4QQLA

Crystal structure of c1ql3 in p1 space group
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
KIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q-like protein 3
publication title Structures of C1q-like Proteins Reveal Unique Features among the C1q/TNF Superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 27
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qqlA00
1XU2A 4OULA 3TWIA 2WNUC 3ME2A 4G4FA 5KWRA 3K48A 1JTZX 4E4SA 4QQLA 1IQAA 1TNRA 2HEYF 2HEWF 2RJKA 4EN0A 1PK6B 2R30A 2WNVA 2RE9A 4GIQA 5KC5A 2JG8C 1U5XA 2Z5WA 4D7YA 2WNUA 4KG8A 2JG9C 3WD5A 3MI8A 4QQHA 1OQDA 1OQEA 3URFA 3B93A 4J6GA 3V56A 2JG8A 4MXWA 1RJ8A 1D4VB 2JG9A 4QQOA 3B9IA 2TUNA 3LKJA 2R32A 4E4DX 1RJ7A 1OSGA 3QD6A 5L36A 3K51A 1GR3A 2WNVB 2OIIA 2Q8OA 4QPYA 2ZPXA 3B94A 2WNUB 4QQ2A 5HBAA 2E7AA 4HT1T 1A8MA 2R6QA 5L19A 1TNFA 1XU1A 5KC6A 1KXGA 1U5ZA 2RJLA 2X29A 3L9JT 2QE3A 2JG8B 2TNFA 1PK6C 4G3YC 4OUSA 1C28A 2O0OA 4TWTA 2JG9B 1D0GA 4TSVA 4DB5A 1DU3D 1U5YA 4MSVA 4N90A 4MXVA 4KGGA 1ALYA 3TYJA 3FC0A 1S55A 5TSWA 3ALQA 4NN0A 5BNQA 1PK6A 1DG6A 2KA3A 3QBQA 1C3HA 4RSUA 5CIRA 1KD7A 1WCKA 1O91A 1JH5A 1D2QA 2Q1MA 4MXWB 4F3JA 2HEVF 2ZJCA 4KGQA 2AZ5A 1I9RA 3AB0A 4DOUA 4OUMA 2QDNA 4QQPA 2WNVC 3IT8A
chains in the Genus database with same CATH superfamily
1BBT2 4J25A 3S0MA 1VP6A 3EYPA 4UFIA 5L9VA 5T54A 4QKDA 4HK9A 3FFQA 1POQA 3H3ZA 4L0PA 3DL3A 1JUIA 1R1A1 1XE7A 3RYRA 5JXJA 3OF1A 2BP6A 2RS32 3D6EA 4NVPA 3VDDC 1W3XA 4AF9A 5FZFA 3VZLA 2GMEA 1QWRA 1UZ0A 5GLZA 3ACLA 3P5BA 1QH7A 3WDYA 3O1RA 5A7OA 3LEMA 4A45A 1YEWA 4YGBA 5A80A 1ZNPA 1PO21 2WAOA 3H1YA 4R9DA 3POWA 4YW4A 3KVAA 3WEZA 4CXXA 4QHZA 4XIOA 4ATFA 2XBO2 1PVC2 4AR2A 3INAA 5BNNB 4LQRA 5DUVA 1T6BX 4A41A 1DGWX 4AI0A 2G1MA 3B9IA 2YGLA 3SH4A 5C4WB 3CEWA 3LGRA 1CX4A 2XR4A 1X8EA 4M3CE 1Y9QA 3K3NA 5A6ZA 1W05A 4IEOA 2VULA 5GALA 3PMEA 5CISA 4XTPA 2DVBA 2OA2A 2WNVB 4NAMA 4ZU5A 3EB7A 1L7RA 3USUB 3RPQA 1S0DA 4BK5A 4AEKA 1OT5A 3WZ1A 3GZUC 1CJDA 2D97A 2ZACA 2WZEA 3BOPA 3GCXA 4Q4W1 4QPGC 1K5MB 2ZEWA 5FMOS 3O0XA 2TEPA 2ZGOA 1GNYA 4IDZA 4PLNA 3CMGA 3E1F1 1BVP1 1PMJX 1FI2A 3E6DA 5F6KA 5J98B 3ZYRA 4XQWA 5C8CA 3FHAA 4CUCA 4TZDA 1IZ3A 4YRDA 4FOQA 2VZSA 4L11A 5E88A 3M70A 4AI8A 5FP8A 1W2OA 2A5ZA 3U4SA 4C1XA 1F4AA 4FOWA 4IW3A 5KHIA 1RHI1 3AZXA 4ARXA 2J1EA 3C7FA 3PJQA 5FWEA 4WM7C 4XFGA 4HSJA 1Z78A 1UYXA 5A6QA 3FC0A 5FAXA 3T0DA 4MV2A 1R092 4QX8A 3VBOA 3K4ZA 3WXPA 4QD2A 2QQVA 5BNQA 5FK7A 4QPIB 4QXHA 1YNAA 3O7OA 2YDEA 3OUHA 1BZWA 2XJQA 3OYWA 4H2AA 3RYKA 1UYYA 1X7NA 2PAMA 1QEXA 4YVSB 3J7MA 4NR1A 4QKFA 5DAQA 3VD7A 1MS3A 3R0RA 1ENXA 4KU8A 1VR3A 2FDIA 3NW4A 3N7KA 2D93A 1WCKA 1RUD1 1ODMA 3TB0A 4DUVA 3ILRA 1D2QA 1UYPA 1URXA 4QDQA 2A3WA 4FFGA 2ZJCA 4RS5A 4AI2A 3GCWA 3JBG1 4JQRA 3KHBA 4IUGA 3AB0A 1X33A 1W04A 3H50A 4DOUA 4CPBA 1L7LA 2ZGRA 2R16A 3I54A 2XJTA 3MGUA 4JKMA 4RHV1 2BNMA 2Y0IA 2BBAA 4ZXEA 4QU2A 1B09A 4IERA 3GHMA 4BK4A 2JEMA 3LOIA 5CEHA 4CP9A 2P3IA 4Y1YA 2WA4A 5D8AC 2OX0A 5FJHA 3SEPA 5JDBA 1QJZA 3NO8A 2CL2A 2I2SA 4CXWA 4Y1ZA 1JYVA 2DTYA 2F4PA 2RE9A 1V00A 2WNOA 4I0BA 5GLWA 4XURA 3VKOA 1U5XA 5FZMA 4JKLA 1T6GC 2HWD1 4KNCA 5JUVA 3ZLIA 4LEJA 4EN8B 5JZGC 3KSCA 5CA6A 2W1QA 1ASJ3 2XL9A 2OZ6A 4AI1A 4CDQC 1ZBE2 3C7GA 4X6QB 3DKWA 2V5DA 3NNMA 3MPBA 3WDUA 3WVJA 2E51A 1W9FA 4BMEA 3OB8A 3IMMA 4YARA 3WW3A 2IXLA 3LD8A 1WLWA 3HAGA 4NUBA 4N43B 3CIHA 2CGPA 4H55A 1J1TA 1WGPA 1FOD3 3ZFFC 2G19A 4GAZA 4DO0A 3HNBM 4V2WA 5IK5A 5C71A 4LLFA 5LBEA 4HXCA 1IKPA 3RSJA 1XSQA 3ZSJA 4QM9A 5F7UA 3K77A 3GZEA 4XUPA 3JCIA 4RD7A 1K42A 1RJ7A 1KEXA 2JDMA 1W2NA 4ES8A 2HWE1 2VCMA 2Y33A 2BWAA 2GNMA 4G9SB 2DURA 3SCFA 2BRTA 1HJFA 1VAKA 3MIEA 1W6PA 4I02A 3VHRA 3WDTA 3AMPA 1GWMA 3HOBA 4OQ9A 1O5LA 5LA2A 2XH6A 5BNPC 5B4NA 4QX3A 4Q4X2 1LOFA 2PHTA 1IPSA 4KL1A 1EAH1 4CDUC 1V0AA 2XMLA 3HBZA 2VNOA 4E8DA 2VZVA 1XU1A 3VLBB 1QIQA 2EVXA 4N7IA 5I0SA 1D4M2 3WNPA 3KCCA 4FOYA 4CRQA 1PGW2 1ZZBA 5FQ0B 1W2TA 2VGDA 4FPJA 4LOTA 3U78A 1IS5A 2RVAA 5KXCA 1RYYA 1XYPA 4RQPC 5ACA3 4TWTA 5BNOC 5I0DA 4CP9B 4DB5A 1D2SA 4M0HA 3WP3A 2VC9A 5FZ0A 4U2AA 1GWLA 1ZRIA 3ZFGC 4B7EA 1ULEA 2WQ8A 1GKBA 2ZKNA 3AM2A 3ZDVA 2W92A 5JIUA 1X82A 4AI9A 4X8NA 2RMU2 1QKQA 1LECA 1CAXB 4E4HA 3N9OA 1MPXA 4YM1A 4EWEA 1LJ7A 2VMHA 2YROA 1WLTA 2JWPA 3GJAA 4GH4B 4LBKA 5LY1A 5AC93 1RUF2 4RSUA 4DY3A 4JDNA 4CYDA 2QCSB 4NROA 3POSA 3FUQA 3VBFA 1VBC2 3TN92 5I0RA 4COUA 2E9QA 4EROA 3WP6A 5AVPA 5LBBA 1ZRDA 3SEEA 4RL7A 5LCWL 2LS6A 1JZ8A 5FYBA 3ZYGA 5C9AB 3H7JA 2OS2A 1MEC3 3GM8A 5F1RA 2XGXA 3IT8A 1REFA 1GYKA 1YXWA 3E97A 3P3PA 4JC1A 4JGZB 1EV13 4AI3A 3S5AA 2A71A 1W9SA 4UF0A 5KHHA 1XNTA 2LW8A 2MNGA 3KS7A 2WNUC 5IUQA 5T52A 3NNJA 5DUUA 3IBMA 1AYM1 1JTZX 3T08A 5HCFA 1FMD3 3UGFA 2RR12 2JENA 4ZHNA 1NLSA 3VBUC 1GZWB 2AEZA 5CNAA 5JOXA 2CWSA 3PUQA 1RINA 2EXIA 2ZAHA 3PVEA 4QXBA 4HANA 1NQDA 1H1AA 1DYKA 2R0HA 1IPJA 1BCXA 1NQJA 1ZRRA 5FKCA 4PDWC 2ARAA 1YHFA 4C0HA 3BPSA 2W1SA 1QOOA 5EJ1B 2PLV3 3I7DA 4P9YA 1EP0A 3OBAA 3T1MA 1QXPA 3I2JA 4IXLA 5JXHA 3TNQA 3RGBA 2XWJB 1RIRA 4GULA 1ZM1A 1RMU1 4CE8A 3KZ4C 3MFCA 1WMDA 3M3OA 2D6NA 5A7QA 4A4AA 3OBTA 2RS12 1LESA 4KWLA 2QQIA 