2W1UA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,3) galnac
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1uA00
1NAEA 3K4DA 3LPFA 5J1XA 4PT6A 2Y6KA 1EUTA 3K4ZA 1UXZA 3I3BA 4M4PA 3VD7A 2J22A 3WNMA 5DQ0A 4QPWA 3C7HA 3I2GA 2BGOA 4CUBA 4XZUG 5JXHA 2VCCA 1CZTA 2Y6LA 2X05A 1O8SA 5DN2A 2DCKA 1K45A 1GOFA 2R7EB 3LPGA 3LEKA 1ULOA 1GQPA 4PQQA 1F4HA 4QX3A 3WNLA 4PF1A 3LEGA 4ZXEA 4A4AA 3NRUA 4A44A 1UX7A 1PX4A 3WSOA 3MO4A 2J1UA 2BBAA 3ZM8A 2J1VA 1JZ5A 3NJXA 3K75B 1K3IA 2ZEYA 2W5FA 3WF1A 4TXWA 4DXRA 1UY3A 2V72A 3OGRA 4GWIA 1US2A 1OH4A 2YB7A 4W8JA 2VMDA 2VMEA 4AAXA 1PMJX 3I2IA 4CU8A 3J7HA 1D7PM 1US3A 3T2QA 1EUUA 2RV9A 2OKXA 1TVGA 3WF4A 1GMMA 3IB3A 1JYXA 4W4ZA 4D8MA 3CZJA 4QAWA 4L0PA 4P08A 3FHQA 3T0BA 3UNPA 3T08A 1GOHA 2VTFA 1W8NA 2XOMA 3C7FA 2W95A 3HNYM 4MOAA 5F7UA 2E26A 3I2KA 1CX1A 3I97A 3UETA 2WDBA 4KI5M 2EIEA 4HG6B 1L7RA 2Y6JA 1DLCA 2VL4A 5JUVA 2W46A 4XUQA 4QDRA 3GM8A 3NJVA 2CDOA 3DYOA 4QB6A 2W1QA 4MO3M 4QX2A 5JMOA 4P00B 1OT5A 5G05L 3SEPA 2W92A 5FUIA 2LS6A 2VZUA 1DP0A 2YFUA 2RJ2A 3I2JA 1IQDC 2V4VA 3MV11 3I2HA 3LE0A 4JKMA 3SKVA 2DCJA 2YFZA 4JKKA 4XUOA 5G04L 4A45A 4D0QA 2VMFA 2PQSA 2HYXA 4QB1A 1I5PA 5IFTA 3SEEA 2VZ1A 1SHWB 2J1RA 2VCAA 3ACIA 2VO5A 1W99A 4OUEA 4DEVA 1GUIA 1OF4A 1SG3A 2KD7A 1OD3A 1YQ2A 2Y8KA 4XUPA 4DUXA 2EIDA 2J1EA 4ARXA 4ZZ5A 1ULPA 2LW8A 3I3DA 5B4XA 2VZRA 1GOGA 4DXTA 4OZOA 4A41A 4UOJA 2VR4A 4A42A 2ORXA 3FHAA 2J1TA 3MV01 1UWWA 3I3EA 4P02B 4M4RA 2XQXA 2V5DA 1JHJA 2VZ3A 3CKHA 2W9XA 3GDBA 2ZEXA 2C4XA 4Z2AA 2WZEA 4KWUA 1JU3A 2EIBA 3HNMA 3T2OA 3HN3A 2ZXQA 2E32A 1JU4A 3P1IA 2VZPA 1W9SA 1PMHX 3WNOA 3FN9A 4BK4A 1K42A 3OG2A 3CZUA 3A23A 5EJZB 2B9VA 2JE8A 3I2FA 1UYXA 2E31A 3HNBM 2WBKA 2Y6HA 3OGSA 2VCBA 3ACFA 2C26A 5I0DA 4LQRA 3DYMA 5JR2A 5JXIA 1KGYA 1RYYA 3OEBA 5CZKA 4QX1A 1UXXX 2JD9A 2YC2A 1UYYA 5C7GA 4TTGA 2CDPA 3NNGA 2QQKA 1MPXA 3WF0A 1L7QA 3DYPA 3C8XA 1CZSA 1JYNA 2X09A 3MUY1 2W1WA 1BHGA 4BK5A 1JYWA 4OYUA 2WAAA 1R64A 2VQTA 3IDAA 2XHNA 2W3JA 4XUTA 2WUHA 3K46A 4W50A 3K77A 4MADA 2VZSA 3VD4A 3HPNA 4QDSA 4OMCA 4LKSA 2J1AA 1K12A 1JZ7A 4UAPA 4CVUA 4AG4A 4XURA 2QQNA 2W94A 3VDCA 3CQOA 1JZ4A 2JDAA 3IIIA 2WO1A 1NX9A 5IJRA 4E8CA 2VZTA 2J1SA 2Y64A 2QBXA 1XC6A 1O8PA 2QQOA 2X10A 4LPLA 4JX0A 3VDAA 3E1F1 2J7MA 4ET7A 4GZ9A 2VMCA 4FI9A 3HOBA 4P5YA 5C70A 1XNTA 2WYSA 1UYZA 5DMYA 1PX3A 3VDBA 3OBAA 3MUZ1 4QDQA 2RVAA 3C7GA 2WAOA 2QQIA 1P8JA 2W91A 4BDVB 1JI6A 1TG7A 3BN6A 3VD3A 5HPOA 3OEAA 5JXGA 3ACGA 5IYYA 2W87A 2W47A 4CUAA 1NUKA 2VJXA 3EYPA 5DPNA 1H6YA 3ETPA 4RN5A 3WNKA 3AC0A 1GNYA 1T2XA 1W0NA 3CMGA 3EB7A 2VM9A 3GGLA 4LHSA 1GU3A 1XNAA 3NQHA 1H6XA 1F4AA 4JHZA 2WN3A 4ARYA 1CZVA 1NKGA 3ECQA 4DEQA 2L9LA 3F2ZA 3GXUA 3ABZA 5IFPA 4CU7A 1WKYA 3WNPA 3LQCA 3THCA 3WF2A 5C71A 3K4AA 3T09A 3HJRA 2BGPA 3W5NA 2ZEZA 3SKJE 1CIYA 3WF3A 3A21A 3THDA 2VZVA 1UMIA 3DECA 2DDUA 1UY1A 1J83A 3VD9A 5LA2A 4ZZ8A 1UMHA 1UY0A 2Z4FA 2EICA 3IAQA 1UY2A 3HEIA 5LA0A 4DXSA 2Y6GA 1J84A 4XUNA 2WQ8A 1W9WA 2BZDA 2HLEA 5HXMA 3OGVA 2VQUA 4IUGA 4BXSV 2WABA 1UZ0A 1HN1A 2WO2A 3ACHA 4KMQA 5LCWL 1JZ8A 3OB8A 3C7OA 3JXSA 3T0DA 5EJ1B 2YC4A 3MBWA 2WN2A 3VD5A 1KEXA 1JYVA 3D3AA 4UI9L 4CU6A 1OF3A 4A3ZA 3T2PA 2VZOA 4XVHA 4MGQA 2QQLA 2YG0A 1W8OA 5JXJA 1WCQA 3A22A 2ORZA 4E8DA 2BERA 4GWJA 3T0AA 3FL7A 1JZ3A 3CIHA 3WQBA 4A6OA 2WZ8A 1W9TA 4DUVA 4JKLA 1XPWA 1LNSA 5B4NA 4MGSA 2B4KA 2VC9A 3C7EA 3P6BA 5EIYB 5LA1A 4OMDA 2W1UA 1JZ6A 3W5MA 2VOTA 4DUWA 4CUCA 2QQJA 3UESA 4YPJA 3PUHA 2W1SA 3WEZA 4BJ0A 4CU9A 3IAPA 2VZQA 3LEIA 4QX0A 1DYOA 2ID4A 2E33A 1SDDB 2XONA 3CDZB 4QB2A 2C9KA 3WNNA 2QQMA 3U37A 3A7QA 2ZEWA 1JZ2A 1O59A 5A1AA 4RYDA 2JKXA 5CYYA 5IHRA 3BGAA 3PUIA 2WO3A 1UY4A 4ZY9A
chains in the Genus database with same CATH superfamily
5FZ8A 3WNXA 4WM7A 4BB3A 3RJRA 5C5UA 1EUTA 3K4ZA 1UXZA 3NW4A 3B7MA 2Y34A 4Y1YA 1LJ7A 1VPHA 4QXHA 5DQ0A 4RHV3 4LXLA 4HVRA 1HLCA 3P5BA 3DF0A 3J4UH 4XQWA 1Q8QA 2BGCA 3ILRA 3TB0A 3I2GA 2BGOA 3RNSA 5JXHA 4I3GA 2VCCA 4N9HA 1AR61 1CZTA 4K40A 3GZTB 4FFGA 4JHTA 3CBNA 4CDXA 3GHNA 4XDOA 3U4SA 2X05A 4FTEA 1NQJA 5IK8A 4FP3A 4FBFA 4S2FA 5L9RA 3V65A 4CEWB 5C6CA 1RIRA 1ZZCA 2ARAA 3NV2A 3POWA 1YRZA 3JBG3 3WVJA 1QJX3 1UZWA 3ON7A 1DQ4A 3ZFGA 5FPUA 3K2OA 1GNHA 1O6UA 1X82A 3MPPG 3OUIA 1KDKA 2YHJA 1UIKA 1YJLA 2X5IC 3N9OA 1R1A2 1BJQA 3MO4A 2JDZA 3OOXA 3AZXA 4SLIA 5F3GA 4AE2A 5JR7B 2BBAA 4AL9A 3ZM8A 1NXD1 1VRH3 5LZ6A 4FOYA 1UKGA 4LMFA 4OULA 3K75B 5A7WA 2YBPA 5K8SA 2B8MA 1QJY1 4XJWA 1OH3A 4DPNA 1CX4A 4DXRA 1UY3A 4JCKA 1W8ZA 5EHDA 4HPKA 1K5MA 3OGRA 4GWIA 4D6SA 1CAXB 5JOYA 3KHBA 2YB7A 2HWD3 1S2BA 4MZUA 2ZMNA 4GKYA 5FZ6A 5I0UA 4S2DA 1PNFA 4UFHA 1TMF2 1AF9A 3H3LA 2VMEA 1E5IA 1SACA 2PHUA 4OI4A 4AAXA 4K20A 4DS0A 3I59A 3Q8AA 5C5TA 4LLOA 1NLQA 1Q56A 5FZ7A 4OVEA 1RVF1 5DZEA 2OZ6A 1W9FA 1GZCA 5FZLA 3BB6A 5A7NA 2ILMA 5DDJ1 3WF4A 5FV3A 4XF1A 1G9AA 1J1LA 1DF0A 1YFUA 4QAWA 1Z78A 1ZNPA 4C91A 4BQ4A 5FZ4A 1GOHA 1O91A 3AMNA 1FNZA 3MICA 4UF0B 3LDBA 4XFHA 2EF6A 4EN6B 2Y60A 3VHPA 4QT6A 3NAPC 2A5ZA 1S2KA 1S55A 5FZ0A 1DHKB 1OVSA 1OLRA 3NKTA 4YVSB 2QKDA 3HNYM 4HBNA 2X5IB 1W6OB 4MOAA 2JG9A 2ES3A 4D94A 1GZ9A 5LBCA 1H2KA 2JWPA 4PBOA 1MS4A 3PLQA 5JLVA 1DYPA 4MXWA 2WO7A 3UETA 1O3QA 1ULGA 3N4MA 1AR62 2R1DA 1H1IA 4HG6B 4XAEA 4IE5A 2Y6JA 4XCBA 1VBE3 2B39A 2V5YA 1OBNA 2D7FA 2W46A 4NJ4A 3AL5A 2VAUA 3NJVA 4XUQA 3S7EA 3VBSA 3SLIA 2FDHA 5FMOS 2VMGA 3E5XA 1RUI3 4MO3M 5DUVA 3HVDA 3MZHA 3A4UA 2AEZA 1RGSA 3U11A 2OIIA 4FPLA 1H0BA 3IPVB 1QOSA 1BBT3 4X8PA 1DZTA 1AR71 2LS6A 4BU2A 3AP6A 5JSRA 1H8TC 1HJGA 2HYKA 3MV11 4LBJA 4BXFA 3NNFA 5IK4A 2DCJA 2YFZA 4Y4YA 5IVEA 4XUOA 3O0XA 1WCSA 2P1BA 4CCDA 1NQDA 1RUG1 1SBDA 1VBB3 3PURA 1QH7A 1QJY2 2UWBA 5H9SA 1OFSA 1I5PA 2BWCA 3B02A 5IAVA 2HWF1 2WA4A 1CAVB 2HEVF 3AXDA 1U5XA 3POSA 2J1RA 1A8MA 2WNUC 1W99A 4OUEA 1GUIA 2JDYA 1DDLA 4K3UA 2WWSA 3N9PA 1SG3A 3SISA 1C8NA 2XUMA 3MPBA 1HRI3 4FT8A 5D8AC 1DYKA 2KD7A 1OD3A 4CZSA 1ND3A 2ETEA 1HQLA 2OUHA 2R1BA 4ZZ5A 1WW6A 4AFMA 2BJSA 1JODA 2YUEA 2YPJA 3HT1A 4QU2A 4Q4X3 1POV3 4Q4Y3 3DEMA 4RR3A 1ZRIA 4XAAA 3ZLIA 1DG6A 1F5FA 1W9YA 3KT7A 5DZFA 5DDJ2 1XYOA 2YMZA 5B4XA 2UU8A 5C8CB 3WHUA 2BV4A 1GOGA 5IUQA 4AEDA 3OGGA 4DXTA 1JUIA 5FYBA 2W68A 4XF3A 3ZFFC 5HXVA 1AJKA 3POEA 4HMZA 4KL1A 2P3KA 1AL23 4IE6A 2ORXA 3FHAA 1PO13 4WV8A 5FPAA 3SNMA 2W08A 2RDRA 4CCNA 1OFNA 4E2QA 5A7QA 4NRMA 3ZXAC 3OUHA 1UWWA 2R0HA 1V6KA 4M4RA 3GYDA 1C57A 2V5DA 1V6IA 2XQXA 2GC0A 5FMOL 1V9U2 4AI3A 1AYN3 4ES9A 1JHJA 5LBFA 1W90A 4HLTA 4ITCA 1H8TB 3H50A 3RGBA 1JTZX 2JDHA 2VUAA 4IEPA 4CRQA 2PLV2 4QGNA 3AYAA 3KZ4C 3HNMA 2OZJA 4CEWA 5DAWA 3KVAA 4F7ZA 4AI8A 1ONAA 1FPN2 3HN3A 4GKXA 5DUXA 5GLWA 5GZEA 2A70A 2BP6A 1W8UA 4AAPA 1JU4A 2BTVC 4YM0A 4YG6A 4H7MA 4XMAA 3ROUA 1UD1A 3DN7A 4A3XA 2ADEA 3CZUA 3IZOA 4Q4V1 4AI0A 5D8AB 4CP1A 1W8TA 1H30A 1QWRA 1UYXA 4Y5Z0 3WZ1A 2JXAA 2Y6HA 3OGSA 1RUC3 1VR3A 2QUOA 3KGZA 1GP6A 2PHWA 3WW1A 5K4LA 4C0BA 1HDKA 3D82A 4V2WA 5I0DA 5FYSA 1RUG2 4IEOA 1PGSA 5FYTA 5KHKA 3JU9A 4ORFA 5CZKA 2PHTA 2HWF2 4QX1A 2JDPA 2VVDA 1NYWA 3U07A 2I2SA 1ZBE1 1QY4A 2NM1A 1Y7BA 5C7GA 1XE7A 4TTGA 2MEV3 2FMYA 5A3LA 2WZR1 1BEV3 1HKDA 3OPWA 3WF0A 4WVWA 3UT0A 3ZFEC 1CZSA 3UGGA 4XOGA 3TOJA 5DG2A 3BCWA 1F5JA 2YDEA 5LY2A 3NJZA 4BK5A 1JYWA 3WDTA 1W2AX 5FUNA 2CAUA 2R061 5FZEA 4E4ZA 3KQRA 3NNLA 5BV6A 5IWFA 1QDCA 4Y1XA 5H9PA 4LR4A 5C8WA 2WUHA 3LFMA 1S0FA 1C5IA 3K77A 3W21A 3VD4A 1SQ4A 1RUD1 4UF0A 3HPNA 1N1YA 4L2NA 5I0RA 4A7ZA 5L19A 4OMCA 2J1AA 3MF9A 5BY5A 1QF3A 1HW5A 5LEKA 1XRUA 3TEZA 1MS9A 2RS53 4AI9A 3M70A 4YVSA 3LAGA 2QQNA 4QKBA 4YW6A 5I8TA 1LHWA 1W6OA 5APAA 2WO1A 5IJRA 1LHNA 3GZUC 5C4WC 2CTVA 4KWKA 5JIUA 3BODA 5JZGC 3WD5A 3HQUA 2XG3A 3LIHA 3GBFA 2ZX1A 1M4WA 3TEYA 1UOBA 3N9QA 5DABA 4Z07A 5FY0A 3UK9A 5E1RA 3UV9A 5FMDA 3O1PA 2WQZC 4IV3B 3BTYA 1IS5A 4YZ4A 1HN0A 5F1RA 1W6PA 4FPOB 4XIKA 4D6QA 1UIJA 5KXCA 3E1F1 1NXMA 1QJFA 1XU2A 1U12A 3AZWA 5DZGA 4ET7A 1IGOA 3IPVA 2ZGRA 4DIQA 2R30A 4PLOA 4P5YA 1D0GA 1KQRA 4CCOA 3PJYA 3I2OA 4Q4V2 3NO8A 3VZKA 3NJYA 3ZFEB 1JYTA 1UZZA 3OBAA 1GBGA 4CEYA 5IAXA 1VBC3 3LD8A 4INDA 3MUZ1 3VB9A 1ASJ1 1P8JA 4E4DX 4BQXA 5F6LB 4BDVB 3GNEA 1UCXA 4JTNA 2EXKA 1CAVA 1OMIA 1IPSA 1BVVA 3PL0A 1HXS1 1CQ9A 4OQ8A 1PIV1 2XHKA 3H9AA 4JTOA 4U36A 2W47A 2ZTNA 4DMIA 1LU1A 3ELNA 1NUKA 1XYPA 2MHFA 2VJXA 4FFHA 1H6YA 3AKRA 2WZR2 4IEUA 1LCLA 3D0SA 4I01A 4F8AA 1OPMA 3ILNA 3KV9A 3TAYA 3H1YA 1WW4A 3M3QA 4ASLA 4E2SA 4MV2A 1YIPA 1H2LA 1RTVA 1YQ6A 2WNVC 3IDEA 1YWKA 3GGLA 5BUVA 4RL7A 1GU3A 2XWBB 2C1FA 2R062 3BKZA 3POIA 3NQHA 5C8CA 4KWJA 2CV6A 1RB8G 2A6XA 5FZOB 5C4WB 1W2UA 5A3NA 1F4AA 1LEMA 3SH4A 1CZVA 4AVBA 1RUD2 4GULA 5GKAC 2ZKLA 3I54A 3FJSA 2PN5A 4LNVA 1PGL1 3U1XA 2KM2A 5C3SA 3WNPA 3OF1A 3LQCA 3ZMOA 1ST8A 2D43A 1NY72 4AVCA 2G4IA 3FHIB 3VKMA 2Q8DA 3KF5A 4M3CB 5C71A 3K4AA 5IVVA 1ZVFA 3AL6A 3GZEA 4MG2A 3HJRA 3PU8A 1CIYA 1XSRA 3M2MA 4LKFA 1AHSA 5ACA3 4FOQA 2VCMA 3Q8CA 1S0DA 2VZVA 1PM7A 2XDVA 3AMPA 4EYUA 2LM3A 4AVTA 1G9BA 5CEHA 3VDDB 4QHZA 4LBOA 1B35B 5SV5A 3FUOA 5C3RA 1J83A 2VE1A 4PDWB 3D4KA 3VD9A 3KS7A 4NIGA 1COV3 2UYAA 3OD0A 1XQNA 2OQ7A 4Y4RA 2OT7A 5I8YA 3ILFA 3IAQA 2WT0A 4NHYA 1WA4A 2JX9A 4KG0A 2Y6GA 4H3WA 4CDWC 2VBDA 4HSLA 4WVZA 1MZEA 5DAPA 4QM9A 4OUMA 5IATA 5BNOC 2Q1FA 3LDRA 4OQ9A 2FZ2A 1ASJ2 1H1AA 5EWSA 3MIDA 4XEZA 1YO8A 3LOBA 1REFA 4NN0A 5EFUA 1CAWB 1IOAA 2O8OA 1MZ5A 4WM8A 1HXS2 3AFGA 5FPLA 3Q9OA 1PIV2 4L97A 1DQ0A 3O1RA 3BTXA 3RZGA 1NA1C 3ACHA 1JZ8A 5LCWL 3JXSA 3MIHA 2IXIA 5EJ1B 2P3IA 1MR5A 3GHMA 1DGRA 3MBWA 4BYYA 1GR3A 1KFUL 5FTTC 2O8QA 4YG0A 3VKFC 1RUH1 1JYVA 2CGPA 2RM21 1SPPB 1JMUB 1LENA 4CP9B 4HVOA 2ENRA 2LRPA 3KT1A 5K7PA 4TWTA 3S57A 2VY0A 2HEYF 4EE2A 4LBNA 1PHMA 3LOIA 2RS31 2PHDA 1OKOA 4JRLA 2PMWB 2WSUA 1R083 1WA6X 2YG0A 2YYOA 3FZ3A 4GAZA 2G19A 1Z7S3 3I3QA 2ORZA 1UZVA 2YU1A 3B3QE 4Y33A 4E8DA 3W9AA 4GWJA 2VNVA 2F17A 3FL7A 5EZWA 4CXXA 2XVGA 3CIHA 4HVQA 4JKLA 2PHRA 4K8FA 3VBUB 4JVAA 1ZBA3 4CYDA 1OOPC 3ITQA 4MGSA 1PGL2 3Q8EA 1S0JA 3KWVA 3WDWA 5LRSA 3HD8B 1VMJA 1CONA 2UY9A 3RI9A 2ZJCA 2FDFA 1XJAA 3S30A 2ZGLA 2DV9A 4GMP1 2XH6A 4EWAA 1Q8SA 4DUWA 5JDBA 2QQJA 2X53S 3H0OA 2WWUA 2FDJA 4BMBA 4XFCA 4PIZA 5FPBA 2UWCA 3AP5A 3IAPA 3WG4A 2BVBA 1HRV1 5FKBA 2ID4A 2VECA 1SDDB 1ZA7A 4IV3A 2XONA 4QB2A 5F5AA 3WDXA 3JQWA 4KU8A 4IE7A 4PHZA 5FLHA 3VHOA 1UYPA 5AC93 1X8MA 5FJHA 2ZEWA 4HXCA 3WP3A 1EPZA 1O59A 4FTBA 2JKXA 5FXVA 3ZFEA 5ABJC 5AVPA 1ZREA 4AEJA 3QCWA 2FD8A 1MACA 2O14A 3SMHA 3SCGA 2BWAA 2DU0A 1PO23 2HJIA 4PT6A 1I3HA 4M4PA 3I3BA 2JDUA 4YW5A 5IT6A 2XJVA 1RXGA 3ENRA 3GF6A 1I9RA 3FC0A 4O65A 1SCRA 4XXPA 1HB3A 4XFFA 1JOJA 2F4PA 4IQPA 2Y6LA 3PJQA 