2Z79A

High resolution crystal structure of a glycoside hydrolase family 11 xylanase of bacillus subtilis
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATAGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase A
publication title Crystallographic analysis shows substrate binding at the -3 to +1 active-site subsites and at the surface of glycoside hydrolase family 11 endo-1,4-beta-xylanases.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 49
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2z79A00
3MF9A 3WP3A 1OLQA 1HV0A 1REDA 4S2HA 5EJ3A 2DCJA 4HK9A 3M4FA 3VZNA 3LB9A 1OLRA 3WY6A 2JENA 5K7PA 1C5HA 3WP6A 1REFA 3VZLA 3WQ1A 3WQ0A 1T6GC 2B46X 2QZ3A 3VZJA 4XQ4A 3WX5A 3AMNA 3VLBB 2BWCA 3HD8B 1HIXA 1BCXA 3EXUA 1KS4A 1XNBA 1XXNA 1KS5A 1C5IA 4HKOA 3VZKA 2Z79A 3WR0A 2BWAA 4IXLA 3WP4A 1XYNA 2D97A 4NPRA 3RI9A 3WQ7A 1IGOA 1XNCA 3VHPA 3AKSA 2NLRA 1XYOA 4XQWA 2C1FA 2DCKA 4S2GA 2B45X 3ZSEA 1REEA 1H4GA 4HK8A 3AMMA 1OA4A 3VHNA 1XYPA 1W2UA 2BVVA 1H1AA 3VHOA 1AXKA 4S2DA 4HKWA 2DFBA 3MF6A 1UU4A 1F5JA 3RI8A 3AKRA 3VL8A 1H8VA 3AMHA 2DFCA 1UU5A 5K9YA 1XNDA 3VZOA 1OA2A 1PVXA 2BW8A 3MFAA 2B42B 1H4HA 3B7MA 1TE1B 2VGDA 5HXVA 2JICA 4HKLA 1BK1A 1BVVA 1UU6A 1QH7A 2VULA 3AKQA 4H7MA 1HV1A 2VUJA 3WXPA 3WP5A 2F6BA 2DCZA 3VGIA 1H0BA 3AMQA 1ENXA 2D98A 1OA3A 2JEMA 3AKPA 2VG9A 1UKRA 3VZMA 3LGRA 4XQDA 4XPVA 3WT3A 4S2FA 3O7OA 1NLRA 3AMPA 1M4WA 2QZ2A 3AKTA 1XNKA 3MFCA 3B5LB 2DCYA 2NQYA 1QH6A 1YNAA 3VL9A
chains in the Genus database with same CATH superfamily
1GZ9A 1SG3A 2R6QA 4RHV2 4NRPA 4HVRA 1YFXA 5DZGA 1JUIA 3HWJA 5DUUA 4KWKA 5B4XA 5FP8A 3GJBA 5I8SA 3UGGA 3ZX7A 2NZ9A 1S2BA 2DUOA 4LNVA 4RGGA 4I01A 3N9PA 1N3QA 4FT8A 1V9U2 4XEZA 4IEPA 5C8WA 2ZEXA 2VMFA 3PUAA 4XUTA 1U12A 2KD7A 2WDBA 3DGTA 4SBVA 4XFAA 5EJ1B 3VZJA 1GNYA 4BHPA 1ULOA 1CZSA 5FLHA 1LOEA 4K21A 1US2A 2R071 4PJYA 3WW4A 1V9U3 4N7UA 2E32A 3B02A 1KS5A 3CMGA 1C5IA 1NCRB 2P2KA 2WKKA 4AI8A 4KL1A 4F3JA 3H8XA 2DVGA 3LQCA 4W4ZA 5E16A 1JOJA 2RS11 4ZONA 3KB5A 4I2OA 5FZKA 3VHPA 1HX6A 1MEC1 1RVF2 2W94A 3GYDA 1WZXA 1XYOA 3GZUC 4OYUA 4Q4X1 2Q8EA 2JDHA 1KJRA 3RG0A 3KHCA 1KDKA 1XU2A 3K3NA 4LOTA 3INAA 1PZ9A 4D6QA 3IWZA 5F37A 1A8MA 4L0PA 1CAXA 4AWDA 3OBTA 1RVF3 3M3OA 1WD4A 1IKQA 3FFQA 5C4WB 4XUPA 3RDIA 5E89A 1JZ6A 4HKWA 4LO8A 4M4PA 4P9XA 5F39A 3MIGA 3GBGA 2NPIA 4RGKA 2ZGKA 4ASKA 1CAVA 2VECA 2ARCA 2AACA 2CSGA 2GP5A 3ECQA 1ZZCA 4J6GA 3GNEA 5BNOA 3BIEA 4F7ZA 2RV9A 1FAYA 3GGLA 4K9SA 2WNUB 3THPA 2HWD1 3I3MA 1KJLA 5F6KA 3DYMA 3AP5A 3FN9A 3VBOA 1BLZA 2VUCA 4JDMA 4BQ5A 5I0UA 5JPMB 2QJVA 4QD2A 4CDQA 2P1BA 3P1IA 4IGOA 4COWA 3AYCA 1J83A 1PVC2 1AYM2 4A3XA 3IMNA 2VH9A 2XB6C 1ZREA 5LZ6A 2ES3A 5BNPC 3O1MA 3UK9A 1BK1A 2YY1A 4NIGA 1BEV1 1PVC3 1AYM3 2Z4FA 4OUEA 4MVTA 3AL6A 1VIWB 2WZPP 3PJYA 1YRZA 3K77A 4AEMA 2XWJB 4ATFA 1ENXA 3NV3A 3AKPA 2P6CA 3LKJA 4JGYC 4URAA 1LOBA 1OLME 3N7LA 4KH9A 3BVCA 4BQWA 1DU3D 4UW6A 3LGRA 2PYTA 4EN9B 1J84A 4GAZA 4RS5C 1JZ8A 3T1MA 4LBQD 3H1WA 3HT1A 4GH4B 4AF9A 3NKGA 1C1FA 1W6PB 1CESA 4G3YC 4IETA 3O1SA 3AKTA 1C8NA 1OF3A 3BOPA 2JG9A 1ZM1A 2P5BA 2JG9B 2R0HA 3TYJA 1YNAA 1LR5A 1AUYA 3E5QA 2P3YA 4IEYA 3VD5A 2VW2A 1R082 5EYYA 3WP3A 1S2EA 4XXPA 1V9U1 4IE5A 4NUBA 4V2VA 1H8TB 1V6NA 3ES4A 4B1LA 4ZS3A 3DYPA 1EUTA 1JUHA 1ODMA 4COZA 2WSVA 1R083 1J58A 3VKLA 1RTVA 3KWVA 4NMIA 1IG0A 1S55A 2LROA 1MS9A 4HFSA 4HL0A 2XL9A 1K5JA 2AREA 4Q0VA 4QPIB 4JGZA 4IDZA 5SV8A 3KM5A 4YGCA 2WZR2 3L2YA 1RVF1 3EBRA 5A6ZA 4MGKE 1LULA 5A3MA 1BCXA 3KV5A 3OG2A 3TEWA 2GC0A 2ZGLA 4DXTA 3TN92 1WCSA 2OT7A 5FZAA 1O8SA 1PMJX 5K0UC 2WZR3 3C8XA 2YBKA 3HNMA 3S30A 3AP6A 5CVRA 4ZU5A 2OA2A 4ZU7A 3VBUC 3ZYJB 4QGMA 3TN93 3CJXA 1XE8A 3PHMA 3VUOA 4IV1C 1F5FA 3TWIA 4EWAA 1RHI2 1VPHA 1X8EA 2VBBA 4URTA 5IVEA 4UF0A 1ZYBA 4BYYA 4AFCA 1BZWA 2HWB2 1W2UA 2V4AA 3A21A 2ZKLA 3FX3A 3MLLA 4COUA 3WDTA 3VKOA 5BYNA 1WW5A 3BIWE 3MBWA 3DUIA 3H50A 1RHI3 3A0KA 1HQNA 1KFUL 1ONAA 2ZJCA 3LSEA 1AR63 1QY4A 5C7GA 2VZQA 3U1XA 1HJGA 1SLAA 2HWB3 1JYNA 4WM7C 3ZN5A 3I49A 1QU0A 1PK6B 1W05A 3N9OA 4PF5A 4NWVA 4UW3A 1OVSA 1PVC1 3WDYA 1AYM1 5F6LB 1H2NA 1D0HA 2GC3A 3A7QA 3AP4A 1SPPB 3K51A 5FXZA 1SZBA 4OFGA 1OURA 1O5UA 3VZOA 3CU7A 3WF4A 1WKYA 2YBSA 2ET7A 1DDLA 2BTVC 1PMIA 3ACGA 3ACHA 1J3QA 4KG0A 1RIRA 2X29A 3WV6A 1K12A 2VTFA 3K3OA 2E51A 3GJAA 2BU9A 1AL23 1K5MB 1GP6A 3AKQA 3GHNA 2ARBA 3MV11 2QTWB 3GCWA 1JHJA 2VVFA 3K4ZA 4OMCA 5FCCA 3LDRA 2FHRA 4X6QB 2PHLA 1GV9A 1RUI2 2ADDA 1FATA 4Y1ZA 3UJOA 5JZGB 1UIKA 5IATA 5FK8A 1IQDC 2G4IA 3T2PA 1DYOA 3E1F1 1ND3B 1UKRA 2WT2A 3NNMA 3C2UA 2X5IB 2JX9A 2PTMA 5FZ8A 1RUI3 3N4MA 1IOAA 2VOXA 4MGQA 4XJAA 4ZKTB 1RUF2 3GHMA 4META 1BHGA 3M3EA 1R081 1G9BA 3H3LA 3RYKA 3UKVA 1AZDA 1Q8SA 2A3WA 2I2SA 5LEKA 3MFCA 4GALA 3B5LB 4GD4A 2UY9A 2JE7A 1YFYA 3GDBA 3VHRA 2CL2A 3CEWA 3T4VA 2XH6A 5LBEA 3SEPA 3LPFA 3MF9A 5BNOC 4V1PA 1MZEA 4DXSA 4A7YA 1VBC3 4YGDA 3H7YA 2BYVE 2KA3A 1HKDA 2WNEA 3J7HA 1JYVA 4ITCA 1WUVA 4H2AA 3RSJA 3UGFA 2WZR1 4D8MA 4NHYA 4PDWB 4JHTA 3FJSA 3SCHA 3AP9A 3WF2A 4CDQC 5JSRA 1TQ5A 1KDMA 2HWE2 5KHGA 3WNNA 4BK5A 1I6XA 1PNFA 3TN91 1LB2A 3ZXLA 3GALA 2YU1A 5A70A 2R7EB 3H0OA 5LA9A 