1E57A

Physalis mottle virus: empty capsid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
160
structure length
160
Chain Sequence
SPAIVLPFQFEATTFGTAETAAQVSLQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPATPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPKLLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PHYSALIS MOTTLE VIRUS
publication title Structural Studies on the Empty Capsids of Physalis Mottle Virus
pubmed doi rcsb
source organism Physalis mottle virus
total genus 15
structure length 160
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1e57A00
4N43A 3J8F1 5DDJ1 1RVF3 4Q4V3 2RS51 5K0UB 2Y26A 1ND2C 2X5IC 3VBOB 2HWE1 1V9U2 1VBD1 4CDUA 1HRV3 1PIV1 4CDWC 3ZFGB 1B35B 1RUE3 4QPGA 2HWC2 1TMF3 2WS91 2RMU2 1POV3 2PLV3 1AYM1 1MEC1 1V9U3 4AEDB 2ZZQA 1FPN2 3LOBA 1HQNA 4GH4A 2RM22 1QJX1 5C4WC 3VBRC 1FPN3 2RS32 1NA1B 1NCQA 4LLFA 3CJIB 4RS5A 2WZR3 5C8CB 1X36A 1WCDJ 2R071 1ASJ2 1AYN2 1C8M2 4CEYC 1VRH2 1RUI1 4JGYA 5JZGA 5L7OC 4N43B 3VBUA 4WM7C 1VBB1 3VDDA 1AR91 1CD3G 1OPOA 1C8M3 1FMD1 1QJZA 3VBHB 1TME2 1AR61 2HWB2 3DPRC 1A6CA 1ND2A 1RUC3 2HWD1 1PO13 4JGZC 5BNNC 5C9AA 5CFDB 4FTSA 2GH8A 1PO21 4CDQC 4CDWA 1AR83 2XBO2 5CFCC 1RMU2 3JD71 4FTEA 1R082 4RHV2 1R091 1Z7S2 2XBO3 3JBG1 5C4WA 2RMU1 2DF7A 5ACA1 4CDUC 4YVWB 3J8F3 5DDJ3 4QPGC 2RM21 1RHI2 1QJY2 1HXS2 4CDXB 1BBT1 2RS31 5L7OA 4WM7A 1BMV2 1VBD3 1QJU2 4QPIC 4BCUA 1ASJ1 1HRI2 2MEV3 1AYN1 3VBFA 2X5IB 5AC93 1VRH1 4RS5C 3TN92 2RR12 1NG0A 2WFF2 1FOD2 1MEC3 1RUH1 3NAPB 1COV2 4Q4Y2 5BNNA 1ZBA1 1EV12 4JGYC 5JZGC 1TME1 1RUJ1 1COV3 4Q4V2 1NOVA 1NY71 1PVC1 3ZFFC 1EV13 1RUF3 5CFCA 1MQTC 2R062 1R1A2 3VBRB 1HRV2 3FBMA 4WM8C 1RUI3 4IV3C 1K5MA 1RUE2 2ZAHA 5BNOA 1TMF2 5C9AC 4IV1A 2R063 1R1A3 2PLV2 1VBB3 5A32A 1AR93 4GB32 1RUD2 2BUKA 4CEYB 1VAKA 1AR63 1Z7S1 4GB33 2VQ0A 4CEWC 1RUD3 2HWD3 3S6PA 5BNPB 4N53A 2RS13 3IDEA 3DPRB 2WZR2 4QPIA 4RR3B 1PO23 1DDLA 4JGZB 1D4M3 1H8TC 4YVSC 1AR73 5ABJC 1VBE1 4GMP3 4CDQB 1VBC2 1AL21 4Q4W1 1HRI1 1ZBE1 2HWF2 3TN91 2RR11 1ND3A 1POV0 5K0UC 1RUC2 4Q4Y1 3ZFFA 1PO12 1VBC3 1E57A 3VBFC 1MQTA 2HWF3 1RUG3 1VBA1 3VBOC 1BBT3 1EAH1 1RVF1 3ZFEA 4WM8A 4CDUB 4IV3A 1AR82 3VBSA 4QPGB 4GH4B 1BEV2 4FSJA 1CJDA 4CEWA 5FMOS 1AL0G 2R043 1QQP3 1V9U1 3JB4C 1NCQB 2IZWA 4Q4X3 1BEV3 1VB2A 1ZBA3 3J8F2 5DDJ2 1NCRA 1K5MC 4RS5B 5BNOC 1RUJ3 2HWC1 3CJIC 4IV1C 2RS52 2BPA2 2WWSA 5C8CC 2QQPA 1FPN1 1PVC3 1GFF2 2FZ1A 4JGYB 5JZGB 1H8TA 3VBUB 4YVSA 4PDWA 5ABJA 2RS53 3VDDB 5D8AC 1VBD2 1PIV2 1F2NA 1OOPA 3ZFFB 2MEV2 4N53C 5AC92 2HWE3 3VBHC 5FMOL 1MEC2 1PIV3 5K0UA 1ND2B 4EJRA 1C8M1 2WS93 5C9AB 2GSYA 3VBOA 1AYM3 4CDWB 2TBVA 3ZFGA 1B35A 1QJX3 1RUF2 4RQPC 4Z92B 4SBVA 2HWB1 2R072 4AEDA 1ND3C 1AUYA 1RUI2 1VBB2 5C4WB 1AR92 2R073 3ZFEC 1NA1A 3VBSC 4Q4W3 3CJIA 1AR62 2XBO1 1RMU1 5C8CA 4CDXC 1FMD3 2HWD2 2BFUL 5L7OB 1R081 2RS12 4RHV1 4WM7B 1M06G 1VBA3 5D8AA 1EAH3 4Y4YA 1PO22 4RFT0 1D4M2 3VBFB 3VBHA 1NCRC 1AR72 1RHI1 1QJY1 3JD72 3M8LA 1HXS1 1C8NA 2FZ2A 3NAPC 5BNNB 1R092 3JBG2 1PGW2 5CFDA 2MEV1 4PDWC 5AC91 3JD73 1BMV1 5ACA2 4Y5Z0 1QJU1 1PGL2 1OOPC 1R093 3JBG3 4RQPA 5CFCB 2HWC3 1RUG2 2RMU3 1BBT2 1RB8G 5ACA3 2WFF1 1FOD1 1COV1 1K5MB 2RM23 5BNOB 1EV11 4IV1B 5A32B 1RUF1 4Q4V1 2RS33 5J98B 4YVWA 3ZFGC 1B35C 3HAGA 5J96B 1RUH2 5D8AB 2R061 4CDXA 1R1A1 2R042 1QQP2 4AEDC 1ASJ3 1HRV1 1AYN3 4GMP0 4N53B 4Q4X2 1ZBA2 1VRH3 5BNPC 1RUE1 1RUH3 1W39A 1RUJ2 1TMF1 1F8VA 1NY72 1POV1 2PLV1 4QPIB 3ZXAC 2XPJA 4GB31 4RR3C 5LK7B 1RUD1 1PVC2 1NA1C 2X5IA 1TME3 2RS11 2HWB3 3NAPA 4NWVA 1SMVA 5A33A 4RQPB 2HWE2 1D4M1 4N43C 2WZR1 3JB8A 1AR71 1ND3B 4GMP1 2WS92 1MQTB 5FOJB 1AYM2 1PGW1 2WLPA 1RMU3 1IHMA 2BBVA 3VBRA 3ZFEB 4WM8B 4IV3B 3VBSB 1R083 5GKAC 4RHV3 1PGL1 1QJX2 1VBC1 1Z7S3 5CFDC 2HWF1 1RUG1 1OHFA 1X33A 4CEYA 2BFUS 1RUC1 1PO11 4GH4C 1RHI3 1QJY3 1VBE2 4CEWB 1HXS3 4NWWA 1HX6A 5BNPA 1AL22 1AR81 4Q4W2 1NCRB 1NCQC 1ZBE2 1VB4A 1VBE3 3DPRA 4RR3A 1QJU3 1FMD2 1AL23 1QQP1 2R041 4JGZA 5A33B 1HRI3 1H8TB 2ZTNA 1ZBE3 4Q4X1 1BEV1 4YVSB 1VBA2 4PDWB 4YVWC 3TN93 2RR13 5ABJB 4FTBA 2WFF3 3VBUC 1EAH2 1FOD3 1RVF2 4Q4Y3 3VDDC 1OOPB 4CDQA
chains in the Genus database with same CATH superfamily
1YEWA 2JIJA 2QQMA 5IK5A 3J8F1 2OA2A 2WNOA 3M70A 1V6OA 3GGLA 3PMSA 1H2MA 3Q8BA 5K0UB 2Y26A 5D1IA 5FY1A 5DN2A 3HBZA 5FWJA 2W0XA 4L0PA 1QWRA 4IESA 4BQYA 1O4TA 5FZEA 1HN0A 3IT8A 5ISLA 1W6OB 3IDBB 2WKKA 1E5HA 1UY2A 2A3WA 1V9U2 2OUJA 3MUZ1 1UZ0A 5FZ3A 4HN1A 4CDUA 5HPOA 2KD7A 3TYJA 1JUIA 3SH4A 5A3WA 3NKTA 3IBMA 5H9SA 3CQOA 2HWC2 3R4UA 2RMU2 1POV3 2PLV3 2XXZA 5AVPA 2GNMA 4GXLA 5I0DA 4R9BA 3HNYM 4C90A 4AG4A 3LA2A 3LPGA 3RWKX 2Q1ZB 3WOGA 3O5SA 3PU3A 3WQ0A 3PJYA 3M3EA 4UWDA 2YHJA 4CCOA 3VBRC 2HYXA 3URFA 2VMHA 2BZDA 4P9JA 2CWMA 3CJXA 3FHQA 4LLFA 3O0WA 1V6MA 2XB6C 2VQUA 3WD5A 1E5RA 3FC0A 1I5PA 2CHHA 5FLIA 1KS4A 1MZ5A 4LR4A 1HIXA 1RC6A 2WJSA 5LY2A 1X36A 1FYUA 1WLCA 1O6UA 2R071 3I2HA 5HCAA 2Y6LA 4CEYC 1RUI1 2JIGA 5JZGA 2JDYA 2WSUA 2ET7A 3LEIA 5FYBA 5IWFA 4C8DA 3VKLA 1C1FA 3ZDVA 4RD7A 1CD3G 1OPOA 3RWNA 4YFWA 4KG0A 3WNNA 1HB3A 4TZDA 1ST8A 1YJLA 1TME2 2GAUA 5EP9A 4CCDA 1OD3A 1AR61 3DPRC 4YM0A 5DZFA 4P5HA 