2W1UA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,3) galnac
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1uA00
5F7UA 2C9KA 4XVHA 3WEZA 5HXMA 4A45A 2Y6GA 1UZ0A 5B4XA 2OKXA 1NUKA 5IFTA 3I2GA 1RYYA 4W4ZA 3ACGA 3WF0A 5C7GA 3C7EA 2VZ1A 1CZTA 1K45A 4XURA 1UY0A 3BGAA 2BGPA 5DPNA 2W92A 3A23A 3NJXA 4A6OA 2QQKA 3OG2A 1JU4A 3I3BA 3DYPA 3C8XA 4DUXA 4OMDA 4MOAA 3K4AA 3J7HA 2W1UA 2VZTA 2VL4A 3MUY1 2VZPA 1UWWA 1WCQA 1XNTA 2WUHA 2QQNA 3WNPA 4UI9L 3VDAA 4E8CA 3LPFA 5IFPA 3PUHA 5G05L 2VZ3A 2CDPA 4ZZ8A 3OGSA 4QAWA 4DUVA 4QB2A 3C7FA 2E33A 3NQHA 1CZSA 2ID4A 3CIHA 3VD5A 5HPOA 3C7GA 3IAQA 4DXRA 2EIEA 2W9XA 1GNYA 3GXUA 3LPGA 1SDDB 2J1VA 3BN6A 2VMCA 3ETPA 4DEQA 3HN3A 4DXTA 4D0QA 3UESA 2QQMA 4DXSA 1UXZA 3IIIA 1GOGA 2KD7A 4XUQA 3C7HA 4Z2AA 2VZOA 4ET7A 1NX9A 2ZEZA 1US3A 3K75B 3T09A 1JI6A 1R64A 4E8DA 1UYYA 1OH4A 2WABA 1IQDC 2VQUA 2DCKA 4FI9A 3CZJA 2W46A 4OYUA 2DDUA 5A1AA 1XNAA 3WNKA 4A42A 4MGQA 3IAPA 4MADA 3K4ZA 2VJXA 3LEGA 1GUIA 2HLEA 2VCAA 1TG7A 4P5YA 1J83A 1WKYA 3I3DA 3OGVA 2J1UA 4W8JA 3LE0A 5EJ1B 5DN2A 4CU8A 4QX1A 1NKGA 4QDRA 4M4RA 3SEEA 3W5NA 4ARXA 3CQOA 5JMOA 4W50A 2Y6JA 1W0NA 1EUTA 3K46A 5I0DA 2WZEA 4MGSA 3AC0A 1P8JA 5JXIA 3LQCA 2YG0A 4HG6B 1UYZA 5EJZB 2L9LA 2ZEYA 1UY1A 3GDBA 1OF3A 2ORXA 1UMIA 2WDBA 1I5PA 2JE8A 4BJ0A 1UY3A 1PX4A 1SG3A 2RV9A 1MPXA 2WAAA 2WQ8A 4PF1A 4L0PA 3SKVA 5JXHA 2WN2A 3NNGA 2YB7A 2W87A 4MO3M 3T2PA 1XC6A 2EIDA 1DYOA 2BGOA 2J7MA 3K77A 4QX3A 2QQOA 3A7QA 3I2KA 2WYSA 2J1TA 1EUUA 2J1EA 3OGRA 3A21A 4LQRA 3SEPA 1W9SA 3P1IA 3WNLA 3WNMA 2ZEXA 3VDCA 2R7EB 2WO1A 3P6BA 3PUIA 3VDBA 3DYOA 2XONA 2W3JA 2WAOA 1XPWA 3JXSA 2J22A 2C4XA 3FL7A 4A3ZA 2YFZA 5JXJA 2W91A 2W47A 4JKLA 1JHJA 2XOMA 3VD4A 4CU7A 3ECQA 4XUNA 1PMJX 1GQPA 2VOTA 4PQQA 4BK4A 4CU6A 3HNMA 3T0BA 4XUPA 3MV11 1KGYA 3F2ZA 4A41A 3GM8A 2B4KA 3ABZA 2XQXA 1JYWA 3FHAA 3MO4A 2W1WA 1SHWB 2HYXA 1W8OA 3MBWA 3MUZ1 1KEXA 4QB6A 3I2FA 2E32A 1US2A 2VQTA 3T0AA 3LEKA 5JUVA 3GGLA 2VR4A 2X09A 1W9WA 3FHQA 2XHNA 4KMQA 1ULOA 3IDAA 4BDVB 4CUBA 4ZZ5A 2W1SA 3VD9A 3NJVA 4GZ9A 3SKJE 3NRUA 1JZ7A 1PMHX 1UX7A 2X10A 4ZY9A 2V5DA 1GOFA 1UMHA 2E26A 3UETA 2VZSA 3WNNA 1OD3A 3W5MA 1GMMA 4YPJA 4A4AA 2Z4FA 3D3AA 1H6YA 3WSOA 2EIBA 1UXXX 4GWIA 2YFUA 4JKKA 4M4PA 2VO5A 2Y6HA 3CDZB 4QDSA 4AG4A 1K12A 3WF3A 3VD7A 5LCWL 2W95A 4TTGA 3HEIA 2BBAA 2W94A 3WQBA 2RVAA 4DEVA 4BXSV 2JDAA 4QDQA 1OF4A 4P00B 2EICA 5J1XA 2LS6A 1BHGA 1F4HA 3OEBA 2ORZA 3A22A 1T2XA 1UY2A 1O59A 1JYVA 2J1RA 4JX0A 1UYXA 1JZ2A 2VC9A 4XUTA 3UNPA 4XUOA 5EIYB 4QPWA 1JZ6A 3T0DA 3T2QA 2YC4A 5FUIA 2VCCA 4OZOA 5IJRA 1D7PM 3U37A 2X05A 3T2OA 1O8SA 4OUEA 1H6XA 5C70A 1PX3A 2E31A 1DP0A 3I2HA 3I97A 2ZEWA 2Y64A 5CZKA 2RJ2A 3IB3A 1YQ2A 4CUAA 4P08A 2WO2A 4OMCA 5IYYA 2JD9A 3E1F1 5LA1A 4IUGA 1GU3A 4LHSA 4CU9A 2VMEA 1W9TA 5DQ0A 3ACHA 1OT5A 5IHRA 2QBXA 3HNBM 2VZVA 3FN9A 3THDA 5CYYA 1K3IA 3I2IA 2ZXQA 2VZQA 1JZ3A 4PT6A 4XZUG 4CUCA 1L7RA 1NAEA 1O8PA 1CX1A 2C26A 2VZUA 5LA2A 1LNSA 3CZUA 3OEAA 3DYMA 5DMYA 4AAXA 2VTFA 4P02B 3OBAA 3I3EA 3ACFA 3I2JA 2BZDA 4GWJA 3DECA 4A44A 1TVGA 4JHZA 5G04L 3EB7A 1JZ5A 1JYNA 1K42A 2WO3A 1JZ8A 1F4AA 2WN3A 4LKSA 4D8MA 5B4NA 1J84A 2PQSA 3WF2A 4ARYA 2W5FA 5JR2A 3WF1A 2VMFA 2VMDA 5JXGA 3LEIA 1W99A 3T08A 2Y8KA 1JYXA 1JZ4A 4UAPA 1GOHA 2W1QA 4QX2A 4RN5A 1W8NA 3THCA 3WNOA 2JKXA 3CMGA 1CZVA 4BK5A 2J1AA 3OB8A 1HN1A 1ULPA 2B9VA 4JKMA 4KWUA 2BERA 2WZ8A 3ZM8A 3HJRA 4QX0A 2VCBA 3HPNA 2J1SA 2VM9A 5C71A 2V4VA 2V72A 4RYDA 4CVUA 2QQIA 2Y6KA 1DLCA 3VD3A 3C7OA 3WF4A 2VZRA 5LA0A 4DUWA 3MV01 3HNYM 2CDOA 1JU3A 2WBKA 2QQLA 3ACIA 4ZXEA 4UOJA 4TXWA 2LW8A 2Y6LA 1CIYA 4LPLA 1L7QA 1UY4A 2DCJA 3EYPA 4KI5M 2QQJA 4QB1A 2YC2A 3CKHA 3K4DA 3HOBA
chains in the Genus database with same CATH superfamily
1IG3A 4XBLA 1BQPA 3EJKA 4A2UA 3PL0A 1S0BA 1OOPA 1V6LA 1ZYBA 2K2SA 2ZOEB 2FDJA 3NW4A 2AH2A 5I0RA 1OUXA 3LB9A 1ULGA 5CFDC 1QY4A 1IHMA 2XBO2 4HN0A 1UZ0A 5EWSA 1EAH1 4ZU4A 5AC91 3I2GA 3N7LA 4A6SA 1DIWA 3ACGA 4W65A 5KR7A 3F95A 1RUJ1 2WNVC 5DZFA 1A8DA 5C7GA 5FWJA 2ZGNA 3OPWA 4PIYA 3ASIA 3I7DA 1K45A 2YPJA 5SV5A 1QQP2 2ARCA 1YCIA 4NR1A 1RUJ3 1J1LA 3WW2A 1RXFA 1S2EA 2RS53 5HCFA 1VRH3 3J9SA 2CHHA 5CFDB 1WA6X 4O65A 3DGTA 1OPMA 1YJKA 3OG2A 2PHFA 1RUH1 4EN6B 1W3VA 2B9UA 3I3BA 3DYPA 3C8XA 4ASMB 4AVSA 3T1MA 1WUVA 2WNVB 1VBE2 3FMGA 4OMDA 1RUI1 3K4AA 3BOPA 3I3MA 1RUH3 3U78A 4XJWA 2VL4A 3MUY1 1HIXA 4NIDA 4HT1T 3TWIA 1N1VA 5DAWA 3QBQA 1Y9MA 1UOBA 3EO6A 2Q4SA 2JJ6A 2LROA 3URFA 4LLOA 5ISLA 1F15A 5FXWA 4DFSA 5FUNA 1W05A 4QPIB 5F32A 1GNHA 1V9U1 3NWKA 1WD4A 3LPFA 1HRV3 3M3CA 4MHUA 1QJFA 1C8M3 3HQXA 4GMP0 2HYKA 4JDNA 3U1XA 4AAPA 2RG4A 5G05L 1NE6A 1I5ZA 1X9PA 1V9U3 5FZ3A 3OGSA 5EZWA 4BQ5A 3O12A 2QVSB 4IGQA 2GP5A 5FO7B 4A3XA 3C7FA 3ENRA 4QMAA 1TNFA 4WVMB 5GZFA 2D40A 2ID4A 2WC2A 1FNYA 1C5HA 1JMUB 4AI1A 2E51A 2GH8A 3KT1A 1HJFA 4WBBA 2EIEA 3AKRA 4YLZA 1D0HA 3U14A 1JOPA 2KM2A 2PAMA 2WZR1 3FX3A 3Q8AA 4YM0A 2GN7A 2DVFA 2D6MA 4CXXA 1R093 1VBA2 3LEMA 5GZCA 2QQMA 2ZGSA 3WG2A 2WA3A 3CJXA 5BUVA 1N3QA 1UXZA 4IEOA 5FKCA 2Q0AA 1UPSA 5FK7A 2WS92 3O1SA 2VZOA 2FDIA 4C90A 4ET7A 1F35A 4B29A 3RZMA 1UF2C 3K75B 1WMFA 4UW3A 4FTSA 1UYYA 1OH4A 3ON7A 1VB2A 2RDNA 3AZVA 1ZREA 1W8HA 1J58A 3VZNA 1NCQA 2DCKA 2E63A 4FI9A 3CZJA 4YVSC 3H8RA 1YYNA 4OYUA 4CRQA 2DDUA 4UYBA 4ZU5A 5A1AA 2ERFA 1UQXA 3WNKA 4WZFA 2XH6A 4COZA 3UKNA 5IVFA 1QU0A 4L97A 2ZPXA 3IAPA 2AYHA 3WQ1A 3C2UA 1HX6A 5DDJ1 1YFYA 3TNPB 1Q8PA 1GUIA 3SCHA 5CG8A 1OA2A 2D97A 4HMZA 4Q4W1 4PI0A 1U5IA 2D43A 3E97A 4LLFA 2J1UA 5FPLA 1S0JA 4YVSB 3UYJA 5H9RA 4L92A 4AGVA 4U36A 1PM7A 4U2AA 3D5OA 2D98A 1ZBA2 4Q4W3 3U10A 2DVBA 3I59A 3KSCA 4OFGA 5A3LA 4UF0A 1ZBE2 1JOJA 4Y24A 4X8PA 3RG0A 4BMEA 3W5NA 2PFWA 1W6NB 5FY1A 5JMOA 4BQ3A 1Q8OA 2Y6JA 3O1RA 1WW6A 1EUTA 3MW2A 4UT5A 1AR91 3T3YA 3KGLA 4AXOA 4BXFA 1CIWA 1UNBA 4E27A 2VULA 1W06A 3GZUC 1REEA 2HWB3 4MGSA 4YW3A 1P8JA 1V6KA 3HQRA 3AFGA 4M01A 4XAAA 3N9PA 3RWKX 1V70A 1LENA 4HG6B 5LBEA 1J3RA 1FPN2 2JEMA 4C0HA 5DABA 1S0CA 1ENSA 5EJZB 5HV4A 5IK5A 5I8TA 3LGRA 3AKQA 3AVSA 1UY1A 4QHOA 4S2DA 3ORJA 1RJ7A 1ULDA 2WDBA 3ZOIA 1I5PA 3BVCA 2ENRA 3BU7A 1PX4A 1SG3A 1N1SA 3SITA 2R0HA 1MPXA 3JB8A 4NPMA 3O1OA 2FCUA 2WAAA 3O0VA 4L0PA 4PF1A 5SV8A 2DU1A 2WN2A 2WT0A 3NNGA 5AVAA 2X8KA 1WZXA 5FZ6A 1VBB1 3GNEA 4FFIA 4XDPA 1B35C 1DYOA 3ZFGC 1OBNA 1YIFA 2BGOA 3EXUA 5JIAA 3K77A 1F8VA 4LUMA 3LFIA 2NZ9A 5C3RA 1XRUA 1VBB3 2QQOA 1Q5OA 4R4XA 3A7QA 5L9RA 3AKTA 4FFGA 4ZS2A 5FAXA 3I2KA 4DS0A 5F9TA 3OGRA 1EUUA 2OYZA 1DBNA 1U5YA 4YGCA 3WR0A 5KHKA 4XF3A 4QXBA 1J3PA 4B1MA 1OLME 3IDEA 5FTTC 3VDCA 3ZFGB 5IK7A 1WBLA 3HD8B 1DGLA 4GAZA 4IEXA 2WR9A 3UKVA 4B4RA 2YU2A 5I0UA 3VZLA 1G9BA 1FOD2 4FPKA 3DYOA 2XONA 4XZPA 2BGCA 4XXAA 2WAOA 1O5UA 5ANQA 2QQVA 2C4XA 1XNDA 2DF7A 1BEV1 2GDFA 2XG3A 2YU1A 4MGYE 1SPPB 2YFZA 5JXJA 2HWE1 2MEV2 3KV9A 4V2VA 4EN0A 1CAUA 4J1WA 4CU7A 1KS5A 1RUE3 2VNOA 3OJBA 1N47A 2HWE3 4YW1A 5BXXA 3VHPA 4CU6A 4B7KA 2AUYA 4MGTA 2OUHA 2QQUA 2XVGA 4RSUA 2FDKA 1RHI3 1LCLA 4AGRA 5FV3A 4TSVA 3B02A 5FZLA 5C3PA 3MV11 3B7MA 1LECA 5T3NA 2JDPA 4KNCA 2JKBA 1SLIA 4A41A 2XQXA 5F3IA 3WDXA 2CL2A 3E5UA 3NJYA 1W8OA 1SLLA 2O8QA 4XF4A 4OHVA 3O1MA 2XBO3 1UU5A 3MPBA 1W9FA 2D3RA 2GMEA 2VQTA 3H8OA 1QQP1 1X7NA 4QKNA 2OA2A 1PVXA 2OX0A 5FZMA 1WMDA 3VKNA 4O9EA 1RUC2 2XHNA 3IDAA 1KQRA 3AYEA 2LUWA 4JVAA 4ZZ5A 4M0NA 5A6YA 1OA3A 5FZGA 4XJUA 1WCSA 4IE0A 3K48A 4HK9A 4AL9A 4GZ9A 3SKJE 3AMNA 3HBKA 2BFUL 3NRUA 3KZ4C 4NWVA 1JZ7A 1YHFA 4ZY9A 1REFA 1ALYA 1TME2 1UMHA 3UETA 3VBRA 2VZSA 1E5IA 1VBE3 5KHHA 3WNNA 1OURA 4YPJA 2Z4FA 3NV4A 4AWDA 5K0UA 1FNZA 1PO12 4N8MA 2YFUA 3I8TA 2VO5A 2Y6HA 3CDZB 3KGZA 4AQSA 4Z8BA 1DU3D 5DUWA 5T50A 3WW1A 4OHZA 1K12A 4YZ4A 3H3ZA 2WQ4A 2VCMA 2EXIA 2G19A 2W95A 2ATFA 4JGZC 3ZLIA 5L9BA 2IZWA 2YUEA 3NV3A 1PNGA 3M8LA 1UOFA 2QZ2A 2JDAA 3QD6A 4P00B 3KWVA 2EICA 1SLBA 2ZGRA 2LS6A 2D5HA 1AR72 1GZWA 2CU5A 4DMIA 2EXJA 1AR82 2NN8A 3ZSEA 5FY4A 1HQWA 4NIIA 1JYVA 2Q8DA 2DYCA 4GXLA 4JX0A 3PDQA 4CCJA 4JGZB 2NYYA 4YVWA 1POV1 1QJU1 5A3OA 3WP4A 3UKTA 1VBC2 4BLJA 4XQ4A 1MS8A 3VBOC 1VBD1 4O9GA 3MLJA 5DUUA 1PIV2 2QDRA 1VBA1 4AHZA 1POV3 5T5OA 1JS9A 1GWLA 1S0IA 4QPWA 1I3HA 3QH6A 5FYZA 1ZRDA 1QXPA 1QJX2 4HKWA 2YC4A 3ZSJA 1VBA3 4DZGA 5FMDA 2RS13 1QDCA 1JODA 1MACA 1PO21 2BOIA 2X05A 3M1HA 4OUEA 2CAVA 4GJYA 4IEUA 4MXWB 2WS93 3NAPA 3ZXDA 3S7IA 2E31A 1DP0A 4Y3OA 3AZYA 4XQDA 5H9PA 5LK7B 4BIFA 2WIIB 4QM9A 3I97A 1RUG2 3WOGA 5FZFA 3Q8EA 3U07A 1ZA4A 1R082 4GH4A 5CZKA 4BHPA 5IVJA 2BYVE 4CDQC 5LATA 3MW4A 1QXJA 4H14A 1OLMA 1VJ2A 4FPJA 3RDIA 4OQ9A 4MYEA 3AX4A 4RGGA 1ZVFA 4GIQA 2Y0OA 5L7OC 1CAXA 2XJPA 1Y9GA 1CAUB 4OMCA 4F7ZA 2ZHMA 1MS9A 2A3XA 2XJSA 5AVPA 3BB6A 2XWBB 1GU3A 4LHSA 4YM3A 2HH9A 3E6BA 2ZX3A 4FQ4A 4LBNA 1ZBA1 4CDQB 1ND3A 5IHRA 1DQ5A 3BI3A 3JCIA 5A7QA 1R1ZA 2RMU2 2VZVA 4K6BA 4AEDC 1ZBA3 2IC1A 5L7OB 5FMCA 2WSVA 1ZBE3 5FQ0A 2VGDA 2DCZA 2YY1A 1PZ8A 4P14A 4PT6A 1KFXL 2JX9A 2CTVA 3IMMA 3B69A 1O8PA 4Q0PA 4H7MA 3VL9A 1LNSA 1Y4WA 4AQ2A 2JE7A 3OEAA 5A6QA 1FPN1 3B5LB 3VBUA 1HN0A 2Z42A 2ZGUA 4GA9A 5A7NA 4AEDB 4Q0QA 3VBRC 4NE9A 2Q1FA 1W6PB 2WRAA 4KWLA 5LA9A 1AX2A 4LKEA 3NNMA 1PVC2 2J42A 2VOVA 1DZRA 1BCXA 1LHNA 1LJ7A 3I3EA 4LTAA 3ACFA 5GZEA 5IVVA 1EPZA 1PK6A 1LOAA 1LRHA 5IVBA 4FXKB 1SLTA 2AACA 3KMHA 5EHDA 4GKXA 5G04L 2GSYA 4JDMA 4CP0A 1K42A 1ONAA 1JZ8A 3NL1A 3E6CC 1OA4A 4D8MA 5B4NA 1FXZA 1J84A 1DLLA 1UZVA 4JV4A 1O91A 5FPZA 3ME2A 2YC0A 4LE4A 3VBRB 3WF2A 5CBLA 2W5FA 1NLSA 1XE7A 1LOGA 3WF1A 3EHKA 4XEZA 4D7YA 4GKYA 4ZHNA 2XGXA 2SBAA 2VMDA 5JXGA 5FP3A 1IKQA 1W99A 2D5FA 1OI6A 3GYDA 4CP2A 4UFLA 2RJKA 4M3CF 4Z92B 1GV9A 4YVWC 4QX2A 4I02A 1XE0A 2RS52 3B94A 2D6NA 1W0OA 1W8NA 5DZGA 4Y4YA 3AMMA 4WM7C 2FZ1A 4PF5A 3N9QA 3UJQA 2IFRA 1SACA 4YW4A 5ERLA 2CV6A 4FAHA 4JKMA 1A34A 1CAVA 3ZXFA 3V0BB 5KC6A 2R061 1FOD1 4YGBA 1QXRA 5FP8A 2BERA 1EV13 3PJQA 4QX0A 1G9CA 1DGWA 1Y3TA 3AJYA 1NQDA 3HPNA 1W6QA 4I0WB 4RFRB 4YVWB 5FLHA 5F5AA 4B3NA 4FAGA 1YEWA 4PIXA 1FOD3 5ACA3 2P5BA 4XCBA 2GMMA 4WM7B 2JE9A 4QGLA 4RYDA 2A6XA 3NO8A 3VD3A 1CX4A 2GNTA 1G6NA 2GNBA 2VZRA 5FP7A 2ARAA 4AFMA 2MEV3 4BH9A 2JECA 4BWOA 2VNVA 3HNYM 3L9JT 5FZ9A 3WG1A 5FDBA 2UYBA 3THPA 3CLPA 5A7PA 4ZXEA 4TXWA 1UO9A 1H2LA 2Y6LA 3NKTA 4NAOA 4LPLA 1WD3A 3RYRA 2YZ4A 1SMVA 4AI3A 3KB5A 1GP4A 3WDWA 1RUNA 5J96B 1IPJA 4XACA 3EYPA 1VALA 4KI5M 1IS6A 4CCMA 5FY8A 4QB1A 2A3WA 4Z07A 4FFFA 5CB7A 1N1YA 4XMAA 2DUPA 2JENA 3TEWA 3OUHA 1RB8G 4XBNA 5FREA 3ZXLA 3N7JA 1CAXB 4FOWA 4AR2A 5CKMA 1XYNA 3AP4A 4EE2A 1BMV1 1SBDA 4L11A 4HVRA 2PHDA 2O14A 1RUC1 4YNIA 4WVVA 4IL7A 2RHPA 2UWCA 2P3JA 4IEZA 4Y20B 5FBZA 1W6OB 2BU9A 1RYYA 