3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
2VXUH 3BN3B 3CFDA 4MWFA 4LNRB 5KEZA 3QR3A 1FNFA 5JBEA 3VXRD 5HYSB 1DQTA 5J9PB 5I73B 4FP8L 3WEXB 4XCYA 4AD1A 1N5AB 4L9LC 2I60L 4Q9BA 1U3HB 1MQQA 3V4VH 4GRLC 1OGGA 4P4KB 4AYFA 1C1EL 4JJ5B 3ARUA 4WEUD 2Q6WA 1QI2A 3AXXA 3UROR 2WZEA 2P5WA 5AWNL 2J77A 4OCYL 5ACZA 3HPJA 1I1XA 1RIVH 2YD1A 3MLXL 3Q6GL 4PJFA 4CUCA 3OJVC 3BAJA 4NBYB 1OTUD 3P30L 5KANI 3UZQA 1FE8H 1NGPH 3OF6D 4I3RL 4N9OB 3WUWG 1EHAA 3I50H 1MFDH 3H9SA 3TTOA 4HA4A 2H45A 2ZX5A 4XP5H 5JW5A 1JF1A 2P5EE 3CFBB 2QSQA 2DJ4A 4FF5A 1UUQA 3MRJB 3GZAA 2VLLB 3N11A 1MIEL 5BRZD 1IGFH 1CDJA 3CQOA 3UDWA 3LEVH 1A0QH 1LO3L 2FO4A 4ZZ5A 2X42A 3RCNA 1NBYB 5LYRA 2AQ2A 4YBHA 1JXKA 3JBG7 4A6YL 2YK1L 3QA3B 4G9FA 4YO0A 1V3KA 4UTAL 2QQJA 3L4TA 3IFNH 4ET7A 3QOKA 2AQ3A 3LKRA 2B9VA 3FB5A 3LQZB 4HLZH 4OKDA 3ILQD 5IF0B 3CIQA 1CFVH 4AZCA 1BFOA 3VA6A 3T0BA 4KRTA 1Z0NA 3NGBC 4IDLA 1MQRA 3CVHH 1EV2E 5HSFA 4QF1B 2HTKC 3QUZC 3L3JB 3HE7B 1NCNA 1DVFD 2D23A 3CFKB 4U49A 3MRLB 4NYLA 1JRHH 1G7QB 2DWEA 4PJXB 3PG2A 1KB9J 4S3KA 3QHFH 4AYSA 2IEPA 2VRJA 1NSNL 4LPUA 7FABL 5C07D 1UR9A 3BKYH 4CMMA 1QOKA 1IT0A 4H5SA 4I18B 4E2OA 2AK4E 4XZUB 1R24A 1BQLL 3QP3A 5D7SL 4EDWH 1CVSC 3EIFA 2O93L 3QDJD 3H7LA 2IAMA 3A23A 2PWDA 4QRQB 2V2XB 5SV4A 1V7ML 4OMDA 3MR9B 5B4MD 3IFLH 3QXDA 5AG8A 4V2XA 2AEQH 2DICA 3JVGC 3BUYA 1A22B 2YA0A 1V5JA 1Q0YH 1J1XH 4AH2B 1PBYA 3QJFB 2NZ9D 3GI8H 5I6SA 4O58L 2VDML 2GVYA 2PWGA 5J13C 4YDLC 5EC2A 3CUHA 2PYFB 1LL7A 5L6YH 1WAAA 4BFIB 4LIQL 3DMMC 3N85L 3EOAA 4ESKA 5K59E 5MENE 1J0IA 3WFLA 4TXWA 3L4UA 2ZUNA 1X5ZA 4UOW0 3OAUH 4OGYH 1KCUL 2DB8A 5E03A 5T3XD 3NVQA 3VXOB 3VIFA 1WSST 3L3KA 1W0YT 5JNYA 3DGCR 2Z4FA 4LKSA 3MGTB 3OBAA 1KGUA 2DLGA 3VI3E 4K7FA 2X4TB 4WFEE 4F80A 4YHYB 5EMYA 1N3NB 2GAZB 4P2QA 4ZYKB 1TE1A 1YMME 4NKOB 4R8WH 1FNLA 3P4OB 4XHJC 1LE9A 4P46C 1R5VA 4LBEB 1T0MA 4YHZH 5E6YA 3AAZA 4DM2A 3DIFB 4MD0B 4TTDC 3L2LA 5I5RA 1E6OH 4OZ4A 4XBPA 4OF5A 5GHWH 3VFRB 4FQ2H 1ROWA 2CDGA 3HNBM 5I8CB 1UCBH 3P4NA 5HDBF 5HPCA 1B4JL 3WJLA 1D6EA 1C7TA 3QNXA 2VZQA 3ZE1F 3D0VA 3BN9C 1LQSR 1RZJH 4CW1B 1I1AC 2F19L 5FUOH 1NCTA 1EFQA 1J1PH 2DD8H 3ISWA 2EE2A 4LPXA 3TV3L 3X13B 1ZS8A 3U48A 4PCSA 2JD9A 2HFEA 1JTPA 4GKZB 1AKJB 2CHNA 4WKFA 2OM5A 4LCCA 5EIVA 2B20A 4BJ0A 1W3KA 1YQ2A 1T1ZB 2ZCKH 1NCWL 4AEIH 4UAPA 4D9LH 3C5SB 1MHCA 3WFZA 3BPOC 3H3PL 5DUPH 4QHUB 5HYJA 1SHMA 3HI1A 2UWFA 2OK0L 5IW1B 1BFTA 1UJTA 3BQUB 5DD5L 3CXDH 4Y4FC 2D0FA 2W07A 1Q6DA 4NQEA 4K2UL 2V2WB 1T1WB 5J6GA 5C2UB 1P69B 1HQRB 1I7ZB 2Y36L 4M7JL 5IT2H 1XH0A 4YHEA 2X4TA 1QW9A 5K9QI 3MNZB 3U4EA 5C0EA 5E08L 1W0WA 5F9JA 4P23D 5FYJH 2UY4A 1XF2A 1XF4A 4OFVA 2P4AB 4EN3C 3C8XA 4KKCC 3EJYC 3PWPE 4OFIA 2AP2A 2WBJD 5DYOA 1JPSH 1MJUH 1UYWH 4OKVA 3ZT6A 3UPRB 1QQDA 1H0DB 3MBEA 1NL0L 4ACZA 5ABHA 3TT1L 2NXZC 3I50L 4V28A 2V3DA 4DKAA 1QOXA 4N8CH 2BNRA 3RL1B 3UTQB 4LLDB 3HI6L 3ZYJA 5DZNA 3QEUA 1KQYA 4Y1AE 1UQZA 2ARJB 5CCKH 3BD4A 4HKBB 4NQVA 5IFTA 4JLRB 2EDDA 1YDPB 4F15B 1NM9A 5DD3L 3P4MA 4ZSOB 4TOQA 3N0PB 4NQSB 3TBTA 2JIWA 2APFA 2HFEB 4GKZA 2OYPA 4UB0H 5BVJB 1AGCA 2BOCA 4TVSa 3W27A 3NIDF 1DLHA 4ERSL 3W6LA 3HNVL 4P5MB 3W37A 1CCZA 4TVPD 5CEZH 2C9AA 1KNOA 3WE6B 5JHLH 1WFOA 1V0NA 1V0LA 4KUZL 1EIBA 2OR8A 3BQUA 4ISVB 1L0YA 4WNQA 3Q6GH 3KNBB 4GXPA 1NFKA 4MNJA 3WD5H 4N42A 3S37H 3SKUD 1BPLB 2CKRA 3EDFA 5DFAA 4MD5B 5D7JC 3IJHB 5CIPH 2QEJA 4XXDA 1KLGB 5IROC 4U1KA 1PD6A 2M1KA 4P57A 2NZ9C 2Y23A 4ZOCA 2DI7A 2DLFH 1I3VA 4X6FB 5A69A 5DHVH 1BFSA 1A1NB 2XOTA 1LD9B 3EMQA 4XBPB 3VXSA 3FQNA 5E6ID 4FA8A 3AZTA 4AC1X 2XZAL 2XHNA 5FA4B 1P7HL 3IU3A 3UTTD 1BQLH 3G6LA 3TO4A 3RI5K 4MDJA 4MNQB 5D5MF 2WMGA 5EORH 1RH9A 4PJ8C 3EOTL 1R64A 3A4WA 1Q6FA 4ODHL 1V8HA 3FB8A 1F6LL 3FFDA 5I66A 2N56A 2GJ6E 4P2CG 2IBZY 2X1OA 1JPGA 4GS7B 4ELMB 1ZBKA 1I5PA 1F5WA 1ZAGA 3B5GA 4L0PA 2XWEA 3VXPB 2VL5A 3MLYH 1T1ZA 1C92A 2NX5B 3BKML 1KR1A 1Z9OA 4C58B 1OBAA 4P2OA 4XI5C 1JG9A 1OARL 1S7TA 4TPRH 2WUHA 1R3IL 5DDHA 4POYA 1CE6B 1N0LA 4Y4HB 2EC9U 2YPVL 1QI0A 1JL8A 3AJ7A 1MCJA 1B4RA 3MRDB 2GUYA 3C8KB 4KZDL 4YXKH 5FGSA 3VM5A 5JHDA 2MKWA 5DSCA 4R2GC 1AFVH 2IG2H 3ARPA 4GAYA 4FABH 2X1IA 4FG6D 4URTB 5A2KH 3VRJA 1B3VA 2ZX7A 3IJHA 2KL6A 3FW6A 1KCVH 5I24A 1TZGL 4G6MH 3CDGA 3VCLA 4XC1H 1QBMH 1ORQA 4PJHA 4NM4H 4WTWA 2IANE 5I16A 5MHSD 3OHXA 4MQTB 3R06B 4MNQD 1MF2L 2I24N 3UZVB 5D2LA 1CFNB 2BSTA 4F79A 3HC0A 1HL8A 3PXHA 2R39A 4P5TA 1B4JH 3ILQC 1Y6MR 2XY2A 4NFBA 3MUAA 3SUSA 1NCCH 1A14H 5EOQL 4MHHI 4EJ1C 3KPSA 4WUUA 1KSRA 1CDUA 4WRLA 5DPNA 4NQVB 1BJMA 4X5WA 2HTKD 3H0TB 1I1WA 2WIMA 3TIEB 2DIAA 4YDJA 1RQ5A 2D0GA 1INQA 5CPTA 1A7PH 1UA3A 1KCRL 2DYPA 1RY7B 3WEXA 1AO7E 5IW6B 4PGDB 4HK3J 4LU5H 5GHWL 1OF3A 3GJFK 4QCIB 3NIGE 2XI9A 2AXFA 4FQXB 1KNOB 3GHBH 2P7TA 3SDXA 3HUJA 1TETL 1FVDB 1BMGA 1PEZA 2A73B 3LH2H 5DD0L 3WD3A 4HKXB 5EBGA 1X4XA 1CDCA 4M6MH 4C55A 2AMGA 1NANH 4MNGA 5FO8B 4FI9A 1HSAB 4B9ZA 3A6CL 1S8DA 3MODL 1VGKA 2YUXA 3I2CH 4I0KA 3VWJB 4DCQA 3I6KB 5A8MA 2PCPB 1CIDA 3PABA 2B2XL 1XCQB 2YPLD 4WI9A 3MV9A 4I0CC 4UT9L 2ZCKL 3FRUB 2W9EH 4F2MA 3OB0K 5BROA 2OMNA 