3IIAA 4LT5A 5I91A 1BK1A 4U2AA 2A3XA 2VCAA 5IYYA 2ZKNA 3AP6A 2ERFA 4JGZC 4K21A 3JQXA 1H9WA 4IEXA 1Z78A 2QZ3A 4JDNA 4NIAA 4IEVA 2ZGUA 1WMDA 5GZEA 4TTGA 4LKSA 4XPVA 4DUVA 2GH8A 3H0OA 4NPRA 1RUNA 2CNAA 3UKNA 2WZ8A 4HK8A 1AR83 1CAVB 1UQXA 4XJ9A 1I3HA 1QJEA 4A4AA 2JG8A 5H9PA 3ETPA 2FCTA 3HNMA 1WZXA 4ZXKA 4Q1RA 1HQLA 5F5CA 1LHVA 3FZ3A 1R082 3EMRA 4WBBA 3UJOA 4PQ9A 2ARXA 5CA6A 1W0NA 2XBO3 3AMHA 4MZUA 3ZSLA 2OIIA 5LBCA 4J6GA 4Q8LA 4CDUC 4RGAA 1KDMA 5FPBA 3W9AA 1L7LA 4AAPA 1JYIA 4HZFA 2UWCA 5FP8A 1O8SA 5E88A 1GBGA 1TNRA 4QX8A 1QJY2 2VG9A 4LHSA 1BBT1 3PJQA 1UY3A 3NJZA 3T1MA 4BIFA 2WNVA 4CE8A 2G9ZA 3C7GA 4XVHA 1W3XA 2VY0A 2AACA 5L7OA 3OYWA 4MOAA 2QDNA 4M0NA 4XFGA 4QKBA 5FZ6A 1SFPA 1G9DA 2XJSA 3AVRA 4OFGA 4BZ4A 2B5HA 2C0ZA 4XOGA 1KFXL 1QJU2 4DINB 4QPIC 5FMDA 3ZYPA 4BCUA 1Y9QA 2K9ZA 3ZKUA 2J42A 4EWDA 4OHWA 5FTTC 1HRI2 3WHUA 1AYN1 3CEWA 5FY0A 4BMEA 1VRH1 3O14A 4H3WA 3T2TA 4LKEA 5A7WB 1JOBA 1X8EA 1MEC3 2YBPA 5HV0A 3NAPB 1FNYA 3P1IA 4Q4Y2 4YM1A 1CIYA 3OG2A 4LBQB 3O1MA 1DGRN 5FZOB 3GBFA 3SMHA 4KH9A 4AE2A 2E63A 5FZ9A 4DEVA 5JZGC 4ASLA 3PTRB 3UGGA 2YFUA 1RUJ1 4WZFA 1J83A 2ZKLA 1W9TA 5I0RA 3K51A 4XBLA 1H2NA 1W2TA 3T0DA 1QHDA 2EAAA 2P2KA 1O4ZA 3K4AA 3OBTA 5FCCA 1EV13 5CFCA 5J36A 3LCPA 4JRAA 2R062 4AW7A 2XVGA 3MPBA 5IFTA 5CKMA 3RMXA 2CWSA 4AVAA 2GALA 3UJQA 3WF3A 4WM8C 1LOEA 1PMIA 2FQPA 2BNOA 2EXKA 2WNUB 3DN7A 4BU2A 5IVEA 2HKXA 1K5MA 5A6YA 4QHZA 3RZLA 3C3VA 1R1A3 2PLV2 3J4UH 3BPZA 4GB32 4I3PA 2DVFA 3AZXA 3RYPA 5CKQA 5KXDA 4LBJA 2ZGNA 4XF1A 1VAKA 2A6ZA 1TEIA 5LA1A 5FYYA 3CMGA 2RV9A 4HKWA 4CU8A 4ZU5A 3U4XA 2VQ0A 1RUD3 3IAQA 2B46X 1WCSA 3GXUA 3S6PA 2DVGA 4QDQA 2FCVA 3J7MA 2W87A 1OKOA 2R7EB 2PHWA 3B3QE 1EUTA 5FPUA 3VL9A 2D3PA 2J1RA 2KA3A 5A7OA 3M7AA 4K40A 5CKNA 4JAAA 2R32A 5JIAA 1BQPA 2D43A 4LKFA 4QB6A 3WT3A 3JZVA 3S7EA 3PIJA 4P9IA 1XE8A 4Y5TA 1U5XA 4UFLA 4DRVA 3GHMA 4K6BA 5EFUA 3S57A 4YVSC 1AR73 5ABJC 1VBE1 1DZQA 1JMUB 3DF0A 1SBEA 2R16A 3LA7A 4KL1A 1PX4A 4GIQA 4UT5A 1VBC2 3S0MA 3RZZA 4Q4W1 4XMIA 2Q8EA 2HWF2 1EY2A 4UW6A 2RR11 5K8SA 4JQTA 5FYZA 2CDPA 1K5JA 3ZFFA 1I1EA 1WW7A 1E5IA 3MIGA 4NAMA 3WF4A 2CY6A 1LJ7A 3ZIWA 5A3PA 1VP6A 3K75B 2BJSA 5FO8B 1R1ZA 3U10A 1RUG3 4BH9A 3MLLA 4YW2A 4E4HA 4LBMA 3ZN4A 4AI3A 4IV3A 1AR82 4P9WA 3VBSA 2XUEA 4AQ6A 4P9XA 4LK7A 4YZ1A 1S0BA 2AZ5A 3OB8A 3WQBA 5EV7A 1CAUB 5FJKA 1AX2A 3AMMA 2E26A 3J9SA 4E4SA 5EZWA 3ZYRA 3GZAA 4FOVA 2J1UA 4EN8B 1N3OA 5FAXA 1OD5A 1D0GA 2DUPA 1ULGA 4CUGA 4D94A 1CJDA 4AK3A 5KHHA 3GYDA 4CEWA 2R1DA 4QHOA 2VECA 2R043 4QWNA 1V9U1 3JB4C 5FY9A 1W8FA 1UAIA 1EUUA 2D6NA 1BEV3 5T50A 1A8MA 1K5MC 4CCNA 3P3PA 1O5UA 2HWC1 2XLGA 3CJIC 1FV2A 4G4FA 5DZGA 2OPWA 2K2SA 5C8CC 2E7QA 2CGOA 3TNPB 5FZGA 5FR3A 1BK0A 2FZ1A 3CKHA 1H8TA 2JDZA 3K4DA 3PHMA 3PVOA 2GMPA 1UIJA 3UKVA 4HETA 4NE9A 5F2WA 1PIV2 4LBOA 5FRAA 1F2NA 1W8OA 2VNRA 1ULDA 1FXZA 5FBZA 1JH5A 2PN5A 4PLOA 2PHDA 5FKCA 4PT6A 5FMOL 5KHJA 1MEC2 2YROA 1YFUA 2WBKA 2XOMA 4NPLA 4QDSA 5K0UA 1YFXA 4EJRA 4NIHA 2VZQA 1K42A 4P08A 2BVVA 5C9AB 1PNGA 2FDHA 2VZTA 1LESA 2G9FA 3I3DA 3KZ4C 2XKOA 2NMNA 3LSDA 2QVSB 2TBVA 2YXSA 1IQAA 3WLUA 3H8UA 2EICA 4LBLA 4OQ8A 1PGSA 2XJUA 3M4FA 4BOWA 1YRZA 2VVDA 1JYNA 3KMHA 1QGLA 2ZX4A 4BE3A 4DZGA 4K3UA 5HCBA 2RDRA 4FPFA 4QGMA 1QKQA 2R073 2WIIB 4KG8A 1NUKA 3Q9OA 1HW5A 1SLLA 4QU1A 2R0HA 3VBSC 4GJZA 4NVPA 1CIWA 3WP4A 3BGAA 3N9LA 2D6PA 2BGOA 3N3HA 4N90A 1Q43A 2ZGQA 3ILNA 3OUHA 3POFA 4PCRA 2DDUA 4Q8KA 3UV9A 5LA0A 5FZ8A 2BFUL 4CTEA 2JE7A 4KWUA 1N1TA 1R081 5TSWA 4FQ4A 1IKQA 1CPMA 4QGNA 4FPJA 3APBA 5CEHA 4GWIA 5HBAA 1M06G 1YIPA 4PI2A 3KVBA 3I59B 4QX0A 4HVQA 3LOIA 3TOJA 3H7YA 4Y4YA 1NQJA 4RFT0 2LRPA 3WQ7A 4AVSA 4L9BA 5I8TA 2BBAA 1JI6A 2PAEA 4LHLA 3DXTA 3LWCA 4CUCA 1W2NA 4UFMA 3ZN6B 1AR72 5LZ6A 1QJY1 1SQ4A 4XACA 2FZ2A 4MVTA 2WAOA 4MXWB 2W68A 3DGTA 4NMIA 1VAVA 5EXOA 2GC3A 4NRPA 3JBG2 4W65A 3TBDA 1VMHA 4RGGA 2XL9A 3NSTA 5DUXA 1SZBA 5FYMA 1D7PM 4AVCA 2BOJA 4Y5Z0 1WCQA 2VGDA 1GQPA 1QJU1 4AHZA 1CAVA 4RQPA 1F9KA 3OOXA 2BP6A 3G6JB 3EQEA 1RUG2 4EWAA 4BXFA 4O7XA 1LTEA 2VZ1A 2ZX3A 5LK5A 4CP1A 1IG0A 4XE9A 4L97A 3NO8A 5ANQA 1LHOA 1Q8VA 4R9CA 3LDKA 3NJVA 2QJVA 2WN3A 2Y6FA 4KU7A 1W6NB 2W92A 1SDDB 1XB9A 3B7MA 4FFFA 3WCRA 4NRQA 2G19A 3DYPA 3WG2A 1GYKA 2BRTA 2VZUA 3OEAA 2DVDA 1I9RA 2Q1FA 1PMJX 4LO6B 1IZ3A 4Z2WA 5JIUA 4HT1T 3U14A 2R061 4MXVA 2XVKA 3E97A 1J84A 2R042 1BZWA 4FPYA 1AYN3 2PXJA 1ULPA 2D3SA 4UAPA 2VMFA 1VRH3 3KHCA 1DBNA 2GP5A 4CP2A 3AB0A 5GLUA 3RZMA 4B4RA 1NY72 1POV1 2PLV1 4QPIB 5T54A 1J3PA 2DV9A 3AXDA 2YG0A 4GB31 5CB7A 1DG6A 4OVEA 4AQSA 2Z5WA 2WLQA 5FZ4A 1Y7BA 1V6NA 2VOTA 2HWB3 3RVHA 3NAPA 1OQEA 4LBQA 4YG0A 5FZOA 5A33A 4QX7A 5EYYA 4OI2A 3MGUA 2ZHLA 5GJ6A 3ROUA 1HV0A 4HONA 1LODA 2ZGRA 1W0OA 1YQ5A 2F17A 1F5JA 3AVSA 4GMP1 5L19A 2FCUA 4N9HA 2WYFA 2DCKA 5FOJB 3Q8AA 3KM5A 3C7HA 1HN1A 1XOYA 2ZGKA 5FP3A 3AX4A 1LEMA 4WM8B 3KF5A 1NLRA 5DAWA 1CJPA 1QH6A 2ZMKA 1W8TA 2WNUA 4FI9A 4RHV3 5FZHA 3RQ0A 3FFZA 4Z82A 2PMWB 1VBC1 4FT8A 4Z2AA 4QXKA 1G6NA 2GNDA 3AYAA 2PELA 2HWF1 2EF6A 1UOBA 1OHFA 2AENA 2J22A 3OPWA 3QBQA 1D0HA 1ZYBA 1DP0A 3VN4A 1MS0A 5HXMA 1CONA 1ZX5A 2IXCA 1HXS3 4NWWA 1IGOA 3USUB 3P5BA 4BDVB 3H3UA 