3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
b'SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
2FECI 3NCCB 2GT9A 5TF1H 3CDGB 5GRZA 1E6NA 2C3VB 5GSVB 1OF2A 2ZWZA 4ZD3L 3P9LA 1TTUA 3CZKA 2Y72A 4ACZB 1QFHA 4TPRH 5EIVA 4S1DD 1FDLH 4FLRA 2Z91A 5EO1A 4G80B 5MEQB 2YG0A 4BFIA 4AQ1B 5IQ9A 4P2OD 1JNHA 1HYSD 4K7PH 3QJFB 4WV1B 1AE6H 2PXYB 5C09E 4NBXB 4OLWH 3KXFA 4FQXC 2Z8RA 4FQ1L 1LMKA 5MP6L 5ACZA 5JXEC 3C7FA 5A69A 3WH8A 3MRCA 2DMKA 1RVFL 4KHTL 3KPSD 2O5XH 1VACA 4ATWA 3A0OA 2RVAA 1A3HA 2VXQL 1G0YR 5C08D 5DXWA 3LOWA 3DHUA 4RWHA 1ZLWH 3VXRE 2EO7A 2ZX6A 2Z1SA 3ARDA 4RE4A 4ZXEA 2JFEX 1YPZA 4JKPL 2MQ3A 3S5LB 4LPLA 2X2YA 4U1LB 4F9JA 1C16B 4H1LG 5HOSA 3POHA 5CINH 3F5KA 3C6LB 3JWOC 4HC1H 4X99B 2E8YA 3MMWA 3HRZB 3LS5L 3QPQD 3DBXA 5I8EA 3SCTA 5KSVA 1FOBA 2QHLA 1E0OB 2CLRA 3APGA 1PKOA 4MD4B 3RWEA 3WFLA 4B9ZA 4JFHD 5FM5M 2NNAB 3ULUH 1K85A 5L2JA 1RULL 2CHNA 1NC2D 5IW3A 3EYSH 1MHEB 3U1SL 4HUMB 3BAKA 3O45B 3U0PB 3UC0H 3A7QA 5AY7A 1W72A 1XMWA 5J4MA 4LDLB 4TSAL 4MB4A 3W29A 3PGFH 3QEQA 4K3DL 4AH2B 1FIGH 2ICCA 2XFYA 5A95A 3B9KA 3K8KA 2HVMA 3N1MC 3WSOA 1RZIA 3ZT5A 2GW5A 2XN9A 1ETZB 5GGSY 4P59H 3VWKC 2CUIA 5JUEL 2HAZA 4LSRH 2A6KA 1QNPA 2WHJA 1GGBH 4W8AA 4YO0A 1E3ZA 3IXAA 4FTVB 4G6AC 3AAZA 3UTSB 3SCMA 3GI9H 1DYOA 4TUOB 2GJZB 4FQXD 3VVGA 5JXED 4XNXL 3V4VH 3A6BL 2VX5A 1KGUA 3VKKA 1GGYA 1S7SB 2XKNB 2HYXA 4PY8I 4JHZA 1X5YA 3HR5A 4DKDC 1A2YA 1AIFB 3MBXL 5I17A 5CKGA 5D1XB 2OP4H 1BX2B 3SIMA 5LAXB 3PDOB 2L7JA 2FO1A 3RX7A 3U36B 4KJPC 3GRWA 3T2OA 3EYUL 1I8IB 4JGJA 3W0WB 4Y5XB 5ABFB 1LDPH 1T5XB 3LKOB 5I1HH 3U7YH 3L5JA 3GKZA 4YUEH 1A6TB 3JTSB 1UQSA 2XZAH 1V0KA 5CZVL 1YYML 1DLHB 2MHAB 4JLRB 3F58L 1NANI 1OT5A 3FQRB 1ZE3C 5HGHA 4OAWA 3SN6N 4PREB 3O4LE 1TQCC 2KD7A 3SCNA 3KPPB 3OLIA 1Q9OB 4H1LH 3P0YH 4OCMC 1B4JL 4YZFF 2X5PA 3RAJH 1AVAA 1XV8A 3BC9A 5FKPB 5B21A 2CDFB 1OOAA 1P4BH 1B90A 1MFAL 4W85A 2K3TA 1F90H 2VUOA 1V7ML 4CU9A 4UV4L 3EYVB 1U92A 4EVNB 1OD8A 4UCFA 2I07A 3PGCA 1X5XA 5E94A 1G7LB 3WKMH 5CMAB 4QT5B 1XF5B 1FPTL 1KCUL 3THCA 5FHBL 3GUTB 4BELD 1CG9A 2IADB 1VGKB 5DRNB 3RBSA 3T09A 1R87A 3L4TA 2ZZUT 3I50L 1C12A 3VWKD 2YK1H 5I1EL 3CFKB 2V3EA 4YZFE 2BNJA 4WWKC 4LCYB 5EO9A 3QCVL 2XVGA 4G6AD 4M61A 2J8UA 4CVZA 5EULV 2OSXA 5ESQB 3UTTE 1JJUA 1IJ9A 4JZOA 3LPOA 2EIDA 4WU7A 3WFBH 4OF8A 1KPVA 3QIUC 1CZ8H 4GXVL 3LKSA 1WB0A 1DWFM 1OGTB 3LQZB 3RIFK 1HHGA 1FYTE 1MHCB 1QVOA 3LH2L 4TVPE 2O9OA 3RJYA 4KJPD 2AV1A 5IMMB 2D24A 1WIPA 1ZEAL 2DLFL 3NCEB 4HFUH 4Y1AB 5DQJA 5F9AC 1QFWL 3QISA 4KRNA 5FYJU 5TPWL 3LIZH 4TRPL 5TDNA 4OFKA 1JI1A 2G5RA 4FF5A 1OLLA 4V2XA 1YMMD 1FN4A 4XBGB 4Z76A 4N0UA 2GJXB 4J3SA 4M7JH 4QHNA 3PZOA 4K2UH 5ESAA 2WINB 4LSTL 3SDCC 2XIDA 4XZUB 5DDHA 4ONHB 4ZFZA 4QX1A 4MNGE 5FF6A 3X3FH 5IMKB 1DSFH 3LEYL 4JR9H 3VRLE 1PW3A 3QULA 2V2TA 3QHNA 3RHWF 5ITFA 4AENB 2FZ3A 3ARBA 3FB5A 2ICES 5DRZB 5SX4I 1F6AA 1Z9LA 4WHCA 5D5MA 2Y6LA 1ZLWK 2BNRD 3VW3L 2JJSC 2Z1KA 3DOSA 2P5EE 4G8GD 5H94B 5E8PA 1X6LA 4C56D 1IM9B 1NFDF 4YXKL 4P5KB 1JI6A 3HCVA 3QWRA 5IFHH 3RUGB 4WWKD 3TESA 2UY7A 4EDWH 1E4NA 4DZ8B 2F53B 1EA9C 2HTLC 4OZGA 1S7TA 1N64H 1CD0A 2R4SL 2XA3A 1N6QH 5INDA 4UTAL 4PRAA 1BYDA 5DR5H 2IC2A 1OAYL 3QHTC 4JY6B 5FKAB 5MEND 1ZTXH 1L8NA 3WF1A 2EIZB 1KCRL 2DIJA 3O11A 3QIUD 1DQLL 2V5YA 1NFDE 2BXYA 5DZOA 1KTLB 2XT1B 2CO7B 3ARGB 2N7BA 2NW2A 5HI4C 2YD6A 5JR1H 2C3WA 2NXZB 1HKFA 4RDQF 4X8JB 5I71B 4DVBB 5FL1A 4HIXH 3HAEG 1G7MA 4I48B 4GH7B 4D9RE 1KB5B 2EYRB 1UA6L 1N3NB 2EDXA 3VFWA 3E3QC 4U1HB 3PZNA 3CCHB 3KR3L 5K59F 4I0PB 4JDTH 3BD5A 3TH3T 4FMVA 3FONB 2FSEB 1KNOA 5T3ZD 4RMQA 1DLFL 2AXJA 4QB1A 3SDCD 1DCLA 2QKIB 4Q0XL 4GS7C 3A23A 1NGPH 4JY5L 3UROR 1NLBL 3TTOA 5DMKA 1P1ZB 4EUPG 5DJYA 5EZJA 3BISA 4UOQA 4M6OH 2F2HA 2E7CA 5C6TH 1W0VA 3FZUC 5F8QC 1ZLSH 4BCEA 2XQYG 3L1OL 1CICA 5K59E 1HCVA 3V0AC 1XGQB 3ZJ8A 5FA3A 3BSZL 4UV7H 3MRNA 4NRSA 2YL9A 1IGTB 2QMJA 3ACFA 5JMOA 2HTLD 1XH3B 2R69H 3UBXA 5C8BB 1PG7W 2Y36L 3BESR 3VXQA 4LASH 4BQ3A 3FQWA 2EYTB 2DCKA 1VEOA 3PE9A 3CZGA 3VFRB 5DGQA 3RQ3A 3WUWA 3G5YB 3TJEL 4I0CC 4GI9A 3KNBB 2GSGB 5DVNA 4RN5A 4ZFOB 1E71M 1BLNB 3VX1A 1LWHA 1C5CH 3VMOA 3GHBL 4JPVL 2WWMC 1EAPB 5DEFA 1Z32X 1S9YA 1B0RA 2VE6B 4QRRB 5HY9A 3T0EA 1KR1A 1DVFB 2PYEA 3TT1L 3DPBA 1W9BM 3H3KA 4PY7A 3SEPA 3QWOA 1QI4A 5HI4D 2YDSA 4GMTL 1MQPA 4QHUA 4X6DA 3LE0A 1ODAA 2SEBA 5E9AA 1NCAL 2J74A 2DQGL 3WH9A 5F8RC 3WELA 5E1AB 2A6DB 5MERA 1KCKA 5GS0C 3N1FC 4LVHC 4XHQA 2LU3A 1IC1A 3OKKB 4WY7L 1W0NA 4RFNC 4D6EA 2EE9A 1FO0B 3GBEA 3MCLL 2GHWB 3HAEH 3NAAL 4XUTA 1FIEA 4PRIB 4WI9A 4H0GA 3VFMA 4JN1L 4DZBB 3CFDA 2EKSB 1E4WL 4G6FD 2XY1A 3I6KB 3RA7L 3LB6C 5L0QC 1CFSB 3IDJB 5GNYA 3CLFH 2V3DA 3HKFA 4BSJA 1K42A 5LGHH 4KZEL 1KC5L 1O7VA 3MJ8A 1LP9A 2VLRD 3DYOA 4JZNA 1TMCB 2ZX8A 4Z2JA 2GJ6A 5GRJL 4FTVE 3HNTH 5EC2B 2JF6A 1CXFA 3FZUD 1NQBA 3UTSE 4DEPC 5FIEA 2I5YH 4JM4H 2BVUA 4Z7UA 3MV8B 1FLRH 3IRPX 5GRVK 4OTXL 2HRLA 3FRPG 3F7PC 4YE4L 3W5MA 2ATPA 1UB5B 4NO3A 3EB7A 1YNTB 4LXFA 2DSZA 5I0ZA 1H8OA 2IH1B 3S3PA 2UY6A 1S9VA 1L7IH 1T21A 4M6NL 3VIIA 4X6CB 1P84J 5JDSB 3HNYM 1MIML 2NMSA 4P4KA 