4R3SB 2WCSA 2K7PA 4CAGA 1RU9H 4K3JH 3ZIZA 1GYAA 5D5MA 1G1YA 3OGRA 2UZIH 5E0FA 3QDMD 5C0CD 3DO3A 5JUVA 3WIFB 2WHLA 3X14B 4XVTL 3R4DA 5IBUB 3F7QA 1MCOH 1F4XH 1YEJH 4PCTA 2DWDB 2RHEA 4QY8B 1I7TB 4RFEB 4WEMB 2W67A 2Y36H 1EPFA 3MOAL 1GGCL 15C8H 2XWJA 3BMWA 4F8XA 1MWOA 2GK1B 3SCMA 2DWEB 4PJXA 3RP1A 5JW4Q 4X5LA 3IKKA 3UBXB 4G6AC 4OUUB 5ISZA 1H3XA 1RIUL 3CDYA 3RWIA 4MQ7A 3L4XA 1IGYA 1E4XL 4DKEH 4L9DA 5CP7A 1YEEL 1EMTH 1YN7B 3TT1H 5JXEA 1RPQA 4I9WD 4JG0H 4PJCB 3OG4B 4DXTA 1G9NL 5F88B 2IBZX 3MREB 3L4VA 1XCTB 5IM7A 3L2MA 1RZKL 4PJDE 1U8MA 2D24A 3HR5B 5BXPA 3T2QA 4YFLI 4K94L 4WJXA 4HAFA 2ITDB 3BDYH 5FO8A 1I1CA 5F7MC 2IMNA 6FABL 3S37X 5L9DL 3U36B 1TNMA 3QPQC 1MPAL 4P4KC 3WQWA 3KYNB 4AH2A 1MRDH 4YHYC 4EE9A 4HS3B 3ES6A 2DEPA 3BDBA 1AE6L 1JF5A 2E3VA 4TSBH 2ICES 2DTSA 1UA7A 2V9TA 3LPOA 1GQIA 3TNNB 2C1OB 3MLRH 4XP6L 1RK0A 3A6OA 3VA2C 4P5KB 4P3WA 3ET9F 3T8XB 4PLJC 5M17A 1R7OA 2NY1D 2Q3ZA 2W4XA 2DIEA 1ZK9A 3I2KA 5C8BB 5JXHA 4LARH 1OSEA 1MY7A 4PRIA 3CH1A 4ZTOH 5I18H 1AJ7H 4V1DD 4U2YA 2JIEA 3NTCH 5I1IH 4HAGA 4GO8A 1GOIA 4U1MA 3QIBB 1IKFL 4NKOA 1IC4L 3S8WA 1XH3B 2V2TB 3HUJB 4L3ED 4XVHA 5EUOE 2YXMA 1ORSB 2JELL 5GGVL 3CPLB 1EDGA 4JFSA 3N1MC 4YEEA 3QEGH 3QIUA 3BE1L 5I8CA 2GK2A 1UY3A 2JCCE 3V5DA 5DVOA 4L4TB 3O8XC 4JANA 4JPVH 4HOXA 3MSGA 1EXUA 2O9OA 1JWSA 5T1LB 5ILTH 4NRYB 3D0VB 3VE0B 5CGYD 4WW1B 2VISA 3NH7H 5DVKA 5F9OL 5JOEA 3LRSA 4XUPA 3GI9L 1E0VA 1JCKA 1QRNB 2B4CH 1JV5B 2ATPB 1LO4H 3IRZA 2QQOA 2WSKA 2CHOA 3B83A 1NANI 2XKSA 1ZGLP 1R5IB 4NCC2 4U33A 4Z76B 3VOCA 4JFEA 3FNDA 4AK1A 1OARH 4CNIB 3K0WA 1T03H 2DDQL 3UYPA 3ARGD 3DTXB 4YPGA 3QFJB 5DEFA 4AG4L 1ISXA 5GGSA 4NQUA 4C56E 3QI9A 4DVRL 1MWAL 2Z35B 4HCRH 3FQWA 3MYJA 4HGMA 4HJGB 4H41A 5HYJB 3OKDA 4IOFC 4Y4HD 3C6LA 4MAUL 2AJXL 4GO6B 5I1JL 1IAKA 2OL3B 3RWDB 4RFEA 4TSCH 3QDHA 5KSUB 5TDNA 3NJXA 1IGTB 2FH8A 4OT1H 2JJTA 4ZUVA 1HOCA 5D1QD 2X4OB 1JYWA 5IW3A 3GSRA 2V3EA 3CZGA 5LGKA 3SUWA 1E4JA 5CEZD 4KROC 4Y5XC 3WH9A 1CFBA 5CHNA 2W46A 5F72S 3P2TA 5ESVB 1J8HE 3ZL4L 2R69H 3ILPA 3WELA 3SCPA 2WMKA 1FNSL 3F5KA 1VB9A 5C6TL 2QQLL 4HQQL 4PJGB 1JZ5A 2VR4A 3VDAA 3ZM8A 5BS0D 5B39B 3V4VL 1MEXL 4PJIF 1DQML 3SEEA 4MB5A 1QHOA 3MLWH 3DUSA 4WI4A 4AIZB 1OQXA 3KXFB 4PG2C 4JRXA 3HPLB 4G8GE 3TONA 4IMLB 3JV0A 4Z2GA 5D93C 2XN9E 3C8DA 2YPKA 5GIRA 4K8RC 5D93B 4ZFFA 3MXWL 5C0JA 4M6ML 2FD6H 4DKFL 4ACZB 4IMKA 2P8PB 2ZOLA 1OGAD 4M80A 4JANB 4OD1L 4M3JA 3TYGL 2ZEZA 4WUKH 4HIEA 2Y6LA 5MEQB 1QFWI 5DLMH 1A14L 1WLHA 2GJJA 3ULUD 3UTOA 3LMJL 4OI8A 4G9DA 1B3WA 2RCSH 3QWRD 3S96A 3DYMA 5IVXF 4YFEA 2LFGA 2V4VA 5AZ2H 3IB3A 5K9JL 3G6JA 1XCXA 2H8PB 1HH6B 3SCTA 1RZ8A 2ERJC 1G9MH 5HVWA 5T3ZH 4G80B 3O4LA 2X8RA 3NQHA 3RGVB 5ELIA 1MW2A 3VIJA 1RMFL 3PDGA 3KPRD 1DDHB 1QYGH 4M81A 4EXPX 3T0VA 1CT8A 3NGBB 1YECL 4S10A 1MJ8L 3N50A 4JB9H 4W5UA 4TQEL 4GQQA 1KJ2A 3E3QC 4JVUA 4Z7UF 4PJBB 5CKAA 1GZPA 1NGPL 3GSWA 4LP5A 5ESQB 4PRAA 3ALGA 1BOGA 4OV5A 1IC5H 3SDYL 3CUPA 3BP4A 1M7IB 4NSKB 1U8HB 5H94B 1EDTA 4NC1C 2AJVL 4PJEA 5BZWB 4QB6A 3KLSA 4MS8D 2VZRA 2DSVA 1BF2A 4TNWF 3C9NA 3NFSH 1SFSA 3WENA 5JIKA 1T7ZA 2KBGA 3D18A 2B7DT 2QADD 2Y6SD 1TVPA 4OBSA 2F53B 4RBPH 2VZOA 5M03A 1QFWM 4L4OA 5F3HB 5E8NA 1U33A 3QIUB 1ZHNA 5L0QB 4UT9H 3MLUH 3V5DB 4OZHF 1I85A 2J1KA 4HK0B 3BRDA 1IAIL 35C8L 3B6SA 1T3FB 2F5BL 1G9NH 2APWA 5HJ3B 3X17A 5C0CB 4MTVA 3RWCB 2DKUA 3LOWA 3UTSB 1ADQH 3BH9B 1MWAB 1YYLH 3DOSA 3KYOA 3MRHA 5A6BA 1U95B 2P8PA 4NM4L 2CGRH 4WEBL 1EVUA 1FYTA 3QWQB 3MU7A 3E3QE 5D8WA 5MEQA 1CZ1A 4F9PA 1CICC 2JCCF 5HYSG 1PG7W 2FGZA 5JHDE 3VILA 2PYEB 2APXA 2PW1B 3DMMB 5DI8B 3RVWC 1SM3H 1T22A 2OSWA 3VFSB 4I18C 3X3FH 4L8DB 4YFLF 5LGHL 1NMAH 2AK1H 2EIZB 2R29H 3P11L 1RZKH 2BCKB 1J84A 3LN5A 5D9NA 5IJVA 3ARDD 3VXTA 4U1SB 2E9BA 4IRJC 1YY9D 3GKWL 4M7LH 4Q58C 2BXYA 1KCRH 1FIGL 2YL8A 2YUWA 3ARFB 3ULSB 5GJSH 5HHVH 5AEAA 1JU3A 4UNUA 2P8MA 2DT3A 4PTTA 5HPOA 2VQ1A 4PR5A 5K33A 1MUJB 3OKOA 3WUBA 1T1XA 3TJEH 4E41B 2ZXDA 2WW5A 1MREL 1OGTA 1OAQH 4E9LA 4ZFMA 3DUSB 4A6OA 2YIHA 5JQ6L 3KR3L 3HZYB 3QAZC 3AREB 2HJKB 1ZXQA 3L5XL 1NAML 5D7KE 2WAAA 3DVGB 2WMIA 1AD0A 3PN8A 1GGYA 1KC5L 4UI9L 2YOCA 2R8SL 2VMEA 3LQCA 4JFOB 3R0MA 4RAVB 5F1SA 1T3FA 2GW5A 2X70A 4RE4A 3R0NA 1WF5A 3UJTH 3MZTA 5I78A 2WC3A 1JWUB 2ZX9A 3MV9D 1PGRB 3L3OA 1V7NH 1FYTD 5D1QB 3QDAA 5AY7A 1Y18A 1T04B 4OCLC 4P46B 4P9HL 2EBNA 4OQTH 2VZTA 1AQ0A 3MRMB 1HCFX 1AP2B 3OR7A 1FLRH 3GBNL 1TVNA 1NKRA 5T1LD 2BVYA 2IQ9H 5I1AB 1DCLA 4MXWH 4AMKH 2JJSA 4UIMA 3IJSA 4XCNA 4CU7A 4E5XA 1T7VA 4BK5A 3MNVB 3ZDZE 1MH5A 4TSCL 3IDYB 4N1EA 2CIKB 2EDXA 1IGIL 4X9GA 3QOMA 2EO1A 2F74A 4XXCA 2FRGP 4R90H 3WUWA 1FHLA 5FOBB 3LMYA 5FD0A 1LE5B 5T3XE 1GOOA 5CEXB 3IKCB 3SGKC 1TFHA 3OKMB 4A6YB 1NMBL 4GOSA 3DECA 3BW9A 4RN5A 1MFAL 2Y07H 2BV9A 1XIWB 32C2A 3WCYA 3AROA 5CQ1A 4OZGB 2EPMX 3TBYA 1TVBA 5IKCB 1GCFA 1AXTH 2ADIB 1LP9B 3LN4B 1NBZA 4J27A 3BP5B 4LPCA 2G4FA 5E1AA 3VXMA 5M95B 1RJZA 3LPFA 3GDBA 2E31A 2Q86B 1WTLA 1NBQA 3QG6B 3AISA 1UEMA 4C59B 3F7VA 4QPWA 3U7BA 1FYTB 4D9RD 1FZMB 3NCBB 4LCYB 5HY9A 4XHJD 3HKFA 3PWPB 3WY1A 1S7XB 3FY1A 5A6LA 2EO7A 