2Z79A

High resolution crystal structure of a glycoside hydrolase family 11 xylanase of bacillus subtilis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
b'STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATAGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Crystallographic analysis shows substrate binding at the -3 to +1 active-site subsites and at the surface of glycoside hydrolase family 11 endo-1,4-beta-xylanases.
pubmed doi rcsb
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z79A00
2DCZA 3VHOA 1KS5A 3AMQA 1XNDA 3VZKA 5HXVA 1ENXA 3AMNA 3LB9A 3MFAA 2B46X 3WP3A 3MF9A 1XYPA 3WQ1A 3VLBB 3AKRA 3WP6A 1BCXA 1OLRA 1XNBA 3VL8A 3VZLA 1QH6A 3AMMA 4HK9A 5K7PA 4S2DA 3AMHA 1AXKA 1H1AA 1W2UA 1OLQA 3AKPA 3AMPA 3AKSA 3WT3A 4HKLA 3VZMA 2C1FA 3VGIA 4S2FA 2JEMA 2QZ3A 3VZJA 4NPRA 2NLRA 4S2HA 2JICA 5EJ3A 3VZOA 2DFBA 3AKQA 2NQYA 2DCJA 1H8VA 1UKRA 3MF6A 3WP4A 1UU4A 4XQWA 1XYOA 2DFCA 1NLRA 1H0BA 3MFCA 1XNCA 1REFA 1BK1A 1UU6A 2VG9A 1HV0A 2Z79A 3AKTA 1KS4A 1TE1B 4HKOA 3WR0A 2BWAA 3WQ0A 1YNAA 2BWCA 4XQ4A 2QZ2A 2BVVA 3RI8A 1F5JA 3VHNA 3O7OA 1OA4A 4S2GA 5K9YA 1REDA 4XPVA 1OA3A 3ZSEA 4HK8A 1C5HA 2JENA 1IGOA 3M4FA 1H4HA 1PVXA 4HKWA 4XQDA 1HIXA 3VHPA 2DCKA 3HD8B 1UU5A 3EXUA 1T6GC 1XNKA 3WY6A 1QH7A 3WQ7A 1M4WA 4IXLA 2VUJA 2D98A 1BVVA 1OA2A 1XXNA 2B45X 2DCYA 3WP5A 3WXPA 2VULA 1H4GA 2D97A 1REEA 3WX5A 3LGRA 3VL9A 3B5LB 2BW8A 3VZNA 3B7MA 1HV1A 2B42B 2VGDA 3RI9A 1C5IA 1XYNA 4H7MA 2F6BA
chains in the Genus database with same CATH superfamily
2P6CA 1VJ2A 4I02A 1POV3 2XMLA 4MHUA 1KS5A 2JG9A 4RL7A 1XNDA 4NOTA 3RJ2X 3VZKA 3V0BA 2B8MA 4HVRA 4N53C 4N9HA 2BTVC 2BNNA 4DOUA 2VCBA 4ZZ5A 5FYCA 3RVHA 1V70A 3QCWA 2XJQA 3OGRA 2Q8CA 4AEKA 4ZS2A 1EUTA 3DYPA 5I0TA 3RS6A 1TVGA 4ZZ8A 3VL8A 1PGW1 2QBXA 4YRDA 4FBFA 3IIIA 4BE3A 2HWD1 5A3WA 4HK9A 1W9WA 2H0VA 1C8M2 2TBVA 4QDRA 2UURA 5J09A 4NIIA 4AEDB 4NIAA 4CDWC 2VBBA 4YARA 1W9YA 2R042 4OVEA 2PFWA 2VVDA 4NWVA 1J3QA 1UIJA 1TME1 4IETA 3LF7A 4XJ8A 3Q8BA 4S2FA 4HG6B 3ZKYA 1JZ4A 4YVWC 4AEDC 2I74A 2UU8A 5E89A 3B9CA 1AYN3 3CNAA 4LK7A 1QJY1 4AI1A 5FLJA 1YI9A 4UW3A 5FUIA 4P5HA 4GXLA 4AI0A 3NNGA 5I0UA 1QNYA 3IZOA 3PVEA 1W2NA 4UFJA 1MS1A 3M3OA 3RZJA 1J1TA 1GNZA 4GMP3 1K42A 4ZXKA 1D2SA 1XYOA 1VIWB 4RGKA 4Y20A 1VPHA 3IWZA 2Y38A 4YW1A 5FLHA 3E1F1 3R4SA 1JMUB 4MYEA 1YYNA 4W8JA 4M3CF 1ND3B 1IQDC 4XCAA 1QQP2 2RDRA 3MIFA 3RJRA 2GDFA 1S0EA 5CFCB 1X33A 3D82A 1JODA 2VZSA 5J1XA 3PMSA 4B29A 4DMIA 5A6QA 1GBGA 3ZPOA 4CDXB 4XUNA 4ZU5A 5C5TA 2XLFA 4TLFA 4CE8A 1AX2A 1ONAA 1UXZA 1WCUA 5BNPB 2A6WA 1LGNA 2R063 3MZHA 4M3CB 5EIYB 5JOXA 2RHPA 1NYWA 1SLTA 2QNKA 2JG8A 1NCRB 3HN1A 4XBLA 5CAZA 3UETA 5C9AC 2HWC3 2Z2SB 1UYXA 2ZGQA 2ZZJA 2YPJA 1W6OB 2O8OA 2N7GA 1UU5A 1WCDJ 1RUG1 3GZEA 2W1WA 4FPKA 4E27A 3E6CC 1T6GC 1PNFA 2W47A 3WY6A 5C3PA 3WQ7A 3GGLA 3BCWA 2PLV2 4QPGA 2VUAA 2A6VA 5GJ6A 1FX5A 2ARBA 4A2UA 2XDVA 5A33B 4CEYA 3OUHA 4X6RB 3U4SA 1BMV1 2WO7A 1AXYA 4L99A 5CYYA 1O3SA 5FQ0A 3V64A 1ENSA 4X8NA 3T4HB 4XIOA 4M3CE 1PNGA 3MPBA 5HCBA 1U5XA 1GFF2 4R9CA 2PAEA 2EAKA 3GM8A 1QXRA 4XDQA 4LORA 2BW8A 1FOD3 1RL3A 1XRUA 1VBD3 1O8PA 3P3PA 1UMZA 3CMGA 1WLDA 1AVBA 3PL0A 4XC9A 1FMD1 2WNVC 4QXKA 3U0ZA 2XUMA 1GLHA 4DEVA 2CDOA 3RI9A 4AVSA 3E5QA 2BGCA 2RS52 1W2AX 4UW6A 3W58A 3WHUA 2UWAA 3ASIA 2XWBB 1MS0A 3LEMA 2DUOA 4N90A 2FD8A 4PI2A 1SLLA 4Y5Z0 3VN4A 4I0WB 5IATA 1U12A 1H9PA 2CHHA 3NKGA 4QD2A 1LU1A 1R082 1M06G 4Q4Y3 3MIGA 3THTA 2VZUA 2QQUA 5KBFA 3ZFGB 3ZYIB 3SCHA 2FHRA 2OPKA 1NA1C 1QH6A 2YHJA 3H0OA 5KHHA 1H9WA 3OJBA 4BWOA 3AYCA 1OT5A 2D3PA 1NX9A 1Q3EA 2VQUA 4FPLA 1SPPB 1UY0A 3BB6A 1QU0A 2Y6HA 3ZR5A 5JMCA 2W46A 2IXJA 2D93A 3JB8A 3VGIA 2X5IC 2LM3A 4QB1A 1Q5OA 2R062 4PLOA 2Y26A 2PELA 2XJRA 2Q0AA 2V5DA 2A3YA 4PDWA 1LHWA 5KC5A 3POIA 3LA2A 3LCPA 1IG3A 3WDVA 5KXEA 3ZX7A 3J9SA 1KJLA 3RYRA 3CF6E 2DBNA 3MIDA 4MH0E 1ZNPA 1JTZX 3O0XA 4C0HA 3ZFGA 3RZMA 5LASA 1NY71 1ST8A 1WKYA 3NAPB 4AHWA 5C8CC 1ZBE1 4LKDA 3BTZA 2X09A 1DP0A 4XDOA 1NQDA 4AYUA 4YW4A 2J1TA 3I3MA 2AEYA 3ZFGC 3D0SA 1VR3A 3GHNA 1Z0HA 2Q4SA 1VP6A 4CSWA 1EPWA 4ZY9A 4CP2A 2ILMA 3UESA 1OQEA 2V72A 3PIJA 4CYDA 5FOJB 5FZHA 1ZBA1 5DDJ2 1TNRA 5F32A 3ZN6A 3TYJA 2JDZA 4LHLA 4FFFA 2A75A 4NHMA 4XFBA 3CO2A 3C8XA 1UW8A 1LU2A 2JDYA 2K9ZA 2QQKA 3I54A 2GZWA 4V2VA 5AVAA 4LBQD 4XFGA 5LEKA 1RXFA 4OULA 3SCGA 4JGYC 3M4FA 5AC93 3N4MA 2JDHA 2ADEA 2FZ2A 2CL2A 4XHBA 1C1LA 1SPPA 2QUOA 1AJKA 3KCXA 4B4RA 1L3JA 3U11A 1AF9A 4AXOA 4JTOA 5FO8B 1VBB1 5FPUA 3LD8A 4NHYA 1MEC3 3NVCA 2QQJA 4JKKA 4HVQA 1W8UA 3I8TA 1QH7A 4CEYB 3CEWA 5A33A 4OUEA 1NLQA 1OPMA 4JCKA 2YC2A 1KQRA 1LHOA 4E4HA 1SLAA 4COYA 3POWA 3S6PA 1T2XA 4OCTA 1FXZA 3MICA 2HLEA 2WN2A 4KMQA 2IFRA 1LGBA 1RITA 4BHPA 3D3AA 1B35C 2VCMA 1ASJ1 1REEA 5CKQA 3WF1A 3WF0A 3PJQA 2YBSA 4I0AA 4IV3C 3OBZA 4I3PA 1RINA 4FTEA 1MS8A 2VBPA 4UAPA 2P4EA 3S5AA 3B5LB 1ACCA 3TNPB 4J6GA 1XQNA 4B4PA 4AQTA 1UKGA 1GWLA 1S2EA 1X82A 2SBAA 3R4DB 5BNPA 3VZNA 5LY1A 3VKMA 5JIUA 3BGAA 3D4KA 5C9AB 1AL0G 2XJTA 5FBJA 5FPLA 3ZMNA 4CDXA 1UZWA 3U78A 1ZBA2 3C3VA 5DDJ1 2F6BA 1VBE1 4FOYA 4Z2WA 3T4VA 1UOGA 3LFMA 1U5ZA 1GOGA 4IGPA 4JGZC 5E8AA 2PHWA 5FWJA 