3ETPA 3QGVA 1LE9A 3SCWA 5HGAB 3HE7C 1S7UA 1PY4A 3W0WE 4U6HB 3D25B 3QIBC 5C0BB 2XSAA 3RIAK 1R3IH 5E0QA 2WWMD 3O4OC 5DI8B 3S34L 5FYKE 3OF6D 2W67A 1TVPA 3T4AA 5C0FB 3K1KC 4RGOL 3D3VD 4HS6A 4XMPL 5FO9B 1CGXA 3O2VH 4ZAKB 2DM4A 3RWHB 3U37A 1XHGA 2CYGA 1MWAL 5I1DA 4P7OA 2V5SA 3QZWB 2XPKA 4HWBA 2YA2A 2JELH 1XD1A 4PGJA 1RYYA 4PV9B 5GS0D 3LY6A 4KUZL 4MX7A 1C5BL 1XAUA 2APWA 3N85H 5EZOL 5A8MA 2DQCH 4HIHA 4F7MA 5EWIH 5C0DA 4J8RA 4F3FB 1VERA 4M48H 1YEKL 4KHXL 4PJGB 3DURB 1U93B 3ZYIA 4PTTB 2EDTA 2DDQH 3LB6D 3PWPA 4PJXA 4QWWC 3HPNA 2CMRH 3EOAA 4M1RA 3O2WL 4XCEA 1KUMA 4HGWA 2A83A 2AK1H 3PF2A 3LEIA 2GDUA 1IEBA 4NHUA 5EIIA 4UZGA 1I7ZA 5CG0A 4QRPB 1WCGA 2UY2A 4LLAA 1F4AA 2NX5A 3KLAA 4L4OA 3BE1L 4YN5A 5DS8A 3GMLA 3ZE1F 1JK8A 4CVWA 4M62H 1JGUH 1JMZA 4I3SH 1TQBC 4OCWL 4MB5A 2A77L 4BDVB 2Q76A 1NBVL 4O58H 3CZFA 4DN3H 1YC7A 2GCYB 1NMAH 4JG0L 2ATKB 2W65B 3MLRL 1E0VA 3CX5J 3MXVL 2VXSH 1XH2A 3ZLQC 4DTGL 1V0NA 3HE7D 1BGXL 1FZKA 4L8BA 3V95A 2GAZA 1DEEA 4GW5A 3QIBD 1HHKB 3R0MA 4ZFGL 4OZ4A 4QDMA 4Y1AE 3X12B 1JPTH 2ZXAA 3VIGA 3WFDL 1HQRA 2OYLA 1GHFH 4G8IB 1P8JA 1HKJA 2BC4B 5IFAL 1NCNA 2X4NA 2DBLH 4RX4D 2J47A 4YDKL 3D85D 1X44A 3O2DA 3U83A 4NQCD 4P2OB 4A6YL 5F3HB 3PZMA 3RUGF 1MAKA 5GGQH 1M7DB 4GBXC 3RNQA 4HK0A 1U3HA 4R96A 1H3VA 3TN0C 3QUMA 1RAMA 5I76A 3VIHA 5GS0H 4F9LC 2ZOKB 5F7YC 4P7RA 4R7NB 1S7XA 2BSRA 5M03A 1FL5B 2V5DA 4N42A 3V6FA 1Y6KR 3CD4A 3I3DA 1QPKA 4UT7L 4D3CL 2PCPA 4U2YA 2GY5A 1OAXL 5EU7C 1IEAB 4QWWD 5C08B 1BREA 3FHQA 3G6DL 4R4BA 4HKZA 1ZT7B 4QXGH 2X4SA 5JHLL 1SJHB 2I60L 1IQWH 3RUGE 2WMIA 2F53E 1SY6H 2QMKA 4L1DA 1ZHLB 3B9KC 3IDIA 4MO3M 2DI8A 1XF1A 3DYPA 5I30L 2OWCA 5TE7L 3FT2A 1CGYA 1U8NA 4F2MA 1M7IB 3C9NA 2O26U 4AZCB 1RJLB 3GJEB 2P4AB 3WIHA 2OI9C 1W8NA 4Z7QF 1HOCB 1QPXA 3IFPB 3JTTB 3AU1A 4XP4L 2CKSA 4NQDA 4GW1A 2FR4A 5I6SA 1NC2B 1SVCP 5DUBA 5KVDL 5HYSB 4XNYL 3WDQA 3TBYB 4ELKB 1H11A 2AS5M 1EMTL 3C5SB 5D72L 3B9EA 4XXDB 4HLZG 1BM3H 3MLSL 1E6JH 2DLIA 1R24A 4PRBA 3QFJD 3G9AB 5L8KB 4V1DD 2BVEA 1UA7A 2W0KA 4Z7QE 3I2KA 1MVUB 5DZNA 3SKJL 3SBWA 4LCCA 4D8PB 4X4YA 1FFNA 3PWNB 3VM5A 1MJ8H 2BFVL 4YX2L 3FO9A 1ISYA 5F7LB 3H9SA 4F7PA 2VX7A 3MRDA 4H8UA 4GBXD 2ZSVA 4G5ZL 1C1EL 4NQED 1VBRA 1FNGB 1RUQL 3O8XA 3M17A 3TN0D 2VURA 3HG1D 1Z9OA 3GSNH 2OJZL 1EO8L 3HPLB 3EYQC 2Y5TA 3RNKB 1L0PA 1TTGA 4HBQA 4NT6A 4TQEL 4YDJB 1QYGH 2F5BH 2XQYK 1F5WA 4RAVA 2LVCA 4JPWL 3SGEI 4YGAB 1U8PB 5CGTA 4XPHL 2DLEA 1T83A 2IMNA 2R1YB 3PTMA 3TVMA 1N0XH 3D48R 1KGWA 4FRWA 1SEQH 2OL3L 5I15L 2XY2A 4YHNB 5DQ9B 1AQDA 2DIAA 4JO4H 4PGBA 3B9KD 3FQUB 3I2GA 2VQUA 1U8HB 4OUUA 2XN9D 1I9IL 5K9OB 1DWHM 5GGSB 5M7QA 3OR6B 5CJXC 1VRXA 2I24N 2HT3C 1D6VH 3ARUA 3FRUB 4TUJA 5GS1A 5J6GB 5HDQL 5CHNA 3HZMA 1G6RL 3W11C 1NKGA 4PT6A 2DI7A 2X4UB 4QRRE 3PZGA 4HJGB 3WUEA 3FO0L 1A8JH 1U91B 1W91A 3FKUS 1KLGB 4JFED 3ARRA 3GK8L 1XCQA 3GSUB 1RHFA 2NTFB 4G42A 3TO2A 4PJIB 5E8OA 2APTA 3ALGA 4HS3A 3SY0A 1QBLL 4P57B 1Y18B 4G43B 1NDMB 3UTPE 5DJ6B 2VMFA 1MFBH 1JWUA 3SDXB 4BKLB 2W95A 4DFHA 4XPAL 3X17A 3IETB 4GG6A 5EORL 2CIIA 3VWKB 4HLZH 5C70A 3QCUH 1JZ3A 4PRIE 3LS4H 5DJAB 5BRZA 4BSVB 4IDLA 3QP3A 4RZCB 4W87A 1FVDB 1C8XA 3UTZB 2AAAA 4PJAA 4U1IA 2AEQH 1NEZB 4S10A 5D1ZA 3IDMA 3MUHL 3UETA 3U30C 5C0GB 1CGTA 2P5WD 3EYQD 1NLDL 3P4NB 3P73A 2HN7A 4X6CF 3SGKA 3VFTB 5K9JH 1J8KA 4XI5D 2OJEA 2ZUMA 2E9BA 3GYCA 2IQAB 2JIXA 3MLWH 1QFWM 4KWUA 1JVKA 3MV8E 3ZT6A 1TZIB 5DHVH 5E2TL 3WFHA 3WF3A 3BT2H 5BVPL 3FO2B 3ARBC 3BQUA 4D6CA 1AHWA 3VJ6B 3S36H 1I9JL 5I3DA 2DJSA 1NWUA 3NJ3A 4O02L 4O2CB 2ZG3A 1EFXD 4E5XA 5KW9H 1QBBA 4X6CE 3IU3A 2L4OA 5D9SB 5HYQA 2AXGB 2HT3D 5HPMA 1YMMB 3KPLA 5L9DL 5C0BE 2VLKA 3CFEA 2H8PB 4QXWA 4XGZB 1O6IA 5HSFA 4KU1A 3W11D 1TVHA 2PQSA 2B4CH 5C6PB 5HHOA 4LGSB 1OWQA 4FI9A 4U6YA 4PJGF 5CJQL 1I4FB 3MLTA 1A6VH 5EN2B 3N0PB 4BZ1H 3BHBA 3DTXB 1ZGLA 2R2CA 5I1AB 1OGGA 4L8SB 2QQLH 5IW1A 5ENWB 2QPUA 4NKDA 2BJML 2HWZH 2BNRB 3DVFA 5CSUA 1EBPA 5A6JA 4G8GB 1NKRA 4U05A 2ZIDA 4L4TD 3MNWA 4AG4L 4L5FH 1WSST 4C56B 2PWFA 4MJIA 4FQCL 3K46A 2JD9A 4JKWA 4PJGE 1HJVA 1NEUA 1CN4A 3R8BB 4LCIL 3ULUF 3F7YB 3IDYC 5K33A 3UZEA 4ZOAA 3OXSA 1RIHH 3TYGH 3B3IA 2Y7QB 5BXSA 5MENB 4BQCA 4HEME 3CFJB 4Q97A 4QRPE 3QIUB 3LZFH 1PSKL 5EOCL 3A21A 4GO6B 3U0TA 5BJTB 3NFPB 4KZDL 4J3VA 1X1NA 3F12B 3L5WA 2A0LC 4WW1A 4LBEA 3ARBD 1OQXA 3L3KB 1KQYA 2GJPA 5JO5B 1MFNA 5L8JB 3ULUE 5E08H 3CXDH 3STZA 2UWEB 5HXMA 4A4AA 3G6JB 4HPHA 4P5MA 2EH8L 3BP4B 4KK9C 1F02I 4W88A 5I77A 3PN8A 4NJAH 2DQUH 3ZT7A 2DT2A 2WNWA 3ILQC 3T2NL 2DD8L 3VFGH 1P9MC 4DW2H 5BMFH 1XNTA 4FQQA 2HKFL 2H1PL 2X9WA 1UWSA 2CESA 2FJGA 3SDCB 2CKNA 1EHLH 2PR4H 1R3HB 1VFAA 5IMOB 3AXHA 5D7JA 1PQZA 1QSFA 1CQYA 1IILE 2GUOB 5TDPA 1IC4L 1KIQA 3KLDA 1RUAL 2F5AH 3R1GH 4F15C 4XC1H 1XH0A 2QQNL 5F6HI 2DQXA 3SE4A 4G7VL 4X5XA 5KANG 4EUPB 4KY1L 4F7TB 3NA4A 4KUCD 1ZXQA 4A3HA 1U8OA 5K93A 1OGBA 1T2QH 1UM6L 3HLAB 1AFVL 4R7DB 5GHWL 2DN7A 1EK3A 5C08E 3Q2CA 3SKMA 3FB7A 4RGMC 3L3JB 3UJTH 2D7OA 5IBTH 1I8MA 1Q9LA 4M93C 1CE6B 2JB6B 1UY4A 5IJRA 1B4RA 1IC5L 2KL6A 4PJBA 4PJHB 4XNMB 1ODUA 1U8JA 2ENSA 2YPVH 3DV6B 3T2QA 