1R082

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1r08200
1ND2C 3CJIB 4RHV3 1HRI1 1AR72 2PLV2 1PIV1 1RUJ1 4GB32 4Q4X3 4Q4W2 2MEV1 2DF7A 4N53A 3VDDC 4CDUC 1PO23 1RHI3 2R061 4AEDA 2RMU1 1VBC2 1HRI2 1PIV2 3VBFA 2MEV2 5D8AB 2R041 3ZFFB 4YVWA 1AR73 2PLV3 4GB33 3CJIA 4QPGC 5FMOS 1R081 4Q4W3 1PGL1 3VBUB 1AR82 1EV11 1B35A 1VB4A 1ND2B 4JGZC 4WM7C 1BBT2 1OHFA 1SMVA 1VBC3 4LLFA 1HRI3 1NCRA 1VBA1 1PIV3 2GH8A 5C8CA 2HWD1 2X5IA 1RUF2 1RUG2 1PGL2 5D8AA 1EV12 1HXS2 4CEWC 1POV0 5CFDC 3JD71 1NA1B 2HWC1 1AR83 1FMD1 3M8LA 4Q4Y1 1EAH1 4QPGB 4NWWA 4N43C 1BBT3 1QJU2 5ACA3 2WFF2 2WLPA 2BPA2 4Q4V1 1QJY2 3HAGA 2TBVA 1D4M1 1RUH2 1ND3A 5C4WA 3TN93 1RUF3 1R1A2 1RUG3 1RVF2 4JGZB 4WM7B 2R072 1HXS3 2HWE1 4RFT0 2RS33 1AR62 4Z92B 2IZWA 1NA1A 4AEDC 1VRH1 1QQP2 1VBB1 2QQPA 1PO12 1VB2A 3VBFC 1QJX1 4GMP1 1COV3 4CEWB 1AYM2 5CFDB 5LK7B 1QJU3 2WFF3 4YVWC 1QJY3 3CJIC 4IV1A 4Y5Z0 1RUH3 2WS91 1R1A3 1WCDJ 5A33B 1ASJ2 4RS5B 1OOPB 1RVF3 1FPN1 2R073 4N43B 1B35C 1QJX2 1AR63 4CDQB 1ZBE2 1QQP3 1RMU1 1NCRC 1CJDA 1PO13 1AL21 1C8M1 5C8CC 2WS92 1MQTB 2X5IC 1AYM3 5DDJ1 3VBOA 4AEDB 2HWF1 1ZBA2 5BNOC 1ASJ3 4JGYA 2WZR2 2Y26A 5A33A 1H8TB 4RS5A 1PVC1 1OOPA 1AL22 1QJX3 1MEC1 1FOD1 4YVWB 2RM21 4CDQA 1ZBE3 1RUI1 2XBO2 2HWF2 2WS93 1ND3C 5C4WC 1B35B 1MQTA 5L7OA 1ZBA3 1C8M2 1V9U2 1NCRB 5ABJB 2RM22 1TME1 1RUJ2 1NA1C 5C8CB 1RUI2 2WZR3 1NY71 2X5IB 1H8TA 1AL23 5CFCA 5BNOB 1NOVA 2XBO3 2R062 4IV1C 2RMU2 2RS51 1TME2 3VBSA 2XPJA 1QJZA 1VBD1 1POV1 4CDWC 2RS11 1C8M3 1V9U3 1HX6A 2R042 2RM23 5ABJA 1RUJ3 1ND3B 1RUI3 5BNPA 5C4WB 1CD3G 5A32B 5C9AC 3ZFGB 1R082 2MEV3 1W39A 1HRV1 4Y4YA 4RQPA 1VBD2 2BBVA 1AUYA 5BNOA 3VBHA 1AR91 1M06G 3VBOC 2R063 3ZFEB 2RMU3 1VBA2 1TME3 5JZGA 4JGYC 2HWD2 2BFUS 1BEV1 4RS5C 1OOPC 5GKAC 3DPRB 1HRV2 2R043 2ZAHA 1RUD1 4IV1B 4CDQC 3JD72 4NWVA 1RB8G 2HWC2 1Z7S1 1R083 5A32A 3ZFGA 4CDWB 1EV13 5K0UA 1MQTC 1VBD3 1FMD2 4Q4Y2 5L7OC 1EAH2 1BEV2 1BMV1 1POV3 5FOJB 1RUC1 2HWB1 5BNNA 3ZFEA 1RUD2 5C9AB 1VBA3 4Q4V2 1VBE1 1D4M2 1K5MA 2HWD3 1PGW1 1H8TC 2WWSA 5CFCC 1HRV3 3VBOB 2HWE2 3DPRA 1X36A 5FMOL 3JD73 4EJRA 2HWC3 2HWB2 4JGYB 1VRH2 1R091 1VBB2 4CDWA 3VBSC 1FMD3 4CDXA 4Q4Y3 3VBRA 1EAH3 1PGW2 3LOBA 4YVSA 3J8F1 1RUD3 4Q4V3 5C9AA 5ABJC 1D4M3 5BNPC 4RHV1 3NAPB 5L7OB 1R092 1FPN2 4CEYA 2HWE3 1VAKA 4RQPC 5J98B 3VBHC 4RR3A 1VRH3 4QPIB 1RMU2 1PO21 1RHI1 1VBB3 5CFCB 5JZGC 4GMP3 2BUKA 4GH4B 4WM8A 5DDJ2 3JB4C 1AR71 2PLV1 4GB31 3VBSB 2FZ2A 3NAPA 1R093 3ZFGC 1PO22 1FPN3 1PVC2 4Q4W1 2ZTNA 5K0UC 1MEC2 1FOD2 1OPOA 5J96B 5BNPB 5BNNC 1RMU3 3ZFEC 2VQ0A 4QPIA 1VBC1 4PDWA 1F2NA 1K5MC 4RQPB 2ZZQA 3VBHB 4FTBA 5DDJ3 4GH4A 1AL0G 3DPRC 2HWF3 3JBG1 5JZGB 3IDEA 1NY72 4FTEA 3S6PA 1PVC3 1AR81 4CDXC 1MEC3 3VBRC 1FOD3 2FZ1A 1NCQB 4YVSC 1HQNA 4IV3B 1BBT1 3JBG2 5ACA1 2RS52 5K0UB 1A6CA 3TN91 1RUF1 1RUG1 1IHMA 4CEYC 4FTSA 5BNNB 2RS12 1X33A 1HXS1 2RS31 4RR3C 1K5MB 1RUE1 5ACA2 4BCUA 3VDDB 3TN92 1NCQA 4CDUB 1COV1 4IV3A 4WM8C 1AR92 3JBG3 1QJU1 1AYN1 2WFF1 1C8NA 1QJY1 2GSYA 2RS32 2RS53 3ZFFA 4CDXB 1RUH1 1RUE2 3NAPC 3VBRB 1R1A1 4YVSB 1RVF1 3VBUA 2RS13 2R071 1DDLA 1AR61 1COV2 1ND2A 1TMF1 1Z7S2 4QPIC 1AYN2 1QQP1 4PDWC 2RR11 4CEYB 1PO11 3JB8A 1BMV2 3VDDA 4CDUA 1F8VA 4RR3B 1AR93 1AYM1 4GH4C 1RUC2 4N53C 1VBE2 1RUE3 1E57A 1BEV3 1TMF2 1ASJ1 2RR12 4WM8B 5AC91 4SBVA 4FSJA 4QPGA 1Z7S3 1AYN3 1ZBE1 4Q4X1 3FBMA 1GFF2 3J8F2 1RUC3 2HWB3 5AC92 4JGZA 4WM7A 1NG0A 4GMP0 1ZBA1 4PDWB 1VBE3 4RHV2 2BFUL 1TMF3 4Q4X2 2WZR1 2RR13 3ZXAC 4N53B 1NCQC 4IV3C 4CEWA 5D8AC 5CFDA 2XBO1 1RHI2 3ZFFC 3VBFB 3J8F3 3VBUC 5AC93 4N43A 1V9U1
chains in the Genus database with same CATH superfamily
2W1QA 1ND2C 5KWRA 1AR72 1GV9A 3KWVA 4GB32 3AL6A 4KQ7A 3SEPA 1I3HA 5FPBA 4NJ4A 4P02B 2QQMA 3N9MA 3PVOA 1S0EA 1WMFA 4Q4W2 4DNYA 5JOYA 1QMJA 3OBAA 2DF7A 3N9NA 4CDUC 4Y24A 4AVAA 3I3EA 1J3RA 1W8HA 3CO2A 1Q8VA 1UAIA 4CTEA 4PLMA 3OTFA 4GALA 5FYYA 1QU0A 2OQ6A 4AEDA 1SQ4A 4ARYA 1SLIA 1HRI2 1GP5A 4P9XA 2P3JA 5JWPA 5JUVA 1WCQA 4N90A 1PVXA 2BEOA 2VW0A 3A4UA 4JZRA 3MFCA 4Y20A 4AQ2A 2Z4FA 4H14A 3MPBA 1XYPA 4PQQA 3NKTA 2XGXA 4P9IA 4BQ5A 2PLV3 4YZ5A 4QPGC 5FMOS 3WG3A 1SLLA 1TEIA 4PIYA 4WZCA 1ZM1A 1JZ8A 2CDPA 4E2SA 1AR82 2WQ8A 2ARCA 1YCIA 3PVBB 2WAOA 3QCWA 3W5NA 1ND2B 5FQ0B 5EXOA 4JGZC 4DIQA 1BBT2 1JH5A 1OHFA 2YYOA 4HETA 3ZYIB 4XJ9A 3MFAA 2ZJCA 3KGLA 4Z2WA 3GM8A 5C8CA 2HWD1 2GNTA 2O8QA 2BNMA 4L99A 1QOTA 2P6HA 4YZ4A 2QQVA 5FLJA 1OUSA 4AI1A 4ZHNA 4LBJA 3SQOA 4E4DX 5EV7A 3HBZA 4UF0A 1KS5A 3VD4A 2ORZA 3JD71 5KXEA 3N7LA 4ZKTB 1JU4A 2CAVA 2G9FA 1ULEA 2GC0A 5F5QA 3GCXA 4LHLA 2RDSA 1OVSA 3CMGA 3HN3A 3O1VA 1CESA 1V6OA 3I3QA 1G9DA 1QH7A 4QPGB 5GLTA 2PELA 3KT4A 4N43C 3WNLA 5HPOA 2RE9A 1E5HA 3MYXA 2BDRA 3E6CC 1PZ7A 4JV4A 4Q4V1 3AX4A 3B3QE 4AK3A 1W6PA 2A3WA 1RUH2 1UY3A 4ZU4A 2VTXJ 2QUOA 1VAMA 1V0AA 1OLME 1R1A2 1RUF3 3PTYA 4UW4A 5CZKA 2FDJA 5T50A 5T52A 1RINA 4JGZB 1HXS3 2HWE1 2AENA 2OPWA 2ZAAA 4RFT0 1LJ7A 1PMJX 2C26A 4NR1A 2C0ZA 1DU3D 1AR62 1UMHA 4Z92B 2QQUA 5H9SA 1VJ2A 1N47A 1NA1A 4AEDC 2AUYA 2C6SA 3R4UA 4HK9A 4HMZA 5JSRA 1VBB1 1Q43A 2XLAA 4XPVA 4XVHA 1PO12 