5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
molecule keywords Subtilase SubHal from Bacillus halmapalus
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
3I34X 1NQJA 1BE6A 1Y4DE 1AU9A 1T1GA 4H6WA 1XF1A 3D9QX 4DZGA 3Q40A 2XRMA 2P4EA 1JEAA 2X8JB 3F49S 1WVMA 3DE6X 1AV7A 2ZRQA 5SICE 2V8BA 3VYVA 1Y1KE 3OSZA 1TO2E 1IC6A 2GKOA 1V6CA 1ST2A 1PEKE 1T1IA 4WOCA 1Y3FE 1PTKA 1MEEA 1BFUA 1R0RE 1Y9ZA 3ZXXA 1GTL1 5ARCA 1P8JA 1KDZA 3L1KA 3QFHA 2DUJA 1SUPA 2PQ2A 3PRKE 1A2QA 2Z2YA 5JXGA 2G4VA 3AJ8A 1CSEE 3AJ9A 4B5LA 3JQWA 1SBTA 1Y3BE 1R6VA 2WWTA 2E1PA 1KE1A 2SICE 4KPGA 3VSBA 5AVJA 3H42B 3VTAA 4KB5A 3DVSX 3DVQX 1S2NA 1OT5A 2HPZA 1CNMA 2IY9A 1S01A 1PFGA 1AVTA 2XVLA 1GA4A 4DY3A 4DZTA 1SIBE 1Y3DE 1S02A 2XTJA 4OMDA 3DF0A 2ZWPA 3Q5GA 4K8RB 1SCBA 1C9JA 2W2OA 3HJRA 1ZVKA 2PWBA 4YN3A 1TMGE 2IXTA 3VV2A 5JXIA 1SCDA 5AVKA 1SCJA 2XVGA 2DP4E 1Y34E 3CO0S 4ZARA 2XVKA 1AK9A 3WIVA 1Q5PA 4MZDA 4DY5A 5JMOA 1SBHA 1WSDA 3BPSA 3SQOA 3A3OA 4M1ZA 3PTLA 1AH2A 1NDUA 3BX1A 1GTG1 3ZXYA 4FONA 4I0WB 1TM5E 3A3PA 3D43A 1T1EA 1TM3E 3JQXA 1SIUA 3SICE 1Y33E 1R64A 1C9MA 2HD4A 1GCIA 3WHIA 5FAXA 5ARDA 3TECE 1SIOA 5ARBA 2O8OA 1ZVJA 3TI7A 1SPBS 5B1DA 1DUIA 1TM1E 3DDZX 3QTLA 4HVLA 1OYOA 2TECE 4CFYA 1SCAA 1YJAA 1DF0A 4CFZA 3DE0X 1Y48E 5SV5A 1NQDA 1NDQA 3LPCA 1P7VA 1SBIA 1AF4A 4KG7A 1KDYA 1PJ8A 1BFKA 4H6VA 1TK2A 2Z30A 1OYVA 1GNVA 2ID4A 3BGOS 1THMA 1SUAA 4H6XA 4DJ5X 1SELA 4NE7A 4LVNA 3A3NA 1P7WA 5AMXA 1WMEA 4GI3A 1GA1A 1YJCA 1BE8A 3T41A 4JP8A 3TI9A 1NLUA 2QFEA 2PMWB 2WUVA 3LPDA 1Y4AE 4OV6B 3LPAA 1WMDA 1YU6A 2LUWA 1KFUL 1LW6E 1TECE 2SBTA 3BOWA 3DE3X 4HPKB 1TM7E 2ST1A 1BH6A 4ZOQI 3P5BA 3DVRX 5JXHA 2ZWOA 3DE7X 4HX2A 3VHQA 2W2PA 1SN7A 3DE2X 1MPTA 3DE4X 1SCNE 4WOBA 2PKCA 3I30X 3GT3A 1SUEA 3DW3X 3GCWA 4C3UA 4AKTA 2PWAA 4DXZA 3F7MA 1SBCA 3DYBA 3I37X 1GTJ1 4LVOA 3CNQS 2X8JA 1Y3CE 3F7OA 4C3VA 1EA7A 3WQBA 4NE9A 4CG0A 1UBNA 1IAVA 3DWEX 4BWGA 5FBZA 2W2MA 4RYDA 2W2QA 2Z2XA 3EIFA 1DBIA 3DW1X 5K7SA 4Z2AA 1QXPA 2WV7A 3EDYA 1SH7A 1C3LA 1TM4E 3QMPA 4DWWA 5JXJA 2Z58A 2WUWE 1GA6A 4OMCA 1KDVA 3EE6A 2Z56A 1SBNE 5B1EA 1KFXL 1GNSA 3DE1X 1SVNA 2SECE 2QTWB 4NMXB 1KE2A 1C9NA 3I2YX 2Z57A 4AKSA 2ID8A 3DE5X 3AFGA 1TO1E 5AQEA 1BJRE 1ST3A 1WMFA 3WIUA 4HPKA 2SNIE 2Z2ZA 3GCXA 1VSBA 1SUCA 2PRKA 2DQKA 1YJBA 1U5IA 1SUBA 3GT4A 1SUDA 2PYZA 5CW1A 3UNXA 1GT91 5FFNA 2B6NA 3VV3A 1AQNA 5I9SA 4I3GA 2W2NA 1EGQA 4J94A 1V5IA 3LXUX 1HT3A 4G9SB
chains in the Genus database with same CATH superfamily
1JWBB 5CVCA 1QORA 1QFZA 3CGWA 1S1MA 4AZTA 5AW1A 1OASA 1XF1A 1XNQB 1RVF3 3OEHA 2FE4A 5AWFC 4O2AA 4BC0A 1NVFA 3HDYA 4ZI5A 1VRBA 2LW8A 4KFTA 2WBKA 4DJDC 2NNLD 1U6IA 3GF4A 5IN4A 1XG5A 1I32A 5CH3A 4Y5SA 3HO8A 5IM4F 4F8EA 1OLSA 1HDGO 3LHSA 1IN7A 4MP3A 2IYEA 1VBFA 4BUJA 1R0RE 1NA1A 5BXXA 5L8VA 4ETMA 2DBYA 1UX6A 2Y9MB 3VR4H 3ZJ5A 4N12A 2HN9A 4DVGA 2CDRA 2ZTVA 1C7EA 1QYVA 3VBHC 2R96A 5JPIA 4LOHA 3ZYBA 4YAOA 1UC8A 5JV5A 5LBTA 3ROXA 1VG0B 2Z8ZA 1R6UA 4E32A 1U8EA 4DANA 2IY9A 3KYDB 4QU5A 5CBPB 1EUQA 2J9FB 4H0NA 5BOSB 4DAOA 5TRTA 2WSYB 4RD0A 4F7WA 3BA1A 2C3OA 3TRJA 4DSOA 1SXJE 1CPMA 3I2IA 3WZ2A 2W1SA 5B36A 5GLTA 1UYZA 3V3TA 4LSMA 1UF9A 2NVUB 4OH7A 3VKFA 3O4RA 4YW6A 2UWBA 3UMBA 3R24A 3ZE9A 3CPEA 2YDEA 2NYRA 4MUHA 1RIIA 3BPSA 1BCSA 2NYYA 4PIXA 5EKSA 4NAHA 2WIJA 5CUQA 3IE1A 2BZ0A 4MGIR 5FIXA 3SSMA 3HYRA 4GE3A 4IR7A 4QYMA 3R6SA 3HNPA 3GCDA 3KHKA 1KAEA 2BTQB 1O8SA 5J43A 3AKSA 3P96A 4C43A 2D0OB 3ANSA 3DTTA 3QVJA 2YS6A 1J8VA 2IYQA 4HZGA 1E1QD 1JPUA 4HAXA 4PPFA 3EAFA 4Q9HA 2OK8A 3E27A 2XXAA 3LC7O 2BMJA 3R5FA 4F4HA 4B3IA 1RBQA 3KEQA 5ALRA 4HWRA 1Y8CA 4AG6A 1QWSA 3IAQA 2HSWA 2VHJA 1EPUA 2XUQA 1IUOA 5AYVA 3QEAZ 3UAGA 2ZB4A 4Y0NA 2W47A 2AW5A 3PGA1 5HKOA 1P7WA 3MK31 1I01A 1DZTA 5K09A 3ATGA 2GBPA 4KE7A 4XZPA 2AA3A 3ZVRA 4YCCA 5G0SA 4YUXA 3E18A 3R6GA 3OF3A 3NNLA 3FPBA 2C8LA 3FZNA 1D7PM 5A7NA 4ZRNA 4CP2A 1UOEA 4IIJF 3UWDA 3GROA 2ZUVA 3UK9A 3MLJA 2FUNB 1P4AA 1P2BA 4UVGA 4O2AB 4IX1A 4R69A 3FPGA 3I3BA 2JBAA 3CLSD 1Y82A 3T09A 1FPN2 2AEMA 4JL6A 2WA1A 3JTMA 2QAGA 3RS2A 1EKXA 3FPHA 3LXMA 1FLDA 1CQPA 4D3ZA 4KIUA 1XBFA 2CNWD 3KEFA 1KYVA 1LGBA 4B8EA 1C8VB 2DCUA 4CLOB 2GNDA 5FEMA 3BWMA 2JAHA 4G6ZA 5AKZA 4J2TA 4EVIA 2HYKA 4BGUA 5H1YA 1P72A 4PFJA 4A1FA 2JASA 2QKYA 1VGQA 5CVJA 4YMIA 2C99A 3TTXA 3TFOA 5FBZA 2PO5A 4ZI3A 4UVEA 3VGIA 5JJBA 1QKKA 1YBVA 2ORYA 5HDQA 4JODA 2QPOA 2GAJA 3CH7A 3DLBA 4PIMA 3ORJA 4IGPA 2CCKA 1RXSA 1COV2 8ABPA 1U8YA 2XTAA 4LRQA 3H6GA 5COBA 1UMDB 4BAZA 1CEEA 3RI3A 3SITA 5CT4A 1N1TA 4ENSA 4KMMA 4XRRA 4LJSA 2NXNA 3EAQA 2P40A 4UW4A 3PA8A 1ORDA 2BRUC 4RV5A 4S1OA 3AOEC 2P30A 4HNTA 5F3CA 1TTPB 4PNPA 4F2DA 4BAGA 4RF2A 3V1UA 2QGNA 3OYWA 5FOXA 4M4PA 2JBHA 3UMRA 3HRIA 1NE6A 3DLIA 5DIFA 2DBIA 2RHBA 1J5EB 2XRYA 4UBJA 1ESMA 4LY0A 3MS7A 4ZOCA 2ARAA 3ANYB 4GQIA 2ZGTA 4RJJA 3KALA 3MTEA 4WT7A 4Q39A 1P74A 2X9LA 4Z5XA 5K8JB 4LPSA 3RMYA 3LDGA 1XBTA 1GOFA 4FPKA 4E1VA 1PS9A 4OHPA 3W9SA 1U9ZA 1B4DA 1Z3CA 1NMSA 4DMHA 5CVDA 1VSUA 5A70A 2WN2A 5LP6C 5DDIP 2P4HX 3SXJA 2R041 5DCWA 4HEA1 3LGRA 4KSBA 4G9BA 3N0XA 1MEEA 2HCRA 2VNGA 4OEHA 2IXBA 