1UEMA 4HA3A 1NGWA 1BPVA 5HHQB 1LL4A 3QDJA 1OT2A 2AI0L 2HVKB 1KEGH 1G84A 3WH7A 4FFZL 4WHTB 2XKSA 2A0LD 3BW9A 5D6DC 3OKOA 1T7XA 4CVXB 1DL7H 1QLFB 2CKBA 1LG2A 2RHEA 5CCKH 4H25B 5BXTA 1KYOJ 2VT0A 1T7VA 4HT1L 1ADQH 3IXTB 4FHBD 1QSEA 4JFHE 1J1OL 1GHRA 1TNNA 1A7QH 2N4IA 1BSIA 4KK9D 3W0KA 2D3NA 4NQVA 2ZKHH 4PFEA 2G75B 4AIEA 3ILQD 1GIGL 3IGAA 3ARFA 4YPGA 1GGUA 1JBJA 2KKQA 2VLJD 4RMSA 4HBCH 2WM0A 3TZVC 1ZJBA 4U1NB 3IYLW 4UNVA 5B22A 1JDAA 1XCTB 1V02A 1LO2H 4G6FB 1IT0A 1BOGA 5GGVH 3N13A 2D23A 1A6AA 2VLRB 2VC9A 5ICYB 2C3XA 2EKJA 1BVZA 4NZTH 3V6OC 2PYED 5DD5L 2HFEB 3BUYB 1KIPA 1PZ2A 5AD0A 1NGQH 4AEIH 4FQHA 3C08L 2DS4A 4RSVA 3CFBA 1WC7A 3EYFA 2ZUWA 4H88H 3E8UH 2IALB 5DO2C 1UG6A 4WI3A 4LCWB 1JPSH 1H3XA 5M94B 3IVKB 4NO2A 2XJ7A 3WHXA 1T3FB 1U58B 3NJVA 1L7RA 4MZ3A 2KZWA 3WXVL 2VISB 1JYNA 1E56A 1YY8B 1ZMYA 2ESCA 4ISVA 2QBXA 1W9VA 1QSZA 1GGIH 2XWTA 4PJIF 1MOEA 3LHPL 5FV1L 5I1GH 3BDYH 3WN5A 4BS0A 4Y19D 3U7WL 3GMRB 3M6DA 2I26N 2O5ZH 1P7QA 3OG2A 4PS4L 4S1SH 1OWRM 3SDXF 4HUWA 3D3VB 1LNUA 3WEXB 1MLBB 5ACLA 3H6JA 2A74B 4L3ED 5KS9A 3MV01 4GSDH 1FE8H 4HH9B 2FJHA 2NCMA 1Q1JH 3CSGA 2NTSP 1GVIA 2MMXA 4LVHB 3ROLB 2E27L 4PJIE 1FAIH 1MXGA 4DGYH 3M1BB 3AIVA 4RFNB 1M71A 3BLPX 3TZVD 3V5HA 3GMMB 1NCDH 1RK1A 1KLUB 1H8NA 1Q6FA 3CH8A 3G5VB 3SDXE 2C1PB 4WF7A 2IPUG 4ZUVA 4U1JB 2XPGB 4XXCA 5L0QB 4XB7A 4P7QA 4LLDA 4OM0H 1IGIL 2D4FA 4GXUN 2VVNA 1U3ZA 1UCBL 2DSVA 5CUSH 4W84A 5JIWA 3I6LD 5I1JL 4PRNB 4GQQA 2YDQA 1KXTA 2P7TB 4DEPB 1CL7I 3U0WL 5EFFA 3W9DB 1MEXL 1IGYA 3MRIA 5T3XD 3HMXH 4UIMA 2UY5A 3KPMA 1H1NA 4HFWA 5L2KA 5I23A 3F2ZA 3DUSA 5D7SH 4PYSA 5DO2D 2CBUA 1R5WA 2QQJA 4OGAC 4XPGL 4I3RL 2CJUL 2DJ4A 3SHSA 5HI5C 5D2NA 4HWNA 1I8LA 4AEHH 4Q6IB 1C7SA 2Q86B 4QDQA 2VDLH 5JLZA 3CIHA 2AP2A 2R2BA 2ARJB 4X0KB 3HE7B 3C60C 3MSGA 1U3JA 1I1FB 2GK0B 1MREH 3QIBB 3WE6B 3PWPD 4JAMA 1LK3L 1Q94A 2E9IA 2JCCA 4WSKA 4KH2A 3O4OB 2A3CA 3IFOA 2EO9A 4PGDB 4ODUA 2A9NL 5E2UL 4YXHL 2ZPKL 2E9LA 1YMME 1F4WL 4PLJC 5E4IA 1KXQA 1EEQA 3D85B 1DUZA 2YKLH 1NJ9A 4NQCB 2NW3A 2WK2A 2CUHA 1E4MM 4QCIA 1JZ7A 1HJSA 3W53A 2YC1A 1CT8A 1B2YA 5E9DA 1FRGL 3FB8A 2ADJA 3VCLB 1PG7H 1KTDB 3MGOB 4EEEA 1CIYA 2OX5A 5EIYB 2FO4A 2BNRE 1VF8A 1UB6A 1O7AA 3MLVH 5ESVB 4G8GE 1JZ8A 1OF2B 3MRHA 4MAYC 5E7BA 3S35H 3UCQA 4XNUL 4QRSB 3P9MA 3DSFL 4X4ZA 1A6WL 3DUHA 2Z91B 5EO1B 3WFEL 2UWEF 4BFIB 3G6JF 2ILLA 3SE8H 3D5HA 3NH7L 4ZD3H 4JANA 4BSWB 1JNHB 3ZL4H 5MENE 1GJUA 1OM3L 4I2XB 3BKJH 2YUWA 1AGFA 4PJ7B 4ACPA 1MIEL 4OGAD 4GAYA 5HI5D 2H2PC 2DI9A 4NRZA 3WF2A 3CFCL 4J3OC 5JBEA 3C60D 5HHXL 4J4PC 4MWFA 3REVA 2V9QA 2UWEE 3MSPA 3G6JE 2FGWL 1T83C 3QFJB 3QJHA 4FQ1H 5MP6H 1RPQA 1XF4A 4V1DB 2BBAA 1RVFH 4KHTH 3PXHA 4PLJD 2CHOA 1XF3B 5EFDA 2V2XB 4TVPL 4ZNEA 3DIFB 1KG0A 3S96A 4FXKB 2VXQH 1NH6A 5T3ZE 2J6EL 2FX7L 2VDPL 2J22A 3C5JB 3DBXB 4HIJA 4GBXB 4LSDA 4NQEB 1WEJL 3ES6B 5E24E 1NSNL 3HG1B 4JKPH 3TM6A 2BP3A 2CLRB 3BIBX 4X6FA 3C7HA 5CZKA 1P2CA 3IU4L 3SGDI 1CGUA 3MBEC 3RWEB 3EFDH 4NQDD 2X4QA 5EMYA 3LDBC 5L2JB 1LO0L 1F11A 4PJHF 3LS5H 1V6UA 4L4JA 5AZEL 4ZTOL 5BV7L 4FP8L 3MA7A 1ZLVH 4X83A 4MAYD 4AZ8A 3ALPA 3MUGA 3VGEA 1J9YA 2E6PA 1MW3A 4XUOA 5DHVA 3BIKA 3FO1A 5I18L 1TVGA 1NPUA 1E3XA 2NY2C 4CL7A 3BSGA 1RULH 1GJIA 3B9KB 4J7RA 2JJTC 2XN9B 4X9GA 4M9OA 4M6ML 2A6KB 4O9HL 4LF3B 4YO0B 3WIIL 4TSAH 1V3KA 2E4TA 1J10A 3EJYC 4ZUSB 2X6MA 2OI9B 4JJ5A 4KJQC 4PJHE 4YFLF 3DO7A 4K3DH 3RDTC 3ET9F 5BS0D 3O8XD 2J1UA 1GOQA 2H2PD 4MNHA 2J79A 4P3CL 4YXLL 2CRYA 4JFEB 2VOTA 4PUBL 4RGNB 4X7SL 1MWOA 4U6TA 1CYGA 4AXNA 3CHFA 4J4PD 1CDGA 3ESVF 3O3EA 1A2YB 1E5JA 4GRWH 2AEIT 5IWLA 1UH3A 1T2JA 4S1QL 3E3QE 1AHWC 3A6BH 4OT1L 2FBJL 5DJ0A 2MWCA 4S1RL 3B6SA 4JE4B 5A3HA 2NY4C 5HYJA 5DJZA 2BRRL 5DD3L 1UQSB 2ID4A 3FCTA 1ACZA 5T1LA 4OOZA 5LGKA 3F7QA 2J75A 3W26A 5HGHB 5DMGC 4J3TA 1QZ1A 3W5NA 2P5WB 3EYUH 3J8F7 1IARB 1OF3A 1FORL 1O0VA 4UQDA 2ZE0A 3ZHKA 1MRCL 1BZ9A 1TCMA 3MXWL 3TBVA 1YYMH 3A4AA 3F58H 1VFBB 4ZZ5A 4OLUL 1KPRB 1U92B 2FHFA 2I07B 1TE1A 5E94B 4Y4HA 1IAKB 4PSPA 2FBOJ 1B4JH 4BFBD 2NY2D 4LCWE 3MYJA 1A3LH 1IEHA 5D8ZA 1AP2B 1EFXB 1MFAH 2QSCH 1IAII 4QXTB 1C12B 2ORBL 2HJKA 1EFQA 1V7MH 1V3IA 4UV4H 1XGUA 3H0TA 4WI5A 3EJYD 5EO9B 1D5IL 2CH8A 4Z77A 1FPTH 4M61B 3RDTD 3VFOA 1KCUH 3CAFA 1DN2A 1YEDA 4ACYA 5FHBH 4X0VA 4AT6B 3HZYA 4NZCA 2BSSA 1XR9A 4C57C 5I1EH 3Q0HA 2Q3AA 3S4SG 5ICZA 4WU7B 2QV4A 2D1ZA 3ALFA 3QCVH 3IF1A 5DF0A 3LKSB 4KRPC 2KQMA 5GGUB 5FFLA 3O9WC 4JG1L 5IESL 1INQA 4CJ1A 1LD9B 1HHGB 43CAA 2CIPA 1SJEB 2WZHA 4UQAA 3BP5A 1CFQA 4U1GC 2VERN 3MRGA 4XZWA 5DYOA 5DQJB 2NY4D 2W1UA 4GXVH 3MFGB 2IPUK 4MZ2A 1CLVA 5TDNB 3DETC 4WW2C 1ISWA 3KYKL 3W4RA 1HNGA 4RWYL 1I1YA 1N5YH 3G5XA 3U30B 1N26A 1CR9L 4LAJH 2W60A 1ZEAH 5CQ1A 5ESAB 2A38A 2DLFH 1HIZA 1QFWH 3UX9B 3QEHA 1XZ0A 5DDHB 5TPWH 4PMZA 4ZFZB 2X4OA 5FF6B 4TRPH 5IW6A 3TIDB 3PTKA 5JMRA 3QULB 4G6KL 3RY6A 4IRSC 5ITFB 1RZJC 3VXME 2FZ3B 2J2ZA 2JJVA 3ARBB 3FB5B 3ACIA 1NCTA 1H6XA 4KJYA 1FG2A 1F6AB 4XVSL 4LSTH 2J88H 2F58L 1PYWB 3NZ8B 1J88A 5E8PB 4IPNB 3H8NA 4HS8H 3JV4A 1PZ5B 4MJID 2IQ9L 3O3DB 5HBBA 5K9QI 2D7TL 1YN7A 1OL0A 