4QQLA

Crystal structure of c1ql3 in p1 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
KIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q-like protein 3
publication title Structures of C1q-like Proteins Reveal Unique Features among the C1q/TNF Superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qqlA00
4DB5A 5CIRA 1RJ7A 1RJ8A 2R30A 2WNUB 3FC0A 4D7YA 4E4SA 2WNVB 2HEVF 1ALYA 5KWRA 3K51A 4QQLA 2TUNA 1S55A 2WNVA 4OUSA 1U5XA 3ALQA 3QBQA 2KA3A 1GR3A 2ZJCA 4F3JA 4J6GA 1A8MA 2JG9B 3LKJA 1IQAA 1TNRA 2ZPXA 4G4FA 4GIQA 4OUMA 1D4VB 1XU2A 3TYJA 1JH5A 1KXGA 1PK6C 3B9IA 3AB0A 4KG8A 1D2QA 1C3HA 2E7AA 2JG8A 4EN0A 5HBAA 4E4DX 4HT1T 4MXVA 3B94A 2QDNA 1U5YA 5KC6A 1O91A 1OSGA 2X29A 2OIIA 4QQHA 5TSWA 2TNFA 4G3YC 3URFA 4DOUA 2JG8B 2Z5WA 2WNUC 4MXWB 1PK6A 2Q8OA 2WNVC 5KC5A 3MI8A 2QE3A 2R32A 2AZ5A 4MSVA 1JTZX 4KGQA 4MXWA 2RE9A 4QQ2A 1OQEA 2HEWF 4QQPA 4QQOA 1XU1A 4TWTA 2JG9C 2RJLA 4TSVA 3V56A 3TWIA 4QPYA 3WD5A 2O0OA 2RJKA 1PK6B 1D0GA 5L19A 2JG8C 1I9RA 3B93A 4N90A 1KD7A 3QD6A 2Q1MA 5L36A 4RSUA 2WNUA 1DU3D 3K48A 4KGGA 4NN0A 5BNQA 3L9JT 3ME2A 1WCKA 1C28A 2R6QA 4OULA 1OQDA 2HEYF 3IT8A 1DG6A 2JG9A 1TNFA 1U5ZA
chains in the Genus database with same CATH superfamily
2VBDA 2VNGA 2YPDA 1PMHX 4Z07A 2PAKA 1LENA 1S0GA 1XBFA 2R30A 3D6EA 4Z82A 3VZKA 4A7ZA 2EALA 4HKWA 2LALA 4IEOA 1GFF2 5JLVA 5DXDA 1QJX3 4JKLA 2VOKA 1BEV1 4UW6A 1HW5A 2W1WA 2Q8EA 5C8CB 4YZ2A 2H0VA 4LBNA 1COV2 3ENRA 4ATEA 3NO8A 4URTA 5FREA 2AEZA 5BPXA 1POV3 3C8XA 1WMDA 2JE7A 4AF9A 3AKRA 4YVWC 1QJEA 4QPGB 3KV9A 4PDWA 3I2OA 3GZTB 1AL22 2XUMA 2B4KA 3JBG2 3DCQA 3NV3A 3SH4A 2D5FA 5J96B 3VBHC 1JZ4A 1QQP3 4YGDA 3RZLA 4QGMA 1W6PA 1V6MA 1UWWA 2PHFA 3HEIA 5T5JA 4CP0A 2E7AA 1T6GC 4URAA 5DAXA 3CZJA 1SFYA 3V64A 1AYM3 3I97A 1IPKA 4HKLA 1HN1A 4YNIA 5FZ3A 1YFYA 4OHZA 2BBVA 1Z78A 2MPFA 1BEV2 5FYYA 3UGFA 1KJLA 3O1RA 1PO22 4XMIA 4N9IA 3VBSC 1CX4A 2VCAA 2XBO1 3MW4A 5EJZB 1RVF1 1SEFA 3HAGA 3UESA 1YC61 1D4M1 3PTYA 2X53S 3URFA 3TRSB 1CJPA 2NQYA 3PUHA 1BXHA 2GAUA 1NCQC 1W2OA 2O8QA 1VBB3 3WUDA 4Y5SA 5KC5A 3H8UA 4W65A 1K3IA 2QQJA 4MADA 4FPOB 5FZ0A 5FZ7A 1R082 2GALA 1VAVA 3V65A 3LEMA 4LKEA 5JOWA 1W6OA 3IDEA 4JGZA 4Q4X2 4RL7A 2HWE2 4GH4A 3C3VA 4IE4A 4LO7A 4LTAA 5FK8A 1WMFA 1X7NA 2VVEA 1DYPA 1W3VA 4YW4A 5A3OA 4YVWA 2BTVC 4I09A 2PLV2 1OPMA 5FLHA 5JXIA 4XC9A 4KU7A 4UF0A 3VHRA 3WR0A 2JDZA 2PHUA 1VJ2A 3LA2A 3ACLA 3WDVA 4HETA 3VHNA 1X33A 4CCLA 4RGAA 1RVF2 4XTMA 3VBHA 1PHMA 2JDHA 3T2QA 3ES4A 1D4M2 3P3NA 3PIGA 5BNPC 3J9SA 2W3JA 5KHGA 5FPVA 2Q1FA 5FPZA 4UFIA 4PIYA 4EN9B 3JBG3 5KHJA 3CKHA 3ZO0B 4YM1A 4RD7A 2QNKA 5IK5A 2WAOA 3ASIA 1ZRIA 3AC0A 2HWC1 2XQXA 3G7DA 4WM7C 1UL9A 3RZJA 5FBJA 4UFLA 4P9YA 1UMZA 1V6KA 4P9WA 4JKKA 2E63A 2LW8A 4UI9L 1IHMA 5FPAA 3LEKA 3RGBA 1CIWA 4ISRA 5JSOA 2ZGRA 3AYCA 3N9OA 3QH7A 5KR7A 1DDLA 3VBSA 4Q0QA 4C0BA 3PVBB 1NLQA 2VMEA 3CDZB 4QHZA 2WNVB 4RGGA 1GMMA 2NP0A 3TN91 3X29B 2A71A 1LU1A 3CJIA 4ZZ8A 1PO23 4MH0E 1HRI1 5G04L 3WDXA 1NCQA 1S55A 3MW2A 4XAEA 2FD8A 5FZBA 2XJUA 3L2YA 1UYZA 4AEDC 3I2JA 3B9CA 3KQRA 2ZKNA 1YCIA 2JG9B 3NRUA 1OLRA 4IE0A 1IKQA 5JI7A 4HN1A 2HWD2 2ILMA 4XJZA 3SNMA 3IM0A 1R083 3ACFA 2H6BA 5CA6A 5L73A 4CXWA 2HWC2 1PMJX 1OLQA 4BPZA 1J83A 1JW6A 3RZZA 4E8CA 1W8FA 2GNDA 1RUD3 4Q4X3 4QX1A 5AVAA 2HWE3 5JAXA 2ZGLA 1XYOA 3ZFGB 5FR3A 4PIZA 3ST7A 4M00A 4BQ1A 3BIWE 3ZXEA 3UKNA 3N9PA 5LB6A 3KV4A 1OVPA 1XNBA 2W9XA 2B7YA 2WT2A 2YDEA 4M0HA 4XMAA 4CCJA 3S57A 1CX1A 3FMGA 2GU9A 4CPBA 5IATA 2PLV3 4L8QA 3S7EA 3TN92 3U4SA 2XJRA 3NJZA 2QDNA 4YM2A 5I93A 1HRI2 5C9AB 2AYHA 3T4HB 3KWVA 5IK8A 1QOTA 1MS3A 4ZHNA 1OI6A 4XXAA 3OGVA 4FPFA 5LRSA 2J1UA 4YW7A 4WM7A 2H0BA 3HD8B 4FT8A 1FXZA 4PF5A 5IVJA 4XFFA 4Z2AA 2CWSA 3Q8BA 1TG7A 2VTFA 3H3UA 4DY5A 2R041 2WFF3 5FYVA 1ZNPA 2ZHNA 3VBFC 4AVVA 2DCZA 2LRPA 4AHYA 4D69A 2W87A 3PVOA 5CB7A 1GWKA 4BH9A 2XQRA 3POEA 5A1FA 3Q9OA 4NAOA 1UZYA 4ASMB 4FVVA 2GN3A 3N9LA 1YQ8A 1IG3A 5KXDA 5D8AB 4LHNA 1WMEA 1RHI3 1YQ2A 1SLCA 1WGPA 2YZ4A 3I49A 2W52A 3A4UA 4A44A 1AHSA 4MHUA 1G7YA 2IFRA 1LODA 3WP6A 2YG0A 2VNOA 3M3QA 4OI2A 2VMGA 5CNAA 1S0DA 5FYCA 1K42A 4JCKA 4OHVA 5ABJB 1DU3D 1QJY1 2HWD3 2R042 3MLLA 3ME2A 2D6PA 1C8M1 1OOPC 4HLTA 2BOJA 2XJQA 4LBMA 2CGOA 3KCYA 1RUNA 2ZX3A 4DEQA 1EUUA 3VBUB 1UY2A 3I2DA 3M3IA 3GBFA 4EN7B 3D0JA 3UETA 5DAWA 4ARXA 3NQHA 4Y26A 1GOGA 4D6QA 3DECA 4B1LA 5FOJB 3H1MA 5KXBA 3WQ7A 3GHNA 1UKRA 2K0GA 4IV1B 5A3TA 4KI5M 3PJYA 1XPWA 3UGGA 2IC1A 1J1TA 2UYAA 1H1AA 2QBXA 4AGVA 4IEYA 4AHWA 5LA0A 4NIDA 2G1MA 1S1AA 5KXEA 3NSTA 4FSJA 2IUWA 4ES8A 5JZGC 4CEWC 2OS2A 2QQUA 4PLOA 5FMBA 1GWLA 1REFA 3TAYA 1UW8A 1UZVA 1F9KA 1FATA 2ZEZA 4R9DA 5DUUA 1QJY2 5F3IA 4BQ5A 1X50A 3EQEA 2OKXA 1C8M2 2CL2A 1NKGA 3KF5A 3R4SA 4M3CE 4N53C 3BU0A 1H6YA 3CLPA 4D8MA 1LOAA 3AP5A 2VW1A 4XZUG 3WDWA 3J7LA 5F8PA 3LA3A 1PIV1 3WW3A 4FOVA 1N3QA 3LCPA 3UGHA 5C3OA 2F4LA 1D0HA 5FQ0A 3ZYHA 1HQNA 4CDUB 2E33A 5JOZA 5F5CA 2RDRA 1VBC1 3CU7A 2I2SA 4XXPA 1N1TA 4XJWA 1O4YA 1LECA 3AZYA 2A73B 4P08A 1PNGA 4R9AA 5F5IA 4K1ZA 1AYN3 2VZTA 3IB3A 1O8PA 4K21A 3EXUA 5APAA 2LM3A 5FY8A 4LK6A 2CDPA 2JE8A 4Y1ZA 4AI3A 1U5YA 5A80A 