3U7GA 1IZ0A 4QM7A 1C1HA 4QTYA 3P0HA 3VUOA 2G8NA 3OGSA 1U04A 1E4VA 4NTZA 3WWOA 5BMVA 4GH4B 2RJNA 1SPPB 2XMPA 1XZBA 3P52A 4GM1A 2XD9A 1D9ZA 5HQJA 3G7DA 2X3UA 3AP1A 1R5BA 2FZ1A 3COSA 3AIMA 4YO8A 4PICA 1H4GA 4XABA 2AHRA 2F3PA 1Z2AA 2YXPX 1TE1B 5ISMA 2H63A 1C9JA 3KQPA 1CUWA 2VWGA 1R9MA 3BUCA 4L97A 3D8SA 3KVOA 3T7DA 1NTRA 1T26A 5CNAA 3CRQA 2AG1A 4NPRA 1QR2A 4GD4A 1RI4A 3EXFB 4AVYA 1FIUA 1G8WA 3USZA 5C4WB 3I9JA 2YFHA 4YRDA 1K5DA 4IEXA 3SR4A 4ALLA 3FOCA 2I07B 3PU3A 1JF8A 5DMXA 4OQZA 1PYOA 1PR1A 4DMGA 4BPBA 4M1YA 4C20A 3VN4A 4MR9A 3PJRA 4GX0A 2VC2B 2TSYB 4UFMA 3MJCA 4X8PA 4E5YA 1I2CA 2AH5A 3BMOB 4Z4FA 2HV9A 1I2BA 3ZHTA 2IS4A 1RYZA 3L0SA 5KYUB 5DLDA 4M8SA 2XXZA 1VAVA 2EIEA 2R7NA 2BCGY 1WXQA 1X70A 1T9CA 3DNFA 4C30A 2Q27A 4O4HA 5COQA 3HUFA 2V65A 5EZYF 2FQQA 4H77A 1AR83 4P2GA 1LV7A 4IBOA 4ZGBA 3BTXA 1NA5A 2QP9X 4N7JA 4EUNA 3ZCVA 4D3DA 4HEHA 2X7XA 3FWKA 3LXRA 4KU7A 4LKFA 3WOGA 3L2OB 4AHXA 1VE5A 4BE9A 5B30A 3LUAA 4PHHA 4B76A 3C85A 2PYIA 1YQ2A 1JN2P 3Q8EA 4CMGA 1W36B 1EFPA 5DAVA 2VP5A 3DBRB 5JW6A 4Y0VA 4NCIA 2ZJFA 5F7OA 3UWOA 4LFAB 3UHFA 1AXYA 3W5DA 5F4ZA 3WQ7A 3IEPA 2A6YA 2Y1OA 1LV8A 1ESNA 3OF1A 4NVPA 1LLDA 2I9PA 1L5HA 3VHLB 2OYRA 4KOAA 3I30X 1F4HA 5FYVA 3ESRA 2ZE6A 3V4PB 4WOPA 3WRYC 3G1UA 1F2UA 4FYPA 4RU1A 1W8NA 4CRWB 3TIIA 4FOTA 2HBRA 3O8OB 4O1HA 3B6MA 4I2OA 4NRMA 2H65A 5LZ9A 3DAHA 2EF1A 4BL5A 1RUH3 2XUFA 1NQWA 3G0OA 1ZG3A 1DBVO 4P8RA 4YAEA 1V71A 1GNYA 2GO1A 3NUZA 4B6OA 3MRVA 4YMLA 4AT1A 2ZM5A 2DFKB 4IUYA 1KERA 1C3LA 2AJCA 3FFZA 3GGSA 1ILWA 3V56A 3CF2A 1E6KA 1ST8A 3RAJA 5APAA 3ES4A 2F59A 1SWVA 2NU8B 3RIXA 3FG9A 4NMXB 2H54A 1UM8A 5KTKA 3TLCA 4HNRA 5ADUS 1LNQA 1WDWB 3G7SA 1GPLA 5F73A 1M0TA 2A1XA 3NJXA 3Q6MA 4RXUA 4XAAA 2HNBA 3AMMA 3TOJA 2XBMA 1K3UB 1G9TA 4MDFA 3PUXA 3C7EA 5BO5A 3HJTA 2BJHA 4L0QA 4CN8A 4BTLA 2DFDA 2DFPA 4ENQA 2OT7A 1PX3A 3QEMA 3OEED 1FP4A 4R3NA 4R40A 3O94A 4DS0A 1U0TA 1VRVA 5AHKA 1OXXK 5I9SA 2PS3A 4DVJA 1T9DA 2VUHB 4GI7A 4DG8A 2HMSA 1N6HA 1V5IA 1RWPA 5F9MA 4I09A 4BXSV 4JI3B 4XTPA 4LTDA 5FPLA 1K7YA 2PLNA 3QFFA 1WUJS 3L4JA 2ES4A 1L7QA 1C4XA 1QK5A 3NVMB 1DAHA 3B8HA 3WFJA 4CUJA 5I0SA 3JAMA 2JNWA 4UXHA 5LQJA 3OI7A 1EM8B 3T7TA 3TRFA 3ZBUA 3L7CA 5GJWC 3IN9A 2JLWA 4BWFB 4IXNA 4HAWA 5TQ0B 1RLIA 3V4FA 1PIWA 1W0JA 3OPWA 5CKQA 3LF7A 2WFLB 5DXFA 4LMPA 4QX1A 1IPHA 2A59A 4ZVOA 3I1IA 1H69A 2ZAYA 1BXZA 3CRVA 3TMAA 3OZFA 3B5LB 3A9TA 5B1SA 3LQYA 1DLCA 3ZHUA 4UEOA 5EP3A 3UF0A 4MWOA 5EA2A 4UAVA 3F6EX 1QH1B 4FQ7A 1I1QB 4Q3KA 1CHDA 4WZCA 1RHKA 4U7JA 3E5UA 3A70A 4MVJI 3H6HA 4C29A 4ZEMA 2Z09A 1PDOA 2ERFA 1MEC1 1CUZA 4WK2B 2XKPA 3ZX7A 4GWJA 3VV2A 2ZZJA 3OP4A 4G4FA 1XXHA 4Z0HO 1PQWA 3UENA 1BEV3 4LE1A 4EIWA 1UAGA 3C8DA 4J2HA 4XPVA 4TSRA 2PBZA 1AN0A 4ER7A 3LU1A 1OD5A 3C74A 4IWYA 1OR8A 3FBGA 1A4XA 3UJBA 3HBMA 3PHCA 3F2IA 3L1UA 1XQ9A 3VPHA 3SICE 4DKJA 2UZ4A 2BBTA 2R5NA 1FV3A 2VRWA 2JAQA 2VMIA 2FSUA 4NATA 1KHHA 3W1VA 2P6PA 4NV1A 4IDDA 3H5IA 1THGA 1RPZA 1TK3A 2CFCA 5HFNA 3S5QA 1SQGA 2PQ6A 3WDXA 2PDAA 3GDWA 1TMOA 3EGVA 3CB4A 3G9ZA 2UYQA 4QXKA 1EX6A 3T2PA 2L0XA 4Q0UA 4AX8A 3M81A 1F8FA 2AT1A 1BQ3A 4R2KA 3EGEA 1HB3A 4NQRA 3W06A 5IJ9A 3KKOA 3IT2A 1D5WA 3DYMA 1NRIA 3N76A 3SEFA 4YYZA 2OM6A 5CPBA 4HXYA 1Q20A 2UWAA 1TEHA 5J1TB 1MEC2 3WAKA 1GNPA 5LBCA 3B6ZA 2W1QA 3JRNA 3FPAA 3ZI0A 4MH0E 3LCRA 4QUGA 1XD8A 1ZGCA 3LWCA 3MJTA 4EG7A 3GPLA 4WDRA 2YKGA 4NS4A 3PEWA 3ZGYA 2XYVA 3WRYA 4MVJH 2C2BA 1CZNA 2GZ1A 4G86A 3A1UA 4ZQHA 1BE0A 2GTHA 2F9LA 5THQA 5DLPA 2DH5A 3RRFA 3IDAA 1QOSA 1ZM2A 4PFQA 4XYEA 3A2MA 1W8OA 4I2NA 4CIWA 1MBZA 1A8UA 4BQXA 5JSPA 1I1NA 3Q8BA 1GUIA 5SZHB 4UFLA 3NBXX 5A5VA 5DSZA 1JAZA 4RCVA 1U9CA 2X58A 1W6PA 2JF0A 3FZ3A 1MB9A 2P2GA 3IB3A 3QYFA 3H8VA 4DIKA 1PZXA 1QCCA 4PLOA 2WNSA 3LDBA 1HRKA 2CHEA 3FZEA 3O4HA 1RWNA 3V65A 1QCDA 2XMSA 5L4LA 2NVOA 5AM3A 4UOZA 1KRWA 3HD8B 4B4QA 5C3SA 521PA 4ZO9A 5BWLA 3ETLA 3B1VA 4QAWA 5ESDA 1WCYA 3EZFA 2QQWA 2EGUA 4LXQA 2WLPA 4CU7A 1XMIA 4P81A 4F1WA 1VM6A 3TF5A 4ZU6X 3KUKA 4JQOA 2ZYDA 1ND2A 3UOAB 3SS7X 2GAFA 5JWHA 1VYUA 4LJRA 5KYUA 4JXKA 3C1AA 5AQ1A 4DR2B 1IJFA 1AO3A 3QXHA 4JMPA 5KPDA 4BQFA 1I3MA 2I8AA 3TE6A 1T8SA 4GWKA 2BBOA 1U28A 3W5AA 3FYUB 4FEEA 2AEEA 3PU8A 1QHHB 3DTNA 1FNMA 4AVVA 1F5FA 1SDWA 1UFKA 3JQAB 1HA3A 4KTTE 3N7KA 2OILA 2NSJA 1H1MA 3LPMA 3AR4A 3FFBA 2NUTA 5GGYA 3EVTA 3KYBA 3Q7TA 2VUSA 4F7ZA 1YCDA 1KH2A 4PHGA 2O2EA 3VO9A 2IIVA 1GEEA 2BW0A 5EFUA 2ZGUA 2HEVF 3BOSA 4JV4A 2VTDA 3STVA 3HKDB 3JD2A 2XVXA 5LATA 3X1JA 3BTAA 2O8BA 4JJFA 5IAXA 3MPPG 3O4FA 2JHGA 3LA3A 4CKXA 4P84A 3OA2A 2DBQA 1PQYA 2VUTA 3FUTA 3K53A 1Z8DA 1W28A 5HBGA 4IL7A 4F11A 4INAA 1GAEO 1RUF1 2VQTA 1B43A 2AN9A 3GJYA 2Z95A 1WLYA 4YCBA 4CLDA 2ZKNA 4AQ6A 1GYRA 5KHHA 1WEHA 1QJZA 5DAQA 4LG1A 2VG9A 2GETA 4A03A 2GK6A 4PG7A 2WSBA 4NHOA 4QUEA 3R74A 1Q84A 3ITKA 4GZ3A 3CRRA 4IUGA 2W2OA 1YA8A 1XAIA 1KP2A 3NV4A 3GGCA 1KMNA 4B7KA 3ZYZA 4US1R 5LRSA 3HQXA 3EA0A 3O73A 3TTTA 3CX3A 3NMUF 1KH3A 5CRIA 1L7XA 1W8DA 4PQRA 1YQUA 4LO7A 3IJEB 3ONVA 5IVBA 1N7JA 4U02A 3OFJA 4U00A 4ZYYA 3WYGA 4XUEA 3RKSA 3PYLA 3EMVA 2JLQA 4LHXA 3I6YA 3OCJA 3EG9A 2VZOA 4TSKA 