3W37A 4OZGB 4DWSC 1MH5A 3UPCA 1UKOA 3VW3H 2O9PA 2PBOA 5INDB 4PRAB 5DRXB 1EAJA 1MVYA 4GUPA 5B3NA 2RGLA 4AISA 3OG6B 3QQ9C 3S6CA 3T0AA 2XA8H 4NSKB 1HH6B 1T89C 2P42B 4YXKH 3FQXA 2X70A 1G1CA 3O11B 5AC4A 1T0PB 4NQCE 5GQBA 2R4SH 3O9WD 1QEWB 1ZLVK 4YBLC 1PIGA 4GKLA 4QTHA 1MUJA 1OAYH 4U3XA 2NW2B 1F4XL 4QLRA 4GWIA 5IK3A 1W2VA 3FFCA 3VU2A 1KCRH 3H9YA 3VH8A 4Q9QH 4OZOA 1G7MB 3NTCL 1DQLH 2PO6C 3X3GL 1G7IA 4PJ7F 3VFWB 3DETD 2RJMA 4XCNA 2FRGP 4PG9A 5B39G 1J9CT 2HVJA 4ML4A 4LHUA 2D7NA 9CGTA 2X7LA 3PGDB 1DE4A 2J25A 3TYFA 3CQOA 3PIQA 1P4LB 1UA6H 2VZVA 4XP5L 1OT1A 3KR3H 1QSFD 4UOW1 1TENA 4IRSD 4R26L 1AJ7L 2HISA 5E8DL 4I2XE 5FYLD 1W0VB 1DLFH 2DTSA 5D9NA 4WEBL 4Q0XH 3MV9A 1L7TL 5FA3B 4JY5H 1YEHL 5JHDA 1NLBH 5TQ0H 4V28A 1D5MA 3LKQA 1K4DB 3NRUA 1MCDA 4DWSD 5DT5A 2VLJB 4N90D 3VXQB 3UTQB 5FYJL 3L1OH 3FQWB 6FABL 2CLZB 4PJDA 1BZ7A 4UAOC 3RWCA 3QFJE 4JM2A 3X13A 2CIKA 5KSBB 1BWMA 3EFFA 3QQ9D 3BSZH 1HL9A 4HU8A 4L29A 4F8TA 1ZBVA 4LLMB 4NUJB 1H3TA 5A16A 2AK4D 1XCWA 1GQIA 3WN5C 1NARA 4CD8A 2Z4FA 3QDJD 5HY9B 2PYEB 4M1GL 5HI3C 4NQEE 4CMHB 2RGMA 4F15B 3HG1E 4HPOH 4LU5L 4OCRL 3TJEH 5J3HC 2B39A 4X6DB 3QEGH 3X14B 4JPVH 3HI5L 5EFIB 3MRKA 2PO6D 3DRQA 2OCFD 3GBML 3TT1H 2VZSA 4OZHA 3WJLA 3TA3C 5EU7E 2R2EA 1EXUB 5A2CA 4GMTH 5IR1A 2AQ3A 4OFYA 4RGMB 1QFUL 1CDCA 4XRCA 2AEPL 4C7GA 4JDVA 4JFXB 1RJYB 3OGCB 1L9MA 3N1AA 2DQGH 4PMRA 5H8DA 4HCRH 1G7JA 2DLTA 2EYSA 4NQUA 2XN9E 4RQQA 2BVTA 1NUKA 2Y07L 3I2CL 4JZNB 4JPIA 1I9EA 2Z4QA 1WBXA 3SDAC 3MCLH 1RZJH 2YB7A 4WIWA 2GEEA 4JN1H 3ARWA 1QRNA 4AZ5A 3WO4C 1E4WH 1RUML 5I16A 4Z7UB 1N2RA 4NF7A 2AXHA 3LKRA 3QDMD 4QHLB 4KZEH 1KC5H 4RGNE 2ATPB 4NO3B 2EDHA 2VL5B 3WSQL 5GRJH 2BGOA 2UWFA 1S9VB 1FBIH 4XP1L 3TZVB 4ZFMA 2V7HB 2WZPD 4URTB 4OTXH 1LE9B 4MDIB 4YE4H 5MHSD 1S7UB 5I9QC 4BJLA 4OD3L 3AYRA 4N8VG 3V0WL 3GFUA 2OLHA 4AZBA 5DURD 2X44D 4M6NH 1NBZA 1RMFL 1NL0L 3T4AB 5EG6C 3DMMA 5HI3D 4NFDA 3L9RA 1MIMH 3AZTA 4HS6B 1KB5L 2X89D 4LPTA 2B2XL 3VRIA 2P5WE 5J3HD 3PXJA 3DHPA 1FV1A 3TA9A 1B3JA 1VEMA 4H5SA 3GMOA 5D96C 3ZYJA 5I1DB 2VYRE 4JZJA 4A42A 4WSJA 5EBWB 3S34H 4K68A 4J12A 4C7DA 4AL8L 1RK0A 3EW3B 4Z0XA 4KKCC 4XCYB 3TA3D 3DSNA 5FGBA 1AQKL 4XMPH 4HIHB 5C0DB 4BQBA 2YUXA 4LAQL 1MWAH 2WSPA 1HKLL 2VXUL 3T3MF 3PWPB 4PJXB 3D2UA 1XIWA 4DXTA 5D7LD 1C5BH 1SYTA 4ZE5A 4XCEB 5EZOH 4JPKL 1UJ3C 4HGWB 1UXSA 2A83B 1P6FA 1K6AA 3SDAD 3D69B 4QX2A 1YEKH 4H0HB 5EIIB 5EU3A 1I7ZB 1K12A 3KLAB 3F5JA 3WY1A 5KSUA 1I5PA 3V4PL 3O2WH 4W6WB 1OD9A 1FL3B 5IVXA 1PDKA 1GAFL 2Q76B 5D6CB 3T3ME 3S37H 3CZFB 3KLSA 1JHJA 3PQYA 4KGLA 4KVCL 4M7KL 2VZOA 3BD3A 4XT1C 5JDJA 1AGBA 1CXEA 1VADB 3NSMA 1KB9K 4HUUA 1GYAA 1FZKB 4L8BB 1ULPA 2A77H 2GAZB 3L3HA 3KYAA 4PMXA 5IFPA 1NBVH 4TTDC 3MJGX 1HQRB 1H5VA 2B1AL 4XC3L 1A9BB 1W8OA 3RP1A 5C86A 1V7NL 5FDWA 2YRLA 3MLRH 1UR9A 2B31A 2ZEYA 1E6RA 3MXVH 3QEUA 4RYDA 3MACL 3Q48A 1ZV5A 4DTGH 1BGXH 4N0UE 5GGTA 3U9PH 2JEQA 2PKDA 4ZFGH 5MEOB 1MJUL 3WFDH 3ZYOA 1J0HA 1FO0L 4OZGF 3LQAL 1WFNA 4LCUA 5CEYB 4R96B 3MNVA 4KKCD 3ZYZA 5I76B 5A2AA 5IFAH 3TJHC 2FEEI 1FNEA 3MS8A 1BFOA 3VFVA 3L4ZA 5TD4A 4YDKH 1MXDA 3V6FB 5IB1A 4A6YH 1UWUA 3MRPA 4C83B 3VGFA 3C60B 3I2FA 4GRWB 2PCPB 1DHKA 5LQBL 4W4ZA 1W0YT 4R4BB 4HKZB 5F7UA 1MYRA 3IAQA 4G6ML 2WMIB 2QLVB 4OZGE 4P46A 1XGTA 1UYQA 3WNKA 4UT7H 4D3CH 4N1HB 4KUCF 5IROC 1KWGA 1OAXH 1QO3A 4NBYB 3BCDA 1A1OB 1B0GB 3C9NB 3OZ9L 4NKIL 3OKDA 2VRQA 5JHLH 2I60H 4KKAC 5BCAA 1L9NA 3VO0A 2BFGA 1QG3A 1JGDA 2MPAL 3HE6A 4D71A 3AU1B 4U1KB 5IEKB 4UU9B 43C9B 4JFFD 4OD1L 4NQDB 4GW1B 4UILH 3QXTA 4S2SA 3GSWA 4ETQA 5I30H 4HDIA 5TE7H 5DUBB 5ILTL 4WWID 4U0RC 3QQNA 1T1WA 5C0CA 4N0YL 5C3TA 2C1OB 5BWFA 4MAYB 1W99A 1CECA 5LXGL 4TTDD 4XP4H 3JWDL 5IWLC 4PRBB 1GCFA 1AE6L 1FP9A 3L5XL 5KVDH 3PWUB 4XNYH 4F7EB 4WJXA 4JL1A 1T04B 1UWRA 1FFNB 4LEOA 1RH9A 1EMTH 1R3LA 4JQXC 5IT2L 4UFHA 1GOOA 3H9SB 3MLSH 3ARSA 2LU7A 1IKFL 3BH8B 2EICA 3VXSD 4FQLL 1UZ0A 3MRDB 3GGWA 2ZSVB 5I19L 2LFGA 5BS0B 1ZOXA 3CUPA 3M17B 3O8XB 4WFGD 2CLVA 3TJHD 4A45A 5KSBF 3SKJH 3EO0A 1ZVYA 2NSXA 4NT6B 2BFVH 4K7FA 4YX2H 5ABHA 4RAVB 1M04A 3ULSA 1Z5LB 5CP3H 3VG0L 3TH4T 4G5ZH 1B3XA 1C1EH 1AD0A 2YZ8A 5DFVC 5DC0A 4C4KO 1KULA 2OBGA 1CD1B 4KDTA 1EO8H 5J9PA 3MSDA 3TVMB 4MCYA 4U3HA 2EPOA 3ROOA 5E2JA 4QRUA 4TQEH 1G7QA 1WIOA 2NY0C 4YBHA 2VLJE 3F8UB 4JPWH 4X6DF 3PABA 2EDRA 5DTFA 4OF7A 5KSBE 2GFBA 3TC9A 3ULUL 4XPHH 1SHMA 4KKAD 4ZE4A 3CPLB 5F6IC 5FO8A 4R97C 2E7BA 1JFQL 2OL3H 5GS1B 5I15H 5CHNB 3HZMB 1SYVA 2FJFA 4W7WA 5J6HB 2PYEE 3LDBB 5DEZA 5DD6A 2D31A 2J7LA 4JRYD 3TO2B 5ICXA 2VLLB 3AHYA 3VIPA 3BEVB 2IWGA 4X6DE 3SY0B 3CMOL 4P59L 4EXPX 2J4WL 5HDQH 2CPCA 3GSOA 5AEAA 1G6RH 1VKXB 3PZTA 4L1HA 2NY2B 4H7VA 2D0GA 3FO0H 1AQHA 3JXSA 3GK8H 4Z7UF 4XAWH 3BWAA 4PJFA 3IDGA 4GG6B 2CIIB 2HH0L 3CVIL 3V6ZB 3U6RA 2R4RH 5C2UB 5BRZB 4OJFL 4W5UA 4Y8AA 5T1LD 4PJAB 3RDTB 5A6LA 5D1ZB 3IDMB 4HX1A 2VQ1A 2QPSA 4EN3A 4XPAH 3ARQA 1II4E 1CLCA 2F8XC 1BEYL 2HN7B 5EORH 5KOVC 3NYDA 4P48A 2OSLB 4YHPA 1Q9KB 2OJEB 2Y8KA 3T0XA 2JIXB 4HZLA 4F9DA 5LA1A 4KKLC 3JV0A 2XFXB 3H9HA 4Z7UE 5DFVD 1A4JA 2BOBB 2YEZA 3WFHB 3LKNA 5E00A 