1AXZA 4Y24A 1A34A 1GV9A 2XPJA 2A71A 2DF7A 4AVVA 2HWC3 4Q4W3 1VALA 1RUH2 1G7YA 4CCJA 2RM22 4JQRA 3ZIWA 4PQQA 1F4HA 2A3YA 3AB0A 4QX3A 5CKQA 4YGEA 4DY3A 5BNQA 1SEFA 3UGFA 2QDRA 3LEGA 1OD5A 5FXZA 4E9KA 2D93A 3RYRA 5FZOA 4NRQA 4P9XA 5C4WA 2FDKA 3NVCA 5JI7A 1J3RA 3RYKA 3BI3A 2WJSA 3RZHA 4Q0PA 1XSQA 1H4GA 2RDNA 1EY2A 2Z2SB 3S0MA 4LO6B 3VKOA 3AVRA 2IXKA 4UW4A 2G1MA 3CO2A 2AGSA 4ZXKA 2FDIA 2W5FA 2V4AA 3WF1A 3AX4A 1SMVA 3SXWA 1ULFA 3ES4A 4PIYA 4QM8A 4TXWA 1EP0A 1KRIA 1DGWA 2QDNA 4M3CA 4C1WA 3PTRB 1TEIA 3IN9A 4LHNA 2UY8A 1W28A 3OPZA 4HKOA 4PIXA 5FZIA 1F31A 2GDFA 4ATFA 3KV6A 1E57A 4CP0A 3THPA 2Y33A 1DQ2A 3D6EA 3I2IA 2D3RA 5FZHA 2E7AA 1LHVA 1X33A 2D6NA 4PLNA 4Q26A 1QEXA 1SFYA 1US3A 2B5HA 5LB6A 2O0OA 3VDDA 1LGNA 3VBRC 1B35A 4LBQD 1HRV2 1XNCA 2Y6FA 4PDWA 4CCMA 1XNDA 1RJ8A 3DXTA 4H2AA 1XE8A 2YBKA 3RZLA 4N9IA 5A80A 4QQPA 3FHQA 1F35A 4ZS2A 3UNPA 1VB2A 2RDQA 3KVBA 3ZYJB 3OBZA 3B69A 3E6BA 2VTFA 1VBB1 4IEYA 4AVAA 1IKQA 2GMPA 2XLAA 3ZSEA 2GC3A 1MS3A 1N3OA 4NHMA 1PVC2 5IVFA 1S4CA 5BNNB 4FPCA 1QNYA 1NCQB 2DCYA 4GH4C 3CHXA 4QQHA 4XMIA 3SC7X 1CAWA 1HRI1 3ZIXA 3J7LA 3PIGA 2ZGQA 1CX1A 2Z69A 2VD7A 2NZ9A 1IG3A 3I97A 2WDBA 4DY5A 2Z5WA 2JKBA 3M1HA 1SPPA 3MEPA 1POV1 3MLLA 4HT1T 4Q4Y1 5DUWA 4CP9A 5AFEA 5JUVA 3EO6A 3DYOA 4FPJA 3H1WA 1QHDA 5HCBA 2R071 4N43A 5E6HA 4P9JA 2AENA 2XR4A 1OT5A 5G05L 2O1QA 5I91A 4XTMA 3O14A 1YHFA 4AR2A 2DCZA 2VZUA 3AKTA 4I0BA 5FUIA 1LAJA 4L11A 4HK8A 3U75A 3VBOC 2JE7A 4BIOA 1R093 2BVVA 4LIVA 4EN7B 1PO11 3MFAA 2PHFA 4GMP0 3I2JA 4UFKA 1IQDC 4AGVA 3I2HA 3LE0A 4JKMA 3VBRB 4YZ5A 5AFBA 3VBUA 1VBA2 4JKKA 4I3PA 3M3CA 2QQVA 4D0QA 2VMFA 1SBEA 5IFTA 3ACIA 2CGOA 2VO5A 3AKSA 4AQ6A 1V00A 4P14A 1YLLA 1MQTA 2WS92 5D1IA 1DGRN 5DAVA 1BLZA 1ZYBA 2A6VA 3B9IA 4UWDA 2Y8KA 1YQ2A 1W6MB 4JC1A 1FT9A 2EIDA 3W58A 5L9BA 1DFQA 1SLCA 2VW0A 1RUE3 4EN9B 3QBQA 1ULPA 2VVEA 5EP9A 3PVOA 5JIAA 3EHKA 2W0XA 2LALA 3ZDVA 3O1UA 2LW8A 4RQPB 2ZA9A 1OLQA 1TME3 3S7IA 4YZ2A 3E5QA 1A78A 3L9JT 4LO7A 1S0GA 2VNOA 5F3CA 3VHRA 4YW7A 3LSDA 1ACCA 5FY8A 3PUQA 4UFJA 3JCIA 4FQ4A 5F37A 4YVWB 3RVHA 2VR4A 1JOPA 1LRHA 4XTPA 4A42A 2W39A 1R1ZA 2Q8OA 1O5UA 2RMU3 3MV01 5F6KA 3ZXKA 4BQWA 1LOCA 4QPIA 1FOD3 3ORJA 2G9GA 1APNA 2B45X 3AP9A 3FBMA 4P02B 5EYYA 3BPSA 3F95A 4JGZB 3FWEA 3QOPA 2PHXA 1OURA 3CKHA 3GDBA 2ZEXA 1DGLA 4IGOA 1LOBA 2C4XA 1LECA 2GH2A 4KWUA 4GQ7A 4IXLA 3MIBA 3O5SA 2ZHLA 4URTA 2ARBA 1C8M3 3OBRA 1UN1A 1S0EA 2G9FA 2VXJA 4IEZA 3MFCA 4RD7A 5A7SA 5HCFA 4I09A 1JYIA 1QJU3 2D44A 3T2OA 3BTZA 4Q4Y2 4NVPA 2D97A 4R9AA 2GC2A 5FYVA 1DLLA 3BU0A 2R072 2VZPA 5JAXA 1AR82 1PMHX 3MI8A 3CEWA 3WNOA 5FP4A 3A23A 4B1LA 5K0UC 2B9VA 5LW9A 1VMFA 1X8EA 2DVAA 1GYKA 1MEC3 1WLCA 3DXUA 4YM1A 1PO12 4XBLA 4N8MA 1FATA 2VCBA 2XGXA 4ZPIA 2C6SA 5FUPA 4QKDA 3USUB 1TZOA 1OA2A 2C26A 4JQTA 4LJHA 1GWLA 5KC6A 2P37A 3DYMA 5JR2A 1KGYA 2A6WA 2K9ZA 2TNFA 5T55A 2P2KA 4QQ2A 1AR91 4MGZE 3MYXA 1TNFA 4M01A 2JD9A 1W0PA 4F3JA 2A6ZA 1FV2A 1H9PA 4L8QA 4K7JA 2LUWA 3BVCA 3ZXDA 1YEWA 5KHGA 2CDPA 3IDBB 1UX6A 3NNGA 2QNKA 1PNGA 3HIFA 1HQWA 1LGBA 3ZPYA 2GMMA 3ME2A 4DRVA 5FK7A 3MUY1 5E16A 2D98A 3DKQA 4HN0A 4DQAA 2W1WA 1QMJA 2P5BA 2HWE1 5LEJA 2BW8A 4HL0A 3M7AA 4OYUA 3PIJA 5T5PA 5FP9A 3VL9A 3ZKUA 4K9SA 2E9QA 3ZSKA 3NV3A 3IDAA 2D6LX 4Q0QA 3MW2A 2DFBA 4XUTA 3ZYBA 2EXJA 4HKLA 3ETQA 2JE9A 4B4PA 5FP3A 2ZACA 3RWNA 4UFLA 1GANA 1ZA4A 3KSCA 1D0HA 4YLZA 1CVNA 2TBVA 2WC2A 1JZ7A 1F15A 2ZAAA 5BNNA 1L3JA 1CIWA 1NCQA 2OPWA 1FI2A 1OQDA 4CVUA 4AZZA 3J8F3 2OUJA 3VDCA 3V64A 3A0KA 3UKVA 5EPAA 1O4TA 1JZ4A 1OUSA 2VOWA 2FMDA 4Q5OA 2GH8A 2VZTA 2Y0OA 4AFDA 2Y64A 2AREA 3DUIA 5FZDA 4M00A 5F5QA 1ULDA 2JICA 2QBXA 5A6QA 1JS9A 1XC6A 2IVJA 1FYUA 1O8PA 4WVVA 3WG1A 5F9TA 4JDOA 4ASMB 4Y22A 4CDUC 1OKQA 3P3PA 1FMD1 4YG3A 3BYWA 3N7MA 1BK1A 4LPLA 1LESA 4P9IA 2DU1A 4P9GA 5FLIA 2VBBA 2NMOA 2J7MA 4AF9A 3RDIA 1X9PA 3NL1A 4GZ9A 2QQUA 4Y1ZA 2VMCA 3WY6A 1XNTA 4O9EA 1KS5A 1OQEA 3C3VA 2JDMA 3EXUA 2YU2A 1QXRA 1UYZA 4AI2A 3AMMA 1PX3A 3VBRA 3NAPB 1XYNA 3BTAA 1IS3A 4R4ZA 2RVAA 1CESA 4BHPA 4QXKA 2W91A 3LDKA 1RVF2 2VU9A 1JI6A 4DNYA 5FFOC 2R49A 5L9VA 5FXXA 2YV8A 1AR92 3E97A 4Q29A 1QKQA 3OEAA 5JXGA 3ACGA 4CDQC 5IYYA 2ARCA 2RJKA 3EYPA 3T4HB 1R1A3 3UKTA 1C1LA 2BEOA 3RQ0A 5FCCA 4AHYA 4D7SA 1W6MA 4EJRA 1LTEA 3ETPA 2WNEA 2X29A 3L2YA 2VH9A 4XETA 5FDBA 2GMEA 4J1XA 1GNYA 3ZMNA 2A1XA 1IPKA 3EB7A 4IV1C 2MPFA 1VBD3 2AYHA 2HWE2 4Y5TA 4RQPA 1IZ3A 3O12A 4LO4B 3ZYFA 4H7LA 5GLTA 2ZGMA 1OLMA 4G3YC 3BOPA 4FFIA 2ZMLA 2BOJA 2ZGNA 4YVWA 1NKGA 5FIXA 2IVIB 3QD6A 4DEQA 1XNBA 4CCCA 1TMF3 2ZHNA 1NE4A 4CDUB 2BRTA 2OW4A 5M0TA 1V6JA 1QJEA 2E7QA 2EIGA 3H1MA 4I30A 4CU7A 2BNOA 3THCA 4M0NA 4P9YA 4ZU5A 2RG4A 3MIGA 3AK0A 4R9CA 3WCSA 5HV4A 2WNUB 4JGZA 4J6GA 1D4M1 1J1TA 3T09A 2BGPA 2DTYA 2PTMA 3W5NA 3NV1A 4RS5C 4XXAA 1AR72 1UW8A 2NQYA 4B3NA 3WF3A 4JZRA 3R05A 4NAOA 3WP4A 5CFDC 2JDKA 3N35A 1UMIA 4G4FA 4D6RA 2JB4A 3DECA 2ATFA 4W6XA 3B93A 5F2WA 3ZKYA 1ENXA 3FFZA 3LSEA 1FMD2 1R081 1RHI3 4AXOA 5J7MA 1LR5A 1CAXA 1WMFA 2AH2A 2C5DA 4NOTA 5LA2A 2FQPA 1DQ5A 4KNCA 4E2GA 1O3TA 4Y20B 1ZX5A 3NWKA 1GLHA 3LGRA 3ZFFB 3ZXLA 3HEIA 3WX5A 3FLRA 1VIWB 4NIAA 4RGGA 5T5LA 4XUNA 1S1AA 2DVDA 4RGAA 3USUA 3ZYHA 5A70A 1AR63 1ODNA 2DVBA 4IV1B 2VQUA 5HXMA 1LGCA 2I07B 1GWMA 1TE1B 3IT8A 4LBQB 1C28A 2XJSA 3H7YA 2EA7A 3OYWB 2XVKA 5GM0A 1HN1A 4GD4A 1HB2A 3O1TA 4D69A 5FPZA 4LBLA 3JB4C 4YFZA 1RMU3 1S2EA 4NPMA 2VTXA 1KD7A 2SLIA 4CP2A 2XJTA 3T0DA 4AQ2A 3R4DB 1SLAA 2CGNA 2WN2A 4Y5SA 5FPVA 2ZZJA 3TEXA 1NE6A 4WZCA 1GZWB 2P4EA 4K8RB 3NNMA 2WT1A 1CJDA 1Y9QA 4HANA 4UI9L 3JD71 1V6LA 4YSFA 5AC91 4FPHA 3WT3A 3AP4A 4CCLA 2X5IA 4MGQA 1JW6A 2QQLA 2ZX0A 1W8OA 3SITA 4QX8A 3A22A 5CVRA 1E5HA 2BERA 1XBFA 3T0AA 5A6YA 2WR9A 1PO21 1CGPA 1W9TA 1CWPA 3N9NA 4DUVA 1K5JA 3UYJA 1XPWA 2GALA 3NKGA 2Q1ZB 1W39A 4RGKA 3P6BA 3C7EA 3OJBA 3VZLA 5A1LA 5EIYB 5LA1A 1OC1A 1XU1A 2PFWA 1ENRA 3J9SA 1A6CA 1FNYA 2HWB1 4MH0E 3W5MA 1D4M2 1UAIA 3QACA 1IHMA 1YYNA 5FYHA 5DDJ3 5GLUA 2XXZA 2HWC1 4Q4W1 1JBCA 4YPJA 3TNPB 3KHCA 3PUHA 1CPMA 2H6BA 2W1SA 3ZYRA 4Q27A 4QKFA 3WEZA 1SDWA 1SFNA 4YRDA 3CNAA 2VZQA 5FY4A 3VL8A 3AJYA 5FZKA 1DYOA 2OVUA 3IM0A 4FPKA 4X8NA 3CDZB 2SBAA 5LBBA 2XQRA 5EV7A 1ZRCA 1OHFA 4EWDA 2QQMA 5CIRA 2DBNA 2VQ0A 2DUOA 3A7QA 1ZBE2 5FYUA 2Q8CA 4KBBA 1V9U3 4L99A 4CU6A 4RYDA 4NPRA 1ND2C 3NMBA 4AQSA 1QH6A 3NAPA 3CLPA 4E27A 5FZ9A 4H55A 4ASKA 2PLV3 3SH3A 3K4DA 3M3IA 3LPFA 5J1XA 5C3QA 5KHJA 4LKEA 5BNPC 1PK6C 5HCAA 3IIAA 2D3PA 4BWOA 4QPGC 4CPBA 4TN7A 5LWBA 1QNWA 1FPN3 1EV13 3WNMA 2XKOA 3C7HA 1ALYA 5A7OA 3VBHC 4TSVA 3RZMA 3DCQA 3LWCA 1O3RA 4CUBA 3NNJA 5JZGB 4XZUG 2ZGUA 1REEA 3AYDA 1RUF1 3HQRA 1ZZ8A 1PMIA 2B7YA 1O5LA 1X7NA 4LO8A 2WINB 4N53C 1N3QA 1N3PA 3RZZA 3WINE 3KT4A 4KWLA 3TRSB 1WMEA 5DN2A 2A6YA 2DCKA 1GOFA 3LEKA 5FYMA 4LEJA 1ULOA 1GQPA 5GLVA 5IVYA 4IW3A 5AC92 3JD72 1HB4A 4PF1A 1RUG3 3ATGA 4ZXEA 5JCTA 1BMV1 1Q43A 4A44A 2WIIB 3BOWA 1UX7A 1PX4A 1UPSA 2ZZQA 1H8TA 1OVPA 4MGTA 2CYFA 3CJXA 1VRBA 2BDRA 2BU9A 4L9BA 5KC5A 2J1UA 4I2OA 4NROA 2J1VA 1I1EA 3NJXA 2ZEYA 2OA2A 3AKQA 4O61A 3GALA 3J7NA 4UBGA 5I8SA 2Q0AA 4NIIA 3B5LB 5A1FA 3CJIC 4LBKA 3O0VA 3RYPA 1C5HA 1KJLA 1SLTA 2VOKA 4PCRA 2WNUA 2XBO1 5FZMA 1US2A 5FY5A 2G9ZA 1GWKA 3PUAA 2HWB2 4UW6A 5D8AA 3VLBB 4AHXA 2VMDA 2IXHA 3O1MA 2ZX3A 2HWC2 4Q4W2 3AP7A 4FPEA 2BQPA 4EV0A 1XNKA 3H8XA 1RUOA 4H14A 5BNPB 3ZN4A 3T2QA 4AWDA 1YQ5A 2WNVB 4QPGB 2BBVA 1JN2P 2DCTA 1EUUA 1X9TA 2GN3A 4X6QB 4IERA 4YM2A 3RSJA 3SCFA 1BCXA 2D6KA 1WCKA 4P9WA 2QFEA 4HZFA 1TVGA 3VBHB 4CE8A 1GMMA 1KDMA 1R091 3MLKA 5KHHA 2B42B 4W4ZA 3CZJA 4D8MA 1JYXA 4Y20A 4L0PA 4P08A 3ZFFA 4N53B 2FZ1A 4BPZA 5CADA 3LB9A 3QLQA 3T08A 2EXHA 2FBEA 5C9AC 3IMNA 1BXHA 1N47A 4IV1A 3HBZA 1YIFA 4LBQA 2OPKA 4WM7C 2WFF1 3OYWA 4UYBA 1N1VA 3AYEA 1SZBA 2E26A 1Q8OA 1GKBA 3I2KA 1AXKA 2ZS6B 5FY1A 2AR6A 5J96B 4MYEA 1RUF2 1RUE1 2CHHA 2EIEA 1W6QB 4LOTA 4Q4V3 3E5UA 4QX5A 5I0TA 3ZXEA 4PF5A 2YZ4A 4V2VA 3ZR6A 1DLCA 4CDXC 5HBAA 2VL4A 3CJIB 1GZWA 1B09A 3AYCA 4FO9A 4RHV1 3GJAA 2CDOA 4R4XA 4BQ3A 1YFWA 4NRPA 5JMOA 2WLQA 4XBNA 4BE3A 4UBHA 1JYCA 4A6SA 1OI6A 3SEPA 1BMV2 2P17A 2W92A 3ZFGC 3G6JB 1Q3EA 4CDWB 1E5SA 1DP0A 2K46A 4V1PA 1PZ7A 1J58A 2R16A 3JBG1 5BNOB 1FOD1 2AUYA 2D6MA 1QJX1 1YUDA 5G04L 4A45A 1VB4A 1YFYA 1X36A 2RR13 4QB1A 3ZN6B 4XYXA 3QH6A 3CU7A 4AW7A 2XBO2 4ATEA 1HV1A 1NA1B 1VRH1 3OBTA 2R063 3KM5A 1C8M1 1DIWA 5KWRA 4GALA 4LE4A 3EJKA 4NIHA 4OHZA 3O7OA 4Q8LA 4AFBA 3VBFC 4M0HA 5C9AB 1PZ8A 1UU6A 4XUPA 2VUDA 4MHUA 2BFUS 1UMZA 2BNNA 4K6BA 3LCPA 2BOIA 4UFIA 3V0BB 3PUSA 5BPXA 1I5ZA 1WLDA 4HOOA 5HV0A 4ZS3A 5DUUA 5FY9A 2ZCWA 2R0FA 1OUXA 2HWD1 2E51A 4NO4A 1POQA 3AMQA 2PELA 2VZRA 3T3YA 2XVLA 5EYXA 2HBTA 3VKNA 1R092 2IXJA 2E6VA 2QQWA 4FXKB 5A3WA 4R9BA 2Z42A 4CCKA 2JIJA 2ZBJA 3LKJA 4OZOA 4A41A 1DU3D 1GNZA 4LULA 5J98B 1J59A 1OOPB 1VAKA 4RFT0 2HKXA 2UYBA 3URFA 2K0GA 1BK0A 4LUKA 1KJRA 5L36A 2WFF2 1JHNA 2RS32 1MS8A 4LK6A 2W9XA 5T5OA 5JZGA 4Z2AA 5FXWA 2WZEA 1V6OA 4R8HA 4XILA 4GA9A 2R6QA 4KGQA 3LA3A 1RUJ3 3RI8A 3MIFA 4I02A 1RUE2 3E6DA 1AX2A 1KXGA 1ZZ7A 3DV8A 2GNTA 2ZXQA 1VAVA 3FMGA 2E32A 4RHV2 1N1TA 4JV4A 3P1IA 3VBSC 3JB8A 4SBVA 4HPKB 4O9GA 5FY7A 1ASJ3 2XKPA 2HBUA 3FN9A 4BK4A 1K42A 5FYYA 1A3KA 3POGA 4QU1A 5FZ1A 1UKRA 3VBFB 5ABJB 1U5ZA 3AM2A 1VBE1 2DFCA 1HXS3 3I2FA 4GWNA 1PIV3 1PGW1 2WBKA 4Q0SA 1SCSA 2AEYA 5CU1A 1UQXA 4CTEA 1RUI1 3I59B 1G9CA 1SBFA 1GP4A 3ACFA 3JBG2 3J8F1 4NUBA 3ZXGA 1QJX2 5LY1A 4Z1VA 2BFUL 5L7OC 2Z79A 3PNAA 4LQRA 4XF9A 1HB1A 1BBT1 1YFXA 4EZ4A 4I0WB 3OEBA 5GZFA 4XF0A 1DGWX 2YC2A 5CKMA 1ENQA 3UGHA 4YFWA 4UXAA 3SQOA 5KHIA 1VRH2 5E8AA 4BIFA 4B4RA 1AX1A 2QQKA 1MPXA 3WDUA 1V0AA 2ZX4A 1CD3G 2OX0A 3C8XA 4BH9A 1W8HA 2X09A 3V56A 2V09A 3WG3A 3X29B 3N7LA 4N90A 5BNPA 1ND3C 4YM3A 2WNVA 4HETA 4QPGA 5FBJA 1W8FA 1AVBA 5A32B 3H8RA 4UT5A 3RWKX 4QWNA 4XJZA 1U0AA 2HWD2 1R64A 5F2SA 1AYM3 4RR3C 1V6NA 1PZ9A 2XHNA 3O1OA 4IE0A 2ZGOA 1D2QA 5I0SA 4N53A 1WLWA 1REDA 2VZSA 4MADA 5IVJA 2CU5A 5A3TA 1WMXA 4O7XA 3O0WA 4Q4X1 1K12A 1ZZBA 1LEDA 3JZVA 3POFA 4URAA 1W2OA 2XL9A 1EAH3 1BKZA 1Q8VA 2JG8C 3VHNA 2WZPP 5L73A 2GAUA 3KV5A 4AG4A 2NYYA 4XURA 2UWAA 4QMAA 4Z2WA 2AACA 5JSPA 3CQOA 3IIIA 1R1A1 1NX9A 4FPFA 3ZSJA 1AL21 2LROA 5H9RA 3KV4A 2E7TA 1CN1A 3DL3A 4KBZA 1W6QA 4LKDA 1VBD1 4CSWA 4BQ1A 2VUCA 3K51A 4RA0A 1WW5A 4YZ1A 1V70A 5L7OB 3FX3A 2A73B 2ZHMA 4GB33 5FZGA 5F5CA 1AYN1 2X10A 4CEWC 4NAMA 1WCUA 3V0AB 5F39A 3D5OA 4ISRA 4FI9A 4AVSA 1RJ7A 3ZVXA 5C70A 5JPNB 5FLJA 4CDWA 5GZCA 4FP2A 5KR7A 1LOGA 3HBKA 1RUNA 1NLSA 4AEKA 1VBE2 5DMYA 1PGW2 1NLRA 3SCHA 5BNOA 3VDBA 5FPXA 3ZN5A 3KB5A 2NPIA 1RUI2 4OHXA 1RC6A 