4CPBD

Crystal structure of leca in complex with a divalent galactoside at 1. 57 angstrom in magnesium
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
120
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLIHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title A Leca Ligand Identified from a Galactoside-Conjugate Array Inhibits Host Cell Invasion by Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4cpbD00
1W8TA 1OKOA 3ZYBA 1W9FA 2JWPA 1V0AA 1W8ZA 3ZYFA 1W8WA 4YW6A 2LROA 4LKEA 4BQ5A 2Q1FA 4BQ3A 1L7LA 3F95A 1OH3A 4LK6A 1UOJA 5D21A 1WMXA 2WYFA 1GWLA 4LKDA 2LRPA 4CP9A 1WZXA 4YWAA 4CPBA 4LJHA 3UT0A 4CP9B 4LK7A 4YW7A 4BQ4A 2O14A 1W8UA 4CPBD 4LKFA 1GWKA 1HN0A 4BQ2A 2VXJA 2C24A 4A6SA 2KR2A 1WCUA 4AL9A 3ORJA 2K46A 1W90A 1GWMA 3ZYHA
chains in the Genus database with same CATH superfamily
4K20A 4UW5A 4D7YA 3D6EA 4CP1A 1KFXL 4Y1ZA 2UYAA 3WDTA 1VBE2 5GLVA 5JZGB 5FZHA 4SLIA 1NCQB 3U75A 2NQYA 2R16A 2LW8A 2XMLA 3ZYJB 4MADA 4H2AA 5C8CC 4FTEA 1F4HA 5FYHA 4LORA 4RS5A 2DU1A 4OMDA 5FZOA 5K0UB 3ZIWA 4HT1T 3BCWA 1RITA 1ZYBA 3ZOIA 5LASA 3UETA 1G86A 4CU8A 1WLTA 2D3SA 1MZEA 1OOPB 4CDWC 1RHI3 3KV6A 2WQ8A 2B9UA 2BOIA 2XVKA 4X8PA 2YUEA 1JUIA 1BBT2 4PBPA 4QAWA 1DZRA 4L92A 3B5LB 4XF4A 5T3NA 4UFMA 4Y1XA 5T55A 4RSUA 3BIEA 1GYKA 3ZXAC 4BK5A 4RFRB 1B35A 1SDWA 3F95A 5JOWA 4FPKA 4WVWA 4HG6B 5DQ0A 4A2UA 2EALA 4Z82A 3K51A 2A3XA 4IV1A 3GBGA 1YI7A 3J7HA 1EP0A 2J22A 2JG9C 3AP5A 4AFDA 1RGSA 2LUWA 4L9BA 4MX3A 2XBO3 4TSVA 2ZMLA 3CIHA 4YW1A 1QH7A 4AW7A 4F7ZA 1POV3 3T4VA 5BNQA 5LCWL 5EJ3A 2W2IA 2X29A 1ZZ6A 2LROA 1REDA 1MR5A 1PK6B 3ALQA 1RUI2 3IT8A 1AL22 4LK6A 2OKXA 1UIJA 4COUA 2ZGNA 2E7TA 2R062 3WP6A 4JHZA 5E8AA 5CB7A 4AGVA 3FZ3A 2DFBA 1QJX2 2QQUA 3V64A 4A3ZA 2D3PA 3RYPA 1V6MA 2CY6A 4ZHNA 2HEYF 1QWRA 1UYZA 4BZ4A 5F3CA 4E4HA 5DAVA 3WG2A 1PO12 1UOBA 3N7LA 5HI0A 1QQP1 2VO5A 4BYYA 2XJSA 2RMU3 1O6UA 3BPSA 4AEMA 1UYXA 4FO9A 4L2NA 1V0AA 1EUTA 3J7NA 3SQOA 2QQVA 3VZOA 3ZKUA 4JRLA 2WO2A 2Y60A 1RVF3 3O5SA 1S0CA 1TNFA 1MEC3 1LB2A 3KF3A 4QHZA 4PLOA 4EN8B 1YIFA 5EWSA 4F8AA 2E26A 1Z7S2 4ZXEA 2JG8B 3S0MA 5FP8A 4RR3C 4LE3A 4DB5A 3JB8A 2I2SA 2JDMA 3AYEA 3I3QA 5EP9A 1ND3C 3D8CA 5CNAA 2XLAA 3AKPA 4DRRA 2WNVC 3E6DA 3MLJA 5HCHA 1ULDA 2IXLA 4YVWC 4MGSA 4DFSA 5FYVA 3H7JA 1PK6A 1UY4A 2ZAHA 3VBUB 1XNAA 3V0AB 2YC0A 5FYZA 5FY4A 3J9SA 4FOQA 4ASKA 1DDLA 2D6OX 2VM9A 4XXAA 1ASJ2 1ZRDA 3WD5A 2TEPA 1APNA 1YWKA 1GKBA 4NPMA 2CDPA 5BUVA 4Z92B 3H3LA 3O1SA 1C1LA 1F15A 3UT0A 4PHZA 3HVDA 4NVPA 1QNWA 4BXSV 4HXCA 5HPOA 5FZEA 1W3XA 3JBG2 3IDBB 1VMHA 5FAXA 3C8XA 3B9CA 3NMBA 4GB31 5LW9A 4LBNA 3L2HA 1NLSA 5DZGA 4XUQA 2BRTA 4LOTA 1LGNA 1F5FA 1AR81 1EAH1 4LBJA 3WVJA 5C3OA 2EF6A 1DQ0A 2MHFA 4H55A 1AYM1 3M8LA 5F3EA 5FFOC 1EYBA 3VD3A 3WF0A 3TN93 1R64A 2WN2A 1J1TA 2XWBB 4GA9A 2P2KA 1CD3G 4X6RB 3UGFA 1GICA 3VBOC 4R9BA 1C8M1 1OHFA 4N7IA 2OQ6A 3NAPC 4YW4A 2IVIB 2IZWA 1EY2A 4GZ9A 4LE4A 4DUWA 4Q4V2 2PN5A 4MSVA 4COVA 1QIQA 1HN0A 2XXZA 2BPA2 2HWD3 4OFGA 5ACA3 1VRH2 3WNXA 1WCDJ 1RUD3 2R6QA 4LHLA 1VJ2A 3JD73 3NO8A 3K75B 5HV4A 4DOUA 5J7MA 1JZ6A 1LOBA 1Q8QA 1RUOA 1XNKA 3VDDB 4E9KA 3EMRA 5FMOS 2E32A 2DVFA 2DCJA 2G9ZA 2ZX1A 3RJRA 2VVEA 5JI7A 5CFCC 3G7DA 2XHNA 4PIXA 5F39A 1UOFA 1I5PA 2FCTA 1DP0A 1TE1B 1W0OA 2W9XA 2JDYA 1K45A 2C4XA 4HVRA 2R49A 4Y24A 5KHIA 1MS8A 3NW4A 4LBQB 1W04A 3U11A 3CLPA 4FPCA 3JUUA 3PHMA 4XJ9A 3HQUA 1VE0A 4I0BA 3IIAA 2VCAA 3GGLA 2DBIA 3JQWA 3VZJA 4AR2A 1F9KA 5EZWA 2RS33 3I97A 4NHLA 5C5TA 4ISRA 3THPA 1GOGA 3GALA 4TZDA 2XJTA 3GDBA 1VBD3 5LATA 3TYJA 4YZ2A 3RZGA 1JU4A 4N53B 2C5DA 4NMIA 3VKNA 2GP5A 2L9LA 2NYYA 2X8KA 2OXBA 3A7QA 5EYYA 1XNDA 2DBNA 4NIAA 2D97A 1ZBE3 4FQZA 5A7SA 2A73B 3CMGA 4QX2A 5F3GA 3ZN6B 4IEQA 4K21A 5L7OC 2ZPXA 4CCCA 5FZ3A 3ON7A 1QJZA 2KM2A 3GZUC 3WCRA 2PTMA 1WMEA 2GC2A 2HWE1 1PVC1 2ZAAA 2W1UA 3K4ZA 3KWVA 3VDDA 4GXLA 3WP5A 4C90A 1OKOA 2CU5A 1XB9A 3POFA 3VHPA 3OD0A 4ZU7A 1G9CA 5IWFA 3AZXA 1W8WA 2WAOA 1XC6A 1DG6A 4LBKA 2B7YA 4H3WA 4QXBA 3POYA 3ZFGB 4XUOA 3I2OA 2OVUA 5FYUA 3WG3A 2UURA 1S2EA 3OBZA 1JZ7A 5JMCA 4COZA 2JDHA 3IMMA 4YZ1A 2QQWA 3WT3A 5L9RA 2SBAA 4XBQA 1FPN1 3VBFC 1VBA3 1IS3A 3EBRA 3KGZA 4UFKA 2HWB1 3RS6A 3IZOA 3RSJA 1XYNA 3M70A 4UF0B 4PLMA 4FAHA 4BQXA 2VAUA 4JDMA 4NIIA 4AEDB 4N53A 5KXEA 1XQNA 3UL2A 4MLOA 3GCXA 2ZMKA 3A21A 5DDJ3 3ES1A 2WS91 4RHV3 4R9DA 2X53S 2VD7A 4AHYA 3POJA 4YG3A 3WLUA 3ZN6A 5DZEA 1IS4A 4CUAA 5C4WC 5JXIA 3I3DA 1W8UA 2QBXA 5GZDA 1ODNA 1RMU1 5GALA 1ZM1A 5BNNC 2QQJA 1CPMA 3NNLA 5IT6A 2P37A 4NIDA 2A7AA 2DUPA 1S0DA 2UYBA 1A8MA 1CJDA 2Z42A 2ZX2A 5BXXA 3BTXA 2WA3A 1R081 2ES3A 3VD7A 1O4YA 1RUC2 2R071 4Y26A 2F4LA 5LRRA 1ZREA 3DPRA 1A3KA 5LB6A 1HW5A 1VPHA 2V09A 1D4M3 1GQHA 1SBDA 4TWTA 5JAXA 1RXFA 3R05A 4HVOA 4L0PA 4E2GA 4LUMA 2QCSB 1GBGA 3V0BB 1UD1A 1DZQA 3AVSA 4N8MA 4C0HA 5T50A 1AF9A 1H9PA 4R4ZA 3LIHA 5IK8A 5ABJB 1W6QB 2WA4A 2ID4A 4CCKA 2WNUA 5DXDA 4QB1A 3O1UA 4QPIC 2BNOA 1DQ2A 2RS51 1GR3A 2W92A 2ZS6B 4QQOA 3VBFB 3PVOA 5FUNA 4B4RA 5F5IA 3TOJA 4GB32 1DGWA 3PDQA 4GJYA 5IJRA 4M3CE 2RS12 1H8TC 2DYCA 2JB8A 2VVFA 1AR82 3AJZA 4A6OA 1NOVA 1SBFA 3AK0A 1UOJA 1ZBA1 3L2YA 1YNAA 2GMPA 5FP3A 5FLJA 4EWEA 3ZLIA 2NPIA 4XQ4A 2IVJA 4XTPA 2WZR3 4A7KA 3IDAA 1EUUA 2B5HA 5EHDA 3ZYGA 1RUG1 4QKFA 2X5IB 2YDEA 4AG4A 4EYUA 1EPWA 3BTAA 5EPAA 1VBE3 2HWF2 4FXGB 4XMIA 4M3CA 1KQRA 3GXUA 4NR1A 5FY9A 3VL8A 5IHRA 4RQPA 1LHNA 1GNYA 2V73A 4U2AA 3WQ0A 4YGBA 2BFUL 1O8PA 3CU7A 4V2VA 1LGBA 3HPNA 3ZDSA 4F3JA 4PCRA 5I91A 3MGUA 1LHWA 4BM8A 1CWPA 1WKYA 4A3XA 3VBSC 3H1MA 1CQ9A 2DURA 5A1AA 2VNVA 3OF1A 5D21A 4Z1VA 3ECQA 3MBWA 2JE9A 3O1OA 1L3JA 4QXKA 2AEYA 4BQWA 1VIWB 1SLLA 1W6QA 2Z2SB 3J26N 4TXWA 4EV0A 1BK1A 4QX8A 1RJ7A 3RWKX 3F2ZA 3VHOA 4A4AA 5FKCA 2QJVA 1BBT3 4QQLA 5IFTA 3ACHA 1TME1 4Q4X2 3P3PA 1WBLA 4INDA 3BODA 4P9LA 3A23A 1V6NA 2VOXA 3DUIA 5B4XA 1UU6A 2QZ3A 3VBHB 1ODMA 3CZUA 2P34A 3CHXA 1NA1C 4AXOA 4MGKE 1TVGA 5BNOA 4D8MA 4K9SA 4PJYA 3PMSA 4XZUG 2YPDA 5I93A 4HSLA 1R092 2E9QA 4QPYA 3GYDA 5CEHA 2ZGUA 4GULA 2VMGA 4QU2A 4CDUB 5FXXA 1D4VB 5F6KA 2DUOA 5EJZB 2VECA 4LO7A 4AI2A 4XF1A 3NSTA 5A6QA 2X5IA 3SISA 4JVAA 2ZJCA 1YQ5A 3H3UA 4K6BA 4HK8A 1LJ7A 3LB9A 1QKQA 1H0BA 5F32A 1FATA 3LSDA 1DGRN 1RUI3 3AL6A 4XQDA 3WX5A 1AL23 2AR6A 3KMHA 4RL7A 1PIV2 1MS0A 3OOXA 3R4DB 5D8AB 2R063 2QQKA 1CJPA 3M2MA 2HWE2 1PVC2 2VW1A 4FFGA 3IB3A 3JZVA 4WVZA 1QJX3 4XZPA 4WVVA 1LRHA 3J7LA 5CVRA 4YVSA 1UY2A 4JGYA 3PL0A 3UGHA 1JYWA 1W03A 5AVPA 1IQDC 1PO13 4NAMA 2EIDA 2X10A 2AUYA 1C4RA 4RA0A 2O14A 5FYBA 3ZIXA 2G9FA 4H14A 1HJFA 2HBUA 2FBEA 3WP3A 2VW0A 4KWJA 4W65A 2R0FA 2G9GA 3H9AA 4RS5C 3VZLA 3B01A 2Y8KA 4CYDA 4YGCA 5HXMA 4MGIE 5A3WA 2HWB2 2J1SA 1Y9MA 2BEOA 3KCYA 1Z7S3 2X09A 4KU8A 4CDUA 5BNPB 5F37A 1ZA7A 4C91A 3OBRA 3K48A 5E1RA 2Y6FA 2EXIA 1YJKA 5FPZA 4DEVA 3FLTA 2BTVC 3MI8A 4LOSA 2WS92 4JQTA 3WQ7A 2A1XA 2J1EA 3CF6E 1JS9A 4IV3B 4DPNA 4HANA 3ATGA 3ZM8A 1HV0A 1B35C 2WUHA 2A75A 4HN0A 1VAMA 1O5LA 4EE2A 5HCAA 1JZ3A 1UL9A 1VLNA 1RMU2 5D8AA 4IV1C 3ZMNA 1YIPA 4D69A 4Q0VA 1ASJ3 3WXPA 1UXZA 4IEYA 1R082 3TNPB 2R072 2R042 3S57A 3VZMA 4W4ZA 2RM21 5A3TA 1G9DA 3H0OA 1VMFA 5ERLA 2AZ5A 2IXHA 2N7GA 3ES4A 1SBEA 3I3BA 3TB0A 3JBG3 2FZ2A 1ULGA 1G8WA 1GOHA 3CZJA 3SHRA 1N1TA 3THTA 3ZXJA 1SZBA 4JKLA 3LDRA 2P3JA 4XIOA 4Y1YA 1SEFA 4HPKA 1OLRA 3ILFA 2JB4A 3LKJA 4NAOA 5SV5A 3AKTA 5T54A 2PAMA 3WG4A 3EO6A 1P8JA 1W6MB 2VBDA 2QTWB 1QMJA 2RV9A 3QOPA 4IETA 4OZOA 4ET7A 1EV12 1N3QA 1ULPA 2GDFA 2YBSA 1STMA 1IKQA 2YFZA 5FIXA 3EXUA 2ZGSA 3KZ4C 4P08A 4DXZA 3PVEA 4MO3M 3URFA 1C28A 3FJSA 2RDSA 5JPMB 3H8RA 2VZOA 2XQXA 4Q4V3 3DKWA 4YLZA 5KXDA 2WL1A 1NXMA 3D5OA 4YZ5A 2ZHLA 1PMIA 3HT1A 3S7EA 3P5BA 1ZX5A 3NKTA 1ZBA2 3UKTA 5AC91 3O1PA 1OKQA 3OGJA 4OHYA 1VRH3 4PLNA 1UZYA 1ZZBA 5CA6A 1FOD1 5FZCA 1Y4WA 2LS6A 3I2FA 3O14A 3WUCA 4NRMA 1WA6X 1YQ8A 2CV6A 1RUF1 4Y4RA 2CWMA 2XJRA 4YM0A 3GM8A 3BB6A 1CAXA 5FRAA 3RWNA 4A41A 1CZTA 4BU2A 2P6HA 2A6VA 4AHZA 2D5FA 3ZYHA 2O8QA 3Q8CA 3KV4A 1IKPA 4JCKA 1W9FA 1YFXA 3R4SA 3T30A 1NCRB 1GZCA 3GBFA 5KHHA 1KXGA 4XBLA 4G3YC 3VD9A 2EA7A 3O1VA 3CJIA 5JR2A 2E7AA 1US2A 1OD5A 1VBB2 2XDVA 1W28A 5JOXA 3PTRB 3PLQA 1QJY1 1W8HA 4FP3A 1UKGA 3WDVA 1TMF1 1VBC1 4MUVA 5DAQA 4NO4A 5ANQA 5IFPA 4UBGA 5FYTA 2W68A 4CCDA 3E6CC 4NHXA 3U4XA 3WNOA 1VMJA 4O9EA 4E8CA 3N7JA 4AEKA 4GH4B 1HN1A 4IXLA 5CKQA 3J7MA 4OHVA 2W3JA 4MXWB 5A3PA 3AP7A 5C7GA 5LEKA 1UZ0A 5FZKA 1UN1A 4AQTA 4QM9A 1HQLA 2ET7A 2ZGQA 3OPWA 3DEMA 3IPVB 4HSJA 1QJFA 1LULA 3VDCA 4PQQA 3FFZA 5CIRA 1WMFA 1H1MA 2QQLA 3M4FA 2WT2A 2VW2A 2UWBA 4S2DA 1WZXA 2QZ2A 1N1SA 4XABA 4AAPA 3FN9A 5DG1A 1LOCA 2W94A 3ASIA 3H42B 4LKFA 1GOFA 