3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
3CVHL 5KZCB 5T3ZE 1KSRA 1FYTE 4R2GC 3T1FB 3IS0X 4UT7L 3UO1H 3FJTA 1E6RA 1BX2B 1VENA 2Q76A 3T04D 4JR9L 3EAKA 3CFJA 4AM0B 5ESAB 5E08H 4GUPA 2Y9RT 4P4KC 4ELMA 1WBZA 4KXZI 4JY4B 1H15B 1KJ2B 4HGKC 3CFKA 3C5SB 5GXBB 4E41D 2OTUB 1UM4H 2D24A 1J8HE 3ZT7A 4ML4A 1Z9SA 3PABB 3E2HB 4XVJL 3MNVA 3MPCA 1DQLH 1PKQA 2ZSWB 2WLYA 4K8RC 4NGHH 1XIWD 2WAHA 3X14A 5GJSL 4MB5A 1SY6L 4M6MH 2YA1A 5I6XC 2XZQL 3LMJH 4UQCA 1W99A 1V0NA 3AVEA 3OKDB 3NFPA 3RWHB 4JFPA 1DUZB 2XWJB 4ONOA 2APXA 3HNSL 1MHPH 4LLVA 1KGUA 2H8PB 4RMUA 4DGVH 3I2KA 4P7OA 3ZJ6A 3OKMA 3EDKA 4IPLA 1JFQH 4X0NA 3WIJA 3P9WB 3MBEA 5BMFH 3MA9L 5FO9B 2VLJA 3QR3A 4YDJA 1YNTA 2J1SA 2GSIA 4JPVL 2W0KA 1YN6A 3D39B 3T1WA 3WO4B 2BNQB 1KJMB 4EN3C 1XF3B 3JV4A 1B9ZA 5IK3A 1RU9L 3EMCA 2BNQD 3IS1X 1OAYL 1MJUL 3WLBB 4S1QH 2OSYA 4N0FA 5C7XH 2GAZB 3VGHA 3OLEA 1KIQB 4J3UA 1I4FB 5E00A 1K9FA 3IFOA 3MV9B 5BVJA 3MLTA 5KJRL 4RYDA 1GJUA 2AKRA 2FH6A 1A9EA 4PN2A 4TVDA 4HKZB 5HBFA 1T7ZA 4HC1H 3QG6B 1NBZA 4URIA 4ZFOL 4W70A 2VZRA 4MJ6B 4RMQA 2VDNH 4NQDA 4KAQL 2BVDA 2JEQA 3HUJB 5IQ7H 3W6MA 4PJ5B 2P8PB 5ITFA 2FH8A 3IXAB 4L4VB 4L5FL 1JHTA 4I18B 3VXNB 1NANI 4ZFGL 1BFOA 1DUYA 4S10A 3PGCA 3LRSB 4WU5B 1KJVA 3CXHK 3KNBA 2XUCA 4PCTA 4IRJB 3UERA 4KPHL 1BIIA 1OVZA 3EO0B 3QB7C 4HC1L 4IHOB 1WP6A 4P9ML 2D1ZA 1KQZA 1CGVA 1J10A 5DFWH 1LILA 1YJDH 1PGRB 5E2WH 3C5JB 4F8TA 1W1PA 4PMUA 3WUFA 4FQQA 5DD1L 2CLRA 5BS0A 3CSPA 4L9LB 3HB3C 4ODHL 1KR1A 5HDBF 2ICWJ 3GMQB 4LLDA 4GINA 3JZ7A 4E42B 4XZBA 2IQAB 1H5BC 5ID0B 5ICZB 4AENB 1A6TA 1VA9A 3MGTB 1GW1A 5F3HB 3ZJKA 1T0MA 4XPHL 5ANME 1R24B 2PWFA 1C92A 4AY1A 1IGTA 2VM9A 4MNGB 3V5DB 4NZTH 3NRUA 5B38G 3BXNB 1E6NA 2GY7B 2VRQA 1QSEA 4KRMB 4H1LA 4J6RH 3B8SA 1Y6KR 4PGDB 1K45A 3TZVA 4HIJA 1P53A 3MLSH 3Q6GH 4M7JL 1MNUH 4GQQA 3A23A 4QHNA 2VYRE 4N42A 4MLSA 2PXYB 1A6WL 2YD3A 3FQWB 1MI5A 3BP6A 4K3EH 1QFUH 2HH0L 3WD5L 4ZNCD 5DQDH 1MXDA 4U1LA 1GH7A 4YK4B 5DJYA 2ZCLH 2R23A 4X7SH 5L2KD 3CFIC 3VIGA 3UCRA 4BKLA 5CHNB 1MFAL 1WISA 1IFHL 5EULV 2QQMA 1HHHA 1QPXA 3QWOB 5B3JF 4JGUA 3LPFA 4YFDB 5B4XA 5INCA 4A3ZA 1LG2A 4EK7A 5CZVL 1TQCC 5IMLB 3SKJL 2CK0H 2WAOA 2NY4D 2MCPL 2Q7YB 3WD5H 3I75A 4G9FE 1HWHB 1W9XA 2IC2A 1MIEL 1T83C 3RZCC 2AK1H 2G60L 4LPVA 4AZ5A 4YBLC 5T1LD 1NMBH 3VFGH 3WJJC 5B3NA 1T1YA 4OTXH 2X4PA 5A2BA 2EPKX 1KUMA 4PRDA 1N4XH 3G08B 4R2GB 3BGMA 1CIDA 4S1RH 4LMQE 5T3ZD 3QUMH 3ALFA 3RPKA 3VXQB 3RY6A 2D2OA 4UOW0 4AEIL 3I2JA 4XX6A 3QIUC 2XPGA 1T5WA 4C56D 3GSOB 2X4TA 4JHWL 4JRYA 3S5LB 1FNSL 4WUUD 2W66A 1CFVL 1KLGA 4HWBH 3PHAA 2J22A 2XV6B 4IDJH 2TAAA 3QZWG 1EGZA 3O4LA 5KSBF 3M6DA 3HTLX 2VSDA 3P9LA 4HWEL 5I17A 1NMCC 1IAKA 2I60L 1NFKA 3AS0A 3GKWL 4LQ1A 2V7NB 3QFDA 2CKRA 2ZNWA 2FZ3B 5L8KB 1MFBH 2IFFH 4X5LA 3O41A 3RHWK 4QLRA 5FKAA 4DWSB 3VFWB 3U30B 5HGAB 4L4VE 3WFDH 5FYKL 1AGCA 1EPFA 3C5ZA 1TZ7A 4WW2A 3ZTNH 4HWBL 3DV6A 5I8CB 1RK1B 1EHNA 4M9OA 4YPGA 1ISZA 1ZJAA 4HUWB 1NDGA 2A9MH 1RH9A 3TEUA 5CWSB 3RGVA 1U92A 1QQDB 4HAGA 5C07D 3WO4C 5AG9A 3LV3A 3UNPA 4G3YL 4JG0H 3O11B 3PL6C 4JCLA 1S9VB 2NY0D 4ZMAT 2XVPA 4JFXA 1TLKA 4GQRA 1BSIA 1H4PA 4Z7OE 2HLFD 4U31A 4KROC 3GNMH 4GKNB 5D2LA 5HHNB 5A2AA 3PWLB 1KCKA 4Z7VA 4QY8B 4TTUA 2NR6D 1XT5A 1MFDH 3GMRB 2MANA 3FQXA 3AXHA 3HI6L 3NSMA 5D2NE 2XVGA 2D7MA 1UB5A 3C8DA 4NZJA 3KYMB 4OZFB 1A4JB 2EYRB 5IBTL 4M62H 1NUFA 1H0DB 3C9NB 3QIBC 3GJEA 3HPLB 4JFYA 2R1XA 1YY8B 4CD4A 4ACZA 1NGXB 5FM4A 4RDQG 2AJ3A 4LCYA 3FRPA 4YZFE 1MCNA 3O6FA 5D1QA 1W9SA 1RD6A 4NQXA 3BN6A 3QI9C 1QHZA 2YUWA 3DBXA 1GHFH 5A6LA 4N5UA 4XP6H 4QF1B 1UMHA 4HDIA 5IW6A 3WEZA 2BNRB 4CAGA 4PRPE 4OZFH 5BQ7A 1S7UB 2D3LA 2K3TA 4U0QB 3BESR 1A7QL 1YPZF 2MHAB 1R5VA 2XSAA 5BXFA 5C0RL 1U33A 2Z91B 2KQNA 2CKBB 4K7FA 3WFEL 4AT6B 5I3DA 5AZEH 2IANB 5DFVC 1T0PB 4TQEH 5FUZH 1ZBCA 4NWTH 4FFZL 4M3KB 3L7EB 1P4BH 2XTJD 1MQKL 1OP3K 5J13C 1U92B 1WAAF 5JTWA 3H9SA 1K4CB 3HNTL 1ZT4B 1HQRB 2DWEB 1TFVA 1RK1A 4OQTL 4N0YL 3GNOA 3A21A 1WK0A 5CUSL 4P7RA 4ZOCA 2XWJA 2WBJB 2PWHA 3CDYA 1QSZA 5EBMB 3OEAA 1KEXA 1ZLVH 4ZUUB 1ED3A 4D0BB 1UY2A 1T1ZA 1FBIL 1UR4A 3MUY1 2EO1A 5ABEA 2AK4E 2ED7A 4FQLL 5ECJE 1FFPA 4PUBH 1G7LB 2AK4B 2R1WA 5DTFA 2OMBA 3IDIB 4ODVH 2X1XR 5ICXA 15C8H 1T6WA 4D0QA 4NKDB 1KB5B 4MZ3A 3DETD 3DARA 1BM3H 4PGEB 1JGDB 4NQDD 3KPQA 5KZCD 3NIFE 3WF4A 2DN7A 3WHE1 1OGTA 2Y07H 5GSRA 3RZCB 3EJZD 1S9YA 3TBYB 4ACPA 4MAUL 5JXJA 4NKQB 2XHYA 3QDMD 1J1OH 3UYPA 3DVGB 4FQLH 3WJLA 4B53A 1JXKA 1ZS8B 1T21A 2GY5A 1PLGH 1BFVL 2P44B 3WN5B 4HKBB 3MSGA 1RMFH 4LQFH 3IGAA 2VRKA 5CEYB 2M2DA 2H32H 5D6DC 1EV2E 4JJHA 5H35A 3SCRA 2DJUA 1Q9KB 4YHML 1ZHBB 5DC4B 4FXLA 1XGUA 4HIXH 3UTQA 3RIAK 4D2NA 5CPQA 2G41A 3S3SA 4R0LB 4JPKH 1JV5A 4QTIH 4B3LA 3WELA 2IPUK 5GGSB 4S11A 3PWJB 5E6ID 5AYUH 1U3ZA 1UUQA 4I0PD 5FM5M 1JPGA 1YYLH 1NMAH 2FGWL 2VLKE 4UDUB 2B8OT 1NJ9B 3T08A 1G9HA 1JXJA 4JKKA 4FXGA 5EJ1B 1NC4D 4L4VD 1WSST 5GJSH 2GUOA 2YN5A 4PQQA 5KN5B 5MERA 3OTTA 5FL1A 4F58L 5JOPD 4OMCA 5K9QG 3CPLB 5J1XA 1MHPL 5IDIA 3AIRA 3VWJA 3VFVB 5TFSL 3L4XA 5M5DA 1WQVT 4QRPB 4YZFF 5LXGL 1MW3A 4PJIB 5C0IB 