1XNBA

High-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycosidase
molecule keywords XYLANASE
publication title High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis
rcsb
source organism Bacillus circulans
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xnbA00
2DCKA 4HK9A 3WQ7A 5EJ3A 2QZ3A 3MFCA 3LB9A 1XNKA 3AKPA 3HD8B 1XYNA 4XQ4A 3WR0A 3RI8A 2VGDA 3VZNA 3WY6A 2C1FA 4XQWA 1ENXA 3WX5A 1REEA 1H4HA 1XNDA 2F6BA 3WP5A 1UKRA 1UU4A 3MF6A 3VGIA 1W2UA 2DCYA 1KS4A 3B5LB 1H4GA 3VHOA 3VL9A 3VHPA 3ZSEA 1M4WA 3VLBB 3AKQA 1IGOA 2JICA 1OA2A 3WQ1A 1C5IA 4S2FA 3EXUA 4NPRA 1XXNA 1UU5A 3VZOA 1F5JA 3VZMA 2BWAA 2DCJA 1HV0A 3AKSA 2VULA 4S2DA 3AKRA 2DFBA 1AXKA 1TE1B 1OLRA 2D98A 2NQYA 3WP3A 4XQDA 1QH6A 3LGRA 1OA3A 3AMHA 3AMQA 3WP4A 3WT3A 3VZLA 2DCZA 2BW8A 2QZ2A 4HKLA 2B46X 3VZJA 1XNBA 3WXPA 4XPVA 2VG9A 4HK8A 2JENA 4H7MA 4HKOA 3AMMA 3MFAA 1HIXA 3M4FA 1YNAA 2DFCA 1H0BA 1REFA 2B45X 5K7PA 1BVVA 4HKWA 2B42B 4S2HA 1PVXA 1XYPA 3VHNA 4S2GA 2D97A 2VUJA 1H8VA 3WQ0A 1BK1A 3B7MA 5HXVA 3RI9A 1BCXA 1NLRA 3AKTA 1C5HA 1OA4A 2BVVA 3AMNA 4IXLA 2NLRA 1XYOA 3AMPA 3VL8A 2JEMA 3O7OA 1T6GC 1OLQA 1KS5A 5K9YA 2BWCA 1XNCA 3VZKA 1UU6A 1HV1A 1H1AA 3MF9A 1QH7A 1REDA 3WP6A 2Z79A
chains in the Genus database with same CATH superfamily
1OUXA 3H0OA 4Y5Z0 5IK4A 1S1AA 1CX1A 3JD73 3WNNA 4M4RA 5LCWL 3QCWA 3WQ7A 1V9U1 1RVF3 2ZJCA 2GSYA 5FTTC 4I2OA 3GYDA 4XQ4A 3WR0A 1R64A 4HMZA 3WF1A 3BPSA 4GH4A 2BEOA 3ZKUA 4QHBA 4X8NA 4B4RA 1GZTA 2VTFA 5IUQA 3GF6A 3E6DA 4RR3B 3VBSC 1W6MA 2VMIA 3DYOA 3NQHA 4Q0PA 4U36A 1Q8OA 3AP4A 4OYUA 4XVHA 3WP5A 1VBB1 2VZQA 3C3VA 2JG8B 5D8AB 3F2ZA 3MF6A 3VGIA 3IDBB 3CDZB 3K4AA 1QDOA 3U4SA 3POBA 5JLVA 4QDSA 1V0AA 3WNXA 1TMF1 4ZS2A 3ZFEC 2Y33A 3KV9A 1QJU1 1OLME 2ZX2A 1F31A 5JOXA 2VO5A 2NPIA 2ZPXA 4E8CA 2BERA 1UX7A 1JOJA 3U07A 3OD0A 1AR63 1J1LA 2J1UA 1QOOA 4CDWA 2QJVA 1QU0A 4JTOA 3VV1A 1EPWA 1EAH3 4RS5C 3MHZA 3TNQA 1VBC3 3T4VA 4KNCA 1I3HA 3MDPA 1RUG2 3MIHA 5F37A 1MQTB 3B93A 3LA2A 3VZOA 3KHBA 4F8AA 4Y26A 5BNPA 2A6WA 3U0ZA 2BWAA 1SLCA 2QQJA 2XBO2 5K0UA 5A7SA 3H8OA 4OUMA 5F5AA 1UO9A 1LENA 1YI7A 5A1LA 3H8XA 1AXKA 1VBA3 2P3KA 2PLV1 4CUBA 4TSVA 2HWD2 4QQPA 3H3LA 5BV6A 5BNOA 1HB2A 3AMHA 4FPCA 3OD4A 1Z7S1 4P9LA 2UU8A 1XNAA 1PK6C 1JU4A 1RHI3 2UWCA 3GJAA 5EJ1B 3VBSB 5FO7B 2R041 1GANA 3GZTB 3FWEA 3ZYRA 2PFWA 2PHTA 2VMFA 4Z07A 4B4PA 4WM8C 5F3CA 1HB4A 1U5XA 3B94A 3LD8A 3SNMA 5GZGA 3DKWA 2CYFA 1EYBA 2DUOA 1HIXA 4Y3OA 3ZFEB 5F3EA 2WNVC 2XVLA 2YMZA 4DOUA 3S7IA 5J37A 5I0DA 2WSUA 2A6XA 5A3TA 2ADEA 1H1MA 1NCQA 3AZWA 3HMYA 4KWLA 3MW4A 4ASMB 1H2KA 1A8MA 1YEWA 1W2AX 4RS5B 4CPBD 5EJZB 3S5AA 3I97A 5JOYA 4B3NA 1EUUA 1BK1A 5HXVA 2ZXQA 3L2HA 1S4CA 2QTWB 4P9YA 2VVEA 4A7KA 5FZBA 5C8CB 1SFYA 3AKTA 2WFF3 1MS1A 1JXNA 2IC1A 4GKYA 4QQLA 1U5ZA 3ILFA 4XCAA 1BZWA 1S0BA 1YO8A 3AJZA 1SBEA 2JEMA 1PVC1 4K1YA 4DFSA 1COV1 3OCPA 5LK7B 3WNKA 1XNCA 4CU9A 1JZ6A 1N1VA 2YC2A 1C1LA 2WWUA 3CJXA 2VD7A 3LFMA 1JS9A 2D3RA 3ZXEA 4CCOA 5CKNA 3RJRA 1ASJ2 1OT5A 4LBOA 3TNPB 4PI2A 1FI2A 1HJFA 1LEMA 2V73A 2XL7A 3GZAA 1PK6B 4DUXA 3SLIA 5DZEA 4XJZA 1YCIA 2A3YA 2W1UA 2ZX0A 4QAWA 2HWF3 2Y6KA 5EJ3A 2BBVA 2BNMA 1LHWA 4MGQA 4RGGA 3HD8B 1PMJX 4WM8B 5FP8A 3H50A 5CFDA 1QQP2 3DGTA 3WG1A 4XIKA 2RMU1 4B8EA 3N9MA 4A45A 3H3UA 1ZRFA 3UGFA 3PUHA 5DAXA 1SQ4A 3FE5A 3I2HA 2RS32 3WX5A 2F6BA 1LHVA 4ZHNA 1QWRA 2WNVB 4CCEA 2XB6C 3UK9A 1RINA 3J7HA 2EALA 5BPXA 1UYXA 4XW3A 4Q4Y2 3LOBA 1R1A2 1GQPA 1FT9A 1AR92 4QPGA 2UYBA 3M3EA 1W39A 3J8F1 1GV9A 1CONA 1VMJA 1YUDA 3LDRA 2AACA 4JTNA 3JQXA 4XJ8A 1LEDA 4LE4A 1OURA 1XNTA 1ZYBA 3P5BA 4E2QA 4LKFA 4SBVA 3D0SA 3X29B 3CLPA 3I3MA 2YBSA 4DIQA 1CWPA 3KV4A 5K8SA 1OA2A 2EAAA 1ZRIA 4Q4V1 5IVFA 5KBFA 3A23A 2H6CA 4YGEA 1WUVA 1LJ7A 1QJX2 1UD1A 2Y60A 3M2MA 1OH3A 4BIOA 3OGGA 5FWJA 5I8TA 1W8TA 3MLKA 3LKJA 3VN4A 3O0XA 1H9WA 3AFKA 3OPWA 4XDOA 3WUDA 2B4KA 4J1WA 5FPUA 2RM22 4FP2A 4E4DX 4AEKA 3JBG1 1QJY2 1ZBA3 2NQYA 2YBPA 4CEWA 2IXKA 2GNDA 1YWKA 1ZZBA 4UAPA 3TBDA 1KJRA 1NE6A 2JE9A 2WZ8A 2OQ6A 1V9U3 3FUOA 3EB7A 2G19A 1HRI2 4IE5A 5H9PA 2XWBB 1D0GA 1WMFA 3UJOA 4QPIA 1B35C 1Y9QA 2ARXA 2JECA 3VZJA 4A2UA 4COUA 5BYNA 1DGWX 4FXGB 4LHNA 3UESA 4HVQA 3ETPA 3NSTA 3RZGA 3O1SA 5J7MA 4DXTA 3JB4C 1Y3TA 1VBB3 4PHZA 3U37A 2GP3A 5A32A 3UT0A 2GMPA 1BYHA 4NPLA 4Y4YA 4CU8A 5C4WC 4W6YA 1QHDA 1F4HA 2FCVA 4FOYA 2XR4A 2R7EB 1QJU3 1FMD1 3AL5A 4YZ3A 1WBFA 1PVXA 4EN0A 3BVCA 4PIYA 4ASLA 3ETQA 2AGSA 2IZWA 4XF9A 5BNNC 1VAKA 3VKMA 3ZYBA 3ZN4A 4Z8BA 2DBIA 1ENSA 1PMHX 3NJXA 1CIWA 4KI5M 1IS4A 4XBNA 3UGGA 5JMOA 1HKDA 4KMQA 2B39A 1US3A 2YPDA 3O14A 2VW0A 3MICA 3DECA 4RQPA 3ZFGB 4XJWA 5LK5A 3G7DA 2WA3A 1E5SA 4MXWA 4ONUA 1HXS3 1W90A 1D4VB 2HEWF 4BE3A 4GB33 3POEA 1AR82 2PLV3 2E31A 3CF6E 3THTA 3U78A 5IAXA 1Z0HA 3I7DA 2Y6GA 3GM8A 4W8JA 4DY3A 1G9BA 1LB2A 2R49A 5FAXA 4AAPA 2PHXA 2Y8KA 1Z7S3 2ZGKA 1A34A 4WM7C 1B35B 3MFCA 3M8LA 2HWB3 2GZWA 3WG2A 4L92A 1JZ2A 4BMEA 5FMCA 1CPNA 1ULEA 1V6OA 2R043 2YFUA 1AYN1 1GWMA 1DQ1A 4I0AA 2P4EA 1TG7A 4XQWA 5L9RA 4GXLA 3K2OA 3RYKA 5C4WB 4DB5A 2BBAA 3JXSA 1LOEA 1J83A 5EXOA 2XHNA 4JC1A 5FRAA 4GKXA 2RR13 1ZBE2 1WD4A 