5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
b'DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilase SubHal from Bacillus halmapalus
molecule tags Hydrolase
source organism Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
1OYVA 1JEAA 3BX1A 1P7WA 4CG0A 1OT5A 3VSBA 4AKTA 4DY3A 2G4VA 4ZARA 1SUBA 1GTJ1 2IXTA 1ST3A 1TM4E 1QXPA 1SVNA 1YJBA 2DQKA 3JQXA 4DXZA 1Y1KE 3AJ9A 5SICE 2W2MA 1YJAA 4CFYA 3DE7X 3DDZX 2HPZA 1R6VA 1KFXL 1BE8A 1C3LA 2Z56A 2ID4A 5FAXA 3QTLA 4KPGA 1PFGA 3EE6A 1BFUA 4J94A 4KG7A 1SPBS 1P8JA 5CW1A 2SNIE 2SECE 4DZGA 4Z2AA 1SCBA 2TECE 1TO1E 1SCAA 1S02A 5JXJA 2PWAA 1KDVA 2ZRQA 2XVLA 3LPCA 1YU6A 5B1DA 1HT3A 4NE7A 1C9MA 1BE6A 1SBIA 2PWBA 4ZOQI 2Z57A 1AH2A 4C3VA 2QFEA 4DJ5X 1WSDA 1SBTA 1ST2A 2ST1A 1IC6A 2W2PA 4DY5A 1IAVA 3DE4X 3HJRA 3L1KA 3A3PA 2Z2ZA 4H6WA 1DBIA 1R0RE 3A3NA 1KE2A 5ARDA 3VHQA 1SN7A 1A2QA 2P4EA 1ZVJA 3H42B 4I0WB 2SICE 2SBTA 3F7OA 1NLUA 1AF4A 1S01A 2IY9A 1AK9A 1Y3CE 4NMXB 1T1IA 2E1PA 1SIBE 1SUDA 3EDYA 3DE6X 1VSBA 5I9SA 1BFKA 1YJCA 1LW6E 5JXGA 4YN3A 4CFZA 2ZWOA 2XVKA 1SELA 1SCJA 2DUJA 1SIUA 4FONA 3TECE 1Q5PA 1Y3BE 3VV2A 2XVGA 5AVKA 4KB5A 5ARCA 3SICE 2XRMA 1BH6A 1AQNA 1NQDA 1SBHA 1NDUA 4H6VA 4B5LA 1WMEA 1C9JA 1KDYA 3LPAA 1KE1A 5AQEA 1EA7A 3EIFA 1SUPA 1AVTA 1T1GA 3GT3A 1NQJA 3VV3A 1R64A 3I2YX 3WQBA 4LVOA 1SUAA 3UNXA 5AMXA 1Y9ZA 1GCIA 1SIOA 3Q5GA 2PRKA 1TM7E 4DWWA 3CO0S 1Y4AE 1TECE 3PTLA 4WOBA 3I37X 2WUVA 2ZWPA 2X8JB 3GCWA 3P5BA 1KFUL 1P7VA 4GI3A 3DW3X 3DE3X 4AKSA 1AU9A 2PKCA 3ZXYA 4G9SB 3I34X 3BOWA 5SV5A 4HX2A 3ZXXA 1NDQA 4OMCA 2W2OA 5JMOA 1TK2A 1BJRE 1SBCA 3AJ8A 4NE9A 4I3GA 4LVNA 3Q40A 3LPDA 1Y3FE 1PTKA 3QFHA 2LUWA 3DE5X 2X8JA 3AFGA 1GNSA 3WIUA 4HVLA 1UBNA 1DUIA 4K8RB 3DWEX 2Z2XA 4JP8A 1MEEA 3DE0X 1U5IA 3OSZA 3DW1X 3BGOS 5ARBA 1SCNE 1MPTA 3PRKE 3T41A 1WMFA 5JXIA 1Y48E 1PJ8A 4DZTA 4C3UA 2PYZA 1GTG1 4WOCA 2Z2YA 1GNVA 3DF0A 3DVQX 2WWTA 1S2NA 5FBZA 3A3OA 1V6CA 4OV6B 3WIVA 1SCDA 3DYBA 5JXHA 3QMPA 3TI7A 3BPSA 4M1ZA 1KDZA 4HPKB 2GKOA 2V8BA 1AV7A 3DE1X 1GA4A 3TI9A 1THMA 4MZDA 2DP4E 1TM5E 1Y33E 1EGQA 1Y34E 1Y3DE 1CSEE 2HD4A 2XTJA 4RYDA 4BWGA 3DVSX 3GT4A 1T1EA 1TM1E 2B6NA 3I30X 3VYVA 1C9NA 1CNMA 1SH7A 1TMGE 1TM3E 1OYOA 3LXUX 1GTL1 1SUEA 2ID8A 4OMDA 3JQWA 1SUCA 1ZVKA 1GA1A 5K7SA 1SBNE 1XF1A 1V5IA 1PEKE 3DVRX 2Z30A 3WHIA 3D9QX 5FFNA 2WV7A 2W2NA 5B1EA 1GA6A 1WVMA 2PQ2A 1DF0A 2Z58A 1Y4DE 3SQOA 1WMDA 2O8OA 3F7MA 3DE2X 2QTWB 1GT91 3GCXA 3D43A 5AVJA 2W2QA 2PMWB 3CNQS 1TO2E 4H6XA 3VTAA 2WUWE 3F49S 4HPKA
chains in the Genus database with same CATH superfamily
3LGAA 4J0FA 5ITZA 3INTA 4OQ4A 2B46X 3I61A 4E5NA 1JZQA 1J8VA 2ZZJA 2P7IA 4EO9A 1DAKA 5CUQA 2CV0A 3KHCA 5EMLA 3CW8X 1WQ1R 2BFCB 3TAHA 1YOBA 3RH0A 1XC7A 2EL7A 3POEA 2W8BA 4RULA 2KQUA 4O5OA 3CLUD 3KXIA 4JGGA 1Z5OA 2VSFA 1GZHB 1P62B 1V4BA 4KR6A 1DXHA 1X1EA 2C54A 1FNYA 1ILWA 2AJBA 1QH6A 3CL1A 2AI2A 4AVAA 2OG1A 2PSFA 4ZVNA 1Z0HA 2PE5A 4N47A 4GGOA 4EAAA 3B6EA 3LQFA 1P19A 2XT9A 3LUPA 2V6FA 3MZ0A 3RBVA 2VFAA 3OEBA 5EJGA 3A1CA 1VG1A 1NVMB 4Z8BA 3FNQA 2WSMA 1U2EA 1S55A 4FXPA 1RPJA 2E33A 5CA1F 2FPIA 3KV3O 3WK4A 4P5YA 3PGLA 4I55A 3ORYA 4MAFA 4W6QA 3FE5A 2P8JA 4C8DA 2AKAB 4DBLC 3MPBA 1AK9A 1CW2B 5T4FA 4H7IA 2OM6A 4LZPA 3CLSD 4KFRA 1GNZA 3I8TA 3GGSA 5ERLA 2X2EA 2FZVA 2PKYX 2ZG6A 4KB5A 1LR5A 5ARCA 3WLFA 2GU9A 4G41A 3MCWA 4LO7A 3LI2A 4Z07A 1QNYA 2BHRA 3HCCA 3WCSA 1XD8A 5MGBA 2MYUA 1E9SA 3ZWXA 2Z43A 4O5AA 2BD0A 1UL1X 1PMJX 4GECA 2DHEA 4K9DA 4JI7B 4Q16A 2B8NA 4OA5A 2H4XA 1OBOA 2A6WA 3RS5A 2V7QA 4O7XA 2MSDB 1V45E 4KRGA 1RKQA 5BNPC 3OICA 2Q5TA 4KDRA 2GJKA 3NQ41 2OD9A 2WS91 3I37X 1YL7A 3DMFA 3NOQA 1MZPA 2C95A 1R1A2 4U6NA 3LQKA 4CLDA 3LA6A 4KU8A 2BZSA 1NI5A 3ZVKA 3OU7A 4RXTA 1ZRSA 5LBIA 4PG5A 1EVEA 4Q1AA 2AZXA 4ZN6A 3AB0A 1P8AA 3OFKA 4UNQA 3FPAA 4P9LA 4IOMA 3O91A 4ACAA 1SXGA 2WSYB 2ZIWB 3DGTA 4KQ1A 3ZK8A 1E3WA 2H0VA 4BZPA 4QLOA 3M49A 5FKJA 3U6KA 4ND4A 1PK7A 2ET1A 1CP2A 1I7QB 1GNSA 3WIUA 1ZOPA 3MQ2A 2NXWA 2ZJOA 4OYYA 3I3MA 1HORA 4GEKA 2ZSIA 4MXVA 1H9WA 1MZ5A 4XJZA 1HDZA 4RHTA 5FWNA 4B33A 2Z42A 4FSJA 1DYKA 1UPBA 4P0PB 2ZR9A 2YICA 1ZOSA 4FS3A 4FN5A 4F11A 3EFHA 1BW9A 4ARIA 3KL2A 4RFRB 4GOXA 5E8JA 4YH1A 1SZBA 4YVFA 1E5XA 1D2CA 2IOFA 3DZKA 1OYWA 4GPZA 4X90A 2CBXA 2R2AA 3EA4A 3ME5A 3RR2A 5EINA 5DIZA 3E5XA 3GBWA 3R0RA 1NUPA 1RWMA 1AUXA 3DG9A 1ULUA 4MVJD 2QD2A 2IUEA 3CLRC 1P45A 1QR6A 5HP4A 1JHYA 3ZBPA 4X84A 1K9VF 3IJRA 2BKVA 4DB4A 2P2YA 4L78A 3V55A 1U2DC 1E58A 4JLJA 5ILQA 4PO3X 2RJ3A 3KEOA 4PYKA 4BGVA 2I2XB 4DANA 3CZCA 1NLFA 4ZGWA 3W3AA 2RK3A 3F4LA 5LA6A 1OX6A 1QWOA 3GW8A 5EKDA 2PVPA 2GM3A 1HN0A 1R0KA 4HOOA 3HLKA 1EVQA 1EA5A 5CFRA 5GJ6A 4PHTA 2P9GA 3DHVA 3ZFGB 2ZRHA 3U4AA 3T2OA 5IDXA 4E14A 1TLTA 4Q6WA 4D02A 3NU1A 4PGGA 4Q4W2 4FI9A 3LHSA 1XD9A 4ND6A 3BGDA 4PWZA 1BCSB 3WIBA 1M2KA 3G2JA 3N2EA 2F4LA 2CNOA 1MA3A 2ACWA 4NZOA 1W06A 4JN6B 2HSWA 3SHVA 1WLTA 2FR8A 2YFHA 3WW1A 4W4TA 3HUEA 2C2MA 2VHUA 3WVNA 1FB5A 1YJBA 3T1HB 5AXDA 4TXMA 4LJRA 4TTTS 1RXWA 1RVF1 4O61A 3WBKA 1ML3A 2YC4A 3AF4A 5LA2A 4QBHA 3B01A 1NI4A 1VJGA 5IBPA 4KOEC 1EM8B 3GFRA 3QKSB 4BNGA 3HBAA 1S0DA 2QF7A 