5GLZA 2D6KA 1OOPA 5KC6A 1UXXX 3OF1A 1UAIA 2VQTA 4A6SA 2ZHKA 4K3UA 1WBLA 2R043 2GN7A 3N35A 2WWSA 3AJYA 4DOUA 1YJKA 2JXAA 2B8MA 4FXKB 2NLRA 1NZIA 2Z5WA 3J7NA 4A42A 2D3SA 3DPRB 1W2AX 4YPJA 3DUIA 4EWDA 1PIV2 3LAGA 4BQ2A 4UXAA 2RE9A 4OHXA 1QH6A 4QQ2A 5DUWA 2R073 1CAVB 1WW6A 1EPWA 1OQEA 3GNEA 4LUMA 4QQPA 4UBHA 4YGCA 1VBC2 4YW6A 4DQAA 4EZHA 1AR83 2RV9A 3AM2A 4CEWA 3TEZA 1JYTA 1PZ9A 4G9SB 4OMDA 5H9SA 4BXSV 2Q8CA 4XFHA 5JXHA 3OPWA 4HXCA 5E8AA 4L99A 5DUVA 2UWAA 1HRV2 2ET1A 1MEC2 2QQIA 5H9QA 1D0GA 1Q43A 3VHOA 4CUBA 3J8F3 5LY1A 3KV6A 4N53A 2D44A 1AXYA 1JN2P 3H1YA 1GANA 3OY8B 1QJY3 4EV0A 4HG6B 5T5OA 1C8M3 1PVXA 5BYNA 1MS9A 4ZXEA 3H42B 4LLFA 3THCA 1Y7BA 3ZXLA 1AR91 3CL1A 3Q8FA 1JUIA 4QHOA 4BQ4A 2A6YA 2HJIA 1XJAA 1UOFA 4OULA 2ARBA 5LATA 2RG4A 1DQ6A 1KS4A 4OZOA 1Q8OA 4P9XA 4XJ8A 1HIXA 2VZSA 2WWUA 1H9PA 3CBNA 1YYNA 3L2HA 3WVJA 2ZHMA 1U5ZA 1KRIA 5C7GA 3WXPA 2RS13 1XNKA 4HKOA 4E8DA 4EE2A 3HR9A 3PNAA 5JDBA 1ZVFA 1AJKA 2D6OX 4NIHA 4FO9A 5K7PA 4UFHA 3C7GA 2OUHA 3MIGA 3WNLA 3UT0A 3ZN6A 4AVAA 3PHMA 3SMHA 5JUVA 4J25A 2QQPA 4IERA 2A70A 3TBDA 2ZKLA 4PJYA 4XOGA 4CDWB 1S0FA 3ZYJB 5LEJA 1V00A 4YZ3A 5DDJ1 2XONA 1UY3A 4B4PA 5FYSA 1AR92 3DYPA 4RQPA 3MIEA 1LOBA 1KGYA 2DVGA 4LK7A 1XU2A 4Q4Y3 1OKOA 3RJ2X 4C90A 1JH5A 1JXNA 3THPA 1RUH1 4H55A 4F8AA 3SH3A 4ASKA 1EAH3 2ARXA 3ABZA 3K46A 5A70A 2P3KA 4PQ9A 3DYOA 4XJAA 3HT1A 2DTWA 4PCRA 1VBC3 2ARAA 3WCSA 1AXKA 3POWA 4KG8A 4D0QA 4ASLA 4LITA 4BYYA 3AKQA 4Q4W2 3HT2A 4YLZA 4YVSA 4DO0A 1YFXA 2GMMA 2RM21 1KITA 4Q8KA 1WCSA 1HRV3 1ZA7A 1MEC3 2E9QA 2WT1A 4HT1T 3WQ0A 5ACA1 3TEYA 2WO7A 4IETA 2WINB 1G9CA 4GMP0 3WEZA 3WQ1A 4DUVA 4WM8C 3LF7A 2JKBA 1Q56A 5J98B 2Y6LA 2X5IB 3CO2A 4LPLA 4WVVA 2BRTA 3VZLA 5DDJ2 2A75A 2I07B 2MHFA 5T5LA 5JCTA 2TNFA 5FKCA 2WZR1 4NHLA 3UKTA 3WCRA 4FBFA 3IN9A 2WQ4A 3WT3A 4GQ7A 3U75A 3WG1A 4TLGA 4Q2FA 4RHV1 1ACCA 1RUH2 4OQ8A 4K8FA 3EJKA 1FNYA 2YU1A 2DUQA 2ZGTA 3IZOA 4AEKA 1RB8G 1YJLA 4NHKA 3UNPA 2SBAA 4FFIA 4WVWA 3RI9A 4AL9A 4M0NA 4XFCA 1RUJ3 2OX0A 1RUC3 2RM22 3AMQA 5JXGA 5IUQA 4NHXA 2IXKA 1PX4A 1GZWB 1GOFA 1OD3A 3P5BA 5ACA2 1OQ1A 5L9BA 2YGMA 1ENSA 3EO6A 1DGWA 4IEPA 4UOJA 2DU0A 3HN3A 5DAPA 4XVHA 2ZZQA 1XQNA 2A3WA 3VD3A 4DRRA 1O59A 4LE3A 3B93A 5IK7A 2WZ8A 3AX4A 4QU1A 1VMHA 3DV8A 3O1OA 5L7OB 5B2GB 4O9EA 1CPMA 4IV3C 3E5UA 3H7YA 3SKVA 2WNUA 5DZGA 2BOIA 2WZR2 4KBZA 5BNQA 1W0OA 4LEJA 4IEZA 3H0OA 5FZ6A 1VRH1 1XNCA 2BW8A 3AL5A 1CAUB 2VG9A 2VVDA 1WLWA 3V0AB 1CZVA 4YARA 3C7OA 1MQTC 5FIXA 1N1SA 3I2GA 2X10A 4DPNA 3D3AA 2D6NA 4QKFA 2WS91 2MNGA 3P1IA 2R7EB 4Q4W3 4OLLA 4WM8A 1ZREA 2VVFA 3USSA 1AVBA 4L11A 3OD4A 3FUQA 3IDCB 3U11A 4XQWA 1PVC1 1WD4A 4KMQA 1ULCA 1VBE1 2XL7A 2C5DA 1EPZA 3KT4A 4CP9B 5BNNB 5FZOB 4XF1A 3ZSKA 4JKMA 2ES3A 3RRDA 1YI7A 3G6JB 1ALYA 5K8SA 4ZU5A 3PMEA 5EP9A 1UZZA 1APNA 4QQLA 4Z92B 2CGPA 1H2KA 5HXMA 1LTEA 4XHXA 4LOTA 2O1QA 1ULEA 2BPA2 2RJ2A 3PURA 3JB8A 4AEJA 2VECA 2VXJA 4IEVA 3KV5A 4KBBA 1CZTA 1VRH2 4ZS2A 4LBLA 2FCTA 1RUF2 2QDRA 4YZ4A 4U2AA 2XWBB 1TNRA 2ZPXA 4HSLA 4I3PA 1OFSA 5FXZA 2DFCA 3ZFEC 3KVBA 4OUMA 4FOYA 1E5HA 2VCMA 2CU5A 1ZBA1 3I2FA 2VQUA 2WS92 1UXZA 4ARYA 1LOCA 5EXOA 4AAXA 1HDKA 2Z79A 3ILNA 1CD3G 5FAXA 5IWFA 1I1EA 4AFCA 2VZVA 1C5HA 4AR2A 4N43C 4DFSA 4AI0A 3WY6A 3POSA 1PVC2 4LBQA 1VBE2 4W6XA 2ADEA 4KNCA 4Y22B 1QJX1 1NQJA 3KD4A 4QKNA 2VL4A 2Q4SA 2WA4A 3C2UA 3ECQA 2E53A 1FNZA 3DL3A 3BTZA 1TE1B 2P3JA 5EZWA 3ZIXA 1POV1 3HNMA 2GC0A 5A32B 4BJ0A 1LNSA 1NE4A 2PELA 4E4ZA 1NA1C 1HJFA 5F1RA 2OIIA 1STMA 1MQTA 2V5DA 4MOAA 4D6RA 1W6NA 5EFUA 2WLQA 1ENQA 3A0NA 2GNMA 2GH8A 2PHWA 1OA3A 4Q8LA 4NIAA 2F6BA 4DIQA 4CU7A 1UU4A 3SISA 2EIEA 4Y33A 3ZLIA 4MYEA 1QQP1 3EYPA 4HONA 4FFHA 1O5LA 1LR5A 2G9GA 2ZBJA 3HBZA 2Q8DA 1AF9A 3POFA 5A33B 1GBGA 2VR4A 1WCDJ 4C8DA 4QXCA 4AQSA 1O3SA 2XJVA 3B01A 1AYM1 1ZM1A 1AXZA 1QKQA 1RUG3 3SKJE 5DG2A 5EWSA 1WZXA 3GM8A 4IEUA 4TWTA 2E7QA 4CCMA 2ZHLA 3LA7A 1XRUA 3C7FA 1QOSA 4QDRA 5F2WA 5GZFA 4NAMA 2OYZA 3NAPC 1LRHA 1UOJA 3ACIA 4QPIA 4S2FA 5LBBA 2Z42A 4HZFA 4ET7A 3GJAA 2VGDA 1OD5A 2W1SA 1TZOA 5JVVA 3ZFEA 3WNMA 4GD4A 4CU8A 5FY5A 3I2HA 4FPCA 4CUGA 4IGOA 4B7KA 1GQGA 4GB33 1RUF3 4XJUA 4DXRA 2ET7A 5C5UA 5FYMA 2P17A 1PX3A 4IW3A 5FY1A 1W0PA 3IBMA 4PF1A 1POV0 3W59A 1W04A 2JDMA 3KGLA 3FE5A 3QH6A 3AFGA 3PVNA 2WS93 5L9RA 2PFWA 4AWDA 2VUCA 1VMJA 1OHFA 2JEMA 3W9AA 2A6ZA 4LBQD 1GUIA 3IWZA 1OKQA 2C26A 2O8OA 3OUJA 1WW5A 2VU9A 1REEA 5FZ9A 1VBE3 1W3XA 1UIKA 1W9FA 2ZX4A 3AYDA 3N36A 2Q8OA 1JU4A 2JDKA 3S0MA 1NA1A 3RDIA 5IFPA 4A4AA 4OI0A 1DFQA 1JS9A 1A8DA 3E1F1 1I6XA 1CVNA 2OPWA 2Y6FA 4Q1PA 1RITA 3FUOA 1J3QA 1Y3TA 3A21A 3MPPG 4NR1A 5FWEA 3WNKA 2W1UA 4OUSA 2A6VA 2LTNA 2VD7A 4IESA 3VLBB 2Y0OA 1GR3A 1LOEA 1CZSA 1ULDA 3JBG1 4JRLA 5F6KA 1CESA 3THDA 4BMEA 5KXCA 1I3HA 1YFUA 5I0RA 1M06G 1W6MB 4LO4B 4NMIA 2HWF1 2JE9A 3FLPA 2C9AA 4HL0A 2GMPA 3VV1A 2B46X 1S0BA 1XOYA 4P00B 1EP0A 1SPPA 2J42A 5GLVA 5SV8A 1US3A 1SG3A 3IKWA 4OYUA 2Y6HA 5I8YA 4A41A 1Q8SA 2OZ6A 5C3RA 2PQQA 4IEQA 1POQA 3H8RA 2VBPA 3NAPA 4LUKA 4JQTA 2DVBA 5BNPB 1SLBA 4CDQC 5HV4A 4YW2A 4JGZC 2YGLA 4GH4C 4HPKA 1OH3A 2GC1A 4IQPA 2VUDA 4XQDA 4MV2A 3N3HA 4UW3A 1PO21 