2FX8H 1O5DT 2VR5A 4H25B 1R3HB 2FLRT 1DVFB 2QHAA 4KVNH 2QQLH 1UADC 1RZGA 2QQKA 4YBQC 4OLYH 5K9JH 5IMOA 3M7SA 3JUYA 2OWWA 2EC9T 1N6UA 3RIFK 4ODXA 4NUGL 4LHSA 1NMAL 2AK1L 1DFBL 2P45B 5HDQL 3IYLW 1XF3B 3CVIL 5C08D 1JAKA 1KCUH 3LIZL 2QBXA 4TQEH 3AXLA 4JDTH 1L9MA 3H9SB 5FUIA 1IBGL 4X80L 4AJ0A 1IC5L 3DHJA 3CSPA 2I25N 3WNMA 4NO3A 5EJ1B 2YBUA 3MGAA 2CMRH 4L8SA 1CZSA 2W0FA 5DMIL 5CMAA 2Y2WA 4YC2B 4HMEA 1LQ0A 5H8DA 3G5VA 2AV1A 4UTAH 2OSXA 1KLFA 3IKCA 2UYLA 2HG5B 4HJJL 4FNLL 1A2YB 2X9XA 4ZUUB 1G7LA 4RSVA 1P7QA 5DRNB 3DVGA 2WMIB 2WC4A 1DWIM 3IFOA 4RQQA 5F9OH 2VR9A 1HILB 1SEBA 3EGSB 3VD4A 4JCMA 5J9PA 4IRJD 2BGPA 3F6IA 3DXAD 2VYRE 5FA3A 4NKMA 2W61A 4QLKA 3RRQA 3SGEH 3SDAB 1JWUA 1T5WA 4AY1A 2ESVB 3E2HC 2J1RA 4MD4B 3PWJB 3MV8D 2CKBA 4FFYL 4M6OL 4NQED 4NGHH 2OJEA 1U8PA 2APVA 4P46A 6A3HA 1YEIH 1JHTB 5EOTB 2VDMH 2BRRL 3VXUB 4R0LB 4BSVA 4H25A 1U8LB 3LB6D 4J3UA 1KWKA 7CGTA 1ZA3A 3U7YH 4ZO6A 4ENED 3LKQB 1N0XL 4POZC 5HDBE 5D70H 5I71C 5C0DA 3ACGA 5E2VL 1MHPH 3Q6FA 2VX6A 4LGPB 5CSGA 4LYQA 1KJVA 2E27L 3FT2A 2JF7A 4XP1H 5HTSA 1BECA 1IZKA 2IPUK 2AAVA 3TN0B 5DFVC 2B1AH 2DF3A 4IOIB 1S9XB 1M71B 4AM0B 3WHE1 4MA7L 1QRNA 4O58H 3LQZA 1DEEB 3RA7L 2Z4QA 3NIFE 5L8LB 3GSVB 5DC0A 5T1MB 2A3EA 4NZTH 3QFJA 5DD1H 1JMZA 3KR3H 3BZ4B 4NYLB 3EJYD 4YPJA 4Y1AD 3WBDA 4JR9L 3ROOA 4NRXA 5JW4M 3IFOB 1A6UL 3ZKNC 5BV7C 1HILA 1OGAA 3ZKSD 5F93C 2YC2A 2VXQH 1C08B 4Y89A 3BIKB 3VXRB 3RVVC 5J12B 5HVFB 1EEZB 1S7XA 4LAJH 2Q7YB 3WDRA 4OLVL 2BBAA 1DBMH 2G2RB 5E09A 5IJKC 4K3DH 4AQOA 2ZSWB 3P4OA 1SY6H 1I1FB 4DWSB 5HDOA 2J6EH 1VIWA 4YXHL 1C16A 2G5BB 4PREB 3RIAF 1JWMA 3QDJA 2H32H 3MX0A 2E7BA 2IFFL 1U8KB 3JTSA 3AC0A 4HOWA 1KN4L 3PGDB 1ZANH 5AZEL 5BCAA 5E5MA 4WHCA 2XNAB 4JZNB 3GBEA 3GSNB 4APQB 5A2IH 1II4E 2NYYD 2VAJA 4U6VH 3RM8A 5EO9A 3D3VD 2G60L 4GJTB 1BLNB 4FFZL 1CTNA 3AS1A 3HC3L 2BNQA 1UKQA 1AI1L 2EXWC 3B3IA 3VNYA 4G3YH 4K9EL 5IB4B 4X6CB 4PJ9B 4CN4A 4XBGB 1WBYB 2HVKA 4FQPA 3FQXB 4EQ3A 1S9XA 1W2PA 3PV6A 1C90A 1IEBB 1JPFB 1A2YA 3VFOB 3NZHH 3PUCA 3SGJA 2IADA 1V3IA 5LA1A 2YWYA 3ULVH 4BUGA 4K3EH 5FGBC 5HI5C 5A94A 3HI1B 2GIYA 1MLBA 3NABH 2EDEA 1NC4B 3FO1A 2WKLA 4DM1A 1DDHA 2NY2C 4FFVC 1J10A 4WY7H 2Y06H 1WAAE 5DJ8A 1KBKA 1EO8H 4KJWD 2XFRA 2GITA 2JK5B 4LEOB 3FB7B 4XMLH 2QKIB 3EFFB 1HHJA 1FYHB 3ARDC 3H7BB 1P5VA 5DT1H 3I2CL 4YUEH 3OX8A 1AIFA 1VAHA 3ZHKA 4FZ8L 5BV7L 5IEHA 2V72A 5DUMH 1KG0A 3PWNB 5F9JB 4ZY9A 2B39A 1YYMH 3N18A 4M62L 2Z91A 2W9EL 5FHBH 3F7YA 1J11A 5JW3L 2Q6WB 3MLVH 4CW1A 1LDPH 4UV4L 5DQDH 4UFLA 3Q5TA 1L4IA 4G5ZH 4JHWL 1QO3A 2BC4B 2W63A 1YQVH 1U91A 2VUYA 4BFBD 2VIRA 2VRKA 1FNEA 5KVFH 3O45A 5E6IB 1NCBL 5C07B 1KJMA 3PIQA 3JTSB 1A6AB 1QFPA 1OD9A 4IOSD 5F7DA 2IQAA 4X80H 2VT0A 4CVZB 1G7PA 4APQA 4PRHE 3AXIA 1D5BB 4R4BB 3PTQA 1WIOA 4F57H 4Q2ZB 3KPMA 1ZJAA 2W59A 2YB7A 1VACA 1T5XA 3BPLB 4PJFE 3L3HA 1JZ6A 5IUSA 2QL1A 1HF6A 5KS9E 3B3IB 2GEEA 3BDYL 3MV8E 3FOMA 3EZ8A 2VLKB 3MSPA 4WV1A 1UWIA 5JOPE 3T65B 5A2BA 3HR6A 2EYRB 4O4YL 4UMGA 4M9OA 4P5MA 5I15L 3EBVA 3QIWA 1UD4A 4PLJD 1GAFL 2ZX6A 3UJTL 1CPUA 2ZNWA 3OKKB 3FAWA 3SEPA 1ZT4B 5EU6E 3WIIL 4JZJC 3O6FB 4GAJH 4M7ZC 4XXDB 1HSBB 4ODBD 3OZPA 1FSKB 3QG7H 1IM3A 3DPBA 4TSAH 3OIHA 4M6OH 4J6RH 1GJWA 5M5DA 1V02E 2COQA 2VQ1B 3JTTA 4MJ5A 1D9KC 1H0DA 2MNUA 4DWSC 5ISZD 2NW2B 3VFTB 4ZENA 3GMLB 2XN9A 1JRHI 3G08A 2BVUA 1BFNA 4ALAH 4OIFA 5GS2D 1A9EB 2J8UB 4A3YA 3PZTA 1G9HA 3O3AA 5DC4B 5JBDA 3UNPA 1VFBB 3REVA 4PJ8D 3UJJH 5GGUB 1X44A 3U83A 2VDOH 1OOAA 1FVCB 3PV6B 4TOYH 2LAAA 1J18A 3BGMB 5DO2D 1B0IA 4K71C 1FPTL 1TZGH 3MV8B 4P7QA 4JN1H 2VWEC 1LEKA 3QEQD 2VLME 2EZ0D 3UTPD 1WDQA 1WIPA 3KDMA 3KNBA 3AGVA 3BQUD 3C60A 2VDNL 1E4MM 4QX1A 1QSEE 3HPNA 5HHXL 1P6FA 2D7PA 4LQFL 3A3HA 3GSQA 4KHTL 1EO8L 2EE9A 3CUIA 2JIXD 5D70L 3TM6A 1F90H 1J1OH 2NNAA 1E0OB 3ALPA 1YEFL 2OMBA 3W53A 3WJJA 4N0CC 5J3HC 5T1DH 5I1DA 1DN0A 2B1AL 3D9AL 1EJ6A 1XGYL 2A1WH 3QCTH 5IMKB 4ETYA 2RR3A 4ODUA 3CC5B 2Y1VA 1BBJB 3QUXA 4I2XE 3TZVD 1OWQA 3RL2A 5C6TH 1SMDA 4U3XA 1FG9C 4JPKL 3ZYIA 4HXAL 1BLIA 3HC0B 4M9PA 4Z6AT 3VGBA 4D6IA 2ZUWA 2JDAA 4I4WA 5EZLA 5E1AB 3MJ7A 3VXMB 5J13B 4FQCL 2NX5A 3RY6C 3SHSA 6FABH 1C5BL 4ZG1A 4KRPB 4XP5L 2YC1B 3SCMC 3RPIA 3WF0A 4RAUB 1HHHA 1D5XB 3A0OA 1D6VH 5IW6A 1EAJA 4XZBA 1HYSC 4HPYL 3RAJL 3V7AG 5BJTA 3NA9L 3IU4H 3ARGA 4GG8B 4JQIL 1WP6A 4BJLA 5DUBA 4Y7EA 5D1ZC 4JHAL 4UUJB 3LB6C 5GPRA 4ODXB 4HBCL 3S5LA 3WMBA 4NRRA 4L5FL 5TGBA 5B3NA 5ADPH 4LMQE 5I17A 2V2WA 1GC1C 4D0BA 1O0VA 1XYZA 1NAMB 2AEPH 3N9GH 4KGJA 1RP9A 3ZTJH 1U8IA 1A02N 3NNGA 1E5JA 2G60H 2VAAA 5KSAA 1KXTA 4R7DA 3BAXA 5C0EB 3TZVB 4F2MB 4RBPK 1CFTA 1I1AB 4ORGA 2DQIH 5GNZA 1I75A 4Y1AA 2FJHB 4UOW1 5DYOB 4MB4A 4NNYA 4PD4J 4FXLA 2G9HB 3RWGA 2DT2A 1G6VK 5DQJA 1DP0A 4O2CA 4ZUSA 1GQLA 5J06A 1KGWA 3ARFD 5ERWB 4W4ZA 1K6AA 3JWNC 1KIRB 4X6EB 3V8OA 2BFGA 1KB5L 3CSYA 1OD8A 1PY4A 3AB0B 2PO6A 1QBLL 4JB9L 4MA1B 2BRQA 2AEQL 1B0RB 2DYPB 2IH3A 3RL1A 5IIEB 2NX5D 2Y6GA 1V7MH 5H37G 3TBSB 3VX0A 4WY7L 2R4RL 2ARJA 3W2DL 1TVDA 3DJ9A 3MRFA 5HGHB 1IMHC 3QHOA 1WIUA 1QNZH 1YDPA 5L2KE 4ZS6D 5L6YL 1X5HA 3UBXA 