4MGSA 4XE9A 4OHYA 1GOFA 1MS8A 4XFIA 5I8SA 1BEV3 2P3YA 4DEQA 2ZGLA 5I0RA 4QKDA 1HLCA 2XQRA 3VBOC 3R05A 4UYBA 2VQUA 2JICA 4KU8A 3AP6A 5EP9A 5LBEA 3O5SA 2HWC1 3V65A 2RS11 2W5FA 1QJEA 3ST7A 1LHNA 2PHDA 2Y64A 3WQ1A 4S2FA 3POGA 5FQ0A 2QKDA 4IV3A 4AE2A 1W6OB 1WW6A 1OMIA 3ZYFA 2YGLA 1PVC3 3N7LA 3VKOA 2XOMA 1W9WA 4H2AA 4BISA 2VULA 5D1IA 4HZFA 4GAZA 5CISA 4EZHA 1D4M2 2EAKA 2A6YA 4YZ2A 1N1YA 2BTVC 3I3DA 5DDJ2 1GFF2 4WM7B 3TRSB 3ZYPA 3EBRA 4JHZA 5CBLA 4YRDA 4YVWB 2XKPA 2A71A 2TNFA 1YFXA 1W0NA 2PHRA 1VMHA 1UAIA 4RHV3 1DGRA 1X33A 2OT7A 2ZMNA 1JYWA 1JHJA 4CPBA 1XJAA 3WDXA 3I49A 1RITA 4JRLA 5FYBA 1DQ2A 1Y7BA 5FY1A 4QXHA 1UYPA 4LHSA 1LOFA 4NO4A 2P5BA 2Q30A 2XHKA 3ABZA 1NQDA 1FXZA 4ATEA 1H0BA 3ZFFC 3JQWA 3EQEA 1QXJA 2ZEZA 2F4LA 5E89A 1IOAA 5FLHA 4AI9A 3J8F3 4KBBA 3KWVA 1SBDA 4OLLA 1NZCA 5FV3A 5FZ6A 1CAWA 5F5QA 5A7OA 2YDEA 2XVGA 5A3OA 3IPVA 1H2LA 1MVQA 4FPKA 1A8DA 4LMFA 3OYWA 1DFQA 3NNFA 1R081 1RTVA 2WS91 2NLRA 2A6ZA 4JRAA 4AG4A 4LBMA 3V0BB 1T6GC 1OLQA 2KD7A 3GDBA 4YZ4A 3LZZA 1YJLA 1OF3A 4I30A 5K9YA 5FZGA 3ZIWA 4RA0A 1WA6X 3W20A 4DXSA 4A44A 4XBQA 1QNWA 3WP6A 2OS2A 4HK9A 4LTAA 1JZ7A 1GKBA 4BWOA 2VQ0A 3E5QA 5FMOL 2W52A 5ABJA 1TMF2 5C3QA 3RZHA 1CAXA 1NY72 3KVBA 2YU2A 3ZSMA 3B00A 3C7EA 5FZ9A 3I2DA 3K4DA 1RB8G 4M0HA 3ZFFB 4CE8A 2QQWA 2H6BA 4UFLA 2WT2A 3OB8A 1OI6A 3RQ0A 2E63A 1GP6A 4Q0QA 5FZDA 3THDA 1SHWB 1RUI3 2VMHA 3A0KA 1QIQA 1O4ZA 1UN1A 3N9NA 5FPBA 2DVGA 4CP9B 1RMU3 1W6PB 3D0JA 4XMAA 3U1XA 5IT6A 4R9CA 2WLPA 2PQSA 3NRUA 3AKQA 1AZDA 1CGPA 5JXHA 1V6IA 3RZZA 2J1VA 3E1F1 1JZ8A 4G4FA 4BZ4A 1VP6A 4NMIA 2WQ4A 1FV3A 2AREA 4WVVA 4C90A 5JIUA 3ZN6A 2JDMA 4TZDA 1KDMA 5FZLA 1IPSA 2FDHA 2ZA9A 4XEZA 3S6PA 4Y1XA 2DDUA 4AAXA 1N3QA 2ZBJA 3N9QA 2JKXA 3LAGA 4HG6B 5GLUA 1K5MA 4AEJA 1OBNA 1W9TA 3EO6A 3SCHA 1GICA 4UI9L 5JWPA 3HPNA 1AX2A 3WQBA 2XJSA 3J4UH 3BB6A 4YVSC 1WCKA 2JDNA 2VOXA 4CZSA 5J48A 1FOD2 4OQ9A 1WW4A 3NJVA 3QBQA 5LATA 3VZLA 4HKLA 2B46X 2FDJA 1GNZA 1IHMA 1XNBA 2WZR1 2CWSA 4Y33A 4J1XA 2CWMA 3RG0A 4OQ8A 2QQVA 3FJSA 3NV3A 1JYIA 5FZ7A 5I0UA 1O3TA 1WCDJ 3AP7A 4OMDA 2ARAA 3WCRA 5JI7A 5F9TA 3KV6A 2ZGPA 2PQQA 2VCBA 3M4FA 3WZ1A 1REFA 1YIPA 2J42A 5A7PA 1SACA 5DUWA 3QH6A 2W92A 1RUF1 2BZDA 2OZJA 1COV2 4YPJA 2C6SA 2XH6A 3VBUC 5C6CA 3MW3A 3NNLA 3JD71 3IN9A 1XE0A 4CXXA 5FYZA 5A80A 2TBVA 1RJ8A 1UOGA 5LW9A 3O0WA 2OKXA 1XE8A 1RVF1 1WLDA 2VUJA 2EIGA 1LU1A 1TVGA 4XFHA 1I1EA 2WINB 2K46A 3R4UA 5F39A 4XF3A 4Y1YA 2PHLA 4LE3A 4QGNA 3VD5A 1C5HA 1QMJA 3J7MA 1A6CA 4UW4A 3VL8A 2Q8OA 4DMIA 3Q9OA 3WG4A 1W0OA 3JZVA 4CUGA 2BFUL 2BWCA 1XSRA 3WG3A 3B9CA 4YZ5A 4JVAA 2W39A 2X5IA 3A4UA 5A3NA 5C33A 2VE1A 5JI9A 3T0DA 3UKVA 1B09A 1NCQC 4Z1VA 4YVSB 5LWBA 4XJUA 1JYVA 4AQTA 4EJRA 3KZ4C 5DQ0A 2JDUA 3K3OA 3NV1A 5CKQA 3A7QA 4GWNA 5FWEA 4QX1A 1MR5A 1TME3 3HWJA 2XKOA 3HBKA 1ND3A 3J7NA 3HNMA 4LBQB 2AEZA 1W99A 1UY4A 1Q8SA 1EAH1 4XOGA 1VBC1 5DUUA 2YROA 1J3PA 1ENXA 2V4VA 2I74A 1ZA7A 5CNAA 2ZGOA 3DUIA 1UX6A 4L0PA 4A42A 2BP6A 1ZRRA 4Q4V2 2Y0OA 1LCLA 2CL2A 2WAAA 2CNAA 4K6BA 3T2PA 3VBUB 1W9FA 2Q1FA 1NXD1 3PUIA 4CCJA 1ULGA 2J1RA 4IEWA 1H4GA 4NHXA 4NPMA 4NE9A 3VHPA 4BPZA 2FCTA 4XUTA 4LIUA 4QU1A 1AXYA 1W0PA 2D6KA 4NROA 5EV7A 3SEEA 2PN5A 2NZ9A 3LSDA 1OSGA 4AW7A 1DQ5A 3Q8AA 4D3WA 4UFKA 3RJ2X 4O65A 5F6KA 2DVFA 4EZ4A 1RHI1 3W5NA 2XUMA 3KCYA 5GZFA 1CAVB 2WS93 3A0NA 4QHOA 2V5DA 2JE8A 5CFCB 1W6NA 1SPPA 1AYM3 1CAUB 1HV0A 5BY5A 1NCQB 4CA9A 2YPJA 4UBGA 3DXUA 4CP0A 5KR7A 4QT6A 1EP0A 4AFBA 5DMYA 1X8MA 2ZEWA 3AMQA 4D94A 1WW5A 2W1WA 4QWNA 4Z2WA 3GCXA 4DZGA 2UY9A 1DHKB 1XU2A 2DUPA 4IETA 1S2EA 4LA3A 1LR5A 1VRH3 1FMD2 1F9KA 4YNIA 2A3WA 1P8JA 1GOGA 2VBBA 2VBPA 1HDKA 1PNFA 2HWD3 2MPFA 4LBJA 4XF1A 2WFF1 2FMYA 4IV1A 3OSDA 3CEWA 3NNMA 1GNYA 4QB6A 4MV2A 1EPZA 1V6MA 4B4QA 1RUD1 1TQ5A 1DGLA 4Y20A 2YV8A 2C9AA 2YUEA 2GN7A 2Y6HA 2H0VA 4FOWA 3AYEA 4URTA 5A6XA 1W03A 5FBJA 5BXXA 2CGOA 5FZ4A 1EV11 3BN6A 3K77A 4PT6A 2Q8DA 2W68A 1H8TA 5KXBA 1XE7A 3PVOA 3MYXA 4QPIC 3DKQA 1G9DA 2P6CA 2RHPA 3KM5A 5I0SA 1US2A 4BA6A 3T2TA 5DXDA 4Q29A 1V6JA 2P37A 2X09A 3D82A 3LA3A 4N43C 1MS5A 4LIVA 2OQ7A 5FZCA 1OFNA 4QX8A 1HQWA 4R4ZA 1BBT2 2JDYA 2R1DA 3B02A 1XYOA 2GNTA 5FJKA 1WMXA 3AMPA 4H3WA 5AFEA 5FY0A 1AYN2 1PHMA 2WWJA 4XF4A 4Q4X3 4AF9A 4BK4A 2VTXA 3ZSLA 1AL23 4CCLA 1Q3EA 2FQPA 2R32A 4W65A 3POYA 2ZGMA 3H1WA 3H3ZA 4CEYC 3W21A 4W6XA 2ZTNA 2JDHA 3KGLA 2WC2A 3ELNA 5H9RA 1A78A 3LB9A 3RFRA 4PF1A 3HEIA 5AVAA 2ENRA 1RUE2 2OZ6A 2VCMA 2WZR3 1NQJA 3JCIA 1MZ5A 1MZ6A 1J58A 2A1XA 1X36A 1LAJA 4YWAA 3VBRB 3HR9A 1V6NA 2B7YA 2MEV3 1H4HA 1K3IA 1XNDA 2ZMKA 3AVSA 5F32A 2VOTA 2HWC2 3OBRA 2RS12 3PUAA 3W9AA 1DP0A 1MS4A 1VBE3 2WL1A 1W2UA 3MW2A 4ITCA 2ATFA 3ES4A 1W8OA 3PIGA 4AHZA 1QXRA 2L9LA 3J9SA 5F1RA 3UKNA 1CD3G 3T09A 1PO13 4XURA 2EXJA 4L8QA 1TEIA 4OI4A 5DPNA 1H1IA 3VHOA 3WHUA 2VMDA 2MHFA 2JD4A 4FI9A 4DNYA 3E97A 2A73B 2BOIA 3CNAA 3VBHC 3GXUA 2WYSA 4N43B 3ZN5A 5H9QA 5J36A 2XXZA 4O7XA 5EZWA 4EN9B 4BXSV 2LS6A 3FZ3A 1Q56A 4ES9A 5KXEA 2A70A 3M7AA 2VNOA 1XB9A 3CL1A 2DV9A 4N53A 1F5JA 2GALA 2BQPA 3ASIA 3FL7A 1ENRA 4QM8A 1POV1 5DZFA 1RUC1 4B1MA 4G9SB 1W6QA 5I91A 2PXJA 4LUMA 2VMEA 