3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
3WNOA 1VACA 4JRXD 3CPUA 4S1QH 5BZWB 2YDSA 3C5SB 1V8HA 3RNKA 4K94C 5A6BA 1RFDL 2XNAB 4ACYA 3I9GH 4Z2GA 2ZJSH 4KK8D 2E40A 1DDHB 1I7RA 3SKMB 2CESA 4YIQA 3Q6GL 4R4NC 1A3HA 5TDNA 1EX0A 2CKBH 3BP7B 2Q6WA 4UQBA 3LKSA 4HUXB 4LHUD 1U8QB 5JHDE 1NKGA 1XPWA 3FQXA 5DGRA 4X9FA 1RZJC 2XSBA 5TDPA 1LP9F 2GFBB 5E2JA 3SCUA 5L2KE 2IMNA 2AJVH 3DVFA 2VXVH 3DVIA 4N0YH 2VX7A 2DLFH 1OF2B 5MEND 4GG6B 2R69L 1BFOA 5EU7C 2HAZA 4MNQB 4XZBA 2J78A 3N9GL 4JRYE 4N0CD 3HZMB 4L8BA 3NDZA 3HG1A 3MUJA 3D6GA 3QXTA 3KPPB 4DM1A 1K12A 1E1FA 1I5PA 5HBFA 1MRDL 2VQUA 3MLWL 4WV1A 3RDTB 5BRPA 2LU3A 4O4YL 4PY8J 4JCMA 3RVVD 1WFTA 2MWCA 3HZYB 5BQ7B 1U2CA 3I6LD 4XCNB 4RMTA 1VGEH 4TX6A 3VXUB 2ATKA 1JGDB 3O3DA 5HHQB 5J1AB 4MQ7B 5JW4Q 4P2QE 1E72M 4BS0A 3VKKA 1MQ8A 3SCMC 4XMPH 1YECH 1U8JB 2EH7L 4JN1L 4F57L 1JJUA 5CJXC 5T1KD 4IOSD 3RTQA 1RP9A 2BNJA 4JFPB 1LWJA 4NQCD 2GY7B 3GI9L 3HI5L 4ARYA 4OBRA 2HKHL 5BVJB 4MD5B 4AZIA 1ZK9A 2B9VA 3VI3F 4LEOA 1CZVA 3V6FA 4QOKA 4NIKB 2J7EA 4U1MA 1MVYA 1A14H 1T1ZB 4GMSH 5JLZA 2YPKA 5GJSL 3NIYA 3CXHJ 1NAKL 4L4VD 4O2CA 3REWB 3KPRE 5FKPA 2LTQC 5IEHB 4P2OB 4P00B 1QP1A 4M5ZL 1J11A 5T1KB 4AQ1B 4PRPB 4JFXB 4LSVL 4Z7QE 4WU7B 4HMCA 1XEDA 4NKMB 5E6IC 4V28A 1VSCA 3RP1A 2VISB 4E5XB 3VFNA 2DT3A 2LVCA 4ZXBA 2A9NH 1J1OL 5IR1B 2R23A 4RBPH 3VD9A 1Y7VA 1L8NA 4JDTL 3CUPB 3LRSA 4G6AC 1D9KC 3GIVA 1HXYB 3VWJC 1A3RH 1NC4D 1I8LC 2NY6C 3CFEA 2QQQA 2AJUH 3QHZH 4Q74A 4XVSL 3CLFL 1FVCA 2X7LB 4PY7B 4HH9B 1ADQA 3BQUC 1B9ZA 4JHBA 1ZLUK 1A8JH 1OD8A 4TUOA 1ULOA 1M6OA 1IEBA 4JR9L 5F7NC 5KAQF 3OLGA 2ZUWA 4H7VA 4P9HC 5GJTH 4CGTA 4YQXL 4KI1A 4WFFE 4S1RH 2JDAA 3QWOB 3PNWB 5D72L 1LO3L 2YA2A 3BEWB 3T0EE 3TGXA 5TD4A 4A2LA 4JZNB 3G08A 1KTLA 4B7IA 3V4VL 5SWQB 2WWKT 3LN9A 4JFZL 1CFSA 1U2YA 2J8HA 3RDTC 1HZHH 4WTXA 5FYKH 1CLCA 5LG1A 1EEYA 3KPSA 1X5IA 2W9LA 3KYKH 4PMVA 1N5AA 2KZ1B 1A9BB 1KB5B 1VFAA 3DIFA 4OSUH 1E0OB 4LF3B 2XHYA 4M6OL 5DVMA 3H9HB 1K2DA 5EOTB 3S96B 3AB0C 4EN3B 1NWSA 4GRWH 4KKLD 3OZ9L 3BESR 5H94A 4F37F 2W92A 1UD3A 1TVHA 3AROA 3CHEA 1NFDF 1KN2H 1HHGA 1FLRH 1LJYA 1QYGL 3N1FC 3OG4B 1UWUA 4K8RC 4HUWA 4BXSV 4MXVF 4ZUUA 1ZLSH 2HRLA 4WDIA 3EBAA 2X4OA 4LGRB 5DYOA 3DHUA 2WMIB 5FCUL 1UM6H 1CBVL 3MANA 3EZJB 2NX5B 3BKML 4GINA 5DSCB 1HKMA 3JV4B 1IT9H 2CUHA 4X5WA 1CE1H 4XBGA 4PBXA 5FYKL 1CQKA 1H0DB 2JB6B 3HFML 5A6KA 4QRUB 2CNCA 3PV6A 3WL9B 1R3IH 2O5YH 2VAAA 4ERSL 1XGQB 1CFNA 4HS3A 4M7KH 1AI1H 1KT2A 4ZOAA 5C0BB 3BGAA 4DN3H 1T7VA 3MLXL 5E2VL 3NQHA 3PP3K 2VN7A 5FCSH 5ISZD 1CWYA 2XYLA 3S6TA 3OGCA 5T3ZD 1E6RA 3DLQR 4QOKD 3V5DA 5B3NA 2QSCH 2NZIA 1JGLL 2V7HA 2X42A 2BVOA 3MV8B 5A8NA 4R96A 5HHME 5ID1B 2E9LA 4YHEA 3MODL 1DYOA 1BQLH 4P8VA 1FO0A 4XPHL 3NIGE 1A5FH 3VFOB 1KJ3L 1OW0C 4NN7C 4XTRD 1AQMA 4UT7L 2ED9A 2NY6B 4JDTH 4IS6A 5F7YC 5IB1A 2G4FA 1UWEH 2QQOA 4K3GA 4P8WA 2C5DC 3CQOA 2CJUL 4LPTA 1OSEA 3X3GL 2EDQA 1YEFH 3WUWB 1ISYA 4WFEE 3HMXH 3VFSB 4HSQA 2DQUH 3BGMB 5CJOH 4YR6A 1TA3A 3VXUE 2FECI 1A64A 3V7AG 2WBJA 5T1MB 2VKXA 1IGCL 3BZEA 3T1WA 5HY9B 1KXTB 4YWGL 5DEGB 4YAQA 4LCYA 2G60L 3JVGC 3LDBC 4DAGH 5ID0A 3C2SA 1GGIL 2LQRA 4JB9H 3DECA 4P9HH 1UQZA 1MCOL 1FGNH 4IDLA 1K9EA 2QR0B 5TH2A 3W0WD 1HHIA 4QRPD 3V4VH 4C54A 1HSAA 5BV7C 3SJVA 3TBYA 2YPLD 3DUUA 1G6RL 1TVBA 4J4PA 1AHWA 1P1ZB 5LCWL 4PG9B 2CPUA 3ALPA 4CVUA 1MI5D 4PLJC 2J77A 4RGMC 1V6YA 4KDTC 4PJ8B 5DK2B 1KFWA 3GMPB 1ITCA 2H3NB 4NZUH 2G5BB 3QDJA 2F19L 4K94L 4YHZH 3UTQA 3VWKA 3VIHA 3GXMA 1IM9B 4I0CC 1J84A 4ZFOL 4D1JA 2EO1A 3IJYB 4WCYH 3QIWC 4LKCA 3T4AA 2V2WA 1AFVH 1DVFB 1DLFL 2X9WA 4PJCA 4DK6A 3TM6A 1DUYA 4KZDL 1PQZB 2DQFA 4HAGA 5EN2A 1PY9A 4NM4L 5HYEA 4PMRA 4C7GA 1T3FB 3WH8A 4Q9QH 4N8VA 5JXHA 2VL5A 2A6KA 4MPKA 2JF6A 5KBNC 5CSBA 3WEOA 4GWJA 3VDBA 4EE9A 2N56A 2E8YA 2MQ0A 1HSBB 3MLZH 3TH2T 2Y6KA 1T22B 3O4LD 2NY6D 3CMOL 2EKJA 3B9KB 2Z93A 4JPVL 5ADPL 3ARGB 5KW9L 5CBEA 1JN6B 2DEPA 2ZE0A 4W8LA 2DQCH 2K7PA 4Y5XA 3NIDE 2GJPA 2OYMA 4OD2B 2DQHH 1JP5A 4M43L 3ROOB 5GGRY 1HCFX 1FNGB 4NKDB 4MNQA 5D7IE 3RM4A 2PN5A 3HS0B 1D5MA 2VXUH 3PL6A 5E2WL 3CZFA 5EU4A 3CHDA 2WYSA 5EUKA 4ZFOA 2FCBA 3GSQA 2AEWA 4LSPL 4PRIB 4IPLA 5EB9A 1CDJA 2JKXA 4M6OH 4HWEH 5J4MA 3NSMA 4YC2C 1SJHB 2WIMA 4W6YB 3MJ8A 5FYKU 2VLKE 4PJEB 3UETA 4G6KH 2HH0L 4CUCA 2A3EA 1QPKA 4PRPE 5F7KC 4NDMB 3IU3B 1F8TH 2F74A 3CO4A 2D7OA 3PDGA 3BW9A 2R1XB 4MJ5B 3RCNA 2Y6JA 4LRNL 1E55A 3QOMA 1EAJA 5AG8A 4UR9A 2WHMA 4GXUM 1E73M 5C2BL 4M7ZB 2DB8A 5DA4A 3QULA 1A4JB 3AVEA 3M6DA 4Y4FD 2VLRE 3AIRA 1P84J 1O8SA 2OLHA 2NY7L 8A3HA 4YHML 3RIFK 2Q76B 1KGUA 3GMNB 1BX2B 3P30H 3RUGF 1J0ZA 3RVXC 3G5YA 4R26H 1HKLH 2CYGA 2VLRB 3D39E 2CRMA 4KUZL 3S36X 4PTVA 3TNNB 4Y4FB 3L3HB 3VD7A 1NAMA 3IDNA 2BVPA 5A2AA 1NANH 1NCWH 3TZVD 3MUHL 3CBWA 2YPLE 2FD6L 2J2ZA 1B4RA 1NQ6A 4X4MA 3ZYIA 1RD6A 4G8GE 3GHEL 4OUOA 5GS1C 3VFNB 1CE6A 4ACZA 1U3ZA 1N59A 1G0CA 5A3IC 1GC1C 5L0QB 4JREB 1C8QA 2DI7A 5C0EA 1AQ0A 3QQ9C 4F7PA 3G9AB 2WSKA 5HGAA 3RVTC 4M1GH 3PTKA 4FRWA 5E08L 4RAVA 4QLJA 1FZOA 3CVIH 5ABFA 4RWYH 5CUSH 4K23H 2BOCB 3GSOA 5IOPA 4LCCC 1TCRB 5B3JE 