1EPWA 2QQIA 4GH4B 5ISLA 4PI2A 2AC1A 1OPOA 4BLJA 3FFQA 2RM23 5CG8A 1LULA 1TG7A 2R043 2ZHKA 2JB8A 5H9QA 1BBT2 1MS1A 2P3YA 1ZRFA 2VVFA 3M4FA 3T30A 4DFSA 1NA1A 1FV3A 1C4RA 5FOJB 1RUC1 2A7AA 2FCVA 3PVNA 5DG1A 3VGIA 2W87A 4META 4Q0VA 5C9AA 5DPNA 1QQP3 4C90A 4OCTA 5CAZA 1QJZA 2GZWA 3BPZA 4U2AA 1W05A 3WNKA 5A3OA 1RHI1 1VBB2 2ZGTA 2VGDA 4D7YA 3V0BA 1WWYA 2EXIA 2JG8B 3ZOIA 1T2XA 1LOFC 4PI0A 4XC9A 3BIEA 1NT0A 2VM9A 3WP5A 2VW2A 2MEV1 2PAKA 2Y38A 3T4VA 4KH9A 4N7IA 3ZDSA 3VUOA 5T50A 2GU9A 1BEV1 1H6XA 3VBOB 1JOBA 1HRI2 4DZGA 2OQ6A 2WN3A 3RJ2X 4YW3A 4ARYA 4YYOA 3T2TA 2I74A 5JVVA 3WXPA 1WBLA 4AFAA 3H3UA 4GMP3 1YI7A 3ECQA 1OOPA 3KQ4B 5A6ZA 2L9LA 1UU4A 4Y1VA 3WOGA 1KS4A 3F2ZA 4Q4X2 3ABZA 4B29A 2FDGA 1WKYA 3BUCA 4HK9A 3FUQA 4XPVA 2ZGPA 2BUKA 2YPDA 3WF2A 1LHOA 3MGUA 5A3UA 1HRV3 1RMU1 5F32A 1OXCA 4XABA 4YVSC 1ZRRA 3TYJA 4Z82A 2FCTA 2ZGKA 5IVBA 2DUPA 4XBQA 4HN1A 1AL22 1NG0A 3A21A 3THDA 4R9DA 3UJQA 2KA3A 2P3JA 3O1SA 1M06G 1UOGA 2RS51 3LEMA 1OA4A 1VBD2 2DDUA 3A0NA 3VN4A 5CA6A 5CFCC 4Q1PA 1AYN2 3RG0A 1PVC3 3SH5A 1KFXL 4E4HA 4ZZ8A 1UMHA 5IK5A 3RMXA 3TEWA 3I8TA 1DQ1A 2IXCA 4XDQA 1WD4A 2XLGA 2PAEA 1J3QA 4D3WA 4B7EA 2RS13 1UZYA 3VBFA 3SHRA 5ABJA 3GCXA 4KG8A 1W8WA 4S2HA 1BZWA 4AFCA 4DXSA 1YC61 2PYTA 4TZDA 2XJPA 4XJAA 3THTA 1W9WA 4AK3A 2BZDA 2HLEA 3OGVA 4GIQA 4IUGA 4LO5B 1QOTA 1SLBA 1A8DA 2QZ3A 4CEYC 4BXSV 5LK5A 4A7YA 5FWEA 2WABA 1SLIA 1V6MA 4Z92B 2I45A 5SV8A 2A75A 5LRRA 2XWJB 4LE3A 3WW2A 4C0HA 2WKKA 1IKPA 4PBPA 1WCDJ 1Y9MA 5BYNA 2DURA 5JI9A 2XL7A 2DTWA 2WO2A 1RUC2 5FO8B 1VBC1 4KMQA 3FBYA 3C7OA 4Q0UA 3ZPOA 2D6OX 1KEXA 2C0ZA 3M3EA 3D3AA 4JDNA 1RHI2 2DWRA 1VBA3 1POV0 5A32A 1W0OA 4ZHNA 4XJUA 2GN7A 2VZOA 5LASA 4J25A 4XVHA 1V9U1 5K0UB 2MEV2 3PHMA 1CAUB 4L92A 5AVAA 4Y1UA 5FZ3A 1BEV2 5JXJA 3N7JA 5C8CC 1VLNA 5FP8A 4YZ3A 5FBZA 3TN93 1U5IA 4FXGB 3AZYA 2PLV1 1JZ3A 2WS93 4IE4A 1HX6A 3WQBA 2WZ8A 4A6OA 4OUSA 5A6XA 3JQXA 3H7JA 2XB6C 5ERLA 3ZYIB 5CFCB 1FPN1 1EV11 5B4NA 2B4KA 4UW3A 3USSA 2VC9A 4ISQA 4NHKA 4AQTA 2CSGA 3K3NA 3DPRC 3POBA 4LHKA 2TEPA 4OMDA 5A7PA 1W6PB 4PQ9A 1JZ6A 2J42A 3TNQA 4MGKE 1RMU2 3PMSA 4CUCA 3HT2A 5JSOA 3C2UA 3UESA 3P3NA 5T5JA 4MVTA 3WW3A 4DINB 3TWIA 3VZNA 5L7OA 3LEIA 4FFFA 2UURA 4CEYB 4QX0A 2RS52 3ALQA 1W6NB 3GBGA 3Q8FA 4CXWA 4IEXA 3WNNA 5ACA1 2GP5A 1MVQA 5A33B 3V0AA 5JPMB 4AI1A 1BQPA 4EZHA 2CNAA 5A1AA 2W52A 2OXBA 3HMYA 4IEQA 5T3NA 3PUIA 4M3CE 3UL2A 5FREA 2WLPA 2WSVA 3WW4A 3U4XA 1NAEA 1COV1 3MLJA 2ZMKA 4PLMA 2D5FA 2KR2A 4GH4A 2Y6KA 3LF7A 3VD7A 2YBSA 1H2NA 1CR7A 5FMBA 2J22A 4QPWA 1WMDA 4FSJA 2Y26A 2R073 1AR83 3ACLA 5LATA 2RDSA 1SFPA 2ZX2A 4WM8C 1VBC2 3M3OA 3JUUA 4GJYA 1O8SA 1W03A 5C3OA 1AX0A 3AVSA 3LA2A 2OYZA 4EN0A 3HR9A 3RRDA 1IPJA 3I7DA 1K45A 2JG8A 5D21A 3LPGA 2R7EB 2R32A 3BALA 3RMYA 4COUA 5K9YA 1UL9A 3DPRB 4NWWA 4JDMA 1H8VA 3U78A 4BISA 3WNLA 3B01A 4IL7A 2CL2A 3NRUA 3VBOA 2IFWA 3MW4A 4A4AA 4D7TA 5J09A 4JGYC 3WSOA 1S0CA 3AZZA 3ST7A 2XJQA 4KGGA 5EXOA 3ZSLA 3ZYGA 1JZ5A 1Y4WA 4E4SA 4EROA 1MZFA 1K3IA 5LBEA 4BZ4A 3Q8BA 4NE9A 1EV12 1L7LA 2V72A 4C8DA 1Z7S1 4YNIA 3IWZA 1OH4A 4CDQB 4OFGA 5J3UA 3HQXA 2VNRA 2VULA 4W8JA 1ZBA1 1UU5A 1O3SA 1PMJX 2IZWA 4W65A 1J3PA 3H42B 3KCCA 5FQ0B 3J7HA 1D7PM 2C24A 1CPNA 4HSJA 1GFF2 4MHRA 2PHLA 1Q5OA 2RV9A 5FO7B 2OKXA 4IV3C 3IB3A 4LHLA 2GC1A 1WZXA 4K21A 5FRAA 5ACA2 3VZJA 4WM8B 1C3HA 3T0BA 3WHTA 4HONA 2WWJA 5GLZA 3N3HA 1YXWA 2XMLA 4IGQA 3B94A 5IW0A 2RR11 4ONUA 3WUDA 1W8NA 2XOMA 4MSVA 1LOFA 3KCYA 4COWA 3C7FA 2ARXA 2H0VA 1COV2 3IDCB 4WBBA 3UJOA 2XUEA 5A3MA 2WQ4A 2IC1A 2JDNA 3OUJA 1FXZA 1QJY3 2W95A 4YWAA 2PA7A 4RS5B 4JGYB 1TQ5A 5F7UA 1YI9A 1NCRC 1QXPA 3IBMA 1RXFA 4BOWA 3GBWA 4CU8A 5CFDB 5KXBA 1ODMA 4TLGA 2QJVA 4B4QA 4LA2A 4KI5M 4COVA 2EAAA 1L7RA 5FYCA 2DYCA 5CBLA 4ZU7A 4QDRA 3GM8A 4GXLA 4QB6A 3VZOA 2PQQA 1NY71 2EALA 2W1QA 5FK8A 4QX2A 1KITA 5CKNA 3IKWA 4TYSA 4LITA 4P00B 3PMEA 4R52A 2B9UA 1RVF3 5K0UA 2HEWF 3W59A 5J37A 1CAUA 4B8EA 1U5YA 1PVXA 4NWVA 1AR93 2QVSB 2YFUA 2RJ2A 3WUCA 4AGRA 3PVBB 2V4VA 3RZKA 3SKVA 4XE9A 2WA3A 1IS4A 1Y9GA 1S0IA 4COZA 5CFCA 4FPYA 5CB7A 3GCWA 2YGLA 1WD3A 2HYXA 2PQSA 4UW5A 4DB5A 1R082 1LB2A 4XZPA 2XJUA 4OI1A 2VZ1A 1Z7S2 3SEEA 1SHWB 4AGGA 2VMIA 2VCAA 3E6CC 4LTAA 2CAVA 2HWE3 2VUJA 5FWJA 4DEVA 1YQCA 2JD4A 5JOWA 1MVEA 1RUJ1 2YROA 4YGDA 1OF4A 4EQVA 1F9KA 3WLUA 3WQ1A 4QD2A 2CWSA 2QTWB 1ZBA2 4EWEA 4JRAA 4DUXA 3ASIA 3LFIA 3AZVA 3OTFA 1GICA 2J1EA 2C9AA 4QHBA 4ARXA 3CL1A 2QZ2A 4ES8A 4M3CF 1W6NA 1VP6A 3VDDC 1DZRA 1B35C 3I3DA 2ERFA 3GJBA 3MIEA 5LA9A 4CUGA 1NCRB 3ZYPA 5A33A 4PDWC 1GZTA 1MS0A 1Y43B 2ZAHA 4IGPA 4N7UA 3IMMA 2KXLA 4UOJA 1AR73 5JOZA 4OHWA 2PAMA 4GJZA 2J1TA 2RR12 4RFRB 4MLOA 1LKNA 2ZGSA 3KF3A 3DKWA 1AJOA 4Y3OA 1Y3TA 3I3EA 4KQ7A 3H3ZA 5E89A 1ENSA 5FZFA 2WRAA 4C1XA 1FMD3 5LK7B 2VNGA 1ULCA 4XACA 2EVXA 2VZ3A 2WL1A 4LUMA 2HWF3 4QKNA 3LZZA 1LODA 3OY8B 2VTXJ 4XCAA 3WG2A 1DCSA 3PTYA 4LT5A 4PJYA 1JU3A 4P9LA 1T6BX 4FTSA 2VG9A 4ZU4A 2LTNA 2WNOA 4IEVA 1PO22 2EIBA 4J1WA 4BM8A 4CDUA 2D6PA 2RE9A 3O1VA 1BYHA 1LOEA 2F4LA 3U0ZA 1AYM1 1H9WA 1OA3A 1W3VA 3DPRA 5F8PA 1ZZ9A 1F2NA 1Z0HA 2W2IA 4AHZA 4TLFA 5GJ6A 1W9SA 4N43C 2EAKA 1WUVA 4COYA 3OG2A 2QQPA 4OZXA 5EJZB 1ND2B 1O7FA 2XJRA 5JWPA 5F3IA 3RFRA 2JE8A 2E31A 3S5QA 3WCRA 2NMNA 3HNBM 4BMEA 1WGPA 1O4ZA 4LA3A 1EAH1 1ZZ6A 4OHVA 2YY1A 4FAHA 4Q2FA 1PK6B 1W2TA 2X8KA 3MW3A 1LHUA 1FX5A 2JECA 5FMCA 5FO9B 3VBUC 2IUWA 2YXSA 1X50A 5JXIA 1HJFA 2DVGA 1RYYA 2Q5TA 5J48A 1NZIA 3LIGA 4QPYA 1G9FA 1AL0G 1UXXX 4CDQA 3LA7A 4OLLA 3OGJA 4ZKTB 3CF6E 1UYYA 2ZKNA 1G8WA 3G7DA 3H8UA 5FP7A 2K2SA 1QDOA 1RUJ2 3AFKA 3B00A 3MHZA 4NIDA 3HWJA 1MQTC 4QQLA 3TBDA 2Q1MA 3ZO0B 1L7QA 3DYPA 4GB31 4QHOA 5A3PA 1ULEA 4XHXA 1JYNA 5FYIA 5FQ0A 5FZCA 3EMRA 1BHGA 4YW4A 2H0BA 3RZJA 5EQUA 5T54A 2JJ6A 2WAAA 2YGMA 2H6CA 2VQTA 1IS6A 1C1FA 2W3JA 3POYA 3WV6A 4P5HA 4X6RB 3K46A 4W50A 5CNAA 3OCPA 1D4M3 3KLSA 4W6WA 4QGMA 3VV1A 4QDSA 4WVMB 1W2NA 4LKSA 2Q8EA 1VAMA 3RS6A 2XLFA 1F8VA 1O4YA 1TME1 2R041 4UAPA 3R6SA 1RINA 4BQYA 4G9SB 3T1MA 2GNBA 5C33A 4N43B 3U14A 4QPIC 2W94A 3D0JA 1QGLA 4JGYA 4RS5A 1CJPA 1H2MA 1OSGA 3NV4A 4XFIA 1RL3A 2AZ5A 1QQP1 2JDAA 2NLRA 1XXNA 3I4IA 2JIGA 2BNMA 4XFAA 4B7KA 2J1SA 5CFDA 4E8CA 3KCXA 2VOVA 1ZBE3 4XHBA 2RMU1 5GZGA 5JOXA 2QCSB 4IDZA 4AYUA 4FPGA 1OLME 2WZR3 3UKNA 1HIXA 3BU7A 2QQOA 4JAAA 4QGLA 1AUYA 4DXZA 1AYM2 5DAXA 5FYZA 4BQ5A 4NHXA 1JH5A 4JX0A 3VDAA 5J36A 1K5MC 2JEMA 3D8CA 1VJ2A 5E88A 4CCEA 1JXNA 4UFMA 3HOBA 4W6YA 4Q8KA 3WDVA 1MQTB 4AOCA 1AXYA 3KMHA 2WYSA 4A7KA 1QJU1 2RJLA 3AJZA 4XW3A 1W04A 1VE0A 3N9MA 3H8OA 2GNMA 1HV0A 4GWMA 1TNRA 2ZABA 4MGYE 4XJ9A 2VOXA 3AXEA 1D2SA 1EAH2 1RUD3 1YJKA 1XB9A 2GSYA 2WAOA 3BIWE 3C7GA 4QDQA 4WM7B 4MXVA 1H1MA 2F6BA 2WT2A 3BN6A 3OD4A 2VW1A 4CPBD 3VD3A 5IK7A 5HPOA 3N7KA 1T6GC 1MEC1 5FR3A 3WP6A 3JD73 5F3EA 3I3MA 2IWGB 5FOBB 2MNGA 1G86A 4CUAA 2DBIA 5KBFA 4LIUA 4CDXB 2BYVE 4BA6A 4RN5A 4GB32 1UNBA 2CY6A 3AC0A 4NPLA 1PVC1 3VKLA 4LLFA 5KXDA 4IEWA 2ZPXA 2ET7A 1W0NA 3CMGA 4QPIB 4QXCA 5ANQA 1RITA 4LHSA 4MX3A 2N7GA 1XNAA 1UF2C 2RS11 1NCRA 3ZFGB 1E5RA 4XFBA 2VQAA 1XOYA 3HN1A 4RSUA 3AMHA 1WLTA 1UOFA 2JG9C 4JHZA 1W3XA 4FVVA 2IFRA 2D3SA 2HWB3 4QXBA 5F5IA 3DGTA 4NMIA 4BCUA 4S2GA 1NOVA 3FLPA 5ANNA 1D4VB 1IQAA 1FAYA 2JENA 3GXUA 5A7WB 3EBRA 1GQHA 4F83A 5IFPA 4EN8B 1TME2 2R042 5CISA 4BLIA 2P6HA 2YC0A 5BNNC 1K5MB 2HH9A 3R4UA 2RHPA 1NCQC 2IXLA 3S6PA 4NR1A 2CWMA 2FHRA 2ZEZA 3OY8A 4NHLA 3SKJE 4AHWA 3PU3A 1QQP2 4YGCA 4QX7A 1GP5A 3K48A 5T52A 2VPVA 4YW1A 5FZAA 4LK7A 2RMU2 4XFGA 1VBA1 3PVEA 1UPIA 1UOJA 1FOD2 5GALA 5EJ3A 1YQ8A 4YW2A 1I6XA 1WBFA 1UY1A 3N9LA 2DUQA 4FCAA 5CG9A 4HKWA 2NP0A 2WFPA 3OSDA 3MF6A 2Q4SA 1UY0A 2ET1A 2QE3A 2Z4FA 4KU7A 2EICA 4DO0A 3TN91 4DOUA 3I49A 3KD4A 2WS91 4MUVA 1ND2A 1C8M2 1UY2A 3N36A 5D2AA 5LA0A 5TSWA 2D5HA 1J84A 2E53A 4BQ2A 3POJA 1QJU2 1GSLA 2WQ8A 3FE5A 4AEMA 1PK6A 4HFSA 1RUF3 1YNAA 4LORA 2BPA2 5FAXA 2ZOEB 2VBPA 4IESA 1QOOA 1IG0A 1GQGA 2P6CA 2V73A 3QH7A 3WDYA 5FZBA 3VBHA 1W06A 1UZ0A 1Q8PA 3PDQA 1ZM1A 2JG9B 4FOVA 1MEC2 3AKPA 4Q1RA 5DAQA 3MDPA 4AEDC 3OB8A 4MXWB 3T1LA 3WQ7A 2YC4A 3L2HA 4WZFA 1QXJA 1DBNA 1MS5A 2FCUA 1XE0A 3VD5A 2A3WA 4YGBA 5JMCA 3RPQA 4CA9A 2PXJA 4ZONA 3VBSB 1LOAA 4K1YA 1MZ6A 3HAGA 2OS2A 4FOWA 2GP3A 1OF3A 4OI2A 3ZXFA 1AZDA 3T2PA 3ZXJA 4A3ZA 5HI0A 1G9DA 3B9CA 3VZMA 1WW7A 1QU0A 3NSTA 4MGIE 5KXEA 5GZDA 2RS12 4RQPC 1JUHA 3I2DA 3WQ0A 2ADDA 5B2GB 1OQ1A 1WCQA 2XBO3 2WYFA 3ES1A 2E63A 1ZRDA 1BVP1 1PM4A 4FQZA 4CXYA 4WVMA 4YVWC 5C3PA 2B46X 3CJIA 1DQ6A 4Y26A 1VMHA 1LNSA 3K3OA 4LOSA 4OHYA 4Y22B 4OI0A 2P34A 3KGLA 3M8LA 3J7MA 4QQOA 3FLTA 3OPTA 1S0BA 3R0RA 4FAGA 2TUNA 4IETA 2VXRA 1AR81 4K1ZA 2W1UA 1SLLA 2Y0IA 3INAA 3ZSMA 4XF4A 5HCHA 2VOTA 3J26N 4JGZC 4XJ8A 5FJKA 4YARA 1TMF1 2DVFA 2Q30A 2D40A 1YCIA 1LU2A 3WR0A 2A3XA 1NZCA 4LBMA 5I93A 4XDPA 1ND3B 4BJ0A 1G6NA 1DZQA 4I0AA 4CU9A 1H4HA 1N1SA 1QIQA 2NN8A 3APBA 3GZAA 4XQ4A 3S5AA 5FKCA 4A2UA 3J8F2 5BXXA 1RUH3 1UO9A 2E33A 3ZN6A 4B1MA 3W20A 4RR3B 3ZX7A 2C9KA 2VMHA 3R4SA 1HQNA 4XQDA 1EYBA 5DXDA 4Z8BA 2GNDA 3U37A 3TN92 2WFF3 4AEDB 2RS33 4DRRA 5IVCA 1JZ2A 3U10A 5CYYA 4XIOA 1STMA 3EQEA 1URXA 3BGAA 5IHRA 3ZR5A 2WO3A 1UY4A 4ZY9A
chains in the Genus database with same CATH topology
