5FAXA

Structure of subtilase subhal from bacillus halmapalus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
total genus 148
structure length 432
sequence length 432
chains with identical sequence B
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5faxA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5faxA01
2SECE 1OYOA 1T1EA 4DZGA 1P7VA 2Z2ZA 2SICE 2LUWA 5ARDA 1Y33E 3LXUX 1EGQA 2IXTA 2Z58A 2PRKA 1Y4AE 3DYBA 3TI7A 1R64A 3DDZX 1SUDA 2WUWE 3WQBA 1SCAA 1SH7A 5AMXA 1SBIA 5JMOA 2W2OA 1DF0A 2SBTA 2XRMA 1SPBS 3Q5GA 4WOCA 2PYZA 1P7WA 3QMPA 4DZTA 1AQNA 2G4VA 3VV2A 1GTJ1 1C9MA 4ZARA 1YJBA 1GCIA 1SIUA 4CFZA 1C3LA 1PFGA 1C9JA 1ST3A 3LPDA 4HVLA 2X8JB 3P5BA 3I37X 3DE7X 1MPTA 1NQDA 1SUEA 3EDYA 3Q40A 1OYVA 2Z30A 1U5IA 2GKOA 2ID4A 1TM1E 5B1EA 2SNIE 4Z2AA 1CNMA 3HJRA 3WIUA 3T41A 2IY9A 3DE2X 1NQJA 3TECE 1MEEA 1Y1KE 5AVJA 2DP4E 3DE3X 2HPZA 3EE6A 1SCNE 2HD4A 2W2PA 2ZWOA 3VSBA 3DVRX 5AVKA 2ZRQA 3DF0A 1Y3FE 3F7OA 1C9NA 5K7SA 1SIOA 1NDUA 3BOWA 1DUIA 1SUAA 3UNXA 1NDQA 3SICE 1QXPA 1BE8A 4I3GA 3H42B 3BPSA 5JXGA 1WMEA 2QTWB 1SBNE 1AF4A 4NE9A 4OMCA 1GT91 3ZXYA 3D43A 5FAXA 1T1IA 4B5LA 4KB5A 1Y3CE 2XVKA 2ST1A 1AV7A 3QFHA 2XVLA 4G9SB 5B1DA 4HPKB 2WUVA 1UBNA 1GNSA 4I0WB 3LPAA 4ZOQI 3GCWA 1KE2A 1TECE 1TM5E 2W2QA 1P8JA 2V8BA 3VTAA 1Q5PA 2PWAA 4NMXB 3D9QX 3DW1X 1WVMA 3I30X 1WMDA 1SBCA 1KDYA 3BGOS 3VYVA 3F49S 5ARBA 4DXZA 1Y48E 2PKCA 3JQWA 2DUJA 3A3NA 1BFUA 1Y3DE 2W2MA 3F7MA 3GT4A 5JXJA 4GI3A 1AU9A 3SQOA 3CNQS 2PWBA 5I9SA 1AH2A 1GTG1 1SUCA 1GA1A 5AQEA 4WOBA 3DE5X 2TECE 1S2NA 1TM4E 1DBIA 1THMA 1SVNA 1NLUA 2Z56A 3CO0S 1KE1A 3DVSX 3DE6X 4C3UA 3GT3A 1YJAA 1TO1E 1GA4A 1ZVKA 1OT5A 1S02A 1WMFA 3OSZA 3AJ8A 4DWWA 1Y9ZA 2WV7A 4YN3A 1Y4DE 1BH6A 1SCBA 1V6CA 4FONA 4MZDA 3DE0X 3JQXA 2XVGA 3I2YX 2B6NA 3DE4X 4M1ZA 1TM3E 1Y34E 2ZWPA 1GTL1 1JEAA 1A2QA 1AK9A 3LPCA 2PMWB 4DJ5X 3BX1A 1SELA 3L1KA 1ZVJA 1YU6A 2O8OA 1SBHA 1BJRE 4J94A 2XTJA 2WWTA 1LW6E 2X8JA 3EIFA 5FBZA 1AVTA 5SICE 3I34X 1GA6A 1GNVA 3PRKE 1IAVA 2QFEA 1R6VA 1S01A 3GCXA 5ARCA 1Y3BE 5CW1A 2PQ2A 1SCDA 1IC6A 1PEKE 3PTLA 1TO2E 1PTKA 1SBTA 1R0RE 2DQKA 4NE7A 4CG0A 5SV5A 3WIVA 3AFGA 4H6XA 3VV3A 4BWGA 3AJ9A 1SUBA 2ID8A 3DW3X 1WSDA 3ZXXA 5JXHA 1V5IA 1BE6A 4LVOA 2W2NA 3TI9A 4C3VA 1KDVA 4DY5A 1KFXL 3A3OA 3DWEX 1PJ8A 1SCJA 4JP8A 1TM7E 4AKTA 1TK2A 4AKSA 1SIBE 4H6WA 1CSEE 5JXIA 1HT3A 4HPKA 4HX2A 4KPGA 1T1GA 2Z2YA 1KFUL 2P4EA 4H6VA 1ST2A 3WHIA 4K8RB 4RYDA 1BFKA 3QTLA 1KDZA 1EA7A 2Z57A 2E1PA 4OV6B 3A3PA 4DY3A 4OMDA 5FFNA 1XF1A 4CFYA 3VHQA 3DE1X 1SUPA 3DVQX 1SN7A 2Z2XA 4LVNA 1YJCA 4KG7A 1VSBA 1TMGE
chains in the Genus database with same CATH superfamily
2SECE 4AWXA 4GSLA 4RTSA 4U9HS 1X39A 1ECFA 3L40A 1HV8A 4UQPA 2LVBA 3K2IA 2SICE 1DFQA 5IRCD 1UZUA 3I8TA 3W7VA 4EECA 3GBWA 3AJAA 3ZDFA 5ED0A 4EPWA 2JLRA 3IAM1 2FEPA 5B58T 2DHEA 3BCRA 5HQ3B 1TE2A 1XA3A 3EZGA 4Q18A 4XOGA 5C4IA 4GPBA 1HLDA 2I74A 1XK7A 2F1OA 1W6PA 3VDBA 4O4HA 1J1TA 5I0UA 5DHAA 5C1DA 5K8TA 1H30A 2J6CA 3WK8A 4BJ0A 4ZXKA 3QHQA 2MMGA 3LS2A 1C1LA 4PW0A 1UINA 2RS32 4M01A 1R0YA 3B9CA 2QDRA 3K32A 2H0QA 2C5SA 2R1DA 4Q0MA 2PFWA 4CMAA 4HRAA 3NCHA 1K7XB 4ZT2A 4J25A 4FGUA 3FTCA 3IJPA 1G1AA 4I4TF 4NG4A 2QQKA 1D9ZA 4C04A 1TYZA 2BMJA 2FKNA 1P75A 2ZATA 2JI6A 1XZNA 2IQ5A 2O8CA 5FIUA 2W6OA 1P3DA 3NV7A 1PK7A 3BCHA 1K6XA 2QRMA 2K87A 4MRMA 1N2GA 3SP1A 2A4KA 3AIKA 4QARA 1KI6A 2WO2A 4EGFA 1IVSA 2R7LA 2RIRA 1YOVA 2E82A 4ZTZB 3NU1A 2JBWA 4AC9A 1FIUA 1A76A 4IH9A 1Z4QA 1AY0A 4MI3A 4LO4B 4IOJA 2ZVJA 1EXMA 3TTVA 5LMNB 2FQXA 2JIDA 1DLIA 2GJAA 3TMKA 1J8VA 1CUDA 2VAWA 1LJLA 3EEFA 3HYRA 4Q1DA 3QEAZ 3QEKA 5IKMA 3LEGA 3L1VA 1G8MA 1NZIA 4RHUA 1O0BA 2A0YA 3MLEA 4MUIA 3BH7A 3STHA 4YW4A 2O07A 4LKFA 3UV9A 3ZVKA 1JS1X 1YA8A 1YJXA 1O6UA 4RVDA 1KWGA 4LBYA 4ZYVA 2YGMA 2QRVA 1TFUA 5CW2A 4GMP0 2CE2X 4NC9A 4TSFD 3L7NA 3R5FA 1OBNA 4F2PA 1GGJA 4AWAA 3SXPA 5HF9A 5GY7A 3FHAA 5C51B 1DC7A 2J1RA 3LQYA 5AI6A 4Q16A 4ENWA 4V24A 3NHAA 1AQLA 4IPTA 2AR0A 1GFWA 2NYRA 3L7YA 1XLWA 4LZWA 4Q1FA 2A6PA 1GSLA 4YUVA 5EZSA 4Y67A 2BN4A 2OGZA 2PIAA 1AQ6A 1W6OA 4U2CA 5K3AA 1Z5WA 1ND2A 3KSZO 4YI5A 4YJHA 1A2QA 4HWGA 4ZO7A 4HGYA 4RVSA 1F17A 3BSWA 4GLOA 1W2GA 3AL5A 1SWVA 4EN6B 3SKVA 1N3QA 3E9DA 2H31A 5ITSA 1WP4A 5AI9A 4YW2A 1OLMA 3SF0A 3PLQA 2IIBA 5ERGB 3EXUA 1P73A 2N46A 3JATA 2C4KA 3VLBB 1RZVA 4WPGA 4IERA 5E2IA 5CIRA 3T0DA 1C7JA 1JDSA 2VSNA 5LU9A 4ZQHA 1EE2A 1PUXA 5LDGA 4EFKA 1E77A 3PPWA 4TN5A 2F4PA 2EXKA 2QE3A 3KPYA 2UYOA 2WFF1 2Y6UA 1UBHS 1U3WA 5JBQA 3GRZA 5FWYB 1UXZA 4JYBA 1N6LA 2W68A 2QN1A 4XM1A 2Q4DA 2HF9A 3M81A 3U13A 1MZPA 3VR5H 4PHHA 4B74A 4KMRA 5L40A 2V09A 3ELDA 5DEIA 4L8WB 1ETUA 2ZEJA 1OWMA 1KDPA 1FUUA 2G9GA 2GNBA 5KNBH 4KL1A 4UWDA 4MWCA 1JOPA 4O5AA 1CSEE 3D6NB 1UOOA 1JXNA 3AVYA 3W2EA 1FLDA 5J36A 1UADA 2QQIA 1G6HA 1MFPA 3CKLA 3IDAA 2ECPA 1BLZA 3DZCA 4QNRA 5AXBA 1ALYA 1GPJA 4D02A 1Y6GA 2V7WA 3GXBA 1EDOA 1QQ5A 2DHCA 4BNHA 2Z1NA 3DM5A 1XCLA 3VZJA 2Z2IA 4I9HA 4GLFA 1FFSA 1TYEB 3FWPA 1E61A 3RG2A 5GM2A 3ZY4A 2ZYDA 1GTMA 3EFEA 2YC4C 4QX0A 2A7XA 5A3UA 1ZYUA 1QHYA 3MMPA 3MWEA 5J9FA 3ZI7A 3KVRA 4M0KA 3T7IA 2VMIA 1QHIA 3H3ZA 