2B7YA

Fava bean lectin-glucose complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
181
structure length
181
Chain Sequence
DEITSFSIPKFRPDQPNLIFQGGGYTTKEKLTLTKAVKNTVGRALYSLPIHIWDSETGNVADFTTTFIFVIDAPNGYNVADGFTFFIAPVDTKPQTGGGYLGVFNGKDYDKTAQTVAVEFDTFYNAAWDPSNGKRHIGIDVNTIKSISTKSWNLQNGEEAHVAISFNATTNVLSVTLLYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Favin beta chain
publication title Three-dimensional structure of favin: saccharide binding-cyclic permutation in leguminous lectins
pubmed rcsb
molecule tags Lectin
total genus 19
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2b7yA00
1DQ1A 4PF5A 1LHNA 2GMPA 3I4IA 2FMDA 5GLVA 3VV1A 2ZA9A 2ERFA 4LBNA 1LGNA 2CWMA 5E89A 4Q8KA 4DQAA 1MS0A 1DQ2A 5FREA 4GKYA 4YW4A 1YRZA 1FYUA 5DUUA 1LULA 3LCPA 3BOPA 1JXNA 1Q8SA 4WVVA 4Y22B 5CBLA 1Q8PA 1UZZA 2NMNA 2W39A 3POSA 3INAA 1MVEA 3N7KA 3DUIA 2DTYA 2E51A 3FLRA 4ISQA 1PZ9A 3WUDA 4Q2FA 5SV8A 2V73A 4OZXA 3WDVA 2A3WA 2E53A 3O0VA 1AJKA 1G7YA 3AP6A 5IUQA 2D6LX 3T1MA 1GSLA 4F83A 5T5PA 2UWCA 2DVBA 2DU0A 4YGDA 2AENA 1N1VA 3SNMA 1C1LA 3T1LA 3WVJA 1G9CA 4Z8BA 1WCSA 4ISRA 4R9CA 3OYWB 3WG2A 4XBNA 2A6VA 3FUOA 1KDKA 1LENA 2DVDA 1G9AA 3PVNA 3OJBA 1FNZA 3NV4A 2PHTA 1Q8VA 4P14A 2ZGRA 4FOWA 4ATEA 3AP4A 1S0EA 1WLDA 4M3CE 4XJAA 1F31A 4FPOB 4Y20B 1S1AA 1G86A 1RINA 2PHRA 4XJZA 5JMCA 3WNXA 4JRAA 1DGLA 2Z42A 1LEMA 2ENRA 2R16A 3V64A 1W6OA 1GANA 1SLCA 3D6EA 4AYUA 4GWNA 2EF6A 1MZ6A 5GM0A 2ZGLA 2LALA 4FVVA 5EYXA 1SBEA 2VW0A 5GLUA 3V0BB 1HKDA 5GALA 1YIFA 1LHVA 1FV3A 2H0BA 2YV8A 2GDFA 5JOYA 2ZGNA 1CIWA 2HYKA 4XYXA 1ZM1A 3R05A 4M00A 1LOGA 2OVUA 2JDZA 4YM0A 1S0GA 1Q56A 2NP0A 1MVQA 2JKBA 2PHWA 4M3CA 4UW5A 2RHPA 4YZ4A 2D6NA 1WLCA 2YZ4A 1DQ4A 2DVFA 2ZMNA 4ATFA 2ES3A 2GALA 1N1TA 3APBA 1DYKA 5GZFA 3VKMA 1SBFA 2AGSA 1PZ7A 3ZXEA 1V6LA 2B7YA 2I2SA 5E8AA 3UJOA 1FAYA 2GNMA 4CTEA 5GLTA 5JOXA 1DFQA 2A75A 3IPVA 3UJQA 1VLNA 2ZKNA 5H9QA 1QGLA 1QU0A 1N3PA 1BKZA 1Q8OA 1X50A 1A3KA 4GKXA 4R9AA 3MW4A 1LEDA 2FHRA 5AVAA 5F9TA 1F9KA 1WW4A 4AGRA 1QDOA 1WBLA 1LU2A 1MR5A 4XBQA 1LU1A 2A70A 2WJSA 4FOYA 4XTMA 2V5YA 3VKLA 1LOFA 4BMBA 4XJUA 3MW2A 1YYNA 2UWBA 5LK5A 2EALA 3W58A 2CYFA 3W59A 1Y7BA 5CA6A 4YZ1A 2WT2A 2D43A 1HQWA 4FPLA 1UZYA 4K21A 5DUWA 2ARXA 2A7AA 1MS9A 2AYHA 3RMYA 4K20A 5CB7A 3FLTA 4Q26A 1CR7A 4FPFA 1CN1A 3WDXA 3AK0A 1KDMA 4BM8A 3FFZA 2A6WA 1N3OA 2DUQA 4RL7A 4FPYA 3WOGA 2D44A 4XHXA 1BZWA 2W68A 2ZHKA 4PBPA 4U2AA 4AVVA 1BXHA 1VIWB 5IK5A 2XG3A 1ENSA 4LBQB 3IM0A 2A5ZA 1LCLA 5DUXA 2BQPA 2CNAA 4YGCA 1LHOA 1WW5A 4NO4A 1W6MB 1FX5A 1V6KA 2A6XA 4FPHA 3WG4A 2C5DA 4FQZA 4SLIA 3ENRA 1DLLA 2ZZJA 2WQZC 2KM2A 3M3OA 3R4UA 3LSDA 4YG3A 3TAYA 3IKWA 3WUCA 5KXDA 4YZ3A 3T2TA 1F5FA 4YM2A 1S0CA 1XQNA 1VAVA 1SLLA 4K1YA 5EYYA 3M2MA 1LOAA 1MS3A 3WCSA 3N7JA 3OPZA 3GNEA 2VU9A 2EXKA 2UURA 3ATGA 3AFKA 5BYNA 1GKBA 3TB0A 3O0WA 1UKGA 1WUVA 2P3IA 1YO8A 3ILFA 4ITCA 2CL2A 3DGTA 4Q8LA 1RIRA 4YGEA 3ZSKA 1AX0A 1LECA 1KRIA 2R0HA 2A3XA 1WD4A 3M1HA 4M3CF 4HANA 3N36A 1JYCA 5IK4A 2R0FA 4M01A 2ZHLA 1APNA 3I8TA 2AR6A 3IN9A 4YM3A 1H9PA 1LHUA 1V6OA 2VW2A 3AP5A 4XE9A 5JOZA 5JLVA 1LOEA 3U4XA 1JOJA 4Y22A 1LGCA 3AXEA 4GA9A 5H9RA 3ZSJA 2DU1A 1JYIA 1KQRA 2ZMLA 1ULGA 2WT1A 1Z0HA 1IOAA 1G8WA 3WG3A 5JDBA 1O4YA 4MYEA 1C1FA 2D6MA 2Q5TA 1GZ9A 3A4UA 3RRDA 1SCRA 1N47A 3LSEA 4FPEA 2GNDA 5DZGA 3B01A 5GZCA 1AXKA 3WCRA 2LTNA 2ZGMA 4YG0A 1MS4A 4YW5A 2YROA 1UL9A 3ZYPA 4ASMB 1H30A 2VW1A 5CAZA 1IS6A 2NZ9A 4FPCA 1W6NB 1LJ7A 1YXWA 2EIGA 3MPPG 1V6NA 3OYWA 4XJ9A 1LGBA 3MEPA 4XOGA 3AP7A 1NXD1 3OY8B 4FOVA 2G4IA 4UW4A 3UK9A 4XDQA 4C1WA 4Q1RA 1C4RA 3NV3A 1DIWA 4YW2A 4BPZA 2NN8A 1S0DA 2DURA 4Y20A 1KJRA 3A0KA 1AF9A 5L73A 4ZKTB 3WV6A 2D3PA 4R9DA 3USUB 4BLIA 1LODA 4K1ZA 1DQ5A 1FNYA 2A3YA 2ZGOA 2DVGA 2GNTA 3ZXJA 2E7QA 2GMMA 1W6PB 2ZHMA 4XTPA 2R1BA 2W08A 3V0AB 5CNAA 3WG1A 3QLQA 1ULEA 3H0OA 4XIOA 4XJWA 3V0BA 1GNHA 1G9BA 1GZWB 3OY8A 4BOWA 4L8QA 1UX6A 3WDUA 1O4ZA 2NYYA 3ZYRA 3AYAA 4I30A 3ZPYA 5GZGA 4YM1A 1HLCA 1KITA 5GJ6A 2D3SA 3AP9A 5T52A 5KXBA 1C57A 3RSJA 1V6JA 1W6QB 4JC1A 4Y24A 4Q1PA 1S0JA 4P9WA 4UW6A 3M3QA 3VKNA 4KBBA 1MS1A 2AREA 2NM1A 3QCWA 3AZVA 1MS5A 3UL2A 3V65A 4C1XA 3NV2A 3NWKA 2OUHA 2XB6C 3IMNA 3SITA 3O0XA 3FUQA 1AXYA 1JBCA 2JJ6A 2D3RA 2PELA 2WNEA 4Q27A 5HCFA 4XXPA 2ZBJA 4XIKA 2D7FA 2TEPA 2WSUA 3AX4A 1BQPA 4LBJA 4AGGA 1SLBA 3AYCA 3JU9A 1FATA 3VUOA 1I1EA 2D6PA 1N1YA 2PHXA 4Y1YA 5JVVA 3AXDA 3AYEA 1H9WA 2C9AA 4TZDA 3AJYA 3CNAA 1A78A 5H9PA 5IT6A 1BJQA 1AJOA 1SCSA 1AVBA 1DHKB 5T5LA 1JHNA 1GBGA 1CESA 2P3KA 2JECA 3RS6A 3WHUA 1AX1A 4YFZA 3M3CA 1S0IA 4YZ5A 3SH4A 1D0HA 2A6YA 5DG1A 1GNZA 2CY6A 5IK7A 2P34A 3AZZA 5DXDA 4Y1ZA 4W65A 1QNYA 1RITA 1HDKA 1FV2A 3WLUA 1VALA 1LTEA 4BMEA 3FLPA 5HCAA 4WV8A 4XJ8A 1N1SA 4XILA 3POYA 1SLAA 1WD3A 2P2KA 3PMEA 5DZFA 3AYDA 1LESA 2AUYA 4YG6A 4LBQA 1V6IA 2SLIA 1Z78A 4P9YA 4WVWA 3HN1A 4CRQA 1SACA 1W6MA 2CWSA 3WDTA 4GALA 2ZGUA 3B00A 1QOSA 1GICA 2DVAA 2PHUA 3O5SA 4ZXKA 3WHTA 1R1ZA 1ENRA 1G9FA 1LHWA 1UN1A 2EXJA 3AZWA 2R1DA 4XXAA 3SH5A 3C2UA 1IKPA 1IS4A 1W0OA 3D4KA 3AJZA 3ZSLA 1YI7A 2GMEA 1MZ5A 1SLIA 4BLJA 5DUVA 3ZVXA 4NOTA 3VKFC 3POWA 1EPWA 3D5OA 5EXOA 5DZEA 4Y26A 1UMZA 