1R082

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08200
2X5IB 3VBFC 1RHI1 3J8F1 4RHV3 1RUJ2 1C8NA 5AC91 4Q4X3 1WCDJ 1ZBE2 2MEV1 1QJU2 1C8M1 1RUI2 2XBO1 3NAPA 1AYM3 1AL0G 4IV3A 2RS53 3ZFGC 3J8F3 1AR63 1AR82 1RUH2 1RMU2 1D4M1 5AC93 1RUF1 5L7OC 1ASJ1 1H8TC 3M8LA 2MEV3 1C8M3 4CEWB 2WFF2 2XBO3 5K0UC 5A32B 1NCQA 2X5IA 1AL23 4RS5A 1RB8G 4YVSA 1D4M3 2WZR1 1RUF3 1ASJ3 1TME3 4GMP0 1B35B 5JZGB 3CJIB 3VBOB 3ZFFB 1Z7S2 1K5MC 1PIV2 1A6CA 4CDWB 2WZR3 1BMV1 4PDWB 2ZTNA 5C8CC 4JGZA 1VBA1 1FMD1 1POV1 3JD71 1QJY1 1ND3A 1B35A 1ND2B 4QPGC 2IZWA 1TMF2 2HWD1 5BNPB 3CJIA 3ZFFA 1AYN2 1OOPC 1VBA3 4Q4Y1 1FMD3 1POV3 1R1A1 2RM22 1COV1 1RUD1 4EJRA 4RFT0 4CDWA 1QJY3 2HWB1 4CEWC 1PGL1 2RMU1 4CDQA 4WM7C 2HWF1 4PDWA 1QJX1 2ZZQA 2HWD3 5J98B 1VBE2 1PO11 3ZFEB 1NY72 3HAGA 4Q4Y3 1FOD1 1R1A3 4Q4W2 5JZGC 1DDLA 1COV3 1RUD3 2HWB3 1NOVA 4Q4V1 1HRV2 1ND2A 2RMU3 2RR13 3VBOC 3ZFGB 2HWF3 1QJX3 1QJZA 4QPIB 1PO13 5C9AC 5L7OB 1H8TB 1FOD3 5K0UB 4Q4V3 3VBFA 1RUE2 3TN92 1RUC1 1BEV1 1ZBA1 1RHI2 3J8F2 4CEYB 5ACA1 1RUG1 5BNPC 2MEV2 4Q4X1 3ZFGA 4Y5Z0 1K5MB 1C8M2 1VRH2 2XBO2 1IHMA 1RUC3 1ZBA3 5L7OA 1MEC1 1H8TA 1AYM1 5BNNC 5GKAC 1E57A 3VBHC 1NA1C 2RS51 5K0UA 5C8CB 1D4M2 1HX6A 5D8AB 5ACA3 1ASJ2 1AR61 1RUG3 1PVC1 2PLV1 3ZFEC 4CDXC 5FMOL 1HQNA 1MEC3 2R062 4QPGB 4WM8C 1AL21 5FMOS 1OOPB 4QPIC 1PVC3 1K5MA 2PLV3 1TME1 5A33A 1F8VA 1HXS1 2DF7A 3VBRC 2HWE2 4WM7B 1BBT2 5C8CA 5ABJB 1R081 4Z92B 5CFCC 1CD3G 3VDDB 1M06G 5DDJ1 2R071 2WS93 4GB33 4CDUC 1HXS3 4CEYC 1VBA2 4QPGA 4Y4YA 1QQP2 3JD72 1R083 5J96B 1OOPA 5C9AB 5DDJ3 2HWD2 1RUI1 2R073 1MQTB 2RS12 4CEWA 1PO23 5BNOC 4Q4Y2 3S6PA 4WM7A 5D8AC 1R1A2 5A32A 4RR3C 1AR81 1COV2 2R042 2FZ1A 1AR71 1ZBE3 5JZGA 1RUI3 1PO12 3VBUC 1W39A 3VBOA 1FOD2 1FPN1 4BCUA 1V9U1 4N53C 1AR83 1RMU3 5C9AA 4Q4V2 1NCRC 1AR73 5BNNB 3DPRB 4AEDB 3VBHB 2RR11 1NA1B 1PGW2 1AR92 3JBG1 5ABJC 4NWVA 1RVF1 1FPN3 4CDXB 1V9U3 3VDDC 5C4WC 4YVWB 1HRI1 2BPA2 4WM8B 2RS32 1RUC2 1BEV2 1Z7S3 5BNPA 3JBG3 1RVF3 1EAH1 3JB8A 4RHV2 1MQTC 5BNNA 2XPJA 3VBRB 1TMF1 1VBB1 1VBC1 1HRI3 4Q4X2 3VBHA 1NA1A 5CFCB 1ND3C 1MEC2 1AYM2 3ZFEA 4CDXA 1EV11 2RM21 1VB2A 2RS52 1EAH3 2Y26A 4CDUB 4FTBA 1AR62 1PVC2 3FBMA 5AC92 2PLV2 1OHFA 1TMF3 1VBC3 1VBB3 4IV1C 4CDQC 4QPIA 1EV13 2RM23 4Q4W1 1R091 3DPRC 4AEDC 1AL22 1VBD1 3VBRA 5BNOB 1RUF2 1TME2 4RR3B 5CFCA 1HXS2 2WWSA 1VAKA 3VBSC 4YVWC 1SMVA 2WLPA 4Q4W3 1R093 4CDUA 3LOBA 3VBUB 4CEYA 1VBD3 1F2NA 2WZR2 4N53B 1RUE1 3TN91 2TBVA 4GB31 2WS91 1NCRB 4JGYC 4RS5B 4YVSB 3IDEA 5BNOA 2QQPA 5D8AA 4SBVA 4GH4C 2HWC1 4RR3A 1RUE3 1VRH1 4FTEA 4N43C 3TN93 5C4WB 1BMV2 1POV0 2BBVA 1RHI3 1PO21 1X33A 5CFDC 1FMD2 3VBUA 1RUJ1 1AR72 2GH8A 4RQPC 1QJY2 4N53A 2HWC3 1VRH3 1ZBE1 1QJU1 1NCRA 4JGZB 4NWWA 2R061 1FPN2 1V9U2 4FSJA 2FZ2A 3JB4C 1ND3B 1RUH1 1RUJ3 1RUD2 1RMU1 3NAPC 3ZXAC 5ABJA 2HWB2 3VDDA 2VQ0A 1PGL2 2RMU2 4IV3C 2RR12 5C4WA 1QJU3 2HWF2 3JBG2 1QJX2 2WFF1 2HWE1 1RVF2 2R063 4IV1B 1BBT1 1RUH3 4CDQB 1HRI2 1NCQC 2X5IC 4RS5C 1CJDA 1MQTA 2WFF3 4GMP1 4YVSC 1Z7S1 2HWE3 1QQP1 1BBT3 1EAH2 5FOJB 1PIV1 2BUKA 2BFUL 1VBB2 1VBC2 3VBSB 2GSYA 2RS11 4FTSA 4GMP3 1ZBA2 1EV12 4IV1A 1QQP3 2R041 2BFUS 3JD73 1PIV3 1X36A 1VB4A 4JGYB 3VBFB 2ZAHA 5ACA2 4JGZC 1RUG2 3DPRA 2RS13 4AEDA 1AUYA 1AYN1 4GH4B 1B35C 1R092 2R043 1OPOA 4N43B 1VBD2 3CJIC 3ZFFC 3VBSA 4YVWA 4LLFA 5CFDB 1PGW1 1AR91 4WM8A 1VBE1 4RQPB 4CDWC 1NY71 5LK7B 1AYN3 4PDWC 1NG0A 4JGYA 1GFF2 2RS31 1HRV1 1AR93 4GB32 2WS92 3NAPB 1VBE3 4GH4A 4IV3B 1ND2C 4N43A 4RHV1 1R082 2RS33 2HWC2 5DDJ2 1HRV3 5CFDA 5A33B 1BEV3 2R072 4RQPA 1PO22 1NCQB
chains in the Genus database with same CATH superfamily
3J8F1 3H7YA 1JTZX 5A3WA 2ZA9A 4ASLA 3A0NA 1KEXA 4XCBA 4Q4X3 1AXKA 3MO4A 5A7PA 5C3QA 1WCDJ 3FC0A 1CQ9A 4LK7A 4L9BA 2ET7A 3IDCB 1BJQA 2D3RA 2WR9A 1BVVA 1MS1A 1AL0G 3B94A 1GP5A 4LPLA 1DP0A 3U10A 2EIDA 1KITA 2D6PA 2VW0A 2WT0A 2ORXA 3ZYFA 4AEJA 1ST8A 2TEPA 1AR63 5A6YA 3G6JB 4KH9A 4E2SA 3HMYA 1CAWB 4LBNA 1Z0HA 5LY2A 3ZYGA 5CBLA 4D94A 5L7OC 1T2XA 3ZXKA 2MEV3 2DVDA 3WUDA 1C8M3 2RG4A 2WFF2 1GZWA 2K9ZA 4XDPA 3DYMA 2EXIA 2Z5WA 4A3ZA 2X5IA 1VRBA 3ZIWA 1KDMA 4XHXA 2VMIA 2XHKA 4SLIA 4YFZA 4B3NA 5LY1A 2JG9B 2IFRA 1QIQA 1RUF3 1ASJ3 1JOPA 1TME3 3WNKA 1B35B 2QCSB 2JDHA 4AE2A 4CYDA 1XXNA 3FLTA 4RGGA 3CJIB 1JW6A 2B8MA 5L73A 1BMV1 3O1OA 4BQ5A 1V00A 2VZTA 1A6CA 3DXTA 3FWEA 3F95A 3HQXA 2KXLA 1IPKA 1YJKA 4XXPA 2A70A 2E9QA 3M3CA 5FXVA 4UF0B 3NV3A 1UY3A 5FBJA 5FP8A 3GZEA 3OPZA 4CXXA 4OVEA 5ISLA 2JENA 4XUOA 1K3IA 3PUHA 2GALA 1QJFA 3MI8A 3S5QA 3WT3A 1ND3A 5F3IA 2E6VA 1UCXA 3OGVA 1PMIA 2IZWA 4LK6A 2QJVA 2UY8A 3DUIA 3OGSA 4QPYA 3VHPA 4INDA 1CX1A 3ZFFA 2EVXA 1X50A 4J1XA 1OOPC 1EUUA 1LENA 3WP5A 3K3NA 1A8DA 1QOTA 2Y6FA 2VZ1A 4Q4Y1 1DYPA 2J1TA 2YMZA 2P37A 3OPWA 1COV1 4I09A 1QJY3 1LESA 2HWB1 2A7AA 2VG9A 4HN1A 3BI3A 3I3MA 2VXJA 2AR6A 3PVEA 1UIJA 2ZZQA 4CPBD 2HWD3 3DV8A 3HVDA 4URAA 4Q5OA 1AHSA 3DL3A 3ZFEB 1NY72 3GBFA 3HAGA 1FOD1 4YARA 4LO8A 4Y20B 2DYCA 1RUD3 1FX5A 2RDSA 2G9ZA 3DXUA 4H2AA 3SKVA 4YGDA 2FDFA 5A7WB 2R7EB 3E5UA 4Q4V1 1O6UA 2O1QA 4FI9A 4IUGA 5DAXA 4JVAA 4KQ7A 