1XNBA

High-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis
rcsb
source organism Bacillus circulans
molecule tags Glycosidase
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xnbA00
1KS5A 3AMHA 1OLRA 3AMPA 1H1AA 1BCXA 1OA2A 3VZLA 3HD8B 3WR0A 1HV1A 1W2UA 2B45X 2Z79A 3WQ1A 4HK8A 3M4FA 2B42B 3MF9A 3VL9A 3AKTA 1REDA 2NLRA 1UU6A 1XYOA 3AKRA 2VG9A 3AKPA 3AKQA 3VZNA 3WP3A 3AMQA 5EJ3A 1H4GA 3WXPA 4HK9A 3AMNA 1OA3A 1XYPA 2QZ2A 3VHPA 1IGOA 3VLBB 3WP6A 1BK1A 1M4WA 3WP4A 2JICA 5K9YA 1XNBA 3WQ7A 1C5IA 2D98A 4XPVA 1AXKA 1XNKA 2NQYA 2B46X 3LGRA 1XXNA 1PVXA 3B5LB 3LB9A 3VHNA 3VZJA 2BVVA 2DCKA 4S2DA 2DFBA 2VULA 3VZOA 3WT3A 1UU4A 3MF6A 3WY6A 2JEMA 4S2GA 3AMMA 4XQDA 1UKRA 2JENA 3ZSEA 3O7OA 1OLQA 2DCZA 3AKSA 1C5HA 1H0BA 4HKOA 3WQ0A 5K7PA 3WX5A 1TE1B 1XNCA 1BVVA 2BW8A 1H4HA 2F6BA 1QH6A 2C1FA 2BWCA 4XQWA 1HV0A 1XNDA 3VHOA 3EXUA 3MFCA 1REEA 4S2FA 2DCYA 4XQ4A 1REFA 1H8VA 2DFCA 2VUJA 4NPRA 1ENXA 3VL8A 2D97A 4HKWA 3VZMA 5HXVA 2BWAA 1YNAA 1F5JA 3RI9A 4IXLA 1UU5A 3WP5A 1HIXA 1XYNA 2VGDA 1OA4A 2QZ3A 4S2HA 1T6GC 1QH7A 1NLRA 3VGIA 2DCJA 3RI8A 4HKLA 4H7MA 3VZKA 3B7MA 3MFAA 1KS4A
chains in the Genus database with same CATH superfamily
2J1AA 2RR11 3BU7A 4LHSA 4KU8A 4YM2A 5A7SA 2OPWA 1GZWB 1WLDA 4BU2A 3BGAA 1JBCA 5FY1A 1W2OA 1OQ1A 4F83A 2F4LA 1AR83 3BOPA 5DABA 1ZX5A 2CDOA 2DTWA 2ET1A 2RS52 4CDUB 3WQ1A 4CDXB 2FD8A 2ARAA 4J6GA 4N53A 3TBDA 3OGJA 3N7MA 3PMEA 4FOQA 3AKTA 4B4RA 4PF1A 1GLHA 1QXJA 1H6YA 4LBJA 1VBE3 3ZSLA 4GWJA 3FJSA 3OY8A 1DFQA 4JQRA 4EWAA 4LJHA 4JRAA 4O7XA 4QQOA 4QDSA 5FYIA 5AC91 4OFGA 1YWKA 3MW4A 5C8WA 2DUQA 1GZCA 3TEYA 3VBUB 5ANQA 2HWC3 1SACA 2A7AA 1JH5A 4HSLA 2ZGQA 5G04L 4CDXC 4EYUA 5KWRA 1LODA 2JWPA 1PK6B 3ACHA 2WFF3 5FMOS 3I3MA 3CDZB 3PVBB 1LEMA 5L9RA 3VKFC 4G4FA 4CCNA 3ZXDA 3VB9A 4UWDA 1RUF3 2VOXA 3THTA 5F5IA 1CPMA 1S0IA 2J22A 2VVFA 2VMFA 1DU3D 1LHNA 2RMU2 4IE6A 2Z69A 2OS2A 3ZYGA 4Z92B 3ETPA 2IXHA 4M3CE 3JBG1 3LDRA 3VBUC 1AYM2 3EQEA 1LENA 5JXHA 2X8KA 3LEIA 2VL4A 3CJIB 2VW1A 5I8SA 5E89A 5F2SA 5HCFA 3VHNA 3UETA 5JXJA 4UBGA 3ZN5A 4IV3B 3LOBA 1FPN3 2JDYA 4FTEA 1VPHA 4JHZA 1UU4A 3MPPG 4D7SA 3OEAA 1JZ2A 2O8QA 2XB6C 4EZ4A 2R0FA 3MW3A 2HWB2 1WKYA 3C2UA 2ZX4A 4MHRA 1ST8A 3OUJA 4ZHNA 2OYZA 3S0MA 1JZ3A 3RZMA 1ZBE2 4CDXA 3L9JT 4CA9A 5CFCB 3BTXA 3CJIC 2A5ZA 2XLFA 3D0JA 3WW1A 5BNQA 3RFRA 2QQWA 1ZBA3 2ZXQA 3HQRA 1QJU3 1W0NA 4IV3C 1S2BA 1GNZA 1FMD3 3POBA 3J7MA 2BBVA 3ZXAC 3IMMA 4CUBA 1XJAA 2BWCA 3OF1A 3ACLA 3M7AA 1PNGA 2VD7A 4H2AA 1S55A 3GBWA 3VBUA 3KS7A 3ZXKA 5EQUA 1RUI3 5G05L 3WNMA 2WO7A 3GBGA 5IT6A 3ALQA 1KFXL 2BUKA 5A3WA 4AHYA 1GNYA 3AZZA 5A3OA 5B4NA 4AOCA 1YQ2A 4JX0A 3H3ZA 4ARXA 3ITQA 1PO12 2JDAA 4NRQA 1AR93 3BTAA 3RZZA 5KXDA 1F5JA 3D3AA 4HFSA 4CUAA 4IE5A 1QF3A 4K20A 3FC0A 1CAVB 3ZYIB 1RC6A 3ZSKA 1F35A 1V9U2 2VGDA 4YW1A 2BU9A 1J59A 1NZIA 3E6DA 2W08A 3WDYA 2HBTA 2X29A 3M3IA 1W8HA 3FZ3A 2DCJA 3CJIA 5FZEA 1UX6A 2WT1A 1RHI3 2IWGB 2JKBA 3I2JA 4IV3A 4EQVA 1KS4A 4TXWA 1WCDJ 4NIIA 3FLRA 1CVNA 1V6JA 3OGVA 3NNGA 1PNFA 3HPNA 4QQPA 4QD2A 4IEUA 3LCPA 1D4M2 1QQP1 1W99A 1OLMA 2QKDA 2W1QA 4M01A 4QGLA 4QHOA 3WF4A 4CCOA 1UF2C 3DV8A 4Y1UA 2GAUA 1W03A 2FBEA 3UL2A 1V6IA 3I54A 2DF7A 2X53S 5LCWL 3ZMNA 1GOHA 4E4ZA 5AVPA 1SDWA 4NWVA 1GOFA 3J9SA 3THCA 1CIYA 3WW4A 5ISLA 3MLKA 1FOD1 2NLRA 1UU6A 3B00A 4IEYA 2VG9A 2W0XA 2XQRA 1AR72 3EMRA 3KZ4C 4HVQA 4ORFA 3KCXA 2E32A 2ZHMA 1ENQA 4LHLA 4OHXA 1JS9A 4JV4A 5FP9A 3WINE 4HVOA 4Q4X1 3THPA 2DDUA 5KXEA 1CN1A 2GP3A 3AZYA 1GQGA 5BNPB 1TEIA 2IXLA 1BMV2 3HEIA 2CAVA 2VQAA 3SXWA 3OBTA 4YG0A 2RHPA 2P5BA 4EV0A 1NQDA 4FPOB 1AYN1 5EPAA 1F4HA 3NKTA 4FQZA 1RUOA 2WS92 5LA9A 3LQCA 5DXDA 1XSQA 2GMMA 3SMHA 4OMCA 1HXS2 2IUWA 4JTNA 1MVQA 2VMDA 1H9PA 3SITA 4O9EA 1OMIA 4HLTA 3INAA 2XBO2 3N9OA 2W1UA 1PVXA 4KI5M 2ET7A 4D6SA 1C8M3 2OQ6A 4DXRA 2VXJA 3K4ZA 4L97A 2GMEA 2WNVB 4E4SA 1KDMA 1R64A 2Q5TA 4IEPA 4R9BA 3KVBA 5HCBA 2CV6A 3LIHA 4R4ZA 1HLCA 1K5JA 3QH7A 1UO9A 5LASA 3FFZA 5A7PA 1LHWA 3J7LA 4MV2A 4IV1B 3HN3A 1UYXA 1V70A 4XFFA 4DUWA 5FR3A 1PMIA 5FP8A 4Y1XA 3RSJA 1SLLA 5LEJA 1LAJA 2P6HA 1COV2 5H9RA 1F5FA 4HPKB 4AAPA 4XDOA 4UFIA 1ZRCA 2B7YA 3C3VA 4HKOA 3W9AA 2WNVC 2VUAA 1OVPA 4DRVA 1W28A 2V5YA 3P1IA 4QKDA 2P34A 3AL5A 2WA4A 1WBLA 1ENRA 1MPXA 1JN2P 2B4KA 2XJSA 3JXSA 3OBAA 2W9XA 1MS3A 1UMHA 3DYPA 5EZWA 5C8CC 2P3KA 2BFUL 1RUJ3 4Q4W2 1JOBA 1QWRA 3POJA 2OW4A 2DTYA 2ZHLA 4AEDB 4Q4Y1 5FLHA 5C5UA 5IK5A 5JI7A 1ACCA 2E26A 2QQPA 2VO5A 3CKHA 5IVFA 3WV6A 1TNFA 1EUUA 1HRI3 2HWF3 5DAVA 1RUE2 2R1BA 1DLCA 4XFIA 5FKBA 3WDUA 3WNXA 3JB8A 1FMD1 2VOWA 1FT9A 3PUAA 2ID4A 4JCKA 3MO4A 4PI0A 4CXXA 3LDBA 4BOWA 5FPLA 5F5CA 2BNMA 4XJ9A 3MDPA 2E33A 2XH6A 4LTAA 1OSGA 3JZVA 3ABZA 1QJY3 2WQ8A 1EAH3 2Y0IA 2ZJCA 4KGGA 4XEZA 1I9RA 3JD73 1OVSA 5IYYA 2DYCA 3B7MA 1PHMA 1X7NA 2WNVA 2WWSA 3AL6A 5FUNA 5LZ6A 2E7QA 1YJKA 3LDKA 5C8CA 1UL9A 1XE0A 2GU9A 3WR0A 3ILFA 1YFWA 3B9IA 5I8TA 1HB4A 5FZFA 2A71A 3KD4A 4CCKA 4HK8A 5T5JA 5AVAA 3ENRA 5JLVA 5JPNB 4HPKA 3MUY1 5C70A 4Q4V3 4LE4A 1RHI1 4V1PA 4A7KA 1P8JA 1TMF2 5EXOA 3PHMA 3KMHA 4PQ9A 4H14A 2WZR3 3IKWA 2A6VA 5FYBA 2XLGA 4P00B 