2B7YA

Fava bean lectin-glucose complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
181
structure length
181
Chain Sequence
DEITSFSIPKFRPDQPNLIFQGGGYTTKEKLTLTKAVKNTVGRALYSLPIHIWDSETGNVADFTTTFIFVIDAPNGYNVADGFTFFIAPVDTKPQTGGGYLGVFNGKDYDKTAQTVAVEFDTFYNAAWDPSNGKRHIGIDVNTIKSISTKSWNLQNGEEAHVAISFNATTNVLSVTLLYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords Favin beta chain
publication title Three-dimensional structure of favin: saccharide binding-cyclic permutation in leguminous lectins
pubmed rcsb
total genus 19
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b7yA00
2D3PA 1D0HA 3BOPA 2JKBA 3H0OA 1ULDA 4YM1A 4R9DA 3ZYRA 3BTAA 1LHVA 1ULFA 4YZ5A 1BJQA 2WT0A 3LSDA 5T55A 3Q9OA 1Q8QA 3D4KA 1W6QA 2ZHMA 3QLQA 4KBBA 3ZVXA 3ZXKA 3ENRA 2DTWA 5JOYA 4M3CE 1S0IA 5IK4A 1Q8PA 1N47A 1QOTA 2AGSA 2EALA 2VW1A 2WT2A 3DGTA 3N7KA 4M3CA 1GZ9A 3O0VA 2AR6A 5GZDA 1AZDA 1C4RA 1FNZA 5EYYA 1WCSA 1DQ0A 3PVNA 4FPEA 2A6ZA 4LBQB 4K1YA 4XBQA 2UWAA 5GLZA 2DVDA 4BMBA 4YM3A 2KM2A 3HR9A 4UW4A 1SLTA 2ZHKA 4Y1UA 4YW5A 1QNYA 2DV9A 4YZ2A 1W6MB 3FBYA 1C1FA 3N36A 4XJZA 1CESA 3RMYA 3VKNA 1UMZA 1V6OA 2A7AA 1AJOA 2R1BA 2UWBA 3HMYA 5DZEA 1W6OB 3O5SA 2ZMNA 1W6NA 2WLQA 5BYNA 4ZXKA 2W68A 3WUDA 3OJBA 3N7JA 2GNDA 2ZGNA 2ZZJA 3TAYA 4FP2A 4XJ8A 2Q5TA 4M3CB 4YGBA 1MS1A 2GN3A 2DWRA 1R1ZA 5F5QA 5L73A 3AJYA 4FPKA 5H9QA 1G9AA 4Y1YA 4UW6A 3FUQA 3RSJA 2SBAA 3M3EA 2FHRA 5T52A 5T5OA 1FV3A 3IM0A 3UK9A 3JUUA 5EYXA 5GZFA 1BZWA 5T5JA 2E53A 5IK5A 3V64A 5GLVA 2EXIA 2A3YA 2ZMKA 1V6NA 1IS3A 3VUOA 1CPNA 2ZACA 3O0WA 1JUIA 3POYA 3ZSJA 1QOSA 5CNAA 4PBPA 2EAKA 4XJAA 3R4SA 4FPJA 4XIKA 1LCLA 3MW3A 4AGRA 2GMPA 1KRIA 1DLLA 1IOAA 1YRZA 1MS9A 2GNTA 1QDOA 2NZ9A 2OVUA 1V6LA 4YZ1A 1KITA 4GXLA 2LALA 3R4UA 2A6WA 2YXSA 1RIRA 1ULEA 3ASIA 4ITCA 4K21A 1UAIA 3WG1A 3V0BA 1VALA 3AZVA 2YZ4A 3APBA 1GNHA 3LCPA 1LEMA 3AX4A 2I2SA 5JLVA 1WW7A 5GLUA 1QMJA 3INAA 3PMEA 4AVVA 3UJOA 4YW1A 5SV8A 2FMDA 3O12A 3I8TA 4YW4A 1MS8A 3M3OA 3MPPG 3IPVA 1HQLA 4AGGA 4M3CF 4AYUA 2JJ6A 5CBLA 1G9CA 3BODA 4H55A 5FREA 3WG3A 3WDTA 5CA6A 4P9YA 4XILA 2PHUA 3RS6A 4UW3A 1IS6A 1G7YA 2A5ZA 1N3OA 1BKZA 1UN1A 3I4IA 2D6PA 2H0BA 1C57A 4YW2A 5GLWA 1AVBA 1OQ1A 2D6MA 2YV8A 4XXAA 1DQ5A 3TB0A 1CVNA 3WCRA 1V6JA 1Q8VA 4GALA 1LGNA 1JN2P 3IKWA 1GZWB 1HQWA 4AVTA 1V6MA 1WW4A 3AXDA 4LBOA 4BMEA 1O4ZA 5JOZA 3B01A 3W58A 4YFZA 1OKQA 5KXCA 3PJQA 4LBJA 3IPVB 4Q27A 1W6PA 2R49A 2ZHNA 1C1LA 2ZA9A 1GICA 5AVAA 1V00A 4I30A 5H9RA 5JDBA 3POWA 3OBRA 4ISQA 3WG2A 1ULGA 3B00A 1H9PA 5T5LA 1H30A 2P37A 1AXKA 3ZSKA 1A3KA 1W6MA 1LODA 3SH3A 2D6NA 4XE9A 3WLUA 1NXD1 1G8WA 1W6OA 3FLRA 3FLTA 4GA9A 3M3CA 3SLIA 2ARBA 4XZPA 5HCFA 3AZXA 1FYUA 4FOQA 4BPZA 3MW4A 3N3HA 3PVOA 3MW2A 5T54A 3NV1A 2AREA 2AENA 2CWSA 1WD3A 3USUB 3CNAA 1S0CA 3B9CA 2ZGUA 5T50A 1KJLA 2P34A 1JOJA 2D3SA 3KM5A 4LBKA 2WNEA 2EF6A 5H9SA 3DUIA 1LU1A 1WD4A 2JE7A 4ISRA 1WLCA 1W6PB 1G86A 1SLCA 2D6KA 2GDFA 3HN1A 4Q8LA 3WZ1A 1EPWA 2VUAA 1HKDA 3OY8B 3SNMA 2OUJA 4DQAA 1WW6A 1I1EA 4Y24A 4FPLA 1LOFA 1GZCA 3OYWB 1F9KA 1J1TA 1JHNA 5T5PA 2ZGQA 3WVJA 4BM8A 5KXEA 1ZA4A 4MYEA 5E8AA 1JW6A 2D6LX 4K20A 2W52A 4YG0A 5CAZA 2DYCA 3FFZA 1LENA 5FRAA 1VLNA 1ENSA 3W59A 1V6KA 1IKQA 3M2MA 4M01A 2SLIA 2PHRA 4U2AA 2C5DA 1G9DA 3WDXA 2P3IA 4XMAA 3ZXEA 2LTNA 2WSVA 4Y1XA 1IS5A 3V0AA 4XOGA 1DHKB 1WW5A 3ZSMA 3ZXLA 1DQ1A 4Q2FA 2TEPA 3ZXJA 4R9CA 5JOXA 1D2SA 1SBEA 4WV8A 1U0AA 4WVVA 5KXDA 2R16A 1UKGA 4Y26A 1BXHA 2ENRA 2NYYA 2WKKA 2CTVA 1FAYA 1S1AA 3FLPA 2GN7A 5EWSA 4R9BA 5DG1A 1LHOA 4GWMA 5GZGA 1DYPA 1LHWA 2DVFA 5EXOA 1ENRA 1UX6A 4BOWA 2DUQA 2W08A 2PHXA 1AX0A 1AX1A 2A6YA 4K1ZA 2A71A 3WCSA 1GKBA 1G9FA 4PQ9A 1YI7A 1B09A 3LSEA 3SITA 2DU1A 1CJPA 1S0DA 1DQ2A 4L8QA 1IKPA 2A6VA 2AH2A 4XJWA 1CPMA 1WLDA 3FUOA 3V0AB 2P3KA 1MVEA 2YMZA 4FQZA 4U36A 1RITA 1WLWA 2R0FA 1ULCA 4D69A 1SCRA 1Q8SA 3BIWE 1GZWA 1SLAA 2A3XA 2R0HA 4BLIA 1W0PA 4FOVA 2JDZA 3ZYPA 3QCWA 4Y1ZA 3AYDA 5DZFA 1SBFA 1I3HA 3WG4A 2NN8A 2YROA 1LGCA 4Y22A 1UZZA 4Q1PA 1ENQA 4ATFA 3B3QE 4C1XA 1DBNA 1GYKA 2V73A 5JOWA 4PCRA 3C2UA 2PHTA 1MR5A 2ZGPA 3AP7A 1N1SA 4JC1A 4LBMA 2VW0A 2GMEA 2ZGTA 4XXPA 4YZ4A 1CONA 2ZHLA 2ZMLA 1WBLA 3VKLA 5IK8A 1BYHA 2ZGRA 2BQPA 5DUVA 2D7FA 1GNZA 4XTPA 4XTMA 3B69A 4LBLA 1UZYA 3IMNA 2EXKA 2PHFA 3USUA 1AXYA 2D3RA 3AYCA 5DUXA 3WDVA 1DFQA 4BLJA 4FPFA 2XG3A 4SLIA 1VAMA 4FPYA 2UURA 4Y22B 3ILFA 2WT1A 1GSLA 1APNA 1GLHA 1A8DA 2V5YA 2OW4A 1YYNA 1MS0A 2UU8A 1A78A 3OY8A 1QKQA 4WVWA 1DGLA 3OYWA 4GWNA 3RRDA 2D43A 3WDYA 1JXNA 2JECA 1LECA 1Q56A 3AP5A 1Y7BA 2E7TA 4GKYA 5IT6A 3SH4A 4RL7A 5DZGA 1DZQA 2DURA 4XYXA 4YGEA 4XJ9A 4ATEA 2YY1A 5JMCA 2EXJA 4Q26A 1MZ5A 1V6IA 1FV2A 1Z78A 4R9AA 3RMXA 3GALA 2ARXA 1NLSA 1F5FA 4XDQA 3OBTA 2ZABA 1MACA 1MS5A 4DRRA 2PELA 1LOAA 2ERFA 2ZBJA 2A75A 4P9WA 1YO8A 5GALA 4Z8BA 3WDWA 2A70A 1FNYA 1LOEA 4UW5A 4C1WA 5GM0A 1UL9A 4FP3A 4DS0A 1BQPA 1JYCA 2CNAA 3NV2A 5E88A 3M1HA 3T1LA 4DRVA 3AZWA 4IQPA 1LTEA 1LULA 2WQZC 4XBNA 4CZSA 3U4XA 1HLCA 3NV3A 3JU9A 4FPOB 3WDUA 2DU0A 1LESA 1QU0A 1SCSA 1KQRA 2ZKNA 4OZXA 4FPCA 2VH9A 4P9XA 4HANA 1N3PA 4CRQA 3ATGA 3D6EA 4Q1RA 4F83A 1MS3A 2DVGA 1S0JA 4XMIA 2EXHA 1QF3A 4FOYA 2PHWA 2JD4A 