1R082

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08200
4CEYC 3JBG1 1FPN3 1R1A3 5C4WC 2WFF1 5L7OC 4RQPA 5BNNA 1POV1 1RHI2 2PLV2 1AYM2 1Z7S2 5CFDC 1RUG3 2RS31 4PDWC 1OHFA 5ACA3 1B35B 1NA1B 1PO23 5DDJ2 1OOPA 1D4M3 3VBHA 5CFDA 3NAPA 3VBFC 4WM7A 4YVSA 4QPGA 1R081 4CEYA 1HRV3 5L7OA 5C9AA 3M8LA 5C4WA 1VBA3 1EV12 3HAGA 4CDQA 2RS13 1B35C 1NA1C 1AR63 3DPRB 1ND2C 1VBD3 4Q4X1 3VBFB 3CJIC 1K5MA 2HWB2 2HWD3 2WS92 4WM8C 4QPIA 3VBUC 1QJY3 2RS51 5DDJ3 2WZR2 1C8NA 2GSYA 1TME3 2RS11 1COV1 1AR73 4Z92B 1QJU3 3CJIB 3DPRC 1RVF2 3S6PA 1FPN2 4GH4B 1TMF1 1D4M1 4JGYA 4PDWA 4GH4A 1F2NA 1FMD2 3VDDC 1PO11 3ZFEA 2BFUS 1AR91 1C8M1 1RUH1 1RUF2 3VBRB 2HWB1 1HXS3 5AC93 1V9U2 1VB2A 1VBD1 4Q4X3 4CDUA 4Q4V2 1FMD3 1BBT2 1RVF1 4QPIB 1K5MB 5C8CA 1RUD1 5C9AC 3ZFEB 2DF7A 2X5IB 1HXS2 1A6CA 1F8VA 1PO21 5K0UB 4QPGB 1AR92 1C8M2 1K5MC 1RUH2 2WS91 4NWWA 2RS32 1PVC3 4QPIC 1RUC3 1BBT1 1VBA1 5A32B 1BMV2 2VQ0A 2ZAHA 5K0UC 4SBVA 1RMU3 1RUD2 5BNOC 3ZFFB 1QJX1 1R1A1 2WFF2 2WFF3 1BEV3 4CDWC 1EV13 1ZBA1 4N53C 4QPGC 5AC92 4BCUA 5BNNB 1HRI2 1AYM1 1CD3G 4RR3A 4FTEA 1RUI1 5K0UA 2BUKA 4FTSA 2RS33 2R071 4IV1C 1Z7S1 1OPOA 3TN92 2HWE1 1ZBE1 2FZ1A 2RR11 4WM8A 1TME2 1CJDA 5A33B 2RS12 1H8TB 1AYM3 1RUE2 4CEWC 2MEV1 1EAH3 3VBRA 1R082 4RS5A 3JB8A 2WZR3 4RS5B 1FOD1 3VBHC 1QQP2 1AL21 1OOPC 1VBB3 1AR72 4WM7C 1HXS1 5AC91 1NCQA 2ZZQA 2WS93 4AEDC 5ABJC 1EAH2 1H8TC 1VBE1 3VBFA 1PGW2 1R092 2R061 1PIV2 1PIV3 1VRH1 1PGL2 4GMP3 1NCQC 2WZR1 4IV3C 5J98B 1AL23 3VBOA 1BEV1 1AR61 5JZGC 4WM7B 1TMF3 1NG0A 4JGZC 4RQPC 5BNOA 2HWC1 4JGYB 1ASJ3 4Q4Y2 2XBO1 5D8AC 4GB32 3VBOC 1MQTC 4IV3B 1VBC2 1E57A 1EAH1 3DPRA 1Z7S3 2RR13 1AR71 3VBSC 1QJY2 1AUYA 1PGL1 2PLV1 4IV1A 4N43B 4Q4V1 1VBB1 5D8AB 1RUF1 4JGYC 1AR62 1RHI3 4CDUB 2WLPA 1RMU2 1RUD3 5CFCB 2GH8A 2RMU1 3VBOB 5BNPB 3FBMA 4RHV1 1ZBA2 1QJU1 2Y26A 1HRI1 3JBG3 4CDWA 1VBC1 2HWF2 1ND3A 2XBO2 1HX6A 4FSJA 1RHI1 1IHMA 3ZFEC 1ND3B 2RM21 2BFUL 5DDJ1 4Q4W2 1PGW1 1R091 1DDLA 1VB4A 5CFCC 5FMOS 1TME1 1PVC2 1AR81 1COV2 5A32A 1V9U3 4CDQB 4GB33 2RMU2 1POV0 3VDDB 1EV11 1ZBA3 4YVSB 1BMV1 1RVF3 1FPN1 1RUI2 1RUI3 4Q4X2 4RFT0 3NAPC 1RUF3 4Q4Y1 1M06G 3VBRC 1QQP1 3ZFGC 2R043 2QQPA 2RMU3 1AYN2 4GMP1 1BBT3 1QJZA 1VBE2 1NY71 2HWE3 2RR12 4N53B 5CFCA 5C8CB 1AR93 1C8M3 1RUH3 3JD72 1HQNA 5ACA1 2R072 4EJRA 1PO12 3NAPB 1RUJ2 1VBB2 1MEC1 3ZFGB 1RUG1 1H8TA 1NCRC 1QQP3 1SMVA 2RM23 2R041 2HWD2 1TMF2 3VBUB 4N53A 4LLFA 1WCDJ 1FOD3 2WWSA 4GB31 1D4M2 4PDWB 4NWVA 4RR3B 1VAKA 1R093 2R062 2R063 1NCRB 3TN93 1RB8G 3ZFFC 1PO13 3CJIA 1RUC1 3J8F3 2R073 4Q4W1 1OOPB 1B35A 1MEC2 3JD73 1NA1A 1VBA2 2HWD1 3VBSA 1HRI3 4FTBA 3ZFGA 4RR3C 2HWC2 2HWC3 1ND2A 5J96B 1ND2B 1BEV2 1ASJ2 4Q4Y3 1QJU2 4IV1B 4GMP0 4N43A 1PO22 4WM8B 1R083 2XPJA 1MEC3 1R1A2 5JZGB 2X5IA 1VRH3 5FOJB 4IV3A 1AL0G 1AR83 4JGZB 4RQPB 5JZGA 1AYN1 1NCRA 2PLV3 5BNPA 4YVWA 2FZ2A 5C9AB 2HWB3 1X33A 5ACA2 1MQTB 2BPA2 1QJY1 1MQTA 4CDXA 4RS5C 3VBHB 4GH4C 2XBO3 3VBSB 1RUG2 4RHV2 2ZTNA 4AEDB 4N43C 4AEDA 1HRV2 5ABJB 1RMU1 1QJX2 1QJX3 2MEV2 1FOD2 4CDXC 3LOBA 4CDUC 1FMD1 1ASJ1 4Q4V3 2RM22 1NCQB 1RUE3 3TN91 1VBE3 2HWE2 4YVWC 3J8F1 4Q4W3 2HWF1 3JB4C 3ZFFA 3JD71 1PVC1 5ABJA 1V9U1 1PIV1 3IDEA 2RS52 1NOVA 1RUC2 1ZBE2 1ZBE3 5LK7B 1ND3C 1AYN3 4CDXB 1AR82 2R042 1VBC3 1POV3 5D8AA 1RUE1 2X5IC 2MEV3 3VDDA 2BBVA 4Y5Z0 1GFF2 4CDQC 4YVWB 4Y4YA 1COV3 1HRV1 3JBG2 2TBVA 4CEWA 1NY72 1RUJ3 4CEWB 4YVSC 1AL22 3VBUA 5C4WB 5FMOL 5BNPC 5L7OB 4CEYB 5BNOB 3J8F2 5GKAC 4CDWB 2RS53 5A33A 1W39A 1VBD2 1VRH2 2IZWA 5CFDB 2HWF3 5BNNC 5C8CC 1RUJ1 3ZXAC 4JGZA 4RHV3 1X36A
chains in the Genus database with same CATH superfamily
3B94A 1MZ6A 4AI9A 3LA2A 3NNJA 5EZWA 4FPFA 1UXXX 4CEYC 4XFCA 3FBYA 2QQUA 2ZEWA 3AVSA 3KHCA 1R1A3 2A1XA 5JR2A 3CKHA 1W6OB 4XBNA 4K21A 3TWIA 1W8OA 1XE0A 2OKXA 1RHI2 4DEVA 3DXTA 3IT8A 1LULA 5LB6A 4JDMA 1FV2A 4BOWA 1OKOA 2XL7A 1GZWB 4L92A 1TNRA 3FMGA 1PHMA 4IW3A 5F3EA 4PDWC 3ZSKA 5LCWL 4JTOA 3VHPA 1I9RA 1OOPA 2LM3A 4OI4A 3UETA 4CU6A 2JG9B 3VBHA 1LAJA 5CFDA 5L9RA 3KV6A 3HVDA 5JOXA 1J3RA 1NZIA 3WEZA 1PK6A 1DCSA 5IVYA 4B7KA 4IE6A 1HRV3 1S0JA 4F3JA 3ENRA 5F2SA 5C9AA 5L7OA 4QQPA 1H1MA 4XF4A 2YGMA 1F5JA 1CAXB 1LESA 1LHVA 5DG1A 1SLTA 3NMBA 4L97A 1UY3A 2DVBA 1YC61 1B35C 2JE9A 4CDQA 3K3NA 2WO3A 1ND2C 2QQNA 3MV11 1WLTA 4LO8A 2DCYA 4P9GA 1A78A 5FZDA 4U2AA 3VBFB 5CVRA 1K5MA 2HWB2 2WS92 4HBNA 3I3QA 3ZXEA 4KWUA 1QJY3 3B7MA 3AMPA 3ES4A 2XUEA 4AR2A 4A7ZA 3O7OA 5IHRA 1G9FA 3QOPA 2WZR2 1UX6A 1W3XA 5BNQA 1CAVA 1MVEA 2JDAA 1NUKA 2WFPA 4NAOA 1COV1 1G9AA 3WDVA 3ZYIB 5JOZA 2NZ9A 1QHDA 2XOMA 3MF6A 3N9MA 4WVVA 1GZWA 4Z92B 5E6HA 4MZUA 5CNAA 1LB2A 2VC9A 1KS5A 2GNDA 3CJIB 3H1YA 3LEMA 4ZS3A 2CV6A 5C5TA 1QOOA 5IWFA 4UYBA 3Q9OA 1RGSA 3OF1A 2WYFA 1GYKA 1OF4A 4GH4B 2VQAA 1UYZA 4DPNA 3H3LA 4JGYA 2EIBA 1IG0A 5FY0A 4GH4A 3EQEA 3ZM8A 3D0SA 4V2WA 3LPGA 1VMHA 3LSEA 2DURA 1SACA 3BOWA 3GM8A 4XBLA 1Y9GA 4ES8A 2BU9A 3WSOA 4Y22A 5FYMA 1JYIA 3T3YA 3GXUA 2E33A 2JD9A 4N7UA 5F32A 1DYPA 4HG6B 4JZRA 2BFUS 1AR91 3OJBA 2HWB1 4GWIA 1Q8PA 1W8WA 2CHHA 1TG7A 4QDQA 3P3NA 4UFIA 1MZFA 2XKOA 1LOCA 