3J8F2 5FZOB 4Z8BA 2ZX0A 4IV3B 1PO22 2HWE3 1US3A 4D6SA 3VBHA 4XDOA 1RINA 2HWF2 1VBD2 4YNIA 1UNBA 1S0CA 3POEA 4CPBD 1RHI1 2KM2A 3IDBB 1Y43B 4LBKA 4EZ4A 3AYAA 4FBFA 5J96B 1PO23 3MIHA 2HWB1 4FO9A 4M0NA 1W0PA 4NO4A 2HWF3 4DINB 1OH3A 4KQ7A 3OB8A 4FOYA 4QU1A 1VMFA 2QQPA 4BQXA 1Y9GA 4E4HA 1DBNA 4Y24A 1Y9QA 1YQ8A 2OPWA 4KBBA 3FFZA 4O9GA 4TZDA 1W9FA 1WMEA 1CR7A 3KT4A 4S2DA 4HZFA 3N3HA 1AL0G 5GALA 5AVAA 2J22A 2KR2A 4PT6A 4NIDA 2JG9C 1LEDA 3RYRA 2CU5A 1HDKA 2BGOA 1W9YA 3BTYA 3D4KA 4OUMA 4JTOA 2WNVB 1H6XA 3OPWA 1V6OA 1W99A 2OX0A 4LUKA 1Z7S2 4QXCA 5CNAA 1GWKA 5EQUA 4QB2A 4BPZA 1AL21 3SEEA 2AR6A 2D6KA 1H8TC 2DUQA 4LO5B 3RWKX 4LHLA 2UU8A 4MXVA 3PVEA 3ZXFA 2ZX4A 2P4EA 1G9DA 5FPBA 3FHAA 4C0BA 1Z7S3 5IVCA 3EO6A 4FTEA 3POWA 1CN1A 1ZRDA 4AAPA 1GR3A 4BQ1A 2CV6A 3AJZA 1H4HA 1MS5A 3UNPA 3MO4A 5F1RA 4LR4A 1RUI1 5FYCA 4CCLA 4DFSA 4JGZC 2VGDA 5HXVA 4XTPA 1LOCA 2JE9A 2WIIB 4AEDB 1HLCA 2DVBA 5FP9A 2A1XA 3ZYBA 5LK7B 3O1OA 3OUHA 1HV1A 3HIFA 4RR3B 3R6SA 4Q8KA 3THCA 4E8DA 3CZUA 2C6SA 1J59A 5IAXA 3FHIB 3JB4C 4P00B 4ES9A 4INDA 1V6LA 5BUVA 1LOGA 1LOAA 1O3QA 3ZXKA 1U5XA 1V00A 3VKMA 1VBC1 5FP3A 2JDZA 4QX0A 3VLBB 5A33B 2XONA 1OQEA 3OJBA 1VP6A 2VY0A 4CCCA 3RZJA 1UPIA 5F32A 5IT6A 3N9QA 1R1A2 1QJX3 4CCKA 2ZAHA 2G9ZA 4JKMA 2WNOA 5DN2A 3V64A 1G9AA 3NL1A 1QH6A 4GMP1 2VNRA 5A3WA 2FZ2A 3ME2A 4N53A 5FPAA 4E4ZA 2G9GA 2EF6A 2HWE1 3F2ZA 1GQGA 4XBLA 2AYHA 3WNLA 4GMP0 2B8MA 4GIQA 1JYXA 3B00A 1UOBA 2DCJA 5GZGA 3J8F1 1BMV2 1JOBA 1ND2A 2XJPA 2A3XA 1FI2A 1PO21 2LALA 2JENA 1QF3A 2HWF1 2Q8OA 1VBD1 3T09A 4CDUB 4LXLA 1W0NA 3ZDSA 4AQ2A 5FQ0A 4LLOA 5FO9B 4XFHA 5LY2A 4H14A 2XXZA 3B9IA 1NXMA 5FWEA 3IDCB 4QPGB 5A3PA 1XXNA 2XJSA 4ORFA 4Q5OA 2UURA 1BJQA 4JKLA 3VZKA 2FCTA 5JXGA 3NVCA 5APAA 5KR7A 1QJEA 4ZY9A 3THTA 4KWUA 5CEHA 2HJIA 4A45A 2C1FA 2DVAA 2PAMA 1UPSA 2RM22 1UKGA 4AVCA 1BQPA 3ILNA 3P3NA 5FV3A 4HK8A 5C9AA 3HNYM 1NAEA 2I74A 5D21A 2FDGA 1CJPA 4JTNA 1GOGA 1Z7S1 1PNGA 2DBIA 2IXCA 1XSRA 3ILFA 4IEQA 3MPBA 5FWJA 5ACA2 1UZVA 1POV3 3BPSA 3R4UA 2VW0A 3AZXA 3CF6E 5FMOS 4AVBA 5GJ6A 4IW3A 4AQ6A 2Y6FA 1LKNA 5T5PA 5FO7B 2JKXA 4TSVA 2OUJA 4RFRB 3D6EA 1BBT3 1ZBA3 1YQ6A 5ACA3 1VRH3 3ACIA 4Y1XA 1BK0A 3ZYRA 3RVHA 3ROUA 5CAZA 2HYXA 4HVOA 4HBNA 5L36A 4PDWC 4G4FA 2E31A 3GZTB 3ON7A 1RUNA 1DQ5A 1Q8OA 2WR9A 1UX6A 4XBQA 5FMBA 4YM1A 5EIYB 5LRSA 4BMBA 4UW5A 4IERA 4N43B 4FVVA 4IV3C 1IPJA 2UY8A 3ZFGA 4FXGB 3VBHC 3FL7A 1EP0A 4OI4A 2K0GA 3W5MA 3Q9OA 1NY72 2DBNA 3CO2A 4KNCA 2VZSA 5FP7A 3ZDVA 1DZQA 3WZ1A 4DEVA 1URXA 4M3CE 1OA3A 4EROA 4I0WB 1X82A 4GZ9A 4JZRA 1OOPB 5A32B 3NV1A 4AR2A 3LA3A 2XUEA 2WT0A 2XVLA 4JCKA 4AQSA 4KU8A 2C5DA 4FPOB 1YI7A 3V0AA 4OMDA 2BGPA 2RR12 2YHJA 1OQ1A 3OUIA 1HN1A 1OVPA 2MPFA 2PXJA 3AMPA 5BNNA 5JXIA 2E63A 3C7HA 3R4DB 4X6RB 5D8AB 3MUZ1 3T0DA 3HQUA 3RZLA 4HPKB 2XQXA 2OW4A 4X8PA 4H3WA 2UWAA 1AJKA 1AHSA 4O7XA 3J4UH 1O3SA 1BMV1 4B29A 2IXHA 2YXSA 4RQPA 1D4M3 1G6NA 4NAOA 2CGNA 2AH2A 4CVUA 2O8QA 2J1UA 5IUQA 4CDXA 1MPXA 1YFUA 1H2LA 2W52A 4XAAA 1LOFA 4EWEA 3OOXA 3VBSA 1ZZ6A 3WP6A 1ULDA 1ENRA 4CZSA 4FTSA 1WMXA 2DU0A 3NJXA 2EIDA 4D94A 4Y5Z0 1ULPA 2ZGUA 4AEDC 5HI0A 2JDMA 3RFRA 3AXDA 3FUQA 4YGEA 1DGWX 1CPNA 4YVWB 2PQQA 2RM21 1KS4A 3T2OA 1QMJA 2D93A 4CRQA 4XFIA 4Q4Y3 4Z92B 2Z79A 4IXLA 4NPRA 4RGAA 1W28A 4A41A 4B1MA 4B8EA 4YSFA 1POV1 3DPRA 3BCWA 3H3UA 2JDNA 4CCJA 5AVPA 1UD1A 2CAUA 3KV9A 2Y0OA 4Y22B 1BBT1 2W87A 5FY7A 4MX3A 3GZAA 5GKAC 5ACA1 3O1PA 1VRH1 3Q8AA 4P9JA 2Z2SB 4UBHA 3PUIA 1W6MB 2P3JA 3BPZA 4H7LA 2CYFA 1NE4A 4BLIA 4YVSB 4YG0A 2ATFA 1TME2 1SFYA 3K4AA 3L2HA 3VHOA 1MQTA 3T3YA 3USUA 4FFIA 3CIHA 3WW3A 2ZKNA 1MQTB 3LAGA 2VOVA 1ZZ8A 3SNMA 5I0RA 5ISLA 4RN5A 1H8VA 2JECA 2CDOA 4XFCA 3U4XA 1F8VA 1TME3 2VUAA 4NIIA 2G9FA 4TLGA 5CB7A 5DMYA 3OUJA 1DYPA 2ZACA 4XDPA 4CU7A 1QJU3 2W2IA 5A1LA 5A7QA 1F9KA 3DEMA 4NN0A 2GSYA 3ZFEB 5LCWL 2NM1A 3WG1A 1ND2C 1ZX5A 1MZ6A 1QXPA 1JZ7A 1W90A 1QGLA 2RS12 3KZ4C 4AVSA 2UWCA 5CYYA 2YB7A 1NY71 2GNDA 4K8FA 1FV3A 3T0AA 3ZYGA 3HN3A 3I3DA 2LUWA 1MS0A 1DGLA 1GU3A 1UXXX 2JICA 2Y8KA 5IW0A 2IFWA 1DG6A 4C1XA 1UU6A 5FMOL 1GP4A 1HB2A 4MADA 4W6XA 5FUNA 3VDAA 3ATGA 2HWC3 1CVNA 4AL9A 4MXWA 4B4QA 3BALA 4BB3A 1LHWA 1NLQA 5B4NA 2RJ2A 2RR11 1PZ7A 3FBMA 5DAVA 1S0DA 5LEJA 4PI0A 2RVAA 3U10A 2W91A 3VBRB 4LQRA 1D4M1 5FYUA 2VVDA 4CA9A 3APBA 1IS4A 3ZYPA 3D3AA 4XPVA 1YC61 1DQ2A 4AYUA 4E27A 1HB4A 3K48A 3IIIA 3MW2A 2HWD2 1SMVA 4YW5A 3WNPA 1GMMA 2UYBA 1D4VB 2LW8A 2VZTA 1ZA4A 3GCXA 3ZVXA 2H0BA 4QQLA 2YFUA 4IEXA 4CEYA 2RS32 1FNYA 4D7SA 1KFXL 4PLNA 5JI9A 5JCTA 1B35A 1JZ4A 3RRDA 4Q4V2 2AEYA 4U2AA 5K0UA 5C3SA 2R062 3E6BA 3E97A 5KHKA 4IE7A 4MV2A 1JTZX 4CYDA 1GOFA 2HEYF 2RS33 4IE6A 2PHUA 3VBUA 2Q8DA 3ZR5A 5FZ7A 1CIYA 3ZN6B 4HOOA 1PGW1 2FDJA 3GBFA 4B7KA 4DUVA 1S0BA 4L11A 3TNPB 5C5UA 4Q4V3 4WVWA 2R063 1WCQA 2A70A 3OYWA 1CGPA 3KCYA 3AM2A 3VZLA 2SBAA 4ISQA 1RJ7A 3I2IA 2VMIA 4GJYA 4XQ4A 3WNKA 3BB6A 2DVDA 5DUWA 2VZPA 4AGGA 5DAXA 1C1LA 1XBFA 4GWMA 1DQ0A 3RYPA 5CFDB 3WHTA 2J1SA 3ZFGC 4HKOA 3IKWA 4O61A 1QJZA 3HAGA 3DN7A 3U78A 2PLV2 1N1TA 5GZDA 2BBVA 2RHPA 2AGSA 3EYPA 1QOSA 2DYCA 3POIA 4UOJA 2VQUA 4BE3A 4ZZ8A 3ZFFB 1GP5A 2B45X 1TME1 1H1MA 