4FVVA 1WBFA 2ZGMA 3SH5A 4FPGA 1JYIA 3M3QA 2GMMA 4YZ3A 4XBLA 1AX2A 1ZM1A 2VXRA 1SFYA 4XHXA 1X50A 4WZFA 5KXBA 2CWMA 3ZXFA 1TEIA 5DXDA 1W6QB 5F9TA 1S0EA 2P3JA 2AUYA 4Q8KA 3VKMA 3WOGA 2OUHA 4BQ1A 5GZEA 5DUUA 2D6OX 1LJ7A 1LEDA 2JE9A 2D44A 1GV9A 3ZPYA 3O0XA 3AP6A 4AGVA 5GLTA 2DUPA 2B7YA 1HDKA 1W0OA 2DTYA 4W65A 2DUOA 4YGDA 5HCBA 2E7QA 2WJSA 3AP9A 5H9PA 1FATA 2XB6C 1LOCA 2GALA 1UPSA 1H9WA 2ES3A 2VU9A 5DG2A 5IK7A 1DIWA 5DUWA 4XIOA 4YM2A 3N7LA 3VKOA 1IS4A 3A4UA 1CQ9A 2DVBA 3NWKA 1AXZA 1SBDA 1CR7A 4YW3A 2A3WA 1MVQA 1Z0HA 3WHTA 4LBQD 3SISA 3WV6A 2ZGKA 1YIFA 3AYEA 1OFSA 5IUQA 4M00A 1PZ8A 1W6NB 1GBGA 3N35A 4PBOA 4TZDA 4ZKTB 1Q8OA 5CB7A 4FQ4A 1SACA 1ONAA 4XHBA 1JBCA 3GNEA 3AJZA 3V65A 2NP0A 3AFKA 1QOOA 2P2KA 2WSUA 5JVVA 2DVAA 4DFSA 1LU2A 3AZZA 3R05A 3UJQA 3VKFC 1N1TA 2HYKA 1WUVA 4YM0A 3T1MA 2ZGLA 1XQNA 3VV1A 5HCAA 4ASMB 4Y1VA 1MS4A 1S0FA 1CIWA 4YLZA 1RINA 5GJ6A 4GKXA 4YFWA 2AYHA 3T2TA 2EIGA 1GANA 3N7MA 3RG0A 3NV4A 2CYFA 1KDKA 2CY6A 1O4YA 1QGLA 3PVEA 4AWDA 1AF9A 4XJUA 1VIWB 3AYAA 4NO4A 3ZSLA 4YG3A 1KDMA 3OPZA 4LBNA 3RQ0A 1LHUA 1N1VA 2R1DA 2ZGOA 3OGGA 4AVSA 4Y20A 1LOFC 1FX5A 1QNWA 1LOBA 3UL2A 1QDCA 1YXWA 2CL2A 2NM1A 3POSA 4YG6A 4TYSA 4FOWA 1SLIA 2Z42A 3AP4A 1CN1A 1AJKA 1DQ6A 1PZ7A 3IN9A 1G9BA 1DQ4A 3AZYA 1DYKA 2W39A 3V0BB 3A0NA 4NOTA 5LK5A 2G4IA 4DPNA 3AXEA 1SLBA 2E51A 1S0GA 2C9AA 2RHPA 3MEPA 4YGCA 1URXA 3D5OA 2VY0A 4JRAA 4CTEA 1LOGA 1VAVA 4FPHA 2ZGSA 3ILRA 5GZCA 3A0KA 1SLLA 2GNBA 2NMOA 3ILNA 3WHUA 3KQRA 4HL0A 1N1YA 4P14A 1LHNA 3WUCA 4PF5A 1MZ6A 4LBQA 1PZ9A 3L2YA 2NMNA 1KJRA 2A6XA 3AK0A 4RA0A 2UWCA 1S0BA 5E89A 2E6VA 4JCKA 1N3QA 3WNXA 4Y20B 2ZAAA 2VW2A 1LGBA 2GNMA 1F31A
chains in the Genus database with same CATH superfamily
2D3PA 4B8EA 4YM1A 5JZGC 2LM3A 2RS33 3JBG2 3ZYRA 5F7UA 1NOVA 4XEZA 5FY5A 4PQQA 4AI3A 4YZ5A 4KBZA 3LSDA 2VBDA 3Q9OA 3VBFC 3QLQA 3ZVXA 1NG0A 4ZU4A 3ZXKA 2W2IA 3ENRA 5JOYA 3ZN6A 4GB33 4M3CE 3RGBA 2CGNA 5IK4A 3TN92 3A23A 1YI9A 4LK7A 1OI6A 1Q8PA 1QOTA 3I3BA 2AGSA 2VW1A 2BEOA 2WT2A 2RV9A 3DGTA 1FMD2 1IGOA 3N7KA 3O0VA 4QM9A 3KF3A 1AZDA 1KS4A 3OGVA 1DQ0A 4I09A 4EN9B 4QDRA 1UYZA 1VMHA 4CA9A 3BB6A 3FJSA 1YFXA 4YW6A 4QQLA 5I0UA 5J37A 3CZUA 3J4UH 3R6SA 5B4NA 4IGOA 4XABA 4Y1UA 4B4PA 4YZ2A 5K7PA 2DV9A 1W6MB 3CBNA 1C1FA 3VZJA 2HWE3 3RMYA 5FYUA 3VKNA 1UMZA 2A7AA 1W05A 3O5SA 5DAXA 4QPGA 4RSUA 5FV3A 1IQDC 5HBAA 3O1VA 3PUSA 3OJBA 4IW3A 2VMCA 4OHXA 3ZFGA 5J09A 2FDIA 2ZGNA 5CVRA 2XONA 3HN3A 4YGBA 4FFFA 2DWRA 5A32B 3J9SA 3AJYA 5H9QA 1HB3A 3IDBB 5AFEA 2EICA 2OPWA 5FO8B 4Y1YA 5AFBA 1R1A2 4UW6A 5JUVA 1T6GC 5EP9A 1NCQC 2P17A 1SZBA 2Y38A 3M3EA 4UF0B 3ON7A 3DCQA 3RSJA 5A3TA 2HWF2 2PFWA 2JKXA 3L9JT 3UK9A 1ND3A 1J3RA 2J1VA 3JUUA 5GZFA 1BZWA 2UYBA 5IK5A 3NMBA 5C3PA 4GIQA 1UY2A 2ZMKA 1V6NA 1IS3A 3PUIA 1AL22 5CYYA 1C8M1 4JV4A 3X29B 1QOSA 3NRUA 4OQ9A 1YEWA 2EAKA 3ZYJB 5A3UA 3R4SA 3R4DB 1MEC2 3IIIA 1LCLA 1VBD1 3BTYA 3LB9A 4CEWA 1DLLA 2FDKA 2WQ4A 2GNTA 2K2SA 4CP1A 1KITA 4CDXC 1Y9GA 1VB2A 1DLCA 1ST8A 1RMU1 4MGSA 2WFF2 5A33B 3ZDVA 3ASIA 1UAIA 4R4ZA 4WVMA 3WG1A 2BGCA 1VALA 1F8VA 4PDWB 3LDBA 5L7OC 4COUA 4FI9A 1FI2A 4YVSA 4JKMA 4IV1C 5E16A 5LB6A 3RI9A 2I07B 4EZ4A 4CEYC 3UNPA 3RWKX 4YW4A 3HPNA 3MV01 3VBSA 2ZX1A 5J1XA 5C3SA 2G9GA 3MPPG 4GQ7A 1WWYA 2HBUA 3IPVA 4TWTA 4BB3A 5L9VA 2JJ6A 1GMMA 3LPFA 1JI6A 1VB4A 4KU7A 3BODA 2V4AA 3WG3A 4CCCA 3RPQA 3OBAA 4P9YA 2IFWA 4UW3A 1G7YA 1WLTA 2IXCA 4JGYA 1UN1A 1F4HA 3I4IA 3GZAA 1C57A 2NQYA 2BVBA 5GLWA 3ECQA 3THTA 4QQHA 4QPIC 1MQTB 2HYXA 1CVNA 4V2VA 1Q8VA 2OXBA 2VMFA 3OD4A 5FO7B 4BQWA 1CGPA 1LGNA 2XBO1 1JN2P 4N43B 5A3PA 1BMV1 2TNFA 1US2A 3ELNA 3JQWA 4JDNA 2BV4A 2QJVA 2XLFA 4LBOA 5I0TA 1RUF3 4XZUG 3WQ1A 3EJKA 4YVWA 1YQ5A 1R082 1H2LA 1WKYA 1REDA 4YFZA 1OKQA 1UW8A 5KXCA 2QDRA 4OHVA 5FPZA 1R092 1Y9QA 4TLFA 3NKTA 3QH6A 1RUC3 2ZA9A 5AVAA 5JDBA 5JPMB 3OBRA 4XFGA 1SHWB 4G9SB 4HZFA 4ISQA 5A1AA 2ZEWA 4RYDA 4PHZA 3WQ7A 4NPRA 2YBSA 2CU5A 1AR93 1LODA 4IEYA 4HONA 3RZZA 3SH3A 2D6NA 2ZEYA 3ZYBA 3WLUA 1NXD1 3SLIA 3FLRA 3M3CA 1EAH1 2E33A 4CXXA 4RQPB 4PLMA 3JB8A 1UMIA 4JQTA 3MW4A 3N3HA 5CFDA 1OF4A 3F2ZA 4A6SA 3ZXGA 2R061 2TUNA 5T54A 2AENA 1QQP1 1S0CA 2GC1A 2VJXA 3KB5A 4GMP0 5FP7A 4LBKA 2WNEA 2AEZA 4TLGA 5C3QA 1UCXA 3RZLA 2NPIA 4LA2A 1NLQA 4ISRA 2Y26A 5FY1A 1E5IA 3BOWA 1OOPB 1VBE1 4NVPA 4BA6A 2C6SA 2C0ZA 1H6XA 1HKDA 1OH3A 2XVKA 1C5HA 1COV1 2JE8A 3POBA 1OLMA 3SNMA 1RUD3 2ADEA 3EHKA 1GOFA 1LOFA 2BNNA 2ET7A 3CIHA 4FPLA 3KVAA 1ZA7A 3LPGA 4OMDA 4DZGA 5KXEA 4BQ5A 2XJUA 3POEA 4MADA 3I49A 5E8AA 2D6LX 4AFAA 3Q8EA 1VRBA 4CPBA 5C4WA 2PXJA 4W6YA 4Q4W1 4WM7A 1W9YA 5F32A 1IKQA 4CCDA 5JZGA 4AFCA 1OVSA 2PHRA 1ODMA 4U2AA 2C5DA 2D97A 2GU9A 2RDRA 1EPZA 3WDXA 1O5UA 1NA1B 4XMAA 3ZXEA 4D8MA 1IS5A 3ABZA 3WNOA 1D0GA 1QJU3 4XOGA 5FJHA 3ZXLA 3MFCA 1DQ1A 4CCOA 1JZ8A 1IG3A 1QXRA 3U0ZA 2QQPA 5JOXA 2ARCA 1U0AA 2R16A 1UKGA 4Y26A 2ENRA 1W2NA 4N90A 1S1AA 3T30A 3OGJA 1UF2C 3B93A 4P9IA 3VBUA 3VBRC 2F4LA 3VL9A 1JYVA 5FPLA 1JOBA 4GWMA 1O3SA 1W8TA 1DYPA 4FT8A 4UAPA 2BOIA 1ENRA 3I2OA 2DUQA 2W08A 2PHXA 4AQTA 3GHNA 2RVAA 1O6UA 2ZX2A 2XLGA 3ZFEC 5EV7A 1BEV2 5BNPB 4KWUA 4EN6B 2J1UA 3NAPB 4I0AA 5FLIA 1B09A 2ZCWA 2IXIA 