3KL3A 1D5XA 2IAMA 1NLDH 2DWEA 1HQ4B 1SJXA 2EDNA 2W61A 1AHWB 4CMMA 4M29A 3RZCC 5C2BL 3GJFA 3WXWL 2VJXA 3T4YA 1LWJA 5I1CL 1D7PM 3VXUA 3QUYA 2NY4B 3FFDA 4E5XB 3P0YL 1HN1A 4Y2DA 5E2TH 1W9PA 1ACYL 1YZZA 3GMQA 5HYQB 5BVPH 4P5TC 1OW0A 5IFJA 1P4BL 1FVEB 2WMPA 5DVLA 1T1XA 3CFEB 2P46B 4O02H 3A4WA 3V6OE 3HMWL 2R39A 4XAKD 2VLMD 1ORQA 2DJUA 3MLTB 4UNUA 1UD4A 4U1SA 4TVUA 3BHBB 4OLEA 5T3XE 2G5BA 3LV3B 4LLQA 5L9DH 5BRQA 4C4KT 2BVDA 3WHE1 3CU7A 1ZS8A 2X4RA 3W82A 4NKDB 1CWVA 3BKCL 1F3JA 3K8LA 3JSSA 3LQMA 3JUGA 3MNWB 3UP1A 4MJIB 4XH2B 1MHHA 3KPRA 3SKOA 5JPMB 1E43A 2WVUA 3SKUD 2WBWB 5IVZA 4RFEA 3ZE2F 2OSWA 2C3HA 2F8VA 4AYFA 2VDOH 5DA0B 4OFPA 1N6UA 4GKNA 3PWPE 1P5VA 1A7NH 2BJMH 4PJXE 1TJIL 5CJ8A 3BGAA 1CNVA 2WKLA 5F71A 3HFML 1S7RB 4AG4H 4HKBB 4FQCH 3WUBA 3V52L 3K1DA 3ZTJG 4MJ2A 1VSCA 2PW1A 5AZ2L 1QHZA 3SGJC 4KKLD 1BOYA 1BQHA 4LCIH 3U0TB 5SWSD 4HFUL 3O9WB 5AYBA 4W68A 3L5WB 3FT3A 4WW1B 3JWOL 4LBEB 3U57A 3ZE2E 2EEXA 3OL2A 1KWKA 3RZCD 4U1GB 2WMFA 3IB4A 4ZFFB 5CAYB 1JNJA 1PSKH 2VDRL 2WV3A 4M7JL 4HKJA 4P5MB 5EOCH 3C8DA 4XPBL 1H9VA 3E6HA 5IEHA 4E4PA 4WW2B 4P5TD 4QB6A 1QI5A 4HKXB 4XNZC 2AJYH 1DSFL 4GJTB 5F7NC 1T20A 4FQQB 4EI6A 3CC5B 4F66A 4U2ZA 1MCJA 4UNTA 2ESVA 2GIYA 3PNWA 5KSAC 1BG4A 1HI6B 4MDPA 2XTLA 2DT1A 4GRWF 5EBLB 1JHLL 3CSYA 2BSTA 5HVFB 3AY4A 1QSFB 5HYFA 3T2NH 2DD8H 3K3QA 2BNQD 4IRSB 3UJIL 2YJQA 1MJJB 3VH8G 1FHDA 2HKFH 2W46A 2EO1A 5TDPB 1OY3B 4EDWL 2DH2A 2FIKA 3ARYA 2I25N 3SE9L 1K8IA 2G3IA 3OTTA 1V05A 1NC4A 1HSAA 4ERSL 1OB1A 2XWJA 2Y6HA 1U8OB 2RB8A 5E0FA 3MLPA 2BMKA 5GNZA 5EBMA 4GRWE 3BZFB 4DWSB 4GKSA 1IC4H 2VKXA 3CH1A 4PJ8A 2HFGL 3SKMB 3CUIA 1H2JA 2QQNH 3D9AL 3FB7B 4MNQA 1UY0A 4JFSA 4G7VH 4X4XB 2AABL 1PX4A 3EDKA 4O2EB 1I8MB 4KY1H 3QAZC 4PLNC 5IHZB 3QXAA 2B9VA 1TCRA 5JR1L 2GKIA 2AK4B 1AGDA 1UM6H 2HJFA 1NGWB 4GRMB 5GHWH 3QDJB 1MCBA 4HIXL 3RM8A 4L8CA 2QJDA 4HA1A 1BVLB 1QRKA 1UZ6F 1WDSA 1RIUL 1INEL 4YBLB 5FOBB 1XT5A 3OKOB 1M4KA 2P8PA 3QHOA 4L3CB 1IC5H 2D7PA 3ZTJH 3GIVB 5F72S 4NQDE 1RHHA 1F6FB 1Q6EA 4L4VD 5CLTA 4OQTH 2AI0H 1NUGA 4FFZH 3QBTB 4NQVB 4X7DC 1JFXA 1U95B 4OSUL 1HILB 1JIBA 3VXRD 1NWSA 4OCNC 4X7TB 3IGAB 1EEUA 3UDWA 1GH7A 1TVDA 1MWAB 4HT1H 4WVRA 3MC0A 3I02A 1UZ6E 1J1OH 3OPZL 5F7MC 1VPOL 5KSAD 4M56A 3ME0A 3R0NA 1I8KA 2BVPB 1A64A 1G6VK 3O6LL 4P8XA 1B88A 2WXDM 1A4KA 1U8QA 2W59A 1I3VA 1KEXA 1GIGH 2Z31A 2X1QA 3LN4A 4Y4KA 2CETA 3KL5A 3WQ5A 3H9SE 4HUVA 1TETL 2FLRT 1JTTA 4J6RL 5EU5A 3NCBB 3EGSA 1C8YA 3AROA 4ZODA 1D5BB 2C4FT 3WS6A 2E6JA 4RFOH 4MA7L 1KIPB 3WQ8A 5BS0E 5AD0B 5D4QA 3D39A 2NQCA 1TG7A 4FQHB 4ZPVA 3QDMB 1WC7B 3EYFB 3OKYA 3UYRL 2VITA 4JZJC 3HUJA 2PF6A 4MADA 1M6OA 1SBSL 1P5UA 3H3BC 5DD5H 4NO2B 3WHXB 1YNLH 3WDJA 5JW4M 4UAOB 5JW3H 4ATDA 2R0KL 3ZO0A 3C08H 3NN8A 2NPLX 4B7IA 3LEKA 4ISVB 1UKSA 3CZUA 5IHSA 3ALXA 2OR9L 5IKCA 2F19H 3C87A 4BH7A 3WN5B 3NFSH 5DURB 3EMQA 3KG5A 2CRMA 1N5AA 3OGVA 4D0QA 3I2HA 4KK8C 4CGTA 3WXVH 4HUWB 2WUBH 4Y5VA 4G9FA 3C8KA 4GG6F 1HKKA 1L0QA 2NY3C 5ANMA 1C5DA 3THML 3U7WH 5KS9B 4UFKA 1EGJL 4TYUA 3DVNA 4QDSA 2R8SH 1AMYA 2FJHB 4RL3A 2BY2A 3G04A 3OB0K 4PJAF 4PS4H 3TA3B 5T3ZL 4ESKA 5B8CA 2Z8WC 3I3BA 2W1SA 1DWIM 5F1SA 1IVLA 3AYSA 1GGCL 2E40A 4A6YB 2AV7A 4MMZC 5A2IH 4PBXA 4U7SA 4M80A 2QQOA 4A3ZA 3PHQA 4FOMA 1UQZA 3D0LA 4LLDB 5CGMA 4GG6E 5D7LB 1CFTB 1T4KA 2X40A 3RKPA 4TOYL 1TLKA 3WENA 5BRZE 3OMZA 3L3GA 3SDAB 1KXTB 4PJAE 1HJUA 4PJ9C 3WO4B 1Q38A 2HJLA 4DCQB 3VFNA 1BF8A 3MRIB 3BYYA 1IGIH 2VABA 4YHKL 1JE6A 5I1JH 3X11B 4B5EA 1QNRA 5FB8A 4UZUA 2QQKH 2R1WB 4ZUTA 5FIPA 3BYTA 4NO0A 3U0WH 1UWTA 1KQZA 5D2NB 1MEXH 1LEKA 2D3LA 5LCWL 3SKNA 5JLZB 3HU7A 1CFNB 3BO8A 3O3AB 4Z2KA 3WDRA 3DX7A 1I7UA 3UYOD 3D2UD 2JCCB 4UQBA 1ED3A 1O8SA 4XPGH 3HMCA 2CJUH 5CSGA 1DN0A 3QO0A 4KK8D 2JELL 5HPOA 1H41A 1IAOB 3W9EA 4YK4C 4Q22A 5BVJA 4Z2LA 1NJ9B 3A4XA 4OCYL 2NY3D 5ERWA 2NW3B 3P4MA 5D96B 5HHOE 1DUYA 1LK3H 3BZ4A 4QCIB 4M48L 3WF0A 4G8EB 5HJ3A 5E2UH 2A9NH 2YC1B 4YXHH 1CT8B 3ILPB 2J62A 3N1PC 3FB8B 2ADJB 3HE6C 3LEXA 4TVPD 1F4WH 3N15A 1CXIA 5HYIA 5JW4R 1NAMA 4PRWA 1IM3A 2FD6L 4AIZB 4EI5C 5CSYA 5B4NA 4YWGL 4RMVA 25C8L 2OTUA 3MRHB 4AYSA 4MJIE 2V2WA 4M62L 4C59B 1A3RL 4Q9CA 2V7NA 4FG6C 1CGVA 3D18A 5CPTA 3T65B 1ROWA 4RAUA 1FH7A 3QRGL 4WUUD 3WS3B 4P99A 4MQ7A 1Q6DA 4GZJA 4JANB 1CF8L 1UXWA 2RQ8A 2OL3B 4XNUH 3T8XA 4WW2F 1AD9B 2LTQC 2ZUSA 3DSFH 4MHHI 4P23A 1AGFB 4LHSA 4QO1A 4P2QD 4PGZA 4JFFB 3B2UC 3WFEH 1S7WB 3VGDA 2F8OA 1SEBA 3FT4A 3GO1H 5L88L 4OGYH 4NCC1 1JPTL 1X5HA 2AJZA 2K9UA 2EPMX 4OKVA 3NH7H 3ZE0F 1CGWA 4MWFB 1XF2A 3TFKC 3REVB 1MIEH 4NFCA 4JCLA 4YGVA 3SUUA 8FABA 1JNLL 3MFFA 2WC3A 1CXLA 5GIRA 2J7EA 5DSCA 4PJCA 2WABA 4TNWF 4UQ3B 4ET7A 3MGTA 3NGBC 1PX8A 1BZQK 3ZDZF 1IFHL 1S7VA 5DRWA 3CFCH 4DUWA 5HHXH 1KG0B 5DT7A 4LLYA 3GSVA 3VXSB 2FGWH 4R0LC 3ZE0E 4MNJA 3OZOA 2OXHA 2JTDA 2Z9TA 3LAFA 1QSFE 3HE6D 3CMGA 4X6FB 1P2CB 4TVPH 2X4QB 3GXMA 1VENA 4YHIA 3AS0A 5FYLE 4AQOA 1F11B 1KBGL 2FX7H 2VDPH 1EHXA 4EI5D 3TEUA 1Y6NR 5DUPL 3ZDZE 1F4HA 3MA7B 1ZT4A 2LV4A 1NSNH 3MU7A 3PDDA 1R3JA 4YFEA 3IU4H 4RDQG 3FO1B 4JY4B 5K9KA 3FNDA 1I85C 3K2UL 1LO0H 