3JBG2 2TUNA 4B7EA 1RUC3 4CYDA 4I0AA 2WYFA 3HAGA 4XFFA 3IPVA 4PBOA 5A7WA 1YQ5A 3C7EA 2JG8C 2VZ1A 4LNVA 1CZTA 2HWC2 2XL7A 1UY0A 1PMIA 3MFCA 1UX6A 5F5QA 3FJSA 4MZUA 1W8FA 3KV5A 1PO11 4LBQD 2BW8A 2BGPA 4KWKA 2VMGA 5DPNA 1PK6C 1TME3 2QQKA 4DXZA 3MLLA 1S0FA 2ZACA 4UW6A 2Y60A 2BFUS 4UW5A 3SC7X 2FZ2A 2DFCA 2JDNA 2JB8A 3OCPA 3J7MA 4ZPIA 4Y1YA 1PO13 4YFWA 5DUXA 1AX1A 4YWAA 3VBUB 2O0OA 2V5YA 1YIPA 2JG8B 4UBGA 5IK4A 5A3MA 2W1UA 4BU2A 4I30A 1BK0A 3UT0A 4EN9B 2A6VA 2HJIA 2E6VA 2IXHA 4AVBA 5HXVA 1AR71 5FPBA 4JRAA 1OFNA 2ET1A 3OPZA 1PK6B 4GJZA 3O7OA 4RGKA 2Y34A 4NROA 1OUSA 3JQWA 4UI9L 1WA4A 3C3VA 1V6IA 4I0BA 3RPQA 3VDAA 5A3TA 1AR83 3LCPA 3S0MA 2IXJA 2WNVA 3PLQA 3PUHA 4M0HA 2ZA9A 2GZWA 4FPLA 2HWB2 3SQOA 3IWZA 3KCXA 1Q8SA 1VBC3 4XJZA 3N7MA 4EV0A 3HMYA 4W6XA 1ZZCA 1KXGA 1QJX1 1PIV3 1GZTA 5C5UA 3MYXA 3H7YA 2XLAA 5E89A 1AR61 3C7GA 3VD5A 5HPOA 3PIJA 4ONUA 2W9XA 4IE7A 3GHNA 3PU3A 1OMIA 1NXMA 3GXUA 2J1VA 4OUSA 5K8SA 4GB32 4S2FA 4KH9A 1JYCA 4CCEA 2RE9A 1URXA 4GALA 1RUG1 4GMP3 4NHYA 3WUDA 2NM1A 3WDTA 3LDRA 1X33A 2JWPA 1CESA 3U4SA 3IIIA 5C3SA 1GOGA 4AYUA 5FYVA 2PHUA 3O14A 4JC1A 2X53S 3WV6A 2G9GA 1R083 2ZEZA 1US3A 3T09A 3U0ZA 5FP9A 3ZN5A 4WVZA 5J36A 1LOFA 1O3SA 4AOCA 4SBVA 1JH5A 1PGSA 3TBDA 1AVBA 1IQDC 1AXKA 2KR2A 4HLTA 2P37A 2WWJA 5A3UA 1XSRA 1V6MA 2A6WA 2RS32 1KJRA 5LEKA 2YV8A 1NY72 4QPGC 4MGQA 2RMU1 2PLV2 3LEGA 2HWD2 2HLEA 2ZTNA 4Q4X2 2VCAA 4P5YA 1N1TA 5LRSA 5JVVA 1J83A 1WKYA 2WWSA 5J98B 3IKWA 4FPFA 3GZTB 4W8JA 5CG9A 2AZ5A 2P6HA 1W2NA 2OUJA 1X8EA 1H4HA 2Y6FA 5FYSA 5FZDA 3RWNA 4UW4A 4CPBA 5LK5A 1W2OA 4CU8A 3MIFA 4XCAA 3R6SA 3SCFA 5KC5A 4TLGA 5KHGA 4AFAA 3EQEA 3LIGA 3POJA 1ZZ8A 4Y33A 5DAXA 3SEEA 3TN92 1ODNA 1T6GC 2B45X 4GWNA 2JDYA 1PVC1 2Z79A 2IXIA 4DRVA 1EY2A 3M3EA 1ND2C 5AFBA 4M00A 1OH3A 4BM8A 2WZEA 2YGLA 5L36A 4PCRA 1GYKA 2P3YA 3LQCA 5FYTA 5FZBA 3KVAA 5T52A 3PVEA 5BYNA 1CWPA 2EF6A 1UYZA 1OHFA 4DY3A 1M06G 2VW0A 1W6NA 2H0BA 4CE8A 1OF3A 1UMIA 3CL1A 3PUQA 2WLPA 3DKWA 1DF0A 1ND2B 2A5ZA 2DUQA 2JE8A 1DG6A 2WSUA 1UY3A 2ZCWA 4BJ0A 5FPXA 2ZHLA 3ZYHA 1MEC2 1WW4A 1DQ4A 3SLIA 1S55A 1BBT2 3TOJA 5JXHA 2RS51 3AXDA 1VRH1 3HN1A 3IMNA 5FYUA 1AHSA 2FHRA 1H2NA 4HZFA 4MO3M 5IT6A 4LIUA 2R072 4EQVA 1DYPA 3VHNA 3JD72 3PTYA 5A6ZA 2DVDA 2D6LX 2PYTA 5JZGB 1ENRA 4Q1PA 2QTWB 3ILFA 3POBA 4LULA 4X8NA 2EXHA 5FKBA 1XE8A 2WYSA 1U5XA 3H7JA 4FQZA 5HCBA 3ZIWA 4LQRA 3QCWA 1HDKA 1DQ2A 2EAKA 3DEMA 1HLCA 2A75A 3IDBB 4XAEA 4LK6A 1MZFA 2ZGQA 1ZZBA 4O61A 3VDDC 1DDLA 1CJPA 4XJ9A 4HFSA 1HRV1 1C8M1 2OQ6A 3WUCA 1GSLA 4YW7A 1UZWA 2VUDA 3D0SA 2XJUA 5H9QA 2YGMA 1XPWA 3ZYRA 3L2HA 3JXSA 2XLGA 4XBQA 3B9IA 3B00A 4CDUC 1YUDA 5JSPA 1LOFC 2BBVA 3ZFGA 1B35A 1TZOA 3E6DA 3O1PA 3WT3A 2BWAA 2BQPA 2F6BA 5CKQA 2XOMA 4C8DA 3VD4A 5T5PA 3S57A 3ECQA 2E7AA 3AP7A 1PMJX 2F17A 1GQPA 4OHXA 2PMWB 2VOTA 4Y1XA 4LBQB 4CEYC 2VG9A 5FCCA 1H2MA 1R091 1H1AA 2JD4A 4K1YA 3DXTA 2CSGA 4AI0A 5JSOA 2ZZQA 4BA6A 3HNMA 2VW2A 4Q8LA 1SPPA 2VXRA 5FZCA 2AEYA 3P3NA 3MF6A 3NNFA 1KGYA 3CBNA 3F2ZA 4L2NA 1WLCA 2RS12 3ABZA 4XC9A 3VBFA 1IS3A 4WVWA 3FHAA 3MO4A 2VVDA 2W1WA 4R4ZA 3JBG1 1SHWB 2JICA 5KXCA 3MBWA 3CEWA 1BVVA 4AVVA 4CEYB 1EP0A 3MUZ1 1KEXA 4Q29A 1YFXA 5C5TA 2DTWA 3AJZA 2PTMA 2C24A 1US2A 2JDKA 3JBG3 3J26N 5JUVA 3VN4A 3GGLA 4D7TA 3FHQA 5APAA 2WO7A 5F6LB 2WNUA 1GLHA 1EYBA 2W08A 2HWC3 3LDKA 5KHJA 4A7ZA 1RTVA 3ZXGA 1CR7A 2R1DA 3FUOA 2ZHNA 2G1MA 1YQ8A 3OBTA 3U75A 3LKJA 1W2TA 1XNCA 1UX7A 4FPCA 1BXHA 1NOVA 4FOYA 4P9LA 3RYPA 1I1EA 1S0EA 3FE5A 1OD3A 1VMHA 1GMMA 4LO6B 4Y22A 5EP9A 3D3AA 1H6YA 5JOZA 1PHMA 1DQ1A 1UXXX 2EIBA 3ES4A 4D6RA 1CJDA 4META 3BOWA 3GBGA 4AG4A 2VD7A 4LA2A 4NHLA 3VD7A 5HBAA 5FMOL 2VH9A 4IW3A 2XJRA 3HEIA 1COV3 2BBAA 4TTGA 3GJAA 4DEVA 4YM2A 3VLBB 5E8AA 4NHXA 4UFJA 2WT1A 4Y1VA 3M7AA 2HWB1 1QMJA 1M4WA 1UD1A 2XUEA 5A7OA 5BV6A 1TQ5A 1GFF2 4KWJA 1BHGA 1X82A 3ZYJB 2ADDA 2QDNA 5LZ6A 3SH4A 3A0KA 4ATEA 4XETA 3IBMA 4D94A 3GALA 4AI8A 2J1RA 2XR4A 3K51A 2YBKA 1OPOA 3ZFEC 2FD8A 1RMU3 4OLLA 3ZFFA 3B01A 4CDXA 1YI9A 1VR3A 5T54A 2ETEA 2NMNA 4GB31 1FMD2 5JI7A 1VRBA 3NMBA 2WFF3 2BRTA 4CEWC 4JTOA 2Q1MA 3W58A 2OZ6A 3MI8A 3P3PA 1JZ6A 4QQPA 4FT8A 2B46X 4YZ3A 1LHUA 4GB33 1NT0A 1I6XA 3T2QA 5FYHA 3ZFEB 2D6KA 4XHBA 1MVEA 5FYIA 3KVBA 3POIA 4JGZA 4OZOA 1KITA 1MS4A 5KHIA 5EV7A 2UYAA 4Q2FA 1ENQA 1VAVA 4QM8A 4IE4A 5L9VA 4FPGA 4LBKA 2XJQA 4PIZA 3I3QA 3I2OA 5EFUA 3VZJA 1E5SA 4LOSA 3H9AA 4CEWB 1AL22 1JYIA 3OUJA 3OOXA 4F3JA 1TMF2 2YPDA 3OGGA 4LOTA 3BPZA 3OTFA 4PLNA 4XHXA 5KBFA 5H9SA 1AX0A 3IB3A 3CO2A 4Q4X1 1B35B 2NMOA 2RS33 1S2KA 2WO2A 3ILNA 4XF1A 3VBOA 4BQWA 1K5MA 4TLFA 4MXWA 1AYN2 1EV12 3LAGA 2PLV3 3E1F1 3HWJA 1Z78A 4YG0A 5LA1A 1JYTA 2HWD3 4Q4X3 3VBFC 4XYXA 4Q4Y3 2DVAA 5BNPC 5ACA2 2FDFA 5DQ0A 4J25A 3ZYBA 4BZ4A 5B2GB 3ACHA 1OT5A 2GNMA 3VGIA 2LM3A 2GH2A 2QBXA 1RUE1 3PNAA 2K0GA 5C33A 1O5LA 3KQRA 4FXGB 2ADEA 1NZCA 1E5HA 2BWCA 4OI0A 4S2GA 3ZR6A 4HOOA 2WNUC 1C8NA 3R0RA 4AQ6A 3VKFC 1RHI1 1ACCA 1PNFA 3MW3A 1RC6A 3VBFB 1NG0A 1ZX5A 2DBIA 3TN93 3VHOA 3ZX7A 1JZ3A 1L7RA 5BNPB 3TYJA 3OD0A 4HKLA 1RIRA 4XFBA 2O8OA 4CDQA 1O3TA 1CX1A 2C26A 1IKPA 2VZUA 4PJYA 4Y1UA 2DWRA 3S7EA 3DYMA 5FWEA 2VVFA 5KXEA 2W2IA 2XL9A 5L7OA 1UZZA 4HSJA 5A80A 1UAIA 4M3CA 2I74A 3TEZA 1OQEA 2WNUB 3LOBA 2XBO1 2CWMA 3H42B 2QQWA 3KCCA 3BIWE 3I2JA 2BZDA 4GWJA 1H30A 1BBT1 3DECA 2VBDA 4ITCA 4QQHA 1YFWA 3SNMA 2WZPP 4MX3A 3DL3A 2UURA 4H2AA 4JHZA 3WDUA 5A3NA 4AVTA 5M0TA 5JWPA 1F5FA 1IG0A 1MEC3 2WN3A 4AEDA 2PQSA 2YHJA 3I2DA 1BBT3 5FY9A 1W6PA 5I91A 4ARYA 3A4UA 3AK0A 4Y22B 5F2WA 5FXZA 2JDUA 1W8ZA 2ZX4A 4XJAA 5JR2A 2R073 1J1TA 4MHRA 4JZRA 3OBRA 2RM22 2DCYA 3JD73 3T4HB 2V73A 3T08A 2Y8KA 4YM1A 5IATA 4UAPA 1VBE1 2QFEA 1GOHA 2W1QA 1LU1A 3AP6A 3PMEA 4QKFA 3ZFFC 5CAZA 3ZDVA 4CDXC 1ZM1A 5HV0A 3WNOA 4MXVA 3CMGA 3H3UA 2WINB 3JUUA 2FQPA 3OB8A 4JTNA 4YW6A 5FXVA 3RYKA 2GMPA 1BJQA 3LF7A 3OD4A 4RL7A 5ABJC 2XXZA 1UPIA 5FY7A 4KWUA 2DU0A 4QT6A 5K4LA 2WZ8A 3ZM8A 1O4ZA 3HJRA 3AKPA 2NQYA 2VCBA 3ZFFB 1VP6A 4QKBA 2HBUA 3RNSA 4CDXB 5C71A 3O1TA 2V72A 1O4YA 4IE5A 5EYXA 1MQTC 5FZ1A 2QQIA 4ORFA 4K1ZA 4JCKA 5ABJB 2ZKLA 2EVXA 3V0BA 1D2QA 3C7OA 1GP6A 2ARBA 3I4IA 1VLNA 2Y0IA 3H1MA 4LEJA 3BKZA 1LHWA 1W3XA 2W39A 4NHKA 4D69A 2V4AA 4I01A 4JGYC 2QQLA 3ACIA 4Y1ZA 1CQ9A 5JI9A 1CIYA 1K5MC 3RI9A 2A1XA 4WM7A 1MQTB 2DBNA 1IS4A 1WCUA 2RS11 2WFPA 4X6QB 3U11A 3VUOA 4Q26A 4Q0VA 2X5IC 2VECA 4N9HA 1Y43B 1QNYA 4XABA 2RDSA 5JOYA 3ZXJA 2WS91 3X29B 3MGUA 5FOJB 3CKHA 4XDQA 3PTRB 3VKOA 3WCSA 3HVDA 4P9YA 1OLQA 1F31A 2QCSB 3Q9OA 1MS5A 3BALA 4RA0A 3VBOB 5A32A 2GC2A 5F7UA 1K5MB 1XNKA 2C9KA 4E2QA 4LK7A 2BP6A 3R4UA 4YRDA 2R49A 2RDQA 3LD8A 4XVHA 4AGGA 5K7PA 2FDHA 2VOKA 4V2WA 5J37A 2OPWA 2G4IA 4AI9A 4XPVA 2PA7A 2X5IB 5HXMA 1DHKB 1WWYA 4A45A 3AL5A 3FHIB 4NHMA 1AYM2 3FLRA 3RZLA 4Q4V2 4PLMA 4W4ZA 1B09A 2F4LA 1FYUA 1XNBA 3IM0A 3WF0A 3W21A 3AKSA 1AJOA 4XF9A 5EQUA 1GBGA 3J8F3 2PHXA 3AZZA 4R9CA 1YQ6A 4XURA 1HQLA 4Q1RA 5A33A 3UK9A 2BVVA 3VBHA 1S0DA 3AXEA 1G86A 1GZ9A 4BE3A 4A6OA 3POGA 4MVTA 1HQNA 2PHWA 1C1FA 2AR6A 1XSQA 1W6OA 4MLOA 4Y20A 1ZBE1 3R4DB 1JU4A 5GLUA 2ZX2A 2R042 4YG3A 2Z2SB 4NRQA 4DUXA 4E4HA 1JW6A 4ISRA 4MOAA 3J7HA 4XE9A 1QH6A 2VZTA 4M3CB 1C57A 1GQGA 1WCDJ 4QU1A 5J7MA 1AJKA 2VZPA 1G9DA 3KF3A 4FTEA 1XNTA 3OSDA 2WUHA 3WNPA 3LDBA 1RUF3 3N35A 4JHTA 5FMOS 4EJRA 5C9AC 2PELA 4E8CA 1SDWA 4DPNA 5IFPA 2JG8A 2PHLA 2BNOA 2VOXA 4ZKTB 1LESA 1YNAA 4HVOA 1LGCA 5CISA 2CDPA 2GAUA 2VTXJ 3LA3A 4NO4A 3T1LA 4QAWA 1DZTA 4OUMA 1QJY2 4EN8B 5EJ3A 3QACA 4QB2A 1FMD3 4IE6A 1ZRFA 2E33A 5C8CC 2E9QA 5JOWA 2XJTA 2HWF2 4Q27A 4OVEA 4BLIA 3CIHA 4IV1A 3ZSMA 5C9AB 1JTZX 1FT9A 1H1IA 4H55A 3VL8A 3WCRA 3POWA 1SDDB 1HRI2 3BN6A 5GLVA 2CNAA 2VAUA 2VMCA 3ETPA 3H1WA 5FY0A 4DEQA 5FZEA 3HN3A 2FMDA 5JLVA 1WBFA 5GLWA 1AL21 1ZRCA 4LA3A 4BCUA 1YJLA 2DURA 2LALA 2I45A 5FK8A 1O7FA 5C8CB 2Q8EA 3WHTA 2D6PA 1JHNA 2KD7A 3N7KA 5IAXA 1AL23 3M3QA 4XUQA 4Z2AA 2DTYA 4FPHA 1NX9A 1TMF3 3K3NA 5FXXA 5FZ7A 3R05A 3VZMA 1Z7S2 2KA3A 1EV11 1R64A 4E8DA 1MS3A 1WLTA 2WABA 1W28A 4H7LA 3HQUA 2E53A 2JG9C 2W46A 5ACA1 4QHBA 5LY1A 2D3SA 1UL9A 1AYN3 5K9YA 1XNAA 1FV2A 5J09A 2ZGPA 3RZHA 1UZYA 2BUKA 1LU2A 2D7FA 2ZMLA 5J3UA 1EAH2 2JXAA 3N9MA 4A42A 5AC92 1LKNA 2GC1A 5F37A 1QEXA 2ZJCA 1C28A 2VJXA 3WY6A 4F8AA 5GZGA 1I9RA 2MEV1 3W59A 1TG7A 2Q8OA 5GALA 3BYWA 3WG3A 2D6OX 4Z1VA 5JOXA 3OGVA 4CSWA 1G9AA 2JG9B 3OGJA 4FPOB 2B39A 3G6JB 1MVQA 3LE0A 1W2AX 2P4EA 5DG2A 1QIQA 4LBOA 4QX5A 2WLQA 3VKLA 5DN2A 4RGAA 5A32B 1STMA 1MR5A 1HW5A 2XUMA 1NKGA 4M4RA 1FAYA 1OQ1A 3J4UH 4K20A 4R9AA 3O0WA 4BQ4A 1RUI2 4Y5TA 3VBHC 3CQOA 2PHTA 3JB4C 3QOPA 4W50A 5KWRA 1ZZ6A 3LZZA 1ASJ3 3Q8BA 2F4PA 5BNNA 3K46A 4Q0UA 4NUBA 3WP6A 3AFKA 4LXLA 3AC0A 1KS4A 4JQTA 5LW9A 4QPGA 5JXIA 3FLTA 4RQPA 4QQLA 5FR3A 1H4GA 4LO5B 3AVRA 1OC1A 2L9LA 3SCGA 5A33B 3VBHB 1HB3A 2ZEYA 3GDBA 5CFCC 3ZMNA 5F1RA 1DGWX 2ORXA 4LORA 3DN7A 4LO8A 4ASLA 1TNRA 2RM21 1QJEA 2RV9A 4MG2A 3OPTA 4LMFA 1JXNA 4AI2A 5E88A 3S6PA 4B4PA 4A7KA 1F9KA 3P5BA 2Y33A 2YB7A 2W87A 2RM23 4K9SA 1TME1 1XC6A 1A3KA 1RJ8A 2VUAA 3GCWA 2EIDA 4B8EA 4KGGA 5CFCB 4LBMA 3MPPG 1XXNA 5FJKA 4QX7A 3IDCB 2XHKA 2N7GA 1ND2A 1WLDA 3WW3A 4Y5SA 4Q8KA 3H1YA 3KV6A 2GN3A 4LITA 2H6CA 4IV1C 2BJSA 1OQDA 4OCTA 2J1TA 3ATGA 1PGW2 4NAMA 3A21A 2R0FA 3SEPA 3JU9A 4BYYA 4GQ7A 2ZEXA 1PZ9A 2G9ZA 2SLIA 5GKAC 1AR81 3MF9A 3H3LA 2WO1A 3P6BA 3RVHA 4CCNA 1COV2 1RVF2 1PZ7A 5JZGA 5E16A 3ZYFA 4FFHA 3USUB 3PUIA 3VDBA 2XKPA 5GM0A 4IV1B 4AHXA 3ZYPA 4AEJA 1TEIA 2W3JA 3ILRA 3ITQA 2OXBA 1VBC1 3POFA 4INDA 2UWBA 3JZVA 1OKOA 3PVBB 1D4M2 4EYUA 1KJLA 2NPIA 2OT7A 3AYDA 3FFQA 1LAJA 1PIV1 2V09A 5DDJ2 4J1XA 4A3ZA 4NWWA 2VNGA 1H8TA 1Y7BA 2W47A 1LB2A 1ULEA 1RMU2 2Q1ZB 1OVSA 5FPVA 2K9ZA 4ATFA 3POYA 3FUQA 3PURA 4YYOA 1DZQA 1SLCA 2E7TA 2ZAAA 4YGEA 3RJRA 4OI1A 3GZAA 4PQQA 1DFQA 3T2TA 5JPMB 1V6NA 2WJSA 4GWMA 2WFF2 1RL3A 4GMP1 4LIVA 4BOWA 3NKGA 4XTMA 1X8MA 3T0BA 3ELNA 1NLRA 3HT1A 3NJZA 4N9IA 5D8AC 3V65A 3MICA 3VDDA 1UIJA 1LGNA 4P9XA 4QPYA 3BIEA 5LASA 1R081 3WP3A 2B4KA 3PJYA 4DO0A 4K3UA 2B5HA 4XXPA 5IVEA 2UWAA 2OQ7A 1AR92 4LBQA 4IDZA 4YSFA 4DRRA 4QB6A 3AP5A 1AYM3 3I2FA 4CDUA 3WQ0A 4Q4V3 1R1A3 3N9OA 3IT8A 4IEPA 4NN0A 1O4TA 4OULA 2D44A 5D8AB 3HBZA 2HEVF 1W9WA 3OYWB 3POSA 5BNNC 3ALQA 3CHXA 4CUGA 4CUBA 4E4ZA 1X9TA 2W1SA 2YBSA 4XMIA 2EXKA 3VD9A 4JAAA 4MH0E 4CEYA 3JQXA 3BPSA 2R041 1BK1A 3NJVA 4EROA 4EZHA 2QJVA 3MIDA 4TZDA 4IEWA 4RQPC 2RR13 1PMHX 4CCKA 1Q43A 4RHV2 4Q4Y2 4UFKA 4QKDA 3RZGA 1V6JA 4ISQA 4YZ5A 1C4RA 2E26A 2R043 3DV8A 3CF6E 5BNNB 3W5MA 3N9LA 3RGBA 4N7UA 4A4AA 5FYBA 1MS0A 3WSOA 4JKKA 4GWIA 3CJIC 4K8FA 4QXHA 4C91A 