1ZZBA 3K4AA 4RS5A 4A7KA 2PAEA 5EJ1B 1DQ2A 4CSWA 1V9U1 1IKPA 1TG7A 2AH2A 5DAVA 5FBZA 3FUOA 2CDOA 1VRH3 4Q0SA 4J25A 1JUHA 4FTEA 1RITA 5FPXA 1ULCA 5DDJ1 2XLAA 1QJFA 2R0HA 4KL1A 1W0PA 3LA2A 4R52A 1DYOA 4FOVA 5DAQA 4L92A 3ZFFC 4EZHA 4Y1ZA 2GP5A 3ZYHA 5F6LB 1SBFA 5KHIA 5D21A 5LK7B 2W95A 3WG4A 2RDSA 3T3YA 3NNJA 1RUI1 1JH5A 3B3QE 3DXUA 1GYKA 1PNGA 5JOWA 5ACA2 4E2SA 4KGGA 1GWKA 3AP7A 2C1FA 5A6ZA 5HPOA 5IVYA 1SG3A 4D6RA 2Z79A 3H3ZA 1H8TC 2ZHLA 4LO4B 5BY5A 1OXCA 3OUJA 1JZ7A 1RUH3 3TEYA 2WBKA 1DF0A 4W6WA 3C8XA 4XTPA 3B69A 2HWC1 2X5IB 4XUNA 5D8AA 1WMFA 2DCZA 1SFPA 4DOUA 4NAOA 2HWB3 5DUXA 3MFAA 2YHJA 4L97A 4BLJA 4F7ZA 4FPFA 1RUE3 2XG3A 4SLIA 2WNVB 2PLV1 5FZGA 2XWJB 4JKKA 1PGW2 3H1WA 3KSCA 3MIFA 1EV12 1GLHA 1A8DA 1UY4A 2OW4A 2UU8A 3HEIA 5DAPA 1QKQA 1JODA 4WVWA 5LBBA 1AYN1 4O7XA 3ST7A 4AVBA 4BK5A 3THDA 2QZ3A 2XUMA 2CSGA 4M0HA 5JXHA 3P5BA 1PX3A 4L9BA 2YPDA 4Y3OA 1RC6A 1Y7BA 1ZBE3 3E5UA 3ZR6A 5C71A 5JAXA 1VBB1 5IT6A 3SC7X 5DZGA 4XYXA 1OLQA 4EN7B 4JZRA 4BQ2A 4QX2A 4Y33A 1MZ5A 3QD6A 4LIUA 2JEMA 1QJX3 1Z78A 3ETPA 3RMXA 5LBCA 1BBT1 2XDVA 4ARXA 3WNMA 1YFUA 3WP6A 3FHQA 4UFIA 3O14A 3OPTA 2WS91 1X36A 3MIDA 4KGQA 1ENXA 4OZOA 1CAUB 4Z8BA 1AR61 2VUDA 3O7OA 2XH6A 4C1WA 4FBFA 1BQPA 1DGRN 3KVBA 3NV2A 3BI3A 3ZMNA 4Y5TA 3JD73 4BQYA 4BXFA 2AACA 5A3LA 2Z5WA 3CJIC 2BWCA 1LULA 2WA4A 3WNPA 1H1AA 4AHXA 3U4XA 3C7HA 1HLCA 4Q4X1 4AEDB 3GF6A 4HSLA 4LO5B 2DU0A 3ZYIB 3TRSB 4LJHA 4FPCA 3POJA 4IV1B 2HWC3 1CX4A 2Y0OA 3KV9A 4RGKA 4MX3A 4QQOA 3NL1A 4XCAA 2PA7A 5FCCA 4HKWA 3WX5A 3ATGA 3D6EA 3MBWA 4CRQA 5I0DA 1MS3A 2DVGA 1ZBA3 2W47A 1Q3EA 4XMIA 4PIZA 2XWBB 1AR72 1PVXA 4FPGA 5DABA 2QKDA 2GMMA 4HPKA 4YZ3A 1AX2A 3GCXA 3TN91 1SFYA 2RJ2A 1H2MA 2D40A 2W1QA 4AI2A 2CWMA 1FMD1 5KXBA 1W9WA 4LXLA 4K6BA 5LRSA 5FPBA 4WZCA 3VDDB 1CIYA 2BNOA 3VKMA 2B39A 2WN3A 5DUUA 5FOJB 5FR3A 3EMRA 3WF2A 5A6YA 1TME3 4AGVA 3MF6A 3AP6A 5FUNA 2X09A 5JXGA 4LNVA 2DTYA 4FAHA 5FZ4A 4YGDA 4CU6A 1XNDA 4AI0A 4BQXA 1FATA 2XB6C 2ZJCA 3EBRA 4KI5M 4UT5A 2ES3A 1BVVA 1DIWA 4TXWA 3VD7A 2FCTA 2ID4A 3N7LA 1RHI1 2KXLA 3RJRA 1CQ9A 1UU4A 3LGRA 4JGZB 2BRTA 1SBDA 3EQEA 1QIQA 2A3WA 1Y4WA 3GZUC 4LBQD 1ZZ7A 3FC0A 4P9LA 5LBFA 1OFSA 4QPGB 4IXLA 2GP3A 4XC9A 5F6KA 1W04A 4YYOA 4FQ4A 2W91A 3GNEA 4NIIA 3V65A 3AFKA 1R1A1 4RN5A 2ZPXA 1LU2A 2BBAA 1ZZ6A 3R05A 3UJQA 3VHPA 3VKFC 4A7YA 3B7MA 4NHMA 1K3IA 2CV6A 2HWF1 4OI4A 4MVTA 3VV1A 1H1IA 2WWJA 1YJLA 2ZS6B 4IEZA 4NROA 4MGTA 1XYPA 2RMU2 1UY1A 3IAQA 5IVVA 3WF1A 2EIGA 3MUZ1 5JCTA 2VZPA 3NNLA 5KBFA 1O4YA 1QGLA 2VTXA 2WWUA 1ND3B 2VTXJ 1MEC1 1VBC2 2ZOEB 3JBG3 4XJUA 4E8DA 3NO8A 4N53B 4AFDA 5LA2A 3H8OA 5A7WB 4YG3A 1EAH2 2VQ0A 3OPZA 4UBHA 1JZ5A 3RQ0A 1LHUA 4FXGB 1FOD2 1N1VA 2R1DA 2WFF1 3PUAA 4AVSA 4COWA 3OOXA 4Y20A 1LOBA 5M0TA 2XVGA 1PVC3 3N9NA 3ZOIA 1QJZA 1QQP2 4FOWA 5FO9B 2JG9B 5IJRA 1AJKA 1PZ7A 2ET1A 3M3IA 1G9BA 1L7LA 2ZXQA 2VNRA 4LUKA 3H7JA 4NOTA 2QQLA 5CFCA 1S4CA 2EIEA 3I3MA 3GM8A 1VBE2 4AVCA 2C9AA 1HX6A 1UZ0A 2RHPA 3MEPA 4JTOA 4YGCA 1COV2 5F3CA 4IGQA 2VY0A 2Y64A 2BFUL 2GSYA 4DUVA 5GZCA 5A1LA 5FYMA 3VBSB 4PDWC 4W6XA 5JIAA 3WUCA 2ZX0A 4N7IA 5A7QA 5FKBA 1NXMA 4P08A 5FZKA 1KD7A 5A3NA 1KJRA 4DB5A 4XFFA 5A3MA 1OUXA 3KMHA 5E89A 5FY9A 4JCKA 2HWD2 5IWFA 4OHYA 3WNXA 3OEAA 1PGL2 5C8CB 3KV4A 1LGBA 4NRQA 5APAA 2JKBA 3QACA 2WDBA 3DPRC 4R9DA 1FXZA 1ULFA 3C7OA 1BJQA 3POIA 2VNOA 4J6GA 5T55A 1RUG2 1YIPA 5LCWL 1W6QA 2ZHMA 3H42B 2JG8B 5KHKA 1XPWA 1BK1A 2ZAHA 3CEWA 1R091 1S0IA 5CG9A 1N47A 4M3CA 1EUUA 1GZ9A 3FHIB 3GGLA 3DN7A 1AL23 1RUJ2 1FNZA 2B9UA 2QUOA 5BXXA 3PVNA 2G1MA 4HBNA 3WQ0A 2V72A 3J8F3 2A6ZA 4QGNA 4K1YA 2B42B 4CDQA 4COVA 1AYM2 1POV0 4OLLA 2UWAA 3SEPA 4N43C 3TEWA 2PAKA 5GLZA 4YM3A 4NIHA 5FMOS 5CU1A 5FZAA 4CCEA 1OH4A 2YUEA 3HR9A 1SLTA 4URTA 4XQ4A 4LLOA 4YW5A 5J98B 5B2GB 1D4M2 1VMJA 3WNNA 1UMHA 4INDA 2BU9A 5ISLA 4FAGA 2R072 1ASJ2 3CU7A 1YQ6A 5CFDB 4C0HA 2YFZA 3N7JA 1U5YA 3OTFA 4FP2A 5DN2A 2X29A 3DECA 4D94A 1IQAA 4QPWA 2CAUA 2GN3A 2RS13 1CZSA 3F95A 2ZTNA 3N9PA 4RQPC 5F5QA 4RR3A 4JTNA 4JDMA 2VOTA 4I0WB 1RUI2 2MPFA 1OA2A 4IE5A 4A2UA 2SBAA 1HRV1 4S2DA 2FHRA 5T52A 1FV3A 4EWEA 3PTRB 3CZJA 4BU2A 4GJZA 3V64A 1CAXB 2DCTA 5GLVA 4I0BA 1K12A 2EXIA 4QHOA 3B94A 4COZA 4IDZA 1ZRCA 1TQ5A 1CPNA 1OOPC 1M4WA 2ZACA 3IBMA 3O0WA 3IWZA 4BXSV 4URAA 3QH7A 4HN0A 3ZSJA 3VDAA 4PBPA 2ARAA 3D3AA 3LFIA 5F5CA 4A41A 1D2QA 1FPN3 1XB9A 3VBFA 3MW3A 1OA4A 5C4WB 3E6DA 5LEKA 1KRIA 3P1IA 2W3JA 4A45A 2WO2A 2Q0AA 4CCNA 1R083 2LALA 4GXLA 3SKJE 4EN0A 3R4UA 3D82A 4P9JA 1GWMA 1ULEA 4ITCA 1UY3A 2PLV2 4YSFA 3VLBB 3BALA 3WF3A 3AX4A 5JLVA 1WW7A 4AAXA 3INAA 1REFA 5FZMA 3KT4A 1W06A 3LZZA 3FHAA 1AYN2 4YW1A 5SV8A 3UJOA 1NA1C 2FMDA 3I8TA 4NIGA 3FWEA 4LO8A 3M3OA 4DXRA 4I3PA 3AM2A 3POGA 5AC92 2JB4A 4AGGA 4M3CF 4AYUA 4N9IA 1TMF2 4DY3A 5CBLA 5HCHA 4OULA 1PIV3 5B4XA 1JZ6A 4BQ4A 4EWAA 4XILA 4DEQA 2PHUA 4OI2A 5G05L 3I2HA 3BUCA 4QX0A 3I59A 5C7GA 4R8HA 3U75A 2H0BA 1BBT2 1AVBA 1U5IA 1JU3A 3TBDA 4DO0A 1OQEA 4CPBD 2WZR2 3WCRA 2FDFA 4OVEA 4GH4B 5FY7A 5BNPC 4AK3A 2VZUA 3NAPC 4HVRA 2WO1A 5A1FA 1NCQA 5CEHA 1AR62 3IKWA 4AVTA 3ACGA 1V6MA 1WW4A 3ME2A 4BMEA 2QQJA 4J1WA 4BDVB 2RJKA 1HB2A 2DDUA 4S2HA 2J22A 4LBJA 