1VB2A 2NM1A 3HQUA 2QQPA 3BTXA 3BIEA 4Q2FA 1JBCA 2W68A 3DYPA 1X9TA 4P00B 1S0BA 4IEWA 1IG0A 1QJU3 1QJY3 3H3LA 3WP3A 3EO6A 1SLBA 4Y5Z0 2VM9A 1W6NA 3SH4A 5DZFA 1JHNA 3PJQA 4YZ3A 5A33B 1ASJ2 5FLHA 1MZ5A 3LA2A 1RVF3 4RS5B 4AFBA 2R073 3H0OA 4N43B 1OQ1A 4K8RB 4D69A 2VZSA 4J1WA 5ERLA 2LROA 5IYYA 4HPKB 3AMMA 3V56A 3VN4A 1UYPA 1NXD1 1PX3A 5GZEA 1OF3A 1ZBE2 1XE8A 5CIRA 5FP8A 2VBPA 4XUTA 5JPMB 3IMMA 5KHHA 2ZX0A 5C8CC 1OA2A 1MQTB 1WLTA 2GN3A 2JDYA 4R9CA 1HDKA 4URTA 4ZS3A 3NV1A 5I93A 3VKFC 1UOGA 2HJIA 5FUNA 4AEDB 3R05A 4MV2A 2NYYA 2BWCA 5H9QA 2WNUA 1LOEA 1DGRA 3K3OA 4OZXA 2JDHA 2RJLA 2DYCA 4NIDA 1LULA 5L36A 3IDAA 3N7MA 1OOPA 3PIJA 1J58A 2VGDA 4MXWA 3ES1A 2FDIA 2VZOA 3E5XA 3Q8CA 2JXAA 2RM21 3ME2A 3IDBB 3GF6A 4Y1UA 1CR7A 3KV5A 3SISA 3PURA 4GQ7A 3T30A 3KLSA 2XBO2 3PMSA 4A44A 2HWF2 4C0BA 2B9VA 3S0MA 2C4XA 3E1F1 2VQTA 3O0VA 2C24A 4QPYA 4KWJA 3RYPA 1UWWA 1W2OA 5L7OA 1V6NA 3WVJA 5FY4A 1VR3A 5B4NA 4KG0A 4XJAA 1W9WA 2RDNA 2B5HA 1C8M2 3AZXA 1N3QA 2ATFA 3RWNA 1YQCA 2K0GA 2ZEXA 3K4AA 3NQHA 3ZN4A 2B4KA 3H1WA 1TME1 2XH6A 1RUJ2 1NA1C 5C8CB 1IPJA 3ZSJA 5KR7A 3ZYFA 4LXLA 5EP9A 1H8TA 3O0XA 1AL23 5JMOA 1MVEA 3MICA 1G9AA 3WLUA 1UU6A 5ANNA 4ZXEA 1NOVA 4AQTA 2WO1A 1LU2A 2N7GA 3OBZA 3VGIA 4A6SA 2XVGA 3WCRA 3ZLIA 1YJLA 5IVYA 2Q5TA 2RS51 5GALA 1D2QA 3E5UA 1QJZA 1XQNA 2W9XA 3GZTB 1W6OA 3OPWA 2D43A 4YW4A 3OEBA 2QDNA 3WP5A 1O4TA 2RS11 3QBQA 1SDWA 1W6PB 2W1WA 1DIWA 2B7YA 1W28A 4W8JA 3HBKA 5BNPA 5JLVA 4LORA 4QDSA 1N1SA 4K20A 2CGOA 1CD3G 5C9AC 3ZFGB 1R082 5FZHA 1DBNA 2ILMA 1TNRA 5FYVA 5DG2A 3T2QA 3D8CA 4JKMA 4D7TA 3FHIB 3JZVA 1VBD2 4LE3A 3R6SA 2ET1A 4UXAA 3VLBB 2VH9A 4I3PA 3WHUA 4A7YA 1M06G 1HLCA 4B3NA 3ACLA 1UX7A 4L92A 2ZZJA 4N7IA 1XJAA 4UFIA 4FPOB 4DRRA 2WNUC 4BH9A 3IIAA 1LOAA 3X29B 2VCBA 4DRVA 1AX1A 2BFUS 1OOPC 1UNBA 2OX0A 4IERA 5GKAC 3POJA 4UFJA 3AZZA 1HRV2 4M3CE 2VXJA 1W6NB 2JICA 3M4FA 1FATA 5C3QA 4NRMA 2BRTA 4NWVA 4E4HA 2ES3A 3N36A 2HWC2 1KDKA 1Z7S1 4G4FA 4L0PA 5A32A 5J09A 2FDGA 2JKXA 1RC6A 3FBYA 4XILA 2R0HA 2XJRA 2XONA 1G8WA 3RFRA 1CAWA 4YZ2A 3E6DA 2GNDA 4Q4Y2 5L7OC 3H8UA 3D82A 2JDMA 1UPIA 1RUC1 2VZTA 5C9AB 1RUD2 3DGTA 4FPCA 1UY0A 2WNOA 3THTA 4FAGA 2HWD3 2VU9A 4NRPA 4OZOA 5FMCA 2IFRA 2B45X 1H8TC 2WWSA 2VE1A 1LHVA 1XYOA 1S0FA 4DFSA 4XJZA 3T08A 4RYDA 1DQ2A 2W94A 2O8OA 1X36A 5FMOL 2WNUB 3A23A 3JD73 4KMQA 2FMDA 2VULA 2HWB2 2HEYF 5DUWA 5A1LA 1NE6A 4Q0UA 1VRH2 3ITQA 1J3QA 2ERFA 2HBTA 2ORXA 4MXWB 4I30A 4XTMA 4Z07A 2NP0A 1W9TA 2JKBA 1PGW2 3IBMA 4NHXA 4LTAA 3PL0A 4EV0A 3T2TA 4PT6A 2YDEA 5F2SA 1NE4A 4RL7A 3CNAA 3JU9A 2BQPA 2Y6LA 4Q4V3 2QQIA 3WNPA 5KHGA 3C8XA 5BNPC 3RPQA 2FDKA 3MEPA 3W59A 4O7XA 4S2FA 5L7OB 1QF3A 2I07B 3MGUA 4QX3A 1UQXA 4Y3OA 2HWE3 4E9KA 1DYPA 5LA9A 4NPMA 4DY3A 4LMFA 2JIJA 2YC2A 1PK6A 1RXGA 1YHFA 4XF1A 4QPIB 1C1FA 4TYSA 1OLMA 5FXVA 1VBB3 4D7YA 4XXPA 2P3YA 1OI6A 2D44A 4HG6B 3N9QA 4J25A 3VKMA 4EYUA 5LRSA 5KHIA 1J59A 2YHJA 4RN5A 5JOZA 3NV3A 3UGHA 4EROA 2DBNA 3I3DA 1JTZX 4JDOA 2WWUA 4WM8A 5HBAA 1ALYA 1V6LA 1BCXA 2ZGUA 2VW1A 3G7DA 3B9IA 4MADA 2D6LX 4LNVA 5FXWA 4MGKE 5JOWA 1AR71 4HBNA 4GB31 2FZ2A 3NAPA 3CDZB 4GWMA 3WDTA 5FDBA 1R093 2WYFA 1W6OB 2IFWA 2R1DA 4Q4W1 1UOJA 2ZTNA 4UFHA 1S0CA 4XHBA 3WDVA 4BU2A 2Y60A 3U37A 2DCJA 1FOD2 4BQWA 2WC2A 4GKYA 3Q8EA 3HQXA 5DAPA 5BNPB 3GCWA 3S5QA 3WG2A 2CDOA 5IVVA 2VQ0A 2W95A 3VV1A 3TOJA 1QDOA 1F2NA 2OZJA 5C70A 4LO7A 4WVMA 2XL9A 1QXJA 2AGSA 4XFCA 5A6YA 3ZIWA 1X7NA 1HB1A 2DU1A 2J7MA 4JVAA 1WZXA 5C3OA 4BXFA 4W65A 3CZJA 4FCAA 4KGGA 1NY72 1KFXL 2VAUA 1RXFA 2VQAA 3CU7A 2IXCA 4XF0A 3RZZA 1AR81 3PIGA 3THPA 5FY0A 4CCOA 2TNFA 4CE8A 1BXHA 2WKKA 2ZGSA 1G7YA 3A0KA 2ZX4A 5CAZA 4MGZE 3J26N 3NV4A 3RYKA 1BBT1 4JRLA 2WR9A 3JBG2 3FC0A 4OMDA 4R4ZA 1WLWA 3ZDSA 2RJKA 3EQEA 3TEZA 1AX0A 2BNNA 2XDVA 1VAVA 1BVVA 1OFNA 1CAWB 5FPAA 2E7QA 3TN91 3O1PA 3KF5A 3ZYRA 4COZA 1S1AA 1O8PA 1S0DA 1PK6C 2RS31 4CUAA 3C7OA 1RUE1 1ZA4A 3M1HA 2VZUA 1XRUA 3AMNA 1US2A 1DZRA 4W6XA 2YGMA 3BPSA 4DXTA 1EPWA 2XG3A 1TZOA 4QKBA 1NCQA 3LGRA 3T2OA 3WQBA 4EN7B 4AFMA 4WM8C 2EAAA 1W2NA 1WWYA 1XU1A 2IUWA 5FZDA 4PI0A 4PLNA 3VHNA 4IXLA 2RS53 3AVRA 4AHWA 3BTAA 1P8JA 1RUH1 3NAPC 3VDAA 2RHPA 4QX5A 1R1A1 2BP6A 4AEMA 2B8MA 1GNHA 2DU0A 3VBUA 2RS13 5HXVA 1QXRA 5A7QA 4G3YC 4HK8A 3JCIA 4CXYA 3CKHA 1AR61 3LEMA 1LGCA 3P3NA 4HLTA 2WT0A 3UGGA 1UU4A 4CCMA 1AYN2 4Q8KA 4ARXA 3RRDA 4BK5A 2RR11 5FZGA 4MHUA 4EE2A 1PO11 4NROA 4FPFA 3A0NA 1BMV2 3VDDA 1F8VA 1JS9A 5HCFA 1STMA 3DL3A 3LOIA 5CKMA 1E5SA 1OA4A 1UY2A 2AH2A 2W5FA 2W39A 2WABA 4YNIA 5T5LA 3POEA 5APAA 4A42A 2QZ2A 4CXXA 2OKXA 5H9PA 3ZYBA 1QEXA 1TMF2 1UIJA 1ASJ1 5CB7A 2EALA 3K51A 1JW6A 1VMJA 4LEJA 3RZLA 4WM8B 5K4LA 2NZ9A 4QXBA 1REFA 4O61A 4K3UA 2GC1A 3RJRA 3HWJA 1SCRA 4CUGA 4FSJA 4IGOA 3MW2A 1OUXA 5FPZA 1Z7S3 2RJ2A 1APNA 1Y9QA 1ZBE1 2VZ3A 4QHBA 4CXWA 3MHZA 4QM8A 1W9SA 1IS3A 2NMNA 5A1AA 4NUBA 3MUZ1 2ADEA 4Y26A 1DQ6A 1ULPA 2JDAA 3OBRA 4M3CA 2EXJA 1GFF2 1RUC3 3KB5A 3K77A 2FHRA 4TLGA 5J37A 1W99A 3EYPA 4RHV2 4WVMB 2BFUL 1WGPA 3WV6A 2L9LA 1VMFA 1UZ0A 2GP3A 4Q4X2 1CAUA 2VOXA 3SNMA 1J1LA 2QDRA 2XJVA 4BQ1A 1H1IA 3KCXA 