5DN2A 5EIYB 3G6JB 5T50A 3WZ1A 3RWKX 1PMJX 3Q8FA 4IUGA 3POWA 2N7GA 5FZ6A 1JHJA 1HJGA 2JDKA 1RJ7A 4QWNA 4OLLA 3I3BA 5GZCA 1XOYA 2VPVA 3LE0A 3SLIA 3UNPA 1V0AA 3R4SA 4E9KA 3FHQA 3WQ7A 3L2HA 1CZSA 1C5IA 2XJTA 4BMBA 5C33A 2B9VA 4CU9A 5JSOA 1R093 5FP7A 1V6LA 4BMEA 4J1XA 4COZA 5F2WA 5D2AA 4LORA 4E8CA 1ASJ3 2HWD1 2Z42A 3VUOA 3LB9A 3NNFA 1LHVA 1PO13 5LW9A 1VALA 2PHTA 2WT2A 2IXIA 1RVF2 4FPLA 5FBJA 4D7TA 1NKGA 4SLIA 2CL2A 3KT4A 2TEPA 3I59B 4Y4RA 5C7GA 5E6HA 3KCCA 4COUA 1MS8A 3SEEA 2AR6A 3WG2A 1SG3A 4A6SA 3GHNA 4XBNA 3SCGA 4WM7B 3UGHA 5FZ3A 1HKDA 4BIOA 1MS9A 2LROA 2XKOA 1ZM1A 5FY5A 1Y9MA 2MEV2 2W95A 4DRRA 2DUPA 1POQA 4NAOA 3N9PA 1MEC1 1PGW2 4ZS3A 2Q8EA 1W6PB 2VTXA 1AZDA 5F5QA 4DPNA 1D2SA 3ASIA 4MGIE 3FUQA 1POV1 2DFCA 2PHUA 1MQTB 2GDFA 2VZRA 3OYWB 4MLOA 5JI9A 2BNNA 2EXIA 1E57A 4WM7C 2VVEA 1D7PM 4YFZA 2Y6GA 1Q8QA 5C6CA 3OOXA 2ZA9A 1NE6A 4LO4B 1O5LA 2E9QA 5IVYA 2D3SA 3LAGA 1GV9A 2FDJA 2XJPA 5FOBB 4ASKA 4SBVA 2JX9A 5AFBA 4AQTA 2JD4A 5FZ9A 4IEWA 4FPHA 5LY2A 1RUD3 4Z07A 3NNJA 1MQTC 3AP6A 4LBKA 5I0UA 2BRTA 2HYKA 2RS51 1D0HA 3AX4A 4BQ4A 1ULOA 1UOFA 2VJXA 4OMDA 3CIHA 1UWWA 5IK8A 3P3NA 5T5LA 3B3QE 1IPKA 4JGYB 2BGCA 1Y3TA 3ACFA 5FJHA 5GJ6A 3ZN4A 4AGGA 2RS32 2VZQA 1JODA 5A70A 3I59A 1SZBA 4OHWA 5DAXA 2OA2A 2YC2A 1FXZA 2W91A 3FHIB 5J7MA 2C9KA 5T5OA 3WUDA 1SLTA 4DS0A 1E5SA 5LRRA 4CEWB 4WM7A 3U10A 1PGL1 3SCHA 4YW2A 2B5HA 4GWIA 3VZNA 4JGYC 1DP0A 1XNTA 5LBEA 1RXFA 2QQIA 1RITA 3IIIA 4OI2A 1SEFA 1VBA3 2RE9A 2KD7A 1DLLA 2RMU1 1W6PA 4ZONA 4Z2WA 1UOBA 4X8NA 3D6EA 1K5MC 2GC1A 1MQTA 2G19A 3OYWA 3QOPA 4NJ4A 3TN93 1AYM1 2RM22 4CEWC 3AVRA 3ILNA 3M8LA 3WP6A 4L8QA 2ZPXA 4DNYA 2XHKA 3PLQA 4BK5A 4FPCA 5CG8A 3ACGA 2EIEA 3A21A 1BK0A 5L73A 1N1VA 2K9ZA 4YGBA 5A6XA 3KF5A 4CE8A 5H9SA 4LA3A 4WVWA 3PDQA 3NW4A 1ZBE1 3POSA 2R042 5BUVA 2VMEA 1O3TA 2DFBA 4JGYA 4L99A 1I5ZA 5F3EA 3WT3A 1NCRB 4ES8A 4OQ9A 3PVEA 2YC0A 5CADA 1YCIA 2R1DA 2JEMA 2IXCA 3DXTA 4S2GA 2BP6A 3DPRC 4FT8A 3BOWA 2V4AA 1O6UA 5FREA 1VMFA 3MIFA 1K5MA 3T3YA 4JKMA 5EP9A 3O1OA 2VBPA 4IERA 4ZY9A 1YJLA 5FKCA 4CEWA 1DGWX 5KC6A 4BQXA 3T4VA 1AR82 4IEVA 3A4UA 4RGKA 1TE1B 4KL1A 1SDDB 1NCRC 1W8ZA 2BZDA 2P1BA 1PO11 2WN2A 1CAUB 4HN0A 1W3VA 2VCMA 1K42A 4ZU5A 4EN6B 3RGBA 4KGQA 1VBE2 3GZEA 4W8JA 1PGSA 1WD4A 1V9U1 4WZFA 4NIHA 2Z2SB 1F15A 1XC6A 3AP5A 3TEXA 2HWC2 3PMSA 2D6KA 1W6NB 2WBKA 3RJRA 3VKLA 3H42B 2B8MA 3RI9A 2GN3A 2WFF2 4P9WA 5L36A 1SQ4A 2DVAA 2FCUA 3DPRA 3GJBA 2G1MA 3USSA 5A3PA 1KITA 2R30A 4G9SB 4XW3A 1RUF2 2I45A 1D4M1 4P9IA 5IAVA 3ZPYA 2JD9A 2D3PA 1ZZ8A 1QMJA 5IVBA 4LK6A 4MSVA 3RI8A 3AJZA 5FZHA 2WNEA 1LHUA 1NCRA 4ZS2A 3IWZA 4CPBA 3NNMA 1VR3A 1MS4A 5FO8B 4D69A 1AR71 4EJRA 4EROA 1QXRA 1UYPA 2CDPA 4QDQA 4GD4A 1HW5A 2VQUA 5DZFA 3H3UA 2XWBB 1FPN2 4LLFA 1OUXA 3APBA 1AL23 4XJUA 4RD7A 4MVTA 5T5PA 4P14A 1C4RA 5EFUA 5E8AA 2AGSA 1PX3A 3WOGA 4EE2A 4XETA 4INDA 5FRAA 4Q0QA 5FZMA 3ZVXA 3HNBM 4ASMB 3Q8AA 3WG3A 1N3QA 3RZKA 3VD4A 2WABA 3VLBB 1ZBA2 2JDNA 2R16A 2WO1A 3N7LA 4YRDA 1YLLA 4UFMA 1QJU2 2WS91 2QZ2A 4DUVA 1FMD2 5IVJA 4TSVA 2R073 1S1AA 1HXS1 2ZGOA 4UFJA 1U0AA 2X5IB 2YUEA 5FUPA 4D7YA 2WAOA 1YI9A 2GALA 2PHWA 2RDNA 3H50A 2WRAA 2XBO1 3LSEA 1RUI2 2RJKA 3GXUA 2XXZA 1VMHA 3T1LA 4BLJA 4BDVB 5K9YA 1S0FA 5I0TA 1CGPA 4FSJA 1VBC3 1IZ3A 3NRUA 4QB2A 2CHHA 1CJDA 4NE9A 3FBYA 2W68A 4YW3A 4W50A 4GMP3 3ZX7A 1RB8G 1AR92 3RDIA 1UXXX 2A6XA 1V00A 3H1MA 1Q5OA 2WYFA 1F9KA 1BLZA 1RYYA 1YQ5A 1PZ7A 2GN7A 4FPGA 4PCRA 1DYOA 4Y24A 3VZJA 5JIAA 1COV1 2MNGA 3NL1A 1IPSA 3KM5A 2WSUA 3N9LA 4TZDA 2QQMA 1V6OA 4AEMA 3WY6A 2BOJA 2Y6LA 1QJFA 1RHI2 3GCXA 4YG3A 1C8NA 3GDBA 4GQ7A 1DDLA 4ZU7A 3UKTA 2IFWA 2VZVA 5AFEA 1GZTA 1C57A 4IEZA 2EAAA 4ZZ5A 3I97A 4NRPA 2XL7A 4Q4W1 2XDVA 3TNQA 3O0VA 3ZM8A 5FYZA 5IK4A 3AKSA 1ZRFA 4MOAA 3M3QA 2HEYF 1ND2B 1QJX2 2EF6A 3E6BA 1BVVA 1RJ8A 3BPSA 1N1YA 4K8RB 1QH6A 1RUE1 2RS13 5FMBA 5KBFA 3GJAA 4HG6B 1FNYA 4M0NA 4XCBA 2J7MA 5L7OB 2ADDA 2AACA 4K21A 1EP0A 5A6ZA 3I2FA 4IL7A 5GLWA 4EWDA 1QY4A 3MHZA 2UWAA 2PHDA 2BGPA 2YGLA 5DZGA 2W94A 3V0AA 4D6QA 3RZGA 1SBFA 1OPMA 2H0BA 2Y33A 1GWLA 3HWJA 2VQTA 4JDNA 4FAHA 2D6MA 1ND2C 1XE7A 2DBNA 4AI3A 3FX3A 1GR3A 1R083 1E5HA 4UFHA 1O8SA 4RN5A 4MGQA 1OA4A 2SLIA 4W6WA 2Y6JA 5A6YA 2CNAA 1DQ0A 2V73A 3BPZA 4OYUA 4Y1VA 2R32A 2I07B 1UX7A 2R063 4NPMA 4QM9A 1QJEA 2E7TA 2EAKA 2JKXA 2WJSA 3N36A 2VXRA 2C0ZA 1JOJA 2R0HA 4H7MA 2XLAA 2Q8CA 3VZKA 4Q1PA 4URTA 5F9TA 3BCWA 2DVGA 3LSDA 3FL7A 2ZEYA 4QHZA 4WVMB 1EY2A 3KCYA 4RL7A 4BH9A 3WNLA 3T30A 1TMF1 3CLPA 1C8M2 3T2TA 1STMA 5D21A 3WNPA 2XUMA 5BV6A 2H6BA 2PTMA 1R1ZA 1RXGA 1VIWB 4N43B 5LRSA 2C4XA 4IE4A 4LHKA 1O3SA 2WQZC 1W8TA 3GALA 2A3YA 4JC1A 1ND2A 2ZZQA 4IESA 1O4ZA 1XB9A 2OVUA 1VRH3 4DXZA 3K3OA 4GB33 5BNNB 2ZS6B 1AVBA 3AC0A 3WF2A 4COYA 3JUUA 4M4PA 3AMNA 4UFKA 5FZ4A 4BXFA 5JUVA 1FI2A 1BYHA 4DIQA 3M3CA 4LOSA 4MYEA 3LPGA 4LR4A 2Y6KA 2WINB 4N43C 4XFBA 4OI4A 3ZSMA 2J1SA 4X6RB 3AVSA 4QXCA 3U07A 1RUJ2 2OUHA 1WMXA 2Y64A 1M4WA 3NSTA 1EV13 3SKJE 5FXVA 3ACIA 3VD3A 4MADA 2ZKLA 3NV3A 1S0GA 1ONAA 2ZZJA 5BNNC 3O5SA 2PHRA 1CQ9A 2Y38A 1RVF1 4OUSA 4XPVA 1HRI2 2HWF2 2NQYA 4Y1ZA 4KMQA 