2ARBA 2ET7A 2OW4A 3X29B 5K0UC 1TMF1 2XJVA 4K6BA 3MFAA 4E2GA 2VU9A 2VAUA 3MPPG 3ATGA 3CDZB 2G9GA 2TUNA 4YYOA 1V9U1 1AR83 4R9BA 2VQ0A 3AMQA 1JXNA 3R4UA 1FNZA 2VPVA 5A1LA 1O3RA 3BTAA 3CJIC 5HV0A 1JI6A 2WBKA 3O1VA 3BYWA 2VZUA 2AEYA 3VBRC 3VBHA 3UKNA 2OIIA 1UL9A 1YFYA 4Q4V1 4IGQA 4AEMA 1RXGA 4Q1RA 2WZR3 4X6RB 2R6QA 1O3TA 3ASIA 2GC1A 2W3JA 3CZUA 1XB9A 2V09A 4Q26A 2WC2A 1H8TA 4ZS3A 5A32A 2VECA 3MYXA 4AGGA 2D3SA 4MUVA 2DVFA 2WWUA 3G7DA 4YW3A 1W3VA 2KD7A 3VDDB 5A7WA 4CA9A 3PHMA 4LIVA 1H4GA 4JGYC 3ZYHA 4Z8BA 3W5NA 5HPOA 4R9AA 4CCEA 1QY4A 1HB2A 4AVVA 1YQ6A 2WO7A 1Q8OA 4N90A 2D7FA 4YZ4A 1F35A 4NPLA 2E31A 1J84A 4IE6A 3WQ0A 2FCUA 3BKZA 1CVNA 1COV2 1N1VA 4AFMA 2VOXA 1Z7S3 1GOFA 3HBKA 5I8YA 5FTTC 5BXXA 2Q8DA 4BQXA 3I59A 4QKNA 5FZLA 1LGNA 4GB33 5BPXA 1UY1A 2MPFA 1NCQA 5FPVA 4K1YA 3AYDA 4C1WA 3B9CA 3KV4A 3KV9A 3WR0A 2JKXA 4FSJA 1AL22 1OFNA 4BB3A 2ENRA 3AKRA 2NPIA 2O8OA 4N8MA 3ZXLA 4HPKB 5FY0A 3O1MA 5FREA 4HLTA 1AX0A 4QPGB 3OD4A 4YGCA 2YBPA 1RUJ2 2OPKA 5F39A 4EV0A 3H3UA 1W28A 1FV2A 1O3SA 5HXMA 4GA9A 1UWWA 3I97A 3RWKX 2WFPA 1OPMA 1UU5A 3VBHB 3B5LB 4HG6B 4Y1UA 4PQQA 1RUI2 5FZ8A 1VAMA 4BIFA 2HKXA 3KGZA 4OI2A 1UNBA 3DXTA 5FYTA 3VGIA 3Q8EA 3O1PA 5FXZA 1VMHA 2VY0A 3KCXA 1C8NA 2QZ3A 4NRMA 2YMZA 5C6CA 1NX9A 1TE1B 2FDGA 1H8TB 5F3IA 1CWPA 5LEKA 1WMXA 4N9IA 4WM7B 3WQ7A 3BU0A 2H6CA 2ZZQA 1H2LA 1BBT3 4A3XA 4META 3BIEA 1OKQA 5A7PA 4MHRA 4DS0A 5I0UA 4AFAA 1L3JA 4EZHA 5E6HA 2GH8A 2MEV3 4ES9A 2N7GA 3NKGA 5H9RA 4YM3A 3RJRA 3RG0A 5FPXA 1TME2 2HBTA 2BNOA 2RDNA 5EYYA 5FYUA 1RL3A 2DVAA 2VZTA 5A6XA 4LBNA 5M0TA 4D0QA 1WW6A 2DF7A 3J7HA 2JDAA 4XCAA 4B3NA 3ZXAC 5C7GA 3DPRC 2RS33 3SC7X 4AVAA 3ELNA 3R4DB 3J9SA 4PLOA 4Q0UA 3WF4A 4N9HA 1WA4A 1EYBA 2WLPA 1AXKA 5FP9A 4DPNA 3OEAA 2XB6C 3I59B 4D6RA 1GSLA 1XNKA 3PIJA 2Y6GA 4CDWC 4FO9A 2HWC3 4PI0A 3VBSA 3OOXA 1HIXA 2XBO3 1PVC3 4J1WA 3WNKA 4QPYA 3SH5A 1YQ2A 2B46X 1I5PA 5LA9A 1SLAA 1QHDA 1A8MA 2Y6LA 2BOIA 4K7JA 5GZEA 4AEJA 3FBYA 4FT8A 2WT0A 1R64A 2TBVA 2X29A 3VDCA 1NXMA 3IZOA 1ASJ1 3LF7A 4Q4Y2 3RZZA 3V0BB 2X09A 1OQ1A 4KH9A 4IEYA 2O8QA 3KM5A 1GANA 1MS8A 1W2UA 1AXYA 5JZGB 2R072 4Q4V2 3NV3A 4Q8LA 5JXGA 5JSPA 5FY5A 2WINB 2CGNA 5ERLA 4CDQB 5A3UA 3NNGA 2A7AA 3BN6A 4COZA 1FOD1 2W52A 4IE0A 1MZ6A 1DQ6A 2ARXA 1LU2A 2ZGNA 3QH7A 3ZXEA 2FCTA 1CZSA 3ZSMA 2AUYA 2HYKA 4P00B 5A3WA 2BVBA 4OYUA 2BERA 5DN2A 3ZFFB 5LBFA 4BYYA 1NE6A 5LA0A 3QBQA 1OOPC 3HQUA 4PIYA 1C3HA 4K8RB 3UT0A 3D8CA 5F8PA 1KD7A 5FPAA 4LO4B 2VD7A 2DCJA 4XQDA 4GKYA 2R49A 3KD4A 1CPMA 4XDQA 2XHNA 4Y22B 3N9LA 1PZ7A 3ZN5A 1XNAA 4XF3A 1R093 4LHLA 5KXBA 5KR7A 5BNPB 3H7YA 4LK7A 1IG0A 1AYN2 2OQ6A 2RDSA 3N36A 5ABJC 5DUWA 3RJ2X 3WNOA 4DY5A 2C26A 3GXUA 2WQZC 4YZ3A 1W6QA 1HV1A 1G9BA 5DAWA 4OULA 4Z1VA 3TEWA 5ACA1 5D2AA 3W9AA 1VBA2 4Q0PA 1AZDA 1YJLA 2VW0A 3ES4A 2ZS6B 1W6MB 3BIWE 2DTWA 4AGVA 3T09A 2BDRA 2H0VA 5J1XA 3OUIA 1A34A 2H0BA 5BNOB 1XQNA 1AR92 4AZZA 1NUKA 5CFDC 2XOMA 4FAGA 1ND3A 3CQOA 1ULGA 4PBPA 5C3RA 1OXCA 2C4XA 1D0HA 3ZFGB 2XUMA 3D82A 5AC91 1S0GA 2Y60A 4YZ2A 4LUKA 3ZFEA 2VMDA 5H9QA 4AVTA 4CXYA 4J6GA 3IDCB 1H8VA 5DXDA 5BYNA 2IXJA 4XQ4A 1WCDJ 3R05A 4Y20A 5JVVA 5A6YA 3PNAA 1E5SA 2PHRA 3U37A 3BGAA 1MEC1 1WMEA 5CKQA 5FYVA 1MS5A 4CEWA 1CPNA 5IVVA 3RI8A 1NLRA 1O5UA 1UPIA 1Y9MA 2R32A 1SPPA 3AYAA 4QHBA 4XZPA 4YFWA 5FBZA 3WCRA 1EV11 1ZBE3 2QFEA 3HD8B 3J7NA 5DAVA 5L7OA 1VBB2 1DGRA 2D40A 3K51A 5ANNA 4DNYA 3CZJA 1FMD1 1C4RA 3UJQA 1ZZ6A 5IAXA 1M4WA 4TLGA 2WNUB 4QQ2A 4COWA 1B35C 2HWB2 2VXJA 1CAUA 2VOKA 3D4KA 3OUJA 4FPHA 1OI6A 3VBUB 4LO7A 1U5ZA 3APBA 4YFZA 1CAVA 3N7MA 2VE1A 3FN9A 3HPNA 5C8WA 2PLV1 1D7PM 5CFCC 5B4XA 5FMCA 3SKJE 3TRSB 3B01A 1F9KA 4PDWB 1JS9A 4WM8A 1WW4A 2QDRA 3AKPA 4JRLA 5J09A 4Y5Z0 3TAYA 2OZJA 3MIDA 3WLUA 4Q4X3 3ZKUA 1UIJA 4QGNA 4YLZA 2GZWA 5BV6A 5HV4A 3H0OA 2R063 2DWRA 2CDOA 2YU1A 3NSTA 1S0FA 3LSDA 2WL1A 3Q8FA 2BFUS 1TZOA 1D4M3 1S1AA 2E63A 4NN0A 1AR81 1OURA 3WG3A 3TEZA 4FP3A 4M00A 5K0UB 2B9VA 1VBE2 1V6KA 2UURA 3JD72 3NWKA 2YGMA 3THCA 3V0AB 2PAEA 1KFXL 4IE5A 4DRRA 4AHXA 2YBSA 1YI9A 3MDPA 3ROUA 4D69A 4Z2WA 3N9MA 1O91A 1K12A 3CJIB 5DZFA 1RUG2 2GMPA 1MVQA 4BQ2A 2WR9A 4CDXC 2WZR1 2YUEA 4E4ZA 4PI2A 1GP6A 2VNGA 5FYIA 2HWF2 4MGZE 3H8RA 1ZX5A 2WNEA 2ZXQA 2W46A 5FYZA 1SMVA 5FZ4A 1NXD1 4XABA 2RMU3 5BNNA 3POBA 5GJ6A 3ST7A 4BH9A 2OQ7A 2ZGTA 1UMHA 2CYFA 5B2GB 1APNA 1RUF3 3UJOA 2UWCA 2W08A 2E53A 5KWRA 4LKSA 4MH0E 1SCSA 4CCDA 4C91A 2JDHA 2ET1A 3TN93 3WDWA 1NG0A 1UU4A 2IVIB 2VQAA 1JMUB 3POIA 5JPMB 1Y7BA 2GDFA 2WNVA 4J1XA 4NJ4A 4DINB 3USUA 1CONA 2AH2A 3IIIA 1BK1A 4IEXA 5FCCA 1CAVB 3VKNA 2EICA 5A3LA 1Z7S1 5GLVA 3FUOA 3MI8A 2UWBA 1SLIA 2D6MA 3ZO0B 2NP0A 1S4CA 3FWEA 1DDLA 1AR63 4DXRA 2Z2SB 1OMIA 2QQOA 4GB31 4URTA 3KHCA 1YIFA 1Q8SA 1KS4A 2RR13 1DZTA 2RDQA 5DG1A 4EN9B 1ZRFA 1WCQA 3N35A 4XAAA 4XEZA 2NN8A 4MXWA 2Q8EA 3WW1A 3LE0A 1OFSA 1FT9A 1MS4A 4QX1A 4NIHA 1QJU2 5ANQA 5FXVA 2DVDA 5JSRA 2A6XA 4A7YA 4BZ4A 1C1LA 4XUOA 4HBNA 4AQSA 1OLMA 2WZPP 5JOYA 4UFLA 2ADDA 4RGGA 1GLHA 4QPIA 1Q3EA 3DKQA 2I07B 4CP0A 3ACHA 4YVSA 4YG6A 3RZLA 2K9ZA 2PHDA 4CCLA 1HXS2 2RS13 5FY4A 1W8HA 1V6LA 1Y4WA 3AVSA 3SCHA 3VDBA 2GNTA 3POFA 