2W1UA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,3) galnac
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1uA00
1YQ2A 3K77A 4OMCA 4PT6A 2QQLA 3K4AA 4P02B 1K42A 4D0QA 4W50A 4E8DA 2W9XA 4HG6B 1CZTA 2J7MA 3WQBA 4QB1A 1UMIA 3I2JA 2VZPA 5G04L 2WDBA 3I2FA 4OZOA 5DMYA 4XVHA 2W46A 4OYUA 1JYNA 2B4KA 2RVAA 3WNOA 2QQMA 3WNMA 4CUAA 2W91A 2LS6A 3NJVA 3T09A 2DDUA 2JKXA 4OMDA 4UAPA 4XUPA 2PQSA 4XURA 4BK4A 2XOMA 3ECQA 3HJRA 3A23A 2VC9A 4PQQA 4DEQA 3W5MA 2J1TA 3GDBA 4CUBA 2QQNA 3GGLA 2VZUA 1ULPA 1W99A 3C8XA 1JZ7A 2WAOA 1LNSA 3AC0A 2J1VA 5FUIA 4QX0A 1P8JA 4A6OA 1W0NA 1HN1A 2VCCA 2YG0A 1NAEA 1F4AA 1L7QA 2WAAA 4MOAA 3P1IA 3BGAA 1J83A 2DCKA 1US2A 3UETA 2VM9A 1W9SA 2VCAA 3IAPA 1JZ6A 3OEBA 2ZEYA 4QB6A 3EYPA 1GU3A 5JUVA 2WYSA 1EUTA 3I2GA 3K75B 4KWUA 1JYXA 5EJZB 3ETPA 3VD3A 1PMHX 1DP0A 4DXRA 2BERA 3WF0A 4BK5A 1NKGA 4ZZ8A 1JYWA 3PUIA 4TXWA 3ACGA 4QAWA 3E1F1 2WN3A 3I2KA 1UYYA 4LKSA 3C7OA 1SG3A 4DXTA 4IUGA 5CYYA 1JZ2A 3T0AA 4GWIA 3C7GA 2WN2A 4ARYA 4DUXA 3SEEA 1JU4A 2VZSA 3I3DA 1GUIA 3LEGA 5EIYB 1O8SA 3LEKA 1UWWA 3HPNA 2DCJA 3J7HA 3NRUA 1JZ8A 4A44A 2E26A 4CU7A 4FI9A 3OEAA 5JR2A 2VL4A 4E8CA 2YC2A 3D3AA 3LPGA 1JZ5A 1JYVA 2RV9A 3SEPA 3F2ZA 2W1WA 3C7EA 1WKYA 5IYYA 1CX1A 4AAXA 3K4ZA 2C4XA 4YPJA 2HYXA 5JXGA 3C7FA 3CMGA 2WQ8A 3HNBM 3T2OA 2RJ2A 3K4DA 1UYXA 3CZUA 1OH4A 3I2HA 5JMOA 4JHZA 1SHWB 2E32A 3ACIA 3DYPA 5LCWL 3W5NA 3UNPA 3JXSA 4P5YA 3VD4A 2WO2A 4BXSV 3OG2A 4L0PA 4M4PA 2VMDA 4QPWA 1UY4A 3NNGA 2VZTA 1GQPA 3LEIA 4OUEA 3CDZB 4JX0A 1W8NA 2X09A 4CU8A 3FHQA 3WF1A 3T0DA 1SDDB 2WABA 2J1EA 4QDQA 1GOFA 4XUOA 3OGSA 5EJ1B 3VD5A 1UYZA 2VJXA 4DXSA 1H6YA 3I3BA 4CUCA 2BZDA 2LW8A 2Y8KA 2WBKA 4P00B 3MO4A 3NJXA 1O59A 5J1XA 4A45A 2BGOA 3CQOA 4KI5M 2W95A 4RYDA 3CZJA 2JE8A 3HN3A 3WNNA 2W5FA 3VDBA 1KEXA 4A3ZA 2CDPA 4W8JA 3VDAA 2VZOA 2VQTA 2BBAA 4LPLA 3THDA 4AG4A 2YFZA 4JKMA 2ZEXA 5IJRA 3WSOA 1UY1A 2ID4A 2W92A 3WF4A 2X10A 4CU9A 1OT5A 1ULOA 3LPFA 1TG7A 5G05L 2Y6KA 3HEIA 4BJ0A 1NUKA 2JD9A 4TTGA 4DUVA 4W4ZA 3THCA 3MUY1 3OGRA 2HLEA 2VCBA 5C7GA 2KD7A 2EIBA 3MV01 1JU3A 1OF4A 3FN9A 1DYOA 3I2IA 3GM8A 1K12A 4XUNA 2C9KA 2W47A 3T2PA 2VZVA 1UMHA 3A21A 3WEZA 2W1SA 1W9WA 1GOGA 2QQJA 5JXJA 1CZVA 1UXXX 1XNAA 2W3JA 3LQCA 5DQ0A 3WF2A 3T2QA 5CZKA 2VZ3A 4ZXEA 1IQDC 2QQOA 1KGYA 4DUWA 1TVGA 4UOJA 5HPOA 1GMMA 4ARXA 1I5PA 2WZ8A 2X05A 1XPWA 2QQIA 3WF3A 2V5DA 3C7HA 5C71A 4ET7A 4CU6A 1JI6A 2L9LA 2BGPA 5LA1A 2YB7A 1UX7A 2Y6JA 4KMQA 4GZ9A 3OB8A 4A4AA 2CDOA 3OBAA 5B4XA 3I97A 2W1UA 2VO5A 3ZM8A 4MO3M 1H6XA 3ABZA 1UZ0A 4ZY9A 5IFTA 3FHAA 5DN2A 4RN5A 2ORZA 3SKVA 2WO3A 2WO1A 3UESA 3WNKA 1NX9A 4M4RA 3WNPA 1RYYA 3ACHA 2Y6LA 3HOBA 3IIIA 4QX1A 2ZEWA 1PX3A 3T08A 1OF3A 2V72A 2VR4A 1BHGA 4DEVA 2VZ1A 1JHJA 3GXUA 4LHSA 2ZXQA 4GWJA 1PX4A 4JKKA 4D8MA 3DYOA 1XC6A 4BDVB 4ZZ5A 1T2XA 1UY2A 1J84A 2Y6HA 4CVUA 2OKXA 5F7UA 2YC4A 3T0BA 3IB3A 3VD9A 1F4HA 2VZQA 2W87A 2JDAA 2VOTA 5B4NA 1GOHA 2J1SA 4PF1A 3I3EA 3VDCA 2EIEA 3HNYM 5IHRA 2E33A 4QDRA 1JZ3A 2Y64A 4XUTA 2ZEZA 2EICA 3K46A 2Z4FA 1JZ4A 1K3IA 4MGSA 1W9TA 3IDAA 1WCQA 3DECA 5DPNA 5LA2A 1CIYA 2Y6GA 3FL7A 2J1UA 1US3A 2B9VA 2VTFA 1OD3A 3MUZ1 2J1AA 3VD7A 1GNYA 3A7QA 2VQUA 4QB2A 3LE0A 3P6BA 2C26A 5IFPA 2VMEA 1XNTA 4LQRA 1R64A 3SKJE 2WUHA 5HXMA 2ORXA 1D7PM 3BN6A 2VMFA 1UY3A 2V4VA 1DLCA 4A41A 1PMJX 4XZUG 2EIDA 1K45A 3EB7A 1UXZA 2XQXA 4QDSA 4QX3A 3IAQA 4MADA 4XUQA 2QQKA 4P08A 2YFUA 4UI9L 3WNLA 5JXHA 4A42A 3U37A 2WZEA 2VZRA 5I0DA 1L7RA 3MV11 3DYMA 2E31A 4Z2AA 5C70A 2W94A 3PUHA 2XONA 3MBWA 5A1AA 2R7EB 1MPXA 3OGVA 1W8OA 2W1QA 3CIHA 3CKHA 3ACFA 3HNMA 2J22A 1EUUA 2QBXA 5LA0A 1O8PA 3NQHA 4QX2A 1UY0A 2XHNA 4JKLA 5JXIA 2VMCA 2J1RA 4MGQA 1CZSA 3A22A
chains in the Genus database with same CATH superfamily
4Q4W1 4ORFA 4CYDA 1XOYA 4OFGA 1R091 5LY1A 2XVLA 5F6KA 3T3YA 4D0QA 2W9XA 4HG6B 1CR7A 3PIGA 1MQTA 3ZYRA 2W68A 1W05A 3I2JA 1V00A 1Q8OA 3AB0A 2VZPA 3MIDA 3H1YA 2RMU3 4M3CA 2RHPA 4IESA 1RUC2 4MGKE 5DXDA 1W6NA 5ACA2 1JOBA 5LK7B 1T6GC 4S2HA 4YSFA 4MGYE 4LLFA 1CAXA 2JDNA 1TNFA 3IBMA 4FO9A 2DBIA 4MSVA 4A7YA 1ALYA 4GQ7A 1UAIA 3WNOA 3MW2A 4OI1A 2OW4A 1AL23 2A70A 2DBNA 1NZIA 3U75A 5GM0A 3WQ7A 1WW5A 3UKTA 3MYXA 3VV1A 4N9IA 1DG6A 3WNMA 5K0UA 3VBOC 5KXCA 2LS6A 4KQ7A 3T09A 3CJIA 3WD5A 4XJWA 4XUPA 4RL7A 2PQSA 4XURA 1OD5A 3KCYA 3B9IA 3KV9A 3ECQA 4CCEA 1ZBE2 3IMMA 4LBLA 2VNOA 4PQQA 5BNPB 1IPKA 4PDWC 4CP0A 1W90A 1W8WA 1AXKA 2VMIA 3R4SA 2JG9B 2DCZA 3EXUA 3U07A 4NIHA 3GDBA 4CUBA 4RSUA 5FYMA 4RHV3 4M00A 5FXZA 1CZSA 5I93A 3GGLA 1QJX2 3WW2A 5CG9A 2WAOA 1LNSA 3JD73 4XDQA 3AC0A 1GZWA 2XPJA 1Y7BA 1WA6X 1DU3D 3ZFGB 1Y9QA 4BWOA 1HN1A 5FUPA 4NAMA 2GC3A 1D4M2 4FPJA 5FO8B 2ZGPA 2YG0A 1F4AA 2ZHLA 1X8MA 3P1IA 4LBNA 4I0AA 3FWEA 3ZN6B 1C1LA 2DCKA 5C4WC 3POJA 1US2A 3A4UA 4LMFA 3UETA 1FMD3 4LK6A 2VUJA 2D3PA 1HRV3 3B94A 4Q4Y3 1BMV2 3J8F1 1GU3A 2BP6A 2P5BA 1OVPA 2TEPA 2VUCA 4JAAA 4FPGA 3LWCA 3R05A 3ZMOA 2Y33A 3AKPA 5FZ7A 3HAGA 4JGZA 4L11A 3NMBA 5I0RA 3ST7A 4CCLA 1PO21 5DUUA 1NE6A 1R1A2 2WKKA 2BPA2 4UF0B 1U5XA 1V6KA 2PHLA 2Z42A 3VZJA 1WGPA 1PMHX 1PIV3 1DP0A 2P6CA 5A3PA 5DZGA 1ENRA 3RDIA 1G9AA 3TEWA 4BK5A 1NKGA 4ZZ8A 3RYRA 4EWDA 5JCTA 4TXWA 3AYAA 2W52A 3UGHA 5IWFA 1EV13 1QU0A 3MLJA 4Q4X2 1OQDA 1LHVA 2YY1A 4Y1ZA 3VBFC 1UOFA 1X8EA 1ULFA 1VMJA 5LK5A 1QJZA 4M3CB 3RI8A 2D6KA 4XJUA 2VOWA 1ZX5A 4COWA 3ITQA 5KXEA 2VAUA 3MIEA 4RGAA 1GP6A 1RGSA 3C2UA 2G1MA 1ZVFA 3KF5A 1W2UA 4XE9A 2NYYA 4U2AA 2E51A 4Q1RA 1BQPA 3OD4A 1ZRIA 4QPIA 4OHXA 2XLFA 3EO6A 2MEV3 1BMV1 2ZJCA 3KQRA 1WZXA 4LLOA 3OBZA 3W21A 2D6LX 5DUXA 3VHPA 4CEYB 3S6PA 2R061 1MZ6A 1CGPA 2F17A 2DCJA 5GZCA 1NE4A 3HN1A 3E97A 4LBKA 5FZAA 2JD4A 2ET7A 3NRUA 4ATEA 2A7AA 5AFBA 4CU7A 4BH9A 3HT2A 2VBBA 4ASKA 1NA1C 4BLIA 2ET1A 3FFZA 4R9CA 4E8CA 4BQ4A 3D3AA 3DXUA 1XNCA 4CP1A 1DZQA 2RV9A 2QQUA 3D6EA 3SEPA 3C7EA 4ZONA 1OURA 1VRH1 3K4ZA 2WNOA 2YROA 4JDMA 4YPJA 3L2HA 5FZOA 3VDDA 1G6NA 5JR7B 1JYCA 5GZDA 4HSJA 4KH9A 1UZWA 4QQHA 3HNBM 2FZ1A 3RGBA 2Q4SA 4YM1A 1WD4A 3AL6A 2RJ2A 3J9SA 4CDUB 1UYXA 2FDGA 1U5IA 1RUH2 4YG0A 2XWBB 3I2HA 4XBLA 3JB4C 3WY6A 3ZXAC 5BY5A 1HRV1 3MEPA 2VH9A 2IZWA 5FUNA 2BNNA 4JHZA 3AZXA 2ZOEB 5KXDA 1SHWB 2MPFA 1CPMA 1RUF3 2E32A 2JG8B 3DYPA 3RJRA 4D7YA 4NN0A 1UZZA 5LCWL 1OUXA 2QKDA 3URFA 2ATFA 4P5YA 3KM5A 2ZX4A 2QE3A 2HEWF 2ZTNA 4GKXA 4QQLA 4DRVA 4ZHNA 4QU2A 3VBFB 1QJY3 1YUDA 2WO2A 1HN0A 4IGOA 5F37A 1C4RA 1GWLA 4CPBD 3N9LA 4QKNA 5FZEA 3RI9A 1BEV2 4I0BA 4IEWA 2WWJA 4AFMA 1PO13 1XYPA 2R6QA 1UY4A 4QPWA 5LBFA 3O1RA 1RUC1 1YQ6A 3AX4A 3BPZA 3IDCB 5CNAA 1AR81 4OUEA 5DZEA 5A3WA 5FY8A 1M06G 5FDBA 4BOWA 1SLAA 1XNBA 5EPAA 4HANA 2OX0A 1AZDA 2RMU2 3TN91 1VBE1 3VBFA 4CU8A 1RB8G 1CAUB 5FZ8A 3WF1A 5K9YA 3GZEA 3WHUA 1YFYA 4MXWB 4FP3A 2VXJA 4XUOA 1O3RA 5BNNA 5FYHA 2K46A 1VBD1 4L9BA 4KNCA 3N9OA 4DXSA 5KC6A 3PU3A 4YRDA 5DAXA 4C1WA 5BPXA 1RINA 3T2TA 2WBKA 4P00B 4L97A 5EV7A 1MS8A 4BQ5A 4XMIA 3AL5A 3CQOA 1YEWA 2BWAA 2RS11 4V1PA 2WNUB 4WVMA 4AOCA 3FJSA 1FNYA 2IXKA 5CU1A 2VBPA 2X29A 4QX8A 2JE8A 3HN3A 4LO8A 4DY5A 5C5UA 2B5HA 2HWB2 4N9HA 4MXWA 3WNNA 1RUC3 2W5FA 2Q1FA 3BODA 1KEXA 3ELNA 5LASA 3R6SA 1RMU1 1FX5A 4K8FA 2BGCA 2A6XA 5EYXA 2VW1A 5E88A 2HWD1 4P9XA 3E6BA 2R073 4IL7A 2XKPA 5DAWA 4E2GA 5FYZA 3THDA 1H4GA 3PJQA 4O7XA 1UL9A 3VBOA 2YFZA 2ZEXA 1STMA 4RA0A 1W6QB 5A33B 3WF4A 1FYUA 2X10A 1POV1 1A8MA 2P17A 2R32A 3AMNA 4AI3A 1LGBA 1F8VA 3LPFA 4XFCA 1Q8QA 2VTXJ 1MS4A 2C6SA 2JG8A 1LRHA 5A7SA 1ZZ7A 3R0RA 3USUA 1FPN1 1S2BA 2Z2SB 1G9FA 2ERFA 2YDEA 3V65A 2X5IC 1BVP1 2PN5A 2YU1A 5LBEA 1GZ9A 4BYYA 4FXKB 1G8WA 1QNYA 1MS1A 1W2AX 2XMLA 3PDQA 3DCQA 3DN7A 3FLPA 3I59B 1PIV2 3GBGA 2VG9A 3IIAA 3ZX7A 1HW5A 4OUSA 1PVC1 4XXPA 1N1VA 2I2SA 1GFF2 1BBT1 1EPWA 2XJSA 3S7IA 4DB5A 3WDUA 3POIA 2WSUA 1J3QA 2QDRA 2W47A 3OTFA 4XUNA 1HB3A 1ZNPA 4W6YA 4YFWA 1UMHA 4YZ1A 1UKGA 1FV3A 1LULA 4GH4B 4Y4RA 5FYBA 1Q8VA 1W9WA 4GULA 2QQJA 1B35B 1IKPA 1CZVA 1UXXX 1VP6A 2W3JA 3N3HA 5GKAC 5K0UC 1AR91 3NNFA 3BIEA 3WF2A 3T2QA 4EN0A 2HWF3 5JOWA 2QQOA 5HCHA 4DUWA 1S1AA 1GMMA 1WMFA 5CEHA 1DZRA 4NPMA 2XVGA 2WZ8A 3T4HB 3WP4A 4AZZA 4BA6A 4FQZA 1W6PA 4KL1A 5LB6A 2ZGKA 5IW0A 5C71A 2WQ4A 4URAA 2A6ZA 3EMRA 2L9LA 3LIGA 1WA4A 3WDWA 1FAYA 2CGNA 2B42B 2YXSA 5BNPA 1Y9MA 3FLRA 3O14A 1FOD3 1AR71 3A0NA 3AMMA 1QKQA 5IVJA 5F32A 5GZFA 4E2QA 4EZ4A 4ZPIA 1BJQA 1H1MA 2Y34A 3OBAA 2IFWA 5J96B 4AI0A 4FXGB 4F8AA 5K8SA 3BI3A 4WM7B 1IS4A 2BRTA 3SH3A 3ZR6A 1RITA 4CDWC 3VBSC 2JB4A 2GP5A 1UZ0A 3VBOB 4D3WA 5GLZA 3VGIA 1HX6A 3LB9A 3O1VA 5T5JA 3CHXA 1V9U2 1ULEA 2CL2A 3MW3A 2R043 1RUF2 2KXLA 3UESA 3U78A 2RR13 4M4RA 5FZ4A 5FMOS 4YGDA 3WNPA 2UY8A 4QXCA 1UNBA 4XW3A 1MS5A 2VQ0A 4WZCA 1UCXA 2FCUA 1AJKA 1QJY1 1R081 1W8HA 2ES3A 2YU2A 2XGXA 3J4UH 2ZEWA 1Z0HA 2ZGTA 1GQHA 1PX3A 2D3SA 4JQTA 5FZHA 1GZTA 1PMIA 2OZJA 2VR4A 2ZHKA 4JGZB 3ZN6A 4A6SA 4S2DA 3HR9A 4HLTA 5F5AA 1AR62 1JHJA 3GXUA 1YHFA 5BXXA 3B9CA 3M3IA 4UW5A 2O1QA 5FXXA 2YGLA 1ZZCA 4YZ5A 2R062 1APNA 1D2QA 2LUWA 1XC6A 5C3PA 4BDVB 1ZZ6A 2EVXA 3IT8A 2DTWA 2P3IA 4IEUA 4CEWC 2FBEA 5J37A 2GNTA 1B35A 4EZHA 5FQ0B 4FPFA 1H30A 1OPMA 4CVUA 5LEJA 1F5JA 1AUYA 1ODNA 3VBHC 4AQSA 5F5QA 3IB3A 4NR1A 1F4HA 3ZXLA 4BIOA 4PCRA 3O1UA 4WVVA 2XUEA 5FWJA 3OPWA 5FR3A 4YW6A 1X82A 4QKBA 3B69A 3B02A 2EXHA 5H9RA 4QPIB 4F83A 2V4AA 2XB6C 1RTVA 1I5ZA 3HIFA 1YCIA 1RVF2 3ZYPA 2CWSA 3RZGA 1JZ3A 2OQ7A 2Y64A 2NMNA 1ZREA 1HRI3 2Q8EA 3K46A 3CNAA 1XE7A 3LKJA 1CD3G 3TAYA 3D4KA 3ZSMA 1JZ4A 4MGSA 1VB2A 1W9TA 4ES9A 1CJPA 3SMHA 1YLLA 2R072 3DECA 5DAVA 1CJDA 2WS92 2XJUA 3KF3A 4LUKA 5LA2A 1XRUA 1LU2A 2A3XA 1FT9A 4QHOA 4WM7A 2GSYA 2EXIA 5IK5A 3SCGA 2WFPA 5FP3A 2XHKA 4OQ8A 2BU9A 4CEYC 3P6BA 1TME2 1UOJA 4LO5B 5GLVA 5IFPA 4LE3A 1MS9A 3AZZA 4M3CF 3SKJE 5HXMA 4GB31 1DHKB 1WWYA 1W9YA 1UPIA 4XFIA 4HXCA 5ACA1 5FBZA 2R041 3D5OA 4Y1XA 1K45A 1REEA 5EJ3A 1H0BA 5F2SA 1UQXA 3LOIA 2A73B 1UIJA 5FRAA 4EN7B 3OYWB 4QX3A 4V2WA 1GICA 3RZLA 4BB3A 4XUQA 4TYSA 2WWSA 1HV1A 3BCWA 3NWKA 1PZ8A 1ACCA 4LJHA 3VBSA 2BFUS 1YI7A 4FPEA 5FO7B 3U0ZA 3MV11 1LR5A 3OGJA 2G9ZA 4XTMA 1ZRFA 4EJRA 3MICA 1ZRCA 1GP4A 2A6YA 1OXCA 2BOJA 1FOD1 4UFKA 5IATA 5FY1A 1W8OA 4XF1A 2FDJA 1KS4A 1FV2A 3KVBA 2A6VA 4YVWB 3KV4A 3CIHA 2XLAA 3V0AA 1AXZA 3O0XA 3IMNA 4JTNA 4QQ2A 4AI8A 4QGNA 1OA2A 3B01A 4QQOA 3RNSA 3GZAA 2XJPA 4JGYB 2SLIA 3PVOA 1O8PA 1QQP3 5FBJA 5FMOL 5FZCA 3BU0A 4LOTA 1Q8PA 4JKLA 5KHIA 3J26N 4AEDB 2VMCA 4FOQA 2O8QA 5FK8A 5FXVA 5ABJC 5L7OB 1AYM3 5FMBA 3AZYA 1EV12 3MHZA 1YNAA 1TQ5A 3MGUA 4CCDA 3K77A 1LTEA 4OMCA 3AXDA 3D0SA 1FI2A 4PT6A 3UGFA 4Y5SA 4AYUA 4P02B 1AYN3 1QY4A 4E8DA 2R49A 5A1LA 4LKEA 5C3QA 3WCRA 1VLNA 1Q3EA 2AEYA 4Q0VA 