2BTVC 5EWSA 3TEZA 4JDOA 4QQLA 2F6BA 1BVP1 4WVZA 4MXWA 1VR3A 5FPXA 4P9LA 2W9XA 1KD7A 3AXDA 2K46A 1UU6A 2GH2A 2WNVB 4KG8A 3RWKX 3VKLA 4EQVA 3VUOA 4C1XA 2E7QA 5C9AC 3ZFEB 4E4HA 2BOIA 1GWKA 3BU0A 5H9QA 3L2YA 2DF7A 3KM5A 4XFGA 2VPVA 1OA3A 5HCFA 1UY1A 1EPZA 3EXUA 2I2SA 2H0BA 2JKXA 1N3QA 1YFYA 1A6CA 2E26A 4W8JA 4XBQA 3H7JA 3AM2A 3E97A 4NRMA 1K5MC 1RUH2 2YPDA 2ZGRA 4Q8LA 4XACA 3ZSJA 4HVQA 1H2LA 3J7NA 4XUNA 4AK3A 4EN6B 4TWTA 3S5AA 2QJVA 4PQ9A 4QX2A 1RUC3 4LPLA 4QDSA 4S2HA 3W9AA 1BBT1 1ZA4A 1VBA1 5F39A 5APAA 5I91A 2VQ0A 2Q1ZB 4FPEA 5A3NA 1F35A 2VZUA 4LNVA 4D7TA 4D6RA 2WFF2 1BEV3 4CDWC 1WWYA 1ZBA1 2OX0A 5A6YA 5AC92 1XE8A 1VRBA 5A1FA 1ULPA 1GZTA 1AYM1 1CD3G 3V65A 4BIFA 1RUI1 3C2UA 5L9VA 2B4KA 2ZHNA 2WT1A 4JDNA 3MPPG 4BQXA 3VZNA 3RZKA 3AKTA 4Q1PA 2CAVA 2RS33 1XU2A 2W95A 3M2MA 3APBA 4AVBA 2NP0A 4PF1A 1JW6A 1W03A 1OPOA 4JQRA 4OMCA 1JU3A 5FYZA 2FD8A 3CDZB 1AJOA 2RR11 4WM8A 2PHWA 3POJA 3MEPA 5A33B 3TEYA 5IFPA 5C5UA 1X9PA 4AFCA 1AYM3 5JUVA 2V09A 3C7EA 4YSFA 2MEV1 1GMMA 2CTVA 4NPLA 5GZCA 2ZHKA 5DXDA 5K7PA 2GN3A 2WWJA 2VOXA 3MUZ1 3VBRA 3PU8A 3IDCB 2VTFA 3D0JA 2Z4FA 4NHLA 1C4RA 3ZYPA 2D3RA 3JB8A 4RS5B 4X8NA 1FOD1 3K51A 5EHDA 1BCXA 1DHKB 1QQP2 1AL21 4FFFA 5LA2A 4XUQA 5T5JA 1HXS1 1WCSA 5AC91 2D6PA 4RGAA 3RMYA 5EQUA 2KM2A 2JICA 3KHBA 4AXOA 1PGW2 4BPZA 5I0DA 1V6MA 1YRZA 2VW0A 1R092 1REEA 3VKOA 3TNPB 3ZSLA 2WAAA 1CN1A 3LOIA 2RV9A 4Y24A 3ACHA 4GMP3 2IFRA 3MHZA 3AB0A 5CAZA 4CCJA 3U14A 2PAEA 2EA7A 2K9ZA 3DEMA 4IV3C 3T30A 4BLJA 5FKCA 5HI0A 1SZBA 3H50A 1OXCA 2Y6LA 3NNGA 1AR61 3LB9A 5FY1A 1HW5A 2WUHA 4Z82A 1LHNA 3O1UA 1O3TA 4H55A 1GOGA 1FI2A 2BJSA 4JGZC 3ZYRA 5F3GA 3OB8A 4CP9A 1VIWB 5FYHA 4TZDA 3DYPA 4BQ1A 1OBNA 2V4VA 5D2AA 3GCWA 4LO4B 5BXXA 1OA4A 4AI1A 4GB32 3T1MA 3EB7A 2VMFA 2NLRA 1MQTC 3AZWA 3MUY1 5K9YA 3K48A 4LA2A 1A3KA 2Z79A 2OUHA 4K40A 5TSWA 2OW4A 1WGPA 2C9AA 3HIFA 4J6GA 4QKNA 4QU2A 5A3WA 4BLIA 2OIIA 4XJWA 2Y6FA 2BNMA 1RYYA 2RJKA 3HNBM 1ULEA 3WG3A 1PGL1 3IDBB 4MHUA 1V6KA 4IV1A 3HD8B 4IDZA 4N43B 2EAKA 2D6LX 3PHMA 1L7LA 2ARBA 5L9BA 3FZ3A 4EN9B 1HLCA 1F9KA 4I0BA 5D8AB 2PHDA 4GJYA 2VXRA 4IE5A 4JGYC 4XUTA 1CGPA 5E88A 4MGTA 4CDUB 3N7MA 4XFBA 5FZCA 2CDOA 4FOWA 5FO8B 5CFCB 1JYWA 3O1OA 5GZFA 3RJ2X 3ZO0B 1K12A 1PZ9A 4M0NA 4RHV1 1ZBA2 2CGNA 3OBAA 2EIEA 4PLMA 1CX4A 2Y26A 4LBJA 4LXLA 4M3CE 2Y60A 3CZJA 4M3CF 3A22A 4G9SB 4MHRA 4YW2A 1IG3A 3JBG3 4A42A 3AXEA 2VMIA 2XDVA 5FPAA 3OBRA 5CADA 3AP6A 5CZKA 3VDBA 3GGLA 1LU1A 1JZ7A 2IC1A 2PAMA 2WBKA 5KXDA 4FSJA 1QU0A 4XCAA 3PJQA 5FTTC 2NM1A 4Q4W2 2G9ZA 3AYAA 3JUUA 1UX7A 1C28A 1OUSA 2ZEZA 3E5QA 3KVBA 3LKJA 3KGZA 2XVKA 4CDQB 4YWAA 1ZZ9A 4HVRA 1RINA 3WF1A 2BYVE 3J26N 3L2HA 1GP5A 2GZWA 3ZYGA 4XTMA 1H2MA 1SFNA 4I30A 2VE1A 3POFA 2PQSA 4FT8A 5DAXA 3HWJA 1JYNA 4JTNA 3RZMA 1J59A 2JG8A 5G04L 4LJHA 4E8DA 3H8OA 1RVF3 5JI7A 4EV0A 1UY2A 1W6NA 2ARCA 2PFWA 3I2JA 3LIGA 3PUIA 1QOSA 4IE4A 3UKTA 1AF9A 1GQHA 5FUIA 2VH9A 3VV1A 4MGSA 1QQP1 3VKMA 2YBPA 5LRRA 3FHQA 1MR5A 1KITA 2R043 2W87A 3LSDA 2RDRA 3M7AA 4BISA 1L7RA 1AYN2 1QNWA 3ASIA 3BALA 3LA3A 4LHNA 2Y0IA 3BTYA 1N3PA 1O91A 1RL3A 2DVFA 2ETEA 2HWE3 1WMEA 4N53B 3FE5A 3MW4A 5K8SA 3KT7A 5C8CB 1UXZA 4UFHA 1GQPA 2VBBA 4KWJA 4XQ4A 3TBDA 5ACA1 4A6OA 1PO12 4AYUA 4WZFA 1BKZA 2J7MA 3W21A 3UGGA 3ZFGB 2D6OX 4BH9A 3NV3A 4NIAA 4P5YA 3VBUB 3BKZA 3A4UA 4A3ZA 1WCDJ 2IXHA 1O4ZA 1PK6C 1FAYA 2WWSA 1AXYA 4ORFA 3RYKA 3UYJA 3ACLA 3SEPA 2Y8KA 2J1VA 3LDRA 3FC0A 1ZZ7A 4GB31 2VZTA 1W28A 2P3KA 3KT4A 3LEIA 1D4M2 2BWCA 2YXSA 1SPPB 1T6BX 2WQ4A 1LRHA 2ZAAA 5LA9A 3VD4A 1LEMA 2JG9C 4OZXA 3GNEA 4I0AA 4AEMA 3ZFFC 1PO13 4ZPIA 4ZZ8A 1WMDA 2DYCA 4NHYA 4XEZA 1NA1A 5KXEA 4QGNA 3FHAA 4L0PA 2NPIA 1HV1A 5A3UA 1GUIA 3D4KA 1F4HA 3BPSA 1DFQA 1HRI3 3ZFGA 4RR3C 3Q8BA 1LOEA 1ND2B 1W9WA 3B02A 2W1UA 4GKXA 5F6KA 4IV1B 4N43A 2XXZA 2VNOA 4YW3A 2XLGA 1MEC3 1ZNPA 4LK7A 3WLUA 3GBFA 2Y6GA 3OD4A 1VRH3 5FOBB 1UMZA 5FY8A 4XJUA 2OZ6A 2FCVA 2WA3A 5FLIA 4AL9A 4FAHA 1P8JA 1AX1A 3KVAA 3O14A 3OGVA 3WDWA 2FZ2A 5F5AA 4E4ZA 4NN0A 1X33A 1GLHA 3MGUA 3DKWA 3CZUA 2E7TA 3LDKA 3ALQA 1FNYA 3WCRA 2J1SA 4D94A 1MQTA 2XLFA 2GC1A 4BB3A 4XYXA 4YZ4A 4FPYA 2QCSB 5JIUA 4RS5C 3IZOA 1XPWA 2ZMLA 4Y20B 2ORZA 5KC6A 2WNEA 4GH4C 4P08A 1VE0A 3G6JB 3ZXLA 5ABJB 5FAXA 1ZA7A 1E5IA 1S2EA 1VAVA 1JS9A 2P3YA 2P34A 4MLOA 1KEXA 5FPUA 3M1HA 2JDYA 2A6VA 4Q4V3 3K4DA 1X7NA 5FPLA 3OY8B 5LY1A 4YG3A 4DIQA 2DVDA 1VBE3 4W4ZA 4YVWC 4AQ6A 2HWF1 4Q0UA 4AF9A 4CUGA 5FBJA 4E8CA 3WINE 5EV7A 4EROA 1SG3A 5L19A 1GR3A 2RS52 4HSJA 2OUJA 1NQJA 5FZFA 1NOVA 1H30A 2Q8EA 2GALA 4XMAA 5A3OA 1XU1A 1ZBE2 1HV0A 5IAXA 4KU7A 1NLRA 3ZXDA 1MS8A 4F7ZA 1AR82 4QM9A 4A7YA 1IPKA 2CYFA 4LBMA 2ZPXA 5FO7B 3W5NA 1NAEA 5CIRA 3VDDA 2ET1A 3LAGA 3ZMOA 3A0NA 4YVWB 3MBWA 2VECA 4P5HA 1WW4A 1BHGA 1COV3 3POEA 2VR4A 4X8PA 3SLIA 5GZDA 3X29B 4D7SA 5FUPA 2ZEXA 3AZXA 2ILMA 5HPOA 3LD8A 1SBFA 2A6ZA 3N9PA 4X6QB 4YVSC 3USUA 5JMCA 2QQVA 3SNMA 5CG8A 1OVPA 4LITA 3VBUA 4XFAA 1APNA 2FDIA 3TAYA 1CZSA 3D6EA 4KMQA 5IATA 2EVXA 4AHYA 3ETQA 4ASMB 4HETA 3GCXA 5JSPA 4KNCA 3BODA 4CPBA 3ZYHA 3R6SA 1HN0A 3NKGA 1PX4A 3O0VA 3ZXGA 