4LA2A 5DYYA 3T6KA 2DQYA 1AR83 1KH3A 2OLJA 2PA0A 2PRKA 1DL5A 2BGNA 1KZ7B 5G0WA 5AVYA 3M5DA 4M98A 5ALLA 4YM1A 2VPIA 1WD4A 4BNVA 5C34B 5IFLA 4LBKA 2IU6A 3V46A 3M1HA 3EGVA 4QGGA 4P54A 3OLXA 2FR8A 3HCRA 5IBQA 2G4VA 1GXSA 2VPVA 1PS8A 3A6PC 5F77A 4FK8A 5DEOA 2DF8A 1X15A 2HK7A 3FZNA 3BJEA 1EG7A 5GV8A 1VB5A 1TA0A 2PUEA 4LHVA 1OXXK 5CUQA 2G40A 5CFDB 5JBNA 5JC8A 2JANA 3S2GA 3PDIA 4KMOA 4S2EA 1ISHA 3FWEA 1X38A 2HK9A 4HDOB 4CCYA 5C4WB 2APJA 3PX7A 4ZU5A 1P33A 4RKEA 2J3MA 1EUYA 4ZU4A 5DCYA 1B74A 4E6EA 5D8AB 1ZHFA 2Q21A 2H4WA 2CAUA 5B1IA 2GA9A 5DHPA 3R75A 2AEYA 4YSFA 1L3BA 4Q0PA 2PUTA 4KIJA 5LFAA 4KU8A 1RT9A 3D0SA 4JBLA 2XVLA 1LVHA 1RWNA 2WUVA 4RVFA 1UBNA 2WYUA 2WVHA 1HOXA 3FMOB 3IUSA 1UBRS 3NHUA 2H92A 4OXRA 2VD7A 3HUTA 4H1VA 3USUB 4V1CB 3T3HA 2BCJQ 1Z15A 3ONVA 3DW1X 4HS9A 5CCDA 5DNDA 2O7NA 4F93B 4LVUA 1QOSA 5FPUA 2XE4A 4IV1B 3JARB 3ROXA 2G9UA 4TSRA 1IWOA 3RYHA 3OO1A 2VJXA 3TQFA 2NPIA 1U1IA 4U7GA 4B31A 2MINB 4OG2A 4NYIQ 2CVFA 4Y2SA 4F4DA 4MVCA 2ATCA 5I9LA 2NADA 4NDAA 3ECCA 3VH4A 4QC2A 3QOFA 1Z0UA 2BL4A 1OLQA 2H2FA 4P5EA 1JIJA 1D1SA 2PUAA 5BQPA 3I59B 4DS3A 1HN0A 2WUDA 2AFHE 2IHJA 4GP6A 2AG6A 4GQ7A 1KI1A 5ALPA 1KFEB 1H0SA 3ORJA 5K8JB 1D4AA 2D2EA 3UTCA 1TG7A 5FO8B 3E4CA 3DE0X 1JBKA 2AJCA 2P2CA 3VUOA 2WT2A 1J06A 4JXXA 2OLKA 3BODA 3AP9A 5KNCD 3M6IA 3RYCA 3QUBA 1O8PA 1UIMA 2ZWPA 4BPZA 1YO8A 3WJ1A 1Q2UA 3U4QA 4L5CA 2R5NA 3I9FA 5IM5A 5NULA 4L9BA 1O3RA 3QX8A 2ZBJA 5DNVA 4CQMB 2WUEA 4PGAA 1QF3A 1L5MA 4PLFA 1ODNA 1TJNA 2WE8A 4KSBA 4CEWB 4QYMA 4AS1A 1JKIA 1U0LA 4GICA 1H42A 2JG9B 1ML3A 1BHJA 2RE9A 3PHBE 3C48A 3TQOA 4CG0A 1UMIA 4XYLA 3INYA 4Z51A 3W1VA 2CEKA 1D4VB 4N0PA 3KWFA 4MQ4A 2CY6A 5DMYA 5JCOC 3DPRA 3BMCB 5U4XA 4QQRA 5KXBA 1KI3A 2VYVD 4LVOA 1C14A 4PXSA 3PEVA 5ER6A 1RUG2 1B6GA 3SI7A 2PUGA 1GL7A 1PK9A 1HX7A 1BHGA 2VOWA 1Z5PA 4EQ6B 1AJEA 4UUBA 4CDMA 3K71B 5D5QA 5I8YA 1M2JA 3QUSA 4P14A 3WNCA 5C3QA 3BIOA 3LUFA 3ETJA 4NHMA 4JJ7A 2YN4A 4UKDA 5HKOA 4PC3A 3AR5A 2GWRA 1OYWA 4JJFA 3L2HA 3IEPA 2JGKA 4BLTA 4FFHA 4I5GA 1KJZA 3LKJA 1K6MA 5CVTA 2ZWAA 1J5PA 2RHHA 1RBMA 1MOSA 1OLOA 1Y6RA 1RS0A 2DY0A 2H5EA 4HR7A 3X43A 1ZIOA 1Z37A 3MV11 1JAXA 1LBTA 5BNPA 5TF0A 4COOA 1V7CA 2ON6A 3KVAA 1W6RA 1M1YA 6PFKA 4NP6A 2GYYA 3CIFA 3J7HA 5LDDC 5EN4A 3BU7A 3JB4C 4BQFA 1QHGA 1Q83A 4ER3A 2EX1A 1X8EA 3QEMA 2Q5HA 1F0KA 1OC4A 3ZCQA 4TUYA 2CJYA 3LW7A 1YL5A 3NUQA 1PWHA 3CH5A 5MGBA 2OZLB 3BM5A 1T6NA 1XNGA 2WJWA 5GV7A 3QPDA 1PFQA 3M3EA 3DO8A 2C77A 3D64A 3O8OB 1JX6A 2IDKA 5J4LA 1T91A 5JWPA 5C8CB 1VIWB 1TJPB 4Q0QA 4GE0A 2VVTA 2E4WA 4CUZA 3KE9A 4O8ZA 3ZE0B 1C3LA 5ICMA 3O1PA 4S0ZA 4IDCA 3DV8A 4JK3A 4WNAB 3UBTA 1LSOA 4ZTBA 1WZEA 4IEEA 5I0SA 2F6RA 1ZA1A 2NQ2C 4B34A 2V72A 2ZJ1A 2N9UA 4RA9B 3TEZA 5EJ3A 3M70A 4AVBA 1G18A 2NZ2A 1IG3A 5B37A 3LGSA 4CYDA 3U4CA 3VZSA 1PS0A 4BBZA 2E6UX 4Q0SA 2FMIA 3PEEA 2NUPB 4E5KA 1QZ3A 1I3CA 4ZAZA 1V8BA 2IYVA 4IJ6A 1UW8A 5HUQA 5G0VA 2YPJA 3NVKI 1SZJG 5FY0A 5K4AA 3AVXA 2R4QA 3CPSA 4JYZA 2DCYA 3VNBA 4M7WA 2C2OA 4HEA1 4OYYA 1E2GA 4MUEA 3MJEA 1I2BA 2B36A 1XVAA 5H81A 3COYA 5JJIA 1Q5PA 1T8UA 1RIIA 3B52X 3Q2OA 1YUBA 1SBCA 2O8DA 1JZ5A 3BTSA 2VF4X 4DXZA 2A9QA 1JH8A 3IFSA 3TN92 3CPJB 3H2KA 3VPDA 3WXPA 1JUDA 5SYNA 2QQVA 3RJ5A 3ZUPA 3DCIA 3V0BA 4ARUA 5JSHA 4H15A 3IBSA 4R9AA 4GO1A 4NN0A 3ADOA 2VHEA 1XJ5A 3UXMA 4O4LB 5D01A 2V3CC 4OLAA 3MERA 1VE3A 3UKOA 5KU7A 3VFDA 4PAWA 3EJ6A 3OIDA 2H9YA 2G3YA 4UCFA 3ROFA 3VRHA 3VKUA 4DPNA 2K9ZA 3ZCVA 4OUDA 4H4EA 5F23A 3DV2A 4J7UA 4FONA 1E5DA 1W6QA 3NBKA 4EHNA 5JZ9A 2ATEA 3NLLA 3F46A 1S89A 4Z8XA 4QM9A 1ZEJA 3IAPA 1US3A 5B1YA 1N33B 3U4SA 1UAGA 5IJRA 3UH1A 1UFKA 2JKBA 4FIDA 1Y7IA 4PIMA 1D1PA 2WYSA 1UFOA 4S35A 3TSYA 1YZYA 5I0TA 3LDUA 2QQEA 4Y1VA 3A0KA 4B47A 1U99A 4BDSA 3CLTD 2X58A 4K20A 1AOXA 1DZIA 2R7MA 1YZVA 4M88A 1OT3A 1G5RA 5M5BA 4C3ZA 3DBRA 5AW4A 4TN7A 3PXGA 2QCSB 3FJOA 3E22B 3QLUA 3L6OO 2D43A 2CJWA 1RYHA 1XKLA 2PHUA 1T2XA 1DQ4A 2EERA 3PQ3A 4LBQD 5AKLA 3KR2A 3Q10A 5EZQA 3P32A 3N74A 2VJMA 2EKPA 2WM3A 4DGSA 5DM2A 3U17A 3MD9A 4AL4A 4UW5A 1RUJ3 2C2ZA 3GJ0A 4IEQA 2WFAA 1Q0LA 3LDBA 2QV0A 1P4HA 3B1ZA 5A9TA 1CB0A 1VAVA 1FMTA 3EQ7A 1FDIA 3BVCA 2G5PA 3E9QA 1T1JA 1OH6A 4BP9A 2VTDA 4IEXA 3HDGA 3N0VA 2ORVA 4QAWA 3P9NA 4S12A 1F35A 4L15A 4JLNA 1MORA 3WGGA 4BP8A 2AC7A 4GI2A 4N43C 2IXGA 4W1SA 4OJYA 2HMTA 3L6EA 5IVPA 5HCFA 3HKCA 5CHEA 2BGPA 1VHDA 1SFNA 3EZ2A 3CVVA 4OGGA 3I9KA 3UWDA 3L6UA 3WWYA 1ZITA 2QE7A 4ISQA 4KAXA 4EHAA 3ZDXB 2WR8A 4H7IA 1RWXA 1OLSA 1V45E 5AESA 3N3HA 4RK7A 3DOFA 4M0MA 4JJGA 1CK4A 4KO2S 4YVSA 1C0LA 2PS3A 1Q1AA 3O7WA 3HIFA 4YXWA 3PGVA 1G3UA 4CEYC 2GVZC 3CSUA 3SD7A 1NBME 1ISRA 4BQQA 3TCKA 4MSVA 1LCIA 3QVLA 4IP0A 3QKUA 5JV5A 5D2AA 1GTJ1 2GRUA 5EE1A 4EYEA 4MJ3A 3QEBZ 2JJ6A 1PJTA 1JHYA 1PFGA 3ZDEA 4PZZA 4HVLA 5LBFA 2D4HA 3W4KA 3C16C 2FPMA 1RJEA 4TXLA 3DZDA 1Z56C 3EBLA 4CIVA 3MTBA 3QOXA 1GL6A 4J3FA 2VFAA 1NC1A 2H4YA 3O26A 1K6JA 2OMEA 2PEYA 1FMJA 6REQB 1KITA 3CJIB 1EXDA 3EG5A 5I3CA 4CDWA 1PG2A 2FXVA 4CHTA 2FDIA 3T5GA 2V5DA 1YDHA 2W2PA 3OZTA 4ZJUA 2VHWA 4XIYA 3KQLA 1DIRA 4R8VA 1CEEA 4Y7CA 4AQYB 3AP6A 5CKMA 2CNWD 3CKMA 1SK8A 3FH0A 4K86A 