5FP3A 1OXCA 4KBZA 1R1A3 3GYDA 2XG3A 2QQKA 4CP9A 2ILMA 5CEHA 2R071 4UW4A 3MICA 5GZGA 3MIBA 1HQNA 3IAQA 3VD5A 5A3TA 4FI9A 1W2TA 2P4EA 4WVMA 1QJY2 2MEV1 3OUHA 1BBT3 1EAH2 4RHV3 3N4MA 1PGL2 1MS1A 5FZAA 3JD72 1APNA 3LD8A 2XJUA 2FCTA 2YPJA 2ZGKA 2IXJA 1UKRA 1PGW1 2WYSA 2JENA 4GMP1 4L2NA 3HQXA 4N43A 4JTOA 3GNEA 2HLEA 4Q2FA 5J37A 2A70A 1UIKA 2EALA 3MIEA 3ES1A 2ADEA 4CEYB 4XE9A 3WQ0A 4AVVA 5K7PA 3V65A 2PA7A 4JKKA 1BVP1 2C1FA 3GM8A 3B94A 5BNNA 1K12A 3GF6A 1W9YA 5GLTA 3VHOA 2RDRA 5SV5A 3LKJA 4Q4V2 4YWAA 1WUVA 2WR9A 4LKFA 4PT6A 1PX4A 1REFA 1IS5A 1WA6X 1H8VA 1H2KA 4KQ7A 5JOXA 1SLIA 4CU8A 1ZA4A 2WZR2 3AB0A 1BJQA 2Y8KA 4P02B 2XR4A 4AL9A 5F1RA 1ZREA 2O14A 4NRMA 3TOJA 4CEYC 1AL0G 1F31A 2XMLA 1JZ8A 2FDKA 1LTEA 1SBDA 2QTWB 1LGCA 1HIXA 2RDQA 2RS31 4ET7A 3SH5A 3B93A 2J1UA 3IDEA 2ZGLA 4LLOA 1ZZCA 2OKXA 4MO3M 4AFAA 2JB8A 3IDCB 4HOOA 5FZCA 4OHYA 1CZVA 4HKLA 4QX1A 5A33B 2W5FA 1ND3B 4FPFA 1JYTA 1OBNA 1R092 4LBQD 4P9YA 2C9AA 4N7UA 1H8TB 1UZVA 5EV7A 4YW4A 3SH3A 3ZYHA 1ASJ2 1VE0A 4J1WA 3HD8B 1R081 1RUC3 1HV1A 2BFUS 4B29A 2ZMKA 1D2QA 3M1HA 4BLIA 3M3EA 5KXBA 2ZOEB 3UV9A 1QOTA 4CCCA 1Z7S3 3MV11 1KXGA 1UMZA 4R52A 3ZO0B 3NJVA 1Y43B 2J1TA 4KWJA 5LATA 1ND3C 2RM21 4CEYA 4Y20B 4HL0A 3WCSA 1O8PA 4A44A 3T2PA 4BK4A 4HANA 1JZ7A 2YBKA 1H8TC 4XACA 3AYCA 4H55A 2WNUB 1JYVA 1LNSA 1SFNA 2D93A 1ULPA 1BQPA 4AXOA 4CDQB 1WCSA 2ORXA 4YSFA 2JG9B 4GIQA 4NOTA 4LKSA 4QU1A 4B1LA 4KU7A 3J7NA 4YW6A 3JU9A 5FY8A 5FPAA 1E5IA 4UXAA 5EYXA 3OGSA 4ZXKA 4LA2A 3UGFA 3CHXA 1JXNA 2LUWA 4MHUA 2VC9A 2ZHNA 4Q0UA 2GNDA 3VKNA 1FNZA 3ZYFA 2G9ZA 4Y26A 2XJRA 2R041 4CCJA 3UKVA 5JOZA 1QJX3 3W21A 4M0HA 2WNUC 2YXSA 5KHKA 4B4QA 4LUKA 3UYJA 1OC1A 4CDQC 4R8HA 1XNKA 2JG9C 2MHFA 5FZDA 3E5XA 4FFFA 4Y33A 3S6PA 3BTZA 3POGA 3KT1A 2CGNA 4Q0SA 3LGRA 2BPA2 4YG6A 1UY2A 5A33A 5DAQA 5JZGB 1KJRA 4CZSA 1ND3A 3Q8CA 1B09A 2VULA 4NHXA 3HT2A 4KG8A 2DVBA 1RUD2 1AXYA 4E8DA 3RMXA 1H8TA 1AR81 1NCQB 1EV11 3D4KA 4I3PA 4RS5C 4Z1VA 1D4VB 1YEWA 3GZTB 5JXIA 5HI0A 3EO6A 4DZGA 4XQDA 1JYIA 2YY1A 1ULGA 1JU3A 2CAUA 3WNOA 1L7RA 2IFRA 3ZXFA 1VBE1 1ULEA 4K1ZA 4QDRA 1H2MA 1OHFA 2PAEA 1OF4A 2VCBA 1DGLA 2EA7A 3LIGA 5JZGC 1YFUA 1GUIA 3AYAA 4I3GA 2KA3A 4LO7A 1OUSA 4P5HA 4Y20A 2ARCA 3LA3A 5F6KA 2PN5A 2RDSA 1NCQC 2HWC1 2WNUA 3C7OA 2DWRA 1QHDA 2VZTA 3IDBB 1BBT1 2GSYA 4RHV1 4CDQA 1DGWA 1W90A 2JG9A 2WFF1 3PUHA 1FATA 4XJ8A 2VBBA 5T54A 2WO2A 4ATEA 4CVUA 4XQ4A 2ENRA 1OF3A 4AF9A 2B39A 3VD9A 1PO23 2DURA 1RUF1 1JYXA 2QQOA 1VBA2 4AI1A 3SEPA 2A1XA 4EN8B 5C8CB 4BIFA 4RYDA 1MACA 2GNMA 1YNAA 4RS5A 3TN92 1S0BA 4FPEA 5FWEA 1ZA7A 2XUEA 1OD5A 1WW4A 3WLUA 3JQXA 3ZXEA 4ARYA 5A3UA 5DQ0A 4YZ3A 4S2HA 4MGTA 2GP5A 1CESA 1S0EA 4A7ZA 3VGIA 4CXWA 1XNAA 5J1XA 2WL1A 4E4HA 3ZFFB 4META 4XUQA 4DMIA 2RG4A 1FPN1 1NZCA 1U5IA 5JZGA 5L19A 2A3WA 3PVNA 1A6CA 3DYMA 5HCHA 4MGYE 1NCQA 4IETA 1JI6A 1MZFA 2GNBA 4I30A 2YU1A 2SBAA 2PHLA 5JMCA 4KWUA 4CCMA 2DVDA 1ZBA1 1QJU1 3ZFFC 3FUOA 4LNVA 1IG0A 2D6NA 4PIYA 1UNBA 4Q27A 3VL9A 3AFKA 1JMUB 3N7JA 5F6LB 4XUPA 4CCLA 3PNAA 4PHZA 1DZTA 3T0DA 4AG4A 5F7UA 1RUI1 3MLJA 4UW5A 5HV0A 4AI8A 1W8OA 4FP2A 4XJWA 5IJRA 4KWLA 1S0CA 3M2MA 3C8XA 4QX3A 2QUOA 5E1RA 1H9WA 1RUC1 1CZTA 1OH4A 5FPBA 3AZWA 3KLSA 3UESA 5K8SA 5LA0A 5DDJ3 2J1VA 1AR91 3E5QA 1X82A 4YLZA 1O4YA 2JE9A 4YZ4A 4LIVA 2I74A 1XU2A 3U4XA 4XMAA 5DUWA 4CTEA 1J3RA 3H0OA 3W58A 3T08A 3H9AA 2DU0A 1KJLA 2PFWA 1AR63 3CMGA 4AQSA 5BXXA 2NP0A 5J09A 2YHJA 1DF0A 5ANNA 1O4TA 4MGSA 2Y6FA 3ZFFA 3IB3A 2LALA 4QXBA 5JOWA 1JUIA 4AEKA 2RJ2A 5SV8A 4K40A 1UPSA 3ZFEB 5FJKA 2VNRA 4HXCA 3RZLA 2PHFA 4NMIA 1HQWA 2AC1A 1W9FA 1UMIA 5J48A 1QJX1 2G9FA 1EYBA 1W8WA 2CGOA 2XONA 4QX8A 2Y34A 4CU6A 4LT5A 3HAGA 1HDKA 3N7KA 3J7HA 3U0ZA 3CZUA 4AFDA 5JCTA 4NUBA 4QKBA 1V6MA 5FK8A 1Z78A 5ABJB 3DUIA 3VBFB 3NWKA 3P3PA 4XF3A 4B4PA 4URAA 1X36A 2BGOA 2CWSA 4PBPA 1S0JA 3ZFEC 1PMHX 3DN7A 2YFUA 3TYJA 5DAPA 1H4HA 1AL22 4AI0A 1O59A 5E16A 1QKQA 2QQLA 5IW0A 2OPKA 4S2FA 3DXUA 4IGPA 4K6BA 4C1XA 1POV0 4XJZA 3UKNA 3W5MA 4QX7A 5ABJC 1OOPC 4PDWB 3VBFC 4DOUA 2VZUA 1KFUL 5LK5A 4RFT0 1J58A 2R072 2WQ4A 4M00A 2QDRA 1UU5A 3VDCA 3WP5A 2HKXA 3LA7A 3MW2A 4QB1A 3ZIWA 5IHRA 2ZX1A 3WDXA 4FO9A 3OBZA 1KEXA 3AZVA 2PQQA 1ZRRA 5C3SA 4BHPA 1C8M1 1VJ2A 2W1WA 3J26N 1DCSA 3I3DA 4QX0A 1VBC2 4NHMA 5FCCA 5FYYA 3I7DA 4XILA 2UWCA 1VAMA 1YQ6A 4XOGA 4PDWC 4ZXEA 4ATFA 3AK0A 4YARA 3ZFEA 4B8EA 4M3CB 3LF7A 4MGZE 4Y1YA 1AX0A 3VDBA 2P6CA 1VBB3 1GU3A 4LOTA 4XF4A 1NOVA 5FYSA 3VKOA 1HJFA 5I0DA 2VZPA 4Y22B 1SBEA 2WLQA 4W6XA 2C24A 2VH9A 1Y4WA 3FFQA 2GZWA 1LJ7A 1BZWA 2ZTNA 2CY6A 5ABJA 1OOPA 3VBFA 1MZ5A 1RMU3 2JG8B 4N8MA 4LO8A 2O1QA 3OJBA 3SHRA 4CP0A 1VBD3 2R6QA 2VQ0A 1UOGA 4IGQA 5FY0A 2QJVA 3SCFA 1RUJ1 1LOGA 1IQDC 3JCIA 3NJXA 3WXPA 1WCQA 4HK9A 2Q4SA 1KQRA 1GP4A 1Y9GA 1GQHA 4PLMA 4I0BA 3T0AA 3VHPA 2HEVF 1HRI1 2HWF1 4MXVA 3E5UA 4F8AA 4LKEA 2RS12 1Y9QA 2BV4A 4GJZA 4PDWA 3WG1A 2BEOA 2JG8C 2JE8A 3RMYA 2WLPA 1X9PA 1LU1A 3RG0A 2VNOA 3Q9OA 1K5MB 2BYVE 2UY9A 2ZGTA 5JWPA 3J8F3 3U78A 4KH9A 1L7LA 4XFHA 2ARBA 3OCPA 5HXMA 1QJY1 1EAH1 2ZACA 3N9NA 2K46A 3JD71 3FWEA 2FMDA 5FY4A 2EVXA 1R082 1JZ6A 