1O91A 1VA4A 4NBKA 3T3MB 2KSQA 2RAPA 1OVSA 3O5SA 1K86A 2JG9B 3A27A 3T5MA 3E5RA 1GNQA 3PICA 4Z9AA 1UFOA 5A03A 1A98A 1L2TA 3I32A 3JQ7B 3H1GA 2YFUA 5T41A 2W92A 4CGZA 4DILA 3BBLA 1JLLB 3LCPA 2OZ6A 3OQIB 4EH1A 3UMYA 3IQHX 3P2KA 1WSDA 2YXBA 4XUGB 4XB2A 3ENZA 5D1IA 3C7CB 2W2PA 4QBTA 5IN5A 4EN6B 3E7DA 5AHRA 3I0NA 2Z2ZA 1YB1A 2PJRA 1JR3D 3DTVB 1KE2A 4L9BA 4KC0A 1F15A 2ARKA 1M1NA 5FY0A 2EKPA 5I01A 2H16A 4YT8A 4ORFA 4LULA 2VPTA 1EB8A 4NMXB 1BBT3 4PVDA 5F3WB 4IEWA 2C2YA 2I4IA 1GYRA 1SVUA 4U7TB 3BODA 4CU2A 2O2GA 3AKZA 4XVRA 1QYXA 4FKZA 1W6NB 1DOZA 4XHBA 2GP3A 1SC3A 3AX4A 2ZHKA 1YNAA 2LW8A 1F2NA 2VZRA 4BMVA 1DDLA 4JVOA 5JPMB 1Q5OA 1W2OA 1AQNA 3E0XA 2H4HA 4HYEA 1SCKA 5FZ6A 4RZSA 1RVDA 2JHAA 3NC0C 3PXDA 2HWE3 4D82A 2VOEA 3ZMNA 4HLUA 1GRVA 5DT9A 3H1MA 4D3WA 4K6GA 1IQUA 1C3HA 4UBJA 4EFLA 4PS0A 1JAIA 2FN7A 3SLIA 3HR8A 3IP7A 3RYIA 1EK5A 3C8XA 1QQAA 1U5YA 3OY8A 3GCDA 3GJAA 5HF9A 4CLHA 4EY5A 4N40A 3DW3X 5JMWA 1Q7EA 4RDCA 4FMBB 4FVTA 4ENVA 2J6BA 4KIWA 3JAMA 3EVFA 1DUSA 3L1VA 1U5CA 5CURA 1DINA 1OX5A 1RE1A 1ZDMA 3RUFA 3ENRA 5FPKA 3VLBB 3O3MB 2Q9UA 3UGQA 5BT8A 4ONEA 4DV6B 3DM9B 2Q5IA 3F96A 4XW3A 3UETA 1MO6A 1SXJA 4TL7A 2C7GA 3OBAA 1SR8A 2HJGA 1RWVA 3DM5A 4CP0A 5JR3A 1DGRN 1U12A 1HK7A 4JV4A 4GQ7A 4ZV4A 4PVCA 1HEYA 4L51A 3QHPA 3AIIA 3ROQA 2PLV1 2EVWX 3UK2A 1MDFA 4ACBA 3G79A 5EHQA 3HDQA 4HFNA 5J36A 1R27A 3UA3A 4BU1A 1OUSA 3VSCA 1QFZA 3ZE1B 2QSYA 4DXRA 1YK1A 4Y5TA 1ODLA 4HAXA 4WSOA 3AZOA 4DWJA 5JJ5A 1AKUA 4IM7A 3ANXA 4E3ZA 3WWYA 1UKZA 4XLZA 2B4QA 2Q1YA 2BELA 4EVRA 1Z6AA 1HN1A 4ENQA 2B92A 2C8LA 5F12A 3ANLA 2D59A 3MRXA 4Q9LA 1JW6A 4Y2VA 5FO0A 4WN9B 1PIV3 5IWFA 1HB2A 5LLDA 3MT8A 4LOTA 4AO6A 3GAFA 3OZCA 3V65A 3DLCA 4JLDA 2JJYA 4LF8B 2PAEA 1IS6A 5IVKA 2FPRA 3MJRA 4PLYA 1PWEA 1YTUA 3R9WA 4QDOA 5JZVA 3C6XA 2LXNA 1ATZA 3ZLJA 1T8RA 2A3RA 3FCCA 3O1PA 1HQCA 3LFTA 4EAQA 4FYIA 4RPGA 2HWD3 1Y4ZA 3CUKA 4JNKA 2H8GA 5CVRA 2RGUA 1UMBB 4CODB 4XGIA 5LP6C 2ZJ7A 7AT1A 5JLJA 3Q8CA 4RK6A 2WWGA 4E15A 2R6CA 1P4HA 4YB8A 5BSTA 2VNAA 2ZIGA 3FCUB 1KJLA 3BGWA 5HKBA 1E92A 5JS8A 1BCSA 1GIAA 5PNTA 2Z2SB 2JEZA 2CHQA 5F3CA 3TR5A 1PDWA 2DVDA 3ZI4A 4XW2A 3BCUA 1EJBA 3NHSA 1P3JA 1V9SA 4WFQA 3QFFA 2X13A 3GT0A 3L77A 1RAHA 5HRUA 3AOGA 5FDBA 1D04A 2IYEA 3QOPA 2PN1A 2COUA 2H1IA 3P0IA 2ZRBA 4BUJA 4N3NA 1DQYA 2BTQA 1AX1A 4JCOA 3CWZA 3B13B 1YRHA 3R74A 3FWNA 4XQGA 5G04L 3RIGA 4LV6A 1PW7A 5FLHA 5FH9A 1WF3A 1MB4A 4CZ2A 1XOYA 4FTBA 3M2MA 2WUFA 1EBUA 2RAVA 5AM1A 4MWOA 1PBTA 3DECA 5LBCA 1QTIA 5EIWA 3PHJA 3IJEB 5A3MA 5IABA 1Y8QB 1B93A 5HX7A 1XEWX 1D6MA 4F6CA 1YJLA 5U9CA 4NN0A 5KYGA 1LQTA 4JOSA 1HNNA 4D4MA 1QJEA 1C0IA 1EDBA 5HG0A 5EHDA 4MRMA 2X5JO 1YQXA 1XP8A 3D8SA 2PJZA 2YMZA 3FZNA 4LJ5A 2WU3A 4P7GA 2VTKA 4GMDA 5B2EA 4NENB 4IQ8A 4WH0A 2QI9C 2H4FA 3SH4A 2G9UA 3KFXA 2A58A 4RMHA 4WL0A 4M37A 4PYLA 2UZ4A 3WLIA 5KYWB 4XQ0A 4JJ6A 1N2CB 4BFZA 2WO1A 1NUUA 2XNJA 4CLXA 3A31A 2G4LA 4LX0A 3KOUA 2EJWA 5IAJA 4ZVRA 2EF6A 2G9ZA 4TUYF 5FLJA 2JAWA 2WNEA 2XUFA 2BV4A 1VQ1A 3K1ZA 5FJKA 1QHHB 3SE7A 3ADDA 1JI6A 4HH0A 3U78A 3H50A 2X8JB 3AETB 1WSWA 3BGAA 4AP6A 2NPIA 3X1YA 5FCCA 4PEVA 2WFLB 4OQDA 2H4WA 1C7QA 1CF2O 2G1JA 1F3OA 1K5DA 1T2XA 1Z88A 5L4NA 3TUZC 3EDMA 3PGMA 1LDGA 3S0JA 4H1VA 1MAWA 2SKEA 1XYVA 1M8PA 2D3TA 4A2PA 4JGZC 1A9OA 1KYIA 1ADYA 3MS4A 3WWDA 3KD4A 1U3VA 3E7PA 3WLPA 3RS9A 2X8AA 1P0CA 4K9LA 4CHGA 2OQ6A 4F04A 4K26A 2A75A 1SCRA 3A9VA 1XAGA 1QJX1 5GZFA 2ZJ2A 2LW7A 4KGXA 2W6QA 3CBQA 3SIPA 1OLRA 1B8VA 1CX9B 1XXLA 2I2AA 5BR4A 1MQTA 1JFLA 4UVEA 4FFIA 3Q3VA 3Q41A 3OD1A 1H2WA 2QDKA 2RGDA 5TGDA 1QXRA 4Z4GA 4IMJB 5E4JA 3RREA 2RJNA 3V8RA 3H9JA 1K5PA 4OL0A 5A7WA 2PL3A 5CFDB 2GEKA 4BDTA 4C1WA 4BP3A 3NBQA 3U4GA 3VU1A 4DB2A 2WU8A 5CIWA 4YG3A 2HA7A 4O2AA 1UDRA 3WKEA 1LQ2A 3O8BA 4CKYA 1T34A 1UFRA 2B2XA 2ES3A 1DQ2A 2AZ5A 2XKBA 4TRNA 3RF6A 5LMZA 4CEHB 1TM1E 4AJIA 4AQDA 8AT1A 1GZTA 4L22A 3DLAA 3QYPA 5ALEA 1ZRFA 4IV3B 1XXHB 3I6MA 2VDLB 5K8UA 4RS3A 4Q4X1 5FR3A 3QA3E 4OJTA 1OHHA 3ILNA 1Q3HA 3U7QA 4YT2A 3LIPA 1VL1A 4E9KA 3KQMA 2AR6A 3NO4A 3OWHA 2HRCA 2QNKA 2CB0A 4HBNA 4R83A 5EKSA 4GRAA 1TK9A 5I45A 3KXLA 4RABA 3SDBA 3AL2A 5M3BA 2CNDA 3RSHA 1CJBA 4ZAWA 2C7QA 4CG0A 1PR9A 4NEGA 2WIJA 1TZKA 2GO1A 1Z7S1 1C7RA 4XQEA 1ULPA 3DPRC 5FREA 5JV5A 4ND8A 4AF8A 4MUJA 1B00A 4PBPA 2H85A 2NSJA 3PFBA 2C24A 3AFHA 1XNRB 4ASMB 1P6QA 3TCKA 3F6SA 1ODJA 1BEEA 1RXYA 4W5TA 1WOYA 5CT8A 3P45A 4L16A 3TJMA 4AJ9A 5AJYA 1UZ0A 4OF4A 4XPIB 1VRH2 4CQNA 4C90A 3TQQA 5E7JA 3KJHA 4DWOA 1COV2 3P0FA 3DN7A 1UKBA 5L7TA 3LBNA 4V1CB 2HF8A 4DZGA 1P0QA 4YJDA 4KWUA 3VJLA 2EHJA 3X1JA 3QKRB 3LCRA 1WZNA 2H08A 3R6TA 2JHPA 2PGJA 1WUHS 4DS3A 3SC6A 3MHTA 2AX4A 4PBTA 3G17A 1G6Q1 2PD4A 1F4PA 2JRLA 4NPAA 5EG5A 3JYHA 3V9PA 1MVOA 4MUEA 3KAJA 2CK3D 3VR3A 2WN2A 5FWYA 3LZZA 4XYBA 1QNWA 4N9IA 2Q5LA 2PHRA 2VA9A 4QE3A 3VOSA 2X9VA 3R5KA 3PLNA 4GPTA 3J8F3 4WESB 4OG2A 3D6AA 1A8QA 2QN7A 5TNXA 1UOFA 2Z69A 4YDSA 1QFJA 3NKGA 2ZT5A 4RMJA 3LW8A 2Y38A 3ZXAC 1XRPA 1DTWB 4PZLA 4L0MA 4LV5B 1VAKA 4Y6QA 5IJ9B 2FWIA 3POYA 1JUDA 2JZOA 2WB2A 3S8MA 5LEJA 1J24A 3JQ9A 4BEVA 1NBHA 1RU3A 2DBQA 3IAEA 2IEGA 