4KH9A 4CDWB 2A5ZA 3UKNA 2W52A 1VBD2 1VRH2 4JHTA 3ZOIA 1OVSA 3D5OA 5FZ1A 1RUJ1 3GYDA 5KHIA 3NV4A 1H9PA 3LWCA 4LBQB 3W5MA 4RQPA 4RHV3 3CBNA 2EIGA 1X36A 3FFQA 3I97A 4META 2IVJA 5FZ3A 5KXCA 1RITA 3WF2A 3M3QA 5A3TA 2QE3A 5DAWA 4IERA 5A7OA 4GULA 1FPN3 2WFF1 5L73A 5C3QA 5JR7B 5FR3A 2GNTA 5L7OC 1KFXL 3FLTA 3ZR5A 4JV4A 3I4IA 2XMLA 5LK5A 3AP7A 1AYM2 5I8SA 2VTXA 3V64A 1Z7S2 3R0RA 5T5OA 4AHWA 4XFIA 5FY7A 3ACGA 1XRUA 2W1SA 1CX1A 3BGAA 1J58A 1PVXA 2VOTA 4LKDA 4NPRA 4W65A 5FYSA 3OGJA 2RS31 3AC0A 5ACA3 1B35B 3LEKA 5GM0A 3WNKA 4PCRA 2I45A 1KDMA 5FQ0B 4BMBA 4IEWA 1D4M3 1H1AA 2Q1FA 4CPBD 4QT6A 3VBFC 5EJ3A 2JG8B 5K4LA 1W6QA 2BEOA 2AUYA 3AKRA 4AHXA 4ARXA 3KQRA 2G9FA 3R05A 5IVEA 1YQ5A 3M8LA 3E5UA 3HPNA 2AACA 1XBFA 1LGBA 3W58A 4BXFA 5HCHA 2NN8A 1H6YA 1ULGA 2VL4A 1MPXA 1ULCA 4OLLA 3F95A 2ZCWA 3RNSA 3BTZA 1KQRA 1QXJA 4J1WA 3H8RA 3ETPA 2N7GA 3B01A 3I2HA 1YJLA 1JYXA 2C6SA 1RXFA 3CJIC 3UJOA 5HXMA 2C1FA 4WM8C 1HIXA 1J3PA 5F5IA 3VBUC 1JZ6A 3CL1A 2RS51 2ADDA 1QY4A 4O9GA 5DDJ3 1REFA 3ZVXA 1SLIA 2GC3A 1C8NA 4Y1ZA 3WD5A 1CVNA 2W92A 3I2DA 4CTEA 1NX9A 2UWCA 3UJQA 1DIWA 1AR73 2WKKA 2CY6A 2VCMA 3LFIA 4D6QA 2A6WA 3I3BA 4YW1A 2WN3A 5FYYA 4ZHNA 3DPRC 2YBSA 4DRVA 1K3IA 1RVF2 2Z69A 1CPNA 2HJIA 1SBDA 2VUDA 5JXJA 1V6LA 1QIQA 4M0HA 5FIXA 3SEEA 3T2PA 3U0ZA 2XJSA 3WHTA 1F2NA 4XF0A 3HOBA 1YFXA 3VZLA 1GP4A 2D93A 1IGOA 5BV6A 1PO11 1Q3EA 1ZZCA 2EICA 4NHXA 1G86A 5C70A 4PIZA 4PIYA 2JDHA 5EYXA 1AJKA 4ITCA 3VBRB 5FYBA 4MGYE 2VMGA 1VB2A 1S4CA 1WD4A 1VBD1 4Q4X3 3KLSA 4DXZA 2EXIA 4QQHA 2FDJA 4LIVA 4QX0A 1YXWA 2LUWA 4XFHA 2XGXA 3U07A 2PHFA 4ATFA 1SLBA 4CCNA 2ZEYA 2XJRA 2ZMKA 5CB7A 5FYTA 2H0VA 5KHKA 1GU3A 1K5MB 2HYXA 3KCYA 1W99A 3J9SA 4UW5A 5C8CA 1QXRA 2VZQA 3PUQA 3ZPOA 4QX5A 4XMIA 2TNFA 1C5HA 3CEWA 4Y4RA 4CE8A 3M4FA 1MZEA 5LA1A 4FFGA 1LENA 1HXS2 3AZVA 3NW4A 4MG2A 4O61A 2XG3A 1LOFC 2XKPA 5K0UB 2HYKA 2A6XA 3BOPA 5AFEA 2ENRA 3UV9A 3USSA 3VLBB 4DUVA 2Q4SA 3IPVA 3NJXA 3IN9A 1C8M2 3M3CA 2RS32 3VL9A 2NYYA 3JQWA 4BZ4A 1QDOA 3PJYA 1WLDA 1YYNA 4XZUG 1NKGA 1KFUL 2XVGA 3HBZA 1H4GA 4HSLA 3OPWA 4HK8A 2WNOA 4O7XA 3SCFA 3PMSA 4C90A 3NVCA 3AZZA 4QXCA 4XZPA 2A7AA 5A32B 1JBCA 1LGCA 4FFHA 2ZAHA 2R30A 3T0AA 2JECA 4B3NA 3Q8AA 4YZ2A 3RZHA 5C8WA 1RUD2 1POQA 5BNOC 3MW2A 2WABA 1N1VA 2WFF3 1O7FA 4E4SA 3RSJA 4RFRB 4IEVA 2DCKA 4N53C 2A71A 2ZA9A 4GXLA 4LBNA 5IVCA 4QPGC 5A6QA 4MGKE 4YGEA 1SFPA 5BNNB 5JXHA 1SPPA 4FTEA 1XYPA 5FMBA 2C0ZA 4BDVB 4EE2A 2BUKA 3K3OA 1UD1A 1UKRA 4MXVA 3ZYJB 4AQ2A 5AFBA 4OHZA 5GZEA 3ZPYA 3BUCA 1ONAA 1UWWA 4Q27A 4OZOA 2R071 4TLGA 1ENRA 3FWEA 1O5UA 2E32A 2WDBA 3CJXA 3T4VA 4QXHA 2RHPA 3TN92 2HWE1 5DPNA 1LNSA 1UW8A 3FL7A 1OLRA 3VDCA 1IS4A 1TME2 2UU8A 1CJDA 3KV5A 3POSA 5HCBA 4OCTA 4E27A 4LMFA 1UMIA 3BIWE 3UK9A 4CEWC 4XIKA 3FHIB 1Q8VA 2AGSA 3UT0A 3RZJA 1UMHA 1M4WA 4FPLA 2IXKA 2DCTA 3H9AA 4QKFA 1XE7A 4R9CA 1S1AA 4R9BA 4RS5A 5C3PA 1SHWB 4OUEA 3HNYM 2WO2A 4LOTA 3E6BA 1YHFA 5IYYA 5SV5A 5FZOB 3V0AA 5FFOC 1C57A 3THPA 1O8SA 3OEAA 1NCQA 2ZZQA 4AEDC 5J09A 2X09A 4XJ9A 4UT5A 3S7EA 1LJ7A 1DBNA 2ZKNA 1VBE1 3VBFA 3OG2A 1BQPA 1U5IA 1CAWB 2W39A 4QB1A 2EXKA 4FFIA 3ZIXA 1YWKA 3H1WA 1PIV2 3I7DA 4Q8KA 1QF3A 1H1IA 3AMMA 3ZXJA 4KGGA 1NCQC 2RDQA 1Z78A 2WZR1 1HN1A 1C1LA 1CIYA 5I0UA 3VBOA 4V2VA 5FZ8A 3ZMNA 1EUUA 4Y33A 3LQCA 4XJZA 2RE9A 4WM7B 2JDPA 3HNMA 3LGRA 2JIJA 4RQPC 2ZHLA 4YZ1A 1N1YA 1XJAA 1YO8A 4HANA 2Y0OA 3MIGA 5I8YA 2KR2A 3NSTA 2XBO1 2W0XA 3RWNA 2J42A 4XVHA 5SV8A 2B39A 4NAMA 2OPWA 5DZEA 1DP0A 4FOYA 2YV8A 4ARYA 4IV3B 1VBC2 3I8TA 4AFDA 1EAH1 3DPRA 3THCA 4UW6A 1Z7S3 3I59B 4L9BA 2NMNA 4B29A 2P1BA 4B1MA 4F83A 1UY0A 1QJY2 4XW3A 1AUYA 3WOGA 4FVVA 1GNZA 1H9WA 1YIFA 5JVVA 1O4TA 4YGCA 2FMDA 4MADA 4QGMA 4CYDA 3K46A 2D97A 5FDBA 2DVGA 1W0PA 1QOTA 3V0BA 1YFUA 2QBXA 1CONA 1RMU2 4LE4A 4RSUA 5FY5A 3CHXA 3HBKA 2FDHA 4YW7A 3VBOB 1OURA 3C8XA 5J3UA 4QQOA 2GP5A 2WT2A 4RGKA 5I93A 1QJU1 3FJSA 2H6CA 3VB9A 2PAKA 3W20A 5LWBA 4DRRA 2VZSA 3MZHA 4CDWA 1RJ7A 2ZGOA 2FDKA 2ZGNA 1RXGA 2JE7A 1NYWA 3OY8A 3HEIA 4AG4A 1FNZA 2XBO2 2XWBB 1HX6A 3ZFEC 1IKPA 2BFUL 1VP6A 2YGLA 4KBBA 4YNIA 5FP3A 3UKVA 1A8DA 4NVPA 2SBAA 3WNXA 1DLCA 2LS6A 1WD3A 4K3UA 5FMOS 1TME1 2XUMA 4FPKA 1COV2 1JHNA 4H3WA 2ZBJA 3ZR6A 4COWA 1LOFA 4IETA 4LBQA 3T4HB 1I6XA 2QNKA 4A6SA 1GWMA 2RMU2 1JZ2A 1S0DA 3MDPA 2BGCA 4LKFA 4AVAA 1ZBA3 3H3UA 4QHOA 3MI8A 3MLJA 5FLHA 1BZWA 4YVSB 2DBNA 4QHZA 5ANNA 1WBFA 4F8AA 2OYZA 1UYYA 1RUI3 5E1RA 4XXPA 5T50A 1ODMA 2XHNA 3AFKA 2PMWB 4NO4A 4RFT0 1O3RA 4XHXA 2VNRA 5HXVA 4EWDA 4OUSA 1GICA 5GLWA 4DO0A 1LEDA 3OUHA 3WP5A 5H9RA 4EN0A 5FYVA 4UW4A 5FREA 1JTZX 1JUIA 4HOOA 1VBE2 2ZGKA 1LOBA 1W9SA 1AR93 4B7EA 5FZMA 1JOJA 1HB3A 2VZVA 4AQTA 5BY5A 2VZ3A 1UZ0A 3MYXA 4QAWA 5IVJA 1IZ3A 4PT6A 5CKMA 1VBB2 3AYEA 3TRSB 4MVTA 2BRTA 4L99A 2RM23 2E9QA 5KHJA 4NOTA 4XDQA 3POGA 4NUBA 4QXKA 4XOGA 3LEGA 1Q5OA 5KBFA 1SFYA 1WBLA 4DNYA 1UZYA 2C24A 2ADEA 2D44A 2B7YA 1FOD3 3E1F1 3I59A 4O65A 3NL1A 1GSLA 1KS4A 2B5HA 3HN3A 4UW3A 1UQXA 4AVSA 1OH4A 4HKOA 2WT0A 2AREA 4XF1A 5FP9A 4AE2A 4GIQA 5IVBA 5EIYB 1BYHA 1NXMA 1W04A 1ZZ8A 1XC6A 2H6BA 3A21A 1W2NA 