3P6BA

The crystal structure of celk cbm4 from clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
HMALEDKSSKLPDYKNDLLYERTFDEGLCFPWHTCEDSGGKCDFAVVDVPGEPGNKAFRLTVIDKGQNKWSVQMRHRGITLEQGHTYTVRFTIWSDKSCRVYAKIGQMGEPYTEYWNNNWNPFNLTPGQKLTVEQNFTMNYPTDDTCEFTFHLGGELAAGTPYYVYLDDVSLYDPRFVKPVEYVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Cellulose 1,4-beta-cellobiosidase
publication title Structure of CBM4 from Clostridium thermocellum cellulase K.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3p6bA00
1XC6A 5IJRA 4L0PA 1TVGA 4UAPA 4P00B 4QPWA 3MV11 2W1UA 3VD5A 3C8XA 3D3AA 5JXJA 3WF1A 2R7EB 4XUPA 3K4ZA 3LPGA 1PX3A 3DYPA 5DQ0A 2YFZA 3HJRA 3P6BA 4E8DA 2RJ2A 1JZ5A 1UZ0A 3JXSA 3IDAA 3VD9A 2VZRA 4UOJA 4P5YA 5FUIA 1KEXA 1GQPA 4QX0A 3ECQA 1JYVA 3LE0A 1P8JA 3T09A 2B9VA 3WF4A 2ZEYA 2W91A 1L7RA 3I2GA 4TTGA 3K77A 1UMIA 2C9KA 4A6OA 2EIBA 2VMCA 3LPFA 3IB3A 3ZM8A 2CDOA 3U37A 3WF0A 4PF1A 1I5PA 3T08A 1UY0A 5JMOA 2ORXA 5DMYA 1UXXX 2V4VA 1XPWA 2W3JA 4LPLA 2VMFA 3NQHA 4ARYA 3ABZA 3CDZB 3E1F1 1CZTA 1UYYA 3VD3A 2QQJA 5HPOA 3I97A 3I2HA 1TG7A 4QB1A 4DUXA 4GWJA 3WNNA 3CZUA 1PMHX 4YPJA 4A45A 1HN1A 2C26A 4CUAA 4DXRA 4D8MA 4JHZA 2J1RA 3WNLA 1NKGA 5EJ1B 4DUWA 4GWIA 4QDQA 3WEZA 1W9WA 3FHAA 2DCKA 4AG4A 2WUHA 3A23A 4QB2A 2VZPA 2YC4A 3SEPA 4D0QA 4P02B 2ZXQA 3IIIA 2VC9A 1GU3A 1W8NA 4JKKA 3WF2A 2OKXA 5IFTA 1DYOA 1GUIA 3IAQA 2YB7A 2WN2A 3WNOA 4OUEA 4DEQA 1K42A 1PMJX 4BXSV 1OH4A 4ARXA 1MPXA 2B4KA 4GZ9A 3HPNA 3MUZ1 2XQXA 5CZKA 2JKXA 3SEEA 1UMHA 3PUHA 3NRUA 2Z4FA 1ULPA 2VZ3A 3CQOA 5C70A 4DXSA 3FN9A 2Y6KA 2BGPA 2EICA 2WZ8A 1JZ6A 2VCAA 2J7MA 4A44A 4CU9A 4RYDA 3OGSA 1EUTA 3I2IA 3T2OA 3HNMA 2QQOA 1DLCA 5LCWL 2Y6GA 3I3EA 1NUKA 2VZVA 2BGOA 3I2JA 2W1QA 3A22A 2VZTA 1O8PA 1RYYA 4HG6B 2VJXA 3WNPA 2JDAA 2VQUA 1JYXA 5LA2A 2WO1A 3HN3A 3W5MA 4KMQA 2WAOA 3K75B 1UX7A 3GGLA 3SKVA 4OMDA 3EB7A 3CMGA 2J1AA 3WQBA 3WNMA 2J1TA 3NNGA 1GOHA 1BHGA 2HLEA 2VZQA 4ZZ5A 3K46A 4Z2AA 4ET7A 2E26A 1J84A 3NJXA 1JZ8A 1JHJA 2VM9A 2QQIA 2X09A 2KD7A 3OBAA 2W87A 1LNSA 2BZDA 2QQMA 3NJVA 2ZEXA 1OD3A 3LEKA 4A42A 3P1IA 4MADA 3W5NA 3VDCA 1JYWA 4BJ0A 1F4AA 2W94A 2WO3A 3OEBA 1SG3A 4DUVA 3FHQA 2VOTA 3I3BA 2J22A 3C7HA 4XUTA 1SDDB 4CU7A 3A21A 3WNKA 2W92A 4OMCA 4M4PA 2E32A 4PQQA 3CKHA 3C7OA 2VO5A 1W99A 1JZ4A 3AC0A 2L9LA 5J1XA 4W50A 3C7FA 2YG0A 3MUY1 4OYUA 2RV9A 3LEIA 2BBAA 2YFUA 3THDA 4BDVB 2YC2A 4JKMA 1K12A 3ETPA 4OZOA 2W47A 4M4RA 1W9TA 3UESA 2W1SA 2Y64A 1YQ2A 4E8CA 1R64A 3EYPA 5LA1A 2ZEZA 5EJZB 3T2PA 4FI9A 1KGYA 2Y6HA 1JYNA 2LS6A 1JU3A 5I0DA 2WO2A 2Y6JA 2VMEA 3VD4A 4QX3A 3K4DA 4XURA 4KI5M 2J1SA 1UY1A 4W8JA 2QBXA 1H6XA 4DEVA 2XHNA 1OF3A 4MGQA 1UYXA 3C7GA 2VZUA 3OG2A 2BERA 2Y6LA 1XNTA 1WCQA 4UI9L 5IYYA 5B4NA 1JU4A 4QB6A 3UETA 3T2QA 3BGAA 5JR2A 3C7EA 4IUGA 3ACIA 4XZUG 5DN2A 1UY4A 2V72A 2WDBA 5JUVA 4PT6A 1GNYA 1K3IA 3A7QA 2W9XA 2VQTA 2J1UA 5CYYA 2PQSA 4CUCA 1W9SA 2WYSA 3MO4A 5JXHA 3GXUA 4CVUA 1CX1A 4QDRA 4CU6A 3ACHA 1GOGA 3J7HA 5A1AA 4KWUA 3DYOA 3OGVA 4QAWA 3VD7A 3LEGA 2VCBA 5G04L 2WAAA 3OB8A 2C4XA 3GM8A 3HNYM 2HYXA 1F4HA 3BN6A 2XOMA 1UXZA 3HEIA 3DECA 4JX0A 3ACGA 4LQRA 4QDSA 3IAPA 2W1WA 3OGRA 1XNAA 1NAEA 3UNPA 1CIYA 1GMMA 2X05A 2WBKA 3GDBA 3K4AA 4ZXEA 2WQ8A 2JE8A 4P08A 3T0BA 4LKSA 1DP0A 5JXIA 1JZ7A 2VCCA 5JXGA 1L7QA 4QX2A 3FL7A 3THCA 1OF4A 2EIDA 1WKYA 3MV01 2WN3A 5IFPA 4XUNA 4A41A 2CDPA 2DDUA 2V5DA 3ACFA 4MO3M 3I2FA 5EIYB 1O59A 3WSOA 3LQCA 4CU8A 3VDAA 2J1EA 2W5FA 2Y8KA 3DYMA 3I3DA 4JKLA 1JZ3A 2J1VA 5B4XA 2X10A 4MOAA 1J83A 2QQLA 4TXWA 5C7GA 3OEAA 1EUUA 3T0DA 2EIEA 4MGSA 3VDBA 2VZOA 2WABA 1K45A 2E31A 1UYZA 4LHSA 3HOBA 2VL4A 4AAXA 3CZJA 4BK4A 2ORZA 4RN5A 1SHWB 1W8OA 2VZ1A 1W0NA 5G05L 5F7UA 4QX1A 2LW8A 4XVHA 3HNBM 4XUQA 1JZ2A 4W4ZA 4XUOA 1GOFA 2VR4A 2E33A 4ZZ8A 3SKJE 2VTFA 3PUIA 2QQKA 1ULOA 5HXMA 1OT5A 4ZY9A 3WF3A 2QQNA 5C71A 1H6YA 2ZEWA 1NX9A 2RVAA 4DXTA 5LA0A 1O8SA 3I2KA 2DCJA 1PX4A 1US3A 1UY3A 3F2ZA 1D7PM 2VZSA 2JD9A 2ID4A 1US2A 4A4AA 1JI6A 1UY2A 5DPNA 5IHRA 2W95A 3CIHA 4BK5A 1UWWA 4A3ZA 4CUBA 3T0AA 2WZEA 1CZSA 2XONA 2W46A 1IQDC 1CZVA 1T2XA 2VMDA 3MBWA
chains in the Genus database with same CATH superfamily
5APAA 1C5IA 1OC1A 2BNOA 1QJFA 5HCHA 4GH4A 3ZYRA 4A3XA 1K5MB 1S0DA 4MGTA 5A80A 2BJSA 4TYSA 1QOSA 1OMIA 3MLJA 2HWF3 2VUCA 5JXJA 4CEWC 3BOWA 2P3YA 3LIGA 3LPGA 1PX3A 3N9PA 3HJRA 4Q4V3 2RS51 3S0MA 4D6QA 4E8DA 5CFCB 2RJ2A 5J96B 3RWKX 3FLPA 3JXSA 5GZEA 3WW4A 4XQDA 1IGOA 3IDAA 2XPJA 5C9AB 2WO7A 4UOJA 2PN5A 3LDKA 1ZBA1 4UYBA 1RUD3 5FP7A 2B45X 3LSDA 1HDKA 2RMU3 2XJQA 3JZVA 2JG8B 4UFLA 3EXUA 1JYVA 3MYXA 1HX6A 2HWB1 2YU2A 5LASA 1VBD2 3WF4A 2FQPA 5FZOA 1H8TC 2HKXA 2ZEYA 3RZMA 2PHTA 5I8TA 4AFAA 2W91A 4M3CA 1L7RA 5JSRA 1ZRCA 3I2GA 1K5MC 4TTGA 2ZCWA 3WQ1A 2C9KA 3IZOA 4TWTA 2K2SA 3W21A 4COUA 5IVBA 1KJLA 2XDVA 4GMP0 2EIBA 4XETA 3LPFA 3PDQA 4FPHA 1ZYBA 1AYN3 1GNZA 3IB3A 4G4FA 2GU9A 4HANA 4S2DA 5IVVA 5M0TA 3TEWA 2WR9A 1S0JA 1X7NA 2OUHA 2CDOA 4L92A 1JODA 1VMFA 2RS52 2UWBA 4RGKA 4ZKTB 5CFCC 1ASJ2 1RVF1 3DL3A 1I5ZA 2Y0IA 5C9AC 2XQRA 2XMLA 3T08A 3KF3A 1ZBA2 5C33A 2QVSB 5CKNA 2ORXA 5DMYA 1SBEA 2JDNA 4HZFA 2JG8C 1UOBA 1N1YA 4I3GA 3H50A 3E1F1 2HWB2 1LGNA 4GALA 4BLIA 3MZHA 3K48A 4IE7A 5HPOA 5DAVA 4IEUA 5L7OB 1AR61 1LULA 3MIGA 4Y20B 3MICA 4DPNA 3RDIA 2WRAA 2PYTA 1UU5A 1JXNA 3QCWA 3SISA 1PMHX 1RHI1 2OIIA 4B1MA 4A45A 1UPIA 4FBFA 3M7AA 1O4ZA 1LECA 2GC3A 4D8MA 5FP9A 4IV3A 3AJYA 2J1RA 2VNVA 4QDQA 2JE7A 5J98B 1RVF2 5FIXA 3FHAA 5B2GB 3RRDA 2FZ2A 2UYBA 3MFCA 5C8CB 4LKEA 4P9LA 5GZGA 4OHWA 1BMV1 2N7GA 2VOVA 2VC9A 1GU3A 1SCSA 2YU1A 3EQEA 3KSCA 3PMSA 2IC1A 4HN1A 1WA6X 4O65A 4PCRA 3USUA 4YW6A 3AZYA 1OXCA 4OUEA 5DAXA 5L7OC 1SLCA 2WS93 4DEQA 2D7FA 1B35A 2YV8A 2YYOA 4BXSV 1S2EA 1OOPB 5A32B 1RB8G 4BCUA 2H0VA 1RHI2 2B4KA 1ZRFA 3HPNA 2XQXA 1KQRA 3LIHA 3WX5A 1FV2A 1O5UA 4FXKB 2C24A 5FCCA 5K4LA 3GHNA 5FQ0B 4AI0A 1Y3TA 4FSJA 2VTXA 1D4M2 3Q8EA 2BTVC 1W8UA 4Q26A 5DUXA 1JZ6A 1XYPA 2VCAA 1DGWX 1OLRA 1W6OA 5IAXA 1ZREA 4N43A 5C8CC 2YHJA 5A7WA 2YPDA 5DXDA 3T2OA 5CFDB 4H7LA 2QQOA 2WJSA 1DLCA 1XQNA 1RIRA 4YWAA 2D3RA 3CL1A 4BQ2A 1NUKA 4NO4A 2VZVA 4LA2A 2VZTA 1OOPC 4HG6B 3WNPA 2AENA 4O7XA 4Q4X1 2ADDA 5CADA 1RUG1 1DQ0A 1JYXA 2O8OA 5LA2A 2OZ6A 5CKMA 3WQ0A 3HR9A 5DUWA 3EHKA 5DAQA 4YYOA 3POBA 3K75B 2ZGQA 2I45A 1SPPA 1SFYA 2MPFA 2VXJA 1OUXA 3CMGA 2ZGRA 2KXLA 