2ZGSA 5GLWA 3AZXA 4PBOA 3NV1A 3VKOA 4XBLA 1I3HA 1W6OB 4CZSA 2E6VA 1DYPA 4JCKA 4YZ2A 1VAMA 1SFYA 4WZFA 1DQ6A 1Q8QA 2SBAA 1AXZA 1N3QA 1MACA 3AZYA 3ZSMA 1IS5A 3M3EA 2DV9A 2R49A 4FPKA 3MW3A 1QKQA 1WBFA 3PVEA 1JUIA 1QOOA 3RQ0A 2JE7A 2W52A 1CONA 2ZGPA 1IS3A 3ZXFA 1JW6A 3GALA 5EWSA 1TEIA 2EXIA 2UWAA 3A0NA 4LBOA 2AH2A 4M3CB 4UW3A 4P9XA 5E88A 1SBDA 4YGBA 4XMIA 4DS0A 1G9DA 3R4SA 1LOCA 2YY1A 4U36A 1D2SA 1A8DA 3WDWA 4HL0A 1KJLA 1NLSA 3KQRA 1WLWA 1OFSA 2GNBA 3SLIA 1LOBA 2WKKA 2PHFA 3HMYA 5FRAA 1GLHA 1MS8A 3N35A 4FP2A 1B09A 3OBTA 2OUJA 1W6NA 2UU8A 1CQ9A 1J1TA 3ASIA 2ZABA 4YW3A 5HCBA 5F5QA 1ULDA 4Y1VA 3IPVB 2DUPA 5GZDA 2E7TA 2ZHNA 2ZGTA 1QOTA 1ULCA 1DQ0A 1W0PA 2A71A 3ZXKA 1V6MA 2D6OX 1CPMA 3OGGA 5GZEA 1IKQA 4FP3A 1QNWA 2ZACA 3FBYA 4RA0A 4DPNA 5KXCA 2ZMKA 4AVSA 4GXLA 3O12A 4IQPA 4XMAA 3USUA 5JOWA 4TYSA 2ZAAA 3B69A 4PCRA 1WW7A 4XHBA 1DBNA 1W6PA 4AGVA 2DWRA 3JUUA 3PVOA 3ZXLA 3RG0A 4LBQD 2WT0A 3V0AA 2VUAA 5IK8A 3PJQA 2YXSA 4AWDA 2CTVA 2DTWA 3ILRA 4Y1UA 1PZ8A 2JE9A 1GZWA 4D69A 3WDYA 3RMXA 2WLQA 1LOFC 4R9BA 4FOQA 1ULFA 1CVNA 2DUOA 3BIWE 1U0AA 1QDCA 4DFSA 2GN3A 2EXHA 4FPGA 4FQ4A 1CJPA 1W6QA 3B9CA 1AX2A 4YLZA 4PQ9A 5KXEA 1OKQA 5H9SA 1SLTA 4DRRA 1JN2P 4LBLA 5GLZA 5T55A 1HQLA 1GV9A 4XZPA 1ENQA 3HR9A 2GN7A 3ILNA 4YFWA 3SISA 1UPSA 2JD4A 2P3JA 2VXRA 3Q9OA 5T5OA 3N7LA 2A6ZA 1ONAA 1S0FA 1WW6A 3SH3A 2ZGQA 2P37A 5T50A 4AVTA 4BQ1A 1CPNA 1GZCA 1QMJA 4FPJA 5T54A 2OW4A 1QF3A 1AZDA 1UAIA 3L2YA 3N7MA 1S0BA 3OBRA 4GWMA 4YW1A 2DYCA 3WZ1A 2ZGKA 5T5JA 4LBMA 3BODA 1OQ1A 2NMOA 1URXA 5DG2A 2EAKA 1BYHA 4DRVA 4H55A 2VH9A 2YMZA 1DZQA 1V00A 3N3HA 3BTAA 1GYKA 2D6KA 2VY0A 2ARBA 3KM5A 2WSVA 4LBKA 4Y1XA 3B3QE 1ZA4A
chains in the Genus database with same CATH superfamily
1H1IA 3IDCB 4PF5A 1LHNA 3I4IA 1QQP2 4IGQA 4S2DA 2ERFA 4CUBA 4Y5SA 1DYOA 1LRHA 1VJ2A 3QOPA 4IV3A 4BB3A 2IVJA 5E89A 1RUJ3 5KC6A 4B4RA 3OUJA 1DQ2A 1BLZA 1JS9A 1D7PM 4ES9A 5KC5A 4META 1LULA 1OF4A 2XXZA 4WVVA 5CBLA 1SMVA 1UZZA 2J1TA 2VMGA 1HN1A 2XJUA 1CD3G 3HAGA 4LK7A 2QBXA 5FP8A 1OOPC 1OLME 5C9AA 1NA1B 1PO22 3JCIA 1GP4A 3A21A 3H8XA 1PZ9A 3F2ZA 5FLJA 3WUDA 2YG0A 2V73A 4CXYA 1HRI3 1OUSA 4OYUA 2XWBB 2D6LX 1PNFA 3NJYA 1OQDA 4D3WA 2VQAA 2VCCA 4JKLA 2JIJA 4F83A 3FMGA 3ZLIA 3HN3A 5DN2A 2DVBA 5JZGA 1G9CA 2AENA 2IWGB 3T1LA 5JI9A 4URTA 4Q4W1 4R52A 3PJYA 2A6VA 3FUOA 2XJRA 5C33A 2PA7A 3VB9A 3NV4A 4EN7B 1Q8VA 4K7JA 1EUUA 1F15A 2ZGRA 3FFQA 4FOWA 3VBFA 5C3SA 4H2AA 3ZFEC 2UYBA 4LKEA 4Z82A 2Y6KA 4Y20B 2B42B 4XFCA 1NAEA 4N53C 1S1AA 2PHRA 2QKDA 3WNXA 3MLJA 2IXCA 1GQHA 2JD9A 2ENRA 3B93A 5EJ1B 5KHJA 2IFWA 3FBMA 3OUHA 1W6OA 3V64A 4NIGA 5C5UA 3KHBA 5FJKA 4CXXA 1W8FA 3D6EA 3ZFGB 4HZFA 2JIGA 4GWNA 3PMSA 4X6RB 1MEC1 5GM0A 1WZXA 5FY1A 1ZRDA 4QDRA 4QWNA 1HRV3 1SBEA 1CAWB 5FYSA 1RUC2 3TYJA 5IVBA 5GALA 4AFAA 2QE3A 2ZOEB 2YV8A 4D7TA 4YYOA 3PIJA 1CIWA 2HYKA 4XYXA 1ZM1A 4CUAA 3R05A 3TNPB 1DG6A 3GBGA 3LA3A 5G05L 2OVUA 4Q4V3 4OZOA 4FAHA 1Q56A 2NP0A 2BOIA 5LA0A 3ZXDA 2A1XA 5FYCA 2Y33A 3A7QA 3LDRA 2HWB1 4Q4X2 4XW3A 3THCA 1OPMA 2D6NA 4BDVB 1V9U3 1WLCA 2R073 3WF3A 2BRTA 1WKYA 2FZ1A 4XQWA 1PGSA 3V56A 3APBA 3D0SA 5GZFA 2AZ5A 2VQTA 4PLOA 1SBFA 2AGSA 2CU5A 3FHIB 1V6LA 2I2SA 1RVF3 1U5IA 4HBNA 5E8AA 4AI1A 1FAYA 4P08A 2ZXQA 2BWCA 3TRSB 1D0GA 5IFTA 1ND2A 4QQ2A 3AMNA 1J3QA 2ZKNA 5H9QA 2BVVA 2V4VA 4CDUB 3I49A 3KGZA 2HJIA 3MV11 3LIGA 1LU2A 1UQXA 4XTMA 2A70A 2WJSA 4GH4C 4BMBA 2V5YA 3VZKA 4CVUA 4XJUA 4WM8B 1GNYA 3ZYIB 1VBD3 2V4AA 3H7JA 1BVVA 2C24A 3ZKUA 1VBA2 1HQWA 1UZYA 1TMF2 4NUBA 2A7AA 4JX0A 3LEGA 1ASJ3 2BJSA 2VVEA 2YC0A 3T3YA 4Q26A 3VBUA 5I8YA 2I45A 2PFWA 4RS5B 4AL9A 1RUNA 1AHSA 1AR92 1OLQA 2DUQA 1PK6A 4A2UA 1C8M3 2Y34A 3WOGA 4NN0A 4RFT0 1H8TB 4QX8A 1BZWA 1Y9MA 2ZHKA 3NJXA 4XF4A 4YVWC 5F6KA 4PBPA 2KR2A 2Y38A 4PHZA 1AYM3 2ET1A 3BPSA 5CVRA 1RUE3 4CEWA 1PIV3 4HONA 4LXLA 4RGAA 3FN9A 4XF1A 2VNGA 5FP4A 5IK5A 2K2SA 3IM0A 2A5ZA 3OPWA 5DUXA 4YGCA 1US3A 2XDVA 5L7OC 2A6XA 1AR71 1RC6A 3DF0A 1HB3A 3LKJA 5FPZA 3N9PA 4MZUA 2CSGA 3M3OA 1R093 4YG3A 2VBPA 3UGGA 4CCCA 4B1MA 3WINE 1W8TA 3T2TA 1S0CA 1XQNA 1SLLA 2XHKA 5L36A 1W9SA 2R32A 2WNUC 3N7JA 1NZIA 5BYNA 3ATGA 4OCTA 1MZEA 3O0WA 3TWIA 4LUKA 1YO8A 1KS5A 3DGTA 2IXLA 1RIRA 1VRBA 3K3OA 1FI2A 4MUVA 2YU2A 2WZ8A 4JKMA 3M1HA 3JD72 4LHLA 4P5HA 4RHV3 5IK4A 1VRH1 1XU2A 4Y3OA 1NE4A 3CMGA 4JQTA 3VD5A 4YM3A 1JZ6A 3W5MA 1H9PA 1LHUA 3AP5A 2VW2A 3FZ3A 5JOZA 5K0UB 1LOEA 1XBFA 1JOJA 5GKAC 3AXEA 4N9HA 3H42B 3ZSJA 3RNSA 2XJQA 2R042 2ZMLA 1IQDC 1ULGA 2WT1A 4EWEA 1RUI2 3M4FA 4HN1A 1IOAA 1NA1A 3I3QA 3TN91 5FXWA 4N7UA 5BNQA 1NCRC 1C1FA 5EZWA 5FUIA 1SCRA 3NAPB 1N47A 5E6HA 5I8SA 3BTZA 4CU8A 4COYA 2WR9A 1H8VA 3ES1A 1H30A 1QQP1 2IZWA 2W1QA 2ZEZA 4FPCA 1YXWA 1V6NA 5FZ1A 3MEPA 2HBTA 5IHRA 5FP7A 2DCYA 4CU9A 4DEQA 3G7DA 2JDAA 3ME2A 4PI2A 3F95A 5LBBA 2OS2A 4H3WA 1JZ8A 2JB4A 3WQ0A 2O8QA 2OZ6A 3AM2A 3NV3A 2NN8A 4Y20A 1KJRA 3A0KA 1PO21 1RTVA 1VBB3 3AMQA 4ZHNA 1VMHA 3WNKA 1X82A 2K9ZA 2JE8A 1GZTA 4XFIA 1HXS2 4BLIA 4E27A 5ACA3 4FXGB 3CJIC 1UU4A 2BFUL 2AEZA 1O4TA 2E7QA 2P6HA 4S2GA 2DCKA 4ZU5A 5EFUA 3ZFGA 3ZSEA 3KD4A 2VUDA 3V0AB 3SCFA 2YPJA 4Q4Y2 4OI1A 5D21A 3NW4A 3BTXA 1CAWA 4AVCA 4AI3A 1GNHA 