4LJHA 4ZONA 4CEYB 5AVPA 1WA4A 3TN91 4Q4W1 4IUGA 2OPKA 5KHJA 5F2SA 4Q2FA 3VDDA 4ZZ8A 3RMXA 4AEDA 4IE7A 4F3JA 1OVPA 5KHHA 1GQHA 4N7IA 1PO22 4NIDA 2W87A 3WT3A 3RWKX 2XJPA 2ILMA 1QJFA 2VH9A 2QQOA 2OIIA 3PURA 4CP1A 2CGNA 1YQ5A 1DZTA 2HWE2 2JE7A 4HVOA 4I09A 4UFMA 1SCRA 5FYVA 1WZXA 2EF6A 2W46A 4XPVA 1AVBA 5C7GA 3V0AB 5IFPA 1ULCA 2VNRA 1GZWA 4PDWA 4PF5A 5IK8A 1KRIA 2JENA 2W08A 3IDCB 1JZ3A 3O1VA 3LA7A 4BXFA 3RZKA 1HW5A 2GU9A 5FK7A 4OCTA 4LBKA 1DQ4A 1R082 3FHQA 3VDAA 4N9HA 4URAA 1HXS1 1ND2A 2YZ4A 4GB31 3V56A 3Q8EA 1PX3A 1KJLA 1UKGA 5GLZA 2P3IA 5T5PA 4I3GA 1MZFA 3VBHB 3ZXFA 1IKQA 2Z69A 2WWSA 4QMAA 4D69A 2DVBA 4IEXA 1O4TA 4MLOA 1NUKA 2D43A 3K48A 1SFPA 2B8MA 4QXCA 3FBMA 3JUUA 2GMMA 1WGPA 2HWB1 4YFZA 1NLQA 1XPWA 1U0AA 2EXHA 2YC4A 4BYYA 1ZRCA 1RUH3 5E16A 3BUCA 1LOFC 1O6UA 2D6LX 1D2QA 4IEOA 5ERLA 2X8KA 3AMNA 5F5IA 3T1MA 3ZVXA 5AC93 4KU7A 3WW1A 2EICA 2IXCA 5E6HA 3TEXA 3RS6A 3NKGA 2R072 2JWPA 1AR72 3VBFA 2GNBA 1S2KA 1UU6A 4DO0A 1W9SA 3D3AA 3FN9A 1UXZA 2ZEYA 3GALA 2Z79A 3FLPA 1T2XA 5FPAA 2RR11 5JZGC 1WCQA 1PZ7A 3E5UA 4RN5A 3ZXLA 3KLSA 5FXZA 4FOVA 4H7LA 5I0TA 1BEV1 2AEYA 3PU3A 5EIYB 5FXWA 5J3UA 3N35A 1VBD1 3BTYA 5J1XA 4OMCA 3OUIA 4IW3A 4XUOA 3CJIC 3AM2A 1LU2A 2G9ZA 1CESA 2RS51 1LKNA 2XONA 3KQRA 4YM1A 5A3MA 1OD5A 3H1YA 1A3KA 2VVDA 3R4SA 5A70A 2JJ6A 1F15A 3MIFA 1CQ9A 4IE4A 1TNRA 4AVAA 5HBAA 1RUD3 3LDKA 3RYRA 1N47A 5FP3A 2ZGQA 4AFAA 1S0FA 2ES3A 3S5QA 2WSVA 1WMDA 3NMBA 2AENA 3AYDA 5GALA 2BJSA 2VPVA 3WD5A 5CG8A 4MO3M 5ACA1 1YQ6A 2XQXA 5ABJC 1EV13 2D3SA 4IGQA 2B9UA 1IPJA 4CDQA 4C0HA 1IPKA 4NUBA 5LBCA 1BMV1 4RFRB 1BJQA 3KCCA 2XGXA 4KWKA 4RHV1 4A7ZA 3N7JA 3OOXA 2WAOA 3POSA 4HT1T 5A7WA 2JG9A 1W06A 4MADA 4OI0A 1V70A 2WNUC 2E26A 1UU5A 3KSCA 1UY1A 3LEKA 5CYYA 2YBKA 4H55A 3PVEA 2HEVF 3FUQA 4LOSA 4YGCA 1SLLA 2E7TA 4CXWA 2G1MA 4S2DA 2GC3A 3KQ4B 4IL7A 4FAGA 1CAWB 3ACGA 2GP5A 1TE1B 5IHRA 1FV2A 3OY8B 5JZGB 1OLRA 2WIIB 5DUVA 2D98A 3IPVB 5JR2A 4PLOA 4YM0A 5HXMA 2UWAA 3IT8A 1QH6A 3LGRA 3PVNA 4HETA 4JGYA 3IIAA 4Q0VA 5E8AA 5FZ1A 5FZOA 4FQ4A 3WF0A 3VDCA 2HH9A 2WT1A 2BUKA 4XCBA 1ZZ7A 3CJIB 3EHKA 1RUF2 2DCZA 2DF7A 5FPXA 5APAA 4UF0A 5ISLA 4JDMA 3S57A 2SLIA 2VM9A 3JD72 2ZGSA 4R9DA 3T2OA 3SH3A 4D6QA 1G9AA 2G9GA 4A41A 4FTSA 3CBNA 2DBNA 3M3IA 1RVF2 1SLTA 3RNSA 5B2GB 2A3XA 5L9VA 2R16A 1ULOA 1YYNA 4LK6A 3VHRA 3ZO0B 1C8M1 2C9KA 4ISQA 1YNAA 3ACHA 3CIHA 3B9IA 4WVZA 2YYOA 2FCUA 4CVUA 4ES8A 1K5MC 2QBXA 2WKKA 1QGLA 3WNPA 2PHWA 4JGZA 4AYUA 5FZIA 4YSFA 1VPHA 5FZ3A 3THCA 4LA2A 2BGCA 2K0GA 2WT0A 4Y22B 5DAWA 3ZDVA 1DLCA 2W1SA 3UV9A 1JYXA 4SLIA 4CUCA 5GLWA 4MXVA 2WNUB 2WA4A 3WINE 2GAUA 1NLRA 1T6BX 5DAQA 3ZYJB 3NAPA 1IKPA 3ACFA 4IEUA 5IYYA 5IK5A 4MZUA 1QF3A 2ZOEB 4HFSA 1AR62 4FPGA 4AI2A 5IWFA 3V64A 1POV3 1RUC3 4JZRA 3ZPYA 1FPN3 2HBUA 1EAH2 1S0EA 2WQ8A 1VBC2 2XG3A 2LRPA 2VQTA 4K21A 5T54A 5FZKA 2D5FA 1UZVA 2WLQA 4Q4W3 3I2IA 3MF9A 2VZPA 3NJZA 4PQ9A 3TN93 3USUB 2R063 1CR7A 2BNNA 1UW8A 4XABA 4BOWA 1RUI1 1NCRA 1M06G 1MEC3 5KC5A 1WD3A 4BLIA 4R8HA 1WCUA 5FYIA 1FNZA 2QZ3A 1RMU1 1VBA2 3INAA 3BU7A 3IAQA 5EHDA 4D7SA 2DYCA 5FIXA 1MS9A 2AZ5A 4LR4A 5CG9A 3PMEA 4E4SA 3E6BA 1W2TA 2ARCA 2XLAA 3I8TA 2ETEA 4AR2A 4OVEA 4HSLA 3D5OA 3CZUA 1I5PA 2ZHMA 3VDBA 1RHI2 5BNQA 2C0ZA 1HRV1 4Y24A 4D6RA 4UW5A 3I54A 3BI3A 4XMIA 3LSEA 1OQ1A 2XMLA 1LULA 4NHKA 4MGIE 4P9IA 1G6NA 2JG8A 3RSJA 3FFZA 2VJXA 2ZS6B 4XDPA 5D8AA 3ZPOA 2OW4A 2VQAA 3P1IA 4GIQA 5LA9A 2JDZA 1GU3A 5T5LA 1K12A 2VU9A 3GNEA 5F6LB 1JZ5A 3SEPA 1IS6A 5FZ0A 1POV0 4AHYA 3BPZA 1C5IA 3AL6A 1QXPA 4N8MA 1DBNA 4CUAA 3B69A 5FY7A 1W8NA 3MPPG 4ASKA 1BKZA 4FFGA 1PIV1 3AKSA 2PA7A 4AEMA 4GMP3 4GA9A 3OBTA 4Q8LA 3ACLA 2D40A 2ZEXA 4IEVA 4KWUA 4ZXKA 2ZAHA 4CDUA 2PYTA 2C4XA 2WFF2 4JQTA 3WEZA 3ITQA 4AL9A 4D7YA 5DABA 2GN3A 3CU7A 3UKTA 4QKBA 4AGRA 2EXKA 4PLMA 2C24A 2EIEA 4XC9A 1OKQA 5BNNB 4ZU4A 2NMNA 3J7LA 4M4PA 3LEGA 1VBD3 2VVFA 4DUVA 4EROA 5CAZA 3OBAA 3THPA 1UZZA 1QKQA 5CIRA 4P08A 5JVVA 4AFCA 1K42A 2RS53 4N90A 1DIWA 3TWIA 5F8PA 2HWF2 2TUNA 1UMIA 2YC0A 2ZX1A 3AMMA 3WNLA 4YZ1A 3VBSA 5D2AA 1K45A 2VXJA 3H9AA 2DFCA 3SC7X 4BH9A 3F95A 4FPOB 5FZMA 5FY4A 2ZAAA 5T50A 4R9AA 2VZ3A 2RJKA 5ACA3 3W58A 1HN1A 4FCAA 3URFA 3ZFEA 1NXMA 1LHOA 2LW8A 3WDYA 3FLTA 3NW4A 4K8FA 2D97A 2WYFA 1TME1 2XWJB 4HLTA 4W50A 5FBZA 1WWYA 3WF3A 3HVDA 2V4AA 4K40A 4COZA 2WUHA 3GBWA 4KGQA 4GMP0 1MPXA 2QDRA 4LO6B 1G7YA 4FPEA 4L11A 4AHWA 2R0HA 4QXBA 4EN8B 1GP4A 3O7OA 1STMA 5C8CA 1X82A 3I3BA 2ORXA 4FP3A 2E53A 2FBEA 3QLQA 3IMMA 5BUVA 1BK0A 4GZ9A 1DLLA 3WOGA 5G04L 3VBOB 3FC0A 3AYAA 1MS0A 5J98B 5LZ6A 1R093 2WZEA 3R6SA 1BHGA 4RYDA 4A3XA 1ZBA2 1D7PM 1PK6A 2X10A 1NOVA 3TYJA 1OF4A 2GC1A 2IVJA 2VUCA 1V9U2 4GULA 1W3XA 4KGGA 2K9ZA 1IQAA 2W94A 4X8PA 5JPNB 4G3YC 1ACCA 1UF2C 1C8M3 1QJZA 1SEFA 1UKRA 2B9VA 4YW5A 1AUYA 1LOAA 5IW0A 1AHSA 1NYWA 1AYM1 3C7HA 3M70A 3VKFC 3WNOA 4XAEA 2ZHNA 1GP5A 4IEPA 3IZOA 3BIWE 3WDWA 5IVVA 1VBB2 1O3SA 3RRDA 4LKDA 4WVWA 4E27A 1X8EA 3VLBB 3VKNA 2VZRA 5D21A 2Z42A 2QQNA 3H7JA 4RFT0 1WBLA 4JX0A 1QJU2 1VRH1 2Z4FA 4H14A 5FYMA 1C4RA 4Y20B 2RDSA 4EV0A 1JMUB 1CN1A 2HWD1 3AXEA 1E5HA 2VR4A 4CCKA 5DG1A 