3LPFA 2YFZA 3U1XA 1JI6A 4B29A 2RS33 2YC2A 3SXWA 3PUAA 3ZXKA 1O4ZA 2CYFA 1W0NA 3NNLA 3OYWB 4Q29A 4JQRA 2FQPA 2I45A 4BLJA 5LK5A 5FZ8A 3NKGA 5FZ4A 1NT0A 2BERA 3WNXA 2AACA 5FO7B 1RTVA 3VHPA 2BNOA 2OPKA 4LQRA 5CISA 2JG8B 4Q0UA 2HWF2 5K0UB 1R081 1GOHA 2D5HA 2NPIA 2E31A 1FPN2 2WR9A 2ZGQA 3N9QA 3WZ1A 2GMEA 1RUD1 4Q4X1 4AVSA 2HWE1 5A6YA 1BKZA 1F2NA 4AW7A 4LORA 1JYVA 4MXWA 1DGWX 1ST8A 1X82A 2JD4A 2A6XA 3BTAA 4FP3A 2EA7A 1P8JA 3AZWA 3HOBA 4QWNA 1OUXA 5HCBA 1H8TC 1AUYA 1OFNA 3PUQA 4MVTA 3JQXA 2PLV1 2VY0A 4UT5A 4QMAA 2JENA 4XF0A 3WF0A 5I0DA 4UWDA 1RUOA 4DXZA 4QM9A 3I3MA 4HVRA 3ILFA 4O61A 1B35A 2DU1A 4OFGA 5FMDA 5AFEA 3HJRA 1DGRN 3T2OA 1NG0A 4LO5B 1NCRC 1QY4A 2EICA 3CJIC 1KS5A 4N90A 3VZJA 1IOAA 2BVVA 1MPXA 2LS6A 4BDVB 1SCSA 3RQ0A 1W6QA 2Y0IA 4L0PA 2VOTA 2WFF1 4Q4V3 3GGLA 1ZYBA 2HH9A 1QDCA 5CFDB 5IFTA 4O7XA 1MS5A 4CDQA 1YRZA 3B02A 4HK8A 1Q3EA 1RUD2 4Q27A 2WLPA 4BE3A 3VZMA 1PZ7A 2VXRA 5E88A 3RZMA 1SDDB 4CEYB 4NIGA 3T1MA 2C0ZA 1DHKB 2EIDA 4E9KA 3T4VA 1RHI1 5K4LA 5DN2A 4PIXA 3VBOC 2W46A 5FO8B 4PI0A 4C1WA 2NZ9A 2F4PA 2PAMA 5C3QA 3KS7A 3D0SA 5B4NA 4Y20B 4ZKTB 1W9YA 3K4ZA 3PTRB 2DV9A 2PHDA 3LDBA 3VBFB 4A6OA 3MUZ1 1B09A 3JU9A 1H2MA 3BUCA 4S2DA 2ZZJA 4V2VA 2VNRA 5J3UA 2TUNA 4IUGA 1GV9A 1ENRA 2ZGMA 1U5XA 4PBPA 1EY2A 5KBFA 4LO8A 1UN1A 3FLTA 1W8OA 3ALQA 3BVCA 2HWD1 1CR7A 2ZGNA 2WFF2 3BALA 5JSRA 2FDIA 3MDPA 4A7YA 2XGXA 2KR2A 1NAEA 1QOOA 2VTXA 2HWF3 4QX2A 5F3CA 5IVYA 3PUIA 5F7UA 3LKJA 5FLJA 3VKLA 4GAZA 1FPN3 3ZFFC 3WLUA 1K5MB 2D7FA 1H8TA 2P37A 2ZX0A 3N7MA 5FQ0B 4DNYA 1O3TA 1ND2C 1SFNA 5FCCA 1NXMA 5A6XA 1NQDA 2BUKA 3N7LA 1CWPA 4RN5A 4PLNA 1FX5A 2GH2A 1BJQA 2QQKA 3MYXA 4IGPA 1AX2A 1RHI2 1W39A 4XF9A 4A45A 4LT5A 3GF6A 2EF6A 3AZZA 3WP4A 1PO11 1NCRA 4M4RA 4XYXA 1XB9A 3LOIA 4I0WB 3KB5A 5CU1A 5C8CC 2XPJA 1OOPB 4JAAA 1JZ5A 1C5IA 2W39A 4AQ2A 3H7JA 1SMVA 2D40A 1BQPA 1K5JA 2G9FA 4L92A 4CP1A 1LEMA 4QPGC 4J1WA 4N7UA 1W9SA 3AKTA 1IS4A 1XYNA 1H9WA 1MS0A 3N9MA 4FXGB 4WV8A 3TB0A 3MGUA 5F6LB 1QXRA 2ID4A 4MGIE 4YRDA 4XZPA 2JDAA 5A3PA 1EV12 4QXBA 3E5XA 2RR11 1X8EA 5IVVA 3K3NA 3VBOA 5JOYA 3IPVB 5A3LA 1PK6A 1MZFA 1MR5A 1S0IA 2BWCA 3LD8A 1A6CA 3LIHA 1UIJA 2D3PA 4NOTA 3I3EA 5FTTC 4DUXA 5BY5A 3E6BA 3LPGA 4DEVA 5JZGB 1FOD2 4E4HA 5AVPA 4WVMA 1SCRA 2IXJA 2QZ3A 1PO12 2HBTA 4UFMA 3AVSA 3LWCA 5FKBA 3RMYA 4BM8A 1QGLA 2PYTA 2WQ8A 2C4XA 3GALA 4UAPA 2WYFA 3AZXA 1AX0A 1O3QA 1ZRDA 2RJLA 4EWEA 1AYN1 4TSVA 3V56A 2Q30A 2WKKA 4CCKA 5A3UA 3I59A 3BOPA 4EWAA 5M0TA 3FLRA 3Q8EA 3ES1A 3VL9A 2BYVE 4LXLA 1W05A 4M3CB 3ZFFA 3KT7A 1DZQA 1W90A 1ND2A 2RS53 1W2NA 4IE5A 4P5HA 1OMIA 2CNAA 2GNTA 5CVRA 3SH5A 5L36A 4I3GA 3RFRA 1JODA 2E6VA 4AHZA 2CGNA 2Y6KA 2RR12 2JECA 5FUIA 1R64A 4WZFA 1Z0HA 2P4EA 3J7HA 5FOBB 1G6NA 4P5YA 1UYXA 1BMV1 5EPAA 4MUVA 4YW1A 2XR4A 2H6CA 2YBPA 4OCTA 3MIDA 4Q26A 5GJ6A 5C8CA 2NN8A 1YNAA 2R071 5DZFA 1SFPA 2JDUA 3BB6A 2WYSA 1AR81 4QDSA 5FYUA 4QXHA 4QPGA 5DMYA 5E89A 2QKDA 3T1LA 5CADA 4DB5A 3A22A 1AYN2 1HQLA 3C7EA 2XB6C 3IDBB 1BZWA 4Q0PA 1ZX5A 1ODMA 4OI1A 5BUVA 4FPGA 1CAWB 3NNJA 1LHUA 3JUUA 3J8F1 3PJQA 5I8SA 2AR6A 2A7AA 2P6HA 2XHNA 3K51A 2IXCA 3W5MA 2VO5A 1V6NA 1R1A1 5FP7A 4Z8BA 2R16A 1YO8A 2FZ2A 3OBAA 1EV13 3H1WA 2AH2A 3VZNA 1TME3 5A3MA 5JWPA 1DIWA 2QQVA 2PXJA 1DBNA 1IQAA 3ZR6A 1BMV2 1ZA4A 4XHBA 1DQ0A 5F3EA 2R072 1ZRFA 1FOD3 5A1LA 3LZZA 4ZPIA 5AFBA 3GCXA 3BKZA 1AR82 1PO13 1OUSA 3T2TA 3R4DB 3K2OA 2BV4A 4CDXC 2WC2A 2RS11 4JGYC 1HB1A 1WLCA 2VTXJ 2N7GA 4KWLA 5IK4A 2ZGKA 5FDBA 4HSJA 2C24A 4DZGA 4GA9A 3T0DA 1TMF3 2HBUA 4KL1A 1NY72 1OC1A 3J8F2 1F31A 5JXJA 4Y4YA 1GWMA 5CBLA 2XJSA 2WN3A 1L3JA 5IHRA 5IYYA 5IJRA 1O3RA 1NYWA 1R1A2 2R1BA 5C3SA 5IVEA 1PMIA 3RWKX 2WDBA 2ORZA 5A7WA 3DXUA 2X29A 4LKFA 1HB2A 4S2HA 2RR13 4M01A 4OZXA 1WA6X 4MGZE 4OQ9A 4COVA 3OGJA 1AJOA 3ZMOA 4FQZA 1W9TA 4AI9A 2O14A 2W08A 2CV6A 2TEPA 3K3OA 4Q1RA 4Q4Y1 2J1RA 3ZFGC 4AI1A 1NUKA 1EAH1 3MI8A 2VE1A 1J3RA 5F32A 2WSUA 2ENRA 4TXWA 3S6PA 3VDDC 3D4KA 5CFCC 1A3KA 2BFUL 3T09A 1US2A 4BIFA 3MICA 3AMHA 1W8TA 2RS12 3T0AA 2HYXA 3NW4A 4AFMA 2XUEA 4QQOA 1LHWA 3BI3A 1BBT3 3WINE 1HRV1 4HVQA 1MEC1 1GLHA 4NRMA 3OCPA 1JYXA 2J1AA 3SITA 4BISA 3TWIA 1H4HA 1RUI1 2DVFA 5JPMB 1UU6A 2HYKA 1VB2A 2YBKA 3D82A 3KGZA 1WWYA 2V72A 3ZOIA 1V6IA 2QVSB 5CG9A 2HWB1 2XMLA 4ZU7A 2ZEYA 4QAWA 1RINA 1IQDC 1LHOA 1ZZ8A 1HX6A 4B8EA 2WSVA 1GP4A 3W58A 2P2KA 2D43A 1S2EA 4IL7A 2VMCA 2FBEA 2Q1ZB 4Q4Y2 4JGYA 2UU8A 4CDXA 4OUEA 2AENA 2ZXQA 1EAH2 2NMNA 1C28A 5LK7B 4WM8B 4RQPC 5D8AC 2RDSA 4YM0A 5EYYA 2YYOA 3WX5A 4BLIA 3HNBM 3ZXJA 5HPOA 1UO9A 5FP9A 4A2UA 2ZGOA 1RUJ1 1RUC1 1H2LA 2JG9A 4ZZ5A 2QQNA 1FMD3 1UOBA 2ERFA 2FZ1A 4XUNA 5FFOC 4V1PA 2D6LX 4D3WA 3N7JA 4HVOA 2E32A 1VLNA 1RXFA 1RUI2 3MF6A 4YVSC 2JIGA 5KHIA 5DG1A 2P3IA 5FZEA 1L7RA 1R1A3 3IDAA 3ROUA 2HWB2 3J4UH 3ZFGA 1XNDA 2B5HA 2FDJA 3WG2A 2VOXA 3WF3A 4YWAA 4AOCA 3QCWA 1FV3A 3HQRA 4LULA 3VDDA 1JOPA 2ZX2A 4IEXA 1UX7A 5CFCA 1J3PA 4J6GA 1PM7A 2PQSA 4R9BA 4Y1UA 5G05L 4K9SA 3VBUC 2WAAA 3VKOA 1HLCA 4FPEA 4RS5C 4JVAA 4NO4A 1IG0A 3DGTA 2VZUA 2ZS6B 4FQ4A 4NUBA 5DQ0A 5C9AA 5B4XA 1DQ2A 1EUTA 3GZAA 4W4ZA 1LHNA 4NJ4A 3WNOA 4EQVA 1F35A 