4LQRA 4DXZA 1NCQC 5LB6A 3PLQA 3I4IA 2X05A 3LE0A 4CEWA 1ZREA 5D8AC 2UWBA 4NPRA 3I2IA 1GR3A 3O0WA 5DN2A 2XBO1 2ZGOA 3EMRA 2ZGPA 1UN1A 2JDUA 2W91A 2BGOA 4A7KA 5FZ9A 3BU0A 3VBFB 4DEVA 4Z8BA 3LWCA 2YU1A 4XJ8A 3AMHA 4CP9A 4K8FA 3WR0A 3VBUC 5AC93 2WL1A 1UZZA 2WZ8A 3J7LA 4FO9A 1C8M1 2Q0AA 2GDFA 2GC2A 3Q8FA 3B94A 1WCUA 3CJIB 3OOXA 1LNSA 4M4PA 1JI6A 3T3YA 1RUJ1 2DUPA 3IPVA 4UYBA 1O4ZA 3RMYA 1WD3A 1LHWA 1LAJA 3LIHA 4QD2A 5DG1A 3VDDC 2XUMA 4XQWA 3WW4A 1JHJA 1GWKA 4KI5M 3T1LA 5F37A 1MS0A 3ZKUA 4QHZA 1LOBA 1W04A 2E53A 5GLWA 1NZIA 2WZPP 1W05A 3AP7A 2ZHNA 1PIV2 3U4XA 1GANA 1JODA 5E88A 4XQDA 2CSGA 3CJXA 1SBDA 4SLIA 2MEV2 4ZPIA 5D8AB 5IW0A 1BK0A 2UU8A 2A1XA 2J42A 1YIPA 3KV4A 5FYHA 3T4HB 1AR73 3K48A 1KGYA 4GB33 2P3KA 3I3BA 4YW1A 1U5XA 2X09A 1R081 4Q4W3 5L9VA 5IK7A 3VBUB 2JD9A 2DFBA 5FYTA 1GQGA 4FPJA 1PGL1 2BYVE 3H1MA 1EV11 1LGBA 2E33A 4BQ4A 1VMHA 1NQDA 1QOSA 1VB4A 1XNTA 4MYEA 1GBGA 3U0ZA 4ASKA 3GYDA 5CADA 1SMVA 2IXHA 4UBHA 3AZVA 3EJKA 4RGAA 4GWIA 1HRI3 1NCRA 2P2KA 3I2DA 4C91A 1OKQA 3HNYM 4LOSA 4XIOA 1WCKA 4F8AA 1ZZBA 1J1TA 2DV9A 4MOAA 4AWDA 3AZYA 4UFMA 4CSWA 3D4KA 1RUG2 4OUEA 4XUOA 5LEKA 3JUUA 4P9LA 3V65A 4ZS2A 1ZRCA 2YC4A 4BLJA 1C5IA 2ZX3A 4CEWC 5DAWA 4LIUA 4AFDA 1POV0 1U5YA 1XPWA 2J1SA 4LUMA 2HWC1 2V73A 4MHRA 2VO5A 4QXHA 2XR4A 1WA6X 1AR83 2P1BA 1QJEA 1I6XA 2ZKNA 3PMEA 4RFRB 1O7FA 2FCUA 4F3JA 1O3RA 2EXIA 1C5HA 3C3VA 4Q4Y1 5FP7A 4JHZA 5FZCA 3T0BA 4AOCA 4URAA 1BBT3 2XJTA 1HJGA 2WFF2 2YXSA 1CIWA 2BPA2 4MGYE 4TZDA 4XAAA 1ND3A 1OPMA 2O1QA 3TN93 2CAUA 1YQ8A 3UK9A 5GLZA 2AEZA 4CRQA 5A3PA 3LFIA 2PQSA 1XU2A 4MG2A 2OIIA 3VL9A 2H6CA 2RS33 4ZY9A 2R0FA 4B1MA 5C5UA 1VALA 5I0TA 2IZWA 4TLFA 2ZBJA 3MV11 1VRH1 1JUHA 1CAUB 1QQP2 2VMCA 2XL7A 2ZKLA 4HKWA 4OCTA 1H4GA 1VPHA 1GNYA 3ZO0B 4GMP1 4UW3A 3TEYA 2DUQA 5FZEA 2ZEZA 4CEWB 2XJSA 4CCDA 5JOXA 1AYM2 2HKXA 5CU1A 2FDHA 2OPKA 5FZ4A 1GZCA 1XYNA 3KQ4B 3AXEA 4QB2A 3AP6A 1ODNA 4IV1A 1RUH3 1UW8A 5H9RA 1R1A3 1WCDJ 2VZQA 2GAUA 1HN0A 2DVGA 2VCAA 1DLCA 4OHYA 4YGEA 1LOGA 3VDCA 3I49A 3RZGA 3NJVA 1QJX2 1AR63 4Y1VA 1AJKA 2K2SA 2CWSA 4GIQA 1SG3A 1ZZ6A 3FLPA 3V0AA 2JG9B 4XURA 1W8FA 2WYSA 4PQ9A 5GLVA 1IGOA 1EPZA 1NCRC 1FNZA 4MZUA 1CJDA 1PO13 1AL21 1GZWB 5I8YA 2WS92 5IVFA 5K7PA 3UKTA 2H6BA 1V6MA 4U36A 1PM4A 3KV6A 1RUNA 3GGLA 2CGPA 1LGNA 2OS2A 1JOPA 1ZBA2 3SMHA 1MS3A 5BNOC 1ENQA 4XIKA 2VUDA 5C3RA 5JCTA 2WLQA 4XDQA 5EFUA 1ASJ3 1Q56A 2YBSA 1YEWA 2D7FA 1WBFA 1ENSA 2UY9A 1HB4A 2WZR2 4RS5A 3DECA 4UWDA 5A33A 5EWSA 1H1MA 5LA1A 1NLQA 2ETEA 1LCLA 1FOD1 2VOVA 5EJZB 5JDBA 4XCAA 1GKBA 5LWBA 1ULFA 1QY4A 4FFHA 4HPKA 2DVAA 3I2KA 3OD0A 4PJYA 5A3OA 1ZBE3 3K3NA 4IE5A 4XUQA 1JYNA 2EICA 1L7QA 2MNGA 2QCSB 1ND3C 4WVWA 3AKSA 3KZ4C 3FWEA 3ZKYA 1MQTA 3ACHA 3KS7A 3WSOA 4OI2A 2XVLA 3UNPA 3IZOA 1NCRB 1SLCA 2C5DA 4IEYA 3CHXA 4N7UA 1I1EA 4AI0A 5HCBA 1RUI2 4WBBA 1NY71 3AP5A 2CNAA 4BMBA 3LCPA 3RS6A 2YPDA 5EQUA 2XMLA 5DUVA 3IN9A 2Z79A 3OG2A 4Q0PA 5EZWA 2Q8OA 3QOPA 5BNOB 3FZ3A 5C3PA 3HOBA 2GZWA 3HR9A 2XBO3 2W47A 2R062 5FCCA 4IV1C 2RMU2 4CCEA 1L7RA 4HN0A 3THDA 4NMIA 3VZKA 4PI2A 4B4PA 2XPJA 4Q1PA 4DS0A 1SLAA 5HXMA 4CDWC 5BY5A 4XJWA 1Q8SA 1C8M3 2V5DA 2G1MA 2R042 1GSLA 3QLQA 4W50A 3RZJA 2YB7A 1UYXA 3L2HA 1RUJ3 4JQRA 4QQLA 1ND3B 4XDPA 3UT0A 5F6KA 1CPMA 1H1AA 1D4VB 5FP4A 3D6EA 4Z82A 2LUWA 2I74A 5JI7A 1Y43B 3DV8A 3T1MA 3AYCA 4I2OA 4JDNA 2Q1FA 1O59A 4M0NA 1IPSA 2GMPA 1AUYA 1H2NA 5LBFA 3KCYA 2IXIA 2KXLA 3ZFEB 1KJRA 1F31A 1OLQA 1HV0A 1GYKA 4EZ4A 4NIAA 2NMOA 4YGDA 3W20A 1CPNA 4CUCA 2H0BA 3FL7A 3B93A 4RS5C 2SLIA 4NPLA 5LBEA 4IQPA 3RNSA 3NVCA 2YPJA 3NRUA 2WQZC 2ZAHA 5FZKA 2WA4A 4LBQD 5J3UA 4IV1B 3AJZA 4LBOA 2K9ZA 1D2SA 1F4AA 2YBPA 1SZBA 2PQQA 2VCCA 1R083 3VD3A 1W6QA 2VW2A 2Q8CA 3ZFGA 3ALQA 4NN0A 4CDWB 2CGNA 1EV13 3HT1A 5FLIA 1MQTC 1VBD3 3SC7X 1BMV1 3ILNA 1BEV2 5J36A 2UWAA 3V0AB 3WNKA 2JX9A 3J9SA 1HQWA 1K42A 4XJUA 3MPPG 4NHYA 2D3SA 2Q30A 5FK8A 3UJQA 5IFPA 3WW2A 5FZ0A 1OSGA 4N9IA 1N1TA 1BVP1 3G6JB 2P4EA 5FPLA 5T55A 5JAXA 3GZUC 4C8DA 4BIFA 4ONUA 4PF5A 1HRV3 2A7AA 3POYA 4CZSA 4ES9A 4AEJA 5DAXA 2WAAA 3MW4A 1OC1A 5FZ1A 3WP6A 1LHNA 4EJRA 2HWC3 3ACGA 3PUQA 3MF6A 4TSVA 4EZHA 4FAHA 1R091 4XMIA 5FJHA 3O1RA 3TBDA 1PMHX 3IAQA 3I2HA 2Z5WA 4Q4Y3 4XCBA 3VBRA 1ZRRA 3LOBA 2RDQA 1E5IA 4IE4A 3O1UA 4L2NA 1RUD3 3N9OA 3CLPA 4Q8LA 5C9AA 3N35A 3H8RA 3HQRA 3VB9A 4RHV1 4BJ0A 2JECA 1RIRA 5GZFA 4FQZA 2D6OX 4UT5A 5EHDA 1FPN2 4JC1A 4RGKA 3BVCA 1VAKA 1S0IA 4AE2A 3O1TA 4CUBA 1UPSA 3H7YA 5FY7A 4EWEA 2XJPA 3P5BA 3J7HA 5GZCA 1DP0A 2YY1A 1VRH3 1ULDA 1YLLA 1RMU2 1PO21 4IEUA 1GWMA 4WV8A 1AZDA 4FBFA 1HB2A 4GMP3 1OURA 1UCXA 2Y8KA 1ZZCA 1Y3TA 3ETQA 1FT9A 2BUKA 4XEZA 4X6RB 4GH4B 1CN1A 5DDJ2 4YYOA 2QQKA 3RJ2X 5B4XA 4QB1A 3JB4C 2GU9A 5LASA 4ATFA 3OY8B 1OBNA 1X8EA 4JQTA 4LBKA 1JZ4A 2AREA 3URFA 3WW3A 3ZFGC 4GXLA 2R49A 4ET7A 3WF4A 5JVVA 2WA3A 1WBLA 4X8NA 3FN9A 5JSOA 1IOAA 3POGA 1AHSA 3S7IA 2XLGA 3ZIXA 5LA2A 2VMEA 1EUTA 1AXYA 2VC9A 3FFQA 4DZGA 4QPIA 5A3MA 4AHXA 1XB9A 5I0SA 3KMHA 5I0DA 4P9GA 2XUEA 2E7TA 5AVPA 1W0PA 2ZZQA 1WD4A 1BQPA 1SBFA 1D0HA 1AL0G 3RDIA 3ZVXA 2A73B 2A6VA 3OEAA 