3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
5JW5B 3O45B 4ONFL 3TT1H 3O3EB 1U33A 5L6YL 1QZ1A 1R3LA 2ORBH 2ICWI 4LP5A 4U1MB 5BO1L 3P4MA 1D5MB 2IC2A 4C58B 1SBSH 2FBJH 4OFDA 5DUPL 1G7PA 3IDIB 5FYJL 3TIEB 1XSKA 2GY5A 4NQDD 2BHYA 2E6PA 1JXKA 1DQQB 5TH2A 3VDAA 3PWNB 4AYSA 2QADC 1JGVL 4QB2A 4OJFL 5HI3D 4AEEA 1QA9B 4YHMH 2OR7A 4ZFZB 1W3HA 5I75C 1YEIL 4AAXA 1AH1A 3UDWA 4MJ2A 3BZEB 2D0HA 3N0PB 3MA9L 2G60L 5CEYA 4NF7A 3OX8B 2OSLA 3GNMH 2J1SA 2CDGA 1HJQA 2PO6D 5IROA 4L4TE 4HIXL 2E4TA 3FQNB 3MJ9H 2WUBH 1BX2A 5BXFA 1UFUA 5DT1L 3GNRA 1B4JL 3QXAB 15C8L 2XY1A 5FM8A 1P2CA 1LNSA 4R26L 1K5NA 1DCLA 4C59B 2CUMA 1OGAA 2C1OA 1XNTA 5DGQA 4DN4L 4IEFB 3CFJA 1DJSA 4TVDA 3SDYL 3ROLA 4GQPH 3O2DH 3UC0H 4FP8L 2VAAB 1VF8A 1NDGB 3U0PA 2XICA 5CJQL 1W1YA 2FX8L 3CVIH 5A40E 2ZEYA 3QUMB 1T2XA 4F33A 1JWUB 4PJHB 3QPXL 3WFDH 1CLOH 5EU7C 4O00A 3LQAC 4WU7B 5HGHB 1L9NA 4CCEA 5I30L 1LE5A 4MMXC 1PG7W 2X1WL 1LWJA 3X3FL 3AS1A 5F7MC 5FYJU 1V7MH 2NXZD 4MD0A 3KEHA 5FECA 3Q6GL 4M1DL 3EJYD 4K3DH 3DNKA 4ZSOE 3REVA 2AXGB 4PREA 1T1WA 2NW3B 5KEZA 3T77B 4GXUN 2CUIA 3U6RB 1TCMA 2E3ZA 3O6LL 5T5FL 1HHIB 4R0LA 3W11C 1CZSA 4MXQC 4MS8D 3GZKA 1AR2A 2H2SC 3EYUL 3SCPA 4XBEL 4HS6B 1UT9A 1CD1B 4XHQA 5CILL 4GKNA 5B21A 2V2XA 4MPKA 1FIGL 4HJGA 5KVGL 5MEOA 4K3HA 4LPYA 1J8HD 2D0FA 1U2HA 1H3VA 1DL7H 3QDMA 1HIML 5JXIA 4G6JL 1I7TB 4O2CA 3TWCH 4NUGL 4OYUA 4KKBC 5MHSD 2DQEL 3DUUA 4I77L 1NMAL 1NCBL 2VLRD 3GMMB 3QXDB 5FYKL 5ACLA 4U3XA 4D0DA 1T2QL 3ARFB 2VDKL 4PRDA 3C08L 3VX0A 4NP4H 1WCBA 3OWEA 2VDQH 2PCPA 4U1JA 1QSEB 5F8RC 2C8NA 4D0CA 4HJJH 2AABL 3U30C 1U6AH 4EDXA 1SYTA 3ALGA 1FL5A 4NN5C 1BQHB 4FQXC 4NQVA 4PJ9C 2CKRA 3GYCA 1ZBKA 3FN9A 3V9FA 2Z4QB 4PGBB 5DJDA 1C90A 3ZKMD 4LPVA 4JFEE 3QQ4A 3FRPA 1ZLVK 3ULSB 4P00B 5A6SA 1YNTB 1DQTA 5KOMC 5B38A 2DTML 4RGNE 4U3CA 2XTJB 1NCWL 4MDIB 1YY9C 3T1FB 5GJSL 4FFVD 1S7WB 3ESVF 3V0WH 2HKFH 4UFJA 4D9RE 1QSFA 1NBVL 4HCRL 4HIJA 2Q3AA 3C6LD 1JNEA 4BKLB 2GJ6A 4HUVA 4NZRH 2A6DB 2VM9A 2IPUG 1IGTB 2A3AA 1GZPA 4HZLA 2OSXA 3QCVL 3J7HA 1NEZG 2B9VA 4Y4HD 4H88L 1QNZL 4ZPVA 5KSBF 4ODHL 3L6FA 5AG9A 2YR3A 1MY5A 2O26U 4NFCA 1KXVA 5CLTA 1FO0H 2GTWB 3SE4C 4RDQG 2J77A 4IJ3B 1NC4D 3HI5H 4LHUG 3CHEA 1PSKL 2Z4FA 1QBAA 3AAZA 2FJGB 1KEGL 1O7VA 5FYKU 2WBJA 1HHHB 3ACFA 2MMXA 4BZ1H 4ONGL 5D7LA 3WFBL 5DRZA 4KRTA 1T4KA 2IANB 2O9RA 2WAGA 5HPMB 2WWCA 5KSBA 4ISVB 5HYJE 2VZ3A 1BVLB 3I2CH 2NYYD 1HKKA 2GITB 5I18L 7TAAA 2DH3A 2QLVB 1FP5A 3HJEA 5DJAA 3CUPB 4JM2D 1V0NA 2NY7L 3GMRA 5E2WH 3UZVB 4LF3A 1QEWB 1I8KB 1KN2H 1UWGL 2DIAA 3INUH 1RHHB 3WO4B 1W9SA 4OUUA 4K8RL 4DXRA 4N9OB 4DWHA 1E6JL 3TNMA 4M43H 1Q4NX 1MH5A 4LKXB 3BD5A 2X4UB 2X0YA 5K59E 3GI8H 4GRLC 2Q3ZA 4PB0H 1B90A 5F7HA 2F54D 4MDPA 2XXCB 4JJHA 2XG4A 1DQJB 3PGDA 3DETC 4G8FA 2JEQA 3NZ8A 2V9QA 5EOCH 3W6LA 3OL2A 3VXSA 1V7NH 2WC4A 3MV9A 1JPFA 4IOFD 2UWEE 2YEZB 3IDYC 1R7AA 4EOWH 5AC4A 4QRTB 4Y0GA 1I1XA 3RNQB 1ED3B 1S7XB 5BZWA 2H9GB 5FO8A 3W5MA 3V5DB 1UA6H 4IS6B 3LQZB 4QOKA 5CKAA 1LDPH 4XNMA 5DK2B 4B5EA 1SR0A 4XUYA 5DEGA 1J10A 2K3TA 4JREB 5EJZB 4N5EC 4XVTL 1P6FA 4CVZA 1SQ2N 4LCCA 4M5ZL 4R7DA 1B3VA 1W9VA 4POYA 3L7FA 1RUAL 1QNRA 5D8JL 1A7BA 1C1EL 4U1IA 2KKQA 2YPVL 1BTCA 4JFUA 3HG1D 4HCRA 2WN3A 1I7ZB 3O6FC 3GXDA 3CLEL 3WQVA 1IC1A 3TFKC 2J7EA 3B5GA 3OHXA 3T0DA 3TVMC 4HH9A 5AAMA 3AISA 3CIQA 1EEUA 4EKXA 2PTVA 5EO0A 3WIIL 3H9ZA 1JHTA 3I3EA 4I48B 4Z7WB 3LKNA 4LDEB 3VU2A 1K3ZA 2IF7A 2KPNA 3CPLB 3SDAC 1B3WA 5E2TH 4LARH 4KZDL 5HBBA 1SBBA 4PG9B 1NCDH 2PXYB 3PZGA 3G08B 4RGNC 1CU4L 3VCLA 5HGDA 1ORSB 1TVGA 1ZS8B 2BNJA 3KXFB 1DBAL 4PGZA 2UUDH 4ODUB 2I26N 2ZNXA 3LN9A 3UPRB 3UTPD 4XNXL 3IGAA 4UDUA 2RCSL 2QQNH 3RILA 2XQBL 2IALA 1KIQA 5FGSA 2NY2D 2VLKD 2WZHA 2ZJSL 4KMQA 4XUPA 3CZFB 4XP1L 1KXTB 3D85B 1E40A 1GGCL 1KB5H 4JVUA 3VWJA 2ID4A 1CLVA 1U8PA 3KLAB 1VA9A 4LIQE 2CGRH 3RGVA 4KROC 2CLVB 5TFSH 5I9QB 3NCBB 5E9DE 5F1IB 3LIZH 4P5KB 3MRFA 2IAMB 3C5SA 3QDGD 1P7KA 1CFQA 3PWUB 4P4KA 3VXMB 3BPLC 2XGBA 4BQ8A 3I75A 3STLB 3N1QC 1ADQH 1F4AA 2GSGA 3HE6B 1BEYL 5C0EA 1E6OH 1U8HB 2O93L 4HPGA 5EBLA 3L5WA 1MJ8H 5E8EA 2Q8AL 3KL0A 4X6DF 3IJYA 3IU4L 4JKKA 4JZOA 1OHQA 5DHVA 4M93B 2XWJB 4PJXE 1K12A 4M7LL 2YKLH 2FEEI 4OLXL 2NY5C 5D1QD 2E40A 1HH6B 3AHTA 3ZDZF 2YUVA 3HPLB 5M95B 1XR8B 3UROR 4XZWA 4PY8J 1CICC 2V5MA 2HLAA 1MVUB 2FEEL 4BK5A 5CSZB 1WZKA 3NBNA 1AQDA 1V0KA 2C4FU 1TJHL 3NNGA 3H42H 4YAQA 3NIGF 3EMCA 1E4NA 3L1OL 4WI3A 5J0BA 1WDQA 2DQIL 2XHYA 3RL1A 2VURA 2DQDL 1FNEB 4X6DA 3VFTA 4JRYE 3A67H 3RVTC 3LKSA 4N9GB 1M4KA 32C2A 4JN1H 5TF1H 1KCUH 4HXBL 3EDDA 1ZLWK 5H35B 3WSQL 4JQXC 4XVSH 4ZZ5A 2ED8A 1ZJAA 3PZ9A 5DD6A 3LN5A 4K3JH 4HHAA 3IXAA 4N5UA 1A6UH 3M07A 2I27N 2WLYA 3I02A 4GRWE 4OT1H 2B4CL 3IS0X 1P5VA 4KRPB 3REWB 1US3A 3T1WA 1XC6A 3RU8H 4NRRA 4OD2B 3BHBA 3W0WE 1KOAA 3LEKA 5AZ2H 4KTEH 3W2DL 5AAWA 3MMUA 5BROA 1KYOJ 3O9NA 2VLMD 4TSAL 1XGUA 1HXJA 3A4WA 1W3LA 2BNQA 1W91A 3BPOB 1EX0A 4TVCA 1PIFA 4AISA 2AEPL 3A0OA 5T5NF 2HT3D 2C1PA 1Q6CA 3QIBB 5I8KL 3BUTA 4G80A 3SE9H 5IG7A 4D3CL 5HHOB 3QDJD 5ALBL 5ERWB 5C08D 3AYSA 3NN8B 1EJ6A 1TPXC 1MFCH 