3K46A

Crystal structure of full-length e. coli beta-glucuronidase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
603
structure length
597
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-glucuronidase
total genus 178
structure length 597
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k46A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k46A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k46A03
1C5BL 4JRXD 3ULUF 2VXQH 4AEHL 2IAMC 2YL9A 1FVEB 2LABA 4GZ9A 2R4SH 1JVKA 4XAKD 5FKAB 4JO1L 3U0PA 3S36X 4UT9H 4OI9A 2QQQA 3D9AH 4YHYB 1C92A 4L4TA 1PZ2A 2F2HA 4DN3L 3OQ3B 3HMXH 4QRTA 1RZJL 1ZJBA 5EH1A 3ULVD 4X8JB 5IBTH 1E6QM 1FNHA 4M7LH 3U30B 3OGSA 5T1MA 1R5WB 5EUKB 4I48A 3DURB 2RR3A 5CSYA 4K23H 1KELL 4F9PA 4CCDA 4YHPA 3CZJA 5B3JE 3TNNA 5E56A 1TCRB 3OKEB 5CD5D 2J74A 1OF3A 3L2LA 1I9JH 1W0WA 3RWFB 1RUQL 4XNYL 4XX6A 4JIEA 2BJMH 5HHPA 2QADB 4DW2H 3V6OA 2XA3A 2AK4E 3L95A 3MGTA 3EAKA 1ODAA 3CFDB 5ADOL 1OGAE 1UY3A 4UTBH 1IGYB 3WFCH 4Z6AT 3ET9F 1C1EL 3U1SL 2D7QA 1ZVSB 1DQMH 5F88A 4AC1X 3DRTA 4LSTH 3KR3H 4R3SA 4F37K 2AJ3B 1CEOA 1I9RL 2CERA 1YEIL 1K8IA 5C0FA 3U36B 5IHZA 1FFRA 4LCWB 5CGMA 3HEIA 2NSXA 5FF6A 1SVZA 3Q6FB 4MNMA 1W72A 3BGFC 4OUEA 5DMIL 4UIKL 1VENA 3EMZA 2IQ9H 1UOKA 1BEYH 5JBFA 3OR6B 4MS8D 4H7VA 4PRHA 2H32B 2BRQA 3ARFC 5D9MA 3QEUB 1OT2A 4DZBA 5IEHB 2EYTB 3BEWA 1XAUA 3GMPB 3VD9A 4MA8H 4NQEE 2WBJC 4XPBL 5TDPA 3CZ8A 3HFMH 1TETL 4WNQA 1M6OA 4KDWA 1OBAA 2P5WA 5EUOA 4P7OA 3MODH 1KIPB 2Z31A 1DDHB 4S11A 1OWQA 4H04A 1YUHB 5E1AB 4W87A 4F7MB 1AO7A 1JNHB 4TVPL 5GQBA 2NY5H 1KV3A 1NQBA 4YR6A 1B0GA 1R85A 3VG0L 1QNSA 3E3QC 3GMNA 1WFTA 1I7ZA 2VLRA 1B2WL 4M7ZB 3WIHA 1AD9B 4UCFA 3QAZC 2DSUA 1IAIM 3PV7A 1KEXA 4M80A 5CQ1A 3WH6A 1X5ZA 3MV8A 1ORQA 2J4WH 1TENA 2JCCB 1V05A 1NMCB 5D7SH 3IGAA 1EVTC 4Q22A 1AQ0A 1TZGL 3V8CA 4OIIL 2YDRA 2YN5A 5CSUA 4HF5L 5E99H 4YR6B 5A6AA 4HIJB 1CZ8L 1P2CB 3WEZA 3S5LB 1H6YA 2XYCA 1MHCA 4JO4H 1OAKH 3AB0B 2ZUXA 2AS5M 4WWKD 4FQXD 3TH3T 3WJJC 4R96B 4E42A 1CWYA 3SCPA 4DEPC 1T7WA 4G9DA 2R15A 4JL2A 4OLWH 4E0RB 4X8XA 4QLLA 2Z8WC 5IJKA 4W7UA 1FOBA 4G3YH 1G7QA 4MNHA 5FYLL 2XM1A 2AKRB 2XA8H 5J7CC 4JHAH 1UJTA 5EBGA 5F71A 1BFVH 4G7VH 2A6KA 4PTWA 1UZ6E 4J8RB 4ZFOL 4JPIB 1J87A 2ZSWB 4LF3B 3IJ8A 3WQ5A 4KHTH 5FM8A 2AK1H 3FOLA 4WU7A 3BN6A 3WH8A 5D70H 4H1LH 3U82B 5HHQA 1FFOB 4ZTOH 5TPWL 1A7RL 4P8UA 2VLJA 1MCHA 3MZGB 3QUKB 5FAAA 5DMKA 4X6DA 3BIKB 3PBGA 3T09A 4Z7VB 4QTIL 4FQ2H 4FQ1H 3LIZL 1W9XA 4PY8J 2RQ8A 5KOVC 3IVKB 4LBEA 1KB9K 5J6HB 3NIDF 1CBGA 5CP3A 3S36L 2Z31C 3MRFB 1E6RA 1YY8B 2ATPB 3AREC 1QFHA 5E09A 1ZHKA 2VO5A 3DGCR 1LO3H 2ZICA 3MRGA 3T77A 5JUEL 3TVMB 2RV9A 2Y23A 4U1LB 2V9QA 2MHAA 3AVEA 4TVSa 3WV0A 5HY9B 1TVPA 2R56L 4PJ9A 1N0LA 1F45A 5IMKA 4JDVA 4F9DA 3WUWG 2E31A 4YPGA 1KQZA 4LASL 4TVUA 1SJHB 5DD0L 4OIFA 5T3ZE 1DLFH 3ZR6A 4BK4A 5E5UB 2IWGA 4NKIH 1IAII 5GS0L 4BSWB 3LS5L 4MXVE 3D5OF 1BWMA 1PZUB 5C0IA 1KFWA 3TN0B 1GOIA 3RJQB 2CR6A 2HJKB 3ZHKA 4NIKB 3UESA 4XXCA 1A6TA 1KCSL 2YA2A 3QHFL 5I71C 3A4AA 3LN9A 1E4KA 3HPNA 2C3WA 2VDMH 3OLIA 1T22B 1HN1A 1ORSA 2FX8L 3I50H 4UOJA 1KN2L 3WNLA 3VXPB 12E8L 1PEZA 3IFPB 5CP7A 1WFNA 4ODUA 3WS3B 2V2TA 3PHAA 3LKPB 4PRAB 1VADA 3DX8B 2VR9A 4AIZA 3HHRB 1Q94A 3NFSH 3TC9A 3KS0H 3GMOA 1ISWA 4NKDA 5I15L 4QRPD 5A94A 5FGCE 3D1MC 3NCFB 4PJDF 2Z91A 1UXWA 4HUVB 5A69A 1BQUA 5GGVL 4LQFL 3WUEA 3OZ9H 5GNZA 3RDTA 4G9FA 2OL3B 3GMQB 3K74B 2FJGB 2J1UA 3CDFA 3FO9B 3E0GA 3RU8L 1LP9A 2APFA 2C4XA 3NIFF 2X9XA 2DYPB 4NKQB 3QUMH 5SX4I 4TULH 5FM5M 4G42B 2XPKA 4XPFH 2MWCA 4ZAKB 5L0QC 4NZCA 3STBA 3V5KB 1VSCA 4Y5YA 3FXYA 5ILTH 1NBYA 4QXTA 2APTA 4GQRA 5EA0L 5ISZB 2GFTA 3VXOA 3ZDXE 4D6CA 1T0MB 4RQQB 3EOTH 1TUXA 1LO5B 3ARBD 2JIEA 3S4SG 5IW6B 3AREA 5CZVL 2VUYA 4MNGB 5D7JC 2EYSB 4E5XB 5LGKA 4H41A 4KRUA 1B3JA 3PHQA 1NCCL 2XTKA 4R7DB 4PJDA 1CFNB 5C0GB 5KSUB 5ANMA 5CJOH 3V79C 2X1WL 2AK4A 1W3JA 1PKQE 4NRZB 5B8CB 1U36A 3QDJA 2FSEA 1K9EA 4FTVA 2NNAA 4P23C 1WIUA 3ARGC 4MNKA 3CFEB 1HHIA 1ZTXH 2CKBH 2C3VB 4ZFZA 1UY0A 5T3XL 4PJXA 3DSNA 1E55A 5GGQH 3U30C 4P8XA 1CTNA 5T3XE 1I1RA 3NSMA 3QI9B 4Y5VB 5IQ7L 1I7RA 3K7UA 4U1HA 3L4VA 4W89A 4JKPL 5DRZA 2BOBB 5ISZD 1U33A 1J0YA 4KZEH 4PY7B 3RWGA 4GLRI 4KGJA 3BXNB 2F5AL 4HBQA 1TNMA 4LCYB 4DKDC 2V5DA 2DF3A 2FEDD 2EE9A 1WC7B 3VFVB 3CIQA 5FL1A 1FGVH 4DOHB 4P4KA 3EGSA 4ZFZB 2Q87A 4ODTL 3VWJA 1RZFL 3UETA 4JAMA 1EAJA 1TFHA 5ABGA 4H20L 3TCLA 2JE8A 2ID5A 4RMWA 4UNTA 1WO2A 1BPLB 2IAMD 3L4YA 4PJAE 3IJYB 4GAJH 4MSWA 7FABH 4YDKL 1YC7A 5DZOA 3SDDD 4HWZA 1F6FB 2ZOLA 4MD4A 4QRPB 2PYEE 4PGBA 4I2XE 2H6PA 3MA7B 2GTWA 4XPHL 2QHLA 2RGLA 4F8XA 4GRMB 5IW1A 4KVNL 4PJ8A 4CDGC 2W1QA 4P46C 1QA9B 1UD2A 4WFHD 1E3XA 3MRMB 3FRPA 3HR5B 3OWEA 5D2NE 5EU6E 5AC4A 2BNJA 3Q5TA 3MLZH 3P0VL 4X4XA 4Y2DC 4XI5C 3QJFB 1NBVL 2Q8BH 5BS0B 2PWEA 1CBVH 1UC6A 4M4RA 3AHZA 1K4CB 4MNGE 5DEFB 3HOBA 2WMIA 4NP4H 2YSSB 4FXGA 3GSNH 2QBWA 2XSAA 1S9YB 4IOFD 3D0VA 3KYNB 3O3DA 3UBXG 1DL7L 2VITB 3KYKH 2DIAA 4H8WL 4UT7H 3RTQB 1PIFA 1KXVC 2CD0A 2WSKA 3VFNB 1TVDA 2E26A 1FORL 4JANB 2XVNA 2EXYC 4QHLA 1S78C 3CNKA 5FYKU 3QCUH 3LN5A 4R4BB 2I27N 5FD0A 1CLOL 