2PTMA 2Q1MA 4H3WA 2ZGUA 3MIFA 3VHNA 5FFOC 3WNMA 3G6JB 5FK8A 4FAGA 4ZU7A 1VBC3 1A3KA 1C57A 1VLNA 4Y1VA 2WSUA 3FUOA 3VBFB 4LUMA 1GOHA 2VD7A 5JI9A 4Q27A 4LBQD 4XIOA 5CFDC 3AK0A 1EAH3 2OXBA 3K46A 1HRI3 1EYBA 3KQRA 2C9AA 3LB9A 2MHFA 1J3QA 4AVTA 2DCYA 3KCCA 5JSPA 1FPN3 4JDNA 4CUGA 1LOFA 2BOJA 4XJ8A 3H8RA 2CGOA 3WW1A 2JDKA 3RI8A 2FDHA 3CHXA 4JGZB 2B8MA 2BZDA 1MS4A 2QNKA 4Y4YA 5EPAA 3ZPYA 1XU2A 2HWE3 3NV2A 3W5NA 1FT9A 5CA6A 1NCQA 2WNUA 1GZTA 1LHWA 1VMHA 2A3WA 4AHZA 4Q1PA 5AVAA 4C0HA 3RS6A 3AP4A 2D6LX 3VBFC 2DFBA 2FMYA 2EF6A 2Y0OA 2WKKA 3ELNA 3H1MA 4DZGA 2RHPA 2RDNA 3OEBA 2DBIA 2W08A 1GWMA 2Y34A 3NVCA 1POV0 3FWEA 3GJAA 3IPVA 3J8F1 4LO6B 1SDDB 4XUTA 3UK9A 1U5ZA 1OHFA 4UF0A 3RFRA 4CRQA 3KVAA 3A21A 4S2HA 1UZWA 4GKXA 3WNKA 3ZYHA 4M4PA 1J3PA 4YZ3A 3URFA 2VO5A 3ZFFB 1JZ4A 5FBZA 2HEVF 4JGZC 4R4XA 2DF7A 2DUQA 3AB0A 2YG0A 3NNFA 1YFYA 2QZ2A 4M3CE 3BCWA 2RV9A 3OCPA 1AL21 1RUJ1 2YDEA 1H1MA 4QU2A 3CNAA 2BBAA 2YFUA 3KMHA 4W6WA 3A4UA 3ETPA 3OUIA 4J25A 4OUMA 3N7KA 3DPRA 4M4RA 4A7KA 1W9TA 2VG9A 3UESA 3ZN4A 1RUH3 5E6HA 1YQ2A 5LATA 4MGIE 3LGRA 5FLIA 4COYA 1V9U1 4NHLA 3N9MA 3WZ1A 3VBSA 1MEC1 4YVSB 5LA1A 3FMGA 1DU3D 3I59A 4FI9A 5A7QA 2FDGA 4QWNA 4ATEA 4XBNA 4RQPB 3LKJA 3H7YA 4XFFA 2Y6HA 2WA4A 5FPAA 4F7ZA 2E63A 3HD8B 3JD73 1JYNA 2AZ5A 1LOGA 1NLQA 2P4EA 3J8F2 4FPCA 3ZO0B 5I0DA 5EP9A 1PMIA 4GJZA 4XTPA 2A70A 4MZUA 5D21A 2AEYA 2F4LA 4LEJA 1XE8A 4QX3A 4OI1A 1OVPA 1W2OA 2A5ZA 1LKNA 1WW4A 3K4DA 4G9SB 3ZFFC 4B4QA 5K9YA 5IK7A 2XXZA 1UZYA 3FBMA 2GN3A 4XURA 4ASLA 1RJ7A 4Q0PA 5JOXA 5JAXA 1BEV3 1QQP1 2J1SA 1HRV1 1UY1A 1RUJ2 4C1XA 4YGDA 5JI7A 4B3NA 1VBE1 2QBXA 5F1RA 1GLHA 4RS5A 4YG6A 1UYXA 2RM23 2ZOEB 2DUOA 3NWKA 4C0BA 3KGLA 4KBZA 2BBVA 1VRH2 3AZWA 1V9U2 2X5IA 4YVSC 1MEC2 2RR13 1GZCA 3KGZA 4W6YA 1ODMA 1IS5A 2BUKA 3DN7A 4RQPC 1OVSA 4XF3A 1YUDA 3BALA 4LOSA 3WCSA 1MQTB 4UFMA 1B09A 3PLQA 2WL1A 2R071 2O0OA 2WT1A 2ZGPA 4BXFA 4BQ4A 2WDBA 1CR7A 4DNYA 2D6NA 5KXDA 1GNYA 1FOD2 1H4HA 1WLCA 1J58A 1N3QA 3A7QA 5ABJA 3H9AA 5E1RA 5ISLA 1VBE2 2GC2A 1R092 3BKZA 4O9EA 3NO8A 4QXKA 5FZLA 1Z78A 1PVC1 3GZTB 4D69A 3POYA 4MV2A 5A3LA 5JXHA 4R52A 3GXUA 1AHSA 1BVP1 1Q8SA 2AREA 5GALA 1Q5OA 2VQAA 4Y1YA 1PO23 3JBG2 1GOGA 2BDRA 2W2IA 2WZPP 3OGVA 1ZZCA 2MEV1 2WT2A 4O9GA 5DG2A 5D1IA 4AI9A 3LEGA 5G04L 1MQTC 1EV11 3LOBA 5CU1A 5JZGB 2GNMA 3OB8A 3U1XA 3RI9A 1LGCA 2TNFA 3AP9A 2R063 4K1ZA 2R072 1F4HA 3BN6A 5D8AB 5F5CA 4BQ1A 1IS3A 1LENA 4LQRA 5FZ3A 3VDDB 5EWSA 2W52A 4NUBA 1GZ9A 2DUPA 3UGGA 1HB2A 3J4UH 4PLNA 4MYEA 4I0WB 2WZR3 1QNYA 1K5JA 1XE0A 4IGQA 4URTA 5H9SA 3LA7A 1QH6A 1LOCA 3DV8A 3DGTA 2DURA 2QE3A 3DKWA 1KFXL 4ISRA 3KVBA 4ZS2A 1ZBE3 3I54A 3T0BA 4FVVA 3IT8A 4LKSA 5FYTA 4BISA 4GJYA 1PVC2 2AACA 1JZ7A 1DDLA 4EN8B 1Q8OA 4AHWA 3ZXGA 3CO2A 3JCIA 1Q56A 3WHTA 2QQUA 3B02A 3LWCA 3KV4A 2WN3A 4RA0A 5EHDA 4AI3A 4QPGB 5BNOB 1EV12 2ZX3A 4QQ2A 1S2KA 5IFPA 4XUNA 1GWLA 1W6QB 4HVOA 5IATA 5JZGC 3JB4C 2PELA 1RL3A 5D8AC 4FFFA 2ARAA 1ZA7A 5EIYB 1O59A 5C4WB 4XCBA 1OPOA 3LQCA 1HV0A 3VDDC 2OVUA 1NYWA 1NLRA 1XB9A 3AZVA 2Y8KA 3I3DA 4Z2WA 4WVMB 2H6CA 1YRZA 5LRSA 5FO9B 1BBT3 2X10A 4XC9A 4TXWA 4NR1A 5JVVA 5F5QA 4NIIA 5KHGA 2CAVA 3C2UA 4GXLA 2XLGA 2K46A 4BMEA 3OPWA 4LK7A 4N90A 1DBNA 4IL7A 1AJKA 4RHV1 2OX0A 2JE9A 2VOWA 5JOZA 3KWVA 3ZN6B 2JDYA 2E31A 3KHCA 3ZXLA 4NHKA 5K0UA 1Q3EA 4LHSA 3CF6E 2JIJA 1CAXA 2VL4A 4AAXA 5BNOC 3FJSA 4QPGC 3E97A 5DZGA 1ZRRA 3VZNA 5KWRA 2BWCA 2FDJA 2Z69A 4OZXA 3CEWA 2VOKA 3JB8A 4RGGA 1EPZA 1UZVA 1W0NA 5G05L 3M3EA 4XTMA 1C1LA 3AZXA 5FV3A 5JIAA 4H2AA 4GQ7A 5A3MA 3J26N 5AVPA 5C4WC 4J6GA 4CDXA 3AYDA 1RUOA 1JZ2A 3MLKA 4IXLA 5CVRA 2XJRA 3BOPA 3O7OA 2E33A 4QPIA 5FPXA 4FPLA 3ZDSA 4FCAA 1YIFA 1RUF3 2HH9A 1S2BA 2ARBA 5KC5A 4LUKA 2QQNA 5E8AA 4W6XA 3VBRB 4DB5A 4K9SA 1APNA 1AYM1 2D5HA 4RHV2 4XFIA 1NX9A 3VBHB 4IEQA 4NE9A 4I09A 1U5YA 4Y1ZA 1O8SA 4AI8A 3NAPB 2BNNA 2DCJA 4OFGA 4QKDA 1F5FA 1X33A 1SLBA 1UY3A 3WG4A 3TEZA 2GAUA 2WNOA 3POSA 4QHBA 2VZSA 1DGRN 1W6NA 3BB6A 3EJKA 5FMOL 1AR71 1UAIA 2VVDA 1JI6A 1UY2A 5DPNA 1A78A 1UO9A 5I93A 5CG8A 3CIHA 4BK5A 2QQPA 4YM2A 1O5LA 1UWWA 2OPKA 2W68A 3KCXA 2Q8CA 4MG2A 1UX6A 1QJY1 2WZEA 1GANA 4DOUA 2K0GA 4I02A 1FI2A 5H9PA 4Q4Y1 1XU1A 5FBJA 5TSWA 4MXWB 1H2NA 3EMRA 4AVAA 3WDVA 4Z8BA 1TVGA 2V5YA 4P00B 5FZOB 4D6SA 4QPWA 3J9SA 3VBRC 3MV11 3ZYPA 1TMF3 3OOXA 3VD5A 2OUJA 3C8XA 3WF1A 3VBHC 4XFGA 4FTSA 2BQPA 1HB3A 1WW7A 1SQ4A 2HWF1 3DYPA 5GLUA 4TSVA 3NAPC 4Y3OA 1UPSA 5F3GA 1N1VA 3ZIXA 3I7DA 2FCVA 1UW8A 3O14A 3PJYA 2XBO2 4RFT0 4Q4V1 1UZ0A 5C3QA 2ERFA 5F5IA 1WLDA 2UYAA 4AVBA 4BYYA 1YQ6A 1NA1B 2VH9A 4HT1T 3OBRA 3U11A 3J7NA 3WLUA 1AR72 2D3PA 2X53S 1RUD1 3AKQA 3AYCA 3GBWA 2VMHA 4QX0A 2RMU1 4HL0A 2VBDA 5FZGA 3WOGA 3ZMNA 3LE0A 5BNPB 1EP0A 3NV4A 5E88A 1QJY2 2XKPA 2B9VA 3QACA 3U10A 5KC6A 5HCAA 5FP8A 2R0HA 3OYWB 4Q4Y2 5FTTC 1HIXA 4LOTA 4P9IA 1VBB3 2EA7A 4DY3A 3K77A 1DQ5A 1UMIA 4EQVA 1KXGA 1ND3A 2A6ZA 2GDFA 1OD5A 2A7AA 2JJ6A 2VMCA 3ON7A 3OY8B 1DCSA 3ZR6A 1VALA 1SBFA 5FYCA 1NCRA 2R043 3ZM8A 2HWF2 1POQA 1AYN1 4HOOA 3CJXA 5A1FA 1MVEA 2CAUA 4GB32 4PF1A 4CPBA 4CEYA 2UWAA 2JIGA 1W6PB 2DVFA 2XL7A 2ZGTA 1NA1C 3AKSA 3J7MA 4PIYA 4XHXA 4AEDB 2VCMA 3TWIA 4PF5A 4AVSA 1CAWB 1UXXX 2JG9B 3PTRB 1I3HA 1RUD2 1XPWA 4TLGA 5T54A 2Z5WA 3NQHA 4ARYA 5FZAA 5BNPC 2YY1A 3ABZA 3CDZB 4NVPA 2ZACA 5IW0A 3IIAA 5HV4A 1GZWA 3VD3A 4D7YA 1YCIA 2Y60A 4URAA 4JQRA 3I2HA 1MZ6A 3P3NA 1X8EA 4C8DA 4DUXA 2YROA 3HIFA 4AQSA 4BPZA 3ZSJA 1HB1A 3ES4A 4YPJA 3BI3A 5HCFA 3IM0A 3NMBA 5C5TA 1HN1A 2GH8A 5GM0A 1NZIA 2C26A 4CUAA 4XF4A 4DXRA 1RXFA 3O1RA 2I07B 1DZRA 1R1ZA 5LRRA 1AYN2 2JEMA 4Z07A 4FAHA 1F8VA 1NKGA 4ZU5A 4S2GA 4DUWA 1GQHA 3NNLA 2FDIA 2NPIA 2NYYA 3WEZA 1KRIA 1VAKA 1W9WA 2K9ZA 1FATA 4LJHA 1XNBA 4AEDC 3O1VA 4QB2A 3THTA 2ZKNA 1ENQA 2YC4A 3I8TA 1LEDA 1BVVA 1PK6B 4P02B 2JG9C 1PZ7A 5CISA 2ZHNA 3VZJA 3BU0A 3RMXA 4JKKA 5GZDA 4YGBA 4FQZA 2VNOA 3WVJA 3O1SA 3EBRA 4CCDA 4CCMA 5A3NA 1NY71 3IAQA 2YB7A 3CJIB 5F8PA 5FYHA 3WNOA 1ENSA 1FMD2 5F32A 3B7MA 3VBOA 5IAVA 3LFMA 4XFHA 1IKPA 1CAUB 4OULA 2WS91 4PI0A 1OH4A 2P3KA 3I3QA 3POWA 5KHHA 1MPXA 3V0AB 4DO0A 4HFSA 4CDQB 3L2YA 4BQWA 2D40A 3SITA 3KS7A 3AKPA 4LO5B 2E9QA 1WLTA 1RINA 1ULPA 2ARXA 3CQOA 4XDOA 3T4VA 3O1UA 4NWWA 5T5PA 1QJEA 2EICA 2E7TA 4IV1B 4LO7A 2HWC3 4COVA 5K0UB 4A44A 2ET1A 1CESA 5FZ1A 1EUTA 3ZX7A 1PK6C 3LFIA 4FPEA 1H2MA 