3DECA 4HKLA 1IQAA 3EHKA 3N9QA 1D2QA 4RR3B 3DKQA 4XUPA 2VO5A 3AYCA 5F3CA 1VAKA 1R093 5EFUA 4AFMA 2R062 3WXPA 4RD7A 2VNVA 3DF0A 1CR7A 5CKNA 3RFRA 4OI1A 4AAXA 1D4VB 2VMDA 3CJIA 1TE1B 3J8F3 3TEXA 2WJSA 1OOPB 3AYDA 3H3ZA 2JJ6A 2VZRA 3EYPA 1MEC2 5J48A 4OQ8A 1VBA2 3RJRA 3O12A 4EWAA 1BK0A 2O14A 2PYTA 3ACFA 3C7OA 2HWD1 3VBSA 5FUNA 1LGNA 2XH6A 3GHMA 1ND2A 2JX9A 4Q0SA 2HH9A 4HZFA 1ASJ2 4Q4Y3 1QJU2 4URTA 3SHRA 5D21A 3THTA 3WCSA 4HT1T 2ZKLA 3GHNA 5IJRA 3T08A 2D43A 4E9KA 5CBLA 5JZGB 2WSVA 4IEPA 3MFAA 1L3JA 3WUCA 3POIA 3ILFA 3M3IA 4JQTA 4XETA 5FY9A 4D69A 4PIXA 4LT5A 5JZGA 2PLV3 1AXKA 5BNPA 4YVWA 3OEBA 3ILNA 4HONA 5C9AB 3AVRA 3VL8A 1X82A 2XVLA 3NWKA 4BM8A 1RTVA 4QGLA 1W05A 1MQTB 2VU9A 4X6RB 1EP0A 2W5FA 3IIIA 1W3VA 3PVNA 3MIDA 3OUIA 2VY0A 4AWDA 4HVOA 4AGGA 2DVAA 3LA7A 2JIGA 2W47A 4AVTA 3J7MA 3VDAA 1GP6A 2J1TA 4N43C 5D1IA 2O8OA 5T52A 1QJX2 1QJX3 1FOD2 1UIKA 4R4XA 2DFBA 4CUCA 4ZKTB 2XONA 4OYUA 2ZX2A 1FMD1 2KXLA 1GNHA 3SMHA 1ASJ1 4UAPA 3ZX7A 4EZ4A 1JYVA 1OKQA 2CDPA 3NJZA 1UNBA 2RM22 4QXBA 1NCQB 1UIJA 2UY8A 2GC2A 1RUE3 1S0CA 3IPVB 3OPTA 3TN91 5J37A 1RUOA 2HWE2 2VGDA 3MF9A 4BJ0A 2GNBA 3J8F1 5FJKA 3KF5A 4E4DX 3JB4C 3I2FA 2XJQA 5C3SA 4OHVA 1PVC1 2VMCA 4RGGA 3AMNA 1V9U1 4LBKA 4A44A 3I2OA 4ET7A 2K2SA 2DCJA 1ZBE3 4EWEA 1A34A 1WUVA 2FDGA 2OZJA 2BZDA 2VCAA 2WYSA 3PUHA 4N7IA 4MXWB 1F31A 1ZRFA 4Q26A 1POV3 2D6KA 3VD3A 5GZGA 3W59A 1RUE1 5FXWA 1HJFA 3DCQA 2MEV3 2NQYA 3KWVA 5FZ0A 2A3XA 1OQDA 3WNMA 3E5XA 1LOAA 2VZ1A 3WV6A 3OGSA 2BW8A 1PNGA 1DGWA 3ZYBA 4B4QA 5JXGA 3GDBA 3KMHA 1CAUB 1KJLA 2WL1A 4A3XA 4FPJA 4P9JA 4R52A 3TB0A 1NY72 1RUJ3 4QQ2A 4XTPA 1CAUA 4R9AA 5IAVA 2BP6A 1HQWA 2KD7A 4M4RA 3AP9A 5FMOL 2Q5TA 3JZVA 5BNPC 3RQ0A 3SCGA 3J8F2 4DMIA 2XR4A 3ROUA 2X8KA 3ZN4A 4E2QA 3WDUA 3UL2A 2IZWA 1W2AX 1JOBA 3ZKYA 1OLQA 4I09A 5BNNC 5C8CC 4R8HA 2WQ8A 4JGZA 5AVPA 1TEIA 1XNBA 3PVEA 1GBGA 2WIIB 2AH2A 1G7YA 2Q8CA 4AGRA 3JBG1 4JHZA 4Z2AA 1H8VA 2VW2A 3OGRA 1DQ4A 2QZ3A 2E6VA 3WHUA 2MHFA 3CQOA 3WT3A 4CSWA 5BNNA 1POV1 1URXA 4YGBA 2XHKA 5FZOA 3V0AB 4LE3A 1XQNA 1W8TA 4NHKA 3U10A 1DGWX 4OULA 1RUG3 4BYYA 4COYA 5CFDC 1G9CA 3IDAA 1ZRDA 3I2IA 1FXZA 4QB2A 4MGQA 4B4PA 4DQAA 3I49A 1YFWA 2VVEA 5FXXA 2ZGLA 3D3AA 4I3GA 1DF0A 1OHFA 1WLWA 1NA1B 4G4FA 1PO23 3U11A 5DDJ2 2WWUA 2PHLA 3RMXA 2VW1A 4DS0A 4EN7B 1UU5A 2VMEA 3DUIA 4QM8A 5T3NA 2V72A 4BQ3A 2E31A 3O0XA 4YVSA 4H2AA 5FYCA 2V5DA 4HKWA 1CWPA 4QPGA 5LZ6A 1R081 3KSCA 4Q0PA 5C4WA 2EXJA 4LK6A 3HQRA 1DZQA 4LTAA 3VD7A 3HAGA 2QKDA 3RZLA 1ENSA 2RS13 1ZVFA 3AJYA 3WF0A 4AW7A 2DUQA 1MS3A 4K9SA 2PHXA 4M3CA 2JB8A 5T5PA 3TEWA 1K42A 3K4ZA 4YZ5A 1CZVA 2P37A 3ZYFA 1T6GC 4I3PA 4DY5A 4E2GA 2NMOA 4QPIA 4RN5A 5FP7A 4YYOA 5FZHA 2JDNA 2GSYA 4IEOA 4TSVA 1YJKA 4N9IA 3RVHA 5A6ZA 5A7QA 4IEXA 2RS11 4Y1XA 1LU2A 3ELNA 4LEJA 3KV4A 3TOJA 4COVA 1MACA 1YIPA 4ONUA 3TYJA 2RJLA 5IVFA 4KBZA 2ZX0A 3BB6A 1OH3A 5DUWA 1QJU3 1I5PA 5JIAA 4CU9A 3BYWA 3S6PA 5JDBA 1JMUB 3URFA 1FPN2 1OI6A 1D4M1 2HEWF 3PUSA 4IE0A 4XQWA 3MLLA 4LUKA 4LR4A 4QKDA 1DG6A 1IS3A 5FZ4A 1XB9A 5A7WB 3VDDC 4M3CB 2D6MA 3OTFA 1JZ4A 4RL7A 2XLAA 1LODA 1J84A 5HBAA 1EYBA 3ZFEA 2XJPA 5DMYA 4ISQA 3IM0A 1WW5A 2YC0A 3OYWB 1RUH1 2QUOA 2XL9A 1RUF2 3WW3A 2AZ5A 2WNUB 4COUA 5LBBA 5AC93 3O1TA 3PL0A 4CDUA 3VHOA 1UOJA 2X10A 3C7GA 4YW6A 2JEMA 1DYKA 4ZXEA 5H9PA 1FMD3 5FXZA 1BBT2 2CWSA 2OT7A 1W0NA 3E6DA 4QPIB 3EJKA 5LEJA 1S0EA 3U37A 3I3DA 5FMDA 3B9CA 4D0QA 4QU1A 5JXIA 3N3HA 5DUVA 1W9YA 2WRAA 2Y38A 4NMIA 2F4PA 1SBEA 4FOQA 4QX7A 2ZGPA 1JZ5A 1PO21 5A7WA 4AVCA 1TNFA 3VD5A 2ES3A 2D40A 3NRUA 3D82A 1PK6B 4YM0A 1AR92 3WUDA 4NWWA 4WVMB 4ES9A 1GWLA 3CU7A 5B4XA 4TLFA 3O1RA 1PVC3 2VVFA 4QPIC 1N1TA 2YU2A 2E51A 5IW0A 2PN5A 5LBEA 4NIHA 4JC1A 5ERLA 4OHXA 2I07B 3SKVA 1CESA 5A7PA 1XOYA 5A3MA 1U5XA 1PMJX 1V00A 3H42B 1V6IA 4YM3A 5HV0A 5K0UC 4SBVA 1NE4A 2ZX4A 3CF6E 3ZFFB 3KF3A 1XYOA 1H2NA 2XQRA 2W3JA 1EV13 3K75B 2WZEA 3GZUC 4Y5SA 1UN1A 4XURA 5C7GA 3WNLA 5EXOA 2X53S 5E8AA 4DXRA 4ZU7A 2P17A 4PLNA 4RR3A 1HKDA 2AC1A 3ITQA 3H8UA 5K0UA 3UESA 4UOJA 5E89A 1PGSA 3OUJA 5A7SA 1LECA 2LALA 1WA6X 2QQJA 4IV1C 4XFFA 2PHRA 1Z7S1 3T0BA 4IUGA 3EO6A 4D7YA 1OC1A 1ZBE1 2FZ1A 1G9BA 1BK1A 4BQ2A 4Y3OA 5FRAA 1F5FA 3WVJA 1MS4A 4MX3A 2RS12 1SCRA 1H8TB 1ZRRA 4QX1A 1W6PA 3ECQA 3Q8FA 4WV8A 4YZ3A 5F6LB 4XJ8A 1OSGA 2JG9A 1VPHA 3SC7X 1VJ2A 3INAA 1C3HA 2L9LA 4L11A 2ID4A 3JCIA 5FPZA 2F17A 4RYDA 4QD2A 4UFLA 4XCBA 1LHOA 2Z5WA 5EJZB 5KHHA 1MS1A 4DFSA 4DXTA 2VQTA 4JKKA 3ZSEA 4CXYA 4P14A 3RGBA 2RDNA 1WCUA 3Q8EA 3VBHC 2WZR3 5C33A 2HBTA 2VXJA 4LULA 4RA0A 1OOPC 2DUOA 1VBB3 1AR72 1QH7A 2VNGA 1UZZA 2R1DA 4IE7A 4D3WA 2WS93 1FX5A 3P5BA 2JE8A 1OUXA 5ABJC 4LKEA 1H8TC 3OSDA 4UXAA 5KWRA 3PIGA 3AL6A 4CP9B 3IKWA 2RG4A 1KGYA 4WVWA 1G9DA 4IGQA 4QKBA 5F9TA 2R061 2P4EA 1W06A 2WNUA 1VRH1 4N9HA 1PGL2 2QQIA 2IXLA 1EUTA 2ZOEB 4CCOA 5IT6A 2FMYA 5F3IA 3KCCA 3U4XA 4QX3A 5J98B 5I0SA 1W90A 1AL23 2ARAA 2HEYF 4K1YA 1BEV1 3NKTA 1YUDA 5F1RA 1X50A 5JZGC 1KDKA 1TMF3 4S2FA 1NG0A 4XE9A 3WW4A 2G19A 4JGYB 4JKMA 4DZGA 1JXNA 1DZRA 1S55A 1NT0A 4TTGA 1XNAA 2W1QA 1E57A 2QQKA 1O3SA 3ZDVA 2IXIA 