2ECQA 2WJGA 1TQHA 2PS0A 4JP5A 5T5PA 1AIPA 2K6GA 2EZ4A 1CF4A 1LHOA 1E2PA 5C1IA 2XDVA 4BH9A 2W6ID 1JQEA 4MUVA 4UXIA 2GXAA 1Z2PX 3BU0A 4XACA 4QHSA 5KYUB 3L07A 8OHMA 2TRSB 1XAJA 3HP1A 4WIAA 4CR7A 4E46A 4TN1A 2XMQA 4A26A 3QH7A 1GY8A 1RI4A 3AZPA 4ATEA 1V4NA 5JE8A 1IZYA 2REQB 3R0JA 4JTNA 1P2TA 5C9AC 4X94A 4DT1B 3DAFA 3AEYA 3SH4A 4GT1A 4YR7A 2BONA 1E98A 1OE0A 4XFAA 2BEWA 5GGYA 2BMAA 2X7JA 1R0CA 2ZE7A 3PGA1 3EPJA 1TYCA 3G1WA 2QGZA 2C95A 4E3WA 4GWGA 2HRBA 4JR0A 1H0BA 4FYIA 3ORQA 2O3TA 3CIHA 2VSFA 4UBLA 1GA4A 1XMIA 4HDSB 2WVJA 1SMKA 5FWNA 3USZA 4PE5B 2FR1A 2AOWA 4LO6B 2E32A 3E18A 4JA0A 3FRIA 5DHQA 5KJFA 3E2MA 1FUKA 2I5PO 3T3PB 2JFXA 3GEMA 5P8WA 2ATVA 1SVOA 2XKJE 3SJCA 3LFUA 4CR6A 3WNPA 2Q1XA 3DDSA 1G3MA 1PV4A 2VA8A 1W76A 2VAMA 1K88A 1U81A 3FN4A 1UC8A 2WNSA 5ESXA 5IEJA 2ZIGA 3LZCA 2FI1A 3KOWA 3RYPA 3OWOA 3K6KA 4JP3A 1X2BA 5BUQA 3POFA 1SNYA 1VG8A 3TD9A 1LU1A 2XUGA 1Z2DA 4R9DA 1K75A 3A4VA 3TW6A 3GA0A 4M0CA 3N7KA 1BA3A 3VR6D 1YA6A 5FUYA 1Q8SA 3HJTA 2C97A 4UC0A 2WZPP 2PPVA 3QVTA 2XXAA 1GQRA 1HFJA 2BUAA 3TTTA 1VJ1A 1PE0A 3EJWA 3HYSA 1RAEA 2EALA 4FCVA 3ASUA 1RMTA 4J1NA 3DLTA 2PZMA 1K42A 2JAHA 1FFBA 4E4SA 4GYWA 4E2SA 2O0LA 2GNAA 3MJDA 1EAH1 1CV2A 1XFAA 4AZWA 4M3CB 3W5SA 5FLIA 2IPLA 2RMU3 3IAAA 5E4TA 1MEJA 4X7BA 1KFXL 3PT9A 3FJYA 4TV8F 1JFFB 1MLDA 2I2AA 3RGGA 2MT9A 5FWXA 5C8WA 1QO9A 1YZUA 3QOPA 4H7JA 4OHCA 2G83A 5EIWA 3ADBA 3AQIA 1UMBB 5T6BA 5FXWA 4DTIA 5CB4A 3RHZA 4CYMA 4EPRA 3Q2KA 3KU1A 2O4UX 2A67A 4OHMA 3OHPA 4AMBA 3LKVA 2JIJA 4C2UA 3MFQA 3DFUA 4CM8B 1VMEA 3R8FA 1NN0A 2ZGVA 2ZJ6A 1Z63A 1IHMA 2FSIA 2VAXA 4BFTA 4M4RA 1RQLA 4PXYA 2B4TO 2O57A 1JMKC 4WV8A 4LDJA 1UJBA 4FE4A 3P94A 1ZRDA 1N78A 5KBFA 4G5SA 3AY3A 2H9IA 2V7QD 3CSDA 2BMDA 3ICWA 3QIVA 1H1MA 4YCLA 3I28A 1FDVA 5IYYA 3FC0A 3KJEA 2YIMA 3F5QA 4MR7A 4YRKA 2VBGA 3QF4A 2R1VA 4LMPA 3BGDA 1LDBA 2GMWA 2ZT6A 1CJBA 3WG9A 4H35A 1KYTA 1C0IA 2A1IA 2EDCA 3WHLA 4Y2QA 3ZGXA 3DDHA 2RGWA 2VUUA 4R0MA 1ST3A 4TRJA 3KSBC 3ANLA 4OQ8A 1R8XA 1K7FB 3ZWVA 3KWJA 2NYUA 1QE0A 4S1WA 3I64A 3PU6A 5CVVA 2WN2A 1R4ZA 4IS3A 2ZUWA 1B2LA 1IBRA 1L4YA 1CNMA 1M54A 4ZPXA 4CCLA 2EFHB 5JPMB 4OOFA 4QDOA 4G9EA 1YCFA 3U0VA 2ZGSA 3ZX4A 1J1IA 4WAUA 2WNOA 4NXNB 3CKHA 4M54A 3CLRD 3R9XB 2RH4A 4CF3A 2J7MA 2V65A 4IKPA 1W03A 1ZJ4A 3WGTA 2VXJA 3LNCA 3ETLA 4GALA 3ZFEC 4NBNA 3M82A 3QI2A 3F74A 2HMSA 1JZSA 3B69A 2G36A 1LNQA 4JT4A 1DADA 2JVKA 1NR1A 4C1BA 1N2BA 4KFUA 5AW3A 1B6TA 3SCHA 4JD5A 1BO6A 2VJQA 1G4AE 2W91A 3NWEA 4EW6A 4RY8A 1T13A 4N76A 1K3IA 2A3XA 2CWSA 2GEKA 3R2JA 4LZZA 2W2VA 2W98A 3HUUA 3NB0A 5ALYA 2HREA 5AC93 3IOMA 3CZAA 3H2YA 2UWBA 3E1GA 3BJMA 2F3RA 2AHRA 2V0GA 2VQ6A 2GZDA 3WF0A 1UEJA 3PJDA 3PC2A 1ZGJA 2OG2A 4RKFA 5SYAA 2WTAA 1QYCA 4D4GA 1J2EA 1LTKA 3UXEA 3HEBA 2AJDA 3DL4A 1V1MA 4G6ZA 3OCCA 3C15C 5JXJA 4ZMSA 2KSQA 3EEIA 5ERYA 1M0WA 4DINB 3ZHRA 2ZSBA 4KO3S 2ES3A 3IP3A 1OIVA 3NAPA 1CAUB 2F1JA 3DXZA 3CF4G 4PBOA 4ER7A 2RDNA 1NF3A 1VG0B 3GEEA 4AGRA 4Q48A 3D7MA 5EYYA 2O2JA 4M36A 4HOYA 1KVSA 2X77A 3KSCA 4BIMA 3A31A 2WHEA 1VGQA 1NRJB 2OWDA 1EVZA 4J0IA 3ZYCA 1JBCA 3UOGA 4YT2A 2P1BA 4W6XA 2ZAMA 2PM8A 5EXSA 2KQUA 2NU6A 4X00A 4E08A 3DBLA 2X4DA 1SKMA 2CSUA 3UMBA 3PTYA 3E81A 1P1BA 4CZSA 3EYWA 3ICPA 2ZETA 1VA5A 4KDCA 4UFPA 1A6CA 2C7QA 3VOBA 4MWZA 2WHPA 4JZRA 4RZIA 4L2IA 4QU1A 3BXEA 4TVBA 3D3NA 4WK6A 1U04A 2PHLA 1MG5A 1Y3HA 2O23A 3ZNNA 4FFFA 3WLIA 4MUJA 4Q9KA 2OC4A 2P5BA 2ORXA 4AXOA 4MZUA 4B83A 2QMHA 1ZNWA 3FM9A 2VUAA 7ABPA 1DJNA 5BV7A 2JDZA 5I9BA 5IANA 4R31A 1PVVA 2AEFA 3UWPA 4BWGA 4G8BA 4JI8B 2FPPB 4I9GA 1NC3A 4OUSA 1A71A 1T4CB 3FHOA 4BO6A 1COV3 4QTZA 2YVUA 3IQGX 3QM1A 4Y33A 3O14A 1EXNA 1VQ1A 3V0AB 1RXFA 1QTNA 2ZR0A 4Q4W3 3CW2A 2VBIA 3LUBA 3D2CA 4C0QC 2YJ5A 3BRWD 4KQFA 4RZHA 4I01A 5KTOA 3PL1A 3ENNA 3WYNA 3KLSA 4YV0A 1V5GA 1MS3A 4GH4B 3LHIA 2PUHA 2K2QB 4F3YA 3D0RA 2DWQA 4RHV1 5LNK1 3IGFA 4TV9A 3WK5A 4NMWA 2YHSA 2ZGLA 3R05A 2ZHLA 4JENA 3AONB 2W1WA 2D74A 3TLMA 2HWE1 5BYKA 3PWKA 2O6HA 2X0DA 2PZJA 4GD3Q 3U40A 5JAMA 5KTTA 2A3NA 1UANA 4OAQA 1DJLA 1BIFA 3T1QA 4Q3BA 4UTZA 4FR2A 1G7SA 2DKFA 5IPFA 5LA0A 2UURA 1W19A 1N6OA 4HQ0A 1J21A 2IXLA 2OHIA 4ESOA 1AL22 3I3SR 4E5UA 3M4YA 4CTMA 6LDHA 5BYJA 4ZKTB 3S29A 3VPFA 3U4MA 1ZOSA 4V2IA 1Z0HA 1S4MA 4LOAA 3N2YA 5HR5A 1IQ0A 5JMOA 2YV3A 2XB2A 2NYVA 1U3UA 3EX7C 4KQ2A 1A82A 1D4FA 4ND8A 2H07A 2EVXA 5IXSA 3K3OA 4ZARA 2DKNA 4CFZA 3EVDA 1EWQA 3AUTA 1C9JA 2FMXA 3TE6A 4LSZA 4AEJA 3ZDQA 2OQRA 3O1JC 2PJRA 3ZXGA 1NBMD 2ETXA 4N6GA 3B5EA 1Y42X 2OENG 3KHKA 1NNLA 4QBHA 5AW6A 3QCWA 3QKWA 3IUNA 3UUGA 2WSVA 4L4XA 1KMMA 5F39A 3ZCRA 4FQ8A 4O63O 3THSA 4E70A 3OZAA 4H08A 4ZI3A 4Y2YA 1N3OA 3JCIA 4Z2WA 3WY6A 5I4IA 1SCNE 3WJ2A 5JQGB 4YZ5A 1V4VA 2JH9A 2A6ZA 1C9NA 3Q7PA 3CX7A 1BWPA 5HZKA 1ZGAA 1YFLA 3COSA 4FEYA 1EGAA 4DDHA 4KWEA 1PGPA 4H59A 2C7RA 3KCYA 2JIQA 1W4BA 3OI7A 1RJ8A 3TM5A 4ANFA 4NZNA 2GNOA 2XCUA 5CG1A 2Y1GA 3ZFFA 3ZIWA 1NUQA 5FUPA 4ZHQA 3IIMA 1GU3A 2VNAA 2IYOA 1HIXA 1KS4A 1HZZC 3I4CA 2VJAA 4OKNA 4LIUA 1GPYA 3V7WA 1QPBA 5GWXA 1V1RA 2GUGA 2VA9A 3MEPA 1IK6A 5A7HA 2P9HA 3I30X 3V1MA 1BJKA 1CZTA 1XQVA 4P5YA 2J3QA 5KAPA 3U37A 3WB1A 