5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
3QMPA 3DF0A 1SELA 3F7MA 1GNSA 1NDUA 1Y48E 4MZDA 1CSEE 1Y34E 1GA4A 3BOWA 1T1IA 5FFNA 1S2NA 4LVNA 1C9NA 1TM3E 4KPGA 1SH7A 1SUBA 2Z56A 2IY9A 1GA1A 3WIVA 2G4VA 1ZVKA 2ZRQA 1SCJA 1TO1E 4DJ5X 4RYDA 5CW1A 3LPAA 4KG7A 3VHQA 1TK2A 5SV5A 4KB5A 1AV7A 4C3VA 1SUCA 1WMFA 1P7WA 3UNXA 1KDZA 1SIUA 4DY3A 1YU6A 2E1PA 1SCAA 4OMCA 1UBNA 2DP4E 3P5BA 3CO0S 2XRMA 1AQNA 3SICE 2HPZA 4J94A 2V8BA 1DF0A 4HPKA 3LXUX 4HX2A 3A3NA 3BGOS 4DZGA 4BWGA 3BPSA 1YJBA 1AU9A 2WWTA 3DWEX 5AQEA 1TECE 2SNIE 2W2NA 4OV6B 1GTJ1 2W2OA 3DE4X 1YJCA 2IXTA 1TM7E 4I3GA 3DYBA 3I34X 4H6XA 2WUVA 1SBHA 2XVKA 1GA6A 4H6WA 3GCXA 1Y3FE 1BFKA 2XVGA 4ZARA 1T1GA 1SBNE 2PYZA 1NDQA 1C9JA 3DVSX 3JQWA 5ARCA 3VYVA 2QTWB 2GKOA 2HD4A 1OYOA 2B6NA 2PMWB 3PRKE 3DE3X 5JXHA 3WIUA 2DQKA 5JXJA 1SCNE 3EIFA 3DE7X 1OYVA 1AH2A 3DW1X 1SCBA 1SIOA 1THMA 3A3OA 5B1EA 3AJ8A 3L1KA 1GCIA 3AFGA 1AK9A 3Q5GA 4CFZA 1MPTA 5AMXA 1U5IA 2LUWA 5JXIA 1KE1A 1V5IA 1TM1E 4AKTA 1NQDA 1SPBS 1S02A 1Y3CE 2X8JA 2PWBA 4OMDA 4K8RB 1SUAA 1PJ8A 1KFXL 3VSBA 1NQJA 1AF4A 3F49S 4LVOA 3TECE 1BE6A 1BE8A 4I0WB 2SICE 5AVKA 1C9MA 3HJRA 3T41A 5FBZA 4AKSA 1SN7A 5JMOA 1A2QA 1GT91 1WSDA 1IAVA 4NE9A 3QTLA 5SICE 3AJ9A 3VV3A 4ZOQI 4M1ZA 2ZWPA 3D9QX 1CNMA 1BFUA 4WOCA 1KE2A 3OSZA 1DUIA 4WOBA 1BH6A 1Y3DE 3QFHA 3EDYA 4CFYA 3DE2X 3F7OA 1SVNA 2ST1A 3I2YX 2PRKA 3VTAA 1SIBE 1V6CA 3D43A 2PKCA 1HT3A 1PTKA 1Y4AE 1ZVJA 1SUEA 5ARDA 3I37X 2DUJA 1SBTA 1KFUL 1ST2A 2SECE 1GTL1 2ID8A 1TMGE 3BX1A 1DBIA 2PQ2A 3GT4A 4DWWA 2Z58A 1WMDA 5B1DA 1WVMA 2W2QA 1Q5PA 4JP8A 3DE0X 2Z30A 2TECE 1QXPA 1VSBA 2QFEA 1R6VA 4HVLA 3CNQS 2PWAA 1SBIA 2SBTA 4NMXB 1TM5E 2ZWOA 1NLUA 1KDYA 3Q40A 3LPCA 1TM4E 4NE7A 3TI9A 2ID4A 2WV7A 3VV2A 3EE6A 1Y33E 1R64A 3DVQX 2X8JB 3I30X 4Z2AA 3A3PA 4DZTA 2WUWE 4GI3A 3GCWA 3SQOA 1SUPA 3JQXA 1PEKE 3DE6X 4CG0A 1LW6E 2W2PA 1PFGA 1Y3BE 3ZXXA 4G9SB 1GTG1 1IC6A 1BJRE 1MEEA 1SBCA 5AVJA 4H6VA 4HPKB 2Z2YA 3DE1X 1WMEA 4B5LA 3PTLA 3WHIA 5FAXA 3H42B 1OT5A 1Y1KE 1C3LA 3LPDA 1TO2E 1EA7A 4C3UA 3TI7A 4DY5A 2Z57A 1XF1A 1AVTA 1SUDA 4DXZA 2XVLA 1YJAA 1P7VA 4FONA 1SCDA 1P8JA 1R0RE 3GT3A 2P4EA 1Y4DE 2W2MA 5I9SA 2Z2ZA 3DE5X 1ST3A 1JEAA 2XTJA 3DVRX 5K7SA 1GNVA 1T1EA 5ARBA 1Y9ZA 2O8OA 3DW3X 5JXGA 1S01A 2Z2XA 1EGQA 1KDVA 3WQBA 4YN3A 3DDZX 3ZXYA
chains in the Genus database with same CATH superfamily
5CTAA 3GLGE 2YWRA 5T8KA 1E6UA 1HYBA 1QHIA 3HJAA 4YG0A 3TN92 1PWZA 3EQZA 2IYOA 1JG7A 1XQWA 3UYKA 5C7LO 1ZESA 1QF9A 4Y30A 4U7GA 3C5HA 5ACA3 1P5JA 5H9RA 4NNPA 1W4ZA 5CHEA 2DG2A 4FSXA 5C53B 1QZUA 3ZPXA 3IODA 3P32A 4G5YA 2ILTA 4D7YA 1RKXA 1H9CA 4P3KA 3UUGA 3PVEA 1NE6A 3UFXA 3ZDVA 4LYDA 2P5YA 1VL2A 4BFTA 3A4VA 1NN3A 1V48A 3AKCA 1P6QA 2Q99A 1NA1A 3KTOA 2WJVA 3KR2A 1DQ5A 1OOPB 2WNOA 4V0ME 3V0BB 4B9EA 3G0OA 1Q43A 4ZT3A 2OGWA 2VQ3A 3ABIA 4QQPA 4XW2A 4UFIA 2BH9A 3IUSA 5COBA 3LFIA 2IC1A 3I6BA 4RZQA 5A4IS 3RUEA 5JXJA 4B85A 1LOEA 5FREA 1NZJA 3SQWA 1P3DA 5B1EA 3AP3A 1TJPB 4UVIA 4IJMA 2VRCD 5FY4A 2UYCA 4LQRA 3T12A 4Q4W1 1RWXA 2XEXA 2XVMA 4EN0A 3ILXA 1IQ0A 3SQMA 1ZKDA 2OBLA 3VHNA 1YZHA 3ZDXB 2I99A 4C4OA 1GTSA 2BQPA 1VBA3 2B46X 2I67A 2PHFA 5E2BA 5JNRA 3BXGA 1ASJ2 5A3LA 4PQEA 1RE1A 1R6XA 3U0VA 2XE7A 1G9CA 2RKBA 2FCTA 5C1DA 3QPAA 1Q0QA 5KYVA 1U5BA 1RPZA 2EEPA 2YY1A 4C20A 2GH8A 4RK6A 2ZGSA 1M6WA 3S2ZA 2Q8CA 2QG9A 1ZA2A 4Y2VA 1R1ZA 4CUAA 2ZSAA 3JX9A 2EW1A 3AEKB 5IZCC 3OPVA 4Q5OA 4GQ7A 3RARA 1TEHA 1EFDN 4NQRA 3CF0A 3VC7A 1K97A 2J1LA 3DE2X 1JRLA 4AZ3A 1OD3A 2BN4A 2Z5VA 4IW3B 3GCDA 4K21A 1TTPB 1U0NA 2CD9A 4JMPA 2XMSA 1CF4A 3NBQA 4NS4A 5LY2A 4KXUA 2F4LA 2NPFA 3LIGA 3PKZA 3ELDA 4W4TA 1QO9A 5IUQA 1PO22 4O4JA 3T7RA 3NJ8A 2FPUA 4XM1A 1W87A 2WLSA 3TLKA 1F35A 4M86A 2AVNA 4D2IA 5IFPA 4FOLA 3R7WA 1N32B 4BBPA 4LC0A 4IH4A 3V8NA 1U2DC 4FYVA 1YR2A 1GZ5A 2O59A 2X8JB 2HA2A 4ZAWA 4HXEB 4JL6A 3ZCSA 2E7QA 2RI0A 3N07A 2TNFA 3UHFA 4FEAA 3HDJA 1RRVA 4QPIB 2IZWA 5FY8A 3LZDA 2C2ZA 1Y1TA 2KM2A 1VMIA 4AJJA 3K96A 3GVPA 4XYLA 3EFBA 3ZLTA 2Z04A 4ER6A 3FTEA 4YJFB 1S0UA 4IQ4A 4ZCTA 2OPHA 3CLTD 4AZWA 4JEMA 1ZXLA 1IN7A 4AVSA 3WLFA 2UYBA 1NVEA 4PZYA 3ND8A 1Q1NA 3RF6A 2DVDA 1JYTA 1OZ0A 2W37A 4WAUA 2P8SA 3E81A 2X58A 4YS6A 5CAEB 4D4KA 2HNKA 1QNFA 3IB3A 5F21A 1ZEJA 1UJBA 2GK4A 4IIEA 4IPTA 4CT4B 1IDOA 4KG0A 4P5PA 2Y0BA 3O90A 4H27A 3V0BA 2HTFA 1IZ0A 5ALOA 2W2MA 4Q4Y3 3PX2A 5LIRA 2Q8PA 2WFF1 5F8PA 3M1LA 4AW7A 4FQZA 1U3VA 4HN4B 4EUHA 5ES4B 2E0IA 1Z34A 4BO7A 3NVCA 3K92A 1XKLA 1FQOA 1C7FA 1WB6A 2VL7A 2FWNA 2E4YA 1ATIA 3RAFC 3I4LA 1YKSA 4R4XA 4QUIA 4QPWA 4PTZA 4COYA 2EYUA 3NDRA 1JDPA 4MUMA 4R1OA 3NQ41 2I3BA 4KQCA 3TB4A 4IFBA 1K75A 1MV5A 5FB3A 4D6RA 2D6OX 3F5QA 3FLPA 4OHBA 3MJRA 4XVQA 2PGOA 1KJ8A 1QIQA 3PLQA 1DBRA 2B37A 1CUFA 1U1FA 2D6PA 5D1IA 4Q9JA 4D9EA 2NT4A 2NACA 3RSFA 1JZ7A 3G89A 5L4SA 1JWLA 3KLSA 1T9AA 4BLWA 2IFRA 4XQCA 2Q4DA 3K73O 2G4VA 1SFRA 3FFXA 3ZG6A 5CW1A 1HTBA 3RIEA 1W0OA 4Y1RB 1DPGA 1DG6A 1Z28A 2AMVA 4C3VA 2AHOA 2P6PA 1QDCA 3ZHCA 1KDZA 4EJFA 2IXIA 3WGVA 2FZ5A 2E1PA 2R65A 3U7IA 3ZWCA 2ZEXA 3STXA 2ZUWA 2E49A 5EE5B 3L7NA 3MGCA 4C4SA 1COV2 5DNYB 