4BB3A 4NVPA 4KWUA 3BPZA 4AVSA 5IK8A 3WY6A 1SACA 3IDEA 5IWFA 5FZ3A 4FTEA 2GNMA 3OUHA 3BUCA 1OQEA 2ZX2A 4CU9A 3VBRC 1FOD3 1DGWX 2FZ1A 3VD9A 1GUIA 3K46A 1XNCA 1CZSA 4LITA 4J1XA 1NX9A 4E2QA 1W6QB 1A3KA 3OUJA 5ACA1 3GBWA 4BK4A 2HEVF 3ZX7A 1Q8QA 5DAVA 5T54A 2B9UA 4JAAA 4MUVA 4AGGA 3IWZA 1A6CA 1BYHA 4XF4A 2DURA 2W87A 4ISRA 1RUG1 5FY8A 1A8DA 5KXCA 4F83A 4AGVA 1X33A 3H9AA 5FZOA 1UIKA 3UGFA 3WQ7A 1LTEA 3HN1A 3IM0A 3ZYPA 1DZTA 4P5HA 4BOWA 3B5LB 3IIIA 2ZGQA 4O9GA 1QWRA 3UYJA 4A3ZA 5A6XA 2DCYA 4QX2A 5HCAA 3AMQA 2ZXQA 4FPEA 1UY4A 1YNAA 3H42B 5FO7B 3ZDVA 3WNOA 4I02A 1COV1 4C1XA 5B2GB 5C7GA 5F3CA 1AR92 4ZU5A 3JBG3 4LE4A 1Q8OA 4HVRA 4Q1RA 2WFF1 4DXSA 3ACFA 1C57A 1C8NA 3ZFFA 3NV2A 4CCJA 4Z1VA 2O14A 3VBRB 4Y22A 4M00A 4META 3ZXDA 2NN8A 2PHUA 4D0QA 2F6BA 4IESA 1NYWA 1UKRA 1U0AA 1DDLA 3ZN5A 2LALA 2B39A 3M3OA 3T4VA 4R4XA 2EIGA 4HSLA 4XOGA 1XBFA 1XXNA 4QPIC 5EIYB 2J1VA 4LO4B 1QQP1 1H4HA 4A45A 5T5JA 3NJXA 4B1LA 5JMCA 3JB8A 1NAEA 4GWNA 4QHOA 1AYM1 3ZMNA 5KC5A 4BLIA 4YLZA 4N53C 2QZ3A 3VKLA 2VOTA 4OI4A 1VBE2 1Y4WA 1LECA 2WSUA 3EXUA 1SDDB 3N7KA 3LAGA 1E57A 3I2GA 4KU8A 3SKVA 1BKZA 2R7EB 4DEQA 4CP1A 5M0TA 1Q3EA 2YBKA 5AC91 2WO2A 4RD7A 4JX0A 2PYTA 2WT1A 4KG8A 4QU1A 2ZEYA 3SH3A 3GHNA 4BQ3A 1AYN3 4OHZA 1W0OA 2NPIA 4MX3A 2OA2A 4IE6A 1REEA 5FOBB 2WT2A 2R6QA 5LY2A 3VHPA 3FBMA 4X8PA 4YFWA 4AI2A 3J8F2 3T0DA 2CHHA 2Y33A 4P9YA 1NG0A 5FZ6A 4A2UA 1MS1A 1ZBA1 4XFGA 2VNVA 3B7MA 1MR5A 2GALA 5IJRA 1PZ8A 2QQWA 1TMF3 4LO8A 1Z0HA 2WZR1 2J1TA 1OVPA 1UOFA 3JQWA 5A3WA 4NIIA 2XQXA 2PAEA 3SCHA 2DDUA 4N53B 3W58A 1OA3A 5F3GA 2E32A 4P5YA 2ZMLA 4PF1A 3MIHA 2CV6A 3GXUA 5HI0A 1JZ7A 2WZEA 1RHI2 1IPKA 4HZFA 5L73A 3ZFFC 1ZZ9A 1T6BX 2R32A 3BIWE 3PDQA 4IGQA 5T5OA 3KT1A 3M3QA 1VP6A 3BB6A 4AHZA 5FPVA 1QXPA 5FMDA 5IT6A 1LOFA 3U11A 4RHV3 2W3JA 1HRI1 1PNFA 1V6JA 1F4HA 4ISQA 4Q4X3 3R0RA 1MS9A 3LDRA 1SHWB 3NNFA 4Y5TA 5DZGA 2EVXA 2HLEA 3M3CA 4KNCA 3VKOA 4EQVA 4IUGA 1O3TA 5FZOB 2E31A 2ZHLA 4Q27A 4XFHA 4HANA 3W21A 3JXSA 5CISA 4D3WA 1PO23 2R061 4QKDA 1CZVA 1KXGA 1GP6A 1N1YA 2RMU1 1VBC2 2XWBB 4XDOA 3AFGA 1HQLA 4HKOA 1PHMA 4XBQA 3NNMA 3VBFA 4AXOA 2VZVA 1ULOA 4LHSA 5D2AA 3WINE 4XC9A 4FFIA 4ZZ5A 2Q1MA 1H9WA 2XVKA 1GNZA 2R041 5IVBA 2GMEA 3N3HA 3ZFFB 3FFZA 4EN0A 3CJIA 4Y22B 5DABA 4AVCA 3QH7A 1ZRIA 2BU9A 4Z2AA 2ZGNA 5G05L 3AYDA 1ZX5A 5BUVA 3KQRA 4BPZA 4XW3A 4V2WA 5A6QA 1YJKA 4OQ9A 4D7SA 2BGCA 2J1UA 4LLFA 1QIQA 1LR5A 1PIV3 5FY1A 3AFKA 4P14A 4YM2A 5A6ZA 5IK4A 2GH8A 2LTNA 5LBBA 2X5IA 1CONA 5AFEA 2V4AA 2D98A 3FE5A 1H6XA 3BN6A 2A5ZA 4JRAA 3GHMA 1HB3A 5D8AA 1W9YA 1DGLA 1DQ0A 4IEZA 2QQLA 2VPVA 1RTVA 2F17A 4Y1ZA 1DQ1A 4LBLA 3FUOA 4OHVA 4GJZA 5C33A 4J6GA 4TN7A 1OH4A 2VQUA 4XBNA 2E7AA 1RYYA 3AP4A 2DUOA 4QX8A 5E6HA 2WNVB 3ES4A 4DXRA 5IAVA 3M8LA 4LLOA 1F5JA 4YARA 2UYBA 4FXKB 2HEWF 4NWWA 3BODA 4R52A 3RZMA 1LOFC 5ACA3 1JYCA 2WLPA 3ORJA 2ZS6B 4I09A 4BZ4A 3HPNA 3HAGA 1YRZA 3BOWA 2TBVA 2GN7A 5F8PA 3EB7A 5C4WA 3VHOA 2CU5A 4UFLA 1RUG3 1OMIA 4GZ9A 4YSFA 3N9PA 3ETPA 4IGPA 5C3SA 4EWDA 4I01A 1W0NA 1AJOA 4FQ4A 4Q29A 3OJBA 5A3UA 1IS5A 4LBMA 2GH2A 3C2UA 3O7OA 4XAEA 5DZEA 1W6MA 3A22A 4NIHA 3WCSA 3VBFC 2ADDA 4UI9L 1HW5A 4JKLA 1COV3 2KD7A 3FJSA 5F39A 3D0SA 5FFOC 5LK7B 3M3IA 2ZHMA 4RSUA 3T2PA 3UKVA 2WFF3 5DUXA 3CJIC 3SLIA 4H2AA 3T09A 5GJ6A 3WNXA 5I0UA 1FPN1 3MV01 3PUIA 2WUHA 4B8EA 3KHBA 3PVNA 4CDQB 3APBA 3DXTA 1QQP3 1RMU1 1KITA 3U1XA 4ATEA 1O6UA 2OXBA 4Y1XA 5I8SA 4MGTA 4IE7A 3AKTA 1N1VA 2VTXA 2X5IC 4YRDA 1AYM3 1VLNA 1YXWA 1YUDA 3QH6A 1JOBA 4GJYA 5DDJ1 4JHTA 2HWF1 1IKQA 3K2OA 4XFBA 3RZHA 1TVGA 4LHNA 4XE9A 3VZJA 1XNAA 3ASIA 1C4RA 4AFAA 2Y26A 1XNKA 3K4ZA 1DFQA 3SH5A 1CX1A 1FXZA 1XSRA 5D1IA 3FHAA 4DO0A 2OQ7A 1QJX3 1XNDA 4FI9A 3QD6A 5LK5A 3C7FA 1MPXA 3KF3A 5G04L 2JG9A 1NUKA 4YG0A 4XHXA 3MLJA 3VZNA 3DCQA 3PHMA 4HKLA 3RMXA 4R8HA 1G9FA 1FV2A 2WS93 1SEFA 2SBAA 3AXDA 1GZWA 4NHLA 3UKNA 5C4WC 3LA7A 4PLOA 1POQA 4IEOA 1VRBA 2QQOA 1UZVA 2XLFA 4IETA 1ZBA3 5BNQA 2QNKA 1V9U2 4XTPA 1DZQA 2PAKA 2QJVA 2RM22 3UESA 4B4RA 5CA6A 2IXJA 5ABJB 2W92A 5FYBA 3N4MA 3M3EA 2A3XA 2WZR3 2X5IB 3RZKA 1YQ2A 4R9AA 1NQJA 1S2EA 4Q5OA 2Y6GA 3MO4A 4AI3A 2Y0OA 1BK1A 3VZMA 2HYKA 4UBGA 5A70A 1PMIA 1DQ5A 4IL7A 3MZHA 1ODMA 3MDPA 5SV8A 4DUVA 5J1XA 3AC0A 4N9HA 1TNFA 1F35A 3HNBM 1OQDA 3H3UA 5F32A 1TME2 5A3NA 4UW5A 5FR3A 4YGCA 3VBSA 1VBD1 3ENRA 3A7QA 3IT8A 1URXA 5HCHA 1BHGA 4KU7A 4Q0SA 4EN9B 1YYNA 1AF9A 3POBA 2XOMA 4LKSA 3WUCA 4EN8B 1LHOA 2IXLA 1DG6A 1ZNPA 2VZ1A 1NZCA 1L3JA 2BTVC 1RUI3 3HEIA 3KSCA 5C4WB 4IEXA 3VKNA 2AACA 1VE0A 2VR4A 1KFUL 2FDFA 1W39A 2WSVA 4AVTA 2ZA9A 1HRV1 2CWMA 3NNLA 4G9SB 4RQPA 5JSPA 3ZXFA 1OD5A 3BI3A 2DCKA 1YIFA 5BNOA 1AR91 3ZYJB 2R063 4QX1A 5AVAA 3LIGA 1TE1B 2RMU3 1W6MB 2KM2A 4K9SA 2LW8A 4DUWA 1VBA2 3FX3A 5JZGA 2BJSA 3Q8AA 3RGBA 2Z69A 1FNYA 4S2DA 1W8UA 4LPLA 1LB2A 3NW4A 2J22A 4LT5A 3WT3A 3DPRB 1L7LA 2R043 2WIIB 3F95A 1RUD1 5CYYA 5A7SA 2JG9C 4H7MA 4PBPA 5A7PA 4XF9A 1RB8G 5FYUA 3NWKA 5LATA 4IDZA 4L11A 5TSWA 4L8QA 1UXXX 1FMD2 2JG8A 3WUDA 4AFCA 1EAH2 1POV3 1JMUB 3HJRA 2XHNA 4NO4A 5FOJB 3AKPA 2HWB1 5BNNA 3ZFEA 1RJ7A 3CF6E 