1RUG3 1XXNA 5A7QA 4A2UA 1AX2A 1MVEA 5DMYA 5DDJ1 5LBFA 2XQXA 1WLWA 2C5DA 2IC1A 4L9BA 4OUEA 3SC7X 3VHRA 5I0SA 2FZ1A 3KF3A 4M3CA 5EWSA 5L9VA 1CWPA 5JR7B 5DAWA 5GM0A 5EHDA 5A7WA 4O61A 3RYPA 4AW7A 2R062 4TLFA 1VMJA 4XAEA 1LHOA 3FBMA 4Y22A 2NMNA 5CU1A 1VB2A 4BCUA 2D6PA 2WWJA 4AEJA 4Q4V1 5HCAA 3K77A 1XRUA 1C3HA 3OEBA 4A6OA 3N9MA 2JG8A 1PZ9A 3IN9A 3DPRB 3R05A 4LMFA 2L9LA 1RUH3 2WZR1 2OX0A 1NXD1 1CX1A 3ME2A 2YYOA 4YZ5A 3LEKA 1WW7A 1BEV3 4MXWB 3H8OA 2WO3A 3AFGA 2PLV3 2IVJA 1DIWA 4K8FA 3M3OA 1VRH2 5GLUA 1NY72 3KWVA 4GB32 4NPRA 2A3XA 3ZR6A 4MGKE 3QACA 4I09A 2VZ3A 4OCTA 1HB1A 5GZEA 1FAYA 3IIAA 2ZGUA 2NM1A 1R091 5FUIA 1Q8VA 4FQ4A 2DUOA 1HRV3 4QAWA 1ASJ1 4Q5OA 1QNYA 2LW8A 1EV12 1IG3A 2Q30A 4NWWA 4PI2A 3BODA 2NYYA 1YIFA 3WEZA 1RIRA 4DB5A 5F37A 5FMDA 4E2QA 5D8AB 1OLME 2BQPA 2F17A 4QGMA 4OQ8A 1WWYA 3USUB 3WW3A 4XAAA 1YFXA 1C1FA 1ULFA 3O0XA 1GWMA 3VBSB 5C9AB 3AM2A 1R1A2 4WM8B 4KBBA 4FBFA 4COVA 3LEGA 1ZZ9A 1QEXA 3PL0A 4DY3A 4PIXA 3C7GA 4MH0E 2Z79A 1A8DA 3I2KA 3POEA 1XBFA 4FPJA 1K3IA 2P3YA 2PAMA 2VECA 2ZEZA 4H7LA 4HVRA 3F95A 5ERLA 1BBT2 4RHV2 1IS6A 1NLSA 1LECA 1ZZ6A 2VU9A 5D8AC 4A42A 5FBZA 3RWNA 4DY5A 1I1EA 3H8UA 1S2KA 3AKPA 3AKRA 5GLVA 5DZEA 2HYXA 3VBSC 5C9AC 3AMQA 4WM8C 1S2EA 2XGXA 1G8WA 4YFWA 4HSJA 5F8PA 1VBB1 4MXWA 1AHSA 1JOPA 5D1IA 4A4AA 2D3RA 1J83A 2YV8A 1OFSA 3BN6A 2ZHKA 4KWKA 1F8VA 2PQSA 3VDDB 1DZQA 2RJLA 2VUCA 1W06A 5JDBA 5GLZA 1UD1A 4FXKB 5A7OA 1DQ6A 1SHWB 2Y60A 3VD7A 1RL3A 4AFMA 4JZRA 1N1SA 1VBD1 4GKXA 1PM7A 3S7IA 1RUD1 1ODMA 4DXTA 2D98A 3ZSJA 5FWJA 3PJQA 4NHYA 5FYMA 3RVHA 5FLIA 2ZGSA 4TWTA 4IDZA 1S0DA 3QH6A 4RQPB 3I2IA 1HB2A 4QXHA 5D8AA 1GKBA 1OI6A 2ZGNA 4XXPA 3VDDC 3KV9A 5C3QA 2DV9A 3K3NA 3KT7A 2BVVA 3USUA 3VDAA 3EJKA 5H9PA 1CX4A 4AGVA 3VBSA 2ZAHA 5C9AA 1NA1C 5C4WC 4WM8A 4D94A 5A32B 2RR13 5IK7A 3V0AB 2BNOA 3CF6E 2O8OA 1CAWB 3I3EA 3QLQA 5DUVA 1J3PA 1HN0A 3EB7A 2IZWA 4RQPC 4FP3A 4PLNA 1WGPA 3DKWA 4V2VA 1JZ4A 3O7OA 3I8TA 1NX9A 4XBQA 5FXXA 5FXZA 1RUC2 3SQOA 3KQ4B 3PUQA 3BI3A 4AGRA 3HNYM 1VBA1 1QIQA 4LO6B 4XZUG 1SLCA 3WX5A 1JU4A 5A1AA 3BB6A 2F6BA 1Z7S2 4M3CF 4Q1RA 2GC3A 3TN91 2WSVA 4GJYA 1LOBA 5AC93 1IKPA 1H1MA 4YGCA 3VDDA 2GMPA 2VCCA 2ES3A 1DBNA 2WN3A 4BB3A 2YC4A 2IVIB 1U5ZA 4AR2A 1NA1A 5F5AA 5C4WA 1RUH1 1G6NA 3R0RA 4ZPIA 3RPQA 3FMGA 4JDMA 2ZKNA 1M06G 1O5UA 3RZHA 5CKMA 3PUSA 3OBRA 1NE4A 4ONUA 5C3PA 4OI1A 3A0KA 1TVGA 2YBSA 2X05A 1KD7A 2D5FA 2D40A 3NV4A 4LQRA 4RQPA 1QU0A 5C3OA 3JBG3 3VV1A 3AXEA 1UY4A 2XHNA 3TEWA 3A22A 4P9GA 2AEZA 1SPPB 5CBLA 1L3JA 5A3NA 5JR2A 1CPNA 3ST7A 1D0GA 3IM0A 1AJOA 3AMPA 3ZXLA 3POIA 4YM3A 2EXJA 5A32A 2VZOA 1PVC3 3MEPA 1W8FA 2VMGA 4GAZA 4BE3A 2FDHA 1CAWA 3PUIA 1HRV1 4BQ1A 1GMMA 5IFPA 2JDPA 3B69A 1JW6A 1LESA 4O9GA 3WCRA 1ALYA 2F4PA 2LM3A 3MYXA 1Q56A 4E2SA 1Y7BA 4XF1A 1G9DA 2A75A 1H4GA 2XVLA 4BXSV 1NQJA 4CP9B 5A6QA 5KR7A 1UY0A 4YVWB 3ZDSA 1VAKA 2P3JA 3AXDA 3H8RA 2JXAA 5FLJA 5L9BA 4XIKA 2Y26A 1JUHA 2D6OX 4LBMA 4D0QA 3UT0A 1TZOA 3J4UH 3ZLIA 1YHFA 3ZPOA 3TWIA 5A1LA 4CUGA 1N47A 2FQPA 4IW3A 4TN7A 5FIXA 1GP6A 1PO22 3HJRA 4B7KA 1DGRN 2UYAA 4QQHA 1LOEA 3I2HA 4AFCA 4YVWC 2UY8A 4EN9B 5B4XA 4NO4A 5FZ8A 3G7DA 5DG2A 3O1RA 2P3IA 1KDKA 4LULA 4ZU4A 1SPPA 2E51A 3S7EA 5KC5A 3T2OA 5A80A 4S2DA 2VOKA 3FLTA 1LOAA 3AYDA 3RYRA 1W3XA 3SH4A 4LBNA 3IDAA 2ZX0A 1AL21 4N7IA 2VBDA 3CZJA 3ZYJB 4CP1A 4EZHA 1WBFA 5JSPA 1U12A 3E6CC 4P9LA 1QQP3 4P08A 4GMP0 1LU2A 1JYWA 1UQXA 3D0SA 3W59A 4EN0A 2WAAA 3NV2A 1W9WA 1H0BA 3WW2A 2ZCWA 1OT5A 3S5AA 3WDWA 5LY1A 4NHKA 3E97A 3SKVA 1QOSA 3IPVB 4CPBD 1FOD3 1UZYA 4XBLA 3CBNA 2GH8A 1HV0A 1W6QA 2Y0OA 3FE5A 3DCQA 4YVSB 4YVWA 3O14A 3MUZ1 5GZDA 1W04A 2Q1FA 1OKQA 3QBQA 4DQAA 4I02A 3DF0A 2BDRA 2X09A 3O1UA 2VZ1A 4Q4X3 4GWMA 2YROA 1S4CA 1VBC1 4AQ6A 5H9QA 2FDIA 1CR7A 1CD3G 2GC2A 2MPFA 4J25A 2I2SA 3S30A 5DDJ2 4IXLA 4YZ2A 1MS0A 4UOJA 2EIGA 3PIGA 4LBOA 4YVSC 3RYKA 3ELNA 2W92A 5FP4A 3U75A 4AVAA 1AYN3 3VN4A 5LA1A 1W8UA 3LWCA 4Y4YA 5I8YA 4UW6A 1PIV3 3K4DA 4F7ZA 2JDZA 3IAPA 5JPMB 2WKKA 3GCWA 3BALA 1AR62 3I2GA 4WVVA 4C91A 4CDUC 1FV3A 2WIIB 5K0UB 5M0TA 2WZEA 1SLAA 1OLRA 3H3LA 2HJIA 5A3LA 4IGOA 4JRLA 3VBRB 4YGEA 3R4UA 5CG9A 1FV2A 1SFPA 4FTSA 1OFNA 1Q8SA 3RRDA 2PHXA 1IOAA 1C1LA 2B9UA 5T52A 5IVCA 2HBUA 4JGZB 2QNKA 3W5NA 1W8NA 3V0BA 3IT8A 3K75B 3SNMA 3KHCA 3NVCA 4YPJA 1BHGA 1EPWA 2RS11 1GICA 1Z0HA 4FTBA 5KHHA 3AKQA 5K0UC 4QQLA 5ACA3 1VLNA 1PK6C 1DZRA 1H2LA 3FLPA 3H1YA 1UY1A 2XOMA 3ILRA 3IPVA 4L0PA 3VBRC 2RVAA 3KV4A 4YVSA 3FHAA 3HNMA 4LE3A 2WZPP 1PVC1 1LOCA 1Q8OA 3W20A 1OA3A 1XYPA 1YIPA 3PURA 5LB6A 4Q0VA 2VZSA 1GZWA 4JGZC 3UGGA 4Q8KA 3LFMA 1IGOA 2XL9A 2GH2A 4FXGB 2DVFA 4Q4Y3 5FZGA 4CDUA 1A34A 5CISA 3WP4A 2H6CA 3P6BA 4PIZA 4FPKA 2AYHA 1ULCA 1LB2A 3OD4A 3DEMA 2E6VA 2VY0A 3I2DA 2YBPA 2R061 4UW3A 4TLGA 2CSGA 4QT6A 4Y3OA 2HH9A 2YMZA 4P9JA 2CTVA 4XIOA 3KB5A 4Y5Z0 4BQYA 3B5LB 4AVSA 5K0UA 4D3WA 5CFCC 3LA2A 2Q1ZB 3HBZA 1PK6A 4Y5SA 3I3QA 3OB8A 1YO8A 4WBBA 1W6OB 3CNAA 3MF6A 4QX5A 1OQDA 4N9HA 3VBRA 2P17A 2V4VA 4BJ0A 2KM2A 1BXHA 4ITCA 3MIDA 4GWNA 2WWUA 4EWEA 5F3CA 2HWE3 3HQUA 5FV3A 4BZ4A 2ZGPA 3ZSEA 4JGZA 3V64A 2WT0A 4HN1A 