5BOPA 1UWIA 1AQKL 1HP4A 1MUJA 3I6LD 4NYLB 3GSXA 3OA5A 5MHSE 1O6IA 5FO8B 1OL0A 3OR6A 4LLDB 2QSQA 1OD0A 4R7NB 5EFFA 5ABHA 2PW1A 4ATLA 5GGUA 1U8KB 4PRHB 3AIWA 5J89A 1QBML 4JFEE 3KLAB 2V7HB 4K7PX 3MLXH 2D31A 5I30H 2MNUA 1VBUA 1YEDB 1HQ4B 2D9CA 3CCHB 1CR9H 1HVQA 1NM9A 4XUNA 5ABFA 2P5WB 3F7QA 3RM8A 1WUNT 4A3HA 1KIRB 5DC9B 4LLMA 4GSDL 4PJAA 3ARGB 4DVBB 4LCWB 3NA9L 2VDNL 2GKIA 4PRAA 1IGCL 4HG4J 5ABFB 4UV7H 3H9HA 1FZJA 4N1CA 4P2QD 4LOUD 1AQHA 3EYQC 5I78A 2I07A 4E9LA 1Q9LB 5KBNC 3KL3A 4QHLA 5EO0B 3QHZL 3C08L 4E5XB 1HKIA 3LE0A 3HG1A 1R7AA 1DCLA 2ZX7A 2FATL 1I8KB 4OCRH 2NY1B 4P3WA 5FXCH 1HJXA 1W3LA 4JDTH 4QWWC 5KSAC 4JN2A 1IL1A 4OZ4A 4UV4H 2BRRH 2ZOXA 1RIVH 2KDGA 4CW1A 4PF1A 1EVTC 3MXVL 3RBSA 3MV8E 4PJ7E 4H0IA 1U2HA 4ZFOB 1EEZA 3L3DB 1XGUB 5C0IA 5E2VH 2Y6JA 1QO3A 2X4QA 2A74A 4DGYH 4NN5C 5JPNA 4FXKA 4CCEA 4TNVF 4Z7WA 3WH9A 1US3A 5J13B 2CDPA 5JUEL 1BWMA 2WUCH 4AYFA 2VZ1A 4ODWB 5IJRA 1A6VH 1BREA 3B5GA 4L3EE 4I0CC 2J1VA 4W93A 5MERB 2P47B 1FRGH 3CNKA 1ZS8A 2BVOB 2VLJB 4OM1H 3KXFB 1CT8A 4Y4HB 3MYZA 4LVOB 5D2LF 5DJXA 4OIFA 2HFGH 1JWSB 3MXVH 4WO4A 1VESA 2YSSB 2VAAB 1RHFA 4PJ7F 3FQRA 3LEYL 3P77A 5CGTA 7CGTA 4IRSD 4P59H 2EIDA 4NDMB 2LQRA 4JM2D 4LARL 4JZJC 1AJ7H 2AXGA 3CFBB 4JQIL 4Z6AT 3VIHA 1AO7E 2X44D 4P9HC 2W65B 2P5WD 5F7LB 4FQ2L 2FX7L 1K12A 2F58H 1JN6A 3NIGF 1MLCA 4UT7H 2KH2B 3UO1L 4FFWC 1V5JA 1EZVY 3ILPB 4LYQA 5IB5B 3O6LL 2V5DA 3GMOA 3N1MC 1UYYA 3WHXA 5DI8B 1KFAL 1XGTB 1NFDA 3VXUB 3EIFA 3MRJA 3QFJA 3TYGH 3HC4H 5ITBL 1XAUA 1JK8B 1I9RL 1JGVL 3OKLA 4ZD3H 3LKNB 5MP6L 2JCCB 4HEME 1JF1B 3O2DA 2J79A 4JHZA 4MJID 5B4NA 4DVRH 3LS5L 3SJVA 3BPCB 5AWNL 5JHDE 4KZEL 1ZGLP 4OD1L 1IGYA 3O9WA 3S96A 2DSZA 1I9EA 2XI9A 4D1JA 1GQPA 2E3ZA 1DANU 4P2OD 4R90L 5FYJL 3PP3K 3T3MF 4NQCA 3AREC 4M03A 5JA8B 4UFMA 4QT5A 5E6IC 1U8LA 1NBQA 2XG4A 2V5YA 3BEWB 4PV8A 3VIFA 2ICWA 5BV7H 4ENEC 7TAAA 3EYQD 1L0XA 4TULH 4UNUA 3UYRH 3FFCD 3OGOE 4GKSA 5L9DL 4PRBB 1SEBA 3GMMA 4F80A 3WHE0 1S5IH 1FIGL 1W9PA 5D5MA 3NZ8B 4BH8B 5GJTL 1LHZA 1FP5A 3MRHB 4G5ZH 4KI5F 4XHJD 3KGRA 5IESH 3O6FB 5D1QB 5HGDA 4J1UA 1NLBH 2PKDA 5T33H 4P8VA 4PJXF 3QCTH 2EECA 4GKZA 4NBXB 5TGBB 5JQ6H 4ARXA 3BLKA 2V3GA 3BD4A 5C09E 3WFDL 3SCMD 4HG6B 5JNYA 4XV0A 3F5WA 4MB3A 3CLFH 4YPGB 2F5BH 1XSKA 4U4BA 5IB1B 3TO4D 1ZHNB 4ENED 2E8YA 1QZ1A 5IVXA 3M17B 1QFHA 3GI9L 3DO7A 4LHJB 2X70A 3FO2A 3QFJB 3STLA 2ZOLA 1W3KA 4LOUC 1GOGA 1SMAA 5CD5D 3W4RA 2EE3A 1I1AC 2OL3A 4UOW1 3BDBA 4UILH 1DN2A 5IB5A 2YS4A 1VEMA 3ECBA 1FL5A 5FDWA 3TO4A 3WUWG 3AIQA 1N5YH 1LE9A 5KVEH 4MNMA 1A7PH 4N5ED 3TCXA 1O59A 3DUSA 3II1A 1MCCA 4YHKH 1BYCA 4WUKH 5KS9F 5IVNA 4YBQC 1PSKH 1T7VA 5D1XA 4B5EA 3RUGF 1JI6A 2W5FA 4ZYKA 4WY7L 3QUZB 2JJVA 4X6FB 4LMQI 4DZ8B 4W8BA 3DXAD 3MLZL 5INDB 5JZ7C 3PZTA 2A9NL 2EIZA 3TIEB 3BC9A 4MNGE 4QOKE 2OYLA 1OHQA 1G6RH 3QBTB 4KVNH 4NQEB 2Q8AH 3P1IA 2RBLA 3TBTA 1OGAB 3VMPA 3B9KA 4HBCL 1AXTL 1OTSC 1IAIM 5HDQL 3S3PA 2YL8A 4YO0B 3GSRA 5DUML 1J5OH 3ZDYE 1ZA3B 5D71H 3MV7A 3QXTA 3R8BB 1VAHA 3UCQA 4AISA 5KSAB 1WNOA 2D0FA 2W9EH 1JYNA 5DT5A 2ADFL 2W87A 4Y7EA 3P11L 4DOHB 1A0QH 4OLYL 1BVLA 1CQKA 1MFEH 5D93B 2XA8H 3D48R 1MJ7L 4RMWA 1JZ7A 2O5XL 5DSCA 3DGGB 1UZ4A 3QWOA 5FECA 1IARB 3HA0A 5EUOF 1N6QH 2E3VA 5L2KA 2V5RA 1B31A 4XNZB 5TDOB 4DUVA 3ARSA 4M48L 5DK3A 2WANA 3PHQA 3TT1L 2JCCA 2ZUTA 5GS1A 1P4BL 4YUEL 3WNNA 5CAYB 4W50A 3BH8A 1FJ1A 1N8ZB 4OIBA 4YIQA 3MZTA 2APTA 3MRRA 4LSQL 5DDHA 4CRPA 3L3GA 4GXUN 1RYYA 2G3JA 3LQAH 3VFWA 5EOQH 2ZUUA 2WC3A 5JIKA 4LU5L 3C7GA 1AJ7L 1CL7I 1PDKA 3MV9E 4NQUA 4XPHH 2L9LA 1FORL 4WO4C 1CICD 1YEFH 5DJ8A 4Y8DC 1KEMH 4JZJB 1OAQH 3PWUB 3RU8L 3X12A 1YPZE 3KPPB 4AZCB 1N3NA 3FNDA 5HYSB 3EUUA 3DX7B 1OF2B 3EJJX 2VQ1B 4CU9A 1V6YA 3A22A 4KQ3L 1XGRA 4W87A 1Q0YH 4ZDHB 3M8OL 4LHUB 3STLB 4QRQB 4EDWH 1AI1H 1I9RH 1R86A 1D9KA 4XVUD 4PT6A 5FDWB 1U8OA 1RP9A 4Z5RA 2Z31B 4Y16B 2ZCLL 3I2GA 2APVA 1KQYA 2DIAA 1I1YA 5H2BA 4OFYA 1JHKL 5DUPL 2ZICA 4QRPA 1RUKH 1TVHA 3SCOA 4O2EB 1U8JA 5D9PA 4P3DA 4PLJC 4GW1B 5FYJH 3QUYB 1AGEB 4XZUG 4G6AD 1J1OL 2Y7QB 4KK5C 3V5KA 4GRWH 3VDAA 4DZ8A 2I5YL 8FABB 3N9KA 5BV7L 4U1GB 1XGYL 1CLXA 3FT3A 1UOKA 3SDAA 1H0DA 3I02A 3G5YA 3HI5H 4GRWB 5HPOA 3O45A 1BOGA 1TTFA 2DBLL 4NGHL 1I7RB 4JRXA 4M1CC 5HPMA 4Z78B 3H6JA 3VXRE 4HJJL 1K9TA 3G6AA 4D6JA 3POCA 1OD9A 1KYOK 1I85A 3WE6B 3W2DL 2DQFA 3O3EB 3CKHA 4GRLA 2CBJA 3P0VL 1X3DA 2H26B 1ITXA 4LEOA 3EMQA 4M43H 4X80H 1PG7W 5CG0A 4IRJA 3DROA 1OM3H 3LEKA 3PZVA 2HT3C 3W0WB 3JVGC 4JFXB 1Q72L 3CLFL 1YEGH 1JGEB 3QDMB 1Q0XH 3WIHH 3FN0H 4DTGH 5EORL 3T2NL 2JJSC 3ULSA 1E4JA 4HGMA 1UEYA 2WIIA 5LYRA 3OLIA 1N26A 1WPCA 4XC1L 1E6QM 1B0WA 4L4OA 2NX5D 3LEXA 1MFVA 4K68A 4NKIL 3WSQH 1MVUA 4MJ6A 3BYYA 4Z7UA 1GPOH 3THCA 2ZX9A 1LEGA 1G9MH 2DLEA 1NAMB 1UJ3B 3ZYJA 5HHQA 3FCTB 3MUJA 4PJFB 4PMDA 3ARZA 1O7VA 3VXTB 3DMMA 4FNLL 5FO8A 1G5AA 2FJFB 3ULVF 3MLVH 4W8LA 4P2CG 4PJDB 1LEKB 1IQDA 5DJZB 2YPLE 3UBXB 5JW3H 4KAQH 5HYJB 2CRIA 3P0YH 2E27L 3EO0A 3WD0A 1J0ZA 4P2QB 2J8UA 5JOFA 2DKUA 4LBEA 1T89A 5IW1A 4ZFGH 2EDTA 3SGKC 3BN3B 1BGAA 4PTTA 2NT1A 3GZKA 5DJXB 4P00B 4P5MB 3SJVD 