1XNBA

High-resolution structures of xylanases from b. circulans and t. harzianum identify a new folding pattern and implications for the atomic basis of the catalysis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
185
structure length
185
Chain Sequence
b'ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title High-Resolution Structures of Xylanases from B. Circulans and T. Harzianum Identify a New Folding Pattern and Implications for the Atomic Basis of the Catalysis
rcsb
source organism Bacillus circulans
molecule tags Glycosidase
total genus 52
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1xnbA00
4XQ4A 1UU5A 3AKSA 2JICA 3HD8B 2Z79A 4HKOA 3O7OA 1H0BA 1UKRA 1OA2A 3AMPA 1PVXA 3VZJA 4H7MA 1BCXA 1F5JA 1OA4A 4HKLA 1ENXA 2BVVA 3WP6A 3ZSEA 3VZKA 3AMQA 3WP5A 3WT3A 3MFAA 3AKTA 2QZ2A 1REDA 3VHPA 1H8VA 1XYPA 1C5IA 3MF9A 1UU6A 2JEMA 3WP3A 2NLRA 1NLRA 1C5HA 3AMHA 2DCJA 1QH7A 4XQWA 5EJ3A 2BWCA 3M4FA 3B7MA 4HK8A 1IGOA 2D98A 4HK9A 3AKPA 5K7PA 3VGIA 2VUJA 3AKRA 3WQ7A 1M4WA 3LB9A 3VZLA 3VL9A 3WXPA 1QH6A 1AXKA 4HKWA 2B46X 1H4GA 2B42B 1REFA 1W2UA 2BW8A 4S2FA 5K9YA 3MFCA 3VZNA 3WX5A 4S2DA 3VL8A 2DFCA 3WP4A 1T6GC 3RI9A 3WQ1A 1HV0A 2NQYA 1BK1A 2DCKA 3MF6A 2DFBA 1YNAA 2D97A 2QZ3A 3VZMA 1XNBA 4XPVA 3AMNA 1HV1A 2DCYA 1BVVA 2VULA 1OLQA 1XYOA 1XYNA 2DCZA 4XQDA 3WR0A 3WY6A 1KS5A 1H4HA 3AKQA 4NPRA 1XXNA 1OLRA 2VGDA 3AMMA 5HXVA 2B45X 1XNKA 3EXUA 2JENA 1OA3A 3B5LB 1KS4A 4IXLA 3VZOA 3LGRA 1XNCA 4S2GA 1UU4A 1HIXA 3VHOA 3VHNA 3VLBB 2C1FA 1TE1B 2BWAA 2F6BA 1H1AA 3WQ0A 3RI8A 4S2HA 2VG9A 1REEA 1XNDA
chains in the Genus database with same CATH superfamily
4YM0A 1R1A1 4CEWA 1GLHA 3CEWA 3E6BA 2VOWA 4C91A 5EP9A 1CN1A 5EYXA 2HJIA 2XJPA 2WN2A 3HQXA 2WNUA 1LOAA 2W1WA 5KWRA 2DU0A 1RMU1 4EWDA 2Y8KA 5D21A 2WUHA 1HX6A 1FMD1 1RUF3 3PNAA 4BMBA 2Y6LA 3PDQA 4NHYA 5E8AA 3M3QA 2JKBA 2ADDA 4LIVA 5DDJ3 2A5ZA 1AR83 2BVVA 3ZN6A 3LFIA 3VDDA 4B29A 3AB0A 4M0NA 5DUXA 1R081 1RITA 4AF9A 1JU4A 3T1LA 1O6UA 1SBDA 5GLVA 3NL1A 3OB8A 3I2OA 2RMU2 3MIDA 2JEMA 4YZ5A 2XL9A 1C5HA 4JAAA 4YZ3A 4D7TA 1AYM3 5LRSA 3ZPOA 1O3RA 3U07A 4LBNA 3FLRA 1AJKA 4JGZA 3LD8A 4GKXA 3HNBM 2JDPA 4J1XA 4M00A 1O4TA 1Y9GA 2QQMA 1BMV2 4OHZA 4CEYB 3BTXA 2HWC1 3LB9A 1RXGA 5IT6A 2RS53 3USUA 4ZZ8A 4YVSC 4LHSA 3B9IA 1RUD3 4WVMB 1PZ7A 5EHDA 1E5SA 3IT8A 2FD8A 5FLIA 4BXSV 5C3SA 3A23A 3ZR6A 1ZZ9A 5F3IA 4KGGA 5A3PA 1YQ8A 1S0GA 4RHV3 3GZAA 4NAMA 3MLLA 2PAKA 3I2GA 5K0UC 2FQPA 4RSUA 1ULOA 1UL9A 2DFCA 3OPTA 4FPHA 3U14A 1YLLA 1OQ1A 5FUPA 4FTEA 4D3WA 4QPIC 2CL2A 4QU2A 1KD7A 5A3TA 3VZMA 5BYNA 4NN0A 3OPWA 4BQ5A 1WLWA 3S0MA 3ZYHA 3X29B 1AYN1 2ZEYA 1JW6A 2OS2A 1STMA 1ST8A 1AYM1 4HVQA 3VD4A 2IXCA 1QJFA 1ALYA 1PIV3 3P3NA 4NHMA 4P9GA 5JI7A 3AMMA 4JZRA 4I3GA 3POSA 4XOGA 4AFCA 3EXUA 1WMDA 1W03A 2FCUA 1GNYA 2J1RA 1J3RA 4FPKA 4X6RB 5LK5A 3ZYGA 4IXLA 2EXIA 3WF2A 1HRI2 2ZS6B 1MVQA 1XE0A 3INAA 4HONA 1OUSA 4DMIA 4S2GA 4K40A 2CWSA 2A6XA 3ATGA 4JGYC 4GB32 5EJZB 3O1PA 1LTEA 3I2DA 2W91A 3AYCA 5T5LA 3LDKA 4LOTA 3VHNA 3VKLA 5FAXA 1UIJA 4IEZA 5FY7A 1QJEA 3KLSA 3R05A 3ZSKA 5C3PA 2WS93 4LBKA 4QX3A 1LU1A 4CDWA 2CU5A 2BTVC 2ET1A 1JZ4A 3NJYA 5F6KA 1ASJ1 2RDQA 1HLCA 4XJ9A 1J1TA 4XDOA 3WF4A 1UY2A 1K5JA 1UU5A 3C7FA 5JR2A 2JD4A 4URTA 5DZEA 4XC9A 4HOOA 2DYCA 1UKRA 2WO7A 2Y34A 5DZGA 1KFXL 3ON7A 5FYMA 2ID4A 3BTAA 1BKZA 1ZYBA 1BCXA 2RR11 1F5JA 1OA4A 3PUQA 3AP9A 5FZIA 4OZXA 3LF7A 3OSDA 2UU8A 1NLSA 4GJYA 4AI3A 5JSRA 4GWNA 3VHPA 3ZVXA 5FY9A 4UFIA 1C5IA 3LDRA 5FZFA 2ZHMA 2V72A 3M3IA 3PTRB 4YVSB 1DGWA 1SFPA 2P6HA 1POV1 2ETEA 3EJKA 1IG3A 1ULFA 4FFGA 4WVZA 2X05A 3FHQA 3Q8CA 5HBAA 3I3EA 2PQQA 4FPJA 4HK8A 1IS5A 4OHWA 5G04L 5T52A 4UW4A 4BOWA 4DXTA 3MIEA 1O91A 2V4AA 3NV4A 1M4WA 2OUHA 3CL1A 2F4PA 3IPVB 4DPNA 5K0UB 4N43B 1YYNA 1FX5A 4YYOA 1JZ2A 2A6ZA 1G6NA 4LLOA 3WDWA 4CPBD 2CSGA 2YC2A 3POJA 2HWF2 2JB4A 3O14A 1UX7A 1FOD3 2B46X 4Z07A 3UJQA 1BYHA 1DGRN 1NQDA 2VMCA 1FV3A 4RGAA 1ZRDA 2QQNA 2R0HA 3GF6A 1HRV2 1W8OA 2RDNA 3VD5A 3ITQA 1ZBE1 2QKDA 1C1FA 5EYYA 2IC1A 1J1LA 2VZUA 2VVDA 2E32A 3RZZA 3O1OA 5F5IA 2KA3A 3AYAA 1VLNA 4G9SB 3WQ1A 1HB2A 3I8TA 4MLOA 4CDXA 2UY8A 1DGLA 5LY2A 3VBRB 1O8SA 2QQIA 2ZX3A 3DXTA 1BQPA 1OD5A 1CPNA 1GWMA 1G86A 5IJRA 2QTWB 2WO1A 4ZU7A 4A2UA 2SBAA 5KHIA 1UYYA 5H9RA 4NO4A 1YO8A 1OLQA 3A21A 1XYNA 4ISQA 4JGYB 3VBSA 4COUA 3IDAA 2EA7A 5C4WA 3USSA 2ZGMA 4FOVA 3Q8EA 5L19A 1FT9A 5DMYA 1F5FA 2CAVA 1HQNA 1UOJA 4CDQA 1RTVA 2UWCA 3C7GA 2IFRA 1LR5A 2WYFA 2H6BA 3CQOA 1VMHA 1XB9A 5I0SA 4Z92B 4AEDC 3LDBA 1IG0A 3MUZ1 4A7YA 2JDKA 2Y6KA 4AGVA 4NIHA 2GNTA 2NYYA 3AXDA 3HMYA 3LGRA 3T2QA 4XBQA 1W6QA 3O12A 3NJVA 4P5HA 1HIXA 2G1MA 2VTXJ 1RJ8A 4YGCA 3T09A 1YQ6A 4XW3A 2X10A 4BCUA 1JYIA 2A71A 3FL7A 5DUUA 3FFZA 1NA1C 1QMJA 2NMNA 3I2HA 1OURA 1HN0A 1CIWA 2HLEA 3M3CA 1PGW1 2LTNA 2ENRA 1UY1A 2RS12 3P5BA 5BNNA 2A7AA 4XZUG 1TMF3 4INDA 4IEVA 4QKFA 2R072 1Y7BA 2Y6JA 4DRRA 2Z69A 4QXKA 1V9U3 1YQCA 2ZGSA 4BQ4A 2WAAA 1GFF2 2EAAA 2KXLA 3H7YA 5FQ0B 3RG0A 5CFDA 1ODNA 3MV01 2DVAA 2ILMA 5FMBA 3UV9A 4HKOA 1PO12 1AZDA 3JD71 1R64A 1C8M3 4MGQA 4Q0VA 5IATA 1NLQA 2W0XA 4AVSA 5IVFA 4BIOA 4EWEA 5FYIA 5FPXA 3OG2A 4RL7A 2XVKA 3NAPB 