3HPNA 4LBQB 1NXD1 3DKQA 1OHFA 1DFQA 4UFKA 5FYZA 5BXXA 2PLV3 3WDVA 1QJU1 4WZFA 4A7KA 2ZGNA 5K7PA 1R092 2UYAA 3PMSA 5FY4A 2EAKA 1LESA 3NWKA 5A80A 2VNGA 5C8CC 1PGL2 1F4AA 3U07A 5A3TA 2WO3A 5BNNC 5EHDA 3GF6A 5FP4A 1HRV3 3PIGA 3POYA 4IL7A 3JU9A 1QDOA 1R093 1VAVA 3ELNA 2JJ6A 4YM2A 4OHYA 3HQXA 2QQVA 1NCRA 4P9YA 4NVPA 4QGLA 4XABA 3RMXA 5IK5A 5A6YA 2FDKA 4LA3A 1H2KA 3WUCA 1QIQA 4RQPC 2R16A 1UU5A 4D3WA 1GKBA 1HRI2 1NA1B 3HOBA 4R4ZA 1YLLA 4CDXC 1UY0A 1LOFC 3TEZA 2ERFA 1OFSA 2A73B 3VBSC 5JAXA 1JI6A 4IESA 4Y1UA 2C4XA 1HRI3 2JXAA 1YI9A 1YHFA 4Z07A 5C4WA 2XR4A 2DV9A 3SISA 3B7MA 2RDQA 4K7JA 4LIVA 2Q1MA 5L19A 3T1LA 1UOFA 2VL4A 5KWRA 2OS2A 4Q29A 3POFA 1MZFA 2RS53 2WBKA 4H7MA 5GZFA 1S0FA 3I8TA 3MIBA 3FC0A 5G04L 1QJFA 3WXPA 4BJ0A 5IJRA 3B94A 1XOYA 3WDWA 2WNUA 4AE2A 3DPRC 3POJA 1L7LA 2GC2A 5DZEA 5FLJA 3VZMA 3O5SA 4Z82A 2VBPA 1UN1A 4P02B 4XUOA 2RS31 4QQHA 1LHUA 1UXZA 1Y3TA 4XYXA 1F15A 1ENQA 3O7OA 1NLRA 2OVUA 5LBBA 3BU7A 5FYYA 4Q4V1 4DUWA 2VQTA 2Y0IA 1GNHA 2R061 3OD4A 4HXCA 5L73A 5T52A 3Q8BA 3J7MA 1MQTC 1OSGA 4GWJA 4TLFA 5E8AA 5DUXA 4YW3A 5L7OB 5DG1A 3PMEA 3NQHA 1E5SA 2GNMA 3Q8FA 2E7TA 1ENSA 1J1TA 1S4CA 1QXJA 1X8MA 1W2NA 4IEUA 4RL7A 5A7NA 5T50A 3VDDB 1ST8A 1SDWA 1W8UA 2Q30A 3MV01 4YYOA 4DRVA 3BODA 1S1AA 3ZFEC 4N9IA 5JOZA 2BQPA 1D2SA 1O91A 3NNGA 5FMCA 5C3RA 5FOJB 4AI9A 3LB9A 3KLSA 4UW4A 1WW6A 5FUPA 1C5HA 1REFA 4JX0A 2FDHA 1SLIA 4GH4A 1D0GA 1XE7A 4NWWA 4YW6A 1UZWA 5FKCA 4AGRA 3K2OA 1W6PA 3JBG2 2VTXJ 4P9WA 4QKNA 4XF4A 4E2QA 1S0JA 2PLV1 2QCSB 1XU1A 3ACFA 3HD8B 3MEPA 4UFHA 4MGTA 2R30A 5CBLA 5KXEA 3O0VA 2Q8CA 1W39A 3MYXA 3JBG3 4CU6A 2D97A 2GP3A 4TTGA 3V0BB 4HN1A 1QNYA 1R091 4LOSA 2JDKA 2V09A 2NLRA 3H9AA 1PGL1 2WFPA 4UFIA 2A5ZA 4BU2A 5FOBB 1H8TA 1GQHA 4ZXEA 3WD5A 1XQNA 1RYYA 1SLCA 4J1XA 4Y1VA 1Q8VA 3UT0A 1NQDA 2ZHMA 3FLRA 2JG8B 4WBBA 4QDSA 2VUDA 3E6DA 2Z42A 1UY2A 4DQAA 1X9TA 2VMGA 4QPIA 3ETPA 4A6SA 5F2WA 2ET1A 1KXGA 3O0XA 4LHKA 5T55A 3ZXAC 1HRI1 1VR3A 1C8M3 1ODNA 3JQXA 4CEYC 4AI0A 5ERLA 2XKPA 4E4DX 2RDSA 2WYFA 2PAKA 1B35C 1RGSA 3N36A 4LK6A 5FXWA 1K3IA 4C91A 1U5IA 3DL3A 3LIGA 5GLVA 1NG0A 2WQZC 3I59B 5F3GA 1A6CA 3T30A 4FPHA 1Q8QA 5CG8A 2JDPA 5BV6A 1CQ9A 2ZEYA 3O14A 2GN3A 4HG6B 1OD3A 2VU9A 2YYOA 4XUQA 1G7YA 2XHKA 3C7GA 4AI1A 1AR62 3S57A 4XMAA 1G86A 1M06G 1WMDA 4QAWA 3WG2A 2VCBA 1KQRA 4COVA 1RL3A 3C7FA 3V65A 1PK6A 3B69A 3T4HB 2XWBB 2HEWF 1I1EA 1HXS3 3VGIA 1UL9A 2FMDA 4XF9A 3ENRA 4N8MA 1SPPA 4P5HA 2OYZA 3ZFFC 1W6OB 4YZ1A 4H55A 3BN6A 2FMYA 4OI1A 5KHIA 5FJHA 5DABA 4G9SB 3WSOA 4OZXA 1EPZA 5KBFA 2QFEA 3U4SA 5FMDA 1X7NA 2XVKA 3OGRA 4KI5M 3BUCA 1OUSA 2W9XA 1AL22 3AZYA 3WQBA 3POSA 1J3RA 3RGBA 1UY4A 3RJRA 1J1LA 1MS4A 3NJVA 2BZDA 4MHUA 1GSLA 2DCYA 3IPVB 3OY8B 3LZZA 1K5MA 3WNOA 1V0AA 1NCRC 3PL0A 3ZPOA 3THDA 3EMRA 4YZ5A 1VBE3 5FZHA 2YFZA 5JZGA 2BPA2 1LGCA 1YIFA 4C1WA 2J1TA 1A8DA 1IPKA 1ND3A 3JBG1 4O65A 1MS8A 5D2AA 1RXGA 2X5IA 4LE4A 3LE0A 2GC1A 1YQ5A 3M3IA 3U37A 2ZHNA 5JIAA 1JMUB 3PIJA 3JUUA 4KGQA 2JDAA 4DY3A 3WQ0A 4FOQA 5IK8A 1TVGA 1JXNA 5GLUA 2BUKA 5DAPA 5L9BA 3AZWA 5C4WC 1A78A 5ABJB 5T5OA 3BYWA 3G7DA 1ULFA 3QCWA 5JVVA 1VBC2 2ORXA 3RQ0A 5C71A 3DKWA 5CFCB 1BYHA 3ZOIA 1V6JA 3BTZA 2GH8A 4U36A 1UMZA 3AFKA 4YARA 1D2QA 2WNUC 4XHBA 2JIGA 2ENRA 5F5IA 3HN1A 4CUGA 3GBWA 1CZTA 2VZRA 3ZSEA 2R49A 4JHZA 4PDWA 5GZEA 1ZZ9A 5FZMA 4Y26A 3HJRA 4CU9A 1WGPA 3KF5A 2ZMKA 1XYPA 1Z0HA 5EFUA 4CU8A 4GKYA 4CCNA 4B3NA 1OQDA 1AXKA 3O0WA 5FZOA 2EIEA 2XHNA 4IV3A 4A7ZA 1G9FA 1NCQB 1O3TA 4X8NA 4EN8B 3LF7A 1F5JA 1QOOA 3PDQA 4DO0A 4EWDA 1WBLA 4QHBA 2D6PA 1GBGA 3AMHA 4CEWB 1OH4A 1QKQA 1UAIA 2ETEA 2DF7A 1XNAA 3ITQA 2GMMA 4M01A 3T2QA 5JDBA 5LA1A 2EVXA 2IXLA 1AR61 1W9TA 4DRRA 3NV2A 1GZCA 2JIJA 2JKBA 4MGZE 4ARYA 2PHFA 4BIOA 1HXS1 4JVAA 2BVBA 2NMNA 2NN8A 1B09A 2IVIB 2B42B 2QUOA 1GZWB 3HBKA 5DAWA 3VKNA 4CCDA 1ULCA 2BDRA 3IZOA 2WN2A 4Y4RA 1RUOA 1OPOA 2DTWA 1W2AX 4AVAA 2RDNA 1DGRN 2ZX1A 1UY1A 4GH4C 1SFPA 4LKDA 5FR3A 4L8QA 2H6BA 4MHRA 2HBTA 3WEZA 2E7AA 3HBZA 5DDJ3 1JU3A 2HLEA 1CJDA 1L3JA 2MEV3 2WABA 1KRIA 2R043 2WNVA 3MHZA 4FPLA 2J42A 3NJZA 1S0EA 4V2WA 3DYOA 5KXBA 2BP6A 5EJZB 2FQPA 2WQ4A 5F5CA 5CA6A 4RSUA 3IAPA 1COV3 1VBE1 2HH9A 3QH6A 4MYEA 1EY2A 1O5LA 1O4ZA 1PX4A 3K46A 3SCFA 3ASIA 3RS6A 1OXCA 4QPIC 4EZHA 5GLWA 5EZWA 1KITA 1OI6A 1SHWB 4AEDA 4FSJA 2P34A 2WYSA 4BIFA 3M7AA 3ZXDA 3O12A 4TXWA 5JSPA 2O1QA 3JXSA 4RR3A 1C3HA 1FXZA 4Z2AA 2W08A 2VO5A 1W8ZA 1HV0A 2Y6KA 5FZ9A 3TEXA 3VN4A 5E1RA 4UI9L 5EJ3A 3I2HA 4HK9A 1UYPA 4OULA 4UWDA 2SLIA 3H7JA 3M4FA 4WVZA 1WLDA 1W03A 2AZ5A 4A6OA 1FV2A 1AR82 2HKXA 3MIFA 1JYTA 3RZMA 1TNFA 1OLRA 5A33A 2GALA 1QJX2 1T6BX 1CZVA 2V72A 2QDRA 1UYXA 2QBXA 2ZXQA 3AYDA 3CJIB 3NW4A 4QX5A 2B46X 4PBPA 5GLTA 2XG3A 2BWCA 1DCSA 1XE0A 1AR83 3CKHA 4FQ4A 1PM4A 3V56A 1HIXA 4CP2A 4LO7A 2H0VA 3DCQA 1GANA 4AZZA 5GLZA 2VZ3A 2QQKA 2VZUA 1WWYA 2D40A 4XZUG 4CTEA 1Y7BA 1PK6C 1WLCA 2C9KA 1IGOA 2QNKA 4N90A 4CDWB 5FO8B 4AG4A 2XBO2 3DV8A 5FLIA 2I07B 5JR7B 4ZPIA 1NZCA 2ZHKA 3A4UA 3WLUA 2D6MA 4FOVA 4HSLA 1W06A 2D5HA 3IDEA 2MNGA 2A71A 4DXZA 1O4TA 1HB1A 2B4KA 2XBO3 3D82A 4CDUA 3H1YA 4QMAA 5FY1A 1EAH2 5C8CB 1NKGA 5JUVA 1WBFA 3DECA 