4KJWD 1TVHB 2ZXBA 4N68A 1FP5A 1H41A 3UAJC 1EOMA 4PMXA 5A8NA 3MUHL 1XNAA 1E6OL 3B9DA 3UTTA 4CN6A 3NUKA 4C56B 1UENA 4EI5A 1N3NA 4PS4H 2E7LC 2DWDB 3Q5YA 2N7AA 2AJZB 2BVEA 3M07A 5TFSL 1WVZA 1OCQA 2RJMA 3UJIL 1K4DA 2WIMA 3EO9H 4EAMA 1RJYB 4FFWC 4N8VA 1MRFL 4K8RC 1PBGA 3FT3B 3WH5A 1EERB 4J4PD 2P24B 1MAML 1M53A 3IJHB 4GXUN 4GG8B 2FHCA 3LPWA 3VD7A 4YNYA 3T3PF 3QXAB 2G9HA 2F74A 1BZQK 2BNRA 5TDNA 1YDPB 3JBG7 3PNWB 3OGCB 1LEIB 5EOCL 4WV1C 4MXQC 4RGMB 2YC4A 3BW9B 3QFDB 4P2CG 3VNZA 4PLNC 4P9HH 2V7NB 1UM5H 3N85L 4WY7H 5JMOC 5ABDE 1ZHNB 3CLEH 2WYSA 2GK1B 1TVGA 4OFDA 1W9BM 4ZYKB 1FL6B 1TZIB 4OF7A 4GAGL 4E9LA 5C0CD 1ZHLB 4AZ8A 3GYCA 3PP3H 3W6LA 2CKBB 3VPLA 3OXSA 1L7IL 2BNQD 1E5NA 1A4JA 5I1IL 3BD5A 4G6JH 3C7EA 1UWWA 4XVSH 4IRZL 4JFDE 3IDIB 5C92A 3QNYA 5IOPA 4EEEA 3T3MF 4X9BA 4NQTA 3S96B 1TZHA 3NCJH 3ZR5A 4L4TB 2HMIC 5F3BB 3T65A 5CBAB 3U9UA 1HXYA 2PI6A 3RWHA 1AQHA 3FFCE 3IXAA 1MNUL 4EUPB 4M1GH 4HOXA 4TSAL 3ZKMD 4HK3J 4HF5H 5E99L 2V5CA 3DURA 1XGTB 3NFPA 2EXWD 1MSPA 3RQ3A 2QQNH 4JFPB 3R8QA 5EIQA 2DLTA 3GKWH 5KW9L 4N8CH 3MFGB 1RZKC 2YFUA 4PREA 1JFHA 1XGPA 4LCWD 1SY6A 1OD8A 3CH9A 2J8UE 2C7FA 3RZWA 1KG0B 3SE8L 4P5TD 3C5SA 3TYFA 3HNMA 4YHLH 3LMYA 1WP6A 4L9LC 5I8CA 2NZ9C 3MYJB 2MCPL 5I19H 5GS2H 4GXUM 1S46A 4LLDA 1QHOA 3WKML 2DKMA 2XFFA 4YDLC 4C54A 1UCTA 2HT2C 5F9OL 3UTZB 3WKZA 3ULSB 2FJHA 3EHBD 1IEHA 5HHOB 3C87A 3RY6A 3NZ8B 3CVHA 1MLBB 2ICEB 1WDSA 1B4JL 1MFAL 4V2XA 1AHWA 2CJUL 3THMH 1H5BA 1I9IH 2HKHL 1FVCB 1T83A 2QQKA 3PE9A 3OR6A 4FZ8H 3AHYA 4Z0XA 1ZEAL 2DIBA 2FR4A 4Z2HA 1MLCB 4A2LA 1MHCB 1OB1A 3CFBA 1K45A 5D7KD 4U7KA 1NWSA 1KNOB 4UQAA 2XG9A 1U2CA 4X83A 1VRXA 4P57B 1S78D 3IFNL 1H2JA 3OLEA 2CXKA 2I60H 1KIPA 1L0XA 4MCZB 5HGAA 4XP1L 2P5WB 5EUOB 2DQHH 5ID0B 5HOSA 3E6HB 2ZPKH 5CEXB 5D8JH 2XVGA 5I9QB 4UU9B 3WJLC 3MRKA 1SYTA 2XIIA 2VDPL 3RM9A 1N4XL 3CUIA 4M5YL 5F89B 1BQLH 3D3AA 1ZLSL 1AJ7L 1WCBB 3X12A 2ZUMA 3I2KA 5HDBE 2XTJC 3VGEA 4HUUB 4XP6H 3ZT6A 5DD6B 1S5IL 3FQRB 1H15B 3LVEA 5SWZA 4X4YA 5IG7A 3N18A 1RFDH 1GGTA 4IOSD 1QFWI 4GBXB 2FIKB 4RRPA 1IGML 3H9SB 1GC1C 1N5AB 3K4ZA 2H1PL 2YOCA 5ID0A 2ZUWA 5KSVA 5KVDH 1V6WA 1HEZA 4ZO7A 3CCHA 1NARA 5I1DA 2VMCA 5GS0C 3WHXA 3A6CH 1IAIH 3DYPA 1M7DB 4X99B 1AE6L 1SEQL 2HVKB 3FO1B 4NO3A 3BWAA 3IAQA 4FQQB 1WAAF 4M43L 4QKXB 5D1ZA 1IGJB 3QUMA 4PTTA 5BMFH 5DD3L 1UHVA 2NY0C 5JXHA 5DGRA 4MDJA 3ARDC 2HKFH 2C1PA 4MAUH 2XTLA 1ZA3A 5KAQG 4GWIA 3KWWA 4D6IA 4G9FE 3VXSB 1OWWA 3HRPA 4W5ZA 4L29A 2RFXA 3U4BH 5FUZH 5HPCA 5TDOA 4IBLT 2UZYB 5J1AB 3WD3A 4IRSC 2DT0A 4X98A 1EEQA 3FT4B 2DOCA 1CK0L 2QADC 2WC4A 3RVTD 5LCWL 3BRGC 1T83C 3DUUB 5J6GB 4DTGL 1L7TH 3DLQR 3MOBL 2D1ZA 5KVEL 5HHQB 1HE7A 1R3HA 5F21B 1JZ8A 4AAXA 2VAAA 3BC9A 3GRWA 4JFOA 5EBMA 3TPUB 3EYUL 4Q74A 1YEEL 4W70A 1I8LA 2HTLD 4Q2ZB 5C2BL 5KN5A 2Q8XA 3DVFA 3HUJE 3VDCA 2I9LB 5EA0H 4E41B 4F7TA 3N06B 4NT6B 4RNRB 5IFHL 3QDAA 2CMRH 2GAZB 3MRNA 4KKCD 4PJBB 2Q86B 1OGTB 3A3HA 1R5IB 4PJGA 2XT1B 5E00B 4WLCA 3SDCC 3W25A 3ZL4L 2FEEI 3RHWF 5HDOA 5D7IB 1RZGA 1IC5H 1JF1A 1LE9B 3C6LD 2VJXA 3GSOB 1YC8A 4DWSD 4IMKA 2VAAB 3NCYS 5IESL 3HMCA 4JO3L 2W66A 3S4SA 4XURA 1HXJA 3GIZH 2FBOJ 4PD4J 3QQ3B 4CUBA 5JLZA 4BJ0A 5JMOA 4G6FD 5FCZA 2VZPA 4DUWA 4XBGA 3WDQA 4O02L 3D2UD 4XC1H 5C0BA 4MDOA 2B0SH 1JWUA 5D6DC 3NAAL 3RUGE 4JM2D 1IAOA 4AZBA 3P73A 3MO1A 4BZ2H 2WC7A 2CSPA 3L5JA 1NQ6A 5DJZB 3UR7A 3EBVA 1UXXX 4JKWA 4JFSA 1KPVB 1ISVA 3CMOL 4HK0A 1CXEA 3DO7A 5CBEA 1K3ZA 1QLFB 1U8MA 1BHGA 5IB5B 3V0AC 2GCYB 3WLBB 3OF6A 1JPFA 5AYUL 2IPTL 4HG6B 1E6PA 2NQCA 2CRIA 4KKAD 2VLLA 4U5IA 2VRKA 5C07D 4F37F 2EKSA 2AMGA 5DVNA 2D20A 5LWYL 1QSEA 4PIRF 3OB0H 4ACZB 4CDHA 1GOOA 5ESQA 3UPAA 3V5DA 2VLKA 3NH7L 1K9DA 3WEXB 1CL7L 3PQYD 4UT6L 3VXPA 1YEGH 1GOKA 3AYSA 2BNRE 4APQC 3CKHA 4OZGF 4U0RC 2PW2A 4MXQD 4A2MA 2WNGA 4J2XA 2JK5B 1KB5L 4GLRH 3TA3A 1AGCB 3VFUA 1IGIL 5MP6H 1NWRA 3FJTA 1YYMH 4GI9A 1MQKH 1NDMA 5DWUH 4F7EB 2P4AB 3W5NA 2Y06H 5CWSB 4KVCL 5IHRA 1FDLH 4I77H 4K2UL 1BREA 1CTOA 3GNML 4LKXA 3QI9D 1NEUA 4ZOAA 3HG1A 4Z7OE 3G5VB 3ULVH 3HMWL 4MA7H 4NUJA 2WMPA 3RNQB 4F2MB 4P2OB 2N7BA 3GHBL 3LRSA 5ITBH 2KH2B 3B5TA 1CE1L 4ZAKA 1DUZB 1AIFB 5DJYB 1LE5A 5DQ9B 2ZOXA 1NGXA 1XGUB 3MBXL 2NY4D 1BD2D 2YZ8A 5A2JH 1JGVH 2AI0L 3MNVA 4RFNC 3SKJL 4K7PH 3V4PL 2BVOB 2HFTA 3C6SA 3K0WA 5DJ8A 5JOPD 3GXDA 5GRXG 2L4OA 4QT5A 1A6VH 3WFHB 3MCKB 5MEPB 1P5UA 4NWTH 1C12A 2DMKA 1MCCA 5AUMB 2PTUA 1MREL 4JPVL 3BE1H 5EU6B 1XSJA 2VR4A 4P8VA 1WAWA 3VWJD 1Z9MA 1NFDF 2NTFB 1QSFA 4O5LL 1H8OA 2UY2A 1BVLA 3ZDZF 1E0VA 1B3WA 1NGWA 4OZHB 3CSPA 1D9KA 4UIMA 1FFQA 2P8LB 3QUYD 2YPVH 4MMZC 4PJBE 4M02A 2XVLA 5SX5K 2MKWA 2D7PA 3OKYA 1NOFA 4M24A 4UDTB 5DK0A 4APQD 4OCSH 1A9EB 1U93A 5CEZL 2G3NA 5EU6A 3GI9H 4HPHA 4P59H 1JZ2A 2VT0A 4MO3M 2XIBA 3KPOA 3BN3B 3G6LA 1IAMA 3ARDB 2P47B 1KENH 1NSNH 4W4OA 2W0PA 4X9FA 4XWGH 1RVFH 1EO8H 3U5YA 1S7QA 5DRZB 2AJVH 2FBJH 3BEVB 1BVNP 5EJZB 1BJMA 4ETQB 5SV4A 3RDKA 3WHE0 2YXFA 2XWBB 1V0MA 2A6DB 2C7UB 1CDIA 3IYLW 4HKZB 4XVJH 5C0EA 3F8UB 1QRNA 5D1ZC 3D69A 2I9TB 4MHHG 2APWA 2XXMB 1QBML 4OGZA 1G9NL 1KEGL 1YQVL 4NHUB 4YZFE 2XRAH 1KB3A 4GG6F 1KFAL 2ZEZA 2W61A 