4PQQA 2Y6JA 4QB1A 2QUOA 1LGBA 4MHRA 1JYNA 1QY4A 5L7OC 5GLVA 1GBGA 4YW7A 3NKTA 4WVMB 1UOFA 5L36A 3SISA 4UT5A 3WP3A 5FO8B 2ZHLA 4OUEA 4XQDA 3ME2A 1OA3A 2ZZQA 4XFGA 1FATA 1HXS2 2J1EA 4ET7A 3HBZA 2J7MA 2PLV2 1I9RA 3I59B 3OTFA 4GH4C 4EWDA 5LRSA 2HLEA 3JU9A 3MUZ1 5FMDA 2OYZA 4N53C 2YU1A 3TEWA 1Z7S2 4MG2A 1NX9A 2Q8EA 4F7ZA 4OHXA 4HKOA 2HWB2 4QGMA 2E32A 2PAEA 3IKWA 3RZLA 5IVJA 4A6SA 2R042 3LIHA 1HRV3 1ZA4A 2BDRA 2NYYA 4Q4X1 3VDDC 1VALA 4QQHA 5C8WA 1QNYA 1AL21 2P6HA 2QQKA 4I3PA 4CYDA 5GZDA 2VZTA 3USSA 3O1RA 3LCPA 3PNAA 2ET1A 1YC61 1YI9A 2BRTA 4BQYA 3HT2A 4LNVA 4CDWC 1H6YA 1Q8QA 2VMGA 5JDBA 4PBPA 3UL2A 4LBNA 3AB0A 2RR12 1G9CA 5CB7A 2E9QA 2H0BA 1KFXL 1PNGA 1GOHA 1ULDA 4TLFA 4V2WA 1AJOA 3MLLA 4M3CB 1W05A 1OQEA 4XETA 4MX3A 5BNPC 2BVVA 3OJBA 5K0UC 4B7KA 2D44A 3UNPA 5L7OB 4CCNA 2MEV1 4OZOA 5GM0A 1PIV3 3U10A 5JOZA 1GLHA 5FMBA 1VBE1 3H8UA 1Q43A 1HV1A 2BVBA 2JX9A 4XAAA 1JOPA 5JXGA 4JKMA 3ZFGA 5A3UA 5BNOC 3SKJE 4YGDA 1PVC2 1G9FA 4HN0A 1PO11 1BXHA 1W3VA 4GH4B 1NA1A 1ONAA 1H2MA 3UJQA 1HX6A 4N53B 4P9WA 4RL7A 1W6MB 2IUWA 3T30A 1PM7A 4E2SA 2VOVA 4JKLA 3RI8A 3WVJA 1W6QB 3GZUC 2VCAA 3KCXA 4C8DA 3R0RA 1UIJA 1B35A 4DUWA 4Q4Y1 1R1A1 1UPSA 2A5ZA 3VBFC 1GZCA 4RHV2 1UY2A 3VDDB 4AQSA 2VCCA 1EY2A 2DU1A 1LOCA 4NRMA 3OUHA 2RMU2 2O8QA 5FKBA 3FFQA 1UMZA 2BU9A 1O8SA 4XUNA 1GQGA 4Q26A 3B5LB 3E6CC 3D4KA 5A3WA 5C4WA 4CDWB 4WZCA 5J96B 3ZSEA 3T4HB 1Z78A 4J6GA 1QJX1 1BLZA 2ZKNA 3KB5A 2Y26A 2YY1A 4LO7A 4NWWA 4Y1UA 3DXTA 4AK3A 3ATGA 5BNPB 5HV4A 3J8F2 5K0UB 3AFGA 1RUJ3 2RM21 4LBQD 3ZXGA 4BQXA 2VUAA 3O1MA 1FX5A 4LO5B 1XU1A 2ZHKA 1QJY1 1DYOA 3NJYA 4B29A 4BLJA 1LESA 3VZMA 2W0XA 1OKOA 2V5YA 1UWWA 2VNGA 4M00A 3EJKA 1IS3A 1AXZA 3RGBA 1N3OA 3W5MA 2VY0A 2SBAA 4QX3A 5BNOB 1MS3A 2EXIA 2BGOA 1RXFA 1WKYA 4DEVA 3TOJA 1UZ0A 1HRI1 4LXLA 3WW4A 5JXJA 1CJDA 5FYSA 2DTYA 1V00A 4CDQC 4Y5TA 4FPFA 1W2OA 2DCTA 4XILA 1W2NA 2GH8A 2EA7A 3SITA 2MNGA 1DZRA 3DL3A 2HEYF 4CSWA 5CFDC 3JBG2 4BIFA 4YM3A 4DS0A 3GBFA 3ZYGA 2JG9C 4AGGA 4BQ4A 4M0NA 4Z2AA 1IS5A 1YFYA 2YG0A 4LEJA 1GWKA 4TLGA 4YVWA 3FBYA 3VBFB 4QKFA 4MVTA 1RUH1 2UY8A 3KT7A 3NNJA 3PTYA 4YARA 5AC91 3IDAA 1ZX5A 5A7NA 5KHIA 2JDAA 1YHFA 2D3PA 1C57A 2FHRA 2J1SA 3APBA 5JUVA 2WO2A 1ZZ8A 4P9XA 3BOWA 1UZWA 4QPGC 1J84A 2JKBA 4JGYC 3IWZA 5ANQA 4AQ2A 4CTEA 1X9PA 3KT4A 2VZSA 3HJRA 4LBLA 2B42B 4ZKTB 1RXGA 1DF0A 1RUG3 1S0CA 4V2VA 5GJ6A 4JQRA 5C3OA 4XFCA 4FBFA 4CP2A 1DCSA 1H8VA 2XBO3 1GR3A 1RUI2 3WQ0A 4OI2A 3S0MA 1PGSA 4YW4A 3CKHA 5JIAA 1G8WA 1LHUA 3ZX7A 3KS7A 2P3JA 4KWJA 2O14A 3VD3A 2IFWA 3BTAA 4CEWC 1H1AA 1JZ4A 3IM0A 1OD3A 3MIBA 4UFIA 4AFDA 4AI8A 2CTVA 2YFZA 4JHTA 3V0BA 3B01A 5FZEA 4PLNA 4R52A 1UOBA 5CFDB 1YLLA 3HNBM 4NOTA 4QDQA 2JG9B 1OPMA 2QDNA 5DAPA 5A33A 5IATA 5CVRA 3NAPC 1GUIA 2R073 3HN3A 2IXHA 3NL1A 2WNEA 5GZEA 3T08A 2QQLA 5JSRA 4LUKA 4ARYA 2KM2A 1DYPA 4YLZA 2HKXA 1ZBE1 4QX0A 5DN2A 2XVKA 1IQDC 2OXBA 3C8XA 4KBZA 3RVHA 4BMBA 4QPGB 2WO1A 4L97A 4JGYB 1QDCA 1UU4A 1EUTA 2AH2A 3DV8A 4GJYA 4O61A 4KQ7A 2I2SA 3RMYA 3OGJA 1NCRC 4JDOA 3ZFFA 3WHTA 4FPLA 1O3QA 2VNVA 5B4NA 5FZFA 1SMVA 2G9FA 3LF7A 1UYZA 1LODA 3ZXKA 3IMNA 2JIGA 2LUWA 3SQOA 3GBGA 2ORZA 4WV8A 4LHKA 2P1BA 2QE3A 4C1XA 3ILRA 4B1LA 4DINB 3LEIA 4IDZA 2OUHA 2ZGRA 4UW6A 1D0HA 1W6PA 4JKKA 4NPRA 3OGSA 1OUSA 4RQPC 3SMHA 1VAMA 1D4M1 4LQRA 1ASJ3 5IVBA 3I2GA 4AOCA 3KHCA 5HCAA 2A75A 2BNOA 4Y5SA 1YQCA 3O1TA 5T55A 4CEWB 3CHXA 3M3OA 5FP7A 2XJTA 4TYSA 5FPVA 3I4IA 4L9BA 5D8AC 2FDFA 4YG6A 1QQP3 5DZGA 2PMWB 4IEYA 2NP0A 1DGWA 3OGVA 4QPIB 3BODA 3NAPB 4F83A 2DURA 3Q8BA 1JTZX 2WDBA 4X6RB 2QQMA 5C9AA 1I6XA 2RS33 1O59A 2WABA 4N7UA 2QZ2A 1GSLA 1VE0A 1SDWA 4COWA 1I5ZA 1SCSA 4LHLA 4RD7A 3ORJA 5JPMB 1QEXA 1XSQA 4NAOA 4COYA 5A32B 2CY6A 1DU3D 2NM1A 3DPRA 4Q4Y3 1R1A3 2W9XA 1TME2 1AR93 5DG2A 2RDRA 1W8HA 3KT1A 1NCRB 3EYPA 3VD9A 2XUEA 1LRHA 3KV5A 4KG0A 4Q1PA 5L9BA 4W4ZA 1FPN1 4CDUC 4CDXA 1F5FA 3D6EA 2XJQA 4AQ6A 3ILNA 3ZDSA 5C3SA 4LOTA 5HCHA 3ZMOA 3OPTA 4DQAA 5A1AA 1XBFA 4FTBA 2R061 2WJSA 2B5HA 2Y38A 4ATFA 1MEC1 4NIIA 3BGAA 1QJX3 4IGPA 5LB6A 3PDQA 3VHNA 2JB4A 2BGPA 4E4ZA 3MV01 3PMSA 1ZZ9A 2LALA 1E57A 3O1UA 4RQPB 3RI9A 1CJPA 4AI0A 1LOGA 4IV3C 5KXCA 5FY8A 2RM23 2FZ1A 1HJGA 4MXWB 4XUQA 4META 1AJKA 5IAVA 1QJY3 4IXLA 4XIOA 4BQWA 1WMEA 1GWLA 3LPGA 3H7YA 3N9LA 2VC9A 1UOJA 4I02A 3TEYA 3WUCA 4FPJA 3MIEA 2WS92 5IVYA 1PGL1 2Y6FA 4FXKB 2E51A 1HRI3 5FYCA 2ZGTA 4PJYA 4AVBA 2XLFA 3PHMA 4BHPA 3TAYA 1RC6A 1NY71 3CQOA 1L7LA 1ZVFA 2UURA 1AYM2 1DQ6A 1RJ7A 2VOKA 4NIHA 2WQZC 3POIA 4P00B 4BQ5A 4D0QA 4D6SA 5LA0A 3OPZA 2RV9A 2QNKA 4YVSA 4IESA 1PGW1 3WDUA 4UOJA 1APNA 4E8DA 5ANNA 3GCWA 4O9GA 1RUNA 3VZNA 3WY6A 4BQ2A 4QX5A 3ZOIA 2IWGB 3U11A 5JR7B 2VL4A 5H9SA 3PUSA 4CDUB 4LBQA 2R1BA 5C8CC 3TEZA 3KF5A 1VRH2 3Q8FA 3BTZA 4CCCA 3L9JT 4GMP1 3RZJA 1UL9A 4P5YA 5CU1A 1NKGA 1UCXA 2D7FA 1ULPA 5IFTA 4QQOA 2X53S 1SLBA 4MSVA 4QU2A 2LTNA 5DAVA 5C3PA 4NIGA 2PHFA 4IEQA 4NRQA 3VBUA 1JN2P 3WNMA 3N36A 5FQ0B 3BOPA 4WBBA 1JHNA 4IV3B 1DG6A 4Q0SA 1ODMA 3ZXJA 2WFPA 1UNBA 2DVDA 4A6OA 4M3CF 4OI1A 2PELA 1AR83 2R30A 4AI1A 1QOSA 3H8RA 4L2NA 4YG0A 4DXZA 3NV2A 1CAVA 4I0BA 1YIFA 2DFBA 