3SNMA 2B45X 5L9VA 3AL6A 4QKDA 1QDCA 1RJ8A 2E31A 3LDRA 3UL2A 5E6HA 1AL22 1US3A 1AR81 4QPWA 1NCRB 1JZ5A 1W0PA 3SCFA 2XG3A 1VBE3 5FY7A 5BXXA 3ZSEA 5AFEA 3ZXKA 1GKBA 4XBQA 3L2YA 4YSFA 3PMEA 5KC6A 4E2SA 3I3EA 4IE6A 5FZ1A 3BTZA 3H3LA 1U0AA 4W4ZA 3LQCA 3OBZA 4B1MA 4FPGA 2JKXA 4XFHA 4FAGA 2VE1A 3HT2A 1Y9MA 4YVSB 5ABJB 2RR13 4URAA 1WLDA 2WFF3 1KFUL 1RVF2 2DUQA 2OS2A 3VBUC 4HN0A 2FMDA 2CV6A 3PTYA 5LATA 3VDDC 1OOPB 3IIIA 1OC1A 3L2HA 2NM1A 3M2MA 2P3KA 3H7JA 1ODNA 3RSJA 4I2OA 1EYBA 5F7UA 4AEKA 4IGOA 3PIGA 4Y26A 3N9NA 2ILMA 3I49A 4YNIA 3NV4A 2BGPA 1GZ9A 4MV2A 2E51A 1SFYA 4IERA 4JTNA 5CYYA 5FY5A 4ISRA 1ND2C 1SDWA 4P00B 3WP6A 3ZYHA 5JOWA 1OVPA 4R4XA 5FV3A 3UK9A 4BQ5A 4PI0A 1LKNA 5GZDA 1T6GC 2VZOA 5FPLA 3LEKA 4P9LA 2ZMLA 5I0UA 4CUBA 5IW0A 3USSA 1G9AA 1MZFA 1DYPA 1HRV3 1PIV1 2A5ZA 2XR4A 4XF4A 3ZFGB 1RUE3 2OT7A 5DABA 2Z4FA 1X8MA 1CAUA 2YGMA 3OF1A 1AYM1 1MEC1 1V9U3 4IE0A 4J1XA 4JQRA 1ZRCA 4XFAA 3FLTA 3LOBA 5A3OA 2VUDA 1HJFA 1JYXA 2WT2A 4XDQA 1UY4A 5T5PA 1CQ9A 3POYA 2JB8A 3WZ1A 1GNHA 1N1SA 2Y6JA 4AEMA 5IK7A 1NA1B 3J7LA 1CX1A 4QQLA 2WNUC 2EIGA 3QLQA 3RGBA 5M0TA 2ENRA 3CJIB 1GUIA 1STMA 4XF3A 1CESA 5C8CB 1WCDJ 3K4ZA 5FO7B 5LASA 4CSWA 2B39A 1J58A 3JU9A 3WR0A 3AZWA 1AYN2 4QU2A 1ZRIA 4YZ3A 1C8M2 4AQ2A 1JXNA 1VRH2 1EP0A 2HLEA 4A44A 4COUA 4BYYA 2F6BA 2A75A 4N43B 5FLHA 4FAHA 1H1AA 2VD7A 4WM7C 2ADEA 1NZIA 5FP7A 1UY0A 3ZKYA 4CP9B 5I93A 1UX7A 5IVVA 2NP0A 2VOKA 3I2FA 4UF0B 1ENRA 3PVNA 4AQTA 5FZIA 2C9AA 5F5IA 2VOWA 4HVRA 4V2WA 2P37A 2HWB2 4DPNA 1XPWA 1W6MB 1YQ6A 2WO1A 1A6CA 2WC2A 4SLIA 4EN9B 3O1RA 1F5FA 3POBA 3UKTA 1S0JA 1DQ6A 1FI2A 1MVQA 5BNNC 4OZXA 4XHXA 5C9AA 5FZDA 3WNKA 4IGQA 1UMHA 3O7OA 2RVAA 2EXJA 5DPNA 3AL5A 2FDKA 1CVNA 2YU2A 3CF6E 4BM8A 3E6BA 3W21A 4Y1YA 4XUNA 1UMIA 1V6JA 4BIOA 4LK6A 2WSVA 4OMCA 5HCFA 3HQXA 5A80A 2YDEA 4FXKB 1AJKA 3BTXA 4RHV2 3BOWA 1OVSA 2PHTA 4PJYA 3JBG1 3MDPA 2E7TA 5FP4A 3ZN5A 3WSOA 3NW4A 1S0GA 4DY5A 4XTPA 1WW4A 3DXUA 2OKXA 4CUAA 4YW3A 5JSOA 2GNTA 3CLPA 5DDJ3 4HXCA 3MLJA 2ZX0A 3ACFA 1HXS2 2RDNA 1CX4A 1FT9A 2O0OA 2R0FA 2EIEA 2UU8A 1LOAA 2VZPA 3KF3A 3N9MA 2B8MA 3TEWA 1C28A 4BISA 2YV8A 4JC1A 2RG4A 3GNEA 4B1LA 2LM3A 1AZDA 1UZVA 2DFCA 5FIXA 3I59A 5E8AA 1VBD3 3C2UA 1D2SA 1BJQA 1SLBA 2FMYA 2B42B 1ASJ1 5IAVA 2VQTA 2RR12 4DY3A 1YI7A 1GOHA 2WFF2 3I2GA 5T55A 3ZN6A 1G9CA 1C3HA 3ILRA 1CWPA 1JU4A 4MXWA 4H55A 5C3RA 1LRHA 3O1PA 2BNNA 2JDUA 3T0BA 1AX1A 2WINB 3E6DA 3O1OA 4OYUA 2VMGA 2IXIA 1Q8OA 2FBEA 3NNLA 3RJRA 5FYUA 4ASMB 2ZEYA 3T4VA 5IK4A 2XJRA 1BHGA 1NOVA 1NY71 4XURA 2CL2A 4C0HA 1U5IA 1QDOA 3LEMA 4IEWA 4GAZA 4BMBA 3T4HB 1DZTA 2Y6HA 3VZOA 4DUWA 2ZPXA 2QQKA 3PUSA 1MQTC 2WO7A 4LBNA 3CZJA 3LZZA 5A6QA 2J1EA 3I8TA 5FP9A 1HRV2 2BW8A 1O8PA 2VJXA 3ETQA 3I7DA 1RUE2 5IATA 5FK7A 3WQ1A 3C8XA 1W6NA 3HT1A 2Q30A 2R063 5C9AC 2BDRA 2QDRA 5I0TA 5A7QA 4GWJA 1AR93 3WCSA 4OCTA 4EN0A 4EWEA 1KXGA 4O61A 2X05A 3H8XA 3BIEA 4LOSA 4KGGA 4JDOA 3TRSB 4LO5B 5FDBA 2DUOA 2WWJA 3AYEA 5DUUA 2MHFA 4GB33 1PVXA 1GP6A 1SCSA 5F5AA 4ZY9A 2WR9A 3BN6A 2JG9B 4IGPA 4LUMA 4ZONA 4CU9A 5B4NA 2QQWA 2Q8CA 3BUCA 3M3CA 4LBKA 4W50A 3KT1A 4QPIA 5FWEA 2V5DA 1LNSA 1DDLA 1DQ0A 1YQ2A 5FUPA 2E6VA 5EJZB 3R05A 3WG1A 3HJRA 3VKNA 3LEGA 1W8WA 4Y1VA 4PLMA 5A7NA 2W47A 4GMP3 3VZMA 3UYJA 1FNZA 3JXSA 1H6YA 2VCBA 3HNBM 3J26N 1AL21 3O0VA 5LBFA 4FPKA 1L7RA 3R4SA 3WNMA 4AHWA 2QQJA 3IMMA 4F8AA 3TEYA 3OUJA 3D0JA 4FFIA 2GMEA 4M01A 2JDNA 2Z42A 1POV0 2ZGPA 4FFHA 5F37A 1E5SA 1VBC3 2XUMA 3FLRA 4INDA 2O8QA 3OPTA 1MS3A 1QNWA 2HWF3 5FQ0B 1GWLA 2IUWA 2D93A 1RVF1 4NHLA 2BWAA 4WM8A 2D6OX 3MFAA 1XNBA 3ACGA 3T0AA 4QPGB 5FKBA 1UYPA 2RJLA 3B9IA 4IUGA 2KR2A 5GZCA 1JOJA 3MV01 1WLTA 1YQ8A 5L9RA 3PUQA 2H0BA 3NNJA 1Q56A 5DUVA 5EJ1B 4ZS3A 2O14A 5FZMA 1W90A 1J3RA 1W05A 5FOBB 1D4VB 1S0CA 4AZZA 3GM8A 4QX3A 4RGKA 1AL0G 5FMOS 3USUA 2XKPA 3M3OA 4M3CB 4QAWA 4Y33A 1C5IA 4BXSV 4NIDA 3ZDSA 2LUWA 1SPPB 4FPOB 1NCRA 4NJ4A 5DDJ2 4UW4A 1S0IA 1L3JA 1ZA4A 4KWJA 1QH7A 1LCLA 2RS52 4ISQA 2VNOA 2WWSA 3O0XA 2YUEA 2VUJA 1IS4A 4AI0A 2OVUA 3WW2A 3VBUB 3JQWA 3EYPA 1ZZ8A 3NMBA 4KWLA 4YVSA 5ABJA 2HH9A 2EXHA 2XJVA 4XTMA 3MW3A 1VBD2 4NIIA 1ODMA 3VDDB 5FY8A 5JI9A 1OOPA 4CCEA 5KR7A 1ZZ6A 4PHZA 4BK5A 2ARAA 1BKZA 2QQVA 4LHKA 1HLCA 4MGZE 3W5MA 3VBHC 3VGIA 3AM2A 4B7EA 1ALYA 4JVAA 1PIV3 1Y4WA 3VKOA 4QQPA 1ND2B 4DS0A 3BVCA 2VMDA 4GZ9A 1GQHA 2FDJA 5EIYB 3N7JA 4GKXA 1F15A 1C8M1 2EXIA 1XNCA 5FZAA 2GSYA 5FBJA 1S55A 2VOXA 3HBKA 3ZMNA 5JXJA 2CAUA 4MSVA 1AYM3 3F95A 2FHRA 4WVMB 4XXPA 2Z79A 3JCIA 1F4HA 4B7KA 1H2LA 2VVEA 4BJ0A 4YZ5A 1T6BX 4Z8BA 4EE2A 1IPJA 1JYVA 4MGTA 1REEA 3HMYA 4FFGA 3RYRA 4N7IA 4JZRA 3NJXA 3ZFGA 3T09A 4A2UA 4M4PA 2YGLA 1OF4A 1NXMA 4XYXA 1ZZ7A 4DQAA 1KD7A 5FMCA 1ZRDA 1CN1A 2HWB1 3KS7A 4H2AA 3ZYFA 5EWSA 4XF9A 2R6QA 4Y3OA 4XAAA 4ZU4A 2IVIB 3PNAA 1JTZX 4IW3A 3POJA 3THPA 1AR92 2Y33A 4RYDA 1MZ6A 1CZVA 2WN2A 2CAVA 2PHFA 4M3CE 3THDA 1Q8SA 4F83A 3ZPOA 1NA1A 2WABA 1QOTA 3HQUA 3RG0A 1LOBA 3GALA 2VW0A 3I2JA 3CJIA 1FATA 2HEVF 2XJTA 3IKWA 1I5ZA 2VXJA 2ZXQA 4YARA 3A0KA 1PNFA 5FXVA 5C8CA 2K0GA 4CDXC 4EN7B 3GBGA 3A4UA 1ZZBA 4XUTA 5FYTA 3K77A 3DYOA 4MGKE 4RHV1 2BV4A 2IXHA 4MGQA 4OULA 2QUOA 4WM7B 4Y4RA 