5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
b'DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
3DE7X 1YJAA 1EGQA 2Z2XA 3DW3X 3VV3A 1Y3BE 1Q5PA 1TM1E 4C3VA 1Y3FE 2V8BA 2W2QA 1TK2A 3ZXXA 4HPKB 2Z30A 2Z2ZA 5FAXA 2ZRQA 3AJ9A 1P7WA 2SBTA 4G9SB 2ID8A 1OYOA 2X8JB 1Y48E 5AMXA 1XF1A 3OSZA 4K8RB 3WIUA 1WMEA 3F49S 3VTAA 2TECE 3GT4A 1TMGE 3QFHA 3DYBA 3PTLA 1OT5A 1KDZA 1PJ8A 4I3GA 1AQNA 2HD4A 1ZVJA 4J94A 1T1EA 2Z58A 5JXGA 2W2OA 3QTLA 4AKSA 3JQWA 3DE3X 5B1EA 1SBCA 4H6XA 2XVGA 1DUIA 1HT3A 1SBHA 1LW6E 1V6CA 3Q40A 1YJCA 1NDQA 3H42B 2DP4E 4NE7A 1Y1KE 3L1KA 1SIUA 2SNIE 2WUVA 1WVMA 1BE8A 3BGOS 3PRKE 1JEAA 1OYVA 3GCWA 1BJRE 5JXHA 5JXJA 3WIVA 2B6NA 3QMPA 4Z2AA 3A3PA 1PFGA 1KE1A 1SH7A 2WUWE 1GTL1 1NQDA 1GNVA 1SBNE 5CW1A 1GCIA 1DBIA 4HPKA 1GNSA 1WSDA 1TM4E 1WMDA 4WOCA 2X8JA 3A3OA 3GT3A 3F7OA 4HX2A 2ST1A 3DE0X 4KB5A 1GTG1 2G4VA 1SCNE 4OMDA 3UNXA 5FBZA 3F7MA 3LPCA 1U5IA 1C3LA 3LXUX 1BFKA 1Y34E 2W2NA 4DY3A 1NQJA 3ZXYA 1V5IA 1ST2A 3DE4X 4JP8A 4OV6B 3DDZX 1A2QA 1Y3DE 4LVOA 5AVJA 3EDYA 5JXIA 1TM5E 1GTJ1 3EIFA 4HVLA 3TI9A 1SUAA 4ZOQI 4DXZA 2XTJA 3WQBA 2IXTA 1Y4DE 2PWBA 1C9NA 1SIBE 3P5BA 1EA7A 2SECE 1GA4A 3BPSA 1KE2A 1Y9ZA 3Q5GA 3I2YX 4NE9A 3D43A 3LPDA 1AF4A 5I9SA 1Y4AE 1SELA 1CNMA 4KG7A 3CNQS 2LUWA 3AJ8A 1SUCA 3VV2A 4H6VA 5B1DA 5ARDA 3SQOA 3DE1X 3D9QX 2W2MA 2ID4A 3VHQA 1S02A 1R0RE 3BX1A 3DE5X 2ZWPA 2PYZA 2PKCA 3JQXA 1BFUA 1SN7A 2WV7A 1S2NA 3BOWA 1SPBS 1UBNA 3GCXA 1TO1E 3DVSX 3TECE 3T41A 3LPAA 1AVTA 1BH6A 2HPZA 1ZVKA 1IC6A 4AKTA 3A3NA 1SCBA 4DWWA 3EE6A 2O8OA 3AFGA 5FFNA 3HJRA 5SV5A 1C9MA 5JMOA 4MZDA 1SVNA 1PTKA 1Y3CE 1KDVA 2Z56A 1T1GA 4OMCA 2DUJA 4GI3A 4YN3A 4M1ZA 1GA6A 5AVKA 4H6WA 1SUDA 1AV7A 3VSBA 4DZGA 4CG0A 4C3UA 3DF0A 1TECE 1THMA 1KFXL 1TM7E 4BWGA 3DE6X 1SUEA 1TM3E 1Y33E 2PQ2A 2ZWOA 4NMXB 1SCAA 1IAVA 2E1PA 1MPTA 1BE6A 1P8JA 1QXPA 2PWAA 1T1IA 2QFEA 3TI7A 4I0WB 3VYVA 3DE2X 4WOBA 4KPGA 4DJ5X 3I30X 4LVNA 1GT91 2P4EA 1TO2E 2Z57A 3I37X 1R6VA 2GKOA 1SIOA 4ZARA 1CSEE 1PEKE 2WWTA 1S01A 1AK9A 3I34X 2SICE 5SICE 1MEEA 2PMWB 4DZTA 2XVKA 1R64A 1SUBA 3DWEX 4CFYA 4DY5A 4FONA 1SCJA 1C9JA 1SBTA 1SBIA 1YU6A 1KFUL 4B5LA 1AH2A 1AU9A 1GA1A 3DVQX 4CFZA 2PRKA 1NLUA 2QTWB 5AQEA 2IY9A 1NDUA 1KDYA 5ARCA 1ST3A 5K7SA 3CO0S 1SCDA 1SUPA 3DVRX 1YJBA 1P7VA 2Z2YA 3WHIA 3DW1X 2XRMA 2XVLA 2DQKA 1DF0A 2W2PA 3SICE 1VSBA 5ARBA 4RYDA 1WMFA
chains in the Genus database with same CATH superfamily
3RC1A 3DNPA 4HHEA 2QTFA 3ZFFB 3PXUA 4C3VA 1Y3FE 2GEUA 1GO2A 1W1UA 4XIGS 2OHJA 1II8A 2MEV1 3QU7A 3VBUB 4L22A 5KNCD 5L8VA 4KI7A 2ZS6B 4UBKA 1FATA 4HPJB 5CLGA 2BEOA 2A8YA 3RTAA 1XF1A 4MLZA 4ABYA 1DZQA 4R31A 4AUEA 2PXAA 4WKGA 1K86A 2QUKA 5F64A 4C6RA 4MVJF 4CL2A 1JEOA 4W8OA 3ZHYA 1JB9A 5CA1A 5IAKA 3CBGA 4MGKE 2H1VA 2PZJA 3BJZA 3PHGA 1E69A 3FYDA 2H0AA 4LBKA 5SY9A 1OFGA 2Z1NA 5JE8A 3V46A 4MW9A 1OWLA 1YZTA 4BVKA 3LIHA 5A9TA 3EMKA 1H2ZA 1AGRA 2KB0A 4ZU1X 2DWCA 2B69A 5TQ2A 1H2LA 4GIBA 1E1QA 1E8MA 4MW4A 5FPPA 5AHOA 2FZ1A 5EESA 1X6VA 3MLJA 2FZ5A 2WJGA 1DJQA 3R7LA 1S2GA 4W9MC 1LEMA 3MRTA 1XRJA 4DMIA 1RINA 2OT7A 4Z1VA 4BWOA 2OMKA 5KBFA 4I1OA 3KCQA 3W4JA 2WTBA 1L7PA 1SH7A 5I8YA 3JQBC 1SU6A 3J7TA 1ETHA 5CW1A 2POQX 1J5EB 4GU5A 2CN1A 1MX1A 2WSUA 2AEYA 3D3WB 2QB5A 4XLLA 2P8JA 1UPUA 3C3XA 1ULBA 3IUEA 4IHQA 4LOHA 1MENA 5B6IA 2MSDB 1XJAA 2WW8A 5HCAA 2ZBUA 3VPBA 4J1NA 2CK3A 1WW3A 1CAUA 3HA7A 3NTVA 2XB9A 3T7KA 3C6BA 4HUTA 4GMDA 1BFKA 4KE6A 2ZB2A 1N92A 3L6BA 2JGFA 1LFDB 2GERA 1R0YA 2NUPB 5J4KA 4I6JA 3QKWA 5JAOA 1FFXB 3B9PA 3QTTA 5BV1A 1EEHA 1VJCA 2EAKA 2VUTA 3HNOA 3KKNA 1K4KA 2IHZA 5L3SA 4IDAA 1YS2X 4KQWA 1XQ1A 1S1CA 3TPFA 2QDNA 4CDMA 3AF6A 4GX0A 5F1OA 4BX2A 4HQFA 3TUJC 2NO6A 4N76A 5ADHA 4Q12A 4DVJA 4KRYA 1EV12 1QCZA 2G4CA 3JQ6A 1R10A 2XE7A 5CG9A 2ZRMA 2BMVA 3CWCA 3KX2A 3TZHA 3RRZA 1LS6A 1YDMA 4CEIA 3PFBA 3T7JA 2BKLA 2C5HA 5CKNA 5A6SB 4BMEA 1JBQA 3THDA 1W49A 3LEIA 3ZTYA 3OQIB 3NHRA 2B2CA 3G0OA 2FDCA 4HOOA 4F5WA 2WWYA 1EAYA 2B4AA 2WF5A 2A6ZA 3MC1A 3AM1A 4D5EA 2R25B 4LPKA 4KDEA 2MR6A 1OI3A 5EHGA 3K6JA 3D8BA 1ISRA 2I87A 3KQWA 4Z7JA 3NCTA 4WZAE 2IS2A 2JFHA 1AYM2 1I7SB 2YYZA 4D9HA 1SKBA 1V6MA 2AACA 2QU8A 3TSYA 4GKAA 4K9LA 1QQBA 4Y2QA 1TECE 1LB1B 2HWC1 3VOTA 1H2WA 1Q1NA 1YQDA 2PJRA 3HCRA 5BSTA 4A6EA 2ZWOA 1ZJ4A 1KXGA 2Z4SA 4X41A 3WQRA 2C84A 2WPDD 3LEGA 1G7RA 2V6IA 3DZJA 4DC9A 4E27A 2IOYA 4EY8A 4HLDA 4XRRA 5TJ9A 4ZOAA 5DWVA 1RRCA 4QYSA 1P77A 3T4PA 2QLMA 3WF2A 5ITSA 1R0CA 4YXWD 2ZEXA 4CGYA 1R64A 1ZFNA 3BKXA 4W6YA 1BA2A 5DM2A 2GLXA 2TUNA 2WA4A 2YWBA 4KFCA 3DLCA 4YJDA 1YZFA 2J31A 2VHJA 1JOPA 2IY9A 4LZNA 3LG2A 1E4YA 3PXBA 5FTTC 1SOAA 4RHCA 4ALNA 5EP3A 3GLFB 2XTAA 3BU0A 3KL4A 4QHTA 2ET7A 1I01A 2A0KA 1TU3A 1Z07A 2I71A 1LNSA 3LUBA 5IC4A 4IV8A 4QX3A 1H6YA 4H27A 5I4BA 3ZE7A 5CYYA 1G7SA 1D2RA 4GPBA 1TYBE 2CBZA 3BZWA 1NJ5A 1KOJA 3NO4A 3P9PA 3QVSA 1SBEA 3JSXA 1O97D 3OPVA 3AUFA 1E5TA 4MXWB 2NSLA 4ZU7A 3V64A 2HTEA 1E2BA 1ISHA 1Y48E 3GHNA 1U0LA 4TWTA 1I5RA 5FTMA 4Q1FA 3DBRA 5FOUA 2JLZA 4YRMA 1XSRA 3HMQA 4G8DA 3SVZA 5KHOC 4RGAA 2REBA 1RUF2 4CEHB 2WZBA 2A6XA 3NHJA 3WRXA 2W2OA 1JHQA 4PZLA 