5DUVA 2XVGA 1T6BX 3ZFGB 1G9CA 2LRPA 2VVEA 3KQRA 1QJX3 3RI8A 1QJZA 1YWKA 2H6CA 1H4GA 2D5FA 1UY0A 2ET1A 2QE3A 2BWAA 4K9SA 4QPIB 3ZMOA 3H0OA 5DUUA 2B7YA 2VD7A 4DRVA 1JBCA 2BERA 4H55A 4FPKA 3I3BA 1WA4A 5K0UB 2DCZA 2NN8A 3D0JA 1WA6X 2VZUA 4MUVA 4AFMA 3VBFA 4IEPA 5HBAA 1UY2A 5DN2A 3TN92 2X8KA 1ZBA1 3I2IA 1UZWA 3CLPA 4TTGA 3OGRA 5LBFA 3K51A 4AWDA 1L7QA 1IGOA 4XYXA 1KJLA 3CDZB 1CAUB 1K45A 2GP5A 3AMQA 3LEKA 1HLCA 5ACA1 1XNTA 2D40A 3LDKA 3S7IA 5J36A 5FZFA 4CZSA 2J1RA 3O0WA 4FPEA 4CCLA 1ZRIA 5H9QA 1IHMA 1STMA 4Y5TA 1MEC1 1H8TA 4YNIA 3VUOA 2OPKA 5GKAC 1E57A 3VBHC 1OT5A 3J7HA 1NA1C 3WG2A 1ENSA 4JKMA 2FDKA 5KR7A 2OQ6A 1ONAA 3VZOA 1GQPA 4YYOA 4YW5A 3BU0A 1HQNA 3WP3A 4KI5M 5FZAA 2J1EA 2VZPA 4FPFA 4FPOB 4Y22A 5IWFA 4WM8C 4AVVA 1W9TA 3LF7A 1W6NA 3ZYRA 3R4SA 4IEXA 1AL21 1APNA 3MGUA 5EP9A 3MEPA 4XIKA 2VBDA 2PLV3 3C7EA 3DCQA 3IMNA 2YGLA 2Q8EA 4Q29A 2E63A 2XJSA 4AQTA 1OUSA 2P17A 1QGLA 2DF7A 1CAVB 3AKQA 1OLME 5EFUA 5C7GA 3MICA 1N1SA 2PHXA 2ZGRA 1N47A 5KXEA 5FYBA 1CD3G 2RVAA 1MR5A 1M06G 4C91A 4AVCA 4X8PA 3N35A 3DYOA 1IKQA 4NHMA 4LBJA 2DCTA 4N90A 2R071 1C1FA 3JUUA 2E7QA 3OYWB 3SITA 3UKTA 2JDKA 1RITA 2Z79A 4QPGA 2Y60A 2C4XA 1XRUA 3V65A 3VZJA 4MGTA 2UURA 4HVRA 3PDQA 2WA3A 1H30A 1PK6C 5DDJ3 4CCNA 5BV6A 1CAWA 2DBIA 4IE5A 4XJAA 1V6OA 1RUI1 4W8JA 3VHNA 1MQTB 2RS12 3D0SA 3IB3A 4XVHA 1GV9A 1N3OA 1DZQA 3D4KA 4D8MA 4HKWA 4Q26A 1DLLA 3S6PA 4WM7A 4TZDA 4CCKA 1DQ4A 1AR81 2JECA 1X9PA 2VM9A 4H7LA 4LE3A 1ZBE3 2RDQA 2ZCWA 2GDFA 4NHKA 4QKNA 1HB2A 3ABZA 3PUQA 5GZFA 2XHNA 3TAYA 2VGDA 2E32A 1FPN1 4QT6A 1RJ8A 1V9U1 4G4FA 4BCUA 2EALA 1UZ0A 5DG2A 3S30A 1MPXA 1RMU3 3ZN6A 1A8MA 2CWMA 1NCRC 2WO3A 4YG6A 1SLBA 3ES4A 4MG2A 2JE7A 4PLNA 2FBEA 3H8XA 1D0HA 2GMEA 2B4KA 1PGW2 5DZFA 3ME2A 2BVVA 2YB7A 4LHLA 3N7KA 4UF0A 2WO1A 5ABJC 1RVF1 4LBQD 5DAVA 5EPAA 4AHYA 4CDXB 3APBA 5G05L 3F2ZA 4BQ4A 5CIRA 4D7SA 5B4NA 1LEDA 1I5ZA 2OPWA 2A6XA 5FO7B 3B93A 2JKBA 1LOFA 4TYSA 4XPVA 5FYIA 4DPNA 3WV6A 1ULPA 2BPA2 4JDNA 3KGZA 2WFPA 3CKHA 2Y34A 3WNLA 5IVJA 1F5FA 1R64A 1MVQA 3MLJA 1RYYA 4LUMA 4IL7A 2E51A 3WEZA 3KZ4C 3J9SA 3SMHA 2ZHMA 4AG4A 5JSOA 2GAUA 4HZFA 1O3RA 3B9CA 2UWBA 3VBRB 1TMF1 2XVKA 4Q4X2 1C3HA 3FL7A 4XETA 5FJHA 3ACLA 5FDBA 3AYCA 2LUWA 3IWZA 1Q8QA 1ND3C 4D0QA 2QTWB 4QKDA 4TN7A 3ZFEA 4NAMA 2W1QA 3IDAA 5G04L 3TBDA 5FZEA 1REFA 2QUOA 4Y20A 3C3VA 4CDUB 2ID4A 3RQ0A 2J1UA 3HR9A 1OKQA 3RVHA 1AR62 1PVC2 3FBMA 3TB0A 3CL1A 1QEXA 4DFSA 1UW8A 1VBC3 4W4ZA 1RC6A 3TRSB 2WUHA 5ANQA 3EBRA 3VB9A 4JTOA 5JXJA 1H2LA 4LJHA 5CKMA 3K4ZA 5GLUA 1XNDA 3SCHA 2BQPA 1ZX5A 3THPA 1O5LA 4QPIA 1QXJA 1W8FA 2IVIB 1OVSA 2RM23 1G9AA 2ZX4A 3PHMA 1UN1A 3DPRC 3MW3A 4AEDC 2IFWA 4Q0PA 5BNOB 4OZXA 1RUF2 1W8HA 1TME2 3EJKA 4YWAA 1OF4A 5A70A 4PT6A 3USUA 3ZXJA 1J3RA 4NAOA 3NKTA 5JI7A 4YVWC 1SMVA 2WLPA 2Q8CA 1ENXA 4XEZA 4LEJA 1W0OA 3VKMA 2W92A 5F3CA 2WYSA 5C3RA 1CAUA 1PGSA 1TG7A 2DFCA 3VV1A 5LZ6A 2VNOA 4XTMA 3GALA 3AK0A 4KBBA 3EYPA 4N53B 5IVEA 1G8WA 1WW6A 4GB31 4QM8A 5FR3A 4DUXA 1OXCA 1N3QA 1O8SA 4QKFA 4LO5B 3RNSA 1GSLA 1KDKA 2WN3A 4AXOA 5A6ZA 1JS9A 3HQUA 3QD6A 4LOTA 2OKXA 3WVJA 4CU7A 1UYPA 4M3CE 3G7DA 4QU1A 4EYUA 3ZKYA 4LT5A 2R1DA 4QDSA 4GH4C 2DVGA 4XF0A 3AZYA 4NPRA 4RR3A 4CP0A 4FTEA 5C4WB 4D69A 1ALYA 2Z42A 2HH9A 2WT1A 1W90A 3PU8A 4QX5A 1JH5A 1O91A 1UZVA 2Y0IA 1W8ZA 2R0FA 1D7PM 1X33A 4R4ZA 5FZ8A 4C1XA 1SDDB 2QVSB 2VQTA 3VBUA 1Q43A 1RUJ1 4YPJA 5DUXA 1ZZ7A 4YW2A 1QJY2 3T1LA 2I07B 3J7LA 5IVCA 2ZS6B 3P3PA 4IDZA 1VRH3 5FP9A 3T2PA 4P5HA 1ZZBA 5I8SA 4NWWA 2VY0A 3RZZA 2R061 3GXUA 3DEMA 2CDOA 1GWMA 1ZVFA 2P2KA 2QNKA 3ACHA 2XGXA 1C1LA 1Q56A 1W2NA 3I2GA 3AKTA 4COWA 1RUH1 1RUD2 3NAPC 3PTYA 5FY4A 1UU6A 4CVUA 1K5JA 1OA2A 1YCIA 2LS6A 2PFWA 2OZJA 4IGPA 4M4RA 5A7NA 2ADDA 3JBG2 3UYJA 1QJX2 3OYWA 1TE1B 1JU3A 4WZFA 4IV1B 4XXAA 2D6OX 4S2GA 1O7FA 4CDQB 2AEYA 2PHRA 3O1MA 1DLCA 5FZ7A 1HRI2 1ZNPA 2ENRA 3MPBA 4DB5A 5HCAA 2C26A 4D6RA 2DU1A 3CHXA 4QHZA 4RS5C 5F3EA 1MQTA 2OT7A 2WFF3 1YUDA 2PXJA 1XSQA 1Z7S1 3ZO0B 1EPWA 1QQP1 3M70A 1EAH2 4NIIA 3MIEA 1SPPA 3WOGA 2NLRA 2BFUL 3NO8A 3VBSB 4YZ2A 3RJ2X 1URXA 1C5HA 4K1YA 2WZ8A 2D7FA 1ENRA 1FI2A 3OB8A 4MX3A 2IXJA 4Z82A 4TLFA 5FOBB 1EV12 4FFHA 2R041 3POEA 4O61A 3H42B 3WSOA 2WZPP 3H8OA 2BWCA 4LO7A 5HXMA 4MGZE 4JGYB 3NJVA 4JGZC 1J83A 1NE4A 1DCSA 2CTVA 2A3YA 2AENA 2UYAA 4CTEA 4NHXA 5A3UA 4KNCA 3SCGA 2GC3A 2W1WA 3LPFA 5FY5A 4QQLA 1FV3A 3BVCA 1BHGA 2JG9C 5FV3A 1BXHA 1AYN1 1YFUA 3S7EA 1ZRFA 4XF3A 1B35C 2BNNA 4LKFA 3U0ZA 1UY1A 3WP4A 1VBD2 3CJIC 4OLLA 3MV11 3FHQA 3WCRA 2ZEYA 2QQOA 4LLFA 4Q2FA 3C2UA 1H1IA 5FYVA 3SC7X 5LW9A 1AR91 2PYTA 1HQWA 5LK5A 1MACA 4HMZA 3M3QA 3B5LB 3AYAA 3VKNA 2E53A 2B42B 3KV4A 4QX8A 1GU3A 5FKBA 1YO8A 2VMCA 2YFUA 1S2KA 1IKPA 4JDMA 3AVRA 5JXHA 1NG0A 4GJZA 4UFIA 2RS31 5JR7B 1SZBA 4Y5SA 3ZKUA 3RMYA 1UWWA 5KXCA 2V72A 4PIZA 3NWKA 5A7OA 4XZUG 5KHIA 1Y9MA 4CPBA 4Y1ZA 2VUAA 2YDEA 5CNAA 1Q8OA 4W6WA 4AR2A 3BIWE 4RA0A 1U12A 3ZYJB 5IYYA 4PI2A 2BBAA 3IPVB 4W6YA 1O3TA 1U5ZA 3LIGA 1GOFA 5DDJ2 5CEHA 3RSJA 3NKGA 1GZWB 3ST7A 2QBXA 3I54A 3MUZ1 4YW7A 3KCCA 2X10A 4E4HA 2LALA 2X5IB 2ZGQA 3N7JA 