1F3JA 5JIWA 2FBJH 1NCWL 3IRZA 1SBBA 1CR9L 1HN1A 1A47A 2P8PA 5ITFB 2WXDM 3RTQD 4FNLH 2IBBA 2WVVB 2DGAA 2XKSA 3W0KA 2C1OA 3BSGA 4Z77B 3RL2B 1T20A 4OZGF 1NJ9A 1BQHG 5T3ZL 3D6GA 3LKNA 4LGPB 4PJHA 4PB9L 1G7MA 4NO5A 1GGBH 3UROR 3HS0B 5E9DA 1KXHA 4D6DA 5F8QC 5J57B 5F3BB 1E72M 3VXSD 1MCWM 1ZBWA 3VINA 1BBDH 1PG7X 2MQ3A 4CBPA 1OAUL 2CNCA 4PMOA 4JZNA 2AJXL 4YFLF 2XVNA 5I1GL 4H8UA 2FIRT 3ARFB 3G6DL 1N64L 1WWAX 4OB5H 5D93C 3SEEA 2XVLA 1KC5H 3ARFD 5H35B 2Z91A 3KR3H 1M4KA 3GUTB 1K42A 3MOQA 5GS0L 4EDXA 4FTVA 4G7VL 1T3FB 3VCLB 2J8FA 4IS6A 3QQ4A 1SJHA 1RIVL 4U6XA 3QEQB 3ES6A 2EDWA 3QIUB 1V7NL 3PDOB 4JIEA 4HWZA 3L6FB 2GT9B 2C7UA 1U3YA 4B41A 3QDGB 4APQA 3HPJA 1KENL 1RJYB 4POUB 5SX5H 3MMEA 4GI9A 1C1EH 3BKYH 4O2FA 1CD0A 4LIQH 3T0EB 5ECUA 1NMCB 3G6DH 2QADD 5GGRA 3JBG7 3FQUA 1FVEA 3BP5B 1J12A 4GRMA 1YEIL 3OJ2C 4MD5B 3GMOB 3VFNA 5GS0H 1CLCA 5I15L 5KS9A 5JBEA 1U36A 3EGSA 3KHOA 2UZYB 3QIBA 5EZOH 3TA3C 1AR2A 5DMYA 3FB6A 4FQJH 4M1CD 4BYHA 3WD4A 3VXTA 5DEGA 2OJEB 4KUZL 5DLML 1B0GB 2PW1B 3VG9B 4HCRA 5KOVC 4ELMB 2R2EA 4LQFL 2NY5C 4MDOA 1LEGB 4Z7UB 4XCYA 1XF4A 1NANH 5GHWL 5I2IA 3LD8B 2HVJB 4IJ3C 4YHMH 1LNUA 4PJEE 4PREB 2VZPA 4HUVB 1V02E 2UZXB 4PS4H 2UZIH 3SDYL 5CBAB 2NY4C 4OFKA 1A14L 5DZLA 3V4VH 1JGLL 3TVMC 1AKJD 4JPKL 3MNZA 1VPOH 5JPMA 4TPRL 1FOBA 3UR8A 3U83A 3QPQD 1RULH 1FV1B 4P23D 1IAIH 4W4ZA 4JO2L 4BJLA 3QUYC 5CEZL 1NMAL 4Z2JA 15C8L 4FQIL 4JHWH 2GSGB 2IH3A 2GUOB 2VMDA 4KTEL 1VRXA 1NGZA 5IVOA 3ZHLA 4ZUTA 1AY1L 4BA8A 2DQXA 1KIPB 4MHHI 5B39B 1JGIA 1U8HA 2J78A 3VFUA 3OKKA 2DKSA 3WUEA 2AV1B 4S0SD 5GZOC 1LEIB 1MQ8A 3MCLL 3T2PA 4YXHH 5E0CA 5F7MC 3GBEA 4JZNB 3STZB 5HYSG 1FLRH 3F58L 2CRYA 3V7AE 4HH9A 3BAJA 1HJVA 4RFEB 5E1AB 2WVTA 5D96B 5I17B 2PTVA 5AYIA 1BFVH 3HS0A 5E9DB 1IM3B 5FA3A 5IMMB 2J1UA 4RIRB 2F5AH 1KIUA 3QUMB 3MGAA 4XP5L 3QO1A 4DQOL 1Y6MR 3S37X 2NSXA 1U3HD 5FDYA 5EORH 1AC0A 2OL3H 3T2NH 1JWUB 2DQEH 1W3HA 3MOAL 4JL1A 1H49A 4NC1C 5JR1L 1XR9B 4P2RE 2ICES 3MRKB 4NKMB 1QBMH 3JVGA 1OT2A 3MV9D 4XHQA 4JVWA 5T33L 4S1SL 2ADGA 5AYUL 4AJ0A 3CPLA 4ELMF 5E09A 4CCDA 1QVOB 4ZUSA 4HEPG 3MO1A 2ZSVA 3PDGA 4MZ2A 1XGRB 1D7PM 2UVEA 3CFDA 1T1XA 3ZYIA 3MFGB 2P5EA 1WB0A 4GSDH 3VA6A 3RAJH 3UBXI 2AXJA 4OCYL 4HLZG 2BFVH 2E9JA 4F7EB 4G6JH 4ZPTA 1EMTL 1C8PA 4LGSB 1Z32X 3FCTA 1RU9H 3TJEH 3SO5A 3B5TA 1UY3A 1FVDB 4P5TA 1UM6L 3N18A 4RN5A 3SCSA 5HYQB 4Y0GA 2EXYD 1INQB 1DWAM 4W68A 2GJ6A 1X5LA 2XYCA 1H8OA 3U0PA 2CBVA 2OJEA 3PQYD 4PJBA 4OFYD 4X8XA 2V3DA 5KTEH 4M7ZC 4Y1AE 3CSBA 5ENWA 2VSCA 1QKZL 1A3LL 4Z2HA 4XBEH 5I1LB 4CN1A 4J3OC 5HGAA 3AMDA 1U8QB 7FABL 4BFEA 5C08A 4PJIF 3MLRL 3A67L 2Q87A 1CDBA 4B9ZA 4WI7A 1BECA 1LO5B 1MJ8L 3N12A 4UT9H 1GORA 4LK4A 4PRNA 3QIUD 1F42A 4IS6B 1A21A 2EYSA 4LX4A 4XNYL 1U2CA 1XFPA 3HJRA 2NX5A 1CZ8L 1NEZA 3HMXL 1X5YA 4Z8FH 3GJFA 3CZUA 2PYEA 2H26A 3S36L 1RZKH 5HHOB 2Z93B 1CLOH 4NP4H 2HFGL 1J5OL 3NA9H 1M7IB 4DK6A 3N17A 4H8WC 2DQUL 1N2RB 2WCSA 5HHOD 1NP2A 3WSOA 4BA0A 4X6DB 4MAZA 4P59L 3MJGX 1S8DB 2PO6B 3GIZH 1UWXK 2OXGA 3QRFM 2GITB 4NHCH 4KKCC 2DOCA 2PYFB 1CXIA 1VFBA 1DE4A 1GOFA 5FKPB 2J7HA 5DS8A 3TA3D 5I1DA 2ZOKA 2IQ9H 3FT3B 2IF7A 3T0EC 1HINH 1SEQL 1JZ4A 5A3IC 1KPUB 4P46A 1IMHC 4L8SC 4MWFB 1HILB 3GRWA 2Z8RA 2BRRL 2G75B 4QDSA 4PMZA 4HP5A 1GOQA 1VFFA 4MAVA 3KPNB 4U1SB 2BMKB 3QHOA 2EE6A 4QRQA 4L8CB 1PZUB 1Q6EA 1O7SA 3R0NA 4O5LL 3HPLA 4M6OH 2HT2C 2CJUH 3PWPA 3U7WH 2AEIT 4ZD3L 4HK3N 2W38A 1GHSA 1QFWL 2EJ1A 4KJWC 1INEL 3RI5K 4LBEB 3OLDA 4QPWA 3LS5H 3X12B 5FD0A 4RGOH 3T0XA 1OY3B 5AD0A 1UQZA 2BNUB 1GMMA 1NAMA 4MXVF 1CE6B 1MEXH 5DRZA 2J25A 1CI5A 4CCCA 4P3CH 3A4AA 2CDOA 5E08L 3VE0B 4XPFH 1F45A 3KYKL 3NPSC 1J7VR 1QNSA 1YJDC 5ERWA 1IAIL 1QBLH 3B6SA 4WUUB 3RQ3A 1OBAA 2PR4H 1EX0A 4IRSA 3FOMB 4KV5E 4M5ZL 1PLGL 5EJZB 3GH7A 4KRPD 1U8MA 5F7DA 1SVZA 4PRWA 1PPIA 4LNRA 5FCUL 3QXUA 3HJEA 1ZAGA 5C0AE 2PF6A 1TQBC 3E8UL 4DWSD 4Z7QE 1DWGM 3HNSH 1VFBB 5FKPA 3ARBA 1Z5LB 4KWUA 3L5WA 4NRYB 4JGMA 1EGJH 1KFAH 2VXUL 1KJ2L 4QRSA 1P7QB 1SHMA 3ACIA 4R26H 1T03H 1U8LB 3LB6C 4JPVH 4R96B 2VDML 2FRGP 1WE5A 3VFSB 2XOMA 4JFEB 4KZDL 4WSKA 5J6GA 3EYUL 2H1PH 4MJ4A 3QIWA 5FK9B 1CDCA 1QFPA 2XPGB 2CHOA 5DRNB 1M71B 2DQCL 5I18H 2OYKA 1U8IA 3SJVB 4PJ9C 3KPNA 2CXGA 4A42A 1K6QL 2P5WE 2FIKA 5C08E 1ISXA 2DT2A 5ABGA 3GGWA 1VDGA 3MJ7B 3LV3B 3G6JB 4GAFB 2WINB 3QPXH 1QQDA 5CJQL 3WXWH 1OM3L 4C56B 1W72A 3GIVA 3CZ8A 3I3BA 1OGAA 3GMNB 1A4JA 2IG2H 3IAPA 2ESVA 4U1MA 3MJ9A 1S5IL 4DEQA 1DSFH 6TAAA 5F9JB 4I5BB 3V0VB 4F33B 4RFNC 3D18B 5AD0B 2UWEA 1I1YB 2C3VB 1LE9B 2UY2A 4X6CB 4HQQL 4KI5D 2R8SH 4Z2IA 1NLBL 4P2OA 4BQ9A 5I30L 2DRUA 1KLUA 4LVOC 4RAHA 3CDGA 1Z6JT 3D0VA 1BFSA 3OG6B 3ZOAA 2CIKA 2P5EE 5ANMB 1MW0A 2ESVE 3D0LA 4P5TC 2GSJA 3VOCA 5IT2H 1OGAE 1YDPB 3V52L 1PZ2A 4GWIA 4KHTH 5D71L 4X9HA 1O5DT 2G3IA 1HT6A 3W39B 4LHUG 4WEBH 2ZXBA 3S6CA 2R0ZH 3ZTJH 4HQQH 3A67H 5CD3A 1G1YA 2NY1C 1HYSC 2EH7L 1TCMA 2MPAH 5EC1B 3DHMA 2L4OA 3N13A 4AD4A 1N8ZA 2FJGB 3U37A 4HW6A 3QUKB 5TGBA 1I1XA 4LSUL 1CLOL 3NABH 1BIHA 1U42A 5GGVH 4OT1H 5ID1B 3BRFA 1LLOA 4MA7L 4ZSOA 3RI5F 4C59B 1MNUL 2NY1D 4LSQH 