1NAEA 3K4DA 3LPFA 5J1XA 4PT6A 2Y6KA 1EUTA 3K4ZA 1UXZA 3I3BA 4M4PA 3VD7A 2J22A 3WNMA 5DQ0A 4QPWA 3C7HA 3I2GA 2BGOA 4CUBA 4XZUG 5JXHA 2VCCA 1CZTA 2Y6LA 2X05A 1O8SA 5DN2A 2DCKA 1K45A 1GOFA 2R7EB 3LPGA 3LEKA 1ULOA 1GQPA 4PQQA 1F4HA 4QX3A 3WNLA 4PF1A 3LEGA 4ZXEA 4A4AA 3NRUA 4A44A 1UX7A 1PX4A 3WSOA 3MO4A 2J1UA 2BBAA 3ZM8A 2J1VA 1JZ5A 3NJXA 3K75B 1K3IA 2ZEYA 2W5FA 3WF1A 4TXWA 4DXRA 1UY3A 2V72A 3OGRA 4GWIA 1US2A 1OH4A 2YB7A 4W8JA 2VMDA 2VMEA 4AAXA 1PMJX 3I2IA 4CU8A 3J7HA 1D7PM 1US3A 3T2QA 1EUUA 2RV9A 2OKXA 1TVGA 3WF4A 1GMMA 3IB3A 1JYXA 4W4ZA 4D8MA 3CZJA 4QAWA 4L0PA 4P08A 3FHQA 3T0BA 3UNPA 3T08A 1GOHA 2VTFA 1W8NA 2XOMA 3C7FA 2W95A 3HNYM 4MOAA 5F7UA 2E26A 3I2KA 1CX1A 3I97A 3UETA 2WDBA 4KI5M 2EIEA 4HG6B 1L7RA 2Y6JA 1DLCA 2VL4A 5JUVA 2W46A 4XUQA 4QDRA 3GM8A 3NJVA 2CDOA 3DYOA 4QB6A 2W1QA 4MO3M 4QX2A 5JMOA 4P00B 1OT5A 5G05L 3SEPA 2W92A 5FUIA 2LS6A 2VZUA 1DP0A 2YFUA 2RJ2A 3I2JA 1IQDC 2V4VA 3MV11 3I2HA 3LE0A 4JKMA 3SKVA 2DCJA 2YFZA 4JKKA 4XUOA 5G04L 4A45A 4D0QA 2VMFA 2PQSA 2HYXA 4QB1A 1I5PA 5IFTA 3SEEA 2VZ1A 1SHWB 2J1RA 2VCAA 3ACIA 2VO5A 1W99A 4OUEA 4DEVA 1GUIA 1OF4A 1SG3A 2KD7A 1OD3A 1YQ2A 2Y8KA 4XUPA 4DUXA 2EIDA 2J1EA 4ARXA 4ZZ5A 1ULPA 2LW8A 3I3DA 5B4XA 2VZRA 1GOGA 4DXTA 4OZOA 4A41A 4UOJA 2VR4A 4A42A 2ORXA 3FHAA 2J1TA 3MV01 1UWWA 3I3EA 4P02B 4M4RA 2XQXA 2V5DA 1JHJA 2VZ3A 3CKHA 2W9XA 3GDBA 2ZEXA 2C4XA 4Z2AA 2WZEA 4KWUA 1JU3A 2EIBA 3HNMA 3T2OA 3HN3A 2ZXQA 2E32A 1JU4A 3P1IA 2VZPA 1W9SA 1PMHX 3WNOA 3FN9A 4BK4A 1K42A 3OG2A 3CZUA 3A23A 5EJZB 2B9VA 2JE8A 3I2FA 1UYXA 2E31A 3HNBM 2WBKA 2Y6HA 3OGSA 2VCBA 3ACFA 2C26A 5I0DA 4LQRA 3DYMA 5JR2A 5JXIA 1KGYA 1RYYA 3OEBA 5CZKA 4QX1A 1UXXX 2JD9A 2YC2A 1UYYA 5C7GA 4TTGA 2CDPA 3NNGA 2QQKA 1MPXA 3WF0A 1L7QA 3DYPA 3C8XA 1CZSA 1JYNA 2X09A 3MUY1 2W1WA 1BHGA 4BK5A 1JYWA 4OYUA 2WAAA 1R64A 2VQTA 3IDAA 2XHNA 2W3JA 4XUTA 2WUHA 3K46A 4W50A 3K77A 4MADA 2VZSA 3VD4A 3HPNA 4QDSA 4OMCA 4LKSA 2J1AA 1K12A 1JZ7A 4UAPA 4CVUA 4AG4A 4XURA 2QQNA 2W94A 3VDCA 3CQOA 1JZ4A 2JDAA 3IIIA 2WO1A 1NX9A 5IJRA 4E8CA 2VZTA 2J1SA 2Y64A 2QBXA 1XC6A 1O8PA 2QQOA 2X10A 4LPLA 4JX0A 3VDAA 3E1F1 2J7MA 4ET7A 4GZ9A 2VMCA 4FI9A 3HOBA 4P5YA 5C70A 1XNTA 2WYSA 1UYZA 5DMYA 1PX3A 3VDBA 3OBAA 3MUZ1 4QDQA 2RVAA 3C7GA 2WAOA 2QQIA 1P8JA 2W91A 4BDVB 1JI6A 1TG7A 3BN6A 3VD3A 5HPOA 3OEAA 5JXGA 3ACGA 5IYYA 2W87A 2W47A 4CUAA 1NUKA 2VJXA 3EYPA 5DPNA 1H6YA 3ETPA 4RN5A 3WNKA 3AC0A 1GNYA 1T2XA 1W0NA 3CMGA 3EB7A 2VM9A 3GGLA 4LHSA 1GU3A 1XNAA 3NQHA 1H6XA 1F4AA 4JHZA 2WN3A 4ARYA 1CZVA 1NKGA 3ECQA 4DEQA 2L9LA 3F2ZA 3GXUA 3ABZA 5IFPA 4CU7A 1WKYA 3WNPA 3LQCA 3THCA 3WF2A 5C71A 3K4AA 3T09A 3HJRA 2BGPA 3W5NA 2ZEZA 3SKJE 1CIYA 3WF3A 3A21A 3THDA 2VZVA 1UMIA 3DECA 2DDUA 1UY1A 1J83A 3VD9A 5LA2A 4ZZ8A 1UMHA 1UY0A 2Z4FA 2EICA 3IAQA 1UY2A 3HEIA 5LA0A 4DXSA 2Y6GA 1J84A 4XUNA 2WQ8A 1W9WA 2BZDA 2HLEA 5HXMA 3OGVA 2VQUA 4IUGA 4BXSV 2WABA 1UZ0A 1HN1A 2WO2A 3ACHA 4KMQA 5LCWL 1JZ8A 3OB8A 3C7OA 3JXSA 3T0DA 5EJ1B 2YC4A 3MBWA 2WN2A 3VD5A 1KEXA 1JYVA 3D3AA 4UI9L 4CU6A 1OF3A 4A3ZA 3T2PA 2VZOA 4XVHA 4MGQA 2QQLA 2YG0A 1W8OA 5JXJA 1WCQA 3A22A 2ORZA 4E8DA 2BERA 4GWJA 3T0AA 3FL7A 1JZ3A 3CIHA 3WQBA 4A6OA 2WZ8A 1W9TA 4DUVA 4JKLA 1XPWA 1LNSA 5B4NA 4MGSA 2B4KA 2VC9A 3C7EA 3P6BA 5EIYB 5LA1A 4OMDA 2W1UA 1JZ6A 3W5MA 2VOTA 4DUWA 4CUCA 2QQJA 3UESA 4YPJA 3PUHA 2W1SA 3WEZA 4BJ0A 4CU9A 3IAPA 2VZQA 3LEIA 4QX0A 1DYOA 2ID4A 2E33A 1SDDB 2XONA 3CDZB 4QB2A 2C9KA 3WNNA 2QQMA 3U37A 3A7QA 2ZEWA 1JZ2A 1O59A 5A1AA 4RYDA 2JKXA 5CYYA 5IHRA 3BGAA 3PUIA 2WO3A 1UY4A 4ZY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAE A;  3K4D A;  3LPF A;  5J1X A;  4PT6 A;  2Y6K A;  1EUT A;  3K4Z A;  1UXZ A;  3I3B A;  4M4P A;  3VD7 A;  2J22 A;  3WNM A;  5DQ0 A;  4QPW A;  3C7H A;  3I2G A;  2BGO A;  4CUB A;  4XZU G;  5JXH A;  2VCC A;  1CZT A;  2Y6L A;  2X05 A;  1O8S A;  5DN2 A;  2DCK A;  1K45 A;  1GOF A;  2R7E B;  3LPG A;  3LEK A;  1ULO A;  1GQP A;  4PQQ A;  1F4H A;  4QX3 A;  3WNL A;  4PF1 A;  3LEG A;  4ZXE A;  4A4A A;  3NRU A;  4A44 A;  1UX7 A;  1PX4 A;  3WSO A;  3MO4 A;  2J1U A;  2BBA A;  3ZM8 A;  2J1V A;  1JZ5 A;  3NJX A;  3K75 B;  1K3I A;  2ZEY A;  2W5F A;  3WF1 A;  4TXW A;  4DXR A;  1UY3 A;  2V72 A;  3OGR A;  4GWI A;  1US2 A;  1OH4 A;  2YB7 A;  4W8J A;  2VMD A;  2VME A;  4AAX A;  1PMJ X;  3I2I A;  4CU8 A;  3J7H A;  1D7P M;  1US3 A;  3T2Q A;  1EUU A;  2RV9 A;  2OKX A;  1TVG A;  3WF4 A;  1GMM A;  3IB3 A;  1JYX A;  4W4Z A;  4D8M A;  3CZJ A;  4QAW A;  4L0P A;  4P08 A;  3FHQ A;  3T0B A;  3UNP A;  3T08 A;  1GOH A;  2VTF A;  1W8N A;  2XOM A;  3C7F A;  2W95 A;  3HNY M;  4MOA A;  5F7U A;  2E26 A;  3I2K A;  1CX1 A;  3I97 A;  3UET A;  2WDB A;  4KI5 M;  2EIE A;  4HG6 B;  1L7R A;  2Y6J A;  1DLC A;  2VL4 A;  5JUV A;  2W46 A;  4XUQ A;  4QDR A;  3GM8 A;  3NJV A;  2CDO A;  3DYO A;  4QB6 A;  2W1Q A;  4MO3 M;  4QX2 A;  5JMO A;  4P00 B;  1OT5 A;  5G05 L;  3SEP A;  2W92 A;  5FUI A;  2LS6 A;  2VZU A;  1DP0 A;  2YFU A;  2RJ2 A;  3I2J A;  1IQD C;  2V4V A;  3MV1 1;  3I2H A;  3LE0 A;  4JKM A;  3SKV A;  2DCJ A;  2YFZ A;  4JKK A;  4XUO A;  5G04 L;  4A45 A;  4D0Q A;  2VMF A;  2PQS A;  2HYX A;  4QB1 A;  1I5P A;  5IFT A;  3SEE A;  2VZ1 A;  1SHW B;  2J1R A;  2VCA A;  3ACI A;  2VO5 A;  1W99 A;  4OUE A;  4DEV A;  1GUI A;  1OF4 A;  1SG3 A;  2KD7 A;  1OD3 A;  1YQ2 A;  2Y8K A;  4XUP A;  4DUX A;  2EID A;  2J1E A;  4ARX A;  4ZZ5 A;  1ULP A;  2LW8 A;  3I3D A;  5B4X A;  2VZR A;  1GOG A;  4DXT A;  4OZO A;  4A41 A;  4UOJ A;  2VR4 A;  4A42 A;  2ORX A;  3FHA A;  2J1T A;  3MV0 1;  1UWW A;  3I3E A;  4P02 B;  4M4R A;  2XQX A;  2V5D A;  1JHJ A;  2VZ3 A;  3CKH A;  2W9X A;  3GDB A;  2ZEX A;  2C4X A;  4Z2A A;  2WZE A;  4KWU A;  1JU3 A;  2EIB A;  3HNM A;  3T2O A;  3HN3 A;  2ZXQ A;  2E32 A;  1JU4 A;  3P1I A;  2VZP A;  1W9S A;  1PMH X;  3WNO A;  3FN9 A;  4BK4 A;  1K42 A;  3OG2 A;  3CZU A;  3A23 A;  5EJZ B;  2B9V A;  2JE8 A;  3I2F A;  1UYX A;  2E31 A;  3HNB M;  2WBK A;  2Y6H A;  3OGS A;  2VCB A;  3ACF A;  2C26 A;  5I0D A;  4LQR A;  3DYM A;  5JR2 A;  5JXI A;  1KGY A;  1RYY A;  3OEB A;  5CZK A;  4QX1 A;  1UXX X;  2JD9 A;  2YC2 A;  1UYY A;  5C7G A;  4TTG A;  2CDP A;  3NNG A;  2QQK A;  1MPX A;  3WF0 A;  1L7Q A;  3DYP A;  3C8X A;  1CZS A;  1JYN A;  2X09 A;  3MUY 1;  2W1W A;  1BHG A;  4BK5 A;  1JYW A;  4OYU A;  2WAA A;  1R64 A;  2VQT A;  3IDA A;  2XHN A;  2W3J A;  4XUT A;  2WUH A;  3K46 A;  4W50 A;  3K77 A;  4MAD A;  2VZS A;  3VD4 A;  3HPN A;  4QDS A;  4OMC A;  4LKS A;  2J1A A;  1K12 A;  1JZ7 A;  4UAP A;  4CVU A;  4AG4 A;  4XUR A;  2QQN A;  2W94 A;  3VDC A;  3CQO A;  1JZ4 A;  2JDA A;  3III A;  2WO1 A;  1NX9 A;  5IJR A;  4E8C A;  2VZT A;  2J1S A;  2Y64 A;  2QBX A;  1XC6 A;  1O8P A;  2QQO A;  2X10 A;  4LPL A;  4JX0 A;  3VDA A;  3E1F 1;  2J7M A;  4ET7 A;  4GZ9 A;  2VMC A;  4FI9 A;  3HOB A;  4P5Y A;  5C70 A;  1XNT A;  2WYS A;  1UYZ A;  5DMY A;  1PX3 A;  3VDB A;  3OBA A;  3MUZ 1;  4QDQ A;  2RVA A;  3C7G A;  2WAO A;  2QQI A;  1P8J A;  2W91 A;  4BDV B;  1JI6 A;  1TG7 A;  3BN6 A;  3VD3 A;  5HPO A;  3OEA A;  5JXG A;  3ACG A;  5IYY A;  2W87 A;  2W47 A;  4CUA A;  1NUK A;  2VJX A;  3EYP A;  5DPN A;  1H6Y A;  3ETP A;  4RN5 A;  3WNK A;  3AC0 A;  1GNY A;  1T2X A;  1W0N A;  3CMG A;  3EB7 A;  2VM9 A;  3GGL A;  4LHS A;  1GU3 A;  1XNA A;  3NQH A;  1H6X A;  1F4A A;  4JHZ A;  2WN3 A;  4ARY A;  1CZV A;  1NKG A;  3ECQ A;  4DEQ A;  2L9L A;  3F2Z A;  3GXU A;  3ABZ A;  5IFP A;  4CU7 A;  1WKY A;  3WNP A;  3LQC A;  3THC A;  3WF2 A;  5C71 A;  3K4A A;  3T09 A;  3HJR A;  2BGP A;  3W5N A;  2ZEZ A;  3SKJ E;  1CIY A;  3WF3 A;  3A21 A;  3THD A;  2VZV A;  1UMI A;  3DEC A;  2DDU A;  1UY1 A;  1J83 A;  3VD9 A;  5LA2 A;  4ZZ8 A;  1UMH A;  1UY0 A;  2Z4F A;  2EIC A;  3IAQ A;  1UY2 A;  3HEI A;  5LA0 A;  4DXS A;  2Y6G A;  1J84 A;  4XUN A;  2WQ8 A;  1W9W A;  2BZD A;  2HLE A;  5HXM A;  3OGV A;  2VQU A;  4IUG A;  4BXS V;  2WAB A;  1UZ0 A;  1HN1 A;  2WO2 A;  3ACH A;  4KMQ A;  5LCW L;  1JZ8 A;  3OB8 A;  3C7O A;  3JXS A;  3T0D A;  5EJ1 B;  2YC4 A;  3MBW A;  2WN2 A;  3VD5 A;  1KEX A;  1JYV A;  3D3A A;  4UI9 L;  4CU6 A;  1OF3 A;  4A3Z A;  3T2P A;  2VZO A;  4XVH A;  4MGQ A;  2QQL A;  2YG0 A;  1W8O A;  5JXJ A;  1WCQ A;  3A22 A;  2ORZ A;  4E8D A;  2BER A;  4GWJ A;  3T0A A;  3FL7 A;  1JZ3 A;  3CIH A;  3WQB A;  4A6O A;  2WZ8 A;  1W9T A;  4DUV A;  4JKL A;  1XPW A;  1LNS A;  5B4N A;  4MGS A;  2B4K A;  2VC9 A;  3C7E A;  3P6B A;  5EIY B;  5LA1 A;  4OMD A;  2W1U A;  1JZ6 A;  3W5M A;  2VOT A;  4DUW A;  4CUC A;  2QQJ A;  3UES A;  4YPJ A;  3PUH A;  2W1S A;  3WEZ A;  4BJ0 A;  4CU9 A;  3IAP A;  2VZQ A;  3LEI A;  4QX0 A;  1DYO A;  2ID4 A;  2E33 A;  1SDD B;  2XON A;  3CDZ B;  4QB2 A;  2C9K A;  3WNN A;  2QQM A;  3U37 A;  3A7Q A;  2ZEW A;  1JZ2 A;  1O59 A;  5A1A A;  4RYD A;  2JKX A;  5CYY A;  5IHR A;  3BGA A;  3PUI A;  2WO3 A;  1UY4 A;  4ZY9 A; 
#chains in the Genus database with same CATH topology
 5FZ8 A;  3WNX A;  4WM7 A;  4BB3 A;  3RJR A;  5C5U A;  1EUT A;  3K4Z A;  1UXZ A;  3NW4 A;  3B7M A;  2Y34 A;  4Y1Y A;  1LJ7 A;  1VPH A;  4QXH A;  5DQ0 A;  4RHV 3;  4LXL A;  4HVR A;  1HLC A;  3P5B A;  3DF0 A;  3J4U H;  4XQW A;  1Q8Q A;  2BGC A;  3ILR A;  3TB0 A;  3I2G A;  2BGO A;  3RNS A;  5JXH A;  4I3G A;  2VCC A;  4N9H A;  1AR6 1;  1CZT A;  4K40 A;  3GZT B;  4FFG A;  4JHT A;  3CBN A;  4CDX A;  3GHN A;  4XDO A;  3U4S A;  2X05 A;  4FTE A;  1NQJ A;  5IK8 A;  4FP3 A;  4FBF A;  4S2F A;  5L9R A;  3V65 A;  4CEW B;  5C6C A;  1RIR A;  1ZZC A;  2ARA A;  3NV2 A;  3POW A;  1YRZ A;  3JBG 3;  3WVJ A;  1QJX 3;  1UZW A;  3ON7 A;  1DQ4 A;  3ZFG A;  5FPU A;  3K2O A;  1GNH A;  1O6U A;  1X82 A;  3MPP G;  3OUI A;  1KDK A;  2YHJ A;  1UIK A;  1YJL A;  2X5I C;  3N9O A;  1R1A 2;  1BJQ A;  3MO4 A;  2JDZ A;  3OOX A;  3AZX A;  4SLI A;  5F3G A;  4AE2 A;  5JR7 B;  2BBA A;  4AL9 A;  3ZM8 A;  1NXD 1;  1VRH 3;  5LZ6 A;  4FOY A;  1UKG A;  4LMF A;  4OUL A;  3K75 B;  5A7W A;  2YBP A;  5K8S A;  2B8M A;  1QJY 1;  4XJW A;  1OH3 A;  4DPN A;  1CX4 A;  4DXR A;  1UY3 A;  4JCK A;  1W8Z A;  5EHD A;  4HPK A;  1K5M A;  3OGR A;  4GWI A;  4D6S A;  1CAX B;  5JOY A;  3KHB A;  2YB7 A;  2HWD 3;  1S2B A;  4MZU A;  2ZMN A;  4GKY A;  5FZ6 A;  5I0U A;  4S2D A;  1PNF A;  4UFH A;  1TMF 2;  1AF9 A;  3H3L A;  2VME A;  1E5I A;  1SAC A;  2PHU A;  4OI4 A;  4AAX A;  4K20 A;  4DS0 A;  3I59 A;  3Q8A A;  5C5T A;  4LLO A;  1NLQ A;  1Q56 A;  5FZ7 A;  4OVE A;  1RVF 1;  5DZE A;  2OZ6 A;  1W9F A;  1GZC A;  5FZL A;  3BB6 A;  5A7N A;  2ILM A;  5DDJ 1;  3WF4 A;  5FV3 A;  4XF1 A;  1G9A A;  1J1L A;  1DF0 A;  1YFU A;  4QAW A;  1Z78 A;  1ZNP A;  4C91 A;  4BQ4 A;  5FZ4 A;  1GOH A;  1O91 A;  3AMN A;  1FNZ A;  3MIC A;  4UF0 B;  3LDB A;  4XFH A;  2EF6 A;  4EN6 B;  2Y60 A;  3VHP A;  4QT6 A;  3NAP C;  2A5Z A;  1S2K A;  1S55 A;  5FZ0 A;  1DHK B;  1OVS A;  1OLR A;  3NKT A;  4YVS B;  2QKD A;  3HNY M;  4HBN A;  2X5I B;  1W6O B;  4MOA A;  2JG9 A;  2ES3 A;  4D94 A;  1GZ9 A;  5LBC A;  1H2K A;  2JWP A;  4PBO A;  1MS4 A;  3PLQ A;  5JLV A;  1DYP A;  4MXW A;  2WO7 A;  3UET A;  1O3Q A;  1ULG A;  3N4M A;  1AR6 2;  2R1D A;  1H1I A;  4HG6 B;  4XAE A;  4IE5 A;  2Y6J A;  4XCB A;  1VBE 3;  2B39 A;  2V5Y A;  1OBN A;  2D7F A;  2W46 A;  4NJ4 A;  3AL5 A;  2VAU A;  3NJV A;  4XUQ A;  3S7E A;  3VBS A;  3SLI A;  2FDH A;  5FMO S;  2VMG A;  3E5X A;  1RUI 3;  4MO3 M;  5DUV A;  3HVD A;  3MZH A;  3A4U A;  2AEZ A;  1RGS A;  3U11 A;  2OII A;  4FPL A;  1H0B A;  3IPV B;  1QOS A;  1BBT 3;  4X8P A;  1DZT A;  1AR7 1;  2LS6 A;  4BU2 A;  3AP6 A;  5JSR A;  1H8T C;  1HJG A;  2HYK A;  3MV1 1;  4LBJ A;  4BXF A;  3NNF A;  5IK4 A;  2DCJ A;  2YFZ A;  4Y4Y A;  5IVE A;  4XUO A;  3O0X A;  1WCS A;  2P1B A;  4CCD A;  1NQD A;  1RUG 1;  1SBD A;  1VBB 3;  3PUR A;  1QH7 A;  1QJY 2;  2UWB A;  5H9S A;  1OFS A;  1I5P A;  2BWC A;  3B02 A;  5IAV A;  2HWF 