3N9LA 4QPGA 1CWPA 4OCTA 1SQ4A 5IVJA 3UV9A 2VQAA 4XF0A 3KVBA 3POBA 1H9PA 4BA6A 2ORZA 1K5MC 1ALYA 4W65A 1EAH3 4Y5TA 5DDJ1 4R9CA 3KCXA 1VAKA 1W8OA 4UYBA 4LO4B 5JZGC 2D6LX 2CTVA 2JDYA 3OSDA 5JXJA 2R041 1A3KA 3ZXEA 5JOXA 1ND3C 3ZSKA 3VV1A 4I30A 2XOMA 2HYKA 5FAXA 2X5IC 5E88A 1JH5A 3LEMA 1W6NB 4YFZA 3N7MA 4MSVA 4PLOA 1JS9A 4LMFA 2YC0A 5C70A 3LA7A 3ABZA 1N1SA 1C57A 3S7IA 1GYKA 5J98B 1LENA 4AFDA 1BBT2 3S5AA 1DGWA 1I9RA 1ZBA2 3P5BA 4GKXA 5FXVA 2WA4A 3AL5A 1VRH2 3AVRA 2A75A 3MPPG 3U14A 2VE1A 3D0SA 4E9KA 2PA7A 1S2KA 3ZPYA 3WP5A 1AF9A 4QX1A 2C9AA 3ZMOA 3SHRA 3KCCA 5J7MA 3IM0A 4AVTA 2FZ1A 2E9QA 3NAPA 3LDBA 3QACA 3DF0A 4DY5A 5BPXA 3NAPB 4EV0A 2OIIA 2FCUA 4B7EA 4WM8B 3ZSLA 4CP1A 4UAPA 3LOIA 2TEPA 2ZZQA 1KGYA 2WZ8A 2G19A 4N43A 4NJ4A 5LA2A 4GULA 5BY5A 5IVYA 1Q43A 4XUNA 5IVFA 3RPQA 2WJSA 1PIV2 1UX7A 3TAYA 4LBNA 2PELA 2NYYA 3QOPA 4CUAA 4BZ4A 4CEWC 1AR81 1UCXA 1U0AA 3EHKA 1QJX1 3U11A 3T0BA 3H8RA 1U5ZA 1PIV3 1VB2A 1PM7A 2ZGPA 1UQXA 4OLLA 1RUE2 1YUDA 4LK7A 5K8SA 1OOPA 3FBYA 5A32A 5H9PA 4SLIA 1W8HA 2OXBA 2QQNA 2W46A 5DXDA 2VMDA 4QKBA 3VZNA 2XJUA 3OTFA 3R05A 4JC1A 4GWIA 1CX1A 4A42A 1RUE3 5FY8A 2QZ3A 4B4RA 1YJKA 4OUSA 4CXXA 4K20A 1FOD2 1VMHA 3OGGA 5D8AA 3S7EA 3WCSA 2XBO1 3LDKA 4HPKA 1D4M2 4Q8LA 1XB9A 3K4DA 3TBDA 5A1AA 5I91A 2O14A 5A3NA 5FZCA 4GB32 5F7UA 2ZGSA 3WR0A 3ACLA 1FOD3 3JD72 3RI9A 1XRUA 2WNVC 2EXJA 4PBOA 2YPDA 1JZ3A 3I3BA 3OGVA 2EAAA 2EXHA 1EAH1 3R4SA 3SLIA 2YC4A 4GB33 2E26A 3ST7A 5FZ4A 3JD73 4LORA 2DTYA 3KSCA 1CIWA 1AX0A 2VAUA 2VMHA 4KBZA 5I8TA 4EE2A 5KHJA 1Z78A 2EXIA 4XFGA 4Q4Y2 3N7JA 1UOJA 5C3OA 2IXKA 1BXHA 4UFMA 4IEZA 4W8JA 1PGW2 2ZA9A 3LCPA 1G8WA 4YVWA 4I3PA 2DWRA 3VBFB 3WG3A 4Y1YA 1LU2A 4YLZA 3WF1A 2GH2A 3J26N 5FZBA 4RR3C 1CAWB 5CADA 5DUVA 3NSTA 3N9MA 4R9BA 2DFCA 5J3UA 3EJKA 5LASA 1V6MA 1W6QB 3NMBA 3IBMA 1WCUA 2W47A 3FLTA 4R4XA 2CNAA 4OHXA 1FPN2 1XNDA 4QX8A 3I2DA 3KGLA 4Y22A 4OHZA 1YXWA 2XLGA 3ZO0B 2K46A 1VBA3 1POV0 3USSA 3RZKA 1WA6X 1ZBA1 3WW1A 4J1WA 1MS3A 2WN3A 2WL1A 1W6MA 4QM9A 1FPN3 1LECA 4P9LA 4YVSA 1TE1B 4ZS2A 4KG8A 4E4SA 5FYHA 4MUVA 3M70A 1WW7A 2VMCA 3FHQA 4HKLA 1W8NA 4QQOA 4XFBA 4RA0A 1QJU2 1SFNA 1O7FA 4IQPA 4XF1A 3MLKA 3L9JT 2JD9A 4LEJA 5FBJA 3FMGA 4WVVA 4CDWC 4QDRA 5LB6A 2ZBJA 1E5IA 3AMQA 5FUIA 4BMEA 4DNYA 5FDBA 1EPWA 4YW2A 2BERA 4BOWA 1J3PA 2VCAA 2L9LA 3ZFEA 3ZXJA 1JZ5A 4PHZA 1PIV1 4JKKA 4KMQA 2B39A 2C26A 2R0FA 2W68A 2WQ8A 2DVFA 4CDUC 1M4WA 4LKEA 1QDCA 1QQP3 1H9WA 4QX3A 2HWC2 1AX2A 1MVQA 1H1IA 2F4LA 2P3KA 2ZTNA 1CX4A 4P08A 5BNPB 2D3RA 1RUE1 4L9BA 4QPGC 3I2FA 4ASLA 3OBRA 2GNTA 2QKDA 4AVVA 2BWAA 2D6NA 4EJRA 4FXKB 2ZGTA 3P6BA 5A7WB 3H8OA 4OI0A 4R8HA 1LGBA 4BLJA 4I02A 1NE6A 1ZZBA 2B5HA 1W3XA 4JGYB 3LOBA 2YU2A 4XFFA 1FOD1 3VBRA 3UL2A 4FPGA 1UO9A 4DIQA 3U75A 4Y33A 4RS5B 3UGHA 3E5XA 4GB31 5IFTA 4LIUA 3WQ1A 3JD71 3LIHA 2QQOA 5M0TA 1W04A 3I2KA 5HBAA 1OD5A 4CP9B 4M4RA 1CONA 4OZOA 1E5RA 5FJKA 5CISA 2K2SA 1AR92 2O0OA 4I09A 4QQ2A 1XNBA 2C0ZA 4Q4X3 3VDBA 1H30A 5D1IA 2HBUA 4C0HA 4Y20B 2PHTA 3CL1A 4XACA 3PVOA 1LNSA 4E2SA 4QXKA 4ONUA 1AR93 2DCKA 4XQWA 4ZXKA 3S5QA 4Q4Y1 4S2GA 2W1WA 3ZN6A 3NAPC 1SBDA 2YDEA 5A3UA 4LT5A 2P3IA 1H4GA 4Q0UA 5A3LA 3ORJA 1UYYA 2OQ7A 2CAVA 2XJVA 4XCBA 2XPJA 2FD8A 5IHRA 1OA4A 2AUYA 1I3HA 4A4AA 4OQ8A 5FPUA 2RJKA 5LWBA 1MZ5A 1VBA1 4BXFA 4N43C 5FREA 4FPFA 4D69A 4CUBA 3AFGA 5JIUA 4M3CB 5F5QA 3PU3A 5CFDA 1GOHA 1I5PA 1PX3A 1PHMA 3MI8A 1UU4A 1FPN1 1UW8A 4WVMB 3WNMA 1RB8G 3ZR6A 1X33A 1RITA 3HT2A 3C7OA 5EV7A 2R1BA 1O3RA 1N3OA 1W3VA 2QQMA 2VNOA 3POGA 2XVGA 4LA2A 1PGSA 2V5DA 4XF3A 3NKTA 4XJZA 3ZFFA 1OOPC 1FYUA 4LBQA 1DF0A 2WO2A 2ARAA 4IV1B 4MLOA 2MHFA 3MFAA 3AJYA 1LCLA 4P9GA 1F2NA 1HRV2 5C3PA 3PVNA 4LHNA 5T3NA 2WZEA 3JB8A 2VCMA 5FZDA 5IYYA 1HQWA 4XJUA 5A3OA 4ET7A 5HV4A 1X9PA 3VD3A 3CHXA 4YW4A 5C6CA 1AR73 5D8AC 4AGVA 3BTAA 3HVDA 1BVVA 2QQJA 2QQWA 3D5OA 4YW1A 1QQP1 3KT7A 4JQRA 4WM7B 4QHOA 5LW9A 1GFF2 4YW7A 3I2GA 2Y6HA 1DQ6A 1OFNA 1QOTA 4D6RA 2ZGQA 4PCRA 1BVP1 1UZ0A 2Z69A 4WZCA 1NA1A 4EN0A 1TG7A 3WW2A 2VQ0A 4NROA 4QB6A 3AP7A 2HWC1 2IFRA 4RHV3 4KU7A 4LHSA 3LWCA 4TWTA 3PURA 1XSQA 3OF1A 4HSJA 3O1VA 3H42B 4QXHA 2YGLA 4A3ZA 1QEXA 3HR9A 5IVVA 4PLMA 2W1UA 3HNBM 1DYKA 2RS52 1XPWA 3JQWA 5IAVA 1NLSA 2QZ2A 3MUY1 4MGIE 4XZPA 2X05A 4DMIA 3TEYA 3UKNA 1IS6A 1GNZA 3LEKA 1R64A 4YVWC 4IUGA 5FYTA 4D0QA 2XGXA 2XDVA 3S6PA 1DLLA 2FDFA 3WDUA 3S0MA 2V5YA 4FP2A 4LBJA 1TZOA 1REDA 3I97A 4Q0PA 4BH9A 4XTMA 3MZHA 4LULA 1V6KA 4N9HA 5FPXA 2WLPA 5FZIA 2VOKA 3RWNA 1SDDB 4IEVA 2XQRA 4QKFA 1AR91 1CAXB 5LA0A 1JODA 2ZEWA 5F8PA 2LRPA 4AOCA 3DXUA 5FTTC 4NRMA 4AQTA 3LPGA 1X36A 3AMNA 4YVSC 3WHUA 3I2OA 5FZFA 2VXJA 2V4VA 2VZOA 2CGOA 3MW3A 2OKXA 3TRSB 5DQ0A 5L7OA 2BEOA 5KXCA 4QHZA 1CAVB 4CP0A 1Q5OA 3ZSMA 3NRUA 5BNOB 2B7YA 3WQ7A 1XNCA 2E7QA 4FQZA 5J48A 2JB8A 3VDDA 5LY1A 2VBDA 3B3QE 3O1UA 4CXYA 1GWMA 1JHNA 1IQAA 3A23A 4GQ7A 3VBOB 5JLVA 1CAUA 5JWPA 1Y4WA 2DU1A 3QLQA 5A6XA 1CAUB 3SXWA 2A6ZA 4CDQB 2RJLA 3ZIXA 1DQ4A 4AHWA 1HJFA 4OVEA 3EQEA 1RUH2 4R9AA 2XUMA 5FZ1A 1POQA 5H9QA 4Z1VA 2OZ6A 4DZGA 4D7YA 2HEVF 5B2GB 5HCAA 3U0ZA 4XURA 1N47A 5HCFA 2F4PA 3VD9A 1H2MA 1RUH3 2D44A 5FY0A 3CLPA 3HEIA 