4QQLA

Crystal structure of c1ql3 in p1 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
KIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Complement C1q-like protein 3
publication title Structures of C1q-like Proteins Reveal Unique Features among the C1q/TNF Superfamily.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qqlA00
1U5ZA 2RE9A 2RJLA 5KC5A 1D4VB 2RJKA 3V56A 1D0GA 4HT1T 1OSGA 2Q1MA 4DB5A 4QQ2A 1XU2A 4D7YA 5L19A 4QPYA 4G3YC 2Z5WA 2R32A 2HEVF 1OQEA 3B94A 3URFA 4KG8A 2JG9B 2R6QA 1C28A 2R30A 2WNVB 2WNUC 1PK6B 4TWTA 2JG9C 3ME2A 2TNFA 4MXWB 3B93A 4QQHA 1WCKA 1PK6C 2OIIA 4QQLA 2WNVA 5BNQA 4OUMA 1U5YA 1ALYA 4MXWA 2O0OA 1JH5A 2JG8C 2ZJCA 4QQOA 2AZ5A 3QBQA 4GIQA 1O91A 1C3HA 2WNUB 3TWIA 4J6GA 1D2QA 4E4SA 1DG6A 4EN0A 1KXGA 2HEYF 3LKJA 2WNUA 3B9IA 5HBAA 2QDNA 2JG9A 2TUNA 4F3JA 1S55A 2JG8B 4G4FA 1PK6A 4NN0A 4OULA 2ZPXA 5TSWA 5CIRA 1OQDA 4E4DX 2HEWF 4TSVA 4KGGA 2E7AA 2JG8A 4KGQA 2X29A 3L9JT 1TNFA 2KA3A 5L36A 4DOUA 5KC6A 3K48A 4MSVA 4QQPA 1DU3D 1U5XA 4RSUA 1GR3A 3K51A 2Q8OA 1A8MA 3IT8A 3WD5A 1I9RA 3QD6A 5KWRA 1KD7A 1TNRA 3FC0A 3TYJA 2QE3A 3MI8A 3ALQA 1JTZX 1RJ7A 1IQAA 1XU1A 1RJ8A 4MXVA 4OUSA 3AB0A 2WNVC 4N90A
chains in the Genus database with same CATH superfamily
1LOGA 1R1A2 1W05A 1WW5A 1COV1 3LEGA 2G1MA 5ANNA 5T5PA 5JVVA 2QTWB 3WDTA 3WP4A 4AGRA 3Q8BA 4MZUA 3PDQA 1ZNPA 2HWF2 2VZ1A 2A6YA 5FZ9A 5IAVA 3LWCA 5FZKA 1RUJ1 2B42B 2NPIA 5CG8A 4NHYA 2W87A 3H3LA 4I09A 5IW0A 1DZRA 4RHV2 1VRH2 1UMHA 3MIBA 4COVA 2XWJB 3PHMA 3OY8A 4NO4A 4DEQA 2BPA2 5E16A 4CEWC 4IEVA 4JTOA 1A6CA 5IWFA 4QX1A 4N7UA 2XLAA 5CFDC 4AVAA 4EWEA 5FLJA 4YW7A 3D3AA 4L9BA 1BHGA 5CVRA 5DAWA 2BV4A 3I3DA 1HQWA 1AYN2 3KCYA 4AF9A 2DURA 3GZTB 4O7XA 3S0MA 4YZ4A 4E8CA 5LEKA 2AR6A 1RUI1 4IDZA 3ZYIB 4Q8KA 3AMMA 1EPWA 2Q8CA 4CE8A 4EWDA 1FPN1 1N47A 4I0WB 1DQ5A 3QBQA 1MQTA 1RUD2 1VMHA 4XFCA 3WT3A 2ZX2A 3EBRA 1AR61 4J25A 4PDWA 4SBVA 1LU2A 5B4XA 3I2FA 1WCDJ 2ETEA 3MLLA 4N43A 2BGOA 2I07B 2L9LA 3KCXA 4NWVA 1TMF3 3TAYA 5JOZA 1D7PM 1SPPA 1GQPA 4FT8A 1S0IA 1ENXA 1GUIA 3MW2A 1W8OA 4QXHA 2YBKA 2DUQA 2OQ7A 2B5HA 5FZCA 5FLIA 1VLNA 4B4QA 1H4HA 4F3JA 5I93A 5I91A 2WT0A 1FNZA 3D82A 4MOAA 4NMIA 4V1PA 1AYM2 4LA3A 1CAUB 4QPGB 5FYCA 5F1RA 3AZZA 1A78A 4UW3A 3TEZA 1R1A3 3WNLA 3S57A 1BLZA 4QM9A 4LXLA 2VAUA 3AJZA 2ZEYA 1GZWA 3NWKA 2PHUA 5LWBA 1WBFA 3L9JT 3WUDA 3MFAA 5GALA 4CP9A 3W5MA 3HVDA 5JR2A 2W2IA 4PIZA 2Y0OA 3TEXA 1YC61 4NPMA 4CDQC 1OC1A 3J8F1 3FLPA 2PTMA 4XFGA 2VQ0A 1QNWA 2D6NA 3UKNA 4BQXA 1ASJ2 1O5LA 3MICA 4CU6A 3NV3A 2AENA 3HQUA 1PO22 4CP0A 4RSUA 3WR0A 1DIWA 1DDLA 3VD7A 4MX3A 1HIXA 2BZDA 4W50A 4Q2FA 4UW6A 2Q8OA 2XHNA 3LB9A 2YC2A 1AYN3 2GN7A 3FUOA 3HD8B 1MZ5A 4DUWA 4I0AA 3NNLA 3E6DA 4AR2A 1MZ6A 1NAEA 4KMQA 2QQMA 4LO8A 5L7OA 1QJX2 3RS6A 4M3CA 3TYJA 1O4ZA 3B69A 1GLHA 1POV1 4B7EA 1PZ9A 4XHBA 1VJ2A 1NCQA 3H1MA 4WM8A 3SISA 5JXGA 4LBQD 2E33A 5BNOA 4I02A 1EP0A 2A7AA 1S2EA 3AFKA 4Y3OA 5GLTA 2AACA 3N4MA 2PQQA 1RUF3 1XYNA 2VPVA 3NAPB 3AXEA 1EUTA 4YFWA 5FP4A 3LA3A 1UZYA 3LDKA 1YQ2A 2Q1FA 3UNPA 3PVOA 2TBVA 2HWC3 5HXVA 1DGRN 1MQTC 4UW4A 4EJRA 5BYNA 5J36A 5SV8A 4PDWC 3TRSB 2Z69A 5K7PA 4UOJA 1OVSA 5T5JA 2FQPA 4N43C 4XJZA 3ACHA 3JBG1 3HBKA 4IEPA 4YM2A 3I49A 3OJBA 1E5HA 2XBO3 3I8TA 1C8M2 2Z79A 5JMOA 5CG9A 1WBLA 5L73A 2A71A 2C6SA 3GGLA 3WP5A 1WLDA 2QQLA 2W08A 1Q56A 4K8RB 3ACIA 1V6IA 1S0GA 1Y3TA 2VW1A 3F95A 5LASA 2D43A 4LUMA 2XONA 3PL0A 2VC9A 2XL7A 5A7NA 3GJBA 3PVNA 3LCPA 4L97A 4OUEA 2IXIA 3LFIA 4V2VA 4HMZA 4XIKA 5DPNA 3CL1A 1ND3B 1F5JA 3WINE 3D8CA 2WNUB 5BNNA 1D2QA 2C24A 1U12A 4LE3A 4V2WA 5LW9A 1L3JA 3ZXAC 3UESA 1ONAA 1ZYBA 1HJGA 4NIDA 1QJX3 1KXGA 5FMOS 1UL9A 1OVPA 5GZGA 3SKVA 2WO1A 3SLIA 2HJIA 3CIHA 4PF5A 3WW1A 1RUH2 2R072 4CP2A 3B00A 2BGPA 1QJY3 4W8JA 1ND2A 3N9OA 2GC1A 4GALA 1N3OA 3B5LB 5KHKA 5LCWL 4A44A 4WVWA 5JSPA 3PURA 4OI1A 2DTYA 1H30A 4CXYA 2AEYA 3UV9A 5L7OC 4AVTA 4DPNA 2XQRA 1GQGA 1IHMA 1NCQC 1J3QA 2GNBA 4WM8C 4MGQA 1IPSA 4ISQA 1AL22 4P5HA 4M0NA 3SKJE 5A6YA 1W2OA 4NOTA 5BNOC 5I0SA 2PHWA 5JSRA 4NPLA 5JWPA 4Q4V1 1FI2A 2P3IA 5J3UA 2QQOA 1WD3A 3U75A 1JOJA 3FHIB 2F4PA 4XTPA 1W3VA 3KS7A 4EN9B 1WLCA 5KC6A 4QQPA 1EAH2 2K46A 3WDWA 1OA4A 4Y5TA 1GFF2 2JJ6A 5CKMA 4W6XA 3AYEA 5IVVA 1O4TA 4Y20A 3ZXLA 1UMZA 1PO11 1FYUA 3VGIA 1N3PA 5LATA 1ZVFA 3C7FA 2BU9A 3KQ4B 2XHKA 3MV01 2MPFA 1QJEA 1W9YA 4PHZA 3LA2A 5EJ3A 4GMP1 1AXZA 1HXS3 5BNPA 2DFBA 4DXZA 3EQEA 2CL2A 3LE0A 2VUAA 5EQUA 5CADA 1CZSA 4NVPA 2MHFA 5FFOC 3WW4A 1VBB2 2JB8A 4ZPIA 2C4XA 3RZLA 3MW4A 1KFXL 2HWB2 4OUSA 4R4XA 5FZ1A 5A33A 1RC6A 2JDAA 1DFQA 2XJRA 3BODA 5F3EA 4K7JA 3GDBA 3GCWA 4CCJA 4ZZ5A 5GLUA 2FDJA 5CEHA 3VBOA 1HB4A 1ZBE3 1RUH3 2OPWA 2R073 4QT6A 3WF3A 5LA1A 1IS6A 1MR5A 3HQRA 1O3SA 1O4YA 4AEKA 4CPBD 4ITCA 2KXLA 2RDRA 5DZFA 2WS93 5FUIA 4D7YA 5BNNC 5IVCA 2J1EA 5T50A 3SH3A 2XVLA 4QXKA 1CPNA 3GBWA 4LHLA 1IS4A 1SFNA 4CDUB 3W20A 5AVPA 4AVSA 4LTAA 4YG0A 1JYIA 1GZTA 2Q8DA 4C90A 1AL23 3GHNA 3UKTA 4QPWA 1BEV3 3HT2A 1ND2C 4B29A 3PTRB 1C5HA 1LENA 2HBTA 4CUGA 4NUBA 1G9BA 1UMIA 2W9XA 4Z1VA 2OX0A 4Z2AA 1RIRA 4S2HA 4OUMA 3T08A 2E6VA 3O7OA 1W8NA 5BUVA 2BNMA 3ZN4A 