2XHYA 1TQCB 3D48R 4F9LC 1E4LA 4FTVE 5EOTA 1KYOK 3W6MA 4Y5XA 1YEEH 3WD2A 3QDGA 5HHPA 4WENB 2CITA 1TMCB 3GSQB 2WMJA 4UQBA 5E4EB 1A47A 1GJUA 2DI9A 1KLUA 4OLVH 2VLRE 3HPJB 3RJDA 3MLTB 5HI4C 5GSVB 3ZKMC 1AC6A 3KJ6L 4PLNC 3ULUC 1QZ1A 1YA5A 2GK0A 3VWKD 4TUKH 4N8VG 2W38A 1DVFC 3STZA 1DN0B 1J05A 1JBJA 4IOIA 1NAMA 4LIQE 4M43L 1EHXA 1E6OL 3DV4A 4LP4A 5DMGD 2XUCA 2XPKA 5E2WH 5L88H 2F61A 5DF0A 4N8CL 2C0HA 3C09B 4KROB 1KN2L 2BDNL 3DGGA 3VFMB 3VI4F 5GRVL 4PRBB 5EFFA 5INCB 4U2ZA 5FV1L 1ONQA 4QY8A 3VXME 5I8KH 2VXTL 3QZWA 3CZFB 5I1CH 1YJDH 1FFQA 1PPIA 3GRWA 4NNYB 5JPNA 5D2LF 2IBBA 1E4WH 2FJGA 3CDFA 1MFCH 4LHUD 4ZUSB 5GGTL 3FB5B 1HYRC 4KK5D 4QT5A 3WNOA 2JEPA 5FKPA 2YD7A 1V3HA 1W0NA 3OTTA 5TQ0H 5D7IE 1CGSH 1EQCA 4JDVA 1ZBWA 1TJGL 4YHGA 3N1QC 1TZIA 5D8JH 4R7NB 1I8LA 4XGZB 3MRLA 3MLPA 4GRLA 4HUMB 2DDQH 2I5YH 4JN2A 4Z5RA 3C60C 2WVVB 4Y88A 4D0CB 5KSAD 5LAXA 3GXMA 1LEGB 2H2SD 3HR5A 3S5LB 1HVXA 4UAOB 1VJZA 3RVUC 3LQAC 3GMRB 3QCUL 1BGXH 3TO2B 1YECH 5DR5H 4M6NL 3QDGB 4JHZA 4XMLL 2YC4A 1JDCA 1WBXA 2VC2H 3DMMD 3RWJA 3EOYG 4LK4A 1NAKL 4LASL 4PJDA 1UFUA 3P73B 3VJ6A 2EH7H 3LRSB 3LKSB 1H8OA 5GSVA 1JPTL 3STBA 3WHXB 3D85B 5EWIL 5IB4A 3MLZH 4DN3H 2AABH 2FJHA 5DZLA 2OP4H 3GH5A 4WSKA 3BUYB 5EIQA 5KAQG 2WWMC 1ZHKB 1F3DJ 1MVFA 3RWGB 1BGGA 5EU6D 3VW3H 3MYZA 5FYJE 2XVNA 2VH5L 1BOYA 1CF8H 3QDMB 3QFDA 2XFXA 4K07A 4O2EA 2QQLA 3CO4A 3MMUA 4B50A 2E9JA 3OKDB 4W4OA 1NUNB 5HGDA 2CO6B 4GG6A 4P02B 1VERA 3BP7A 4GXUM 1DWAM 3TBSA 1H5BB 3EO0B 1PZ3A 2K9UA 3OAZK 4Z7VB 3RVTC 1FP8A 1CR9L 1RZ7H 4S1RL 3ZDYE 3SKJL 4PYGA 4FMKA 1UH2A 4A2LA 3WL9A 5L2KD 5DZOA 1JU4A 4GMTL 4HTYA 4XMKH 3WO4C 2GCYB 2BY1A 2QTEA 5HDRA 4HPYH 4MVBC 4L4TA 2Y8VA 3MANA 3L3GA 5FCZA 1QVOA 3HLAB 4BQCA 2DSKA 4JPKH 4GRLB 3NIFF 4F33A 4XP9H 2VISB 2A73A 1JGDA 4G6ML 4YNYB 1MJ8H 3CH9A 2CRIA 2PR4H 1MXGA 3RILA 2BGOA 4JFEB 3SDYH 4Q97A 3NDYA 1T7YA 4BA0A 3L9RB 2DLFL 2D9QB 3T2NH 2DQEH 2ZCLH 2JCCA 3KJ4B 3QNXB 3SURA 4R4BA 1CI5A 4UDUB 1R86A 3HI6H 4PV8B 1WWCA 2HFFB 4X9FA 4KK6D 1A7QL 3S37L 3VFMA 3WFCH 4FN0A 3PF2A 1CQYA 2XOMA 4YBLB 1G9ML 4YHML 1MHEB 5GRZA 2K1MA 5EFIA 4C83B 1F13A 1NKGA 2BXZA 2VLKA 4JL2A 5F7YC 2W95A 4UT6H 3QIBC 2NY6B 3H9SE 4PRPD 5KVDH 2OYMA 1XSKA 3GYCA 3D3VB 1HOCB 4JFPA 1S5HA 2HFTA 3QFDB 4H0GA 3VXOA 1A1OA 1LK3L 2R1WA 1VSCA 5IR1A 4JQXC 3P6BA 1XGPB 4ZQKA 2CLRA 3KAAA 3PWUB 3Q3GB 3NCYS 2CGRL 2GK1A 3KYMA 3C9NB 4GXVL 3CUFA 2X4QA 1RUAH 1ZJBA 1QD0A 3T0EE 1JZ8A 5IEKB 1JHKL 3K7UA 4U3CA 4ML4A 1DQLH 2RFXA 2ZSVA 1RUMH 5CJOH 4NQEE 3ULUF 3RWIB 1YEIL 4IISA 1F58H 3ACHA 1WAWA 5MEOB 1NUFA 1SYVB 1ZLVH 1I3RA 3VGFA 2D9CA 3BAKA 2XXMB 4X7EC 2NXYC 1S7SA 1WBXB 2YD5A 2EDWA 3BKJL 1L7IH 4Q7NA 1KOAA 3IF1B 3AU1A 1NGZB 5IB5A 3P11H 3EYFA 4DGIH 1BZ7B 5F88A 4M7LT 4ELME 5C0CA 2XFYA 3MJ6A 3BSZH 1XD1A 2UVFA 3BH9A 3VXUE 3O3AB 1IGIH 3JV6B 1QQDB 2WAGA 2DBLH 5DFVD 2PW2A 4UILH 5D9MA 2UZIL 4PBXA 3G6JF 5EWIH 1JGVL 1OSZA 1HXYA 1Q72H 2ZUQB 3UMTA 5GRJL 1TUXA 5IVXA 1GGIL 1R0AL 1ZHKA 2YEZA 4XCCL 1MVUB 3UCRA 1D5ZB 5EZJA 4N0UE 3ES6B 1RI8A 4JFQA 3G6JE 3VD3A 1CLYL 4NZDA 1KCVL 3MRIB 4UQ2B 1UM4H 2W94A 3KYKL 3UG3A 1LF1A 1YPZE 2EKJA 5E6IC 2BY0A 3WH5A 5GQBA 5EOQH 2NY4B 1AGCB 1AR1D 6CGTA 2PN5A 3VXTB 4OF3A 3O4LE 4YHIA 2C4FT 1O7SA 4ODSH 2LV4A 5I79A 1CBVH 2P43B 3NRUA 3BUTA 4S1RH 3U5YA 4PG9A 1ZHLB 2Z8VC 1RJYA 1CXLA 4F9JA 2BVEA 4PR5B 1OIFA 1W0WB 5I0ZA 1T7XA 4LAQH 1US3A 1A5FL 4U7KA 4HK0A 3CIHA 5EO1B 4JPWH 4U1KB 3PZVA 3ELAT 5C92A 1QBML 1CLZL 2CRYA 2NY7H 5IEKA 2GJZB 1OVZA 5I1CL 2WUCL 3C5JA 3PUIA 4PTXA 5MI0C 1BGXL 5GGRB 1DUYA 3DXAB 1BAFL 5CJ8A 4XCFL 2R0LH 5E6ZA 3GJEA 4QGTA 4FS0A 4RAVA 1JZ4A 1G9EA 3AU1B 2C3VB 2P48B 4Q9RL 5EORL 5EZLB 2V3GA 3AHYA 2BNRD 5FGCB 5ABDE 1KXVC 1BVLB 2QBWA 3WNNA 1C8QA 4TTGA 4DGYL 5EBMB 3F7RA 4Q9QL 4RX4A 3W0WB 4DFIA 1F6AB 2EDRA 4G3YL 2W87A 3SDCA 5EFIB 4PGBB 2W3JA 3MBXH 4H20H 4PMVA 4W6XB 3EYSL 1KEGH 2E9IA 3WMSA 3NZHL 2CDFA 1K8IA 3IJYA 3VIOA 1XMWA 4O51B 3ARFA 5E9DD 2I5YL 1HEZB 2R1WB 5JMOA 1LO0H 2C7UB 1CDBA 4NQDD 1CE6A 1EEYA 4U3HA 3RWDA 1XH2A 4Y5VA 3K8MA 3GB7A 5E8PA 5HOSA 3MRCA 5TDOA 4GAFB 4UV7L 3HS0A 2DM2A 4OZIA 4X8XA 4U6YA 1JRHL 4KK6C 1CGYA 4GXVH 1A7RL 4AIEA 3WFEH 3FQUB 4PRDA 1QPXA 3GUTA 2LU7A 2QADB 4PG9B 3PTKA 3VWKC 4G7VH 1KXTB 3GK8H 5BO1H 3CLWA 15C8L 4AAXA 3VW3L 1FLTX 4L4TE 3AQUA 3U7YL 3BAIA 4CUAA 2PXYA 2WBWB 2F8OA 3BKYL 2E40A 1CD8A 4G8IA 2AABL 3CHDA 3BH8B 4JY4A 1BZ7A 2B5IB 2O5XL 2HLFD 3FOLA 3OR6A 1CYGA 5EIIA 2O5ZL 4Y19D 4LGXA 4J3TA 3PZMA 3U4BH 4L3EA 4NBXB 3PHSA 4NZJA 1V3LA 3DXAA 4QTIL 1V6UA 5I66B 1AGEB 1AQDA 3QUZD 1ZLUK 2YD4A 4GG6F 2PO6B 5D9OA 1HH9B 1MCOL 2UZYB 1I9IL 5ESAA 3TVMD 1ES0A 4BA8A 1EHLL 1Y6KR 2O5YL 3CJJA 1D5ZA 3MMDA 2YD6A 3HAEH 5JORB 1IGJA 2DQCL 2FB4H 4UTBL 2XVKA 2HVJA 2YBRA 2DQUL 2X40A 1NDGB 3QULA 1G7IA 5T33L 3GNPA 5CSBA 1MH5B 5FHBL 1RIUH 5FK9B 2J78A 1A7OH 4WCYH 4MXVF 4XH2A 5KSBA 5D96C 4K7PH 1QI5A 5DN2A 1BJ1J 4OB5H 1KCKA 2XACC 4RCAA 1FAIL 3HAEG 2XYLA 3ARBA 4PJDF 4FQIH 1CGWA 2A3AA 2Y6JA 4LPWA 1FN4A 3BESR 1KENH 4NNXA 4U1LA 3BKCH 3DRQB 1PZUB 4K3DL 2YL5A 1IL1B 1BWWA 4HWEL 3HRPA 3GGWB 4LARL 4TVCA 4H26B 