3O1UA 3VB9A 4NOTA 5FMBA 1FATA 3WF3A 3TRSB 4QPGB 5LCWL 4B4QA 4FPEA 1HB1A 3AZWA 3DXUA 4RQPB 2W94A 2BVBA 2P1BA 4QDQA 1N3PA 4NJ4A 5IW0A 4L8QA 5T5LA 4CP9A 3GCXA 4LE3A 1QJY1 5A6XA 1F4HA 1L3JA 4PHZA 1O6UA 2DFBA 1YO8A 2ORZA 3H0OA 4IEYA 3CJIB 3A22A 4JDOA 5LBCA 3KHCA 1UY2A 3LOIA 1HB2A 3WDYA 3TB0A 1QJY3 1W90A 4BB3A 4LJHA 5DG1A 1UYXA 1LULA 4O7XA 2VC9A 4XUTA 3MHZA 2HWF3 2UY9A 1NCRC 2A3YA 3BODA 3INAA 5FOBB 2QZ3A 3WXPA 5FLJA 1XBFA 1DCSA 4NVPA 2NLRA 3PIGA 1HRI3 2C0ZA 1BLZA 4ZU7A 2P6CA 2FMYA 1XOYA 4W6YA 4XQWA 3ZMOA 5FUIA 4NIAA 4BQ1A 3WZ1A 2XDVA 5IJRA 1CAWB 2AC1A 1Z7S1 4XFCA 1YC61 1NCRB 1H8TC 3UV9A 1H6XA 4KBBA 2B7YA 1PX3A 1CONA 5F5CA 5EPAA 3RJ2X 5C70A 5JAXA 1E5RA 3APBA 1QH7A 2MPFA 4R8HA 1Z7S3 4IETA 2IXLA 2Y64A 2ARXA 2MHFA 4PI2A 4MSVA 5FBJA 3VBSA 3VZKA 4P9GA 4PDWC 3ZFEA 1MZ6A 4IEVA 4DB5A 5FZ8A 3RFRA 5C8WA 1RINA 1YQ2A 2A6YA 4P08A 1POQA 4P9JA 3ES1A 1H8TB 3N9NA 1EAH3 1YXWA 5AC93 1JBCA 2WNOA 1MS1A 2VBBA 1UN1A 1QF3A 3LA7A 4IUGA 1VB4A 3UGHA 3ZYGA 4AHWA 4CEWA 5FO9B 4CU9A 4COWA 1JUHA 5A1LA 1NA1C 1Q8VA 1XYOA 1Z0HA 4YGDA 1H0BA 2IVIB 4PDWB 4QPIC 5GLZA 3AM2A 2QKDA 3U4XA 1JOBA 1W9YA 4LO7A 3FN9A 2ZGOA 4K7JA 4GULA 1GWMA 5CYYA 3VDDB 5HI0A 1SEFA 1QOSA 3I2IA 2XWJB 5I0SA 3V0AB 2ZXQA 3I49A 3MLKA 1E57A 4RS5C 4YW5A 2JB4A 1W2UA 4XZUG 3NNLA 1RUI3 5D2AA 1AUYA 1NA1B 4KU7A 4UFHA 2PAKA 2YYOA 3KLSA 4W6WA 5FJHA 5JR7B 4IGOA 4EWDA 5LA2A 4LKDA 4CDUB 4YZ2A 4LBLA 2DUOA 1AF9A 2I2SA 5D1IA 1Q3EA 4FCAA 2ZKNA 1W6MB 1S1AA 4CXWA 1UKGA 4RS5B 4M3CE 2VTFA 4K8RB 2IXKA 4LKFA 5C4WC 3H8UA 1S4CA 3D0JA 2OS2A 3MIHA 4HK8A 4FBFA 5BNPA 1QJZA 2BEOA 1L7LA 1YWKA 3ST7A 4DINB 4A44A 4NRMA 4XFGA 2HWC1 3POEA 3NVCA 2CGNA 1QJU2 3AYCA 4I3GA 1WW7A 4GD4A 4AFDA 4G3YC 5FP4A 5AFEA 1VBD2 1G8WA 2Y38A 5C4WB 3LEIA 1DGRA 3J8F2 1S2BA 1LHVA 1IGOA 5FZIA 1KRIA 5F6KA 5A7WB 5FRAA 3AZXA 1PGW1 2WZR3 4YFZA 1W8TA 5FO8B 3OUIA 4HSLA 3FBMA 4HPKA 1QOOA 1VPHA 5FZAA 3THCA 2JKXA 3ZKUA 1PO22 4CP9B 2J1AA 4OZXA 5IVCA 1ULPA 5BNQA 1COV1 1RVF1 2B9VA 5CNAA 1DQ0A 2OIIA 1HV0A 3ZKYA 2FBEA 4YW2A 4I2OA 1RITA 1RVF3 2J1SA 2VM9A 1D4M1 2R6QA 4MGZE 2ZGMA 2V4VA 3QH7A 4L99A 5CADA 2H6BA 1OOPC 1RUF2 1RUD2 3DF0A 3ZDSA 3EMRA 4QHZA 1D4M3 1RMU1 2Y6KA 3M70A 2H0VA 5JCTA 2RJLA 3WF4A 1UU6A 5A3PA 5DDJ3 1YI7A 5LA0A 1NYWA 2JIGA 3VBSC 4DUWA 3G7DA 3MV01 4A7YA 2FDGA 1LODA 3V64A 4D7SA 1LEDA 2WFF1 3VHRA 1JU3A 2VQ0A 3Q8FA 4XFHA 3W20A 1OOPB 2HKXA 2XJVA 2G9FA 1L7QA 2YMZA 3LIHA 3O5SA 4HL0A 4FTBA 3DKQA 3S5QA 5IAVA 5ABJA 3ZPYA 2DCJA 3BU0A 4COYA 3E5QA 4Y26A 3VBSB 2QQJA 5KXBA 3KT7A 2YC2A 5D21A 3O0XA 1Q8QA 1A78A 3V56A 4KGQA 1IZ3A 4JQRA 4E4DX 3S30A 4HN1A 1AR93 3RSJA 4DNYA 3MFAA 1HXS2 2BNMA 1MQTA 4D6QA 1NQJA 5GJ6A 3RQ0A 3WEZA 1PGL2 1SQ4A 2RS31 4CXYA 2Y6GA 1QNWA 5B4XA 1NY71 1NUKA 2OKXA 3HR9A 3O1VA 4XJ8A 2PLV1 3WHUA 2WA4A 4JGYA 2HWD1 4N53A 4AE2A 4RHV1 4Q4Y1 3ZSLA 4COUA 4K40A 2PAEA 4CA9A 3BCWA 3GF6A 3WVJA 5JPNB 4QXKA 4XIKA 1ZRRA 4C0BA 1LR5A 3EBRA 4D6SA 3BGAA 4RHV3 5FFOC 3UJOA 2X5IA 1QWRA 2W92A 3A23A 3NJXA 4XFAA 3RMXA 2KXLA 5JMCA 1SBEA 3TAYA 5A1FA 3R4SA 1KDKA 2QUOA 3TN91 4JRLA 2FCTA 4NIHA 3ZN4A 2ZZJA 2VU9A 4C1XA 3PU8A 4N43A 1IQAA 1LOCA 2IUWA 4K21A 3K2OA 4HXCA 1UWWA 1WCQA 4IGPA 2B8MA 2BNNA 2P2KA 4HKOA 3TNQA 1C3HA 1CD3G 2QQNA 3FWEA 2R062 3D8CA 3DCQA 1ASJ2 1H9PA 4QXCA 2JDMA 2K46A 4L9BA 1A8MA 3LSDA 4E4SA 4RD7A 1GP5A 3D6EA 1OKQA 2VZ3A 5I0TA 4PQ9A 3T4VA 4CDWA 4ZZ8A 4ZS3A 3PUAA 5DAPA 4DUVA 1FX5A 1NCQC 1QDOA 1SCRA 1UOGA 1MEC1 2EAAA 2XLFA 1EPWA 4QQ2A 4ES9A 5BNOA 3ZYIB 1BEV3 4AW7A 5IK8A 5A3WA 1UCXA 3NQHA 1CZSA 3LFMA 4HPKB 4XTPA 4AZZA 4HONA 1W8UA 2R071 5KXDA 3IAQA 4DXRA 2XMLA 5HCAA 1GNYA 3JD71 3LPGA 4XW3A 2R32A 2UU8A 1WLWA 3BTZA 1SBFA 1W8WA 4D0QA 4DXTA 1BYHA 1NCQB 1CPMA 1VMFA 3UESA 2VMHA 3WLUA 4DXSA 3KV4A 3A0NA 1HJGA 5IVYA 4BIOA 3C7HA 3N36A 5C9AA 5CA6A 1H9WA 1DYKA 4LT5A 5E1RA 1JI6A 2YXSA 4KG0A 3SXWA 2ZAHA 2VQAA 4TYSA 4AFCA 1XU2A 3GJBA 1HB4A 1BMV2 2VQUA 1QOTA 2B42B 1ENXA 2AENA 2DCTA 1SFYA 1W0PA 5C8CA 3HIFA 2P3IA 1QQP3 3KT4A 2GP3A 3I59B 3HT2A 4DIQA 1AZDA 4MADA 4UF0B 2R16A 1KD7A 3K4ZA 4BPZA 4I3PA 3N3HA 2OW4A 1UMZA 3I3DA 1NE4A 4QGMA 5FZKA 1FI2A 5IUQA 4AFBA 4G9SB 2NP0A 1KFUL 3KD4A 4Z82A 5I93A 3W9AA 5IWFA 4OI2A 4FO9A 5EYYA 5DUVA 4UBHA 2CGOA 3GHMA 4AQTA 4N7IA 2A71A 3FLPA 5EJ1B 1CVNA 2TEPA 4SLIA 4QU2A 4N53C 5EXOA 1UYPA 4QX1A 4WV8A 1LOEA 3ETQA 3PMSA 1LTEA 2CY6A 3PUSA 3D82A 4QDRA 4XIOA 4NRPA 4ARXA 5CKNA 4WZCA 5A70A 1W0NA 2JG9A 4E2SA 1GNZA 5DXDA 3H8XA 1S0GA 1V00A 4XDOA 3IIAA 5I0DA 5CU1A 5IFTA 2TNFA 3TEXA 4JGYB 4URTA 3RZKA 4N53B 4DOUA 3KCYA 4F83A 4XOGA 2YG0A 5FY5A 3VV1A 1JUIA 4CZSA 4N43C 2CWSA 1H8VA 4KBZA 2HBTA 3ZPOA 2A6ZA 4Z2WA 5FPUA 2ZGKA 4UWDA 5F5IA 4HANA 1W03A 2C1FA 3J8F1 1QJU3 1Q56A 1D0GA 3SH3A 1IOAA 3LWCA 1R1A2 2E7QA 1WGPA 1VBD3 1F2NA 2WQ8A 2Z69A 5FYCA 3SKVA 2Z5WA 3T2PA 2BOJA 1MZEA 1AR62 3NV2A 4KG8A 3IZOA 4N43B 2PN5A 4CDWC 1VIWB 5I8YA 5JZGC 2J7MA 1U5ZA 5BNOC 3FBYA 3AL6A 2RR12 1APNA 4CCLA 1PO23 4QX3A 4AF9A 2ET7A 2WQZC 5BPXA 1XB9A 3PVOA 3NV1A 2J1EA 5T55A 1HKDA 3CNAA 1GQHA 1W9SA 3AMPA 3PHMA 3D4KA 3P1IA 1RUF1 1RUD1 1F5JA 2JDHA 2PHRA 4KQ7A 3WNLA 1IPSA 3WNMA 4CDWB 2R7EB 1FV3A 5CFCA 4LUKA 5BNOB 4LBJA 4OQ8A 3DUIA 1RUD3 1J59A 1T6BX 1WMEA 1CPNA 1ZNPA 2A70A 2YROA 1REDA 3ZXKA 4IEQA 4LO4B 3AMQA 2J22A 1NLQA 3FL7A 1FMD1 1QGLA 4LR4A 3ZN6A 1RUOA 5F8PA 4WM8A 4RR3A 2W91A 1D4VB 3AP9A 5GZDA 4IESA 4P9IA 4Q0SA 4JKLA 1JHJA 2WKKA 3PVNA 1LHOA 2EALA 1SFNA 1BZWA 4MGIE 4H3WA 4XUNA 3USUA 4XILA 5FIXA 3Q8CA 4RFT0 4BK4A 5JDBA 1YQCA 2FCVA 5FZOA 3KQ4B 5C6CA 2W0XA 3M2MA 4IV3A 4HETA 4B1LA 4FSJA 5LWBA 1V6OA 1HXS1 1VAMA 4XUPA 5F3EA 4CCCA 1N3OA 4R9BA 3OF1A 5A7SA 1PGL1 1VMJA 2JDZA 1LOBA 3GM8A 1TMF1 3B93A 4QX8A 5K0UC 1FPN3 3MIGA 1JYWA 3VKMA 1HXS3 1YFUA 3OY8A 4MUVA 2HYXA 2VBPA 4COVA 1GZCA 3MIBA 2XVKA 4CP1A 4XFIA 2BTVC 2ZX0A 3WG4A 2E32A 2VPVA 1Y9QA 3T0AA 1AYN1 3LEKA 4S2HA 3UGGA 4BQXA 5FZ0A 3WD5A 2VR4A 2XQRA 2X09A 3ROUA 5E6HA 4KMQA 2Q8CA 1ULOA 4BDVB 4YARA 5K0UB 1ULFA 4NPRA 3RZZA 2QNKA 3AYAA 4Q5OA 1TE1B 4PLOA 4D3WA 2DVGA 3H50A 4E2GA 3M3IA 1RUJ2 3B9CA 4FOQA 2X10A 1VRH2 5FYYA 1W04A 2V5DA 1GOFA 1O3RA 3ZIXA 1RXGA 5LBBA 5D8AA 3RI8A 3WP5A 2VY0A 4DY5A 1OSGA 3CU7A 3OYWA 1J3QA 1GZWB 2BDRA 3SISA 1C1LA 4M4PA 3BTYA 3FFZA 4QDSA 2IFWA 4R52A 3MDPA 5F39A 3LA2A 1RUH2 4FVVA 4YG6A 3RMYA 1ZZ9A 5CIRA 1ASJ1 1BVP1 3WQBA 2RVAA 2ZBJA 5LEJA 1OLRA 1POV0 1SZBA 5HCHA 4BXSV 2R063 1DGRN 1OF4A 3DPRA 4XF0A 5J1XA 3NAPC 3AMHA 2ES3A 2WT2A 4URAA 2ZMNA 3OEBA 1HV1A 2OVUA 3THTA 4ES8A 1T2XA 1HRV2 4GH4C 1C8M2 1O59A 3UGFA 2ILMA 4NMIA 1OVPA 1X50A 4N90A 1V9U2 4NIGA 4UFMA 1V0AA 1JZ2A 4AEKA 3UNPA 4KU8A 3GBWA 3RRDA 2WL1A 2MNGA 3NAPB 3M4FA 2O1QA 1QKQA 4XUOA 5EIYB 1X36A 3WX5A 3CJIA 4MV2A 4GH4B 2IWGB 5FZ4A 3FC0A 3T0DA 1ODMA 1ND3C 2Y26A 2VUCA 2A73B 2OPKA 3ZXAC 5L73A 4EWEA 4QWNA 2VCCA 5GLTA 4OI4A 1UW8A 3ZXEA 1R092 1D7PM 3U37A 2GC3A 2XKOA 4WM8C 5TSWA 3T2OA 1O8SA 2D3PA 4RR3C 4ZXKA 4BMBA 4FP2A 2BV4A 2LRPA 4UFIA 2WZR2 1IS5A 1WW5A 4DQAA 4P9WA 3N4MA 3I2HA 3K3OA 3KF5A 3WW4A 2PQQA 4QD2A 2ZEWA 1XQNA 1MZ5A 5DZEA 3BUCA 1ND3B 1XU1A 1UKRA 2CYFA 4KL1A 2RJ2A 4IV3C 5LRRA 3WDVA 1CN1A 1OD5A 1CAWA 1SLAA 2EA7A 2P3KA 4P5HA 5DAQA 3VBUC 4CUAA 1GKBA 3ZN6B 3M3OA 4WM8B 1NCRA 4RR3B 2ZS6B 2X29A 5DAVA 5C3QA 2VVEA 1CGPA 5IYYA 2JD9A 4MGKE 4QGNA 5FQ0B 3SHRA 1NXD1 2EIGA 3J7NA 2GALA 4TN7A 2Q5TA 4LHKA 1YLLA 1BKZA 1UOJA 1W9TA 2GNDA 2IVJA 2VMEA 4IQPA 5F3GA 5FZOB 2GU9A 1QHDA 2AGSA 4IV3B 1ZRIA 3KHBA 5ANNA 2W52A 1U0AA 2WWUA 3HNBM 2QE3A 3L2YA 3NSTA 4C1WA 2BPA2 3THDA 4FPYA 4NPLA 3KM5A 1OFSA 3ZO0B 1K3IA 2R1BA 1WMXA 2ZGLA 4PBPA 2C6SA 1U12A 4Q4W2 2VNRA 2VZQA 4E9KA 5JSRA 3OY8B 4CCOA 4CUCA 5CFDA 1NZIA 1W39A 3I54A 4AVCA 1NAEA 2W68A 4BISA 3MZHA 2WNEA 1LEMA 1O3QA 2XPJA 2GC0A 4PDWA 5F2SA 1AR73 3SMHA 3CZUA 2AEZA 2HEYF 1SFPA 3ACLA 1VE0A 4HBNA 1GWKA 5DMYA 4AAXA 1AXZA 4CCDA 2IXCA 3IN9A 4YZ1A 3E5XA 1OXCA 2VMIA 4CTEA 3TEYA 5C3OA 3V0AA 2YBPA 2QQPA 1AYM1 1XJAA 5CVRA 4P02B 1ZA7A 4Q4V1 1UIKA 3OBAA 1VAKA 1R1A1 4CPBD 1GR3A 3GZEA 3S5AA 2XVLA 1NA1A 2JIJA 3USSA 2C5DA 4UXAA 1TVGA 5BY5A 4QPIA 5FYMA 3EB7A 2YDEA 5L19A 1JZ5A 1JYNA 5JIUA 2VTXA 2WO3A 1F4AA 4IERA 4LKSA 2CGPA 3DPRC 3RZJA 1AL0G 4EZ4A 1G7YA 4LHNA 4FOVA 5LB6A 1QJX3 2VXJA 2TBVA 1W6MA 3ZR5A 4OHYA 1LGBA 2RR11 4AVAA 2PXJA 2XB6C 1AR63 1CAVB 2VMFA 4QQOA 4RS5A 5LY2A 3RS6A 3WQ7A 1H1MA 3NNJA 1JN2P 1WCKA 2Q30A 2ZHKA 5FPAA 3OBZA 1JYXA 1RGSA 2CAUA 1DQ6A 4X6RB 4AK3A 4EN7B 1JZ4A 4Y5Z0 4WVMA 1W6QB 2ZABA 4RN5A 2R30A 4ASKA 1RUG3 3FZ3A 1YRZA 3DPRB 1CZVA 4BK5A 2P17A 1VBB2 3GBFA 5T5JA 3J7LA 1HN1A 2VW1A 1XYPA 1PM4A 3MEPA 1C5IA 5FUPA 3T30A 5CEHA 5C4WA 4G4FA 3UL2A 1SCSA 1G9FA 1GANA 1KDMA 3BTAA 3AB0A 3VZOA 2RDRA 2ZGTA 3WINE 3BTXA 1AXYA 4I09A 4R9DA 4FP3A 3WNXA 5J48A 2ZMKA 4EWAA 2VUJA 1K5JA 1H2KA 2ZX1A 4V1PA 4BQYA 4CVUA 2C9AA 4BQ2A 4LHLA 5FLIA 3ZVXA 1DLCA 5LBFA 4Y4RA 3ZSKA 2RMU3 5I8SA 2HWF1 2D93A 2LTNA 2DV9A 2HEWF 2CDOA 3SH5A 4IXLA 5FZHA 2WBKA 1GICA 1UU4A 1HRI1 4OHWA 4UOJA 4AEMA 4HVQA 2LW8A 2AREA 2VE1A 4J6GA 1BEV2 1RUE2 1IPKA 3KS7A 2OZJA 4TWTA 2HWE2 1ZZ7A 1ST8A 1UY4A 4ZONA 2A7AA 3QLQA 1A6CA 1RHI2 4YVSA 2UY8A 1ULCA 3B3QE 2P34A 3LSEA 2I07B 3MIEA 5F3CA 4AHYA 1D2SA 2VOWA 3K4DA 1PVC3 3HOBA 3IPVB
chains in the Genus database with same CATH topology