1DYKA 1LODA 3K3OA 5L73A 1WA4A 1HRI1 1K5MC 1WCSA 3AYAA 2BVBA 2ZGTA 4QKNA 5TSWA 4KNCA 3ORJA 3SH3A 2GC1A 1KGYA 1OLQA 2V5YA 5B2GB 4KWLA 5A7QA 3SNMA 3KV9A 2WFPA 4JTNA 4NIGA 3GJAA 3AFGA 4IEWA 5A7OA 1BMV2 1WW7A 1X8EA 4QMAA 1IHMA 2F6BA 3NV2A 4FPYA 4OHXA 1T6GC 4M4RA 2WT1A 1JN2P 4YFZA 4PDWB 2WYFA 5GLWA 4JHTA 2D6KA 5GZFA 3MW3A 1DCSA 5A6ZA 4QDRA 4D6SA 2A6XA 2JICA 4YW5A 4XAAA 5A1FA 4GH4A 5CKMA 5FPUA 1SHWB 4ASMB 5LY2A 4Q0SA 4GALA 4CDQA 1IPSA 2P3KA 1PZ9A 4IE4A 2GMMA 3P6BA 2NM1A 3DGTA 4XUTA 5DMYA 4CU9A 4XIKA 5GLUA 4CTEA 2RJLA 1OC1A 2VMHA 4Q27A 1Y7BA 1RJ8A 1H9WA 3ACIA 3IKWA 2KD7A 5IAVA 2YMZA 1SQ4A 5F6LB 1NE6A 3TAYA 5FYYA 4O65A 4META 1TEIA 5FY5A 3E5UA 3O1TA 5EJ1B 1SFYA 3WV6A 2VQUA 1ULCA 5IVJA 1ENQA 2XG3A 4RGKA 2Z69A 3H8OA 2HWC1 2HJIA 2XB6C 3LEIA 5FYSA 2PXJA 1VR3A 2MEV1 2WZ8A 5FZDA 1RUC3 4YM1A 5FPVA 3VBRA 4BH9A 4CPBD 4CXYA 2UY8A 5EYXA 3SLIA 1PZ7A 2VXJA 5KC5A 3J8F1 4A6SA 5FJKA 3GF6A 3E5QA 4DUVA 2EICA 4BK4A 4EWDA 2F17A 2ZGLA 5FY1A 4ES9A 3W9AA 1CX4A 2I07B 3WUDA 5FZFA 4K40A 1O3TA 3OCPA 1ND2B 1RUJ1 2ZCWA 3AZZA 4COYA 3N7KA 2BOJA 2UU8A 5T5PA 4OMCA 2ARBA 4R9CA 1L7LA 4JGZB 4FXKB 4UOJA 5FMCA 2DFCA 5FZGA 2PMWB 4XFIA 4JC1A 1BQPA 1QDCA 2VUDA 4HBNA 1MVEA 1SPPA 4FP2A 3BTZA 2E51A 4W6WA 2ZGKA 1E5IA 4BPZA 1E5HA 1H6YA 1K3IA 3JXSA 4YM2A 4DMIA 4EQVA 1AR62 4GB33 4LEJA 1LU1A 4QT6A 1V9U2 1FNZA 5F8PA 2WDBA 2RS13 5DZFA 4CSWA 4Q4W2 1VB2A 2P17A 3BGAA 1MVQA 2FMDA 4XJZA 1PM4A 2JDUA 2ZTNA 5CYYA 4D94A 5FO8B 3MV01 1COV1 1UYYA 3FHAA 4NHMA 5FZ0A 4GMP3 5JZGA 4X6QB 5FZIA 3ZXFA 1NCQA 4Q4Y2 2Y64A 2TUNA 4CCMA 3HBKA 1TZOA 4UT5A 2FD8A 1AR92 3N9OA 3U37A 5K0UA 1A6CA 2D6LX 4PI2A 2G1MA 1WD4A 2HWF3 2VZPA 4Z07A 4EROA 3UV9A 3HQXA 4L97A 1OOPA 3PMEA 4N53C 1X9PA 5AC92 5CFDC 2EXKA 5F7UA 1T6BX 1BEV1 1I9RA 4FPFA 4JX0A 2A71A 4MGYE 5A80A 1SG3A 2XUEA 3WDYA 4EWAA 3VKFC 1FOD2 2ZX0A 4DY3A 2NMOA 1W0NA 2VOKA 5FBZA 1RUF2 1LOGA 1S0BA 2WFF2 4XCAA 2WO7A 4CEYB 1I5ZA 1VAVA 2C1FA 2XR4A 3FE5A 5IVYA 1W99A 1QXPA 4P5YA 1DBNA 1ONAA 3AXDA 3IDCB 3SITA 1MQTB 4Q4X3 2OPKA 3WR0A 3O7OA 2Q1MA 3DPRC 4M4PA 1MS3A 1C5IA 2VCCA 2Q8OA 1CGPA 1O3SA 1Q8SA 3ZFEB 2JKXA 3B3QE 2D44A 2XJUA 4EJRA 5JXJA 2Q0AA 1H6XA 4K1ZA 1OVPA 4Y5TA 1HXS2 2Z5WA 2ADEA 4UW3A 1AX2A 2P3IA 4S2FA 3FC0A 1R093 1UMIA 1QF3A 2HEWF 4JDOA 5A33B 3WP4A 2W0XA 1ZRRA 2ARAA 3U0ZA 4YW2A 3VZNA 4FOYA 2IXJA 5F5CA 2DTYA 4RFT0 3USSA 3C7GA 1OUXA 2WNUC 1O3RA 2GNDA 3CL1A 1ENRA 3OJBA 4R52A 4W8JA 1LENA 2Y6JA 4B1LA 4BISA 2ERFA 1UAIA 1R1A2 2CHHA 5DUUA 1Y3TA 4UXAA 4LO4B 1JYCA 1SLIA 4OQ8A 4YW7A 2VMEA 3I2IA 4Q8LA 1PIV3 4Y20B 3ZFFB 1JYTA 1GWKA 2CWSA 5T5LA 2HWE3 1PVC3 5FBJA 1PM7A 1JTZX 1X33A 2QDRA 1AVBA 2XWJB 3AL5A 2PHUA 1M06G 1QOOA 5IVBA 1RHI1 2AGSA 3H8UA 3PNAA 3KCXA 4AHWA 4ZZ8A 5K8SA 4CUGA 3R4UA 3K3NA 4FQ4A 3TBDA 2R1DA 1MS5A 4CUBA 1MQTA 1UMHA 1GQPA 2CAUA 4IDZA 4FTSA 1HQNA 3HD8B 3POWA 3T09A 4LO8A 4D6RA 3AZWA 2JG8A 3DN7A 1FV2A 4B4PA 4RQPC 4H7MA 5JIAA 2WNOA 4B8EA 4WM7B 1G7YA 3D0SA 3OY8B 4K8FA 5DABA 2D6PA 2PA7A 2BGCA 3VBOB 3AMHA 2HWB3 3LF7A 3WEZA 1F8VA 4QKDA 1OBNA 3GCWA 1PGW2 2E7QA 2DDUA 3NKGA 4Y1UA 2V72A 2JE8A 5LWBA 5FZLA 2Y0IA 2CGOA 3VBUA 3V0AA 4NUBA 5JI9A 2WSVA 1POV1 2ZOEB 4GWNA 5I0UA 3RYRA 1XNTA 3MF9A 3I2JA 4BQ1A 1O4ZA 3VDBA 3UGGA 2Q1FA 2WAAA 2WS93 2VZ3A 4ZKTB 5I8YA 3IWZA 4K8RB 3POIA 3AP9A 4Q1RA 5LA0A 1KS5A 2R1BA 1T2XA 4CDWB 2OIIA 4RGGA 5BNOC 4BOWA 1HB1A 4Y20A 5C6CA 1RMU3 3AMQA 2H6BA 2JD9A 1CR7A 1JYXA 3MV11 2HWC2 1IG3A 1G9AA 2KXLA 1YQ2A 1RUNA 1D2QA 1R083 4BLJA 2MEV2 2R073 2R043 2W95A 1W6OB 1W39A 3WSOA 4HFSA 2VMCA 1W2UA 3BI3A 4PF5A 2ADDA 3DF0A 4YFWA 3SH4A 2X5IC 4QDSA 4LNVA 5LBFA 4AFMA 1D2SA 4CU7A 2RMU1 1W8ZA 3AP6A 4Q0PA 1C57A 4XDQA 4NROA 1SMVA 3GZAA 4U36A 3O1MA 1XYPA 1RVF1 2VTXA 2JG9B 4BLIA 4MYEA 4B7EA 3D3AA 1MEC1 3DV8A 3KB5A 4IE7A 4LQRA 3OY8A 1CPNA 4WM7A 5A7WB 1XXNA 5FLHA 4CE8A 4KQ7A 3V65A 5C71A 1IGOA 1O5UA 2BBVA 3PURA 4P9IA 4IGOA 3BPZA 2E31A 5IVCA 5JIUA 1NZCA 1W6PB 1AJOA 1EV13 4OI2A 2J1RA 1CAUB 2DCYA 2W47A 5B4NA 3TEZA 4YVSC 3SMHA 3UESA 4JGYC 1CAWB 2D3RA 3IIIA 4PF1A 4BWOA 1Z0HA 2VC9A 4RGAA 4XFFA 4P5HA 1UZWA 2ZGMA 3O0XA 3LAGA 1N1YA 2PYTA 5FKBA 4E4ZA 4LR4A 1ZBA3 3B00A 2QVSB 4S2HA 4XAEA 2HLEA 1ZRFA 4R4XA 1VRBA 2XQRA 2A5ZA 1VALA 2QUOA 2YFUA 3I4IA 1MS4A 2ZHMA 2FDGA 3WF2A 4C1WA 3X29B 4CEWB 1ENXA 4AGRA 2WBKA 5HBAA 1JYVA 4OI1A 4LBQA 2YU1A 4CDUC 2PHTA 2ZXQA 1V6KA 4QB2A 2XHKA 5IK5A 3BKZA 1W05A 3VZKA 1IG0A 4AF9A 5FPXA 1TQ5A 1ALYA 2VMFA 1OUSA 5LK5A 1VBB3 1JZ8A 1V6IA 4KWUA 1REEA 3HIFA 1AHSA 4LT5A 2YHJA 1F2NA 4JRAA 4LBMA 4EN0A 1GZWB 4RR3B 4LKEA 3PUQA 1QQP2 3NV3A 4AI8A 3TN91 1X9TA 4XBNA 3HJRA 1ND3B 5D8AC 5DPNA 4XILA 1GP5A 2WYSA 4FOVA 2BFUS 4XUNA 5FJHA 1CESA 3OG2A 4ASLA 3PU8A 4I30A 3AB0A 3LOBA 2CYFA 2CTVA 2WKKA 1CAUA 4I0WB 4M0NA 5FK8A 3OUHA 4YVWB 3ZSKA 5FMOL 4BCUA 3S5AA 1FMD1 3OBTA 3ZX7A 2PHDA 1C8NA 4G4FA 3UYJA 4BQ2A 3AJYA 1C5HA 2Y6HA 2A3WA 3WW4A 1SLTA 2VUJA 2HWD1 1UF2C 1R1ZA 2AREA 3NV4A 5ACA1 5L9VA 1QH6A 2C0ZA 3JD71 3LIGA 2LM3A 3M1HA 4QDQA 4YARA 3AYDA 5CADA 4FBFA 1SFPA 1J3QA 4HL0A 3H1YA 4XF9A 1H2LA 2VH9A 2O0OA 2GH8A 4RN5A 2VCMA 2JIGA 4ZXKA 3ZFGA 4CEWA 3RMXA 1Q3EA 2WO1A 3OB8A 1H2NA 4P9XA 1QOTA 2Q8EA 5I8TA 4C8DA 2JEMA 3ABZA 2B9VA 2NLRA 4AWDA 3VKOA 2VPVA 3U14A 3PVNA 1JOBA 2VGDA 2A6ZA 3NV1A 3O0VA 3D0JA 4OZXA 2BV4A 3DL3A 5FO7B 4E2SA 4Z2AA 4KH9A 3K77A 4UF0A 1GMMA 4JQRA 3AFKA 4AEDA 1XYOA 5D1IA 2CDOA 3QLQA 1LEDA 3NAPB 2JDZA 1SACA 4HKLA 2XGXA 2ZGOA 3MIHA 3RZZA 1AX1A 1ND3A 3ACGA 4OI4A 3PJYA 4KU7A 4OUSA 5GLTA 3LA7A 1EAH2 4NWWA 3ZSLA 4XMAA 4Y22B 2VZTA 1AYM2 1VBD1 3INAA 1ENSA 2DF7A 5F1RA 5JCTA 2XKPA 1POV0 1WBFA 1GZTA 1XJAA 4AE2A 3WQ1A 3NJVA 1C8M2 5FV3A 5C33A 4LTAA 3CJIC 4I0AA 1ZBE1 3ZXDA 5J36A 1MZ6A 2BUKA 2FHRA 4XFAA 4YGEA 3WF1A 3LFIA 1UU5A 4IEUA 1OPMA 5CFCB 2K9ZA 3N9QA 3CNAA 3DYPA 5FY0A 4XJAA 4YNIA 2ZZQA 4UFIA 3U10A 4NE9A 5LBBA 5G04L 3ZPYA 5JSRA 4NIHA 3BOPA 3V0BA 2B8MA 3APBA 3SCHA 3POGA 5LBEA 4CCOA 3OGSA 4DQAA 3NJYA 1MZ5A 5ABJA 4FSJA 3UKNA 3WHUA 1UIKA 3RZJA 2EAAA 5LBCA 2IXCA 4CP9B 1HDKA 2GAUA 3LA2A 5IW0A 3VBFA 1NQDA 4E4DX 3U4SA 3VV1A 3LFMA 4DXRA 3EHKA 5A7NA 5FPLA 3ZMOA 1GNHA 1F35A 2OUJA 1N1VA 5FQ0B 1ZZ9A 1NE4A 1LAJA 1KFUL 3CEWA 2J42A 1FV3A 3LWCA 2WO3A 5FXVA 3VD5A 3NRUA 5I0SA 1FNYA 2GC0A 4FPGA 4WVMB 1AR63 2ZACA 4NJ4A 4NN0A 1ST8A 4KG8A 4AVSA 5L7OB 1V9U3 1Q8PA 2XKOA 3LPFA 4Q4W3 4RHV1 1A78A 1DZTA 5C9AC 1J84A 3THCA 4LKSA 2W91A 5JSPA 4LO6B 4YPJA 4N9IA 1OPOA 2J7MA 5FREA 4ZS3A 3VKLA 1W06A 3OYWB 4XDPA 2BGOA 4Q4Y3 4A42A 1WLDA 5CZKA 5IUQA 1JXNA 1LNSA 3W5NA 1M4WA 2DVDA 1AR93 4GH4C 2JWPA 2J1TA 4J1WA 3RYKA 4MGTA 2XOMA 4QHBA 4CDQC 5GKAC 2PLV1 4LA3A 2CAVA 5J98B 3SC7X 4A7ZA 3FMGA 5AC93 1OA4A 2VZQA 5K4LA 2LRPA 1I6XA 2J1AA 3IMNA 4DO0A 1HQWA 4E4SA 1DGRA 3PUIA 5CISA 5LY1A 4Y5SA 2JECA 1FOD3 4XFGA 4Z8BA 2RDRA 2ILMA 2VR4A 4OLLA 3MW2A 5E16A 1JYNA 1JU3A 1LECA 1RUF3 2WFF3 5FWEA 3VBHA 3ENRA 2GNTA 5FQ0A 3QH7A 1U5IA 5JOZA 1UO9A 3MIFA 4NRPA 4NWVA 1ZRCA 3M3QA 1FPN2 4K1YA 2RDQA 4P9GA 4Q0QA 5CG8A 3K46A 3WINE 5JLVA 1KJRA 4WVMA 3VBRC 3POEA 4KL1A 5CU1A 1UMZA 1CX1A 3H50A 1V70A 4URTA 1OH3A 1G6NA 2BBAA 3RZHA 4JKKA 5H9QA 5BNNB 4FPJA 3Q9OA 2JD4A 2DCTA 2IUWA 1HXS3 2B42B 2VOVA 5T52A 1KDKA 2O1QA 3TEYA 2LTNA 1NLQA 1WUVA 3CBNA 3M3CA 3T4HB 3ZXLA 1X82A 1WLWA 4JDNA 4FPEA 5FOBB 1W9TA 4Q29A 2QQMA 2VBPA 4DEQA 1FMD2 1KS4A 1N47A 5E88A 1VBE1 1QU0A 4MG2A 2WT0A 1GNZA 3FLPA 1SCSA 1BKZA 3VLBB 1AL0G 1UNBA 4FCAA 5JWPA 1H1AA 1KD7A 5FPAA 4HMZA 4XTMA 4C1XA 3LCPA 3NVCA 3KVBA 1R1A3 2RR11 1W2OA 2YBPA 5FMBA 2G4IA 3WF3A 4FPLA 4QWNA 4XE9A 3GHNA 1U0AA 5BPXA 1YUDA 4M3CF 1VAKA 4QPIB 1E5RA 3M3IA 3WY6A 5JZGC 2CL2A 4JV4A 3RPQA 1ULFA 3NNGA 3OGRA 1NCQC 2XPJA 3HNYM 3S7IA 4J6GA 2FQPA 1ZVFA 1BBT1 5FO9B 3PTYA 3A22A 5ANNA 3V56A 4AQ2A 5F3IA 4O7XA 4CCJA 3DXUA 2WRAA 4HOOA 5K0UC 1JHJA 4K7JA 4BB3A 1Q8VA 3RJ2X 3O12A 3N36A 4IEPA 1W8TA 1LHUA 3LZZA 4LPLA 4GWJA 4AGGA 5JXHA 5KHGA 1QY4A 2DVAA 1FYUA 2RS52 2Z4FA 4IESA 5BNPA 3MZHA 1OOPC 1YEWA 2B46X 2JXAA 2XUMA 4KBBA 5FYIA 2Q1ZB 2BDRA 3LDKA 3MIGA 1JUHA 1DQ5A 1Y9GA 4D7SA 1JZ4A 1DHKB 2K0GA 2P6CA 3MUY1 4BIOA 1UZZA 5A3LA 2X05A 1H1IA 4IV3A 5CKNA 3KD4A 4CP0A 2XL9A 1REFA 1PZ8A 4S2GA 2VTFA 1WW4A 2OUHA 1SLCA 3VHNA 4N9HA 1ZZ8A 1O7FA 2ZHKA 4OHWA 1YLLA 3OTFA 4CDXB 3VBSB 2ZABA 3N9MA 1F4AA 4AK3A 1Y9QA 3KF5A 1AXZA 1RUG2 1GV9A 2A70A 3EQEA 3FBMA 5KXCA 1W90A 4ZZ5A 1RUI1 1VB4A 1C1FA 1AL21 2C6SA 3KVAA 4N90A 2ZGPA 3VHRA 4FAGA 5A3MA 2CNAA 4E27A 1NXD1 4AVTA 3W59A 1RUH1 2HWC3 3ETPA 3LA3A 5K9YA 1ACCA 2B45X 3WHTA 3Q8EA 2MEV3 1J3PA 5JPNB 2WQZC 1S0FA 2OZ6A 1NA1B 1PK6C 2PAEA 2WLPA 4MHUA 4Q2FA 4XPVA 1PO11 1AYN1 3S30A 4FFHA 4HK9A 1W6MA 4P02B 2D98A 3HQRA 3FBYA 4IW3A 