3KHBA 1TVGA 1W6PA 2R49A 1SEFA 3U10A 1C1LA 4H3WA 1GICA 4I30A 1ZRIA 2WLPA 4UFHA 3QOPA 1POV3 2D98A 2OKXA 3T2OA 1ULGA 3B00A 1XU2A 5EPAA 3NQHA 1H30A 2P37A 2ZX3A 4QB1A 4XQWA 5T5LA 3ZSKA 1NCRB 3E97A 4LLFA 2P1BA 5CISA 1W8UA 1YWKA 1W6OA 3VHRA 4CDXA 3FLTA 3M70A 2Y60A 4QQ2A 1K5MA 4XDPA 4AG4A 4QKDA 4XZPA 1O4TA 2VZ1A 3AZXA 5HCFA 5FUIA 4WVZA 4AAPA 2P5BA 4FOQA 2WO7A 3PVOA 2A73B 5L7OA 2CGOA 3NV1A 1PGW1 3WW3A 3ZIXA 4B1MA 1UO9A 1EV11 3P3PA 4R4XA 5T50A 2DBNA 2P34A 4CEYA 2WINB 3MYXA 2MEV3 2F4PA 4GWJA 2RR11 1H4GA 2X5IC 3DUIA 4I01A 1WLCA 1G86A 1SLCA 4I3GA 3HN1A 4L99A 4Q8LA 3RJ2X 1DZRA 3RNSA 2VUAA 1V70A 1BEV3 5TSWA 3RI8A 2OUJA 2WZPP 4Y24A 3HD8B 2WNVC 5FWEA 1UX7A 4E27A 3BU7A 1GQGA 3MHZA 1J1TA 4A7ZA 5T5PA 2ZGQA 3HAGA 5C5UA 2KD7A 1RHI2 4Q4Y2 1KGYA 5KC5A 1JW6A 2AZ5A 1YC61 1H1MA 4YG0A 5F1RA 2DYCA 1QXJA 1LENA 5FP3A 3W21A 1VLNA 4ZS2A 3NVCA 3RZHA 3M2MA 1OA3A 2SLIA 2BYVE 4K8RB 3H9AA 1MZFA 2ZZQA 1HJGA 4KU8A 2H0VA 1HV0A 3EB7A 4Y1XA 4G3YC 3GBFA 4OYUA 5KWRA 1RJ7A 4Q0VA 5J48A 1NE4A 2WO3A 2XHKA 2UYAA 3MF9A 3ZSMA 5ACA3 4QX1A 2TEPA 3VZLA 2VAUA 1D2SA 1GFF2 1SBEA 4WV8A 5C70A 5KXDA 1QJY2 4FCAA 1BXHA 2NYYA 4A44A 2WKKA 1ZRRA 2CTVA 5A3WA 5K8SA 2GN7A 4LKSA 3H8XA 4NHLA 4JDOA 4IETA 5EZWA 1RVF3 3C3VA 5JI7A 1UX6A 2CGPA 3ZR5A 4QGLA 1PO22 1W8OA 4MSVA 4XFCA 2A6YA 2IVIB 3OG2A 3WCSA 5FZ8A 4ZONA 1AR71 3GDBA 4PQ9A 3WW1A 4D0QA 1OPOA 3M7AA 5FOBB 3MIGA 1NX9A 4BIOA 2A6VA 3DYOA 4IEPA 4AEDC 3V0AB 1S55A 1JMUB 1XSQA 4U36A 4I2OA 3KCCA 1D7PM 1WLWA 2R0FA 1W28A 3ACIA 1SCRA 2VOVA 3AVSA 3BIWE 4HPKB 5BV6A 5C9AA 2A3XA 1SLAA 2WFPA 3J7MA 4B7EA 4ET7A 5D2AA 4ZU5A 4ASKA 5FUPA 3AYDA 5FQ0B 3AC0A 2NN8A 4Y22A 1UZZA 4Q1PA 4FTBA 3DPRB 2XJRA 1WA4A 4LEJA 2Z69A 4PCRA 4W8JA 1BK0A 4HXCA 2RM22 5J96B 4JQRA 3AMMA 4HSJA 5KC6A 1XBFA 3AFGA 3VDDC 4DIQA 4RGAA 3OGSA 4LKFA 2Y33A 2ZGRA 3AL6A 4NHXA 2BQPA 3N9MA 1L7QA 4NPMA 1GNZA 4JVAA 3FBMA 4EN8B 3WSOA 4DXZA 5ABJA 5LW9A 3USUA 1H8VA 4QX3A 5L36A 2D3RA 4UWDA 2LROA 2WZ8A 4KWLA 4LTAA 3S57A 2Z2SB 5L19A 1OF3A 3BYWA 1VMFA 4JGZC 3VBRA 4GAZA 2UURA 4QXHA 2RMU1 3ILFA 2V5DA 5IVEA 1APNA 2YC4A 2V5YA 3GXUA 2XJQA 3AKTA 4QPGC 3T0BA 3WNLA 1MS0A 4CUBA 3OY8A 4DEVA 1C8M3 2AC1A 1DGLA 5FZDA 3WXPA 5BNNB 1CX1A 4CP9B 1VBC1 2JDHA 2EIBA 4OCTA 4A3ZA 3V56A 1ZREA 2FZ1A 1VBD3 2VCMA 5J36A 2VZ3A 1B35B 1ZNPA 2VNVA 5FYSA 2E7TA 4GKYA 4HVOA 1NUKA 3U4SA 4UOJA 1FOD1 3ZXAC 3UKNA 1US3A 2VBPA 3VZKA 1RMU3 4EE2A 3ZMOA 1OFNA 2XQXA 3AKSA 3S7IA 3OF1A 4OI1A 1WGPA 3S6PA 3PURA 1NLSA 1F5FA 3B5LB 3EYPA 2ZABA 3K3OA 3OBTA 1V0AA 4QDQA 1HXS2 1MS5A 3HWJA 1ND3C 3ZFFA 5JMOA 4ZHNA 4BISA 1LOAA 4NN0A 4EQVA 2ERFA 3L2HA 2ZKLA 4N53C 4PT6A 3H8UA 2XHNA 2XJVA 1H6YA 2VVEA 5GALA 3MGUA 4DS0A 5DQ0A 4C0BA 2VMDA 3H3UA 2DCKA 4HKOA 2R041 3IZOA 3H8RA 4IGPA 4RHV2 3T1LA 4DRVA 2Q1ZB 3WP5A 1HRV2 3W20A 4OI0A 2C9KA 2JG9C 3AVRA 3LAGA 3I7DA 4XBNA 1ZX5A 4CZSA 1NYWA 2HWD1 4PIYA 3VHNA 1PO11 3JU9A 3CHXA 4EV0A 1X9PA 1LESA 1SCSA 5J7MA 1PGL1 2QQOA 1OVPA 2ZKNA 4YVSC 4HANA 1N3PA 5AVPA 1C8NA 2XBO3 3KT1A 4DXTA 3PU3A 1RUG1 5CKMA 4QXCA 1QF3A 1EUTA 3VBSC 3VD9A 1OUSA 3ZPOA 5HXVA 2VL4A 1PK6A 5A3OA 4LO6B 4XFAA 4D6SA 1J84A 3HOBA 5FP8A 2VXRA 5ERLA 2RMU3 4XHXA 1ZRDA 3VBHA 3DKWA 2PHLA 5CZKA 3ZXFA 1L3JA 1TEIA 1W6QB 3OBZA 1RUJ1 3I2DA 2QNKA 4GD4A 5C8CC 2AUYA 4X6RB 4LT5A 5IAXA 3IAPA 1ODNA 3E6CC 3ZX7A 3HBZA 2D6OX 2WR9A 4QXKA 1AYM1 3WF4A 2JE9A 4Q0QA 1GV9A 2QCSB 3O0XA 1W8ZA 3HQRA 1EAH3 4Q5OA 1HDKA 5HXMA 2HLEA 5FK8A 2JG8C 4LHNA 2WNUB 2WJSA 1RUOA 1SFNA 4QKNA 4CDQB 1D4M1 2JIGA 5FYVA 1G6NA 3H1YA 5FZ0A 5DG2A 2R063 4GMP1 4WM8A 3DEMA 1UXZA 5DUWA 4MGYE 5IVJA 4YW7A 1HJFA 1IS4A 1QQP3 1ASJ1 2R071 4NMIA 4YVWC 4D3WA 3I97A 4QX7A 2VZTA 4YW3A 5FZ3A 5JSOA 1A34A 4ZZ8A 3SISA 1EP0A 3NJZA 1YIFA 2WAOA 4L11A 1PZ8A 1SPPA 4DXSA 5LEJA 1VBE3 2GH8A 5CB7A 5J3UA 1RXGA 2W92A 1LAJA 4XHBA 2ZEXA 1COV3 1H2KA 3AJZA 4GULA 5FK7A 4CCKA 1QOOA 2P2KA 4DFSA 4ONUA 2GH2A 2HWE2 3CJIA 3U14A 2Q1FA 2ZGLA 5LA9A 5HCAA 5CFDC 1XNBA 3PL0A 1GWLA 4XF3A 4XFHA 4NIDA 3KS7A 4YLZA 5GJ6A 5A70A 2AYHA 2OYZA 1O91A 3NV4A 4X8NA 1GUIA 4Q4W3 4XAEA 2YYOA 3LE0A 4HMZA 2BBVA 3KGZA 4Y5SA 3AMPA 3UKTA 5I8SA 1VIWB 5FZCA 3AYAA 1NAEA 3K75B 3UGFA 1KDMA 1ZVFA 2VQAA 2NLRA 4KG0A 4MGKE 4CDWB 4SBVA 2ZGOA 1AUYA 4MZUA 1LOFC 2GAUA 3RYRA 2E31A 4AXOA 1WCQA 3HBKA 4Q29A 4TYSA 3TYJA 5IHRA 1DGWA 1DQ6A 1R64A 4L2NA 3RVHA 1GZTA 1W2UA 1OD5A 4RFRB 5JXIA 2RR12 4CU7A 2VNGA 3LIHA 5C4WC 3AXEA 4WM7C 5AC91 1DG6A 1TMF1 1ZRFA 5E6HA 5CADA 2XKOA 1ND2B 3ILRA 3ZN5A 3WHUA 1V9U3 2P6CA 2WYFA 3KQRA 4P14A 5C8WA 2O0OA 4PF5A 1MZ6A 2Y0IA 3L2YA 3OUIA 4MXWB 2NMNA 2IWGB 2QQNA 3C7EA 3DYPA 4H2AA 4RA0A 4IUGA 5DDJ3 3VBOB 3KLSA 2UWCA 1S0BA 3HQXA 4A3XA 1N3QA 3OPWA 3VBUC 4UFJA 2WZR1 3BOPA 1XU1A 3H0OA 1ULDA 4MGIE 4OUMA 3TWIA 2QTWB 1IPKA 3BTAA 5BNOB 2JDPA 1XYNA 1RUI3 3FL7A 3SCHA 1Q8QA 3IT8A 4B4QA 2VBBA 1KFUL 2B46X 2HEVF 3J7HA 4QXBA 3SQOA 2VOWA 3UYJA 2ORZA 4G4FA 4HETA 3MLLA 4QKBA 2AR6A 2W9XA 2OPKA 2J7MA 5EYYA 5GZDA 5A32A 4EYUA 2XUEA 4FPEA 4HFSA 1W3VA 4GH4C 2OZJA 4NJ4A 4LBQB 1K42A 1OURA 4HN1A 4UF0A 4BMBA 2MHFA 3PU8A 4AEMA 5FDBA 5K0UB 2ZHKA 4XVHA 1QNYA 2DBIA 5C3OA 3FBYA 3LQCA 4XJZA 3S0MA 5F5AA 1V6OA 4K9SA 2R1BA 5F2SA 2PLV3 1W6OB 1K5MB 2RDQA 