4W8JA 3VD5A 2UURA 2QNKA 2VNGA 4Y24A 1J1LA 1WWYA 4CP9A 4GALA 2I07B 1VALA 5EHDA 3U07A 1W3VA 2LALA 3VZLA 4A45A 3K3OA 3ZYIB 3ST7A 3J7NA 2YU1A 3MICA 2ZCWA 3VBFB 4I0AA 4AF9A 1NCRC 3T2QA 3M8LA 3JD72 1ENQA 4YGEA 1HXS1 1U12A 1W6MA 4ZS2A 3LGRA 4LUKA 1QY4A 3T2PA 3DV8A 3MO4A 5JMOA 3IZOA 3E5XA 3I97A 1JBCA 1O4YA 1R092 1YWKA 4XBNA 3VHRA 4LMFA 2O1QA 5BNNB 1OA4A 2MEV1 3WVJA 5IVBA 5AC91 3IDCB 1OLME 1UY1A 1CAXB 2A6YA 4TYSA 5HI0A 1JOPA 5EPAA 1SBDA 2P6HA 3IN9A 1C1LA 4XAEA 3RYKA 1OOPC 3JBG3 4HKOA 3KV4A 1W2AX 3ACHA 3Q8EA 1RB8G 1Y9GA 2WFF1 1QXRA 4LKDA 2FDFA 4LPLA 3AKTA 1ZRFA 3MF9A 5JSPA 4G3YC 3KHBA 5BNOB 3T2OA 1J3QA 1Z0HA 1LGCA 4DB5A 4LQRA 1RUF1 2DYCA 4JKKA 2GC2A 2B7YA 3ON7A 2Y38A 4KWKA 3KVAA 5C70A 5E89A 1GSLA 5HCHA 1KITA 4CA9A 2P4EA 5IUQA 1G9FA 5J98B 3SXWA 3AK0A 3ZFGC 1ZA7A 3S30A 1RUH2 1P8JA 1UXXX 4UI9L 1CAWB 5D8AB 2AREA 3WG4A 1S0EA 1I6XA 1WD4A 4YZ2A 5KHGA 2C1FA 2Y0IA 2Q8OA 2P3YA 5JR2A 1ASJ3 1HRV1 4K20A 4N53B 4ZHNA 4UXAA 1NE4A 2ZHNA 1QU0A 1RUE1 2VMCA 5CBLA 4PIYA 4LORA 1F8VA 4M00A 2UWAA 4QQHA 3G7DA 3ZXAC 3M1HA 4I09A 1FV3A 4DUXA 5E1RA 4RR3C 2YPJA 4PLNA 1NA1C 3FN9A 2J1TA 3SITA 3HPNA 5I0SA 4NWVA 1WMXA 2F4PA 3NV2A 3UT0A 2C26A 3NNGA 4KQ7A 3ITQA 4S2FA 3OSDA 5E16A 2D7FA 1QMJA 4QPYA 1UW8A 2IC1A 2W46A 4W6WA 4I0BA 5CNAA 2BYVE 4N43C 4Q2FA 3RZKA 2E7AA 5G04L 2ORXA 1ND3B 5CIRA 4ES8A 5LCWL 3BODA 4NUBA 4WVWA 3SH3A 1CZSA 2WWUA 5F39A 1U5ZA 1GP4A 1MQTB 1UKGA 5K7PA 1W03A 1AYM2 1PGW1 3B9CA 2WLPA 5CVRA 2A6XA 2YZ4A 1DLLA 1W2OA 4QXBA 4ORFA 2Q0AA 4EZHA 1DQ2A 5B4XA 3LF7A 4BQ4A 1PGL1 5DUWA 3SEPA 1W6OA 3SKVA 1ULFA 3R4DB 4DFSA 1V70A 2OPKA 4YZ4A 3I54A 3IM0A 1PM4A 4Q0SA 3WF0A 3I2DA 3HOBA 3JUUA 4D69A 1V6KA 4AR2A 3H1YA 5L36A 5HXVA 4GH4C 2YPDA 4G9SB 1PZ9A 1RHI3 4AL9A 1GR3A 1LEDA 2EAKA 1HX6A 4IEZA 4XZPA 3R6SA 1RINA 4ARYA 1B09A 1L7QA 2Q5TA 1ONAA 1NCQC 1KEXA 2JG9A 2JE8A 4HLTA 4YGDA 4ZKTB 2QQNA 1VB4A 4P9YA 5FLJA 1KRIA 5I8YA 4BQ3A 1NXD1 3BKZA 4CCLA 4WZCA 2VZVA 1LOFA 1QXPA 1AL23 2SBAA 3CNAA 1O3TA 5KWRA 3GZEA 3PVEA 2ZTNA 3IB3A 4CCMA 4Q4X1 4NR1A 3MIHA 4PDWB 3TB0A 1IKPA 3U11A 3KQ4B 3VD4A 1FOD3 4HVOA 3UETA 3ELNA 1S1AA 3NNFA 4EZ4A 4LLOA 2SLIA 1NLQA 4C1WA 1YXWA 1AXYA 5LEJA 3IAPA 4IEOA 4OUMA 3WDXA 5CAZA 5DDJ1 3WINE 3CIHA 3M3IA 3ZO0B 1RVF3 3FE5A 5ERLA 1ULOA 4Q4V3 4EQVA 2RS51 4HSLA 5C3SA 3LDBA 2D40A 4NO4A 4QGLA 3V0AB 1DZRA 4LTAA 2N7GA 5IAXA 1H1MA 2A6WA 3K3NA 5FQ0A 1UU5A 4ZZ5A 4QXHA 1KJLA 5FK8A 2JDAA 3WNPA 1VBD1 3KT7A 2CTVA 1H6XA 3A0NA 1SLCA 4CDWC 4BHPA 1JHNA 2PAKA 4LO8A 3MPPG 5CADA 4QPGA 2XLFA 2WS91 2ZHMA 2GNBA 3AJYA 3POIA 4IEUA 4PIXA 1S2BA 3I3QA 4S2HA 1JYWA 1MVEA 3SQOA 2ZZQA 3NV1A 1FPN2 4FP3A 3WXPA 3V0BB 2VTFA 4FPCA 5EQUA 1OMIA 2GZWA 5FPVA 1GZWB 3LFMA 1QJX1 3ZIXA 2VBPA 3MW2A 1MPXA 5C4WC 4MYEA 4M3CA 1GU3A 4XXAA 4COVA 2VZRA 4P14A 4AYUA 1SPPA 4CCKA 1VRBA 5FZBA 5J48A 2DVAA 2WZR3 4AFBA 3GHNA 3VLBB 4A7KA 5JPMB 3QD6A 4FP2A 4AVVA 1ASJ2 2NMOA 3MIEA 1O59A 4RSUA 3ZYJB 1QIQA 2P17A 2WAAA 3MF6A 5FZKA 4AEJA 3DECA 4D0QA 3WNOA 3VBUA 4X8NA 1BVP1 3VV1A 3VDDA 1AR91 3MBWA 4Y20B 3OGVA 4IQPA 1C8M3 4META 5D21A 4OUEA 1QJZA 1RXGA 3VBHB 2XWBB 4BWOA 2JG9C 2JX9A 3O12A 4KU8A 3PUIA 1G8WA 2JECA 3UGHA 3THCA 1ND2A 3HR9A 2DVBA 3U1XA 1GWKA 5CU1A 1LOFC 1PO13 4KBZA 4XDPA 4HOOA 5KHKA 1G9BA 5CFDB 3PUHA 5A7WA 3S5AA 4E27A 1YQCA 4O9EA 2VXRA 1V00A 3ALQA 1W28A 1OLMA 2XJPA 2YC4A 2W94A 3U4SA 4FTSA 1TG7A 2YBSA 1IS6A 1JUHA 1QNYA 1ENSA 3O1TA 2HEYF 3VB9A 3V65A 5GZFA 4LXLA 4XFBA 2XQXA 5DG1A 5JXGA 3A21A 2D44A 3VD3A 4FO9A 1RJ7A 3JD71 4FTEA 4AGGA 1UU6A 4UW5A 1MS1A 1SACA 4Y5SA 1R091 2VU9A 3ZFEA 3DKQA 4MO3M 3OGSA 3A22A 1DGWX 2F4LA 1XXNA 3MIBA 4CP0A 3VKMA 1F31A 1OF3A 2CSGA 3NJYA 4JCKA 4YVWB 2ZGTA 4QPGC 2RM21 1RHI2 4H14A 4CDXB 4CCCA 2WT1A 4W6XA 1XNAA 4TN7A 3PURA 3WF1A 4AGRA 2RS31 4M3CF 4M4RA 3WP3A 1H1IA 3RDIA 4WM7A 3P6BA 2PAMA 4JKMA 1BMV2 3CU7A 5CZKA 3H9AA 4Q29A 1GNYA 5T3NA 4UFHA 1HB2A 1WW6A 3OBAA 1PMHX 4HK9A 5FPXA 2MEV3 1QOSA 1GLHA 1S0FA 2BU9A 2X5IB 2OX0A 4IDZA 4XQDA 3VBFA 4RL7A 5AC93 3T30A 1FOD2 1RUH1 1COV2 4URTA 1W06A 2DTYA 1ZVFA 1GP5A 5KXBA 5BNNA 4ES9A 4NHMA 1O7FA 3N35A 1DGLA 1NZCA 3ACIA 1CAXA 4Q4V2 2I2SA 3L9JT 4DO0A 2YYOA 2V72A 4Q26A 5DMYA 4Z1VA 5T5JA 5LW9A 1GANA 1RUF3 4YRDA 3EJKA 4PF5A 4AFMA 3INAA 3K48A 3ZXDA 2JD4A 3HIFA 3FBMA 5F3GA 2E33A 4OI4A 5FFOC 1OI6A 3D4KA 1UF2C 1YFYA 4D7SA 4D8MA 2ZAHA 5BNOA 5J1XA 5KC5A 1J1TA 4XFIA 4E2GA 1VBB3 2GC1A 1UWWA 3AP9A 3N7KA 2PQQA 3BYWA 3OTFA 4EROA 3HQRA 2D6MA 4YG3A 3B93A 2A71A 4H7MA 5A3TA 3SC7X 4GKYA 2QE3A 3ZXGA 1Z7S1 5HV4A 2WYSA 1CAWA 2VOVA 2K46A 4FCAA 2HWD3 3WY6A 1C4RA 4N53A 1WLWA 3LAGA 2QBXA 1OUXA 1N47A 3ECQA 3IDEA 5G05L 2WZR2 3OY8B 4RR3B 4HFSA 3I2IA 1UYXA 3RZJA 1PO23 5T5OA 4JKLA 3WDTA 1YO8A 4COZA 4LEJA 3AZVA 3AKQA 5H9QA 3KV5A 4E8DA 2EALA 3FWEA 3ME2A 5JOZA 2W91A 2DCZA 2ATFA 2EVXA 4BLIA 3ENRA 3CL1A 3AMNA 4CDQB 2TUNA 1LHUA 4P9GA 4OUSA 1REFA 5A3NA 2XLAA 4H7LA 2WUHA 3TN91 3X29B 3WW3A 2Y34A 1GV9A 4IE5A 1ND3A 1JYTA 5FXWA 3IDAA 2ARBA 5A3UA 1PO12 4A3XA 2JKBA 3SCHA 5T5LA 1V6IA 4U36A 5SV5A 1MQTA 3MEPA 3VBFC 4D3WA 4FOWA 1J59A 2VMIA 3VBOC 4GQ7A 2BGCA 1YCIA 4OLLA 3U78A 2AH2A 3SHRA 4MH0E 2QTWB 4BLJA 4MGSA 2V4VA 2QKDA 2P1BA 3FJSA 3AP5A 2ZEWA 