5F7UA 2C9KA 4XVHA 3WEZA 5HXMA 4A45A 2Y6GA 1UZ0A 5B4XA 2OKXA 1NUKA 5IFTA 3I2GA 1RYYA 4W4ZA 3ACGA 3WF0A 5C7GA 3C7EA 2VZ1A 1CZTA 1K45A 4XURA 1UY0A 3BGAA 2BGPA 5DPNA 2W92A 3A23A 3NJXA 4A6OA 2QQKA 3OG2A 1JU4A 3I3BA 3DYPA 3C8XA 4DUXA 4OMDA 4MOAA 3K4AA 3J7HA 2W1UA 2VZTA 2VL4A 3MUY1 2VZPA 1UWWA 1WCQA 1XNTA 2WUHA 2QQNA 3WNPA 4UI9L 3VDAA 4E8CA 3LPFA 5IFPA 3PUHA 5G05L 2VZ3A 2CDPA 4ZZ8A 3OGSA 4QAWA 4DUVA 4QB2A 3C7FA 2E33A 3NQHA 1CZSA 2ID4A 3CIHA 3VD5A 5HPOA 3C7GA 3IAQA 4DXRA 2EIEA 2W9XA 1GNYA 3GXUA 3LPGA 1SDDB 2J1VA 3BN6A 2VMCA 3ETPA 4DEQA 3HN3A 4DXTA 4D0QA 3UESA 2QQMA 4DXSA 1UXZA 3IIIA 1GOGA 2KD7A 4XUQA 3C7HA 4Z2AA 2VZOA 4ET7A 1NX9A 2ZEZA 1US3A 3K75B 3T09A 1JI6A 1R64A 4E8DA 1UYYA 1OH4A 2WABA 1IQDC 2VQUA 2DCKA 4FI9A 3CZJA 2W46A 4OYUA 2DDUA 5A1AA 1XNAA 3WNKA 4A42A 4MGQA 3IAPA 4MADA 3K4ZA 2VJXA 3LEGA 1GUIA 2HLEA 2VCAA 1TG7A 4P5YA 1J83A 1WKYA 3I3DA 3OGVA 2J1UA 4W8JA 3LE0A 5EJ1B 5DN2A 4CU8A 4QX1A 1NKGA 4QDRA 4M4RA 3SEEA 3W5NA 4ARXA 3CQOA 5JMOA 4W50A 2Y6JA 1W0NA 1EUTA 3K46A 5I0DA 2WZEA 4MGSA 3AC0A 1P8JA 5JXIA 3LQCA 2YG0A 4HG6B 1UYZA 5EJZB 2L9LA 2ZEYA 1UY1A 3GDBA 1OF3A 2ORXA 1UMIA 2WDBA 1I5PA 2JE8A 4BJ0A 1UY3A 1PX4A 1SG3A 2RV9A 1MPXA 2WAAA 2WQ8A 4PF1A 4L0PA 3SKVA 5JXHA 2WN2A 3NNGA 2YB7A 2W87A 4MO3M 3T2PA 1XC6A 2EIDA 1DYOA 2BGOA 2J7MA 3K77A 4QX3A 2QQOA 3A7QA 3I2KA 2WYSA 2J1TA 1EUUA 2J1EA 3OGRA 3A21A 4LQRA 3SEPA 1W9SA 3P1IA 3WNLA 3WNMA 2ZEXA 3VDCA 2R7EB 2WO1A 3P6BA 3PUIA 3VDBA 3DYOA 2XONA 2W3JA 2WAOA 1XPWA 3JXSA 2J22A 2C4XA 3FL7A 4A3ZA 2YFZA 5JXJA 2W91A 2W47A 4JKLA 1JHJA 2XOMA 3VD4A 4CU7A 3ECQA 4XUNA 1PMJX 1GQPA 2VOTA 4PQQA 4BK4A 4CU6A 3HNMA 3T0BA 4XUPA 3MV11 1KGYA 3F2ZA 4A41A 3GM8A 2B4KA 3ABZA 2XQXA 1JYWA 3FHAA 3MO4A 2W1WA 1SHWB 2HYXA 1W8OA 3MBWA 3MUZ1 1KEXA 4QB6A 3I2FA 2E32A 1US2A 2VQTA 3T0AA 3LEKA 5JUVA 3GGLA 2VR4A 2X09A 1W9WA 3FHQA 2XHNA 4KMQA 1ULOA 3IDAA 4BDVB 4CUBA 4ZZ5A 2W1SA 3VD9A 3NJVA 4GZ9A 3SKJE 3NRUA 1JZ7A 1PMHX 1UX7A 2X10A 4ZY9A 2V5DA 1GOFA 1UMHA 2E26A 3UETA 2VZSA 3WNNA 1OD3A 3W5MA 1GMMA 4YPJA 4A4AA 2Z4FA 3D3AA 1H6YA 3WSOA 2EIBA 1UXXX 4GWIA 2YFUA 4JKKA 4M4PA 2VO5A 2Y6HA 3CDZB 4QDSA 4AG4A 1K12A 3WF3A 3VD7A 5LCWL 2W95A 4TTGA 3HEIA 2BBAA 2W94A 3WQBA 2RVAA 4DEVA 4BXSV 2JDAA 4QDQA 1OF4A 4P00B 2EICA 5J1XA 2LS6A 1BHGA 1F4HA 3OEBA 2ORZA 3A22A 1T2XA 1UY2A 1O59A 1JYVA 2J1RA 4JX0A 1UYXA 1JZ2A 2VC9A 4XUTA 3UNPA 4XUOA 5EIYB 4QPWA 1JZ6A 3T0DA 3T2QA 2YC4A 5FUIA 2VCCA 4OZOA 5IJRA 1D7PM 3U37A 2X05A 3T2OA 1O8SA 4OUEA 1H6XA 5C70A 1PX3A 2E31A 1DP0A 3I2HA 3I97A 2ZEWA 2Y64A 5CZKA 2RJ2A 3IB3A 1YQ2A 4CUAA 4P08A 2WO2A 4OMCA 5IYYA 2JD9A 3E1F1 5LA1A 4IUGA 1GU3A 4LHSA 4CU9A 2VMEA 1W9TA 5DQ0A 3ACHA 1OT5A 5IHRA 2QBXA 3HNBM 2VZVA 3FN9A 3THDA 5CYYA 1K3IA 3I2IA 2ZXQA 2VZQA 1JZ3A 4PT6A 4XZUG 4CUCA 1L7RA 1NAEA 1O8PA 1CX1A 2C26A 2VZUA 5LA2A 1LNSA 3CZUA 3OEAA 3DYMA 5DMYA 4AAXA 2VTFA 4P02B 3OBAA 3I3EA 3ACFA 3I2JA 2BZDA 4GWJA 3DECA 4A44A 1TVGA 4JHZA 5G04L 3EB7A 1JZ5A 1JYNA 1K42A 2WO3A 1JZ8A 1F4AA 2WN3A 4LKSA 4D8MA 5B4NA 1J84A 2PQSA 3WF2A 4ARYA 2W5FA 5JR2A 3WF1A 2VMFA 2VMDA 5JXGA 3LEIA 1W99A 3T08A 2Y8KA 1JYXA 1JZ4A 4UAPA 1GOHA 2W1QA 4QX2A 4RN5A 1W8NA 3THCA 3WNOA 2JKXA 3CMGA 1CZVA 4BK5A 2J1AA 3OB8A 1HN1A 1ULPA 2B9VA 4JKMA 4KWUA 2BERA 2WZ8A 3ZM8A 3HJRA 4QX0A 2VCBA 3HPNA 2J1SA 2VM9A 5C71A 2V4VA 2V72A 4RYDA 4CVUA 2QQIA 2Y6KA 1DLCA 3VD3A 3C7OA 3WF4A 2VZRA 5LA0A 4DUWA 3MV01 3HNYM 2CDOA 1JU3A 2WBKA 2QQLA 3ACIA 4ZXEA 4UOJA 4TXWA 2LW8A 2Y6LA 1CIYA 4LPLA 1L7QA 1UY4A 2DCJA 3EYPA 4KI5M 2QQJA 4QB1A 2YC2A 3CKHA 3K4DA 3HOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F7U A;  2C9K A;  4XVH A;  3WEZ A;  5HXM A;  4A45 A;  2Y6G A;  1UZ0 A;  5B4X A;  2OKX A;  1NUK A;  5IFT A;  3I2G A;  1RYY A;  4W4Z A;  3ACG A;  3WF0 A;  5C7G A;  3C7E A;  2VZ1 A;  1CZT A;  1K45 A;  4XUR A;  1UY0 A;  3BGA A;  2BGP A;  5DPN A;  2W92 A;  3A23 A;  3NJX A;  4A6O A;  2QQK A;  3OG2 A;  1JU4 A;  3I3B A;  3DYP A;  3C8X A;  4DUX A;  4OMD A;  4MOA A;  3K4A A;  3J7H A;  2W1U A;  2VZT A;  2VL4 A;  3MUY 1;  2VZP A;  1UWW A;  1WCQ A;  1XNT A;  2WUH A;  2QQN A;  3WNP A;  4UI9 L;  3VDA A;  4E8C A;  3LPF A;  5IFP A;  3PUH A;  5G05 L;  2VZ3 A;  2CDP A;  4ZZ8 A;  3OGS A;  4QAW A;  4DUV A;  4QB2 A;  3C7F A;  2E33 A;  3NQH A;  1CZS A;  2ID4 A;  3CIH A;  3VD5 A;  5HPO A;  3C7G A;  3IAQ A;  4DXR A;  2EIE A;  2W9X A;  1GNY A;  3GXU A;  3LPG A;  1SDD B;  2J1V A;  3BN6 A;  2VMC A;  3ETP A;  4DEQ A;  3HN3 A;  4DXT A;  4D0Q A;  3UES A;  2QQM A;  4DXS A;  1UXZ A;  3III A;  1GOG A;  2KD7 A;  4XUQ A;  3C7H A;  4Z2A A;  2VZO A;  4ET7 A;  1NX9 A;  2ZEZ A;  1US3 A;  3K75 B;  3T09 A;  1JI6 A;  1R64 A;  4E8D A;  1UYY A;  1OH4 A;  2WAB A;  1IQD C;  2VQU A;  2DCK A;  4FI9 A;  3CZJ A;  2W46 A;  4OYU A;  2DDU A;  5A1A A;  1XNA A;  3WNK A;  4A42 A;  4MGQ A;  3IAP A;  4MAD A;  3K4Z A;  2VJX A;  3LEG A;  1GUI A;  2HLE A;  2VCA A;  1TG7 A;  4P5Y A;  1J83 A;  1WKY A;  3I3D A;  3OGV A;  2J1U A;  4W8J A;  3LE0 A;  5EJ1 B;  5DN2 A;  4CU8 A;  4QX1 A;  1NKG A;  4QDR A;  4M4R A;  3SEE A;  3W5N A;  4ARX A;  3CQO A;  5JMO A;  4W50 A;  2Y6J A;  1W0N A;  1EUT A;  3K46 A;  5I0D A;  2WZE A;  4MGS A;  3AC0 A;  1P8J A;  5JXI A;  3LQC A;  2YG0 A;  4HG6 B;  1UYZ A;  5EJZ B;  2L9L A;  2ZEY A;  1UY1 A;  3GDB A;  1OF3 A;  2ORX A;  1UMI A;  2WDB A;  1I5P A;  2JE8 A;  4BJ0 A;  1UY3 A;  1PX4 A;  1SG3 A;  2RV9 A;  1MPX A;  2WAA A;  2WQ8 A;  4PF1 A;  4L0P A;  3SKV A;  5JXH A;  2WN2 A;  3NNG A;  2YB7 A;  2W87 A;  4MO3 M;  3T2P A;  1XC6 A;  2EID A;  1DYO A;  2BGO A;  2J7M A;  3K77 A;  4QX3 A;  2QQO A;  3A7Q A;  3I2K A;  2WYS A;  2J1T A;  1EUU A;  2J1E A;  3OGR A;  3A21 A;  4LQR A;  3SEP A;  1W9S A;  3P1I A;  3WNL A;  3WNM A;  2ZEX A;  3VDC A;  2R7E B;  2WO1 A;  3P6B A;  3PUI A;  3VDB A;  3DYO A;  2XON A;  2W3J A;  2WAO A;  1XPW A;  3JXS A;  2J22 A;  2C4X A;  3FL7 A;  4A3Z A;  2YFZ A;  5JXJ A;  2W91 A;  2W47 A;  4JKL A;  1JHJ A;  2XOM A;  3VD4 A;  4CU7 A;  3ECQ A;  4XUN A;  1PMJ X;  1GQP A;  2VOT A;  4PQQ A;  4BK4 A;  4CU6 A;  3HNM A;  3T0B A;  4XUP A;  3MV1 1;  1KGY A;  3F2Z A;  4A41 A;  3GM8 A;  2B4K A;  3ABZ A;  2XQX A;  1JYW A;  3FHA A;  3MO4 A;  2W1W A;  1SHW B;  2HYX A;  1W8O A;  3MBW A;  3MUZ 1;  1KEX A;  4QB6 A;  3I2F A;  2E32 A;  1US2 A;  2VQT A;  3T0A A;  3LEK A;  5JUV A;  3GGL A;  2VR4 A;  2X09 A;  1W9W A;  3FHQ A;  2XHN A;  4KMQ A;  1ULO A;  3IDA A;  4BDV B;  4CUB A;  4ZZ5 A;  2W1S A;  3VD9 A;  3NJV A;  4GZ9 A;  3SKJ E;  3NRU A;  1JZ7 A;  1PMH X;  1UX7 A;  2X10 A;  4ZY9 A;  2V5D A;  1GOF A;  1UMH A;  2E26 A;  3UET A;  2VZS A;  3WNN A;  1OD3 A;  3W5M A;  1GMM A;  4YPJ A;  4A4A A;  2Z4F A;  3D3A A;  1H6Y A;  3WSO A;  2EIB A;  1UXX X;  4GWI A;  2YFU A;  4JKK A;  4M4P A;  2VO5 A;  2Y6H A;  3CDZ B;  4QDS A;  4AG4 A;  1K12 A;  3WF3 A;  3VD7 A;  5LCW L;  2W95 A;  4TTG A;  3HEI A;  2BBA A;  2W94 A;  3WQB A;  2RVA A;  4DEV A;  4BXS V;  2JDA A;  4QDQ A;  1OF4 A;  4P00 B;  2EIC A;  5J1X A;  2LS6 A;  1BHG A;  1F4H A;  3OEB A;  2ORZ A;  3A22 A;  1T2X A;  1UY2 A;  1O59 A;  1JYV A;  2J1R A;  4JX0 A;  1UYX A;  1JZ2 A;  2VC9 A;  4XUT A;  3UNP A;  4XUO A;  5EIY B;  4QPW A;  1JZ6 A;  3T0D A;  3T2Q A;  2YC4 A;  5FUI A;  2VCC A;  4OZO A;  5IJR A;  1D7P M;  3U37 A;  2X05 A;  3T2O A;  1O8S A;  4OUE A;  1H6X A;  5C70 A;  1PX3 A;  2E31 A;  1DP0 A;  3I2H A;  3I97 A;  2ZEW A;  2Y64 A;  5CZK A;  2RJ2 A;  3IB3 A;  1YQ2 A;  4CUA A;  4P08 A;  2WO2 A;  4OMC A;  5IYY A;  2JD9 A;  3E1F 1;  5LA1 A;  4IUG A;  1GU3 A;  4LHS A;  4CU9 A;  2VME A;  1W9T A;  5DQ0 A;  3ACH A;  1OT5 A;  5IHR A;  2QBX A;  3HNB M;  2VZV A;  3FN9 A;  3THD A;  5CYY A;  1K3I A;  3I2I A;  2ZXQ A;  2VZQ A;  1JZ3 A;  4PT6 A;  4XZU G;  4CUC A;  1L7R A;  1NAE A;  1O8P A;  1CX1 A;  2C26 A;  2VZU A;  5LA2 A;  1LNS A;  3CZU A;  3OEA A;  3DYM A;  5DMY A;  4AAX A;  2VTF A;  4P02 B;  3OBA A;  3I3E A;  3ACF A;  3I2J A;  2BZD A;  4GWJ A;  3DEC A;  4A44 A;  1TVG A;  4JHZ A;  5G04 L;  3EB7 A;  1JZ5 A;  1JYN A;  1K42 A;  2WO3 A;  1JZ8 A;  1F4A A;  2WN3 A;  4LKS A;  4D8M A;  5B4N A;  1J84 A;  2PQS A;  3WF2 A;  4ARY A;  2W5F A;  5JR2 A;  3WF1 A;  2VMF A;  2VMD A;  5JXG A;  3LEI A;  1W99 A;  3T08 A;  2Y8K A;  1JYX A;  1JZ4 A;  4UAP A;  1GOH A;  2W1Q A;  4QX2 A;  4RN5 A;  1W8N A;  3THC A;  3WNO A;  2JKX A;  3CMG A;  1CZV A;  4BK5 A;  2J1A A;  3OB8 A;  1HN1 A;  1ULP A;  2B9V A;  4JKM A;  4KWU A;  2BER A;  2WZ8 A;  3ZM8 A;  3HJR A;  4QX0 A;  2VCB A;  3HPN A;  2J1S A;  2VM9 A;  5C71 A;  2V4V A;  2V72 A;  4RYD A;  4CVU A;  2QQI A;  2Y6K A;  1DLC A;  3VD3 A;  3C7O A;  3WF4 A;  2VZR A;  5LA0 A;  4DUW A;  3MV0 1;  3HNY M;  2CDO A;  1JU3 A;  2WBK A;  2QQL A;  3ACI A;  4ZXE A;  4UOJ A;  4TXW A;  2LW8 A;  2Y6L A;  1CIY A;  4LPL A;  1L7Q A;  1UY4 A;  2DCJ A;  3EYP A;  4KI5 M;  2QQJ A;  4QB1 A;  2YC2 A;  3CKH A;  3K4D A;  3HOB A; 
#chains in the Genus database with same CATH topology
 1IG3 A;  4XBL A;  1BQP A;  3EJK A;  4A2U A;  3PL0 A;  1S0B A;  1OOP A;  1V6L A;  1ZYB A;  2K2S A;  2ZOE B;  2FDJ A;  3NW4 A;  2AH2 A;  5I0R A;  1OUX A;  3LB9 A;  1ULG A;  5CFD C;  1QY4 A;  1IHM A;  2XBO 2;  4HN0 A;  1UZ0 A;  5EWS A;  1EAH 1;  4ZU4 A;  5AC9 1;  3I2G A;  3N7L A;  4A6S A;  1DIW A;  3ACG A;  4W65 A;  5KR7 A;  3F95 A;  1RUJ 1;  2WNV C;  5DZF A;  1A8D A;  5C7G A;  5FWJ A;  2ZGN A;  3OPW A;  4PIY A;  3ASI A;  3I7D A;  1K45 A;  2YPJ A;  5SV5 A;  1QQP 2;  2ARC A;  1YCI A;  4NR1 A;  1RUJ 3;  1J1L A;  3WW2 A;  1RXF A;  1S2E A;  2RS5 3;  5HCF A;  1VRH 3;  3J9S A;  2CHH A;  5CFD B;  1WA6 X;  4O65 A;  3DGT A;  1OPM A;  1YJK A;  3OG2 A;  2PHF A;  1RUH 1;  4EN6 B;  1W3V A;  2B9U A;  3I3B A;  3DYP A;  3C8X A;  4ASM B;  4AVS A;  3T1M A;  1WUV A;  2WNV B;  1VBE 2;  3FMG A;  4OMD A;  1RUI 1;  3K4A A;  3BOP A;  3I3M A;  1RUH 3;  3U78 A;  4XJW A;  2VL4 A;  3MUY 1;  1HIX A;  4NID A;  4HT1 T;  3TWI A;  1N1V A;  5DAW A;  3QBQ A;  1Y9M A;  1UOB A;  3EO6 A;  2Q4S A;  2JJ6 A;  2LRO A;  3URF A;  4LLO A;  5ISL A;  1F15 A;  5FXW A;  4DFS A;  5FUN A;  1W05 A;  4QPI B;  5F32 A;  1GNH A;  1V9U 1;  3NWK A;  1WD4 A;  3LPF A;  1HRV 3;  3M3C A;  4MHU A;  1QJF A;  1C8M 3;  3HQX A;  4GMP 0;  2HYK A;  4JDN A;  3U1X A;  4AAP A;  2RG4 A;  5G05 L;  1NE6 A;  1I5Z A;  1X9P A;  1V9U 3;  5FZ3 A;  3OGS A;  5EZW A;  4BQ5 A;  3O12 A;  2QVS B;  4IGQ A;  2GP5 A;  5FO7 B;  4A3X A;  3C7F A;  3ENR A;  4QMA A;  1TNF A;  4WVM B;  5GZF A;  2D40 A;  2ID4 A;  2WC2 A;  1FNY A;  1C5H A;  1JMU B;  4AI1 A;  2E51 A;  2GH8 A;  3KT1 A;  1HJF A;  4WBB A;  2EIE A;  3AKR A;  4YLZ A;  1D0H A;  3U14 A;  1JOP A;  2KM2 A;  2PAM A;  2WZR 1;  3FX3 A;  3Q8A A;  4YM0 A;  2GN7 A;  2DVF A;  2D6M A;  4CXX A;  1R09 3;  1VBA 2;  3LEM A;  5GZC A;  2QQM A;  2ZGS A;  3WG2 A;  2WA3 A;  3CJX A;  5BUV A;  1N3Q A;  1UXZ A;  4IEO A;  5FKC A;  2Q0A A;  1UPS A;  5FK7 A;  2WS9 2;  3O1S A;  2VZO A;  2FDI A;  4C90 A;  4ET7 A;  1F35 A;  4B29 A;  3RZM A;  1UF2 C;  3K75 B;  1WMF A;  4UW3 A;  4FTS A;  1UYY A;  1OH4 A;  3ON7 A;  1VB2 A;  2RDN A;  3AZV A;  1ZRE A;  1W8H A;  1J58 A;  3VZN A;  1NCQ A;  2DCK A;  2E63 A;  4FI9 A;  3CZJ A;  4YVS C;  3H8R A;  1YYN A;  4OYU A;  4CRQ A;  2DDU A;  4UYB A;  4ZU5 A;  5A1A A;  2ERF A;  1UQX A;  3WNK A;  4WZF A;  2XH6 A;  4COZ A;  3UKN A;  5IVF A;  1QU0 A;  4L97 A;  2ZPX A;  3IAP A;  2AYH A;  3WQ1 A;  3C2U A;  1HX6 A;  5DDJ 1;  1YFY A;  3TNP B;  1Q8P A;  1GUI A;  3SCH A;  5CG8 A;  1OA2 A;  2D97 A;  4HMZ A;  4Q4W 1;  4PI0 A;  1U5I A;  2D43 A;  3E97 A;  4LLF A;  2J1U A;  5FPL A;  1S0J A;  4YVS B;  3UYJ A;  5H9R A;  4L92 A;  4AGV A;  4U36 A;  1PM7 A;  4U2A A;  3D5O A;  2D98 A;  1ZBA 2;  4Q4W 3;  3U10 A;  2DVB A;  3I59 A;  3KSC A;  4OFG A;  5A3L A;  4UF0 A;  1ZBE 2;  1JOJ A;  4Y24 A;  4X8P A;  3RG0 A;  4BME A;  3W5N A;  2PFW A;  1W6N B;  5FY1 A;  5JMO A;  4BQ3 