5IAEA 5AFBA 1Z83A 1QMPA 1E7WA 3LLVA 3IESA 3S0JA 1NDQA 1GU0A 3P6BA 1IHUA 2ECFA 1N0HA 4KQJA 1IGOA 3AFMA 3E1F1 4YM1A 2HLPA 4EQZA 5LQKA 4IGOA 4RGBA 4YMUA 4OGFA 5ALPA 3HY4A 2WFF3 1R4AA 5ERGB 1T3HA 3R7SA 2Q1WA 3BWCA 2P4UA 1PJAA 5C33A 4JXZA 4B2PA 1E6LA 3OQMA 3WL6A 3JD3A 4MV5A 3LKDA 1CB0A 4MP8A 5H3HA 4HPKA 2ZR9A 5CADA 4AIRA 2BOVA 2JZOA 1A8IA 4H17A 1OA2A 5IF3A 3V4LA 1VKZA 1XRSB 4QT0A 3OIVA 2VKQA 5BV7A 1HETA 4GX2A 2CWMA 1SCQA 1IS6A 4HXGA 1Z5VA 4ZIRB 1X7YB 5KSWB 2JFBA 1ND3A 4BWYA 4UD6A 4F86A 4DYDA 3LC7O 3ZUPA 1IE3A 4WM8C 4M3CF 3VZPA 3GOQA 1UEIA 2CMFA 4Y1UA 1YGYA 1TEVA 1IKQA 4GFDA 3B7WA 1UXOA 3FDZB 4FPCA 4DJEC 4M4RA 3B70A 1B00A 2ZJFA 2NP6A 1N1YA 4YJ3A 3G59A 3FCYA 4PLWA 2PT9A 5F4ZA 3ANMA 4L4ZA 2LTAA 3E22A 4RD6A 4JELA 2A3RA 4JJAA 4UXIA 4YJHA 2XCLA 1N7JA 2X7HA 3NEPX 2CLDX 3OTOB 3B12A 3G9QA 4WMLA 3DV8A 1RBZA 4UM9D 5CAEA 1K42A 4C7VA 4ZGWA 4AKHA 2VSFA 2XDQB 2XOMA 4QASA 16PKA 4PGAA 1V1MB 2HA3A 2CJFA 1SUCA 1CRWG 3CTMA 4XE5A 2ZYDA 4IIJF 1WSAA 4J9UE 1DJPA 3R0JA 1C8M3 2B36A 4FIZA 1H2BA 3H2HA 4CM9A 4TSKA 4PIXA 4LXYA 3I0NA 3VHXB 3F4KA 4IW3A 2Q07A 2QDRA 2PKCA 2Q6TA 1SN7A 2WV7A 2X8WA 3LS2A 2Q3LA 4IGAA 3GXOA 3HDVA 3BWXA 2ZRCA 3RM3A 4IMIB 5F6KA 3K32A 1WCQA 1AS2A 3HJRA 1KYYA 1BMV1 2V65A 1T36B 4GWMA 3STWA 1JHUA 3ZK8A 1LTHR 1Q3KA 2E18A 2I03A 4AZ0B 5CIWA 4QEKA 2DDUA 4DZGA 2D4AA 1O6FA 2FSGA 1YJ5A 3R3WA 4UQOA 4MJLA 4PC3A 1Y5RA 4U6QA 1CNFA 4TS4A 2A0UA 2Q8NA 4JUFA 3VGIA 2D3SA 1Y33E 1QJFA 2NXCA 3E7WA 1O0SA 4UAJA 2F17A 3V1TC 2OUKA 5LD2C 1K5MC 1K9VF 3SNKA 2DFCA 2WQ8A 4G2TA 3JB4C 4KE8A 4OHWA 3I34X 4PRLA 2ZDGA 4JBLA 2P37A 3RZGA 4PQQA 4FONA 4I9NA 1G1MA 1PZHA 4HLCA 4UTNA 1G59A 5TEVA 3X1JA 1SG3A 2P9HA 5JI7A 2VNJA 4MKRA 4XM0A 4M0KA 2ZT7A 4F4FA 3I3BA 2CF6A 1VIYA 1G8SA 4JQSA 1AD2A 1ENYA 5E1OA 4A0QA 3I9LA 3A6KA 5ALNA 1FMFA 4DM3A 1HE5A 5AXBA 4HDAA 1W30A 1GYQA 1A9ZA 2ZXFA 3VNBA 5AKHA 2FF5A 1FXUA 4Y5SA 4ER0A 3HEMA 4GD3Q 4YZ4A 4JCKA 1FU8A 4DQUA 3JZMA 1IG0A 2VHYA 4FZRA 1MPXA 4UFOA 4TUYB 2B1QA 1Q19A 4UU0A 1ZMRA 3OCVA 3EGDA 3WK5A 3GRCA 1OAKA 3VBHA 1QDEA 2SKEA 2WWWA 2FB9A 4I19A 2IYZA 4XDGA 3NVMB 1EFVB 3O12A 2JANA 5JISA 4D9CA 2XPCA 1X1TA 4LCBA 4UUPA 3WWPA 3LYLA 1YE8A 4IXMA 1Z9BA 4AVVA 4FGKA 1ABBA 3NEYA 2GA9A 5C4WA 3OLZA 4M60A 4E4ZA 1XF9A 1FRZA 4LHXA 4WN9A 3OLYA 4DF3A 3MUY1 4M7PA 5LBUA 4WFIA 3TXYA 2Q2QA 3AKQA 1Z78A 4B46A 4Y5TA 5LU8A 1W8TA 3ZWXA 5LYJB 3O8OB 4MUJA 2YQ5A 2ZUFA 1WTAA 4KIJA 3V56A 4E11A 2BTVC 3UHAA 4KE9A 3AVWA 2VVDA 2FKAA 4CMHA 3O74A 3X2FA 4O5OA 4DQKA 3E7XA 1OX4B 1EX1A 1C80A 3VPXA 1ZUWA 5A7GA 3W9UA 4GGPA 4PCVA 4Y1FA 3GNQA 5EINA 2ASEA 2C1EA 3AU9A 3TMYA 1KSFX 5KC6A 1HRV3 2OVFA 2ZRLA 1M2VA 4PFSA 4LYYA 2FPLA 2W6MA 2OZEA 4EHJA 1DC5A 5BORA 2R8RA 3NNNA 4EY6A 3AY3A 1IM8A 2I3ZA 4KXLA 2HWD1 3DPUA 3AERB 3OG9A 3TVDA 3BTOA 3E5QA 221PA 4AY6A 1RYYA 1AXYA 2V7GA 1SRQA 4LJRA 2H6CA 2X41A 4JP5A 1J1TA 3PYLA 4S2DA 1OH3A 5TY0A 3O03A 3BXPA 2R1VA 3MILA 4M01A 2IBTA 2PQQA 2ORVA 4IOKA 4DUGD 3CMMA 2WICA 2I6SA 3BK2A 3OGRA 4GPZA 4HAYA 4U7PB 3KHCA 3NRUA 1K5JA 1FFHA 1I6KA 1E3MA 1QGUB 5FPYA 1NA1A 4RF2A 4ZAGA 4KLNA 2ZDQA 1MAVA 3C5WP 5JJCA 1MTOA 3W7BA 4KQ6A 4ZOQI 2Q62A 3FMFA 2RS11 1XLVA 3K6SA 5DHTA 4EAAA 5H9VA 1ZM1A 1X8MA 2C59A 4B80A 2W6ZA 1JG4A 4FPHA 4PIVA 2ZE7A 1CUDA 4MP3A 1NY6A 3MCTA 1A9PA 2H0VA 2CHQA 1IN6A 1X7HA 3REQA 1HRI1 2HJRA 2HF9A 1ISGA 2IS6A 4BJ5A 4KU7A 2R0HA 1MB2A 2I66A 1ODSA 3QUAA 3DVAA 1VMEA 2A1TS 3CUUA 2A7AA 1L5VA 3C1AA 4YB8A 2RGCA 2ODNA 5ALFA 2IA5A 1YDHA 4QGGA 3ZSMA 4F8AA 3PR1A 2ZJ3A 3CLVA 1OC1A 3ROMA 4FPFA 1ZAKA 2ZOSA 4AMVA 4LVUA 2FFBA 4EWDA 3DP9A 1XELA 3PUAA 3BB1A 3Q8XB 1IYZA 1AX9A 2CXNA 1MOZA 1AJEA 1PJTA 3MHPA 1II8B 4CCAA 4H7PA 2QQUA 5GVRA 3BWMA 4YAOA 1L5OA 3IOYA 3CF4G 4WY5A 2PAMA 1YUMA 2HV9A 3NWPA 2IQIA 1ENZA 1I7DA 1T35A 3PUZA 2DBRA 4KW7A 4QKFA 3UATA 1WD7A 2V0CA 2RAPA 3QZUA 5LMZA 5HM6A 4PIZA 4AD8A 3FSEA 3IDFA 4XETA 4BCBA 5CK5A 5L51A 3RBAA 2UKDA 2J1LA 3IUQA 5CA1B 4CE8A 2IYUA 5FOSA 3DXXA 2C61A 1Z4OA 5KXBA 2PLRA 1O97C 5BSGA 5BMOA 5LZ7A 3Q8WA 4GXRA 2QT0A 2Y9MB 1YAHA 3REFA 2RI6A 4Q1DA 1CUIA 1P2TA 2CHHA 3DOJA 4ZOLF 2ZYAA 3QXHA 2IHKA 3LL7A 3LGXA 5AQ1A 4DKJA 2EICA 1DRWA 3KT7A 5FX2A 4XJSA 3EXFB 3MUOA 3JASB 2BJSA 4EGFA 1UQUA 5TQ2B 3ZKYA 3N07A 3BI3A 4L8LA 1QQP1 1AMUA 4FVTA 1YB2A 3BTVA 2XOKD 3NHAA 3WLMA 2PHRA 2VUSA 3DOIA 4QPGC 1E0KA 1AY0A 1R27A 1OU0A 4RIGA 1Y4UA 1QB7A 1CJVC 2G76A 5EMMA 4DGSA 5HJ2A 4JEMA 3SC7X 5LQRA 5DHRA 2LD4A 1OVMA 4EGQA 4YAKA 3NGLA 5L4NA 4COOA 5C37A 4G09A 5I7VA 3O1LA 1XD2A 5EJ1B 5JSUA 3IAM6 4N9HA 1NMYA 5T55A 2HXSA 3OSZA 1BCSA 3PVBB 1M33A 5DDJ3 4II3A 3K9CA 4TYSA 4CUGA 3DFUA 4GB33 3FHJA 2CLHB 5F5XA 1QUEA 5KJCA 2PSJA 3EBRA 2H1WA 3DMRA 1BXHA 1OW3B 2EIEA 5JZGA 4CG3A 4A0SA 1CZTA 1Y63A 4DNYA 4FB4A 1RQNA 1XXHB 1UFKA 5MFZA 1T0HB 4ITRC 1VSTA 1WGPA 2ZR0A 4UFLA 3B78A 5JAMA 4FFDA 2B2XA 4A3SA 4LTNA 4Q03A 3GFGA 2ZYTX 5K1ZA 3U7JA 3EPHA 2J7PA 2J9XB 1HV0A 3DF9A 1R50A 5C6CA 1I9CA 4QXCA 1F14A 1K7EB 2BAGA 2WMOB 1JSZA 3HM9A 2GHQA 3WP0A 4AEDC 5LA0A 1W4AA 3PXEA 5BXQC 4EG0A 5C70A 4E7OA 1V6IA 4HH1A 5DOZA 5CXUA 5EJ3A 4YMLA 3CX7A 2PGIA 1AV6A 1KIMA 5DSTA 4Z0PA 