1F4AA 2YC2A 1BCXA 3MV11 3E6CC 3MHZA 4HBNA 2E9QA 1DIWA 4UW3A 4XUQA 2A6VA 4GH4B 4QKNA 3VUOA 2WA3A 3B5LB 2ZABA 1REDA 3RJ2X 2Q8DA 1GWMA 4ITCA 1TVGA 4EYUA 1HV1A 2HEWF 2C5DA 3U37A 1IPKA 1NCQB 2IZWA 1G86A 1VB2A 1ZBA3 2ZZJA 4Q4X3 2WZPP 2ZA9A 4E9KA 2OW4A 4RN5A 4RS5B 5BNOC 3PLQA 2OYZA 4IEPA 5DQ0A 3PDQA 3LIHA 2BPA2 1GQGA 4ARXA 2A7AA 2D5FA 4XIOA 4A3ZA 1FPN1 1PVC3 4JHTA 4JGYB 4XEZA 3TWIA 2ORZA 4PDWA 2W2IA 4OI0A 2JJ6A 2RS53 5C3PA 5D8AC 2PHUA 3POSA 4JV4A 3MIFA 4TLFA 1BVVA 1LHNA 3ZFFB 5LWBA 2MEV2 3PU8A 4N53C 1KQRA 1XU2A 3N9PA 5AC92 2ZHKA 2ET1A 1VR3A 2YMZA 4NROA 5BUVA 2JB4A 3KWVA 3B69A 4QHBA 3WNLA 4S2GA 4LBQD 5A1FA 3MIDA 2OZ6A 2WDBA 3DYMA 4ZU7A 3V0AA 2WS93 2VNVA 1VIWB 5JMCA 1ZRRA 2XGXA 2XVLA 2ZBJA 3UESA 4AI2A 3OEBA 4CDWB 1JU3A 1PK6B 1YHFA 4MGIE 1LGBA 4A41A 1N1YA 1QJX3 1RUF2 3GDBA 4QX2A 4A6OA 5GLTA 2Z69A 4UBGA 1ND3C 1AUYA 3V0BA 2TEPA 3J7HA 4XW3A 2AGSA 1RXFA 4B29A 1GZWA 1UYYA 2VUAA 2UY8A 1VBB2 4FPEA 3AJZA 4TXWA 5C4WB 1S4CA 1UNBA 4HMZA 3S7IA 4AHYA 1GMMA 4AI8A 2OQ6A 2P6CA 1UIKA 3I2KA 3RPQA 2UWBA 3ZXEA 1MACA 2X29A 3Q8CA 2AR6A 2LROA 3DCQA 1S0DA 2HWD2 3OUIA 1RIRA 4Q27A 4TLGA 2WRAA 4LA2A 4XILA 3BTYA 3T08A 1VBA3 3KCXA 4QM9A 5FUNA 1EAH3 3ZYBA 4Y20A 1MS5A 1PO22 1DHKB 2ZGLA 2P5BA 1VPHA 2OUHA 3D8CA 3UGFA 1XYPA 4HKLA 3OPZA 3WW1A 3VBHA 1MS8A 4PBPA 3ZPYA 5A6XA 4D7TA 3NVCA 2J1AA 1RHI1 3LPFA 5LY1A 5BYNA 1XSRA 4JDMA 4M0HA 1YC61 4XQWA 4AWDA 4LHNA 5K9YA 1H9PA 3POEA 4OHVA 3AP7A 3C7EA 1Y3TA 1M4WA 4OHXA 2MNGA 1PGW2 2OZJA 5FYCA 1HKDA 1XE7A 2WQZC 3OD0A 5CFDA 3VKFC 3ZYGA 3BCWA 3D82A 4PDWC 3JD73 2BTVC 2W9XA 4FOQA 2QQIA 1BMV1 5ACA2 2DBNA 4A6SA 1UMZA 2C4XA 4XETA 1PGL2 1R093 4E8CA 4R9AA 2J1SA 4XJ8A 4V1PA 4NHYA 1US2A 1NAEA 2JEMA 3DKWA 4UFJA 1DQ4A 1QEXA 1W2UA 2L9LA 2VC9A 3F2ZA 1FOD1 2D6KA 3N9OA 1COV1 1IQDC 1OT5A 1HB1A 3RI9A 1X82A 4DRRA 1WKYA 4K1YA 1UOJA 1SHWB 2W39A 2X09A 2Y0OA 2RM23 1WUVA 3A23A 4IV1B 4COYA 4K8FA 5A32B 1YIFA 3V64A 2UYAA 4Q4V1 2D3RA 3ZXJA 2Q1MA 2E32A 2RS33 5JCTA 2R30A 4AOCA 1LECA 1JZ2A 5I8SA 2QZ2A 4YVWA 5F3CA 3CZUA 3HAGA 5J96B 4CYDA 1ULCA 1JZ4A 4QX5A 5A6ZA 2AUYA 4CDXA 1F35A 5BY5A 2GC0A 2V5YA 2XL7A 1UO9A 4HANA 4GMP0 4Q4X2 1ZBA2 2QFEA 1SCRA 4X6RB 5BNPC 3U0ZA 1D2QA 1OH4A 1RUH3 1YI9A 4ASKA 3N7MA 2IXJA 5BV6A 3CDZB 3FLPA 1A34A 4QMAA 2XPJA 1X9PA 1UU4A 5LK7B 2BERA 2BVBA 4XC9A 1PVC2 1GICA 1ZZCA 2QQUA 4LO4B 1W8UA 4DOUA 2X5IA 3LIGA 4CCJA 1WCKA 2RS11 2TNFA 3H3ZA 3K46A 1CZTA 3T3YA 4IL7A 4CXYA 4D6SA 3AMPA 4MG2A 3D0SA 1O5LA 2VBBA 1SMVA 5LRRA 2PHRA 4RQPB 3AC0A 2A3YA 4Q5OA 1D4M1 2AEZA 5JOYA 3TNQA 4A7ZA 3GJBA 4CXXA 1OURA 1ZM1A 2WZR1 3QOPA 1AJOA 2VAUA 3JB8A 4O9GA 3GBWA 5D2AA 4HPKB 1LGNA 2W08A 4YLZA 5GM0A 4MX3A 4TSVA 3O1SA 2WS92 2PA7A 4CU6A 4XABA 1H30A 1W9YA 3NRUA 4KI5M 3BPSA 1RMU3 2BBVA 3O1VA 4QQOA 1LENA 3BIWE 2VH9A 3T1LA 3ZFEB 1KDKA 2GU9A 1OFNA 2VVFA 2VO5A 3H8OA 1JW6A 4GD4A 3LFIA 3RI8A 3W59A 2ZGSA 1QJX2 1MS4A 1TZOA 1Z7S3 5CFDC 2BEOA 1LU2A 3OGGA 5F6LB 3KGLA 2GN7A 5A70A 1X33A 4CU7A 3AFGA 3KV9A 2DU1A 5J37A 2BFUS 2YB7A 1PO11 2UYBA 2JE9A 3IPVB 1JYCA 4CPBD 5LBEA 3B94A 3D3AA 5A3LA 2GN3A 1H2KA 4RFRB 3OJBA 2IFWA 4I02A 4ONUA 2W1UA 4CZSA 1H8VA 1JHJA 4F3JA 4CXWA 1OKQA 5FYIA 1UN1A 3TEXA 3CO2A 4XDOA 1ZBE2 4YGBA 4YW1A 1W6QB 5FXXA 3OY8A 2J1VA 4IE7A 5FYVA 3GF6A 4RR3A 4OHZA 2DU0A 1JZ3A 2NLRA 1O91A 2W5FA 1QQP1 3KQRA 5A33B 1IS5A 1UXZA 4YVWC 4D7YA 2CDOA 1VBA2 5IVFA 3TN93 2FDIA 3WX5A 1HB4A 2HBUA 1EAH2 1UPSA 5IVCA 4YW6A 1JS9A 2VR4A 5DXDA 3ZVXA 1PM7A 4LO7A 4CDQA 3B02A 3FUOA 3HN1A 4DXZA 4C0BA 1DGRA 4XMAA 4Y1XA 5F3EA 4N43A 4QDRA 4JRLA 5J09A 1N3PA 4XJZA 3BALA 2VBDA 1SBFA 4UF0A 4XF0A 2X8KA 4TWTA 5JUVA 1QJFA 1OLQA 3FUQA 2X5IC 3VBOB 4F7ZA 2GP3A 2HWE1 2V73A 4J25A 1ULEA 4PQQA 3VDAA 4LOTA 1DQ1A 2G4IA 4B4QA 5FMBA 3N36A 1B35B 3PUAA 1TMF3 2D98A 1W8NA 3N4MA 4ZXEA 3ES1A 2JG8C 2IXKA 2B9VA 4AEDB 4QB1A 4E4DX 3D6EA 3VDCA 1QOOA 3WW4A 1HQNA 4GH4A 2RM22 1SLTA 4Y22B 2R1BA 2W1SA 2Y64A 2LS6A 1C57A 2EIDA 2GH2A 2IWGB 3CHXA 4PF1A 2WNEA 4IXLA 1FPN3 2RS32 3M3QA 5IVJA 2A73B 1EPZA 5SV8A 1NCQA 2HYKA 5IVYA 4D6RA 1JZ8A 1W8ZA 1XNDA 2KXLA 4LIVA 4RS5A 4WV8A 3GCXA 4R52A 4FVVA 2DCTA 3RFRA 3OGRA 5BPXA 4XZUG 3ZSMA 4BQXA 4CRQA 5CG8A 1AXZA 3WP5A 3N9QA 3ASIA 1Q8QA 1XNTA 4ATFA 2WNVC 3FHAA 4NN0A 3SH5A 4JGYA 3ZXFA 1XE0A 5L7OC 3DUIA 4NPMA 5F5QA 5GLZA 4DXRA 1VBB1 3QACA 4Q0UA 1URXA 2VW1A 3GJAA 1V6LA 4AVBA 1FMD1 1JN2P 1UD1A 5C5UA 4FOYA 4UBHA 2G9GA 3KD4A 3NWKA 1H4HA 1WBLA 2DFBA 5FZ7A 1IS3A 1OQ1A 4N9IA 1RTVA 4YGCA 1W6PB 3ATGA 1RUC3 2HWD1 4QQ2A 2JDMA 4LA3A 3CBNA 4AGVA 1XYOA 2VCCA 3KGZA 4L92A 4BA6A 1W99A 4MADA 4DXTA 5F1RA 2G1MA 4UYBA 3SISA 5JVVA 5FYSA 5LB6A 1PO21 3SEEA 2C6SA 4CDQC 4CDWA 1PK6A 2DCJA 2Y6GA 2JICA 2MPFA 3VD7A 2RDSA 1W9WA 2XBO2 1UZZA 3HN3A 2B9UA 3S5QA 5CFCC 1RMU2 3FFQA 1T2XA 3W58A 2D6LX 4L99A 3SLIA 2FDGA 3VZJA 2ZMNA 3H42B 1Z7S2 2WL1A 1UOGA 4LNVA 2X53S 1A8DA 3FMGA 1TQ5A 1WW5A 1DQ5A 5C4WA 3WEZA 1UPIA 2RMU1 3KCCA 1XYNA 2DF7A 2VQAA 5ACA1 4W6YA 2W1QA 3RS6A 1MS9A 1CR7A 3J8F3 1AF9A 1IG3A 3KSCA 4C91A 3BU0A 2R49A 1RITA 2ID4A 5JWPA 4BB3A 3HD8B 4ET7A 1YJKA 4OQ9A 1XBFA 5B2GB 3A7QA 5JXIA 1AVBA 5A7SA 1VJ2A 5APAA 4NAOA 4LE4A 5IT6A 5FZ0A 1UCXA 2QCSB 1YYNA 3O1UA 5FZCA 1OQDA 