4DUXA 3EB7A 1T6BX 4BMBA 3AC0A 1G86A 2F4LA 4HL0A 4RR3C 3LPGA 2C9AA 1LOFA 1WMXA 1UPSA 2UWBA 3MFAA 3OBTA 4MGYE 5FQ0B 2D6PA 4QPIB 3USSA 5JZGA 3M3CA 3FX3A 5A3TA 1ZBE2 2YGLA 3MEPA 4QKNA 4BCUA 1UY4A 1LOFC 3UJOA 3FLRA 2RDSA 5AC92 5B4NA 2Q8EA 1LEDA 3AMHA 2Z42A 5JOYA 4P9GA 1W8OA 1FPN1 2ZPXA 4CEYC 4Q4W1 1AZDA 1V6KA 1WMFA 2RS13 5A32A 1YHFA 1WCQA 2WO2A 3ENRA 3OF1A 4CVUA 1O3RA 1VBA2 1C1FA 1NCRA 1OUSA 1OKOA 1RMU2 4XJWA 5FYBA 2PHXA 2ZMLA 5CKMA 1EYBA 1Q8QA 3VD7A 5J7MA 2EA7A 1RGSA 1QWRA 3B01A 1QOOA 3C7FA 3GDBA 4PIZA 4W6YA 4Y33A 4ES8A 2W91A 5BNOB 1G9FA 1YJLA 5LBEA 4W50A 2DFBA 4OHXA 4P9LA 1QJU3 2C5DA 1GMMA 2RMU3 4IQPA 2VNGA 1N1YA 3NWKA 2ZX0A 1H1IA 5FO7B 4D7SA 4QQPA 1U5YA 1D4M2 1ND3A 4MX3A 1W8HA 1PGL1 2VG9A 5K0UC 3V0BB 2JG9B 1ZRFA 3SH5A 4CCJA 3BPSA 3SCFA 1GP4A 2W52A 3U10A 2BJSA 3OBRA 2RS51 5BPXA 1OQDA 4ATFA 1CD3G 5KHIA 3TB0A 4OI1A 1PO23 4ITCA 4XQ4A 3WDWA 4EYUA 2VOVA 3N9QA 5C3QA 4YZ3A 4ISQA 2BEOA 3KSCA 4Y22B 4AEJA 1JYIA 4LLFA 3GXUA 1OHFA 1W06A 2VXJA 5C5UA 1CN1A 5L9VA 2DVGA 4QM8A 3NKTA 4RGAA 2MEV3 4IE0A 1NLSA 5LRRA 4AI2A 2F17A 1KEXA 4CCOA 1CAXA 2ADDA 4LHKA 5FMOL 5FV3A 5C8WA 1HX6A 3UGFA 4AEDA 1E5IA 3OD4A 5JLVA 2E7AA 2IXLA 1YXWA 2VVFA 2W68A 3LEKA 1W8FA 3LWCA 5A3NA 2A7AA 2QQLA 3EHKA 4IXLA 3C7OA 4OLLA 4CXWA 2DCYA 2PLV1 2DURA 5C4WC 4UF0B 5FOBB 1GWKA 4EWEA 2EIDA 1AX1A 4MSVA 1W0PA 3NNFA 3WW1A 3T0AA 5EV7A 1HKDA 3VBHA 4AVCA 4MXVA 2B4KA 5GLTA 1EP0A 2ZGSA 1UPIA 4COUA 2HEWF 4BDVB 1RC6A 5JVVA 4OHVA 3KT4A 3BTXA 4XETA 2OW4A 2R043 4N43A 3B02A 2W87A 3EMRA 3MO4A 4GWMA 2JDNA 4AQSA 1QDOA 5AFEA 1QJY3 4LTAA 1RUE2 1C8M3 3ACIA 3U4XA 3I2KA 1K45A 5DUWA 2A71A 1GZ9A 2P34A 2XOMA 1LKNA 2HWB1 2VMGA 1OFSA 1TZOA 2XLAA 4XJZA 4BQWA 4XAEA 5EXOA 5A7QA 5C8CB 4GAZA 1QQP1 4BYYA 1ENXA 4AQ2A 4OYUA 4UBGA 3U37A 3WNOA 1CVNA 2UYAA 2QQNA 3FHQA 3RWKX 2P6HA 1COV3 2RR13 3HVDA 1OUXA 1BEV2 3AKRA 2WFF2 4XOGA 2A1XA 4LLOA 1ND2B 4AW7A 1W99A 1AL21 1OXCA 3AXEA 4FCAA 4U2AA 2A3XA 4UT5A 3N36A 4JKMA 2AR6A 3LSDA 4LKSA 4S2DA 3RGBA 4QWNA 3WF4A 3RZLA 1AHSA 1H1AA 1SG3A 3N35A 3VKLA 4CDQC 1OQ1A 1RIRA 2BVBA 3FBMA 4YSFA 1PVC3 2YV8A 4GWJA 5LA1A 1F4AA 5IUQA 1TME2 2XONA 5LW9A 3V65A 5FDBA 2C1FA 3FLTA 4QAWA 4Q4W2 1UZ0A 2DVBA 2KM2A 1MS4A 2VMEA 5FZ0A 4GQ7A 4HETA 4RA0A 3WW3A 3WF2A 1C8M1 1UXXX 5F39A 4B1MA 2E6VA 3DYMA 1W9FA 2P17A 5D8AC 5T5JA 3VBRA 4AFCA 1ND2A 4FXGB 4IV3B 2H0BA 2VZVA 4XVHA 1Z7S1 3OY8A 5DUVA 2XGXA 2HWE1 4Y1UA 5JOWA 3L2HA 1AR82 3NJVA 2EXKA 5I8TA 1JZ8A 3IDEA 5FPXA 1HRI1 2ZTNA 3A23A 3EQEA 5F8PA 3J26N 1RUNA 1MACA 1XOYA 2Q8OA 3USUB 4UI9L 1JYWA 3DGTA 2YBPA 4NJ4A 4F3JA 1QHDA 3ZXEA 3WW2A 1MEC2 2EICA 2K2SA 1RUF2 3FJSA 4R9DA 3KS7A 2BVVA 3ZXAC 2D6OX 5KXCA 1OA4A 2PQSA 4IV1A 1I1EA 4S2GA 5CFDC 5LCWL 4AEMA 1IOAA 1S2KA 2NZ9A 1FAYA 2ZMNA 1RUI2 5FFOC 3MIHA 4YNIA 5FXZA 1CGPA 4NIHA 2YU2A 4KWLA 4RFT0 5FK8A 2VU9A 1PVXA 3BODA 3DV8A 1PX4A 2E51A 4Q0SA 5DAWA 1UY1A 1HIXA 5DG2A 4EN9B 5FZ9A 2VZRA 3CJIC 2ZBJA 3C7GA 3V0AA 2GN3A 2WS92 4JV4A 4P9JA 1ZM1A 2VUDA 5JWPA 2WQZC 1YWKA 3BN6A 4Q29A 4A42A 4B7EA 3AZYA 1M4WA 3NRUA 1ZZBA 2RG4A 3CQOA 3PTRB 4G4FA 5F6LB 5GLVA 2B45X 5I8SA 4AQ6A 4A4AA 4CP9A 2HH9A 2YFZA 2VTFA 2E26A 5GALA 4D6SA 4FT8A 1VBB3 1UCXA 2QQMA 3N7JA 5D21A 1WLCA 4RN5A 2CWSA 1Q8OA 3H7YA 1UYZA 3ZLIA 1CAXB 2PA7A 3ZXDA 1JN2P 1V9U1 4QDSA 1XB9A 3CZJA 3F2ZA 2YB7A 1J1LA 2XHKA 4OZXA 5FCCA 5FYUA 1GP6A 1RUH2 2YUEA 2ZXQA 5FZIA 1DIWA 4AZZA 1WW5A 1OKQA 3CDZB 1WW6A 4KGQA 1VMHA 4WVVA 4Y22A 5DUXA 1POV1 1DGWX 4GALA 5LBFA 3DPRC 3ECQA 5A6XA 1BBT2 5M0TA 1G9DA 1F8VA 4YVSB 4WVWA 2PHTA 3ME2A 2WN3A 2VE1A 3W5NA 3RNSA 3ZYGA 1W6QB 4RS5B 2DDUA 2LRPA 1DQ0A 4JC1A 3IPVA 4FPCA 4SLIA 2WQ8A 3IT8A 2HWD3 2BV4A 4P02B 5IT6A 4AGVA 2D6LX 2A6XA 3ALQA 3OPTA 4FO9A 1LHNA 3MF9A 4H7LA 4LE3A 3M70A 3VBUA 4DIQA 3VLBB 3KGZA 3WP6A 1WD4A 2VC9A 2WC2A 3N9PA 3GHMA 3VBFC 5C6CA 3S5QA 2X8KA 3LE0A 2R30A 2X29A 4HN1A 5K7PA 1RHI1 4BB3A 5BNOA 4J1XA 5IVVA 1APNA 4BQ2A 4Q8KA 4GKXA 5F1RA 5A3MA 2CTVA 2R061 4W6WA 2YZ4A 4L2NA 3SXWA 4Q1PA 1HB4A 1X8EA 1OC1A 2H6BA 2WT2A 4HKLA 1POV0 4MGKE 1HN1A 3MGUA 4LOTA 4AWDA 2QZ3A 2Q1FA 5A32B 3I3EA 2DVAA 3LIGA 2BP6A 5F3EA 4FPJA 1XU2A 2YROA 5FUNA 3KVAA 5SV8A 4QX2A 2EVXA 3IN9A 4XURA 1H8VA 1MEC1 1HW5A 2EAAA 2WIIB 2JDUA 1CAWB 4A3XA 4XQWA 4AAXA 1OURA 3ACLA 3BOWA 1Y9MA 1BEV3 1H0BA 3WHTA 1HRI2 1SLBA 5FK7A 3VKNA 4PQ9A 3T1LA 1FNYA 2JDAA 4OMDA 4WM7C 1BKZA 1KS4A 4XUTA 4CDQB 2NM1A 4KWUA 4GJYA 1SZBA 5D1IA 2VL4A 4COZA 1NQJA 3HNYM 2RVAA 1JZ7A 3KF3A 5C9AA 1MQTB 1LULA 4BXFA 5EYXA 4ZONA 1R091 3O7OA 3RMXA 1VBD1 1REDA 1UF2C 2RS33 4CCMA 3HJRA 4E2SA 4BIFA 4XF4A 3O1VA 4OZOA 2GMMA 2AUYA 3TNQA 2JE8A 5IVFA 5FZEA 3WVJA 1KGYA 4R52A 3R6SA 4HT1T 5BNNB 2QQIA 3OPZA 1QKQA 3N7MA 4GH4A 5FZ3A 4KL1A 4FTSA 3WUDA 3M8LA 3MLKA 5ACA3 1NE4A 2PAKA 2QQWA 3DXTA 2D6KA 2Y6KA 5FXVA 2BGOA 5CEHA 4A6OA 3JD71 5L9RA 1N3PA 1V9U3 3BKZA 4NRPA 1BVVA 2XG3A 3AZZA 1BEV1 4RD7A 5FXWA 2ARXA 4TYSA 3NMBA 4QKFA 4A7KA 3S30A 2WNUB 5FLIA 1FOD1 2OA2A 2VR4A 4KI5M 4BMEA 1UD1A 5IK5A 1SBEA 4LEJA 4NE9A 2YBKA 3LGRA 3UKVA 3I3BA 2LROA 4LO5B 1MZEA 3J7MA 3S0MA 1K5MA 2YFUA 4LJHA 4N53A 3W9AA 2KR2A 1QJFA 2Q1ZB 3AL6A 1B35B 1MVEA 3TN93 1W6NA 3MIEA 4BQ3A 1RJ8A 4AFMA 