2BHLA 1ESZA 4CEIB 4ZOCA 1XNCA 2QL7A 2LRPA 1QG4A 4XDPA 2RE9A 2UUPA 3C6MA 4Z6KA 2EC5A 4U0JA 1FTGA 4FEEA 4P5PA 2B82A 5TPZD 1XC6A 1N77A 3R0IA 3EQ9A 1RVDA 1EBFA 1P5RA 3DEJA 3PC8C 1DAFA 3MT0A 1XMQB 4URXR 3WLHA 3L84A 1BKSB 4YCBA 3H8SA 1MVLA 3OETA 2CBXA 3MBWA 4UUMA 1UYZA 3HYRA 1RRPA 4R2XA 3QKUA 3VFDA 1EE1A 2YFYA 1QX4A 2P4SA 3DDHA 5CXQA 3IPVA 2DWOA 4XJVA 4KK3A 3HXMA 4NCAA 2GN7A 2YC4C 4MGEA 2RAVA 1MV5A 4LDNA 5CDYA 2JBAA 3HYTA 3EUFA 2IHNA 3J8F3 5B53A 4JKMA 5EVCA 4MEBA 2SBAA 3DTVA 3KT4A 4HEQA 1YI0A 3KAQA 1LGCA 1GU7A 2D0IA 5K0NA 3V8MA 4LUMA 4IICA 2NXWA 3GXBA 1XE8A 3ONVA 1I8TA 4FXKB 3UJ3X 2YWDA 4W6WA 4C4YA 4YP7A 1UPSA 2O5CA 4NEGA 3CX6A 1V8ZA 3K4ZA 2XHKA 4OTZA 4MDEA 3PQEA 1M1YB 4RIFA 2RM21 4FFFA 2YBDA 1GFZA 1EQUA 1LOBA 1G5QA 1KERA 2DFBA 2YICA 2ETVA 4OH1A 3DHVA 2IP4A 2D1SA 5CRIA 5J7MA 1EK6A 3ASIA 1G9BA 3QW4B 3W6PA 2JB4A 1NM5A 3PQ7A 1U7TA 1PHPA 3N2EA 2IFTA 1B8PA 1BMDA 2J59A 1ECJA 2XWPA 3CT6A 4MVJG 4DZRA 4DMLA 3NTUA 1OAOA 3EEIA 3DCQA 3AWIA 1CF9A 1GPYA 2Q1XA 4HAOA 1ZUD1 3DLPX 3WLJA 3DWFA 3ZYCA 3DXUA 2AWOA 4FXOA 4I5IA 1KO7A 5AK6A 3WGUA 3I05A 3WGQA 3T7IA 1I7NA 2EKPA 3V32A 4GP6A 1RHI2 1NFRA 3DBRB 4JVAA 1T3GA 1T1IA 2QFEA 4ZO8A 2JIZA 4F3NA 1XVUA 2WLSA 4RH3A 5IK8A 3TRKA 2WF6A 3A2KA 5HV0A 3P0HA 5T3NA 5T3UA 4GM0A 2VAPA 1X7XB 2PRIA 1AKYA 5CFRA 2JJYA 5K5EA 1KK2A 4B9AA 1DQSA 5BN4A 4MWCA 2V59A 5C1BA 3LDUA 3W5VA 4MUGA 1DCMA 2IZ1A 3JVVA 4QELA 2PSEA 4FS8A 2IDJA 1Y1SA 2XL9A 3O8RA 5IWAB 4ONUA 1LRLA 4LFAB 1KBZA 4TXJA 4YT4A 2CJPA 5JJKA 4P31A 1H05A 2A4KA 1K5DA 2IYWA 3BTSA 3DUIA 3K46A 2DVDA 4N7IA 1N32B 4BP8A 2AC1A 4RS5A 3OMXA 3RFUA 3LGSA 4GVLA 3WSVA 5LBFA 5LKAA 4P83A 3DW3X 3GARA 3OQ1A 4NMHA 4KSBA 5D7NA 1YZNA 2ZJ6A 4HPKB 4TS3A 2WKWA 1HT0A 4DLSA 1ZZ8A 3K70B 1LR5A 4O08A 5CCDA 5SV2A 1ZRFA 4BV9A 5CG8A 2EBFX 2VF4X 4AY4A 5JADA 3NASA 1FNZA 1PU2A 2BKAA 2Q8QA 3AXSA 1JVNA 3ZXAC 1E66A 3FHCB 1KQPA 3PFFA 5IJRA 3GLHA 3FWYA 4EKNB 4B7KA 1NUPA 4MRMA 4B7EA 1XOIA 4OHOA 5FLJA 2X7XA 4MYDA 5FWAA 3ND6A 2XVGA 2QXYA 2G77B 1SBHA 3SLRA 5KWVA 3TSZA 4REOA 2CDOA 4B6SA 4TVSA 3LOBA 4JQZA 4UW3A 2XCTB 3VNQA 4YBRA 4OQZA 4UWDA 4YJ3B 5I0RA 1LX7A 1JUIA 4IFBA 1S5PA 3Q7QA 4YJHB 4B44A 2R042 4MULA 2B92A 4JQCA 4L85A 2AZ5A 4MUHA 5LWHA 2ZAIA 4Q15A 1G4HA 2CXOA 3BQ9A 1D9XA 2I8LA 1AL21 2ZSFA 4GF5A 2E51A 3TE7A 3TNDA 1Z0KA 3SM3A 5AM1A 2QBYA 1NNSA 1IL0A 5G1NA 1SHWB 3V9PA 2R6FA 4XARA 4DLUA 4W4ZA 1BHO1 2FK8A 3ZY6A 1NVFA 4NOMA 2UUAB 1QAOA 2FGJA 2PU7A 1WUKS 3W5MA 5FYUA 2LUOA 5I9BA 2PIDA 5EIHA 2XLAA 3KLSA 3T2QA 2QLJA 4G0NA 2XTMA 3OUTA 3PDIB 1VE7A 4GECA 3BXGA 4GM1A 1PJRA 1K6MA 2ZBEA 1M72A 3TJZA 5GVSA 1YFJA 4DY3A 3FUUA 1R093 4ZN6A 4ZJZA 3HWSA 3HC7A 2YXNA 5H5JA 3NKTA 3AJDA 2N1MA 1GARA 5KNLA 4BNDA 4FWIB 3FMIA 2DURA 5DSZA 2A70A 4QDXA 2AOVA 2JFZA 2CFCA 2BKEA 8MHTA 4MAAA 2NP0A 2VDJA 4QC2A 1GNHA 4QBHA 3ZBPA 4W4TA 4UU8A 5ECGC 1L5FA 4EJ2A 3E27A 4JSYA 2JFUA 1EM8B 2V5VA 5AI5A 5ICSA 3IM0A 2R1ZA 1OIWA 3LPNA 1VMIA 5BW6B 3VD7A 1TB4A 2PNFA 3UMJA 3GFOA 3W8NA 1Y4AE 3KXKA 4GW3A 1S8OA 1FNCA 3EG9A 1LU9A 3AEUA 1F7UA 2RHRA 1Z29A 3NHLA 4WN3A 2QJVA 2AXEA 4EJMA 1NCQA 1SC1A 5AVSA 2RHHA 3JSAA 3WRWA 4R1SA 4P98A 3OMWA 3AWDA 4HWTA 2P2SA 1H2RS 5AICA 5EE9A 3WMFA 3W5HA 1WW4A 1WCYA 4KG8A 4NMWA 3EGWA 4C4OA 5IUNC 4OHRA 2IPLA 3IO5A 4BNVA 1Z5GA 2VULA 2YIJA 3NWJA 1RJ8A 1Z7BA 2BI8A 5KVSA 1GA6A 4KQEA 2ZXQA 1NW5A 4OLAA 4ZPXA 4DAOA 3E58A 3EGDB 2OQIA 4LKFA 2XF2A 4QRHA 3TXXA 3VBHB 2NVBA 2JGEA 1N25A 2VZ9A 1EDDA 1N78A 1VJRA 1JJAA 4WW0A 1N5LA 3WHPA 3FFBA 4JXKA 1SFRA 4MAMA 1AKTA 2LBPA 3KJIA 2I3GA 4I3HA 3PNMA 1DTSA 3K77A 3HN6A 3PUXA 4WQMA 4AW9A 2WAOA 1D1QA 1U5BA 5IARA 3TQHA 3JBG2 4CP2A 3FYHA 5KS2A 1F8XA 1JYEA 3GNEA 1OB5A 2WINB 4B87A 1VLZA 4P35A 5FXVA 3QPVA 5EZ5A 3U3DA 4OFZA 2J3KA 2JG9C 1CCWA 1N0VC 3OTFA 1RAHA 2BH2A 4C1NA 4R71A 1RKUA 4RFVA 4MLCA 2UDPA 3EISA 4NR0A 3W8RA 3W5IA 5JOYA 2XJVA 3IT3A 4ZRMA 4ATFA 1GADO 3MLKA 3TIFA 1DINA 4KQ7A 5M0TA 4Q4LA 4PPQA 3AR6A 3HDHA 5CVVA 1XRMA 1IZ7A 4YARA 3LQ2A 4D3XA 3U78A 1M2VB 1YTUA 1JLKA 1O0BA 4W6ZA 4IHKA 3G5TA 4C4AA 1P17A 1QO9A 1R3DA 1SG0A 1N5DA 1ZJWA 4XF3A 5BRNA 3V8QA 4AROA 1ZD3A 5DHFA 3CEPB 3RZLA 1CLUA 3ADKA 2GXAA 4QTYA 2WZR2 1O54A 1PW7A 4QE3A 1OFHA 2HF2A 4F7DA 1H42A 1KP9A 5I7UA 1SA0A 4MJ7A 5JR3A 4Q4Y1 4GKBA 3UV3A 3IPRA 1BHJA 5K45A 1JA0A 3BD7A 1VLMA 2BM1A 3L6RA 2VP4A 1WCUA 4EPRA 2W6IA 3QYPA 3F6EX 2NUTA 1VFNA 1QHXA 2Z58A 2I4TA 2BJVA 1M5TA 1V3QE 2ORXA 4YUZA 4LO7A 2ET6A 4N49A 4L8FA 1HLFA 1XZIA 4OQPA 1G7CA 1NA1B 1F8FA 4Q8LA 3P32A 5DIFA 1GSAA 1HK7A 1OZHA 4DDUA 1S0FA 3C1OA 3ZQ6A 1G5IA 2QQEA 5JVDF 2VJQA 3CRMA 5AIBA 2HKXA 3AVYA 4QJBA 1Y8QB 4GI1A 5FBVB 1NQVA 3PRHA 5FJIA 4V03A 1XTJA 1B76A 4Y6GB 4ES8A 4F1WA 3W8DA 2PGJA 1YI1A 1LBSA 1AYN2 5DTIA 3MV11 2EJVA 2QTLA 1XN4A 3REQB 2GLUA 2AN4A 1U8ZA 2WWIA 5F3IA 3SG0A 1OWMA 3DVAB 3CUKA 3OURA 5D2CA 1TMKA 1A82A 3N7JA 2HCBA 2V6JA 4ZAYA 5FOJB 1UX6A 4Y8VA 1K8ZB 4OUDB 1MS3A 1ML4A 2Q8DA 2BZ0A 2R8PA 3B00A 2QMHA 3ZU4A 4EZ4A 4G56A 1Z12A 5L95A 1WMSA 2ZR8A 2HSJA 5B30A 4RY2A 2RGDA 4URWR 5BR4A 3KOZA 1PHRA 2GR9A 2X23A 3G2HA 4D69A 3U9SA 1PGL1 5BNZA 4PYKA 3C3MA 5FO1A 1ETUA 1Y9MA 