1;  2WA4 A;  1CAV B;  2HEV F;  3AXD A;  1U5X A;  3POS A;  2J1R A;  1A8M A;  2WNU C;  1W99 A;  4OUE A;  1GUI A;  2JDY A;  1DDL A;  4K3U A;  2WWS A;  3N9P A;  1SG3 A;  3SIS A;  1C8N A;  2XUM A;  3MPB A;  1HRI 3;  4FT8 A;  5D8A C;  1DYK A;  2KD7 A;  1OD3 A;  4CZS A;  1ND3 A;  2ETE A;  1HQL A;  2OUH A;  2R1B A;  4ZZ5 A;  1WW6 A;  4AFM A;  2BJS A;  1JOD A;  2YUE A;  2YPJ A;  3HT1 A;  4QU2 A;  4Q4X 3;  1POV 3;  4Q4Y 3;  3DEM A;  4RR3 A;  1ZRI A;  4XAA A;  3ZLI A;  1DG6 A;  1F5F A;  1W9Y A;  3KT7 A;  5DZF A;  5DDJ 2;  1XYO A;  2YMZ A;  5B4X A;  2UU8 A;  5C8C B;  3WHU A;  2BV4 A;  1GOG A;  5IUQ A;  4AED A;  3OGG A;  4DXT A;  1JUI A;  5FYB A;  2W68 A;  4XF3 A;  3ZFF C;  5HXV A;  1AJK A;  3POE A;  4HMZ A;  4KL1 A;  2P3K A;  1AL2 3;  4IE6 A;  2ORX A;  3FHA A;  1PO1 3;  4WV8 A;  5FPA A;  3SNM A;  2W08 A;  2RDR A;  4CCN A;  1OFN A;  4E2Q A;  5A7Q A;  4NRM A;  3ZXA C;  3OUH A;  1UWW A;  2R0H A;  1V6K A;  4M4R A;  3GYD A;  1C57 A;  2V5D A;  1V6I A;  2XQX A;  2GC0 A;  5FMO L;  1V9U 2;  4AI3 A;  1AYN 3;  4ES9 A;  1JHJ A;  5LBF A;  1W90 A;  4HLT A;  4ITC A;  1H8T B;  3H50 A;  3RGB A;  1JTZ X;  2JDH A;  2VUA A;  4IEP A;  4CRQ A;  2PLV 2;  4QGN A;  3AYA A;  3KZ4 C;  3HNM A;  2OZJ A;  4CEW A;  5DAW A;  3KVA A;  4F7Z A;  4AI8 A;  1ONA A;  1FPN 2;  3HN3 A;  4GKX A;  5DUX A;  5GLW A;  5GZE A;  2A70 A;  2BP6 A;  1W8U A;  4AAP A;  1JU4 A;  2BTV C;  4YM0 A;  4YG6 A;  4H7M A;  4XMA A;  3ROU A;  1UD1 A;  3DN7 A;  4A3X A;  2ADE A;  3CZU A;  3IZO A;  4Q4V 1;  4AI0 A;  5D8A B;  4CP1 A;  1W8T A;  1H30 A;  1QWR A;  1UYX A;  4Y5Z 0;  3WZ1 A;  2JXA A;  2Y6H A;  3OGS A;  1RUC 3;  1VR3 A;  2QUO A;  3KGZ A;  1GP6 A;  2PHW A;  3WW1 A;  5K4L A;  4C0B A;  1HDK A;  3D82 A;  4V2W A;  5I0D A;  5FYS A;  1RUG 2;  4IEO A;  1PGS A;  5FYT A;  5KHK A;  3JU9 A;  4ORF A;  5CZK A;  2PHT A;  2HWF 2;  4QX1 A;  2JDP A;  2VVD A;  1NYW A;  3U07 A;  2I2S A;  1ZBE 1;  1QY4 A;  2NM1 A;  1Y7B A;  5C7G A;  1XE7 A;  4TTG A;  2MEV 3;  2FMY A;  5A3L A;  2WZR 1;  1BEV 3;  1HKD A;  3OPW A;  3WF0 A;  4WVW A;  3UT0 A;  3ZFE C;  1CZS A;  3UGG A;  4XOG A;  3TOJ A;  5DG2 A;  3BCW A;  1F5J A;  2YDE A;  5LY2 A;  3NJZ A;  4BK5 A;  1JYW A;  3WDT A;  1W2A X;  5FUN A;  2CAU A;  2R06 1;  5FZE A;  4E4Z A;  3KQR A;  3NNL A;  5BV6 A;  5IWF A;  1QDC A;  4Y1X A;  5H9P A;  4LR4 A;  5C8W A;  2WUH A;  3LFM A;  1S0F A;  1C5I A;  3K77 A;  3W21 A;  3VD4 A;  1SQ4 A;  1RUD 1;  4UF0 A;  3HPN A;  1N1Y A;  4L2N A;  5I0R A;  4A7Z A;  5L19 A;  4OMC A;  2J1A A;  3MF9 A;  5BY5 A;  1QF3 A;  1HW5 A;  5LEK A;  1XRU A;  3TEZ A;  1MS9 A;  2RS5 3;  4AI9 A;  3M70 A;  4YVS A;  3LAG A;  2QQN A;  4QKB A;  4YW6 A;  5I8T A;  1LHW A;  1W6O A;  5APA A;  2WO1 A;  5IJR A;  1LHN A;  3GZU C;  5C4W C;  2CTV A;  4KWK A;  5JIU A;  3BOD A;  5JZG C;  3WD5 A;  3HQU A;  2XG3 A;  3LIH A;  3GBF A;  2ZX1 A;  1M4W A;  3TEY A;  1UOB A;  3N9Q A;  5DAB A;  4Z07 A;  5FY0 A;  3UK9 A;  5E1R A;  3UV9 A;  5FMD A;  3O1P A;  2WQZ C;  4IV3 B;  3BTY A;  1IS5 A;  4YZ4 A;  1HN0 A;  5F1R A;  1W6P A;  4FPO B;  4XIK A;  4D6Q A;  1UIJ A;  5KXC A;  3E1F 1;  1NXM A;  1QJF A;  1XU2 A;  1U12 A;  3AZW A;  5DZG A;  4ET7 A;  1IGO A;  3IPV A;  2ZGR A;  4DIQ A;  2R30 A;  4PLO A;  4P5Y A;  1D0G A;  1KQR A;  4CCO A;  3PJY A;  3I2O A;  4Q4V 2;  3NO8 A;  3VZK A;  3NJY A;  3ZFE B;  1JYT A;  1UZZ A;  3OBA A;  1GBG A;  4CEY A;  5IAX A;  1VBC 3;  3LD8 A;  4IND A;  3MUZ 1;  3VB9 A;  1ASJ 1;  1P8J A;  4E4D X;  4BQX A;  5F6L B;  4BDV B;  3GNE A;  1UCX A;  4JTN A;  2EXK A;  1CAV A;  1OMI A;  1IPS A;  1BVV A;  3PL0 A;  1HXS 1;  1CQ9 A;  4OQ8 A;  1PIV 1;  2XHK A;  3H9A A;  4JTO A;  4U36 A;  2W47 A;  2ZTN A;  4DMI A;  1LU1 A;  3ELN A;  1NUK A;  1XYP A;  2MHF A;  2VJX A;  4FFH A;  1H6Y A;  3AKR A;  2WZR 2;  4IEU A;  1LCL A;  3D0S A;  4I01 A;  4F8A A;  1OPM A;  3ILN A;  3KV9 A;  3TAY A;  3H1Y A;  1WW4 A;  3M3Q A;  4ASL A;  4E2S A;  4MV2 A;  1YIP A;  1H2L A;  1RTV A;  1YQ6 A;  2WNV C;  3IDE A;  1YWK A;  3GGL A;  5BUV A;  4RL7 A;  1GU3 A;  2XWB B;  2C1F A;  2R06 2;  3BKZ A;  3POI A;  3NQH A;  5C8C A;  4KWJ A;  2CV6 A;  1RB8 G;  2A6X A;  5FZO B;  5C4W B;  1W2U A;  5A3N A;  1F4A A;  1LEM A;  3SH4 A;  1CZV A;  4AVB A;  1RUD 2;  4GUL A;  5GKA C;  2ZKL A;  3I54 A;  3FJS A;  2PN5 A;  4LNV A;  1PGL 1;  3U1X A;  2KM2 A;  5C3S A;  3WNP A;  3OF1 A;  3LQC A;  3ZMO A;  1ST8 A;  2D43 A;  1NY7 2;  4AVC A;  2G4I A;  3FHI B;  3VKM A;  2Q8D A;  3KF5 A;  4M3C B;  5C71 A;  3K4A A;  5IVV A;  1ZVF A;  3AL6 A;  3GZE A;  4MG2 A;  3HJR A;  3PU8 A;  1CIY A;  1XSR A;  3M2M A;  4LKF A;  1AHS A;  5ACA 3;  4FOQ A;  2VCM A;  3Q8C A;  1S0D A;  2VZV A;  1PM7 A;  2XDV A;  3AMP A;  4EYU A;  2LM3 A;  4AVT A;  1G9B A;  5CEH A;  3VDD B;  4QHZ A;  4LBO A;  1B35 B;  5SV5 A;  3FUO A;  5C3R A;  1J83 A;  2VE1 A;  4PDW B;  3D4K A;  3VD9 A;  3KS7 A;  4NIG A;  1COV 3;  2UYA A;  3OD0 A;  1XQN A;  2OQ7 A;  4Y4R A;  2OT7 A;  5I8Y A;  3ILF A;  3IAQ A;  2WT0 A;  4NHY A;  1WA4 A;  2JX9 A;  4KG0 A;  2Y6G A;  4H3W A;  4CDW C;  2VBD A;  4HSL A;  4WVZ A;  1MZE A;  5DAP A;  4QM9 A;  4OUM A;  5IAT A;  5BNO C;  2Q1F A;  3LDR A;  4OQ9 A;  2FZ2 A;  1ASJ 2;  1H1A A;  5EWS A;  3MID A;  4XEZ A;  1YO8 A;  3LOB A;  1REF A;  4NN0 A;  5EFU A;  1CAW B;  1IOA A;  2O8O A;  1MZ5 A;  4WM8 A;  1HXS 2;  3AFG A;  5FPL A;  3Q9O A;  1PIV 2;  4L97 A;  1DQ0 A;  3O1R A;  3BTX A;  3RZG A;  1NA1 C;  3ACH A;  1JZ8 A;  5LCW L;  3JXS A;  3MIH A;  2IXI A;  5EJ1 B;  2P3I A;  1MR5 A;  3GHM A;  1DGR A;  3MBW A;  4BYY A;  1GR3 A;  1KFU L;  5FTT C;  2O8Q A;  4YG0 A;  3VKF C;  1RUH 1;  1JYV A;  2CGP A;  2RM2 1;  1SPP B;  1JMU B;  1LEN A;  4CP9 B;  4HVO A;  2ENR A;  2LRP A;  3KT1 A;  5K7P A;  4TWT A;  3S57 A;  2VY0 A;  2HEY F;  4EE2 A;  4LBN A;  1PHM A;  3LOI A;  2RS3 1;  2PHD A;  1OKO A;  4JRL A;  2PMW B;  2WSU A;  1R08 3;  1WA6 X;  2YG0 A;  2YYO A;  3FZ3 A;  4GAZ A;  2G19 A;  1Z7S 3;  3I3Q A;  2ORZ A;  1UZV A;  2YU1 A;  3B3Q E;  4Y33 A;  4E8D A;  3W9A A;  4GWJ A;  2VNV A;  2F17 A;  3FL7 A;  5EZW A;  4CXX A;  2XVG A;  3CIH A;  4HVQ A;  4JKL A;  2PHR A;  4K8F A;  3VBU B;  4JVA A;  1ZBA 3;  4CYD A;  1OOP C;  3ITQ A;  4MGS A;  1PGL 2;  3Q8E A;  1S0J A;  3KWV A;  3WDW A;  5LRS A;  3HD8 B;  1VMJ A;  1CON A;  2UY9 A;  3RI9 A;  2ZJC A;  2FDF A;  1XJA A;  3S30 A;  2ZGL A;  2DV9 A;  4GMP 1;  2XH6 A;  4EWA A;  1Q8S A;  4DUW A;  5JDB A;  2QQJ A;  2X53 S;  3H0O A;  2WWU A;  2FDJ A;  4BMB A;  4XFC A;  4PIZ A;  5FPB A;  2UWC A;  3AP5 A;  3IAP A;  3WG4 A;  2BVB A;  1HRV 1;  5FKB A;  2ID4 A;  2VEC A;  1SDD B;  1ZA7 A;  4IV3 A;  2XON A;  4QB2 A;  5F5A A;  3WDX A;  3JQW A;  4KU8 A;  4IE7 A;  4PHZ A;  5FLH A;  3VHO A;  1UYP A;  5AC9 3;  1X8M A;  5FJH A;  2ZEW A;  4HXC A;  3WP3 A;  1EPZ A;  1O59 A;  4FTB A;  2JKX A;  5FXV A;  3ZFE A;  5ABJ C;  5AVP A;  1ZRE A;  4AEJ A;  3QCW A;  2FD8 A;  1MAC A;  2O14 A;  3SMH A;  3SCG A;  2BWA A;  2DU0 A;  1PO2 3;  2HJI A;  4PT6 A;  1I3H A;  4M4P A;  3I3B A;  2JDU A;  4YW5 A;  5IT6 A;  2XJV A;  1RXG A;  3ENR A;  3GF6 A;  1I9R A;  3FC0 A;  4O65 A;  1SCR A;  4XXP A;  1HB3 A;  4XFF A;  1JOJ A;  2F4P A;  4IQP A;  2Y6L A;  3PJQ A;  1AXZ A;  4Y24 A;  1A34 A;  1GV9 A;  2XPJ A;  2A71 A;  2DF7 A;  4AVV A;  2HWC 3;  4Q4W 3;  1VAL A;  1RUH 2;  1G7Y A;  4CCJ A;  2RM2 2;  4JQR A;  3ZIW A;  4PQQ A;  1F4H A;  2A3Y A;  3AB0 A;  4QX3 A;  5CKQ A;  4YGE A;  4DY3 A;  5BNQ A;  1SEF A;  3UGF A;  2QDR A;  3LEG A;  1OD5 A;  5FXZ A;  4E9K A;  2D93 A;  3RYR A;  5FZO A;  4NRQ A;  4P9X A;  5C4W A;  2FDK A;  3NVC A;  5JI7 A;  1J3R A;  3RYK A;  3BI3 A;  2WJS A;  3RZH A;  4Q0P A;  1XSQ A;  1H4G A;  2RDN A;  1EY2 A;  2Z2S B;  3S0M A;  4LO6 B;  3VKO A;  3AVR A;  2IXK A;  4UW4 A;  2G1M A;  3CO2 A;  2AGS A;  4ZXK A;  2FDI A;  2W5F A;  2V4A A;  3WF1 A;  3AX4 A;  1SMV A;  3SXW A;  1ULF A;  3ES4 A;  4PIY A;  4QM8 A;  4TXW A;  1EP0 A;  1KRI A;  1DGW A;  2QDN A;  4M3C A;  4C1W A;  3PTR B;  1TEI A;  3IN9 A;  4LHN A;  2UY8 A;  1W28 A;  3OPZ A;  4HKO A;  4PIX A;  5FZI A;  1F31 A;  2GDF A;  4ATF A;  3KV6 A;  1E57 A;  4CP0 A;  3THP A;  2Y33 A;  1DQ2 A;  3D6E A;  3I2I A;  2D3R A;  5FZH A;  2E7A A;  1LHV A;  1X33 A;  2D6N A;  4PLN A;  4Q26 A;  1QEX A;  1SFY A;  1US3 A;  2B5H A;  5LB6 A;  2O0O A;  3VDD A;  1LGN A;  3VBR C;  1B35 A;  4LBQ D;  1HRV 2;  1XNC A;  2Y6F A;  4PDW A;  4CCM A;  1XND A;  1RJ8 A;  3DXT A;  4H2A A;  1XE8 A;  2YBK A;  3RZL A;  4N9I A;  5A80 A;  4QQP A;  3FHQ A;  1F35 A;  4ZS2 A;  3UNP A;  1VB2 A;  2RDQ A;  3KVB A;  3ZYJ B;  3OBZ A;  3B69 A;  3E6B A;  2VTF A;  1VBB 1;  4IEY A;  4AVA A;  1IKQ A;  2GMP A;  2XLA A;  3ZSE A;  2GC3 A;  1MS3 A;  1N3O A;  4NHM A;  1PVC 2;  5IVF A;  1S4C A;  5BNN B;  4FPC A;  1QNY A;  1NCQ B;  2DCY A;  4GH4 C;  3CHX A;  4QQH A;  4XMI A;  3SC7 X;  1CAW A;  1HRI 1;  3ZIX A;  3J7L A;  3PIG A;  2ZGQ A;  1CX1 A;  2Z69 A;  2VD7 A;  2NZ9 A;  1IG3 A;  3I97 A;  2WDB A;  4DY5 A;  2Z5W A;  2JKB A;  3M1H A;  1SPP A;  3MEP A;  1POV 1;  3MLL A;  4HT1 T;  4Q4Y 1;  5DUW A;  4CP9 A;  5AFE A;  5JUV A;  3EO6 A;  3DYO A;  4FPJ A;  3H1W A;  1QHD A;  5HCB A;  2R07 1;  4N43 A;  5E6H A;  4P9J A;  2AEN A;  2XR4 A;  1OT5 A;  5G05 L;  2O1Q A;  5I91 A;  4XTM A;  3O14 A;  1YHF A;  4AR2 A;  2DCZ A;  2VZU A;  3AKT A;  4I0B A;  5FUI A;  1LAJ A;  4L11 A;  4HK8 A;  3U75 A;  3VBO C;  2JE7 A;  4BIO A;  1R09 3;  2BVV A;  4LIV A;  4EN7 B;  1PO1 1;  3MFA A;  2PHF A;  4GMP 0;  3I2J A;  4UFK A;  1IQD C;  4AGV A;  3I2H A;  3LE0 A;  4JKM A;  3VBR B;  4YZ5 A;  5AFB A;  3VBU A;  1VBA 2;  4JKK A;  4I3P A;  3M3C A;  2QQV A;  4D0Q A;  2VMF A;  1SBE A;  5IFT A;  3ACI A;  2CGO A;  2VO5 A;  3AKS A;  4AQ6 A;  1V00 A;  4P14 A;  1YLL A;  1MQT A;  2WS9 2;  5D1I A;  1DGR N;  5DAV A;  1BLZ A;  1ZYB A;  2A6V A;  3B9I A;  4UWD A;  2Y8K A;  1YQ2 A;  1W6M B;  4JC1 A;  1FT9 A;  2EID A;  3W58 A;  5L9B A;  1DFQ A;  1SLC A;  2VW0 A;  1RUE 3;  4EN9 B;  3QBQ A;  1ULP A;  2VVE A;  5EP9 A;  3PVO A;  5JIA A;  3EHK A;  2W0X A;  2LAL A;  3ZDV A;  3O1U A;  2LW8 A;  4RQP B;  2ZA9 A;  1OLQ A;  1TME 3;  3S7I A;  4YZ2 A;  3E5Q A;  1A78 A;  3L9J T;  4LO7 A;  1S0G A;  2VNO A;  5F3C A;  3VHR A;  4YW7 A;  3LSD A;  1ACC A;  5FY8 A;  3PUQ A;  4UFJ A;  3JCI A;  4FQ4 A;  5F37 A;  4YVW B;  3RVH A;  2VR4 A;  1JOP A;  1LRH A;  4XTP A;  4A42 A;  2W39 A;  1R1Z A;  2Q8O A;  1O5U A;  2RMU 3;  3MV0 1;  5F6K A;  3ZXK A;  4BQW A;  1LOC A;  