The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
178
|
sequence length |
603
|
structure length |
597
|
Chain Sequence |
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb |
| molecule keywords |
Beta-glucuronidase
|
| molecule tags |
Hydrolase
|
| source organism |
Escherichia coli
|
| total genus |
178
|
| structure length |
597
|
| sequence length |
603
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.2.1.31: Beta-glucuronidase. |
| pdb deposition date | 2009-10-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00703 | Glyco_hydro_2 | Glycosyl hydrolases family 2 |
| A | PF02836 | Glyco_hydro_2_C | Glycosyl hydrolases family 2, TIM barrel domain |
| A | PF02837 | Glyco_hydro_2_N | Glycosyl hydrolases family 2, sugar binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | Sandwich | Jelly Rolls | Galactose-binding domain-like | ||
| Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Glycosidases |