1AJKA 2GC3A 1W06A 1OF4A 4H7MA 1G9AA 5HI0A 5AVAA 4NHYA 3RMXA 5CBLA 2BPA2 1DYPA 1MS0A 3CLPA 1RITA 3ES1A 2QQKA 4AAPA 2XJSA 1BBT1 1G8WA 1UX7A 1NCRA 1PGSA 2O0OA 2MEV1 4DEQA 4FVVA 5JXIA 2FD8A 1SBFA 2WWSA 4YVWC 5FZOA 4AVCA 1WW5A 3P1IA 5FY7A 2D43A 4EJRA 3J26N 4Q1PA 4XBLA 1QF3A 4MGTA 2P34A 2ZKLA 4EQVA 1OUXA 5FFOC 1UN1A 1NZCA 2RS31 4GJYA 1AR72 1RUC3 3AL5A 3KT4A 5C3SA 1E57A 1MVEA 1I5ZA 3LIHA 5EYXA 2JE7A 1OLME 5T3NA 3WT3A 4CSWA 5LA1A 3OCPA 2JDZA 4N53C 3LCPA 4FI9A 2VMCA 4IV3C 3B69A 1DLLA 3AYEA 3DPRB 1PVXA 2VJXA 2GNBA 5CZKA 5ABJA 2HWC1 5LASA 2XBO1 2C6SA 1QOSA 4BQ1A 1W6NA 1VE0A 2WLQA 4YW7A 4HONA 4FFFA 4PCRA 2Q8CA 1LOBA 2BEOA 4MXWB 1XYOA 2BZDA 2HEVF 3ACGA 4TYSA 1OH3A 1LTEA 4CDWB 1RUE2 5CB7A 2Y0OA 5LEJA 4FQ4A 1COV3 3OY8A 4N43A 4FPLA 4RR3A 3D5OA 3SMHA 1H2MA 2QTWB 3CJXA 2XLAA 4JAAA 3ZXGA 3WF1A 2P2KA 4XDPA 1AVBA 4QMAA 4IV1C 5GM0A 4IE4A 4Q0QA 4W4ZA 4OFGA 3WF3A 1QJFA 2XHKA 4CP1A 1GFF2 2RM22 1QJX2 2WAAA 3OJBA 5FZIA 3JBG2 3MV01 4M3CB 4EN0A 4GD4A 1XPWA 1UOJA 2DBIA 1H9WA 3KWVA 2Y6HA 3C7HA 1S0JA 2VUDA 3PUIA 4QU1A 5FZCA 2RDRA 2JG9C 3AYCA 3WD5A 3PTRB 4LXLA 3IPVB 1HB1A 3BPZA 1UZZA 3QLQA 1RUJ3 3DUIA 4A7ZA 3LIGA 1NCRB 5F9TA 4D6SA 5FQ0A 1SFYA 5IK8A 2Q5TA 1BKZA 4I0WB 5FZOB 1RUI3 4EN7B 1N3OA 4ZZ8A 4ORFA 5FO9B 1OOPB 2YPJA 3MZHA 4GWIA 2HWD2 3W5MA 3O1UA 1QJY3 1PIV3 1LEMA 4AWDA 1R091 2PFWA 2YBKA 4PJYA 3AJYA 4OZXA 3VN4A 1PX3A 2WN2A 4NHLA 4XACA 3THDA 1Q8VA 2BYVE 3ENRA 4NIDA 2A6VA 2OUJA 1WZXA 4L92A 3ITQA 5A33B 1J59A 2EF6A 4NE9A 4W6WA 4BQ4A 2DU1A 4P9XA 4Q0VA 5ABJB 3WG2A 4D3WA 1ZZCA 1CAXA 1DQ4A 5JR7B 1TME3 2FCVA 3TBDA 1W6NB 4S2GA 1RB8G 4GH4A 4CUGA 2WS92 2GN7A 3KF3A 2HJIA 4HT1T 2NM1A 4XHBA 4JX0A 4OZOA 2IXKA 1G9FA 3HT1A 3PDQA 5T5LA 1SG3A 2O1QA 3OY8B 4BISA 4RR3B 3LEIA 5FR3A 2W68A 2PHXA 5CKNA 1K3IA 3T0BA 3FZ3A 1VBD3 4PIXA 4IQPA 5C9AA 1O7FA 3SXWA 1SBDA 5AFBA 1NZIA 5CFDB 4XF4A 3ZIWA 2ZX2A 2YZ4A 1MS9A 3M8LA 5JCTA 1W8ZA 1GNHA 2YHJA 4JGZA 1XOYA 4WVVA 2GAUA 3PL0A 3N3HA 4UFHA 4OCTA 5LATA 5L9RA 2VMFA 1YQCA 1ZBA3 1U12A 1W03A 1ALYA 2ZGQA 5DPNA 1GZWA 4UOJA 3ZR6A 4R4XA 2ZHNA 3OPTA 4Q4Y3 3S7EA 5CADA 3I8TA 1ZBE1 3AP6A 4KI5M 3GZAA 3WDXA 1ZZ9A 1Y9GA 2V72A 1XNCA 4YG0A 1UAIA 1YI7A 2GP5A 2R073 4XBQA 3ACIA 1J83A 1MQTC 3KCYA 3UETA 2NQYA 3HN3A 5FO8B 1TEIA 3W20A 4OQ8A 1W9TA 5JAXA 2D3RA 2RHPA 1GP5A 2JE9A 5FO7B 4BQYA 2A6YA 5FOBB 2ZGKA 5F3EA 3ZXDA 3RNSA 4W50A 2Z4FA 3NVCA 1UY4A 3I2HA 1PM4A 3I3EA 4W8JA 2B7YA 4KG0A 1B35B 2R7EB 3NV4A 2EAAA 4AEDA 3WQBA 3VKLA 3LDBA 1XU2A 4BOWA 3KQ4B 3GBWA 1BMV1 3TWIA 1SBEA 4GWJA 1K45A 5GZGA 3O1TA 2VQTA 1IQAA 3CBNA 3H1WA 1PO12 1RVF2 3HWJA 4Q4X1 4WVZA 5CFCB 2WSVA 2R061 5DUXA 1W90A 1CZTA 3W59A 4XXAA 1UMZA 2PHUA 4LBMA 4NO4A 5KC5A 4AFBA 1D4M1 4AXOA 1V6MA 1PGW1 4FPYA 4LBOA 2B39A 1HV0A 2ADEA 2BV4A 1GP4A 2GMMA 3OGRA 2X8KA 2FDJA 1JU4A 1O8PA 1AYM2 1OQEA 1NLQA 1F8VA 1LGBA 3URFA 1GNZA 3VZNA 2W94A 4ZU4A 3POEA 2VUCA 1VBA3 1VRH2 3ZR5A 3VD4A 5E1RA 5IT6A 2ZHMA 4IESA 3VDDA 1UZYA 4I0AA 1QH6A 1VB4A 1DF0A 2OXBA 2Z79A 3OPWA 4JDOA 3HT2A 3WY6A 3VD9A 2R1BA 1HX6A 1AL0G 1DQ5A 3I2DA 5JMCA 4BU2A 1BEV2 1BHGA 1O4TA 1ULPA 1VB2A 2C0ZA 3AZZA 2RMU1 3CO2A 4CDXB 4NMIA 4LBQD 5H9PA 5JI7A 1L7QA 3JB4C 5FXXA 1GZCA 1LCLA 1Q8PA 3JU9A 3MIGA 3OGSA 5HCAA 3VHNA 2D98A 1RUF1 1HRI2 5EWSA 4DUWA 4XJWA 3E6BA 1ODNA 5F5CA 3TN91 4IEPA 3ZYJB 1O4ZA 1OA4A 5F37A 4LTAA 2GC0A 4XZUG 3UNPA 3DYMA 4B8EA 5JIAA 1GOHA 4YW5A 1EY2A 2DCZA 4AVSA 3VKFC 4MGYE 4LULA 4XJUA 1NOVA 3NJXA 1OLQA 3NMBA 2AYHA 3WHTA 1NA1C 2C9AA 1S0BA 1ENQA 4AEDB 1AR61 2VO5A 4CEYC 1JYXA 1VBB3 1NAEA 1PK6C 3JUUA 2BUKA 4HPKA 5F32A 1I6XA 4W65A 3WNLA 4TXWA 4QPGA 1J3QA 1D0GA 2RR11 2EALA 3O0VA 5FRAA 4E8CA 3NJZA 1POV3 2XXZA 1OD3A 3LPFA 1DIWA 1U5YA 2SBAA 4BQ5A 2J1RA 3HVDA 4MXVA 3WHUA 3JZVA 1YCIA 4CU8A 4NOTA 5EFUA 2EIDA 1DZQA 4XJAA 2AC1A 2A3YA 4I2OA 1GWKA 4CUAA 5DDJ3 3AZWA 1VMJA 4BQ3A 2CTVA 2QQUA 3I2FA 3D3AA 4GALA 5JSOA 4XVHA 3K3OA 4ZONA 3H8XA 5FP3A 1DLCA 3H1MA 1C5HA 1ND2C 1HQLA 4ISQA 4A6OA 2QQWA 4QDRA 4UYBA 4WM7A 5FOJB 1S2EA 1YFWA 2ERFA 5I91A 1UW8A 1PGL1 5LRSA 3WF0A 3I2IA 3GYDA 1JH5A 2RS11 3AKTA 1MZ5A 4I3PA 5A1AA 3B02A 2BQPA 1SZBA 2OPWA 2X53S 4Z07A 1WD4A 3LB9A 4P9LA 5GZFA 4YZ5A 2R043 1BLZA 1W9WA 3GZTB 2PQSA 4DRVA 1CESA 5J3UA 3QH6A 2VBDA 3JD73 1FAYA 1ULCA 2VH9A 3A22A 1PNGA 4WVMB 2AACA 1RC6A 4AL9A 2J1AA 3E5XA 3LOBA 5FPBA 2EXKA 3U14A 4O65A 1WD3A 2DCTA 5IJRA 2W2IA 3SKVA 4XE9A 4XC9A 1XSRA 3EJKA 3BUCA 3K4DA 4B4RA 3A23A 3WUDA 3NAPC 2VOVA 4I09A 4K21A 2WN3A 1RUC1 2JG8C 4QGLA 4LNVA 4LKEA 4Y1VA 4YVWB 1PX4A 4ATEA 4FTEA 2ZX1A 1HN0A 1UZVA 4NHKA 3FX3A 5H9SA 3RZKA 3ILNA 2A70A 5C3PA 2ZA9A 5D8AA 2GALA 3LEKA 2UYBA 2JIGA 1F4HA 2X5IC 4DFSA 1JZ2A 3TEYA 2ZTNA 2ZMKA 5FY8A 1LRHA 2E33A 3EHKA 5D21A 5DAPA 5GZCA 1R083 4I01A 1PZ8A 3V0BA 1JU3A 5T5OA 3IB3A 5T5JA 5JZGA 3RMYA 1UF2C 5KXEA 4B4QA 4W6XA 2CNAA 2EA7A 1BVVA 2P6HA 4ITCA 4CDQA 1UPSA 1COV1 2V4AA 1KQRA 1V6IA 3J8F2 2J22A 1WLCA 2Y26A 4WZFA 4PQ9A 4O7XA 3K2OA 1S2BA 1OA3A 3U10A 4E2QA 1VJ2A 1LOAA 3WX5A 3ZFFA 1DP0A 2VOTA 1J1LA 1CQ9A 2Q8OA 2WJSA 4CCMA 2BGCA 4JHZA 5SV8A 2ZBJA 2CAUA 1OA2A 2A75A 4MYEA 3ZM8A 5IFPA 4Y4YA 1LODA 4IV1B 4OI1A 3RFRA 5F2SA 1FNYA 2BW8A 