1W6NA 3LDKA 1GQPA 1NY71 1REEA 3O1PA 1Q5OA 2WLQA 2BGOA 3VGIA 1RUC2 4LMFA 4ZXKA 3AB0A 1NCRC 1HB1A 2GNDA 1OC1A 1RXFA 3ZN6B 1AYN3 4YRDA 2ZZJA 3TAYA 4XJ8A 2Q5TA 1AR92 2VMGA 4B7KA 3G7DA 3H7YA 5T3NA 4LA3A 1MS1A 3I3EA 5L73A 2YU2A 4QPYA 4FPKA 1VBB3 3NJYA 4K40A 2W1UA 5IAVA 3VZNA 2XQRA 1G9AA 3HT1A 2ORXA 2XR4A 2YG0A 1VPHA 3CF6E 5T5OA 3IM0A 4Q4Y1 4BE3A 5EYXA 5T5JA 2E53A 3S5AA 1W9FA 4O9EA 1BBT3 1TE1B 4XF1A 4LUMA 4CDUA 3VUOA 1I6XA 1RB8G 3POFA 4QQPA 2WS93 2A1XA 4XJAA 4AE2A 4C90A 4FSJA 3ZYGA 1AR63 4BHPA 3O1UA 3T0DA 5LY2A 2IXLA 1POQA 1QDOA 1UOGA 5FPAA 3J26N 3ZFGB 4YZ1A 3DYMA 5FYTA 3ZO0B 1HRI1 2A6WA 3CL1A 1RIRA 1QJY1 1NE6A 3V0BA 2QBXA 1MQTA 1OMIA 3AL5A 5IFTA 3APBA 1GNHA 3LCPA 3PMSA 3KV6A 4Q4X3 3RZMA 1ULPA 5GLUA 1XJAA 4BH9A 1JHJA 4N43A 3PMEA 4AVVA 2PQQA 1CAVA 4AI1A 4Q0PA 1PO21 3MLKA 3O12A 4H7LA 4KNCA 1MS8A 4LOSA 2W46A 2K9ZA 1SDDB 3ROUA 4E9KA 1KFXL 3K2OA 1YQCA 1QJU2 3VD4A 2BERA 2J1EA 4H55A 4XQDA 3TN93 2HEWF 1HQNA 4D7SA 4CEWB 5CA6A 3RS6A 1FMD3 1IS6A 3D0SA 2A5ZA 3ES4A 3KV5A 1BKZA 2D6PA 2E63A 4YW2A 4IV3A 1J1LA 4TN7A 4WVMB 1YHFA 2FDGA 2D6MA 2YV8A 4XXAA 1BVP1 2Q4SA 5FAXA 1V6JA 5IVFA 4PI0A 1ZZCA 1K45A 1O59A 1Y9MA 2G9ZA 4YVSB 5C9AB 5I8TA 2VCCA 4XCBA 3AXDA 1W2AX 4IE7A 5JOZA 1UU5A 3W58A 2RM21 2R042 3LOIA 3PJQA 4QU2A 3T4VA 1RHI3 3IPVB 1WMEA 2XJTA 1XNKA 1OOPA 1VRH2 1H0BA 1UY0A 2K0GA 3POWA 4QHBA 3NJVA 2VUJA 2Q8DA 3WG2A 1IG0A 1PO12 1VBA1 2I74A 1A3KA 4PF1A 4LKDA 4E2QA 1MPXA 4JGYB 4K8FA 2JXAA 4K3UA 3ACLA 2BWAA 1YQ2A 2IXHA 4QX5A 1JOPA 1R1A3 3RWNA 4A4AA 5FMOL 4BPZA 3QBQA 1JTZX 2EA7A 1OQDA 2HWF3 2QQUA 1O7FA 5LRRA 3RYPA 2QFEA 3USUB 2CWSA 5K9YA 2OS2A 3CNAA 3H1MA 2BVVA 1XOYA 1H4HA 2ZGUA 1ZZ8A 2D3SA 3KM5A 4YVWB 2L9LA 1NA1A 1O8PA 2EF6A 1PMIA 1WD4A 2GDFA 5C3RA 5FZ1A 1MEC3 2JX9A 3WZ1A 2Q8EA 5EIYB 3LD8A 3WF0A 1UZWA 2HEYF 4P02B 3OY8B 4DQAA 4JX0A 5A6QA 1WW6A 1I1EA 4AEKA 2XKPA 4XUOA 2HWB2 2WFF3 1F9KA 5JR7B 4XUQA 3WVJA 1RUE2 3K4DA 1ZA4A 3FMGA 4LE3A 4BQ3A 5JXJA 2C4XA 3UKVA 3K46A 1HXS1 2XL9A 3CJXA 2RS51 3IMMA 5BNNC 1E57A 3Q8CA 3FFZA 5FRAA 3W59A 1V6KA 2VECA 3NAPA 4M01A 1B35C 3LKJA 2IVJA 5C6CA 4IESA 1G9DA 2LTNA 2WSVA 1LKNA 3NKGA 2FCVA 3HNBM 2HH9A 1ZBE2 3DL3A 3ACHA 5L9RA 4XUTA 4RHV1 2O8OA 1XE8A 4I02A 5IFPA 1QHDA 1NQJA 4OFGA 2J42A 1ACCA 2GC3A 4Q0UA 3FLPA 4CP0A 1QH7A 1YNAA 2J1SA 2J1AA 3KZ4C 2BUKA 3T2QA 2PMWB 1JYTA 2IXKA 1LHWA 1GOHA 4QHZA 1W39A 5I0RA 4EJRA 2VZSA 1AX1A 4K1ZA 1O3TA 2A71A 5CKQA 4CCJA 1QH6A 4WM7B 1GKBA 5F3EA 1H2NA 5C33A 2IXJA 1YI7A 3LSEA 1UZVA 3FX3A 2DU1A 1HN1A 5F39A 1R093 1CAWA 2WL1A 3O1OA 3CMGA 4AEJA 1WLDA 3MIBA 2P3KA 1MVEA 2YMZA 4PI2A 2BJSA 3IDEA 4XAAA 5FJKA 1LB2A 2VZOA 2BDRA 2X5IA 3MI8A 1XC6A 3NNMA 3J7LA 1Q8SA 3ZKUA 3OB8A 5JSRA 4D7TA 1GZWA 5FYHA 4Y4RA 5FZ9A 2JDZA 3DXTA 3QCWA 4KWJA 3VBUB 2W5FA 5DZFA 1I3HA 2I45A 2WNVA 4OHWA 2RS31 3CO2A 2ZEZA 2EAAA 3EXUA 3TNPB 4FXKB 4YPJA 4ATFA 5FYYA 1DBNA 2V73A 3DV8A 3W5MA 2PHTA 2OZ6A 1MR5A 4JC1A 4LBMA 5FYCA 3RZKA 2GMEA 1GNYA 4GB31 2BPA2 3KQ4B 3ES1A 5BNQA 3ZLIA 4RS5B 1WBLA 3VKLA 1CJDA 4WM8B 1BYHA 4MG2A 1Q43A 1PM4A 1X33A 3J7NA 4LOTA 4PLNA 3VZOA 4RFT0 1O3RA 3HVDA 2Z4FA 4XTMA 1VR3A 2P4EA 2WNUC 4LBLA 1TME2 4CDQC 1W2OA 2EXKA 3OEBA 4FO9A 4X6QB 3P3NA 1AXYA 3AYCA 3WDVA 1DFQA 3PIGA 2HWE1 1DGRA 2VVDA 1HRV3 1W90A 2WQ8A 1XE0A 1VAMA 3FFQA 2JDNA 2WN2A 4FPYA 3D8CA 4BZ4A 2QVSB 1OLRA 3OD0A 1F5JA 1GOGA 5KHJA 1GSLA 4WBBA 4AQ2A 1YYNA 1XSRA 4P9GA 1A78A 1VP6A 2Y8KA 1DGWX 4B4RA 2UY8A 4KH9A 3OYWA 4GWNA 4Y5Z0 3RRDA 4DUWA 1F35A 1FT9A 4EWDA 3MLJA 2Q30A 4L0PA 3HQUA 4C8DA 3AP5A 3U11A 4O61A 2WUHA 2VOKA 1XNAA 3SH4A 4EROA 4RL7A 4AEDA 4XW3A 4ATEA 2YY1A 3WW2A 5D8AB 2RJLA 1PMJX 1LNSA 1FV2A 4R9AA 2E32A 3FN9A 2VXJA 1HV1A 2ARXA 1NY72 3GALA 4IV1A 4ZU7A 3GBWA 1MACA 4FFIA 4DRRA 4HT1T 2AEYA 3PUHA 2JENA 1U12A 2A75A 2V09A 5FZLA 1YO8A 3GJBA 1IHMA 1UOFA 1WMDA 4ZS3A 4CDWC 1LOEA 4UW5A 4O9GA 2Y6LA 3OCPA 4FP3A 1XNCA 1JYCA 2VD7A 5FZ7A 4CUCA 1IPJA 1J59A 4OUEA 4UFMA 2JWPA 3K48A 3M1HA 3VDDA 4KG8A 3WNKA 1W9SA 4IQPA 2FMYA 1UYPA 4YWAA 1PVC2 2FQPA 3I3DA 4M0NA 3ZYFA 5JPNB 4QPIA 4BWOA 2Y6HA 1UKRA 5F5IA 1NT0A 3O1TA 1YQ8A 1QU0A 5FZIA 4HK8A 4AVAA 3OUHA 4A6OA 2VH9A 2C26A 4P9XA 4MO3M 1JU4A 4E2GA 2YC2A 2DFBA 3I3QA 4Q1RA 1ND2C 3UESA 1O3QA 2EXHA 4AR2A 4JGZA 2XGXA 3K4ZA 4NHYA 4FVVA 4UFLA 4AW7A 5IATA 1W8WA 4XACA 5F3IA 2BTVC 3GJAA 3M3QA 3M8LA 5FYIA 1HRI2 3VBOC 1X50A 3RFRA 4WZFA 3KT7A 3KHCA 5DXDA 3Q8AA 5F9TA 1OPMA 4QM8A 1NLRA 2H6CA 4LK6A 4Q8KA 2OUHA 2PAMA 2WRAA 1LEDA 2D44A 5BNOC 4XF4A 4GWIA 2Y6GA 4AFMA 2D93A 2DUPA 2B7YA 4LITA 4LO7A 3KCYA 2DUOA 2GZWA 4NIAA 2E7QA 4IEOA 3AP9A 3LOBA 5EFUA 1LOCA 2GALA 2RDNA 1RUF1 5A7NA 1H9WA 1W8FA 4E4SA 4QB6A 2VU9A 2BOJA 3NJXA 5IK7A 2O14A 5KHHA 1TNRA 4YM2A 2TBVA 1J3QA 2VMHA 3VKOA 1EV13 1C5IA 3A4UA 2DVBA 1RUC1 3NWKA 1AXZA 2EVXA 1CR7A 3MIHA 4XUPA 4N53A 5A80A 2WNOA 1MVQA 1Z0HA 4Q4V2 3WHTA 4QX8A 5A7WA 2BZDA 2RR13 3A21A 3AYEA 3U37A 5IUQA 4M00A 5K0UC 1AR91 1W6NB 1GBGA 2YPJA 4PBOA 4TZDA 3J8F2 3WR0A 4F8AA 1Q8OA 3VDBA 4CXWA 1AR82 1HB4A 5FP9A 1ONAA 3AKRA 1VAKA 1OSGA 5FIXA 4XDOA 3LEGA 1CZTA 1OHFA 4IEWA 2YU1A 5JVVA 2JG9A 1K5MC 2HYKA 1VJ2A 4YM0A 1XQNA 3I2IA 1W2TA 4ASMB 2YDEA 4Y1VA 5IW0A 1MS4A 1S0FA 2WAAA 1CIWA 