4IQ8A 3OHMA 2OFPA 1G3MA 4BYYA 1CYEA 1SWVA 2ECOA 5FREA 1ACLA 1DFQA 2JDIA 5JZMA 3DTTA 2IOQA 5T41A 1CJCA 2IEBA 2AMVA 4F6RA 5KI6A 4PT6A 4L50A 4BN0A 3H1PA 2YOHA 5KUTA 5D85A 1MMFB 4NAUA 2ZT6A 4EYOA 3VBOC 3M8KA 5A4KA 1RUE3 5I7RA 3DLAA 3DQPA 3PUQA 1KJJA 3MF4A 4WUTA 1U0OC 4HGNA 4I81A 4FYHA 2CEAA 1F2UB 2FH5B 1U8XX 4BBJA 3KQYA 2QYTA 1D0HA 1DIWA 3CEWA 2ZJCA 1XB2A 4MOWA 1JX6A 3ZQKA 2DCYA 1CRQA 2Y6GA 2X0JA 3PFHA 1X50A 3AETA 5AW9A 3ZKWB 4FGLA 5A03A 3H5RA 2XEXA 4RZIA 5FK8A 3FETA 2VTDA 2XNDD 1YH3A 1DADA 2JD4A 5E0KB 3ZD6A 2BFNA 1VDZA 2JAQA 4K9NA 2O4CA 2PGDA 1R5JA 5AO9A 2PSDA 3F5MA 1BBT1 3K9NA 3TEFA 3M3HA 3GXUA 1N5MA 5IF9A 4WZAA 3FTQA 2I45A 1F3LA 2QDXA 4DDHA 5E8RA 1IEXA 1SUDA 4O1IA 4QUIA 1SCUA 2VFAA 4R9SA 2Y93A 1ULCA 4A44A 4ARXA 1RUJ1 3WWZA 4UEWA 4XIIA 1Q3TA 4FFRA 4LO6B 1BCSB 3PHHA 2JI4A 4LE0A 3DB1A 1P8JA 3ZPOA 4S05A 4RGQA 5DQ0A 3VPHA 4TTGA 4RNDB 4NESA 5ILOA 1FCJA 4HVOA 4OSOA 4UBHA 2YXSA 2ORED 3IP8A 4MKZA 3WBBA 3BE4A 1WPGA 2QYOA 1OKKA 1TYEB 4OL0A 1ZD5A 3VNVA 1XSQA 2GZWA 1LPMA 2HYDA 1FFEA 3QNWA 1ENPA 1P4RA 2LRHA 3AM5A 3VYRB 1U2ZA 4YONB 2OPWA 2IEGA 1PX3A 1UC4B 5AI9A 1C9EA 2GAJA 2ODBA 1NQAO 1KYXA 5FD8A 2HLNA 2XVYA 2IPNA 3R24A 1EG2A 1TKAA 3ZJUA 3GNTA 3K92A 1RJDA 3ID6C 3D6JA 4L0CA 3DOFA 4QLAA 3KM0A 4Y0VA 2GWHA 4AIIA 1RAEA 3A7QA 1KI9A 1E2QA 2I54A 4PG8A 5DAWA 2YFKA 3WDMA 1W2AX 2IIPA 1QRRA 1TU0A 4P2BA 3N74A 2YVLA 5HM8A 2QUZA 2R2AA 3PYXA 2RS33 5CHEA 2GB4A 3GQVA 3L4KA 2H00A 3FFTA 4A42A 5HW0A 3HGQA 3E2IA 4QD2A 3C7GA 1TMGE 1FSSA 1KIAA 3B8EA 3RSGA 2W70A 5FBJA 4E4DX 4CF7A 3CHXA 1GPUA 4BVBA 3I2IA 4HUQA 2HAEA 4L4XA 1QJU2 3T12A 3OBAA 2PV7A 4WCFA 2QLBA 1O94C 3IPVB 1TCCA 1UK8A 1DUIA 2X5JO 3WNNA 1Q8PA 4GEGA 1KGDA 1BHSA 1XU2A 2PAAA 1RCFA 1B6RA 2JBAB 3KGLA 2W58A 1Q6ZA 3FB4A 2I34A 3K5PA 5E4YA 1TTHA 3EY9A 5TSDA 4ZMSA 4K2HA 4IM7A 1XDSA 2ECPA 2BFFB 2WIJA 2OPKA 3O8CA 3FZQA 2FBEA 5ES4B 4YRFA 4YPJA 2QY6A 3ORJA 4LBZA 1L4KA 1HDKA 5FZ0A 2HMWA 2VHUA 4IRXA 3WP3A 1BWRA 3LOPA 5EXTA 4WXRA 4M8KA 3SLIA 3PT5A 4NCIA 4RVSA 2FP4B 3CU5A 2WBLC 3ZK9A 3WAKA 3IDSA 3D8TA 3LPMA 1FNDA 1UJ5A 2O23A 2G40A 2V6GA 1ZOOA 4Z1MD 2BI4A 1OPOA 4C90A 4BVLA 1S9DA 1SXJE 2PM8A 1RQLA 2ZHKA 4MQ4A 4V0QA 5COQA 4ZYWA 1DQ1A 4GICA 1HRDA 1SVIA 1R37A 1ZR2A 5EA2A 1C3OA 2QUAA 1MG5A 3BH0A 1FV3A 4A5SA 4A73A 1WB4A 5EXDA 4U02A 4KFSA 2VNRA 3DOCA 1VYVA 4DJAA 3CJIC 3QKIA 2HLDA 1R5OA 5TV2A 4MPJA 4C4SA 2E6VA 3EDRA 4JTNA 3QEKA 3K8ZA 5DGTA 1UUFA 4F6LA 5K3EA 2P9ZA 4F85A 4OQQA 4PYMA 4KN9S 3AR7A 3IIMA 5BN4B 5SYNA 3QEOA 4BEBA 2Q4RA 2EF6A 4Q4X2 4JR1A 2GF0A 4YPOA 2I2DA 3FRIA 2A92A 4NZPA 4XM2A 3AMNA 4CM4A 3WTCA 5A3VA 3WGZA 2QTZA 3VDAA 3F7NA 4JT9A 2OO5A 2JARA 2BFWA 3GCXA 1UC9A 1BVP1 5C8DA 4P7FA 4KVAA 3ZBQA 5A04A 1Z6TA 1V39A 3RSCA 4QTTB 4ARCA 1PGQA 1UAYA 4IQGA 5BY2A 2F1JA 4A82A 4RS5B 1Z2NX 4YUVA 1JDUA 1J07A 1UY2A 4WNAA 4OHCA 1ZGGA 1ZVMA 3FTNA 3WV5A 5MFPA 2M1XA 3KUXA 4BIFA 3DN7A 1NZIA 2QLLA 4JKIA 3B6EA 3FAKA 3GFFA 1JR2A 3VC7A 1K5HA 4DNPA 2X8KA 4Q3DA 2HB6A 3AC0A 1HYHA 4E9KA 2F00A 3DFMA 2WIDA 4Q39A 3U1BA 4HX5A 5KOJB 5DYGA 3GLHB 3ZZUA 4L97A 2FN4A 4QTUB 1LKNA 4MRMB 1R8XA 4J1QA 5HZMA 3DSRA 3OQ6A 2PFGA 2HRRA 1AKNA 1C3VA 3QY0A 3FY4A 1XZGA 4WBSA 2BGIA 2IGBA 4P9GA 1W0CA 1ZL2A 5E88A 5DP1A 1C9DB 3VBFA 3L8YA 5F5NA 3VI3B 4IQFA 1O9GA 2HSWA 1NXMA 1WHTA 4DN6A 5KX5F 4MI1A 3C24A 5FR3A 2H3EA 5EQFA 3T5AA 1I32A 2KLBA 5EJAA 2HA0A 2AQIA 2EBUA 3E0XA 1O95C 2EG5A 3O4IA 2ZAYA 3NAZA 5ESDA 5HNKA 3TKLA 1W8IA 4AJKA 2ID9A 3ZDCA 1IHDA 4UNNA 2OXFA 5A0TA 5C3MA 4CNQA 3RTGA 3OTQA 3ZLUA 4HK9A 2QBYB 3S3TA 1XNGA 3TLJA 3H9UA 3OUIA 3N3AC 3NFRA 2DGDA 2CGOA 2YHJA 3WNPA 2CHEA 2BZSA 5JC8A 3PXAA 2YCBA 2ZQ5A 4LDPA 5FYIA 4LK2A 1KS4A 5EQJB 5EWJA 2WNVA 3NV2A 1YASA 2DM6A 2BRTA 5E1DA 2YUTA 5HRCA 2XJPA 3LWNA 4I1SA 5CM9C 1H5NA 1JJ7A 2VJAA 5I51A 2ZJ5A 1T43A 5TMPA 2BYTA 2I7VA 2IC1A 2IIVA 4B8YA 4MB0A 2CXUA 4NABA 4ZEXA 1QGOA 1ZSVA 4BNDB 1G2QA 1UZZA 1L4FA 3FF4A 3PE4A 3WSWA 4F96A 4DBZA 1KH3A 3SZGA 3TLEA 2ZS9A 4MKHA 5KQMA 5IK2D 4ZZ5A 3S2YA 4AI8A 1DE0A 4CM3A 3KCNA 4B3GA 3ZE9A 4A91A 2ZGKA 1J9ZA 3GZ4A 3VVMA 1CY4A 2OT3B 4FQ4A 4BYMA 4IXNA 3ASZA 5K4LA 1XZKA 2JGAA 3REGA 1NY71 3AEUB 2E32A 2YBPA 4DY6A 1NCQB 1QM5A 1R8SA 4Q0PA 1TQHA 5LDGA 1EJ2A 3ZWYA 1JZ4A 4PCAA 1PO7A 1TM4E 3P4XA 4COYA 1BMQA 1P7ZA 1L3JA 4QKDA 1D2HA 1PZGA 1Z5PA 1Y0BA 3P9ZA 3PX7A 4GLFA 1EAH2 5I7EA 1P61B 3HXPA 1E5SA 4OVKA 3OWHA 3O93A 3WGJA 3MW8A 4LECA 3KYCA 1Q0HA 3K0FB 1XALA 4Q4V3 2R6R1 4OYYA 2V97A 2FMTA 5DYYA 3EASA 2G1UA 4GC9A 5FV4A 1F0KA 4YG6A 2JFGA 1AZLA 4Q7KA 4JIGA 1JFFB 4LR4A 2A78A 1MS1A 1RI2A 2WF8A 1QDUA 4R9NA 4XB1A 4G0YA 2CL7X 2WMYA 3KYIB 3VRHA 2WO1A 2YASA 3PDCA 3TZCA 2P3YA 1GPWB 5EUQB 2ZE8A 4LY0A 5CBPA 3GJ7A 4OJMX 4OHKA 5CCBA 2JX9A 1X9GA 4KVGA 4XFCA 4WJKB 4TL8A 5LA6A 1RP7A 4PAOA 2CAUA 4FJ0A 3LKVA 1GKUB 4FHFA 3AJ8A 2C5GA 1XQ9A 2E5FA 2W5FA 4O2AF 3JD71 1F0YA 1JDZA 1B2LA 2H2GA 4QBFA 2IYYA 4UMEA 3I3MA 3SSNA 3H1EA 1RR6A 2CBGA 1DZ3A 1VLQA 1XZDA 1G6Q1 3BX1A 3KJXA 4DBLC 1FRNA 4HGOA 1O6CA 4HP8A 1NBAA 2QPAA 1K89A 1EFLA 3JD1A 4PXSA 3PC2A 3DLIA 4DIQA 4M1EA 3AB7A 3U4SA 5EAIA 1F0NA 3Q8FA 4N7UA 4UM5A 2IBMA 