5A7WB 1H9WA 3WQBA 2WQZC 5JDBA 4QGLA 4X6RB 1UMIA 2RS33 5EP9A 4CXWA 4XIKA 3LSDA 2WDBA 3NAPC 3CLPA 3IKWA 4K1ZA 2YBKA 1NA1B 2W46A 4TZDA 1X7NA 2B4KA 5FTTC 1S0DA 1O3QA 3CEWA 2WYFA 4S2GA 3WDXA 2XJQA 1SLIA 4C1XA 3LDBA 1HXS1 1ZBA3 5D21A 3UGGA 2TBVA 1K5MC 4CUAA 3J7MA 1DLLA 2W91A 2ZAAA 1LOAA 2PYTA 3RZMA 3I4IA 3GNEA 1C1FA 4QHBA 2OVUA 1SCRA 2F6BA 4K20A 1KS5A 3PUAA 4QXKA 5C9AC 5LRSA 1J59A 4NROA 3TB0A 1YO8A 4KU7A 4DEQA 1RUE1 3FZ3A 2BEOA 5E1RA 1G7YA 1WMEA 2NQYA 3S0MA 1OQ1A 1JYTA 4Y1UA 2VZUA 1RXFA 2XDVA 1RUH3 2JDHA 3WW1A 2K0GA 1BYHA 2UYAA 4LUMA 2C1FA 5FUIA 1LKNA 1U5ZA 2CY6A 4I2OA 2LALA 1UW8A 4Y3OA 3NV3A 1AX0A 3Q8FA 5ANQA 1LJ7A 2Q8DA 1DFQA 4OLLA 3V56A 4B29A 4JRLA 2WLPA 3N9PA 2WAAA 2CGPA 2GN7A 3U10A 3ZR5A 2EAKA 2WT0A 3TN92 4WM7C 3T1LA 3E5QA 1ULGA 4R52A 2VCAA 3KV6A 4M3CE 1AX1A 2B45X 4N90A 2AENA 4XYXA 4AAPA 4BISA 1JZ6A 4FOVA 1VBC2 4UBGA 4QB6A 5JUVA 2WYSA 1EUTA 4LO6B 2IC1A 3Q9OA 3NW4A 1XNDA 4PDWB 3FUOA 1JYXA 3OY8B 5FLJA 4IGQA 4XQWA 1OI6A 4BE3A 5BNPC 5EJZB 2RG4A 2ZA9A 1AHSA 3ETPA 1G9BA 5FQ0A 1QGLA 1I9RA 1XBFA 1YQ5A 3ES1A 4GALA 5D8AC 2C0ZA 4AHZA 1YFWA 4U36A 4GA9A 2J42A 5HCBA 5BUVA 1QJEA 1JYWA 4JC1A 4EN9B 2PHRA 2V09A 4CTEA 4IV3A 3KS7A 3ACGA 3SQOA 4ASLA 5L7OC 3FHIB 2DVAA 4XDPA 1GZWB 3E1F1 4HN0A 3I54A 1SDWA 3O1OA 1SBEA 4K9SA 4Q8LA 4XEZA 1UYYA 2JDPA 2PLV2 4LKSA 5FZLA 4DXTA 4FAGA 2XWJB 3KT4A 4OVEA 3WNXA 1QJX3 1LOCA 3PTRB 3JZVA 1YWKA 4KGQA 2HWF1 4OULA 3R4DB 1TME3 2GNMA 1QQP1 3ACLA 3BB6A 5T55A 2P2KA 5ANNA 5EFUA 3K3NA 1J58A 3LF7A 3NL1A 4Y24A 3UV9A 4ARYA 2E6VA 4Z1VA 2ZGNA 4YVWC 5K7PA 5A3UA 4GKYA 4JV4A 5T50A 2VY0A 1GUIA 1K5MA 1JYIA 2HWB3 4NE9A 2RR11 2DTYA 1RUH1 4DXZA 5LBBA 1HRI2 3U4XA 3ENRA 2WWUA 3HPNA 1V6OA 2PHTA 5BNOB 2VBDA 1W0OA 2DF7A 3PVNA 4CDQA 5F39A 4R4ZA 2EALA 4PJYA 4AQ6A 4FI9A 4L92A 5CA6A 3WDYA 5C3OA 5JR2A 2TUNA 1XE0A 2W1WA 3OF1A 5FYSA 4D94A 2Y0IA 1WKYA 4LULA 1XU2A 4AAXA 3VZKA 2HYXA 2CSGA 4FPCA 5A7QA 3E5XA 1HIXA 4FPOB 3TNPB 5HCAA 4AI1A 1MVEA 4LKDA 4QM8A 2FDIA 1IHMA 3CMGA 3GF6A 1K5MB 1BBT2 1UD1A 4GXLA 3WCSA 3K4DA 2IXCA 4CDUC 4XJ9A 1PZ9A 1OH4A 1IS5A 5JMOA 2DUQA 2YBPA 4GMP1 4I3GA 3E5UA 1QQP2 3KHCA 2XKOA 4IV1C 4OI0A 1C28A 3RMYA 4N8MA 3ZLIA 4JGZC 4CCKA 3WVJA 4UFHA 4AXOA 3OBTA 3UNPA 3F95A 3KGZA 1UOGA 4XF0A 1AYM1 5L36A 3QH6A 4AFDA 1SZBA 4BXSV 2CNAA 4K40A 3OG2A 1UMZA 2ZGUA 4Q0QA 4FAHA 4L0PA 4M4PA 3HBZA 4J1XA 3RQ0A 5CISA 3J8F2 1IQAA 1IG0A 4HVOA 3NNGA 2H6BA 4RGGA 1GQPA 5DUVA 4NIIA 1A78A 4LBOA 2RJKA 4UW6A 4COUA 4IEQA 4TLFA 2ADDA 4UFIA 3CDZB 4LEJA 4A2UA 4FOYA 4FT8A 2WNUA 4IV1A 1W8NA 2XVKA 4JX0A 4NHXA 5FCCA 2WZPP 2IXIA 3RYKA 1LHUA 3FHQA 4IE0A 2E63A 1S4CA 4IEPA 1XQNA 1H9PA 2WZR3 4QDQA 2OUHA 2JG9A 4XTPA 3OGSA 1VB4A 3WINE 3MIBA 1RC6A 5IK4A 1HQNA 5EJ1B 2W0XA 4H2AA 4LBMA 3VKOA 5CKQA 4AL9A 4TLGA 3KT7A 3QH7A 4AVTA 1Z7S1 1HLCA 5CKMA 1RUOA 1H6YA 2CAUA 4AI2A 2BZDA 4LTAA 4CUCA 2Y8KA 1H2KA 4ISQA 4Q4Y1 4CUGA 3RMXA 3HBKA 4R8HA 1GWKA 1OVSA 3PURA 3NJXA 1OUSA 1QH7A 4Y26A 4B3NA 1O59A 5J1XA 3VKLA 4HT1T 2BGOA 5EHDA 4KI5M 4A45A 3VL9A 1RUI3 2W95A 4YYOA 5A7PA 1OQEA 1JBCA 4PI2A 2JEMA 3H7JA 3O7OA 2RDSA 5C4WA 2ETEA 1W8TA 2AC1A 2YC0A 3ES4A 2DFCA 4YGEA 2X5IB 4ASMB 1A34A 3RJ2X 1QJY2 3VDBA 3C3VA 2AH2A 3EBRA 1L3JA 3ZVXA 2CDPA 1DGLA 4W8JA 1HB2A 3VDAA 5HBAA 3O1MA 3UJQA 2VPVA 1RUF1 2PQQA 2BBAA 1SFYA 5KR7A 2QCSB 4Q8KA 1XJAA 4FFHA 1KFXL 4CDUA 4XAAA 2AREA 2RR12 4GJYA 4HOOA 4AK3A 3AFKA 1RUI1 5BV6A 1V6MA 1POQA 4CCNA 2R16A 3H9AA 1I1EA 5CFDC 1VALA 1UY1A 3NV1A 2ID4A 3VBSB 2RDRA 2W92A 3BOWA 3RZZA 5C9AA 3WZ1A 1ZA7A 3UYJA 4YVSB 1OT5A 4Z8BA 1OH3A 1ULOA 1DDLA 3AP7A 3OUIA 1H8TB 3POSA 2Y6KA 5D1IA 5G05L 1S2KA 5FZDA 2Q8CA 4BJ0A 4QM9A 2XL7A 3JUUA 1UU6A 1NXD1 4AFAA 2FMDA 1JOPA 2JD9A 2RDQA 2XH6A 1KFUL 4TTGA 3WXPA 1CAWB 4Y22A 4Z92B 2PFWA 1V9U1 1XYNA 5FPBA 3MUY1 2LRPA 3WG1A 5FMDA 1PO12 2VCBA 4X8PA 4BLJA 1GYKA 2GNDA 4LORA 5HV4A 5FY7A 1OA3A 1IPSA 3I2IA 4IQPA 4YW1A 1K12A 2R30A 2PHXA 1COV1 5IUQA 2E53A 5A7WA 3TN93 3RS6A 1J3RA 3FFQA 2P3KA 2QQVA 4LT5A 4YZ4A 3ASIA 3ZFFA 1GOGA 5JXJA 5I8YA 4AEDC 4QPGB 1PVC2 4CXYA 3NJYA 3LQCA 2KA3A 5CADA 3FUQA 1W6NB 4EROA 1QJFA 1AYN1 5CZKA 4ZXEA 1S2EA 1LOFC 1Y4WA 5K0UB 2QQPA 4EWEA 1D0HA 1KGYA 2JICA 4UW3A 2PAMA 4Q27A 4YW5A 5FYIA 5A33A 2ZPXA 4UOJA 5HPOA 4PLNA 4ARXA 1MZEA 1I3HA 4AVCA 3KT1A 5JOYA 2XJRA 2G9FA 4META 5FZ6A 5FYYA 3O1PA 4YWAA 2JXAA 3TYJA 4FTEA 2XBO2 3ZKYA 1WCUA 4ET7A 4CU6A 3GBFA 2WSVA 1YIFA 2GMPA 2D44A 1KD7A 2BGPA 1PIV1 2YB7A 5IVBA 2FDFA 1BVVA 5LA9A 1RUD1 3H8RA 1XU1A 2XUMA 1KDMA 4KMQA 4D6SA 1HV0A 5FP4A 5A6ZA 5A3LA 3JBG3 3KCCA 1JN2P 4PI0A 4A4AA 5ISLA 4QPGC 5B4XA 3I97A 4TSVA 1ND3C 2VO5A 2WA4A 3MZHA 5FZ0A 4IE6A 4LHNA 1H6XA 1OBNA 5F1RA 5IFTA 4MGZE 2PA7A 4XAEA 4KWKA 2QFEA 3ZFEB 2JB8A 4RR3C 4RHV2 2WO3A 2RS12 3IM0A 4CCOA 5ACA3 3M3EA 1RUJ2 4N53B 4DFSA 4UYBA 1NX9A 2BNOA 1A8DA 5CVRA 4NHYA 3ACHA 1Q56A 5DUWA 3KSCA 2FZ2A 2V5YA 2QVSB 3IIIA 4QX1A 4HK9A 1C8M1 1N3PA 4Q0PA 3HT1A 3I3QA 1ULCA 4PDWA 1MZ5A 1OF3A 3AM2A 2BW8A 3NKTA 3ZN4A 4YVSC 2DFBA 1NT0A 1Y3TA 3G7DA 5LBCA 5CG8A 5FYTA 4Q4Y2 5DG2A 1LU1A 1ZBE3 4NIGA 4GWJA 2EXJA 1XSRA 3WDTA 4Q0SA 2ZS6B 2AGSA 3MIGA 3WX5A 5JZGB 3THPA 1ASJ2 1CIWA 3K2OA 3HD8B 4NPLA 1UY2A 1R1A1 2DCYA 4PLOA 4GD4A 1KQRA 4HVQA 1VBD3 4I02A 3GBWA 5LW9A 2KM2A 4IE4A 1ND2C 2UWCA 2JECA 2VZQA 1EP0A 4AI9A 1Y9GA 3AMQA 2UWAA 2VOTA 4IV1B 1Y43B 1MACA 4PF1A 2ZGQA 3NNMA 4MVTA 1J3PA 2VVEA 3VDCA 1RUD2 3WOGA 5KHGA 1W6PB 4KBZA 1YIPA 4CSWA 3VBUB 2WNVC 3KZ4C 2A3YA 5LATA 3AJZA 5FO9B 2WNVB 3DPRA 4QPYA 2YHJA 5FLHA 2E33A 3RRDA 4NAOA 4QDRA 1VBD2 4XCBA 2YBSA 2EICA 2ZEZA 5A6QA 3M70A 4RQPB 2B46X 3I49A 2WZR2 5F3IA 5LZ6A 1K3IA 4XCAA 5AVPA 1LOEA 3IDAA 1O91A 2Y26A 3O12A 1VBB1 3ATGA 3LOBA 2D6NA 4KWJA 3DEMA 4PBPA 4UBHA 4E27A 4YW3A 1NCQB 4FPYA 4YM3A 2NLRA 4DNYA 1JMUB 3CL1A 2JDYA 2ZHMA 3PMEA 1US3A 1W6OB 4GAZA 1RJ7A 1PO11 5FJKA 3VD7A 3BTYA 5AC93 4QB2A 2DUOA 2C26A 5H9PA 2VMEA 3VHRA 4LQRA 2JE7A 5E16A 3VBUC 5T5PA 3BN6A 3ZFGC 2UU8A 1NXMA 1UY3A 2V4VA 1MQTC 1KJRA 1EYBA 1Q5OA 2A5ZA 2SBAA 4KWLA 5J98B 1UXZA 2D5HA 2XQXA 5C33A 5CFCB 4QPGA 1OOPB 4JGYA 4GWMA 2JDKA 4P08A 2YFUA 3WUCA 2PAKA 3O5SA 1NLSA 4P5HA 2PELA 3DKQA 3SH5A 1D4VB 1HRI1 2VZRA 2WZEA 1PZ7A 2ZCWA 4JCKA 4AEDA 1L7RA 2GH2A 5CKNA 5A6YA 3WT3A 3N7JA 2NZ9A 3M2MA 3TNQA 3PUHA 3R4UA 1OOPA 1SLTA 4CP9A 3MBWA 3GHMA 5A1AA 2R7EB 4IEOA 2R063 4JQRA 2PTMA 2XJTA 3LAGA 2IWGB 4QX7A 4UFLA 1PVXA 3CKHA 1CAWA 4BQ3A 3E6DA 3ACFA 3ZYBA 5JSRA 1GV9A 2AUYA 2BDRA 5LRRA 3HNMA 5IVCA 3TEXA 3BTZA 1VBA3 3B3QE 4RD7A 3VBRB 4AVVA 1PK6B 1R093 1LECA 1N3QA 1XB9A 3NQHA 4QX2A 5JOZA 1UZYA 5AVAA 1ZZ9A 2HBUA 1VBE3 4XF4A 2WIIB 3VZLA 5CIRA 4D69A 3IPVB 2ENRA 3N36A 1CX4A 3I8TA 4Y33A 2XBO3 4AHYA 4CCJA 1W06A 4F3JA 3LA7A 3OYWA 2FDHA 3A22A 1VRBA 1W2TA 3GZTB 4CP9B 1JXNA 1YQ2A 3DPRC 4PHZA 3Q8AA 1FNZA 3OGGA 3WLUA 1IGOA 3K4AA 5SV8A 2LROA 1K42A 2D93A 4W50A 2FD8A 4COVA 1IG3A 2J7MA 5H9SA 3AP5A 4QB1A 4S2FA 5JSPA 1O5LA 1VPHA 3JBG2 4JRAA 1Z7S2 3KQ4B 4DY3A 1BEV3 1MR5A 5G04L 3SH4A 5DMYA 4OZOA 3WHTA 5F8PA 4XVHA 4DINB 4UW4A 1QNWA 3NJZA 4OYUA 2JG8C 1JYNA 2Q5TA 1MVQA 2WO7A 4FFGA 4I3PA 5FY9A 1SMVA 3W20A 2RVAA 2WA3A 4QWNA 2IXHA 4RQPC 1VR3A 5C4WB 3ZN5A 2P3JA 4AQ2A 2VMGA 5EQUA 4O65A 4HONA 1Z7S3 1S0JA 5FZ9A 1F5FA 2DDUA 1M4WA 3NVCA 4BK4A 2N7GA 2XOMA 1BCXA 2ZBJA 4CEWA 3A23A 2GC2A 3H50A 4I30A 5GALA 1V6IA 1IKQA 3TEZA 1U0AA 2OA2A 5LY2A 2P34A 3W5MA 1WD3A 2J1TA 1N3OA 3HMYA 5FY5A 1AYM2 4K6BA 2QQNA 4CA9A 1F15A 2DV9A 5GZEA 1W99A 4Q0UA 1H1IA 1WCDJ 3SC7X 2QJVA 3DV8A 1H2LA 2J1VA 1PHMA 2MEV1 1HXS2 2VNRA 4QX0A 2H0BA 4NRMA 5FP8A 3WP5A 1ZA4A 1LOFA 4A6OA 1W0NA 4RR3A 5JWPA 2VCCA 2ARXA 2OZ6A 2RS13 4C91A 3OPTA 1NAEA 1L7QA 3SXWA 4Y22B 3H42B 2ZX1A 1GZCA 4D7TA 5AFEA 1EY2A 4YFZA 4MGTA 1QJU2 4BCUA 4UWDA 2CAVA 5GJ6A 5ABJB 3ZXFA 4IEZA 1W9SA 3N9MA 3ZIXA 2QTWB 1OA4A 2XLGA 4NPRA 2ADEA 3OEBA 4HKOA 4BQ1A 4JHTA 4MX3A 3EYPA 2JIJA 5FOBB 2A1XA 3G6JB 3T1MA 3K75B 1JYVA 3ETQA 4J1WA 3AJYA 5A3MA 3INAA 1COV2 3LDRA 2RMU1 5CBLA 2CGOA 2ZMNA 3W9AA 2ZX0A 3VD3A 4P9JA 4LBJA 5LEKA 1AR82 3MLLA 1C3HA 3GJBA 1AYN2 4QXHA 3CBNA 4XACA 3WF0A 2G9GA 3PUIA 1VE0A 4RS5A 2HYKA 3JU9A 1ND3B 1RHI3 2WN3A 2HWE3 3I2KA 1O3TA 4NMIA 3VZNA 5CFDA 1VBC1 3ZXGA 4IEYA 1EAH3 3C7OA 1ND2A 3IN9A 4V2VA 1LGNA 4IUGA 1YXWA 2B7YA 3MFCA 1XYOA 1W9FA 3MIFA 5A7NA 1AR83 4GWIA 2VD7A 1RUE3 4Y5Z0 3T0AA 3C7GA 4B7KA 1DF0A 3V0BB 2WN2A 3ZDVA 1G9CA 1LOGA 3NNLA 1LOBA 1YI9A 5T54A 1FOD2 5FZKA 4JDOA 1OFSA 4AFBA 1QEXA 1JU4A 2VZSA 1TMF2 2E9QA 2NPIA 4Q4W2 3I3DA 4YG3A 1F31A 2GAUA 5IK7A 3SHRA 3FE5A 1PM4A 1SLCA 3MF9A 2B9UA 1KDKA 3LEKA 1UWWA 1DZTA 3EQEA 3AKTA 5L9BA 3VL8A 1VBC3 2JDUA 2HH9A 4Q4V3 4EQVA 3J7HA 1JZ8A 3AVRA 1VIWB 4A44A 1NCRC 4EWAA 3ZXJA 4E4DX 5FJHA 4EN6B 5JSOA 3ZFEA 5E8AA 2YC2A 1SACA 3AP9A 1DGRN 2R042 3ILNA 4IV3B 4N43C 5IYYA 1CX1A 1AR73 2OXBA 4H7LA 1RUNA 3D82A 4C90A 3LZZA 5JXGA 1OC1A 2YZ4A 5JZGC 5FZMA 4HL0A 2ZMKA 2NN8A 5FPAA 1HJFA 1QH6A 2OQ6A 2WQ8A 1QF3A 4C8DA 4IEVA 4O9GA 5CAZA 5J7MA 1GNHA 1DQ2A 1UYPA 5JOXA 1UPSA 2QZ3A 1LENA 3QBQA 1ST8A 2GDFA 2JIGA 2D98A 1SQ4A 1MEC2 2GC0A 4YM2A 5A1FA 2FHRA 5JMCA 4P14A 3T4VA 4NOTA 4BQYA 2R1BA 3JCIA 5L9VA 3TEYA 1ENQA 3JXSA 1DQ4A 2G19A 3M3CA 3VD4A 3BVCA 4K21A 4ONUA 5H9QA 2D6OX 5JZGA 3KCXA 3POWA 4Q4X1 1RUJ1 1SPPB 3L9JT 3ZOIA 4E2SA 2GNBA 4QGMA 2VMDA 2YPDA 5FZ1A 4FTSA 3MIHA 1GNZA 1OPOA 4XOGA 3AVSA 2VZTA 4ITCA 1MEC3 3ZFEC 5AC91 4COYA 5T5LA 5BNQA 5FPXA 3MPPG 3N35A 4WM8A 4OCTA 3PVEA 1ENSA 2ZKNA 3SCFA 2WFF2 1LHNA 3HQXA 1FXZA 1WMDA 2AEZA 2MNGA 2XXZA 3T0DA 1SDDB 2WABA 3OPZA 4CZSA 4QQPA 3JQWA 1OHFA 3K3OA 4BQWA 3NAPB 1R082 1RUG2 1NCQA 4Q1PA 4YVWA 3POEA 1G86A 4A7ZA 1W6OA 3POGA 4TWTA 1BBT3 4RQPA 1UYZA 2VJXA 1O4ZA 1FMD1 2ZZJA 1S0EA 3ILRA 4N43A 4LBQB 3CJIC 5L73A 2WFF3 3BYWA 3MO4A 4OUMA 2VXRA 3TOJA 4BHPA 3EJKA 3NNJA 1HB4A 1HKDA 3AFGA 4RYDA 5FPZA 4XFGA 5C8CC 2YPJA 3CZJA 3V64A 1CWPA 4CCCA 3GZUC 4K8RB 3H0OA 4IV3C 4N43B 1POV3 2XR4A 2NM1A 3DL3A 5K4LA 2I45A 1REFA 1W28A 4A3ZA 1TNRA 2E7QA 2QQWA 1IZ3A 1GP5A 1RVF3 2XJVA 4AHWA 2YYOA 1FMD2 2GMMA 4LPLA 2ZGRA 4W6WA 1RUJ3 1HQLA 5FZGA 3MW4A 2OIIA 1O7FA 4HPKB 1H4HA 2ZACA 5C3RA 5IJRA 1VBA1 2W08A 2IUWA 3VUOA 2VVDA 3WSOA 2VNVA 1LHOA 4BIFA 5FPVA 2VE1A 1SEFA 3U4SA 3HQUA 5JI9A 1OMIA 1V70A 2R0HA 3JD72 3POFA 2O0OA 3ME2A 1E5HA 3HEIA 1NUKA 1COV3 2P4EA 3VBHA 1UF2C 1NY72 5FKCA 1PM7A 4NIAA 1QOSA 4DUVA 3H3UA 2QUOA 4W4ZA 3THCA 3ZDSA 4AQTA 4G9SB 3VDDC 2HLEA 1KJLA 2BJSA 3LFIA 2Z5WA 5C7GA 2KD7A 3J8F3 2EIBA 4LBQD 1JU3A 3FN9A 5FZ3A 1RUI2 3LIHA 2RE9A 1DYOA 4LHLA 4UXAA 4XABA 1H2NA 1OKQA 3ZYJB 5I0SA 2C9KA 1RHI2 2P1BA 3PU8A 4GB32 3ALQA 2D7FA 3X29B 3PVBB 2RS52 1QJU3 3A21A 3IPVA 1LEMA 3LSEA 1SFPA 3DGTA 