5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
molecule keywords Subtilase SubHal from Bacillus halmapalus
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
1PTKA 1C9JA 3DE6X 4ZARA 1DF0A 4J94A 2PYZA 4ZOQI 1SCAA 3DE4X 3T41A 1SCNE 3DWEX 1TK2A 3DE7X 1AK9A 1IC6A 4K8RB 1AF4A 3PTLA 3I2YX 4BWGA 1HT3A 4GI3A 2DUJA 4H6XA 2X8JA 1SIUA 2IXTA 1T1EA 1GNVA 4KG7A 3D43A 4LVOA 3DE1X 1AH2A 4DXZA 1YU6A 1S2NA 1Y9ZA 3QFHA 1AV7A 1GT91 1R64A 1SIBE 2SNIE 1TM7E 1C9MA 1BE6A 1WMFA 3GCXA 4FONA 1BE8A 4AKTA 4C3VA 1GA4A 1SH7A 1JEAA 2ZWOA 5SV5A 1KDZA 4B5LA 3GCWA 1SUCA 3DVQX 3LPDA 2QFEA 1YJCA 3SQOA 1Y3FE 1SPBS 2PKCA 5AVKA 1U5IA 1KFUL 4I0WB 2XTJA 1SCDA 1Y1KE 2W2QA 2ZWPA 1GA6A 1V6CA 3DE2X 1SELA 2PMWB 3LPCA 2Z2XA 3VSBA 3ZXXA 2SECE 1BFUA 1GTL1 1AQNA 3BX1A 5JXIA 2TECE 1T1GA 1SCBA 1Y3CE 2ZRQA 3LXUX 2B6NA 1IAVA 1SUBA 3VV3A 4OV6B 3AJ8A 3DW1X 1ST2A 1TO2E 3WQBA 1P8JA 3DF0A 1KFXL 5K7SA 2XVGA 3UNXA 2X8JB 3DVRX 1Y33E 4G9SB 1Y34E 3VTAA 1TM4E 1PFGA 3DDZX 2LUWA 4DWWA 1NQDA 3AJ9A 5ARCA 2XRMA 3BGOS 4LVNA 1SUAA 1PEKE 1NDUA 1YJBA 3AFGA 3JQXA 4CFYA 1NLUA 5CW1A 4RYDA 1SCJA 4MZDA 1WMEA 3VHQA 3I37X 2Z2YA 1A2QA 3HJRA 1WVMA 3WHIA 1SN7A 1SVNA 2WUWE 3PRKE 3SICE 1MEEA 3A3OA 1ST3A 1Y3DE 4CG0A 1Q5PA 1Y48E 1TM3E 3VYVA 2PWBA 1CSEE 2Z56A 3DE3X 5ARDA 2IY9A 3P5BA 2WV7A 3TI7A 4JP8A 1NDQA 2Z58A 2ID8A 5JXJA 3DVSX 4KPGA 3QTLA 3L1KA 3EE6A 5AVJA 1SUPA 3WIUA 2DP4E 2ID4A 2Z30A 2XVLA 3QMPA 3OSZA 2W2MA 4HPKA 1YJAA 4H6WA 2WUVA 4NE7A 1OYVA 3BPSA 1SBNE 1CNMA 5I9SA 2XVKA 3CNQS 1C9NA 1AU9A 5JXGA 2V8BA 3CO0S 1GA1A 1KDYA 2O8OA 4YN3A 4HX2A 1GNSA 1TO1E 2Z57A 1BH6A 2Z2ZA 4OMDA 3A3NA 1TECE 4C3UA 3F49S 4AKSA 2DQKA 4OMCA 4M1ZA 1P7VA 2PQ2A 1GTJ1 4DZGA 1TMGE 2WWTA 1EGQA 2QTWB 1VSBA 4HPKB 3JQWA 3DYBA 4H6VA 4NE9A 1C3LA 2SBTA 5ARBA 2G4VA 3WIVA 1KE2A 1UBNA 1ZVJA 1AVTA 4I3GA 1SUEA 1NQJA 2HPZA 1TM5E 3DE0X 1PJ8A 1OT5A 4WOBA 1XF1A 5AMXA 3F7OA 1MPTA 1SBHA 1TM1E 5FAXA 1Y4AE 3EIFA 2SICE 1BFKA 3TI9A 1T1IA 2GKOA 2W2NA 1BJRE 4NMXB 3F7MA 3I34X 1R6VA 1DUIA 1WSDA 4CFZA 1KDVA 3GT3A 4DJ5X 1GCIA 4WOCA 3ZXYA 1OYOA 1R0RE 4DY3A 1LW6E 1ZVKA 3EDYA 5FFNA 5JMOA 3DE5X 1SBTA 3LPAA 5B1DA 3I30X 1EA7A 1SBCA 2PWAA 1DBIA 1Y4DE 3BOWA 5B1EA 2P4EA 3VV2A 5JXHA 3DW3X 2E1PA 1GTG1 5SICE 1S01A 1WMDA 4Z2AA 1P7WA 1SIOA 1S02A 1Y3BE 2ST1A 1KE1A 5AQEA 3GT4A 3Q5GA 4DY5A 3A3PA 1QXPA 3Q40A 4DZTA 2W2OA 4HVLA 2PRKA 3TECE 1THMA 2HD4A 3H42B 2W2PA 1V5IA 1SUDA 4KB5A 5FBZA 1SBIA 3D9QX
chains in the Genus database with same CATH superfamily
1BN7A 5AHKA 4XJTA 4ZYVA 3DWGA 3DPRA 1L2TA 5DG1A 5JUWA 4RTLA 2OVUA 3OHSX 4HBGA 3RS5A 1T91A 2A0YA 4DPKA 3ROEA 3ENKA 1YB5A 3AUSA 3T7CA 3RWOA 4HHEA 3VLBB 1N2CA 4HKWA 4OXNA 4RD1A 3X0DA 5JRJA 4XB1A 2P3QA 1U7DA 5I6DA 1KFBB 2OXFA 2PL5A 1PUIA 2AFVA 2J6BA 2ZLBA 5IC4A 3VOSA 2Y0BA 1GL6A 5ELXA 4LULA 5K0UA 3UATA 4Z9XA 3VAZA 4RY0A 5AHXA 2E53A 2ICAA 2Z69A 3EVZA 5BSWA 3WHUA 2HJ9A 2DCYA 4WRRA 2CGPA 3CJXA 4B3NA 4D6XA 3OQOA 3OBRA 4MYHA 5A3MA 4H1VA 1F51E 1VRH3 4I0WB 3S0MA 4C0LA 4NTZA 1A4IA 1XZNA 1Z63A 4JL6A 3PC4A 3V1NA 4CM9D 4LG1A 1UYXA 4PXYA 5H9VA 3PMSA 2HIHA 1SLAA 4Z3DA 4R8SA 4YJ2F 1GTL1 5K6TA 3GUVA 1Z06A 3RIYA 4KQKA 2FE4A 1N1SA 2IX3A 1CETA 1ENZA 4D8XA 4W5WA 1JR2A 3IAFA 1FJ2A 1EV13 1CRPA 3ITQA 2Y1GA 1AQIA 1RYEA 1Z0HA 2C54A 2WFLA 5JH7F 2FX5A 3ZKYA 2Q5FA 3GIWA 4XDGA 2IS4A 3U49A 1Z45A 4A7ZA 1C8M3 2HWB1 3UCEA 2RBGA 2B7YA 2CKMA 2BGJA 4DDKA 5LOVF 3NDRA 4KH9A 2Q2VA 4MGYE 2WTEA 4ZAFA 1DDLA 1EGHA 3TAHA 2WHEA 4Z82A 1U98A 4XUEA 3C14C 3MGKA 2OWDA 1G7CA 1Z3IX 5FOXA 3OUIA 4FOYA 4C7VA 1PGJA 3IMKA 3ER9A 3BB4A 2QROA 8MHTA 5LDGA 4H2AA 1IE3A 3KSRA 5EJ4A 4LK3A 3IP6A 3B3AA 4W4ZA 2JHFA 1VBD2 2Y38A 1V8FA 1T4MA 2GSDA 1H4HA 2YJGA 1Y9GA 3LIHA 5AJZA 4KV7A 5JALA 2H2GA 5FP4A 3WJ2A 1BWRA 4JLSA 4W5OA 2EGHA 5CFMA 4TROA 3WLIA 1KF0A 4KPUB 3H3XA 1YXMA 4JJAA 3FTNA 3PDJA 4FFBB 2XLFA 5CVRA 3QFTA 2QTGA 5FZ8A 1P9WA 3M8KA 2BBVA 1WE2A 3TVYA 5KNBH 5ERXA 3ZQ4A 3ILNA 2WMYA 1I14A 1UD1A 1H8TC 3WOHA 3ZN4A 4EV0A 3I4IA 3WLLA 3KB8A 4NECA 1G3UA 5CB0A 1T0PA 3QW4B 1X9PA 1OI4A 1LPMA 1NBAA 4J7CA 3CVVA 4HDAA 5D5HA 3AWIA 4ONUA 3A32A 4XYEA 1NCQA 4EAAA 3RARA 2FQQA 2I4RA 3GPDG 1MAWA 4OGKA 3TUJC 4IX1A 2FP4A 5SYMA 4ZYUA 2G28A 5DLDA 1Z5OA 4IIBA 3THSA 2WWGA 4FDLA 1WUHS 3WB2A 4I02A 5J1XA 3RANA 4YRCA 3QHPA 2UUBB 2KLHA 2OQ2A 2VXOA 3ZLUA 4QUJA 1LVUA 5C8CB 2HBUA 4QU8A 5CPFA 3OZSA 5L7OC 4RH1A 4MWOA 3WYFA 4ZC8A 1KHHA 4ZP1A 3TG8A 1X7NA 4QHBA 1YRBA 3GELA 4WZBE 4D9IA 3VZPA 2EP5A 3KOWA 3S2IA 1IXYA 5FXZA 4EELA 4C0WA 2O48X 4EUHA 4YIHA 2VZPA 3LY5A 4RE5A 5DAPA 2HQSA 2ZRBA 5JXHA 4ATEA 4XRGA 3ONVA 1K2VN 3EO6A 2DWCA 2AZMA 4HN2A 3GAAA 2F4LA 4AO8A 3SYLA 2WTAA 1Q3HA 3N75A 1XZEA 1UX7A 2H8KA 3SXUA 5TEVA 2R1BA 1VZ3A 3RSCA 3I9NA 1Y5IA 3X1YA 2W2OA 2P3JA 4LNUB 1J4AA 4DYHA 3PSHA 5IC6A 2PRKA 4OL0A 3LWCA 4RBNA 2QMQA 4RZSA 1YCDA 2XVZA 3HJBA 2WWWA 1Q8SA 2PNFA 1C1YA 3BIJA 4QU2A 4G67A 1CAWA 5EMHA 1JYWA 2JB4A 4JDMA 3NBAA 2B8MA 2QZ3A 3V3TA 5K0UC 1HRDA 1IJKA 3BFJA 5BSKA 4GI3A 5KVAA 2O9JA 3TNFA 1C28A 4HVRA 4L6AA 2MEV3 1CZUA 2BGTA 2ZMLA 4HBZA 1JXAA 2V73A 1YQCA 5DABA 2X42A 5I01A 1X3SA 4QX5A 1MS8A 4Z7QB 4RS5A 