1DXYA 3IIIA 1TIKA 4RBNA 4HNHA 2F1KA 4Q01A 4IWYA 3AEKA 5KTRA 2JATA 3BD8A 3GP3A 3O4GA 5DGDA 5FO0A 1SBHA 3W0LB 3O82A 4QWMA 1Z2OX 4N18A 2QDNA 2ZROA 3E9NA 1BFKA 3BQMB 4IETA 1TCBA 1G8YA 4WCFA 1BSVA 3VDCA 3R76A 4C4YA 1JHMA 4BE3A 4HOYA 4RD1A 2OZEA 1Z5PA 3RKSA 3JQPA 4XYGA 5GP1A 4KR9A 1M2VB 2OQ6A 3MILA 2IW3A 2WT2A 1P1KA 4C0WA 4N43C 5F3GA 3EYPA 4AYWA 5CIYA 3C6YA 1LSSA 3PVZA 1YQ5A 4ZT5A 4F7DA 5H3CA 4C7XA 5FPLA 1IM8A 2FW8A 4Q0UA 4J3JA 1UT6A 4CMEA 2YN4A 1Z7YA 1TM1E 3P9QA 5FFFA 2B5WA 4DNPA 4RPCA 2I03A 4TM7A 5IN4A 2X8JA 5G05L 5G3YA 4KNWA 2C0QA 2VYCA 1KJYA 2FRVA 1VMJA 1E5VA 4CR7A 3CEAA 3GDWA 2QVSB 5J63A 4JLSA 4BFXA 1ZD9A 5A9RA 2VTKA 1T5SA 2Y64A 3HNMA 4JV4A 4QPIA 2RH5A 2QQOA 2X9NA 2QSUA 1RADA 1VRH2 4R2WA 2HEVF 4KDEA 1VSUA 2CWWA 4DYHA 5FPBA 1OPRA 2Y4NA 4WXRA 3C85A 3PQFA 2QKYA 3AJEA 1JR6A 2WT9A 2WE7A 4QE3A 3EZGA 4AFCA 1HNNA 4Q4CA 4QECA 2FDHA 4E03A 4Q4X2 5CAEA 3ZKYA 4A0HA 3WLAA 5ILQA 2E3JA 2P9HA 3E2PA 4GWGA 2O06A 2WOJA 3DZBA 1Y8AA 2DE0X 2WW8A 2RMKA 3PYMA 1LRHA 3OMXA 5CDFA 2PAFA 3KVYA 1XPJA 5JYDA 1X9TA 1OX5A 3WLIA 1GTL1 3MIEA 3H1BA 4ZI5A 2N47A 4MICA 1UMCB 4X6RB 2UZ4A 1OH4A 2IF0A 2WJSA 1CUDA 5BSTA 4HYYA 4R83A 2PUEA 4HAIA 1IBLB 5TJ9A 1GWLA 5DHSA 1YVPA 1W19A 3K51A 3VX4A 4MRMB 3VBOC 5BUSA 5CB4A 3TQRA 1FCJA 3ZGZA 5KEIA 3E7XA 2YN2A 3LPLA 3PFBA 1E0JA 5AVPA 3T0IA 3U3XA 2ADEA 1ANKA 4XDZA 4TV8F 1PWXA 5ESDA 5KYKA 5JNWA 4YM0A 1MOSA 4B8EA 4JT4A 1XDBA 3S2GA 4WW0A 4DQLA 1HTWA 3LF2A 2YOHA 4KXQA 1KZ7B 2INGX 3NVKI 5BV8A 2Z2YA 1NI5A 1U5ZA 3V7UA 2QJWA 3KLOA 2UZIR 4AROA 5DPMA 4GMP3 2O23A 4K2HA 5TT0A 5T67A 3PL1A 4GE3A 3BIOA 4UDOA 2B1JA 2GUGA 2O1SA 4O9EA 4O65A 2AF3C 4F6RA 1MJGA 2FNAA 3T3GA 2W87A 5JVVA 4FT4A 2YDYA 3E9DA 4WL0A 1HQYE 2QX7A 4BNVA 3GRAA 3D0KA 1R8SA 4LDAA 1N3LA 3D81A 4JYMA 5KTTA 1G9AA 1KFBB 1G7RA 1FMD2 1RYBA 1ZMTA 2J1TA 3ZMNA 1EAH1 2C4TA 1QRDA 2F4VB 1DRJA 3USCS 1SOUA 3EHEA 4RQPC 5IHXA 3VHPA 4PGFA 5SZIA 1SUSA 1B8PA 3ZBUA 3PX7A 3I92A 2FB9A 1LHVA 2I9PA 5FPUA 4QD2A 2BF4A 4QUBA 2Y0PA 1GR0A 2C83A 2OFWA 4TTJA 1RQXA 3DCIA 5DVZA 3ETGA 4RZ3A 2ACEA 1K92A 4LOIA 2ZGNA 1RZRD 4IDEA 1VL6A 1AB6A 1QFMA 3HTXA 1C7ZA 2LIVA 2JJ6A 3AKDA 5HVNA 3DKWA 3D8CA 4BNMA 2D1RA 4C7OB 1AVBA 2QLBA 1AXRA 3DTVA 3QV2A 1Q8SA 1KK3A 2YBSA 4LCEA 1XRUA 3BL6A 4TV9A 5F3RA 3A9VA 3HBZA 1JHRA 4RK5A 1U7HA 1E4VA 4Z0HO 2XQKA 1TGYA 4AY4A 4CTOA 4YT4A 1NLRA 2DHDA 1I2CA 4QAWA 2WM2A 1HZJA 4XMIA 5K0LA 5C32A 2DVAA 2GFIA 3LUPA 4UBHA 3AINA 2BBSA 2K2WA 3BFVA 2AC4A 2HDNB 5HXAA 4YIHA 3CRNA 3H2KA 4YMTA 2BFNA 1CQXA 5AM0A 3OA0A 3IUNA 2NX2A 1U8YA 2IYQA 1XNCA 1JDVA 1EK2A 4EY8A 3QZUA 3OEBA 5CFDC 3O1PA 4URYR 4EG5A 2HLDD 2W4MA 3DT8A 1SQFA 2FMFA 3MBKA 2H4ZA 4MRMA 3J81k 3C45A 3ENNA 1REQB 3H05A 3WTBA 1ESCA 3U4CA 3MS2A 3GJXC 3T5TA 5A3PA 2ODNA 2PQSA 3N5CA 1U31A 3WDLA 3L8GA 1XKXA 4Q93A 1BMTA 3OUZA 3KQWA 2GSWA 2NTNA 2JIPA 3KS9A 5IRCD 2UYOA 2BTEA 4BKMA 4GPZA 2OLEA 1LFAA 1XZAA 3HN7A 2PHZA 3CF2A 1OJ7A 1WW2A 5LQDA 2E7ZA 1VRCA 3T9AA 1H6BA 4K1YA 4RMHA 4KE7A 1AOXA 1GSOA 3OIDA 4G2NA 1NNLA 4QPDA 4EN9B 3JVUA 1LRLA 3UJ8A 3VR6H 1AQYA 2HWYA 3BU0A 4JKMA 5EXOA 2VBPA 5A3OA 4F3NA 4RZUA 4JV5B 3MXTA 1Q8OA 4IS2A 3ZWKA 3ZCQA 3K70D 4NJMB 2IEDA 2O48X 5M5BA 3N7TA 4QOHA 5ILGA 4RHV1 2QQWA 2ZPAA 3KIPA 2A3YA 1ZRRA 1N92A 3I7DA 1WCSA 4XYBA 1DEHA 4CP9B 3ZXLA 3E97A 1YBMA 3AHCA 4GOOD 1AX9A 4KRGA 4IX9A 2JGEA 3JB8A 2P0AA 2LW8A 4LO4B 1MGPA 2G77B 3KQRA 3LLMA 4ZQCB 1RAAA 3JVVA 1KFCB 3GJ6A 2V7GA 4Z4GA 4KU7A 3UWMA 2NAFA 2KPOA 2ORIA 2WYFA 2WVHA 4OK5A 4E2ZA 4YQEA 4HD8A 3UBTA 5AWFC 2XJ9A 2VBFA 1UYPA 3IAPA 3POEA 5HILA 4EI9A 4NCBA 3WXPA 1JDBC 3STTA 4HAZA 4QGNA 4ZS2A 2CLFB 2PMEA 2OW4A 5DN6D 3U4QB 2PRIA 4BMXA 5BQPA 2J3JA 3K3NA 1OTYA 2O9JA 1O5LA 1S4CA 2V96A 4YAFA 5BSRA 1G5QA 2V09A 4A6EA 1A7KA 4R9VA 3HWWA 3OLCX 5SY4A 3HKDA 4ZWNA 3C8ZA 4PG7A 4BVFA 4C7OA 1D2MA 4QLOA 5DLDA 4BUCA 5BWBA 2NQYA 4GLFA 1WUHS 3CGGA 2OV2A 2F1JA 1KWKA 1YV9A 4OI0A 1JYEA 2IIPA 4NBSA 3BK2A 3U09A 5CCXA 1OGJA 3JQ7B 1DHRA 2VSYA 5HCBA 1V1RA 2VXOA 4FWIB 1G66A 3GHMA 3D6AA 4O4JF 1J3QA 1R0RE 1FI2A 5FYBA 3NAPC 3RS6A 1NHWA 4GPD1 3UJDA 2DWCA 3FPHA 5EPEA 4PLPA 4M0FA 1JHDA 2DGDA 1V3VA 2QGNA 3E4CA 3R77A 2Z4SA 4MRVA 3IUYA 5E4YA 4CI9A 5FV4A 2ACKA 3EVEA 3GPIA 4D9KA 2G9QA 1ZGZA 1T6YA 3E8XA 4IICA 1EWKA 1AKWA 4E4RA 2ZJFA 3II6X 5JZGB 3FB1A 3CNBA 4LMAA 1CSEE 1N2HA 1WXFA 4H3SA 3LFHA 1QOSA 4OQFA 5L51A 2QPTA 2GZHA 3OKCA 3OWHA 4XPIA 3WAGA 4DCTA 2P79A 3MUNA 3NBXX 1EZZA 1FPN1 3KZNA 1MHTA 3B9QA 1L7XA 5I9MA 1DT3A 4HXYA 3F7TA 2X2PA 4DA0A 1NCQC 1U3TA 2WG2A 4MV4A 4OXIA 1RVF3 3CX4A 2R87A 3Q3CA 3IT8A 1OAOC 1MABB 1BVP1 5GADl 3QH6A 2QVCA 1WLDA 2VNVA 4B4WA 2XWJI 4HRYA 4R2LA 3TJZA 1DI0A 3GVCA 1NQUA 3BGOS 3B7PA 4OJTA 4QFDA 1CKEA 3NBZC 2A0WA 5M04A 2RHDA 4KYVA 4EFDA 3RGBA 3U39A 3NM6B 4BRUA 4TOIA 4EK9A 2XDVA 1YE3A 5JH7B 2Z3ZA 3OFNA 1FU8A 4Y2UA 4Y5TA 3DR3A 4XH9B 1EM8B 3OOXA 3FHTA 4JU8A 4POAA 4UM9B 2ZIVB 3OCJA 2J5QA 2RHCA 4HWKA 3FTQA 2EBWA 5IF3A 1AGNA 5LD2C 1XB2A 1W8WA 4PLCA 2GH1A 2UVPB 3RNLA 2ZP1A 4BKOA 1Q16A 3NAZA 2ODTX 5BNPC 3UK9A 1Z5UA 3OFVA 4V0NA 1U9ZA 3RSJA 1D0VA 3RYCB 5MN6A 4KIGA 3VNBA 4DUXA 5FP3A 