4IV1C 5GZCA 4Q4W1 4MLOA 2EXJA 1JZ7A 2W91A 1RUJ2 2ZA9A 1RUC2 2WZPP 4EJRA 4IV3B 3ZSMA 2BGPA 4IE6A 2XG3A 3PU3A 1NLSA 4COYA 2AUYA 3GBWA 1QJU3 1ULOA 1JOJA 2GNBA 2YB7A 2ZEWA 1JYIA 4CCEA 3WHUA 2D6MA 2C6SA 2V4AA 1C8NA 4P14A 3ZX7A 5C33A 5SV5A 5FYIA 5AC93 1MQTB 1GNZA 3AP6A 4DMIA 4CU6A 3KLSA 4AFBA 2YC4A 4R9CA 2ZACA 4Q5OA 5D8AA 2VW2A 4GJYA 3LGRA 1W06A 3CEWA 1W8ZA 3N7KA 3N9NA 3SHRA 3WOGA 3ZSEA 2GP5A 3KHCA 5CAZA 2WNUC 1UNBA 3AP7A 1VALA 3USUB 4CDUC 2P6CA 5EJ1B 2AZ5A 1RMU3 1S2BA 4K40A 3GZUC 2PAEA 5ABJA 1RXGA 5D2AA 3E97A 2BEOA 2A1XA 4FP2A 4META 1RUI3 3BTXA 2Y8KA 1UYYA 3AZVA 4QKDA 5C3PA 5BXXA 5C5TA 1FV2A 1BVVA 2QUOA 3VBUA 1F4AA 1SZBA 5CZKA 1Y9MA 2HWB3 2IXLA 2VAUA 4RS5A 4HOOA 3WD5A 4W6WA 3P6BA 4DRVA 4F7ZA 4J1XA 1MS8A 4FAGA 3PU8A 1CIYA 1V6OA 1W8HA 2ARCA 1GKBA 3NJXA 3FFZA 1WKYA 2Q1MA 4IV1A 3JD73 3RSJA 4N43B 3VKMA 2QJVA 5T54A 1SLTA 1I5PA 3MPBA 1ZZ7A 3UKVA 3JXSA 1CGPA 2B9VA 4MGYE 4CCCA 1KQRA 1WCKA 1XC6A 4MGSA 5FP3A 2X05A 2ZGUA 4NWVA 1S2KA 3FHIB 1KDMA 1QMJA 3JB4C 3AL6A 2EAAA 1RUG1 3OJBA 3OPZA 1HB3A 2HKXA 4NPMA 3KMHA 1TNFA 2OQ7A 3WP5A 2XLAA 1S0EA 5A7NA 2PHRA 3WQBA 3TNPB 5IW0A 1ZZ9A 3AK0A 2XVLA 3SCHA 5I91A 3MV11 4I02A 3FHAA 1G9BA 2Y6GA 5FP8A 4CDUA 3KT1A 5GLTA 3W21A 1CAXB 1GQHA 4GB31 1RUF1 5FYHA 1W8WA 3ZN5A 1X8MA 3IMNA 3OUIA 4XURA 2DTYA 3FN9A 3LDRA 2OQ6A 2VNVA 3KSCA 4CVUA 3WG3A 3JQWA 1MVQA 3NAPB 4IEWA 2J1EA 2BQPA 2K46A 1H30A 2QQMA 1SQ4A 4MO3M 1KXGA 3TYJA 2DWRA 1QEXA 1XYPA 2AGSA 4L97A 2XKPA 3POGA 5FJHA 1RUG2 4HPKB 3QLQA 1C1FA 1NLRA 2WO3A 1V9U3 1WMXA 3I2KA 3HN1A 3NNFA 1UD1A 4XILA 5FK7A 2V5YA 4PT6A 3VD9A 3MV01 1XSRA 3IAQA 1X9PA 2DUPA 4GZ9A 3ZYGA 4BCUA 1W2UA 4QX7A 4MG2A 4CXYA 1O5UA 1OT5A 2VMDA 3ZKUA 3DPRA 4PDWB 3LFMA 5FLIA 3WSOA 4MXVA 4GMP3 3TOJA 2WWJA 2PHLA 3MFAA 3H9AA 3PL0A 4NHYA 4UW5A 2FDGA 5FPLA 1PGL1 4ZY9A 5DABA 1CAVA 2DCJA 1S0JA 4QPIC 5CG8A 4GB32 3ZMNA 5FZHA 4YSFA 4KWUA 1QIQA 1W6PB 1UPSA 3FFQA 5IVCA 3SC7X 3NNMA 2I74A 2XVKA 3UV9A 5DZEA 1H8VA 4G3YC 3AVRA 5FUPA 2ZGSA 4LKSA 4MXWB 1UPIA 3IMMA 3WF1A 1X36A 3ZSJA 4MGTA 1HXS1 5FZGA 4K6BA 3VBRC 4K1YA 2QE3A 2JDYA 2R32A 4TLFA 2Z4FA 3AJZA 5HI0A 1CN1A 1NXD1 4NPRA 3LSDA 2UURA 4JTOA 3OY8A 5F3GA 3FL7A 3H3LA 4O9GA 4XW3A 5F37A 3PDQA 1DQ1A 2HEWF 3KHBA 4DS0A 2YMZA 1LGCA 1W2TA 4LIUA 2DBIA 2JICA 1BLZA 1LOFC 2RS31 3O7OA 4OMCA 4BA6A 2OZJA 1RIRA 2PHTA 2VZ3A 2VUAA 4SBVA 1PGL2 3D5OA 4D7SA 4Y5TA 1C4RA 5C4WC 5L19A 3IIIA 4YW5A 1O7FA 3UK9A 2W5FA 1TVGA 2GDFA 4PQQA 4QGNA 2RMU3 4Y1YA 1ODNA 4HMZA 4P9JA 1W6OB 4JGZB 2UY9A 4RSUA 4GH4B 3M8LA 4CUAA 3ON7A 2QQOA 3WP3A 5LCWL 3KVAA 3POYA 3SCFA 4FFGA 1HXS2 4I01A 3PLQA 4LE4A 1ND3C 2VZ1A 3WW2A 3ZPYA 2FDHA 2R0HA 1F15A 2R6QA 4AYUA 1OBNA 4YVWB 4RA0A 3BIEA 1DGRA 1V6LA 3K4DA 4UF0B 4LHSA 1OLME 3UYJA 4E2GA 3KM5A 1DQ5A 2FHRA 3HQXA 1VBD1 5CIRA 5EQUA 3VBHB 5L9VA 4BIOA 2RS32 1UY0A 3EHKA 3U78A 3FC0A 1VBA2 1YLLA 4M3CF 4QB6A 2WO1A 2DCYA 2D93A 1AR61 2BFUS 5L7OC 1OA4A 1J58A 2HEVF 4UFKA 4XUQA 3RMXA 4CRQA 5KWRA 3CQOA 4D6SA 3POJA 4LLOA 4NWWA 1VMFA 4UYBA 3VBRA 3OGGA 4MHRA 4Q4V1 3VGIA 3MHZA 2CY6A 5LA9A 5J48A 1GZTA 5I0SA 2AC1A 3M7AA 3LIGA 3GCWA 1RGSA 4R4ZA 2B42B 1LESA 4GALA 4IDZA 3VBSB 4W50A 3WDUA 5LA1A 1O6UA 1WUVA 1W8UA 4TYSA 4JHTA 2FMYA 4NIIA 1LOFA 3MIFA 2E26A 3RZGA 3CJIB 1GICA 1L7LA 2QQLA 2VM9A 3AP4A 1T6BX 2F17A 4KWJA 3WV6A 1NCQB 1D2QA 1VBD2 5C4WA 4DXTA 4HFSA 3F2ZA 4AVCA 1ZZ6A 4B3NA 2ATFA 1JZ3A 3NKTA 1BVP1 5I0TA 1ZBE2 3BN6A 1J59A 1GSLA 1AR62 1YWKA 1IS6A 2BWAA 3HPNA 1JUHA 4NVPA 3B94A 2GC3A 3THTA 1Y43B 3AP9A 4FAHA 5J37A 1GP6A 1B35C 1ND3A 2MEV3 1NX9A 4MGQA 2J1VA 4Q4V2 5GLWA 5FMOL 4FOQA 1TEIA 4K8RB 4GWIA 4NROA 1F5JA 2P3YA 5LWBA 1FPN1 1GZ9A 2KM2A 3ACGA 1GZWA 1HXS3 4XBNA 2VBBA 1YQ5A 1EYBA 1G9DA 5FUNA 5BNOC 5FV3A 4CE8A 2BBAA 1OLMA 1V6JA 4H2AA 2OVUA 3PMSA 1TQ5A 2FDFA 4BXFA 5FZIA 5L7OA 1WW4A 1D7PM 4INDA 3UJOA 4ISQA 5J1XA 1QXJA 5GZEA 3W5NA 3FBYA 4XE9A 4CP2A 1VBA3 2HLEA 1XU1A 2VW0A 2ZAAA 5JPNB 4WM7B 3RI8A 3ZYRA 4YFWA 3V0AA 1UX6A 5FZCA 4AEMA 4DINB 3RYPA 4EYUA 4BQYA 5ISLA 5LBFA 4GULA 1DZTA 3P3PA 2ZX1A 1FAYA 2PN5A 4ZXKA 5ANNA 3SEPA 3H8OA 4JTNA 3QD6A 5A6ZA 2CHHA 2SLIA 4RR3C 4FOWA 3OBRA 3O1UA 1Z7S3 4EROA 4CP9A 5BNNA 3DKQA 4NN0A 3W20A 1R1ZA 3Q8AA 2BGCA 4XUTA 5FZOA 1SBFA 4Y4RA 2PA7A 3O1MA 3CMGA 4GKYA 2L9LA 1VP6A 3H8XA 1UQXA 3A7QA 2K9ZA 2NMOA 1Q8PA 3ZN4A 4JDMA 2HEYF 2GP3A 1DG6A 1QJFA 2W94A 3MUY1 4PBOA 1VBD3 1QNYA 3ZKYA 4W8JA 3EBRA 3MLKA 4ZU4A 3I3DA 4CSWA 3V0BA 1BCXA 1ZBE3 1VAKA 3AMMA 3SCGA 1KJRA 1AR63 4BMBA 3ZXAC 1XE7A 2EXKA 3WW1A 3N4MA 4YG0A 3MFCA 4FPJA 2BDRA 3WF2A 3NV1A 4QGLA 4AHXA 4AVBA 5EV7A 1CPNA 3I4IA 1DYKA 2OT7A 1N3OA 2RS51 1XNAA 2Y64A 4F83A 5BNOA 4JDNA 3B3QE 4LR4A 4UW4A 4AXOA 3TEWA 5E16A 2QQWA 4Y22A 1WW7A 3OG2A 4YFZA 1KEXA 5CYYA 1WA4A 1MS4A 1MZ6A 3MEPA 4H3WA 5F9TA 5T52A 4XAAA 1PK6C 1VR3A 5A32A 1XXNA 5A7SA 2VC9A 2CTVA 1UKGA 1PGSA 4AVTA 5LA2A 3OBTA 1Q8QA 2XWJB 3GYDA 4BQXA 4YYOA 3NV2A 2YY1A 4D7TA 2UWCA 5HBAA 3RVHA 5IT6A 2YV8A 3WF4A 4RR3A 5F5QA 4E4DX 3NJYA 5A7WB 3AMPA 4CU9A 5FYBA 4GJZA 4BK4A 1D2SA 2D98A 2RS52 5A33A 1N1VA 3ZYBA 4L2NA 2VMIA 4WZCA 1QH7A 4YW3A 1O91A 1EV11 3RZHA 1OSGA 1ZZBA 1V70A 3MBWA 3RZKA 1TME1 1VAMA 