5BXXA 1REEA 1XPWA 4L8QA 5FO7B 2X53S 3KF3A 5FDBA 4GMP1 3ZYRA 3M8LA 2WS91 2NLRA 2WNVC 5IWFA 4CCDA 3ZYFA 5GZGA 1HLCA 5KXBA 3AP9A 4GB33 3RSJA 4AW7A 4JC1A 4RYDA 4MSVA 4Z1VA 4Q1PA 1S0JA 4WM7C 3RZJA 3VKNA 1AUYA 3E5QA 4AAPA 1UF2C 3GHMA 4KBBA 2AREA 2NM1A 2R062 2Z4FA 2Y6HA 3V65A 4QX5A 5A3TA 3NWKA 4A7ZA 1A34A 4NIDA 2VD7A 3IMNA 3E5XA 1EP0A 1IG3A 3O0XA 3B94A 3CEWA 2D3RA 2WNEA 4Q27A 4XF9A 3WY6A 3ZM8A 4XFFA 1PHMA 2WSUA 3CZUA 1RUC1 5G04L 5ABJB 1Z7S3 1AR82 2IFRA 4QDQA 4AGGA 4RQPC 2Z69A 5J3UA 1FATA 4W6YA 3VUOA 4CDUA 1WWYA 1N1YA 1SHWB 3ABZA 4NPLA 1LKNA 4I0AA 1O3RA 2C9AA 2BV4A 3H9AA 1A78A 2WAOA 4TXWA 4WM8A 4S2HA 3I3BA 4Q4X1 4FTSA 2VUJA 4QHBA 1CESA 3WHUA 4AFCA 4FBFA 3Q8AA 1X33A 1EAH2 5F3IA 5JUVA 3OBAA 3LOIA 4YVSB 5DG1A 1GNZA 5B4XA 3C7OA 1IPKA 1NX9A 1QIQA 3EQEA 5IK7A 5DXDA 2VM9A 3DXUA 1VP6A 4RS5A 4LA2A 3JB8A 4W65A 3J7NA 4NHXA 1RITA 1HDKA 4XACA 1H6YA 3VD3A 1H8TA 2Q1ZB 3MZHA 4AHWA 2R6QA 2HLEA 1WMXA 1K45A 1ZX5A 3BCWA 4WV8A 5K7PA 1JZ5A 2FCUA 3VHPA 4I0WB 3LWCA 3DKQA 1V6IA 3VHOA 4C0HA 5LWBA 2R7EB 4CRQA 3W5NA 1R64A 2FDFA 1DGRN 4FXKB 2E7AA 2PMWB 1NE6A 3WDTA 1QOSA 1VBA1 3LB9A 3PVBB 4WVZA 3S57A 1OD3A 2QZ2A 2W95A 4FT8A 1TMF1 4ZXKA 3CBNA 3LPGA 5C9AC 1G9FA 4OMDA 2ZS6B 3AZWA 4LKFA 3DYOA 3K3NA 2PQSA 1XJAA 3HT2A 2FDGA 2WO2A 1IKPA 4FFGA 4BHPA 1FMD3 5FZ7A 4UFKA 4GD4A 5DUVA 1AR91 5EJ3A 4NOTA 1AR63 3UYJA 4QX3A 3D5OA 3BU0A 4E2SA 3MICA 4FO9A 5EXOA 1QJX2 3ZYBA 5JZGC 4Y26A 2BDRA 2ZGSA 5GLWA 3AZXA 4BK4A 3NV1A 4RN5A 3VKOA 1OT5A 2PAEA 3RZZA 1LAJA 2L9LA 4YZ2A 3OTFA 1JYWA 2WUHA 4B4QA 4CCKA 1HJGA 1DQ6A 1Q8QA 2X09A 1V70A 4Q0SA 5FZBA 3T09A 5CYYA 1Y9QA 1DLCA 1BEV3 1MACA 1N3QA 3QH6A 5FMCA 3VBFC 1GWLA 2BBAA 4BQ3A 1EV12 2K0GA 4FPKA 3ZYGA 3O1PA 5K0UA 3ZFFC 4ZZ8A 1JUIA 4MGKE 1ZNPA 2JE7A 2VMCA 3OEBA 4HKWA 5DAQA 1NYWA 1QJFA 3VDDC 2ZGPA 2KXLA 3GALA 3HJRA 5EWSA 3ZN4A 3A0NA 1AYN2 1UPIA 3ACLA 4M3CB 2E9QA 1ZRRA 3H50A 4XMIA 3J8F3 1G9DA 2JDUA 4LK6A 2Q8EA 3NAPA 1V0AA 1JZ7A 1A8DA 1PVC2 1JUHA 4CP0A 1WCKA 5LA1A 1HB2A 1JZ4A 1NG0A 4G3YC 5A3PA 2VZUA 1OFSA 5DMYA 3SLIA 1LOBA 3R6SA 2FZ2A 1GLHA 2GU9A 3DYMA 2EIDA 1YNAA 2RS52 4IGOA 4UAPA 3JD71 2J7MA 3ASIA 2ZABA 3HVDA 5FYIA 3ZR5A 2CGNA 3VD4A 3LEIA 4QPIB 2E7TA 2ZHNA 4JV4A 1TE1B 3O1TA 1QOTA 5F5IA 3THTA 3ZO0B 1RUJ2 1W0PA 1XE0A 4OUEA 1QJY3 4MGZE 2R041 3OGGA 5FZOB 4AXOA 3AKRA 1IKQA 3MPBA 1U5XA 5KXCA 3FBYA 3LAGA 4MLOA 4RA0A 5I93A 4I2OA 4CPBA 3O12A 4LUMA 3RWNA 3U14A 1T6GC 2RJLA 4LTAA 1W8WA 4MHRA 4XETA 2ZAAA 1WW7A 1X36A 3RZLA 2BOJA 2VBDA 4AGVA 1ND2C 4Y4RA 3PVOA 3WW3A 3RG0A 3ZXLA 4BK5A 2VULA 5HBAA 3V0AA 2VUAA 5CFCB 1BBT2 4R4ZA 3T30A 3ILRA 2DTWA 4BQYA 5JSOA 3WDYA 2WLQA 5FMDA 3RZGA 2DUOA 2Q8OA 5FUPA 1OMIA 3BIWE 1U0AA 4CP1A 3ES4A 3ACIA 4FPGA 4FQ4A 1DGRA 2Y6LA 4AVAA 3B9CA 2W0XA 1W8OA 2VZ1A 5A6QA 3POEA 3UGFA 5A3NA 5KXEA 5FZ4A 4QPGB 1SLTA 2XUEA 4E4HA 1JYVA 3BPZA 4OI4A 4LBLA 4XUNA 5FZ6A 3IBMA 5GLZA 1YHFA 5AC93 1HQLA 1GV9A 1HXS1 2ADEA 1VBC2 3NJZA 4K3UA 4XZPA 5I0TA 2JD4A 2P3JA 5FK7A 1K5MC 1E5RA 1R1A2 1UY0A 2A6ZA 1PK6C 1HN0A 4IEWA 2P37A 5T50A 4AVTA 5T54A 4OHZA 2OW4A 2UYAA 1UXZA 3GGLA 3MDPA 1AZDA 2B9UA 3ON7A 4HVOA 1PO13 4Q4Y1 2IXIA 5IATA 5ABJA 4NRMA 5T5JA 4CEWC 3IZOA 4AEDB 1XSQA 4KBZA 5DG2A 3DL3A 2XOMA 4D7SA 4CCMA 1HRV2 4H55A 1DF0A 3CJXA 4WZCA 1VAKA 2OZJA 1V00A 1QXPA 2Q4SA 2VTFA 1YQ5A 2XLAA 3BN6A 3BTAA 5F7UA 3TEZA 2ARBA 4PT6A 2WSVA 1DU3D 4Y1XA 3B3QE 1ZA4A 4IDZA 1CWPA 4W50A 2TBVA 3O1VA 4PDWB 4BISA 4QKDA 3OSDA 4CDQB 5KHGA 3LQCA 1OPOA 5GLVA 3C7HA 2R061 1RUH3 5D8AC 3C3VA 3JBG3 4JGZB 3MIEA 5FREA 4YW4A 3DPRB 4YVSA 1YRZA 3SHRA 3JQXA 3K4DA 5DUUA 4Y22B 1POV3 2RM23 4GIQA 5DAVA 5IVYA 1Q8PA 4UT5A 1Y4WA 2NMNA 3NVCA 3POSA 3N7KA 1X7NA 3T0DA 1YI9A 4XPVA 1AR81 1JYTA 3FLRA 4Q2FA 3RFRA 1TQ5A 5FBJA 4OVEA 4NRPA 1G7YA 5IUQA 3BTYA 4L11A 1GSLA 5KHHA 1XSRA 1RMU3 2GH8A 3N9QA 4DO0A 2CGOA 5A1AA 3NQHA 1GMMA 2GC0A 2UWCA 2KA3A 2X5IA 3ZX7A 2DU0A 4DXTA 3UNPA 2PLV3 3GDBA 3WVJA 2OXBA 1ZBE3 2X10A 5IJRA 1P8JA 4BIFA 2WWSA 3EMRA 1SEFA 3AMPA 3OYWB 1L3JA 1EAH1 5JR7B 1JU3A 2DVDA 1G9AA 1YQ8A 1NA1C 2JEMA 1ZBA2 4P14A 1WA6X 3WW1A 5JCTA 4SBVA 3KHCA 1ASJ2 5IAXA 2K46A 1XRUA 1YJLA 3GXUA 1O3TA 3H3ZA 3KV9A 3D3AA 4XJZA 1RINA 3O7OA 4LE3A 2GP3A 1QJU2 3BUCA 3S5AA 2RDSA 3WP4A 1DGLA 2Z42A 4OI2A 4LNVA 1TVGA 2R16A 1TNFA 5EQUA 1DDLA 2AACA 1SLCA 4XFHA 4YARA 5BNOB 3CF6E 4GQ7A 1ZVFA 3NNMA 3ECQA 4OULA 5DQ0A 2ZGLA 2LALA 5EYXA 5KBFA 2VW0A 2WFF2 5JIAA 1BMV2 2QQKA 4N8MA 2MNGA 1LHVA 2GDFA 2ZGNA 4P9GA 2R30A 4JHTA 4UOJA 1JOPA 2OPKA 5ISLA 4M00A 3LZZA 1LB2A 1PGL2 3UKNA 4YM0A 1DP0A 1JHJA 5JIUA 4M3CA 1CIYA 1EPZA 3PUHA 4UW5A 1ZRIA 1COV3 3VHRA 2RHPA 1UCXA 2DFBA 4MGYE 5FY9A 4HSJA 3ZFGC 3W21A 1QJX1 5FYMA 2DVFA 1D4M2 5KHKA 1N1TA 3VKMA 1UYXA 2NQYA 1PZ7A 3DECA 5CG8A 5JXJA 3QH7A 3UJOA 2AC1A 5K8SA 5GLTA 2VO5A 5JOXA 2HWD2 5C3RA 4QPIA 1EV11 1VLNA 3AL6A 1QWRA 4LORA 1SFPA 4R9AA 5A6XA 4LO7A 1FPN3 5F9TA 3POBA 2Y6JA 4MGIE 3VZMA 2GP5A 4XBQA 3HPNA 5FZOA 5A7SA 1UZ0A 1LOFA 2G1MA 2HYXA 1AYN1 2RDQA 4KH9A 4E9KA 3N4MA 1ZRFA 1YWKA 3DKWA 1PM4A 4BU2A 2Y6FA 2CYFA 1Y7BA 5F3GA 5IW0A 1ND3B 4F8AA 1PVC1 2D43A 4IE7A 3VBSB 4DXZA 4FPLA 4F3JA 4Z2WA 2ARXA 2JKXA 4D0QA 3OD0A 4QHOA 2BNMA 3UETA 3LIHA 3ZN5A 4AVBA 