A;  1Q8O A;  2Y6J A;  3O1R A;  1WW6 A;  1EUT A;  3MW2 A;  4UT5 A;  1AR9 1;  3T3Y A;  3KGL A;  4AXO A;  4BXF A;  1CIW A;  1UNB A;  4E27 A;  2VUL A;  1W06 A;  3GZU C;  1REE A;  2HWB 3;  4MGS A;  4YW3 A;  1P8J A;  1V6K A;  3HQR A;  3AFG A;  4M01 A;  4XAA A;  3N9P A;  3RWK X;  1V70 A;  1LEN A;  4HG6 B;  5LBE A;  1J3R A;  1FPN 2;  2JEM A;  4C0H A;  5DAB A;  1S0C A;  1ENS A;  5EJZ B;  5HV4 A;  5IK5 A;  5I8T A;  3LGR A;  3AKQ A;  3AVS A;  1UY1 A;  4QHO A;  4S2D A;  3ORJ A;  1RJ7 A;  1ULD A;  2WDB A;  3ZOI A;  1I5P A;  3BVC A;  2ENR A;  3BU7 A;  1PX4 A;  1SG3 A;  1N1S A;  3SIT A;  2R0H A;  1MPX A;  3JB8 A;  4NPM A;  3O1O A;  2FCU A;  2WAA A;  3O0V A;  4L0P A;  4PF1 A;  5SV8 A;  2DU1 A;  2WN2 A;  2WT0 A;  3NNG A;  5AVA A;  2X8K A;  1WZX A;  5FZ6 A;  1VBB 1;  3GNE A;  4FFI A;  4XDP A;  1B35 C;  1DYO A;  3ZFG C;  1OBN A;  1YIF A;  2BGO A;  3EXU A;  5JIA A;  3K77 A;  1F8V A;  4LUM A;  3LFI A;  2NZ9 A;  5C3R A;  1XRU A;  1VBB 3;  2QQO A;  1Q5O A;  4R4X A;  3A7Q A;  5L9R A;  3AKT A;  4FFG A;  4ZS2 A;  5FAX A;  3I2K A;  4DS0 A;  5F9T A;  3OGR A;  1EUU A;  2OYZ A;  1DBN A;  1U5Y A;  4YGC A;  3WR0 A;  5KHK A;  4XF3 A;  4QXB A;  1J3P A;  4B1M A;  1OLM E;  3IDE A;  5FTT C;  3VDC A;  3ZFG B;  5IK7 A;  1WBL A;  3HD8 B;  1DGL A;  4GAZ A;  4IEX A;  2WR9 A;  3UKV A;  4B4R A;  2YU2 A;  5I0U A;  3VZL A;  1G9B A;  1FOD 2;  4FPK A;  3DYO A;  2XON A;  4XZP A;  2BGC A;  4XXA A;  2WAO A;  1O5U A;  5ANQ A;  2QQV A;  2C4X A;  1XND A;  2DF7 A;  1BEV 1;  2GDF A;  2XG3 A;  2YU1 A;  4MGY E;  1SPP B;  2YFZ A;  5JXJ A;  2HWE 1;  2MEV 2;  3KV9 A;  4V2V A;  4EN0 A;  1CAU A;  4J1W A;  4CU7 A;  1KS5 A;  1RUE 3;  2VNO A;  3OJB A;  1N47 A;  2HWE 3;  4YW1 A;  5BXX A;  3VHP A;  4CU6 A;  4B7K A;  2AUY A;  4MGT A;  2OUH A;  2QQU A;  2XVG A;  4RSU A;  2FDK A;  1RHI 3;  1LCL A;  4AGR A;  5FV3 A;  4TSV A;  3B02 A;  5FZL A;  5C3P A;  3MV1 1;  3B7M A;  1LEC A;  5T3N A;  2JDP A;  4KNC A;  2JKB A;  1SLI A;  4A41 A;  2XQX A;  5F3I A;  3WDX A;  2CL2 A;  3E5U A;  3NJY A;  1W8O A;  1SLL A;  2O8Q A;  4XF4 A;  4OHV A;  3O1M A;  2XBO 3;  1UU5 A;  3MPB A;  1W9F A;  2D3R A;  2GME A;  2VQT A;  3H8O A;  1QQP 1;  1X7N A;  4QKN A;  2OA2 A;  1PVX A;  2OX0 A;  5FZM A;  1WMD A;  3VKN A;  4O9E A;  1RUC 2;  2XHN A;  3IDA A;  1KQR A;  3AYE A;  2LUW A;  4JVA A;  4ZZ5 A;  4M0N A;  5A6Y A;  1OA3 A;  5FZG A;  4XJU A;  1WCS A;  4IE0 A;  3K48 A;  4HK9 A;  4AL9 A;  4GZ9 A;  3SKJ E;  3AMN A;  3HBK A;  2BFU L;  3NRU A;  3KZ4 C;  4NWV A;  1JZ7 A;  1YHF A;  4ZY9 A;  1REF A;  1ALY A;  1TME 2;  1UMH A;  3UET A;  3VBR A;  2VZS A;  1E5I A;  1VBE 3;  5KHH A;  3WNN A;  1OUR A;  4YPJ A;  2Z4F A;  3NV4 A;  4AWD A;  5K0U A;  1FNZ A;  1PO1 2;  4N8M A;  2YFU A;  3I8T A;  2VO5 A;  2Y6H A;  3CDZ B;  3KGZ A;  4AQS A;  4Z8B A;  1DU3 D;  5DUW A;  5T50 A;  3WW1 A;  4OHZ A;  1K12 A;  4YZ4 A;  3H3Z A;  2WQ4 A;  2VCM A;  2EXI A;  2G19 A;  2W95 A;  2ATF A;  4JGZ C;  3ZLI A;  5L9B A;  2IZW A;  2YUE A;  3NV3 A;  1PNG A;  3M8L A;  1UOF A;  2QZ2 A;  2JDA A;  3QD6 A;  4P00 B;  3KWV A;  2EIC A;  1SLB A;  2ZGR A;  2LS6 A;  2D5H A;  1AR7 2;  1GZW A;  2CU5 A;  4DMI A;  2EXJ A;  1AR8 2;  2NN8 A;  3ZSE A;  5FY4 A;  1HQW A;  4NII A;  1JYV A;  2Q8D A;  2DYC A;  4GXL A;  4JX0 A;  3PDQ A;  4CCJ A;  4JGZ B;  2NYY A;  4YVW A;  1POV 1;  1QJU 1;  5A3O A;  3WP4 A;  3UKT A;  1VBC 2;  4BLJ A;  4XQ4 A;  1MS8 A;  3VBO C;  1VBD 1;  4O9G A;  3MLJ A;  5DUU A;  1PIV 2;  2QDR A;  1VBA 1;  4AHZ A;  1POV 3;  5T5O A;  1JS9 A;  1GWL A;  1S0I A;  4QPW A;  1I3H A;  3QH6 A;  5FYZ A;  1ZRD A;  1QXP A;  1QJX 2;  4HKW A;  2YC4 A;  3ZSJ A;  1VBA 3;  4DZG A;  5FMD A;  2RS1 3;  1QDC A;  1JOD A;  1MAC A;  1PO2 1;  2BOI A;  2X05 A;  3M1H A;  4OUE A;  2CAV A;  4GJY A;  4IEU A;  4MXW B;  2WS9 3;  3NAP A;  3ZXD A;  3S7I A;  2E31 A;  1DP0 A;  4Y3O A;  3AZY A;  4XQD A;  5H9P A;  5LK7 B;  4BIF A;  2WII B;  4QM9 A;  3I97 A;  1RUG 2;  3WOG A;  5FZF A;  3Q8E A;  3U07 A;  1ZA4 A;  1R08 2;  4GH4 A;  5CZK A;  4BHP A;  5IVJ A;  2BYV E;  4CDQ C;  5LAT A;  3MW4 A;  1QXJ A;  4H14 A;  1OLM A;  1VJ2 A;  4FPJ A;  3RDI A;  4OQ9 A;  4MYE A;  3AX4 A;  4RGG A;  1ZVF A;  4GIQ A;  2Y0O A;  5L7O C;  1CAX A;  2XJP A;  1Y9G A;  1CAU B;  4OMC A;  4F7Z A;  2ZHM A;  1MS9 A;  2A3X A;  2XJS A;  5AVP A;  3BB6 A;  2XWB B;  1GU3 A;  4LHS A;  4YM3 A;  2HH9 A;  3E6B A;  2ZX3 A;  4FQ4 A;  4LBN A;  1ZBA 1;  4CDQ B;  1ND3 A;  5IHR A;  1DQ5 A;  3BI3 A;  3JCI A;  5A7Q A;  1R1Z A;  2RMU 2;  2VZV A;  4K6B A;  4AED C;  1ZBA 3;  2IC1 A;  5L7O B;  5FMC A;  2WSV A;  1ZBE 3;  5FQ0 A;  2VGD A;  2DCZ A;  2YY1 A;  1PZ8 A;  4P14 A;  4PT6 A;  1KFX L;  2JX9 A;  2CTV A;  3IMM A;  3B69 A;  1O8P A;  4Q0P A;  4H7M A;  3VL9 A;  1LNS A;  1Y4W A;  4AQ2 A;  2JE7 A;  3OEA A;  5A6Q A;  1FPN 1;  3B5L B;  3VBU A;  1HN0 A;  2Z42 A;  2ZGU A;  4GA9 A;  5A7N A;  4AED B;  4Q0Q A;  3VBR C;  4NE9 A;  2Q1F A;  1W6P B;  2WRA A;  4KWL A;  5LA9 A;  1AX2 A;  4LKE A;  3NNM A;  1PVC 2;  2J42 A;  2VOV A;  1DZR A;  1BCX A;  1LHN A;  1LJ7 A;  3I3E A;  4LTA A;  3ACF A;  5GZE A;  5IVV A;  1EPZ A;  1PK6 A;  1LOA A;  1LRH A;  5IVB A;  4FXK B;  1SLT A;  2AAC A;  3KMH A;  5EHD A;  4GKX A;  5G04 L;  2GSY A;  4JDM A;  4CP0 A;  1K42 A;  1ONA A;  1JZ8 A;  3NL1 A;  3E6C C;  1OA4 A;  4D8M A;  5B4N A;  1FXZ A;  1J84 A;  1DLL A;  1UZV A;  4JV4 A;  1O91 A;  5FPZ A;  3ME2 A;  2YC0 A;  4LE4 A;  3VBR B;  3WF2 A;  5CBL A;  2W5F A;  1NLS A;  1XE7 A;  1LOG A;  3WF1 A;  3EHK A;  4XEZ A;  4D7Y A;  4GKY A;  4ZHN A;  2XGX A;  2SBA A;  2VMD A;  5JXG A;  5FP3 A;  1IKQ A;  1W99 A;  2D5F A;  1OI6 A;  3GYD A;  4CP2 A;  4UFL A;  2RJK A;  4M3C F;  4Z92 B;  1GV9 A;  4YVW C;  4QX2 A;  4I02 A;  1XE0 A;  2RS5 2;  3B94 A;  2D6N A;  1W0O A;  1W8N A;  5DZG A;  4Y4Y A;  3AMM A;  4WM7 C;  2FZ1 A;  4PF5 A;  3N9Q A;  3UJQ A;  2IFR A;  1SAC A;  4YW4 A;  5ERL A;  2CV6 A;  4FAH A;  4JKM A;  1A34 A;  1CAV A;  3ZXF A;  3V0B B;  5KC6 A;  2R06 1;  1FOD 1;  4YGB A;  1QXR A;  5FP8 A;  2BER A;  1EV1 3;  3PJQ A;  4QX0 A;  1G9C A;  1DGW A;  1Y3T A;  3AJY A;  1NQD A;  3HPN A;  1W6Q A;  4I0W B;  4RFR B;  4YVW B;  5FLH A;  5F5A A;  4B3N A;  4FAG A;  1YEW A;  4PIX A;  1FOD 3;  5ACA 3;  2P5B A;  4XCB A;  2GMM A;  4WM7 B;  2JE9 A;  4QGL A;  4RYD A;  2A6X A;  3NO8 A;  3VD3 A;  1CX4 A;  2GNT A;  1G6N A;  2GNB A;  2VZR A;  5FP7 A;  2ARA A;  4AFM A;  2MEV 3;  4BH9 A;  2JEC A;  4BWO A;  2VNV A;  3HNY M;  3L9J T;  5FZ9 A;  3WG1 A;  5FDB A;  2UYB A;  3THP A;  3CLP A;  5A7P A;  4ZXE A;  4TXW A;  1UO9 A;  1H2L A;  2Y6L A;  3NKT A;  4NAO A;  4LPL A;  1WD3 A;  3RYR A;  2YZ4 A;  1SMV A;  4AI3 A;  3KB5 A;  1GP4 A;  3WDW A;  1RUN A;  5J96 B;  1IPJ A;  4XAC A;  3EYP A;  1VAL A;  4KI5 M;  1IS6 A;  4CCM A;  5FY8 A;  4QB1 A;  2A3W A;  4Z07 A;  4FFF A;  5CB7 A;  1N1Y A;  4XMA A;  2DUP A;  2JEN A;  3TEW A;  3OUH A;  1RB8 G;  4XBN A;  5FRE A;  3ZXL A;  3N7J A;  1CAX B;  4FOW A;  4AR2 A;  5CKM A;  1XYN A;  3AP4 A;  4EE2 A;  1BMV 1;  1SBD A;  4L11 A;  4HVR A;  2PHD A;  2O14 A;  1RUC 1;  4YNI A;  4WVV A;  4IL7 A;  2RHP A;  2UWC A;  2P3J A;  4IEZ A;  4Y20 B;  5FBZ A;  1W6O B;  2BU9 A;  1RYY A;  3JBG 2;  2TUN A;  4B7E A;  1RUC 3;  4CYD A;  4I0A A;  2WYF A;  3HAG A;  4XFF A;  3IPV A;  4PBO A;  5A7W A;  1YQ5 A;  3C7E A;  2JG8 C;  2VZ1 A;  4LNV A;  1CZT A;  2HWC 2;  2XL7 A;  1UY0 A;  1PMI A;  3MFC A;  1UX6 A;  5F5Q A;  3FJS A;  4MZU A;  1W8F A;  3KV5 A;  1PO1 1;  4LBQ D;  2BW8 A;  2BGP A;  4KWK A;  2VMG A;  5DPN A;  1PK6 C;  1TME 3;  2QQK A;  4DXZ A;  3MLL A;  1S0F A;  2ZAC A;  4UW6 A;  2Y60 A;  2BFU S;  4UW5 A;  3SC7 X;  2FZ2 A;  2DFC A;  2JDN A;  2JB8 A;  3OCP A;  3J7M A;  4ZPI A;  4Y1Y A;  1PO1 3;  4YFW A;  5DUX A;  1AX1 A;  4YWA A;  3VBU B;  2O0O A;  2V5Y A;  1YIP A;  2JG8 B;  4UBG A;  5IK4 A;  5A3M A;  2W1U A;  4BU2 A;  4I30 A;  1BK0 A;  3UT0 A;  4EN9 B;  2A6V A;  2HJI A;  2E6V A;  2IXH A;  4AVB A;  5HXV A;  1AR7 1;  5FPB A;  4JRA A;  1OFN A;  2ET1 A;  3OPZ A;  1PK6 B;  4GJZ A;  3O7O A;  4RGK A;  2Y34 A;  4NRO A;  1OUS A;  3JQW A;  4UI9 L;  1WA4 A;  3C3V A;  1V6I A;  4I0B A;  3RPQ A;  3VDA A;  5A3T A;  1AR8 3;  3LCP A;  3S0M A;  2IXJ A;  2WNV A;  3PLQ A;  3PUH A;  4M0H A;  2ZA9 A;  2GZW A;  4FPL A;  2HWB 2;  3SQO A;  3IWZ A;  3KCX A;  1Q8S A;  1VBC 3;  4XJZ A;  3N7M A;  4EV0 A;  3HMY A;  4W6X A;  1ZZC A;  1KXG A;  1QJX 1;  1PIV 3;  1GZT A;  5C5U A;  3MYX A;  3H7Y A;  2XLA A;  5E89 A;  1AR6 1;  3C7G A;  3VD5 A;  5HPO A;  3PIJ A;  4ONU A;  2W9X A;  4IE7 A;  3GHN A;  3PU3 A;  1OMI A;  1NXM A;  3GXU A;  2J1V A;  4OUS A;  5K8S A;  4GB3 2;  4S2F A;  4KH9 A;  1JYC A;  4CCE A;  2RE9 A;  1URX A;  4GAL A;  1RUG 1;  4GMP 3;  4NHY A;  3WUD A;  2NM1 A;  3WDT A;  3LDR A;  1X33 A;  2JWP A;  1CES A;  3U4S A;  3III A;  5C3S A;  1GOG A;  4AYU A;  5FYV A;  2PHU A;  3O14 A;  4JC1 A;  2X53 S;  3WV6 A;  2G9G A;  1R08 3;  2ZEZ A;  1US3 A;  3T09 A;  3U0Z A;  5FP9 A;  3ZN5 A;  4WVZ A;  5J36 A;  1LOF A;  1O3S A;  4AOC A;  4SBV A;  1JH5 A;  1PGS A;  3TBD A;  1AVB A;  1IQD C;  1AXK A;  2KR2 A;  4HLT A;  2P37 A;  2WWJ A;  5A3U A;  1XSR A;  1V6M A;  2A6W A;  2RS3 2;  1KJR A;  5LEK A;  2YV8 A;  1NY7 2;  4QPG C;  4MGQ A;  2RMU 1;  2PLV 2;  3LEG A;  2HWD 2;  2HLE A;  2ZTN A;  4Q4X 2;  2VCA A;  4P5Y A;  1N1T A;  5LRS A;  5JVV A;  1J83 A;  1WKY A;  2WWS A;  5J98 B;  3IKW A;  4FPF A;  3GZT B;  4W8J A;  5CG9 A;  2AZ5 A;  2P6H A;  1W2N A;  2OUJ A;  1X8E A;  1H4H A;  2Y6F A;  5FYS A;  5FZD A;  3RWN A;  4UW4 A;  4CPB A;  5LK5 A;  1W2O A;  4CU8 A;  3MIF A;  4XCA A;  3R6S A;  3SCF A;  5KC5 A;  4TLG A;  5KHG A;  4AFA A;  3EQE A;  3LIG A;  3POJ A;  1ZZ8 A;  4Y33 A;  5DAX A;  3SEE A;  3TN9 2;  1ODN A;  1T6G C;  2B45 X;  4GWN A;  2JDY A;  1PVC 1;  2Z79 A;  2IXI A;  4DRV A;  1EY2 A;  3M3E A;  1ND2 C;  5AFB A;  4M00 A;  1OH3 A;  4BM8 A;  2WZE A;  2YGL A;  5L36 A;  4PCR A;  1GYK A;  2P3Y A;  3LQC A;  5FYT A;  5FZB A;  3KVA A;  5T52 A;  3PVE A;  5BYN A;  1CWP A;  2EF6 A;  1UYZ A;  1OHF A;  4DY3 A;  1M06 G;  2VW0 A;  1W6N A;  2H0B A;  4CE8 A;  1OF3 A;  1UMI A;  3CL1 A;  3PUQ A;  2WLP A;  3DKW A;  1DF0 A;  1ND2 B;  2A5Z A;  2DUQ A;  2JE8 A;  1DG6 A;  2WSU A;  1UY3 A;  2ZCW A;  4BJ0 A;  5FPX A;  2ZHL A;  3ZYH A;  1MEC 2;  1WW4 A;  1DQ4 A;  3SLI A;  1S55 A;  1BBT 2;  3TOJ A;  5JXH A;  2RS5 1;  3AXD A;  1VRH 1;  3HN1 A;  3IMN A;  5FYU A;  1AHS A;  2FHR A;  1H2N A;  