4WM8A 3RFRA 2VGDA 1A78A 3ZN6B 2V4AA 3WF3A 3E6DA 3PUAA 1HB2A 3HR9A 5IJRA 2WZR3 2FDHA 2Z5WA 1XBFA 1H2LA 5LA2A 1AR61 1ENRA 1S2BA 4YW2A 4XDPA 5T5LA 3OD0A 4IE7A 3CJIA 3GYDA 1G6NA 1IHMA 2VUCA 3NAPA 2GNMA 1YIFA 1YC61 2ZABA 3T08A 4M00A 3L9JT 4QXCA 2DVDA 5BNNC 2MPFA 1O5UA 1ZRIA 3FL7A 1QJU2 1FYUA 1OF3A 2K46A 2P3IA 4XIKA 5E16A 1QJY2 2NYYA 4PDWB 1OLQA 4UFKA 5L36A 1D0HA 4PF5A 4LBLA 2GP3A 5DG1A 3GZAA 1VE0A 4QHBA 2GC0A 2WNUC 4MZUA 4WVMA 1DZQA 5IW0A 3AM2A 3P5BA 2AREA 2ATFA 1O4ZA 1R092 4JGZB 5EJ3A 2ZGOA 5F3GA 1UOFA 3NO8A 4GB31 5BXXA 4PHZA 1UN1A 3QH6A 3ON7A 4Y3OA 1PGW2 4B7KA 2Y33A 3ITQA 3QACA 2WZR1 1UU4A 3UGHA 1STMA 3LOIA 1AYN1 5IVJA 3H1YA 3VDDB 5FTTC 1PO12 1PGL2 1OD3A 1E5SA 4P08A 4BISA 3TOJA 5EP9A 3VDCA 4JAAA 3PMEA 3ZKUA 4Q4Y2 4QHOA 5EJ1B 3PHMA 3BUCA 1W39A 4XFFA 4KU8A 1X50A 5IVYA 5FJHA 4YG6A 5GZCA 3JQWA 5IK4A 1Y4WA 5LA0A 1VB4A 3ZYJB 2D5HA 1WLTA 4PBPA 4RHV3 4XPVA 4QPIC 4XHXA 1F5FA 2WA4A 3E5UA 4BQ1A 2QDRA 2X10A 3I4IA 3O5SA 4K8FA 5C71A 5JPMB 1CPNA 5HPOA 1PVC2 1VMFA 1AUYA 1WMEA 1H4HA 1H2MA 1MS3A 1UWWA 3LZZA 5DAVA 3WNNA 2JD9A 3MLLA 4Q4X3 4URTA 1OFNA 3O1SA 5JR2A 1QXPA 3OGSA 3POJA 3TWIA 1O5LA 3ZSMA 3BIEA 5JSPA 3AFGA 3C7HA 4BK4A 2JX9A 4QPGB 3GF6A 4R4XA 1YI7A 4IGOA 2VULA 4LUKA 2AZ5A 4NUBA 2QCSB 3O1MA 3I2FA 4LKFA 4XF9A 3GBGA 2C24A 3ES4A 3I2OA 3KZ4C 3DN7A 1IPSA 1QEXA 2WABA 4Q0UA 3AVRA 1PVC1 2JG8B 2AYHA 5DDJ3 3UYJA 5HI0A 1VBE3 3HOBA 1Q8SA 4DNYA 4WM7A 4DFSA 1IKQA 2E7TA 3A21A 1D4VB 4WZCA 4HPKB 4JGYB 5T5PA 4YGDA 3AXDA 4GJZA 2B42B 1SDWA 3AZWA 4XBNA 5FY9A 3AP9A 2BNMA 5T5OA 4MLOA 1W05A 4K9SA 4LO6B 3X29B 3KQRA 4AGGA 3PU8A 2RM22 3NJXA 2WYFA 5HV0A 1W9SA 1BK0A 1R1ZA 5C7GA 5JSOA 2VTXA 1J58A 3H3UA 1PO11 4KGGA 1S0GA 4YZ2A 3ZDSA 2OZ6A 2GC2A 2LTNA 4P00B 2A6YA 2OQ7A 2ZX1A 1BCXA 2X5IA 2HWC2 2IXCA 2XHNA 4YGBA 5AVPA 1GSLA 3I3DA 4AK3A 3C2UA 4NIDA 4BIOA 1G8WA 3S57A 3OB8A 3AMMA 1AR73 4YM1A 3D5OA 3AP5A 1W04A 4A41A 3CKHA 3DCQA 2OUHA 3PUQA 4RYDA 2UY9A 1C4RA 3RSJA 3PUHA 1O3TA 4AE2A 3G7DA 3FWEA 3DYOA 1EPZA 3AK0A 2JEMA 2NP0A 1CAUB 3LIHA 1N3OA 2WSUA 3EYPA 1AYM1 4S2HA 5FZ1A 4AHYA 4FP2A 4Q1RA 1I5PA 3I97A 4UFMA 1ZREA 3WEZA 1UL9A 3TAYA 3WP4A 3ZPYA 1JZ2A 4FOWA 1RVF2 4CCLA 4XJUA 1LHUA 5DAQA 5LB6A 1LOCA 2HJIA 2ZHKA 4JRLA 1RTVA 1UX7A 2CGPA 5J3UA 3CJXA 4ES9A 2ZEYA 4XUPA 1REFA 1AR62 1W8NA 2DBIA 1HV0A 2HWF3 3SITA 3GBFA 3SISA 2HWE2 4LA2A 2JDPA 2IZWA 5IAXA 2D6MA 4ISRA 1NY72 3I2DA 3KT7A 2R0FA 1CZSA 4NR1A 2HBUA 2BWCA 4G3YC 2ES3A 3BI3A 4OHZA 1SHWB 2W08A 5F6KA 1DG6A 1V6LA 1RUJ1 4KNCA 4KWKA 5LATA 2OYZA 4PIYA 4CEWB 4CDWA 4GKYA 4P9XA 3CBNA 4MADA 1ZZ8A 2EF6A 5BV6A 2BBVA 1Q43A 2V09A 4INDA 2BZDA 2NMNA 4AGRA 4DEQA 4DXZA 4OI0A 1OLME 2G1MA 1JZ5A 2JB4A 2IC1A 1DQ2A 1R1A1 1GICA 4QQLA 3ZFFA 4QMAA 3QLQA 2PLV3 5K8SA 1RUC2 1OI6A 1DQ6A 4ASKA 4QM9A 4XUQA 2JWPA 2ET1A 2G9FA 4E4ZA 4OI2A 3I7DA 3J4UH 4Y1VA 4CRQA 1ULOA 1PO13 4OMCA 4Y4YA 3V56A 3ZDVA 3LOBA 4HSJA 3JD72 4QXBA 4DXRA 5FREA 4AAPA 4NWWA 1YQCA 2VW1A 1DF0A 2LALA 3HWJA 4XFCA 4K40A 4E8DA 5EWSA 4YM3A 5A1LA 5F7UA 1OBNA 3H8UA 5FKBA 3SKJE 5JXJA 4NVPA 3RZHA 2BQPA 4LXLA 1RXGA 2HWB2 4MGQA 1R1A2 5DN2A 2ZHLA 4LITA 3SQOA 4DRVA 2P3KA 2E33A 4RR3A 3SEEA 4O61A 4O7XA 3PVBB 4IUGA 4Q0VA 2QQOA 1AX0A 1PK6C 3I2HA 1HLCA 1YQ5A 1LENA 3IMNA 4QX5A 3LAGA 5CU1A 2BFUS 4BLIA 1J59A 1YUDA 2BOIA 2WWJA 1Z7S3 4W65A 5FP7A 3LPFA 3K51A 4PCRA 2ZAAA 4ORFA 3H42B 1EAH1 1D2QA 1W6MA 1DQ4A 2B46X 4MO3M 1V0AA 4B8EA 1QJX1 3CHXA 4YWAA 1EV12 3OG2A 2CSGA 5CFCC 1TMF2 1XJAA 3PUSA 3VZLA 4HBNA 3WOGA 3LQCA 4E9KA 4I01A 4ZPIA 4OQ8A 4XTMA 5GZGA 2BFUL 3B3QE 5HCHA 1S0CA 5L73A 4DXTA 1LECA 3MI8A 4K6BA 1AYM3 2DCTA 2VBDA 4X8PA 1XE0A 4IGQA 4NAMA 5L7OA 5E6HA 3WDUA 3K75B 4D69A 3VZMA 3KD4A 4XABA 1MR5A 3PIGA 4QB2A 4BU2A 4NPRA 2NLRA 1K5MC 1TNFA 2OVUA 3SH4A 1N3QA 5F3CA 3POFA 5CISA 3NSTA 4AFDA 5CBLA 2QJVA 2GNTA 2A3WA 1JU4A 1LODA 1OSGA 2WINB 3T2QA 3NV3A 3OTFA 4L97A 1KDKA 2JE7A 2PHRA 4AVVA 3ES1A 2FCTA 1XNCA 2FCUA 1RUJ3 1YQ8A 2DVFA 2PQQA 1LR5A 1QIQA 1HQWA 4CPBD 2QVSB 2HYXA 1UNBA 3H1MA 1HB3A 5FZLA 3OGJA 1PZ9A 2YC0A 2WJSA 1KXGA 5FZ4A 3HNBM 4C1XA 1XU1A 5GZFA 4HSLA 2FDFA 1W2OA 2A70A 1BBT1 3FBYA 4QHZA 3J7NA 4FPYA 3ZOIA 3JBG2 3L2YA 2I07B 4QU2A 4Q2FA 4ASLA 1GKBA 1UMHA 1HN0A 3PLQA 3MV01 1ZBA3 1RUH1 1OH4A 1RUF3 3AP4A 3DPRB 2EXIA 3KLSA 4FVVA 1J84A 4CUCA 1DGLA 1OVPA 2HYKA 3ROUA 2W0XA 2JE9A 3AJYA 3N9OA 2OQ6A 4BLJA 3A4UA 2DCKA 2DUPA 4IESA 2D7FA 4A7ZA 1Y9QA 2O0OA 5DPNA 3UL2A 5FYYA 1VBA3 4TTGA 1AR93 1ZBE3 2OUJA 3DKWA 3WINE 2VUJA 1W8ZA 5A7OA 2VQ0A 1UZVA 4RQPA 5GZEA 3H9AA 5JCTA 1XPWA 1JZ3A 5LWBA 1G9CA 1O8SA 2PTMA 2WS91 1Y43B 2OPWA 4MXWA 1RUD1 1DCSA 4FPOB 1MS9A 3K77A 5B4XA 4HOOA 4PLNA 3ZMOA 4D3WA 3BVCA 2HEYF 4LMFA 4QX8A 3GCXA 1GUIA 2K0GA 3FUOA 3VBSB 3C7EA 4N8MA 4Q27A 5T50A 4JX0A 2WAOA 4P14A 4TSVA 4RR3B 2A73B 1RUF1 1S0IA 4JDMA 3NNLA 3ZXKA 2IXHA 2ZS6B 4LBMA 2R073 3QBQA 4UW4A 2J1EA 4Q4Y1 1W6PA 5FYTA 3KT1A 2W1QA 2EXJA 1WCSA 3N9NA 4R8HA 1QF3A 3K46A 2AGSA 3VBFA 3T09A 4P9WA 4C91A 5KHKA 1DYPA 5ACA1 4NHLA 3RG0A 1IS4A 2ZHMA 3GZUC 3FUQA 2RDQA 2VPVA 4XZUG 3D8CA 3RZGA 5CNAA 1ULDA 1UZYA 2ETEA 1R083 1FV2A 1JOPA 1XNBA 2BRTA 3DF0A 4K1ZA 3WQBA 2J1VA 4DUVA 4XZPA 2OX0A 4AVBA 4R4ZA 