3C6SA 3O6FA 4FG6D 4N90E 2DTML 3L95B 1WZ1L 4ZTOH 5AZEH 3Q5TA 4PY8J 4FP8H 5BV7H 1AGCA 4IRJA 4JFQA 3VE0A 1E6OL 1AKJA 3PUCA 4E41A 3SE3A 4JJ5B 4OM1L 4PJBE 3DO7B 1RU9L 3CZEA 4QPWA 2CGRL 3B2UD 3QDJE 2NYYC 4EN3C 1BM3L 3KPNB 2X0YA 5A2LH 3RFZC 4M6MH 4O9HH 4AZ7A 4CW1A 1XPWA 3BKYH 3LCYA 4JRYB 4U0RB 1ES0B 2KH2B 4Y16A 5IB4A 3WIIH 2BVQB 5E2WL 2LVEA 5IB2A 3O41A 5FDYA 4RA0C 3TFKD 1QSEE 3O3EB 2AJUL 3S98A 3DVGA 1CBVL 3WUGA 1ZA6B 3FN0H 4YXLH 1Z2KA 4PUBH 3N17A 4X7SH 5FUZH 5DJ0B 4BQ6A 2XGBA 1RUPL 3QUYC 4Y5XC 1RZ7L 1UA3A 2Y9RT 4WRLA 5DVOA 1V02E 3FCTB 4WUKL 1BD2D 5T1LB 4HA4A 3AS3A 4MJ4A 3HNSL 3RPIA 1YYLH 1S9KC 3EMCA 4MB1A 3OKEB 3GNOA 3FMGL 4ALAL 4OT1H 3STLA 4NKQB 5KG9A 4S1RH 4MNLA 3LMYA 1N0XL 1WTGT 2D9CA 5DD3H 4OYUA 1LEGB 4W5ZA 4K9EL 2ITDB 5I75B 3TT3L 3QDME 1MCCA 4UIKL 3L4WA 2IBGA 4EDXA 1EUTA 5A94A 1BIHA 3NABL 3HRPA 3OAUL 4WDIA 3OLGA 3ZO9A 1W1YA 1US2A 3BGMA 4JKKA 2I9TA 4XVHA 3GSQA 4R8WL 1MCWM 3MXWH 5SWZA 5KS9F 2HJKB 3C7OA 3BP7A 5DGRA 2DQDL 4OLUH 1RZKC 3Q6FB 5MHSE 1VCAA 4KI1A 4GZEA 5F6IB 1F2QA 2DGAA 4R97B 1YC8A 3TBSA 2YLAA 1OTTC 3EOTL 3SCVA 2NYYD 4EN3D 1F3DH 4UDUA 5SWQA 4OFIA 4F9PA 2ORBH 2BSSB 3N18A 1S9XA 4UOW0 1MFBL 1JF1A 4UFLA 2OLDA 4Z95L 4DFIA 3S36X 2X4TB 1HP5A 2EECA 5KS9E 1HWGB 3QQ4A 1U8LA 2HFFA 1INQB 2ZXDA 1VFMA 43CAB 5GGRA 5HVGB 4ODXA 2P8LB 3WIFA 4QHKI 1HP4A 1R6VA 1QNSA 5DYOB 1FFPA 3QUYD 4NIKB 2VSCA 1WGOA 3RGHA 5BQ7B 3E0GA 1EIBA 4JG1H 2WC7A 2VMEA 5IESH 4YJZL 3MLYL 2E7LA 3G5XB 2R0LL 5D7LE 4LK4A 3HZVA 5A1AA 5C71A 4QYOB 1F4YL 2C8NA 5D8JH 1HINL 3WQ6A 1XZ0B 4QOKA 3TV3L 1EX0A 4TNVF 2JCCF 3KYKH 5A6AA 4RWYH 5SWSB 3KAAA 2J8HA 2R1XA 3SCQA 2IUZA 1CR9H 3NCMA 3WF4A 2PN5A 5ID0A 1UMIA 3QUZA 1ESWA 5F88B 5F1NA 5D2NE 2BOCA 5BW7A 2FDBP 4W86A 4G6KH 2OXGA 3KPRD 1W2PA 1YN7B 3F62A 4P5TB 4QX3A 2VTFA 4JVUA 3VGAC 4NKOA 4EAMA 4XVSH 1OTTD 2JCCE 4FLOA 2F58H 2HRPL 4ZO7A 3IJ7A 1HEZA 4YQXL 1G7PB 1UVQA 2IQ9H 1PKQB 3FQXB 2X42A 1D5ZA 2D7TH 1DWGM 3EOYG 3QNZA 3GRWL 5FYJD 1QW8A 1B1YA 3L4UA 4OZFG 5DK2A 4PLKC 2JALA 3LRSB 1WCBB 3H7LA 1UR2A 3DV4B 4O5LL 2YPKB 4FA8A 4NSBA 3IDXL 4W7VA 3DECA 3MJ9A 4HXBL 1WT5A 3VH8B 4TOQA 5I71C 1JGIA 5H35A 1RZ8A 1R8LA 5F89B 5AG8A 3BLKA 5IJKC 1G7IB 1UEYA 5JIKA 1P4IL 4RIRA 3LZFL 4NC2B 4XCNB 4PG9B 1F4XH 5I8KL 4OCLC 4XZUG 5IM7B 2VRAA 2FH6A 2VH5L 1EVTC 4RMUA 3F6IA 4ZTPL 4Y5YA 4QHMA 3NTCH 3TYFB 5CD3A 4PR5B 4OF6A 4N9OB 1A6UL 3PIQB 2EDFA 4NC0B 3X3GH 1EEYB 5EB9A 1NM9A 1QLEL 2Z93A 2XUCA 4NZRL 1TNMA 2Z31C 3MMEA 5EC1B 5EBGA 1JGEB 5JXIA 5DJ8A 4MGXA 5C09A 3RY4A 3I6GA 1KCLA 4JFFE 4OB5L 3HEIA 5J06A 1NC4D 3MV9B 4A6OA 4UOJA 5CSZB 4L4VB 4XP5H 1JAEA 5DC4B 4Z7VF 5A2FA 4LPWA 4KI5C 3RHWK 1EHLL 3OR7B 3AISA 4R26H 1AJ7H 1OM0A 3LKQB 1Y7VA 2OZ4A 3D0VA 5E8DH 4Q9BA 4ZNCD 1KXVC 3OAYH 3EDDA 2F53D 3DGCR 3T0DA 4PJDB 4WEBH 1BZ7B 4MNQD 1OGSA 2NR6C 1KIRA 4Y2OA 3G6AA 3X13B 5KSAB 2BVOB 1L7TH 1U8IA 3MRRB 3WQBA 1YEHH 5ABEA 3QIWA 4PJ5A 5EOQL 3IJ8A 2CDGB 4HQQL 3R1GL 5A16B 4HZ6A 4ZNEE 5AUMB 3MJ6A 1QLRA 2P47B 3AHXA 5FYJH 3VXSE 1GVYA 1NOFA 3AM8A 1T2QL 4PLKD 1UCTA 3BXNA 4YIQA 4C7FA 1C93A 4NOFA 4WFGE 1ZKAA 5A43C 3IDNA 1IZJA 3V6BR 5BO1L 2QEJA 4NQSA 3PHSA 1ZHNB 3ZMRA 4RRPA 4OZFH 5IV2B 1TJHL 4ZPTA 5IR1B 3JV5A 4LU5H 4OCRH 3DHJA 1BBDL 2AKRA 4XRCB 4JDVB 1HDMA 3QAZB 2F8QA 1KPUA 4KMTL 5JW5A 5LWYH 4PYHA 3HI5H 1BJ1H 1GSMA 3C5ZA 2FB4L 4CKVX 4YHOH 1G7JB 1MPXA 3DC0A 4WEUD 1UENA 4K8RD 4RQQB 3W2DL 1KCSL 5C7XL 3LKPA 2Z31D 3CHCA 4JPIB 1QFUH 3VGGA 2AEPH 1WBXB 3DX9A 3IAPA 4L8DA 3W25A 4GZ9A 3M7SA 4HJJL 1IKNA 5C0AA 1QOKA 4L0PA 4D1IA 4HIEA 4RNRA 5I16B 1HIML 3QXUA 1QA9A 3FB6A 3MJ7B 4O2FA 2UZIH 4GW4B 3EO1B 2Y07H 3I2CH 3I75A 4JRYE 4KI5D 5CWSA 5DMJB 3HR6A 2D22A 3AREA 1UH4A 3VWJA 1H6YA 5C8JA 4Z0BH 4PLOB 3UZVB 4PD4K 1NUFA 1IGJA 2NR6D 4TVSa 1NCBL 2OR7A 2C4FU 4PCTA 3HNMA 4N5EC 1TJGL 4X98B 4GRLA 3WSQH 1Y6MR 1GOGA 4NGHL 4AEIL 1S46A 3BZEA 5E56A 4XP1H 2YS4A 2W4XA 2RCSL 1NBZB 4K23H 1UY3A 3HTLX 2EE6A 3WKNA 3L9RB 4P9HL 4IM4A 1MCHA 3O4LA 4G9FD 5I0DA 2EXWC 2Z35A 3BEWB 3CSPA 5SV4A 5DHYA 1SJVA 3VRIB 4OD3H 5A2BA 1B9ZA 1UXXX 2HLAA 3V0WH 5HGBA 5IJVA 4JZJB 3G6MA 2IFGA 5LBSL 3RJDA 3F5LA 3AHTA 1H3PH 2VXTL 1GGIL 1NL0H 1RMFH 4OIAA 3UTPD 4E42B 4MXVF 4MNMA 1R3KA 2NXYC 2R23B 4HZ7A 1JUFA 2B2XH 1UD5A 1J5OL 2O5ZL 2Y6GA 3DXAA 3NUKA 4S1SL 5J1TC 1XGPA 3FOLA 5BRPA 1PMJX 1K9TA 3D2UB 4AL8H 1XIWB 2JK5A 1V6WA 3P11L 5D1QC 1AXSA 4JHOA 3Q3GB 4XMKL 1ONQB 2NW0A 4BQ5A 2GSIA 4U49A 4LAQH 1TXKA 3O6ML 5EU3B 5KANI 1HKLH 3QH3A 4MXVE 1G9ML 5FK9A 3UTTA 4RA3A 4DGYL 4RAHA 4X6EA 5IHLB 4XAKE 3D1MC 1NCDL 2VLME 3BAYA 3MV8D 4JPKH 4Q7DA 3K7UA 3MRLA 4P23C 3PWLA 4DM1A 3BRDA 4OM0L 4PRPA 2VCBA 3LEVL 5F9JA 1VAHA 1FYTA 1AGBB 4HUUB 3V4PH 4N5ED 3HI1A 3VTRA 2J6EA 4MJ6A 3ZR5A 2YL6A 1GAFH 4NRXA 4JDZA 4XURA 3NBNA 4PBWD 1JV5A 4KVCH 4M7KH 5I6XC 2AQ2A 4NZDA 5D7SL 1AR1C 3VRJB 1AGEA 3L7EA 5G04L 2EXWD 4WUUB 1FL6A 4AEHL 3EOBA 4EIGB 1KELL 1U6AL 1JRHL 3OX8A 4AMKH 4Z2GA 1LGVA 4MNGA 4P2QB 4XC3H 3QG7L 2W94A 1V7NH 2BHZA 1K8DB 4GO8A 5SWSE 2NXYD 4X5WA 4BH8A 3MACH 3D3AA 1FZOB 2E26A 3CXHJ 3OAYK 4MD5B 3MRPB 4YFDB 3MUIA 1MJUH 5BXFB 5C6WH 4G8FA 1FO0H 5BOPA 