3W6OA 3VKWA 3I54A 4XYXA 1JLMA 2H1HA 1JQKA 2XYPA 3ZDRA 1FOD3 4EY5A 1WW4A 1QTNA 4RA0A 4XLTA 1UKAA 2QMEA 3ZBPA 4L0PA 1Z22A 3KPUA 5JECA 1SJ9A 3U4QA 1Z12A 2XNKA 3SXPA 3KXKA 4N7IA 4I2VA 5L3SA 3O2QB 3T34A 5AKXA 3OJLA 3PCRB 2N3ZA 4G4SP 1DYPA 1DKQA 4GP9A 2OIIA 2Q8NA 3TIGA 1PHPA 3FFZA 2Y26A 2OK8A 4I9FA 3JD4A 4TXNA 1T2EA 1JI3A 4XQDA 3FUTA 1W39A 3B2EA 3FZQA 2YFZA 1UXOA 3JQ7A 1IOVA 4MUXA 2WQ6A 1BU8A 5T5PA 4D41A 4BMVA 1TXGA 5IP5A 4KPFC 3R74A 2FDGA 3GHNA 3SEFA 2RDQA 5T8KC 2OD7A 2Z6VA 3EVZA 3AZVA 1IWBB 1TLTA 3FFWA 2JH8A 1KZYC 5FZBA 2P7HA 5F9HA 1BYIA 3EEYA 5E3JA 3LIHA 4B9AA 2W3JA 4PRLA 4Y1FA 5IFKA 4X8MA 3WB1A 4UCQA 5BUZA 2HXSA 2R072 3V8PA 3H9AA 3P52A 2Z4FA 3FCYA 5JZGA 4QHBA 3ZE7A 2PX5A 2P6RA 1QRRA 5KNBH 1PVDA 5JAMA 3DA8A 1W36B 2C31A 1TM2A 1XNKA 1EDZA 3I30X 1GTMA 2QZ9A 1PIV3 4FYHA 5BRAA 4KTVE 2E55A 4FOVA 1O5IA 3VV1A 4FJ0A 4XA8A 1T4MA 1NA1C 3NNSA 1S0JA 1VKOA 3NUZA 1W9YA 2RHWA 3TLZA 2AB0A 4IDPA 3OCXA 5JDIA 1H2EA 4HNQA 2IU6A 1P75A 1QHYA 5EQTA 3KQPA 4HSGA 1SY7A 1N2XA 2H0QA 4Y8VA 3ILHA 1MABA 3COWA 4XPVA 2BP7B 3OQVA 1BWRA 2DFBA 2I34A 4QIHA 1ESMA 2EERA 4QDJA 1FXZA 3H5OA 3CJTA 3RH0A 3QNMA 1R15A 3U3DA 3KV3O 4IBOA 3ZD8A 1P4AA 5ICEA 4RJIA 4IEIA 1AL23 5CIWA 3U4HA 3SOPA 3WGOA 1XXHB 3I5AA 3GYDA 4WI1A 1X1RA 1BQPA 1ONBA 2XUZA 1ZSVA 4NPHA 3NX4A 3SDBA 2BI7A 1B8UA 4P9XA 1E6CA 1N0WA 4HS4A 3QENA 1ZIYA 1GKUB 2EIDA 2ZXFA 2ZEWA 3OGVA 1BGVA 5HKLA 4JTNA 4MI1A 2P69A 3LO8A 3UMBA 3VJRA 2QU7A 1DTWB 5CB4F 2TBVA 4QQ8A 3WC4A 1DFGA 4QDTA 5BPHA 2VCMA 4AVVA 1ZGHA 4YLYA 3GLFB 2UVPA 3ELBA 4PZPA 4X91A 1JR2A 5DUUA 1FYDA 3ZE6A 3LYAA 4AKHA 4CL2A 3RYCA 4IE5A 3AJAA 1QCZA 3IEUA 3H7IA 4HL6A 3GCZA 2VH9A 1TM3E 3IAQA 5FIXA 3BA6A 1JNYA 1RUG2 1LSUA 4RWEA 4PM4A 5HFAA 4BNDA 4E2XA 3FROA 1ZBQA 3H5TA 1O6CA 4KGVA 1W2WB 1LTQA 5JW6A 1SCJA 1AQJA 3A1EA 4D9HA 1UAAA 4JB0A 4NI5A 1O91A 3A0NA 3AILA 1SIUA 2R8OA 3TTTA 4KH1A 3SCGA 1UBMS 4C7KA 2WEKA 2G6TA 5B1IA 5KYYA 1ZG3A 4CM7A 1QO0D 5JQWA 2QAIA 4L50A 2GXQA 4YR7A 4AJOA 1ZK3A 2PGXA 4JSRA 4QYIA 2ZYDA 3ICCA 4FPEA 4PLFA 1VFPA 1LDNA 1MAHA 2II6A 4O3MA 4DZZA 5F73A 2WAMA 3KD3A 4DR3B 3DYBA 4D8YA 4CEIB 2GC3A 2AUNA 4DLVA 2OENG 4Z54A 5AUNB 1G19A 1Y37A 5HKKA 4RGYA 1P0IA 1W8IA 3AEXA 3FPFA 2AUYA 4Q02A 1CJMA 2NZYA 2Y6JA 4H3HB 1XPUA 5EFOA 5JD4A 2AN9A 1C9JA 3GQBB 3CRW1 3F9IA 4FTEA 3FYHA 2GMMA 3C3PA 5I93A 1RWOA 4KVAA 3AF2A 3WNOA 4J0IA 2QRGA 1TZJA 3IT2A 3WQSB 5U1PA 3GX1A 2QCSB 1WDTA 4MAAA 1XDWA 4PIYA 3G0GA 1AH2A 4FKMA 4HEQA 4EL0A 4YP0A 5JWHA 3ZIXA 4YFZA 3E53A 3TGPA 1A8PA 1F7UA 4BFVA 5C1OA 1NP3A 4A92A 3M6IA 4H1WA 1RI3A 1FP6A 4ZCQA 3C5WP 4EEXA 1JUHA 3RWOA 1CJUC 4FW9A 1XJCA 3TXAA 1P2UA 1C7JA 1NVMB 1ZK0A 2AQIA 2ZRPA 3S8YA 4HQNA 5DB4A 4AQSA 5ICMA 3ER9A 5JCTA 2H1LA 4N43A 4MQ5A 4JYPA 4M9ZA 4N41A 3QPUA 5GVRA 3UJOA 3ZYJB 2D6MA 3V1YA 3H8XA 1PU2A 1VBE1 2BP7A 4E5VA 2P1RA 3TRHA 2JI6A 4JI5B 3T1MA 3VC2A 5ACA2 1GPLA 3REQA 1TMF3 2QV7A 3JYPA 4GB33 2ZMKA 3AP7A 4KC0A 2HLHA 5KYXB 1JPNA 3AIIA 1QZ3A 1XXHA 2ZG6A 4TWRA 1XTQA 2VNHA 5KC8A 1HX6A 4ND8B 3WK4A 4EKYA 3K5WA 4X6UA 3LT5A 3UWSA 1WU7A 1WF6A 1U65A 1LBHA 5KIAA 1QIJA 2EF1A 5F5XA 1RQ2A 3WY9A 1H2AS 1T8UA 2ZT7A 1QF7A 4MGHA 2C4VA 1EX1A 3TNJA 2ZANA 4XAQA 4CSWA 4KBZA 4TYQA 1GNRA 2IKQA 5TB5A 1KBOA 3WYGA 3ADCA 5C7YA 5JMCA 1I6KA 4IKPA 4EN7B 3TR0A 3L7DA 3V8RA 1O5UA 2QJOA 2GJ8A 4R68A 4PRZA 3LKDA 3QVMA 4G8BA 1A2BA 4XX0A 4AL9A 1HLPA 3DP9A 1JZ5A 3V65A 2Q4RA 2M32A 1MORA 2ZSHA 5GZGA 1NLMA 2D06A 4AF6A 2QQVA 4AMVA 1KMCA 4L8GA 3MJEA 3OCPA 1Q22A 3C1AA 1BDHA 4NPMA 1M7HA 1YS6A 1NMQA 4NH4A 3WBJA 1EM6A 4WLNA 4Z49A 4CV3A 3JRWA 3DPRB 2GN9A 4MW0A 1N75A 4DQAA 1PG5A 4MVXA 5BPXA 3BRWA 1VBA2 3JPYA 3AEUA 2WP0A 4JKYA 5L3QB 4UCXA 2XZDA 4P1ZA 4ZYZA 3QFTA 3A1VA 5CPBA 3QLQA 1MC8A 5EUMA 1LLCA 1Q57A 4KWKA 5CXQA 5GJCA 4BN4A 1NX9A 3K71B 1H94A 4G3YC 3GEDA 3N86A 4RMGA 1V5WA 1JR4A 5FL7A 3OZTA 1XDDA 4QPGB 3GRFA 1WD4A 3H8WA 1O8PA 3V6LA 5P21A 2IK8A 4CMEC 4DYVA 5LWHA 3U1BA 4N47A 3K77A 4RU1A 3GQBA 1J90A 4N65A 4WEQA 1W0JA 2RDRA 4CP2A 4IJWA 5BN1A 5JLJA 3WNVA 1E2FA 2ZJYA 3QVTA 1EPWA 2A75A 4GS5A 4KWJA 4QPIC 4AI9A 1W35A 4Y0VA 2BFCA 4I6GA 2G9GA 5AH0A 4IJUA 1WLYA 2Q5EA 4XZ3A 3DV9A 4YW3A 3C7GA 4CKYA 2GHTA 2I6TA 4LBQB 1CUCA 1OXMA 1M34E 3PHLA 1WOMA 2XBUA 2FP3A 1J4AA 1QOZA 3OX1A 5TPZD 3ESYA 4N5NA 3U7JA 2GBLC 1U81A 2ZRQA 2DBIA 2CDPA 3EMRA 1SXHA 3LW8A 1NR7A 3VR4H 2EZUA 1TUIA 5ALNA 1FFGA 4Q3KA 1V6JA 5BNZA 1E9DA 4LOSA 2C5HA 3ZOIA 2OL4A 3SICE 5FOTA 2YQ5A 5EKDA 4S0XA 1YKGA 4C5AA 2JH3A 3W7VA 4G01B 3UL2A 4QXRA 1VCMA 2E2WA 3USES 1UX7A 3CF4G 4ND8A 1R0BA 2G7ZA 2JLYA 2RH9B 1XL1A 4IEPA 2I3AA 3OE5A 3VR1A 4QBKA 1CV2A 1ZJZA 1WM1A 5DUWA 5KJ6A 1O4ZA 3E5XA 3LYHA 2G9RA 3ACHA 4KIWA 1JSZA 1UMIA 2A6YA 1YS9A 3VUFA 2J4CA 4DCNA 3TFQA 2VPZA 1U7PA 2ANCA 2VLBA 4QSHA 1DQYA 1AN9A 1WCUA 3FTCA 4GAEA 5FP7A 4Q4Y2 3TL6A 2ZVDA 3NC4A 4NK5A 1D2CA 4TLGA 1MMFB 2FE1A 4CU7A 5CFZA 1V5IA 4AKTA 3O0WA 1STOA 5C3RA 421PA 1NQDA 4EWEA 2YIVX 3VNSA 5HKBA 1Y3CE 1X13A 4O1HA 3LX5A 3BFPA 2GPJA 3V1UA 2AG0A 1DAPA 3O83A 1V35A 2D1QA 3K35A 3C3VA 4FXGB 4RD3A 2M9MA 1XYVA 3MQ4A 4QVKA 5T55A 3HDGA 4G5XA 1Z13A 2VWHA 3PJRA 2OCXA 