2B4KA 4JKIA 5JOYA 3SHQA 3SN6A 1KMCA 2D8AA 5AKGA 4N8MA 4DN6A 2DE0X 1TAGA 4U2BA 3HKEA 3G9TA 3WGKA 2ZYWX 1DU4A 3LVBA 2E7AA 2Q1SA 5TPZD 2B8TA 3LP5A 5EXDA 3PNQA 1E1LA 1CVLA 4XD2A 3FLRA 4AMBA 1UJ2A 3DEAA 3HT2A 1CJCA 4TMWA 3VR6D 1A5AB 4E3WA 1NCRC 4HBZA 4IHAA 1NI4B 4QT0A 4Q12A 1LHUA 3PJGA 3FB1A 4Q7EA 5LNK6 1KQGA 3GGCA 3IUMA 2GDZA 4MQUA 1V70A 3OE7D 2XYGA 2AEEA 4PIXA 2WD7B 1O96B 4TSRA 4M0MA 4NY1A 3O4JA 3EYPA 2HHCA 3CXUA 4EB6A 2D98A 2AUMA 1PL0A 4DNXA 4GF5A 3BEDA 1U3GA 5KU7A 3PC2A 4Q66C 5ELXA 2NTJA 1ZNYA 3QF4A 4JA2A 4X1YA 4C0XA 3FUTA 3OX3A 4NF2A 1B35A 1K6MA 2HJIA 3A9SA 2XB6C 1RVV1 1NY72 3IHWA 1VHJA 3NALA 4KQCA 4PTZA 1U5IA 3RU9A 2VOWA 3ZY4A 4FYHA 5BY5A 2C4KA 1WCSA 1T0JB 2O2JA 2GC2A 2QTVB 4IQGA 3PNSA 3SKVA 1QRAA 2EIEA 1NBEA 4DDHA 4J07A 3JYOA 1HETA 3W05A 2FW8A 3CEPB 3W5MA 1DXOA 4UM7A 5F5IA 3OJCA 4S2HA 2ZW9A 3G2MA 1OR8A 2E51A 4OMFG 1X9HA 1FMJA 2LD4A 1EFRD 5IMSA 4XTCS 3CLPA 3F1LA 3OX1A 2O2IA 5TVGA 3TBFA 5KBFA 2CT8A 4C04A 4Z92B 1GRCA 2IXAA 5D5QA 4MO2A 3QLUC 1N4AA 4DLTA 2PSHA 2I4MA 4RBNA 1IJEA 3QX9A 2GXSA 1WLWA 2IEYA 2OCDA 1BJQA 3MYRA 3EPRA 3MPOA 3AW9A 2OZJA 1CUVA 3QI7A 1R66A 1P44A 4TZ6A 1N1DA 2W71A 4PAGA 1AQYA 3DCIA 1XLTA 4MRAA 4CF5A 1Y4DE 2OSVA 3B1KA 4EGQA 1K7CA 3K4PA 5CEHA 2BY4A 4KSCA 3ZLTA 4BV2A 1Z47A 5F7JA 1JFSA 4JFRA 4YY3B 1RLIA 1W4RA 5LDGA 3WR0A 3OOYA 5TQ0B 1L8QA 1S0CA 3HHEA 4KPUA 2YV2A 2JZNA 1LRJA 3Q7TA 4KFSA 1N8TA 1A8SA 4G1FA 1RM3A 1JOBA 1YBHA 4HXCA 4UU7A 3ZDSA 1C0LA 1ZIDA 3G59A 3DDCA 3VAZA 3IEXA 3EXG2 1JTEA 5A7NA 3IHTA 4XCQA 3NGMA 3FLMA 4IDEA 2VF8A 1QQ7A 4IR7A 2XQXA 5B55A 3T12A 4KQ6A 2R1UA 3NEPX 1KKUA 5FPSA 2TYSB 1M7GA 4KWTA 4XSGA 4LBLA 3H8UA 4ZS2A 2EWMA 3RZGA 5JFOA 1LPNA 5DDIP 2J3LA 3PC6A 1WZIA 5FWYB 3VR4D 2J5BA 3AFOA 3PHIA 4YRPA 1U0GA 3MYYA 1FMD1 1TYAE 4IW3A 1TAHA 2PUFA 1CVIA 1NMZA 1DWUA 3Q11A 5JAZA 3GDFA 4RTQA 3VDNB 1DARA 1P4RA 4M54A 3Q7PA 5GZDA 3D7LA 4ARBA 1O4WA 5J59A 4OJMX 1XRSB 2X1VA 4KXUA 2JGJA 1GQGA 2IV3A 5DZEA 1W05A 3WTCA 5IRCD 5DG1A 1RRFA 4WM8C 5ICMA 3SPXA 4W50A 3PDQA 3LKJA 3MIGA 2WDBA 2PUBA 4BXOB 2GZ3A 3CUWA 5G0TA 3STWA 4R1PA 2O54A 4JKMA 4TRJA 3QFSA 2QZJA 1LLCA 5JPCA 3QBEA 1ZUHA 1ECBA 5L9AA 3ZSJA 2Y92A 4M7PA 2ILMA 3RBXA 4NCHA 2QG6A 4CTEA 1W0JD 1Q11A 2YXSA 2ZB7A 1NBWB 4C1BA 4L97A 4Z1OA 3BE4A 4A03A 3D8HA 3UENA 1UPUA 5I5GA 2X53S 3CJIA 3L6UA 4FQ8A 4A8JC 5IJRA 5F4BA 4IXTA 1SHJA 3VTZA 3PDWA 2YS6A 2DU0A 4BCDA 5FO8B 5JR7B 2O6HA 4MR7A 1ISGA 1P3Y1 2RJ2A 1BMDA 5KTRA 4K1LA 3RSJA 1SEVA 3ZD8A 5LQNA 2I2WA 1UZLA 3FUUA 3JQEA 3EF0A 2OBYA 4I4TB 2WU4A 2QE7A 4QD2A 5H81A 5ENDA 2I7TA 3BHMA 3UWKA 5KX5B 3ZI0A 5B6IA 3KVNA 721PA 2AHOA 1UJBA 3VDXA 2GYUA 3RTDA 5JNWA 4MIYA 3EQEA 1PO11 3VOBA 4DFSA 3BSWA 2I78A 1UWLA 3DAYA 4P08A 3ZW7A 2EIBA 5AKEA 4XFIA 2W48A 3Q0TA 5H82A 3SX0A 2VPYA 4MJ3A 2OFOA 3JQAB 4NU8X 2ZI5A 1MBZA 3VBRB 1Z0IA 4CM9D 5C5CA 1NY6A 3ZDDA 3P2MA 1FQWA 3WDKA 3GARA 5GZ3A 5DN6A 3OCJA 2Q46A 3V2HA 3MMZA 1YXMA 1P39A 3VD9A 1L5YA 1ODMA 2E4YA 2ZYAA 4LJAA 1V6OA 4DMKA 1RUC3 2XJRA 4TWIA 2O3JA 4W9RA 3OI7A 2O3TA 1GUYA 2OHFA 4BN0A 3WNQA 4E33A 4URWR 3DXTA 5FUMA 5HZMA 1W19A 1NFRA 2WSSD 1VB2A 1B8PA 4AJ4A 3PLQA 4BJ1A 4M6WA 3P0RA 3IDAA 1DJPA 1DLJA 2P37A 3L6CA 5J4LA 1QB7A 4M1ZA 1YNSA 1YFJA 3CRRA 5A6XA 4XI9A 1AJOA 4Z53A 4BNKA 4NARA 1S2EA 2Z1NA 3R2JA 3KCNA 2NXCA 2GB4A 3KHUA 5E9QA 4MXWA 2XE8A 1XA3A 1ICEA 1MU0A 4NK4A 1Y7HA 2R1TA 1E4EA 3EQ6A 3L7LA 3TDMA 4WNYA 1VE3A 2IP4A 1D0IA 4FE7A 3EEQA 1ULDA 4EHNA 4IE4A 1DC6A 3SZLA 5CT4A 1Q1NA 4XVCA 2EX4A 4J76A 4B34A 2QDNA 3FH0A 5L40A 3H84A 4M99A 1P5RA 4U2FA 1F0YA 3HZOA 4IEUA 1R0XA 2XNCA 5DK6A 4D3XA 1NJFA 3UOAB 2V6GA 1YJ5A 1M34B 1A0OA 1ECLA 2JGLA 3ES1A 2Q8OA 4BGDA 3G9ZA 3JWHA 2Q9AA 9LDTA 4YMTA 1I9CA 2RHBA 3UHPA 1PS8A 2OP1A 4QO7A 4HGRA 4X71A 4M7RA 3RG8A 4XBQA 4PI0A 2C61A 4PPNA 4ND1A 3C39A 1N2EA 5HMLA 4BB9A 1NUQA 3F3KA 2JBWA 3TW4A 2AOVA 4DDVA 1FLNA 1JYVA 2PAKA 5FO1A 2CWDA 3BTAA 4JKLA 4EKNB 4GZ5A 2Q9BA 2FDGA 3IULA 4TKUA 3WY6A 3E2MA 2ERYA 3BD9A 3HGTA 4II7A 3DB1A 3R9XA 2CXRA 1E4YA 3K2EA 5GQSA 3ONNA 4Z51A 2IXKA 1UADA 5D8DA 4JBNA 3YASA 3IIAA 3A0RB 1PYGA 2UZ1A 5HK8A 3WXPA 3DZGA 4ECAA 2WFLA 1LCIA 3T1QA 1Z9BA 4I14A 1CRPA 1DXQA 3ZJYA 3DVLA 3A9RA 4NBRA 2FW9A 4MB2A 3W8DA 4D9FA 2RONA 2FD8A 1J58A 2VZVA 2G1UA 3O83A 4FPYA 2ZQ5A 2P4SA 2F6BA 2COKA 1SLCA 3DLIA 4RF4A 2JW5A 4Q7MB 4YPJA 3K4QA 2PLRA 2ZAHA 1C8VB 2X5IC 3EPJA 1ZBDA 2ZEXA 2YZ7A 4BJ6A 5GJCA 4IW3B 3PVCA 4BL5A 3C70A 3HACA 3ZU6A 1P18A 3WLLA 4IEXA 2XKAA 5LWHA 4H3KB 4AJKA 4KWLA 3BYWA 1RDFA 4CLEA 1J9ZA 3BXZA 2LZ0A 4LZJA 1FEZA 4PSCA 5KHOC 1FQKA 4ZRMA 2Z79A 5HCIA 2HEYF 3AI2A 2JE9A 3IAFA 1R50A 3FIUA 5TJ9A 3JY6A 4WZZA 1LI7A 2RHTA 1OI7A 5CXQA 1Q22A 4AJHA 3U1TA 3I2GA 4UFLA 1JH9A 4MDHA 3F5FA 4MGSA 2WSSA 1PL7A 5KYUA 2NO5A 4YMSA 5JPNB 2W6IA 3A6DA 4JCCA 1YRYE 3HJNA 2WSLA 3OKPA 3JSXA 1XZEA 1V95A 3HCEA 3T09A 4IGFA 2RB5A 3CRW1 2NU6B 1U31A 2HIMA 1AK1A 3PQ6A 4Q05A 4PLHA 3N2GB 5LVAA 1TVEA 4G1MB 1FQJA 2IU4A 1JJBA 1OAAA 3H2KA 4PBOA 1RTKA 4OD0A 5IHRA 1J0BA 3W20A 4LRSB 1QS0A 4C91A 2B5OA 1QCYA 1G41A 2DPHA 1S0JA 2IPMA 1GZ6A 4K1ZA 3C5WP 3NYQA 4R5HA 1E9FA 2J9YB 1SKQA 2Q50A 4K5QA 3MWKA 3K92A 