4DMIA 4EE2A 4XQWA 4XVHA 5A70A 4AQTA 3MIGA 1H8TB 4QHBA 5LBEA 1WMFA 1ZM1A 3RZZA 2W3JA 4UI9L 3WP6A 1VB4A 1HB2A 2FZ2A 1Z78A 5DABA 3ZYGA 1G9CA 3IDAA 2AGSA 2R041 5A1LA 2RDNA 2GC0A 3MPPG 4Z92B 1LGCA 3OUHA 3FLTA 4M3CF 1MZEA 5F5AA 1S2KA 4Q1RA 1TME3 1VBC3 2XJSA 2UY8A 3KSCA 4P9IA 2PHDA 1AUYA 1W9FA 2VW0A 3FL7A 4M01A 1UIJA 1ZZ7A 5A80A 1AF9A 2UY9A 1BCXA 4EN6B 2ILMA 1KDMA 4ZS3A 5ACA2 2ZCWA 2BWCA 1CR7A 1NLQA 4S2DA 4C0BA 4IEZA 5BNPC 2A3YA 4YGEA 3WF1A 2JG8A 4KGQA 3KHCA 3RZMA 1NA1B 3T0AA 2XMLA 2VZSA 4QB6A 3H8UA 4N8MA 3AYAA 3RJ2X 2OUJA 5FZOA 1H8TA 3BN6A 1JZ6A 1W6PA 1AR71 5F2SA 4BQ5A 1W2UA 5JPMB 3JD73 4AW7A 4IV1B 5DMYA 2VZTA 3VBOC 4M00A 2PMWB 2ZX1A 4LR4A 3K51A 1COV3 1OA3A 1F4HA 1UKRA 4CDWC 3WVJA 4OHXA 1W6NA 5D2AA 3FE5A 3ZR6A 3KWVA 4EWAA 2YU1A 5IJRA 1MS0A 2O14A 3I2IA 2D3PA 1J83A 5FZ4A 1X50A 2Y6JA 2W68A 2WR9A 5LA2A 1US3A 5CYYA 4DY5A 2Q8EA 1TEIA 2CDOA 3P1IA 1RJ7A 1IQAA 4GKXA 3LA7A 3M2MA 3O1RA 3VKOA 1PVC3 5BV6A 4LJHA 3ZN5A 1XNDA 2XPJA 2X5IB 2RDSA 5D21A 2B9VA 2ID4A 2KD7A 3FJSA 4MGZE 2GDFA 3VUOA 3E5QA 1J1LA 1OHFA 1U5ZA 4L11A 1RUE1 2BBVA 1R64A 2WO3A 2QQNA 4QX5A 2DBIA 2P3YA 1W8FA 5HCHA 1ZZCA 4IV1A 4H7MA 3J7HA 1LKNA 1WMEA 1AR92 5JIAA 1S0FA 3AM2A 1JI6A 3FBMA 1CPMA 4JHZA 2VVFA 4COZA 1JUHA 2E7TA 1LHWA 1OQEA 3CJXA 3AK0A 2DCZA 5GZEA 1BBT1 1NCRA 2Y64A 2AYHA 4JKKA 1PK6B 5G05L 2XJUA 4LLOA 2I45A 4QQHA 1O5UA 3KT7A 1UY2A 4QX0A 5JPNB 5M0TA 1SBDA 4S2FA 1W9TA 5E8AA 1W2NA 5A6QA 2DWRA 4X6QB 2BYVE 4PQQA 3THTA 5FXXA 5A32A 2JIJA 2ARCA 4XC9A 2X5IA 2JG8C 3POFA 5C3PA 1LHUA 3FBYA 2WQ4A 3V65A 3BIEA 4PF1A 4ZS2A 4FAHA 3I3QA 3X29B 4AVVA 4LKEA 5DDJ3 5LEJA 1GP5A 1WW4A 3IMMA 1H8TC 2LS6A 2GP5A 1D4M2 2QQKA 1VRH1 1QF3A 4J6GA 3UKVA 2J1UA 1AR82 1WD4A 3VD9A 4XFHA 1JU4A 1Q3EA 2JKBA 2YXSA 1CAVA 3OYWA 3BKZA 2MEV2 1DBNA 1HRV3 1LOAA 5GZDA 2ZTNA 3N9QA 4Z82A 1UU4A 1X8MA 2RS53 3NV4A 3DYPA 3VBFA 1AX0A 3TOJA 1R093 2VW2A 2WQZC 2WFPA 5CA6A 1W8TA 1PK6A 4FXGB 5EYXA 4PLOA 1CWPA 4YPJA 3MLJA 1VAVA 3SEPA 4YG6A 1QDCA 1JBCA 3IDCB 4DY3A 1V9U2 4Q0QA 4Q4Y2 1GYKA 1HJFA 4LKFA 4LBLA 1AR93 5KHJA 4ZONA 3RMXA 1YNAA 1AX1A 3I4IA 1SLIA 5CFCA 1H6YA 2RM22 3H1YA 2WZR2 1T6GC 3WNPA 1JMUB 4HANA 3LSDA 5KR7A 3UJOA 3WQ7A 1Q8SA 4IV1C 3E5UA 1V6KA 2DV9A 2IXJA 2R1DA 4ES8A 2QDRA 2VOKA 2IFRA 4FPFA 5FP3A 3KMHA 5T55A 3EHKA 3ZYRA 5CBLA 3C3VA 5EWSA 1ODNA 1NCRC 1V00A 1WA4A 1ULFA 2Q0AA 1OUSA 3Q8AA 3A23A 4BCUA 2ZAHA 5LBCA 1JTZX 3LEMA 1NXD1 1REFA 4XBLA 4XILA 1WWYA 1POV0 3E5XA 4AGGA 1D4M3 3DYMA 2VM9A 1FMD3 4UYBA 4RFT0 5H9SA 2D44A 1AR83 2YZ4A 4IQPA 3DECA 1R082 3ES4A 4AGVA 2NZ9A 1XNBA 2TEPA 5FWEA 1ASJ1 1TE1B 1UW8A 2X5IC 1PO21 1D4VB 2DCYA 4RR3B 3M7AA 1RGSA 3BTZA 4DB5A 5AC92 1VIWB 5A1AA 2F4LA 4WBBA 2RS32 2ZGNA 4YW6A 3DL3A 3LDBA 4WV8A 5FZLA 3B9CA 4I3PA 2YG0A 2NYYA 1PGW2 3EMRA 5F32A 4JZRA 2PQSA 3ECQA 4KWKA 4ONUA 1V6MA 4NRPA 4OLLA 1T2XA 3WEZA 1OH4A 2RDQA 3T4VA 1K12A 2RV9A 4CP1A 4IE4A 1VRBA 3N7LA 4KBZA 4TWTA 3VBFC 3I2KA 1H1MA 2VZOA 2DVBA 4Q4Y3 5EHDA 3KQRA 3TN91 2PHTA 3UJQA 3J9SA 3USSA 1PK6C 2W1SA 3O0WA 1I5ZA 4AXOA 3OD0A 1HDKA 4UT5A 4HONA 1SBEA 1UY3A 2OA2A 4GXLA 1U5YA 4TZDA 4MXWA 4W6YA 2O0OA 1VP6A 4AHYA 1V6JA 5FK8A 5IVBA 1AJOA 4FVVA 1US2A 2AZ5A 1OKQA 2D97A 4CEWB 4UF0A 2ZGKA 4L92A 1QOTA 4OZXA 5CFDB 3RI8A 5FP9A 1XSRA 4GD4A 1QKQA 3HNYM 1J58A 4E4HA 4FPJA 5CFCC 1G8WA 4BMEA 5EIYB 1UX7A 2HBUA 2R062 3ETQA 3VDBA 2HWE2 3D0SA 3OUIA 3IWZA 1OBNA 4FPOB 5SV5A 5BY5A 3P6BA 4AK3A 4QGLA 4XXPA 4LO5B 4LBQB 1S4CA 4JHTA 4ATEA 2UWCA 2VMFA 4FPHA 5DUWA 5DAPA 3I2HA 2QZ2A 3ROUA 4YW2A 3AVRA 1R083 1YYNA 2E9QA 3WW2A 3CZJA 4FOWA 1J59A 4W65A 4TXWA 3A7QA 3R4DB 2EVXA 4UBHA 1UKGA 3U78A 4WZCA 2DCKA 4DXRA 3BPZA 1S2BA 4NHKA 2ZGMA 4LOTA 1HKDA 3HIFA 2XKOA 3IM0A 3O5SA 5AVAA 5F5IA 2I2SA 1QXRA 4Q8LA 2BP6A 1XE8A 4OI2A 5LK7B 3O1OA 3WDUA 2YV8A 1HN1A 2W39A 1G7YA 5IUQA 4NE9A 4RFRB 3T2OA 2AUYA 4MGSA 4AWDA 4DS0A 1C57A 3POIA 1L7LA 4H7LA 2P34A 2YMZA 2BJSA 4HKWA 4KQ7A 3S7IA 4BQ2A 4XJ8A 4YSFA 1DYPA 3SXWA 1KD7A 1ULDA 4BA6A 1ACCA 3EJKA 3AMPA 4PLNA 4A41A 2YB7A 1A34A 4CDQB 2P37A 4CUCA 1YJLA 5KXBA 4OQ9A 5C3OA 2HYXA 3AKQA 2GU9A 4GMP0 3ZMOA 5IFPA 1YJKA 1MZFA 3ZN6A 4CDXA 1XYOA 2EAKA 4C1WA 1CIYA 1J3PA 1EV13 4FQZA 2B4KA 2JDUA 2W5FA 3UL2A 1RUG1 2RMU1 1MEC3 3AZVA 3BOWA 4MO3M 3VZOA 1DZQA 4XUNA 3LEIA 3AYCA 4GWIA 2CY6A 3OY8B 1MS5A 3U10A 4UFLA 4XFAA 4A3ZA 2D6LX 2VU9A 4HPKA 1H2KA 2D6OX 4G9SB 5F3GA 3AKRA 1TMF2 3I2GA 1B09A 2RJ2A 3E1F1 2OVUA 4Y1UA 3S30A 2R30A 1QQP2 3J26N 4GJZA 3O1SA 2ZGOA 3H7YA 1OI6A 1EPZA 4JKMA 3ILFA 1AXKA 4K1ZA 5EYYA 4I3GA 1VBB1 3NVCA 1SLCA 1QMJA 1DLLA 1WCKA 1WLTA 2HWB1 1E5RA 1PIV2 2J1VA 1IKQA 4N7IA 5C3RA 2IWGB 5B2GB 2WNVA 2BFUL 5K9YA 1MQTB 2VD7A 4YNIA 1W2TA 3PUQA 2VXJA 2WZ8A 4PDWB 3RVHA 3U14A 3WNMA 4HXCA 1K45A 1PHMA 1REDA 4XF1A 4BWOA 4AHZA 3RYPA 2ZXQA 4N43B 1QJU1 4CCOA 1QDOA 1SPPB 2RG4A 1W9WA 3N36A 1JYVA 4NIGA 4Y4RA 5DUUA 5FMBA 1VBD1 1LR5A 2ZX3A 4UFIA 4B8EA 1VALA 1LAJA 2JB4A 1C4RA 3NW4A 4CA9A 4LORA 4CU9A 3ZVXA 1VBE1 3KHBA 3MIHA 4Q0SA 1GZ9A 5IVJA 4JDMA 4AEJA 1HRI1 5LK5A 4K3UA 1QH7A 2PLV1 4XUTA 2J1AA 1GZWB 3T2QA 4CP9B 3BU7A 4MADA 1DF0A 2A5ZA 4F8AA 1LRHA 1ZBA1 2C9AA 2GALA 2XDVA 1REEA 2BNOA 