4FO9A 4X6QB 1O59A 3U07A 4RHV3 2FCUA 4LKDA 5AC91 1YIPA 2QKDA 1JOBA 3VHOA 3TWIA 4NIHA 1F8VA 1ZBE2 4J25A 1QJU2 4C0BA 1MZ6A 5DXDA 4QB6A 4Q8KA 2XBO1 4YZ1A 2VE1A 4OCTA 5EJZB 5C9AC 4P9JA 5FK8A 5HI0A 5CKQA 1Y43B 1YJLA 2DCJA 2YC4A 3KD4A 2N7GA 4LA3A 3ZFGC 1J1LA 2YU1A 2I45A 1IG3A 1RMU2 2QQIA 1LECA 1D4M1 2XG3A 2XKOA 1I5PA 4QXKA 5LBCA 1EYBA 4BK5A 5FWEA 1GBGA 3WNNA 1ZZ9A 4V2VA 3N9PA 1DQ5A 5K0UC 4K7JA 1JZ3A 4XF4A 4LMFA 1AL23 2G9FA 3AXEA 2OIIA 3KT4A 5J09A 1RB8G 2R32A 1HV1A 3CF6E 3LAGA 2IVJA 2WZR1 4M0NA 1REEA 2D6KA 4ZONA 4ZXEA 4GMP0 5FUNA 2E7AA 2QQWA 2VZOA 2ZKNA 3FBYA 5JWPA 2AZ5A 2VMGA 1CIWA 1S55A 4P9XA 3HOBA 4Y4RA 3T30A 3ZFFB 2J7MA 2ZZJA 3V0BA 1W6QA 3LZZA 4LORA 1DQ1A 2Q1MA 1ULGA 3HN3A 4AGGA 4G3YC 1NXD1 1PIV2 5EXOA 1LU2A 2YUEA 2YU2A 5K4LA 2ZGNA 1TVGA 4ORFA 5T5OA 4A4AA 3WNMA 1O5UA 4I30A 3CMGA 3FX3A 3R6SA 4DO0A 5A7QA 4EE2A 5FY1A 2JDMA 1CN1A 1SCSA 3AKSA 4FPGA 3KMHA 1VBA1 4C1WA 2VNGA 2VMFA 1FMD1 1POV1 2RJLA 3GJBA 3WZ1A 3B3QE 1PMHX 5F39A 2WNUA 2VOTA 3KVBA 4XJ8A 4DOUA 4Z2AA 3RMXA 5AVPA 4AFDA 4HVQA 2RDNA 4BMBA 4LLOA 3LSDA 3I3EA 3M2MA 4DEQA 3WNPA 2ZMLA 3AJYA 4S2FA 2JE8A 1R1A1 4XJZA 1UOJA 2RM22 4UFMA 3TOJA 1IOAA 3O1VA 2MPFA 3H8UA 1AXZA 2DURA 4K40A 2DUQA 4B7KA 4CDWA 4CEWC 1PGL1 4UXAA 4CDQA 3U37A 2W08A 1FV2A 2WKKA 4DQAA 3P3NA 2E33A 3I2FA 2QQNA 2PN5A 3E6CC 1PO11 2YPDA 5JR2A 3SH4A 2R1BA 3TEXA 1RL3A 3BCWA 4A42A 4AOCA 2J22A 4BQWA 4AI8A 5JZGC 3PTRB 1DQ0A 1C4RA 4LNVA 1NOVA 4GWMA 4CUBA 2RMU3 2WSVA 3B01A 4QX7A 3VBOC 4P08A 4O9GA 4XE9A 1BYHA 2HWF3 4XJUA 3E5XA 4F7ZA 1OURA 3THDA 4CCOA 2L9LA 3NV1A 1HJGA 3H8RA 2ZEWA 5CU1A 3SEEA 3RI9A 2NP0A 1H8TB 1G7YA 2F17A 5BPXA 3HN1A 4YM0A 2G4IA 4R52A 4H7MA 5JOXA 5K9YA 2C1FA 2C9AA 4IGQA 2RDRA 4ET7A 4MOAA 5FYSA 3O1SA 1UX7A 3GZTB 5B4XA 1RUC1 1LHNA 4D7TA 3I2JA 3TEZA 5CB7A 3LDBA 3POFA 3J8F2 2OXBA 5CKNA 3LWCA 2XJRA 2JKXA 1W6NB 2BGCA 4LBQA 1RUG1 3BOPA 5BNPC 1QF3A 4HG6B 4YG0A 3MIFA 3P5BA 4XBLA 5JMCA 3MLKA 2FDGA 1VRH2 2P6CA 3OUIA 3PVNA 1AYM1 3M3OA 4NIDA 1B09A 1GMMA 2ZHKA 5KC6A 2Y6JA 1LTEA 2VMEA 3KWVA 1H1MA 3ZPOA 2RS51 2XH6A 1C5IA 4RYDA 5FIXA 3R05A 2HBUA 1PM7A 1JXNA 4AVAA 5EYXA 3MYXA 2JG8B 4CDXC 1YQ5A 3NMBA 5FZMA 1MVEA 4YZ4A 3O0XA 4LKSA 2HEYF 3AKRA 4QPGB 4EN8B 2XL7A 3I2HA 4B29A 4R9DA 1VPHA 2WL1A 3ALQA 1W8UA 2VC9A 2JB4A 2Y6GA 5FMOS 1TEIA 2RV9A 3I3DA 3VDAA 2DV9A 3BPZA 3M3EA 4HONA 4AVSA 1PVC3 4F3JA 4QWNA 1K5MA 3IPVA 4FVVA 4YGCA 3VD9A 1PHMA 1OH4A 4IE4A 2XWBB 1TNFA 1HB1A 1HXS1 3KSCA 2QDRA 3KV5A 3QCWA 4HETA 1QY4A 5FYCA 5IVYA 3RG0A 3VBRC 2RHPA 4UFLA 4FAHA 4WM7B 3E6BA 1BLZA 1UF2C 5FKCA 1NXMA 5C8CA 4Z92B 4XFIA 5JOZA 1OQDA 4KWJA 3MIHA 2BDRA 3VDDB 1DYOA 1VLNA 3HD8B 3WY6A 3H3LA 3OBAA 3WQ1A 2JDAA 2RE9A 4GB33 3I2KA 4QB2A 3V56A 2UWCA 2W46A 1S2EA 3KQ4B 3NV2A 1UU4A 4CDUC 3GBWA 4CEYC 2WN2A 3OUJA 4HFSA 3N4MA 3I2DA 1X7NA 3KM5A 3WF4A 1R083 2ES3A 3ZN6B 1J84A 1VMHA 1DG6A 1WMFA 4ZS2A 5LRRA 3WNOA 4A6OA 2FMYA 2WZEA 5EQUA 1DZTA 3AM2A 3ZLIA 5BNOC 2W87A 4ISQA 4Q4Y2 5LA0A 5D8AC 1P8JA 5FPUA 1CONA 4AF9A 1COV2 4BB3A 3B7MA 2FZ1A 5A6XA 3PURA 5M0TA 2W91A 1AR71 1XU1A 3NV4A 4I0AA 4MGKE 3S0MA 5BYNA 1K12A 1RGSA 2C6SA 1WZXA 2ADEA 2Q5TA 3RZGA 4X6RB 2VMHA 1NQJA 2DVFA 1FOD2 2CGOA 4UBGA 1OD5A 4N53C 4N8MA 4QU2A 2LTNA 2YFZA 4PJYA 4XQ4A 1LOGA 3WUCA 4PLOA 4HKLA 1OLRA 4Q4V2 2MHFA 1KGYA 5C9AA 5IHRA 5C3OA 2ZJCA 3NQHA 1BQPA 2A6WA 3B69A 3O0VA 4C8DA 5JOYA 2RR11 4IE6A 3PJQA 2IXCA 2Y64A 1A3KA 1UYYA 2WWJA 3D3AA 4XAAA 5KBFA 1QNYA 4GA9A 5C71A 4GWJA 1GWKA 3ACFA 1XNKA 3O1UA 4HXCA 1C28A 2G1MA 3ZYBA 5EYYA 5C4WC 2WSUA 4XQDA 1ZYBA 1BVP1 4BHPA 5A3LA 5IFTA 3KT1A 5FZGA 1SBDA 5FZ4A 3VZMA 5IAVA 3O1TA 1LR5A 2XWJB 3RZJA 4YSFA 2ZGOA 1WLTA 5A1AA 1Z7S3 3JBG3 5FZ3A 2EF6A 4JDOA 4H3WA 1YI7A 4MYEA 4BIFA 1OI6A 2OZ6A 3GCXA 4P02B 4K3UA 4AGRA 1AX2A 1Q8PA 4META 4RHV2 2ZGTA 4U36A 5BNNA 2XPJA 3OY8A 1VBB1 5APAA 5IUQA 1HRI3 2ZX0A 2JXAA 4E27A 3QLQA 2H6BA 2VOKA 3VKFC 1XYOA 2JICA 3MBWA 2GC1A 2PHTA 2W47A 4KGGA 5JVVA 1MEC2 3AMMA 3USUB 5FREA 2W95A 2WBKA 4RL7A 1S1AA 1EAH3 1W9FA 2ARCA 2VW2A 4Q27A 5LATA 4AHZA 1OD3A 3WW2A 4DUWA 4FTBA 4EN6B 1I9RA 4UFHA 5EHDA 5IK7A 1WMEA 2XMLA 4IV1C 4YGBA 4BWOA 1Q8VA 2GN7A 1UAIA 5T55A 4QX0A 2HLEA 1FNZA 4O9EA 4FXGB 4JCKA 1AF9A 5F6KA 4CDQC 5FYUA 4A2UA 1LCLA 1EV13 2DUOA 3FN9A 3WD5A 1R091 2XL9A 2EICA 3U14A 4ASKA 4A44A 5I93A 2VUDA 1AL22 3I49A 3UKVA 2BZDA 5FPLA 3IAQA 4I01A 2R6QA 1H4HA 3DGTA 4PI0A 3ZXFA 3TEYA 3MLLA 4NRQA 3ZX7A 1ZZCA 2VJXA 4RR3B 3GGLA 4B8EA 5CFCA 2JDYA 2YBPA 3T4HB 1TQ5A 2WWSA 2J1SA 1FXZA 2FQPA 3T08A 3UESA 3VBSC 1I3HA 1V6JA 2LW8A 3EMRA 2F4PA 3NNFA 4Q4W3 1JYWA 1O3SA 1H9PA 3VZLA 3LOBA 3VBUB 2CL2A 2O14A 5EWSA 1VBD3 5K7PA 1F2NA 4BXFA 2NQYA 4P9LA 4WVWA 4N9IA 2C9KA 1J1TA 3TN91 1UU5A 3ENRA 2TBVA 4UW5A 2WS91 4BLIA 4N7UA 1WKYA 4JGYC 4TWTA 4URTA 4BQ1A 3Q9OA 3I2OA 3BKZA 4ISRA 3ZSJA 4B1LA 1VMFA 1W8OA 4UFKA 4YVSB 5DPNA 3VGIA 2W52A 1N1VA 1DHKB 2ZHLA 3KV9A 4K1ZA 4GULA 2W5FA 1GNZA 2AREA 2HWC1 1PNFA 1RUE3 2K2SA 2XQRA 2JG8A 2WINB 4AI0A 3LA7A 4HBNA 4XBQA 1BMV2 1U5YA 2QQVA 2WNVB 4MO3M 4IQPA 4YRDA 4XABA 3WW3A 1PO21 3D6EA 1GWLA 3N9OA 2V4AA 3POYA 4MGSA 1KQRA 3WNXA 2BU9A 