4IGPA 1YEWA 2CNAA 2RR13 1AR71 3VBSC 2FBEA 2WNVA 2BQPA 2G9GA 1CAXA 4INDA 2BWAA 2PLV1 4Q4V1 4P9YA 4H7LA 1VBB1 1W6NB 3R4UA 5DAQA 1DGRA 1AR62 3C7FA 4AI8A 2OPKA 4FQZA 4XF9A 1CIWA 2GDFA 5C3OA 4Q2FA 1DZTA 2RVAA 2Z42A 4JKLA 4UI9L 3FBMA 3N36A 1D0HA 2PTMA 4CRQA 1Y7BA 2J1AA 3WF4A 3RYRA 2VUCA 4NRQA 3KD4A 1X8EA 3VN4A 3PTRB 2B9VA 2VM9A 4FP2A 4Y1YA 4BMEA 4C0BA 4Z1VA 1JOPA 4CCEA 5LW9A 1LTEA 2DUPA 1KJRA 1GZCA 5F37A 4EYUA 4PF5A 2X05A 1I5ZA 2YY1A 3BTAA 1DQ5A 1RHI1 1UOFA 2P5BA 3LF7A 4ASKA 2RM21 4K7JA 5DDJ1 3S5QA 4IESA 2DBIA 3OPZA 1VB4A 3CNAA 3HQUA 5CFCC 1F15A 3O1VA 5FKBA 1PVC2 2O1QA 5A1LA 5GALA 3MIHA 4NPMA 3SXWA 1A8MA 3MPBA 1UOBA 1E5SA 3NNMA 1VALA 1RC6A 1POV0 1WW6A 3GZTB 3POYA 4BQWA 3VDDB 2VBPA 5JSRA 4LKSA 2ZJCA 3ME2A 2ZGTA 4UBGA 2Q0AA 4CCMA 1BMV1 3LDBA 2J22A 4YW4A 3J7LA 2WINB 1J83A 3NAPC 1CZTA 1RUF3 4Q4Y1 2OQ6A 2EF6A 3MO4A 4UFJA 5CKQA 2B46X 4M00A 5I0TA 1W2OA 3QACA 2DU0A 3KCXA 2QQPA 1O6UA 2R6QA 1IS6A 2JG8C 2WAOA 3NV2A 5BYNA 1ZYBA 1BBT3 2R0HA 1QWRA 1QEXA 1QJZA 3WG1A 1NY71 4R4ZA 2BV4A 4IXLA 1C8M3 3JD72 3MV01 3A0KA 1NXD1 1SLCA 2R072 2XB6C 2VMHA 4EJRA 3EMRA 1ZZBA 5GJ6A 5EJ1B 1SDDB 2IXCA 3BN6A 2CWMA 1OQ1A 2Y6HA 3I2GA 3M70A 5A70A 3QH7A 5HCAA 5IK4A 1NCRC 2R041 5LASA 1WA4A 2ERFA 2TEPA 5EPAA 1REDA 2JD4A 4GAZA 2P2KA 4CP1A 1OQEA 4N53A 2EXHA 3IMNA 4FCAA 4LLFA 1K45A 1OD3A 1QNYA 4FOVA 4Q0VA 2QQLA 3T1LA 5LA0A 1TZOA 2YU1A 3WR0A 4HPKA 1W6MA 3QD6A 2SLIA 4MYEA 1O3QA 3QLQA 2IWGB 5FY4A 3TNQA 1BXHA 2P6CA 1W2TA 4PDWB 1Q8QA 4FO9A 1N3OA 4Q29A 4C1WA 4WZCA 3BI3A 1UY4A 4K6BA 1UU4A 4YPJA 3SH3A 2RJ2A 2R063 2VTXJ 3PU3A 1NCRB 4KWLA 3TN93 4CP2A 1RB8G 1W0OA 4EZHA 4LBLA 3DN7A 1AXZA 2R073 4ZXKA 4Y5TA 3UGHA 1OPMA 1GQGA 4OVEA 1VMFA 1L7QA 3JD73 4YM2A 2VBDA 2YUEA 4CUBA 2XJTA 4FPOB 3UNPA 1QGLA 1TVGA 2AYHA 4FTBA 3J7HA 3V0BB 3PNAA 5DABA 2HWC2 2BOJA 1WMFA 3LE0A 3N7LA 5J96B 3GZEA 2PXJA 2BGOA 1ENXA 2J1EA 3U4SA 1X9TA 4A45A 2QDNA 4Z2WA 1O59A 1W8ZA 1Z0HA 4WVMA 3ZIWA 3WNNA 3IMMA 4GA9A 4AFAA 1GOHA 1PO22 4YM1A 1PMHX 2XPJA 4XDOA 1BLZA 4ZU4A 5T54A 4EN8B 1R1A2 5J36A 4YFZA 4P02B 2X5IA 3IBMA 1CPMA 1JHJA 1AL0G 1AR83 2ZGQA 1ULFA 4IEYA 4IV3A 4PI0A 4RQPB 5F7UA 2ZX1A 2WSUA 1PMIA 3N35A 5ISLA 5ANQA 5FZ9A 3N9LA 1JZ8A 3T2QA 3WX5A 3ZN6A 1Q8OA 1UZVA 4P9WA 1G8WA 2BNOA 2V5YA 1QJFA 3KB5A 1Q8SA 4LORA 4ZY9A 1QJY1 4K20A 2P6HA 4CDXA 3VBHB 1JODA 2D5FA 2DU1A 2ATFA 1H4HA 4BQYA 2W68A 1XYNA 3AZYA 1RUG2 2D7FA 2ZABA 4FPCA 4NRPA 4BHPA 2UWAA 2ZTNA 4AEDA 2A6YA 1IOAA 1RMU1 1WCKA 4A2UA 1R64A 4ZZ5A 2EALA 3KS7A 4GQ7A 1CAWA 4S2GA 4CDXC 3A23A 4NIDA 3G7DA 1S2BA 3MFCA 3LZZA 4YG0A 4OQ9A 4I02A 4JX0A 3GBGA 2HBUA 3RG0A 3WG2A 2WNUC 1Y9MA 2VOKA 4GD4A 1LR5A 1KXGA 4O9EA 4CU7A 4YARA 1XNKA 3AL5A 3ZFFA 2WO1A 1AHSA 1IKQA 3JD71 2Z2SB 5ABJA 1PIV1 3IDEA 5JPNB 4LBOA 2EIDA 1RUC2 2QTWB 4CXXA 1BJQA 1LHUA 2G4IA 2IFWA 3WDXA 5LK7B 4QMAA 2WN2A 4JRLA 1ND3C 1AYN3 1V6JA 2FCUA 4CDXB 4I2OA 2R042 2Q30A 4AHZA 2KA3A 4IGOA 3OD0A 3ZSMA 3ZN6B 4FXGB 4KGQA 5JLVA 1YQ8A 1FATA 2MNGA 1GFF2 4KG0A 3FLRA 2ZX3A 4Y4YA 4G3YC 2E63A 4ZONA 1W6MB 5FPVA 5FZGA 4P00B 3IIAA 4MV2A 2FDFA 2OQ7A 3H0OA 3HQXA 4CEWB 1MS0A 4QHBA 4WBBA 5FK8A 1AL22 1XXNA 1T2XA 2VULA 1HB4A 3DV8A 3WQ0A 4AQSA 3WDTA 5A3LA 2Q8DA 2JKBA 1ODNA 2B42B 5FZLA 2ZHMA 5C4WB 2AENA 4UFKA 1V0AA 3KGLA 5L7OB 3NV1A 4Z07A 3HR9A 4CEYB 5KC5A 1YCIA 2PHTA 5GKAC 3S7IA 1PZ7A 3RI9A 4LO6B 1W39A 4P9IA 1SLAA 4M4PA 3T2OA 2BNNA 1N47A 1VLNA 2UY9A 3C7HA 1EY2A 4BQ4A 4LIUA 3ZXAC 5CA6A 2UURA 2YDEA 2YMZA 5FZ7A 1W9TA 2R49A 1BVVA 5C3RA 1DGLA 3MIEA 4C8DA 1OLMA 2GAUA 3MW3A 5C4WC 1V6OA 4NIIA 2JDKA 4UBHA 1OLME 1MS5A 2PELA 2O8QA 3GF6A 1DYOA 4BE3A 1SLLA 5IK5A 1BMV2 1UCXA 2PLV2 5C6CA 3SITA 1UOGA 3LPFA 3QH6A 3OOXA 4MGIE 4Q1RA 5A3PA 3WP4A 1Q56A 2A3YA 4HXCA 1S0IA 3VZMA 1UL9A 1US2A 5LATA 2K0GA 1HB2A 4IEQA 2WZPP 2ET7A 1CAVB 4AI0A 5FPBA 4AVVA 4LQRA 4FXKB 4PBOA 3NAPA 2UYBA 1Y43B 1UKGA 4MH0E 4WM7A 2RDSA 1OFSA 2AEYA 1FT9A 4CEYA 4CU8A 4Y26A 4AZZA 3K77A 1JU4A 4XXAA 3O5SA 2GC0A 1VBA3 1EV12 1U5YA 3MLKA 4HPKB 5C71A 1NA1C 3RZGA 1AR63 2Y64A 3DPRB 1VBD3 4Q4X1 4DINB 5JOWA 3SCHA 3NJYA 1JYTA 2C9KA 1O8PA 3WNOA 2HWD3 4LHSA 1OT5A 2W2IA 1J1LA 3U75A 3S0MA 2C26A 4HN0A 5J7MA 1WMXA 1JZ3A 1ZRCA 2A3WA 1IPSA 5H9SA 1K5JA 5CYYA 2LRPA 3LCPA 1JN2P 1TME3 3VGIA 5T55A 4N8MA 4FQ4A 1OF3A 4LHKA 2ZMNA 4QX8A 3P6BA 2V73A 3PDQA 4BQ5A 4CCDA 2FQPA 2DV9A 5DZFA 3K2OA 3VD9A 4K1ZA 1N1SA 1TMF1 2JDUA 5B2GB 2AEZA 5FMCA 3RI8A 4V1PA 3L9JT 4PDWA 2J1RA 1XSRA 5FCCA 2VZOA 3THDA 3KQ4B 3ZN5A 1FMD2 2DDUA 1W9FA 3FLPA 4MO3M 3IWZA 3ZDSA 1MVQA 4Q5OA 5FZKA 1HDKA 5G05L 1V70A 1JH5A 2E7AA 3PVBB 1C8M1 2YZ4A 1UYPA 4OI0A 1HXS3 5DAVA 1V9U2 5GLTA 1FYUA 2O0OA 1ACCA 4Q4V2 3ES1A 2VCCA 1OD5A 1UYXA 4Y20A 4CP0A 1UO9A 5FZAA 5A7NA 4QB6A 1RVF1 4CUAA 1SQ4A 1VAMA 4MSVA 3E6CC 3B00A 4B1LA 5DUXA 1GNYA 1RUD1 4W6YA 4Y1UA 4IQPA 2DTYA 4JVAA 4PQQA 5A6XA 1Y3TA 2E53A 2V4AA 5DUUA 2XQXA 1Q43A 3GALA 1NE6A 3RRDA 3T2TA 1W8FA 3BIEA 4I0WB 1B09A 1W8UA 1TQ5A 2X5IB 5FZBA 1US3A 2CL2A 3F2ZA 4DOUA 1F8VA 5FO9B 2VAUA 3AMQA 2HKXA 3N7KA 1YNAA 2W46A 3I3EA 4QPGB 2D3PA 5LBFA 5LBCA 1W6QB 2XJUA 2WS91 4BK5A 2DWRA 3AKQA 1SCSA 2W08A 