2J1AA 4A42A 2QQPA 1IHMA 3H1MA 4KH9A 3WT3A 2AGSA 4YRDA 4MYEA 3E97A 3IAQA 5DUVA 2FMYA 4AHZA 4N7UA 1C1LA 3C7HA 1BEV3 4ES9A 5IFPA 2Y64A 1WCQA 3O1SA 2RE9A 4Q1PA 1N3QA 4QKDA 3VBUC 2J42A 4L0PA 5FFOC 1LHOA 3OYWB 4L99A 1W6PA 5E88A 5EJ3A 1W28A 4SLIA 3ZXGA 1K45A 4LTAA 4Q4X3 2BWCA 3CJIA 2VD7A 4I09A 5GLTA 4ATEA 4CCCA 4UAPA 2WA4A 3FX3A 2BNMA 3AKRA 2VOKA 4MADA 5C8CA 3GBFA 2CGPA 1WW5A 5JOZA 3I3QA 1PZ9A 4XIKA 3BTYA 3M7AA 1R1A2 2PHXA 2XDVA 5F7UA 4FVVA 3NJZA 3HNMA 2RV9A 4KMQA 3ZXAC 4AFDA 2ZACA 4AGRA 4BH9A 1FPN1 4QM8A 1RUI1 5A3WA 5C3RA 1MS1A 1RMU2 1OBNA 4Z8BA 1C57A 1FMD2 4WM7A 2DDUA 1RYYA 1MVEA 2K0GA 3WD5A 4LA2A 4CP1A 4LULA 1T6GC 3RI9A 1MQTC 1R082 1CAVB 2ZEZA 1J3PA 3PUHA 4XF9A 2VUAA 2BRTA 4XBNA 2VNOA 2DU1A 4C90A 4DY5A 2ZHNA 4AEDB 3TYJA 4LT5A 5I0RA 1AX1A 2V5DA 1XNBA 3AXEA 1CQ9A 1Q8OA 3P3PA 2RMU3 4XJZA 5A7OA 5JXHA 1NYWA 2MEV1 3KV5A 1W8ZA 4XCBA 3KVAA 4AI8A 2MNGA 2A6WA 1F8VA 2H6CA 4LO5B 4O65A 3UGHA 4KBZA 2HWC2 1NA1B 4JRAA 5JWPA 1W9WA 1DU3D 3I2FA 1GWKA 4YGDA 2VMDA 2P37A 5JAXA 4Y1YA 3DGTA 5E89A 1OD3A 1LENA 1KS4A 4A3XA 4XYXA 3T1MA 4GMP0 4IV1C 3GHNA 4ZHNA 1I5PA 1W8NA 2GAUA 1WGPA 1TVGA 4OQ8A 3GALA 4ES8A 3SXWA 3ZIWA 1E5RA 1UYXA 2BV4A 2RJLA 3ZN5A 5E1RA 4AAXA 3K46A 5IAXA 3RZMA 3DL3A 1FI2A 2WWSA 2Q1FA 1XU2A 4J1WA 3H8OA 2EALA 4XTMA 1DQ5A 1UOGA 2R0FA 4K1YA 1CESA 1HQLA 4M3CB 1OH4A 2JE9A 3JCIA 3MPPG 4BXFA 5F39A 3O1TA 5C8WA 3Q8AA 1UY3A 5JR7B 4CU6A 1UOFA 1K5MC 2YFUA 1WCKA 3PUAA 3WCSA 1JZ8A 2DWRA 1AYN2 1WLTA 2NZ9A 2ARBA 2Z79A 4XABA 4CUCA 3LCPA 4QDRA 3VBUB 4EN9B 2ZA9A 2OX0A 1DHKB 1GZWA 4IETA 5FYZA 1O7FA 1TNRA 3RS6A 3VBOA 2JG8C 4CCNA 1DDLA 1GANA 2JDUA 3ZYIB 4QGNA 1NQJA 5FP7A 5CKMA 3N9NA 3WP6A 1GR3A 1DQ1A 1SG3A 3VZKA 3Q8BA 5DG1A 1OKQA 5FYHA 3E6DA 4K21A 3MF9A 3WP3A 1H8TA 4CCEA 5KHHA 2ZGNA 5T54A 2AENA 1Q8SA 4R9AA 5DAPA 4XJ8A 2WO2A 5FZDA 4B4RA 4EN0A 1HRI3 1H6YA 5AC91 4IV3C 3TNQA 1TEIA 2VNGA 3UYJA 3N9MA 4XCAA 2EVXA 5KC6A 1D2SA 1CPMA 2PLV1 2V4VA 1NCQC 4GB33 3D0JA 1YXWA 4PIXA 1RUJ1 2OVUA 2GC1A 2PHRA 1U12A 4CCJA 4MGZE 1W8UA 1GU3A 1VBE1 4WM8C 4M4RA 1MQTB 2CDPA 4Y4YA 1TZOA 1P8JA 2I45A 4PIZA 2Y6GA 3S6PA 1ASJ2 1PX4A 3M1HA 1HW5A 1UZZA 2YHJA 2BDRA 3D0SA 1G9AA 4Z82A 4O9GA 1JHJA 2XOMA 3POYA 2ZEWA 2BBVA 3KWVA 1RINA 1LGBA 1YIPA 5J1XA 2RR12 3BU7A 5LZ6A 4CEWB 5ABJC 4JVAA 3V0AB 4LR4A 5CFCC 1EPWA 4QDQA 3DPRA 1YRZA 2UURA 2NQYA 1MR5A 2AUYA 1AHSA 3WG3A 3ZR5A 1W90A 2IXJA 4CU7A 1BK0A 5CKNA 3DXUA 2R30A 2IXLA 2OT7A 1HQWA 2RJKA 4FP3A 2XUMA 5F5QA 3ACLA 3S5QA 3H7JA 5F1RA 4IV1B 4Y5TA 4YW4A 3PIJA 3VDCA 2CAUA 2HEYF 2VZPA 4PBOA 2Y26A 3FZ3A 1FAYA 4QPWA 4GH4A 2WDBA 2BFUS 4FPGA 4PIYA 3RZHA 2VUDA 1VBB1 3BOPA 3K2OA 4WVWA 1DGRA 4D6QA 1KJRA 4RQPC 5FZOA 4R4XA 5J96B 5FP9A 3ZXKA 4AVTA 3OPZA 1UZWA 2WKKA 4D69A 1G8WA 1SLLA 4FOQA 5F5AA 4AEJA 4KG8A 4H7LA 1N1TA 5CVRA 4MXVA 2VZSA 1AXZA 2HWF3 1WMEA 4Q0QA 1K5MB 1QNYA 1XNCA 2PAEA 1ZZBA 2VZRA 3GBWA 3NMBA 2DUOA 5FPAA 4I0BA 1VB2A 1ZBE2 5A6QA 4UBHA 1HRV3 4CXXA 1PGSA 4LKFA 3WDYA 2WQ4A 2LRPA 3NKTA 4B1LA 1W8FA 2PN5A 2IZWA 4NRPA 5FZHA 2JG8B 2OZ6A 3RI8A 2YU2A 1RJ7A 4GULA 5D8AC 4J6GA 5DN2A 1YFYA 1XNDA 3A0NA 1W9FA 1GBGA 3HPNA 4W4ZA 2QUOA 5HCFA 1U5XA 1MACA 2N7GA 1UYZA 5CA6A 3R4SA 3UKNA 2FDIA 3LA2A 2WZ8A 4AI2A 5C33A 5FK8A 1XPWA 1X9PA 4IV3B 2HWE1 1SPPA 3ROUA 3SH3A 4NRQA 4IEWA 2QQKA 2VR4A 1NCQB 5IFTA 4HKLA 2E7AA 4GMP1 4P9YA 3U37A 3RGBA 3MLKA 1D0HA 5LWBA 3LOBA 2VZOA 1VBC1 3IDEA 5L9VA 3AMQA 4Z2AA 4WM8B 1QOOA 2VCAA 2DVBA 3I4IA 4WBBA 3ZMNA 1PK6A 4NRMA 1RC6A 3WW1A 2F4LA 1UY0A 1YQ5A 4CU9A 3ZFEA 4RYDA 2NLRA 5KXCA 2ZGTA 5LCWL 1NXD1 2NMOA 4XURA 5CIRA 4COWA 2J1UA 1W6MB 3NWKA 4X6QB 5FCCA 1V6IA 5FWJA 4B8EA 4YLZA 1ZA7A 5BPXA 4KG0A 2QDRA 4RS5A 2D98A 1LGCA 1SLIA 2R6QA 4PQQA 2ZJCA 1PGW2 3CU7A 3IIIA 3NSTA 5GZEA 4DFSA 5ABJB 2QBXA 1UXXX 4TXWA 1LEDA 2RS13 5A1AA 2ZKLA 1L7LA 1WA6X 1IPKA 1IKQA 1VBD1 2VUCA 2R073 2A3XA 2VCCA 4N53A 2W1QA 1YQ2A 1DG6A 4XFCA 1K42A 2PA7A 3JD72 3JXSA 3NNMA 3M3OA 2P1BA 1PO13 2VVFA 3MFCA 4JQRA 3GJBA 5DG2A 2ATFA 5FZBA 2YDEA 4XF3A 3ZMOA 1GQGA 3JQWA 3OBRA 3IKWA 2G19A 1DGWX 4GA9A 3RMYA 4DOUA 1LAJA 5C5TA 4RQPB 4JCKA 3D82A 4QQLA 4NPLA 4WZFA 4AVVA 4BA6A 3MF6A 4MHRA 1OHFA 3MHZA 1Y9MA 1YNAA 1CX1A 1JYTA 3OGRA 1W9TA 1ZBA1 4JDMA 1KRIA 1MZEA 2YUEA 5F3CA 3UETA 3OOXA 4OI2A 5CNAA 2JE8A 3Q8FA 2YG0A 5FBJA 5G05L 3E5UA 3HT1A 1W3XA 3ELNA 4YW3A 2XKPA 1U0AA 3OD0A 1LOGA 1XNKA 4H2AA 1OKOA 5D8AB 1UZ0A 1QJU1 3HEIA 4BQXA 1QXRA 5JOWA 4CSWA 1R1A3 4DUWA 1Y43B 2VCBA 3MW4A 3WOGA 3I7DA 2P3JA 3PTYA 1FPN2 4UF0B 2WFF1 4IGQA 5FK7A 5BNPC 1RUI2 2FDKA 1Q8VA 3ZXEA 3I54A 5JOYA 2W95A 3DCQA 4E9KA 1NG0A 2VMIA 4FQZA 2JB8A 1NE6A 1RVF1 2B5HA 1H30A 2LALA 1ND2C 3LZZA 3N9LA 1RMU3 2C1FA 4OYUA 3UL2A 4M3CF 1QQP1 4JDNA 1FMD3 1H1AA 1RUOA 3VKNA 2DCTA 3QLQA 1YC61 1HB1A 2TNFA 3W21A 2W46A 1US2A 2PELA 1F31A 5EZWA 2YGLA 5JIAA 1R083 4LUKA 3O1UA 5A32A 1CAUA 3ASIA 3MBWA 3VBHC 1Q5OA 5I8TA 5LA0A 2O0OA 4CUAA 2FZ1A 3CDZB 3WSOA 2MEV2 3T2TA 5FZ0A 4EZ4A 1W8TA 4ZS2A 4CDXB 2YBPA 5EJ1B 3KGZA 3R6SA 1RUC1 4YW6A 5IWFA 3MDPA 5T3NA 4Y22A 2VNRA 5AFBA 1COV1 1OLME 3ACFA 1U5ZA 3D4KA 4HSJA 3WLUA 2C9KA 3IBMA 2HWC3 4AEMA 3BOWA 1CAXB 2BP6A 1AJOA 4B7EA 3VBSB 4FOWA 1OVSA 3AVSA 4K3UA 4ATFA 2QQOA 