2R1DA 4PQQA 1OPOA 3OBAA 1PO21 3ZFEB 3HQRA 4DINB 2ZEXA 2Y60A 2XBO2 1ZZ9A 3WDTA 5FY8A 4CDUB 1NZIA 4RHV1 4DO0A 2VZPA 2RS31 5LEJA 3POGA 3NNJA 1C8NA 3M3IA 1XSQA 4J25A 4XUOA 1BZWA 2WNVA 1RUH3 2YY1A 3Q8FA 4NRMA 4QPWA 4A6SA 4CUAA 5C70A 4X6QB 1WD3A 2WA3A 4Z2AA 3JBG1 3W59A 3OYWB 4META 4OHYA 1Z78A 4FSJA 4Z1VA 1CIYA 1D4M3 3P1IA 2CV6A 1ULPA 1GZWB 4WVZA 2Y0OA 1V6MA 2WFF1 2TNFA 4IV1C 1NLRA 2WLPA 5FPZA 4GB33 5BY5A 1H30A 1NA1A 4EN0A 1O4YA 1W9TA 1L7LA 2CU5A 2RV9A 1H8TC 3AP6A 4P9YA 1OLMA 1E5HA 1GU3A 3E97A 4UFHA 4YVSC 2HWE3 2RJLA 1JHNA 4ZKTB 3LKJA 3NV1A 4EROA 3VD5A 5ANQA 2BDRA 1H8TA 1ODNA 1KD7A 2JD4A 1SMVA 3HQXA 4CPBA 5A6ZA 4Q5OA 1JZ6A 3NL1A 2J1SA 2R32A 1OOPA 4LHNA 4YVWB 4C8DA 2VZ3A 5FP4A 1QY4A 1OA3A 4IW3A 1S1AA 2VQAA 5EPAA 4YZ5A 1GWMA 1CAUA 1RVF3 3H8XA 1CX4A 4XFHA 3G6JB 5JMOA 1JW6A 1QNWA 1UY3A 2JENA 2WYSA 3DKQA 1QOTA 2CWMA 1LOBA 4GD4A 4GWNA 4AG4A 4B4QA 3ATGA 4XMAA 3MW4A 2OZJA 5EFUA 4LBQA 2HWB3 3AJZA 5FPVA 4PJYA 2OIIA 5KC6A 5J37A 1RYYA 1FOD2 2I45A 3MYXA 4XFIA 4YGEA 2IXKA 4QKDA 3ZM8A 4MGSA 1HRV2 5F9TA 2VO5A 3ZSKA 3LFIA 4V1PA 5K0UB 1UYYA 2D98A 4H14A 1WW7A 1R081 5LY2A 4DXSA 4FQZA 2SLIA 3URFA 2CGNA 3PVOA 3BIWE 3AYDA 4QB6A 3O1RA 1WBLA 1JOJA 5FYSA 4K1YA 4ATEA 5H9RA 4E2GA 3POBA 4WM8C 3O14A 5FY5A 4D7YA 1O91A 2WNOA 3A22A 1H2KA 1IKPA 4XF1A 2EIGA 4R9BA 1C3HA 5FP8A 3TN92 1BHGA 4JGYA 5LK5A 1AR63 4JKLA 1XNAA 2FBEA 4LUMA 4CU8A 3LDRA 2W1SA 5DZGA 5JIAA 2ZAHA 1HB1A 1GNHA 1JBCA 2G4IA 4IEUA 2ZKLA 2ENRA 2UYBA 3KWVA 3H3ZA 3WZ1A 2WFF3 5BNOC 3AMQA 4XJ9A 3PDQA 2YXSA 3IBMA 2HEVF 3J8F3 4IE5A 5T55A 3WCSA 5FR3A 4FOQA 3HIFA 5FIXA 4Q8LA 1S0FA 1W0OA 1XC6A 2WT1A 4GA9A 5ABJB 3H50A 1WUVA 2IWGB 5FBZA 4B1LA 1GZCA 2X53S 2XL9A 4JRAA 4AL9A 2VNVA 5A7WA 4FAHA 1QQP3 1I6XA 4W6XA 2VW0A 4Q4V3 5LBCA 4HFSA 3VBHC 1RUG2 2I2SA 3AMPA 1MPXA 3AKPA 2IUWA 2KXLA 2VM9A 4CXYA 1W3XA 4LO8A 4DY3A 1CJDA 1PMIA 1RMU3 1KFXL 5JZGC 2PYTA 2CDPA 3S7IA 4D0QA 1UO9A 1ULGA 4CU9A 1DHKB 5DQ0A 3RPQA 5A70A 3I59A 3Q8EA 3PTYA 5T54A 5A7WB 4AI3A 4HVOA 2B39A 3A0NA 1SQ4A 4U36A 3CIHA 5FZOB 4LO4B 1X8MA 2RMU2 4YLZA 1LEMA 1PIV1 4BK5A 1CIWA 2YYOA 5LK7B 3TEWA 3CL1A 1IS6A 2BNOA 3NJYA 2DUQA 2XR4A 4QPGC 4L0PA 4E4DX 4FI9A 2P1BA 1OF4A 3VDDA 2B7YA 3B00A 3LEIA 3KV5A 4LOSA 2GC1A 4BJ0A 2P3JA 3APBA 2W92A 1RVF1 1VBE2 3O12A 5T3NA 5J36A 2GP5A 2Y64A 1GOFA 1JYTA 3SNMA 1GZTA 1W2TA 2LS6A 3RI8A 4BQYA 2VMDA 3B9IA 2QTWB 4CP0A 4R9AA 3KMHA 3ZSEA 1TEIA 2IXIA 2RDNA 2O8QA 1WLWA 1U0AA 1IGOA 1ZZCA 2KD7A 4BQXA 3R05A 4IEVA 4UFLA 3EBRA 3R4UA 2O1QA 1F2NA 5FP3A 5G04L 4QU1A 2PXJA 3JU9A 3VD4A 2YMZA 1URXA 4CA9A 4JDNA 4XTPA 4WBBA 4LNVA 3R0RA 1UOBA 4M01A 2CNAA 1SBDA 1DGRA 1ZRRA 2WR9A 4Y1XA 1ULCA 1ND3C 4YZ4A 4Q4X2 2HWC1 2XLGA 1QJX3 5K0UA 5FY4A 2Y6FA 3WP5A 1KITA 3OGVA 4O9GA 5ABJA 2ERFA 3IMMA 2DF7A 4K7JA 3BYWA 2DTWA 1DFQA 1UOJA 5GLUA 2FQPA 4Q4V1 2OT7A 2VTXJ 3ZIWA 1YFWA 1LOEA 4LBQB 4YGCA 3VD9A 3TBDA 2VH9A 2YU1A 3LDBA 4AFBA 4DUWA 4Y5SA 1ZA7A 4ZS3A 3VL9A 3W21A 4RFRB 3OGGA 5FY0A 2WWUA 5IVBA 3MBWA 3A0KA 1DLLA 1YRZA 2A5ZA 2JJ6A 2G19A 2GSYA 3OUJA 2BGPA 1OOPB 4YVWA 3KHCA 1CAVA 1RUOA 1SBFA 1GP5A 4IEPA 2XL7A 1C5IA 4BZ4A 5DZEA 1DLCA 2R16A 4TZDA 4C90A 1JYVA 1JU3A 4URAA 5GLWA 3RMYA 4IERA 4QX7A 1ZA4A 5EYYA 3TEXA 2ARAA 2TUNA 1NAEA 2VXRA 3IM0A 3EO6A 3WQ1A 1O6UA 4PDWC 1VAVA 2J1AA 1X9PA 2RM23 5L19A 2VMIA 1JYCA 5IWFA 1VALA 2AH2A 1Y7BA 3LDKA 3O1UA 1YCIA 2ZGTA 1H6YA 4LQRA 1J3PA 2ZGNA 3KCCA 4QX1A 4GH4B 3VKOA 2GMPA 2JIGA 1X9TA 1GQHA 4IDZA 2C9KA 3SH3A 5CFDB 2WNVB 1AR92 1WCKA 1H6XA 3K4ZA 4L92A 2EXHA 4D6RA 2WSVA 5KXDA 1W03A 1BQPA 3ILNA 3MW3A 3I2IA 3P6BA 5FPBA 2G9GA 4LULA 2XJPA 3D6EA 5DZFA 1HRI3 2JKXA 3N7LA 5DAPA 3RRDA 1AL22 4LBKA 4XJAA 3UV9A 3MF6A 4ONUA 4AI9A 5I93A 4EN6B 1LTEA 4CDQA 1WA6X 4JHZA 3FC0A 1MS5A 2XBO3 5FZ6A 4AR2A 3MFCA 2JXAA 1MQTC 1UU6A 3VBUC 1ULFA 2PAMA 1DZRA 2WKKA 1KJRA 4FPHA 1N1SA 3U1XA 2P3YA 2Q8DA 2WZR2 2FDIA 2BWAA 2VMCA 5FZFA 1ZRDA 2VZ1A 4LBJA 2BYVE 1Q8PA 3CZUA 2YPDA 3N7KA 2CGOA 3W20A 1PM4A 2VCCA 4GB32 2MEV1 5KWRA 1AXZA 1FMD2 5A7NA 1VLNA 1RUC3 2XVLA 2EIBA 5K9YA 1OMIA 3PVNA 3TN91 4H2AA 1NKGA 4MG2A 1BXHA 3E5XA 1VAMA 1VRH2 2E7QA 4WV8A 3NV2A 1ZYBA 1L7RA 2PMWB 4FAGA 4XQDA 3LSEA 5D8AA 5FZCA 4MV2A 5FMCA 1YIPA 2V73A 3HD8B 3MHZA 5BNQA 3THDA 2ZX4A 1GV9A 5FZAA 3GNEA 3WV6A 4AFAA 1A3KA 1TMF1 2Z4FA 3ABZA 2YDEA 1MZ5A 5JXGA 3M2MA 4K20A 1QJX2 3WNMA 3ZVXA 3WXPA 3VV1A 3ZXFA 1A34A 1RUI3 2AEZA 2R7EB 5IFTA 1RHI3 4SBVA 1V6IA 2J42A 4LHSA 1H4GA 3VBFB 5CA6A 2FCVA 5JSRA 3JD73 5C3RA 1XSRA 4MHRA 2PHUA 2QE3A 4YW7A 1LRHA 3ZSLA 5B2GB 4CZSA 2LUWA 1VRH1 1CJPA 4YVSA 3JCIA 4EE2A 5FO9B 1Q56A 3VDDC 1YQ6A 1XE8A 4A7YA 2VOWA 3CLPA 2RE9A 3F95A 3O0VA 1ASJ3 5EJZB 5FUPA 3VBSA 3FHAA 3JB4C 1YJKA 1OH3A 4LPLA 1ZZ6A 4LO7A 2WLQA 2VNOA 4ZXEA 3GALA 3K4AA 5FY7A 1LESA 4CCKA 2VECA 1GQPA 4LBNA 3VBSC 1W28A 2P2KA 4FFIA 5FYHA 4K21A 4MXWB 4M0NA 5C4WB 3NQHA 4H55A 3AMNA 1MZ6A 3RYPA 3RDIA 2UWCA 2ID4A 1JS9A 4GZ9A 5ERLA 3FHIB 2XVGA 2VZOA 1XYPA 4Z82A 2VW2A 1TMF3 3P3NA 1LAJA 2JKBA 2PHFA 3T30A 4CP9B 1HXS2 4KQ7A 1O59A 2Y0IA 2BUKA 5F5QA 2BPA2 3VDBA 3THPA 3OUIA 4PF1A 5FAXA 2BBAA 5A3PA 4QXHA 1LCLA 1UZZA 1NXD1 1RUC1 2WDBA 3INAA 5ABJC 2D5FA 2AC1A 3PJYA 3HNMA 