3C7FA 1XNTA 2B4KA 4V1PA 5GKAC 2X8KA 1RINA 3A7QA 1A8MA 2V4VA 3N7MA 3IIAA 5F37A 3T2PA 2CYFA 2CY6A 1UOJA 2JDYA 2YBPA 2VZRA 1IPSA 1AHSA 1VBA2 4MOAA 2YGMA 4W50A 4P5HA 2ADDA 3UETA 5ANNA 3VL8A 2BW8A 2RS12 4CDUB 1YJKA 2QE3A 1RUD1 5JIUA 1CZVA 2VO5A 3U78A 3UT0A 4ZPIA 2YFUA 1QNWA 3LIGA 2NM1A 1YXWA 2CL2A 3MUY1 5FXVA 3WW4A 2OA2A 3M4FA 4AL9A 5C8CA 4DNYA 2CAVA 4NWWA 1SLIA 3NW4A 4ES8A 3DKQA 1Z7S2 2QQKA 3IN9A 3AZYA 3HNYM 4GJYA 1DYKA 1TZOA 2QDNA 2W39A 3V0BB 5FZHA 4QB2A 5LK5A 3ZFEA 4P00B 2JG8A 3H3LA 3HIFA 4XETA 5FYZA 3E5QA 3ZFGC 2E51A 3BTZA 1W9TA 1S0GA 3USSA 1FPN2 5FPVA 2ATFA 2R30A 1AR73 3S7EA 4AFBA 1CAVB 1P8JA 1QJU1 4JRAA 3U07A 1LOGA 1VAVA 4CTEA 2ZGSA 4IE4A 4NPLA 3TEZA 2PQSA 1I9RA 2NMOA 3ILNA 2FD8A 5C5TA 4HL0A 1N1YA 1LHNA 1X9TA 2CHHA 4HOOA 2A6XA 4LE4A 3N4MA 4LKEA 2WZEA 2E6VA 2RS52 2VOXA 3WEZA 4HLTA 4Y20B 4OUSA 3GZTB 2VW2A 3GYDA 1JYWA 3WV6A 1D0HA 1L7RA 3HT2A 3N9QA 1LHVA 1RUNA 4E4HA 2WT0A 3AKPA 3PVBB 4IV3B 4QDSA 3BN6A 1DDLA 3D4KA 2JICA 2PYTA 4KBBA 5CFCB 4CEWC 4P5YA 4QKFA 1PIV2 2DTWA 2J1RA 1H8TA 3CLPA 1T6BX 5FWJA 2Y6KA 3N9LA 4BCUA 1VRH1 2EALA 4MXVA 2E26A 2MNGA 4D7YA 3WD5A 1C4RA 3WINE 5LY1A 1WCSA 2WA3A 2WYSA 2YB7A 3E1F1 3UV9A 1Y43B 4XBQA 4MGQA 5C9AC 5FXXA 2DVDA 1DP0A 2VGDA 2KM2A 4AHWA 1QWRA 1UIJA 4QD2A 1ALYA 4UW4A 4XF9A 4Z2WA 5JI9A 2W94A 3N36A 1CAXA 1CESA 1GR3A 4JHTA 1AJOA 2E7AA 1WZXA 2UWBA 2D5FA 3HMYA 4AQ6A 5DZEA 2ZMNA 2OT7A 1MZEA 1JS9A 5BYNA 2Q1MA 5FZOA 4XF0A 2W68A 3WUDA 1RUH1 4JGYC 1XXNA 1U5XA 2OQ6A 3MO4A 1VBC3 2LW8A 4LHKA 1HW5A 4B1LA 4M3CB 4Z92B 5FY8A 5LASA 1R1ZA 2RS32 5FBJA 3CQOA 2HWB1 5ABJC 1FOD3 5FZ6A 3GBGA 3FUQA 3ZDSA 1RUE1 2OIIA 5FMCA 4LULA 4MLOA 4GB32 4F3JA 2A3YA 2Q8CA 4META 2BNMA 2PHDA 2MEV2 1JUIA 5FLHA 2BP6A 2BGPA 3NNGA 3POYA 5CNAA 4FPJA 4XIKA 4AGRA 2GC0A 1HN0A 5I91A 2GMPA 1IOAA 1YRZA 1MS9A 1RGSA 1ZBE1 2NZ9A 3PUQA 2OVUA 1V6LA 2RE9A 2R32A 3AKQA 4B3NA 5I8YA 2R043 4M4PA 1GU3A 1QXPA 5LWBA 2YXSA 4K21A 1AL0G 4LIVA 1JYXA 3BU0A 4RR3B 4BK4A 1QJX1 2YZ4A 3AZVA 1LEMA 4E8CA 4GH4A 1I5PA 2I2SA 4ES9A 2HWD3 3AMQA 3LEKA 1PO13 1QMJA 2PTMA 3C7GA 4MHUA 3CDZB 5JR2A 3FE5A 5FY4A 4CCLA 1UU6A 3TEXA 2JIJA 2IC1A 4AOCA 1UD1A 1RUG3 1UYYA 1HQLA 5JZGB 2EIDA 3E6BA 3LFMA 1PGSA 2VPVA 5FZFA 1G9CA 1UYXA 2B45X 3JD71 5FREA 3VBFB 3WDTA 4DMIA 1CWPA 1NCRA 1F15A 1GP4A 2VG9A 1N3OA 3Q8BA 1RUJ3 3ALQA 2PN5A 1RTVA 4S2FA 1CAWB 4HKLA 1OQ1A 4MUVA 1AYM3 1DQ5A 1RVF2 3B02A 3TB0A 5KHGA 3IDAA 3H50A 5KR7A 4GALA 5FFOC 3ETQA 3THPA 2W87A 1GZWB 1HQWA 1VE0A 1ZBA1 3LF7A 1D4M3 1GQHA 1O5LA 4C91A 2F17A 3CKHA 1O4ZA 2QQMA 3B01A 1UNBA 1YCIA 2VMEA 4GMP3 1A6CA 2O1QA 3MICA 4Q27A 4BYYA 2R073 1ASJ3 2ZHNA 5LA1A 1PK6C 1X8MA 1V00A 1S2EA 4UI9L 5A6XA 2X05A 1LR5A 3ITQA 1H9PA 3VBHC 1GP6A 4RD7A 1AXKA 1W6MA 2XJPA 2HKXA 3BPZA 5FYBA 4HVQA 3ORJA 1SDWA 1TME1 4XE9A 4XURA 3I59B 3K3NA 4FFGA 1G8WA 4GA9A 5I0SA 2ARBA 2P3YA 5F8PA 1FYUA 3T08A 2CDPA 4LHLA 3WQBA 1X7NA 4LR4A 3MW2A 2VMIA 1PNFA 1UIKA 2AREA 2LRPA 1NCQB 1WD3A 2QQVA 4IEXA 4RS5C 4PIXA 3B9CA 1JZ2A 3O1SA 4WM8C 1KJLA 3ZIWA 1JOJA 2DFCA 4TSVA 2FBEA 4JHZA 4Z1VA 5H9SA 1ZZ9A 1LU1A 3HJRA 2JE7A 2FDHA 1W6PB 1I5ZA 2D6KA 1J58A 2OX0A 3ACFA 2WABA 1EYBA 4LPLA 4TTGA 1EPWA 3OSDA 4MGZE 1OLME 4IEQA 3A22A 4CVUA 3RYKA 1STMA 3WP4A 2KR2A 1NKGA 1GZCA 3OYWB 4IEUA 2HBTA 3GCWA 4QGMA 1RUF2 4RGGA 1JHNA 3IDCB 4BM8A 4CDXB 4MYEA 2FDJA 4M4RA 3D0JA 3K77A 3U1XA 5I93A 4NRMA 4K20A 2W52A 4HG6B 4J1XA 5CAZA 1ZYBA 4CYDA 1KS5A 5L7OB 3TOJA 5IYYA 1ENSA 4JAAA 2W1WA 1C8M2 3OGRA 3KCXA 2FZ2A 3JXSA 3JBG1 5A7PA 4CEYB 3JCIA 4UFKA 5A33A 5AC93 5IVCA 5JWPA 1VBD2 2P3IA 3HNMA 4NRPA 1TMF3 4OHZA 3V0AA 3GZEA 4YARA 2KA3A 4PDWA 1DHKB 1WW5A 4E4ZA 4UBGA 4JKLA 5D8AC 4Q2FA 5A7SA 3ZXJA 4R9CA 1RMU2 1ULOA 4WVVA 5CKNA 1PVC1 1FAYA 5FKCA 5G04L 5FQ0A 5EWSA 3VD5A 4R9BA 4NR1A 5DG1A 1LHOA 5GZGA 4DY5A 5EJ3A 3DPRA 1BHGA 2DVFA 2WZR3 4KMQA 5EXOA 3EO6A 4BOWA 1D4VB 4XFBA 4CU9A 3VDCA 4QPIB 1AX0A 3VN4A 4B29A 4X8PA 2VUCA 4FTSA 5FXWA 3AMHA 1G9FA 2VTFA 1BCXA 1RUD2 4LORA 4QT6A 1C3HA 3LA3A 4NUBA 1OT5A 1CJPA 1W0NA 1S0DA 3PDQA 3SITA 4L8QA 4NHKA 2IZWA 3S5QA 2P6HA 2Y6FA 4XJWA 1CPMA 3E5XA 5LZ6A 4FQZA 4H14A 1T2XA 3WP3A 4IE6A 4D69A 3T4HB 2JD9A 1X82A 3MPBA 1CD3G 4BLIA 1JYNA 1W03A 3ZYPA 2YGLA 2N7GA 3RDIA 1F4AA 4CUAA 2ILMA 2X10A 2J1TA 2YROA 2FCUA 1LGCA 1X8EA 3SMHA 3VHOA 1YLLA 4PLOA 2XBO2 1ENQA 2RG4A 2E9QA 2VZVA 3KGLA 4NE9A 4C1XA 4DUXA 2VVFA 1M06G 1BMV2 3C2UA 4AHZA 3KF5A 2QQWA 1S2KA 1N1SA 2ZGPA 1PX4A 2VW0A 3PHMA 1OD3A 5BNNA 2HJIA 2ZGTA 4XXPA 4YZ4A 4K7JA 5FTTC 1CONA 4CP9A 3NSTA 1JZ3A 3RZGA 1GP5A 2ZMLA 4Q4V1 3VB9A 1B35A 3AMNA 5HV0A 1AL21 3WY6A 5IK8A 3W5NA 4RQPA 1J3PA 4JRLA 3J8F1 4N7UA 5DUVA 2D7FA 1AR81 3PNAA 2XMLA 4BJ0A 1KXGA 1UZYA 3LEIA 2VE1A 2YBKA 4MH0E 4QWNA 2B8MA 2VQTA 2PHFA 3IMNA 3VD3A 4AF9A 4YNIA 5FMDA 3MZHA 3I2KA 4LHSA 3MDPA 3SCGA 2JDAA 1PHMA 2UY9A 2R062 1UWWA 4Q4Y3 3THCA 4Y22B 3O1RA 2WT1A 4MHRA 5LBEA 4Z82A 5FZEA 5FP4A 3SHRA 4DINB 2Q8OA 2Y34A 3LEMA 4CE8A 4UYBA 1F2NA 4OMCA 4AI9A 5HI0A 2D43A 3WDYA 1JXNA 2JECA 1RYYA 1TNFA 4N9HA 1LECA 5EHDA 1Q56A 2IUWA 3SKVA 1WA6X 2RS11 1SMVA 2B9VA 2XPJA 1S2BA 1WCDJ 1WCUA 1DZQA 5F2WA 2DURA 4YGEA 1HRI3 4XJ9A 3URFA 2K46A 4CCMA 1QJY3 5ABJB 5JMCA 2EXJA 1E5HA 