5I7UA 1D0IA 3PR2B 2F6RA 1TLFA 3HKBB 1S2EA 1XRPA 2XHZA 4FPOB 1QJ4A 1VBKA 1UZAA 1CHNA 2EIGA 1A98A 3O4FA 1MU0A 3T9CA 4YBRA 3EPJA 4TPKA 5FTWA 3UZUA 4C4SA 1I30A 3FB1A 1Q1GA 3I3MA 4XSVA 1Y7BA 1NW5A 4AULA 3KLSA 2O6LA 4JN6B 1XB9A 3W5CA 5LKAA 4F9GA 2WJSA 1QYXA 2LTNA 1XNRB 2P9EA 2QVLA 5HR5A 2W91A 4E1AA 1X1DA 5JT1A 2GOYA 4HQRA 2VQ0A 3IVAA 2IV3A 5A7WA 1J42A 3CU5A 1SQ0A 4IH1A 4KO2S 4U0KA 1XMPA 2FY8A 5T8KC 1Z18A 1L7PA 1W8FA 1YS7A 3L8CA 3G1TA 5D7BA 1K92A 4C90A 2IDJA 2P3KA 2DR3A 5AUOB 4FOOA 1U8CB 4JJGA 1N32B 1ZMXA 1S96A 2ZSKA 1QOZA 4F3YA 4XUOA 2AFHE 1IHMA 4XGKA 4PRLA 1FV3A 5KU1A 3O8RA 1TF7A 1Y9MA 4XGIA 2EX0A 1P5HA 1DQYA 2C9MA 1ZD3A 2EBUA 5BV7A 1HEIA 5TPWB 3WTCA 3PWZA 5KKNB 2WTUA 4P34A 4WDRA 4BJ1A 5AVZA 5F4ZA 5FADA 5FBHA 4IJVA 4GD3Q 1KZ1A 4QXBA 4P33A 2QUOA 1PFWA 4NZNA 3L5OA 4DW8A 5IWCA 1ALYA 1T1SA 3ES9A 4XFGA 3LT5A 2ID8A 2JIQA 1ACCA 5G1OA 2QN1A 4RY8A 1OKQA 3EE6A 4YMVA 2C31A 2JLRA 4WUVA 3HL4A 3H1BA 3AZZA 4WKPA 3YASA 4BS9A 2CJFA 1JYFA 5K0GA 1CG6A 2VZ9A 1AG9A 3BE5A 1GITA 2X5XA 3PQEA 4BNMA 3GP8A 2HDNB 1VE9A 1GDTA 1J3QA 2WJAA 3TD9A 3NFRA 3OOJA 2YHAA 1O03A 3WBJA 2VZLA 2JFOA 2YL2A 4OMDA 2KX7A 2GN1A 3H9GA 2UUOA 1E7MA 5LUAA 1PX4A 4DQ0A 1GLNA 4H14A 4GLFA 2WFZA 2R2GA 3R40A 4ZO6A 1PJSA 4CIYA 5BOSB 4TM7A 1G8GA 4BQOA 1VFNA 3OO0A 2PX2A 3TJMA 1HLPA 1AMOA 1EGQA 1XVTA 2JD1A 3AJYA 1VLZA 3R76A 1X7ZB 4ZJZA 1TPZA 2XGSA 3ITNA 1MEC3 4YYEA 2GM5A 5J4HA 1Y4UA 1WS6A 1A04A 2QW0X 4ZRMA 1I5RA 4D6PA 4OSOA 5L7TA 2A6VA 2JKYA 1WSWA 1S0DA 3L1JA 4B2IA 5CFOA 3QEMA 2CFCA 1Y4AE 3AZPA 4QODA 5CDTA 2AZ4A 1ENXA 3T0AA 4N01A 1ZZBA 1KPIA 4CEHA 3TLXA 4MQFA 2Q9BA 3IGFA 3RI8A 3TNYA 4RKYA 3ZYBA 4X64B 2C4WA 1DUIA 4NPLA 1IY2A 3O9ZA 4YJHB 3F78A 3G6JB 2VP6A 3B48A 3CRRA 5K3EA 1XD2A 3H1PA 3FDZA 3EDYA 3NAGA 1IZ3A 3N7AA 5NULA 2BGLA 1K9SA 2CXRA 3K73O 3DQZA 4KIUA 4CCSA 2OC9A 4C5AA 3FFBA 4C7OB 1G2PA 2A9VA 2TBVA 1R66A 2GDZA 2P0AA 2CFTA 3ZM8A 1OE0A 3DBRB 3OSUA 3VO9A 1E2GA 1ZX1A 2I9PA 5CB4A 5JANA 1SBEA 1T6YA 1Z4MA 1ZRDA 4OHBA 2AIRA 2YW2A 4IV1C 2HNKA 1HPLA 1D7PM 3V2GA 4JJEA 5FMDA 4MTLA 4CFSA 1WO8A 2QMUA 2E87A 3C3XA 4HTAA 1IWOA 1JGTA 3ZIDA 3G0IA 4GH5A 1ZK4A 3KZKA 3NRCA 1CNEA 3NIDB 3HZOA 2P1RA 4Q3EA 4JQSA 1MFPA 3TBHA 2WA2A 4FBMA 4PIXA 4CG1A 2ZYRA 3I2FA 2A3YA 1L4GA 1XU4A 3BQNB 2H5IA 4NBNA 2G1MA 4K6FA 3LUHA 2PR7A 1II8B 5DP1A 5A62A 4WT7A 3LCVB 4W5RA 2AUYA 2HXYA 2CLMB 4KN5A 1WMFA 1ISHA 3ZDCA 4WM8A 3B9RA 3OZAA 1Z35A 3H2BA 3SC6A 4UOEA 2HJWA 3GEGA 4A8HA 4FC7A 3JQDA 3N8NA 3SQOA 5TR9A 1U1EA 1OXCA 5DHUA 1T6BX 1A4UA 2X05A 4X6YA 121PA 1EP3B 4B33A 2INGX 4BVBA 8ADHA 4U36A 3PFFA 3ZXSA 1MJGA 3F5QA 4DN6A 2R6JA 2VBDA 1LHUA 3TYXA 1MRZA 1W6OB 1AHHA 5EFZA 2YCBA 1H5QA 2C8LA 2O0MA 5LWBA 1W1UA 3KMHA 5BORA 3D4LA 1CFJA 5GM0A 3KVRA 1RUJ3 2CF5A 3LXUX 3IJPA 1DYKA 2CNAA 4QNMA 1B1CA 4O3MA 1S2KA 1XWWA 3WR0A 4JROA 1Q11A 5IBCA 1YQTA 4KK3A 4H31A 1R10A 3PQCA 4L4SA 3TN7A 4BC1A 3RRYA 2W68A 4OKNA 5ADHA 2HUPA 3U0BA 4F97A 5TPZD 5I0TA 2R00A 4GMKA 2QE6A 1GU3A 1ZM2A 1RWVA 1NLRA 2WZR3 2IFWA 4ETMA 4A1OA 2XG3A 4XYGA 5FBQB 4KPYA 4FEEA 3D8NA 4YY3B 2Q8CA 3ON7A 2J7KA 5LQKA 5JZSA 3LPGA 2BM9A 3PEYA 2ZGTA 1UXIA 3BGAA 4MEJA 1A2QA 1ZO8A 3QVJA 3HJRA 4QUHA 3CU7A 1F4HA 3ZFFC 1FXZA 1PEDA 4HDKB 5IVJA 3OMXA 1MT3A 1OUMA 2QU8A 2PWBA 4JJ4A 4CMCA 2FLVA 4RCYA 1EDZA 3DWFA 3ACHA 4CMHA 3BCRA 4EAQA 4AYTA 2W0MA 1GKYA 3HSYA 3W2TA 1DIGA 3PS9A 5L7YA 4DRXB 1MOQA 3DKIA 3KAPA 4LKFA 4F3NA 2CJXA 5AOVA 3QTLA 3FPSA 2O7VA 3BTVA 1GV9A 3I5AA 3MUEA 3IX7A 5FWYA 2VSQA 1N9GA 4RMIA 3K0BA 2NSLA 3PFWO 2JGMA 3AP3A 1W9WA 3U4QB 4LFCB 2XY4A 4JLVA 1Y7LA 1CAXA 2BFCB 2XZDA 3IDZA 3MT9A 5DBIA 1JAHA 1JSRA 2K46A 3IR7A 4OU4A 3OCZA 2VFAA 4KLNA 4LFBB 3DYVA 3IURA 4FYWA 1GQGA 3TRKA 4EG7A 3VVCA 2FPUA 3HNBM 3PURA 1S2OA 4MAAA 4L28A 4O1IA 3M8LA 2B5HA 1GPNA 3VDBA 4D8MA 1TB4A 3V7YA 2B8JA 3GJ5A 2XB9A 1SM4A 1AYN1 4LKDA 3I4CA 1GPWB 2FZ5A 3D7SA 1A9YA 5BWBA 2VHUA 1AVTA 3BB3A 3WDXA 2RHTA 3Q41A 3PR3A 1NI4B 4MVJH 4QKFA 1QFSA 1OZHA 3ML1A 4A0SA 4GICA 4B85A 3R9XA 1T6NA 2GPYA 4YP0A 1ML3A 4ZYLA 1I2ZA 1N2GA 1YC2A 2MPFA 1MVOA 2X5IC 3QVKA 4OU5A 1K6MA 3MELA 3I34X 4RHFA 2XKBA 4A3ZA 4MV5A 1AQLA 3AHFA 2V5DA 5HS4A 1UJ4A 1AURA 2IXFA 3WD5A 2OQ6A 3QBTA 3HCPA 4EW3A 3SBOA 1OGIA 4OHVA 3QE4A 4PZZA 3JQPA 4XXPA 3ZLBA 1NQWA 4GL4A 2XHKA 1HLGA 4R0MA 3QXHA 4XPIA 3WSTA 3I8XA 5A3NA 3RFVA 1E1DA 3NUGA 1MC8A 4IZIA 3JUUA 1G2QA 2AZXA 2WKKA 3JD4A 1VBFA 2E48A 3GT4A 3LGAA 4PG4A 5LB6A 4QDQA 4JCOA 4GB33 4S1NA 4BB9A 1HFKA 4UHBA 1EV11 4G0OA 2PU7A 5FO8B 2VBIA 1R8SA 2JFFA 3CNLA 1QGUB 4BRSA 3Q3IA 2QZPA 3AV0B 5FPZA 3DC7A 5JARA 3SQNA 4NZMA 2VOVA 1HK7A 3TINA 3KXKA 3AF4A 3HDGA 5IN4A 4QYIB 4IEFB 4FOTA 4QX6A 3NCTA 2FN4A 1EE9A 1QWSA 3WLAA 1T9AA 1EYZA 2Y1XA 3AL6A 3OMLA 4RZIA 1CERA 4YDHB 3B1JA 3GZEA 1DZQA 4LZOA 2PEZA 1SULA 3GFPA 4XM1A 1U9YA 1NF9A 2QN2A 3MS2A 2YZMA 1ILEA 2BV3A 3PX3A 3QITA 4ZI3A 2G4LA 2W6OA 1G7TA 1XYVA 1R0SA 2XL9A 3TUIC 3H18A 1C5HA 2PZBA 5C8CC 5LQDA 2LM3A 4V3CA 3H9CA 2RD2A 3H9JA 4C8DA 3PGMA 3TLCA 3C6ZA 4QBHA 1FSGA 2C5SA 4C04A 1UKAA 1DLCA 1DC5A 1NA1C 2W00A 1Y1KE 1E6KA 2OHOA 4RK5A 1E6EA 3N8HA 4CV1A 1BFDA 3V55A 2JJ2A 2Z2XA 2GLXA 