3SCFA 1CVNA 2EIBA 1DGRN 1FOD1 2VOWA 4NRPA 1IG0A 5CFCA 1OLMA 1CAUA 4GALA 1HQNA 1O7FA 5LRRA 2VMCA 3SH5A 4XTPA 1KGYA 5FUPA 4AVCA 4Q4X2 1AL22 2F4PA 4PI0A 2BW8A 4UW3A 1RL3A 3ENRA 2JIJA 3LPFA 1YFWA 3SCGA 3IIIA 4XFAA 4IERA 5C71A 3I2OA 1ZBE3 1S0GA 2P34A 2Q0AA 4ZZ5A 1F4AA 5KHGA 4TXWA 2WZR2 2KXLA 2HBTA 4BQ3A 4OULA 2XLGA 4C91A 2ADDA 1N3PA 1S0IA 3PLQA 5K7PA 1OOPA 1VLNA 4HKWA 4XF0A 2MEV2 1K5JA 3VUOA 4S2HA 1CZSA 1NG0A 4I0WB 4AVTA 3DYPA 1VBE2 4YYOA 4OFGA 5EWSA 4E9KA 1XYPA 3OYWB 4QGLA 5I93A 3PJQA 1R091 3WLUA 2IXIA 4DY5A 1OPOA 2CDPA 5LY1A 2ZMLA 1PO12 4O9EA 2YB7A 4XJAA 1CPMA 4NR1A 3AP5A 4QHZA 5HPOA 1SDDB 3IBMA 4B7EA 1S0JA 4XXPA 1D4M3 4KH9A 4P5HA 4OHWA 1F8VA 1Y43B 2W95A 5DDJ3 5EFUA 5C70A 1W8WA 5LA1A 3MPBA 4RSUA 4NVPA 5CA6A 2WR9A 3H42B 2IFRA 3G6JB 4IE0A 4E2GA 1X7NA 3C2UA 1V6LA 2Y34A 1QH7A 5C5TA 5A6ZA 5ABJB 4XXAA 1DQ0A 1BQPA 3UYJA 2X29A 1CAXB 1JYCA 3FMGA 1S0DA 4OZXA 5JCTA 3ALQA 4Z92B 3AVRA 1JUHA 2W1QA 4LO4B 3NO8A 4ORFA 4NHYA 3NVCA 1OHFA 3T3YA 3MZHA 4HANA 2VBDA 2VECA 4MGKE 3KF3A 3BCWA 5FXXA 5FYTA 4LO8A 5LY2A 1CZTA 2J22A 3DYMA 3S7EA 4Q0UA 3OEBA 1W28A 2Q1ZB 3HOBA 2Q4SA 1LTEA 1O4YA 1VB2A 5EYXA 2HJIA 3ZM8A 5B4XA 3ZFGC 1NT0A 2DCYA 4HPKA 1KS4A 4L99A 3PUQA 4FSJA 3VBRA 2A6VA 2ZZJA 3WW2A 4K8RB 5FOBB 4YW3A 5FLIA 3T0BA 4TWTA 1NA1C 3SH4A 2FDIA 4QB2A 3VL9A 4FFFA 2GMEA 1UY0A 3L2YA 1H30A 1ZZ6A 1X50A 3ZSJA 4FTEA 1KQRA 1UMHA 4NJ4A 1VB4A 3ZN6B 4AWDA 1ALYA 4MH0E 4LK7A 4FPYA 4YW2A 1XC6A 3POWA 3SXWA 4N43A 5T5JA 2E7QA 1X9TA 5IVEA 1UZYA 1DZQA 2W47A 3HT1A 4LKEA 3AYCA 1N1TA 1OC1A 4YG3A 1K5MB 5F3GA 4XBLA 2X5IC 3HIFA 1POQA 2C5DA 4LULA 4BDVB 1RUH2 4BB3A 3ZXAC 1OFSA 1R1ZA 2PHUA 4RR3A 5FCCA 4Y1ZA 1TMF3 5FPZA 2G4IA 5FPLA 4BK5A 3RPQA 5AC92 4Q8KA 1YXWA 5FZHA 2VZOA 4CEYA 5KXDA 1ND3C 2ARBA 2ZX3A 2FDKA 3AC0A 3HAGA 3C7GA 4XHBA 2WNOA 1KEXA 2J1TA 2XJVA 3IAPA 5TSWA 4HSJA 2FD8A 4V1PA 1PMIA 4CRQA 5LBFA 2DWRA 4XHXA 4LLFA 4YW6A 3T0AA 1U5IA 1ZZCA 2QFEA 3UETA 3T2QA 2WO3A 3OUJA 5FP4A 1N1SA 1W8FA 4JAAA 3R4DB 4H7MA 5IK7A 5LEKA 3A22A 2JXAA 3KGZA 5FOJB 3V0AA 1MACA 4E4HA 2E33A 5FFOC 2BV4A 1NA1B 5FO9B 4K9SA 1MQTA 1PZ8A 4YW1A 4IQPA 5FLJA 1UXXX 3MBWA 4HBNA 4PIXA 3AXDA 3MI8A 1H6XA 3WCSA 3WSOA 1RUD2 1BBT1 4S2GA 4YVWC 2VW2A 2QVSB 5JXIA 1FNYA 3VBHA 2K2SA 3OBZA 4ZY9A 2UYAA 4LPLA 1EV12 4ARXA 3VD4A 3K51A 2E6VA 4BCUA 2X5IB 1TZOA 3DN7A 2ZABA 4CCDA 4PCRA 5HV0A 1OVSA 4BJ0A 3AJYA 3ON7A 4GWJA 4K20A 5FYUA 2Y0IA 3ZMNA 5AFBA 3AK0A 1YQ8A 1FOD3 2WO7A 1JUIA 1Y4WA 4K7JA 5CADA 1G86A 1ND3B 4COVA 1RUE1 4W6WA 5A3LA 1HB1A 2W3JA 1URXA 1W8ZA 4EWEA 2AUYA 2I07B 5FKCA 2P2KA 1OQDA 1KD7A 4YFWA 4XACA 1JU3A 2E7AA 2DTWA 2IXJA 5JAXA 2OX0A 5KC6A 1QOTA 3N7MA 3KVAA 5FJHA 1JBCA 3WV6A 1J59A 5FYYA 1O5LA 1RUJ1 2DVAA 3FHAA 4RS5A 4JV4A 4IV1C 3AZXA 2XL9A 1COV3 2OPWA 2VW1A 4D8MA 3N9OA 3BYWA 1J1TA 1F2NA 1E5RA 4Y4RA 3VKLA 4FVVA 1CIYA 5FUNA 2OUJA 3WF4A 1W8UA 4M01A 3K3NA 2ZGUA 2R6QA 1C28A 2GC2A 1H8TC 4KG8A 1VMFA 3FLRA 5HCBA 1ZNPA 1M4WA 3S30A 1UIKA 3M3CA 1AF9A 2GH2A 4AHXA 1CZVA 2BOJA 2IVIB 3O0VA 2GNMA 2RMU3 3GJBA 3GGLA 5EPAA 3DEMA 3HQXA 2ZACA 1O8PA 1W6NB 1SPPB 2Z2SB 3O12A 4UFJA 1FYUA 4HOOA 3IDEA 4P9GA 4HVRA 4Z82A 1MZEA 3PU8A 4A4AA 4EQVA 4HXCA 3K75B 4Y1VA 2VZVA 4WM8A 2DCJA 4KL1A 1O91A 3CMGA 3HQRA 4ZPIA 1H2NA 3AKRA 1PO21 2JD9A 4P14A 3N4MA 1MVEA 2HYKA 2N7GA 2KA3A 4MGZE 1OH4A 2Q1MA 4FT8A 2YHJA 2D6MA 2HWE1 2WNVA 4NN0A 1RUC2 1JYTA 1W9YA 2CDOA 1FPN2 3P3PA 4I01A 3WP4A 5JZGA 3OY8A 1SG3A 1RUG1 3TN92 1SFNA 2FMDA 4Q4W2 1DYKA 2R062 3RWNA 4Q4V3 4P02B 2XBO1 4FO9A 3SHRA 4IV1B 1RUOA 1MEC2 1F35A 3CJIA 3WDVA 2D93A 1Q8VA 1NLSA 2DUQA 3LDBA 3N3HA 2R0FA 2RG4A 3K4ZA 1J3QA 1U12A 1L3JA 3D8CA 3I2KA 1LGCA 4ISRA 2B45X 2CAUA 3JBG3 3I3EA 4ZS3A 1H8TB 5A33B 5FP9A 4HONA 2FZ2A 5C9AC 4EE2A 1SBFA 3MUY1 1PGL2 3ZXDA 4GB32 4BU2A 4CU6A 1V6KA 3DPRC 2ET7A 4K3UA 3B7MA 2R071 2X05A 1AR71 2CV6A 1BCXA 1WW7A 2QCSB 4GWIA 4Y22A 1ENQA 2HYXA 4XFBA 4EN7B 4QDRA 5FK8A 5A1FA 5LEJA 3TB0A 1OA4A 1O5UA 1S55A 1C1FA 2ZCWA 4CDXC 1PGW2 2WNUA 3AZVA 4TTGA 1L7QA 3RYPA 3QD6A 1VAVA 1XQNA 4ZU5A 5K4LA 3K46A 2RJLA 5F7UA 2JDKA 3NWKA 4GJZA 4QKNA 5IJRA 3ES1A 3OF1A 4AEDC 1HB3A 1FMD3 4UXAA 1SZBA 3GHMA 4EN6B 3I2FA 1PM4A 3POJA 1C8NA 4J25A 4AVVA 1Y9MA 2CAVA 2O8OA 3PVBB 3USUA 4AI3A 5F3IA 4QX2A 1XNKA 4R9BA 4XDQA 4CXYA 5CKMA 1JH5A 4PIZA 5E1RA 3U14A 1HN0A 1ULFA 2VGDA 2RDNA 1VR3A 4PDWC 2C1FA 3CZJA 1BEV2 4NHLA 2EVXA 1REEA 4R4XA 3QOPA 2UWBA 1ASJ1 1VBD2 5F2WA 3SKVA 5L73A 1ND2C 4OHZA 4FFIA 3MIGA 2RS52 5FMOS 5C9AB 3MO4A 4DPNA 1RIRA 3HN1A 3M3QA 3ZIXA 5FUIA 4AGVA 1VIWB 2QQUA 5GLTA 3NV4A 4NWVA 1QQP1 4OHVA 1Y9GA 4LITA 1JOBA 4CCMA 2VZUA 3I2JA 5T3NA 4NIAA 3DPRB 3WDTA 1BBT3 3RZMA 4ZU7A 1PX4A 1IGOA 2RS31 4P9JA 4AXOA 2QQPA 3PIJA 1AYN3 4FPHA 3T1LA 2P17A 5IVCA 3AP9A 1XOYA 4CDXB 1UPIA 5ACA2 5CZKA 2WN3A 3HQUA 1XXNA 4XUPA 1ODNA 4DRVA 1BMV2 1AR91 2OA2A 4X6QB 4DRRA 2D6OX 2I45A 5LA2A 3ZKYA 3BTXA 1LGNA 1JI6A 3M1HA 1YFUA 4AEDB 5CEHA 4BM8A 1FAYA 4QX7A 3LFIA 3LEMA 1RUE3 3NNGA 4NAMA 2O1QA 5C3RA 3AX4A 3O1OA 1WCSA 1WLCA 1GZWB 1VJ2A 4PDWB 2HWC3 1WLWA 2RS13 5A3PA 2TEPA 2NMOA 5BNNA 2CGPA 3VD7A 2VG9A 5FY5A 3ZSKA 1R092 1ZREA 4IGOA 1ND2B 2F17A 4LLOA 