1R3HA 5C09A 4G8FB 3MX0A 2DDUA 4RGNE 3H9ZA 3WMSA 1FAKT 1E28B 1HNFA 3LZFL 3OAUH 4EUPH 4PLNC 3IRZA 5CEZD 1UVQB 4OGYH 3B9VA 3O3EA 2XRAL 3HCVB 2M26A 1A4KB 1UA6L 4MXWL 3L5WA 3UJTH 1P6WA 3MLTB 1BIHA 5E00B 1S7SA 3ZSTA 4UDUB 5M5DA 4BZYA 3WFLA 2OL3A 3P0YL 1E1EA 3V6ZA 5CBAA 2VXSH 1OD0A 3BT2L 3T65A 3A0OA 4OIFA 1D5IH 2Z8RA 2J22A 2PW2B 2MNUA 4G5ZL 2AEPL 1A6VH 1AC0A 2W0KA 2Y72A 3PZUA 4ONOA 3RUGB 2ZG2A 3CH8A 1F00I 4AZGA 5CP7A 3DIFB 4XH2B 4PFEA 4JFEB 1GAFH 2FH8A 1Q6EA 3K4DA 1CQYA 4EN3A 4HWEL 5DRNA 1P7QD 2W59A 2A3CA 5EIQA 4DN4L 1EHLL 1H8SA 4CCDA 3NCMA 3BZDA 2PF6A 4FQPA 3WBAA 3T4YA 1DWGM 3S4SB 4KDWA 3U0TB 2DL2A 4YHIA 5JORB 2ORZA 1XFPA 1MFUA 1N6QH 1YYLH 1JHKH 3UNPA 4WU5B 3AFBA 3CFBB 4UT9L 4EI5B 2W1QA 5A6SA 2XFXB 3V5HA 4PGEA 2DLFL 2GSIA 3K8LA 4Y16C 5B39B 2NX5A 5IGXH 1NC2A 3OTTA 2PYEE 1P2CA 4PTWA 4M43H 4X5WB 5CPTA 5JHDD 2Q3AA 4BFGA 4JFWA 4QDMA 3NSNA 4ZFGL 3THDA 2DWEA 5JZ7D 3VGAC 3O0RH 4PD4K 2BVDA 3RWDA 3D25A 4M29A 2WC3A 1IGIH 2GSGA 2JEPA 4NSBA 5KAQG 5AYBA 4NQSB 3DSFL 1EHXA 5E4EB 4ZFFA 1MHHB 1RZ8B 1YEEL 4O58L 2P4AB 4F58H 3VIPA 4MA8H 3IT8D 3BE1L 3MSPA 2I9TA 5MEPA 2PWHA 1J86A 2G9HA 3V9FA 3IGAB 4NO5B 3LKOA 4M8VA 1DUZB 2IANA 1MUJB 3V0AC 2B1HL 5A6MA 1QQDA 3CJJA 3D39D 3K1DA 1FV1B 4PMUA 5GGRA 4YE4H 1IV8A 2NY4C 4KI5D 3D69B 2D03H 4ZS7H 5CILH 5DLMH 5HDOA 2IAMA 2JF7A 2FIRT 4D6FA 2IPKA 3A6BH 1BFVH 2R9HD 3KPQB 4Z5RA 3JTSA 5DD6A 4OF5A 4NN6B 1NP0A 3NFSH 2IANE 5HI3D 2P8MA 2WWCA 2XOMA 3MUGB 4PJIF 2OJZL 1UA3A 3LN5B 2WBJD 4Y88A 5HY9A 3QDAA 5FCZA 3WJJC 4FP8L 5J13C 3OZOA 2O9PA 4Q2ZB 2PUQT 1DEEA 2EH8L 1S9XA 1AHWC 2D3LA 2EPLX 2AAVA 1P53A 4KHXH 1IAMA 5DMKA 1TJGL 4K3EL 2IG2L 1A0QL 3NA4A 5I6XC 2AQ3A 1D5BB 3KPLB 5IW1B 2CMRL 4A6OA 1TVBB 4FTVB 1M53A 1ACYH 3MLZL 2DMCA 1OLZA 5DRZB 4U6HA 1E4IA 1GVYA 4CJ1A 5BXSA 1K9DA 5L0QC 3V4PL 1U8IA 4GOSA 4LSQL 4ZNEA 4KK9D 4KKCC 4PYSA 3LS5H 3HE6D 4CN4A 4N1HB 1BOGA 4LGPB 3FN0H 3TFKC 4FQ1H 5HYQA 1JGLH 5FYKD 3ZJ8A 1P4BL 3P0VH 2V6HA 1YQVL 4ZE4A 5J11C 4IRJC 4NQED 1FNAA 5JW4N 1J8HB 4S1DD 1NBQA 4IMLA 1AGFA 2QQLH 1GUIA 3VIFA 2NXZB 4QT5A 4EVNA 4YFLI 3DO7A 1BOYA 3SURA 3MCLL 3UAJD 5CG0A 1OAYL 1B2YA 4LLVB 5A6LA 2AOSA 2Q6WB 3TJHC 4RMWA 4BQ2A 2X4SB 4TVPE 3OR7A 4HGMA 1ULVA 5E9AA 4H5SB 3GMOB 3TBVA 5D7JB 5CMAB 2C3VB 4P2OD 5F8QC 1MAMH 3TIEA 3VDCA 4GZEA 4WO4C 2XKUA 2A74A 4WWID 1CT8B 4ZFOB 2GIYA 3W2DH 3NOIA 2A3BA 4F9LA 2IXUA 3LPFA 1QI2A 1A6UL 1AD0A 2DQGL 1U41A 4X6EA 4HCRA 2WINB 4MD4B 4MCZA 5C07D 5F72S 5IV2A 3WQVA 3ARBB 1M05A 5MENE 1CENA 4WW2B 4PJAA 4S2SA 4RRPA 4C56B 1QOXA 4TQEL 4DXRA 5FUCC 5BJTA 2R8SL 1GGBL 1NH6A 4EQ2A 4PCTA 4GQQA 1RIUL 1KENL 5DVLA 1NAML 3HEIA 4KRNA 4JFQA 2Y7QB 5EFFA 4OLYL 1KEML 4QYOA 3VRIB 1F3DJ 3QJHA 4POZD 1UUQA 3QI9B 4TSAL 3VRLE 1XZ0A 4Z7OF 4YXKH 2BY1A 1CZ8L 4IHOB 5HHNB 3GEWB 3HC3L 1FC2D 4XB8A 1QI5A 4D72A 2FZ3A 3EDDA 4NT6B 4QNPE 3QUYA 1IVLA 1OH4A 5D1QA 4N0UB 3LD8C 2P5EE 1A1NA 2A83A 5J56B 5DK3A 5IESH 4ZO9A 3EHBC 1GGCH 3WLWD 4V2XA 1PLGH 1NC2D 5BCAA 4G7YL 2AXGB 4GS7B 4J6RH 2R1YB 3SBWA 3LKQA 1W9BM 5DI8B 3F65A 4P2RD 4TYUA 3C6LA 5KG9A 1Y6MR 2P8LA 2FLBT 3IDNB 5SX4H 2GJZB 4MZ2A 4Q0XH 2YUXA 2ENSA 3SOBL 1AQKL 4WW1A 4BQ5A 3BQUA 4W81A 5FUZH 1KB3A 5IM7A 3QPXH 3DX8B 3QEGH 4OM0L 1HIML 3ARDD 5AYUL 5EZLA 1DL7H 4AWEA 4OIIL 4WWKB 5E03A 2VJXA 3W0WB 4JFEE 1GOMA 5IB2B 5HPCA 4HK3N 1KNOB 2IUZA 3DRTB 5D2NA 4L8CB 3FOMB 3MSGA 3VDAA 3KXFA 1NAKH 1YDPB 3HNSL 3X17A 1I7TB 2YKKA 3BO8A 2B7DT 1FZKA 3H6JA 4LNRB 1TCRA 1A7OL 5EBLA 3VGEA 1L0PA 4FLOA 3I2FA 1HXYA 2B4CL 2R4SH 5GS0C 4NHUA 4Y19E 5I8CA 5FDWA 1KB5H 4A41A 3SKNA 4P3DA 4XNQA 2MCPH 1S7SB 3P0VL 3I3DA 4YPGB 1LO5B 2R29H 1FL5B 15C8H 2WBJC 4LVHC 1IKFL 7A3HA 2IGFH 3RZCB 2OQJA 1AKJB 4U1HA 3DURA 1FHDA 5KEZA 5EUOA 1FNSL 4ZOCA 1BSIA 4CUBA 2QHAA 1JF1B 5DWUH 3PGFL 4HIEB 3JV6A 1FL6B 5A16B 5L7XH 3CLFH 1EGJL 1HILB 1QFPA 3C8HA 5F9OH 4C7FA 1DDHA 1I7RB 4QCEA 3FQWA 5IROA 5D9NA 2FO1A 5LWYH 1KB5A 3T0ED 2GI7A 4LBEB 1S7QA 1E4XI 3MJ9L 2F5AL 2NNAA 3BPCB 4FNLH 5B4MD 5ITBH 2GJJA 1HHGB 4L4TE 1DN0A 5DO8A 5FGBA 1W9TA 1JNHA 3HRZB 4OCMC 5HDQH 1JK8B 2HYXA 5JPNB 5KSVA 2VLJE 4XPBH 5FHBH 1TVDA 3O8XB 4HA3A 2A3AA 5B3JF 2DLGA 3WIJA 2EXYD 4KRUA 3EFDH 1SJXA 3B8SA 4Z0XB 3RWGB 5FF6A 3PDDA 4QRUA 3ZKMC 3EO0A 5T5NF 4X6DF 3GSRA 1TJGH 4K3EH 3TN0C 2HT3D 2VMFA 2XG5A 4PY8I 1R24A 2BNRE 1I3GL 1RUPL 4PD4J 5J1AA 5HHQA 2HLEA 5CGTA 5H37G 4WIWA 4NKIL 1OOAA 4PREB 3OJDA 4JDZA 5GGVH 4DKEL 3BPNB 4ODUB 5GGRB 3UXFA 4R97C 2OYKA 3TYFB 1XSJA 3HPJA 43C9B 1LL6A 1KBGL 4HJGB 4GRLB 3ARDA 1NBZA 1TZ7A 4HD9A 4LGSB 4AG4L 2FX8H 3C5ZB 3QUZB 5E8OA 4R6UA 3NIFF 3KS0H 5LA2A 1OT1A 9CGTA 1JHTA 1JNDA 3WQWA 1RU9L 3QG7L 1IQDC 2SEBB 2FWOA 1EBPA 4UQDA 2NPLX 1XR9B 2DT2A 1MNUL 4GRMB 5D1ZD 2BK8A 1JGIA 3GJFB 1GXEA 4TSAH 4OZHE 3QG6A 3P4OA 1R3KA 2BVQA 2YKLL 5D70H 5I1JL 1UCTA 4HBCH 1RJZA 3CFKA 2AMGA 1AXTL 4WFHD 4LVNB 4ZTOL 4S3KA 5EWIH 1KIQA 1VKXB 5D71L 3O3BA 1AY1H 1TUXA 4JL1A 3R06B 3EIFA 4LFHG 5FYJH 3POHA 3H9SE 1W2VA 3V6OE 2ZXQA 2E31A 4PMQA 5DURB 1NMCC 4QHNB 4MAZA 1B6UA 5EBWB 4ALAH 4F7TA 4K8RL 1E6QM 3TPUB 5E8NA 5A3ID 2DD8L 4WI6A 2YG0A 3I2CL 4S11A 1CK0H 3MRRB 