2BERA 5A80A 4COZA 2RS51 5CFCA 4FPFA 1YLLA 5A7QA 4CDUC 5LZ6A 2VL4A 1BVP1 4RL7A 2QUOA 1OSGA 2PAMA 2KD7A 4D6SA 2VZ3A 2XBO2 4CCEA 1NY72 2WZR3 2I07B 2VOKA 1BXHA 1VIWB 2XG3A 1ENSA 4LBQB 5FY7A 5JPNB 2BW8A 2BQPA 1CZVA 1UW8A 3M3IA 2IXHA 2RR13 4NO4A 4PLNA 1W6MB 4EYUA 1V6KA 3MIHA 5FMOS 4FPHA 4BQ4A 1W3XA 4HKOA 1D2QA 4UFIA 5FKBA 3URFA 4RS5C 4IE0A 1IG0A 1DLLA 3ENRA 4LE4A 1PVXA 4LKDA 2VQ0A 3VL9A 5L9VA 1H8TC 3IKWA 2DFCA 5DAXA 1BBT1 1F5FA 4XUQA 1VAVA 4AEDA 4CEYB 2JDNA 1UOFA 3C7GA 3WCSA 3OPZA 4ET7A 3AFKA 5CKMA 1GKBA 1I6XA 3JXSA 1WUVA 2GC1A 4ITCA 3LDKA 3ILFA 4UFJA 4XDPA 4Q8LA 4YGEA 4DXSA 3TBDA 1AX0A 2RS32 4PDWA 5DAWA 5EV7A 3VN4A 3ZPOA 4CDQA 2LM3A 2A3XA 1KRIA 1F2NA 4HANA 2WIIB 5LB6A 3SMHA 3CIHA 3RZMA 4G4FA 4LO6B 1VBC1 2ZHLA 3I8TA 4GJYA 4JGZA 4AOCA 5C71A 4HLTA 3VDBA 2VJXA 1EUTA 1R1A1 3DPRA 3M70A 4Y22A 2X8KA 5A3LA 5H9RA 1OBNA 2FCVA 3BOWA 5FZKA 1Z0HA 1G8WA 2VZQA 4CXWA 3VBHB 2HKXA 2D6MA 1GZ9A 4I09A 3NMBA 4HMZA 1Z7S2 4QU2A 4O61A 4C0BA 5CISA 3RDIA 2BWAA 1AXKA 5EP9A 3RI9A 3WCRA 1R082 3KT7A 4JDOA 4YG0A 1MS4A 1ZREA 1UL9A 3ETQA 4ORFA 3Q8FA 3ALQA 1IS6A 2NZ9A 2JG8B 1OKOA 1W6NB 1LJ7A 4OQ8A 3LEKA 2EIGA 4KMQA 2Y0OA 3OYWA 2LRPA 3PTYA 3R4DB 3WR0A 5BV6A 4XOGA 2XJVA 5JXHA 3H1YA 1YFYA 3KV4A 4FOVA 4AR2A 1OH3A 2G4IA 1AL22 3IAQA 1A8MA 4FCAA 2RVAA 4MHUA 4NAOA 1JU4A 1U12A 3NAPC 4Q4W3 4YW2A 4AE2A 4BPZA 2DURA 5F8PA 2JDHA 4QB6A 5TSWA 1W39A 5DPNA 4K1ZA 1DQ5A 2ZGOA 3E5UA 2DVGA 2GNTA 4RR3C 3WF0A 2P17A 4LPLA 4IEPA 5BNOA 4M4RA 3B02A 2R1BA 4F7ZA 1XU1A 1WA4A 1POV0 2W08A 4LMFA 4QX2A 4XFGA 5IVJA 3JQWA 5FPBA 2N7GA 3QLQA 4A7KA 4GZ9A 4XJWA 1ZZBA 4EN8B 1G9BA 3OY8A 3OGRA 1UX6A 5A7WB 2BP6A 3WDUA 4RSUA 1Y43B 2EIBA 1W06A 1ZBA1 2ATFA 1UY4A 3AYAA 1MEC3 4ZS3A 1KITA 2QVSB 1IZ3A 1C57A 3ZIWA 1O59A 3B7MA 2O8OA 2HWE2 1MS1A 3LE0A 1QJU1 4BXFA 3UL2A 3NV2A 2OT7A 1K12A 4XUTA 3WF4A 4DB5A 2OA2A 2HWB3 1XYPA 4IV1B 1UY2A 5IVCA 1JBCA 2PELA 3OEAA 5HXVA 4NIHA 1OA3A 1BK0A 2WFF1 3ELNA 3AX4A 2VVDA 3KS7A 1BMV1 1ALYA 2CHHA 3J4UH 3JU9A 3BIEA 2VBBA 3WDVA 5JVVA 5FLHA 3AYEA 4L92A 5SV5A 3ITQA 5FOBB 1PGL1 1I5PA 3CNAA 4P9IA 2WINB 2VMFA 1RUD2 1TZOA 1W8UA 1CZSA 4JTOA 4IEQA 2MEV3 3GJBA 5FYUA 5H9PA 1SCSA 2FD8A 1DHKB 4E8CA 5LK7B 3H7YA 4NHLA 1ND3A 2JECA 1O5UA 1U5ZA 1AX1A 1G6NA 4QX7A 1OA2A 3VBSA 4AI9A 1D4M1 3T0AA 3EJKA 1NUKA 1UMHA 5FPLA 4B7KA 5FTTC 3O14A 1SG3A 5FPXA 1QJZA 2P34A 2WO1A 4QMAA 4EV0A 4Y1ZA 3CDZB 2HWD1 4UI9L 3WLUA 4DUXA 2XMLA 4W6XA 4L97A 3WP5A 3POYA 4XEZA 5DZFA 3AYDA 3T0BA 1REFA 4NAMA 3BGAA 4AFDA 1JOBA 3IDAA 2PHLA 3IAPA 1VR3A 4LBQA 4YRDA 3HNBM 2SLIA 4MADA 3D0JA 1Z78A 3S30A 4P9YA 5BNNC 1T2XA 4QKFA 5BNNB 2XPJA 1W6MA 4YVSC 4MGSA 4BJ0A 1PNGA 2DVAA 1RHI2 1REDA 1ENRA 1LHWA 4LITA 5C8CC 2R1DA 1W0OA 3D4KA 3AJZA 2PTMA 1YI7A 1AR73 2GMEA 3MO4A 4PQQA 1DGWX 3CU7A 4A6SA 5BNPC 1CAUB 2HEWF 1QXRA 4NHMA 3ZMNA 4CEYA 4CUGA 2XBO1 4O9GA 4A3XA 1NY71 2QQWA 4N53B 1S2BA 3FHQA 1I3HA 3O1SA 1BCXA 4CZSA 4MOAA 1W90A 3K4AA 3OUIA 2SBAA 1H2KA 3EYPA 4LEJA 3ZMOA 4BWOA 3WP6A 3J7MA 3K75B 1XNAA 5I0DA 4DOUA 2DV9A 4LHSA 2R49A 4OMCA 1TME2 3MW3A 4XAEA 1QOOA 2W52A 3KV5A 5D1IA 3IIIA 1VRH3 1O6UA 2TUNA 3QD6A 1W0NA 4KI5M 2WDBA 3VBHA 1AL0G 1LOCA 1RYYA 4NVPA 5DDJ2 3WDWA 2J1UA 2WQ8A 1FOD2 1KJLA 3KQRA 1WLWA 2LROA 3ACHA 5A32B 5CADA 3HMYA 1HB4A 3TN93 4L2NA 1GUIA 1NOVA 4FP2A 2G9GA 2RS31 2JDMA 2JG8A 2OUJA 1JYXA 1W6NA 3U78A 1CQ9A 2HBUA 4MH0E 4NWVA 5HCBA 2B39A 2DUPA 1DCSA 4UXAA 2ZGTA 2VNOA 3VDAA 4A3ZA 3K48A 1ULCA 5I0SA 1QQP3 2WYFA 2ZX3A 2A71A 3ZDVA 2YPDA 2IVIB 1NXMA 4JDNA 2D98A 4JGYB 3TEWA 1RXFA 5GZEA 3KLSA 2Y60A 4DZGA 1H2LA 2B8MA 2QJVA 2BBVA 1I5ZA 3EXUA 2ZMKA 4DPNA 4GXLA 3WX5A 4UBHA 2XH6A 1XYNA 4AFBA 2VVFA 4BQWA 4PI0A 5LRRA 3I97A 5FAXA 3AKTA 4IETA 3RYKA 1H6XA 3EB7A 2DCZA 4QXKA 3HD8B 1R081 5J37A 5A7OA 3NNLA 3JUUA 4QPIC 3GYDA 1W04A 1GOHA 4V2VA 2V09A 3PJQA 1VPHA 4AWDA 4Y1UA 2JE9A 4D69A 4J1XA 4DY3A 1LOFC 2TNFA 3OG2A 3LGRA 3PLQA 4R9BA 1CVNA 1XNTA 2VAUA 5A7WA 2ZTNA 2OYZA 1AL21 2QFEA 3H8UA 3VBOB 5HXMA 4DFSA 2EXHA 4YVWB 5AFEA 3WF2A 1B35B 1KEXA 1AX2A 1D4VB 5FO8B 2YUEA 1OA4A 3OGVA 4HN0A 1Q3EA 4XDOA 5H9SA 4EZ4A 5JI7A 1C28A 1GWKA 4GMP3 2F17A 2WS93 2YC2A 3I2GA 3PU8A 3VL8A 4DRRA 2XVKA 4MO3M 1YUDA 2FDKA 4YFWA 2WN2A 2Y64A 5CFCC 2GN7A 2YC4A 4BIOA 5FZ8A 2VXRA 3L9JT 5FBZA 4IV1A 2ZGQA 4DXRA 3I2HA 3AVRA 1CPNA 4CDXB 4CU6A 4FI9A 4EZHA 2Z5WA 3N7MA 3OBRA 3WZ1A 4YW1A 5FR3A 3WW2A 2DYCA 1OQ1A 1URXA 5FXZA 1QHDA 1NCQA 2P3YA 1UY1A 3N9LA 4QPGC 5EHDA 4C91A 3N3HA 1S4CA 5FMBA 2YBPA 4CU7A 1GYKA 2JWPA 2H0VA 4QPGA 1XNCA 1RUC3 4IE5A 4IGPA 2Q8DA 3UESA 2FMYA 4QB1A 1ZZCA 3ZN6B 5HPOA 2GMPA 2BTVC 1W2OA 2RS12 2HEVF 2HWE1 4IV3C 4BZ4A 3VV1A 1UIKA 2X5IB 1RUF2 3UKVA 5C8WA 4LBNA 3SKJE 1LGNA 2RMU2 4Q8KA 4Q4X3 1FYUA 4AEDC 4EN0A 1U5YA 3FJSA 2ZX2A 3GZTB 3POJA 2P5BA 2WO3A 1CX4A 2BNNA 5C3PA 3INAA 1MVEA 2AEYA 4OQ9A 2QDNA 2E51A 2QQPA 3LD8A 4OHYA 4ONUA 3HNYM 2HH9A 1H2NA 2O14A 3CO2A 3IB3A 5FZAA 5IAVA 3LEMA 5SV8A 3O0VA 1Y9GA 4PDWC 4KL1A 5EPAA 4B3NA 3KT4A 4N9IA 3S6PA 1VBE2 2Q1FA 4RFRB 2JB8A 4J25A 5C3QA 1RUG2 1VB4A 1RUD1 4AF9A 1CX1A 5T5PA 5JAXA 2JENA 2VCAA 3FL7A 2ZAHA 4QB2A 4WBBA 3SNMA 3DPRC 1C1LA 5BNNA 4W8JA 1WCSA 4PJYA 3NNJA 2HWF2 4ISRA 3PUIA 4R9CA 3RI8A 