1VBB2 2E31A 4FOYA 2W46A 3H1WA 1HX6A 1OLQA 4RS5B 1YQ8A 1N3OA 3MLLA 1VRH1 4FFGA 1NY71 4QPIB 1CONA 3O12A 4R9DA 4GB31 5KHGA 1XU1A 3U11A 4Z8BA 5FYVA 5FPZA 4IQPA 3Q8BA 1CAXB 4XFGA 2YB7A 2D44A 4UAPA 1T2XA 2Z4FA 2VOVA 1RMU2 1XNDA 2VW2A 2XVKA 3GHMA 3I4IA 4ISRA 3U4SA 4ZKTB 2Q1MA 3HMYA 3UJOA 1FYUA 2DCYA 1VBD2 2QQVA 1FX5A 2TBVA 4TYSA 3HT1A 1E5RA 3WG4A 4YM0A 4AVTA 1TNRA 2JB4A 2VUJA 2TNFA 5LWBA 1GANA 1UZWA 3NNLA 5I91A 1NAEA 5F3GA 3BU0A 3NJYA 4QPIC 3GBFA 1TME3 2D97A 2NPIA 4HKWA 5CFCA 2FZ2A 3HOBA 5KHIA 1ZRIA 1ZVFA 3K48A 1LEDA 4QPWA 3R6SA 1I5PA 3BIEA 2Q8OA 1G9CA 1R1A1 1L7QA 4XFAA 4XHXA 3SISA 4RGAA 1ZRDA 1NLRA 5HPOA 4GZ9A 1YI7A 3ETQA 3J8F2 3ZKYA 5FMOL 2JIJA 1WZXA 3RZJA 1EPZA 3U37A 4DINB 2EXHA 3KV5A 5FZ1A 5LA2A 4NR1A 2ATFA 4G3YC 5FO9B 2HWD3 4UT5A 1W0PA 1W6OA 1RUG2 5I0RA 3D8CA 2E53A 4AK3A 5FYTA 2Y6HA 3ZN6B 4BQ5A 1UKGA 3HR9A 5KHJA 4AHWA 4H3WA 4D8MA 1CAVA 2WZ8A 5HBAA 3ECQA 4OHZA 4A3XA 5CA6A 5FZKA 1PIV1 3MF9A 3S5QA 3JQWA 1YFYA 4QPIA 4XABA 5FPVA 3Q8EA 3NQHA 1REDA 3RS6A 3ZMOA 2V72A 2NN8A 1XYOA 2BVBA 1WLTA 3LZZA 2A6WA 2H0VA 3N35A 5TSWA 4JVAA 2EIDA 1CAXA 5A7NA 5BNPC 3A7QA 4OUMA 2W39A 2YFZA 2VTFA 4LITA 5HV4A 3K51A 3RQ0A 1RUH2 1WMDA 3C7EA 3K2OA 1MEC3 3O1PA 2ZEWA 2ZABA 1UXZA 1K45A 2VUDA 4JDOA 4OVEA 1BEV2 1QDOA 1POV3 4UI9L 2PLV2 3VBOB 2JICA 1G86A 4LPLA 4QKNA 5ACA1 1UPIA 2PMWB 1HB3A 1PZ8A 2OT7A 1IHMA 3O1VA 2RV9A 1H6XA 1IQAA 2OUJA 2PELA 5BYNA 2BTVC 5FFOC 5LK7B 3LOIA 5FZBA 1MS5A 1US2A 3WQBA 1SFYA 3EHKA 4XURA 2XKPA 4U36A 4NN0A 3WF3A 4LO5B 2VW0A 1HRV2 2JECA 4IV1C 2AH2A 2YG0A 4R9AA 3BKZA 4B3NA 4QX2A 3WHTA 3VBOC 4IEQA 3BUCA 1DHKB 2RS53 3I49A 1AUYA 3WF1A 5BNPA 2OIIA 1YC61 4XJAA 1YXWA 1YYNA 3O1SA 4R4XA 1WMEA 1J1LA 2JJ6A 2OZJA 4L92A 1U5YA 1Z7S1 2VMHA 3ZN6A 3ATGA 2FCVA 3A0NA 3ES4A 4XVHA 4MG2A 2YZ4A 4IE7A 2AREA 3MPBA 2DCZA 2VMIA 4QHBA 3T09A 1WCUA 1ZZ7A 1C5HA 3C7FA 1UYYA 2E63A 2TUNA 4CU7A 3V56A 1GOGA 2FDGA 4AEDC 1XQNA 1VRBA 2FDFA 2E7AA 2R49A 3PVOA 1X8MA 5F3IA 3HVDA 4OI0A 4YW7A 1GSLA 4Q0PA 1UIJA 3H8XA 4AHXA 1UN1A 4K1YA 2HWE1 2RMU3 2OQ7A 3POFA 1NXMA 4IV1A 2GC0A 1ENXA 1GP5A 5JVVA 3VBOA 5HXVA 1AYM3 1DQ4A 1ZNPA 4OZOA 1X9TA 1JZ5A 1GBGA 1O3RA 3OPZA 4CRQA 3ORJA 2QFEA 1GNHA 1OOPB 2ZEXA 1LKNA 4YYOA 4DEQA 2A6YA 3CJXA 4FPYA 3PJYA 1UCXA 5CVRA 2YGMA 4GXLA 2CGPA 5J3UA 4FOWA 2HWB3 4QPYA 2NZ9A 4Q29A 5CYYA 3MFAA 4NAMA 5FQ0B 4AEDA 1ZBE3 3AMHA 1TME1 3DGTA 3OUIA 4C8DA 5DUUA 1X50A 3B01A 4U2AA 1EUTA 2V5DA 2C26A 3I2OA 3ZIXA 4WV8A 3TRSB 5JSRA 3CQOA 4XUNA 5DG1A 1BKZA 4AE2A 3M4FA 2J1EA 2B42B 2RR12 5IUQA 3WHUA 4A7YA 2YDEA 1GWKA 2JE7A 3U14A 1LOFC 3MBWA 2QQJA 3WP3A 1HN1A 2ZGMA 1IPJA 4YM1A 5FYCA 4OHVA 2LS6A 4RSUA 1PO21 1UOJA 1LR5A 4LBLA 3OGGA 5B2GB 2W52A 4NROA 3N3HA 1HQLA 3ZXGA 4C90A 5BNOB 1IS4A 5T3NA 2A73B 2LTNA 4YNIA 2P37A 2ORZA 4XFCA 5EYYA 5A7WB 4XHBA 4E2GA 4XMIA 1MR5A 4RA0A 3LPFA 1V9U3 1SCRA 4DFSA 4Z2AA 2DBIA 5FZ0A 2EIBA 1DQ2A 4DO0A 4DEVA 1OKOA 2CYFA 2NMOA 2FHRA 4JAAA 4ZZ8A 3AP4A 3HBKA 4XUTA 4AI2A 5AC92 5JMOA 1NLQA 1RGSA 1QNWA 3O0WA 1JTZX 3POYA 3WD5A 2BOIA 4CXYA 4NIAA 5CB7A 4AVCA 2CU5A 2WDBA 5BNOC 2AENA 5FDBA 2YU2A 2K2SA 1QGLA 4CDWB 1I6XA 4XDPA 5A1FA 1D4M3 1H2NA 1WMFA 2LRPA 3CEWA 3F2ZA 4BQ3A 3K4AA 5FQ0A 2DCKA 1GQPA 2UYBA 3OTFA 1TQ5A 1LOFA 2EICA 2VVDA 4UFLA 4PQQA 4CYDA 2VCAA 4XCAA 3JBG2 5FYUA 4LHNA 2ERFA 4NVPA 3ZOIA 4QU2A 5DPNA 4AHZA 1KGYA 1YRZA 1UW8A 5C5TA 1AF9A 1VAVA 2D5HA 3NMBA 4TTGA 1AR73 1JYNA 3ZYRA 3KSCA 2WA3A 1PVC2 4CDWC 4Y5TA 3D5OA 5EJ1B 2ETEA 5IATA 2W1SA 3NJZA 4GA9A 2UURA 3BTYA 2BW8A 3LFIA 4JQTA 5JXGA 3EYPA 4QPGB 1UZ0A 1PM4A 4R9CA 3BYWA 4DXSA 3PTRB 2QQNA 4BQ2A 3EXUA 5FXWA 3MFCA 1REEA 4IEOA 4D6RA 5BNOA 4GH4B 2XJVA 4E27A 3ON7A 4RFRB 1ENSA 3K46A 2WS93 4Q26A 2W87A 1GZ9A 3LEMA 5GZFA 5C71A 3VL8A 3VBHB 1HXS3 3THDA 1F2NA 1AR61 1ZZBA 5DUXA 1NT0A 2KXLA 2PXJA 4FVVA 4QPGC 2XBO3 3ZXJA 1N1TA 1XYNA 1Q8PA 4BPZA 3WDVA 1QOOA 1US3A 3KHBA 5FO7B 5FK7A 2J42A 4GH4C 3TNPB 1UYZA 3NKGA 3OSDA 3VKMA 4CDWA 1W9SA 1G9FA 3JB4C 1ODNA 3KQRA 3PTYA 3VBHC 3ZYBA 1KS5A 2BERA 3AP9A 3L2YA 2OZ6A 2JDMA 3N9QA 5FY9A 3O1TA 3R4DB 5FAXA 2VNGA 1H1AA 1VB4A 3KGZA 3OPTA 4PLOA 3VZLA 2D43A 1A3KA 1COV3 1X8EA 1LRHA 5BPXA 3ZDVA 5BY5A 2AEYA 4IE0A 1MZEA 1W2UA 2B45X 1V6NA 2W3JA 4LUMA 4O65A 4LEJA 1F4AA 1DYPA 3OPWA 4XTMA 2OXBA 2ZX2A 5APAA 4N9IA 4Q4W3 2HWB1 2VMCA 1B35B 1W2AX 4XC9A 4XF0A 1WLCA 4PBOA 3HIFA 1AJKA 2Q0AA 1QQP2 5EJ3A 4QPGA 5J98B 4CSWA 1W6MB 3WVJA 2VTXJ 4QQ2A 1CIWA 3EBRA 4HETA 1W39A 1X33A 4C1WA 1W0OA 1RUE3 4LIUA 5I93A 4GH4A 4MX3A 5K4LA 4A45A 1WW6A 2VOTA 5FMCA 4B1MA 4COWA 4MZUA 1FOD2 1UZZA 5GKAC 4NHLA 4Q8LA 5FPXA 3VBHA 1BK1A 2DU1A 4XDQA 2UU8A 1B35C 1C28A 1XNBA 4AVBA 1J1TA 3CU7A 3IZOA 5FTTC 4XF9A 4HMZA 4Q4X2 2BBAA 4CCDA 1IS3A 3BIWE 3GGLA 2WFPA 1AXKA 3H7JA 4FOVA 4Z82A 5C3RA 2QDNA 1T6BX 2A6ZA 4LXLA 1XE8A 1QXPA 3OGRA 5FOJB 2JIGA 5FZ7A 1AYN2 3DYOA 1N3PA 4XTPA 1QDCA 2G9GA 3VZOA 4ES9A 4P9XA 4YZ1A 1PIV2 4FFIA 1WA4A 5FZLA 4B7EA 3AMMA 2IXKA 2BJSA 1O91A 4I0WB 3ZYPA 4N90A 1RMU1 1TMF3 1G9AA 2XVGA 5FZIA 1NA1B 5C4WB 5GALA 1CJPA 4UBHA 1IKQA 5J36A 1DG6A 1GFF2 3TAYA 3ROUA 3IMNA 4XUOA 1B35A 4FAGA 4GALA 5IAXA 1QJZA 2QBXA 5JOYA 1AXZA 