4C7VA 3SOZA 4B3JA 3R0JA 4HNGA 4TZTA 5FNVB 2XTZA 4AYUA 5EXEA 1CIVA 2V74B 4RV9A 3PX2A 3TIVA 4MJXA 3T1OA 4EBFA 1SULA 4AYXA 1FP7A 4B1LA 4CPBD 5FR1A 3F4KA 3AFKA 4PBSA 4XJSA 2MHFA 4CDRA 2QLNA 4LVCA 3LPFA 1TVGA 3K0KA 4BBJA 3FJSA 4MV2A 2OO5C 2VHZA 3FFWA 4PLCA 3OFND 3FYSA 2VJPA 1TKCA 2ZJ6A 4M49A 2Z2YA 3A1NA 2ACKA 3HYNA 3EQ7A 5IDWA 2QDXA 2QW1A 3NNNA 3SHTA 5KS2A 1BXRA 3V1TC 5T8KC 3DWGA 2F8SA 1XCPA 4JC5A 4P92A 1DJLA 3UW1A 4L3WA 1XNKA 2A6ZA 2QD1A 1NKVA 1I0LA 3NHLA 2C4UA 4AW9A 3DE1X 5HMMA 3VL9A 4I9GA 1FFWA 4CEJB 2ARXA 5A3UA 5A7FA 1Q8OA 2RI1A 2YU1A 1JVNA 3ZX7A 2VJYA 5L9VA 1V26A 2VF7A 1PSWA 5KYVA 2C97A 2UYCA 2OGUA 5CTAA 1J0CA 2VUIB 2FSIA 4B79A 4EKEA 5CJPA 3CY6A 3L49A 1Z6TA 3TLKA 5FQ0A 3CG0A 2WNSA 3CX6A 1HE8B 5SY6A 4RMNA 3KB6A 5KNBD 1ABBA 1IULA 1V6SA 2Y2UA 4BLOA 5EP1A 3QH4A 2CZCA 1RUF1 1N6KA 3AMVA 3KR1A 3KYDB 1WDLA 2ODEA 1XCGB 3NH6A 4C0KA 2JDUA 2FEPA 2C6SA 1S0EA 2FW1A 1VM6A 4C0LA 3T9EA 1EWTA 3DEHA 1JRLA 2X4LA 1VBD3 3IM0A 5DQ0A 1Y4SA 1XJCA 2I71A 4XUNA 4PPGA 5IT9A 3WO0A 4CM3A 3N2GA 4X8LA 4CKCB 5BOVA 1OC2A 3M6XA 5CAEA 4A0RA 2JDYA 4AURA 3ETCA 4UVDA 2Q3JA 2DULA 5CLHA 3AFIA 3KHTA 4NONA 2V7XA 1OROA 1Z28A 3ROFA 3EDCA 4PI2A 5T5OA 1QCCA 1DSSG 3IBFA 5BY2A 3T52A 1K3TA 1OZ0A 3QPDA 5IW0A 1XFDA 3QTLA 3VA7A 2P9ZA 1EWVA 5TT0A 2XNDA 2WM2A 4WMLA 4XWAA 1W36C 1KI7A 1NT4A 3PSHA 4AEKA 2ONZA 1DV2A 1MO5A 4TSKA 4AMUA 4QLAA 3PNBA 2G28A 1ND3C 2QENA 4TKMA 2W9XA 3ZHQA 1PWHA 2ZLBA 3O75A 1RUD1 3LPCA 1LGCA 5IM4F 1IGOA 1W90A 1R4ZA 4WK4B 4JT9A 3TTVA 1ABFA 5BSRA 2GHQA 3H2ZA 3VI3B 4JJZA 4JLVA 4QXOA 1A4UA 1IC6A 4CUJA 4S2EA 2GYWA 4N3GA 3JBG1 5SY9A 5HYVA 3A3NA 1H5QA 3KQ4B 3KJFA 4LZZA 2AS0A 1JWBB 4B84A 3NCTA 3TN91 3CHXA 2VM9A 3HADA 2C78A 3KXPA 2DFCA 4YRGA 1O0BA 1UZVA 3JV7A 4JI3B 4WVVA 2GF2A 4I3HA 2DVAA 1J06A 5KJEA 2AMVA 5FCDA 4UVGA 4D26A 4WLVA 3ECAA 4MCAA 1J1LA 1Y3BE 1YS1X 3DCNA 1A5BB 1XYNA 3TXYA 4LSMA 1P2GA 2RGBA 2YJZA 5IKMA 5I3ZA 4X8PA 3O2NA 5FZIA 1XDDA 3RC8A 4UTPA 1AK2A 4XABA 2VXBA 1W36D 4PLPA 2ZCWA 2QXYA 2C7BA 5KHIA 3WK5A 2XQFA 3UJAA 3RVDA 5B3JC 3I04M 2ZGMA 3DUFB 5FTKA 1IN4A 2P9CA 2GSDA 3CZPA 4HAYA 1QU3A 1MCZA 4XFBA 4O4IA 4HRXA 5I7FA 2GR9A 4R2XA 3BXHA 2P2ZA 2JDID 3BFXA 4IX9A 4EZBA 2HQRA 3TO5A 1VZ3A 2CWSA 4NHOA 2CVZA 1AQJA 4R2WA 3S1LA 3OCCA 3P9CA 4AWXA 1IBSA 3OT4A 1W9SA 3SLGA 1G1AA 3WXBA 5C8WA 1TT5B 4QFBA 2LUWA 2I7DA 1RMTA 4HFSA 2ZATA 4YZ3A 3Q9UA 3NB0A 2R7KA 5NULA 1L1RA 3DKQA 3PXAA 2XXZA 4WVZA 2BGOA 2A5DA 3SSOA 4JR2A 5EPAA 3CNHA 1XQ1A 1VYVA 3RRFA 1RP7A 4DXTA 2PY6A 5H83A 4LYGA 3CKKA 3L8EA 3H4VA 2CLSA 3PD7A 5IJZA 3H8JA 3WHPA 4XCBA 3QPWA 4IFBA 5D8AC 4X6QB 1QIJA 3CBNA 5KOHB 3CIFA 7GPBA 2YNMC 2JI8A 5FBJA 1QZUA 4BZXA 4DXDA 5A3WA 3QVWA 4OH7A 4FTEA 1RM5A 3BIEA 2DRIA 2MMGA 4ZU3A 4DF3A 1IHOA 5ISLA 3P2YA 4AL4A 3CC8A 2AFHE 9ATCA 1LBSA 4FT4A 4DUWA 4OKNA 3VBOB 1RWKA 1GRNA 4U9HS 4EG4A 2BF7A 4XIOA 1WLSA 1EPZA 1QG6A 1LPAB 3WLKX 2JECA 3L4JA 2FJ0A 2DAPA 1RC8A 1ZUNB 1UX7A 5TV2A 2MINB 4D6RA 3ZJ5A 5LK5A 2CXNA 5CM9C 4PO1A 5I6DA 4NDAA 3SQOA 3P4YA 1C1XB 3MFYA 5LYYA 4LZLA 5FI1B 3JZAA 1ZD9A 5KYUB 5LJIA 1QE3A 4V0KA 4MQLA 3HFRA 3KZ1E 2Q3MA 2ATEA 1JYXA 1N1VA 1ONPA 4G8BA 3HSKA 1F17A 3IP3A 4Y2TA 2WNHA 5ALZA 2I3DA 3II6X 2ZAYA 2YV1A 4KSBA 3VR5D 4XM0A 3GEHA 1EQAA 5BXQC 4I4TF 1ST3A 2WBKA 3EIWA 1V2HE 2HU7A 4A92A 3DOFA 5G41A 3IQEA 4LDNA 2QBYA 4YP6A 3V6LA 3DE7X 4OYHA 3DDZX 4TN5A 5K8LA 3OUTA 1H0SA 1TCVA 2V7GA 3LUDA 3DV9A 2LKCA 1VRH1 1CGPA 4UE2A 1WM1A 3E3MA 5KVVA 1Y37A 1FDOA 4JXKA 3DYPA 5IX8A 2CHUA 4TWAA 1P8JA 4BO2A 1AQIA 1T8WA 4Q3DA 3L7DA 4V1CI 5LBUA 4C7XA 1UO9A 4UM8B 2CUTA 1AF9A 4CV0A 2WWFA 2OCBA 2XXAB 5FNZA 2AOTA 3VKGA 1QJY3 1OLUA 4CEYA 3EZ9A 1BE6A 3AZQA 1W29A 4O1IA 3QPCA 3UXEA 2IELA 4LEJA 3DOJA 1JHMA 5K3FA 2OHGA 3P9NA 3FR8A 3NM5A 1AXEA 2FMIA 1LF0A 2AFIB 3MCUA 4F91B 3ZDYB 4DABA 3KJXA 3FWYA 4RWEA 5F1OA 5IWAB 3AKDA 3PC3A 2B9UA 2IY9A 5A7HA 1UMDB 2FCAA 3ZNPA 3NDBB 2QV0A 3QWBA 3VD4A 2VL4A 5C33A 4DLYA 4IHQA 2E5LB 3ZIDA 1PR6A 2HREA 4LA4A 4RSMA 2COEA 2GK7A 1N2BA 1KGYA 1KFCB 2F62A 3BWYA 4FOOA 5K0SA 4M8KA 1QJCA 3IIKA 1I32A 4MWGA 4UBNA 4RGVA 3LH5A 4IJVA 4RTJA 4ARSA 5ECDA 2WYWA 5TF4A 3VBFA 3OGJA 4LBQB 2W1WA 2IUFA 3NAPB 5AD1A 3FL7A 2VSNA 4D45A 1L3IA 1PJQA 1VPTA 1D1TA 2XLFA 3TW8B 2NZJA 1BXGB 1NYTA 4RPIA 2IU3A 3VPBA 4OHRA 5BXXA 4L27A 4S1TA 3R9XB 4RDXA 4YNIA 1JTVA 2Q4TA 4JHXA 3VNVA 3ND5A 5IVDA 2WTXA 2VYQA 3CIOA 3AMNA 2NW6A 1IQRA 3TRDA 4EUHA 2ZGKA 3UJ7A 1YQDA 4BP8A 1F5SA 1IOVA 2NLOA 1WDTA 4XF4A 4RCVA 1OGIA 1HXS3 2IWRA 2Y68A 3EPKA 4AC9A 1SJ9A 2DVBA 3W5NA 4XPZA 1I3KA 1G8KA 4C7KA 2PSEA 3RW9A 3NHBA 3RJTA 3VVBA 4BB3A 3V8QA 3IR7A 1ACCA 5I8ZA 1IUPA 2O8DA 3APBA 1U3UA 2PG3A 5HIMA 4O63O 1JMUB 4HNUA 1ZUIA 2NV0A 1NW5A 3HNOA 1FOEB 1F0PA 1IG3A 4BVHA 1JXQA 1W96A 3OT5A 3GJTA 1KQNA 4JGIA 1BMFD 2BFPA 1E77A 4TX1A 4PCRA 4YJ2B 1L7VC 3RSSA 2EZ9A 3B6IA 4WT7A 4KN8A 1RJ7A 2LR0A 3WQSB 4LBVA 3VD3A 2PTHA 4WQMA 1GCUA 3WDVA 1AHIA 4NG5A 4UPVA 2IFTA 1DJQA 4INDA 1WKCA 3ZKUA 3JR3A 2R6ZA 3Q6NA 4TYYA 2WKKA 4F4FA 1O2DA 2HU8A 3PV0A 1NF2A 2PNJA 2MINA 4Y20A 2YW9A 1SVWA 4MZDA 3IEKA 4QKNA 1UPIA 3VDBA 2IUUA 3VYVA 3KTDA 1AR73 1KK2A 4F4CA 2AREA 5E9AA 