3E4DA 3IMGA 2B42B 4OQDA 2BDEA 4DV7B 1U2GA 4JVOA 1Q77A 2GPTA 3ZXEA 2YFYA 1P2TA 1RTKA 1LBHA 2YVUA 4DLPA 4NY1A 3AKDA 4A9AA 3PP8A 5K20A 1VZ2A 3WDWA 2OAEA 2DAPA 3LCCA 4IE0A 5HXMA 3B3QA 4WCFC 4DYVA 1ICEA 1KJIA 2JLCA 1GV1A 3WBKA 4ZQEA 1PL6A 2G5CA 3X2EA 2PGIA 2XAUA 5L45A 2ZROA 1UKZA 2H0RA 3RB8A 4ZMRA 1I4EB 3SHFA 4BLQA 4TMWA 5JPNB 1A8PA 2ISQA 4C30A 3LSTA 2DFPA 4IH9A 4X20A 2P6PA 1VMHA 1M8JA 5TQ0A 3B7GA 2P7HA 4D3YA 2VP5A 4UUNA 4ZVQA 4EYOA 1Y7IA 1RP1A 1Q8QA 1PO13 2Q4RA 3Q87B 4W6YA 4CU6A 4XOUA 4OP1A 3USSA 4NG4A 3B1FA 2CB9A 2V0GA 4E30A 3W20A 2A0KA 4RWZA 1P4AA 2WJ4A 2FHRA 3ZZ1A 1IIRA 4ZTBA 5I8SA 8ATCA 3PGLA 3N5CA 3TI7A 1DCKA 4Y2PA 3COPA 9LDBA 4HEA6 3AVUA 1MVEA 4B5KA 4EJSA 4MV6A 4MVJI 2WMDA 1RYFA 1USWA 1VQ1A 4M0LA 4GEKA 2AK3A 1M8KA 2E4XA 3IHWA 3T52A 3ZIAD 1LBQA 3TSAA 3WL7A 3ECSA 4P84A 4CDNA 1XQXA 3KE9A 1W6QB 4J4HA 2JANA 1XVLA 3G2QA 1G6HA 4B9EA 1IEQA 2J08A 5KQPA 1GGFA 1ZHHA 5HWSA 1PFKA 4O7XA 4PLPA 3PDQA 5IFLA 2AI2A 2UXBB 3U26A 2PBRA 1NCRC 3N2LA 1NKVA 4HMOA 2D3WA 4L0PA 5LU8A 4EO9A 2Z2SB 1FNYA 1T3SA 4FPLA 1IUNA 4US2R 1ZGAA 3N4MA 4J1NA 3HR8A 1A9RA 4F4UA 4O2AF 3W6UA 3ESXA 5ACA2 2RH4A 4GLBA 4YVSA 4Y6SA 4ZPIA 1UF2C 1H8TA 1FFGA 2QN9A 4A7PA 3RWNA 4GJYA 1QG2A 4ZMBA 5LBBA 2JE8A 8LDHA 1JH9A 4CODB 2WAAA 2XKOA 4R1MA 4ENSA 2MEV1 2I1VB 4LYEA 2OD9A 3KS9A 3Q6IA 2PSHA 2O14A 2E5FA 1YFJA 4BKPA 1Z7EA 1RZ3A 5JXWA 5LEJA 4JHTA 5CFDC 5J2TB 1HJGA 2VVEA 1QR2A 1Y9QA 4Q0UA 4MUBA 3IAHA 5DXFA 2VUIB 3OFKA 4AY4A 2HWE3 1U0TA 5FTTC 1RWBA 3WO1A 2DB3A 4CYDA 1DLLA 2CLLB 5KWSA 1OT3A 1O5LA 3KV4A 4DDHA 4LRYA 3P0RA 1BE0A 5LYYA 2H1SA 4PYIA 2VAPA 3NGLA 3U80A 1E3DA 2ZSBA 1SIOA 1PT8A 3RQSA 5CT9A 2XUJA 1FVXA 2GH2A 2VYFA 1E8MA 2VW0A 1GNRA 1CY4A 3AZQA 4A7YA 3LBNA 3DD5A 1POV3 2YC4A 4Z07A 4BIFA 4AJNA 1JWAB 2VAXA 3C74A 4NR0A 1L5VA 4YUVA 1KBQA 4NOKA 3ILXA 4NCIA 1PZEA 3HKEA 3BVCA 3ZDFA 5J98B 4C0AC 1Z2AA 3VR0A 1M72A 3OURA 5IATA 2QR5A 2XMSA 5F2EA 1EMDA 2HWYA 3CKYA 1Z8HA 4EMTA 4XVHA 3DP9A 2RMKA 1UFKA 4BWGA 3LWNA 1YJLA 4GP7A 3D4OA 3DMGA 3VBOB 4LNUA 2BUKA 3OQJA 1V3TA 3DTVB 3EVGA 5C8YB 1M1YB 4Y6LA 3KSBC 2GHIA 1KEEA 3MIGA 4WVLA 5EIOA 2GD2A 1KI6B 4OO3A 3AZWA 1GRNA 2FR0A 2WSUA 3E7DA 1WY7A 1GPKA 5IKMA 1W4BA 3LPDA 1YA6A 5FYVA 3THYB 3LUKA 1Q0TA 3DHWC 5BYJA 1GN9A 2VXJA 2BVBA 2W2IA 3KVYA 2Y4NA 2W98A 1JEOA 1AQJA 2FUEA 2JCYA 3ORYA 2KYRA 4NU5A 1R7RA 1UWKA 2JJMA 4MZUA 4WN9A 4QDUA 4BNDB 1H0KA 4QJ3A 2BL4A 4H1UA 1QP4A 1J0XO 1TU4A 1T9GR 1IAVA 3V8RA 3IP7A 1EVJA 3PHHA 4M0MA 4EG5A 1MX3A 1XCMA 1VBB3 2AUNA 4J1TA 4CYMA 1FPN3 5DM2A 1W0NA 3OTOB 4Q5IA 3MT0A 3BXHA 3I1IA 2P4QA 4N53C 4ZV9A 5HJEA 3ELUA 3IESA 2PXAA 3ETJA 2ZEYA 5G05L 4ASMB 2BFBA 4N40A 2IYOA 3WCRA 1HLCA 2CWDA 1VBE2 4CCNA 1A9ZA 4HQ6A 4BVEA 5DNUA 1V96A 3SSMA 3OOYA 4L9BA 5T6MA 1LNZA 2FZEA 3RS8A 5BW5A 2Z9BA 2PE5A 2D98A 3BWCA 4JYAB 2OGWA 4RFSA 3QPBA 1GQHA 1U0LA 3BWYA 2HWD2 2QTTA 5DRTA 3RTEA 2Q5EA 1GU0A 4RHV3 1X36A 1UL9A 3OFVA 2NUBA 3N2GA 2WNUC 5ARDA 3HVHA 4NDAA 4DCMA 5C5IA 1REFA 4KAAA 4XIKA 3A6EA 5KYWB 4F5EA 2JW5A 5JPIA 2V7QA 4LHXA 1SFYA 5C7OO 2DY1A 4HKLA 2VHCA 2AW3A 5KWRA 1S2GA 1TME1 3THWB 4PNHA 1IQRA 2YNMD 2ZS9A 3I5XA 1XQVA 4W5QA 1VGVA 5JBQA 4JX9A 5C4GB 2A1UB 2GH1A 4A26A 1FP7A 1DEHA 2UYOA 1MQ9A 1YO6A 5EMLA 1NPTO 2DYKA 2PRJA 3NBUA 1SZBA 3C5CA 4B0OA 3K51A 4HX2A 1P3DA 3M3PA 1JTZX 5IUQA 1UZYA 1ZXXA 1H2ZA 4I2OA 2ZBJA 3KV6A 3DJFA 4RTQA 3RAGA 2ORIA 4CUCA 4TS3A 4GBED 1GGMA 2VT7A 1EUCA 3IP3A 1F1BA 4F4FA 4RSUA 4G23A 3W1VA 1NW8A 3D4PA 1YZQA 2HLEA 4JLJA 4DUVA 4C21A 1FMD1 5FXWA 3NALA 4P98A 3BA6A 1SEFA 1MAHA 4EX6A 3V2UA 2GNOA 1WLCA 1G20B 4XFDA 3UUWA 3TBDA 5EPEA 5CH5A 2G9UA 4OFGA 3R0IA 2YMMA 4JDUA 5J09A 3AHCA 4XC9A 4HYYA 1ESCA 2WNVB 4EO4A 4DLTA 2XYQA 3LDKA 3OY8B 3ZK8A 5FPSA 5C5TA 1UKRA 2OFPA 3N70A 3L6DA 1XKTA 3HVJA 4BMPB 1XEXA 2GVNA 2IH2A 3B5JA 1E4OA 3DFFA 3Q3GE 3KYIB 3PTZA 2ZAGA 3FH0A 3I2JA 5H68A 3QU2A 2P6OA 4BBPA 1E6LA 1K06A 2CFSA 2JB8A 5JNLA 1YIAA 3EK2A 2MYTA 1BGVA 2ODBA 5IDYA 3D4KA 1M1NB 3QELB 1KZ4A 3VR5A 3D6EA 2D62A 4A1FA 1PKEA 4NAHA 3Q5GA 1H1LB 2YPDA 5K3BA 1FVHA 4XARA 4FYIA 4PR0A 1UM8A 1COV2 4EGJA 1Q0ZA 3DT9A 2H6BA 3D7NA 4NYIQ 3EFOB 1JOJA 5FYCA 2D06A 3JWPA 2X10A 1WLDA 1QU3A 2WUEA 4C7OA 5E1BA 1UBUS 3FYUC 3F95A 2B78A 4F7ZA 1K8YB 1E0SA 3LM8A 4GSKA 2JLAA 3ZCXA 4XWOA 2YV3A 4R7GA 5FPXA 3N3HA 2KWIA 1DQ6A 1K9VF 2B82A 4TMXA 4KP7A 2C84A 2ZEWA 3CNOA 5EIXA 3OGJA 3IP5A 4HLNA 3GC6A 5A70A 4DXZA 4KGVA 2OK8A 4DRRA 1GDHA 4OXRA 3FGOA 5E9JA 3SM9A 3NL1A 3V33A 2BM0A 4RZ2A 3O03A 2QTBA 2DPYA 4V02A 3SBDA 2AG0A 5BXXA 2VMIA 1V7CA 1B93A 3RSOA 1NKSA 1P81A 4UVGA 4CSWA 3TSCA 2ZETA 4UM5A 3IO5A 1KP2A 4NOLA 3B9QA 2IP2A 2VNKA 1VIYA 4HYQA 2WNEA 4FKZA 1SOUA 5FL7D 1L1QA 4PIVA 3RVOA 4P53A 4YZ2A 5KNCH 1XZQA 3OJXA 4NBKA 2X9GA 1AGXA 4RELA 1UK7A 3FR7A 2E0IA 1VJ5A 1CQPA 4BLIA 1GZ3A 1QH0A 1YUMA 5TQJA 4WW0A 1SZJG 2PZAA 5B2EA 4XDPA 4W1SA 5K2MA 5E4JA 4YQFA 1WHSA 1UO9A 5AC92 3CZ4A 1OH7A 4CUAA 1JFFA 1W9SA 4R83A 1GZDA 2XVGA 3DLBA 1HYGA 2I7TA 3AUKA 3W5NA 2X0KA 3TOCA 5ITSA 4E4SA 1YS2X 4KWCA 4WVWA 3BGVA 3FBMA 2P9TA 3ZE1B 1M1UA 4G81A 4G5XA 1HQCA 5CA0B 4HVAA 1J56A 1RLIA 1PU2A 2FTKE 1P0CA 2GDFA 