5FYMA 2MSEB 2FWJA 2GQ0A 1JNYA 1KS5A 3ETQA 5AW6A 2VCCA 3KWFA 2GCNA 3OGVA 5DBFA 3FCEA 2JLVA 1RE0A 1Z82A 3IUMA 3CZRA 3RZKA 1V11B 5EZWA 2JPDA 4OHZA 2RMU1 3MXOA 1VE6A 3T9CA 4BFXA 5FOQA 4L6AA 4CU7A 1SA0B 4IE5A 3SZUA 3MJRA 1HXS1 5T52A 1B0PA 4UEJA 1R6XA 4BE9A 3ETLA 3KE8A 4F0JA 1D2AA 2NUTB 1BD3A 4GMP1 1ZOPA 2UVQA 4TTSA 4JK3A 1DQ2A 2H06A 2I3BA 4PTLA 5LPNA 4A5OA 2FSIA 1YB7A 1RPNA 4Z9FA 1WAMA 4QYXA 2C97A 1FLDA 2PGNA 4O1MA 4TV9A 4YJ2F 1N6OA 1F60A 5C8CA 1EMDA 5D7BA 2E82A 2Q3DA 4POAA 2BEWB 1DAKA 2O8NA 3O95A 1V7CA 1SDDB 3O1RA 3I3DA 2JE7A 2PMCA 1CR7A 1EGQA 4FVVA 5FWXA 1JSCA 1JPVA 1ZBQA 1IAQA 1D2CA 5EJ7A 1GNPA 4AHYA 1IY1A 2QE6A 3QBJA 3ILSA 1QH7A 3UAXA 3G82C 2P3OA 3OX4A 4XUCA 4IEQA 1IUNA 5A6YA 3KQRA 4FFMA 2HADA 3JAMA 2MSNA 1NW9B 3TQCA 3ZX7A 3X2EA 5K0BA 4D8WA 1YR8A 2TECE 5I8SA 4EA8A 4QVIA 1QJY2 2BFDB 5LY1A 1JIKA 3TR5A 4C7BA 2F3SA 2FA9A 4FW9A 2XVMA 3WYFA 4M4PA 5CH3A 1HE8B 5FMBA 3S8MA 2QRLA 4K9PA 4UATA 1TC1A 4E2ZA 3JYQA 1C30B 1GKBA 4TWRA 1F4VA 3QMMA 2ZR7A 4NZNA 3FHQA 4E7PA 2IEAA 2CZQA 2HHAA 3PEVA 3W06A 1AKMA 5FWNA 3PQ4A 3B5EA 1A8UA 2QZPA 5CAZA 5JBQA 4CUAA 1SMVA 4XIJA 4X1YA 3R4CA 4P9YA 4QPIB 1LSUA 4BLJA 4C0SA 3UV7A 2YVUA 3CVOA 1J24A 3VR2D 4RFRB 4F5YA 4F6RB 4FP3A 3GM8A 3GJZA 3MIBA 4IWNA 3HKEA 1WW7A 2GEVA 4X1OA 2JK1A 5LQAA 1FDWA 1G5HA 3AUUA 4C9BA 4DIBA 3ULKA 3VZRA 5B4NA 4D8YA 1ORWA 1QDLB 2QX9A 3TW6A 3EZFA 4YCMA 4YW5A 2YY7A 4RL7A 1SQGA 3D02A 1W4ZA 3JY6A 5CIYA 2UZ1A 1VJ1A 3GPCA 4KYUA 1VYHA 5THKA 2QW0X 1KZ4A 2A5ZA 1W5TA 3I49A 1WB5A 4O4JA 1NVEA 4EX7A 4EA6A 1NN5A 13PKA 4NY1A 2P2GA 2Y0PA 4DV4B 4TOIA 1W2HA 3OJWA 1B43A 4MUBA 4TL7A 5FA5A 5KOIA 4N3AA 3IPLA 4BMDA 2C57A 5DP2A 4IQPA 4MP6A 1IPHA 5ICCA 1PQWA 1U5IA 5TMDA 3O82A 4PXAA 2GWRA 3ZR6A 3HI6A 2NO7A 1QK4A 2HJSA 5D3MB 1ZBE2 4NIAA 1PTJC 3I9MA 4G4SP 4JC5A 4I1IA 3AIKA 1SCUB 3BMCB 3TDNA 4OXXA 3MVEA 1DKUA 1YJQA 5IFKA 4BO4A 1GNZA 1SC4A 3MTDA 3SHWA 4AZTA 4KXXA 5BUQA 4R9AA 1GLVA 4WFJA 1SZBA 3RKUA 2OXCA 2R86A 2D00A 3CURA 2WWSA 3X1DA 2BRUA 4KYVA 1Z6PA 4NQRA 1OHHA 3LB9A 4JSRA 2VS1A 5BVGA 2CVPA 1L7MA 1GQSA 4DG8A 4YJGB 1T34A 1CNMA 2W95A 3LVQE 2FSVA 2VD7A 3PFKA 4C21A 1AKVA 2HSDA 1UKZA 2QP9X 1CFZA 4RSHA 3A28A 1UXZA 3W5NA 5GLVA 3KQOA 3QH7A 1TME3 2E7ZA 1CULC 1KKMA 2ZI5A 1XC7A 5EN4A 2VZVA 3G88A 3HO1A 1RXFA 2PFWA 1SKYB 2QXTA 4EJ0A 4TWBA 2WOOA 1FFBA 2HYIC 2IU4A 4HQKA 3EOBI 4GP7A 1V0JA 3ECAA 3TGPA 4L16A 4D0NA 1WXIA 2X2OA 5IG2A 4QHYA 2FCAA 1G9AA 4GGOA 4D9KA 2NO1A 3E53A 3GJSA 1Q8OA 1T91A 4CHGA 2RGNC 2G63A 1H2YA 2XUQA 1TCVA 2CUZA 4RR3C 4BRZA 4YG3A 3ZY4A 1A27A 4FK8A 3RTCA 2XOEA 3KKLA 1LNZA 2QZZA 3EDCA 1E9SA 2G82A 3EH1A 3HVJA 1J00A 4CCNA 1VB4A 3SH5A 4LIUA 3H83A 3SQDA 2F9MA 5ALOA 2QCSB 2Z2SB 4ER6A 5FBKA 5GPBA 4P81A 4GWNA 1FYVA 4HUQB 3AVQA 3TTTA 4J7CA 4G24A 5HS6A 1A8HA 3DWEX 5AW4A 4X85A 2PD3A 1XTTA 3NOQA 3WQ1A 1VRWA 3E1KA 3EXEB 1VAVA 2LTNA 4XDZA 5FZ9A 4JKYA 3W4KA 1C8VB 2FTKE 4JJIA 2FUCA 1BW9A 4BMBA 4PSAA 2V5DA 3LNCA 3AZXA 5CYOA 4E08A 3THSA 3Q6NA 1SZJG 2CNOA 2EDAA 3AI1A 1PP4A 4B6RA 5FHRA 3BRQA 3JYOA 2R2GA 1U6JA 2HPAA 1AS0A 3PL1A 2X77A 1RB8G 3W7AA 4MIEA 4RWEA 3RGGA 2OYRA 5FUMA 2OCYC 4R7GA 2F7SA 2OR3A 2FWPA 3PUSA 3S2ZA 1OH6A 3L7OA 2AKYA 2GYVA 3ZWVA 1JGTA 1MAWA 3THXB 3NNGA 1V26A 3FR8A 3UESA 1J33A 3PKIA 5IFPA 1SRRA 2VJMA 1U4SA 4R01A 1LJ7A 1W9SA 1R0SA 1AS3A 4CV1A 1PR9A 4J6EA 2UZIR 2ZUSA 2PBZA 1NYWA 5IJXA 1AR61 2B7CA 1SOMA 1T8PA 5IDVA 2CMDA 1YDGA 3YASA 2QVBA 2Y3IA 3VPDA 3GEEA 5FFFA 4QU8A 2XRZA 1KI3A 1Q1QA 2Q2VA 4FX2A 1PHMA 4P0QB 3P0FA 2XUPA 5B7NA 4HVCA 1T2FA 4OULA 1CJPA 3PXDA 4MW5A 4R2LA 5FBHA 1JEYA 2CL5A 3FUOA 1LUAA 4BQ4A 1U80A 1G63A 1E8DA 3T5TA 2R1UA 4LHWA 5LWBA 4E5PA 3QMPA 3TZQA 4BCDA 3FNEA 1W39A 3H9QA 2W71A 3EWSA 1Z0FA 3CG0A 2HPVA 1NDHA 5JWRA 1GTL1 4M9CA 4RVGA 1ND2B 1JYVA 1SBNE 4B47A 3Q72A 5CNAA 3TD9A 2Q4TA 2O1WA 4NI5A 4R0NA 4MW1A 2V98A 2YWJA 4PG5A 3IEKA 2O50A 4UJ5A 3LD9A 5ACA1 3OPNA 1QORA 1Y7LA 4AWXA 4OOEA 4KR9A 4AXXA 2O2CA 1VBC2 2FPIA 1Y8AA 5ESWA 2QMYA 2C2MA 2QV0A 3IJEB 3PDWA 3GOHA 3LXUX 2E0IA 4YV0A 4MG2A 3UETA 3N2NA 1P9NA 1UOFA 2V9ZA 5FUYA 4D3WA 4ZAXA 1PFWA 2VIIA 4CM7A 1FFWA 3WK4A 4YHBA 1UQTA 3GJ4A 1LZLA 4CUBA 1GPMA 4UMVA 4TVOA 2NADA 2VBCA 2XA1A 1W0KD 4YCSA 1ZK1A 2GDJA 1DJLA 1RWBA 2QYSA 2A1XA 4I99A 1XQXA 4F97A 4DLXA 3SH3A 4QUKA 5F77A 4GQIA 1CVLA 4IV3C 3A04A 1XKLA 3HNPA 3OBTA 3C5VA 5LZ4A 3VDBA 2EQAA 4X6QB 4KG7A 1JODA 3BE8A 3CLRC 1D0SA 2ONYA 1J9EA 2P78A 2WM2A 4Q1PA 4ZY9A 4L8VA 3M1YA 1XLWA 5C81A 4CODB 5KHIA 3RC9A 1ZMXA 3H7JA 3BILA 3VBFB 3OX3A 4ZYLA 4K0RA 5I7AA 3H2KA 1WHTB 4OHPA 1QGLA 3FUCA 4UFJA 4FC6A 3Q87B 3M3IA 2CVHA 4AECA 3W2TA 4P0TA 1TEIA 4RL6A 3RS0A 2D3RA 1ZKDA 3LWCA 4B4QA 2O8OA 4CCJA 3PJFA 4EX6A 1YDWA 3IP1A 3L93A 2YBKA 3ENVA 1TVGA 4MGYE 2HREA 1YBAA 2XCUA 3EEBA 1ZC3A 2ZAGA 3IBTA 4R2JA 1YQWA 2REXB 1HDCA 5BP7A 1NVDA 3JAKA 1T8TA 2I3AA 1MW8X 4OHVA 3KO8A 4UXJA 4RMGA 3MGBA 4YVSA 4Y1EA 3VNAA 2WNVB 2JL1A 1AMNA 1XA4A 4L6CA 1CAUB 3RW9A 4XGKA 4XZPA 2CXSA 3U1VA 3ZXDA 3ZLJA 4R1UA 4MVWA 2YUEA 1CSEE 1S01A 4AI1A 3QCWA 4AY5A 2A3WA 2AQHA 3FJSA 4O4LA 4JLJA 3P1JA 1EK1A 1AQ6A 2XCQA 3WA7A 2AJBA 3AEQA 4J0DA 4BIIA 