2J8UF 4QX3A 2VRQA 4UOZA 3BP4A 1G5AA 1MFUA 1IILE 4AD2A 4M7ZC 1GOFA 2XZCL 4APQC 1WIPA 2EDLA 4L3CB 3SDDA 3QIUA 4YHZH 3WMSA 2R2CA 4HKBA 3THMH 5I1CH 5C0BA 4ATDA 3MLUL 2P7TA 1F02I 2J75A 4DWSB 3CVHL 1NC2D 3HUJB 4OCLC 2ZUVA 3NCFB 2BOCA 2YC4A 3I2FA 3WEZA 1UZ1A 2J8UA 3D2UD 4Y8DC 5F7FA 5J8OA 4S1DD 5IB5A 1MLCA 4PTXA 3GXMA 1V02A 2WMFA 5JXEC 5TF0A 4P2QA 4XPTH 5CZXC 5CCKL 1OW0C 3CFCH 4G42B 4JM4L 3PBGA 1G7LA 5GS2D 2FB4H 2FBOJ 3F58H 3RIAF 1AGEA 2VI0A 2X2YA 1E6QM 3CDFA 4Y4KA 1RZKL 4QRQA 5IIEB 1KNOA 1XZ0B 2FNBA 4ARYA 2EKJA 1IZKA 1RJZA 3B4NA 4HT1H 1A9BB 3FB8A 5JW4M 4WKAA 3LD8B 1BQLH 1UMHA 4GRMB 4XPHH 4RGMC 1AO7D 1ZEAH 1IT9L 1I3VA 4QRPD 2MQCA 1R3LB 2G9HB 5JLZA 4CBPA 1OP9A 4ZUSA 2CMRL 3IF1B 5C0CA 4IM8A 3UJIL 3P4MB 1G0XA 2IMNA 4OF8A 1A6AA 1G7PB 3NH7H 5HD8D 4NN7B 5JIPA 2A77L 1XF1A 4N68A 1OCWL 5TH2B 4OZIB 5M17A 3T4YA 4HWEL 2ZUUA 3WLWC 5IW6A 3ARSA 3P3YA 4G8GA 2DLFH 3FB5A 5DLML 3ZKNC 5DUMH 1FSKB 4IBLT 1B3YA 5EU5A 4CCCA 4CADA 5FGCE 2OCFD 4W85A 3BW9A 5DURB 1J12A 3B9VA 5I77A 2LS6A 4FNLH 4JFDE 4WVRA 3QPQC 2A1WL 2CDGB 4FLOA 3SBWA 3CSPA 3OKYA 4G6KH 1BX2B 1GCFA 4UIMA 1N6VA 1HINH 1P2CB 3AFLA 1NUDA 1N0XH 1JPGB 4LSUL 3L7EA 5C09A 4MA3A 3T09A 1G9NC 5HHVL 2ZCLL 5CJOL 1OF3A 4L0PA 3CFJB 2ZWZA 4GS7B 2AK1L 3ROLB 1HSAA 3QRFM 4NYLA 4CNIA 1GZQA 3EDJA 4CL7A 2J25A 4DUXA 1K6QL 3CVHA 3KPRD 4PJBE 3U0PB 1A3QA 3QAZB 5EU4B 5LXGL 1ZWIA 1SEQH 1XNAA 1BM3H 3EOAA 3V0AC 2V9RA 3QO0A 1N2RB 2QPSA 4S3JA 4IRJC 1FGVH 5DPNA 4CD7A 1UEYA 2I60L 1ZK9A 3ZQ9A 2J2ZA 1KPVB 4JGJA 4JO4L 4OZOA 2R9HC 4N1HB 4R97C 2E9BA 5GGRY 5CYYA 2XWDA 1ODUA 2XM1A 1W3JA 4MD0B 2EO7A 5AWNL 3H3PH 4P59L 4MVBC 2KBGA 2ADFH 3B8YA 5C3TA 3ILQD 1JGUH 5CLWA 1IC7H 4N90D 4OFKA 4QRSA 3REVB 3KGRA 4F7EA 3MXWH 5I1IH 4M62L 2XVNA 1T1WB 3W38A 1GGUA 4R0LB 4WV1A 4GMTH 2WVUA 2XZQL 3F5WB 2VUOA 3EFDL 1ZVYA 1CBGA 2GK1A 4GKNB 4AXNA 2V2XB 1A6VH 3TIDB 2M1KA 1VGEH 1UR9A 2AK4E 1K9DA 4N0UE 5C0DA 3THDA 5GNYA 4HJGB 3M8OH 5MEOB 3QNZB 3JVGA 1JPTL 2JIXD 4XZUB 1H4PA 4PRIA 1U42A 3QDMB 5F9WB 3BDYL 3BH8A 1YQVH 1F90L 3BT2L 3WJLC 4X6FB 4ZAKA 2E9LA 4O2CB 2XZAH 1QLRA 5FB8A 1KBGL 1L4IA 3DUUB 2QHRL 5C0NC 1CK0H 2BHZA 1VFUA 2RJMA 4KUZL 4PLJC 3ARED 2AXFA 2EDKA 3T4AB 1V3MA 4D0DB 3KYNA 4W7WA 3RIAK 1WCBB 2R2HA 1MJ7H 1OGTA 3GMPA 2PCPB 5JIKA 2XG9A 4U1JB 5L0QC 3CHDA 2FJFA 3MRIB 4D0CB 1N26A 2OYMA 1K42A 5LGKA 3ULVE 2WKLA 1NMCC 1FL5B 2GFTA 4NQVB 3TONA 3OXSA 3BZFB 2WW8A 3IXTB 4LX4A 1ZVHA 2YWZA 1HJWA 1KGCD 1UD3A 1M05A 4X9BA 1NGYB 3N1FC 5DJDB 3EYVA 3STBA 1VBRA 2J8FA 2DKMA 5FM5O 5T3ZL 3TC9A 4P8WA 2PF6A 1FAIH 1KENH 5GS2H 1BQSA 5EU6A 1XF5A 4L5FH 1EO8H 3ZT6A 1HL9A 4PRNB 3VFNA 1A1OA 4YFDB 2PW1A 4BZ2L 5DO2D 1JDCA 3VGAB 4DTGL 1QSFB 1RZ8A 4HIJB 4EXKA 2GJ6B 4HUVB 1KJ3L 1JU4A 4HZLB 3O2VH 1I3UA 2UYLA 3ZDXF 4H8WL 2EDFA 2OL3A 3HNTL 1W2VA 3WEXB 4ZPVB 1Q6GA 1HXYA 4LOUD 1S7QA 3L6FB 4Z7UF 3RTQC 4WO4D 3D1MC 5I1KH 1CFSA 3OGCA 1DWGM 4KI1A 1QRNE 3FO1A 4HU8A 3LH2H 2BCKA 2PTTA 2FEDD 3RA7L 3FTGA 3C60A 2WBJB 3U36A 3S3PA 2AEWA 1TQBC 5KVDL 3U7YL 3K77A 3BSHA 1T21A 3ULUL 3ARGA 4J4PD 5I1JL 5D7LB 3HU7A 1DWIM 5DRZB 1BPLB 3VRLF 3KYMA 5KSBB 4Y5YC 2O61A 4ODXB 4LAQL 4Z7UA 2W0PA 3F2ZA 3GBDA 1NLBL 5DJAB 1YEFL 4AMKL 4NO2A 3DLQR 4P2OC 3OAYH 1H0DA 2R56L 1MEXH 4OJYA 5A2AA 5AZEL 2F19L 3LKPA 3NOIA 4DKFH 5DJCA 3GXFA 3S9DB 2DQXA 3RUGF 1JU3A 4OUUB 4G6MH 2HVKA 5IB4A 3NIFE 1MH5B 4B3LA 2VC2H 4R4FL 5I0DA 1FIEA 3CH1A 2YSSA 1X5KA 1Q72H 1OAYH 5JUEH 4FOMA 5BV7C 3O2WH 3PGDB 4ZTPL 3ZE0E 3G04A 4W7VA 4G8FB 5D2NE 5CINH 3JXSA 1OP5H 3VXSB 5JPMA 2B0SH 1MCIA 3MV9B 2VVSA 1T1XA 4V1DA 1JPFB 5T3XL 5DI8A 1CTOA 1VPOH 3RUGA 2Z8WC 3MJGX 3QYCA 5BZWB 4ORZC 1GQIA 1KC5H 1MRCL 3EZ8A 1INQA 5FO8B 4K9EC 4RDQF 3IANA 1GOMA 3O8XA 2F2HA 4JG0L 4RE3A 4JFWA 4QOKB 4XNMB 2X10A 2K1MA 5DEGB 3VXRD 1FLRL 1YJDL 5EDXA 1HEZB 1GHFL 4G43B 4K7FB 1KGWA 1WBZA 3VWKC 4R7DB 5TQ2L 3HMXL 2GSJA 2YIHA 1XGQB 3L7FB 1KN4H 1NEZA 4IRZH 3MV8A 2E9IA 5EH1A 6TAAA 9CGTA 2W87A 3H9SE 3CNKA 2DSZA 2R29L 2WB5A 4PP2A 5ECUA 4AT6B 3WQBA 2FR4A 1MFNA 1U3HC 3OHXB 3OJ2C 3ULVC 4LHUA 5IFTA 4NO0D 4IMKA 2JJUA 2NR6D 2W4XA 3OKEA 4AZHA 2ZUQB 5EO0B 5IBUG 4LYQA 5TDNB 4TUKH 2W47A 3KPQA 5GS0C 3LKNB 3PQYA 1JF6A 1YYML 1DQLH 1D9KB 3T0WA 5DS8B 1UY4A 2D7MA 3O3BA 2WPGA 2BC4A 4Z2KA 3U48A 3DMMD 4QGYA 3PWLA 4NPYA 4NGHH 4NZTH 4CN4A 1DBMH 4RQQB 1V0MA 1I1AD 4YZFF 5HGDB 1MFVA 4Q9QH 1IC4L 4TPRH 3A4AA 4R4NC 4R8WL 2YDRA 1E27A 1CT8B 3ARPA 2HMID 2CQVA 1N64H 2YN3A 4WFHD 1X5JA 1ZA3A 3VFOA 3GK8L 4LLUA 3CMJA 3OZ9L 1DFBL 4LRIA 3IGAB 4UDUB 2IALB 1KIQB 1U8JA 4P46D 1JPSH 2APVA 2XWTB 4M7KL 1RIVH 4HC1L 1MCOL 3VDCA 5ITBH 4O51A 1MHPH 4JO1L 1UB5A 3D18B 2NNAA 3VWJB 2W1SA 1U8PB 2HA1A 3TYGL 3V4PH 4LK4A 1PBGA 1T7XA 4LPUA 5IQ9A 1G7HA 3V52H 5JDJA 5KVMC 1GOWA 1JBJA 1WGOA 4YQXL 4XGZB 3OR7B 4Z7QF 3SGJA 4NOBA 4YHKL 3MRFB 1GOGA 1P7KB 2V72A 3AM8C 1OB0A 2RJ2A 1G7QA 2R23B 4P4KB 4LDLB 3LEYL 5LGHL 3VD4A 2VAJA 2GSGB 4XP9H 5FKPA 5EBLB 3L5WB 5E8EB 3GO1L 3IDJA 3MJ8A 4JHOA 2UVEA 4JDZA 1OAQL 4JZOB 4AIUA 4JKWA 4PS4L 4MXWH 5DHVB 4XPBH 4DEPB 2R0KH 3CSBA 5T1DH 4QX2A 1JZ3A 3HMXA 3FCTA 1PG7L 1TJGL 5BS0A 3CDZB 1I9IL 