1FMFA 1NCQA 3KAQA 2XVYA 4WZBE 2FWJA 3ELNA 3WSTA 5F3RA 4DG5A 3ZSEA 4EG1A 3LSYA 5EGSA 4C0JA 1X74A 3IB6A 3CVYA 3BTXA 5KTRA 4GWMA 3LCJA 1M6EX 4AMUA 5C52B 2XTAA 1SG0A 2JENA 2ZR9A 4LPSA 4KC0A 3WV4A 2I2XB 1H3EA 4D92A 3EXEB 3L0PA 4CCOA 1U6KA 2ZUCA 5KNDD 1NBOA 1YJKA 2ZTSA 1DBIA 1RWOA 1FTSA 1GLNA 3ZWYA 1K5PA 3C6QA 3FBTA 1HE2A 5IAVA 1L5WA 4UDXX 1JHAA 4Y1EA 4RN5A 5DNEA 1S2OA 5A9SA 4LGMA 1FTWA 3RSLA 1JU4A 2ZE6A 3ICOA 2IZ1A 4GZLA 4AJ1A 3DS8A 4HFNA 3UKTA 1E94E 2C9ZA 2I6XA 3HHEA 4R1LA 1XKTA 4PLZA 4S1OA 3BFJA 2IODA 2R11A 5EZ5A 4OI4A 4GVLA 4XJSA 4ZOAA 1XPOA 1XNAA 3EGDB 3B85A 1Z08A 2W2TA 1QPZA 2R1BA 4XFKA 3KKPA 1KK3A 5EKXA 4A6SA 3VKHA 1GO2A 2XTJA 1X50A 2I03A 2CGEA 1O6CA 1J42A 3KOOA 1Z4OA 2GMMA 1FP2A 1HJFA 4NIIA 2AYHA 5LU8A 1GCOA 3PGMA 3I9V6 1MC4A 3ILSA 4G4GA 1NPDA 3AUJB 1EYBA 1NF9A 1ZKDA 2VHCA 3OZSA 1NXD1 4L8FA 4UD2A 3CINA 3EYPA 4Y1ZA 1VKJA 5FZMA 1OAKA 3UPTA 1BEV1 1TZ2A 4O02B 1GUIA 2IYLD 1ZGGA 5CLQA 1AXZA 4KRXA 2Y67A 2GN0A 4CMBA 1RXWA 3RRYA 2JLQA 3I76A 3GL9A 3H65A 3PCXA 3PKZA 2ET6A 1Q3TA 2VPXA 2NU8B 4HPWA 2HRDA 1XCOA 3NAZA 1E57A 3AK4A 3C2UA 4RJJA 3POJA 3BXPA 4DLUA 4TROA 1N2XA 1N5MA 1FJHA 4B17A 2JVIA 3Q6IA 1JPVA 4NARA 1I2ZA 4XJVA 4Z7OB 5DZGA 4Z7NB 4H27A 1GYQA 4A0SA 3K20A 5HRCA 2HH9A 1XKXA 3OZXA 3ILYA 3OF1A 4MPTA 5HQ3A 2EF1A 2GSWA 2QRZA 1OH3A 1F2TB 3OURA 1EVEA 5LSAA 1GZWB 4WACA 1WU7A 3PQ7A 1VL8A 3B6EA 5BNFA 1UKZA 4G5QA 4A2QA 3D54D 4RQUA 5KVCA 1REQB 1RTVA 2J46A 5A70A 1YQWA 3WGZA 5IXYA 2QKYA 4GC5A 4S2FA 4FLFA 4JRLA 5EXXA 2FX2A 1QG4A 4K6KA 3UMFA 1Z7S1 1DOAA 2DX7A 4Q1VA 1PLJA 2Q30A 5YASA 5HKBA 2ZRHA 4KBFA 4NNPA 4Q4JB 1OYYA 2CDBA 1XHEA 1UBTS 4UTNA 1U2QA 4MO9A 4XCAA 1L5SA 2V4ZA 4HVAA 4ZGWA 1BMV2 2W2XA 3BWYA 4RHEA 3JQFA 4BJ6A 4AKHA 1BU8A 4RVGA 1XTZA 2QVBA 4G8CA 1NBHA 5EHXA 1NY72 2E51A 3W9AA 4FAGA 4Y6OA 5DTRA 3PGXA 5KQRA 2FY8A 3G5UA 2JFUA 3DBOB 1WZCA 3BTOA 3LZ6A 1XQWA 3SKJE 3B01A 3Q3EA 4B6RA 3KL4A 3FOCA 4R7TA 1SOAA 3PB3A 1DQ0A 3NIGB 1SUEA 4BLUA 1S1CA 5JMWA 1T9GR 1U5IA 1K12A 3C8XA 1Y6JA 4RE6A 2MSLA 4CKEB 3VYRB 2X05A 5FDBA 2VDWB 1MB9A 5C1PA 4V0KA 2AGVA 4YRFA 4DF3A 3R7DA 4M46A 3LA6A 2Y27A 3H6KA 5DM4A 1M1NB 2VEDA 1X3SA 1C8KA 1ZI6A 3L8DA 2V7GA 1TKCA 2Q3MA 2EGGA 3EPRA 1T9AA 1Z5NA 3EDOA 1IN7A 3UK7A 3ELWA 2O2HA 1TJYA 2G1JA 3GUZA 4FNMA 1QDCA 4I3GA 4FS3A 5TQ0A 3SXUA 4MQEA 1E20A 1JOJA 3AZZA 2ACKA 3OIFA 1HQDA 1RR6A 1XEAA 2OC9A 5T5OA 2X23A 5I7SA 4WBNA 5BNIA 1QCZA 4XWAA 3CLTC 2AH5A 2CHUA 3A1DA 2ZWVA 3ROQA 1W0KD 1FRFS 1XRJA 5JDIA 2M9MA 4QD2A 1WMDA 2G80A 1ZNXA 2F9MA 3DYPA 5I7OA 3ZXJA 2DZDA 5E3JA 5FMOS 6AT1A 3NTUA 1MX5A 3HU1A 3SBDA 4N3AA 1XJQA 2YYYA 2QZ2A 2NU7B 3P4UA 5I9SA 2BZDA 1N9KA 2AXQA 4QSMA 5LY1A 5C80A 2ASEA 3UWSA 4FYXA 2R66A 3BD6A 2GHRA 1VLJA 3H84A 4HLUC 4X1IB 1PGQA 4JKLA 1SXHA 3KYJB 3KB8A 2ZB4A 3ZD9A 4LIVA 2M6RA 3JRWA 2O8NA 2R79A 4K28A 2P2YA 4DABA 3GAZA 3E05A 4DARA 3IO5A 1HEIA 1LOFA 2O7SA 2KR2A 3MT8A 1NXMA 4JGYC 3D8HA 3PC8A 1H1IA 3HO1A 3D0JA 2E7TA 1RKUA 1I1OA 4QEKA 2WNVA 3QLTA 1D2AA 1C0KA 4G4FA 4KQCA 4KKXB 5C3MA 4ZVPA 5AJXA 5J4VA 1VP9A 3ZLUA 4KNCA 3QZUA 2QLFA 1D5CA 4XLLA 2YXEA 3W1EA 1M3SA 2ZB3A 3USES 5K51A 4QBKA 2O0MA 2P9YA 3WNKA 1YK0A 1AZLA 4RS5C 1GWNA 1IZ0A 4M49A 1SQFA 2V1UA 5C46F 1JQKA 2KLBA 3RMXA 2ZPAA 1YR7A 4O08A 1F0NA 2JHPA 1HYEA 3TAHA 5EGNA 2C3PA 5ADWA 4RANA 1W6MB 4Q34A 4DSNA 5GLZA 3MLKA 2IXJA 1YBMA 3HXTA 5HM6A 4KO4S 2KX7A 2MSNA 3IM0A 4IWXA 3KD4A 2BUKA 4LOJA 1PX3A 2B0JA 4V38A 2BDRA 4XLTA 4D2IA 3L7AA 5KCMA 1YS1X 4LC1A 5GZFA 4QHYA 2W2NA 3GFRA 3M0EA 3KGZA 4PZYA 1R6TA 1U63A 3RROA 1UPIA 1BCRA 1HYQA 2F90A 4U4AA 2Y1CA 5IC5A 1CAVA 5LKRA 2XJSA 2V58A 2AW3A 2B3DA 3KB1A 3ZGOA 1W73A 5DHTA 1N2SA 4YDRA 3SBEA 3M4FA 1VSUA 3KQKA 2YQ5A 1BFKA 4TTJA 4L8YA 4G0UA 2YBEA 4NRMA 1FDOA 4WGGA 4LZAA 3RRJA 3DL3A 3D2LA 2EFGA 4GUDA 2Q5LA 5E6RB 4Q4V2 2JH3A 3GLIA 3NJVA 2QAGB 4KG7A 4KLAA 1H85A 2Q6OA 4KN6A 2GKSA 2DCTA 1FTGA 3RMYA 3NNJA 1V37A 3FE5A 3G2LA 3C1OA 1EDBA 4YJ3A 3FLRA 1MEOA 2EW2A 5ARDA 1A04A 4M0EA 1L7PA 3PRYA 5K0BA 2C2KA 4YAWA 2YXLA 2P5TB 1HDZA 3JYQA 2OPBA 4L8LA 1O8BA 1VLMA 2GPBA 1B1CA 2H5IA 2W8ZA 3D3KA 3GPDG 3QYAA 3RKUA 3BWMA 1SH7A 2I71A 4YRIA 2XUIA 4DDTA 2E21A 2WNHA 2A3YA 3U4XA 4PLWA 1RC1A 5I6DA 1T5BA 4Z0NA 4JQSA 2AMLA 3NJ8A 3JVUA 4LQRA 2JLYA 2G88A 3M9WA 3B5IA 4PSUA 1GZ5A 2FLWA 3TEFA 1FF9A 4HAXA 1ZN2A 4N4AA 1ZRSA 1O8CA 4NL4H 2C2XA 4DLLA 1BWRA 5K3FB 3E4DA 1F2DA 1M0EA 3DOOA 3PUXA 3S2IA 4LBNA 2QQPA 3N2KB 3HEIA 1NVUQ 5C71A 4CM9A 1VXRA 3J81k 3B1KA 1T3SA 1FP6A 2WP0A 1USUA 1YR6A 3WGNA 3QU7A 2ZA9A 1QYVA 4XYXA 1NSYA 5IBPA 5IM4A 4II7A 3UHAA 3WWZA 3UJCA 3L1UA 5SY4A 1FX0A 1AR93 2WIAA 2MINA 1Y9GA 3KGLA 1WP9A 5FOSA 3CM0A 4FE7A 3H3FA 4AAYA 5JAQA 4HVCA 1QUFA 4WA8A 3ETNA 4DLTA 2PX8A 1N6PA 4KE9A 4OM8A 4F8AA 1ND6A 4L8GA 1BMDA 1Z2NX 3CR3C 3B12A 4Z54A 5ECWA 2J4FA 4I0WB 1SHZA 4O1MA 1BW9A 4NZYA 3OZGA 5AW1A 4Q82A 5JH7F 1Z07A 4I6JA 4YRQA 2W42A 3G23A 1BD4A 1VM6A 4PX3A 2A5LA 2AT1A 4A4DA 2O8EB 4P08A 4MW0A 1OAAA 3CF0A 1NY5A 3QKSB 1ISPA 1ZJ5A 5DLYA 2W93A 3FWNA 3OG2A 3GYBA 2DXIA 3FZ3A 3AUYA 1HW5A 1KAOA 2JFVA 4IGAA 121PA 1DIOB 2UAGA 1B8OA 4AKEA 1NE4A 1H2HA 1Z0KA 3EVGA 1JAZA 3EOBI 4LT5A 3UTDA 