3KT7A 2XLGA 1A6CA 4MO3M 1X8MA 3DGTA 2FZ2A 3UK9A 5T5PA 2QBXA 1QJU3 2VCAA 4NHXA 1QJEA 4YG3A 3VB9A 1YWKA 2C1FA 3E5QA 1F2NA 5AFEA 4Y22A 3ZYFA 3PUAA 1XRUA 3RZJA 3JXSA 1RUJ1 4GZ9A 2PMWB 5BNPA 1SCRA 3AFKA 1JZ3A 3U0ZA 1REEA 1OLRA 2ZCWA 5C4WC 4LORA 2JG9B 5KHJA 3FLRA 4CDUA 2JDYA 1HJGA 1RUI1 2WYFA 1N1TA 2YC0A 3POGA 4AVBA 1HXS3 3B00A 4XF1A 3FJSA 3MV11 3S6PA 3ZDSA 4COVA 1QJY1 2VVDA 1PIV1 1IKQA 2VZ3A 2K2SA 3ILFA 3EMRA 5FIXA 5C5TA 1WKYA 3RZHA 2DU0A 1DGLA 2QJVA 2R1DA 2D5HA 3ALQA 1W6MA 1CD3G 4RQPA 1F5JA 1K5MC 5BNOA 1ZA4A 1XBFA 1TVGA 2AENA 1ZZ8A 4QGMA 1MZEA 5D8AB 4AW7A 4A2UA 5JI9A 4GKXA 1NY72 1JZ6A 3A4UA 1LOGA 4Z2AA 2VUAA 3GJBA 4JRAA 2ID4A 5C3OA 1K5JA 1TME1 3MIHA 3L2HA 3MW2A 3ZFGA 4FBFA 2ZX3A 1TG7A 3NRUA 1DQ1A 1PMIA 2IFWA 1HN1A 3F95A 2UY9A 1ZZ7A 1AR73 1FPN2 1XNBA 1HRV2 1JOJA 1I9RA 4KGQA 4QDSA 2LRPA 3SNMA 3R4SA 3TNPB 1RUH2 4P14A 1IS6A 1VBD1 3K46A 2VCBA 3C8XA 4Y26A 1H1MA 4HK8A 5A70A 3I2OA 1QQP2 4JQTA 1KGYA 3POYA 4IGPA 4NIIA 4DXTA 5F3CA 4XDOA 2Y6KA 1W8WA 4BXSV 1ZBA1 2WIIB 4LKDA 4CPBD 1RUE3 1SLCA 1N1SA 3PJYA 4XCBA 4KQ7A 4A44A 2P37A 3WSOA 5IK4A 3AMHA 3U4XA 2MHFA 1G7YA 1LHUA 2WNUA 2XJUA 4JVAA 3PUSA 2JDNA 4Q4Y1 5CU1A 3B3QE 4YM0A 5ISLA 2QQMA 3DN7A 3VBUA 2AREA 1LU1A 2Q30A 2QUOA 1HLCA 3ABZA 2R071 3RVHA 1WMFA 4EWDA 2RM23 1QJX3 4ZPIA 2VTXA 3MLJA 5DG2A 2YYOA 4CDUB 4B7KA 1UCXA 1O4YA 4P02B 5J37A 2BWCA 1W8FA 2FBEA 4Y3OA 5FZBA 4PDWA 3WG4A 2YFZA 4LHKA 1RTVA 5LB6A 5HCHA 1I3HA 4QHOA 4HVRA 2ZEYA 2IZWA 1MQTB 1ZVFA 5KHGA 2XVLA 2ZGPA 3BTZA 3T4VA 1ONAA 4P9IA 1LHOA 3O0WA 4RQPB 3SITA 4SBVA 4OVEA 1JODA 3QD6A 3S30A 5C8CC 1YQ8A 4D94A 2VR4A 3WNNA 3PUHA 5L36A 2JXAA 2W47A 5K0UA 4Q5OA 1HQNA 3IWZA 3V0AA 1AF9A 4C90A 4RN5A 2RV9A 3RS6A 2ARCA 4XIKA 4Z82A 1KITA 5L19A 3CJIA 2DFBA 2EIEA 5FXWA 5EJ3A 2WFF2 3VBRA 4S2DA 3VDAA 2VTFA 4FAHA 2JD9A 2P3JA 3VBOC 3Q9OA 2TNFA 1C57A 1RXFA 3UKVA 3Q8AA 1RUOA 1Q5OA 1C28A 1AR62 5JMOA 4BA6A 3L2YA 4L9BA 3P6BA 1VBA1 2QQJA 3CU7A 5A7NA 5KHKA 5LK7B 3WUCA 3FL7A 3ZN6A 2WS93 4XHXA 1JBCA 1YLLA 2A3XA 4XXPA 5FKBA 3ZXJA 1Z0HA 5LBCA 2ZZJA 5FZEA 1S55A 5T55A 1U5IA 1PHMA 2D3PA 4KWJA 5GKAC 4LHNA 4JGYA 4RS5C 1DG6A 2G4IA 3H42B 4XUNA 2VNRA 1LENA 4XPVA 1Q56A 4ZU7A 1LHWA 1M06G 2JB4A 3RWNA 2OYZA 4E9KA 1GQHA 3ZIXA 4BLJA 5CIRA 4N7UA 4FXGB 4QX5A 2Q0AA 2RS52 2W5FA 4YGEA 3E6CC 2A73B 4PT6A 5FZKA 4F8AA 1AR82 1O6UA 1JYNA 2AZ5A 1YQ5A 4Q8KA 2QDNA 4QQPA 1F31A 1PZ9A 1RGSA 3FHIB 3OGVA 3ZYPA 5FZAA 2PELA 1YJKA 2FQPA 1VBB1 1W8TA 4XMIA 1UZWA 1C8M2 4TTGA 4G4FA 3ON7A 2WZR2 1SDWA 1JZ7A 4JDMA 4ZY9A 1POV1 1NA1B 5FYYA 3KV5A 2VNVA 4CEYB 2HEWF 5J48A 1PK6B 4AQ6A 1EUTA 2R30A 3AFGA 1HKDA 2VBPA 1N3PA 1PM7A 5DDJ1 1HDKA 1PMHX 4RGKA 4AK3A 4ZZ5A 3CF6E 3J7LA 1FYUA 1KS5A 1OVPA 3M7AA 5E16A 3VBRB 1OQDA 4OMCA 2WRAA 1EPWA 5L73A 1JYIA 1QDCA 2DBNA 3DXUA 4GQ7A 1PO13 1RVF3 1ND2B 4MADA 3N9QA 3ZN6B 1C1FA 3HJRA 3E5UA 1UMIA 2JB8A 3A7QA 2GN3A 5F5AA 5JWPA 2WWJA 3O1SA 1VBC3 2Y64A 1JYCA 1VAVA 5FUPA 2R041 1LOFC 3M3EA 3PTYA 4GMP3 4JGYB 2Q1FA 4KU7A 3JD71 1LGCA 5IVCA 2XG3A 4HKWA 2CGOA 4UBHA 1US2A 5EPAA 1VMFA 4JZRA 4Y1XA 5EP9A 1VRH3 2XPJA 1MR5A 3C2UA 3DPRA 3KQRA 3AP5A 1GUIA 2F4LA 3I3QA 1H6XA 5HBAA 4K3UA 3N7JA 1OD5A 1X50A 2PHFA 3V65A 2NMNA 3SLIA 1R1A2 1ULDA 2OT7A 3AZYA 3PURA 1BEV3 1NT0A 5FBJA 1S2KA 2ZGMA 5FP4A 1JUHA 3A0NA 4LBQB 1WBLA 2QE3A 1CAWB 2QQNA 4CDWA 2SLIA 3IIAA 3UGGA 3NAPB 4AQTA 2JG8B 3D0SA 1QNYA 2B4KA 3MF6A 2XONA 1HRI3 4OUSA 1PO22 1R081 2BFUL 4JTOA 2ZABA 1AX2A 3IN9A 4LR4A 1I1EA 4P5HA 3GHNA 1ACCA 2X5IB 3O1OA 1W0PA 5EHDA 1YYNA 2F17A 3AX4A 4Y24A 3VBFC 4BPZA 3LA3A 3VZMA 4XJ8A 5IVEA 5TSWA 4FQZA 4M3CA 4IEWA 1JZ4A 3UYJA 5J7MA 2L9LA 2MEV2 3VHPA 3PU3A 4HVQA 2Q1ZB 3KF5A 1YC61 3AK0A 2KA3A 3WINE 1YO8A 4DQAA 3THTA 4A6SA 2OKXA 3IPVA 2D6OX 4QWNA 4LE4A 5FLHA 2CY6A 2JX9A 2V73A 4Q4W2 1UX6A 1QJU1 1CN1A 2QZ2A 4KWKA 2W9XA 4RA0A 3VHOA 1OOPA 1O59A 1QDOA 2JDUA 2KM2A 4XAEA 2BGPA 3NNLA 4NIAA 1SLLA 4BHPA 4D8MA 1S0EA 2HWC2 3IDEA 1JN2P 1IS3A 3MIFA 5A3OA 3TEXA 4YW2A 3LPGA 1WBFA 4UFMA 1EUUA 4LLOA 2YFUA 4HKLA 1UYZA 5A33A 4BLIA 5FUIA 2WO3A 1HXS1 1RHI2 2VW1A 2RJKA 1AHSA 3GBFA 5T50A 1YIPA 2NMOA 2W87A 3IKWA 4HN0A 1PVC1 2YY1A 3NNFA 1FV3A 3OSDA 2W1WA 5L9BA 2WT2A 4COYA 2XJPA 5GZDA 2VOWA 2X05A 3VZJA 3KVBA 3OPZA 1FX5A 1X9TA 3N9NA 4EN6B 5C70A 1LEDA 1JOPA 4XFHA 1IG3A 2B45X 5SV5A 1LKNA 4HN1A 3HNYM 3K75B 3OBRA 2VW2A 1NYWA 1RUD2 1OKOA 2P5BA 4RGAA 4ZS2A 1FXZA 5CFDA 1UKGA 2ZEXA 3R6SA 3H8OA 2P6CA 3VBHC 1RJ8A 3BODA 4OI4A 1D4VB 1HW5A 2HH9A 5G04L 2Z42A 4KMQA 1AR71 2XQRA 4D6QA 3PVNA 5IFTA 4CCOA 2QQPA 2GNDA 3I3MA 1AL23 3LKJA 2GC2A 3AXEA 4IEUA 3ZPYA 2HBUA 3DECA 4FCAA 1W8OA 2ZGLA 4HSLA 4RHV2 4NPRA 4KWUA 4UW3A 1H8TC 1N1YA 4AHWA 1GR3A 5A3NA 2FHRA 3N4MA 3KV6A 1LR5A 2JKBA 5GLUA 2EIBA 1XXNA 1CZVA 4L2NA 1Q8QA 3P3NA 2C9KA 2JD4A 1RUE1 1Q43A 1QXRA 1CR7A 2DV9A 4LJHA 3KLSA 3J8F3 4Y5TA 4R8HA 4IGOA 2ZMLA 1W99A 1YRZA 2J1UA 2VQUA 4IETA 2ES3A 3N7LA 3J4UH 2DCKA 3MHZA 2RM21 1QJX1 3JB8A 4H14A 1B35A 1E5RA 3ZXKA 2PHWA 1Y3TA 5FMOL 1A3KA 3C7EA 5E89A 4K8FA 4MG2A 1W6OA 2VMEA 2YU2A 5CG8A 5FLIA 2NZ9A 2CU5A 3MW4A 4LOSA 3PVBB 4NPMA 1VALA 4XF0A 1NCQC 5I0TA 3LA7A 2FDKA 1JYTA 1R1ZA 2WZ8A 4KBBA 3VKMA 