5C0JA 3X11A 5GZOD 4LU5H 3MLZH 1HJVA 1A6TB 4PRPE 1RIUL 4ODSH 3PV7A 3K8MA 5B4MC 3GGLA 2VRAA 1AQDB 2VN7A 4KMTH 3WFEL 4YAQB 2RV9A 2DDQL 1YMMD 1INDL 2Y64A 1DBKL 3VFTB 1KCVH 3DGGA 3LKSB 4P49A 2WZIA 3OAZH 4P99A 1QOKA 2GTZA 32C2B 1REIA 1B88A 4NQEB 4MNQA 4Z9KB 1N6QL 4FFYH 1QBBA 4FQLH 2NXYB 5IOPA 5IFPA 1R5IB 2AJ3A 4WEBH 4YHGA 3MLVH 4IHOA 4F79A 5CZVH 2B4KA 2DL2A 4WKFA 3ECQA 4X4ZA 5HDLA 3EO9H 2W92A 3MNZA 4MQ7A 4HHAB 2VDML 3IXAB 5E7FA 5DC9B 5GGQL 3O3UN 1OSZA 1G0CA 1OB1A 2CJUL 4YGVA 3MV7A 5I71C 2VDRH 1SBSL 2FBJL 1EDTA 3G6MA 2GJXA 4L4OA 1BREA 1IC5L 4TX6A 4OD1H 3P2TA 3OG4B 3UTSD 3N50A 5F9JB 1AP2A 2EE2A 1H5BA 1FBIH 2PWHA 3GXUA 1WIOA 2D22A 1U0QA 1MAKA 1XGUB 4YHML 4JPVH 4U1KA 5T33L 3QUYC 4PRHA 2BNQB 5JPNA 2ZG2A 1BYAA 4X6BB 4HC1A 3WBDA 2ADJA 4LBEA 4QHUA 5CBAA 2YRLA 2C1PB 4G80B 4CMHB 3I85A 4K3EH 3L4YA 4OCXH 5IG7B 3V8OA 3MJ9L 2WUBL 4YUEH 2APWA 4AY0A 5I2IA 1ITXA 4OFYD 3Q6FA 4UAOC 5K9JL 1Q6EA 2E32A 4DUVA 1NGQH 3BP4B 3I6GB 5A2BA 4YHIA 4UI9L 2DSUA 4U6TA 3QIUB 5A2FA 2W3JA 2DOCA 1X5FA 4XUQA 1EJOH 4QXGH 4XMPH 2WIIA 4YDJB 4HKBB 3AIQA 4NM8H 3SUWA 5C0BB 5INDA 2P7TB 4PJDF 3L95A 3QUZC 1G0YR 4D6CA 4YDLB 2R4SH 2RBLA 2QQOA 1YZZA 4WFEE 2J8UB 1OT1A 2OP4L 5IB5B 3UBXG 2KL6A 4J6RH 4NHUA 3BP7A 3O3DB 5JA8B 4P2QB 2DLGA 5DFVD 1IE5A 5A2JH 4WJXA 1V7ML 3SPVA 4XP5H 1AGEB 3WENA 4AZBA 4DZ8A 5IMOB 1ZXQA 4QRQB 2ATPA 4B15A 2J4WH 1R3KA 1RJZB 3LB6C 4PJDA 4V2BA 3TN0A 3MRBA 2CRMA 1D6VH 2QV2A 3FB8B 3W29A 2XNAB 1GVYA 3LS4L 1JRHH 5JHDE 3TJHD 1EFXA 1P84J 1WZ1H 1FZJA 1UXWA 3HB3D 4MB1A 2YD6A 2A74A 4P08A 2G41A 4W5UA 3MRPA 4YHLL 3L4UA 2EIBA 2OTUA 5C0CB 1HZHL 4H41A 5DEZA 2EO1A 2PR4H 3SCMB 2J8GA 3G6JB 2QQLL 4LASH 3RIKA 2CIKB 1FV1A 5C6TH 4NRZB 1A1MA 3SO3C 2Q76A 3U4AA 1DL7L 3IJ8A 5E1AA 4JRXA 2EH7L 1TZGH 3I84A 5IHUH 2WABA 4HKJA 4TYUA 5IW6B 5EO1A 4UIKH 1E3ZA 4U1SA 4IOIB 1T89C 1QFUH 3LPGA 1W0WA 1RQ5A 1EHAA 2J5LC 3QJFA 1INEL 2VDQL 3IKKA 3K3QA 3N9GL 4U0RB 1MFEL 2VLJE 3H2WA 1NFDE 4Q2ZB 5C9JA 3BWUC 3MJ9A 1LD9A 4GG8B 2WIMA 2XA8H 4ORGA 4FXLA 4U6HA 1CLZH 1HL8A 3EO0A 3UJJL 1N4XH 3G6AA 2D7NA 2EC8A 1CNVA 1XCQA 4JY4A 2XFFA 5FHAH 4UQCA 4DKAA 4NC0B 3CUIA 4ZNCD 2X9XA 4R7NA 3L7EB 3MRQA 5HHMB 5C09B 4MA3B 2PWFA 4N0FA 2IMMA 2AERT 3MUGA 5EWIH 3CBWA 4M03A 5GGRA 3G5YA 3X3GH 4D9LH 4NYLB 3MCLH 4CNIB 1GZQB 1LEGA 1UKTA 2IQAA 3MLTB 3CVHB 4WI5A 3G9VA 5DK0B 2E31A 1ZWIB 1E9LA 4E5XA 2AV1A 1Z0MA 3EOAB 3PN8A 4Z18A 5FCZA 4IISA 4Y7EA 3QO0B 2Q8XA 2D3VA 1MQKL 3LPWA 1JNNL 5A16A 5DHXB 2OZ4H 4L3EB 1HKLL 3PWPB 3LN4A 3QISA 4NZRL 5HYQA 3RKDC 2ERJB 1CL7I 1XIWA 1UD4A 2VLRE 4P5TA 1M7IB 3ARFD 3O6AA 4UCFA 5DMKA 1M1SA 1Q8MA 2DSWA 4M6OL 1CL7L 3HI5L 1DQMH 3CUHA 4QRSB 4F7EB 1PYWA 1S9WB 2ZOLB 4JCMA 2YL5A 2W46A 2MWCA 3CUFA 3LQAL 2EDQA 1FVEA 3FMGH 4ZO6A 5J06A 4RX4D 2GK1B 5A8MA 2VCAA 1BBDH 1W9WA 4PJCE 4FK9A 2I9TA 1HF6A 5DSCA 4PJ7E 3KDMA 3LRHA 7FABL 4FLQA 3I2CL 5BXTA 4XUNA 4M4RA 4Q9CA 4TSCH 4WTWA 5E6YA 1ZLSL 1KTDB 2XTJD 5E2WL 4PRIB 3BH8B 4G8IA 2QL1A 4ZAKB 1AIFA 1QLRB 5FB8B 2VDNH 3VIKA 3H3KA 5IW3A 4OIIH 2DT0A 3TOPA 4LLVB 2AXFB 2PO6C 3BIBX 3S98A 4TN9A 1MVYA 4PB0L 2R4RL 4KDTC 3KYNB 2R2HB 1SMAA 3GMPB 1BWWA 3UZQA 2YL8A 1J0ZA 2HRPH 4S11A 2FJFB 4HPHA 3NDYA 1LL6A 4MJ6A 2IG2L 4JZNA 1K9TA 3MO1A 1V7NL 5DRWA 4FQJH 4XWGH 4MNHA 3OXSB 3T0BA 5DR5L 1EGJH 4U6XA 1KCSH 2IH3B 4UILL 4UT7H 1FNGA 5F6IB 1JNJA 1UA6L 1H6YA 3EYVB 5LQBH 1LDPL 4KXZH 1URLA 3SDXE 5GRUL 2IAND 5H37H 3WIHH 2HJKA 3NPZB 4ONOA 1RZFH 5EU6B 1R3HA 1GGBH 4N8CH 4Y4FC 1A1OB 5AYBA 2BHUA 2Z8VC 3BZ4A 2NXZC 1UQYA 3HPJA 1RZ8B 4MGXA 4S2SB 2TAAA 3ZSSA 4LPLA 3FRUB 1X5XA 1XCWA 1FZKA 1YPZF 2AXHA 5HTSA 1DBJH 4U1NA 2UYLB 4M48H 5ALCL 2Y8VA 5BYWA 1UZ6E 4C7GA 2D03H 2UZXB 3EJJX 2IFFH 1S7QB 3FXYA 5D6CA 1J9YA 1JHKH 4W4NA 5E7BA 4YR6A 1CFSB 2VZVA 1WB0A 2K9UA 4BSVA 4LARL 4OQTL 1JWSA 1KBKA 2BCKB 4NQDA 2PTTB 2OR9H 2Z93A 1FVDA 4RE2A 3IRPX 1Z9MA 3FTGB 3C60B 1WICA 3U36B 3VG9B 2A38A 1YPZA 1T21B 3ARGB 3ELAT 2IBBA 4KQ4L 4B9ZA 2AEQH 3KYMB 4WU5A 2O61B 4JLRA 4LSSL 3UPCA 4M8UA 2WBGA 1RUPL 4HS8L 1OD7A 4WIWA 1H0DB 2I9LB 3MOBH 2HP4A 1IRAY 5F1SA 1AR1D 1ACYH 2YG0A 3FAXA 1VHPA 4TUFA 4YHYC 5DVOA 5D70H 5I3DA 4MTVA 2AW2A 4JRWA 3CD4A 2HVKB 5IB4B 4Z76A 3G5ZA 3DHUA 4TXEA 1KB5L 3I97A 1FH9A 4S0SD 2D0GA 4J12A 2CGRL 4LEXL 1LK3H 5TFSL 4ERSL 5K93A 4YBLB 1W9BM 2YSSB 5KS9B 1ESWA 4BELD 2LU4A 2W9EL 3CDYA 3CZGA 2EIZA 1LL4A 4QO1A 5BCAA 3IRZA 5JPMB 2WO2A 5ICYA 1E6PA 1OAZL 1T1XB 4V1DB 1DHKA 2P5WE 1KXHA 5FF6A 3CX5J 5DI8B 3RUGB 2D7OA 4DCQA 4U1GB 3UG5A 1JI1A 2PXYD 1E6OL 3QCUH 1INQB 4R90H 4CKVX 1H3PH 1MJ8L 2XN9A 3O8XB 3TEUA 4OLWL 3OG2A 2GK0B 2VIRB 3KXFD 5DD5L 2EDRA 4R96A 2VRJA 1XGRA 2YKLL 4F80A 1OY3B 3R0MA 1X5HA 2NY1C 4Z2AA 5JIHA 3QA3A 3FB6A 2FDBP 4FQXA 3C2AH 1NEZB 1NAMH 4LQ1A 4M3KB 2APXA 2HG5A 4EDWH 4ZO7A 5KAQG 3MV8B 3EW3B 2WZPD 4U7KA 1C93A 5D7IF 3H42L 4LLMA 2FR4B 1R5WA 4N8VB 3D85D 1MAMH 5SX5K 4LHUB 3WH6A 1TZIB 1WAAE 3A67L 4C7FA 5M3WA 4WGVB 5BVPH 3A23A 5FL0A 5TF1L 4JN1L 4PJEE 4HS3A 2V3EA 5E24E 1PEZA 4KHTH 4LGSB 1C7SA 3PUCA 4HFWB 2Y07L 3UERA 3PQYB 5E6IB 5JZ7C 4F15B 4JPKL 2IAMD 3DO3A 1H5VA 1J8HA 2WUCH 4OQTA 