1O58A 2XB6A 4UFKA 4ZOAA 1AX9A 4E2XA 4K87A 4R8KA 3V8QA 3UN1A 3L02A 3L40A 2FDXA 3H19A 4KPEC 3A9UA 1HL7A 3WISA 4FYVA 3HWWA 4HDMB 2HRRA 4J3FA 2Z42A 4GBED 2QU7A 4XUOA 4Z51A 1UBRS 4HVRA 1GYKA 5EKUA 3WS7A 2PGAA 3ILYA 1MJGM 3FTDA 5EKTA 3OX2A 4IFEA 3WBFA 1MQTA 5FQ0B 3S5JA 5HUQA 5FPUA 2YN2A 2ZRPA 3GYBA 4MYDA 1REQA 1QH8B 5EEHA 3N9LA 3R40A 1PVC1 7MDHA 4J49A 4CMEA 1V3QE 2BOVA 3B89A 1SFYA 3E6CC 2VP2A 1G9CA 2HWB2 2RVAA 3OFND 2HLHA 3UTDA 5K4HA 5G3ZA 3ZFGA 3A6FA 3DL4A 1H9WA 2ZWOA 1H30A 3D0RA 4NL4H 2CDBA 2UYBA 5SY9A 3N9QA 4BNXA 5TMDA 5JAOA 2C26A 2FDHA 4ESVA 4TUYA 1DRKA 2XH6A 1CV2A 4ZDJA 2FV8A 3MBWA 2HV8A 2WP8J 3RVJA 1GZTA 3KOMA 1MS4A 2FSIA 3UQYS 1N8NA 1JR3A 3BMCA 2ISCA 3PHBE 3KQQA 4Y7DA 4PLVA 4GWGA 1UBGA 4XUDA 1KGDA 1Q56A 4JKIA 5K05A 5TB5A 2VXRA 3SKVA 5AVOA 1WDKA 2EIBA 3T8YA 3DWEX 1FJ2A 5HG0A 2P5YA 4DHWA 2VDQB 1KY4A 3PFGA 1XPUA 3ADKA 4P9YA 1NLZA 2VJDA 2VZTA 1KJ9A 2Q4BA 1YXWA 4PLYA 3F9IA 2FN9A 3WGLA 1IEXA 4LYFA 3KLPX 1Y6ZA 2BFOA 2Q5FA 1ZA1A 1WCSA 1MB4A 4OJKA 4QDQA 5KSWB 1PFWA 4QYWA 1GT6A 4MIEA 3A4TA 4GVLA 4CYMA 3U09A 4MI1A 3JATB 2VSOA 4BVEA 3KYJB 2JDPA 3IMFA 1PIV3 1X0XA 2UZ1B 1OKQA 3OQ6A 3Q85A 3DC7A 4Y9RA 2HGZA 3C6BA 4YCLA 4TLCA 3GA0A 4EEXA 2I6GA 1EHCA 4QOEA 1T3HA 5FNVF 5JAXA 3UPDA 4B3CA 2HA6A 1XQ1A 3MLBA 4C07A 3EXAA 3HJBA 2GNMA 2Z69A 3VJLA 5JPCA 2JGRA 2QUJA 4YXFA 4UM8B 4KN5A 3B02A 2UYCA 4M9CA 3OEYA 2D6PA 4WY2A 3OUIA 4QT6A 1OLRA 5C5TA 3I4LA 4PGMA 5FY9A 3QLVC 4P9XA 4KSYA 4ZV4A 4NJ4A 2LCFA 3K6JA 3G2IA 1YUBA 1YCFA 4XEUA 3BCUA 1KSGA 4Y1YA 3DFFA 5DWDA 3KOUA 4YV2A 1H3EA 3B13B 1YBAA 5I9LA 5F23A 1OF1A 1A7KA 3QITA 2CE2X 4AR2A 5IDVA 4EG8A 1OB2A 4W7HA 4BO3A 3RC3A 2JGDA 3R8FA 4I4NA 4HN9A 3UCFA 5CDSA 5EJZB 1E2GA 3W3AD 2QW8A 5FQ0A 2H9AA 5FUMA 4R4ZA 1ELOA 2RJKA 2J1LA 4LR4A 4J4TA 1ECLA 3BS4A 3VNUA 1T5OA 4LTMA 3VBRB 2GZRA 2WV9A 3MWJA 1NBAA 2R8XA 2RJ3A 2ZUBA 4XGQA 2JK1A 5CAEA 1KDZA 1RZVA 3FI0A 2YPDA 3ENKA 3MJRA 2TMKA 1NUPA 4Q01A 1DG1G 1NUQA 4HPWA 2DLNA 4C4YA 5FIUA 5LMZA 1T13A 4KFCA 3ZYHA 4KVZA 1IS3A 3NJ8A 2YJ3A 4L85A 3ZSJA 3T7IA 4O7XA 1JZ7A 3AJYA 4L2IA 5ALPA 4EQ6B 1OZHA 4RTRA 3OUHA 4UDOA 3U7RA 1YS6A 3BODA 2R3SA 4MGKE 2R6ZA 4AMYA 2JGKA 1CY0A 4MVXA 4AGVA 2VF2A 4Q4HB 1Y34E 3RUAA 1JALA 5AHOA 3KQNA 2W2LD 5KYVA 4NBSA 2WIIB 3NAPA 5M5BA 1ZA2A 2JD2A 1KQNA 3HXOA 3T61A 5E7QA 4N9WA 4XWOA 1SA0B 1N6LA 1PNRA 5JNVA 4TV8A 2HZBA 10MHA 2PUAA 1C4RA 4DG5A 1OAAA 4PIPA 4Y2SA 3D0JA 4V1CB 2UDPA 5K0UA 4B4VA 4R2HA 3BFKA 3MFYA 4RY8A 1P7YA 4UVDA 2CFIA 3JYHA 4TTSA 1CG6A 3TTYA 2O23A 3SH3A 3I7DA 3FPLA 4BNFA 1LKNA 1Q43A 4AN1A 3JZMA 1O94D 2P6HA 4YDRA 4MG2A 3HCCA 3SHOA 5LFAA 2YV4A 3DOHA 5DFAA 2ZOSA 4RHFA 3RJTA 4C1BA 3DOIA 3CBQA 3KKEA 4ND2A 5FT9A 1CJCA 1ZSVA 4K46A 4XLTA 1VRCA 3DBHA 5I4KA 2G83A 4DV2B 2Z4SA 4MO3M 4H14A 2P9YA 4R8MA 5E1OA 4NWIA 3KB5A 1EGMB 5LEKA 2DBZA 4YLEA 3BFVA 2ZKIA 3N2KB 3CMGA 1KJIA 4RADA 2XIJA 1XDBA 3RYCA 4NZOA 3VYUB 4X3CA 1RTTA 2QTZA 4LBQB 4B73A 1QY4A 3KVVA 4I4LA 4X1IA 2G70A 2DVBA 4FR2A 3VKVA 1ZK0A 2B1GA 1IVNA 2R11A 4I50B 3OIDA 2OLEA 5M3BA 3ZZ0A 5D8AC 5HMMA 4BLPA 2ST1A 1JFRA 4IFTA 4Y4RA 3D3JA 2AENA 3KM0A 4MTCA 3MHTA 2HWF2 1QVVA 1S4QA 2F2TA 3HPQA 5IFKA 1E58A 4ZO8A 4HNUA 2XODA 1AJOA 3RT9A 3HBNA 3FYHA 4PFKA 2NG1A 5CB6A 1SKYB 5CP8A 1GNHA 3KSRA 5L3QB 3NC1C 3QWBA 3EEQA 4AI1A 4KZPA 2HJGA 1L4LA 1FATA 2V45A 2EBUA 3ZV4A 3EDYA 4DO0A 4QOSA 3AHGA 2CXTA 1GPKA 4M3NA 4B09A 3A7QA 1JKIA 1N8KA 4M49A 3M3OA 5JPDA 1S0JA 4URUR 1PJSA 2PT9A 3FHOA 3TEZA 2EL7A 3FLMA 2AK3A 1IYZA 1WTAA 1V48A 3MWFA 1ZR2A 3IOEA 4LKRA 3D8BA 2W8BA 3CIFA 3P9RA 1QYDA 1NAHA 1UXZA 3MOGA 3WLKX 3SJCA 4ZJPA 1V1JA 3ZJTA 2A5ZA 1JKJA 1ZOSA 2VMHA 3LH5A 4OQYA 2A33A 1FY2A 4AKGA 3M6WA 3U4AA 2CEAA 1RJEA 5A3WA 1R6DA 1WPGA 1PYDA 1IPKA 5KJCA 1NULA 2DWUA 4M8KA 4LC1A 4JBHA 3NRBA 3JXSA 3VZOA 5HWSA 2VMCA 2VBIA 1SFNA 5JAIA 2VQEB 3RANA 3Q1LA 4LZPA 4DZGA 4KU8A 5IAKA 3FFAA 5B4XA 1UNBA 4QKQA 1V5GA 3ETEA 2QX7A 3W5JA 2XZDA 2G19A 2M6KA 4CM5A 13PKA 2CJFA 1FTGA 4YALA 4KXXA 4C6RA 2Q6VA 4GM4A 4ADSG 3DZ8A 3VU9B 2GH2A 1MJ5A 4YIHA 2ZETA 5AW9A 3DMRA 1EVQA 4E4SA 2C8JA 2FNAA 5EMHA 2HEWF 2VZ0A 4V0SA 3ETGA 5DUUA 4ZS3A 2Q5LA 2ZWAA 2JJ1D 3U37A 1QRUA 2WHQA 2EJVA 4CKEB 2C31A 3K3NA 3BH0A 2QRLA 4QMAA 4JCKA 1RHJA 2DFNA 2FF5A 3OX1A 3DN7A 2ZABA 3SR0A 3IIAA 2KWIA 4F4FA 3Q8KA 1WW3A 4YAIA 4KPUA 3UTCA 1NCQB 3V6LA 3S1LA 3D5OA 3KQ4B 4M8NE 2HSZA 3L4KA 1TW3A 1NN5A 3DWGA 3BF8A 4FR0A 5CISA 4RKEA 4HNVA 3WGMA 2FFAA 3HFGA 3O8LA 1Z0IA 3SCFA 5A6SA 4DUVA 4DS3A 2AEFA 3NIFB 1M76A 2Z6VA 3K8YA 3DEKA 5G04L 4DLLA 4FMCF 3M70A 2KBEA 5A0TA 1DXYA 2XLBA 4R98A 3EB7A 2QYTA 3LWDA 1UBJS 1WCIB 2CDCA 3DTYA 4HAZA 2VA9A 1SIUA 1B0ZA 3R23A 5TLSA 4M2LA 4ZCPA 3EJWA 5LZ4A 4KX5A 1EGHA 4RSRA 5FZ6A 5DH9A 4YMWA 4UHKA 2BMWA 2UKDA 3F0TA 3A0RB 4KMSA 3RFUA 1FXWF 3REFA 2ASVA 3TNLA 2EU8A 3T9CA 1SPBS 4AS1A 1M8JA 4FM9A 2YZKA 1MC5A 4BRWA 2V1XA 2GCGA 5IZCA 2ZE5A 3JAWA 3HMYA 1VHTA 3DE0X 4LKDA 1IOLA 1Z8NA 3BTUA 1SB8A 1OX4B 5KC9A 2FKNA 2UXDB 1RKXA 3HL0A 1LECA 4O63O 2VQSA 3CQ9A 3HXTA 3MT8A 4TQUS 3ZXKA 4ZAZA 2WYVA 5AHWA 1NQTA 3TKLA 4DQLA 3F73A 4FCVA 4GECA 4JB8A 4OOFA 5CITA 2DQSA 4ME6A 1B42A 3ESCA 