4BIOA 3ZLIA 3WW2A 3QBQA 1H6XA 4D8MA 1ALYA 1D2SA 3PUAA 1R1ZA 5F2WA 3NQHA 4YFWA 2ZGSA 3DXUA 2QZ2A 2IXJA 1RMU3 3B5LB 1ST8A 2BBAA 3WG4A 5KR7A 1QJX1 1R1A1 5BUVA 1O5LA 4L2NA 4OHWA 1GKBA 1QJEA 4R9DA 4W50A 1C5IA 4BCUA 1X8MA 1W6OA 1XNDA 1HRI2 4HLTA 3RDIA 5JMOA 5DG2A 5FWEA 4URAA 1HQLA 1ULOA 3WQBA 5E16A 3USUB 5FWJA 3CO2A 1H0BA 1WW7A 4YRDA 3WY6A 4FTSA 1S0FA 3A7QA 2YBKA 4KWKA 2YPJA 3MIBA 3VZOA 3CMGA 3T09A 3ON7A 1S0GA 4AOCA 1QDCA 3AJZA 4FPHA 4TYSA 2CGOA 3ZKUA 2OXBA 1W6PB 3BPZA 1RUE2 5L36A 4HL0A 1U12A 5I0RA 1EPWA 3I3MA 1EAH3 4AI2A 4GKYA 5IVVA 2B45X 3GZAA 4QPYA 4PJYA 3BVCA 4ZS2A 1R082 4Q0QA 2HLEA 3JQXA 2R1BA 3AFGA 3O0WA 3OGGA 3ST7A 1GANA 2Y34A 4WM7C 2PA7A 4XAAA 2BVBA 4A7KA 5KHGA 2GMPA 3HN1A 2B9UA 3Q8CA 4XJAA 3VKFC 4FP3A 3H1MA 3SKJE 1EAH2 5A80A 4E2SA 2VOWA 2ARXA 4L8QA 2I74A 2ZGUA 1GZ9A 4ZU5A 4XHBA 2WZ8A 2A73B 3O1SA 1PIV3 2YYOA 3HT1A 1AZDA 5M0TA 1UAIA 1AX2A 2TUNA 2VUAA 3FFZA 4H14A 3WQ7A 4BXSV 3DL3A 4AEKA 2D3SA 3K4AA 3ZXKA 2OVUA 4FAGA 5FBZA 5FYIA 3SQOA 2YC4A 1ZRIA 3HJRA 5A1AA 4Z8BA 4C91A 2CAUA 3HT2A 4XIOA 5BNOA 2HWC1 1U0AA 1ASJ3 1W8HA 3FUQA 4OFGA 3OCPA 4Q4Y2 5FQ0A 3GJAA 5D8AC 2D5HA 4AI3A 1E5HA 3VBOC 5F8PA 3J4UH 2R7EB 2UYAA 2WA4A 4BWOA 1H2KA 2YB7A 2ZZJA 4Y22B 4CVUA 5LEKA 2P3JA 2LROA 3KT1A 1GV9A 4XAEA 5CISA 4LBQD 4LO7A 1HJGA 2WLQA 1XNCA 2OS2A 3NNLA 3WF3A 3H7YA 4HFSA 4AEJA 2YG0A 3R4SA 1RUF1 4JRAA 4NE9A 1RHI3 2WLPA 4XPVA 1IPJA 2QVSB 1RUD3 1QMJA 3IAPA 1JUHA 5FLJA 4GJZA 2GH8A 2RMU1 3NJVA 3WP6A 5BNPB 2GMEA 4SLIA 3OBTA 2BDRA 3AMHA 1Y4WA 3POBA 4C0HA 3BU7A 3D8CA 1NQDA 3PTYA 5FJHA 4MGZE 1HRI1 1LKNA 3DYOA 1VBC1 3V56A 4ATEA 2VQUA 5JOYA 2LTNA 2HWF2 2YC2A 4FPGA 1ND3A 2C5DA 1AX0A 2J1UA 2WNVC 5LRSA 4YW5A 4PLOA 1IHMA 1OFNA 4UFMA 1ND3B 3ABZA 4K8FA 2W1WA 1S2KA 5IK8A 1PGW1 3RZZA 5I8TA 1R091 1DU3D 2VG9A 5FK7A 5JI9A 1DDLA 3PIJA 3UGFA 1AR81 2B8MA 3POWA 1V9U3 4BK4A 5A32A 1ZZ6A 4NHMA 4MUVA 2QDRA 4GB33 1V6NA 2JENA 3GBWA 1EV11 5DAPA 5IK7A 3B9IA 2BVVA 3PLQA 2C4XA 5T5LA 5KXBA 2Q1MA 4CXWA 1FPN1 1UZWA 3HMYA 1RUI2 4Q4X2 3SH5A 5CEHA 1QXPA 1OA2A 1ZX5A 4W6WA 4Y1VA 1D7PM 2GP3A 1IQDC 1VMJA 4YGDA 3VBRC 3T0DA 1M06G 2ZGMA 3ATGA 3WQ1A 3ZFGC 1PNFA 3VZJA 3OBZA 3BCWA 3RYPA 2RMU3 2XWJB 4BA6A 4GMP1 3KZ4C 2QQMA 2IUWA 4PHZA 5DQ0A 2Q8OA 2D98A 4ISRA 2RR12 3S30A 4U36A 5CFCA 3S57A 1RUH3 2WR9A 5IUQA 1YQ6A 1HQNA 4LUMA 3DGTA 1Y9QA 1I1EA 1PM4A 3NAPB 4KI5M 4DXSA 5GLZA 3ILRA 1ENQA 1DQ0A 1RUJ2 1MEC1 4J25A 5LY2A 1RUG1 1H8TA 1SMVA 1QQP3 3P1IA 3PVOA 5GLUA 1YLLA 1W2UA 2QFEA 2PQQA 1PX3A 3C3VA 1QH6A 1S0BA 2FHRA 2HWD2 1TMF2 3LFMA 2OA2A 4K8RB 3OYWA 1O4YA 3SH4A 2YHJA 4A4AA 4GWMA 4MOAA 5JWPA 4LO5B 2QQWA 2P3IA 4YLZA 3GJBA 1GOFA 4OI2A 3N4MA 1G6NA 2LW8A 4B8EA 4UF0A 2UWBA 3AP5A 5DZGA 1MZ5A 5JPMB 2ZACA 3M3EA 3N9NA 1LCLA 3I54A 1D0GA 4NWVA 4QDRA 3N9OA 3U78A 3WW1A 2VVDA 5CU1A 4GWNA 1CJPA 2VZPA 3VHRA 3SISA 3KV9A 4UWDA 2YFUA 1RUNA 4CCCA 1HB1A 1RUC1 4Q4W1 3P3PA 4M01A 4OMDA 4NIGA 3IB3A 1B35A 4N90A 4A41A 5EP9A 4HN1A 3BTXA 1DGRN 4TN7A 3U1XA 4ASLA 3M3OA 1WKYA 2DCZA 5JAXA 4LLOA 2ORXA 4QWNA 3VKNA 1ZREA 3R4DB 5FP4A 4JAAA 2HWC3 3AKSA 4XDPA 3LIHA 4LOSA 5IFTA 4KU8A 1DQ2A 3WDYA 5B4NA 1QKQA 4KL1A 1BEV2 1DQ6A 4XABA 4IEUA 1DQ1A 4GMP0 1RJ8A 4W6XA 2JDZA 4FI9A 1R083 4WM8B 2AR6A 3FX3A 1J1TA 1DLLA 3MICA 5FV3A 2BGPA 1WLCA 4I01A 4S2DA 2DTWA 5FOJB 1NLSA 2YROA 5JCTA 2XJVA 1YQCA 4JGZB 2CU5A 1ULDA 1AYN1 2GN7A 1NCRA 3IAQA 4H7MA 4P9XA 4FBFA 3B3QE 5CG9A 2BERA 2Y6JA 4HK9A 1WCQA 4AAPA 2HWB3 3EBRA 1U5ZA 2FCTA 2JB4A 4NR1A 5ACA2 5FZ6A 2BPA2 4CCKA 1J3QA 2MPFA 5F5QA 1JI6A 4CZSA 4DUWA 4CA9A 2WC2A 5FZIA 2XBO3 3CIHA 5FP8A 3VBSB 1SEFA 2GMMA 4RHV2 1UPIA 3QCWA 3H8XA 4AEDB 1UPSA 5FZEA 4GWJA 4AFBA 5J1XA 3FN9A 1HRV2 3WNPA 4PI2A 1RIRA 3FUOA 1FV3A 2EAAA 2MEV2 4COZA 1XSQA 3LOBA 2JXAA 4IL7A 4CDUC 4DUXA 2A70A 3JU9A 1YI7A 3WZ1A 1IS5A 1F4AA 4D6SA 4IEZA 4XF3A 3AK0A 4XUOA 2R32A 4XILA 2IVIB 4B4RA 4Q4W3 2F4LA 3WP3A 3ZXFA 1C1FA 2R16A 2DFCA 3B69A 3NO8A 4KQ7A 3O1PA 2D6NA 4OUMA 1AVBA 2G1MA 2CSGA 2W94A 3VHNA 2Y6KA 4LA3A 2GNMA 3MIFA 1NZCA 3RPQA 5AVAA 3N7JA 1KRIA 2VOVA 4XC9A 5FYUA 3O1MA 1LOGA 1CQ9A 2QQOA 4DY3A 1VBC3 4GALA 5D8AA 5JSOA 2VJXA 1W8NA 2X5IC 3ORJA 2CGPA 4QPWA 2GU9A 2JWPA 1NLQA 2ZXQA 1YI9A 3B93A 4Y5Z0 4CDQC 4CCLA 2BBVA 1YQ2A 4AGVA 2ZS6B 3RS6A 5HV4A 3NNFA 2PHUA 4PBPA 4YG6A 1HRV1 1JYCA 1MS9A 5F5CA 2VCBA 2X29A 3JBG2 2TBVA 2WO7A 5BPXA 3AX4A 5FXVA 4CEWA 4DB5A 5EYYA 4OHYA 3PMEA 3I2KA 3JXSA 1WZXA 4XQDA 2Y33A 2VUJA 1XNTA 2WQZC 3PURA 4J1XA 3AP4A 2R0FA 2VD7A 1OMIA 1E5RA 4HMZA 4LHLA 4BU2A 5BNOB 3VZKA 1I3HA 1PZ8A 3ACIA 3AKPA 2HEVF 1PM7A 4TXWA 4JCKA 4UF0B 1ZM1A 2RS53 2A75A 4NJ4A 5A33A 5CFDB 5GLVA 1UF2C 1SDWA 2JDMA 1STMA 2W91A 4NROA 2HWF3 1LHWA 3CLPA 5DN2A 3DYMA 4GZ9A 2YFZA 4DEQA
chains in the Genus database with same CATH topology