4LE4A 3HNMA 3PURA 4TZDA 2JD4A 4XXAA 1BLZA 4BMBA 1PGSA 5EJ3A 3CJIC 1W8HA 1NY72 2XUEA 5JLVA 3BIEA 3WG1A 3MDPA 2W1QA 3A22A 1D4VB 3FHIB 5EYYA 3ZXFA 1AXYA 1CONA 1RYYA 2WS92 3LCPA 3POJA 1W05A 2GMMA 3TN91 1YXWA 1WZXA 1NOVA 1WD4A 4OI2A 4CDQC 2P3IA 4I30A 1QJZA 2R1BA 3BTYA 3ATGA 3N36A 3HN3A 4JGYA 3TEYA 3I3MA 4Q0VA 3TAYA 4YZ1A 1ZVFA 3GGLA 1TQ5A 1UU4A 3RZKA 5I0TA 1OA2A 3ENRA 3EB7A 4AQTA 3BODA 1IS6A 3WQBA 1REEA 1GFF2 4HKWA 4IV1C 4CDWA 2J1TA 1UOFA 3ZXEA 1DQ4A 1CPNA 2RS33 5FREA 2O1QA 4Q8LA 4Z1VA 4Y22B 4JDOA 3ZYJB 5HCBA 3NJZA 4W65A 5ACA1 3S5QA 3HT2A 4K8FA 4ET7A 1EAH1 3NJXA 1HRI1 1JZ8A 5GLTA 3RYKA 1XNDA 4HSJA 2BFUS 5LBEA 1FPN1 1OKOA 2KD7A 2X09A 3OBAA 5T5JA 3PL0A 2W87A 2WNVB 4KU8A 1XSQA 3SC7X 2CY6A 5FY8A 2CGPA 1WMXA 3T30A 4H7MA 3NJVA 2ZEXA 1OD3A 4IEXA 3TN92 4AYUA 5FYZA 4NPLA 1EY2A 4WVVA 1OUSA 2DVDA 4L8QA 1I6XA 4XFBA 3QLQA 4MADA 5EXOA 3I49A 3HQRA 1TME3 1WA4A 3BPSA 1S1AA 4CTEA 3VL8A 2HWE1 4R9CA 4L9BA 2ZPXA 1BK0A 3KCYA 4JDMA 4QD2A 3KT1A 3SCHA 2IXHA 1CAVA 2ZGNA 5C3OA 2PMWB 4IETA 3WDWA 4KGGA 2PXJA 1A8MA 1SFPA 5J7MA 5BUVA 2WA3A 5FJHA 1OI6A 1XYOA 2PFWA 1S0CA 5FZFA 5JDBA 5FZKA 3T4HB 1J3RA 4FTBA 2JX9A 1RITA 1LRHA 2VE1A 5LBFA 3RMYA 3AVRA 1FYUA 3RSJA 5ACA2 2G4IA 4CU7A 1HRI2 3RQ0A 1DGRA 4OMCA 5GLVA 5FYBA 3L9JT 4AFDA 5CIRA 3C7OA 3MPPG 4HSLA 1BYHA 1FPN2 2WNVC 4QQPA 4UFJA 1ONAA 4GWNA 4WZFA 2ZBJA 5AFBA 5CG9A 1GICA 1VBA3 2VY0A 4Q0SA 3MUY1 4UFHA 4OYUA 3VUOA 3RZLA 2IFWA 1PO13 2XJUA 2JXAA 4CPBD 2AR6A 2YC2A 1K12A 5FXVA 4XZPA 5BPXA 3W9AA 1UKRA 2OA2A 2W47A 5EQUA 1XOYA 5T50A 2Y64A 3APBA 1R64A 3EYPA 5JWPA 1OA3A 1RJ8A 1RUH1 3AMPA 4PHZA 2V09A 4BA6A 5I0SA 1G7YA 4LITA 1PNGA 1ZZBA 1JU3A 1HJFA 2WFPA 5C8WA 5A7SA 3UYJA 3AXEA 3JD71 3BPZA 4OI0A 2UURA 1GSLA 1D0HA 3WW3A 2DU0A 1AR62 5HI0A 1WGPA 2A1XA 4QX7A 4IERA 3VN4A 3KHBA 4KI5M 3VBUA 2ENRA 4CCKA 3PVEA 5IVCA 1AZDA 3N4MA 1BEV1 2XB6C 4Q1RA 1G9DA 1UN1A 3PMEA 5BXXA 2LUWA 1OF3A 1REDA 1MVQA 3AFGA 3U14A 4UFKA 4AI1A 2VGDA 3PJQA 1YI9A 3MF6A 2Y6LA 1XNTA 5KHIA 5B4NA 2ZJCA 3UETA 1RUH2 1OFNA 1RUE1 3D8CA 4J1XA 4Y26A 4U2AA 3MI8A 5FYVA 4B4RA 1BMV2 4UW5A 3BGAA 4R8HA 2RR11 5JR2A 1AX2A 3C7EA 1VR3A 3GALA 4IUGA 1VB4A 3WDXA 4EN0A 1X9PA 1SBDA 2VNGA 2ZGKA 3E6CC 5T5LA 2KM2A 2V72A 4HONA 2DU1A 1WMDA 3HN1A 2IWGB 1O4TA 2IZWA 2Q4SA 4LBLA 2TEPA 4TLFA 3EO6A 1LR5A 4GA9A 2BNMA 1KS5A 3M1HA 4K21A 4M00A 3VKNA 3PVNA 1IKQA 1GR3A 4LA3A 4F8AA 2RJLA 4CP0A 4NROA 1VBD3 3GYDA 1V6NA 5FMBA 5J3UA 1LAJA 1BEV2 1QOTA 1QJX1 3B69A 5FPUA 1VJ2A 2P2KA 1COV3 4PDWB 4XW3A 1URXA 3ZFEB 3ILFA 5FOBB 1ZZ7A 3Q8AA 4FP2A 1YJLA 4CUCA 5A6XA 2XUMA 3FLTA 1XNKA 4FPGA 2C5DA 5FWEA 4HPKB 5A33A 1E57A 4LBOA 4CEWA 5F6LB 3U4SA 1TZOA 4XMAA 2GNDA 1RUE2 4QDRA 5FRAA 4KGQA 1W28A 2VMIA 4KBBA 3J7HA 2RR12 5A1AA 4KWUA 1PO21 1ULFA 1KITA 4JTOA 3V0BA 1H1IA 4DRVA 1ASJ3 1UMZA 2XHKA 2GC0A 1J59A 1A8DA 4RD7A 2ZGSA 3BTAA 1CJPA 1XXNA 1G9BA 2ZGOA 3ALQA 1Q8QA 2R061 1H30A 1W04A 1ZZ8A 2G9GA 2UY9A 1CX4A 2WYFA 3HEIA 4FOVA 2W1WA 4JX0A 2P1BA 4Q4X2 4XABA 1RUG2 1ZX5A 1JW6A 1XNAA 3AP5A 1NAEA 4TN7A 2DVBA 3UNPA 1H8TA 1CIYA 1W9FA 2WZR1 1D2QA 2Q0AA 3FE5A 1QJX2 2WQ8A 5FYUA 4PDWC 3ZFEC 1K5MA 4P08A 4BH9A 4META 4LR4A 2XKOA 4HKLA 4HN0A 1POV3 1ZBE1 1QKQA 4CE8A 3PVBB 4Q8KA 5DG1A 1O3QA 2IVJA 4FT8A 4OHZA 2VUDA 2V73A 4YRDA 4B8EA 1GWKA 4QX2A 4UWDA 4K7JA 2NZ9A 2AC1A 5LY1A 4FTEA 5CFCA 1WKYA 4KNCA 3O12A 2YXSA 1ZNPA 3IDCB 4NHXA 5C9AA 1BKZA 2CDPA 3ACFA 1LHNA 4MO3M 4YW1A 3I2DA 1WCSA 3WUDA 4F3JA 1PNFA 3WSOA 2JG8A 4CU8A 3RVHA 4A6SA 2DTWA 4YW4A 3THPA 3NV3A 2J1EA 2J42A 3DYMA 3HVDA 4JKLA 1OBNA 4XYXA 2AYHA 2WZR2 2QQLA 4K8RB 1BBT1 3MLLA 1HV1A 2ETEA 4A7YA 1W6MA 5FPVA 1F15A 4CP9B 3MW3A 1FNZA 2WINB 3T0DA 2EIEA 1RHI3 4N53B 4MGSA 1LHOA 3RNSA 3TBDA 4AQ6A 1SDWA 2CGNA 1LODA 1K45A 3QOPA 1UYZA 4HBNA 4LULA 4RFRB 3HOBA 4BK4A 1D4M3 1TNFA 1XRUA 2BEOA 1W39A 2CV6A 3IWZA 1JS9A 3W58A 4BU2A 5F9TA 2IXJA 4EROA 1W8OA 2VNRA 3ZXDA 2QTWB 3FLRA 4KWKA 4AZZA 4CXXA 4CDUB 3GBGA 2BFUL 3SXWA 3GZAA 4ZXKA 2ZMKA 2D97A 3ETQA 1AL22 4W4ZA 4XUOA 5FYMA 2JECA 2ZGMA 4QX8A 2FDFA 1N1SA 4LHKA 2VR4A 5L7OA 2VTFA 2UU8A 2Y38A 4Y20A 4RR3B 2PA7A 3H8UA 2QQKA 1ULOA 3MIHA 1BBT2 3B93A 2IXIA 1YNAA 4FP3A 4XEZA 5I0RA 1ULGA 1RUF1 2D5FA 3NJYA 4QKBA 3LDRA 4GWMA 4N53C 4XPVA 1H6YA 1NQDA 1MS8A 1HLCA 5F3EA 5FUNA 4XFCA 3TOJA 3H7JA 3JQXA 4AK3A 4DXTA 1GQGA 5C5UA 1H1AA 4QQOA 5FPBA 2PHWA 1LHVA 4LLFA 3ZMOA 2D98A 4K20A 4JZRA 1WW6A 1PX4A 3VV1A 2LM3A 1JHNA 1S0BA 1W3VA 3F95A 2ZKLA 5IVFA 2KR2A 3F2ZA 4IDZA 4XACA 2Q30A 5C8CA 2ID4A 4CDUC 5LY2A 5I8SA 2YPJA 2WQ4A 5JR7B 4IW3A 1DGWA 1ND2A 2W95A 4HXCA 1QQP2 4BLJA 1HRV2 1H2KA 1OLMA 4CUBA 4H55A 1AR83 1OQDA 1CZSA 5T55A 2VPVA 1T2XA 1AUYA 4RR3C 4AGRA 1ZRDA 4L2NA 5AC93 1C8M1 1XC6A 1OOPA 3K3OA 4L0PA 4MGKE 4YVWB 1RMU1 5A32A 2BPA2 1W8TA 3N7MA 3ZKUA 1RUF2 4WM7B 3LSEA 5L73A 5CAZA 2AH2A 2W1UA 3WXPA 3ST7A 3D3AA 3V56A 1TMF1 4AXOA 2VBBA 2OQ7A 1VPHA 2HEWF 3LF7A 3QH7A 4M3CF 4XUPA 3VKMA 2P5BA 5FQ0A 5DQ0A 1S0GA 1PGL1 2YFZA 3P6BA 2FBEA 4DMIA 1W03A 4OHXA 4BB3A 2YZ4A 1JZ5A 3W20A 3WDYA 1GNHA 2VZRA 1AJOA 1JBCA 3MIBA 2CWMA 4P5YA 5LEKA 1KEXA 4WM8B 5CFDA 2PAMA 1Y4WA 2BRTA 2OYZA 4AEKA 3S5AA 1A34A 1SZBA 4XDQA 4NHMA 1G8WA 2H0BA 1RUC3 3T09A 4OQ8A 3H3UA 5FKCA 1L7LA 4XAAA 1Q8VA 1NE4A 4Q4W3 1V00A 2VOXA 1C8M2 2F17A 4YVWC 1RMU2 2BU9A 3I4IA 4WM7C 5GKAC 3WDTA 4HVRA 1G6NA 3N9OA 1VBB1 4A6OA 4AVVA 4QU1A 4CP2A 5LWBA 1N3PA 1YI7A 3LA2A 4YFWA 5KBFA 1TMF2 2AGSA 1UCXA 4XMIA 2MEV2 5FR3A 1CGPA 2R041 1PGL2 4ITCA 1PGW1 1UYPA 4K3UA 4YSFA 1WCUA 3E5QA 3AVSA 4CSWA 3VBFA 5BNNB 1QF3A 4PBOA 4CYDA 1UY0A 1SLIA 3PUAA 2XVGA 3SH5A 4WM8C 3WP3A 4KL1A 1W2NA 2ZZQA 2LROA 3PHMA 2DYCA 2W3JA 1HXS3 5FZ9A 1ULEA 2VMFA 5F6KA 2PLV3 1AR93 1G9CA 2EXIA 1CZTA 1UYYA 3DF0A 2QQJA 5JOYA 3I97A 4LIVA 3UGFA 3BTXA 4JGZA 1O3SA 2PHUA 3AL5A 5K8SA 2FD8A 3KT7A 1NXMA 4GWJA 5FY0A 1RGSA 4I0AA 3OBZA 1VBB2 4BQXA 4INDA 1ZA4A 4KG8A 4JC1A 4JHZA 1DZTA 4AR2A 3ME2A 3WNLA 3ZDVA 2R042 5EJ1B 2P6HA 3R05A 1PGW2 1I9RA 2BP6A 3D82A 3ZYGA 1VRH3 1WMEA 5BNNC 5KXBA 2DCKA 3S7EA 3RZHA 2HBUA 1V9U3 4AHXA 3A23A 2LTNA 1D0GA 2VZPA 2YMZA 4OQ9A 3ROUA 3ZN5A 4D0QA 2ZX2A 4EZHA 1WBFA 2YGMA 1QU0A 5I91A 3IIIA 1QNWA 4LTAA 4XBLA 1W8NA 1XJAA 1ZM1A 2JKBA 3N3HA 4UXAA 3V64A 3WF2A 4OHYA 5IFTA 1GUIA 2Z2SB 4ZU4A 1YHFA 1YYNA 2Q5TA 4LBQB 3ZFFA 4XCAA 2FDKA 2CYFA 3LD8A 2HWD3 3S7IA 2JDUA 1K42A 4ISQA 1FOD3 1R1A3 4GH4B 4ARXA 