3I01M 2GO1A 3R0VA 1TVKB 1QF3A 2XUIA 4JBHA 3B1WA 3FCCA 5AI0A 3TOSA 1UOFA 2OKGA 3DPRA 5C5UA 1RAFA 4DDKA 2A9VA 3A14A 2GAUA 2ZTHA 2DHQA 3RJ9A 3SIXA 1E3DA 2BFAA 5L3QA 3C7OA 4Q7EA 4ARXA 4G56A 3P45A 3IHWA 5I0TA 4QOSA 2CGOA 3KKMA 1RPTA 4MVWA 2ZB2A 2QVXX 4BO2A 1UDAA 4UREA 5EYXA 3ZWYA 3OIVA 5TF0A 3UH0A 1DC5A 4F72A 2G9UA 3WHTA 1F06A 5F51A 5IKPA 4AQTA 3OTHA 5F4BA 3LUHA 4RV9A 3SZLA 2IEZA 3NO4A 1Z2AA 5IXSA 1TIPA 2ZGRA 6ABPA 1E6MA 3ZJVA 2F9FA 3PNAA 2WUWE 4B40A 1KIAA 3YASA 3DM5A 4CU2A 1PMJX 1A8SA 3CLRD 1Y1QA 3RIMA 1WUYA 3DEKA 1N57A 5AJTA 1Y3BE 1EWVA 1FDVA 4HGRA 4CKCA 4D46A 1S9HA 1PYGA 1N6HA 5EEGA 4GLBA 2GFHA 5CYGA 1EG7A 4KCGA 5HKOA 1RC8A 1W0PA 2B61A 2Y6VA 4Q0QA 1GPDG 1MT0A 2XMRA 5F2OA 1KDKA 1T9BA 2PFWA 2Q7OE 1G8AA 3C1TA 2VJKA 5ITZA 2DFTA 5JYEA 4PWYA 2O7QA 1YACA 2CK3A 1ODLA 4E5DA 4F0JA 2ZU0C 5K8JB 4HX9A 4GWJA 3UKTA 2CHFA 1DIWA 1R3DA 2XMQA 3O91A 2WRZA 1SZPA 1ST3A 5BNWA 4EQ6B 2R073 4CCYB 2PD6A 3SEZA 4LUCA 1TJ5A 2AEMA 3JASB 1IWPB 1V41E 3RTGA 3RAGA 3V48A 2EKQA 1DNPA 3G7DA 1HQNA 2WHXA 4TMYA 4N6OA 4G25A 1YASA 2NU9B 1LTHR 1QS0B 2W6JA 2NM0A 3INTA 1JEOA 4Q1FA 3REFA 4A2QA 4OLJA 2X9LA 5T52A 5A7WB 4KPGA 1G21B 4EG6A 3PBKA 4PX9A 2A0YA 1BMFA 2B2NA 1G42A 3UIEA 4BE4A 3R4DB 5FBLB 2ZGUA 5JAXA 2AN3A 4DLZA 2FRDA 1J2TA 2FOLA 2YRWA 2QE6A 3OTFA 2J5BA 3JQAB 5AD1A 3OGGA 1QH9A 3Q9SA 3G0HA 1TVKA 2NG1A 1NPDA 4GPBA 3VPGA 5TQ0B 3EFHA 1JAHA 2I4OA 2AYZA 3TSAA 1NLYA 4WOJA 4FB4A 2BI8A 4RZSA 2JL1A 5DBEX 2W6ID 3E0QA 3C2UA 4TLAA 2P17A 4DPNA 4B09A 4B6QA 2I1LA 2VJDA 4J3NA 1FUUA 3PWTA 3GR6A 3P27A 5T57A 4X6QB 3TRIA 1KR2A 4QOFA 2IU4A 4GIQA 3L0YA 1OAOA 2CWMA 3RPEA 3VH1A 3QBEA 2VCCA 5AOAA 4PV7A 4IJ6A 2A73B 5KHAA 3WG9A 4NVRA 5T41A 2RIRA 4CCLA 1SEPA 3ZHBA 2XQJA 3IQHX 2R2AA 3PRKE 1FTQA 3R9IA 3PDIA 5J59A 2JJ1D 5BNQA 3JD71 1E7WA 3QVGB 2AMJA 3N9IA 1O8BA 5A06A 1PJZA 5FOJB 3HDHA 1FMFA 5D3QA 3HGQA 4LWOA 2WD8A 1HQCA 1BW9B 1PJ3A 2NO1A 3OC0A 5FBHA 5LJLA 2XJSA 2AF4C 5HQ3B 4JX8A 1D1QA 3VXKA 3I42A 2HMTA 4NKRA 3L41A 5LY1A 5BNPA 4HZGA 3G2OA 3E22A 1R6BX 5LDHA 5EE0A 2AENA 4MZUA 4RL7A 2A0FA 1O95A 3WYDA 4ZT7A 4UOEA 3D0QA 1Y9QA 2ICAA 3OGJA 1EXWA 4MUEA 4WVWA 1V4VA 1GILA 1GZWB 1PVOA 3KCNA 1YUDA 4G67A 3T3PB 2H63A 3TNQA 3A04A 1DKLA 3C3MA 3VKOA 3Q9OA 4B7ZA 1R16A 3HCDA 1BH6A 2J0UB 4Q7KA 3WHKA 4JUBA 5IEJA 1HX7A 1S89A 4KFUA 1QZXA 3EAGA 1Z56C 1TC2A 1T5BA 2NQ8A 4MVJM 4QU9A 1YB1A 1SC6A 1A5AB 1YL7A 2HK9A 3FNRA 4EO7A 1P33A 3D7KA 3ZIAA 4EQ6A 1FB5A 4CCYA 1X7DA 1CUEA 2EAUA 2R1ZA 1YA4A 1Q6YA 3EF0A 3JASA 3N36A 1O2DA 4LDJA 4FFNA 1OFGA 1R4MB 3A3YA 4XZUG 3WLKX 2JGMA 1RMYA 4PANA 2ZJ2A 1QOTA 1PV1A 1FFEA 3LWCA 2GK3A 1TK9A 4WERA 4QVIA 1QS0A 3B94A 5TXGA 3U4DA 5BV0A 4EFNA 4E1BA 1OPOA 1MAAA 2ISCA 3KHKA 3SITA 3E3MA 4TTQA 2WNUB 3NHUA 1Y4UA 2WT0A 2ARKA 1W1WA 1TW3A 4B7UA 1XZMA 1NXTA 2AFVA 4HB0A 4J76A 2EX0A 3WZMA 3QMWA 3G13A 1GTVA 4FXPA 4FWTA 1ZH6A 3I3MA 5BSEA 3Q9LA 4IHQA 4O2LA 4E9KA 5L3RA 4CDWB 1AZLA 4P4SB 1X1AA 5BOSA 2C5FA 5E6UB 4BEWA 4V38A 1JQEA 4MXWA 4P38A 4MLOA 4MUNA 4V3BA 2A1TS 3ZJYA 4DXZA 2CXOA 3EVTA 4C7BA 3D2CA 2PD4A 3L0ZA 5G1NA 3LQKA 3WDWA 1ZHFA 5KKAA 1Z83A 3HN3A 3IVRA 2VPXA 5CNAA 2K5UA 1QGAA 3PKJA 1Y43B 2B4TO 3N2LA 4LMPA 1TK3A 2HDOA 4D3SA 4FIZA 1II9A 1RRPA 4OHRA 3U7EB 1C9KA 4IE7A 3Q8LA 1SCQA 2JGDB 4PFSA 4BFYA 1PR4A 5KS2A 4TT3A 1V3UA 2OXBA 3OUTA 1SDDB 2GN0A 5H9SA 2R6GA 4MV5A 3QVGA 4PC6A 3WGZA 3U1TA 1KIMA 1N0VC 3ZCXA 4A44A 3PQCA 1FX0A 1EUYA 3JD0A 4L5BA 5LP6B 4RH1A 3POIA 4CLRA 4C6RA 4YQYA 2X7XA 3CLKA 2V6BA 3TLBA 2VRBA 5DYIA 5HQ3A 1C4KA 3L8DA 4XCAA 5DHUA 5KTNA 2H9IA 4V1CA 2KI5A 3M3OA 1LHUA 1F4LA 4EYKA 2X40A 1AUPA 3LPAA 5E1BA 4XJAA 821PA 1D4M3 1WCV1 4N53B 4UBMA 1SVMA 3B9CA 3VBRB 1WHTB 5TVGA 4KAJA 2HN9A 2JBHA 3OGSA 3WISA 4CGZA 4J7UA 2QM3A 2H2FA 3D6JA 1JECA 5DE3A 2CLDX 3RQIA 2R8RA 3CNHA 1VJ0A 2ZBUA 1NIPA 1YJCA 1KAQA 1Q1EA 4R2JA 1EBFA 5GJBA 1DSSG 5A62A 4J9UE 1DAIA 2R2GA 3C97A 3PPYA 3HXMA 2P4SA 4RHUA 5JZGC 3O03A 2DWUA 2UAGA 2FKNA 2AJDA 3LJKA 3TKAA 1UPFA 2PYZA 4WUTA 5KSPA 1FJ2A 4GOKA 3W5SA 1XRQA 2DFVA 1Q1QA 5DM70 3DE7X 1KEEA 1M8KA 1HA3A 1L5ZA 4YUXA 4A5OA 1CIWA 2XCUA 1L1EA 1ENXA 2KHZA 3FHJA 4KU8A 5A5GA 5JDIC 1AK9A 3LK6A 2X9GA 3D59A 1MD9A 3MOGA 4COOA 4DANA 2OHXA 4PSCA 1WKYA 2V7TA 2D1FA 3VISA 2YN0A 2CXSA 5K0ZA 1FDWA 2VL4A 5CFPA 2I4TA 1PK7A 4RHTA 3MYRA 2WTUA 2WNUA 3TEYA 4D8VA 1GG9A 1Z5OA 2KBFA 1OVGA 1OVSA 3SD7A 2C4MA 2PJRA 1DJNA 1NUAA 1IQPA 4IDQA 3RPQA 1NBME 2B94A 1XVLA 2BGMA 2R751 5FZMA 2OFFA 1GWKA 1THGA 1TZOA 3NV3A 3DBVO 3KJXA 2FMXA 1KJQA 1OAKA 2PUBA 4CDWA 1VHQA 3MSXA 1YQXA 2FGJA 1UM8A 1Y3AA 5TLSA 4Z92B 4ZEOA 1RVF2 1QPGA 3JQBA 3OSUA 3UAOA 3ZD9A 1SVNA 1OOPA 4BQ1A 2QNKA 5GJWC 1PTKA 2C03A 2M6RA 5K6RA 4JYBA 4D0NA 3BICA 3IBYA 1I2MA 1UBUS 2GVZC 4QICA 1OA2A 2OCYC 2QRZA 1NW3A 3V8QA 4PS1A 4DJDC 1FMJA 3AKZA 2BTOA 3VD9A 4Q7LA 3CIOA 5JCJA 4FI3F 3SKXA 2YWHA 2JGDA 1GZHB 3RF7A 3WQ7A 3CNQS 1LK0A 2J1VA 1NV9A 4ZDJA 4ACBA 3TR6A 1N2JA 1ZW6A 4KG8A 4E09A 1TQ8A 5FKJA 1YI1A 5K9ZA 2C29D 3DYPA 1M75A 4WLUA 4RFRB 5KTMA 3MF4A 4UNPA 2ZAIA 3B6EA 1C7QA 1JTFA 2IXLA 1ZD3A 3ZD7A 3SAJA 4OHUA 5FBWB 2RJLA 3THSA 2D97A 1JW6A 