5ISLA 2PHDA 5LA0A 1CIYA 1VBE1 5A3LA 3V0BA 1D4M2 3LB9A 5L9BA 1WUVA 2ZABA 1PGW1 2OVUA 1J83A 4A4AA 3A21A 4E8DA 3EBRA 5DUUA 1S0GA 2A70A 1YI9A 1YFYA 2I45A 2D5HA 2PXJA 3ROUA 3CL1A 5FUPA 2R30A 1ULCA 4BIOA 4XETA 1N3PA 2OUJA 1X50A 4MVTA 4CDWA 3VBSC 1GZ9A 3AJYA 4LULA 4CDXA 3FHQA 2A6YA 4K7JA 5IVJA 1H6YA 3OGVA 4QWNA 2BVVA 2D5FA 3J8F1 5DXDA 1B09A 2Y64A 4OYUA 1U12A 4K40A 4QX7A 4I3GA 1MACA 4AQSA 4YZ1A 3H8OA 4QXKA 1CQ9A 4CCNA 3WF1A 3USUB 3PUHA 1LU1A 5KXBA 2VZRA 4LJHA 4NE9A 1NXMA 3H8XA 5FYMA 1O4YA 1GWLA 4K6BA 3U14A 1UKGA 2ZMNA 4GAZA 4I0BA 2DVDA 4AR2A 1EUUA 4RQPC 2VNRA 1PM7A 2TEPA 2XQRA 5J98B 3TWIA 1UD1A 2JDNA 5FPUA 1YO8A 4NRQA 4RR3A 4ORFA 3ZXLA 2EXKA 2Z42A 4WVZA 1RHI1 2E63A 3LPGA 5C8WA 5LEJA 4LIVA 4KL1A 5JZGC 3R4SA 3MBWA 1JXNA 2VG9A 5FYIA 4ZONA 1CX4A 3ZSKA 5T5PA 2DBIA 3ZSLA 4AI9A 1QH6A 2MPFA 2VOKA 4K21A 4XUNA 5FZAA 1OKOA 2WO3A 2YGLA 3ZR5A 2IC1A 2DWRA 3DEMA 5LRRA 3UJOA 3VBSB 5IVCA 3ZOIA 4YM0A 1FPN3 2VOWA 1OXCA 1PVC2 1O8SA 2I2SA 2VVEA 1IS4A 2ZCWA 1SFNA 1U5ZA 2VMIA 4QDRA 3SEEA 2JG8C 1MEC2 5T3NA 5HV0A 1UF2C 1W2TA 4LKFA 3S7EA 4DY5A 1OPOA 3WZ1A 2GMMA 2E6VA 5F7UA 1QOOA 1QDCA 5BNNC 1RMU3 2OUHA 3KVAA 3AYEA 3LDKA 3NKGA 3ZFEC 3NL1A 4NAOA 1VBC1 5F5AA 2HH9A 4PDWA 3GZEA 5GZGA 1O3SA 3OPTA 4YG6A 4RQPB 1LODA 2VMDA 1YC61 2WQ4A 4BM8A 1W3VA 5C5TA 5DDJ3 4Y33A 3ZPOA 2XXZA 4GH4A 2HWF3 3JBG1 2ZOEB 1YI7A 4XFAA 1CAVA 3L9JT 5JZGB 2ZGMA 2OYZA 1GOGA 3WOGA 3OY8A 4LUKA 2VECA 3B9CA 5EPAA 3S6PA 4ES8A 1UX6A 3CZUA 2HYXA 3SKJE 4DOUA 4CDXC 3CBNA 1MS4A 3OYWA 1F15A 1U5IA 3M70A 5IK5A 2EIBA 4QMAA 1AXKA 4CCCA 2BOJA 4OHWA 1HQNA 2YFUA 4IV3B 5JIAA 3P3PA 5BV6A 2V72A 5FMBA 4HFSA 4AZZA 3POWA 1BZWA 2VMGA 1H9PA 1JN2P 2AYHA 2PHRA 3ECQA 3IAPA 4QQOA 2WWJA 2LS6A 5BXXA 5F5CA 3WG1A 3OUIA 1SPPA 3RG0A 2JG8B 1US3A 4CP0A 5LW9A 4LA3A 2G9GA 4BYYA 4XZPA 3I54A 3MUY1 4S2HA 1J84A 2EIEA 4Y5SA 1XE7A 3ZXKA 5BNNB 4XMAA 4MSVA 5A7OA 3V0BB 1HIXA 3POIA 4RR3C 3TRSB 5JR2A 3P6BA 1Z78A 2PHWA 5EJ1B 4LO5B 1AVBA 2FQPA 2P6CA 4ZU7A 4PIXA 5JXHA 3O5SA 3ZYHA 4QKFA 3IKWA 2VY0A 3TN92 4CDUB 3NSTA 4DPNA 2WJSA 4LR4A 2XWJB 4I0WB 3KGZA 3RVHA 1S2KA 4JTOA 1AYN1 3VD7A 3VHRA 3RI9A 1V00A 1OT5A 2X53S 2GSYA 3K4DA 2RS32 3KCCA 3U4SA 4CDXB 1RUE2 1YFUA 3KVBA 1UYZA 3KT7A 3CEWA 3OF1A 3OGSA 2ZMKA 1ENXA 5I91A 5A80A 2OW4A 4OVEA 1UU5A 1LRHA 2P37A 5JXJA 4M0HA 2LRPA 2B46X 5FWEA 3WX5A 4JKKA 4QAWA 3GNEA 2GP5A 1TMF1 3O14A 4JTNA 4PDWC 5AFBA 2D6NA 2VD7A 2Y6KA 2W1SA 4H7LA 4XACA 1KRIA 1T2XA 1SFYA 2LM3A 2XB6C 2ZGLA 4ITCA 2Q8EA 4RR3B 1AR93 4GH4C 2Q4SA 2ZEWA 3GJAA 5KC6A 4JCKA 1JYIA 1T6GC 5FPXA 2BVBA 1GMMA 1LENA 2A3YA 3EHKA 4BHPA 1JYVA 1MZFA 2NLRA 3AKQA 1QHDA 5C71A 2RR12 4DUXA 4OI1A 5FK7A 4YWAA 1UYYA 1ZRDA 3N9LA 2DCZA 4HN1A 4IEVA 2B42B 4ASLA 4GULA 4CVUA 3AP9A 1H30A 2UYAA 1W03A 2A75A 4TWTA 4MLOA 4NHMA 4Q4X1 2ZPXA 2VMHA 5A7WB 4AAXA 1NKGA 3VUOA 3F2ZA 4FOWA 2EF6A 4XF3A 2VVFA 1UOBA 3GBFA 2PHTA 1WW5A 2YUEA 2HWB3 5FZBA 1X9PA 4OI0A 4B4QA 4WM7A 4FOVA 2C1FA 4V2VA 4GMP0 3B69A 1VBE3 3IB3A 4PDWB 2FD8A 1RJ8A 5FXZA 3UETA 3FMGA 3I97A 2IWGB 4GA9A 3HD8B 4MH0E 4QU2A 4PHZA 3AKRA 3NJYA 2DVFA 3TYJA 1WA4A 3ZXAC 4AL9A 3BALA 1JZ3A 1DHKB 4DMIA 1CAVB 2JD4A 1XSQA 4QGLA 5F1RA 5CFDA 4IE0A 1JZ5A 5BPXA 1KQRA 3SXWA 5CVRA 3HMYA 4FPLA 3OYWB 3SHRA 4C90A 1MS8A 1IQAA 3S5AA 4Q26A 4CPBA 1UO9A 3J8F3 1JZ6A 4ZZ8A 1H0BA 4Y20B 4NIGA 5CG8A 1V9U1 2ID4A 1ENRA 2PLV2 1SPPB 3LF7A 1PIV1 4FPKA 1LEDA 4HONA 1W06A 2RVAA 3BGAA 2D97A 1H8VA 3RWKX 2MEV1 1JYXA 4QGMA 1IKPA 5I8TA 5K8SA 4N53A 1ZVFA 2ARXA 5F6LB 1QNYA 3TB0A 1I5PA 5KHKA 2A6ZA 5FZ8A 2RG4A 2EA7A 3OB8A 1DQ4A 1RHI3 5CKQA 4W6YA 5GLUA 2Y0IA 1S4CA 1ZZ8A 4FXGB 1JU3A 4O65A 2Q1ZB 3TAYA 3WNMA 4Y1YA 2YROA 5FKCA 4BA6A 3IDCB 2E26A 4CU8A 2EIDA 4UF0B 4YVWA 2PFWA 1CZTA 4YG3A 4OUSA 3U07A 1K3IA 1LKNA 2A71A 3B01A 3ZXJA 1GU3A 4LK6A 2J1EA 4A6OA 1W2AX 1KJLA 5JR7B 5FO8B 2AEYA 2BV4A 2ZGKA 1B35A 3MIBA 4YFZA 2PHXA 5CG9A 1RL3A 1V6KA 4WM7C 2MHFA 3J4UH 4MXVA 2E9QA 2YC0A 5FXXA 1VBC3 1UZYA 3WNNA 2Y6FA 3FLTA 4L97A 4BE3A 2QVSB 1VBA1 2JDKA 4AF9A 2VL4A 3BOPA 4BQ2A 3S57A 4KGQA 1A34A 1H2MA 1RUF2 1TQ5A 2PA7A 4QQ2A 4F7ZA 1PGL2 5JI9A 2E51A 1UZWA 1EV12 1HXS2 3OCPA 3J7MA 4W4ZA 5CFDC 3WF0A 1H2KA 1NA1B 1OLRA 2QTWB 2FMYA 1VIWB 4IW3A 1WW7A 2QBXA 2F4PA 3R4DB 3I2FA 1WW6A 4P9JA 1FMD1 1WMEA 1EAH1 5FREA 2Y38A 2VJXA 1WCSA 1C28A 1QJU2 1FI2A 1S2BA 2DFCA 2OZ6A 1SLTA 5CNAA 5F5IA 4BWOA 2VBBA 1QJY2 3DF0A 2D3PA 3H3ZA 3QACA 1D4M1 3V64A 2ARBA 2JB4A 3B00A 1C1LA 4UOJA 5FZ7A 1RVF2 4WM7B 2R072 4UFKA 1A78A 2GNBA 5FY9A 3TNQA 4TXWA 3AYAA 3UV9A 4P9WA 5FUIA 1KEXA 5JXIA 1Y7BA 1AX2A 2VXRA 1XC6A 1LHUA 5FZFA 3MF9A 4YGBA 1REDA 4KWKA 2FBEA 4RGGA 4XFIA 5DQ0A 1JYWA 1RUOA 2VNOA 4NOTA 5FWJA 1V6IA 1PGSA 2WNVA 1JZ2A 1QJX1 4AGRA 4LK7A 1SCSA 3POSA 5FBJA 5CFDB 4QT6A 2X29A 3LDBA 3MW3A 1E5RA 4E4ZA 5KBFA 1W3XA 5E89A 3ELNA 4YVWC 2Y34A 5FKBA 3FUQA 4QQHA 5LCWL 4MO3M 4EWAA 1OD3A 5EYYA 2WS91 3WF2A 1R64A 3BTYA 3RYRA 1OOPB 2K46A 1G9CA 2PN5A 1B35C 3WP4A 3DYOA 5L9RA 3JQXA 3OBTA 2ARAA 1O3QA 5F3EA 3DKQA 3INAA 5FP9A 3C7HA 1XNBA 4FPGA 4K1YA 2WN2A 3BTZA 1XOYA 4YM1A 1LESA 2X10A 1SBEA 3ZM8A 4B7KA 2QFEA 3PU3A 1EP0A 4IEPA 