3N35A 1YC61 2H6BA 2NN8A 1W8WA 5KHJA 2XWBB 3HT1A 1LOBA 3MUZ1 1S0IA 4M0HA 5FY9A 2ZGLA 1VBE3 2JKXA 3FFQA 2A6XA 4SBVA 1UMHA 4V2VA 3SEEA 1LCLA 1R093 3B94A 2GSYA 2VZ3A 2Z4FA 5C70A 4JAAA 2DV9A 4X6QB 2BGPA 2DWRA 2D6PA 3GJBA 5FP4A 2Q8OA 4DXZA 4YVSA 2Z42A 5FLJA 1UIJA 3D4KA 2D6KA 4YW3A 1SLAA 4RQPA 4RYDA 3OGSA 3JBG3 2HWC1 2WIIB 3VZMA 4DIQA 1WLWA 4NRQA 4E4DX 1BCXA 3H3LA 1WUVA 3KLSA 2XL9A 3Q8BA 4JCKA 4QXCA 1MR5A 1QEXA 5DDJ3 2VULA 3I3EA 1FNYA 1KD7A 3OD4A 5FO8B 1XNCA 3M3OA 4WVZA 2R073 2BGOA 5EFUA 1W0OA 4GD4A 1X82A 4LK6A 4M3CB 2E51A 3AJZA 3NKTA 3NL1A 4GH4C 1AYM2 4RSUA 2XLFA 3UKNA 4F83A 2JDAA 3AMHA 4LNVA 1SMVA 1MS9A 2VQUA 2YBPA 2WO1A 1T6GC 4QXBA 4MGZE 2P34A 4Q5OA 3W5MA 4IGPA 3MW2A 5LZ6A 4KMQA 1J1LA 2WAOA 2GMPA 1UX7A 2DBNA 2WFF3 5E16A 1ENRA 1YFXA 3O1MA 2YUEA 3AYAA 4LKDA 3U0ZA 1EPWA 2WLQA 1F2NA 3K3NA 4YG0A 2Q8EA 3NNGA 4QKFA 1BHGA 4QGLA 5FYIA 3I2OA 1NLSA 2HWC2 2WSVA 2HLEA 2X29A 5F3IA 1MS3A 2RS31 4ZZ5A 1MQTA 2P3JA 1PIV3 1LB2A 2AUYA 4LT5A 3A0NA 2VUJA 1YQ8A 2FMDA 2VM9A 5LBCA 4MUVA 1E5SA 1OLME 2QQIA 1QH7A 1H0BA 1QJU3 1ULCA 2JENA 3WR0A 1V70A 1LU1A 1Y9GA 5FXWA 3IKWA 2UY8A 4XJUA 3U75A 5FZ7A 3OGJA 5AFEA 2AEZA 3WQ7A 4A42A 1DYPA 3P1IA 3ZYBA 3AMNA 2GNBA 2VW2A 1UZZA 3AMQA 1UL9A 1X8MA 3OD0A 3ES1A 3WG3A 4OI4A 2HYKA 4IV3B 4Q4V2 5FXXA 3VDCA 3ZVXA 4MHRA 1TME1 4OCTA 5LB6A 2D6OX 1UOJA 1JYWA 3VHPA 3T1MA 1NT0A 1X50A 3HBKA 4BJ0A 4MSVA 1RUI3 5J37A 1TE1B 1IPKA 4AVCA 2W94A 3CBNA 4I0BA 4LMFA 2RMU2 4YM1A 4CZSA 4L11A 1CQ9A 1DGLA 5IWFA 1SG3A 4XHBA 3POEA 3FHQA 3VKFC 2VOTA 2WNEA 4IESA 3SH4A 4DUVA 5JZGA 5C3SA 1JUIA 5FPZA 3ZSLA 5FMDA 5D8AA 1BQPA 2E32A 5BY5A 3USUB 4PQQA 3TRSB 3VDDA 3PIGA 1W99A 3AC0A 2L9LA 4FOWA 1B35B 4NIDA 5J1XA 1HJGA 1U12A 1O7FA 3E5XA 4Y1XA 1OSGA 1LTEA 1VBA1 4MHUA 2QDNA 3QBQA 3THDA 4BDVB 4Z92B 2W0XA 2XGXA 5I8YA 3W59A 1PO11 1JYCA 1RTVA 3U07A 3MIDA 4IV3C 3R6SA 1TNRA 5FDBA 1ZZ6A 4MVTA 5JCTA 4CP1A 5LW9A 2W1SA 2FCUA 1RXGA 3WW2A 2OPWA 4E8CA 4RHV3 1W2TA 1AXZA 5T3NA 4XXPA 1FV3A 2JB4A 5EJZB 1VE0A 1W6OB 2JWPA 4JHTA 3WT3A 3MGUA 1KGYA 4N43B 5A7WB 5BNOA 2LS6A 4QPGA 4Y4RA 4IE0A 4WV8A 1W6QA 1VB2A 1SLTA 5L9RA 1GYKA 2Y6JA 3MFAA 5C4WA 3ILRA 4JRLA 2PAEA 3UV9A 1PVXA 4E27A 1B35C 4DRRA 3FFZA 4WVMA 1JYIA 5JSOA 1SEFA 3ZIWA 1S55A 3B9CA 5FY4A 3ZYIB 4Y33A 3PVOA 2JDZA 1MS0A 1H6XA 5L36A 2GP3A 1PO12 2SBAA 1U5IA 4EZ4A 1R083 1M4WA 1Q43A 2ATFA 2VZUA 1SPPB 4XJZA 4N9HA 1VP6A 2BERA 1NXD1 3ZN6A 1WCQA 4UI9L 5F37A 1RUNA 4Z82A 4YG3A 2XVLA 3T2QA 3H1YA 4WZCA 4YLZA 2ZA9A 4CCEA 3RZGA 4N43C 4CA9A 5CBLA 3KQ4B 5DUVA 3AM2A 4YGEA 5IK4A 2FCTA 4FOQA 2IXLA 2XBO3 3ACIA 4XZUG 4EWAA 1JOJA 2XG3A 5FZDA 1I1EA 3BYWA 3AYEA 3OPZA 3OUJA 5A6ZA 5A70A 4LO8A 5JUVA 3RJRA 4PT6A 3ITQA 1ODNA 3TYJA 3U4XA 3JUUA 1K3IA 1G86A 3KB5A 4Y5SA 5J36A 4V1PA 3T1LA 3SMHA 3OSDA 1O3RA 5FK7A 4Q4Y3 2NQYA 3U78A 3AP7A 1VBD1 3B3QE 3E6BA 3HBZA 2PQQA 1Z7S3 2VQTA 3O1TA 4AFBA 5T5OA 3ZXAC 3VBRA 1COV1 1NCQB 2PQSA 2WNUB 1N3OA 4AEMA 3VBHA 1W90A 1VBC1 4OUSA 1NZCA 1YQ5A 2TUNA 3HMYA 3X29B 4CVUA 4DFSA 2XJPA 5L9BA 3AXDA 3NAPA 5F5AA 5FZ4A 3DUIA 4D7SA 2D43A 3VD7A 4GMP3 4HLTA 5D2AA 2VCBA 3IDBB 1JN2P 3O0XA 4GB33 3AMMA 3SH3A 2WWUA 5BV6A 3IPVB 3OPTA 4XQ4A 2VXRA 5LA9A 1ASJ1 4N9IA 4UF0B 3WD5A 3HNYM 2HYXA 1LOFC 2YC0A 3IMNA 3G7DA 4LBJA 2QJVA 3IAPA 1F5JA 2ES3A 4A2UA 4AFMA 1HQWA 3O5SA 2R0FA 3UKTA 1E5HA 4LHLA 2JB8A 2OQ6A 2V4AA 1GMMA 4MXWA 4OLLA 2X05A 3JQWA 2WBKA 3GDBA 2YGLA 3K4AA 1V6JA 4LBNA 4UW6A 4ZXEA 2O8QA 2JE8A 2ZTNA 4WBBA 1NCQC 3OJBA 2E6VA 1COV2 2WNUC 3DPRB 4N8MA 4Q2FA 5FZ0A 5I0UA 3VHOA 2C1FA 2RS13 4B7KA 5LK7B 1POV1 1W6MB 1VBC2 4AEJA 2VCCA 5JXGA 5LEJA 3VBSB 1L7QA 3THCA 3I59B 2EIDA 1EAH2 3MV01 4IEOA 1MZEA 4UW3A 5F39A 3ZFGA 5IT6A 1NA1A 2W39A 4XBQA 1QXRA 4A41A 5A3TA 2V5DA 3H0OA 5A6QA 1HN0A 5FUPA 5ANQA 2HJIA 3M4FA 2IXCA 1HQLA 1YEWA 2G1MA 3GBFA 3Q8FA 3D5OA 3O0VA 1IG0A 2EXKA 4HKOA 5BNPA 1H2LA 1HW5A 5B4XA 1H8VA 3OYWA 4YARA 5IVJA 2ILMA 4QM8A 3OGGA 3SLIA 1DYKA 1J83A 4MOAA 5A7PA 2ZS6B 2ET7A 1FMD3 5LK5A 3UL2A 3NSTA 2HWE2 5L9VA 3OEAA 1SLLA 1VAVA 1WCKA 2CHHA 3AP6A 4Q29A 4RS5B 3DPRC 1Y9QA 1EUUA 3OY8A 1REFA 5GLWA 4MXVA 2VZOA 2WABA 3VBSC 1AL0G 2JDMA 2X5IB 4HMZA 4P9WA 4EJRA 3B5LB 3E5UA 3CZJA 3KM5A 4QHZA 1C8NA 4UBHA 4FPOB 1W6PA 1QWRA 2KA3A 2OW4A 2ORZA 3LZZA 4AEDA 1SHWB 1D4M1 2VZ1A 3M8LA 4KH9A 2RE9A 2RDRA 5FO7B 1CAWA 2I74A 5F7UA 2JG9A 5GZCA 2OS2A 2GC1A 5JIUA 1V6LA 4XVHA 1M06G 4XUQA 1UIKA 3N9LA 2RG4A 2ZAHA 4P14A 4P9YA 1RC6A 1UD1A 2DTYA 4EN7B 1QY4A 4YZ2A 3WUCA 1ND2B 3HQUA 3VHRA 3V65A 4YW7A 5ABJB 3CU7A 3GF6A 3PUIA 2QKDA 1A6CA 2RM21 4R9AA 5FXZA 1OT5A 4RS5C 1IPSA 5A3UA 3LEMA 3WCRA 5HXMA 5DABA 1Q8PA 1V6OA 1LGBA 2VVFA 3ZPOA 2NMOA 4X8NA 4CCJA 1NQJA 2ZEWA 2LRPA 2CU5A 3RWNA 2X5IC 3H3ZA 4L97A 2D6MA 3I2KA 3WDUA 4QT6A 1X9TA 4DS0A 2GNTA 3JD72 5CKQA 4AW7A 3FBYA 4E9KA 4Q0QA 5JMCA 5ERLA 4CCCA 3AZZA 1D7PM 4D7TA 3MIEA 2BYVE 4JV4A 4IEYA 4V2WA 3NNJA 1MZFA 2JD9A 1PK6A 4RL7A 4E4HA 2BV4A 1VMJA 3B00A 4BE3A 4XJWA 4ZPIA 4A3ZA 3RZZA 3LAGA 2Y33A 1ND2C 3CJIA 1UF2C 1F9KA 5ABJC 1AR81 3RYPA 4YGCA 2VMDA 5HBAA 5K7PA 3MBWA 3OUHA 3TEXA 1QXPA 3S30A 1CAUA 5IJRA 2QZ3A 1W06A 2PHRA 2RM22 4UAPA 5AC91 4KU7A 3V0AA 4B4PA 4CDQA 1N47A 4IE5A 1QXJA 1S4CA 3TN93 5C3RA 4LLOA 4NAMA 2R7EB 4GULA 4LORA 4CCOA 3K4ZA 2RS53 5FZMA 4EN6B 1O91A 2OT7A 4D6RA 2QCSB 2WLPA 1IZ3A 4GAZA 1JOBA 2XJVA 4IV1A 1WMFA 4Y24A 1ZBA3 2ZHMA 3VD9A 1CJDA 4XFAA 5JPNB 3GCXA 2A6WA 4I3PA 4QM9A 5FUIA 4BHPA 4UFIA 1GQPA 3KV9A 3NV1A 1DG6A 2R49A 4IEVA 5FY5A 2Z79A 1LESA 2HWB3 5JOWA 1LEMA 1WW5A 2B5HA 3ECQA 5ACA3 5FLHA 5C3PA 1P8JA 4RGAA 4YM0A 5DZEA 3DKQA 5CNAA 1AR82 4FPJA 4OVEA 4M0NA 1RUC1 2GH2A 5FOJB 4FXGB 1JH5A 1CIWA 2R1DA 2VU9A 4COZA 2E53A 2D44A 2B46X 2YBKA 2ZHLA 4Q4W1 5AC92 2FZ1A 1YLLA 1PHMA 2BWAA 3GNEA 1LU2A 2FHRA 3BU7A 3ZYFA 5A7OA 3H1WA 3GCWA 1PO22 2WQZC 1Y9MA 4IEPA 2RJKA 1CN1A 1D2SA 1CVNA 2EAAA 1RVF3 3O0WA 1E5RA 4IGOA 4PQ9A 5A3WA 3T3YA 3U37A 1GKBA 3WF0A 1CAXB 2OZJA 3AKTA 1I5PA 2R062 3INAA 5JMOA 1GV9A 2DVAA 2ZMLA 1LJ7A 4Y22A 5BYNA 4IQPA 4SLIA 2V4VA 3L2HA 5FY1A 5DAPA 3NW4A 4FPYA 4LPLA 5FAXA 4AGVA 2C0ZA 5FMCA 1DIWA 2E7QA 4AE2A 4EYUA 4CDXB 1HXS1 3N9NA 4G3YC 4JRAA 4PBPA 4QXHA 2PLV1 1AR91 1JOPA 1C5HA 1AR63 5FZCA 4XOGA 2GP5A 4MH0E 1OQEA 3RPQA 1RUC2 2WNVA 1GP4A 4QPIB 4C90A 1TG7A 4EN9B 1QMJA 1ZBE2 3BVCA 5FMOS 3WHUA 4QB1A 4Q4W2 4D94A 3HWJA 2B39A 3CZUA 3WNNA 4L99A 5KXEA 4LE3A 