5DYNA 3R4SA 1L5FA 3AQ4A 4I50A 4LGYA 2JZNA 2VZ8A 4RD7A 2XCOA 3JQ7A 3KQSA 4DY4A 4H0NA 4X7MA 3GO4A 4V39A 4XARA 3T7KA 821PA 4FTBA 2QPOA 4PHGA 1WW7A 4LCEA 4XYBA 1RM4A 3SM9A 1R6AA 3AO0B 3ZS9A 1RYYA 1OLME 5TXGA 5JG7A 5KQPA 3WRXA 1VBFA 4QICA 3OFND 4QE3A 4AO8A 4Q1AA 4GLBA 2IY8A 1P18A 3AM1A 4KGDA 2CDPA 3K46A 4DCMA 4L9WA 2IV3A 2JAPA 3ZKAA 2JD1A 1E1CA 1RZRA 2JXAA 4D0RA 5ALQA 3HSYA 5EYPA 2YFHA 3I9NA 4TLLB 3GCGA 3DPRC 1EFHA 4G89A 3MINB 4AJ9A 1Z7YA 3Q8XB 4DDWA 4ASUD 4P81A 1J49A 1L4EA 2P91A 1HRV3 1Z7GA 4I0AA 4MVJI 3AESB 3KYIB 5CIYA 3R6WA 1PS9A 3N36A 2PLV1 3SMHA 5ABJA 2DT8A 2GRJA 2REBA 3PDQA 2B4RO 2CXTA 4B33A 1GP4A 3UGGA 3MWGA 2LDBA 4EF5A 1A7UA 3RD5A 3OY8A 2OS2A 1YZ3A 4AJ4A 4E8DA 1GGKA 1MABB 2DFBA 4JP8A 1Z2OX 3T52A 3KBOA 4GKBA 4N7IA 3HMKA 1AURA 2UDPA 7ADHA 1SPPA 3R5JA 4LSWA 4PBPA 3RIHA 5K0EA 3KEFA 4NU0A 5F78A 2ZSJA 3L4EA 3OUTA 4DMKA 2XJVA 3CLRC 4JI1B 2JJQA 3E82A 1POV1 3R4CA 5DJ5A 2FW7A 3PNLA 1AHSA 3RC1A 1NT2A 4M21A 5IABA 1C28A 1WMAA 5KXCA 2QN9A 4JZYA 1XU2A 2PLRA 1KQGA 1RPJA 5DX0A 4ZQGA 1KSFX 2C1XA 2I80A 3BALA 2W95A 2Z2ZA 2HHLA 2CN1A 1O8SA 4MIKA 4PQRA 3QV2A 3ONDA 3U7RA 3REOA 3AL3A 2NSLA 3WSVA 5HBGA 3RYIA 2GZAA 4F9TA 5BO5A 1M5UA 3TLCA 1V6LA 2YBKA 1OLRA 5EWLA 1VG1A 2ZI3A 4L9AA 1G9FA 5CNKA 5FLKA 3OQNA 2H29A 3BFXA 3U44B 3PR1A 4AI6A 5FPXA 3ZWDA 4ML3A 4EKYA 3DPIA 2NUPA 1ZJZA 3E7WA 1JTEA 3VV2A 1YZFA 5B1HA 3N0TA 2AE1A 1U28C 5C7YA 3CKKA 5CISA 1VRH3 5FJIA 1JUIA 1UIKA 2EP7A 1UWWA 1WMSA 5GKAC 5BSEA 4P7FA 1ACCA 5BVGA 2C82A 1BHQ1 7REQB 3J7AC 1M8GA 3U3ZA 3KKLA 2ZABA 3L84A 3X3HA 3PUYA 5FZ4A 1E2HA 2GC1A 1NIJA 3FYDA 2Z6VA 5K0SA 1XSEA 1KF0A 3J81A 4EI2A 4WZFA 3L0OA 4JWKA 4MEJA 4QU2A 1QIQA 3HG7A 4LJYA 3E8XA 4WK0B 3KJFA 4OO3A 1AZSC 2QXTA 5JZGB 4MS3A 3OGVA 4LYHA 1X1CA 3IQHX 1R1A1 1BDIA 1KJIA 4XH9B 1GDDA 2VUSA 2YBDA 4X44A 1YFUA 5DHRA 1DQSA 4X6YA 3AC0A 2QPTA 2P75A 4O2LA 4F8EA 1RM3A 1ZI9A 3BWVA 1GFSA 1J25A 3UMCA 2VHQA 1E4EA 4Z4QA 1S5PA 3DEKA 2IUWA 4LXUA 4R9UC 4LIPD 1TCBA 3O95A 4Q6BA 1O77A 1T9HA 1YCIA 5REQA 1XTBA 4GG1A 4B4UA 1I14A 1VIMA 3P2YA 2IH2A 1PO13 2DBQA 1E8MA 4CM5A 3S40A 4RDXA 2WO7A 3KPUA 3RWNA 4XVHA 5K0UB 3HEMA 5TPZA 1VE7A 1Q1ZA 4BOWA 2MMCA 1RB8G 2YJTD 4UU7A 1UD1A 1TME1 4BEBA 1L5KA 3EY4A 1TW2A 2DCUA 3CXRA 4XI9A 2QTZA 4OQZA 2D40A 3WTCA 1QGAA 1CR2A 3KTAA 3LYAA 4HNAB 4BFZA 2RS13 1ZK3A 3PFBA 3ZHZA 1QZXA 3UEOA 1GUFA 4XJ9A 2CKDA 5IK2D 3CC8A 3UK0A 3GLTA 1O96A 2WA3A 1PFWA 2AKEA 3I6BA 5L95A 3W06A 2WZR3 2GZ2A 2ARKA 3MT9A 4TTPA 3I3DA 4ZV7A 1E0JA 3I1IA 4QJ3A 3LCVB 4XHXA 1UOPA 1KRXA 1K4MA 2X4LA 3OD4A 4HUTA 4PQYA 3HBAA 1AQUA 1K3FA 1L7VC 3H7IA 4FLMA 1QF6A 3UAGA 1OV4A 5FFOC 2JW5A 1IHDA 2C2HA 1UH5A 3JQ9A 3UV6A 4HV4A 2WG1A 1QO0D 2CTVA 4R8HA 3H13A 1C7EA 1KMHA 2OO3A 1U8TA 2DVDA 8AT1A 1P45A 5FR1A 1RHRA 1SVMA 5CIWA 3OMWA 3B3FA 1Q1NA 1RJDA 1JEYA 4B0PA 2COUA 4YH1A 2NZYA 4BIIA 1AKMA 3PEWA 3O9MA 5C7OO 4RSRA 4AIIA 3CNHA 1HQCA 1VGVA 4EI9A 3D3QA 5IFKA 1L7AA 4S3MA 5A1FA 3DV0B 2EW8A 4Y3UA 1BYHA 4YPFA 4D80A 2ID9A 2ADEA 4K6MA 4DBLC 1PK8A 3IIAA 1XE8A 3J80A 5KR7A 1AKTA 4G8JA 4Q1PA 3KR0A 1WBLA 5F2OA 1ZN9A 5KHHA 3QWBA 2B1IA 2YUIA 2ZI9A 3RNLA 1OBFO 2CL2A 1R0XA 1NW5A 5EEHA 1ZZBA 1G2PA 1YXWA 2JIGA 3CJQA 2UV8A 1M2NA 4K9DA 1QJFA 4HQLA 2P5YA 4FMPA 1GZDA 3DP7A 1R4NB 4U02A 4HLTA 4D9IA 2AIRA 1VKZA 1NMQA 3LQRA 4AVVA 5JD5A 2QMQA 5T8KC 1LK7A 2W94A 3SSAA 3SSMA 5IBRA 4OCTA 1TA9A 4X3OA 5H1YA 2CDNA 3VVCA 3ND6A 5DV9A 4GXRA 2BFBA 1J3QA 4B4PA 3DMHA 4HY3A 3AMVA 1JKJA 2PT9A 4OAOA 3SVZA 4M8IA 2QR3A 2ZYWX 3E03A 3ZQ4A 3LP5A 5TPWA 4BN5A 1R6DA 5JDCA 3KKNA 1E9VA 3SKXA 4ZOLB 2HWWA 1OXCA 3PCRB 3PNVA 3R4DB 1D3AA 1FP1D 4BQ5A 5DI3A 5DNCA 4BK5A 4AB1A 4LQLA 4IEWA 2VF7A 4FWBA 5DU2A 1NA1B 3JR7A 3WQ0A 2J5KA 1G3IA 2H4JA 3L7IA 4ZCQA 4RH0A 1V8FA 3TH5A 1J56A 1T9BA 1B15A 1CUBA 2VRNA 3ZFGA 4NR0A 3CB2A 4G1BA 1R50A 2W6ZA 1E63A 2Z5WA 1G17A 1QC5A 1P1KA 3G9UA 3NAGA 2BGOA 5IKEA 3QBDA 4JJEA 3T3GA 3B1JA 1QK3A 4L4SA 5B36A 3ZWCA 2C2BA 3M83A 1PIV1 1D04A 4KI7A 1KJWA 4XR4A 1QJY2 2IY9A 2R8YA 1JP7A 3VNAA 4WADA 5E0KB 2P6NA 5MN4A 2Y1KA 2VDJA 1S0GA 3WZ1A 4BNDB 2O6LA 4MOAA 4PIXA 2YS6A 4GH5A 3BOWA 4H18A 4NFYA 4BZZA 1EG2A 4KQ1A 4FDMA 1J23A 2G5CA 1O9HA 4OB6A 3ICQB 1Z4NA 5DAPA 1DKPA 1EWRA 1VMHA 4EUHA 1EP3B 3OF2A 3ER8A 2FCTA 5JLAA 1CUGA 1IHPA 4ND4A 2IFTA 2QMYA 3CW8X 1Z6XA 1UL9A 3D82A 1GNSA 4Z99A 4G9GA 1RMQA 3B3JA 3LP6A 2PAAA 1VBA1 1O4YA 5CITA 1G60A 2GK7A 4Y9UA 1BU5A 3F49S 4RCZA 3HBFA 1U31A 4CXXA 1OI2A 5JRJA 3HB5X 2XOMA 3PNSA 4WASA 2GHQA 1GGEA 9ABPA 1OTHA 4L6AA 2PXAA 2GJSA 2C0QA 2GM9A 3UKVA 4AOCA 1RCUA 5M34A 2D1SA 3Q8AA 1YIDA 1CQWA 4RXUA 1EFRA 3T9FA 2C92A 3AJZA 4FPEA 1UBSB 2NZJA 3W7BA 3ZH2A 2OM2A 1FI2A 5F21A 2X0JA 4N6OA 3CO0S 3CQ9A 2HBQA 4REMA 5BUVA 4JCKA 4XZ3A 2QL6A 2H59A 3AMNA 2WWSA 3Q8WA 3VO1A 1TF5A 4IF6A 2CT8A 1M72A 2FSVA 3L0CA 1Z35A 4YLEA 3E9NA 4FSHA 1PX0A 1I7DA 3V2GA 3P2KA 3IJRA 2VIIA 4L99A 1LS1A 3CRZA 4C5AA 1QFMA 2JS7A 1TUEA 3L06A 1KQ3A 3CLSD 1HMYA 3CLPA 1EZ1A 2BJHA 1CQIB 1U2EA 2O2GA 5TMDA 2Q62A 3BGWA 4EZEA 3DCQA 3ANMA 3IEVA 3NIBA 3EZ7A 4E5DA 2EFDB 1D1QA 4X5OA 4U9IS 5C4MA 2FHRA 1RVDA 4U7FA 3TB6A 4CLRB 4C0XA 5JTTA 2XYGA 1G9XA 2JJMA 5L9VA 