3B94A 1MZ6A 3LA2A 5EZWA 4FPFA 4CEYC 4XFCA 3FBYA 1R1A3 1W6OB 4XBNA 4K21A 3TWIA 1RHI2 3IT8A 1LULA 4JDMA 1FV2A 4BOWA 2XL7A 1GZWB 4L92A 1TNRA 3FMGA 1PHMA 3ZSKA 4PDWC 4JTOA 3VHPA 1I9RA 1OOPA 2LM3A 4OI4A 2JG9B 3VBHA 5CFDA 5JOXA 1J3RA 1PK6A 4B7KA 1HRV3 1S0JA 4F3JA 3ENRA 5C9AA 5L7OA 4QQPA 1H1MA 4XF4A 2YGMA 1F5JA 1CAXB 1LESA 1LHVA 5DG1A 1SLTA 4L97A 4CDQA 2DVBA 1B35C 2JE9A 1ND2C 1WLTA 4LO8A 2DCYA 4P9GA 1A78A 4U2AA 3VBFB 1K5MA 2HWB2 2WS92 4HBNA 3ZXEA 1QJY3 3B7MA 3AMPA 3ES4A 4A7ZA 3O7OA 1G9FA 3QOPA 2WZR2 1UX6A 5BNQA 1CAVA 1MVEA 2WFPA 1COV1 1G9AA 3WDVA 3ZYIB 5JOZA 2NZ9A 1QHDA 4WVVA 3MF6A 1GZWA 4Z92B 4MZUA 5CNAA 1LB2A 3CJIB 1KS5A 2GNDA 3H1YA 2CV6A 1QOOA 3Q9OA 1RGSA 3OF1A 1GYKA 4GH4B 2VQAA 4DPNA 4JGYA 4GH4A 3EQEA 3D0SA 3LSEA 2DURA 1SACA 3BOWA 4XBLA 4ES8A 4Y22A 1JYIA 4N7UA 1DYPA 2BFUS 1AR91 3OJBA 2HWB1 1Q8PA 3P3NA 1MZFA 2XKOA 1LOCA 2BTVC 5EWSA 4JDOA 4QQLA 2F6BA 1BVP1 4WVZA 4MXWA 1VR3A 5FPXA 4P9LA 1KD7A 3AXDA 3VUOA 1UU6A 2GH2A 2WNVB 4KG8A 3VKLA 4C1XA 2E7QA 5C9AC 3ZFEB 5H9QA 3L2YA 2DF7A 3KM5A 4XFGA 2VPVA 1OA3A 5HCFA 1EPZA 3EXUA 2I2SA 2H0BA 1N3QA 1YFYA 1A6CA 4XBQA 3H7JA 3AM2A 3E97A 1K5MC 1RUH2 4Q8LA 2ZGRA 3ZSJA 4HVQA 1H2LA 4AK3A 4EN6B 4TWTA 2QJVA 4PQ9A 1RUC3 4S2HA 3W9AA 1BBT1 1ZA4A 1VBA1 5I91A 2VQ0A 2Q1ZB 4FPEA 4LNVA 4D7TA 2WFF2 1BEV3 4CDWC 1ZBA1 5AC92 1XE8A 1AYM1 1CD3G 3V65A 4BIFA 1RUI1 3C2UA 2ZHNA 2WT1A 4JDNA 3MPPG 3VZNA 3AKTA 4Q1PA 2CAVA 2RS33 1XU2A 3M2MA 4AVBA 3APBA 2NP0A 1JW6A 1OPOA 4JQRA 1AJOA 2RR11 4WM8A 2PHWA 3MEPA 5A33B 4AFCA 1AYM3 2V09A 4YSFA 2MEV1 2CTVA 5GZCA 2ZHKA 5DXDA 5K7PA 2GN3A 2VOXA 3VBRA 3IDCB 3D0JA 4NHLA 1C4RA 3ZYPA 2D3RA 3JB8A 4RS5B 4X8NA 1FOD1 3K51A 1BCXA 1DHKB 1QQP2 1AL21 5T5JA 1HXS1 1WCSA 5AC91 2D6PA 4RGAA 3RMYA 2KM2A 2JICA 4AXOA 1PGW2 4BPZA 1V6MA 1YRZA 2VW0A 1R092 1REEA 3VKOA 3TNPB 3ZSLA 1CN1A 3LOIA 4Y24A 4GMP3 2IFRA 3AB0A 5CAZA 2PAEA 2EA7A 2K9ZA 4IV3C 4BLJA 5HI0A 3H50A 1AR61 3LB9A 1HW5A 4Z82A 1LHNA 1O3TA 4H55A 1FI2A 4JGZC 3ZYRA 1VIWB 4TZDA 4BQ1A 4LO4B 5BXXA 1OA4A 4AI1A 4GB32 3T1MA 2NLRA 1MQTC 3AZWA 5K9YA 3K48A 4LA2A 1A3KA 2Z79A 2OUHA 4K40A 5TSWA 2OW4A 1WGPA 2C9AA 3HIFA 4J6GA 4QU2A 4BLIA 2OIIA 4XJWA 2BNMA 3WG3A 2RJKA 1PGL1 1ULEA 3IDBB 1V6KA 4IV1A 3HD8B 4N43B 2EAKA 2D6LX 3PHMA 2ARBA 3FZ3A 4EN9B 1HLCA 1F9KA 4I0BA 5D8AB 2PHDA 1CGPA 2VXRA 4JGYC 5E88A 4CDUB 3N7MA 4XFBA 4FOWA 5FO8B 5CFCB 5GZFA 3RJ2X 3ZO0B 1PZ9A 4M0NA 4RHV1 1ZBA2 2CGNA 4PLMA 1CX4A 2Y26A 4LBJA 4M3CE 4M3CF 4G9SB 4YW2A 3JBG3 3AXEA 2VMIA 3OBRA 5CADA 3AP6A 1LU1A 2IC1A 2PAMA 5KXDA 4FSJA 1QU0A 3PJQA 5FTTC 2NM1A 4Q4W2 3AYAA 3JUUA 1C28A 3E5QA 3LKJA 3KGZA 2XVKA 4CDQB 1ZZ9A 4HVRA 1RINA 2BYVE 3J26N 3L2HA 3ZYGA 2GZWA 4XTMA 1H2MA 1SFNA 4I30A 4FT8A 3HWJA 1J59A 4JTNA 2JG8A 1RVF3 5JI7A 4EV0A 1W6NA 2PFWA 1QOSA 3UKTA 1AF9A 1GQHA 2VH9A 3VV1A 1QQP1 3VKMA 5LRRA 1MR5A 1KITA 2R043 3LSDA 3M7AA 1AYN2 1QNWA 3ASIA 3BALA 3LA3A 4LHNA 2Y0IA 1N3PA 1O91A 1RL3A 2DVFA 2ETEA 2HWE3 1WMEA 4N53B 3FE5A 3MW4A 5K8SA 3KT7A 5C8CB 4KWJA 4XQ4A 3TBDA 5ACA1 1PO12 4AYUA 4WZFA 1BKZA 3ZFGB 2D6OX 4BH9A 3NV3A 3VBUB 3A4UA 1WCDJ 2IXHA 1O4ZA 1PK6C 1FAYA 2WWSA 1AXYA 4ORFA 3RYKA 3ACLA 3FC0A 1ZZ7A 4GB31 2P3KA 3KT4A 1D4M2 2BWCA 2YXSA 2WQ4A 1LRHA 2ZAAA 1LEMA 2JG9C 4OZXA 3GNEA 4I0AA 4AEMA 3ZFFC 1PO13 1WMDA 2DYCA 4XEZA 1NA1A 5KXEA 4QGNA 2NPIA 1HV1A 3D4KA 1DFQA 1HRI3 3ZFGA 4RR3C 1LOEA 1ND2B 3B02A 5F6KA 4GKXA 4IV1B 4N43A 2VNOA 4YW3A 2XLGA 1MEC3 1ZNPA 3WLUA 3GBFA 3OD4A 1VRH3 5FOBB 1UMZA 4XJUA 2OZ6A 2WA3A 5FLIA 4FAHA 1AX1A 3O14A 3WDWA 2FZ2A 4E4ZA 4NN0A 1X33A 1GLHA 3MGUA 3DKWA 2E7TA 4D94A 3ALQA 1FNYA 3WCRA 1MQTA 2XLFA 2GC1A 5JIUA 4XYXA 4YZ4A 4FPYA 2QCSB 4RS5C 4Y20B 2ZMLA 5KC6A 2WNEA 4GH4C 3G6JB 3ZXLA 5ABJB 5FAXA 1VAVA 2P34A 4MLOA 3M1HA 2A6VA 4Q4V3 1X7NA 3OY8B 4YG3A 2DVDA 1VBE3 4YVWC 4AQ6A 2HWF1 4Q0UA 4AF9A 3WINE 5EV7A 4EROA 5L19A 1GR3A 2RS52 4HSJA 2OUJA 1NQJA 1NOVA 1H30A 2GALA 4XMAA 1XU1A 1ZBE2 1HV0A 4KU7A 1NLRA 3ZXDA 1MS8A 4F7ZA 1AR82 4QM9A 4A7YA 1IPKA 2CYFA 4LBMA 2ZPXA 5FO7B 5CIRA 3VDDA 2ET1A 3LAGA 3ZMOA 3A0NA 4YVWB 2VECA 4P5HA 1WW4A 1COV3 4X8PA 3SLIA 3X29B 5GZDA 4D7SA 3AZXA 2ILMA 1SBFA 2A6ZA 4X6QB 3USUA 4YVSC 5JMCA 3SNMA 5CG8A 3VBUA 4XFAA 1APNA 3TAYA 3D6EA 2EVXA 4AHYA 3ETQA 4ASMB 4HETA 5JSPA 4KNCA 3BODA 3R6SA 3NKGA 3O0VA 3ZXGA 4KH9A 4CDWB 2A5ZA 3UKNA 2W52A 1VBD2 1VRH2 3D5OA 1RUJ1 3GYDA 5KHIA 3NV4A 1H9PA 3LWCA 4LBQB 4RQPA 4RHV3 2EIGA 1X36A 3FFQA 4META 5KXCA 1RITA 3M3QA 2QE3A 4IERA 4GULA 1FPN3 2WFF1 5L73A 5JR7B 2GNTA 5L7OC 1KFXL 3FLTA 4JV4A 3I4IA 5LK5A 3AP7A 1AYM2 5I8SA 3V64A 1Z7S2 3R0RA 5T5OA 4AHWA 4XFIA 1XRUA 1J58A 1PVXA 4NPRA 4W65A 3OGJA 2RS31 5ACA3 1B35B 5GM0A 4PCRA 2I45A 1KDMA 5FQ0B 4BMBA 4IEWA 1D4M3 1H1AA 4QT6A 3VBFC 5EJ3A 2JG8B 1W6QA 2BEOA 2AUYA 3AKRA 4AHXA 3KQRA 2G9FA 3R05A 3M8LA 3E5UA 1LGBA 3W58A 2NN8A 1ULGA 4OLLA 1ULCA 2ZCWA 3RNSA 1KQRA 1QXJA 4J1WA 2N7GA 3B01A 1YJLA 3CJIC 3UJOA 2C1FA 4WM8C 1HIXA 1J3PA 3VBUC 3CL1A 2RS51 1QY4A 4O9GA 5DDJ3 1REFA 3ZVXA 1SLIA 2GC3A 1C8NA 4Y1ZA 3WD5A 1CVNA 3I2DA 4CTEA 2UWCA 3UJQA 1DIWA 1AR73 2WKKA 2CY6A 2A6WA 4YW1A 3DPRC 4DRVA 1RVF2 2Z69A 1CPNA 2HJIA 1SBDA 1V6LA 3U0ZA 4M0HA 2XJSA 3WHTA 1F2NA 4XF0A 1YFXA 3VZLA 2D93A 1IGOA 5BV6A 1PO11 1Q3EA 1ZZCA 1G86A 4PIZA 4PIYA 5EYXA 1AJKA 4ITCA 3VBRB 4MGYE 2VMGA 1VB2A 1WD4A 1VBD1 4Q4X3 3KLSA 4DXZA 2EXIA 4QQHA 5KXBA 1YXWA 2LUWA 4XFHA 2XGXA 3U07A 2PHFA 4ATFA 1SLBA 2XJRA 2ZMKA 5CB7A 5KHKA 2H0VA 1K5MB 3KCYA 4UW5A 3J9SA 