4BHPA 2DV9A 1JH5A 2VCMA 4IEUA 3APBA 5CYYA 3RZJA 3S7EA 3WDXA 4OI4A 2JXAA 5I93A 3J8F1 3O0VA 3SCGA 4CCOA 5J7MA 1LNSA 1IGOA 2VZ1A 4AOCA 1XE8A 1JUIA 4LUMA 1F15A 4EJRA 1H1IA 3J7NA 1SLCA 4W65A 3W5NA 5F2SA 1U5IA 4OVEA 3C7OA 4HT1T 1MS3A 4Q8LA 1UOBA 4BISA 4SBVA 3H1YA 4XUQA 4BPZA 3KV4A 4GIQA 2BPA2 5D1IA 1IZ3A 3KHBA 5CAZA 1AYN3 4IW3A 1JYWA 3GXUA 3RWKX 2VL4A 3IN9A 2Q8EA 1RGSA 3L2YA 2QQUA 1TNFA 3R0RA 4Z2WA 5SV5A 3KB5A 1OT5A 4CUBA 1QGLA 3F95A 3M8LA 5EV7A 4AQSA 2OPWA 2VW2A 1W6NB 4UBGA 2YPDA 4D6RA 1M06G 1ND3C 4P00B 4GD4A 2QZ3A 3OY8A 1A8DA 4FQ4A 4L2NA 4LE3A 4XFAA 3POBA 5AC92 5BNPB 5CEHA 1PNFA 3CZJA 4XDQA 5EXOA 1BVVA 2PLV2 4GALA 2ZGRA 2DCZA 4IE7A 2C4XA 1LULA 1W04A 4XQDA 3ZDVA 1RUJ2 2OPKA 1ND2B 4LHLA 1E5HA 3A22A 5ANQA 1UAIA 1VBE2 2JX9A 4MOAA 1DQ6A 2GC2A 3OBZA 1PM7A 1WD3A 2BZDA 3KV6A 3U1XA 4B3NA 5HCHA 2JENA 5F32A 4N9IA 1V00A 2BGOA 1YJKA 4N43C 4HLTA 4PDWA 4UFLA 3K77A 3VBHB 1ASJ3 4QXBA 3PU8A 3TBDA 3GHMA 3NKGA 2AC1A 5C8CB 5JCTA 2VU9A 4XDPA 4CP0A 4B1MA 5DAWA 1PMIA 5DAXA 4YNIA 4GWIA 2D43A 5F8PA 3SH4A 1UPIA 3AL5A 4BK5A 5CBLA 3HBKA 3OUJA 2RR13 1GNHA 3VHRA 1ZRCA 1IPSA 3IMMA 1PZ8A 4YPJA 3NV3A 5DQ0A 4FTSA 3CNAA 3P1IA 4IE5A 4M01A 5I8SA 2O8QA 1N1SA 5FUIA 3RJRA 5IK8A 2FDHA 5KHKA 2WIIB 2GMMA 1YCIA 4EZHA 4V2VA 3CF6E 1POV3 3VBRC 1VBA1 1H1MA 3OEBA 5BXXA 3ZSLA 3TEYA 5A33B 3ZFGC 3AYDA 2VY0A 2AREA 3SNMA 3NNJA 2A1XA 1I3HA 2C5DA 4LXLA 5JXGA 3W59A 4ZPIA 3ZFFC 4QM9A 1VBB2 4QDSA 3PUIA 5JZGA 2J7MA 1B35C 2A6VA 2JD9A 3JQXA 3MV11 4XILA 1YFWA 2WNVC 2LROA 3I3DA 5H9SA 3D5OA 3ZO0B 5DUWA 1OLMA 2GC0A 4Y1VA 1ZM1A 3VD3A 4XFGA 1DQ4A 3JU9A 4I0AA 5FPZA 1ULDA 3ENRA 4K20A 1PNGA 4CP9A 4GKYA 5A7WB 1XNTA 2X5IA 4K7JA 3ZX7A 4C0HA 3GYDA 1JZ6A 1PGL1 3MICA 4AFMA 1WKYA 4G3YC 5JUVA 4MX3A 5C9AC 4GJZA 1ZBE3 3AJZA 1Q56A 2QCSB 4E2SA 1QJY1 1YFXA 2VZ3A 5FPVA 4Y20A 3MUY1 5C3QA 1Y4WA 3RSJA 4ZU5A 2WYSA 5CZKA 4BWOA 1JYXA 4MXWA 4BB3A 2DBNA 4GH4C 2JDZA 3SC7X 4JQTA 4URAA 4N90A 1ND3B 2VE1A 1DZRA 3T3YA 4DEQA 3ORJA 2ARCA 2P3KA 5DAVA 4IEOA 3TB0A 1A6CA 1D2QA 1UPSA 1W0PA 1ZNPA 1IQAA 3WW4A 2HWE2 2YGMA 3AP4A 4XEZA 4YVWC 3POGA 5FYVA 2VZVA 4W6XA 5GZCA 1ZREA 1ULCA 3NNGA 3PVBB 2LM3A 2BBAA 3N7KA 4A7KA 1OFSA 1SFNA 1VBC2 3WP4A 4ARXA 2R7EB 4E27A 3E6CC 1VJ2A 3VD9A 4IEQA 3HN1A 4OULA 2VBBA 4D7SA 3N36A 1DZTA 2Y33A 1OI6A 3NAPC 4FAHA 1Z0HA 3IWZA 5A1FA 5C71A 1ZA4A 3M70A 4HXCA 4LA3A 4U36A 4XMIA 4C1XA 4LBJA 2R49A 4RR3A 5F5CA 1OSGA 1IQDC 3OGGA 4X8PA 5HV4A 1NY71 3B01A 1UKGA 3MI8A 2BU9A 3WY6A 1QEXA 5GLWA 1H8TB 2ADEA 4Y1UA 4XTPA 2QQWA 3BPZA 4Q8KA 1NCRA 4IERA 2ZGLA 2PFWA 1W8WA 4E4SA 4QPGC 3U11A 5HPOA 1NKGA 4KI5M 4Q0PA 5T5PA 4D7YA 3PUSA 1VBD2 3PIGA 3VBFA 1AXYA 4Y5SA 1ZZCA 1UMZA 3TNPB 1GKBA 2JG9A 4FFHA 3R4UA 1JODA 5FOBB 2PQSA 1LOFC 4FOYA 3ZFGB 2I74A 3JD73 3WG1A 2D5HA 4GZ9A 1TE1B 2GP5A 2BOIA 4MUVA 4Q4V1 2VW1A 3ZFFB 3SLIA 1ZZ7A 1S2BA 4LBQB 1B35B 1EAH1 3WNMA 1E57A 1V6LA 3L2HA 1N3PA 5FPLA 2XVLA 4B4PA 4YZ1A 1Z7S1 2WNVB 1OC1A 2XBO1 2YXSA 4Y1ZA 3ACGA 3LFMA 2JKXA 4E4HA 2YFZA 1CAWB 1O5LA 3KCYA 4A3ZA 4C1WA 1ZBA2 5FMOS 2W5FA 1QOTA 3MEPA 4CDUA 4CPBA 4CXWA 5KHGA 4QXCA 5LW9A 3CBNA 4K8RB 5IVBA 1V6JA 4XACA 2VZQA 5C9AB 4FPEA 3QD6A 2WLQA 1ENXA 3B94A 3GGLA 4H14A 2YZ4A 3JZVA 3ME2A 2ZX1A 3ZSEA 3SISA 1S1AA 5I0DA 3WP5A 4NHXA 1S0BA 2QQVA 2NM1A 2NPIA 1QJU2 2UY9A 1UZVA 1UMIA 4GH4B 1DF0A 5B2GB 2WFF2 4UT5A 1IS3A 1J58A 2YMZA 1OOPA 3QCWA 4META 3RYKA 2VM9A 4EV0A 1FPN3 1HB3A 1MZ5A 1XBFA 1RUI3 4EWAA 1ENQA 1RVF2 2HH9A 3POEA 2W3JA 2Y6FA 1LOEA 2ZTNA 1QQP2 3QH7A 4YVWB 4YG3A 1CZVA 1QKQA 3I3MA 1UF2C 2YC4A 2X09A 4HN0A 3MIFA 2ZPXA 3HWJA 4FPFA 4QHZA 2DUQA 4V2WA 5DABA 5LBFA 1JXNA 5J09A 2E33A 2HYKA 3D6EA 3LEIA 1HJGA 1AR91 2ZX0A 1QDCA 2W94A 5CISA 4OHYA 4XBLA 2WWJA 3T0DA 1AR71 3ES1A 3LIHA 4PHZA 5LA1A 1SDDB 4AHYA 4YM2A 1NZIA 5JMOA 1OUXA 1QNWA 1SDWA 2ZAAA 3U78A 2WSVA 4OLLA 1XSRA 3T0AA 2MEV3 4MGKE 2XMLA 3K51A 4FCAA 3IDBB 3O0WA 1RUC2 3VKMA 2LUWA 1COV2 1WCSA 3LEGA 1V6KA 4CCKA 1KDMA 3DUIA 4Q4Y1 1LHVA 3KF5A 5FOJB 4CEYA 1JYNA 4QX5A 1CWPA 4UI9L 2PAMA 4IEYA 5BNOC 4QPGB 3VB9A 2DFBA 3VUOA 2E7TA 2E53A 1RUH1 5LASA 4WVMA 4I30A 4Q2FA 4QGLA 3AMNA 3WF0A 2P3YA 3J8F2 3WR0A 3U0ZA 1JOBA 1PK6B 4KWLA 1WLDA 1QXJA 1H4HA 4NPRA 4QWNA 1I6XA 3O0XA 2AEYA 2W87A 1X8EA 4K6BA 3ABZA 2H0VA 2JDHA 2R061 2ZX2A 1GWLA 2XH6A 2WLPA 3M2MA 4LITA 4QHBA 2XUEA 4YGEA 5FTTC 1I9RA 3CO2A 4QKBA 1W06A 2P34A 4RS5B 1O3TA 5C5UA 4LO8A 2IVIB 4Y4RA 4LKDA 4CA9A 4AWDA 4I0WB 1ZX5A 2HWD1 3TWIA 2VXJA 4DIQA 5FUNA 3T4VA 2BNOA 3GM8A 1V6MA 2ES3A 4W6WA 2RJ2A 4XF0A 4XUNA 3K4DA 5F9TA 1A78A 4A45A 4CEWC 1JTZX 2GH8A 5FREA 1ULEA 2AR6A 1SLBA 4UFHA 1BLZA 1NOVA 1H2KA 4BQWA 2BQPA 1RIRA 2J1EA 1W99A 1A34A 4DO0A 1X8MA 3K3NA 4HPKB 2WNUC 2A3WA 2KR2A 1GP5A 2HWB1 5FZ9A 2RDSA 1W6OB 3UT0A 4XFBA 4LBLA 4LBMA 2JICA 4UFJA 3KGLA 2GNMA 3J7HA 4NWWA 3RWNA 2ZAHA 4QKNA 4NJ4A 1ACCA 5AC93 3VDDC 3KD4A 2PLV3 3C8XA 4PF5A 2GDFA 1WD4A 5IK5A 1LU2A 4P9IA 1RUJ3 3PVOA 1YJLA 5A7SA 3MLJA 4HVRA 2EXHA 2GH2A 1VBE3 3P6BA 1VRH1 5GLUA 1H8VA 4FBFA 2B4KA 1VAMA 3I59B 5GJ6A 5FZAA 4CUGA 4I2OA 3J9SA 3KV9A 4NHLA 2DTYA 3IIAA 4WZCA 4XHBA 5IVVA 3H8UA 4NAOA 5AFEA 1AL0G 4JGZC 3LPFA 4HN1A 2DCJA 3OUIA 4XUOA 5CU1A 4XQWA 1SLTA 4QX8A 2J22A 