3GRWL 1NMBL 4WKFA 1JWSA 3SE3A 3AZSA 4ZXBA 4XUYA 3PN8A 3QNZB 4PUEA 1NFIA 1XH1A 5CPSA 1I3RA 3SUWA 3HZYA 4DGVH 2V5SA 8A3HA 5LQBH 4JFFD 5ICXB 1E28A 3ZJ7A 5TJWK 1WNOA 2VXUL 3P9WB 4MB3A 3O3AA 4YLQT 4XTRC 3U7BA 4AK1A 1X5YA 3A67H 3B43A 5I18L 2X4NA 4MLIA 2WIIB 3NCYP 4LU5H 2ERJC 4OAWB 1BBJA 3B9EA 5FOJA 4NQDE 2XTJE 1U8IB 2F53A 4ZSOE 4NNPL 3W5MA 2M1KA 3DV6A 3MZTA 3NDYA 4QHUB 4P5TC 5DFTA 1FN4B 3I2CH 3HS0B 1CXHA 4U7MA 4PJ8D 5EB9A 3O2DH 3NTCL 4JFHE 3SDYL 1C16A 3ZDYE 1S9YA 1WUNT 1FG2B 1HSAA 3MRPB 1Y6KR 5IBLD 5D8ZA 3MYZA 2WPGA 3WMBA 3LSOB 2B20A 2CDEA 3VFNA 5ITFA 3RPIB 1GNYA 3FN0L 2XQBH 4LCCB 1YPZB 2VSDA 2IPKA 2A3BA 2EPLX 2JF1A 3EYSL 3FQWB 1LLOA 2XKSA 1U8LA 3KPQA 4P3DB 5FUIA 3N1PC 3L4TA 1JPGB 1TCMA 4YHNB 3TTOA 4BFIB 1EHLH 1HSBB 2F15A 1UQYA 3OXSB 2FGWL 3QO0A 4N5ED 4D71A 5D1QA 1BZ9A 1UR8A 1UZ8A 1VIWA 5ITFB 4BQ8A 3D85B 1KSRA 1C5DB 5I8OH 1FL5B 4DGIL 3DI3B 1IC7H 3U2SB 3KL3A 3DVGA 1NC2B 3IS1X 3O6KL 3SJVA 4WJ5B 1OARL 1PLGL 3S37X 1J83A 2UWEA 4ODWB 4QXUH 5E9DA 1OF2A 3WD5H 6FABH 1DWHM 2CUIA 4Y16B 1MFAH 4ZNEA 3D87B 2AEWA 2V5RA 2HT4C 4I0PC 1LNUA 4JZJC 2NY3D 1S3KL 1HSBA 2M8XA 4MAYD 1B3ZA 4ZD3H 4DWSC 4U0RB 4U2YA 2OJZH 4GKNB 4UMGA 4YBQD 1FSKB 2Z92B 2Y72A 2HAZA 4UNVA 3L3JA 2G75B 3EO1A 5F1NA 4XI5D 2J6EA 3QDGD 4NQCA 1S7XA 4L1HA 1P4BL 1LD9B 3KPPB 5KSAB 1EGJA 3MRJA 4R2GD 1FZJA 4NBYB 1XHGA 2MCG1 3W82A 4AD0A 1MHHB 2IH1A 1SJVA 3BSZL 5J12B 2C3GA 5DR5H 5C09E 1JD7A 4L3AA 1MIML 3VIOA 1MFEH 1Q6DA 4OFPA 3MV9A 3V6OE 5AG8A 4G6MH 1GNXA 5HYSG 4ZFMA 3L7FB 1GU3A 5HGBA 1CDBA 2IJ0C 3KL0A 3UTTD 1MFNA 3GIVA 4OZ4A 3FFDB 4LHUA 4HWEH 5A3ID 5DD1H 2DD8L 4LCUB 4TTDC 4IPNB 1VERA 4JN2A 2I26N 4ZPVA 1UYWH 4LSUL 1JRHI 1GCYA 1J1PH 1KR1A 2BHZA 3IRPX 3GMRA 4FQXA 2VM9A 2VISB 1UD5A 1OLLA 2VQ1A 2WC3A 2DJSA 2JF6A 3K2UH 4HH9A 2FECI 5I75C 3RZCD 5HHMD 3LQAL 4QO1A 1KTRL 5C3TA 3IS0X 4L5FH 4LHUD 3SGEI 4QNPE 4GZJA 2BFVH 2YEZA 5IVXA 3OV6A 2DKUA 4V2BA 4JKKA 2PYFB 3ECQA 5K9KA 4A6OA 3MV9E 3S35H 2XWJA 1DSFH 3AFLA 4KTEH 1G6RH 4DUXA 1IKNC 1EGJH 1YN6B 3MX0A 5TPWH 4B7IA 1IC4L 5TQ2L 4IMLB 5DRWA 1FNSH 2RJ2A 1U8QB 5TDPB 1GGIH 1WCQA 3P0GB 2VZRA 2BVUA 4W8BA 1GJUA 1PY9A 4HGWA 2YFZA 2MPAL 1QSEE 1CK0H 1OTTD 5DEGA 3X11A 2YWZA 4F7PA 4AYSA 3EJYD 3I84A 1XMWA 3QR2A 1M04A 1A14L 2XNAB 3O11A 5DRXA 4WFFE 1CXFA 3QIWA 1GONA 3NIGE 2P8MA 5AZEH 1LJYA 4LXFA 1LL6A 4D6GA 2MSPA 1J1XL 4MMXC 1JXJA 1IV8A 4ELME 3H0TB 1YN7A 3QRGL 4X5XB 4PP2B 1LG2A 3OLDA 1IGCL 4XUOA 3MBEA 4PJAB 4CJ1A 2EDTA 3UG5A 1UB6A 4JY6B 3L3GB 2IADB 3DX6B 5I8EB 3WFEL 3BSHA 4XPBH 1EV2E 1JTOA 2VZTA 3U0WL 4OKVA 4ACPA 5B8CC 4PJ7A 1E73M 4JG0H 4LNRA 3RL1A 4KK6D 2CLVA 2MQ3A 3PGCB 2I07A 4Z7NE 5ABEA 1INDH 4QF1A 2P7TA 3VMPA 1FYTE 1J05B 2B5IC 3VRIA 1G9ML 3O4LA 3NZHL 4PRPE 5T1LB 4XZUG 4JDTH 4TOQA 1I3UA 1LQSR 3WDHA 3L3GA 3IDYB 3ZQ9A 4UTFA 3ZSSA 3RL2B 1CGSH 2IANA 4FQJL 3U6RB 3WD2A 1PGRB 2BSSB 3RDTD 4TYUA 5C08A 4YX2L 3JTTA 2G5RA 3MV01 1CX1A 1PG7L 2ED7A 3CX2A 3MXVL 5DVOA 4UZUA 1ZLWH 1I1YA 2H2PD 2BHYA 3VXNA 3SDCD 4H5SB 3HU7A 4QOKB 4P5YA 2IBBA 5TE4H 2A3AA 5KVFL 4NQDD 4Y4HA 1BIIA 2UWEE 3PABB 2QLVB 3P0YL 3OBAA 4L4OA 4JM2B 5DTFA 1L7QA 3QUKA 3N1AA 4OFYA 3TZVB 5GRWA 5CSZB 3TM6A 4RDQG 1HL8A 3UPRA 4XUNA 1R5WA 5EUKA 3SDCA 3L1OH 25C8H 1IL1B 5F3HA 1QP1A 3V52H 4HS3B 5IQ9A 3X3FL 1TTUA 3C7GA 5K9JL 4E41E 3QEGL 2NXZB 3OZOA 4OGYH 4JO2L 3MRFA 2ID4A 2D24A 1OAZL 1C08B 2FHFA 2VLLB 4MB1A 4YFLI 1KOAA 4X6CE 1VPOL 2FDBP 2DWEB 5SWZD 3W11C 4D0QA 1WJ3A 3LD8C 2DQFB 3C08H 1IT9L 4P2RB 4F66A 1UZ1A 1KCKA 1V3HA 3Q2CA 4A45A 3LQMA 4DWSA 2J8GA 2OWWA 4KV5F 5EBWB 1F58H 4LGXA 4JGJA 3V6ZA 2D7TL 1ZT7B 3WFBH 3WFDL 43CAB 2ICWB 5D7LA 4OV5A 5EU3A 1XR9A 1EK3A 2QPUA 4NI3A 1JPST 1J5OL 5HYIA 3TONA 4HC1A 4IHOB 4G5ZH 3GSRB 3TBTB 1A3HA 4AWEA 1NFKA 1I1CA 1ED3B 4X7CC 5MHSD 4L4VD 1F4HA 3DHJA 1V3MA 1MCOL 3IDXL 4P3CH 2W94A 3TF7C 5IQ7H 2HT3C 4ORGA 1CNVA 1S7WB 1R24A 4NJAL 1E4LA 4U3XA 4APQA 3I3BA 3PTMA 5CPQA 1BZ7B 1CE6A 3WE6A 3N1MC 5EZIL 1MJUL 1NAMB 2VL5B 2QKIB 2QSQA 3ZE0F 1ZWIA 4LVHB 5IWLC 3A6BL 4IJ3C 2OR9L 2ZXDA 1KTLA 4AIZB 5HVHB 3S3PA 1AHWC 3I75B 4OFIA 4XNQB 3MUGA 2FCBA 5DFVC 1DBML 2ZKHH 3FO2B 3B5GA 1P5VA 3NIDE 1N0XH 2O5ZL 3AB0C 4C7FA 4HC1H 3FN9A 1I7ZB 1F00I 2FNBA 5LG1A 3TYGL 2AJUL 2XZAL 4N1CA 3HNSL 4J7RA 1FYTB 1X5AA 4Y19A 5FECB 2B7DT 4WTZA 5I1EH 4WWKA 1E56A 3C9NB 2DYPA 4PRPA 2XICA 3K46A 1G9HA 3BAKA 1T6WA 2PW2B 1QW8A 1SBSL 2J88H 3LV3B 5CPTA 3FONA 3UEZA 3VX1A 5GSVA 1KXTA 2E9LA 1DE4A 1R0AH 1JV5A 1KCVL 2NYYD 3GJFH 1ACYL 3RVXC 1UWQA 3OJDA 4WEMB 1UWIA 2E40A 3D18A 2RGSA 1QNZL 4XBEL 2CDFA 4P99A 4M82A 4F15B 2PTTB 3VFGH 4O51A 4FNLL 4R6UA 5EZJA 3CHCA 4JQVA 4PRPD 3IDYC 3FL7A 2OL3L 2DQEH 5I8KL 5KSBE 1UX7A 1WAAA 4GAYA 4GKSB 3SQOH 3VXUA 1W9TA 3QWRA 2JDAA 3ZE1F 1GHSA 4C59B 1T66D 1ZVHA 4LSQL 3DETC 5D6CA 1NUNB 3O2WH 1F3DJ 4JFED 5E95B 2AERT 2GSJA 2AKRA 3OJDB 5D5MB 5BS0E 4HXBL 3W2DL 2ZJSL 1W9SA 1AGBA 3MR9A 2A6KB 2GSGA 2GTZA 5EIIA 3BGAA 3L3IB 1A8JH 5DT7A 3OKDA 2ADFL 3E1F1 15C8L 1CR9L 1MCRA 1CLYH 1E27B 5EORH 1C12B 3KZSA 7A3HA 3ECBA 3LKSB 2XY1A 1N26A 3SDAD 4N0YH 5BXTA 1DZBA 4M6AA 1IGFH 3MV11 2EPKX 4WTWA 1MCFA 1JWSB 4XV0A 2R7EB 5DMKB 4Q6IC 1X5LA 4NC2B 