2E9SA 4L08A 4AAPA 4DBLE 1MS1A 4K1ZA 1IQDC 3ZQUA 2QTBA 3EBOA 4B2LA 3E8MA 4A8TA 1GSOA 3G2IA 1E9BA 3RC3A 4G0PA 4C07A 2ID8A 1GV1A 5J2UA 2JBHA 1RHKA 3HWX1 4FZJA 5KJEA 3RUIA 3AF3A 1HF3A 2PSFA 4G01B 4F4IA 1E2LA 1SIBE 5B7PA 2IXCA 4GU5A 5MDHA 2XDWA 3BXHA 3QVOA 3MT7A 4HLQB 2ZQYA 2P4EA 5KWVA 3PGJA 1UZWA 4XD7D 2V97A 1BQPA 4BFVA 3GLRA 3THCA 5T67A 4EO7A 8LDHA 3T9EA 5K99A 2QSYA 2VNRA 2BR5A 1YUMA 2HWD2 3EWIA 4JEMA 1KRWA 1YCHA 4WDQA 4D6PA 2WABA 1YS2X 4JVNA 3SE7A 3DVQX 1DEAA 1KEWA 1W8WA 2X4GA 1L9XA 4LF8B 2XECA 2DQZA 2CYFA 2ZUEA 1C8LA 1NR5A 1OJLA 3PNYA 4LY9A 3DMTA 3CR7A 1J0DA 1A8PA 4RACA 4TQUS 4FPGA 1XDBA 4XBNA 1EGQA 1GFZA 1LBHA 4EFLA 3W3AH 2WFF3 4B4VA 5HUJA 3I72A 1CLEA 1TLFA 2GXSA 1O97C 3X1KA 3AJRA 4DLWA 2W4MA 1FFCA 4G5XA 3BZWA 2BEUB 4FPHA 4PI2A 1FXZA 2J31A 2EFEB 5EY5B 5DGHA 2WMYA 1EP2B 1NCRC 3RFVA 2LR0A 2JLWA 5BVHB 4DV2B 1WL8A 1TAUA 1OC1A 2H2HA 4XJUA 3ESAA 1ZK2A 5DDJ1 3KWVA 5GZEA 5ES3A 1IDOA 1NL3A 5AKHA 1KJNA 4CN8A 2B8WA 3WHUA 4YGCA 5A3JA 4MA0A 1E1QD 4DCJA 1DELA 1T2VA 3HI4A 3T41A 4F12A 4D7SA 3OU2A 3P2JA 4RENA 1UZYA 5LCXA 4NYIR 4AK9A 2QP4A 4JSTA 4AZ3B 1H5UA 3MIGA 2AKYA 3S2UA 1M34B 1ZA2A 1JILA 3MUNA 3NKTA 5FNVA 3SR4A 3I2JA 4E7OA 1MQSA 3PHLA 2WYWA 2RGBA 2XKOA 3OJ0A 1UZZA 4WMLA 2C20A 3VSCA 3WTBA 3A6EA 3OCYA 3RAJA 1UMDB 1PQUA 4ZT7A 1BGVA 3VDCA 3ESBA 2I4RA 2R87A 1E0AA 1LSUA 1VJ2A 3EBRA 1MF7A 4RJTA 3RJRA 2ZS7A 4AEDC 2PTGA 3I0MA 2W48A 1X7XA 3WIOA 1XPJA 2CV1A 2W9XA 2IGTA 5DCUA 2WOJA 5BNOB 3JQWA 4GGMX 2MDTA 2HLNA 1KC3A 3ZC3A 4MLCA 1H69A 5IJ0B 1UZAA 3H3JA 3IOCA 1ENQA 4BUJA 4XQ9A 3AFIA 3OCUA 5LP6A 4EEKA 3FKSD 3SQOA 5JUWA 1Z0ZA 2VDVE 1WKVA 4KAJA 3TLJA 1EUZA 1EH5A 1FJGB 2CUNA 2GXUA 2BOVA 3EIWA 5FY1A 3CZQA 3TR0A 4X6LA 3GJBA 4PICA 1YDEA 3K9LA 2ZR8A 3PUZA 5JVVA 1XMSA 3A4YA 3WRYA 1PVC1 2H17A 3H1BA 4XDQA 1CJCA 1HX6A 1G2IA 3RDPA 1DKUA 3T5TA 1GP5A 3TOCA 3GJTA 1NNEA 4CF6A 2Q4TA 3GJ8A 3GPIA 1DTSA 1YE3A 2Q0QA 4HZIA 3I2YX 4H17A 3V4VB 2VNJA 5MHTA 5HGXA 1N2EA 1Q43A 1U2SA 3DZ8A 1SEFA 1SLTA 2H85A 4XPIA 4BQ3A 4LF5B 3WDYA 1UFVA 1RJ7A 2JKXA 2QRQA 4MGKR 1P4RA 2P8JA 1IQAA 4MLZA 4YYZA 5EZYA 2VZEA 3HU2A 2HXGA 1Q2XA 4PIVA 4R3NA 4EQZA 3WQQA 5L9AA 2WOOA 3TXXA 4OJQA 3GDHA 5UKDA 1Y80A 2LROA 1IBKB 3FBWA 3X1WA 5TGZA 4TOIA 2DVGA 3H1WA 1HO3A 2C07A 5JMPA 2QI9F 3QUQA 1ZM1A 3H0OA 1PU2A 3K4HA 4CUKA 1AL0G 1K5MB 4AAXA 4GA9A 4D43A 2PGOA 1GNQA 3HR9A 4RMNA 2XH6A 2W7TA 4QGSA 1C1HA 1SUWA 4ER5A 1U8EA 5ITVA 4ICIA 3UBMA 4ZZ3A 5IDWA 3NIFB 3WWEA 5TIIA 3KDPA 3X1MA 3DDOA 1R18A 1MO3A 2WTMA 3R7FA 4URAA 1Y1TA 3BREA 2CNBA 5GADl 1MV8A 4YCMA 1P5FA 4UM9D 5CRIA 3ETEA 1CZUA 1EEXB 4MW2A 1TC2A 2H8KA 2EXJA 1GARA 4BWOA 5T5JA 3HBJA 1AUVA 2C0ZA 4NMLA 3X1XA 3BB1A 2AWOA 1KZHA 3K6SB 4N9HA 4KBZA 1RCFA 1ONAA 3D5QA 4CTKA 1US2A 3O8QB 2KBFA 1C8VB 3VC2A 2ZAGA 1AX2A 1M0TA 3OPVA 1AKEA 2QTVA 2ZQ5A 2GD0A 1E3DA 1YQQA 1ZNQO 4GKVA 3MJ4A 3UJ9A 1G38A 4CEJA 5BW4A 4J16C 3MGGA 4TS1A 3GIDA 2E4XA 3CVXA 3N5CA 3BMNB 1O08A 4DMCA 1WVGA 2ZIEA 2Z3WA 4NBVA 3CNEA 3ENQA 2H52A 1M2GA 3NHBA 2IUTA 3T34A 3PPYA 2RJOA 4O2AB 3OBRA 3PHGA 3BILA 4PO3X 2I8AA 4Q6WA 4EJRA 3O6VA 5ECDA 3MCZA 4WOCA 3L7LA 3UMVA 1PO21 1Q20A 1FTYA 4FZRA 4R7ZA 3O8NA 3LPDA 4M9RA 3IHWA 3P9IA 2NZUG 5KKAA 2UYCA 4W5QA 1Z5OA 1S0EA 1W2AX 2BVBA 1ONBA 3PIIA 3CMMA 4CIAA 4YY3B 4NENA 2YMMA 3UG7A 3HUFA 4HGPA 4YJ2F 5FPQA 5H02A 4FYHA 3CVOA 4LWZA 1HQLA 3AHDA 4YRZA 4KI0A 4C7VA 3S68A 4CM1A 4TWRA 3MAGA 4QKBA 1Y1QA 1NW8A 2PVCA 3NRCA 4UD6A 1RMU1 4IX9A 3VKFA 5T50A 1R8SA 3H7AA 1A8HA 3A6JA 4TX1A 4A7KA 3RRDA 3VR2D 3C1AA 1KJYA 3IOEA 3OT1B 1XZGA 1UJMA 2Y0EA 3AI3A 2WAOA 3D4PA 3W6ZA 3KT1A 3EXEA 3UMRA 3TTUA 2XUQA 4KFSA 4CKWB 3C14C 1N2CE 2ZI7A 5E7JA 2Q9AA 4FT8A 1QMPA 3PUSA 2W2QA 4TMKA 3VTAA 5TQ2B 1B35B 4S1PA 4C1XA 4QOJA 1ZZEA 4BNWA 1J22A 3IT1A 1RTTA 3DYOA 3OFSA 3R9KA 3OLCX 5DP1A 2R8BA 4XFCA 4Y1XA 2AKAB 4BEVA 1I51A 3H1EA 1N34B 2E18A 1OBOA 4WV3A 2RAPA 1AC5A 5CNAA 3G02A 5IFTA 4EVIA 1U7WA 4XWWA 3W4JA 3E5NA 2UUBB 3WRWA 8ABPA 3RLFA 2I3ZA 1THMA 4WM7A 2JIOA 4WCFC 3THPA 2EYUA 4PLNA 2ZWIA 2D8AA 3D7SA 4OFXA 2FPGB 1EM8B 5ESWA 1G21A 1SCSA 1C7QA 4CP2A 8ATCA 3VD5A 2RHDA 4LOLA 3LVRE 3ROGA 3GUHA 2J5QA 2P1ZA 4I55F 4YG6A 4PCVA 3I05A 1GQGA 1VALA 4YWHA 3S8EA 4PZUA 5JVDA 5A6XA 2GS9A 4GP7A 4FDAA 4RMHA 2B2NA 3WP0A 5DWVA 4AJ2A 3QE4A 1C3OB 5LZ6A 1JHNA 4NHEA 3SXWA 4BJ5A 2QAJA 2ZIFA 3NV3A 1J09A 3F6EX 3JXEA 4L11A 4GQBA 4BC0A 3GCDA 2XWBF 5B7QA 1ZMXA 4M9SA 1R9GA 1KXGA 4KQWA 5CT6A 5JROA 3W4IA 2YFZA 4MGIR 3OQOA 5L3SA 4JVLA 5L51A 2WYOA 1TD9A 4MA5A 3EG9A 1CRZA 3FCYA 1P81A 5HJ7A 2DPMA 5AM0A 3CZ4A 2H1FA 2GF9A 1Z8HA 3A2LA 4RAOA 3IYLW 3KV1A 1ZM7A 3LSDA 1HQWA 3AFGA 1DYOA 3FROA 2AOTB 2XJTA 3HV2A 3DVLA 1STOA 1PK6A 3CRW1 3FKJA 5M29A 5CA0A 1MB3A 3H1AA 3MAJA 4GWIA 1IPSA 1T0HB 3DD1A 4JFRA 3VBHC 4OGWA 4Z53A 3KZOA 5FYIA 3OJLA 4WECA 2FEAA 4AX8A 5CM8B 3JD72 3FPGA 1L4GA 4R98A 5JUVA 2WS91 4DM3A 3JWHA 1BE1A 1TE1B 3EB9A 1QWSA 1U4OA 1WSWA 4QUEA 3HM2A 4Q37A 5CVCA 3OJXA 5IVEA 3N9OA 4C14A 4XYGA 4I4TB 4ER0A 2F8LA 1U0BB 3OGJA 3HT1A 2QE7D 1I9GA 1JDPA 1NTOA 4I08A 2AV6A 2BFPA 1PTJC 4MUNA 5IKXA 4EFMA 1SHKA 4MDFA 4OPMA 1ZJYA 5IK4A 4GBMA 1H9BA 3KKOA 3HN1A 3S99A 