2VNJA 5B53A 4DUYB 2DPYA 2IYAA 1Q50A 3UJOA 4OK6A 1Y8RB 3W5CA 2GK7A 3BORA 4A16A 2VW0A 4GR5A 5JJCA 4KUGA 4HWOA 1LUAA 1R1A1 1BH6A 2Q2NA 3QLUC 5EUCA 2WY2D 1IG3A 1F35A 2PUEA 5LU8A 4RQTA 3OUJA 5BWNA 2BFCA 2ECPA 3HAGA 3QXSA 1PGW2 3IAUA 4V3BA 2R071 1C9YA 5LQMA 4DA4A 4KWEA 5JIBA 3W8RA 3P2MA 5J09A 2I2CA 1FTQA 3PFFA 2MEV3 3L8YA 3GZTB 1DAIA 4BZXA 3FHQA 3PX2A 2D0IA 1E2KA 5DNYB 2IS2A 3CF6E 3MUZ1 1Z08A 2CLCX 4WBXC 1LD3A 3QG5A 5F52A 1SD5A 1Y3CE 3WB0A 4DNXA 4BECA 4C87A 2DCYA 4YNBA 3E0XA 5DYYA 2G8LA 3QX3A 2R751 1G86A 2IGTA 1G2IA 4YT2A 1W7AA 1Z78A 1HL3A 4UBGA 3QHQA 4L28A 4RA9B 3CUEF 2GPBA 2W39A 1Q3EA 4C6TB 1H8TC 4RX1A 3WNOA 5EINA 3TJZA 3S6PA 2E3JA 3V7FA 3D6FA 1STMA 1YZNA 2A94A 4K28A 3TNQA 2H0BA 3WP4A 1JBKA 3MVEA 1T36B 4F56A 4DDMA 1YTUA 3LD8A 3O5AA 3T12A 1Q1AA 2GQ0A 3AH8A 3BVPA 3WRWA 4B4UA 4RZ3A 2YJTD 4BP3A 4RTNA 4TTQA 4CEYC 2H1VA 1WCIA 3DZDA 4HPXB 3D6HA 4MQ6A 2ZUCA 2CLIB 4F06A 1WB4A 1WIWA 2X10A 1E1RA 4NIMA 4B6RA 2P1BA 5AKYA 4XUQA 5DNCA 4COOA 2HEGA 4R1PA 3LKDA 2Z79A 3Q8MA 3CX4A 3MERA 4IDPA 4YMUA 1UPAA 1BJTA 3RSOA 3H2YA 3L1VA 1Q1NA 2AE1A 2XHZA 1KJRA 3VR0A 3JBG1 3O14A 1F60A 4Q7MB 1YZFA 4EE2A 5FBQB 2QR5A 3V32A 3I59B 5HKKA 4ZYZA 4QYIA 4IINA 3N8KA 4RLSA 2EAKA 4XOIA 3RGBA 3OSZA 4J4BA 3FZQA 1GG9A 5IEBA 4DXHA 4RNDB 1M2GA 1W4LA 1E63A 2WPDA 2JFXA 2NO1A 2O2XA 1UBTS 2I99A 3MT0A 3QX8A 4J0GA 4UW3A 5AI8A 2QTBA 5JPNB 2BBWA 2AYZA 2PHWA 2GXQA 4AAYA 1QMGA 2Q3LA 3PGLA 4M53A 1W9HA 4DC1A 2P65A 1O59A 2WWTA 5DULA 4DCJA 1N6RA 3I2HA 2O2GA 3B82A 2SHKA 2YV5A 4CDGA 3IEXA 5DN6A 4FINA 4Q27A 1ZW6A 5C1IA 3UKNA 5BW5A 3FI9A 3KV3O 4KFSA 3RJZA 1WTCA 1GQHA 2ZBPA 4DBZA 4BE4A 4K8RB 1GRQA 1UT6A 1R4NA 3G0GA 2F1HA 3K6KA 3II6X 2HEIA 1J6UA 5EY5B 5GZ3A 3V0BB 1XRMA 1Z5ZA 3UK6A 3C8ZA 2MOKA 3RIYA 4IWXA 5GOTA 1QJFA 1AQYA 4M9RA 5IH3A 3AX6A 1X15A 2YIVX 5IARA 4LOSA 4M3CB 1ZHHA 3GJZA 3NOVA 2QRJA 1SXJA 1OJLA 3WGQA 3AHFA 3L2YA 3AYEA 2O50A 4IIGA 5EIAA 1G1AA 4BMPB 2ONZA 3TLJA 4FIDA 5KMGA 5DNVA 2FXVA 1ZY2A 2O2SA 5ITWA 1W47A 3E53A 4QUAA 1L4NA 2EIHA 3ZWBA 4MW1A 3QYAA 1DO0A 3HHPA 2VNVA 4DAEA 2H7CA 2IX3A 5H68A 2QP4A 5BQ5A 1TME2 4QHBA 3I2FA 4BP8A 1DTEA 4V0OA 1OOEA 5IJ0B 5JOWA 1H8ED 4J0HA 3ZJUA 5LQUA 4GT1A 2HH9A 2PL1A 3AQ4A 4J7CA 3ZXUB 4KPYA 3FNBA 3SZ3A 4Q4V3 3VBEA 1LTKA 2IQ5A 4QXBA 5L95A 2HKIA 5EZ6B 2CXHA 3TL6A 4OF4A 4ZHSA 4OV6B 1JQ3A 5IEJA 5IUNC 4JGIA 1FP2A 2JJ1A 1J22A 3DE3X 3QWIA 3NCTA 4HPKB 1OYWA 4WFKA 4YHBA 1TNRA 4L9RA 4RKWA 4YFYA 1HDYA 2Z9CA 1ZAKA 2IXLA 1NYTA 4R41A 3MIGA 5F1OA 4X8NA 3W6PA 2OOKA 1KMQA 3SVTA 2ILVA 5DNUA 5D21A 2NTJA 4B84A 1NI4B 4AXXA 1QPGA 2HJSA 5GJVC 1KY2A 5HPYB 2IP2A 3NKLA 3EC2A 4IGEA 4XWAA 3FYDA 3QHPA 4HN2A 3NBAA 4XJWA 5LLDA 4MW7A 2BM0A 5DUXA 3I64A 1GZSA 1POQA 1FSGA 2ZUFA 3R76A 2VHTA 5KTOA 3HNRA 3T5AA 1YD7A 2I6QA 4IEIA 3KCYA 1YACA 4FPYA 1S55A 2DBVO 1OVMA 5IS2A 5ICCA 2HWC1 3E5QA 3JQ8B 3AY3A 4RVDA 1PZHA 3DC2A 3D54D 3I4FA 4NJMB 3I9LA 4QVGA 1JQDA 1NVWQ 4CLRB 3CRZA 3EPKA 1KFXL 3K77A 1Y4UA 2C84A 1PD1A 4LE4A 2QTWB 3X1ZA 1KJYA 2WYHA 4AEMA 3ZTTA 4OBBA 2W22A 4BMCA 3C97A 4X71A 2FPRA 1W2WB 2RS31 4EL5A 3PJFA 1REDA 5ANNA 1OURA 3AEXA 1Q7BA 1BJRE 3VBUB 2G04A 5EMKA 1JWLA 3BB4A 4ND8A 2PRJA 3TFQA 2OYZA 1IJKA 3HZOA 1UZMA 3HN3A 3WQ0A 3AR7A 1NQUA 5I47A 1PK9A 3DOCA 3DXZA 2WZEA 3U3XA 1U2PA 3EGCA 3SNMA 5K99A 5ENDA 2VHCA 5A1TA 5ICSA 4BTEA 3DMNA 3TJMA 3A0UA 4L8QA 1G3MA 1SZCA 4Z2WA 2AMYA 3W05A 1YC61 5BWCA 2C83A 5IUKC 4Y9TA 2HTFA 4QGLA 3RFVA 4ISCA 4OL0A 1I4WA 2ZRQA 3KWFA 1T5TA 4RDCA 1DRWA 4BX9A 1F5JA 3IE0A 1NIJA 1TO2E 2PZGA 2FTKE 2H4FA 1DKPA 3INRA 5U4QA 3GJ3A 4AS2A 2COKA 1W6MA 2W5FA 5L53A 4TXMA 3LQ4A 5EUQB 3RQSA 2VZ8A 4WIAA 5J2TA 2XJTA 2XYHA 2AMVA 2E51A 3JQWA 1MC4A 2YOHA 3VNSA 3FHTA 3HDQA 4UEKA 3WDTA 1SZJG 2VDLB 4DDKA 5CA1B 1NPTO 3VA7A 2O05A 1J2TA 5KXCA 1AYM3 2XHNA 1LPPA 1YVRA 3FJSA 4PC7A 3GLKA 1OKKA 4AOCA 4WN3A 3HJRA 4GZ9A 4UTPA 1SEPA 1E66A 3PFCA 1C2TA 3AEYA 4Q4W2 4MRMA 4DLXA 3BCSA 4MUMA 3HJGA 1RYMA 2EFHB 3HSSA 3N8DA 1VJ5A 2VE1A 5AOAA 4Y1RB 2RS33 4UUOA 3F90A 3WTBA 1TMF3 4UMDA 4RLHA 3TUJC 2W4MA 5I0TA 3PXDA 1GR1A 1FBTA 4TXHA 4OI2A 4MZXA 1UAAA 2VP0A 3QMVA 1LBIA 2VCYA 1E1YA 2ZS7A 4KP7A 4OIFA 3UGGA 4HP8A 3DDUA 3TDNA 1NG0A 1LSUA 2J1AA 3SHRA 4YYOA 1R16A 1OI4A 5P21A 5BWBA 4U3JB 5ARDA 2KR2A 2F9FA 4HLCA 3UW1A 4NO4A 4MCJA 4MKIA 4BN5A 3QVKA 4EF6A 2FY8A 1H2EA 2CHVA 2WU0A 1OYOA 3L3BA 4WBBA 2ODQA 5KYXB 1U1GA 1Y1TA 2V6GA 5FYUA 5T5PA 4PNZA 1MENA 1D1QA 1M0SA 3I61A 4E6PA 2ZTHA 1IIBA 4E94A 1GR3A 1C3XA 1W4BA 5JBQA 2O8QA 2OXEA 5EJ9A 3WKAA 2F17A 2OFXA 1C5KA 4IHJA 3RSGA 3E84A 1FB5A 5H81A 2X0EA 4GMP0 4J16A 4RGGA 4IXMA 3SC4A 5E0OA 1QIQA 1Y1SA 3RUDA 2C7GA 1O6BA 2WTEA 2Z8YA 3G17A 1KAHA 5JZGC 4UHJA 1BCRB 1HQCA 2QJRA 4LJ7A 2J7PD 2EGGA 3E9ZA 3B5IA 4BPZA 2BR3A 5A3LA 2XITA 1U7WA 3LVFO 1DKUA 1FP7A 2B45X 3LHKA 5T4EA 1N5KA 2OWDA 1I33A 2Z2IA 1VPWA 5JAUA 2IOHA 1AT1A 1VKNA 5AW3A 1KJWA 1SCNE 3RWBA 4JK3A 3EEOA 1MN6A 1C2YA 4B0PA 5BUCA 2VTBA 1DFGA 1GU0A 1KK0A 4P9JA 4RCYA 4NRDA 1RWQA 2XNDA 4X64B 4CKCB 3CMCO 2XKKA 3B8EA 2WZR2 1XLWA 1P4HA 3EPPA 5BV8A 5LSAA 4YP1A 5JSZA 4YYEA 4PQEA 1F0KA 2IDKA 4BVAA 4ES9A 1Z82A 2GKSA 3MYXA 