2W60A 4Y8AA 1T2JA 2CDFA 32C2B 1ZT1A 4U5IA 5DJCB 3ZKSD 2XG9A 1OGTB 3TYGH 4P2RB 5EZOH 4RMUA 5IEKB 3FO9A 4I4WA 4ZUTA 1G7PA 5IVXF 2BNQE 3HNVH 3RHWF 1FVCB 3N1MC 3BISA 2G5BA 3RMEA 4NJAH 2JLLA 3MRPA 3WKML 5J1SC 3UCQA 2XG4A 2ITCA 2VDLH 4JY6B 3HZKA 1E9LA 3TOPA 4NC2B 2VXTL 1WB0A 4X4XB 4XAKE 5BZDB 2X2YA 1JNJA 1IAOB 4N8CH 3EOYG 3GJFH 3MO4A 3SDXA 5EZOL 5IFHH 2WQRA 2E3VA 1AGEA 1WISA 1FFRA 3VH8G 4BA8A 2EE9A 4HUXA 4FXKB 1QFOA 4ODSH 2AK4E 3ACGA 1SBSH 2GT9A 3MRNB 4OZIB 3I2CH 5K9KA 2NY1C 1MCWW 1EUUA 3V4UH 4RA0C 5GGQL 1MCIA 2BMKA 4OCXH 3B4NA 3MRQB 3NABL 1UG6A 4RISL 4GRWB 2VR5A 1W1PA 5GGSB 4UB0L 4Y5XB 1VFFA 1FSKB 3TT3H 4D9LL 4BQ9A 4R2GB 2E7MA 1YJDC 1JHKL 2NT1A 3FB7A 4CMHB 1Q0YH 4GQ9L 4AZBA 2JALA 3SGJC 5JQ6L 1DE4A 5C0RL 4R0LB 3WS6A 2F5BH 2VLJB 1HKLL 2W9DH 1NWRA 2WBWB 3O2VL 2GKIA 1S8DA 4I48A 4TOYL 3RGHA 3I2JA 5ANMA 2PB1A 5F96H 1XNTA 2XWBA 3QCVH 3CIVA 4F9LC 5C8JA 1BFNA 5JIHA 3D85B 1JTOA 1RZIA 2JB6A 4N0YL 5IVXB 1ZS2A 4NUGH 2VXQL 3F58L 5I5RA 5FHAL 4CKQA 4G7VH 4XX1G 4HFUL 4NCDA 2EC8A 2NX5D 5BROA 1M4KA 2ENYA 4D0BA 4PJ7E 1XHGA 2D4DA 4HKBA 2CDGA 4LOUC 4JHOA 1C7SA 1CR9H 1MFDH 5IJKC 1CLYH 3QIUB 3QUYB 1W72A 1DBKH 3MXWL 1KJMB 1WC7A 5A2BA 1KCKA 2MKWA 2E9JA 4IBLT 4J7RA 4D0CA 3CFCL 5CJ5A 1FO0B 4S0SD 1KXQA 2DSKA 2R1YA 3GH7A 5KS9F 3EOBB 3D2UB 3PL6D 3TV3L 1XGPA 2OSYA 3NYDA 4FFWC 1JE6A 1RUML 3UYOD 2DD8H 3VXNB 4CADA 1CLYL 3VFPA 1V3MA 3I75B 1FGVL 1XH3B 2EEDA 2ZX5A 3WBEA 4ZY9A 3MV9D 1EHNA 3FHAA 2BY2A 3WLWC 2DM4A 2OM5A 3WUWA 1NDGB 1JNLL 2RJ2A 1Q1JL 1SY6L 2PKDA 4XWGL 2YEZB 1TA3B 4BCEA 4XP5L 3SO3B 3QO1A 1MFVA 4ZO8A 2WIIB 2DIBA 1KNOA 2E5EA 2IAMD 4LHJB 4M9OA 3LH2L 4AJ0A 2B4CC 3T2PA 1Q9KB 1UD4A 3DUSA 3WD4A 3TTYA 1EGJA 3GKZA 4FABL 1G9MC 2V7NB 4X0NA 1S7XA 3I6KB 3MRGA 1PEZA 3LB6D 3AZSA 3BMVA 2K3TA 1HT6A 4I2XA 3VINA 1Y6KR 1S9WA 1FJ1A 4E41D 1FZOB 3WIIL 2M2DA 5HHMB 1LO5A 4U7KA 4C4KT 2HT2C 4U0QB 3BRGC 1IT0A 2FYYB 2NY3B 3MREB 4PRAA 2JJUA 5E99H 3MYJB 1HKKA 5JDJA 3WJJA 2ZX8A 1S7TA 1NARA 4P7NA 2R2BA 3EFDL 1WCBA 1ODZA 1CD1A 1FRGH 5I6SA 1KXHA 5IMMB 4KZEH 5I74C 4JZNA 4JG0H 5CEYB 1UZ6F 3U0PA 1BQHG 5SWQA 4XVTL 4PJ8C 1UEYA 3NJVA 3T65B 1CDHA 3MLSH 3U4BH 1LF1A 1NBYB 4X9BA 2P44B 4PJCB 1OB0A 3O4OB 4D9RE 1TJIL 1ZT4A 3DX7B 3GBMH 1WO2A 4OZGF 1K5NB 1GQKA 5HYSG 2Y1VA 3NGBC 3QRGL 5IMOA 3FTGA 1F90L 5FA3B 1TR1A 4KDVA 2E8ZA 2UWEA 4P2CG 2W38A 1S7UB 4YIQB 1OF2A 4JB9L 2CR6A 4FQLH 3BIKB 4JLRA 3QIUC 5FO8B 5DURD 1NCAH 1HHHB 2HFFB 3DOSA 5JORA 3S4SG 4QLLA 1OB1B 1DLFH 1ZT7A 2HT2D 1EGJH 4OD2A 4NP4H 1EHAA 3CSBA 7TAAA 2GYSA 2AABL 3KPPA 4LDEB 5MERA 3C2AL 3FQXB 3WQ8A 4PGDA 1SEBA 2VQTA 3WF0A 5EO9A 2F53A 4PN2A 1HXMA 3AREA 4JDVB 2AJXH 3DMMB 2W9DL 2GUOB 2VAAB 3A6OA 4TVSa 2RR3A 3VXSD 1GZPB 5HDRA 3WEXA 1VBUA 4BQ4A 4XBEL 1K9TA 5IMKA 1KT2B 3QOKA 1IGTA 3SDYH 1OM3H 3IDYC 3D25B 1QHPA 4J6RL 3D3VB 5EDXA 3TJEL 1NM9A 4PF1A 5FOJA 2GK1A 3MODH 2HTLD 4YHPB 3HNTH 1CFBA 4UB0H 4K8RD 3WMBA 1V6XA 1JWSB 1OTUC 5ISZA 4HS6B 1GRWA 3U7VA 2ZOXA 3EJYC 3RU8L 1JZ4A 1XCWA 3TO2A 1YMMD 1HHJA 4JM2D 3KG5A 1MW2A 4OUUB 4NO5A 2F54D 1O59A 5JXED 4P23B 5ICYA 1UWIA 4U1NA 1B3WA 3KL0A 1OGAD 2DM2A 4Z7VE 3AU1A 2JTDA 5I19L 4U7MA 5KSBA 4HEME 3ALGA 4LLUA 1QBMH 2J5LC 3F6LA 5EC2B 1IGJA 3S9DB 3UPAA 4MCYB 1EO8L 4M8UA 2A6IA 4ONHB 2B2XL 1QI3A 2J8UB 4TULH 3MLUL 4NOFA 1Z32X 1CLOL 2DICA 1PG7W 4ZDHB 4GQRA 1KWGA 3RIKA 2J1SA 3LMJH 4YAQB 1T1YA 1EAPA 4HWNA 3VFGH 2GJ6E 4BDVB 2W3JA 4KTEH 4HWBL 1FVDB 4PTTB 5LCVL 4GXUN 4U1MB 5SWZB 4OLXL 3QZWB 5BXPA 4G8GB 3VGBA 1DLHA 3L7FB 3UBXA 1BECA 3R06A 3OAZK 1XR8A 2XGIA 1KF9B 3QPQD 1U6AH 2M8XA 1T89C 3ETBF 4QHUA 3CH1A 3MV9E 1UY4A 3M46A 3UYPA 5DN2A 3LPOA 2HLFC 5H2BB 3EYFB 2X7LA 1B1YA 2XQBH 3QAZB 3IB4A 2GITB 1TZIB 1MQKH 3FB8B 1HOCA 2PQSA 2R23B 4YFDB 2QSTA 1G7PB 4HCRL 4NFBA 1JG9A 1F02I 4Z78A 1XYZA 1UWQA 3F7VA 5J13B 2BJML 2EPKX 2RAMA 2ESVD 3EYQC 3WD5H 4YQXH 4APQC 2C3GA 1DQJB 4RFOH 2ZUSA 5GZOC 4PIRF 4PP1C 3BEVA 2K1MA 2AKRA 3PWVA 5F9OL 4EANA 1ED3A 1OPGL 5I6XB 5JIIA 1CD8A 1F2XK 4LMQI 2IALA 4WRLA 4J3UA 4BFBD 5I79A 2XY2A 4G43A 5CS7A 1D9KB 3PNWA 2YB7A 1DQLH 4RN5A 3FO2B 2RV9A 3CZ8A 2R1WB 3KR3L 2DIAA 4YHLH 5D9SA 3UBXI 5K59F 3O4LA 2XTLA 2I25N 4TPRL 2EDBA 2ZPKH 4O51A 2DT0A 2FDBP 1KCLA 3JWOC 3QIBD 5FCUH 3BZ4B 2VT0A 4K3HA 3ZHDA 4YXHL 4DVRL 4EBQH 1PKQE 1U8PB 4JFDA 4QRSB 2CBUA 3IJ8A 1H5BB 2A0LC 4R0LA 2DT1A 3VXQB 1SJEA 3W38A 4MAYC 1PG7L 3BKJL 3QEUB 2PYEB 5DJAB 2I24N 1Q0XH 3AOFA 4ZNEE 4UU9B 2G3IA 4JY4B 1GQIA 5D1XD 2DJ4A 4G6AD 4FQ1L 3MRIA 4DW2H 3MJ8B 3UJJL 1ORQB 3VU2A 1EEQA 2PTVA 2WINA 4PJEA 2DWEB 4WV1B 1V5JA 1W0VA 4PJHA 5HYJE 2QQNH 2WWMC 2DYPA 1H5VA 2BCKB 3ES6A 5EFIB 4W7VA 4YGAB 3VD4A 2FIKA 5AD0B 3QDJD 2Z8VC 4XMKL 1H0DA 4UOQA 3LEKA 4ZFFB 1F6AB 1YZZA 1JGDA 3O3DB 5FGSA 2ZCLL 3LOWA 4OFKA 3WF3A 2R0LH 4WFFD 1KB9J 4WSKA 4U0RB 1F6LL 4XZUB 2R2HB 4IUGA 1BJ1J 2AK1H 3BRDA 3MACH 4ZUSB 3ZSSA 3SCSA 4AC1X 5I2IA 4QHKI 4MNMA 2UYLA 4PLOB 3RY5A 4TULL 4WTWA 3N85H 4R5EA 5I24A 3RPMA 4GAYA 3D2UA 3ECBA 4Z8FL 1M7IA 3RZWA 3TEUA 3C5JB 2Y24A 3IETB 1P5UA 4PBVC 2IPKB 1T2XA 3N1PC 1GJWA 1JNNH 3BKYH 4ZG1A 3U7WH 4U1GB 3OG2A 3GDBA 2ICWA 