1FAKT 1N0LA 3O3BB 3MBEC 4LNVA 3AICA 5K9OB 2BC4B 3SDCC 3VXMD 8FABA 2WSKA 5D7IA 1KFAH 3PWLB 5SX4I 1A6UL 1FG2A 5I2UA 1G6RL 5F7DA 3PDDA 4JM2C 4OT1L 5FCUH 1P8JA 2DQUH 5GGVL 4JFQA 3LRSB 5HJ3A 4IM4A 1MW3A 3RU8L 4L29A 1ZA3B 3VFOB 4KQ3L 5AZ2L 1X1NA 1IARB 1I3GH 2FH6A 3GKZA 1U8JB 4BH8A 4S10A 5FO7A 5DTFA 2W1WA 4AM0B 3OKMA 5F44A 2GQHA 5JBDA 4GKZA 4OLYH 1KB5A 3VDHA 4O51B 2LTQB 5IQ7H 2W0KA 1NL0L 3NCEB 3SE9L 4DFIA 4GPNA 2H1PH 4GG6E 4Y16C 3GSOA 1H15B 1QI3A 1WWCA 3A6OA 3IDNA 4H8VA 3DTXA 5IGXH 3VGDA 4G5ZH 2X05A 3G6DH 4AMCA 4NCDA 3SKJE 4D8MA 1V3LA 4KPHL 1UM6L 3QQ9C 2DM4A 2CHNA 1H8OA 3OZOA 1G7QB 4QT5A 1UD8A 5TE6H 3GBNL 3B2UD 3QULA 3PF2A 5D8WA 4GRLA 4HGKC 4YHZL 2DQHH 3ORJA 4LSQH 1A6ZB 3C2SA 3TYFA 2E7LC 3MJ8B 4NRYB 4JDZB 1U93B 1S3KH 5I1CL 1C8XA 4KRPD 1V05A 3EYSH 4JHAH 1BJ8A 1VEOA 4Q6IA 4Y4HA 4ET7A 1LP9F 3H7BA 3FCTB 1WISA 5ETUA 3PTKA 1OF2B 1LNUB 5F3HA 5GIRB 3X11B 5C0JB 2X4NB 2VX4A 3DV6A 4XPTL 1ULPA 1NOFA 2Z31D 1NWRA 4RFOH 2VZRA 2HFEB 2VLME 4RMWA 3H7LA 3R06A 1ULOA 3UTZA 2FB4L 2ZX9A 4ODWA 3PXHA 1VADA 2Y6KA 2PKDA 4Z95H 3QIBD 2F5BH 2XG5A 5TDPA 2VOTA 5FHBH 1DLCA 1ISZA 1DP0A 3BKJH 5I73C 4DJMA 5HHOD 4HUNB 2JK5B 5KSUA 4F8XA 4MNQB 2NY5L 5IOPB 1LP9A 4IHOB 3QHOA 5F9OL 2OQJA 5IYYA 3MNZB 4MQ7B 3I6LD 4MQXD 4AEFA 1FRGH 1G6RA 3WYRA 3VD9A 4LKSA 1OSZB 2ED9A 2UY2A 3WN6A 1OB1B 2ZKHH 4PIRF 4HQQH 2EECA 4GI6A 4ZFGH 4K68A 3RM8A 4ODTH 4YEEA 3HNSL 4DWSD 1Q9LA 4KDVA 1AP2B 4JZJC 5CEZD 2F54A 1NGZA 4I13B 4WJ5A 5ABEA 4BM7A 5JUVA 2V6HA 3RZCB 3H9HA 3MLYH 4GBXC 5H8DA 5DUML 3RP1A 1MOEA 4U1KB 1UZ0A 3VG0H 1MCBA 4PRHB 4XNZB 4N0YL 4X7FC 1NP0A 2ADJB 2YFUA 1E4WH 4LBEB 4QHUB 5CBAB 3JWDH 4GLRI 3NYDA 5D1XB 4FNLL 4HUXA 1BGAA 2I07A 4PV8B 4G6KL 2MQ3A 4RIRB 2UUDK 1RJCA 4NBYB 4YFLI 4EI5B 5I2IB 4G7VH 1HINL 1N5YL 3Q6FB 1BFVH 2DSKA 5EIIB 4NZJA 2MOVA 3F5LA 3UBXI 3WKZA 2DT3A 1YNKH 4YHIB 3IJ7A 3VI4F 3MUIA 4UZSA 5J9PA 3VPLA 1UWXH 3HG1A 2W62A 4Z8FL 3DURB 2AMGA 5D2LF 4BJ0A 2YUZA 3MLXH 2WIIB 2YXFA 3V7AG 2LAAA 5J6HA 4W86A 3L3KA 4HPYL 2X1OA 1GPOH 3WUWG 5INDB 4PJ8B 5IWLC 2VX6A 2IBGA 3BPNB 3C8XA 2UY7A 2Y72A 3SGDH 1H3WM 1FGVL 1J84A 3ZE2E 3EOYG 4NHUB 3BP7B 1UA7A 4QX1A 5CXPA 4G6FB 2FECI 4QHMA 3SGKA 4U0QB 4QLLA 4QRRA 4AZ5A 3IFNH 5FUCE 3VRIB 4M6NH 2QSCL 3GI9H 4DZ8B 5DURD 3IDXH 1CZ8H 2XI9A 3H3PL 3NABL 5D2LA 1W1PA 2J47A 4ZD3H 2ATPB 2FECL 4UOW0 3RJDA 5CP3H 1X5AA 4B16A 1JGUL 4HF5H 1HDMA 1FC1A 4PJDB 3MRBB 4Z0BH 5D93B 2X1PA 1MCPH 1QW8A 4PUDA 5KG9A 1TVHA 1Z3GH 1CICA 2J7CA 2AP2A 5CPTA 1RURH 1SVZA 4LIQL 1FZJB 1UXWB 1QFWM 2P8LA 2XY2A 1XH3B 5HDBE 1UWRA 3BP5B 3VMOA 5L2JB 1PZ2A 4PMQA 2OTUB 3WF1A 4I18C 3CLFL 2YPLE 1VGEL 3T3ME 4LNRA 4X7SH 4KI5E 1FV1B 4PP1C 1BFOA 5ADOL 5C8BB 2DT2A 1A1MB 4RAHA 2OWXA 3KPRE 2WMJA 1KQYA 1YQVL 2G5RA 2VH5H 4JRXB 5E1AB 1MJJB 1MQPA 3NCOA 4X5WA 4JQXA 3MS8A 2XZAL 4HKJB 1GOHA 4U1SB 5FA3A 2DRUA 1W0WB 5BW7C 4AZGA 4QLRA 1JFXA 3WDRA 3UTTE 1MJ7L 5DMJB 5FIPA 2WMIA 4AL8L 2XHNA 2W67A 5CSYA 4FQCH 4DN3H 4AG4L 1LD9B 1CD8A 1EERB 5AUMA 4ORGB 1I9RL 1IAIH 4U6HB 3EO0B 3P1IA 5IVNA 3DX8A 3GGWB 4UZUA 1XCQB 2M2DA 4JY4B 1E4KA 4ZXEA 5D1QA 3L2MA 4R7NB 3MRQB 1CXEA 5B4XA 2IWGA 1JL8A 3L4WA 3MUGB 3T3PF 5M03A 5GGRB 2F58L 2FGZA 4BQ6A 4B0MM 2IADA 1FAIL 1LEGB 5FYJD 3UBXA 1KR0A 1QVOB 3CLWA 1CG9B 1Q9WB 3ALPA 4L5FL 4JKLA 2IQAB 4S1DC 2BDNL 3IAGC 3TA9A 1JF1A 3QDMD 4E5XB 2IJ0C 5B39A 4HIIA 2AV1B 4P5YA 1EVUA 1LVEA 4F57H 1BIIB 5H37G 1A2YB 3RPIB 1VFAA 2F53E 1S5HA 3WLBB 3LZFH 3ZLQC 4I0PB 4APQA 1KGUA 5DD0H 2VJXA 5HYQB 1OTTC 2CUHA 4QDSA 4M29A 1T0MA 3O2VL 4P5TB 3PZNA 4LLAA 5FA4A 1VCAA 4WW2F 1HKIA 2VTFA 2WZ8A 5DF0A 2EXWC 5ILTL 2FJHA 4HGMA 5DMKB 2WINA 2DCKA 4D0BA 1CQKA 1KGXA 1B30A 4YEFA 3ARTA 1E73M 5J6GA 2GAZB 1ZV5A 3HE7C 4O4YL 4P8UA 4JFYA 1BPVA 2JD9A 4MAVA 1ZKAA 1A1NA 5J12C 4UDTA 1PYWB 5FUOH 3RVWD 3LH2L 3LEGA 4RWYL 4NRSA 4I3RL 1WBYA 4PBXA 4MA7L 5JXEA 5CEZH 5LVEA 3VIIA 1KTRL 2OXGA 4WK9A 1OW0A 1J05A 1QQDA 1R24A 4JPWH 1FVEB 3L3HA 4KMLB 2NSXA 4U31A 1WZLA 4FFWD 3AZSA 1A5FH 5DSCB 1Y18A 3KDMB 4WW2A 1NAKH 3OJDA 1NFKA 3KS0J 1AD0A 4NNYB 1NKRA 3EFFA 1HILA 2J7BA 2ORZA 4F37F 4AYFA 4WWKC 4P4RA 3RKPA 3GFUA 5FUCC 5MERA 1QI4A 2R8SH 1AIFB 5C08A 4G6ML 4ZUVA 1QSFD 5ISZA 5I5RA 5KTEL 2GJ6D 3PV6A 2Z1KA 4KTDL 1AE6H 3QNXB 3HC3H 2BJMH 1ZGLM 4IPNB 3FAWA 4MLIA 2J1KA 2NZ9C 2C4XA 1OTSD 1OAYL 1Q72L 1RZGB 1MHHA 3O2WL 1VENA 3QIWC 3V8CA 4B9YA 5CINL 4I2XE 4JZNB 3MO1B 3RWDA 4QLKA 5DRWB 4NZCA 1NC2A 1MI5E 1A9EA 4B3KA 1VPOL 2QADB 3BXNA 4GOSA 3FHQA 2PN5A 3D3VE 4FQQB 4OKDA 3D2UA 2H2PD 2WBJD 3L3IB 5I75B 1FNGB 4KI5C 4P3CH 1CVSC 1JK8B 5HPOA 1VKXA 2OYLA 3CXHJ 5D7LD 3E3QE 3GSXA 3JV6A 4NQUA 2XOTA 3LRGA 3ZR6A 2HJKB 5MENE 4Y5XA 5HI4D 5JR1H 1R3HB 4LHJB 1CFTA 1W72L 4AZ8A 5EOTA 4KK6D 1KN4L 4IRZL 2J78A 3VXTA 1MHEB 3CFDA 4X6CF 3BZ4B 5F7EH 4KHXH 3S5LA 3NACH 1DSFH 4JO3H 4M1CD 1KBBA 1KCRH 5H94A 4U05A 3SKOA 2YD2A 3T2NL 1FZKB 1PZ3A 3KVQA 5I8EA 1AO7A 1YC8A 5FYKD 3U9UA 2CNCA 4WGWB 4PJFF 4QRPA 4U1NB 1D5XB 2BRRH 1IM3A 2Y06L 1UCBL 5DXWA 4RL3A 1PAMA 1BQHG 4XVUD 2IH1A 4XXCA 3NIDE 4MX7B 1D5IH 2DQJL 1H0IA 2YBUA 1DQLL 2HTLD 3MV9D 4BSVB 2AJVL 3VXQA 1BVNP 4X6CA 