4DIQA 2OVUA 2WQ4A 4GXLA 5FMBA 2P3YA 5CFCA 1FATA 4FPFA 1SDDB 1KDKA 3LDRA 2P1BA 3WP5A 3DF0A 2IWGB 2VL4A 4UW4A 4CP2A 5A3TA 3UESA 5A1FA 2HWE2 4PF1A 3Q8BA 2I74A 1JOBA 2G9FA 2I45A 4O61A 4URAA 1UOFA 4DXSA 1OF3A 1IPKA 4XOGA 5C8CB 1UXXX 3BB6A 3OEBA 1EAH2 4B4PA 3H9AA 4BJ0A 1T2XA 1WCUA 2PA7A 3JQXA 3MUZ1 4LT5A 3AMNA 2IVJA 4S2FA 4YSFA 2XKPA 3AVRA 3MIBA 4LPLA 5F5QA 3W21A 4XJ9A 1POV0 4XTMA 3M1HA 1X36A 2Z69A 3UGHA 4CDXA 4XFAA 1AUYA 4E4SA 1OC1A 1G6NA 1UQXA 5FUNA 1LOEA 2B5HA 3A0KA 1TNRA 3VBOB 4P5YA 2WS91 4K20A 3RZGA 1GICA 1H2KA 4OHWA 5FMDA 5K4LA 4EZ4A 4TN7A 4SLIA 4Q4V3 1US3A 5C33A 1LHVA 4GIQA 1FPN3 2E26A 4QM8A 1HRV3 3OYWB 3EXUA 4LITA 4XETA 4F7ZA 4QX2A 1RUH3 3M2MA 2YC4A 1UXZA 3MUY1 5IVFA 3ZMNA 4Z92B 1BMV2 4P9GA 3AL6A 1NE4A 4CU9A 1QXJA 5FY9A 3ETQA 2BGOA 4UT5A 3AP7A 1H1IA 3B7MA 2V5YA 5FLJA 1QQP3 2LM3A 4UAPA 2R062 4D7TA 5IHRA 4V1PA 4GJZA 4FPEA 4NAOA 4BXFA 4RS5B 4XFFA 5EIYB 2ZGSA 5EQUA 3UKTA 5JLVA 4LIUA 1ZRCA 1W6OB 2PN5A 2YG0A 1F5FA 4GWMA 4Y5SA 1WW7A 2CHHA 4MX3A 3VBSC 5LZ6A 4OHVA 1V70A 4CZSA 4JV4A 4WV8A 3NJVA 4LUMA 2R0FA 3MW3A 4UI9L 4A7KA 4I3GA 4DEVA 2B8MA 2YXSA 4XF9A 1YFXA 5EZWA 1UOGA 3H3LA 5DAXA 2ETEA 3NQHA 1AYN3 1SFNA 5IW0A 1GOGA 2DYCA 3TOJA 3WF2A 1CIWA 1AX1A 3ZKYA 5FPUA 2UWAA 1MZFA 2WUHA 4FFHA 4NRQA 5I8SA 3PLQA 4ET7A 1BXHA 2VZOA 2XVGA 2ZPXA 5A3MA 4ISRA 5IVJA 2A6WA 2VZ1A 3RI9A 1GQGA 2DDUA 3USSA 5IAVA 5FZ6A 3WNXA 1KXGA 4R52A 4YWAA 3D0JA 4LE3A 3T2TA 1BJQA 3GGLA 3HR9A 4A3ZA 3VD3A 1UY0A 3VL8A 1AR93 1PNFA 4UW5A 5C3QA 1UIKA 1A8DA 2WO1A 4GWNA 4AGRA 2VZQA 2BVVA 1JW6A 4IE7A 1UU6A 3OD0A 4G3YC 1DQ0A 3ZSEA 4E27A 2BOJA 3A21A 1PO11 1RVF1 1RMU2 1DU3D 1KJRA 3WCSA 5FWJA 1UKRA 4WVMA 5LK5A 3LEGA 4YGDA 4KGGA 4YM2A 3KGLA 1VBC1 1TMF2 4LBLA 4QXKA 1Y43B 2QVSB 2BBVA 1XE0A 3H8UA 4LMFA 1N47A 2A1XA 1DYOA 2WFF3 2ZAAA 1KFUL 1V9U2 2EXHA 2J1SA 4GMP1 5FP7A 3UL2A 1W6PB 2C24A 1GU3A 2XVKA 4YVWA 3ZSKA 2ZHLA 3IDBB 2H6BA 1H0BA 3T30A 2PYTA 1ZYBA 1VRH1 2P3KA 3LDKA 4YNIA 4BCUA 4HFSA 4EYUA 3U75A 2Y6FA 4C8DA 3Q8CA 3O12A 1GV9A 4N53A 4AAXA 1VIWB 2RJ2A 4IV3A 4LBJA 1BEV1 2E6VA 2J1VA 2WYSA 4INDA 2DFCA 2ZX0A 4XILA 5EV7A 3BOWA 4DZGA 2HWB3 1SQ4A 5FZ7A 3MO4A 4AFCA 1PGL2 1CJPA 1ND3C 4FPKA 1JHNA 2AGSA 2BTVC 1HRI1 4KBZA 3ME2A 5F2WA 2JDKA 2RS53 4QQLA 4WZCA 5F6LB 4AHYA 2K0GA 3ZFEC 1W0NA 1ENRA 3OTFA 3BTXA 4JCKA 4D7SA 1SHWB 4DUXA 4UXAA 1IS4A 2HYXA 3I2KA 2Y34A 3IMNA 3QACA 2DUPA 4YZ1A 1W8NA 4D7YA 2EXJA 4IV1A 3ACFA 3PVOA 2QKDA 2D6KA 4B29A 5LWBA 4QQHA 4MOAA 4E2SA 5IYYA 3FE5A 3VBFB 1DBNA 2J42A 4CEWC 3EQEA 2BJSA 2KR2A 1C8M3 4BDVB 3WP4A 4QX0A 5APAA 1C5IA 1VBE3 1ST8A 3OGJA 1SFPA 2VUJA 1LULA 4QB2A 4AQ2A 5K7PA 3IDAA 1RUC2 4FOVA 4FPGA 5L7OC 3SCGA 4M0NA 4U36A 2JG9A 3QOPA 1KJLA 5IVBA 4FPCA 3DYOA 3HQRA 1RUG3 1IOAA 4MGIE 4UF0B 1ZREA 3RDIA 4MZUA 1UO9A 4CUBA 4I30A 4E4DX 2JECA 2HWF3 3MF9A 1LAJA 2IXIA 1G9DA 2IFRA 4WBBA 4HKOA 1LB2A 1LOCA 3RQ0A 3T0AA 4S2HA 4FP2A 1XE8A 3AP4A 3S5QA 3I3BA 2ZGUA 1S0IA 1DHKB 1XJAA 2CSGA 2WSUA 4M4PA 1E5HA 4L99A 4WM8C 5FYSA 1A78A 4K9SA 2PXJA 4N53B 3ZN4A 4NRPA 4IV3B 1TNFA 1VPHA 2W0XA 4XBNA 2RJLA 2EIGA 4LO6B 3WG1A 3OBZA 1OPOA 3HEIA 4QT6A 3NKTA 2FMDA 1O8SA 3PIGA 5HCBA 4FFIA 4LO8A 1GQPA 2FZ1A 2WA3A 5FZ1A 5G05L 2JIJA 2UYAA 2GP3A 3FMGA 3WW2A 4MLOA 3LWCA 2ORZA 3GBGA 3V64A 1KRIA 3N9PA 4CCNA 5D1IA 5A7SA 3FLPA 4Y33A 4MHUA 2JJ6A 4LKFA 2DUOA 3IAPA 1CX1A 2PHLA 4PHZA 1R1A3 5EJZB 4AYUA 3KB5A 1WA6X 4CCKA 2Q4SA 1HQWA 1QNWA 4OMDA 1AL21 3O14A 4IEVA 3W58A 4C0BA 1LHNA 4CCCA 4XYXA 3HN1A 4JHTA 4PLMA 1WWYA 5DQ0A 3DCQA 5LY2A 3SQOA 3WW4A 2X10A 1REDA 4AE2A 1PO23 2VZRA 2G9ZA 3BALA 5BNNC 5FPLA 2PQQA 1QJY2 1PIV2 4MGSA 1DCSA 4W6YA 2E7TA 1WCSA 4LHSA 2XL7A 3T1LA 2E32A 1IQDC 2Q1MA 4HZFA 3DEMA 5A32B 4CU7A 4QPWA 4F3JA 5CYYA 2VXRA 3ETPA 1WLDA 1J58A 3PU8A 4MGKE 1IGOA 5HXVA 2IC1A 5BY5A 1H30A 5J96B 3J8F1 2ZHKA 3QCWA 1W0OA 5JOWA 4OUMA 2XUEA 5A7WB 3MBWA 2B42B 2WNVC 4YW6A 2PTMA 3T2OA 2WABA 1ASJ2 1MQTA 4XUQA 1HB3A 1STMA 2JE8A 3DYPA 4RYDA 3PMSA 4OHZA 3HNMA 3FBMA 3LFMA 5CAZA 4XW3A 4MGQA 1G9CA 4K1ZA 5JOZA 2W1UA 2VTXJ 2HEYF 4AFDA 3VUOA 1CIYA 4H7LA 1FOD2 4Q4W3 4UWDA 4ARYA 4ZXKA 1VBD2 4BWOA 3I49A 4ASLA 5F5IA 4UW6A 4NWVA 4ASMB 4EE2A 1W9YA 2YV8A 4KG8A 4V2VA 3LA2A 2NYYA 5KBFA 1NCQB 2WKKA 3HIFA 1OUSA 1MACA 3KMHA 2ATFA 1JZ5A 2VM9A 2XJRA 1KDMA 4YPJA 2LUWA 3CKHA 5K9YA 1ZBA2 4RFRB 4L97A 4QB1A 5EXOA 2B9UA 1RHI3 1X9PA 4Q27A 3ZSLA 5CG9A 4UFKA 4QPIC 5KXDA 5FV3A 2QQLA 2XDVA 2XQXA 4QAWA 1HB4A 3RYPA 4YVSC 3KT1A 1DQ2A 1SLBA 2AR6A 4QQOA 3AKQA 3GF6A 1YUDA 1V6JA 3AKSA 1DFQA 4B1LA 3MLKA 1TQ5A 1NY71 4XFCA 5FYMA 1OSGA 2GU9A 4XJZA 2DCYA 5DZGA 4A42A 4K40A 5ACA2 2F6BA 1RUD3 3VZKA 3CNAA 2VCCA 3VV1A 1OHFA 2VMIA 2YB7A 5FZDA 5FDBA 4NIGA 4PF5A 3B94A 1NCRC 3JQWA 3LAGA 1SEFA 5LW9A 4HL0A 3OG2A 1UOBA 2E7QA 2XWBB 1FPN1 4P9JA 2O14A 1HRV1 1W2AX 3HQXA 3JBG3 5CVRA 5DABA 1RUH1 4RFT0 1JHJA 1U0AA 4AHZA 1QU0A 2D44A 2NLRA 2IXCA 2JICA 5DZEA 3RZMA 4RHV3 3FLTA 2EAKA 4BE3A 5E8AA 3F2ZA 5FPZA 1YFUA 1QQP1 5K8SA 3ORJA 2RG4A 5AC92 3M3QA 3S7IA 5DMYA 1AXZA 3ZX7A 5J36A 4YW1A 4AOCA 4L8QA 4QXCA 5BUVA 1VRBA 1G86A 2P17A 2A6ZA 3AJZA 2BU9A 4TSVA 3ZYBA 2KXLA 2IUWA 5FZ9A 4M4RA 4BQWA 3I2GA 3C3VA 5IWFA 