5A32B 3H8XA 3P1IA 2P3YA 1TME2 3MIDA 4AFCA 4IEXA 4B3NA 3WDUA 4Y33A 4G9SB 4Y1VA 3WW1A 2WSUA 3SKJE 3WW2A 3ZYIB 2NP0A 1H2KA 4UYBA 2YROA 2BZDA 4LLFA 3UNPA 1Z7S1 2QDNA 3MPBA 1OT5A 2Q30A 2Y6LA 3RVHA 3T0BA 1WCQA 1WMXA 4YG6A 1D7PM 1BK0A 2DCZA 3A0KA 4XHXA 4Q5OA 3R0RA 3FL7A 3K2OA 2WABA 3QD6A 5FR3A 5KHKA 4XJWA 1YO8A 3U1XA 4CDXA 1CIWA 4QX3A 3NNFA 2ZEYA 1B09A 4DUXA 1CZSA 1HB2A 1YJLA 2C24A 2JG8C 2XJPA 3I2HA 3GBWA 4P00B 4FFIA 3RFRA 3PU3A 2FZ1A 3JU9A 2CSGA 3RNSA 1NCRA 4IERA 2FDFA 1MZFA 1QJU1 2BERA 2NMNA 4GAZA 3UJQA 3DECA 1ASJ1 4CUCA 3QACA 4LULA 4KGGA 3WG1A 3ZSEA 4TLFA 1YQCA 1ULOA 2ZKNA 3AKQA 1XU1A 2PLV2 1JMUB 1E57A 3OD4A 1U5XA 3VBUC 5I0RA 3JBG1 1J83A 3RI8A 1Y43B 4RS5B 1AZDA 5IYYA 5KXBA 3E5XA 2EVXA 1IOAA 5FZAA 4MXWA 5F2WA 1XOYA 3KQ4B 4QHOA 1CAVB 5JOYA 1IPKA 2ZX4A 4QGMA 1UPSA 4LMFA 2YY1A 1CN1A 1DF0A 1QQP3 3IPVA 2BNNA 1BLZA 1DQ1A 1CZVA 3PUSA 4QX7A 1AR71 1OF3A 4N43B 3LGRA 3B93A 3C3VA 3T2QA 4YW6A 2OPWA 2XLGA 3T1MA 3T0AA 1V00A 4MXVA 4PT6A 5AVAA 3BIWE 1B35B 5FLIA 3WNKA 4CXWA 4Q4V1 4UFJA 3HMYA 3OGGA 4IUGA 1MS9A 2Y26A 1X50A 3K4AA 3AZVA 3KT4A 4M00A 4XEZA 4XF3A 1ZA4A 5I8SA 1VRH1 3ZPOA 4ITCA 1POQA 3ZDVA 4D0QA 4IEZA 3ZSJA 1DQ4A 4YM3A 2RDNA 4WM7C 4LO5B 3I2DA 1A8DA 3GJBA 5DAWA 3DXTA 1XSRA 1RUE1 2F4PA 4F83A 4HZFA 3MUZ1 3DKQA 3WNPA 1CONA 2VE1A 1NT0A 1NYWA 2GN3A 5EIYB 1S55A 4HETA 2RE9A 3MIEA 1LGCA 4PDWA 2JDPA 3AMPA 3ZYPA 4BDVB 5FP7A 1GWLA 4AVBA 2RR12 2RM22 4Y5Z0 3VDDC 3WW3A 1UY0A 4I01A 4NRQA 4PBOA 1CAVA 2W1SA 3ETQA 1QGLA 4I09A 4LJHA 5FTTC 3TNQA 4ONUA 4XVHA 3MFAA 5F9TA 3SEEA 1Q5OA 2OW4A 4RYDA 2NZ9A 1NZIA 3ACLA 3GNEA 1WW5A 2PHLA 2QQNA 1LU2A 4HN1A 5GM0A 5IATA 3RZKA 3SCGA 5FZ6A 1HLCA 4LHNA 1AR83 1EAH3 2VCBA 3IDEA 3PIJA 2JKBA 4I02A 4MVTA 4N43A 4B29A 1AYM3 4YRDA 3O0WA 3BTYA 3IM0A 1IZ3A 1X36A 3WF4A 4ES8A 1KDMA 1V6LA 4WV8A 1XNCA 1D0HA 2EXJA 4DXTA 5KC6A 1ULEA 2C9KA 1C8M3 4W6XA 2YZ4A 4YG0A 3LOIA 4XC9A 2VZUA 5FXWA 5CBLA 4Q1PA 2UWAA 2DWRA 3KHBA 5LEJA 3AKSA 2VOWA 3E6BA 1HRV1 3M7AA 2ZGRA 2ORXA 1WWYA 1XU2A 4GQ7A 2BGPA 4CVUA 4QX1A 4EZ4A 4OUMA 1OQEA 2QQIA 3C7FA 3I59B 4OQ9A 4KGQA 4WM8B 4D7TA 2JDAA 1XPWA 3WDWA 4BA6A 3ZYRA 4BHPA 1N3OA 1W2TA 4IQPA 4FTBA 1ND2A 1G9BA 2PHRA 2GZWA 2AACA 2JDKA 3LEKA 4JGZA 3ZYFA 2UY9A 3MO4A 2WINB 2BVVA 2QFEA 1JOPA 4P9YA 4I3PA 5FZBA 1DU3D 4OUEA 4TTGA 3ZXKA 3ZXGA 1RUH2 2VULA 5H9SA 4ZU4A 2WZPP 2VNRA 3SKVA 3FUOA 1QJY2 3C2UA 1MPXA 4AEJA 1TMF2 1VBC2 2BWAA 3PUAA 4JAAA 3ZVXA 4OYUA 1A34A 3EB7A 4W6YA 3BN6A 1LOFA 4Q8KA 5C70A 2WWSA 3BOWA 3SXWA 3ZFGC 4AVVA 4CEWC 5F2SA 1W2AX 5A3UA 1AYN2 2VNOA 1PO21 4KI5M 1UY1A 1NLRA 1PNGA 2R32A 1GFF2 3NL1A 2Y38A 3AYCA 1NY71 4AVAA 5EFUA 2YGLA 1RC6A 1DGLA 4LXLA 2GSYA 2BYVE 4HKOA 4AAXA 3OEAA 2Y33A 1SLAA 3N3HA 5A6XA 4QPWA 1K5MB 4MGZE 1W2NA 1GUIA 2FDIA 3KM5A 4QGNA 2RJ2A 4UBHA 2ZMNA 4AEDC 1OD3A 4AFBA 4D3WA 5JDBA 2EIBA 2VY0A 3I59A 4DXSA 4WM8A 2W46A 4DIQA 1GANA 1S0EA 5BV6A 4C0BA 2IFRA 1RUC1 3IN9A 4JZRA 5DUWA 3KSCA 3TEXA 1SLBA 5FUIA 3CJXA 3TWIA 3VN4A 1RIRA 5DG2A 4CEYA 1TG7A 5FPBA 1HRI2 3UKVA 4QPGB 1GU3A 1FXZA 2A6YA 4QQ2A 3POSA 2PQSA 3HBZA 3HEIA 1YFUA 1QJU2 1S4CA 3DYOA 5T5JA 2OT7A 4XUPA 1HV1A 1PMHX 4CZSA 4FOWA 1DYOA 3ZO0B 2GALA 2Q5TA 3B9IA 1FX5A 3I7DA 4LLOA 1UPIA 3OUJA 3HWJA 4XHBA 5FP4A 3ZFEA 4BQYA 4UW4A 3I2GA 1FPN3 1W8OA 4QX5A 4ZU5A 4COWA 2MPFA 2VBBA 1BHGA 1KEXA 3DYMA 5LRSA 1HX6A 1FAYA 1U5YA 2RS11 1H4HA 3LQCA 4QXCA 3MLKA 1S0GA 5A33A 2XBO1 1TNRA 2YPJA 5ABJC 1GP4A 5C8CB 4GMP1 1AJKA 2WJSA 3IBMA 4DRVA 3AKRA 1DIWA 1N3PA 3ZKYA 1US3A 3HOBA 4GIQA 1DQ6A 2ORZA 2O8OA 4QQPA 1AR72 1IQAA 1K5MA 2BNMA 2BWCA 3OPZA 1CIYA 4LBOA 4XFHA 1NUKA 2IC1A 2YC2A 3AVRA 2H6CA 3RMYA 5FXZA 1S0IA 2OA2A 1C3HA 2ET1A 1FMD3 3ZFFA 3H7YA 2HWF1 1OFNA 1S0JA 3C7OA 2D6MA 3KGLA 4ZONA 5FCCA 1BJQA 2DCKA 2FMYA 2VU9A 1PX4A 2W39A 2XVGA 2VXRA 4MOAA 1LOEA 5GZEA 3VL9A 4QPGA 4AI1A 3BU0A 1Q56A 2E53A 2VNGA 1JZ5A 4AZZA 4CCLA 1GLHA 2OYZA 2CGPA 3J8F2 2HKXA 3A4UA 1RUE2 2H0BA 1UX6A 4V2WA 3KT1A 5KR7A 1UU4A 4MZUA 3ZR6A 1OVSA 4J1XA 1RUJ2 3ZR5A 2WWJA 2GU9A 2J1VA 2XL7A 2UWCA 1GZ9A 1YRZA 2W52A 4QX0A 5K7PA 5J3UA 4Q4X1 1YCIA 4AYUA 4CP2A 4NHYA 2AEZA 3OGVA 2ZEXA 2AC1A 5J1XA 4QB6A 4XACA 3GZEA 3D82A 2XH6A 1H30A 5KBFA 3H1WA 2RS53 5J09A 1YHFA 4FPHA 4LA2A 4CCEA 1L7RA 4WZCA 3SEPA 5C8CA 1XBFA 1NX9A 3QCWA 4ARXA 2RHPA 3T3YA 4TYSA 3CO2A 1R091 2OS2A 2BU9A 2YU2A 2JIJA 3BUCA 1COV2 4QU1A 2EXHA 3BU7A 1XSQA 2ARCA 3VBHC 3VKMA 4I2OA 4OI0A 4CDWA 5CFDB 3AX4A 3EJKA 4PIYA 5FYMA 2FDHA 1K42A 1FI2A 3HT2A 4QM8A 5L9BA 1RB8G 3B94A 2ZBJA 2Y0OA 3LDBA 1WLCA 1RUG3 1HRV2 2P1BA 1PIV1 1W6OA 2PHXA 2EIEA 1OXCA 5IVVA 3QH6A 1OA3A 3MHZA 2DV9A 3BALA 4WBBA 3RZMA 4BIFA 1BEV2 4HKWA 1CVNA 2VZ1A 3ZYBA 3Q8AA 3UK9A 2YBKA 3DPRB 4XJUA 4ORFA 1HB4A 1JW6A 2B39A 2JG9A 5A7WA 4AI9A 1AXYA 4CXXA 4UFLA 4PI0A 3W20A 3RG0A 2W1WA 1ZZCA 2IWGB 3ZN5A 5C8WA 2HBTA 2WNVB 1W6PA 1TME3 3RI9A 1YFWA 3QBQA 4AVCA 2V4VA 3VUOA 2IXIA 3IAPA 3MF6A 3KS7A 1IPJA 4UWDA 2VJXA 4JKMA 5EXOA 1CAWA 3UJOA 5DUVA 4M01A 3H3ZA 1WCUA 2WNUB 2RG4A 4AL9A 1OURA 4H7LA 4JTOA 5IK7A 1Z78A 3LEGA 1O3QA 2E63A 3TEWA 1UX7A 1RUD1 4BE3A 5BYNA 1PO22 4ARYA 2BQPA 2WZEA 4CCNA 5CFDA 3W58A 5JSOA 3WZ1A 1NY72 2VUAA 1IS5A 1U5ZA 3CQOA 4ZY9A 2RJKA 1HKDA 2I45A 1LEMA 5LA2A 4DY5A 2W5FA 5CG9A 2E6VA 4LBLA 4HVQA 4B1MA 4XXPA 2GH2A 3RGBA 3TRSB 5AFBA 5BNPC 4IE0A 2DTWA 3DCQA 2OX0A 2WN3A 3LPGA 2YB7A 4MH0E 3ROUA 4YW3A 3KT7A 2ZA9A 4A7YA 1JOJA 2HEVF 2HYXA 1DLCA 1D0GA 3MIBA 1K5JA 2BJSA 2R041 2YC4A 4IV3C 4LHKA 3FUQA 4M3CB 1W8FA 3NNJA 5FZ7A 2PLV3 4RQPB 1GZWA 1YC61 1WW6A 3EYPA 4RR3A 3RRDA 1RHI2 5HCBA 4URAA 1HB3A 4XW3A 3I3EA 2VL4A 3ZSMA 5EQUA 4BQ3A 1H2MA 3HAGA 1J59A 2A6WA 2RS31 2EIGA 5GJ6A 1J3RA 2Q8CA 4GKYA 3T2PA 3U78A 1IS6A 2WNVA 1E5SA 1AX0A 1J1LA 2B4KA 3FHQA 3NNMA 1PGSA 4GMP0 4YVWA 1W9WA 2P5BA 4LIUA 4QQHA 4ZPIA 3FLRA 5JVVA 3THDA 4BJ0A 5IVFA 2PFWA 2D93A 3GHMA 5A70A 3I8TA 3ZN4A 2DVGA 5FYCA 5M0TA 4E8DA 2E33A 1UQXA 2KA3A 1EV11 4A44A 4AQSA 1JZ2A 2XLFA 2FDKA 4P9WA 3SCFA 3E1F1 4HONA 5DN2A 1HJGA 1UOGA 3ILNA 5HCFA 3W5MA 3ITQA 2YXSA 4R9AA 3Q8FA 1UKRA 4NOTA 5BNOB 2XBO2 3OBAA 2ZEZA 4V1PA 2HYKA 4YYOA 1JI6A 3N9LA 2WR9A 3L9JT 4L11A 3PJQA 1UY3A 5SV8A 4LUKA 1YFYA 4ISQA 4YGDA 1W3VA 2VOTA 4IEOA 5FY7A 3T08A 3N9NA 4AOCA 3I49A 3N4MA 2JE7A 4QKBA 3HNMA 4FPOB 1UYPA 2ZHNA 2OZJA 4OCTA 3S6PA 1OA2A 2IFWA 5GZCA 3LSEA 3NWKA 5FZ8A 4KMQA 1QJEA 5KHJA 1GSLA 3KV5A 1F31A 3VBOA 1LESA 4CU6A 5A3NA 1VBA1 2WLQA 3NAPA 4KG0A 5GLZA 5A6YA 2VZRA 3SH5A 1VBB1 2JX9A 5C5UA 1XNBA 2FCUA 2RR13 4P9JA 1LKNA 4CDXC 5G05L 2RM23 4EN6B 1WMDA 4WZFA 4Y22A 2GNMA 2DUQA 4Q0UA 2EAKA 5HXVA 1QXJA 5FZMA 1PX3A 2RMU2 4LKDA 1BXHA 1S2BA 4TN7A 3FHIB 4Q26A 5DDJ1 1UXXX 1NCRC 4XF0A 4YVSB 4UFHA 5AFEA 1RVF2 1EPZA 3AM2A 4JGYB 1RL3A 4NPLA 1QOSA 1MEC2 2VVDA 2VQAA 3E97A 5FUPA 3R6SA 3I54A 4AHXA 1ZZ7A 4LBQD 3HNBM 3LE0A 2V4AA 5A7PA 4DS0A 1LR5A 2VQ0A 4EN7B 5L36A 2SLIA 3I2KA 5CFCA 5JXGA 4IGPA 5LA9A 3MYXA 5CAZA 4X8NA 5E6HA 2XVLA 5FMDA 2WQ4A 5C3QA 2ARXA 2GN7A 4FT8A 4HLTA 4B4QA 5FZ9A 1D4M1 4BMBA 3MICA 1ZRIA 1QHDA 3Q8BA 2D6NA 4KWKA 1JYIA 2VUCA 2Q8DA 1SDDB 1OQ1A 1UW8A 3JB4C 4EZHA 5E89A 1NKGA 2VZSA 3POBA 3ME2A 4BQ4A 5LK7B 4YZ3A 2JJ6A 2VMIA 4NPRA 3HN1A 3HR9A 5BY5A 1PNFA 2WIIB 2ETEA 3WNMA 4YZ4A 3MDPA 1BMV1 3MEPA 3G6JB 5F5QA 1LHOA 2DU0A 4Y3OA 3WNNA 4N7UA 1DFQA 2DVBA 5I0DA 1I1EA 2WC2A 5I0TA 3MW4A 3LEMA 1X7NA 1RUH3 2Y6KA 2PELA 3ELNA 5IVEA 1LTEA 4QD2A 4EN9B 1OLME 4XQWA 1OFSA 1QJY3 5L7OA 2JENA 1VP6A 1TMF3 1VBC3 4XDOA 5C4WB 4OHZA 3AXEA 4Z2WA 1QXRA 3KCCA 4CP9A 1FT9A 1PGL1 4QXHA 3TN92 2LALA 2TBVA 1AYN3 2V5DA 5GZGA 4NHKA 1JH5A 1S2KA 1W9YA 1JODA 2H0VA 2WZR1 3OYWA 4GKXA 4HPKB 3AMNA 4PDWC 3C7HA 3P3NA 2FDJA 4L99A 1U12A 3RDIA 1BYHA 4IE5A 1LHVA 3MLLA 3FWEA 3N9PA 3U07A 1OLMA 4GWIA 3VB9A 1OH4A 2HWD2 1XE7A 4Y4YA 2YYOA 5ACA2 3PUHA 4J25A 4XFBA 4XOGA 1PMJX 1RUD2 3T2OA 3JD72 4LIVA 3AC0A 5FZ4A 4SBVA 2BW8A 4UI9L 2Q4SA 1GQGA 1URXA 3AMMA 2RVAA 4N43C 2GNBA 3VDAA 4AFAA 4BMEA 3ACFA 3B02A 4DNYA 2QQOA 3WDXA 4OVEA 1O8SA 2J1UA 1QEXA 2GMEA 1SFNA 3M3OA 4IGQA 1HRI3 4DINB 5C3RA 1O91A 1O4TA 2XJVA 3RZLA 1H8TB 1BVP1 3LD8A 3USUB 2PAKA 1WD3A 2KR2A 3CDZB 1QJU3 2A3YA 3PIGA 2QQPA 2C26A 1CAXB 1OSGA 2W87A 1JBCA 1RXGA 2GC3A 1LCLA 3K4DA 5C4WA 5FOJB 2YV8A 3J4UH 1PHMA 4GJZA 5BNNA 1UZVA 1YQ6A 3MFCA 3T0DA 3CJIB 1L7QA 4O9GA 3A0NA 5FY8A 3ST7A 3WQBA 1NG0A 1Q43A 5C3SA 1AR61 4A45A 3BVCA 1ND2C 5D2AA 1XE8A 2D7FA 2RS32 1V9U1 2D43A 1AUYA 5LZ6A 4Q4W1 4CPBA 1VBD2 1YYNA 3I3MA 2G19A 2QKDA 3AZYA 4JGZC 5A1LA 3NJXA 1SCRA 4AQ6A 2HH9A 3OSDA 1QDOA 4I3GA 1BCXA 3CKHA 4L8QA 3FFQA 3OUIA 1AR73 1K12A 4Q4Y1 1ZBE2 4TLGA 1GWMA 5DAPA 4AI0A 5IK4A 5DUXA 3KHCA 1DYPA 3O1RA 2D40A 2QE3A 2Y34A 1AR91 1I3HA 