3C60D 2R29L 4KUCF 4NO3A 5HVHC 4HF5L 4F33B 2FEDD 2A3HA 2W94A 5FYJD 3LN5A 3RI5F 3H7BB 4URIA 8FABA 1OF3A 4JM2F 1A3LL 4KDTA 1PDKA 4Y8DC 1DBJL 4OFPA 1FYTB 2ZOKA 4X80H 3EYVA 5IVNA 2Z1KA 1J1XL 1FG9C 1S9XB 2YD1A 2NW0A 4PBGA 3DI3B 2PR4H 3PDOA 1KULA 1BJ8A 4AYSA 3IFOA 4FQHB 1B0IA 3NDYA 5ESQA 5HHOB 2FNBA 1I9IL 4F8QA 4OV5B 1I7TA 4AIZA 3CVHH 1M1SA 3IXAB 3SCMD 2DJUA 3FT4A 1L0YA 4IM8A 1CGSH 1T0NA 2C1OA 3S35X 3QSKB 4M3JA 3JVGA 3WD1A 5CFHA 2BNQB 3OA5A 3RX8A 4LAQL 5CKAA 1RVFL 4HOZA 3LSOB 3VJ6A 1LGVA 1GOQA 3C6LD 4Q6IB 5JBDA 1CLZH 2XSAA 3L6FB 4LPUA 1US3A 4OCWL 4E41B 3QXWA 3QWOA 3ULVH 3OKDB 3TBSA 3BEWA 4FQ2H 1TZGL 3BH8B 3WHXB 4FQJH 4NN6C 3ABZA 3VWKB 1PJ9A 5EU6D 4OI9A 1TITA 4Z7UE 4MD0A 4PRHB 3K0WA 3E2HB 2QV2A 3QDMB 5IMOB 5HJ3A 1JYVA 1RAMA 5DRNB 1D6VH 2JIWA 2D20A 5TJWK 2A6JB 1QUNA 2BGPA 4QRRB 3O3AB 2CKBL 3QCUL 1FP8A 1QNSA 3ZE2E 4U1JB 5T33H 5BS0E 1G1YA 4AD2A 5F6HI 4HXBH 4A6YH 4W4OC 1R6VA 3RVXD 5A95A 5FL1A 1MCSA 4OZ4A 1FC1A 4WU5A 4PGZA 3KWXA 1RIVH 2UZYB 3LRGA 1V02E 4IJ3C 1R5VB 3RWCB 5TDPB 5D7SH 4OKVA 1DP0A 5I3DA 1T22A 5EUKB 3P9MB 2Z93B 5D96C 5J3HC 5EO9B 1NGPL 1XIWB 4XV0A 2F53B 2EPNA 4Y4HD 4XHQA 1NLDL 4P57A 4BUGA 1JK8A 2EDHA 3MTRA 3WDIA 4G80B 1YEJL 2A74B 2VLLA 5TE7H 1H41A 4JQXC 2XIIA 3S36L 1EQPA 2R4RL 3ROOA 4ZD3H 2BVEA 3S37H 5FFLA 5K9OB 5DJ8B 4GKNB 3QDGA 5IHRA 3G5ZB 4RGOL 1QSED 1CL7I 5DMGD 4HGKC 4PLJD 2FJHA 1CIYA 2HLAA 2R1XA 2HFGL 3O3UN 4GIAA 1A02N 2FB4H 1LO2H 5DMYA 4RGND 2I9TB 4P5TC 2VUOA 4HWBA 4GZ9A 1R24B 4LPYA 4Q9RL 5DJ0A 1GHSA 2QPUA 3QIBA 3NZ8A 4PG2C 1PX3A 1Q9WB 2AABH 1D5IL 2IH1B 4U1NB 2O5XH 4J3OC 1VGKB 3ARFB 1OGAA 1FAIL 3HUJA 5LA1A 1LNSA 3U57A 4TXWA 5J1XA 3AIQA 5CKGA 1RI8A 2J4WH 2H6PB 2A6IB 4OCXL 3SDDC 1I75A 1GPFA 4LX4A 3RI5K 2EZ0D 3C5ZA 2DSVA 5BVJA 2VZSA 5D4QA 1PAMA 5IB3B 3LEYL 3TWCH 1FFOA 1HYRC 3NCJH 3L4XA 1RIHH 4JPKL 4Z7WB 1WAAF 1RIVL 4MAUL 4Q6IC 5EA0H 2EIDA 4K7PL 1XSIA 1N8ZB 1YEEH 1QLEH 3L9RA 4ELME 4JJ5B 3MC0A 1T04B 3LIZL 4M48L 3U0WH 1G7MB 3SGKA 4DXSA 3V2AR 1JU4A 1JMXA 3TBTB 3HC0B 1RJYA 1RZFH 2MPAH 1G6VK 2BOCA 4EI5D 4PJXF 6A3HA 2HN7A 1BZ9A 5KSBF 1FBIH 5IUSA 2E6JA 3BVNA 4FFYL 1NX9A 2GDVA 5GNXA 5C09D 3BP6A 2G3JA 1KV3A 2EDDA 2APTA 2IADA 2ZSWA 5D7LE 1CLZL 3FAWA 4M1DL 1I9RL 3IRPX 2QADC 4P2OC 3HHRB 4QY8A 2I26N 2VI0A 3QEHA 5E9DA 5ELIA 3WNNA 4K68A 4HV8B 3UTSB 2VXVL 4P2RA 4PUBH 5ISZE 3JUZA 3UTQB 35C8H 3LH2H 5F93C 4LVNC 4RNRA 3W4RA 1E5JA 3MMUA 4LRIC 3NIDF 4YHKL 5MENB 1FFQA 2IALB 4ORGB 3VIIA 1R8LA 5A40E 1RUMH 2ZUUA 2C3XA 2CLRB 5BV7B 1BWWA 1F8TL 1QRNE 4LCUB 4QRPB 3OX8B 4MJ4A 3RVVC 2CO7B 3MXVL 1ZWIB 4XZUG 5C0GA 3WN6A 1FL3B 1HINL 4UV7L 3RTQC 3Q0HA 3VXMD 1ZVSA 3TN0B 4IMKA 2EBNA 5IW3A 4D71A 4JGJA 3G04A 3GMQA 3IVKA 3ZIZA 4JRYB 1Q6FA 3RJXA 2O5ZH 3T2QA 5DD1H 2UY6A 2F15A 5EU3A 5A2JH 5LXGL 4HP5A 1TIUA 2Z35B 5E2TH 1JWMB 5BRZD 3GXDA 1U8MA 2D7QA 3B6SA 3AZTA 2D0GA 1S7VB 2UWEE 3QDJE 3BC9A 2ZKHL 5KANI 5JOFB 4DKAA 4X9YA 4U6YA 3GNRA 3SPVB 5F6IB 5HHMD 2EIEA 3HE6B 3RWFA 2WHLA 3DRQB 1QSFA 4K8RH 4P5KB 5I2UA 1BEYL 2BCKA 4MJIA 3B9AA 5A1AA 2XKNB 3DXAD 4X98B 3EAKA 5HGBA 1BPLB 5DC9B 2F2HA 2OSWA 2IFGA 4M00A 3D85A 1G84A 1X5KA 2EE6A 2OJEA 3VRIA 1OT5A 1GC1H 3MR9B 4AEHH 2FGLA 1ORSA 1H0IA 4YDKL 2XQXA 1IFHL 1U8KB 5JXAH 5A43C 4DUVA 4EI5C 2JJSA 3MRMA 1P6FA 2R2HA 1CG9A 4ZUSA 1RZ8A 2UYLB 3UCRA 1T03H 4DZBA 1W8OA 5DQ9A 5GSRA 4JFPA 3KZSA 3AS1A 2FSEA 3F7YB 2C7UB 4QHKJ 4XUQA 1ZGLM 3L3DA 2W0FB 4X7TA 5DHXB 4O02H 3C6LB 1OQXA 1JRHH 1PG7H 3BGFC 3HAEA 3IFPA 4G9FD 1MQQA 3BT2H 5HHVL 3GXUA 4NQEB 5KTEL 4CCCA 2XV6B 1OSPH 2XWJA 5EPMB 4HZLA 3DX9A 1U33A 2ZICA 3HE7A 1Z0MA 3ARRA 3H7BA 2WCGA 4I0PC 1NAMB 1U3HC 3FW6A 1DSFH 1NKRA 5IHUH 4UT7H 1G0XA 5ITFB 3WHE0 4PJGE 3VXPB 4GBXC 3OHXA 4K23L 4RIRA 4QB1A 3KXFB 4HDIA 1RJZB 1CE6B 3ARYA 1QFHA 4ACZB 1OPGH 3T04D 4HC1H 1WFUA 2EDJA 2YD9A 4ODBD 5HHXL 1DQMH 1MCHA 1YPZF 2P46B 2Y06L 1UXSB 4M7LT 1HSAB 3MLXH 5E2VH 3SGEH 5IT2H 1OP9A 2QADD 5I1GL 1CTNA 4UTAL 4Z2IA 1HYSC 4DGYL 4XP1H 4RFOL 3RGVB 3QZWG 1FL5A 2HG5A 4OFVA 1F4XH 5I77A 4NZRL 4IRZL 3C7HA 4XX1E 1FH9A 5HYJB 5BZWA 4MXQD 3MLTA 5IEKA 3U1SH 2H2PD 2WMJA 2BHYA 5CGYD 1EA9C 4ELMB 5C0FA 1JF1A 2R2CA 3SKMA 3UP1A 1U8IB 2D2OA 2EDKA 4HEPG 5EBMB 5H37H 5AYUH 3U0PB 3VIJA 2NW3A 4DGYH 1QNQA 3ZR5A 4QX3A 2WZIA 2KL6A 5D5MA 2R7EB 3U9UA 4M1RA 2OLDA 5ILTH 5DT7A 2OK0L 3ET9F 2XPKA 4XH2A 3VGHA 1GSMA 3BAYA 4FQCH 3HI6H 4TTUA 2DQIH 1TTGA 5HI3C 4E4PA 5JIWA 1HH6B 1G9NH 4YBHA 2JJTA 3BKYL 5F6HJ 1JBJA 3LE0A 5DJYB 3VXOB 4W84A 1MFNA 3DROB 2BS9A 4FQQB 3H9SB 4WY7H 2ZEYA 4WNQB 5JPMA 1EOKA 2P43B 4WO4D 4JFOA 3ZDZF 4OQTL 4FXGA 1OY3B 4DOHB 3GMMA 1U8QA 2NXYC 5FECA 3O8XA 5D1XB 2GSIB 2GAZB 5D2LE 4CD6A 4P46A 1TVGA 4PJ9C 1NC2B 3S6CA 4UNIA 3QUML 4KQ4L 1ONQA 3R8QA 3HZYA 4GKNA 4TTGA 1FFNB 1MHCA 3QDGB 5BQ7A 2VCCA 3QFDB 1KN2L 2C3VA 5JZ7C 1IC5H 1QRNB 3V0VA 4QX2A 1UR0A 5BRQA 5E8PA 1A7OH 1OAXH 4DGIL 3VG0L 5CEXB 1I4FA 2FJFB 3FZUC 3PP3H 2D0HA 1U42A 3K1KC 1QVBA 2VH5H 1FG2B 3FO1B 4L1HA 3QI9A 1D2KA 4AEIL 2IQAA 4PJ7A 4S1DC 4U6XB 1MF2H 3I84A 3WH6A 5FHBL 5I9QB 4F7CA 2CIPA 2H2SD 4JFZH 4HIHA 5IV2B 5D7JC 4OM0H 5HGGS 4AIOA 1NCDH 4P5TA 