4GMP0 4QX7A 1V6OA 5FZHA 2V4VA 3K4AA 4BM8A 1XNDA 1NA1A 4HOOA 4JTNA 3AP9A 4CEYA 3ZPOA 1MEC2 1GMMA 1PK6A 2HWD3 1V6NA 4FPOB 4LA2A 3VBSB 3T3YA 2VMGA 1H4HA 3MEPA 1EV12 3M4FA 5A3PA 1AYN1 4OHXA 4N43C 4RR3C 1UD1A 1GBGA 4ASKA 1WUVA 2VVEA 5C5UA 2IXHA 1J3RA 2Y8KA 4PIZA 4CVUA 3WQ1A 1VLNA 4NWWA 1FMD2 2CAVA 3CHXA 1QMJA 2W39A 2K46A 5FY1A 5FZGA 3WOGA 4HETA 4P08A 4F83A 2FMYA 4P9WA 1H9PA 2ZOEB 2WO2A 3GALA 4LO5B 1ENSA 1ND2A 4OUEA 2J1TA 4UBGA 1JYWA 4CTEA 3U1XA 3IM0A 1UY2A 4QB6A 4Y4RA 3NL1A 4JKKA 3T4HB 1AR91 2P4EA 2PAKA 2PLV2 5I8TA 3HMYA 2HWE3 2WDBA 2ZEZA 3GDBA 3WV6A 3ZYIB 2XLFA 3K48A 2DUQA 4Q0SA 3EBRA 1BYHA 2LROA 3VZOA 1DZRA 1AJOA 3MICA 2Y6JA 5FK8A 3NV2A 4EWAA 1EAH3 1BK0A 2XKOA 4M3CF 3FFZA 3ZVXA 3AXDA 5FYHA 2Z5WA 2WFF1 4PBOA 2ZMNA 3C7OA 2GSYA 3IAQA 2OUHA 3FHQA 3LZZA 3BTYA 3EO6A 3M3IA 3NJYA 3SH3A 3WNMA 3ECQA 4BMBA 4LBQA 5FYCA 1CAWA 1UY3A 3I4IA 3B93A 4HMZA 3NAPA 1W8UA 2BNNA 2Y38A 4H3WA 1J3PA 2JG8A 3V56A 3ZXFA 2JDPA 2D6PA 5DDJ2 4WVWA 5I93A 4FXKB 2LALA 2ORXA 4IEZA 3LQCA 4R9CA 2FDHA 1NKGA 2W95A 2ILMA 2D5FA 3ZMOA 1RUNA 1W6QB 1ULOA 2VG9A 4GH4C 4LK6A 2X5IA 3BVCA 4XFBA 3T2QA 1CGPA 1F15A 2HWB1 1DGRN 5CKMA 1O3QA 2YC2A 2ZX4A 2HLEA 1IHMA 1OVSA 3GNEA 3O5SA 2CDPA 3VD5A 1DGWA 2LTNA 2DVGA 3CL1A 5IATA 5IK7A 5LRRA 2RS51 2W91A 3BCWA 5JR2A 5C9AC 4ZKTB 1ND3B 4AG4A 2R042 1OH4A 3RRDA 2VVFA 3T2PA 3OGGA 1E5IA 2E7AA 4JGZC 4MVTA 1GZTA 5F3GA 4BIOA 2VBBA 1QOTA 1H6YA 1MS1A 3AMMA 3THPA 4Q2FA 3U07A 5KC6A 5FZ3A 3S57A 1N3QA 4O9GA 3L9JT 3ZFEB 1Z7S2 3AC0A 4IEQA 2CWMA 4CU6A 2UY8A 1ULFA 3UV9A 1C8M1 4R4ZA 2J7MA 4Y20B 4OLLA 1XYNA 4DMIA 1BQPA 4GB32 4M01A 1VBE1 4OI0A 1W39A 4XMAA 1AYM3 1EPZA 2WT1A 3DV8A 4HVOA 1ZA7A 4FTSA 1S0CA 4CEWB 4ONUA 4MSVA 4LA3A 3U11A 5GLTA 1SACA 4NHMA 4O9EA 4B1MA 5JPNB 1SPPB 3TYJA 2GH2A 4DXZA 1RUG1 2D6LX 3WDVA 3ZOIA 5L7OB 3SISA 3MLLA 1H2NA 3NV1A 5C4WA 2QNKA 4CCJA 1XC6A 2HWF1 1R082 5IVYA 1SLTA 1P8JA 2YPDA 3LFIA 4XUTA 1QGLA 1RMU3 1CAUB 3LSEA 4Q29A 3VL9A 4AEDC 4OHYA 1OBNA 3AZVA 4TLFA 2FDFA 1GZ9A 4UFJA 4QKBA 3I3DA 3POJA 2UU8A 1K5MA 1TMF3 3G6JB 1LNSA 3SHRA 4X8PA 2C5DA 3M3CA 3BU7A 5FJKA 1V9U3 2VZPA 4WM8B 4FTBA 4XFIA 3BI3A 4IL7A 2CV6A
chains in the Genus database with same CATH topology
1BBT2 3S0MA 1VP6A 5T54A 4HK9A 3FFQA 3H3ZA 3DL3A 1JUIA 1R1A1 1XE7A 3RYRA 3OF1A 3D6EA 2RS32 3VDDC 4NVPA 4AF9A 3VZLA 2GMEA 1QWRA 5GLZA 3ACLA 1QH7A 3WDYA 4YGBA 1ZNPA 1PO21 4R9DA 3H1YA 4YW4A 3POWA 4XIOA 4ATFA 2XBO2 1PVC2 3INAA 5BNNB 5DUVA 1DGWX 4AI0A 3B9IA 2YGLA 3SH4A 5C4WB 3CEWA 3LGRA 1CX4A 1X8EA 4M3CE 1Y9QA 4IEOA 2VULA 5GALA 3PMEA 4XTPA 2DVBA 2OA2A 2WNVB 4ZU5A 3USUB 3RPQA 1S0DA 4AEKA 3WZ1A 3GZUC 1CJDA 2D97A 2ZACA 4Q4W1 3BOPA 4QPGC 1K5MB 5FMOS 3O0XA 2TEPA 2ZGOA 4PLNA 5J98B 5F6KA 1BVP1 3ZYRA 1FI2A 3E6DA 5C8CA 4XQWA 4TZDA 1IZ3A 4YRDA 4FOQA 4L11A 5E88A 3M70A 4AI8A 2A5ZA 4C1XA 4FOWA 5KHIA 1RHI1 3AZXA 3PJQA 4WM7C 4XFGA 4HSJA 1Z78A 3FC0A 5FAXA 4MV2A 1R092 3WXPA 3VBOA 4QD2A 5BNQA 4QPIB 1YNAA 3O7OA 2YDEA 1BZWA 2XJQA 3OYWA 3RYKA 1X7NA 2PAMA 4YVSB 4NR1A 1MS3A 3R0RA 1ENXA 4KU8A 1VR3A 3NW4A 3N7KA 2D93A 1WCKA 1RUD1 3TB0A 3ILRA 1D2QA 1URXA 2A3WA 2ZJCA 4RS5A 4AI2A 3JBG1 4JQRA 3AB0A 1X33A 3H50A 4DOUA 2ZGRA 2R16A 3I54A 2XJTA 3MGUA 4RHV1 2BNMA 2Y0IA 4QU2A 1B09A 4IERA 3GHMA 2JEMA 3LOIA 2P3IA 4Y1YA 2WA4A 5D8AC 5JDBA 1QJZA 3NO8A 2CL2A 2I2SA 4Y1ZA 2DTYA 2F4PA 2RE9A 1V00A 4I0BA 5GLWA 3VKOA 1U5XA 4KNCA 1T6GC 2HWD1 5JZGC 4LEJA 4EN8B 3KSCA 5CA6A 2XL9A 1ASJ3 2OZ6A 4AI1A 4CDQC 1ZBE2 4X6QB 3DKWA 3WDUA 3MPBA 3WVJA 2E51A 4BMEA 4YARA 3WW3A 2IXLA 1WLWA 3HAGA 4N43B 2CGPA 4H55A 1J1TA 1WGPA 1FOD3 3ZFFC 5IK5A 4LLFA 3RSJA 1IKPA 3ZSJA 4QM9A 3JCIA 4RD7A 1RJ7A 4ES8A 2HWE1 2BWAA 2GNMA 4G9SB 2DURA 3SCFA 3MIEA 1VAKA 4I02A 1W6PA 3VHRA 1ZRFA 3WDTA 3AMPA 1O5LA 5BNPC 2XH6A 4Q4X2 1LOFA 2PHTA 4KL1A 1EAH1 4CDUC 3HBZA 2VNOA 1XU1A 3VLBB 2EVXA 4N7IA 5I0SA 1D4M2 3KCCA 4FOYA 4CRQA 1PGW2 1ZZBA 5FQ0B 2VGDA 4FPJA 1IS5A 5KXCA 1XYPA 4RQPC 5ACA3 4TWTA 5BNOC 4DB5A 1D2SA 4M0HA 3WP3A 4U2AA 3ZFGC 4B7EA 1ULEA 1GKBA 2ZKNA 3AM2A 5JIUA 1X82A 4X8NA 2RMU2 1QKQA 1LECA 1CAXB 4EWEA 4YM1A 1LJ7A 2VMHA 2YROA 1WLTA 4GH4B 4LBKA 5AC93 1RUF2 4RSUA 4DY3A 4JDNA 4CYDA 2QCSB 3POSA 3FUQA 3VBFA 1VBC2 3TN92 5I0RA 4COUA 2E9QA 4EROA 3WP6A 5AVPA 1ZRDA 4RL7A 3ZYGA 5C9AB 3H7JA 1MEC3 5F1RA 2XGXA 3IT8A 1REFA 1GYKA 1YXWA 3E97A 3P3PA 4JC1A 4JGZB 1EV13 4AI3A 2A71A 5KHHA 2MNGA 3KS7A 5IUQA 2WNUC 5T52A 5DUUA 3IBMA 1AYM1 1JTZX 5HCFA 1FMD3 2RR12 2JENA 1NLSA 3VBUC 1GZWB 5CNAA 5JOXA 2CWSA 1RINA 2EXIA 2ZAHA 3PVEA 4HANA 1NQDA 1H1AA 1DYKA 2R0HA 1IPJA 1BCXA 1NQJA 1ZRRA 4PDWC 4C0HA 1YHFA 1QOOA 2PLV3 3I7DA 4P9YA 1EP0A 3T1MA 1QXPA 4IXLA 3TNQA 2XWJB 1RIRA 4GULA 1ZM1A 1RMU1 3KZ4C 3MFCA 1WMDA 3M3OA 2D6NA 3OBTA 2RS12 1LESA 4KWLA 3X29B 2ARBA 2ET7A 2OW4A 5K0UC 1TMF1 2XJVA 4K6BA 3MFAA 4E2GA 2VU9A 3MPPG 3ATGA 2G9GA 2TUNA 4YYOA 1V9U1 1AR83 4R9BA 2VQ0A 3AMQA 1JXNA 3R4UA 1FNZA 2VPVA 1O3RA 3BTAA 3CJIC 3VBRC 3VBHA 3UKNA 2OIIA 1UL9A 1YFYA 4AEMA 4Q1RA 2WZR3 4X6RB 2R6QA 1O3TA 3ASIA 2GC1A 2V09A 4Q26A 2WC2A 1H8TA 5A32A 2VECA 3MYXA 4AGGA 2D3SA 4MUVA 2DVFA 3G7DA 4YW3A 3VDDB 3PHMA 1H4GA 4JGYC 4Z8BA 4R9AA 1QY4A 4AVVA 