5JMCA 1COV3 4I2OA 2XBO2 4CTEA 2ADDA 1SBEA 4LHKA 3ZR5A 5GZGA 4B4RA 1FOD1 3ZYIB 1A78A 5C8WA 1H1MA 1AL23 4XUOA 2WABA 4C1XA 2IXIA 3VDBA 1R091 2EAKA 2R0FA 4ATFA 2XL9A 3OUHA 4IE7A 1AR71 4W6YA 1YXWA 1IS3A 4PI2A 1GZCA 1PZ8A 1TMF1 2WA3A 2KXLA 1HQWA 3T3YA 1LGNA 3OSDA 4HK9A 1OXCA 4AEDB 1KFXL 2Y33A 3WHTA 4ZONA 1J84A 2JG8C 2EIGA 3DKWA 5K0UC 2DBNA 1QDOA 1BEV3 2XJPA 4JGYB 4CDXB 1L7QA 1TME2 2JJ6A 2BP6A 3E6DA 4RFT0 5F5AA 4LKDA 1JZ6A 3TEXA 4AK3A 2A5ZA 3LB9A 4NE9A 3B00A 5GLUA 4CEWB 2GC2A 5GKAC 5J7MA 2V09A 3HBKA 4QX5A 4KWKA 1DZRA 2XH6A 3LQCA 1R092 1S4CA 2Y34A 4GWMA 1FT9A 2VMFA 3MIBA 4XF3A 5HXVA 5FY7A 2B39A 2YPJA 1ONAA 1AR72 1I5ZA 2VMHA 1BBT1 4N53B 3AXEA 3CIHA 3ZYPA 1TMF2 1FI2A 1W6MA 2ZEXA 3H3ZA 1JZ8A 2E7TA 1V0AA 1H1IA 3VKNA 5IAVA 1JOBA 1WLTA 2YROA 3HQUA 1A34A 4XUPA 2W47A 3VDDB 4LA2A 5CFCB 2J1TA 4IXLA 2DF7A 3DF0A 5LASA 4TTGA 5CFDC 4FPKA 5FZ1A 5BV6A 1PGW1 3ZPOA 5BNPA 2Q0AA 4JDOA 4IGQA 4C91A 3O1VA 4AQTA 2DURA 2P1BA 4ORFA 2XBO3 4CEYC 4RYDA 4UBGA 1N1YA 1YUDA 1OA2A 1RVF3 1BHGA 2WFPA 3O0XA 2BZDA 1JYWA 1D4M3 3OTFA 5J09A 1YI9A 4AGRA 4LBJA 1YIPA 4XFGA 3OYWA 1D4VB 4WVZA 4AQ6A 2OUJA 3U4XA 3ZN6B 1UCXA 2RDQA 2Z2SB 3B9IA 1FMD1 1BBT2 3AB0A 2VCCA 4H7LA 3T0BA 1C3HA 4QM8A 1NY71 1W8NA 2JG8A 5K0UA 3TNQA 3NMBA 1HB4A 1DP0A 4LBKA 2VULA 4XDQA 5HCAA 1FYUA 2XLFA 3WDTA 4B4QA 2NM1A 1U5IA 2XVGA 3R0RA 4NHMA 4RQPB 4CUCA 2XXZA 2VCBA 3HVDA 5FO9B 1ZRCA 1PNFA 1Q5OA 5A7QA 4E2QA 1PGW2 2ZABA 4AEDA 2CWMA 2A3YA 1K5MC 3J7MA 5FZMA 4HN0A 4QHBA 3BOWA 1WLDA 3I7DA 4QX0A 1MZEA 4FTBA 1UY4A 5TSWA 2JD9A 3AKPA 4YVSB 2QTWB 3T30A 1DGLA 3FWEA 3LEGA 3PUSA 2WNVC 2W95A 1R093 3DXTA 2G9ZA 4L9BA 4COUA 1ULPA 3HMYA 4Y1XA 4FI9A 3NJVA 1AR73 1FMD2 5LZ6A 2HWC3 3T08A 3VUOA 1QJU1 5CFDA 1UY1A 1CQ9A 1ZRRA 2WO2A 4RS5B 3VZOA 2JG9C 1DLLA 1LB2A 1CONA 2XJTA 1IKPA 1MACA 4CPBD 5AC91 1UMIA 3SLIA 3ETPA 3RYRA 3VN4A 3KZ4C 4CEYA 3PVEA 2O0OA 1LEDA 3EB7A 5F39A 3FHQA 3ZYFA 3TN93 1VPHA 3O5SA 3ZM8A 4YG6A 1JYCA 1SLLA 2JWPA 1HRI3 2P5BA 2RVAA 2W0XA 2YU2A 4LHLA 4U36A 4YGEA 5JIUA 5FPUA 1LAJA 2CAVA 5C6CA 3HNYM 5EIYB 1NZCA 1WCUA 4Y20A 1AX1A 3I8TA 2JB4A 3U14A 3VBFA 2LUWA 1UYPA 5JMOA 1H2NA 1LU2A 4DXSA 4LO6B 3U10A 4MGKE 1RMU1 2JDNA 5T55A 4Y5Z0 4CZSA 1JZ2A 1QWRA 3INAA 5CKNA 5EJ3A 5C9AC 1E5IA 2W1QA 4JZRA 4XCAA 5FMOS 4A3ZA 4AGGA 1QJU2 2ZMNA 4X8NA 4Y3OA 4I0BA 2DFBA 1DYOA 5CKMA 5DAQA 3BYWA 3OPTA 1RJ7A 4AE2A 5FJKA 1K5MA 4CCNA 2WNUB 3LFIA 5AC92 4E4SA 3CNAA 3AYAA 1XSQA 5LW9A 2IZWA 3RYKA 4AAPA 1GNHA 4AFAA 3EMRA 1OF4A 4QX3A 3FX3A 3SEEA 2XDVA 4CCOA 1F4HA 3H50A 3O12A 2Z69A 2WNVA 2YFUA 3JD71 2G4IA 3BODA 3VL8A 4OVEA 2JX9A 3CJXA 2KA3A 2R1DA 3DYMA 4V2WA 3VB9A 1GU3A 4BZ4A 5DPNA 3C7HA 5JIAA 2FMDA 1IPJA 1UOGA 2P34A 3E5QA 4XQ4A 1LCLA 1RMU2 3JCIA 5LY2A 4GIQA 5HV0A 4N8MA 3M3CA 3OB8A 4QU2A 2UWBA 2AREA 1G9AA 2R061 1JHNA 4E2SA 5FY0A 2FCVA 4ITCA 2JIJA 2ZAHA 1F5FA 3I3QA 5ANQA 5A6QA 2JDPA 4XTPA 4LIVA 4DUWA 5LRRA 3ZSLA 2WJSA 3POBA 5ABJC 3RS6A 3IPVA 3IAPA 2DDUA 3BPSA 1ULFA 3B69A 1YHFA 1VE0A 3VDAA 4BQ3A 1SLIA 2ORXA 5JZGA 4KH9A 3LEIA 5IAXA 3JD72 1CJDA 4LOSA 3ITQA 4QB1A 4JV4A 2QZ2A 3M4FA 1N3PA 4Z1VA 1QHDA 4X8PA 4ES9A 1LKNA 4RFRB 2Y26A 3I3BA 4QQHA 4KU8A 1DCSA 1RYYA 1AZDA 2WIIB 2XLGA 4LNVA 1VIWB 4GXLA 4LBQB 4YG3A 3KF3A 3M2MA 3I2IA 1KDKA 1GP5A 4LA3A 2VZQA 4M4PA 4CXXA 2DUOA 4M3CA 1XNTA 3OBZA 2R062 1V9U1 3VD5A 3R6SA 4Z2WA 2DVAA 1W28A 2XHKA 5FRAA 4QX8A 4YZ1A 1REDA 1UZWA 3E6CC 3ACHA 4HBNA 4KQ7A 2PHXA 2Q5TA 1QF3A 2DCKA 1W6NB 4K20A 4GMP1 4JX0A 4AG4A 4P9GA 4QPYA 2ETEA 2PTMA 3A0KA 4R8HA 4FPHA 5KHKA 4XFBA 5J36A 3D8CA 1I9RA 4QPWA 4XBLA 2ZMKA 1S0CA 1JYNA 1KD7A 3NV4A 5A3NA 1YEWA 4BHPA 1X9TA 1T2XA 2C9KA 3M70A 3S30A 3AXDA 3F95A 3K48A 1F8VA 1CAWA 4K7JA 1YFWA 3L9JT 2JKXA 2OXBA 3LDKA 4ZS3A 1GYKA 4XF4A 4XBQA 1Y9QA 4BK5A 3RNSA 2RDNA 3S5QA 2VOVA 1V9U2 4NRQA 4YZ5A 1OQDA 5LEKA 3RJRA 1G8WA 4QPIB 4ONUA 4XEZA 5I8TA 5GM0A 5H9PA 5GALA 1K12A 4R4XA 1PIV3 3ZVXA 3R05A 3ZFEB 3K75B 3T2PA 2QCSB 2VZPA 3OD0A 1RJ8A 4AI8A 2AEYA 3ZIWA 1BYHA 3LSEA 4BOWA 2B45X 3VBRB 4RGKA 1BK0A 1M4WA 2J7MA 4JC1A 3DPRC 2RMU1 5FZLA 5FPXA 3GZEA 1JBCA 2VJXA 3IIAA 4AZZA 3GBGA 1E5SA 1KFUL 3QBQA 1AL0G 2WT0A 2ZJCA 3LOBA 2YC0A 3M3OA 2Y38A 4A3XA 1A8MA 2VQAA 3RPQA 5LBEA 1DF0A 3PIJA 5T50A 4LMFA 4PHZA 4TZDA 1IPSA 3OGSA 4AI2A 4B1MA 1NA1B 1RUE1 1HV0A 2R063 1HN0A 3RWNA 5FZAA 1GQPA 3VD7A 5ERLA 5C4WB 3MZHA 4OHYA 1OVSA 2A3XA 1LGBA 3ELNA 3BPZA 3ZXFA 5FP4A 1UZ0A 1IS5A 2XOMA 3NL1A 3AYEA 3AMNA 5DUXA 1K45A 5F2SA 3CHXA 5C71A 4EN0A 3S7IA 2UYBA 2R49A 1ND3B 4X6QB 4EN8B 2WNOA 1Q8VA 1MS1A 1URXA 3B7MA 5E6HA 1JU3A 2RMU2 3FZ3A 4XACA 5KHHA 3WW4A 1GNYA 1SPPB 2EXHA 4WBBA 4I0AA 3OOXA 4XDOA 4JRAA 3WDYA 4E27A 4YGBA 2LROA 3BCWA 5A3WA 5JR7B 4H14A 1HV1A 4COWA 4QT6A 3HIFA 1C57A 4NPLA 3ZDVA 3AFKA 5CKQA 3O0WA 5IVFA 2ZGPA 1RUE2 3DN7A 2J22A 1SLAA 2WBKA 4JHZA 3VDCA 4CYDA 1AR93 1N47A 4MX3A 4OHWA 4R52A 4D94A 3MLJA 4MSVA 3FJSA 3U37A 1JTZX 4KGQA 4UFJA 3I54A 2BJSA 5FMCA 4RHV2 1U12A 4AFDA 3RG0A 3K4AA 1IGOA 2WN2A 1NE6A 5T5PA 4CDWC 1W99A 3OGRA 1LOGA 4QKBA 4Y1VA 4BB3A 2A6WA 2ZMLA 5I0UA 3O1PA 1OF3A 2IFWA 4XPVA 4XABA 4XJ9A 2BNNA 2UY8A 2VZOA 3K77A 4P02B 3OEBA 4XDPA 4S2GA 