1XC6A 1WD3A 2GZWA 3FE5A 4LE3A 2WC2A 4R52A 4YPJA 5JOYA 2PAEA 2WLQA 1AR71 2PMWB 4QWNA 2LTNA 2VOTA 1UYZA 3V0BA 4XAEA 1HRV1 4UFLA 1VBB2 2EIGA 1G9CA 1C4RA 3ZYIB 5IFPA 1YEWA 4LBOA 5L9RA 4BQYA 1QJY2 2X09A 1JZ2A 1RJ8A 3VBRC 5FK7A 1OBNA 2W3JA 4Q2FA 4XXAA 2JG8A 4BQ4A 1ZBE2 3QBQA 4NIAA 1VBB3 3AC0A 1NUKA 1C8M2 4RHV1 5KHHA 3UKTA 1QJY3 1V6IA 2Y34A 1EYBA 2I45A 3ALQA 5J09A 1NQJA 2E53A 2O8OA 1ZBE3 4C90A 4OQ9A 2CGPA 5JXHA 4HETA 1PMHX 3MLJA 5JI7A 1LJ7A 5KXDA 4HANA 4W50A 5FZ6A 2VUJA 5T5LA 2QQIA 4FPKA 2F6BA 3PVBB 4UBGA 5LBCA 3RJ2X 4AXOA 2GAUA 3IDAA 2RS51 3I59A 3O1TA 2DCTA 1ZZ7A 2EIBA 3KQRA 4QM8A 2XLAA 2Y38A 1RMU2 4PQ9A 4XQDA 4RFT0 5LBFA 1Q8PA 2BOJA 2WS92 3ES1A 1SLBA 3I3QA 5EP9A 4EN7B 5CKQA 5J36A 1XNTA 2W39A 5IK4A 1UF2C 2BRTA 4K1ZA 1NYWA 2ZEZA 3Q8CA 3PNAA 2Q0AA 1DGRA 1RMU3 4JGZB 1HXS2 1O59A 1W8WA 4XHXA 5LATA 4CPBA 4YG3A 5CFDC 2WS93 1IZ3A 3ZKYA 5EYXA 5JMCA 2B9VA 2WO1A 3OEAA 5KC5A 3IMMA 2YMZA 4Q1RA 3ZN4A 1QXRA 2OUHA 1L7QA 1RUD2 2WWUA 5FXXA 4CE8A 1TNRA 1C28A 1OLQA 2IC1A 5EPAA 5FZLA 1ZVFA 2ILMA 3J7LA 1V70A 2V73A 1RC6A 3KVAA 2TBVA 2YG0A 1W6OA 1YWKA 5A7OA 2G1MA 2OQ6A 1JW6A 1F31A 4AFMA 4YM0A 1RUD3 5DZFA 5FY5A 5J37A 5SV5A 3JZVA 1AYN2 4UF0B 5AC92 2ZZJA 1JYCA 1K42A 2ZMLA 2VXRA 2VTXA 3VKFC 4COYA 4D7TA 2YV8A 4K1YA 5KC6A 3SQOA 4I0BA 2D6OX 1VBE2 2PHWA 1AYN3 3I3EA 1AX1A 3IPVA 3OY8A 2D3PA 4FP3A 3CQOA 4MH0E 5AC93 3E5UA 4L2NA 1DIWA 3BGAA 3MW4A 1FT9A 5IVBA 2NMOA 3WP4A 2GMEA 1XYNA 3KT1A 4WV8A 4YZ2A 1OPMA 2J1RA 4LPLA 1RUH1 1ZRCA 2EALA 1YIPA 4NPMA 3WF3A 2A7AA 1O6UA 2DUPA 1NA1C 4OHVA 1ZRIA 2CWSA 3AX4A 2J1AA 4CXWA 3RMYA 3OBAA 1DZTA 2OZJA 3M2MA 5DPNA 1MVEA 2W92A 4MG2A 2PHDA 4ES8A 3OGSA 1W8FA 4GJZA 5IK7A 3H3ZA 2B9UA 2BJSA 2BVVA 3ZLIA 5ABJA 3W20A 3IT8A 1VBB1 3K75B 4NE9A 4QDQA 2WRAA 3ZKUA 1WLTA 4IEOA 4AFAA 1QJY1 2Q4SA 4PI2A 4XMIA 5CFCA 2FBEA 2Y64A 1ULGA 4YZ3A 5C3QA 1ZBE1 4NIHA 5F5AA 4Q1PA 4DXRA 5AFEA 4EN6B 2WFF2 1IPSA 2ZGRA 4YFWA 1C8M1 5K9YA 4DPNA 1LHVA 4XVHA 1QHDA 3PUSA 4PIXA 2ZX2A 5FIXA 3H8UA 4BISA 1UOGA 4AEKA 2FDIA 1PVXA 2BW8A 4YZ4A 2WFF3 1HB3A 3WVJA 3D8CA 1ACCA 2CY6A 2ADEA 4XC9A 3BOWA 3WG4A 4C8DA 1A34A 1NCQA 1RUF3 3AB0A 1NZIA 1OLMA 4DUXA 5L7OC 3KF3A 2ID4A 2VULA 5FZGA 2VD7A 1GLHA 1RMU1 4CEWA 2WS91 1O4YA 4FFFA 2VVEA 5FYMA 4MOAA 2Y33A 3UETA 3VDDC 1JOPA 1UMHA 3VBOC 3WUDA 5L9VA 4I0AA 3QD6A 5H9RA 4F83A 2ZX3A 4NOTA 2A6XA 1YFWA 1JYWA 4QB1A 1GZWA 3OD0A 3BTXA 1OT5A 5DDJ2 1VMJA 2VCCA 2CHHA 2IZWA 3Q8EA 2MEV2 4NPLA 4GMP3 1RUD1 2VPVA 2R042 4FI9A 5T54A 1HW5A 3BU0A 1LTEA 2ZPXA 4HMZA 3FZ3A 5ANNA 3MDPA 5FY9A 5FZ0A 1W9WA 5JOWA 4CUCA 2WSUA 3VBHB 3WOGA 2J7MA 2LM3A 4S2FA 4QT6A 3J8F3 4QU2A 1COV2 1SLLA 1S0GA 3VL9A 2VNVA 5FYIA 4BK4A 4E2GA 1AYN1 4MZUA 4Q4W2 2ZAAA 3ZMNA 5CG9A 3B01A 4S2HA 2RDRA 4XE9A 3MIDA 2F17A 5AC91 1GQPA 4F8AA 3E6CC 1VBD3 2WWJA 1U5YA 5FPLA 4LTAA 4K3UA 1KEXA 2IXIA 4LKSA 4UXAA 1R1ZA 1SBEA 3T2TA 2YPJA 4MGYE 5CKMA 4AHYA 4GXLA 4Q4W3 2BGCA 2JG8C 3IN9A 2RMU2 3KMHA 1T6GC 3P3PA 1WLWA 5A1FA 3SKJE 4HLTA 4AEJA 2AENA 3ILRA 1NX9A 3KD4A 3CBNA 2RMU3 4P14A 5I0SA 5HV0A 1S0IA 2XJRA 4GA9A 1W9SA 3NNJA 1X50A 2IWGB 3AYEA 3I4IA 4PF1A 3AKSA 1UMIA 4M3CF 2XKOA 5F2SA 1WMFA 2BNOA 4DOUA 1UY3A 1OKQA 5LK5A 3J9SA 2WAAA 4TN7A 2W0XA 1REEA 3CZJA 1WW4A 2ARXA 1W0OA 4I3GA 3GXUA 4ATEA 3ETQA 1GZTA 3CJIA 3AZZA 5F3CA 1WCKA 4P9IA 4AI3A 3LFIA 3G6JB 1VRBA 1VE0A 1AXZA 1SBFA 2EA7A 1RUG2 2JE8A 5FRAA 1H1AA 2D5FA 3LEGA 2WFF1 3MIEA 1I5ZA 1O8PA 3M3CA 5FFOC 1LAJA 2VMEA 4W6YA 4LJHA 2AEZA 3NJYA 5T5JA 3OPZA 1IS5A 4Q0QA 3RZHA 1WA4A 1RUG3 3W5NA 3KQ4B 4CDWA 4JV4A 1RUF1 2VR4A 3IAQA 1RUC2 2R32A 1F4HA 5FKBA 3VD7A 1VLNA 4BQ3A 4FTBA 2VZ1A 2P6HA 2AC1A 1MR5A 2RG4A 3I7DA 4OI2A 1SEFA 4XJ8A 2XL7A 3ZSJA 4NHMA 2WINB 1RUC3 4ASMB 4YG6A 1YJLA 2W95A 1AJOA 1LHOA 5FPZA 5H9SA 5C8CA 3BKZA 2K9ZA 3EB7A 2LS6A 2W5FA 4LKFA 3MGUA 1ZRFA 3PU8A 1YO8A 4XILA 5F9TA 4FPJA 2OPKA 2JB4A 3WCRA 1UIJA 4N53B 3ZXGA 1R1A3 1EUUA 1IKPA 2PN5A 4FFGA 4DEQA 4A2UA 3RNSA 4ISRA 2MEV1 2UWBA 2N7GA 2YC2A 3ZM8A 4BWOA 4P5YA 2VC9A 4OHWA 4W6WA 1ND2B 3LA2A 3SCGA 2TNFA 4AHZA 5I0DA 4QQPA 3M1HA 1W6NA 2Y6JA 3GZEA 4LBLA 3B93A 4YWAA 1W8TA 2YZ4A 5FQ0B 1K45A 1COV1 4Q4W1 5CKNA 5FYBA 3LEIA 5A6QA 2GNBA 5ABJC 2R1DA 3A0NA 5FYVA 4KWJA 4XOGA 2VM9A 4FPYA 4AI2A 5C5TA 3SITA 2NQYA 5CFCC 1ZNPA 1IS3A 2GN7A 4IGQA 3UYJA 2Y60A 5FZEA 1ASJ2 1DLCA 1SLTA 1DHKB 2DURA 2RMU1 3UESA 4FAHA 5DG2A 2WA3A 4Y3OA 4QPYA 1Q3EA 5HCBA 4ZZ5A 4UT5A 1NOVA 3B9CA 4BDVB 3HMYA 4WM8A 1LEMA 1ASJ3 5C33A 5C9AB 3WY6A 1VB4A 3AXEA 2YROA 2RM23 2BFUS 3SKVA 4PIYA 1APNA 2BOIA 1YCIA 3ZYFA 2D7FA 4QKDA 1JBCA 1TMF2 1UWWA 1ZA7A 2Q1ZB 4RD7A 2D3SA 1NCQC 4ZU4A 3MICA 2D43A 1XJAA 4AFBA 5HCHA 1E57A 4Q27A 1JN2P 1YYNA 1P8JA 3NNFA 4PIZA 3AVSA 1DZRA 1TMF3 3VBFA 1LGNA 1RUJ2 4ARXA 3SH3A 1RUG1 5FBZA 3I2JA 4HONA 5HXMA 4EQVA 4LBMA 4NHLA 1QNWA 3TB0A 1GICA 1RUJ3 3CDZB 4ZHNA 2WWSA 3RZZA 1Q56A 2IVJA 2PHRA 3W58A 3PUQA 3KV4A 2PFWA 1IG3A 1RUC1 3W59A 1D7PM 1Y9MA 4QGNA 3ZFGB 4NAMA 1IHMA 3AKRA 2QVSB 3VL8A 1FNZA 4DS0A 1F35A 3PJQA 4K6BA 4BCUA 3J7NA 1LRHA 2QQUA 1LODA 3W9AA 1JYIA 1KD7A 3QH7A 1R1A1 5I8YA 4YGBA 5F3EA 2ZOEB 1OA2A 1WCDJ 5JR2A 3WF0A 3C7EA 5GM0A 2VZVA 3V0AB 2J1EA 1OMIA 1UZZA 3OBZA 