3PTYA 1OLME 2W1SA 3GCXA 1VAVA 1POV0 4XJ8A 1JUHA 3ZXEA 1ODMA 3VZOA 4Q4V1 3ZFGA 1XNAA 4LO4B 4NUBA 1PNFA 3PMSA 1RUE2 2I74A 3WW4A 1RUD3 1V6LA 2WLQA 2VZ3A 3Q8EA 3TWIA 1GR3A 1C5IA 3H3ZA 4LIVA 5IVEA 1IQDC 2WS91 4N7IA 5T52A 4BU2A 5C9AB 3O1SA 1W3VA 4GB33 1YRZA 2HWB1 2X05A 4JZRA 2HWC2 5FREA 3K51A 4AFCA 2V5DA 1ENXA 1MS3A 3H8OA 3C7HA 2C9AA 1W0PA 4LA2A 1NQDA 3OCPA 4QKFA 5E6HA 5GZGA 4YGBA 5D8AB 3Q8BA 1DQ0A 1F2NA 2VOXA 4WVWA 4OI2A 5A80A 4CDQC 2WC2A 2VQAA 3I59A 5LA1A 4NHKA 4ZXKA 2VECA 5A3TA 3POYA 3JQXA 4K1YA 3WV6A 5F3EA 4CE8A 5FK7A 1OSGA 1VRH3 1AL21 3QLQA 4CCMA 4GZ9A 4O61A 2H0VA 4XFBA 2NP0A 2W1UA 1X33A 2PHFA 4Y1VA 4OHZA 1X36A 4CEWB 3ZM8A 1TE1B 3N7LA 4QU1A 1TMF3 2K9ZA 4XF9A 5T3NA 4H3WA 2WT1A 4LE4A 2EXKA 1O4YA 2ORZA 3LA3A 4MLOA 2DVFA 3SKVA 2HKXA 4GIQA 4XILA 2X53S 2A75A 3FC0A 4XZPA 2XL9A 5I0TA 3AZVA 4LXLA 4UF0A 1B09A 1H8TA 3HOBA 4B4PA 4NWVA 5FZIA 1W39A 3ILFA 4AEJA 4COZA 2O8OA 1K5JA 3FBYA 1REDA 2GALA 1BHGA 3BIWE 2AZ5A 3JB8A 1UN1A 5ABJA 3POBA 4GH4C 5FV3A 5BNOC 5C5TA 2VZ1A 4O9EA 5FZFA 4LHSA 5GLTA 2ZXQA 1EV11 1GQGA 1SFNA 1VBA2 4SBVA 5HXVA 4FBFA 1R092 1WW7A 2WNVA 3DPRB 3AZWA 4ZKTB 4AGVA 5FKBA 2HBTA 1PGW1 3DYOA 4HBNA 4OHYA 2WRAA 3ZYGA 5L19A 5IVVA 2JJ6A 4INDA 3VDDB 4HVRA 1T2XA 3RWNA 5A32B 5J09A 5FIXA 1J84A 1R083 2WJSA 5KHHA 1S0GA 2Y6HA 2Y60A 4Y20B 3ZYHA 2FCTA 1S0FA 1X9PA 2RM23 4MH0E 2YMZA 3VBUA 1PNGA 4B4QA 2WL1A 2YC4A 3WP6A 1VMHA 3VKMA 3WG3A 2XQRA 4AVBA 3VD9A 2W87A 1JODA 1PK6C 2JDAA 3B00A 4WM8B 5A3NA 1UOBA 5B4NA 1U12A 1GOHA 2J1SA 3N7KA 3I3EA 1LEDA 3CO2A 1OLRA 4HKLA 2UWBA 1JW6A 3LA2A 2C24A 4PIYA 2OS2A 3I7DA 5EYYA 4DQAA 3WW3A 4EV0A 3NAPA 1PGW2 4IERA 2Q0AA 1UIKA 4Y1YA 3MI8A 3Q8CA 2FCVA 2Q30A 3OUJA 2GMEA 1GWMA 4OHVA 4QXBA 4SLIA 4WV8A 4XUTA 2ZX2A 2DVBA 3W58A 5BNOA 1CAUA 1WCQA 3BALA 4WVZA 2IXJA 2R071 4OZXA 5DPNA 2WT2A 2RS31 5F9TA 2BWCA 1CIYA 1H8TC 1IS6A 2P37A 3FL7A 4HN1A 4MG2A 1NYWA 2GZWA 1U5YA 1O6UA 2CHHA 5CFCA 2VTFA 1OD3A 3MUZ1 1GNYA 1VAKA 1D0GA 3WG2A 1AL22 4JTOA 1TME1 3ZSKA 2PLV3 1X9TA 2UYBA 2VTXA 2VMFA 4Q29A 3TBDA 4P9IA 1DLCA 1VJ2A 4A41A 4XZUG 5FXWA 3I2OA 2AACA 2EIDA 3EB7A 3ZXDA 4BMBA 3RG0A 2KR2A 4QDSA 1D2SA 3IAQA 4FVVA 4MADA 2QQKA 4FCAA 4ZS3A 3GJAA 4H55A 3WNLA 5IAXA 1ZZ8A 5JXHA 3AKRA 3LCPA 2A6WA 5KWRA 3K48A 5I0DA 1O3SA 1DQ1A 2ZMLA 5FZBA 1PK6A 1G9DA 1BXHA 2E31A 4YNIA 4Z2AA 5C70A 1KXGA 2X5IA 1WCSA 4LA3A 2OYZA 3SLIA 3WQ1A 1W6MB 3ZIWA 4CRQA 1DGWX 1C57A 1MPXA 5FYVA 1MS0A 4NRPA 2W1QA 5FAXA 3VHNA 4Q26A 5BNNB 1Q8SA 3H3LA 1PO22 1MZFA 2QBXA 1KITA 1TEIA 5DZFA 5KHKA 1YJLA 1CVNA 3VZMA 2XHNA 2B8MA 1RVF1 3BPSA 3IDBB 5JXIA 5I8SA 1RMU2 2ZGSA 4AHXA 1W6QA 3CF6E 1WCKA 2J1RA 4MGQA 2UURA 2D43A 3N9NA 1L7LA 4LR4A 3H1WA 1VBB3 3PUSA 5FP7A 1RXGA 3USUB 2HWE2 2Y38A 2QQLA 2AR6A 1VMFA 3BOPA 2GC1A 1AF9A 2RS53 1E5IA 4IXLA 3KWVA 4K3UA 2QDNA 3RSJA 1CZTA 1N47A 2ZGOA 4D6QA 4EE2A 2YV8A 3ZSLA 1RMU3 2ZX3A 2GH8A 4YW4A 3ZKUA 5A3OA 1QWRA 1WLCA 1YYNA 2JWPA 3I2FA 4MYEA 4AVAA 3WQ0A 1NY71 5JI7A 1HJGA 4NWWA 5FOJB 2W2IA 4ZU4A 5CFCC 4HMZA 4MHRA 4CPBA 1ZYBA 1MQTB 1AR61 4Y4YA 2DWRA 2D5FA 4MXVA 4B4RA 5JPNB 3N9QA 2ZAHA 1QOTA 4FOWA 2QQMA 4RR3B 3WG4A 3RPQA 3PUQA 5SV5A 3NJVA 4D7SA 4K7JA 1DCSA 2JKXA 4OMDA 4UAPA 1PGL2 3ZMNA 4HETA 4G3YC 1LAJA 4R4XA 4M01A 5F5CA 3ORJA 2WZR1 5HV0A 1HDKA 2D97A 2R0FA 2VC9A 3HJRA 4DOUA 4WM8C 1VAMA 4UFMA 4Q4X3 4PF5A 2LTNA 4H14A 2TNFA 4XHXA 4FP2A 3VBHB 1AR92 4E4ZA 5JVVA 3HQRA 3GCWA 4BM8A 1ULPA 3C8XA 4LO7A 1JZ7A 4GH4A 4YARA 4XFHA 1TZOA 1P8JA 1W8UA 4CDXA 5CB7A 3S30A 3BTXA 1LESA 2RJLA 2ARCA 1DIWA 2CV6A 5GLWA 4MOAA 1QXRA 4CDWB 3BGAA 1AR93 4NIDA 1J83A 4RS5B 2VM9A 3ZFFB 3IAPA 3MPBA 3P5BA 2Y0OA 5GLUA 4FFFA 4GMP3 2ZEYA 1CPNA 1ND2B 3B5LB 1H2MA 1H1AA 2JG9C 3IWZA 3T30A 3I2GA 4LKFA 1XNKA 3U1XA 1RUG1 2IXLA 2PHUA 4KWUA 1S0IA 2A3WA 2R1DA 4FPKA 4CDWA 4J25A 1PGL1 3W59A 4N53A 2Y6FA 3D8CA 5FWEA 5J3UA 5A32A 4CDQB 1ONAA 4UFJA 1WUVA 5JIAA 4DXRA 1DYKA 4Z2WA 2BERA 4HFSA 2Q1ZB 3ZSJA 5C6CA 3WP3A 3AMHA 4QAWA 2Q8OA 1RUG3 2PXJA 4PIXA 2K2SA 3OOXA 2BBVA 5FZOB 1DYPA 1X50A 1V0AA 2O14A 2RM22 4XMAA 3ON7A 4L8QA 1SG3A 3PJYA 2VMHA 5CYYA 1DQ6A 4LK7A 3O1TA 3BTAA 1JZ2A 1AL0G 1CAVB 1NOVA 4XC9A 1QXJA 5DAQA 4DMIA 5HI0A 1QDCA 5IVFA 3OD0A 3RFRA 1MEC1 3SEEA 4DUXA 5BNNC 3H7YA 3H1MA 5EXOA 3PHMA 3DKWA 3PIJA 2VU9A 3LEGA 2VGDA 2ZZQA 4QMAA 4YW2A 4W65A 1UKRA 2NMOA 3UJOA 5EIYB 4QD2A 2VULA 1O8SA 2BQPA 3AK0A 4MGIE 1QJX1 4QPIC 3CJXA 3UL2A 4F7ZA 5C3SA 2IFRA 1OKOA 5DDJ2 4B1MA 2E26A 2UY9A 1WLWA 3OEAA 3LGRA 1TMF1 2P3YA 2VL4A 1JZ5A 2JKBA 3LPGA 1JH5A 4AVSA 2WNEA 2YGMA 3MFAA 3F2ZA 5FYCA 4B1LA 4XF3A 2BUKA 4WZFA 2PMWB 2C4XA 4AF9A 3I3MA 1AVBA 2ZGMA 2PHWA 2VCMA 3P3PA 4QHZA 4BQXA 1JUIA 3ROUA 3VLBB 4CDXB 5FYUA 3C7FA 4P9WA 4CP2A 2P6HA 3DF0A 4KU8A 4YG6A 5A7OA 3T2OA 3WUDA 4Z82A 3N4MA 5DG1A 1O4TA 3CZUA 1PO23 3U14A 1W3XA 4XIOA 1N1YA 3IDEA 1BZWA 2RS51 1ZBE1 2HEYF 2VOVA 2HEVF 3ACIA 4DRRA 3W5NA 1GBGA 5IVYA 1W6MA 1GLHA 3MLKA 3DUIA 2GU9A 1NZCA 1WW4A 3HWJA 4PLMA 5ERLA 4XPVA 5T5OA 1NCRB 4FFIA 1CQ9A 4DPNA 3ZPYA 4Q4W3 5E89A 4XDOA 3RWKX 1HRV2 4OI4A 5JIUA 2ZGLA 1CONA 2WNUC 2ZHNA 3J7LA 1I6XA 1UU4A 2B39A 3N7MA 1YFXA 2IVJA 1PGSA 1W8ZA 2H6CA 2VNGA 4Y20A 1SLLA 2A71A 3FMGA 3WR0A 3LEIA 5FY4A 1RHI1 3QD6A 4IE7A 2LM3A 5I8TA 1NQJA 2HWD3 4FPHA 1QJU1 3NV2A 2X09A 2EA7A 4TN7A 1WLDA 1EAH2 4ZU7A 1EAH1 1NCQC 2GN3A 2J1EA 3ZYFA 1GOFA 4WBBA 1AR72 1UZVA 2JDZA 3D0JA 4M0NA 1V6JA 4JGYC 4AW7A 2HWF2 2RDNA 4NHLA 3VD5A 2PHDA 2CWMA 5FY0A 5I0UA 1BEV1 4G4FA 5TSWA 2VUDA 3I3BA 1ASJ3 3VHOA 2LW8A 2ILMA 3DXTA 1WW6A 1CESA 5JPMB 2FMYA 5IAVA 2ZKLA 3P3NA 3AKSA 2CTVA 1QDOA 1VRH2 3O0WA 4MUVA 1CAXB 4CDXC 3ZPOA 4XETA 1GANA 1SPPA 3BUCA 5L7OA 1OFNA 2DURA 2E7AA 3SCHA 4BMEA 2MEV2 3NO8A 4X8NA 4LIUA 2PLV1 1UU5A 4P9GA 1H8VA 1A3KA 2VW0A 3V0AB 2Z69A 3OSDA 1XXNA 2VZOA 4AWDA 4YM0A 5DDJ1 2VQTA 3UK9A 4DS0A 3MF6A 1R1ZA 1XE8A 2BOIA 4JDNA 2DVGA 5FPLA 4AG4A 4D6RA 2EAAA 4JKMA 3S57A 5F5IA 3SNMA 3S5QA 5LWBA 5EWSA 3NKGA 5D2AA 4WVMB 5F6LB 2JDMA 3UKVA 4XBQA 4A7KA 4C0HA 1IPJA 1YJKA 3RZKA 4YZ3A 4CU9A 1IS3A 4HSLA 5FFOC 4Z07A 5A70A 4ISRA 5A6XA 1ASJ1 2D40A 2HWC1 4KG0A 4LHKA 1TG7A 4I01A 4P9LA 5AC92 1FPN2 1O5UA 2D3RA 1W2OA 1C8M2 4OQ9A 4B7EA 4E4SA 3A0KA 2VOKA 5FP9A 1NCRA 4BZ4A 5F2WA 2EIGA 5KC5A 4YW7A 3SITA 4CXXA 3M3QA 3GHNA 1OLQA 4N53C 2F4LA 2CU5A 3AKQA 3OGRA 4MZUA 4YGCA 3LD8A 3ZSEA 4IDZA 4BXFA 1AR63 4JVAA 3MV01 1OF4A 1BKZA 4NO4A 4RGKA 1OLMA 1UX6A 3U11A 1NG0A 1RL3A 3GM8A 1SBFA 1JHNA 1RJ8A 3T2PA 3OBRA 2VZVA 1FPN3 4BQ2A 4AR2A 1JTZX 3I2DA 1QHDA 3WEZA 1LODA 2VW2A 1CN1A 3AYCA 4GMP0 3S5AA 3PLQA 5J48A 3HVDA 2BYVE 4NRQA 1S0CA 4HPKA 3GYDA 5DQ0A 2QZ2A 1BLZA 4LITA 1EPZA 3M1HA 2Q1MA 4RHV1 3RVHA 2FDKA 5DAPA 2ARAA 3FLTA 1TVGA 5KHJA 4ZU5A 4AGGA 3AP4A 4RS5C 1E57A 1I5PA 2WINB 1C8NA 4GWNA 4LOSA 1BK0A 1JS9A 3JD71 1XPWA 2QQIA 3IZOA 3UKNA 3WF3A 2BNMA 4AGRA 3S7EA 1S55A 5FPUA 5I91A 2FQPA 2XBO1 1URXA 1W03A 4MV2A 2DCTA 5DDJ3 5DABA 1JI6A 3LDKA 1C5HA 1CAVA 1VBE2 1ZZBA 2ARBA 3AXEA 3B93A 1F9KA 3AYEA 1NLRA 1UX7A 3WDVA 4E9KA 4E4HA 3J7NA 3KVAA 3OJBA 1YQ8A 2Y6JA 3BKZA 4IGPA 2I07B 5APAA 1UO9A 1E5RA 3OB8A 1FATA 2CDOA 4QT6A 4EYUA 3RZHA 4M0HA 3KV5A 2W39A 4XXAA 5EZWA 1JOJA 3EHKA 1V6NA 5B2GB 4MO3M 1DBNA 3QOPA 3ABZA 4ES8A 3M4FA 5KBFA 4ZY9A 3ZO0B 3FHAA 4FSJA 2BVVA 1E5SA 1HB1A 5DN2A 2GP3A 4R9DA 4RN5A 3LFMA 3BU7A 1LGCA 4AEMA 4CEYA 1S0BA 2CYFA 4QX5A 3OY8A 3USSA 1DGWA 1Z78A 2D6PA 2E7TA 2WO1A 3ZXKA 3WNKA 5L9RA 1GSLA 4R9AA 1RYYA 2Y6LA 3SISA 4XHBA 4XBNA 3TRSB 1QIQA 1NA1A 2Z79A 3T08A 2OPKA 2V72A 4EN8B 3UT0A 3VBRC 4DEVA 3KGLA 4HZFA 2JENA 2WS93 1QMJA 2OUJA 1ND3A 2OT7A 4I0WB 4RFT0 1BK1A 4IE5A 5CFDB 1ZM1A 4RFRB 3QCWA 1SLBA 1PX4A 1W04A 4JKKA 2HWE1 3GALA 2BVBA 3VKNA 1N1SA 3CJIB 4D8MA 3FBMA 4XQDA 1D4M3 3FX3A 1LCLA 4ZZ5A 3V0BA 3VKFC 4QKDA 1J1TA 4KG8A 5C8WA 4GJZA 1HXS3 2OKXA 2DYCA 1QOOA 2PAEA 4PIZA 1DQ5A 3T0BA 4AEKA 4YZ2A 1VBB2 3QACA 5F7UA 3H8XA 1A6CA 2ZABA 3MDPA 1AJOA 4KGGA 4XQ4A 1ZBA1 4L99A 2WFF1 1SBDA 2EF6A 4Q2FA 2EIEA 1KRIA 2HWC3 5JLVA 4DZGA 3VN4A 3HNYM 4IW3A 4ATFA 4HKWA 4R9BA 5IHRA 1R1A3 1SCSA 3RYPA 3NSTA 5D8AA 1LHWA 1ULDA 3KD4A 3OUHA 2G4IA 2HWD2 4XJAA 2VVFA 4HK8A 4L2NA 1W8FA 1WBFA 2MHFA 4AE2A 1Q43A 4UT5A 1AX2A 5J36A 2Z4FA 5F3CA 1NLQA 5BYNA 1WLTA 1YC61 4MHUA 5M0TA 4PBOA 4Y5TA 3M7AA 4BPZA 3RZJA 2Y6GA 2BTVC 1WBLA 4LBQA 2J1UA 4DO0A 2B9VA 4URTA 3H8UA 3O0VA 1RIRA 2XG3A 1XSQA 4FPLA 5C8CA 2J1AA 3M8LA 3A7QA 3AMPA 3KHBA 2VQUA 1N1TA 3KMHA 3LE0A 4H7MA 2F4PA 3NV4A 4XFAA 4XJZA 3VBRA 2BFUL 1XNTA 1R64A 1T6BX 2D6MA 2WUHA 2JE9A 4FTBA 2ORXA 1D7PM 5KXBA 1ZRRA 5FLIA 4J6GA 1ZRDA 1PMJX 2HJIA 2BV4A 3B7MA 1F35A 1C8M3 5F3GA 1QXPA 2C5DA 4NJ4A 4IETA 1WMXA 1V9U3 4UI9L 4ZS2A 5HCFA 2RS32 1LB2A 3ZYIB 4A42A 1OOPC 2DU0A 3U37A 4DIQA 5FMCA 2AYHA 4XFFA 1J1LA 4B8EA 5IT6A 3CU7A 3L2YA 5C8CB 2IVIB 3DYMA 1PVC3 3JBG1 4NHMA 4Q4V2 4YLZA 2W94A 3PL0A 2XONA 2DVDA 5JAXA 1D4M1 3KLSA 2DUPA 3AP6A 3OGVA 1YFUA 4PQ9A 4C0BA 4NVPA 2WR9A 5IK8A 1ZBA2 3E6CC 3AYDA 1DGRA 4LNVA 3KB5A 2YUEA 2J22A 2X8KA 1EUUA 3LEMA 3M3OA 4X6QB 4N7UA 4OHWA 4KBBA 2RM21 2V73A 4IEXA 4A3XA 1HQWA 5LA0A 1UY0A 3PNAA 3APBA 1GKBA 4P9YA 1AXYA 2QNKA 4W6XA 3VB9A 1B35C 1YQCA 3ZFFC 2DU1A 2JX9A 3THTA 4YVSA 1IOAA 4FQ4A 4I09A 2OPWA 2VUAA 1W2NA 4Q5OA
chains in the Genus database with same CATH topology