2NYYA 1WBFA 1PM4A 1XE8A 1UMHA 3UJQA 2MEV1 2YXSA 1ZZCA 2WL1A 3GJBA 3NVCA 3ZXDA 4GWNA 1SHWB 2VUJA 2VH9A 4B7EA 4C0HA 1H0BA 3WNPA 3JZVA 5HCFA 1W03A 4LJHA 1DQ4A 5FXVA 2J1SA 5DDJ3 1HKDA 2EXIA 4LBOA 1QNWA 3POIA 4YM3A 5EYXA 5FZKA 3CZUA 5FXWA 3V0BB 1B35B 1XE0A 3IT8A 4BU2A 1ASJ1 1RUH3 3KQ4B 2D3RA 1VBA1 2DYCA 4XETA 3ZXGA 3ATGA 2X5IC 4O65A 4KG0A 3U07A 4Q0VA 1H4GA 2XKOA 2IXHA 1J1LA 4Y24A 1W6QB 4XIKA 4QDQA 2VZRA 4D7YA 3GXUA 3QOPA 5BNOB 4FTEA 4P9LA 2ZTNA 2RM23 3ZDSA 4A7KA 1U0AA 3SQOA 4CDQB 2MEV2 1WD3A 5IVBA 4FPYA 2Y60A 2X09A 3UL2A 2V4VA 5ACA3 4OI4A 4QXKA 2RHPA 4IV3A 1O4TA 4XFAA 4CA9A 2KD7A 1G9FA 1Z7S1 4N9HA 4COZA 1JHJA 4F3JA 3ORJA 2JB8A 2YUEA 3M3EA 3APBA 5GZDA 5FZFA 5HCHA 1O8SA 4CCDA 5D1IA 5FWJA 1RUE3 1SBDA 3MF9A 4XIOA 2OW4A 5D21A 4CDWA 2WZR3 4G4FA 2DCTA 2VQ0A 1LULA 4QD2A 4FPLA 3O1TA 2CDOA 2WUHA 4XFIA 2E51A 3GDBA 2B9UA 4RHV3 1ASJ2 1DLCA 5JSPA 4Q0SA 1JMUB 3KCCA 4EZ4A 1ULGA 1ZBE1 4RR3B 1E57A 1ZBA2 2VPVA 2YHJA 3BGAA 2BGOA 1RL3A 2GSYA 2QFEA 1Y4WA 3USUA 1E5RA 2PMWB 1ENXA 1SACA 1VB4A 4GWJA 4TN7A 3CF6E 2VOWA 4P9IA 5A7OA 4QB2A 1YIFA 2K2SA 1BK1A 3MIHA 5FYTA 5T3NA 4BWOA 1H8TB 5K9YA 1HJGA 1MVEA 1QJX2 2EIBA 2G19A 2IVJA 2X8KA 3ETQA 2IWGB 4PLMA 4FTSA 4HANA 1Z7S2 1YQCA 3AKSA 1Y9GA 4NRPA 4EN6B 3O1SA 2BVBA 3M1HA 2V73A 3NWKA 2Y6JA 5JOXA 2WRAA 1NCRB 2WZEA 3LE0A 3QACA 2IVIB 3NNGA 2X5IA 5C70A 5BNNC 4SLIA 3DEMA 1VRH3 1QU0A 5A1AA 2BNMA 5JR2A 1OURA 1W9WA 3OEAA 3HWJA 1SDWA 2TBVA 1VBB1 1IZ3A 2WQZC 4H7MA 2BU9A 5CEHA 1UF2C 3GHMA 4BQWA 1NOVA 1QQP2 2W68A 4I30A 4N43A 4PDWC 3ILRA 1UU5A 5FY9A 2ZOEB 3U0ZA 4GKXA 1YQ6A 4DY3A 3BU7A 3VD4A 4FFFA 1MZ5A 1C1LA 2OA2A 3Q8CA 1AYM2 5JI9A 2FDKA 2WNEA 3B5LB 1RC6A 4FCAA 4N7IA 1PVC3 5FXXA 5LBCA 3VBOB 2RJKA 2W2IA 3J26N 1PK6B 3MO4A 5H9RA 5FPBA 2YBSA 2D97A 5FZDA 3O14A 1COV1 2W92A 5A7PA 2ZCWA 2GZWA 4WVMB 1VRBA 4KGGA 3O0VA 4X6RB 3WG4A 2FCUA 5FYZA 4XCBA 5FBZA 1WCQA 2DVDA 3WUCA 3R4UA 1QJZA 1AL21 2EVXA 3MW3A 1QXPA 3KCXA 1G86A 3VKFC 2CSGA 2CAUA 3I59B 1VBB2 2C1FA 5FY4A 1ASJ3 1LJ7A 5E1RA 1H6XA 1CAXA 1LHVA 4MZUA 5DAVA 1CAUA 5EHDA 3A23A 3S5AA 1OPOA 3FBMA 1ZBA3 3ZFFB 3WNNA 3BTYA 1OH4A 1ND2B
chains in the Genus database with same CATH topology
2VNGA 4Z07A 2PAKA 1LENA 1S0GA 3D6EA 2R30A 4Z82A 3VZKA 4A7ZA 2EALA 4HKWA 2LALA 4IEOA 1GFF2 5JLVA 5DXDA 1QJX3 2VOKA 1BEV1 4UW6A 1HW5A 5C8CB 4YZ2A 2H0VA 4LBNA 1COV2 3ENRA 4ATEA 3NO8A 4URTA 5FREA 5BPXA 1POV3 1WMDA 2JE7A 4AF9A 3AKRA 4YVWC 4QPGB 4PDWA 3GZTB 1AL22 2XUMA 3JBG2 3NV3A 3SH4A 2D5FA 5J96B 3VBHC 1QQP3 4YGDA 4QGMA 1W6PA 1V6MA 2PHFA 5T5JA 4CP0A 2E7AA 1T6GC 1SFYA 3V64A 1AYM3 1IPKA 4HKLA 4YNIA 4OHZA 1YFYA 2BBVA 1Z78A 2MPFA 1BEV2 1KJLA 1PO22 4XMIA 4N9IA 3VBSC 1CX4A 2XBO1 3MW4A 1RVF1 1SEFA 3HAGA 3PTYA 1D4M1 2X53S 3URFA 3TRSB 1CJPA 2NQYA 1BXHA 2GAUA 1NCQC 2O8QA 1VBB3 3WUDA 5KC5A 3H8UA 4W65A 4FPOB 1R082 2GALA 1VAVA 3V65A 5JOWA 1W6OA 3IDEA 4JGZA 4Q4X2 4RL7A 2HWE2 4GH4A 3C3VA 4LO7A 4LTAA 1WMFA 1X7NA 2VVEA 1DYPA 4YW4A 4YVWA 2BTVC 4I09A 2PLV2 1OPMA 5FLHA 4KU7A 3VHRA 3WR0A 2JDZA 2PHUA 1VJ2A 3LA2A 3ACLA 3WDVA 4HETA 3VHNA 1X33A 4RGAA 1RVF2 4XTMA 3VBHA 1PHMA 3ES4A 1D4M2 3P3NA 5BNPC 3J9SA 5KHGA 5FPZA 4PIYA 4EN9B 3JBG3 5KHJA 3ZO0B 4YM1A 4RD7A 2QNKA 5IK5A 3ASIA 2HWC1 3G7DA 4WM7C 1UL9A 4P9YA 1UMZA 1V6KA 4P9WA 2E63A 1IHMA 5JSOA 1CIWA 4ISRA 2ZGRA 3AYCA 1DDLA 3QH7A 3VBSA 4Q0QA 4C0BA 3PVBB 2WNVB 4RGGA 2NP0A 3TN91 3X29B 2A71A 1LU1A 3CJIA 1PO23 4MH0E 1HRI1 3WDXA 1NCQA 1S55A 3MW2A 2XJUA 3L2YA 4AEDC 3B9CA 3KQRA 2ZKNA 1YCIA 2JG9B 1OLRA 1IKQA 5JI7A 4HN1A 2HWD2 2ILMA 4XJZA 3SNMA 3IM0A 1R083 5CA6A 2H6BA 5L73A 2HWC2 1OLQA 4BPZA 1JW6A 3RZZA 2GNDA 1RUD3 4Q4X3 5AVAA 5JAXA 2HWE3 2ZGLA 1XYOA 3ZFGB 4PIZA 3ST7A 4M00A 4BQ1A 3BIWE 3ZXEA 3UKNA 1XNBA 2YDEA 2WT2A 2B7YA 4M0HA 4XMAA 3FMGA 2GU9A 2PLV3 4L8QA 3S7EA 3TN92 2XJRA 3NJZA 2QDNA 4YM2A 5I93A 1HRI2 5C9AB 2AYHA 5IK8A 1QOTA 1MS3A 1OI6A 4XXAA 4FPFA 5LRSA 4WM7A 2H0BA 3HD8B 4FT8A 1FXZA 4PF5A 4XFFA 2CWSA 3H3UA 4DY5A 2R041 2WFF3 1ZNPA 2ZHNA 3VBFC 4AVVA 2DCZA 4AHYA 4D69A 3PVOA 5CB7A 4BH9A 3Q9OA 1UZYA 4ASMB 4FVVA 2GN3A 5KXDA 5D8AB 4LHNA 1WMEA 1RHI3 1SLCA 1WGPA 2YZ4A 2W52A 3A4UA 1AHSA 1G7YA 2IFRA 1LODA 3WP6A 2VNOA 3M3QA 4OI2A 2VMGA 5CNAA 1S0DA 4JCKA 4OHVA 5ABJB 1DU3D 1QJY1 2HWD3 2R042 3MLLA 3ME2A 2D6PA 1C8M1 1OOPC 4HLTA 2XJQA 4LBMA 2CGOA 3KCYA 1RUNA 2ZX3A 3VBUB 3I2DA 3M3IA 4EN7B 3GBFA 3D0JA 4Y26A 5FOJB 3H1MA 5KXBA 3WQ7A 3GHNA 1UKRA 2K0GA 4IV1B 3PJYA 2IC1A 1J1TA 2UYAA 1H1AA 4AGVA 4AHWA 4IEYA 1S1AA 5KXEA 3NSTA 4FSJA 4ES8A 5JZGC 4CEWC 4PLOA 1REFA 3TAYA 1UW8A 1F9KA 1FATA 4R9DA 5DUUA 1QJY2 1X50A 3EQEA 1C8M2 2CL2A 3R4SA 4M3CE 4N53C 3CLPA 1LOAA 3AP5A 2VW1A 3WDWA 3LA3A 1PIV1 3WW3A 4FOVA 1N3QA 3LCPA 5FQ0A 1D0HA 1HQNA 4CDUB 5JOZA 1VBC1 3CU7A 2I2SA 4XXPA 1N1TA 4XJWA 1O4YA 1LECA 3AZYA 2A73B 1PNGA 4R9AA 4K1ZA 1AYN3 4K21A 3EXUA 2LM3A 4Y1ZA 4AI3A 1U5YA 5GLZA 1OOPA 2D6KA 5KC6A 3OF1A 1UAIA 2ZHKA 4K3UA 1WBLA 2R043 2GN7A 3N35A 2WWSA 3AJYA 4DOUA 1YJKA 2JXAA 2B8MA 4FXKB 2NLRA 2Z5WA 2D3SA 3DPRB 3DUIA 4EWDA 1PIV2 3LAGA 4UXAA 2RE9A 4OHXA 1QH6A 4QQ2A 5DUWA 2R073 1CAVB 1WW6A 1EPWA 1OQEA 3GNEA 4LUMA 4QQPA 4UBHA 4YGCA 1VBC2 