1UY4A 4ARYA 4R9CA 2BOJA 3HAGA 4XUPA 3LAGA 4Y1XA 5L7OA 2XKOA 5FZLA 1OPOA 5FZ6A 3WINE 3OGJA 5EQUA 2DUPA 3ETQA 1RL3A 1AX2A 1K12A 1GSLA 4QB6A 3FWEA 1GOFA 1D4M1 5BNOB 2ZMNA 1UQXA 2I07B 4ZONA 5GKAC 1VBA2 1H9WA 1PMHX 1CX4A 5FZEA 2GN3A 2WINB 1PVC1 1RHI1 1VR3A 4QQPA 5F6LB 2VECA 5JPMB 4HBNA 5A32B 2XJUA 1VP6A 2Z42A 5DXDA 3WHTA 4EYUA 4R9DA 3I49A 1SBEA 2PTMA 1VBB3 2P5BA 4JTOA 4Q0SA 2P3IA 1FNYA 5IVEA 5K0UA 2UYBA 3H3LA 2ZABA 2C9AA 3DKWA 4AEKA 2XR4A 3NQHA 2OXBA 2D97A 4Y22B 5L36A 3ZKUA 2BGCA 4QPIA 2WFPA 4E8CA 1F4HA 5JSOA 4D6SA 1PGL2 4CU8A 4I01A 1HV1A 4PLOA 1UMHA 2W39A 3E1F1 4MVTA 2OUJA 2XQRA 3SKVA 3MPBA 3BYWA 1R091 1QJY2 3UJOA 1LHWA 2LS6A 5GZGA 3KQ4B 3ST7A 2R041 1DIWA 2LW8A 5HXVA 1XRUA 5FZGA 1KDKA 3PL0A 3WV6A 5ACA1 4Y24A 2P4EA 1JU3A 2XJQA 1OA3A 3Q9OA 1AUYA 1CJPA 4ZS3A 1F4AA 1PO21 3I2KA 3JUUA 2WNUB 5FXVA 3POIA 1N47A 4JDOA 2WJSA 1XNAA 3TOJA 1DP0A 4DXSA 2WO3A 3VHOA 3JBG1 2P2KA 3N9PA 2TEPA 2HWE3 2VNVA 4JGYA 3PU3A 4KBBA 3BCWA 4LLFA 3OBTA 3VDDB 3ZN6B 3ZM8A 4CDWC 3MIBA 2PHWA 4GMP3 2VBDA 2VQ0A 3EHKA 4XE9A 1VBC3 3BTZA 1WWYA 2WAOA 1GQPA 2YPJA 5C70A 1W2NA 4UWDA 3O1MA 1OFNA 1WCDJ 4XUTA 2QNKA 1D4VB 3QH6A 1N1YA 2VMFA 1CD3G 4LNVA 3U75A 1U5YA 1AVBA 1MPXA 2WNEA 2CHHA 1NY72 3O7OA 4JGZB 3RPQA 1Q3EA 1GUIA 1KITA 3POWA 5F2WA 2FCTA 1QWRA 3UGGA 2VQAA 1Z78A 4M3CE 5IW0A 3WNOA 1OF3A 4EQVA 5FDBA 3TEZA 3N7MA 2YBKA 3USUB 3BIEA 2ZKNA 3AL6A 3QACA 4LQRA 5C3OA 3DN7A 3N7LA 2XGXA 1L3JA 2Q5TA 3LEMA 3SCFA 1VBD3 3N35A 1XQNA 4UYBA 3AMHA 4AZZA 5FQ0A 5FYSA 3HR9A 1VIWB 1QJX1 3OUHA 4NMIA 5L9BA 1LEMA 3TEXA 4AAPA 4YM3A 1IOAA 2YBSA 3GCXA 2BERA 3KM5A 3LWCA 2XG3A 3B7MA 4AXOA 3KT4A 4Q4V2 4O9EA 3FUOA 1EAH2 3IB3A 2QQJA 4KQ7A 1DZQA 5T5OA 2YB7A 1Z7S2 4AHXA 2XBO2 5KXBA 2J1VA 2PHDA 1EPZA 2D3RA 3A7QA 4MZUA 4LO6B 1S2KA 4QX0A 3BU0A 1REFA 3MO4A 4FTBA 3RYPA 1CZTA 3I3BA 2EF6A 1ZBA3 2BW8A 2EAKA 4MV2A 4LO4B 4S2FA 1IPJA 4AVCA 2ZHKA 4FO9A 1DQ2A 1N3OA 1O8PA 4HG6B 4OCTA 2WZPP 3ZXFA 4QU1A 4D8MA 5FO8B 5JIUA 4A4AA 4CDXC 3VZNA 4AFBA 3MIGA 1B09A 3VL8A 5FXZA 5FLHA 2C6SA 3WQBA 5FPUA 3ACHA 4AQ2A 2GN7A 5FP3A 3KMHA 2DCKA 1HXS1 1POQA 4NUBA 4R52A 4DNYA 5A70A 1QJU3 4NIAA 4CVUA 4HZFA 4IE4A 1OXCA 3VBSC 3HBZA 4Q1RA 1KEXA 3WDVA 5C4WC 2WFF3 5A7QA 3FBMA 3UNPA 2A3YA 2RM21 4QQ2A 1O3QA 1RVF3 3AKQA 2P17A 3LIGA 3R4DB 2RS31 4CDQC 4E8DA 5LK7B 3EQEA 1QQP3 1Q8PA 4CDWB 3NO8A 2HKXA 1CONA 1AR92 3KT7A 1RUE1 4M4PA 2AYHA 4ZZ5A 2A75A 4BZ4A 1L7QA 2X5IB 4JHZA 1AR72 1CAVA 5JDBA 3IM0A 3ZXLA 2AH2A 3B5LB 4DB5A 1F9KA 4AEDA 4QQHA 5LRRA 4L11A 1RB8G 1RUG1 1SZBA 4Y33A 2MHFA 2JDNA 1NXMA 5BNNC 2XWBB 2F6BA 1RUC3 1LJ7A 4W6YA 1COV3 1GQHA 1F2NA 4Q4Y2 4PJYA 3WHUA 1J84A 4QX1A 4E2QA 4P5YA 1LCLA 3WW2A 2C24A 5CFDC 1YFUA 4LE4A 1JI6A 2BJSA 5JVVA 4AR2A 5LEJA 4XQ4A 3V64A 3H3ZA 1RUH2 4YG0A 3B02A 5FZ8A 1W8HA 2VMGA 3AKSA 3HD8B 1O59A 4AK3A 4KNCA 4JX0A 3KSCA 1H0BA 1EV11 1MS0A 1AR61 4AVAA 3ACIA 1PVXA 4OMCA 3AP5A 3J8F3 5ANNA 5ERLA 4H7MA 3BB6A 3AZYA 1AF9A 2W52A 4IEXA 3QOPA 4YW1A 3LPGA 4FPYA 5IVYA 3ZDSA 5KXEA 4F83A 2GMPA 2C0ZA 2R062 3T08A 5T5JA 3K4ZA 3W9AA 2WZEA 4L9BA 1X7NA 2GU9A 2JDMA 4M3CA 3LE0A 4EROA 5ISLA 1UNBA 4P02B 3K4AA 2FDJA 4AI1A 2IXHA 2Q30A 2G9ZA 2WABA 1GP6A 3CJIC 4HL0A 4OHVA 5IHRA 2HWD2 1NCRB 1G9CA 3FHAA 3GZTB 4XIOA 5JMCA 2ZX4A 3VBUA 5C8CC 3HNYM 4JV4A 4HK9A 1XC6A 3NW4A 3BI3A 4FPOB 5FP4A 3SCHA 5LA2A 1AL21 3DKQA 3VZLA 5K8SA 4MSVA 1S0IA 2HWB2 1EP0A 5A3UA 4NIDA 5FZ3A 3U4XA 5IUQA 5FY4A 5FR3A 4WM7C 1QOSA 3RMXA 5C4WB 1EYBA 3S57A 1KXGA 2JJ6A 4MG2A 2DVFA 2XB6C 4U2AA 3NVCA 5FYTA 4EE2A 2A70A 4CDQB 2OW4A 1UO9A 4Y3OA 2H0BA 1NAEA 4ISRA 2L9LA 3B69A 2Y38A 1VRH2 1LOBA 1HV0A 4QD2A 4XXPA 4XFHA 3G7DA 3VKFC 1H9PA 2VZTA 1MQTA 3WDTA 1W6QB 2CV6A 2IXIA 2KM2A 2WZR1 1ENSA 2XJTA 3H1WA 2ZZQA 1I5ZA 2E26A 3AC0A 1XYOA 2DCYA 2WRAA 3ILRA 4Z1VA 1PMJX 1WBLA 2X8KA 2ERFA 4XMAA 5FZCA 3KF3A 4LIUA 4COVA 5BNNB 1CR7A 2AACA 1XXNA 1OOPB 3FHIB 3V0AA 3O1RA 3TN91 4ET7A 3THCA 3CJXA 2UWAA 3EO6A 4P9JA 5DPNA 1QDOA 3AFGA 4Q4W1 1BBT1 1D4M2 1SCRA 4NPMA 5A33A 5A6YA 1O5UA 1WLCA 4XZPA 5CFDB 4JKLA 4IE6A 2ET7A 2W1SA 3ILFA 2R32A 4K1ZA 3D3AA 3V65A 4CRQA 2BFUL 2Q1ZB 1PVC2 3ZN4A 1VBA3 1RHI2 2GNDA 4PBPA 2QFEA 3VV1A 1SMVA 2D6KA 3CIHA 4IV1A 1W9YA 4YWAA 4DXZA 1QF3A 1TME1 2JECA 1QU0A 1V6OA 4QB2A 4QAWA 1SACA 5FZMA 3RVHA 2ZZJA 3URFA 3NNLA 2X29A 3ECQA 1DCSA 1EY2A 2JDYA 2GP3A 2ZMKA 4S2HA 2GMEA 1REEA 3AK0A 3OD4A 5A7NA 1LODA 4IGPA 4ASMB 3JB4C 3HVDA 2HYXA 4GWMA 5L7OC 1W3VA 1UIKA 3FUQA 4JRLA 4FFIA 5AVPA 3WG4A 5CG8A 3HJRA 3SITA 2VXRA 1W6PB 1MEC1 4TYSA 3VBOC 3WNPA 3O1VA 3G6JB 1K5MA 3CJIB 4DEVA 5LBCA 3T0BA 2RVAA 3AP6A 3CKHA 1R092 1NUKA 3L9JT 5FKCA 3B9CA 5I0TA 4JKMA 2R042 5DAQA 1QJY3 1L7RA 1GV9A 1XU1A 2E6VA 2JG8A 2TUNA 3ZLIA 4BIFA 3GJAA 5ACA2 1GZTA 4FFFA 1H8TC 4WV8A 3MGUA 3EMRA 1PO22 3AM2A 1WW7A 5KXDA 3WNKA 2XJRA 3HQRA 1S0EA 2A73B 2HEVF 2ZGQA 1QH7A 4WM7B 2HBUA 4QB1A 3JBG2 2DVGA 2EICA 4PLMA 1RUF1 4AHWA 5KC5A 4KU8A 3OBAA 1ZRFA 4IV3A 5DDJ1 1S2EA 1AR81 3KS7A 1A8MA 1CZSA 1UN1A 2VUJA 4RA0A 4AL9A 2DBIA 1Y3TA 1JZ3A 1D7PM 1NCQA 3S7IA 4CE8A 5FRAA 4AQTA 1N1VA 3FFQA 3RDIA 5A6ZA 5K7PA 3UGFA 4TWTA 1QH6A 4WM8A 2D93A 1C8NA 1HKDA 2JE7A 4LO7A 1SQ4A 4X8NA 1H4GA 4AGGA 3DYOA 5T50A 4TTGA 