3A2KA 2AVNA 2IQIA 4YRGA 5AHXA 4D4IA 3I62A 1ASJ1 1YRAA 3U0ZA 3ZY3A 2VHYA 2AD5A 2I33A 1S9DA 2WVAA 5L7OB 3MIEA 4PN7A 3A1DA 4RGQA 3BI3A 2QZ3A 2H11A 4LOKA 4RIHA 4AKSA 2VBFA 1MQAA 2ZHKA 1M34E 2CD7A 1TXGA 4WV8A 1E5DA 3Q9OA 3AI3A 1HETA 5CFDC 1HDRA 4Q4CA 2VCBA 3F9CA 2WNUC 2MR6A 3CUWA 3I32A 2WKPA 4GWNA 4XMIA 4HG6B 3F5FA 2O0MA 5IDXA 1Z6YA 2ZGNA 3JSXA 4POAA 2OFOA 2QTGA 1AJKA 1IQPA 3NX4A 2EATA 3DD1A 3HKCA 4JP3A 2ZVQX 4I4TA 4YRZA 2FMDA 1N5DA 2ZK7A 1LDYA 2Q1UA 2BL4A 2O7VA 1E1QA 2NQYA 1PFVA 2A6VA 1AC5A 2Q9UA 3Q40A 4FPCA 4CMKA 2W3JA 3AILA 4I5DA 3ME2A 5A32A 1G42A 1HM5A 2Y8KA 3P71T 2RGBA 3L46A 1M2OB 3HR4A 2RGCA 1JRLA 4YT5A 2D00A 1RGSA 2GN7A 1H0KA 4DQAA 2BSQA 4GKVA 2DERA 2JZNA 3W5MA 2GN3A 4PYOA 2VULA 3EGOA 4DWVA 4XVCA 2YHIA 1ZNXA 1LKZA 2HM7A 4FLFA 1DAKA 3HRKA 4H27A 4PDWC 2BPOA 3T4EA 2I80A 5GLUA 4HXFB 3V1MA 5DZEA 2MINA 4BDVB 4MYSA 2NAPA 4GBJA 1FFGA 3VD3A 2X8BA 4YJ2B 4CCOA 2A9OA 1BCRA 3MIZA 5FV7A 3ZQ4A 1LDGA 1MQ8B 2VRCA 3F1LA 3OQIB 5AFSA 2R8ZA 4C4XA 4JDNA 4FNMA 3OD1A 4RSMA 1KDMA 4DY3A 1FNYA 3DO5A 1CY2A 1ENRA 2ZAOA 2ZIXB 3NC0C 1FW6A 4ARIA 2ES3A 2DPHA 5EIOA 4L73A 3VZDA 5CA0B 3THRA 1YH3A 4IV1B 3UAZA 2R072 1NF8A 4MQLA 1HSZA 5IT9A 1ETUA 1X7GA 4ZDWA 5EPOA 3PIJA 4I7EA 1GUAA 2VPXA 4DY5A 4OQ9A 1N3IA 2W4IA 4Z2YA 3T3NA 4CG1A 3UXEA 3RROA 4ZAXA 3AEQB 4FCTA 2PAFA 4QQKA 3FGNA 3DZHA 1TA4A 2ZYHA 1S4CA 3TLKA 3MIIA 4XBQA 4ZT2A 1N1YA 2Y1FA 1LBHA 4P5DA 3RD5A 1TJNA 4IDFA 2R6FA 5DTJA 4S35A 2GB4A 2HD4A 2ADEA 2JI9A 1GCIA 1EAH3 3OE7D 1W46A 1JG4A 1GSHA 1PSZA 4JFAA 2G76A 3AINA 2E87A 3C6KA 1LH0A 4CCWA 1MRNA 1NX9A 4Z92B 3CYFA 1UN1A 4TL9A 3TI7A 1HDEA 1S2GA 4BLVA 4HHEA 2VGDA 4UAPA 4N7MA 5AKHA 4NCKA 3ZWYA 5CFZA 3GWZA 3HG7A 4JC5A 1WHTB 3OJOA 3UJ6A 2DTDA 4JKYA 1AUXA 5IM5A 1ZL0A 5ADVA 5E9AA 1NVKA 3UUGA 1V95A 2FWPA 3BXZA 3W58A 5AKEA 4DUGA 4MUGA 3SH4A 2MYTA 2OD7A 2C94A 2OBMA 4DWJA 2C54A 2O5RA 4LXYA 4H6VA 1TK2A 5FL7A 4M1KA 1CRLA 5TF0A 3KHSA 2MEV1 3U2QA 1QFMA 3IPYA 4WM7A 2JEYA 5C4WA 1NN1A 2PK3A 3B3QE 2ZGRA 2HLDA 3KMHA 3FBMA 1GTRA 4DXSA 4IEEA 4QARA 4Y2YA 4JI7B 4PQGA 4HNAA 1R1A3 2BN4A 4OKIA 4MSVA 2RGAA 3NAZA 3PE6A 3F78A 4XD2A 1YRWA 5J47A 4XUPA 1EXMA 3I5AA 4HDCA 1NUSA 2B9UA 4J1TC 2EF0A 3K73O 3SM3A 2ERYA 4DCOA 5IFTA 1YI7A 4KAAA 4B4RA 3K16A 1VIMA 3E6BA 5B37A 2PYTA 5AJYA 2JS7A 1II8B 3TIFA 2A1TS 3FDXA 5AXCA 5JXWA 1XT6A 3V7YA 1I8TA 2XJRA 4ZI2A 2YU2A 3SYRA 1RPNA 3ZVNA 1HDXA 5JO0A 1CDEA 1VE6A 3MJHA 2PRYA 4PX9A 3DKPA 6YASA 5IKMA 2W2MA 3HB1A 4N7RA 3AKRA 3HNYM 5FBJA 4ER0A 3E4CA 4TRJA 1OV6A 3I9NA 4BFZA 4MW4A 2R8PA 2XUPA 4NZNA 4P4NA 2BW8A 2QI9C 5A4DA 3UYLA 5G0UA 2G7ZA 1S0IA 1CIVA 1OLMA 1XTBA 4P02B 1BYIA 4XIOA 4GP9A 3U61B 3DV8A 2G9QA 2QX4A 4NIGA 1LQTA 1K8RA 4MUJA 1P19A 1E9AA 4Q5OA 5KX5A 5BR4A 5ILGA 4KLRA 3Q41A 5DX0A 2HUPA 4TT3A 2YHSA 2BGLA 1A2KC 5HCHA 5ERYA 1OI7A 3PE4A 1PSDA 3CA8A 4BNIA 1XJWA 4L0CA 4TKVB 4M1MA 3SQDA 3HRHA 4ALKA 4D3YA 2YIMA 2X5XA 3LY7A 1QQBA 5FMBA 5I8PA 3R20A 2VATA 1VSTA 1K98A 4X1OA 4TLAA 4OHWA 1HYGA 2MWMA 4ZYXA 4BEWA 1Q0TA 1K9VF 2ZMNA 1W85A 5JQWA 1K5GA 3INNA 4RO0A 3QVMA 2O6LA 1GL6A 3L7MA 4AQYB 3FOAA 3ZUGA 4AQ7A 2JLRA 5H3HA 4XIIA 3PSAA 4YJ2F 3U17A 4EA8A 4IVQA 3G2HA 1CNFA 3EDMA 4MCIA 1JJBA 4XDYA 2PX0A 4U2GA 3H11B 4YT4A 2E6VA 2V7QA 4XXHA 5J98B 3BCRA 5J4VA 1GKLA 1VJDA 4B7CA 4QXHA 1K08A 3IQGX 3DCYA 3CONA 1E4OA 3R44A 2WZPP 1A7UA 5LK5A 1GWNA 4N3CA 4KACA 2R7MA 5GZ6A 1MABA 1W76A 4A8JB 5ALQA 2Y4OA 2XQXA 1ZZ8A 3R9KA 1MF7A 3ON7A 3GWGA 1R2QA 5K8CA 3HMKA 3POFA 4N9HA 3PQDA 4LVCA 1NQVA 1MIHA 4BLTA 3MYYA 1HEIA 1NZDA 2E6UX 3WLTA 3OPYA 4PR0A 2RE8A 3KT7A 3CLTC 1JX6A 2P2ZA 4HYYA 1B00A 221PA 5KJ1A 4C7BA 5FZEA 5FOWA 4A3SA 4XJZA 2EXHA 2ZZQA 4XVRA 1DCFA 4NIIA 3EUAA 3RS9A 4MHSA 1EWKA 1WW8A 4QM8A 3LWZA 5TC4A 2QN6A 2CF5A 2PMCA 3WDVA 4CXXA 4J75A 5B55A 2WW8A 1G3QA 4GH4C 4Z07A 3L1IA 4FGSA 1CT9A 3QEBZ 3NJZA 4ZHQA 4M37A 1EDZA 3AFOA 4U39A 3NXKA 4FK8A 1CK4A 1FMD1 3AL3A 3EJ6A 2OUHA 3ICOA 1L4HA 4JBXA 2YHBA 1CD3G 4J43A 3VO2A 4INOA 5DBIA 5KDDA 1MAAA 2FP4B 4L51A 2AQHA 2XMRA 2EOAA 3U9LA 4O4IA 2TECE 2GARA 1O5OA 2I22A 4QJ4A 5FQOA 4U2AA 4E13A 3RVBA 5ALGA 1HORA 4Y2HA 5EUMA 1G0OA 2ZWMA 1GDDA 2IOQA 5HQ3B 5BN1A 2AZDA 5DG2A 1COWA 4E5DA 2ORXA 2JLYA 3PYMA 4AN4A 1NVMB 1PP4A 3JZAA 4MMZB 4H7HA 3CINA 1OBHA 1Y7BA 3TTWA 4WEQA 1O7FA 1KYYA 1JQLB 1M06G 4N6GA 3PC4A 3Q7QA 3B6IA 5E6UB 4R0MA 4POOA 3E0QA 1XZAA 4EI8A 4D4GA 2YXLA 4ENRA 1VLHA 2WO3A 2AFVA 1BHQ1 1AR82 4X84A 3JYQA 1RPAA 3LDRA 1ZVVA 4Q3AA 2EX4A 3JWGA 1MIOA 3U4MA 3FF4A 5AXDA 2JDKA 3K15A 2BBSA 1JGTA 5TX7A 4FVVA 3VPCA 2XQKA 1WBDA 4FYYA 2Y8EA 4KAFA 1TCVA 2RGRA 2I7XA 1K3TA 3QOPA 4RDIA 3OQHA 1PJAA 2CCJA 4CTNA 2FUKA 3SHQA 1TJPB 1N3OA 3BA6A 5IKEA 4AWBA 1JHPA 2WQ4A 1F8YA 2XOKD 3BHNA 3WFIA 1PO11 2J1RA 1CLUA 3PPWA 3CF4G 5TQ2A 4F0JA 2GH1A 3HCBA 4L07A 2IZZA 3BCWA 3JQ7B 4IJ6A 4YUAA 4WCVA 4KQIA 1PD0A 4L78A 3WD5A 4GR4A 4GPBA 2O57A 2FSFA 1OA1A 4G3XA 1WS6A 1IZ9A 2F8SA 1A2OA 2H1IA 3CKLA 3N1UA 5AJUA 1GRVA 4Y33A 4V24A 3OJLA 1MB3A 3N28A 3ILHA 3S0MA 3K4AA 4LXUA 3RVSA 2DR3A 4Q3DA 1CHNA 1JS1X 1MC1A 1U4OA 2AQ8A 4YG0A 2QR3A 2QT1A 1W9TA 4MKFA 5LB4A 2WB4A 5GM0A 4HMOA 2ZREA 