4IRJA 4RFNC 2Z93B 2D7TH 4OV5B 1FVDB 3UZEA 4Z7NE 1IBGH 4F9LC 4NGHL 4NZTL 3LEXA 5C7XH 4Y1AD 4A6OA 4AIXA 1YPZB 5DHYA 5C9KA 4QOKD 4PJFA 4Q9QL 2VQUA 2DL9A 4TPRL 3IJHA 3BUYA 2DLEA 3WUZA 5IBTL 1TXKA 1O5DT 1V6VA 1OGGA 2ZWYA 4JLRB 5B8CA 2XZZA 2XQYG 5I6XC 2ADIA 2OYKA 3D39E 2E9MA 3NCMA 3UNPA 2YBRB 4U1LA 5D5ME 1I1YA 5EBWA 2XIDA 1JNDA 1MRFH 1P7HL 2GHWB 1RIVL 2B1HH 5AD0A 2XPGA 2D7QA 4ZQKA 4X5LA 4Z76B 3MCG1 1MHPL 1A8JH 3G5ZB 2YPKA 3RVXC 1MQRA 4ONFH 1T6VN 1U95A 3OR6B 4XPAH 1E4XH 3V52L 3WF4A 4UOJA 4HWZB 3WS6A 4EJ1C 2R7EB 4TTGA 2J8OA 5BO1H 1HHJA 1F11A 2EIZB 5A8PA 4OKVA 2BFVL 4ELME 1FYTE 3QUKB 4JAMA 1D9KD 4MDJB 5FF6B 5IMLA 3S35H 1MQ8A 4YBQD 1L7TH 4XV0A 2DM2A 3LV3A 1AHWC 1HE7A 2PWGA 2XN9B 1JGVH 4OJFH 1U8QA 2AV7B 4FQPA 3ZJ8A 4NQTA 5DT7A 3RWJB 2LU3A 4R96B 1KJVA 1XGRB 2R0KL 5BV7L 3TH3T 3MKKA 1RIHL 4U7SA 2EDNA 3MA9H 1OP3H 5DRNA 4NN5B 4OV6F 4FQXB 5LA1A 4PJ9B 4LU5L 4HIXH 5E6ZA 3RWEA 2HG5B 1B0GB 4K8RD 4YWGL 3QEQE 15C8H 2JJSC 3U2SA 4K9EL 4LLMB 3N06B 1R5WB 2W9DL 4R26H 7A3HA 4JHBA 3W0KA 3AUVA 2PI6A 2RAMA 3QG6A 1G7JA 2WHJA 1AXTL 3VWJD 1KCVL 2J74A 1WITA 3ZYZA 2BGPA 5BQ7A 4HS3B 3DXAE 3SDYH 3GSQB 1JTOA 3VA6A 1VIWA 3MLVL 4EUPH 2VITA 2BVQA 4L3AA 1YEGL 1QYGL 1VGKA 1YMHA 4PJGF 2Y5TA 1PLGL 4PLKD 1AJ7H 2CETA 3EO9L 3BO8A 4F2MB 3EZJB 1DEEA 2FX8H 1AMYA 4JFDA 3WQ4A 3GSNH 4UV4L 4MGQA 3QPXH 1SHMA 4L4TB 1QLEL 4PJBF 1FG2B 3KYOA 1I4FB 5F7DB 2VDRL 1TMCB 4CGTA 2MPAL 3AREA 4OD1L 3TBTB 3O6KH 4JFQB 1ZBWA 5HJ3B 2Z35A 3RTQA 3UP1A 4NWTL 3UCRA 1U30A 4L29B 5GS0L 3EYPA 3HI1A 3Q6GH 1OTUC 4BH8B 4PJGA 5IEHB 5FO7B 5DTFB 4KKLD 3LQMA 1IV8A 3MMDA 3OKMB 5IJVA 3BKCH 2DD8L 3O6LH 4GKZB 4PJBA 5T5FH 2J3SA 2N4IA 4X0VA 1KB5B 3VM7A 2VABA 1ORQA 5D7KE 2BNRA 3EYUH 1ZHKA 2N7BA 1YMME 5FM4A 4C55A 2MKWA 3FQRA 3GSOB 4K3EL 5KAQF 5CILH 4E42A 3VO0A 4YUEL 3IDNB 4NQED 5JW3H 3VTRA 2NXYD 2HN7A 2MANA 3OAYK 5FGBA 5KVGH 3Q1SH 3WF3A 3BN9C 3RGHA 2VC9A 3QUXA 1TMQA 1XGPA 5G05L 3MRGB 4QT5B 4NI3A 1K45A 1JZ4A 4G6JH 3QHMA 4TUOA 2GI7A 2Q6WA 2V5CA 1B2WL 3QULB 5DMIL 3TO4C 1E72M 1C08A 1MCWW 4GRLB 5EG6C 3TYFB 1PD6A 3RWGA 1I75A 4I77H 4H25A 3P4LA 1KG0A 3OJVC 1E5NA 1X5GA 1N5AB 1W2PA 1T2QH 4FQIL 1HJSA 2VDKH 3C7OA 1Z9LA 3C08H 2EYRA 4Y4HB 4JN2A 2R4SL 4PTWA 3H7BB 2XRAL 2QF8A 1WPCA 5ETUB 5F3HB 3IDYB 4ZFOL 2AABH 1XR9A 5D9OA 5IBUB 4PR5B 3FQUB 4NBZB 1UOKA 3P4NB 2GJPA 4ODWB 2EDEA 2JEPA 1VADB 4LCWE 4S1RH 4UT9L 4HG4J 3HZVA 4A3ZA 1W3KA 1FORL 1M03A 5TDPB 5C0FA 5F1KC 4PY7A 2J7GA 4NJ9L 4Y88A 3P11H 1P9MC 4BDVB 2WVVA 5I8CB 3AXIA 1D6VL 4K07A 5FFLA 4RMUA 1LP9B 3VIPA 4H20L 4OZHE 5IHLB 4D94A 2W1QA 1ZA6B 1UB6A 4ZOBA 1WZ1L 3V4UL 5KJRL 4U5KA 5CJXC 5K9QG 5JW4R 1NCWH 3D5HA 4PGJA 1A02N 2L7JA 2OQJB 5GJSH 2F9BT 5DA0B 4JFFE 1T80A 4H1LA 1U3HA 1I8LC 1G6RB 3QIUD 3TVMB 2ITCA 3P0YL 3MROA 5JMOA 2FATL 2PR4L 1NBVH 2YL6A 5SV4A 4W50A 4LASL 4ACYA 5C6TL 4OAWA 3C6SA 5C0BD 2ZUTA 2DIJA 3IETA 4C57C 1MFDL 1Q9LB 5D6DC 1AGFA 3AIWA 1WZMA 1EK3A 1NGZB 1DN2A 1QNZH 2B1AL 1I1CA 4WJ5B 4ODHH 3SDAB 4FG6C 3CDGA 2VE6A 3FO0H 3H9HB 4DW2L 4Q0XL 1OINA 1FFQA 4P2QD 1YYLH 2X0HA 5DJ0A 1NUNB 3VW3L 1KT2A 5A3ID 3F62A 4RGNB 2V2TB 3R1GL 4WHYH 4OF3A 4CMMA 2QSTA 4HUXB 4W93A 3EMZA 2I07B 5KVFH 5C07E 3WFBH 1CLZL 3VXRA 1ZL1A 1L0XA 3MNVA 2EEBA 2Y6SC 2X5PA 1G7IA 1JN6A 2NY7H 1KCLA 4EBQH 1XCTA 4YO0A 1UWTA 4QHKJ 4AZIA 1U91A 4JGMA 1ZGLP 2R69L 1UWGH 5J9PB 3VIJA 2CKSA 4XBGA 5C0CD 2K7PA 3HG1B 4D9LL 3ARQA 1A64A 1E6JH 4KROB 1QRNA 3B9KC 3SCMD 5J6HB 1UWQA 3L3KB 4ZNEE 1PKQE 4QCIB 1JIBA 5J13B 4FLRA 2XTLA 4NO0A 2BVPA 3K46A 4L8CA 5EB8A 4WTZG 4ZFOA 1ISXA 3VNZA 1CR9H 1IEHA 3BPLB 1WQVT 3TBWB 4WI8A 1BJMA 4QHMB 4TQEL 2H32H 4ENED 2ICWJ 2A6JB 4QRRB 4WFFE 2OTWA 1UG6A 1NBZA 4RAUA 4ZG1A 5D2LB 1OOAA 1MW2A 2EKSA 4HZ6A 1I1AA 2NLJA 4FQ1L 5DC4B 4H04A 3EGSA 3RWFA 4JVPA 3UXFA 1E4JA 4XVTH 5DHVH 1TVHB 1L8NA 5IEKA 3PDOA 2W60A 1CICB 4IOSD 4M5ZH 1Q9KA 1M7XA 2OJEA 4JFZL 3MUZ1 5HHMD 2P8LB 4P46A 1J0YA 2NY2B 5D8JH 3CJJA 4M7JL 5C0RL 1C1EH 2XSAA 5HDRA 2YPVH 1BQCA 4L4VE 4OBSA 3S3JA 1KLGB 5J89A 4LNRB 1NWSA 2ZEWA 4I4WB 4NKMB 3CLEH 2VMDA 2BVEA 1V3JA 1BFOB 3OAZK 1LG2A 1FQ9C 5I1HL 5BJTA 4R5EA 3S37L 4A2LA 4CCDA 1J5OL 4GINA 4X5WB 3TNNA 1I7RA 4Q58C 1QSZA 3L3JA 3SUSA 3S36X 2ZSWA 4L3ED 4TOYH 3PWPD 5FA3B 2DYPB 3OG6B 2QBWA 5KZCB 3L3GA 5L7XH 1PEWA 4XI5D 4K2UH 3JTSA 4QWWC 3NAAL 5TE4L 2J7FA 4QTHA 1DVFA 1QSEE 1ZSDA 5GS1C 5I24A 3H9SA 2E9JA 5F21B 4FQJL 4N0CD 1DBAH 3PZQA 2FX7H 1PG7X 4TULH 1EGJL 2PUQT 1MCSA 3CC5B 4FA8A 4RYDA 3WUWA 4UT7L 5E8PA 4XNXH 1FH5H 2XQBH 4KK8D 3GJFB 3WMCA 1JXJA 1CE1H 4D8PA 4ZEPA 2ZJSH 2EDBA 3WIHL 3O4OC 2IADB 1EZVX 3MBXL 3UBXB 3BEWB 3ZKXC 5I66B 1RZFL 2MCPL 4GXPA 5D9SA 4PLNC 1EA9C 2DJUA 5SWQA 1GGCH 3L3DA 1JVKA 1O7AA 1JUFA 1QPKA 4PRID 4M5YL 4OF6A 1JF1B 4XHJC 5DA4A 1TPXB 2XTJE 4HIIB 4XC1H 5B39B 2G8ZA 3Q48A 4ZAKD 4FABH 1CF8H 1JJUA 1L7IL 4BFIA 4JQIH 4QGTA 3HS0A 3BKML 2EDDA 1VFAB 3UEZA 1S5HB 3OKLA 2J79A 4M7ZB 4PLOB 3CAFA 4APQB 1ZBCA 3WH9A 1T5XB 4P9HC 1RUKH 1DBJL 3D69A 4M48L 4OM0L 5FA4B 1CDCA 4XRCA 5FDWA 1V6WA 4Z7VE 2FJHB 2WINB 1BEYH 3VA2C 4D0BB 2VXSL 3QUZA 2Q8AH 2QV4A 3IKCB 3OIHA 5J6GB 1IQDC 5DZNA 