5J37A 3C7EA 4RD7A 1DLLA 2R061 4MV2A 1LOFC 3ILRA 4XCBA 2PHFA 2ZZJA 3W21A 4AI3A 1KITA 1XRUA 4QPIA 3NJZA 4IE6A 1QJX1 4IL7A 4CA9A 2ZKLA 3N35A 1Q8OA 5H9RA 1H8TA 2AENA 3N7MA 3B69A 5J48A 3USUA 3J8F3 3D4KA 1DGWX 3WOGA 1OQDA 2WFF1 1RUE3 4IEVA 4FI9A 5J96B 1G9FA 2K2SA 3AP4A 2P4EA 2VQTA 4UW6A 3VGIA 1RUJ3 1UWWA 3B7MA 5FWJA 4P14A 4WM8C 1VBA2 3HN3A 5C9AB 4XFCA 1H8VA 1J58A 1HIXA 4QGLA 3OEBA 5FK7A 1W6NB 3RQ0A 4UAPA 2JDNA 4CEYC 4XYXA 1PVXA 2MNGA 4ZS2A 1OI6A 5F5AA 1HXS1 1XE0A 2IXKA 2NN8A 1ZNPA 4D6QA 2OQ7A 5DDJ2 3IAQA 3S5QA 3WNLA 5HV0A 5IAXA 3VBSA 1F5JA 1MQTC 1YI9A 4PIZA 4RHV2 2D5HA 1RTVA 4CDQB 4GD4A 1MACA 5T5OA 1QNYA 2R0HA 1COV3 3PVBB 5A3OA 5JMOA 2ATFA 4K3UA 2VTXJ 2BP6A 2K46A 4LHSA 5JUVA 4BXFA 3VD4A 3ZFEC 1BVVA 1UCXA 4MHRA 4XETA 1OF4A 3JQXA 5FZ1A 3T1LA 2CGNA 2YGMA 3NQHA 4BQ5A 1W0PA 2TNFA 2PQQA 1R1A1 5L19A 1YXWA 2ZX3A 5FDBA 1V6OA 3M3EA 2AH2A 4GWMA 4M0HA 5KWRA 1BZWA 1D4M2 1HRV3 2PHWA 1NA1A 5H9PA 2Z79A 4FFFA 1NQJA 2AYHA 2R7EB 2WWUA 4LK7A 4LITA 2VMDA 4OULA 4XJ8A 5JR7B 2GP3A 1BEV3 4PQ9A 4E2QA 4FVVA 5FZOB 4O61A 2ENRA 4MGQA 5A32A 2Y6GA 1WGPA 1X8MA 2QNKA 2FCVA 3VBRB 4YSFA 3GZTB 1H4GA 1W9SA 1V6JA 1KRIA 2XJQA 2C9AA 1NAEA 1W8NA 1LOAA 5C9AA 2VG9A 3WCSA 2YG0A 3ZFFC 3KQRA 3JCIA 1MS1A 4ATEA 5APAA 5C3PA 1S1AA 1RYYA 1W6NA 2R30A 3FX3A 5ISLA 2XONA 4XURA 4W50A 1KJLA 5LA1A 4QPGC 1O59A 1WCKA 2ZEWA 4R8HA 2VZVA 3MPPG 4YWAA 2I74A 3OPTA 5FP9A 4IV1B 1SPPB 1PGW1 1PGL2 1RINA 2W08A 3BYWA 1PO23 4CRQA 1OMIA 3T2TA 1GP6A 1AXKA 2W1QA 5DAXA 4ATFA 4DZGA 1JHNA 2WZR2 3ZXEA 2WNEA 5EV7A 3KLSA 4B7KA 4KBZA
chains in the Genus database with same CATH topology
1W8TA 1OKOA 3ZYBA 1W9FA 2JWPA 1V0AA 1W8ZA 3ZYFA 1W8WA 4YW6A 2LROA 4LKEA 4BQ5A 2Q1FA 4BQ3A 1L7LA 3F95A 1OH3A 4LK6A 1UOJA 5D21A 1WMXA 2WYFA 1GWLA 4LKDA 2LRPA 4CP9A 1WZXA 4YWAA 4CPBA 4LJHA 3UT0A 4CP9B 4LK7A 4YW7A 4BQ4A 2O14A 1W8UA 4CPBD 4LKFA 1GWKA 1HN0A 4BQ2A 2VXJA 2C24A 4A6SA 2KR2A 1WCUA 4AL9A 3ORJA 2K46A 1W90A 1GWMA 3ZYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8T A;  1OKO A;  3ZYB A;  1W9F A;  2JWP A;  1V0A A;  1W8Z A;  3ZYF A;  1W8W A;  4YW6 A;  2LRO A;  4LKE A;  4BQ5 A;  2Q1F A;  4BQ3 A;  1L7L A;  3F95 A;  1OH3 A;  4LK6 A;  1UOJ A;  5D21 A;  1WMX A;  2WYF A;  1GWL A;  4LKD A;  2LRP A;  4CP9 A;  1WZX A;  4YWA A;  4CPB A;  4LJH A;  3UT0 A;  4CP9 B;  4LK7 A;  4YW7 A;  4BQ4 A;  2O14 A;  1W8U A;  4CPB D;  4LKF A;  1GWK A;  1HN0 A;  4BQ2 A;  2VXJ A;  2C24 A;  4A6S A;  2KR2 A;  1WCU A;  4AL9 A;  3ORJ A;  2K46 A;  1W90 A;  1GWM A;  3ZYH A; 
#chains in the Genus database with same CATH topology
 4K20 A;  4UW5 A;  4D7Y A;  3D6E A;  4CP1 A;  1KFX L;  4Y1Z A;  2UYA A;  3WDT A;  1VBE 2;  5GLV A;  5JZG B;  5FZH A;  4SLI A;  1NCQ B;  3U75 A;  2NQY A;  2R16 A;  2LW8 A;  2XML A;  3ZYJ B;  4MAD A;  4H2A A;  5C8C C;  4FTE A;  1F4H A;  5FYH A;  4LOR A;  4RS5 A;  2DU1 A;  4OMD A;  5FZO A;  5K0U B;  3ZIW A;  4HT1 T;  3BCW A;  1RIT A;  1ZYB A;  3ZOI A;  5LAS A;  3UET A;  1G86 A;  4CU8 A;  1WLT A;  2D3S A;  1MZE A;  1OOP B;  4CDW C;  1RHI 3;  3KV6 A;  2WQ8 A;  2B9U A;  2BOI A;  2XVK A;  4X8P A;  2YUE A;  1JUI A;  1BBT 2;  4PBP A;  4QAW A;  1DZR A;  4L92 A;  3B5L B;  4XF4 A;  5T3N A;  4UFM A;  4Y1X A;  5T55 A;  4RSU A;  3BIE A;  1GYK A;  3ZXA C;  4BK5 A;  4RFR B;  1B35 A;  1SDW A;  3F95 A;  5JOW A;  4FPK A;  4WVW A;  4HG6 B;  5DQ0 A;  4A2U A;  2EAL A;  4Z82 A;  3K51 A;  2A3X A;  4IV1 A;  3GBG A;  1YI7 A;  3J7H A;  1EP0 A;  2J22 A;  2JG9 C;  3AP5 A;  4AFD A;  1RGS A;  2LUW A;  4L9B A;  4MX3 A;  2XBO 3;  4TSV A;  2ZML A;  3CIH A;  4YW1 A;  1QH7 A;  4AW7 A;  4F7Z A;  1POV 3;  3T4V A;  5BNQ A;  5LCW L;  5EJ3 A;  2W2I A;  2X29 A;  1ZZ6 A;  2LRO A;  1RED A;  1MR5 A;  1PK6 B;  3ALQ A;  1RUI 2;  3IT8 A;  1AL2 2;  4LK6 A;  2OKX A;  1UIJ A;  4COU A;  2ZGN A;  2E7T A;  2R06 2;  3WP6 A;  4JHZ A;  5E8A A;  5CB7 A;  4AGV A;  3FZ3 A;  2DFB A;  1QJX 2;  2QQU A;  3V64 A;  4A3Z A;  2D3P A;  3RYP A;  1V6M A;  2CY6 A;  4ZHN A;  2HEY F;  1QWR A;  1UYZ A;  4BZ4 A;  5F3C A;  4E4H A;  5DAV A;  3WG2 A;  1PO1 2;  1UOB A;  3N7L A;  5HI0 A;  1QQP 1;  2VO5 A;  4BYY A;  2XJS A;  2RMU 3;  1O6U A;  3BPS A;  4AEM A;  1UYX A;  4FO9 A;  4L2N A;  1V0A A;  1EUT A;  3J7N A;  3SQO A;  2QQV A;  3VZO A;  3ZKU A;  4JRL A;  2WO2 A;  2Y60 A;  1RVF 3;  3O5S A;  1S0C A;  1TNF A;  1MEC 3;  1LB2 A;  3KF3 A;  4QHZ A;  4PLO A;  4EN8 B;  1YIF A;  5EWS A;  4F8A A;  2E26 A;  1Z7S 2;  4ZXE A;  2JG8 B;  3S0M A;  5FP8 A;  4RR3 C;  4LE3 A;  4DB5 A;  3JB8 A;  2I2S A;  2JDM A;  3AYE A;  3I3Q A;  5EP9 A;  1ND3 C;  3D8C A;  5CNA A;  2XLA A;  3AKP A;  4DRR A;  2WNV C;  3E6D A;  3MLJ A;  5HCH A;  1ULD A;  2IXL A;  4YVW C;  4MGS A;  4DFS A;  5FYV A;  3H7J A;  1PK6 A;  1UY4 A;  2ZAH A;  3VBU B;  1XNA A;  3V0A B;  2YC0 A;  5FYZ A;  5FY4 A;  3J9S A;  4FOQ A;  4ASK A;  1DDL A;  2D6O X;  2VM9 A;  4XXA A;  1ASJ 2;  1ZRD A;  3WD5 A;  2TEP A;  1APN A;  1YWK A;  1GKB A;  4NPM A;  2CDP A;  5BUV A;  4Z92 B;  3H3L A;  3O1S A;  1C1L A;  1F15 A;  3UT0 A;  4PHZ A;  3HVD A;  4NVP A;  1QNW A;  4BXS V;  4HXC A;  5HPO A;  5FZE A;  1W3X A;  3JBG 2;  3IDB B;  1VMH A;  5FAX A;  3C8X A;  3B9C A;  3NMB A;  4GB3 1;  5LW9 A;  4LBN A;  3L2H A;  1NLS A;  5DZG A;  4XUQ A;  2BRT A;  4LOT A;  1LGN A;  1F5F A;  1AR8 1;  1EAH 1;  4LBJ A;  3WVJ A;  5C3O A;  2EF6 A;  1DQ0 A;  2MHF A;  4H55 A;  1AYM 1;  3M8L A;  5F3E A;  5FFO C;  1EYB A;  3VD3 A;  3WF0 A;  3TN9 3;  1R64 A;  2WN2 A;  1J1T A;  2XWB B;  4GA9 A;  2P2K A;  1CD3 G;  4X6R B;  3UGF A;  1GIC A;  3VBO C;  4R9B A;  1C8M 1;  1OHF A;  4N7I A;  2OQ6 A;  3NAP C;  4YW4 A;  2IVI B;  2IZW A;  1EY2 A;  4GZ9 A;  4LE4 A;  4DUW A;  4Q4V 2;  2PN5 A;  4MSV A;  4COV A;  1QIQ A;  1HN0 A;  2XXZ A;  2BPA 2;  2HWD 3;  4OFG A;  5ACA 3;  1VRH 2;  3WNX A;  1WCD J;  1RUD 3;  2R6Q A;  4LHL A;  1VJ2 A;  3JD7 3;  3NO8 A;  3K75 B;  5HV4 A;  4DOU A;  5J7M A;  1JZ6 A;  1LOB A;  1Q8Q A;  1RUO A;  1XNK A;  3VDD B;  4E9K A;  3EMR A;  5FMO S;  2E32 A;  2DVF A;  2DCJ A;  2G9Z A;  2ZX1 A;  3RJR A;  2VVE A;  5JI7 A;  5CFC C;  3G7D A;  2XHN A;  4PIX A;  5F39 A;  1UOF A;  1I5P A;  2FCT A;  1DP0 A;  1TE1 B;  1W0O A;  2W9X A;  2JDY A;  1K45 A;  2C4X A;  4HVR A;  2R49 A;  4Y24 A;  5KHI A;  1MS8 A;  3NW4 A;  4LBQ B;  1W04 A;  3U11 A;  3CLP A;  4FPC A;  3JUU A;  3PHM A;  4XJ9 A;  3HQU A;  1VE0 A;  4I0B A;  3IIA A;  2VCA A;  3GGL A;  2DBI A;  3JQW A;  3VZJ A;  4AR2 A;  1F9K A;  5EZW A;  2RS3 3;  3I97 A;  4NHL A;  5C5T A;  4ISR A;  3THP A;  1GOG A;  3GAL A;  4TZD A;  2XJT A;  3GDB A;  1VBD 3;  5LAT A;  3TYJ A;  4YZ2 A;  3RZG A;  1JU4 A;  4N53 B;  2C5D A;  4NMI A;  3VKN A;  2GP5 A;  2L9L A;  2NYY A;  2X8K A;  2OXB A;  3A7Q A;  5EYY A;  1XND A;  2DBN A;  4NIA A;  2D97 A;  1ZBE 3;  4FQZ A;  5A7S A;  2A73 B;  3CMG A;  4QX2 A;  5F3G A;  3ZN6 B;  4IEQ A;  4K21 A;  5L7O C;  2ZPX A;  4CCC A;  5FZ3 A;  3ON7 A;  1QJZ A;  2KM2 A;  3GZU C;  3WCR A;  2PTM A;  1WME A;  2GC2 A;  2HWE 1;  1PVC 1;  2ZAA A;  2W1U A;  3K4Z A;  3KWV A;  3VDD A;  4GXL A;  3WP5 A;  4C90 A;  1OKO A;  2CU5 A;  1XB9 A;  3POF A;  3VHP A;  3OD0 A;  4ZU7 A;  1G9C A;  5IWF A;  3AZX A;  1W8W A;  2WAO A;  1XC6 A;  1DG6 A;  4LBK A;  2B7Y A;  4H3W A;  4QXB A;  3POY A;  3ZFG B;  4XUO A;  3I2O A;  2OVU A;  5FYU A;  3WG3 A;  2UUR A;  1S2E A;  3OBZ A;  1JZ7 A;  5JMC A;  4COZ A;  2JDH A;  3IMM A;  4YZ1 A;  2QQW A;  3WT3 A;  5L9R A;  2SBA A;  4XBQ A;  1FPN 1;  3VBF C;  1VBA 3;  1IS3 A;  3EBR A;  3KGZ A;  4UFK A;  2HWB 1;  3RS6 A;  3IZO A;  3RSJ A;  1XYN A;  3M70 A;  4UF0 B;  4PLM A;  4FAH A;  4BQX A;  2VAU A;  4JDM A;  4NII A;  4AED B;  4N53 A;  5KXE A;  1XQN A;  3UL2 A;  4MLO A;  3GCX A;  2ZMK A;  3A21 A;  5DDJ 3;  3ES1 A;  2WS9 1;  4RHV 3;  4R9D A;  2X53 S;  2VD7 A;  4AHY A;  3POJ A;  4YG3 A;  3WLU A;  3ZN6 A;  5DZE A;  1IS4 A;  4CUA A;  5C4W C;  5JXI A;  3I3D A;  1W8U A;  2QBX A;  5GZD A;  1ODN A;  1RMU 1;  5GAL A;  1ZM1 A;  5BNN C;  2QQJ A;  1CPM A;  3NNL A;  5IT6 A;  2P37 A;  4NID A;  2A7A A;  2DUP A;  1S0D A;  2UYB A;  1A8M A;  1CJD A;  2Z42 A;  2ZX2 A;  5BXX A;  3BTX A;  2WA3 A;  1R08 1;  2ES3 A;  3VD7 A;  1O4Y A;  1RUC 2;  2R07 1;  4Y26 A;  2F4L A;  5LRR A;  1ZRE A;  3DPR A;  1A3K A;  5LB6 A;  1HW5 A;  1VPH A;  2V09 A;  1D4M 3;  1GQH A;  1SBD A;  4TWT A;  5JAX A;  1RXF A;  3R05 A;  4HVO A;  4L0P A;  4E2G A;  4LUM A;  2QCS B;  1GBG A;  3V0B B;  1UD1 A;  1DZQ A;  3AVS A;  4N8M A;  4C0H A;  5T50 A;  1AF9 A;  1H9P A;  4R4Z A;  3LIH A;  5IK8 A;  5ABJ B;  1W6Q B;  2WA4 A;  2ID4 A;  4CCK A;  2WNU A;  5DXD A;  4QB1 A;  3O1U A;  4QPI C;  2BNO A;  1DQ2 A;  2RS5 1;  1GR3 A;  2W92 A;  2ZS6 B;  4QQO A;  3VBF B;  3PVO A;  5FUN A;  4B4R A;  5F5I A;  3TOJ A;  4GB3 2;  1DGW A;  3PDQ A;  4GJY A;  5IJR A;  4M3C E;  2RS1 2;  1H8T C;  2DYC A;  2JB8 A;  2VVF A;  1AR8 2;  3AJZ A;  4A6O A;  1NOV A;  1SBF A;  3AK0 A;  1UOJ A;  1ZBA 1;  3L2Y A;  1YNA A;  2GMP A;  5FP3 A;  5FLJ A;  4EWE A;  3ZLI A;  2NPI A;  4XQ4 A;  2IVJ A;  4XTP A;  2WZR 3;  4A7K A;  3IDA A;  1EUU A;  2B5H A;  5EHD A;  3ZYG A;  1RUG 1;  4QKF A;  2X5I B;  2YDE A;  4AG4 A;  4EYU A;  1EPW A;  3BTA A;  5EPA A;  1VBE 3;  2HWF 2;  4FXG B;  4XMI A;  4M3C A;  1KQR A;  3GXU A;  4NR1 A;  5FY9 A;  3VL8 A;  5IHR A;  4RQP A;  1LHN A;  1GNY A;  2V73 A;  4U2A A;  3WQ0 A;  4YGB A;  2BFU L;  1O8P A;  3CU7 A;  4V2V A;  1LGB A;  3HPN A;  3ZDS A;  4F3J A;  4PCR A;  5I91 A;  3MGU A;  1LHW A;  4BM8 A;  1CWP A;  1WKY A;  4A3X A;  3VBS C;  3H1M A;  1CQ9 A;  2DUR A;  5A1A A;  2VNV A;  3OF1 A;  5D21 A;  4Z1V A;  3ECQ A;  3MBW A;  2JE9 A;  3O1O A;  1L3J A;  4QXK A;  2AEY A;  4BQW A;  1VIW B;  1SLL A;  1W6Q A;  2Z2S B;  3J26 N;  4TXW A;  4EV0 A;  1BK1 A;  4QX8 A;  1RJ7 A;  3RWK X;  3F2Z A;  3VHO A;  4A4A A;  5FKC A;  2QJV A;  1BBT 3;  4QQL A;  5IFT A;  3ACH A;  1TME 1;  4Q4X 2;  3P3P A;  1WBL A;  4IND A;  3BOD A;  4P9L A;  3A23 A;  1V6N A;  2VOX A;  3DUI A;  5B4X A;  1UU6 A;  2QZ3 A;  3VBH B;  1ODM A;  3CZU A;  2P34 A;  3CHX A;  1NA1 C;  4AXO A;  4MGK E;  1TVG A;  5BNO A;  4D8M A;  4K9S A;  4PJY A;  3PMS A;  4XZU G;  2YPD A;  5I93 A;  4HSL A;  1R09 2;  2E9Q A;  4QPY A;  3GYD A;  5CEH A;  2ZGU A;  4GUL A;  2VMG A;  4QU2 A;  4CDU B;  5FXX A;  1D4V B;  5F6K A;  2DUO A;  5EJZ B;  2VEC A;  4LO7 A;  4AI2 A;  4XF1 A;  3NST A;  5A6Q A;  2X5I A;  3SIS A;  4JVA A;  2ZJC A;  1YQ5 A;  3H3U A;  4K6B A;  4HK8 A;  1LJ7 A;  3LB9 A;  1QKQ A;  1H0B A;  5F32 A;  1FAT A;  3LSD A;  1DGR N;  1RUI 3;  3AL6 A;  4XQD A;  3WX5 A;  1AL2 3;  2AR6 A;  3KMH A;  4RL7 A;  1PIV 2;  1MS0 A;  3OOX A;  3R4D B;  5D8A B;  2R06 3;  2QQK A;  1CJP A;  3M2M A;  2HWE 2;  1PVC 2;  2VW1 A;  4FFG A;  3IB3 A;  3JZV A;  4WVZ A;  1QJX 3;  4XZP A;  4WVV A;  1LRH A;  3J7L A;  5CVR A;  4YVS A;  1UY2 A;  4JGY A;  3PL0 A;  3UGH A;  1JYW A;  1W03 A;  5AVP A;  1IQD C;  1PO1 3;  4NAM A;  2EID A;  2X10 A;  2AUY A;  1C4R A;  4RA0 A;  2O14 A;  5FYB A;  3ZIX A;  2G9F A;  4H14 A;  1HJF A;  2HBU A;  2FBE A;  3WP3 A;  2VW0 A;  4KWJ A;  4W65 A;  2R0F A;  2G9G A;  3H9A A;  4RS5 C;  3VZL A;  3B01 A;  2Y8K A;  4CYD A;  4YGC A;  5HXM A;  4MGI E;  5A3W A;  2HWB 2;  2J1S A;  1Y9M A;  2BEO A;  3KCY A;  1Z7S 3;  2X09 A;  4KU8 A;  4CDU A;  5BNP B;  5F37 A;  1ZA7 A;  4C91 A;  3OBR A;  3K48 A;  5E1R A;  2Y6F A;  2EXI A;  1YJK A;  5FPZ A;  4DEV A;  3FLT A;  2BTV C;  3MI8 A;  4LOS A;  2WS9 2;  4JQT A;  3WQ7 A;  2A1X A;  2J1E A;  3CF6 E;  1JS9 A;  4IV3 B;  4DPN A;  4HAN A;  3ATG A;  3ZM8 A;  1HV0 A;  1B35 C;  2WUH A;  2A75 A;  4HN0 A;  1VAM A;  1O5L A;  4EE2 A;  5HCA A;  1JZ3 A;  1UL9 A;  1VLN A;  1RMU 2;  5D8A A;  4IV1 C;  3ZMN A;  1YIP A;  4D69 A;  4Q0V A;  1ASJ 3;  3WXP A;  1UXZ A;  4IEY A;  1R08 2;  3TNP B;  2R07 2;  2R04 2;  3S57 A;  3VZM A;  4W4Z A;  2RM2 1;  5A3T A;  1G9D A;  3H0O A;  1VMF A;  5ERL A;  2AZ5 A;  2IXH A;  2N7G A;  3ES4 A;  1SBE A;  3I3B A;  3TB0 A;  3JBG 3;  2FZ2 A;  1ULG A;  1G8W A;  1GOH A;  3CZJ A;  3SHR A;  1N1T A;  3THT A;  3ZXJ A;  1SZB A;  4JKL A;  3LDR A;  2P3J A;  4XIO A;  4Y1Y A;  1SEF A;  4HPK A;  1OLR A;  3ILF A;  2JB4 A;  3LKJ A;  4NAO A;  5SV5 A;  3AKT A;  5T54 A;  2PAM A;  3WG4 A;  3EO6 A;  1P8J A;  1W6M B;  2VBD A;  2QTW B;  1QMJ A;  2RV9 A;  3QOP A;  4IET A;  4OZO A;  4ET7 A;  1EV1 2;  1N3Q A;  1ULP A;  2GDF A;  2YBS A;  1STM A;  1IKQ A;  2YFZ A;  5FIX A;  3EXU A;  2ZGS A;  3KZ4 C;  4P08 A;  4DXZ A;  3PVE A;  4MO3 M;  3URF A;  1C28 A;  3FJS A;  2RDS A;  5JPM B;  3H8R A;  2VZO A;  2XQX A;  4Q4V 3;  3DKW A;  4YLZ A;  5KXD A;  2WL1 A;  1NXM A;  3D5O A;  4YZ5 A;  2ZHL A;  1PMI A;  3HT1 A;  3S7E A;  3P5B A;  1ZX5 A;  3NKT A;  1ZBA 2;  3UKT A;  5AC9 1;  3O1P A;  1OKQ A;  3OGJ A;  4OHY A;  1VRH 3;  4PLN A;  1UZY A;  1ZZB A;  5CA6 A;  1FOD 1;  5FZC A;  1Y4W A;  2LS6 A;  3I2F A;  3O14 A;  3WUC A;  4NRM A;  1WA6 X;  1YQ8 A;  2CV6 A;  1RUF 1;  4Y4R A;  2CWM A;  2XJR A;  4YM0 A;  3GM8 A;  3BB6 A;  1CAX A;  5FRA A;  3RWN A;  4A41 A;  1CZT A;  4BU2 A;  2P6H A;  2A6V A;  4AHZ A;  2D5F A;  3ZYH A;  2O8Q A;  3Q8C A;  3KV4 A;  1IKP A;  4JCK A;  1W9F A;  1YFX A;  3R4S A;  3T30 A;  1NCR B;  1GZC A;  3GBF A;  5KHH A;  1KXG A;  4XBL A;  4G3Y C;  3VD9 A;  2EA7 A;  3O1V A;  3CJI A;  5JR2 A;  2E7A A;  1US2 A;  1OD5 A;  1VBB 2;  2XDV A;  1W28 A;  5JOX A;  3PTR B;  3PLQ A;  1QJY 1;  1W8H A;  4FP3 A;  1UKG A;  3WDV A;  1TMF 1;  1VBC 1;  4MUV A;  5DAQ A;  4NO4 A;  5ANQ A;  5IFP A;  4UBG A;  5FYT A;  2W68 A;  4CCD A;  3E6C C;  4NHX A;  3U4X A;  3WNO A;  1VMJ A;  4O9E A;  4E8C A;  3N7J A;  4AEK A;  4GH4 B;  1HN1 A;  4IXL A;  5CKQ A;  3J7M A;  4OHV A;  2W3J A;  4MXW B;  5A3P A;  3AP7 A;  5C7G A;  5LEK A;  1UZ0 A;  5FZK A;  1UN1 A;  4AQT A;  4QM9 A;  1HQL A;  2ET7 A;  2ZGQ A;  3OPW A;  3DEM A;  3IPV B;  4HSJ A;  1QJF A;  1LUL A;  3VDC A;  4PQQ A;  3FFZ A;  5CIR A;  1WMF A;  1H1M A;  2QQL A;  3M4F A;  2WT2 A;  2VW2 A;  2UWB A;  4S2D A;  1WZX A;  2QZ2 A;  1N1S A;  4XAB A;  4AAP A;  3FN9 A;  5DG1 A;  1LOC A;  2W94 A;  3ASI A;  3H42 B;  4LKF A;  1GOF A;  1DYK A;  1LOD A;  3K3O A;  5L73 A;  1WA4 A;  1HRI 1;  1K5M C;  1WCS A;  3AYA A;  2BVB A;  2ZGT A;  4QKN A;  5TSW A;  4KNC A;  3ORJ A;  3SH3 A;  2GC1 A;  1KGY A;  1OLQ A;  2V5Y A;  5B2G B;  4KWL A;  5A7Q A;  3SNM A;  3KV9 A;  2WFP A;  4JTN A;  4NIG A;  3GJA A;  3AFG A;  4IEW A;  5A7O A;  1BMV 2;  1WW7 A;  1X8E A;  4QMA A;  1IHM A;  2F6B A;  3NV2 A;  4FPY A;  4OHX A;  1T6G C;  4M4R A;  2WT1 A;  1JN2 P;  4YFZ A;  4PDW B;  2WYF A;  5GLW A;  4JHT A;  2D6K A;  5GZF A;  3MW3 A;  1DCS A;  5A6Z A;  4QDR A;  4D6S A;  2A6X A;  2JIC A;  4YW5 A;  4XAA A;  5A1F A;  4GH4 A;  5CKM A;  5FPU A;  1SHW B;  4ASM B;  5LY2 A;  4Q0S A;  4GAL A;  4CDQ A;  1IPS A;  2P3K A;  1PZ9 A;  4IE4 A;  2GMM A;  3P6B A;  2NM1 A;  3DGT A;  4XUT A;  5DMY A;  4CU9 A;  4XIK A;  5GLU A;  4CTE A;  2RJL A;  1OC1 A;  2VMH A;  4Q27 A;  1Y7B A;  1RJ8 A;  1H9W A;  3ACI A;  3IKW A;  2KD7 A;  5IAV A;  2YMZ A;  1SQ4 A;  5F6L B;  1NE6 A;  3TAY A;  5FYY A;  4O65 A;  4MET A;  1TEI A;  5FY5 A;  3E5U A;  3O1T A;  5EJ1 B;  1SFY A;  3WV6 A;  2VQU A;  1ULC A;  5IVJ A;  1ENQ A;  2XG3 A;  4RGK A;  2Z69 A;  3H8O A;  2HWC 1;  2HJI A;  2XB6 C;  3LEI A;  5FYS A;  2PXJ A;  1VR3 A;  2MEV 1;  2WZ8 A;  5FZD A;  1RUC 3;  4YM1 A;  5FPV A;  3VBR A;  4BH9 A;  4CPB D;  4CXY A;  2UY8 A;  5EYX A;  3SLI A;  1PZ7 A;  2VXJ A;  5KC5 A;  3J8F 1;  4A6S A;  5FJK A;  3GF6 A;  3E5Q A;  4DUV A;  2EIC A;  4BK4 A;  4EWD A;  2F17 A;  2ZGL A;  5FY1 A;  4ES9 A;  3W9A A;  1CX4 A;  2I07 B;  3WUD A;  5FZF A;  4K40 A;  1O3T A;  3OCP A;  1ND2 B;  1RUJ 1;  2ZCW A;  3AZZ A;  4COY A;  3N7K A;  2BOJ A;  2UU8 A;  5T5P A;  4OMC A;  2ARB A;  4R9C A;  1L7L A;  4JGZ B;  4FXK B;  4UOJ A;  5FMC A;  2DFC A;  5FZG A;  2PMW B;  4XFI A;  4JC1 A;  1BQP A;  1QDC A;  2VUD A;  4HBN A;  1MVE A;  1SPP A;  4FP2 A;  3BTZ A;  2E51 A;  4W6W A;  2ZGK A;  1E5I A;  4BPZ A;  1E5H A;  1H6Y A;  1K3I A;  3JXS A;  4YM2 A;  4DMI A;  4EQV A;  1AR6 2;  4GB3 3;  4LEJ A;  1LU1 A;  4QT6 A;  1V9U 2;  1FNZ A;  5F8P A;  2WDB A;  2RS1 3;  5DZF A;  4CSW A;  4Q4W 2;  1VB2 A;  2P17 A;  3BGA A;  1MVQ A;  2FMD A;  4XJZ A;  1PM4 A;  2JDU A;  2ZTN A;  5CYY A;  4D94 A;  5FO8 B;  3MV0 1;  1COV 1;  1UYY A;  3FHA A;  4NHM A;  5FZ0 A;  4GMP 3;  5JZG A;  4X6Q B;  5FZI A;  3ZXF A;  1NCQ A;  4Q4Y 2;  2Y64 A;  2TUN A;  4CCM A;  3HBK A;  1TZO A;  4UT5 A;  2FD8 A;  1AR9 2;  3N9O A;  3U37 A;  5K0U A;  1A6C A;  2D6L X;  4PI2 A;  2G1M A;  1WD4 A;  2HWF 3;  2VZP A;  4Z07 A;  4ERO A;  3UV9 A;  3HQX A;  4L97 A;  1OOP A;  3PME A;  4N53 C;  1X9P A;  5AC9 2;  5CFD C;  2EXK A;  5F7U A;  1T6B X;  1BEV 1;  1I9R A;  4FPF A;  4JX0 A;  2A71 A;  4MGY E;  5A80 A;  1SG3 A;  2XUE A;  3WDY A;  4EWA A;  3VKF C;  1FOD 2;  2ZX0 A;  4DY3 A;  2NMO A;  1W0N A;  2VOK A;  5FBZ A;  1RUF 2;  1LOG A;  1S0B A;  2WFF 2;  4XCA A;  2WO7 A;  4CEY B;  1I5Z A;  1VAV A;  2C1F A;  2XR4 A;  3FE5 A;  5IVY A;  1W99 A;  1QXP A;  4P5Y A;  1DBN A;  