1TG7A 1W6MA 4F3JA 4ASLA 3WSOA 3U1XA 1YQCA 2ZMNA 3MZHA 5IVEA 2HEWF 4HBNA 4M4RA 3DECA 5ACA2 4MUVA 5IFTA 3OD0A 4XYXA 4QB6A 3TEZA 1G9BA 5LBCA 4YW5A 3J8F1 5EJZB 3ZR5A 1XSRA 2VAUA 4LBQB 3TB0A 2W2IA 3A23A 4BM8A 2AUYA 1MZ6A 4UYBA 4CP2A 2XPJA 4PJYA 4GULA 4X6QB 2CWMA 5LEKA 1UAIA 1H30A 1BMV1 3AP7A 2QZ3A 4Q4Y2 1RUG1 4XXAA 1T6GC 5CFDB 1WD3A 3KV6A 4LKDA 1NYWA 5CIRA 1CAUA 1NG0A 3OG2A 1JHNA 1W9TA 1RVF3 3O1MA 1DGRA 2C6SA 3NAPB 1ULDA 1I3HA 5CNAA 4E4DX 4P5YA 3B02A 3PU3A 1DQ1A 3MIGA 1BCXA 2ZX3A 1JYCA 1OA2A 3MV01 2X10A 3PIJA 4V2WA 1W6NA 2PYTA 5CFDC 2MEV3 4BISA 2ZAAA 3MIHA 3AJYA 3QCWA 1GYKA 4FCAA 4UF0B 4RR3B 3WUCA 3NAPC 5IVVA 1LGBA 1RINA 3KGLA 4BA6A 2WUHA 2AZ5A 2HWE2 1WW5A 1BEV1 1XPWA 1J3QA 1O7FA 4OULA 3RJ2X 5JAXA 5E88A 2PLV1 1OD3A 2X5IC 3FN9A 4KG0A 5JIUA 4NPLA 4OZXA 4W4ZA 4I2OA 4NIDA 4K3UA 4PF5A 5F32A 5J96B 3DL3A 3UK9A 4CUCA 4KNCA 2R7EB 4K7JA 4LK7A 2KR2A 1SMVA 5CZKA 4BWOA 1KRIA 4AYUA 1A78A 3GZUC 5IWFA 3WDTA 4C0BA 4RR3C 4W6YA 4XZPA 4C0HA 5KXCA 4I01A 4AWDA 4DUXA 3DKQA 4LBQA 2FMYA 4HONA 3CL1A 4RGGA 2XWJB 1V6KA 4YGDA 2WNOA 2V09A 4A3ZA 2VR4A 4CCEA 2WC2A 4AAXA 1RUNA 4HZFA 2JDHA 4QMAA 4GKYA 4AI9A 5FZOB 5CFDA 1TME2 3RNSA 5F39A 3KVAA 4W65A 2J1RA 2B46X 1G7YA 2DCTA 2ZGRA 4NIGA 2RS33 3ZFGB 1J84A 1OQEA 1ZYBA 4FFHA 3T2QA 2JDUA 4A41A 5CAZA 4QM8A 3NAPA 5LBBA 1W6QB 4X8PA 2G4IA 1UY3A 3WF0A 3NV1A 4K9SA 4AFBA 4BQWA 2VM9A 1H1IA 2X5IA 1AX1A 2UWBA 1VP6A 3NO8A 3P5BA 1SLBA 4I0AA 4WVZA 4BYYA 1OH3A 1Q43A 2HWD2 1DYKA 3ZKUA 3T1MA 5FY7A 4EN7B 3ZFGC 4N53B 4QGNA 4QXKA 3URFA 4UF0A 5L7OC 3D82A 4RR3A 2XJQA 3HN1A 5CKQA 3MGUA 3WNNA 1DQ5A 1WCKA 2QE3A 3GZAA 3T0BA 3X29B 3WNKA 1A8MA 2Q8DA 1XNCA 2W47A 1OURA 3AYEA 3OY8B 4IEXA 3C7HA 4ISQA 1LULA 3QD6A 3E1F1 2RM23 2D6LX 1SCSA 2ZMLA 3AZXA 4XQWA 2ARXA 1URXA 2Z5WA 2P2KA 1OPOA 4AQ2A 2GNTA 3M70A 2QVSB 3H7YA 3S57A 2VNVA 4N53C 3UJQA 3PU8A 2O0OA 3IBMA 2EXKA 4WZCA 3MI8A 5A3MA 4L11A 1LGNA 2QQUA 4HT1T 4JKLA 5CKNA 1O3QA 3VZMA 1W2NA 1MEC2 1Q3EA 2BWAA 4JHTA 3CO2A 2D7FA 2K0GA 1W05A 4QKFA 2R043 2ZBJA 4AZZA 5FZOA 3V0BB 1U5XA 3B9CA 5T55A 1QH7A 1YUDA 3BVCA 5FYHA 1LCLA 1RTVA 3ZFGA 2YPDA 5L7OA 2VE1A 1NUKA 2PAKA 2QCSB 3T4HB 5FPUA
chains in the Genus database with same CATH topology
2RR11 3BU7A 4KU8A 4YM2A 1GZWB 1WLDA 1JBCA 4F83A 1OQ1A 1AR83 3BOPA 1ZX5A 2DTWA 2ET1A 4CDUB 2RS52 4CDXB 3WQ1A 4J6GA 4N53A 3TBDA 3OGJA 3N7MA 3PMEA 4FOQA 3AKTA 4B4RA 1GLHA 1QXJA 4LBJA 1VBE3 3ZSLA 3FJSA 3OY8A 1DFQA 4JQRA 4EWAA 4QQOA 4JRAA 5AC91 4OFGA 1YWKA 3MW4A 5C8WA 2DUQA 1GZCA 3VBUB 2HWC3 1SACA 2A7AA 1JH5A 4HSLA 2ZGQA 4CDXC 5KWRA 1LODA 1PK6B 5FMOS 2WFF3 3PVBB 1LEMA 3VKFC 4G4FA 3ZXDA 3THTA 1RUF3 2VOXA 1CPMA 1S0IA 2VVFA 4NOTA 1DU3D 1LHNA 2RMU2 2Z69A 3ZYGA 4Z92B 2IXHA 4M3CE 3JBG1 3VBUC 1AYM2 3EQEA 1LENA 2X8KA 3CJIB 2VW1A 5I8SA 5E89A 5HCFA 3VHNA 4UBGA 3ZN5A 4IV3B 3LOBA 1FPN3 4FTEA 4D7SA 1UU4A 3MPPG 2O8QA 2XB6C 2R0FA 3MW3A 2HWB2 3C2UA 2ZX4A 2OYZA 3S0MA 1ZBE2 4CDXA 3L9JT 5CFCB 3CJIC 2A5ZA 2XLFA 3D0JA 3WW1A 5BNQA 1ZBA3 1QJU3 4IV3C 1S2BA 1GNZA 1FMD3 2BBVA 3ZXAC 3OF1A 2BWCA 3ACLA 3M7AA 1PNGA 3ZXKA 1S55A 3GBWA 3VBUA 3KS7A 1RUI3 3GBGA 5IT6A 3ALQA 1KFXL 2BUKA 4AHYA 3AZZA 3H3ZA 1PO12 1AR93 3BTAA 3RZZA 5KXDA 1F5JA 4HFSA 1QF3A 4K20A 3FC0A 1CAVB 3ZYIB 1RC6A 3ZSKA 1V9U2 2VGDA 4YW1A 1J59A 3E6DA 2W08A 3WDYA 2X29A 3M3IA 3FZ3A 2DCJA 3CJIA 1UX6A 2WT1A 1RHI3 2IWGB 2JKBA 4IV3A 1KS4A 1WCDJ 3FLRA 1CVNA 1V6JA 1PNFA 4QQPA 4QD2A 4IEUA 3LCPA 1D4M2 1QQP1 2QKDA 4M01A 4QGLA 1UF2C 3DV8A 4Y1UA 2GAUA 2FBEA 3UL2A 1V6IA 3I54A 2DF7A 2X53S 3ZMNA 4E4ZA 5AVPA 1SDWA 4NWVA 3J9SA 3WW4A 3MLKA 1FOD1 2NLRA 1UU6A 3B00A 4IEYA 2VG9A 2W0XA 1AR72 3KZ4C 4HVQA 4ORFA 3KCXA 2ZHMA 1ENQA 4LHLA 4OHXA 4JV4A 3WINE 4HVOA 4Q4X1 3THPA 5KXEA 1CN1A 3AZYA 1GQGA 5BNPB 1TEIA 2IXLA 1BMV2 2CAVA 2VQAA 3SXWA 3OBTA 4YG0A 2RHPA 4EV0A 1NQDA 4FPOB 1AYN1 3NKTA 4FQZA 1RUOA 2WS92 5DXDA 3SMHA 2GMMA 1HXS2 4JTNA 1MVQA 1H9PA 3SITA 4O9EA 1OMIA 4HLTA 3INAA 2XBO2 1PVXA 2ET7A 1C8M3 4L97A 2GMEA 2WNVB 4E4SA 1KDMA 2Q5TA 4IEPA 4R9BA 5HCBA 2CV6A 4R4ZA 1HLCA 3QH7A 3FFZA 1LHWA 4MV2A 4IV1B 1V70A 4XFFA 1PMIA 4Y1XA 3RSJA 1SLLA 5LEJA 1COV2 5H9RA 1F5FA 4HPKB 1ZRCA 2B7YA 3C3VA 4HKOA 3W9AA 2WNVC 2VUAA 4DRVA 2V5YA 2P34A 2WA4A 1WBLA 1ENRA 2XJSA 1JN2P 5EZWA 5C8CC 1MS3A 2P3KA 2BFUL 1RUJ3 4Q4W2 1QWRA 2OW4A 2DTYA 2ZHLA 4AEDB 4Q4Y1 5FLHA 5IK5A 5JI7A 2QQPA 3WV6A 1TNFA 1HRI3 2HWF3 1RUE2 2R1BA 4XFIA 3WNXA 3WDUA 3JB8A 1FMD1 2VOWA 1FT9A 4JCKA 4BOWA 2BNMA 4XJ9A 3MDPA 2XH6A 4LTAA 1OSGA 3JZVA 1QJY3 2Y0IA 1EAH3 2ZJCA 4KGGA 4XEZA 1I9RA 3JD73 2DYCA 3B7MA 1PHMA 1X7NA 2WNVA 2WWSA 2E7QA 1YJKA 5C8CA 1UL9A 2GU9A 3WR0A 3ILFA 1YFWA 3B9IA 5I8TA 2A71A 3KD4A 4HK8A 5T5JA 5AVAA 3ENRA 5JLVA 5JPNB 4HPKA 4Q4V3 4LE4A 1RHI1 4V1PA 4A7KA 1TMF2 5EXOA 3PHMA 3KMHA 4PQ9A 4H14A 2WZR3 3IKWA 2A6VA 2XLGA 3G6JB 5T50A 3WZ1A 3POWA 2N7GA 1RJ7A 4OLLA 5GZCA 2VPVA 3SLIA 3R4SA 4E9KA 3WQ7A 3L2HA 1C5IA 2XJTA 4BMBA 5C33A 5JSOA 1R093 1V6LA 4BMEA 4J1XA 4COZA 1ASJ3 2HWD1 2Z42A 3VUOA 3LB9A 1LHVA 1PO13 1VALA 2PHTA 2WT2A 2IXIA 1RVF2 4FPLA 4D7TA 2CL2A 3KT4A 2TEPA 3I59B 3KCCA 4COUA 1MS8A 2AR6A 3WG2A 3GHNA 4XBNA 3SCGA 