1YQ2A 3K77A 4OMCA 4PT6A 2QQLA 3K4AA 4P02B 1K42A 4D0QA 4W50A 4E8DA 2W9XA 4HG6B 1CZTA 2J7MA 3WQBA 4QB1A 1UMIA 3I2JA 2VZPA 5G04L 2WDBA 3I2FA 4OZOA 5DMYA 4XVHA 2W46A 4OYUA 1JYNA 2B4KA 2RVAA 3WNOA 2QQMA 3WNMA 4CUAA 2W91A 2LS6A 3NJVA 3T09A 2DDUA 2JKXA 4OMDA 4UAPA 4XUPA 2PQSA 4XURA 4BK4A 2XOMA 3ECQA 3HJRA 3A23A 2VC9A 4PQQA 4DEQA 3W5MA 2J1TA 3GDBA 4CUBA 2QQNA 3GGLA 2VZUA 1ULPA 1W99A 3C8XA 1JZ7A 2WAOA 1LNSA 3AC0A 2J1VA 5FUIA 4QX0A 1P8JA 4A6OA 1W0NA 1HN1A 2VCCA 2YG0A 1NAEA 1F4AA 1L7QA 2WAAA 4MOAA 3P1IA 3BGAA 1J83A 2DCKA 1US2A 3UETA 2VM9A 1W9SA 2VCAA 3IAPA 1JZ6A 3OEBA 2ZEYA 4QB6A 3EYPA 1GU3A 5JUVA 2WYSA 1EUTA 3I2GA 3K75B 4KWUA 1JYXA 5EJZB 3ETPA 3VD3A 1PMHX 1DP0A 4DXRA 2BERA 3WF0A 4BK5A 1NKGA 4ZZ8A 1JYWA 3PUIA 4TXWA 3ACGA 4QAWA 3E1F1 2WN3A 3I2KA 1UYYA 4LKSA 3C7OA 1SG3A 4DXTA 4IUGA 5CYYA 1JZ2A 3T0AA 4GWIA 3C7GA 2WN2A 4ARYA 4DUXA 3SEEA 1JU4A 2VZSA 3I3DA 1GUIA 3LEGA 5EIYB 1O8SA 3LEKA 1UWWA 3HPNA 2DCJA 3J7HA 3NRUA 1JZ8A 4A44A 2E26A 4CU7A 4FI9A 3OEAA 5JR2A 2VL4A 4E8CA 2YC2A 3D3AA 3LPGA 1JZ5A 1JYVA 2RV9A 3SEPA 3F2ZA 2W1WA 3C7EA 1WKYA 5IYYA 1CX1A 4AAXA 3K4ZA 2C4XA 4YPJA 2HYXA 5JXGA 3C7FA 3CMGA 2WQ8A 3HNBM 3T2OA 2RJ2A 3K4DA 1UYXA 3CZUA 1OH4A 3I2HA 5JMOA 4JHZA 1SHWB 2E32A 3ACIA 3DYPA 5LCWL 3W5NA 3UNPA 3JXSA 4P5YA 3VD4A 2WO2A 4BXSV 3OG2A 4L0PA 4M4PA 2VMDA 4QPWA 1UY4A 3NNGA 2VZTA 1GQPA 3LEIA 4OUEA 3CDZB 4JX0A 1W8NA 2X09A 4CU8A 3FHQA 3WF1A 3T0DA 1SDDB 2WABA 2J1EA 4QDQA 1GOFA 4XUOA 3OGSA 5EJ1B 3VD5A 1UYZA 2VJXA 4DXSA 1H6YA 3I3BA 4CUCA 2BZDA 2LW8A 2Y8KA 2WBKA 4P00B 3MO4A 3NJXA 1O59A 5J1XA 4A45A 2BGOA 3CQOA 4KI5M 2W95A 4RYDA 3CZJA 2JE8A 3HN3A 3WNNA 2W5FA 3VDBA 1KEXA 4A3ZA 2CDPA 4W8JA 3VDAA 2VZOA 2VQTA 2BBAA 4LPLA 3THDA 4AG4A 2YFZA 4JKMA 2ZEXA 5IJRA 3WSOA 1UY1A 2ID4A 2W92A 3WF4A 2X10A 4CU9A 1OT5A 1ULOA 3LPFA 1TG7A 5G05L 2Y6KA 3HEIA 4BJ0A 1NUKA 2JD9A 4TTGA 4DUVA 4W4ZA 3THCA 3MUY1 3OGRA 2HLEA 2VCBA 5C7GA 2KD7A 2EIBA 3MV01 1JU3A 1OF4A 3FN9A 1DYOA 3I2IA 3GM8A 1K12A 4XUNA 2C9KA 2W47A 3T2PA 2VZVA 1UMHA 3A21A 3WEZA 2W1SA 1W9WA 1GOGA 2QQJA 5JXJA 1CZVA 1UXXX 1XNAA 2W3JA 3LQCA 5DQ0A 3WF2A 3T2QA 5CZKA 2VZ3A 4ZXEA 1IQDC 2QQOA 1KGYA 4DUWA 1TVGA 4UOJA 5HPOA 1GMMA 4ARXA 1I5PA 2WZ8A 2X05A 1XPWA 2QQIA 3WF3A 2V5DA 3C7HA 5C71A 4ET7A 4CU6A 1JI6A 2L9LA 2BGPA 5LA1A 2YB7A 1UX7A 2Y6JA 4KMQA 4GZ9A 3OB8A 4A4AA 2CDOA 3OBAA 5B4XA 3I97A 2W1UA 2VO5A 3ZM8A 4MO3M 1H6XA 3ABZA 1UZ0A 4ZY9A 5IFTA 3FHAA 5DN2A 4RN5A 2ORZA 3SKVA 2WO3A 2WO1A 3UESA 3WNKA 1NX9A 4M4RA 3WNPA 1RYYA 3ACHA 2Y6LA 3HOBA 3IIIA 4QX1A 2ZEWA 1PX3A 3T08A 1OF3A 2V72A 2VR4A 1BHGA 4DEVA 2VZ1A 1JHJA 3GXUA 4LHSA 2ZXQA 4GWJA 1PX4A 4JKKA 4D8MA 3DYOA 1XC6A 4BDVB 4ZZ5A 1T2XA 1UY2A 1J84A 2Y6HA 4CVUA 2OKXA 5F7UA 2YC4A 3T0BA 3IB3A 3VD9A 1F4HA 2VZQA 2W87A 2JDAA 2VOTA 5B4NA 1GOHA 2J1SA 4PF1A 3I3EA 3VDCA 2EIEA 3HNYM 5IHRA 2E33A 4QDRA 1JZ3A 2Y64A 4XUTA 2ZEZA 2EICA 3K46A 2Z4FA 1JZ4A 1K3IA 4MGSA 1W9TA 3IDAA 1WCQA 3DECA 5DPNA 5LA2A 1CIYA 2Y6GA 3FL7A 2J1UA 1US3A 2B9VA 2VTFA 1OD3A 3MUZ1 2J1AA 3VD7A 1GNYA 3A7QA 2VQUA 4QB2A 3LE0A 3P6BA 2C26A 5IFPA 2VMEA 1XNTA 4LQRA 1R64A 3SKJE 2WUHA 5HXMA 2ORXA 1D7PM 3BN6A 2VMFA 1UY3A 2V4VA 1DLCA 4A41A 1PMJX 4XZUG 2EIDA 1K45A 3EB7A 1UXZA 2XQXA 4QDSA 4QX3A 3IAQA 4MADA 4XUQA 2QQKA 4P08A 2YFUA 4UI9L 3WNLA 5JXHA 4A42A 3U37A 2WZEA 2VZRA 5I0DA 1L7RA 3MV11 3DYMA 2E31A 4Z2AA 5C70A 2W94A 3PUHA 2XONA 3MBWA 5A1AA 2R7EB 1MPXA 3OGVA 1W8OA 2W1QA 3CIHA 3CKHA 3ACFA 3HNMA 2J22A 1EUUA 2QBXA 5LA0A 1O8PA 3NQHA 4QX2A 1UY0A 2XHNA 4JKLA 5JXIA 2VMCA 2J1RA 4MGQA 1CZSA 3A22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ2 A;  3K77 A;  4OMC A;  4PT6 A;  2QQL A;  3K4A A;  4P02 B;  1K42 A;  4D0Q A;  4W50 A;  4E8D A;  2W9X A;  4HG6 B;  1CZT A;  2J7M A;  3WQB A;  4QB1 A;  1UMI A;  3I2J A;  2VZP A;  5G04 L;  2WDB A;  3I2F A;  4OZO A;  5DMY A;  4XVH A;  2W46 A;  4OYU A;  1JYN A;  2B4K A;  2RVA A;  3WNO A;  2QQM A;  3WNM A;  4CUA A;  2W91 A;  2LS6 A;  3NJV A;  3T09 A;  2DDU A;  2JKX A;  4OMD A;  4UAP A;  4XUP A;  2PQS A;  4XUR A;  4BK4 A;  2XOM A;  3ECQ A;  3HJR A;  3A23 A;  2VC9 A;  4PQQ A;  4DEQ A;  3W5M A;  2J1T A;  3GDB A;  4CUB A;  2QQN A;  3GGL A;  2VZU A;  1ULP A;  1W99 A;  3C8X A;  1JZ7 A;  2WAO A;  1LNS A;  3AC0 A;  2J1V A;  5FUI A;  4QX0 A;  1P8J A;  4A6O A;  1W0N A;  1HN1 A;  2VCC A;  2YG0 A;  1NAE A;  1F4A A;  1L7Q A;  2WAA A;  4MOA A;  3P1I A;  3BGA A;  1J83 A;  2DCK A;  1US2 A;  3UET A;  2VM9 A;  1W9S A;  2VCA A;  3IAP A;  1JZ6 A;  3OEB A;  2ZEY A;  4QB6 A;  3EYP A;  1GU3 A;  5JUV A;  2WYS A;  1EUT A;  3I2G A;  3K75 B;  4KWU A;  1JYX A;  5EJZ B;  3ETP A;  3VD3 A;  1PMH X;  1DP0 A;  4DXR A;  2BER A;  3WF0 A;  4BK5 A;  1NKG A;  4ZZ8 A;  1JYW A;  3PUI A;  4TXW A;  3ACG A;  4QAW A;  3E1F 1;  2WN3 A;  3I2K A;  1UYY A;  4LKS A;  3C7O A;  1SG3 A;  4DXT A;  4IUG A;  5CYY A;  1JZ2 A;  3T0A A;  4GWI A;  3C7G A;  2WN2 A;  4ARY A;  4DUX A;  3SEE A;  1JU4 A;  2VZS A;  3I3D A;  1GUI A;  3LEG A;  5EIY B;  1O8S A;  3LEK A;  1UWW A;  3HPN A;  2DCJ A;  3J7H A;  3NRU A;  1JZ8 A;  4A44 A;  2E26 A;  4CU7 A;  4FI9 A;  3OEA A;  5JR2 A;  2VL4 A;  4E8C A;  2YC2 A;  3D3A A;  3LPG A;  1JZ5 A;  1JYV A;  2RV9 A;  3SEP A;  3F2Z A;  2W1W A;  3C7E A;  1WKY A;  5IYY A;  1CX1 A;  4AAX A;  3K4Z A;  2C4X A;  4YPJ A;  2HYX A;  5JXG A;  3C7F A;  3CMG A;  2WQ8 A;  3HNB M;  3T2O A;  2RJ2 A;  3K4D A;  1UYX A;  3CZU A;  1OH4 A;  3I2H A;  5JMO A;  4JHZ A;  1SHW B;  2E32 A;  3ACI A;  3DYP A;  5LCW L;  3W5N A;  3UNP A;  3JXS A;  4P5Y A;  3VD4 A;  2WO2 A;  4BXS V;  3OG2 A;  4L0P A;  4M4P A;  2VMD A;  4QPW A;  1UY4 A;  3NNG A;  2VZT A;  1GQP A;  3LEI A;  4OUE A;  3CDZ B;  4JX0 A;  1W8N A;  2X09 A;  4CU8 A;  3FHQ A;  3WF1 A;  3T0D A;  1SDD B;  2WAB A;  2J1E A;  4QDQ A;  1GOF A;  4XUO A;  3OGS A;  5EJ1 B;  3VD5 A;  1UYZ A;  2VJX A;  4DXS A;  1H6Y A;  3I3B A;  4CUC A;  2BZD A;  2LW8 A;  2Y8K A;  2WBK A;  4P00 B;  3MO4 A;  3NJX A;  1O59 A;  5J1X A;  4A45 A;  2BGO A;  3CQO A;  4KI5 M;  2W95 A;  4RYD A;  3CZJ A;  2JE8 A;  3HN3 A;  3WNN A;  2W5F A;  3VDB A;  1KEX A;  4A3Z A;  2CDP A;  4W8J A;  3VDA A;  2VZO A;  2VQT A;  2BBA A;  4LPL A;  3THD A;  4AG4 A;  2YFZ A;  4JKM A;  2ZEX A;  5IJR A;  3WSO A;  1UY1 A;  2ID4 A;  2W92 A;  3WF4 A;  2X10 A;  4CU9 A;  1OT5 A;  1ULO A;  3LPF A;  1TG7 A;  5G05 L;  2Y6K A;  3HEI A;  4BJ0 A;  1NUK A;  2JD9 A;  4TTG A;  4DUV A;  4W4Z A;  3THC A;  3MUY 1;  3OGR A;  2HLE A;  2VCB A;  5C7G A;  2KD7 A;  2EIB A;  3MV0 1;  1JU3 A;  1OF4 A;  3FN9 A;  1DYO A;  3I2I A;  3GM8 A;  1K12 A;  4XUN A;  2C9K A;  2W47 A;  3T2P A;  2VZV A;  1UMH A;  3A21 A;  3WEZ A;  2W1S A;  1W9W A;  1GOG A;  2QQJ A;  5JXJ A;  1CZV A;  1UXX X;  1XNA A;  2W3J A;  3LQC A;  5DQ0 A;  3WF2 A;  3T2Q A;  5CZK A;  2VZ3 A;  4ZXE A;  1IQD C;  2QQO A;  1KGY A;  4DUW A;  1TVG A;  4UOJ A;  5HPO A;  1GMM A;  4ARX A;  1I5P A;  2WZ8 A;  2X05 A;  1XPW A;  2QQI A;  3WF3 A;  2V5D A;  3C7H A;  5C71 A;  4ET7 A;  4CU6 A;  1JI6 A;  2L9L A;  2BGP A;  5LA1 A;  2YB7 A;  1UX7 A;  2Y6J A;  4KMQ A;  4GZ9 A;  3OB8 A;  4A4A A;  2CDO A;  3OBA A;  5B4X A;  3I97 A;  2W1U A;  2VO5 A;  3ZM8 A;  4MO3 M;  1H6X A;  3ABZ A;  1UZ0 A;  4ZY9 A;  5IFT A;  3FHA A;  5DN2 A;  4RN5 A;  2ORZ A;  3SKV A;  2WO3 A;  2WO1 A;  3UES A;  3WNK A;  1NX9 A;  4M4R A;  3WNP A;  1RYY A;  3ACH A;  2Y6L A;  3HOB A;  3III A;  4QX1 A;  2ZEW A;  1PX3 A;  3T08 A;  1OF3 A;  2V72 A;  2VR4 A;  1BHG A;  4DEV A;  2VZ1 A;  1JHJ A;  3GXU A;  4LHS A;  2ZXQ A;  4GWJ A;  1PX4 A;  4JKK A;  4D8M A;  3DYO A;  1XC6 A;  4BDV B;  4ZZ5 A;  1T2X A;  1UY2 A;  1J84 A;  2Y6H A;  4CVU A;  2OKX A;  5F7U A;  2YC4 A;  3T0B A;  3IB3 A;  3VD9 A;  1F4H A;  2VZQ A;  2W87 A;  2JDA A;  2VOT A;  5B4N A;  1GOH A;  2J1S A;  4PF1 A;  3I3E A;  3VDC A;  2EIE A;  3HNY M;  5IHR A;  2E33 A;  4QDR A;  1JZ3 A;  2Y64 A;  4XUT A;  2ZEZ A;  2EIC A;  3K46 A;  2Z4F A;  1JZ4 A;  1K3I A;  4MGS A;  1W9T A;  3IDA A;  1WCQ A;  3DEC A;  5DPN A;  5LA2 A;  1CIY A;  2Y6G A;  3FL7 A;  2J1U A;  1US3 A;  2B9V A;  2VTF A;  1OD3 A;  3MUZ 1;  2J1A A;  3VD7 A;  1GNY A;  3A7Q A;  2VQU A;  4QB2 A;  3LE0 A;  3P6B A;  2C26 A;  5IFP A;  2VME A;  1XNT A;  4LQR A;  1R64 A;  3SKJ E;  2WUH A;  5HXM A;  2ORX A;  1D7P M;  3BN6 A;  2VMF A;  1UY3 A;  2V4V A;  1DLC A;  4A41 A;  1PMJ X;  4XZU G;  2EID A;  1K45 A;  3EB7 A;  1UXZ A;  2XQX A;  4QDS A;  4QX3 A;  3IAQ A;  4MAD A;  4XUQ A;  2QQK A;  4P08 A;  2YFU A;  4UI9 L;  3WNL A;  5JXH A;  4A42 A;  3U37 A;  2WZE A;  2VZR A;  5I0D A;  1L7R A;  3MV1 1;  3DYM A;  2E31 A;  4Z2A A;  5C70 A;  2W94 A;  3PUH A;  2XON A;  3MBW A;  5A1A A;  2R7E B;  1MPX A;  3OGV A;  1W8O A;  2W1Q A;  3CIH A;  3CKH A;  3ACF A;  3HNM A;  2J22 A;  1EUU A;  2QBX A;  5LA0 A;  1O8P A;  3NQH A;  4QX2 A;  1UY0 A;  2XHN A;  4JKL A;  5JXI A;  2VMC A;  2J1R A;  4MGQ A;  1CZS A;  3A22 A; 
#chains in the Genus database with same CATH topology
 4Q4W 1;  4ORF A;  4CYD A;  1XOY A;  4OFG A;  1R09 1;  5LY1 A;  2XVL A;  5F6K A;  3T3Y A;  4D0Q A;  2W9X A;  4HG6 B;  1CR7 A;  3PIG A;  1MQT A;  3ZYR A;  2W68 A;  1W05 A;  3I2J A;  1V00 A;  1Q8O A;  3AB0 A;  2VZP A;  3MID A;  3H1Y A;  2RMU 3;  4M3C A;  2RHP A;  4IES A;  1RUC 2;  4MGK E;  5DXD A;  1W6N A;  5ACA 2;  1JOB A;  5LK7 B;  1T6G C;  4S2H A;  4YSF A;  4MGY E;  4LLF A;  1CAX A;  2JDN A;  1TNF A;  3IBM A;  4FO9 A;  2DBI A;  4MSV A;  4A7Y A;  1ALY A;  4GQ7 A;  1UAI A;  3WNO A;  3MW2 A;  4OI1 A;  2OW4 A;  1AL2 3;  2A70 A;  2DBN A;  1NZI A;  3U75 A;  5GM0 A;  3WQ7 A;  1WW5 A;  3UKT A;  3MYX A;  3VV1 A;  4N9I A;  1DG6 A;  3WNM A;  5K0U A;  3VBO C;  5KXC A;  2LS6 A;  4KQ7 A;  3T09 A;  3CJI A;  3WD5 A;  4XJW A;  4XUP A;  4RL7 A;  2PQS A;  4XUR A;  1OD5 A;  3KCY A;  3B9I A;  3KV9 A;  3ECQ A;  4CCE A;  1ZBE 2;  3IMM A;  4LBL A;  2VNO A;  4PQQ A;  5BNP B;  1IPK A;  4PDW C;  4CP0 A;  1W90 A;  1W8W A;  1AXK A;  2VMI A;  3R4S A;  2JG9 B;  2DCZ A;  3EXU A;  3U07 A;  4NIH A;  3GDB A;  4CUB A;  4RSU A;  5FYM A;  4RHV 3;  4M00 A;  5FXZ A;  1CZS A;  5I93 A;  3GGL A;  1QJX 2;  3WW2 A;  5CG9 A;  2WAO A;  1LNS A;  3JD7 3;  4XDQ A;  3AC0 A;  1GZW A;  2XPJ A;  1Y7B A;  1WA6 X;  1DU3 D;  3ZFG B;  1Y9Q A;  4BWO A;  1HN1 A;  5FUP A;  4NAM A;  2GC3 A;  1D4M 2;  4FPJ A;  5FO8 B;  2ZGP A;  2YG0 A;  1F4A A;  2ZHL A;  1X8M A;  3P1I A;  4LBN A;  4I0A A;  3FWE A;  3ZN6 B;  1C1L A;  2DCK A;  5C4W C;  3POJ A;  1US2 A;  3A4U A;  4LMF A;  3UET A;  1FMD 3;  4LK6 A;  2VUJ A;  2D3P A;  1HRV 3;  3B94 A;  4Q4Y 3;  1BMV 2;  3J8F 1;  1GU3 A;  2BP6 A;  2P5B A;  1OVP A;  2TEP A;  2VUC A;  4JAA A;  4FPG A;  3LWC A;  3R05 A;  3ZMO A;  2Y33 A;  3AKP A;  5FZ7 A;  3HAG A;  4JGZ A;  4L11 A;  3NMB A;  5I0R A;  3ST7 A;  4CCL A;  1PO2 1;  5DUU A;  1NE6 A;  1R1A 2;  2WKK A;  2BPA 2;  4UF0 B;  1U5X A;  1V6K A;  2PHL A;  2Z42 A;  3VZJ A;  1WGP A;  1PMH X;  1PIV 3;  1DP0 A;  2P6C A;  5A3P A;  5DZG A;  1ENR A;  3RDI A;  1G9A A;  3TEW A;  4BK5 A;  1NKG A;  4ZZ8 A;  3RYR A;  4EWD A;  5JCT A;  4TXW A;  3AYA A;  2W52 A;  3UGH A;  5IWF A;  1EV1 3;  1QU0 A;  3MLJ A;  4Q4X 2;  1OQD A;  1LHV A;  2YY1 A;  4Y1Z A;  3VBF C;  1UOF A;  1X8E A;  1ULF A;  1VMJ A;  5LK5 A;  1QJZ A;  4M3C B;  3RI8 A;  2D6K A;  4XJU A;  2VOW A;  1ZX5 A;  4COW A;  3ITQ A;  5KXE A;  2VAU A;  3MIE A;  4RGA A;  1GP6 A;  1RGS A;  3C2U A;  2G1M A;  1ZVF A;  3KF5 A;  1W2U A;  4XE9 A;  2NYY A;  4U2A A;  2E51 A;  4Q1R A;  1BQP A;  3OD4 A;  1ZRI A;  4QPI A;  4OHX A;  2XLF A;  3EO6 A;  2MEV 3;  1BMV 1;  2ZJC A;  3KQR A;  1WZX A;  4LLO A;  3OBZ A;  3W21 A;  2D6L X;  5DUX A;  3VHP A;  4CEY B;  3S6P A;  2R06 1;  1MZ6 A;  1CGP A;  2F17 A;  2DCJ A;  5GZC A;  1NE4 A;  3HN1 A;  3E97 A;  4LBK A;  5FZA A;  2JD4 A;  2ET7 A;  3NRU A;  4ATE A;  2A7A A;  5AFB A;  4CU7 A;  4BH9 A;  3HT2 A;  2VBB A;  4ASK A;  1NA1 C;  4BLI A;  