3P9LB 2R0ZL 1W32A 1NEZB 4WI6A 1KB5H 1BAGA 1JWMA 2V17L 5ICZA 3JWDC 2WHLA 1TPXC 4MQ7A 1FPTL 4HIEB 1NARA 5TE4H 2FX9H 2AW2A 1YEFL 5E24E 4XMPH 5E2TL 1EQCA 4L29A 2Y4SA 1L7IH 4R4FH 3ZR5A 1EFXB 1WF5A 2X4UA 4OFIA 3U48A 2BVTA 3IU4L 1NCUA 4QGYA 1TNMA 3KYOB 3WIFA 1IGFH 1J0IA 4D1IA 3D2UA 4LPTA 3OV6A 1OIFA 1A6AB 1XGPA 3BQUB 1KYOJ 3SDDB 4LKXB 1GOKA 2BSSA 4KI5C 5F1IB 5BZWB 4OZHA 4P46C 4D94A 2W9DH 1DUYB 1C1EL 1KWKA 1QSED 3SKNB 2J6EL 1UWGL 4LRNH 1FNAA 1GQKA 4Y2DC 1K8DB 4FQXB 4XMKL 2IFGA 2V9QA 5CIPH 5IFHH 1SFSA 5FYLL 2NNAA 4LKSA 1MEXL 1VACB 1U30A 1S78C 3UC0L 3B9KC 4C83B 2A6DB 4OSUH 4HS8L 2YPKB 1SJEA 5CJOH 4XUOA 2VLKD 4QXUH 3RL1A 3QEHA 2PR4L 3M1BA 4Z2KA 5DJ0B 2ZCHL 3KYNA 1UY0A 4OUEA 1A7NH 2ADJB 2VLKB 4H8VA 1S9XB 4JKWA 2J6EH 5E4EB 4Q6IA 4NKMA 3RVUC 4O2CB 1XC6A 3BIKB 4XMKH 2E9LA 1XF5B 5E03A 3ZKSD 1RI8A 3HOBA 4EUPG 5GRJL 4IOIB 1NX9A 5E6IB 3L5XH 3E8UH 4RBPK 4HS8H 4E2OA 1HXMA 1TQBB 4UIKL 4Q6YA 1CD9B 4RIRA 4WK9A 2C3WA 5F8RC 4P7NA 4YDLC 3RVVC 1A7NL 2Y5EA 1BAFH 1Y18B 3ZTNL 2DTMH 1KWGA 4U7KA 4HFUL 3H3KA 4MNHB 4PJDF 3ZT6A 3ZLQC 4HK0A 3JWOL 2VDMH 4ZG1A 1HVXA 3WBAA 4XVSL 4UDUA 2NX5E 3MRDB 2YD2A 5DD3H 1HEZA 3ELAT 2C5DC 5DUPH 3LMJL 5DJCB 1JNLL 2R0WH 3U7YH 3ZDZE 2XM1A 3X3FL 5I18L 1JPSH 4NKIH 2NY6B 2QQNL 5HVGB 1Y7VA 1X5AA 3CFJB 4RGMB 3I6KB 3O2DH 4K9EC 1GOHA 2FR4B 1F90H 4KKCD 3SDDA 5A2KH 1GUIA 3CFKB 5CD5C 4GS7B 1U95B 2GW5A 4NO5B 4R4BA 1SR0A 1INDH 1KPRB 4HJGB 5EDXA 4QRUB 5D2NB 2XICA 1NCBH 2F54D 2ZUQC 1YYMH 2BC4A 4PJBE 5LA2A 4OYUA 4OF7A 1MOEA 1ZT1B 4OZHE 1DN0B 1MFCH 3S35L 4HUVA 1R85A 5EB9A 1MJJB 4F58H 1R3LB 2GJ6E 1ZHKB 5C0GB 4FLQA 2R7EB 4QXGH 5F1SA 2LVCA 5GSVA 1HHIA 3GUTA 1OP9A 4I77L 4X0KA 1G9EA 1DWIM 1FP9A 4M43L 5GSRB 4G42A 4MNQA 5D8WA 1FFPB 4TOQA 1X5KA 2CK2A 4DKFH 3DSFH 1JTTA 3WKZA 3BSZH 4MAYB 4FFYH 1MAKA 5IT2L 5GIRB 1A6ZA 4ZE5A 4LCCC 3VD4A 3MNVB 2WSPA 2VAJA 2APWA 2QQJA 4MGSA 1GHFL 2W1UA 1CG9A 5EBMA 3WFBL 1UM6H 3VH8G 1FG2B 4WO4B 4ZSOE 3VWJB 1RIHH 1S7RB 2ITDA 2GK0A 2YEZB 4P2RA 2HTLC 2J47A 2EH7H 2MPAL 4L4TB 4N0UB 3NCMA 4GWJA 2XNAB 3LHPL 4WO4D 1ZHLB 2HT4D 4KGJA 4RAVB 5GGQL 4LCIL 3W39A 2C4FT 4MNLA 3G5XA 1RZJC 2ZG2A 4P5MA 1NCAL 1JHJA 4AMKL 3GNRA 3BAIA 4G7VH 4OZFG 5F6IB 4WDIB 1GAFH 5D6CA 4KI5M 3VXRB 3KXFA 1B6DA 5GRZA 5DHYB 5IM7B 5KN5A 3QG7L 5F9DC 3TJHD 1UG6A 4HK3J 1JTOA 3LRGA 3VXRD 3UJIH 4BS0A 4PLNC 1JU4A 1ONQB 1CN4A 3AOFA 2O5XH 1IM9A 1FGVH 3PQYE 3TTYA 1NCWH 1H5BA 5SWSD 1O7AA 2DJ4A 2X4QB 2R9HC 4LCIH 2O9PA 4GQ9L 4GMSH 4M93B 1NCAH 1KB9K 3GSNA 3DV4A 4PMNA 3P3YA 2EPMX 4XWOD 1IGJB 4HK0B 5LJYH 4U1GC 2DQUH 3BRGC 4RL3A 4PPTA 2ITCB 1E56A 2GK1A 2ORBL 2NPLX 2YK1L 3MRBB 2VDPL 4BCEA 3TYFA 4XUTA 1BBJB 1RVFH 2XVKA 3VFUB 1A3RH 5EA0L 5E56A 1DDHA 4LCWA 5KEZA 5I74B 4Y4KB 4CN4A 1U8IB 1DJSA 3UTTD 1FORH 1JD7A 4Q0XL 1YY8A 1OF3A 1KC5L 1FFQA 1OAQL 4Z7NE 1CXLA 2PBGA 1NKGA 4NO3A 4NUGH 4CUAA 4NRSA 3DYPA 1VBRA 4Y16A 3WE6A 1G0CA 3T4YA 5E0FA 2JEPA 4PTUA 4CKQA 5DTFB 1JP5A 1XH0A 4KRUA 5GNYA 3FQXB 2BFGA 4J3XA 4M9PA 1HEZB 1M05B 4HFWB 4OF8A 3UTOA 4GAYB 3PXHA 1RMFL 3GSVB 2QMKA 2P49B 4OD3L 4WU7A 2X89D 3I2CL 3REWA 3H2WA 2YA2A 1HK6A 4JQIH 1INEH 3UYOD 3GNPA 3PGDA 4FQ2H 1G7IA 8FABA 4W5UA 1GZQB 3ALXA 4JHBA 3D85A 4QDQA 4RQQA 1HHJB 2F9BT 2ZUYA 1A1NB 3FRPG 4NRZB 4XPFL 2XIIA 1OP5K 3VWKC 1AQDA 4HLJA 4NUJB 5F89B 1QBLL 1RJLB 1E6OL 3WL1A 1D5IL 4KU1A 3W37A 4Q74A 3U36A 2PI6A 3U2SA 1KTDB 3K2UL 3L3OA 4FQPA 1FSKC 1ZK9A 3AM8A 2VT0A 4Z95L 4YDLB 4CVZB 5ISZA 4ONGH 4H26B 3MS8A 1DEEB 4PS4L 4ZXEA 1B3JA 4HJJH 1N0XL 1Z0NA 3J8F7 2J77A 3U7YL 4JDZB 5CSZA 5DQJB 3ARWA 4BQ8A 5EU3B 1CGUA 1NUDA 3M45A 5F1NB 3EFDH 3UZEA 2Y1VA 5JW4Q 3BAEL 2ED8A 4HDIB 2XIBA 1U8NB 3H3PH 1DQJA 3L5HA 3K3QA 4G9FB 5DJ8B 4GG8A 4KTEH 4AD5A 3HR6A 1BJ1J 3PWJA 4TXEA 3IDNA 4FQ1L 4ATDA 2OSLB 2BX5A 1EOKA 4G6JL 1N0XH 1DQQA 3PWPE 2FEDD 2CXKA 1T1YB 2VB5A 3MCLH 3OWEA 4HWUA 3RIFK 4UAOB 3HNBM 2ZZUT 2WLZA 3CIHA 1K85A 3B4NA 3G08A 1U8OB 3VPLA 3QCTL 2EEAA 2PO6A 2X4UB 5B38B 2YDQA 1B4JL 2J2ZA 4TVPE 4Y4FA 4IIQB 5C3TA 3SDCB 3RKDD 3A6CL 4AEFA 4M81A 1ORSA 4JFOA 4NC0B 1NCDH 4KMLB 5HHNA 5BVPH 2AJVL 2XWBB 3I75B 2PB1A 2JE8A 4XBEL 1HHHB 4CN6A 2ZIDA 1OGTB 3ARQA 3WQ4A 2M8XA 4JDZA 5DQJA 2XQYK 2GJZB 1TJGH 2W0PA 3SKMB 3LMYA 4Z7UE 1T66C 1ZA3A 1MJ8H 2XTLA 2ZX6A 2FEDC 2OK0H 1F6LL 2W60B 4JDVB 4K55A 1P6WA 1JNHB 2X0HA 3D3VE 5CEXA 1E40A 2WW5A 1KCRL 3HNVL 1YMHB 5MEQB 1QOXA 4LASL 3SGEH 3FO1A 2PYEE 3QAZB 5ACZA 3UPRA 1UJ3A 5HHQB 3OKEA 4M8UA 4O58L 1LDPL 3HMWH 1NCDL 1RZIB 3MA7B 2R29L 2XKUA 2VIRB 3EDDA 2WB5A 3U7BA 1MCOH 4UTBH 3SEPA 3LDBB 4N8VA 1T5XA 3DIFA 5C09A 3U36B 5D9SB 4X6FA 2LFGA 3BMWA 3CFEA 4YHZL 5CWSA 3MLZH 4XB8A 3PV7A 3A47A 2V7NA 3QFDB 3P4OA 2CKNA 1HL8A 5D5ME 3IDAA 4XT1C 4MVBC 4DW2L 4WLCA 5F1KC 4HA4A 3BH9A 2Z4FA 5ERWB 1NBYB 3UZQA 3NSNA 4MYWB 5JMRA 2VJXA 5EU6A 1ADQH 3REWB 5GGVL 3KJ4B 2G9HB 3MR9B 1UY4A 1CE6A 4XPAH 3RWIB 4IRZH 1AHWA 4FHBD 4U1IA 2VDPH 3L4ZA 2F53D 2J7LA 4QLJA 3STBA 5CUSH 3ZKMD 5T1MB 3W0WD 2VN7A 5TE4L 4P5KB 4FQXD 2VQUA 4QRTA 5I74C 2WINA 2Q8BL 2OR9L 4ZNEA 4JM2F 1DYOA 4JM2A 1ZLSL 1SVCP 2Z1SA 2OCFD 1JUFA 1UB6B 4P5YA 4E8DA 5D7JB 3BHBA 