1HJXA 3IU4H 4JFYB 3N15A 1A1NB 4UDTB 3UTSA 1GYAA 4UQBA 2FLRT 4MAZA 4PT6A 2ZXAA 4OLXH 4PRWA 3QBTB 2Y25A 4JL1A 3QR2A 2YKKA 3DV4A 1JZ5A 1J05B 1QQDB 1R24B 3S97C 3FZUD 3IDAA 5E9DB 4AH2B 5FUIA 3NGBC 1S7SA 4M9OA 2VCBA 4CD5A 1Y18B 1TTFA 3DSFL 3OJDB 2AEQL 2E27L 2APBA 1AD0B 1TJHH 3EMQA 3ZTJG 1CGXA 3EFFB 3L1OH 3APGA 1LE9A 2DQIH 3II1A 1BF2A 5JORA 4RE4A 1HILB 1JGLL 2DQDH 3O6ML 3EJZD 4D6GA 5A69A 5ACZA 4P4RB 3FOMA 4JHZA 4W81A 4PUEA 2LU7A 4RGMB 4HXBH 1ISYA 1P69B 4OFYA 4ZUVB 1HP5A 1NWUA 3VM5A 5ISZB 5F9AC 4PJXB 3PV6B 5E95B 3O3EA 5I16B 5E56A 3IVKA 5D96C 2RHEA 4LMQE 4XUTA 1MHHB 4U1MA 5C8JA 4GUPA 2PYEE 2GT9B 2YN5A 3FT3A 4R2GC 2B4CH 4I3SL 5DZOA 4PJAE 3NCYP 5B4NA 5KANG 1EGJA 3GKWH 3BXNB 4ZE4A 4P23A 3C60D 1R86A 3W2DH 4HD9A 3ARGD 1EVTC 3RWCA 1XRVA 4TSAH 2MQ0A 2FO4A 2YDSA 1QW9A 3WIHA 4XZUG 3JV6B 3UG4A 2AQ1A 1VESA 3ARBC 4H8HA 1UR8A 1CTNA 4MAUL 1CFBA 2AEPH 3MREA 2LW8A 2C3XA 5HVGB 3JUYA 4UTAL 2YWYA 3MZTA 3C8DA 3TA3C 5EOTB 5LCVL 4FLSA 1NAML 2SEBB 3VXTB 1WFUA 1LMKA 2YLLA 3S5LB 5ALBH 4GRWB 4U6YA 5EUOE 5T1KA 3DHMA 5E99L 5H94B 2DCJA 5I8EB 4AC1X 3U9UB 1BLNB 4QRPB 3AXLA 5BVPL 1IM3B 4YHPB 1YN6B 4Z2IA 1B3XA 1EDQA 1CDUA 1GGTA 1NCTA 2IUZA 5EC1B 1UD5A 2IH1B 2VAAA 5IHBA 1UR0A 1OGBA 2WUCL 3MLUH 5CPQA 3RBSA 4GO8A 4KK9C 3VXQB 3CVHH 4IRJB 4W84A 1JWUA 3LKOB 2YD7A 3HZYB 4R97B 3V5KB 4EUPG 4WI2A 3O8XD 4JIEA 5DHYB 1LEKA 1NCNA 4MDOA 4J8RB 4PJFB 3A22A 2HTKC 5CCKH 3IJHB 3BUYB 2XTJC 1BZ9A 5T3ZD 2YD4A 4JG1L 1BD2A 3KXFE 3SKMA 2P24A 2ADIB 2V5YA 2KUTA 3B9EA 5LJYH 2XACC 4LFHG 4PMDA 3U7AA 3KR3L 1RZKH 3RDTC 3DVGA 2ATKA 2R2EA 1RI8A 1PZ5A 1I1YB 1QNQA 1TR1A 5EBWB 1P7QA 2AXGA 3FHAA 4F7MA 4F58L 3MV8D 1CWYA 4NC2B 4MGSA 2EBNA 4WW1B 3U6RA 2X4SB 5AD0B 1HKFA 4WUUA 2BY1A 5ESVB 1A14H 1OIFA 4ZQKB 5IQ7L 2F61A 2DMBA 2YPKB 3W81A 4M81A 4E8CA 2H1PL 4LHUD 3DARA 4HS6A 1CD1A 3ZO9A 1U95B 4IJ3C 1E6NA 3KPMA 5F72S 3JTTA 1YHTA 2VNCA 3D6GA 5IGXL 4GT7A 2CMRH 4UOW1 1EMTH 3G6DL 1HHJB 3OLGA 4ZYKA 4ZXOA 1V6XA 1ZTXH 3PQYD 5E6ID 3BEVB 2NX5E 1KEML 4JAMB 3VIHA 2QKIA 4AEHL 1K4CA 2A77H 3N11A 4WI9A 1OCWH 1H3UA 4O58L 5HYIA 3ULUD 3NA9H 4LSQL 1N59A 2HRLA 4PN2A 5DLMH 1U8QB 4OZGE 3K8LA 4ESKA 4OF0A 5FYLH 1AC0A 5CEXA 5L0QB 3PZIA 4JY5L 4I3GA 3A6CH 3RVVD 3GIZL 4YJZL 4BXSV 3N1GC 5JQ6L 2CXKA 3WIJA 4UBDC 1SYSA 1W72B 1NMCB 5DRNB 1NAMA 2A1WH 5C71A 1W9PA 4HPOL 3RWEB 4HFUL 5A8OA 1BQHA 5LCWL 1UA3A 3VXPA 1VJSA 3VGHA 4A4AA 5CGYC 4Y19D 2Z4QA 4LSUH 3QG6B 1G7JB 5K9KB 2F5BL 4P2CG 4PSPA 5E1HB 4PMZA 4RX4A 5ID0B 5FHBL 1WCGA 2ZCLH 5CJOH 3U7WL 3ULSA 3OLDA 4X4ME 3DOSA 5KVEL 2WKGA 1UD6A 1XH1A 4Y4FA 5DMGC 5E8DH 2BVQB 1XH0A 5FGCB 1VGKB 1YMHB 4F8TA 2Y5TB 2N7AA 4QHNA 2VDPL 5T3XD 2ZUSA 5LXGH 2VLJA 3BO8B 3WV0A 1DEEB 2D3LA 4PBGA 4JFDB 3QSKB 1IGYB 1FRGL 5L8LB 2VSCA 5HPCA 3SCUA 2ZKHL 4HQQL 5C7GA 2I60H 4P7OA 2A6DA 4ODTL 3AREB 4DGYL 4NQSB 4JANA 3RTQB 4N1CA 1JG9A 4RMQA 2HAZA 5J7CC 4EVNA 4HK0A 5AWNH 3HI1B 2GW5A 3WFLA 4QB6A 4P59H 2VR5A 2Y4SA 4NRXB 3VG0L 3T65A 1C5BL 1FFOA 4NQCE 4DK3A 5IJVB 4UFKA 1TQBB 4PJBB 1CVRA 3NZHL 4PB9H 3CSYA 1C8PA 2VABB 1ORQB 1NQBA 2BNRB 3SCTA 1ZHKB 3EFDH 1ZT7B 4OUEA 1XD1A 3FQRB 1C5DB 1Y6MR 1IKFL 3BYYA 4E42B 2IANA 3C9NA 3HMWL 4P2OB 4LCUA 1BVLA 2HN7B 4WHYG 5CWSB 2R2BA 3DPBA 3QUXB 1JPTH 1UD2A 1JPST 2YZ1A 4S1QH 5LKNA 1XGPB 4KKAD 5EORH 4LLWB 4HUMB 1V0LA 3TTSA 4Z7OE 1I8KA 3BDYH 4YBHA 1F5WA 2X89D 3OPZL 3QEHA 4TUOB 2Q6WB 1UMIA 1C08B 1KBGH 2XFXA 3MLXL 3RWGB 2E8YA 1PPIA 2XUCA 4H25B 1KG0B 2X4UA 4KUZH 2AVGA 1S46A 5BV7B 4ZTOH 1CGYA 4JN2B 3KJ6L 2WVSA 3S6TA 3RZCD 5B22A 1G1CA 3CXDH 3QRGL 4OSUL 5HHPA 1J01A 3DHPA 5I6SA 4L4JA 1XR9B 4N0UB 1NCCH 1CLYL 3UAJC 3KPPB 4ZUTB 4PD4J 3RVUD 5I9QC 1CI5A 1S7XA 1SY6H 3IDXL 5E4EC 3HZVB 4K94C 5D1XD 4ZD3L 4KH2A 4IS6A 5C0FB 5CKGA 2V2WA 3SGEI 2A3CA 2GEEA 4FMFA 3QOMA 3AXHA 3VWKB 2WVVB 4WHCA 4YN5A 3MGOA 4EI5D 3DI3B 3QWQB 5T3ZH 3WFCL 1Z9OA 4QY8A 3HE6C 1JAKA 1UB6B 3OKNB 2P4AB 1NCUA 4Z7WF 5HVHC 2Y2WA 3TF7C 3ARDC 2JJTC 2AJSL 4R6UA 4BZ2H 3ARVA 4H1LB 4OGXL 5JXGA 1BECA 1U3HB 1K8DA 5ELIA 4PMVA 3MQIA 3HEIA 5JTWA 3MXVL 3BX7C 4X7SL 3FJTA 4FHBD 2GKIA 4OAWB 3Q3GB 3C6SB 3EB7A 1ZLUH 3PABA 43C9B 2ZE0A 1AGFB 4O9HL 4PJ8D 2JFEX 5CMAB 2ZNWA 1T3FA 4URIA 1WWBX 4C56E 4J1UA 3SDXA 3MBEA 4Z7WA 3SDCA 3GXIA 3NCJL 4G6FD 1MWAL 1YEKL 5DJ0B 2DBLH 3KWXA 1KT2B 3MRDA 4JEGB 2IBZX 4XWOD 3AY4C 4OI7A 2PXYA 4CMMB 1BF8A 1GRWA 1BAFL 4DN3L 3U7YH 5KVDH 3ULUH 1GOIA 3D0LA 5I1JH 1EHLH 4L4PA 1ZS8A 1IAIL 4PFEA 1P4IH 3UO1H 4OGAD 2RGLA 4LAQH 4OZFG 1NLBH 3MRNA 4JDTL 1UZ8A 4XVJH 3W4RA 5EA0H 1XCTB 2R56H 4YO0B 4J3SA 3TZVA 2VRKA 5AZEH 2F19H 1OGAE 1U91B 3BFOA 4KRPC 2VUYA 2AEIT 4Y16A 3F7YA 2PBOA 3OF6D 4TUJA 1QRNB 3MPCA 5FK9B 1TZHA 5A8QA 3X17A 4R4FH 4NO0B 4M00A 2Q7YB 2BVPB 5DZLA 2CLVA 1JNHA 4U33A 4F66A 1NAEA 4JRXD 3MOAL 4L8CB 3RAJL 3WD4A 1X6NA 5DFTA 3PP3H 4ZFOB 2F5AH 4RAVA 3LZFL 2IAMA 1UACL 5DD0L 2Y7QA 1J0HA 4LP4A 1L9MA 3VXMA 3MLRL 4KY1H 5T3XH 2OTWB 3FFCE 1HYSC 4RAUB 2FL5A 4KJQC 1MRCH 1VAHA 1I9EA 3MV11 2BXYA 4N8PA 1IQWL 3BGFC 1O6IA 1IGIL 4POZD 5FUOL 1FLRH 4M8QA 3K0WA 1YJDH 4XC3H 4D6HA 5DUBB 5IEKB 2W60B 2IPTH 4KRLB 1Q9KB 5TQ2H 