4QPI A;  1FOD 3;  3ORJ A;  2G9G A;  1APN A;  2B45 X;  3AP9 A;  3FBM A;  4P02 B;  5EYY A;  3BPS A;  3F95 A;  4JGZ B;  3FWE A;  3QOP A;  2PHX A;  1OUR A;  3CKH A;  3GDB A;  2ZEX A;  1DGL A;  4IGO A;  1LOB A;  2C4X A;  1LEC A;  2GH2 A;  4KWU A;  4GQ7 A;  4IXL A;  3MIB A;  3O5S A;  2ZHL A;  4URT A;  2ARB A;  1C8M 3;  3OBR A;  1UN1 A;  1S0E A;  2G9F A;  2VXJ A;  4IEZ A;  3MFC A;  4RD7 A;  5A7S A;  5HCF A;  4I09 A;  1JYI A;  1QJU 3;  2D44 A;  3T2O A;  3BTZ A;  4Q4Y 2;  4NVP A;  2D97 A;  4R9A A;  2GC2 A;  5FYV A;  1DLL A;  3BU0 A;  2R07 2;  2VZP A;  5JAX A;  1AR8 2;  1PMH X;  3MI8 A;  3CEW A;  3WNO A;  5FP4 A;  3A23 A;  4B1L A;  5K0U C;  2B9V A;  5LW9 A;  1VMF A;  1X8E A;  2DVA A;  1GYK A;  1MEC 3;  1WLC A;  3DXU A;  4YM1 A;  1PO1 2;  4XBL A;  4N8M A;  1FAT A;  2VCB A;  2XGX A;  4ZPI A;  2C6S A;  5FUP A;  4QKD A;  3USU B;  1TZO A;  1OA2 A;  2C26 A;  4JQT A;  4LJH A;  1GWL A;  5KC6 A;  2P37 A;  3DYM A;  5JR2 A;  1KGY A;  2A6W A;  2K9Z A;  2TNF A;  5T55 A;  2P2K A;  4QQ2 A;  1AR9 1;  4MGZ E;  3MYX A;  1TNF A;  4M01 A;  2JD9 A;  1W0P A;  4F3J A;  2A6Z A;  1FV2 A;  1H9P A;  4L8Q A;  4K7J A;  2LUW A;  3BVC A;  3ZXD A;  1YEW A;  5KHG A;  2CDP A;  3IDB B;  1UX6 A;  3NNG A;  2QNK A;  1PNG A;  3HIF A;  1HQW A;  1LGB A;  3ZPY A;  2GMM A;  3ME2 A;  4DRV A;  5FK7 A;  3MUY 1;  5E16 A;  2D98 A;  3DKQ A;  4HN0 A;  4DQA A;  2W1W A;  1QMJ A;  2P5B A;  2HWE 1;  5LEJ A;  2BW8 A;  4HL0 A;  3M7A A;  4OYU A;  3PIJ A;  5T5P A;  5FP9 A;  3VL9 A;  3ZKU A;  4K9S A;  2E9Q A;  3ZSK A;  3NV3 A;  3IDA A;  2D6L X;  4Q0Q A;  3MW2 A;  2DFB A;  4XUT A;  3ZYB A;  2EXJ A;  4HKL A;  3ETQ A;  2JE9 A;  4B4P A;  5FP3 A;  2ZAC A;  3RWN A;  4UFL A;  1GAN A;  1ZA4 A;  3KSC A;  1D0H A;  4YLZ A;  1CVN A;  2TBV A;  2WC2 A;  1JZ7 A;  1F15 A;  2ZAA A;  5BNN A;  1L3J A;  1CIW A;  1NCQ A;  2OPW A;  1FI2 A;  1OQD A;  4CVU A;  4AZZ A;  3J8F 3;  2OUJ A;  3VDC A;  3V64 A;  3A0K A;  3UKV A;  5EPA A;  1O4T A;  1JZ4 A;  1OUS A;  2VOW A;  2FMD A;  4Q5O A;  2GH8 A;  2VZT A;  2Y0O A;  4AFD A;  2Y64 A;  2ARE A;  3DUI A;  5FZD A;  4M00 A;  5F5Q A;  1ULD A;  2JIC A;  2QBX A;  5A6Q A;  1JS9 A;  1XC6 A;  2IVJ A;  1FYU A;  1O8P A;  4WVV A;  3WG1 A;  5F9T A;  4JDO A;  4ASM B;  4Y22 A;  4CDU C;  1OKQ A;  3P3P A;  1FMD 1;  4YG3 A;  3BYW A;  3N7M A;  1BK1 A;  4LPL A;  1LES A;  4P9I A;  2DU1 A;  4P9G A;  5FLI A;  2VBB A;  2NMO A;  2J7M A;  4AF9 A;  3RDI A;  1X9P A;  3NL1 A;  4GZ9 A;  2QQU A;  4Y1Z A;  2VMC A;  3WY6 A;  1XNT A;  4O9E A;  1KS5 A;  1OQE A;  3C3V A;  2JDM A;  3EXU A;  2YU2 A;  1QXR A;  1UYZ A;  4AI2 A;  3AMM A;  1PX3 A;  3VBR A;  3NAP B;  1XYN A;  3BTA A;  1IS3 A;  4R4Z A;  2RVA A;  1CES A;  4BHP A;  4QXK A;  2W91 A;  3LDK A;  1RVF 2;  2VU9 A;  1JI6 A;  4DNY A;  5FFO C;  2R49 A;  5L9V A;  5FXX A;  2YV8 A;  1AR9 2;  3E97 A;  4Q29 A;  1QKQ A;  3OEA A;  5JXG A;  3ACG A;  4CDQ C;  5IYY A;  2ARC A;  2RJK A;  3EYP A;  3T4H B;  1R1A 3;  3UKT A;  1C1L A;  2BEO A;  3RQ0 A;  5FCC A;  4AHY A;  4D7S A;  1W6M A;  4EJR A;  1LTE A;  3ETP A;  2WNE A;  2X29 A;  3L2Y A;  2VH9 A;  4XET A;  5FDB A;  2GME A;  4J1X A;  1GNY A;  3ZMN A;  2A1X A;  1IPK A;  3EB7 A;  4IV1 C;  2MPF A;  1VBD 3;  2AYH A;  2HWE 2;  4Y5T A;  4RQP A;  1IZ3 A;  3O12 A;  4LO4 B;  3ZYF A;  4H7L A;  5GLT A;  2ZGM A;  1OLM A;  4G3Y C;  3BOP A;  4FFI A;  2ZML A;  2BOJ A;  2ZGN A;  4YVW A;  1NKG A;  5FIX A;  2IVI B;  3QD6 A;  4DEQ A;  1XNB A;  4CCC A;  1TMF 3;  2ZHN A;  1NE4 A;  4CDU B;  2BRT A;  2OW4 A;  5M0T A;  1V6J A;  1QJE A;  2E7Q A;  2EIG A;  3H1M A;  4I30 A;  4CU7 A;  2BNO A;  3THC A;  4M0N A;  4P9Y A;  4ZU5 A;  2RG4 A;  3MIG A;  3AK0 A;  4R9C A;  3WCS A;  5HV4 A;  2WNU B;  4JGZ A;  4J6G A;  1D4M 1;  1J1T A;  3T09 A;  2BGP A;  2DTY A;  2PTM A;  3W5N A;  3NV1 A;  4RS5 C;  4XXA A;  1AR7 2;  1UW8 A;  2NQY A;  4B3N A;  3WF3 A;  4JZR A;  3R05 A;  4NAO A;  3WP4 A;  5CFD C;  2JDK A;  3N35 A;  1UMI A;  4G4F A;  4D6R A;  2JB4 A;  3DEC A;  2ATF A;  4W6X A;  3B93 A;  5F2W A;  3ZKY A;  1ENX A;  3FFZ A;  3LSE A;  1FMD 2;  1R08 1;  1RHI 3;  4AXO A;  5J7M A;  1LR5 A;  1CAX A;  1WMF A;  2AH2 A;  2C5D A;  4NOT A;  5LA2 A;  2FQP A;  1DQ5 A;  4KNC A;  4E2G A;  1O3T A;  4Y20 B;  1ZX5 A;  3NWK A;  1GLH A;  3LGR A;  3ZFF B;  3ZXL A;  3HEI A;  3WX5 A;  3FLR A;  1VIW B;  4NIA A;  4RGG A;  5T5L A;  4XUN A;  1S1A A;  2DVD A;  4RGA A;  3USU A;  3ZYH A;  5A70 A;  1AR6 3;  1ODN A;  2DVB A;  4IV1 B;  2VQU A;  5HXM A;  1LGC A;  2I07 B;  1GWM A;  1TE1 B;  3IT8 A;  4LBQ B;  1C28 A;  2XJS A;  3H7Y A;  2EA7 A;  3OYW B;  2XVK A;  5GM0 A;  1HN1 A;  4GD4 A;  1HB2 A;  3O1T A;  4D69 A;  5FPZ A;  4LBL A;  3JB4 C;  4YFZ A;  1RMU 3;  1S2E A;  4NPM A;  2VTX A;  1KD7 A;  2SLI A;  4CP2 A;  2XJT A;  3T0D A;  4AQ2 A;  3R4D B;  1SLA A;  2CGN A;  2WN2 A;  4Y5S A;  5FPV A;  2ZZJ A;  3TEX A;  1NE6 A;  4WZC A;  1GZW B;  2P4E A;  4K8R B;  3NNM A;  2WT1 A;  1CJD A;  1Y9Q A;  4HAN A;  4UI9 L;  3JD7 1;  1V6L A;  4YSF A;  5AC9 1;  4FPH A;  3WT3 A;  3AP4 A;  4CCL A;  2X5I A;  4MGQ A;  1JW6 A;  2QQL A;  2ZX0 A;  1W8O A;  3SIT A;  4QX8 A;  3A22 A;  5CVR A;  1E5H A;  2BER A;  1XBF A;  3T0A A;  5A6Y A;  2WR9 A;  1PO2 1;  1CGP A;  1W9T A;  1CWP A;  3N9N A;  4DUV A;  1K5J A;  3UYJ A;  1XPW A;  2GAL A;  3NKG A;  2Q1Z B;  1W39 A;  4RGK A;  3P6B A;  3C7E A;  3OJB A;  3VZL A;  5A1L A;  5EIY B;  5LA1 A;  1OC1 A;  1XU1 A;  2PFW A;  1ENR A;  3J9S A;  1A6C A;  1FNY A;  2HWB 1;  4MH0 E;  3W5M A;  1D4M 2;  1UAI A;  3QAC A;  1IHM A;  1YYN A;  5FYH A;  5DDJ 3;  5GLU A;  2XXZ A;  2HWC 1;  4Q4W 1;  1JBC A;  4YPJ A;  3TNP B;  3KHC A;  3PUH A;  1CPM A;  2H6B A;  2W1S A;  3ZYR A;  4Q27 A;  4QKF A;  3WEZ A;  1SDW A;  1SFN A;  4YRD A;  3CNA A;  2VZQ A;  5FY4 A;  3VL8 A;  3AJY A;  5FZK A;  1DYO A;  2OVU A;  3IM0 A;  4FPK A;  4X8N A;  3CDZ B;  2SBA A;  5LBB A;  2XQR A;  5EV7 A;  1ZRC A;  1OHF A;  4EWD A;  2QQM A;  5CIR A;  2DBN A;  2VQ0 A;  2DUO A;  3A7Q A;  1ZBE 2;  5FYU A;  2Q8C A;  4KBB A;  1V9U 3;  4L99 A;  4CU6 A;  4RYD A;  4NPR A;  1ND2 C;  3NMB A;  4AQS A;  1QH6 A;  3NAP A;  3CLP A;  4E27 A;  5FZ9 A;  4H55 A;  4ASK A;  2PLV 3;  3SH3 A;  3K4D A;  3M3I A;  3LPF A;  5J1X A;  5C3Q A;  5KHJ A;  4LKE A;  5BNP C;  1PK6 C;  5HCA A;  3IIA A;  2D3P A;  4BWO A;  4QPG C;  4CPB A;  4TN7 A;  5LWB A;  1QNW A;  1FPN 3;  1EV1 3;  3WNM A;  2XKO A;  3C7H A;  1ALY A;  5A7O A;  3VBH C;  4TSV A;  3RZM A;  3DCQ A;  3LWC A;  1O3R A;  4CUB A;  3NNJ A;  5JZG B;  4XZU G;  2ZGU A;  1REE A;  3AYD A;  1RUF 1;  3HQR A;  1ZZ8 A;  1PMI A;  2B7Y A;  1O5L A;  1X7N A;  4LO8 A;  2WIN B;  4N53 C;  1N3Q A;  1N3P A;  3RZZ A;  3WIN E;  3KT4 A;  4KWL A;  3TRS B;  1WME A;  5DN2 A;  2A6Y A;  2DCK A;  1GOF A;  3LEK A;  5FYM A;  4LEJ A;  1ULO A;  1GQP A;  5GLV A;  5IVY A;  4IW3 A;  5AC9 2;  3JD7 2;  1HB4 A;  4PF1 A;  1RUG 3;  3ATG A;  4ZXE A;  5JCT A;  1BMV 1;  1Q43 A;  4A44 A;  2WII B;  3BOW A;  1UX7 A;  1PX4 A;  1UPS A;  2ZZQ A;  1H8T A;  1OVP A;  4MGT A;  2CYF A;  3CJX A;  1VRB A;  2BDR A;  2BU9 A;  4L9B A;  5KC5 A;  2J1U A;  4I2O A;  4NRO A;  2J1V A;  1I1E A;  3NJX A;  2ZEY A;  2OA2 A;  3AKQ A;  4O61 A;  3GAL A;  3J7N A;  4UBG A;  5I8S A;  2Q0A A;  4NII A;  3B5L B;  5A1F A;  3CJI C;  4LBK A;  3O0V A;  3RYP A;  1C5H A;  1KJL A;  1SLT A;  2VOK A;  4PCR A;  2WNU A;  2XBO 1;  5FZM A;  1US2 A;  5FY5 A;  2G9Z A;  1GWK A;  3PUA A;  2HWB 2;  4UW6 A;  5D8A A;  3VLB B;  4AHX A;  2VMD A;  2IXH A;  3O1M A;  2ZX3 A;  2HWC 2;  4Q4W 2;  3AP7 A;  4FPE A;  2BQP A;  4EV0 A;  1XNK A;  3H8X A;  1RUO A;  4H14 A;  5BNP B;  3ZN4 A;  3T2Q A;  4AWD A;  1YQ5 A;  2WNV B;  4QPG B;  2BBV A;  1JN2 P;  2DCT A;  1EUU A;  1X9T A;  2GN3 A;  4X6Q B;  4IER A;  4YM2 A;  3RSJ A;  3SCF A;  1BCX A;  2D6K A;  1WCK A;  4P9W A;  2QFE A;  4HZF A;  1TVG A;  3VBH B;  4CE8 A;  1GMM A;  1KDM A;  1R09 1;  3MLK A;  5KHH A;  2B42 B;  4W4Z A;  3CZJ A;  4D8M A;  1JYX A;  4Y20 A;  4L0P A;  4P08 A;  3ZFF A;  4N53 B;  2FZ1 A;  4BPZ A;  5CAD A;  3LB9 A;  3QLQ A;  3T08 A;  2EXH A;  2FBE A;  5C9A C;  3IMN A;  1BXH A;  1N47 A;  4IV1 A;  3HBZ A;  1YIF A;  4LBQ A;  2OPK A;  4WM7 C;  2WFF 1;  3OYW A;  4UYB A;  1N1V A;  3AYE A;  1SZB A;  2E26 A;  1Q8O A;  1GKB A;  3I2K A;  1AXK A;  2ZS6 B;  5FY1 A;  2AR6 A;  5J96 B;  4MYE A;  1RUF 2;  1RUE 1;  2CHH A;  2EIE A;  1W6Q B;  4LOT A;  4Q4V 3;  3E5U A;  4QX5 A;  5I0T A;  3ZXE A;  4PF5 A;  2YZ4 A;  4V2V A;  3ZR6 A;  1DLC A;  4CDX C;  5HBA A;  2VL4 A;  3CJI B;  1GZW A;  1B09 A;  3AYC A;  4FO9 A;  4RHV 1;  3GJA A;  2CDO A;  4R4X A;  4BQ3 A;  1YFW A;  4NRP A;  5JMO A;  2WLQ A;  4XBN A;  4BE3 A;  4UBH A;  1JYC A;  4A6S A;  1OI6 A;  3SEP A;  1BMV 2;  2P17 A;  2W92 A;  3ZFG C;  3G6J B;  1Q3E A;  4CDW B;  1E5S A;  1DP0 A;  2K46 A;  4V1P A;  1PZ7 A;  1J58 A;  2R16 A;  3JBG 1;  5BNO B;  1FOD 1;  2AUY A;  2D6M A;  1QJX 1;  1YUD A;  5G04 L;  4A45 A;  1VB4 A;  1YFY A;  1X36 A;  2RR1 3;  4QB1 A;  3ZN6 B;  4XYX A;  3QH6 A;  3CU7 A;  4AW7 A;  2XBO 2;  4ATE A;  1HV1 A;  1NA1 B;  1VRH 1;  3OBT A;  2R06 3;  3KM5 A;  1C8M 1;  1DIW A;  5KWR A;  4GAL A;  4LE4 A;  3EJK A;  4NIH A;  4OHZ A;  3O7O A;  4Q8L A;  4AFB A;  3VBF C;  4M0H A;  5C9A B;  1PZ8 A;  1UU6 A;  4XUP A;  2VUD A;  4MHU A;  2BFU S;  1UMZ A;  2BNN A;  4K6B A;  3LCP A;  2BOI A;  4UFI A;  3V0B B;  3PUS A;  5BPX A;  1I5Z A;  1WLD A;  4HOO A;  5HV0 A;  4ZS3 A;  5DUU A;  5FY9 A;  2ZCW A;  2R0F A;  1OUX A;  2HWD 1;  2E51 A;  4NO4 A;  1POQ A;  3AMQ A;  2PEL A;  2VZR A;  3T3Y A;  2XVL A;  5EYX A;  2HBT A;  3VKN A;  1R09 2;  2IXJ A;  2E6V A;  2QQW A;  4FXK B;  5A3W A;  4R9B A;  2Z42 A;  4CCK A;  2JIJ A;  2ZBJ A;  3LKJ A;  4OZO A;  4A41 A;  1DU3 D;  1GNZ A;  4LUL A;  5J98 B;  1J59 A;  1OOP B;  1VAK A;  4RFT 0;  2HKX A;  2UYB A;  3URF A;  2K0G A;  1BK0 A;  4LUK A;  1KJR A;  5L36 A;  2WFF 2;  1JHN A;  2RS3 2;  1MS8 A;  4LK6 A;  2W9X A;  5T5O A;  5JZG A;  4Z2A A;  5FXW A;  2WZE A;  1V6O A;  4R8H A;  4XIL A;  4GA9 A;  2R6Q A;  4KGQ A;  3LA3 A;  1RUJ 3;  3RI8 A;  3MIF A;  4I02 A;  1RUE 2;  3E6D A;  1AX2 A;  1KXG A;  1ZZ7 A;  3DV8 A;  2GNT A;  2ZXQ A;  1VAV A;  3FMG A;  2E32 A;  4RHV 2;  1N1T A;  4JV4 A;  3P1I A;  3VBS C;  3JB8 A;  4SBV A;  4HPK B;  4O9G A;  5FY7 A;  1ASJ 3;  2XKP A;  2HBU A;  3FN9 A;  4BK4 A;  1K42 A;  5FYY A;  1A3K A;  3POG A;  4QU1 A;  5FZ1 A;  1UKR A;  3VBF B;  5ABJ B;  1U5Z A;  3AM2 A;  1VBE 1;  2DFC