4QX2A 2Z5WA 5LRRA 2ZCWA 3D0JA 2PQSA 1AVBA 2E6VA 1N1YA 2Q5TA 2Y6LA 3M3QA 2IXJA 4E8CA 1GWLA 5BNNB 2WO7A 5I93A 5HPOA 1DQ1A 1OUXA 2BNNA 1MS1A 2E33A 3F95A 2EXKA 5JSOA 2W1QA 2RR13 1FMD2 1VAMA 4O9EA 4LUMA 1QH7A 4LO6B 1EV12 1CAWA 4NR1A 3KHBA 2DCZA 4RQPB 5IWFA 1VBA2 1W6QA 3HQRA 1DP0A 1FMD3 2D98A 2Y26A 3AK0A 3LFMA 2VG9A 3LSDA 5GZCA 4EYUA 4K40A 3NNLA 1BKZA 4XJ9A 4CSWA 1EV13 1CPMA 5TSWA 4CDXB 3OGJA 4A44A 3FWEA 4FOWA 1STMA 2ZGOA 3ZIWA 4FFHA 3VBSB 3CJIC 4FCAA 4N7IA 2JWPA 3PUHA 4XCAA 2BV4A 3FLPA 3W21A 3M8LA 3TNQA 1ASJ1 4AAXA 1XNKA 3LD8A 2WT1A 4Y4YA 3NV4A 4MGSA 2H6CA 1LU1A 4IGPA 3X29B 1HQLA 4FPCA 4JDOA 3VD4A 1OKOA 4R9DA 5J1XA 4JAAA 5FZ3A 1PO12 4UFJA 2YGMA 2TUNA 4QXBA 4XETA 1H6YA 3WINE 4B4PA 2VW1A 1JU4A 3DPRB 2Q1FA 3KV6A 1GUIA 5F3IA 4L97A 4BXSV 3RZGA 1AXYA 1PO13 4NHXA 1QQP2 1TMF1 3OPTA 4IEWA 2ZS6B 4XW3A 3IB3A 2ZABA 3VDCA 4JQTA 4LITA 5A7PA 3WX5A 5I0TA 2X10A 4QX7A 5BNPA 4CCMA 1RUJ1 2WAOA 3USUB 4DB5A 4AK3A 3EXUA 5FYSA 2QQLA 2ZHLA 1UZYA 1ZRRA 3PTYA 4N53C 1PZ8A 4KWLA 5A7WA 4YM3A 2EICA 2JDUA 5K4LA 4XDQA 2XJTA 2R072 2BNMA 2DDUA 3H1MA 4JGYA 4FAGA 1LHNA 3IIAA 1CD3G 3I54A 3JCIA 2GU9A 3SMHA 4KGGA 2CDPA 4RS5A 1E5HA 3NO8A 4XJWA 3AMMA 2WUHA 1MEC2 1HN0A 2R073 2BFUL 3VHNA 2CWMA 4Q4X2 3T08A 2YBPA 3ZYHA 4BQ2A 1L7RA 2BBAA 1OF4A 2RE9A 2VJXA 4AHXA 4CP9A 5EWSA 5JPNB 2DFBA 2RS13 3GM8A 3MF6A 3BI3A 1MEC3 2X8KA 2XLFA 3RI8A 4XBNA 3WNXA 5CIRA 4QPWA 1TEIA 4Y20A 4HVQA 1OC1A 4MXWB 2J1VA 3N35A 5EXOA 5FPVA 3SC7X 5G05L 5BNQA 2P37A 2GDFA 2A6WA 4M00A 1NT0A 5JMOA 1VJ2A 2QE3A 2FCVA 3A22A 4NRQA 4TYSA 2JD4A 5ANQA 4CCEA 1SCRA 3R0RA 2KXLA 3SH4A 4L99A 1VALA 4NHKA 4Y5SA 4JRLA 4JDNA 5CU1A 5C9AC 1FMD1 3N9NA 2ZGMA 4WM8C 4M0HA 2IUWA 3OEBA 1EV11 2XJQA 4K8RB 2W1SA 3FUOA 3KS7A 4YRDA 4XIKA 4CCOA 3C3VA 4GWNA 1W2TA 4IE0A 4M3CA 2Y6GA 3KGZA 3N7KA 4BM8A 2A3YA 2ZMNA 4WVMA 4CEYB 1YQ2A 1FX5A 2PHXA 2A6VA 2HWD3 2YUEA 3AZVA 3PLQA 5A7SA 4AW7A 3OCPA 1QWRA 1B35B 1SACA 3CNAA 3VB9A 2XMLA 4J25A 1H0BA 5K0UB 5CZKA 4L92A 3VBFC 1SCSA 2JEMA 5E6HA 4RYDA 5AFBA 4FPEA 2X53S 1BEV2 2VOWA 3VBUB 1N3PA 1MACA 1N1VA 2A6YA 4IV1A 3TOJA 3URFA 1AR72 1ULEA 1YQCA 2P17A 3OYWB 4Q26A 2QDNA 3WT3A 4MO3M 4Z2WA 4XIOA 1PO11 1BEV3 3O1RA 4HN0A 4HT1T 3PTRB 4JRAA 4LLFA 3UJQA 1W2OA 2C24A 5DAQA 1T2XA 2NP0A 1RXFA 4IE4A 3SH5A 4WM7A 2GMPA 4PQQA 3DXTA 3WDXA 4Q0SA
chains in the Genus database with same CATH topology
1GZ9A 2R6QA 4RHV2 4HVRA 1YFXA 5DZGA 1JUIA 3HWJA 5DUUA 4KWKA 3ZX7A 5I8SA 2NZ9A 1S2BA 2DUOA 4LNVA 4RGGA 4I01A 1N3QA 4FT8A 1V9U2 4XEZA 4IEPA 5C8WA 1U12A 4SBVA 3DGTA 4XFAA 3VZJA 4BHPA 5FLHA 1LOEA 4K21A 2R071 4PJYA 3WW4A 1V9U3 4N7UA 3B02A 1KS5A 1C5IA 1NCRB 2P2KA 2WKKA 4AI8A 4KL1A 4F3JA 2DVGA 5E16A 1JOJA 2RS11 3KB5A 4I2OA 3VHPA 1HX6A 1MEC1 1RVF2 3GYDA 1XYOA 3GZUC 4Q4X1 1KJRA 3RG0A 1KDKA 1XU2A 3INAA 1PZ9A 3IWZA 1A8MA 1CAXA 4AWDA 3OBTA 1RVF3 3M3OA 1WD4A 1IKQA 3FFQA 5C4WB 3RDIA 5E89A 4HKWA 4LO8A 4P9XA 3MIGA 3GBGA 2NPIA 2ZGKA 1CAVA 2VECA 3ECQA 4J6GA 5BNOA 1ZZCA 3GNEA 4F7ZA 1FAYA 4K9SA 2WNUB 3THPA 2HWD1 1KJLA 5F6KA 3AP5A 3VBOA 4JDMA 5I0UA 5JPMB 2QJVA 4QD2A 4CDQA 4COWA 3AYCA 1PVC2 1AYM2 4A3XA 3IMNA 2VH9A 2XB6C 1ZREA 2ES3A 5BNPC 3UK9A 1BK1A 2YY1A 1BEV1 1PVC3 1AYM3 4MVTA 1VIWB 2WZPP 3PJYA 1YRZA 4AEMA 2XWJB 4ATFA 1ENXA 3NV3A 3AKPA 4JGYC 3LKJA 1LOBA 3N7LA 4KH9A 1DU3D 4UW6A 3LGRA 2PYTA 4EN9B 4RS5C 3T1MA 4LBQD 3H1WA 3HT1A 4GH4B 4AF9A 3NKGA 1C1FA 1W6PB 1CESA 4G3YC 4IETA 3AKTA 1C8NA 3BOPA 2JG9A 1ZM1A 2JG9B 2R0HA 3TYJA 1YNAA 1LR5A 1AUYA 3E5QA 4C91A 4IEYA 2VW2A 1R082 5EYYA 3WP3A 4XXPA 1V9U1 1H8TB 1V6NA 3ES4A 1JUHA 4COZA 2WSVA 1R083 1J58A 3VKLA 1RTVA 1S55A 4HL0A 4HFSA 1MS9A 4Q0VA 2XL9A 2AREA 4QPIB 5SV8A 3VLBB 4JGZA 3N4MA 3KM5A 4YGCA 2WZR2 3L2YA 1RVF1 3EBRA 4MGKE 1LULA 5A3MA 1BCXA 2GC0A 2ZGLA 3TN92 1WCSA 5K0UC 2WZR3 3S30A 3AP6A 5CVRA 4ZU5A 2OA2A 4ZU7A 3VBUC 3ZYJB 4QGMA 3TN93 3CJXA 1XE8A 3PHMA 3VUOA 4IV1C 1F5FA 3TWIA 4EWAA 1RHI2 1X8EA 4URTA 1ZYBA 4BYYA 4AFCA 1BZWA 2HWB2 1W2UA 3MLLA 2ZKLA 3FX3A 4COUA 3WDTA 3VKOA 5BYNA 1WW5A 3BIWE 3DUIA 3H50A 1RHI3 3A0KA 1HQNA 1KFUL 1ONAA 2ZJCA 3LSEA 1AR63 1QY4A 1SLAA 2HWB3 4WM7C 3ZN5A 1QU0A 1PK6B 4PF5A 4NWVA 4UW3A 1PVC1 3WDYA 1AYM1 5F6LB 1H2NA 1D0HA 2GC3A 3AP4A 3K51A 4OFGA 3VZOA 1O5UA 3CU7A 1DDLA 2ET7A 2BTVC 1PMIA 1J3QA 4KG0A 1RIRA 2X29A 3WV6A 2E51A 1AL23 1K5MB 3AKQA 3GHNA 5CBLA 2ARBA 5FCCA 2VVFA 2FHRA 4X6QB 2PHLA 1GV9A 1RUI2 4Y1ZA 1FATA 3UJOA 5JZGB 1UIKA 2G4IA 1ND3B 1UKRA 2WT2A 3C2UA 2X5IB 2JX9A 2PTMA 1RUI3 1IOAA 2VOXA 4XJAA 4ZKTB 1RUF2 3GHMA 4META 3M3EA 1G9BA 1R081 3RYKA 3UKVA 1AZDA 1Q8SA 2A3WA 2I2SA 5LEKA 3MFCA 4GALA 3B5LB 2UY9A 2JE7A 1YFYA 3VHRA 2CL2A 3CEWA 2XH6A 3MF9A 5BNOC 4V1PA 1MZEA 4A7YA 1VBC3 4YGDA 3H7YA 2BYVE 2KA3A 1HKDA 2WNEA 4ITCA 1WUVA 3RSJA 2WZR1 4PDWB 3SCHA 3FJSA 3AP9A 4CDQC 5JSRA 1TQ5A 1KDMA 2HWE2 5KHGA 1I6XA 1PNFA 3TN91 1LB2A 3ZXLA 3GALA 3H0OA 3J8F2 4Z8BA 2ZX0A 4IV3B 1PO22 2HWE3 3VBHA 1RINA 2HWF2 1VBD2 4YNIA 1S0CA 1RHI1 2KM2A 3IDBB 1Y43B 4LBKA 5J96B 3AYAA 4FBFA 1PO23 3MIHA 2HWB1 4FO9A 4M0NA 1W0PA 4NO4A 2HWF3 4DINB 4KQ7A 4FOYA 2QQPA 1DBNA 4Y24A 1Y9QA 4KBBA 3FFZA 4O9GA 4TZDA 1WMEA 1CR7A 3KT4A 4S2DA 4HZFA 3N3HA 1AL0G 5GALA 