3LQAH 5F70A 4MQTB 5D1QD 5KVGL 3ACGA 1E6ZA 1BFTA 3KJ6L 5JNYA 3NOIA 2BVYA 5DLML 1E0WA 2WWCA 3VI3E 4YK4B 3U9UB 2GTZB 1A1NA 1F8TL 5LQBH 1QO3B 3GBNL 4EIZC 1TZGL 1J0JA 4IRJC 2OQJB 1UD2A 3SE3C 4BUGA 4G6MH 4P23D 4G7YL 15C8L 3HE6B 4P3DB 4NP4L 3MROB 1QI3A 4QB2A 1CDUA 2DYPA 2DICA 2H32A 3BVNA 3NIYA 4KTEH 1C92A 4S2SB 4ETQB 5L8LB 3T0BA 4CCCA 4L9LA 4EI5B 4Y16C 3OZ9H 4NKIH 5E03A 5C0CB 2PETA 1HXMA 3FTGA 4W4OA 4ZUWA 5KVMC 2MPAH 4ZOCA 3RWFA 1LILA 3SE8L 3GB7A 4OD1H 3JVGC 1L6ZA 1F58L 3ZL4L 5T3XL 3BKJL 3V8CA 2E5EA 2C3VA 5GSVA 4U6XB 5ILTH 4HWBL 1UMHA 4A41A 3CDYA 1AR1D 1SYSB 4HAGA 4J28A 4N0YH 2O9RA 4HEPG 4JVWA 2QLYA 5FHAL 5LXGH 4BYHA 2J1KA 3JWDH 5JORA 3ZJ7A 5MEQA 4KPHL 2LTQB 5I66B 4JFOB 4QNPF 4EK7A 2CLVB 3L5XH 3M8OL 4PJDF 4PJEB 1QUNA 3RKDC 2ED9A 3QJFA 4ODVH 4WV1A 4HG4K 1OTSC 4K3HA 5IT2H 4RBPH 1GL4B 2PXYA 1T5WB 1IKFH 1H3GA 4NOBA 3ULSB 3WHE0 5HDBF 5CEZD 4FQLH 1K2DA 2F54A 5I19H 3MV9E 4L4VE 3GMNA 3IJHB 3MLZH 4MCYB 4PGCB 1OARL 2YHGA 3ROOB 3NGBB 4J3XA 2CDOA 1G7QB 4QNPE 4H26A 2C4XA 3QO1A 4PRHD 1VB9A 3VG0H 4P49A 4PJDE 1HNFA 3EFDL 4LLWB 4IHOB 3UPAA 4E9LA 4JO1H 1KTRL 1O5DT 1BD2B 4IRJD 4AM0B 3WH6A 4R0LB 1YEJH 3S5LA 1DEDA 4E41D 1C16A 4NC1C 3H9ZA 1NAKL 1DQTA 3F7RA 5HDBE 4D9QE 3CVHA 4IM8A 4MA8L 3ZHDA 3C6LA 2XRAL 5HYSG 1K3IA 3F7VB 3HRZA 2FJFB 3V2AR 4AK1A 2JDAA 5DD6B 1GNYA 3TPKA 4PG2A 4EE9A 1U2YA 4Y16D 2WUCL 1E28B 1PZUB 4DKAA 1CE1L 1JFQH 2NNAA 3ABZA 3GBLA 3GSOB 4N0CC 3VILA 2A3AA 4JRXD 3O2DL 1JN6B 4IS6B 3RPMA 4UB0L 3NDZA 1MW1A 3BWAB 3GNPA 1EERB 4MCZB 2DKSA 4JQVA 1MCOL 3CMOH 2J4WH 3AIQA 2J4GA 5IP4A 3AXXA 3EO9L 1OGAD 4JN2B 2OTWA 1H0IA 4LPUA 1MSPA 4JO2L 1A7RL 1ETZA 4HX1B 2VQ1B 4FQPA 4EN3B 4Z2IA 2WAHA 4BA0A 1I1RA 2HH0H 3RKDD 3CVIH 5FOJA 5B4XA 4R6UA 1X4YA 1OTSD 4D72A 3GH4A 2WKGA 5F7FA 3UTSA 3WQWA 4WTZA 3SJVD 1V6VA 4OJFH 4X4MA 5F9DC 2X1WL 2LAGB 4TUOA 2GJZA 3H9HB 5CEZH 3PP4H 2YEZB 2P45B 1QOXA 4I8DA 3L2LA 3LKNB 5GGRY 1D5XB 1IMHC 1BEYH 2W3JA 2XKNA 4CMMB 3VIKA 4YR6A 3GJFB 2X09A 2IG2L 3T4YB 3WIHL 1AIFA 1OAUL 1S5IL 3QUYB 3FFDB 1BX2A 5IBLC 5LAXA 1E4KA 2XWEA 1J8HA 5AYIA 4W6XB 1PD6A 5IFJB 1I8IA 4KJWC 1RURL 1T1XB 5JOFB 5IVNA 5C2BH 4JCMA 4XCCL 3WXWH 3PZVA 2Q7NA 5I1CH 1IC7H 3NCJH 1DLHA 2MHAA 2UZYB 4O51A 4JLRA 4PTMA 4BZ2L 1ORQB 3GDBA 3GTNA 1ACYH 1NFIA 1A3LL 1T2XA 3KPPA 1Q9OA 1I1AA 1JYWA 3GZAA 1DBBL 2G5BB 5A40E 4LLQB 4PMUA 2QSCL 1X7QB 3PHOA 4N0CD 4QY8A 1ZS8B 4PV8A 3TCLA 3HMWH 5DA4A 3PL6C 2AW2A 4JFDA 4L8SC 1F3JB 1RUKL 2DSWA 1BYBA 4YHZL 2XIIA 4EVNA 1GOKA 1MHHB 1NEZG 1BAFL 3KPRB 3SKOB 5IVZB 1QTYT 4RFEB 1OB0A 1W1VA 1KIUA 3RY5A 3AICA 2IADA 4GKNB 1VGKA 3L3IB 5DRNA 3IDAA 2LQRA 3BKCH 2VR5A 4MD0A 3CFKA 1NWRA 5I1KL 5GZOC 2MKLC 3V4UL 1JWMB 1E4XH 5B38G 1H4PA 1WAAA 2EPKX 2XIBA 4URIA 2ARWA 2Q8AH 4D0DA 2PW1B 5TFSL 2WQRA 5CIPH 1BQHB 5CBEB 1TJIH 4F33B 1RJZA 1NOUA 3HFMH 4FQ2L 2M26A 1QSVA 2RAMA 5IFTA 4N9GB 3V52H 1HHIB 1C8PA 3IAGC 1N5YL 1DFBL 1KSRA 1WBYA 5JR2A 5AZ2H 3LQZA 5BZWA 2ADGB 3QI9C 4OZFB 4HKJB 3VRLF 5IBLD 1MHCA 3E6HB 3NPSC 5EDXA 3IJ9A 4H41A 4MLSA 3JWOH 2DQIL 1FJ1A 4KJWD 2BERA 2MKWA 3SKVA 1U33A 4Y1AA 5F6HJ 1E55A 1KJMB 1T20B 4EI6B 4HD9A 5JIHA 3A67L 2ESVB 3P0VL 1XNAA 5MI0C 2VDRH 4JIEA 3UXFA 4HG6B 2GYSA 1OH4A 4XPBH 4Z78A 1FG9C 3MREB 1H8SA 2J88L 3FJTA 4QFUA 4UUJB 3QNXA 4RBPK 2G3NA 4WUUE 5C9JA 1LDSA 4HWEH 2D03L 4IIQC 4HGKC 4HS8L 2W1WA 4LX4A 2YR3A 4LRIC 3T08A 2FIKB 3PL6D 4P2QE 5IMKA 1UD6A 1NC4B 1ZJAA 1JHLH 1HSAB 2G9HB 3BSHA 1QFWI 3WJJA 1BFNA 2BRQA 2XA8L 3UJIH 5EU4A 5EBMB 3TNNB 3QNYA 2EIBA 1WFTA 4GKSB 3VGAB 1MFVA 3SE9H 1DP0A 4LP4A 3P4OA 5GXBB 1IM9A 4MNQB 1KOAA 4P5KA 1GMMA 4ERSH 5ETUA 3CFIC 3HPJA 3RUGA 5GZOD 3KDMA 3SDDC 3RTQC 2XXMB 2RBLA 3QXAB 3E2HC 1TCRB 3WD3A 1CFVL 3C5ZC 1CGSL 1J18A 1IGML 3HB3C 1AGDB 1T0NA 2HJFB 4Q9QL 2HFGH 4JY6A 5CEXB 4QLLA 3D9AH 1RZGB 4NO5A 2AABH 3BH9B 2P8PB 2EIZA 3VUPA 1MCLA 1IKNC 2WBKA 1MPAH 1HVXA 1LQSR 5IOPB 1KJVA 3QI9D 1VJSA 3OGRA 3ARGA 3N9KA 3HI6L 4QRQB 1RIUH 1INEH 4MA3A 5C0CE 1C90A 4X8JA 2WO3A 4PF1A 4ZSOB 2VQTA 4D6FA 4PJEF 4MAZA 3C2SA 3I02B 5F96L 1KB5A 1SR0A 1LG1A 4H8HA 4RMRA 1N3NA 5T1KD 1NP0A 1GOMA 3V5KB 4U1HA 4NHCL 1I8KB 1J1PL 3MOBH 1A6ZA 4JHAL 4PJ5D 5IIEA 3BZDA 2VDNL 4OSUH 3QDHA 3WCYA 3LPFA 1U8QB 4P2RD 2FSEA 2Z31B 2CBVA 2CBIA 2CUMA 4KXZH 4HUVB 5TQ0L 3B5GA 3OPZH 1VPOH 4RRPG 1NAEA 3O6LH 4PJEE 3H42H 2FYYA 1P53A 4EJ1C 2XTJC 4LP5A 3HUJB 1TETH 3WDIA 4J6RH 1M6OB 5TE6H 4OF5A 4QAWA 3QUXC 4MA7H 1X3DA 4IEFB 1E1FA 2CR6A 2GTWB 1IGTA 3SDDD 3UYRH 5JBDA 3RTQD 1CLOL 3C7EA 3QXDB 1XH3A 1UWGH 5IKCB 3C5ZD 4GT7A 4HPOL 3V79C 3PV6A 3HB3D 4XBEL 4BH7B 1SBSH 5LG1A 2EYTA 1HSBB 3QEGL 4I77L 2DBJA 1ZSDB 1BD2E 1SM3L 2ZUQC 2R0KH 5KTEL 2GSGA 4Q74A 2E7MA 4ZFOA 4G9FB 3WL1A 2BK8A 1N4XL 3UESA 2OR9H 3MYZA 4LSSL 1BYAA 5ANMB 1MLCB 4AEFA 5IBUB 1YEEL 4HCRL 2ZUVA 1HZHL 5D7KE 4Y4FC 1QR1A 5F1KC 1W9WA 2I27N 2K7PA 2AV7B 2YSSB 3PZQA 4F8XA 5E1AA 1OINA 4NWUL 3WD5H 4AD2A 3THMH 4RMWA 4ONOA 1EGJH 4HLJA 3VXOA 1RZJL 3PHQB 2J7DA 3LN5A 3OKKA 1D2KA 5FYLL 2AJXH 3D0LB 3ZZ1A 7FABL 3QHZL 5T3ZH 1I1WA 5J1XA 3ARZA 2VZQA 1GGCH 4PRIA 5FA4B 4DZBA 5DQ0A 1KJ2H 5A6BA 2EKSA 4ODTL 3ZDYE 1DANT 