2ZUVA 5ITBL 2Z31D 5LBSH 1BQSA 5K33A 5LAXA 4EN3C 3S98A 3MPCA 4Y16D 5GRYA 3CUIA 1RK0B 5HYSB 4PR5B 1BVZA 2B5IC 3QRFM 3LKQB 1ODUA 5AC5A 5KVGL 5CP3H 5FUOH 1DBBH 3D69A 1Z9OA 1F45A 1U58A 2IAMB 2IC2A 4UINH 1BX2A 5GJSH 5IM7B 2W9EH 4B7LA 4H0GA 4PJBF 1A7PL 1GJUA 5T1KA 2WO3A 4WJ5A 5IBTH 3O11A 3BCDA 3CDZB 3VG0H 4LSUL 3LQCA 1T1YB 1UJ3B 3DRTA 5KVFL 1UYQA 1KTKE 1DSFL 2EYRA 1KIQB 3OKOA 3UC0L 4HOWA 2XIBA 2FBJH 3BWAA 3D2UD 4LSVH 5JW5B 1TTUA 1B0GA 5D93B 3UTTA 3PUIA 4RE2A 2J1TA 2HJLA 2VRAA 2ADIA 2WDBA 1KLUB 3VWJA 1J18A 1S9YA 2ADJA 3TPUA 2WC7A 3BLPX 3SDDD 2LW8A 1JRHL 3PTQA 4P3DB 1BAFL 1U8OA 3HAEH 3WD5L 5CD5D 3HNYM 3BYYA 1URLA 4OCNC 4HPYH 1PFCA 1FRGL 2OP4L 1E6PA 3S7GA 4Y19A 1A7PH 4G9FB 3P77B 4MNGA 2LTQB 3ULVD 4Y7MA 4WI3A 3LQAC 4MLIA 1JUFA 1BFTA 2ZXAA 4HPOL 4PJAF 1DWFM 3G08B 2X10A 4Y0GA 1EFXB 1H3PH 1I1AB 2PCPA 3NN8A 4MDIB 4U05A 5GGSY 4HIEA 3PWNB 2EE2A 1AO7B 1IQWH 3N17A 4OAWA 3N9GH 4OSUL 4X4XA 4PGJA 2XA8H 1WDPA 5D7LD 4UZSA 4X7EC 5DQDL 2ORBH 5DT1L 1EZVX 2ZWZA 4IRSD 1C8XA 3KYNA 3HNMA 2YMXH 1ZWIA 3WUZA 4AIEA 4XNZB 1BD2A 4NPYA 4OLZL 3QO0A 3W9EB 1Z9SA 4DGVH 1JNLH 3WSQL 1KTLB 2VDMH 4HIXH 1UYWL 1AMYA 2AJYL 1JAKA 3AMDA 3WCYA 1RZFL 4YDJB 4MNKA 4OGAD 1FL6A 4P0DA 1OAZL 4WDIB 1MVUA 4PGCB 2OK0H 4GJTB 3RIAF 5M3WA 4M6NL 2VDRH 1H15B 1YY8B 1S7UA 2QJDA 3F6IA 1RK1A 4ZOEA 3Q6GH 4JFYB 4J3WA 5HI4C 2VX4A 5DUPH 1IGYB 2ZCKL 1UYZA 4G8GD 3GRWL 3TV3H 3SQOL 3BPLB 3TA3A 5M17A 3VGGA 1SBBA 1CT8A 1MCWM 1YJDH 4G6MH 4PJCE 4NQDD 3T8XA 4F7MA 2C4XA 1FIGH 1CE1L 2P24B 4ZUUB 4OGXL 2WC4A 4PRHE 4LU5H 1RZIB 2GJXA 2NW2B 2P49B 3N0PB 1CR9L 1INDL 2GUOA 5DFWH 4GXVL 4NWUL 4LVOC 1DBKL 4GG8B 1ZBCA 1GGTA 1CZ1A 3W26A 3WEXB 3JV4A 2AXFB 5DUMH 4C4KO 2QPSA 1FLTX 5CSUA 3U30C 1I3RA 3ZL4L 3D87B 4LLWB 3SEPA 4GWIA 1I9JL 5BVPL 2VAJA 1R5WB 1BJMA 5FF6B 5IJKA 2WBGA 1XGQA 4FOMA 5K93A 4MADA 4PJEF 4WIQA 3ZKNC 3CAFA 1QFWL 2I27N 1QD0A 4PB9L 4M93C 2DYPD 1MUJA 1BYAA 5D7IA 1BVNP 5HXMA 3NACL 5JBEA 1N5YH 3ORJA 4GG6E 5FXCH 2X1OA 1CI5A 4PLKD 4PRNA 2ZUTA 2JJWA 5DVOA 5JO5A 4E0RB 5IHLB 2DS4A 4XNUH 4S1RL 1EMTH 1J0JA 4AEHL 3NABH 1O7VA 1CFQB 5E4IA 3BDYL 3IYLW 3MV9A 4AM0B 4RMVA 4JO3H 5C0DA 4FQXD 3BAXA 4KVCH 4LSDA 3A4WA 1V3LA 3CDYA 2QQKL 4S1SL 4RZCA 2OR9L 1QLEL 3OR6A 5DJZB 3ZYZA 1HHIB 2P8PA 2J88L 3GSNH 3M8OH 5HGDB 1IGMH 2LE9A 4NZCA 4YEEA 4NM8L 1MELA 4KV5E 5KSUA 2OBGA 4UI2A 3IAQA 2IH3A 1JGUL 3J7HA 1QRKA 4X6BB 3NNGA 4X99B 5EORH 1HNGA 3N11A 1CIUA 4KRMB 3BP5A 1KFAL 1EEUA 2HG5B 5TH2B 3P4LA 4GW1A 5GHWH 5BO1H 1W9VA 6FABL 4ZEPA 1NCNA 3SKNB 4KHXL 2BXYA 5DEFA 3FZUD 1UVQA 3O3EB 4JHZA 5C9JA 1LWHA 4ONGL 2DAVA 4TVPD 3L5WB 4N0UE 4O9HL 4YPGA 3DO3A 1HXJA 4XCYA 1AHWB 4Q9RH 5HVFB 4LEXL 4CMMA 4NQUA 1IQDA 1S3KL 2BHUA 5DK2A 1T5XB 5LGHH 5IYYA 3V5KA 3EMQA 1WLHA 2PW2A 1MFCH 1UWXK 1HSBA 3IDMA 3UERA 4ML4A 4FFZH 3BP4A 5H35A 3WFCL 1KC5L 2ESVE 3ARGA 3QIUD 4L3CA 4JFEA 2FO4B 2Q7YB 3QDMA 4FQIH 3WD2A 4JANB 4FZ8L 2BNRB 3RJYA 3JWOL 5E0QA 4WI8A 5CGMA 5TDOA 4LSSL 4PV9A 5FO8A 2OZ4A 3WLBA 1XD0A 1OB1A 4OFIA 4LBEA 2ICWI 2PW1B 1XGYL 3FHQA 3B9KC 3DVGA 4PYHA 4RISH 1S7QB 2VERN 2GK0B 3VPLA 3CZFB 4K2UH 1I8KA 4XP4L 4KY1L 1WP6A 4P46B 3W82A 1GYAA 4ZPVA 2BSRB 1KCSH 4HGWB 4PRIA 3C7FA 4ODSL 5DJ6B 3GXFA 3FT2A 1HQRB 3APGA 2ZKHH 3AFLA 1NOWA 2JEQA 3WN5B 1OQOA 3DXAB 3MV11 3ARXA 1A7QL 5AZ2H 4X83A 1IGTB 4QTIH 1KJ2L 4JFHD 1G7LB 4X6EB 1X5FA 4TTDC 5F89B 2Y6SD 3OBAA 4NQSA 3JWDH 4RMRA 3RWGA 4GAGL 4HJJL 1CEOA 1A47A 4HS6A 1MHHA 4BK5A 3W24A 2X4QA 2VC2L 3CFJA 3MJ6A 4P99A 5A6JA 3QIBC 5KVDH 4JO3L 1E27B 4AMKH 3BH4A 3RNQA 2BY0A 1G7IB 4HJ0D 3QIWD 5ICXA 2ZCLH 2J4WL 2AQ1A 1TVNA 2WCAA 4P23A 5ICYB 1EPFA 4KKLC 3IFLL 4YXLH 4NRRA 4AAXA 3RWEA 2R0ZH 4A4AA 1INEL 3OKKA 4BH7B 2YZ1A 2P5EB 1J8KA 4ODUA 3WH5A 5C3LD 1MI5A 1NFIA 2FX7H 2B0SL 2CIKB 3C8KB 1BG4A 1H3VA 4AEEA 4XAKD 2DQCL 3A23A 3FQNA 4X6CF 4PUBL 3OKEA 4Z95L 2DLEA 2WMGA 3FN9A 3STLA 2OTWA 4HBCL 4S1SH 1ZEAL 2PTTB 1NDGA 4K3JH 3SKJL 2CK2A 2RJMA 2EXYC 4GLRH 4MQXC 3CU7A 4GMTH 1VCAA 3MLYH 2CIIA 3BSGA 1I9JH 5BVPH 1AQHA 1OCWH 5J12B 1WAAE 3KPNA 4UQ2B 2YJQA 4NQCB 3P2TA 5ABEA 4PJBA 4NO3B 1V3HA 3VX0A 1Z5LB 4F7PB 2X1IA 2DBLL 1UA6H 1LK3L 3UJTL 4BK4A 1OD3A 3QCTL 2ADIB 2VXTH 2VDML 4HIXL 5EORL 1OGSA 3N15A 4WWKA 5A2CA 3AICA 2CXKA 2NQCA 2VZ3A 5CJ8A 1H3UA 4Z7NF 3VVGA 1TFVA 4OD3H 2P45B 3ZKQD 4UFLA 4WTZG 5KSBE 3BAKA 5GRJL 3VDHA 1AIFA 5EBWA 4XUYA 4CU6A 4N9GB 1L6ZA 4UIMB 4MXVE 4EZMA 5CJQH 2BDNL 3NZHL 4MQTB 1VJZA 5FV2A 3ZL4H 3MKKA 1EEZA 4PRPD 4UOZA 1X5GA 1NJ9B 3S88L 1EK3A 2NY3D 1HEZB 1NBYA 3HAEG 2P48B 1P4LB 1N4XL 2YC1A 1KYOK 1LO4H 2ITDA 2X4RA 1CU4H 2G60H 4KHTL 4E41A 3HZKB 4Y4FC 1U8HB 2VITA 4ZSOA 3PHSA 1WCBB 4LDOB 5I1EL 1QLRB 1CD1B 2BRRL 4HLZH 2EYTB 1NQBA 1U92B 1TQCB 25C8L 2BZDA 1A6ZA 4W93A 1NL0L 5JR2A 4QXWA 1M7DB 3S35L 4B53A 1HF6A 2J1AA 3HR5B 4HUVB 3OMZA 4GRLD 4H04A 4X0KB 4YHMH 1KGCD 1ADQL 1V02A 4RL3A 3MGTB 5ALCL 2BFVL 4GBXA 2ZWLT 4QB6A 2WMFA 3QXDA 5EC1A 2BVTA 3OAYH 5IG7B 3FTGB 1T0MB 4XC1H 5B22A 5F7MC 1ZHNA 3QEUA 4KTDH 2MFNA 3PHQA 2OP4H 4D8PA 3OJVC 2NCMA 1KPRB 3FB5A 5C6TH 1G94A 5B4MC 5C0JA 5CLWA 3LHPL 2AVGA 2IBZX 3HZMA 3VXMA 