4P08A 1U8EA 1PGOA 2W6NA 5L3SB 3B2QA 1ZEMA 2NWQA 4OVEA 2EZ8A 2MEV3 4HOYA 5C3UA 2GESA 3SQMA 1OGYA 1L5KA 2JKXA 3PF9A 1ML3A 2YYYA 1AR93 4JVLA 3MO4A 1XDUA 3EWIA 2BNOA 4P3PA 1HDOA 1I14A 1CTQA 3FSRA 1FXSA 1YBMA 3TSOA 2VMHA 5JEEA 5DM4A 4RYDA 1T0JB 1KEXA 3M83A 3Q7IA 2AQKA 1UKYA 4DNFA 3MS4A 5C3OA 5GZFA 3PB3A 3LYHA 1DYPA 1JQ5A 3AB3A 1RHJA 3OFVA 4D0QA 5FYBA 5CTJA 3C3BA 1LJ8A 2ONKA 3A22A 1KK1A 1O91A 2IPMA 5CD1A 4RPLA 3IQFA 2RHPA 1KZ6A 1ODLA 2Y1LA 1MT0A 1GPH1 1MVOA 5BUZA 5IT0A 1VFPA 2QZJA 4F2PA 1RIIA 2VUDA 4WRRA 4D9MA 3ZCVA 3KYCB 2YW9A 1ND6A 3L0IB 3E5RA 1XL1A 1LEDA 4YP1A 1LOFA 3EVTA 1D2SA 4E6EA 3MLBA 2H31A 2J4CA 3RNOA 2IYFA 1G18A 4QGLA 3NM5A 3UGJA 2CE7A 3EA4A 2F62A 3OEBA 1D4OA 1JDBB 3RHSA 4HDQB 1K6JA 1HE1C 3N76A 5FAKA 1P0FA 2HKIA 3BS4A 2PHFA 1GVHA 3VKFC 2ZXEA 2ID7A 4ITUA 4YMTA 3PQ5A 1DLLA 1HORA 2PBLA 5LA9A 3NMBA 1I6MA 3MBIA 4MV9A 3IOBA 1X1BA 2WS93 5I9TA 4JLOA 4Q4AA 1OB2A 7REQA 3KLNA 3ECSA 2W48A 5FTJA 1BKYA 1WKBA 3RR2A 4G1CA 3G9XA 2IEDA 2YJZA 4AP5A 1C3XA 1P2FA 1CIYA 1VKOA 5IVBA 1PQPA 4PHGA 2Y1DA 4AZSA 2LWIA 2X0EA 1X1SA 1GRVA 4TVKA 1XXNA 3W2GA 4QQKA 1K2VN 2WE8A 5AW3A 5SZKB 2EXIA 2XMLA 3HZOA 2GMMA 4WNCA 1JZTA 1FTNA 4TROA 4RA0A 3WQHA 4E12A 1KGYA 1ZSNA 3BF7A 4FJ1A 5CVJA 4G1BA 1J06A 4BLUA 3Q8AA 5KCMA 2RGGA 1GPDG 4ZYZA 4PRZA 5FO7B 4A6PA 4PSUA 4W5QA 2VUJA 2M6LA 1PUXA 5SZJA 2XIJA 3BJMA 4M8NE 3DE4X 1NUAA 1Q0TA 3CVYA 1UANA 2XODA 3TIVA 4INZA 1RUH2 2B8WA 1DL5A 1DP4A 1G3QA 3CX4A 4TM8A 2YRWA 1GPKA 1K1EA 3O75A 1MC4A 3AKCA 2XCSB 2PXHA 1T3TA 1P5HA 3KOOA 3T3PB 4PO3X 4A27A 2X0IA 2TEPA 1NMSA 1ZH8A 3GRAA 3CPEA 4XFIA 1EINA 2HCRA 2O0HA 3TRDA 2ANBA 2JASA 3TD2A 2XE4A 3DEZA 4LT5A 2W37A 1JHMA 4MV1A 4Q4W2 2FN7A 3T1QA 2E4AA 3VISA 3FLRA 3TWIA 5L7TA 3EGXA 5FY5A 5C5TA 4TMZA 3U07A 1Y5MA 1CUYA 3WB2A 3R0QA 5KVVA 2HWC3 3ZS8A 1Y3TA 4I9FA 1A7UA 2YMQA 2EEPA 4MSVA 1U9ZA 4K6KA 1R1ZA 3GRYA 2J3IA 5FWXB 4GOKA 4WEQA 4WNYA 4A23A 1G7YA 2DR2A 1NUUA 3R7WA 3U19A 2GJAA 4RD4A 1UN1A 3PC4A 1DIHA 2V4MA 5ABPA 3EGEA 8ATCA 3BUCA 2G0TA 5CNJA 4EKIA 1BVVA 4HN9A 4NKRA 4RV4A 1WIWA 1V25A 2RONA 5CDSA 1ND3B 1JUHA 5CK4A 5HI0A 1HE3A 1E3DA 4WZBA 4JGGA 4Z9AA 4HDOB 4I01A 2FEWB 2VAMA 3FKJA 4OU5A 3QQPA 2FMYA 2O2GA 2L17A 3G13A 5DZEA 1RITA 2QKYA 5DI9A 3FRJA 2NYYA 5DN9A 3ZV5A 3WY6A 1Z16A 3PPYA 4TUYF 3GLKA 2XVKA 4CCEA 5IH7A 3FNQA 2JEOA 1LGNA 4XD2A 4X1YB 4FQZA 2WJHA 3E22B 2B0CA 3K15A 3PR2B 3KJEA 1YC2A 1HB2A 4B83A 4Y1XA 1UIRA 2C2WA 1G7TA 2C07A 4L5AA 4ZXKA 3HKEB 4EY3A 5CAEB 5C5DA 4L4YA 5JD6A 1RQGA 1YVPA 3KR0A 5AH0A 4I1VA 5FZHA 4IPTA 4LZOA 2R4UA 4ABTA 4Q7QA 1ENOA 1LPSA 3ZU5A 3ZVXA 3FUQA 4LFCB 4YDHB 3H0CA 1YIFA 4H7JA 3J7MA 4AG6A 3RYPA 4MWBA 1SU8A 4IW3B 2YWFA 1O94D 5LYJF 5FAXA 1JBEA 3W77A 4O4JB 4OQYA 1VIAA 1CIWA 5AW8A 3QE3A 2WJVA 4A6OA 3K4HA 5BNOC 5BMVA 1A9TA 3WIUA 1JLRA 3KXIA 3LZ6A 2P9TA 2ZGUA 1T5OA 2IFRA 4EPXA 3GDOA 3X1XA 1JVBA 3MTAA 3VX4A 3GC6A 1DX9A 3HCNA 1QXSA 4BLVA 3R9IA 3FXAA 1FPQA 2EW2A 1COV2 2P9YA 4EUKA 3VA7A 4H14A 1E9VA 3NIDB 1J0CA 1E1YA 3PRJA 3PNQA 1GU3A 3H0KA 4XHBA 4A26A 1KYWA 2I3DA 4XLZA 3UXEA 5A9SA 1JMYA 1D2NA 1XYVA 2Q9CA 3P2JA 3TNQA 1TLFA 1L8OA 2H4XA 2PLNA 3AU8A 1L1QA 3C6XA 3ELUA 4V0LA 2ZEZA 3IAM1 1O6GA 5CLLA 4C05A 3VO1A 3ES1A 1OR8A 4MIYA 1E64A 1T5TA 2UVPA 3WGHA 5FNZA 3KGZA 2JBHA 3EGCA 2VRCD 4IIXA 3O4FA 4F3KA 5E3JA 2VPQA 3DL7A 1CPMA 1GNSA 1ESDA 5F5IA 1W93A 3UVEA 3VR5A 2QRVA 1TW3A 3RC8A 3UHPA 4LGMA 3KETA 1N2CE 1OKOA 2DTXA 1DCFA 6PFKA 1NCRC 3ZQ4A 4AYWA 4KB5A 1WNTA 2EFEB 3FN9A 3BGDA 3SPXA 1PBTA 3TIIA 4QJIA 4HANA 1SXJA 3QX9A 2BERA 1Z0ZA 1U0HC 2JE8A 3PXGA 1POV3 4H4EA 1XRUA 4HBGA 1G9SA 4PS1A 4DUWA 2WNIA 4H7FA 3RYFA 1QTIA 1M6WA 3FX3A 2CD9A 3L77A 3U4QA 4JYAB 3GN1A 1XEFA 4GH4C 4IE4A 1NN1A 1OYYA 3W3AA 3ZPYA 2QQ0A 4TTQA 4U7FA 3K9LA 1KI1A 1G0OA 1RYHA 2NN3C 1Y6JA 5ES3A 2XEDA 721PA 3WIDA 1PSDA 5GY7A 5C4WB 5B2ZA 1NU6A 1ODKA 1VC2A 2EX0A 4WN9B 4R81A 4BFUA 4YM3A 2Q5JA 4Z07A 3IVMA 2ZPAA 3CA8A 1KJRA 3VDDA 2Q3EA 2H1HA 2RHCA 2DFDA 1ZMBA 3ZXGA 2B7LA 3T15A 3MCZA 3ET5A 1E5QA 1E6KA 5G02A 5KTRA 3FAZA 3S81A 3B6MA 1RWXA 2IH4A 1VR3A 4EG5A 1BMTA 1TIPA 4WBXC 4OEHA 3O4GA 4H1WA 5LQUA 5CA1F 1IOZA 4MUAA 4E1BA 5FXZA 3IMKA 3ESRA 4J4HA 3OQOA 3LXMA 5JMOA 3LBFA 4MPTA 3EQ7A 3A2LA 2R97A 2BHSA 1ZJ6A 4V02A 2XWJI 4J1TC 1H2MA 1VSVA 2QZSA 3VSCA 2J7MA 3RFXA 4H7IA 3A9TA 5L3QA 3PVSA 4X66B 1F31A 5EIOA 3FPFA 2ODAA 1JIQA 1KQFA 3CZCA 2R1VB 3FCSB 2R6GA 4ZU5A 4AO7A 2Y26A 3H4MA 5AXAA 1Z7GA 3TOSA 1O95D 4P9LA 1GFF2 2JICA 4F5EA 2VCMA 2VXOA 3RRNA 3ZVNA 1JHOA 3A25A 2VATA 4EP1A 2DUPA 4GYJA 5KU7A 3HBJA 2W91A 4UMDA 2QNKA 4P7KA 3V1YA 3RC3A 3LY9A 1CY1A 3V7YA 1QIHA 5IT5A 5HVNA 5HG0A 3WB1A 3ZGYA 2VPVA 3ESCA 3K6SB 4ENVA 2EDCA 1YVUA 5IANA 4F5DA 4QDSA 4CFZA 1T1JA 3AHIA 3HXLA 5A5DA 2JFOA 2DQZA 2WHQA 1ST3A 1UZVA 1EE2A 2VQAA 3QU2A 4XFJA 2V7EA 3PNYA 4HB4A 4EL0A 3DW1X 4WLEA 5IRCD 3SF8A 2ZHNA 4E2XA 3OIFA 4U9UA 4M53A 3QKRA 1ZOLA 3S30A 1RI3A 4X1KA 1GFIA 1XU7A 1BXRA 1ZY2A 3HNYM 3AKYA 5DISB 3GVCA 1U8CB 2FSFA 4JI0B 1EQAA 4EW2A 1E7MA 4GYYA 1A5TA 3JQ9A 1JZQA 3U0VA 3C87A 2JCSA 2D13A 3QHPA 4NOKA 3U7RA 5BSUA 1N7HA 3TW8A 1PF7E 4QMAA 3OPYI 4NV0A 5L36A 