1ONA A;  3AXD A;  3IDC B;  3SIT A;  1MQT B;  4Q4X 3;  2OPK A;  3WR0 A;  3O7O A;  2Q1M A;  3DPR C;  4M4P A;  1MS3 A;  1C5I A;  2VCC A;  2Q8O A;  1CGP A;  1O3S A;  1Q8S A;  3ZFE B;  2JKX A;  3B3Q E;  2D44 A;  2XJU A;  4EJR A;  5JXJ A;  2Q0A A;  1H6X A;  4K1Z A;  1OVP A;  4Y5T A;  1HXS 2;  2Z5W A;  2ADE A;  4UW3 A;  1AX2 A;  2P3I A;  4S2F A;  3FC0 A;  1R09 3;  1UMI A;  1QF3 A;  2HEW F;  4JDO A;  5A33 B;  3WP4 A;  2W0X A;  1ZRR A;  2ARA A;  3U0Z A;  4YW2 A;  3VZN A;  4FOY A;  2IXJ A;  5F5C A;  2DTY A;  4RFT 0;  3USS A;  3C7G A;  1OUX A;  2WNU C;  1O3R A;  2GND A;  3CL1 A;  1ENR A;  3OJB A;  4R52 A;  4W8J A;  1LEN A;  2Y6J A;  4B1L A;  4BIS A;  2ERF A;  1UAI A;  1R1A 2;  2CHH A;  5DUU A;  1Y3T A;  4UXA A;  4LO4 B;  1JYC A;  1SLI A;  4OQ8 A;  4YW7 A;  2VME A;  3I2I A;  4Q8L A;  1PIV 3;  4Y20 B;  3ZFF B;  1JYT A;  1GWK A;  2CWS A;  5T5L A;  2HWE 3;  1PVC 3;  5FBJ A;  1PM7 A;  1JTZ X;  1X33 A;  2QDR A;  1AVB A;  2XWJ B;  3AL5 A;  2PHU A;  1M06 G;  1QOO A;  5IVB A;  1RHI 1;  2AGS A;  3H8U A;  3PNA A;  3KCX A;  4AHW A;  4ZZ8 A;  5K8S A;  4CUG A;  3R4U A;  3K3N A;  4FQ4 A;  3TBD A;  2R1D A;  1MS5 A;  4CUB A;  1MQT A;  1UMH A;  1GQP A;  2CAU A;  4IDZ A;  4FTS A;  1HQN A;  3HD8 B;  3POW A;  3T09 A;  4LO8 A;  4D6R A;  3AZW A;  2JG8 A;  3DN7 A;  1FV2 A;  4B4P A;  4RQP C;  4H7M A;  5JIA A;  2WNO A;  4B8E A;  4WM7 B;  1G7Y A;  3D0S A;  3OY8 B;  4K8F A;  5DAB A;  2D6P A;  2PA7 A;  2BGC A;  3VBO B;  3AMH A;  2HWB 3;  3LF7 A;  3WEZ A;  1F8V A;  4QKD A;  1OBN A;  3GCW A;  1PGW 2;  2E7Q A;  2DDU A;  3NKG A;  4Y1U A;  2V72 A;  2JE8 A;  5LWB A;  5FZL A;  2Y0I A;  2CGO A;  3VBU A;  3V0A A;  4NUB A;  5JI9 A;  2WSV A;  1POV 1;  2ZOE B;  4GWN A;  5I0U A;  3RYR A;  1XNT A;  3MF9 A;  3I2J A;  4BQ1 A;  1O4Z A;  3VDB A;  3UGG A;  2Q1F A;  2WAA A;  2WS9 3;  2VZ3 A;  4ZKT B;  5I8Y A;  3IWZ A;  4K8R B;  3POI A;  3AP9 A;  4Q1R A;  5LA0 A;  1KS5 A;  2R1B A;  1T2X A;  4CDW B;  2OII A;  4RGG A;  5BNO C;  4BOW A;  1HB1 A;  4Y20 A;  5C6C A;  1RMU 3;  3AMQ A;  2H6B A;  2JD9 A;  1CR7 A;  1JYX A;  3MV1 1;  2HWC 2;  1IG3 A;  1G9A A;  2KXL A;  1YQ2 A;  1RUN A;  1D2Q A;  1R08 3;  4BLJ A;  2MEV 2;  2R07 3;  2R04 3;  2W95 A;  1W6O B;  1W39 A;  3WSO A;  4HFS A;  2VMC A;  1W2U A;  3BI3 A;  4PF5 A;  2ADD A;  3DF0 A;  4YFW A;  3SH4 A;  2X5I C;  4QDS A;  4LNV A;  5LBF A;  4AFM A;  1D2S A;  4CU7 A;  2RMU 1;  1W8Z A;  3AP6 A;  4Q0P A;  1C57 A;  4XDQ A;  4NRO A;  1SMV A;  3GZA A;  4U36 A;  3O1M A;  1XYP A;  1RVF 1;  2VTX A;  2JG9 B;  4BLI A;  4MYE A;  4B7E A;  3D3A A;  1MEC 1;  3DV8 A;  3KB5 A;  4IE7 A;  4LQR A;  3OY8 A;  1CPN A;  4WM7 A;  5A7W B;  1XXN A;  5FLH A;  4CE8 A;  4KQ7 A;  3V65 A;  5C71 A;  1IGO A;  1O5U A;  2BBV A;  3PUR A;  4P9I A;  4IGO A;  3BPZ A;  2E31 A;  5IVC A;  5JIU A;  1NZC A;  1W6P B;  1AJO A;  1EV1 3;  4OI2 A;  2J1R A;  1CAU B;  2DCY A;  2W47 A;  5B4N A;  3TEZ A;  4YVS C;  3SMH A;  3UES A;  4JGY C;  1CAW B;  2D3R A;  3III A;  4PF1 A;  4BWO A;  1Z0H A;  2VC9 A;  4RGA A;  4XFF A;  4P5H A;  1UZW A;  2ZGM A;  3O0X A;  3LAG A;  1N1Y A;  2PYT A;  5FKB A;  4E4Z A;  4LR4 A;  1ZBA 3;  3B00 A;  2QVS B;  4S2H A;  4XAE A;  2HLE A;  1ZRF A;  4R4X A;  1VRB A;  2XQR A;  2A5Z A;  1VAL A;  2QUO A;  2YFU A;  3I4I A;  1MS4 A;  2ZHM A;  2FDG A;  3WF2 A;  4C1W A;  3X29 B;  4CEW B;  1ENX A;  4AGR A;  2WBK A;  5HBA A;  1JYV A;  4OI1 A;  4LBQ A;  2YU1 A;  4CDU C;  2PHT A;  2ZXQ A;  1V6K A;  4QB2 A;  2XHK A;  5IK5 A;  3BKZ A;  1W05 A;  3VZK A;  1IG0 A;  4AF9 A;  5FPX A;  1TQ5 A;  1ALY A;  2VMF A;  1OUS A;  5LK5 A;  1VBB 3;  1JZ8 A;  1V6I A;  4KWU A;  1REE A;  3HIF A;  1AHS A;  4LT5 A;  2YHJ A;  1F2N A;  4JRA A;  4LBM A;  4EN0 A;  1GZW B;  4RR3 B;  4LKE A;  3PUQ A;  1QQP 2;  3NV3 A;  4AI8 A;  3TN9 1;  1X9T A;  4XBN A;  3HJR A;  1ND3 B;  5D8A C;  5DPN A;  4XIL A;  1GP5 A;  2WYS A;  4FOV A;  2BFU S;  4XUN A;  5FJH A;  1CES A;  3OG2 A;  4ASL A;  3PU8 A;  4I30 A;  3AB0 A;  3LOB A;  2CYF A;  2CTV A;  2WKK A;  1CAU A;  4I0W B;  4M0N A;  5FK8 A;  3OUH A;  4YVW B;  3ZSK A;  5FMO L;  4BCU A;  3S5A A;  1FMD 1;  3OBT A;  3ZX7 A;  2PHD A;  1C8N A;  4G4F A;  3UYJ A;  4BQ2 A;  3AJY A;  1C5H A;  2Y6H A;  2A3W A;  3WW4 A;  1SLT A;  2VUJ A;  2HWD 1;  1UF2 C;  1R1Z A;  2ARE A;  3NV4 A;  5ACA 1;  5L9V A;  1QH6 A;  2C0Z A;  3JD7 1;  3LIG A;  2LM3 A;  3M1H A;  4QDQ A;  4YAR A;  3AYD A;  5CAD A;  4FBF A;  1SFP A;  1J3Q A;  4HL0 A;  3H1Y A;  4XF9 A;  1H2L A;  2VH9 A;  2O0O A;  2GH8 A;  4RN5 A;  2VCM A;  2JIG A;  4ZXK A;  3ZFG A;  4CEW A;  3RMX A;  1Q3E A;  2WO1 A;  3OB8 A;  1H2N A;  4P9X A;  1QOT A;  2Q8E A;  5I8T A;  4C8D A;  2JEM A;  3ABZ A;  2B9V A;  2NLR A;  4AWD A;  3VKO A;  2VPV A;  3U14 A;  3PVN A;  1JOB A;  2VGD A;  2A6Z A;  3NV1 A;  3O0V A;  3D0J A;  4OZX A;  2BV4 A;  3DL3 A;  5FO7 B;  4E2S A;  4Z2A A;  4KH9 A;  3K77 A;  4UF0 A;  1GMM A;  4JQR A;  3AFK A;  4AED A;  1XYO A;  5D1I A;  2CDO A;  3QLQ A;  1LED A;  3NAP B;  2JDZ A;  1SAC A;  4HKL A;  2XGX A;  2ZGO A;  3MIH A;  3RZZ A;  1AX1 A;  1ND3 A;  3ACG A;  4OI4 A;  3PJY A;  4KU7 A;  4OUS A;  5GLT A;  3LA7 A;  1EAH 2;  4NWW A;  3ZSL A;  4XMA A;  4Y22 B;  2VZT A;  1AYM 2;  1VBD 1;  3INA A;  1ENS A;  2DF7 A;  5F1R A;  5JCT A;  2XKP A;  1POV 0;  1WBF A;  1GZT A;  1XJA A;  4AE2 A;  3WQ1 A;  3NJV A;  1C8M 2;  5FV3 A;  5C33 A;  4LTA A;  3CJI C;  4I0A A;  1ZBE 1;  3ZXD A;  5J36 A;  1MZ6 A;  2BUK A;  2FHR A;  4XFA A;  4YGE A;  3WF1 A;  3LFI A;  1UU5 A;  4IEU A;  1OPM A;  5CFC B;  2K9Z A;  3N9Q A;  3CNA A;  3DYP A;  5FY0 A;  4XJA A;  4YNI A;  2ZZQ A;  4UFI A;  3U10 A;  4NE9 A;  5LBB A;  5G04 L;  3ZPY A;  5JSR A;  4NIH A;  3BOP A;  3V0B A;  2B8M A;  3APB A;  3SCH A;  3POG A;  5LBE A;  4CCO A;  3OGS A;  4DQA A;  3NJY A;  1MZ5 A;  5ABJ A;  4FSJ A;  3UKN A;  3WHU A;  1UIK A;  3RZJ A;  2EAA A;  5LBC A;  2IXC A;  4CP9 B;  1HDK A;  2GAU A;  3LA2 A;  5IW0 A;  3VBF A;  1NQD A;  4E4D X;  3U4S A;  3VV1 A;  3LFM A;  4DXR A;  3EHK A;  5A7N A;  5FPL A;  3ZMO A;  1GNH A;  1F35 A;  2OUJ A;  1N1V A;  5FQ0 B;  1ZZ9 A;  1NE4 A;  1LAJ A;  1KFU L;  3CEW A;  2J42 A;  1FV3 A;  3LWC A;  2WO3 A;  5FXV A;  3VD5 A;  3NRU A;  5I0S A;  1FNY A;  2GC0 A;  4FPG A;  4WVM B;  1AR6 3;  2ZAC A;  4NJ4 A;  4NN0 A;  1ST8 A;  4KG8 A;  4AVS A;  5L7O B;  1V9U 3;  1Q8P A;  2XKO A;  3LPF A;  4Q4W 3;  4RHV 1;  1A78 A;  1DZT A;  5C9A C;  1J84 A;  3THC A;  4LKS A;  2W91 A;  5JSP A;  4LO6 B;  4YPJ A;  4N9I A;  1OPO A;  2J7M A;  5FRE A;  4ZS3 A;  3VKL A;  1W06 A;  3OYW B;  4XDP A;  2BGO A;  4Q4Y 3;  4A42 A;  1WLD A;  5CZK A;  5IUQ A;  1JXN A;  1LNS A;  3W5N A;  1M4W A;  2DVD A;  1AR9 3;  4GH4 C;  2JWP A;  2J1T A;  4J1W A;  3RYK A;  4MGT A;  2XOM A;  4QHB A;  4CDQ C;  5GKA C;  2PLV 1;  4LA3 A;  2CAV A;  5J98 B;  3SC7 X;  4A7Z A;  3FMG A;  5AC9 3;  1OA4 A;  2VZQ A;  5K4L A;  2LRP A;  1I6X A;  2J1A A;  3IMN A;  4DO0 A;  1HQW A;  4E4S A;  1DGR A;  3PUI A;  5CIS A;  5LY1 A;  4Y5S A;  2JEC A;  1FOD 3;  4XFG A;  4Z8B A;  2RDR A;  2ILM A;  2VR4 A;  4OLL A;  3MW2 A;  5E16 A;  1JYN A;  1JU3 A;  1LEC A;  1RUF 3;  2WFF 3;  5FWE A;  3VBH A;  3ENR A;  2GNT A;  5FQ0 A;  3QH7 A;  1U5I A;  5JOZ A;  1UO9 A;  3MIF A;  4NRP A;  4NWV A;  1ZRC A;  3M3Q A;  1FPN 2;  4K1Y A;  2RDQ A;  4P9G A;  4Q0Q A;  5CG8 A;  3K46 A;  3WIN E;  5JLV A;  1KJR A;  4WVM A;  3VBR C;  3POE A;  4KL1 A;  5CU1 A;  1UMZ A;  1CX1 A;  3H50 A;  1V70 A;  4URT A;  1OH3 A;  1G6N A;  2BBA A;  3RZH A;  4JKK A;  5H9Q A;  5BNN B;  4FPJ A;  3Q9O A;  2JD4 A;  2DCT A;  2IUW A;  1HXS 3;  2B42 B;  2VOV A;  5T52 A;  1KDK A;  2O1Q A;  3TEY A;  2LTN A;  1NLQ A;  1WUV A;  3CBN A;  3M3C A;  3T4H B;  3ZXL A;  1X82 A;  1WLW A;  4JDN A;  4FPE A;  5FOB B;  1W9T A;  4Q29 A;  2QQM A;  2VBP A;  4DEQ A;  1FMD 2;  1KS4 A;  1N47 A;  5E88 A;  1VBE 1;  1QU0 A;  4MG2 A;  2WT0 A;  1GNZ A;  3FLP A;  1SCS A;  1BKZ A;  3VLB B;  1AL0 G;  1UNB A;  4FCA A;  5JWP A;  1H1A A;  1KD7 A;  5FPA A;  4HMZ A;  4XTM A;  4C1X A;  3LCP A;  3NVC A;  3KVB A;  1R1A 3;  2RR1 1;  1W2O A;  2YBP A;  5FMB A;  2G4I A;  3WF3 A;  4FPL A;  4QWN A;  4XE9 A;  3GHN A;  1U0A A;  5BPX A;  1YUD A;  4M3C F;  1VAK A;  4QPI B;  1E5R A;  3M3I A;  3WY6 A;  5JZG C;  2CL2 A;  4JV4 A;  3RPQ A;  1ULF A;  3NNG A;  3OGR A;  1NCQ C;  2XPJ A;  3HNY M;  3S7I A;  4J6G A;  2FQP A;  1ZVF A;  1BBT 1;  5FO9 B;  3PTY A;  3A22 A;  5ANN A;  3V56 A;  4AQ2 A;  5F3I A;  4O7X A;  4CCJ A;  3DXU A;  2WRA A;  4HOO A;  