3VCLB 1ED3B 3NCOA 4U0QB 3CMOL 2GJZA 4HJJH 3SBWA 4ZTOL 1ND0A 2ENYA 2XKUA 5I18L 1MRDL 3I84A 4GXUN 2QJDA 4HD9A 2F54A 2GUOA 4XVSL 3CFEB 4JM2C 5TH2A 3MO4A 1UGNA 4G9FD 2I9LB 4G43B 3WUEA 1BAFH 3DX7A 4RMTA 4MADA 4M00A 4P5TB 3T0EA 3GJEB 3KPOA 3EGSA 2AK4D 2W5FA 2FEEL 2XFFA 5CWSA 1BVZA 2H2PC 3ARRA 4KDWA 1AI1H 1MCRA 4GBXC 2PI6A 4AZ7A 2WW8A 1S5IH 3L5JA 1E43A 4D9QE 3U46B 1C7SA 3V6OC 5IQ7H 1I8KA 4OGAC 3ZHDA 1FGVH 1I3GH 4OUEA 3HEIA 4J6RL 2WZPD 1MCCA 5KG9B 3QXAB 4JFDA 2XWJB 1Q1JH 2BVOB 5EO0A 3U6RA 3WLWD 4K55A 4XVUD 5I3DA 5F96L 4L8DA 2GJXB 4Y5VB 3E8UL 4JAMA 4XP1L 3NBNA 4PJXE 5CMAB 3BCDA 2X4PB 3GXFA 1FL5B 4M02A 4GUPB 3UTTB 2DMBA 3AS3A 4H04A 2CDEA 2IAMD 4N0YH 3A6BL 3B2VL 1LDSA 4HUUB 4JKWA 2NY1C 1F4YH 4CJ0A 1A7RH 5GRVK 1MCPH 1S9WB 3O6ML 1TJHH 4KJWC 3LKSA 5FYLH 5C09A 5DUML 1P7QB 2WBJB 1G5AA 4BK4A 3GXUA 2JB5H 4N1HB 2DIJA 2G8ZA 4LSUH 1RHFA 3L6FA 4RQQB 2FEDC 4OI7A 1D7PM 3OLIA 3LEYH 4R8WL 2VDLL 4HUXB 3HHRB 4OCWL 1EGJH 2XSBA 4NOFA 5JXED 1J88A 4XRCA 1JHLH 2VZ3A 3C7OA 1UC6A 4JY6B 2SEBB 3QDMA 5IYYA 3B9VA 5KVFL 4ODTH 2WXDM 1AGEA 1AQDB 4NRXB 4M4PA 4DK3A 5BXFB 5TE4H 2CKBH 1U8PB 3N1PC 1G6RL 1DZBA 2BNQE 2EH8L 4OI9A 4BDVB 4OYUA 3T0AA 4QYOB 4XNZB 5MEND 1C8XA 4I2XB 4JCLA 1DQDH 1U8LA 2YUVA 2XGBA 2WV3A 4YHMH 3T77A 4CU9A 1ZMYA 5KZCB 1Z5LA 3QGVA 1E6XM 4XX1E 1MCWW 1NWSA 2IC2A 4AZ6A 2WINB 1QFUH 1QYGL 5DJ0B 3QUYD 2V38A 3Q0HA 1SBSH 4WU5B 5A3ID 2X89A 4HCRA 5MEPB 4CL7A 5I1AA 4Y4KB 5DQ9B 1PSKH 5JHLL 5HYEA 2Q7NA 4GQ9H 1ACZA 2NR6D 1ZE3C 1U2YA 3N04A 1I4FB 1OPGH 3IFPB 4JRWA 4X5XA 4NP4L 4TUJB 3ZZ1A 3L5XH 3N17A 1CD1A 3FO0H 1J0ZA 1KC5H 2E7LC 3VGAB 1S9WA 2ZUMA 1HNYA 1F6FB 4DEPC 5D7IF 3QXUA 1F4AA 3GFUA 4DEPB 1MFUA 3FFCD 5C09B 2HJLA 2EPNA 2VMCA 1W9WA 4LPVA 4BQ8A 5TE6H 2H32A 1E4KA 4LNRA 5DHXB 3T0EB 1EZVX 1E6JH 3FMGL 3A47A 4JQIH 5GS3A 4XUQA 4U6XA 4PJ7F 4LVEA 4K68A 4BQ2A 1IT9H 2ICEA 2CKSA 5DJ8B 1GQPA 4HJGA 2VDOL 3IDGB 1Q9WA 5BXFA 3P1IA 1DLFH 5I0DA 4AMKL 3IETB 3KPSD 4WUUD 2ID4A 4LSVH 4MXQC 1IQDB 3QRGL 1AD9A 3ZDYF 2N4IA 5C0FA 1TQCC 2YHGA 2W0PA 3FB6B 2YFZA 1K12A 2H6PB 2VLLA 1CEOA 3PBGA 1ZT7B 5DMJB 5I15H 4JFUA 3WV0A 3G04B 4U5KA 5DJ0A 1ETZA 1N4XL 1EK3A 3BYTA 1EXUB 1VFAA 3VD5A 4N0FA 4M5ZH 2A77L 5A8NA 2YWZA 3O11B 3QJFA 1AFVL 2AJYL 3X11A 1LO2L 5SWSD 1IQWL 1DWJM 3R1GH 4K8RL 4WHDA 3O8XA 4W6WB 1P1ZA 5FXCH 5FL0A 1T2JA 1JTOA 2AV1B 4NUJB 2AAAA 3ARWA 3LMJH 3SE8H 2PWHA 2WBJC 2UYLB 3CFKA 3B9KB 3GJFB 5J3HD 3MSDA 1MRFL 1CICB 2BHZA 3PQYD 2JB6B 1MF2H 2GITB 5EBWB 5CEZE 4V1DB 3QHMA 2XZAH 3WD1A 1UXWB 2OJZL 1RZJL 3L3KB 3C6LB 4JKMA 3C6LC 4XB3A 2X44D 2KUTA 5MI0B 1B6DA 1PKQA 5CJQH 4QYOA 1GOGA 1N3NA 3RY4A 2JJWA 3GSUA 4Z78A 3BWAA 4UTFA 1O8SA 3QG7L 3V6OA 4H8UA 4Z7WE 1T0MB 3W9DB 3HCVA 3T0WA 4YHOL 4N5EC 3JZ7A 5EU7C 4E0RA 1CL7H 4PJAA 1PZ5A 3DI3B 4FXGA 5EPMB 1FSKC 3HNTH 1FGNL 4NSKA 3MJGX 3JTTB 4MJ5B 4OLXH 3LN9A 4PJ9C 4OZOA 1C91A 3SCMD 3UPAA 4WKAA 3W26A 1CWVA 2XM1A 4I77H 5TE7L 2JJTC 3CXDL 4HS8H 5CILL 3MBED 4CVZA 2A2QT 4NPYB 4DWSD 1VHPA 1VJSA 2D31B 1AY1L 4HUWB 1MFVA 4XVSH 1X5LA 5GRUL 3KE0A 1B88A 4NHUB 4IMKC 4X5XB 3ZT7A 3IDXH 4WFFE 4GI9A 5IWLA 2F5BH 3MRKB 1VBUA 2WAHA 4ZAKA 1U8QB 1LO5B 3SGDH 1FH7A 4I0PB 3O11A 2A6JA 1YYLL 2PTUA 4W8JA 1ZGLA 1TJGH 4JGMA 5F3BB 1CFSA 2E9WA 3LQAL 2OWCA 1L7TH 3BDXA 2H1PH 4LCWA 3CHEA 4NQEB 4GRMA 1K8IB 2HP4A 1KJ2B 2VH5H 4J7RA 2DAVA 4PRAB 4P8VA 2ID5A 3G5YA 4YDIH 1MCSA 5A1AA 1E27A 1PDKA 5ABEA 4U6TA 2D03L 3SDXE 3BEVA 3I02A 3IETA 4PN2A 3ARSA 1F2XK 3RVTD 4FTVB 2TAAA 4U6HB 3WS3A 4ZS7L 2XN9B 3G08B 3VM7A 1HHKB 4N1CA 4NO5A 3QEQB 1A9EA 1NFDF 3HNMA 4EBQH 2VZPA 2EDLA 4ERSH 5E8NB 4PMOA 5FECB 1SJHB 3G04A 4UT7H 4PMDA 5A6KA 4IUGA 1IGCL 3HAEB 4BSJA 1WWWX 4H2CA 3WNPA 2CH8A 2GFBB 1G01A 1WWAX 5BOZG 5EN2A 5JLZB 2X1PA 1U92B 3CSGA 3TH2T 1GOWA 2OBGA 3KG5A 4HXBL 4LVNC 1MLCB 3AREA 4OIIH 4N90D 3WIHL 1LO2H 1I9EA 4NHUA 4OLWH 1FZOA 1C93A 1NH6A 1I85C 2QMKA 2YMXH 2ZUVA 1WBYA 3ZR5A 3HA0A 2BHYA 3QUYB 1K9EA 4H1LH 2F53D 3C60D 2JF6A 4PY7A 1CICA 1GJIA 3WUGA 3I9GL 1OTTD 4G8EA 5ICYB 3VXSD 4A41A 1R5WB 3OJ2C 3ZDZF 3U9PL 3MRGB 1HYSD 1MHHB 1OT2A 4OJFH 2ADJB 1UEYA 1GZQA 3JWDL 1NCWH 2YZ8A 4K3JL 2B0SL 4HX1B 1HXMB 2MJWA 4YXHH 3B2UD 1T1YA 4UR9A 1PW3A 1FZKB 3SQOL 3G6AA 3CU7A 2WLZA 4GRMB 3AI0A 2AEPL 2JK5A 4WFGD 5IVNA 5I1LA 2A3CA 2VM9A 3H7BA 1MFDL 3GTNA 4X9YA 4OGZA 3WQ8A 5TQ2L 1L6ZA 4LSDA 2E26A 1CLCA 2CXGA 5GGVY 3V52H 2E8YA 4LPTA 3WXWL 4OF8A 1XD0A 3WUWB 4LXFA 1KTKE 4PJGF 3K75B 1BTCA 4NGHL 1HKIA 2YDSA 4K3GA 2YRZA 3VG0L 4RGNC 4RNRA 3MA9L 4U7SA 3QHFL 1OWWA 1OHQA 4LLQA 5I74B 4C7FA 4JFOA 4PJEE 2DBJA 4YE4L 3AFBA 3CZJA 4NN7C 1LP9A 3LN4A 4QX3A 1UWGL 1INEL 3PGCA 1FJ1A 1NWTA 2WP3T 4EVNA 4EDWL 3K4DA 4ZMAT 5LXGH 1MFEH 1RJLA 4FQXC 4TUKL 2B31A 3D25B 5CIPA 5F1NA 4P2OB 1H3VA 4H8WL 5J6HB 4FFYH 1T04A 1JNHA 2G75B 1UM6L 4WTZA 5JXAL 3NACH 5I1GH 1BZ9A 1JFHA 3AHTA 4JO3L 2QV4A 4CUBA 3TP4A 1H6XA 2WZIA 4D0BB 4AEHL 1GPOH 4R96A 7FABH 4PRPA 3G5YB 4PBVC 2YLLA 1GZQB 2WWCA 1E4WL 3W24A 4CKVX 1HL9A 1JGUH 5D7SH 1HVQA 4IM4A 3GKZA 4GKSB 3MBWA 4XC3H 2AXGA 2UWEA 5ID0A 1FCCA 1PYWB 3WN5A 4MJ6A 5CP3H 1HHKA 3CTTA 1SY6L 5FGRA 