2DF7A 4Q26A 3VZMA 1V6IA 1W8HA 2XL7A 3JB4C 5FZBA 1PM7A 4XDQA 1Z7S1 1UXXX 2XXZA 3JQXA 4A42A 1K5JA 1OKOA 3UGGA 2QQIA 2PELA 3VBRB 1RUH2 4Q4W2 2VZQA 5F3GA 2ZBJA 1PO23 1LRHA 1DZTA 3P6BA 2VR4A 4P9WA 4CDUC 5FMBA 4O65A 1FPN1 2BFUS 2VQUA 2A70A 3WDWA 1JZ4A 1FNYA 4V2WA 5GM0A 1UL9A 5FPUA 1NQDA 1W8NA 2CNAA 3ZFEB 5L9BA 1R081 5E88A 1W3XA 3R0RA 3AZWA 3WT3A 1QJEA 2X53S 3PIJA 4OQ8A 4BIFA 1LTEA 1U5ZA 2WQZC 2B5HA 3DF0A 4Q4V3 5SV5A 3NV3A 3LWCA 2IFRA 1MQTC 1OBNA 5FLJA 1DCSA 4FPOB 3WDUA 2WNUA 5BPXA 5BNPA 2JDKA 2R6QA 1KQRA 2G9FA 4OZXA 4ZXEA 2DCJA 1AR83 4H7MA 2W1SA 3SXWA 4W4ZA 2ZX4A 2LUWA 3ZFFB 4F83A 3ZM8A 4HK9A 1S0JA 4FFHA 4COYA 4FOYA 3Q8FA 2JDMA 2PHWA 2JD4A 3W9AA 1WBFA 2ZGMA 3BPSA 1PIV1 1RJ8A 3SH5A 4AI8A 4IL7A 1E5RA 1IZ3A 2RM23 1JYIA 4XBLA 4ZZ5A 1ZM1A 1V9U2 1SQ4A 3G6JB 3SEEA 1XRUA 1NZIA 2C24A 1QJX2 1YFWA 2VC9A 2W0XA 4PJYA 5D1IA 1S0EA 1EY2A 2P3JA 5DDJ2 3RZJA 1H8TB 1VBA3 3WOGA 4BQ1A 5GZEA 4AQSA 1LJ7A 1W99A 4Y4YA 4IV3C 5EJZB 2VCAA 1Y3TA 3ZPYA 2YC0A 5GLTA 5FXZA 1W0OA 4W65A 1DU3D 5CFCC 5LA0A 1BLZA 5FY0A 5HCBA 5LATA 4CU8A 2WC2A 5H9PA 4CUGA 1HIXA 1UPSA 1XE7A 1E5SA 5EQUA 2G19A 1WCKA 4XIOA 3JD72 4S2GA 1XYOA 1J83A 3B9IA 1Z7S3 4UXAA 1POV1 3T0AA 1PK6B 2WIIB 4LQRA 3NNFA 2ZGKA 1YFYA 4E4DX 5DAWA 4CP2A 4CDWA 3N35A 3VBHB 4ZKTB 4AHYA 1SACA 5FZOB 2HWC2 5A7OA 2VCBA 3KD4A 1JBCA 5HV4A 3O1MA 3ZN4A 2NP0A 1RL3A 2ETEA 3ZSEA 2DCYA 2WSUA 1QEXA 1UOBA 2DVAA 1ZBA2 2H6BA 3AZZA 3I54A 4NWVA 5E1RA 1N1TA 1WUVA 3T1MA 3GHMA 4Z2AA 2GC2A 1C28A 3IB3A 3PTYA 1HXS3 4GKXA 2RS53 4ORFA 4YFWA 3T2TA 1GANA 3RG0A 3MV11 5JSPA 2MEV1 2R7EB 4XFIA 1KDKA 2JB8A 1WMXA 3BKZA 3PVEA 2VM9A 3I2GA 4IERA 1ND2A 2LS6A 1AF9A 4AWDA 2QZ2A 2XJSA 1YUDA 2Y6JA 4NO4A 3ZSLA 1BEV1 3KWVA 4MXWA 3BGAA 4LBNA 5IVBA 1VBB2 1SPPB 4KQ7A 1KEXA 3FZ3A 3K51A 4RHV3 3TNQA 3VBOA 4CXYA 3OGGA 1UQXA 2D5HA 3N9OA 4ARYA 1O8SA 5ANQA 4IE0A 1FX5A 3UL2A 1QDCA 3PLQA 4YG6A 3POSA 1PMHX 3I2FA 3LA7A 5DPNA 4ASLA 4QAWA 2XVLA 1CAUA 2VULA 2Z42A 1CN1A 3AP4A 3MIEA 5H9RA 5K4LA 3CJIB 4ZY9A 1DQ4A 1NZCA 5BNOA 3ZKYA 5DMYA 2JDUA 2O8QA 3A0NA 3JZVA 3LDRA 3SCFA 3UGHA 3PJYA 2G4IA 4DPNA 3BTXA 3BIEA 2WS92 1SLBA 5CIRA 3BCWA 4D6QA 2F6BA 4KWKA 3T09A 4MV2A 3ZXDA 1URXA 2WWSA 3D5OA 4N8MA 4FPHA 4QU1A 4QMAA 5ACA1 4RR3C 1QY4A 5BUVA 3A0KA 1SLLA 2GNBA 3BVCA 3I2JA 4Z07A 4LBQA 2XOMA 4IEVA 1PZ9A 2OQ7A 3AK0A 1UPIA 5K0UA 5CG8A 4AZZA 4Q4X2 4NAMA 3S30A 2ZAAA 4GZ9A 4XPVA 1RVF1 2GNMA 1F31A
chains in the Genus database with same CATH topology
2D3PA 4B8EA 4YM1A 5JZGC 2LM3A 2RS33 3JBG2 3ZYRA 1NOVA 4XEZA 4AI3A 4YZ5A 3LSDA 3Q9OA 3VBFC 3QLQA 3ZVXA 1NG0A 4ZU4A 3ZXKA 3ENRA 5JOYA 3ZN6A 4GB33 4M3CE 2CGNA 5IK4A 3TN92 1YI9A 4EN7B 1OI6A 1Q8PA 1QOTA 2AGSA 2VW1A 2BEOA 2WT2A 3DGTA 3N7KA 1FMD2 1IGOA 3O0VA 4QM9A 1AZDA 1KS4A 4I09A 1DQ0A 4EN9B 3BB6A 3FJSA 1YFXA 4QQLA 5I0UA 5J37A 3J4UH 3R6SA 4Y1UA 4YZ2A 4B4PA 5K7PA 2DV9A 1W6MB 1C1FA 3VZJA 2HWE3 3RMYA 3VKNA 1UMZA 2A7AA 3O5SA 4QPGA 4RSUA 5HBAA 3OJBA 4OHXA 3ZFGA 5J09A 2ZGNA 5CVRA 4YGBA 2DWRA 5A32B 3J9SA 3AJYA 5H9QA 3IDBB 5AFEA 5FO8B 4Y1YA 5AFBA 1R1A2 4UW6A 1T6GC 1NCQC 2P17A 2Y38A 3M3EA 3RSJA 2HWF2 2PFWA 3L9JT 3UK9A 1ND3A 1J3RA 3JUUA 5GZFA 1BZWA 2UYBA 5IK5A 4GIQA 2ZMKA 1V6NA 1IS3A 1AL22 1C8M1 4JV4A 3X29B 1QOSA 2EAKA 3ZYJB 3R4SA 3R4DB 1MEC2 1LCLA 1VBD1 3LB9A 4CEWA 1DLLA 2WQ4A 2GNTA 2K2SA 4CP1A 1KITA 4CDXC 1VB2A 1RMU1 2WFF2 5A33B 3ASIA 1UAIA 4R4ZA 4WVMA 3WG1A 2BGCA 1VALA 1F8VA 4PDWB 5L7OC 4COUA 1FI2A 4YVSA 5E16A 4IV1C 3RI9A 2I07B 4CEYC 4YW4A 3VBSA 2ZX1A 2G9GA 3MPPG 4GQ7A 3IPVA 4TWTA 2JJ6A 4KU7A 1VB4A 3BODA 3WG3A 3RPQA 4P9YA 2IFWA 4UW3A 1G7YA 1WLTA 4JGYA 1UN1A 3I4IA 3GZAA 1C57A 2NQYA 2BVBA 5GLWA 3ECQA 3THTA 4QQHA 4QPIC 1MQTB 1CVNA 1Q8VA 3OD4A 5FO7B 1CGPA 1LGNA 2XBO1 1JN2P 4N43B 1BMV1 2TNFA 3ELNA 3JQWA 4JDNA 5I0TA 2QJVA 2XLFA 4LBOA 3WQ1A 1RUF3 3EJKA 4YVWA 1R082 1H2LA 4YFZA 1REDA 1OKQA 1UW8A 5KXCA 2QDRA 4OHVA 5FPZA 1R092 1Y9QA 4TLFA 3NKTA 3QH6A 1RUC3 2ZA9A 5AVAA 5JDBA 5JPMB 3OBRA 4XFGA 4ISQA 4G9SB 4HZFA 3WQ7A 4NPRA 1AR93 1LODA 4IEYA 3RZZA 3SH3A 2D6NA 3WLUA 1NXD1 3SLIA 3FLRA 3M3CA 1EAH1 4RQPB 4PLMA 3JB8A 3MW4A 3N3HA 5CFDA 3ZXGA 2R061 2TUNA 5T54A 2AENA 1QQP1 1S0CA 2GC1A 3KB5A 4GMP0 4LBKA 2WNEA 1UCXA 2NPIA 4LA2A 4ISRA 2Y26A 3BOWA 1OOPB 1VBE1 4NVPA 4BA6A 2C0ZA 1HKDA 2XVKA 1C5HA 1COV1 3SNMA 1RUD3 3EHKA 2ET7A 1LOFA 2BNNA 4FPLA 4DZGA 5KXEA 2XJUA 5E8AA 2D6LX 4AFAA 5C4WA 4W6YA 4Q4W1 4WM7A 1IKQA 4AFCA 2PHRA 4U2AA 2C5DA 2D97A 2GU9A 1EPZA 3WDXA 1O5UA 1NA1B 4XMAA 3ZXEA 1IS5A 1D0GA 1QJU3 4XOGA 3ZXLA 3MFCA 1DQ1A 1QXRA 3U0ZA 2QQPA 5JOXA 1U0AA 2R16A 1UKGA 4Y26A 2ENRA 4N90A 1S1AA 3OGJA 1UF2C 3B93A 4P9IA 3VBUA 3VBRC 3VL9A 4GWMA 1O3SA 1DYPA 4FT8A 1ENRA 2DUQA 2W08A 2PHXA 4AQTA 3GHNA 2ZX2A 2XLGA 3ZFEC 5EV7A 1BEV2 5BNPB 4EN6B 3NAPB 4I0AA 5FLIA 1B09A 2ZCWA 2IXIA 1ZZBA 4RS5A 4A7KA 2PAEA 1DQ2A 1V9U1 1IKPA 2AH2A 5FBZA 3FUOA 1VRH3 4Q0SA 1JUHA 4FTEA 1RITA 5FPXA 1ULCA 5DDJ1 2XLAA 2R0HA 4KL1A 1W0PA 3LA2A 4R52A 3ZFFC 4FOVA 4L92A 4Y1ZA 5F6LB 1SBFA 5KHIA 5LK7B 3WG4A 1RUI1 1JH5A 3B3QE 1GYKA 1PNGA 5JOWA 5ACA2 4E2SA 4KGGA 3AP7A 2C1FA 2Z79A 3H3ZA 1H8TC 2ZHLA 4LO4B 5BY5A 1RUH3 1DF0A 4W6WA 4XTPA 3B69A 2HWC1 2X5IB 5D8AA 1WMFA 2DCZA 