5JPNB 1LAJA 4RS5C 3TN92 3AZZA 1NG0A 4K7JA 1WD3A 3RZHA 1K3IA 4QM8A 3VHOA 2A70A 2C9KA 4R9DA 5IFPA 1XC6A 2PFWA 4K9SA 5H9RA 1A78A 3HEIA 4AVTA 1YLLA 1LB2A 2ZGMA 1ZBA1 1EV12 3C7OA 4JGYC 4BQ1A 3RRDA 1LHWA 3ZSJA 1TME1 3ZR6A 1DYKA 2P34A 1COV3 3DL3A 1WGPA 1BLZA 4UFIA 4X6QB 4DXSA 2NPIA 4QX1A 4MHRA 2ZEXA 1JZ7A 5C7GA 2RJKA 5J7MA 1PVC1 3ZFFC 2I45A 5F8PA 4B3NA 2RJ2A 2ZX1A 5DZEA 5A3MA 1R1A2 1AXKA 3ZLIA 1YNAA 2LTNA 4KMQA 2RDQA 3VBRB 3FX3A 1HDKA 2JD9A 2VMEA 5C6CA 1WCUA 3PL0A 4NOTA 1RUI3 4Y1ZA 4DIQA 4IV3C 2OQ7A 1OBNA 1N3QA 5C71A 1EPWA 1TMF2 3QH7A 4IV1A 5A32A 1ZNPA 2JDKA 3MFCA 2AEYA 5JXHA 2CGNA 5F2SA 2AC1A 1JODA 1RUD2 1Y43B 2AYHA 1RUOA 1QXJA 2BUKA 4CEYB 1PK6C 3MLKA 4NRMA 4JHZA 4YG6A 1FAYA 2A1XA 4DNYA 1AR63 1IOAA 1OFSA 5C8WA 2XDVA 4I0WB 5DAQA 4CEWC 1NKGA 5A1LA 3POWA 3R0RA 5BNPB 4GULA 2GMMA 2RS13 5GLWA 4Y1UA 5FPZA 3NL1A 4AFDA 3DPRB 3WDVA 2JDPA 4K8RB 4MUVA 1OPMA 2VUCA 4JGZB 3EBRA 2VTXJ 3EO6A 4B4PA 4K1ZA 1D4M3 3THTA 5AFBA 3ES4A 2NN8A 4GWMA 4XIKA 1H8TC 2E53A 4I3GA 1PZ8A 3LB9A 2WQ8A 5ANNA 1IPSA 2VCMA 2IVJA 1WA6X 3LKJA 5FO9B 4COWA 2WO2A 1HRI1 4OHYA 2DBIA 1WA4A 1R64A 1ZBE1 2BWCA 2XHKA 3EHKA 3K2OA 2C24A 1Q8PA 4QD2A 4XJWA 5GALA 1PZ7A 1KJRA 2XWJB 4V2VA 4HPKA 5K0UC 1RUC2 4Q4Y1 2WZEA 2ZX2A 5F32A 1E57A 4N8MA 3VDBA 1ZZ9A 3I3MA 2FD8A 3MYXA 4XUPA 4EV0A 2GDFA 1VBA1 1BBT3 1O3QA 2D97A 3MZHA 1EAH1 3VHNA 2JWPA 4OMDA 2JENA 3KV6A 1TE1B 2XH6A 1V0AA 1GNZA 4P5YA 3I3BA 5EJ3A 4CDUB 4EN6B 1UL9A 2CYFA 3VZKA 1A3KA 2YBKA 1Q3EA 1AHSA 1SEFA 2NZ9A 3BU7A 1OUSA 4WVVA 2BQPA 3NV3A 4WVMA 3AP4A 1WMFA 4KBBA 2BOIA 1SG3A 4UFKA 5FPAA 5JDBA 3TAYA 1OXCA 1BEV2 1DYOA 4FPHA 2JXAA 4XJUA 1S2EA 4XCBA 3IPVA 4OI1A 3RMYA 3WDWA 4FSJA 2QQOA 1DLCA 2DURA 3ILFA 1TNFA 2PQSA 2HBTA 3B01A 3ZXLA 4ATEA 3ZOIA 1QQP3 4GWNA 5AVAA 5C3OA 5KHIA 1BXHA 1OH3A 3J8F2 5JAXA 2ARCA 2Y6KA 1RUJ3 1W6QA 4IV1C 4Z07A 4YPJA 1XU1A 2W1WA 2PHLA 4GA9A 4Q0PA 4BPZA 4L11A 2D5HA 4HG6B 2QQPA 3EB7A 2ZACA 3LD8A 4YW7A 1GFF2 5JZGB 2DCYA 5T52A 1LU1A 2ZS6B 3NNMA 1VMFA 4JX0A 3OD4A 4X8PA 5GZGA 4KNCA 4Q0QA 4R4ZA 1CGPA 1WMEA 1NE6A 5C5TA 3BTAA 5A7PA 2HJIA 3HWJA 5L73A 5LBBA 1DF0A 2OXBA 3FBYA 3P3NA 4KGQA 2HWE3 1SLAA 4AFCA 2EA7A 2ETEA 4I30A 1FX5A 3ORJA 5JLVA 3ZMOA 1C5HA 3H1MA 1SFNA 3WUDA 3NKGA 5CISA 3VBOA 2J7MA 1LULA 3OGJA 1POQA 3UNPA 3U75A 4XJAA 4ZPIA 1YFWA 2LW8A 2W52A 5EYXA 3I2OA 1U5YA 3AMQA 4PIZA 3EXUA 1B35A 4RQPC 4Z92B 1LOGA 2ZAAA 3H50A 3N7LA 2JG8B 2IFRA 4I01A 4SBVA 3WF2A 4YFZA 4MGYE 2VM9A 2YY1A 1NLSA 1WBFA 2PHXA 2R072 4O65A 4AEDA 4IEYA 1LOCA 2CGPA 5FYHA 1Q5OA 1RUI2 2DWRA 5DAPA 2VW2A 1G7YA 1RL3A 1GZTA 2WO3A 2XJQA 2YC0A 3AYDA 3DEMA 3HVDA 3VD9A 4Y22A 1UOFA 1UZYA 4YM3A 3ZFEC 4Q1PA 3QH6A 2X10A 3MUY1 3AXEA 2QQLA 5C3QA 4Q4W3 2WFPA 1AR62 5KXEA 1MR5A 2XBO1 2ZEZA 1RMU1 1MZEA 1FMD3 1VLNA 2WNVB 1VE0A 2XHNA 4FPLA 4E2QA 3MW4A 5L7OB 2RS12 2UY9A 3OYWB 3FHIB 3LSEA 1XNKA 2JDHA 5D8AA 3AKPA 3ZSKA 1N1VA 4AXOA 3H8RA 5JI7A 5CG9A 3I4IA 5KXCA 5FY4A 1D4M2 1O3SA 3FL7A 5F9TA 5K4LA 5C33A 2Y8KA 2XONA 4AFAA 4YM2A 2H6BA 4YYOA 2BNMA 1C8NA 2V09A 3NAPC 3VZNA 1W6PA 3PVBB 5FZLA 4QKFA 3IMNA 3AKSA 2H0VA 1OA3A 4LJHA 4OZOA 3V56A 4MLOA 5F3IA 2VZSA 4RA0A 1K12A 3B00A 1XJAA 4LITA 3KLSA 1BYHA 5BNQA 1K45A 5LEKA 4LE3A 2XQRA 1GOGA 3ZR5A 4PBOA 5CFCB 3WHTA 2HWC3 3SKJE 2RMU3 4IETA 3SCGA 1BBT2 1CPNA 5ACA3 1GOFA 4NHXA 5FJHA 3C7FA 5DAVA 3GZUC 2RE9A 4UOJA 2Y60A 1VAMA 5JR7B 1K5MB 3WDUA 1ZREA 2EIBA 3BB6A 3LA3A 1EV11 4HSJA 4HL0A 4QT6A 5L9BA 5IHRA 5IK8A 5F6KA 1LR5A 1W8HA 3POGA 3E1F1 3LE0A 4Q0VA 4QB2A 1HJGA 1DCSA 2PTMA 1X7NA 2CU5A 2ZJCA 4GJYA 1OA2A 5FUIA 2VPVA 1B35C 4ZZ8A 3BI3A 2WA4A 2P3JA 1R1A1 1O3RA 3H1WA 5FXZA 5JSRA 2VZ3A 1QQP2 2H6CA 4AEDC 4XQ4A 1HQWA 4AHXA 2ADDA 3WNXA 1SLIA 2WQ4A 2RHPA 2Q4SA 1NQDA 1S2KA 3VL8A 1W39A 1RUJ2 2PYTA 1TMF1 1VMJA 3OCPA 3QCWA 4N7UA 1PHMA 4XUOA 5KBFA 3WDYA 5LRSA 1RYYA 2B4KA 1X9TA 1RUD1 5DAXA 2ZOEB 4FXGB 3BOPA 4C1XA 2KM2A 1TME3 2Z2SB 1PX3A 4J1WA 5LA2A 1KGYA 4FQZA 2W95A 2O8OA 1NX9A 4JTOA 3ABZA 4XFCA 3E5UA 1X50A 3ACLA 2WT0A 3ZM8A 3OBRA 2HWE2 3AZYA 3WG3A 3KCYA 4XCAA 1QF3A 3VHPA 5A1AA 4QXCA 1AR71 2V4AA 2ZGOA 2W3JA 5JOXA 4BQWA 4L2NA 1OLRA 3AKRA 4A42A 4MHUA 1UYZA 2VULA 5GLVA 4L8QA 3TEZA 1IHMA 2DTWA 3VBRA 1DU3D 4YW5A 2I74A 4CPBA 1UKRA 3E5QA 4IV3B 1RGSA 3VBSB 1R083 4IEQA 5GKAC 1DGWA 2IXLA 4AI9A 1NT0A 4WVZA 4LIUA 1GZCA 4D6QA 4DEQA 4BQ2A 5IJRA 4NIGA 4LULA 1RUG1 4YW4A 1NYWA 4NHKA 4AAXA 4E4ZA 1H0BA 4P02B 1XRUA 4CEYA 1RUC1 1XSQA 3ZX7A 4R8HA 3MI8A 3IWZA 4BK4A 3RNSA 2NYYA 1QJY3 3D5OA 1VBE2 4CEWB 1KS5A 1H4GA 1W9SA 5J3UA 4IE4A 1UX6A 5FZFA 4CVUA 3RZGA 5BNPA 4Q4W2 4S2DA 3NQHA 5DG2A 1APNA 1OSGA 2XMLA 4AI1A 2YFZA 1ACCA 1W9FA 3DPRA 2P3IA 1UZWA 4A7YA 4FBFA 2VL4A 4DMIA 3KB5A 4XFFA 1QJU3 2VTXA 1FMD2 3GCWA 1JZ6A 4XHBA 2R041 4JGZA 4YWAA 1HRI3 1ENXA 1H8TB 1XQNA 1ZBE3 3KT4A 1BEV1 4B8EA 4FTBA 2NQYA 3GZTB 2ES3A 3AYCA 3W5NA 3AFKA 3WV6A 3WUCA 5FREA 1W04A 3W20A 1AX0A 4Q4Y3 5LA9A 1DFQA 1YUDA 3Q8FA
chains in the Genus database with same CATH topology