5HGGS 2FDBP 1K6QH 4JRXD 5AAMA 4YO0B 3Q2CA 4B7LA 4JRYE 1FV1B 5L88L 3QUMA 2ZUQC 3FO2B 4MO3M 4OCSL 3NTCL 5I1IL 1HKLL 1NC2D 1E71M 3FB8B 4OZGA 2WO3A 4J1UB 4I77L 3ZT5A 1VDGA 4HWBH 3N12A 1WO2A 3U7AA 3ME0A 2QPUA 3MFFA 5AWNH 1U58A 4BUHA 4PB0L 4GFTB 4FNLH 4GLRH 3CIVA 3LS5H 3DV6B 4ENEC 3WLBB 2FECI 4Z7WB 2Z0BA 3H0TA 5D1ZB 1EOKA 5FKPB 4NM8L 1OLLA 2L0DA 4XP6H 2ZUTA 4EANA 1HJUA 3MV7D 3QUKA 5SWZE 2A83A 3MRDA 4EVNB 3W0KA 3KXFE 4NN5B 4QDMA 2CK0H 3IDNB 4OFYD 3RVXD 4KY1H 1A5FH 1FFOB 2DMKA 4HKJA 4KRPD 1W3HA 1A6ZB 3HNTL 3IFNL 4QRQA 4RMSA 4Y5YA 1DQJB 4OAWB 3CLEL 3OAYH 1UACH 2LW8A 4OZFG 4X4YA 3QQ4A 4HG4J 2OSLB 2ZOKB 3PHQA 4M7KL 3OSKA 1FO0H 1MI5A 5CILH 5EBLB 2P5ED 4JQVC 4YLQT 1NUDA 4BM7A 2Q8XA 3I75B 5CJXC 4BFGA 5BQ7A 5GRXG 3M17A 4X4ME 1V02A 1INDH 1KCSH 4GRWF 4MAYD 1UD2A 3MNWA 3V9FA 4CN6A 3SO3B 4PT6A 4R6UA 4N68A 5ENWA 2WANA 2VRAA 1CDHA 3SJVA 5T1KA 1ZT1B 2OI9C 4CVXB 4F58L 3UJIL 4NNPH 3RDKA 2BNJA 3CVHB 3TA3C 1AXIB 1BBJA 1HP4A 3MMWA 2DQHL 1WDSA 1Z9LA 5JNYB 1AR1C 3QI9C 3I6GA 4XAWH 1JNJA 5F89B 5I30H 5ICXA 2IANB 4HIJB 1MCQA 3BSZL 3POCA 4JFTA 2NY6D 3DV6A 2XN9D 3V0VB 1CTOA 4OM1L 3U37A 2RBLA 2ITCA 4NC0B 4FRWA 2G75A 1B0WA 5CLTA 1QNPA 4D6GA 3VU2A 1HHHB 4XCCH 2R0KL 4E41E 4MQ7B 5AG9A 1FDLH 3RWEB 3BPOB 3WSUA 3RWFB 4ZUTB 1I1FA 5JXIA 4QFUA 1UQSA 2IF7A 2CETA 3F65A 3QUXD 3WF1A 3BRGC 1U8MB 2B0SH 5AYIA 1JPSL 3FN9A 3CZ8A 5ECUA 3QCTL 1YQVL 4CDHA 4KGLA 3TC9A 2ZWZA 4BXSV 1GGTA 2VZVA 3FRPG 4XZWA 2IPKA 2YUZA 5L2JB 3PZUA 2OXGA 2PYEE 1GXEA 1NLDL 3DUUA 5FO7A 3WDPP 2WBKA 1CK0H 4P8XA 1KENL 1QW8A 3WFCL 3V8CA 4P23B 4DAGL 4P7LA 5DJDB 5D7LD 4OLUH 1DUZB 5EH1A 4GW4B 1W9XA 5A6AA 3S3SA 1KXVA 1I7TA 2RGMA 3HU7A 2NY5H 4B5EA 2DI8A 3GNRA 5KANG 3RBSA 5D6DC 5JOPD 1HKFA 4HGKC 4JFFA 4I3GA 3UYRL 1D6VL 4P4RB 2FLBT 5AUMB 2CK2A 4CMHB 5IHLB 1A9BB 5ANMA 5HHQA 4HIXL 1B0RA 2GCYA 4XNXH 1NC4A 3ZJ6A 3CCHA 4GLRI 3X3GH 4XWGL 4KUZH 3RDTD 1A6PA 1AGBA 2A6KA 3QUZA 1UWTA 2NY4D 1HX0A 1CLXA 2EIBA 3C7HA 4NQDA 3SKJE 3IDNA 4GAJL 1BHGA 5FKAA 2V2TA 2MHAA 1K9TA 2DMCA 5HD8C 4ZXLA 3VPLA 8A3HA 4LDOB 2P5WD 4MNHA 4RISL 1FHGA 1AIFB 3RMEA 2XPGB 4HMDA 2MCG1 3RUGA 1QUNA 5IVOA 3V2AR 3WSOA 5IJKA 3PGFL 5E5MB 4DGIL 5A8PA 4M7KH 3WSQH 2PXYC 1OAUH 5KSVB 3OA5A 1GMMA 3HE6D 2UWEF 3LS4H 3GSOB 1Q4NX 2DKMA 3WH7A 1R3JA 3HRZA 4E4PA 3BOVA 4WWKD 4R27A 4WFHE 2YLAA 5EUKA 4AIXA 4MS8C 4NQSA 3TBTB 4C83A 3RGVC 1S3KH 3LPWA 4ZAKB 1U8QA 2XZCL 5HHVL 1HHIB 3HC4L 4F57L 4TX8A 1U8OA 3L1OL 4YPGB 5DEFB 3VFOA 5JXAH 1MVUA 3EHBC 1UCTA 2A6JB 3JV4B 5GGSB 3T3ME 3KWXA 1Z2KA 3BGFB 3EDEA 4KUCD 2KH2B 4PRBA 1DEDA 1MREH 4KXZI 3OLEA 1ONQB 1MAJA 4GAGL 4MGSA 1R3LB 2W60A 2CIPA 5TD4A 1KTLB 4X4XB 4FFWD 2YPLA 3O9WD 3UCQA 2F15A 1NMCC 3PWUA 3Q3GA 5JIPA 3WUFA 5F7HA 1VF8A 4D6CA 2FEEI 3GSRB 3BZFB 1OTSD 1HHJB 4QEGA 3O41A 5D71L 1NCDH 4Y2DB 4QRPD 3CZUA 2AK4B 1FO0A 5KN5A 2BY2A 1NGXA 1I3RB 4ZYKA 1TZIB 2MQ3A 5FYLL 4HZLA 4DGVL 1A3HA 1HE7A 1CICD 1OSPL 2DLIA 3DX9A 3KJ6H 3PQYB 4HV8A 4JRYB 5T3ZL 1RULH 3GMQB 2WQRA 3TA3D 3K81A 3D9AH 4XNQB 5F9DC 5T5FL 5IFAH 2XIDA 1NC2B 2XV6B 2DRUA 4S0SD 1LWHA 2RV9A 1US2A 3TO2A 5EU7E 1S7UB 1R5IA 4Z76A 2DH2A 1OSZB 3FZUD 1LO0L 5F7DB 4TUOA 1MW1A 2XJ7A 4PJDB 1U0QA 4NOBA 2DGAA 2UY6A 2F19H 4IJ3C 4D71A 4FQQA 2BSRA 4ORZC 3UX9B 1RV6X 4W93A 3P73A 3H9ZA 4KTEH 3VJ6B 2CDPA 2F54E 4F37K 4IRSA 1J1PL 4EI6B 2NY3D 4L5FH 4Q0XH 4LFHG 3EB7A 3K4ZA 1MELA 2Z92A 4UQ2A 5F21B 1I9JL 2WVUA 3C7FA 1WITA 3FQTA 5EUKB 3HNSH 3A67L 1DBAL 3V4PL 4LCCB 4XHQA 3WJLC 5TQ0L 5FYJL 5IV2A 3ROLA 3QCVH 3HI5H 4PGCA 2EQDA 2IJ0C 3D69B 5FAAA 2ADJA 1AH1A 1MJUL 4QGYA 4F3FA 1ISZA 5DD5H 3O81A 1BOGB 4OV5B 1QACA 3L3DB 1NUGA 2UUDK 4QRTB 1FL6A 4NRZB 1YNTB 5DGRA 5H94A 5TDPB 3ECBA 3PHAA 2DQGL 3CLEH 1YPZA 4R2GD 1K4DB 3NAAL 2FJFA 4E42A 2MSPA 5I74C 5BMFH 5HHOD 4Z7VA 5ITFA 5FKAB 4J3SA 3WQ6A 1I7ZA 1GHFH 1G7HB 1IAIM 4MNHB 3FO0L 5C70A 1U3HD 3EBAA 4O2FA 2CPCA 4OZHB 3SBWC 3VH8B 1FO0B 5KN5B 2EO9A 5D2LB 3MROB 3GMPA 1J0KA 1L7RA 3P9LB 2ICWA 2FWOA 2A1WL 3S3JA 3U30C 4JRYA 1UB5A 2QSVA 1A7OL 4WHTB 4WCYL 4U1HA 1PX8A 2FBJH 1E6ZA 2V6HA 4OB5L 5I2IA 1AR2A 1W2KT 1UD3A 5GGQL 1Q9KB 3MBEB 1R3JB 2H8PA 3RO8A 4NO2B 1ZLVK 4F7TB 5I71B 2FR4A 1F4YL 4WFHD 1OW0A 4ARXA 1T21A 3MXWH 5F8RC 3D39D 5C9JB 1FJ1B 4I4WB 5LA0A 5CJ5A 3MJ7B 3OZ9H 4IRSB 4EI6A 2X0HA 3PP3H 3QDME 4ZFOB 4TX6A 1U9KA 3POHA 2R1XB 3SOBL 4KV5F 1FC1A 1TIUA 1LJYA 5IK3A 3ETPA 3WFHB 3LD8B 4KJYB 5EOCH 1DN2A 1Z32X 4MNLA 3QFJE 2ORBH 4MNGB 4D0DB 1P84J 3U5UA 5BRPA 3D87B 3AZSA 3KLHD 3VWJA 2OWXA 2P8LB 1S9KC 4HZ8A 2J12B 4YGVB 1Q38A 1Z9MA 1FBIH 2E7HA 4Z7QE 1X5IA 4QRTA 2VL4A 1MUJA 4JM4L 3ECBB 1K4CB 5DA4A 5C08B 4JKPL 1I7UA 4MJ4A 1JZ2A 2PR4L 1FOBA 3U9UA 5D6CA 1RULL 3LPGA 3QISA 4HOZA 4MLIA 4MYWB 5CJBA 3BCFA 1FLRL 1CL7L 2NXZB 3ZSTA 4P9ML 1DE4B 1NGQH 4ZOEA 3X14A 3KPQB 3RY5A 3VRLF 2LS6A 1R3KB 3MA7A 3S36L 3MPCA 1UKTA 5F96H 1TETH 2VUOA 4EN3A 5SWZD 4QNPE 1E4KC 2ZPKH 1YHTA 1OL0A 2XTJE 3LS4L 2EE6A 4PJ7E 1Y0LB 2VN7A 1VGEH 1HKJA 2NY6C 1TVGA 1FGVL 3RPIB 4HIXH 3D39A 4PUEA 2VZ1A 5HBFA 5FKYA 5FGCE 4AQ1B 3RHWF 5KSBB 5JPMB 3LN5B 5CD5C 2MQCA 1ZVSB 4X0NA 4IPNB 3GBML 3NH7L 3W2DH 