1HN1A 3SQOA 4LOSA 1W6MA 1YIFA 2D44A 2WL1A 3DPRC 1J59A 1YUDA 3WZ1A 4LPLA 3WX5A 4QXHA 4FT8A 4A6SA 2K46A 1WW4A 2PYTA 2CY6A 2Z2SB 5IAVA 3WF1A 3V0BA 4UW3A 5F37A 1Y9QA 2RS51 5ABJA 3N7JA 3N4MA 2VMHA 5CFCA 4QMAA 1RUD1 1OF4A 2Y0IA 3MZHA 5GALA 3NJXA 1OQDA 1VAVA 4YW7A 1QJX2 4L8QA 1QHDA 3C2UA 1DLLA 3MYXA 2OQ6A 4RHV1 5H9PA 2VULA 1GOGA 3B3QE 1DYPA 4BQ1A 4H3WA 2C26A 3NV2A 3I97A 3RYRA 4YZ2A 2XQXA 1ULPA 1UZYA 3IMNA 1S55A 4Q4V3 2YYOA 5LBBA 2Q4SA 3FE5A 1JZ5A 1TQ5A 1O3SA 1CJDA 2CTVA 5FIXA 5GLZA 2VOVA 4QX2A 5FLJA 1EAH3 4HVOA 1W2AX 1ZZ6A 2VO5A 4ONUA 2OQ7A 5B4NA 4RQPA 1Z7S3 2Z5WA 2XBO3 1W05A 5L7OB 3CLPA 5F3GA 2HBTA 4HANA 4D0QA 2NP0A 5LY1A 4LEJA 1GZWB 4UFMA 2FMDA 4F7ZA 3RZKA 3FLPA 3VBOB 3ZXDA 4JTNA 3NV1A 3BGAA 1HJFA 2D7FA 3FJSA 3VLBB 1PIV1 2OIIA 4BK4A 3WQ0A 5F3EA 3OTFA 4EN8B 1NT0A 1X82A 3KZ4C 5JI9A 4BJ0A 3ZPYA 3RNSA 2IUWA 1HXS2 3AJYA 1TG7A 2GZWA 2BUKA 5D8AA 4IDZA 4GQ7A 5A3OA 2O1QA 2CNAA 2R16A 3C7EA 1LHNA 1VMFA 3BUCA 2AEZA 1YHFA 4QT6A 4UF0A 4YARA 2RM22 1HB4A 3ZXJA 4PF1A 4TLFA 5FY0A 2RS32 1WCUA 2R1DA 4K9SA 3WCRA 1WMXA 4HMZA 4LBOA 2WS91 4L92A 1PK6C 5FMDA 1RUE2 4QPIB 4QHOA 4E2GA 5LEKA 3FMGA 4LMFA 1OMIA 3ZFEC 4OZOA 1K3IA 1R1ZA 2ZBJA 1AR93 4EN7B 2DTWA 5CB7A 4Y26A 1UU6A 4CTEA 1AR73 2J1SA 1RXFA 2QVSB 2R1BA 1LESA 1VPHA 1WA4A 3RFRA 1W9SA 4OI1A 4DQAA 1RUG2 4B7KA 1CVNA 2IVJA 4RS5C 2ZEXA 3PURA 4KL1A 5FJHA 4P9WA 5JSPA 3A4UA 5IVCA 5IYYA 3TRSB 2V5YA 4BYYA 1W2TA 2F17A 5FZ4A 3DPRB 1BJQA 2ZOEB 4BQYA 2VVEA 4OUEA 4JHTA 1MZFA 5FJKA 3WQ7A 1EUTA 3OGVA 4YW2A 2VAUA 1T2XA 4N53C 4JKKA 4Q4Y3 3THDA 1FATA 3WXPA 4NVPA 2ARXA 2I2SA 2D6OX 1CAXA 4MGIE 4HKWA 1FNZA 1BVP1 1S0JA 2WT2A 5GZDA 1WW6A 1EV12 1RUH3 1W2UA 1AR62 4O7XA 5FMCA 4DRVA 1XSQA 3OGSA 4AG4A 1Q43A 2PXJA 1LOCA 4XHXA 1X36A 2VH9A 2W9XA 4QGMA 3LA7A 5FZOB 4S2DA 5BV6A 3M3EA 3GCWA 4XXAA 2IXKA 3ETPA 3H50A 4B4QA 1GZ9A 2XJVA 2R063 4M0HA 3LQCA 2ZGKA 1FOD1 2ZMLA 2B39A 4CCDA 4YSFA 1GOHA 1G9BA 3E5QA 1VB4A 2W47A 4FPCA 5J98B 3N9QA 5A3MA 1JOJA 2Q8OA 2XLGA 1US3A 4LKEA 5CKQA 4OFGA 2VMEA 2HWD3 1CGPA 2WQZC 2YC0A 1OPMA 2D40A 1LHUA 3I2JA 3PMSA 3JB8A 1ENRA 4Q0UA 1AL22 2B45X 5AVAA 2PHFA 4C0BA 5FZ1A 5FY8A 2FDGA 4F3JA 2Q0AA 1W6NA 4BLIA 4COYA 5FBZA 1JBCA 2BYVE 3HN3A 4OMDA 4RN5A 2HWB3 1SCSA 4PI2A 5JPNB 2ZXQA 3ZYBA 1Q8QA 4KWUA 1SPPB 3BN6A 4R9BA 5BNPA 5DZFA 5JLVA 1OVPA 2D6NA 4V1PA 5FZ7A 3T30A 4NROA 3RRDA 5A3NA 5TSWA 3AZZA 4NOTA 1ND2A 2WNOA 1S0DA 1VALA 3KHCA 3I2IA 1PHMA 3WW3A 4N7IA 3ZFEB 1JHNA 1ZRIA 1VRH3 4AVBA 1GNZA 1LGNA 4XF1A 3BKZA 3KVBA 4PI0A 1SLAA 1UWWA 4BQ3A 4R8HA 3NNFA 2WZR2 2ARAA 2ZGUA 2OKXA 2E31A 3FBYA 3VBHA 3ZOIA 2ZGOA 2YU1A 2BEOA 4NE9A 5KHJA 2TBVA 4BMEA 4TSVA 4KU7A 3AMPA 3K75B 1PX3A 4YGBA 2VTFA 4O61A 4CP2A 3VZJA 4BQ2A 3TAYA 3CMGA 1ZZ8A 2Q1MA 1V70A 4LORA 2UYAA 3TN92 4AE2A 2BNNA 1TMF1 3VDBA 3AKTA 3CZUA 4QX7A 3KQRA 4XETA 1V9U1 2QZ2A 1BBT2 4Q4W2 3LSEA 1XYPA 4N53B 5EPAA 2B9UA 1UD1A 3THTA 3N3HA 1O4ZA 4LK6A 1D4M3 2GALA 4BDVB 3N9OA 4L97A 1QJZA 1FYUA 1C8M1 3QBQA 2W68A 4YFZA 2D6PA 3KCXA 4Q5OA 3FC0A 4UW5A 3RZGA 1PVC3 1TME2 3M4FA 2XL7A 1RHI3 5FZKA 1PM4A 2D3PA 1SFYA 4IEPA 5HCAA 3S5AA 3H42B 4BM8A 4AFAA 5FYCA 2WWUA 2XVGA 1JUHA 5IK4A 5C7GA 2D3SA 5FYUA 3IZOA 4HETA 5LBEA 1BEV1 4Q26A 4FXKB 2B7YA 5FYYA 1W39A 2B42B 2OZJA 3DEMA 1MEC2 4KWJA 2FCVA 1DFQA 3HIFA 3OJBA 4A41A 4Q4X1 4YM1A 1MS9A 4PLNA 5LATA 1HDKA 3H3UA 5A7WA 4H55A 4NIIA 3W20A 5K9YA 4XAEA 2WSUA 3POFA 3U10A 2JDAA 4FPLA 2ZGPA 1R093 2FZ2A 1YI7A 3DECA 2Q8DA 3VD7A 2VJXA 2XHKA 3FLTA 3J26N 2R043 2XLAA 3ALQA 2QE3A 1X33A 3SHRA 4LJHA 5ACA3 3A0KA 4E4ZA 5A6XA 5H9QA 3PJQA 1S0FA 2QQLA 1X50A 1DLCA 2RDRA 1UX6A 1PO23 1ND3A 4P14A 4ASKA 2YROA 3T2OA 2EIGA 3K48A 3TEWA 1LECA 1V0AA 2O14A 4OHXA 4Q27A 1RUF2 3J7LA 1VE0A 4N8MA 4ZU4A 1H2LA 4FI9A 5DDJ2 1LRHA 1AR82 4YVSA 3ZIXA 2EXJA 3JBG3 4PCRA 4F8AA 2XLFA 3KT1A 2Y60A 3OEAA 4FP2A 2CDOA 3H8RA 4LBQD 3RZLA 1CAUB 4PDWC 5GM0A 5SV8A 3ZKYA 3IDCB 3NRUA 1SHWB 2VQTA 2V09A 1EUUA 1VAKA 2RMU1 1O4YA 3VZOA 1AYM2 4FXGB 5EFUA 5EWSA 5B4XA 2JWPA 1G7YA 3DV8A 3IPVA 3LEKA 4QQOA 4N43A 3T4HB 2CGNA 1VMJA 2FBEA 4IESA 5FY5A 2X53S 5APAA 1SEFA 3WF3A 4DUVA 2E7QA 2BWAA 3B00A 2G9FA 3RJ2X 2MPFA 1BMV1 3H8XA 2XONA 2YV8A 1JN2P 2RS52 4IL7A 4XJWA 5GZFA 3ZYPA 2VOXA 2XXZA 1RUD2 1JZ7A 1JS9A 5EIYB 4HFSA 1OH3A 4YZ4A 2EIBA 2Z4FA 4AYUA 2B8MA 5HV0A 4W50A 4N9HA 4CYDA 1QY4A 3MW3A 4WVVA 4RHV2 5M0TA 4G4FA 4TN7A 5JZGC 1C4RA 1QJX3 3VBRA 3ZFGA 5LB6A 4RFRB 1A3KA 1QXPA 4XFIA 3ZFFA 3VKOA 4AI0A 5CADA 4LBQA 1B35A 2QDNA 3WUCA 5C6CA 1REDA 5KBFA 1I1EA 1DYOA 1OQEA 5FMOL 2XPJA 4P9LA 3KCCA 2WNVA 4GAZA 4NHKA 2IWGB 2X5IC 3AZWA 4JC1A 1S0CA 3RQ0A 4W8JA 3UESA 2BGPA 2OYZA 1CAWA 2W92A 4IUGA 1ZVFA 5FO9B 4XJUA 2VW0A 1LKNA 3MW2A 1PIV2 4I02A 5L9RA 1MS8A 2QJVA 1DQ0A 3AKPA 3PJYA 2RG4A 5FO7B 5FXXA 4RD7A 2D6MA 1ZRRA 1FXZA 3GBGA 1JYVA 2EXKA 5FV3A 5A3LA 5C9AA 2VOTA 1JMUB 2UWBA 4YFWA 4NR1A 4NWVA 3WVJA 4EN6B 1UCXA 4OUMA 3OY8B 1AXKA 3BALA 4CCLA 2DURA 2ORXA 4E4DX 1HXS3 1XOYA 2CYFA 2J1TA 2G9GA 3AX4A 1KFUL 4UOJA 4BE3A 1HRI1 5J36A 2CGOA 2IFWA 3ILNA 1KGYA 3SH5A 5FYBA 1NZCA 1MS4A 5K4LA 4GB31 3ZYJB 3UK9A 3PVEA 5HCBA 3J7MA 1H2MA 3PHMA 3HT2A 4BU2A 1F35A 1SBFA 2RM23 3EBRA 2HEWF 4IE0A 4MGTA 2WS92 4ITCA 4YVWA 1VRBA 1YEWA 2AZ5A 2K9ZA 2RS33 3WG2A 4MGSA 2ORZA 3VDAA 2OA2A 5FKBA 5I8YA 1RUE3 1BK1A 3AZXA 3BPSA 4DS0A 5E16A 4PDWB 5JXIA 1BZWA 2CWMA 4RR3C 2PHUA 1BHGA 2A6YA 4YG6A 2JIGA 3DYMA 3NAPA 1QIQA 5D2AA 5FP8A 4Y5Z0 5A80A 3J4UH 1WZXA 3S30A 1JOPA 3PMEA 4CZSA 1RUG3 4AQ6A 1W2OA 1H6XA 3BODA 1GYKA 4P9XA 1KS5A 1NCRC 3DF0A 4GXLA 3UKVA 2VC9A 2PHLA 3GZUC 3SEPA 4IGOA 3PLQA 1OLRA 2VGDA 4XFFA 3LA3A 5L73A 5LA9A 4RFT0 3VBFC 2DF7A 3OYWA 2D5FA 5J37A 5IVJA 2WT0A 2YY1A 1IS6A 3GDBA 4KGQA 2JG9C 3B93A 3UKTA 2KD7A 2P6CA 5IK7A 2BVBA 2WT1A 5T55A 4QPGA 1ONAA 5FXWA 2JIJA 4XJAA 4DXRA 1EV13 4PQ9A 3ZSMA 1AR63 5J3UA 5JZGB 5FPBA 4DY3A 5BUVA 2XJSA 4CXYA 4R4ZA 1LOFA 3AFKA 2VTXA 3OCPA 4FAGA 5J48A 1FV2A 2W1UA 1AX0A 2WQ8A 1BXHA 5FWEA 1FOD2 1XE7A 1XJAA 3ZYRA 4CDUC 4DZGA 4UW6A 2HWF1 2PHTA 4CP9B 2FHRA 1KQRA 4OQ9A 2E63A 4ZXKA 2DVDA 1UYPA 5JXJA 4TZDA 1WMFA 3WNLA 4XVHA 3V0BB 1HRV1 1OA2A 4ZXEA 4UXAA 4ZKTB 3EYPA 5CFCB 1APNA 4Y20B 5HXMA 1UXZA 1GP4A 1YWKA 2G4IA 3HOBA 5I0UA 3OF1A 3W5MA 5CG9A 2SLIA 3H9AA 1H2NA 4IQPA 4MXWB 1G9DA 1IKPA 2W2IA 3MFAA 3VN4A 1CIYA 1AL23 3THPA 3WNNA 1OOPC 4DUXA 2WA3A 3F2ZA 4XAAA 4HPKA 1DYKA 1NA1A 1NLRA 2W08A 5JOXA 1DBNA 1X9TA 4ZY9A 4A44A 4LHKA 3K3OA 2B9VA 1W6OA 1MZ6A 2WBKA 2RHPA 3H0OA 2XHNA 3BIWE 3AYEA 5I91A 3VGIA 4MH0E 1C3HA 3BVCA 5E6HA 4A7ZA 2E9QA 4ORFA 2GC3A 2WR9A 4CCMA 2O8OA 4AW7A 2WC2A 2Y0OA 3VL9A 1NE4A 2VPVA 4XF4A 1J83A 3LSDA 1WBFA 3O5SA 4LK7A 4QPYA 5KR7A 3WEZA 3I59A 4RR3B 1NX9A 3SKJE 3D8CA 2VBPA 5BNQA 4YW5A 2WZR3 4K8FA 1IS4A 1GICA 3ES4A 1GZCA 1UW8A 2NN8A 4P08A 5A1LA 3AZVA 3CHXA 3T2PA 4CEYC 4LHNA 1G9FA 4OUSA 4I3PA 3ZYFA 1TMF2 2RS11 4GWJA 2VQUA 4J25A 1V9U2 3TN93 3U4SA 4KWKA 3VBFB 3FN9A 4AI9A 4A6OA 4TLGA 2R071 3AP7A 4DINB 2JG9B 2K2SA 1BBT3 2V73A 4Q4W3 1C28A 3W58A 4XPVA 3GNEA 4RGKA 5BNOA 2FDFA 1C8M2 2ZCWA 4COZA 1J3QA 1PO11 4UFKA 2WN3A 1JYCA 4C8DA 3DYPA 4PT6A 3AVRA 1TME3 1MS5A 1T6BX 4ASLA 4HSLA 2ZHLA 3SMHA 2E51A 3EB7A 3IAPA 3V56A 3LKJA 1YI9A 3HQUA 1LB2A 2Y6HA 1URXA 4NIGA 2Q8CA 1BEV2 2EIDA 2GNBA 3E5XA 4D94A 2XWJB 4CDUB 1V6NA 4MO3M 1ODMA 1W0NA 2GSYA 1KJLA 3SEEA 4Q4X2 4OI0A 1UU4A 1MEC3 1RUNA 3GZEA 1GMMA 3WUDA 2EIEA 5FY1A 5A7PA 3WDUA 1S4CA 4MHUA 3ZSJA 4Q29A 1ULGA 1E5IA 4FSJA 5BY5A 3LOIA 1POV0 2D6LX 2PMWB 3WNXA 3MIHA 4MGYE 2VG9A 1D0GA 4LKSA 3PVNA 1WUVA 4RGGA 4BLJA 1W0OA 5HI0A 3C3VA
chains in the Genus database with same CATH topology
4YM0A 1R1A1 4CEWA 1GLHA 3CEWA 3E6BA 2VOWA 4C91A 1CN1A 5EYXA 2HJIA 2XJPA 3HQXA 2WNUA 1LOAA 5KWRA 2DU0A 1RMU1 4EWDA 1HX6A 1FMD1 1RUF3 3PNAA 4BMBA 5E8AA 3M3QA 2JKBA 5DDJ3 2A5ZA 1AR83 2BVVA 3ZN6A 3VDDA 4B29A 3AB0A 4M0NA 5DUXA 1R081 1RITA 4AF9A 3T1LA 1SBDA 5GLVA 3NL1A 2RMU2 3MIDA 2JEMA 4YZ5A 2XL9A 1C5HA 4JAAA 4YZ3A 4D7TA 1AYM3 5LRSA 1O3RA 3U07A 4LBNA 3FLRA 1AJKA 4JGZA 4GKXA 4J1XA 4M00A 1O4TA 1BMV2 4OHZA 4CEYB 2HWC1 3LB9A 5IT6A 2RS53 3USUA 4YVSC 3B9IA 1RUD3 4WVMB 1PZ7A 3IT8A 5FLIA 1ZZ9A 4KGGA 1S0GA 4RHV3 3GZAA 3MLLA 2PAKA 5K0UC 2FQPA 4RSUA 2DFCA 1UL9A 4FPHA 1YLLA 1OQ1A 4FTEA 4D3WA 4QPIC 2CL2A 4QU2A 1KD7A 3VZMA 5BYNA 4NN0A 1WLWA 3S0MA 3X29B 1AYN1 1JW6A 1AYM1 4HVQA 2IXCA 3P3NA 1ALYA 1PIV3 4NHMA 4P9GA 5JI7A 3AMMA 4I3GA 3POSA 4XOGA 4AFCA 3EXUA 1WMDA 4X6RB 5LK5A 1J3RA 4FPKA 3ZYGA 4IXLA 2EXIA 1HRI2 2ZS6B 1MVQA 3INAA 4DMIA 4S2GA 4K40A 2CWSA 2A6XA 3ATGA 4JGYC 4GB32 1LTEA 3I2DA 5T5LA 3AYCA 3VHNA 3VKLA 5FAXA 1UIJA 4IEZA 3KLSA 3R05A 3ZSKA 2WS93 4LBKA 4CDWA 1LU1A 2BTVC 2ET1A 5F6KA 1ASJ1 1HLCA 4XJ9A 1J1TA 1UU5A 2JD4A 4URTA 5DZEA 2DYCA 1UKRA 5DZGA 1KFXL 3BTAA 1BKZA 1ZYBA 1BCXA 2RR11 1F5JA 1OA4A 3AP9A 4OZXA 2UU8A 1NLSA 4AI3A 5JSRA 4GWNA 3VHPA 3ZVXA 1C5IA 2ZHMA 3M3IA 4YVSB 1DGWA 3EJKA 4WVZA 1POV1 2ETEA 1ULFA 5HBAA 2PQQA 4FPJA 4HK8A 1IS5A 4OHWA 5T52A 4UW4A 4BOWA 3MIEA 1O91A 5K0UB 3NV4A 1M4WA 2OUHA 3CL1A 2F4PA 3IPVB 4DPNA 4N43B 1YYNA 1FX5A 4YYOA 2A6ZA 1G6NA 4LLOA 3WDWA 2HWF2 3O14A 1FOD3 2B46X 4Z07A 3UJQA 1BYHA 1DGRN 1NQDA 4RGAA 1FV3A 1ZRDA 2R0HA 3GF6A 1HRV2 1ZBE1 2QKDA 1C1FA 5EYYA 2IC1A 1J1LA 2VVDA 3RZZA 2KA3A 3AYAA 1VLNA 4G9SB 3WQ1A 3I8TA 4MLOA 4CDXA 2UY8A 1DGLA 3VBRB 2ZX3A 1BQPA 1OD5A 1CPNA 1G86A 4ZU7A 4A2UA 2SBAA 5KHIA 5H9RA 4NO4A 1YO8A 1OLQA 4JGYB 1XYNA 4ISQA 3VBSA 4COUA 2EA7A 5C4WA 3USSA 2ZGMA 4FOVA 5L19A 1FT9A 1F5FA 2CAVA 1HQNA 4CDQA 1RTVA 2UWCA 2IFRA 1LR5A 5I0SA 2H6BA 4Z92B 4AEDC 4A7YA 4AGVA 2GNTA 2NYYA 3AXDA 3HMYA 3LGRA 4XBQA 1W6QA 3O12A 4P5HA 1HIXA 1RJ8A 4YGCA 4XW3A 4BCUA 1JYIA 2A71A 5DUUA 3FFZA 1NA1C 1QMJA 2NMNA 3M3CA 3WV6A 1CIWA 1PGW1 2LTNA 2ENRA 2RS12 5BNNA 2A7AA 1TMF3 4INDA 4IEVA 4DRRA 2R072 1Y7BA 2Z69A 4QXKA 1V9U3 2ZGSA 1GFF2 2EAAA 2KXLA 3H7YA 5FQ0B 3RG0A 5CFDA 2DVAA 2ILMA 3UV9A 4HKOA 1PO12 1AZDA 3JD71 1C8M3 4Q0VA 2W0XA 4AVSA 4BIOA 4EWEA 5FPXA 4RL7A 2XVKA 3NAPB 2QQPA 1IHMA 3H1MA 4KH9A 3WT3A 2AGSA 4YRDA 4MYEA 3E97A 5DUVA 2FMYA 4AHZA 4N7UA 1C1LA 4ES9A 1BEV3 2RE9A 4Q1PA 1N3QA 3VBUC 5FFOC 1LHOA 3OYWB 4L99A 1W6PA 5E88A 5EJ3A 4SLIA 3ZXGA 4LTAA 4Q4X3 2BWCA 3CJIA 4I09A 5GLTA 4ATEA 2WA4A 3FX3A 2BNMA 3AKRA 2VOKA 5C8CA 3GBFA 2CGPA 1WW5A 5JOZA 1PZ9A 4XIKA 3M7AA 1R1A2 2PHXA 4FVVA 3NJZA 3ZXAC 4AFDA 4AGRA 4BH9A 2ZACA 1FPN1 4QM8A 1RUI1 1MS1A 1RMU2 4Z8BA 1C57A 1FMD2 4WM7A 