3NDIA 5JZSA 3R9KA 2RDQA 2VQTA 4BQFA 3OH8A 2OO5A 3ETLA 4W4ZA 1PIV1 3EWNA 5BQXA 3CEJA 1SG9A 1XBFA 1GR0A 4F46A 2BZ0A 5ACA3 5FNVF 1TME3 2QB5A 2OUIA 5CLLA 3OTQA 3IUJA 4R8SA 4MSVA 4IEEA 2IQ5A 3GJ5A 2VZUA 1BIFA 3E5MA 5EYPA 5DI3B 3CNQS 1OLUB 5SV2A 1JU3A 2XLAA 4UHHA 2V4MA 3LSEA 3LT1A 3TE7A 4HQKA 5K99A 3LUFA 1IPFA 1ZBE2 4CYMA 1GJRA 2BZDA 2H92A 1ZCFA 2BFOA 1SA0B 1RBMA 1EG7A 1TVMA 1JFFA 4W6ZA 2O2CA 4QOEA 1DP4A 4G85A 4MPPA 4P22A 3TTUA 1RGSA 5JU6A 4BLRA 1PGL2 4FGUA 1OJ7A 3VGJA 2FDIA 2GALA 5GONF 1N6OA 5FBKA 1REQA 3CJTA 3IA7A 3SDZA 1VYHA 1QKKA 2CV1A 3NIFB 2EGGA 4CKZA 4CCKA 2P2DA 1WUIS 1A77A 4LXIA 2AWOA 1QYDA 2WJZB 2IHUA 4XQ9A 4BGIA 4IIJA 4MEBA 5DTRA 5E3IA 1WA5A 3U0ZA 1GUBA 4JOBA 1WHSB 4DR3B 4E70A 4TQAA 4ZREA 4OUEA 1IXKA 1OBVA 2FQ1A 3EFOB 1LU2A 2XL7A 5F3EA 4ZV7A 1KZ6A 1SCAA 4YUWA 5K3EA 4C05A 3ROUA 3EXHC 3WMXA 1IIRA 3ICPA 5B6PA 3DC2A 3QW4B 1Y9EA 5TQ2B 1F2VA 2RG4A 1F8VA 2RHWA 5C9AC 3L1KA 4KO8A 3GRRA 2QRUA 1B26A 3R7BA 4AVCA 4RHCA 5T4HA 4H3WA 4RD7A 2BMAA 3DOUA 4LJKA 5M34A 1KJJA 3ZZUA 5AVUA 5IPFA 1RM4A 5HBAA 5H8WA 4DY6A 2G9GA 1E2GA 3UUEA 1WW2A 3VKFC 2VTDA 2PJDA 4KQ9A 2B1QA 1I51A 1Q83A 4IFEA 2NO6A 4EZ4A 2N75A 4IRMA 3AJEA 3BJRA 4B7AA 2QVLA 1UDCA 3TOJA 2BGIA 4PZEA 1QXJA 1Q5PA 3LNCA 5GOTA 1BMFA 2O5CA 3TZLA 2Q4DA 3HUFA 3RYHA 2C1EA 3JU9A 4PO9A 2FMDA 3OCVA 4WECA 3KVYA 4LOJA 1E1YA 1EGVB 4G8JA 2DCTA 2JENA 1AD2A 1TYCA 4BIMA 5D5PA 2UDPA 4YAUA 1SCSA 3M9WA 3VBFC 5TPWB 4D9IA 1FP2A 4BKPA 3TN92 4GYJA 1J2EA 1IZ8A 1YC5A 1ZWLA 5H68A 1JDTA 4TV8A 4BNMA 1SIOA 4DB5A 2VDOB 1RIFA 2F9MA 1QP7A 1FP6A 4Z9XA 1I2CA 2BUBA 2ZSKA 4Z4FA 1G98A 3PU3A 1KMHB 1C30A 5DZSA 1OPXA 4BVAA 1H69A 1MRSA 1IS5A 3NAGA 4NAVA 4ZXEA 5FLKA 4W8OA 2ZRGA 2Y33A 2FOLA 2QX8A 1PO7A 1JR6A 1XMPA 1BBT2 1VJ1A 3EZGA 5KTSA 3UH1A 1MFPA 1WW4A 4MW2A 2VPPA 1LHVA 2H6BA 2VTVA 4CM4A 1U6IA 1ML4A 4JIGA 5F7OA 4LE2A 1X7HA 4F5YA 2GDFA 1QMGA 1DL5A 1HLDA 3SF8A 5EAIA 3RDPA 4B87A 1KITA 3JATA 1UCXA 2IIPA 1PJ8A 1ISFA 1GMMA 1BZYA 1WW5A 1R5OA 3AYEA 4W5NA 5C80A 1A34A 3EIOA 1C7FA 5FLYA 3T7AA 2O2EA 1U8YA 3ZD7A 3WICA 3L8GA 3W34A 5A1AA 1V71A 4FFPA 1HT0A 1KVQA 3OZEA 5LUAA 3QSGA 1VE0A 4ARUA 3DBHB 2VF5X 1ND2A 5FT9A 3WNNA 1W9HA 3RAEC 2X9GA 4UATA 2VT7A 1BD4A 2IYSA 2P90A 4BWGA 4YCBA 4UULA 3VPDA 3KVBA 1CU1A 1OA0A 3DAOA 3R3ZA 1E7SA 4EDFA 3ZYGA 2CDNA 4YJ2F 4HDQB 1UOJA 4QBKA 5IMBA 1HA3A 2CXXA 1V5FA 2O3SA 4JENA 4TVKA 1A3KA 2AB0A 1YOVB 2F3UA 5JAQA 1Q0SA 4J2HA 2ZI3A 4WHMA 5EJ6A 1I0IA 1LOGA 3TG8A 1F2DA 4LJ7A 3ETHA 1XZCA 4YRZA 1SBZA 5IEBA 1SKUA 4N0QA 5D8AA 2RS52 3W5UA 1H2AS 1Y3HA 1OCEA 1URXA 1K2VN 5I5EA 2QGZA 5CFLA 3H3UA 4Q4V3 2DX7A 3UFXB 1E0AA 3OTWA 1W7AA 1ZFNA 2HMVA 3LDFA 1B76A 5LDDC 1MVEA 2A3YA 2F9LA 1WMAA 3SSNA 1Q1AA 1YZFA 1WBLA 2NSDA 4JY7A 3H5LA 3FBGA 3AR8A 2YRXA 4I0BA 3H9BA 5A71A 2A92A 2UWAA 3BMNA 3PNLA 3ONFA 2BGJA 4TYMA 3B1ZA 1KI8A 4H9GA 1TEHA 3FY4A 3O14A 3WG2A 4WY5A 5G4KA 2NPOA 3WMEA 1Y5RA 3ND7A 4O3MA 1JU9A 3O92A 2QKDA 3UMGA 3QUSA 2BVBA 4DSNA 3BMCB 1R7RA 4K9RA 3DMNA 10MHA 4KG7A 2G36A 3UMFA 1Y3TA 1XNTA 5HFAA 2GEFA 3HRHA 2ZUBA 3LQQA 3IT0A 2GEUA 2H06A 1R9JA 1JYEA 1S8OA 3GUUA 4IIHA 1GT6A 4PX9A 1C5KA 2I1WA 3V4VB 1K5MB 4FR0A 2I6XA 3CF4G 1G16A 1KC3A 4GDFA 2OPKA 5CPBA 1OFIA 1RJDA 3CJQA 1NV8A 3LKDA 2BFDA 3USUA 1RUH1 3AGQA 3MT0A 5F64A 3PCXA 3GPCA 3KF3A 3FWHA 5CEFA 3PWZA 2QTHA 4XE5A 4LQDA 4ZCRA 2QX7A 4HDNB 3QA9A 2H07A 1USVA 3UKTA 2ZYTX 4J6EA 5FEMA 5BW6B 4CV2A 3THXA 4AGGA 1UJ4A 1GNPA 3HXKA 3RFTA 1M0EA 1MT3A 1VLHA 5K1ZA 5KTMA 1X7ZB 3M3PA 4O2BB 3K3PA 3CKLA 1CDOA 4RD1A 2JA1A 3PJFA 2YVKA 2JLQA 4BNIA 1CF9A 3KEMA 3QU4A 5SYNA 2AUTA 1GCAA 3SI7A 1DQRA 3FPKA 3DZIA 2GYVA 4QLBA 1XVUA 2RMU1 3KE9A 3WI7A 4DHWA 3F74A 5BYKA 5LSAA 3LWNA 5HEKA 3GRCA 2QVZX 2IYZA 2WWSA 3HV2A 3WLOA 3HMKA 5JNUA 2NYYA 1UIRA 1QVRA 2B21A 1L8OA 2D06A 3O38A 3MZHA 4QPGA 4L7QA 2OGTA 3WF4A 2D00A 5HXMA 1QH1A 5FPYA 1UOOA 1FS5A 1KP3A 3PWTA 2ZU0C 3TBKA 1JFTA 2IC1A 3W7AA 4N49A 1QGUB 3PDJA 4MX8A 4D3FA 2Q6TA 5FPAA 4ZQFA 3WLNA 1KEPA 1G5IA 3OIVA 1AO0A 5JQGB 3ZV7A 1FFEA 3SVZA 1ZA4A 3BMOA 1H8VA 4MEJA 3TR6A 1EE9A 1H2HA 4XE9A 1LVUA 3KOXA 3HR7A 5B7NA 1TKBA 3AG5A 2A9JA 2NP6A 4DAEA 3QFHA 2BFBA 3LUBA 1N34B 2JCYA 1SPXA 2HPHA 4NCXA 1DWQA 4M88A 1FVXA 3IJ5A 2FH5B 2BFCA 4OATA 2EKQA 1NT0A 2IW1A 1RZVA 3BCSA 3QLUA 1P2BA 1KFJB 1RM0A 4WE3A 4DUGA 2K7FA 2Y34A 2R1TB 4QA9A 3T0GA 3UO8B 4DIOA 3R6DA 3KKLA 4P5DA 4B6FA 3GZAA 4FPOB 3U4CA 4HX9A 3ABIA 2XKJE 2GUWA 3JBG2 1UDBA 4LY3A 2C7PA 2VXOA 5A5EA 4W99A 2XT0A 2F8TA 1WDWB 1TU4A 2J33A 4EJ0A 2KE5A 3STXA 2VN8A 4P7KA 1TMGE 1E0DA 2IYLD 3EXG1 3WQ0A 3LP8A 2DWUA 5BVHB 5BR1A 2IYRA 1D9XA 4F3JA 5F51A 2ATIA 5LBBA 2D54A 4K9OA 1AL22 1EPWA 3CS3A 2OHXA 3MB8A 2A4MA 2O06A 3DTYA 1XV5A 1L0BA 1KI2A 2Z09A 1Q3EA 5DCYA 2ZSAA 3B5LB 1P77A 5CHEA 3L0YA 5EMJA 2X10A 5DLEA 3UJCA 3GNLA 1UQRA 3CH4B 4FGLA 4M98A 3VGIA 1VYTA 4HV4A 3O90A 4IEZA 1N2JA 2H5LA 3M6FA 3GFFA 4XQCA 2XWBB 4RJIA 4WVFA 3N0XA 4XIGS 4AP5A 1YDEA 4IDNA 3V0BB 4KP7A 4TXWA 3FUWA 4YW4A 5KAMA 3RC9A 4P4LA 1DG1G 5A32A 3VPGA 4ZHNA 2IUYA 1NCRA 4ARZB 5HKAA 1Z5GA 3IPXA 4MKGA 1Y1PA 2A5FA 1WQ4A 4DQAA 1AL21 4EQVA 4ZZ0A 1QPGA 1AKWA 2D13A 3B1WA 