1CFSA 1MCIA 3IDJA 2HJLB 1FBIL 3VFNB 4NRYA 3EYOA 2ZEZA 3EHBC 2Q3ZA 5EOTB 2XTJD 4TOYH 1G1YA 4HXAH 4LMQI 5GRUL 5FB8B 2AOSA 1EO5A 2W92A 4X6BB 4EUPH 5I8CB 4ZUTB 3QUXD 2EPLX 4LCWD 1NGYA 4XCFL 4X7CC 4MXWL 3W39A 1UB5A 5JW4Q 2IH1A 5SV3A 4Q6IC 3R8QA 4YHKH 3KPOA 2B4KA 3AOFA 5D9MA 3VXUE 4NKMB 1ED3B 4X6CA 4HHAA 12E8H 1L7QA 5JDSA 1DN0B 3K2MC 5IB3B 1IGCL 3QQ3B 5HGAA 2W0FB 5DJCA 4U6HA 3SPVA 3E6FB 3A6CH 1EH9A 5ERWB 3P4MB 5ISZA 1WTLA 3NACL 3BZ4B 5IG7B 5C0FA 2ICWI 5HJ3B 2W1QA 4YDLC 1VDGA 3OKMA 3OLEA 4Y4FD 1CDIA 3CPUA 4ZAKA 3DX6B 2NXYB 2BGPA 2BSED 3QZWA 4OCYH 1IM3B 1B6DA 4PV9A 1K6QH 1OAKL 1ZA3B 5E7FA 1EEZB 1E5NA 2H6PB 4APQA 4W4OC 5DQDL 1KJ3H 1QNQA 3STBA 5D1QB 2J8OA 4F3FA 2V2WB 3KPRE 3DUUA 2FWOB 1A9EB 3ARTA 4K9EC 4PTTA 2FD6H 3KS0J 2V7NB 2HMIC 4JFUA 3S37L 1I7RB 4YWGH 4WK9A 1OVZA 3U5YA 3NQHA 25C8H 4MQ7B 1VFUA 3EHBD 4YLQT 4OBRA 2Y6KA 1N7ML 1OPGL 4HC1A 1UKQA 4P23B 4QRPA 4IRZL 3VXMD 1A3RH 5FYJE 3WNOA 2N7AA 4FMKA 3LN9A 5F9WB 2AJZB 3QRGH 3F5WA 4DN4L 1CF8H 4AD4A 3MV11 2GK1B 2GCYA 2ATKA 4YGVB 3MFFB 3U9PL 4HWZA 5GIRB 5L88H 1PLGL 5I6XB 1QBMH 2DM3A 4PJCB 5KVEL 3MGTB 1W32A 2WLYA 1S7VB 3ARDC 4CRPA 4KK5C 3X12A 1IQDA 2ESVE 4JFYA 4NNYA 4LHJB 3GSVB 4WHYG 3RO8A 1JNLH 3AB0C 5J7CC 1J0IA 2FHBA 1IFHH 2DLGA 4P2OA 1ZLUH 3MPCA 1XR8B 4WFFD 3Q1SL 4YDIL 3ARPA 4YHIB 1M7DA 4KKBC 3RJXA 3MA9L 3BH4A 2A6IA 4R90L 1Q9WA 2H41A 4XP6L 3WYRA 1QQDA 4LPYA 5H37G 1HHJB 1FL5A 1R3JB 5J1AB 4Q7NA 3KPSA 1MCSA 1T1YB 5DWUL 3RM4A 4TUFA 1KBGH 5AG9A 3U7BA 3C6SB 2HMID 5M17A 4PRHB 5DUPH 1ZT7A 4MNQE 1SJHA 1AGCB 3CU1A 4UILL 4IRJB 4JGMA 3VE0B 3IIIA 1OCQA 1AKJB 2ZCLH 4E41B 2PI6A 1R64A 4OUEA 1ZHLA 1U9KA 2Y25A 2C0HA 3DGGA 3TBTB 3K2UH 4ZZ8A 1M7IA 3SCMC 1NFKA 3RCNA 2DTMH 1XGRB 3VD5A 4DQOL 3LPPA 1WZ1H 1RJLA 2FL5B 3GJEA 3KXFD 5A8PA 1OP9A 3INUL 5GISH 4Y16B 4H1LA 5IB4B 1HOCA 1E6OH 4E0RB 1A0QL 3JTTA 4RGNC 5IB2B 4OM1H 3O41B 4CKQA 4FFYL 4M7LT 3F65A 2VUYA 1EXPA 1RU9H 2XM1A 3DVGB 2CGRH 1NC2A 4JRXB 3TBYA 3WD2A 1J87A 4ELKA 2J8GA 2YBUA 3C5SA 3ARDD 4ZSOE 4KK5D 4UDTA 5GSRA 2AEWA 1BVNP 1ORSA 5E2WH 3AJ7A 1BP3B 2AJUH 4KI5F 1EJ6A 3HUJF 3RL1A 1OGAB 2OSYA 1CBVH 4PBVC 5DN2A 4IISA 4QDRA 2X1XR 1X5JA 1GOFA 1JHTB 5F1IA 1RUPH 4Z5RA 5IGXL 4Q2ZA 3SQOH 1A02N 5CIPB 4KKBD 1RZ7H 4WHYH 3SJVB 3V8OA 1FNGA 4XI5C 4GLRH 4WUKH 3HNSH 4FQXA 2R7EB 2R0ZL 1ND0B 3P4LA 5JXEA 3GSXB 3FMGH 4ALAH 3K77A 4R3SB 4KI5E 4WDIB 3HUJE 2YMXL 1IAIH 4XUNA 3VFPA 4QP0A 4OGXL 4I3GA 1OLZA 3QEQD 5MEPA 4DOHB 1V3MA 3GSQB 4WGVB 3U2SB 4K9EH 3MBWA 5SWZB 5CJ5A 4LL9A 2R1YA 5H37H 3TT3H 1P84K 4UIKH 1NGZA 1GOIA 2X0HA 5DT1L 1X5KA 1DQDL 4YHNA 3NABH 3OAUH 5T5FL 5DJDB 4OLVL 4WTZG 3BUTA 5K9OA 1G7HA 1D6EA 4R8WH 3GMPA 3SCMD 1UFUA 3RVWC 4D6HA 5TGBB 2YZ1A 2HT4C 4K94C 5IB5A 2V5CA 3FRUA 2DQDH 4G9FE 4RGND 4P8WA 2IEPA 4XAWL 2X4UA 1G5AA 5ANME 5C0IB 2R4RL 2WPGA 2XZCL 1U3YA 1U91A 2DQJL 3EOTH 3GHEL 1U8LB 1C08B 1KLGA 3BI9X 4LGXA 4XZBA 4ODXB 3L7FA 1OAZL 4HUKB 1T1ZB 4P57A 4Z95H 3NZHH 4G43A 1EOMA 4H8WL 3RX8A 3KWWB 2VC2L 5DJ6A 1HHHB 1OCWL 3SDXA 3VFSA 2KQNA 4LSPL 3REWB 5F7KC 2A6JA 3OV6A 4YH6A 4GQRA 5AYUL 3HZVB 5H2BB 3LD8C 5DJAA 1WFUA 4BSVA 3QA3B 3UTZA 5DK0A 3V9FA 1JFHA 3ZJ6A 3U5UA 3JV6A 1UHVA 1VJZA 3MLYH 5M5DA 2KPNA 2R0LH 2HFTA 3VFTA 3MRJA 3VD7A 4YEFA 5B38B 1U8MA 4N5UA 1F4YH 2IQAA 3KE0A 1W72H 2WIIB 2VMDA 4JFDD 5SX5H 5I79A 3V0VB 1NDGB 1E70M 3KL0A 1HINH 5F7EL 3TV3H 3QFDA 3VXTA 2BOCB 2IPTL 2DQHL 3FO2A 3CX5K 2B20A 5AWNL 6TAAA 4D1JA 1BQCA 2IF7A 1K5NA 4O2CA 4BFEA 4NKOB 1KBBA 4GAJL 4LVOC 1ISVA 2X05A 4CNIB 3IDUA 5DD0L 2ZXBA 3RVWD 4HZAA 2HT4D 4TXWA 1ZLUK 3A22A 1YMMA 3O9NA 3N06B 1D5ZB 4WI8A 3TH2T 2H8PA 4XGZA 1GQJA 1E1EA 3QNZB 1DLCA 5F7DB 4WEMB 4CCEA 1XSIA 3MNZB 5D9OA 2XYLA 1F6LL 2HRPH 1I4FA 1WWWX 5DK2B 5EN2A 4S0SD 3QOMA 3PL6B 1HXYB 1T03L 4YQXH 2VDOL 2IXUA 2XVNA 4FXGA 1UG9A 3DTXA 1A7NL 5INCA 1H0GA 4CCDA 2WBGA 3RILA 1NBYB 1LEIA 3JBG7 5J89A 3GRWH 2EPNA 2DRUA 2WP3O 4XHJC 2BNRA 5KVFH 1ITCA 4P9HC 4OCXL 1QPPA 4DEQA 1GRWA 4G8GA 2VAAA 4C56A 2E32A 3IKCA 4O5LH 1B2WH 4OFVA 2VVSA 3RWJB 2CO6B 4GXUM 4ELMB 4D9LH 1TR1A 3IDXH 3RU8L 4WWKA 4HXBH 1ZBWA 2W07A 4QHMB 3TNMA 5CD3B 3DRTA 3WLWC 3F7YA 3BAXA 2Z93B 1P4IH 5F97E 3MMEB 5I8KH 1W3HA 3KYMA 4KRUA 5D70L 3W38A 5MENA 2R15A 2DLHA 4PJCF 32C2A 1LWRA 2VH5H 3SUVA 2XFFA 3PDGA 4ZTPH 2AJYL 4TVDA 1A6UH 3NFPA 4UT9H 1QLEH 3QI9B 1CICC 4QLJA 4KROC 2GUYA 4OD2B 4NZRH 3FN3A 2ADIA 2EE3A 3NPSB 1WCQA 5JO5A 4IBLT 3O0RL 4FZEH 4BM7A 2APVA 1G9MC 2WIMA 3QWRD 2C5DC 1OWWA 3G6JA 3NPZB 5JMOC 3BP4A 3MQIA 4ZO8A 4OB5H 4W89A 1KIRB 3WD1A 5MI0B 1WDRA 5T1KB 1U8IB 4XBPB 4PJCE 4ETYA 2PUQT 3KYNA 4PJ5B 1VIWA 4NPYA 4K94H 3HAEA 3OHXB 2PNDA 4P2RB 1HH9B 2HA1A 3MO4A 4F7CA 1IZKA 1QFPA 1KJ2B 4IIQB 2PF0A 2WVSA 1QLRB 4I5BA 2EQDA 3WQVA 3SDCA 1BJMA 3T0EC 3HN3A 5IMOA 5FKYA 1A7PL 5LCVH 5EOQH 2X1IA 4HQQH 4CMHC 1A1MA 1Y0LB 2F9BT 4HP5A 2GUOA 4OKDA 4U1MB 3UPRA 3WQ4A 4NQSB 2NLJB 3BPLC 4XHJD 5CEZE 4TSBH 2JJSA 4PPTA 3GH5A 5CXPA 2OR8A 3VD3A 4ZPTB 4ZS7H 3T1FA 3PG2A 4PCSA 5BXPA 2Q6WB 2AKRB 1KFAH 5BO1H 3SDDB 1KPUB 3RTQB 5JW5B 2WC4A 4PMYA 4PQQA 3E2HB 3HLAA 4NDMB 3C5ZB 3L4XA 1ZVSA 3WLWD 2ZG2A 2TAAA