1RM5A 3EHKA 4FK8A 4KR7A 3IPXA 3RVHA 1WS6A 2JANA 3ZFEB 3QHQA 4B4VA 1O5OA 5FTWA 1E5QA 4CM9D 3UANA 3WLRA 1FOD2 2N75A 3ZD6A 3RT1A 3DPIA 3MF6A 1WHTA 1OFUX 4GU5A 2AWNA 2CMDA 4IUBS 3S2EA 5C6CA 4UU7A 4HCJA 2ZUTA 4QWNA 2ZJ4A 5DULA 3ONNA 4XGNA 1P7VA 3P2YA 4B3IA 3I62A 3IAEA 4HVTA 3MIHA 1ABBA 1W8ZA 4Y1UA 4IW3A 3G5AA 3OKPA 4ZYLA 1WDKA 2LTNA 3PHBE 5EWMB 2XUGA 3FLBA 1WL8A 3KBBA 2J1EA 3R0IA 3L6CA 1XA3A 3FC0A 3PUVA 1WXHA 4H3WA 3HBAA 2CF6A 1IHPA 5K3DA 2OR3A 1O96B 2ZI6A 1P5ZB 5DXDA 3DOEA 5DX8A 3AR7A 1RHUA 4B29A 4R8LA 4RM2A 4AHXA 3RLFA 4U6NA 2JFGA 4WZAE 5EJFA 4JVNA 4C0HA 4WJZA 2XCLA 4HI0E 5DBGA 3JATB 5CCDA 4AJEA 3A6HA 2DFCA 5BR7A 3AESB 3N75A 3T0AA 1RHRA 4O61A 4MV9A 3DMPA 2CXRA 3CPSA 1GGNA 4QMAA 3N2KB 5H59A 3LEKA 2G07A 5T4HA 2REXB 1ECGA 3HHEA 2UV8A 5IK4A 3CZ5A 3IVCA 2FFHA 2DQYA 3L6RA 1KC1A 1ESDA 3O6VA 4WY8A 5KKCA 4BMDA 2CXTA 3JZDA 4YJFA 1PIV2 2P2LA 1OZHA 4A91A 4RHCA 5ALXA 3ZOKA 2Y1WA 4DV3B 3RI9A 3I39X 2IDKA 5DAVA 1J23A 3AR2A 5DYWA 1YIFA 1AM4D 1BDMA 4YT2A 1UDXA 2GBLA 3W5VA 2QXTA 3ACBA 4K6BA 4Z5XA 5DI9A 4JI4B 4HQLA 3LA8A 3ECAA 1SLTA 3FPCA 2PZJA 1EFPB 2JDZA 3OIGA 5FYYA 3M49A 5E9QA 4DLWA 2GKOA 5DGHA 4XCXA 3SQDA 1MXFA 1AL22 2J9ZB 4Q3LA 5K09A 4QYSA 5AM1A 1NQAO 1HJGA 3DEMA 4G24A 4OFGA 5HCNA 4DEVA 2VTXJ 4OHFA 1VLQA 3VUEA 5FDFA 2FMHA 3V97A 2IIQA 3NB0A 2CKDA 2WLPA 3ODGA 1XEAA 5IAAA 3HNOA 2ZAGA 2ZJ5A 4IS3A 1OSGA 3CZJA 1LAJA 3RU3A 3NBFA 5DXFA 2PKQP 4H7EA 4YI5A 4C08A 1YQCA 5GVSA 4MMXB 2GILA 4YM3A 3RIXA 1SXJD 4II7A 2F2TA 4ZU6X 3KL2A 5KC9A 1H0BA 4OQ9A 4B79A 2QN3A 3RFXA 1YA8A 1XA0A 4WPGA 3MMZA 5SV2A 2Z09A 1N3YA 4RD7A 1U4SA 3RAJA 2O8DB 2ZFUA 3VZRA 4A4AA 4OP1A 5C81A 2M6SA 1PR1A 2QF7A 1YRAA 4Y1RA 3VR6A 3TX6A 3KEMA 3AYEA 3GJRA 5ANNA 4CMIB 1ZOLA 4R84A 3SEEA 1CS4C 1ULDA 1A8HA 1Q8VA 4KN5A 1Y6RA 3T3HA 4AHWA 2FXIA 2CLEB 4DV7B 3GNSA 1J20A 1URPA 3VAAA 2Y6KA 5JS6A 1FTYA 3G9QA 1OYYA 2AZDA 4LXUA 3CSUA 4I5FA 1DBWA 1XMQB 2OCLA 2APJA 1YJ5A 4QGMA 1RJFA 4LIPD 3DSRA 4HEJA 1ZPDA 5GMOA 3L6BA 4MK4A 1FRZA 4NU0A 5EZQA 2WSUA 4QRDA 4FOOA 4Y1YA 2RVAA 4GZLA 2EGHA 3ET5A 1AKUA 3QXXA 1UDBA 2BERA 3GN2A 3NOOA 3CUTA 5FL3A 4I9NA 4LDQA 4I55B 1N77A 1A34A 4JELA 1M2VA 5IASA 5JI2E 4Z1MD 1BXHA 4FPCA 3HFGA 4XIJA 3KJHA 3ZYRA 4TKUB 2GMWA 4QOEA 1QWRA 1YL5A 3FG9A 2X8LA 3NIGB 3R41A 4CQJA 5HM8A 2PM8A 4IDZA 3WI7A 1E3WB 1E9FA 3MYXA 3WHPA 4ZVNA 4EI2A 1Q7GA 4ER7A 1TMOA 3RVBA 2COEA 2XL7A 4AVTA 5KQGA 3H97A 4JVLA 5AVTA 2X1MA 1Z82A 2EIHA 5JWRA 3N2KA 3E70C 1R4AA 1HN0A 2HK6A 3VR2A 3BWVA 2P9YA 5INTA 1AYN1 1G9FA 1GUZA 3FOWA 3EZ6A 4R1TA 4CMBA 3PD1A 1RHKA 4AQYB 4YPFA 4LBZA 4Z7OB 4DFDA 1LGCA 4UQLA 3UEOA 1RYDA 4Z4FA 4YB8A 4IGAA 1G9XA 3I4FA 4PINA 1Z7BA 4DY5A 4NV3A 4C1WA 2AOUB 3F7NA 4JDNA 2Z9BA 1M2FA 2ZT6A 4EW3A 2VAPA 1CVLA 5HV4A 1N3IA 2PUCA 1F12A 2QTMA 5BY5A 5K45A 3O8RA 5F2KA 2O7VA 1J7KA 3RYPA 5MFZA 5F1YA 2JKXA 3AVSA 4OUSA 3DH0A 4FI3C 1M33A 1ZXBA 3BDVA 5BN3B 2NXNA 2IYEA 2XGXA 2PYDA 1TMF2 1EFPA 1VKHA 3A2NA 3FBWA 4GB32 1ULOA 4EYUA 3ZVKA 1S8NA 3OAAD 2O8BB 5LFAA 2OV4A 4JQRA 1UMCA 1U8XX 5EJ5A 1WMSA 2IVIB 2B7BA 1UY0A 2G8NA 1J8FA 4JLJA 2FZVA 4RZHA 1QRUA 3F98A 1LRJA 4TWBA 4LGVA 1PL6A 4IRXA 3VNVA 3DUFB 3ILRA 3TYXA 4L57A 3ZXUB 3BM5A 2V7VA 3FSEA 4L0DA 4CMAA 3EDMA 3DPRC 3LGXA 3WMRA 2LTAA 1KQGA 1KTVA 3AY0A 3F1LA 3AG6A 4G84A 4OJNA 5K4GA 2QP9X 1T5TA 2WUDA 3H8JA 4AEKA 1IK4A 3CNEA 4KB5A 4RF3A 5KMGB 5E2AA 3MB8A 1IN5A 2WWJA 5KREA 5A4AA 4N9IA 1LU1A 2Q2OA 3MJFA 3WCRA 1Y6QA 1W6MB 4Z7QB 1NURA 1YS2X 2UZ1B 4BMNA 3WNBA 1DGRN 4TTRA 2HR1A 4JXJA 4OXRA 4RTKA 1Z5GA 3EC7A 4RKQA 3WP6A 3V4OA 3KDPA 5L95A 5JSQA 5FPVA 1V4NA 4TYSA 1K08A 2HRBA 3OFSA 5AOBA 2XNSA 1YR3A 3CPJB 4PU0A 4MR7B 4AX8A 4K88A 3U81A 4LMFA 2ZRKA 1OKKA 2XVAA 1ZISA 1EA5A 3DYVA 5DYGA 3OM9A 3P4UA 5JZ9A 4JNCA 3AZXA 1EVKA 1W05A 5EMKA 4UE3S 2P9EA 1T24A 4F4FA 3JW8A 3FI9A 3QLVA 4XYMA 1DBNA 5F7JA 2UYYA 5IANA 2MDTA 3QU4A 3RHTA 4I55A 5FV3A 3ACIA 2EXIA 2BELA 5E6HA 2QIOA 3HWRA 4CFZA 3OU6A 3QFCA 1U12A 5AK5A 1K68A 2PHTA 1Z68A 2X86A 5HFJA 2LUWA 1UP4A 2PKRA 5BOVA 1DQ4A 3C5EA 3ZLIA 1E3WA 3PF9A 1G18A 5A70A 2TS1A 1F14A 3TPZA 1C3OB 2PT5A 5SV8A 2W5UA 4EY3A 1GZTA 4JSTA 3VH3A 4P9IA 2PRJA 2XA2A 3UTDA 4JGYB 3TCXB 5JISA 3IDOA 1ZD2P 4FCVA 1C50A 5C1IA 1NZDA 1HEYA 2EJVA 3OYWB 4AUKA 2OBNA 3DMHA 3VTFA 2HBRA 4M46A 3W05A 2K9ZA 4HDRB 2WSYB 4P4GA 1ESNA 2I4LA 4KWCA 3CZUA 4YUWA 3K4QA 1P61B 5AJVB 1EH5A 1PM4A 4DLUA 5JDBA 1YMVA 3TEJA 5AJYA 2JJYA 5LA6B 2FHPA 3OBAA 5GAJA 1DLLA 3I3QA 4DMUB 1YRWA 1MS4A 2VJCA 5F5NA 1X82A 1N3PA 1P9NA 2P2CA 5BN3A 1EHIA 3PVOA 2VECA 2DJIA 4XWYA 4QX7A 3S44A 1AGXA 4NHYA 1Q83A 4PRYA 5BQFA 4EAQA 3RYFB 3P3PA 5LRRA 1QXPA 3H5VA 2O8BA 1Y8QB 2O2HA 2WTBA 5KNBA 5KI6A 1W9SA 4A6SA 3UMRA 2FRDC 2GDJA 4MARA 1NN0A 5DFAA 3SZUA 1YNAA 1YQQA 4J4BA 4EKIA 1D4VB 1JYFA 3DUFA 1GRRA 4NMHA 3SNMA 2DVFA 2C98A 1REQA 4NDAA 1XYNA 1T35A 4LO8A 3TL2A 1BTOA 3R20A 1Q44A 3Q8MA 4LI3X 1HFKA 3V7YA 4AMBA 4F84A 1C5KA 3G7NA 4UMVA 2P2ZA 1JOBA 4K81B 1SLLA 1OXKB 4Z3KA 4YRSA 5K3BA 5FZ8A 2BGJA 5FBVB 3LWNA 4L4RA 3L4SO 1LX6A 1GXSB 4YRLA 1W6MA 1Q2UA 1P2GA 2Y2VA 4BV9A 2VMHA 3DFIA 2ATVA 2RHTA 3MK31 1HG1A 2CZCA 4YGYA 