1KXGA 2EIDA 5FREA 4U2AA 1PZ9A 4XFFA 1LNSA 2D5HA 5T52A 5SV5A 5CFCC 5HI0A 5M0TA 4FFHA 4K1ZA 2ERFA 1W6OA 2RVAA 4UFHA 5I8YA 5KWRA 2J1AA 2Z5WA 1C8M2 4ZXEA 2ZGNA 2V09A 4OUSA 4RGAA 2A7AA 2VAUA 4FAHA 4QXKA 1HQLA 3BIEA 1C3HA 1AR61 1NZIA 1UY3A 2IXLA 5FYHA 1JODA 1J3RA 4MHUA 4WM7A 3DCQA 1RGSA 3ACIA 3MIDA 2Y6LA 4GQ7A 2CU5A 4MYEA 4FOQA 4EWAA 2CHHA 4A7YA 4XJ9A 4GD4A 3KMHA 1GMMA 1OOPC 2V72A 5GKAC 3MV11 2LM3A 3UGHA 1PO23 2JB8A 3BKZA 5E88A 2JDPA 4LORA 3BALA 3C7OA 5J09A 1VBA1 3A21A 5LASA 4N9IA 2PAMA 1REDA 3QH7A 4NHMA 4CU7A 2HWE3 2GC0A 1UQXA 1ZRDA 2DCKA 2LROA 2NN8A 4Q5OA 3ZLIA 3B3QE 1JW6A 4HL0A 3WW3A 2VUDA 2XDVA 4FQZA 4UWDA 2XPJA 3AZZA 2W2IA 3AKPA 3PL0A 1ZM1A 4BQ1A 3LWCA 1IG3A 1XYNA 2BFUS 2PAKA 3VBOA 3EMRA 4TN7A 5FDBA 1R083 1WLTA 3HNYM 3PTRB 5A7QA 3VB9A 2BYVE 4QPYA 1AR81 3E5XA 3MEPA 1RMU2 1AX1A 3OGRA 4PBOA 5G05L 5SV8A 3LOIA 2YXSA 3O1PA 2VTXJ 4QQ2A 2WN2A 2WZPP 2RJ2A 5JSPA 1NAEA 2D6PA 5HCFA 1AX0A 5JOWA 2GDFA 4AFMA 2Q8CA 4LKSA 4JGZC 2WRAA 2AC1A 3P6BA 4CDQB 3RDIA 2AYHA 2WBKA 4WZFA 3MGUA 1SLAA 5F5CA 1Q5OA 4DXRA 5A7WB 1HRV2 3ZR5A 1RYYA 4YM2A 2ID4A 1YRZA 1UYYA 5FXVA 3U75A 4XYXA 5FR3A 3KD4A 1AR73 2XJUA 1GYKA 5FZAA 4C0BA 1O3RA 3OG2A 3EXUA 1VRBA 5C5UA 1H9PA 4IEZA 3MLJA 1KDKA 1GZ9A 1OOPB 1KFUL 3LE0A 4XZUG 1KITA 3VBRC 1OXCA 1CX4A 5KHKA 4QPWA 4M3CE 4XZPA 5DUXA 3FHIB 1YJKA 3ZR6A 5FZOB 1YQ2A 3ZYHA 3CO2A 1NE4A 2RDQA 1U5YA 2KR2A 2PTMA 4UF0B 5FY9A 3ECQA 1PIV2 4IE6A 4UBHA 2ZX4A 5EQUA 4WVMA 3I3QA 4RGKA 2HWF1 5JSOA 2D6NA 4C1WA 1GNHA 4MOAA 4MGYE 5FZ8A 1LECA 3JB8A 2Q5TA 5EYYA 3U4XA 1BVP1 2ZKLA 3POFA 1S2BA 4CP9A 2XJRA 4HK8A 4JDNA 3LIGA 1SLIA 1D2SA 1Q8PA 3I59A 4A3ZA 2QQIA 3PJYA 4GWMA 1DDLA 4JCKA 4D7TA 2FDGA 3MFAA 2VZ1A 2O0OA 4JGZB 4Q1RA 5DDJ1 4RR3C 3N7KA 2CSGA 3DF0A 4EYUA 3N9PA 3FX3A 4MGTA 3QACA 2JG8C 1BVVA 3AZYA 3J26N 4MUVA 3GZEA 4INDA 4AZZA 2AR6A 2OVUA 2RE9A 5JMCA 5A6YA 4QM9A 3P3NA 4YGBA 5A6QA 1TNFA 1ST8A 1IZ3A 4HN1A 2BPA2 1E5IA 3IB3A 5GZCA 4QD2A 3C7FA 3ROUA 3LQCA 4HPKB 3Q8CA 4Q27A 3H1MA 3GHNA 3WF2A 5L19A 3OEAA 1LOBA 1L7RA 5T5OA 4XTMA 2YGMA 1KS5A 1MQTC 3BU0A 4M3CA 3WXPA 3VZKA 2W91A 1W04A 1RUJ2 5LBBA 2C26A 4LT5A 3ZYIB 2DU0A 3W59A 1XRUA 1RUF3 2VXRA 4AVSA 5L7OA 1ZBA1 1AL0G
chains in the Genus database with same CATH topology
4Y5Z0 3H0OA 5IK4A 1S1AA 3JD73 3QCWA 3WQ7A 1V9U1 1RVF3 2ZJCA 2GSYA 5FTTC 4I2OA 3GYDA 4XQ4A 3WR0A 4HMZA 4GH4A 2BEOA 4QHBA 4X8NA 4B4RA 5IUQA 3GF6A 3E6DA 4RR3B 3VBSC 1W6MA 2VMIA 4Q0PA 4U36A 1Q8OA 3AP4A 3WP5A 1VBB1 3C3VA 2JG8B 5D8AB 3MF6A 3VGIA 3IDBB 1QDOA 5JLVA 3WNXA 1TMF1 3ZFEC 1QJU1 2ZX2A 1F31A 5JOXA 2NPIA 2ZPXA 1JOJA 3U07A 3OD0A 1AR63 1J1LA 1QOOA 4CDWA 2QJVA 1QU0A 4JTOA 3VV1A 1EPWA 1EAH3 4RS5C 3TNQA 1VBC3 4KNCA 1I3HA 3MDPA 1RUG2 3MIHA 1MQTB 3B93A 3LA2A 3VZOA 4F8AA 4Y26A 5BNPA 2A6WA 3U0ZA 2BWAA 1SLCA 2XBO2 5K0UA 4OUMA 1LENA 1YI7A 1AXKA 1VBA3 2P3KA 2PLV1 4TSVA 2HWD2 4QQPA 5BV6A 5BNOA 3AMHA 4FPCA 3OD4A 1Z7S1 4P9LA 2UU8A 1PK6C 1RHI3 2UWCA 3ZYRA 3VBSB 5FO7B 2R041 1GANA 3GZTB 3FWEA 4B4PA 2PFWA 2PHTA 4Z07A 4WM8C 1U5XA 3B94A 3SNMA 5GZGA 3DKWA 2CYFA 1EYBA 2DUOA 1HIXA 3ZFEB 2WNVC 2XVLA 2YMZA 4DOUA 3S7IA 5J37A 2WSUA 2A6XA 1H1MA 1NCQA 3AZWA 3HMYA 4KWLA 3MW4A 4ASMB 1H2KA 1A8MA 4RS5B 5JOYA 4B3NA 1BK1A 5HXVA 3L2HA 4A7KA 4P9YA 2VVEA 5C8CB 1SFYA 3AKTA 2WFF3 1MS1A 1JXNA 2IC1A 4GKYA 4QQLA 1U5ZA 3ILFA 1BZWA 1S0BA 1YO8A 3AJZA 1SBEA 2JEMA 1PVC1 4K1YA 4DFSA 1COV1 3OCPA 5LK7B 1XNCA 1N1VA 3CJXA 1C1LA 3ZXEA 2D3RA 3RJRA 1ASJ2 4LBOA 3TNPB 1FI2A 2V73A 1LEMA 2XL7A 3GZAA 1PK6B 3SLIA 5DZEA 4XJZA 1YCIA 2A3YA 2ZX0A 2HWF3 5EJ3A 2BBVA 2BNMA 1LHWA 4RGGA 3HD8B 4WM8B 3H50A 5CFDA 1QQP2 3DGTA 3WG1A 4XIKA 2RMU1 4B8EA 3H3UA 1ZRFA 1SQ4A 3FE5A 3WX5A 2RS32 2F6BA 1LHVA 1QWRA 2WNVB 2XB6C 3UK9A 1RINA 2EALA 5BPXA 4XW3A 4Q4Y2 3LOBA 1R1A2 1FT9A 1AR92 4QPGA 2UYBA 3M3EA 1W39A 3J8F1 1GV9A 1CONA 1YUDA 4JTNA 3JQXA 4XJ8A 1LEDA 4LE4A 1ZYBA 4E2QA 4SBVA 3D0SA 3X29B 3CLPA 5K8SA 1OA2A 2EAAA 4Q4V1 5KBFA 2H6CA 4YGEA 1WUVA 1LJ7A 1QJX2 1UD1A 3M2MA 4BIOA 5I8TA 3OGGA 3MLKA 3LKJA 3VN4A 3O0XA 1H9WA 3AFKA 3WUDA 4J1WA 2RM22 4FP2A 4E4DX 4AEKA 3JBG1 1QJY2 1ZBA3 2NQYA 4CEWA 2IXKA 2GNDA 1YWKA 1ZZBA 3TBDA 1KJRA 1NE6A 2JE9A 1V9U3 3FUOA 1HRI2 5H9PA 2XWBB 1D0GA 1WMFA 3UJOA 4QPIA 1B35C 1Y9QA 2ARXA 2JECA 3VZJA 4A2UA 4COUA 5BYNA 1DGWX 4FXGB 4LHNA 4HVQA 3NSTA 5J7MA 3JB4C 1Y3TA 1VBB3 5A32A 2GMPA 1BYHA 4Y4YA 4W6YA 1QHDA 4FOYA 1QJU3 1FMD1 4YZ3A 1WBFA 1PVXA 4EN0A 4PIYA 4ASLA 3ETQA 2AGSA 2IZWA 4XF9A 5BNNC 1VAKA 3VKMA 3ZN4A 4Z8BA 1ENSA 1CIWA 1IS4A 4XBNA 1HKDA 2B39A 3O14A 2VW0A 3MICA 4RQPA 3ZFGB 4XJWA 5LK5A 3G7DA 2WA3A 4MXWA 4ONUA 1HXS3 2HEWF 1D4VB 4BE3A 4GB33 1AR82 2PLV3 3CF6E 3THTA 1Z0HA 3I7DA 4DY3A 1G9BA 1LB2A 2R49A 5FAXA 2PHXA 1Z7S3 2ZGKA 4WM7C 1B35B 3MFCA 3M8LA 2HWB3 2GZWA 3WG2A 4L92A 4BMEA 1CPNA 1ULEA 1V6OA 2R043 1AYN1 1DQ1A 4I0AA 4XQWA 4GXLA 3RYKA 5C4WB 4DB5A 1LOEA 5EXOA 4JC1A 5FRAA 4GKXA 2RR13 1ZBE2 1WD4A 4XE9A 4OHYA 1MS8A 4XFIA 5I8SA 1BEV3 2ZGLA 5I0RA 1HLCA 3VBOC 3R05A 2JICA 4KU8A 3AP6A 3O5SA 2HWC1 3V65A 2RS11 3WQ1A 3ST7A 1LHNA 2PHDA 5FQ0A 4S2FA 2QKDA 4IV3A 4AE2A 1W6OB 1WW6A 1OMIA 2YGLA 1PVC3 3N7LA 3VKOA 2VULA 