3O2DH 4UTBH 3QFJE 4HUUA 5F88B 1LEKA 1H3GA 3D3VA 2ZUQB 4JFFE 3PWUA 3JUYA 3C7EA 1LD9B 3ARBA 2V4VA 2DSZA 4UDTB 4TSCH 1LEGA 1I3RB 4Y4KA 1HXMB 2X40A 2J8GA 2Q86A 4LLWA 1FZMA 4L8SB 2YDQA 3I2GA 2VXUL 2UY2A 2HTKC 2HLAB 2E9IA 4OZHB 4HZ8A 3MR9A 2VDRL 1D9KD 3VE0A 4L4JA 1B88A 4F9PA 4KKBC 3GJEA 3AHYA 3E2HC 4YGVA 1E4XL 2HRPH 3DETD 1H0GA 5E6YA 4PREA 4BZ2L 5JA8B 3A67H 3FO0H 4NGHH 1BVKB 4WFHE 1YEFL 3TJEH 3KLHD 1UD8A 5JO5B 3AYRA 2VYRE 5B8CB 2IPUK 4MNQE 4MD5A 1QEWB 1HWGB 1X7QA 1OLLA 3DGGA 3OAZH 3QDMD 4RE4A 3EO9H 3WE6A 4MA1B 3TA3C 3SCWA 4Q2ZA 4ARXA 4UTBL 1JGVH 3K74B 1XH3A 5B38B 3O45A 5E5MA 1W3LA 4J3VA 1RZKH 1XR9A 5E8DH 5IJRA 4DEQA 1WICA 2GDUA 4W86A 4G9FE 4QRQB 2VCAA 1KUMA 4O2EA 4LHUG 5C6TL 5AYIA 5DWUL 2DQIL 4UAPA 1U2HA 2NY1D 2FHFA 2NY2D 4RIRB 2UUDK 2JK5B 4OMDA 2W1WA 1I8MA 4HUMB 4U1LB 2G75A 4AENB 2D31B 4NYLB 5SWZA 2V7NA 2KPNA 2A9ML 1E6NA 4EIZC 1P4IL 2H8PB 1C8YA 1R85A 3BN9C 2NT0A 4F66A 4QHNA 2FJGA 1NL0H 4K71C 4F7TB 2BNQA 3V0WL 3CH1B 4POUB 3UBXG 3X12A 2IADB 3DHJA 1UM6L 4TUJA 5I71B 1FE8H 3GMLB 1RUKH 5IHBA 1OGTA 4I3RL 4W4ZA 4QY8B 1EJOH 2GITA 3MBWA 3V5KB 1MRFL 4I2XE 1OTTC 5MHSD 1AKJA 2CUIA 1XCTA 3R8BB 1HL9A 3QXVA 5D1QD 5EUOB 3HOBA 3ISWA 4XVHA 2X9YA 3F5JA 4YBQD 3U6RA 1BOGB 1ETZA 1MVFA 1HE7A 4JY6A 1K8DA 3JBG7 3FY1A 1Q4NX 1A6WL 3O3AA 1REIA 3W2DL 3KPSB 1YPZA 3R4DA 1K42A 3KPOB 4P5MB 4Z7QF 5IKCB 4LIQE 2JIXD 4R3SB 3QDGE 2ED7A 4K7PX 1MAML 4LKSA 3OJMB 3GMOA 1VFOA 2WK2A 3EBVA 3MJ7B 5IDIA 4KJWD 5D2LB 4XT1C 1T7ZA 2ESCA 1E6JH 5DHYA 1V6VA 4ZPVB 1RY7B 3Q2CA 3T2NL 1N64L 4FI9A 4DVBA 1X6LA 1U0QA 2V5CA 4MSWA 3QCTH 1OAYH 3A6BL 2H2PC 4JN2A 4JN1H 3FB6B 1Q0XL 4KROD 5D1XA 1LL4A 3C08H 4N9OB 1M05B 5CILL 5DLML 4JFDB 4C56A 2HJFA 2ICEA 3GSNA 1DHKA 5DZNA 5D5MF 3QXUA 1UWWA 3QP3A 2J4GA 3BH9B 1JL8A 5ANMB 4EBQL 3CXDH 4W7WA 5DJAA 2XWBB 2VZUA 1E6ZA 3ARDC 1IT9L 3H8NA 1MH5B 1OAQL 3KL3A 2Y5TB 3LKRA 1FG2A 3AI0A 1GOIA 1OWRM 1GHFL 3FFDB 1GCFA 4N0UA 1S3KH 2WSPA 3W9DA 4XGZA 3INUL 2OXGA 4K7PY 3SUUA 3QI9C 1ZLSL 3AM8C 4BYHA 4MJ6A 5TF0A 4UOJA 5EULV 2VXQH 3F58H 1MLCB 4AT6A 1KIPB 3VI4E 3WO4B 3IETA 3WL0A 3MQIA 1MYRA 2VC2H 2OTUA 5EC2A 5FEBA 1T4KA 1PKQB 4PJXE 1X4YA 4CD5A 2WANA 5IQ9B 3CZGA 4HLZG 2E4TA 4GAGH 5I2IB 3ACIA 3PZMA 2PO6B 5GGTL 1KLGA 3G6DH 5C08A 3ROLA 4JQVA 2NXYD 4Z2HA 2J1RA 4IOFD 3IXTB 1BAGA 3U4AA 2IFFL 4HC1A 4IOIB 3FRUA 2DN7A 1DFBL 1JPGB 3L3OB 5BXRA 4XHJD 5IK3A 1RJYB 1AGCB 4MS8C 3TIDB 2CRYA 3UTTB 1XGTA 3FFCD 5I8CB 1EVTC 1J1PH 4QWWD 4X0VA 5FDWB 5KVMC 1CZTA 3GIZH 1A6VL 3RPIA 1VFBA 4J4PD 3BWUC 3I6KA 4HUNB 2VE6A 4H1LG 3RDTA 2R56H 4CD8A 1NBVL 5HGHB 4NO2A 4RFNB 4PJ8A 2BFVH 5ECUA 4DQOL 1PIFA 1UEMA 2OMNA 1MPAL 3W0KA 1J1OH 1TPXB 3MCG1 1Q38A 2AGJL 2O26U 5AYQA 3MRCA 3VMPA 3IXAA 5H8DA 1E0WA 3RBSA 2AS5M 2ITDB 2X4RB 3D9AL 3DBXA 3GBML 4GS7C 2W1UA 4PJFE 4LKCB 1WWBX 1CTOA 5A16A 1LNUB 1R5IB 4JFFB 5FD0A 1U8HA 5C0FB 2YFUA 3SDCD 4PJIE 3BGFB 4KRPC 4P08A 3KGRA 2FX7L 4DWSD 1GORA 3KNBA 4N68A 3RZCA 3OKMB 3U7YL 3S37L 3KAAA 4WI4A 1K45A 2X05A 3N18A 4R7NA 1A7NL 4OCRH 5C08E 1W32A 3GNMH 2AEQL 3RWCA 1E4LA 3NCOA 4IIQA 3CX2A 4PJDE 2BMKB 5D71H 4YDJA 2VABB 1I9EA 3HE7D 2UWEB 2Y4SA 4XI5C 4CCEA 4XXDA 1JIBA 1BBJA 4G6FD 1WV7T 4NM8H 4NRYB 2PO6D 3T2OA 1NGQL 1QBLL 4K9EC 5K9QI 3TESA 3B6SB 2P1YA 4LCWE 4FG6D 3MV7E 5E94B 4OCSL 3WIHH 1MLBB 2AQ2A 5IMLA 2CKNA 1E70M 1SM3L 4GRWF 4Z7VB 1UM5L 3PHAA 3RL1A 5T33L 5JW4M 3MOAH 1GOFA 2Y25A 2WAHA 1MCJA 5F1KC 5I8EA 1IE5A 3TFKD 1OAZH 4FQXB 4F7MB 3C5ZC 2XWDA 4JZOA 2Z31B 2F8VA 3UJIL 1OAKH 3QFDA 1SJHA 3BHBB 3Q6FA 2Z92A 5D9PA 4P8XA 5CZXD 5C92A 1B0RA 1CFVH 1II4E 3FO1A 4P4RA 7FABL 4YHPA 3RBGA 5EIIB 5L8LB 4I18C 3D0VA 3WKMH 4C57C 3CDGA 4ODXA 1MHEA 4UFHA 5DQ9B 4TRPH 3MA7A 3O9WA 5GQBA 2XONA 5ERWB 1WZMA 2DCJA 2QL1A 3UPRA 4JHWL 1S5HB 5IVZB 4Y2DD 1HP5A 2ZUNA 3L3KA 2QMKA 2QQJA 1W72H 2MHAA 3L2LA 2DSWA 2BC4A 4JCLA 4AY1A 2AJ3B 4L29A 1IC1A 5JHLL 4BQBA 3UTTE 3GHEH 7CGTA 4GRLA 3D3VE 2Y36H 3HB3C 2BVQB 1YNTA 3O45B 2B5IB 4OGXH 4MAYA 3FFCE 1FFPA 4NUGL 1KCVH 2YRLA 4L4OA 4PTUA 1KCRH 4EUPB 3MLPA 1XCQA 4AM0A 3GM8A 4UNUA 5I1JH 3HKFA 1JHTB 4NKQB 3UO1H 1P9MC 2OWWA 3UC0H 2YFZA 1JWUB 2F5AH 2DOCA 3CGTA 1NKOA 4PTTA 3SY0B 1PEWA 4NQTA 5DHVA 1DLHB 3L7FA 4L8DA 3UBXB 3RVUC 3WQ4A 5E8NB 5JW5A 3QG6B 1C08A 1XR8B 1UB5B 4P5TD 1RZGA 3QXAB 4NSKA 32C2A 4OOZA 5F9WB 4RAVB 4TN9A 4EEEA 3QIWB 4OLZH 1GUVA 2A0LD 3MRBB 4GAFB 3U7BA 1G7HA 4U1SA 3TCLA 3X11B 2WCSA 1UYWH 3LIZH 4M48H 3JTTB 3MRPB 2EDRA 3RRQA 1VEMA 1ZE3C 5I66A 5DQDH 2NR6C 3BX7C 5C0BA 1RZ7L 5C07B 2W60B 3FKUS 5FB8B 3WUWG 1K6QH 4U5KA 1G1CA 4H8WL 3RWJB 2EYSA 2WKLA 1IQDB 1E4WL 4DWSC 3O81A 4W87A 3PWNA 4JO4L 5GS3A 3S36H 1Q0YL 3C8XA 4RQQA 5MEQA 1FL3A 1NMCB 3NCYS 5FKYA 3B3IA 2UZIL 2PI6A 4AIUA 1ERNA 5EZJB 4QRRA 1MY5A 1VJSA 4OB5L 3PE9A 5SX5H 2DJSA 1A6AA 2CLRA 1ZLVH 5C0AE 3F62A 3QUMH 2DQHL 2W9XA 3U0TA 2VDQH 4HWZA 3PQYD 1SR0A 2GT9B 3MRNA 3UYRL 4OZIA 1KFAH 5C0NC 4X7SH 1DCLA 2PXYB 3A6CH 3HE6A 4OKVB 1RK1B 4LCYB 5EOCL 3S3PA 2WZEA 1O0VA 1GOGA 2OS7A 1Z6JT 3HMWH 1SJEB 4M62H 4A45A 4NN7B 2F54E 4WUUA 4XPFH 1M71A 5DT5A 2FJFA 3SDDA 3ZDXE 3GIZL 2W1NA 1HHKA 4I9WE 2VLRD 