4HZF A;  4MO3 M;  5IT6 A;  4LIU A;  2R07 2;  4EQV A;  1DYP A;  3VHN A;  3JD7 2;  3PTY A;  5A6Z A;  2DVD A;  2D6L X;  2PYT A;  5JZG B;  1ENR A;  4Q1P A;  2QTW B;  3ILF A;  3POB A;  4LUL A;  4X8N A;  2EXH A;  5FKB A;  1XE8 A;  2WYS A;  1U5X A;  3H7J A;  4FQZ A;  5HCB A;  3ZIW A;  4LQR A;  3QCW A;  1HDK A;  1DQ2 A;  2EAK A;  3DEM A;  1HLC A;  2A75 A;  3IDB B;  4XAE A;  4LK6 A;  1MZF A;  2ZGQ A;  1ZZB A;  4O61 A;  3VDD C;  1DDL A;  1CJP A;  4XJ9 A;  4HFS A;  1HRV 1;  1C8M 1;  2OQ6 A;  3WUC A;  1GSL A;  4YW7 A;  1UZW A;  2VUD A;  3D0S A;  2XJU A;  5H9Q A;  2YGM A;  1XPW A;  3ZYR A;  3L2H A;  3JXS A;  2XLG A;  4XBQ A;  3B9I A;  3B00 A;  4CDU C;  1YUD A;  5JSP A;  1LOF C;  2BBV A;  3ZFG A;  1B35 A;  1TZO A;  3E6D A;  3O1P A;  3WT3 A;  2BWA A;  2BQP A;  2F6B A;  5CKQ A;  2XOM A;  4C8D A;  3VD4 A;  5T5P A;  3S57 A;  3ECQ A;  2E7A A;  3AP7 A;  1PMJ X;  2F17 A;  1GQP A;  4OHX A;  2PMW B;  2VOT A;  4Y1X A;  4LBQ B;  4CEY C;  2VG9 A;  5FCC A;  1H2M A;  1R09 1;  1H1A A;  2JD4 A;  4K1Y A;  3DXT A;  2CSG A;  4AI0 A;  5JSO A;  2ZZQ A;  4BA6 A;  3HNM A;  2VW2 A;  4Q8L A;  1SPP A;  2VXR A;  5FZC A;  2AEY A;  3P3N A;  3MF6 A;  3NNF A;  1KGY A;  3CBN A;  3F2Z A;  4L2N A;  1WLC A;  2RS1 2;  3ABZ A;  4XC9 A;  3VBF A;  1IS3 A;  4WVW A;  3FHA A;  3MO4 A;  2VVD A;  2W1W A;  4R4Z A;  3JBG 1;  1SHW B;  2JIC A;  5KXC A;  3MBW A;  3CEW A;  1BVV A;  4AVV A;  4CEY B;  1EP0 A;  3MUZ 1;  1KEX A;  4Q29 A;  1YFX A;  5C5T A;  2DTW A;  3AJZ A;  2PTM A;  2C24 A;  1US2 A;  2JDK A;  3JBG 3;  3J26 N;  5JUV A;  3VN4 A;  3GGL A;  4D7T A;  3FHQ A;  5APA A;  2WO7 A;  5F6L B;  2WNU A;  1GLH A;  1EYB A;  2W08 A;  2HWC 3;  3LDK A;  5KHJ A;  4A7Z A;  1RTV A;  3ZXG A;  1CR7 A;  2R1D A;  3FUO A;  2ZHN A;  2G1M A;  1YQ8 A;  3OBT A;  3U75 A;  3LKJ A;  1W2T A;  1XNC A;  1UX7 A;  4FPC A;  1BXH A;  1NOV A;  4FOY A;  4P9L A;  3RYP A;  1I1E A;  1S0E A;  3FE5 A;  1OD3 A;  1VMH A;  1GMM A;  4LO6 B;  4Y22 A;  5EP9 A;  3D3A A;  1H6Y A;  5JOZ A;  1PHM A;  1DQ1 A;  1UXX X;  2EIB A;  3ES4 A;  4D6R A;  1CJD A;  4MET A;  3BOW A;  3GBG A;  4AG4 A;  2VD7 A;  4LA2 A;  4NHL A;  3VD7 A;  5HBA A;  5FMO L;  2VH9 A;  4IW3 A;  2XJR A;  3HEI A;  1COV 3;  2BBA A;  4TTG A;  3GJA A;  4DEV A;  4YM2 A;  3VLB B;  5E8A A;  4NHX A;  4UFJ A;  2WT1 A;  4Y1V A;  3M7A A;  2HWB 1;  1QMJ A;  1M4W A;  1UD1 A;  2XUE A;  5A7O A;  5BV6 A;  1TQ5 A;  1GFF 2;  4KWJ A;  1BHG A;  1X82 A;  3ZYJ B;  2ADD A;  2QDN A;  5LZ6 A;  3SH4 A;  3A0K A;  4ATE A;  4XET A;  3IBM A;  4D94 A;  3GAL A;  4AI8 A;  2J1R A;  2XR4 A;  3K51 A;  2YBK A;  1OPO A;  3ZFE C;  2FD8 A;  1RMU 3;  4OLL A;  3ZFF A;  3B01 A;  4CDX A;  1YI9 A;  1VR3 A;  5T54 A;  2ETE A;  2NMN A;  4GB3 1;  1FMD 2;  5JI7 A;  1VRB A;  3NMB A;  2WFF 3;  2BRT A;  4CEW C;  4JTO A;  2Q1M A;  3W58 A;  2OZ6 A;  3MI8 A;  3P3P A;  1JZ6 A;  4QQP A;  4FT8 A;  2B46 X;  4YZ3 A;  1LHU A;  4GB3 3;  1NT0 A;  1I6X A;  3T2Q A;  5FYH A;  3ZFE B;  2D6K A;  4XHB A;  1MVE A;  5FYI A;  3KVB A;  3POI A;  4JGZ A;  4OZO A;  1KIT A;  1MS4 A;  5KHI A;  5EV7 A;  2UYA A;  4Q2F A;  1ENQ A;  1VAV A;  4QM8 A;  4IE4 A;  5L9V A;  4FPG A;  4LBK A;  2XJQ A;  4PIZ A;  3I3Q A;  3I2O A;  5EFU A;  3VZJ A;  1E5S A;  4LOS A;  3H9A A;  4CEW B;  1AL2 2;  1JYI A;  3OUJ A;  3OOX A;  4F3J A;  1TMF 2;  2YPD A;  3OGG A;  4LOT A;  3BPZ A;  3OTF A;  4PLN A;  4XHX A;  5KBF A;  5H9S A;  1AX0 A;  3IB3 A;  3CO2 A;  4Q4X 1;  1B35 B;  2NMO A;  2RS3 3;  1S2K A;  2WO2 A;  3ILN A;  4XF1 A;  3VBO A;  4BQW A;  1K5M A;  4TLF A;  4MXW A;  1AYN 2;  1EV1 2;  3LAG A;  2PLV 3;  3E1F 1;  3HWJ A;  1Z78 A;  4YG0 A;  5LA1 A;  1JYT A;  2HWD 3;  4Q4X 3;  3VBF C;  4XYX A;  4Q4Y 3;  2DVA A;  5BNP C;  5ACA 2;  2FDF A;  5DQ0 A;  4J25 A;  3ZYB A;  4BZ4 A;  5B2G B;  3ACH A;  1OT5 A;  2GNM A;  3VGI A;  2LM3 A;  2GH2 A;  2QBX A;  1RUE 1;  3PNA A;  2K0G A;  5C33 A;  1O5L A;  3KQR A;  4FXG B;  2ADE A;  1NZC A;  1E5H A;  2BWC A;  4OI0 A;  4S2G A;  3ZR6 A;  4HOO A;  2WNU C;  1C8N A;  3R0R A;  4AQ6 A;  3VKF C;  1RHI 1;  1ACC A;  1PNF A;  3MW3 A;  1RC6 A;  3VBF B;  1NG0 A;  1ZX5 A;  2DBI A;  3TN9 3;  3VHO A;  3ZX7 A;  1JZ3 A;  1L7R A;  5BNP B;  3TYJ A;  3OD0 A;  4HKL A;  1RIR A;  4XFB A;  2O8O A;  4CDQ A;  1O3T A;  1CX1 A;  2C26 A;  1IKP A;  2VZU A;  4PJY A;  4Y1U A;  2DWR A;  3S7E A;  3DYM A;  5FWE A;  2VVF A;  5KXE A;  2W2I A;  2XL9 A;  5L7O A;  1UZZ A;  4HSJ A;  5A80 A;  1UAI A;  4M3C A;  2I74 A;  3TEZ A;  1OQE A;  2WNU B;  3LOB A;  2XBO 1;  2CWM A;  3H42 B;  2QQW A;  3KCC A;  3BIW E;  3I2J A;  2BZD A;  4GWJ A;  1H30 A;  1BBT 1;  3DEC A;  2VBD A;  4ITC A;  4QQH A;  1YFW A;  3SNM A;  2WZP P;  4MX3 A;  3DL3 A;  2UUR A;  4H2A A;  4JHZ A;  3WDU A;  5A3N A;  4AVT A;  5M0T A;  5JWP A;  1F5F A;  1IG0 A;  1MEC 3;  2WN3 A;  4AED A;  2PQS A;  2YHJ A;  3I2D A;  1BBT 3;  5FY9 A;  1W6P A;  5I91 A;  4ARY A;  3A4U A;  3AK0 A;  4Y22 B;  5F2W A;  5FXZ A;  2JDU A;  1W8Z A;  2ZX4 A;  4XJA A;  5JR2 A;  2R07 3;  1J1T A;  4MHR A;  4JZR A;  3OBR A;  2RM2 2;  2DCY A;  3JD7 3;  3T4H B;  2V73 A;  3T08 A;  2Y8K A;  4YM1 A;  5IAT A;  4UAP A;  1VBE 1;  2QFE A;  1GOH A;  2W1Q A;  1LU1 A;  3AP6 A;  3PME A;  4QKF A;  3ZFF C;  5CAZ A;  3ZDV A;  4CDX C;  1ZM1 A;  5HV0 A;  3WNO A;  4MXV A;  3CMG A;  3H3U A;  2WIN B;  3JUU A;  2FQP A;  3OB8 A;  4JTN A;  4YW6 A;  5FXV A;  3RYK A;  2GMP A;  1BJQ A;  3LF7 A;  3OD4 A;  4RL7 A;  5ABJ C;  2XXZ A;  1UPI A;  5FY7 A;  4KWU A;  2DU0 A;  4QT6 A;  5K4L A;  2WZ8 A;  3ZM8 A;  1O4Z A;  3HJR A;  3AKP A;  2NQY A;  2VCB A;  3ZFF B;  1VP6 A;  4QKB A;  2HBU A;  3RNS A;  4CDX B;  5C71 A;  3O1T A;  2V72 A;  1O4Y A;  4IE5 A;  5EYX A;  1MQT C;  5FZ1 A;  2QQI A;  4ORF A;  4K1Z A;  4JCK A;  5ABJ B;  2ZKL A;  2EVX A;  3V0B A;  1D2Q A;  3C7O A;  1GP6 A;  2ARB A;  3I4I A;  1VLN A;  2Y0I A;  3H1M A;  4LEJ A;  3BKZ A;  1LHW A;  1W3X A;  2W39 A;  4NHK A;  4D69 A;  2V4A A;  4I01 A;  4JGY C;  2QQL A;  3ACI A;  4Y1Z A;  1CQ9 A;  5JI9 A;  1CIY A;  1K5M C;  3RI9 A;  2A1X A;  4WM7 A;  1MQT B;  2DBN A;  1IS4 A;  1WCU A;  2RS1 1;  2WFP A;  4X6Q B;  3U11 A;  3VUO A;  4Q26 A;  4Q0V A;  2X5I C;  2VEC A;  4N9H A;  1Y43 B;  1QNY A;  4XAB A;  2RDS A;  5JOY A;  3ZXJ A;  2WS9 1;  3X29 B;  3MGU A;  5FOJ B;  3CKH A;  4XDQ A;  3PTR B;  3VKO A;  3WCS A;  3HVD A;  4P9Y A;  1OLQ A;  1F31 A;  2QCS B;  3Q9O A;  1MS5 A;  3BAL A;  4RA0 A;  3VBO B;  5A32 A;  2GC2 A;  5F7U A;  1K5M B;  1XNK A;  2C9K A;  4E2Q A;  4LK7 A;  2BP6 A;  3R4U A;  4YRD A;  2R49 A;  2RDQ A;  3LD8 A;  4XVH A;  4AGG A;  5K7P A;  2FDH A;  2VOK A;  4V2W A;  5J37 A;  2OPW A;  2G4I A;  4AI9 A;  4XPV A;  2PA7 A;  2X5I B;  5HXM A;  1DHK B;  1WWY A;  4A45 A;  3AL5 A;  3FHI B;  4NHM A;  1AYM 2;  3FLR A;  3RZL A;  4Q4V 2;  4PLM A;  4W4Z A;  1B09 A;  2F4L A;  1FYU A;  1XNB A;  3IM0 A;  3WF0 A;  3W21 A;  3AKS A;  1AJO A;  4XF9 A;  5EQU A;  1GBG A;  3J8F 3;  2PHX A;  3AZZ A;  4R9C A;  1YQ6 A;  4XUR A;  1HQL A;  4Q1R A;  5A33 A;  3UK9 A;  2BVV A;  3VBH A;  1S0D A;  3AXE A;  1G86 A;  1GZ9 A;  4BE3 A;  4A6O A;  3POG A;  4MVT A;  1HQN A;  2PHW A;  1C1F A;  2AR6 A;  1XSQ A;  1W6O A;  4MLO A;  4Y20 A;  1ZBE 1;  3R4D B;  1JU4 A;  5GLU A;  2ZX2 A;  2R04 2;  4YG3 A;  2Z2S B;  4NRQ A;  4DUX A;  4E4H A;  1JW6 A;  4ISR A;  4MOA A;  3J7H A;  4XE9 A;  1QH6 A;  2VZT A;  4M3C B;  1C57 A;  1GQG A;  1WCD J;  4QU1 A;  5J7M A;  1AJK A;  2VZP A;  1G9D A;  3KF3 A;  4FTE A;  1XNT A;  3OSD A;  2WUH A;  3WNP A;  3LDB A;  1RUF 3;  3N35 A;  4JHT A;  5FMO S;  4EJR A;  5C9A C;  2PEL A;  4E8C A;  1SDW A;  4DPN A;  5IFP A;  2JG8 A;  2PHL A;  2BNO A;  2VOX A;  4ZKT B;  1LES A;  1YNA A;  4HVO A;  1LGC A;  5CIS A;  2CDP A;  2GAU A;  2VTX J;  3LA3 A;  4NO4 A;  3T1L A;  4QAW A;  1DZT A;  4OUM A;  1QJY 2;  4EN8 B;  5EJ3 A;  3QAC A;  4QB2 A;  1FMD 3;  4IE6 A;  1ZRF A;  2E33 A;  5C8C C;  2E9Q A;  5JOW A;  2XJT A;  2HWF 2;  4Q27 A;  4OVE A;  4BLI A;  3CIH A;  4IV1 A;  3ZSM A;  5C9A B;  1JTZ X;  1FT9 A;  1H1I A;  4H55 A;  3VL8 A;  3WCR A;  3POW A;  1SDD B;  1HRI 2;  3BN6 A;  5GLV A;  2CNA A;  2VAU A;  2VMC A;  3ETP A;  3H1W A;  5FY0 A;  4DEQ A;  5FZE A;  3HN3 A;  2FMD A;  5JLV A;  1WBF A;  5GLW A;  1AL2 1;  1ZRC A;  4LA3 A;  4BCU A;  1YJL A;  2DUR A;  2LAL A;  2I45 A;  5FK8 A;  1O7F A;  5C8C B;  2Q8E A;  3WHT A;  2D6P A;  1JHN A;  2KD7 A;  3N7K A;  5IAX A;  1AL2 3;  3M3Q A;  4XUQ A;  4Z2A A;  2DTY A;  4FPH A;  1NX9 A;  1TMF 3;  3K3N A;  5FXX A;  5FZ7 A;  3R05 A;  3VZM A;  1Z7S 2;  2KA3 A;  1EV1 1;  1R64 A;  4E8D A;  1MS3 A;  1WLT A;  2WAB A;  1W28 A;  4H7L A;  3HQU A;  2E53 A;  2JG9 C;  2W46 A;  5ACA 1;  4QHB A;  5LY1 A;  2D3S A;  1UL9 A;  1AYN 3;  5K9Y A;  1XNA A;  1FV2 A;  5J09 A;  2ZGP A;  3RZH A;  1UZY A;  2BUK A;  1LU2 A;  2D7F A;  2ZML A;  5J3U A;  1EAH 2;  2JXA A;  3N9M A;  4A42 A;  5AC9 2;  1LKN A;  2GC1 A;  5F37 A;  1QEX A;  2ZJC A;  1C28 A;  2VJX A;  3WY6 A;  4F8A A;  5GZG A;  1I9R A;  2MEV 1;  3W59 A;  1TG7 A;  2Q8O A;  5GAL A;  3BYW A;  3WG3 A;  2D6O X;  4Z1V A;  5JOX A;  3OGV A;  4CSW A;  1G9A A;  2JG9 B;  3OGJ A;  4FPO B;  2B39 A;  3G6J B;  1MVQ A;  3LE0 A;  1W2A X;  2P4E A;  5DG2 A;  1QIQ A;  4LBO A;  4QX5 A;  2WLQ A;  3VKL A;  5DN2 A;  4RGA A;  5A32 B;  1STM A;  1MR5 A;  1HW5 A;  2XUM A;  1NKG A;  4M4R A;  1FAY A;  1OQ1 A;  3J4U H;  4K20 A;  4R9A A;  3O0W A;  4BQ4 A;  1RUI 2;  4Y5T A;  3VBH C;  3CQO A;  2PHT A;  3JB4 C;  3QOP A;  4W50 A;  5KWR A;  1ZZ6 A;  3LZZ A;  1ASJ 3;  3Q8B A;  2F4P A;  5BNN A;  3K46 A;  4Q0U A;  4NUB A;  3WP6 A;  3AFK A;  4LXL A;  3AC0 A;  1KS4 A;  4JQT A;  5LW9 A;  4QPG A;  5JXI A;  3FLT A;  4RQP A;  4QQL A;  5FR3 A;  1H4G A;  4LO5 B;  3AVR A;  1OC1 A;  2L9L A;  3SCG A;  5A33 B;  3VBH B;  1HB3 A;  2ZEY A;  3GDB A;  5CFC C;  3ZMN A;  5F1R A;  1DGW X;  2ORX A;  4LOR A;  3DN7 A;  4LO8 A;  4ASL A;  1TNR A;  2RM2 1;  1QJE A;  2RV9 A;  4MG2 A;  3OPT A;  4LMF A;  1JXN A;  4AI2 A;  5E88 A;  3S6P A;  4B4P A;  4A7K A;  1F9K A;  3P5B A;  2Y33 A;  2YB7 A;  2W87 A;  2RM2 3;  4K9S A;  1TME 1;  1XC6 A;  1A3K A;  1RJ8 A;  2VUA A;  3GCW A;  2EID A;  4B8E A;  4KGG A;  5CFC B;  4LBM A;  3MPP G;  1XXN A;  5FJK A;  4QX7 A;  3IDC B;  2XHK A;  2N7G A;  1ND2 A;  1WLD A;  3WW3 A;  4Y5S A;  4Q8K A;  3H1Y A;  3KV6 A;  2GN3 A;  4LIT A;  2H6C A;  4IV1 C;  2BJS A;  1OQD A;  4OCT A;  2J1T A;  3ATG A;  1PGW 2;  4NAM A;  3A21 A;  2R0F A;  3SEP A;  3JU9 