4ENTA 1OWOA 1DX9A 3G8YA 4CKYA 1GFIA 4Q7LA 3H2IA 3EXEB 4M7OA 3KQKA 3ETHA 3NNNA 4GLOA 3CLHA 4Z3DA 5C7OO 1USUA 5DGHA 4F6LA 4KE6A 5E8JA 3ONNA 2AD1A 3MWYW 1B41A 3WMWA 1O4VA 2Z08A 3MV11 2AR9A 3ZHRA 2WM8A 3BGWA 3VHXA 1GT91 4Q0PA 1S8FA 3KHUA 3H9BA 5K3DA 4RIIA 4LDPA 1Y4DE 5T41A 4YWHA 3D59A 2GDZA 2JGLA 2ZB7A 4IJUA 2CJWB 1E6EA 1CUBA 5IT0A 4QX8A 2BERA 4NZZA 1US8A 3A04A 3NHPA 2G0AA 1G291 1OZGA 2X77A 1Z38A 4TKMA 1TLTA 1AR63 1JXMA 2C9AA 1PTKA 5EVJA 1JOJA 2RS51 3P9NA 3DV9A 3ROPA 2OPBA 5C4GB 2IF0A 3HCNA 4BFSA 1BHO1 3ZXXA 1KD7A 1U2DC 2R2AA 1U5YA 4II2A 1RUNA 2H8KA 1RUE2 1GZDA 3TUZC 3FKSA 3KE8A 4RTQA 2FK8A 3O0XA 3KT0A 5FEUA 2D06A 4UNRA 2CGEA 1CUIA 3OX4A 3UB3A 1Z5UA 3M33A 4CCLA 5ADWA 2BJVA 4OULA 1YC5A 4JHTA 5BSUA 3PJGA 5BRJA 1TU4A 2WDBA 3AVWA 4F8AA 1LHOA 3T95A 4L9AA 5LQCA 3ZBQA 1ZW1A 4MULA 1U2QA 4ZEVA 3AF3A 1GNRA 2DPXA 3U3DA 2C5EA 1L5QA 4NR0A 2C0PA 4HQNA 3G9TA 2YBKA 4XFKA 3IDEA 1NOIA 3FWNA 5DK6A 2DP4E 1JLMA 1TC2A 3NANA 3ND5A 4II7A 4KBYA 2OZEA 4Y20A 2PN5A 4F9EA 4OUEA 2FR8A 4B5KA 2O2CA 3O1HB 1FFEA 3F6BX 4G09A 3RBXA 4MUVA 3QMWA 4Q1RA 2JFVA 3P2YA 3KDPA 5J3JA 4DUGD 1U8UA 5TE9A 1L7NA 3AR6A 1T1EA 1T6NA 3AB0A 2XUDA 1PJQA 4YW5A 4D56A 4XFHA 3KGLA 2EQ5A 5ALSA 4FR5A 4UVIA 3AB8A 1NT4A 1XKQA 5LCXA 4X8OA 1ADFA 2DHQA 1UY3A 5INTA 1YDHA 5EG5A 3ASYA 3GZ4A 4DWOA 4Q12A 4L6CA 2OYCA 1QRSA 2Q8PA 4EJSB 4A6PA 4R8LA 4TV9A 2JCSA 4C0SA 1OFNA 3CZ9A 1W35A 4JJ8A 1VBB1 4MAFA 2OZPA 4ILKA 3DZIA 4OVEA 2GN6A 4QEKA 3WQHA 5K0CA 1HQWA 2JVJA 4W7SA 3O1MA 3L9WA 3UJQA 1DAEA 4MOWA 2FN7A 3ZNPA 1KMCA 3KETA 5K20A 1IZ7A 4YCSA 3H1TA 1VLJA 4CQLB 2B8EA 4RS4A 3C3EA 1FFBA 5BNQA 1DGRN 1Z17A 4RIGA 4IE6A 3I49A 3RKUA 1AMUA 3LJKA 1ZH4A 2J3DA 5EWSA 5LD2B 3GVHA 2OQ6A 4KRXA 4Y18A 2FOLA 4IIJA 4KAJA 2JFQA 1DB3A 4O59O 4YJGA 1Z4KA 2C3UA 3EC1A 3IBTA 1A77A 3NNJA 2BM9A 4DNQA 1MFZA 5DHAA 1OROA 3DAGA 3FVWA 2WIDA 5A7WB 2Q5EA 3HOBA 2FSHA 1QE0A 4QUBA 3TBFA 4AURA 3ZLTA 2G63A 4EMTA 3ZXSA 1TJYA 3QSYA 3TW0A 2HQBA 3ZU6A 3BDVA 2GD0A 3EBRA 1WBLA 1TYCA 4I1IA 4QBFA 2B8JA 1O8PA 2AVDA 2H1SA 1T8PA 4UTVA 4BMSA 4NE9A 1A9XA 3T7AA 1G8HA 3CCCA 1HRI3 1SC9A 1KYXA 2JDIA 2W46A 4JC0A 5AKLA 3F7TA 5CEFA 2CHFA 4C88A 3IQHX 2R7LA 3NETA 4W6XA 1Y9EA 4D25A 3WGNA 4WX2B 1JTZX 1KR5A 5FLKA 1ZGZA 4X6UA 3ZD7A 2Q3HA 4YJKA 1DHKB 1Z4NA 2EGHA 1W94A 2BLNA 3FTCA 4FILA 4NYIR 3G23A 3LZDA 2VHZA 3DE1X 2P67A 2Y0PA 5ADHA 5ALUA 4QJ3A 3BZUA 1B2RA 2VQ3A 5IK7A 4OY3A 2QTLA 4RV9A 5D7BA 3AXEA 5IVEA 2DU8A 1GPUA 3ZIAA 2ARBA 1R15A 4HPJB 3DQPA 4Z4EA 3SBDA 5THXA 1I5PA 3IQFA 2ON6A 1Z7S2 1NOJA 5H0IA 4BB0A 2AC7A 1OXCA 2GD2A 4LMAA 1Z5PA 2QT9A 2QQ5A 4HGOA 2YQ5A 2AE2A 2NYUA 4MWGA 3NRCA 1O97C 1VRWA 1QGZA 4N0EA 2V03A 2N0SA 2QWXA 5KAPA 5CG8A 4B47A 2I8LA 2IYLD 5EJEA 4CUZA 1C30B 1K97A 3ELNA 1RACA 2OXBA 1D9XA 5JSOA 5IT5A 3AR9A 4PINA 3P3NA 2X1VA 5AK0A 4AM8A 3FRJA 3EPLA 1WVMA 3CVVA 2YMLA 3L8MA 4A0RA 3ZD6A 3MW3A 1W6NB 3FUUA 2WR8A 1FRZA 1FFWA 3N2GA 3I9OA 3OPTA 1XDGA 2VAVA 4OMUA 4ZT5A 3KT1A 3F96A 1UWVA 3ZDBA 2H4WA 3RG2A 1V16A 1WW7A 4KQ6A 2BGUA 4CM4B 3GP3A 4XCQA 1ISGA 2NVWA 5IVIA 4TYSA 4DBLC 1PG5A 2PLRA 4U7HA 1ISMA 4ITUA 2OP0A 4B82A 4F72A 1H42A 5FPXA 5JCJD 4WGGA 4NZYA 3IDCB 4XJTA 1KH1A 3AL2A 1K5HA 3N58A 1SBEA 3D7SA 4D8VA 5TARA 3ESQA 1Q83A 2V7GA 4P7BA 2B5HA 2I91A 3ZYJB 3BTSA 1UM9B 3I3SR 3NRJA 2LD4A 1VA4A 2WFF1 2WIGA 1GIAA 4WN9A 1NLRA 1SCJA 1VRH3 2EFDB 2WJHA 3TMYA 2IHJA 5DYNA 1T6BX 1JZTA 1N6NA 3UGTA 4XX0B 4A41A 3SC2A 1PFUA 4LRWA 3O26A 4MZDA 2XUEA 4HLNA 2CAUA 3DBIA 5KWSA 4PDWB 4EAQA 5HOEA 2J0VA 1G4AE 2W0XA 1WSBA 1O3YA 4GPAA 5DBFA 1D4AA 5FK7A 5FZBA 5DM2A 4K9MA 3WJ1A 3PIIA 4Q1CA 1RAGA 3PU6A 1PWHA 4RR3B 1DFQA 1KMMA 3QTLA 1EVYA 4W6ZA 2MT9A 1JIVA 5AVRA 3FSRA 3BXGA 3ELYA 1UU6A 4PZDA 1V9U1 2ZFUA 4KG7A 4EY8A 3ETDA 3KZKA 1AUQA 2HWC2 2YASA 1QQP3 1SXHA 4IDGA 1XYGA 3L8EA 1UOFA 2C4UA 3M3CA 5BSKA 4S24A 5EZYB 2ZWIA 3BK7A 3MWDA 3HNOA 1H2ZA 1CAXB 3CTMA 4JJAA 4R84A 2B4QA 2R97A 4QRIA 4IMIB 1Z25A 1PMIA 3OQPA 3CT4A 4JBYA 3IO5A 5LKAA 4K40A 4N53B 3ULKA 3FUXA 4FPEA 4C9BA 3K35A 3GLGA 1M34B 2QPTA 4PI2A 3ONWA 1BNCA 2FW1A 2ZI4A 2FPSA 4NPAA 4GKBA 3VHQA 4UOQA 4BB6A 2OHFA 3J7NA 3PNLA 1GAXA 2K87A 3C1TA 4WASA 2H0QA 3KQWA 4BPRA 4F97A 5IM4A 2NO0A 1ZUD1 2J3MA 3DMHA 3AKCA 4IQPA 3ECAA 4CDXC 2R47A 3Q98A 1OILA 4TXLA 3H5LA 4DADA 1U3VA 4R1LA 1K68A 1N4AA 3AO0B 3DBVO 2FEMA 1P8AA 4BFCA 3BJMA 1JDJA 3LC2O 1KO8A 2XKJE 3ZCPA 3NHWA 4C6SA 4BWGA 2IZ6A 2PX8A 1QDLB 4JHZA 2NXCA 5KI6A 1H05A 4Z2AA 2BZGA 3S5AA 4YM3A 3GO4A 2OO3A 4DV5B 3K9HA 3JZVA 5C70A 4OMCA 5BN3A 3WBBA 4EZIA 2ZS9A 2JGDB 1EUUA 2LWIA 1EDDA 4P38A 1P2VA 3LA7A 3IP5A 4EA9A 1WSWA 4CL3A 3CG4A 4CR7A 3UL2A 1CF4A 1EG2A 3W1EA 2E4VA 3STYA 3SX2A 2IU3A 3IVCA 4M8LA 3F95A 2VPTA 4M1OA 1YO6A 4NK4A 3FTQA 4AHZA 2XA1A 4I2VA 3RT7A 1OH5A 5FZMA 5HF6A 3HBKA 2DV9A 2YUTA 1YDFA 1DYKA 2VHVA 5DISB 1RUC3 4LWQA 1DC6A 1WLTA 4BY9E 1RYEA 3FWPA 3UBTA 1E3EA 5KQRA 4UXJA 5FBHA 3VKFC 3L7KA 1PJ3A 1RUF3 5BN5B 2X6QA 3AMHA 1XTZA 4OU5A 1EK0A 4PYKA 1SHLA 3L06A 1K88A 2IYOA 4WE3A 3IAM6 3CUKA 4XM0A 3NHKA 5BNFA 2P6MA 3NKGA 1YBMA 4EZBA 2YVAA 5JIAA 4QQPA 4OHBA 3EJKA 3CS3A 2G5GX 1DBWA 2J1VA 4LO5B 2GEFA 