4JQIL 4K7FA 3L1OL 1WFOA 3DXAA 4KPHL 3RWDB 4OZFB 4TOQA 3W11D 2GSGB 3SJVB 1C16B 3IDGB 2KDGA 4F2MA 2J7MA 4Q7NA 1ISWA 3T1FA 3ES6B 5EFIA 1CICC 1JGVL 4NO0D 3WIFB 4LHSA 5J6GB 4ERSH 2HVKB 1YNKL 3RVWD 1FH8A 4V1DB 3AJ7A 4RCAA 3VMNA 5F3BB 1ZGLP 5KVEL 4I9WD 3ACHA 3PZNA 3WNMA 4BFIA 4LFHD 4XC3H 3D3VD 2EJ1A 4ATDA 2K7QA 1BQCA 4EXPX 3H3BC 5IFAL 4FF5A 1DVFA 2QQNL 5CJBA 2GK2A 1WF5A 4OZGA 2I60H 2VMCA 4EI6A 4BH7A 1GGBH 2XM2A 1U8KA 3VA6A 4HXAH 5DFVC 4B16A 1U58B 3I2KA 5GRZA 4LLUB 4KMTH 2LS6A 4W4NA 2D24A 1RULH 1IGJB 5I30L 4UFJA 2BSSB 4Y5VC 3VWKD 1RUPH 1J88A 1DQDL 3QQ3A 1WKYA 4MA7H 4P7QA 1GGUA 5HDLA 5FKAA 1EXUB 1KG0B 3IXTA 2BP3A 4UQ9A 3INUH 1V0LA 2W46A 1XF3B 1NUKA 4PCSA 1RUAH 3GGLA 4ODVH 2HMIC 5DD0L 4LQRA 1UD2A 4NRZB 3HAEB 4ALAL 1N6VA 4BSVA 1EJOL 1CS6A 4FFVC 4G8GA 1RULL 5DJXA 1NUDA 1UKQA 5FYKE 3CUGA 3MV01 2ATPA 5F3HB 1KTDA 2EIBA 3WDPP 4EXKA 3NCEB 1U8OB 4NRXA 3V0WH 2DCKA 3E3QC 4MVBC 4ENEC 4QEGA 5KSUB 5FAAA 4F15B 4XC3L 5I19H 2WAGA 1FPTH 3NGBB 3D48R 3MNWB 4X99A 5EU6A 1YY9D 5CSZB 2DF3A 1H9VA 5DFAA 5K9JH 2E7CA 3AS2A 1KBBA 4NNXB 2O61A 2PYFB 4DVRH 3EFFB 1T0NB 4QF1A 2ESVA 3I2IA 1H49A 1MXGA 3N1GC 2YD3A 3IU3A 2X70B 1FJ1B 3HUJE 3KLAA 1D3CA 1KEMH 1HEZA 3VFMB 4OD1L 2BOBB 2YIHA 1U36A 3BSZH 4BZ1H 1KJVA 1FCCA 1TZHB 4YDLB 3V4PH 3ZOAA 1T5XA 2VOTA 4RX4A 1R3LA 1D6EB 4HK0A 5HYJA 3W9EA 2IBGA 1YN6A 1OTTD 5CD5C 3MJ9H 4NZRH 3U7AA 4AD3A 5I1GH 2YD4A 2XVNA 3MACL 3WS3B 4PRHA 1IBGL 5HJ3B 1W9UA 4NQVA 4M3KB 3G6LA 1TE1A 1H3XA 5CQ1A 3JV0A 2F58H 4MDJB 1AGDB 3VXRB 4QDQA 5B4NA 1I7UA 5GS2D 1BBJB 2ZSVB 1S78C 3QNXB 1MF2L 1Z0NA 5HDBF 1J87A 3S3SA 4JY5H 1OHQA 2RVAA 4Z2JA 4PV9B 1ZOXA 5CZVL 5L7XL 1MLBA 4H0HB 5FA3A 5L2JA 4XNXL 5E2UL 5IJVA 2D7TH 1H5BA 1DQLL 1OAXL 4AL8L 3VXQA 5GPRA 1NGXA 1YMME 4FS0A 1F90H 2UVFA 1F97A 3FT3A 2GJXB 2YOCA 5I75B 4Z7UF 3ULUC 3A6CL 4UUJA 1UENA 1XYFA 2P5ED 3MZTA 4R90L 1UMHA 1TG7A 3GI9H 4KI5E 4HUUB 4MCZB 5F88A 3MRIB 3WFBH 2ZEZA 3RFZC 1K4CB 5HTSA 2QLYA 2VO5A 1OWWA 1QO3A 1R3JB 1RJLA 2WMPA 1CVSC 4HIHB 4GKZB 4KI5F 1JPSL 2C4FU 4JG0L 3WN5C 5JW4R 4PJXA 1NLBL 5IBTL 3GGWB 4GMTL 4GZJA 1INQB 3MBEB 4QYOB 3GI8H 4JG1H 3WYRA 5CWSA 1NCBL 5GS0L 4XB3A 3HCVA 1WAWA 2CUMA 4UQEA 1YC7A 1J8HD 2WUBL 3PWLA 4NJ9H 3MLVL 4UI9L 3GJEB 4WKAA 4AEFA 5INDB 2H32H 3QJFB 2AJ3A 4L29B 1Y6NR 4PRID 1P7KB 3WUBA 4GAYB 4QHLA 3MRDA 3NUKA 4H26A 3ECBB 1RUAL 5CSGA 2UZXB 1OTSC 1R0AH 3C5JA 4RSVA 5D7LB 3VFRA 2CMRH 1AD9B 1YEHL 2AJSH 5ENWB 3ZT7A 3MV9B 2OSLB 1S9VB 3WFEL 2XNAA 2VDKH 3GSVB 3QYCA 3V6OA 4TQEH 3P9LA 3OGSA 3HLAA 3RQ3A 2CK0L 4HG4K 3WXWL 1ITBB 4HCRH 2IQ9L 3T0XA 4QHUB 3NAAL 3L9RB 1E3XA 3LB6C 3BZFB 4KGJA 4PGEB 4QCIB 3OF6A 1CZ8H 1EAPB 2D7NA 2QSVA 4PTXA 3LEXB 4DN4H 1OTUD 4HKJA 5D72H 3NZHH 5FYLD 5BS0A 1T7XA 3SCVA 1FVDA 1Q6CA 4J3TA 1YDPA 4WI5A 3T0AA 3HU7A 1AO7E 5EU6E 4EOWL 4ELKB 3GHBL 3SE9L 5ESAA 4NYLA 1CDYA 5FK9B 5GRJH 4W50A 4JHAH 1HH9B 1D5ZB 4KAQL 1P84K 4N90D 5ICZA 1EJ6A 3F5KA 4FLSA 1E71M 3CNKA 2RFXA 3AHVA 5I66B 1HJQA 1FDLL 1CFVL 3LDBB 3WD3A 4Z7NE 5GZOD 1ZANH 3VXTA 4QP0A 2D3VA 1C5DB 2IPTH 3EJYD 4XPFL 1VERA 1UJ3C 4MXQC 5E24E 3PP4H 1E6SM 5T1DH 1T66D 3CH9A 3BE1H 2RGSA 4YZFF 2VLME 2Q7NA 3WIIH 4APQB 4JHWH 3L3JB 4R4FH 1FV1A 1YYMH 3O4LB 1DBML 1NMAL 4MD0B 4U1KB 2BRRH 2JELH 4LAJH 5EZJA 2WBKA 1CDBA 3LV3B 4KRTA 4FABH 4K71B 4WKHA 4QRPA 4W8JA 4BUHA 1T89A 3MNZB 2E33A 4MO3M 1GHRA 3U1SL 3JUGA 3OLDA 1VPOH 2YPLA 1YY8A 5CZKA 3S5LB 4CN1A 1INEH 2PW1A 4LLMA 3Q48A 2FX9L 4GMSL 2W63A 5TE7L 3GMRA 1L9NA 3BUYB 3QEQB 3QO0B 3GMQB 3IVKB 3PGCA 5C86A 3NCFB 1W3JA 1WEJL 5EJ1B 5TGBA 5DHYB 2Y06H 3IDIB 4C59B 4D6EA 4Y5YA 1FN4B 3CDFA 3HE7C 3I3EA 1J5OH 2L7JA 1T1WB 4HC1L 3MYZA 4ZZ8A 3QEQD 2GJ6A 2ADFH 4GG8A 1QW8A 3DMMD 1ZHLB 2WP3T 4WLCA 5DEZA 3O6LH 5M95B 3UTPE 5BXTA 1NMBH 1U93A 1V05A 1LEKB 5L2KD 5MI0B 2Y23A 5LXGH 3NCJL 1OW0A 1PZ5B 1UH2A 1D6VL 3RX7A 3CFJB 4MWFA 1OIFA 4GKOA 1KCSL 2ZX6A 2AEPH 1ACYL 3E6HA 1TXKA 3NA9L 43CAA 4BKLA 4U3HA 4OYUA 4KJPD 4PJHB 5T5FL 3TBWB 4NCC1 1XGRA 5CHNA 3G5XB 1HI6A 3MRHB 4Q6YA 4O02L 4XCFH 2XVPA 4XPTL 4JGUA 1CG9B 4QXUH 3DYOA 1WT5C 3ZDYF 3EYPA 2OYLA 3TP4A 1YYML 1NUNB 5CEZL 3W6LA 1QVOA 1G6RA 3D0LB 2IEPA 5E8OB 2OTWB 5T1LD 1YMHB 5M03A 3L3DB 4CD7A 2HP4A 1OP3K 4QT5B 4F33A 3VIKA 2EE3A 4TUFA 4WI9A 1NGQH 1QBLH 4ZYKB 1YNLH 4RZCB 3O8XC 5JQ6H 2R0ZL 1RHFA 5A3HA 2GY5A 3DSFH 2PETA 4EKXA 1ZBWA 1YEJH 1KGYA 5I73B 3RHWK 2FR4B 4O9HH 5LA0A 3DV6B 1RHHB 4FFYH 2XQYG 3ME0A 1XCXA 1SJVA 5LQBH 3E6FA 1VKXA 1UOKA 2CHOA 1HL8A 5FM8A 1VESA 3CLEH 4UILH 3MGAA 3WNPA 1KJ2H 2NXZC 4NKOB 1UKOA 1NMAH 4YUEL 2CXGA 3EYVB 4MD4A 4LCIH 1UACL 2ARJA 3OLIA 1JDDA 2PYFA 5GISL 3GNOA 1ZT1B 2ESVB 3M8OL 4EJ1C 4RYDA 1E6XM 3BCFA 4H20H 1HQ4A 2OR9H 1C91A 2AK1L 1L0QA 5GS1B 3UROR 2EPOA 3GSNL 2YC1B 2X0HA 3FT4B 1JV5A 1H5BC 3BUTA 2VNCA 1FDLH 5F96L 1KJVB 1WEJH 4YHZL 1PVHA 3DBXB 3MLRL 5SWSD 1CK0L 4IHOA 5HHNA 3E8UL 4CNIA 3W5NA 4OMCA 1IAKA 3VILA 4Y2DC 3GH4A 2Q7YA 4LCCA 2Z1SA 3C08L 3GSWB 1CGYA 2KKQA 4EOWH 2E6QA 3OX8A 3CMJA 4FQIL 3VFVB 4B50A 3WLBB 1QSZA 1H3PL 4KK6D 1BQHA 4UFMA 2WUBH 4NJ9L 4URTB 2AXJA 4KK6C 3AIVA 4BJLA 3DXAE 3EJJX 4HZ6A 1MFAL 