2V5AA 1PGW2 2MYPA 3BXZA 1JEQA 1MG0A 3V42A 3RWKX 2RCYA 4QJ4A 3MIBA 2R041 2CFOA 2VDWA 2JRCA 2R25B 3FGPA 3KBBA 1NNSA 3TZCA 1CIPA 1N5IA 1H1DA 3KQUA 2YASA 2PMDA 4DXTA 1XQ9A 2PMFA 2FN3A 1AR71 3VZBA 3F4LA 4IQPA 5JYDA 1UEXC 4INJA 4GSKA 5BWMA 4M53A 5K9YA 1THTA 1SUSA 2PQ0A 4W1PA 4X97A 1L8AA 2G4IA 1FNCA 5AI4A 3IESA 4EHJA 3K1ZA 1Z16A 2D62A 1U0EA 5CAZA 3ETCA 3OICA 2YC0A 1JJIA 1J90A 3A21A 2GKOA 4Z7JA 4IEFB 4F2GA 1JUHA 2O1XA 1ECCA 1KVTA 3WIUA 3IMFA 1NQJA 4LITA 3W8RA 3SJ7A 4AJPA 4ZS2A 2NU9A 4UM5A 1KZ4A 3IBGA 5AVKA 5J4YA 3AF6A 1ULZA 5HK9A 3W2FA 1RXGA 2B5VA 5I7RA 1LRHA 4ERXA 2QVSB 1NDQA 2R0HA 2O50A 2DV9A 2CHHA 5JDIC 2NSHA 2JGNA 2FZKA 2GJ4A 1KY4A 4YRAA 1ACMA 1YL6A 2DOKA 4XD2A 1YQ6A 4X1IA 3KEMA 1XB9A 4EI8A 3ZZUA 1HI9A 4HGRA 1TM5E 4EY3A 1PYGA 2GNPA 2I34A 1C5KA 4JB3A 4RQAA 3CRQA 3GRCA 5FULA 4CR8A 3HCPA 2G6TA 3OD1A 1HT0A 3CEMA 1UJCA 1RRCA 3VKWA 1B09A 3RTEA 1JE1A 1OOPC 5J63A 4J07A 3VNQA 4ARBA 4X7PA 2A57A 4QQ2A 1Y9DA 1ZQ9A 4RGQA 1T34A 1SDDB 1P6QA 1RDFA 4KXXA 2G25A 1GQHA 3OMXA 4ZCSA 3HQUA 2VUIB 4DC9A 4AF6A 2H5LA 3RSSA 4GAZA 5CDUA 1NG9A 3LCUA 1SCRA 1Z3CA 3VB9A 3IRUA 2UZ1B 3OLWA 4MV0A 4EHFA 1KR2A 2NPOA 2BRTA 4D8MA 5JPDA 4CV2A 3X44A 5CCXA 4ND6A 4AG5A 4I9UA 4K5QA 3B3QA 1S8FA 2DDUA 5I93A 1L5GB 4XIFA 2J9FB 4MP3A 1UY4A 1IE3A 2VKQA 4F3RA 1SXJB 3D4LA 2BM8A 3EWSA 3IPAA 2P9BA 3ZU2A 4CIDA 4YARA 1JEAA 4MPDA 1JEJA 1OF1A 5HILA 3JASB 3RKSA 2RMKA 5J4KA 3L1HA 4KR3A 4HDQB 3OPMA 1Y8QB 5EPOA 4BJHB 4JGBA 1NLMA 1DCMA 1P9OA 2W58A 1EE1A 3PPIA 1TC1A 2FXIA 3E48A 4BFWA 3EIOA 3FMPB 4P7BA 1ASJ2 4JVOA 1PTKA 4B7AA 2VXBA 4LLFA 4POOA 3SPXA 2O5RA 4QX3A 5CNMA 4BNYA 2C4VA 1V11B 5EUBA 1B0AA 1ZW1A 5DHSA 2QAGA 1GQYA 1AKWA 2O3SA 3LQQA 4IEIA 3W5NA 4UI9L 4MQ6A 2Q1SA 2G4CA 4A5OA 4Q47A 2RB5A 3WL8A 4KVAA 4LFBB 4MKIA 4OP3A 3H9BA 1K89A 1KP3A 2VL7A 4JYPA 5F98A 3HWRA 1QKIA 5CVDA 3VH2A 2P2LA 2CU5A 3MLBA 2UU8A 1S0DA 5KCZA 1JIQA 3I4FA 3LRXA 3QUAA 3T7RA 2IP2A 3H2GA 3ZCTA 1FOD2 1X1RA 1RPTA 1SG9A 1WPGA 1CUAA 3QFSA 2IYSA 3DKPA 3WMFA 1EHCA 2PXJA 4EOGA 3TIIA 3HZOA 4JP1A 3TBKA 3ILFA 1IONA 5CVEA 1AX0A 4R05A 1ULEA 2VXRA 3B1WA 5BW6B 4TT3A 3D3JA 1QVRA 4I9FA 5TMEA 4QBGB 1CE8B 2DULA 3N8DA 5FPAA 4RZ3A 1F9AA 1G2OA 1AQJA 3U56A 3MQFA 1YRBA 3S2YA 4B7ZA 4MRRA 2YH2A 3K6JA 4BGUA 2IUUA 1EAH3 2WZCA 2PXCA 1FMCA 4IDDA 4M3NA 4NVPA 2VCEA 4FMCF 2BBVA 2ONCA 1WWYA 4WJZA 1A34A 5EP1A 4C6SA 4GZ3A 1LRJA 4FNGA 4TLGA 4R4ZA 5EMLA 2IF2A 1O97D 5DHFA 3GK3A 1FC0A 1ORHA 2REOA 4MVYA 1TMF1 4GL2A 4CLXA 4RQTA 4UFKA 1SIUA 1FPN1 1HTWA 1NG1A 4DV7B 2JE7A 1K98A 4KQMA 2CBGA 4JLPA 1RUH2 2DFKB 4E14A 3M6FA 3ZLBA 1EFTA 5IVJA 1RI1A 2BGRA 3BEOA 5C35A 1UKRA 4LFAB 4IJWA 3H50A 1IOWA 4BBJA 1TQ5A 4BNXA 2HJGA 5FBKA 1XEWY 1QGUB 2E0IA 4AJOA 1ND2C 1G19A 4U1RA 2CLSA 2VSQA 4X24A 3A37A 5JR2A 2ADMA 2C24A 2C42A 2AI2A 3O2SB 1MEC2 4DMHA 1H5QA 1Z0SA 1SIOA 1YB4A 4WFQA 2FCAA 3QKSA 2B78A 5BV8A 3VMFA 3CLSC 3VDDB 5KHJA 2IXEA 3PUHA 3ZY5A 1F6DA 4FPOB 4DLXA 3ZHXA 4YRMA 3I5XA 1TNFA 1W5BA 1GCGA 3ZY6A 4EPVA 2ADDA 2Q0AA 2OE2A 2ICAA 5FWYA 1XNQB 1T3LA 3RWMB 3RUFA 3QVUA 3NYQA 2H0VA 2CLHB 1RUI2 1LV7A 2Q0HA 1L7OA 3ZYRA 1SLIA 4IDPA 1EFAA 3GC6A 4YAJA 1QRDA 4QGBA 2UVQA 4N1AA 4DLVA 1A9PA 5ACA2 3O0TA 1SVSA 3LFIA 3UK6A 1M67A 5FP3A 3IIIA 1AN9A 2NQTA 1VYVA 3MWFA 4JL6A 3LYUA 5JI7A 4PTYA 5GJBA 2VDNB 3WB9A 5K01A 2PKQP 5E38A 3FFZA 1AXGA 3P4XA 4QJIA 4FVVA 2CUZA 3ON7A 4GOKA 1RKVA 1YKFA 1OVSA 4KODA 4DPKA 3MZ0A 4R6XA 2IT1A 4YRCA 3PI7A 3T1MA 1NXTA 1BH6A 3IT3A 4YVFA 2WLTA 1C8M2 3JVIA 2QD3A 3HDVA 1ZK0A 1QTRA 4B73A 4ADSG 5BRNA 4WBSA 4EB8A 3N9IA 1ZIXA 3E6DA 1WZXA 4QOGA 3TE7A 2CWMA 4PDWB 4M4SA 3CMCO 5FX2A 4I2VA 1DKRA 3K0KA 3WG2A 3Q9NA 2PV7A 3LPCA 5F3GA 2XNKA 3QWAA 3JZIA 3LX6A 4F5DA 5L53A 1JBEA 4EJSB 1VC2A 4AMZA 2G5GX 2KI5A 4YRTA 4M9XA 4N49A 4BOYA 3D6MA 3ZM8A 2FR8C 3UXYA 3MT0A 3EQ2A 1Y89A 5CFDA 1IUKA 2Y0CA 3EVZA 4MCAA 1MN6A 3K70B 4M7OA 4B2IA 1UT5A 4XQWA 1C8BA 2WWFA 2BRUA 1R092 1GNRA 3FPFA 2B1QA 3U4IA 1ODIA 3VV3A 5C4WA 2HQSA 221PA 1VBE1 1CYEA 3I49A 4P0PB 2XNSA 2Z1MA 2ZRPA 5D8AA 4QDRA 1RUF2 3GEDA 1P2SA 1YI1A 4NHYA 4QELA 3AMPA 4M22A 1OFHA 1KYVA 1H5NA 2QTLA 3ZHQA 3AVUA 2GTPA 1DHTA 1APBA 4IHKA 1WWKA 4UPEA 3H83A 4Q24A 2RHTA 4JOSA 3ZYGA 1EFLA 3ZGLA 4MQLA 3USUA 2VZ0A 4V1CA 3LK7A 2HT1A 1LECA 3E3LA 4KWUA 3N39C 2GPNA 4ZVVA 1EGHA 1Y3TA 3O7OA 2PAEA 4BAZA 4IV1A 3JARA 1ADYA 3NMUF 2F6BA 3FLBA 4F7WA 4Q0UA 1L4MA 3F97A 3RS0A 4IWYA 1UEIA 3FNRA 2H1OA 1XU9A 2FPLA 1UKCA 3SKYA 4GM4A 3SBOA 3FPJA 2I07B 4XUQA 3R4VA 1JKXA 4AYUA 2FHSA 1QG0A 4ESVA 3AR4A 3ZPXA 3I59A 4GBED 3HABA 1V26A 4LMAA 2EV9A 1PFKA 3HXPA 2J7KA 3ONEA 4YMVA 3CH4B 3TGLA 1VIVA 5CEJA 1YT5A 1XD8A 5LUBA 2RKBA 1QJU2 4QULA 3ZHBA 4EK9A 4ENPA 1IN4A 1W49A 4PFJA 3UWMA 5ALGA 1CUCA 2FU5C 1SXQA 3JQAB 3Q12A 2XUJA 4RHV3 3U3XA 1ZLXA 4MKHA 5AVWA 2XZDA 3GHNA 5C8YF 2CCKA 5FI5A 1F5SA 2VHTA 4DQAA 2HWE3 3VR5A 4CQMA 1Y7PA 3W5BA 3QU4A 4R2KA 5M2QA 1YOBA 5I7UA 4CEWA 4M8LA 5CDHA 5KNBA 2Q41A 4INPA 2JG9A 1JWAB 4GR4A 5CFQA 3G9TA 1ZU5A 3C8UA 3REGA 3I5YA 3VZKA 2VH1A 3EFHA 2OQ6A 1NNUA 2ETVA 2XHZA 1F4HA 4DEYA 1C2YA 4LHEA 5DNYB 3WP3A 1I1QB 1XZKA 1KVQA 5FAXA 3ASYA 5LB2A 4RK4A 3BMCA 3NBYC 1RGSA 