4DQAA 1AR83 3AM2A 4CEWA 1PZ9A 4G9SB 5H9SA 4XFHA 5E8AA 4L99A 5DUVA 2UWAA 1HRV2 2ET1A 1MEC2 5H9QA 1D0GA 1Q43A 3VHOA 3J8F3 4N53A 2D44A 1AXYA 1JN2P 3H1YA 1GANA 3OY8B 1QJY3 4EV0A 5T5OA 1C8M3 1PVXA 5BYNA 1MS9A 4LLFA 1Y7BA 3ZXLA 1AR91 3CL1A 1JUIA 2A6YA 2HJIA 4OULA 2ARBA 1DQ6A 1KS4A 1Q8OA 4P9XA 4XJ8A 1HIXA 3L2HA 1H9PA 1YYNA 3WVJA 2ZHMA 1U5ZA 1KRIA 3WXPA 2RS13 1XNKA 4HKOA 3HR9A 3PNAA 5JDBA 1ZVFA 1AJKA 2D6OX 4FO9A 5K7PA 2OUHA 3MIGA 3ZN6A 4AVAA 3PHMA 3SMHA 2QQPA 4IERA 2A70A 2ZKLA 4PJYA 4XOGA 4CDWB 1S0FA 3ZYJB 5LEJA 1V00A 4YZ3A 5DDJ1 4B4PA 1AR92 4RQPA 3MIEA 1LOBA 2DVGA 4Q4Y3 1XU2A 3RJ2X 5FDBA 4C90A 1JH5A 1JXNA 3THPA 1RUH1 4H55A 4F8AA 3SH3A 1EAH3 2ARXA 2P3KA 4PQ9A 4XJAA 3HT1A 2DTWA 4PCRA 1VBC3 3WCSA 1AXKA 3POWA 4KG8A 4ASLA 4BYYA 3AKQA 4Q4W2 3HT2A 4YLZA 4YVSA 1YFXA 2GMMA 2RM21 1KITA 4Q8KA 1WCSA 1HRV3 2E9QA 1MEC3 4HT1T 2WT1A 3WQ0A 5ACA1 4IETA 2WINB 1G9CA 4GMP0 3WQ1A 4WM8C 2JKBA 1Q56A 5J98B 3CO2A 2X5IB 3VZLA 4WVVA 5DDJ2 2A75A 2I07B 2MHFA 5T5LA 5JCTA 2TNFA 2WZR1 4NHLA 3UKTA 3WCRA 4FBFA 3IN9A 2WQ4A 3WT3A 4GQ7A 3WG1A 4Q2FA 4RHV1 1RUH2 4K8FA 3EJKA 1FNYA 1RB8G 2DUQA 2ZGTA 4AEKA 1YJLA 4NHKA 2SBAA 4WVWA 3RI9A 4M0NA 4XFCA 1RUJ3 2RM22 1RUC3 3AMQA 5IUQA 2IXKA 1GZWB 5ACA2 1OQ1A 2YGMA 1ENSA 3EO6A 1DGWA 4IEPA 2DU0A 4DRRA 2ZZQA 1XQNA 2A3WA 4LE3A 3B93A 5IK7A 3AX4A 3DV8A 5L7OB 5B2GB 4O9EA 1CPMA 4IV3C 3E5UA 3H7YA 2WNUA 5DZGA 2WZR2 5BNQA 1W0OA 4LEJA 4IEZA 3H0OA 1VRH1 1XNCA 2BW8A 1CAUB 2VG9A 2VVDA 1WLWA 3V0AB 4YARA 1MQTC 1N1SA 4DPNA 2D6NA 2WS91 2MNGA 4Q4W3 4OLLA 4WM8A 1ZREA 2VVFA 3USSA 1AVBA 4L11A 3OD4A 3FUQA 3IDCB 3U11A 4XQWA 1PVC1 1WD4A 1ULCA 1VBE1 2XL7A 2C5DA 1EPZA 3KT4A 5BNNB 4XF1A 3ZSKA 2ES3A 3RRDA 1YI7A 3G6JB 1ALYA 5K8SA 4ZU5A 3PMEA 1UZZA 1APNA 4QQLA 4Z92B 2CGPA 1H2KA 1LTEA 4XHXA 2O1QA 1ULEA 2BPA2 3JB8A 4AEJA 2VECA 4KBBA 4IEVA 1VRH2 4LBLA 2QDRA 1RUF2 4YZ4A 3TBDA 4U2AA 2XWBB 1TNRA 2ZPXA 4HSLA 4I3PA 1OFSA 2DFCA 3ZFEC 4OUMA 4FOYA 1ZBA1 2WS92 1LOCA 5EXOA 1HDKA 2Z79A 3ILNA 1CD3G 5FAXA 1I1EA 4AFCA 1C5HA 4DFSA 4N43C 4AI0A 3WY6A 3POSA 1PVC2 4LBQA 1VBE2 4W6XA 4KNCA 4Y22B 1QJX1 1NQJA 3KD4A 2Q4SA 2WA4A 3C2UA 3ECQA 2E53A 1FNZA 3DL3A 1TE1B 2P3JA 5EZWA 3ZIXA 1POV1 5A32B 2GC0A 2PELA 1NE4A 4E4ZA 1NA1C 5F1RA 2OIIA 1MQTA 1W6NA 5EFUA 2WLQA 1ENQA 3A0NA 2GNMA 2GH8A 2PHWA 1OA3A 4Q8LA 2F6BA 1UU4A 3SISA 4MYEA 1QQP1 1O5LA 1LR5A 2G9GA 2ZBJA 3HBZA 1AF9A 5A33B 1GBGA 1WCDJ 1O3SA 4AQSA 2XJVA 3B01A 1AYM1 1ZM1A 1AXZA 1QKQA 1RUG3 5DG2A 5EWSA 4IEUA 4TWTA 2E7QA 2ZHLA 3LA7A 1XRUA 1QOSA 5GZFA 2OYZA 3NAPC 1LRHA 4QPIA 4S2FA 2Z42A 4HZFA 2VGDA 1OD5A 5JVVA 3ZFEA 4FPCA 4B7KA 1GQGA 4GB33 1RUF3 4XJUA 2ET7A 2P17A 1W0PA 3IBMA 1POV0 3W59A 3KGLA 3FE5A 3QH6A 3AFGA 3PVNA 2WS93 2PFWA 4AWDA 1OHFA 2JEMA 3W9AA 2A6ZA 4LBQD 3IWZA 1OKQA 2O8OA 1WW5A 2VU9A 1REEA 1VBE3 2ZX4A 1UIKA 3S0MA 3AYDA 3N36A 1NA1A 3RDIA 4OI0A 1DFQA 1A8DA 1I6XA 1CVNA 4Q1PA 1RITA 3FUOA 1J3QA 1Y3TA 3MPPG 4NR1A 4OUSA 2A6VA 2LTNA 4IESA 3VLBB 2Y0OA 1GR3A 1LOEA 4JRLA 1ULDA 3JBG1 5F6KA 1CESA 4BMEA 5KXCA 1I3HA 1YFUA 5I0RA 1M06G 1W6MB 4LO4B 2HWF1 2JE9A 3FLPA 2C9AA 4HL0A 2GMPA 3VV1A 2B46X 1S0BA 4D7TA 1EP0A 5GLVA 5SV8A 3IKWA 5I8YA 1Q8SA 2OZ6A 2PQQA 4IEQA 3NAPA 4LUKA 2DVBA 5BNPB 1SLBA 4CDQC 4YW2A 4JGZC 2YGLA 4GH4C 4HPKA 4XQDA 2GC1A 4IQPA 4MV2A 3N3HA 4UW3A 1PO21 4B29A 2RS33 3SXWA 3ZXKA 1O4ZA 2CYFA 3OYWB 4Q29A 4JQRA 2FQPA 2I45A 4BLJA 5LK5A 3NKGA 3WNXA 3VHPA 5FO7B 1RTVA 2BNOA 2OPKA 2JG8B 4Q0UA 2HWF2 5K0UB 1R081 2D5HA 2NPIA 1FPN2 2ZGQA 3WZ1A 2GMEA 1RUD1 4Q4X1 4AVSA 2HWE1 1BKZA 1F2NA 4AW7A 4MXWA 1DGWX 1X82A 2JD4A 2A6XA 3BTAA 4FP3A 2EA7A 3AZWA 5HCBA 4AEDB 1H8TC 1AUYA 1OFNA 4XF0A 4MVTA 3JQXA 2PLV1 2VY0A 4QMAA 2JENA 1RUOA 4DXZA 4QM9A 4HVRA 3ILFA 1B35A 2DU1A 4OFGA 5AFEA 1DGRN 1NG0A 4LO5B 1NCRC 1QY4A 3CJIC 1KS5A 4N90A 3VZJA 1IOAA 2BVVA 1SCSA 3RQ0A 1W6QA 2Y0IA 2WFF1 4Q4V3 1ZYBA 5CFDB 1QDCA 1MS5A 4CDQA 1YRZA 3B02A 4HK8A 1Q3EA 1RUD2 4Q27A 2WLPA 4BE3A 3VZMA 1PZ7A 2VXRA 5E88A 4CEYB 3T1MA 2C0ZA 1DHKB 4E9KA 1RHI1 3VBOC 4PIXA 5FO8B 4C1WA 2NZ9A 2F4PA 2PAMA 3KS7A 3D0SA 4Y20B 4ZKTB 2DV9A 2PHDA 3VBFB 1B09A 3JU9A 1H2MA 4S2DA 2ZZJA 2VNRA 5J3UA 2TUNA 1GV9A 1ENRA 2ZGMA 1U5XA 4PBPA 1EY2A 5KBFA 4LO8A 1UN1A 3FLTA 3ALQA 2HWD1 1CR7A 2ZGNA 2WFF2 3BALA 5JSRA 3MDPA 4A7YA 2XGXA 1QOOA 2HWF3 3LKJA 5FLJA 3VKLA 1FPN3 3ZFFC 3WLUA 1K5MB 2D7FA 1H8TA 2P37A 2ZX0A 3N7MA 5FQ0B 4DNYA 1O3TA 1ND2C 1SFNA 5FCCA 1NXMA 1NQDA 2BUKA 3N7LA 4PLNA 1FX5A 2GH2A 1BJQA 3MYXA 4LT5A 1AX2A 1RHI2 1W39A 4XF9A 3GF6A 2EF6A 3AZZA 3WP4A 1PO11 1NCRA 4XYXA 3LOIA 4I0WB 3KB5A 5CU1A 5C8CC 2XPJA 1OOPB 4JAAA 1C5IA 2W39A 4AQ2A 3H7JA 1SMVA 2D40A 1BQPA 2G9FA 4L92A 4CP1A 1LEMA 4QPGC 4J1WA 4N7UA 3AKTA 1IS4A 1XYNA 1H9WA 1MS0A 4FXGB 4WV8A 3TB0A 3MGUA 5F6LB 1QXRA 4MGIE 4YRDA 4XZPA 1EV12 3E5XA 2RR11 1X8EA 3VBOA 5JOYA 3IPVB 5A3LA 1PK6A 1MZFA 1MR5A 1S0IA 2BWCA 4NOTA 1A6CA 4S2HA 1UIJA 2D3PA 5FTTC 2Q8OA 5BY5A 3E6BA 5JZGB 1FOD2 5AVPA 4WVMA 1SCRA 2IXJA 2QZ3A 1PO12 3LWCA 3RMYA 4BM8A 1QGLA 2PYTA 3GALA 1ZRDA 3AZXA 1AX0A 1O3QA 2RJLA 4EWEA 1AYN1 4TSVA 3V56A 2Q30A 2WKKA 3I59A 3BOPA 4EWAA 3FLRA 3ES1A 3VL9A 2BYVE 4M3CB 3ZFFA 3KT7A 