4DOUA 2HWB3 5DUXA 3MFAA 2YHJA 4L97A 4BLJA 4F7ZA 4FPFA 1RUE3 2XG3A 4SLIA 2WNVB 2PLV1 2XWJB 1PGW2 3H1WA 3KSCA 3MIFA 1EV12 1GLHA 1A8DA 2OW4A 2UU8A 1QKQA 4AVBA 4WVWA 1AYN1 3ST7A 2QZ3A 2XUMA 4M0HA 4L9BA 1RC6A 1Y7BA 1ZBE3 3E5UA 5JAXA 1VBB1 5IT6A 5DZGA 4XYXA 1OLQA 1MZ5A 3QD6A 2JEMA 1QJX3 1Z78A 3RMXA 1BBT1 1YFUA 3WP6A 3O14A 2WS91 1X36A 3MIDA 4KGQA 1ENXA 1CAUB 4Z8BA 1AR61 3O7OA 2XH6A 4C1WA 4FBFA 1BQPA 1DGRN 3NV2A 3ZMNA 3JD73 5A3LA 2Z5WA 3CJIC 2BWCA 1LULA 2WA4A 4AHXA 1H1AA 3U4XA 4Q4X1 1HLCA 4AEDB 3GF6A 4HSLA 4LO5B 2DU0A 3ZYIB 3TRSB 4FPCA 4IV1B 2HWC3 1CX4A 2Y0OA 5FCCA 4MX3A 4QQOA 3NL1A 3WX5A 2PA7A 5L19A 4HKWA 4CRQA 3ATGA 3D6EA 1MS3A 2DVGA 1ZBA3 4XMIA 1Q3EA 4PIZA 2XWBB 1AR72 1PVXA 4FPGA 2QKDA 2GMMA 4HPKA 4YZ3A 1AX2A 3TN91 1SFYA 1H2MA 2D40A 4AI2A 5KXBA 2CWMA 1FMD1 5LRSA 4K6BA 4WZCA 3VDDB 2BNOA 3VKMA 2B39A 5DUUA 5FOJB 1TME3 4AGVA 3MF6A 3AP6A 4LNVA 2DTYA 4FAHA 4YGDA 1XNDA 4AI0A 1FATA 2XB6C 2ZJCA 3EBRA 2ES3A 1BVVA 1DIWA 3RJRA 3N7LA 1RHI1 2KXLA 1CQ9A 1UU4A 3LGRA 4JGZB 3EQEA 1SBDA 2A3WA 3GZUC 4LBQD 1ZZ7A 3FC0A 4P9LA 1OFSA 4QPGB 4IXLA 5F6KA 4YYOA 4FQ4A 3GNEA 3V65A 3AFKA 1R1A1 2ZPXA 1LU2A 3R05A 1ZZ6A 3UJQA 3VHPA 3VKFC 4A7YA 3B7MA 4NHMA 2CV6A 4OI4A 2HWF1 4MVTA 3VV1A 1H1IA 1YJLA 2ZS6B 4IEZA 1XYPA 2RMU2 2EIGA 5JCTA 5KBFA 1O4YA 1QGLA 1ND3B 1MEC1 1VBC2 2ZOEB 3JBG3 4XJUA 3NO8A 4N53B 4AFDA 4YG3A 1EAH2 2VQ0A 3OPZA 4UBHA 3RQ0A 1LHUA 4FXGB 1FOD2 1N1VA 2R1DA 2WFF1 4COWA 4AVSA 4Y20A 1LOBA 2XVGA 1PVC3 1QJZA 1QQP2 4FOWA 5FO9B 2JG9B 1AJKA 1PZ7A 2ET1A 3M3IA 1G9BA 2VNRA 4LUKA 3H7JA 4NOTA 5CFCA 1VBE2 4AVCA 2C9AA 1HX6A 2RHPA 3MEPA 4JTOA 4YGCA 1COV2 2VY0A 2BFUL 2GSYA 5GZCA 3VBSB 4PDWC 4W6XA 5JIAA 3WUCA 2ZX0A 4N7IA 1NXMA 1KD7A 1KJRA 4DB5A 4XFFA 5A3MA 3KMHA 5E89A 4JCKA 2HWD2 4OHYA 3WNXA 1PGL2 5C8CB 1LGBA 2JKBA 3QACA 3DPRC 4R9DA 1FXZA 1ULFA 1BJQA 2VNOA 4J6GA 5T55A 1RUG2 1YIPA 1W6QA 2ZHMA 2JG8B 5KHKA 1BK1A 2ZAHA 3CEWA 1R091 1S0IA 5CG9A 1N47A 4M3CA 1GZ9A 3FHIB 3DN7A 1AL23 1RUJ2 1FNZA 2B9UA 2QUOA 5BXXA 3PVNA 4HBNA 3WQ0A 4COVA 3J8F3 2A6ZA 4QGNA 4K1YA 2B42B 4CDQA 1AYM2 1POV0 4OLLA 2UWAA 4N43C 2PAKA 5GLZA 4YM3A 5FMOS 5CU1A 2YUEA 3HR9A 1SLTA 4URTA 4XQ4A 4LLOA 4YW5A 5J98B 5B2GB 1D4M2 4INDA 4FAGA 2R072 1ASJ2 3CU7A 5CFDB 4C0HA 3N7JA 1U5YA 3OTFA 4FP2A 2X29A 4D94A 1IQAA 4RQPC 2CAUA 2GN3A 2RS13 5F5QA 2ZTNA 4RR3A 4JTNA 4JDMA 4I0WB 1RUI2 2MPFA 1OA2A 4A2UA 2SBAA 1HRV1 4S2DA 2FHRA 5T52A 1FV3A 4EWEA 3V64A 1CAXB 2DCTA 5GLVA 4I0BA 2EXIA 4COZA 3B94A 1ZRCA 1TQ5A 1CPNA 1OOPC 1M4WA 2ZACA 3IBMA 3O0WA 3IWZA 5JZGA 3QH7A 4HN0A 3ZSJA 4PBPA 1D2QA 1FPN3 3VBFA 3MW3A 1OA4A 5C4WB 3E6DA 5LEKA 1KRIA 2Q0AA 1R083 2LALA 4GXLA 4EN0A 3R4UA 3D82A 4P9JA 1ULEA 4ITCA 2PLV2 4YSFA 3VLBB 3BALA 3AX4A 5JLVA 1WW7A 3INAA 1REFA 3KT4A 3LZZA 1AYN2 4YW1A 5SV8A 3UJOA 1NA1C 2FMDA 3I8TA 3FWEA 4LO8A 3M3OA 4I3PA 3AM2A 5AC92 4AGGA 4M3CF 4AYUA 4N9IA 1TMF2 4DY3A 5CBLA 4OULA 1PIV3 4EWAA 4XILA 2PHUA 4OI2A 3I59A 4R8HA 2H0BA 1BBT2 1AVBA 1U5IA 3TBDA 1OQEA 2WZR2 3WCRA 4OVEA 4GH4B 5BNPC 4AK3A 3NAPC 4HVRA 1AR62 1NCQA 3IKWA 4AVTA 1V6MA 1WW4A 3ME2A 4BMEA 4J1WA 2RJKA 4S2HA 4LBJA 2R49A 1W6PA 1SEFA 3U10A 1C1LA 4H3WA 1GICA 4I30A 2WLPA 3QOPA 1POV3 2D98A 1ULGA 3B00A 1XU2A 5T5LA 1H30A 2P37A 2ZX3A 4XQWA 3ZSKA 1NCRB 3E97A 4LLFA 1YWKA 1W6OA 3VHRA 4CDXA 3FLTA 3M70A 4QQ2A 4AG4A 1K5MA 4XZPA 1O4TA 3AZXA 5HCFA 4WVZA 4FOQA 3PVOA 2A73B 5L7OA 2CGOA 3NV1A 1PGW1 3WW3A 3ZIXA 1EV11 3P3PA 4R4XA 5T50A 2P34A 4CEYA 2WINB 3MYXA 2MEV3 2F4PA 2RR11 1H4GA 2X5IC 3DUIA 4I01A 1WLCA 1G86A 1SLCA 4I3GA 3HN1A 4L99A 4Q8LA 3RJ2X 1DZRA 3RNSA 2VUAA 1V70A 1BEV3 5TSWA 3RI8A 2OUJA 2WZPP 4Y24A 3HD8B 2WNVC 4E27A 3BU7A 1GQGA 1J1TA 4A7ZA 5T5PA 2ZGQA 3HAGA 1RHI2 4Q4Y2 5KC5A 1JW6A 2AZ5A 4YG0A 1H1MA 5F1RA 2DYCA 1QXJA 1LENA 1VLNA 3NVCA 3M2MA 1OA3A 2SLIA 2BYVE 3H9AA 1MZFA 2ZZQA 4KU8A 2H0VA 1HV0A 4Y1XA 4G3YC 3GBFA 5KWRA 1RJ7A 4Q0VA 5J48A 1NE4A 3MF9A 2XHKA 2UYAA 3ZSMA 5ACA3 2TEPA 3VZLA 1D2SA 1GFF2 1SBEA 4WV8A 5KXDA 1QJY2 4FCAA 1BXHA 2NYYA 2WKKA 1ZRRA 2CTVA 5K8SA 2GN7A 4NHLA 4JDOA 4IETA 5EZWA 1RVF3 3C3VA 5JI7A 1UX6A 2CGPA 4QGLA 1PO22 4MSVA 4XFCA 2A6YA 3WCSA 1AR71 4PQ9A 3WW1A 1OPOA 3M7AA 5FOBB 3MIGA 4BIOA 2A6VA 4IEPA 4AEDC 3V0AB 1S55A 4I2OA 4U36A 3KCCA 1WLWA 2R0FA 1SCRA 2VOVA 3BIWE 4HPKB 5BV6A 5C9AA 2A3XA 1SLAA 2WFPA 4B7EA 4ZU5A 3AYDA 5FQ0B 2NN8A 4Y22A 1UZZA 4Q1PA 4FTBA 3DPRB 2XJRA 1WA4A 4LEJA 2Z69A 4PCRA 2RM22 5J96B 4JQRA 3AMMA 4HSJA 5KC6A 3AFGA 3VDDC 4RGAA 2ZGRA 2BQPA 1GNZA 4JVAA 3FBMA 4EN8B 5ABJA 4DXZA 3USUA 1H8VA 5L36A 2D3RA 4KWLA 4LTAA 2Z2SB 4JGZC 3VBRA 2UURA 2RMU1 3ILFA 1APNA 2V5YA 2XJQA 3AKTA 4QPGC 1MS0A 3OY8A 1C8M3 1DGLA 3WXPA 5BNNB 1VBC1 3V56A 1ZREA 2FZ1A 1VBD3 5J36A 1B35B 1ZNPA 2E7TA 4GKYA 4HVOA 1FOD1 3ZXAC 3UKNA 3VZKA 1RMU3 3ZMOA 1OFNA 3AKSA 3S7IA 3OF1A 4OI1A 1WGPA 3S6PA 1NLSA 1F5FA 3B5LB 3OBTA 2ZABA 3ZFFA 1HXS2 1MS5A 3HWJA 1ND3C 1LOAA 4NN0A 2ERFA 3L2HA 2ZKLA 4N53C 3H8UA 2XJVA 2VVEA 5GALA 3MGUA 4DS0A 4C0BA 3H3UA 2DCKA 4HKOA 2R041 4OI0A 4RHV2 3T1LA 4DRVA 2Q1ZB 3WP5A 1HRV2 2JG9C 3LAGA 3I7DA 4XBNA 1ZX5A 4CZSA 1NYWA 2HWD1 4PIYA 3VHNA 1PO11 3JU9A 4EV0A 1LESA 1SCSA 5J7MA 1PGL1 2ZKNA 4YVSC 4HANA 1N3PA 5AVPA 1C8NA