5D1IA 4HZFA 1D4M2 2EAKA 2A6YA 4YZ2A 1N1YA 2BTVC 5DDJ2 1GFF2 4WM7B 3TRSB 3ZYPA 3EBRA 5CBLA 4YRDA 4YVWB 2XKPA 2A71A 2TNFA 1YFXA 2PHRA 1UAIA 4RHV3 1DGRA 1X33A 2ZMNA 3WDXA 1RITA 4JRLA 1DQ2A 1Y7BA 1LOFA 4NO4A 2Q30A 2XHKA 1NQDA 1FXZA 4ATEA 1H0BA 3ZFFC 3JQWA 3EQEA 1QXJA 5E89A 1IOAA 5FLHA 3J8F3 4KBBA 1SBDA 4OLLA 1NZCA 1CAWA 5F5QA 2YDEA 2XVGA 3IPVA 1H2LA 1MVQA 4FPKA 1A8DA 3OYWA 1DFQA 1R081 1RTVA 2WS91 2NLRA 2A6ZA 4JRAA 4AG4A 4LBMA 3V0BB 1T6GC 1OLQA 4YZ4A 5K9YA 3LZZA 1YJLA 4I30A 3ZIWA 4RA0A 4XBQA 1QNWA 3WP6A 4HK9A 4LTAA 1GKBA 4BWOA 2VQ0A 3E5QA 5FMOL 2W52A 5ABJA 1TMF2 1CAXA 1NY72 3ZSMA 3B00A 3I2DA 1RB8G 4M0HA 3ZFFB 2H6BA 2WT2A 1OI6A 3RQ0A 2E63A 4Q0QA 1RUI3 2VMHA 3A0KA 1O4ZA 1UN1A 2DVGA 1RMU3 1W6PB 3D0JA 4XMAA 5IT6A 4R9CA 2WLPA 1CGPA 3AKQA 1AZDA 1V6IA 3RZZA 4G4FA 4BZ4A 1VP6A 2WQ4A 1FV3A 2AREA 4WVVA 4C90A 5JIUA 3ZN6A 4TZDA 1KDMA 2ZA9A 4XEZA 3S6PA 4Y1XA 1N3QA 2ZBJA 5GLUA 4AEJA 3LAGA 4D7SA 1K5MA 3SCHA 3EO6A 1GICA 5JWPA 1AX2A 2XJSA 3J4UH 3BB6A 4YVSC 1WCKA 2VOXA 4CZSA 5J48A 1FOD2 1WW4A 3QBQA 3VZLA 4HKLA 2B46X 1GNZA 1IHMA 1XNBA 2WZR1 2CWSA 4J1XA 2CWMA 3RG0A 3NV3A 3FJSA 1JYIA 5I0UA 1O3TA 1WCDJ 3AP7A 3WCRA 5JI7A 5F9TA 2ZGPA 2PQQA 3M4FA 3WZ1A 1REFA 1YIPA 1SACA 5DUWA 3QH6A 1RUF1 2OZJA 1COV2 3VBUC 2XH6A 5C6CA 3MW3A 3JD71 3IN9A 2TBVA 1RJ8A 3O0WA 1XE8A 1RVF1 1WLDA 2VUJA 2EIGA 1LU1A 4XFHA 1I1EA 2WINB 3R4UA 4XF3A 4Y1YA 2PHLA 4LE3A 4QGNA 1C5HA 1QMJA 1A6CA 4UW4A 3VL8A 2Q8OA 4DMIA 3Q9OA 3WG4A 1W0OA 3JZVA 2BFUL 2BWCA 3WG3A 3B9CA 4YZ5A 4JVAA 2W39A 2X5IA 3A4UA 5C33A 5JI9A 3UKVA 1B09A 1NCQC 4Z1VA 4YVSB 4XJUA 4AQTA 4EJRA 3KZ4C 3NV1A 4GWNA 1MR5A 1TME3 3HWJA 2XKOA 1ND3A 4LBQB 1Q8SA 1EAH1 4XOGA 1VBC1 5DUUA 2YROA 1J3PA 1ENXA 2I74A 5CNAA 2ZGOA 3DUIA 1UX6A 1ZRRA 4Q4V2 2Y0OA 1LCLA 2CL2A 2CNAA 4K6BA 3VBUB 1NXD1 1ULGA 4IEWA 1H4GA 3VHPA 4BPZA 1AXYA 1W0PA 2D6KA 5EV7A 2PN5A 2NZ9A 3LSDA 1OSGA 4AW7A 1DQ5A 4D3WA 3RJ2X 5F6KA 2DVFA 1RHI1 2XUMA 3KCYA 5GZFA 1CAVB 2WS93 3A0NA 5CFCB 1W6NA 1AYM3 1CAUB 1HV0A 5BY5A 1NCQB 2YPJA 4UBGA 4CP0A 4QT6A 1EP0A 4AFBA 1X8MA 3AMQA 4D94A 1WW5A 4Z2WA 4DZGA 2UY9A 1DHKB 1XU2A 2DUPA 4IETA 4LA3A 1LR5A 1VRH3 1FMD2 1F9KA 4YNIA 2A3WA 1HDKA 1PNFA 2HWD3 2MPFA 4LBJA 4XF1A 2WFF1 2FMYA 4IV1A 3CEWA 4MV2A 1EPZA 1V6MA 4B4QA 1RUD1 1TQ5A 1DGLA 4Y20A 2YV8A 2C9AA 2YUEA 2GN7A 4FOWA 2H0VA 4URTA 3AYEA 5BXXA 2CGOA 1EV11 2W68A 1H8TA 5KXBA 1XE7A 3PVOA 3MYXA 4QPIC 1G9DA 2RHPA 3KM5A 5I0SA 4BA6A 3T2TA 5DXDA 4Q29A 1V6JA 2P37A 3D82A 3LA3A 4N43C 1MS5A 1OFNA 1HQWA 4R4ZA 1BBT2 2R1DA 3B02A 1XYOA 2GNTA 5AFEA 3AMPA 4H3WA 1AYN2 1PHMA 4XF4A 4AF9A 4Q4X3 3ZSLA 1AL23 1Q3EA 2FQPA 2R32A 4W65A 3POYA 2ZGMA 3H1WA 3H3ZA 4CEYC 4W6XA 2ZTNA 3KGLA 2WC2A 3ELNA 5H9RA 1A78A 3LB9A 5AVAA 2ENRA 1RUE2 2OZ6A 2WZR3 1NQJA 3JCIA 1MZ5A 1MZ6A 1J58A 1X36A 3VBRB 3HR9A 1V6NA 2B7YA 2MEV3 1H4HA 1XNDA 2ZMKA 2HWC2 3OBRA 2RS12 3W9AA 1MS4A 1VBE3 2WL1A 1W2UA 3MW2A 4ITCA 2ATFA 3ES4A 4AHZA 1QXRA 3J9SA 5F1RA 3UKNA 1CD3G 1PO13 2EXJA 4L8QA 1TEIA 4OI4A 3VHOA 1H1IA 3WHUA 2MHFA 2JD4A 4DNYA 3E97A 2A73B 3CNAA 3VBHC 4N43B 3ZN5A 5H9QA 5J36A 5EZWA 4EN9B 3FZ3A 4ES9A 1Q56A 5KXEA 2A70A 3M7AA 2VNOA 3CL1A 4N53A 2DV9A 1F5JA 2GALA 2BQPA 3ASIA 4QM8A 1ENRA 5DZFA 1POV1 1RUC1 4G9SB 1W6QA 5I91A 4LUMA 4CEYB 5AVPA 1WA4A 3TN91 4Q4W1 2OPKA 5KHJA 4Q2FA 3VDDA 3RMXA 4AEDA 4F3JA 5KHHA 1GQHA 4N7IA 1PO22 3WT3A 2XJPA 2ILMA 2VH9A 2OIIA 4CP1A 2CGNA 1DZTA 2JE7A 2HWE2 4HVOA 4I09A 1SCRA 2EF6A 4XPVA 3V0AB 1AVBA 1ULCA 2VNRA 1GZWA 4PDWA 4PF5A 5IK8A 1KRIA 2JENA 2W08A 3IDCB 3LA7A 1HW5A 2GU9A 4LBKA 1DQ4A 1R082 4N9HA 1HXS1 1ND2A 2YZ4A 4GB31 3V56A 1UKGA 1KJLA 5GLZA 5T5PA 2P3IA 4I3GA 1MZFA 3VBHB 3ZXFA 1IKQA 2Z69A 2WWSA 4QMAA 4D69A 2DVBA 4IEXA 1O4TA 4MLOA 2D43A 3K48A 2B8MA 3FBMA 3JUUA 2GMMA 1WGPA 2HWB1 4YFZA 1U0AA 2EXHA 4BYYA 1ZRCA 1RUH3 5E16A 1LOFC 2D6LX 4IEOA 1D2QA 5AC93 3ZVXA 2X8KA 3AMNA 3T1MA 4KU7A 3WW1A 2IXCA 3RS6A 3NKGA 2R072 1AR72 3VBFA 2GNBA 1S2KA 1UU6A 3GALA 2Z79A 3FLPA 2RR11 5JZGC 1PZ7A 3E5UA 3ZXLA 3KLSA 4FOVA 4H7LA 5I0TA 1BEV1 5J3UA 3N35A 1VBD1 3CJIC 3AM2A 1LU2A 2RS51 1CESA 3KQRA 1LKNA 4YM1A 5A3MA 1OD5A 3H1YA 1A3KA 2VVDA 3R4SA 2JJ6A 3MIFA 1CQ9A 4AVAA 1TNRA 5HBAA 1RUD3 3RYRA 1N47A 2ZGQA 4AFAA 1S0FA 2ES3A 2WSVA 1WMDA 2AENA 3AYDA 5GALA 5CG8A 2VPVA 3WD5A 5ACA1 5ABJC 1EV13 2D3SA 2B9UA 1IPJA 4CDQA 4C0HA 1IPKA 1BMV1 1BJQA 3KCCA 2XGXA 4KWKA 4RHV1 4A7ZA 3N7JA 3POSA 4HT1T 2JG9A 4OI0A 1V70A 2WNUC 1UU5A 3KSCA 4H55A 3PVEA 2HEVF 3FUQA 4YGCA 1SLLA 2E7TA 4S2DA 2GC3A 4IL7A 4FAGA 1CAWB 1TE1B 5JZGB 1FV2A 3OY8B 1OLRA 2WIIB 5DUVA 2D98A 3IPVB 4PLOA 4YM0A 2UWAA 3IT8A 1QH6A 3LGRA 3PVNA 4HETA 4JGYA 3IIAA 4Q0VA 5E8AA 4FQ4A 2WT1A 2BUKA 1ZZ7A 3CJIB 3EHKA 1RUF2 2DCZA 2DF7A 5FPXA 4JDMA 2SLIA 3JD72 2ZGSA 4R9DA 3SH3A 1G9AA 2G9GA 4FTSA 3M3IA 3RNSA 1RVF2 1SLTA 5B2GB 2A3XA 2R16A 1YYNA 3VHRA 1C8M1 4ISQA 1YNAA 3B9IA 4WVZA 2YYOA 4ES8A 1K5MC 2WKKA 1QGLA 2PHWA 4JGZA 4AYUA 4YSFA 4LA2A 2BGCA 2K0GA 2WT0A 4Y22B 3UV9A 4SLIA 5GLWA 4MXVA 2WNUB 2WA4A 3WINE 2GAUA 1NLRA 3ZYJB 3NAPA 1IKPA 4IEUA 5IK5A 4MZUA 1QF3A 2ZOEB 4HFSA 1AR62 4FPGA 4AI2A 3V64A 1POV3 1RUC3 3ZPYA 1FPN3 1EAH2 1S0EA 2XG3A 