1DZQA 1ND2A 2RS53 4P5HA 3SH5A 5CVRA 1OMIA 2CNAA 2GNTA 5L36A 4I3GA 2E6VA 4AHZA 2CGNA 2RR12 2JECA 4WZFA 1Z0HA 5FOBB 1G6NA 1BMV1 4MUVA 4YW1A 2H6CA 5GJ6A 3MIDA 4Q26A 5C8CA 2NN8A 1YNAA 2R071 5DZFA 3BB6A 1AR81 4QPGA 5E89A 2QKDA 3T1LA 5CADA 4DB5A 1AYN2 1HQLA 2XB6C 3IDBB 1BZWA 4Q0PA 1ZX5A 4OI1A 5BUVA 4FPGA 1CAWB 1LHUA 3JUUA 3J8F1 3PJQA 5I8SA 2AR6A 2A7AA 3K51A 2IXCA 1V6NA 1R1A1 4Z8BA 2R16A 1YO8A 2FZ2A 1EV13 3H1WA 2AH2A 3VZNA 1TME3 5A3MA 5JWPA 1DIWA 1DBNA 1IQAA 1BMV2 1ZA4A 4XHBA 1DQ0A 2R072 1ZRFA 1FOD3 3LZZA 5AFBA 1AR82 1PO13 3T2TA 3R4DB 4CDXC 2WC2A 2RS11 4JGYC 4KWLA 1WLCA 5IK4A 2N7GA 2ZGKA 4HSJA 4DZGA 4GA9A 1TMF3 4KL1A 1NY72 3J8F2 1F31A 4Y4YA 5CBLA 2XJSA 1L3JA 1O3RA 1NYWA 1R1A2 2R1BA 1PMIA 2X29A 2RR13 4M01A 4OZXA 4MGZE 4COVA 3OGJA 1AJOA 3ZMOA 4FQZA 2W08A 2CV6A 2TEPA 4Q1RA 4Q4Y1 3ZFGC 4AI1A 1EAH1 3MI8A 1J3RA 3S6PA 2WSUA 2ENRA 3VDDC 5CFCC 3D4KA 1A3KA 2BFUL 4BIFA 3MICA 3AMHA 2RS12 3NW4A 4AFMA 4QQOA 1LHWA 1BBT3 3WINE 1HRV1 4HVQA 1MEC1 1GLHA 3OCPA 3SITA 3TWIA 1H4HA 1RUI1 2DVFA 5JPMB 1UU6A 2HYKA 1VB2A 3D82A 3KGZA 1V6IA 2QVSB 5CG9A 2HWB1 4ZU7A 1RINA 1ZZ8A 1LHOA 1HX6A 4B8EA 2WSVA 3W58A 2P2KA 2D43A 4IL7A 2FBEA 2Q1ZB 4Q4Y2 4JGYA 2UU8A 4CDXA 2AENA 1EAH2 2NMNA 1C28A 5LK7B 4WM8B 4RQPC 5D8AC 4YM0A 5EYYA 2YYOA 3WX5A 4BLIA 3ZXJA 4A2UA 2ZGOA 1RUJ1 1RUC1 2JG9A 1H2LA 1FMD3 2ERFA 2FZ1A 5FFOC 4V1PA 2D6LX 4D3WA 3N7JA 4HVOA 1VLNA 3MF6A 1RUI2 4YVSC 5KHIA 5DG1A 2P3IA 1R1A3 3ROUA 2HWB2 3J4UH 3ZFGA 1XNDA 2B5HA 3WG2A 2VOXA 3QCWA 1FV3A 3VDDA 4LULA 2ZX2A 4IEXA 5CFCA 1J3PA 4J6GA 1PM7A 4R9BA 4Y1UA 3VKOA 4K9SA 3VBUC 1HLCA 4FPEA 4RS5C 4JVAA 4NO4A 3DGTA 2ZS6B 4FQ4A 5C9AA 1DQ2A 3GZAA 1LHNA 4IV1C 5GZCA 4Q4W1 4MLOA 2EXJA 1RUJ2 2ZA9A 1RUC2 2WZPP 4EJRA 4IV3B 3ZSMA 2XG3A 1NLSA 4COYA 2AUYA 3GBWA 1QJU3 1JOJA 2GNBA 1JYIA 3WHUA 2D6MA 1C8NA 4P14A 3ZX7A 5C33A 5SV5A 5AC93 1MQTB 1GNZA 3AP6A 4DMIA 3KLSA 4AFBA 4R9CA 2ZACA 5D8AA 2VW2A 3LGRA 3CEWA 3N7KA 3SHRA 3WOGA 3ZSEA 5CAZA 2WNUC 3AP7A 1VALA 3USUB 4CDUC 2AZ5A 1RMU3 1S2BA 4K40A 3GZUC 2PAEA 5ABJA 3E97A 2BEOA 4FP2A 4META 1RUI3 3AZVA 5BXXA 1FV2A 1BVVA 2QUOA 3VBUA 3WD5A 1ZRCA 2HWB3 2IXLA 4RS5A 4W6WA 4F7ZA 4DRVA 4J1XA 1MS8A 1V6OA 1GKBA 3FFZA 3VKMA 2Q1MA 4IV1A 3JD73 3RSJA 4N43B 2QJVA 5T54A 1SLTA 3MPBA 1ZZ7A 3UKVA 1CGPA 4MGYE 1KQRA 1WCKA 2ZGUA 4NWVA 1S2KA 3FHIB 1KDMA 1QMJA 3JB4C 2EAAA 1RUG1 3OJBA 3OPZA 2HKXA 3KMHA 1TNFA 3WP5A 2XLAA 1S0EA 2PHRA 3TNPB 1ZZ9A 3AK0A 2XVLA 3SCHA 5I91A 4I02A 1G9BA 4CDUA 3KT1A 5GLTA 1CAXB 1GQHA 4GB31 1RUF1 3ZN5A 1X8MA 3IMNA 2DTYA 3KSCA 3WG3A 3JQWA 1MVQA 3NAPB 4IEWA 2BQPA 3TYJA 1H30A 1SQ4A 1KXGA 2DWRA 1XYPA 2AGSA 4L97A 2XKPA 1RUG2 4HPKB 3QLQA 1C1FA 1NLRA 1V9U3 4XILA 3HN1A 1UD1A 2V5YA 2DUPA 3ZYGA 4BCUA 1W2UA 1O5UA 3DPRA 4PDWB 5FLIA 4MXVA 4GMP3 3TOJA 4UW5A 2PHLA 3MFAA 3H9AA 1PGL1 1CAVA 2DCJA 1S0JA 4QPIC 5CG8A 4GB32 3ZMNA 4YSFA 1W6PB 1UPSA 3FFQA 2I74A 2XVKA 3UV9A 5DZEA 1H8VA 4G3YC 2ZGSA 4MXWB 3ZSJA 1UPIA 1X36A 1HXS1 3VBRC 4K6BA 4K1YA 2QE3A 2R32A 4TLFA 3AJZA 5HI0A 1CN1A 1NXD1 4NPRA 3LSDA 2UURA 4JTOA 3OY8A 4XW3A 4O9GA 1DQ1A 2HEWF 4DS0A 2YMZA 1LGCA 2JICA 1LOFC 2RS31 3O7OA 4BA6A 2OZJA 1RIRA 2PHTA 2VUAA 4SBVA 1PGL2 3D5OA 4D7SA 1C4RA 5C4WC 5L19A 4YW5A 1O7FA 3UK9A 2GDFA 4QGNA 2RMU3 4Y1YA 4HMZA 4P9JA 1W6OB 4JGZB 2UY9A 4RSUA 4GH4B 3M8LA 3WP3A 3POYA 3SCFA 1HXS2 4I01A 3PLQA 4LE4A 1ND3C 3WW2A 3ZPYA 2R0HA 2R6QA 4AYUA 4YVWB 4RA0A 1DGRA 1V6LA 4E2GA 3KM5A 1DQ5A 2FHRA 3HQXA 1VBD1 5CIRA 3VBHB 4BIOA 2RS32 3EHKA 3FC0A 1VBA2 1YLLA 4M3CF 2DCYA 2D93A 1AR61 2BFUS 5L7OC 1OA4A 1J58A 2HEVF 4CRQA 3RMXA 5KWRA 4LLOA 4NWWA 3VBRA 3OGGA 4Q4V1 3VGIA 5J48A 2CY6A 5I0SA 3M7AA 1RGSA 4R4ZA 2B42B 1LESA 4GALA 3VBSB 3WDUA 1WUVA 4TYSA 2FMYA 1LOFA 3MIFA 3CJIB 1GICA 3AP4A 4KWJA 3WV6A 1NCQB 1D2QA 1VBD2 5C4WA 4HFSA 4B3NA 4AVCA 1ZZ6A 2ATFA 3NKTA 1BVP1 5I0TA 1ZBE2 1J59A 1GSLA 1AR62 1YWKA 1IS6A 2BWAA 1JUHA 4NVPA 3B94A 2GC3A 3THTA 1Y43B 3AP9A 4FAHA 5J37A 1B35C 1ND3A 2MEV3 4Q4V2 5GLWA 5FMOL 4FOQA 1TEIA 1F5JA 1FPN1 1GZ9A 2KM2A 1GZWA 1HXS3 4XBNA 1EYBA 1G9DA 5BNOC 1V6JA 2OVUA 3PMSA 1TQ5A 5L7OA 1WW4A 4INDA 3UJOA 4ISQA 1QXJA 5GZEA 3FBYA 4XE9A 4CP2A 1VBA3 2VW0A 1XU1A 2ZAAA 5JPNB 4WM7B 3RI8A 3ZYRA 4YFWA 3V0AA 1UX6A 4AEMA 4DINB 3RYPA 4GULA 1DZTA 3P3PA 2ZX1A 1FAYA 2PN5A 4ZXKA 4JTNA 3QD6A 2SLIA 4RR3C 4FOWA 3OBRA 1Z7S3 4EROA 5BNNA 4NN0A 1R1ZA 2BGCA 1SBFA 2PA7A 4GKYA 1VP6A 2K9ZA 2NMOA 1Q8PA 3ZN4A 4JDMA 2HEYF 1DG6A 4PBOA 1VBD3 1QNYA 3EBRA 3MLKA 4ZU4A 3V0BA 1BCXA 1ZBE3 1VAKA 3AMMA 3SCGA 1KJRA 1AR63 4BMBA 3ZXAC 1XE7A 2EXKA 3WW1A 3N4MA 4YG0A 3MFCA 4FPJA 4AHXA 3NV1A 4QGLA 4AVBA 5EV7A 1CPNA 3I4IA 1DYKA 1N3OA 2RS51 4F83A 5BNOA 4JDNA 3B3QE 4LR4A 4UW4A 4AXOA 5E16A 4Y22A 1WW7A 4YFZA 1WA4A 1MS4A 1MZ6A 3MEPA 4H3WA 5F9TA 5T52A 1PK6C 1VR3A 5A32A 1XXNA 2CTVA 1UKGA 1PGSA 4AVTA 3OBTA 1Q8QA 2XWJB 3GYDA 4YYOA 3NV2A 2YY1A 2UWCA 5HBAA 5IT6A 2YV8A 4RR3A 5F5QA 4E4DX 3AMPA 1D2SA 2D98A 2RS52 5A33A 1N1VA 4L2NA 2VMIA 4WZCA 1QH7A 4YW3A 1O91A 1EV11 1OSGA 1ZZBA 1V70A 1TME1 1VAMA 5JMCA 1COV3 4I2OA 2XBO2 4CTEA 1SBEA 4LHKA 5GZGA 4B4RA 1FOD1 3ZYIB 1A78A 5C8WA 1H1MA 1AL23 4C1XA 2IXIA 1R091 2EAKA 2R0FA