3WQ5A 1TFHA 2WAGA 3V4UL 1XCQB 3DUSB 3KDMB 3UG3A 4XNXH 1E70M 3HUJA 1I85C 3HUJF 2W1QA 3TYGL 2X8RA 5J6GB 2OQJB 1P69B 3B6SB 5I5RA 4N90D 5KVDL 3W25A 3ECBB 4XCFL 5HI3C 4P2QE 4ZUWA 3BH9B 1AO7A 2ED9A 1BFNA 1XF3A 3NJXA 5F7WC 2BJMH 5C0DA 4Z7UF 1WFNA 1XYFA 5CJOL 3RVWC 3O9WD 4JG1L 3PWUA 2GDUA 4HGWB 1KG0A 5GRVK 4U6YB 4WFFD 1NDGB 1ZEAH 5A2JH 4AZBA 2W61A 2PWGA 3NAAH 2OTPA 4U6HA 3BXNA 1OTTD 35C8L 4KJPD 5F88B 1JK8A 1ITCA 3DUUB 1FSKB 1UXZA 3SPVA 1SY6H 3UPRB 5HI4C 2XNAA 2NW3B 4U6VH 5FB8B 2VDLH 5F97E 1RZIA 5HI4D 4DGVL 1QSEB 2WDBA 1DUZA 1L9MA 4TRPH 2VR9A 2X4RB 4ZAKB 1CG9B 4RRPG 2NY3C 1KGYA 3IF1A 1OTTC 5I1IH 5TPWL 3UP1A 1QFWM 5SX5K 4UZUA 3IXTB 1W1YA 2VXTL 2ESVD 3JWOH 1QA9B 5JORB 4E42A 2VVSA 3QSKB 3NACL 5EU7C 4NHUB 5K9QI 1MCWW 2A73B 3T65A 3EOTL 3ULVH 4MQXC 2QHAA 3ZTJG 3G6LA 3GBNH 2ENSA 1Z0MA 4ACYA 3G6JF 1MCFA 2W07A 5AUMA 1BP3B 1JWSA 5C7XL 1ZU8A 2DQJL 4KUCF 1DQML 5IWLA 4JRWA 3O4OB 3BXWA 1S3KL 4M7LH 4G6KH 4L8BA 5KVEL 3FO0H 2MJWA 3KL5A 3UPAA 2VVNA 5I1IL 1KB9J 5A8QA 3KS0H 1Q0XL 4KK8D 3WIHL 3MRIA 2BOBB 3RM4A 3CX5K 3V52H 2JJWA 1T0NA 4CMHB 1DDHB 1P84J 5DUBB 2IEPA 2PO6C 2EPLX 1MW2A 3KL0A 1JN6B 3GYCA 3PE9A 1DTUA 1ROWA 3CD4A 2XXCB 5K9KB 4XNQB 2LU3A 5LKNA 1NBVH 1Q4NX 4V27A 4XP4H 4QAWA 4IEFB 4JY6A 1QHPA 2C9KA 3OAUH 2Y23A 2X6MA 4L4PA 4EIZC 3ARDA 1MH5B 3CUPA 2H9GA 3MLTB 5JXIA 5D9OA 2P45B 3MLVL 4FFYL 2BY2A 3C6SB 4BSJA 3QAZC 1QKZH 1UG9A 4XCNA 4AZGA 5CP3A 3G5XB 2EXOA 3TBSB 5D72H 5BS0D 4PJXE 4QTHB 3B9AA 1I3VA 3LDBC 1HDMB 5F1OB 3RUGB 5EFIA 3CLEH 1IC4H 1RIHL 2E6PA 3IIIA 1YQ2A 4XP4L 1KTLA 3MREB 1V03A 3RY4A 1GXEA 5DWUL 2HJKB 1ZS2A 1RPKA 3K4ZA 1I8LC 1YEDA 1EO5A 5CFHA 5F89A 3NPSB 2O5ZH 1FLTX 4WW1B 1KR0A 2B4CL 2ADJA 2VLKA 4YUEH 4X7DC 1D2KA 2IWGA 4MA1B 1HH6B 3LEVH 5JOEA 1GZQA 1ZLWK 3PZGA 3TVMA 1G6RB 5T1KA 3PGDB 5GGVY 3MMUA 4NQCE 5I77A 1H3VA 1NOWA 4H5SB 5J11B 5JUEH 3TOPA 1FFRA 2JB6A 5I1GH 3GMQA 3OJDA 2EBNA 4HA3A 4N8VG 1DBKH 1HKMA 4J27A 5IF0A 4XVTH 1BJ8A 4YHNA 1KNOB 1WC7B 2HVKA 4P4KB 5AZEL 1WBXA 1R7OA 1ZHBA 2DT1A 3VNYA 4KVCH 3F12B 3VWJD 1RZ7H 3BAWA 1UD8A 5FV2A 4AM0A 3QFJE 5TQ2H 5MEOA 1PG7H 1KXQE 2JF6A 3B3IB 3WDIA 1ZT1A 4UB0H 4EDWL 4XURA 1HKLH 3WCYA 5IEKB 4XB7A 4MA8H 3MRGA 4OQTH 4PV9A 1LF1A 1QFWH 4O2FB 3E6HB 2ZUXA 4HX1B 4G6FB 3WO3B 1AXSB 1MIEH 5DJAB 1XCTB 4M6NH 2Z4QA 2LAGB 3ZO0A 4O51B 4X6CF 3KPSB 4HKZA 3ET9F 5A16A 4LCUB 4UQAA 5ESVB 1B0RA 4NRXA 1FGNL 2DLTA 4DXSA 4U7MA 3W53A 4JFVA 1FBIH 1RZ7L 2P5ED 4ZXBA 2DM3A 1LK3H 1JE6A 4HF5H 4MDIB 5E2JA 4XB3A 3FO9A 2FJGA 4XAKE 1B0GA 2AK4A 2R1WB 1KCUH 2XN9D 3FMGH 2C8NA 4D6FA 5EH1A 2W62A 2QHRH 3FT4A 3FB7B 1B2WL 3OZ9H 3ZSTA 1FIEA 3T09A 2J7MA 5FCUH 1OD3A 4YX2L 1UWTA 4S3JA 2R69L 1J01A 3H9YA 4BUGA 3X3FH 5FGCE 2X1IA 1WFOA 1R5WA 3JWDL 5JPMB 3W2DH 3T0WA 4XNUL 4JFFA 4I4WB 4TRPL 4MQTB 5FIEA 1BQSA 5E6IA 2CGRH 4PJ7A 3MV8A 3QDGA 2AEWA 3LN5B 3D0VB 1C5DA 1NFIB 1B3ZA 1DHKA 2H8PA 1AY1H 1IC1A 3QIUA 5I6XB 3E6FA 4LLYA 1KTKE 1YYML 4DZBA 1C5BH 4J4PD 1YEJH 1ODUA 2DPEA 2YZ8A 1Z9LA 5F72S 2WHMA 4HKXA 1PKQB 5D96C 1T1ZB 2NYYC 1DQMH 2BOBA 5L8LB 1E0XA 1IL1B 4UI9L 1KULA 3APGA 4LNVA 2UWEB 5CJQH 1NGYA 4E41B 4HUNB 4UNTA 4S2SA 5I1AB 5FA4B 4X0KB 8CGTA 4NM8H 3MNWA 3IKCB 1ZLWH 1S5HA 4HFUH 4RFNB 2ARJA 2NY7L 2A6KA 5HD8C 1ZVHA 1FN4B 1JPSL 3QIWB 5FK9A 4P5KA 4S1QL 1I1AD 1QLFB 4JVUA 4NCC1 4HXAL 4M7KH 1JG9A 4FTVB 1HNFA 5GS2D 4NKDA 3NFSH 5HHVL 2WP3O 3PNWB 3I9GL 4XBGB 3TNMA 5CINH 3ILQD 3I6KA 5L2KE 3BQUC 5FUCC 3D39D 4LLQA 2FHCA 5D2LB 2A0LD 2IPKB 1D7FA 4HUXA 4K9EL 4WJXA 2YBRA 4J7RA 3HE7B 5EWIL 4FMVA 5BXTA 1RFDL 4XAWH 4PJHE 5FGRA 3TIEA 3ULVD 2AJXH 4I77H 3O3BB 3NMEA 4KPHH 4OFPA 3A3HA 3EOAB 4A6YB 4JFQA 3OEBA 1BF2A 4KDVA 2GJXA 2M1KA 1EHAA 4MO3M 2OJZH 1HHGA 5DUMH 4AIZA 4N8VB 1T1WA 2HG5B 3FB7A 4BZ1L 1MCPL 3WN5C 3RDTB 3NCBB 5JOFB 4M24A 2EICA 3WQ8A 4ZS7H 3M1BB 3RVTD 2J8UE 1WZKA 3GHBH 5AG8A 3ULVE 2FSEA 4KDWA 4X5XB 1QLRB 4U1NB 5CJXA 5JHDD 4L4TD 1LMKA 4JFED 1DLFH 1BZ9A 5T1DL 1PW3A 4JJ5B 2X1QA 3OKNA 2VZVA 4UZGA 1BOGB 2WMGA 4NNYA 3QHTC 1UH3A 2YLLA 5EU4B 1ULPA 3K75B 4EJ1C 5GS0D 4LHUD 2JIXB 2EE2A 2VMEA 1HSBB 3SDXF 4U1SA 5ISZD 1FGVL 2NLJB 5IVXE 3CHCA 1NLDH 5IV2A 3HZMA 1CK0L 1TVBA 2AP2A 1D5ZB 1FRGL 1FA2A 2BOCA 4XWOC 1AD0A 1HH9A 1JDCA 2FHFA 2X4SA 4MAUH 2WW8A 3CIQA 4OBSA 2XG5A 5B22A 1RPQA 1CGSL 3T0DA 3KPOA 2VH5L 3VFPA 2XRAH 1HKFA 2ERJB 2H41A 4GFTB 2W4XA 1IKNA 3FRUB 5HDRA 3OKYA 3ALGA 2EDOA 4ZXLA 5CEZH 3VFTB 4EUPH 3TONA 5D1XD 3CAFA 1FFNA 1P7KA 2VR5A 3LN4B 1OLZA 1CFTA 5BO1L 4PMVA 4X6DF 4WNQA 1EIBA 1JHKH 2WSKA 3FTGA 5E0QA 1UZ1A 1UYQA 2VMCA 2CO6B 2YDSA 3GHEH 2ZKHL 3QDJE 4WTXA 5F9WC 1MCIA 3H9SE 4K3GA 2CDGA 1FAKT 4OV6F 4W81A 4H7VA 1IC5H 1KGCE 1NFDB 3FOMA 4LSSL 4OAWB 1WCGA 1XGYH 3ZE2E 4QRPE 2B1HL 1JGVH 5EO9B 2J88H 5MEQA 4AIEA 1DBMH 4OV5B 5AC4A 1V7ML 1V3LA 4JZOA 4JKPL 3EJYC 1GNYA 4S1DC 1K5NB 2BZDA 1M7DB 1CZ1A 1BGXL 1E4MM 4FMFA 5FUIA 2K7QA 1UH4A 5DD3L 5ANMA 3FN3A 4N0RA 5E9AA 3U0TB 5D6DA 5JR1H 4KMTH 2YUZA 4WRLA 4KTDH 4ZYKB 1WDQA 3NIDF 2XKNA 2Q86A 2EIEA 1K4DB 5GZOD 3LPPA 4S1SH 2VISB 4JFOB 1F3RB 5LXGH 1FNEB 5KAQF 2BNUA 3U4EB 4R26L 1T03L 3UBXG 2YRZA 4R8WL 