3LA3A 4FQ4A 1Y43B 4AFCA 2PHDA 1OLQA 4PI2A 3VLBB 2VTXJ 5DUUA 4NPMA 1AX0A 2LALA 5K0UC 4GWIA 3RG0A 3UGHA 2EAKA 3QD6A 4QPYA 1C28A 2EXHA 4AG4A 2WUHA 2NP0A 3M3CA 2JICA 3VZKA 1VRH1 3SEPA 1BXHA 4GIQA 2SLIA 4ES9A 1W6NB 3KT4A 2ZXQA 4IE6A 2Q8DA 3MF9A 2BGCA 2QQWA 3HQXA 4CDXC 4ES8A 3M3QA 1OURA 1HXS2 2OKXA 1ALYA 3NKGA 1DYOA 1OQ1A 1AR92 2PLV2 1V6MA 2WN2A 5FYSA 1O3TA 4QPIC 2XH6A 3MEPA 1WCDJ 1IPJA 1PMJX 4NAOA 1SCRA 3BUCA 3ZLIA 2HWD1 2Q1ZB 2E7AA 1IOAA 2CL2A 2ZHKA 2R6QA 3ORJA 5A6YA 4GZ9A 1FOD1 4EE2A 1GP6A 1R1A1 4B7EA 1KJRA 2PHXA 4WVWA 5CZKA 4BIOA 3SCFA 3PUHA 3NRUA 3P3PA 1V6IA 4LBMA 4DXSA 1R091 3FN9A 2Y6KA 4R9BA 4OHVA 5GJ6A 2WZ8A 1DQ2A 2Y26A 3ZKYA 4E4SA 2J7MA 5ANNA 3RZJA 3AFKA 1JUHA 2WC2A 4LKFA 5IK8A 3FC0A 3N9QA 4Y1UA 2NLRA 4AOCA 1RUE3 4COWA 4CU9A 4K6BA 4XDPA 4CCLA 4P9XA 2P6CA 3I2IA 4X6RB 3JBG1 4XILA 3KF5A 5FZ6A 1QDOA 4QGNA 4YZ5A 1C1FA 5LCWL 4J1WA 4ONUA 2Y6GA 2BVBA 4NWVA 1WBLA 2BW8A 5EV7A 2ZX0A 4PLOA 4Q0UA 1YWKA 1W3XA 3I2JA 5DDJ1 1OH3A 3ASIA 4NJ4A 1MS1A 2B42B 4MLOA 5IK5A 2R16A 2QQVA 1O8PA 4Q4X3 3POIA 2VJXA 5IVYA 1RUG3 2HWD2 4KWLA 4LXLA 4NPRA 1ND3B 1V0AA 2XR4A 4NHYA 1G9FA 1R1A2 3TNPB 3QH6A 4X8PA 5DZFA 4XF9A 2D93A 1O6UA 1QJX3 4NIAA 1NCRB 4QX5A 1ENXA 3SKVA 3C3VA 1DHKB 4OMDA 2WFF1 3UT0A 1IHMA 4DQAA 2J1AA 1F35A 4AI2A 1W9YA 3FZ3A 4Y5TA 4YNIA 5F3CA 4CEYB 4K1YA 4KG0A 3IDEA 3GZEA 1MS5A 1DQ1A 1NG0A 3DCQA 3MPBA 2I2SA 2VZQA 4QMAA 2VBPA 3RJ2X 4Z2AA 3DEMA 3POFA 4P9JA 2E26A 1J84A 5SV8A 4FPKA 4AL9A 1PIV1 1JHJA 1JYTA 5KXCA 1HQNA 1GZWB 3K2OA 5A3OA 4P9GA 4PIZA 5DDJ2 1U5XA 2X8KA 4NOTA 3Q8CA 2XWJB 1LNSA 1L3JA 1ZRIA 2IUWA 1QJU1 2ZX4A 3BIWE 1KDMA 3ILNA 4IE4A 2QQMA 1ST8A 2QFEA 5IUQA 1CPMA 1ND3C 3LEKA 2F4PA 1YIPA 4FPFA 5FPLA 3VZLA 3OBTA 4PDWA 1NCRC 4Y5Z0 5LBBA 3VKLA 3ZFEA 1PM4A 2GALA 2QDRA 4HK9A 2WFF2 3USSA 3ZSEA 1IG3A 1W8ZA 4HPKA 5FY7A 2A6YA 2ARCA 3R4UA 4CEYC 4S2FA 4ZONA 1QDCA 1F4AA 1OFSA 4U36A 1RUI1 4K40A 1AXKA 1E5IA 3A0KA 2WO3A 3AKRA 1KDKA 3J8F3 3UJOA 3PUSA 3R4DB 4AHYA 4ASKA 1VAMA 3I3BA 2J22A 3C7HA 2VUAA 4FFIA 4IEWA 3BTZA 4HETA 4XIKA 1PIV2 4ZS3A 4E2SA 2W92A 3WINE 1WD3A 2IVIB 3CKHA 5JPMB 2G19A 5FZ8A 4A7ZA 3PNAA 3VBOB 1QJU2 4W50A 1AL23 1RUJ3 3C7FA 3ZOIA 3ZXJA 3D6EA 3MHZA 3LEIA 4LO4B 3H8OA 4AQ2A 4R9DA 1W2UA 3J7LA 4JKMA 4FOYA 4OZOA 4BWOA 2CSGA 3R0RA 4ATFA 2NMNA 2XLAA 3HAGA 2A73B 1H9WA 1MEC3 4XJAA 3WY6A 4B29A 2D3SA 1OKQA 4H14A 2A3XA 2ZEZA 2R30A 3T2PA 5GLZA 2R32A 1OA4A 1RUI2 4P5HA 3N7LA 5GZFA 1GP5A 1Y7BA 1F31A 2A75A 3Q9OA 4UT5A 2WO2A 5T52A 5IVEA 3LOIA 4FFGA 4O61A 2DVGA 2IXKA 1KFUL 1CD3G 2VMEA 4YZ4A 3VD4A 2VQ0A 4JVAA 3SNMA 3ZR5A 5FWJA 1QIQA 1H9PA 3WNXA 4BQYA 5J09A 3VBOC 2G9FA 1JMUB 1QQP3 4ORFA 1HRV3 1VRBA 1SACA 1FAYA 3K51A 4QQHA 4QHOA 1DF0A 4W8JA 3TB0A 3FUQA 4DEVA 2XHNA 3VL9A 4JGYB 4MGQA 1W0PA 4C1WA 1ACCA 1U0AA 3C7GA 4CP9A 1XE7A 4N53A 2EXJA 5FP3A 1R081 3OG2A 1DFQA 2ADEA 4JQTA 5IYYA 4PJYA 1WWYA 3CLPA 4YM3A 1JU4A 1PZ8A 2EALA 4QB6A 4CDWB 4EWDA 2Q1FA 4NRPA 4BOWA 1YFUA 4FO9A 4ZHNA 3KZ4C 5DN2A 1W2AX 2WT0A 2A71A 3R4SA 3UKVA 5J48A 1UY4A 4BM8A 2XBO1 4CDUA 1PM7A 4YFZA 4R4ZA 3VB9A 3WP6A 2WWSA 1UNBA 1KS4A 2ZABA 3M2MA 1BJQA 2PAKA 4DINB 4GKYA 2CNAA 2XJTA 1S0EA 1YO8A 4AWDA 3ZXKA 2EVXA 4EWEA 4QQLA 3PIJA 2A3YA 4RR3A 5EZWA 2BVVA 3UJQA 4YW2A 1N1TA 3E6DA 3WP4A 3P5BA 2B7YA 2W9XA 3M70A 4JGYC 4IEZA 1C8M3 5HXVA 1PVC3 2J1UA 1RMU3 1SFNA 1AX1A 1HKDA 1Z7S1 5CYYA 5L19A 1AF9A 5FZIA 1W9SA 2WYSA 1R082 3MO4A 3PTYA 4AAPA 4E2QA 3M3IA 4CDWC 1CX1A 1CAVB 2ZAAA 2GZWA 1IS4A 2MEV3 3ACHA 4CU6A 1MACA 3KV6A 5A7NA 1EV13 2VW1A 3D0SA 2UWCA 2PHFA 3DYOA 4QAWA 4XE9A 1LOAA 3SHRA 3VKOA 1G9AA 4XJ9A 5FZEA 3OTFA 5FZBA 2WAAA 1ZZ9A 4GMP1 5F2SA 4GB31 2C4XA 3GM8A 1IQAA 5FKBA 1C4RA 1J1TA 3ZFGB 2XOMA 1T6BX 1H4GA 1AVBA 1UXZA 2F6BA 2VMGA 3DECA 2O14A 3ACGA 5EYXA 4LHNA 4QDSA 4BQ3A 2EIGA 1XSRA 2JDPA 3OGRA 2IFRA 3SQOA 3H42B 4FFHA 3T2TA 5KHKA 3GZUC 1UQXA 4DY5A 5DAWA 2HEYF 1UOGA 3ACLA 5BNQA 4YVWA 1QGLA 2DFCA 4I01A 4WM7A 1FXZA 1UKGA 1Z7S2 1DP0A 3AX4A 4C91A 5JXIA 3S57A 3KV5A 2VW0A 5A1LA 1YJKA 1BK1A 4UW4A 4HVQA 2RS11 2RS32 1VIWB 1Z0HA 3FL7A 3VZOA 4N7UA 1OF4A 1QOOA 2P17A 1XYNA 3SCGA 2VVEA 1X36A 3H8XA 3WG2A 3DXTA 5FZHA 4B1LA 5FJKA 2DCTA 2DDUA 1STMA 4E2GA 4WM8A 4MX3A 3I2FA 3ZFGC 4NRMA 4CXWA 3WV6A 3VDAA 1YFWA 1GBGA 4D3WA 4HK8A 5F2WA 1C3HA 2NM1A 2W5FA 1JZ3A 2J1VA 3VBUB 3IMMA 2XJSA 2BOIA 1OPMA 4PLMA 5C7GA 4BIFA 4KWJA 1TME2 4YW5A 5H9QA 4KQ7A 5H9RA 1TEIA 3VGIA 1FMD1 2MNGA 5CEHA 4XF0A 2DCZA 5SV5A 1FX5A 2TBVA 3O1PA 4JTNA 3RYRA 5C6CA 4NIHA 3TNQA 4MGYE 1S0FA 3N7JA 2GN7A 3VDBA 4NIGA 3NNMA 2RS12 1DLLA 4BQ5A 1BZWA 4M01A 2QUOA 4LIUA 4N7IA 1LOEA 3MW4A 2WWJA 5BNNA 2Y6FA 4PIXA 2ZX1A 2A6VA 4RN5A 2CWSA 4UBGA 4CCNA 2VAUA 5A3PA 3PU3A 2XVKA 4QX1A 2LW8A 4NMIA 4CXYA 5HV0A 3HNBM 1MZ5A 4XF1A 2ZMNA 4QGMA 2G9ZA 1VBA2 3B9IA 5FYYA 1V6KA 5CB7A 1DZQA 1GOFA 3IBMA 3VBUC 1UU6A 2C6SA 3RGBA 4ZZ8A 3SKJE 4AF9A 4LBKA 1JTZX 3DXUA 3JU9A 1CWPA 3AL6A 1QHDA 3D0JA 4XAEA 2B9UA 4ZY9A 3WP5A 3WF3A 4NN0A 1AYM3 5C71A 3O1OA 3GHMA 2YBSA 1ULDA 3FX3A 3ZSMA 1YQCA 4CEWB 2RDSA 2RVAA 5A33B 5LA0A 1W8FA 2RDQA 1PZ9A 1LHUA 4ASMB 2PHLA 4BZ4A 4AGGA 1DQ6A 3B01A 5KR7A 3V0BB 2VECA 1US3A 1XBFA 2ZZJA 4I2OA 1AR73 3POGA 4EV0A 3S6PA 1HB4A 2JDHA 3ZSKA 1US2A 4A4AA 2P37A 4E4ZA 2HBTA 3KD4A 5IHRA 1NE6A 3PU8A 3LDBA 1QJY3 2CTVA 4XQWA 2GMEA 3T0AA 4QKNA 3PUQA 2XONA 3IN9A 2W46A 1IQDC 4LBQA 1CZVA 1H8TB 1O4YA 3OF1A 5E89A
chains in the Genus database with same CATH topology