3VHNA 4TSVA 4XBNA 5F39A 1XNDA 1KDKA 2B45X 4COVA 5HCHA 2FDHA 3PURA 5FZ9A 1LENA 5ERLA 3WF1A 2QQJA 4W4ZA 5JXIA 5JPMB 2PHTA 3POGA 1UO9A 4NRQA 1XNBA 1S0EA 3AP4A 3EHKA 4MX3A 4XC9A 4NJ4A 1VBA3 4D7YA 1F31A 2HWC2 5FP3A 1CAUA 1UX7A 1TMF3 4XZUG 4B4PA 1OLMA 4LHNA 1G86A 2DBIA 5JMCA 4JRAA 2WL1A 2C6SA 2ZZQA 1UXXX 3MGUA 4N53A 4ZPIA 5CKNA 4MG2A 4BCUA 1KXGA 1AR93 1GANA 4AEKA 3BVCA 3DYPA 4AYUA 3KVBA 4LO4B 3MYXA 3CJIB 1O91A 4P00B 5GLUA 1ZZ8A 4TLFA 1HKDA 4RD7A 2VCMA 1WCDJ 1RHI1 1YIFA 2WABA 4LQRA 1FV3A 1HJFA 4FTEA 2XL7A 1YC61 1LOGA 2WFPA 2XL9A 1J58A 4H7MA 4K40A 2JDZA 1S0GA 1MVQA 2GC3A 1HB1A 4IE4A 3ZKYA 3VD7A 1YIPA 2BGPA 1RUI1 4COWA 1MQTB 4LKSA 3Q8EA 3TNQA 5BNOC 4LO5B 4P5YA 2D5HA 2YZ4A 4WM7B 4MVTA 5IYYA 2ZMNA 1I9RA 3NSTA 5A3OA 5A32A 3WW4A 1DYKA 2JDYA 3I54A 2WYSA 4GULA 2RJKA 2J22A 1HRI2 2P4EA 1C5IA 1HV0A 3K4ZA 1H4HA 2WWUA 3FC0A 1GR3A 1F8VA 3IIAA 4OHXA 3NKGA 2GNMA 4CTEA 5FPUA 4A44A 2ZX1A 2JG9B 1CAXB 2A75A 4XAAA 3UJQA 3OCPA 4KWKA 1JZ2A 1TME1 3NNFA 4ASMB 1BKZA 4Y5TA 1LEDA 5AVAA 1O3SA 2RG4A 1F9KA 1QXJA 1WW4A 1QDOA 3JD73 1MR5A 5F5CA 4AGRA 1LU1A 4FOYA 3I3MA 4JGYA 4FAGA 5FYYA 3VKLA 3GCXA 2PAKA 5FZ0A 4FTBA 3MW2A 4QQHA 2RDRA 2UWBA 2EALA 1IHMA 3LOBA 1W2TA 5FZCA 3ORJA 5L9BA 4Y4YA 5DDJ1 4AI0A 3AKPA 4LJHA 4AHXA 2R043 2H6CA 1FOD1 5F3EA 1MS9A 3VBUC 2AYHA 5FY0A 2WA4A 3K77A 4K20A 5CB7A 5LCWL 3KZ4C 5FIXA 1CR7A 1CN1A 3WDXA 3U10A 2XKPA 1KDMA 3FFZA 4IW3A 2C9KA 2Y0IA 4BQXA 2D44A 4XHXA 4HK9A 1S2KA 2QQIA 2UY8A 4LR4A 4N7IA 3VBOA 5A33B 4YVWA 1ND3C 2FBEA 1B35A 2J1RA 2G19A 3T2OA 4Z2AA 5FWJA 4KNCA 2D5FA 1LCLA 1C3HA 1JH5A 1LHOA 1XXNA 3FE5A 4Q4V2 4QKBA 2IUWA 4ZONA 5J09A 2VZSA 3WG4A 4QDSA 4EN9B 4QGNA 1L7LA 2C5DA 3R0RA 1V9U2 4RGGA 2R072 4CDXA 3X29B 4UWDA 3WUCA 4JAAA 5KXDA 4YZ3A 2VPVA 4BYYA 1HXS3 4YM2A 5FOJB 5FLIA 3DN7A 5FYBA 4EROA 2FDJA 3O1RA 3WNOA 1MS3A 1F4HA 1RVF2 4QM9A 5FZLA 3GNEA 2B4KA 2EXKA 2UURA 1KD7A 1UD1A 1Y3TA 4V2WA 3A22A 3MLLA 1UKGA 2ORZA 2P3IA 4Y5Z0 2WZPP 2CL2A 4M0NA 4UFLA 3KGLA 3ZSKA 3ZN6A 5LEJA 2WNOA 5C4WB 1LR5A 2YDEA 1WD4A 5LY2A 4M3CF 3N36A 3CL1A 1JYCA 2R0FA 3AKSA 4LA3A 2LS6A 5DAPA 1V6OA 1VBD2 2WZEA 5JLVA 3U4XA 4YWAA 1GP6A 3I3EA 5FCCA 1JYIA 4NIAA 2R063 3ZFFB 3HEIA 4X8NA 3I59B 3WG3A 1TG7A 3VDDB 5F37A 3HQUA 3OB8A 4GMP0 2Q5TA 3A4UA 3GZAA 4S2FA 4JQRA 1W2AX 3LSEA 4FPEA 3Q8CA 2XWJB 3T4HB 2GNDA 2J1VA 3VDCA 5GZCA 3MFCA 3OGJA 2ZGMA 4G9SB 1C8M2 5IFPA 2VZVA 2YROA 3ZYPA 2YBKA 4LLOA 1W99A 3D8CA 1H1AA 1AYM2 2RS11 2YYOA 1K3IA 1RUE2 5CAZA 5APAA 1PIV2 1RUF1 4NE9A 1XC6A 2MEV2 3HQXA 1UIJA 2DBNA 2RMU1 2CDPA 1LGBA 3PUQA 4JVAA 4XJ9A 1O8SA 2OQ6A 3OY8B 4FFFA 4UW4A 3UK9A 1KGYA 4A7YA 3BI3A 2ZEWA 1XOYA 2J1SA 2X29A 3VBHC 4C1WA 4BE3A 2Q30A 5LA9A 3WNPA 1IPSA 1QH6A 1RL3A 5F2WA 3WNMA 1S0DA 2BFUS 4CYDA 1AF9A 1EAH3 1UNBA 1YJKA 1R092 5FYZA 3TEYA 3B9IA 2BUKA 1LNSA 2D3PA 2VTXA 4R9DA 1LODA 2A3YA 2JG8C 3PU3A 3UKTA 1VBE1 4QGMA 5C3OA 1OXCA 1RUG1 3MF9A 3KWVA 1W6PB 4IESA 1E5IA 4P9LA 1KFXL 3CJIA 5F5AA 3GBFA 5LBEA 1GFF2 1VE0A 2HWF1 1ULEA 3H0OA 2BVBA 1GZWB 3MIGA 4BOWA 5EJZB 4OUMA 4YSFA 1O4ZA 2PHDA 2NYYA 4A41A 5KR7A 4RHV2 3ZPYA 2XJPA 4YM1A 5GJ6A 5A3UA 1WLTA 4QD2A 1V6JA 2HWC1 1OLRA 4N43B 4WVMA 4P9WA 1UWWA 1MQTA 3M3QA 5FQ0B 1AR72 4A6OA 5IVEA 4B1LA 3QCWA 3RYRA 3PUAA 1F35A 3AZVA 3BB6A 4WM7A 5L19A 4OI0A 3POIA 2FQPA 2QQUA 2RE9A 3SITA 2XUMA 1WMDA 3P3NA 1K5MB 1QJX3 2D7FA 4UFMA 3CHXA 2VECA 2JG9A 1CAXA 1UZWA 4LHKA 3SC7X 2XR4A 4LBJA 4CE8A 2QTWB 3T2PA 1GU3A 1ACCA 1S2EA 3SCHA 4E8DA 2J1EA 2D6PA 2Y26A 3E97A 4DIQA 4WM8C 5JXGA 1IGOA 5FZ3A 4RQPA 3AJYA 1RUJ1 1OC1A 1W8NA 1EV13 1OD5A 1AJOA 1AVBA 2CDOA 3HIFA 4J6GA 4NR1A 1L7QA 1VRH2 2X05A 5T5LA 4IV1C 4ZXEA 3WD5A 3RS6A 4CA9A 1E5HA 4O7XA 2Z2SB 3ZR6A 4GWIA 4YFZA 3M3CA 1AYN3 3HWJA 3OPTA 1UU6A 1VBB2 4DMIA 4YZ5A 2W1SA 3SISA 2A6YA 2YGLA 1SPPB 3E6BA 1HRI1 3AZZA 1ODMA 5CFDB 5ACA2 5CG9A 1YQ6A 4EQVA 1PVC3 5C5TA 1QNYA 2Q0AA 4N90A 2CGPA 3POFA 2GAUA 5FZDA 2LW8A 1LTEA 4BMEA 3FLPA 4NIIA 2E31A 4CDWB 1WD3A 3PMEA 2RS53 5A33A 1O7FA 1BHGA 1LESA 1UY3A 2VOTA 4XVHA 2OPWA 4YG6A 1JTZX 1L7RA 2EA7A 4ASKA 4WVWA 5FPVA 3HN1A 2YU1A 1SACA 4URAA 3VZJA 4GALA 3B00A 4GB32 4I02A 4M4PA 3WHTA 1R1ZA 4TN7A 1OVPA 4QXHA 2C4XA 2EXJA 4H14A 4XXAA 3SH5A 1OHFA 3C2UA 1IS4A 3VD9A 1WMFA 4D6QA 1TNRA 1MZ5A 4BLJA 2JX9A 5CEHA 1NQDA 5AFBA 3ZVXA 3AVSA 5E1RA 3POWA 1YQCA 2MPFA 2ET7A 3MUY1 3AC0A 3TEXA 4DNYA 2W2IA 1UMZA 1HRV1 3I2DA 1BBT3 3KQ4B 4X8PA 4CCOA 4JZRA 5A1LA 3IMMA 4XBLA 2YGMA 5J48A 4V1PA 1FXZA 2E6VA 4XABA 2F4LA 3CZJA 1XE7A 4K8RB 1VAMA 5C4WA 1J1LA 4Q4V1 3NJVA 5K0UC 4TLGA 4EWAA 3AZYA 1QH7A 5J36A 1IS5A 1X9PA 2YB7A 2WS92 2VG9A 1WBFA 1DGWA 1V9U1 2R071 2W91A 4Q5OA 3ZXFA 2W1WA 5IVFA 3ZFFA 2EXIA 4Q0QA 4LBOA 2D40A 1VBC3 2AH2A 2DCTA 3I59A 3J7LA 4UW3A 3VDDA 2ZCWA 2ORXA 1UYPA 1SBDA 1R1A3 4NHYA 3WQBA 4AK3A 4DS0A 1RVF1 3KCXA 2G9ZA 2RJ2A 2YY1A 3R4SA 1D2SA 4KU7A 4U36A 4BQ2A 5EIYB 2BZDA 3I7DA 3P5BA 4JHZA 1J59A 3H3LA 3N9NA 2GNBA 2YHJA 3IT8A 2WKKA 2I74A 2PHFA 4KGQA 1MS8A 2E26A 3AFGA 3FX3A 3OBTA 2C0ZA 3VBRB 3RZKA 5FY8A 4I0BA 5K9YA 3NL1A 4YW3A 3WEZA 4Y1VA 5BY5A 3IPVB 5A3WA 3ACFA 1VBD1 4Q29A 4HSLA 1JYNA 1HIXA 3S0MA 2HEYF 3MFAA 3ZXKA 1V6MA 3KV6A 1CPMA 3OBZA 4Z92B 4ZY9A 5I91A 4FP3A 3UV9A 