5E16A 5EYXA 2J1AA 1M4WA 4RA0A 4QDQA 1MVQA 1TG7A 3VBOA 3I59A 3ZPYA 1BJQA 1QJFA 4EN6B 2TUNA 2YZ4A 1NT0A 4M3CF 5EJ3A 1DF0A 2Z2SB 4E4SA 3WQ1A 3W5MA 4AYUA 1WLCA 1Y9GA 3TEXA 4JGYA 3M7AA 1H8TB 4AHYA 1PVC1 3WDUA 2CYFA 1AL22 4COUA 4UW6A 4CYDA 2QKDA 1MEC1 3RQ0A 3BKZA 4LA2A 5F2WA 4YVWB 4AAPA 3O1MA 1K5JA 2JIGA 2NQYA 2UWCA 4CDQA 3Q8BA 1I5ZA 1RUI1 3MIDA 4BQYA 4OUMA 4LKEA 1GZTA 1MZ6A 1ONAA 2ENRA 3NNJA 1B35B 2AC1A 4R9BA 2QE3A 1PNGA 3D3AA 3LPFA 3MIFA 2VUJA 5IHRA 1OH3A 5FP3A 1CAXA 5SV5A 3I2OA 1OFSA 4AQ6A 3GJBA 5LZ6A 2D93A 5IUQA 2EAKA 3ZSMA 5GZDA 4A3XA 4H3WA 3VZLA 1O5LA 2YU2A 1GOFA 3KM5A 3C7EA 3ON7A 4XUPA 5CFCA 2WNVC 2BGPA 1ST8A 1W2UA 5CEHA 3P1IA 4M01A 4GKXA 2C9AA 5IAXA 2VVDA 4XFFA 2VUCA 5FZMA 4HL0A 4COVA 3CQOA 3DXUA 4KBBA 4AVVA 1WMDA 2RDRA 4OFGA 4QM9A 2JDPA 3H1YA 5IVEA 2HBUA 3GZAA 3IMNA 1POV1 3RI8A 1F9KA 3SCGA 3OGJA 2XJQA 3GALA 2G9ZA 1V9U3 3N7JA 1JOJA 1HX6A 3LSEA 4OMCA 2RM23 5FZLA 1DGWA 5ABJA 3LD8A 4BXSV 4CP2A 3DUIA 2AR6A 5A32B 2UURA 1Q8PA 4A7ZA 2MEV3 2ZHKA 4ZXKA 1DCSA 2D3RA 2JWPA 2ZACA 2D6MA 4Y4YA 2BBVA 3RSJA 3WG4A 2BOIA 3VBHA 3GDBA 3VBOC 1RGSA 1YQ5A 4K1ZA 2YV8A 4YW7A 5FJKA 1UMZA 3NJZA 4GD4A 4YW5A 1TME3 1UXZA 1C3HA 5ANQA 3ZSEA 4JGYC 4DINB 3KHCA 2BWAA 2HWD2 2XHKA 1BEV1 4M4RA 4QXCA 4CU6A 3ATGA 3PJYA 2W46A 1QGLA 3SITA 1IQDC 3DKWA 5IATA 4QGNA 2JENA 2BZDA 2W2IA 4CDQC 4V1PA 3J7NA 1Q5OA 1AXZA 3JD72 4MGQA 3NO8A 1YFWA 1W9FA 1G9BA 1S55A 2IVIB 2CY6A 1UY1A 4PIZA 5K0UA 1DYKA 3ZXEA 2WRAA 2JE8A 5JIUA 3H7JA 4E27A 1KDMA 4O9EA 1VBA3 2YMZA 4Q4V2 5E8AA 1Y9MA 2KA3A 2WDBA 4N8MA 1K5MA 1W8NA 2JE7A 3PU8A 1QKQA 4FVVA 3WHTA 1LOCA 1X82A 4HVOA 3NNGA 2VTFA 1NLRA 2DTWA 2H0VA 4A41A 5CFCC 3VBOB 3I59B 4W6WA 2HWE2 4E8CA 1YWKA 3DPRA 3MIGA 1W8WA 1CWPA 1PK6B 1EY2A 2FCTA 2A6WA 2C9KA 4JGYB 2WINB 1H2LA 3WXPA 4HOOA 2W52A 3LEKA 4INDA 1VBB2 3LA3A 1FMD3 4AG4A 1EAH3 4C0HA 3GBGA 4LBQA 3BYWA 3NMBA 3AM2A 2G4IA 3L2YA 3M2MA 4QX0A 1LEMA 4YVSA 3UL2A 1MZEA 3O1OA 2AZ5A 3DN7A 2ET7A 2JE9A 3I3MA 2F4LA 1IG3A 4BISA 4CPBD 5ABJC 1D4M3 3I2JA 3NAPB 1R1ZA 2PHLA 3LFMA 4MGSA 5FZIA 3U78A 1SFPA 3WQ0A 1R092 2WNEA 1CAXB 5C6CA 2PAMA 4CEYA 3AK0A 3LZZA 4Y4RA 4D6RA 4E2GA 1A8MA 3AB0A 4XZUG 3VBHC 2CL2A 5DPNA 4LBNA 5J7MA 1W90A 2KR2A 3FLRA 1N3OA 1HKDA 4FPHA 1O5UA 5CFCB 4FP2A 3TEWA 3LEGA 4CCKA 3ACIA 4FOQA 4B29A 3LSDA 1KS4A 4CCLA 4DB5A 4BMEA 4COWA 4LHKA 1ZZ7A 4QKNA 3USUA 1KD7A 2PLV1 5FTTC 3VD5A 1PZ9A 1CVNA 3OGRA 3LEIA 1PO22 2YG0A 2QQNA 2V5YA 5I0RA 1UMIA 4BQXA 5K0UC 3AVSA 5FYSA 1W8ZA 3U75A 5E1RA 4CU7A 3DYMA 3MLLA 5A3TA 5J96B 3ILFA 4FOYA 1NLSA 4LO6B 2BNOA 2PTMA 3LKJA 3OSDA 3THCA 2W0XA 1FV3A 1RITA 1K5MC 2Y6HA 3KV9A 3WW1A 3AMPA 3PNAA 3D0JA 1GQHA 4HXCA 4QB6A 2VZPA 3VBHB 4IEQA 4FTBA 1G6NA 4UAPA 3DPRC 3ILRA 3ZN6A 4AVBA 4Q0VA 1IS6A 1ULGA 4JDMA 1DYOA 5J48A 3E5QA 4AI8A 3BCWA 2VUAA 3MI8A 2W1UA 1HV1A 5F3IA 1FAYA 3WDWA 4XXAA 1ZRFA 5FRAA 1PVC3 1YQ6A 2XKPA 3MLKA 5FO9B 3O1SA 2ZX1A 3C7GA 4QQPA 3WDXA 1MEC3 5K9YA 4KH9A 1NCQB 2P3IA 4YVSC 3PUAA 4LOTA 5KHJA 3E97A 4HSJA 4COYA 5DMYA 1JUIA 3ZMOA 2JJ6A 3HT2A 3MIEA 1W8TA 3B02A 1UL9A 5GM0A 2DTYA 2RS52 5K0UB 2FCVA 3ZR6A 2VBDA 4U2AA 4L9BA 4XABA 2O0OA 3WEZA 4ASMB 1RUF1 3O12A 4NHKA 4CEYC 1IHMA 1ZA7A 2IXKA 4OQ8A 4FTSA 2RS12 1HXS1 5IFTA 4Q0QA 1K5MB 3CIHA 4FT8A 1WKYA 1DGRN 5FBZA 3I8TA 3H50A 1PX4A 5LBCA 5ACA2 2P5BA 4BCUA 3BU7A 1WLDA 2PHFA 2XKOA 3T0AA 3TNPB 3WF3A 3VL8A 3ZYGA 3WDYA 3VDDB 1QNWA 4IV3A 2BERA 1HN1A 2ZGTA 3PVEA 2WBKA 5DAQA 1QJU1 2YFZA 4WVVA 4YW2A 4AEKA 4D6QA 3VDBA 2A6XA 1JYTA 3USSA 1QJY1 4X6QB 4B7EA 3KD4A 4LBQB 2WN3A 1WMXA 4YVSB 3SCFA 1RVF1 1BLZA 3PUSA 3ABZA 1ACCA 2R071 2DCTA 3S30A 4XQ4A 1F5FA 2EXHA 2IVJA 4KBZA 5HV4A 5LY1A 1COV2 1ND2A 5FYZA 5FQ0A 2V09A 2D6KA 1GLHA 2G19A 1Z7S2 1HJFA 5D21A 1D0GA 2P34A 4CEYB 4YPJA 1GP4A 5L19A 5FIXA 3I7DA 3AL5A 4M3CB 3OGGA 1FYUA 4CDUA 1S0JA 5BYNA 2OT7A 1RUC2 2VCMA 1CGPA 1O91A 1WW4A 4KWLA 4GWJA 4C1WA 1K12A 1RUE3 2XJUA 1ZYBA 5FYCA 1BEV3 4I0AA 4P08A 4HVQA 2JEMA 3HNMA 4S2GA 4PCRA 1IZ3A 2X8KA 1I9RA 4OHXA 4XBLA 2UY8A 4D8MA 1DLLA 2VMFA 4OLLA 4SBVA 2DVBA 4D6SA 4BDVB 5A1FA 3PTRB 4QPGA 1FX5A 5JXGA 2JB8A 2D6PA 3AZWA 2Q8DA 5FAXA 2VNGA 1G86A 1EYBA 5A7NA 1MS5A 2ZGRA 3E6BA 3ST7A 2BBAA 4D94A 4AW7A 1YFXA 1OF4A 2R1BA 3ZXGA 1GQPA 1K45A 4QPWA 4TTGA 4CP9B 4XYXA 4YW6A 5FV3A 5JPNB 3OPZA 1J3PA 2W08A 4MGIE 1CJPA 4JGZA 4PBOA 5AC92 1V70A 2Y6JA 3D5OA 4WZFA 4NAMA 3HIFA 2D40A 3IPVB 3K75B 2CTVA 3HVDA 3OD4A 1D7PM 1X8MA 2J1RA 2RR13 5CKNA 2V4VA 1GOHA 2GC3A 4HT1T 3ZN6B 4FFFA 3U10A 2WO7A 4R9DA 5CBLA 5FY5A 4IV3C 4H55A 5F9TA 2PMWB 2QQJA 4OULA 4LKDA 4YM3A 4CA9A 2JDZA 4FFGA 5A7WA 1GICA 1XE0A 3Q9OA 4FP3A 3VZOA 4FPYA 4DQAA 2P17A 1W8OA 2WFPA 2RV9A 2R16A 3W9AA 4YW3A 3WD5A 4N43A 3LQCA 3POFA 2BW8A 5KXDA
chains in the Genus database with same CATH topology