4O9EA 2FHRA 2RR12 4FI9A 4ZY9A 2DUOA 5JSOA 1RTVA 3OGGA 1JZ7A 5FBZA 2CSGA 2WFF2 4OI4A 1JYXA 3HN3A 1M06G 1JW6A 5H9RA 3DGTA 4CDXC 2Q4SA 4KBBA 1RUF2 3KGZA 3FN9A 5JXIA 2W95A 3RZGA 4RL7A 4BK5A 4NPRA 4NAMA 1QQP3 1IG0A 4Y22A 2HWC2 3IPVA 5A6XA 2FCVA 4A3XA 5L7OB 3HN1A 4RD7A 4M3CB 2B39A 1RUE3 4BOWA 3PU3A 3H8XA 5GJ6A 4K1YA 1LESA 1NCQB 4WM8B 4XBNA 3RPQA 3VHNA 1OPMA 1PIV3 4XF0A 5BNOB 5KXEA 1X8EA 2O8QA 3C7HA 1E5IA 1Q8PA 5ACA1 4A6OA 4LULA 2XBO2 4AFAA 3ELNA 1G6NA 5I0RA 3PJYA 3MIDA 4K21A 2LM3A 4BLJA 3I2JA 4QDQA 1DQ6A 3B7MA 3ZSMA 4BM8A 4XPVA 5C9AA 3N9MA 4BK4A 5IK8A 2D3RA 2ARAA 2WNVC 4YARA 3CJIA 2C9KA 3UGGA 3RJRA 4QKFA 1LB2A 5FZ7A 1ZZ8A 1GICA 4CPBA 1SCSA 4O65A 2CV6A 5L9BA 4XUPA 4NIAA 4YVSA 4IXLA 1GP4A 1XU2A 3D0JA 5E6HA 2VUCA 4DXSA 1CZTA 3BU0A 1RUC2 2QJVA 4GB32 4AYUA 2RR13 2D40A 1CZVA 3WF0A 1W39A 4I01A 1CAWA 1SMVA 1Y7BA 3AC0A 3JB4C 3THPA 1QJY2 2WFF3 1Y9QA 1CN1A 2TNFA 2W46A 4ZKTB 2BBAA 5GZFA 1DQ4A 2WYSA 4P9XA 4ASMB 3PUIA 2GMMA 4AI1A 3ZYHA 2ZABA 4AFBA 2CGPA 3IKWA 5BNNB 4AFMA 2WA4A 1W6OA 1C1FA 3GJAA 4HFSA 4YZ2A 4QPIA 4YZ5A 4AHWA 3E97A 3KV6A 1JZ5A 1NG0A 4XDQA 4OZOA 2ZBJA 3MFCA 1OOPA 1SCRA 2JDZA 3RG0A 2PYTA 1NLSA 1ND2B 1YFWA 3KZ4C 1LOFA 3HEIA 2ZHMA 2MNGA 1HB3A 2FDKA 4XJWA 2JEMA 4QX3A 3J7LA 2GMEA 1SQ4A 4XW3A 3FUQA 2D6PA 4Q4W3 4IL7A 1ENRA 2WIIB 3LOBA 3RZHA 1L7RA 3M4FA 1VMJA 2YPJA 1QXPA 1RYYA 1BYHA 4G4FA 5LY2A 2Q30A 3GZEA 5A3NA 4PBPA 3AP6A 4O9GA 3P5BA 4Y24A 1HXS2 4D7TA 1SLAA 4LIUA 2BUKA 1DP0A 1WKYA 1O3RA 1UYXA 3PNAA 4UWDA 2W1UA 3RYKA 4FOVA 5FPXA 4LIVA 4DO0A 1IS3A 2XL9A 4CXXA 4X6RB 5FUNA 3WXPA 5C9AC 2Y60A 4TN7A 5KBFA 1SEFA 4XUQA 5FZ0A 5DG2A 1UX6A 1ULCA 3H1WA 3OUJA 4Y20B 1PMIA 1RUC3 3CJIC 4GB33 3I3MA 4A6SA 3ZOIA 4FPCA 2VBPA 1ZBE2 5A7WA 2OQ6A 1NOVA 4HG6B 3BTYA 4DZGA 1GANA 4P9LA 5BXXA 4TLGA 1VBA3 3KV9A 4F83A 1UOFA 4JVAA 1Z7S2 2WS92 4IEOA 4YVSC 5BNPB 1FOD3 2DFCA 3CHXA 3D6EA 3QH6A 3VDDA 3ZO0B 1X9PA 2E7QA 1V6NA 2IXLA 5BPXA 5EV7A 1MS3A 1OLQA 1JXNA 5J98B 5A33B 1BEV2 2RHPA 3MI8A 1V9U1 4LT5A 5I8YA 3HR9A 5KHHA 4IERA 1KEXA 3VBOB 2UYAA 3R6SA 3ITQA 1NT0A 5F9TA 3AB0A 3N7MA 3THCA 4QDRA 1H2NA 2RM21 3PIJA 2WZR1 2AH2A 1OF4A 1WUVA 2RE9A 1XYPA 4ZU5A 1D2SA 2ZGUA 1YO8A 2NN8A 4LO4B 3LFMA 3ORJA 4IV3A 1B35A 1GWLA 4BXSV 4IEUA 5EP9A 4QPIC 5FV3A 3V56A 2A6ZA 2YUEA 3ETPA 3GALA 3ILNA 3RFRA 3Q8EA 4ZXKA 3C7OA 4M4PA 1OOPC 3A0KA 1PGL2 1V0AA 1RMU3 3INAA 4G3YC 1QOOA 3ZXDA 3OG2A 1LOFC 3NSTA 1KFUL 4L2NA 4CDWB 2HWD1 4KI5M 1CJDA 1TME2 1VBC2 4LBOA 5DUVA 1DQ1A 5KHGA 3TEYA 1ZZ9A 3N9LA 5DUXA 2QQPA 1JOBA 5FIXA 5FKCA 1W8ZA 3ZPYA 2OW4A 3AZWA 1KGYA 5LA9A 1SDWA 2V5YA 4HSJA 3POBA 4XUOA 1ZRCA 1YQ5A 1RVF1 2FD8A 1QNYA 4A45A 3MHZA 2WKKA 5CNAA 3AMQA 1HQLA 3U0ZA 1UPIA 5JR7B 5DAXA 3BIWE 1BK0A 1S0EA 3QLQA 3TNQA 5F2WA 4HN0A 1WLWA 1CQ9A 1WW7A 1Z7S3 1VR3A 2RS31 2IC1A 2VTXA 2WL1A 3CO2A 4GWJA 4XJAA 5FZMA 3KVBA 3WDXA 3JD72 1PGW1 4GULA 2FZ1A 4QWNA 4XMIA 1OURA 1AX2A 2RS13 2HEYF 1JOPA 1OQ1A 2ZEXA 2VOVA 2BGCA 3QCWA 1COV2 2D3SA 2VCAA 3KV5A 4BE3A 4BYYA 4CDWA 3NNGA 3ZFFB 2XG3A 4B1MA 1UYZA 3WHTA 2JG8B 4D94A 4HBNA 1NY72 3DUIA 4XF4A 3LPFA 2VZRA 3T0BA 3VDDC 4OULA 4DRRA 4X8NA 2E32A 1HN0A 4I30A 1RUJ2 4XYXA 5CIRA 4CSWA 1ZRFA 3VKFC 1WGPA 4IW3A 4LBKA 2XJPA 4KGGA 3MBWA 5FZOB 2Y34A 1F2NA 1W6PB 1IOAA 2GN3A 2ZHNA 4Q5OA 4UFKA 5J48A 2OZ6A 2PA7A 2PAKA 2EIEA 1PVC2 2QCSB 4UFHA 5K0UA 4AEMA 4CEYA 5D8AB 2PXJA 3N35A 2YC0A 1UY4A 1LOBA 1NLRA 3PVEA 2PHFA 4E2SA 2K2SA 3SMHA 4Q4X3 2GZWA 1V6OA 2WNOA 4UXAA 2R061 3EXUA 4EQVA 1H4GA 1ST8A 2VMEA 1S0DA 2HWE1 1W6NB 1F4AA 1RUI2 4IV3C 1B35C 1QJFA 3SCGA 4P9WA 4AI3A 5FJKA 2H6CA 3OBRA 2PHRA 1K5MA 2RMU3 1GKBA 3DN7A 3SQOA 5FYHA 3WD5A 1C5IA 3WY6A 2CDPA 4R8HA 5IK4A 2V09A 2XB6C 3T2TA 4NIHA 1RITA 2B45X 4OHWA 4PBOA 1AR62 3FLRA 1RL3A 1VAMA 3ZFFA 2G9FA 1TNRA 3FC0A 5A7SA 1JYWA 2CYFA 4K6BA 4XF9A 3DXTA 4P9JA 1RHI1 1LOEA 3L2HA 5IK5A 3H0OA 4WVZA 5A7QA 2XUMA 1JODA 2RVAA 4LHKA 3W5NA 3OD4A 4HSLA 3GHMA 1K42A 3AXDA 1OFSA 3NMBA 4A7YA 2GNDA 5C8CB 5D8AA 3NRUA 3ZIWA 4ARXA 5C8WA 2A3WA 2QUOA 4KG0A 4QB2A 4WM7A 3UK9A 1FATA 2RJKA 2W0XA 5C71A 1QJZA 3VHPA 4XZUG 5DDJ2 2VTFA 2C0ZA 3LDRA 1ZA4A 1NCRB 1JN2P 1MS4A 4OCTA 1ULGA 2BQPA 5L19A 4FFIA 1JYNA 2R32A 2XLGA 5C33A 1RUJ3 1YWKA 4Y1YA 3B94A 3URFA 1HRV2 4CCKA 1C28A 1KQRA 2J7MA 2IZWA 2RS52 2VBBA 5ABJA 2A3XA 3P3NA 4BJ0A 2ZGPA 1W6QA 1Y4WA 1UY0A 2DVAA 3FFQA 3S7EA 3AL6A 1R092 3VD5A 5A32B 4LLFA 3T1MA 4Y4YA 4IETA 5C5TA 2FDFA 3QOPA 3WOGA 2Q1ZB 4C91A 2VZ3A 2WNEA 1IPKA 1HRI3 2GH2A 4PI0A 1QU0A 2PLV3 1ALYA 3O1MA 4DFSA 3T2PA 5JOWA 4YZ1A 5I8TA 3HMYA 1OLME 4GA9A 1JHJA 3GZAA 1RUI3 1ZBA3 2ORXA 5C8CA 2ZACA 2BNNA 4CEYC 4EZHA 5K0UC 1WCUA 2X05A 1CAVB 3OYWB 3RRDA 1FPN3 2CWSA 2ENRA 1FV3A 3IAQA 4W4ZA 3OPTA 2GH8A 3MIEA 2FDHA 3JUUA 1O59A 4LEJA 2WLPA 2SBAA 4XCBA 1NE6A 3V64A 3VBFB 1AR63 2UYBA 1SACA 3T1LA 2VMHA 4C1XA 3KB5A 3GZUC 2WDBA 1S1AA 3GCXA 4LE4A 1DGWX 4JRLA 1Q43A 3B9IA 2WUHA 3ACGA 3JZVA 1K5MC 3WZ1A 1X7NA 2YHJA 3VKNA 2E26A 2ET1A 2VZUA 1LNSA 3JQXA 1S55A 3I59A 5F6LB 1A3KA 1JUIA 4KWJA 4E4ZA 3V0AB 1R1A1 2EAAA 1N1YA 4MUVA 1YRZA 2QZ3A 5FO9B 1OQDA 3FZ3A 1FXZA 3ZFFC 3N9NA 1LHVA 1SLBA 2HWF1 3NNJA 3U1XA 5A6ZA 2E7AA 2OXBA 