1UJ3A 3MCG1 2B31A 1A7BA 3EYOA 2F54E 4RAVB 5B38B 4NO0A 2AP2A 3W39A 5C0NC 2EIEA 2Z8RA 3VGDA 2AJSH 3TNMA 3F7RA 3WNNA 1KGWA 3ACFA 1A6ZB 1DWFM 2R8SL 2PKDA 1CDCA 3CAFA 2DQJL 3IU4L 4UUJB 3BKJH 2WBJD 3R1GL 4CJ0A 4FI9A 2YUWA 3AIEA 4XP4H 3CUHA 3QWQB 1XRVA 2AQ3A 2HT2D 2IBZY 4OQTA 2GITB 3P4MA 2R2BA 4TRPH 3CC5A 5JPMA 5BXPA 5D96C 2P43B 1RHHA 2FGWH 2ZNXA 3V5HB 2G4FA 2WWKT 2WMHA 1G7MB 5F96H 1JAKA 3LPFA 3NFNB 4CD6A 1XZ0B 4KQ3H 1S7RB 4XUQA 4Q9QH 2PXYB 4Z9KB 4MNQE 2G2RB 2D03H 2DIEA 2A0LD 1K5NB 2AXJA 5SWQB 2JJSA 1TJGL 2A6IB 3TV3L 3WSOA 3BKMH 4I3GA 2ADJA 1RZJC 4D6FA 3SDAA 3AU1A 3PWVA 1UYXA 4JCMA 4BK5A 1X7QA 1VKXA 3QNZA 1CG9A 3ZTNL 3OX8B 1D6EB 1OTUD 1DFBL 4GKZA 4KV5E 3RVVC 1ITXA 4LOUD 2YL8A 1L9MA 4AG4H 3RVUD 1E6ZA 5AD0A 4OGAD 4TVPD 3FQXB 1QR4A 5ALCL 4G43B 2ARJA 3QHZH 4GI8A 1QVBA 5GXBB 5HDQL 3PV6A 3MV9D 4U3CA 4ZUTB 3AS1A 3LKRA 2WIIA 4XMPH 1CFQB 2DQUL 1MNUH 4MA3B 4HXAH 2R69H 3SCTA 1HJQA 1SG3A 1JYNA 2BCKB 2YPLD 3SE4C 2J25A 1EMTH 2ZUUA 2AV7B 3F7YA 2DRUA 3IFLL 2FH8A 4N5UA 4W6XB 2GUOB 4QYOA 4WENB 3I6LD 2EIZA 1P7QB 1UY4A 1SM3L 1ZAGA 3W9DB 5HSFA 4XNMA 4HU0A 3CTTA 1BP3B 4WI5A 2CEQA 1PDKA 2HH0L 5IVOA 3ULUE 5D1QC 3DOSA 3MLVH 1GW1A 4OI7A 4KMTH 5F8QC 3VFTA 3KLDA 3QCTL 5I1JH 3KWXA 4I2XA 5IEKB 3C8KB 3RZCA 1JRHH 4HIXH 4NUGH 3TO2A 5ICZA 2J47A 4KZDL 5CZKA 2YLAA 4GW4B 1AC0A 2WLZA 3KYKL 3WIHL 3CMGA 4R2GC 3TP4A 4OCXL 3TH2T 2LQRA 5IT2H 4LYQA 1RUQH 1FO0A 4XNYH 2VR5A 1DVFC 3HI5H 3EJZD 1H1NA 1MWOA 3QFJE 4MD5B 3ARVA 2J8UA 1QRND 4C7DA 5D1QD 4DUVA 3X14A 1PKQB 5HJ3B 1X5IA 1MHEA 2CDGB 4AIUA 8CGTA 4HX1A 5IF0A 3OXRB 4UOW0 5FHAH 1G1CA 5IJVA 3EW3B 1F11B 4D94A 4LLUB 1JZ3A 1JU3A 4PBGA 2ZCHH 3VXTB 2FGLA 1KEML 4HCRL 2VDLH 4JRYD 3KPSA 3SKOB 3DXAB 5DI8A 1LO4L 3JWOL 1T03L 4C83A 4NJ9L 1ND0A 2H3NA 1Q9KA 5GRVK 4P9MH 1I8IB 4I18A 4OJYA 3PG2A 3DHUA 5GS1A 1A6UL 2PYEA 1YECL 3P4LA 1DLHB 4MAYA 4MJ2A 3FCTB 3WLWC 1HILB 4QHNA 4Y4FB 3ULUH 2WMKA 1TLKA 3M46A 5DQJA 1CIYA 2WBWB 3SHSA 1M7XA 1QKZL 1B9ZA 1H9VA 4BH8A 3FOMB 4PJDE 2J7LA 3SCMC 4JGMA 1JTPA 4B9YA 4KROC 4LPTA 1JP5A 2A73B 1ZBKA 4HT1H 2F19H 2DM7A 2PBOA 4O2FB 4MNQA 3BLKA 5CD3B 4DN4L 3X11B 5D2NB 2J1RA 2PYEB 2X4OA 1U8KB 4RGNC 3JXSA 1URLA 4AMKH 1RI8A 3UMTA 2DIJA 1JMXA 1G0DA 1INEH 1HHKB 2R1YA 5FGBC 3KNBB 2R0KH 2YUXA 2ZEXA 4I8DA 5GHWL 2VE6A 5DUPH 3DX7B 3Q3GB 1TZ7A 2UY5A 2YDQA 3A4WA 5JIHA 5F6HI 4OFYD 3LQCA 3O81A 4WHYG 4DWHA 5BCAA 3LKQA 5EFIA 3VE0A 2DSVA 2J6EH 4NM4H 1FP9A 3FQRA 3HC0B 5E4EB 4NCC2 3B3IB 1QBLL 5C3LD 5GNXA 2DN7A 3I9GH 1GOHA 2JLLA 1CZ8H 5FB8B 1DVFA 1RUMH 1R86A 2CLZB 1AHWB 2CKRA 3RGVD 3MROB 1GH7A 4EN3A 2RCSL 2FGZA 1R5VB 2XWJB 4TQEL 2X1QA 1QHZA 1CIDA 4PJIF 2QPSA 3D25B 1TITA 1AO7B 1PYWB 1QLEH 1DBKL 3HC3H 3I2JA 4UQ3A 4HZAA 4H0IA 1BQHB 4FF5A 1M71B 1TMCB 3GXUA 4YDVA 5E8EB 2VURA 4HP5A 4LYPA 4FQHB 5FB8A 1SYVA 4NC0B 5F9WB 1V02E 3PJSB 1U3HC 1ZOXA 3HRZA 4UINL 2OJEB 1N59B 3GSUA 4GJTB 2OZ4A 4QDQA 4MWFA 1JNEA 4P4RB 1TPXC 4WV1B 1GIGH 3MODL 4PLOB 1N6VA 3RUGF 4NZRH 4JFDD 1Q72H 5FXCH 5HYQB 2HWZL 3DUUA 3UBXA 1B31A 1UACH 2HTKC 5SV3A 2B1AH 4X5WB 2F8QA 3F7VA 2I24N 3QCVH 3D39D 4M8QB 3CZEA 4GKLA 3BCDA 5CAYB 4Y2DB 1A21A 4CBPA 5F93C 4U1KA 1TQBC 4GIAA 1WWAX 3SKVA 4I0KA 3UPRB 4XB3A 1MJ8L 5D7LD 3MSDA 4G8IA 4HUXA 1VBUA 5C0AA 3FQUA 4OCYL 2I07B 1NAKL 3SDXF 1JF1B 1YDPA 2R29L 1LEIA 4RGMC 3SKNB 2YKLL 4WU7B 4UV4H 4MJ4A 3WN5A 1WITA 1ZANL 2DQTL 1C08A 3EMCA 3VO0A 1YEGL 2NY2D 3VIGA 1NBZB 4AEIL 3CZKA 3O0RH 3HAEH 3GSNA 4PTTB 4ZS6C 3F5LA 5B4NA 5A6SA 4LHJB 4P5TB 4XPTH 5HI4D 1OLZA 2ZNWA 1NGQL 4XX1G 5GGTA 5SWSA 4MJIE 4CD4A 2R4RH 1BG9A 5DJXA 1HVXA 3A6BH 1BGGA 1OCWH 1QACA 1KULA 4FTVD 3EFFB 3G04A 1ZA3B 4RE2A 1A1OB 1G0YR 3V6ZB 4N9GB 4HBCL 2F8XC 1KCLA 2ZUQC 4S0SD 2WHJA 5AZ2H 5HHMB 3KPNA 4JFEA 2P1YA 1MXGA 3PIQA 3PHOB 3MLRH 1H0DA 2JJWA 1HXMB 4HPGA 4LKCB 4X6EA 2BXZA 1RZJH 2E7CA 4RA0C 3WELA 3MRQA 2ZG3A 1CE1H 2VMDA 4XRCA 1TVBA 1KWGA 4NQDA 1KJ2B 4Y4HD 5E24E 1BQSA 4UB0L 4OSUH 3CLFH 4LQFH 1QYGH 2NXZD 4X6CB 2V2WA 5IB3A 4HV8B 1OT1A 1I3GL 3KPRE 2DBLL 5L7XH 3FTGB 1O8PA 4AZCB 4M62L 2NY4C 1DJSA 2FECL 3MRDB 4ZUVA 3VXUD 3BZFA 1S8DB 4KK5D 2VMEA 4AZGA 1UQSA 5HHOE 4HKBA 5JIKA 1P53A 4OTXL 1AKJD 5JR1H 4YBHA 5JHDD 1FFPA 1HJSA 3Q6GL 1CDGA 3KPLB 1PJ9A 1WEJL 1CICB 1NFDB 5GZND 3LEGA 3EYUH 1P9MA 5E8NA 4CN1A 4S1QH 4OCRH 4EUPG 1JDAA 4OZIE 5EBWA 4D3CH 4HK3N 5ESAB 3P73B 3MMWA 1OW0C 4EOWL 3FONB 5B38G 2J8UF 3V0WH 3FMGH 2C9KA 4YJZL 5JW4R 3R4DA 4ODTH 1DLFL 1E4WL 1HF6A 3DRQB 4Z2GA 5JNYA 3VFPA 3WD1A 2E9WA 2AEPH 1PVHA 2LU7A 1DP0A 4L3EB 3IKCB 1LO0L 3PWLB 5JW3L 2P5WE 5EUOE 1JAEA 1A6WH 1QPXA 5LXGH 2CXGA 4ZUUA 5J12C 1KN4H 3GUTB 4A44A 5IHSA 3CDCA 4JREC 5JOFB 2P46B 4GBXC 4RYDA 5EIVA 3HJEA 1JIBA 3F5KA 1BFOB 1MPAH 4KKNA 1O0VA 4CADB 1P1ZB 4PYSA 1J8HD 3L3DB 5GGRY 4LSPL 1NMCC 5LVEA 4YE4L 1CQKA 2KBGA 5DMGC 5GZOD 1HH9A 1T1YA 3SOBL 5C1MB 1YQVH 2JK5A 4J3OC 1JWMA 5FA3B 1GPOH 4XCYA 1HL9A 1NMBH 2J7BA 4Z95L 4LLAA 4P8WA 2EDJA 5BQ7A 4K9EL 4M7ZC 4F33A 4X7SH 3PGFL 4GBXD 4GG6B 2W4XA 2GSIB 1FYTA 1PFCA 5D93C 4I0PD 3MO4A 3ZKND 1A02N 5I2IB 1B3XA 1SEBA 7TAAA 1WT5A 4NUJB 4OZGB 4H1LG 3BQUB 3ZZ1A 3PDOB 1J11A 5IMLA 4XC3L 4HDIA 1Y7VA 1IKFH 3OAYH 