4M37A 4R6WA 4MOWA 4P9JA 4NHXA 3DMDA 1GL6A 3GH1A 2MYPA 3TBHA 1DFQA 3G2KA 1DFIA 3M4NA 4L22A 1M2JA 2PPLA 1V1JA 4G8DA 5AHXA 4NYIQ 2YTZA 5D2CA 3HRIA 3O14A 2V4VA 4NJMA 3NKFA 3ZZ1A 4Q26A 4CCSA 1DB3A 2FR1A 2IS4A 5LMCA 5AVSA 2WR9A 3BJZA 4TLBA 4ITCA 3BG5A 3RUPA 3TUZC 4IJKA 4CP9A 4H1HA 2VVFA 5T64A 3A11A 5HQJA 3OUUA 5IVBA 1M06G 2ONZA 5DBIA 1GNYA 3N2IA 5EQDA 1JWBB 2UY8A 4RPGA 3EXFB 2JZOA 2PUJA 1AQ6A 3UMMA 1KEUA 1GA4A 1O95C 3CURA 3KQKA 4TMVA 4UMEA 4YW1A 3J7NA 2MSEB 5A7HA 5LEKA 4Q27A 2DUQA 4N9WA 5B36A 3IQIX 3LGAA 5CP8A 3LSDA 1NAHA 1WPXA 1CLEA 4IIVA 1PQUA 3FX2A 2VDWB 2QMUA 1KZ1A 4NIGA 4OCTA 1CR4A 1VP6A 3LX4A 5DGCA 5JQGB 1EE2A 4CGYA 1GDDA 3UFBA 1SBFA 2RK6A 1YWGO 1QJX1 3QG5A 1XE7A 3DXTA 3H0CA 5IFLA 1QQTA 2VXCA 1W34A 4BWGA 1OE0A 4BLOA 2ZITA 1UDRA 3L4EA 1KVSA 1JQ5A 2P2YA 3PL0A 4Q4AB 2Z6UA 1QG4A 5CB7A 1GCAA 3X29B 1V2HE 4MGEA 5FTJA 2O3QA 4HMZA 2NO5A 1KC3A 3KB8A 1SC1A 4DNFA 2Q41A 1W8NA 5LQNA 1YI9A 3HDTA 1CIYA 1ZM4A 2CBXA 3TVYA 2P9FA 4DLNA 2OXEA 3ZTWA 2VZ0A 5DDJ3 1ZM7A 1AXKA 4KIUA 2R6QA 5ULLA 3ZH2A 3RYFA 2WIIB 4MV2A 1PJ2A 1PO11 1NJ8A 1JQLB 5I3CA 2VKQA 5DX0A 4IINA 1E20A 4AQ6A 5FZOB 3MSCA 3ZIDA 1YT5A 3CUEF 2H1FA 3FFAA 1Z7GA 1FBTA 1Y5LA 3R5JA 3SQNA 4E5PA 9GPBA 2O3SA 3W9UA 2ZPXA 1KTIA 1FLDA 3BUCA 2W11A 3OZWA 4RLFA 1F6WA 4JLWA 3L2YA 4ITUA 1HB2A 2VZPA 3B8HA 1FJGB 4LVOA 2ZCJA 3GU3A 3WYFA 1ULTA 4PBSA 5JNVA 1BKDR 4RUKA 3G79A 1GFWA 4KX5A 3ES9A 4E94A 2Q49A 5U4XA 1AUOA 3E1F1 3F90A 1X36A 2H4HA 3QTLA 3WIEA 2C1XA 3ZPOA 1GXSA 2C2MA 3FHOA 3REGA 5DNVA 1DWOA 3RAPR 4DLYA 3FHLA 3DECA 3IUBA 3I6YA 4UFMA 1E5LA 1IS6A 3ETDA 4BP9A 1OKQA 5C4GB 1JXMA 4F5DA 1V6CA 4OQYA 4DV2B 3GPBA 1H66A 4X1KB 1VJTA 5JH7A 2RC5A 1U2RA 2WO7A 1YRHA 3ZDBA 5L9VA 4DMRA 1EM8A 3G02A 3BD7A 5LR6A 2W71A 1K4KA 2IPNA 1XNRB 2NZXA 2C3UA 5GQSA 4LDPA 3HXOA 2JXAA 3ENRA 4NS1A 4WXHA 1CDZA 3J8F3 2XKBA 3NUQA 4ZKEA 4IEFB 5ED0A 4TRNA 3L46A 3S2YA 5JYBA 1I1HA 4PBOA 2LKCA 4E15A 4KGGA 2XJRA 4LXYA 5AI6A 1CUAA 3DZGA 2X4LA 4D9CA 3M1AA 3WNMA 2E6KA 3R5SA 2GF9A 3AUKA 4RHXA 3K0CA 4C6TB 3R3VA 1PYDA 4D0LB 2EZ4A 3CRMA 1K5JA 1MX3A 2R25B 3HM2A 4CEWB 3IKMB 2VDWA 5FWXB 4F85A 4X97A 4CCDA 1GYKA 1D6MA 3T1LA 2ZUBA 1MA0A 1D1SA 3OT5A 3OZSA 5B4TA 4QQFA 4JP3A 3C16C 2R6AA 4XI9A 2LWIA 1NUQA 2FG7C 2V7EA 3H4VA 4B81A 3ZU6A 1IZZA 2ID9A 4HX5A 5FI3A 2BHSA 3D6VA 3RUHA 4Q4AA 4EMBA 5K0UB 4ENQA 2WHEA 2JD4A 5FOQA 3MRTA 1PGSA 2GKSA 3TQIA 1PZ9A 1HYEA 3HP4A 2VJMB 3PIJA 2O2IA 4TL8A 5K6TA 3PNYA 4O0LA 3PNVA 4JBLA 3GARA 5FT9A 1COWA 2X23A 1W6UA 3FWYA 5FXWA 2BGPA 2FHRA 3N8IA 2WNUC 4W7IA 2H51A 2AOWA 4CMCA 4HJRA 3MEPA 1OWNA 3M1IA 1G0OA 1W5EA 5JMWA 2VBIA 4B6RA 1VJCA 1SELA 5IMBA 1VXOA 2YS7A 4NCJA 4C05A 1KU6A 4CDQB 3DZFA 1U0RA 3BH7A 1Z39A 1JIIA 4B82A 4I5IA 2E33A 2W6ZA 3QQ5A 3ANMA 2CFIA 4CDWC 5AW5A 2XTAA 2HRDA 3C2QA 3L7KA 2YFKA 5DOVA 3VR4A 2LZ0A 2G1JA 4BO8A 2GM4A 4Z8BA 3HFJA 4PSVA 1LH0A 2VAMA 5CNJA 3JQBC 3THPA 5SV5A 1N0UA 3D02A 2XYQA 1OOPC 1D5CA 4HPXB 3C7CB 1MZFA 3SZGA 2FZGA 1UH5A 2QN8A 1BBT1 3PI6A 4J2OA 4DZGA 2JX9A 5F5QA 5BQ3A 2JDHA 2CLIB 5EZSA 4OLLA 1JZ3A 4P4LA 3WP4A 1CETA 5LMUB 1QPBA 1UFKA 2EU8A 5IWFA 1JHNA 3L2HA 1BDIA 5GINE 3ERCA 2F3QA 2VYVA 2ZOSA 4O08A 1RLOA 2RJKA 4EEKA 3EYAA 3P9PA 3PHMA 3OOJA 1IBKB 2ZA9A 3PLNA 2VPIA 4AJ4A 1CF9A 5BWMA 1K9VF 2OV3A 4X1KA 5EIBD 1B6RA 1O97C 1WD3A 1LBQA 2VO5A 4IJ5A 3K9LA 4IUDS 2X2FA 1BCSB 4G1FA 1GQRA 1YQWA 2IXJA 1W9HA 1A0OA 1DTWA 3I9MA 4R40A 4W6YA 2V6IA 3MUOA 1L4UA 1F8GA 1HIXA 4YRJA 2FDRA 5KQSA 4Y2XA 3GLFA 4IUGA 1VZ2A 4H31A 4NG4A 2F67A 1L7VC 4FLEA 3Q15C 2QP4A 2R00A 3ASZA 4C29A 1EK1A 1JHXA 4NCAA 4N53C 2HSJA 2P75A 3IJRA 4XBLA 1SAYA 3VBRC 3WV6A 4WXPA 4BO5A 1RLMA 1Y98A 4JC5A 1GDTA 1IULA 1CG6A 1E8NA 1EUCB 4E33A 1UPAA 3MJSA 1D07A 1P1BA 1V9CA 4R0NA 4IE6A 2QP3A 1V4BA 2DB3A 1YBVA 1W2HA 4LOJA 3RJTA 3CA8A 4UOJA 3TZHA 4DTCA 3T9CA 1MH9A 5JS7A 2FPKA 4EWDA 4NIAA 3KB2A 1MT3A 1H2KA 1E9EA 4OQXA 2GO7A 1G9BA 1A2KC 2FSHA 3M3HA 4AL4A 4M2LA 4B31A 5JDCA 1VL1A 1QK4A 3O2JA 4KO2S 5B7QA 4L92A 5K0UA 5BW8A 3UMVA 1D4M2 5EZ6B 2GLTA 3DXUA 4LZZA 4M7OA 1D1TA 1OZGA 4CEIA 5TSDA 2VJMA 4I55F 2C9AA 3B2QA 1SC4A 3L07A 4JR0A 3JQ6A 2C1EA 3K8ZA 1M6HA 4YIKA 2JIBA 1DUVG 4KH0A 2OXRA 4M1QA 2DBYA 1Z4QA 1H2HA 4ONEA 5DTMA 2AG5A 4XIIA 2O1EA 1QLWA 2ZWOA 2Z1DA 2VM9A 4A7ZA 3A32A 4CDQA 3LOUA 2FPIB 3RBZA 4AJ1A 5FA6A 1UFQA 2A71A 2C9MA 5G0WA 2UVQA 5AKGA 4Z2WA 3FZGA 3H6GA 2VXYA 2VQFB 2WWWA 4RLSA 4XE5A 4KNCA 4ZQFA 2IVJA 1FY2A 4LA2A 1XZCA 2P1DA 4LBMA 1CRWG 5FJIA 3VD5A 5FUWA 4ZU5A 2GCEA 3E7PA 2FUG1 4RGKA 2FSSA 2RG1A 2LCIA 4WZBB 4N5HX 1CQWA 2WNIA 5HDBB 3URKA 5E1MA 4GPEA 2Y60A 5LA2A 3TXXA 3LNCA 4XOIA 4QM8A 1Z8DA 2X7JA 3SYNA 3NVMB 3ICOA 3EB7A 2OSVA 3N9MA 2DKOA 1U2ZA 1B73A 5LQSA 5KYXA 2CBZA 3HVKA 1AX0A 5LZ7A 2XQVA 1BHGA 1PJTA 2HGZA 1MC4A 1ZNQO 2RS51 5AC92 4OQNA 2I87A 3RRMA 4D6PA 4KYTA 3LXXA 1U8AA 1PZ7A 1EIWA 2R1VB 3OX4A 4OATA 2AL7A 2HYXA 4OH1A 3T4XA 4ASUA 3AJYA 2K87A 1A9QA 1UF9A 2RE9A 4YN3A 3GXOA 3SC2B 3VR5D 3ILSA 4ZZ1A 4EA9A 2Z6AA 2V5YA 4MHSA 3R7DA 4XQ9A 2ZWMA 2R6FA 1FMTA 3HXTA 1M74A 2I2FA 3SIPA 4DILA 3AY7A 1JYXA 2EIEA 3C7KA 1CRQA 3FPBA 3IHTA 2CHVA 