1HW5A 2D98A 4ASKA 2VOWA 4XEZA 1A8DA 5C6CA 4Q0PA 4XBQA 5CFCB 5HXMA 2D93A 3MLKA 4RHV1 1XE7A 2XWBB 4Y5SA 1FMD2 3J7MA 2ZEWA 4CTEA 2YC4A 4ZZ8A 3WV6A 1U5IA 2C5DA 2VCBA 2VOTA 2X10A 5D8AC 3J8F3 5HCAA 4BPZA 4MSVA 3W9AA 3VBSA 4WM7C 1NKGA 1ULPA 3AYDA 4YYOA 3V0BA 2WO7A 3KCCA 1GR3A 1AYN1 5I8SA 4IGPA 4SLIA 3WCRA 4DQAA 2Y26A 4YFZA 1GNYA 1KS4A 2WINB 3WP3A 1UD1A 3KGLA 5A3WA 4IE5A 1LOCA 2Y6FA 3LIGA 4B1LA 3DKQA 2YBPA 1J3RA 1NXMA 3V0AA 1CAXB 5ABJC 1RUD1 4XDPA 1X33A 3LEKA 1POV3 2Z2SB 1DGRA 4GKYA 3W59A 1JYCA 4MXVA 1H1AA 2DVDA 4R9AA 2LUWA 3HPNA 5FZGA 3ZXKA 4COWA 5KXCA 3ON7A 3VD4A 1LEDA 4AI2A 2G4IA 5APAA 3ATGA 3PMSA 4KNCA 2HWC1 5C3QA 2WT2A 1SLTA 5C8CC 3JXSA 2P2KA 1P8JA 4IGOA 1WMDA 1X36A 3ABZA 5CAZA 2E63A 5FAXA 1AYM1 1QH6A 2UURA 1AZDA 2EIGA 2V5DA 4IE7A 3WNOA 3I3BA 3N7KA 4P5YA 5FYUA 3ZSLA 4E2QA 2OUHA 2Z5WA 1MVQA 2NM1A 5FDBA 5KHIA 3MYXA 5C7GA 4FPEA 1C8NA 3JBG3 4H2AA 3MF6A 5FO7B 4BQYA 1E57A 2VOXA 2CAVA 3U11A 1PM4A 4MLOA 3JCIA 4MXWB 5FZAA 3WHUA 1W03A 2ZOEB 3MGUA 3FWEA 1LEMA 1CAXA 4LKDA 5JI7A 3O1PA 4H55A 1GOHA 2J42A 2D5FA 1YFUA 2GNMA 1NZCA 4UF0B 1OFNA 3Q9OA 5LBFA 5IHRA 2WJSA 3EYPA 2PELA 1PX3A 3CU7A 4BZ4A 3OB8A 2VXRA 5FZIA 3JQWA 5EXOA 3NJZA 4QQOA 1ZRIA 3RSJA 1UIKA 2EA7A 2VUJA 1GNHA 5C4WA 1HQNA 3WCSA 1XE0A 2EALA 1QJX1 2J22A 2DYCA 2JDNA 2ZEZA 4Y5Z0 5FQ0A 1DYOA 1LECA 1MS8A 3OSDA 4YGDA 3OF1A 1RXGA 2G9GA 3VBSC 1UZZA 4N53A 4J1WA 3HNBM 4HK8A 2BDRA 3ZYBA 4AHXA 2WN2A 3PU8A 5FY5A 2WZPP 2TUNA 3IDBB 4WVMA 3VBRA 2E53A 2H0BA 4WZFA 1EY2A 1H2LA 1RUOA 2V73A 1YFXA 2E31A 4TLFA 3KF5A 5L9RA 3ZPOA 2X8KA 4K20A 4XFFA 4FFHA 4NHMA 2AREA 4PIYA 5FMDA 4CVUA 2QQJA 4XZPA 4RGGA 3DV8A 3WLUA 1OD5A 4Q4V3 4BIOA 3PVBB 1EV12 4OHVA 4PLMA 1UY1A 5FZ8A 1SFPA 2R0HA 1MEC2 3OBAA 4JQRA 4QKNA 5JIUA 1C8M1 4BLIA 1BMV2 2DCTA 5JZGA 2H0VA 1YCIA 2B9UA 5FCCA 3CBNA 1DCSA 2Z4FA 1PM7A 2JX9A 1LJ7A 1S0CA 1AXYA 3IT8A 1I9RA 1PO13 3OBTA 1UO9A 1HB1A 1KRIA 2YBSA 2R042 2ZX0A 3H50A 3ZN6B 4CDXB 3MIFA 5FZ6A 2Y0IA 2Y6GA 4P9GA 3BOPA 4GMP3 2YFUA 1IQDC 3BPSA 2NP0A 4BXFA 1IG3A 2A6VA 2XGXA 2HWD3 3KLSA 2Y6KA 2NMOA 2K0GA 4FOYA 1RJ8A 1YIPA 2A6WA 1EYBA 3LPGA 1Q8QA 3APBA 3DYOA 4R52A 2VMCA 1SFYA 2G19A 4Y26A 5FMCA 5KXDA 4JCKA 1NYWA 3ZLIA 1XNKA 1DQ0A 5A3MA 1RUH1 2R071 1RUNA 4HPKB 3BGAA 4Q0UA 5KC5A 5C3SA 3D5OA 3HOBA 1G9DA 2HKXA 2IXKA 2IUWA 2DVGA 3E6BA 4L8QA 4HT1T 1BQPA 1W6MB 2CNAA 1MS1A 1ENSA 2Q1MA 3O0VA 1LODA 2R49A 4HOOA 4INDA 5FPAA 4D6RA 5C4WC 4IGQA 2ZKLA 4JRAA 2ZGRA 1SBFA 4D8MA 3A21A 4YG3A 4ZXEA 1W90A 1AL21 3ZIXA 1M4WA 3JB8A 4BQWA 1AR72 1Y9GA 3AFGA 1N3QA 4FBFA 4N53C 3S5AA 2WNVB 1PVXA 4AQ2A 1UOJA 2GP3A 1XOYA 1UF2C 2VNRA 4LQRA 4HVOA 5F5CA 5FYYA 2QKDA 3WNKA 1HV0A 3VBRC 3O1TA 3OGRA 3O12A 5A3TA 2DVFA 1YIFA 2JE9A 2OIIA 4FQ4A 5I0TA 3T4HB 3ZXJA 4BQ4A 1EAH1 2V4AA 5FY4A 1F31A 3RDIA 1R1ZA 4OMCA 4DEVA 1NQJA 2XKPA 4LBJA 2VCCA 1SG3A 2JWPA 2BEOA 1UOGA 2VNGA 3DPRA 5DZGA 2FDGA 2JIGA 4GJYA 4FOQA 4A7KA 2ARBA 3WG3A 1JS9A 2VMIA 2XH6A 4XCAA 1BVVA 4GIQA 1MPXA 2YGLA 3CF6E 3ES1A 1PGL1 1LULA 3LQCA 5E88A 4ET7A 4P02B 5DXDA 2EXJA 2WAAA 2ZMKA 4DUXA 1W6MA 1KS5A 5JMCA 5T52A 3VD3A 1VBC1 2R043 4L99A 5CKNA 3O1UA 2W92A 4BHPA 2YPDA 5JZGC 3UYJA 1RUE2 3C7GA 1W04A 3FHQA 1Z0HA 4UBGA 5F3IA 2JDMA 2WC2A 3POSA 3IB3A 2A6XA 4YGBA 3ZDVA 3NL1A 3K3NA 2VVEA 3MEPA 4CZSA 1JZ8A 2FMYA 4RA0A 4YW4A 3AMNA 4LKSA 3T09A 2ES3A 2H6BA 3OTFA 5J1XA 3RI9A 2JECA 4HK9A 3VBHA 2WYFA 2A75A 4JGZA 5A7OA 2NQYA 5FPBA 5C70A 2J1TA 4Y22B 4IESA 5FXVA 3IPVB 2D5HA 4IEXA 1XJAA 3AP5A 4XJ9A 4DOUA 4GH4A 3HWJA 1LGBA 3FX3A 5GLWA 3G7DA 3WG1A 1AR73 4AVCA 1OT5A 3MUZ1 5F6KA 3ZXEA 5J7MA 5JUVA 3OGJA 1RB8G 3ZKYA 1W3XA 2BTVC 2W47A 4XFBA 3MUY1 3K2OA 2ZX4A 3FFZA 3VL9A 2UU8A 3WG2A 5A1FA 1NY71 5JXJA 3N9PA 1XNCA 3QD6A 3GYDA 2JE7A 2EIDA 5FYIA 1W99A 1NZIA 3WX5A 2OZJA 2WQ8A 5C9AB 3O0XA 4ZHNA 3WUCA 3PUHA 3KD4A 2GC3A 4QX2A 1HLCA 3IAPA 3CJIB 1UXZA 1PVC1 3K4DA 1LHOA 4M4RA 4DXTA 2IXHA 4P14A 1SHWB 5HCFA 2GNTA 1O3TA 3VN4A 3USUB 4AAPA 2NMNA 3HJRA 1JHNA 3ZSKA 2JENA 5FPVA 4HZFA 5JCTA 4K40A 4FTEA 3B01A 2JXAA 5H9QA 4N9IA 1CJPA 1LTEA 4YVSB 2BOJA 2RJLA 1GMMA 1NE4A 1QIQA 3DPRC 3DKWA 3GM8A 1UNBA 3OPWA 1S0JA 4KH9A 1DYKA 4WVVA 3GNEA 5FRAA 2ZHKA 3PLQA 2D6KA 2VZQA 1ZZBA 2ZZJA 1CAWB 1SZBA 4MGYE 1MS9A 1UXXX 4QQ2A 5F39A 2O8OA 2CU5A 3LF7A 3R4SA 4QPYA 4YW1A 1D0HA 2GAUA 1ULEA 1IS5A 1I3HA 2ZMLA 3POGA 3A22A 3ZM8A 5FR3A 3KF3A 3PMEA 3ZFGB 4Q4W2 3WW3A 2YU2A 4OHYA 1BBT3 2IVIB 3ME2A 4Z07A 3S6PA 1W6OB 1CIWA 2DU1A 4QXBA 1MVEA 3IIIA 1O6UA 4QPIB 2BVVA 4EN8B 1POQA 2EF6A 1ZX5A 2VGDA 3WF2A 5GM0A 3ZFEB 5H9PA 3USUA 4AZZA 1XSQA 4BQ1A 5FPUA 4ISRA 3VKMA 1OOPB 4NWWA 3VBHC 5FMOL 3AL5A 2XXZA 4JGZC 5DDJ1 5GKAC 3SITA 4KU8A 3K4ZA 4NR1A 3KV4A 2HWF3 4QD2A 2BFUS 1C3HA 4QGNA 4QDSA 3WG4A 4BMBA 5F7UA 5JLVA 4QX7A 1DG6A 2B46X 4CUAA 4EZ4A 4GH4C 3VZLA 5IFTA 1HRV1 1F5FA 1VRH3 4RHV3 3SC7X 4D7SA 3LKJA 3FHAA 2RS51 5FYVA 4A42A 4EYUA 1VBA2 5FY7A 3SEEA 4A7ZA 4LNVA 1R091 1S0BA 2X09A 4EROA 5FOJB 3I97A 2XVKA 1FOD2 1C1LA 3LD8A 3K3OA 2XJVA 4PI2A 3ZFGA 3MF9A 3ZSJA 4AAXA 5FZ3A 1GOFA 2HLEA 1J1TA 5FY9A 1NX9A 3NKTA 2G9ZA 1CONA 2YY1A 4OI0A 2O1QA 4KWUA 4RQPB 1PMHX 2IFWA 3AMHA 2VNOA 2W91A 3RMYA 1SLLA 