1MVEA 2K0GA 3WD5A 4LA2A 4CP1A 4LULA 1T6GC 3RI9A 1MQTC 1R082 1CAVB 1J3PA 4XF9A 2VUAA 4XBNA 2VNOA 2DU1A 4C90A 4DY5A 2ZHNA 4AEDB 3TYJA 4LT5A 5I0RA 1AX1A 1XNBA 3AXEA 1CQ9A 1Q8OA 3P3PA 2RMU3 4XJZA 1NYWA 2MEV1 4AI8A 2MNGA 2A6WA 1F8VA 2H6CA 4LO5B 2HWC2 1NA1B 4JRAA 5JWPA 1DU3D 4YGDA 2P37A 5JAXA 4Y1YA 3DGTA 5E89A 1LENA 1KS4A 4A3XA 4XYXA 3T1MA 4GMP0 4IV1C 3GHNA 2GAUA 1WGPA 3GALA 4ES8A 3SXWA 3ZIWA 3ZN5A 2RJLA 5E1RA 3DL3A 1FI2A 2WWSA 1XU2A 4J1WA 2EALA 4XTMA 1DQ5A 2R0FA 4K1YA 1CESA 1HQLA 4M3CB 2JE9A 3JCIA 3MPPG 5C8WA 5JR7B 1K5MC 1WCKA 3WCSA 2NZ9A 1AYN2 1WLTA 2DWRA 2ARBA 2Z79A 3LCPA 3VBUB 4EN9B 2ZA9A 1DHKB 1GZWA 4IETA 1O7FA 1TNRA 3RS6A 3VBOA 2JG8C 1DDLA 1GANA 3ZYIB 4QGNA 1NQJA 3WP6A 1GR3A 1DQ1A 3VZKA 5DG1A 1OKQA 3E6DA 4K21A 3MF9A 3WP3A 1H8TA 5KHHA 2ZGNA 5T54A 2AENA 1Q8SA 4R9AA 4B4RA 4XJ8A 4EN0A 1HRI3 5AC91 4IV3C 3TNQA 1TEIA 2VNGA 5KC6A 2EVXA 1D2SA 1CPMA 2PLV1 4GB33 1NCQC 3D0JA 1YXWA 4PIXA 1RUJ1 2OVUA 2GC1A 2PHRA 1U12A 4MGZE 1VBE1 4WM8C 1MQTB 4Y4YA 2I45A 4PIZA 3S6PA 1ASJ2 3M1HA 1HW5A 1UZZA 2YHJA 3D0SA 1G9AA 4Z82A 4O9GA 3POYA 2BBVA 1RINA 1LGBA 1YIPA 2RR12 3BU7A 4CEWB 5ABJC 4JVAA 3V0AB 4LR4A 5CFCC 1EPWA 3DPRA 1YRZA 2UURA 2NQYA 1MR5A 2AUYA 1AHSA 3WG3A 2IXJA 2R30A 2IXLA 1HQWA 2RJKA 4FP3A 2XUMA 5F5QA 3ACLA 3H7JA 5F1RA 4IV1B 4YW4A 2CAUA 2HEYF 4PBOA 2Y26A 3FZ3A 1FAYA 4GH4A 4PIYA 2BFUS 4FPGA 1VBB1 3BOPA 4WVWA 1DGRA 5J96B 1KJRA 4RQPC 4R4XA 3ZXKA 4AVTA 3OPZA 4D69A 2WKKA 1G8WA 1SLLA 4FOQA 4AEJA 4KG8A 4H7LA 1N1TA 5CVRA 4MXVA 1AXZA 2HWF3 1WMEA 4Q0QA 1K5MB 1QNYA 1XNCA 2PAEA 1ZZBA 3GBWA 2DUOA 4I0BA 1VB2A 1ZBE2 4UBHA 1HRV3 1PGSA 3WDYA 2WQ4A 3NKTA 2PN5A 2IZWA 2JG8B 2OZ6A 3RI8A 1RJ7A 4GULA 5D8AC 4J6GA 1YFYA 1XNDA 3A0NA 1GBGA 2QUOA 5HCFA 1U5XA 1MACA 2N7GA 5CA6A 3R4SA 3UKNA 3LA2A 4AI2A 5C33A 4IV3B 2HWE1 3ROUA 3SH3A 4IEWA 1NCQB 4HKLA 2E7AA 4GMP1 4P9YA 3MLKA 1D0HA 3LOBA 1VBC1 3IDEA 3AMQA 4WM8B 1QOOA 3I4IA 2DVBA 4WBBA 3ZMNA 1PK6A 1RC6A 3WW1A 3ZFEA 2NLRA 5KXCA 2ZGTA 1NXD1 2NMOA 5CIRA 4COWA 1W6MB 3NWKA 4X6QB 5FCCA 1V6IA 4B8EA 4YLZA 5BPXA 4KG0A 2QDRA 4RS5A 2D98A 1LGCA 1SLIA 2R6QA 2ZJCA 1PGW2 3CU7A 3NSTA 5GZEA 4DFSA 5ABJB 1LEDA 2RS13 2ZKLA 1IPKA 1IKQA 1VBD1 2R073 2A3XA 4N53A 1DG6A 4XFCA 2PA7A 3JD72 3M3OA 1PO13 2VVFA 3MFCA 4JQRA 5DG2A 2ATFA 2YDEA 4XF3A 3ZMOA 1GQGA 3JQWA 3OBRA 3IKWA 4GA9A 1DGWX 3RMYA 4DOUA 4RQPB 4JCKA 3D82A 4QQLA 4WZFA 4AVVA 4BA6A 3MF6A 1OHFA 1YNAA 1ZBA1 4JDMA 1KRIA 1MZEA 2YUEA 4OI2A 5CNAA 3E5UA 3HT1A 3ELNA 4YW3A 2XKPA 1U0AA 3OD0A 1LOGA 1XNKA 5D8AB 1QJU1 1QXRA 5JOWA 1R1A3 1Y43B 3MW4A 3WOGA 3I7DA 2P3JA 3PTYA 1FPN2 5BNPC 2WFF1 1RUI2 1Q8VA 3ZXEA 3I54A 5JOYA 4E9KA 1NG0A 2VMIA 4FQZA 2LALA 1NE6A 1RVF1 2B5HA 1H30A 3LZZA 1ND2C 3UL2A 1RMU3 2C1FA 4M3CF 1QQP1 4JDNA 1FMD3 1H1AA 1RUOA 3VKNA 2DCTA 3QLQA 2TNFA 2PELA 1F31A 5EZWA 2YGLA 5JIAA 1R083 4LUKA 5A32A 1CAUA 3ASIA 3VBHC 5I8TA 1Q5OA 2O0OA 2FZ1A 2MEV2 3T2TA 4CDXB 3KGZA 3R6SA 1RUC1 3MDPA 5T3NA 4Y22A 2VNRA 5AFBA 1COV1 1U5ZA 3D4KA 4HSJA 3WLUA 3IBMA 2HWC3 4AEMA 3BOWA 1CAXB 1AJOA 4B7EA 3VBSB 4FOWA 4K3UA 4ATFA 4BHPA 2DV9A 1JH5A 4IEUA 3APBA 3S7EA 3WDXA 4OI4A 2JXAA 5I93A 3J8F1 3O0VA 3SCGA 5J7MA 1IGOA 1XE8A 1JUIA 4LUMA 4EJRA 1H1IA 1SLCA 4W65A 1U5IA 4OVEA 4HT1T 1MS3A 4Q8LA 4SBVA 3H1YA 4BPZA 4GIQA 2BPA2 5D1IA 1IZ3A 5CAZA 1AYN3 3IN9A 1RGSA 3L2YA 4Z2WA 1TNFA 3R0RA 5SV5A 3KB5A 1QGLA 3M8LA 5EV7A 4AQSA 2VW2A 1W6NB 4UBGA 1M06G 1ND3C 2QZ3A 3OY8A 1A8DA 4FQ4A 4L2NA 4LE3A 4XFAA 5AC92 5BNPB 1PNFA 4XDQA 5EXOA 1BVVA 2PLV2 4GALA 2ZGRA 2DCZA 4XQDA 1LULA 1RUJ2 2OPKA 1ND2B 4LHLA 1UAIA 1VBE2 2JX9A 1DQ6A 2GC2A 1PM7A 1WD3A 4B3NA 2JENA 4N9IA 1V00A 1YJKA 4N43C 4HLTA 4PDWA 3VBHB 1ASJ3 3TBDA 3GHMA 3NKGA 5C8CB 5JCTA 2VU9A 4CP0A 1PMIA 4YNIA 2D43A 5CBLA 3SH4A 1UPIA 2RR13 1GNHA 3VHRA 1ZRCA 1PZ8A 3NV3A 4FTSA 3CNAA 4M01A 5I8SA 2O8QA 1N1SA 3RJRA 5IK8A 5KHKA 2WIIB 2GMMA 1YCIA 3ZSLA 3CF6E 1POV3 3VBRC 1VBA1 1H1MA 5BXXA 3ZFGC 3AYDA 2VY0A 2AREA 3SNMA 2C5DA 1I3HA 3W59A 3ZFFC 4QM9A 1VBB2 5JZGA 1B35C 2A6VA 3JQXA 4XILA 1YFWA 2WNVC 5H9SA 3ZO0B 3D5OA 5DUWA 2GC0A 4Y1VA 1ZM1A 4XFGA 1DQ4A 3JU9A 4I0AA 5FPZA 1ULDA 3ENRA 4K20A 1PNGA 4GKYA 4C0HA 2X5IA 4K7JA 3ZX7A 1PGL1 3GYDA 3MICA 4AFMA 4G3YC 4MX3A 5C9AC 1ZBE3 3AJZA 1Q56A 2QCSB 4E2SA 1QJY1 1YFXA 4Y20A 3RSJA 4ZU5A 4BWOA 4MXWA 4GH4C 2JDZA 4N90A 1ND3B 1DZRA 2P3KA 3TB0A 4IEOA 1A6CA 1D2QA 1UPSA 1W0PA 1ZNPA 1IQAA 3WW4A 2HWE2 2YGMA 3AP4A 4XEZA 4YVWC 4W6XA 5GZCA 1ZREA 1ULCA 3PVBB 2LM3A 3N7KA 4A7KA 4E27A 1OFSA 1SFNA 1VBC2 3WP4A 3E6CC 1VJ2A 4IEQA 3HN1A 4OULA 4D7SA 3N36A 1DZTA 1OI6A 3NAPC 4FAHA 1Z0HA 3IWZA 1ZA4A 3M70A 4LA3A 4U36A 4XMIA 4C1XA 4LBJA 2R49A 4RR3A 1OSGA 3OGGA 4X8PA 1NY71 3B01A 1UKGA 3MI8A 3WY6A 5GLWA 1H8TB 4Y1UA 4XTPA 3BPZA 4Q8KA 1NCRA 4IERA 2ZGLA 2PFWA 4E4SA 4QPGC 3U11A 4Q0PA 5T5PA 4D7YA 1VBD2 3VBFA 1AXYA 1ZZCA 1UMZA 3TNPB 1GKBA 2JG9A 3R4UA 5FOBB 1LOFC 4FOYA 3ZFGB 2I74A 3JD73 3WG1A 2D5HA 1TE1B 4MUVA 4Q4V1 2VW1A 3ZFFB 3SLIA 1ZZ7A 1S2BA 4LBQB 1B35B 1EAH1 1E57A 1V6LA 3L2HA 1N3PA 4YZ1A 2XVLA 4B4PA 1Z7S1 2WNVB 2XBO1 2YXSA 4Y1ZA 1CAWB 1O5LA 3KCYA 4C1WA 1ZBA2 5FMOS 3MEPA 1QOTA 4CDUA 5KHGA 1V6JA 5C9AB 4FPEA 3QD6A 2WLQA 1ENXA 3B94A 4H14A 2YZ4A 3JZVA 