3ILRA 4OHWA 2YY1A 2CU5A 4E8CA 5GLVA 4QX3A 5FJKA 3OCPA 4KGQA 2XJUA 3NW4A 1ULOA 3FZ3A 3THTA 3AZXA 3LEIA 1FPN2 1V9U2 3B00A 1W3XA 2V5YA 3VZKA 1OUXA 4OULA 5HPOA 5JI9A 2FZ2A 1NX9A 1Q5OA 2NM1A 3AP9A 4UBHA 1SPPB 1JUHA 3VDDA 3OF1A 1GQGA 2RMU2 4QB1A 1OLQA 2VMDA 2Y6LA 3BB6A 1QJU3 2HWF2 3WF2A 3WQBA 5DUWA 4GZ9A 5LRSA 1D4VB 4JTNA 1RVF2 4OYUA 1OA4A 3SXWA 4P9YA 2XJVA 3UJQA 4B7EA 1YEWA 1US3A 3A0KA 1YQCA 2EA7A 2P3JA 1YNAA 3POGA 3I3QA 1UPIA 2E7TA 1S0DA 2K46A 2X5IC 4LHSA 3WG1A 1X8EA 4YGEA 1VAVA 2I2SA 1SLTA 1ULEA 3A4UA 2HWE3 2VH9A 4NPMA 1QXRA 1V6IA 3CZJA 1BBT3 2XUEA 4LHNA 5FOJB 2WAOA 2AC1A 2ATFA 3I97A 3PMEA 3SHRA 2Q4SA 2GSYA 5IFPA 3LFMA 1K42A 1LOBA 2RS11 4LUKA 1Q8SA 2FD8A 3C7OA 1WW4A 2PA7A 4DMIA 4D6SA 4FQZA 4FTSA 5KXDA 2IXLA 4GMP3 4Q1RA 4XMIA 1NYWA 2VAUA 4A45A 4HSJA 1OQ1A 3QOPA 3UT0A 1PIV3 4MADA 3M3IA 4BE3A 3NSTA 3ZM8A 1V6KA 3T2TA 3CU7A 5LCWL 3BTXA 1GLHA 3H1MA 4IEQA 5A3OA 4CCCA 3HT2A 4EN0A 1U5XA 1CX4A 5A3MA 3E1F1 4AK3A 3IAPA 1VE0A 1VAMA 3ZFFC 4CU6A 4E2GA 3D5OA 1KJRA 1PGW1 2CGPA 5CISA 3HT1A 2XXZA 3KCYA 4PF1A 1VBE1 1GUIA 2YZ4A 2QFEA 3WHTA 3WDXA 1ZM1A 4BH9A 2VTFA 4P9IA 5FZHA 3CJXA 4IESA 3EB7A 3GHMA 1CJPA 3RZMA 4XUQA 2IXHA 1GFF2 4AW7A 3ES1A 1HRV1 2BP6A 1LGBA 2HEWF 3T2OA 3PJYA 3N36A 1Y3TA 4GB32 2MNGA 3U78A 1J3QA 1G9FA 3LOIA 2PHDA 4JZRA 3AP4A 1UXZA 4N43A 3FE5A 2LROA 1R082 1KS4A 5H9PA 2VPVA 1YRZA 3MZHA 3H9AA 5CFDA 3K2OA 5A33B 2EAKA 1QXPA 1Y7BA 1W0PA 4LBOA 4RQPA 2ARBA 3ZYIB 4FOWA 4CCMA 4XUTA 1J3PA 3VBFC 4B4QA 1QKQA 1RHI1 5FBZA 3KHBA 1PZ8A 1RUJ2 5DG1A 3ETQA 4NHYA 2Q1ZB 3SNMA 1DGWA 4PBOA 4EN9B 2MEV1 4CP9B 5SV8A 1C8M1 1EUTA 2ZGSA 1OLMA 3RZLA 4U2AA 1QDCA 1NLQA 1AYM3 3V0BB 1PX3A 1W6QB 4IV3A 2RS53 3ZR6A 5IK5A 4PQ9A 1SFYA 3J8F3 5C6CA 4A3XA 2HBTA 5IVVA 4WVVA 1RUH2 4G9SB 3OPTA 3N9LA 4Y1XA 5CA6A 4UW3A 4L92A 1RUF1 2VQUA 1ASJ1 4FP2A 2VZQA 1H8TC 1AX1A 3M8LA 4KG8A 2WT2A 1YFWA 1H2MA 2B46X 2P3KA 2W68A 5A1FA 3CIHA 1W8WA 3GCWA 5FCCA 1NCQA 1XB9A 1KXGA 4LIVA 5FPXA 1ZRDA 1CWPA 3HWJA 3H1YA 1CAXA 2W94A 4XJWA 3SH3A 1G6NA 3ZVXA 3LA3A 2WNUB 4YVSA 1XE8A 1YC61 1YI9A 4UI9L 2R49A 2GH2A 5JXIA 3PIGA 3OSDA 4LA2A 3BTYA 2ZXQA 1Z7S2 5L9RA 2WNVA 5FP3A 3LDRA 1LKNA 2Z4FA 5F7UA 4FFIA 2JWPA 2BGPA 1MZ5A 4CDWB 3BUCA 1DZRA 2WQZC 3WDUA 4XBNA 4ARXA 2VNRA 4R9AA 5GZGA 4DRRA 1A34A 3VKLA 1S0JA 4YZ3A 4ZU5A 3AB0A 2JG8C 2W9XA 5K8SA 5KHJA 4IEWA 1W6MB 5DQ0A 4YW4A 1WW7A 3JD71 1QJY1 1CIYA 1H1AA 3LE0A 5ERLA 4FPLA 3KB5A 4AEKA 5CAZA 2JIJA 4MH0E 1GZCA 4QPGC 2FDJA 5F2SA 3CZUA 2HWD1 1GNYA 3MHZA 4IEYA 5EV7A 2HEVF 3GNEA 4RFRB 4KL1A 4EZHA 1AYN2 3LQCA 4QQPA 4DXZA 3VHRA 4ZS3A 5TSWA 1AXYA 4V1PA 2FDHA 1RUD1 2VECA 4EJRA 5LBEA 3O14A 2DTYA 2HYKA 2SLIA 3IDBB 5CYYA 5FZKA 4NOTA 5F1RA 4WM7C 4BQXA 2P3IA 4PDWA 1QJX1 3POIA 4AZZA 4W65A 1U5IA 4O65A 4YLZA 3O1RA 1QOOA 5DMYA 2ARAA 1O4YA 3K75B 4PIYA 5FP7A 4A7YA 4Q4Y3 3JXSA 3MV01 4Q4W2 2CNAA 1F15A 1DDLA 5IVFA 1COV3 3AKPA 3OD4A 2W39A 1LRHA 5IJRA 2HWB3 4NIGA 1E5HA 3Q8EA 4LBQB 1ND2A 2GNBA 2RR13 3HQRA 3I59B 3VDCA 4AVTA 4DEVA 3HEIA 4ZU7A 2KA3A 1GR3A 2P1BA 2V09A 2X29A 4LO6B 5LA1A 1REDA 3WLUA 1POQA 4QQ2A 2IUWA 3GYDA 1SACA 3M7AA 1FOD3 3PVOA 4XFAA 3VD7A 5IAXA 2WC2A 3U4XA 2CAUA 2KR2A 5A3NA 4MHRA 2NPIA 3O7OA 4Q4V3 4BQ2A 5C3PA 5IT6A 2AACA 3U11A 3PLQA 3Q8BA 1RUE2 5J1XA 4LBKA 4OMDA 1BEV1 3H7JA 2AEZA 4HT1T 4Q0UA 5EJ3A 2Q1FA 4E8DA 3N7MA 1EPZA 4E9KA 1LOFC 4IGOA 2WABA 3AC0A 4NVPA 4RGKA 3VD5A 2CV6A 1IG0A 3MIGA 1XJAA 2VCCA 1F31A 3K46A 3W21A 5FPVA 4GKYA 5E16A 1OF3A 4Y5Z0 1K5MB 4I3GA 1GNHA 3UKNA 5FYHA 2XBO2 4LOSA 4AFAA 5LEJA 4DUVA 4HLTA 1UNBA 1ZBA3 5L7OA 3Q8FA 1C57A 5I8YA 3EQEA 4DXSA 1US2A 5JOWA 3U75A 5C8CB 1D4M2 1HX6A 5ACA3 4D6QA 1W9YA 2A71A 2QQKA 4QKBA 4ZZ5A 2HYXA 4L11A 3PVBB 2PLV1 4LULA 3ZFEC 3LEGA 4LQRA 2B39A 5FMOL 3RJRA 5T52A 3Q8CA 1GP6A 5EIYB 3ACGA 1KRIA 5FZCA 4XUNA 1MEC3 1MS3A 3I7DA 1HKDA 5DAQA 3ZDVA 2DTWA 2A1XA 3URFA 2GNMA 2R30A 2ZMNA 4PLMA 4QXBA 2CWSA 4W6XA 2Q8DA 1YQ2A 4QPIC 1AJOA 2XLGA 4WVMB 1TZOA 1UZZA 1Y9QA 5I0RA 5A33A 2EIBA 3C7HA 3IM0A 5GALA 3VLBB 2YPJA 3DYPA 1JMUB 2VVFA 2BRTA 4YFWA 2HWE2 5E8AA 4AI1A 3KLSA 2ZBJA 1RUOA 1BBT2 2OQ7A 4XF1A 4Q0VA 5ABJB 3LKJA 4YW6A 4F83A 2UYBA 1IZ3A 2ZKLA 4QGLA 5DDJ1 4FAGA 5C5UA 4BU2A 2CDPA 1NLSA 2WS93 3WP6A 3NJZA 4CP9A 3ZN5A 4AQ2A 5IK4A 4QX1A 5F32A 1LGCA 5FY7A 4Z2WA 1VBA2 1SCRA 3RYPA 4CP2A 2XOMA 1WCKA 1OFNA 4MSVA 5HV4A 5JUVA 4IEUA 1OOPA 5J96B 2PHFA 2Z2SB 5C9AB 4LITA 5FP4A 2ZHNA 4NO4A 1KFXL 4UYBA 1OQEA 4FFFA 4ZY9A 2R073 2A3WA 5FAXA 3ZSLA 4UWDA 3KF5A 1MS9A 3ZXEA 4LBMA 1GKBA 1PO23 4XURA 2BTVC 5SV5A 4I02A 1R1A2 5HCFA 1Q3EA 4KWUA 4RR3C 5FY0A 2ZACA 1XNBA 2PHLA 3K4AA 5ANNA 3HPNA 2VNVA 2ZABA 2YHJA 1RUI3 1S2BA 1PO12 3VBUC 1W39A 1HV0A 2Q30A 1FNYA 4UFJA 1RIRA 3LIHA 4YW1A 1AR83 3WHUA 1UXXX 1O8PA 1QNWA 3OGGA 4HVOA 1MZFA 5BNNB 3DPRB 3OY8B 4AEDB 1XC6A 3HIFA 4S2HA 3BN6A 2JDNA 1IQDC 4DINB 4K21A 1QU0A 1E5SA 4UW4A 2F6BA 1E5RA 4QD2A 1JYNA 4NPLA 1FPN3 1NT0A 1V9U3 4NR1A 1CR7A 4QQHA 1EP0A 1W6MA 1YHFA 4YVWB 1JU4A 3ACIA 2WO2A 3VL9A 2OUJA 3AYEA 4OUMA 4NRMA 5T54A 3U1XA 5KHHA 1H2KA 1DFQA 1RUC2 4P5YA 1QMJA 1J58A 3DECA 4S2DA 2BJSA 1RVF3 5BUVA 4XACA 