5K0U C;  1JHJ A;  4K7J A;  4BB3 A;  1Q8V A;  3RJ2 X;  3O12 A;  3N36 A;  4IEP A;  1W8T A;  1LHU A;  3LZZ A;  4LPL A;  4GWJ A;  4AGG A;  5JXH A;  5KHG A;  1QY4 A;  2DVA A;  1FYU A;  2RS5 2;  2Z4F A;  4IES A;  5BNP A;  3MZH A;  1OOP C;  1YEW A;  2B46 X;  2JXA A;  2XUM A;  4KBB A;  5FYI A;  2Q1Z B;  2BDR A;  3LDK A;  3MIG A;  1JUH A;  1DQ5 A;  1Y9G A;  4D7S A;  1JZ4 A;  1DHK B;  2K0G A;  2P6C A;  3MUY 1;  4BIO A;  1UZZ A;  5A3L A;  2X05 A;  1H1I A;  4IV3 A;  5CKN A;  3KD4 A;  4CP0 A;  2XL9 A;  1REF A;  1PZ8 A;  4S2G A;  2VTF A;  1WW4 A;  2OUH A;  1SLC A;  3VHN A;  4N9H A;  1ZZ8 A;  1O7F A;  2ZHK A;  4OHW A;  1YLL A;  3OTF A;  4CDX B;  3VBS B;  2ZAB A;  3N9M A;  1F4A A;  4AK3 A;  1Y9Q A;  3KF5 A;  1AXZ A;  1RUG 2;  1GV9 A;  2A70 A;  3EQE A;  3FBM A;  5KXC A;  1W90 A;  4ZZ5 A;  1RUI 1;  1VB4 A;  1C1F A;  1AL2 1;  2C6S A;  3KVA A;  4N90 A;  2ZGP A;  3VHR A;  4FAG A;  5A3M A;  2CNA A;  4E27 A;  1NXD 1;  4AVT A;  3W59 A;  1RUH 1;  2HWC 3;  3ETP A;  3LA3 A;  5K9Y A;  1ACC A;  2B45 X;  3WHT A;  3Q8E A;  2MEV 3;  1J3P A;  5JPN B;  2WQZ C;  1S0F A;  2OZ6 A;  1NA1 B;  1PK6 C;  2PAE A;  2WLP A;  4MHU A;  4Q2F A;  4XPV A;  1PO1 1;  1AYN 1;  3S30 A;  4FFH A;  4HK9 A;  1W6M A;  4P02 B;  2D98 A;  3HQR A;  3FBY A;  4IW3 A;  5A32 B;  3H8X A;  3P1I A;  2P3Y A;  1TME 2;  3MID A;  4AFC A;  4IEX A;  4B3N A;  3WDU A;  4Y33 A;  4G9S B;  4Y1V A;  3WW1 A;  2WSU A;  3SKJ E;  3WW2 A;  3ZYI B;  2NP0 A;  1H2K A;  4UYB A;  2YRO A;  2BZD A;  4LLF A;  3UNP A;  1Z7S 1;  2QDN A;  3MPB A;  1OT5 A;  2Q30 A;  2Y6L A;  3RVH A;  3T0B A;  1WCQ A;  1WMX A;  4YG6 A;  1D7P M;  1BK0 A;  2DCZ A;  3A0K A;  4XHX A;  4Q5O A;  3R0R A;  3FL7 A;  3K2O A;  2WAB A;  3QD6 A;  5FR3 A;  5KHK A;  4XJW A;  1YO8 A;  3U1X A;  4CDX A;  1CIW A;  4QX3 A;  3NNF A;  2ZEY A;  1B09 A;  4DUX A;  1CZS A;  1HB2 A;  1YJL A;  2C24 A;  2JG8 C;  2XJP A;  3I2H A;  3GBW A;  4P00 B;  4FFI A;  3RFR A;  3PU3 A;  2FZ1 A;  3JU9 A;  2CSG A;  3RNS A;  1NCR A;  4IER A;  2FDF A;  1MZF A;  1QJU 1;  2BER A;  2NMN A;  4GAZ A;  3UJQ A;  3DEC A;  1ASJ 1;  4CUC A;  3QAC A;  4LUL A;  4KGG A;  3WG1 A;  3ZSE A;  4TLF A;  1YQC A;  1ULO A;  2ZKN A;  3AKQ A;  1XU1 A;  2PLV 2;  1JMU B;  1E57 A;  3OD4 A;  1U5X A;  3VBU C;  5I0R A;  3JBG 1;  1J83 A;  3RI8 A;  1Y43 B;  4RS5 B;  1AZD A;  5IYY A;  5KXB A;  3E5X A;  2EVX A;  1IOA A;  5FZA A;  4MXW A;  5F2W A;  1XOY A;  3KQ4 B;  4QHO A;  1CAV B;  5JOY A;  1IPK A;  2ZX4 A;  4QGM A;  1UPS A;  4LMF A;  2YY1 A;  1CN1 A;  1DF0 A;  1QQP 3;  3IPV A;  2BNN A;  1BLZ A;  1DQ1 A;  1CZV A;  3PUS A;  4QX7 A;  1AR7 1;  1OF3 A;  4N43 B;  3LGR A;  3B93 A;  3C3V A;  3T2Q A;  4YW6 A;  2OPW A;  2XLG A;  3T1M A;  3T0A A;  1V00 A;  4MXV A;  4PT6 A;  5AVA A;  3BIW E;  1B35 B;  5FLI A;  3WNK A;  4CXW A;  4Q4V 1;  4UFJ A;  3HMY A;  3OGG A;  4IUG A;  1MS9 A;  2Y26 A;  1X50 A;  3K4A A;  3AZV A;  3KT4 A;  4M00 A;  4XEZ A;  4XF3 A;  1ZA4 A;  5I8S A;  1VRH 1;  3ZPO A;  4ITC A;  1POQ A;  3ZDV A;  4D0Q A;  4IEZ A;  3ZSJ A;  1DQ4 A;  4YM3 A;  2RDN A;  4WM7 C;  4LO5 B;  3I2D A;  1A8D A;  3GJB A;  5DAW A;  3DXT A;  1XSR A;  1RUE 1;  2F4P A;  4F83 A;  4HZF A;  3MUZ 1;  3DKQ A;  3WNP A;  1CON A;  2VE1 A;  1NT0 A;  1NYW A;  2GN3 A;  5EIY B;  1S55 A;  4HET A;  2RE9 A;  3MIE A;  1LGC A;  4PDW A;  2JDP A;  3AMP A;  3ZYP A;  4BDV B;  5FP7 A;  1GWL A;  4AVB A;  2RR1 2;  2RM2 2;  4Y5Z 0;  3VDD C;  3WW3 A;  1UY0 A;  4I01 A;  4NRQ A;  4PBO A;  1CAV A;  2W1S A;  3ETQ A;  1QGL A;  4I09 A;  4LJH A;  5FTT C;  3TNQ A;  4ONU A;  4XVH A;  3MFA A;  5F9T A;  3SEE A;  1Q5O A;  2OW4 A;  4RYD A;  2NZ9 A;  1NZI A;  3ACL A;  3GNE A;  1WW5 A;  2PHL A;  2QQN A;  1LU2 A;  4HN1 A;  5GM0 A;  5IAT A;  3RZK A;  3SCG A;  5FZ6 A;  1HLC A;  4LHN A;  1AR8 3;  1EAH 3;  2VCB A;  3IDE A;  3PIJ A;  2JKB A;  4I02 A;  4MVT A;  4N43 A;  4B29 A;  1AYM 3;  4YRD A;  3O0W A;  3BTY A;  3IM0 A;  1IZ3 A;  1X36 A;  3WF4 A;  4ES8 A;  1KDM A;  1V6L A;  4WV8 A;  1XNC A;  1D0H A;  2EXJ A;  4DXT A;  5KC6 A;  1ULE A;  2C9K A;  1C8M 3;  4W6X A;  2YZ4 A;  4YG0 A;  3LOI A;  4XC9 A;  2VZU A;  5FXW A;  5CBL A;  4Q1P A;  2UWA A;  2DWR A;  3KHB A;  5LEJ A;  3AKS A;  2VOW A;  3E6B A;  1HRV 1;  3M7A A;  2ZGR A;  2ORX A;  1WWY A;  1XU2 A;  4GQ7 A;  2BGP A;  4CVU A;  4QX1 A;  4EZ4 A;  4OUM A;  1OQE A;  2QQI A;  3C7F A;  3I59 B;  4OQ9 A;  4KGQ A;  4WM8 B;  4D7T A;  2JDA A;  1XPW A;  3WDW A;  4BA6 A;  3ZYR A;  4BHP A;  1N3O A;  1W2T A;  4IQP A;  4FTB A;  1ND2 A;  1G9B A;  2PHR A;  2GZW A;  2AAC A;  2JDK A;  3LEK A;  4JGZ A;  3ZYF A;  2UY9 A;  3MO4 A;  2WIN B;  2BVV A;  2QFE A;  1JOP A;  4P9Y A;  4I3P A;  5FZB A;  1DU3 D;  4OUE A;  4TTG A;  3ZXK A;  3ZXG A;  1RUH 2;  2VUL A;  5H9S A;  4ZU4 A;  2WZP P;  2VNR A;  3SKV A;  3FUO A;  1QJY 2;  3C2U A;  1MPX A;  4AEJ A;  1TMF 2;  1VBC 2;  2BWA A;  3PUA A;  4JAA A;  3ZVX A;  4OYU A;  1A34 A;  3EB7 A;  4W6Y A;  3BN6 A;  1LOF A;  4Q8K A;  5C70 A;  2WWS A;  3BOW A;  3SXW A;  3ZFG C;  4AVV A;  4CEW C;  5F2S A;  1W2A X;  5A3U A;  1AYN 2;  2VNO A;  1PO2 1;  4KI5 M;  1UY1 A;  1NLR A;  1PNG A;  2R32 A;  1GFF 2;  3NL1 A;  2Y38 A;  3AYC A;  1NY7 1;  4AVA A;  5EFU A;  2YGL A;  1RC6 A;  1DGL A;  4LXL A;  2GSY A;  2BYV E;  4HKO A;  4AAX A;  3OEA A;  2Y33 A;  1SLA A;  3N3H A;  5A6X A;  4QPW A;  1K5M B;  4MGZ E;  1W2N A;  1GUI A;  2FDI A;  3KM5 A;  4QGN A;  2RJ2 A;  4UBH A;  2ZMN A;  4AED C;  1OD3 A;  4AFB A;  4D3W A;  5JDB A;  2EIB A;  2VY0 A;  3I59 A;  4DXS A;  4WM8 A;  2W46 A;  4DIQ A;  1GAN A;  1S0E A;  5BV6 A;  4C0B A;  2IFR A;  1RUC 1;  3IN9 A;  4JZR A;  5DUW A;  3KSC A;  3TEX A;  1SLB A;  5FUI A;  3CJX A;  3TWI A;  3VN4 A;  1RIR A;  5DG2 A;  4CEY A;  1TG7 A;  5FPB A;  1HRI 2;  3UKV A;  4QPG B;  1GU3 A;  1FXZ A;  2A6Y A;  4QQ2 A;  3POS A;  2PQS A;  3HBZ A;  3HEI A;  1YFU A;  1QJU 2;  1S4C A;  3DYO A;  5T5J A;  2OT7 A;  4XUP A;  1HV1 A;  1PMH X;  4CZS A;  4FOW A;  1DYO A;  3ZO0 B;  2GAL A;  2Q5T A;  3B9I A;  1FX5 A;  3I7D A;  4LLO A;  1UPI A;  3OUJ A;  3HWJ A;  4XHB A;  5FP4 A;  3ZFE A;  4BQY A;  4UW4 A;  3I2G A;  1FPN 3;  1W8O A;  4QX5 A;  4ZU5 A;  4COW A;  2MPF A;  2VBB A;  1BHG A;  1KEX A;  3DYM A;  5LRS A;  1HX6 A;  1FAY A;  1U5Y A;  2RS1 1;  1H4H A;  3LQC A;  4QXC A;  3MLK A;  1S0G A;  5A33 A;  2XBO 1;  1TNR A;  2YPJ A;  5ABJ C;  1GP4 A;  5C8C B;  4GMP 1;  1AJK A;  2WJS A;  3IBM A;  4DRV A;  3AKR A;  1DIW A;  1N3P A;  3ZKY A;  1US3 A;  3HOB A;  4GIQ A;  1DQ6 A;  2ORZ A;  2O8O A;  4QQP A;  1AR7 2;  1IQA A;  1K5M A;  2BNM A;  2BWC A;  3OPZ A;  1CIY A;  4LBO A;  4XFH A;  1NUK A;  2IC1 A;  2YC2 A;  3AVR A;  2H6C A;  3RMY A;  5FXZ A;  1S0I A;  2OA2 A;  1C3H A;  2ET1 A;  1FMD 3;  3ZFF A;  3H7Y A;  2HWF 1;  1OFN A;  1S0J A;  3C7O A;  2D6M A;  3KGL A;  4ZON A;  5FCC A;  1BJQ A;  2DCK A;  2FMY A;  2VU9 A;  1PX4 A;  2W39 A;  2XVG A;  2VXR A;  4MOA A;  1LOE A;  5GZE A;  3VL9 A;  4QPG A;  4AI1 A;  3BU0 A;  1Q56 A;  2E53 A;  2VNG A;  1JZ5 A;  4AZZ A;  4CCL A;  1GLH A;  2OYZ A;  2CGP A;  3J8F 2;  2HKX A;  3A4U A;  1RUE 2;  2H0B A;  1UX6 A;  4V2W A;  3KT1 A;  5KR7 A;  1UU4 A;  4MZU A;  3ZR6 A;  1OVS A;  4J1X A;  1RUJ 2;  3ZR5 A;  2WWJ A;  2GU9 A;  2J1V A;  2XL7 A;  2UWC A;  1GZ9 A;  1YRZ A;  2W52 A;  4QX0 A;  5K7P A;  5J3U A;  4Q4X 1;  1YCI A;  4AYU A;  4CP2 A;  4NHY A;  2AEZ A;  3OGV A;  2ZEX A;  2AC1 A;  5J1X A;  4QB6 A;  4XAC A;  3GZE A;  3D82 A;  2XH6 A;  1H30 A;  5KBF A;  3H1W A;  2RS5 3;  5J09 A;  1YHF A;  4FPH A;  4LA2 A;  4CCE A;  1L7R A;  4WZC A;  3SEP A;  5C8C A;  1XBF A;  1NX9 A;  3QCW A;  4ARX A;  2RHP A;  3T3Y A;  4TYS A;  3CO2 A;  1R09 1;  2OS2 A;  2BU9 A;  2YU2 A;  2JIJ A;  3BUC A;  1COV 2;  4QU1 A;  2EXH A;  3BU7 A;  1XSQ A;  2ARC A;  3VBH C;  3VKM A;  4I2O A;  4OI0 A;  4CDW A;  5CFD B;  3AX4 A;  3EJK A;  4PIY A;  5FYM A;  2FDH A;  1K42 A;  1FI2 A;  3HT2 A;  4QM8 A;  5L9B A;  1RB8 G;  3B94 A;  2ZBJ A;  2Y0O A;  3LDB A;  1WLC A;  1RUG 3;  1HRV 2;  2P1B A;  1PIV 1;  1W6O A;  2PHX A;  2EIE A;  1OXC A;  5IVV A;  3QH6 A;  1OA3 A;  3MHZ A;  2DV9 A;  3BAL A;  4WBB A;  3RZM A;  4BIF A;  1BEV 2;  4HKW A;  1CVN A;  2VZ1 A;  3ZYB A;  3Q8A A;  3UK9 A;  2YBK A;  3DPR B;  4XJU A;  4ORF A;  1HB4 A;  1JW6 A;  2B39 A;  2JG9 A;  5A7W A;  4AI9 A;  1AXY A;  4CXX A;  4UFL A;  4PI0 A;  3W20 A;  3RG0 A;  2W1W A;  1ZZC A;  2IWG B;  3ZN5 A;  5C8W A;  2HBT A;  2WNV B;  1W6P A;  1TME 3;  3RI9 A;  1YFW A;  3QBQ A;  4AVC A;  2V4V A;  3VUO A;  2IXI