4M4PA 2HKXA 1BLZA 3DPRA 3IIAA 4TLGA 4Y1YA 1GYKA 5L7OB 3ZN5A 4ET7A 4GMP1 3WDXA 5FJKA 3UGGA 4YFZA 1JXNA 2XBO1 1YO8A 4OI4A 4IV1B 5A7PA 5FZMA 5IFPA 1PO22 4XCBA 2HWD2 4XFAA 4E8CA 3SMHA 3OSDA 3KV4A 1QOSA 2AENA 2B9VA 1SEFA 3USUA 2DFCA 5GLZA 1A8DA 1WZXA 4CU7A 3IAQA 3BPZA 5FPAA 5ACA2 1BBT3 5C4WA 3J8F2 1PZ7A 3S7EA 3AKTA 3VUOA 4D8MA 3NAPC 2VCAA 4MUVA 1MZFA 3PU3A 4IV3A 3WQ0A 3ZSJA 2CAVA 4TXWA 5F2SA 2XH6A 1OVSA 4V2WA 3VHNA 1YQ2A 1US3A 1FPN3 3D0JA 1AYM2 2YGMA 1U5IA 3O1PA 1LJ7A 1ULEA 4QPYA 1DDLA 1C5HA 4Z07A 2VOKA 4N43C 4CDXC 1HQNA 4QDQA 1B09A 4LK6A 4PLMA 3HT1A 1Y9GA 1F35A 1ASJ2 1RUD2 1V6NA 3ZYRA 4EJRA 2OS2A 2DV9A 2D44A 3RQ0A 4Q4V2 2ZJCA 3BALA 2V5YA 4HLTA 3JZVA 1NUKA 3EXUA 1DGWA 4I09A 1LHVA 1AJOA 3N3HA 3ZYBA 1NE6A 3FN9A 4DY5A 4A3ZA 4CTEA 3O1OA 2EIEA 4Q4X1 1NZCA 3OPWA 3HAGA 4JHTA 5CKNA 3MPPG 1W6MB 4LE4A 4C0BA 1YFXA 4OUSA 1IZ3A 3SHRA 1L7QA 2PHDA 3ACHA 4XW3A 5D8AB 1PMJX 1FMD3 2ZEWA 3B93A 4KG0A 4KWJA 1PM7A 3QOPA 4Q4W3 1TG7A 4GH4C 3M3EA 5AFBA 3T0BA 5LRSA 3UK9A 5IAVA 4K8RB 1QXJA 2ZEZA 1NCRC 2WZ8A 1S4CA 1YLLA 4NPMA 4A44A 5CIRA 2XQRA 1J83A 1UYPA 1SLIA 2HWF2 3K2OA 3JQXA 4NROA 4CEWA 4F8AA 4Z92B 3JBG3 2ZX2A 3O1TA 4LBOA 5FZ7A 1YFUA 3WG3A 2XWJB 1POQA 3AYEA 4I3GA 1HJGA 1XYNA 2DWRA 4H7MA 4XF0A 1QJEA 3IDCB 4CP1A 1HJFA 1NG0A 4QX0A 3VBRC 5A1AA 3KV6A 2VVEA 2CYFA 5HBAA 1F15A 4DZGA 1PIV2 3POSA 1VBC1 4UF0A 3WNPA 4OFGA 2JG9C 3KB5A 1A6CA 4AI8A 2W1UA 3W5MA 3VKFC 4BOWA 2D3RA 4EQVA 5FYMA 3BTAA 1VMJA 3UNPA 3ZYHA 4XYXA 1AXKA 1W2UA 2XB6C 5D2AA 3MIBA 4I30A 2XJUA 4NRQA 4Y5TA 2NN8A 3AFKA 5FWEA 3RWNA 3M3QA 5FZGA 1JI6A 3POEA 3ZFFB 5FYZA 3ZYFA 3KV9A 2XUEA 4COVA 3ETQA 1WBFA 4BPZA 5CFDA 2W94A 2YC4A 3AVSA 4QGNA 3ZO0B 4BH9A 1N1TA 2D3SA 5A7SA 3VZOA 4HN0A 3FLPA 2PHLA 4MGZE 2WT0A 2XQXA 2ZGKA 4I2OA 3RYKA 2VMHA 1EV11 2IFWA 3ILFA 4GWIA 2C0ZA 4LR4A 1S0BA 1C57A 3K48A 1ODMA 1JYNA 1BVP1 5F3IA 3J8F1 3WDYA 2WWSA 3MW2A 4YW5A 3T0DA 1CZVA 1SDDB 2WL1A 3ZYPA 1VBC3 1O4TA 2Z79A 2Y34A 4XE9A 2W3JA 3WR0A 4ASMB 1Z7S2 3WUCA 1AR71 2FMDA 5EZWA 1YNAA 4FXKB 2ZCWA 1CAVB 5TSWA 1F5JA 4HPKA 2ZA9A 2Z69A 4IEZA 5FKCA 3GZTB 1V6OA 3WG1A 1CONA 1I5ZA 1QGLA 3BU7A 5A6YA 4IEXA 2JDMA 2C4XA 4RQPC 4UBHA 2WO1A 3EJKA 3BTYA 3H3LA 2IVJA 4FQ4A 4N9IA 5H9PA 2FDKA 4LT5A 5CG9A 1QJU1 3HBKA 3UJQA 3DEMA 2V4VA 3ST7A 1K5JA 1P8JA 3T1MA 3KGLA 1J3RA 2ZGRA 4MOAA 2X5IB 4FP3A 4TN7A 3NJZA 4QPIA 4C1WA 1HRV1 5JZGB 3PUIA 1RUG3 5I0SA 1I3HA 2GMEA 1E57A 2BOJA 3KHBA 4L9BA 3WX5A 5IYYA 2Q5TA 4J1WA 4HMZA 1UAIA 1F9KA 5JXIA 4AVTA 2RJKA 2VMFA 2RJ2A 4GMP0 3ZFEC 2CAUA 5JPNB 2XXZA 2WZEA 1RUE1 3KF5A 2GH2A 3WD5A 2P37A 5BYNA 2PN5A 5APAA 5BUVA 4WM7B 1SFYA 2AACA 2XJVA 3B69A 3Q8CA 4IL7A 5A3OA 4ARYA 3E6BA 3AL5A 1JYXA 2CY6A 1EV13 2R6QA 1F4HA 3U75A 1AL23 1NXMA 5HXVA 3ACGA 2R0HA 4MVTA 3K4DA 1UIKA 2Y6GA 3DUIA 4N7IA 4AHXA 1OD5A 4CUGA 3KM5A 4LKEA 2A6ZA 2ZOEB 2D40A 5FZOA 1H1MA 4B3NA 1JOBA 2Y6JA 5DMYA 4D7TA 3TEZA 3I59B 1DYOA 4I0BA 1IS5A 1PMHX 1X36A 2GN7A 4P5YA 3FFQA 4JGZA 2WRAA 1TQ5A 3WG2A 2VOXA 2NMOA 4IE6A 4WVMB 4YM2A 5FZ8A 2MHFA 1CPMA 3HPNA 3SC7X 4AOCA 4BXSV 1O7FA 5C33A 3N9MA 5A80A 2WFPA 2R041 2RS32 4XACA 3WG4A 2Q30A 4M0HA 2R1BA 1QJZA 1VBD2 4A45A 5FZDA 3ZXJA 4XXAA 4FFHA 5E1RA 5HV4A 4YG0A 3I49A 5L9BA 2DCJA 5JI7A 5EHDA 1AR72 1PZ8A 5F37A 3TEYA 3FE5A 3SEPA 2E31A 3BOPA 2RS53 4COWA 5C3OA 4QGLA 5JXHA 5H9SA 2VZTA 3DECA 1OOPC 5F5IA 1PX3A 1WWYA 5KHJA 3U07A 1BK1A 4ZU7A 1D4M1 4IE4A 4PBOA 5FY1A 1IQAA 4GIQA 3T3YA 2RM21 5FMBA 5I0RA 4JVAA 3UT0A 5CVRA 2WNEA 4ARXA 3HT2A 2VOTA 4KBBA 4UW5A 1N1VA 2QZ2A 4WM8B 5IK7A 3K3OA 4Y4RA 1GR3A 1I9RA 1W6NB 4JTNA 4RSUA 3ZXLA 2J22A 5LBBA 3RZZA 1K5MB 2GNBA 4HXCA 4Q0PA 5T52A 4Q26A 2BU9A 4IEWA 1R64A 4Y26A 2B5HA 1EUUA 3BU0A 2DYCA 1FPN2 3VHPA 3ZR6A 1LOAA 3ELNA 4IEQA 4KH9A 1UY2A 2FDJA 3WLUA 1RHI2 5GZDA 4KG8A 2W5FA 1EAH3 3ILRA 4OUMA 3J7HA 4CCEA 5AC91 2VZQA 3AZVA 2QKDA 2GNDA 2D6NA 5ANNA 3AZXA 4ZU4A 1DQ1A 1OA2A 3B94A 1MVQA 2P5BA 1VBC2 2TEPA 3CJIB 1GOHA 2ZGPA 1X7NA 2O14A 4KU7A 5KHGA 4FOVA 1YEWA 4UXAA 4NHXA 3WSOA 5CB7A 5GKAC 3Q8AA 4CCNA 4E2QA 2WUHA 3ETPA 1D0GA 5BNNA 1LNSA 2FMYA 2W39A 2ZKNA 2ORXA 3WCRA 2UY8A 4EN8B 4FPEA 4QQHA 4QX3A 3I3QA 3UKTA 1B35A 3MV11 2FZ1A 4EZ4A 4N53B 3B7MA 1H8TB 4O9EA 1HV1A 3T2PA 1GANA 1VB2A 2GALA 3KQ4B 5A3LA 4IEOA 3AP7A 1COV1 2RR11 5J48A 4PT6A 3QH7A 4MGTA 3OCPA 3VHRA 1V9U2 2DCZA 3VHOA 4Q0QA 4F7ZA 4XEZA 5BNPC 3AX4A 1NA1B 2WAAA 4NMIA 5CADA 1Y3TA 4PI0A 4DS0A 2ARCA 4JZRA 4NHKA 1W90A 1HDKA 3IKWA 2WNUA 4LIUA 2ZMKA 1AYN2 2R071 5F2WA 1S0JA 3M7AA 1UMIA 4XILA 1CAWA 2WO3A 2DU1A 1CQ9A 2VD7A 3IDAA 1PGSA 1W8TA 1ZX5A 1GZWA 2ET7A 2W95A 2BERA 3HMYA 5FYVA 4MGIE 4RGGA 5IVCA 3H1WA 1G9BA 1VBB2 1YFYA 3OYWA 5I8YA 4M4RA 1GQGA 2ZACA 1W6OA 1R093 2XVKA 4FFGA 3CU7A 2DU0A 4N7UA 2ORZA 1LB2A 5KR7A 1VRH3 1JH5A 2L9LA 2ZGMA 3UKNA 2ZHNA 2JDKA 1DBNA 3J7LA 3Q9OA 5FP9A 1RJ7A 1WGPA 1SFPA 4CDUA 2F4PA 4M3CA 1LGCA 3FFZA 1SACA 3VZJA 1DZTA 5FRAA 1DU3D 3DL3A 4UFIA 4OHWA 3GJAA 3ZIXA 3ZFEA 4D6QA 1MQTA 4QGMA 2JB8A 1CX1A 2NQYA 4DB5A 4YW6A 5KXBA 1UKRA 1W0NA 2E63A 4NPLA 5H9QA 4H3WA 2WBKA 3HQUA 1UX6A 5CZKA 1SCRA 1S55A 5DABA 5CFCA 1EAH2 3GCWA 1AR81 2Q1MA 4UYBA 4D94A 4Y20B 3IPVB 5DAXA 4XMIA 3T2TA 4UOJA 