1ASJ1 4CUCA 2W1UA 4AVSA 1QJEA 4LULA 1FMD2 5FO9B 5JOWA 4TYSA 2BNOA 3AL5A 1C5HA 4E4SA 1RXGA 4PCRA 4AQ6A 4XHBA 1C8M1 1DBNA 1AR62 2GZWA 1IPJA 1HV1A 1W6PA 3OGSA 1UKRA 2DWRA 4LBQD 3C7FA 1AYM1 1RUE1 2VTXJ 1JODA 5IK8A 1PIV1 4HETA 5IT6A 2CTVA 3EBRA 2MEV1 2VXJA 4ARXA 1PZ8A 2VMHA 1GZWA 1W28A 2Y6GA 3RMXA 4JGYC 5HI0A 4FOQA 1ULFA 4QAWA 2V5DA 4AHYA 1HQNA 3KCCA 1BEV2 1NCQB 4UFHA 3S5QA 1ZYBA 2GN3A 4CP9B 4QX1A 4UBGA 4AEJA 4IUGA 5BUVA 4IXLA 4XFBA 3NO8A 4YLZA 5FQ0A 4N43A 1R091 1W8ZA 3SXWA 1JN2P 1ZBA3 3I2FA 2DCJA 2Z79A 2W9XA 1C8NA 5LBFA 4ZU7A 1ENQA 1SQ4A 3ILNA 1UYZA 5T5OA 1GP5A 4QHZA 2BGCA 3N7LA 5FPAA 1ONAA 1SZBA 1S0FA 2EVXA 2XQRA 3J8F2 2YFUA 5FUNA 4A42A 1T6BX 3GJAA 3UGHA 5ABJC 5A7PA 1FT9A 4FPJA 1K5MA 1QMJA 1QJU3 2E33A 2ZKLA 4AQ2A 1UAIA 1GQGA 3VBOC 1F4AA 2VZOA 2ZGKA 3BODA 4HFSA 1B35C 3H1WA 2EAKA 3VZNA 4DRVA 4HVRA 3L2HA 2WA3A 4LIUA 4RHV1 2QQVA 1OOPB 5LASA 4CP2A 2WC2A 2D6KA 4ZS2A 4HKLA 2WFF3 2BGOA 4LBKA 3LSDA 3AKQA 4QT6A 5FY4A 3E1F1 2ETEA 1DQ1A 4GJZA 5A6ZA 3VLBB 2FMDA 1OF3A 1VB2A 1KS4A 2ZA9A 4JRLA 1QJY2 4CDXC 2CWMA 2LUWA 4DQAA 1MS0A 4GKYA 1SPPA 3I2JA 3J26N 2MHFA 5D8AA 5FFOC 4DUWA 3LCPA 3BOPA 1JXNA 1Q8SA 3I2KA 5LW9A 3KF5A 5CFDA 2VCBA 3ZYJB 2W39A 2RV9A 5D2AA 4UF0B 1D4M3 3WP3A 3DUIA 3ZXGA 2DTYA 4NPMA 5FYHA 4D8MA 5JMOA 4ISQA 3ZYHA 4PIZA 1NZCA 2UY9A 3ZFEB 4HPKB 1W9WA 2A3WA 1UOGA 2E53A 2XQXA 4OZXA 1AJKA 4IERA 3AP6A 4CDWA 2IXKA 3T1MA 1XNKA 3B5LB 2B5HA 1US2A 2WBKA 2X5IC 4I3GA 2XKOA 2FCTA 2HWD3 4XUOA 4YGDA 5FYVA 1N1VA 4YNIA 5FZEA 4OUSA 4Z8BA 5KWRA 3CKHA 5CU1A 4GWJA 3WG2A 1GOFA 1OUXA 1VBB1 4XFAA 3PVNA 4KWJA 3OJBA 1FNZA 3KMHA 5AC92 4ATEA 2VZRA 2EAAA 4OFGA 5K4LA 1WLDA 3OD4A 4GKXA 4M3CE 4XJAA 2WO7A 5ACA1 4FPOB 5B2GB 4QXCA 1UOBA 4KWUA 1CGPA 1J84A 2PN5A 2VMIA 1OVSA 3KT1A 3S7EA 2IC1A 1Q5OA 2VUCA 1PO12 1ENXA 1LEMA 4XF3A 5FXVA 4ZZ5A 5IVVA 4IEOA 4J1WA 4Q0UA 3PHMA 3RVHA 1MPXA 4AI2A 2XJSA 4TWTA 3HOBA 3K51A 4RR3B 2XBO3 2EF6A 2VMEA 1MZ6A 3DXTA 5CIRA 4FVVA 5A6YA 5A70A 4C90A 4GB31 3V0BB 4FSJA 4RGKA 4MGQA 2H0BA 5FWEA 1PMJX 3GM8A 5JOYA 3HNMA 3NKTA 3ZXAC 2B46X 4PIXA 1H0BA 1RUH2 2ADDA 2JKBA 2WQ4A 2ZJCA 3AMHA 3JBG2 2PHWA 1POQA 2OX0A 4EE2A 2F6BA 4YZ4A 1CJDA 3ZDSA 4IEZA 2RM22 4GH4B 4XCBA 4QQLA 2XHNA 5FZMA 2W94A 4COUA 1DQ4A 4ATFA 4KG8A 4AAXA 2ES3A 2GALA 1CAVB 1Z7S1 4KU8A 3W9AA 4B7EA 3ZXEA 2B7YA 1PO23 2O0OA 3E6DA 3VBRA 4M0HA 3WNLA 3IDEA 4K8FA 4DY5A 1W2NA 3AB0A 1RMU2 4O65A 4OHVA 1DFQA 3IPVA 3ZIXA 3O1MA 1QGLA 1QU0A 1N3PA 1Q8OA 3MUZ1 1X50A 1A3KA 2PLV2 2DDUA 2RS33 1W3VA 1ZBE2 2FHRA 3MW4A 4NHKA 4BH9A 1MQTC 3BU7A 1X8MA 1WBLA 4R8HA 1VMFA 5FZIA 2WN3A 3LFIA 3DV8A 4LO8A 4QU1A 1GWMA 1ZZ6A 3VZOA 1YYNA 4IEUA 3GF6A 5LK5A 1W2UA 3W58A 5FZGA 1JI6A 2P6CA 2D93A 4NWWA 3RWKX 3KVAA 3W59A 4CCJA 5CA6A 1NQJA 3KSCA 4YZ1A 2WT2A 2ZEXA 3I2IA 1UOJA 4O9EA 4AI8A 4K21A 5DUWA 3RPQA 3PL0A 5L7OB 3MI8A 2JG9C 1J83A 1X8EA 2ZX0A 3RMYA 1ZZ7A 4PIYA 3BYWA 3FLTA 1SDDB 3K46A 4JKKA 3QACA 1W03A 5FYTA 3CQOA 5LRSA 3PDQA 3AK0A 5JWPA 4BM8A 1WCQA 2A6WA 1N3OA 2VZTA 1R083 4FPYA 2J1AA 3H8OA 2W68A 4K9SA 5A1FA 4LOTA 4YW7A 4CP9A 4U2AA 4AVVA 3THPA 2W3JA 4IEVA 5A3MA 2WNUB 1X9TA 4Y33A 5F1RA 5J96B 2CNAA 5KHIA 1WW5A 4MV2A 3I2OA 1UYYA 1AL23 1FX5A 2OIIA 1FMD1 3HBZA 4ASLA 3J7HA 3TOJA 2EICA 2BU9A 4HK8A 3LA2A 3FHAA 1NLRA 1COV2 4FQZA 1AR61 4SLIA 1W9YA 1PM7A 1WGPA 2ZZJA 2WQZC 2KM2A 5JSPA 3R4UA 3TAYA 4QGLA 2GH2A 2EIEA 4L9BA 3T08A 5FMOL 5C8CB 3USSA 3MLKA 4K1YA 5EYYA 3H8RA 3M2MA 1LOAA 3MBWA 1UMIA 3OOXA 2Y8KA 2QNKA 2VU9A 5BNPB 1BEV1 1OOPA 3TB0A 5ANNA 2VMDA 2E63A 4CDQC 1PMHX 4AHZA 3EO6A 1NCRB 2QZ3A 1A6CA 4MXVA 3U0ZA 1FPN2 1LECA 4QPWA 2R0HA 5FK8A 4JGZC 1OURA 4QXBA 2VOWA 3WQ7A 1WMEA 5FXXA 5F32A 1KFUL 1K42A 4M01A 3WQ1A 1APNA 2VQUA 2AR6A 3IN9A 4QPYA 4CPBD 2J42A 4XE9A 3HQRA 4BQ5A 4TTGA 3J8F1 1XB9A 3QBQA 4ES8A 5E16A 3U11A 1LGCA 2HWE3 3LA7A 4GA9A 3HBKA 4HOOA 2DU1A 5HV4A 1KQRA 4UF0A 3GBWA 4XQDA 5FJHA 4Z07A 4AQTA 5A7NA 5JDBA 1O4YA 4MYEA 2YBSA 3RRDA 3ZFEA 4HPKA 3SEPA 5C4WC 1PX3A 2ZEYA 3B01A 3GHNA 5DZGA 2LTNA 3IWZA 4HVQA 3KB5A 5ANQA 4YW5A 4A4AA 3VGIA 3LPFA 4MGTA 3P3PA 2VW1A 1E5SA 2WZR2 4LIVA 1DZTA 3NRUA 1QJY1 3MPPG 2B9VA 1O5LA 4LOSA 3WNNA 1RUD3 1W05A 3AP7A 1NXD1 3CLPA 2RDNA 2RR12 3MHZA 1JMUB 4XDQA 4CSWA 3SKVA 1EYBA 4Q1RA 4B29A 4PLMA 1C4RA 1W9TA 1DIWA 1ZZ9A 4QQPA 1JZ3A 1F5JA 4I01A 5L73A 2WNVB 4EWDA 4ZKTB 3WV6A 2CAVA 4XCAA 2C26A 4WVMB 4INDA 3MIFA 3USUB 4JTNA 1FNYA 1OH4A 1YFXA 5M0TA 1Q43A 2W46A 1QY4A 3ZXJA 1OQEA 2XVLA 4XTPA 2GMMA 2ZHMA 3NNGA 1VMJA 4XURA 1PGW2 3PUSA 3O1OA 4RR3A 4QX0A 5CNAA 3WG1A 1GQPA 5JR2A 4XIOA 5FV3A 1PMIA 2WLPA 3V0BA 3ZOIA 5BPXA 3W20A 5I0UA 4K6BA 1UU5A 4I30A 1ST8A 5AC91 1YFUA 2D3SA 5T52A 1YFWA 3N9OA 1W6QB 2WAAA 4RQPB 4Y24A 1RB8G 1RHI3 3H3UA 1ODNA 4UW6A 3WXPA 1YEWA 2JDKA 4GH4A 3IDBB 1MS5A 5FZHA 1PO11 4C1XA 1CAVA 2OUHA 2XB6C 2WWJA 5LATA 4KG0A 5C6CA 4NROA 3FUQA 1RUI3 5J1XA 1AXYA 1EY2A 2JJ6A 5HCFA 1XYOA 5J98B 5LY1A 4XXPA 2ZBJA 1PX4A 3A23A 3LF7A 4XIKA 4CCNA 1H1MA 3LDBA 5T3NA 2O1QA 2TEPA 3PNAA 5FY5A 4DUVA 2VGDA 1BQPA 4MXWB 5FP9A 1SLBA 4IL7A 5I8TA 3AYCA 3K2OA 1I1EA 2PYTA 2PHXA 2VZPA 4N43C 4Y1YA 3AXDA 1H9WA 1RUH1 4TZDA 4I3PA 3JBG1 3LFMA 3T2QA 3U75A 4XUPA 4D94A 1BJQA 2G9FA 1TME3 