1Q8OA 4N90A 2D7FA 4YZ4A 3WQ0A 1CVNA 1COV2 1N1VA 4AFMA 2VOXA 1Z7S3 5I8YA 5FTTC 5BXXA 3I59A 1LGNA 4GB33 5BPXA 2MPFA 1NCQA 4K1YA 3AYDA 4C1WA 3B9CA 3WR0A 4FSJA 1AL22 1OFNA 2ENRA 3AKRA 2NPIA 2O8OA 3ZXLA 4HPKB 5FREA 4HLTA 1AX0A 4QPGB 3OD4A 4YGCA 1RUJ2 2OPKA 4EV0A 3H3UA 1O3SA 1FV2A 4GA9A 2WFPA 1OPMA 1UU5A 3VBHB 3B5LB 4Y1UA 1RUI2 1VAMA 4BIFA 2HKXA 3KGZA 4OI2A 3VGIA 3KCXA 2VY0A 1C8NA 2QZ3A 2YMZA 5C6CA 1TE1B 1H8TB 5LEKA 4WM7B 4N9IA 3WQ7A 2H6CA 2ZZQA 1H2LA 1BBT3 4A3XA 4META 1OKQA 4DS0A 5I0UA 4AFAA 1L3JA 2GH8A 2MEV3 4ES9A 2N7GA 3NKGA 5H9RA 4YM3A 3RJRA 3RG0A 5FPXA 1TME2 5EYYA 2BNOA 5JWPA 1RL3A 2DVAA 4LBNA 1WW6A 2DF7A 4B3NA 3ZXAC 3DPRC 2RS33 4AVAA 3ELNA 3R4DB 3J9SA 4PLOA 4Q0UA 4N9HA 1WA4A 1EYBA 2WLPA 1AXKA 4DPNA 2XB6C 3I59B 1GSLA 1XNKA 4CDWC 4FO9A 2HWC3 3VBSA 4J1WA 1HIXA 2XBO3 1PVC3 4QPYA 3SH5A 2B46X 1SLAA 1QHDA 1A8MA 4K7JA 5GZEA 4AEJA 3FBYA 4FT8A 2WT0A 2TBVA 2X29A 1NXMA 1ASJ1 4Q4Y2 3RZZA 3V0BB 1OQ1A 4KH9A 4IEYA 2O8QA 3KM5A 1GANA 1MS8A 1W2UA 1AXYA 5JZGB 2R072 4Q4V2 3NV3A 4Q8LA 5JSPA 2WINB 2CGNA 4CDQB 2A7AA 4COZA 1FOD1 2W52A 1MZ6A 1DQ6A 2ARXA 1LU2A 2ZGNA 3QH7A 3ZXEA 3ZSMA 2AUYA 2HYKA 2BVBA 3ZFFB 4BYYA 1NE6A 3QBQA 1OOPC 4PIYA 1C3HA 3D8CA 1KD7A 4LO4B 2DCJA 4XQDA 4GKYA 2R49A 3KD4A 1CPMA 4XDQA 4Y22B 1PZ7A 3ZN5A 4XF3A 1R093 4LHLA 5KXBA 5BNPB 3H7YA 3N36A 1AYN2 5ABJC 5DUWA 3RJ2X 4DY5A 2WQZC 4YZ3A 1W6QA 1HV1A 1G9BA 4OULA 4Z1VA 5ACA1 3W9AA 1VBA2 4Q0PA 1AZDA 1YJLA 2VW0A 3ES4A 2ZS6B 1W6MB 3BIWE 2DTWA 4AGVA 2H0VA 2H0BA 5BNOB 1XQNA 1AR92 5CFDC 4FAGA 1ND3A 1ULGA 4PBPA 1D0HA 3ZFGB 2XUMA 3D82A 5AC91 1S0GA 4YZ2A 4LUKA 3ZFEA 5H9QA 4AVTA 4J6GA 3IDCB 1H8VA 5DXDA 5BYNA 2IXJA 4XQ4A 1WCDJ 3R05A 4Y20A 5JVVA 3PNAA 2PHRA 1MEC1 1WMEA 4CEWA 1MS5A 1CPNA 3RI8A 1NLRA 1O5UA 1UPIA 2R32A 3AYAA 4XZPA 4QHBA 4YFWA 5FBZA 3WCRA 1EV11 1ZBE3 2QFEA 3HD8B 5L7OA 1VBB2 1DGRA 2D40A 3K51A 4DNYA 1FMD1 1C4RA 3UJQA 1ZZ6A 1M4WA 2WNUB 4QQ2A 4COWA 1B35C 2HWB2 1CAUA 2VOKA 3D4KA 4FPHA 1OI6A 3VBUB 4LO7A 1U5ZA 3APBA 4YFZA 1CAVA 3N7MA 5C8WA 2PLV1 5CFCC 3TRSB 3B01A 1F9KA 4PDWB 4WM8A 1WW4A 2QDRA 3AKPA 4JRLA 5J09A 4Y5Z0 2OZJA 3MIDA 3WLUA 4Q4X3 1UIJA 4QGNA 4YLZA 2GZWA 5BV6A 3H0OA 2R063 2DWRA 3NSTA 1S0FA 3LSDA 2WL1A 2BFUS 1D4M3 1S1AA 2E63A 4NN0A 1AR81 3WG3A 4FP3A 4M00A 5K0UB 1VBE2 1V6KA 2UURA 3JD72 3NWKA 2YGMA 3V0AB 2PAEA 1KFXL 4DRRA 4AHXA 1YI9A 3MDPA 3ROUA 4D69A 4Z2WA 1O91A 3CJIB 5DZFA 1RUG2 2GMPA 1MVQA 4CDXC 4E4ZA 2WZR1 2YUEA 2VNGA 2HWF2 4MGZE 1ZX5A 2WNEA 1SMVA 1NXD1 2RMU3 5BNNA 5GJ6A 3ST7A 4BH9A 2ZGTA 2CYFA 5B2GB 1APNA 1RUF3 3UJOA 2UWCA 2W08A 2E53A 5KWRA 4MH0E 1SCSA 4C91A 2ET1A 3TN93 3WDWA 1NG0A 1UU4A 2VQAA 5JPMB 1Y7BA 2GDFA 2WNVA 4J1XA 4DINB 3USUA 1CONA 2AH2A 4IEXA 1BK1A 5FCCA 1CAVB 3VKNA 5A3LA 1Z7S1 5GLVA 3FUOA 3MI8A 2UWBA 1SLIA 2D6MA 3ZO0B 2NP0A 3FWEA 1DDLA 1AR63 2Z2SB 1OMIA 4GB31 4URTA 1YIFA 1Q8SA 1KS4A 2RR13 1DZTA 5DG1A 4EN9B 3N35A 4XEZA 2NN8A 4MXWA 3WW1A 1OFSA 1FT9A 1MS4A 1QJU2 2DVDA 5JSRA 2A6XA 4A7YA 4BZ4A 1C1LA 4HBNA 4AQSA 2WZPP 5JOYA 4RGGA 1GLHA 4QPIA 1Q3EA 2I07B 4CP0A 4YVSA 4YG6A 2K9ZA 2PHDA 1HXS2 2RS13 1V6LA 3SCHA 2GNTA 1AJKA 2GC3A 1G9AA 4H7MA 5HI0A 5AVAA 3RMXA 5CBLA 2BPA2 1DYPA 1MS0A 3CLPA 1RITA 3ES1A 2XJSA 1BBT1 1G8WA 1NCRA 1PGSA 2O0OA 2MEV1 4FVVA 1SBFA 2WWSA 4YVWC 4AVCA 1WW5A 4EJRA 2D43A 3J26N 4Q1PA 4XBLA 1QF3A 2P34A 2ZKLA 5FFOC 1UN1A 1NZCA 2RS31 1AR72 1RUC3 3KT4A 1E57A 1MVEA 1I5ZA 5EYXA 5T3NA 2JE7A 3WT3A 3OCPA 2JDZA 4N53C 3LCPA 4IV3C 3B69A 1DLLA 3AYEA 3DPRB 1PVXA 2GNBA 5ABJA 2HWC1 2XBO1 1QOSA 4BQ1A 1W6NA 2WLQA 4PCRA 1LOBA 2BEOA 4MXWB 1XYOA 2HEVF 4TYSA 4CDWB 1LTEA 1RUE2 5CB7A 2Y0OA 5LEJA 4FQ4A 1COV3 3OY8A 4N43A 4FPLA 4RR3A 3D5OA 3SMHA 1H2MA 3CJXA 2XLAA 4JAAA 3ZXGA 2P2KA 1AVBA 4QMAA 4IV1C 5GM0A 4CP1A 4Q0QA 4OFGA 2XHKA 1GFF2 2RM22 1QJX2 3OJBA 3JBG2 4M3CB 4EN0A 1H9WA 1S0JA 2JG9C 3AYCA 3WD5A 3IPVB 3BPZA 1UZZA 3QLQA 1RUJ3 3DUIA 4A7ZA 1NCRB 5F9TA 5FQ0A 1SFYA 5IK8A 2Q5TA 1BKZA 4I0WB 1RUI3 4EN7B 1N3OA 4ORFA 5FO9B 1OOPB 2YPJA 3MZHA 2HWD2 1QJY3 1PIV3 1LEMA 4AWDA 1R091 2PFWA 4PJYA 3AJYA 4OZXA 3VN4A 4NHLA 1Q8VA 2BYVE 3ENRA 2A6VA 2OUJA 4L92A 5A33B 1J59A 2EF6A 4W6WA 2DU1A 4P9XA 4Q0VA 5ABJB 3WG2A 4D3WA 1ZZCA 1CAXA 1DQ4A 5JR7B 1TME3 3TBDA 1RB8G 1W6NB 4S2GA 4GH4A 2WS92 2GN7A 2HJIA 4HT1T 2NM1A 4XHBA 2IXKA 1G9FA 3HT1A 5T5LA 3OY8B 2O1QA 4RR3B 2W68A 2PHXA 3FZ3A 1VBD3 4PIXA 4IQPA 5C9AA 1O7FA 3SXWA 1SBDA 5AFBA 5CFDB 4XF4A 3ZIWA 2ZX2A 2YZ4A 1MS9A 3M8LA 5JCTA 4JGZA 1GNHA 2YHJA 4WVVA 2GAUA 3N3HA 1ZBA3 1U12A 1ALYA 2ZGQA 1GZWA 4R4XA 2ZHNA 4Q4Y3 3S7EA 5CADA 3I8TA 1ZBE1 3AP6A 3GZAA 3WDXA 1ZZ9A 1XNCA 4YG0A 1UAIA 1YI7A 2R073 4XBQA 3KCYA 1MQTC 2NQYA 5FO8B 1TEIA 5JAXA 2D3RA 2RHPA 2JE9A 5FO7B 5FOBB 2A6YA 2ZGKA 3ZXDA 3RNSA 3NVCA 2B7YA 4KG0A 1B35B 3NV4A 2EAAA 4AEDA 3VKLA 1XU2A 4BOWA 1BMV1 3GBWA 3TWIA 1SBEA 5GZGA 1IQAA 3HWJA 3H1WA 1PO12 1RVF2 4Q4X1 4WVZA 5CFCB 2WSVA 2R061 5DUXA 3W59A 4XXAA 1UMZA 2PHUA 4LBMA 4NO4A 5KC5A 4AFBA 1D4M1 4AXOA 1V6MA 1PGW1 4FPYA 4LBOA 2B39A 1HV0A 2GMMA 2X8KA 1OQEA 1AYM2 1F8VA 1LGBA 3URFA 1GNZA 3VZNA 4ZU4A 1VBA3 1VRH2 5E1RA 5IT6A 2ZHMA 4IESA 3VDDA 1UZYA 4I0AA 1QH6A 1VB4A 1DF0A 2Z79A 4JDOA 