1W6PB 1TE1B 4NN0A 2RMU1 4HKOA 3SKVA 3MUZ1 5J96B 1PIV3 5DXDA 3O0WA 4P9IA 5JAXA 5IK8A 1S0DA 1EY2A 2VJXA 3LA3A 2ZGLA 2GH8A 4XAAA 3IAPA 4HANA 4YFWA 1VAKA 4JQRA 1LOGA 1FI2A 4HK8A 4BM8A 2GC3A 2RS12 2YG0A 4LA3A 2Y8KA 3SLIA 3THCA 1JHJA 1CZTA 2R49A 3M1HA 4HKWA 1NT0A 5HXMA 3MUY1 1US2A 4DQAA 1SFNA 1NOVA 5LA9A 3QD6A 4NIGA 3N9LA 4L8QA 1ZRCA 5GM0A 2X05A 1WMDA 1XNTA 4RQPB 2ZGUA 1JUIA 5FZBA 4G9SB 2J1UA 1HXS1 3LA7A 3VDAA 1K3IA 1CWPA 3VBUB 3IDBB 4XXPA 5LZ6A 5F5CA 1V6JA 1G9AA 2GU9A 4DRRA 3I2JA 4PIXA 5F5AA 5K4LA 3A7QA 1SCSA 3HN3A 1IS3A 1FATA 4HONA 1W6QA 2VY0A 4RS5A 4E4SA 3U14A 2RS11 5DUUA 1W3VA 2OKXA 3AB0A 4RS5C 1IG0A 3T2OA 3MDPA 5I0DA 3H8OA 1RUJ2 1VRBA 3KVBA 4HZFA 4EWAA 5G05L 5SV5A 3K3NA 1ENQA 3IB3A 4LIVA 4OQ9A 1RUE3 1D7PM 4AF9A 4FPFA 4YZ1A 2J7MA 4EN7B 4TWTA 1WA4A 1RB8G 2J1RA 3LB9A 2VQTA 3POYA 2OXBA 4JDOA 1CESA 5FXXA 4UWDA 3WP3A 4CXXA 1GNYA 1BMV2 1HXS3 5E88A 3ZN4A 2ZZQA 5JDBA 1OLRA 4K3UA 5IHRA 4CCDA 4BQ5A 3VBRB 1WW4A 3FZ3A 5CG8A 2JG8C 1BJQA 4YPJA 2XKPA 3OOXA 4AHZA 1BYHA 1N47A 3JXSA 4JQTA 4CUBA 4NO4A 3V0AB 3ZXGA 3GBWA 3RZKA 1W8WA 3AKSA 3WT3A 1C28A 1PK6B 2IVIB 3FMGA 3OEBA 1FNZA 2C26A 4CCCA 2VNRA 4EZHA 1K12A 1NCQC 3VBOB 2E32A 4YW3A 5JR7B 3MLJA 4Y1ZA 2W9XA 4BQ4A 1XE7A 2JICA 3WW4A 2LW8A 4QQ2A 5HCFA 1E5RA 1NCQA 4IEYA 1CR7A 2MEV2 3ZFFC 1AR83 3AKQA 1ZVFA 1TME3 5JOZA 5FMDA 1KDMA 5EQUA 4CU6A 3H7JA 1DYKA 2KA3A 2R072 2JECA 3WNKA 1A8MA 2QQVA 3NV4A 3HBZA 1SLCA 1HRV3 5C3SA 4O65A 1FT9A 4EV0A 4AVAA 4YM0A 5J98B 1ND2C 3GJBA 4QQOA 2WZPP 2FDGA 3OY8B 4BA6A 1DGRN 1PHMA 4XF3A 1COV2 2RR12 2ZX3A 4F83A 2MNGA 3TRSB 5I91A 2H6CA 1NCQB 1DQ5A 2JIJA 3VBOC 3VD3A 2HWF1 2HBTA 4NAOA 4WZFA 1O3QA 1KRIA 2WQ4A 3ACFA 3VBOA 4W4ZA 1RMU1 1V00A 1VBA1 2W2IA 3NW4A 4QKBA 1AR91 2XJSA 2E53A 1PK6A 4L11A 2XKOA 5HCAA 4RHV2 1FV3A 3VB9A 1HQLA 5JUVA 3VBHB 2E9QA 4EWDA 3HEIA 4YYOA 1XNKA 2WS93 3PNAA 2D43A 3WNXA 4CDUC 1R1A3 1RUD3 1ZZ7A 2Y6LA 4Y24A 3PURA 1IPJA 1XXNA 1ALYA 3ORJA 5A3UA 5JI9A 4FTBA 1QDCA 1QMJA 3LEGA 3AYAA 4DPNA 1G7YA 5FZKA 3NNMA 2G9ZA 3WNLA 2XPJA 2D97A 5FMOS 5FYIA 2DTYA 5A1FA 4Z8BA 5C8CA 2QDNA 4CEWC 2GAUA 4XBQA 2EALA 1Q8VA 1RUI1 3OEAA 3I2GA 1UQXA 3H8RA 4ZHNA 4CDWB 5L7OC 3JUUA 2QQPA 2NPIA 1KFUL 1F31A 2B9UA 2C6SA 2QFEA 3DXUA 2VAUA 4N43B 4GULA 4QT6A 4YG3A 5IVEA 1H2NA 4FPGA 4KBZA 1JUHA 3KCYA 1IPKA 5ISLA
chains in the Genus database with same CATH topology
1VJ2A 4I02A 1POV3 1KS5A 2JG9A 4RL7A 1XNDA 4NOTA 3RJ2X 3VZKA 3V0BA 2B8MA 4HVRA 4N53C 4N9HA 2BTVC 2BNNA 4DOUA 1V70A 3QCWA 2XJQA 4AEKA 5I0TA 3RS6A 3VL8A 1PGW1 4YRDA 4FBFA 4BE3A 2HWD1 4HK9A 2TBVA 2H0VA 1C8M2 2UURA 5J09A 4AEDB 4CDWC 4YARA 4OVEA 2R042 2PFWA 2VVDA 4NWVA 1J3QA 1UIJA 1TME1 4IETA 4XJ8A 4S2FA 4YVWC 4AEDC 2I74A 2UU8A 5E89A 3B9CA 1AYN3 3CNAA 1QJY1 4AI1A 5FLJA 1YI9A 4UW3A 4P5HA 4GXLA 4AI0A 5I0UA 1QNYA 3PVEA 1MS1A 3M3OA 1J1TA 1GNZA 4GMP3 4ZXKA 1D2SA 1XYOA 1VIWB 4YW1A 4Y20A 3IWZA 5FLHA 2Y38A 3R4SA 4MYEA 1YYNA 3RJRA 4M3CF 1ND3B 5CFCB 1QQP2 3MIFA 2GDFA 1S0EA 1X33A 3D82A 3PMSA 4B29A 4DMIA 1GBGA 4CDXB 4ZU5A 2XLFA 4TLFA 1AX2A 1ONAA 5BNPB 2A6WA 1LGNA 2R063 3MZHA 4M3CB 5JOXA 2RHPA 1NYWA 1SLTA 2QNKA 2JG8A 1NCRB 3HN1A 4XBLA 5CAZA 5C9AC 2HWC3 2Z2SB 2ZGQA 2ZZJA 2YPJA 1W6OB 2O8OA 2N7GA 1UU5A 1WCDJ 1RUG1 4FPKA 4E27A 3E6CC 1T6GC 1PNFA 3WY6A 3WQ7A 3BCWA 2PLV2 4QPGA 2VUAA 2A6VA 5GJ6A 1FX5A 2ARBA 4A2UA 5A33B 4CEYA 4X6RB 1BMV1 1AXYA 4L99A 1O3SA 5FQ0A 3V64A 1ENSA 4X8NA 4XIOA 4M3CE 1PNGA 3MPBA 5HCBA 1U5XA 1GFF2 4R9CA 2PAEA 2EAKA 1QXRA 4XDQA 2BW8A 1FOD3 1RL3A 1XRUA 1VBD3 3P3PA 1UMZA 1WLDA 1AVBA 1FMD1 2WNVC 4QXKA 3U0ZA 2XUMA 1GLHA 3RI9A 4AVSA 3E5QA 2BGCA 2RS52 4UW6A 3W58A 3WHUA 2UWAA 3ASIA 2XWBB 1MS0A 2DUOA 4N90A 1SLLA 4Y5Z0 3VN4A 4I0WB 1U12A 1H9PA 3NKGA 4QD2A 1LU1A 1R082 1M06G 4Q4Y3 3MIGA 3THTA 5KBFA 3ZFGB 3ZYIB 3SCHA 2FHRA 2OPKA 1NA1C 1QH6A 2YHJA 3H0OA 5KHHA 1H9WA 3OJBA 4BWOA 3AYCA 2D3PA 1Q3EA 4FPLA 3BB6A 1QU0A 5JMCA 2IXJA 2D93A 3JB8A 3VGIA 2X5IC 2LM3A 1Q5OA 2R062 4PLOA 2Y26A 2PELA 2XJRA 2Q0AA 4PDWA 2A3YA 5KC5A 1LHWA 3LA2A 3LCPA 3WDVA 5KXEA 3ZX7A 3J9SA 1KJLA 3RYRA 3CF6E 3MIDA 4MH0E 1ZNPA 1JTZX 3O0XA 4C0HA 3ZFGA 1NY71 3NAPB 4AHWA 1ZBE1 4AYUA 1NQDA 4YW4A 3ZFGC 3D0SA 1VR3A 3GHNA 1Z0HA 2Q4SA 1VP6A 1EPWA 4CP2A 2ILMA 1OQEA 4CYDA 5FOJB 1ZBA1 5DDJ2 1TNRA 3ZN6A 3TYJA 2JDZA 4LHLA 2A75A 4NHMA 4XFBA 3CO2A 1UW8A 1LU2A 2K9ZA 3I54A 2GZWA 5AVAA 4LBQD 4XFGA 5LEKA 4OULA 3SCGA 4JGYC 3M4FA 5AC93 3N4MA 2FZ2A 2CL2A 4XHBA 1C1LA 2QUOA 1AJKA 3KCXA 4B4RA 1L3JA 3U11A 1AF9A 4AXOA 4JTOA 5FO8B 1VBB1 1MEC3 3NVCA 4HVQA 3I8TA 1QH7A 4CEYB 3CEWA 5A33A 4JCKA 1OPMA 1KQRA 1LHOA 1SLAA 4COYA 3POWA 3S6PA 1FXZA 3MICA 4BHPA 2IFRA 1LGBA 1RITA 1B35C 1ASJ1 1REEA 3PJQA 4I0AA 4IV3C 4I3PA 1RINA 4FTEA 1MS8A 3B5LB 3TNPB 4J6GA 1XQNA 4B4PA 4AQTA 1UKGA 1X82A 2SBAA 3R4DB 5BNPA 3VZNA 3VKMA 5JIUA 3D4KA 5C9AB 1AL0G 2XJTA 3ZMNA 4CDXA 1ZBA2 3C3VA 5DDJ1 2F6BA 1VBE1 4FOYA 4Z2WA 1U5ZA 4JGZC 5E8AA 2PHWA 4BMBA 4RR3C 1G86A 4HL0A 3MFAA 1LOFA 2C9AA 2UWBA 1UPSA 3OBTA 4MGYE 5FQ0B 2D6PA 4QPIB 3USSA 5JZGA 3M3CA 3FX3A 1ZBE2 2YGLA 3MEPA 4BCUA 3UJOA 1LOFC 3FLRA 5AC92 1LEDA 3AMHA 2Z42A 5JOYA 4P9GA 1FPN1 2ZPXA 4CEYC 4Q4W1 1AZDA 1V6KA 1WMFA 2RS13 