4WVZA 4XAEA 1UYXA 5JSRA 2CYFA 4P14A 5FMCA 5FMDA 3FFZA 3JB8A 1LOAA 5IW0A 1MQTC 1VALA 1VBC1 3PUAA 3X29B 3WINE 3VBHA 4BMEA 1WWYA 1NA1A 1NKGA 2JD9A 3JQWA 2D6NA 2J1AA 1A78A 5CFCB 1IPJA 1CVNA 3ZIXA 2YGMA 1AYM2 4QQOA 2W2IA 2RM21 1VB2A 3NL1A 3SEPA 2RS52 4QXHA 2Y26A 2P3YA 4MHUA 4C0HA 1N1YA 5FK7A 4ZXKA 1MZEA 2W1SA 1TMF3 2JD4A 3T4VA 3LD8A 4XCAA 1S0FA 5GJ6A 2AGSA 3I59A 1PMJX 1RUNA 1N3PA 3PNAA 4C90A 3WX5A 3VKOA 1OBNA 1WD3A 2E31A 2NMOA 1ULDA 1W2AX 4TXWA 4XTPA 2VCBA 3MDPA 2V4VA 3AZZA 1O3QA 1GANA 1YQ8A 4CUGA 5AFEA 1HB3A 4PBPA 1SLAA 3AMPA 4XDQA 5KWRA 3WDTA 1WUVA 1ACCA 2VCAA 3THCA 4EWAA 4FBFA 1HXS2 1ODNA 5I0UA 4JX0A 1ZRCA 1VAKA 3KS7A 1UKGA 3QH7A 3W9AA 3KF3A 4AGVA 1F4HA 1G9DA 4FT8A 4B4RA 4CUCA 2VU9A 2YC0A 4Z07A 2ZAAA 5FPAA 2OUHA 1SLLA 3NNGA 4O7XA 4JQTA 4COYA 2BW8A 4AL9A 2ZEXA 5DZEA 4EROA 3UGHA 1UKRA 1PK6A 3UGGA 2BV4A 2VL4A 2CY6A 4E4ZA 5BNQA 2LM3A 3ZPYA 4RS5B 1XU2A 3EO6A 3IDEA 4H14A 1W2UA 5AFBA 2QQPA 1ZA4A 2VULA 4SBVA 5FZ9A 1W0NA 1VRH1 3T0DA 4GIQA 4XFFA 3RFRA 1XYNA 5FMBA 4UT5A 1XBFA 3ZXLA 1NUKA 2BBVA 3EHKA 4P9WA 1W28A 1RHI3 1W03A 2WNOA 5CVRA 5FZ0A 3WF1A 4AHWA 4BXSV 3ZOIA 2AH2A 4MZUA 5E6HA 4Y1YA 1GYKA 3TYJA 5FRAA 2O8QA 2OYZA 4BIOA 3ZXDA 2ORZA 4YM1A 5FXZA 3DKWA 1AR72 2GH8A 4MLOA 2JDPA 4XHBA 4IERA 1V6LA 3A7QA 1MS4A 3AZVA 4XC9A 2G19A 4WVMA 2DFBA 1NCRA 4JGZB 2GNDA 4BK4A 4ONUA 3MF6A 3ILFA 4FSJA 4P00B 3OBTA 1ZREA 2QZ3A 5FYMA 3M1HA 2D6LX 1CESA 1RUJ3 1UZYA 3ELNA 3ZXAC 1WLCA 5ABJA 1KS5A 2HWB2 3OTFA 2VQ0A 2RR12 2C0ZA 2IXIA 1TNRA 4PHZA 4BOWA 1YYNA 3LEMA 3RYKA 2FDIA 2WFF1 4ATEA 2QQLA 2O8OA 2QQMA 1DGRA 2R063 3EXUA 1XE7A 3WCSA 1ULCA 2NYYA 4MXVA 4OHVA 4PIXA 4Y26A 5F8PA 4AI3A 1WGPA 1LHVA 4E4DX 5J7MA 3T2QA 1RUH3 3UETA 3WDYA 4CU9A 3AYDA 5FO8B 1N1TA 3GJAA 1OH3A 4DIQA 3OEAA 2D3SA 5I91A 1CJDA 2BOJA 2A5ZA 1YXWA 1XPWA 2ILMA 4OUSA 3R4UA 1UIKA 3GHNA 4Q0QA 2ZMKA 4NHLA 3I8TA 1ODMA 4XMAA 4M00A 1UPSA 4L0PA 4EN7B 5A3PA 3V0AA 3LFIA 2BUKA 3AFKA 1VBB2 1W99A 4BQ3A 3OJBA 1GICA 2VUCA 5H9RA 2PQSA 1W2OA 4GQ7A 4IEOA 4RD7A 5FXXA 3RRDA 3BALA 3GM8A 1ZBA2 1I6XA 3VL8A 1QQP3 3B9IA 3JD73 4LHKA 1JODA 5IK8A 1ULFA 2XJQA 4HPKA 2C5DA 4OI1A 5ACA2 5JAXA 5LB6A 1VIWB 3HNBM 4K8FA 4J6GA 3DPRA 3NNJA 4KWKA 2CGNA 2ARXA 4X8NA 4AEDA 4CRQA 4OHYA 1AUYA 1WBFA 2WNUC 2Y38A 3PUSA 4HKOA 5GLTA 4AAXA 4MXWB 2DU0A 1E5IA 1R092 2R043 2XLAA 3N9MA 4M0HA 4N43B 1UOGA 4FQ4A 1S0GA 3MFCA 4ASMB 1S0BA 3FLPA 3J4UH 4BPZA 4YVWA 1L7LA 2OW4A 4WV8A 5J3UA 1OFSA 5T3NA 5CFDB 5FZOB 2WNEA 4FXKB 5LEKA 3LB9A 5H9SA 2D44A 4RQPB 4CDWC 4FFGA 1NY71 5CG8A 1YLLA 1AYN3 2BOIA 1IS3A 4I2OA 3AMNA 4XQWA 2BEOA 2K0GA 3POJA 2PELA 1OSGA 2P34A 5L19A 3T0BA 3WQ0A 1JOJA 5B2GB 3BTZA 3KT7A 2J42A 2JDUA 4QX2A 4HN0A 3SISA 4UAPA 4CP1A 4COUA 4AI9A 2XR4A 1AR93 1S0IA 1UO9A 4EZ4A 2WS92 5BXXA 1DQ6A 4QGMA 1W8TA 4GH4A 1GP4A 1WCUA 3W5NA 4AHXA 5HCHA 4IV3B 3FHAA 5HXVA 4GXLA 3RYRA 3LSEA 4RHV1 4CXWA 1DU3D 1W04A 1BK1A 5A7SA 3M4FA 1JZ5A 1QH7A 1LULA 2HWC2 2RS33 1R1ZA 1WCSA 4HK8A 3DKQA 1UMIA 1LHOA 1BEV3 1LJ7A 2X09A 4OQ8A 2CAVA 2R072 4J1WA 2A75A 3HJRA 3SLIA 4Z1VA 3H50A 2UY9A 4I3PA 3ZDSA 1PO22 1NCQB 1CAXB 1D2SA 2VOWA 2Y6HA 3L9JT 1CPMA 2XJPA 3IBMA 1C8NA 2QQJA 2D6MA 2TUNA 3KGLA 2H0VA 2WYFA 5GZCA 5BY5A 1W9SA 4AVBA 3GZAA 4GD4A 2DDUA 3OOXA 1RUI2 3NAPA 3GZUC 5FUIA 3AMHA 3IZOA 1WMXA 3R0RA 5F5CA 1JZ2A 1WCQA 2D3PA 2WRAA 1PZ9A 3ZSMA 3ZXGA 1AR82 1S4CA 2YC2A 1NLRA 2A73B 4IXLA 4KG0A 2VTXA 3WW4A 5AC93 4LR4A 4JHZA 5T5PA 4NN0A 5FZBA 2EIEA 5I0SA 4CEWB 1DGWX 3AL6A 2XBO3 3O1PA 1UD1A 2OX0A 4IE7A 4L97A 4YG3A 1WMDA 3W58A 4ES9A 1T6GC 1ZRRA 2GU9A 5A32B 5IVBA 3LGRA 1JYIA 1AX0A 1U0AA 1UOBA 3FMGA 4OUEA 4RS5A 1EY2A 3OUHA 5A1LA 5JXGA 1V6NA 1D4M3 1FT9A 5FZDA 4OFGA 1LGNA 1W05A 5JZGB 4FP3A 1JZ7A 1SBEA 4P9GA 2A6ZA 3HNYM 4GAZA 1JZ6A 5FLIA 3H3ZA 3VBOB 3N3HA 2ZEZA 3ETPA 3O5SA 4W50A 4FOVA 5I0TA 3AP7A 3NVCA 4HL0A 1K5MC 2VOVA 4WBBA 5LA2A 4CCDA 3K48A 3A22A 2WQ8A 5FYTA 5EZWA 5KC5A 4LE4A 2WZR3 2XUMA 5FLJA 4NUBA 4XOGA 1UQXA 3MFAA 4OQ9A 2ZGMA 4D3WA 4PDWB 2X05A 1G9BA 2ZTNA 4YZ5A 3GDBA 5FLHA 5C8CC 3OG2A 4FOQA 4Y33A 4JGZA 1XNCA 3OBZA 2FCVA 5E89A 2PHWA 4BYYA 1W6OB 3PU3A 1IQAA 4GWNA 5FY8A 1KD7A 1JHNA 4EWDA 4Z8BA 5FO9B 2B9VA 2JG9A 1JYVA 3WW1A 1B35A 4QMAA 2ZGUA 3UJOA 1ND2B 3HBKA 1TMF2 5C3SA 5BNPB 3CJIA 2VR4A 2BVBA 2NMNA 1Z78A 2FMDA 2PAMA 3IMMA 4Q8LA 3BU7A 1VBA3 3QACA 4F8AA 4ZZ8A 1FMD3 1POV3 2EXKA 4COZA 4N7IA 3N9NA 1BKZA 3VD3A 4AFCA 4DNYA 4JRAA 1ENQA 4RFT0 2EXHA 2WAAA 4DXRA 2JDZA 1GOHA 2RMU1 1IPSA 1GZTA 1LAJA 1XYPA 3UL2A 4Q1PA 2HWF1 2BNOA 3T0AA 5J98B 3VDBA 1UX6A 1VBE2 3JQXA 5LA9A 4COVA 3WDWA 4XIOA 3IKWA 4FPCA 5F5QA 3AZWA 1VJ2A 3J26N 3RZKA 1R1A3 2YYOA 3UK9A 4A7KA 4ZKTB 1F5JA 4MGYE 1LHWA 5F5AA 5JPNB 2VO5A 1WBLA 1HRV2 3CQOA 1HIXA 4QHOA 3T3YA 3LA2A 3WXPA 4L8QA 4LBLA 1BZWA 1PO13 3PUIA 4KU7A 4M01A 3BODA 4UW6A 4XF9A 3ZR5A 4B4PA 1CPNA 1OA3A 3IT8A 3T09A 5L7OB 3VD4A 4AQ6A 2FCTA 2JE9A 4Y1UA 3AVSA 4QGNA 1AZDA 4CCJA 1UMZA 1OPMA 2VUJA 1SBFA 1YFXA 3MUY1 5DABA 3WG3A 5J48A 4BZ4A 1CGPA 2VW1A 2WLQA 4CA9A 3PL0A 5EJ1B 3RPQA 1JUIA 2AYHA 4RN5A 3POWA 1RHI2 5D21A 4MXWA 3SKJE 3S57A 1V0AA 3WDVA 4M3CB 4CEYB 2YBSA 