5L2JB 4HOXA 2IPTL 5F71A 2WWCA 2YD6A 4ONGL 5FUCE 3O6MH 1YZZA 2H1PL 1KTDA 1WICA 1X5ZA 2IAMC 5L88L 5IMOA 3GIVB 2J7BA 4QRRD 1FJ1B 2WKLA 1CF8H 5IV2B 3H9ZA 3L4TA 2HYXA 4UMGA 2DLIA 2BY3A 2NXZC 1KGCD 1NGWA 3TZVD 1HI6B 4NQEE 1IGTB 3EFFA 3ZKND 1M71A 2LTQC 3MODH 3BUYA 3TWCH 4LCCB 4DFIA 2P8LB 5FECB 4WI2A 5GS2H 3DMMC 4R8WH 4AENA 5C0AD 3IJYA 4OM0L 1TNNA 3WL9A 3ZT5A 4F7CB 4OUUA 3GI9H 4KV5F 1CWYA 1BZ7A 2R2BA 4G7YL 4JY5H 5DRNA 1LJYA 3GI8L 1LEIA 1AD9A 2DM2A 5DK2B 4Y5YB 1EO7A 1QLRA 4U1NA 5H94A 3IVKA 1S7TB 4P8XA 3LKQB 1XH2A 4AK1A 1I4FA 4AIXA 3ZJ7A 5FYKE 3ZKNC 1GOMA 5HHXH 1UXSB 2WUBL 1Q9LA 2ZJSL 4JQXC 3RVWD 1ZT7A 3EYVA 1WWWX 3OAUL 4MD4B 1IGIH 4OCWL 5BW7C 3IJHB 1IQWL 4PV8B 4XAKD 4CDGC 2LW8A 3LKOB 4I1NB 1Z5LA 2B0SH 4PRIA 2JFEX 1DBJL 4ZZ5A 1U8MB 4DEPB 4W84A 2V6HA 4AWEA 5LBSH 4B0MM 3VGEA 4L4VA 4MNGA 3V5DA 2XGIA 2XTJC 1MHCA 2YR3A 3QOMA 4ZS7L 3ZZ1A 4UAPA 3QDGD 3WIIH 4LHSA 3EOAA 4A6YA 1TCRB 4EKJA 3FFDB 3OJDB 3T0BA 3GIZL 1L0PA 3WKML 1A6TB 5T1KD 1OW0C 2NMSA 1A3HA 4QDRA 2HTKD 5LCWL 2Q8AL 3DURA 2WUCL 4J1UB 2AMGA 4UT6H 4NQVA 2WWKO 2A6IA 1IGIL 3KPTA 5T1KB 2PO6D 4DFHA 4GQPH 2HTKC 2IQ9L 4YQXH 1G7IB 5G05L 3O4LE 2C4XA 4RDQF 3HR5B 1CICC 4WI8A 4W5ZA 1BQHA 2QKIB 1ACZA 1JHLL 2DJSA 1B3XA 3K46A 1P1ZA 1TPXB 2D3VA 3ARVA 1M6OA 4ELME 1RURH 1HYRC 1A0QL 4A41A 4L3AA 3AS2A 1LVEA 4ZPTB 3F5KA 1NUKA 3WMBA 2FEEL 2CRZA 3BKYL 4WU5A 5EO1B 2HJFA 2FECI 3VGAB 1RZFL 2H2SC 2GK2A 1CEOA 2N1KA 4NDMA 3UZVB 1JUFB 4ZOBA 1N6QL 3ZMRA 1UT9A 3ETPA 4TUOB 2ZSVB 4ZOAA 3TYFB 2W94A 3UXFA 2H2SD 3FQUB 3AAZB 1LP9F 5DR5L 5T5NG 5CZXC 5F7KC 5CEZD 4JHOA 1L7QA 3MROB 2D9QB 3WUGA 2GCYB 3W11D 3EKCA 5C8JA 4FRWA 2V5MA 1VSCA 3FZUD 4Y88A 4CMMA 3IKCA 2AVGA 4P46B 2QR0A 3TA3A 1UWQA 2CMRL 3S34H 3TV3H 1G0XA 2KKQA 4ALAL 1Q9OB 3DRQB 3QNZA 3QFJD 4JG1H 1UR9A 2HYMA 2OWXA 1O8SA 1ZVSA 1L0QA 3O6KH 4UINH 5DMKB 5IOPB 1DE4B 1BG9A 1JZ6A 4LU5H 4MD0B 1CENA 1BM3L 2O61A 4MB1A 4X83A 5F70A 4DUXA 3DHPA 2CLZB 4FQCL 3CQOA 3NCCB 4HJ0D 1TETH 1F4XL 5IM7A 4Q97A 3VXSA 2GJRA 1FGNH 1ZLUH 1MWAB 2W1WA 3LQCA 4QHKI 1TZIB 1M7IA 4UTAL 4NQCD 1XZ0A 5E8PB 1MJJA 1MQQA 5DGRA 4XNXL 3HE6D 1T4KA 3HZVA 5C08B 3RGHA 2O9RA 4RX4A 4NFDA 1QNQA 3EOBA 1S7SA 5JZ7D 1OAXH 1JNDA 1QSEE 5FF6B 3ABZA 2OXHA 4I4WA 1QPPA 3DJ9A 4U1LB 5LCVL 5L9DH 4WWKA 3SJVE 3H42L 4OLXL 4GIAA 3OKLB 2EDNA 3BH4A 1BGXH 2OR8A 1P7QD 3AMGA 3EOTH 3CH1A 4OGAC 4UQ2A 3MMWA 4M6ML 5I1JL 3U2SB 1LNUB 3QJFB 5JO5B 1F3JB 2WMHA 4LSTL 3QR2A 3VGFA 4H20H 4QTIL 3GJFH 4PB0L 5IB3B 5IB2A 3DX9B 1BWWA 1FLRL 4G6FD 3MNZB 1A4KA 3LSOA 3TZVC 5BS0E 2WAAA 3ACHA 4NO0B 1QNPA 2NZ9C 4G6KL 2I5YH 3NPZB 5DJCA 4QRRB 4BFIB 3AREA 5TQ0H 5HYJA 3IFNH 1KCSH 1BOYA 5MENA 2C3HA 5DMGC 3EYOA 4PJDE 2NY6C 1OF4A 1GOWA 4ZO6A 3C09B 3KAAA 1IV8A 3WYRA 4U6VL 5GGRB 1OGBA 1JF5A 3PP3H 4MMXC 2KD7A 3LS4H 3ZSSA 4IIQC 2AS5M 1E55A 1QD0A 3HPJB 4CGTA 5LQBL 4HIIB 1F58H 4X80L 4TN9A 3UTPD 3T2OA 4YFEA 3GGLA 4MQSB 1DVFA 2R4SH 3FB8B 4XVUC 1ODAA 4RFOH 2F8VA 2X9WA 1HL9A 3NQHA 4TOYL 1HZHH 3BIAX 5DQ9A 4MVBD 2CD0A 2PW2B 2Q6WB 3WS3B 5BYWA 3L3DA 3IJHA 5EZIL 4GW5A 2UY7A 3WSUA 2E40A 4AD2A 1OGAD 5BXFB 4YNYA 3DWTA 4K3HA 2O61B 2XWDA 5IMKA 2DSVA 3KLAA 4L3ED 3QT2A 2J7GA 2IGFL 2ZPKL 4H5SA 2BNRA 2BNJA 3HNVH 1CZTA 2ARWA 2JB5H 5DURD 4JY6B 1E4WL 4NCC2 1XCWA 2ZUSA 4NQXB 2J8GA 2NW2B 4W8AA 2HMIC 4ZXOA 4MNHA 5E2WL 3NYDA 1AMYA 3B9EA 3G6JE 1T2XA 1OIMA 5IEKA 2JIXD 2WVVA 2W9EL 9CGTA 5D1XC 5I1EL 3OKKB 5FYJE 3WIIL 4X4ZA 3QNXA 4Y16C 5MEOB 4ZZ8A 3RY5A 1RSFA 5IKCA 3BX7C 2XTJB 5EC1A 4PJAB 3KYMA 2WP3T 1X7QB 1MFNA 3P40A 4U2YA 1IEHA 5TF0A 5J9PA 2D7QA 2P46B 5HI5D 3OXSA 1HDMA 1CZ8H 5F6IC 4RGNB 1AP2A 3RBGA 2MQ0A 3ROOB 4PEEA 2OJZL 4H25A 4R97C 4PTXA 4HV8B 2PWDA 3MTRA 4LVHC 2B20A 1NGQL 1J8HA 2HRLA 5C6TL 3TH4T 4JAMA 1RURL 3L1OL 1A02N 1FDLL 2AXFB 3BP7B 2HH0H 5CS7A 3CC5A 1KCVH 1PZ5B 3VM7A 3VGBA 3BOVA 2P7TA 1NP0A 3MLYL 1WDPA 3DX9A 5HGGS 2E7LC 3GBDA 2DCKA 5ICXB 5D2LE 4DXRA 3BKMH 4OFVA 4JFDA 4ESKA 4QRRA 4PJFA 4PJFF 2C0HA 1DLFL 4F3FB 3V6ZA 1CFSA 4M02A 1NAKL 4LSVH 3KPSE 5H37H 1OP5H 4OV5A 1F4WL 3PHQB 2BSSB 4WJ5A 1EFXA 3L95B 5DQ0A 5GS1C 2YFUA 5A8MA 1SG3A 2MCPH 1D9KD 3S8WA 4XCNB 1KCVL 1FNFA 4OD2B 1W8OA 4R4NC 4YFLI 2FIKB 1XZ0B 3QDMA 3MYJA 3NH7L 3O8XA 1S9YB 2QQNA 1WCBA 1KG0B 1TETL 5JXAL 2A6JA 2PF0A 4EI5A 5FHBL 5HSFA 4IOFC 4FN0A 2VERN 3O4OC 4XUPA 4NN7B 3L5XL 4BM7A 2WHJA 4ZE4A 5TDPB 4EI6A 3FHAA 3QUKA 3MUAA 1P2CB 4YHYB 3PUCA 3SCVA 3HC4L 2IANE 2VLLB 2W67A 2YMXH 1BAFL 2OKXA 5D6CB 5KSBE 1H3PL 4Y4FC 3H42H 3RL2A 5CSUA 4KI1A 5GGTL 1E3XA 4UFLA 5A2LH 1ETZB 1N5AB 3UTSB 3D39E 2QV2A 4J4PC 2VO5A 5ICYB 2VUYA 4Z77A 4OCNC 2Y5TB 1S7XA 4WWID 4JPIB 2MSPA 1E4LA 2UY4A 3OLGA 5MHSD 4NZCA 4WHCA 1OB0A 3BLPX 3IFNL 2GTZB 1W1VA 1V7MH 1FYHB 3OGRA 1KB5A 4LLWA 1D6EB 4YXKL 1J0YA 1ORQA 2NY7H 4DCQA 4OKVA 2H32A 4PJ5E 1E6ZA 3AIEA 4X6CE 3IF1B 5T3XD 2R69H 3F7VB 2MTPA 3NUKA 2R23B 1B30A 3C6LA 4X98B 1OAZH 2FX8L 3ARFC 2D4DA 3L5IA 4L8DB 1ORQB 4DCQB 5C0NC 5LA1A 4WTZG 1RUAH 5DT7A 1BQLL 2ZP0T 3QWRD 1VACA 5BMFL 1F58L 5HDOA 1G7PB 1CVRA 5JNYB 3VNZA 4PGCB 4OGXH 3ZDXF 3GO1L 4WCYH 4MA1C 2AAVA 3BPOB 3IDXH 3VRIA 1A3QA 3DURB 