5FMBA 1ST8A 5HE8A 1BBT2 5EQUA 5GPBA 2W2XA 3KSAC 5EN4A 3FCEA 4A6EA 4B4RA 2V59A 4N76A 2QLLA 2BMAA 3KVAA 4Q8LA 2Q8OA 1O0SA 4X63A 1E1QA 4ZANA 5KAPA 4YDQA 1SLBA 3OKFA 4I9FA 2JLUA 5DDJ3 5F12A 2AKAB 2ZBPA 3TIXB 3DZJA 5EUMA 5I8YA 1NY72 3B7PA 4UCQA 4IIFA 2B5WA 2YBSA 1C57A 3AERB 1DIRA 2JLXA 3REGA 5IDQA 4UULA 2F55A 2CNNA 1G8YA 2VBPA 1FA9A 2J41A 4PSAA 1ZISA 2BI4A 4ER7A 4IE7A 3AFIA 4FJ0A 1IQDC 2BHRA 3KDSE 5I8ZA 1LCIA 4ARUA 4XDOA 5M3BA 3T3EA 2C9DA 4Y1VA 3CQ9A 1R8QA 2WC1A 2RGWA 4AI2A 1ORHA 2WJIA 5AW3A 4HFNA 2C96A 1E2KA 2R042 4GB31 5FWDA 3VBHA 2HMTA 3EEBA 1IQUA 1ENOA 3OD1A 3JALB 1WB9A 2Z8XA 3SF0A 2V58A 1UPBA 2JDUA 2VCHA 2PUJA 1QIQA 3ZYPA 2WUGA 4NJEB 1PI3A 1YZYA 5HCAA 5JSQA 1BKZA 4W63A 2MTBA 2R6GA 3X1WA 5GZGA 2GO1A 1AMNA 3CKKA 2IYEA 2PBFA 1OIWA 4HAUA 1GFSA 1N9ZA 3VBUA 4CUBA 4FXPA 1JI0A 1SZDA 3HFSA 4BCCA 3O1MA 4W5TA 2XCTB 5EXPA 3QSYA 4PFKA 3MLEA 3HJFA 1JLSA 3JQFA 1TFRA 2G71A 1DKMA 1UXKA 1BVVA 1TNFA 4D3SA 1CYDA 1FB5A 1GKUB 3IQEA 5FX2A 3CTPA 4EG0A 5JHGB 1SXIA 2Q5TA 4ID3A 2IDKA 1J0EA 2IYVA 2GK6A 4OAOA 4Z1MD 5AOCA 2BEUA 3QIVA 3RVBA 4KR3A 2C4UA 1NAIA 3E7XA 5E4YA 3ZY4A 2R25B 1RZUA 5B36A 5EHIA 1H8HD 3IIEA 4TYMA 4MMXB 2E51A 1GZ6A 1IXSB 2W8BB 1OA1A 1OBCA 1RXFA 2GDJA 1O97D 4AF9A 4D4HA 3P9CA 4CP9B 2Q3HA 2D6NA 4PTLA 8GPBA 4A27A 3GA7A 4DM4A 1RRCA 2HD4A 4D0SA 2W2PA 4TMYA 3PQ3A 3HN6A 1CWPA 4QQNA 5ALRA 1DJLA 5CX4A 1NATA 5CCXA 4X6UA 2HIGA 2RHLA 1Z4OA 4Y2JA 1NT0A 4ISCA 3R0ZA 3M9WA 1P2FA 4HTFA 4NIGA 3USZA 1PFYA 5DISB 1A2OA 1PJRA 1IWBB 3K53A 3U10A 3N7KA 1R00A 2HI0A 3O2JA 3AXSA 5K3CA 1HSOA 5IAJA 3I8TA 2JLYA 5FK7A 1AV7A 3QKRA 1I4WA 2XJ9A 4FPGA 1FT9A 4JLUA 3MDPA 3W5SA 1XQ9A 4EUKA 2NP6A 1RCUA 1J23A 2I71A 2D5IA 1RUD1 4P7JA 3JQAD 3PVBB 2DQYA 3SHWA 5G02A 4PICA 5SV5A 4TZKA 4GQBA 1D1QA 4LO5B 3T7DA 4ZO4A 3SLGA 2E1RA 4AVCA 4UPVA 3UKNA 4KQIA 1U5IA 4IJUA 3AL2A 1PK6A 1XYNA 2IUFA 4JB0A 5FPTA 1QCYA 4EOGA 4U7FA 1AJKA 4LIVA 3Q9UA 3M2PA 4HS9A 3AEKA 1K5HA 3JS5A 3RMXA 2QG4A 2PHLA 4RD3A 2RH8A 2YDYA 5DM70 3O9VA 2Q3EA 3N8DA 4OP3A 2XMZA 1GLHA 1U31A 3RYHB 4ETNA 4D80A 5DNCA 1I3HA 1OFVA 4MUHA 3DDOA 2NM1A 4ITCA 3HVIA 2FMTA 1SLIA 5JJBA 1WY5A 2B4KA 5BWCA 5B58T 4PV7A 2G08A 1G3MA 3TQRA 3GZTB 3ACDA 3K1TA 5IJ0B 1WCKA 2F59A 4BNXA 3A27A 1TM4E 3K0CC 4Q4Y2 3NWOA 3ZS8A 4TMZA 4YM2A 4I50A 3MOSA 1NE4A 1SLTA 2WRZA 3GLGE 3OTGA 3MFAA 1UBMS 1VRBA 4OSPA 4BRUA 2I03A 4IQ8A 1X9HA 2P5TB 3LFHA 3QU9A 2QR3A 3CF4G 1CLUA 4O08A 2NIPA 1GZWB 3MT8A 4Q9JA 2ZR9A 3C98A 4HAZA 4RK6A 2PL1A 4ZQIA 4ATFA 1FTSA 1MR5A 3HBZA 4Y5TA 3UJ6A 3O21A 4QZVA 1SN7A 5KSPA 1K7XB 4JC0A 5KYNA 5CLIA 4GOLD 3NQHA 1FDIA 1E1RA 3AB7A 5KC9A 2JGAA 2GM4A 4L2IB 2C1XA 2FG5A 1VYHA 4NMLA 5COBA 3FUTA 3UYLA 1KZ9A 3EHKA 2X1MA 1B6GA 4RTKA 3HXPA 2F62A 4D56A 1ZN9A 4FDMA 2HWWA 3RFUA 1EVKA 3I6ZA 5JSOA 2K0GA 5LQAA 1WHSB 5DZEA 3O82A 2WFF2 4B34A 2Q6IA 5J59A 2BUAA 1CEXA 5L4NA 2ZGUA 3IT2A 3CZ9A 2AR6A 1PFVA 4QQLA 2G80A 5DIZA 4FAGA 4AQ7A 3DEMA 1CPYA 3GDHA 1J1TA 2I07B 1ZMOA 4D44A 2IOFA 3FSGD 5D8AA 1ZHFA 3OKCA 3WGJA 3PNKA 3HL0A 3KZCA 2NAFA 2I7VA 3QE0A 2ZAMA 4KYTA 5AW9A 2PO5A 1NVFA 2PUWA 1N2HA 2BFAA 2P9BA 1IM8A 2OUHA 4LV5B 4BNKA 1MO6A 3AFNA 4PC6A 1VBA1 2JBWA 3WLHA 1OMOA 1Q95A 5GJ6A 4OCZA 3LLMA 4N5LA 2GM3A 3Q7PA 4XCQA 4ZOLA 1UY3A 1E9CA 2AHOA 3E48A 3AMVA 4ADSG 4G63A 2PHRA 1E2DA 5EZ6B 5BNZA 1VB2A 3C7AA 3D64A 4I46A 5FAXA 4HFSA 3EIFA 3VTFA 3HTXA 2P9HA 4XMAA 3M7AA 4JL8A 3EIWA 3ZXDA 1REQA 5HRAA 2Q7XA 3E3AA 1NJ6A 2JFGA 3Q0TA 4RMGA 1RWPA 2WWRA 4WV3A 3DFIA 2IH5A 3JWEA 4OHKA 2QTMA 4EZIA 4CKWA 1ORRA 4ZS3A 1P4RA 1OBOA 3WY9A 1Y3HA 3WVJA 4QBIA 2J3LA 1KO1A 5A0FA 3C7DB 1XRRA 1PBNA 1QIEA 2N47A 1ZM4A 1DU3D 3CLRC 1HOXA 2IYNA 1NF3A 4D9NA 3BMOB 3IE2A 1NCRA 1N77A 2O3JA 4YTEA 2X0IA 3H8WA 5DYNA 4ACBA 5TNXA 4E3WA 3DWIA 1PGQA 1T3TA 3OZRA 4RJIA 2AS0A 4QGBA 5KTRA 4Z4IA 3WF4A 4FLFA 2UZ4A 1HYQA 3CG0A 4YCCA 4PIPA 4Q19A 2IZ5A 1YRAA 5CP8A 3DDNA 3TLKA 3WW3A 3L3BA 3WGTA 4V2WA 3K48A 4M3CB 4P8RA 3ZYJB 1OZFA 2FYTA 2LDBA 3OJ0A 2BVNA 2VDQB 3DWEX 2WA3A 2EQAA 4TWIA 3WA7A 2N75A 5GLWA 2QHXA 4UCXA 3KS7A 3DCNA 5FJHA 3PSAA 4H6XA 4NFSA 5ILQA 3QKSA 1ACLA 4WZZA 2IPAB 4FOQA 2GYYA 3WWYA 3GG2A 3J26N 1G9XA 3CZMA 3ED1A 4LGMA 4JJFA 3SN6A 5EQDA 3MAGA 4HG2A 3VNQA 1RM0A 3OJCA 3UJDA 5EWLB 1DEOA 1SCIA 1TE1B 1SC9A 3ESBA 3MRTA 5KKCA 5KQGA 1VB5A 3T2QA 4NMMA 3DOUA 3ZIWA 3NIWA 2ZI9A 4O4LF 1T8YA 3T1TA 1L9KA 3GEEA 2ZX0A 4N54A 3MUZ1 1KFUL 1YQ9A 3OWOA 4P0PB 1ULTA 2ZXFA 3JAMA 4AG6A 3SVZA 4JHZA 1QH9A 1TF5A 3OJFA 2EJTA 1L5FA 5BQ3A 1J70A 1FYFA 4O65A 3J8F3 4I1SA 1SELA 3NP9A 1ZUNA 4D2IA 1ID8A 2HWF3 3KSUA 3JAWB 2XR4A 3U6BA 1ZZ9A 3D5QA 5IT9A 1JYIA 3QUCA 5JCXA 3EIOA 2HHAA 1JE1A 2QD1A 3UXYA 3CRVA 1H2BA 1A4RA 3ONDA 4M7RA 5DYWA 4DNXA 3ZV7A 3MERA 3L06A 4CI0B 2CBGA 2ZVPX 3H2ZA 1WBDA 4HTFB 3HVRA 1M7HA 5AJVB 3AK4A 1TKBA 5H16A 2QVZX 4X61A 1X8EA 2GTPA 3HYSA 3TNLA 5JDBA 4MV2A 4LMPA 1GPYA 1K8RA 5E6SA 2ZHNA 3C8DA 4Y7DA 1I7PA 5DYIA 2QLBA 2RBEA 1IU9A 1ZREA 2FBEA 2WFF1 4J2TA 4NAVA 2PS0A 4BNGA 4TKLA 1V16B 2QR2A 4NESA 4EW6A 3ODPA 1HGXA 3VDDB 1QPBA 2HW8A 4R7ZA 4A91A 1WUVA 1FE8A 5KINB 5CTJA 2JLSA 3BRQA 4HX9A 3E8SA 4IP0A 5JR3A 1MA3A 4FPJA 