2ET1 A;  3FFZ A;  4R9C A;  4E8C A;  4BQ4 A;  3D3A A;  3DXU A;  1XNC A;  4CP1 A;  1DZQ A;  2RV9 A;  2QQU A;  3D6E A;  3SEP A;  3C7E A;  4ZON A;  1OUR A;  1VRH 1;  3K4Z A;  2WNO A;  2YRO A;  4JDM A;  4YPJ A;  3L2H A;  5FZO A;  3VDD A;  1G6N A;  5JR7 B;  1JYC A;  5GZD A;  4HSJ A;  4KH9 A;  1UZW A;  4QQH A;  3HNB M;  2FZ1 A;  3RGB A;  2Q4S A;  4YM1 A;  1WD4 A;  3AL6 A;  2RJ2 A;  3J9S A;  4CDU B;  1UYX A;  2FDG A;  1U5I A;  1RUH 2;  4YG0 A;  2XWB B;  3I2H A;  4XBL A;  3JB4 C;  3WY6 A;  3ZXA C;  5BY5 A;  1HRV 1;  3MEP A;  2VH9 A;  2IZW A;  5FUN A;  2BNN A;  4JHZ A;  3AZX A;  2ZOE B;  5KXD A;  1SHW B;  2MPF A;  1CPM A;  1RUF 3;  2E32 A;  2JG8 B;  3DYP A;  3RJR A;  4D7Y A;  4NN0 A;  1UZZ A;  5LCW L;  1OUX A;  2QKD A;  3URF A;  2ATF A;  4P5Y A;  3KM5 A;  2ZX4 A;  2QE3 A;  2HEW F;  2ZTN A;  4GKX A;  4QQL A;  4DRV A;  4ZHN A;  4QU2 A;  3VBF B;  1QJY 3;  1YUD A;  2WO2 A;  1HN0 A;  4IGO A;  5F37 A;  1C4R A;  1GWL A;  4CPB D;  3N9L A;  4QKN A;  5FZE A;  3RI9 A;  1BEV 2;  4I0B A;  4IEW A;  2WWJ A;  4AFM A;  1PO1 3;  1XYP A;  2R6Q A;  1UY4 A;  4QPW A;  5LBF A;  3O1R A;  1RUC 1;  1YQ6 A;  3AX4 A;  3BPZ A;  3IDC B;  5CNA A;  1AR8 1;  4OUE A;  5DZE A;  5A3W A;  5FY8 A;  1M06 G;  5FDB A;  4BOW A;  1SLA A;  1XNB A;  5EPA A;  4HAN A;  2OX0 A;  1AZD A;  2RMU 2;  3TN9 1;  1VBE 1;  3VBF A;  4CU8 A;  1RB8 G;  1CAU B;  5FZ8 A;  3WF1 A;  5K9Y A;  3GZE A;  3WHU A;  1YFY A;  4MXW B;  4FP3 A;  2VXJ A;  4XUO A;  1O3R A;  5BNN A;  5FYH A;  2K46 A;  1VBD 1;  4L9B A;  4KNC A;  3N9O A;  4DXS A;  5KC6 A;  3PU3 A;  4YRD A;  5DAX A;  4C1W A;  5BPX A;  1RIN A;  3T2T A;  2WBK A;  4P00 B;  4L97 A;  5EV7 A;  1MS8 A;  4BQ5 A;  4XMI A;  3AL5 A;  3CQO A;  1YEW A;  2BWA A;  2RS1 1;  4V1P A;  2WNU B;  4WVM A;  4AOC A;  3FJS A;  1FNY A;  2IXK A;  5CU1 A;  2VBP A;  2X29 A;  4QX8 A;  2JE8 A;  3HN3 A;  4LO8 A;  4DY5 A;  5C5U A;  2B5H A;  2HWB 2;  4N9H A;  4MXW A;  3WNN A;  1RUC 3;  2W5F A;  2Q1F A;  3BOD A;  1KEX A;  3ELN A;  5LAS A;  3R6S A;  1RMU 1;  1FX5 A;  4K8F A;  2BGC A;  2A6X A;  5EYX A;  2VW1 A;  5E88 A;  2HWD 1;  4P9X A;  3E6B A;  2R07 3;  4IL7 A;  2XKP A;  5DAW A;  4E2G A;  5FYZ A;  3THD A;  1H4G A;  3PJQ A;  4O7X A;  1UL9 A;  3VBO A;  2YFZ A;  2ZEX A;  1STM A;  4RA0 A;  1W6Q B;  5A33 B;  3WF4 A;  1FYU A;  2X10 A;  1POV 1;  1A8M A;  2P17 A;  2R32 A;  3AMN A;  4AI3 A;  1LGB A;  1F8V A;  3LPF A;  4XFC A;  1Q8Q A;  2VTX J;  1MS4 A;  2C6S A;  2JG8 A;  1LRH A;  5A7S A;  1ZZ7 A;  3R0R A;  3USU A;  1FPN 1;  1S2B A;  2Z2S B;  1G9F A;  2ERF A;  2YDE A;  3V65 A;  2X5I C;  1BVP 1;  2PN5 A;  2YU1 A;  5LBE A;  1GZ9 A;  4BYY A;  4FXK B;  1G8W A;  1QNY A;  1MS1 A;  1W2A X;  2XML A;  3PDQ A;  3DCQ A;  3DN7 A;  3FLP A;  3I59 B;  1PIV 2;  3GBG A;  2VG9 A;  3IIA A;  3ZX7 A;  1HW5 A;  4OUS A;  1PVC 1;  4XXP A;  1N1V A;  2I2S A;  1GFF 2;  1BBT 1;  1EPW A;  2XJS A;  3S7I A;  4DB5 A;  3WDU A;  3POI A;  2WSU A;  1J3Q A;  2QDR A;  2W47 A;  3OTF A;  4XUN A;  1HB3 A;  1ZNP A;  4W6Y A;  4YFW A;  1UMH A;  4YZ1 A;  1UKG A;  1FV3 A;  1LUL A;  4GH4 B;  4Y4R A;  5FYB A;  1Q8V A;  1W9W A;  4GUL A;  2QQJ A;  1B35 B;  1IKP A;  1CZV A;  1UXX X;  1VP6 A;  2W3J A;  3N3H A;  5GKA C;  5K0U C;  1AR9 1;  3NNF A;  3BIE A;  3WF2 A;  3T2Q A;  4EN0 A;  2HWF 3;  5JOW A;  2QQO A;  5HCH A;  4DUW A;  1S1A A;  1GMM A;  1WMF A;  5CEH A;  1DZR A;  4NPM A;  2XVG A;  2WZ8 A;  3T4H B;  3WP4 A;  4AZZ A;  4BA6 A;  4FQZ A;  1W6P A;  4KL1 A;  5LB6 A;  2ZGK A;  5IW0 A;  5C71 A;  2WQ4 A;  4URA A;  2A6Z A;  3EMR A;  2L9L A;  3LIG A;  1WA4 A;  3WDW A;  1FAY A;  2CGN A;  2B42 B;  2YXS A;  5BNP A;  1Y9M A;  3FLR A;  3O14 A;  1FOD 3;  1AR7 1;  3A0N A;  3AMM A;  1QKQ A;  5IVJ A;  5F32 A;  5GZF A;  4E2Q A;  4EZ4 A;  4ZPI A;  1BJQ A;  1H1M A;  2Y34 A;  3OBA A;  2IFW A;  5J96 B;  4AI0 A;  4FXG B;  4F8A A;  5K8S A;  3BI3 A;  4WM7 B;  1IS4 A;  2BRT A;  3SH3 A;  3ZR6 A;  1RIT A;  4CDW C;  3VBS C;  2JB4 A;  2GP5 A;  1UZ0 A;  3VBO B;  4D3W A;  5GLZ A;  3VGI A;  1HX6 A;  3LB9 A;  3O1V A;  5T5J A;  3CHX A;  1V9U 2;  1ULE A;  2CL2 A;  3MW3 A;  2R04 3;  1RUF 2;  2KXL A;  3UES A;  3U78 A;  2RR1 3;  4M4R A;  5FZ4 A;  5FMO S;  4YGD A;  3WNP A;  2UY8 A;  4QXC A;  1UNB A;  4XW3 A;  1MS5 A;  2VQ0 A;  4WZC A;  1UCX A;  2FCU A;  1AJK A;  1QJY 1;  1R08 1;  1W8H A;  2ES3 A;  2YU2 A;  2XGX A;  3J4U H;  2ZEW A;  1Z0H A;  2ZGT A;  1GQH A;  1PX3 A;  2D3S A;  4JQT A;  5FZH A;  1GZT A;  1PMI A;  2OZJ A;  2VR4 A;  2ZHK A;  4JGZ B;  3ZN6 A;  4A6S A;  4S2D A;  3HR9 A;  4HLT A;  5F5A A;  1AR6 2;  1JHJ A;  3GXU A;  1YHF A;  5BXX A;  3B9C A;  3M3I A;  4UW5 A;  2O1Q A;  5FXX A;  2YGL A;  1ZZC A;  4YZ5 A;  2R06 2;  1APN A;  1D2Q A;  2LUW A;  1XC6 A;  5C3P A;  4BDV B;  1ZZ6 A;  2EVX A;  3IT8 A;  2DTW A;  2P3I A;  4IEU A;  4CEW C;  2FBE A;  5J37 A;  2GNT A;  1B35 A;  4EZH A;  5FQ0 B;  4FPF A;  1H30 A;  1OPM A;  4CVU A;  5LEJ A;  1F5J A;  1AUY A;  1ODN A;  3VBH C;  4AQS A;  5F5Q A;  3IB3 A;  4NR1 A;  1F4H A;  3ZXL A;  4BIO A;  4PCR A;  3O1U A;  4WVV A;  2XUE A;  5FWJ A;  3OPW A;  5FR3 A;  4YW6 A;  1X82 A;  4QKB A;  3B69 A;  3B02 A;  2EXH A;  5H9R A;  4QPI B;  4F83 A;  2V4A A;  2XB6 C;  1RTV A;  1I5Z A;  3HIF A;  1YCI A;  1RVF 2;  3ZYP A;  2CWS A;  3RZG A;  1JZ3 A;  2OQ7 A;  2Y64 A;  2NMN A;  1ZRE A;  1HRI 3;  2Q8E A;  3K46 A;  3CNA A;  1XE7 A;  3LKJ A;  1CD3 G;  3TAY A;  3D4K A;  3ZSM A;  1JZ4 A;  4MGS A;  1VB2 A;  1W9T A;  4ES9 A;  1CJP A;  3SMH A;  1YLL A;  2R07 2;  3DEC A;  5DAV A;  1CJD A;  2WS9 2;  2XJU A;  3KF3 A;  4LUK A;  5LA2 A;  1XRU A;  1LU2 A;  2A3X A;  1FT9 A;  4QHO A;  4WM7 A;  2GSY A;  2EXI A;  5IK5 A;  3SCG A;  2WFP A;  5FP3 A;  2XHK A;  4OQ8 A;  2BU9 A;  4CEY C;  3P6B A;  1TME 2;  1UOJ A;  4LO5 B;  5GLV A;  5IFP A;  4LE3 A;  1MS9 A;  3AZZ A;  4M3C F;  3SKJ E;  5HXM A;  4GB3 1;  1DHK B;  1WWY A;  1W9Y A;  1UPI A;  4XFI A;  4HXC A;  5ACA 1;  5FBZ A;  2R04 1;  3D5O A;  4Y1X A;  1K45 A;  1REE A;  5EJ3 A;  1H0B A;  5F2S A;  1UQX A;  3LOI A;  2A73 B;  1UIJ A;  5FRA A;  4EN7 B;  3OYW B;  4QX3 A;  4V2W A;  1GIC A;  3RZL A;  4BB3 A;  4XUQ A;  4TYS A;  2WWS A;  1HV1 A;  3BCW A;  3NWK A;  1PZ8 A;  1ACC A;  4LJH A;  3VBS A;  2BFU S;  1YI7 A;  4FPE A;  5FO7 B;  3U0Z A;  3MV1 1;  1LR5 A;  3OGJ A;  2G9Z A;  4XTM A;  1ZRF A;  4EJR A;  3MIC A;  1ZRC A;  1GP4 A;  2A6Y A;  1OXC A;  2BOJ A;  1FOD 1;  4UFK A;  5IAT A;  5FY1 A;  1W8O A;  4XF1 A;  2FDJ A;  1KS4 A;  1FV2 A;  3KVB A;  2A6V A;  4YVW B;  3KV4 A;  3CIH A;  2XLA A;  3V0A A;  1AXZ A;  3O0X A;  3IMN A;  4JTN A;  4QQ2 A;  4AI8 A;  4QGN A;  1OA2 A;  3B01 A;  4QQO A;  3RNS A;  3GZA A;  2XJP A;  4JGY B;  2SLI A;  3PVO A;  1O8P A;  1QQP 3;  5FBJ A;  5FMO L;  5FZC A;  3BU0 A;  4LOT A;  1Q8P A;  4JKL A;  5KHI A;  3J26 N;  4AED B;  2VMC A;  4FOQ A;  2O8Q A;  5FK8 A;  5FXV A;  5ABJ C;  5L7O B;  1AYM 3;  5FMB A;  3AZY A;  1EV1 2;  3MHZ A;  1YNA A;  1TQ5 A;  3MGU A;  4CCD A;  3K77 A;  1LTE A;  4OMC A;  3AXD A;  3D0S A;  1FI2 A;  4PT6 A;  3UGF A;  4Y5S A;  4AYU A;  4P02 B;  1AYN 3;  1QY4 A;  4E8D A;  2R49 A;  5A1L A;  4LKE A;  5C3Q A;  3WCR A;  1VLN A;  1Q3E A;  2AEY A;  4Q0V A;  5A7W B;  1H9W A;  3WQB A;  2WQZ C;  5JDB A;  4QGL A;  4X6R B;  1UMI A;  2RS3 3;  5EP9 A;  4CXW A;  4XIK A;  3LSD A;  2WDB A;  3NAP C;  3CLP A;  3IKW A;  4K1Z A;  2YBK A;  1NA1 B;  2W46 A;  4TZD A;  1X7N A;  2B4K A;  5FTT C;  1S0D A;  1O3Q A;  3CEW A;  2WYF A;  4S2G A;  3WDX A;  2XJQ A;  1SLI A;  4C1X A;  3LDB A;  1HXS 1;  1ZBA 3;  5D21 A;  3UGG A;  2TBV A;  1K5M C;  4CUA A;  3J7M A;  1DLL A;  2W91 A;  2ZAA A;  1LOA A;  2PYT A;  3RZM A;  3I4I A;  3GNE A;  1C1F A;  4QHB A;  2OVU A;  1SCR A;  2F6B A;  4K20 A;  1KS5 A;  3PUA A;  4QXK A;  5C9A C;  5LRS A;  1J59 A;  4NRO A;  3TB0 A;  1YO8 A;  4KU7 A;  4DEQ A;  1RUE 1;  3FZ3 A;  2BEO A;  5E1R A;  1G7Y A;  1WME A;  2NQY A;  3S0M A;  1OQ1 A;  1JYT A;  4Y1U A;  2VZU A;  1RXF A;  2XDV A;  1RUH 3;  2JDH A;  3WW1 A;  2K0G A;  1BYH A;  2UYA A;  4LUM A;  2C1F A;  5FUI A;  1LKN A;  1U5Z A;  2CY6 A;  4I2O A;  2LAL A;  1UW8 A;  4Y3O A;  3NV3 A;  1AX0 A;  3Q8F A;  5ANQ A;  1LJ7 A;  2Q8D A;  1DFQ A;  4OLL A;  3V56 A;  4B29 A;  4JRL A;  2WLP A;  3N9P A;  2WAA A;  2CGP A;  2GN7 A;  3U10 A;  3ZR5 A;  2EAK A;  2WT0 A;  3TN9 2;  4WM7 C;  3T1L A;  3E5Q A;  1ULG A;  4R52 A;  2VCA A;  3KV6 A;  4M3C E;  1AX1 A;  2B45 X;  4N90 A;  2AEN A;  4XYX A;  4AAP A;  4BIS A;  1JZ6 A;  4FOV A;  1VBC 2;  4UBG A;  4QB6 A;  5JUV A;  2WYS A;  1EUT A;  4LO6 B;  2IC1 A;  3Q9O A;  3NW4 A;  1XND A;  4PDW B;  3FUO A;  1JYX A;  3OY8 B;  5FLJ A;  4IGQ A;  4XQW A;  1OI6 A;  4BE3 A;  5BNP C;  5EJZ B;  2RG4 A;  2ZA9 A;  1AHS A;  3ETP A;  1G9B A;  5FQ0 A;  1QGL A;  1I9R A;  1XBF A;  1YQ5 A;  3ES1 A;  4GAL A;  5D8A C;  2C0Z A;  4AHZ A;  1YFW A;  4U36 A;  4GA9 A;  2J42 A;  5HCB A;  5BUV A;  1QJE A;  1JYW A;  4JC1 A;  4EN9 B;  2PHR A;  2V09 A;  4CTE A;  4IV3 A;  3KS7 A;  3ACG A;  3SQO A;  4ASL A;  5L7O C;  3FHI B;  2DVA A;  4XDP A;  1GZW B;  3E1F 1;  4HN0 A;  3I54 A;  1SDW A;  3O1O A;  1SBE A;  4K9S A;  4Q8L A;  4XEZ A;  1UYY A;  2JDP A;  2PLV 2;  4LKS A;  5FZL A;  4DXT A;  4FAG A;  2XWJ B;  3KT4 A;  4OVE A;  3WNX A;  1QJX 3;  1LOC A;  3PTR B;  3JZV A;  1YWK A;  4KGQ A;  2HWF 1;  4OUL A;  3R4D B;  1TME 3;  2GNM A;  1QQP 1;  3ACL A;  3BB6 A;  5T55 A;  2P2K A;  5ANN A;  5EFU A;  3K3N A;  1J58 A;  3LF7 A;  3NL1 A;  4Y24 A;  3UV9 A;  4ARY A;  2E6V A;  4Z1V A;  2ZGN A;  4YVW C;  5K7P A;  5A3U A;  4GKY A;  4JV4 A;  5T50 A;  2VY0 A;  1GUI A;  1K5M A;  1JYI A;  2HWB 3;  4NE9 A;  2RR1 1;  2DTY A;  1RUH 1;  4DXZ A;  5LBB A;  1HRI 2;  3U4X A;  3ENR A;  2WWU A;  3HPN A;  1V6O A;  2PHT A;  5BNO B;  2VBD A;  1W0O A;  2DF7 A;  3PVN A;  4CDQ A;  5F39 A;  4R4Z A;  2EAL A;  4PJY A;  4AQ6 A;  4FI9 A;  4L92 A;  5CA6 A;  3WDY A;  5C3O A;  5JR2 A;  2TUN A;  1XE0 A;  2W1W A;  3OF1 A;  5FYS A;  4D94 A;  2Y0I A;  1WKY A;  4LUL A;  1XU2 A;  4AAX A;  3VZK A;  2HYX A;  2CSG A;  4FPC A;  5A7Q A;  3E5X A;  1HIX A;  4FPO B;  3TNP B;  5HCA A;  4AI1 A;  1MVE A;  4LKD A;  4QM8 A;  2FDI A;  1IHM A;  3CMG A;  3GF6 A;  1K5M B;  1BBT 2;  1UD1 A;  4GXL A;  3WCS A;  3K4D A;  2IXC A;  4CDU C;  4XJ9 A;  1PZ9 A;  1OH4 A;  1IS5 A;  5JMO A;  2DUQ A;  2YBP A;  4GMP 1;  4I3G A;  3E5U A;  1QQP 2;  3KHC A;  2XKO A;  4IV1 C;  4OI0 A;  1C28 A;  3RMY A;  4N8M A;  3ZLI A;  4JGZ C;  4CCK