A;  1HXS 3;  3I2F A;  4GWN A;  1PIV 3;  1PGW 1;  2WBK A;  4Q0S A;  1SCS A;  2AEY A;  5CU1 A;  1UQX A;  4CTE A;  1RUI 1;  3I59 B;  1G9C A;  1SBF A;  1GP4 A;  3ACF A;  3JBG 2;  3J8F 1;  4NUB A;  3ZXG A;  1QJX 2;  5LY1 A;  4Z1V A;  2BFU L;  5L7O C;  2Z79 A;  3PNA A;  4LQR A;  4XF9 A;  1HB1 A;  1BBT 1;  1YFX A;  4EZ4 A;  4I0W B;  3OEB A;  5GZF A;  4XF0 A;  1DGW X;  2YC2 A;  5CKM A;  1ENQ A;  3UGH A;  4YFW A;  4UXA A;  3SQO A;  5KHI A;  1VRH 2;  5E8A A;  4BIF A;  4B4R A;  1AX1 A;  2QQK A;  1MPX A;  3WDU A;  1V0A A;  2ZX4 A;  1CD3 G;  2OX0 A;  3C8X A;  4BH9 A;  1W8H A;  2X09 A;  3V56 A;  2V09 A;  3WG3 A;  3X29 B;  3N7L A;  4N90 A;  5BNP A;  1ND3 C;  4YM3 A;  2WNV A;  4HET A;  4QPG A;  5FBJ A;  1W8F A;  1AVB A;  5A32 B;  3H8R A;  4UT5 A;  3RWK X;  4QWN A;  4XJZ A;  1U0A A;  2HWD 2;  1R64 A;  5F2S A;  1AYM 3;  4RR3 C;  1V6N A;  1PZ9 A;  2XHN A;  3O1O A;  4IE0 A;  2ZGO A;  1D2Q A;  5I0S A;  4N53 A;  1WLW A;  1RED A;  2VZS A;  4MAD A;  5IVJ A;  2CU5 A;  5A3T A;  1WMX A;  4O7X A;  3O0W A;  4Q4X 1;  1K12 A;  1ZZB A;  1LED A;  3JZV A;  3POF A;  4URA A;  1W2O A;  2XL9 A;  1EAH 3;  1BKZ A;  1Q8V A;  2JG8 C;  3VHN A;  2WZP P;  5L73 A;  2GAU A;  3KV5 A;  4AG4 A;  2NYY A;  4XUR A;  2UWA A;  4QMA A;  4Z2W A;  2AAC A;  5JSP A;  3CQO A;  3III A;  1R1A 1;  1NX9 A;  4FPF A;  3ZSJ A;  1AL2 1;  2LRO A;  5H9R A;  3KV4 A;  2E7T A;  1CN1 A;  3DL3 A;  4KBZ A;  1W6Q A;  4LKD A;  1VBD 1;  4CSW A;  4BQ1 A;  2VUC A;  3K51 A;  4RA0 A;  1WW5 A;  4YZ1 A;  1V70 A;  5L7O B;  3FX3 A;  2A73 B;  2ZHM A;  4GB3 3;  5FZG A;  5F5C A;  1AYN 1;  2X10 A;  4CEW C;  4NAM A;  1WCU A;  3V0A B;  5F39 A;  3D5O A;  4ISR A;  4FI9 A;  4AVS A;  1RJ7 A;  3ZVX A;  5C70 A;  5JPN B;  5FLJ A;  4CDW A;  5GZC A;  4FP2 A;  5KR7 A;  1LOG A;  3HBK A;  1RUN A;  1NLS A;  4AEK A;  1VBE 2;  5DMY A;  1PGW 2;  1NLR A;  3SCH A;  5BNO A;  3VDB A;  5FPX A;  3ZN5 A;  3KB5 A;  2NPI A;  1RUI 2;  4OHX A;  1RC6 A;  1EPW A;  2QQI A;  4GH4 B;  5ISL A;  4PI2 A;  2AC1 A;  1OPO A;  4BLJ A;  3FFQ A;  2RM2 3;  5CG8 A;  1LUL A;  1TG7 A;  2R04 3;  2ZHK A;  2JB8 A;  5H9Q A;  1BBT 2;  1MS1 A;  2P3Y A;  1ZRF A;  2VVF A;  3M4F A;  3T30 A;  4DFS A;  1NA1 A;  1FV3 A;  1C4R A;  5FOJ B;  1RUC 1;  2A7A A;  2FCV A;  3PVN A;  5DG1 A;  3VGI A;  2W87 A;  4MET A;  4Q0V A;  5C9A A;  5DPN A;  1QQP 3;  4C90 A;  4OCT A;  5CAZ A;  1QJZ A;  2GZW A;  3BPZ A;  4U2A A;  1W05 A;  3WNK A;  5A3O A;  1RHI 1;  1VBB 2;  2ZGT A;  2VGD A;  4D7Y A;  3V0B A;  1WWY A;  2EXI A;  2JG8 B;  3ZOI A;  1T2X A;  1LOF C;  4PI0 A;  4XC9 A;  3BIE A;  1NT0 A;  2VM9 A;  3WP5 A;  2VW2 A;  2MEV 1;  2PAK A;  2Y38 A;  3T4V A;  4KH9 A;  4N7I A;  3ZDS A;  3VUO A;  5T50 A;  2GU9 A;  1BEV 1;  1H6X A;  3VBO B;  1JOB A;  1HRI 2;  4DZG A;  2OQ6 A;  2WN3 A;  3RJ2 X;  4YW3 A;  4ARY A;  4YYO A;  3T2T A;  2I74 A;  5JVV A;  3WXP A;  1WBL A;  4AFA A;  3H3U A;  4GMP 3;  1YI7 A;  3ECQ A;  1OOP A;  3KQ4 B;  5A6Z A;  2L9L A;  1UU4 A;  4Y1V A;  3WOG A;  1KS4 A;  3F2Z A;  4Q4X 2;  3ABZ A;  4B29 A;  2FDG A;  1WKY A;  3BUC A;  4HK9 A;  3FUQ A;  4XPV A;  2ZGP A;  2BUK A;  2YPD A;  3WF2 A;  1LHO A;  3MGU A;  5A3U A;  1HRV 3;  1RMU 1;  5F32 A;  1OXC A;  4XAB A;  4YVS C;  1ZRR A;  3TYJ A;  4Z82 A;  2FCT A;  2ZGK A;  5IVB A;  2DUP A;  4XBQ A;  4HN1 A;  1AL2 2;  1NG0 A;  3A21 A;  3THD A;  4R9D A;  3UJQ A;  2KA3 A;  2P3J A;  3O1S A;  1M06 G;  1UOG A;  2RS5 1;  3LEM A;  1OA4 A;  1VBD 2;  2DDU A;  3A0N A;  3VN4 A;  5CA6 A;  5CFC C;  4Q1P A;  1AYN 2;  3RG0 A;  1PVC 3;  3SH5 A;  1KFX L;  4E4H A;  4ZZ8 A;  1UMH A;  5IK5 A;  3RMX A;  3TEW A;  3I8T A;  1DQ1 A;  2IXC A;  4XDQ A;  1WD4 A;  2XLG A;  2PAE A;  1J3Q A;  4D3W A;  4B7E A;  2RS1 3;  1UZY A;  3VBF A;  3SHR A;  5ABJ A;  3GCX A;  4KG8 A;  1W8W A;  4S2H A;  1BZW A;  4AFC A;  4DXS A;  1YC6 1;  2PYT A;  4TZD A;  2XJP A;  4XJA A;  3THT A;  1W9W A;  4AK3 A;  2BZD A;  2HLE A;  3OGV A;  4GIQ A;  4IUG A;  4LO5 B;  1QOT A;  1SLB A;  1A8D A;  2QZ3 A;  4CEY C;  4BXS V;  5LK5 A;  4A7Y A;  5FWE A;  2WAB A;  1SLI A;  1V6M A;  4Z92 B;  2I45 A;  5SV8 A;  2A75 A;  5LRR A;  2XWJ B;  4LE3 A;  3WW2 A;  4C0H A;  2WKK A;  1IKP A;  4PBP A;  1WCD J;  1Y9M A;  5BYN A;  2DUR A;  5JI9 A;  2XL7 A;  2DTW A;  2WO2 A;  1RUC 2;  5FO8 B;  1VBC 1;  4KMQ A;  3FBY A;  3C7O A;  4Q0U A;  3ZPO A;  2D6O X;  1KEX A;  2C0Z A;  3M3E A;  3D3A A;  4JDN A;  1RHI 2;  2DWR A;  1VBA 3;  1POV 0;  5A32 A;  1W0O A;  4ZHN A;  4XJU A;  2GN7 A;  2VZO A;  5LAS A;  4J25 A;  4XVH A;  1V9U 1;  5K0U B;  2MEV 2;  3PHM A;  1CAU B;  4L92 A;  5AVA A;  4Y1U A;  5FZ3 A;  1BEV 2;  5JXJ A;  3N7J A;  5C8C C;  1VLN A;  5FP8 A;  4YZ3 A;  5FBZ A;  3TN9 3;  1U5I A;  4FXG B;  3AZY A;  2PLV 1;  1JZ3 A;  2WS9 3;  4IE4 A;  1HX6 A;  3WQB A;  2WZ8 A;  4A6O A;  4OUS A;  5A6X A;  3JQX A;  3H7J A;  2XB6 C;  5ERL A;  3ZYI B;  5CFC B;  1FPN 1;  1EV1 1;  5B4N A;  2B4K A;  4UW3 A;  3USS A;  2VC9 A;  4ISQ A;  4NHK A;  4AQT A;  2CSG A;  3K3N A;  3DPR C;  3POB A;  4LHK A;  2TEP A;  4OMD A;  5A7P A;  1W6P B;  4PQ9 A;  1JZ6 A;  2J42 A;  3TNQ A;  4MGK E;  1RMU 2;  3PMS A;  4CUC A;  3HT2 A;  5JSO A;  3C2U A;  3UES A;  3P3N A;  5T5J A;  4MVT A;  3WW3 A;  4DIN B;  3TWI A;  3VZN A;  5L7O A;  3LEI A;  4FFF A;  2UUR A;  4CEY B;  4QX0 A;  2RS5 2;  3ALQ A;  1W6N B;  3GBG A;  3Q8F A;  4CXW A;  4IEX A;  3WNN A;  5ACA 1;  2GP5 A;  1MVQ A;  5A33 B;  3V0A A;  5JPM B;  4AI1 A;  1BQP A;  4EZH A;  2CNA A;  5A1A A;  2W52 A;  2OXB A;  3HMY A;  4IEQ A;  5T3N A;  3PUI A;  4M3C E;  3UL2 A;  5FRE A;  2WLP A;  2WSV A;  3WW4 A;  3U4X A;  1NAE A;  1COV 1;  3MLJ A;  2ZMK A;  4PLM A;  2D5F A;  2KR2 A;  4GH4 A;  2Y6K A;  3LF7 A;  3VD7 A;  2YBS A;  1H2N A;  1CR7 A;  5FMB A;  2J22 A;  4QPW A;  1WMD A;  4FSJ A;  2Y26 A;  2R07 3;  1AR8 3;  3ACL A;  5LAT A;  2RDS A;  1SFP A;  2ZX2 A;  4WM8 C;  1VBC 2;  3M3O A;  3JUU A;  4GJY A;  1O8S A;  1W03 A;  5C3O A;  1AX0 A;  3AVS A;  3LA2 A;  2OYZ A;  4EN0 A;  3HR9 A;  3RRD A;  1IPJ A;  3I7D A;  1K45 A;  2JG8 A;  5D21 A;  3LPG A;  2R7E B;  2R32 A;  3BAL A;  3RMY A;  4COU A;  5K9Y A;  1UL9 A;  3DPR B;  4NWW A;  4JDM A;  1H8V A;  3U78 A;  4BIS A;  3WNL A;  3B01 A;  4IL7 A;  2CL2 A;  3NRU A;  3VBO A;  2IFW A;  3MW4 A;  4A4A A;  4D7T A;  5J09 A;  4JGY C;  3WSO A;  1S0C A;  3AZZ A;  3ST7 A;  2XJQ A;  4KGG A;  5EXO A;  3ZSL A;  3ZYG A;  1JZ5 A;  1Y4W A;  4E4S A;  4ERO A;  1MZF A;  1K3I A;  5LBE A;  4BZ4 A;  3Q8B A;  4NE9 A;  1EV1 2;  1L7L A;  2V72 A;  4C8D A;  1Z7S 1;  4YNI A;  3IWZ A;  1OH4 A;  4CDQ B;  4OFG A;  5J3U A;  3HQX A;  2VNR A;  2VUL A;  4W8J A;  1ZBA 1;  1UU5 A;  1O3S A;  1PMJ X;  2IZW A;  4W65 A;  1J3P A;  3H42 B;  3KCC A;  5FQ0 B;  3J7H A;  1D7P M;  2C24 A;  1CPN A;  4HSJ A;  1GFF 2;  4MHR A;  2PHL A;  1Q5O A;  2RV9 A;  5FO7 B;  2OKX A;  4IV3 C;  3IB3 A;  4LHL A;  2GC1 A;  1WZX A;  4K21 A;  5FRA A;  5ACA 2;  3VZJ A;  4WM8 B;  1C3H A;  3T0B A;  3WHT A;  4HON A;  2WWJ A;  5GLZ A;  3N3H A;  1YXW A;  2XML A;  4IGQ A;  3B94 A;  5IW0 A;  2RR1 1;  4ONU A;  3WUD A;  1W8N A;  2XOM A;  4MSV A;  1LOF A;  3KCY A;  4COW A;  3C7F A;  2ARX A;  2H0V A;  1COV 2;  3IDC B;  4WBB A;  3UJO A;  2XUE A;  5A3M A;  2WQ4 A;  2IC1 A;  2JDN A;  3OUJ A;  1FXZ A;  1QJY 3;  2W95 A;  4YWA A;  2PA7 A;  4RS5 B;  4JGY B;  1TQ5 A;  5F7U A;  1YI9 A;  1NCR C;  1QXP A;  3IBM A;  1RXF A;  4BOW A;  3GBW A;  4CU8 A;  5CFD B;  5KXB A;  1ODM A;  4TLG A;  2QJV A;  4B4Q A;  4LA2 A;  4KI5 M;  4COV A;  2EAA A;  1L7R A;  5FYC A;  2DYC A;  5CBL A;  4ZU7 A;  4QDR A;  3GM8 A;  4GXL A;  4QB6 A;  3VZO A;  2PQQ A;  1NY7 1;  2EAL A;  2W1Q A;  5FK8 A;  4QX2 A;  1KIT A;  5CKN A;  3IKW A;  4TYS A;  4LIT A;  4P00 B;  3PME A;  4R52 A;  2B9U A;  1RVF 3;  5K0U A;  2HEW F;  3W59 A;  5J37 A;  1CAU A;  4B8E A;  1U5Y A;  1PVX A;  4NWV A;  1AR9 3;  2QVS B;  2YFU A;  2RJ2 A;  3WUC A;  4AGR A;  3PVB B;  2V4V A;  3RZK A;  3SKV A;  4XE9 A;  2WA3 A;  1IS4 A;  1Y9G A;  1S0I A;  4COZ A;  5CFC A;  4FPY A;  5CB7 A;  3GCW A;  2YGL A;  1WD3 A;  2HYX A;  2PQS A;  4UW5 A;  4DB5 A;  1R08 2;  1LB2 A;  4XZP A;  2XJU A;  4OI1 A;  2VZ1 A;  1Z7S 2;  3SEE A;  1SHW B;  4AGG A;  2VMI A;  2VCA A;  3E6C C;  4LTA A;  2CAV A;  2HWE 3;  2VUJ A;  5FWJ A;  4DEV A;  1YQC A;  2JD4 A;  5JOW A;  1MVE A;  1RUJ 1;  2YRO A;  4YGD A;  1OF4 A;  4EQV A;  1F9K A;  3WLU A;  3WQ1 A;  4QD2 A;  2CWS A;  2QTW B;  1ZBA 2;  4EWE A;  4JRA A;  4DUX A;  3ASI A;  3LFI A;  3AZV A;  3OTF A;  1GIC A;  2J1E A;  2C9A A;  4QHB A;  4ARX A;  3CL1 A;  2QZ2 A;  4ES8 A;  4M3C F;  1W6N A;  1VP6 A;  3VDD C;  1DZR A;  1B35 C;  3I3D A;  2ERF A;  3GJB A;  3MIE A;  5LA9 A;  4CUG A;  1NCR B;  3ZYP A;  5A33 A;  4PDW C;  1GZT A;  1MS0 A;  1Y43 B;  2ZAH A;  4IGP A;  4N7U A;  3IMM A;  2KXL A;  4UOJ A;  1AR7 3;  5JOZ A;  4OHW A;  2PAM A;  4GJZ A;  2J1T A;  2RR1 2;  4RFR B;  4MLO A;  1LKN A;  2ZGS A;  3KF3 A;  3DKW A;  1AJO A;  4Y3O A;  1Y3T A;  3I3E A;  4KQ7 A;  3H3Z A;  5E89 A;  1ENS A;  5FZF A;  2WRA A;  4C1X A;  1FMD 3;  5LK7 B;  2VNG A;  1ULC A;  4XAC A;  2EVX A;  2VZ3 A;  2WL1 A;  4LUM A;  2HWF 3;  4QKN A;  3LZZ A;  1LOD A;  3OY8 B;  2VTX J;  4XCA A;  3WG2 A;  1DCS A;  3PTY A;  4LT5 A;  4PJY A;  1JU3 A;  4P9L A;  1T6B X;  4FTS A;  2VG9 A;  4ZU4 A;  2LTN A;  2WNO A;  4IEV A;  1PO2 2;  2EIB A;  4J1W A;  4BM8 A;  4CDU A;  2D6P A;  2RE9 A;  3O1V A;  1BYH A;  1LOE A;  2F4L A;  3U0Z A;  1AYM 1;  1H9W A;  1OA3 A;  1W3V A;  3DPR A;  5F8P A;  1ZZ9 A;  1F2N A;  1Z0H A;  2W2I A;  4AHZ A;  4TLF A;  5GJ6 A;  1W9S A;  4N43 C;  2EAK A;  1WUV A;  4COY A;  3OG2 A;  2QQP A;  4OZX A;  5EJZ B;  1ND2 B;  1O7F A;  2XJR A;  5JWP A;  5F3I A;  3RFR A;  2JE8 A;  2E31 A;  3S5Q A;  3WCR A;  2NMN A;  3HNB M;  4BME A;  1WGP A;  1O4Z A;  4LA3 A;  1EAH 1;  1ZZ6 A;  4OHV A;  2YY1 A;  4FAH A;  4Q2F A;  1PK6 B;  1W2T A;  2X8K A;  3MW3 A;  1LHU A;  1FX5 A;  2JEC A;  5FMC A;  5FO9 B;  3VBU C;  2IUW A;  2YXS A;  1X50 A;  5JXI A;  1HJF A;  2DVG A;  1RYY A;  2Q5T A;  5J48 A;  1NZI A;  3LIG A;  4QPY A;  1G9F A;  1AL0 G;  1UXX X;  4CDQ A;  3LA7 A;  4OLL A;  3OGJ A;  4ZKT B;  3CF6 E;  1UYY A;  2ZKN A;  1G8W A;  3G7D A;  3H8U A;  5FP7 A;  2K2S A;  1QDO A;  1RUJ 2;  3AFK A;  3B00 A;  3MHZ A;  4NID A;  3HWJ A;  1MQT C;  4QQL A;  3TBD A;  2Q1M A;  3ZO0 B;  1L7Q A;  3DYP A;  4GB3 1;  4QHO A;  5A3P A;  1ULE A;  4XHX A;  1JYN A;  5FYI A;  5FQ0 A;  5FZC A;  3EMR A;  1BHG A;  