2ENSA 2JELL 2XKNA 2I5YH 4GAFB 1WB0A 2UWFA 4QXGL 3GSXA 4JFZH 1KB9J 5CIPB 3TA3D 4L8CB 1WBZB 4ONOA 1NCBH 2G3JA 2P5EA 5FUOL 3RZCC 4Q6YA 2D0GA 4BH7A 4PJXB 3WQBA 4XP5L 2R0LL 3AAZA 1HHIB 3GBDA 1HYRC 2XPGA 1OP5K 5IB2B 4L4JA 2XWDA 4YWGH 4HA3A 4WGWB 1K85A 1A1NB 2AABH 3CFJB 4QRPE 5J8OA 3MNWA 1U8OA 1S7SA 4JFHD 2R23B 3IB3A 4TTDD 5JHLL 5DT1L 4R4FL 4QDSA 2YD1A 4HJJL 1OW0A 3RIAK 3W0KA 2DTMH 3AREB 1OH4A 1G7HA 3OA5A 3S3SA 4C4KO 4R4NC 4CMMA 1XF2A 1D5IL 3ARDD 3JWOC 5FCUH 1NCAH 4XZUB 4MJIA 5E8PB 5C6WH 5IM7A 1HT6A 3HE7C 1Z6JT 1FIGL 3T4YA 5KZCD 1L4IA 4LPYA 2HISA 2OWXA 1A1NA 1OSZB 3QXWA 3PQYE 4M93C 1VKXB 4ZZ5A 2PETA 3CLWA 1UEYA 5J1TC 4CCCA 5BRZE 4RIRB 2FYYA 3QHTC 1ZA6B 4XMKH 4NUGL 5D71L 2VXSH 4WW2F 5KEZA 1JU4A 4PQQA 5AD0B 2CESA 4M1DH 4U3AA 1QFPA 3BT2H 4L3CB 4MDIA 2WZIA 1OARH 1PLGH 1U0QA 1JPSH 3HE6A 4I0CC 2B5IB 4KHXL 4PJ9D 3LSOA 2W92A 2NY3B 2ZOKB 4FFVD 3TVMD 1L8NA 4S1SL 4J1UA 4LASH 5BVJA 5LJYH 4P08A 1AC6A 3ZYZA 3CC5B 4H88H 4YIQB 2AXGA 2ZX7A 5DD0H 2DM2A 3Q1SL 2J2ZA 3LEVH 4OM0L 1Q9WB 3KDMB 5I1IH 3PL6C 3WIFA 2GUOA 5LA0A 5H94A 3QDGB 4PS4L 1W72H 4P7NA 1NFIB 2X4UB 2G2RA 5FO8B 3ULUC 3HZVB 2PXYA 5IHUL 2IG2L 3LRHA 5D7JB 4D6JA 4LGRB 2NY1C 3VGAC 5HYEA 3T1WA 5T1KD 4EDWH 5I1KH 2A6JA 3GBNL 3DMMA 5JDSA 5IGXH 2NY7H 3DTXB 3OKNA 3OGOE 4LVNB 3TFKC 2CPUA 5ESQB 1OD9A 3MRCB 2DI8A 4WHTB 4G6AD 3QOKA 3IF1A 1NGPH 2R1WB 3T2OA 1W1PA 4EZMA 4H1LB 4QOKE 1XGYL 2HVJB 5A6BA 1EFXA 2H6PB 3MA7A 3N50A 3KYOB 2NW2B 3SE8H 2R1XA 2ATKB 3CVIH 3FB5B 2D31B 4M6ML 3KPTA 5BVPL 2G75A 4QEGA 1P8JA 5IBTL 1EXUB 3TO4A 4M7LL 3ARGB 2QMJA 2EDKA 3QXDA 4QB2A 4HIEB 1V8HA 4LCCA 1LO2H 2FB4H 3WF1A 1AKJA 3NJ3A 1PMJX 4ZSOA 4WUKL 3RI5K 3ZHLA 4TUKL 4E8DA 3IXTA 3FT2B 5BW7C 3DXAA 3MLTA 5DI8B 3ARPA 1V0KA 4C58B 1GQIA 5LAXB 4K94H 4M61B 1EFXB 2V72A 2VDRH 3MA9H 3CUGA 4XH2B 1EBPA 1R3IL 2R1XB 2IH3A 5CJQL 3WXVH 5C71A 3KLAB 1NWUA 3T4AA 4LQRA 3EOBB 4JFFA 4KJWC 3PGDA 4LSDA 4MLSA 4AH2B 3DGGA 3LY6A 3QJHB 4WUUE 2Y4SA 1EFQA 1EUUA 1HKLL 1GJWA 1WV7T 5FM4A 3SE9L 4GH7B 4OF0A 2W60A 1CGUA 4RGOH 4P7LA 3HMXA 5GGSB 1DWJM 2R0WH 5DJ6B 5E94A 5E9DB 1DQJA 4U0QB 1OP3H 5IFJA 1T3FB 3OMZA 4JG1H 1NLDH 4LARH 2WV3A 4I48B 1NCNA 1TR1A 1W0YT 1ZT1A 3QUZB 2OP4L 3OKEA 4XUTA 4MA8L 1XIWA 4DZ8A 3BO8B 2EYRB 1G6VK 3CDGB 5F7EH 3L5HA 5JO5B 1K4DB 3L95B 5HXMA 1IEBB 4DKFL 2DLGA 3BPCB 1QZ1A 2XTJD 3RWHB 1F4AA 3CX5K 1CECA 3WUGA 3AS0A 4JO1H 2DBJA 3T0BA 1NCDH 1UWXK 4PTMA 4F58H 3WQWA 5F7NC 3GM0A 2GI7A 2WO1A 4W5UA 4NKMB 3QIUB 2NY1D 3P30H 3O3BA 2F74B 4CVZA 1K2DB 1VFUA 3QPQD 3QUYA 3S34H 3O6LL 1XGPB 1JBJA 2OZ4H 1BLIA 2YWYA 4NCC1 2QQMA 2EO9A 3F5JA 2UUDH 2XN9E 5FUCC 1MWAL 3LQZA 1GXEA 2HJFB 4BZYA 3TTQA 3RAJH 4Q0XH 2GJZB 1GQKA 3V6FA 4WCYH 2O93L 1KGUA 4NHUA 2O9TA 3MLUL 2YC2A 3LAFA 3VTRA 5DS8B 3WMSA 2VLRE 1OQXA 1MJ7L 1C7TA 3D39E 3O3EA 2EDHA 4AENA 3WF2A 2Q6WA 4OYUA 3CVHB 2NXYC 4Q58C 4LSTL 4M3KB 4OJFL 2JEQA 2X4OB 5EOQL 5TGBA 1TFVA 2R9HD 3QIBB 1P6WA 2J62A 3VXRA 2ILLA 5DLMH 5EWIH 2ESVD 1X44A 2EECA 2G60H 5FDYA 1MVUB 2BNQA 3KNBA 2E7BA 2IALB 5ACZB 2ICCA 4N90D 5MENA 1BAFL 1IBGH 4RMSA 1JNLL 1RK0B 4LVEA 4RWHA 5E0QA 1UH2A 1E6XM 1N5YH 5HYJB 2HJLA 1MF2H 3R06B 2VZ3A 3REWB 1QD0A 1D5MB 4M93B 3QRFM 4F80A 1W72B 2EE6A 4GQPH 3SDXA 1CS6A 2HLAB 3TIEB 1QFUH 2V3EA 1GZQB 1N2RB 4PJCB 2H8PA 4IOIA 1NCWL 1IFHL 1OSEA 3T0ED 1MRDH 3E6HA 1S7UA 5EU4B 4OFKA 1V02A 1VGEH 2HKHH 4HUWB 1H11A 1UH4A 4PBWD 4ARYA 3L7EB 4NZUL 3QEQE 4X6CF 2J7HA 3GMPA 4D8PA 1XFPA 12E8H 4LLWB 4FABH 4PJ5E 4BQ3A 1AFVH 3I2IA 3FQTB 3IU3A 3NN8B 4KKBC 4OLVH 4EI6B 4UQ2A 2WZEA 6A3HA 4HEPG 1B6DA 4MVBC 5DD6A 3RWDB 3ZE2F 1M03A 7CGTA 4JPKL 1II4E 1XC6A 2VB5A 5KJRL 2GUYA 1FC2D 3BDYL 2DQHL 3FZUD 3B6SA 3QO0B 4J4PA 1RMFH 2JFEX 3SCMD 1JNHA 1QEWB 5I30H 1UZ8B 2KL6A 4HCRA 4OB5L 3MSGA 2GK0B 5IYYA 1JNNH 5EOTA 1TA3B 2UZIH 5F7LB 5B3NA 1VEOA 1YJDL 5D1XB 1E71M 5FHBH 5T1LA 1PW3A 35C8H 4WJ5A 2ZCLH 2JCCA 1ULPA 3K8KA 3ARYA 3QQ4B 1XF3A 3BDBA 1YEKH 4P3WA 4DWSB 3RMEA 3J8F7 2CPCA 5AAMA 5IFTA 4YK4B 3QG6B 3GIZL 4JLRB 5CILL 3GNMH 3X12B 1J0HA 1HHHB 3L9RB 1DYOA 1OD0A 1I7TA 1XT5A 2CLRB 1I8MA 1TTGA 4NNYB 5IB4B 2F54A 5SWSE 4X6BA 2FWOA 1CD9B 3S2CA 3E6FB 3UJTH 2LTQB 1PQZA 2QSVA 1KN2H 3B5HA 1KYOJ 5BW7A 3X17A 5EPMB 5C09B 3U9UB 4KI5M 2CRZA 3DRTB 4ZTOL 4KQ4H 2EZ0D 5IFAH 1WBYA 5LYRA 4F79A 4XTRD 3JWDH 4BSVB 2GHWB 4X7TB 2F8VA 2MQ0A 2X4TA 3HA0A 3EYVB 4ZENA 3STZA 5IVXF 1ZS8A 5J0BA 5IXEA 5GRVL 5C0IB 4JQIL 1NUGA 1ERNA 1HXMA 4GXPA 4WI7A 4JL1A 4FQCL 2DT2A 4TXWA 1GC1H 1UGNA 3BQUD 2XHNA 1EDTA 2FX7H 3O2VH 3MO1B 4D9LH 4WNQB 2B2XH 4OZHF 4PYGA 3CXHK 3OTTA 3FHQA 4K2UH 2VCAA 1OAUL 2Z31B 3BGMA 1W3LA 5KTEH 1FQ9C 5DK2B 1JPFB 4J4PC 4UFHA 1UZ0A 4J12A 4H20H 1FJ1B 1IAKA 3QFJA 4JZNA 5SX5H 1JHJA 4PJHE 1YN6A 1IC5L 2WQRA 4NDMB 1U91B 1P4LA 5DF0A 2BOCA 4HQQH 3ROLA 4PJ9C 3O9WC 4PB0L 3UYPA 2F54D 1RUAH 2EH7L 5MERA 1UWEL 1N6UA 2OR7A 3JWDC 4H26B 2CRMA 2Y8VA 3WH7A 4MPKA 3N1GC 4ZS7L 5ISZA 4BA8A 4TTGA 2JCCF 1JTTA 4QRUA 4X7FC 3SO5A 5M95B 2DSWA 4ALAH 1WDRA 1RIHH 4Y5YB 1JNJA 3PL6D 3NABH 3SPVA 4UFIA 4QAWA 5A2AA 1U92A 1HVQA 2VKXA 3P0VH 3QEUA 1ZKAA 3EFDH 1EAPB 4U4BA 3TBYA 5C0BE 4JJHA 3NA4A 4NQXB 4ODSH 4TRPL 1UWGH 2YPLE 