4L5AA 1FDIA 1E1NA 1JYXA 1RI2A 4A6EA 1XZGA 1LSSA 4O2AF 2VN8A 5CM8B 2R1VA 1H85A 2APJA 1CVIA 3C3MA 3E6DA 2JFWA 1YMUA 3ESAA 8MHTA 2FDGA 3Q3EA 4UBHA 4JQZA 3SC6A 2GILA 2HDWA 1GXSB 3H2KA 3TH5A 1QTIA 1QRRA 1LOEA 4BLWA 1XGKA 4XZUG 3HKEB 5BV2P 2PS1A 1FDSA 2O0HA 4D0LB 1JHRA 4KQ1A 4FFPA 4NBUA 2O54A 2C1FA 2ZYVX 4Y1ZA 1PDVA 3ACBA 3AHJA 1RCFA 3OQJA 1YGYA 2FSVA 2F67A 4LOJA 4B7AA 3U44A 1FSZA 2BCEA 3PZRA 2XVGA 2OV8A 1RB8G 2OBXA 5JDIA 3ZE7A 3C8MA 2IGBA 4QNRA 1JEOA 2FZWA 3FCCA 1KZ9A 2FDJA 4IEUA 2A9JA 3ZGXA 4CUGA 2E55A 3A3OA 3GNQA 1KEWA 1KPIA 4PQYA 1FXWA 1V4BA 3NV2A 5FZFA 3Q8WA 4XJSA 1LLUA 1IE3A 4HAVA 3U3KA 3IQWA 3KAKA 1YVEI 4HNSA 1O95D 3TLGA 2VNKA 1GQOA 3WHIA 2IP1A 4RULA 4QOGA 4ND7A 4FGJA 4WZAB 2GSDA 3ILXA 4ID9A 2FSSA 3O75A 3A11A 1Z33A 2C6SA 1RFGE 2VTVA 3WHTA 4H08A 4OOEA 3AHIA 3RRBA 3NNSA 5AW0A 1ULCA 1L4MA 2NP0A 3I42A 1K5MB 1YFJA 1FTWA 1Y8RA 2Q2OA 3AP5A 4I6EA 1J1LA 3AG5A 2C4WA 3KJGA 3JQDA 4MUIA 5AMXA 1YS7A 4JMLA 1YZLA 3L7IA 3E1SA 1IQAA 1H1TA 4DE5A 3ZE0B 2VSNA 5FZLA 3HDGA 4PHFA 1UOPA 3JYLA 4WZBA 4BWOA 2IYUA 1B3RA 3WLSA 4DDUA 3KZVA 1BWQA 1MJNA 4WKPA 2R49A 4ZT3A 5KWEA 1OZAA 3K0AA 2OHXA 1H4HA 1T4CB 1CFZA 2AF3C 3OA0A 2PELA 4AGRA 5FZOA 3N3AC 1CWUA 2DFCA 1E64A 3HFJA 3ROUA 1XELA 3JRWA 3NONA 3JASB 3M4NA 4WOBA 3P27A 3BL5A 4A2CA 2JG9B 4HETA 4Q9NA 1QOTA 4WLNA 4QPWA 3GCWA 3FFWA 2EKBA 4E4RA 1Z6XA 1H22A 3AHEA 1NJ2A 4XQDA 5BSEA 1UDBA 2EYUA 3CNQS 2IUEA 4ZAYA 3QFTA 2J85A 3RVQA 1TU3A 2MCFA 3EVBA 4KE8A 4CF3A 1E20A 3ZWWA 3GG2A 4MIYA 4F9TA 5B2FA 4DL9A 3VZSA 2JFUA 3WP3A 3V46A 3QVSA 1WZIA 1AK2A 5BXQC 1T4MA 3KKMA 5FZ8A 3FUCA 5FREA 3AHHA 4QHTA 4YIKA 5BQFA 4ILEA 4URTA 2BONA 2ZX4A 3F8SA 2B6HA 1HYQA 2CAVA 2VECA 1BBT3 2GCPA 4RN5A 3RC9A 1MH1A 2ZDQA 1F51E 2HF2A 4ASUA 2ZJYA 1HC7A 4HQLA 4Z0NA 4ZXEA 3VL8A 3A7DA 2RMU1 3SIXA 2P4QA 5D01A 2YWFA 1QIHA 4YRAA 1Z7S1 4QOFA 2GBCA 3MOSA 1GITA 5JISA 4U5QA 5TPZA 4P3YA 4TN1A 1HZZA 1QQ5A 4KXMA 2QTAA 3NYQA 4HDAA 2VWHA 2A7XA 3VKNA 1JG1A 1N77A 4I3GA 2QVXX 4ZOEA 4YCJA 4EG3A 3GY0A 4YCAA 5DRYA 4RQPB 1DJLA 4EYEA 1BWPA 2QN9A 1RMU3 2CDNA 2F8MA 1GKKA 3JARB 4D99A 4PM4A 2EBWA 4LT5A 3D2LA 5C8CC 2UVQA 4KU4A 1NYRA 1BWSA 1DCSA 3K46A 2BFNA 5EHZA 4J0CA 3W8NA 1IIRA 1C8NA 4Z4CA 2B4YA 1LRKA 2XE4A 5FR3A 5HJ5A 2C0ZA 4KWJA 3BWCA 3OBRA 3WMXA 4R01A 1D2RA 2XA2A 3ZWOA 1WF3A 3TCNA 2AR7A 3SX0A 3WUDA 3EIUA 1OAOC 3IP9A 3UMGA 3N7MA 1PUIA 2A71A 1B8PA 4IGIA 1WKVA 4M3CA 1G5HA 1Z16A 3RFTA 4RDXA 3VBOA 5IHPA 3UC5A 3MINB 4UVHA 1SKBA 4MUEA 4C3OB 4CDWB 4V1CI 1CC1S 1HT2E 5IWCA 2I54A 2QVBA 3BB6A 2JIQA 1OT5A 1E9RA 5DM1A 4X6RB 3GA7A 5KNCA 4DR3B 3TLGB 2XBUA 5LDHA 5LNK6 3Q5DA 3NQ41 4JTOA 2DE0X 4YP9A 1M8FA 5BVHB 1W5TA 5LMCA 4EY3A 1JAHA 1DJQA 5KTSA 3KZXA 3DV0A 4DQDA 4O4IB 3I9V6 4FDAA 1CPNA 3CLTD 4G0MA 2QD2A 1MAHA 1MT3A 1U1EA 5BYNA 3FWYA 1LJUA 2RS52 3EH2A 3ZXEA 2ZPUA 5KKCA 1U3CA 4BEBA 1CS0B 2KLHA 4N7IA 2I1VB 3OLVA 2EL9A 1NDUA 2FUG6 2R1BA 1WKYA 2F1KA 5F39A 2RV9A 4LE0A 1QUFA 1PJTA 3ZK7A 3M3IA 3PQFA 2XONA 1J2RA 3F4KA 3ZKUA 2DR2A 4U36A 1KI8A 3OURA 4M0UA 3RFRA 2MSKA 1HLPA 2WWSA 1GLGA 2XLFA 5LQSA 1WLDA 1A7JA 4QB1A 3H1AA 4MS1A 3W4JA 1Q2XA 2QROA 3ZE6A 4DRRA 1LHWA 4WTOA 1DGWX 1VP9A 2QP3A 2O7NA 3KBBA 2DRIA 3ZDEA 3ZLVA 2WMOB 2XZLA 4NAOA 2ZULA 1TJ4A 4UM5A 4QPDA 5B3JC 4RQUA 1ULGA 1VBE2 1ABBA 5DB4A 3WO1A 3HNMA 5A06A 1CDDA 2PX2A 2KX7A 4NF2A 3U13A 4FSDA 5D1IA 2O48X 4ZIRB 3PC8A 3FNIA 2EWWA 4WRRA 4ZZ1A 2V98A 1YA6A 1VMKA 2IYPA 1MZPA 1VL2A 3LX5A 2QX6A 1U0NA 5HZGA 3HSYA 2HO5A 1PRYA 2GUWA 2WQ6A 1G60A 4E14A 4B6SA 1XI2A 5LL6P 1NJSA 3LK6A 4KQ2A 3T2QA 5DWQA 2ZSJA 3TDMA 1KL7A 4B6PA 3K4QA 1DXOA 4JR0A 2RIPA 1SU6A 3N7LA 1T0UA 5TQ0A 5CA0F 2G6BA 2E53A 2DFBA 1GKIA 3HB0A 4LW8A 5JSKA 3HEMA 4MUYA 2AGSA 5KYNA 1BFDA 1VDZA 4K05A 3JQBC 3IFSA 4A6DA 3CY6A 4EVQA 1EP9A 4CMIB 4OGKA 2QMOA 5EJ3A 1R4MA 1M1NA 3A1NA 4YCMA 1NI3A 2E89A 4EB6A 4HGZA 4RDHA 4A7KA 1J06A 2QQIA 1U1CA 4AK3A 2ZGVA 4ARZB 1PGPA 4AJ2A 3VU8A 4MWTA 2PKWA 4KG0A 2VPIA 4CLXA 4D7AA 4M22A 4O25A 4X1YA 1TQHA 5LBIA 2OSBA 3E5HA 4MP8A 2IXHA 4Y5TA 4OCTA 3LSEA 3CJRA 1R37A 1HN1A 1XE3A 3NVCA 2XCLA 4UTNA 3VPAA 1W59A 3U5TA 4LRUA 5FBKA 2F55A 5LBEA 4J1TA 1A8DA 1SKAA 1IOZA 4QUIA 1IXYA 2ZX1A 3ZHOA 4DZRA 2DT5A 3MUEA 5IVVA 5K2MA 4PPGA 3HCPA 3VBRC 4UU8A 4RFSB 1RC6A 4EABA 3QVOA 3PPXA 3SXWA 1RWWA 3LBFA 3CVJA 5CLIA 5A6QA 5M04A 1ZUNB 3IJRA 5DTIA 5BNNC 2WTXA 4QUKA 4GXNA 2CW5A 3WNBA 4QODA 1A8IA 3KPUA 5TPZD 4TRNA 3KT8A 5EHNA 2QENA 3REQB 1I24A 3GUVA 3WIDA 2NU7B 4RZ2A 4KCGA 1LPOA 4TL7A 1UYXA 3E9YA 1QRTA 3TD9A 1TZJA 4EHFA 2HK8A 1SCUB 2Z8YM 4PI0A 3SKJE 3PC7A 1MVOA 3UMSA 4FSXA 3OQ1A 2AN3A 3OG2A 4G4JA 4Q7JB 3DPRA 1FMD2 3I8SA 1X80B 1UT8A 2BFAA 2ETVA 2WFZA 1MS3A 3FIJA 3K6RA 5B7GA 2XL7A 2M1ZA 2Z6QA 4N43B 3KSCA 4URVR 5F5LA 3ST7A 1M1YE 5KEIA 1WJGA 1H6YA 1OF4A 1JOPA 4KREA 4XB1A 5CDUA 4AKHA 3GUYA 5KSPA 2NV0A 4CUAA 4EAAA 2UXCB 3POSA 1GV0A 3PRKE 3HQRA 2OO5C 3AMNA 3AEKB 3AJ8A 4AD8A 4D0SA 1XO1A 1X7ZB 1HFEL 1U3UA 3UAXA 2GFIA 5J4KA 1N3YA 3M7IA 1LVUA 2J6BA 3O2NA 3T7KA 1NDHA 4P9WA 1TJ5A 1NW8A 2ZZMA 1UKZA 4IS3A 2GXAA 1S96A 3E81A 1JN0A 2JB4A 4NYMR 4PC1A 1LHNA 5IDWA 2AIRA 2G1AA 3WGKA 5L4SA 