5C8CA 1QXRA 4QX5A 4XMIA 2TNFA 1C5HA 3CEWA 3M4FA 1MZEA 1LENA 1HXS2 3AZVA 3NW4A 2XG3A 1LOFC 2XKPA 5K0UB 2HYKA 2A6XA 3BOPA 5AFEA 2ENRA 3UV9A 3USSA 3VLBB 2Q4SA 3IPVA 3IN9A 1C8M2 3M3CA 2RS32 3VL9A 2NYYA 3JQWA 4BZ4A 1QDOA 3PJYA 1WLDA 1YYNA 1KFUL 2XVGA 3HBZA 1H4GA 4HSLA 4HK8A 3SCFA 4C90A 3PMSA 3NVCA 3AZZA 4XZPA 2A7AA 5A32B 1JBCA 1LGCA 4B3NA 2ZAHA 2R30A 4YZ2A 2JECA 1BMV2 5C8WA 1RUD2 5BNOC 3MW2A 1N1VA 2WFF3 1O7FA 4E4SA 3RSJA 4IEVA 2DCKA 4N53C 2A71A 2ZA9A 4GXLA 4LBNA 4QPGC 4MGKE 4YGEA 5BNNB 4FTEA 1XYPA 2C0ZA 2BUKA 4MXVA 1UD1A 1UKRA 4AQ2A 3ZYJB 5AFBA 4OHZA 5GZEA 3ZPYA 1ONAA 4Q27A 2R071 1ENRA 3FWEA 1O5UA 3CJXA 3TN92 2RHPA 2HWE1 1UW8A 1OLRA 1IS4A 1TME2 2UU8A 1CJDA 5HCBA 3POSA 4E27A 3BIWE 3UK9A 4CEWC 4XIKA 3FHIB 1Q8VA 2AGSA 1M4WA 4FPLA 2IXKA 2DCTA 3H9AA 1XE7A 4R9CA 1S1AA 4R9BA 4RS5A 3E6BA 1YHFA 5SV5A 3V0AA 5FFOC 1C57A 3THPA 1NCQA 2ZZQA 4AEDC 5J09A 4XJ9A 3S7EA 1LJ7A 1DBNA 2ZKNA 1VBE1 3VBFA 1BQPA 1U5IA 1CAWB 2W39A 2EXKA 3ZIXA 1YWKA 3H1WA 1PIV2 3I7DA 4Q8KA 1QF3A 1H1IA 3AMMA 3ZXJA 4KGGA 1NCQC 1Z78A 2WZR1 1C1LA 5I0UA 3VBOA 3ZMNA 4XJZA 2RE9A 4WM7B 3LGRA 4RQPC 2ZHLA 4YZ1A 1N1YA 1YO8A 4HANA 2Y0OA 3MIGA 5I8YA 3NSTA 2XBO1 2W0XA 3RWNA 5SV8A 2B39A 5DZEA 4FOYA 2YV8A 4IV3B 1VBC2 3I8TA 4AFDA 1EAH1 3DPRA 4UW6A 1Z7S3 3I59B 4L9BA 2NMNA 4B29A 4F83A 4XW3A 1QJY2 1AUYA 3WOGA 4FVVA 1GNZA 1H9WA 1YIFA 5JVVA 1O4TA 4YGCA 2FMDA 4QGMA 4CYDA 2D97A 5FDBA 2DVGA 1W0PA 1QOTA 3V0BA 1YFUA 1CONA 1RMU2 4LE4A 4RSUA 3VBOB 5J3UA 4QQOA 2WT2A 5I93A 1QJU1 3FJSA 2H6CA 2PAKA 4DRRA 3MZHA 4CDWA 1RJ7A 2ZGOA 2ZGNA 2JE7A 1NYWA 3OY8A 4AG4A 1FNZA 2XBO2 2XWBB 1HX6A 3ZFEC 1IKPA 2BFUL 1VP6A 2YGLA 4KBBA 4YNIA 3UKVA 1A8DA 4NVPA 2SBAA 3WNXA 1WD3A 4K3UA 5FMOS 1TME1 2XUMA 4FPKA 1COV2 1JHNA 4H3WA 2ZBJA 4COWA 1LOFA 4IETA 4LBQA 1I6XA 2QNKA 2RMU2 1S0DA 3MDPA 2BGCA 4AVAA 1ZBA3 3H3UA 3MI8A 3MLJA 5FLHA 1BZWA 4YVSB 1WBFA 4F8AA 2OYZA 1RUI3 5E1RA 4XXPA 5T50A 4NO4A 3AFKA 4RFT0 1O3RA 4XHXA 2VNRA 5HXVA 4EWDA 4OUSA 1GICA 5GLWA 1LEDA 3WP5A 5H9RA 4EN0A 4UW4A 5FREA 1JTZX 1JUIA 1VBE2 2ZGKA 1LOBA 1AR93 4B7EA 1JOJA 4AQTA 5BY5A 3MYXA 1IZ3A 1VBB2 3AYEA 3TRSB 4MVTA 4L99A 2RM23 2E9QA 5KHJA 4NOTA 4XDQA 4QXKA 4XOGA 1Q5OA 5KBFA 1SFYA 1WBLA 4DNYA 1UZYA 2D44A 1FOD3 2B7YA 3I59A 3NL1A 1GSLA 1KS4A 2B5HA 4UW3A 4AVSA 4HKOA 2WT0A 2AREA 4XF1A 4AE2A 4GIQA 1BYHA 1NXMA 1ZZ8A 2H6BA 4HKLA 1IQAA 3EHKA 4RR3B 1D2QA 3AYCA 1VAKA 1R093 5EFUA 4AFMA 2R062 3WXPA 4RD7A 3DF0A 1CR7A 4OI1A 1D4VB 3CJIA 3J8F3 1TE1B 3AYDA 2WJSA 1OOPB 3H3ZA 2JJ6A 5J48A 1MEC2 1VBA2 3RJRA 3O12A 4EWAA 2PYTA 2HWD1 3VBSA 1LGNA 2XH6A 3GHMA 1ND2A 2JX9A 4Q0SA 4HZFA 1ASJ2 4Q4Y3 1QJU2 4URTA 3SHRA 3THTA 3WCSA 4HT1T 2ZKLA 3GHNA 2D43A 4E9KA 5CBLA 5JZGB 2WSVA 4IEPA 3MFAA 1L3JA 3WUCA 4D69A 3ILFA 3M3IA 4XETA 4PIXA 4LT5A 5JZGA 2PLV3 1AXKA 5BNPA 4YVWA 3ILNA 5C9AB 3VL8A 1X82A 2XVLA 3NWKA 4BM8A 1RTVA 4QGLA 1MQTB 2VU9A 4X6RB 1EP0A 3PVNA 3MIDA 4AWDA 2VY0A 4HVOA 4AGGA 2DVAA 3LA7A 4AVTA 4N43C 5D1IA 2O8OA 5T52A 1QJX2 1QJX3 1FOD2 1UIKA 4R4XA 2DFBA 4ZKTB 2ZX2A 1FMD1 2KXLA 1GNHA 3SMHA 1ASJ1 3ZX7A 1OKQA 3NJZA 2RM22 1NCQB 1UIJA 2UY8A 2GC2A 1RUE3 1S0CA 3IPVB 3TN91 5J37A 1RUOA 2HWE2 2VGDA 3MF9A 2GNBA 3J8F1 4E4DX 3JB4C 2XJQA 4OHVA 1PVC1 4RGGA 3AMNA 1V9U1 4LBKA 2K2SA 2DCJA 1ZBE3 4EWEA 1WUVA 2OZJA 4N7IA 4MXWB 1F31A 1ZRFA 4Q26A 1POV3 2D6KA 5GZGA 3W59A 1RUE1 2MEV3 2NQYA 2A3XA 1OQDA 3E5XA 1LOAA 3WV6A 2BW8A 1PNGA 1DGWA 4B4QA 3KMHA 4A3XA 1CAUB 1KJLA 2WL1A 4FPJA 4P9JA 4R52A 3TB0A 1NY72 1RUJ3 4QQ2A 4XTPA 1CAUA 4R9AA 1HQWA 3AP9A 5FMOL 2Q5TA 3JZVA 5BNPC 3RQ0A 3SCGA 3J8F2 4DMIA 3ROUA 2X8KA 3ZN4A 4E2QA 3WDUA 3UL2A 2IZWA 1OLQA 4I09A 5BNNC 5C8CC 4R8HA 4JGZA 5AVPA 1TEIA 1XNBA 3PVEA 1GBGA 2WIIB 2AH2A 1G7YA 4AGRA 3JBG1 1H8VA 2VW2A 1DQ4A 2QZ3A 2E6VA 3WHUA 2MHFA 3WT3A 5BNNA 1POV1 1URXA 4YGBA 2XHKA 3V0AB 4LE3A 1XQNA 4BYYA 4NHKA 3U10A 1DGWX 4OULA 1RUG3 4COYA 5CFDC 1G9CA 1ZRDA 4B4PA 1FXZA 4DQAA 1YFWA 2VVEA 2ZGLA 4I3GA 1DF0A 1OHFA 1WLWA 1NA1B 4G4FA 1PO23 3U11A 5DDJ2 2PHLA 3RMXA 2VW1A 4DS0A 4EN7B 1UU5A 3DUIA 4QM8A 5T3NA 3O0XA 4YVSA 4HKWA 4QPGA 1R081 3KSCA 4Q0PA 5C4WA 2EXJA 4LTAA 1DZQA 3HAGA 2QKDA 1ENSA 2RS13 1ZVFA 3AJYA 4AW7A 2DUQA 1MS3A 4K9SA 2PHXA 4M3CA 5T5PA 4YZ5A 2P37A 1T6GC 4I3PA 4DY5A 4E2GA 2NMOA 4QPIA 4YYOA 4IEOA 2GSYA 4TSVA 1YJKA 4N9IA 4IEXA 2RS11 4Y1XA 1LU2A 3ELNA 4LEJA 3TOJA 4COVA 1MACA 1YIPA 4ONUA 3TYJA 2RJLA 2ZX0A 3BB6A 5DUWA 1QJU3 5JIAA 3S6PA 5JDBA 3URFA 1FPN2 1OI6A 1D4M1 2HEWF 4XQWA 3MLLA 4LUKA 4LR4A 1DG6A 1IS3A 3VDDC 4M3CB 2D6MA 3OTFA 4RL7A 2XLAA 1LODA 5HBAA 1EYBA 3ZFEA 2XJPA 4ISQA 3IM0A 1WW5A 2YC0A 3OYWB 1RUH1 2QUOA 2XL9A 1RUF2 3WW3A 2AZ5A 2WNUB 4COUA 5AC93 4CDUA 3VHOA 2JEMA 1DYKA 5H9PA 1FMD3 1BBT2 2CWSA 3E6DA 4QPIB 3EJKA 5LEJA 1S0EA 3B9CA 3N3HA 5DUVA 2Y38A 2F4PA 1SBEA 4FOQA 2ZGPA 1PO21 4AVCA 1TNFA 2ES3A 2D40A 4YM0A 3D82A 1PK6B 3WUDA 1AR92 4NWWA 4WVMB 4ES9A 3CU7A 4TLFA 1PVC3 2VVFA 4QPIC 1N1TA 2E51A 2PN5A 4JC1A 4OHXA 2I07B 1CESA 5A3MA 1U5XA 1V00A 1V6IA 4YM3A 5K0UC 4SBVA 1NE4A 2ZX4A 3CF6E 3ZFFB 1XYOA 1H2NA 1EV13 3GZUC 1UN1A 5EXOA 2X53S 5E8AA 4ZU7A 2P17A 4PLNA 4RR3A