LA 4KXLA 2G70A 3ZN2A 2I4MA 3PLAE 1QMJA 2PR7A 4PBOA 4TYSA 2Q46A 5KSYA 1F3LA 4EX7A 3GX1A 4XYLA 2EW8A 3QU9A 3H2HA 1KVQA 3USUB 4GC5A 3TN91 1J07A 1AX9A 1M2JA 5DRTA 3WDSA 3OBBA 4ND7A 1G60A 2VJQA 3WA7A 2CVQA 1Z0FA 2C8LA 4BQXA 3EF0A 3WL7A 2EYUA 2ZSJA 3ZY6A 1S6YA 3KOOA 2B37A 2O52A 2W4MA 3KM0A 3Q2KA 4PBSA 3CLPA 3QYAA 5LYJB 5B3JC 4M7RA 1NAIA 1HB1A 2LTNA 4CPDA 1N0WA 1JRLA 1V7QA 1Q2XA 1OFIA 3WSTA 1TFRA 3QCWA 2ZX3A 1JZ8A 3ANYB 4I36A 4II7A 3NBMA 1SN7A 1ZI9A 4HXYA 1Q16A 5H70A 1K7YA 1EFRA 2I71A 5C9ZA 3P6BA 2BFUL 2Y77A 3K9HA 4G5XA 4BV3A 3DL7A 2Y05A 2IIVA 4GMP0 1JDNA 4Q9KA 4RA6B 5D8DA 5LN1A 5FUYA 3VSBA 1Y9JA 1ZVVA 5C34B 3NWPA 2RHBA 1E3DA 4QG7A 5KYUA 4NMXB 3NO4A 3VXKA 4OXQA 2IHVA 1ADFA 1DDOA 3IDBB 3C5HA 2R4QA 1IK6A 4C6TB 4PLPA 3QSGA 3HP1A 3BI3A 4PLVA 1RUI1 3CF6R 4ZT4A 5K6RA 1KBQA 4Q0QA 4CUKA 3QEAZ 1GPJA 2A59A 1JR3E 3WWZA 5CW2A 1SC6A 2IF2A 2QUBA 3B7WA 4DGQA 2R1VA 2VH5R 1XD8A 5KTKA 1LZKA 2GPJA 2VFAA 2IXKA 3FI9A 5E9JA 1VBA1 4A7KA 4B3IA 1WKBA 3GO4A 4HVRA 4COVA 2P68A 1DQNA 3DMGA 2OCPA 4PHFA 3CVVA 1V9LA 4JUFA 4PSDA 4ZKDA 1TMOA 4BQWA 3EUEA 4LBWA 3WYNA 2DFCA 3UWOA 5HF8A 2VTBA 4AFBA 4KL1A 1YLLA 1W4ZA 3R3ZA 5TF0A 2ZGPA 2EERA 5JHHB 1TK2A 4GPIB 4Y30A 1STOA 3SHRA 4RF2A 4D4MA 3MLJA 4YZ5A 3ZYRA 3EGVA 5HI0A 4IIJA 2PVPA 2E51A 5K9YA 2C7QA 3R4DB 5IT0A 3VYSB 3DE6X 4IUGA 3M9LA 5C35A 4XQCA 4W1RA 3NMUF 5IT9A 1BNCA 1S0BA 3MIBA 1XKXA 3RU3A 1ZO8A 4NWVA 4RYDA 3EN0A 3QYPA 3TINA 3ZGZA 2IH4A 4C4RA 1YZFA 3S5JA 2JAXA 1JJ7A 5I9NA 1J8YF 3HR4A 4OQFA 1EX1A 3L4BC 4K9DA 1P91A 3GT7A 3EZ7A 2GVNA 1QVWA 2HPHA 3B7PA 5IAAA 5FZBA 1QHHB 3TRIA 4K20A 3HV2A 3A7DA 5HMMA 1PWZA 5I45A 2JFOA 5TDHA 4J2TA 3WJ1A 3WNNA 4ENPA 4CQLB 4Q01A 2L18A 3C6ZA 1I9RA 2ZCJA 1F48A 2C9DA 2R8OA 2P5TB 4OFWA 1I0ZA 1AYN1 5CA1F 4N0DA 3ESQA 4RSHA 1P5HA 3PJRA 1A97A 3FYCA 1KI1A 3KB6A 4BKMA 2OWEA 2IIBA 2I8LA 1V3VA 3AOGA 3ZTYA 4P9JA 2VSYA 5ITVA 2QMUA 3RWKX 3ATGA 3ETCA 2C7BA 1H3FA 1PMHX 1WA6X 2VOVA 4GULA 1OH3A 1A2BA 4IXDA 4FPXA 2OS2A 2P5BA 2JLRA 4XWWA 4G8DA 3OZBA 4IEUA 1IM8A 4CIDA 2VCCA 5GONF 1MO6A 4CL0A 3UJOA 1CV2A 1JUDA 4QOFA 3ZDZB 2DBZA 1Y3FE 4MARA 4XJ9A 2AJCA 3SNHA 4BBAA 4LAFA 2GBGA 3DOCA 4FKMA 3GFBA 3ADKA 2WOJA 4YHHB 4Q0VA 4NIGA 1CJPA 3ZIDA 3OO1A 2RDRA 1WCSA 1R4ZA 3FBTA 4OH7A 2WZ8A 1JPUA 2QVLA 4G0UA 3TZHA 1W9WA 3BE5A 3VFDA 5FL7A 1CR1A 4ARVA 1AR71 3CKKA 2C8KA 1U99A 1CZUA 1UOJA 2AH5A 3GJBA 1RVF1 1L5ZA 5EG5A 3X1ZA 3EOBI 3A1SA 2C9YA 2WI8A 3GD7A 3GWGA 4HGYA 3FHIB 3DO5A 2GFIA 1B0PA 2IUEA 2C4UA 4ASUA 3J80A 3N28A 2G63A 1PQUA