3CZEA 1HH6A 1T2QH 1MVUB 4Y2DA 4O2CB 1J1XH 3REWA 4P57B 3OB0K 2ZEWA 1HIZA 1CL7H 3IDUA 1CFTA 1Q72L 2A6DB 3F7QA 2Q1EA 1NGXB 3AGVA 4G8IB 3VCLB 2H41A 4JM2C 4YDVB 2I5YH 4RFEB 1CGXA 3DJ9A 4MB4A 1JYNA 1SHWB 3GMMB 5IMLB 4DEPC 1I1FA 1U95A 2YXMA 5F89A 3N50A 3ALFA 3KYMA 4ZSOE 4OZIE 3DRQA 2XRAH 3BRFA 3U79A 2X9XA 4JFDD 4AH2B 2DGAA 1QRNA 3V0VB 4JREC 2A73B 4KAQH 3DVNB 5D7SL 1CDIA 1MEXH 3BSZL 4BZ1L 5C0CD 1OAQH 5J89A 3SQOH 2E27H 2XN9D 2FGWH 3Q6FB 1E4NA 2CLZA 3BIAX 4XNQB 1Z9MA 2Y5TA 2J3SA 4P9MH 1IEBB 1M6OB 3DUUB 3MCKB 2FJHB 4RDQF 3RL2B 2ZIDA 3KPMA 1MXDA 1C93A 3NAAH 3SCTA 4N0CC 1ZL1A 3RTQB 4POYA 1YEGH 1JF5A 3CZUA 4B3LA 5I17A 2BNUA 4FG6C 1CWVA 2R4SL 4YO0A 1Z2KA 2CQVA 4LHQB 1E27A 4CU7A 5D1ZC 4U2YA 1X7QB 4HT1L 1RV6X 5EWIL 5IFJA 3RX5A 3IJYA 2VKWA 2BFGA 1LVEA 2J25A 2GW5A 2QBWA 3C7OA 4PRNB 1UMIA 1N5AB 5EN2B 3GSVA 4B3KA 2V2XB 2WZHA 1N8ZA 3ZLQC 4YZFE 4NQCA 5TF1H 5C70A 5I1IH 1T04A 4IISA 3BD3A 3P30L 2EDEA 3DX9B 3A21A 2A2QT 5J9PA 4RWHA 3HE7B 2WZPD 1GGIH 5IHSA 1KEGH 4PGBB 3CC5A 2PTTA 5BRZA 1IC7H 3QO1B 5HVGB 3B9KA 2D4FA 1QYGH 3QR2A 1J9YA 3OHXB 4YPJA 3L3OA 2P8PB 3J8F7 4LQFL 4X4ZA 1F42A 3RUGE 1UWTA 1G7JB 3S5LG 1NGZB 3GI8L 4W4OA 4PPTA 5CD3A 4N9GA 4Z0BH 2ICWJ 2ZSWB 5DZOA 2J7FA 2WAAA 3BLKA 1C5BH 3DX6A 5HD8D 3WO3B 1R86A 1V6WA 1RZGB 4ZENA 2ADJB 2W1SA 1J0HA 5L88L 1KELL 4JFFD 1I1YB 2UWFA 4OZFG 3TBTA 4Z0XA 2EO9A 3VM5A 4NC1E 3PHOA 5EU4B 3P0GB 3CHCA 3WJLA 4L9LA 1TVPA 3LKNB 4OF6A 4GW1B 5J11B 3MFFA 4QNPF 5C6WH 3WBDA 3JTTA 5T3XE 3ILPA 1MREL 4ORGA 4X7DC 4PB0H 1T20B 3VRLF 4UIMA 5HYFA 3CUHA 5J57B 2MCPL 3EO1B 2PWDA 2XZCH 2D7TL 1I1AA 4IRSC 1JVKA 4N90E 2YD6A 3QDHA 4DXTA 3OJDB 1Y18A 3CCHA 1GOWA 1A6ZB 3PUCA 4OAWB 4MJ5A 1OAUH 3MMEB 3HR5A 3KPOA 4P5MA 4CVZA 3KNBB 4L3EB 4DUWA 4N5EC 5FIEA 4KRLB 4JRYA 2XVGA 4M8QA 3K8KA 3VXSA 4Q22A 1QSEE 5EU3B 1SYVB 1IQWL 4W8AA 1KOAA 1NAEA 1LLOA 2X6MA 5IBLD 1X5YA 2FWOB 3ZO9A 3BGMA 3K4ZA 4YR6B 3BIKA 3FB5B 4JLRB 2P7TB 2BRQA 1BLNA 2BNRD 4I5BA 4WJXA 4XCCL 3HI1A 3BIBX 3S34L 2PWEA 1I9IH 4DWSB 1KJ2A 4H8WC 5INCB 3RGVC 4V1DE 5E94A 4HGWA 3SDAC 2V5MA 4L4VA 3PV7A 4GRLC 4JRXB 2XKNA 4X98A 5LCVH 5MP6H 3QNZA 2E9MA 2N7BA 2HA1A 3DMMA 2WMKA 2X8RA 4D9QD 1OP5H 1S7RB 5F7LB 4P59L 3V52L 2WABA 2MOVA 1S7VA 1IKFH 3C6SB 4WHTA 2HKHH 1XF1A 1ZHBA 3D39B 3S88H 3HMXA 1KIRA 4KMLB 1J0YA 2R0WL 3E6HB 4KJWC 2W47A 1T1XB 4H1LH 2FRGP 2Q87A 2RCSH 3BHBA 3ARSA 2CJUH 3GMPA 2OSXA 1QSFE 4C55A 1FNHA 3SCMB 3STBA 1LEIB 3W37A 5G05L 4HX1B 2C7UA 4Z8FH 1P9MA 2V3EA 3TVMA 1N26A 3KPRA 4F8XA 1ZLWH 4EUPG 2ITCB 1QEWA 1PQZA 2DQFB 1UZ8B 4CW1B 3ARBC 4UDUA 3L5XL 1T4KB 5HHPB 1OSZA 2CIKA 3C8KA 2WWDA 3PGFH 2GSJA 5IB1B 4FQCL 2MHAB 1A0QH 1EOMA 4NRSA 2BC4B 2R0LL 3LEIA 4M62L 1HJSA 3HC3H 3ZJ6A 4N0RA 3SDYL 3OLEA 3VFSA 2W07A 3CK0H 4NQXB 4WJ5B 5JXIA 1TDQA 1GQPA 1ODAA 5I18H 3MRQA 2Y8KA 1TLKA 4PRIE 3UYRH 5EO1A 5I1CH 1IM9D 5FYLH 3TH4T 2DLTA 4IEFB 5MEOB 4PJBB 2CCRA 2F8QA 3SCPA 3A67L 3FO0L 4DW2L 2D0FA 3VH8A 1PBGA 3OR6B 1JDAA 1VENA 3ZR6A 4G8EB 4X6FA 5DGQA 4UTAH 4NC0B 3WFZA 2CDPA 1MCLA 4HT1H 4JZJB 4AEIH 2ZUMA 3W27A 5C8BB 2E26A 3BKJH 4F8TA 5H2BA 5DC4B 4IDJH 3WH9A 4NOBA 4HWBH 3NRUA 3GMLA 5C8JB 3QR3A 4KROB 4TNWF 3MGOB 1FH7A 3UTSD 2C26A 3QRGH 5KOVC 1JF6A 1PD6A 3QDJB 4Z78B 1MWAB 5D6DC 2PC8A 2ZG1A 1CLOH 1ZSDA 1IGFL 5JOEA 5A2FA 4L9DA 3C60B 2EIZA 4OD3L 2NY3C 5F70A 4AZCA 4LARH 5EUOF 4LSQH 4U4BA 3GSUA 2AI0L 2VLKA 4PMDA 3JWNC 1H4PA 1WCGA 1ULPA 4YK4B 5DHVH 5IFAH 1I1RA 1RZJH 5F7EH 5HBBA 2X89D 4M7JL 3RWJA 1PZ3A 4WHCA 5MEPB 3Q5TA 3T0DA 4ELMA 4P7LA 4M1CC 4UZUA 4QB2A 3IGAA 5E99L 4YNYA 1K9FA 3WQ5A 1RURL 1D9KA 4LYQA 2EXOA 5JOPE 1KCUH 3AAZA 3LKPA 4OFYA 1BD2B 4MNGE 4NPYB 5C0CB 5EBMA 1IEHA 2E7BA 5A69A 3H9SA 4YLQT 3SKJH 3EYSL 5I1IL 3IIIA 3MLYL 5JIKA 3BZ4A 1XH1A 3FQTA 4MDJA 1PW3A 2MQ3A 4D0QA 1I7UB 3IU4L 1A6PA 4HQQH 1A6AB 4MSWB 1K6AA 3L3HA 4ETQB 1MFEL 5DD6B 1BGXH 4QXTB 4JKPL 4NO0B 4PS4L 1ONQB 3G6JE 1T0MA 3H3PH 1I8KB 4XWGH 3RIFF 1E40A 4WW2C 2MKLC 5EOCH 1KPRA 2Y36L 5D2LA 1W91A 3VIGA 3SBWC 1OARH 1DWJM 1KPVA 2XICA 4AH2A 1GQJA 2A1WL 2A73A 3IJSA 4PJDF 5C1MB 1O7SA 1S7XB 3PF2A 4H1LB 2IAMC 5DMKB 5D1QC 1K4DB 1N7ML 4HJJH 4PTMA 5F7DB 4Y4KB 1D5BA 2ZXBA 4NDMA 2PXYD 4F2MB 4GSDH 1JTTA 1LDPL 3K3QA 4H20L 3ECQA 5FIPA 3WHE1 2RQ8A 1QI4A 4ZPTB 3MREA 3IJ7A 1M01A 2YK1L 4FXLA 5SWZD 3EYQD 2F54A 1WUNT 3WFCH 3NSXA 1Q9OB 1L7IH 5F3BA 1NFDE 2VMDA 3GJFK 5TPWH 4UV7H 3TO4D 5LQBL 1JFXA 4H2CA 1LO3H 3K75B 4JQVC 5IQ9A 5BW7C 5LYRA 4EI6B 3GMNA 5DA0B 2NY2C 1UY2A 1ZT4B 3DX7A 5GJTL 2E9BA 1K5NA 1VACB 2X4TB 2XTJB 3K2UH 4I77L 4MAYB 1UY3A 1RK0A 5HYSA 2G2RB 4C83A 1SVCP 3O6KL 4K3JL 1WBZA 4FP8H 1UM4L 5J9PB 1AD9A 2GVYA 1CECA 2OSLA 5DJ2B 5JXEA 1DVFC 3SKOB 4LPWA 2GTZB 3AM8A 4ZTOH 4LLVA 1JI6A 1BGXL 3D5OF 4YX2H 1KLUA 3T3PE 3VWJB 4PJFB 3OZPA 3B2UD 3O2WH 5DJZA 4QDRA 3VTRA 3O11B 2K9UA 3I50L 4PGDB 3FRUB 3O6KH 4J27A 5KOMC 4XP9L 1NLDH 2P47B 3LEXA 4OJFL 1ZB5A 4X6CE 5ESQB 5HHOA 1GPOH 1SMOA 3K2UL 5A8MA 3W25A 5L9DH 1PGRB 4DKDC 4P02B 4Z7WF 5C2BH 4BQ3A 3MRCB 3AY4A 5AG9A 2XGBA 4OJYA 5JHLH 3LVEA 1JZ8A 1ES0A 2GK1B 2J8FA 1A4KA 1FGVH 1L7TH 3IAGC 4ATWA 3ULUL 4M7JH 4BF7A