3T34A 4M1OA 4HH1A 1USUA 3LQQA 1I33A 4EFMA 5BN4B 4Z9AA 2Q7DA 4P83A 2Z58A 1GICA 3VHNA 3GFTA 3NV7A 1HBJA 1FYDA 5CFLA 3LQ4A 1QKJA 1U12A 3K1AA 4HSLA 1IXZA 5FZOB 1C8KA 2WSMA 2I1QA 2HU8A 2P3IA 1DMRA 1QRSA 2CXPA 3W7BA 3LC2O 1BHGA 2JDIA 5A06A 2A7AA 1EQUA 5REQA 1U28C 1F38A 3K9NA 1NNLA 3MMPA 4AZZA 2P8SA 1RMU1 4U7WA 1TQDA 5AK4A 4R8LA 1K3TA 3PFNA 4FB5A 5LBUA 4A10A 2ADDA 1Z2DA 4ZRNA 2DVAA 3FLTA 2IF2A 4NZZA 4AKSA 3DBLB 3LT1A 3LQKA 2FZ4A 2OPKA 3M70A 3TQQA 1C29B 5HIJA 1O8SA 2DCUA 2CXQA 2HJSA 1P18A 1SNYA 2O19A 4J0CA 2BW8A 1ECCA 2PH7A 1DJOA 2X5NA 1UBNA 1D2QA 1VCMA 9ABPA 3G8BA 1ZVJA 2I4MA 4YT5A 4H7DA 1YOVA 4ZT6A 1T29A 4RVNA 1SKBA 4XYLA 4WOBA 2PKEA 3M1HA 4B2PA 1F2VA 3U4HA 5KC5A 3BDIA 4G5QA 1GGJA 1CX1A 3U3JA 4OHZA 2H92A 2WT4A 4G0MA 4AEDC 1Y7PA 4Q29A 3IEPA 3EZXA 1UADA 1R9MA 2VH5R 4JT2A 4IDZA 2ZP1A 3LT4A 3GZNA 3ZHQA 2RJ3A 4HDQB 3GLFE 3E4CA 5CCEA 3N7JA 1PZMA 3A06A 4INZA 5CA1B 4DLSA 2JAUA 1MC5A 1T8TA 3AR2A 2WWVD 4LYDA 4C0SA 3A36A 2EEZA 2IW3A 2VP9A 3AZOA 2YXNA 2EIXA 1LPPA 1UOQA 4YRFA 3ORRA 3AM2A 3G82C 5C3QA 5HPOA 1H3NA 2ET6A 3ROTA 4EUNA 1PEAA 1RHJA 2GZ1A 1H6DA 2XRYA 2JFUA 1JSCA 2C7BA 4B43A 2Z5GA 3H2JA 4NS1A 1KC3A 1NW4A 2XNSA 3KPJA 1PT9A 3E03A 2ZSDA 3HNOA 1ZNQO 1JHUA 3KEGA 4N9HA 3D9QX 4UHKA 4AI3A 1NQTA 2R7MA 5KIAA 2JS7A 3D7LA 2P9ZA 3IBSA 3DE4X 1USVA 2P9FA 1DZ3A 4JSRA 4D3FA 1PW5A 3DV0B 4AJEA 4E2ZA 3FMOB 3SYMA 3O3CA 3S4YA 4MLCA 4QULA 1IS3A 4OQXA 3EIUA 2A0UA 2C5BA 4L3WA 5HM8A 4HSEA 2FCVA 3VKOA 1O95A 1L3JA 2K2WA 5K9YA 1NVXQ 4TYWA 1JFTA 1RMTA 1AX2A 4QGSA 1AK2A 3CONA 2P41A 4FONA 5BN5B 5BYAA 5J3JA 1LENA 2F67A 1N6OA 1JEAA 4IFIA 3BWDD 3PRJA 3EIEA 4KRFA 2LUOA 2AR9A 2QORA 3WL6A 2GMMA 1WMBA 1GYRA 4N5MA 1I3CA 2JI7A 3ZFGB 4KO4S 2A9PA 1KJYA 1KS5A 2NVOA 3FAZA 3FSEA 3IHLA 5CB8A 4UPDA 2R97A 3GLHA 2FGJA 3HJGA 4J0KA 3FOFC 1ULDA 3F5DA 5KTMA 3BN3A 2B46X 3BX1A 1EXMA 3OIGA 2P91A 3HU3A 3FZEA 4PYOA 4JCCA 4ML3A 1NG1A 2ZU6A 3V56A 1UDAA 2FZGA 2UU9B 1O7FA 4KFUA 5KTTA 2C42A 3USUB 4MUFA 3NHMA 3FE2A 1HORA 4E13A 2ZDQA 4RTMA 3KQQA 4X1OA 4IUYA 2VK1A 5T5PA 1TUGA 1RI3A 1RJ8A 1L5MA 2F00A 2Y0OA 1KDPA 4FNGA 3EF1A 4DADA 3HZRA 4QAQA 4CCAA 5JAIA 1TTTA 2BJSA 2QL7A 3ABZA 3LFIA 2BTOA 4YI3A 1B14A 2ETVA 4IDPA 2FPKA 4O02B 3M3OA 2VQFB 1E66A 1QVRA 1WL8A 3P27A 4BX2A 2YC0A 1R8JA 4KNCA 3USES 4OLLA 1KQGA 4LXTA 1BBT3 5TS3A 2PLV2 1TYEB 1KTVA 1Z17A 1PVOA 3DNMA 4NUBA 4IYJA 3N5KA 2P27A 5CITA 4ZQCB 2D0OB 3KKMA 4DR3B 1IEVA 2CVPA 4YJGA 2FH5B 3T30A 3ZIXA 3GOQA 1IHUA 3B20A 1IUKA 3HDVA 4HZUA 3ELYA 1IPSA 4EDFA 2O5VA 1VP9A 5LP6C 3FTDA 1D9ZA 5G4KB 3GVHA 5KJ6A 3OSZA 1ND2C 2H1FA 3V7UA 1KS9A 2IUUA 1H3FA 2B37A 1YZFA 1EX7A 1FFWA 1JG2A 2WBKA 3B6JA 3NSTA 1N9KA 2UVDA 1GPLA 3SH3A 3MPUA 3GP3A 1ZA4A 1ZNPA 3DBOB 3B1ZA 4XLLA 4DA4A 5FUMA 1RQLA 2CLEB 5M2QA 1ND2B 3Q15C 2G0TA 1F35A 5GGXA 4OF4A 5IRCD 1QAOA 4OMCA 4Q0PA 3SSAA 1PLLA 4ZI5A 2B8WA 4EI9A 4DR1B 1W6UA 3AU8A 1XDDA 1F4PA 1G8FA 4A3XA 1H1LA 5CAEB 2HGZA 4UVHA 1T2NA 4FP2A 4CDGA 2PGDA 3NMBA 5EJ8A 2VH2A 1U5ZA 4QWWA 1VBMA 3G49A 3UEOA 4BFLA 2QM0A 1RYHA 4PG8A 4K3VA 3LT2A 3O7OA 2W5UA 2Y9MB 1JLLA 3OIVA 4U2FA 1TRHA 2V7GA 4KSCA 4P5HA 2EJCA 3THPA 4WCFB 1O97C 2XUAA 4LJ4A 3BVPA 2P5UA 5C5CA 1OD5A 2F4NA 1WSDA 4YPOA 3OUTA 3OIWA 3PNPA 1GCIA 2W83A 3A9VA 4LY9A 3L8MA 1OFIA 2IHUA 3FFAA 4QKNA 1OFUX 2BGWA 3TAYA 3M3IA 4TWRA 4MVJP 1L5GB 2AE1A 3FD8A 1FTGA 3HJHA 1OYYA 4HN4B 4EWEA 4YP7A 3PJYA 5IK7A 5EYPA 1Z8FA 1S0CA 1K2WA 1R4AA 3HLKA 2VTKA 3GN2A 2YG0A 3DBLA 3NHJA 2V98A 3ZD8A 1HYBA 5IDWA 1YK1A 1T2EA 3WLNA 5IKXA 4HAYA 4PCRA 1AR83 1WDTA 4L4YA 4QOIA 5KO2A 1S7CA 1TU3A 2CVHA 1ZZ8A 4FN4A 3K9HA 4O3FA 3TDMA 3ETLA 2W4MA 1OXMA 1DBQA 5KNCA 5IM4A 4M87A 1WBJB 3EYPA 1NBEA 4XF1A 3JAKA 4M88A 1AR72 3VBFA 4KMOA 3RTGA 3NTVA 1OCEA 4JI5B 1M34A 2JH8A 3GJ7A 4IO0A 3T5AA 4RA9B 2PLNA 1KMIY 4D7YA 4Y1EA 2J1VA 5CNKA 5AOBA 1P5ZB 3AC0A 2Z2KA 4TYSA 1E64A 4CDXA 3CZRA 3D8SA 1GOTA 2H52A 4ENQA 1JQ3A 1MV5A 4AKTA 2VCYA 1QMPA 1UBOS 4JGYB 4WM8C 3O8OA 3BTXA 1SDDB 5LZ2A 3KXDA 3L8GA 5HOEA 4INJA 5BVGB 1FSPA 4DV3B 1Q5OA 1QZUA 3UKVA 4OHFA 4TRMA 4I5DA 2E2WA 3ZDBA 3LPMA 2F3TA 5A33B 5AW1A 1MOPA 2H4YA 2X2PA 1MIHA 3V9PA 3K94A 2QX6A 1JHJA 1MQTA 1TJ3A 3GHMA 4NENB 2V54A 3NP7A 3HO6A 5EWMA 5F9MA 3CJIA 4Z54A 1FSZA 4GNKA 2HIMA 1T25A 1CUBA 3B9IA 4PIZA 4LF7B 5JSRA 2HSGA 1F7VA 2OA2A 4J7XA 1MEC1 5TT0A 2Z8ZA 2J6CA 5JNSA 1M83A 4XCVA 2XQRA 4R9CA 1C4RA 4AMYA 3RJZA 2VHYA 2YROA 2WK1A 1OD6A 2PT7A 3ZVMA 5CDUA 5AOAA 3C4VA 4X5OA 3I61A 1DPFA 4CCDA 4TTQA 3R44A 1J0CA 4KO3S 4ZO8A 1W0JA 4JR1A 3F8WA 2QT1A 2XDQB 1ZXBA 3BDVA 2A58A 5AXBA 2VP4A 4G1MB 3T1YB 4DE5A 5HZKA 4RHV2 4MWTA 4PPNA 1V70A 3AUAA 5PGMA 5F2KA 1B0PA 1THZA 4BVGA 2WM9B 4G1FA 2XAAA 1U63A 4D8VA 4JXJA 4XI9A 2P69A 4EI2A 3L6EA 3Q3EA 1WA5A 2OFOA 5CHEA 3ZSKA 1NXD1 4EHAA 1XTSA 2AOXA 3LLUA 2GXSA 3VBUB 2JENA 4XF0A 1BJKA 3QM1A 2ZGMA 2R48A 3E15A 3GJYA 1U1CA 2HWD1 1NDQA 3P0FA 2UZ1B 3OCPA 3WF2A 1OBNA 2FN7A 2CJWB 1SD5A 4OH1A 4B3JA 5FTJA 2R4TA 4PHFA 3L6UA 2OKGA 1GO2A 1QNLA 1WETA 2O1XA 1JPNA 3TXAA 1SACA 4BC0A 3U7GA 5HRUA 5BPXA 3W34A 2I2SA 3K0CA 2JXAA 4CLDA 1YQWA 2WF5A 5JR2A 3D8HA 2JFVA 2PYIA 4COWA 3TTXA 