2E26A 5FYZA 5A7WA 3BYWA 3SQOA 5T5JA 4OHZA 3FHIB 4NROA 2MEV2 4Q4X1 3ZFGA 1F9KA 1C8M2 1WLWA 3ZN4A 3IN9A 5FZOA 1RUC3 2PTMA 4K8RB 1IS6A 1OC1A 1JYCA 4NJ4A 4MV2A 5BNNC 1QDOA 2XKPA 3CBNA 3CO2A 1DQ2A 5GZEA 5GZDA 5K0UA 2VBPA 5DAPA 3J7NA 5D8AB 1ASJ2 1AR61 1RUG3 5F9TA 2VVDA 1PVC1 1W6PB 2YG0A 4N9HA 5D2AA 4ES8A 2R0HA 1F4AA 2Y6KA 1H0BA 4AQSA 4HOOA 3QH6A 3R4DB 1HJFA 2G9GA 1JZ4A 2YBKA 5FZ6A 5GLZA 3SH5A 2R062 3ZYHA 3C7FA 1ZA7A 2X53S 4DY3A 5JCTA 2VCMA 3CNAA 2AUYA 3RWKX 5F5IA 2GZWA 1OOPB 4EQVA 1S0EA 2KM2A 3W20A 4GJYA 5C33A 1TME1 4HK9A 5L9BA 2ZOEB 1Y4WA 3OGJA 3RWNA 4FCAA 5JDBA 3BIEA 2W0XA 3FFQA 3N7LA 4WZCA 5AVAA 2VXRA 5HV0A 1RTVA 2J1VA 3AXDA 4KBZA 4ZPIA 3U4SA 5JPMB 4TLGA 2VZSA 5FQ0B 4OI2A 1LOEA 1R081 2RJ2A 5CFCC 1PVXA 2KD7A 1NZIA 1VMJA 4JKLA 4XDOA 4ZHNA 5CG9A 1DGLA 1UOFA 2BNMA 5I0DA 2DCKA 2GC2A 3W5MA 3O12A 1HXS3 5FYYA 2V5DA 3RS6A 1YIFA 4Y4YA 2A6YA 3AP6A 1H6YA 3WG4A 1QQP2 2ERFA 3NJYA 3JD72 3VN4A 3UNPA 3RZHA 3LCPA 2GN3A 4LKEA 3RGBA 1GOGA 1H2NA 3C7GA 3J7MA 1GZ9A 1NE6A 5F37A 2HWD2 3MW4A 4KMQA 2TNFA 5DZGA 3TNPB 3D82A 4QPWA 1W06A 1DYKA 5LWBA 4CEWA 1CAVA 2IXKA 1O4ZA 5C70A 5A32A 2UWAA 2D5HA 2R042 3ASIA 3S5AA 2DUPA 2O0OA 2XVLA 1SQ4A 4A7ZA 3ZYPA 4XUPA 1G86A 1I1EA 3P6BA 2VBBA 5F3GA 5JZGA 1YQ6A 4CUAA 4IEZA 2VQAA 2D93A 4FPHA 2YROA 1DF0A 3VBOA 5FZLA 1WD4A 3FLRA 1D2QA 4AYUA 5JLVA 2GC0A 1OKOA 2I74A 4ITCA 3HNMA 4K6BA 4LXLA 1ZZ8A 5F6LB 5FZ1A 1AR73 5GLWA 3RDIA 5I8TA 3OEBA 2NZ9A 3KHCA 1H9WA 5IATA 4XFBA 3VBHB 2JEMA 4I0BA 2H0BA 2W1UA 1NA1B 1AR92 3JBG1 4BISA 3Q8AA 2WWUA 2YV8A 3W59A 4NWVA 1SLIA 1CZTA 3VDDC 1Y9GA 4Y3OA 1W6OA 3ZMNA 5KHGA 2XQXA 4EV0A 2VZRA 3IIIA 1HRI1 3MW2A 4JC1A 4WM8B 2RS32 5LBBA 3A21A 4L99A 1BEV2 5KXBA 4QAWA 5BNPA 2HJIA 2WQ4A 3WF3A 3MF9A 1DIWA 2JX9A 2IWGB 3PIJA 2CSGA 1H6XA 1EAH1 2DBNA 3AJZA 1VR3A 1MS0A 3AX4A 2C24A 3T1MA 3KCXA 1SDWA 2BYVE 1FATA 4EWEA 2OS2A 2OA2A 1SEFA 3ECQA 4BLJA 4BM8A 4AI2A 2P5BA 2D43A 3BOWA 1EV11 4CDXA 1QH6A 2V73A 1LU1A 5L36A 1UL9A 2ZX1A 1SFPA 3BGAA 4E2QA 2XONA 5AC92 2PLV2 1OHFA 1VBB3 2ZX3A 2DVAA 5FPZA 2XJTA 3LPGA 4YM3A 1JZ8A 4MGQA 1JYXA 5J37A 1W8NA 5KHKA 3AP5A 3L2HA 1PK6B 4TSVA 1JHJA 3H3UA 4XFGA 2PHUA 2WO7A 1X82A 1LEMA 1NQDA 4Q4W1 2EXJA 3WF0A 3PMSA 1OVPA 1VBD1 3ZSEA 2XB6C 3HBZA 3VBRA 1XNAA 2BGOA 3KVAA 5A6QA 4PQQA 2B45X 3NJXA 3AFGA 4GALA 2WJSA 2JB8A 4JRLA 2ZGPA 4B1MA 3DF0A 1JI6A 1W3VA 5L9VA 1R093 1QWRA 5DAWA 4M3CA 4CDUA 1OMIA 3AL5A 4CEYA 1LODA 1UYZA 2PAKA 5FZIA 1MS8A 2WZR2 4KWLA 3E97A 1RUE1 3INAA 3JCIA 3OD0A 4LIUA 4QM9A 4Y1VA 2WDBA 4QXCA 1PNGA 3FJSA 4CXYA 1NCRB 3K4DA 1VP6A 1V6MA 3K77A 5JMOA 3ILNA 5T50A 4AAPA 4ATFA 5FFOC 1SFNA 1W2TA 4GKXA 5FXWA 2DVBA 5BNOA 2Y8KA 2EIGA 3C8XA 2PQQA 4OMCA 2EAAA 5D8AA 2ETEA 4PCRA 3BPSA 1W6PA 4CSWA 4N43C 4Q0SA 3TN93 1HN0A 4A41A 4DZGA 1POV0 2RJKA 3E5QA 2XDVA 5GM0A 5CZKA 1RJ7A 3ROUA 4BDVB 1QOSA 1PZ7A 3NNLA 5FTTC 5CFDC 5CADA 1FYUA 1FMD2 5JSPA 1RINA 1ZZ6A 2DCYA 2HKXA 2QQUA 4FPYA 4RGAA 4A6SA 4BA6A 3TEWA 4FOYA 4ARYA 1CZVA 4LO4B 4RQPC 4CCEA 4N53A 2CHHA 1BCXA 1PM4A 2HWC3 1ZBE1 2GMPA 1QJU1 2QDNA 5HCBA 1CZSA 1M4WA 5A3TA 1MS5A 4MVTA 2VZ3A 3OBRA 4IE0A 3JB4C 5FQ0A 1ND3B 1V70A 1DGRN 1HDKA 1RMU1 5A80A 2Q8OA 3VZNA 2OVUA 3GBGA 2GMMA 3V0AB 2D98A 2YXSA 3MPPG 3NNMA 1PGL2 4IV3C 4AFBA 4YM2A 5C4WA 3ZSKA 5FWJA 4QDQA 3D8CA 4JKKA 1LHUA 2HWE1 1F35A 2XLFA 4JAAA 1WLDA 2Y33A 3B02A 4PF5A 1BBT1 1LNSA 2ZGLA 4NIAA 3USSA 4Y24A 2R16A 2WIIB 3FUQA 4NRPA 2FHRA 3MIDA 3IIAA 4DY5A 1J59A 2GP3A 4HPKB 4D7YA 1GQHA 1JYTA 3ON7A 1NCQC 1AJKA 2JJ6A 3ITQA 1X9TA 4M3CF 4K20A 4R4XA 5D1IA 3UGFA 4GMP1 1L7RA 4YVSC 1XE0A 5FUPA 1QHDA 5JIAA 2UU8A 4LTAA 3N9QA 3ORJA 4M4PA 4OZOA 4OI0A 1KFUL 1PIV1 4GWIA 2QZ2A 2ZPXA 1HB4A 1PX4A 4XFHA 4DXTA 1VBC2 4V2WA 1IS4A 2WNVC 4I0WB 5E1RA 4XJ9A 1NZCA 1UMHA 4XFCA 3WR0A 1H8VA 2D97A 4IV1A 4R8HA 1HN1A 2BFUS 1RXGA 2VZVA 3P1IA 2ZX2A 2IC1A 4FPJA 4IETA 3POSA 1X36A 1VB4A 3L2YA 4CU8A 4HSLA 4R9BA 3VBFB 2ZAHA 5FY9A 1RUG2 3SCFA 1FAYA 2RS13 2F4LA 3K3OA 1HQLA 1X8MA 5F2WA 4NE9A 2B5HA 2Q0AA 2VTXJ 1QJEA 4GH4B 5C5TA 3GF6A 1LOCA 4QDRA 1SG3A 2SBAA 4NMIA 3JU9A 4XW3A 3NRUA 1OPOA 2PAEA 2ZGKA 4OHXA 3DN7A 3POBA 1O4TA 2P6HA 3MIBA 3VBSA 4XZPA 4R9CA 5LASA 3V64A 1D0GA 3JZVA 2P4EA 4JQRA 2GNTA 4WM8A 4QHBA 4DS0A 2VOXA 3FUOA 3KV6A 4UOJA 5LK7B 1JN2P 3H1WA 4CE8A 3CEWA 2WA4A 4BQYA 1HW5A 2Y0OA 4PDWC 3WQ7A 1DBNA 4JGYA 4AEMA 4BJ0A 3QBQA 2Z69A 1L3JA 1SLCA 2DWRA 4KU8A 3UV9A 2JIGA 1W9WA 1S0CA 1XOYA 5JIUA 5E88A 4L2NA 3NAPB 1VBE3 3A23A 4IEVA 4JV4A 4IW3A 5C8WA 4Y22B 1AVBA 3BTAA 1WW5A 4MGIE 1ND2C 4ZU4A 4HANA 2W3JA 3I4IA 2B9UA 3TNQA 1BK0A 1IS5A 3E6DA 2PMWB 5FPBA 1NAEA 1YFYA 1SHWB 1HRV3 5T5LA 4JHTA 4XILA 1XSRA 4E4SA 3ATGA 2A3XA 4OI4A 4RSUA 4YW3A 1UY4A 1LB2A 1XQNA 1RXFA 2A6VA
chains in the Genus database with same CATH topology