5JZ7C 3D2UA 4PJDB 3ZHDA 3AAZB 2WCGA 4FQLL 5M94B 5FYJD 5E4EC 1M6OB 3OF6D 4NN5B 2R56H 2WBKA 4NPYA 3CFCH 1AR1C 3MACH 3OG6B 1B0RA 1OTSC 1FZOA 1KXTB 2FX9H 4RFEB 5IKCB 1E0XA 3A0OA 3LV3A 4J23A 5A2BA 2W9EL 4NKDB 4LK4A 4GUPA 5C9JB 1OAQL 1UA7A 1L7RA 2J7CA 4LSSL 1EPFA 4NQXA 1NKGA 2X9WA 3QWRD 1CDHA 3UTQA 1EHAA 4P2QE 4ZFOB 5J11B 4KH2A 2BMKB 3M1BB 4QTHB 4TNVK 5CZVH 3MOQA 3VW3H 2L9LA 3HG1D 1UWXH 3OGRA 4OLXH 5HYSB 3QFJD 3H9ZA 1CZSA 1NOUA 1DN0A 5ETUB 1UKQA 4OF5A 4Z7VF 1T1WA 5TDOB 1TG7A 1T0MA 1BLNB 3X3GH 5I1GL 3QR3A 4UFKA 5F9AC 1D9KD 2GSGB 5EIIB 4WDIA 3IAGC 3QUXD 4YDIH 3VXNB 3CPUA 1EMTL 5E8DH 1NBVH 2Q8BL 1T2JA 2EH8L 3P6BA 4WKHA 2OTUB 3MLZL 5C0DA 3MRHA 2EIDA 3K1KC 4JKLA 3UDWC 4P48A 3A22A 2LTQC 4EDXB 3C60B 5GRUL 1P6AB 1MFDL 4R7DA 1XV8A 2XQYG 4R7NB 2AK4B 5DHYA 2EXYD 4HIIA 4O9HL 3QYCA 1CG9B 4LU5L 4U1IB 1R8LA 3M17B 2NNAB 4JDZA 2Q86A 3HI6L 4PGCB 3G6JF 5T5NF 1XF2B 1TJIL 4WFEE 4LOUC 4Z7WF 2OXGA 5M3WA 5A8OA 1MCJA 5IJRA 3QHNA 1VFOA 5C2BH 5A16B 4YXHL 3C7HA 4JR9L 1Q1JL 3DVNB 3HI5L 4PJHA 1BQHG 1XGZA 3GH7A 2VNCA 2X6MA 1RJLB 2X9YA 3N11A 1HYSC 4GI6A 3KGRA 1OSZA 3A21A 4FS0A 4EBQH 3U37A 4ZFGH 1G0CA 2Z9TA 4QB1A 3EIFA 2W67A 3UZQA 3NFNA 2NPLX 3MQIA 3ALXA 2V2XA 3NJXA 4XGZB 3M8OH 4LCYA 4HTYA 3EO9L 4XVUC 2JJUA 4K3JH 1A3LL 3GBLA 4JHOA 5BVJB 1KPUA 3NAAH 2ZG2A 3VDAA 3KEHA 3G5YB 1J0JA 3BAIA 4HIHA 3VKKA 3HE6D 4WEUD 5EULV 3UTSB 2HN7A 4PUBH 1X6NA 5CMAB 2PF6A 2M2DA 4M6OH 3VFRA 3E8UL 4QHUA 3RIAF 3CVHH 2X4UA 2LW8A 1PKQA 3QDJD 3C2AH 1RV6X 2RB8A 1WZMA 3BXWA 1LL4A 1M4KA 4IDJH 4LGSB 4P2OD 2BNUB 1QKZH 3DGGB 3G6JE 2WVVA 1UM5L 5BXSA 3TBSB 3FB7B 3UPCA 5BOZG 3UTSA 4AZHA 1RZFH 2DWDA 3SKOA 1NC4D 4IM4A 2R1WA 5I73B 1XCTB 5GRJL 3U46B 1QI0A 4WFGD 1FFNB 2YD3A 1HKMA 1W1TA 5GGSA 5IJKC 1E4MM 1BVZA 1GVYA 5HGGS 3QXAA 4XCNB 5DEFA 2D7MA 3LN4A 1XR8A 2VMFA 4IRSB 1H3PL 4RGND 5GS1B 4XNMB 1CVSC 2QQKH 3HLAB 1EDGA 1YEJH 1YEFH 3Q48A 3ZM8A 3IDGA 3C6SB 2DT3A 1ITCA 2BNRB 1EOKA 2Q8AH 4FXKA 3BW9A 3QFDA 2XTJB 2UYLB 3CFKA 3CFEA 1AKJB 3DXAD 1PPIA 4OBSA 3GJFA 2W0FB 3MLSH 4M1GL 1ZL1A 1OF2B 1RUML 2WINA 2DQUH 3Q0HA 2VRQA 3FOMA 4U6VL 5JW4M 1FL6A 3TJHD 1JF6A 3LQAC 4Q9RL 5MENE 3S8WA 3O8XA 5JDJA 1QLRB 5L6YL 4WO4D 2WN2A 2G60L 1EJOL 2IQ9L 5AYIA 1L0QA 3CUPA 3WH9A 3UCRA 4BQ9A 3BZDA 3EYQD 3ZDZE 2PW1B 1BBDL 4N0FB 1IBGL 3TJEL 5FO7B 3HC3L 4DKEL 4BZ1L 5IMOB 4IRJA 4Z7VE 4OCLC 5BXFB 1CXLA 3C8XA 1FA2A 4ZXLA 1HQ4B 5JOPE 2PBGA 1FRGL 3D39A 5FEBA 3IIIA 4OZIB 2G5BA 4GWJA 4AIEA 4M5ZH 5EO1A 3FT3A 4W7WA 3LD8B 3BP4B 3UP1A 1CD8A 3DUSA 5GJSL 3HC0A 5FIEA 4Z5RB 4A6YB 2ADIB 2GW5A 5DJ0B 2G9HB 1WFOA 1R3KA 1Z32X 4TXEA 3V7MA 1QNPA 1VGEL 4OOZA 4OCWL 1J1OH 5HVFB 3JTSA 4Z8FH 2AVGA 1NJ9B 3MROA 4P4KC 4WFED 4DQOL 3RFZC 2MTPA 2XIDA 4JB9H 1XIWB 2X4QA 4OUOA 4PMQA 3RNKA 1CLCA 5GISH 1KENL 1NSNL 4LAQH 4DAGH 4XXCC 2ZCHL 4LLDB 2W1WA 4DOHE 3CPLB 4LQ1A 4W6YB 1EX0A 2VDLL 5FK9A 3QIUA 2BNRD 2JB6B 1F02I 1F42A 4UR9A 2MJWA 3V5HA 3JSSA 2YEZB 3GTNA 1YYLL 4MQTB 4YXKH 1W3HA 4Y0GA 1BX2B 4KC3B 3DIFB 2OXHA 4KUZL 2K7PA 3RWFA 4HS8H 4YQXH 5DEZA 4DVBA 2XUCA 1RFDL 3O3DB 5JW4N 3MJ9H 2W91A 4XP6L 5KS9A 2NMSA 1ZGLA 3F65A 2AJXL 1VJZA 1MHHA 2IH1B 5IV2A 1PSKH 5IBUB 4MJID 4P9HL 3PHSA 5LQBL 1K9FA 2FD6H 3R0MA 1A22B 5FYLH 4Q97A 1MRCL 3ELAT 1CLZL 2QQJA 1S7VB 4QWWD 1K8IB 4G7VL 3O8XC 3QB7C 3BOVA 1E4XI 3RRQA 4AJ0A 1NWTA 3W24A 2OI9B 3GMLA 5E6IB 2CDPA 1VACA 5F1OB 5BV7H 3PZNA 3L5IA 1BM3L 4FOMA 3WDIA 4HJ0C 4JCLA 4WI6A 5DHVH 1Q9OA 5E8OA 2HKFL 4OF8A 5J11C 3V95A 3FO0H 3AIRA 1U3YA 1ONQA 4G6KL 4L9LA 5GGTL 2MANA 2B4KA 4ZQKA 4IIQC 4YBLB 1JK8B 2YD9A 5DJDA 5I76B 5EC2A 3C8DA 2LAGB 3U57A 1MLBA 4P23D 4CD8A 1YPZF 2BVPA 3CCHB 4ONHB 1XF3B 4PRBA 2YSSA 1N5AA 5CUSL 4M1CD 4HWBH 5GGRA 3RILA 3NGBC 2DMCA 3RM4A 2H8PB 1Q0XL 2ESVA 5DURD 1DQQB 3O4OB 3WHXB 3ACGA 2E7LA 3C5ZB 1XGQB 2XZQL 4ZXEA 4XPAL 2QQOA 1I3VA 1V7ML 3QO1A 2Z93A 3FFCD 4LHQB 3O41B 5JXIA 4PJFE 4JRYA 4Y89A 2PCPB 2BSED 3P40A 1HIZA 1DBKH 2VZVA 1AXTL 5DUML 4ELKA 1YEDB 4NFCA 1D6VL 5AEAA 2VLJB 5GGSY 3QEQB 5A8QA 4LFHD 3QIWB 3KWWB 1HIML 4KK6C 2Z0BA 2CBUA 1DQLH 2FZ3A 2WP3O 1ZLVK 4GPNA 1W0WB 4JFUA 5DK3A 3RI5F 2X4SA 1R3HB 5FOBA 4XHJD 3CSYB 3GGWB 3PWJB 3VFOB 3WCYA 3GXFA 3ULVF 4O02H 2CDOA 3L3KA 5D93B 1XCXA 2AGJL 1O7AA 1ZVSA 4JFDA 2EEAA 2KPNA 1CFVH 3E3QE 2EEDA 5E08L 5I1DB 3WNKA 5TD4A 3T1FA 4WFFD 4P5MB 3TN0D 3MRNB 3WDRA 5JXGA 1A6AB 3QDJE 3ACIA 1GAFH 2QEJA 3HNVH 3THCA 2Y6SD 3BKYL 1KJVA 5GGVH 5FGCB 5D7SL 2R0ZH 3OAUH 3AGVA 4XNZB 3VH8B 1OINA 4JFEB 3FCTA 4P23A 3UAJD 3QAZB 1L6XA 4KRPD 1KG0A 1PQZB 3INUL 5ESVB 3VGBA 3CUJA 2CIKA 4NKOA 3VFMA 3FRUB 5JXED 2V5TA 2VN7A 3EO0A 3UTSE 1UG6A 2BC4B 3H2WA 2QQNL 4Y1AB 3U0PB 3H42H 3SGEH 3CH8A 3IGAB 3U7YH 2FL5A 4BSVA 1E4XL 1ORSB 2A9MH 1FH9A 1Y6NR 3WYRA 4NZJA 4P2RA 3H3PL 4G3YL 3WS3A 1DBBL 3BMVA 4PTUA 4XCEA 3BLPX 1REIA 4AEEA 2RBLA 1KLGB 5HHPB 4DEVA 1G84A 4P59L 2YLLA 4LLVA 4L9DA 4MA7L 4ZUSB 1CU4H 4L8DA 2HT4D 4QX0A 3P11H 3DHPA 3HFML 1TETH 4ZUVB 5ERWA 4QHMB 1N64H 1BVKA 5FO9B 1EO8L 4R27A 2OL3A 3GMQA 3T0WA 2ICES 1MQQA 4QB6A 3WUBA 2AJ3A 3ARBA 3OAZH 3NCOA 4RSVA 5B22A 3W9EA 1KBGL 4FA8A 4AL8H 4KY1L 2PR4H 2WMGA 2B0SL 1UD6A 1BFSA 1G7PB 1NAMH 4ZTPH 