2ARKA 2AHRA 4YN3A 4RPIA 5F3RA 3RWBA 1RC0A 1EKXA 4XVCA 1GOFA 4ZT4A 1X38A 4OFXA 2J6IA 5EJ2A 1IEXA 2BMFA 2X8KA 1V11A 1X7WA 4JVAA 3RG0A 1ZLXA 2HF2A 5D6OA 4EITA 4EE2A 5HKAA 1YI9A 4RGYA 1XN4A 4YBZA 2ZUTA 3BH0A 2VDWA 1E96A 1BX1A 4YAFA 3VNVA 4GB32 2R041 2EWWA 1X39A 1A6CA 3PFBA 4GW3A 1ATZA 4Q6BA 2P3OA 2GYWA 4LBMA 3NYRA 3O1JC 4UBHA 2FHSA 2GEBA 5ICGA 1JAZA 4HJXA 2JFHA 3KLNA 1BG6A 3I3DA 1TGVA 2X0NA 3M3EA 3SXPA 4CTNA 4I4TB 5KYVA 3MSXA 3QBDA 4Z51A 2AJBA 2BFOA 4R05A 3KC2A 2OMKA 5D1NA 3F3MA 2AUTA 2Y68A 4CDWA 3ZXYA 3B6ZA 1CEQA 2VNIA 2X13A 4I3FA 4NONA 5FOJB 4RQTA 2Z2JA 5F1PA 2ZRDA 3U78A 2J46A 2NO7A 5L9AA 3P9YA 3CEWA 3F73A 3U44A 5CK4A 4DARA 5FP0A 5F2WA 3OZDA 3QNMA 3E0QA 2HWF1 5B1YA 2X5IB 2XMDA 5DNYB 3OUUA 1NVUQ 1ZN7A 1O57A 4X54A 4PDWB 1HDCA 1Z0UA 4MUMA 1P4SA 3FUVA 3IUYA 2ZVDA 5A05A 2G5PA 4TYNA 3WUDA 1KY3A 1PSWA 1M2NA 4PYQA 5H9RA 1TJNA 3KB6A 2OW4A 4RM3A 4RF2A 4EYUA 4FXGB 3QY9A 3GZJA 4JOCA 4YCBA 4WADA 2BJWA 3QV1A 5A7QA 2COUA 2PLWA 4Y1YA 4JUCA 2V55B 1F8XA 3I2YX 1RVV1 4DXDA 2NT3A 5IJ0A 4ZDWA 1Z83A 3G5MA 1IUPA 1N3PA 5IVVA 2BZDA 3WGIA 1B15A 1JJAA 4L51A 3R24A 3GLGA 3AFKA 3AVOA 2AJLI 3JWIA 2B1GA 1XJWA 2FPOA 2Y67A 4JIMA 2FPPB 3ZVXA 2GPWA 3EA4A 3AJEA 5TF4A 5JO9A 3WF0A 2FQWA 4RD4A 2ZWOA 4P9XA 1LOBA 3R3YA 3OG2A 3GZ4A 4OBWA 1LU2A 2QFEA 1VLQA 5DF1A 1W2OA 1K5MA 2AB0A 4D9EA 3T5PA 4CXXA 3POBA 3I0MA 4LRWA 3CX6A 1JRLA 2PR2A 4NZPA 3L7IA 2QYHA 4R2MA 4UBMA 1VPEA 3SFVA 3QK7A 1Y7HA 3OU6A 2FAXA 1JTVA 1VHDA 5JI2E 4ZD6A 3VR3A 4WLVA 4B35A 5EJ9A 1JUHA 3FVWA 4ZZ5A 4P6VF 4UJ5A 3EF3A 1EXDA 3Q12A 3TR5A 4GQIA 4CQLA 3PL0A 2AN5A 4I1IA 3QBQA 4YCAA 1QOQB 4F6RB 4GOXA 2PQ0A 4XHXA 5A32B 4GX2A 5BV0A 3JYHA 2X1HA 4H3KB 2Q1UA 4BNUA 1J06A 3M83A 2DUPA 2N7GA 3CSUA 2RAFA 2B4TO 3HP4A 2FOIA 1T2AA 3O8BA 3VKFA 2J1TA 3QNUA 4B29A 4C2UA 1ENYA 4BUZA 4XTRA 1M4WA 3BZBA 3ZHYA 4JNCA 1YRLA 3BGOS 2VRCA 4LE3A 2PZMA 1T9BA 2IYZA 1Q14A 2QLTA 2UY8A 3O8OB 4D26A 4AEMA 1SC4A 2P6MA 4MRSA 4M4SA 1Z2PX 4UU8A 2QMYA 1C0IA 3E61A 5DX0A 4MR8B 3VDAA 1OA2A 3T4VA 1SK8A 4OXKA 3E5QA 2QIOA 1RTTA 2G82A 4FFLA 4PM4A 4DF3A 5C70A 1D2RA 4QLOA 5EP4A 4DT1A 5IAEA 2Y1KA 5A3QA 4GUAA 3EGWA 1VLHA 3DFZA 4BXSV 3OF3A 1COV3 4C43A 4C6TA 4IGEA 3DPRC 1JIVA 1UPUA 4GF5A 2Y0DA 4P7BA 3L6CA 1OLXB 3I6YA 2G77B 1U81A 1H8VA 5FMCA 3ZXIA 1IS6A 2R1UA 5IVKA 1M2HA 1ZNWA 3EXHB 2HTFA 1O9HA 5JAQA 5DBGA 5FY0A 1SVOA 4UXJA 1JG1A 4CVNA 2BEOA 2X7JA 3K7EA 2YZNA 3IPRA 4GPTA 4ZI2A 3QVWA 2J45A 2XITA 3BMOA 4GC5A 5CYOA 1FMD2 4XF4A 4AI1A 4EKYA 1X86B 2A94A 1NI3A 4N3AA 1YV9A 4H1HA 1TJ5A 5C9AC 1HKHA 2R4UA 1KYIA 3W04A 1DFIA 3KKLA 3DXUA 4ZZ2A 2NACA 2OGZA 2VC9A 3D31A 1ZBE1 1Q57A 2BIFA 3MOIA 3W2FA 4HWOA 5L40A 2CXTA 4L8GA 1QOSA 1ZCFA 1CUFA 3DCIA 1Y43B 4FOWA 3AUTA 5HKLA 1HDZA 5D21A 1C4KA 2XH6A 2QNRA 1RUC1 3U81A 2VLIA 3U0ZA 5J40A 5C51B 4HH0A 2G8NA 3VJMA 2HQBA 1UPAA 4CCJA 1PVVA 1QY4A 5ABJC 1X13A 1S1AA 3ZV6A 2ZS7A 3ZWYA 3CBGA 3LOIA 2SCUA 4XX0A 3OPNA 3ZSLA 1MX5A 1HXS1 4PFQA 1HA3A 2VRBA 1PNVA 3K0HA 4ENWA 1OWMA 4ENVA 4MKFA 2J3MA 2WDZA 1CPNA 1WQ1R 5CEFA 2D5FA 3MYXA 4UNQA 4EMUA 1T5SA 2O3SA 3BQ9A 3P4XA 4CU5A 1Y3AA 2FLWA 2HKXA 3DZCA 3EG9A 3KYDB 3GJZA 4KV9A 1DRUA 4MR9A 4Q0MA 4B6PA 2QUHA 1UBCA 3OQ6A 4MULA 2ZG6A 1G9SA 2O8BA 4BMSA 2G0AA 4BMXA 1ZXLA 1Q7TA 4M76B 4LQDA 5A3OA 3RODA 1OH4A 1C9DB 2OO3A 5JUVA 4TT3D 2PYZA 4FP3A 3VL9A 1W25A 2IHTA 2GHRA 1K97A 1QQ6A 3OECA 4B3RB 2B7BA 4DIMA 3AIKA 2JA1A 1NUUA 5ERGB 4NZYA 2G4CA 1UDWA 1TUBB 1W8DA 1YL5A 5A3VA 1ZK1A 4FWBA 1LLDA 2WM8A 4CMEA 4CKYA 2BGKA 4IL5A 4KAJA 3EB7A 4RL4A 1ZH8A 1IBKB 1LC3A 4W1QA 4XF9A 3G2JA 2DCKA 5IAAA 2HF9A 3ZWPA 4P92A 5AR1A 4KGXA 1DWUA 2DUQA 2LVBA 4AJOA 1C8LA 3TNPB 2YVQA 5L53A 2IHJA 1Y9EA 1UYYA 5CLLA 3UAWA 1N0IA 3QD6A 1J2YA 1Z6GA 4P7KA 2HKIA 1K42A 4P7GA 2REOA 3UHOA 1PHMA 2XB2A 2GA9A 2WYSA 3TCKA 1NMYA 4BIOA 1ZI8A 5TEWA 1Z4PX 2IU3A 2OPHA 4DR4B 4E5NA 2Q1YA 2ZMKA 4ECAA 2V7TA 5KWJA 3MWJA 3IKWA 2DSTA 1XTZA 4ZEMA 2XMRA 3MUFA 1F2TB 2OZLA 2IU4A 4DLXA 4NIAA 2XV1A 4DWOA 5KYYB 4LTDA 3S55A 4U9UA 3AR9A 4J7AA 1H6CA 1WD7A 3RLFA 4ALJA 1ZW1A 1R18A 3LA6A 4F5YA 2CNDA 3DOEA 4MW7A 4KN8A 2JCVA 1FRQA 3ZCTA 5DZFA 1J20A 3RE1A 1RXSA 2OYCA 2E89A 3IUNA 2W6PA 2WZQA 3ZE8A 3I3BA 2MYNA 3BK1A 4M8LA 2BSAA 3RHTA 3VH3A 4HWSA 4E4YA 4CL0A 5DXDA 1E3WA 2QE3A 2NPOA 1DTEA 3CPEA 3QTBA 4OQPA 1VJTA 4F6LA 3K9CA 3QLJA 1FYUA 5BP7A 4EG6A 1YOVB 2ZRJA 4AQSA 4Q48A 5IX8A 4X20B 4PYNA 3ZBQA 1JI6A 4HVCA 4XSHA 1QO7A 1WF3A 4LRXA 2JI4A 1LBIA 2DC1A 2AW5A 2JI6A 3NHUA 3WF1A 4DLRA 3ZQKA 3NHYA 3WHLA 2X2OA 2XT0A 1O91A 4I8XA 4UE6A 2OESA 3CN9A 4YFVA 4I8DA 3OYWA 3UYKA 3OI7A 1RI2A 5I7SA 3PUWA 5I93A 2PUAA 4DEVA 3UNPA 1UBFA 4YARA 3KETA 2MEV2 3N2IA 1EFDN 2HLDA 3AJZA 1Z33A 1NT2A 4D8UA 2CK3D 4QX7A 5LB4A 1D2CA 4DL9A 3GRPA 1XTBA 3VZQA 3L8HA 4KNVA 1H2MA 1P4GA 3PUVA 3ABRB 1KA9H 1XROA 3PJGA 4CM9A 3B53X 1L5LA 3LPNA 2GU9A 2FRDA 5LBEA 1VSBA 1MXHA 4LHEA 1BEZA 2GZ3A 4LAFA 3T61A 1DP4A 1ZM9A 4GLJA 4GMDA 3OE5A 4EJ6A 1MH1A 1IAQA 5J2TA 3DKKA 3TW8B 3RS7A 1J07A 2I3ZA 4DWVA 3JVIA 4I4NA 2OOSA 3PUJA 3ESRA 3TIVA 3E6DA 1FMTA 5FNVF 1NPDA 3F2IA 2ZWVA 4AJIA 4WKBA 1NW9B 3DOJA 1QIGA 3QFFA 2GTIA 4LOJA 3FNFA 