1ND2C 5KWRA 1AR72 1GV9A 4GB32 4KQ7A 1I3HA 4Q4W2 3PVOA 1S0EA 1WMFA 4DNYA 5JOYA 1QMJA 2DF7A 4CDUC 4Y24A 4AVAA 1J3RA 3CO2A 1Q8VA 1UAIA 4CTEA 4PLMA 3OTFA 4GALA 1QU0A 4AEDA 1SQ4A 1SLIA 1HRI2 4P9XA 2P3JA 5JWPA 4N90A 1PVXA 2BEOA 2VW0A 3A4UA 3MFCA 4Y20A 4AQ2A 4H14A 5JLVA 3MPBA 1XYPA 4YZ5A 3NKTA 2XGXA 4P9IA 2PLV3 4QPGC 5FMOS 3WG3A 1SLLA 1TEIA 4PIYA 4WZCA 1ZM1A 4E2SA 1AR82 1YCIA 3PVBB 3QCWA 1ND2B 5FQ0B 5EXOA 4JGZC 1BBT2 1JH5A 1OHFA 2YYOA 4HETA 3ZYIB 4XJ9A 3MFAA 2ZJCA 3KGLA 4Z2WA 5C8CA 2HWD1 2GNTA 2O8QA 2BNMA 4L99A 1QOTA 4YZ4A 5FLJA 4AI1A 4LBJA 4E4DX 5EV7A 3HBZA 1KS5A 3JD71 5KXEA 3N7LA 4ZKTB 2CAVA 2G9FA 1ULEA 2GC0A 5F5QA 4LHLA 1CESA 1V6OA 1G9DA 1QH7A 4QPGB 5GLTA 2PELA 3KT4A 4N43C 2RE9A 3MYXA 3E6CC 1PZ7A 4JV4A 4Q4V1 3AX4A 3B3QE 4AK3A 1W6PA 2A3WA 1RUH2 4ZU4A 2QUOA 1VAMA 4UW4A 1RUF3 1R1A2 3PTYA 5T50A 5T52A 1RINA 4JGZB 1HXS3 2HWE1 2AENA 2ZAAA 4RFT0 1LJ7A 4NR1A 2C0ZA 1DU3D 1AR62 4Z92B 5H9SA 1VJ2A 1N47A 1NA1A 4AEDC 2AUYA 3R4UA 4HK9A 4HMZA 5JSRA 1VBB1 1Q43A 2XLAA 4XPVA 2QQPA 1PO12 1VB2A 2NM1A 4Q2FA 1JBCA 2W68A 1S0BA 4IEWA 1QJU3 1QJY3 3WP3A 3EO6A 1SLBA 4Y5Z0 1W6NA 3SH4A 5DZFA 1JHNA 3PJQA 4YZ3A 5A33B 1ASJ2 5FLHA 1MZ5A 3LA2A 1RVF3 4RS5B 4AFBA 2R073 3H0OA 4N43B 1OQ1A 4D69A 4J1WA 4HPKB 3AMMA 3V56A 3VN4A 1NXD1 5GZEA 1ZBE2 1XE8A 5CIRA 5JPMB 5KHHA 2ZX0A 5C8CC 1OA2A 1MQTB 1WLTA 2GN3A 4R9CA 4URTA 1HDKA 3NV1A 5I93A 3VKFC 2HJIA 4AEDB 3R05A 4MV2A 2NYYA 2BWCA 5H9QA 2WNUA 1LOEA 1DGRA 4OZXA 2RJLA 2DYCA 1LULA 5L36A 3N7MA 1OOPA 1J58A 2VGDA 4MXWA 3ES1A 3E5XA 2JXAA 2RM21 3ME2A 3IDBB 3GF6A 4Y1UA 1CR7A 3SISA 4GQ7A 3KLSA 2XBO2 3PMSA 4C0BA 2HWF2 3S0MA 3O0VA 4QPYA 4KWJA 3RYPA 5L7OA 1V6NA 3WVJA 1VR3A 4KG0A 4XJAA 2B5HA 1C8M2 3AZXA 1N3QA 2ATFA 3RWNA 2K0GA 3ZN4A 3H1WA 1TME1 2XH6A 1RUJ2 1NA1C 5C8CB 1IPJA 3ZSJA 1H8TA 3O0XA 1AL23 1MVEA 3MICA 1G9AA 3WLUA 1UU6A 1NOVA 4AQTA 1LU2A 2N7GA 3VGIA 2XVGA 3WCRA 1YJLA 2Q5TA 2RS51 5GALA 1D2QA 3E5UA 1QJZA 1XQNA 3GZTB 1W6OA 2D43A 4YW4A 3WP5A 2QDNA 1O4TA 2RS11 3QBQA 1SDWA 1W6PB 1DIWA 2B7YA 5BNPA 1N1SA 4K20A 2CGOA 1CD3G 5C9AC 3ZFGB 1R082 1DBNA 2ILMA 1TNRA 5DG2A 3D8CA 4D7TA 3FHIB 3JZVA 1VBD2 4LE3A 3R6SA 2ET1A 4UXAA 3VLBB 2VH9A 4I3PA 3WHUA 4A7YA 1M06G 1HLCA 4B3NA 3ACLA 4N7IA 4L92A 2ZZJA 4FPOB 4DRRA 2WNUC 4BH9A 3IIAA 1LOAA 3X29B 4DRVA 1AX1A 2BFUS 1OOPC 4IERA 5GKAC 3AZZA 1HRV2 4M3CE 1W6NB 2JICA 3M4FA 1FATA 4NWVA 2ES3A 3N36A 2HWC2 1KDKA 1Z7S1 4G4FA 5J09A 5A32A 1RC6A 3FBYA 4XILA 2R0HA 2XJRA 1G8WA 4YZ2A 1CAWA 3E6DA 2GNDA 4Q4Y2 5L7OC 3H8UA 3D82A 1UPIA 1RUC1 5C9AB 1RUD2 3DGTA 4FPCA 3THTA 4FAGA 2HWD3 2VU9A 2IFRA 2B45X 1H8TC 2WWSA 1LHVA 1XYOA 1S0FA 4DFSA 4XJZA 1DQ2A 2O8OA 1X36A 5FMOL 2WNUB 3JD73 2FMDA 2VULA 2HWB2 2HEYF 5DUWA 1NE6A 4Q0UA 1VRH2 1J3QA 2ERFA 4MXWB 4I30A 4XTMA 4Z07A 2NP0A 2JKBA 1PGW2 3IBMA 4LTAA 4EV0A 3T2TA 2YDEA 1NE4A 4RL7A 3CNAA 3JU9A 2BQPA 4Q4V3 5KHGA 5BNPC 3RPQA 3MEPA 3W59A 4S2FA 5L7OB 1QF3A 2I07B 3MGUA 2HWE3 4E9KA 1DYPA 4DY3A 1PK6A 1YHFA 4XF1A 4QPIB 1C1FA 4TYSA 1VBB3 4D7YA 4XXPA 1OI6A 2D44A 3VKMA 5LRSA 5KHIA 1J59A 2YHJA 5JOZA 3NV3A 4EROA 4JDOA 1JTZX 4WM8A 5HBAA 1ALYA 1V6LA 1BCXA 2ZGUA 2VW1A 3G7DA 3B9IA 5JOWA 2D6LX 4LNVA 4MGKE 1AR71 4HBNA 4GB31 2FZ2A 3NAPA 4GWMA 3WDTA 5FDBA 1R093 1W6OB 2IFWA 2R1DA 4Q4W1 2ZTNA 4XHBA 1S0CA 3WDVA 2DCJA 1FOD2 2WC2A 4GKYA 3HQXA 5BNPB 3WG2A 2VQ0A 3VV1A 3TOJA 1QDOA 1F2NA 2OZJA 4LO7A 4WVMA 2XL9A 1QXJA 2AGSA 4XFCA 3ZIWA 1X7NA 2DU1A 4JVAA 4W65A 4FCAA 4KGGA 1NY72 1KFXL 4XF0A 2VQAA 3CU7A 3RZZA 2IXCA 3THPA 1AR81 2TNFA 1BXHA 2WKKA 2ZGSA 1G7YA 3A0KA 2ZX4A 5CAZA 4MGZE 3J26N 3NV4A 3RYKA 1BBT1 4JRLA 3JBG2 3FC0A 4R4ZA 3ZDSA 1WLWA 2RJKA 3EQEA 1AX0A 2BNNA 1VAVA 1BVVA 1OFNA 1CAWB 2E7QA 3TN91 3ZYRA 4COZA 1S1AA 1S0DA 1PK6C 2RS31 1RUE1 1ZA4A 3M1HA 1XRUA 3AMNA 1DZRA 4W6XA 2YGMA 1EPWA 2XG3A 1NCQA 3LGRA 4EN7B 4AFMA 4WM8C 2EAAA 1XU1A 4PLNA 3VHNA 4IXLA 2RS53 4AHWA 3BTAA 1RUH1 3NAPC 2RHPA 4QX5A 1R1A1 4AEMA 2B8MA 1GNHA 2DU0A 3VBUA 2RS13 5HXVA 1QXRA 4G3YC 4HK8A 3JCIA 1AR61 1LGCA 3P3NA 4HLTA 2WT0A 1UU4A 1AYN2 4Q8KA 3RRDA 2RR11 1PO11 4FPFA 3A0NA 1BMV2 3VDDA 1F8VA 5HCFA 3DL3A 3LOIA 1OA4A 2AH2A 2W39A 4YNIA 5T5LA 2QZ2A 5H9PA 1TMF2 1UIJA 1ASJ1 5CB7A 2EALA 3K51A 1JW6A 4LEJA 4WM8B 2NZ9A 1REFA 3RJRA 4K3UA 2GC1A 3HWJA 1SCRA 4FSJA 3MW2A 5FPZA 1Z7S3 1APNA 1Y9QA 1ZBE1 4QHBA 4QM8A 1IS3A 2NMNA 4Y26A 1DQ6A 4M3CA 3OBRA 2EXJA 1GFF2 1RUC3 3KB5A 2FHRA 5J37A 4RHV2 4WVMB 2BFUL 1WGPA 3WV6A 4Q4X2 1CAUA 2VOXA 3SNMA 1J1LA 2QDRA 2XJVA 4BQ1A 1H1IA 3KCXA 4DXZA 1NCQC 3PLQA 3I4IA 4CEWA 1ZREA 5D8AC 2UWBA 4NPRA 1GR3A 3O0WA 2XBO1 2ZGOA 2ZGPA 1UN1A 4A7KA 3VBFB 4Z8BA 3LWCA 4XJ8A 3AMHA 4K8FA 3WR0A 3VBUC 5AC93 2WL1A 1UZZA 4FO9A 1C8M1 2Q0AA 2GDFA 2GC2A 3B94A 3CJIB 1RUJ1 2DUPA 3IPVA 1O4ZA 3RMYA 1WD3A 1LHWA 4QD2A 5DG1A 3VDDC 2XUMA 4XQWA 3WW4A 3T1LA 1MS0A 1LOBA 2E53A 5GLWA 2WZPP 3AP7A 2ZHNA 1PIV2 3U4XA 1GANA 5E88A 4XQDA 3CJXA 1SBDA 4SLIA 2MEV2 5D8AB 2UU8A 1YIPA 1AR73 3K48A 4GB33 2P3KA 4YW1A 1U5XA 1R081 4Q4W3 5IK7A 3VBUB 1PGL1 2DFBA 1GQGA 4FPJA 2BYVE 3H1MA 1EV11 1LGBA 1NQDA 1QOSA 1VB4A 4MYEA 1GBGA 3U0ZA 3GYDA 5CADA 1SMVA 2IXHA 4UBHA 3AZVA 3EJKA 4RGAA 4C91A 1HRI3 1NCRA 2P2KA 3I2DA 4F8AA 1OKQA 4XIOA 1WCKA 1ZZBA 1J1TA 2DV9A 4AWDA 3AZYA 3D4KA 1RUG2 5LEKA 3JUUA 4P9LA 3V65A 1ZRCA 4BLJA 1C5IA 2ZX3A 4CEWC 4AFDA 1POV0 1U5YA 4LUMA 2HWC1 2V73A 1AR83 2ZKNA 1I6XA 3PMEA 1O7FA 4F3JA 1O3RA 2EXIA 1C5HA 3C3VA 4Q4Y1 1BBT3 2XJTA 2WFF2 2YXSA 1CIWA 2BPA2 