3J8F1 3H7YA 1JTZX 4ASLA 2ZA9A 3A0NA 4Q4X3 1AXKA 1WCDJ 3FC0A 1CQ9A 4L9BA 2ET7A 3IDCB 1BJQA 2D3RA 1BVVA 1MS1A 1AL0G 3B94A 3U10A 1KITA 2D6PA 2VW0A 2WT0A 4AEJA 2TEPA 1AR63 3G6JB 4KH9A 4E2SA 3HMYA 1CAWB 4LBNA 1Z0HA 3ZYGA 5CBLA 5L7OC 4D94A 3ZXKA 2MEV3 2DVDA 3WUDA 1C8M3 2WFF2 1GZWA 2K9ZA 2EXIA 2Z5WA 2X5IA 3ZIWA 1KDMA 4XHXA 2VMIA 2XHKA 4SLIA 4YFZA 4B3NA 2JG9B 2IFRA 1RUF3 1ASJ3 1TME3 1B35B 2QCSB 4AE2A 4CYDA 1XXNA 3FLTA 4RGGA 3CJIB 1JW6A 2B8MA 5L73A 1V00A 1A6CA 3FWEA 3HQXA 2KXLA 1IPKA 1YJKA 4XXPA 2A70A 2E9QA 3M3CA 3NV3A 3OPZA 4OVEA 2JENA 2GALA 3MI8A 3WT3A 1ND3A 2E6VA 1UCXA 1PMIA 2IZWA 2QJVA 2UY8A 3DUIA 4QPYA 3VHPA 4INDA 3ZFFA 2EVXA 1X50A 4J1XA 1OOPC 1LENA 3WP5A 1A8DA 1QOTA 4Q4Y1 1DYPA 2YMZA 2P37A 1COV1 4I09A 1QJY3 1LESA 2HWB1 2A7AA 2VG9A 4HN1A 2AR6A 3PVEA 1UIJA 2ZZQA 2HWD3 3DV8A 1AHSA 3DL3A 3ZFEB 1NY72 3GBFA 3HAGA 1FOD1 4YARA 4LO8A 4Y20B 2DYCA 1RUD3 1FX5A 4YGDA 4Q4V1 3E5UA 2O1QA 5DUVA 4JVAA 4KQ7A 2XVGA 3ZFGB 1G9CA 2VVEA 3KQRA 3RI8A 1QJX3 1QJZA 1YWKA 2H6CA 1H4GA 2D5FA 2ET1A 4QPIB 2QE3A 2BWAA 4K9SA 3ZMOA 3H0OA 5DUUA 2B7YA 4DRVA 1JBCA 4H55A 4FPKA 1WA4A 5K0UB 2DCZA 2NN8A 3D0JA 4AFMA 4MUVA 3VBFA 4IEPA 5HBAA 3TN92 2X8KA 1ZBA1 3CLPA 3K51A 4AWDA 1IGOA 4XYXA 1KJLA 1CAUB 3AMQA 1HLCA 5ACA1 2D40A 3S7IA 5J36A 4CZSA 3O0WA 4FPEA 5H9QA 1IHMA 1MEC1 1H8TA 4YNIA 3VUOA 2OPKA 5GKAC 1E57A 3VBHC 1NA1C 3WG2A 1ENSA 1ONAA 3VZOA 4YYOA 4YW5A 1HQNA 3WP3A 4FPFA 4FPOB 4Y22A 4WM8C 4AVVA 1W6NA 3ZYRA 3R4SA 4IEXA 1AL21 1APNA 3MGUA 3MEPA 4XIKA 2PLV3 3IMNA 2YGLA 4Q29A 2E63A 2XJSA 4AQTA 2P17A 1QGLA 2DF7A 1CAVB 3AKQA 5EFUA 3MICA 1N1SA 2PHXA 2ZGRA 1N47A 5KXEA 1CD3G 1MR5A 1M06G 4C91A 4AVCA 4X8PA 3N35A 1IKQA 4NHMA 4LBJA 2DCTA 4N90A 2R071 1C1FA 3JUUA 2E7QA 3OYWB 3SITA 3UKTA 1RITA 2Z79A 4QPGA 1XRUA 3V65A 3VZJA 2UURA 4HVRA 2WA3A 1H30A 1PK6C 5DDJ3 5BV6A 1CAWA 4XJAA 1V6OA 1RUI1 3VHNA 1MQTB 2RS12 3D0SA 1GV9A 1N3OA 1DZQA 3D4KA 4HKWA 4Q26A 1DLLA 3S6PA 4WM7A 4TZDA 1DQ4A 1AR81 2JECA 4H7LA 4LE3A 1ZBE3 2ZCWA 2GDFA 4NHKA 5GZFA 3TAYA 2VGDA 4QT6A 1FPN1 4BCUA 1RJ8A 1V9U1 4G4FA 2EALA 5DG2A 3S30A 1RMU3 3ZN6A 1A8MA 2CWMA 1NCRC 4YG6A 1SLBA 3ES4A 2JE7A 4PLNA 2FBEA 1D0HA 2GMEA 1PGW2 5DZFA 3ME2A 2BVVA 4LHLA 3N7KA 5ABJC 1RVF1 4LBQD 4AHYA 4CDXB 3APBA 5CIRA 4D7SA 1LEDA 1I5ZA 5FO7B 2A6XA 4DPNA 3B93A 2JKBA 1LOFA 4TYSA 4XPVA 3WV6A 2BPA2 4JDNA 3KGZA 2WFPA 1F5FA 1MVQA 3MLJA 4LUMA 4IL7A 2E51A 4AG4A 3KZ4C 3J9SA 3SMHA 2ZHMA 5JSOA 1O3RA 2GAUA 4HZFA 3B9CA 2UWBA 3VBRB 1TMF1 2XVKA 4Q4X2 1C3HA 4XETA 3ACLA 5FDBA 3AYCA 2LUWA 3IWZA 1Q8QA 1ND3C 3ZFEA 3TBDA 1REFA 2QUOA 4Y20A 3C3VA 4CDUB 3RQ0A 3HR9A 1AR62 1OKQA 1PVC2 3FBMA 3TB0A 3CL1A 4DFSA 1UW8A 1VBC3 1RC6A 3TRSB 3EBRA 4JTOA 1H2LA 5GLUA 1XNDA 3SCHA 2BQPA 1ZX5A 3THPA 1O5LA 4QPIA 1QXJA 2RM23 1G9AA 2ZX4A 3PHMA 1UN1A 3DPRC 3MW3A 4AEDC 2IFWA 4Q0PA 5BNOB 4OZXA 1RUF2 1TME2 3EJKA 3USUA 3ZXJA 1J3RA 3NKTA 5JI7A 4YVWC 1SMVA 2WLPA 1ENXA 4XEZA 4LEJA 1W0OA 3VKMA 1CAUA 1PGSA 2DFCA 3VV1A 2VNOA 4XTMA 3GALA 3AK0A 4KBBA 4N53B 1G8WA 1WW6A 4GB31 4QM8A 1N3QA 3RNSA 4LO5B 1KDKA 1GSLA 4AXOA 3WVJA 3QD6A 4M3CE 3G7DA 4LT5A 2R1DA 4XF0A 4GH4C 2DVGA 3AZYA 4NPRA 4RR3A 4CP0A 4FTEA 5C4WB 4D69A 1ALYA 2Z42A 2WT1A 4QX5A 1JH5A 1O91A 2Y0IA 2R0FA 4R4ZA 1X33A 4C1XA 2QVSB 3VBUA 1Q43A 1RUJ1 5DUXA 1ZZ7A 4YW2A 1QJY2 3T1LA 2I07B 2ZS6B 3P3PA 1VRH3 4P5HA 1ZZBA 5I8SA 4NWWA 2VY0A 3RZZA 2R061 1ZVFA 2P2KA 2QNKA 2XGXA 1C1LA 1Q56A 3AKTA 4COWA 1RUH1 1RUD2 3NAPC 3PTYA 1UU6A 1OA2A 1YCIA 2PFWA 2OZJA 3JBG2 1QJX2 3OYWA 1TE1B 4WZFA 4IV1B 4XXAA 2D6OX 4S2GA 1O7FA 4CDQB 2PHRA 1HRI2 1ZNPA 2ENRA 3MPBA 4DB5A 5HCAA 2DU1A 4RS5C 1MQTA 2WFF3 1YUDA 1Z7S1 3ZO0B 1EPWA 1QQP1 3M70A 1EAH2 3MIEA 3WOGA 2NLRA 2BFUL 3NO8A 3VBSB 4YZ2A 3RJ2X 1URXA 1C5HA 4K1YA 2D7FA 1ENRA 1FI2A 4MX3A 2IXJA 4Z82A 4TLFA 5FOBB 1EV12 2R041 2WZPP 2BWCA 4LO7A 4MGZE 4JGYB 4JGZC 1NE4A 2CTVA 4CTEA 2A3YA 2AENA 2UYAA 4KNCA 3SCGA 2GC3A 4QQLA 1FV3A 2JG9C 1BXHA 1AYN1 1YFUA 3S7EA 1ZRFA 4XF3A 1B35C 2BNNA 3U0ZA 3WP4A 1VBD2 3CJIC 4OLLA 3WCRA 4LLFA 4Q2FA 3C2UA 1H1IA 1AR91 2PYTA 1HQWA 5LK5A 1MACA 4HMZA 3M3QA 3B5LB 3AYAA 3VKNA 2E53A 2B42B 1YO8A 1S2KA 1IKPA 4JDMA 1NG0A 2RS31 5JR7B 3RMYA 5KXCA 4PIZA 3NWKA 5KHIA 4Y1ZA 2VUAA 2YDEA 5CNAA 1Q8OA 4W6WA 3BIWE 4RA0A 1U12A 3ZYJB 3IPVB 4W6YA 1O3TA 1U5ZA 5DDJ2 3RSJA 3NKGA 1GZWB 3ST7A 3I54A 3KCCA 2LALA 2X5IB 2ZGQA 3N7JA 4FO9A 4X6QB 3U07A 4RHV3 5AC91 1YIPA 2QKDA 3VHOA 1ZBE2 1QJU2 4C0BA 1MZ6A 5DXDA 4YZ1A 4Q8KA 2XBO1 4P9JA 5HI0A 1Y43B 1YJLA 2DCJA 3KD4A 2N7GA 4LA3A 3ZFGC 1J1LA 2I45A 1RMU2 1LECA 1D4M1 2XG3A 2XKOA 4QXKA 1EYBA 1GBGA 1ZZ9A 5K0UC 1DQ5A 4K7JA 4XF4A 1AL23 2G9FA 3AXEA 2OIIA 3KT4A 5J09A 1RB8G 2R32A 1HV1A 3CF6E 3LAGA 2WZR1 4M0NA 1REEA 2D6KA 4GMP0 2E7AA 2ZKNA 5JWPA 3FBYA 2AZ5A 2VMGA 1CIWA 1S55A 4P9XA 3ZFFB 2ZZJA 3V0BA 1W6QA 3LZZA 1DQ1A 2Q1MA 1ULGA 4AGGA 4G3YC 1NXD1 1PIV2 5EXOA 1LU2A 2YUEA 2ZGNA 4ORFA 5T5OA 1O5UA 4I30A 3R6SA 3FX3A 1CN1A 1SCSA 3AKSA 4FPGA 3KMHA 1VBA1 4C1WA 2VNGA 1FMD1 1POV1 2RJLA 3WZ1A 3B3QE 2WNUA 4XJ8A 4DOUA 3RMXA 5AVPA 4AFDA 4HVQA 4BMBA 4LLOA 3LSDA 3M2MA 2ZMLA 3AJYA 4S2FA 1R1A1 4XJZA 2RM22 3TOJA 1IOAA 2MPFA 3H8UA 1AXZA 2DURA 4K40A 2DUQA 4B7KA 4CDWA 4CEWC 1PGL1 4UXAA 4CDQA 2W08A 1FV2A 2WKKA 4DQAA 3P3NA 2PN5A 3E6CC 1PO11 3SH4A 2R1BA 1RL3A 3BCWA 4AI8A 5JZGC 1DQ0A 1C4RA 4LNVA 1NOVA 4GWMA 2RMU3 2WSVA 3B01A 3VBOC 4O9GA 4XE9A 1BYHA 2HWF3 4XJUA 3E5XA 4F7ZA 3NV1A 5CU1A 3RI9A 2NP0A 1H8TB 1G7YA 5BPXA 