5A32A 1YHFA 1O3RA 3ENRA 3OF1A 1VBA2 1C1FA 1NCRA 1RMU2 4XJWA 2PHXA 2ZMLA 1EYBA 1Q8QA 5J7MA 2EA7A 1RGSA 1QWRA 3B01A 1QOOA 4PIZA 4W6YA 4ES8A 5BNOB 1G9FA 1YJLA 2DFBA 4OHXA 4P9LA 1QJU3 2C5DA 2RMU3 4IQPA 2VNGA 1N1YA 3NWKA 2ZX0A 1H1IA 5FO7B 4D7SA 4QQPA 1U5YA 1D4M2 1ND3A 4MX3A 1PGL1 2VG9A 5K0UC 3V0BB 2JG9B 1ZRFA 3SH5A 3SCFA 2W52A 3U10A 3OBRA 5BPXA 2RS51 4ATFA 1OQDA 1CD3G 5KHIA 3TB0A 4OI1A 1PO23 4ITCA 4XQ4A 3WDWA 2VOVA 4YZ3A 4ISQA 2BEOA 3KSCA 4Y22B 4AEJA 1JYIA 4LLFA 1OHFA 1CN1A 2DVGA 4QM8A 3NKTA 4RGAA 2MEV3 5LRRA 1NLSA 4AI2A 1CAXA 4LHKA 5FMOL 5C8WA 1HX6A 4AEDA 3OD4A 5JLVA 2E7AA 2IXLA 1YXWA 2VVFA 2W68A 3LWCA 2A7AA 3EHKA 4IXLA 4OLLA 2DCYA 2PLV1 2DURA 5C4WC 5FOBB 4EWEA 1AX1A 4MSVA 1W0PA 3WW1A 5EV7A 1HKDA 3VBHA 4AVCA 4MXVA 5GLTA 1EP0A 2ZGSA 1UPIA 4COUA 2HEWF 1RC6A 5JVVA 4OHVA 3KT4A 4XETA 2OW4A 2R043 4N43A 3B02A 4GWMA 4AQSA 1QDOA 5AFEA 1QJY3 4LTAA 1RUE2 1C8M3 3U4XA 5DUWA 2A71A 1GZ9A 2P34A 1LKNA 2HWB1 2VMGA 1OFSA 2XLAA 4XJZA 5EXOA 5C8CB 1QQP1 4BYYA 1ENXA 4AQ2A 4UBGA 1CVNA 2UYAA 1COV3 2RR13 1BEV2 3AKRA 2WFF2 4XOGA 4LLOA 1ND2B 4AW7A 1AL21 3AXEA 4FCAA 4U2AA 2A3XA 3N36A 2AR6A 3LSDA 4S2DA 1AHSA 1H1AA 3N35A 3VKLA 4CDQC 1OQ1A 1RIRA 2BVBA 3FBMA 4YSFA 1PVC3 2YV8A 5IUQA 1TME2 3V65A 5FDBA 2C1FA 3FLTA 4Q4W2 2DVBA 2KM2A 1MS4A 4GQ7A 4HETA 4RA0A 3WW3A 1C8M1 2E6VA 2P17A 5T5JA 5D8AC 3VBRA 4AFCA 1ND2A 4FXGB 4IV3B 2H0BA 1Z7S1 3OY8A 5DUVA 2XGXA 2HWE1 4Y1UA 5JOWA 3L2HA 1AR82 2EXKA 5I8TA 3IDEA 5FPXA 1HRI1 2ZTNA 3EQEA 3J26N 1RUNA 1MACA 2Q8OA 3USUB 3DGTA 4F3JA 1QHDA 3ZXEA 3WW2A 1MEC2 2K2SA 1RUF2 3FJSA 4R9DA 3KS7A 2BVVA 3ZXAC 2D6OX 5KXCA 1OA4A 1I1EA 4IV1A 4S2GA 5CFDC 4AEMA 1IOAA 1S2KA 2NZ9A 1FAYA 2ZMNA 1RUI2 5FFOC 3MIHA 4YNIA 1CGPA 4KWLA 4RFT0 2VU9A 1PVXA 3BODA 3DV8A 4Q0SA 2E51A 5DG2A 1HIXA 4EN9B 3CJIC 2ZBJA 3V0AA 2GN3A 2WS92 4JV4A 4P9JA 1ZM1A 5JWPA 2WQZC 1YWKA 4Q29A 4B7EA 3AZYA 1M4WA 5F6LB 1ZZBA 5I8SA 4G4FA 4AQ6A 5GLVA 2B45X 5GALA 4FT8A 1VBB3 1UCXA 3N7JA 1WLCA 2CWSA 1Q8OA 3H7YA 1CAXB 2PA7A 3ZXDA 1JN2P 1V9U1 1J1LA 2XHKA 4OZXA 5FCCA 1RUH2 2YUEA 1DIWA 1WW5A 1OKQA 5DUXA 1WW6A 4KGQA 4WVVA 4Y22A 1POV1 1DGWX 4GALA 3DPRC 3ECQA 1BBT2 1G9DA 1F8VA 4YVSB 4WVWA 2PHTA 3ME2A 3RNSA 3ZYGA 1W6QB 4RS5B 1DQ0A 4JC1A 3IPVA 4FPCA 4SLIA 3IT8A 2HWD3 5IT6A 4AGVA 2D6LX 2A6XA 3ALQA 4FO9A 1LHNA 3MF9A 4H7LA 4LE3A 3M70A 3VBUA 3VLBB 3KGZA 3WP6A 1WD4A 2WC2A 3GHMA 3VBFC 5C6CA 2X8KA 2R30A 2X29A 4HN1A 5K7PA 1RHI1 5BNOA 4J1XA 1APNA 4Q8KA 5F1RA 4GKXA 5A3MA 2CTVA 2R061 4W6WA 2YZ4A 4L2NA 3SXWA 4Q1PA 2WT2A 1X8EA 4MGKE 2H6BA 4HKLA 1POV0 3MGUA 4AWDA 2QZ3A 5A32B 2DVAA 4FPJA 1XU2A 2YROA 5SV8A 2EVXA 3IN9A 1H8VA 1MEC1 1HW5A 2EAAA 2WIIB 1CAWB 4A3XA 4XQWA 3ACLA 3BOWA 1BEV3 1H0BA 3WHTA 1HRI2 1SLBA 3VKNA 4PQ9A 3T1LA 1FNYA 4WM7C 1BKZA 1KS4A 4CDQB 2NM1A 5D1IA 4COZA 1NQJA 5C9AA 1MQTB 1LULA 5EYXA 1R091 3O7OA 3RMXA 1VBD1 1REDA 1UF2C 2RS33 4E2SA 4BIFA 4XF4A 2GMMA 2AUYA 3TNQA 3WVJA 4R52A 3R6SA 4HT1T 5BNNB 3OPZA 1QKQA 3N7MA 4GH4A 4KL1A 4FTSA 3WUDA 3M8LA 3MLKA 5ACA3 1NE4A 2PAKA 2D6KA 3JD71 1N3PA 1V9U3 1BVVA 2XG3A 3AZZA 1BEV1 4RD7A 2ARXA 4TYSA 4A7KA 3S30A 2WNUB 5FLIA 1FOD1 2OA2A 4BMEA 1UD1A 5IK5A 1SBEA 4LEJA 3LGRA 3UKVA 4LO5B 1MZEA 3S0MA 1K5MA 3W9AA 4N53A 2Q1ZB 1B35B 1MVEA 3TN93 1W6NA 3MIEA 1RJ8A 4AFMA 4WM8A 2VGDA 1A78A 3ZN6B 3E6DA 3HR9A 2WZR3 2Z5WA 1H2LA 1AR61 1ENRA 1S2BA 4YW2A 5T5LA 3OD0A 3CJIA 3GYDA 1G6NA 1IHMA 3NAPA 2GNMA 1YIFA 2ZABA 4M00A 3L9JT 5BNNC 2DVDA 2MPFA 1O5UA 1QJU2 1FYUA 2P3IA 4XIKA 5E16A 1QJY2 2NYYA 4PDWB 1OLQA 5L36A 1D0HA 4PF5A 4LBLA 5DG1A 3GZAA 4QHBA 2GC0A 2WNUC 4MZUA 4WVMA 1DZQA 3AM2A 2AREA 2ATFA 1O4ZA 1R092 4JGZB 5EJ3A 2ZGOA 5BXXA 3NO8A 4GB31 1UN1A 3QH6A 1PGW2 4B7KA 3QACA 2WZR1 1UU4A 3LOIA 1AYN1 3H1YA 3VDDB 5FTTC 1PO12 1PGL2 3TOJA 4JAAA 3PMEA 4Q4Y2 3PHMA 1W39A 4XFFA 4KU8A 1X50A 4YG6A 5GZCA 3JQWA 5IK4A 1VB4A 3ZYJB 2D5HA 1WLTA 4PBPA 4RHV3 4XPVA 4QPIC 4XHXA 1F5FA 2WA4A 3E5UA 4BQ1A 2QDRA 3I4IA 3O5SA 4K8FA 5JPMB 1CPNA 1PVC2 1AUYA 1WMEA 1H4HA 1H2MA 1MS3A 3LZZA 3MLLA 4Q4X3 4URTA 1OFNA 1QXPA 3TWIA 1O5LA 3ZSMA 5JSPA 3AFGA 2JX9A 4QPGB 3GF6A 4R4XA 1YI7A 2VULA 4LUKA 2AZ5A 2QCSB 4XF9A 3GBGA 3ES4A 3KZ4C 3DN7A 4Q0UA 1PVC1 2JG8B 2AYHA 5DDJ3 5HI0A 1VBE3 1Q8SA 4DNYA 4WM7A 4DFSA 1IKQA 2E7TA 1D4VB 4WZCA 4HPKB 4JGYB 5T5PA 4YGDA 3AXDA 2B42B 1SDWA 3AZWA 4XBNA 3AP9A 2BNMA 5T5OA 4MLOA 4K9SA 4LO6B 3X29B 3KQRA 4AGGA 2RM22 1R1ZA 5JSOA 1J58A 3H3UA 1PO11 4KGGA 1S0GA 4YZ2A 3ZDSA 2OZ6A 2GC2A 2LTNA 2A6YA 2ZX1A 1BCXA 2X5IA 2HWC2 2IXCA 4YGBA 5AVPA 4AK3A 1GSLA 3C2UA 4BIOA 1G8WA 3AMMA 1AR73 4YM1A 3D5OA 3AP5A 2OUHA 3RSJA 2UY9A 1C4RA 1O3TA 4AE2A 3G7DA 3FWEA 1EPZA 3AK0A 2JEMA 2NP0A 1CAUB 1N3OA 2WSUA 1AYM1 4S2HA 4AHYA 4FP2A 4Q1RA 1ZREA 1UL9A 3TAYA 3WP4A 3ZPYA 4FOWA 1RVF2 4XJUA 1LHUA 1LOCA 2HJIA 2ZHKA 4JRLA 1RTVA 2CGPA 5J3UA 3CJXA 4ES9A 1REFA 1AR62 1HV0A 2HWF3 3SITA 3GBFA 3SISA 2HWE2 4LA2A 2IZWA 2D6MA 4ISRA 1NY72 3I2DA 3KT7A 2R0FA 4NR1A 2BWCA 4G3YC 2ES3A 4OHZA 2W08A 5F6KA 1DG6A 1V6LA 1RUJ1 4KNCA 4KWKA 2OYZA 4CEWB 4PIYA 4CDWA 4GKYA 4P9XA 5BV6A 1ZZ8A 2EF6A 2BBVA 1Q43A 2V09A 4INDA 4AGRA 2NMNA 4DXZA 4OI0A 2IC1A 1DQ2A 1R1A1 1GICA 4QQLA 3ZFFA 4QMAA 3QLQA 