A;  3WVJ A;  4UFH A;  4AXO A;  3OBT A;  3UNP A;  3F95 A;  3KGZ A;  1UOG A;  4XF0 A;  1AYM 1;  5L36 A;  3QH6 A;  4AFD A;  1SZB A;  4BXS V;  2CNA A;  4K40 A;  3OG2 A;  1UMZ A;  2ZGU A;  4Q0Q A;  4FAH A;  4L0P A;  4M4P A;  3HBZ A;  4J1X A;  3RQ0 A;  5CIS A;  3J8F 2;  1IQA A;  1IG0 A;  4HVO A;  3NNG A;  2H6B A;  4RGG A;  1GQP A;  5DUV A;  4NII A;  1A78 A;  4LBO A;  2RJK A;  4UW6 A;  4COU A;  4IEQ A;  4TLF A;  2ADD A;  4UFI A;  3CDZ B;  4LEJ A;  4A2U A;  4FOY A;  4FT8 A;  2WNU A;  4IV1 A;  1W8N A;  2XVK A;  4JX0 A;  4NHX A;  5FCC A;  2WZP P;  2IXI A;  3RYK A;  1LHU A;  3FHQ A;  4IE0 A;  2E63 A;  1S4C A;  4IEP A;  1XQN A;  1H9P A;  2WZR 3;  4QDQ A;  2OUH A;  2JG9 A;  4XTP A;  3OGS A;  1VB4 A;  3WIN E;  3MIB A;  1RC6 A;  5IK4 A;  1HQN A;  5EJ1 B;  2W0X A;  4H2A A;  4LBM A;  3VKO A;  5CKQ A;  4AL9 A;  4TLG A;  3KT7 A;  3QH7 A;  4AVT A;  1Z7S 1;  1HLC A;  5CKM A;  1RUO A;  1H6Y A;  2CAU A;  4AI2 A;  2BZD A;  4LTA A;  4CUC A;  2Y8K A;  1H2K A;  4ISQ A;  4Q4Y 1;  4CUG A;  3RMX A;  3HBK A;  4R8H A;  1GWK A;  1OVS A;  3PUR A;  3NJX A;  1OUS A;  1QH7 A;  4Y26 A;  4B3N A;  1O59 A;  5J1X A;  3VKL A;  4HT1 T;  2BGO A;  5EHD A;  4KI5 M;  4A45 A;  3VL9 A;  1RUI 3;  2W95 A;  4YYO A;  5A7P A;  1OQE A;  1JBC A;  4PI2 A;  2JEM A;  3H7J A;  3O7O A;  2RDS A;  5C4W A;  2ETE A;  1W8T A;  2AC1 A;  2YC0 A;  3ES4 A;  2DFC A;  4YGE A;  2X5I B;  4ASM B;  1A34 A;  3RJ2 X;  1QJY 2;  3VDB A;  3C3V A;  2AH2 A;  3EBR A;  1L3J A;  3ZVX A;  2CDP A;  1DGL A;  4W8J A;  1HB2 A;  3VDA A;  5HBA A;  3O1M A;  3UJQ A;  2VPV A;  1RUF 1;  2PQQ A;  2BBA A;  1SFY A;  5KR7 A;  2QCS B;  4Q8K A;  1XJA A;  4FFH A;  1KFX L;  4CDU A;  4XAA A;  2ARE A;  2RR1 2;  4GJY A;  4HOO A;  4AK3 A;  3AFK A;  1RUI 1;  5BV6 A;  1V6M A;  1POQ A;  4CCN A;  2R16 A;  3H9A A;  1I1E A;  5CFD C;  1VAL A;  1UY1 A;  3NV1 A;  2ID4 A;  3VBS B;  2RDR A;  2W92 A;  3BOW A;  3RZZ A;  5C9A A;  3WZ1 A;  1ZA7 A;  3UYJ A;  4YVS B;  1OT5 A;  4Z8B A;  1OH3 A;  1ULO A;  1DDL A;  3AP7 A;  3OUI A;  1H8T B;  3POS A;  2Y6K A;  5D1I A;  5G05 L;  1S2K A;  5FZD A;  2Q8C A;  4BJ0 A;  4QM9 A;  2XL7 A;  3JUU A;  1UU6 A;  1NXD 1;  4AFA A;  2FMD A;  1JOP A;  2JD9 A;  2RDQ A;  2XH6 A;  1KFU L;  4TTG A;  3WXP A;  1CAW B;  4Y22 A;  4Z92 B;  2PFW A;  1V9U 1;  1XYN A;  5FPB A;  3MUY 1;  2LRP A;  3WG1 A;  5FMD A;  1PO1 2;  2VCB A;  4X8P A;  4BLJ A;  1GYK A;  2GND A;  4LOR A;  5HV4 A;  5FY7 A;  1OA3 A;  1IPS A;  3I2I A;  4IQP A;  4YW1 A;  1K12 A;  2R30 A;  2PHX A;  1COV 1;  5IUQ A;  2E53 A;  5A7W A;  3TN9 3;  3RS6 A;  1J3R A;  3FFQ A;  2P3K A;  2QQV A;  4LT5 A;  4YZ4 A;  3ASI A;  3ZFF A;  1GOG A;  5JXJ A;  5I8Y A;  4AED C;  4QPG B;  1PVC 2;  4CXY A;  3NJY A;  3LQC A;  2KA3 A;  5CAD A;  3FUQ A;  1W6N B;  4ERO A;  1QJF A;  1AYN 1;  5CZK A;  4ZXE A;  1S2E A;  1LOF C;  1Y4W A;  5K0U B;  2QQP A;  4EWE A;  1D0H A;  1KGY A;  2JIC A;  4UW3 A;  2PAM A;  4Q27 A;  4YW5 A;  5FYI A;  5A33 A;  2ZPX A;  4UOJ A;  5HPO A;  4PLN A;  4ARX A;  1MZE A;  1I3H A;  4AVC A;  3KT1 A;  5JOY A;  2XJR A;  2G9F A;  4MET A;  5FZ6 A;  5FYY A;  3O1P A;  4YWA A;  2JXA A;  3TYJ A;  4FTE A;  2XBO 2;  3ZKY A;  1WCU A;  4ET7 A;  4CU6 A;  3GBF A;  2WSV A;  1YIF A;  2GMP A;  2D44 A;  1KD7 A;  2BGP A;  1PIV 1;  2YB7 A;  5IVB A;  2FDF A;  1BVV A;  5LA9 A;  1RUD 1;  3H8R A;  1XU1 A;  2XUM A;  1KDM A;  4KMQ A;  4D6S A;  1HV0 A;  5FP4 A;  5A6Z A;  5A3L A;  3JBG 3;  3KCC A;  1JN2 P;  4PI0 A;  4A4A A;  5ISL A;  4QPG C;  5B4X A;  3I97 A;  4TSV A;  1ND3 C;  2VO5 A;  2WA4 A;  3MZH A;  5FZ0 A;  4IE6 A;  4LHN A;  1H6X A;  1OBN A;  5F1R A;  5IFT A;  4MGZ E;  2PA7 A;  4XAE A;  4KWK A;  2QFE A;  3ZFE B;  2JB8 A;  4RR3 C;  4RHV 2;  2WO3 A;  2RS1 2;  3IM0 A;  4CCO A;  5ACA 3;  3M3E A;  1RUJ 2;  4N53 B;  4DFS A;  4UYB A;  1NX9 A;  2BNO A;  1A8D A;  5CVR A;  4NHY A;  3ACH A;  1Q56 A;  5DUW A;  3KSC A;  2FZ2 A;  2V5Y A;  2QVS B;  3III A;  4QX1 A;  4HK9 A;  1C8M 1;  1N3P A;  4Q0P A;  3HT1 A;  3I3Q A;  1ULC A;  4PDW A;  1MZ5 A;  1OF3 A;  3AM2 A;  2BW8 A;  3NKT A;  3ZN4 A;  4YVS C;  2DFB A;  1NT0 A;  1Y3T A;  3G7D A;  5LBC A;  5CG8 A;  5FYT A;  4Q4Y 2;  5DG2 A;  1LU1 A;  1ZBE 3;  4NIG A;  4GWJ A;  2EXJ A;  1XSR A;  3WDT A;  4Q0S A;  2ZS6 B;  2AGS A;  3MIG A;  3WX5 A;  5JZG B;  3THP A;  1ASJ 2;  1CIW A;  3K2O A;  3HD8 B;  4NPL A;  1UY2 A;  1R1A 1;  2DCY A;  4PLO A;  4GD4 A;  1KQR A;  4HVQ A;  1VBD 3;  4I02 A;  3GBW A;  5LW9 A;  2KM2 A;  4IE4 A;  1ND2 C;  2UWC A;  2JEC A;  2VZQ A;  1EP0 A;  4AI9 A;  1Y9G A;  3AMQ A;  2UWA A;  2VOT A;  4IV1 B;  1Y43 B;  1MAC A;  4PF1 A;  2ZGQ A;  3NNM A;  4MVT A;  1J3P A;  2VVE A;  3VDC A;  1RUD 2;  3WOG A;  5KHG A;  1W6P B;  4KBZ A;  1YIP A;  4CSW A;  3VBU B;  2WNV C;  3KZ4 C;  2A3Y A;  5LAT A;  3AJZ A;  5FO9 B;  2WNV B;  3DPR A;  4QPY A;  2YHJ A;  5FLH A;  2E33 A;  3RRD A;  4NAO A;  4QDR A;  1VBD 2;  4XCB A;  2YBS A;  2EIC A;  2ZEZ A;  5A6Q A;  3M70 A;  4RQP B;  2B46 X;  3I49 A;  2WZR 2;  5F3I A;  5LZ6 A;  1K3I A;  4XCA A;  5AVP A;  1LOE A;  3IDA A;  1O91 A;  2Y26 A;  3O12 A;  1VBB 1;  3ATG A;  3LOB A;  2D6N A;  4KWJ A;  3DEM A;  4PBP A;  4UBH A;  4E27 A;  4YW3 A;  1NCQ B;  4FPY A;  4YM3 A;  2NLR A;  4DNY A;  1JMU B;  3CL1 A;  2JDY A;  2ZHM A;  3PME A;  1US3 A;  1W6O B;  4GAZ A;  1RJ7 A;  1PO1 1;  5FJK A;  3VD7 A;  3BTY A;  5AC9 3;  4QB2 A;  2DUO A;  2C26 A;  5H9P A;  2VME A;  3VHR A;  4LQR A;  2JE7 A;  5E16 A;  3VBU C;  5T5P A;  3BN6 A;  3ZFG C;  2UU8 A;  1NXM A;  1UY3 A;  2V4V A;  1MQT C;  1KJR A;  1EYB A;  1Q5O A;  2A5Z A;  2SBA A;  4KWL A;  5J98 B;  1UXZ A;  2D5H A;  2XQX A;  5C33 A;  5CFC B;  4QPG A;  1OOP B;  4JGY A;  4GWM A;  2JDK A;  4P08 A;  2YFU A;  3WUC A;  2PAK A;  3O5S A;  1NLS A;  4P5H A;  2PEL A;  3DKQ A;  3SH5 A;  1D4V B;  1HRI 1;  2VZR A;  2WZE A;  1PZ7 A;  2ZCW A;  4JCK A;  4AED A;  1L7R A;  2GH2 A;  5CKN A;  5A6Y A;  3WT3 A;  3N7J A;  2NZ9 A;  3M2M A;  3TNQ A;  3PUH A;  3R4U A;  1OOP A;  1SLT A;  4CP9 A;  3MBW A;  3GHM A;  5A1A A;  2R7E B;  4IEO A;  2R06 3;  4JQR A;  2PTM A;  2XJT A;  3LAG A;  2IWG B;  4QX7 A;  4UFL A;  1PVX A;  3CKH A;  1CAW A;  4BQ3 A;  3E6D A;  3ACF A;  3ZYB A;  5JSR A;  1GV9 A;  2AUY A;  2BDR A;  5LRR A;  3HNM A;  5IVC A;  3TEX A;  3BTZ A;  1VBA 3;  3B3Q E;  4RD7 A;  3VBR B;  4AVV A;  1PK6 B;  1R09 3;  1LEC A;  1N3Q A;  1XB9 A;  3NQH A;  4QX2 A;  5JOZ A;  1UZY A;  5AVA A;  1ZZ9 A;  2HBU A;  1VBE 3;  4XF4 A;  2WII B;  3VZL A;  5CIR A;  4D69 A;  3IPV B;  2ENR A;  3N36 A;  1CX4 A;  3I8T A;  4Y33 A;  2XBO 3;  4AHY A;  4CCJ A;  1W06 A;  4F3J A;  3LA7 A;  3OYW A;  2FDH A;  3A22 A;  1VRB A;  1W2T A;  3GZT B;  4CP9 B;  1JXN A;  1YQ2 A;  3DPR C;  4PHZ A;  3Q8A A;  1FNZ A;  3OGG A;  3WLU A;  1IGO A;  3K4A A;  5SV8 A;  2LRO A;  1K42 A;  2D93 A;  4W50 A;  2FD8 A;  4COV A;  1IG3 A;  2J7M A;  5H9S A;  3AP5 A;  4QB1 A;  4S2F A;  5JSP A;  1O5L A;  1VPH A;  3JBG 2;  4JRA A;  1Z7S 2;  3KQ4 B;  4DY3 A;  1BEV 3;  1MR5 A;  5G04 L;  3SH4 A;  5DMY A;  4OZO A;  3WHT A;  5F8P A;  4XVH A;  4DIN B;  4UW4 A;  1QNW A;  3NJZ A;  4OYU A;  2JG8 C;  1JYN A;  2Q5T A;  1MVQ A;  2WO7 A;  4FFG A;  4I3P A;  5FY9 A;  1SMV A;  3W20 A;  2RVA A;  2WA3 A;  4QWN A;  2IXH A;  4RQP C;  1VR3 A;  5C4W B;  3ZN5 A;  2P3J A;  4AQ2 A;  2VMG A;  5EQU A;  4O65 A;  4HON A;  1Z7S 3;  1S0J A;  5FZ9 A;  1F5F A;  2DDU A;  1M4W A;  3NVC A;  4BK4 A;  2N7G A;  2XOM A;  1BCX A;  2ZBJ A;  4CEW A;  3A23 A;  2GC2 A;  3H50 A;  4I30 A;  5GAL A;  1V6I A;  1IKQ A;  3TEZ A;  1U0A A;  2OA2 A;  5LY2 A;  2P34 A;  3W5M A;  1WD3 A;  2J1T A;  1N3O A;  3HMY A;  5FY5 A;  1AYM 2;  4K6B A;  2QQN A;  4CA9 A;  1F15 A;  2DV9 A;  5GZE A;  1W99 A;  4Q0U A;  1H1I A;  1WCD J;  3SC7 X;  2QJV A;  3DV8 A;  1H2L A;  2J1V A;  1PHM A;  2MEV 1;  1HXS 2;  2VNR A;  4QX0 A;  2H0B A;  4NRM A;  5FP8 A;  3WP5 A;  1ZA4 A;  1LOF A;  4A6O A;  1W0N A;  4RR3 A;  5JWP A;  2VCC A;  2ARX A;  2OZ6 A;  2RS1 3;  4C91 A;  3OPT A;  1NAE A;  1L7Q A;  3SXW A;  4Y22 B;  3H42 B;  2ZX1 A;  1GZC A;  4D7T A;  5AFE A;  1EY2 A;  4YFZ A;  4MGT A;  1QJU 2;  4BCU A;  4UWD A;  2CAV A;  5GJ6 A;  5ABJ B;  3ZXF A;  4IEZ A;  1W9S A;  3N9M A;  3ZIX A;  2QTW B;  1OA4 A;  2XLG A;  4NPR A;  2ADE A;  3OEB A;  4HKO A;  4BQ1 A;  4JHT A;  4MX3 A;  3EYP A;  2JIJ A;  5FOB B;  2A1X A;  3G6J B;  3T1M A;  3K75 B;  1JYV A;  3ETQ A;  4J1W A;  3AJY A;  5A3M A;  3INA A;  1COV 2;  3LDR A;  2RMU 1;  5CBL A;  2CGO A;  2ZMN A;  3W9A A;  2ZX0 A;  3VD3 A;  4P9J A;  4LBJ A;  5LEK A;  1AR8 2;  3MLL A;  1C3H A;  3GJB A;  1AYN 2;  4QXH A;  3CBN A;  4XAC A;  3WF0 A;  2G9G A;  3PUI A;  1VE0 A;  4RS5 A;  2HYK A;  3JU9 A;  1ND3 B;  1RHI 3;  2WN3 A;  2HWE 3;  3I2K A;  1O3T A;  4NMI A;  3VZN A;  5CFD A;  1VBC 1;  3ZXG A;  4IEY A;  1EAH 3;  3C7O A;  1ND2 A;  3IN9 A;  4V2V A;  1LGN A;  4IUG A;  1YXW A;  2B7Y A;  3MFC A;  1XYO A;  1W9F A;  3MIF A;  5A7N A;  1AR8 3;  4GWI A;  2VD7 A;  1RUE 3;  4Y5Z 0;  3T0A A;  3C7G A;  4B7K A;  1DF0 A;  3V0B B;  2WN2 A;  3ZDV A;  1G9C A;  1LOG A;  3NNL A;  1LOB A;  1YI9 A;  5T54 A;  1FOD 2;  5FZK A;  4JDO A;  1OFS A;  4AFB A;  1QEX A;  1JU4 A;  2VZS A;  1TMF 2;  2E9Q A;  2NPI A;  4Q4W 2;  3I3D A;  4YG3 A;  1F31 A;  2GAU A;  5IK7 A;  3SHR A;  3FE5 A;  1PM4 A;  1SLC A;  3MF9 A;  2B9U A;  1KDK A;  3LEK A;  1UWW A;  1DZT A;  3EQE A;  3AKT A;  5L9B A;  3VL8 A;  1VBC 3;  2JDU A;  2HH9 A;  4Q4V 3;  4EQV A;  3J7H A;  1JZ8 A;  3AVR A;  1VIW B;  4A44 A;  1NCR C;  4EWA A;  3ZXJ A;  4E4D X;  5FJH A;  4EN6 B;  5JSO A;  3ZFE A;  5E8A A;  2YC2 A;  1SAC A;  3AP9 A;  1DGR N;  2R04 2;  3ILN A;  4IV3 B;  4N43 C;  5IYY A;  1CX1 A;  1AR7 3;  2OXB A;  4H7L A;  1RUN A;  3D82 A;  4C90 A;  3LZZ A;  5JXG A;  1OC1 A;  2YZ4 A;  5JZG C;  5FZM A;  4HL0 A;  2ZMK A;  2NN8 A;  5FPA A;  1HJF A;  1QH6 A;  2OQ6 A;  2WQ8 A;  1QF3 A;  4C8D A;  4IEV A;  4O9G A;  5CAZ A;  5J7M A;  1GNH A;  1DQ2 A;  1UYP A;  5JOX A;  1UPS A;  2QZ3 A;  1LEN A;  3QBQ A;  1ST8 A;  2GDF A;  2JIG A;  2D98 A;  1SQ4 A;  1MEC 2;  2GC0 A;  4YM2 A;  5A1F A;  2FHR A;  5JMC A;  4P14 A;  3T4V A;  4NOT A;  4BQY A;  2R1B A;  3JCI A;  5L9V A;  3TEY A;  1ENQ A;  3JXS A;  1DQ4 A;  2G19 A;  3M3C A;  3VD4 A;  3BVC A;  4K21 A;  4ONU A;  5H9Q A;  2D6O X;  5JZG A;  3KCX A;  3POW A;  4Q4X 1;  1RUJ 1;  1SPP B;  3L9J T;  3ZOI A;  4E2S A;  2GNB A;  4QGM A;  2VMD A;  2YPD A;  5FZ1 A;  4FTS A;  3MIH A;  1GNZ A;  