3ZKXB 5T1DL 2VRJA 2PWFA 2GAZA 4J3XA 4QTIH 2DDUA 5M03A 1KACB 4Z77A 4QLJA 2NX5D 1PIGA 5DD5L 4BJLA 1U42A 4E2OA 5C9JA 2BXYA 1H4PA 4GFTB 3SGJA 4WIQA 4CCEA 1KGXA 1AP2B 3BVNB 1U91A 4OIBA 1CZ1A 5DGQA 1IM9D 3GKZA 4K71C 3KLHD 3KJ4B 2HRLA 2VLKD 4K7FB 5EFDA 3K1DA 3ZJKA 2YC1B 5C0BB 5C07A 4HPYH 3AMKA 3AXLA 1DDHA 3AHXA 1KB5B 1PX3A 2E9MA 3O45B 1V3JA 1E6JH 3WQ4A 1M7DA 3PP4H 5HHXL 5HBFA 2PTTA 2MMXA 3G6DL 3V0VA 3LZFH 1QFWH 4CMHC 4NGHL 1JWMB 1WE5A 5DRNA 4PRIA 1D5XA 4NQEA 2PC8A 2XJ7A 3OJ2C 1O7VA 1SJEA 1JUFA 2Y7QB 3DX9B 3VXME 5J56B 4YBLC 4GSDH 5F1KC 1SVCP 3UC0H 4G6FB 2J8OA 4CVXA 1U2HA 4X6DB 2BDNH 1RIVL 4YHOH 1Q0YH 1WBXA 5IK3A 4HZLA 3TA3C 4Z7NF 2OX5A 5LCVH 1D2KA 1FHLA 4K3EL 1HINL 3ARZA 4XBPA 1RUKL 4FZEL 4JFYA 1OD3A 4Z2JA 4WW1B 3VWKC 5J57B 4WO4B 4Z7UA 1LO5A 4U6HA 4AZ6A 1SBBA 1QRKA 4CD5A 3LDBB 4XX1E 1NX9A 3P77A 3MRLB 3S5LA 4TSBL 3HCVB 4Z7QE 3BUYB 4XT1C 4DGVL 1UADC 2WWMD 4LP4A 2DLFL 4JM2F 4ZY9A 5JTWA 4PF1A 4E42B 2FIRT 5I17A 5CCKH 2ED8A 3GSNL 5CFHA 3AY4C 1UR4A 1W9PA 2CK0H 4LRNL 4NRXB 3WFZA 4NYLB 3GXIA 3J7HA 5JR2A 1DL7H 3UYRL 4FMVA 1U3HB 5ILTL 1T4KB 5DJ8B 5KSBF 4N9GA 1YNTA 4FQQA 3JV4B 3LH2L 5DYOB 1V3IA 3HKFA 3RJDA 2Y5TB 5JXAL 1MCEA 4AZ5A 4I9WD 3BP6B 3P4OB 1G7JB 3UTSD 3RA7L 1I85A 2YR3A 2MFNA 3ESVF 4S0TD 5B39G 3U7AA 1O59A 5BYWA 3II1A 2B4CL 2YD5A 5INCA 5I17B 1W91A 3L3HA 8FABB 3L5XL 4G80B 3S37H 1P7KA 1A7NL 2X8RA 2YD8A 4D8MA 3SUUA 3ILPB 1I75A 4MJ6A 4ZEPA 1ZMYA 4LIQL 2ICWA 5D7LB 4OV5B 3GHEH 3THDA 3C5ZC 5C0JB 3UZEA 4HFWA 4K8RL 3TBVB 4MDPA 4P00B 2COQA 4L3CA 3RTQA 4AQ1B 5EBMB 1ED3A 3TPUA 4Z7WA 1UYZA 3QXDB 4KAQL 2OQJB 43C9B 4U6TA 1AMYA 4IDLA 4L4VA 1MCPH 5A6MA 3TVMA 1V3LA 3FB8B 3CSBA 3BEVA 4KMTL 1UXSA 4MSWB 4U1GC 4PJ9B 1Q9LA 3MV7E 4LEXH 1FFNA 3WL1A 2W3JA 2YL6A 1OGTA 2K1MA 2X4PB 3R0NA 4WWID 5CD5C 1EQPA 4IJ3B 4BSWA 4ENED 3QZWA 3SO3C 4HKXA 1JFQH 3LKNB 5F70A 2QR0A 4KKLD 5D8JL 3PQYB 4HKZA 3WSQL 4DXRA 1KPUB 4UI9L 5F1IB 2P5WD 1Z5LB 4UT9L 4O2EA 5DDHB 5I71B 4PJFB 4YFDB 1B0IA 3ZOAA 4PGDA 5HHNB 4DK6A 1S5HB 4QRQA 3UNPA 1FGNL 3ZJ6A 4Z7UF 1IAOB 4PG9A 4YGAB 1VFAB 3EBAA 5F9JB 4BFIA 3NQHA 1BAGA 4D2NA 1JPTL 1CLVA 2DLEA 4OZHE 4GG6E 1S7RA 4KDTA 1C5CL 1UT9A 4U6YA 2NR6C 4O4YL 4MZ2A 3T04D 1J8HA 5HVGB 2QV4A 3A6CL 2WDBA 3ARGA 2NY3C 3QDGE 2Z4QB 5MI0C 1KBKA 5EZJB 4ISVA 3ZTJG 4YDJB 1LK3H 3C6LC 3NNGA 3C5ZD 1NC2A 4LP5A 4MXVF 3RVWD 4OLYH 4F8QA 1XF5A 2VIRA 4NBZB 4FFZH 4QGTA 1LK2A 1BD2E 3BPNC 3GKWL 4JY5H 3T2NL 5C0RH 2YMXH 2YD7A 5HJ3A 3TA3B 4GXVH 1WZ1H 1OTSD 3CO4A 2P8LA 5K59F 2R9HC 5FUZL 3QHOA 4ZZ8A 2A9NH 1G9NC 3WJLA 1T21B 4PSRA 3N04A 2NLJB 4XCFH 1FPTL 5JZ7D 3KPQB 3VWJC 5DO8A 3WBAA 4CU9A 2IPKB 3QT2A 3F5WA 3DSFH 2AV1A 3X13B 3NJVA 1B4JH 3KXFB 1J0IA 2IFFL 3ARRA 3IJHA 3SY0B 2DQGL 4C57C 3GEWB 2XONA 4UQ9A 5C9KA 2BSTA 5HBBA 3B8YA 5ANMB 2QSCL 5D1QB 1KPRB 2CITA 1W1VA 2EE3A 1FNSL 1EFXD 3IFOB 4LVOC 15C8H 3WXWH 4YEFA 5E2VL 2ARWA 2VKWA 2YPLB 4CNIA 1PD6A 1UB5A 2XQBL 3QH3B 4JPKH 4X4XB 1GQJA 2W9DH 4AT6B 2BY1A 4NQVA 3RIFF 2VQ1B 1Y18A 4OLUH 4M5YH 4M56A 4XMLL 3RX7A 5GS0D 4XZWA 4QWWC 4GRLB 1JZ7A 4F3FA 3D48R 3IFOA 1NJ9A 2DQCH 2VLMD 1WZLA 4IRSD 5HYFA 4QGYA 1JNNL 2VX7A 5GIRB 1GOFA 4DVRH 1FZJB 2F58L 2VE6B 1CD0A 3P4NB 1A4KB 2IQAA 3QWOA 1GGUA 1HXYB 4LPVA 3N13A 4OZIF 2GQHA 4OLWL 3Q5OA 5FYJH 2LE9A 5C0FB 4ODBD 5IHZB 1MQ8A 1AE6H 4FQIH 5FUCE 3M6DA 1DQLL 4R3SB 2R2CA 5ABFA 4G8GB 4B3LA 1A7QH 5E2JA 3UTPE 1CL7H 5D7JD 4GRLD 5C7XH 3BGFB 4UNIA 5E2WL 2AEQH 2GYSA 3QG7H 1L7IH 5CJXA 1I4FB 5J3HD 1FORH 2MQCA 3ORJA 1C16B 4GAGH 4PCTA 3RWEB 4LEOB 4AQOA 2H32A 4CAGA 4FQXB 1RU9H 4FQ1L 3LS4H 4Y2OA 3ZO0A 1ITBB 1W9UA 1TZIA 4KQ4L 4QHKI 4YAQA 3STLA 4NSBA 1F58L 3QPXL 4KFZC 3TWCH 3NIGF 4POZD 3CJJA 2XZCH 4Y5XB 1WDPA 5L9DL 3OKKB 2XWTA 1A5FL 4TPRH 5D6DA 4XVTH 1AH1A 1S9WA 1FNGA 2HFEB 2WUBL 4PV9B 4JY6A 1IGTB 6CGTA 4GG8A 5FYLD 3OKMB 4PJCA 5IBLC 4X0KA 3MXWH 4P3CL 4RMQA 3B83A 1BZ9B 4XPGH 3HAEB 3VRLE 1WK0A 2IPUG 4MGXA 5IB4A 2HVMA 3RTQC 4LHSA 3TO2B 1C5DA 2X44D 3SGJC 2ENYA 2IXVA 5EU7E 3V4UH 5JXEA 3OKOA 3SKMA 1SM3H 1AGDB 2Z35B 4HBCH 5A43C 4J6RL 2CMRL 3MLTB 3QXUA 3LN5B 4YUEH 3HS0A 5TE6L 2YXMA 2AAAA 4O5LH 2BSSA 3DYMA 4K07A 4OD3H 4HS6A 4O58L 1ZLVH 1I9IL 1E6NA 3NIYA 1QI2A 2C3HA 4HIJA 5GSRA 4LMQE 2CDEB 1VPOH 1WCBA 1FGVL 2YRLA 3MREA 5HVWA 3W81A 5EC1B 4G9DB 1U6AH 1IT9H 4PMZA 5JQ6H 2XKUA 2NZ9D 4UQDA 2FO1A 4Y16C 3RUGB 1LDPL 2OS7A 3CD4A 5D2NC 4ATWA 4R5EA 2FL5B 3CH1A 2FLBT 4EN3C 4XP1H 5TH2A 5CHNB 4PRNA 4WJXA 1T3FA 1FSKC 2YK1L 3WFCL 1JI1A 3IAPA 4P0DA 5A3IC 4M1RA 1OHQA 3CSYA 4NHCL 2XHYA 1MRFH 1EO7A 1FJ1A 1IAKB 1EEYB 3QFJB 4R0LA 2A3HA 2IGFL 4OGXL 1VF8A 1GGCH 1TXKA 2WAHA 2ZWYA 3FFCA 4Z0BH 5MHSE 1G6RA 5EZLB 5EU5A 4C56E 3PL6B 1HJWA 3F7PC 1T89A 3VXQB 4DCQB 3SURA 5JW5B 3MMEA 2FJHB 3DBXB 4OD1L 2E8ZA 2IF7A 1LO0H 5JW3H 3SEPA 1OCWL 2E27H 3VA6A 5K9QI 1MOEA 1E9LA 1T5WA 3QPQC 1A7OL 4ZFFB 4X7TA 1DEEA 3NSNA 5AYBA 3LEXA 2VXUH 4UNUA 1FO0H 4N0RA 3S5LG 5CLWA 4U1LA 1EAPA 3LEYH 4ELMB 4JM2C 1AGEB 1HI6B 1Q6GA 1JJUA 5JW4Q 4XAKE 1MI5E 1LF1A 3IETA 4H8UA 2MHAB 5HY9A 2A3EA 4NNXA 1ZT4A 4K23L 3C2SA 2R2EB 2A77L 4U05A 2BY2A 2WK2A 3MBXH 1FYHB 1I9JL 2I9LA 1MFUA 1V0LA 1H3UA 3QIUC 5EO9A 5ADOH 2A38A 