2DF7A 2QQWA 3GXUA 3KM5A 1AR91 4MHRA 2AEZA 4NRQA 5EPAA 1CAUA 3MDPA 1YUDA 4QPGA 4YW3A 3ZFEA 4AVBA 3AZXA 5A7WB 3NO8A 4D6QA 5IK7A 1RUD3 3AKSA 3I2DA 4BB3A 3S5QA 5FZDA 2FMDA 3TN92 3JU9A 1CD3G 1DQ2A 1H2MA 2P4EA 3K75B 2W52A 2BWAA 3DCQA 2UWBA 4XHXA 3O1VA 1DU3D 1XPWA 3VDDB 4TTGA 2VNVA 3ZX7A 1IPJA 4KU7A 1GWMA 2VQAA 2XUEA 3H9AA 1UU6A 3AZYA 1RMU2 3U37A 4HVQA 2D6MA 3H8RA 4YWAA 4H14A 1AYM3 2FCUA 4JKLA 5FYMA 2KM2A 4CCCA 4N9HA 4MHUA 4IEYA 2C26A 3ALQA 2VR4A 2EXIA 2Y38A 1D4M1 2A73B 1FMD1 1VAKA 2P6HA 3M3QA 4PIXA 1AR81 1QEXA 2VJXA 3Q8CA 2P3JA 4K9SA 4IV3B 4YVWB 1B35B 1WCSA 5CB7A 5JI9A 1RXFA 4M3CE 3R05A 1PNGA 1UAIA 2MEV1 3RWKX 5KWRA 1TG7A 3POYA 5FY0A 5LRSA 3RQ0A 2OKXA 3AJYA 4HLTA 1ASJ3 4JDNA 3ILRA 1TVGA 2EXHA 5I0UA 2VO5A 1F15A 1D0GA 1OUXA 1PO23 4DRVA 4Z2WA 4HETA 3IBMA 3NAPA 5FK7A 2J1RA 1W2AX 2WWJA 4LBMA 3WDYA 1F8VA 1G9FA 1N1SA 2WWUA 2VL4A 3POEA 2ORZA 3W21A 4AFCA 4FSJA 2RS12 3C2UA 5FKBA 5CU1A 3AKTA 5J96B 1W28A 3SCFA 5F37A 1KDKA 4Q4Y1 4U2AA 1IZ3A 2BRTA 4NAOA 5K8SA 2X53S 3GBGA 4ZU4A 2PAEA 5HPOA 1W8HA 1YHFA 2W94A 2QFEA 1QY4A 3BALA 3ZFGC 3ZXFA 3DXUA 3AVSA 4QQLA 3K77A 5CZKA 3UGHA 4XACA 1WA6X 2YROA 4PT6A 3TN93 4CYDA 5LY1A 3ZSEA 1QXJA 2VMGA 2JDKA 5E1RA 4LA2A 2VUDA 3T0DA 4YVWA 4AE2A 3NNMA 3LIHA 4AQ6A 2XJTA 5JOYA 3VLBB 2WAOA 4LK6A 2EXKA 3LOIA 4URAA 2ZJCA 5CISA 4LMFA 1Y9MA 4QPGC 4QU1A 3WQ0A 3ZFEC 4KWLA 1VPHA 1XQNA 3POJA 2JDPA 4JQTA 5K4LA 4Q4X2 4QXCA 4BISA 3VDCA 4QB1A 1AJKA 1YQCA 3J7NA 4Q27A 4E4SA 1QWRA 4MVTA 2R0FA 3WNXA 1PZ8A 3VB9A 3J4UH 3E6CC 1ND3A 4B3NA 1TZOA 2WNUA 4B7KA 1RUG2 2RMU2 4I2OA 5FYZA 3HQXA 4HKLA 2DUPA 1C8M3 4IEWA 4R9DA 4E2GA 4MV2A 1R081 4IE0A 5IT6A 4FP2A 4S2GA 2PHLA 5K0UB 4NN0A 3B3QE 2BVBA 4CEYB 5G04L 1ZRDA 4XIOA 1BXHA 2HEWF 4XJUA 5HV4A 4A4AA 2JICA 1J84A 5I0DA 4EV0A 1W0OA 3K4AA 5LA0A 5AC91 5FYTA 3M3OA 4YM0A 5E89A 1FV2A 1QHDA 2JE8A 4QKDA 2KA3A 4RQPC 3NV1A 3T30A 2ARXA 3VL8A 2DU0A 1PX4A 4FP3A 3ZMNA 2VTXJ 1OKOA 2YYOA 2LW8A 5L9VA 1ZRRA 3M1HA 1K5MB 3RYRA 1W0PA 3HNMA 3ENRA 3WQBA 5A3LA 5HV0A 2FDIA 4BH9A 3K46A 2AC1A 2ZGLA 1W06A 3OPZA 4GWMA 1V70A 3G6JB 3VHOA 3GBFA 4YZ3A 2VY0A 3I54A 3NAPC 2LROA 1A8MA 3VZMA 1QJU2 1V6LA 1KITA 5C5UA 3NJYA 1NQDA 5FYBA 4MH0E 4LBNA 5FLHA 4BDVB 3CKHA 2DBNA 1VBD2 2DCJA 1HX6A 1FAYA 2VECA 4FXKB 4B4RA 4D6SA 2XOMA 3BUCA 3ACFA 3MV11 1IGOA 1VBE2 4WM7B 4R9BA 3RGBA 4URTA 1HRI2 3PUAA 4XETA 1EV11 4KL1A 2PLV2 4Q26A 4QGMA 4AI8A 2LRPA 2XR4A 1MEC1 2QBXA 3R0RA 4N90A 5FTTC 5ANQA 4W6WA 4YVWC 1BMV1 1ZBA2 2WT1A 1EAH3 1YI7A 4AI9A 2XLFA 3TEWA 1RUG3 1FPN2 4RQPA 1QOSA 1N1TA 1OSGA 2ET7A 2ZZQA 5FZBA 4E27A 1UN1A 4XTMA 4NHLA 3N7JA 1UWWA 2B7YA 5ABJB 4RGKA 1W6QB 4FTBA 1BKZA 5CKQA 1DHKB 3KT1A 3UT0A 2ADEA 2JG9B 2R6QA 1VMFA 5IAXA 1ND3C 3OOXA 1U0AA 1XNAA 2WNUC 4LUKA 2C1FA 4CCNA 4COYA 4H3WA 4CXWA 1OLMA 1E5SA 3ST7A 3U07A 4RN5A 4CDUA 2QNKA 4GAZA 2A70A 3CZUA 1VBB3 4R4ZA 4E9KA 2HWB3 1UCXA 2WSVA 3H42B 3IMNA 3LSEA 4X8PA 1TQ5A 3LGRA 4CU7A 1GBGA 3VBUB 2SLIA 4FFGA 1JZ3A 3Q8FA 3KT4A 3BI3A 4MGKE 1QGLA 3SH5A 4A2UA 3R4UA 4JV4A 1O91A 4XQ4A 3IN9A 5FZFA 3OGVA 1PMJX 1K5JA 1QJU3 5F3CA 1GV9A 2N7GA 3BTXA 5J37A 3J8F2 4J1XA 4EN0A 5FWJA 4MGTA 3RNSA 5FREA 3I59B 1VBD3 2VZVA 2XVGA 2DDUA 4O61A 5LZ6A 4XF3A 1FNYA 1H6XA 5JAXA 4U36A 1G86A 2P3KA 3SCHA 2JG9A 1VBE3 5FUPA 2YGMA 3N3HA 2ZA9A 4QM8A 4YRDA 5FJHA 4E4DX 3CNAA 4CCEA 4OMDA 5DG1A 5AFBA 1ZREA 5EFUA 4ORFA 4NRMA 4C8DA 2YFZA 3IZOA 2IXCA 3ZYJB 2ZHLA 1LU1A 4ATFA 3VBUA 3VBSB 1N1VA 3AKPA 3PJQA 1FX5A 4Q0VA 4DIQA 4JX0A 1TMF1 4OQ8A 3V0BB 1OLRA 1EUUA 4D3WA 1OA2A 5D1IA 4P9YA 1NA1A 1QQP1 3C8XA 3WNNA 4CRQA 4CCDA 3DEMA 2OYZA 5L36A 1F9KA 2W1WA 4LHNA 4JDOA 4AEDB 4IUGA 4FTSA 3CQOA 1ODMA 2CTVA 3SNMA 5FP7A 1XRUA 5FY1A 4Z8BA 2BOIA 1PIV1 2K9ZA 1APNA 1BJQA 1DLCA 4LO6B 4XOGA 5HCBA 2WBKA 2Y6LA 2V72A 3LZZA 4QHZA 1W0NA 3B02A 4E8DA 5FXZA 1X9TA 2Y33A 1UYPA 3IDEA 3RWNA 2R1BA 4CCMA 1XNTA 2NLRA 3JBG2 4QAWA 2ATFA 2QE3A 4AFDA 5ACA3 1JU3A 3O14A 3BB6A 3U4SA 5DAVA 5LB6A 5T3NA 4XAEA 1OPOA 2WZEA 3DF0A 3LAGA 4XAAA 4CDUC 5JXHA 5F8PA 5LRRA 3HBZA 2QQIA 4CCLA 2Z42A 5A7PA 5T54A 2I74A 2WSUA 1H9WA 2OS2A 5EZWA 1H9PA 3HAGA 4LO7A 3PIGA 3I3EA 3BTAA 3OEAA 5FY8A 4TYSA 4RYDA 3VKLA 2PN5A 3OEBA 3SHRA 3F2ZA 4AQSA 3OBZA 2VULA 1OF3A 5DAQA 4LOSA 2W1QA 1XB9A 3L2YA 5FBJA 5IVFA 4BU2A 4Y1VA 5T5OA 4AEDA 1DGLA 3I7DA 3RZKA 2RR11 1YQ8A 4MYEA 1WZXA 4UAPA 3M3IA 1DZTA 3NKGA 2WFF1 4P00B 3VV1A 5F5QA 4AOCA 1F35A 4XABA 3GF6A 5B4NA 1OD3A 4NROA 3BYWA 1GP6A 1RUF1 2JG9C 2ZKNA 5DQ0A 2VG9A 4QX8A 4YLZA 3BCWA 1Q8VA 4CU8A 1BZWA 3U4XA 1YEWA 5FP8A 2GMPA 2JDYA 1H8VA 5FPLA 5C4WB 1MACA 5A3PA 3EO6A 3MW3A 5FQ0B 2OT7A 3ZYPA 4MG2A 1OMIA 2Y8KA 2ZMNA 5DZEA 3UETA 3VBUC 2VH9A 2ZGSA 3H3UA 3ACLA 1PNFA 4N53B 4P08A 4XE9A 5GZCA 4FAGA 4Q4V2 3OCPA 5FZHA 3ZYFA 5JOXA 3TWIA 4QKBA 3MO4A 1URXA 1NA1C 4DUVA 2XBO1 1LHNA 2WABA 2Q5TA 4WVMB 4OYUA 3VBRB 1WCQA 4RS5B 4QMAA 5JDBA 4XFIA 4PQ9A 3ZDSA 4Q4W1 5J09A 4EN7B 4QU2A 1CESA 5HBAA 1BVP1 2V4VA 2QDNA 5FZEA 1XXNA 1UPSA 1PO12 4YM3A 4FPGA 2D7FA 2WRAA 2WWSA 1OH3A 5FYSA 2ZPXA 4NHXA 3VDAA 3C7EA 4D69A 4TSVA 5DN2A 4JGYB 1GU3A 1LCLA 5A3OA 4DNYA 2HWD2 2A1XA 1NUKA 1TNFA 2FBEA 3AX4A 1GWKA 4AL9A 4D0QA 1RUC1 