4CD5A 5E70A 3H7BA 1OOAA 3JXAA 2VITA 4P57B 3VIOA 3FFDA 3K81A 4TOYH 1HILA 5DK0B 3D5HA 2P42B 1FYTB 3BGAA 5FOBA 5I1CH 3MBXL 2RQ8A 2NYYD 1J18A 3U57A 2FHBA 3DYOA 1A22B 2B2XH 5BRZE 2A83A 2Z8VC 4X6EA 1AHWC 2CUMA 2WZ8A 5DRZB 2IANA 1A7PL 5DJDB 2J4GA 3WD2A 4IRJD 5A69A 5KVGH 1CIUA 5EIYB 1B3VA 4YE4L 1H41A 1JJUA 3ARRA 1JNHA 1BZ7B 1G7QA 4D9LH 4J8RA 1J8KA 2BFVL 1X4XA 4CDHA 4QB1A 1JNNH 3R1GH 3QDME 4CJ0A 5D7LA 3IETA 4Y19B 1E71M 3OQ3B 3LD8C 4MXWL 5CKAA 3FONB 1SJVA 3QPQC 3QIWD 5HBBA 1H2JA 2RR3A 5I66A 4M4RA 1JMZA 2IJ0C 1W2PA 4MNKA 3K8KA 1VJZA 3WFEH 4HBQA 3SDCA 1RZ8B 4XRCB 2UY3A 3PF2A 3QCVL 1LP9E 4PD4J 4YE4H 4LNRB 2O5ZL 1H0IA 1LDPH 3HMWL 4NQTA 4P02B 3DVIA 4M56A 3H7BB 3NABL 2R15A 3IANA 5KSVA 3HI1B 1EA9C 3W29A 1OP3H 5HYEA 5J11C 2DLFH 4AYSA 1U6AH 3C2AL 3ARED 1UR1A 1OWQA 4ZDHA 3T8XA 4QO1A 1CL7L 3WKMH 3JV0A 1FCGA 2NY3D 2XPKA 4TX8A 4N0FB 5JW5B 1TUXA 3AIUA 1FL3B 1RAMA 4A2MA 3C7EA 1DBBL 1FNEA 1L7IL 3JV4B 2WQRA 5FYLD 5GISH 3S36H 3UR7A 43C9B 1CLZH 3CVHB 3UTTB 1NH6A 5I8KH 2IXVA 4KVCL 3PN8A 4OGZA 1SBSL 1U3HB 1C7TA 3CSYA 4NPYA 3SDXB 4D3CH 4NZUL 5CJBA 3RY6C 3WFCH 1L7TH 1P6FA 3SBWA 3VDHA 1BGGA 4LSRL 2CH8A 3WN6A 2OS7A 3D18A 3LKPB 2AI0H 2YKLL 2VIRA 2GK0B 3MBWA 1RZFH 1MSPA 5ENWB 4UQ3B 1FG2A 4YHLH 3HU7A 1YN7A 5EBLB 2X1OA 4PJBB 1M7XA 4XTRD 2VL4A 5D7JC 2V2TB 1IFHH 3G6JA 3NVQA 4H1LH 2J1AA 3QEGL 1GC1H 3FONA 1G7HA 4LLAA 5AC5A 4KJQC 1CS6A 1S7VA 2NW2A 3L9RB 4WHYH 3V4UH 1CBGA 3MRHA 2A74B 5M7QA 2YOCA 1IC5L 4LSSH 1B3YA 2A6JB 3O6KL 4Z76B 3K2UH 3B2VL 4U2ZA 2YKLH 4I2XE 1S7VB 2ZUNA 5GSVB 3WQVA 3U5YA 5HGHA 5I1KL 4LSDA 4R7DB 3WBEA 1FZKA 3N1FC 1SYTA 3FZUC 1PKQE 2NY2D 4YO0A 1W3JA 4Q6IC 3FXYA 2VL5A 2EO7A 1Q1JH 4KKNA 4Y4FB 1FN4A 3QHFH 4O51A 5KSAA 1UKSA 4KTDL 3QEGH 1XH3B 1TVBB 1QW9A 4QT5B 1OCQA 3SGJC 3L4VA 1YMME 4S1RL 43CAB 5D9MA 1EEYB 4F7TB 2D20A 3QEQE 1SYVA 2UY6A 1NGPL 4EVNA 3MKKA 4NO2B 4NUJA 5CSGA 2AJUL 1GOOA 5LCVH 1WZLA 1U3HA 2XHNA 1IAII 1H9VA 4JANB 5FHAH 5EFDA 2CUIA 4GBXB 5EUOE 4LGXA 3D85B 2DSKA 1C5BL 3CFCH 1ZGLM 3LKRA 3UTZA 1T22B 4Q9QL 3EO9L 2VCAA 1FL3A 3SKVA 1K8IA 2VX6A 1AGBA 2OP4L 5E2UH 3M7SA 5C92A 2PN5A 3HAEB 3GTNA 4PSRA 5LGJB 3RVXC 1I1RA 4HFWA 3MODL 4OGXL 1QVOA 4ZUSB 1WIUA 5DVOA 3C6LC 2EDXA 2QBWA 1V0LA 3CHDA 3CFBA 4OM0H 2YRLA 4MCYA 4B16A 3VIPA 4P7LA 4MD5A 1AP2B 1TITA 4PTMA 5CSYA 3WD1A 1MFCL 3S35H 4EZMA 3VXOA 3OXSB 4PJEB 2PTUA 2YD7A 4NRZA 5DFTA 1V8HA 4M7KL 3FT4B 4F2MB 1K3ZA 3S97C 1OB1B 3QCUL 4CADB 1G9ML 2ZJSH 1FH7A 1HX0A 5C0JB 4U5IA 3RL1B 4ODSH 3JTTA 4QHMA 1C8YA 4G80A 5T3XL 1MCJA 1SEBB 4TSBL 1A3LH 1ZGLA 3QQ4B 5I16B 3IJ8A 5JW3L 1JYVA 2AJSL 3CUPB 1JNNL 4MJIE 5A2CA 1FC1A 1CGYA 4WFGE 1H6YA 3P4NB 1V3IA 1UFUA 3QHZH 1RFDH 4PRHE 4XZUA 2CEQA 1AIFB 3WEMA 3VU2A 2D03L 1EO8L 2IH3B 1WIOA 4PLJD 5K59F 3EO1A 5IK3B 1FVEB 4G42B 4XPGL 3OB0K 4TTDD 5AZ2L 4JO4H 2DT0A 2FYYB 4OIIH 3C8KA 1F02I 4NP4L 5J7CC 5T3ZH 4AZ7A 3WNLA 4ZS6D 3VG9C 4HWBA 3MROA 5CBAA 3WDHA 1WVZA 1OPGH 3OBAA 4DGYL 5SV4A 5F96H 4NF7A 1R5IA 4WUUA 4EEEA 1JDDA 3I2FA 4RZCA 3NGBC 5BZDA 3QEQA 2DD8H 4KHXH 1IKFL 3ULUE 4NQDE 3SIMA 2D03H 4I48B 3GHBL 2QQKH 1G6RA 2YHGA 1E4IA 1QI5A 1UYWL 3TVMB 3S88H 1HCFX 4PREA 5DXWA 1SEQH 3ZKXC 3KR3L 2FR4A 5DJ2B 1ZLSH 1G01A 1RJZB 4OIIL 4ZTOL 3S6TA 3LIZH 5EMYA 2DDXA 1DLHA 4U0RB 2AV7B 2R2CA 1MXGA 3IXTA 1A8JH 3REVB 4MADA 3D25A 4UFHA 2OR7A 2R2HB 2VURA 5C6TH 3BP7A 5DJ2A 1OPGL 3LEYH 5LGKA 5C6WH 1E28B 3MC0A 3B9KD 4CU8A 3AYSA 3ZE1E 4UQ2B 2XY2A 4EOWL 1R3KA 4P5TD 2DIJA 2AI0L 5B21A 3VGGA 3F7RA 4N0YH 1ZGLB 1XV8A 4QCEA 1NSNL 4LAQL 3CPUA 4KK9D 5FCZA 3TPUA 5C0BB 1ESWA 3VWKD 4DGIL 1C5DB 1NFIA 2FGZA 1AXIB 1CFQA 5C0BE 3MV8D 5D4YA 3BD3A 1EDTA 3U9PH 2QMJA 2C9AA 3T0EA 1X1NA 1F4WH 4PRHD 2I27N 2WIMA 1MH5A 2G5RA 3DSNA 3EB7A 2LABA 1W2KT 3EYFB 4F66A 1ZVYA 4ODWA 4MA8L 4IJ3B 1PAMA 3FO9B 2A3HA 5IR1A 5I1KH 5GRVL 2OM5A 3I6LE 4YHOH 4HXBL 2Z0BA 1Q1JL 1OW0A 4K7FB 2Y8KA 4RAUA 2XT1B 3KPRD 4X5WB 1OD7A 1A14H 2PYED 2VDLL 3AMKA 4JRXB 4C83A 1D5MA 5DJAA 5GGSA 1LK3L 1TA3B 1ZHKA 3TH2T 4YNYB 4ETQA 4ALAH 4N9OB 2QBXA 3RNKA 1FO0B 1CICA 3CK0H 1JVKA 3C9NA 3HFMH 4CMMB 2BHUA 1UCTA 3KPRA 5FL0A 4ZAKD 1DQLL 4HX1A 1KIPA 3NCFB 1BD2E 3V6OA 5A6KA 4LCYB 1MHEB 4HXBH 3EYUH 3PTKA 2VZQA 4DM1A 2MCG1 1WC7A 2HVKB 4P4KA 3BQUA 4KJWD 1S7WA 2DT3A 3HZYA 1BQCA 3ARXA 2V7HA 2YWZA 3HC3H 4LPWA 4M7ZB 1MY7A 1CGTA 4M5YL 1FVDA 1P5VA 3ARBC 4U1IB 1H11A 3V6BR 4HTYA 2RVAA 3GXIA 5J3HD 3MRFB 2IADB 3O45B 2IAMB 1N4XL 2VISA 2OL3L 1VEPA 4MQ7B 2V3FA 1K8IB 5GRYA 4JB9H 4HV8A 4W7UA 3MRFA 4GI8A 1LL4A 2XFXA 1L4IA 2VCBA 1WZ1H 3CUFA 4NNXB 3ACFA 2E32A 2VXQH 3FQTA 4N9GB 1L0YA 3PP4H 4PJXB 4A4AA 4U1HB 3SCMC 4AZ8A 2I9LA 1R3IH 4YDVB 1X5JA 2AJZA 3LEXB 1V0KA 3W0WA 5DRXA 1V05A 3BIKA 4ODUB 4CU7A 4A44A 4KKAC 3GO1H 1D9KC 1F4AA 3EYPA 3ZQ9A 4LSPL 3ALWA 2C26A 3QDJA 1EUUA 4Z5RB 2AABH 3SY0B 5BRPA 4XZUB 4D6EA 1X9QA 1UGNA 2IFFL 5IGXH 4P4RA 4FZEL 3BUTA 4K94C 4OMDA 4D8PA 4A3YA 3FKUS 4YK4C 3C60B 1DWFM 3O81A 2GT9A 2JIWA 3RDKA 1JCKA 4KVNL 3ZM8A 3AHZA 4AG4A 4TUJB 4X9BA 2C7FA 3MBED 3D1MC 3CVHA 3I2HA 5I2UA 1LO4H 2VXSH 4L8SB 4PY8J 3VXMD 2ZEYA 1EOMA 4P2OC 4PJCF 5KTEL 4PJCA 