4WEBH 4JFDB 2R0WL 4G6FB 4O02H 1UR0A 3AICA 3NDZA 3V6FB 4HPOH 2A9NH 1IKFH 3FTGA 1N7ML 5DTFA 1P4IH 4XI5D 3OEBA 1NFIB 3VIHA 2WO2A 4OAWA 2ITDA 5DK3A 1XZ0B 4H26A 2Q76B 4KI5E 3NCJL 3JUZA 1DL7H 4KTDL 3FHQA 5E8DH 1GU3A 1ZA6A 1F3DH 4JQVA 1U2HA 1ADQA 2GSIA 2ILLA 4FP8H 3VXSB 2XGIA 5JXGA 2NY2B 4Q7DA 1I1RA 2E27H 3FQNB 4YZFF 5BXRA 4ZPTA 4AEFA 4FG6C 2GK0B 3DUHA 4HUXA 4Z7NF 4DXRA 1I7UB 2HMID 3U9UB 1IQDC 1VADA 2XM2A 3MCLL 4YAQA 5DQJB 4KK9C 1QLFA 4HA1A 2BDNH 4JHWH 1WFUA 5C0AD 4G6AD 2XG5A 1IGCH 1OTUC 4WSJA 5F89A 2WVSA 2EDBA 2EH8H 2Q1EA 5KOVC 1NPUA 2DSWA 1W1YA 5I8OL 1MFBH 2IMMA 4MB3A 3O3UN 2QV2A 4ELKA 3RZCD 3APGA 3VFVA 3P30H 1GOFA 2J7BA 3A6CH 3MODH 5JQHC 4YDJB 4F9DA 3IJSB 4XCNB 4MQSB 2RGSA 3HNSL 4Y0GA 4NWTL 4H0IA 4C57C 3I3BA 4Y5XB 3HB3D 4YHPB 4MX7B 3AFLA 1ZVSA 1IGFL 1U93B 1UWEH 1CXKA 3LSOA 4OIAA 3V6OE 4IS6B 2J88L 4ATDA 3HE6A 5IBLD 2DQXA 1FFNA 4NSBA 4G7YL 5DRWB 1UQSB 2NY5C 4P59L 4M3KB 4XTRD 1HEZA 3GZKA 5IFAL 2Z8SA 4P0DA 3VIGA 2GFTA 3MRCB 5TDOB 1XV8A 4X7FC 4QOKB 1QLEL 3EYUH 4W7WA 5KTEH 3WIIH 4WO4C 4U6YB 3HUJF 5DHYB 3CVHL 1FGNH 5J8OA 1JVKA 5B4NA 1DE4A 4ZUUA 3QNZB 4Q0XL 3VDHA 4ELMF 3WYRA 3D85A 1QEWA 1IC4H 4JO2H 1DUZA 3O9WA 2W0LA 3F7VB 1FHDA 5C09E 4K7PY 4M5YL 4MCYB 3I85A 2HRLA 1AY1H 1FL3B 4QRSA 2YFUA 4X5WB 1EGZA 2F8VA 3SDAA 2XWTB 5F7NC 3ULVL 2OQJB 3BEWB 3BKJH 3L3IA 4PJAF 1KEGL 3F12B 1TMQA 1EUUA 1E73M 3ZQ9A 3NABL 2V9QA 3ZO9A 2MFNA 5TJWK 1MCKA 4L29B 2YN5A 1JHTA 1FORL 2MQ0A 3RUGE 4WW2F 1W9PA 2CUMA 4C56A 3TA9A 4XGZA 3VTRA 5JTWA 1KPRB 1H3PH 2F8QA 1IGJB 3BIBX 1DYOA 2C26A 3RVVD 1N8ZA 3PDDA 4NZTL 5AC5A 5FM8A 1U8NB 2Z9TA 2Y5TA 4QNPF 5I2UA 2UZXB 2G3MA 4XWOD 4MZ2A 2H6PA 5JUEH 3IXAB 1UM6H 3KL5A 2N7AA 1I4FA 1F58L 3VWJC 4OF7A 4LRNL 2HRPH 3CMJA 1P2CA 3RWJB 4BQ3A 1V05A 5F9WC 4M1CC 3VXSE 5I1JH 5LQBL 3KPRA 3MREA 2XVGA 1GZJA 2VERN 5L2KA 3VX1A 3DBXA 5DGQA 5EZOL 1MNUH 4QRRB 5SWZB 2ZG3A 3VFUB 4C7DA 1D3CA 4P2RB 2Y4SA 4R3SA 1RZ8B 2DM3A 3GKWH 3JV5A 4GKNB 4HC1L 4BQ5A 3QH3A 5DHYA 4GZ9A 4WW2A 4YAQB 2AJ3A 4PV8A 1ZKAA 1ITXA 4PYSA 2OL3H 4XPFL 2Y9RT 3OKYA 1GPFA 2OJZH 3GNMH 2X89D 1IGML 3RUGF 3M1BB 1CE1L 1D7FA 4DTGL 4FFZH 1YC8A 3C6SB 1KTDB 4JM4H 1JGUL 4S3JA 3D3VA 5I1EH 3O2DL 1GL4B 4RFNB 5HGBA 1VA9A 4XX6A 2O26U 4EDXB 3THMH 3P0VH 2R9HC 2ZCHH 1IKNC 2PTVA 1C3FA 5JBFA 3VXUD 3EMCA 2CUIA 5DJYB 1DWHM 1LO4L 3FT2B 5HHNA 3RPKA 2VLKD 2HMIC 1NGQL 3LSOB 2FATL 3M07A 2JALA 4TYUA 5BS0E 1YY8A 4KRPC 5C0BA 3S36H 3PGDA 4PJCA 2XNAA 3GMOA 3CK0H 4JZNA 2VJXA 1SEQH 3UTSA 1RMFH 3QT2A 2HKHH 5FUZH 3UO1H 3ZOAA 2C4FU 3FCTB 3IGAB 5E8OA 1UZ4A 3GGLA 1N2RA 4Z9KB 3BVNB 5AYBA 3GSVA 4K9EC 3UTTA 3AREC 4IDJL 4HK3N 1MQ8A 2AXJA 4F7CA 3D0LB 1NGZA 5IB5B 4PGZA 2JFEX 5DVLA 1KUMA 5I77A 4OT1L 1YC7A 2AEIT 1GOQA 5EBWA 5CD3B 1UY1A 4D1JA 1NDMA 4EI5C 5F3BA 2Z92B 4KDVA 4BZ1L 5IFPA 3CHFA 4J3XA 4P2RA 5IFHL 2A3HA 1F8TH 1EEZA 4J8RB 5D2NC 1UYWL 3QIWD 1XT5A 4D6DA 2V5TA 5E08H 3NJ3A 3MLUL 3IVKB 1LMKA 2XQYG 1BVNP 2XWTA 4U0RB 2EYSA 3FHAA 1PMHX 2WYSA 2GSJA 3ULSA 1HNGA 1XR9B 4JFZL 3RTQB 1H15B 1HWGB 3G5XB 4XAWL 1LL6A 2AJUH 3BEVB 1FL6B 3C5ZD 4NRZA 3ARYA 2IPTH 4LHUA 2JJUA 4EOWL 1A6UH 1QSZA 2KD7A 1WZKA 3SOBH 1PKOA 3LDBB 2CKNA 2J7LA 3E8UH 2WM0A 3S34L 2YMXL 1R24B 1Z5LB 5CINH 2ZUSA 4NO5B 4L8BA 3WN5C 1XC6A 1EHLH 4PQQA 2RCSL 2WZ8A 1KT2B 5FB8A 4UB0L 1H3WM 1E4XI 1YEFH 2WMPA 3MROA 1UMIA 2UWEE 4PJAE 5DA0B 2V5CA 2EIDA 1YEKH 1RUKL 3QUXC 4X98A 5C07A 3PNWB 1AO7B 2I07B 4GZEA 2IQAB 4GKOA 4P59H 5CYYA 2V5SA 4AIZA 1JPFA 5A16A 5AD0B 1OCWH 5GZOD 12E8H 4GS7C 4Q2ZA 3BWUC 3SQOH 3BPNB 4ZFFB 5EZOH 1JFQH 1OP5H 1DSFL 3M8OL 1OWRM 5DS8A 1J9CT 5D7IB 1H5VA 3QIUC 1HINL 1D5MB 5JR2A 1WK0A 1CXIA 4A2MA 3U1SL 3MCKB 4WUKL 4MA8L 4PRID 4QWWD 4U1NA 1OD3A 1ODZA 4P9MH 4LLWA 3T65A 1AP2A 3UYOD 3LEXB 4G9DB 1G6RH 4S0TD 5KBNC 4HWEH 2QQNA 4OIBA 3INUL 1RK1A 4O5LL 5EULV 4F7PB 2X4SB 3ZYOA 4JDZA 4YBLC 1W0VB 3BJ91 1XSJA 1VFUA 2OL3A 3NIDE 5SX4I 1K5NB 1OB0A 5FCSH 1JD9A 3NFNB 2CIKA 4FTVA 3UBXG 3OKEA 5EUOB 4UNVA 1P9MC 1CT8B 4ZZ8A 4RL3A 4ODHH 3EO1B 2P8LA 3VMPA 3CVIH 4NRSA 4FQIL 3DIFA 4YXLL 1U6AH 4Z2AA 3LV3B 3LEIA 5A6MA 1EEYB 2BC4A 4A3HA 4D8PA 1T4KB 4FZEL 2CDGB 4JN1L 4PJ7B 3LPPA 1AD9B 1UA6H 4UOZA 2VLMD 3UTPE 4S1QH 3WFEL 4XUNA 5F6HI 2DLTA 3FQUA 3IAQA 4XNUL 5IT2L 2VZSA 4HWZB 5EC1A 2X05A 3MOQA 4GQPH 4PS4H 5D1XB 4G6FD 1TITA 3HG1B 1ZS2A 1ETZB 1FZOB 5B21A 1HHGB 3TA3A 3B6SB 2DQIL 4YEFA 5C8JA 4IDJH 4Z7QF 1WCBA 4CMHC 1N0XH 3RM4A 3EUUA 5AD0A 1UVQA 2BNUA 2EDTA 1TQBB 2BJMH 2E8ZA 1S5IL 1WAAF 4X9HA 5JIHA 3O4LB 3G5ZB 2O5YH 2IG2L 4HH8A 1CGTA 5SWQB 1Z6JT 2J8HA 5E7FA 4KI5D 1OAZH 5I6XB 5JORA 4NFCA 3L7EA 3CZEA 4S2SA 1IM9A 25C8L 4U1GC 5B3JF 2PTTA 3GSWB 3QRGH 5ESQA 3V7AE 2VTFA 3V4UL 1SJVA 4EKXA 2VXTH 3QBTB 3VUPA 1RZFL 5I9QC 3DYOA 4AT6A 5J56B 1Z3GH 5JUEL 1NFIA 5JDJA 4Y5VC 4XH2B 3WQ4A 2ATKA 1S9VB 2NPLX 5GS0D 5EUOA 2J7FA 2H2PD 2MCPL 1N82A 1PJ9A 1KCLA 4UQAA 3VGGA 4QLRA 2EPLX 3FONA 4ODUB 1P7KB 2YSSA 4JFXA 2NTFB 2XZCH 3GSNL 2WNWA 1ZHNB 4XAKD 4QHLB 4YHZL 4LSRL 2J7MA 1SQ2N 2YZ1A 1NFDE 3PP3K 1NKOA 4TXEA 4J1UA 4G6KL 4RMRA 3TH4T 4QX2A 4RFOL 1VADB 3NIYA 5DK0B 4J4PC 3D6GA 1CENA 