5AVOA 1MZ6A 3NBUA 1EB8A 2X5JO 1CEXA 2JAOA 3PR2B 1EVLA 2GJKA 4CMCA 4EQ6A 1GADO 3ZE1B 4XURA 4Y24A 1QCYA 4MKFA 5LQNA 3VBRB 4F46A 2VDPB 4IKEA 3NHKA 1XZQA 4H7EA 3VYVA 2PBZA 1YZGA 2C5BA 2AEEA 3OPQA 2VDUE 4ZJYA 5D3MB 4EE2A 3EA5A 1NI3A 3JYPA 5IUJC 4UVHA 3QA3E 4XEHA 2RHPA 3MCVA 5E1RA 5JDBA 3TSOA 2XUHA 4A5SA 1VBB2 3QXSA 4Q3AA 4ONUA 3UB4A 1J9GA 4DQ0A 4TVOA 2VWHA 4J0EA 3MF6A 5G3ZA 1N1TA 2A8YA 3P71T 3QP9A 2N0SA 1TTTA 1FXWF 4LNUB 3M1YA 1YFXA 4V02A 4DEXA 2P5SA 5FPTA 3DVSX 3ZIAA 5D1HA 1KC1A 3NTXA 1ZCJA 2NO5A 3S7EA 5HX7A 1JU3A 4FKMA 3UJDA 2Y3IA 4IQ0A 1AUPA 1AYN1 5JS6A 4UHBA 1RLIA 4NPLA 3PD0A 4H4DA 4XUDA 3NHWA 1U2RA 4TTIA 3CVWA 2OZLA 1VJRA 5BNPC 1BCSB 4O1HA 2XVAA 3GDOA 1EINA 3O8OA 1IG0A 3TX2A 1WO8A 1EX6A 5C8CA 1SQSA 2CLMB 3B6JA 3GUCA 1L7DA 1CZHA 4A1OA 4JLOA 1CULC 1WCDJ 5JSFA 1UF9A 1NOVA 1NVKA 2UKDA 1XFDA 1SXPA 2XGGA 4UNSA 4NY1A 4TS3A 2LIVA 4WNAA 1GN8A 4GM0A 2P2SA 4J7CA 3QNMA 3E2IA 4IE6A 4J29A 3IODA 1KGDA 4RA9A 4LTAA 3C6ZA 2NVBA 3TUJC 2ZROA 3CUEF 2N47A 2QQMA 1PG0A 4U63A 1E1YA 4PYKA 3SLIA 4G84A 3ZBQA 2WSLA 1JYEA 2NXCA 3H9EO 3DTNA 4IILA 2WNUB 2R1TB 4NZMA 4G07A 1LCLA 4BDVB 2PBRA 5CDYA 3AGQA 4LF7B 3JB8A 4BDTA 1LLQA 1O5LA 3OLZA 5E6SB 3WYEA 1JHQA 5DVZA 1H2LA 5FY4A 1I0IA 1DP0A 1VL5A 1D09A 2QP3A 4J43A 3JPWA 3QVGB 3ITQA 2D5AA 3SC6A 2O1SA 3P9YA 2V4UA 5JNUA 3PD7A 2NTJA 1ZZ6A 4MSUA 1G59A 1L7NA 1FU8A 4OVKA 3SZMA 2CCGA 5JDCC 3UJQA 5KX5F 4BQOA 1V5EA 4KNVA 3RC7A 2PX0A 1YR3A 2O0KA 3QUCA 2R072 3KKZA 1N25A 3UJ8A 1XL1A 3HBKA 1T1EA 2MYNA 4CIYA 2IKQA 1Q56A 3Q88A 1LPNA 4AK3A 2GZHA 4ZYZA 1GAWA 1PSDA 4O4LA 2VZQA 3ZD6A 4RE5A 1BEV3 1I33A 3KSRA 1RLUA 1DUVG 4O33A 4JVSB 3JQBA 3I53A 4B7UA 4NPMA 1J8QA 2FFQA 1DXQA 4BHTA 4YAFA 1MS4A 3PIJA 4DY6A 5T4FA 3NO4A 2JEMA 1LHWA 3MSCA 4BNDA 2KM2A 1WW8A 3GT7A 4Q26A 4CW7A 2OGUA 1PNFA 4CCMA 3AHIA 3EWAA 1OU0A 1XALA 4Q4AB 2JI4A 4QPGB 4TLEA 3SQDA 4C1WA 1RW4A 1Y5LA 1JYCA 2NQYA 4QOSA 3Q40A 4AZ0B 2CYBA 3TG2A 2WO3A 1FMD2 2JA2A 2VF8A 3POWA 4V0OA 2JIRA 1YYNA 4H7MA 3ET4A 4QA9A 2HM7A 1USGA 3QRWA 1DU4A 1FUYB 1JR2A 4HHEA 4BBPA 3NFYA 1RVF1 3OCVA 1XTPA 4Y18A 1MRSA 3AKTA 1VLQA 1Z7S3 1L3IA 3E22A 1WETA 3EC1A 3QW2A 1B14A 5ENDA 1DKQA 4RQPB 4AF9A 2W43A 1BQ4A 3UXHA 3O0WA 4S04A 2IDJA 3GGDA 1MW9X 2R3SA 1QRAA 1KZGB 1RI2A 3ZDDA 1JI0A 1P8AA 1JDNA 1NU8A 3QLUC 4D4JA 1AGPA 1XELA 3H4IA 4ES9A 4ISBA 3RFTA 1QBGA 1TJ4A 2F64A 5H70A 3E97A 2VUHB 3B48A 3F5SA 4MCHA 4YG0A 1TEXA 3W79A 4DCSA 1ESEA 2BM9A 4I36A 4CM6A 2AMJA 3KUKA 4LRQA 5SV8A 1UBJS 1QOZA 4BAGA 2ZEZA 3MPBA 4YZ4A 2HU5A 4UBOA 4HKOA 4BNMA 4K9LA 1R3DA 2PQ6A 2X14A 3JCZA 1XP5A 4D57A 4YMWA 2GPAA 2OCXA 1ZRFA 4ENTA 4BMSA 4FP2A 2AHOA 2C3YA 3DZKA 5F2WA 2YHJA 2DMRA 1XDUA 3OEWA 5FMCA 2FSVC 2PKQO 3HNBM 4JUIA 3PVSA 4MAMA 1ZK1A 4K1YA 1VPVA 4V3CA 3TL6A 1W3XA 1ZI8A 4U9UA 5DYWA 5B6JA 1HURA 4PT6A 1QQP2 3FZYA 2IYYA 1KP9A 1S02A 1NVFA 1NSTA 1V16B 4M9UA 2BISA 4CUAA 1OU4A 4P80A 2HEVF 5BN3B 2GVNA 4B1LA 1DG6A 3HGTA 1Q7RA 4GYJA 4TV8B 3ND5A 1M1YE 4PYJA 1ORDA 3O9ZA 1YFKA 2QUIA 1TI7A 5E6UB 4D7TA 5BMVF 1NVXQ 2ZTVA 2OO7A 4YMUA 3IURA 3PYLA 1J2YA 5DP2A 1JHZA 1TQ6A 2JFFA 3UUFA 5FY7A 2QG4A 3OQHA 1SLCA 3HZRA 1S55A 2IYNA 2X5XA 4FC6A 1FFYA 1WR8A 4DMFA 4YVSC 1O3YA 1WHSB 3WINE 4Q3DA 3DDUA 5LBUA 1A3CA 1WRBA 2FEOA 4AT1A 1N2JA 3C3KA 1T4MA 2GNMA 2XKAA 1GEEA 3OJBA 3DLIA 5GONF 1IHOA 3WLJA 6REQA 2P2DA 4NHKA 1KAQA 3BEDA 3ZE9A 5KYGA 1C7ZA 3CJIA 4GQAA 4MYSA 1UDBA 1RUC2 3P2EA 4G0QA 4KYIB 1E0DA 4K6HA 4K8FA 2XB6A 2J3DA 2W2LA 4OXIA 1WQ3A 3G2JA 4HOOA 4NZOA 3LHDA 4QAQA 2AXPA 4QTUB 1NMXA 1XD2B 3CZRA 1JRLA 5F9MA 1YRZA 3ROZA 4DYHA 5JJLA 4NPAA 4A73A 3BDAA 1QOQB 4CDWC 1VE5A 4WZAB 4ZU6X 2P2GA 3WLHA 4BQRA 2I45A 4BLSA 3D2AA 1D2NA 2QT9A 2WEKA 1LI5A 2Y33A 2V54A 2YN2A 2PSEA 4KEAA 1CUEA 2ARAA 4ZIRB 2RR12 1AD2A 4TWBA 3M3IA 2YV4A 1OHHA 5KYUA 3L77A 1U9CA 1I0LA 4ZEMA 4HDRB 3PURA 3C3WA 4QGHA 3DEMA 1A50B 1FP4B 2XWPA 2REQA 3QVSA 2PUJA 4DT1A 2GA8A 4IRXA 1OROA 3RTAA 5DM60 3GD5A 1WIWA 5BVHA 4D0LB 1IQUA 3P0JA 3WLMA 4EITA 3A9RA 4GB32 4AY4A 3RHFA 2H2AA 2VTXJ 4WCDA 1N6KA 3EY9A 2ZX1A 1MH9A 4U8GA 4DYVA 4YRGA 1E3TA 2P77A 1HSZA 4FIZA 4HDSA 3DR3A 4BLQA 1THGA 2EXXA 3B60A 1DYPA 4LBLA 1YAJA 1C3EA 3NDJA 4EB6B 2W90A 2PYZA 1PX4A 4UVDA 3NXSA 2W1QA 3WF1A 4QX1A 2D6NA 3AB8A 2OAGA 4LULA 4S1NA 1P4AA 4DV1B 4G5RA 9LDBA 1YA4A 5G40A 3A27A 2ZGNA 2CXOA 2UZ0A 3BE8A 2CNNA 3GRAA 5GZ3A 3INGA 5KVVA 4DRRA 5GMOA 1KJQA 3VU8A 1P3Y1 2CLEB 3BKWA 1YHYA 2UUAB 5HMLA 3S0JA 3O4GA 2B99A 3TECE 4OIMA 3OVMA 1BHO1 4ITVA 3T7JA 3ILHA 1FFXB 2HV8A 4NV3A 1PEDA 3BN6A 1ODCA 2J0SA 4JBNA 3VSBA 4M8NE 3DTTA 1OQEA 2A0UA 4NECA 3IPLA 5IJ0A 1NDUA 4M8SA 4MW5A 4I2NA 2RG4A 4ID3A 3WDTA 3HBZA 3N28A 3HB7A 5EJZB 3WHTA 1D6NA 3VYTB 1K27A 5BNNB 2R5WA 3D43A 5A4DA 3VZOA 4A6OA 2K5UA 1KEKA 4M3CA 1M1ZA 1S3GA 2Z5VA 3AR7A 2VN8A 1F48A 3GOHA 1J1LA 2FWNA 5LP6C 3K1YA 1JFFA 1T6GC 2WBKA 1F4AA 4E2QA 4NMXB 1ZUIA 1UP6A 1V47A 2D13A 3FXAA 3HT2A 5AVXA 1MH1A 4MMXB 1UMBA 3JZFA 2C84A 2SKEA 5FLEX 1VBC1 3NNLA 4G5HA 1BVP1 4FQ7A 5L7YA 3P9KA 4U7TB 5KPJA 4V2WA 4D6QA 4QXMA 1D2MA 3MLAA 4XXAA 4YGXB 3DYVA 5B4UA 1NW7A 1DZTA 2VNOA 1JVBA 2ZLBA 2WWWA 4CM8A 5FZFA 3FG9A 3I12A 3GJ6A 2Y34A