2PLV3 5K8SA 1RUC2 1OI6A 1DQ6A 2ET1A 2G9FA 4E4ZA 4OI2A 3I7DA 3J4UH 4Y1VA 4CRQA 1PO13 4Y4YA 3V56A 3LOBA 4HSJA 3JD72 5FREA 4NWWA 2VW1A 1DF0A 2LALA 3HWJA 4XFCA 4K40A 4YM3A 5EWSA 3H8UA 4NVPA 2BQPA 2HWB2 1R1A2 2ZHLA 4DRVA 2P3KA 4RR3A 3PVBB 4Q0VA 1AX0A 1PK6C 1HLCA 3IMNA 1LENA 4QX5A 3LAGA 5CU1A 2BFUS 4BLIA 1J59A 1YUDA 1Z7S3 4W65A 3K51A 4PCRA 2ZAAA 4ORFA 1EAH1 1D2QA 1W6MA 1DQ4A 2B46X 4B8EA 1QJX1 1EV12 5CFCC 1TMF2 3VZLA 3WOGA 4E9KA 4HBNA 4I01A 4XTMA 5GZGA 2BFUL 3B3QE 1S0CA 5L73A 1LECA 3MI8A 4K6BA 1AYM3 2DCTA 4X8PA 5L7OA 3WDUA 4D69A 3VZMA 3KD4A 1MR5A 4NPRA 2NLRA 1K5MC 1TNFA 2OVUA 3SH4A 1N3QA 3NSTA 4AFDA 2QJVA 2GNTA 2A3WA 1LODA 1OSGA 2WINB 3NV3A 3OTFA 4L97A 1KDKA 2JE7A 2PHRA 4AVVA 3ES1A 1XNCA 1RUJ3 2DVFA 2PQQA 1LR5A 1HQWA 2QVSB 3H1MA 3OGJA 1PZ9A 2YC0A 2WJSA 1KXGA 4C1XA 1XU1A 5GZFA 4HSLA 2A70A 3FBYA 1BBT1 4FPYA 3JBG2 3L2YA 2I07B 4QU2A 4Q2FA 4ASLA 1GKBA 3PLQA 1ZBA3 1RUH1 1RUF3 3KLSA 3AP4A 3DPRB 2EXIA 4FVVA 1DGLA 2HYKA 3ROUA 2W0XA 2JE9A 3AJYA 4BLJA 3A4UA 2DCKA 2DUPA 4IESA 2D7FA 4A7ZA 1Y9QA 2O0OA 3UL2A 1VBA3 1AR93 1ZBE3 2OUJA 3DKWA 3WINE 2VUJA 2VQ0A 4RQPA 5GZEA 3H9AA 5JCTA 1G9CA 2PTMA 2WS91 1Y43B 4MXWA 1RUD1 4FPOB 1MS9A 4PLNA 3ZMOA 4D3WA 2HEYF 2K0GA 3FUOA 3VBSB 4Q27A 5T50A 4P14A 4TSVA 4RR3B 2A73B 1RUF1 1S0IA 4JDMA 3ZXKA 2IXHA 2ZS6B 4LBMA 2R073 3QBQA 4UW4A 4Q4Y1 1W6PA 3KT1A 2EXJA 1WCSA 4R8HA 1QF3A 2AGSA 3VBFA 4P9WA 4C91A 5KHKA 1DYPA 5ACA1 4NHLA 3RG0A 1IS4A 2ZHMA 3GZUC 3FUQA 2VPVA 3D8CA 5CNAA 1ULDA 1UZYA 2ETEA 1R083 1FV2A 3DF0A 1XNBA 4K1ZA 4XZPA 4AVBA 4R4ZA 2R1DA 1OPOA 3ZFEB 1PO21 4DINB 2XBO2 1ZZ9A 3WDTA 4CDUB 5LEJA 4RHV1 2RS31 1C8NA 3M3IA 1BZWA 2WNVA 1RUH3 2YY1A 4X6QB 1WD3A 2WA3A 3JBG1 3W59A 3OYWB 4META 4OHYA 1Z78A 4FSJA 4Z1VA 1D4M3 2CV6A 1GZWB 4WVZA 2Y0OA 1V6MA 2WFF1 2TNFA 4IV1C 1NLRA 2WLPA 5FPZA 4GB33 5BY5A 1H30A 1NA1A 4EN0A 1O4YA 3AP6A 1H8TC 4P9YA 3E97A 4YVSC 2HWE3 2RJLA 1JHNA 4ZKTB 3LKJA 3NV1A 4EROA 5C8CC 1H8TA 1KD7A 1SMVA 2JD4A 3HQXA 3NL1A 2R32A 4LHNA 1OOPA 4YVWB 1QY4A 1OA3A 4YZ5A 1S1AA 2VQAA 1CAUA 1RVF3 1CX4A 4XFHA 3G6JB 1JW6A 1QNWA 2JENA 4AG4A 1QOTA 2CWMA 1LOBA 4GWNA 3ATGA 4XMAA 3MW4A 2OZJA 5EFUA 4LBQA 2HWB3 3AJZA 4PJYA 2OIIA 5KC6A 5J37A 2I45A 1FOD2 4XFIA 3MYXA 4YGEA 2IXKA 1HRV2 5F9TA 3ZSKA 4V1PA 5K0UB 2D98A 4H14A 1WW7A 1R081 4FQZA 2SLIA 3URFA 2CGNA 3PVOA 3BIWE 3AYDA 1WBLA 1JOJA 4K1YA 4ATEA 5H9RA 4E2GA 4WM8C 3O14A 4D7YA 1O91A 1H2KA 1IKPA 4XF1A 2EIGA 4R9BA 1C3HA 3TN92 4JGYA 5LK5A 1AR63 2FBEA 4LUMA 5DZGA 5JIAA 2ZAHA 1GNHA 1JBCA 2G4IA 4IEUA 2ZKLA 2ENRA 2UYBA 3H3ZA 3WZ1A 2WFF3 5BNOC 3AMQA 4XJ9A 2YXSA 3IBMA 2HEVF 3J8F3 5T55A 3WCSA 4FOQA 3HIFA 4Q8LA 1S0FA 1W0OA 2WT1A 4GA9A 5ABJB 3H50A 1WUVA 2IWGB 5FBZA 5CBLA 1GZCA 2X53S 2XL9A 4JRAA 4FAHA 1QQP3 1I6XA 4W6XA 2VW0A 4Q4V3 4HFSA 3VBHC 1RUG2 2I2SA 3AMPA 3AKPA 2KXLA 4LO8A 4DY3A 1CJDA 1PMIA 1RMU3 1KFXL 5JZGC 2PYTA 3S7IA 1ULGA 1DHKB 3RPQA 3I59A 3PTYA 5T54A 4AI3A 4HVOA 2B39A 3A0NA 1SQ4A 4U36A 4LO4B 1X8MA 2RMU2 4YLZA 1LEMA 1PIV1 5LK7B 1CIWA 2YYOA 3CL1A 1IS6A 2BNOA 2DUQA 4QPGC 4E4DX 3VDDA 2B7YA 3B00A 2GC1A 2P3JA 3APBA 1RVF1 1VBE2 3O12A 5T3NA 5J36A 3SNMA 3RI8A 3B9IA 4CP0A 4R9AA 3KMHA 3ZSEA 1TEIA 2IXIA 2O8QA 1WLWA 1U0AA 1IGOA 1ZZCA 3R05A 4IEVA 3EBRA 3R4UA 1F2NA 2O1QA 3JU9A 2YMZA 1URXA 4JDNA 4XTPA 4WBBA 4LNVA 3R0RA 4M01A 2CNAA 1SBDA 1DGRA 1ZRRA 4Y1XA 1ULCA 1ND3C 4YZ4A 4Q4X2 2XLGA 2HWC1 1QJX3 5K0UA 3WP5A 5ABJA 1KITA 4O9GA 2ERFA 2DF7A 4K7JA 2DTWA 1DFQA 5GLUA 2FQPA 4Q4V1 3ZIWA 1YFWA 1LOEA 4LBQB 4YGCA 3TBDA 2VH9A 4AFBA 3VL9A 3OGGA 3A0KA 1DLLA 1YRZA 2A5ZA 2JJ6A 2GSYA 4YVWA 1OOPB 1CAVA 1RUOA 1SBFA 4IEPA 2XL7A 1C5IA 4BZ4A 5DZEA 2R16A 4TZDA 4C90A 5GLWA 3RMYA 4IERA 5EYYA 1ZA4A 2TUNA 2VXRA 3IM0A 3EO6A 3WQ1A 4PDWC 1VAVA 2RM23 5L19A 2VMIA 1JYCA 1VALA 2AH2A 1Y7BA 1YCIA 2ZGTA 1J3PA 2ZGNA 3KCCA 4GH4B 3VKOA 2GMPA 1GQHA 3SH3A 5CFDB 2WNVB 1AR92 1WCKA 4L92A 2EXHA 2WSVA 5KXDA 3MW3A 1BQPA 3ILNA 2G9GA 4LULA 2XJPA 3D6EA 5DZFA 1HRI3 3N7LA 3RRDA 3UV9A 1AL22 4LBKA 4XJAA 5I93A 3MF6A 4ONUA 4EN6B 1LTEA 4CDQA 3FC0A 1MS5A 2XBO3 3MFCA 2JXAA 1MQTC 1UU6A 3VBUC 1ULFA 2PAMA 1DZRA 2WKKA 1KJRA 4FPHA 1N1SA 2WZR2 2BWAA 1ZRDA 4LBJA 2BYVE 1Q8PA 3N7KA 2CGOA 4GB32 2MEV1 5KWRA 1AXZA 1FMD2 1VLNA 1RUC3 2XVLA 5K9YA 1OMIA 3PVNA 3TN91 1BXHA 3E5XA 1VAMA 1VRH2 2E7QA 4WV8A 3NV2A 1ZYBA 4FAGA 4XQDA 3LSEA 5D8AA 4MV2A 1YIPA 2V73A 3HD8B 5BNQA 2ZX4A 1GV9A 3GNEA 3WV6A 4AFAA 1A3KA 1TMF1 2YDEA 1MZ5A 3M2MA 4K20A 1QJX2 3ZVXA 3WXPA 3VV1A 3ZXFA 1RUI3 1RHI3 4SBVA 1V6IA 3VBFB 5JSRA 1H4GA 5CA6A 3JD73 2PHUA 2QE3A 1LRHA 3ZSLA 5B2GB 4CZSA 2LUWA 1VRH1 1CJPA 4YVSA 3JCIA 5FO9B 1Q56A 3VDDC 1XE8A 4A7YA 2VOWA 3CLPA 2RE9A 3O0VA 1ASJ3 3VBSA 3JB4C 1YJKA 1ZZ6A 4LO7A 2WLQA 2VNOA 3GALA 1LESA 2VECA 4LBNA 3VBSC 2P2KA 4K21A 4MXWB 4M0NA 5C4WB 4H55A 3AMNA 1MZ6A 3RYPA 3RDIA 2UWCA 3FHIB 2XVGA 1XYPA 4Z82A 2VW2A 1TMF3 3P3NA 2JKBA 2PHFA 1HXS2 4KQ7A 2Y0IA 2BUKA 5F5QA 2BPA2 3THPA 5FAXA 1LCLA 1UZZA 1NXD1 1RUC1 3INAA 5ABJC 2D5FA 3PJYA 2HKXA 3DPRA 3IIAA 4Y1YA 1GYKA 5L7OB 3ZN5A 4GMP1 3WDXA 4YFZA 1JXNA 2XBO1 1YO8A 4OI4A 4IV1B 1PO22 2HWD2 4XFAA 3SMHA 1QOSA 2AENA 1SEFA 3USUA 2DFCA 5GLZA 1A8DA 3BPZA 5ACA2 1BBT