1I2ZA 3BMQB 3ZHUA 4N0DA 5T3YA 1H85A 1BX0A 1TO1E 1KJJA 1EUCA 3ESXA 2XE6A 4A0SA 2BSAA 3RVDA 4JS0A 1Z17A 3U56A 3UNXA 4QX8A 2X9VA 1O8CA 4I0AA 3HVHA 3MINB 4RY8A 4IMPA 4PNHA 3O1MA 3F47A 3L40A 3J9SA 1RCFA 3SLKA 1ONSA 3PFKA 1T0HB 5AVZA 2GAAA 3LXUX 1W94A 4FP3A 4UW4A 1WJGA 3URFA 5IH7A 2WWIA 2FJ0A 3S1SA 4YMHA 5EJIA 3DT9A 3K75B 3BF8A 3M5WA 1KWGA 3T35A 2NVUB 2PH5A 4B7AA 3VPHA 4LUMA 3BILA 2P6CA 4UHFA 5H1YA 4D4GA 4IGFA 1IUNA 5CVVA 3LHKA 2PSHA 2GHRA 1LECA 2WWVD 1LY1A 1M1NB 3ALQA 3LX6A 1H2MA 4RABA 3O12A 4QU8A 4E22A 4OH7A 4QPGA 2KR2A 1X33A 4BVHA 5DSXA 1NYQA 3IQZA 3R6DA 1PDOA 2OQRA 4R1SA 4Y18A 3VZDA 4F3JA 1B00A 3ZV3A 3DAHA 1W9WA 3LK7A 5FBQB 1VKZA 3VDAA 2GD6A 5TS3A 1YZ3A 1VYTA 1RFGE 1ZQ9A 3WDTA 3GMIA 1L1FA 5EZ5A 4OHYA 5AMXA 4TYPA 1QGOA 1DRKA 4B71A 2GBFA 4IP0A 4BB9A 4W9NC 2FPIA 5CBPB 4JLKA 3PHJA 4Q82A 3V6MA 3UXEA 1Q3TA 4LBQA 3Q3GE 4XJSA 3Q3IA 1NQJA 1UIMA 3OPWA 3PFHA 1OFUA 4ZYXA 2LW7A 2OTCA 4LZNA 3HO8A 2W4QA 1EFCA 1I32A 2YWFA 1GZ6A 1VECA 3Q88A 2GMEA 4LKRA 1XPWA 3M3EA 1SLCA 4MIYA 1UJ6A 2VBGA 3WGIA 1MFZA 2DWQA 4DUPA 3BXFA 4NK4A 2WQ7A 3P9CA 2A0UA 4RGAA 5DBFA 3DXXA 3KQYA 3DB2A 1QVVA 1IPFA 2VZEA 2XITA 3EHDA 5ILOA 2C7BA 1AXGA 3DNFA 2HSGA 2B3TA 3EGIA 2FQXA 1WWYA 3W1VA 1OQAA 2HK8A 3AP9A 2NQ2C 2P30A 2A6WA 2JFXA 1CX9B 2HSZA 2Q9BA 1KORA 3FBGA 4G4SO 1TE2A 9LDTA 3BMOB 2PMKA 1G8PA 4OHVA 3CL1A 1NN5A 1M67A 4Q1PA 5ICFA 3ADBA 3E15A 2QRPA 1P19A 3BTOA 4ETIA 3Q87B 4BTVA 1VSBA 2B8EA 2UZAA 4M88A 4ZVQA 1A3KA 5E16A 2GETA 4XTPA 1DCKA 2PX6A 3KV9A 3CX7A 1TJ4A 1JQ3A 3DF9A 2VY0A 1LHNA 4OBXA 2JS7A 4QODA 2YZ7A 5DLYA 5AKZA 2HJRA 2MR6A 1TEXA 5BQ5A 5JSHA 1ZBE1 3QBDA 2EKBA 4XSGA 2X0EA 3BMQA 4XB6B 3LT4A 4Q4W3 1J39A 3DYMA 5AVOA 2AHRA 1ZLXA 2D2XA 3J7MA 1CCWA 2QVYX 1RXSA 1WGPA 4AT1A 1MEEA 4YG6A 2O6LA 4YCAA 1JMVA 4OGLA 3QPBA 4Z9XA 4JUAA 5FJHA 2D2IA 3M5CA 7ABPA 3OLYA 5JH7F 5IXJA 3WGQA 3VL8A 3QLVC 4RTLA 5HBGA 3NNMA 3KZOA 3MT8A 1M6EX 2ZJZA 2X8BA 4WD3A 1IPSA 4B32A 1ZRCA 4V0OA 2BFEB 3VGJA 4D82A 3C3XA 1ZL0A 5BMVB 1EFTA 4XUQA 1WCKA 3JD1A 4UAPA 4UC0A 2C95A 3WHLA 2YZKA 1QP4A 2NO7A 3OP4A 4H3KB 4AO6A 2V3CC 3NWPA 4NG5A 4F7WA 1OD6A 2O5VA 4PI0A 1H1IA 4XWAA 2E4UA 5C8YB 3U13A 1NVDA 4DBLE 3MV01 2XHKA 1Q2XA 1K6JA 2XADA 2C5SA 3C74A 1T2XA 1JMUB 2RHGB 2YXBA 4TXWA 3ZKUA 1ZCBA 2JGLA 1ULBA 3BMCB 1L7OA 4ZI2A 1K7YA 4P98A 1SQ6A 1L5QA 1KO7A 5EWSA 4E51A 2PVCA 4NU6A 3A1WA 4R1NA 3HUEA 4WMLA 5JQGF 3J81A 3K8OE 4W1QA 2BTVC 5AJWA 4UTRA 2RJ2A 1EE9A 3JZIA 1KNQA 4GOJA 3ZXGA 3Q11A 3KTFA 3RG2A 4Z9AA 1AZWA 2GBGA 2HKIA 4HVQA 4F9FA 1U3UA 4HYQA 4Q8KA 3IEPA 2VXJA 5DK4A 2ZDGA 3UJNA 3QWHA 4O2BB 3ZR5A 3Q5EA 2LUOA 4YK7A 3HR8A 1I0IA 2F6BA 3E4DA 5APAA 4BZ4A 1XD9A 3KJEA 1CR7A 3KB1A 3OY8B 2RJNA 4EJRA 1FP7A 1T5IA 5H68A 1HKHA 3WSVA 4ZVOA 4J1TA 2VUIB 5K05A 5H3HA 2ZETA 3RRDA 5EJ6A 2ZI4A 3PPVA 1KMQA 3MHZA 1PM7A 5B57C 2YBEA 3IOMA 5EKSA 4Y33A 4RJ2A 4XFJA 3WXBA 5YASA 1Y3FE 2ZYAA 2IEIA 4XQWA 3OF3A 4MVJE 1ESZA 1CAUB 3D0RA 4RIEA 2ZBJA 3BMOA 4MW1A 1W2AX 3QWAA 4QTYA 2WFF3 1Z2NX 3D3QA 4GWLA 4NFSA 3S28A 5LBFA 1Q74A 1A96A 2A3XA 4ARIA 2A7QA 2HOQA 4E46A 2NU9A 4ALJA 1T2CA 3DVLA 4FFHA 2A6ZA 1U2SA 4NHOA 4MQFB 3FMVA 3WIOA 1RYYA 5AW6A 2FZCA 3WINE 4FTSA 5A7WA 2P1BA 1G21A 2VNJA 2WIBA 1PKEA 1NW5A 3VDXA 5IBCA 4KVFA 2R60A 1SUFA 4CG2A 2JE9A 4EB8A 4LJHA 2AFHB 4UQPA 3JQAA 5ALMA 4DA9A 4MPTA 1OU4A 5D6NA 4YRFA 1YI8A 2OCGA 5TQ0A 1GAEO 3PGVA 3H3LA 1CNMA 2NNLD 2D2EA 3H2SA 3C7DB 3N7LA 4UU0A 3IAHA 4AFDA 3U9SA 3EUAA 2A5ZA 2KB0A 1W52X 2YMPA 2ZSJA 3JWJA 5F9TA 1H2FA 4EKDA 1U0JA 1BNCA 5H80A 1XCJA 2QR3A 3L84A 3G2NA 3AQIA 5IKMA 2PX0A 2DBNA 4IMIB 1TYZA 2CKMA 3GDHA 4FFMA 4PCVA 1DQ0A 5CLFA 1DXOA 3IJPA 4Q37A 4QJBA 2JAHA 2ZSFA 1YE8A 1ENPA 4GGPA 4KXWA 1KQOA 4HL0A 3UY4A 2EJTA 3IQFA 4HT1T 4P4UA 4PTLA 4GL2A 6NULA 3BMCA 4A0FA 3PLAE 1ID1A 2JGJA 4WOPA 1QYWA 1MPXA 4NLLA 3KP1A 2OPBA 4DC0A 1N5LA 3A2LA 4HXGA 4MSVA 1OIVA 3KU1A 5F76A 1BW9A 2W98A 1UZNA 2XUAA 1MXHA 4P81A 3NV4A 3BRCA 4BQPA 1L7DA 4FZ5A 3DLBA 4Q9AA 3AHDA 4Q3NA 1QU2A 5FF9A 3DDNA 2XLAA 3E23A 3CR8A 1VL0A 5JYCA 2EAKA 2OY0A 1IPEA 2CEKA 4XVHA 4NRMA 1GZWA 2J41A 3MNFA 3L8YA 5IVDA 1VKJA 1WMBA 1JKFA 4C2UA 1JHPA 4BNXA 2W22A 4C1BA 1AX2A 1C4OA 1EJBA 2J0UA 3SC4A 1VPEA 5I9SA 4MCHA 5BSGA 3L9JT 4TVOA 3E3AA 1W0KA 1V11B 5EMLA 2DU0A 3ND6A 1CAUA 1T8WA 2JCVA 3U1XA 3G59A 2HJ9A 2ORXA 4HAOA 4F5ZA 2IUYA 5HJ2A 2BKUA 3CLPA 4OYUA 4WK6A 1Q7BA 2FFRA 3LDBA 3ETNA 1R4MA 3WDUA 3HABA 2XTZA 4AJLA 4Y9TA 3FRIA 2Q28A 1GFF2 1J42A 4ZRDA 1K4MA 4D4HA 4H2DA 1JNXX 1WIWA 1IRXA 1GAJA 2ECOA 1E2QA 3VKMA 2MSKA 4QYMA 5CIQA 5DNCA 4U7FA 1OXXK 1D1PA 1N5RA 4DQVA 3Q12A 4MQFA 1XJQA 4FIDA 3CF6R 2EQBA 3H0OA 3O8QB 3PKIA 1T91A 4P08A 1W85B 1SD2A 3GEBA 2H6CA 1XA4A 2R7EB 4ILKA 1BS2A 5FUMA 1R9JA 2AFHA 4BCBA 4QJ4A 4X92A 1Z7S1 2LGJA 1PSWA 3LBNA 5A3MA 4P4SA 5AC93 4D0SA 4EJSB 5MFPA 3BRQA 1D6JA 4KZKA 5E6UA 2BVNA 2B4RO 2EL9A 1P2SA 4ASKA 2P3KA 3KT0A 3IE0A 1VLMA 5ALKA 3THOA 4L16A 2YB7A 3CO5A 3C5VA 5D21A 4KPUB 4MNTA 1XD8A 3I9FA 4JHZA 1OLUB 1EUZA 3I0ZA 1LHWA 1FU7A 5C80A 3K0CC 4O59O 2VNGA 4EVSA 1U8TA 4BHTA 4B6SA 3K53A 5B55A 2GGSA 5AHKA 1SIOA 1ULHA 2QUOA 5BYAA 