4YW4 A;  2H0B A;  3RZJ A;  5EQU A;  5T54 A;  2JJ6 A;  2WAA A;  2YGM A;  2H6C A;  2VQT A;  1IS6 A;  1C1F A;  2W3J A;  3POY A;  3WV6 A;  4P5H A;  4X6R B;  3K46 A;  4W50 A;  5CNA A;  3OCP A;  1D4M 3;  3KLS A;  4W6W A;  4QGM A;  3VV1 A;  4QDS A;  4WVM B;  1W2N A;  4LKS A;  2Q8E A;  1VAM A;  3RS6 A;  2XLF A;  1F8V A;  1O4Y A;  1TME 1;  2R04 1;  4UAP A;  3R6S A;  1RIN A;  4BQY A;  4G9S B;  3T1M A;  2GNB A;  5C33 A;  4N43 B;  3U14 A;  4QPI C;  2W94 A;  3D0J A;  1QGL A;  4JGY A;  4RS5 A;  1CJP A;  1H2M A;  1OSG A;  3NV4 A;  4XFI A;  1RL3 A;  2AZ5 A;  1QQP 1;  2JDA A;  2NLR A;  1XXN A;  3I4I A;  2JIG A;  2BNM A;  4XFA A;  4B7K A;  2J1S A;  5CFD A;  4E8C A;  3KCX A;  2VOV A;  1ZBE 3;  4XHB A;  2RMU 1;  5GZG A;  5JOX A;  2QCS B;  4IDZ A;  4AYU A;  4FPG A;  1OLM E;  2WZR 3;  3UKN A;  1HIX A;  3BU7 A;  2QQO A;  4JAA A;  4QGL A;  1AUY A;  4DXZ A;  1AYM 2;  5DAX A;  5FYZ A;  4BQ5 A;  4NHX A;  1JH5 A;  4JX0 A;  3VDA A;  5J36 A;  1K5M C;  2JEM A;  3D8C A;  1VJ2 A;  5E88 A;  4CCE A;  1JXN A;  4UFM A;  3HOB A;  4W6Y A;  4Q8K A;  3WDV A;  1MQT B;  4AOC A;  1AXY A;  3KMH A;  2WYS A;  4A7K A;  1QJU 1;  2RJL A;  3AJZ A;  4XW3 A;  1W04 A;  1VE0 A;  3N9M A;  3H8O A;  2GNM A;  1HV0 A;  4GWM A;  1TNR A;  2ZAB A;  4MGY E;  4XJ9 A;  2VOX A;  3AXE A;  1D2S A;  1EAH 2;  1RUD 3;  1YJK A;  1XB9 A;  2GSY A;  2WAO A;  3BIW E;  3C7G A;  4QDQ A;  4WM7 B;  4MXV A;  1H1M A;  2F6B A;  2WT2 A;  3BN6 A;  3OD4 A;  2VW1 A;  4CPB D;  3VD3 A;  5IK7 A;  5HPO A;  3N7K A;  1T6G C;  1MEC 1;  5FR3 A;  3WP6 A;  3JD7 3;  5F3E A;  3I3M A;  2IWG B;  5FOB B;  2MNG A;  1G86 A;  4CUA A;  2DBI A;  5KBF A;  4LIU A;  4CDX B;  2BYV E;  4BA6 A;  4RN5 A;  4GB3 2;  1UNB A;  2CY6 A;  3AC0 A;  4NPL A;  1PVC 1;  3VKL A;  4LLF A;  5KXD A;  4IEW A;  2ZPX A;  2ET7 A;  1W0N A;  3CMG A;  4QPI B;  4QXC A;  5ANQ A;  1RIT A;  4LHS A;  4MX3 A;  2N7G A;  1XNA A;  1UF2 C;  2RS1 1;  1NCR A;  3ZFG B;  1E5R A;  4XFB A;  2VQA A;  1XOY A;  3HN1 A;  4RSU A;  3AMH A;  1WLT A;  1UOF A;  2JG9 C;  4JHZ A;  1W3X A;  4FVV A;  2IFR A;  2D3S A;  2HWB 3;  4QXB A;  5F5I A;  3DGT A;  4NMI A;  4BCU A;  4S2G A;  1NOV A;  3FLP A;  5ANN A;  1D4V B;  1IQA A;  1FAY A;  2JEN A;  3GXU A;  5A7W B;  3EBR A;  1GQH A;  4F83 A;  5IFP A;  4EN8 B;  1TME 2;  2R04 2;  5CIS A;  4BLI A;  2P6H A;  2YC0 A;  5BNN C;  1K5M B;  2HH9 A;  3R4U A;  2RHP A;  1NCQ C;  2IXL A;  3S6P A;  4NR1 A;  2CWM A;  2FHR A;  2ZEZ A;  3OY8 A;  4NHL A;  3SKJ E;  4AHW A;  3PU3 A;  1QQP 2;  4YGC A;  4QX7 A;  1GP5 A;  3K48 A;  5T52 A;  2VPV A;  4YW1 A;  5FZA A;  4LK7 A;  2RMU 2;  4XFG A;  1VBA 1;  3PVE A;  1UPI A;  1UOJ A;  1FOD 2;  5GAL A;  5EJ3 A;  1YQ8 A;  4YW2 A;  1I6X A;  1WBF A;  1UY1 A;  3N9L A;  2DUQ A;  4FCA A;  5CG9 A;  4HKW A;  2NP0 A;  2WFP A;  3OSD A;  3MF6 A;  2Q4S A;  1UY0 A;  2ET1 A;  2QE3 A;  2Z4F A;  4KU7 A;  2EIC A;  4DO0 A;  3TN9 1;  4DOU A;  3I49 A;  3KD4 A;  2WS9 1;  4MUV A;  1ND2 A;  1C8M 2;  1UY2 A;  3N36 A;  5D2A A;  5LA0 A;  5TSW A;  2D5H A;  1J84 A;  2E53 A;  4BQ2 A;  3POJ A;  1QJU 2;  1GSL A;  2WQ8 A;  3FE5 A;  4AEM A;  1PK6 A;  4HFS A;  1RUF 3;  1YNA A;  4LOR A;  2BPA 2;  5FAX A;  2ZOE B;  2VBP A;  4IES A;  1QOO A;  1IG0 A;  1GQG A;  2P6C A;  2V73 A;  3QH7 A;  3WDY A;  5FZB A;  3VBH A;  1W06 A;  1UZ0 A;  1Q8P A;  3PDQ A;  1ZM1 A;  2JG9 B;  4FOV A;  1MEC 2;  3AKP A;  4Q1R A;  5DAQ A;  3MDP A;  4AED C;  3OB8 A;  4MXW B;  3T1L A;  3WQ7 A;  2YC4 A;  3L2H A;  4WZF A;  1QXJ A;  1DBN A;  1MS5 A;  2FCU A;  1XE0 A;  3VD5 A;  2A3W A;  4YGB A;  5JMC A;  3RPQ A;  4CA9 A;  2PXJ A;  4ZON A;  3VBS B;  1LOA A;  4K1Y A;  1MZ6 A;  3HAG A;  2OS2 A;  4FOW A;  2GP3 A;  1OF3 A;  4OI2 A;  3ZXF A;  1AZD A;  3T2P A;  3ZXJ A;  4A3Z A;  5HI0 A;  1G9D A;  3B9C A;  3VZM A;  1WW7 A;  1QU0 A;  3NST A;  4MGI E;  5KXE A;  5GZD A;  2RS1 2;  4RQP C;  1JUH A;  3I2D A;  3WQ0 A;  2ADD A;  5B2G B;  1OQ1 A;  1WCQ A;  2XBO 3;  2WYF A;  3ES1 A;  2E63 A;  1ZRD A;  1BVP 1;  1PM4 A;  4FQZ A;  4CXY A;  4WVM A;  4YVW C;  5C3P A;  2B46 X;  3CJI A;  1DQ6 A;  4Y26 A;  1VMH A;  1LNS A;  3K3O A;  4LOS A;  4OHY A;  4Y22 B;  4OI0 A;  2P34 A;  3KGL A;  3M8L A;  3J7M A;  4QQO A;  3FLT A;  3OPT A;  1S0B A;  3R0R A;  4FAG A;  2TUN A;  4IET A;  2VXR A;  1AR8 1;  4K1Z A;  2W1U A;  1SLL A;  2Y0I A;  3INA A;  3ZSM A;  4XF4 A;  5HCH A;  2VOT A;  3J26 N;  4JGZ C;  4XJ8 A;  5FJK A;  4YAR A;  1TMF 1;  2DVF A;  2Q30 A;  2D40 A;  1YCI A;  1LU2 A;  3WR0 A;  2A3X A;  1NZC A;  4LBM A;  5I93 A;  4XDP A;  1ND3 B;  4BJ0 A;  1G6N A;  1DZQ A;  4I0A A;  4CU9 A;  1H4H A;  1N1S A;  1QIQ A;  2NN8 A;  3APB A;  3GZA A;  4XQ4 A;  3S5A A;  5FKC A;  4A2U A;  3J8F 2;  5BXX A;  1RUH 3;  1UO9 A;  2E33 A;  3ZN6 A;  4B1M A;  3W20 A;  4RR3 B;  3ZX7 A;  2C9K A;  2VMH A;  3R4S A;  1HQN A;  4XQD A;  1EYB A;  5DXD A;  4Z8B A;  2GND A;  3U37 A;  3TN9 2;  2WFF 3;  4AED B;  2RS3 3;  4DRR A;  5IVC A;  1JZ2 A;  3U10 A;  5CYY A;  4XIO A;  1STM A;  3EQE A;  1URX A;  3BGA A;  5IHR A;  3ZR5 A;  2WO3 A;  1UY4 A;  4ZY9 A; 
#chains in the Genus database with same CATH homology
 1NAE A;  3K4D A;  3LPF A;  5J1X A;  4PT6 A;  2Y6K A;  1EUT A;  3K4Z A;  1UXZ A;  3I3B A;  4M4P A;  3VD7 A;  2J22 A;  3WNM A;  5DQ0 A;  4QPW A;  3C7H A;  3I2G A;  2BGO A;  4CUB A;  4XZU G;  5JXH A;  2VCC A;  1CZT A;  2Y6L A;  2X05 A;  1O8S A;  5DN2 A;  2DCK A;  1K45 A;  1GOF A;  2R7E B;  3LPG A;  3LEK A;  1ULO A;  1GQP A;  4PQQ A;  1F4H A;  4QX3 A;  3WNL A;  4PF1 A;  3LEG A;  4ZXE A;  4A4A A;  3NRU A;  4A44 A;  1UX7 A;  1PX4 A;  3WSO A;  3MO4 A;  2J1U A;  2BBA A;  3ZM8 A;  2J1V A;  1JZ5 A;  3NJX A;  3K75 B;  1K3I A;  2ZEY A;  2W5F A;  3WF1 A;  4TXW A;  4DXR A;  1UY3 A;  2V72 A;  3OGR A;  4GWI A;  1US2 A;  1OH4 A;  2YB7 A;  4W8J A;  2VMD A;  2VME A;  4AAX A;  1PMJ X;  3I2I A;  4CU8 A;  3J7H A;  1D7P M;  1US3 A;  3T2Q A;  1EUU A;  2RV9 A;  2OKX A;  1TVG A;  3WF4 A;  1GMM A;  3IB3 A;  1JYX A;  4W4Z A;  4D8M A;  3CZJ A;  4QAW A;  4L0P A;  4P08 A;  3FHQ A;  3T0B A;  3UNP A;  3T08 A;  1GOH A;  2VTF A;  1W8N A;  2XOM A;  3C7F A;  2W95 A;  3HNY M;  4MOA A;  5F7U A;  2E26 A;  3I2K A;  1CX1 A;  3I97 A;  3UET A;  2WDB A;  4KI5 M;  2EIE A;  4HG6 B;  1L7R A;  2Y6J A;  1DLC A;  2VL4 A;  5JUV A;  2W46 A;  4XUQ A;  4QDR A;  3GM8 A;  3NJV A;  2CDO A;  3DYO A;  4QB6 A;  2W1Q A;  4MO3 M;  4QX2 A;  5JMO A;  4P00 B;  1OT5 A;  5G05 L;  3SEP A;  2W92 A;  5FUI A;  2LS6 A;  2VZU A;  1DP0 A;  2YFU A;  2RJ2 A;  3I2J A;  1IQD C;  2V4V A;  3MV1 1;  3I2H A;  3LE0 A;  4JKM A;  3SKV A;  2DCJ A;  2YFZ A;  4JKK A;  4XUO A;  5G04 L;  4A45 A;  4D0Q A;  2VMF A;  2PQS A;  2HYX A;  4QB1 A;  1I5P A;  5IFT A;  3SEE A;  2VZ1 A;  1SHW B;  2J1R A;  2VCA A;  3ACI A;  2VO5 A;  1W99 A;  4OUE A;  4DEV A;  1GUI A;  1OF4 A;  1SG3 A;  2KD7 A;  1OD3 A;  1YQ2 A;  2Y8K A;  4XUP A;  4DUX A;  2EID A;  2J1E A;  4ARX A;  4ZZ5 A;  1ULP A;  2LW8 A;  3I3D A;  5B4X A;  2VZR A;  1GOG A;  4DXT A;  4OZO A;  4A41 A;  4UOJ A;  2VR4 A;  4A42 A;  2ORX A;  3FHA A;  2J1T A;  3MV0 1;  1UWW A;  3I3E A;  4P02 B;  4M4R A;  2XQX A;  2V5D A;  1JHJ A;  2VZ3 A;  3CKH A;  2W9X A;  3GDB A;  2ZEX A;  2C4X A;  4Z2A A;  2WZE A;  4KWU A;  1JU3 A;  2EIB A;  3HNM A;  3T2O A;  3HN3 A;  2ZXQ A;  2E32 A;  1JU4 A;  3P1I A;  2VZP A;  1W9S A;  1PMH X;  3WNO A;  3FN9 A;  4BK4 A;  1K42 A;  3OG2 A;  3CZU A;  3A23 A;  5EJZ B;  2B9V A;  2JE8 A;  3I2F A;  1UYX A;  2E31 A;  3HNB M;  2WBK A;  2Y6H A;  3OGS A;  2VCB A;  3ACF A;  2C26 A;  5I0D A;  4LQR A;  3DYM A;  5JR2 A;  5JXI A;  1KGY A;  1RYY A;  3OEB A;  5CZK A;  4QX1 A;  1UXX X;  2JD9 A;  2YC2 A;  1UYY A;  5C7G A;  4TTG A;  2CDP A;  3NNG A;  2QQK A;  1MPX A;  3WF0 A;  1L7Q A;  3DYP A;  3C8X A;  1CZS A;  1JYN A;  2X09 A;  3MUY 1;  2W1W A;  1BHG A;  4BK5 A;  1JYW A;  4OYU A;  2WAA A;  1R64 A;  2VQT A;  3IDA A;  2XHN A;  2W3J A;  4XUT A;  2WUH A;  3K46 A;  4W50 A;  3K77 A;  4MAD A;  2VZS A;  3VD4 A;  3HPN A;  4QDS A;  4OMC A;  4LKS A;  2J1A A;  1K12 A;  1JZ7 A;  4UAP A;  4CVU A;  4AG4 A;  4XUR A;  2QQN A;  2W94 A;  3VDC A;  3CQO A;  1JZ4 A;  2JDA A;  3III A;  2WO1 A;  1NX9 A;  5IJR A;  4E8C A;  2VZT A;  2J1S A;  2Y64 A;  2QBX A;  1XC6 A;  1O8P A;  2QQO A;  2X10 A;  4LPL A;  4JX0 A;  3VDA A;  3E1F 1;  2J7M A;  4ET7 A;  4GZ9 A;  2VMC A;  4FI9 A;  3HOB A;  4P5Y A;  5C70 A;  1XNT A;  2WYS A;  1UYZ A;  5DMY A;  1PX3 A;  3VDB A;  3OBA A;  3MUZ 1;  4QDQ A;  2RVA A;  3C7G A;  2WAO A;  2QQI A;  1P8J A;  2W91 A;  4BDV B;  1JI6 A;  1TG7 A;  3BN6 A;  3VD3 A;  5HPO A;  3OEA A;  5JXG A;  3ACG A;  5IYY A;  2W87 A;  2W47 A;  4CUA A;  1NUK A;  2VJX A;  3EYP A;  5DPN A;  1H6Y A;  3ETP A;  4RN5 A;  3WNK A;  3AC0 A;  1GNY A;  1T2X A;  1W0N A;  3CMG A;  3EB7 A;  2VM9 A;  3GGL A;  4LHS A;  1GU3 A;  1XNA A;  3NQH A;  1H6X A;  1F4A A;  4JHZ A;  2WN3 A;  4ARY A;  1CZV A;  1NKG A;  3ECQ A;  4DEQ A;  2L9L A;  3F2Z A;  3GXU A;  3ABZ A;  5IFP A;  4CU7 A;  1WKY A;  3WNP A;  3LQC A;  3THC A;  3WF2 A;  5C71 A;  3K4A A;  3T09 A;  3HJR A;  2BGP A;  3W5N A;  2ZEZ A;  3SKJ E;  1CIY A;  3WF3 A;  3A21 A;  3THD A;  2VZV A;  1UMI A;  3DEC A;  2DDU A;  1UY1 A;  1J83 A;  3VD9 A;  5LA2 A;  4ZZ8 A;  1UMH A;  1UY0 A;  2Z4F A;  2EIC A;  3IAQ A;  1UY2 A;  3HEI A;  5LA0 A;  4DXS A;  2Y6G A;  1J84 A;  4XUN A;  2WQ8 A;  1W9W A;  2BZD A;  2HLE A;  5HXM A;  3OGV A;  2VQU A;  4IUG A;  4BXS V;  2WAB A;  1UZ0 A;  1HN1 A;  2WO2 A;  3ACH A;  4KMQ A;  5LCW L;  1JZ8 A;  3OB8 A;  3C7O A;  3JXS A;  3T0D A;  5EJ1 B;  2YC4 A;  3MBW A;  2WN2 A;  3VD5 A;  1KEX A;  1JYV A;  3D3A A;  4UI9 L;  4CU6 A;  1OF3 A;  4A3Z A;  3T2P A;  2VZO A;  4XVH A;  4MGQ A;  2QQL A;  2YG0 A;  1W8O A;  5JXJ A;  1WCQ A;  3A22 A;  2ORZ A;  4E8D A;  2BER A;  4GWJ A;  3T0A A;  3FL7 A;  1JZ3 A;  3CIH A;  3WQB A;  4A6O A;  2WZ8 A;  1W9T A;  4DUV A;  4JKL A;  1XPW A;  1LNS A;  5B4N A;  4MGS A;  2B4K A;  2VC9 A;  3C7E A;  3P6B A;  5EIY B;  5LA1 A;  4OMD A;  2W1U A;  1JZ6 A;  3W5M A;  2VOT A;  4DUW A;  4CUC A;  2QQJ A;  3UES A;  4YPJ A;  3PUH A;  2W1S A;  3WEZ A;  4BJ0 A;  4CU9 A;  3IAP A;  2VZQ A;  3LEI A;  4QX0 A;  1DYO A;  2ID4 A;  2E33 A;  1SDD B;  2XON A;  3CDZ B;  4QB2 A;  2C9K A;  3WNN A;  2QQM A;  3U37 A;  3A7Q A;  2ZEW A;  1JZ2 A;  1O59 A;  5A1A A;  4RYD A;  2JKX A;  5CYY A;  5IHR A;  3BGA A;  3PUI A;  2WO3 A;  1UY4 A;  4ZY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...