A;  3IAP A;  3MF6 A;  3KS7 A;  1IPJ A;  4UWD A;  2VJX A;  4JKM A;  5EXO A;  1CAW A;  3UJO A;  5DUV A;  4M01 A;  3H3Z A;  1WCU A;  2WNU B;  2RG4 A;  4AL9 A;  1OUR A;  4H7L A;  4JTO A;  5IK7 A;  1Z78 A;  3LEG A;  1O3Q A;  2E63 A;  3TEW A;  1UX7 A;  1RUD 1;  4BE3 A;  5BYN A;  1PO2 2;  4ARY A;  2BQP A;  2WZE A;  4CCN A;  5CFD A;  3W58 A;  5JSO A;  3WZ1 A;  1NY7 2;  2VUA A;  1IS5 A;  1U5Z A;  3CQO A;  4ZY9 A;  2RJK A;  1HKD A;  2I45 A;  1LEM A;  5LA2 A;  4DY5 A;  2W5F A;  5CG9 A;  2E6V A;  4LBL A;  4HVQ A;  4B1M A;  4XXP A;  2GH2 A;  3RGB A;  3TRS B;  5AFB A;  5BNP C;  4IE0 A;  2DTW A;  3DCQ A;  2OX0 A;  2WN3 A;  3LPG A;  2YB7 A;  4MH0 E;  3ROU A;  4YW3 A;  3KT7 A;  2ZA9 A;  4A7Y A;  1JOJ A;  2HEV F;  2HYX A;  1DLC A;  1D0G A;  3MIB A;  1K5J A;  2BJS A;  2R04 1;  2YC4 A;  4IV3 C;  4LHK A;  3FUQ A;  4M3C B;  1W8F A;  3NNJ A;  5FZ7 A;  2PLV 3;  4RQP B;  1GZW A;  1YC6 1;  1WW6 A;  3EYP A;  4RR3 A;  3RRD A;  1RHI 2;  5HCB A;  4URA A;  1HB3 A;  4XW3 A;  3I3E A;  2VL4 A;  3ZSM A;  5EQU A;  4BQ3 A;  1H2M A;  3HAG A;  1J59 A;  2A6W A;  2RS3 1;  2EIG A;  5GJ6 A;  1J3R A;  2Q8C A;  4GKY A;  3T2P A;  3U78 A;  1IS6 A;  2WNV A;  1E5S A;  1AX0 A;  1J1L A;  2B4K A;  3FHQ A;  3NNM A;  1PGS A;  4GMP 0;  4YVW A;  1W9W A;  2P5B A;  4LIU A;  4QQH A;  4ZPI A;  3FLR A;  5JVV A;  3THD A;  4BJ0 A;  5IVF A;  2PFW A;  2D93 A;  3GHM A;  5A70 A;  3I8T A;  3ZN4 A;  2DVG A;  5FYC A;  5M0T A;  4E8D A;  2E33 A;  1UQX A;  2KA3 A;  1EV1 1;  4A44 A;  4AQS A;  1JZ2 A;  2XLF A;  2FDK A;  4P9W A;  3SCF A;  3E1F 1;  4HON A;  5DN2 A;  1HJG A;  1UOG A;  3ILN A;  5HCF A;  3W5M A;  3ITQ A;  2YXS A;  4R9A A;  3Q8F A;  1UKR A;  4NOT A;  5BNO B;  2XBO 2;  3OBA A;  2ZEZ A;  4V1P A;  2HYK A;  4YYO A;  1JI6 A;  3N9L A;  2WR9 A;  3L9J T;  4L11 A;  3PJQ A;  1UY3 A;  5SV8 A;  4LUK A;  1YFY A;  4ISQ A;  4YGD A;  1W3V A;  2VOT A;  4IEO A;  5FY7 A;  3T08 A;  3N9N A;  4AOC A;  3I49 A;  3N4M A;  2JE7 A;  4QKB A;  3HNM A;  4FPO B;  1UYP A;  2ZHN A;  2OZJ A;  4OCT A;  3S6P A;  1OA2 A;  2IFW A;  5GZC A;  3LSE A;  3NWK A;  5FZ8 A;  4KMQ A;  1QJE A;  5KHJ A;  1GSL A;  3KV5 A;  1F31 A;  3VBO A;  1LES A;  4CU6 A;  5A3N A;  1VBA 1;  2WLQ A;  3NAP A;  4KG0 A;  5GLZ A;  5A6Y A;  2VZR A;  3SH5 A;  1VBB 1;  2JX9 A;  5C5U A;  1XNB A;  2FCU A;  2RR1 3;  4P9J A;  1LKN A;  4CDX C;  5G05 L;  2RM2 3;  4EN6 B;  1WMD A;  4WZF A;  4Y22 A;  2GNM A;  2DUQ A;  4Q0U A;  2EAK A;  5HXV A;  1QXJ A;  5FZM A;  1PX3 A;  2RMU 2;  4LKD A;  1BXH A;  1S2B A;  4TN7 A;  3FHI B;  4Q26 A;  5DDJ 1;  1UXX X;  1NCR C;  4XF0 A;  4YVS B;  4UFH A;  5AFE A;  1RVF 2;  1EPZ A;  3AM2 A;  4JGY B;  1RL3 A;  4NPL A;  1QOS A;  1MEC 2;  2VVD A;  2VQA A;  3E97 A;  5FUP A;  3R6S A;  3I54 A;  4AHX A;  1ZZ7 A;  4LBQ D;  3HNB M;  3LE0 A;  2V4A A;  5A7P A;  4DS0 A;  1LR5 A;  2VQ0 A;  4EN7 B;  5L36 A;  2SLI A;  3I2K A;  5CFC A;  5JXG A;  4IGP A;  5LA9 A;  3MYX A;  5CAZ A;  4X8N A;  5E6H A;  2XVL A;  5FMD A;  2WQ4 A;  5C3Q A;  2ARX A;  2GN7 A;  4FT8 A;  4HLT A;  4B4Q A;  5FZ9 A;  1D4M 1;  4BMB A;  3MIC A;  1ZRI A;  1QHD A;  3Q8B A;  2D6N A;  4KWK A;  1JYI A;  2VUC A;  2Q8D A;  1SDD B;  1OQ1 A;  1UW8 A;  3JB4 C;  4EZH A;  5E89 A;  1NKG A;  2VZS A;  3POB A;  3ME2 A;  4BQ4 A;  5LK7 B;  4YZ3 A;  2JJ6 A;  2VMI A;  4NPR A;  3HN1 A;  3HR9 A;  5BY5 A;  1PNF A;  2WII B;  2ETE A;  3WNM A;  4YZ4 A;  3MDP A;  1BMV 1;  3MEP A;  3G6J B;  5F5Q A;  1LHO A;  2DU0 A;  4Y3O A;  3WNN A;  4N7U A;  1DFQ A;  2DVB A;  5I0D A;  1I1E A;  2WC2 A;  5I0T A;  3MW4 A;  3LEM A;  1X7N A;  1RUH 3;  2Y6K A;  2PEL A;  3ELN A;  5IVE A;  1LTE A;  4QD2 A;  4EN9 B;  1OLM E;  4XQW A;  1OFS A;  1QJY 3;  5L7O A;  2JEN A;  1VP6 A;  1TMF 3;  1VBC 3;  4XDO A;  5C4W B;  4OHZ A;  3AXE A;  4Z2W A;  1QXR A;  3KCC A;  4CP9 A;  1FT9 A;  1PGL 1;  4QXH A;  3TN9 2;  2LAL A;  2TBV A;  1AYN 3;  2V5D A;  5GZG A;  4NHK A;  1JH5 A;  1S2K A;  1W9Y A;  1JOD A;  2H0V A;  2WZR 1;  3OYW A;  4GKX A;  4HPK B;  3AMN A;  4PDW C;  3C7H A;  3P3N A;  2FDJ A;  4L99 A;  1U12 A;  3RDI A;  1BYH A;  4IE5 A;  1LHV A;  3MLL A;  3FWE A;  3N9P A;  3U07 A;  1OLM A;  4GWI A;  3VB9 A;  1OH4 A;  2HWD 2;  1XE7 A;  4Y4Y A;  2YYO A;  5ACA 2;  3PUH A;  4J25 A;  4XFB A;  4XOG A;  1PMJ X;  1RUD 2;  3T2O A;  3JD7 2;  4LIV A;  3AC0 A;  5FZ4 A;  4SBV A;  2BW8 A;  4UI9 L;  2Q4S A;  1GQG A;  1URX A;  3AMM A;  2RVA A;  4N43 C;  2GNB A;  3VDA A;  4AFA A;  4BME A;  3ACF A;  3B02 A;  4DNY A;  2QQO A;  3WDX A;  4OVE A;  1O8S A;  2J1U A;  1QEX A;  2GME A;  1SFN A;  3M3O A;  4IGQ A;  1HRI 3;  4DIN B;  5C3R A;  1O91 A;  1O4T A;  2XJV A;  3RZL A;  1H8T B;  1BVP 1;  3LD8 A;  3USU B;  2PAK A;  1WD3 A;  2KR2 A;  3CDZ B;  1QJU 3;  2A3Y A;  3PIG A;  2QQP A;  2C26 A;  1CAX B;  1OSG A;  2W87 A;  1JBC A;  1RXG A;  2GC3 A;  1LCL A;  3K4D A;  5C4W A;  5FOJ B;  2YV8 A;  3J4U H;  1PHM A;  4GJZ A;  5BNN A;  1UZV A;  1YQ6 A;  3MFC A;  3T0D A;  3CJI B;  1L7Q A;  4O9G A;  3A0N A;  5FY8 A;  3ST7 A;  3WQB A;  1NG0 A;  1Q43 A;  5C3S A;  1AR6 1;  4A45 A;  3BVC A;  1ND2 C;  5D2A A;  1XE8 A;  2D7F A;  2RS3 2;  1V9U 1;  2D43 A;  1AUY A;  5LZ6 A;  4Q4W 1;  4CPB A;  1VBD 2;  1YYN A;  3I3M A;  2G19 A;  2QKD A;  3AZY A;  4JGZ C;  5A1L A;  3NJX A;  1SCR A;  4AQ6 A;  2HH9 A;  3OSD A;  1QDO A;  4I3G A;  1BCX A;  3CKH A;  4L8Q A;  3FFQ A;  3OUI A;  1AR7 3;  1K12 A;  4Q4Y 1;  1ZBE 2;  4TLG A;  1GWM A;  5DAP A;  4AI0 A;  5IK4 A;  5DUX A;  3KHC A;  1DYP A;  3O1R A;  2D40 A;  2QE3 A;  2Y34 A;  1AR9 1;  1I3H A;  5J37 A;  3C7E A;  4RD7 A;  1DLL A;  2R06 1;  4MV2 A;  1LOF C;  3ILR A;  4XCB A;  2PHF A;  2ZZJ A;  3W21 A;  4AI3 A;  1KIT A;  1XRU A;  4QPI A;  3NJZ A;  4IE6 A;  1QJX 1;  4IL7 A;  4CA9 A;  2ZKL A;  3N35 A;  1Q8O A;  5H9R A;  1H8T A;  2AEN A;  3N7M A;  3B69 A;  5J48 A;  3USU A;  3J8F 3;  3D4K A;  1DGW X;  3WOG A;  1OQD A;  2WFF 1;  1RUE 3;  4IEV A;  4FI9 A;  5J96 B;  1G9F A;  2K2S A;  3AP4 A;  2P4E A;  2VQT A;  4UW6 A;  3VGI A;  1RUJ 3;  1UWW A;  3B7M A;  5FWJ A;  4P14 A;  4WM8 C;  1VBA 2;  3HN3 A;  5C9A B;  4XFC A;  1H8V A;  1J58 A;  1HIX A;  4QGL A;  3OEB A;  5FK7 A;  1W6N B;  3RQ0 A;  4UAP A;  2JDN A;  4CEY C;  4XYX A;  1PVX A;  2MNG A;  4ZS2 A;  1OI6 A;  5F5A A;  1HXS 1;  1XE0 A;  2IXK A;  2NN8 A;  1ZNP A;  4D6Q A;  2OQ7 A;  5DDJ 2;  3IAQ A;  3S5Q A;  3WNL A;  5HV0 A;  5IAX A;  3VBS A;  1F5J A;  1MQT C;  1YI9 A;  4PIZ A;  4RHV 2;  2D5H A;  1RTV A;  4CDQ B;  4GD4 A;  1MAC A;  5T5O A;  1QNY A;  2R0H A;  1COV 3;  3PVB B;  5A3O A;  5JMO A;  2ATF A;  4K3U A;  2VTX J;  2BP6 A;  2K46 A;  4LHS A;  5JUV A;  4BXF A;  3VD4 A;  3ZFE C;  1BVV A;  1UCX A;  4MHR A;  4XET A;  1OF4 A;  3JQX A;  5FZ1 A;  3T1L A;  2CGN A;  2YGM A;  3NQH A;  4BQ5 A;  1W0P A;  2TNF A;  2PQQ A;  1R1A 1;  5L19 A;  1YXW A;  2ZX3 A;  5FDB A;  1V6O A;  3M3E A;  2AH2 A;  4GWM A;  4M0H A;  5KWR A;  1BZW A;  1D4M 2;  1HRV 3;  2PHW A;  1NA1 A;  5H9P A;  2Z79 A;  4FFF A;  1NQJ A;  2AYH A;  2R7E B;  2WWU A;  4LK7 A;  4LIT A;  2VMD A;  4OUL A;  4XJ8 A;  5JR7 B;  2GP3 A;  1BEV 3;  4PQ9 A;  4E2Q A;  4FVV A;  5FZO B;  4O61 A;  2ENR A;  4MGQ A;  5A32 A;  2Y6G A;  1WGP A;  1X8M A;  2QNK A;  2FCV A;  3VBR B;  4YSF A;  3GZT B;  1H4G A;  1W9S A;  1V6J A;  1KRI A;  2XJQ A;  2C9A A;  1NAE A;  1W8N A;  1LOA A;  5C9A A;  2VG9 A;  3WCS A;  2YG0 A;  3ZFF C;  3KQR A;  3JCI A;  1MS1 A;  4ATE A;  5APA A;  5C3P A;  1S1A A;  1RYY A;  1W6N A;  2R30 A;  3FX3 A;  5ISL A;  2XON A;  4XUR A;  4W50 A;  1KJL A;  5LA1 A;  4QPG C;  1O59 A;  1WCK A;  2ZEW A;  4R8H A;  2VZV A;  3MPP G;  4YWA A;  2I74 A;  3OPT A;  5FP9 A;  4IV1 B;  1SPP B;  1PGW 1;  1PGL 2;  1RIN A;  2W08 A;  3BYW A;  1PO2 3;  4CRQ A;  1OMI A;  3T2T A;  1GP6 A;  1AXK A;  2W1Q A;  5DAX A;  4ATF A;  4DZG A;  1JHN A;  2WZR 2;  3ZXE A;  2WNE A;  5EV7 A;  3KLS A;  4B7K A;  4KBZ A; 
#chains in the Genus database with same CATH homology
 1W8T A;  1OKO A;  3ZYB A;  1W9F A;  2JWP A;  1V0A A;  1W8Z A;  3ZYF A;  1W8W A;  4YW6 A;  2LRO A;  4LKE A;  4BQ5 A;  2Q1F A;  4BQ3 A;  1L7L A;  3F95 A;  1OH3 A;  4LK6 A;  1UOJ A;  5D21 A;  1WMX A;  2WYF A;  1GWL A;  4LKD A;  2LRP A;  4CP9 A;  1WZX A;  4YWA A;  4CPB A;  4LJH A;  3UT0 A;  4CP9 B;  4LK7 A;  4YW7 A;  4BQ4 A;  2O14 A;  1W8U A;  4CPB D;  4LKF A;  1GWK A;  1HN0 A;  4BQ2 A;  2VXJ A;  2C24 A;  4A6S A;  2KR2 A;  1WCU A;  4AL9 A;  3ORJ A;  2K46 A;  1W90 A;  1GWM A;  3ZYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...