4A6YH 1ZGLM 3MLWH 3O6FC 4W68A 4UFMA 3U7WL 2ZXQA 5GGQL 5E00A 1GHRA 3BP7A 5TQ0L 5CXPA 4N9OB 2Y6JA 4MDJB 4PJEB 1RZKH 2HRPL 2DBLH 5K93A 5MEQA 1ZBVA 3LCYA 1NAEA 5MENB 3L6FB 4GRWH 1FFOA 4BA0A 2OL3H 2O61A 4X7DC 4B0MM 4WWKB 1NKOA 2J8FA 3IFPA 2YUVA 5IB1B 3IDXH 1MCOH 1HX0A 2ZUYA 3K4AA 4LCIH 5J1AA 1GCFA 2DQIH 2V17H 3F6IA 1N8ZA 2M26A 2VZUA 2NY6C 4Q9CA 4KMQA 3IVKA 3QQ9D 3EDJA 4OT1L 4YGVA 2MNUA 2ZCKH 2OI9C 5E6IC 3WLBA 3L3DA 2OR8A 3A6OA 5IK3B 1FZMA 1GZQA 5E5MA 4W88A 4ONGH 5I16A 1MEXL 5FA3A 1IGFL 2EXWC 2IAND 2PUQT 4R97B 4KROD 3JV6A 1T2QL 4WU5B 2CHOA 1AQDB 3H7BB 4PJ5D 1Z2KA 3MBEC 4PJ5B 1N0XL 4Y19D 1CGTA 4W4OC 4K7FA 3D2UB 5CYYA 3HC4L 3NOIA 3B4NA 2C1PB 2VDNL 3VJ6B 3TYGH 3MLYL 1JHLH 4HGWB 3N85H 1BFVL 3TTSA 4NN6C 3VG0H 3RL2A 2DH2A 4D9QE 1P84J 5AYQA 1FL3A 1KEGH 1HZHH 3GSOA 4KXZI 1JYWA 1S3KH 1YMMB 1U2YA 2WWCA 5D70L 1BOYA 1FE8L 2DQJH 1YNTB 1ISXA 2OTWB 3CZLA 2W0KA 2CBVA 1M7IB 4AD3A 3KPMB 3IFLH 3PHQB 4B3KA 5EZOL 4ZNEE 3VCLB 1FV1A 1YN7B 1NEZB 1IM9B 1HH6A 1JL8A 4NP4L 1FHGA 3UYOD 1FNFA 4X4ZA 3DX8A 4PD4K 3DX9A 1WQVT 2V6HA 1E27A 4D0BB 2DDQL 2Q7YA 1E0WA 3RU8H 1DBAH 4OMDA 1BQCA 5C0GA 2ITCB 4ZE5A 2CGRH 1TZGH 5LGHL 1W9DM 8FABA 1MIMH 1LE5B 5ADPH 1QNQA 4X99A 4RFOL 1U8OB 1MI5B 3QISA 4WO4A 4Z7UB 4L8SC 2NT0A 2OTWA 1YYML 4NO0B 4PJXF 4FTVB 4GS7B 5DXWA 5E0CA 2C7UA 1KB5H 1FLRH 1P7QD 1IGMH 1U95B 3IDNB 4XPTL 1RUPL 1OM3H 4BQBA 1G7HB 1TNNA 2WHMA 3ZLQC 3E6FA 4FFWD 2BX5A 5E5RB 2XA8L 5HHVL 2J1EA 5B4XA 2R2HA 4U1HB 3BYTA 3WJJA 3HI1A 4O4YH 4PB9L 4OZFG 4F57L 4RGNE 4MAYC 5T5FH 1FH8A 2IFGA 2OYLA 5BJTA 2GDUA 2AABL 4MNGA 1RZIB 1SY6H 5F6IC 4L5FL 1DANU 2Y6SC 2BGPA 1U95A 4AZIA 5B4MC 1ZK9A 5HD8D 3TOPA 4QDRA 1KJ2L 3BP6A 3VDHA 3TCLB 4CMHB 3PUIA 4LPUA 1U8HA 4I4WB 5IB2A 1BBJB 5E8DL 2BFGA 1MW3A 5DTFB 4JPWL 1M05B 3MFFB 2JKXA 2V3DA 4IRJD 2ZOLB 1T7ZA 3N1FC 5BO1L 3VXRE 2AOSA 3O9WB 4ETQA 2OP4H 4MJ6B 5F9JA 1J7VR 5D2LF 3ILPA 3BAEH 1K9TA 5FGBA 3A4XA 3KPRD 2I25N 3T08A 3ZKXC 5F44A 3RGVB 5MEOB 5KSBB 5T3ZL 2LV4A 4PJGB 4RFNB 2ZX6A 5E1HB 4L4VE 3MV7B 4XMKL 4GRMA 5D71H 5DK2A 5IW1B 4AY0A 2WVUA 3QQ3A 4F15C 1FHDA 1B3YA 4QRRD 1M05A 2JIXB 3O4LE 4I0PA 1UD8A 1AI1L 3FB8A 2BCKA 3TT3H 3QI9C 4JFTA 7FABL 5DA4A 1Q9LB 3ARBC 5DFAA 5DJYA 3O3AB 3AMDA 3LS5H 4A3YA 1NOWA 2AJVL 3GO1H 5IR1B 4UBDC 1HKLH 1P4IH 2C4FU 2QR0B 5L2JA 2C3XA 1I1FB 2BVOA 3O2DL 4NZDA 2ZOKA 1SQ2N 2WVVB 4NWUH 3AIQA 5I6SA 4P9ML 1JN6A 3RZCB 4K71B 4XXDB 4XVUD 3SDAB 5B39A 5I1HH 3R8BB 5ICYB 3OKLA 1T04B 3MUAA 1KTDA 4LL9A 2A6DA 5FIPA 2BVQB 1NBYB 1UZ4A 2Y36H 4R26L 3HZMB 4LLQA 2AJXH 4X7SL 1E4NA 3PWNB 5E7FA 2AJZA 4WY7L 4YHEA 4IS6A 2MCPH 5D5MF 1WBZA 3I2HA 1D5ZA 3T3PE 1EGZA 2UVFA 3BCFA 3LKRB 4U1SA 2O9RA 3RX5A 3AQUA 4N8VB 3IJ9A 4J3SA 4RRPG 2QHRH 1CF8H 4W4ZA 2VDKL 3QEHB 1RULL 3GSWA 3C9NA 3OKLB 2IXUA 5HHME 1H0IA 4PEEA 3GJFB 3IKKA 3OAZK 1HNFA 2HVJA 5DURB 3K8LA 2YN3A 5GGUA 5HYSA 2QQNA 3ARFD 3CHEA 3WBEA 4AIXA 1PY4A 4EXKA 1CDYA 5CSGA 3D0VB 2P42B 2X0HA 1U8NB 4LSVH 2PXYC 1JDDA 2XYLA 5FOOA 2W65A 2J75A 5TDNB 3V6BR 1DTUA 1AIFA 4M81A 3O8XD 4Y5YC 1AXSA 3F2ZA 1T21A 5FKPA 1MCSA 3CUPB 4E4PA 3ULVL 5CJQH 3WN5C 3WXVL 1AQMA 1QRNB 2DM3A 5A2FA 4GQQA 2VWEC 2YBTA 1QSZA 1NC2D 1IEBA 4TSAH 1DEDA 1KEMH 2D23A 1DQDL 1ZHNA 3GDBA 1OSPL 2A73A 3BPCA 2GKIA 4UOZA 3WQVA 2CETA 4YC2C 1J9CT 3BRDA 2DCKA 1IVLA 3L5WA 1UFUA 3QIWC 1PEWA 1AQKH 4Z76A 1E28B 4JRXE 5FYKL 3ZYOA 1AR2A 4HA1A 1ZA6A 2Z92A 3GI8H 1VACB 2D3LA 4YPJA 4CVZB 4KI5D 1Y0LA 3EMQA 1F3RB 1XCQA 5DD1L 4LCCC 1EEUA 2ZUVA 3TJEH 5DUMH 1F3DH 1FNEB 1QI3A 1HOCB 3CZFB 3DVNA 4PV8A 4M48H 2UUDK 2NY2C 4OLZH 4XNXH 3STLB 1RP8A 3QUXA 5ECJE 4C56D 4Q9QL 2BZDA 2BRRL 4NRYB 3PZQA 5I78A 1K8DA 5H37H 3CLEL 3OG4B 5BRZB 3LQAH 1UA6H 3ALPA 4V1DE 1MUJA 1BSIA 5CJBA 1FAIH 6TAAA 3BZ4B 1WICA 4NKIL 3RVVD 4Q9BA 5GS0H 1R3LB 4V2CB 1ZVYA 1W99A 1XCWA 3N9GH 4R97C 4ACYA 3ABZA 3HPLB 1WWWX 4JQXA 3RWIA 2G3IA 4I5BB 1A4KA 3LDBC 3P4NA 1LP9E 3C5ZA 3SN6N 4GQ9H 4MAUL 2PO6A 3LEVL 4PTXA 2X4RB 5FCSH 4OLEA 1FDLL 4I77L 4MJ5B 4RISH 4HIHB 5L88H 1NH6A 4KPHH 5ABFB 3RTQD 4ZYKA 4PP2A 3W0WE 3MRCA 3LOWA 4HULB 3ARXA 4D0CA 2FATH 1ESWA 5BRZA 4E8CA 3QNXB 3TNNB 5C8BB 4XPHH 2DTSA 4LIQE 4JQIH 3U4EA 3S88L 1OAKL 5IVXB 2ATKA 3FB5A 5A8PA 3HRZB 2QQIA 1YHTA 1W2PA 4ODVH 1F6AB 1B0GB 3MBED 4GOSA 4I13B 5E8OB 4JN1H 4FG6D 4TUJB 1S7UB 5E2UL 5EU4A 2WO2A 3LKQB 2DEPA 4HWEL 1UR1A 4CU7A 2RGMA 3U36A 2DQXA 3DV6B 3WF3A 1PZ3A 3B9KC 2UZXB 3I6LE 1U8QA 4X5WA 4AD1A 3GBMH 1AY1H 3DV4A 4FP8L 4ERSH 1QR1B 2MKLC 1DVFB 4P57A 5CILH 4Y4KB 25C8L 3NN8A 5KTEL 5FYKE 1KXHA 3BHBB 1CN4A 1V5JA 2D3NA 5BZWB 3B2VL 1K6QL 4EI5B 4EANA 2DM4A 4JFFB 1HYSD 2OSYA 1R5VA 1OL0A 3BESR 2L7JA 1Q6FA 4OMCA 4NFBA 3D3VD 1DBJL 1EEYA 2Z93B 4R0LB 4YDVB 2EC9U 3SCNA 1E6OH 1UB6B 3D3VE 2R39A 1F4WL 2FO4B 2F8OA 1CFTB 1T7XA 3GNOA 4Q7NA 1H5BB 5T33H 3N0PB 2D7TH 4RGNB 2BVDA 2ICEA 4W8LA 2N4IA 3VMNA 5DJXB 1RZKL 2HRPH 1YEIH 4KRTA 4UV7L 1QVOB 4KJYB 4MVBD 1MWAB 1HJUA 1T1XA 2AQ1A 3Q6GH 5DRWB 1ZT1B 3QUZA 1OTUC 5I77A 2LU3A 2HTLC 5EC1A 5LGJB 4QRRE 3QXVA 1I8MB 3CFBB 1A3RL 4HPOH 4F9LA 5HYJD 2W07A 4PR5A 3ILQC 4ZUWB 2NY5C 2VISA 4M8VA 1ZANH 4S1QL 4UILH 4I1NB 2Q1EA 4Q6IB 5EO1B 1R6VA 2CIIA 1U8JA