3ME2A 2ZX1A 3ZSEA 3SISA 1S1AA 3WP5A 1S0BA 2NM1A 2NPIA 1QJU2 2UY9A 4GH4B 1DF0A 5B2GB 2WFF2 1IS3A 1J58A 2YMZA 1OOPA 3QCWA 4META 3RYKA 4EV0A 1FPN3 1MZ5A 4EWAA 1RUI3 1ENQA 1RVF2 1LOEA 2ZTNA 1QQP2 3QH7A 4YVWB 4YG3A 1QKQA 1UF2C 5K7PA 4HN0A 3MIFA 2ZPXA 3HWJA 4FPFA 2DUQA 1JXNA 5J09A 2HYKA 3D6EA 1AR91 2ZX0A 1QDCA 4XBLA 1AR71 3ES1A 4AHYA 4YM2A 1QNWA 1SDWA 2ZAAA 2WSVA 4OLLA 2MEV3 4MGKE 4FCAA 3K51A 3IDBB 3O0WA 1RUC2 3VKMA 2LUWA 1COV2 1WCSA 1V6KA 1KDMA 3DUIA 4Q4Y1 1LHVA 5FOJB 4CEYA 4QX5A 2PAMA 4IEYA 5BNOC 4QPGB 2DFBA 3VUOA 2E7TA 2E53A 1RUH1 4WVMA 4I30A 4Q2FA 4QGLA 3AMNA 3J8F2 3WR0A 3U0ZA 1PK6B 4KWLA 1WLDA 1QXJA 1H4HA 4NPRA 1I6XA 3O0XA 1X8EA 4K6BA 2H0VA 2R061 2ZX2A 2XH6A 2WLPA 3M2MA 4QHBA 4YGEA 5FTTC 1I9RA 3CO2A 2P34A 4RS5B 1O3TA 4LO8A 4AWDA 4I0WB 1ZX5A 2HWD1 3TWIA 2BNOA 1V6MA 2ES3A 4W6WA 4XF0A 5F9TA 1A78A 4CEWC 1JTZX 2GH8A 5FREA 1ULEA 2AR6A 1SLBA 1NOVA 1H2KA 2BQPA 1RIRA 1X8MA 4HPKB 2WNUC 2A3WA 2HWB1 1W6OB 4XFBA 4LBLA 4LBMA 2JICA 3KGLA 2GNMA 4NWWA 3RWNA 2ZAHA 5AC93 3VDDC 3KD4A 2PLV3 4PF5A 2GDFA 1WD4A 5IK5A 1LU2A 4P9IA 1RUJ3 3PVOA 1YJLA 3MLJA 4HVRA 2EXHA 2GH2A 1VBE3 1VRH1 5GLUA 1H8VA 4FBFA 3I59B 1VAMA 5GJ6A 4I2OA 3J9SA 4NHLA 2DTYA 3IIAA 4WZCA 4XHBA 3H8UA 5AFEA 1AL0G 4JGZC 4HN1A 2DCJA 5CU1A 4XQWA 1SLTA 4R9CA 3HAGA 5L7OA 3LAGA 4Y1XA 2XKOA 1OPOA 3WINE 3OGJA 2DUPA 3ETQA 1RL3A 1AX2A 1GSLA 3FWEA 1D4M1 5BNOB 2ZMNA 2I07B 5GKAC 1VBA2 1H9WA 1CX4A 2GN3A 2WINB 1PVC1 1RHI1 1VR3A 4QQPA 5F6LB 2VECA 5JPMB 4HBNA 5A32B 2XJUA 1VP6A 2Z42A 5DXDA 3WHTA 4R9DA 1SBEA 2PTMA 1VBB3 4JTOA 4Q0SA 2P3IA 1FNYA 5K0UA 2UYBA 2ZABA 2C9AA 3DKWA 4AEKA 5L36A 2D97A 4Y22B 2BGCA 4QPIA 2WFPA 5JSOA 1PGL2 4I01A 1HV1A 4PLOA 2W39A 4MVTA 2OUJA 3MPBA 1R091 1QJY2 3UJOA 1LHWA 5GZGA 3ST7A 2R041 1DIWA 5HXVA 1XRUA 1KDKA 5ACA1 4Y24A 2XJQA 3Q9OA 1OA3A 1AUYA 1CJPA 1PO21 3JUUA 2WNUB 1N47A 4JDOA 2WJSA 3TOJA 3VHOA 3JBG1 2P2KA 2TEPA 2HWE3 4KBBA 4JGYA 4LLFA 3ZN6B 3BCWA 3VDDB 3OBTA 4CDWC 3MIBA 2PHWA 4GMP3 2VQ0A 3EHKA 4XE9A 1VBC3 2YPJA 1OFNA 1WCDJ 2QNKA 1D4VB 3QH6A 1N1YA 1CD3G 4LNVA 1U5YA 1AVBA 2WNEA 3O7OA 1NY72 4JGZB 3RPQA 1Q3EA 3POWA 1KITA 1QWRA 2VQAA 1Z78A 4M3CE 5FDBA 3N7MA 3USUB 2ZKNA 3QACA 3DN7A 3N7LA 2XGXA 1L3JA 2Q5TA 3SCFA 1VBD3 3N35A 1XQNA 3AMHA 5FQ0A 3HR9A 1VIWB 1QJX1 1LEMA 4YM3A 1IOAA 3KM5A 3LWCA 2XG3A 3B7MA 4AXOA 3KT4A 4Q4V2 4O9EA 3FUOA 1EAH2 4KQ7A 1DZQA 5T5OA 1Z7S2 4AHXA 2XBO2 5KXBA 2PHDA 1EPZA 2D3RA 4MZUA 4LO6B 1S2KA 1REFA 4FTBA 3RYPA 2EF6A 1ZBA3 2BW8A 2EAKA 4MV2A 4LO4B 4S2FA 1IPJA 4AVCA 2ZHKA 4FO9A 1DQ2A 1N3OA 5FO8B 2WZPP 3ZXFA 5JIUA 4CDXC 3VZNA 4AFBA 3MIGA 1B09A 3VL8A 5FLHA 4AQ2A 2GN7A 3KMHA 2DCKA 1HXS1 4R52A 4DNYA 1QJU3 4HZFA 3VBSC 3HBZA 4Q1RA 3WDVA 5C4WC 2WFF3 3FBMA 2A3YA 2RM21 4QQ2A 1O3QA 1RVF3 3AKQA 2P17A 4CDQC 3R4DB 2RS31 5LK7B 3EQEA 1QQP3 1Q8PA 4CDWB 3NO8A 2HKXA 1CONA 1AR92 3KT7A 1RUE1 2AYHA 2A75A 4BZ4A 2X5IB 1AR72 1CAVA 5JDBA 3IM0A 3ZXLA 2AH2A 3B5LB 4DB5A 1F9KA 4AEDA 4QQHA 5LRRA 4L11A 1RB8G 1RUG1 2MHFA 1NXMA 5BNNC 2XWBB 2F6BA 1RUC3 1LJ7A 4W6YA 1COV3 1GQHA 1F2NA 4Q4Y2 4PJYA 3WHUA 4E2QA 1LCLA 3WW2A 5CFDC 5JSPA 1YFUA 4LE4A 5JVVA 5LEJA 4XQ4A 3V64A 3H3ZA 1RUH2 4YG0A 3B02A 2VMGA 3AKSA 3HD8B 4AK3A 4KNCA 3KSCA 1H0BA 1EV11 1MS0A 1AR61 4AVAA 1PVXA 3AP5A 3J8F3 4H7MA 3BB6A 3AZYA 1AF9A 2W52A 4IEXA 3QOPA 4YW1A 4FPYA 5KXEA 3ZDSA 4F83A 2GMPA 2C0ZA 2R062 5T5JA 3W9AA 4L9BA 1X7NA 2GU9A 4M3CA 4EROA 4AI1A 2IXHA 2Q30A 3CJIC 4HL0A 4OHVA 2HWD2 1NCRB 1G9CA 3GZTB 4XIOA 5JMCA 2ZX4A 3VBUA 5C8CC 4JV4A 4HK9A 3NW4A 4FPOB 3SCHA 1AL21 3VZLA 5K8SA 4MSVA 1S0IA 2HWB2 1EP0A 3U4XA 5IUQA 4WM7C 1QOSA 3RMXA 5C4WB 1EYBA 1KXGA 2JJ6A 2DVFA 2XB6C 4U2AA 3NVCA 2A70A 4CDQB 2OW4A 2H0BA 4ISRA 3B69A 2Y38A 1VRH2 1LOBA 1HV0A 4QD2A 4XXPA 4XFHA 3G7DA 3VKFC 1H9PA 1MQTA 3WDTA 1W6QB 2CV6A 2IXIA 2KM2A 2WZR1 1ENSA 2XJTA 3H1WA 2ZZQA 1I5ZA 3ILRA 1XYOA 2DCYA 4Z1VA 1WBLA 2X8KA 2ERFA 4XMAA 4COVA 5BNNB 1CR7A 1XXNA 1OOPB 3FHIB 3V0AA 3TN91 3CJXA 2UWAA 3EO6A 4P9JA 1QDOA 3AFGA 4Q4W1 1BBT1 1D4M2 1SCRA 5CFDB 5A33A 1O5UA 1WLCA 4XZPA 2ET7A 3ILFA 2R32A 4K1ZA 3V65A 4CRQA 2BFUL 2Q1ZB 1PVC2 3ZN4A 1VBA3 1RHI2 2GNDA 4PBPA 2QFEA 3VV1A 1SMVA 2D6KA 4IV1A 4F7ZA 4DXZA 4OHYA 1QF3A 1TME1 2JECA 1QU0A 1V6OA 1SACA 3URFA 2ZZJA 2X29A 3ECQA 1EY2A 2ZMKA 4S2HA 1REEA 2GMEA 3AK0A 3OD4A 1LODA 4ASMB 3JB4C 4GWMA 5L7OC 1UIKA 3FUQA 4JRLA 5AVPA 3WG4A 5CG8A 3SITA 2VXRA 1W6PB 1MEC1 4TYSA 3VBOC 3G6JB 1K5MA 3CJIB 3AP6A 1R092 3L9JT 5I0TA 3B9CA 2R042 1QJY3 1GV9A 1XU1A 2E6VA 2JG8A 2TUNA 4BIFA 5ACA2 1H8TC 4WV8A 3MGUA 1PO22 3AM2A 1WW7A 5KXDA 2XJRA 1S0EA 2A73B 2HEVF 2ZGQA 1QH7A 4WM7B 3JBG2 2DVGA 4PLMA 1RUF1 4AHWA 5KC5A 4KU8A 1ZRFA 4IV3A 5DDJ1 1AR81 3KS7A 1A8MA 1UN1A 2VUJA 4RA0A 1Y3TA 1NCQA 3S7IA 5FRAA 4AQTA 1N1VA 3FFQA 3RDIA 4TWTA 1QH6A 4WM8A 2D93A 1C8NA 1HKDA 2JE7A 4LO7A 1SQ4A 4X8NA 1H4GA 4AGGA 5T50A 1W6MA 1YIFA 2D44A 2WL1A 3DPRC 1J59A 1YUDA 3WZ1A 3WX5A 4FT8A 2PYTA 1WW4A 2Z2SB 2CY6A 3V0BA 4UW3A 1Y9QA 2RS51 5ABJA 3N7JA 3N4MA 2VMHA 5CFCA 4QMAA 1RUD1 2Y0IA 3MZHA 5GALA 1OQDA 1VAVA 1QJX2 4L8QA 1QHDA 3C2UA 1DLLA 3MYXA 4RHV1 5H9PA 2VULA 3B3QE 1DYPA 4BQ1A 4H3WA 3RYRA 3NV2A 4YZ2A 1UZYA 3IMNA 1S55A 4Q4V3 2YYOA 2Q4SA 3FE5A