1OPO A;  4XOG A;  3AVS A;  2VZT A;  4ITC A;  1MEC 3;  3ZFE C;  5AC9 1;  4COY A;  5T5L A;  5BNQ A;  5FPX A;  3MPP G;  3N35 A;  4WM8 A;  4OCT A;  3PVE A;  1ENS A;  2ZKN A;  3SCF A;  2WFF 2;  1LHN A;  3HQX A;  1FXZ A;  1WMD A;  2AEZ A;  2MNG A;  2XXZ A;  3T0D A;  1SDD B;  2WAB A;  3OPZ A;  4CZS A;  4QQP A;  3JQW A;  1OHF A;  3K3O A;  4BQW A;  3NAP B;  1R08 2;  1RUG 2;  1NCQ A;  4Q1P A;  4YVW A;  3POE A;  1G86 A;  4A7Z A;  1W6O A;  3POG A;  4TWT A;  1BBT 3;  4RQP A;  1UYZ A;  2VJX A;  1O4Z A;  1FMD 1;  2ZZJ A;  1S0E A;  3ILR A;  4N43 A;  4LBQ B;  3CJI C;  5L73 A;  2WFF 3;  3BYW A;  3MO4 A;  4OUM A;  2VXR A;  3TOJ A;  4BHP A;  3EJK A;  3NNJ A;  1HB4 A;  1HKD A;  3AFG A;  4RYD A;  5FPZ A;  4XFG A;  5C8C C;  2YPJ A;  3CZJ A;  3V64 A;  1CWP A;  4CCC A;  3GZU C;  4K8R B;  3H0O A;  4IV3 C;  4N43 B;  1POV 3;  2XR4 A;  2NM1 A;  3DL3 A;  5K4L A;  2I45 A;  1REF A;  1W28 A;  4A3Z A;  1TNR A;  2E7Q A;  2QQW A;  1IZ3 A;  1GP5 A;  1RVF 3;  2XJV A;  4AHW A;  2YYO A;  1FMD 2;  2GMM A;  4LPL A;  2ZGR A;  4W6W A;  1RUJ 3;  1HQL A;  5FZG A;  3MW4 A;  2OII A;  1O7F A;  4HPK B;  1H4H A;  2ZAC A;  5C3R A;  5IJR A;  1VBA 1;  2W08 A;  2IUW A;  3VUO A;  2VVD A;  3WSO A;  2VNV A;  1LHO A;  4BIF A;  5FPV A;  2VE1 A;  1SEF A;  3U4S A;  3HQU A;  5JI9 A;  1OMI A;  1V70 A;  2R0H A;  3JD7 2;  3POF A;  2O0O A;  3ME2 A;  1E5H A;  3HEI A;  1NUK A;  1COV 3;  2P4E A;  3VBH A;  1UF2 C;  1NY7 2;  5FKC A;  1PM7 A;  4NIA A;  1QOS A;  4DUV A;  3H3U A;  2QUO A;  4W4Z A;  3THC A;  3ZDS A;  4AQT A;  4G9S B;  3VDD C;  2HLE A;  1KJL A;  2BJS A;  3LFI A;  2Z5W A;  5C7G A;  2KD7 A;  3J8F 3;  2EIB A;  4LBQ D;  1JU3 A;  3FN9 A;  5FZ3 A;  1RUI 2;  3LIH A;  2RE9 A;  1DYO A;  4LHL A;  4UXA A;  4XAB A;  1H2N A;  1OKQ A;  3ZYJ B;  5I0S A;  2C9K A;  1RHI 2;  2P1B A;  3PU8 A;  4GB3 2;  3ALQ A;  2D7F A;  3X29 B;  3PVB B;  2RS5 2;  1QJU 3;  3A21 A;  3IPV A;  1LEM A;  3LSE A;  1SFP A;  3DGT A;  3PTY A;  1OLM E;  2W1S A;  3GCX A;  1VAV A;  1POV 0;  4XJ8 A;  1JUH A;  3ZXE A;  1ODM A;  3VZO A;  4Q4V 1;  3ZFG A;  1XNA A;  4LO4 B;  4NUB A;  1PNF A;  3PMS A;  1RUE 2;  2I74 A;  3WW4 A;  1RUD 3;  1V6L A;  2WLQ A;  2VZ3 A;  3Q8E A;  3TWI A;  1GR3 A;  1C5I A;  3H3Z A;  4LIV A;  5IVE A;  1IQD C;  2WS9 1;  4N7I A;  5T52 A;  4BU2 A;  5C9A B;  3O1S A;  1W3V A;  4GB3 3;  1YRZ A;  2HWB 1;  2X05 A;  4JZR A;  2HWC 2;  5FRE A;  3K51 A;  4AFC A;  2V5D A;  1ENX A;  1MS3 A;  3H8O A;  3C7H A;  2C9A A;  1W0P A;  4LA2 A;  1NQD A;  3OCP A;  4QKF A;  5E6H A;  5GZG A;  4YGB A;  5D8A B;  3Q8B A;  1DQ0 A;  1F2N A;  2VOX A;  4WVW A;  4OI2 A;  5A80 A;  4CDQ C;  2WC2 A;  2VQA A;  3I59 A;  5LA1 A;  4NHK A;  4ZXK A;  2VEC A;  5A3T A;  3POY A;  3JQX A;  4K1Y A;  3WV6 A;  5F3E A;  4CE8 A;  5FK7 A;  1OSG A;  1VRH 3;  1AL2 1;  3QLQ A;  4CCM A;  4GZ9 A;  4O61 A;  2H0V A;  4XFB A;  2NP0 A;  2W1U A;  1X33 A;  2PHF A;  4Y1V A;  4OHZ A;  1X36 A;  4CEW B;  3ZM8 A;  1TE1 B;  3N7L A;  4QU1 A;  1TMF 3;  2K9Z A;  4XF9 A;  5T3N A;  4H3W A;  2WT1 A;  4LE4 A;  2EXK A;  1O4Y A;  2ORZ A;  3LA3 A;  4MLO A;  2DVF A;  3SKV A;  2HKX A;  4GIQ A;  4XIL A;  2X53 S;  2A75 A;  3FC0 A;  4XZP A;  2XL9 A;  5I0T A;  3AZV A;  4LXL A;  4UF0 A;  1B09 A;  1H8T A;  3HOB A;  4B4P A;  4NWV A;  5FZI A;  1W39 A;  3ILF A;  4AEJ A;  4COZ A;  2O8O A;  1K5J A;  3FBY A;  1RED A;  2GAL A;  1BHG A;  3BIW E;  2AZ5 A;  3JB8 A;  1UN1 A;  5ABJ A;  3POB A;  4GH4 C;  5FV3 A;  5BNO C;  5C5T A;  2VZ1 A;  4O9E A;  5FZF A;  4LHS A;  5GLT A;  2ZXQ A;  1EV1 1;  1GQG A;  1SFN A;  1VBA 2;  4SBV A;  5HXV A;  4FBF A;  1R09 2;  1WW7 A;  2WNV A;  3DPR B;  3AZW A;  4ZKT B;  4AGV A;  5FKB A;  2HBT A;  1PGW 1;  3DYO A;  4HBN A;  4OHY A;  2WRA A;  3ZYG A;  5L19 A;  5IVV A;  2JJ6 A;  4IND A;  3VDD B;  4HVR A;  1T2X A;  3RWN A;  5A32 B;  5J09 A;  5FIX A;  1J84 A;  1R08 3;  2WJS A;  5KHH A;  1S0G A;  2Y6H A;  2Y60 A;  4Y20 B;  3ZYH A;  2FCT A;  1S0F A;  1X9P A;  2RM2 3;  4MH0 E;  2YMZ A;  3VBU A;  1PNG A;  4B4Q A;  2WL1 A;  2YC4 A;  3WP6 A;  1VMH A;  3VKM A;  3WG3 A;  2XQR A;  4AVB A;  3VD9 A;  2W87 A;  1JOD A;  1PK6 C;  2JDA A;  3B00 A;  4WM8 B;  5A3N A;  1UOB A;  5B4N A;  1U12 A;  1GOH A;  2J1S A;  3N7K A;  3I3E A;  1LED A;  3CO2 A;  1OLR A;  4HKL A;  2UWB A;  1JW6 A;  3LA2 A;  2C24 A;  4PIY A;  2OS2 A;  3I7D A;  5EYY A;  4DQA A;  3WW3 A;  4EV0 A;  3NAP A;  1PGW 2;  4IER A;  2Q0A A;  1UIK A;  4Y1Y A;  3MI8 A;  3Q8C A;  2FCV A;  2Q30 A;  3OUJ A;  2GME A;  1GWM A;  4OHV A;  4QXB A;  4SLI A;  4WV8 A;  4XUT A;  2ZX2 A;  2DVB A;  3W58 A;  5BNO A;  1CAU A;  1WCQ A;  3BAL A;  4WVZ A;  2IXJ A;  2R07 1;  4OZX A;  5DPN A;  2WT2 A;  2RS3 1;  5F9T A;  2BWC A;  1CIY A;  1H8T C;  1IS6 A;  2P37 A;  3FL7 A;  4HN1 A;  4MG2 A;  1NYW A;  2GZW A;  1U5Y A;  1O6U A;  2CHH A;  5CFC A;  2VTF A;  1OD3 A;  3MUZ 1;  1GNY A;  1VAK A;  1D0G A;  3WG2 A;  1AL2 2;  4JTO A;  1TME 1;  3ZSK A;  2PLV 3;  1X9T A;  2UYB A;  2VTX A;  2VMF A;  4Q29 A;  3TBD A;  4P9I A;  1DLC A;  1VJ2 A;  4A41 A;  4XZU G;  5FXW A;  3I2O A;  2AAC A;  2EID A;  3EB7 A;  3ZXD A;  4BMB A;  3RG0 A;  2KR2 A;  4QDS A;  1D2S A;  3IAQ A;  4FVV A;  4MAD A;  2QQK A;  4FCA A;  4ZS3 A;  3GJA A;  4H55 A;  3WNL A;  5IAX A;  1ZZ8 A;  5JXH A;  3AKR A;  3LCP A;  2A6W A;  5KWR A;  3K48 A;  5I0D A;  1O3S A;  1DQ1 A;  2ZML A;  5FZB A;  1PK6 A;  1G9D A;  1BXH A;  2E31 A;  4YNI A;  4Z2A A;  5C70 A;  1KXG A;  2X5I A;  1WCS A;  4LA3 A;  2OYZ A;  3SLI A;  3WQ1 A;  1W6M B;  3ZIW A;  4CRQ A;  1DGW X;  1C57 A;  1MPX A;  5FYV A;  1MS0 A;  4NRP A;  2W1Q A;  5FAX A;  3VHN A;  4Q26 A;  5BNN B;  1Q8S A;  3H3L A;  1PO2 2;  1MZF A;  2QBX A;  1KIT A;  1TEI A;  5DZF A;  5KHK A;  1YJL A;  1CVN A;  3VZM A;  2XHN A;  2B8M A;  1RVF 1;  3BPS A;  3IDB B;  5JXI A;  5I8S A;  1RMU 2;  2ZGS A;  4AHX A;  1W6Q A;  3CF6 E;  1WCK A;  2J1R A;  4MGQ A;  2UUR A;  2D43 A;  3N9N A;  1L7L A;  4LR4 A;  3H1W A;  1VBB 3;  3PUS A;  5FP7 A;  1RXG A;  3USU B;  2HWE 2;  2Y38 A;  2QQL A;  2AR6 A;  1VMF A;  3BOP A;  2GC1 A;  1AF9 A;  2RS5 3;  1E5I A;  4IXL A;  3KWV A;  4K3U A;  2QDN A;  3RSJ A;  1CZT A;  1N47 A;  2ZGO A;  4D6Q A;  4EE2 A;  2YV8 A;  3ZSL A;  1RMU 3;  2ZX3 A;  2GH8 A;  4YW4 A;  3ZKU A;  5A3O A;  1QWR A;  1WLC A;  1YYN A;  2JWP A;  3I2F A;  4MYE A;  4AVA A;  3WQ0 A;  1NY7 1;  5JI7 A;  1HJG A;  4NWW A;  5FOJ B;  2W2I A;  4ZU4 A;  5CFC C;  4HMZ A;  4MHR A;  4CPB A;  1ZYB A;  1MQT B;  1AR6 1;  4Y4Y A;  2DWR A;  2D5F A;  4MXV A;  4B4R A;  5JPN B;  3N9Q A;  2ZAH A;  1QOT A;  4FOW A;  2QQM A;  4RR3 B;  3WG4 A;  3RPQ A;  3PUQ A;  5SV5 A;  3NJV A;  4D7S A;  4K7J A;  1DCS A;  2JKX A;  4OMD A;  4UAP A;  1PGL 2;  3ZMN A;  4HET A;  4G3Y C;  1LAJ A;  4R4X A;  4M01 A;  5F5C A;  3ORJ A;  2WZR 1;  5HV0 A;  1HDK A;  2D97 A;  2R0F A;  2VC9 A;  3HJR A;  4DOU A;  4WM8 C;  1VAM A;  4UFM A;  4Q4X 3;  4PF5 A;  2LTN A;  4H14 A;  2TNF A;  4XHX A;  4FP2 A;  3VBH B;  1AR9 2;  4E4Z A;  5JVV A;  3HQR A;  3GCW A;  4BM8 A;  1ULP A;  3C8X A;  4LO7 A;  1JZ7 A;  4GH4 A;  4YAR A;  4XFH A;  1TZO A;  1P8J A;  1W8U A;  4CDX A;  5CB7 A;  3S30 A;  3BTX A;  1LES A;  2RJL A;  2ARC A;  1DIW A;  2CV6 A;  5GLW A;  4MOA A;  1QXR A;  4CDW B;  3BGA A;  1AR9 3;  4NID A;  1J83 A;  4RS5 B;  2VM9 A;  3ZFF B;  3IAP A;  3MPB A;  3P5B A;  2Y0O A;  5GLU A;  4FFF A;  4GMP 3;  2ZEY A;  1CPN A;  1ND2 B;  3B5L B;  1H2M A;  1H1A A;  2JG9 C;  3IWZ A;  3T30 A;  3I2G A;  4LKF A;  1XNK A;  3U1X A;  1RUG 1;  2IXL A;  2PHU A;  4KWU A;  1S0I A;  2A3W A;  2R1D A;  4FPK A;  4CDW A;  4J25 A;  1PGL 1;  3W59 A;  4N53 A;  2Y6F A;  3D8C A;  5FWE A;  5J3U A;  5A32 A;  4CDQ B;  1ONA A;  4UFJ A;  1WUV A;  5JIA A;  4DXR A;  1DYK A;  4Z2W A;  2BER A;  4HFS A;  2Q1Z B;  3ZSJ A;  5C6C A;  3WP3 A;  3AMH A;  4QAW A;  2Q8O A;  1RUG 3;  2PXJ A;  4PIX A;  2K2S A;  3OOX A;  2BBV A;  5FZO B;  1DYP A;  1X50 A;  1V0A A;  2O14 A;  2RM2 2;  4XMA A;  3ON7 A;  4L8Q A;  1SG3 A;  3PJY A;  2VMH A;  5CYY A;  1DQ6 A;  4LK7 A;  3O1T A;  3BTA A;  1JZ2 A;  1AL0 G;  1CAV B;  1NOV A;  4XC9 A;  1QXJ A;  5DAQ A;  4DMI A;  5HI0 A;  1QDC A;  5IVF A;  3OD0 A;  3RFR A;  1MEC 1;  3SEE A;  4DUX A;  5BNN C;  3H7Y A;  3H1M A;  5EXO A;  3PHM A;  3DKW A;  3PIJ A;  2VU9 A;  3LEG A;  2VGD A;  2ZZQ A;  4QMA A;  4YW2 A;  4W65 A;  1UKR A;  2NMO A;  3UJO A;  5EIY B;  4QD2 A;  2VUL A;  1O8S A;  2BQP A;  3AK0 A;  4MGI E;  1QJX 1;  4QPI C;  3CJX A;  3UL2 A;  4F7Z A;  5C3S A;  2IFR A;  1OKO A;  5DDJ 2;  4B1M A;  2E26 A;  2UY9 A;  1WLW A;  3OEA A;  3LGR A;  1TMF 1;  2P3Y A;  2VL4 A;  1JZ5 A;  2JKB A;  3LPG A;  1JH5 A;  4AVS A;  2WNE A;  2YGM A;  3MFA A;  3F2Z A;  5FYC A;  4B1L A;  4XF3 A;  2BUK A;  4WZF A;  2PMW B;  2C4X A;  4AF9 A;  3I3M A;  1AVB A;  2ZGM A;  2PHW A;  2VCM A;  3P3P A;  4QHZ A;  4BQX A;  1JUI A;  3ROU A;  3VLB B;  4CDX B;  5FYU A;  3C7F A;  4P9W A;  4CP2 A;  2P6H A;  3DF0 A;  4KU8 A;  4YG6 A;  5A7O A;  3T2O A;  3WUD A;  4Z82 A;  3N4M A;  5DG1 A;  1O4T A;  3CZU A;  1PO2 3;  3U14 A;  1W3X A;  4XIO A;  1N1Y A;  3IDE A;  1BZW A;  2RS5 1;  1ZBE 1;  2HEY F;  2VOV A;  2HEV F;  3ACI A;  4DRR A;  3W5N A;  1GBG A;  5IVY A;  1W6M A;  1GLH A;  3MLK A;  3DUI A;  2GU9 A;  1NZC A;  1WW4 A;  3HWJ A;  4PLM A;  5ERL A;  4XPV A;  5T5O A;  1NCR B;  4FFI A;  1CQ9 A;  4DPN A;  3ZPY A;  4Q4W 3;  5E89 A;  4XDO A;  3RWK X;  1HRV 2;  4OI4 A;  5JIU A;  2ZGL A;  1CON A;  2WNU C;  2ZHN A;  3J7L A;  1I6X A;  1UU4 A;  2B39 A;  3N7M A;  1YFX A;  2IVJ A;  1PGS A;  1W8Z A;  2H6C A;  2VNG A;  4Y20 A;  1SLL A;  2A71 A;  3FMG A;  3WR0 A;  3LEI A;  5FY4 A;  1RHI 1;  3QD6 A;  4IE7 A;  2LM3 A;  5I8T A;  1NQJ A;  2HWD 3;  4FPH A;  1QJU 1;  3NV2 A;  2X09 A;  2EA7 A;  4TN7 A;  1WLD A;  1EAH 2;  4ZU7 A;  1EAH 1;  1NCQ C;  2GN3 A;  2J1E A;  3ZYF A;  1GOF A;  4WBB A;  1AR7 2;  1UZV A;  2JDZ A;  3D0J A;  4M0N A;  1V6J A;  4JGY C;  4AW7 A;  2HWF 2;  2RDN A;  4NHL A;  3VD5 A;  2PHD A;  2CWM A;  5FY0 A;  5I0U A;  1BEV 1;  4G4F A;  5TSW A;  2VUD A;  3I3B A;  1ASJ 3;  3VHO A;  2LW8 A;  2ILM A;  3DXT A;  1WW6 A;  1CES A;  5JPM B;  2FMY A;  5IAV A;  2ZKL A;  3P3N A;  3AKS A;  2CTV A;  1QDO A;  1VRH 2;  3O0W A;  4MUV A;  1CAX B;  4CDX C;  3ZPO A;  4XET A;  1GAN A;  1SPP A;  3BUC A;  5L7O A;  1OFN A;  2DUR A;  2E7A A;  3SCH A;  4BME A;  2MEV 2;  3NO8 A;  4X8N A;  4LIU A;  2PLV 1;  1UU5 A;  4P9G A;  1H8V A;  1A3K A;  2VW0 A;  3V0A B;  2Z69 