3WY6A 3HT2A 2R1BA 1HX6A 1AL0G 1DQ5A 3I2DA 5JMCA 1BEV2 1O4TA 1VB2A 2C0ZA 3AZZA 3CO2A 2RMU1 4CDXB 4LBQD 5H9PA 5JI7A 3JB4C 1GZCA 1LCLA 1Q8PA 3JU9A 3MIGA 5HCAA 3VHNA 2D98A 1RUF1 1HRI2 5EWSA 4XJWA 3E6BA 3TN91 4IEPA 3ZYJB 1O4ZA 1OA4A 4LTAA 2GC0A 4B8EA 5JIAA 4YW5A 1EY2A 2DCZA 4AVSA 3VKFC 4MGYE 4LULA 4XJUA 1NOVA 1OLQA 2AYHA 3WHTA 1NA1C 2C9AA 1S0BA 1ENQA 4AEDB 1AR61 4CEYC 1VBB3 1PK6C 3JUUA 4HPKA 2BUKA 1I6XA 4W65A 4QPGA 1J3QA 1D0GA 2RR11 2EALA 3O0VA 5FRAA 3NJZA 1POV3 1DIWA 1U5YA 2SBAA 3WHUA 4MXVA 3JZVA 1YCIA 4NOTA 5EFUA 1DZQA 4XJAA 2A3YA 4I2OA 5DDJ3 3AZWA 2CTVA 4GALA 5JSOA 3H1MA 1C5HA 1ND2C 1HQLA 4ISQA 4WM7A 5FOJB 1YFWA 2ERFA 5I91A 1UW8A 1PGL1 3GYDA 1JH5A 2RS11 3AKTA 1MZ5A 4I3PA 3B02A 2BQPA 2X53S 4Z07A 1WD4A 3LB9A 4P9LA 5GZFA 4YZ5A 2R043 3GZTB 4DRVA 5J3UA 1CESA 3QH6A 3JD73 1FAYA 1ULCA 2VH9A 1PNGA 4WVMB 1RC6A 3E5XA 3LOBA 2EXKA 1WD3A 2DCTA 4XE9A 3EJKA 4B4RA 3WUDA 3NAPC 2VOVA 4I09A 4K21A 4LNVA 1RUC1 2JG8C 4QGLA 4YVWB 3WQ1A 4Y1VA 4ATEA 4FTEA 2ZX1A 4NHKA 3FX3A 5H9SA 3ILNA 2A70A 2ZA9A 5D8AA 2GALA 4DFSA 2UYBA 2X5IC 2ZTNA 2ZMKA 5GZCA 1LRHA 3EHKA 1R083 4I01A 1PZ8A 3V0BA 5T5OA 5T5JA 5JZGA 3RMYA 1UF2C 5KXEA 4B4QA 4W6XA 2CNAA 2EA7A 1BVVA 4ITCA 4CDQA 1UPSA 1COV1 1KQRA 1V6IA 3J8F2 1WLCA 2Y26A 4WZFA 4PQ9A 1S2BA 1OA3A 3U10A 4E2QA 1VJ2A 1LOAA 3WX5A 3ZFFA 1J1LA 1CQ9A 2Q8OA 2WJSA 2BGCA 5SV8A 2ZBJA 2CAUA 1OA2A 2A75A 4MYEA 4Y4YA 1LODA 4IV1B 4OI1A 1FNYA 2BW8A 3KT7A 2XLGA 1A6CA 1X8MA 3DGTA 2FZ2A 3UK9A 5T5PA 1QJU3 4YG3A 1YWKA 2C1FA 3E5QA 1F2NA 5AFEA 4Y22A 1XRUA 1RUJ1 5BNPA 1SCRA 3AFKA 3U0ZA 1REEA 1OLRA 2ZCWA 5C4WC 2JG9B 5KHJA 3FLRA 4CDUA 1RUI1 1N1TA 2YC0A 4AVBA 1HXS3 3B00A 4XF1A 3FJSA 3S6PA 3ZDSA 4COVA 1QJY1 2VVDA 1PIV1 1IKQA 3ILFA 2K2SA 2DU0A 1DGLA 2QJVA 2R1DA 2D5HA 3ALQA 1W6MA 1CD3G 4RQPA 1F5JA 1K5MC 5BNOA 1ZA4A 2AENA 1ZZ8A 4QGMA 1MZEA 5D8AB 4AW7A 4A2UA 5JI9A 4GKXA 1NY72 3A4UA 1LOGA 2VUAA 4JRAA 1TME1 3MIHA 3L2HA 3MW2A 3ZFGA 4FBFA 2ZX3A 1DQ1A 1PMIA 2IFWA 2UY9A 1ZZ7A 1AR73 1FPN2 1XNBA 1HRV2 1JOJA 1I9RA 4KGQA 3TNPB 3SNMA 3R4SA 1RUH2 4P14A 1IS6A 1VBD1 4Y26A 1H1MA 4HK8A 1QQP2 3POYA 1ZBA1 2WIIB 1RUE3 1SLCA 1N1SA 3PJYA 4KQ7A 2P37A 5IK4A 3AMHA 3U4XA 2MHFA 1G7YA 1LHUA 2WNUA 2XJUA 4JVAA 5CU1A 4YM0A 4Q4Y1 3B3QE 3DN7A 3VBUA 2AREA 1LU1A 2Q30A 2QUOA 1HLCA 4EWDA 2R071 1WMFA 2RM23 1QJX3 4CDUB 3MLJA 5DG2A 2YYOA 4B7KA 1UCXA 1O4YA 5J37A 2BWCA 2FBEA 3WG4A 4PDWA 4LHKA 1RTVA 1I3HA 4HVRA 2IZWA 1MQTB 1ZVFA 5KHGA 2XVLA 2ZGPA 1ONAA 4P9IA 1LHOA 3O0WA 4RQPB 3SITA 4SBVA 4OVEA 3QD6A 3S30A 5C8CC 4D94A 5L36A 2JXAA 5K0UA 1HQNA 3IWZA 3V0AA 1AF9A 4C90A 3RS6A 4XIKA 4Z82A 1KITA 5L19A 3CJIA 2DFBA 5EJ3A 2WFF2 3VBRA 4S2DA 4FAHA 2P3JA 3VBOC 3Q9OA 2TNFA 1C57A 1RUOA 3UKVA 1Q5OA 1C28A 4BA6A 3L2YA 4L9BA 1VBA1 3CU7A 5KHKA 5LK7B 3WUCA 3ZN6A 2WS93 4XHXA 1JBCA 1YLLA 2A3XA 4XXPA 3ZXJA 1Z0HA 2ZZJA 1S55A 5T55A 1U5IA 1PHMA 2D3PA 4KWJA 5GKAC 4LHNA 4JGYA 4RS5C 1DG6A 2G4IA 2VNRA 1LENA 4XPVA 1Q56A 4ZU7A 1LHWA 1M06G 3RWNA 2OYZA 4E9KA 1GQHA 3ZIXA 4BLJA 5CIRA 4N7UA 4FXGB 4QX5A 2Q0AA 2RS52 4YGEA 3E6CC 2A73B 4F8AA 1AR82 2AZ5A 4Q8KA 2QDNA 4QQPA 1F31A 1PZ9A 1RGSA 3FHIB 3ZYPA 2PELA 1YJKA 2FQPA 1VBB1 4XMIA 1C8M2 4G4FA 2WZR2 1SDWA 4JDMA 1POV1 1NA1B 4CEYB 2HEWF 5J48A 1PK6B 4AQ6A 2R30A 3AFGA 1HKDA 1N3PA 1PM7A 5DDJ1 1HDKA 4AK3A 3CF6E 3M7AA 1FYUA 1KS5A 5E16A 3VBRB 1OQDA 1EPWA 5L73A 1JYIA 1QDCA 4GQ7A 1PO13 1RVF3 1ND2B 3ZN6B 1C1FA 3E5UA 2GN3A 1VBC3 1JYCA 1VAVA 2R041 1LOFC 3M3EA 3PTYA 4GMP3 4JGYB 4KU7A 3JD71 1LGCA 2XG3A 4HKWA 2CGOA 4UBHA 4Y1XA 1VRH3 2XPJA 1MR5A 3C2UA 3DPRA 3KQRA 3AP5A 5HBAA 4K3UA 3N7JA 1OD5A 1X50A 2PHFA 3V65A 2NMNA 3SLIA 1R1A2 1ULDA 3AZYA 1BEV3 1S2KA 2ZGMA 1JUHA 3A0NA 4LBQB 1WBLA 2QE3A 1CAWB 4CDWA 2SLIA 3IIAA 3NAPB 4AQTA 2JG8B 3D0SA 1QNYA 3MF6A 1HRI3 4OUSA 1PO22 1R081 2BFUL 4JTOA 2ZABA 1AX2A 3IN9A 4LR4A 1I1EA 4P5HA 3GHNA 2X5IB 1W0PA 1YYNA 3AX4A 4Y24A 3VBFC 4BPZA 3LA3A 3VZMA 4XJ8A 5TSWA 4FQZA 4M3CA 4IEWA 5J7MA 2MEV2 3VHPA 4HVQA 2Q1ZB 3AK0A 2KA3A 3WINE 1YO8A 4DQAA 3THTA 3IPVA 2D6OX 4LE4A 5FLHA 2CY6A 2JX9A 2V73A 4Q4W2 1UX6A 1QJU1 1CN1A 2QZ2A 4KWKA 4RA0A 3VHOA 1OOPA 1QDOA 2KM2A 1SLLA 4BHPA 1S0EA 2HWC2 3IDEA 1JN2P 1IS3A 3MIFA 4YW2A 1WBFA 4LLOA 4HKLA 4BLIA 5A33A 1HXS1 1RHI2 2VW1A 2RJKA 1AHSA 3GBFA 5T50A 1YIPA 2NMOA 4HN0A 3IKWA 1PVC1 2YY1A 1FV3A 4COYA 2WT2A 2XJPA 5GZDA 2VOWA 3VZJA 3OPZA 1FX5A 4EN6B 1LEDA 4XFHA 2B45X 5SV5A 1LKNA 4HN1A 3OBRA 2VW2A 1NYWA 1RUD2 4RGAA 4ASLA 5CFDA 1FXZA 3R6SA 1UKGA 3VBHC 1RJ8A 3BODA 4OI4A 1D4VB 1HW5A 2Z42A 1AR71 3PVNA 2QQPA 2GNDA 1AL23 3LKJA 2GC2A 3AXEA 4IEUA 3ZPYA 4FCAA 4HSLA 2ZGLA 4RHV2 4NPRA 4UW3A 1H8TC 1N1YA 4AHWA 1GR3A 2FHRA 3N4MA 1LR5A 2JKBA 5GLUA 1XXNA 4L2NA 1Q8QA 3P3NA 2JD4A 1RUE1 1Q43A 1QXRA 1CR7A 2DV9A 3KLSA 3J8F3 4R8HA 2ZMLA 1YRZA 4IETA 2ES3A 3N7LA 3J4UH 2DCKA 2RM21 1QJX1 3JB8A 4H14A 1B35A 3ZXKA 2PHWA 1Y3TA 5FMOL 1A3KA 5E89A 4K8FA 1W6OA 5CG8A 5FLIA 2NZ9A 3MW4A 4XF0A 3PVBB 5I0TA 1VALA 1NCQC 3LA7A 1R1ZA 4KBBA 3VKMA 5CFCA 2OVUA 2WQ4A 4GXLA 1FATA 4FPFA 1KDKA 3WP5A 3DF0A 2IWGB 4UW4A 4CP2A 2HWE2 2I74A 2I45A 2G9FA 1IPKA 4XOGA 5C8CB 3BB6A 1EAH2 4B4PA 3H9AA 2PA7A 3JQXA 4LT5A 3AMNA