2OX0A 3IVMA 2PTMA 1UBGA 5CH3A 4UDXX 2P1BA 1NP7A 1USIA 3C7TA 2VBCA 3THYA 4XFGA 4NEQA 4I19A 4Y1XA 4QL3A 2VH5R 5A6QA 1LAJA 3S6JA 4ZMSA 2UV8A 3ZYHA 1YQ6A 4IDGA 4NCKA 3VSDA 5TJHA 2QQWA 1JDPA 2C57A 4P5PA 1ZNPA 1RADA 3TLYA 1YU6A 4HQ0A 1JWAB 1IHPA 5CGQB 1K7SN 1C9MA 4DLRA 2VXYA 4Q1FA 1LNSA 2W95A 1FVOA 1KPHA 1CIJA 3K4AA 1QQP1 2OUKA 2X0DA 4C43A 2P1ZA 4PV7A 2B2NA 1ST2A 2PBZA 1BKYA 3L8MA 4ZYZA 2DU8A 4TQ9A 5HBRA 2JAPA 1GVNB 2WMNB 2JAXA 2ARAA 4RF3A 2GT1A 5J5AA 1X7ZA 4O2BA 3VHOA 4RFSA 2Q21A 1NC3A 3DQZA 2BCGY 2N7GA 3ZN4A 1AG9A 2EX0A 2PGXA 1N3LA 3D8BA 2JIMA 5LWBA 3B36A 2ISCA 2D3RA 5GIOE 3WRXA 2R49A 4JDNA 3D3QA 2E1PA 3EODA 3MJTA 3ZHTA 5EIYB 2V97A 1SUDA 4FOSA 1I4WA 4Z0TA 1X0XA 3AI7A 1N2OA 4BNYA 1UJCA 1GCOA 1CZVA 4I08A 4FSXA 4NI5A 4R41A 1FNDA 3S6PA 4Q9JA 2YOFA 3LECA 5AVKA 4LI3X 4RR3B 2HWB3 1KR2A 3PX3A 4QTUB 4M0UA 1RYNA 2C04A 3TNYA 3D6NB 1V5WA 3K09A 2MT9A 3ZWMA 4MDEA 2X15A 5E89A 1EP3B 2ZX0A 4J1SA 4KQFA 4I2OA 3OTHA 1PVVA 3THWB 1A27A 2PSDA 4M1MA 1QO0A 1IU9A 4EB0A 4HD8A 1XALA 2R68A 5DSZA 2ODAA 3S3TA 1WXFA 3GVIA 4JLNA 1CDEA 1LWOA 1TQHA 2BDEA 5BSUA 4GP9A 4UCWA 3P5BA 4ZK6A 3PS9A 4R9RA 1VCHA 3I3OA 4ML3A 4A6PA 1XYYA 5K8IA 5CCBA 4DIBA 1Q19A 4QU5A 3EIQA 1ZCZA 1E2BA 3IIJA 1W2HA 4G6ZA 3GOHA 4P34A 3ZNNA 1N2HA 1RE0A 2V72A 5UKDA 4AROA 2G70A 1I1NA 1DIOB 2OLJA 4GICA 2OA2A 3UYLA 4M0DA 4R3WA 4OJNA 2XBO1 3WDUA 4GS5A 1TF2A 1QH8A 3Q7RA 1N1SA 2ODPA 1LPBB 2QQIA 2Z98A 1YFWA 3IKJA 1Z75A 1AT1A 3NJXA 5KXCA 5AHOA 3NOVA 4YI5A 4PZ0A 2CBZA 1MA0A 5DG2A 3D4IA 4J4BA 4OP2A 3WL5A 4TL9A 1LX7A 5BO5A 1YO6A 2JS7A 3COVA 2I2DA 3P0HA 4QXAA 1ZGHA 1UP4A 1D4OA 4TV9B 3UJPA 4MH0R 4DV0B 1KDPA 1CJKC 5JBIA 3AJZA 5KTPA 2NSYA 4F4DA 3H1BA 1ZZBA 4A7KA 3MW4A 4BA6A 1H30A 4JDUA 2Q3HA 2AMFA 3O4HA 2VRNA 3OPVA 3GJ7A 1UWWA 1EX1A 4JGZA 4B2IA 2XKKA 1SLBA 1T2AA 2XYVA 1Q0PA 1DJOA 1RLMA 3ACFA 4JDPA 2HN9A 3K9QO 5LZ5A 4ERNA 3PIRA 5BOSA 3IAHA 4QFDA 3MF9A 4G8DA 2TMYA 3TS1A 4TN7A 4P58A 1ABEA 1XWFA 3GX1A 3IH5A 1VIMA 1WNTA 2FXVA 4A44A 3ZVRA 3NC4A 1XZHA 4B6JA 5IFTA 3HRKA 3KQTA 4BN4A 4YUVA 1U5AA 1JLRA 2Q1MA 3QVSA 5IVHA 1U2PA 3ZNQA 2WFF1 5I0TA 4IZIA 1QGDA 2GESA 1EPUA 4NS4A 1UYPA 1J0DA 5IDYA 5EHNA 3EVCA 1W9FA 1CNEA 1VZ2A 3F90A 4RSRA 2QP4A 5TDHA 2B94A 5FTLA 1BD3A 1WSAA 4B47A 2B20A 1NJSA 5GVSA 5A33A 3ZCXA 4G09A 3NRUA 3UICA 1CY6A 3S2ZA 4LF5B 4L8VA 2A67A 4L4RA 3ORRA 2G06A 4JUAA 3O12A 1HX6A 3U39A 2R6QA 2BKUA 4JBWA 3BJZA 3PFGA 1KYYA 2DU1A 2EFGA 2Y0CA 5JALA 5IT6A 1Q0LA 2Z6UA 1X8LA 1V6LA 3MG9A 3GQVA 3ELYA 4MKIA 3IP8A 1D4FA 2C1XA 3E9QA 2DB3A 2WWYA 5HF5A 4W5HA 2AL7A 4MS3B 1FL9A 1FYWA 3O2SB 4E0BA 3D6VA 3T1YB 1J1UA 1DHTA 1BEV2 5JJIA 1NBMA 1FC0A 4CLOB 4TLLB 2TECE 4QXQA 3JQDA 1XF9A 2FPPB 4V24A 1W94A 4Z2WA 1NTRA 2OYSA 2CL7X 3EXIB 1M8GA 5L95A 4M7OA 2RC5A 3SJCA 1AXRA 2EC5A 1JKIA 3H1YA 4J1QA 4DSZA 1LW7A 3BRQA 2CLIB 3OT1A 4O4LB 3ND9A 5E6UB 4XWYA 3S68A 4B3MB 5LA1A 1H6AA 3WXMA 4JVNA 2ZBVA 4BNLA 3UEOA 1U1EA 4I2NA 3KQQA 3FRJA 1X70A 2O0JA 1CWUA 2ZS9A 3U4QB 3EOAI 1ZCAA 2WD7A 2Y8EA 4JUFA 5JNLA 3MWEB 2R6R1 1Y3CE 1EP1B 4F5WA 3OLWA 2Q1FA 1T91A 3EDYA 2P9TA 4FQ5A 3MQ4A 1H8TC 1DCFA 2FBEA 3NASA 4Q8KA 2OESA 3ID6C 2Y1EA 1QLHA 4AJNA 4ZKEA 3OM9A 1SHWB 4YALA 2VUHB 1RKBA 1Z17A 5DNUA 1ZSVA 3D5EA 4IERA 5KBYA 1DAIA 5ACA2 4LI0A 3EVZA 1BRTA 3ECCA 3MYXA 4LE4A 5MF6A 4WCFC 3IAM6 2JGRA 3D0RA 4MV1A 3I49A 4PTYA 2RMU2 1XPRA 2Q4EA 2WBLC 3AKSA 4NWVA 1RYZA 2DFKB 4CDQA 3BCWA 2J0UB 4W7SA 4Q3CA 2ORED 4CIAA 5A3OA 2F3RA 3VR2D 2O2HA 4M87A 3EVTA 1A9XB 1IZZA 5K9YA 4GWGA 2QZ2A 4D9MA 4DMIA 3ELBA 3CUSA 1KI6B 4FIZA 2B0CA 3RTEA 2XB2A 4UOEA 1OD6A 3LMKA 1U1DA 2IS2A 2V0CA 1H2BA 3NFYA 1E2KA 2NU9B 3REOA 2OV2A 3AETA 4KAXA 5C1DA 5I8TA 2JDZA 1T5OA 3ESQA 4WVMA 2XNKA 2WYIA 2PS3A 3DF9A 5IAEA 1D6SA 1GPJA 2E32A 1XJ5A 1N4DA 1G3UA 3HS3A 4BRUA 1NX9A 5D7NA 3QY0A 4QNNA 3N7JA 3M6MD 3DO8A 1NA1C 4CUGA 1IHDA 1QCZA 5KYTA 4QHYA 5H3CA 4ZZIA 3TQIA 2HLPA 4JGBA 4EUEA 1P80A 3GVHA 3ZXUB 5CYYA 3TSZA 3WYGA 1NVKA 1D2NA 1G3RA 2AH5A 1AYM3 3OKFA 2CJWA 2XDAA 4Z6KA 3HY4A 1SXJD 1QFSA 4IMPA 4H18A 4FDMA 2YOGA 4OIFA 1X33A 4RHEA 1RRPA 2IH4A 4W9NC 3WB1A 4LO4B 4YA6A 1C3OA 2IPNA 2FQPA 1QK4A 1RMU2 4UCQA 5A5VA 1Z8FA 4UD2A 5ITSA 3RK0A 2YZGA 1SUIA 5D6NA 4AK3A 2QT9A 1OV4A 1T6NA 5T8KA 3SS9X 1ZH6A 2Z5WA 2JG8B 4LRUA 2B82A 4ZOLB 1W6OA 4GQBA 3OQPA 1D0VA 1NLQA 1U3CA 3TBDA 3C7AA 3EHEA 4BE9A 2ATCA 1SXJC 4CEHA 3PEFA 4EOGA 2RGYA 3OPTA 1KP2A 1U9JA 3D7MA 1NE6A 4RKFA 5F23A 3C3PA 5HUHA 4FBFA 3T7CA 4MV5A 3Q7EA 2VVTA 2A86A 1SBEA 2Z58A 4MIKA 3PFWO 2WHPA 1CZNA 3PYMA 5GTDA 5EJ8A 1B74A 2IPOA 4FP9A 4BNJA 2DG2A 1BYHA 1M06G 4INOA 2HKXA 4ZI7B 1W2GA 3TYXA 4MA0A 3MJEA 1GKLA 2JIJA 3COJA 3AUUA 3KAQA 1N5JA 3W5CA 5DGXA 2YIDA 4QGSA 3DYOA 2ICAA 4WCDA 5LXTA 3ZHYA 3ILSA 2FMHA 3OEYA 5H5JA 3WP5A 2Y6VA 5ECYA 1YUNA 1KFEB 1VMEA 3EVGA 3ILXA 4OHZA 4JFAA 4ZA2A 2GAJA 2Z8YA 2ZJAA 2J4FA 4BOWA 3CX7A 3PUYA 2ADEA 3ZZMA 5D84A 3NHZA 3OG2A 2HF9A 4GZ3A 3KHBA 4PAOA 4KXQA 3VZJA 1A8PA 1GXSA 4LDQA 3M4JA 2I7CA 4UFKA 5D3MA 4G36A 3DR5A 3D8UA 4JKYA 4ZPIA 3I0ZA 2D2FA 4WZAE 4R7ZA 4K3VA 1G21E 1VRWA 4RGAA 3E5HA 3ETGA 3I9LA 2PD3A 4NJ4A 3GLIE 2ES4A 3BE8A 3ZR6A 4RA9A 5JZBA 