4MGYE 4TZDA 1ND3A 1OPMA 2O1QA 3TN93 2CAUA 3UK9A 5GLZA 4CRQA 1XU2A 2OIIA 3VL9A 2H6CA 2RS33 2R0FA 1VALA 5I0TA 2IZWA 4TLFA 2ZBJA 1VRH1 1JUHA 1CAUB 1QQP2 2XL7A 2ZKLA 4HKWA 1H4GA 3ZO0B 4GMP1 4UW3A 2DUQA 4CEWB 2XJSA 5JOXA 1AYM2 2HKXA 5CU1A 2OPKA 1GZCA 1XYNA 3AXEA 3AP6A 4IV1A 1RUH3 1UW8A 5H9RA 1R1A3 1WCDJ 2GAUA 2DVGA 4OHYA 4YGEA 1LOGA 1QJX2 1AR63 4Y1VA 1AJKA 2K2SA 2CWSA 4GIQA 1ZZ6A 3FLPA 3V0AA 2JG9B 4PQ9A 5GLVA 1IGOA 1EPZA 1NCRC 1FNZA 4MZUA 1CJDA 1PO13 1AL21 1GZWB 5I8YA 2WS92 5K7PA 3UKTA 2H6BA 1V6MA 4U36A 1RUNA 2CGPA 1LGNA 1ZBA2 3SMHA 1MS3A 5BNOC 1ENQA 4XIKA 5JCTA 2WLQA 4XDQA 5EFUA 1ASJ3 1Q56A 2D7FA 2WZR2 1WBFA 1ENSA 2UY9A 5A33A 4RS5A 5EWSA 1H1MA 2ETEA 1LCLA 1FOD1 2VOVA 5JDBA 1GKBA 1ULFA 1QY4A 4HPKA 2DVAA 3OD0A 4PJYA 1ZBE3 2MNGA 2QCSB 1ND3C 4WVWA 3AKSA 3KZ4C 3FWEA 1MQTA 3KS7A 4OI2A 2XVLA 1NCRB 1SLCA 2C5DA 4IEYA 4N7UA 1I1EA 4AI0A 5HCBA 1RUI2 4WBBA 1NY71 3AP5A 2CNAA 4BMBA 3LCPA 3RS6A 5DUVA 3IN9A 2Z79A 4Q0PA 5EZWA 2Q8OA 3QOPA 5BNOB 3FZ3A 2GZWA 3HR9A 2XBO3 2R062 5FCCA 4IV1C 2RMU2 4HN0A 3VZKA 4B4PA 2XPJA 4Q1PA 4DS0A 1SLAA 4CDWC 5BY5A 4XJWA 1Q8SA 1C8M3 3QLQA 2R042 1GSLA 3L2HA 1RUJ3 4JQRA 4QQLA 1ND3B 5F6KA 1CPMA 1H1AA 1D4VB 3D6EA 4Z82A 2LUWA 2I74A 5JI7A 1Y43B 3DV8A 3T1MA 3AYCA 4I2OA 4JDNA 4M0NA 2GMPA 1AUYA 1H2NA 3KCYA 2IXIA 2KXLA 3ZFEB 1KJRA 1F31A 1OLQA 1HV0A 1GYKA 2NMOA 4YGDA 1CPNA 2H0BA 3B93A 4RS5C 2SLIA 4IQPA 3RNSA 3NVCA 2YPJA 2WQZC 2ZAHA 2WA4A 4LBQD 5J3UA 4IV1B 3AJZA 4LBOA 2K9ZA 1D2SA 2PQQA 1R083 1W6QA 2VW2A 3ZFGA 3ALQA 4NN0A 4CDWB 2CGNA 1EV13 3HT1A 5FLIA 1MQTC 1VBD3 1BMV1 3ILNA 1BEV2 5J36A 2UWAA 3V0AB 2JX9A 3J9SA 1HQWA 4XJUA 3MPPG 2D3SA 2Q30A 3UJQA 3WW2A 1OSGA 4N9IA 1N1TA 1BVP1 3G6JB 5JAXA 5T55A 3GZUC 4BIFA 4ONUA 4PF5A 1HRV3 2A7AA 3POYA 4CZSA 4ES9A 4AEJA 3MW4A 3WP6A 1LHNA 4EJRA 2HWC3 3MF6A 4TSVA 4FAHA 1R091 4XMIA 3TBDA 2Z5WA 4Q4Y3 3VBRA 1ZRRA 3LOBA 4L2NA 1RUD3 3CLPA 4Q8LA 5C9AA 3N35A 4RHV1 2JECA 1RIRA 5GZFA 4FQZA 2D6OX 1FPN2 4JC1A 1VAKA 1S0IA 4AE2A 1UPSA 3H7YA 4EWEA 2XJPA 5GZCA 2YY1A 1VRH3 1ULDA 1YLLA 1RMU2 1PO21 4IEUA 4WV8A 1AZDA 4FBFA 4GMP3 1UCXA 1ZZCA 1Y3TA 3ETQA 1FT9A 2BUKA 4XEZA 4X6RB 4GH4B 1CN1A 5DDJ2 4YYOA 3RJ2X 3JB4C 2GU9A 4ATFA 3OY8B 1X8EA 4LBKA 2AREA 3URFA 3WW3A 3ZFGC 4GXLA 2R49A 5JVVA 2WA3A 1WBLA 4X8NA 5JSOA 1IOAA 1AHSA 3S7IA 2XLGA 3ZIXA 3FFQA 1AXYA 4DZGA 5A3MA 4QPIA 4AHXA 5I0SA 3KMHA 4P9GA 2E7TA 5AVPA 1W0PA 2ZZQA 1WD4A 1BQPA 1SBFA 1D0HA 1AL0G 3RDIA 3ZVXA 2A73B 2A6VA 4NVPA 4AVSA 3BPZA 5IK8A 3WY6A 1SACA 3IDEA 4FTEA 2GNMA 1OQEA 2ZX2A 3VBRC 1FOD3 1DGWX 2FZ1A 1XNCA 4J1XA 4E2QA 1W6QB 1A3KA 5ACA1 3GBWA 2HEVF 3ZX7A 1Q8QA 5T54A 2B9UA 4JAAA 4MUVA 4AGGA 3IWZA 1A6CA 1BYHA 4XF4A 2DURA 4ISRA 1RUG1 1A8DA 5KXCA 4F83A 4AGVA 1X33A 3H9AA 1UIKA 3WQ7A 1LTEA 3HN1A 3IM0A 3ZYPA 1DZTA 4P5HA 4BOWA 3B5LB 2ZGQA 4O9GA 1QWRA 2DCYA 5HCAA 3AMQA 4FPEA 5FO7B 1YNAA 4I02A 1COV1 4C1XA 5B2GB 1AR92 4ZU5A 3JBG3 4LE4A 1Q8OA 4HVRA 4Q1RA 2WFF1 1C57A 1C8NA 3ZFFA 3NV2A 4Z1VA 3VBRB 4Y22A 4M00A 4META 3ZXDA 2NN8A 2PHUA 2F6BA 4IESA 1NYWA 1UKRA 1U0AA 1DDLA 3ZN5A 2LALA 2B39A 3M3OA 4R4XA 2EIGA 4HSLA 4XOGA 1XXNA 4QPIC 4LO4B 1QQP1 1H4HA 5T5JA 5JMCA 3JB8A 4GWNA 1AYM1 3ZMNA 5KC5A 4BLIA 4YLZA 4N53C 2QZ3A 3VKLA 4OI4A 1VBE2 2WSUA 1LECA 3EXUA 3N7KA 3LAGA 1E57A 4KU8A 1BKZA 4CP1A 1Q3EA 5AC91 4RD7A 2PYTA 2WT1A 4KG8A 3SH3A 3GHNA 1AYN3 4OHZA 1W0OA 2NPIA 4MX3A 2OA2A 1REEA 5FOBB 2WT2A 2R6QA 3VHPA 3FBMA 4X8PA 4YFWA 4AI2A 3J8F2 4P9YA 1NG0A 4A2UA 1MS1A 1ZBA1 4XFGA 3B7MA 1MR5A 2GALA 1PZ8A 1TMF3 4LO8A 1Z0HA 2WZR1 3JQWA 2PAEA 3SCHA 4N53B 3W58A 1OA3A 2ZMLA 3MIHA 2CV6A 5HI0A 1RHI2 1IPKA 4HZFA 5L73A 3ZFFC 1ZZ9A 2R32A 3BIWE 5T5OA 3KT1A 3M3QA 1VP6A 3BB6A 4AHZA 5IT6A 1QXPA 1LOFA 3U11A 4RHV3 1HRI1 1PNFA 1V6JA 4ISQA 4Q4X3 3R0RA 1MS9A 5DZGA 2EVXA 3M3CA 4KNCA 3VKOA 1O3TA 2ZHLA 4Q27A 4XFHA 4HANA 4D3WA 1PO23 2R061 1KXGA 1N1YA 2RMU1 1VBC2 2XWBB 3AFGA 1HQLA 4HKOA 1PHMA 4XBQA 3VBFA 4AXOA 3WINE 2Q1MA 1H9WA 2XVKA 1GNZA 2R041 2GMEA 3N3HA 3ZFFB 3FFZA 4EN0A 3CJIA 4Y22B 4AVCA 3QH7A 2ZGNA 3AYDA 1ZX5A 5BUVA 3KQRA 4BPZA 4XW3A 1YJKA 4D7SA 2BGCA 4LLFA 1LR5A 1PIV3 5IK4A 3AFKA 4P14A 4YM2A 2GH8A 2LTNA 2X5IA 1CONA 5AFEA 2D98A 3FE5A 4JRAA 2A5ZA 5D8AA 3GHMA 4IEZA 1DGLA 1DQ0A 2VPVA 1RTVA 4Y1ZA 1DQ1A 4LBLA 3FUOA 4OHVA 5C33A 4J6GA 4XBNA 2E7AA 3AP4A 2DUOA 2WNVB 3ES4A 3M8LA 4LLOA 1F5JA 4YARA 2UYBA 4FXKB 2HEWF 4NWWA 3BODA 4R52A 1LOFC 5ACA3 1JYCA 2WLPA 4I09A 2ZS6B 4BZ4A 3HAGA 1YRZA 3BOWA 2TBVA 2GN7A 5C4WA 3VHOA 1RUG3 1OMIA 4YSFA 4EWDA 4I01A 1AJOA 4FQ4A 4Q29A 3OJBA 1IS5A 4LBMA 2GH2A 3C2UA 3O7OA 5DZEA 1W6MA 3WCSA 3VBFC 1HW5A 1COV3 3FJSA 5FFOC 3D0SA 5LK7B 3M3IA 2ZHMA 4RSUA 3UKVA 2WFF3 5DUXA 3CJIC 3SLIA 5GJ6A 3WNXA 1FPN1 4B8EA 3PVNA 4CDQB 3APBA 1QQP3 1RMU1 1KITA 4ATEA 5I8SA 4Y1XA 3AKTA 1N1VA 4YRDA 2X5IC 1AYM3 1VLNA 1YXWA 1YUDA 3QH6A 5DDJ1 2HWF1 1IKQA 4XFBA 4LHNA 4XE9A 3VZJA 3ASIA 1C4RA 4AFAA 2Y26A 1XNKA 3SH5A 1DFQA 1FXZA 5D1IA 1QJX3 1XNDA 3QD6A 5LK5A 2JG9A 4YG0A 4XHXA 3MLJA 3VZNA 3PHMA 4HKLA 3RMXA 4R8HA 1G9FA 1FV2A 2WS93 1SEFA 2SBAA 3AXDA 1GZWA 4NHLA 3UKNA 5C4WC 3LA7A 4PLOA 4IEOA 4IETA