5IK5A 3J8F1 2OA2A 3M70A 1V6OA 3PMSA 1H2MA 5K0UB 2Y26A 5D1IA 3HBZA 2W0XA 1QWRA 4IESA 1O4TA 3IT8A 1W6OB 3IDBB 2WKKA 2A3WA 1V9U2 2OUJA 4CDUA 4HN1A 3TYJA 1JUIA 3SH4A 3NKTA 3IBMA 5H9SA 2HWC2 3R4UA 2RMU2 1POV3 2PLV3 5AVPA 2GNMA 4GXLA 4R9BA 4C90A 4AG4A 3LA2A 2Q1ZB 3WOGA 3O5SA 3WQ0A 3PJYA 3M3EA 2YHJA 3VBRC 3URFA 2VMHA 4P9JA 2CWMA 3CJXA 4LLFA 3O0WA 1V6MA 2XB6C 3WD5A 3FC0A 5FLIA 1KS4A 1MZ5A 4LR4A 1HIXA 1RC6A 2WJSA 1X36A 1FYUA 1WLCA 5HCAA 2R071 4CEYC 1RUI1 5JZGA 2WSUA 2ET7A 3VKLA 1C1FA 4RD7A 1CD3G 1OPOA 3RWNA 4YFWA 4KG0A 4TZDA 1YJLA 1TME2 2GAUA 1AR61 3DPRC 4YM0A 5DZFA 4P5HA 3IIAA 4LT5A 5I91A 1BK1A 4U2AA 2A3XA 2ZKNA 3AP6A 2ERFA 4JGZC 4K21A 3JQXA 1H9WA 4IEXA 1Z78A 2QZ3A 4JDNA 4IEVA 2ZGUA 1WMDA 5GZEA 4XPVA 2GH8A 3H0OA 4NPRA 1RUNA 2CNAA 3UKNA 4HK8A 1AR83 1CAVB 4XJ9A 1I3HA 2JG8A 5H9PA 4ZXKA 4Q1RA 1HQLA 1LHVA 3FZ3A 1R082 4WBBA 3UJOA 4PQ9A 2ARXA 5CA6A 2XBO3 4MZUA 3AMHA 3ZSLA 2OIIA 4J6GA 4Q8LA 4CDUC 4RGAA 1KDMA 3W9AA 1JYIA 4HZFA 2UWCA 5E88A 1GBGA 1TNRA 1QJY2 2VG9A 1BBT1 3PJQA 3NJZA 3T1MA 4BIFA 2WNVA 5L7OA 2VY0A 3OYWA 2QDNA 4M0NA 4XFGA 1G9DA 2XJSA 4OFGA 4BZ4A 2B5HA 2C0ZA 4XOGA 1KFXL 1QJU2 4DINB 4QPIC 3ZYPA 4BCUA 1Y9QA 2K9ZA 4EWDA 4OHWA 5FTTC 1HRI2 3WHUA 1AYN1 3CEWA 4BMEA 1VRH1 3O14A 4H3WA 3T2TA 1X8EA 1MEC3 3NAPB 1FNYA 4Q4Y2 4YM1A 4LBQB 1DGRN 3GBFA 3SMHA 4KH9A 4AE2A 2E63A 5JZGC 4ASLA 1RUJ1 4WZFA 2ZKLA 5I0RA 3K51A 4XBLA 1H2NA 1QHDA 2EAAA 2P2KA 1O4ZA 3OBTA 5FCCA 1EV13 5CFCA 5J36A 3LCPA 4JRAA 2R062 4AW7A 2XVGA 3MPBA 3RMXA 2CWSA 4AVAA 2GALA 3UJQA 4WM8C 1LOEA 1PMIA 2FQPA 2BNOA 2EXKA 2WNUB 3DN7A 2HKXA 1K5MA 3C3VA 1R1A3 2PLV2 3J4UH 3BPZA 4GB32 4I3PA 2DVFA 3AZXA 3RYPA 5KXDA 4LBJA 2ZGNA 4XF1A 1VAKA 2A6ZA 1TEIA 4HKWA 4ZU5A 3U4XA 2VQ0A 1RUD3 2B46X 1WCSA 3S6PA 2DVGA 2PHWA 3B3QE 3VL9A 2D3PA 2KA3A 3M7AA 4K40A 4JAAA 2R32A 5JIAA 1BQPA 2D43A 3WT3A 3JZVA 3S7EA 4P9IA 1XE8A 1U5XA 4DRVA 3GHMA 4K6BA 5EFUA 4YVSC 1AR73 5ABJC 1VBE1 1DZQA 3DF0A 1SBEA 2R16A 3LA7A 4KL1A 4GIQA 1VBC2 3S0MA 3RZZA 4Q4W1 4XMIA 2HWF2 1EY2A 4UW6A 2RR11 5K8SA 3ZFFA 1I1EA 1WW7A 3MIGA 2CY6A 1LJ7A 3ZIWA 1VP6A 5FO8B 1R1ZA 3U10A 1RUG3 3MLLA 4YW2A 4LBMA 3ZN4A 4AI3A 4IV3A 1AR82 4P9WA 3VBSA 4AQ6A 4P9XA 4YZ1A 1S0BA 2AZ5A 5EV7A 1CAUB 1AX2A 3AMMA 3J9SA 4E4SA 5EZWA 3ZYRA 3GZAA 4FOVA 4EN8B 1N3OA 5FAXA 1OD5A 1D0GA 2DUPA 1ULGA 4D94A 1CJDA 4AK3A 5KHHA 3GYDA 4CEWA 2R1DA 2VECA 2R043 1V9U1 3JB4C 1UAIA 2D6NA 1BEV3 5T50A 1A8MA 1K5MC 3P3PA 1O5UA 2HWC1 2XLGA 3CJIC 1FV2A 4G4FA 5DZGA 2K2SA 5C8CC 2E7QA 2CGOA 3TNPB 2FZ1A 1H8TA 2JDZA 3PHMA 3PVOA 2GMPA 1UIJA 3UKVA 4HETA 1PIV2 4LBOA 5FRAA 1F2NA 2VNRA 1ULDA 1FXZA 5FBZA 1JH5A 2PN5A 4PLOA 2PHDA 5FMOL 5KHJA 1MEC2 2YROA 1YFUA 5K0UA 4EJRA 1YFXA 2BVVA 5C9AB 1PNGA 1LESA 2G9FA 3LSDA 3KZ4C 2XKOA 2NMNA 2QVSB 2TBVA 2YXSA 1IQAA 3WLUA 3H8UA 4LBLA 1PGSA 2XJUA 3M4FA 4BOWA 1YRZA 2VVDA 3KMHA 1QGLA 2ZX4A 4BE3A 4DZGA 4K3UA 5HCBA 4FPFA 4QGMA 1QKQA 2R073 2WIIB 4KG8A 3Q9OA 1HW5A 1SLLA 2R0HA 3VBSC 4NVPA 1CIWA 3WP4A 2D6PA 3N3HA 4N90A 1Q43A 2ZGQA 3ILNA 4PCRA 4Q8KA 3UV9A 2BFUL 4CTEA 2JE7A 1N1TA 1R081 5TSWA 4FQ4A 1IKQA 1CPMA 4QGNA 4FPJA 3APBA 1M06G 5HBAA 4OHYA 1YIPA 3I59B 4HVQA 3LOIA 3TOJA 3H7YA 4Y4YA 1NQJA 4RFT0 3WQ7A 4AVSA 4L9BA 5I8TA 2PAEA 4LHLA 3LWCA 3ZN6B 1AR72 1QJY1 1SQ4A 2FZ2A 4MVTA 4MXWB 2W68A 3DGTA 1VAVA 5EXOA 2GC3A 3JBG2 4W65A 3TBDA 4RGGA 2XL9A 3NSTA 5DUXA 4AVCA 4Y5Z0 2VGDA 1QJU1 4AHZA 1CAVA 4RQPA 1F9KA 3G6JB 3EQEA 1RUG2 4EWAA 1LTEA 2ZX3A 5LK5A 4CP1A 4XE9A 4L97A 3NO8A 1LHOA 1Q8VA 4R9CA 2QJVA 4KU7A 1W6NB 3B7MA 3WCRA 3WG2A 1GYKA 2DVDA 1I9RA 4LO6B 1IZ3A 4Z2WA 5JIUA 4HT1T 2R061 4MXVA 2XVKA 3E97A 2R042 1BZWA 4FPYA 1AYN3 2D3SA 1VRH3 1DBNA 4CP2A 3AB0A 5GLUA 4B4RA 1NY72 1POV1 2PLV1 4QPIB 5T54A 1J3PA 2DV9A 3AXDA 4GB31 5CB7A 1DG6A 4OVEA 4AQSA 2Z5WA 2WLQA 1Y7BA 1V6NA 2HWB3 3NAPA 1OQEA 4LBQA 4YG0A 5A33A 5EYYA 4OI2A 3MGUA 2ZHLA 5GJ6A 3ROUA 1HV0A 1LODA 2ZGRA 1W0OA 4GMP1 1F5JA 5L19A 4N9HA 2DCKA 5FOJB 3KM5A 2ZGKA 3AX4A 1LEMA 4WM8B 1NLRA 1CJPA 1QH6A 2ZMKA 2WNUA 4RHV3 3RQ0A 3FFZA 4Z82A 4FT8A 1VBC1 4QXKA 1G6NA 2GNDA 3AYAA 2PELA 2HWF1 2EF6A 1OHFA 2AENA 3QBQA 1D0HA 1ZYBA 3VN4A 1MS0A 1CONA 1ZX5A 2IXCA 1HXS3 4NWWA 1IGOA 3USUB 3H3UA 3SNMA 2B45X 1QDCA 1RJ8A 3UL2A 1AL22 1AR81 1NCRB 1W0PA 3SCFA 2XG3A 1VBE3 5BXXA 3ZSEA 5AFEA 3ZXKA 1GKBA 4XBQA 3L2YA 4YSFA 3PMEA 5KC6A 4E2SA 1U0AA 4FPGA 4XFHA 4FAGA 3HT2A 4YVSB 5ABJB 2RR13 1WLDA 2WFF3 1KFUL 1RVF2 2DUQA 3VBUC 4HN0A 2FMDA 2CV6A 3PTYA 3VDDC 1OOPB 3L2HA 2NM1A 3M2MA 2P3KA 3H7JA 3RSJA 4I2OA 1EYBA 4AEKA 4Y26A 2ILMA 4YNIA 3NV4A 1GZ9A 4MV2A 2E51A 1SFYA 4IERA 4JTNA 4ISRA 1ND2C 1SDWA 3WP6A 5JOWA 4R4XA 3UK9A 1LKNA 5GZDA 1T6GC 4P9LA 2ZMLA 5I0UA 3USSA 1G9AA 1MZFA 1DYPA 1HRV3 1PIV1 2A5ZA 4XF4A 3ZFGB 1RUE3 1X8MA 1CAUA 2YGMA 3OF1A 1AYM1 1MEC1 1V9U3 4J1XA 4JQRA 1ZRCA 4XFAA 3FLTA 3LOBA 2WT2A 4XDQA 5T5PA 1CQ9A 3POYA 3WZ1A 1GNHA 1N1SA 4AEMA 5IK7A 1NA1B 4QQLA 2WNUC 2EIGA 3QLQA 2ENRA 3CJIB 4XF3A 1CESA 5C8CB 1WCDJ 5FO7B 2B39A 1J58A 3JU9A 3WR0A 3AZWA 1AYN2 4QU2A 4YZ3A 4AQ2A 1C8M2 1JXNA 1VRH2 1EP0A 4COUA 4BYYA 2F6BA 2A75A 4N43B 5FLHA 4FAHA 1H1AA 4WM7C 5I93A 2NP0A 2VOKA 1ENRA 3PVNA 4AQTA 2C9AA 2VOWA 4HVRA 2P37A 2HWB2 4DPNA 1W6MB 1A6CA 2WC2A 4SLIA 4EN9B 1F5FA 3UKTA 1S0JA 1DQ6A 1FI2A 1MVQA 5BNNC 4OZXA 4XHXA 5C9AA 3O7OA 2EXJA 1CVNA 3CF6E 4BM8A 3E6BA 4Y1YA 1V6JA 4BIOA 2WSVA 5HCFA 3HQXA 2YDEA 4FXKB 1AJKA 