3FZEA 2XRZA 4RF2A 2VAMA 4C0WA 4KIFA 3OY2A 2VMCA 2JXAA 3E35A 4DA9A 1U0HC 1EFUA 3VU9A 3VYSB 4XD7D 4QX1A 5CK4A 4LWZA 4CBVA 2D6NA 5FLIA 4YR7A 3S2EA 5JHGB 1XHEA 1SOMA 2BONA 3VC7A 2FPUA 1E2JA 3PIGA 5D3ZA 3PQEA 4WBNB 1PVC2 3QENA 1BMQA 1VB3A 2NUPA 1MJNA 4B44A 4W6XA 2H5EA 1N0VC 2ZMLA 3SVTA 3S2FA 5L3QB 4XYLA 4P33A 5TB5A 3HXTA 4ZPXA 1S0FA 3MUEA 4P3KA 1QLJA 4LF6B 4G4IA 5HTKA 1LTQA 2CB9A 1QNFA 1X9GA 1EXNA 2XVKA 1EDDA 5K0LA 1Q7RA 1IQPA 1EP0A 5AJHA 2PM8A 2Z9BA 3SNMA 1SBFA 3F6YA 4L76A 2PUDA 4NABA 3D0OA 3LT5A 5HJ5A 2Q5QA 4EJSA 5D85A 4TQUS 4C0BA 1HFKA 2HX1A 4IIXA 4HR7A 5CBPB 4R1LA 3OA0A 1XMSA 3IKVA 3SQWA 3ORHA 3UUGA 2F1JA 1TTQB 1NJGA 4J9UE 2VT2A 2Y9PB 4EPXA 3QUAA 4FZRA 5AVPA 1UDXA 4LAFA 1H6BA 4UUMA 3AVTA 2B39A 2AFIA 3QEMA 2PZMA 3PTRB 3UPUA 1V6JA 3D8RA 2FG6C 4TUYB 1PSZA 4QG7A 4Q00A 3DJFA 1T6ZA 5IK7A 3CPSA 3OBBA 3Q88A 4Y9UA 1H0KA 1BWRA 4H1WA 1BNCA 5JZGB 2CSGA 1G6OA 3AC0A 1T2FA 1YB6A 3VBUC 5J3UA 2G9FA 5HFNA 5SY4A 2V8OA 4I1PA 1N78A 2AR9A 1G6KA 4KL1A 3QJGA 2P6MA 2WZQA 1YVPA 3B3QA 4JLBA 3MCTA 2YY5A 3ITKA 4ITCA 2WAAA 1AR93 4GM1A 3B1YA 4BC1A 2C3YA 1C0PA 3FBYA 3E9DA 1SCNE 3DPRA 1WZXA 4D56A 4NFYA 2VYVD 3UG6A 2H9YA 3EFBA 3N9LA 3QIVA 4AF6A 4UEOA 1UBHS 4CMHA 3CVOA 3JXSA 2Q4SA 2J1VA 4K6CA 4FI3F 3NV7A 1UXGA 1K88A 5FYUA 1BVHA 3Q8AA 4LW8A 1L5SA 2CKMA 1Q50A 3QSYA 3NV9A 3MT9A 3QFCA 1UMCA 3NC1C 1PJZA 2QQ0A 3ABOB 2DY1A 1N3YA 2C82A 1P75A 3OZDA 3FHIB 2VOVA 1QH7A 2VNIA 1W39A 3UG7A 4AQYB 3MFQA 4WXYB 1M8JA 1LSSA 3PTZA 4GT1A 4N5MA 4V1PA 3H2YA 4Q4W1 1ZNQO 2NTEA 2FMTA 2D5FA 2C26A 1DF0A 3MTDA 3MN1A 1F0NA 4G0UA 1EYBA 3EVEA 1CAUA 5AVJA 1YIFA 2IZ0A 4DNFA 1ZR4A 1XZQA 1KO7A 3ROKA 1X19A 2IK8A 2FSVA 5BR8B 4SLIA 5DAXA 3L1IA 5F2SA 1Z63A 3PVNA 1T6XA 2HYIC 4XRGA 3L6BA 2WIDA 2XA9A 1GOFA 1V16A 1VXRA 5FZFA 3SIXA 4N5NA 1R091 5KNDH 1W2TA 4LXUA 1CPNA 3IEUA 1ZC3A 4I66A 5AKJA 1OQ1A 2AEMA 1TM4E 2WTAA 4GNRA 4O33A 3WWZA 2ZGRA 1OBFO 1YJAA 3LHKA 2OB2A 2HLDD 2PBFA 3BD6A 4YMHA 1RB8G 4RKYA 4J4TA 1ID1A 1J0AA 3W7VA 1DQZA 1ZOIA 1VGQA 2C98A 1WZUA 4HUQA 3LLSA 1PAUA 3ONWA 1UQUA 4Y2HA 5GJVC 1RWBA 3C8UA 5FRDA 5BURA 4B8ZA 1ZYUA 4EELA 1Z0ZA 2XUEA 1E1RD 4M86A 2PS0A 4EP1A 4UEKA 3V8VA 2OPHA 5BPFA 4JQTA 3MWGA 1LRLA 1W9MA 4ZO7A 1MOQA 5J1SB 1XE8A 3MJFA 1N1MA 2FCTA 2FEXA 3QX3A 3PNMA 1ZRMA 1V00A 1LEHA 4E09A 4N90A 5BWNA 4C2UA 3GLTA 1E1KA 1Z7GA 5K6RA 4CU8A 1FXUA 3Q3HA 1MGPA 4OHPA 4H7HA 1Y1TA 3OLXA 3QBJA 1UY1A 2XXJA 1RTVA 5HKKA 3G13A 3NGXA 5I9MA 2IEIA 4YWJA 1NF9A 2WYUA 3QKUA 4XZPA 1ZMTA 2AF3C 4ED9A 1C1DA 4PIVA 1N6LA 1QRTA 5FZ1A 2ZIVB 2RHDA 2ZFUA 4JGYC 5DLYA 4CL8A 3JD71 2CLLB 4D0QA 2R751 2JLSA 1L5KA 1CY7A 3ISTA 4MAMA 1RUJ3 5K8JB 3OC6A 3KJZA 4XR9A 3K8QA 5JARA 1GUZA 1VBKA 2WUEA 3H3LA 4BJ0A 3CW2A 5HI0A 4OXQA 2MCFA 2X09A 1RUE2 4QELA 1RMU1 4GUDA 2HW8A 2GJ9A 5D1NA 3K9NA 2VJDA 4COKA 3RYHB 3D6EA 3HYSA 5L3SA 1CS0B 5IVEA 4L4YA 5ERYA 4W1QA 2DGDA 3T3EA 3WJ2A 4FOPA 1GGMA 5TPZA 2ZUFA 2HXSA 1SQGA 3C24A 2GBIA 2JI7A 4YGYA 3QYFA 4P54A 5JI9A 2ZXEA 2XCUA 2I67A 3HEIA 2B99A 2ZGTA 1CY8A 3M33A 4MZUA 4RM2A 3ZV5A 2GZAA 4PO8A 3W2FA 2PUJA 4EYEA 5BRAA 5EMMA 2REXB 2CL0X 4PLTA 3T0IA 4Z54A 5JAIA 1Y6RA 2A1TR 2C2OA 2PMBA 2FR1A 5B36A 3GRKA 5CYFA 4RK1A 4ZYUA 1Z4QA 3UMVA 1SCUB 1T10A 3WOGA 2GMPA 2X41A 3KYDA 5HQ3A 3LYUA 5GY7A 4DR7B 1HDCA 2PT5A 2VTBB 1KMIY 5COQA 4B3BA 1L4EA 3U19A 4PDWA 4AI9A 4H3HB 1DGRA 3KU4A 2ZSJA 1K7XB 4X63A 2DQZA 2OORA 4FEAA 3BXPA 5BWBA 1Z56C 1ZISA 4LE1A 3EN0A 4AXBA 2BDRA 2W4MA 4JBXA 2VVDA 2XD9A 1MNAA 3CRVA 1VCIA 2VK1A 4Q3BA 4F7DA 3H8SA 2R5FA 3W04A 4RK4A 4CR6A 2IV7A 3UFBA 3TI9A 1A82A 2G0NA 3QU7A 4RYDA 4EF6A 5CA0A 1PGL1 1V8ZA 4NWIA 4IDBA 4YT4A 1XQ6A 4XBNA 3B93A 1H8EA 1CQJA 5LD2B 2HJVA 5AUQA 2CHFA 5KSZA 5EE5B 4F1KA 1V8BA 3AKEA 2ATXA 1I13A 3RIHA 1E4EB 3G2HA 4X20A 1UMKA 4BZQA 5CD1A 2G8NA 2AMYA 1WD5A 3P26A 4QUDA 1U7UA 4DV2B 3PJYA 4DSUA 1KSGA 5AO9A 3L7NA 4FE3A 3VPAA 1GPDG 1LNZA 3PMEA 5KOJA 2QZPA 1B3BA 5BNOC 3I1FA 3TEXA 3VU0A 3KV6A 4NOLA 3VZMA 3KSDO 1GPNA 4YFYA 5E6UA 4R68A 1D2EA 5DYYA 4RHV1 5H80A 5L8VA 2WQ8A 3QYAA 4C4SA 4FCCA 3B2EA 4IGKA 3ZU3A 4XIKA 1YAHA 3OIUA 3IKLA 4J0DA 1A7AA 5IVYA 1U99A 1RLUA 1LBQA 3AEYA 2QD5A 1ZVFA 2O8NA 1PQ4A 4BXSV 4UPEA 1VE7A 2PFGA 2QV7A 4URFA 3L5OA 2F55A 3D1JA 2A5YB 2ERCA 2Q6VA 2V7QD 2Z9CA 2Q0HA 3TLCA 3LC2O 3D8CA 2XGGA 1PNVA 1M0TA 1UODA 1HW5A 3IB3A 2TS1A 5L51A 1XNBA 5CFDA 2A9QA 2AYYA 3T5GA 2VW2A 4TSFD 1ZM9A 2ET6A 2WJ3A 1X74A 4GOND 4BLTA 1GKKA 3T7JA 1IXZA 1N0HA 2AI3A 3AY6A 5I91A 1IJBA 1OKOA 1O9BA 2JWPA 1U2SA 2B7BA 4C06A 2Y1FA 1I5RA 2DCZA 2Z83A 1R4AA 3T7RA 5C3SA 1NLSA 1UXXX 4NXMB 1TX4B 1DV1A 1UZWA 2HWF1 3ZLIA 5LN1A 5CB4A 3W2HA 5IG2A 1AX9A 2IE8A 3AF3A 3CZ4A 4QQPA 2AVDA 3NYIA 1JIXA 1KAMA 3MFAA 1W04A 3ILVA 5EXPA 1V1JA 2KB0A 1L7DA 4E2YA 2OV1A 1OWPA 2Q1ZB 2BVNA 5J2UB 4HLUC 4Q0QA 2GTHA 4BTEA 4LJ8A 4LG1A 1XVIA 4IV1C 4Q39A 1SIUA 4TRMA 3RC3A 1T3SA 4KWIA 1QJ4A 4HY3A 2HF7A 3M9LA 4P82A 3MRVA 2X42A 3KAKA 2NLRA 3IQDB 2EYQA 3LUHA 1O94C 2Q1UA 3KDSE 3U4IA 1YQEA 4X7MA 3LPAA 3TZQA 4GC5A 4ZTBA 2I91A 1YJ8A 2H0RA 3DCYA 3VV3A 3JVVA 2X7HA 2ZSDA 4FKBA 1SC9A 4L2NA 1M5RA 3AXSA 2VR1A 4IJMA 1TKAA 4YAJA 2VDKB 1N9GA 4MW4A 3D3NA 