4I9UA 2Z8XA 3FNQA 1SG3A 1EFPB 1EVLA 1XN4A 5JEEA 4KK3A 1M0EA 1S89A 1CR6A 4CLHA 4EF4A 1IZZA 5JWOA 3T4XA 2W0SA 5J3UA 3OO0A 4RVHA 4WXYB 4NKRA 1RXUA 2VR1A 3T52A 2O52A 1XNHA 4KQKA 1OH7A 2ZVJA 2ZXQA 1KU6A 3C2QA 4R2LA 2GF2A 4PLNA 4FHEA 2R85A 4UUMA 1T1SA 3QJ5A 4G1FA 1W9MA 1Z68A 1DIWA 2H1HA 2LDXA 3OY7A 1XTTA 3X0DA 3B9RA 3HA3A 3LOIA 3A1FA 4NDAA 3K5IA 2DCZA 3Q9LA 3M9XA 2FN8A 5ARBA 1KYQA 2XD4A 5GM1A 4LCBA 1F7VA 3HQUA 4TMXA 2H85A 3NLLA 2H92A 2WQ8A 5JDIC 3MZ0A 2P6OA 2R2GA 5IAAA 3KXPA 5IX8A 2RGWA 3TSYA 3KR0A 4R8HA 3KOOA 1IDN1 1W2OA 4QULA 2OCBA 4YASA 2HREA 1GQPA 2WG2A 4K2AA 4LDRA 5FPKA 1O3TA 3UJDA 3VB9A 1HURA 4BU2A 1JI6A 3CJIB 3J80A 1DEHA 4ND3A 4EG4A 3LAGA 2FUEA 1I0IA 1B93A 4BVFA 3I2OA 4BNKA 2CXOA 5FWXB 4CQMA 3TOSA 2PUDA 3PSHA 4QXMA 1TAQA 3PC3A 4TGLA 1G59A 1OBFO 4EDHA 1T15A 2HA2A 2VSQA 1S0BA 1HYBA 3DAPA 1T2XA 5DI3B 1Z4LA 3ZQUA 1ZUHA 1Z83A 2C9ZA 5FTTC 2PUVA 4II3A 3U11A 1NTOA 5DYWA 1VG1A 1LTHR 5AI0A 3ZK9A 1SBCA 4J8PA 4OGWA 5AJTA 5IK2D 2GC0A 1OZFA 3H4IA 1M3SA 1CE8B 4DLUA 4DR4B 3B3FA 3DSRA 1U2RA 3AK0A 3IILA 2HX1A 1BHJA 1JB9A 1R091 2VJYA 2V7XA 2B4RO 4IV0A 2QTMA 1U0BB 2WUWE 3P45A 3PNSA 1ZRFA 3EE6A 3ZWDA 5B1EA 4DM7A 3J81A 1ODJA 5DAWA 2XYPA 1BJKA 4DLBA 4WZBE 4XA8A 3OESA 4O61A 5FCDA 5HV0A 1Y7LA 5EIEA 5FUBA 4ABYA 3H1FA 3O82A 3P1JA 3VPDA 2FWJA 4QQLA 1AA6A 2D5HA 3O3MB 3ZOKA 1HQNA 3DDCA 1NJGA 4C4PA 3QLEA 1KQRA 3OLQA 4NU8X 5JSQA 1ZICA 1C4KA 1K3IA 4KUHA 1EH5A 4XBNA 3O92A 2QRZA 2QAIA 2WRAA 1KFJB 3KK0A 3S8EA 3U78A 5TT1A 4TS4A 5IBCA 3U80A 4LHKA 4WJZA 4I55A 2RBGA 3BU0A 1NRJB 5AVWA 1UMDA 3RBAA 1SXJC 4DV4B 1C28A 4GLFA 5LOVF 5H9RA 2FG6C 1N2HA 4W9RA 3K0FA 1JI0A 3RPEA 4J76A 5HI0A 2FX3A 2YGMA 3GRPA 4K9QA 3PEUA 4ICIA 4I55F 1PK7A 2WE7A 3ZNQA 4L3WA 5AI4A 4NICA 5DK4A 4K0KB 5BNNA 5AVPA 1KNXA 1LBSA 2QNIA 2HLDD 3U49A 1RVF1 4DQVA 4C2UA 2IPAB 3A06A 3NGMA 3F3SA 3JX9A 4WERA 2PZFA 4NIAA 1ZZ6A 1I7PA 4KJXA 1CY6A 4WKCA 3FAZA 4CLOA 4MO2A 4A2QA 5AVVA 4QTUB 2Z3VA 3WYEA 3I3MA 2Q5QA 3FUVA 1WZUA 3Q7PA 3A9WA 3GELA 2O2ZA 3FVVA 1FXUA 1RUD1 5CEEA 2HHHB 3VBSC 1G9AA 4DIQA 5IAVA 5AI9A 3BH7A 4I14A 1PR3A 1XAHA 4RABA 1S0UA 2WTAA 4HQKA 5EMLA 3RVPA 1C0LA 1ZLXA 1D0GA 4XFJA 5AVKA 4NY1A 4ND4A 2I29A 1I5RA 4EHBA 4Q2FA 2XGSA 3ZVLA 5FA8A 4U2CA 2PLV3 1MG0A 3ZKWB 4PZAA 5FY1A 3T30A 4PV7A 1XEXB 2RDMA 2RGNA 2OBNA 2OXTA 1VKZA 2N42A 1YIFA 5E4FA 2QZ4A 2R5WA 4BU0A 1TCUA 4CDXB 3OKFA 5JMWA 1OLUB 3RU2A 3C45A 3HN1A 1AURA 5CFOA 1VLLA 4BMXA 1P9OA 2XDAA 1E4EB 3ZQ6A 1ZD4A 3WWPA 4AQSA 4QOIA 3DKRA 2G3YA 4D9NA 2PCJA 4Q7QA 4E2SA 3R7DA 5K8VA 1QNLA 1SUSA 2JGNA 1V9CA 3KDAA 3GARA 1IRXA 1TT7A 2ZHNA 3FX3A 1N1DA 2OXFA 2ZCVA 4RD4A 2XQVA 3ZKAA 2XUAA 3F9RA 1RUJ3 2WINB 3MW8A 2YZ7A 1KEZA 3KPVA 1CR1A 2OPWA 5CHYA 2A4MA 3I6ZA 2YMZA 3MSXA 2WZCA 4QXOA 4DJ5X 5E2IA 4RE5A 2RR12 1MS5A 1SXQA 2IUSA 4EYGA 3A14A 3TSCA 3DHWC 1GRNA 3QE9Y 1J1ZA 1K86A 1O7JA 4N0DA 3VDXA 3U3RA 2DY0A 2AXQA 1HN0A 3T0IA 2ONKA 4RJ2A 5I9BA 5C52B 3TQQA 1RWBA 4EY6A 1W34A 1Z6ZA 1G7RA 5SYAA 1JH8A 1LU9A 4JLSA 1GGKA 1J3PA 4LQCA 1AO0A 1QJ4A 2HMWA 4WM8C 3F6CA 1VJGA 4X90A 4J9UE 1TEIA 1QV6A 4CGZA 1QIJA 1OFTA 1NZIA 3NBFA 1NCRB 1J3RA 1E9DA 3WE7A 2Q2QA 4TWRA 2VQDA 2E4UA 4KRYA 4EW2A 5GV8A 1DHRA 3QUCA 4C3UA 5CNJA 4KNCA 4CKBB 4MRNA 1GQ2A 2BGCA 3NBUA 3NTQA 3K2EA 4B3XA 1SEFA 3FN9A 3L0CA 3A6ZA 1EPZA 2XCSB 2FGKA 2H17A 3KCQA 4ZQEA 2YIDA 4NCXA 4W9MC 3MMXA 3SF8A 2X0DA 3UJ9A 2WIKA 3IV9A 2H1LA 3N2IA 2JGIA 3ZH2A 5E4YA 3H7JA 4MGSA 2QRVB 4RYDA 5K7SA 4U9UA 4ZICA 2PMDA 3BWBA 2XADA 2CLMB 4S3MA 3ZCRA 2PMBA 3T34A 2RMU3 3OCYA 4AL9A 2Y1CA 5JXJA 4HDQB 4F4JA 2XJ9A 4LRXA 3RYIA 4E4TA 3ZV6A 3DOJA 3KJIA 2HC9A 4J1SA 3AL5A 2A0XA 4LHZA 5A4MS 3R05A 4URXR 2JIOA 2Y33A 2O5CA 1KZ4A 4YREA 1WA4A 2R8YA 5KQMA 3T3IA 3R3SA 2ZJ2A 3PDQA 2KD7A 2QNKA 2XKBA 2QBYB 3PDCA 1EUDA 2Q28A 1XCBA 4GW3A 2FFBA 1XNGA 3CMMA 4JN6B 3HJAA 5TQVA 3HIFA 4ZC8A 5K3FB 4EF5A 5I9MA 1YHFA 3HPNA 4WNAB 3TK1A 2IKQA 2LTNA 3HABA 9LDTA 3P9ZA 1YB1A 2RHMA 3Q3HA 2QSYA 1MQSA 4NZ9A 3SC2B 3GFGA 1VBA3 3LBAA 3GJ6A 3PD1A 4BJ5A 4XDZA 3AMVA 3WLNA 3OE4A 3C14C 3AF6A 3TZKA 5EJ4A 4AWDA 4YGXB 4OHCA 1PLKA 2OFFA 3UW3A 2C2MA 5GINE 4ARAA 1TQ6A 4HDRA 4ETWA 1IWOA 2QM3A 4P9NA 1KDPA 1IC6A 4HATA 2QKDA 2VUCA 1JFFB 5FP7A 1QR6A 5LA9A 4ZVVA 3T1HB 1Y4ZA 1UK7A 1ZVFA 1JNYA 4R05A 1V6SA 2W6OA 1POWA 1AUVA 2ARKA 5ITVA 1ECCA 1UINA 1SC4A 4N53C 1KYTA 2AFHB 4HMQA 5IHRA 3M6IA 1OXSC 3ACCA 1MQ9A 2WSIA 2Z5WA 2WU1A 1G2OA 3DF9A 3SDSA 2AC2A 3R7NA 4P33A 3ND6A 3T5PA 1D0VA 5FADA 3FL7A 2ZG6A 4HTFB 4R2XA 3ZSKA 2HJVA 3QEOA 3TZHA 1KZ1A 4HDNA 4KGVA 2EVXA 1BMDA 3WSTA 2B1RA 4FFBA 5F78A 5F6LB 3TLMA 2OGWA 4TXJA 4BLUA 4X45A 3AZPA 5F5NA 1MJHA 1Q8SA 5B3JA 3I04A 1W6OA 2VZEA 4XDOA 1L5SA 2VU9A 4ET7A 1I7LA 1XZQA 4BNUA 1G17A 3D3QA 4G0OA 5HKAA 1QEXA 1PL7A 1JDBC 2ZP1A 3KXIA 2CNLA 1D7AA 1FNDA 5HZMA 5I9IA 2VTXJ 3GXBA 3OH8A 5KKAA 1EYBA 3NNMA 1Z0AA 5MGBA 4HRAA 1L5KA 4YA6A 3PXCX 4BH9A 1P4GA 4XF9A 3ROFA 3VR3D 2WSMA 4GLJA 2VMFA 2YBEA 3UWMA 1QGUA 3WGZA 1Y33E 3MMSA 3H8SA 3TL3A 3TNJA 3EFOA 3UMJA 3FRHA 1ZZEA 4OQFA 2I6XA 4JUCA 2ZOEB 1KSFX 1AQIA 2CXUA 3KCCA 3DFIA 3V8NA 4JKMA 3RASA 2PX5A 1NQXA 4QDOA 2VYQA 1PX0A