4K21A 1VBC2 5T54A 2D5FA 2WLQA 3TN93 4Q4W3 3MF9A 3NJZA 4PQ9A 3USUB 2R063 1CR7A 2BNNA 1UW8A 4BOWA 1RUI1 1NCRA 1M06G 1MEC3 5KC5A 1WD3A 4BLIA 4R8HA 1FNZA 2QZ3A 1RMU1 1VBA2 3INAA 3BU7A 2DYCA 1MS9A 2AZ5A 4LR4A 5CG9A 3PMEA 4E4SA 3E6BA 2XLAA 3I8TA 2ETEA 4OVEA 4HSLA 3D5OA 2ZHMA 1RHI2 5BNQA 2C0ZA 1HRV1 4Y24A 4UW5A 3I54A 4XMIA 3LSEA 1OQ1A 4NHKA 1LULA 4P9IA 4MGIE 1G6NA 2JG8A 3RSJA 3FFZA 2ZS6B 5D8AA 2OW4A 2VQAA 4GIQA 2JDZA 5T5LA 2VU9A 3GNEA 5F6LB 1IS6A 1POV0 4AHYA 3BPZA 1C5IA 1QXPA 1DBNA 3B69A 3MPPG 1BKZA 1PIV1 3AKSA 2PA7A 4AEMA 4GMP3 4GA9A 3OBTA 4Q8LA 3ACLA 2D40A 4IEVA 4ZXKA 2ZAHA 4CDUA 2PYTA 2WFF2 4D7YA 2GN3A 3CU7A 3UKTA 4AGRA 2EXKA 4PLMA 1OKQA 5BNNB 4ZU4A 2NMNA 1VBD3 2VVFA 4EROA 5CAZA 3THPA 1UZZA 1QKQA 5CIRA 5JVVA 4AFCA 2RS53 4N90A 1DIWA 3TWIA 2HWF2 2TUNA 2YC0A 2ZX1A 3AMMA 4YZ1A 3VBSA 3H9AA 2DFCA 4BH9A 4FPOB 2ZAAA 5T50A 4R9AA 2RJKA 5ACA3 3W58A 3URFA 4FCAA 3ZFEA 1NXMA 1LHOA 3WDYA 3FLTA 3NW4A 4K8FA 2D97A 1TME1 2XWJB 4HLTA 5FBZA 4K40A 4COZA 3GBWA 4KGQA 4GMP0 4LO6B 2QDRA 1G7YA 4FPEA 4L11A 4AHWA 2R0HA 4EN8B 3O7OA 5C8CA 1X82A 4FP3A 2E53A 2FBEA 3QLQA 5BUVA 1DLLA 3WOGA 3VBOB 3FC0A 3AYAA 1MS0A 5J98B 1R093 3R6SA 4A3XA 1ZBA2 1PK6A 1NOVA 3TYJA 2GC1A 1V9U2 4GULA 4KGGA 2K9ZA 1IQAA 4X8PA 5JPNB 4G3YC 1UF2C 1C8M3 1QJZA 1SEFA 1UKRA 4YW5A 1AUYA 1LOAA 3VKFC 1AHSA 1NYWA 1AYM1 3M70A 2ZHNA 4IEPA 3BIWE 3WDWA 1VBB2 1O3SA 3RRDA 4WVWA 4E27A 1X8EA 3VLBB 3VKNA 2Z42A 3H7JA 4RFT0 1WBLA 1QJU2 1VRH1 4H14A 1C4RA 4Y20B 4EV0A 1CN1A 2HWD1 3AXEA 5DG1A 2QUOA 1LGBA 1QY4A 5L7OC 5GLVA 1GBGA 3NKTA 4WVMB 5L36A 3SISA 3WP3A 5FO8B 2ZHLA 4XQDA 3ME2A 1OA3A 2ZZQA 4XFGA 1FATA 1HXS2 3HBZA 2PLV2 1I9RA 3I59B 3OTFA 4GH4C 4EWDA 5LRSA 3JU9A 2OYZA 4N53C 1Z7S2 4F7ZA 4OHXA 4HKOA 2HWB2 4QGMA 3IKWA 2PAEA 2R042 1HRV3 1ZA4A 2NYYA 4Q4X1 3VDDC 1VALA 4QQHA 5C8WA 1QNYA 1AL21 4I3PA 4CYDA 5GZDA 3USSA 3LCPA 3PNAA 2ET1A 1YI9A 3HT2A 4LNVA 4CDWC 2VMGA 1Q8QA 5JDBA 4PBPA 3UL2A 4LBNA 3AB0A 2RR12 1G9CA 5CB7A 2E9QA 2H0BA 1KFXL 1PNGA 1ULDA 4TLFA 1AJOA 3MLLA 4M3CB 4XETA 1OQEA 5BNPC 4MX3A 2BVVA 3OJBA 5K0UC 4B7KA 2D44A 5L7OB 2MEV1 5GM0A 1PIV3 3U10A 5JOZA 1GLHA 1VBE1 3H8UA 1Q43A 1HV1A 2BVBA 2JX9A 3ZFGA 5BNOC 4YGDA 1PVC2 1G9FA 4HN0A 1PO11 1BXHA 4GH4B 1NA1A 1ONAA 1H2MA 3UJQA 1HX6A 4N53B 4P9WA 4RL7A 1W6MB 1PM7A 4E2SA 2VOVA 3RI8A 3WVJA 1W6QB 3GZUC 3KCXA 3R0RA 1UIJA 1B35A 4Q4Y1 1R1A1 1UPSA 2A5ZA 3VBFC 1GZCA 4RHV2 3VDDB 4AQSA 1EY2A 2DU1A 1LOCA 2RMU2 2O8QA 3FFQA 1UMZA 1GQGA 4Q26A 3B5LB 3E6CC 3D4KA 4CDWB 5C4WA 4WZCA 5J96B 3ZSEA 1Z78A 4J6GA 1QJX1 2ZKNA 3KB5A 2Y26A 2YY1A 4LO7A 4NWWA 4Y1UA 4AK3A 3ATGA 5BNPB 3J8F2 5K0UB 3AFGA 1RUJ3 2RM21 4LBQD 3ZXGA 2VUAA 1FX5A 4LO5B 1XU1A 2ZHKA 1QJY1 4B29A 4BLJA 1LESA 3VZMA 2W0XA 2V5YA 2VNGA 4M00A 3EJKA 1IS3A 1AXZA 1N3OA 2VY0A 2SBAA 5BNOB 1MS3A 2EXIA 3TOJA 1HRI1 3WW4A 1CJDA 2DTYA 1V00A 4CDQC 4FPFA 2DCTA 4XILA 2GH8A 2EA7A 3SITA 2MNGA 1DZRA 3DL3A 2HEYF 5CFDC 3JBG2 4BIFA 4YM3A 4DS0A 3GBFA 3ZYGA 2JG9C 4AGGA 4M0NA 1IS5A 1YFYA 4LEJA 4YVWA 3FBYA 3VBFB 4MVTA 1RUH1 2UY8A 3KT7A 4YARA 3PTYA 5AC91 1ZX5A 5KHIA 1YHFA 2D3PA 1C57A 2FHRA 3APBA 1ZZ8A 4P9XA 3BOWA 4AQ2A 4QPGC 2JKBA 4JGYC 3IWZA 4CTEA 3KT4A 4LBLA 2B42B 4ZKTB 1DF0A 1RUG3 1S0CA 5GJ6A 4JQRA 4XFCA 4FBFA 4CP2A 1H8VA 3WQ0A 2XBO3 1GR3A 1RUI2 4OI2A 3S0MA 1PGSA 4YW4A 5JIAA 1G8WA 1LHUA 3ZX7A 3KS7A 2P3JA 4KWJA 2IFWA 3BTAA 4CEWC 1H1AA 3IM0A 3MIBA 4AI8A 4AFDA 2CTVA 3V0BA 3B01A 4PLNA 4R52A 5CFDB 1YLLA 4NOTA 2JG9B 1OPMA 2QDNA 5A33A 5CVRA 3NAPC 2R073 2IXHA 3NL1A 2WNEA 5GZEA 5JSRA 4LUKA 2KM2A 1DYPA 4YLZA 2HKXA 1ZBE1 4BMBA 2XVKA 4QPGB 4L97A 5JSPA 4JGYB 1QDCA 1UU4A 2AH2A 3DV8A 4KQ7A 2I2SA 3RMYA 3OGJA 1NCRC 4JDOA 3ZFFA 3WHTA 4FPLA 1O3QA 1SMVA 2G9FA 3ZXKA 1LODA 3IMNA 2LUWA 3GBGA 4WV8A 4LHKA 2QE3A 4C1XA 3ILRA 4DINB 4UW6A 2OUHA 2ZGRA 1D0HA 1W6PA 4NPRA 4RQPC 3SMHA 1VAMA 1D4M1 1ASJ3 5HCAA 2A75A 2BNOA 5T55A 4CEWB 3M3OA 2XJTA 4TYSA 3I4IA 4L9BA 5D8AC 4YG6A 1QQP3 5DZGA 4IEYA 2NP0A 1DGWA 4QPIB 3BODA 3NAPB 4F83A 2DURA 1JTZX 5C9AA 4X6RB 2RS33 1I6XA 4N7UA 4COWA 2QZ2A 1GSLA 1SDWA 1I5ZA 1SCSA 4LHLA 4RD7A 5JPMB 4COYA 5A32B 2CY6A 1DU3D 2NM1A 3DPRA 4Q4Y3 1R1A3 1TME2 1AR93 5DG2A 3KT1A 1NCRB 4CDUC 1LRHA 4KG0A 4Q1PA 4CDXA 1FPN1 1F5FA 3D6EA 2XJQA 4AQ6A 3ILNA 3ZDSA 3ZMOA 4DQAA 4FTBA 2R061 2WJSA 2B5HA 2Y38A 4ATFA 1MEC1 1QJX3 3VHNA 4E4ZA 3PMSA 1ZZ9A 2LALA 1E57A 4RQPB 3RI9A 1CJPA 4AI0A 1LOGA 4IV3C 5KXCA 2RM23 2FZ1A 4MXWB 4META 1AJKA 1QJY3 4IXLA 4XIOA 1WMEA 3H7YA 4I02A 3WUCA 4FPJA 3MIEA 2WS92 1PGL1 4FXKB 2E51A 1HRI3 4AVBA 2ZGTA 4PJYA 4BHPA 2XLFA 3PHMA 3TAYA 1RC6A 1NY71 1ZVFA 2UURA 1AYM2 1DQ6A 1RJ7A 2VOKA 2WQZC 3OPZA 2QNKA 4YVSA 4IESA 1PGW1 3WDUA 1APNA 4O9GA 1RUNA 3VZNA 3WY6A 4QX5A 2IWGB 3U11A 5JR7B 5H9SA 4CDUB 4LBQA 2R1BA 5C8CC 1VRH2 3L9JT 4GMP1 1UL9A 5CU1A 1UCXA 2D7FA 4QQOA 2X53S 1SLBA 4MSVA 4QU2A 2LTNA 2PHFA 4IEQA 3VBUA 1JN2P 3N36A 5FQ0B 3BOPA 4WBBA 1JHNA 4IV3B 1DG6A 4Q0SA 3ZXJA 2WFPA 2DVDA 4M3CF 4OI1A 2PELA 1AR83 2R30A 4AI1A 1QOSA 4L2NA 4YG0A 4DXZA 3NV2A 1CAVA 4I0BA 1YIFA 2DFBA 3SCFA 1CVNA 1DGRN 1FOD1 2VOWA 5CFCA 1CAUA 4GALA 1HQNA 1O7FA 5LRRA 3SH5A 4XTPA 4AVCA 4Q4X2 1AL22