3HMXH 4NQXA 2IFGA 5CHNB 2XV6B 1E4IA 1A5FL 2P8PA 4P7QA 3ZYIA 3SKJL 3QDHA 1WLHA 2R29H 2QR0B 1UJ3C 3ZL4H 2P5WA 5FYJE 3VE0B 1WE5A 1FNEA 5DYOA 1GHSA 5EIQA 3N18A 1D2KA 3TNNB 5I1LB 3RX8A 3C5ZC 3T0AA 5ESAB 1T66D 3MRLB 3WUGA 2ZSWB 4I0PD 1MWAA 4LVEA 1SDDB 1CZVA 1YYMH 2KQMA 3ZT7A 2LVCA 4P5TD 1C12A 1V8HA 5I71B 5CSBA 4OLVL 2XVPA 2WWMC 4RISH 1TITA 1A4JB 1A3RH 3JTSB 4QTHB 1DVFB 5CQ1A 1ZSDB 3IFPB 3MU7A 5DRXA 2HT4C 2EE6A 4JZJA 3KLHC 3H9SB 1IC4H 1HQ4B 2YMXL 3REWA 1QP1A 2A3BA 1UG9A 5EB9A 2IQ9H 4OD2A 2ESVE 2EYTB 3KZSA 1UENA 4GBXA 1YUHA 3P9LA 3HC4L 4L8DA 4UQAA 3OZ9H 3QUYB 1DFBH 5E8PB 3WUWB 4P3CL 1K2DA 2YOCA 5JXHA 2Y5EA 1KSRA 2WANA 1CX1A 2Z31A 4HWBL 4JPIB 1BIHA 4NN7C 4WTZA 2OJZH 3K80A 3IDMB 3PGFH 4HC1H 2FSEA 1MCOH 1RPQA 4XNYH 5DEFA 5JR1L 4GAYA 2OR8A 1M71A 1E6RA 5J11C 4GI8A 5SWQB 5E5UB 3L3DB 3V5HA 1IGML 4P7LA 3E8UL 3HUJF 1L7QA 5CG0A 3NACL 4BFIB 1BYDA 3UDWC 4OMCA 3HS0B 4QP0A 3IB3A 4YHKH 1HVQA 1X44A 1TVNA 1GONA 1BFSA 1FH8A 5IROC 2GJ6E 2XWBB 3D69B 2V17L 4XRCB 1UWXK 4JFXA 5FDWB 2VZTA 3CFEA 4L3CA 1Z6JT 2FWOA 3STZB 2PWDA 4HZAA 3QUZB 3GO1H 4JFPA 1OM3L 1F3RB 4PMUA 1CXHA 1BYBA 1OAQH 3BISA 2J88H 1HQRA 1US2A 4HKZA 1XHGA 3HUJA 1D5BB 4MXVF 2QADD 3HZKA 4GS7C 1IBGL 5IR1A 4M24A 3DV4B 1PG7H 1TJGH 5C7XL 2EIDA 4NC1E 2ZIDA 1S7SB 2Q86A 3ME0A 2ZZUT 4PJIF 1F4WH 3QAZC 1E70M 1LWRA 4QHKI 5D7LE 3BRGC 1EDGA 1X5YA 3V2AR 1DANT 3L4ZA 2E7BA 4I9WD 1LE9B 2DDQH 3I2JA 1INDH 2B20A 4XCEA 1DBKH 3M46A 3FOMB 1OGSA 1EOKA 1N6QH 1DWJM 4XMKL 4OZIF 4GI9A 5J3HC 2FIKA 4WENB 4GRMA 3UYRH 1CENA 3U5YA 2L0DA 1F8TH 2ZCKL 4PJIA 5FYKE 4XPAL 1E4XL 3IVKB 2G9HA 2VDMH 1HOCB 1UQZA 3IF1A 5GGQH 1JDAA 3LPOA 4HBCH 4V28A 5C8JB 3QFJE 4PRPB 1X5ZA 4GUPB 4KC3B 2CJUH 4PGCA 4PGEA 4GIAA 4LYRA 1AGDA 3FT3B 2WO1A 3SE3A 2ZP0T 4NN6C 1IC5H 4WLCA 1ZHNA 1U8MA 3VXSE 3GH4A 1AQ0A 1XF4A 3MV9E 3S35L 1L7TL 4X4XA 1HJUA 4OZIA 4P23B 5BW7A 3RQ3A 3AHZA 2H3NB 3NUKA 2DLHA 5J1XA 2J5LB 1FPTL 5IMKA 3RWCB 4HWBA 2DQCL 4ARXA 2FO4B 5T33H 3VGGA 2OI9C 4OCMC 3ILPB 3MREB 3E2HB 2PYFB 1WNOA 2XA3A 3PDGA 4PCTA 5TQ0L 5MEQA 5D7JC 4AQOA 3W11D 3U4BL 1NKOA 4MXQD 3QI9C 2EDXA 2H2SD 4U6YB 1T5WB 5K9JH 5T1KB 1KIPA 1JPGA 2W5FA 3WBAA 1KPUA 2R39A 4H7VA 4AD5A 3TO2A 1TFHA 2M8XA 1X9QA 3AXLB 2W1UA 4ZUUA 3I3DA 1LO3L 1OBAA 4YDKH 5IM7A 3ZJ6A 1ITBB 4X8JA 3SEEA 2VDLH 4G9FA 5EJ1B 1AJ7L 1YDPA 5EU4A 1EEYA 1W0VA 4KKBD 1H8NA 3GSNL 4DXSA 1N2RA 1LQSR 1NOWA 2X1QA 1T1ZB 4XXDB 3HN3A 2OP4H 2XN9D 3F6IA 1LEKB 1MYRA 1KPVA 5F1NA 1BZ9B 3O6KL 3ETBF 1BD2B 1AGCA 3SKMB 4YC2C 2P24B 1CEOA 4KAQH 2X42A 3HE7A 5DDHA 1CBVH 2OM5A 1RSFA 4FQXD 3DVGB 2ATKB 2R2EB 4X9FA 1PZ5B 4PJ9D 4XX1E 2XTKA 4OTXL 1P7QB 1DWAM 2C26A 4F7MB 3GSUA 3BKCL 2WCGA 4H2CA 4WUUB 3LS4H 1OTSC 1NBYB 3O3AA 4HTYA 3F5WA 4PYSA 1T2JA 1CDBA 1AD9A 2CHOA 4YHLH 5IF0A 1CGTA 3KPMB 3JTTB 3X12B 1J9CT 5JW3L 3TIDA 4P3DB 1HZHH 3EYQC 4AENB 5HDBF 5CZKA 4ZYKB 1YY9D 3Q1SL 3QNZA 4WWKA 5TDOA 2QQLH 4NC1C 2ICWA 4G3YH 1EQCA 2WDBA 4XZUA 2QKIB 3VFMA 1K4CB 4QCFA 4V27A 4QPWA 1OT5A 2EH7H 4KI5F 5L2KE 4X6FA 4NDMA 4L4TD 2Q87A 1SJHB 1DLFL 2CK2A 1RP8A 5ABGA 1EAPA 4HAFA 4P5MB 1N59B 4QAWA 4S3KA 2DLTA 2CLRB 3DYOA 3T4AA 5CEXB 4UR9A 2VMFA 4JZ5A 5A6MA 2VSDA 5KSAA 1INEH 3N9GH 4NNPH 4WHTA 1MFEH 1SYSB 1RUMH 3MRIA 1NAMB 5E4IA 5D1ZC 5F7NC 5FO9A 1LF1A 4FMKA 4YXHL 3W27A 3DJ9A 1UR1A 3QHTC 3UJJH 4E41A 4W8AA 3BJ91 3CFIC 3BZFA 3VXPB 3IXTA 4S1RL 4ZMAT 4NFBA 2DMKA 1NGYA 5L9DL 1W0NA 5CJBA 1MXGA 5HNNA 1KIRB 1VJZA 4X6DE 3P11L 5C0AE 1P6WA 2X9WA 3PG2A 4EUPA 2OLDA 2UVFA 4Y4FB 2QSQA 1FZOA 3ZDZE 3HC0A 4QHNB 4PRNA 5E5MA 3LEIA 2VLJB 3GSNA 3LKRA 3PWJA 3U4EA 1PW3A 3ABZA 5ANMA 1UJTA 1WWAX 1MQKH 1JNNH 3F7RA 1CDYA 3NIGE 2A0LC 4GRLD 4LCCC 1I8MA 1RZJC 1HKLH 3RNKA 2CDPA 4LSDA 5JR2A 5DD1L 1J1OH 1EIBA 2VKXA 3CKHA 2JCCE 3IAQA 4JANB 5SWZE 4M02A 1T7WA 3WEXA 4NBXB 4EVNB 2X7LA 4LLYB 1C3FA 4HK0B 5EPMA 1HT6A 5JOPE 3MRMB 1DEDA 4L9LC 2DF3A 2BOBB 3FO0L 4M6OH 1CL7H 2QTEA 4KKCC 4N8VG 4QF1B 4EEEA 1YYLL 1RY7B 4O02L 4R3SB 3T65B 1FFOB 4JQVA 4F9LA 1G9EA 2BNQE 3VI3F 1ACZA 3CSYB 3LQAH 3QCTH 3UETA 4XBPA 1I9JH 3WF2A 4RNRA 4CU6A 5KVFL 4N5ED 1FDLL 4AWEA 4G6AC 2F53A 3C9NB 5EN2A 7FABH 4W88A 4LCUB 4ODXA 5EFDA 4MNKA 2R2BB 1R87A 3OBAA 3QOKA 1ZLSH 1ZHBA 4YHYB 4EBQL 1S9KC 3MGAA 4Z2JA 1FP9A 3FN0H 4QRUA 3TFKD 3QEHB 1HVXA 1T20B 1W9UA 1FVCB 3DUSA 2AI0H 2DH2A 3VUPA 3TVMD 3G6LA 1HX0A 2XFXB 4K7PH 3BAJA 2P48B 3VFRA 3FO9B 1UH3A 1TETL 4UT6H 2BY3A 3TH4T 5E70A 5C0BE 3V79C 2R4RH 1UADC 4K8RC 1UWEL 4HWNA 5DJ8B 3S96B 4JFED 3SDAD 1CR9L 4J3OC 4PJ7B 4UQ9A 2J8UE 5HHPB 5GNXA 2IG2H 2D1ZA 3VWJC 1V02E 4AD4A 1AHWA 1OAUH 3RGVC 4P2QE 1T22A 1P4LA 4OZ4B 4RGND 4HMDA 1JWMA 2EC9U 5DR5H 2ZOXA 5C2UB 4LPTA 4UILH 4Y1AA 5CIPB 3D87B 3NMEA 1HCVA 4XNUH 2V2WB 1NSNL 4LSTH 2NY1B 4D9RD 1JNLL 1A7PH 5GRUH 4KV5F 3MGOB 1CCZA 1GQKA 4P4KC 1OP3K 2ZEXA 1HEZA 4G43A 4K7FA 1AGBB 4QY8B 1XGQA 3CZEA 3GMQB 1NUKA 4WI6A 5CD5D 5IT2H 4TTUA 4GKSA 2O9OA 1PY9A 1CE6B 1UYXA 5A3HA 4I2XA 1K8DB 4TNWF 1NOUA 5EUKA 1YEHH 1HHKB 5DC0A 4ZS6C 1EEZB 2H26A 4AT6A 1WT5A 4KROD 1MI5A 4NSKA 5C86A 4M80A 2BVYA 3PABB 1OSEA 3D3VA 3DIFA 5ALCH 4QYOA 1T3FB 4J1UB 4FXKB 