4WM7B 1HKDA 4BIOA 1MS9A 2XKOA 1ZM1A 2MEV2 4DRRA 2DUPA 1MEC1 1PGW2 1W6PB 1AZDA 5F5QA 4DPNA 1D2SA 3ASIA 4MGIE 3FUQA 1POV1 2DFCA 2PHUA 1MQTB 2GDFA 3OYWB 4MLOA 5JI9A 2BNNA 2EXIA 1E57A 4WM7C 2VVEA 4YFZA 1Q8QA 5C6CA 2ZA9A 1NE6A 4LO4B 1O5LA 2E9QA 2D3SA 3LAGA 1GV9A 2XJPA 5FOBB 4SBVA 2JX9A 5AFBA 4AQTA 2JD4A 4IEWA 4FPHA 1RUD3 4Z07A 1MQTC 3AP6A 4LBKA 5I0UA 2HYKA 2RS51 1D0HA 3AX4A 5IK8A 3P3NA 5T5LA 3B3QE 1IPKA 4JGYB 2BGCA 1Y3TA 5GJ6A 3ZN4A 4AGGA 2RS32 3I59A 4OHWA 2OA2A 1FXZA 3FHIB 5J7MA 5T5OA 3WUDA 1SLTA 4DS0A 5LRRA 4CEWB 4WM7A 3U10A 1PGL1 3SCHA 4YW2A 2B5HA 3VZNA 4JGYC 1RITA 4OI2A 1SEFA 1VBA3 2RE9A 1DLLA 2RMU1 1W6PA 4Z2WA 4X8NA 3D6EA 1K5MC 2GC1A 1MQTA 3OYWA 3QOPA 3TN93 1AYM1 2RM22 4CEWC 3ILNA 3M8LA 3WP6A 4L8QA 2ZPXA 4DNYA 2XHKA 3PLQA 4FPCA 5CG8A 5L73A 1N1VA 2K9ZA 4YGBA 5H9SA 4LA3A 4WVWA 3NW4A 1ZBE1 3POSA 2R042 5BUVA 1O3TA 2DFBA 4JGYA 4L99A 1I5ZA 3WT3A 1NCRB 4ES8A 5CADA 3PVEA 2YC0A 1YCIA 2R1DA 2JEMA 2IXCA 4S2GA 3DPRC 4FT8A 3BOWA 5FREA 3MIFA 1K5MA 4IERA 1YJLA 4CEWA 1DGWX 5KC6A 1AR82 4IEVA 3A4UA 1TE1B 4KL1A 1NCRC 1PO11 1CAUB 4HN0A 4ZU5A 4EN6B 4KGQA 1VBE2 1PGSA 1WD4A 1V9U1 4WZFA 2Z2SB 3AP5A 2HWC2 3PMSA 2D6KA 1W6NB 3RJRA 3VKLA 2B8MA 3RI9A 2GN3A 2WFF2 4P9WA 5L36A 1SQ4A 2DVAA 3DPRA 3USSA 1KITA 2R30A 4G9SB 4XW3A 1RUF2 2I45A 1D4M1 4P9IA 3ZPYA 2D3PA 1ZZ8A 1QMJA 4MSVA 3RI8A 3AJZA 2WNEA 1LHUA 1NCRA 3IWZA 1VR3A 1MS4A 5FO8B 4D69A 1AR71 4EJRA 4EROA 1QXRA 1HW5A 5DZFA 3H3UA 2XWBB 1FPN2 4LLFA 3APBA 1AL23 4XJUA 4RD7A 4MVTA 5T5PA 4P14A 1C4RA 5EFUA 5E8AA 2AGSA 3WOGA 4XETA 4INDA 5FRAA 4Q0QA 3ZVXA 4ASMB 3WG3A 1N3QA 1ZBA2 2R16A 3N7LA 4YRDA 1YLLA 1QJU2 2WS91 2QZ2A 1FMD2 4TSVA 2R073 1S1AA 1HXS1 2ZGOA 1U0AA 2X5IB 2YUEA 4D7YA 1YI9A 2GALA 2PHWA 3H50A 4RSUA 2XBO1 3LSEA 3VLBB 1RUI2 2RJKA 3T1LA 4AXOA 4BLJA 5K9YA 1S0FA 5I0TA 1CGPA 4FSJA 1VBC3 1IZ3A 1CJDA 3FBYA 2W68A 4YW3A 4GMP3 3ZX7A 1RB8G 1AR92 3RDIA 2A6XA 1V00A 3H1MA 1Q5OA 1F9KA 2GN7A 1PZ7A 4FPGA 3VZJA 4PCRA 4Y24A 5JIAA 1COV1 2MNGA 3NL1A 3KM5A 2WSUA 4TZDA 1V6OA 4AEMA 3WY6A 4YG3A 1RHI2 1C8NA 1DDLA 4GQ7A 4ZU7A 3UKTA 2IFWA 5AFEA 1C57A 4IEZA 2EAAA 4Q4W1 2XL7A 3TNQA 3O0VA 5IK4A 3AKSA 1ZRFA 3M3QA 2HEYF 1ND2B 1QJX2 2EF6A 3E6BA 1BVVA 1RJ8A 1N1YA 1QH6A 1RUE1 2RS13 5KBFA 4M0NA 1FNYA 5L7OB 4K21A 1EP0A 4IL7A 5GLWA 4EWDA 1QY4A 2UWAA 2PHDA 2YGLA 5DZGA 3V0AA 1SBFA 1OPMA 2H0BA 4JDNA 3HWJA 4FAHA 2D6MA 1ND2C 1XE7A 4AI3A 3FX3A 1GR3A 1R083 1OA4A 2SLIA 4W6WA 2CNAA 1DQ0A 2V73A 3BPZA 4Y1VA 2R32A 2I07B 2R063 4QM9A 2E7TA 2EAKA 2WJSA 3N36A 2VXRA 2C0ZA 1JOJA 2R0HA 4H7MA 2XLAA 3VZKA 4Q1PA 4URTA 5F9TA 3BCWA 2DVGA 3LSDA 4WVMB 1EY2A 3KCYA 4RL7A 4BH9A 1TMF1 3CLPA 1C8M2 3T2TA 2XUMA 5BV6A 2H6BA 2PTMA 1R1ZA 1VIWB 4N43B 5LRSA 4LHKA 1O3SA 2WQZC 3GALA 2A3YA 4JC1A 1ND2A 2ZZQA 4IESA 1O4ZA 2OVUA 1VRH3 4DXZA 4GB33 5BNNB 2ZS6B 1AVBA 4COYA 3JUUA 3AMNA 1FI2A 1BYHA 3M3CA 4MYEA 4LR4A 2WINB 4N43C 4XFBA 4OI4A 3ZSMA 4X6RB 3U07A 1RUJ2 2OUHA 3NSTA 1M4WA 1EV13 2ZKLA 3NV3A 1S0GA 1ONAA 2ZZJA 5BNNC 3O5SA 2PHRA 1CQ9A 2Y38A 1RVF1 4OUSA 4XPVA 1HRI2 2HWF2 2NQYA 4Y1ZA 1R1A3 3GYDA 2XG3A 2ILMA 2R071 4UW4A 3MICA 5GZGA 3MIBA 1HQNA 4WVMA 1PGL2 1QJY2 2MEV1 1BBT3 1EAH2 4RHV3 3N4MA 1MS1A 3JD72 1APNA 2XJUA 2YPJA 2ZGKA 2IXJA 1UKRA 1PGW1 2JENA 4GMP1 4L2NA 3HQXA 4N43A 4JTOA 3GNEA 4Q2FA 5J37A 2A70A 1UIKA 2EALA 3MIEA 3ES1A 4CEYB 4XE9A 3WQ0A 4AVVA 5K7PA 3V65A 2PA7A 1BVP1 2C1FA 5BNNA 3B94A 3GF6A 5GLTA 3VHOA 5SV5A 3LKJA 4Q4V2 1WUVA 1REFA 1IS5A 5JOXA 1H8VA 1H2KA 4KQ7A 1SLIA 1ZA4A 2WZR2 3AB0A 1BJQA 5F1RA 1ZREA 3TOJA 4CEYC 1AL0G 1F31A 1LTEA 1SBDA 1LGCA 1HIXA 2RS31 3SH5A 3B93A 3IDEA 2ZGLA 4LLOA 1ZZCA 4AFAA 3IDCB 4OHYA 5A33B 4HKLA 1ND3B 4FPFA 1R092 4LBQD 4P9YA 2C9AA 4N7UA 1H8TB 5EV7A 4YW4A 3SH3A 1ASJ2 4J1WA 3HD8B 1R081 1RUC3 1HV1A 2BFUS 4B29A 2ZMKA 1D2QA 3M1HA 4BLIA 3M3EA 5KXBA 2ZOEB 3UV9A 1QOTA 1Z7S3 1KXGA 1UMZA 4R52A 3ZO0B 1Y43B 4KWJA 1ND3C 2RM21 4CEYA 4Y20B 4HL0A 3WCSA 4HANA 1H8TC 3AYCA 4H55A 2WNUB 1SFNA 2D93A 1BQPA 4CDQB 1WCSA 4YSFA 2JG9B 4GIQA 4KU7A 3JU9A 5EYXA 4UXAA 4ZXKA 4LA2A 1JXNA 2LUWA 2ZHNA 4Q0UA 2GNDA 3VKNA 1FNZA 4Y26A 2XJRA 2R041 3UKVA 5JOZA 1QJX3 4M0HA 2WNUC 2YXSA 5KHKA 4B4QA 4LUKA 4CDQC 4R8HA 1XNKA 2JG9C 2MHFA 3S6PA 3E5XA 3KT1A 2CGNA 4Q0SA 3LGRA 2BPA2 4YG6A 5A33A 5JZGB 1KJRA 4CZSA 1ND3A 1B09A 2VULA 3HT2A 4KG8A 2DVBA 1RUD2 1AXYA 3RMXA 1H8TA 1AR81 1NCQB 1EV11 3D4KA 4I3PA 4RS5C 4Z1VA 1D4VB 3GZTB 5HI0A 3EO6A 4DZGA 4XQDA 1JYIA 2YY1A 1ULGA 2CAUA 2IFRA 3ZXFA 1VBE1 1ULEA 4K1ZA 1H2MA 1OHFA 2PAEA 5JZGC 1DGLA 2EA7A 1YFUA 3AYAA 4I3GA 4LO7A 2KA3A 4Y20A 4P5HA 5F6KA 3LA3A 2PN5A 1NCQC 2HWC1 2WNUA 2DWRA 1QHDA 3IDBB 1BBT1 2GSYA 4RHV1 4CDQA 1DGWA 2JG9A 2WFF1 5T54A 1FATA 4XJ8A 4ATEA 4XQ4A 2ENRA 4AF9A 2B39A 1PO23 2DURA 1RUF1 1VBA2 4AI1A 4EN8B 5C8CB 4BIFA 1MACA 2GNMA 1YNAA 4RS5A 3TN92 1S0BA 4FPEA 3WLUA 1OD5A 1WW4A 3ZXEA 3JQXA 4YZ3A 4S2HA 1CESA 1S0EA 4A7ZA 3VGIA 2WL1A 3ZFFB 4META 4DMIA 1FPN1 1NZCA 1U5IA 5JZGA 5L19A 2A3WA 3PVNA 1A6CA 4MGYE 1NCQA 4IETA 1MZFA 2GNBA 4I30A 2SBAA 2PHLA 5JMCA 2DVDA 1ZBA1 1QJU1 3ZFFC 3FUOA 4LNVA 2D6NA 4PIYA 4Q27A 3VL9A 3AFKA 3N7JA 5F6LB 3PNAA 1DZTA 