2D5BA 1PIWA 5J98B 1A8SA 3H5AA 3LMKA 4DCTA 1KY4A 3D0KA 4D9NA 5JOXA 3I12A 3KWVA 4DV1B 2HRZA 3R4UA 2C4TA 3RI8A 2SKCA 4D7YA 4OGKA 4DCVA 4Q24A 1NAIA 1Q7CA 1YLLA 4WK4B 5C35A 3OM1A 2K6GA 4G4IA 3LP5A 3PUHA 1K8XB 3OGSA 1IIBA 2D59A 1RXSA 3GFQA 2WJWA 4DB4A 4R1QA 4ZXFA 2YVKA 1UZAA 5DRYA 1ZITA 3DECA 4HPXB 4Q4DA 2EW8A 5DM60 2A9QA 4RA9A 2KA3A 1O5TA 4WAUA 1GTVA 3KB2A 1Q6YA 3EJKA 3MJVA 1UBUS 4M76B 1CJUC 2VDPB 4XFDA 2WYHA 3A3KA 4YW6A 4URAA 1A8DA 3J9SA 1E4OA 4M38A 4CYDA 3CZ5A 3MCUA 2M1ZA 1QH8A 3IA7A 1XQNA 1AR71 3H2ZA 4P9IA 3VPGA 3GI1A 4RHYA 2O2YA 1MO3A 4MW0A 1VRH1 4ZONA 3R0VA 1TYDE 2BELA 1E2HA 4D3DA 4Q29A 2Q5LA 5EI5A 2GCOA 3KSUA 4PC6A 1QYRA 4H2DA 5H9SA 4CMJA 3ADPA 1L5ZA 4IDZA 5KC5A 1YO6A 3CE9A 1WM1A 3VD4A 1MA3A 3WL5A 3OFNA 4MUNA 3F3YA 5EPOA 3CLTD 5CG2A 5DABA 2RBEA 2J22A 4U0KA 3ZLTA 4KREA 1MRNA 3L7CA 4DFDA 1AKRA 2QDKA 4TSFA 1XD2B 3U40A 2C42A 1S2OA 1JBKA 2OZVA 3WJ2A 4EFLA 2QT9A 3QE0A 1AB5A 3AR9A 3JAKB 3HWRA 3ZXLA 2BPOA 4D6SA 4IVPA 2M6KA 1G0NA 1LD3A 3R3JA 2JCXA 4QUAA 1QIQA 3OPYA 1NJFA 1SUAA 4WZBE 5JZGB 2VNOA 4K81B 4LDQA 1GRQA 5FYQA 4LNAA 3F67A 3IV6A 4CKWA 1XZHA 1DU3D 3IP9A 4NC9A 3POYA 2VUIB 3A4TA 1PZMA 3R3YA 4XQGA 5DN6D 2OYSA 5EUBA 4BLSA 2E26A 5K6AC 3Q9OA 4FPGA 4MV6A 2C77A 3U7IA 3AEQB 3R6GA 3ROFA 4MLOA 1P8AA 3SP1A 1X9PA 5FUWA 1ECBA 5JJLA 1SU7A 3WLNA 2ZHMA 5AP9A 1ZKMA 1A3KA 5BWNA 1JHRA 2Z2IA 4J4BA 2BM9A 3HU5A 4X7BA 4LXHA 4AF8A 3EK2A 3OB8A 1S96A 2Z8YM 4URZR 1V9U1 3WV6A 1G8WA 3AQIA 3RSZA 1QJCA 3VZQA 2WD9A 3QJYA 4WZCA 1ZM4A 1MAUA 2H4WA 2WYOA 3NAPA 4QAQA 4G0XA 1HQWA 4AY2A 2Y6LA 4ZCQA 1PEYA 1JLHA 1LLQA 3N2ZB 1QIEA 2A94A 3LQ4A 5JARA 3AF0A 3IXQA 3H4IA 3KZMA 5FJJA 3VSBA 2AJDA 1GAJA 4NU5A 2QG6A 3H2YA 2GVDC 4FFPA 1L4LA 3KR9A 1J6UA 4TT3D 4QOSA 4TPKA 3SAJA 1W6QA 1WA5A 3WBKA 3QVTA 3I54A 1KOLA 2AV6A 4EKDA 2G17A 4UVGA 5BV2P 4ZVNA 5KWIA 1T6GC 4QGHA 1KH2A 2CXTA 1U28C 2EX1A 4HETA 4R9BA 2HEIA 2HQBA 4GXTA 1J1IA 4FT4A 1HFWA 3WWOA 1I33A 4ZEOA 2X8AA 5GQSA 2W2XA 4YREA 4ZFNA 1GY8A 2CJWA 1EG7A 5AVPA 1Z62A 3JW8A 1YTLA 5JSQA 3DTVB 2DWUA 2ZSEA 4Q9KA 5J1TB 4UC0A 4FPEA 3N36A 1FFAA 5KOYA 4ZT7A 4ZZIA 3IXMA 3K6KA 2BFCA 5B2FA 2G5GX 4AJNA 1QK5A 3QF7A 3RMYA 2YHIA 1CD3G 3OO0A 4E09A 4Q4AB 1M2FA 2UYGA 5B36A 2NLRA 4K1ZA 1G9CA 5FYYA 1YJAA 3LC2O 5AVVA 4CT5A 3NIFB 2M9MA 3AUSA 3RNLA 3RS4A 2JJ6A 4BO7A 3VR5H 4QDRA 3RUDA 4MQ5A 1U2GA 1P1BA 2OGWA 3BL8A 5I47A 2FRDC 3VTKA 2ID8A 5LEJA 1CJMA 3FH0A 2YXDA 4R1LA 4YJ3F 4JCOA 5H4GA 1LTQA 4EYKA 4N3GA 2NLOA 1TX4B 4UEOA 4XWOA 4JBWA 1AR82 3OIGA 1FC0A 1L1EA 5KTOA 3T1HB 4CEWA 5M29A 1NI4A 2GCGA 1NIPA 3D5OA 3JWEA 1XSEA 2Y27A 5IULC 4LYFA 2V7BA 1TF2A 4MXDA 2BF7A 1OHFA 3ASVA 2HQSA 4XD7D 3S99A 3GYDA 3H65A 2ZAHA 1P9WA 1P6XA 1X8EA 1Y1KE 5EP1A 3NGMA 2C8LA 2WUVA 1IWPB 3P0JA 2ORWA 2QM8A 5DLPA 5A2GA 2Y1XA 2XHNA 1QFMA 1HT2E 4U2DA 4ISBA 4EO7A 1M6EX 5FP0A 2W1WA 5TPWA 4PBSA 3KZOA 3WQ0A 1DWQA 1HC7A 1PJZA 4O4IA 1IONA 1YFXA 5BR7A 3NTQA 3O0XA 1JFLA 4X61A 3DTNA 1NQDA 4LRQA 1T6NA 3UFXA 2VDUE 5FY1A 4HK4A 5AJVB 2AJTA 1PVC2 4D4GA 1V8PA 5L9RA 1H1TA 5LZ8A 3EGXB 3L0OA 1ZPDA 2DCZA 1F6BA 2HLHA 5E16A 2QS9A 4O02B 2IXBA 1Z8FA 1P39A 1UCXA 2GNOA 1KJNA 2VTFA 4WERA 4JI2B 1ZINA 4H7KA 1CEEA 1REQA 3R5KA 1V6AA 3RAJA 3FUVA 1P4JA 1NYRA 1C3HA 3WLSA 1O8PA 1FP2A 2WM9B 5LP1A 4EUHA 1O0CA 2UZ0A 1F9AA 2Q6OA 1H8ED 3MV01 3BAFA 3RIXA 5GLUA 4YAIA 1K98A 3TR0A 1UFOA 3PE6A 5JWPA 1XVLA 1M0WA 1QGZA 1SFNA 1MEOA 5H8WA 1UF2C 2HO4A 1AXGA 2XCRB 2X9VA 1HMYA 3OCPA 1Z0UA 5ALZA 4ZI3A 4RCZA 3GB9A 4BEVA 2ZHLA 3GGGA 2NSDA 2OHXA 4P14A 3RKSA 1IKPA 3FE2A 3SD7A 4RD3A 1A2KC 1UBJS 1H4QA 3MWEA 4H3SA 1MFZA 1C8BA 1OWNA 1P2UA 1AM4D 4F93B 2RAUA 3I4IA 4CIBA 1FSGA 5KDDA 4NBTA 5HKBA 1M8GA 2B46X 4LPLA 1ZZ9A 1O4VA 1QH6A 1HTBA 5ELMA 4X45A 1EVQA 4XCQA 5C7IO 4TZ0A 3C7CB 2O3JA 5IC5A 1Q21A 4YFYA 2D6NA 4XC9A 4NV1A 3KD4A 2OESA 4P36A 1M7HA 4M1KA 3T0DA 3DEIA 4Y9UA 5IVFA 5EPAA 3E9DA 2ZEYA 1ZRDA 2QENA 4XFAA 4AQ7A 4WL0A 3QBDA 2E5LB 1UZYA 4C03A 1T9ZA 3RS3A 1OF3A 4ATEA 4L4SA 5EJIA 1GKIA 3U7QA 3U5TA 2PUDA 1U2TA 4EK9A 4IKOA 1A4XA 2XECA 1R0XA 2QG9A 4AHWA 3DCNA 2VM9A 1GR3A 2WILA 1QB8A 2PXCA 4XXHA 5FR2A 1WZXA 3M8LA 3S5AA 1AB6A 3H5NA 2FDGA 1TADA 2AVDA 2OA2A 3AL3A 1Z7WA 3IIKA 2CL0X 4RH1A 2QL9A 4JV4A 1XK7A 2IWRA 2BP7A 3NNJA 4NTZA 2YWXA 4CDGA 1HFEL 1NMQA 3OAAA 4KMOA 3VHRA 3WYAA 1FVFA 5A3PA 1RUI1 4KH1A 3GAMA 3M6VA 3PICA 2QVGA 4BMXA 1BWPA 4LUKA 1DRUA 2QPLA 1JILA 3DOUA 3EG9B 4B3BA 2UVPB 1LVUA 2DBIA 2PL9A 5IWFA 4O7XA 3T61A 2R7EB 4Q37A 1FNSA 3B93A 1UM9A 5FXXA 4LXXA 5GP1A 4UJ3A 5MDHA 4HKTA 3KFVA 4NJMA 1JN2P 2ZRQA 1CHDA 3A6JA 4QRIA 2LVBA 1JQBA 1CQJA 4ESHA 5AKJA 2QRVB 3U17A 5C7YA 5E4FA 5ALXA 1DAEA 3SE7A 1G3UA 1WD4A 3WYBA 5LMCA 4LWZA 1UBRS 4ALLA 4DLNA 1OT5A 2CDAA 1MC1A 1O57A 4OH7A 5D1NA 5DIZA 4P9WA 3N0TA 3QLVC 1ZN7A 4DPLA 5BNNC 4QX1A 4JMLA 5JD4A 1SC6A 2VZEA 2AXPA 4YRSA 3RYFB 3KMHA 4YX9A 4HZUA 2PKWA 5E6SA 1AUOA 4FCTA 2GPNA 5EYYA 3PC6A 1ZSYA 1GXSA 4XB2A 1C4XA 3IH5A 1E6UA 5I6DA 1I9GA 2MWMA 3WL7A 3CLTC 4EG6A 1VA5A 1U5BB 3L5KA 2YL2A 3PGMA 1IZ8A 3EVAA 4HSGA 1ZZBA 3BRWA 3OECA 2P6OA 5FOWA 4C07A 1FT9A 5FH9A 2LW8A 5LP6C 2DT5A 3RD5A 3TG8A 