3HN1A 4YM0A 2G4IA 4R52A 4H7MA 5JOXA 5K9YA 2C1FA 2C9AA 3GZTB 1RUC1 1LHNA 4D7TA 5CB7A 3J8F2 3LWCA 2XJRA 1W6NB 2BGCA 4LBQA 1RUG1 3BOPA 5BNPC 1QF3A 4YG0A 3MIFA 4XBLA 5JMCA 3MLKA 1VRH2 3PVNA 1AYM1 3M3OA 1B09A 2ZHKA 5KC6A 1LTEA 1H1MA 2RS51 2XH6A 1C5IA 3R05A 1PM7A 1JXNA 4AVAA 5EYXA 3MYXA 2JG8B 4CDXC 1MVEA 4YZ4A 3O0XA 2HEYF 3AKRA 4QPGB 4EN8B 2XL7A 4B29A 4R9DA 2WL1A 3ALQA 5FMOS 1TEIA 4AVSA 2DV9A 3BPZA 3M3EA 1PVC3 4F3JA 1K5MA 3IPVA 4FVVA 4YGCA 1PHMA 3TWIA 2XWBB 1TNFA 3KSCA 1HXS1 3QCWA 2QDRA 4HETA 3RG0A 1F8VA 1QY4A 3VBRC 2RHPA 4FAHA 4WM7B 3E6BA 1UF2C 5C8CA 1NXMA 4Z92B 4XFIA 5JOZA 1OQDA 4KWJA 3MIHA 3VDDB 1VLNA 3HD8B 3WY6A 3WQ1A 2RE9A 4GB33 3V56A 2UWCA 3NV2A 4CDUC 1UU4A 4CEYC 3GBWA 3N4MA 4HFSA 3I2DA 1X7NA 3KM5A 1R083 2ES3A 3ZN6B 1WMFA 1DG6A 5LRRA 2FMYA 1DZTA 3AM2A 5BNOC 4ISQA 4Q4Y2 5D8AC 1CONA 4AF9A 1COV2 3B7MA 2FZ1A 4I0AA 1AR71 1XU1A 3NV4A 4MGKE 3S0MA 5BYNA 1RGSA 2Q5TA 4X6RB 2VMHA 1NQJA 2DVFA 1FOD2 2CGOA 4UBGA 1OD5A 4N53C 4QU2A 2LTNA 4PJYA 4XQ4A 1LOGA 3WUCA 4PLOA 4HKLA 1OLRA 4Q4V2 2MHFA 5C9AA 2ZJCA 1BQPA 2A6WA 3B69A 3O0VA 5JOYA 2RR11 3PJQA 2IXCA 1A3KA 5KBFA 1QNYA 4GA9A 1XNKA 1C28A 5C4WC 5EYYA 2WSUA 4XQDA 1ZYBA 1BVP1 4BHPA 5A3LA 3KT1A 1SBDA 3VZMA 1LR5A 2XWJB 4YSFA 2ZGOA 1WLTA 1Z7S3 3JBG3 2EF6A 4JDOA 4H3WA 1YI7A 4MYEA 4BIFA 1OI6A 2OZ6A 4K3UA 4AGRA 1AX2A 1Q8PA 4META 4RHV2 2ZGTA 4U36A 5BNNA 2XPJA 3OY8A 1VBB1 5IUQA 1HRI3 2ZX0A 2JXAA 4E27A 3QLQA 2H6BA 2VOKA 3VKFC 1XYOA 2JICA 5JVVA 2GC1A 2PHTA 4KGGA 1MEC2 3AMMA 3USUB 5FREA 4RL7A 1S1AA 1EAH3 2VW2A 4Q27A 4AHZA 3WW2A 4FTBA 4EN6B 1I9RA 5IK7A 1WMEA 4IV1C 4YGBA 4BWOA 1Q8VA 2GN7A 1UAIA 5T55A 1FNZA 4O9EA 4FXGB 4JCKA 1AF9A 5F6KA 4CDQC 4A2UA 1LCLA 1EV13 2DUOA 3WD5A 1R091 2XL9A 5I93A 1AL22 3UKVA 4I01A 2R6QA 1H4HA 3DGTA 3ZXFA 3MLLA 3ZX7A 1ZZCA 4B8EA 4RR3B 5CFCA 1TQ5A 2WWSA 1FXZA 2FQPA 3VBSC 1I3HA 1V6JA 4Q4W3 2F4PA 1O3SA 1H9PA 3VZLA 3LOBA 3VBUB 2CL2A 5EWSA 1VBD3 5K7PA 1F2NA 2NQYA 4P9LA 4WVWA 4N9IA 1J1TA 3TN91 1UU5A 3ENRA 2TBVA 4UW5A 2WS91 4BLIA 4N7UA 4JGYC 4TWTA 4URTA 4BQ1A 3Q9OA 4ISRA 3ZSJA 4YVSB 3VGIA 2W52A 1N1VA 1DHKB 2ZHLA 4K1ZA 4GULA 1GNZA 2AREA 2HWC1 1PNFA 1RUE3 2K2SA 4AI0A 2JG8A 2WINB 3LA7A 4HBNA 4XBQA 1BMV2 1U5YA 2WNVB 4IQPA 4YRDA 3WW3A 1PO21 3D6EA 3POYA 1KQRA 3WNXA 3ILRA 4OHWA 2YY1A 5GLVA 3OCPA 4KGQA 2XJUA 3NW4A 3FZ3A 3THTA 3AZXA 1FPN2 1V9U2 3B00A 2V5YA 3VZKA 5JI9A 4OULA 2FZ2A 1Q5OA 2NM1A 3AP9A 4UBHA 1JUHA 3VDDA 3OF1A 1GQGA 2RMU2 1OLQA 3BB6A 1QJU3 2HWF2 5DUWA 5LRSA 1D4VB 4JTNA 1RVF2 1OA4A 3SXWA 4P9YA 2XJVA 3UJQA 4B7EA 3A0KA 2EA7A 2P3JA 1YNAA 1UPIA 2E7TA 1S0DA 2X5IC 3WG1A 1X8EA 4YGEA 1VAVA 2I2SA 1SLTA 1ULEA 3A4UA 2HWE3 2VH9A 1QXRA 1V6IA 1BBT3 4LHNA 5FOJB 2ATFA 3PMEA 3SHRA 2Q4SA 2GSYA 1LOBA 2RS11 4LUKA 1Q8SA 1WW4A 2PA7A 4DMIA 4FQZA 4FTSA 5KXDA 2IXLA 4GMP3 4Q1RA 4XMIA 1NYWA 4HSJA 1OQ1A 3QOPA 1PIV3 3M3IA 4BE3A 3NSTA 1V6KA 3T2TA 3CU7A 1GLHA 3H1MA 4IEQA 3HT2A 4EN0A 1U5XA 1CX4A 5A3MA 4AK3A 1VAMA 3ZFFC 4E2GA 3D5OA 1KJRA 1PGW1 2CGPA 3HT1A 3KCYA 1VBE1 2YZ4A 2QFEA 3WHTA 3WDXA 1ZM1A 4BH9A 4P9IA 3CJXA 4IESA 3GHMA 1CJPA 4AW7A 2IXHA 1GFF2 3ES1A 1HRV1 1LGBA 2HEWF 3PJYA 3N36A 1Y3TA 4GB32 2MNGA 1J3QA 1G9FA 3LOIA 2PHDA 3AP4A 4N43A 3FE5A 1R082 1KS4A 5H9PA 2VPVA 1YRZA 3MZHA 3H9AA 5CFDA 5A33B 2EAKA 1QXPA 1Y7BA 1W0PA 4LBOA 4RQPA 2ARBA 3ZYIB 4FOWA 1J3PA 3VBFC 4B4QA 1QKQA 1RHI1 5FBZA 1PZ8A 1RUJ2 5DG1A 3ETQA 2Q1ZB 3SNMA 1DGWA 4PBOA 4EN9B 2MEV1 5SV8A 1C8M1 2ZGSA 4U2AA 1QDCA 1AYM3 3V0BB 1W6QB 4IV3A 2RS53 5IK5A 4PQ9A 1SFYA 3J8F3 5C6CA 4A3XA 4WVVA 1RUH2 4G9SB 4Y1XA 5CA6A 4UW3A 4L92A 1RUF1 1ASJ1 4FP2A 1H8TC 1AX1A 3M8LA 4KG8A 2WT2A 1YFWA 1H2MA 2B46X 2P3KA 2W68A 5FCCA 1NCQA 5FPXA 1KXGA 1ZRDA 3HWJA 3H1YA 1CAXA 4XJWA 3SH3A 1G6NA 3ZVXA 3LA3A 2WNUB 4YVSA 1XE8A 1YI9A 2R49A 2GH2A 4LA2A 1Z7S2 2WNVA 1LKNA 1MZ5A 4CDWB 1DZRA 2WQZC 3WDUA 4XBNA 2VNRA 4R9AA 5GZGA 4DRRA 3VKLA 1S0JA 4YZ3A 4ZU5A 3AB0A 2JG8C 5K8SA 5KHJA 4IEWA 1W6MB 4YW4A 1WW7A 3JD71 1QJY1 1H1AA 4AEKA 4FPLA 3KB5A 5CAZA 4MH0E 1GZCA 4QPGC 2HWD1 4IEYA 5EV7A 2HEVF 3GNEA 4KL1A 1AYN2 4QQPA 4DXZA 3VHRA 5TSWA 1AXYA 4V1PA 1RUD1 2VECA 4EJRA 3O14A 2DTYA 2HYKA 2SLIA 3IDBB 4NOTA 5F1RA 4WM7C 2P3IA 4PDWA 1QJX1 4W65A 1U5IA 4YLZA 1QOOA 1O4YA 4PIYA 4A7YA 4Q4Y3 4Q4W2 2CNAA 1DDLA 1COV3 3AKPA 3OD4A 2W39A 1LRHA 2HWB3 4LBQB 1ND2A 2GNBA 2RR13 3I59B 4AVTA 4ZU7A 2KA3A 1GR3A 4LO6B 2V09A 2X29A 1REDA 3WLUA 4QQ2A 3GYDA 1SACA 3M7AA 1FOD3 3PVOA 4XFAA 2WC2A 3U4XA 2CAUA 2NPIA 3O7OA 4Q4V3 5IT6A 3U11A 3PLQA 1RUE2 4LBKA 1BEV1 3H7JA 4HT1T 4Q0UA 5EJ3A 3N7MA 1EPZA 4E9KA 1LOFC 4NVPA 2CV6A 3MIGA 1F31A 4GKYA 5E16A 4Y5Z0 1K5MB 4I3GA 1GNHA 3UKNA 2XBO2 4AFAA 5LEJA 4HLTA 1ZBA3 5L7OA 1C57A 5I8YA 3EQEA 5JOWA 5C8CB 1D4M2 1HX6A 5ACA3 2A71A 4L11A 3PVBB 2PLV1 4LULA 3ZFEC 2B39A 5FMOL 3RJRA 5T52A 1KRIA 1MEC3 1MS3A 3I7DA 1HKDA 2DTWA 3URFA 2GNMA 2R30A 2ZMNA 4PLMA 4W6XA 2CWSA 4QPIC 1AJOA 2XLGA 4WVMB 1UZZA 1Y9QA 5I0RA 5A33A 3IM0A 5GALA 3VLBB 2YPJA 2VVFA 4YFWA 2HWE2 5E8AA 4AI1A 3KLSA 2ZBJA 1RUOA 1BBT2 4XF1A 4Q0VA 5ABJB 3LKJA 4F83A 2UYBA 1IZ3A 2ZKLA 4QGLA 5DDJ1 4FAGA 1NLSA 2WS93 3WP6A 3NJZA