4AG4A 1RUI1 3MLJA 4UW5A 4AI8A 4FP2A 4XJWA 4KWLA 1S0CA 3M2MA 2QUOA 5E1RA 1H9WA 1RUC1 3AZWA 3KLSA 5K8SA 5DDJ3 1AR91 3E5QA 1X82A 4YLZA 1O4YA 2JE9A 4YZ4A 2I74A 1XU2A 3U4XA 4XMAA 5DUWA 4CTEA 1J3RA 3H0OA 3W58A 3H9AA 2DU0A 1KJLA 2PFWA 1AR63 4AQSA 5BXXA 2NP0A 5J09A 2YHJA 1DF0A 1O4TA 3ZFFA 2LALA 5JOWA 1JUIA 4AEKA 5SV8A 4K40A 1UPSA 3ZFEB 2VNRA 2PHFA 1HQWA 5J48A 1QJX1 2G9FA 1EYBA 2CGOA 4LT5A 3HAGA 1HDKA 3N7KA 3U0ZA 4AFDA 5JCTA 1V6MA 1Z78A 5ABJB 3DUIA 3VBFB 3NWKA 3P3PA 4XF3A 4B4PA 1X36A 2CWSA 4PBPA 3ZFEC 1S0JA 3DN7A 3TYJA 1H4HA 1AL22 4AI0A 5E16A 1QKQA 2OPKA 4S2FA 4K6BA 4C1XA 1POV0 4XJZA 3UKNA 5ABJC 1OOPC 4PDWB 3VBFC 4DOUA 1KFUL 5LK5A 4RFT0 1J58A 2R072 2WQ4A 4M00A 2QDRA 1UU5A 3WP5A 2HKXA 3LA7A 3MW2A 3ZIWA 2ZX1A 3WDXA 4FO9A 3AZVA 2PQQA 1ZRRA 4BHPA 1C8M1 1VJ2A 3J26N 5CAZA 5FCCA 1VBC2 4NHMA 3I7DA 4XILA 2UWCA 1VAMA 4XOGA 4PDWC 4ATFA 3AK0A 4YARA 3ZFEA 4B8EA 4M3CB 4MGZE 4Y1YA 1AX0A 1VBB3 4XF4A 1NOVA 3VKOA 4Y22B 1SBEA 2WLQA 4W6XA 2VH9A 3FFQA 2GZWA 1LJ7A 1BZWA 2ZTNA 2CY6A 5ABJA 1OOPA 3VBFA 1MZ5A 1RMU3 2JG8B 4LO8A 2O1QA 3OJBA 3SHRA 4CP0A 1VBD3 2R6QA 2VQ0A 2QJVA 3SCFA 1RUJ1 1LOGA 3JCIA 3WXPA 4HK9A 2Q4SA 1KQRA 1GQHA 4PLMA 4I0BA 3VHPA 4F8AA 2HEVF 1HRI1 2HWF1 4MXVA 3E5UA 2RS12 1Y9QA 4PDWA 3WG1A 2BEOA 2JG8C 3RMYA 2WLPA 1LU1A 3RG0A 2VNOA 3Q9OA 1K5MB 2BYVE 2UY9A 2ZGTA 5JWPA 3J8F3 4KH9A 4XFHA 2ARBA 3OCPA 1QJY1 1EAH1 2ZACA 3JD71 3FWEA 2FMDA 2EVXA 1R082 1RUG3 1XXNA 4A2UA 1AX2A 1MVEA 5DDJ1 3VHRA 1WLWA 2C5DA 2IC1A 4L9BA 5I0SA 2FZ1A 4M3CA 5EWSA 5JR7B 5GM0A 3RYPA 4AW7A 2R062 4TLFA 1LHOA 3FBMA 4Y22A 2NMNA 5CU1A 1VB2A 4BCUA 2D6PA 4AEJA 4Q4V1 5HCAA 1XRUA 1C3HA 2JG8A 1PZ9A 3IN9A 3DPRB 3R05A 1RUH3 2WZR1 1NXD1 3ME2A 2YYOA 4YZ5A 1WW7A 1BEV3 4MXWB 3AFGA 2PLV3 1DIWA 4K8FA 3M3OA 1VRH2 5GLUA 1NY72 4GB32 4NPRA 2A3XA 4MGKE 3QACA 4I09A 5GZEA 1FAYA 3IIAA 2ZGUA 2NM1A 1R091 1Q8VA 4FQ4A 2DUOA 1HRV3 1ASJ1 1QNYA 1EV12 2Q30A 4NWWA 3BODA 2NYYA 1YIFA 1RIRA 4DB5A 4E2QA 5D8AB 2BQPA 4QGMA 3USUB 3WW3A 1YFXA 1C1FA 1ULFA 3O0XA 3VBSB 5C9AB 3AM2A 1R1A2 4WM8B 4KBBA 4FBFA 4COVA 1ZZ9A 4DY3A 4PIXA 4MH0E 2Z79A 1A8DA 4FPJA 4H7LA 2PAMA 2VECA 4HVRA 1BBT2 4RHV2 1IS6A 1NLSA 1LECA 1ZZ6A 2VU9A 5D8AC 4DY5A 5FBZA 3RWNA 1I1EA 3H8UA 1S2KA 3AKPA 3AKRA 5GLVA 5DZEA 3VBSC 5C9AC 3AMQA 4WM8C 2XGXA 1G8WA 4YFWA 4HSJA 1VBB1 4MXWA 1AHSA 5D1IA 2D3RA 2YV8A 1OFSA 2ZHKA 4KWKA 1F8VA 3VDDB 1DZQA 2RJLA 5JDBA 5GLZA 1UD1A 4FXKB 1DQ6A 4AFMA 1RL3A 1N1SA 1VBD1 4GKXA 1PM7A 3S7IA 1RUD1 2D98A 3ZSJA 3PJQA 5FLIA 2ZGSA 4TWTA 1S0DA 3QH6A 4RQPB 5D8AA 1GKBA 1OI6A 2ZGNA 4XXPA 3VDDC 2DV9A 3KT7A 2BVVA 3USUA 3EJKA 5H9PA 1CX4A 4AGVA 3VBSA 2ZAHA 5C9AA 1NA1C 5C4WC 4WM8A 4D94A 5A32B 2RR13 5IK7A 3V0AB 2BNOA 3CF6E 2O8OA 1CAWB 3QLQA 5DUVA 1J3PA 2IZWA 4RQPC 4FP3A 4PLNA 1WGPA 3DKWA 3O7OA 3I8TA 4XBQA 1RUC2 4AGRA 1VBA1 4LO6B 1SLCA 3WX5A 3BB6A 2F6BA 1Z7S2 4M3CF 4Q1RA 2GC3A 3TN91 2WSVA 1LOBA 5AC93 1IKPA 1H1MA 4YGCA 3VDDA 2GMPA 2ES3A 1DBNA 1U5ZA 1NA1A 5C4WA 1RUH1 1G6NA 3R0RA 3RPQA 1M06G 3FMGA 4JDMA 2ZKNA 1O5UA 3OBRA 1NE4A 4ONUA 4OI1A 3A0KA 1KD7A 2D5FA 2D40A 3NV4A 4RQPA 1QU0A 3JBG3 3VV1A 3AXEA 4P9GA 5CBLA 1L3JA 1CPNA 3ST7A 1D0GA 3IM0A 1AJOA 3AMPA 3ZXLA 4YM3A 5A32A 2EXJA 1PVC3 3MEPA 2VMGA 4BE3A 1CAWA 1HRV1 4BQ1A 3B69A 1JW6A 1LESA 4O9GA 3WCRA 1ALYA 2F4PA 2LM3A 3MYXA 1Q56A 4E2SA 1Y7BA 4XF1A 1G9DA 2A75A 1H4GA 2XVLA 1NQJA 4YVWB 3ZDSA 1VAKA 2P3JA 3AXDA 2JXAA 5FLJA 4XIKA 2Y26A 1JUHA 2D6OX 4LBMA 3J4UH 1YHFA 3TWIA 1N47A 2FQPA 1PO22 4B7KA 1DGRN 2UYAA 4QQHA 1LOEA 4AFCA 4YVWC 2UY8A 4EN9B 4NO4A 3G7DA 5DG2A 2P3IA 1KDKA 4LULA 4ZU4A 5KC5A 2E51A 3S7EA 4S2DA 2VOKA 3FLTA 1LOAA 3AYDA 3RYRA 3SH4A 4LBNA 2ZX0A 1AL21 4N7IA 3ZYJB 4CP1A 3E6CC 1WBFA 5JSPA 1U12A 4P9LA 1QQP3 4GMP0 1LU2A 3D0SA 3W59A 4EN0A 3NV2A 1H0BA 3WW2A 2ZCWA 3WDWA 4NHKA 3E97A 1QOSA 3IPVB 1FOD3 1UZYA 4XBLA 2GH8A 1HV0A 1W6QA 2Y0OA 3FE5A 4YVSB 4YVWA 3O14A 5GZDA 3QBQA 1OKQA 4DQAA 4I02A 3DF0A 4Q4X3 4GWMA 2YROA 1VBC1 4AQ6A 5H9QA 1CR7A 1CD3G 2GC2A 2MPFA 2I2SA 3S30A 5DDJ2 4IXLA 4YZ2A 1MS0A 2EIGA 4LBOA 4YVSC 3RYKA 3ELNA 4AVAA 1AYN3 3VN4A 3LWCA 4Y4YA 5I8YA 4UW6A 1PIV3 4F7ZA 2JDZA 5JPMB 2WKKA 3BALA 1AR62 4WVVA 4C91A 4CDUC 1FV3A 2WIIB 5K0UB 1SLAA 1OLRA 2HJIA 5A3LA 4JRLA 3VBRB 4YGEA 3R4UA 5CG9A 1FV2A 4FTSA 1OFNA 1Q8SA 3RRDA 2PHXA 1IOAA 1C1LA 2B9UA 5T52A 4JGZB 2QNKA 3V0BA 3IT8A 3SNMA 3NVCA 1EPWA 2RS11 1GICA 1Z0HA 4FTBA 5KHHA 3AKQA 5K0UC 4QQLA 5ACA3 1VLNA 1PK6C 1DZRA 1H2LA 3FLPA 3H1YA 3ILRA 3IPVA 3VBRC 4YVSA 4LE3A 2WZPP 1PVC1 1LOCA 1Q8OA 1OA3A 1XYPA 1YIPA 4Q0VA 1GZWA 4JGZC 4Q8KA 1IGOA 2XL9A 2GH2A 4FXGB 2DVFA 4Q4Y3 4CDUA 3WP4A 2H6CA 4PIZA 4FPKA 2AYHA 1ULCA 1LB2A 3OD4A 2E6VA 2VY0A 3I2DA 2R061 4UW3A 4QT6A 2YMZA 4P9JA 2CTVA 4XIOA 3KB5A 4Y5Z0 3B5LB 4AVSA 5K0UA 4D3WA 5CFCC 3LA2A 2Q1ZB 3HBZA 1PK6A 1YO8A 4WBBA 1W6OB 3CNAA 3MF6A 4QX5A 1OQDA 4N9HA 3VBRA 2P17A 2KM2A 1BXHA 4ITCA 3MIDA 4GWNA 4EWEA 2HWE3 4BZ4A 2ZGPA 3ZSEA 4JGZA 3V64A 2WT0A 4HN1A 1VBB2 4RS5B 4FOYA 3H1WA 1HX6A 1OLQA 4SLIA 3MLLA 1N3OA 1VRH1 1NY71 4QPIB 1CONA 3O12A 4R9DA 4GB31 5KHGA 1XU1A 3U11A 4Z8BA 5FPZA 4IQPA 1CAXB 4XFGA 2D44A 2VOVA 1RMU2 1XNDA