1XC6A 5IJRA 4L0PA 1TVGA 4UAPA 4P00B 4QPWA 3MV11 2W1UA 3VD5A 3C8XA 3D3AA 5JXJA 3WF1A 2R7EB 4XUPA 3K4ZA 3LPGA 1PX3A 3DYPA 5DQ0A 2YFZA 3HJRA 3P6BA 4E8DA 2RJ2A 1JZ5A 1UZ0A 3JXSA 3IDAA 3VD9A 2VZRA 4UOJA 4P5YA 5FUIA 1KEXA 1GQPA 4QX0A 3ECQA 1JYVA 3LE0A 1P8JA 3T09A 2B9VA 3WF4A 2ZEYA 2W91A 1L7RA 3I2GA 4TTGA 3K77A 1UMIA 2C9KA 4A6OA 2EIBA 2VMCA 3LPFA 3IB3A 3ZM8A 2CDOA 3U37A 3WF0A 4PF1A 1I5PA 3T08A 1UY0A 5JMOA 2ORXA 5DMYA 1UXXX 2V4VA 1XPWA 2W3JA 4LPLA 2VMFA 3NQHA 4ARYA 3ABZA 3CDZB 3E1F1 1CZTA 1UYYA 3VD3A 2QQJA 5HPOA 3I97A 3I2HA 1TG7A 4QB1A 4DUXA 4GWJA 3WNNA 3CZUA 1PMHX 4YPJA 4A45A 1HN1A 2C26A 4CUAA 4DXRA 4D8MA 4JHZA 2J1RA 3WNLA 1NKGA 5EJ1B 4DUWA 4GWIA 4QDQA 3WEZA 1W9WA 3FHAA 2DCKA 4AG4A 2WUHA 3A23A 4QB2A 2VZPA 2YC4A 3SEPA 4D0QA 4P02B 2ZXQA 3IIIA 2VC9A 1GU3A 1W8NA 4JKKA 3WF2A 2OKXA 5IFTA 1DYOA 1GUIA 3IAQA 2YB7A 2WN2A 3WNOA 4OUEA 4DEQA 1K42A 1PMJX 4BXSV 1OH4A 4ARXA 1MPXA 2B4KA 4GZ9A 3HPNA 3MUZ1 2XQXA 5CZKA 2JKXA 3SEEA 1UMHA 3PUHA 3NRUA 2Z4FA 1ULPA 2VZ3A 3CQOA 5C70A 4DXSA 3FN9A 2Y6KA 2BGPA 2EICA 2WZ8A 1JZ6A 2VCAA 2J7MA 4A44A 4CU9A 4RYDA 3OGSA 1EUTA 3I2IA 3T2OA 3HNMA 2QQOA 1DLCA 5LCWL 2Y6GA 3I3EA 1NUKA 2VZVA 2BGOA 3I2JA 2W1QA 3A22A 2VZTA 1O8PA 1RYYA 4HG6B 2VJXA 3WNPA 2JDAA 2VQUA 1JYXA 5LA2A 2WO1A 3HN3A 3W5MA 4KMQA 2WAOA 3K75B 1UX7A 3GGLA 3SKVA 4OMDA 3EB7A 3CMGA 2J1AA 3WQBA 3WNMA 2J1TA 3NNGA 1GOHA 1BHGA 2HLEA 2VZQA 4ZZ5A 3K46A 4Z2AA 4ET7A 2E26A 1J84A 3NJXA 1JZ8A 1JHJA 2VM9A 2QQIA 2X09A 2KD7A 3OBAA 2W87A 1LNSA 2BZDA 2QQMA 3NJVA 2ZEXA 1OD3A 3LEKA 4A42A 3P1IA 4MADA 3W5NA 3VDCA 1JYWA 4BJ0A 1F4AA 2W94A 2WO3A 3OEBA 1SG3A 4DUVA 3FHQA 2VOTA 3I3BA 2J22A 3C7HA 4XUTA 1SDDB 4CU7A 3A21A 3WNKA 2W92A 4OMCA 4M4PA 2E32A 4PQQA 3CKHA 3C7OA 2VO5A 1W99A 1JZ4A 3AC0A 2L9LA 5J1XA 4W50A 3C7FA 2YG0A 3MUY1 4OYUA 2RV9A 3LEIA 2BBAA 2YFUA 3THDA 4BDVB 2YC2A 4JKMA 1K12A 3ETPA 4OZOA 2W47A 4M4RA 1W9TA 3UESA 2W1SA 2Y64A 1YQ2A 4E8CA 1R64A 3EYPA 5LA1A 2ZEZA 5EJZB 3T2PA 4FI9A 1KGYA 2Y6HA 1JYNA 2LS6A 1JU3A 5I0DA 2WO2A 2Y6JA 2VMEA 3VD4A 4QX3A 3K4DA 4XURA 4KI5M 2J1SA 1UY1A 4W8JA 2QBXA 1H6XA 4DEVA 2XHNA 1OF3A 4MGQA 1UYXA 3C7GA 2VZUA 3OG2A 2BERA 2Y6LA 1XNTA 1WCQA 4UI9L 5IYYA 5B4NA 1JU4A 4QB6A 3UETA 3T2QA 3BGAA 5JR2A 3C7EA 4IUGA 3ACIA 4XZUG 5DN2A 1UY4A 2V72A 2WDBA 5JUVA 4PT6A 1GNYA 1K3IA 3A7QA 2W9XA 2VQTA 2J1UA 5CYYA 2PQSA 4CUCA 1W9SA 2WYSA 3MO4A 5JXHA 3GXUA 4CVUA 1CX1A 4QDRA 4CU6A 3ACHA 1GOGA 3J7HA 5A1AA 4KWUA 3DYOA 3OGVA 4QAWA 3VD7A 3LEGA 2VCBA 5G04L 2WAAA 3OB8A 2C4XA 3GM8A 3HNYM 2HYXA 1F4HA 3BN6A 2XOMA 1UXZA 3HEIA 3DECA 4JX0A 3ACGA 4LQRA 4QDSA 3IAPA 2W1WA 3OGRA 1XNAA 1NAEA 3UNPA 1CIYA 1GMMA 2X05A 2WBKA 3GDBA 3K4AA 4ZXEA 2WQ8A 2JE8A 4P08A 3T0BA 4LKSA 1DP0A 5JXIA 1JZ7A 2VCCA 5JXGA 1L7QA 4QX2A 3FL7A 3THCA 1OF4A 2EIDA 1WKYA 3MV01 2WN3A 5IFPA 4XUNA 4A41A 2CDPA 2DDUA 2V5DA 3ACFA 4MO3M 3I2FA 5EIYB 1O59A 3WSOA 3LQCA 4CU8A 3VDAA 2J1EA 2W5FA 2Y8KA 3DYMA 3I3DA 4JKLA 1JZ3A 2J1VA 5B4XA 2X10A 4MOAA 1J83A 2QQLA 4TXWA 5C7GA 3OEAA 1EUUA 3T0DA 2EIEA 4MGSA 3VDBA 2VZOA 2WABA 1K45A 2E31A 1UYZA 4LHSA 3HOBA 2VL4A 4AAXA 3CZJA 4BK4A 2ORZA 4RN5A 1SHWB 1W8OA 2VZ1A 1W0NA 5G05L 5F7UA 4QX1A 2LW8A 4XVHA 3HNBM 4XUQA 1JZ2A 4W4ZA 4XUOA 1GOFA 2VR4A 2E33A 4ZZ8A 3SKJE 2VTFA 3PUIA 2QQKA 1ULOA 5HXMA 1OT5A 4ZY9A 3WF3A 2QQNA 5C71A 1H6YA 2ZEWA 1NX9A 2RVAA 4DXTA 5LA0A 1O8SA 3I2KA 2DCJA 1PX4A 1US3A 1UY3A 3F2ZA 1D7PM 2VZSA 2JD9A 2ID4A 1US2A 4A4AA 1JI6A 1UY2A 5DPNA 5IHRA 2W95A 3CIHA 4BK5A 1UWWA 4A3ZA 4CUBA 3T0AA 2WZEA 1CZSA 2XONA 2W46A 1IQDC 1CZVA 1T2XA 2VMDA 3MBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC6 A;  5IJR A;  4L0P A;  1TVG A;  4UAP A;  4P00 B;  4QPW A;  3MV1 1;  2W1U A;  3VD5 A;  3C8X A;  3D3A A;  5JXJ A;  3WF1 A;  2R7E B;  4XUP A;  3K4Z A;  3LPG A;  1PX3 A;  3DYP A;  5DQ0 A;  2YFZ A;  3HJR A;  3P6B A;  4E8D A;  2RJ2 A;  1JZ5 A;  1UZ0 A;  3JXS A;  3IDA A;  3VD9 A;  2VZR A;  4UOJ A;  4P5Y A;  5FUI A;  1KEX A;  1GQP A;  4QX0 A;  3ECQ A;  1JYV A;  3LE0 A;  1P8J A;  3T09 A;  2B9V A;  3WF4 A;  2ZEY A;  2W91 A;  1L7R A;  3I2G A;  4TTG A;  3K77 A;  1UMI A;  2C9K A;  4A6O A;  2EIB A;  2VMC A;  3LPF A;  3IB3 A;  3ZM8 A;  2CDO A;  3U37 A;  3WF0 A;  4PF1 A;  1I5P A;  3T08 A;  1UY0 A;  5JMO A;  2ORX A;  5DMY A;  1UXX X;  2V4V A;  1XPW A;  2W3J A;  4LPL A;  2VMF A;  3NQH A;  4ARY A;  3ABZ A;  3CDZ B;  3E1F 1;  1CZT A;  1UYY A;  3VD3 A;  2QQJ A;  5HPO A;  3I97 A;  3I2H A;  1TG7 A;  4QB1 A;  4DUX A;  4GWJ A;  3WNN A;  3CZU A;  1PMH X;  4YPJ A;  4A45 A;  1HN1 A;  2C26 A;  4CUA A;  4DXR A;  4D8M A;  4JHZ A;  2J1R A;  3WNL A;  1NKG A;  5EJ1 B;  4DUW A;  4GWI A;  4QDQ A;  3WEZ A;  1W9W A;  3FHA A;  2DCK A;  4AG4 A;  2WUH A;  3A23 A;  4QB2 A;  2VZP A;  2YC4 A;  3SEP A;  4D0Q A;  4P02 B;  2ZXQ A;  3III A;  2VC9 A;  1GU3 A;  1W8N A;  4JKK A;  3WF2 A;  2OKX A;  5IFT A;  1DYO A;  1GUI A;  3IAQ A;  2YB7 A;  2WN2 A;  3WNO A;  4OUE A;  4DEQ A;  1K42 A;  1PMJ X;  4BXS V;  1OH4 A;  4ARX A;  1MPX A;  2B4K A;  4GZ9 A;  3HPN A;  3MUZ 1;  2XQX A;  5CZK A;  2JKX A;  3SEE A;  1UMH A;  3PUH A;  3NRU A;  2Z4F A;  1ULP A;  2VZ3 A;  3CQO A;  5C70 A;  4DXS A;  3FN9 A;  2Y6K A;  2BGP A;  2EIC A;  2WZ8 A;  1JZ6 A;  2VCA A;  2J7M A;  4A44 A;  4CU9 A;  4RYD A;  3OGS A;  1EUT A;  3I2I A;  3T2O A;  3HNM A;  2QQO A;  1DLC A;  5LCW L;  2Y6G A;  3I3E A;  1NUK A;  2VZV A;  2BGO A;  3I2J A;  2W1Q A;  3A22 A;  2VZT A;  1O8P A;  1RYY A;  4HG6 B;  2VJX A;  3WNP A;  2JDA A;  2VQU A;  1JYX A;  5LA2 A;  2WO1 A;  3HN3 A;  3W5M A;  4KMQ A;  2WAO A;  3K75 B;  1UX7 A;  3GGL A;  3SKV A;  4OMD A;  3EB7 A;  3CMG A;  2J1A A;  3WQB A;  3WNM A;  2J1T A;  3NNG A;  1GOH A;  1BHG A;  2HLE A;  2VZQ A;  4ZZ5 A;  3K46 A;  4Z2A A;  4ET7 A;  2E26 A;  1J84 A;  3NJX A;  1JZ8 A;  1JHJ A;  2VM9 A;  2QQI A;  2X09 A;  2KD7 A;  3OBA A;  2W87 A;  1LNS A;  2BZD A;  2QQM A;  3NJV A;  2ZEX A;  1OD3 A;  3LEK A;  4A42 A;  3P1I A;  4MAD A;  3W5N A;  3VDC A;  1JYW A;  4BJ0 A;  1F4A A;  2W94 A;  2WO3 A;  3OEB A;  1SG3 A;  4DUV A;  3FHQ A;  2VOT A;  3I3B A;  2J22 A;  3C7H A;  4XUT A;  1SDD B;  4CU7 A;  3A21 A;  3WNK A;  2W92 A;  4OMC A;  4M4P A;  2E32 A;  4PQQ A;  3CKH A;  3C7O A;  2VO5 A;  1W99 A;  1JZ4 A;  3AC0 A;  2L9L A;  5J1X A;  4W50 A;  3C7F A;  2YG0 A;  3MUY 1;  4OYU A;  2RV9 A;  3LEI A;  2BBA A;  2YFU A;  3THD A;  4BDV B;  2YC2 A;  4JKM A;  1K12 A;  3ETP A;  4OZO A;  2W47 A;  4M4R A;  1W9T A;  3UES A;  2W1S A;  2Y64 A;  1YQ2 A;  4E8C A;  1R64 A;  3EYP A;  5LA1 A;  2ZEZ A;  5EJZ B;  3T2P A;  4FI9 A;  1KGY A;  2Y6H A;  1JYN A;  2LS6 A;  1JU3 A;  5I0D A;  2WO2 A;  2Y6J A;  2VME A;  3VD4 A;  4QX3 A;  3K4D A;  4XUR A;  4KI5 M;  2J1S A;  1UY1 A;  4W8J A;  2QBX A;  1H6X A;  4DEV A;  2XHN A;  1OF3 A;  4MGQ A;  1UYX A;  3C7G A;  2VZU A;  3OG2 A;  2BER A;  2Y6L A;  1XNT A;  1WCQ A;  4UI9 L;  5IYY A;  5B4N A;  1JU4 A;  4QB6 A;  3UET A;  3T2Q A;  3BGA A;  5JR2 A;  3C7E A;  4IUG A;  3ACI A;  4XZU G;  5DN2 A;  1UY4 A;  2V72 A;  2WDB A;  5JUV A;  4PT6 A;  1GNY A;  1K3I A;  3A7Q A;  2W9X A;  2VQT A;  2J1U A;  5CYY A;  2PQS A;  4CUC A;  1W9S A;  2WYS A;  3MO4 A;  5JXH A;  3GXU A;  4CVU A;  1CX1 A;  4QDR A;  4CU6 A;  3ACH A;  1GOG A;  