A;  4BYY A;  4GQ7 A;  2ZEX A;  1PZ9 A;  2G9Z A;  2SLI A;  5GKA C;  1AR8 1;  3MF9 A;  3H3L A;  2WO1 A;  3P6B A;  3RVH A;  4CCN A;  1COV 2;  1RVF 2;  1PZ7 A;  5JZG A;  5E16 A;  3ZYF A;  4FFH A;  3USU B;  3PUI A;  3VDB A;  2XKP A;  5GM0 A;  4IV1 B;  4AHX A;  3ZYP A;  4AEJ A;  1TEI A;  2W3J A;  3ILR A;  3ITQ A;  2OXB A;  1VBC 1;  3POF A;  4IND A;  2UWB A;  3JZV A;  1OKO A;  3PVB B;  1D4M 2;  4EYU A;  1KJL A;  2NPI A;  2OT7 A;  3AYD A;  3FFQ A;  1LAJ A;  1PIV 1;  2V09 A;  5DDJ 2;  4J1X A;  4A3Z A;  4NWW A;  2VNG A;  1H8T A;  1Y7B A;  2W47 A;  1LB2 A;  1ULE A;  1RMU 2;  2Q1Z B;  1OVS A;  5FPV A;  2K9Z A;  4ATF A;  3POY A;  3FUQ A;  3PUR A;  4YYO A;  1DZQ A;  1SLC A;  2E7T A;  2ZAA A;  4YGE A;  3RJR A;  4OI1 A;  3GZA A;  4PQQ A;  1DFQ A;  3T2T A;  5JPM B;  1V6N A;  2WJS A;  4GWM A;  2WFF 2;  1RL3 A;  4GMP 1;  4LIV A;  4BOW A;  3NKG A;  4XTM A;  1X8M A;  3T0B A;  3ELN A;  1NLR A;  3HT1 A;  3NJZ A;  4N9I A;  5D8A C;  3V65 A;  3MIC A;  3VDD A;  1UIJ A;  1LGN A;  4P9X A;  4QPY A;  3BIE A;  5LAS A;  1R08 1;  3WP3 A;  2B4K A;  3PJY A;  4DO0 A;  4K3U A;  2B5H A;  4XXP A;  5IVE A;  2UWA A;  2OQ7 A;  1AR9 2;  4LBQ A;  4IDZ A;  4YSF A;  4DRR A;  4QB6 A;  3AP5 A;  1AYM 3;  3I2F A;  4CDU A;  3WQ0 A;  4Q4V 3;  1R1A 3;  3N9O A;  3IT8 A;  4IEP A;  4NN0 A;  1O4T A;  4OUL A;  2D44 A;  5D8A B;  3HBZ A;  2HEV F;  1W9W A;  3OYW B;  3POS A;  5BNN C;  3ALQ A;  3CHX A;  4CUG A;  4CUB A;  4E4Z A;  1X9T A;  2W1S A;  2YBS A;  4XMI A;  2EXK A;  3VD9 A;  4JAA A;  4MH0 E;  4CEY A;  3JQX A;  3BPS A;  2R04 1;  1BK1 A;  3NJV A;  4ERO A;  4EZH A;  2QJV A;  3MID A;  4TZD A;  4IEW A;  4RQP C;  2RR1 3;  1PMH X;  4CCK A;  1Q43 A;  4RHV 2;  4Q4Y 2;  4UFK A;  4QKD A;  3RZG A;  1V6J A;  4ISQ A;  4YZ5 A;  1C4R A;  2E26 A;  2R04 3;  3DV8 A;  3CF6 E;  5BNN B;  3W5M A;  3N9L A;  3RGB A;  4N7U A;  4A4A A;  5FYB A;  1MS0 A;  3WSO A;  4JKK A;  4GWI A;  3CJI C;  4K8F A;  4QXH A;  4C91 A;  3O1U A;  3VB9 A;  4NOT A;  5FMB A;  1FAT A;  3WF3 A;  3TRS B;  4QPG B;  5LCW L;  4B4Q A;  4FPE A;  1HB1 A;  3AZW A;  3DXU A;  4RQP B;  2W94 A;  2BVB A;  2P1B A;  4QDQ A;  1N3P A;  4NJ4 A;  5IW0 A;  4L8Q A;  5T5L A;  4CP9 A;  3GCX A;  4LE3 A;  1QJY 1;  5A6X A;  1F4H A;  1L3J A;  4PHZ A;  1O6U A;  2DFB A;  1YO8 A;  2ORZ A;  3H0O A;  4IEY A;  3CJI B;  3A22 A;  4JDO A;  5LBC A;  3KHC A;  1UY2 A;  3LOI A;  1HB2 A;  3WDY A;  3TB0 A;  1QJY 3;  1W90 A;  4BB3 A;  4LJH A;  5DG1 A;  1UYX A;  1LUL A;  4O7X A;  2VC9 A;  4XUT A;  3MHZ A;  2HWF 3;  2UY9 A;  1NCR C;  2A3Y A;  3BOD A;  3INA A;  5FOB B;  2QZ3 A;  3WXP A;  5FLJ A;  1XBF A;  1DCS A;  4NVP A;  2NLR A;  3PIG A;  1HRI 3;  2C0Z A;  1BLZ A;  4ZU7 A;  2P6C A;  2FMY A;  1XOY A;  4W6Y A;  4XQW A;  3ZMO A;  5FUI A;  4NIA A;  4BQ1 A;  3WZ1 A;  2XDV A;  5IJR A;  1CAW B;  2AC1 A;  1Z7S 1;  4XFC A;  1YC6 1;  1NCR B;  1H8T C;  3UV9 A;  1H6X A;  4KBB A;  2B7Y A;  1PX3 A;  1CON A;  5F5C A;  5EPA A;  3RJ2 X;  5C70 A;  5JAX A;  1E5R A;  3APB A;  1QH7 A;  2MPF A;  4R8H A;  1Z7S 3;  4IET A;  2IXL A;  2Y64 A;  2ARX A;  2MHF A;  4PI2 A;  4MSV A;  5FBJ A;  3VBS A;  3VZK A;  4P9G A;  4PDW C;  3ZFE A;  1MZ6 A;  4IEV A;  4DB5 A;  5FZ8 A;  3RFR A;  5C8W A;  1RIN A;  1YQ2 A;  2A6Y A;  4P08 A;  1POQ A;  4P9J A;  3ES1 A;  1H8T B;  3N9N A;  1EAH 3;  1YXW A;  5AC9 3;  1JBC A;  2WNO A;  1MS1 A;  2VBB A;  1UN1 A;  1QF3 A;  3LA7 A;  4IUG A;  1VB4 A;  3UGH A;  3ZYG A;  4AHW A;  4CEW A;  5FO9 B;  4CU9 A;  4COW A;  1JUH A;  5A1L A;  1NA1 C;  1Q8V A;  1XYO A;  1Z0H A;  4YGD A;  1H0B A;  2IVI B;  4PDW B;  4QPI C;  5GLZ A;  3AM2 A;  2QKD A;  3U4X A;  1JOB A;  1W9Y A;  4LO7 A;  3FN9 A;  2ZGO A;  4K7J A;  4GUL A;  1GWM A;  5CYY A;  3VDD B;  5HI0 A;  1SEF A;  1QOS A;  3I2I A;  2XWJ B;  5I0S A;  3V0A B;  2ZXQ A;  3I49 A;  3MLK A;  1E57 A;  4RS5 C;  4YW5 A;  2JB4 A;  1W2U A;  4XZU G;  3NNL A;  1RUI 3;  5D2A A;  1AUY A;  1NA1 B;  4KU7 A;  4UFH A;  2PAK A;  2YYO A;  3KLS A;  4W6W A;  5FJH A;  5JR7 B;  4IGO A;  4EWD A;  5LA2 A;  4LKD A;  4CDU B;  4YZ2 A;  4LBL A;  2DUO A;  1AF9 A;  2I2S A;  5D1I A;  1Q3E A;  4FCA A;  2ZKN A;  1W6M B;  1S1A A;  4CXW A;  1UKG A;  4RS5 B;  4M3C E;  2VTF A;  4K8R B;  2IXK A;  4LKF A;  5C4W C;  3H8U A;  1S4C A;  3D0J A;  2OS2 A;  3MIH A;  4HK8 A;  4FBF A;  5BNP A;  1QJZ A;  2BEO A;  1L7L A;  1YWK A;  3ST7 A;  4DIN B;  4A44 A;  4NRM A;  4XFG A;  2HWC 1;  3POE A;  3NVC A;  2CGN A;  1QJU 2;  3AYC A;  4I3G A;  1WW7 A;  4GD4 A;  4AFD A;  4G3Y C;  5FP4 A;  5AFE A;  1VBD 2;  1G8W A;  2Y38 A;  5C4W B;  3LEI A;  1DGR A;  3J8F 2;  1S2B A;  1LHV A;  1IGO A;  5FZI A;  1KRI A;  5F6K A;  5A7W B;  5FRA A;  3AZX A;  1PGW 1;  2WZR 3;  4YFZ A;  1W8T A;  5FO8 B;  3OUI A;  4HSL A;  3FBM A;  4HPK A;  1QOO A;  1VPH A;  5FZA A;  3THC A;  2JKX A;  3ZKU A;  1PO2 2;  4CP9 B;  2J1A A;  4OZX A;  5IVC A;  1ULP A;  5BNQ A;  1COV 1;  1RVF 1;  2B9V A;  5CNA A;  1DQ0 A;  2OII A;  1HV0 A;  3ZKY A;  2FBE A;  4YW2 A;  4I2O A;  1RIT A;  1RVF 3;  2J1S A;  2VM9 A;  1D4M 1;  2R6Q A;  4MGZ E;  2ZGM A;  2V4V A;  3QH7 A;  4L99 A;  5CAD A;  2H6B A;  1OOP C;  1RUF 2;  1RUD 2;  3DF0 A;  3ZDS A;  3EMR A;  4QHZ A;  1D4M 3;  1RMU 1;  2Y6K A;  3M70 A;  2H0V A;  5JCT A;  2RJL A;  3WF4 A;  1UU6 A;  5A3P A;  5DDJ 3;  1YI7 A;  5LA0 A;  1NYW A;  2JIG A;  3VBS C;  4DUW A;  3G7D A;  3MV0 1;  4A7Y A;  2FDG A;  1LOD A;  3V64 A;  4D7S A;  1LED A;  2WFF 1;  3VHR A;  1JU3 A;  2VQ0 A;  3Q8F A;  4XFH A;  3W20 A;  1OOP B;  2HKX A;  2XJV A;  2G9F A;  1L7Q A;  2YMZ A;  3LIH A;  3O5S A;  4HL0 A;  4FTB A;  3DKQ A;  3S5Q A;  5IAV A;  5ABJ A;  3ZPY A;  2DCJ A;  3BU0 A;  4COY A;  3E5Q A;  4Y26 A;  3VBS B;  2QQJ A;  5KXB A;  3KT7 A;  2YC2 A;  5D21 A;  3O0X A;  1Q8Q A;  1A78 A;  3V56 A;  4KGQ A;  1IZ3 A;  4JQR A;  4E4D X;  3S30 A;  4HN1 A;  1AR9 3;  3RSJ A;  4DNY A;  3MFA A;  1HXS 2;  2BNM A;  1MQT A;  4D6Q A;  1NQJ A;  5GJ6 A;  3RQ0 A;  3WEZ A;  1PGL 2;  1SQ4 A;  2RS3 1;  4CXY A;  2Y6G A;  1QNW A;  5B4X A;  1NY7 1;  1NUK A;  2OKX A;  3HR9 A;  3O1V A;  4XJ8 A;  2PLV 1;  3WHU A;  2WA4 A;  4JGY A;  2HWD 1;  4N53 A;  4AE2 A;  4RHV 1;  4Q4Y 1;  3ZSL A;  4COU A;  4K40 A;  2PAE A;  4CA9 A;  3BCW A;  3GF6 A;  3WVJ A;  5JPN B;  4QXK A;  4XIK A;  1ZRR A;  4C0B A;  1LR5 A;  3EBR A;  4D6S A;  3BGA A;  4RHV 3;  5FFO C;  3UJO A;  2X5I A;  1QWR A;  2W92 A;  3A23 A;  3NJX A;  4XFA A;  3RMX A;  2KXL A;  5JMC A;  1SBE A;  3TAY A;  5A1F A;  3R4S A;  1KDK A;  2QUO A;  3TN9 1;  4JRL A;  2FCT A;  4NIH A;  3ZN4 A;  2ZZJ A;  2VU9 A;  4C1X A;  3PU8 A;  4N43 A;  1IQA A;  1LOC A;  2IUW A;  4K21 A;  3K2O A;  4HXC A;  1UWW A;  1WCQ A;  4IGP A;  2B8M A;  2BNN A;  2P2K A;  4HKO A;  3TNQ A;  1C3H A;  1CD3 G;  2QQN A;  3FWE A;  2R06 2;  3D8C A;  3DCQ A;  1ASJ 2;  1H9P A;  4QXC A;  2JDM A;  2K46 A;  4L9B A;  1A8M A;  3LSD A;  4E4S A;  4RD7 A;  1GP5 A;  3D6E A;  1OKQ A;  2VZ3 A;  5I0T A;  4PQ9 A;  3T4V A;  4CDW A;  4ZZ8 A;  4ZS3 A;  3PUA A;  5DAP A;  4DUV A;  1FX5 A;  1NCQ C;  1QDO A;  1SCR A;  1UOG A;  1MEC 1;  2EAA A;  2XLF A;  1EPW A;  4QQ2 A;  4ES9 A;  5BNO A;  3ZYI B;  1BEV 3;  4AW7 A;  5IK8 A;  5A3W A;  1UCX A;  3NQH A;  1CZS A;  3LFM A;  4HPK B;  4XTP A;  4AZZ A;  4HON A;  1W8U A;  2R07 1;  5KXD A;  3IAQ A;  4DXR A;  2XML A;  5HCA A;  1GNY A;  3JD7 1;  3LPG A;  4XW3 A;  2R32 A;  2UU8 A;  1WLW A;  3BTZ A;  1SBF A;  1W8W A;  4D0Q A;  4DXT A;  1BYH A;  1NCQ B;  1CPM A;  1VMF A;  3UES A;  2VMH A;  3WLU A;  4DXS A;  3KV4 A;  3A0N A;  1HJG A;  5IVY A;  4BIO A;  3C7H A;  3N36 A;  5C9A A;  5CA6 A;  1H9W A;  1DYK A;  4LT5 A;  5E1R A;  1JI6 A;  2YXS A;  4KG0 A;  3SXW A;  2ZAH A;  2VQA A;  4TYS A;  4AFC A;  1XU2 A;  3GJB A;  1HB4 A;  1BMV 2;  2VQU A;  1QOT A;  2B42 B;  1ENX A;  2AEN A;  2DCT A;  1SFY A;  1W0P A;  5C8C A;  3HIF A;  2P3I A;  1QQP 3;  3KT4 A;  2GP3 A;  3I59 B;  3HT2 A;  4DIQ A;  1AZD A;  4MAD A;  4UF0 B;  2R16 A;  1KD7 A;  3K4Z A;  4BPZ A;  4I3P A;  3N3H A;  2OW4 A;  1UMZ A;  3I3D A;  1NE4 A;  4QGM A;  5FZK A;  1FI2 A;  5IUQ A;  4AFB A;  4G9S B;  2NP0 A;  1KFU L;  3KD4 A;  4Z82 A;  5I93 A;  3W9A A;  5IWF A;  4OI2 A;  4FO9 A;  5EYY A;  5DUV A;  4UBH A;  2CGO A;  3GHM A;  4AQT A;  4N7I A;  2A71 A;  3FLP A;  5EJ1 B;  1CVN A;  2TEP A;  4SLI A;  4QU2 A;  4N53 C;  5EXO A;  1UYP A;  4QX1 A;  4WV8 A;  1LOE A;  3ETQ A;  3PMS A;  1LTE A;  2CY6 A;  3PUS A;  3D82 A;  4QDR A;  4XIO A;  4NRP A;  4ARX A;  5CKN A;  4WZC A;  5A70 A;  1W0N A;  2JG9 A;  4E2S A;  1GNZ A;  5DXD A;  3H8X A;  1S0G A;  1V00 A;  4XDO A;  3IIA A;  5I0D A;  5CU1 A;  5IFT A;  2TNF A;  3TEX A;  4JGY B;  4URT A;  3RZK A;  4N53 B;  4DOU A;  3KCY A;  4F83 A;  4XOG A;  2YG0 A;  5FY5 A;  3VV1 A;  1JUI A;  4CZS A;  4N43 C;  2CWS A;  1H8V A;  4KBZ A;  2HBT A;  3ZPO A;  2A6Z A;  4Z2W A;  5FPU A;  2ZGK A;  4UWD A;  5F5I A;  4HAN A;  1W03 A;  2C1F A;  3J8F 1;  1QJU 3;  1Q56 A;  1D0G A;  3SH3 A;  1IOA A;  3LWC A;  1R1A 2;  2E7Q A;  1WGP A;  1VBD 3;  1F2N A;  2WQ8 A;  2Z69 A;  5FYC A;  3SKV A;  2Z5W A;  3T2P A;  2BOJ A;  1MZE A;  1AR6 2;  3NV2 A;  4KG8 A;  3IZO A;  4N43 B;  2PN5 A;  4CDW C;  1VIW B;  5I8Y A;  5JZG C;  2J7M A;  1U5Z A;  5BNO C;  3FBY A;  3AL6 A;  2RR1 2;  1APN A;  4CCL A;  1PO2 3;  4QX3 A;  4AF9 A;  2ET7 A;  2WQZ C;  5BPX A;  1XB9 A;  3PVO A;  3NV1 A;  2J1E A;  5T55 A;  1HKD A;  3CNA A;  1GQH A;  1W9S A;  3AMP A;  3PHM A;  3D4K A;  3P1I A;  1RUF 1;  1RUD 1;  1F5J A;  2JDH A;  2PHR A;  4KQ7 A;  3WNL A;  1IPS A;  3WNM A;  4CDW B;  2R7E B;  1FV3 A;  5CFC A;  4LUK A;  5BNO B;  4LBJ A;  4OQ8 A;  3DUI A;  1RUD 3;  1J59 A;  1T6B X;  1WME A;  1CPN A;  1ZNP A;  2A70 A;  2YRO A;  1RED A;  3ZXK A;  4IEQ A;  4LO4 B;  3AMQ A;  2J22 A;  1NLQ A;  3FL7 A;  1FMD 1;  1QGL A;  4LR4 A;  3ZN6 A;  1RUO A;  5F8P A;  4WM8 A;  4RR3 A;  2W91 A;  1D4V B;  3AP9 A;  5GZD A;  4IES A;  4P9I A;  4Q0S A;  4JKL A;  1JHJ A;  2WKK A;  3PVN A;  1LHO A;  2EAL A;  1SFN A;  1BZW A;  4MGI E;  4H3W A;  4XUN A;  3USU A;  4XIL A;  5FIX A;  3Q8C A;  4RFT 0;  4BK4 A;  5JDB A;  1YQC A;  2FCV A;  5FZO A;  3KQ4 B;  5C6C A;  2W0X A;  3M2M A;  4IV3 A;  4HET A;  4B1L A;  4FSJ A;  5LWB A;  1V6O A;  1HXS 1;  1VAM A;  4XUP A;  5F3E A;  4CCC A;  1N3O A;  4R9B A;  3OF1 A;  5A7S A;  1PGL 1;  1VMJ A;  2JDZ A;  1LOB A;  3GM8 A;  1TMF 1;  3B93 A;  4QX8 A;  5K0U C;  1FPN 3;  3MIG A;  1JYW A;  3VKM A;  1HXS 3;  1YFU A;  3OY8 A;  4MUV A;  