1I1EA 4GB31 1WW6A 3PUSA 4ES9A 5JZGB 4LK7A 3POWA 3QH7A 3A0NA 1H0BA 4OHZA 4ARYA 4BQ3A 1QJY1 1RVF2 5HI0A 3THDA 1FT9A 4JC1A 5IATA 1VBA1 2ADDA 2J1SA 2MEV3 4UFJA 1FOD1 4RS5A 1AL0G 4AEDC 1YFYA 2HYKA 3M3CA 4Q1PA 3CEWA 4XXAA 2GC2A 4YW5A 4Y33A 4AG4A 4I0BA 3NJVA 3NV2A 1LGNA 2ZGTA 2VZPA 1CVNA 4IEQA 5EJZB 2LALA 4QHOA 1UQXA 2VMDA 2Y6HA 1ULOA 2WN3A 5GLZA 4HVRA 3M70A 3PTYA 1XU1A 3HT1A 4XURA 1UYYA 2JD9A 1V9U3 2QQUA 4JGYA 2XQXA 3VHRA 1RINA 2BERA 2R16A 3M3EA 4F7ZA 1ZZ6A 4GQ7A 3ZXGA 2QQVA 4JTNA 4DINB 1GSLA 5AFEA 4Y1XA 2F6BA 1JZ2A 3TNPB 3MPBA 4NIIA 1I6XA 3EB7A 2RM23 2WZR3 3M8LA 4Y1ZA 3CLPA 1UZVA 1H1IA 2E51A 3ZR5A 2VBDA 1RMU1 2QVSB 4HL0A 4JAAA 5FXWA 1HXS1 1UZ0A 3I2OA 4M0HA 3UGFA 3MZHA 5IVEA 4RR3A 1VB2A 1BK1A 5GLVA 1GNZA 2BW8A 2HEVF 1UZWA 2KR2A 4KG8A 3H7JA 3FMGA 2LTNA 4AI0A 2GSYA 4FCAA 1Y43B 2EIBA 2CGNA 4LPLA 4GWNA 3QACA 4OVEA 3B93A 3BVCA 3AP9A 5IYYA 3TBDA 3DPRB 1CX1A 1OXCA 2PHXA 3W58A 3NNFA 1DGWA 2PAMA 4YGCA 4C0HA 1ZBE1 4LHSA 5BNQA 2P6CA 1YQ6A 1RVF3 2VQTA 4IE6A 3ASIA 3WSOA 1Q8OA 4ZU7A 4HN1A 1W8WA 1JH5A 4FPYA 1L7QA 1Z7S1 2XJQA 2FCTA 2WS91 2ZGQA 1HV1A 2P17A 1RHI2 1IKPA 1O7FA 2ERFA 4COUA 2CHHA 1CX4A 4GZ9A 5AC93 2RS11 2RS33 1AVBA 1CGPA 2R7EB 1X82A 1BEV1 3VZKA 4CEWA 2WO2A 2VCMA 4PJYA 5EJ1B 4META 3CDZB 4YM1A 5CFDA 4XQDA 4CUBA 2WA3A 4RS5C 1UU5A 3T3YA 1I5PA 1YI9A 3D4KA 4FPKA 2VQUA 4FO9A 3SH4A 3VBHB 4JGZB 1ZA7A 2HH9A 2P5BA 1GQHA 5TSWA 5FPZA 3OGSA 3WF4A 2CGOA 1O3QA 2JKXA 2EICA 3IIAA 2JD4A 4RGAA 4LBQA 1W9SA 3WQ1A 2VVDA 4NJ4A 1O8PA 1VE0A 2X29A 4GH4B 4R9CA 3TB0A 4OFGA 5FOBB 4FFFA 4UFMA 1W8UA 2DTWA 4LITA 4L0PA 3VZJA 2PFWA 4JGYC 3H3ZA 4K8FA 4Q4X1 1YLLA 1GOGA 5ISLA 1KJLA 3AP4A 1TME1 1T6BX 2IVJA 3RZJA 3K48A 2CWMA 1ENQA 2R063 1U5XA 1KJRA 3A4UA 3H8OA 2HWE3 5IVYA 1GZCA 3AP7A 5FO8B 2ZAAA 4B4PA 4UW5A 1AHSA 1O8SA 3KVAA 1G9AA 2P1BA 1XBFA 4RR3C 5T5LA 3CMGA 1JZ4A 1UOBA 2JDHA 1PZ7A 1YXWA 2F17A 1Q5OA 2B8MA 3P3PA 4MGIE 1PGSA 4BIFA 5LBBA 3WDVA 2UWAA 4Q29A 2WLQA 1BBT2 1K3IA 1STMA 1SDDB 3ZKUA 4HKOA 5ERLA 1JYTA 2ZS6B 4XMAA 4ASLA 1RHI3 4FPLA 3JD71 3VZNA 5A3UA 2VE1A 3NJXA 3NQHA 2YDEA 4CDQA 4PCRA 2CAUA 2OPKA 1XC6A 4XDOA 1WMXA
chains in the Genus database with same CATH topology
1LOGA 1R1A2 1WW5A 1COV1 5T5PA 4AGRA 5JVVA 3WDTA 3WP4A 4MZUA 1ZNPA 2HWF2 2A6YA 3LWCA 1RUJ1 2B42B 2NPIA 5CG8A 4I09A 1DZRA 4RHV2 1VRH2 3MIBA 4COVA 2XWJB 3PHMA 3OY8A 4NO4A 2BPA2 5E16A 4CEWC 4IEVA 4JTOA 1A6CA 4N7UA 2XLAA 5CFDC 4AVAA 4EWEA 5FLJA 4L9BA 5CVRA 1HQWA 1AYN2 3KCYA 4AF9A 2DURA 3GZTB 3S0MA 4YZ4A 5LEKA 2AR6A 1RUI1 3ZYIB 4Q8KA 3AMMA 1EPWA 4EWDA 1FPN1 1N47A 4I0WB 1DQ5A 3QBQA 1MQTA 1RUD2 4XFCA 3WT3A 2ZX2A 3EBRA 1AR61 4SBVA 4PDWA 1LU2A 1WCDJ 2ETEA 3MLLA 4N43A 2I07B 4NWVA 3KCXA 1TMF3 3TAYA 5JOZA 4FT8A 1S0IA 1ENXA 3MW2A 2DUQA 2B5HA 5FLIA 1VLNA 4B4QA 1H4HA 4F3JA 5I93A 5I91A 2WT0A 1FNZA 3D82A 4V1PA 1AYM2 4LA3A 1CAUB 4QPGB 5F1RA 3AZZA 1A78A 4UW3A 1R1A3 4QM9A 3AJZA 1GZWA 3NWKA 2PHUA 1WBFA 3L9JT 3WUDA 3MFAA 5GALA 4PIZA 2Y0OA 4CDQC 3J8F1 3FLPA 2PTMA 4XFGA 2VQ0A 1QNWA 2D6NA 3UKNA 1ASJ2 1O5LA 3MICA 3NV3A 2AENA 1PO22 4CP0A 4RSUA 3WR0A 1DIWA 1DDLA 4MX3A 1HIXA 2Q8OA 4Q2FA 4UW6A 3LB9A 1AYN3 2GN7A 3FUOA 3HD8B 1MZ5A 4I0AA 3E6DA 1MZ6A 4LO8A 5L7OA 1QJX2 3RS6A 4M3CA 3TYJA 1O4ZA 3B69A 1GLHA 1POV1 4B7EA 1PZ9A 4XHBA 1VJ2A 1NCQA 3H1MA 4WM8A 3SISA 4LBQD 5BNOA 4I02A 1EP0A 2A7AA 3AFKA 5GLTA 3N4MA 2PQQA 1RUF3 1XYNA 2VPVA 3NAPB 3AXEA 4YFWA 3LA3A 1UZYA 3PVOA 2TBVA 2HWC3 5HXVA 1DGRN 1MQTC 4UW4A 4EJRA 5BYNA 5J36A 5SV8A 4PDWC 3TRSB 2Z69A 5K7PA 5T5JA 2FQPA 4N43C 4XJZA 3JBG1 4IEPA 4YM2A 3OJBA 2XBO3 3I8TA 1C8M2 2Z79A 5CG9A 1WBLA 5L73A 2A71A 3WP5A 1WLDA 2W08A 1Q56A 1V6IA 1S0GA 1Y3TA 2VW1A 2D43A 4LUMA 2XL7A 3PVNA 3LCPA 4L97A 2IXIA 4HMZA 4XIKA 3CL1A 1ND3B 1F5JA 3WINE 3D8CA 2WNUB 5BNNA 1D2QA 1U12A 4LE3A 1L3JA 3ZXAC 1ONAA 1ZYBA 1QJX3 1KXGA 5FMOS 1UL9A 5GZGA 3SLIA 2HJIA 4PF5A 3WW1A 1RUH2 2R072 4CP2A 3B00A 1QJY3 1ND2A 2GC1A 4GALA 1N3OA 3B5LB 5KHKA 4WVWA 5JSPA 4OI1A 2DTYA 1H30A 3UV9A 5L7OC 4AVTA 4DPNA 1GQGA 1IHMA 1NCQC 1J3QA 2GNBA 4WM8C 4ISQA 1AL22 4P5HA 4M0NA 4NOTA 5BNOC 5I0SA 2PHWA 5JSRA 5JWPA 4Q4V1 1FI2A 2P3IA 5J3UA 1WD3A 1JOJA 3FHIB 2F4PA 4XTPA 3KS7A 4EN9B 1WLCA 5KC6A 4QQPA 1EAH2 3WDWA 1OA4A 1GFF2 2JJ6A 4W6XA 3AYEA 1O4TA 4Y20A 3ZXLA 1UMZA 1PO11 1FYUA 3VGIA 1N3PA 1ZVFA 2XHKA 5EJ3A 2MPFA 3LA2A 4GMP1 1AXZA 1HXS3 5BNPA 2DFBA 4DXZA 3EQEA 2CL2A 2VUAA 5CADA 4NVPA 2MHFA 5FFOC 3WW4A 1VBB2 3MW4A 1KFXL 2HWB2 4OUSA 4R4XA 5A33A 1RC6A 1DFQA 2XJRA 3BODA 4K7JA 5GLUA 3VBOA 1ZBE3 1RUH3 2R073 1IS6A 1MR5A 1O3SA 1O4YA 4AEKA 4ITCA 2KXLA 5DZFA 2WS93 5BNNC 4D7YA 5T50A 3SH3A 2XVLA 4QXKA 1CPNA 3GBWA 4LHLA 1IS4A 1SFNA 4CDUB 4AVSA 5AVPA 4LTAA 4YG0A 1JYIA 4C90A 1AL23 3GHNA 3UKTA 1BEV3 3HT2A 1ND2C 4B29A 1C5HA 1LENA 4Z1VA 1RIRA 4S2HA 4OUMA 2E6VA 3O7OA 5BUVA 2BNMA 3ZN4A 4DMIA 4XQWA 4AQTA 3MIGA 1H8TB 4QHBA 1WMFA 1ZM1A 3RZZA 3WP6A 1VB4A 2FZ2A 1Z78A 3ZYGA 1G9CA 2AGSA 2R041 2GC0A 3MPPG 4Z92B 1LGCA 3FLTA 4M3CF 1MZEA 1S2KA 4Q1RA 1TME3 1VBC3 2XJSA 2UY8A 3KSCA 4P9IA 2PHDA 1AUYA 4M01A 2VW0A 1UIJA 1ZZ7A 1AF9A 2UY9A 1BCXA 4EN6B 2ILMA 1KDMA 5ACA2 2ZCWA 2BWCA 1CR7A 4S2DA 4C0BA 