3J7H A;  5A1A A;  4KWU A;  3DYO A;  3OGV A;  4QAW A;  3VD7 A;  3LEG A;  2VCB A;  5G04 L;  2WAA A;  3OB8 A;  2C4X A;  3GM8 A;  3HNY M;  2HYX A;  1F4H A;  3BN6 A;  2XOM A;  1UXZ A;  3HEI A;  3DEC A;  4JX0 A;  3ACG A;  4LQR A;  4QDS A;  3IAP A;  2W1W A;  3OGR A;  1XNA A;  1NAE A;  3UNP A;  1CIY A;  1GMM A;  2X05 A;  2WBK A;  3GDB A;  3K4A A;  4ZXE A;  2WQ8 A;  2JE8 A;  4P08 A;  3T0B A;  4LKS A;  1DP0 A;  5JXI A;  1JZ7 A;  2VCC A;  5JXG A;  1L7Q A;  4QX2 A;  3FL7 A;  3THC A;  1OF4 A;  2EID A;  1WKY A;  3MV0 1;  2WN3 A;  5IFP A;  4XUN A;  4A41 A;  2CDP A;  2DDU A;  2V5D A;  3ACF A;  4MO3 M;  3I2F A;  5EIY B;  1O59 A;  3WSO A;  3LQC A;  4CU8 A;  3VDA A;  2J1E A;  2W5F A;  2Y8K A;  3DYM A;  3I3D A;  4JKL A;  1JZ3 A;  2J1V A;  5B4X A;  2X10 A;  4MOA A;  1J83 A;  2QQL A;  4TXW A;  5C7G A;  3OEA A;  1EUU A;  3T0D A;  2EIE A;  4MGS A;  3VDB A;  2VZO A;  2WAB A;  1K45 A;  2E31 A;  1UYZ A;  4LHS A;  3HOB A;  2VL4 A;  4AAX A;  3CZJ A;  4BK4 A;  2ORZ A;  4RN5 A;  1SHW B;  1W8O A;  2VZ1 A;  1W0N A;  5G05 L;  5F7U A;  4QX1 A;  2LW8 A;  4XVH A;  3HNB M;  4XUQ A;  1JZ2 A;  4W4Z A;  4XUO A;  1GOF A;  2VR4 A;  2E33 A;  4ZZ8 A;  3SKJ E;  2VTF A;  3PUI A;  2QQK A;  1ULO A;  5HXM A;  1OT5 A;  4ZY9 A;  3WF3 A;  2QQN A;  5C71 A;  1H6Y A;  2ZEW A;  1NX9 A;  2RVA A;  4DXT A;  5LA0 A;  1O8S A;  3I2K A;  2DCJ A;  1PX4 A;  1US3 A;  1UY3 A;  3F2Z A;  1D7P M;  2VZS A;  2JD9 A;  2ID4 A;  1US2 A;  4A4A A;  1JI6 A;  1UY2 A;  5DPN A;  5IHR A;  2W95 A;  3CIH A;  4BK5 A;  1UWW A;  4A3Z A;  4CUB A;  3T0A A;  2WZE A;  1CZS A;  2XON A;  2W46 A;  1IQD C;  1CZV A;  1T2X A;  2VMD A;  3MBW A; 
#chains in the Genus database with same CATH topology
 5APA A;  1C5I A;  1OC1 A;  2BNO A;  1QJF A;  5HCH A;  4GH4 A;  3ZYR A;  4A3X A;  1K5M B;  1S0D A;  4MGT A;  5A80 A;  2BJS A;  4TYS A;  1QOS A;  1OMI A;  3MLJ A;  2HWF 3;  2VUC A;  5JXJ A;  4CEW C;  3BOW A;  2P3Y A;  3LIG A;  3LPG A;  1PX3 A;  3N9P A;  3HJR A;  4Q4V 3;  2RS5 1;  3S0M A;  4D6Q A;  4E8D A;  5CFC B;  2RJ2 A;  5J96 B;  3RWK X;  3FLP A;  3JXS A;  5GZE A;  3WW4 A;  4XQD A;  1IGO A;  3IDA A;  2XPJ A;  5C9A B;  2WO7 A;  4UOJ A;  2PN5 A;  3LDK A;  1ZBA 1;  4UYB A;  1RUD 3;  5FP7 A;  2B45 X;  3LSD A;  1HDK A;  2RMU 3;  2XJQ A;  3JZV A;  2JG8 B;  4UFL A;  3EXU A;  1JYV A;  3MYX A;  1HX6 A;  2HWB 1;  2YU2 A;  5LAS A;  1VBD 2;  3WF4 A;  2FQP A;  5FZO A;  1H8T C;  2HKX A;  2ZEY A;  3RZM A;  2PHT A;  5I8T A;  4AFA A;  2W91 A;  4M3C A;  1L7R A;  5JSR A;  1ZRC A;  3I2G A;  1K5M C;  4TTG A;  2ZCW A;  3WQ1 A;  2C9K A;  3IZO A;  4TWT A;  2K2S A;  3W21 A;  4COU A;  5IVB A;  1KJL A;  2XDV A;  4GMP 0;  2EIB A;  4XET A;  3LPF A;  3PDQ A;  4FPH A;  1ZYB A;  1AYN 3;  1GNZ A;  3IB3 A;  4G4F A;  2GU9 A;  4HAN A;  4S2D A;  5IVV A;  5M0T A;  3TEW A;  2WR9 A;  1S0J A;  1X7N A;  2OUH A;  2CDO A;  4L92 A;  1JOD A;  1VMF A;  2RS5 2;  2UWB A;  4RGK A;  4ZKT B;  5CFC C;  1ASJ 2;  1RVF 1;  3DL3 A;  1I5Z A;  2Y0I A;  5C9A C;  2XQR A;  2XML A;  3T08 A;  3KF3 A;  1ZBA 2;  5C33 A;  2QVS B;  5CKN A;  2ORX A;  5DMY A;  1SBE A;  2JDN A;  4HZF A;  2JG8 C;  1UOB A;  1N1Y A;  4I3G A;  3H50 A;  3E1F 1;  2HWB 2;  1LGN A;  4GAL A;  4BLI A;  3MZH A;  3K48 A;  4IE7 A;  5HPO A;  5DAV A;  4IEU A;  5L7O B;  1AR6 1;  1LUL A;  3MIG A;  4Y20 B;  3MIC A;  4DPN A;  3RDI A;  2WRA A;  2PYT A;  1UU5 A;  1JXN A;  3QCW A;  3SIS A;  1PMH X;  1RHI 1;  2OII A;  4B1M A;  4A45 A;  1UPI A;  4FBF A;  3M7A A;  1O4Z A;  1LEC A;  2GC3 A;  4D8M A;  5FP9 A;  4IV3 A;  3AJY A;  2J1R A;  2VNV A;  4QDQ A;  2JE7 A;  5J98 B;  1RVF 2;  5FIX A;  3FHA A;  5B2G B;  3RRD A;  2FZ2 A;  2UYB A;  3MFC A;  5C8C B;  4LKE A;  4P9L A;  5GZG A;  4OHW A;  1BMV 1;  2N7G A;  2VOV A;  2VC9 A;  1GU3 A;  1SCS A;  2YU1 A;  3EQE A;  3KSC A;  3PMS A;  2IC1 A;  4HN1 A;  1WA6 X;  4O65 A;  4PCR A;  3USU A;  4YW6 A;  3AZY A;  1OXC A;  4OUE A;  5DAX A;  5L7O C;  1SLC A;  2WS9 3;  4DEQ A;  2D7F A;  1B35 A;  2YV8 A;  2YYO A;  4BXS V;  1S2E A;  1OOP B;  5A32 B;  1RB8 G;  4BCU A;  2H0V A;  1RHI 2;  2B4K A;  1ZRF A;  3HPN A;  2XQX A;  1KQR A;  3LIH A;  3WX5 A;  1FV2 A;  1O5U A;  4FXK B;  2C24 A;  5FCC A;  5K4L A;  3GHN A;  5FQ0 B;  4AI0 A;  1Y3T A;  4FSJ A;  2VTX A;  1D4M 2;  3Q8E A;  2BTV C;  1W8U A;  4Q26 A;  5DUX A;  1JZ6 A;  1XYP A;  2VCA A;  1DGW X;  1OLR A;  1W6O A;  5IAX A;  1ZRE A;  4N43 A;  5C8C C;  2YHJ A;  5A7W A;  2YPD A;  5DXD A;  3T2O A;  5CFD B;  4H7L A;  2QQO A;  2WJS A;  1DLC A;  1XQN A;  1RIR A;  4YWA A;  2D3R A;  3CL1 A;  4BQ2 A;  1NUK A;  4NO4 A;  2VZV A;  4LA2 A;  2VZT A;  1OOP C;  4HG6 B;  3WNP A;  2AEN A;  4O7X A;  4Q4X 1;  2ADD A;  5CAD A;  1RUG 1;  1DQ0 A;  1JYX A;  2O8O A;  5LA2 A;  2OZ6 A;  5CKM A;  3WQ0 A;  3HR9 A;  5DUW A;  3EHK A;  5DAQ A;  4YYO A;  3POB A;  3K75 B;  2ZGQ A;  2I45 A;  1SPP A;  1SFY A;  2MPF A;  2VXJ A;  1OUX A;  3CMG A;  2ZGR A;  2KXL A;  2PTM A;  2Q1M A;  4H3W A;  2ZGU A;  3MIF A;  3VHN A;  5FFO C;  3WNM A;  3G6J B;  5FK8 A;  4FAG A;  4ZU7 A;  1VBC 3;  1A3K A;  1C57 A;  1VLN A;  4Y1V A;  2WSU A;  3FUO A;  3VBF B;  4LUM A;  1GOH A;  2VD7 A;  5JI9 A;  4Q27 A;  4LBQ D;  4XIO A;  5CFD C;  3AK0 A;  1EAH 3;  2OXB A;  3K46 A;  1HRI 3;  1EYB A;  3KQR A;  2C9A A;  3LB9 A;  2MHF A;  1J3Q A;  4AVT A;  2DCY A;  3KCC A;  5JSP A;  1FPN 3;  4JDN A;  4CUG A;  1LOF A;  2BOJ A;  4XJ8 A;  3H8R A;  2CGO A;  3WW1 A;  2JDK A;  3RI8 A;  2FDH A;  3CHX A;  4JGZ B;  2B8M A;  2BZD A;  1MS4 A;  2QNK A;  4Y4Y A;  5EPA A;  3ZPY A;  1XU2 A;  2HWE 3;  3NV2 A;  3W5N A;  1FT9 A;  5CA6 A;  1NCQ A;  2WNU A;  1GZT A;  1LHW A;  1VMH A;  2A3W A;  4AHZ A;  4Q1P A;  5AVA A;  4C0H A;  3RS6 A;  3AP4 A;  2D6L X;  3VBF C;  2DFB A;  2FMY A;  2EF6 A;  2Y0O A;  2WKK A;  3ELN A;  3H1M A;  4DZG A;  2RHP A;  2RDN A;  3OEB A;  2DBI A;  2W08 A;  1GWM A;  2Y34 A;  3NVC A;  1POV 0;  3FWE A;  3GJA A;  3IPV A;  3J8F 1;  4LO6 B;  1SDD B;  4XUT A;  3UK9 A;  1U5Z A;  1OHF A;  4UF0 A;  3RFR A;  4CRQ A;  3KVA A;  3A21 A;  4S2H A;  1UZW A;  4GKX A;  3WNK A;  3ZYH A;  4M4P A;  1J3P A;  4YZ3 A;  3URF A;  2VO5 A;  3ZFF B;  1JZ4 A;  5FBZ A;  2HEV F;  4JGZ C;  4R4X A;  2DF7 A;  2DUQ A;  3AB0 A;  2YG0 A;  3NNF A;  1YFY A;  2QZ2 A;  