2HYX A;  2VBP A;  4COV A;  1GZC A;  3MIB A;  2XVK A;  4CP1 A;  4XFI A;  2BTV C;  2ZX0 A;  3WG4 A;  2E32 A;  2VPV A;  1Y9Q A;  3T0A A;  1AYN 1;  3LEK A;  4S2H A;  3UGG A;  4BQX A;  5FZ0 A;  3WD5 A;  2VR4 A;  2XQR A;  2X09 A;  3ROU A;  5E6H A;  4KMQ A;  2Q8C A;  1ULO A;  4BDV B;  4YAR A;  5K0U B;  1ULF A;  4NPR A;  3RZZ A;  2QNK A;  3AYA A;  4Q5O A;  1TE1 B;  4PLO A;  4D3W A;  2DVG A;  3H50 A;  4E2G A;  3M3I A;  1RUJ 2;  3B9C A;  4FOQ A;  2X10 A;  1VRH 2;  5FYY A;  1W04 A;  2V5D A;  1GOF A;  1O3R A;  3ZIX A;  1RXG A;  5LBB A;  5D8A A;  3RI8 A;  3WP5 A;  2VY0 A;  4DY5 A;  1OSG A;  3CU7 A;  3OYW A;  1J3Q A;  1GZW B;  2BDR A;  3SIS A;  1C1L A;  4M4P A;  3BTY A;  3FFZ A;  4QDS A;  2IFW A;  4R52 A;  3MDP A;  5F39 A;  3LA2 A;  1RUH 2;  4FVV A;  4YG6 A;  3RMY A;  1ZZ9 A;  5CIR A;  1ASJ 1;  1BVP 1;  3WQB A;  2RVA A;  2ZBJ A;  5LEJ A;  1OLR A;  1POV 0;  1SZB A;  5HCH A;  4BXS V;  2R06 3;  1DGR N;  1OF4 A;  3DPR A;  4XF0 A;  5J1X A;  3NAP C;  3AMH A;  2ES3 A;  2WT2 A;  4URA A;  2ZMN A;  3OEB A;  1HV1 A;  2OVU A;  3THT A;  4ES8 A;  1T2X A;  1HRV 2;  4GH4 C;  1C8M 2;  1O59 A;  3UGF A;  2ILM A;  4NMI A;  1OVP A;  1X50 A;  4N90 A;  1V9U 2;  4NIG A;  4UFM A;  1V0A A;  1JZ2 A;  4AEK A;  3UNP A;  4KU8 A;  3GBW A;  3RRD A;  2WL1 A;  2MNG A;  3NAP B;  3M4F A;  2O1Q A;  1QKQ A;  4XUO A;  5EIY B;  1X36 A;  3WX5 A;  3CJI A;  4MV2 A;  4GH4 B;  2IWG B;  5FZ4 A;  3FC0 A;  3T0D A;  1ODM A;  1ND3 C;  2Y26 A;  2VUC A;  2A73 B;  2OPK A;  3ZXA C;  5L73 A;  4EWE A;  4QWN A;  2VCC A;  5GLT A;  4OI4 A;  1UW8 A;  3ZXE A;  1R09 2;  1D7P M;  3U37 A;  2GC3 A;  2XKO A;  4WM8 C;  5TSW A;  3T2O A;  1O8S A;  2D3P A;  4RR3 C;  4ZXK A;  4BMB A;  4FP2 A;  2BV4 A;  2LRP A;  4UFI A;  2WZR 2;  1IS5 A;  1WW5 A;  4DQA A;  4P9W A;  3N4M A;  3I2H A;  3K3O A;  3KF5 A;  3WW4 A;  2PQQ A;  4QD2 A;  2ZEW A;  1XQN A;  1MZ5 A;  5DZE A;  3BUC A;  1ND3 B;  1XU1 A;  1UKR A;  2CYF A;  4KL1 A;  2RJ2 A;  4IV3 C;  5LRR A;  3WDV A;  1CN1 A;  1OD5 A;  1CAW A;  1SLA A;  2EA7 A;  2P3K A;  4P5H A;  5DAQ A;  3VBU C;  4CUA A;  1GKB A;  3ZN6 B;  3M3O A;  4WM8 B;  1NCR A;  4RR3 B;  2ZS6 B;  2X29 A;  5DAV A;  5C3Q A;  2VVE A;  1CGP A;  5IYY A;  2JD9 A;  4MGK E;  4QGN A;  5FQ0 B;  3SHR A;  1NXD 1;  2EIG A;  3J7N A;  2GAL A;  4TN7 A;  2Q5T A;  4LHK A;  1YLL A;  1BKZ A;  1UOJ A;  1W9T A;  2GND A;  2IVJ A;  2VME A;  4IQP A;  5F3G A;  5FZO B;  2GU9 A;  1QHD A;  2AGS A;  4IV3 B;  1ZRI A;  3KHB A;  5ANN A;  2W52 A;  1U0A A;  2WWU A;  3HNB M;  2QE3 A;  3L2Y A;  3NST A;  4C1W A;  2BPA 2;  3THD A;  4FPY A;  4NPL A;  3KM5 A;  1OFS A;  3ZO0 B;  1K3I A;  2R1B A;  1WMX A;  2ZGL A;  4PBP A;  2C6S A;  1U12 A;  4Q4W 2;  2VNR A;  2VZQ A;  4E9K A;  5JSR A;  3OY8 B;  4CCO A;  4CUC A;  5CFD A;  1NZI A;  1W39 A;  3I54 A;  4AVC A;  1NAE A;  2W68 A;  4BIS A;  3MZH A;  2WNE A;  1LEM A;  1O3Q A;  2XPJ A;  2GC0 A;  4PDW A;  5F2S A;  1AR7 3;  3SMH A;  3CZU A;  2AEZ A;  2HEY F;  1SFP A;  3ACL A;  1VE0 A;  4HBN A;  1GWK A;  5DMY A;  4AAX A;  1AXZ A;  4CCD A;  2IXC A;  3IN9 A;  4YZ1 A;  3E5X A;  1OXC A;  2VMI A;  4CTE A;  3TEY A;  5C3O A;  3V0A A;  2YBP A;  2QQP A;  1AYM 1;  1XJA A;  5CVR A;  4P02 B;  1ZA7 A;  4Q4V 1;  1UIK A;  3OBA A;  1VAK A;  1R1A 1;  4CPB D;  1GR3 A;  3GZE A;  3S5A A;  2XVL A;  1NA1 A;  2JIJ A;  3USS A;  2C5D A;  4UXA A;  1TVG A;  5BY5 A;  4QPI A;  5FYM A;  3EB7 A;  2YDE A;  5L19 A;  1JZ5 A;  1JYN A;  5JIU A;  2VTX A;  2WO3 A;  1F4A A;  4IER A;  4LKS A;  2CGP A;  3DPR C;  3RZJ A;  1AL0 G;  4EZ4 A;  1G7Y A;  4LHN A;  4FOV A;  5LB6 A;  1QJX 3;  2VXJ A;  2TBV A;  1W6M A;  3ZR5 A;  4OHY A;  1LGB A;  2RR1 1;  4AVA A;  2PXJ A;  2XB6 C;  1AR6 3;  1CAV B;  2VMF A;  4QQO A;  4RS5 A;  5LY2 A;  3RS6 A;  3WQ7 A;  1H1M A;  3NNJ A;  1JN2 P;  1WCK A;  2Q30 A;  2ZHK A;  5FPA A;  3OBZ A;  1JYX A;  1RGS A;  2CAU A;  1DQ6 A;  4X6R B;  4AK3 A;  4EN7 B;  1JZ4 A;  4Y5Z 0;  4WVM A;  1W6Q B;  2ZAB A;  4RN5 A;  2R30 A;  4ASK A;  1RUG 3;  3FZ3 A;  1YRZ A;  3DPR B;  1CZV A;  4BK5 A;  2P17 A;  1VBB 2;  3GBF A;  5T5J A;  3J7L A;  1HN1 A;  2VW1 A;  1XYP A;  1PM4 A;  3MEP A;  1C5I A;  5FUP A;  3T30 A;  5CEH A;  5C4W A;  4G4F A;  3UL2 A;  1SCS A;  1G9F A;  1GAN A;  1KDM A;  3BTA A;  3AB0 A;  3VZO A;  2RDR A;  2ZGT A;  3WIN E;  3BTX A;  1AXY A;  4I09 A;  4R9D A;  4FP3 A;  3WNX A;  5J48 A;  2ZMK A;  4EWA A;  2VUJ A;  1K5J A;  1H2K A;  2ZX1 A;  4V1P A;  4BQY A;  4CVU A;  2C9A A;  4BQ2 A;  4LHL A;  5FLI A;  3ZVX A;  1DLC A;  5LBF A;  4Y4R A;  3ZSK A;  2RMU 3;  5I8S A;  2HWF 1;  2D93 A;  2LTN A;  2DV9 A;  2HEW F;  2CDO A;  3SH5 A;  4IXL A;  5FZH A;  2WBK A;  1GIC A;  1UU4 A;  1HRI 1;  4OHW A;  4UOJ A;  4AEM A;  4HVQ A;  2LW8 A;  2ARE A;  2VE1 A;  4J6G A;  1BEV 2;  1RUE 2;  1IPK A;  3KS7 A;  2OZJ A;  4TWT A;  2HWE 2;  1ZZ7 A;  1ST8 A;  1UY4 A;  4ZON A;  2A7A A;  3QLQ A;  1A6C A;  1RHI 2;  4YVS A;  2UY8 A;  1ULC A;  3B3Q E;  2P34 A;  3LSE A;  2I07 B;  3MIE A;  5F3C A;  4AHY A;  1D2S A;  2VOW A;  3K4D A;  1PVC 3;  3HOB A;  3IPV B; 
#chains in the Genus database with same CATH homology
 5F7U A;  2C9K A;  4XVH A;  3WEZ A;  5HXM A;  4A45 A;  2Y6G A;  1UZ0 A;  5B4X A;  2OKX A;  1NUK A;  5IFT A;  3I2G A;  1RYY A;  4W4Z A;  3ACG A;  3WF0 A;  5C7G A;  3C7E A;  2VZ1 A;  1CZT A;  1K45 A;  4XUR A;  1UY0 A;  3BGA A;  2BGP A;  5DPN A;  2W92 A;  3A23 A;  3NJX A;  4A6O A;  2QQK A;  3OG2 A;  1JU4 A;  3I3B A;  3DYP A;  3C8X A;  4DUX A;  4OMD A;  4MOA A;  3K4A A;  3J7H A;  2W1U A;  2VZT A;  2VL4 A;  3MUY 1;  2VZP A;  1UWW A;  1WCQ A;  1XNT A;  2WUH A;  2QQN A;  3WNP A;  4UI9 L;  3VDA A;  4E8C A;  3LPF A;  5IFP A;  3PUH A;  5G05 L;  2VZ3 A;  2CDP A;  4ZZ8 A;  3OGS A;  4QAW A;  4DUV A;  4QB2 A;  3C7F A;  2E33 A;  3NQH A;  1CZS A;  2ID4 A;  3CIH A;  3VD5 A;  5HPO A;  3C7G A;  3IAQ A;  4DXR A;  2EIE A;  2W9X A;  1GNY A;  3GXU A;  3LPG A;  1SDD B;  2J1V A;  3BN6 A;  2VMC A;  3ETP A;  4DEQ A;  3HN3 A;  4DXT A;  4D0Q A;  3UES A;  2QQM A;  4DXS A;  1UXZ A;  3III A;  1GOG A;  2KD7 A;  4XUQ A;  3C7H A;  4Z2A A;  2VZO A;  4ET7 A;  1NX9 A;  2ZEZ A;  1US3 A;  3K75 B;  3T09 A;  1JI6 A;  1R64 A;  4E8D A;  1UYY A;  1OH4 A;  2WAB A;  1IQD C;  2VQU A;  2DCK A;  4FI9 A;  3CZJ A;  2W46 A;  4OYU A;  2DDU A;  5A1A A;  1XNA A;  3WNK A;  4A42 A;  4MGQ A;  3IAP A;  4MAD A;  3K4Z A;  2VJX A;  3LEG A;  1GUI A;  2HLE A;  2VCA A;  1TG7 A;  4P5Y A;  1J83 A;  1WKY A;  3I3D A;  3OGV A;  2J1U A;  4W8J A;  3LE0 A;  5EJ1 B;  5DN2 A;  4CU8 A;  4QX1 A;  1NKG A;  4QDR A;  4M4R A;  3SEE A;  3W5N A;  4ARX A;  3CQO A;  5JMO A;  4W50 A;  2Y6J A;  1W0N A;  1EUT A;  3K46 A;  5I0D A;  2WZE A;  4MGS A;  3AC0 A;  1P8J A;  5JXI A;  3LQC A;  2YG0 A;  4HG6 B;  1UYZ A;  5EJZ B;  2L9L A;  2ZEY A;  1UY1 A;  3GDB A;  1OF3 A;  2ORX A;  1UMI A;  2WDB A;  1I5P A;  2JE8 A;  4BJ0 A;  1UY3 A;  1PX4 A;  1SG3 A;  2RV9 A;  1MPX A;  2WAA A;  2WQ8 A;  4PF1 A;  4L0P A;  3SKV A;  5JXH A;  2WN2 A;  3NNG A;  2YB7 A;  2W87 A;  4MO3 M;  3T2P A;  1XC6 A;  2EID A;  1DYO A;  2BGO A;  2J7M A;  3K77 A;  4QX3 A;  2QQO A;  3A7Q A;  3I2K A;  2WYS A;  2J1T A;  1EUU A;  2J1E A;  3OGR A;  3A21 A;  4LQR A;  3SEP A;  1W9S A;  3P1I A;  3WNL A;  3WNM A;  2ZEX A;  3VDC A;  2R7E B;  2WO1 A;  3P6B A;  3PUI A;  3VDB A;  3DYO A;  2XON A;  2W3J A;  2WAO A;  1XPW A;  3JXS A;  2J22 A;  2C4X A;  3FL7 A;  4A3Z A;  2YFZ A;  5JXJ A;  2W91 A;  2W47 A;  4JKL A;  1JHJ A;  2XOM A;  3VD4 A;  4CU7 A;  3ECQ A;  4XUN A;  1PMJ X;  1GQP A;  2VOT A;  4PQQ A;  4BK4 A;  4CU6 A;  3HNM A;  3T0B A;  4XUP A;  3MV1 1;  1KGY A;  3F2Z A;  4A41 A;  3GM8 A;  2B4K A;  3ABZ A;  2XQX A;  1JYW A;  3FHA A;  3MO4 A;  2W1W A;  1SHW B;  2HYX A;  1W8O A;  3MBW A;  3MUZ 1;  1KEX A;  4QB6 A;  3I2F A;  2E32 A;  1US2 A;  2VQT A;  3T0A A;  3LEK A;  5JUV A;  3GGL A;  2VR4 A;  2X09 A;  1W9W A;  3FHQ A;  2XHN A;  4KMQ A;  1ULO A;  3IDA A;  4BDV B;  4CUB A;  4ZZ5 A;  2W1S A;  3VD9 A;  3NJV A;  4GZ9 A;  3SKJ E;  3NRU A;  1JZ7 A;  1PMH X;  1UX7 A;  2X10 A;  4ZY9 A;  2V5D A;  1GOF A;  1UMH A;  2E26 A;  3UET A;  2VZS A;  3WNN A;  1OD3 A;  3W5M A;  1GMM A;  4YPJ A;  4A4A A;  2Z4F A;  3D3A A;  1H6Y A;  3WSO A;  2EIB A;  1UXX X;  4GWI A;  2YFU A;  4JKK A;  4M4P A;  2VO5 A;  2Y6H A;  3CDZ B;  4QDS A;  4AG4 A;  1K12 A;  3WF3 A;  3VD7 A;  5LCW L;  2W95 A;  4TTG A;  3HEI A;  2BBA A;  2W94 A;  3WQB A;  2RVA A;  4DEV A;  4BXS V;  2JDA A;  4QDQ A;  1OF4 A;  4P00 B;  2EIC A;  5J1X A;  2LS6 A;  1BHG A;  1F4H A;  3OEB A;  2ORZ A;  3A22 A;  1T2X A;  1UY2 A;  1O59 A;  1JYV A;  2J1R A;  4JX0 A;  1UYX A;  1JZ2 A;  2VC9 A;  4XUT A;  3UNP A;  4XUO A;  5EIY B;  4QPW A;  1JZ6 A;  3T0D A;  3T2Q A;  2YC4 A;  5FUI A;  2VCC A;  4OZO A;  5IJR A;  1D7P M;  3U37 A;  2X05 A;  3T2O A;  1O8S A;  4OUE A;  1H6X A;  5C70 A;  1PX3 A;  2E31 A;  1DP0 A;  3I2H A;  3I97 A;  2ZEW A;  2Y64 A;  5CZK A;  2RJ2 A;  3IB3 A;  1YQ2 A;  4CUA A;  4P08 A;  2WO2 A;  4OMC A;  5IYY A;  2JD9 A;  3E1F 1;  5LA1 A;  4IUG A;  1GU3 A;  4LHS A;  4CU9 A;  2VME A;  1W9T A;  5DQ0 A;  3ACH A;  1OT5 A;  5IHR A;  2QBX A;  3HNB M;  2VZV A;  3FN9 A;  3THD A;  5CYY A;  1K3I A;  3I2I A;  2ZXQ A;  2VZQ A;  1JZ3 A;  4PT6 A;  4XZU G;  4CUC A;  1L7R A;  1NAE A;  1O8P A;  1CX1 A;  2C26 A;  2VZU A;  5LA2 A;  1LNS A;  3CZU A;  3OEA A;  3DYM A;  5DMY A;  4AAX A;  2VTF A;  4P02 B;  3OBA A;  3I3E A;  3ACF A;  3I2J A;  2BZD A;  4GWJ A;  3DEC A;  4A44 A;  1TVG A;  4JHZ A;  5G04 L;  3EB7 A;  1JZ5 A;  1JYN A;  1K42 A;  2WO3 A;  1JZ8 A;  1F4A A;  2WN3 A;  4LKS A;  4D8M A;  5B4N A;  1J84 A;  2PQS A;  3WF2 A;  4ARY A;  2W5F A;  5JR2 A;  3WF1 A;  2VMF A;  2VMD A;  5JXG A;  3LEI A;  1W99 A;  3T08 A;  2Y8K A;  1JYX A;  1JZ4 A;  4UAP A;  1GOH A;  2W1Q A;  4QX2 A;  4RN5 A;  1W8N A;  3THC A;  3WNO A;  2JKX A;  3CMG A;  1CZV A;  4BK5 A;  2J1A A;  3OB8 A;  1HN1 A;  1ULP A;  2B9V A;  4JKM A;  4KWU A;  2BER A;  2WZ8 A;  3ZM8 A;  3HJR A;  4QX0 A;  2VCB A;  3HPN A;  2J1S A;  2VM9 A;  5C71 A;  2V4V A;  2V72 A;  4RYD A;  4CVU A;  2QQI A;  2Y6K A;  1DLC A;  3VD3 A;  3C7O A;  3WF4 A;  2VZR A;  5LA0 A;  4DUW A;  3MV0 1;  3HNY M;  2CDO A;  1JU3 A;  2WBK A;  2QQL A;  3ACI A;  4ZXE A;  4UOJ A;  4TXW A;  2LW8 A;  2Y6L A;  1CIY A;  4LPL A;  1L7Q A;  1UY4 A;  2DCJ A;  3EYP A;  4KI5 M;  2QQJ A;  4QB1 A;  2YC2 A;  3CKH A;  3K4D A;  3HOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...