2Q49A 4L9WA 2JG8A 1J5PA 2NGRA 1W5SA 1SD2A 1I2MA 3T4HB 2WY2D 5FWJA 3RUFA 1LHOA 5K0UC 1LDNA 1RIFA 4J4TA 4LDZA 3EVDA 3L2YA 5ETJA 1Y1RA 1XKQA 4QU9A 3O2NA 2DHCA 1R16A 3ZW8A 5JAUA 4GWLA 2RDRA 1H66A 1ODMA 5HZKA 1Y5IA 3VBRC 4TQAA 5AI4A 1PNTA 3PGVA 1KEWA 1RJWA 4QU5A 4X6UA 3G0IA 2HUNA 4QX2A 3ZN6A 2AN5A 3AJAA 5GJBA 1G8KA 3CLRD 3NQ41 4I4NA 2OEPA 1RM3A 4MYRA 3OQBA 3RNSA 3LCCA 4OM8A 1UWLA 2EVWX 1WPRA 4D6RA 1GQPA 4HN4B 5L3QB 2RKBA 2QTHA 3O3OB 4HVLA 4P4NA 1ZNYA 4YMSA 4O25A 1P3JA 3B3FA 2AHRA 5AHWA 1UDXA 2I99A 1GRCA 2Q50A 3FLTA 2QIOA 3FVQA 5J63A 5CPBA 1PNFA 3V33A 1BTOA 1YDFA 2ZB7A 3ENZA 1LGYA 4UBIA 3ZFEC 4JEUA 4B74A 3OCUA 2XGMA 3H5VA 3S5UA 2EQBA 1BQEA 4NRQA 3POSA 2EERA 4F71A 2IUYA 2HWE2 4LDRA 2CD7A 3VDNB 3NJ8A 2DTYA 2Z98A 1E2FA 1GOGA 4N5HX 3WGMA 3KCYA 5EZYA 4EV0A 5KHHA 4TMXA 3SF8B 3AHEA 4DXSA 5FMOS 1GMMA 1S4QA 4NPLA 3QKRB 3VSEA 4JLKA 4X1KB 2P6CA 1JRLA 3EDQA 1AT1A 4DXDA 3ZHQA 4EUFA 1FJXA 3AVUA 3NIWA 4GA9A 4RC9A 3SX0A 1XROA 1T8WA 4MA0A 3U9LA 1U0FA 4H7HA 1W8WA 5A3UA 2IODA 3BGVA 4GVPA 4BB3A 5J2TA 1SCSA 3WWDA 4JGZC 3T7DA 2V1UA 2RH4A 4RQUA 3U81A 3TW8B 3M6MD 3RZHA 4JHXA 4D45A 3RS6A 1JXAA 2XKOA 4BFCA 3QEJA 4LVNA 2WKQA 1A95A 2W0MA 2XWJB 1G66A 4EB6A 2X13A 3TCXB 3DP7A 4BFYA 4BISA 3R4SA 4ZVKA 4RVOA 4L57A 1P4SA 5FYHA 4NQZA 4MQ6A 3IIAA 4XR4A 2WT1A 3OQVA 2E3JA 4CPBD 2OGUA 2BYVE 3RRYA 2D3PA 3H5LA 2BW0A 5IK7A 2FSUA 5F9MA 1ULOA 2FUG6 3OX1A 2B6HA 3EUWA 3K30A 1QCYA 1T1RA 4IV1C 3DKPA 1RWMA 2AOUA 4KR3A 5FZIA 2NG1A 1TTPB 1AUVA 5CFNA 4PZUA 4P7JA 3O3MB 2HMVA 3SS9X 2BBTA 4MCHA 2PHZA 3KKOA 1ABEA 1ZZCA 3HHPA 4U2FA 5BSKA 2R6ZA 3HVDA 4AXOA 1WZEA 3AETB 3NH9A 2V8BA 3TQSA 1J22A 3FI0A 3VL8A 4NF2A 1QZXA 3AFKA 5FZ1A 3O38A 2GCOB 3VJKA 5AKEA 4GRAA 2Y67A 2ZREA 4ZZ2A 3PGKA 3N87A 5LMUB 5KNDA 1YB4A 5LSAA 2PZ8A 2AZTA 3IEUA 3B9RA 3PEFA 2DB3A 1LPOA 4B82A 1QVZA 2D62A 1M34E 1NXXA 1WDWB 4WZAB 1RRKA 2YV1A 3NETA 4LKEA 5ERLA 5ALUA 3MG9A 1IBLB 2HWF1 1JI6A 1W1IA 3MFCA 2P6UA 2ABWA 4RGVA 4JD5A 3ASUA 1LK5A 1LWOA 1A9SA 5ITZA 2GNMA 1DMRA 1MZ5A 1E98A 4MX8A 3ZIUA 4R98A 3NC4A 3DBHA 5HCHA 3FLPA 1Y1LA 4KIFA 1K6EA 1RLJA 2OFOA 1GANA 3K71B 3GHHA 2KHZA 4YRLA 1DQ6A 2NT4A 1EUDA 4NRPA 4FFIA 1MQAA 5D87A 5LQDA 5JC1A 2XUEA 3PTYA 1YRHA 1Z4KA 3OPYB 1KJYA 1M2JA 4DDTA 3PRKE 1FNNA 3PQ6A 1RC6A 4EN6B 3M1LA 3Q0IA 2IOFA 4XYMA 4CKWB 4GPEA 3FPGA 2X3FA 2O0KA 4HD8A 2DX7A 3UW1A 4CP0A 2NU7A 4EHBA 2PU5A 3SEAA 1RJEA 4R0VA 5IZ4A 2ZJ7A 1S6YA 2PWYA 2Q4BA 2YV8A 2AG0A 4LMRA 3KVVA 1DC3A 3I4CA 1PO13 4F9EA 3DG9A 1OBCA 2OY0A 1QWSA 3I2OA 1E2PA 5FYVA 3NAPB 4BZPA 1W2UA 4FYJA 4LRYA 2GCEA 1NTOA 2BD0A 4KWEA 5K05A 1QEXA 3DH0A 2ZU0C 5AJYA 5AXDA 3TM5A 4YAEA 4BKPA 1WULS 1GKKA 1WCIA 5BQOA 3NT4A 1GFWA 5GMOA 1QPBA 3ROTA 4ZI2A 2O2JA 2JDHA 4DCJA 5JT1A 3TFWA 1VHQA 5ESRA 2OENG 4LYJA 4O8ZA 2XVXA 2OA0A 3KP1A 1OMIA 1U7PA 1B6TA 2R6AA 2G5PA 4IXWA 4A4AA 3CKLA 5LJIA 3SEPA 1TT5A 4WCFB 5K8JB 5E9JA 1CUWA 1H6XA 4MITA 2R8YA 1BBT3 4BB9A 4PZPA 3NYRA 3K2BA 2HHLA 3GBFA 2CJWB 1P3DA 3OPXA 3MPUA 1OZGA 4G5XA 3BTAA 3O94A 3FBTA 3QA9A 4NPRA 4HYQA 3DO8A 4JB0A 3MWJA 1WMXA 3OOSA 3E05A 4XPZA 4LJSA 1RUJ3 2HBUA 2NSYA 3F6PA 4RZHA 4EO9A 4DWWA 3VYSB 4AE2A 4F3YA 3W5SA 2RS53 2HO5A 4NMIA 4CI0B 1QFZA 2WU3A 3FKSA 1IBSA 4YXFA 1NX9A 5LZ9A 4BNLA 4W5WA 4Q3OA 1RHMA 3RG2A 2C0ZA 2EFJA 2X0RA 3IL2A 1M2OA 2BDTA 4MB2A 3ZKAA 1BEUB 1YR1A 3LPGA 5C3RA 4TQUS 1E77A 4L11A 1YKFA 3OTGA 2ZQZA 4CEWB 2XQFA 3DE2X 1UBMS 1QF7A 3K1TA 3N0XA 2CYBA 3N0RA 3ER8A 1QIIA 3C70A 3R4VA 1BN7A 4JJGA 1PK6A 4OP3A 1JS9A 2I78A 3W78A 2VMCA 5JMCA 4TZ6A 5TR9A 2XF8A 1RWOA 4PY2A 1PO21 4V2UA 1C3OB 4XX0A 2RR11 1XYOA 2VP3A 3AGQA 1HWYA 2QTGA 2BW8A 3VKMA 2V7TA 4ZCTA 1HX7A 2BSXA 1AX2A 3JZAA 2YNMA 1RQ2A 1ZIYA 3JQAA 1A1SA 1H2EA 2E4ZA 1AU9A 2I7XA 4DXHA 3VYWA 2GTHA 3OTHA 3O5AA 1AUXA 5TPWB 4WKBA 1Q1ZA 2F1IA 3LA2A 4AUNA 4O4IB 2KI5A 5FPQA 4XWAA 2W2PA 4OAOA 4E1VA 3U14A 5ARBA 1NSYA 3A9UA 3HV0A 1IN1A 4J16A 3SDSA 2G1MA 4INJA 3UFXB 2IYRA 4CM4B 3RVJA 4TTVA 2OQRA 1KSGA 2X5IA 2UURA 2DEUA 2IXHA 1Y6FA 3RGBA 2YC2A 1FV2A 1P80A 1Z2EA 1D07A 4D6PA 3OTIA 3RREA 1CDOA 3ZHZA 2GNTA 1Z0IA 3KDAA 4MQFA 2QLTA 4QYIA 2UZAA 1U5ZA 2AENA 2Y71A 4MS4A 1Y7PA 4WNAB 4BA6A 3IV9A 3GJ8A 5E7QA 4YRIA 1PG5A 2WZCA 4YWHA 5FKCA 2GS9A 3TXAA 1GUIA 2QI9C 2Y6HA 1TQ5A 1ZUHA 2QIPA 4KTTE 1T2VA 1P9RA 2GXUA 4Y9DA 3HJUA 3VZDA 2NZJA 1NUHA 2Z8YA 2PYTA 4KO1S 3O8LA 2ZSUA 4PCRA 3WKEA 4FWTA 1EFPA 1WEKA 3WMWA 1D1PA 4ZCSA 4GRDA 1NX6A 3ZXSA 3FFZA 1L7BA 2DKFA 2Q0HA 3BXOA 2C5AA 1B42A 1FUKA 2ZG6A 4YG0A 1K7CA 5FQNA 1OXSC 1VMDA 1E2MA 1XNDA 5L3VA 1HZZA 4M49A 3G9UA 4EH1A 4J0GA 2WUEA 1RUG3 4DR5B 1KH1A 1K3IA 1U7XA 2BKUA 1FJGB 2NZUG 3QH6A 5JSYA 1VBD1 2AK3A 2H1OA 4LGYA 1W96A 3SXJA 1DG3A 3TTYA 2GN8A 2G7ZA 2F64A 4BMPB 1J8VA 3TEYA 1VPLA 1N2CA 4WEOA 2FMXA 2VQSA 1VG1A 2JECA 2AC4A 1A71A 2AKAB 5JTTA 3EVNA 4YRBA 2BJHA 3MIGA 2JFYA 2XQKA 1S2EA 2O1XA 4LWPA 1P2BA 4M86A 2RHOA 4V1PA 1S3IA 4FX5A 3KSBC 2ZJ0A 4AJEA 1L6IA 5E7JA 3VTZA 1VZ2A 3RU7A 2C0CA 4QOGA 1H6CA 2FUG1 3A21A 1D8AA 2OGSA 4ZJYA 2C4XA 2FRXA 1UBHS 4EMSA 4MK4A 4LVOA 5EWJB 3ZO0B 4XH9B 3H87A 3KEMA 2ISQA 2P3JA 1KI2A 3C5EA 4CIYA 1XHFA 4BB6A