2JKVA 2AI1A 5ICMA 4E1BA 3KCQA 1PWHA 3V0BB 5FJIA 3EARA 4FI9A 5AXDA 2PX8A 3RS9A 1QIIA 4PEVA 4LCEA 1M7GA 3W2GA 2O3QA 1Z5PA 1RIIA 5FUQA 4G5GA 2ZB8A 3KKOA 5GV8A 1LA2A 1DX6A 4LFAB 1W8IA 2AN9A 2XZPA 4LITA 1QH1B 1KGSA 2KJQA 1Y9DA 1B26A 2V3VA 3UWOA 1OVMA 4V1CA 3Q2KA 4D9FA 3PUHA 2WSSA 3GT7A 3RVNA 1XPOA 2R7NA 5GINE 1FJGB 3KZ4C 4P86A 5HHTA 2XB6C 2QQ5A 2W6JA 1JUIA 3P94A 4UNNA 2FSFA 4GOOD 3PC3A 3I3EA 1F17A 1XCPA 3UPDA 5LA1A 4F06A 5JEDA 4LT5A 4M0UA 2VXCA 3L6OO 3K2IA 3QQPA 1DGRN 4C0XA 1M2KA 1SCAA 1W6MB 1MS5A 1N8NA 1RJWA 2ODPA 2EERA 3F6PA 4QQFA 3OM8A 5LA6A 4G4SO 3KXIA 4WTOA 5DBHX 4AZ0B 1KQFA 3O1OA 1RUG2 4K6BA 4AUMA 2KA3A 4KI7A 4R68A 3O38A 1A1VA 3WT3A 3U4CA 3A9SA 3DZGA 1M54A 4TQUS 4KLZA 1NP3A 1HM5A 1U8TA 4DLAA 1KRHA 1JU4A 2FUKA 3TLZA 4TXWA 1CUIA 4W99A 4CDXC 2QVBA 2HC9A 1Q0HA 2UYBA 4OHRA 1V4BA 1EUTA 4S04A 3R0RA 1F06A 5JQGB 1TZBA 3T7TA 5IK2D 4O2BB 1E1QD 5KPDA 1XI2A 4ZT7A 5B6JA 1K7SN 5KSZA 2BNNA 3Q0IA 1UJNA 3CJRA 5BURA 2EZUA 5CIRA 1B6SA 3D6HA 2H0AA 2JJYA 3ZWCA 3VO1A 2R30A 4KFTA 3E5MA 1FFYA 3L0YA 1XZKA 1T5DX 3NM6B 3RVHA 1JLRA 5A33A 4OZXA 3AKCA 4MVXA 3PLAE 1UOJA 2IUEA 3QVGB 5IUKC 1Z82A 3LEKA 3QEJA 3V2HA 1UOGA 5DULA 1V8OA 3OUZA 4LEIA 2O3UA 2JWPA 3QENA 5C33A 3CNHA 5K3FB 5EYYA 4X97A 3Q2OA 4PTYA 3FOAA 1F20A 1JEDA 2ZEJA 2X0FA 1NM5A 3L84A 3FFTA 1EV12 4Z53A 3WZ1A 5FLKA 4FM9A 4AHZA 1DHKB 4R3NA 2GX6A 1W59A 3QRWA 2CYFA 1JMKC 5HQTA 4XTMA 2VBGA 3PDIA 4YW3A 1QP7A 1LAJA 1RSZA 4HB2A 4Y2GA 1A95A 4F45A 5DQ0A 5FIUA 4P93A 1HB1A 3P97A 5K0LA 4OXQA 2SKCA 4E70A 4NYJR 5DV9A 6AT1A 5E8JA 4BQ5A 4WM7C 1YRZA 1A78A 2CUZA 1ULHA 2ZS6B 2C0QA 4Z99A 4WKCA 1JSZA 2Q6LA 4ZAYA 1QJFA 3G2LA 5ESRA 3WKCA 4DSOA 3DR5A 3EJKA 5F8PA 2WLTA 3QMPA 4FINA 3JSAA 1TIKA 5DNDA 3I3OA 5AFSA 2J7MA 3BXPA 3ZX7A 2FMHA 4EN0A 3BICA 2WFLB 3IPCA 4OXIA 2I87A 4AZVA 4BB5A 1T9GS 5U4XA 1ZNZA 1XKLA 3I4LA 4LBNA 4CMKA 1QMGA 3S28A 3MLJA 3KZNA 4KEAA 2J09A 4XIFA 1RUH2 3OSDA 3LWDA 1K4MA 2ZJ3A 3UAZA 2NXCA 3T1MA 3OLXA 3WGZA 5LQUA 4LDRA 3OWXA 4NWIA 3G23A 5TSDA 4YRRA 3W5DA 1CF4A 3P0JA 5FYIA 3HVKA 2JA2A 3I9V1 1OF1A 3UESA 4TXNA 4EFDA 1VHWA 2XSZD 2BZ1A 3WGUA 3PYXA 1P5JA 1F4AA 4F3CA 2XBO1 2D97A 4B6EA 1U8FO 1M10A 4AK3A 3B52X 2V72A 2ZMNA 1GSOA 3ROZA 1VCHA 4MJXA 3JAKB 2PX0A 1U0RA 2HFJA 1XRMA 2XUFA 3WICA 1SOMA 1U90A 1XZCA 3LY7A 5G53C 4GYKA 1E6WA 3WFZA 2AKYA 3U4DA 1CB7A 2O0LA 5KHOC 1QFYA 3PQ4A 2R8XA 4HXGA 3UXHA 2WN3A 1HFEL 4QGHA 4L08A 4AE2A 1XDUA 2NSHA 4BNNA 2OGSA 2O52A 2D1RA 3Q7EA 1T2XA 4R31A 3HI4A 5C52B 3Q9NA 3AKPA 4WVVA 2VYVD 4JEUA 3FYUB 2H06A 1JZ7A 2ZXQA 3T08A 4INDA 2QVYX 1CJVC 4AS3A 2DCZA 1IATA 5JD6A 4EGFA 4BECA 1HDYA 3N76A 3B1XA 2YVAA 1P7WA 1FBTA 3QVVA 4UU0A 3OP4A 3I2DA 3IS3A 3ORJA 4XQ0A 4MI1A 1NW6A 3STUA 2QXYA 4R1UA 3IKJA 2WQ6A 1SVKA 4A2PA 2GGSA 1U8EA 2XJPA 4ZCTA 4CW7A 4R1OA 5JZGC 3WQ1A 3JQRA 1W06A 4CEYA 4FGLA 1UBSB 5BVHA 1IOLA 1JEQA 5JWOA 1XCGB 3DKRA 1FNZA 5DASA 1TCVA 2QS9A 3DKQA 4RZ3A 2JGIA 4F83A 1WP4A 3IV6A 5IABA 1L7EA 1BK0A 4CLXA 2AC2A 3BREA 3CUYA 1BWSA 4L92A 1LEDA 1NXWA 1TU0A 4Y8VA 1V9U1 5C8WA 3CXUA 3JY6A 4M22A 4KQCA 1WWYA 2QQ0A 3ZNNA 5A3RA 3U3ZA 4WBNF 2QKDA 3J8F2 3ADOA 4ZCPA 2PANA 1WZXA 1ESZA 1QJX1 1ZPDA 4V0NA 4X1YA 5I7OA 4GC9A 1E5LA 3UHJA 1WHTA 4EYQA 4W8JA 1I7DA 3FNGA 3W5MA 3ZC3A 1MPXA 4QFBA 1XP8A 4C6HA 2BI7A 2O8DA 3UJHA 3FWPA 4W65A 3UUFA 3KWJA 4CM4A 2YIMA 1E69A 3VZCA 4IVNA 1IN5A 5F5LA 1QF9A 3H84A 4ES6A 1M0EA 3P3PA 3FUQA 4L5YA 2Y34A 5FULA 1E5DA 1Z08A 4M1MA 1PGSA 2H4XA 1NF8A 4I5EA 1V4NA 2X2EA 4M7WA 1LEHA 4GAZA 2H4HA 1PTJC 1M6YA 1P1KA 1TT5B 2AOVA 3HY4A 1ZAKA 3WDSA 2Z79A 3AILA 1B35C 2I6SA 3G6WA 4AHYA 1L4LA 3OPQA 3I39X 4FYPA 4MV3A 3WHTA 4M3NA 1QZ3A 1WU8A 4I1PA 2WZDA 5A32A 3MD0A 2OT7A 1ETUA 2V74B 5EJEA 4ZZ1A 2ORZA 3STWA 4V0SA 1SOVA 5L3QB 2VUHB 3SEZA 1FUYB 2Y05A 4RGVA 3TLYA 3A3OA 4DJEC 4PC2A 4FEYA 4BNYA 1R4NB 4CG0A 1Z0SA 4AY2A 1AHIA 2I2WA 5ILOA 2NUTB 2IS1A 3GCDA 2CSXA 4HWTA 4LQRA 4FFWA 3JQQA 3TNJA 4QU1A 3DQPA 3PCRB 4JKKA 2J5BA 3ZYCA 1UAGA 4MRPA 1YC61 4XIGS 1T43A 3Q8WA 4D25A 1ZD1A 1ENRA 4P9GA 1GLVA 4GM1A 5ALDA 1KDOA 3ZDXB 3D2BA 4C01A 5CFNA 3OBZA 3RSQA 3P0IA 2CNWD 2F9LA 3FNHA 4HB3A 4EP1A 4BO5A 1OV6A 3INRA 2IZWA 4MO2A 4DXAA 3IBTA 4DZZA 1NL3A 1OZAA 1AU9A 4LDPA 1WBLA 4L6CA 2NXNA 2AQHA 3CO0S 4LF5B 1UT5A 3ZFGC 4FPFA 5AUNB 2WICA 4GPBA 4BIIA 2G1AA 4YLGA 1FL9A 1P44A 1S9HA 4HF7A 1YQGA 4LQLA 7MDHA 1ENQA 2EKQA 2QTWB 3GHHA 1P77A 3KQTA 2CL5A 3BH6A 4C14A 1X7GA 4MLDA 2VOKA 2ZJ4A 1QU2A 4WDQA 5DWQA 4P5DA 4FVVA 4JOBA 4PRKA 4JLPA 5BR7A 2HEYF 2BGOA 1W47A 2OV3A 1NP7A 4ZVUA 1CDEA 3FBGA 3ZY6A 3FM9A 5FWXA 2C77A 1O4WA 2QENA 4R9UC 2XLCA 5KMGB 3D0RA 2K6GA 3GM8A 2JK1A 5FY7A 2OHHA 1XZJA 3EH2A 4IDBA 3DO6A 3QXXA 3E3NA 3VYRB 1R0WA 1DXQA 2PUFA 5BYBA 4R4ZA 5JCOC 1WR8A 1HNXB 4TZTA 4RZUA 3TVDA 1KNXA 3DE5X 3BE8A 3FJOA 1PUXA 1BMFD 5CH8A 3OPYI 3TTSA 1P0IA 4AWAA 3AVWA 1OAKA 1PG2A 2APJA 2PHDA 1G16A 4M7PA 3WO0A 4Q66C 2IYWA 3C45A 5AI5A 4BBZA 1G5TA 3M4NA 3H13A 4IQFA 4GWNA 1XELA 2Z3WA 3V8NA 2A0FA 3BKWA 4RZXA 3A1VA 3BK7A 3T4HB 1Z2NX 1X7ZA 1A0OA 4DLBA 4E5SA 4QUKA 4J0GA 1PUJA 1K3UB 2P4UA 4I2NA 3OAAA 3GBFA 5EOVA 4DUXA 4TSVA 1ZUD1 2HU5A 1WZIA 