3O47A 2PL1A 5KOHA 4K1XA 4JHTA 4RA0A 1JHQA 5DBEX 2ODWA 2C4WA 2QE7D 1YD7A 4GWKA 1Y6GA 4OBWA 4JB8A 3ZSLA 3RI9A 5LC1A 5KWRA 2NX2A 1I5OA 2Q3EA 3JCIA 2QAGB 1OFHA 2CJFA 2A84A 4UI9L 4JKOA 4KYVA 4C0SA 3PGKA 3ASVA 4KN9S 5LPNA 2Q3BA 3CCCA 3TX6A 4TRRA 4OP1A 5FZ7A 3LFIA 2BZ1A 1JIKA 3L0DA 1XZPA 3DWEX 3MERA 3KTAB 3GDBA 4QHBA 3JBG3 1YC2A 4XQ4A 2VHVA 2HDHA 2QN1A 2JCGA 4YRAA 4GGMX 1QRSA 2I8AA 5FMOS 3JS5A 1UBFA 3OZUA 3M2PA 2HSEA 5HS6A 4IQPA 5KXDA 1XD2B 3GLIB 4RWZA 3VZNA 1FSSA 2AFHA 1RI3A 2E4XA 4QEDA 1AURA 3O3NB 4XTMA 2E4VA 3MELA 2RJKA 4HL0A 4F2HA 4A3ZA 3RV4A 2VSOA 4OI1A 2YCBA 4L5BA 1ZNZA 3T5CA 3KKKA 3N0RA 3PPIA 4RJ2A 1C3XA 3E22A 5A05A 1KQ3A 4IVRA 4WDRA 4JVLA 1L1FA 3MMPA 5KEIA 2A70A 1MQTC 1N6HA 4AFDA 3LWBA 5ALLA 5AFSA 4V38A 3RBAA 4ZCTA 1G2PA 1AUPA 3LBAA 3I9V6 4Q7LA 5ER9A 3KXDA 1SKYB 5CXXA 3SHFA 4GOKA 4TSFA 4ON9A 1DIGA 4B3IA 1LBHA 3UV6A 3I2JA 4DC9A 2QUZA 4YC7A 2AF4C 4MGYE 2IEAA 2P2CA 3UGTA 3AVRA 3PVEA 5EP4A 2LROA 1NR7A 2I54A 2PAAA 3F49S 2OD2A 3C41J 1Y4WA 1OX4B 3ADCA 4NOTA 4GU5A 1ZM1A 4MP3A 2UVPB 4JBLA 4P4SB 5ALSA 1UC8A 5CVTA 4XBLA 2YPDA 3UHJA 1YI1A 4YW5A 3ZDZB 2IXTA 2HHJA 2QQPA 1RHRA 1RUH2 2VE1A 3WDYA 4FHFA 3R8FA 3JARB 1R082 5AOVA 5AW2A 1Y5MA 3CB2A 3ADKA 5KHGA 3WF3A 1HRV1 2ZITA 1HLFA 1R6VA 5A9TA 3IBYA 4M1YA 3RS4A 1JG4A 5CDGA 3DPIA 2JEMA 3WADA 4D7TA 1MV5A 2ZPUA 1CAXB 1CULC 1WW8A 3A6HA 2I4RA 5DP1A 4Q1CA 3OY8B 1YR9A 2O3RA 3OURA 1YB7A 4HRAA 4E13A 2SECE 2HNBA 4WGGA 2HFKA 2OCIA 2P6OA 1XBTA 2XMCA 4NYMR 4HNRA 4QHTA 3B9PA 3SKYA 2VCEA 4DMGA 3LCMA 2PHDA 3R7WA 4TMZA 2QQFA 1I5EA 1SCQA 1TUBA 1W8OA 1XJAA 4Y2QA 2C03A 1TEXA 1RSZA 3DV2A 2Z3ZA 2KA3A 4Z82A 4EI8A 4OHBA 4OFXA 5ANQA 4I9FA 3QTTA 1RKUA 2GZMA 3CZ9A 5JS7A 3C97A 1MS1A 1SXJB 1L6IA 3SC2A 4KAAA 3H75A 3S99A 5EL0A 3DXYA 2VMFA 1XNJA 4QOSA 2R85A 1YMQA 2WZDA 2WZPP 2AG0A 4Q5OA 3AVUA 4II2A 2ZOSA 3HSSA 1W2AX 2AKEA 4G4FA 1FUEA 1U0JA 3UESA 2JH8A 1N2CA 4YLGA 4MV7A 5H70A 3ZHCA 2C20A 4A8HA 2A1IA 3H4IA 3Q7QA 4C3ZA 1JT9A 3VZQA 3IPLA 3LHFA 3OVMA 2O8EB 3HOBA 1R0LA 1OKKA 5K8VA 4WOKA 3A21A 3WLRA 3MIHA 1PL6A 5EIEA 3O1LA 1GR1A 2JFBA 5GJBA 3N8HA 1UPAA 3WKAA 5KOIA 5KYYA 2IU0A 2LDBA 2FUKA 1K08A 4TV9A 1KE1A 1Y7PA 3OUIA 2RV9A 4CXXA 3HDTA 3B7WA 1KJZA 1JFRA 3UGFA 4F9EA 1L5WA 1GCIA 1QRUA 3EF1A 1VSQA 1RKXA 1EAMA 3PHCA 5A7SA 1NNLA 2A73B 1O7JA 1C2TA 1E3LA 1MIHA 1VLZA 2OK7A 2W22A 1I5PA 3WZ2A 1JJFA 3M8KA 1I7PA 2G67A 3E9RA 1A7UA 2JGFA 5D51S 4O02B 3KFLA 2ECPA 1SC1A 4P0TA 4PYOA 1SBCA 2VBDA 1UZMA 2O1QA 1E7WA 2VTEA 4E4SA 1M6VA 4Z3KA 2J08A 4BB0A 3N9IA 3T5DA 3TNPB 4LJYA 2YC0A 4COOA 1JWLA 5FP9A 3BXGA 2PV0A 3NWEA 3WLAA 4HGQA 2O48X 3R1IA 3IAM1 3MDPA 3ACHA 4IDDA 1H1AA 5G1NA 4ND5A 3RI3A 4GYWA 3B3QE 4MW1A 2PELA 3M4YA 4BK4A 2R1BA 5HGXA 4JLPA 2G17A 5E0OA 1QZXA 3F2IA 3T0DA 4G24A 1FDVA 4KN6A 3N8DA 1E3DA 1OFVA 3W9UA 2N1BA 1ZGCA 4RVOA 4RS5B 4PGMA 2LDXA 1UMBA 2PRYA 4DV1B 2GLUA 1SUFA 3KLPX 3S5JA 3MV11 1H8TB 1PI3A 5THKA 3LGRA 2ZULA 1VG0B 5MHTA 3IZOA 2DCJA 3FMVA 3K3NA 4ZHQF 3AEUB 3HA5A 3WAKA 1US3A 3L8DA 5ALMA 4XWTA 5DEOA 4RKRA 4PC2A 3AYAA 3AQ4A 2ZE6A 2ZKNA 2FW0A 4RAOA 2DUUA 3EXEB 5ADHA 5ELLA 4MRNA 3LOPA 2EF1A 3JQBA 4NYMQ 4J3JA 4QAJA 4F6LA 1F7VA 4ZEMA 1UOGA 5KTKA 2HWF2 2X23A 2YHIB 1G9FA 4OXYA 2YV5A 4JBYA 3PL5A 4LDRA 3P2JA 2E6UX 1TO2E 3BTOA 4XJXA 1H2LA 2ABWA 2C4MA 4WEQA 1I7DA 1MS9A 1ZJ6A 2ZJ3A 3TNFA 5EJFA 5JMCA 5TIIA 1EAH2 1UBRS 4L9RA 2W39A 1LEDA 1KZ7B 1SWVA 4RANA 5FWXA 1T3ZA 4AF7A 3DBIA 3F3YA 1VPEA 4KXLA 1IBMB 3U3XA 3ADPA 3IUBA 1J3QA 2CDAA 4DDUA 4CDUC 4CDWA 4KBZA 2KD7A 2J1AA 3TRJA 4ZT2A 3VTFA 4JQSA 4J1TA 1X1AA 2IVIB 3AB8A 4HDCA 3ZWYA 1A9TA 4MVJA 5CM2Z 4XWGA 4GXQA 5M2QA 3BGIA 2BMVA 3GP5A 1ACJA 3WYCA 2W2IA 4WKOA 1ORVA 4X5OA 3IVRA 1OUXA 3CF6E 5K3BA 2PXAA 1GPLA 3U07A 1NJ1A 3RPEA 4LGVA 3CEMA 4N9WA 4ZT5A 4LQ4A 1OOEA 4FZ5A 5F7XA 4HAZA 5AI4A 3BD7A 3KWFA 4XMIA 5TXGA 1SU7A 1P29A 2W1UA 5C18A 3AESB 4DA8A 1XROA 4ROTA 1NZFA 4F96A 5FOUA 2EBUA 4K87A 1ZN9A 3UHOA 2QLTA 2C5SA 5HFJA 5CEJA 2HHHB 5AJTA 1D2SA 2ZUDA 3JWJA 4HLDA 2QYSA 1Z3IX 2GNPA 1SXQA 4ENPA 3P0EA 4RKWA 3FRHA 1DEAA 1KIFA 4OGLA 3PC7A 5DBHX 5HZGA 4JAVC 2X05A 3GOQA 3RVRA 3N8KA 4UXAA 1H8TA 5IYZB 4Q9DA 5I9IA 5LQDA 1EDZA 2A0YA 1C8BA 3H05A 5IHPA 2CL2A 1PFKA 3MOIA 3FIJA 1V8OA 2A0UA 2XR4A 4QGAA 3SC2B 2PJUA 3SICE 4QPIA 2WUGA 4DYHA 3EPPA 2J3QA 5FZ3A 1W99A 3V3KA 2IEDA 3OLQA 4D42A 2WZ8A 3BJMA 3K0SA 3WMWA 3BDIA 1KYTA 1JYNA 3QOXA 4RM3A 1FT9A 4QOGA 3GDHA 2PRZA 3L7OA 3X1WA 5GONA 4AX4A 4WNAB 1H4HA 5JQGF 3WQBA 1VBA1 1PM4A 5JAPA 3C3BA 2PZFA 3JQ9C 2BR5A 3A70A 5KOYA 4XOGA 1TM7E 1LD3A 3I97A 3TZ6A 5C3PA 5BUZA 4ZXKA 1N2GA 4RHV2 5KNBH 1VBB2 5EPUA 1BGXT 4EUKA 4G1CA 1FYXA 4QARA 1Z62A 2AOXA 3ZS9A 2CTVA 2GZ2A 4B4KA 1LB2A 1GQYA 3T6KA 3BI3A 4C5BA 3MT7A 4CXWA 2YXNA 4HJXA 4IYRA 4TPKA 3GVPA 2DTEA 4KQ2A 3B38A 1YQCA 2UYGA 4ZIRB 2XZDA 5KTNA 2E26A 2W6NA 4MQEB 2XMDA 3WV6A 4AVBA 2A5ZA 3L84A 1Y6FA 2AW3A 5CA0F 4EGCB 3ZFEB 2J46A 1XDZA 3CE9A 1QDEA 2OV8A 4CCAA 5JXIA 4L72A 3ENWA 5LB6A 3OGRA 1Q0HA 3ZWKA 4Q4X3 2PUGA 2WO2A 3IBSA 1CT9A 4NDNE 3JQPA 3K05A 3LOIA 2BJVA 1AZTA 4S2UA 1FRZA 3K5IA 1V7QA 1SCDA 5G53C 1NYQA 5AIBA 2CHVA 4GMKA 2CVOA 1RWOA