4RHV2 3BOWA 2PHTA 4PJYA 3JBG1 3MDPA 2E7TA 3ZN5A 3NW4A 1S0GA 4DY5A 4XTPA 1WW4A 4YW3A 5JSOA 2GNTA 3CLPA 5DDJ3 3MLJA 2ZX0A 1HXS2 2UU8A 1CX4A 1FT9A 2O0OA 2R0FA 1LOAA 2B8MA 1C28A 2YV8A 4JC1A 3GNEA 2LM3A 1AZDA 2DFCA 3I59A 5E8AA 1VBD3 3C2UA 1D2SA 1BJQA 1SLBA 2FMYA 2B42B 1ASJ1 2RR12 4DY3A 1YI7A 1G9CA 2WFF2 3ZN6A 5T55A 1C3HA 3ILRA 4MXWA 4H55A 1LRHA 2BNNA 1AX1A 2WINB 3E6DA 2VMGA 2IXIA 1Q8OA 2FBEA 3RJRA 4ASMB 5IK4A 2XJRA 1NOVA 1NY71 2CL2A 4C0HA 1U5IA 1QDOA 4IEWA 4BMBA 1DZTA 2ZPXA 1MQTC 4LBNA 3LZZA 3I8TA 1HRV2 2BW8A 3ETQA 3I7DA 1RUE2 3WQ1A 1W6NA 3HT1A 2Q30A 2R063 5C9AC 4EN0A 2QDRA 5I0TA 1AR93 3WCSA 4EWEA 1KXGA 4KGGA 4JDOA 3TRSB 4LO5B 5FDBA 2DUOA 3AYEA 5DUUA 2MHFA 4GB33 1PVXA 1SCSA 2JG9B 4LUMA 3M3CA 4LBKA 3KT1A 4QPIA 1DDLA 1DQ0A 2E6VA 3R05A 3WG1A 3VKNA 4Y1VA 4PLMA 4GMP3 3VZMA 1FNZA 3J26N 1AL21 3O0VA 4FPKA 3R4SA 4AHWA 4F8AA 3D0JA 2GMEA 4M01A 2ZGPA 2Z42A 1POV0 2XUMA 1VBC3 3FLRA 4INDA 2O8QA 1MS3A 1QNWA 2HWF3 5FQ0B 2D93A 1RVF1 4NHLA 2BWAA 4WM8A 2D6OX 3MFAA 1XNBA 4QPGB 2RJLA 3B9IA 5GZCA 1JOJA 1WLTA 2H0BA 1Q56A 5DUVA 5FOBB 1J3RA 1D4VB 1S0CA 5FMOS 3USUA 5JWPA 1AL0G 2XKPA 3M3OA 4M3CB 1C5IA 3ZDSA 2LUWA 4FPOB 5DDJ2 1NCRA 4UW4A 1S0IA 1L3JA 1ZA4A 4KWJA 1QH7A 1LCLA 2RS52 4ISQA 2VNOA 2WWSA 3O0XA 2YUEA 2VUJA 1IS4A 4AI0A 2OVUA 3WW2A 3VBUB 3JQWA 4KWLA 1ZZ8A 4YVSA 5ABJA 2EXHA 2XJVA 4XTMA 3MW3A 1VBD2 3VDDB 5JI9A 1OOPA 1ZZ6A 4LHKA 1BKZA 1HLCA 4MGZE 3VBHC 3VGIA 3AM2A 4B7EA 1ALYA 4JVAA 1PIV3 3VKOA 4DS0A 4QQPA 1ND2B 1GQHA 3N7JA 4GKXA 1C8M1 2EXIA 1XNCA 2GSYA 1S55A 2VOXA 3ZMNA 2CAUA 4MSVA 1AYM3 2FHRA 4WVMB 4XXPA 2Z79A 3JCIA 4B7KA 1H2LA 2VVEA 4YZ5A 4Z8BA 1IPJA 1REEA 3HMYA 3RYRA 4N7IA 3ZFGA 4A2UA 2YGLA 1NXMA 4XYXA 1ZZ7A 4DQAA 1KD7A 1ZRDA 1CN1A 2HWB1 3KS7A 5EWSA 4XF9A 2R6QA 4ZU4A 3PNAA 1JTZX 3THPA 1AR92 1MZ6A 4M3CE 2CAVA 2PHFA 1Q8SA 4F83A 1NA1A 1QOTA 3RG0A 1LOBA 3GALA 2VW0A 3CJIA 1FATA 2HEVF 2XJTA 3IKWA 1I5ZA 4YARA 5C8CA 3A0KA 1PNFA 2K0GA 4CDXC 4EN7B 3GBGA 3A4UA 1ZZBA 4MGKE 4BH9A 4RHV1 2IXHA 4OULA 4WM7B 2QUOA 2UURA 2QNKA 2VNGA 4Y24A 1J1LA 4GALA 2I07B 1VALA 3U07A 3VZLA 2LALA 3ZYIB 3ST7A 3VBFB 3MICA 2ZCWA 4AF9A 4I0AA 1NCRC 3M8LA 3JD72 1ENQA 4YGEA 1HXS1 1U12A 1W6MA 3LGRA 4LUKA 1QY4A 3DV8A 3E5XA 1JBCA 1O4YA 1R092 1YWKA 4XBNA 3VHRA 5BNNB 2O1QA 1OA4A 2MEV1 3WVJA 5AC91 3IDCB 4TYSA 1CAXB 2A6YA 5HI0A 1SBDA 3IN9A 1C1LA 3RYKA 1OOPC 3JBG3 4HKOA 1RB8G 2WFF1 1QXRA 3AKTA 1ZRFA 3MF9A 5JSPA 4G3YC 5BNOB 1J3QA 1Z0HA 1LGCA 4DB5A 1RUF1 2DYCA 2GC2A 2B7YA 2Y38A 4KWKA 5E89A 1GSLA 1KITA 5IUQA 5J98B 1G9FA 3SXWA 3AK0A 3ZFGC 3S30A 1RUH2 1CAWB 5D8AB 2AREA 3WG4A 1S0EA 1I6XA 1WD4A 4YZ2A 5KHGA 2C1FA 2Y0IA 2Q8OA 1ASJ3 1HRV1 4K20A 4N53B 4UXAA 1NE4A 2ZHNA 1QU0A 1RUE1 5CBLA 4PIYA 1F8VA 4M00A 2UWAA 4QQHA 3G7DA 3ZXAC 3M1HA 4I09A 1FV3A 5E1RA 4RR3C 2YPJA 4PLNA 1NA1C 3SITA 5I0SA 4NWVA 2F4PA 3NV2A 4KQ7A 4S2FA 5E16A 2D7FA 1QMJA 4QPYA 1UW8A 2IC1A 5CNAA 4W6WA 4I0BA 2BYVE 4N43C 4Q2FA 2E7AA 1ND3B 5CIRA 4ES8A 3BODA 4WVWA 3SH3A 1U5ZA 1MQTB 5K7PA 1UKGA 1AYM2 1PGW1 3B9CA 2WLPA 5CVRA 2A6XA 2YZ4A 1DLLA 4ORFA 2Q0AA 1DQ2A 1PGL1 5DUWA 1W6OA 1ULFA 3R4DB 4DFSA 1V70A 2OPKA 4YZ4A 3I54A 3IM0A 4Q0SA 3I2DA 3JUUA 5L36A 4D69A 1V6KA 3H1YA 5HXVA 4GH4C 4G9SB 1PZ9A 1RHI3 1GR3A 1LEDA 2EAKA 1HX6A 4IEZA 4XZPA 3R6SA 1RINA 1B09A 4ZKTB 2Q5TA 1ONAA 1NCQC 2JG9A 4HLTA 4YGDA 1KRIA 4P9YA 1VB4A 5FLJA 5I8YA 1NXD1 4WZCA 1LOFA 1QXPA 1AL23 2SBAA 3CNAA 1O3TA 5KWRA 3PVEA 2ZTNA 4Q4X1 4NR1A 3MIHA 4PDWB 3TB0A 1IKPA 3U11A 1FOD3 4HVOA 3ELNA 1S1AA 4LLOA 2SLIA 4C1WA 1YXWA 1AXYA 5LEJA 4OUMA 4IEOA 3WDXA 5CAZA 5DDJ1 3WINE 3M3IA 3ZO0B 1RVF3 3FE5A 4Q4V3 2RS51 4HSLA 2D40A 4NO4A 4QGLA 3V0AB 1DZRA 4LTAA 2N7GA 1H1MA 2A6WA 5FQ0A 1UU5A 1KJLA 1VBD1 3KT7A 2CTVA 3A0NA 1SLCA 4CDWC 4BHPA 1JHNA 2PAKA 4LO8A 3MPPG 5CADA 4QPGA 2XLFA 2WS91 2ZHMA 2GNBA 3AJYA 4PIXA 4IEUA 4S2HA 1S2BA 1MVEA 2ZZQA 3NV1A 1FPN2 4FP3A 3WXPA 3V0BB 4FPCA 1OMIA 2GZWA 1GZWB 1QJX1 3ZIXA 3MW2A 5C4WC 4MYEA 4M3CA 4XXAA 4COVA 4P14A 4AYUA 5J48A 2DVAA 2WZR3 4AFBA 3GHNA 3VLBB 4A7KA 5JPMB 3QD6A 4FP2A 4AVVA 1ASJ2 2NMOA 3MIEA 4RSUA 3ZYJB 2P17A 4AEJA 3MF6A 3VBUA 4X8NA 1BVP1 3VV1A 3VDDA 1AR91 4Y20B 4IQPA 1C8M3 4META 1QJZA 3VBHB 4BWOA 2XWBB 2JG9C 2JX9A 3O12A 4KU8A 1G8WA 2JECA 1ND2A 3HR9A 2DVBA 5CU1A 1LOFC 1PO13 5KHKA 1G9BA 5CFDB 4E27A 4O9EA 2VXRA 1V00A 3ALQA 2XJPA 4FTSA 1IS6A 1JUHA 1QNYA 1ENSA 2HEYF 3V65A 5GZFA 4XFBA 5DG1A 2D44A 4FO9A 1RJ7A 3JD71 4FTEA 4AGGA 1UU6A 4UW5A 1MS1A 1SACA 1R091 2VU9A 1DGWX 1XXNA 3MIBA 4CP0A 3VKMA 1F31A 4YVWB 4JCKA 2ZGTA 4QPGC 2RM21 1RHI2 4H14A 4CDXB 2WT1A 4W6XA 4AGRA 2RS31 4M3CF 3WP3A 1H1IA 3RDIA 4WM7A 2PAMA 1BMV2 3CU7A 3H9AA 4Q29A 5T3NA 1WW6A 4HK9A 5FPXA 2MEV3 1QOSA 1GLHA 1S0FA 2X5IB 4XQDA 3VBFA 5AC93 4RL7A 1FOD2 1RUH1 1COV2 4URTA 2DTYA 1ZVFA 5KXBA 5BNNA 4ES9A 4NHMA 1O7FA 3N35A 1DGLA 1NZCA 1CAXA 4Q4V2 2I2SA 3L9JT 2YYOA 4Q26A 4Z1VA 5T5JA 1GANA 1RUF3 4YRDA 3EJKA 4PF5A 4AFMA 3INAA 3K48A 3ZXDA 2JD4A 3HIFA 3FBMA 4OI4A 5FFOC 1OI6A 3D4KA 1UF2C 1YFYA 4D7SA 2ZAHA 5BNOA 5KC5A 1J1TA 4XFIA 4E2GA 1VBB3 2GC1A 3AP9A 3N7KA 2PQQA 3OTFA 4EROA 2D6MA 4YG3A 3B93A 2A71A 4H7MA 4GKYA 2QE3A 3ZXGA 1Z7S1 1CAWA 2VOVA 4FCAA 2HWD3 3WY6A <