5AVAA 2JG9C 1LEDA 3RYRA 1HDKA 3D4KA 4OUMA 4JTOA 2WNVB 5CNAA 3VKFC 1V6OA 4LUKA 1Z7S2 4BPZA 1AL21 2AR6A 2D6KA 1H8TC 2DUQA 4LO5B 4LHLA 2UU8A 4MXVA 3PVEA 3ZXFA 2ZX4A 1G9DA 4C0BA 1Z7S3 3EO6A 4FTEA 3POWA 1CN1A 1ZRDA 1GR3A 4BQ1A 2CV6A 3AJZA 1H4HA 1MS5A 5F1RA 4LR4A 1RUI1 4DFSA 4JGZC 2VGDA 5HXVA 4XTPA 1LOCA 2JE9A 2WIIB 4AEDB 1HLCA 2DVBA 5LK7B 1HV1A 3HIFA 4RR3B 3R6SA 4Q8KA 1J59A 3FHIB 3JB4C 4ES9A 4INDA 1V6LA 5BUVA 1LOGA 1LOAA 1O3QA 3ZXKA 1U5XA 1V00A 3VKMA 1VBC1 2JDZA 5A33B 1OQEA 3OJBA 1VP6A 2VY0A 1UPIA 5IT6A 1R1A2 1QJX3 2ZAHA 3V64A 1G9AA 3NL1A 1QH6A 4GMP1 2VNRA 2FZ2A 3ME2A 4N53A 4E4ZA 2G9GA 2EF6A 2HWE1 1GQGA 4XBLA 2AYHA 4GMP0 2B8MA 4GIQA 3B00A 2DCJA 5GZGA 3J8F1 1BMV2 1ND2A 2XJPA 2A3XA 1FI2A 1PO21 2LALA 2JENA 1QF3A 2HWF1 2Q8OA 1VBD1 4CDUB 4AQ2A 3ZDSA 5FQ0A 4LLOA 5FO9B 4XFHA 4H14A 3B9IA 1NXMA 3IDCB 4QPGB 1XXNA 2XJSA 4ORFA 2UURA 1BJQA 3VZKA 3NVCA 3THTA 2HJIA 2C1FA 2DVAA 2PAMA 1UPSA 2RM22 1UKGA 4AVCA 1BQPA 3ILNA 3P3NA 5C9AA 4HK8A 2I74A 1CJPA 4JTNA 3ILFA 1Z7S1 1PNGA 2IXCA 4IEQA 3MPBA 5ACA2 1POV3 3R4UA 2VW0A 3AZXA 3CF6E 5FMOS 4AVBA 5GJ6A 4AQ6A 1LKNA 5T5PA 5FO7B 4TSVA 2OUJA 3D6EA 1BBT3 1ZBA3 5ACA3 1VRH3 4Y1XA 3ZYRA 3ROUA 5CAZA 4HVOA 5L36A 4HBNA 4PDWC 4G4FA 3GZTB 1RUNA 1DQ5A 1Q8OA 4XBQA 1UX6A 4YM1A 5LRSA 4BMBA 4UW5A 4IERA 4N43B 4FVVA 4IV3C 1IPJA 2UY8A 3ZFGA 4FXGB 3VBHC 1EP0A 4OI4A 2K0GA 3Q9OA 1NY72 3CO2A 4KNCA 1DZQA 3WZ1A 1URXA 4M3CE 1OA3A 4EROA 4I0WB 1X82A 1OOPB 5A32B 3NV1A 3LA3A 2WT0A 2XVLA 4JCKA 4AQSA 4KU8A 2C5DA 4FPOB 1YI7A 3V0AA 2RR12 2YHJA 1OQ1A 3AMPA 5BNNA 2MPFA 2E63A 3R4DB 4X6RB 5D8AB 4HPKB 2OW4A 4X8PA 4H3WA 2UWAA 1AJKA 1AHSA 1BMV1 3J4UH 1O3SA 4B29A 2IXHA 2YXSA 4RQPA 1D4M3 1G6NA 2CGNA 2AH2A 2O8QA 5IUQA 4CDXA 1YFUA 1H2LA 2W52A 1LOFA 4EWEA 3VBSA 1ZZ6A 3WP6A 1ULDA 1ENRA 4CZSA 4FTSA 2DU0A 4D94A 4Y5Z0 2ZGUA 4AEDC 5HI0A 3AXDA 3FUQA 4YGEA 1DGWX 1CPNA 4YVWB 2PQQA 2RM21 1KS4A 1QMJA 2D93A 4CRQA 4XFIA 4Q4Y3 4Z92B 2Z79A 4IXLA 4NPRA 4RGAA 4B8EA 4YSFA 1POV1 3DPRA 3BCWA 3H3UA 5AVPA 1UD1A 2CAUA 2Y0OA 4Y22B 1BBT1 4MX3A 3GZAA 5GKAC 5ACA1 1VRH1 4P9JA 2Z2SB 4UBHA 1W6MB 2P3JA 3BPZA 4H7LA 2CYFA 1NE4A 4BLIA 4YVSB 4YG0A 2ATFA 1TME2 1SFYA 3L2HA 3VHOA 1MQTA 3USUA 3WW3A 2ZKNA 1MQTB 3LAGA 2VOVA 1ZZ8A 3SNMA 5I0RA 1H8VA 2JECA 1F8VA 4XFCA 3U4XA 1TME3 2VUAA 2G9FA 5CB7A 1DYPA 2ZACA 1QJU3 1F9KA 4NN0A 2GSYA 3ZFEB 2NM1A 3WG1A 1ND2C 1ZX5A 1MZ6A 1QXPA 3KZ4C 1QGLA 2RS12 4AVSA 2UWCA 1NY71 2GNDA 4K8FA 1FV3A 3ZYGA 2LUWA 1MS0A 1DGLA 2JICA 2IFWA 1DG6A 4C1XA 1UU6A 5FMOL 4W6XA 3ATGA 2HWC3 1CVNA 4MXWA 4B4QA 3BALA 1LHWA 2RR11 1PZ7A 3FBMA 1S0DA 5LEJA 3U10A 3VBRB 1D4M1 2VVDA 3APBA 1IS4A 3ZYPA 4XPVA 1DQ2A 4AYUA 4E27A 3K48A 3MW2A 2HWD2 1SMVA 4YW5A 2UYBA 1D4VB 1ZA4A 3ZVXA 2H0BA 4QQLA 4IEXA 4CEYA 2RS32 1FNYA 4D7SA 1KFXL 4PLNA 5JI9A 5JCTA 1B35A 3RRDA 4Q4V2 5KHKA 4U2AA 5K0UA 2R062 3E6BA 3E97A 4MV2A 1JTZX 4CYDA 2HEYF 2RS33 2PHUA 3VBUA 3ZN6B 1PGW1 3GBFA 4B7KA 1S0BA 4L11A 3TNPB 4Q4V3 4WVWA 2R063 2A70A 3OYWA 1CGPA 3KCYA 3AM2A 3VZLA 2SBAA 4ISQA 1RJ7A 2VMIA 4XQ4A 3BB6A 2DVDA 5DUWA 4AGGA 1C1LA 4GWMA 1DQ0A 3RYPA 5CFDB 3WHTA 3ZFGC 4HKOA 3IKWA 1QJZA 3HAGA 3DN7A 2PLV2 1N1TA 5GZDA 2RHPA 2AGSA 1QOSA 2DYCA 4BE3A 3ZFFB 2B45X 1TME1 1H1MA 4LBQB 1NXD1 1OHFA 1DFQA 3WDVA 5BXXA 2PLV3 1QJU1 4WZFA 4A7KA 2ZGNA 1R092 2UYAA 3PMSA 2EAKA 1LESA 3NWKA 1PGL2 2VNGA 3U07A 5BNNC 3GF6A 1HRV3 3POYA 4IL7A 3JU9A 1QDOA 1R093 1VAVA 3ELNA 2JJ6A 4YM2A 4OHYA 3HQXA 1NCRA 4P9YA 4NVPA 4QGLA 3RMXA 5IK5A 4LA3A 1H2KA 3WUCA 4RQPC 2R16A 1UU5A 4D3WA 1GKBA 1HRI2 1NA1B 4R4ZA 1YLLA 4CDXC 1LOFC 2ERFA 1OFSA 2A73B 3VBSC 5JAXA 4Y1UA 4IESA 1HRI3 2JXAA 1YI9A 1YHFA 4Z07A 5C4WA 3SISA 2DV9A 3B7MA 4K7JA 2Q1MA 5L19A 3T1LA 5KWRA 4Q29A 1MZFA 2RS53 4H7MA 5GZFA 1S0FA 3I8TA 3MIBA 3FC0A 3WXPA 3B94A 3WDWA 2WNUA 4AE2A 3DPRC 2GC2A 5DZEA 5FLJA 3VZMA 3O5SA 4Z82A 1UN1A 2RS31 4QQHA 1LHUA 1Y3TA 4XYXA 1ENQA 3O7OA 1NLRA 2OVUA 3BU7A 4Q4V1 2Y0IA 1GNHA 2R061 3OD4A 5L73A 5T52A 1MQTC 1OSGA 4TLFA 5E8AA 5DUXA 4YW3A 5L7OB 5DG1A 3PMEA 2GNMA 2E7TA 1ENSA 1J1TA 1QXJA 1X8MA 4IEUA 4RL7A 5T50A 3VDDB 1SDWA 2Q30A 4YYOA 4DRVA 3BODA 1S1AA 3ZFEC 4N9IA 5JOZA 2BQPA 1D2SA 1O91A 5FOJB 3LB9A 3KLSA 4UW4A 1WW6A 1C5HA 1REFA 1SLIA 4GH4A 1D0GA 1XE7A 4NWWA 4AGRA 1W6PA 3JBG2 4P9WA 4XF4A 4E2QA 1S0JA 2PLV1 2QCSB 1XU1A 3HD8B 3MEPA 2R30A 5KXEA 3O0VA 1W39A 3MYXA 3JBG3 2D97A 3V0BB 4HN1A 1QNYA 1R091 2V09A 2NLRA 3H9AA 1PGL1 2WFPA 2A5ZA 5FOBB 1H8TA 1GQHA 3WD5A 1XQNA 4J1XA 1SLCA 4Y1VA 1Q8VA 1NQDA 2ZHMA 3FLRA 2JG8B 4WBBA 3E6DA 2Z42A 4DQAA 2VMGA 4QPIA 2ET1A 1KXGA 3O0XA 4LHKA 5T55A 3ZXAC 1HRI1 1VR3A 1C8M3 3JQXA 4CEYC 4AI0A 4E4DX 2XKPA 2PAKA 1B35C 1RGSA 3N36A 1U5IA 3DL3A 5GLVA 1NG0A 2WQZC 3I59B 1A6CA 4FPHA 1Q8QA 5CG8A 5BV6A 1CQ9A 3O14A 2GN3A 1AR62 2VU9A 2YYOA 1G7YA 2XHKA 4AI1A 4XMAA 1G86A 1M06G 1WMDA 3WG2A 1KQRA 4COVA 1RL3A 3V65A 1PK6A 3B69A 2XWBB 2HEWF 1I1EA 1HXS3 3VGIA 1UL9A 2FMDA 4XF9A 3ENRA 4P5HA 2OYZA 3ZFFC 1W6OB 4YZ1A 4H55A 2FMYA 4OI1A 5KHIA 4G9SB 4OZXA 1EPZA 5KBFA 2QFEA 1X7NA 2XVKA 1AL22 3AZYA 3POSA 1J3RA 3RJRA 1J1LA 1MS4A 1GSLA 2DCYA 3IPVB 3OY8B 3LZZA 1K5MA 1NCRC 4YZ5A 1VBE3 5JZGA 2BPA2 1LGCA 1YIFA 4C1WA 1A8DA 