5BNPC 4IEZA 2A3YA 4YGEA 2JG8A 4KGQA 1NA1B 3H8UA 3AYAA 3RJ2X 2OUJA 1H8TA 1W6PA 1AR71 5JPMB 1W2UA 3JD73 4AW7A 4IV1B 3VBOC 4M00A 2ZX1A 4LR4A 3K51A 1COV3 1OA3A 1UKRA 3WVJA 4OHXA 1W6NA 3FE5A 4EWAA 1MS0A 2D3PA 1X50A 2W68A 4DY5A 1TEIA 1RJ7A 1IQAA 4GKXA 3LA7A 3M2MA 3VKOA 1PVC3 5BV6A 3ZN5A 1XNDA 2XPJA 2X5IB 3FJSA 4MGZE 2GDFA 3VUOA 3E5QA 1J1LA 1OHFA 1U5ZA 4L11A 1RUE1 2BBVA 4QX5A 1ZZCA 4IV1A 4H7MA 1LKNA 1WMEA 1AR92 5JIAA 1S0FA 3AM2A 3FBMA 1CPMA 4COZA 2VVFA 1JUHA 2E7TA 1LHWA 1OQEA 3CJXA 3AK0A 2DCZA 5GZEA 1BBT1 1NCRA 2AYHA 1PK6B 2XJUA 4LLOA 2I45A 4QQHA 1O5UA 3KT7A 5JPNB 1SBDA 4S2FA 5E8AA 2DWRA 4X6QB 2BYVE 3THTA 5A32A 2X5IA 2JG8C 1LHUA 3FBYA 2WQ4A 3V65A 4FAHA 3X29B 4AVVA 5DDJ3 5LEJA 1WW4A 1H8TC 1D4M2 1VRH1 1QF3A 4J6GA 3UKVA 1AR82 1WD4A 4XFHA 1Q3EA 2JKBA 2YXSA 1CAVA 3OYWA 2MEV2 1DBNA 1HRV3 1LOAA 5GZDA 2ZTNA 4Z82A 1UU4A 1X8MA 2RS53 3NV4A 3VBFA 1AX0A 3TOJA 1R093 2VW2A 2WQZC 2WFPA 5CA6A 1PK6A 4FXGB 5EYXA 4PLOA 3MLJA 1VAVA 4YG6A 1QDCA 1JBCA 3IDCB 4DY3A 1V9U2 4Q0QA 4Q4Y2 1GYKA 4LBLA 1AR93 5KHJA 3RMXA 1YNAA 1AX1A 3I4IA 1SLIA 5CFCA 2RM22 3H1YA 2WZR2 1T6GC 4HANA 3LSDA 3UJOA 3WQ7A 1Q8SA 4IV1C 3E5UA 1V6KA 2DV9A 2IXJA 2R1DA 4ES8A 2QDRA 2VOKA 2IFRA 4FPFA 3KMHA 5T55A 3EHKA 3ZYRA 5CBLA 3C3VA 5EWSA 1NCRC 1V00A 1WA4A 1ULFA 2Q0AA 4BCUA 2ZAHA 1JTZX 1NXD1 1REFA 4XBLA 4XILA 3E5XA 1POV0 4AGGA 1D4M3 1FMD3 5H9SA 4RFT0 2D44A 1AR83 2YZ4A 4IQPA 3ES4A 1R082 4AGVA 2NZ9A 1XNBA 2TEPA 1ASJ1 1TE1B 1UW8A 2X5IC 1PO21 1D4VB 2DCYA 4RR3B 3M7AA 1RGSA 4DB5A 5AC92 1VIWB 4WBBA 2RS32 2ZGNA 3DL3A 4WV8A 3B9CA 4I3PA 2NYYA 1PGW2 3ECQA 4KWKA 4ONUA 1V6MA 4OLLA 4CP1A 3N7LA 3VBFC 4TWTA 1H1MA 2DVBA 4Q4Y3 3KQRA 3TN91 2PHTA 3UJQA 3J9SA 3USSA 1PK6C 3O0WA 1I5ZA 4AXOA 3OD0A 1HDKA 1SBEA 2OA2A 4GXLA 1U5YA 4TZDA 4MXWA 4W6YA 2O0OA 1VP6A 4AHYA 1V6JA 1AJOA 4FVVA 2AZ5A 1OKQA 2D97A 4CEWB 2ZGKA 4L92A 1QOTA 4OZXA 5CFDB 3RI8A 1QKQA 1J58A 4FPJA 5CFCC 1G8WA 4BMEA 2R062 3ETQA 2HWE2 3D0SA 3IWZA 4FPOB 5SV5A 5BY5A 4AK3A 4QGLA 4XXPA 4LO5B 4LBQB 4ATEA 2UWCA 4FPHA 5DUWA 3ROUA 2QZ2A 4YW2A 1R083 1YYNA 2E9QA 3WW2A 4FOWA 4W65A 3R4DB 2EVXA 4UBHA 1UKGA 4WZCA 2DCKA 3BPZA 1S2BA 4NHKA 2ZGMA 1HKDA 3HIFA 2XKOA 3IM0A 3O5SA 5AVAA 2I2SA 1QXRA 4Q8LA 5LK7B 1XE8A 4OI2A 3WDUA 2YV8A 2W39A 1G7YA 5IUQA 2AUYA 4AWDA 4DS0A 1C57A 4H7LA 2P34A 2YMZA 4HKWA 4KQ7A 3S7IA 4YSFA 1G9BA 4XJ8A 1DYPA 3SXWA 1KD7A 1ULDA 4BA6A 3EJKA 3AMPA 4PLNA 4CDQB 2P37A 1YJLA 5KXBA 3AKQA 2GU9A 4GMP0 3ZMOA 1YJKA 1MZFA 3ZN6A 4CDXA 1XYOA 2EAKA 4C1WA 1J3PA 1EV13 4FQZA 3UL2A 1RUG1 2RMU1 1MEC3 3AZVA 3BOWA 3VZOA 1DZQA 3AYCA 2CY6A 3OY8B 1MS5A 3U10A 4XFAA 2D6LX 2VU9A 4HPKA 1H2KA 2D6OX 4G9SB 3AKRA 1TMF2 1B09A 2OVUA 4Y1UA 3S30A 2R30A 1QQP2 3J26N 2ZGOA 3H7YA 1OI6A 1EPZA 3ILFA 1AXKA 4K1ZA 5EYYA 4I3GA 1VBB1 3NVCA 1SLCA 1QMJA 1DLLA 1WCKA 1WLTA 2HWB1 1PIV2 1IKQA 4N7IA 2IWGB 5B2GB 2WNVA 2BFUL 5K9YA 1MQTB 4YNIA 4PDWB 1PHMA 1REDA 4XF1A 4BWOA 4AHZA 3RYPA 4N43B 1QJU1 1QDOA 3N36A 5DUUA 1VBD1 1LR5A 2ZX3A 4B8EA 1VALA 1C4RA 3NW4A 3ZVXA 1VBE1 3MIHA 4Q0SA 1GZ9A 4JDMA 4AEJA 1HRI1 5LK5A 4K3UA 1QH7A 2PLV1 1GZWB 3BU7A 1DF0A 2A5ZA 4F8AA 1LRHA 1ZBA1 2C9AA 2GALA 1REEA 2BNOA 4O9EA 2FHRA 2RR12 2DUOA 5JSOA 1RTVA 3OGGA 5FBZA 2WFF2 4OI4A 1M06G 1JW6A 5H9RA 3DGTA 4CDXC 2Q4SA 4KBBA 1RUF2 3KGZA 4RL7A 4NPRA 1QQP3 4Y22A 2HWC2 3IPVA 4A3XA 5L7OB 3HN1A 4RD7A 4M3CB 2B39A 1RUE3 4BOWA 5GJ6A 4K1YA 1LESA 1NCQB 4WM8B 4XBNA 3RPQA 3VHNA 1OPMA 1PIV3 4XF0A 5BNOB 5KXEA 1X8EA 2O8QA 1Q8PA 5ACA1 4LULA 2XBO2 4AFAA 3ELNA 1G6NA 5I0RA 3PJYA 3MIDA 4K21A 2LM3A 4BLJA 1DQ6A 3B7MA 3ZSMA 4BM8A 4XPVA 5C9AA 5IK8A 2D3RA 2WNVC 4YARA 3CJIA 3RJRA 1LB2A 1ZZ8A 1GICA 1SCSA 2CV6A 4YVSA 4IXLA 1XU2A 3D0JA 1RUC2 2QJVA 4GB32 4AYUA 2RR13 2D40A 1W39A 4I01A 1CAWA 1SMVA 1Y7BA 3JB4C 3THPA 1QJY2 2WFF3 1Y9QA 1CN1A 2TNFA 4ZKTB 5GZFA 1DQ4A 4P9XA 4ASMB 2GMMA 4AI1A 2ZABA 4AFBA 2CGPA 3IKWA 5BNNB 4AFMA 2WA4A 1W6OA 1C1FA 4HFSA 4YZ2A 4QPIA 4YZ5A 4AHWA 3E97A 1NG0A 4XDQA 2ZBJA 3MFCA 1OOPA 1SCRA 2JDZA 3RG0A 2PYTA 1NLSA 1ND2B 1YFWA 3KZ4C 1LOFA 2ZHMA 2MNGA 4XJWA 2JEMA 2GMEA 1SQ4A 4XW3A 3FUQA 2D6PA 4Q4W3 4IL7A 1ENRA 2WIIB 3LOBA 3M4FA 2YPJA 1QXPA 1BYHA 4G4FA 2Q30A 4PBPA 3AP6A 4O9GA 4Y24A 1HXS2 4D7TA 1SLAA 2BUKA 1O3RA 3PNAA 3RYKA 4FOVA 5FPXA 1IS3A 2XL9A 4X6RB 3WXPA 5C9AC 5KBFA 1SEFA 5DG2A 1UX6A 1ULCA 3H1WA 4Y20B 1PMIA 1RUC3 3CJIC 4GB33 4FPCA 1ZBE2 1NOVA 1GANA 4P9LA 5BXXA 1VBA3 4F83A 4JVAA 1Z7S2 2WS92 4IEOA 4YVSC 5BNPB 1FOD3 2DFCA 3D6EA 3QH6A 3VDDA 3ZO0B 2E7QA 1V6NA 2IXLA 5BPXA 5EV7A 1MS3A 1OLQA 1JXNA 5J98B 5A33B 1BEV2 2RHPA 3MI8A 1V9U1 4LT5A 5I8YA 3HR9A 5KHHA 4IERA 3VBOB 2UYAA 3R6SA 5F9TA 3AB0A 3N7MA 1H2NA 2RM21 2WZR1 2AH2A 1WUVA 2RE9A 4ZU5A 1XYPA 1D2SA 2ZGUA 1YO8A 2NN8A 4LO4B 4IV3A 1B35A 4IEUA 3V56A 4QPIC 2A6ZA 2YUEA 3GALA 3ILNA 4ZXKA 1PGL2 1OOPC 3A0KA 1RMU3 3INAA 4G3YC 1QOOA 3ZXDA 1LOFC 3NSTA 1KFUL 4L2NA 4CDWB 2HWD1 1CJDA 1TME2 1VBC2 4LBOA 5DUVA 1DQ1A 5KHGA 1ZZ9A 5DUXA 2QQPA 3ZPYA 2OW4A 3AZWA 1SDWA 2V5YA 4HSJA 1ZRCA 1RVF1 1QNYA 2WKKA 5CNAA 3AMQA 1HQLA 3U0ZA 1UPIA 5JR7B 3BIWE 1S0EA 3QLQA 3TNQA 4HN0A 1WLWA 1CQ9A 1WW7A 2RS31 1VR3A 1Z7S3 2IC1A 2WL1A 3CO2A 4QT6A 