1T6NA 3FCSB 1EAH3 1M6NA 4ZQIA 3B51X 2VCBA 1M7GA 1N6PA 1NX6A 4OKSA 2H1RA 1Z16A 2P90A 1SFNA 3ACDA 1APBA 1ZHOA 4L28A 3M6AA 5LP6A 4QBIA 1SUAA 3CV3A 4EG3A 3FGOA 1CZHA 1O3TA 3S5AA 3WRYA 5L45A 3PD7A 3T95A 2WINI 1LBEA 1AA9A 4BB6A 5FO7B 3KVBA 4JEHA 4QPNA 2V7QA 4AQ2A 1IHMA 1T8PA 4W1SA 4O5AA 4GM4A 4KL8S 2LROA 2HBYA 4N53A 4MLCA 3UGGA 3WLQA 4ZOQI 3NEYA 4BJ3A 1QX3A 5E1DA 2X41A 3VBRA 4DC9A 2PZBA 4YRTA 3B7WA 2V6MA 5B7PA 4AS2A 4YVSB 2RJOA 1W46A 1HT2E 1QHHB 3AMPA 3SYTA 2AN4A 2PS9A 3O95A 4A6XA 2RDNA 4YRDA 1MTOA 1DKOA 4IXLA 3BWYA 5CG1A 3TF5A 3K5PA 3PGMA 5KTSA 1XLUA 3MGBA 4PGGA 3KKQA 3VJMA 4TX1A 5F1KA 4Z4EA 2WIGA 4EGJA 1UK6A 5FZ4A 5LMZA 4DXRA 1CX4A 3GRUA 1W36C 1H4SA 4FS8A 2ZGMA 4GL4A 5K2OA 5DKFA 3FHIB 1AJEA 4LZJA 1TM5E 3OLQA 1P5FA 3DZKA 4FB5A 1NJ2A 4L73A 1MNQA 2HEGA 2E48A 4WVFA 3A0KA 1JOPA 5K8TA 2G71A 3ORYA 1GGKA 1DEXA 2H08A 4U5QA 4DV5B 1J21A 2P9ZA 5DDJ2 2AFIE 1LGBA 2ZE8A 4UVGA 1SC3A 4AF9A 5DYYA 1OUXA 3HEIA 3O0TA 5J36A 2WTMA 1W5AA 2YVUA 2WILA 2ZT5A 1T0UA 1G6HA 3ZZMA 1GTG1 1A50B 1WBLA 2YV4A 4WBBA 4I2OA 3WXMA 3MT9A 2TUNA 5EHIA 1EESA 1IB0A 4SBVA 5HQTA 4GPIB 3OJCA 1IPKA 4S35A 1Z5WA 4YVWB 4Z8YA 4Q3DA 1NXSA 2VD7A 4RPKA 4YRGA 2WFMA 5F37A 1W99A 5JTUA 4CEYB 1PGL1 2XKOA 4KQGA 5HF9A 2BNOA 2ZIFA 1Z4KA 4OGWA 1EI9A 1MEJA 3DOOA 3JYQA 4CCOA 1I6XA 1BD3A 3L8MA 4PPFA 4AURA 1JHQA 2J3MA 2IBSA 4RKYA 1KDPA 3QKTA 4Q6BA 1Y80A 3HIFA 1I36A 2V5VA 4NE2A 3ASIA 1X1DA 4OAOA 5KOIA 1GMMA 5A6YA 1H69A 5HE8A 3QX3A 3U3MA 3AF4A 2R00C 4G4FA 4JC4A 1VKNA 1OLUA 4D1YA 3PA6A 2Q3MA 1MAVA 1IVYA 4QUJA 3WV5A 4LS3A 5H9QA 4CF6A 4URTA 5FTKA 4JJGA 3ZI4A 2Y71A 4RHV3 1OV6A 3RS4A 4BWOA 4E14A 1T5LA 2ODAA 2WF8A 1EGQA 3EW7A 4X6LA 3X1ZA 4BAUA 3L4BA 1D2NA 1UT8A 2Q6OA 3SE7A 2WM8A 4WQMA 2VZVA 3S6JA 2IEBA 1GUIA 3HY6A 1ULZA 3TDNA 1XVTA 3FLTA 1OTHA 5DHRA 1RM4A 3RSLA 4K2AA 1BGXT 1PTJC 1Z7EA 2BHNA 3J8F2 3R6TA 1QHEA 4CQNA 1C9DB 4L95C 3SN6A 1YCDA 2J3QA 5K3CA 4KOEC 5HCAA 1J0EA 2UDPA 3WDXA 5JDCC 3N74A 5FYTA 4NZZA 1E7MA 1RIIA 1S0EA 5K0UC 2Y33A 1FYEA 4J25A 3SKYA 3P19A 1N1GA 2FA9A 3KCXA 3O2SB 5K03A 3QQPA 3ZFEA 1HLCA 3CLUC 2A9QA 3WL8A 3IQWA 4RQUA 4KNYA 1IOZA 3H9QA 1NI3A 4NCXA 1HW5A 4GX5A 3I83A 2J4FA 4E2GA 4IV1B 3LQCA 2WJJA 3L7BA 4Q6WA 3A4LA 4IQGA 2I1WA 1UMBB 3LPNA 4LEIA 2HJIA 3AMQA 4QPJC 3SEQA 3IE1A 5FNZA 5K3AA 4CDQC 2B99A 5DK6A 1NRXA 1N5JA 4O4HB 4HMQA 3ORRA 4V0KA 3RKRA 2BMFA 5EWMA 1L7BA 4IOJA 5HF5A 1RBZA 2JFFA 2H1IA 2Q3EA 1I6WA 2DQ4A 1V16B 1CDDA 2GS9A 1MB4A 3WL4A 1O96A 3PXGA 3KHTA 3L77A 1A04A 5I4IA 3KUDA 1IU9A 1YVRA 3AU9A 2YHIB 1QXSA 2ETXA 2JHCA 1RQRA 1ZEMA 5IC5A 4JITA 1DIHA 2QENA 1SQ4A 4G6ZA 2A1UB 3JATA 1KGDA 3AESA 2I7CA 2C3YA 1M3SA 2PKYX 3NV9A 3WMWA 1YMUA 4CTNA 2NSDA 1LV7A 3RRNA 1A2QA 1JHVA 1FPN3 1B2RA 5HMMA 1DDOA 1NSFA 3UKJA 1XWFA 3KZCA 4D3YA 1J5PA 2CHQA 4W9NA 2EDCA 3BXXA 1ALYA 4YDSA 2JD1A 4FR5A 9ATCA 3V1LA 3H1GA 3FFQA 4QNRA 1O0BA 1XTBA 4FEYA 3GA5A 5KNDD 2VMFA 2QPLA 3EQ2A 3K1JA 3B1XA 1QQBA 1R1DA 4M76B 4ZEMA 3N9NA 2VOWA 4G8JA 4FAHA 2YROA 3I2FA 5J58A 5CB0A 4X24A 2VR4A 1ACLA 4JL8A 3L4JA 4G1BA 1JLHA 4MAMA 3UT6A 4OZOA 2BWJA 4YZ3A 4W9MC 4ZZ0A 2E82A 4ID3A 3VOTA 5M34A 4B3MB 3QU5A 3ESBA 4COZA 2QQNA 3QCWA 3BTVA 3A9SA 4EPVA 3PD0A 5GM0A 4KWIA 1B14A 1FDTA 4HQFA 3OCZA 3STYA 2BI4A 3N8DA 1UJ5A 2XUKA 5DEIA 4U2CA 2XDYA 5C7OO 1Z8NA 4FJ2A 1YA6A 2XGGA 4YAOA 2LRPA 2BGUA 4DGQA 2ODQA 2X1LA 3E27A 2G1KA 4FAGA 3TZCA 3L05A 2HQ1A 2QRJA 1Z3CA 3T6KA 1E32A 2YJ5A 2W2PA 3ASVA 1VSQA 1S3GA 4DMLA 3VD7A 2MJLA 4LYHA 2B9VA 2H1WA 5D8DA 1ISRA 2O8DA 1OD5A 1M0SA 3IJEB 4LNVA 5TQVA 1WCYA 4L85A 2AQHA 5EESA 4D56A 2JCSA 4QPGC 5BMVF 4CMIA 2VEOA 4IV1A 4C4RA 1KETA 1H8HA 2ZHMA 2QTAA 1ZO8A 3HZRA 1TYCA 3D4IA 3MPOA 5KYTA 1T1JA 1IVNA 1ODFA 2ZPTX 1QYVA 1K42A 4BKRA 2IQ5A 1EVZA 2C54A 4NFLA 4OUDB 4HY3A 1WDLA 5HW0A 1TYDE 4D9NA 1X50A 5T4BA 1W44A 2IOFA 4GPAA 4HBZA 1P2FA 3I53A 4R71A 3LV8A 1MJHA 1QTQA 5THKA 3EFOB 4NCNA 5ADVA 3TD2A 5BWLA 4EF6A 1X2EA 5FPQA 1SNYA 2D00A 2Q8DA 2OC9A 1U94A 4D42A 1V16A 3GPCA 5FZEA 4TKUA 3HO1A 1KY5A 2V1XA 2VH2A 2JASA 2JDKA 3PUZA 1SXQA 2CJWB 5CG9A 3JVIA 3GDGA 3SJCA 4O2BF 2YHIA 3RFTA 1L9KA 2OLKA 3KDSE 5KWVA 2PSFA 3AHGA 3VM6A 3D3NA 3NWJA 4DQKA 4Q66C 1E1LA 1X8JA 4MKZA 2O54A 4KO4S 1E0SA 3ZQUA 4X63A 2BGGA 2XR1A 4GKKB 4RDXA 3H1WA 1D4OA 3WTCA 2V8BA 5C8ZA 3RVMA 2N1MA 1NVVQ 3TQHA 4UVHA 5C8XA 3PNLA 1POXA 1Y63A 1WUKS 1BLZA 1L5NA 1F5SA 2AOUA 3GLIB 1GPUA 4NAHA 1S2MA 1BKZA 5KVQA 1Q84A 1OROA 3D8BA 5FZ3A 5IYYA 2NADA 1WXGA 5H9WA 4JP2A 5LQRA 4YRAA 2ZGLA 1OYOA 3PENA 1VBB1 2PWPA 2V4AA 3QVSA 1QOOA 1A72A 4GO1A 4TN1A 3WL6A 4DA8A 4XB1A 1X7YB 5FYIA 3DW1X 3LHFA 1MVOA 4R8SA 1CY8A 4IDBA 1I5EA 3OD4A 2E31A 1N2IA 1NF2A 1DRVA 3VAYA 4GKJB 4X6XA 7REQB 3KSMA 1ZUIA 4LMBA 4OJKA 2GRAA 4IE4A 4NMIA 1PNRA 1DPFA 3J7HA 1OI4A 3QF7A 2H85A 5EPOA 2CNBA 2DTWA 1NWHA 4QKQA 1XGKA 2UY9A 2GC0A 4NRDA 2K0GA 1B8NA 3CUYA 2R96A 2XWPA 4A0RA 3JWPA 1I3NA 3N5KA 4LQDA 4OLFA 3GLGB 4J0EA 4LF6B 2K2SA 5J2UB 1GT91 1IOWA 4YJ2B 2WNVB 3LHIA 4HK8A 2PXXA 3ZHVA 5KMGA 1A9XB 4HQ0A 1GU7A 4NV0A 3ITEA 3MCAA 2XUEA 3OH8A 2FDJA 4DDVA 3T5PA 5GZ1A 3CRRA 3DT6A 3ELNA 2UZ1A 3AQ4A 4IVPA 4FYWA