1IPKA 1ND3A 3JBG1 1MS8A 2X5IA 4LE4A 2GC1A 3M3IA 2ZHNA 5JIAA 3JUUA 4KGQA 4DY3A 3WQ0A 4FOQA 5IK8A 5GLUA 1JXNA 2BUKA 3AZWA 5C4WC 1A78A 5ABJB 5T5OA 3G7DA 1ULFA 3QCWA 5JVVA 1VBC2 3RQ0A 3DKWA 5CFCB 1BYHA 1V6JA 2GH8A 4U36A 1UMZA 3AFKA 4YARA 1D2QA 2WNUC 4XHBA 2ENRA 3HN1A 3GBWA 3ZSEA 2R49A 4PDWA 5GZEA 1ZZ9A 4Y26A 1WGPA 2ZMKA 1XYPA 1Z0HA 5EFUA 4GKYA 4B3NA 1OQDA 1AXKA 3O0WA 4IV3A 4A7ZA 1G9FA 1NCQB 1O3TA 4X8NA 4EN8B 1F5JA 1QOOA 4EWDA 1WBLA 4QHBA 2D6PA 1GBGA 3AMHA 4CEWB 1QKQA 1UAIA 2ETEA 2DF7A 4M01A 2GMMA 5JDBA 2EVXA 2IXLA 1AR61 4DRRA 3NV2A 1GZCA 2JKBA 4MGZE 2PHFA 4BIOA 1HXS1 4JVAA 2BVBA 2NMNA 2NN8A 1B09A 2QUOA 2B42B 3VKNA 1GZWB 1ULCA 1RUOA 1OPOA 2DTWA 4AVAA 2ZX1A 1DGRN 4GH4C 4L8QA 2H6BA 2E7AA 3HBZA 5DDJ3 1CJDA 1L3JA 2MEV3 1KRIA 2R043 2WNVA 4FPLA 3NJZA 1S0EA 5KXBA 2FQPA 2WQ4A 5CA6A 4RSUA 1COV3 1VBE1 3QH6A 4MYEA 1EY2A 1O5LA 1O4ZA 3SCFA 3ASIA 3RS6A 4QPIC 5GLWA 5EZWA 1KITA 1OI6A 4FSJA 4AEDA 2P34A 4BIFA 3M7AA 3ZXDA 3O12A 5JSPA 2O1QA 4RR3A 1C3HA 1FXZA 2W08A 1HV0A 3VN4A 5E1RA 5EJ3A 4OULA 4HK9A 2SLIA 3H7JA 3M4FA 4WVZA 1WLDA 2AZ5A 1FV2A 1AR82 2HKXA 3MIFA 1TNFA 1OLRA 5A33A 2GALA 1QJX2 3CJIB 3KSCA 5K7PA 2QDRA 3NW4A 4QX5A 3AYDA 2B46X 4PBPA 5GLTA 2XG3A 2BWCA 1AR83 3V56A 4FQ4A 4CP2A 1HIXA 4LO7A 2H0VA 1GANA 5GLZA 2D40A 4CTEA 1Y7BA 1PK6C 1WLCA 2QNKA 1IGOA 4N90A 4CDWB 5FO8B 4AG4A 2XBO2 3DV8A 5FLIA 2I07B 5JR7B 1NZCA 2ZHKA 3A4UA 3WLUA 2D6MA 4FOVA 4HSLA 2D5HA 3IDEA 2MNGA 2A71A 4DXZA 1O4TA 2XBO3 3D82A 4CDUA 3H1YA 4QMAA 1EAH2 5C8CB 1WBFA 4QPGA 1SQ4A 3UV9A 2VQAA 4XF0A 1H9PA 4BA6A 1K5MC 1ALYA 4W65A 1EAH3 5DDJ1 4R9CA 3KCXA 1VAKA 4LO4B 5JZGC 2D6LX 2CTVA 2R041 1A3KA 3ZXEA 5JOXA 1ND3C 3ZSKA 3VV1A 4I30A 2HYKA 5FAXA 2X5IC 5E88A 1JH5A 1W6NB 4YFZA 3N7MA 4MSVA 4PLOA 2YC0A 3LA7A 1N1SA 1C57A 3S7IA 1GYKA 5J98B 1LENA 4AFDA 1BBT2 1DGWA 1I9RA 1ZBA2 4GKXA 2WA4A 1VRH2 2A75A 3MPPG 3D0SA 4E9KA 2PA7A 1S2KA 3ZPYA 3WP5A 1AF9A 3ZMOA 2C9AA 3SHRA 3KCCA 5J7MA 3IM0A 4AVTA 2FZ1A 2E9QA 3NAPA 3QACA 4DY5A 3DF0A 5BPXA 3NAPB 4EV0A 2OIIA 4B7EA 4WM8B 3ZSLA 4CP1A 3LOIA 2TEPA 2ZZQA 4N43A 4GULA 5BY5A 1Q43A 3RPQA 2WJSA 1PIV2 3TAYA 4LBNA 2PELA 2NYYA 3QOPA 4BZ4A 4CEWC 1AR81 1UCXA 1U0AA 3EHKA 1QJX1 3U11A 1U5ZA 1PIV3 1VB2A 1PM7A 2ZGPA 4OLLA 3VBFB 1RUE2 1YUDA 5JOWA 5K8SA 1OOPA 3FBYA 5A32A 5H9PA 4SLIA 5DXDA 3VZNA 2XJUA 3OTFA 3R05A 4JC1A 1RUE3 2QZ3A 4B4RA 1YJKA 4OUSA 4K20A 1FOD2 3OGGA 5D8AA 3WCSA 3S7EA 2XBO1 4HPKA 1D4M2 4Q8LA 3TBDA 5I91A 4GB32 2ZGSA 3WR0A 3ACLA 1FOD3 3JD72 3RI9A 1XRUA 2WNVC 2EXJA 4PBOA 2EAAA 2EXHA 1EAH1 3R4SA 3SLIA 4GB33 3ST7A 3JD73 2DTYA 1CIWA 1AX0A 2VMHA 5I8TA 5KHJA 1Z78A 2EXIA 4XFGA 4Q4Y2 3N7JA 2IXKA 1BXHA 4IEZA 1PGW2 2ZA9A 3LCPA 1G8WA 4YVWA 4I3PA 2DWRA 3WG3A 4Y1YA 1LU2A 4YLZA 2GH2A 3J26N 4RR3C 1CAWB 5CADA 5DUVA 3NSTA 4R9BA 2DFCA 5J3UA 3EJKA 1V6MA 1W6QB 3IBMA 3FLTA 4R4XA 2CNAA 4OHXA 1FPN2 1XNDA 3I2DA 3KGLA 4Y22A 4OHZA 1YXWA 2XLGA 3ZO0B 1VBA3 1POV0 3USSA 1ZBA1 3WW1A 4J1WA 1MS3A 2WL1A 1W6MA 4QM9A 1FPN3 1LECA 4P9LA 4YVSA 1TE1B 4E4SA 4KG8A 4MUVA 3M70A 1WW7A 4HKLA 4QQOA 4XFBA 4RA0A 1QJU2 1SFNA 1O7FA 4IQPA 4XF1A 3MLKA 3L9JT 4LEJA 4CDWC 3FMGA 4WVVA 2ZBJA 3AMQA 4BMEA 4DNYA 5FDBA 1EPWA 4YW2A 4BOWA 1J3PA 3ZFEA 3ZXJA 1PIV1 2B39A 2R0FA 2W68A 2DVFA 4CDUC 1M4WA 5C8CC 1QDCA 1QQP3 1H9WA 2HWC2 2P3KA 1AX2A 1H1IA 1MVQA 2ZTNA 5BNPB 1CX4A 2D3RA 1RUE1 4L9BA 4QPGC 4ASLA 3OBRA 2GNTA 2QKDA 4AVVA 2BWAA 2D6NA 4EJRA 4FXKB 2ZGTA 4OI0A 4R8HA 1LGBA 4BLJA 4I02A 1NE6A 1ZZBA 2B5HA 4JGYB 3LOBA 4XFFA 1FOD1 3VBRA 3UL2A 4FPGA 4RS5B 3E5XA 4GB31 3WQ1A 3JD71 5HBAA 1OD5A 1CONA 2K2SA 1AR92 2O0OA 4I09A 4QQ2A 1XNBA 2C0ZA 4Q4X3 1H30A 5D1IA 4C0HA 4Y20B 2PHTA 3CL1A 3PVOA 4E2SA 4QXKA 4ONUA 1AR93 2DCKA 4XQWA 4ZXKA 4Q4Y1 4S2GA 3ZN6A 3NAPC 1SBDA 2YDEA 4LT5A 2P3IA 1H4GA 4Q0UA 5A3LA 2XJVA 2CAVA 2XPJA 1OA4A 2AUYA 1I3HA 2RJKA 1MZ5A 1VBA1 4N43C 5FREA 4FPFA 4D69A 5JIUA 3AFGA 4M3CB 5F5QA 5CFDA 3MI8A 1PHMA 1UU4A 1FPN1 1UW8A 4WVMB 1RB8G 1X33A 1RITA 3HT2A 5EV7A 2R1BA 1O3RA 1N3OA 2VNOA 2XVGA 4LA2A 1PGSA 4XF3A 3NKTA 4XJZA 3ZFFA 1OOPC 1FYUA 4LBQA 1DF0A 4IV1B 4MLOA 2MHFA 3MFAA 3AJYA 1LCLA 4P9GA 1F2NA 1HRV2 3PVNA 4LHNA 5T3NA 3JB8A 1HQWA 4XJUA 4YW4A 5C6CA 1AR73 5D8AC 4AGVA 3BTAA 1BVVA 3D5OA 4YW1A 1QQP1 3KT7A 4JQRA 4WM7B 1GFF2 1DQ6A 1OFNA 1QOTA 2ZGQA 4PCRA 1BVP1 2Z69A 4WZCA 1NA1A 4EN0A 3WW2A 2VQ0A 3AP7A 2HWC1 2IFRA 4RHV3 4KU7A 3LWCA 4TWTA 4HSJA 3OF1A 2YGLA 3HR9A 4PLMA 1DYKA 2RS52 3JQWA 1NLSA 2QZ2A 4MGIE 4XZPA 4DMIA 3UKNA 1IS6A 1GNZA 4YVWC 2XGXA 3S6PA 1DLLA 3WDUA 3S0MA 2V5YA 4FP2A 4LBJA 4Q0PA 1REDA 4BH9A 4XTMA 3MZHA 4LULA 1V6KA 4N9HA 5FPXA 2WLPA 2VOKA 3RWNA 4IEVA 1AR91 1CAXB 4AQTA 5FTTC 1X36A 3AMNA 4YVSC 3WHUA 2CGOA 3MW3A 3TRSB 5L7OA 2BEOA 5KXCA 4CP0A 1CAVB 1Q5OA 3ZSMA 5BNOB 2B7YA 3WQ7A 1XNCA 2E7QA 4FQZA 5J48A 3VDDA 3B3QE 1JHNA 1IQAA 4GQ7A 3VBOB 5JLVA 5JWPA 1CAUA 2DU1A 3QLQA 1CAUB 3SXWA 2A6ZA 4CDQB 2RJLA 3ZIXA 1DQ4A 4AHWA 4OVEA 3EQEA 1RUH2 4R9AA 2XUMA 3U0ZA 5H9QA 4Z1VA 2OZ6A 4DZGA 4D7YA 2HEVF 5B2GB 5HCAA 1N47A 5HCFA 2F4PA 1H2MA 1RUH3 2D44A 3CLPA 1WD3A 2GZWA 3FE5A 4LE3A 2WC2A 4R52A 5JOYA 2BBVA 2PAEA 2WLQA 1AR71 2LTNA 3V0BA 1HRV1 1VBB2 2EIGA 1G9CA 1C4RA 3ZYIB