3OF1A 3VBSC 2VE1A 1POV1 3SEEA 2RM21 3U1XA 1JHNA 1GBGA 2P3KA 2PXJA 5CKQA 1K5JA 1IQAA 4Q4W2 3O1UA 5JSRA 2CV6A 1STMA 4IV3B 1S0IA 3THDA 3SH4A 4B8EA 5L7OA 1D0HA 5AVPA 5LBCA 2CY6A 5I0RA 2NPIA 2OQ7A 1RJ8A 4BA6A 4E4ZA 5DDJ3 5C9AB 1RMU1 2ZPXA 1FOD3 1FV2A 1MZFA 1VALA 1XE8A 4ZU4A 3VZLA 1ZA7A 5HCAA 2PLV1 4XJ8A 3ST7A 1N1SA 1ZBE1 4XILA 1SLAA 3D82A 2P2KA 2VNVA 5L9RA 3T4VA 2W5FA 3MIBA 3U07A 1O3QA 4HG6B 2AUYA 2WNUA 1SDWA 4KWLA 4Q4Y3 4QQOA 3UT0A 1ULPA 4FFIA 4EN6B 2A73B 4C8DA 5JZGB 1MEC2 4QM8A 3MIDA 2CWSA 4ARYA 2ARCA 2ZGUA 1GOGA 4E2QA 1W8HA 3FWEA 4HXCA 1GICA 4KQ7A 4NPRA 4AZZA 1SFNA 2PHUA 3JZVA 2IXJA 3O5SA 5CZKA 2XONA 1WCUA 4AEMA 5CFDC 4OLLA 1NLQA 1UN1A 4LLFA 3VBFB 3ZSLA 4CEYC 2XGXA 1J3PA 3P6BA 1SLIA 4CDWC 5C8CA 3HT1A 4Q0PA 4H7LA 2HWB2 2XJTA 3VKFC 1DZRA 2CAUA 1EPWA 2QDRA 2VNRA 5FZFA 2W92A 4R4XA 2XLGA 5BNPA 1M4WA 5DZEA 2VOVA 5C70A 3KCYA 5F3CA 1CZTA 4XF0A 3DCQA 1BK1A 4PBOA 2V72A 4EJRA 3RZHA 1W6OB 1NCRA 1H2MA 4NMIA 3JB4C 1DYPA 4JCKA 4L99A 2DF7A 3RGBA 1AR83 1SFYA 4WZFA 2W47A 1RUOA 1AXZA 2PQQA 2OKXA 3RYPA 4DEVA 3ZSMA 5B4NA 1W9FA 2XVGA 3C7EA 1HX6A 3GZUC 3M3EA 1COV1 2E32A 1QKQA 3WSOA 2QQOA 3PVEA 3RQ0A 3ACGA 2Q8CA 1YCIA 1CONA 4LT5A 2VOXA 1IS3A 1JW6A 3RJ2X 3N9MA 4OHWA 4HT1T 1TEIA 2UWAA 5E88A 3C8XA 4CCLA 4P9XA 4YPJA 5LEKA 1OI6A 3PIGA 2F4PA 3J9SA 4YGBA 3U4SA 2BYVE 3P1IA 4HL0A 4E4DX 1NLSA 4IE6A 1E57A 4DINB 1NT0A 1S55A 4A45A 5FRAA 3ETPA 3N35A 1FPN1 1B09A 2VR4A 5C7GA 3PTRB 2ARAA 1QEXA 4FFHA 3SQOA 2QQLA 2UU8A 2FDIA 3BKZA 2W87A 2D97A 1J1TA 3WT3A 1ZRCA 4IEXA 2ILMA 1ULDA 5F5QA 1ND2B 5GZDA 2JICA 2GC2A 4JDMA 1RJ7A 4KGGA 2RS13 4AFMA 3SCGA 5J7MA 1DQ0A 2GSYA 3E6CC 1RUF3 1UZVA 2D6OX 4L0PA 2RMU3 4W6WA 1QNWA 2ZACA 2WNVA 1J3RA 2C1FA 1HW5A 4XQ4A 3Q8BA 2Q1MA 2BEOA 3MF6A 4IQPA 3RJRA 1ULOA 5F2SA 4PF1A 4XMAA 3H1MA 3USUA 3VBRC 5HV0A 3B69A 4IEYA 1O8PA 3I3DA 3AMMA 5FKCA 4GAZA 2WZR1 2WT0A 3VBUB 3U37A 2YXSA 1NKGA 2JXAA 1VBE3 1PK6B 1RUG3 2VC9A 1H4GA 2QQNA 2QCSB 2RR11 4YW6A 1QDCA 3ROUA 3M7AA 2BPA2 4CEWB 1YQ2A 2HWF3 1M06G 1CJPA 1W6QA 3S7IA 4PQ9A 3G6JB 4AG4A 3BALA 1OKQA 4P9JA 2XLFA 5T55A 4D6RA 2H6BA 2ID4A 3HR9A 1UPSA 3Q9OA 5F6LB 2HWC3 2QQMA 1WW6A 2WRAA 3SH3A 4Q0VA 4E2GA 4QKNA 4UYBA 1PGW1 4BQ1A 4AQSA 1GZCA 5D8AB 1QF3A 3L2YA 2ZX4A 1S0BA 1NCQC 3GZEA 4GWMA 5DABA 2YFZA 5LA2A 3TN92 3MV01 4LBMA 4MXWA 2NMOA 4BXSV 1BYHA 2JDPA 3DEMA 4X6QB 2VH9A 2YMZA 1DZQA 4P02B 2VY0A 1OFNA 1RGSA 3KM5A 3GCWA 2P1BA
chains in the Genus database with same CATH topology
1H1IA 3IDCB 4PF5A 1LHNA 3I4IA 1QQP2 4S2DA 2ERFA 1LRHA 1VJ2A 3QOPA 4IV3A 5E89A 1RUJ3 5KC6A 4B4RA 1DQ2A 4ES9A 5KC5A 4META 1LULA 4WVVA 5CBLA 1SMVA 1UZZA 2VMGA 2XJUA 1CD3G 3HAGA 5C9AA 1OOPC 1NA1B 1PO22 3JCIA 1PZ9A 5FLJA 3WUDA 2V73A 1HRI3 2XWBB 2D6LX 1PNFA 4D3WA 1OQDA 2VQAA 4F83A 3FMGA 2DVBA 5JZGA 1G9CA 2AENA 2IWGB 3T1LA 5JI9A 4URTA 4Q4W1 4R52A 3PJYA 2A6VA 3FUOA 2XJRA 5C33A 2PA7A 3NV4A 4EN7B 1Q8VA 4K7JA 3VBFA 2ZGRA 4FOWA 3FFQA 3ZFEC 2UYBA 4Z82A 4Y20B 2B42B 4XFCA 4N53C 1S1AA 2PHRA 2QKDA 3WNXA 3MLJA 2IXCA 1GQHA 2ENRA 3B93A 5KHJA 2IFWA 3FBMA 3V64A 1W6OA 3D6EA 3ZFGB 4HZFA 4X6RB 4GWNA 3PMSA 1MEC1 5GM0A 1ZRDA 1HRV3 1SBEA 1CAWB 3TYJA 1RUC2 5GALA 4AFAA 2QE3A 2ZOEB 2YV8A 4D7TA 4YYOA 1CIWA 2HYKA 4XYXA 1ZM1A 3R05A 3TNPB 1DG6A 3GBGA 3LA3A 4FAHA 2OVUA 4Q4V3 1Q56A 2NP0A 3ZXDA 2HWB1 4Q4X2 4XW3A 1OPMA 2D6NA 1V9U3 1WLCA 2R073 2FZ1A 4XQWA 1PGSA 3V56A 3APBA 3D0SA 5GZFA 2AZ5A 4PLOA 1SBFA 2AGSA 3FHIB 1V6LA 2I2SA 1RVF3 1U5IA 4HBNA 5E8AA 4AI1A 1FAYA 2BWCA 3TRSB 1D0GA 1ND2A 4QQ2A 3AMNA 1J3QA 2ZKNA 5H9QA 2BVVA 4CDUB 3KGZA 2HJIA 1LU2A 4XTMA 4BMBA 2A70A 2WJSA 4GH4C 2V5YA 3VZKA 4XJUA 4WM8B 3ZYIB 1VBD3 3H7JA 1BVVA 1VBA2 1HQWA 1UZYA 1TMF2 2A7AA 1ASJ3 2VVEA 2YC0A 4Q26A 3VBUA 5I8YA 2I45A 2PFWA 4RS5B 1RUNA 1AHSA 1AR92 1OLQA 2DUQA 1PK6A 4A2UA 1C8M3 3WOGA 4E2GA 4NN0A 4RFT0 1H8TB 4YVWC 1BZWA 5F6KA 2ZHKA 4XF4A 4PBPA 2Y38A 1AYM3 2ET1A 5CVRA 1RUE3 4CEWA 1PIV3 4RGAA 5IK5A 4XF1A 2VNGA 2K2SA 3IM0A 2A5ZA 5DUXA 4YGCA 5L7OC 2A6XA 1AR71 1RC6A 3DF0A 5FPZA 3LKJA 4MZUA 3M3OA 1R093 4YG3A 3WINE 3T2TA 1S0CA 1XQNA 1SLLA 2XHKA 5L36A 2WNUC 2R32A 3N7JA 5BYNA 3ATGA 1MZEA 3O0WA 3TWIA 4LUKA 1YO8A 1KS5A 3DGTA 2IXLA 1RIRA 1FI2A 4MUVA 4P5HA 3M1HA 3JD72 4LHLA 4RHV3 5IK4A 1VRH1 1XU2A 1NE4A 4YM3A 1H9PA 1LHUA 3AP5A 2VW2A 3FZ3A 5JOZA 5K0UB 1LOEA 1JOJA 5GKAC 3AXEA 4N9HA 3ZSJA 3RNSA 2XJQA 2R042 2ZMLA 1ULGA 2WT1A 4EWEA 1RUI2 3M4FA 4HN1A 1IOAA 1NA1A 3TN91 4N7UA 5BNQA 1NCRC 1C1FA 5EZWA 1SCRA 3NAPB 1N47A 5I8SA 4COYA 1H8VA 3ES1A 1H30A 1QQP1 2IZWA 4FPCA 1YXWA 1V6NA 3MEPA 2DCYA 3G7DA 3ME2A 4H3WA 3WQ0A 2O8QA 2OZ6A 3AM2A 3NV3A 2NN8A 4Y20A 1KJRA 3A0KA 1PO21 1RTVA 1VBB3 3AMQA 1X82A 2K9ZA 4XFIA 1HXS2 4BLIA 4E27A 5ACA3 4FXGB 3CJIC 1UU4A 2BFUL 1O4TA 2E7QA 4ZU5A 4S2GA 2DCKA 3ZFGA 5EFUA 3ZSEA 3KD4A 3V0AB 3SCFA 2YPJA 4Q4Y2 3NW4A 1CAWA 4AVCA 4AI3A 1GNHA 5BXXA 1REEA 4L8QA 5FO7B 2X53S 5FDBA 4GMP1 3ZYRA 3M8LA 2WS91 2NLRA 2WNVC 5GZGA 1HLCA 5KXBA 3AP9A 4GB33 3RSJA 4AW7A 4JC1A 4MSVA 4Z1VA 4Q1PA 1S0JA 4WM7C 3VKNA 1AUYA 3E5QA 1UF2C 3GHMA 4KBBA 2AREA 2NM1A 2R062 3V65A 4QX5A 3NWKA 4A7ZA 3IMNA 3E5XA 1EP0A 3O0XA 3B94A 3CEWA 2D3RA 2WNEA 4Q27A 4XF9A 3WY6A 4XFFA 1PHMA 2WSUA 