4XJAA 3WDXA 3JD72 1PGW1 4GULA 2FZ1A 4XMIA 1AX2A 2RS13 2HEYF 1OQ1A 2VOVA 2BGCA 3QCWA 1COV2 2D3SA 4BE3A 4BYYA 4CDWA 3ZFFB 2XG3A 3WHTA 2JG8B 4D94A 4HBNA 1NY72 3DUIA 4XF4A 3VDDC 4OULA 4DRRA 4X8NA 4I30A 4XYXA 1RUJ2 5CIRA 1ZRFA 3VKFC 1WGPA 4LBKA 2XJPA 4KGGA 1F2NA 1W6PB 1IOAA 2GN3A 2ZHNA 5J48A 2OZ6A 2PA7A 2PAKA 2QCSB 1PVC2 5K0UA 4AEMA 4CEYA 5D8AB 3N35A 2YC0A 1LOBA 1NLRA 3PVEA 2PHFA 4E2SA 2K2SA 3SMHA 4Q4X3 2GZWA 1V6OA 4UXAA 2R061 3EXUA 1H4GA 1S0DA 2HWE1 1W6NB 1RUI2 4IV3C 1B35C 3SCGA 4AI3A 4P9WA 2H6CA 3OBRA 2PHRA 1K5MA 2RMU3 1GKBA 3DN7A 3WD5A 1C5IA 3WY6A 4R8HA 5IK4A 2V09A 2XB6C 3T2TA 1RITA 2B45X 4OHWA 4PBOA 1AR62 3FLRA 1RL3A 1VAMA 3ZFFA 1TNRA 2G9FA 3FC0A 2CYFA 4K6BA 4XF9A 4P9JA 1RHI1 1LOEA 3L2HA 5IK5A 3H0OA 4WVZA 2XUMA 4LHKA 3OD4A 4HSLA 3GHMA 3AXDA 1OFSA 4A7YA 2GNDA 5C8CB 5D8AA 3ZIWA 5C8WA 2A3WA 2QUOA 4KG0A 4WM7A 3UK9A 1FATA 2RJKA 2W0XA 1QJZA 3VHPA 5DDJ2 2C0ZA 1ZA4A 1NCRB 1JN2P 1MS4A 1ULGA 2BQPA 5L19A 2R32A 2XLGA 5C33A 1RUJ3 1YWKA 4Y1YA 3B94A 3URFA 1HRV2 1C28A 1KQRA 2IZWA 2RS52 5ABJA 2A3XA 3P3NA 2ZGPA 1W6QA 3FFQA 3S7EA 2DVAA 4CDWC 4DZGA 1R092 5A32B 4LLFA 3T1MA 4Y4YA 4IETA 3QOPA 3WOGA 2Q1ZB 4C91A 2WNEA 1IPKA 1HRI3 2GH2A 1QU0A 2PLV3 1ALYA 4DFSA 5JOWA 4YZ1A 5I8TA 3HMYA 4GA9A 3GZAA 1RUI3 1ZBA3 5C8CA 2ZACA 2BNNA 4CEYC 5K0UC 3RRDA 1CAVB 3OYWB 1FPN3 2CWSA 2ENRA 1FV3A 2GH8A 3MIEA 3JUUA 4LEJA 2WLPA 2SBAA 3V64A 1NE6A 3VBFB 1AR63 2UYBA 1SACA 3T1LA 2VMHA 4C1XA 3KB5A 3GZUC 1S1AA 4LE4A 1DGWX 4JRLA 1Q43A 3B9IA 3JZVA 1K5MC 3WZ1A 1X7NA 2YHJA 2ET1A 3JQXA 1S55A 3I59A 5F6LB 1A3KA 1JUIA 4KWJA 4E4ZA 3V0AB 1R1A1 2EAAA 1N1YA 4MUVA 1YRZA 2QZ3A 5FO9B 1OQDA 3FZ3A 1FXZA 3ZFFC 1LHVA 1SLBA 2HWF1 2E7AA 1HW5A 2D98A 2VOWA 4XEZA 1A8DA 5C6CA 4Q0PA 4XBQA 5CFCB 2D93A 3MLKA 4RHV1 1XE7A 2XWBB 1FMD2 4CTEA 3WV6A 1U5IA 2C5DA 5D8AC 3J8F3 5HCAA 4BPZA 4MSVA 3W9AA 3VBSA 4WM7C 3AYDA 4YYOA 3V0BA 3KCCA 1GR3A 1AYN1 5I8SA 4SLIA 3WCRA 4DQAA 2Y26A 1KS4A 2WINB 3WP3A 1UD1A 3KGLA 1LOCA 1J3RA 1NXMA 3V0AA 1CAXB 5ABJC 1RUD1 1X33A 1POV3 2Z2SB 1DGRA 4GKYA 3W59A 1JYCA 4MXVA 1H1AA 2DVDA 4R9AA 2LUWA 4COWA 3ZXKA 5KXCA 1LEDA 4AI2A 2G4IA 3ATGA 3PMSA 4KNCA 2HWC1 2WT2A 1SLTA 5C8CC 2P2KA 1WMDA 1X36A 5CAZA 2E63A 5FAXA 1AYM1 1QH6A 2UURA 1AZDA 2EIGA 4YFZA 3N7KA 3ZSLA 4E2QA 2OUHA 2Z5WA 1MVQA 2NM1A 5FDBA 5KHIA 3MYXA 4FPEA 1C8NA 3JBG3 3MF6A 5FO7B 1E57A 2VOXA 2CAVA 3U11A 4MLOA 3JCIA 4MXWB 3WHUA 2ZOEB 3MGUA 3FWEA 1LEMA 1CAXA 5JI7A 4H55A 2D5FA 1YFUA 2GNMA 1NZCA 1OFNA 3Q9OA 2WJSA 3CU7A 2PELA 4BZ4A 2VXRA 3JQWA 5EXOA 3NJZA 4QQOA 3RSJA 1UIKA 2EA7A 2VUJA 1GNHA 5C4WA 1HQNA 3WCSA 2EALA 1QJX1 2DYCA 4Y5Z0 5FQ0A 1MS8A 1LECA 4YGDA 3OF1A 2G9GA 3VBSC 1UZZA 4N53A 4J1WA 4HK8A 4AHXA 2WZPP 2TUNA 3IDBB 4WVMA 3VBRA 2E53A 2H0BA 4WZFA 1EY2A 1H2LA 1RUOA 2V73A 1YFXA 4TLFA 2X8KA 4K20A 4XFFA 4NHMA 2AREA 4PIYA 4XZPA 4RGGA 3DV8A 3WLUA 1OD5A 4Q4V3 4BIOA 3PVBB 1EV12 4OHVA 4PLMA 2R0HA 1MEC2 4JQRA 5JIUA 1C8M1 4BLIA 1BMV2 2DCTA 5JZGA 2H0VA 1YCIA 2B9UA 5FCCA 1PM7A 2JX9A 1LJ7A 1S0CA 1AXYA 3IT8A 1I9RA 1PO13 3OBTA 1KRIA 2R042 2ZX0A 3H50A 3ZN6B 4CDXB 3MIFA 2Y0IA 4P9GA 3BOPA 4GMP3 2NP0A 2A6VA 2XGXA 2HWD3 3KLSA 2NMOA 2K0GA 4FOYA 1RJ8A 1YIPA 2A6WA 1EYBA 4R52A 1Q8QA 3APBA 1SFYA 4Y26A 5KXDA 4JCKA 1NYWA 1XNKA 1DQ0A 5A3MA 1RUH1 2R071 1RUNA 4HPKB 4Q0UA 5KC5A 3D5OA 1G9DA 2HKXA 2IXKA 2DVGA 3E6BA 4L8QA 4HT1T 1BQPA 1W6MB 2CNAA 1MS1A 1ENSA 2Q1MA 3O0VA 1LODA 2R49A 5C4WC 4INDA 2ZKLA 4JRAA 2ZGRA 1SBFA 4YG3A 1AL21 3ZIXA 1M4WA 3JB8A 4FBFA 1AR72 3AFGA 1J59A 1N3QA 4N53C 2WNVB 1PVXA 4AQ2A 1UF2C 2VNRA 4HVOA 2QKDA 1HV0A 3VBRC 3O12A 2DVFA 1YIFA 2JE9A 2OIIA 4FQ4A 5I0TA 3ZXJA 1EAH1 1F31A 3RDIA 1R1ZA 1NQJA 2XKPA 4LBJA 5DZGA 2BEOA 3DPRA 2VNGA 4FOQA 4A7KA 2ARBA 3WG3A 2VMIA 2XH6A 1BVVA 4GIQA 2YGLA 3CF6E 1PGL1 3ES1A 1LULA 5E88A 5DXDA 2EXJA 2ZMKA 1W6MA 1KS5A 5JMCA 5T52A 1VBC1 2R043 4L99A 4BHPA 5JZGC 1RUE2 1Z0HA 4UBGA 2WC2A 3POSA 2A6XA 4YGBA 3NL1A 2VVEA 3MEPA 4CZSA 2FMYA 4RA0A 4YW4A 3AMNA 2ES3A 2H6BA 3OTFA 3RI9A 2JECA 4HK9A 3VBHA 2A75A 4JGZA 2NQYA 4Y22B 4IESA 3IPVB 2D5HA 4IEXA 3AP5A 4XJ9A 4DOUA 4GH4A 3HWJA 1LGBA 3FX3A 5GLWA 3G7DA 3WG1A 1AR73 4AVCA 5F6KA 3ZXEA 5J7MA 3OGJA 1RB8G 2BTVC 4XFBA 2ZX4A 3FFZA 3VL9A 2UU8A 3WG2A 1NY71 1XNCA 3QD6A 3GYDA 2JE7A 3WX5A 2OZJA 5C9AB 3O0XA 3WUCA 3KD4A 2GC3A 1HLCA 3CJIB 1PVC1 1LHOA 2IXHA 4P14A 5HCFA 2GNTA 1O3TA 3VN4A 3USUB 2NMNA 3ZSKA 1JHNA 5JCTA 2JENA 4FTEA 4HZFA 4K40A 3B01A 2JXAA 5H9QA 4N9IA 1CJPA 1LTEA 4YVSB 2RJLA 1NE4A 3DPRC 3VKNA 3DKWA 4KH9A 4WVVA 1S0JA 1DYKA 3GNEA 5FRAA 2ZHKA 3PLQA 2D6KA 1ZZBA 2ZZJA 1CAWB 4MGYE 1MS9A 4QQ2A 2O8OA 3R4SA 4QPYA 4YW1A 1D0HA 2GAUA 1ULEA 1IS5A 1I3HA 2ZMLA 3PMEA 3ZFGB 4Q4W2 3WW3A 4OHYA 1BBT3 3ME2A 4Z07A 3S6PA 1W6OB 1CIWA 2DU1A 1MVEA 4QPIB 4EN8B 2BVVA 2EF6A 1ZX5A 2VGDA 5GM0A 3ZFEB 5H9PA 3USUA 4BQ1A 4ISRA 3VKMA 1OOPB 4NWWA 3VBHC 5FMOL 5GKAC 4JGZC 5DDJ1 3SITA 4KU8A 4NR1A 2HWF3 4QD2A 2BFUS 1C3HA 4QGNA 3WG4A 4BMBA 5JLVA 1DG6A 2B46X 4GH4C 3VZLA 1HRV1 1F5FA 1VRH3 4RHV3 4D7SA 3LKJA 2RS51 1VBA2 4A7ZA 4LNVA 1R091 1S0BA 5FOJB 4EROA 2XVKA 1FOD2 1C1LA 2XJVA 3ZFGA 3MF9A 3ZSJA 1J1TA 3NKTA 1CONA 2YY1A 4OI0A 2O1QA 4RQPB<