5TDNA 3SDXB 2NZIA 3MBEB 1AXIB 1OIMA 4TOYL 3SDCB 2W0FA 1RAMA 3ZMRA 1OQXA 4PJ5E 1CGUA 4G8GE 1D9KA 3VNYA 5DS8A 3Q5YA 4QRRD 4OQTH 3MRDB 2GJZA 4RFEA 1KB9K 2EPNA 5L7XL 1Z0NA 3RL2A 4P2YA 2DT1A 2OX5A 4K2UL 4RQQA 4PBWD 1N3NB 3D0LB 1YEJL 4KQ4H 1NGXA 3C87A 4LLQA 2RQ8A 4PMYA 1CT8A 2FX7L 5E2UL 5F71A 4LSSH 5EO9A 4TULL 4IIQA 1CICD 4EN3C 1RUPH 4HS8H 3MRNB 1G9MC 1FH5L 1UZ8B 3TZVB 5C09E 3WELA 2DIBA 1CE1L 4KRUA 4PTTA 1BG9A 5IFAH 2XWTA 3PUIA 3BH9B 5D5MF 4Y16B 3F7YB 4TUJB 2C9KA 3RVTD 2WMKA 5BRPA 3D18A 1TZHB 5A6JA 4LEXH 1NARA 1JNHB 4XC1L 4ERSH 2GYSA 1KLUA 4FABL 1CF8L 4XAKE 4PF1A 4JQIL 2XGIA 2W9EH 4XGZA 3OR7A 4RAVB 4LGRB 3EHBC 1IVLA 2H32A 2DYPD 2Y7QB 4CMHC 3OLEA 1RUKL 1OAZH 3C8KA 3TO4A 3D39A 2R23A 3FY1A 5KZCD 3VXNB 4Z2HA 1T83A 5D9MA 4OIAA 3BSZH 2FL5B 5D5MA 4ELMF 5IVZB 3T0EA 4EZMA 4OLWH 5EFFA 1F3JA 4WKHA 2LAGB 4HLZH 4CJ1A 3E6FA 5DD5H 4M8QB 3U7VA 1M6OB 4Z6AT 4J3VA 4WRLA 4DM2A 4JL2A 3BGMA 4XTRC 3SDDC 4NQXB 3CDCA 4P57B 1A6TA 2CO7B 2P8PB 2EH8L 2UV3A 4YGAB 2ICCA 3C5JA 5E94B 4ELMA 1WDRA 2VX5A 5DJYA 1MW0A 2P5WB 1IT0A 2GIYA 4PMXA 2FLBT 4Q97A 5DYOB 2B5IC 2X4QA 2L7UA 5C0GA 1WKYA 3GSRB 5GJTL 1ISWA 5BZDB 4NQEA 3HNMA 4QX0A 4KJWC 5CJXA 1R5IA 1X4ZA 5C0IA 2Y07H 4OF5A 1MWAB 1MY7A 1YY8A 3L5XL 4APQD 6FABL 4JPKH 4Y4KC 1U3JA 5BRQA 1C12B 2BS9A 4OZFA 4L8SC 4YFEA 1G6RH 2MHAA 4GW1B 1WCQA 5D6DA 2WHMA 5DRXB 4JZJB 1D5ZA 3U7BA 4R9HA 1JZ6A 4JFTA 5GGVH 5SX4H 4M3JA 1ULVA 5F9JA 1Y6KR 3GKWL 3FOLA 4M61B 3EBVA 4GBXB 1YUHB 3P9LB 4L8DB 1J0KA 4YXLL 4KQ3H 3BN3B 5CZXD 5JXED 4X4YA 1Y0LA 1K2DB 1LLOA 1WO2A 3DXAA 5E9DD 1UEMA 3S34H 3OLIA 4MSWA 2AKRA 2Z31B 4PPTA 1V3IA 5F8QC 5I15H 4X6BA 4LSRL 2FSEB 5DEFB 4TXWA 4GAYB 1M71B 4YK4C 3WNOA 1NL0H 5EU6E 5SWSA 3V5HB 3WHXA 4GAJL 1BG4A 4TVPE 4N0RA 4RN5A 3K2UL 2HFFA 2Y36L 5ISZD 1T7VA 3BYTA 4KPHH 1PX8A 1UM6H 1DUZA 3QNYB 3SBWC 3I6GA 3MRRA 3MRHA 4JFXB 3B9KA 3CFEB 3OEAA 3GBNH 2FWOB 2HLFC 4JKPH 3V7MA 4JFPB 4YDJA 3SUVA 1UM4L 2YRPA 1U8IA 1HQRB 2VN4A 4HKZB 3RMEA 4MAYC 3QJHA 3WLWD 3HZKB 5IR1B 1JGEA 3FW6A 1N7MH 3ZKND 4CVUA 5BMFH 2Q1EA 4U2YA 5LGJA 1KR1A 3VFVB 3I50L 2Q86B 3O3DA 3TBYA 4UAPA 2XFYA 1JF5A 3ZDXE 2PBGA 3QPQD 4O2FA 1CGSL 1W0YT 1K85A 3TP4A 4JB9H 4MJIE 5IMOA 4FRWA 3WUFA 3G6JF 4XCEB 4Z7UE 1W1TA 4PGDB 5EULV 4KJYB 1E15A 2ERJC 2VLLA 1ZMYA 2NY5H 4KVNL 2XNAA 1AFVL 2FIKB 3VDBA 2E0PA 3RPMA 1A14L 2WV3A 3ZE1F 5HHNA 3ETPA 3U9PL 5F9OH 2H6PA 3W0WD 4PJIB 3GUTA 4OZHF 1QFPA 1CXKA 2G2RA 3MGTA 3KLDA 3VRLE 1EZVY 1EMTL 4XNQA 5K33A 4PGEB 4PGCB 3SCMA 1ZTXL 3G6JA 4WV1C 1AGDB 2CIKA 5MI0C 4NRZA 4RBPH 1ZHNB 1NGWB 2NQCA 4LCWA 4U6VL 3HNSH 1U8MB 4IRJD 1XF4B 5GSVA 4V1DE 1MJUL 4I5BA 4X4XB 1UYZA 3IFOA 3MACL 4HULB 5C92A 2R9HD 3NA9L 3JVGC 5IMKB 5M94B 4IOIA 1OLZA 5FYLL 4OZHA 2HVMA 1T7YA 4N0YH 3A6CL 4MVBD 3S4SG 2VERN 4J3TA 5GS1A 2A6KB 5GGTL 3DYPA 3LOWA 4JFFA 4Q2ZA 1VFOA 3S2CA 2XM2A 4GG8A 1NDMB 2JELH 4QTIL 5MEQB 4EE9A 4ZDHA 1OSPL 2R0ZH 4HLJA 3SE8H 2ID5A 1N5YH 4A45A 2A9NH 3MV8E 4GLRH 1FNSH 2N56A 1KIPB 4JKMA 4YE4L 2BXZA 1KPUB 2OMBA 5M7QA 1BYCA 3TO2B 4UQ3A 2Q8BH 2BY2A 1XEDA 3FB7B 4ZUUB 3GJFH 4BQ5A 2XFRA 4HH8A 2ARJQ 4B53A 4IRSC 4Z8FH 5IM7B 3L4VA 2EEDA 3NFPB 5E8DL 4FTVE 2CRZA 4X8JB 3S8WA 1IFHL 3MLTA 4G9FB 4HPYH 5KOVC 3BRFA 3PQYE 1YDPB 1DWFM 1EEYB 5DK0A 1W0VB 1W9XA 1QFOA 3VXUA 3D9AL 4NOFA 5C0ND 3NCCB 3DRQA 4LXFA 5C07A 3U1SL 1GQLA 1II4E 4PLJD 3QH3A 4L3EA 1OQOA 2A73A 3PWPA 2FD6L 5F1NB 5MEPA 1M7IA 1AGCB 4C4KT 2QSCH 1IQDA 3HE7B 5IJRA 1ITCA 3NABH 5DDHB 2E7CA 5J12B 3MRJA 1WJ3A 1MCNA 2BGOA 2G3MA 1OAXL 3U57A 1MRDL 1S9WA 2ZOLA 3GSUB 4D6FA 1JTPA 3LVEA 3AIRA 1PKQA 1X6LA 4ZOAA 4PB9L 2PETA 5GRYA 3O3AB 2IPKA 4LIQH 4ACZA 1LG1A 1AD9B 4YZFE 5IF0B 1HKJA 2E8ZA 4DM1A 3CLFH 3MANA 5IVXF 4J3UA 1WFNA 5GZNC 4WWKB 5TDOB 3MSGA 4JHWL 3BP6B 2ICWB 3ET9F 3VG9C 1KTDA 4S1QL 5ADOH 4DEVA 5GSRA 5EORL 1ROWA 1T03H 3T08A 3VFMB 1QO3B 4JFDD 3VILA 4NDMB 2Z1SA 5HSFA 1EAPB 2VVNA 1NANI 3FQTA 5CS7A 4LLVA 4ZTOL 3QIWB 3RTQD 3KPSA 5KSAB 5IVXA 5GGTA 3BIAX 4WHTB 4LL9A 4AL8H 5FO9B 3CXDL 4AG4H 1L0QA 2YPLB 5BS0E 1AQKL 1I9RH 1NCCL 1JI2A 4TRPL 43CAA 1QFWI 4E41B 4LGXA 4YBLC 1SY6L 2IH3A 1GAFL 2AJUH 5JDSA 4W6WB 2BNRD 4M9PA 3AHVA 3ARBA 4F3FA 3NTCL 4HJ0C 3SKNB 1U58A 4LMQI 1JHLH 2F58H 4P2OD 4EUPB 1JYXA 3QG7L 1R5VA 4MNQE 4U1GC 4JR9L 5CSGA 5EMYA 4ACPA 4KUCF 3QUXD 1FZOB 4NWUH 5E03A 5GRJL 3HC0B 3BAIA 2BDNH 4X9IA 3UTTB 2O9TA 5E5MB 3LKRB 3GSNB 1FLTX 2EXYC 1WEJL 4I1NB 3O4LA 3PWJB 3QQNA 2CRYA 3U4EB 5ANMB 2HT2C 4S2SA 4GRWH 1I8MB 1F00I 3SKVA 1RH9A 3RNKB 3FRUA 1G9NH 1VACA 3MV7E 4OQ1A 3PZOA 4NT6A 3EDFA 3MTRA 4XCNB 3I9GL 2FDMA 2BZDA 2X7LB 5ILTH 3MMEA 5EPMB 1C91A 1MCKA 3U46A 1UYWL 5F7UA 1VERA 5ADPL 4RFNB 4O4YH 1LO5A 4H8WC 3LHPL 3K1KC 2DBLL 4IMKC 4YHNA 2CBJA 2EDHA 4PRHE 1R7OA 1IKNC 4RWYH 5GGSY 4I3RH 2P5EA 4PSRA 4MA7H 2CXGA 3WD3A 4XBPB 5ICXA 4HV8B 4MO3M 3QEUA 1UY1A 1DZBA 5BRZE 3AGVA 5AYIA 4RNRB 2OWCA 4P02B 3FKUS 5I6XB 4F15C 1EHLL 3VWKD 1P4IL 1BJ1J 2F53B 3UO1L 5EN2B 5A6BD 4WFGE 5KS9F 3N17A 1IZJA 4TTDC 4P2RA 5HXMA 3SY0B 1ZHBB 2JIWA 1UKOA 4XVJL 2LV4A 5EA0L 2I9LA 4UFMA 4UINL 1TTGA 4YNYB 1AI1L 3BAEH 3AB0B 4QRUB 1X3DA <