4TNWF 4Q9CA 3SE8L 4P9MH 1C91A 5JBFA 1KJ3L 4JO4L 3T0EE 1BYAA 4R0LA 5IR1B 4KKLD 4PYSA 4CU6A 1KPUA 4XWGL 4G8GD 4U33A 5F3BA 2V2TA 2Z35B 4U1JB 4JQVA 4YHZH 3R1GL 3QNZB 4POYA 1NOUA 3HI1A 4PJHB 1T7WA 1EVUA 1LO0L 3I50H 4BZ2H 3A6OA 1ZLUK 1DBAL 5AUMB 3HCVA 3GMRA 3PHOA 3S88L 4OCMC 4ACZB 5C07B 1VFAB 1MIML 5HGHB 4OZFA 1MCPH 3SCTA 3SKOB 4W6WB 3KVQA 2D7PA 2GFBA 43C9A 2J8OA 2VLRE 2J8UB 1V3JA 5JOPE 2ORXA 4LAJH 3RTQB 1TDQA 3G5ZA 3V0WL 4D6IA 5CGYC 4ETYA 4I9WE 1BQHB 3WXVH 3VD5A 1YQVL 2AV7A 3AIBA 1YA5A 5EU3A 4QRSB 1BPVA 3AHTA 1LQSR 1DBBH 5EN2A 1ECEA 3NCYP 4HA1A 2Q8BH 5T1DH 2YRPA 5FYLH 4HIJB 1QBAA 1MVFA 4JM2C 4UQ3A 4JEGB 3D69A 1JMXA 1RIUL 3QH3B 4G8GE 4DKDC 1D5XA 2G5BA 3ESVF 4JL2A 2G2RB 4X4YB 4ODUA 4APQB 2GJXB 4KK8C 3PDDA 5BRQA 2E7CA 2XY1A 5D2NC 1M1SA 2V4VA 1T89C 3QXAA 4ZO8A 4OI8A 4POZD 3NNGA 2WABA 2I9LB 3P6BA 4NBYB 5E8PA 4TUKL 1H3PH 3GEWB 3TO2A 1QSVA 2FX7H 5TDOA 5J0BA 4Z76A 4I8DA 5B3JE 3U46A 1LE5B 5JDSA 1F4XH 4M1RA 4PJFE 4F7EA 2ERJC 3JV5A 1TZGH 4QRRE 3CSGA 1M04A 4CD8A 1VGEH 2AXHA 2IAMA 1ODZA 3T3PE 3OZOA 4KROB 2HFFA 4DXTA 4UOQA 3CUHA 5CKGA 2CKBA 2HKHH 4J12A 2IMNA 3KDMA 4WFHD 5T5FH 3B2VH 4P0DA 5A94A 2VI0A 2BVUA 2ILLA 4ZXBD 4YXKH 4Z7OF 1OQOA 4L3EB 4X0VA 1PX3A 3A6BL 4G6ML 2NY6D 1JD9A 2CBUA 5I1JH 3S96B 4QF1A 1JNLH 1U58B 4M29A 4QRTB 4M8QA 4YHPB 3SN6N 3VX0A 3VXQA 4V1DE 4D0CA 3V5KB 4NQDB 4X6BB 2NLJA 3B2UD 2MWCA 1UB6A 1VFUA 4GW1A 4PP1C 5L7XL 4Y19A 3O2DL 1JBJA 2DL9A 2WM0A 4L9DA 3UTSA 5EOCH 5C86A 1WLHA 3CGTA 3GJEB 4JFYB 4XCEA 4LYPA 3VXUA 3UESA 1KCSL 1N7MH 4HH9B 2XFRA 1INDL 4NM8L 2ZUMA 7A3HA 5D1XB 4R96A 3C09C 4PRBA 2PCPB 1R3JA 1MQRA 1CTNA 1ITBB 4DJMA 2E0PA 4NNPH 3DVFA 4PJ9B 3RJQB 3WMCA 4HC1A 2QQKA 2FSEB 3BEWA 1CE1L 5FYKD 1FO0H 5IESL 2F8XC 1FL5B 2DQJH 1ONQA 2JF1A 2HG5A 3WLWC 3FO0L 4H2CA 1TCRA 5JDSB 4RRPA 4KGLA 5CINL 1F97A 4O02H 5KVGL 4P48A 1W9BM 3DIFB 5C09B 4Z7WF 2F5BL 2IG2L 3LRHA 5TE6H 1I9IH 3GM8A 3RGVC 1D5XB 2G5BB 5IB1A 4G8IB 1JGEA 4LLVB 2R0LL 3OG4B 4YGAB 2F74B 3OJVC 2DQDH 3PL6A 3QUZD 1UKPA 4HCRH 1FO0L 3HEIA 1F3DH 2IQAA 5ID0A 5EWIH 4ZOEA 3ROLB 4ONHB 4JCMA 1C5CL 2EKSA 5HGDB 3D69B 5IBTH 1G7QB 1A7RH 3BRDA 2COQA 4L9LA 2Y6KA 2FBJL 3LKQA 1B0IA 1E28A 1EBAA 2DDUA 5DMIL 4WUKL 1QRKA 5D8JH 2AJYH 1R3JB 4F37K 1V3MA 4OUUB 4C57C 5I71B 3C7FA 1H5VA 4M1GH 1A6UL 4X7CC 2IBGA 2FBOJ 4XWGH 3UAJC 2HKFL 3ARYA 4WEBL 5D72L 4LCCA 2DLFL 4OIAA 4XCCH 2YZ1A 1TJGL 5D5MF 4DN3L 1JPTL 3U7VA 2NY0B 5M94B 1BFOB 3BAXA 1TVNA 1J8HB 1LO0H 4TNWK 5J8OA 1AKJB 1CZVA 4ZFZA 5ADPL 4NM4H 4N8CH 5KOMC 1BX2A 1LO2L 1DP0A 1EO8H 3OKOA 4R97B 4GZ9A 4FZ8L 5HVWA 3EDFA 3PV6A 1GQLA 5I1AA 1KXQA 2QLYA 4GMSL 3OGSA 2XFYA 4U1JA 1DQQB 4TQEL 5I19L 2B0SL 2BRQA 1I75A 1QHOA 1ZXQA 2JD9A 2OSLA 3O2VH 3VW3H 2EYTA 2X4PB 4MA7H 1UD2A 5C9KA 1L7TL 3SQBA 1NWUA 2BVPA 1XR9A 5KSUB 3MO4A 3P11H 2CPUA 2VCCA 1EXPA 2XFFA 2JJUA 3DECA 1UR0A 2W91A 4R2GD 3RTQC 3IDNB 3OXRA 4HU0A 4B9YA 3UTTA 5GGRY 1U93B 1FH9A 4XI5D 3DX8B 1UYWH 1YHTA 3QCVH 2BK8A 1WAAA 1UACL 4ZPVB 2OSWA 1DEEA 4I3SH 5EZJB 3QQ3A 1OQXA 2ARJQ 1LWHA 4Q7NA 2Q1EA 4BQ3A 1YNTB 4F9PA 2VABB 3QDJB 1PG7L 2JLLA 4PMXA 1TJHH 1U8QA 5E5RB 1UWWA 5FUOL 1BJMA 4PJIA 4AEHL 4WJ5B 1HKLL 5B39A 1CGXA 3VTRA 2BGPA 3FAWA 2WMJA 1C08B 1KIRA 4TUKH 1EEUA 2V5TA 4XP1L 3WLWD 3NFPB 4G8GA 3RWHA 2GSIB 4PJXA 4NN7C 3MXWH 2BVOA 6A3HA 1UACH 3THML 5L2KB 4GO8A 4AD0A 3HNMA 1QEWB 1VB9A 3GHEL 5SWSB 1H3GA 4JFWA 3QEUA 3SDCC 3AISA 1J1PH 3C6SA 3VXMA 2Y6SD 3P73A 4OCXH 1YECL 1Q0YL 3ARDD 1CDGA 2NXYC 4LPLA 2QSTA 3PWNA 2UYLB 1XF4B 3RWCA 5GS0C 3MRQB 4OZ4B 4I2XB 4XTRC 3E6HA 3MV11 3BAKA 1UVQA 1S7WB 3BW9A 2P24B 3WFHB 4YBQD 3PQYB 1BZQK 3AY4C 1OM0A 3AMCA 3H9HB 4HWNA 3EBVA 1CXKA 4OFDA 2EEXA 1AE6H 4Q9QH 3EO9H 2WMKA 3MSDA 3EYSL 3C8KB 3MFFA 3VG0L 4DKEL 3F12A 4GW4A 1ZSDB 3PZMA 1JHTB 4I18A 1MPXA 5EOCL 5C07E 4MAYC 3T4AB 1OAXL 3HRZB 5DHVH 1MHEA 2DTML 1ZSDA 4WW2F 4IISA 4W7VA 3K77A 3SBWC 3QUMA 2JB6B 1D6VH 2VLRB 2IH1A 1IBGL 4L1HA 3EMZA 4C7FA 4XPBL 4NNPL 3PJSA 3S37L 3DV4B 4PJCB 2VX5A 5GRUH 2X1PA 1NKOA 4QX2A 4Q58C 2NY2B 4L8SA 5CP7A 4PJCE 3L4YA 2A73A 3T65B 5MP6H 1A2YA 2GI7A 4GRWF 4G80B 4L8DA 4M5YH 1B4JH 4YHIA 2N4IA 1QW8A 1GU3A 1QR4A 4XC3H 3D87B 1HH6A 2BNQA 5A6MA 4ZUVA 3QEUB 2WN3A 2CIIB 1XNTA 2WMPA 1EERB 4P3DB 3ULVL 4WF7A 4OJYA 3QDHA 3CFCL 5GRUL 4AEEA 1O0VA 3QJFA 4HCRL 3CUIA 3AXXA 4YDVA 3D85D 5EIQA 2I9TA 1LNSA 4QXGL 1OTSD 5A8PA 4CVUA 2GCYA 1HJUA 1EHLH 1S3KH 2APBA 4M7LL 5LQBH 1KN4H 1CD8A 4MQXD 3IDJA 4UBDC 4LYRA 1UX7A 1I1CA 4PYHA 4HGWA 2WWMD 3SGJA 1E4XI 1NC4B 2OX5A 3VXPA 3H3BC 4O58H 1W72H 2PWEA 2ITDB 4P2RB 4UOZA 3ES6B 1XD0A 3FOLB 3B8YA 5IHUL 1HZHL 4AZCA 1J9CT 2H9GB 1IGCH 2BVYA 2CIKB 3IDIA 4X7TA 1GSMA 4FQHA 5CZKA 2XZZA 4P2QA 5I71C 4GW5B 4HPGA 3TN0C 2R2HA 1CLYL 1OAKL 4UQDA 4ODTL 5MEPA 1UM5H 3W81A 1A6ZB 5L0QC 4PJGF 2DD8L 4KHXL 1CGWA 3GZAA 5ADPH 1OINA 2X0YA 4RZCB 5F1IA 4OCRL 4XNYH 5BZWA 4ZUUA 1P7HL 1NAEA 2WO1A 4GJTB 4D6HA 4M82A 2W9XA 3P2TA 3KPSA 1CQYA 4F57L 1OARH 1G7JA 3CDFA 4JREB 4GAJH 1NCCL 2GJ6D 4V2XA 4QB6A 1T20B 1AKJA 3RKDC 3S36X 4ZNEE 3EHBC 4AZ6A 3G6MA 3WN5A 5FFLA 4IRZL 4YEEA 1EUTA 2X1WL 1BVKA 4I3GA 4G6AC