3BT2L 4HHAB 1C5DA 4ZUWB 5DS8B 3MACH 5IB1A 3WF2A 1H9VA 5I1KL 1XPWA 2VMDA 4LASH 4D9RE 4Y16D 1PMJX 1GUVA 1W9UA 4RWHA 5IXEA 2HVJB 1PFCA 4AIOA 3LKQA 3O6AA 4FQLH 5L7XH 1WEJL 2EXOA 1YEHH 1QPPA 1BD2D 2EIZA 9CGTA 3NN8A 1LK2B 4CADA 4XWOC 4XPGL 1L0QA 4WHYG 4X4YB 5BV7B 5I17B 4KKLD 1PY9A 2OXHA 2GJ6B 2Q8BL 2FNBA 5MERB 2P5WE 3QIUD 3Q5OA 3I02B 2VNCA 4NJ9H 1KCSL 4OM1H 5KSAB 3OKOB 4IJ3B 3TTSA 1GGCH 3GGWA 5CEYB 4NN7B 4I8DA 4PMRA 1EJOL 5HXMA 2EEXA 2FO4B 3T4YB 3DSNA 3UBXI 4YZFE 4XXCC 5EU5A 3OZOA 2E6JA 1RUAL 4AIUA 1KACB 3SJVB 4XMKL 2D4FA 2G9HA 3AIVA 2B2XH 2XA3A 3T4AB 2LU3A 2NTFA 3O9NA 1A6VL 4PRNA 4JAWA 1QEWB 5IF0A 1V3MA 3ALFA 3LEYL 3RVUD 3L6FB 1FRGL 1W9SA 2GFBA 3FFDB 3PWLA 4TVPH 1SHWB 2XZQL 3A21A 3HZVA 3KPOB 4NC2B 2C7FA 1Q8MA 4M03A 3NUKA 5A3IC 1MJJB 3RU8L 5KJRL 1E70M 1UXSB 3W25A 4ODWB 2YA2A 4OZFH 5D7LE 1L7TL 4LLUA 4LSTL 2F2HA 5A2AA 2P24A 4RMWA 2ORXA 3BYYA 3U1SH 4UUJA 3VG9C 4MCZA 5ALCL 3AHXA 3VD7A 3KPSE 4WUUE 1W8NA 1DQJA 3PWPA 1R0AH 1GHFL 4Z7UE 5KG9A 1MXDA 4LSVL 4Z0BH 4OCNC 4LEXH 4PY7B 5CKGA 1NUKA 2I26N 5CUSH 4QRPA 3PUHA 3PZ9A 3PL6B 3TBVA 3L4YA 3SKJH 2A6DB 1BLNA 1W72H 3IXAA 4NO0D 2J2ZA 3HG1E 2DLEA 2MOVA 4JR9H 4C4KO 1N4XH 4OCRH 3AXLB 1MAML 3MXVH 4H8HA 5DQ9A 2WMHA 3QA3A 4G9FB 5F7WC 4LLYA 3ARED 3DUUB 1MQKH 5I16B 5CJQL 1G84A 1TPXB 2XKNB 4O2CB 1DBBH 1OTSC 2G3IA 1UQYA 3VXQA 1WC7A 4JL1A 3SUTA 1E1EA 3HUJE 5J1XA 3TBYB 2J7HA 5EC2B 1BPVA 3QRFM 3SJVE 4G6KH 4GRLD 4WW2B 4NZCA 2Y64A 5TFSH 4AMCA 1VPOL 3QXTA 4HT1H 2ED7A 4XCEB 4HHAA 5GRUH 5HGHA 1WNOA 3TJHC 3QG6A 4LEOA 1ZGLM 4QT5B 1ZHBB 4X6DE 5AUMA 1UCBL 1MIMH 4MA3B 1MCFA 5IHSA 3DXAE 4PMZA 1A1MB 2CBJA 1SBBA 2RIKA 4NO0B 2ICWJ 4OFDA 3QUML 4K9EH 2V5YA 2Z91B 4ZUTA 3EYPA 4CCEA 1J0HA 1JI1A 4UU9B 4B15A 2OJEB 3UJJL 1H0GA 1IKNA 3NCFB 1KXQA 1JK8A 3TO4C 5EB9A 1CF8L 2H1PL 4HFWB 4UQCA 4BCEA 1KJMB 1M04A 3QQ3A 3E6HB 3VH8G 3WXWH 5K59F 5DRXA 3Q6FB 1NEZA 1RUML 4IOFD 4UNIA 1MWAH 1P4IL 2PXYD 5FYKU 5GZOC 4A45A 5E0CA 3O4LD 4IRSD 5ECJE 5GGRY 1CECA 4YWGH 4AZGA 2R0ZL 5FUCC 4V2CB 1FNHA 4FFVD 5H35B 4KTDH 5E8DL 2CLVA 4JFFB 4HF5H 8CGTA 1I9RL 4ONGL 4PP1C 1DEEA 3CGTA 1A3RL 2WUBL 5J4MA 1A9BA 3IFLL 5E94B 2CBVA 3MGTA 3SE9L 4O02L 5F6IC 1ACYH 4MDPA 1D2KA 4N5UA 5T1MA 4K7FB 4WF7A 5DD1L 3ZL4H 3CDCA 3QUZB 3P9MA 4GO9A 4IIQA 1UB6B 3OJDA 5A6SA 4DOHB 2EYSB 5I76B 1T6WA 3ROOB 1NCCL 1AGFA 1H15A 1TDQA 3CFDB 3MZGB 1A7NH 4U6VL 1F4HA 1WISA 3MJ9A 4NDMB 2OKXA 1BVKB 1W72A 1DL7L 4W7UA 2MANA 1KEMH 4LHUB 1QR1A 4JFHE 4P3DB 3MOBH 3W29A 1U3HA 1UT9A 1H1NA 1LVEA 1YEGH 4QRPB 1SR0A 2DCKA 4OZIE 1W91A 1BSIA 3UESA 1UZ8A 2E9MA 4QDSA 1NC2A 1XGYH 1VFBA 3REVB 2DQDL 2IWGA 1EVTC 3RHWK 5IGXH 1QSFE 3L9RA 4S1DD 3S35X 3SE3C 2XKNA 1GNXA 4JHAH 5FEBA 4MQXC 3RDTA 3F58L 4HFUH 2Z4QB 5TPWL 3OGCA 5DJXB 1JN6B 1CX1A 3F4VA 4JPVL 1EBAA 3V52L 1NQBA 3PZNA 1WFNA 5E2UH 3VFWB 2DDUA 3P4MB 4ZSOA 4WDIB 4BH7B 3FQTB 1BD2B 5DO2C 4C4KT 2OTWA 2QHRL 1M05B 2W60B 4N8VA 4MNMA 4ONFL 3V4PH 1Q0XH 3CZLA 5KSBF 4HUNB 5BVJA 3GI9H 3VXNA 1IEBA 1EH9A 2Z93A 3ROLB 1L7IL 4OD2B 3U0PA 1EXPA 3D5OF 3FT3B 1HQRA 1U8JB 3WL9B 1MCBA 3TPUA 1F4WL 5ICXB 5FDYA 3VDCA 4H7VA 1YNTA 5GGQH 1XGPA 5D1XC 5TDPA 3C08H 2G3JA 2FGWH 2WHKA 4IIQB 4MAYB 4MD5A 3SKNB 1UYYA 4M61B 4DZ8B 2NY2D 3GMQA 2P5WB 1L6XA 3ZR6A 5KTEL 1BQHB 2LU4A 3BMVA 1QBLH 2RFXB 2ICCA 1ORSA 3QDJB 4ZOAA 4DKDC 5FDWB 1JNLH 2CJUH 2D0HA 2R0WH 1KG0B 3O3BA 3PWNA 4HLZG 5BW7C 8FABB 3WO3B 3IRPX 2X7LA 3TZVC 5FV2A 4RDQF 1E4XH 4HW6A 4JM2D 2ZE0A 3TO4B 1C8PA 3LKNB 4CVWA 4KDTA 4X7TA 2HTLD 4HMCA 4PJ5B 2KQMA 1W1PA 4JG0L 4JLRA 1JYVA 2VIRB 5D2NE 4HJ0C 4PJ9A 1MHEA 3GMMB 3NMEA 4MJIB 2J62A 5CBEB 3VNZA 4YWGL 3U0WH 2CNCA 4LSSL 2O5XH 4ZAKD 4QCEA 4XPAL 2XA8H 4OLWL 2QR0A 3PJSA 3WNLA 1I1AD 1CLZH 2R4RH 2H41A 4GW4A 3TTQA 3FOMB 1T89A 4PV9B 5SWQA 2EYRA 2DQFB 3JVGA 3SKOB 1CDIA 2WKGA 3WLWC 4HGWA 3SGJC 5ICYA 4QCFA 4I3SL 4A6YH 2ZX8A 3TPUB 1U8IB 2RJMA 2BVDA 2CXKA 3KLHC 5LGHH 1JGLH 4KI5M 2E4TA 4NWUL 1WDPA 1RVFH 1SYSA 4LPLA 1WWBX 3GMPB 2C3HA 2IALB 1NX9A 1NEZG 1ZVHA 4UINL 1BG9A 4EUPG 3CZKA 5EO1A 1FAIH 3Q48A 3MBXL 4H20L 4M61A 2CYGA 3MXVL 1K6QL 5C2BL 5D6CB 3V95A 4JRYD 4NKIH 4LVOC 1BBDH 5BXSA 4JPIB 3RI5F 2PQSA 2EE3A 3EZJB 5C7XL 2BSTB 1KN2H 3HB3C 5FYKD 5C0IB 1IC7H 4PSRA 1KF9B 3CDZB 3E1F1 2JJVA 4JM2A 3AMDA 4AL8L 1JMXA 1PG7X 2VL5B 4HBCH 3DX6B 3LS5L 2VABA 4KKCD 4OM0H 3QAZB 1PLGH 2BVQB 3OGCB 3UO1L 3WKMH 4Y16B 3EYUL 5E0QA 5IQ9B 4Y19B 1J1OL 1NOWA 4LDLB 2XRAH 2G5RA 2O9RA 3CFCL 3EOAB 5LGJB 4W50A 2VO5A 1D5IH 2VLJE 3UTZA 1VESA 4YHIB 1FFPB 4NN5C 5C86A 3MV8A 4FQXA 3QWRA 1LP9E 1MHHA 4M5YH 5DSCB 3M6DA 1EHNA 1AXTL 3THDA 4DVRH 2AJZA 2VQUA 5E56A 3O6FC 1HDMB 3LKPA 4H1LB 5JOFA 4LQFH 3DO7B 4B9YA 1MFAH 2Y07L 1WZ1L 5M94B 4AEHH 5BWFA 4OZIB 4QDQA 4GI8A 4W70A 1P8JA 4PJHB 4JFFD 2X5PA 1ISVA 1TTFA 3OHXB 3C5JB 3KPTA 2NNAB 3IANA 1DANT 5CCKL 5JW4N 2DQCH 2AJUL 2FB4L 1DUYB 3WSQL 3TVMA 3GH4A 5INCA 1EAPB 5HVHC 3VDBA 1DTUA 3RNQB 2BP3A 1XF4B 5DXWA 3D1MC 4M8VA 1OM3H 5ICZA 5EU5B 1P6AB 1FAKT 1HZHH 3NYDA 1QFUL 3NIGF 4NQTA 2XVPA 4HXAH 3S36X 3TNMA 3MUY1 5ETUA 4JEGB 4XB7A 2O61B 1K8DB 3E2HB 1MFBL 4Q6IA 1MJJA 2BNRB 3UTQA