1RUC1 5ABJB 1Z7S3 1AR82 2IFRA 4AGGA 4RQPC 2Z69A 5J3UA 1FATA 4W6YA 3VUOA 4CDUA 1N1YA 1LKNA 4I0AA 1O3RA 2C9AA 3H9AA 1A78A 4WM8A 4S2HA 4Q4X1 4FTSA 2VUJA 4QHBA 1CESA 3WHUA 4AFCA 4FBFA 1X33A 1EAH2 3LOIA 4YVSB 5DG1A 1GNZA 1IPKA 3EQEA 5IK7A 5DXDA 1VP6A 4RS5A 4LA2A 3JB8A 4W65A 1RITA 1HDKA 1H8TA 2Q1ZB 3MZHA 4AHWA 2R6QA 4WV8A 1ZX5A 3BCWA 5K7PA 3VHPA 4I0WB 3LWCA 1V6IA 3VHOA 4C0HA 4CRQA 1DGRN 4FXKB 2E7AA 1NE6A 3WDTA 1QOSA 1VBA1 3LB9A 3PVBB 4WVZA 4FT8A 2QZ2A 4ZXKA 1TMF1 5C9AC 1G9FA 2ZS6B 3AZWA 3HT2A 1IKPA 4BHPA 1FMD3 5DUVA 1AR91 5EJ3A 4NOTA 1AR63 3D5OA 4E2SA 3MICA 4FO9A 5EXOA 1QJX2 5JZGC 4Y26A 2ZGSA 5GLWA 3AZXA 3NV1A 3VKOA 2PAEA 3RZZA 4YZ2A 3OTFA 4B4QA 1DQ6A 1Q8QA 1V70A 4Q0SA 1Y9QA 1N3QA 1BEV3 1MACA 3QH6A 3VBFC 1EV12 2K0GA 4FPKA 3ZYGA 5K0UA 3ZFFC 1JUIA 4MGKE 1ZNPA 2JE7A 4HKWA 1NYWA 3VDDC 2ZGPA 2KXLA 3GALA 3ZN4A 5EWSA 3A0NA 1AYN2 1UPIA 3ACLA 4M3CB 2E9QA 1ZRRA 3H50A 4XMIA 3J8F3 1G9DA 3NAPA 1A8DA 1PVC2 1JUHA 4CP0A 1WCKA 1NG0A 4G3YC 1OFSA 3SLIA 1LOBA 3R6SA 2FZ2A 1GLHA 2GU9A 1YNAA 2RS52 3JD71 3ASIA 2ZABA 2CGNA 4QPIB 2E7TA 2ZHNA 4JV4A 1TE1B 1QOTA 3THTA 3ZO0B 1RUJ2 1W0PA 1QJY3 4MGZE 2R041 3OGGA 4AXOA 3AKRA 1IKQA 3MPBA 1U5XA 5KXCA 3FBYA 3LAGA 4MLOA 4RA0A 5I93A 4I2OA 3O12A 4LUMA 3RWNA 1T6GC 2RJLA 4LTAA 4XETA 2ZAAA 1WW7A 1X36A 4AGVA 1ND2C 3ZXLA 3PVOA 3WW3A 3RG0A 2VULA 5HBAA 3V0AA 2VUAA 5CFCB 1BBT2 4R4ZA 3ILRA 2DTWA 5JSOA 3WDYA 2WLQA 2DUOA 2Q8OA 1OMIA 3BIWE 1U0AA 4CP1A 3ES4A 4FPGA 4FQ4A 1DGRA 4AVAA 3B9CA 2W0XA 5KXEA 4QPGB 1SLTA 3BPZA 4OI4A 4LBLA 5GLZA 3IBMA 5AC93 1YHFA 1HQLA 1GV9A 1HXS1 3NJZA 1VBC2 4K3UA 4XZPA 5I0TA 3SISA 2JD4A 2P3JA 1K5MC 1R1A2 2A6ZA 1PK6C 4IEWA 2P37A 5T50A 4AVTA 5T54A 4OHZA 2OW4A 2UYAA 3MDPA 1AZDA 2B9UA 4HVOA 4Q4Y1 1PO13 2IXIA 5ABJA 5T5JA 4CEWC 4AEDB 5DG2A 3DL3A 4D7SA 1HRV2 4H55A 1DF0A 3CJXA 4WZCA 1VAKA 2OZJA 1V00A 1QXPA 2Q4SA 2XLAA 3BTAA 2ARBA 2WSVA 1DU3D 4Y1XA 3B3QE 1ZA4A 2TBVA 4PDWB 5KHGA 4CDQB 5GLVA 1OPOA 2R061 1RUH3 5D8AC 3C3VA 3JBG3 4JGZB 3MIEA 5FREA 4YW4A 3DPRB 4YVSA 1YRZA 3SHRA 3JQXA 5DUUA 4Y22B 1POV3 2RM23 4GIQA 1Q8PA 2NMNA 3NVCA 3POSA 3N7KA 1X7NA 1YI9A 4XPVA 1AR81 3FLRA 4Q2FA 1TQ5A 4OVEA 1G7YA 5IUQA 4L11A 1GSLA 5KHHA 1RMU3 2GH8A 2CGOA 2GC0A 2UWCA 2KA3A 2X5IA 3ZX7A 2DU0A 2PLV3 3WVJA 1ZBE3 4BIFA 2WWSA 1SEFA 3AMPA 3OYWB 1L3JA 1EAH1 5JR7B 2DVDA 1G9AA 1NA1C 2JEMA 1ZBA2 4P14A 3WW1A 5JCTA 4SBVA 1ASJ2 1XRUA 1YJLA 1O3TA 3H3ZA 4XJZA 1RINA 3O7OA 4LE3A 1QJU2 3WP4A 1DGLA 2Z42A 4OI2A 4LNVA 2R16A 1TNFA 1DDLA 1SLCA 4XFHA 4YARA 5BNOB 3CF6E 4GQ7A 1ZVFA 4OULA 3ECQA 2ZGLA 2LALA 5EYXA 5KBFA 2VW0A 2WFF2 5JIAA 1BMV2 2MNGA 1LHVA 2GDFA 2ZGNA 4P9GA 2R30A 2OPKA 4M00A 3LZZA 1LB2A 1PGL2 3UKNA 4YM0A 5JIUA 4M3CA 1EPZA 4UW5A 1COV3 3VHRA 2RHPA 1UCXA 2DFBA 4MGYE 4HSJA 3ZFGC 1QJX1 2DVFA 1D4M2 5KHKA 1N1TA 3VKMA 2NQYA 1PZ7A 5CG8A 3QH7A 3UJOA 5K8SA 5GLTA 5JOXA 2HWD2 4QPIA 1EV11 1VLNA 1QWRA 4R9AA 4LO7A 1FPN3 5F9TA 4MGIE 3VZMA 4XBQA 1LOFA 3N4MA 4E9KA 1AYN1 4KH9A 1ZRFA 1YWKA 3DKWA 2CYFA 1Y7BA 1ND3B 4F8AA 1PVC1 2D43A 3VBSB 4DXZA 4F3JA 4FPLA 4Z2WA 2ARXA 3OD0A 2BNMA 3ZN5A 4AVBA 4COZA 2RS51 5CFCA 4FPFA 1YLLA 4CDUC 1BVP1 4RL7A 2QUOA 1OSGA 2PAMA 2XBO2 1NY72 2WZR3 2I07B 2VOKA 1BXHA 1VIWB 2XG3A 1ENSA 4LBQB 5JPNB 2BW8A 2BQPA 1UW8A 3M3IA 4QPGA 2IXHA 2RR13 4NO4A 4PLNA 1W6MB 1V6KA 3MIHA 5FMOS 4FPHA 4HKOA 1D2QA 3URFA 4RS5C 3ENRA 1DLLA 4LE4A 1PVXA 2VQ0A 3VL9A 1H8TC 3IKWA 2DFCA 1BBT1 1F5FA 1VAVA 4AEDA 4CEYB 3WCSA 3OPZA 3AFKA 1GKBA 1I6XA 1WUVA 2GC1A 4ITCA 3ILFA 4Q8LA 4YGEA 3TBDA 1AX0A 2RS32 4PDWA 5EV7A 3VN4A 1KRIA 4CDQA 2LM3A 2A3XA 1F2NA 4HANA 2WIIB 3SMHA 4G4FA 4LO6B 1VBC1 2ZHLA 3I8TA 4JGZA 4HLTA 3DPRA 1R1A1 3M70A 4Y22A 2X8KA 5A3LA 5H9RA 3BOWA 1Z0HA 1G8WA 3VBHB 2HKXA 2D6MA 1GZ9A 4I09A 4HMZA 1Z7S2 4QU2A 4C0BA 3RDIA 2BWAA 1AXKA 3RI9A 3WCRA 1R082 3KT7A 4JDOA 4YG0A 1MS4A 1ZREA 1UL9A 3ETQA 4ORFA 3ALQA 1IS6A 2NZ9A 2JG8B 1W6NB 1LJ7A 2EIGA 2Y0OA 3OYWA 3PTYA 3R4DB 3WR0A 5BV6A 4XOGA 2XJVA 3H1YA 1YFYA 4FOVA 2G4IA 1AL22 1A8MA 4FCAA 1U12A 3NAPC 4Q4W3 4YW2A 4AE2A 4BPZA 2DURA 5TSWA 1W39A 4K1ZA 1DQ5A 2ZGOA 3E5UA 2DVGA 2GNTA 4RR3C 2P17A 4IEPA 5BNOA 4F7ZA 3B02A 2R1BA 1XU1A 1WA4A 1POV0 2W08A 4XFGA 3JQWA 2N7GA 3QLQA 4A7KA 4XJWA 1ZZBA 4EN8B 1G9BA 3OY8A 1UX6A 3WDUA 4RSUA 1Y43B 1ZBA1 3AYAA 2ATFA 1MEC3 1KITA 2QVSB 1IZ3A 1C57A 3ZIWA 3B7MA 2O8OA 2HWE2 1MS1A 1QJU1 3UL2A 3NV2A 4DB5A 2OA2A 2HWB3 1XYPA 4IV1B 1JBCA 2PELA 5HXVA 1OA3A 2WFF1 3ELNA 3AX4A 2VVDA 3KS7A 1BMV1 1ALYA 3JU9A 3J4UH 5JVVA 5FLHA 3AYEA 4L92A 5SV5A 5FOBB 1PGL1 3CNAA 4P9IA 2WINB 4OI1A 1RUD2 5H9PA 5FPXA 4JTOA 5IT6A 4IEQA 2MEV3 1SCSA 1DHKB 5LK7B 3H7YA 4NHLA 1ND3A 2JECA 1O5UA 1U5ZA 1AX1A 1G6NA 3VBSA 1OA2A 1D4M1 3EJKA 4B7KA 5FTTC 3O14A 1QJZA 2P34A 4QMAA 4EV0A 4Y1ZA 3WLUA 2HWD1 4W6XA 4L97A 3WP5A 3POYA 4XEZA 5DZFA 3AYDA 4AFDA 1REFA 2PHLA 1VR3A 4LBQA 4YRDA 2SLIA 3S30A 3D0JA 1Z78A 4P9YA 5BNNB 2XPJA 1W6MA 4YVSC 1PNGA 2DVAA 1RHI2 1REDA 1ENRA 1LHWA 5C8CC 2R1DA 1W0OA 3D4KA 3AJZA 2PTMA 1YI7A 1AR73 2GMEA 1DGWX 3CU7A 5BNPC 1CAUB 2HEWF 1QXRA 4NHMA 3ZMNA 4CEYA 2XBO1 4O9GA 4A3XA 1NY71 4N53B 1S2BA 1I3HA 1BCXA 4CZSA 2SBAA 1H2KA 4LEJA 4BWOA 3ZMOA 3WP6A 4DOUA 2DV9A 2R49A 1TME2 3MW3A 1QOOA