A;  3OSD A;  1XXN A;  2VZO A;  4AWD A;  4YM0 A;  5DDJ 1;  2VQT A;  3UK9 A;  4DS0 A;  3MF6 A;  1R1Z A;  1XE8 A;  2BOI A;  4JDN A;  2DVG A;  5FPL A;  4AG4 A;  4D6R A;  2EAA A;  4JKM A;  3S57 A;  5F5I A;  3SNM A;  3S5Q A;  5LWB A;  5EWS A;  3NKG A;  5D2A A;  4WVM B;  5F6L B;  2JDM A;  3UKV A;  4XBQ A;  4A7K A;  4C0H A;  1IPJ A;  1YJK A;  3RZK A;  4YZ3 A;  4CU9 A;  1IS3 A;  4HSL A;  5FFO C;  4Z07 A;  5A70 A;  4ISR A;  5A6X A;  1ASJ 1;  2D40 A;  2HWC 1;  4KG0 A;  4LHK A;  1TG7 A;  4I01 A;  4P9L A;  5AC9 2;  1FPN 2;  1O5U A;  2D3R A;  1W2O A;  1C8M 2;  4OQ9 A;  4B7E A;  4E4S A;  3A0K A;  2VOK A;  5FP9 A;  1NCR A;  4BZ4 A;  5F2W A;  2EIG A;  5KC5 A;  4YW7 A;  3SIT A;  4CXX A;  3M3Q A;  3GHN A;  1OLQ A;  4N53 C;  2F4L A;  2CU5 A;  3AKQ A;  3OGR A;  4MZU A;  4YGC A;  3LD8 A;  3ZSE A;  4IDZ A;  4BXF A;  1AR6 3;  4JVA A;  3MV0 1;  1OF4 A;  1BKZ A;  4NO4 A;  4RGK A;  1OLM A;  1UX6 A;  3U11 A;  1NG0 A;  1RL3 A;  3GM8 A;  1SBF A;  1JHN A;  1RJ8 A;  3T2P A;  3OBR A;  2VZV A;  1FPN 3;  4BQ2 A;  4AR2 A;  1JTZ X;  3I2D A;  1QHD A;  3WEZ A;  1LOD A;  2VW2 A;  1CN1 A;  3AYC A;  4GMP 0;  3S5A A;  3PLQ A;  5J48 A;  3HVD A;  2BYV E;  4NRQ A;  1S0C A;  4HPK A;  3GYD A;  5DQ0 A;  2QZ2 A;  1BLZ A;  4LIT A;  1EPZ A;  3M1H A;  2Q1M A;  4RHV 1;  3RVH A;  2FDK A;  5DAP A;  2ARA A;  3FLT A;  1TVG A;  5KHJ A;  4ZU5 A;  4AGG A;  3AP4 A;  4RS5 C;  1E57 A;  1I5P A;  2WIN B;  1C8N A;  4GWN A;  4LOS A;  1BK0 A;  1JS9 A;  3JD7 1;  1XPW A;  2QQI A;  3IZO A;  3UKN A;  3WF3 A;  2BNM A;  4AGR A;  3S7E A;  1S55 A;  5FPU A;  5I91 A;  2FQP A;  2XBO 1;  1URX A;  1W03 A;  4MV2 A;  2DCT A;  5DDJ 3;  5DAB A;  1JI6 A;  3LDK A;  1C5H A;  1CAV A;  1VBE 2;  1ZZB A;  2ARB A;  3AXE A;  3B93 A;  1F9K A;  3AYE A;  1NLR A;  1UX7 A;  3WDV A;  4E9K A;  4E4H A;  3J7N A;  3KVA A;  3OJB A;  1YQ8 A;  2Y6J A;  3BKZ A;  4IGP A;  2I07 B;  5APA A;  1UO9 A;  1E5R A;  3OB8 A;  1FAT A;  2CDO A;  4QT6 A;  4EYU A;  3RZH A;  4M0H A;  3KV5 A;  2W39 A;  4XXA A;  5EZW A;  1JOJ A;  3EHK A;  1V6N A;  5B2G B;  4MO3 M;  1DBN A;  3QOP A;  3ABZ A;  4ES8 A;  3M4F A;  5KBF A;  4ZY9 A;  3ZO0 B;  3FHA A;  4FSJ A;  2BVV A;  1E5S A;  1HB1 A;  5DN2 A;  2GP3 A;  4R9D A;  4RN5 A;  3LFM A;  3BU7 A;  1LGC A;  4AEM A;  4CEY A;  1S0B A;  2CYF A;  4QX5 A;  3OY8 A;  3USS A;  1DGW A;  1Z78 A;  2D6P A;  2E7T A;  2WO1 A;  3ZXK A;  3WNK A;  5L9R A;  1GSL A;  4R9A A;  1RYY A;  2Y6L A;  3SIS A;  4XHB A;  4XBN A;  3TRS B;  1QIQ A;  1NA1 A;  2Z79 A;  3T08 A;  2OPK A;  2V72 A;  4EN8 B;  3UT0 A;  3VBR C;  4DEV A;  3KGL A;  4HZF A;  2JEN A;  2WS9 3;  1QMJ A;  2OUJ A;  1ND3 A;  2OT7 A;  4I0W B;  4RFT 0;  1BK1 A;  4IE5 A;  5CFD B;  1ZM1 A;  4RFR B;  3QCW A;  1SLB A;  1PX4 A;  1W04 A;  4JKK A;  2HWE 1;  3GAL A;  2BVB A;  3VKN A;  1N1S A;  3CJI B;  4D8M A;  3FBM A;  4XQD A;  1D4M 3;  3FX3 A;  1LCL A;  4ZZ5 A;  3V0B A;  3VKF C;  4QKD A;  1J1T A;  4KG8 A;  5C8W A;  4GJZ A;  1HXS 3;  2OKX A;  2DYC A;  1QOO A;  2PAE A;  4PIZ A;  1DQ5 A;  3T0B A;  4AEK A;  4YZ2 A;  1VBB 2;  3QAC A;  5F7U A;  3H8X A;  1A6C A;  2ZAB A;  3MDP A;  1AJO A;  4KGG A;  4XQ4 A;  1ZBA 1;  4L99 A;  2WFF 1;  1SBD A;  2EF6 A;  4Q2F A;  2EIE A;  1KRI A;  2HWC 3;  5JLV A;  4DZG A;  3VN4 A;  3HNY M;  4IW3 A;  4ATF A;  4HKW A;  4R9B A;  5IHR A;  1R1A 3;  1SCS A;  3RYP A;  3NST A;  5D8A A;  1LHW A;  1ULD A;  3KD4 A;  3OUH A;  2G4I A;  2HWD 2;  4XJA A;  2VVF A;  4HK8 A;  4L2N A;  1W8F A;  1WBF A;  2MHF A;  4AE2 A;  1Q43 A;  4UT5 A;  1AX2 A;  5J36 A;  2Z4F A;  5F3C A;  1NLQ A;  5BYN A;  1WLT A;  1YC6 1;  4MHU A;  5M0T A;  4PBO A;  4Y5T A;  3M7A A;  4BPZ A;  3RZJ A;  2Y6G A;  2BTV C;  1WBL A;  4LBQ A;  2J1U A;  4DO0 A;  2B9V A;  4URT A;  3H8U A;  3O0V A;  1RIR A;  2XG3 A;  1XSQ A;  4FPL A;  5C8C A;  2J1A A;  3M8L A;  3A7Q A;  3AMP A;  3KHB A;  2VQU A;  1N1T A;  3KMH A;  3LE0 A;  4H7M A;  2F4P A;  3NV4 A;  4XFA A;  4XJZ A;  3VBR A;  2BFU L;  1XNT A;  1R64 A;  1T6B X;  2D6M A;  2WUH A;  2JE9 A;  4FTB A;  2ORX A;  1D7P M;  5KXB A;  1ZRR A;  5FLI A;  4J6G A;  1ZRD A;  1PMJ X;  2HJI A;  2BV4 A;  3B7M A;  1F35 A;  1C8M 3;  5F3G A;  1QXP A;  2C5D A;  4NJ4 A;  4IET A;  1WMX A;  1V9U 3;  4UI9 L;  4ZS2 A;  5HCF A;  2RS3 2;  1LB2 A;  3ZYI B;  4A42 A;  1OOP C;  2DU0 A;  3U37 A;  4DIQ A;  5FMC A;  2AYH A;  4XFF A;  1J1L A;  4B8E A;  5IT6 A;  3CU7 A;  3L2Y A;  5C8C B;  2IVI B;  3DYM A;  1PVC 3;  3JBG 1;  4NHM A;  4Q4V 2;  4YLZ A;  2W94 A;  3PL0 A;  2XON A;  2DVD A;  5JAX A;  1D4M 1;  3KLS A;  2DUP A;  3AP6 A;  3OGV A;  1YFU A;  4PQ9 A;  4C0B A;  4NVP A;  2WR9 A;  5IK8 A;  1ZBA 2;  3E6C C;  3AYD A;  1DGR A;  4LNV A;  3KB5 A;  2YUE A;  2J22 A;  2X8K A;  1EUU A;  3LEM A;  3M3O A;  4X6Q B;  4N7U A;  4OHW A;  4KBB A;  2RM2 1;  2V73 A;  4IEX A;  4A3X A;  1HQW A;  5LA0 A;  1UY0 A;  3PNA A;  3APB A;  1GKB A;  4P9Y A;  1AXY A;  2QNK A;  4W6X A;  3VB9 A;  1B35 C;  1YQC A;  3ZFF C;  2DU1 A;  2JX9 A;  3THT A;  4YVS A;  1IOA A;  4FQ4 A;  4I09 A;  2OPW A;  2VUA A;  1W2N A;  4Q5O A; 
#chains in the Genus database with same CATH homology
 1YQ2 A;  3K77 A;  4OMC A;  4PT6 A;  2QQL A;  3K4A A;  4P02 B;  1K42 A;  4D0Q A;  4W50 A;  4E8D A;  2W9X A;  4HG6 B;  1CZT A;  2J7M A;  3WQB A;  4QB1 A;  1UMI A;  3I2J A;  2VZP A;  5G04 L;  2WDB A;  3I2F A;  4OZO A;  5DMY A;  4XVH A;  2W46 A;  4OYU A;  1JYN A;  2B4K A;  2RVA A;  3WNO A;  2QQM A;  3WNM A;  4CUA A;  2W91 A;  2LS6 A;  3NJV A;  3T09 A;  2DDU A;  2JKX A;  4OMD A;  4UAP A;  4XUP A;  2PQS A;  4XUR A;  4BK4 A;  2XOM A;  3ECQ A;  3HJR A;  3A23 A;  2VC9 A;  4PQQ A;  4DEQ A;  3W5M A;  2J1T A;  3GDB A;  4CUB A;  2QQN A;  3GGL A;  2VZU A;  1ULP A;  1W99 A;  3C8X A;  1JZ7 A;  2WAO A;  1LNS A;  3AC0 A;  2J1V A;  5FUI A;  4QX0 A;  1P8J A;  4A6O A;  1W0N A;  1HN1 A;  2VCC A;  2YG0 A;  1NAE A;  1F4A A;  1L7Q A;  2WAA A;  4MOA A;  3P1I A;  3BGA A;  1J83 A;  2DCK A;  1US2 A;  3UET A;  2VM9 A;  1W9S A;  2VCA A;  3IAP A;  1JZ6 A;  3OEB A;  2ZEY A;  4QB6 A;  3EYP A;  1GU3 A;  5JUV A;  2WYS A;  1EUT A;  3I2G A;  3K75 B;  4KWU A;  1JYX A;  5EJZ B;  3ETP A;  3VD3 A;  1PMH X;  1DP0 A;  4DXR A;  2BER A;  3WF0 A;  4BK5 A;  1NKG A;  4ZZ8 A;  1JYW A;  3PUI A;  4TXW A;  3ACG A;  4QAW A;  3E1F 1;  2WN3 A;  3I2K A;  1UYY A;  4LKS A;  3C7O A;  1SG3 A;  4DXT A;  4IUG A;  5CYY A;  1JZ2 A;  3T0A A;  4GWI A;  3C7G A;  2WN2 A;  4ARY A;  4DUX A;  3SEE A;  1JU4 A;  2VZS A;  3I3D A;  1GUI A;  3LEG A;  5EIY B;  1O8S A;  3LEK A;  1UWW A;  3HPN A;  2DCJ A;  3J7H A;  3NRU A;  1JZ8 A;  4A44 A;  2E26 A;  4CU7 A;  4FI9 A;  3OEA A;  5JR2 A;  2VL4 A;  4E8C A;  2YC2 A;  3D3A A;  3LPG A;  1JZ5 A;  1JYV A;  2RV9 A;  3SEP A;  3F2Z A;  2W1W A;  3C7E A;  1WKY A;  5IYY A;  1CX1 A;  4AAX A;  3K4Z A;  2C4X A;  4YPJ A;  2HYX A;  5JXG A;  3C7F A;  3CMG A;  2WQ8 A;  3HNB M;  3T2O A;  2RJ2 A;  3K4D A;  1UYX A;  3CZU A;  1OH4 A;  3I2H A;  5JMO A;  4JHZ A;  1SHW B;  2E32 A;  3ACI A;  3DYP A;  5LCW L;  3W5N A;  3UNP A;  3JXS A;  4P5Y A;  3VD4 A;  2WO2 A;  4BXS V;  3OG2 A;  4L0P A;  4M4P A;  2VMD A;  4QPW A;  1UY4 A;  3NNG A;  2VZT A;  1GQP A;  3LEI A;  4OUE A;  3CDZ B;  4JX0 A;  1W8N A;  2X09 A;  4CU8 A;  3FHQ A;  3WF1 A;  3T0D A;  1SDD B;  2WAB A;  2J1E A;  4QDQ A;  1GOF A;  4XUO A;  3OGS A;  5EJ1 B;  3VD5 A;  1UYZ A;  2VJX A;  4DXS A;  1H6Y A;  3I3B A;  4CUC A;  2BZD A;  2LW8 A;  2Y8K A;  2WBK A;  4P00 B;  3MO4 A;  3NJX A;  1O59 A;  5J1X A;  4A45 A;  2BGO A;  3CQO A;  4KI5 M;  2W95 A;  4RYD A;  3CZJ A;  2JE8 A;  3HN3 A;  3WNN A;  2W5F A;  3VDB A;  1KEX A;  4A3Z A;  2CDP A;  4W8J A;  3VDA A;  2VZO A;  2VQT A;  2BBA A;  4LPL A;  3THD A;  4AG4 A;  2YFZ A;  4JKM A;  2ZEX A;  5IJR A;  3WSO A;  1UY1 A;  2ID4 A;  2W92 A;  3WF4 A;  2X10 A;  4CU9 A;  1OT5 A;  1ULO A;  3LPF A;  1TG7 A;  5G05 L;  2Y6K A;  3HEI A;  4BJ0 A;  1NUK A;  2JD9 A;  4TTG A;  4DUV A;  4W4Z A;  3THC A;  3MUY 1;  3OGR A;  2HLE A;  2VCB A;  5C7G A;  2KD7 A;  2EIB A;  3MV0 1;  1JU3 A;  1OF4 A;  3FN9 A;  1DYO A;  3I2I A;  3GM8 A;  1K12 A;  4XUN A;  2C9K A;  2W47 A;  3T2P A;  2VZV A;  1UMH A;  3A21 A;  3WEZ A;  2W1S A;  1W9W A;  1GOG A;  2QQJ A;  5JXJ A;  1CZV A;  1UXX X;  1XNA A;  2W3J A;  3LQC A;  5DQ0 A;  3WF2 A;  3T2Q A;  5CZK A;  2VZ3 A;  4ZXE A;  1IQD C;  2QQO A;  1KGY A;  4DUW A;  1TVG A;  4UOJ A;  5HPO A;  1GMM A;  4ARX A;  1I5P A;  2WZ8 A;  2X05 A;  1XPW A;  2QQI A;  3WF3 A;  2V5D A;  3C7H A;  5C71 A;  4ET7 A;  4CU6 A;  1JI6 A;  2L9L A;  2BGP A;  5LA1 A;  2YB7 A;  1UX7 A;  2Y6J A;  4KMQ A;  4GZ9 A;  3OB8 A;  4A4A A;  2CDO A;  3OBA A;  5B4X A;  3I97 A;  2W1U A;  2VO5 A;  3ZM8 A;  4MO3 M;  1H6X A;  3ABZ A;  1UZ0 A;  4ZY9 A;  5IFT A;  3FHA A;  5DN2 A;  4RN5 A;  2ORZ A;  3SKV A;  2WO3 A;  2WO1 A;  3UES A;  3WNK A;  1NX9 A;  4M4R A;  3WNP A;  1RYY A;  3ACH A;  2Y6L A;  3HOB A;  3III A;  4QX1 A;  2ZEW A;  1PX3 A;  3T08 A;  1OF3 A;  2V72 A;  2VR4 A;  1BHG A;  4DEV A;  2VZ1 A;  1JHJ A;  3GXU A;  4LHS A;  2ZXQ A;  4GWJ A;  1PX4 A;  4JKK A;  4D8M A;  3DYO A;  1XC6 A;  4BDV B;  4ZZ5 A;  1T2X A;  1UY2 A;  1J84 A;  2Y6H A;  4CVU A;  2OKX A;  5F7U A;  2YC4 A;  3T0B A;  3IB3 A;  3VD9 A;  1F4H A;  2VZQ A;  2W87 A;  2JDA A;  2VOT A;  5B4N A;  1GOH A;  2J1S A;  4PF1 A;  3I3E A;  3VDC A;  2EIE A;  3HNY M;  5IHR A;  2E33 A;  4QDR A;  1JZ3 A;  2Y64 A;  4XUT A;  2ZEZ A;  2EIC A;  3K46 A;  2Z4F A;  1JZ4 A;  1K3I A;  4MGS A;  1W9T A;  3IDA A;  1WCQ A;  3DEC A;  5DPN A;  5LA2 A;  1CIY A;  2Y6G A;  3FL7 A;  2J1U A;  1US3 A;  2B9V A;  2VTF A;  1OD3 A;  3MUZ 1;  2J1A A;  3VD7 A;  1GNY A;  3A7Q A;  2VQU A;  4QB2 A;  3LE0 A;  3P6B A;  2C26 A;  5IFP A;  2VME A;  1XNT A;  4LQR A;  1R64 A;  3SKJ E;  2WUH A;  5HXM A;  2ORX A;  1D7P M;  3BN6 A;  2VMF A;  1UY3 A;  2V4V A;  1DLC A;  4A41 A;  1PMJ X;  4XZU G;  2EID A;  1K45 A;  3EB7 A;  1UXZ A;  2XQX A;  4QDS A;  4QX3 A;  3IAQ A;  4MAD A;  4XUQ A;  2QQK A;  4P08 A;  2YFU A;  4UI9 L;  3WNL A;  5JXH A;  4A42 A;  3U37 A;  2WZE A;  2VZR A;  5I0D A;  1L7R A;  3MV1 1;  3DYM A;  2E31 A;  4Z2A A;  5C70 A;  2W94 A;  3PUH A;  2XON A;  3MBW A;  5A1A A;  2R7E B;  1MPX A;  3OGV A;  1W8O A;  2W1Q A;  3CIH A;  3CKH A;  3ACF A;  3HNM A;  2J22 A;  1EUU A;  2QBX A;  5LA0 A;  1O8P A;  3NQH A;  4QX2 A;  1UY0 A;  2XHN A;  4JKL A;  5JXI A;  2VMC A;  2J1R A;  4MGQ A;  1CZS A;  3A22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...