4Y3OA 2OENG 1WLWA 2GBFA 4BLOA 4ARXA 1XEWY 4FGZA 1XQ6A 1JTFA 3MTGA 2CYCA 4D7AA 1SCKA 2GMWA 3KYJB 4E07A 3OGGA 4ZGWA 3JQ6A 3DQQA 2NYRA 4ZK2A 4KN9S 5IJ9A 2GNTA 2D8AA 4A2UA 3FPEA 3T7KA 4KZPA 4NBUA 5BUSA 3D43A 3DV2A 2FRXA 2J3QA 2O8BB 2OHVA 2RAPA 1WW3A 3L0OA 1NBWB 5FNVA 4JUAA 2P30A 1G41A 4I5GA 1G64A 2J9XB 1NA1B 2H4WA 4YMIA 1SH7A 1DBNA 1QRTA 3FYUA 4X7MA 1YJCA 5ALPA 3FYDA 1XZHA 3KTFA 5CBKA 1NW3A 4AJ4A 4RXUA 3EGDA 5F9HA 2LP4Y 1TQ6A 2GJSA 3HBNA 3H9UA 4Y3UA 1FX1A 4LV6A 5LMUB 1VBB1 3PNQA 1H8ED 3JBG1 4BATA 4PZPA 1G8MA 1FPN1 4JDPA 3TPCA 5SZIA 1QV7A 5B3JC 2BF7A 3AV3A 3C1UA 3T6KA 4AF6A 1Y3TA 2FWIA 1E9VA 3W6ZA 3LIIA 1S0JA 3AJDA 2WAXA 1I6WA 2RCNA 1PO23 4DABA 7GPBA 1ZRMA 1FDUA 4YP1A 2DCJA 2IYAA 3R4VA 1GWMA 3MS4A 2WC2A 3DH0A 5I7WA 1QE3A 3VKHA 4QNRA 4LNAA 3V2IA 4D9KA 3H7YA 2XLAA 1K5MC 4PQQA 1UQTA 5FPUA 5K3AA 2F90A 4OUKX 3O4JA 1IOVA 2ZJ2A 4L2IA 3AP1A 3PKIA 2N3ZA 4IKOA 1KGYA 3KQMA 3REOA 1I2BA 3VBFC 1WMEA 4DANA 2YY5A 2P2SA 3ZXKA 3X2SA 5JH7A 2HO4A 4XAQA 4BKRA 3ANNA 5K0ZA 5EESA 4DRZA 2HWC2 5CT5A 3AXTA 2GCPA 2DWQA 3CUUA 2JEOA 3F6CA 1NE7A 1XK7A 1N4DA 2K5UA 4LWPA 3DPIA 5CVJA 5EIEA 5IF3A 2XNDD 2O20A 4U6QA 3ZWOA 3BALA 1W9FA 4N39A 1UMBA 4IEEA 1E2BA 1NBIA 3CISA 3ICQB 2AWNA 4GNRA 3CH4B 2B2XA 4XILA 3E18A 2FE1A 4AW7A 2Z30A 3CX7A 3TMYA 1E3WB 1O77A 1KJLA 5EE3A 2WTNA 4RC9A 2ZIEA 4UUQA 1IN8A 3ISVA 1IYZA 3S1SA 3NBZC 4E88A 2C1ZA 4M55A 4QFDA 4ZICA 2JIZD 3PHBE 1NLZA 4B7EA 4D92A 1NN1A 3MBWA 1KJ9A 1ODNA 4FZ5A 2MMCA 3HDYA 3UXMA 5LWQA 5LL6P 4O4IB 2DKFA 2QGFA 4JI2B 1G5IA 4MR9B 3ZKUA 2GD6A 1GUIA 1BVUA 1MEJA 1P60A 5BV8A 1NNEA 4MINA 4Y4YA 3QMWA 4I3GA 4XUCA 1T9ZA 2IY8A 2LBPA 2QL9A 2FFHA 4KFSA 2RHBA 4N48A 4L0QA 4Y2TA 1N34B 3J7TA 1PR0A 4M8NE 1XSRA 4E4HA 5FTNA 4TTPA 4HAXA 2OQVA 3A23A 2NP0A 4ZJPA 1XEFA 3G5UA 2ZRMA 5C9AA 1W52X 3WIBA 2FX2A 1KRWA 3KKNA 3RU3A 3T4EA 5DDJ2 1D2AA 3GJQA 1FU7A 2PS9A 1Y89A 3L4EA 1IMJA 2CV6A 2ZRLA 3DW3X 1ZBQA 3W5UA 3ZV3A 1VL6A 4YGBA 3LVBA 1PO7A 3CLHA 4LC1A 3BB1A 4YAOA 1GPAA 4KRXA 2C2OA 4EHKA 2Q30A 3W4KA 1Y3BE 1VCOA 1W96A 5HI0A 3QWFA 1JHNA 3SISA 2JCXA 1SO8A 5B2ZA 4M21A 2WNUA 1EEXB 4B4PA 1YR9A 2ZPTX 4XUDA 4LXIA 2J0UA 2R6FA 2E85A 1AS3A 2HWB2 3M89A 3C7KA 2JZCA 1JDPA 2YYZA 3WP5A 3WXMA 4AXXA 1BXGB 3HCBA 4LTMA 3AONB 3NW9A 1XWIA 2AOTB 1ILWA 1EFCA 4CUJA 3M49A 4AROA 4QHSA 2RFLA 2ZAOA 2FSUA 4L8WB 3V4FA 1LB2A 2NPFA 1ZJJA 5I0SA 5LZ7A 2IL1A 2XWJI 5A4JA 1GT91 3T9BA 3TEZA 1OLUA 1BC5A 2X7XA 4D94A 5HUJA 2YV1A 4RKWA 4CP2A 5APAA 1ZQ9A 1YCIA 1KQ3A 4TN1A 2JEZA 4LRUA 3SJAA 1O5OA 4IL7A 5ADUS 4G1VA 4PW0A 5JSKA 1AYM2 2XJ4A 1ODFA 3GRFA 3R5TA 1N3OA 4CKBB 1JVBA 4AKEA 2FKAA 2V7UA 1K08A 3UMVA 1LBTA 3KTAA 4L5AA 5ERLA 3H1TA 3WMFA 2B8TA 1EDDA 3ACBA 2QMHA 4H3HB 5A5DA 5L9VA 2TECE 4YECA 1T1GA 4BKUA 1SCBA 4LKEA 4GZ9A 2UYAA 2BRUA 2W1SA 3O83A 1R0CA 2HXGA 4YAJA 2COKA 4I9UA 3TSZA 2VY0A 1TIPA 4E1VA 3B69A 2D4HA 2WD7A 4L78A 1ZZ6A 4I9HA 3PXGA 2EL9A 4W4TA 3L7YA 5JISA 3JZMA 3GVCA 2ORYA 5M04A 4ALNA 1TJYA 1L7OA 2LUWA 3HGTA 1NQDA 2P2LA 3B01A 3DGFC 3MPOA 3W5AA 5DG2A 4WZAB 1GVNB 5DW3A 4KDFA 4WZBA 2RHMA 3DD1A 3T9AA 4P5YA 4URFA 3ZWAA 4RW0A 4NZ9A 3NXKA 1ZA1A 3S2EA 1RQ2A 1ZP6A 3FTCA 4TL7A 3EGDB 5E88A 4A2WA 1IPEA 2JGEA 3WW1A 1TJ4A 3ZW9A 4N9WA 1T0HB 3W4IA 1RZRA 3ADKA 5DUUA 2IY9A 3WRVA 1B0ZA 3SCGA 1KZ6A 4WLNA 2KW5A 3S2ZA 3QXCA 3N36A 1CJDA 1BA2A 3GNTA 4M8IA 5AVJA 3IODA 3R0QA 1IB0A 1HLDA 3QXGA 4G84A 4Q4AA 1E9DA 4LXGA 3H2IA 3HJAA 1BMQA 3ONFA 4QSMA 4DKXA 2CWMA 3O5AA 2R8PA 2H9YA 4NQRA 4ICIA 3GPCA 4Q0QA 2V1UA 3MJRA 2KMLA 1TADA 3R3HA 2BOVA 2PXHA 5FZOA 1VB3A 2AG8A 4XGRA 3OD5A 3EXFA 1J2RA 4ROSA 1MJ5A 3LX5A 3GZNB 3QY0A 4KOEC 1CE8A 2W6MA 2BGGA 3EZNA 1NYLA 2ZE8A 4DR2B 2Y3IA 1NUTA 2GEVA 3RU2A 3TB4A 5ILGA 3DYOA 4BKOA 4OGLA 4RF3A 4IMIB 3HDJA 3LUGA 3DL7A 4OM7A 4AZWA 1YWGO 3ZS9A 2XE7A 1W85A 1G66A 2BKAA 1OA4A 1W0KD 1KEVA 3LYAA 2O2YA 3BMCB 3MWEA 4ZYXA 1SXJC 4L5BA 3P6BA 2JDKA 2SICE 3FMIA 2WYWA 3SP1A 1RKBA 1U8YA 3TI9A 1ID1A 2OBXA 3A05A 5JSPA 5FOTA 1BCRA 1OREA 2ZBVA 1IK4A 2IOQA 1CQIB 2AMVA 3ZNPA 3FI0A 3GFFA 4YQZA 4ER3A 1AN9A 5IVCA 4LY3A 2Y0CA 2RMU2 1WV0A 4XQGA 1I6MA 1RNLA 1UAIA 2DPLA 3C87A 3BODA 1ZIPA 5KVSA 2WE8A 3TYJA 1XD8A 1BCXA 4FC6A 5MFZA 3ESQA 1CXZA 3K77A 1RXYA 2VIIA 5E9AA 4IJMA 1DZTA 1MO2A 1MFZA 1T6GC 2AACA 1WZUA 2IOHA 5J47A 5JZMA 1PO22 1AUOA 1H4SA 4LZNA 4HGNA 5TY0A 4OM8A 2CVZA 4FE7A 1GAWA 1XZPA 2GXAA 4YJDA 3RV4A 1NJSA 3B93A 2OVBA 1WZCA 5FJKA 3IFSA 3CF6R 1DFHA 2QRUA 1S0UA 5JPDA 3QACA 4PFJA 3NPAA 4M9XA 4R6XA 3NAPA 3G8AA 4AUEA 4RIFA 2Q4BA 3EZLA 3AK0A 1TI7A 3AOEA 2CWWA 4Q47A 4BY9E 4BCUA 1AUPA 1FV2A 2NPIA 1EXWA 5FO9B 3A6HA 5IXSA 5DUVA 4EB6A 1SIWA 3DUFA 4IRXA 2IWRA 5KX5A 4LO8A 4RDIA 3UWMA 4FSXA 4X60A 4EUEA 4RUKA 3F6YA 1V7QA 1QJY2 5IULC 1MQ8B 1N7IA 1PNOA 1MDBA 3KEQA 3TMKA 5CJ2A 5ES3A 2W0SA 5C5EA 3D6TB 3GLHB 2FWPA 2VMGA 5C32A 4Z7JA 1JA9A 4FMDB 4MW4A 3E5XA 4G41A 1QBKC 2XXBA 1J99A 1M5RA 1IM2A 4NATA 1VLJA 1PWXA 4UVEA 2CXSA 4ONEA 4JSTA 3LT0A 5EP3A 2AX4A 5C4WB 1RADA 5DAXA 3GDGA 1G21A 3U19A 5HMLA 3O1SA 1IZ0A 1WCUA 1YZLA 4KHPB 2NV6A 3DEIA 2ORXA 3ZXJA 4U7PB 4Y20A 3DOCA 5A4DA 3DKVA 1Y3CE 4FNOA 3HKEB 5KI6A 5H80A