4M3C E;  3BCW A;  2RV9 A;  3OCP A;  1AL2 1;  1RUJ 1;  2YDE A;  1H1M A;  4QU2 A;  3CNA A;  2BBA A;  2YFU A;  3KMH A;  4W6W A;  3A4U A;  3ETP A;  3OUI A;  4J25 A;  4OUM A;  3N7K A;  3DPR A;  4M4R A;  4A7K A;  1W9T A;  2VG9 A;  3UES A;  3ZN4 A;  1RUH 3;  5E6H A;  1YQ2 A;  5LAT A;  4MGI E;  3LGR A;  5FLI A;  4COY A;  1V9U 1;  4NHL A;  3N9M A;  3WZ1 A;  3VBS A;  1MEC 1;  4YVS B;  5LA1 A;  3FMG A;  1DU3 D;  3I59 A;  4FI9 A;  5A7Q A;  2FDG A;  4QWN A;  4ATE A;  4XBN A;  4RQP B;  3LKJ A;  3H7Y A;  4XFF A;  2Y6H A;  2WA4 A;  5FPA A;  4F7Z A;  2E63 A;  3HD8 B;  3JD7 3;  1JYN A;  2AZ5 A;  1LOG A;  1NLQ A;  2P4E A;  3J8F 2;  4FPC A;  3ZO0 B;  5I0D A;  5EP9 A;  1PMI A;  4GJZ A;  4XTP A;  2A70 A;  4MZU A;  5D21 A;  2AEY A;  2F4L A;  4LEJ A;  1XE8 A;  4QX3 A;  4OI1 A;  1OVP A;  1W2O A;  2A5Z A;  1LKN A;  1WW4 A;  3K4D A;  4G9S B;  3ZFF C;  4B4Q A;  5K9Y A;  5IK7 A;  2XXZ A;  1UZY A;  3FBM A;  2GN3 A;  4XUR A;  4ASL A;  1RJ7 A;  4Q0P A;  5JOX A;  5JAX A;  1BEV 3;  1QQP 1;  2J1S A;  1HRV 1;  1UY1 A;  1RUJ 2;  4C1X A;  4YGD A;  5JI7 A;  4B3N A;  1VBE 1;  2QBX A;  5F1R A;  1GLH A;  4RS5 A;  4YG6 A;  1UYX A;  2RM2 3;  2ZOE B;  2DUO A;  3NWK A;  4C0B A;  3KGL A;  4KBZ A;  2BBV A;  1VRH 2;  3AZW A;  1V9U 2;  2X5I A;  4YVS C;  1MEC 2;  2RR1 3;  1GZC A;  3KGZ A;  4W6Y A;  1ODM A;  1IS5 A;  2BUK A;  3DN7 A;  4RQP C;  1OVS A;  4XF3 A;  1YUD A;  3BAL A;  4LOS A;  3WCS A;  1MQT B;  4UFM A;  1B09 A;  3PLQ A;  2WL1 A;  2R07 1;  2O0O A;  2WT1 A;  2ZGP A;  4BXF A;  4BQ4 A;  2WDB A;  1CR7 A;  4DNY A;  2D6N A;  5KXD A;  1GNY A;  1FOD 2;  1H4H A;  1WLC A;  1J58 A;  1N3Q A;  3A7Q A;  5ABJ A;  3H9A A;  5E1R A;  5ISL A;  1VBE 2;  2GC2 A;  1R09 2;  3BKZ A;  4O9E A;  3NO8 A;  4QXK A;  5FZL A;  1Z78 A;  1PVC 1;  3GZT B;  4D69 A;  3POY A;  4MV2 A;  5A3L A;  5JXH A;  4R52 A;  3GXU A;  1AHS A;  1BVP 1;  1Q8S A;  2ARE A;  5GAL A;  1Q5O A;  2VQA A;  4Y1Y A;  1PO2 3;  3JBG 2;  1GOG A;  2BDR A;  2W2I A;  2WZP P;  3OGV A;  1ZZC A;  2MEV 1;  2WT2 A;  4O9G A;  5DG2 A;  5D1I A;  4AI9 A;  3LEG A;  5G04 L;  1MQT C;  1EV1 1;  3LOB A;  5CU1 A;  5JZG B;  2GNM A;  3OB8 A;  3U1X A;  3RI9 A;  1LGC A;  2TNF A;  3AP9 A;  2R06 3;  4K1Z A;  2R07 2;  1F4H A;  3BN6 A;  5D8A B;  5F5C A;  4BQ1 A;  1IS3 A;  1LEN A;  4LQR A;  5FZ3 A;  3VDD B;  5EWS A;  2W52 A;  4NUB A;  1GZ9 A;  2DUP A;  3UGG A;  1HB2 A;  3J4U H;  4PLN A;  4MYE A;  4I0W B;  2WZR 3;  1QNY A;  1K5J A;  1XE0 A;  4IGQ A;  4URT A;  5H9S A;  3LA7 A;  1QH6 A;  1LOC A;  3DV8 A;  3DGT A;  2DUR A;  2QE3 A;  3DKW A;  1KFX L;  4ISR A;  3KVB A;  4ZS2 A;  1ZBE 3;  3I54 A;  3T0B A;  4FVV A;  3IT8 A;  4LKS A;  5FYT A;  4BIS A;  4GJY A;  1PVC 2;  2AAC A;  1JZ7 A;  1DDL A;  4EN8 B;  1Q8O A;  4AHW A;  3ZXG A;  3CO2 A;  3JCI A;  1Q56 A;  3WHT A;  2QQU A;  3B02 A;  3LWC A;  3KV4 A;  2WN3 A;  4RA0 A;  5EHD A;  4AI3 A;  4QPG B;  5BNO B;  1EV1 2;  2ZX3 A;  4QQ2 A;  1S2K A;  5IFP A;  4XUN A;  1GWL A;  1W6Q B;  4HVO A;  5IAT A;  5JZG C;  3JB4 C;  2PEL A;  1RL3 A;  5D8A C;  4FFF A;  2ARA A;  1ZA7 A;  5EIY B;  1O59 A;  5C4W B;  4XCB A;  1OPO A;  3LQC A;  1HV0 A;  3VDD C;  2OVU A;  1NYW A;  1NLR A;  1XB9 A;  3AZV A;  2Y8K A;  3I3D A;  4Z2W A;  4WVM B;  2H6C A;  1YRZ A;  5LRS A;  5FO9 B;  1BBT 3;  2X10 A;  4XC9 A;  4TXW A;  4NR1 A;  5JVV A;  5F5Q A;  4NII A;  5KHG A;  2CAV A;  3C2U A;  4GXL A;  2XLG A;  2K46 A;  4BME A;  3OPW A;  4LK7 A;  4N90 A;  1DBN A;  4IL7 A;  1AJK A;  4RHV 1;  2OX0 A;  2JE9 A;  2VOW A;  5JOZ A;  3KWV A;  3ZN6 B;  2JDY A;  2E31 A;  3KHC A;  3ZXL A;  4NHK A;  5K0U A;  1Q3E A;  4LHS A;  3CF6 E;  2JIJ A;  1CAX A;  2VL4 A;  4AAX A;  5BNO C;  3FJS A;  4QPG C;  3E97 A;  5DZG A;  1ZRR A;  3VZN A;  5KWR A;  2BWC A;  2FDJ A;  2Z69 A;  4OZX A;  3CEW A;  2VOK A;  3JB8 A;  4RGG A;  1EPZ A;  1UZV A;  1W0N A;  5G05 L;  3M3E A;  4XTM A;  1C1L A;  3AZX A;  5FV3 A;  5JIA A;  4H2A A;  4GQ7 A;  5A3M A;  3J26 N;  5AVP A;  5C4W C;  4J6G A;  4CDX A;  3AYD A;  1RUO A;  1JZ2 A;  3MLK A;  4IXL A;  5CVR A;  2XJR A;  3BOP A;  3O7O A;  2E33 A;  4QPI A;  5FPX A;  4FPL A;  3ZDS A;  4FCA A;  1YIF A;  1RUF 3;  2HH9 A;  1S2B A;  2ARB A;  5KC5 A;  4LUK A;  2QQN A;  5E8A A;  4W6X A;  3VBR B;  4DB5 A;  4K9S A;  1APN A;  1AYM 1;  2D5H A;  4RHV 2;  4XFI A;  1NX9 A;  3VBH B;  4IEQ A;  4NE9 A;  4I09 A;  1U5Y A;  4Y1Z A;  1O8S A;  4AI8 A;  3NAP B;  2BNN A;  2DCJ A;  4OFG A;  4QKD A;  1F5F A;  1X33 A;  1SLB A;  1UY3 A;  3WG4 A;  3TEZ A;  2GAU A;  2WNO A;  3POS A;  4QHB A;  2VZS A;  1DGR N;  1W6N A;  3BB6 A;  3EJK A;  5FMO L;  1AR7 1;  1UAI A;  2VVD A;  1JI6 A;  1UY2 A;  5DPN A;  1A78 A;  1UO9 A;  5I93 A;  5CG8 A;  3CIH A;  4BK5 A;  2QQP A;  4YM2 A;  1O5L A;  1UWW A;  2OPK A;  2W68 A;  3KCX A;  2Q8C A;  4MG2 A;  1UX6 A;  1QJY 1;  2WZE A;  1GAN A;  4DOU A;  2K0G A;  4I02 A;  1FI2 A;  5H9P A;  4Q4Y 1;  1XU1 A;  5FBJ A;  5TSW A;  4MXW B;  1H2N A;  3EMR A;  4AVA A;  3WDV A;  4Z8B A;  1TVG A;  2V5Y A;  4P00 B;  5FZO B;  4D6S A;  4QPW A;  3J9S A;  3VBR C;  3MV1 1;  3ZYP A;  1TMF 3;  3OOX A;  3VD5 A;  2OUJ A;  3C8X A;  3WF1 A;  3VBH C;  4XFG A;  4FTS A;  2BQP A;  1HB3 A;  1WW7 A;  1SQ4 A;  2HWF 1;  3DYP A;  5GLU A;  4TSV A;  3NAP C;  4Y3O A;  1UPS A;  5F3G A;  1N1V A;  3ZIX A;  3I7D A;  2FCV A;  1UW8 A;  3O14 A;  3PJY A;  2XBO 2;  4RFT 0;  4Q4V 1;  1UZ0 A;  5C3Q A;  2ERF A;  5F5I A;  1WLD A;  2UYA A;  4AVB A;  4BYY A;  1YQ6 A;  1NA1 B;  2VH9 A;  4HT1 T;  3OBR A;  3U11 A;  3J7N A;  3WLU A;  1AR7 2;  2D3P A;  2X53 S;  1RUD 1;  3AKQ A;  3AYC A;  3GBW A;  2VMH A;  4QX0 A;  2RMU 1;  4HL0 A;  2VBD A;  5FZG A;  3WOG A;  3ZMN A;  3LE0 A;  5BNP B;  1EP0 A;  3NV4 A;  5E88 A;  1QJY 2;  2XKP A;  2B9V A;  3QAC A;  3U10 A;  5KC6 A;  5HCA A;  5FP8 A;  2R0H A;  3OYW B;  4Q4Y 2;  5FTT C;  1HIX A;  4LOT A;  4P9I A;  1VBB 3;  2EA7 A;  4DY3 A;  3K77 A;  1DQ5 A;  1UMI A;  4EQV A;  1KXG A;  1ND3 A;  2A6Z A;  2GDF A;  1OD5 A;  2A7A A;  2JJ6 A;  2VMC A;  3ON7 A;  3OY8 B;  1DCS A;  3ZR6 A;  1VAL A;  1SBF A;  5FYC A;  1NCR A;  2R04 3;  3ZM8 A;  2HWF 2;  1POQ A;  1AYN 1;  4HOO A;  3CJX A;  5A1F A;  1MVE A;  2CAU A;  4GB3 2;  4PF1 A;  4CPB A;  4CEY A;  2UWA A;  2JIG A;  1W6P B;  2DVF A;  2XL7 A;  2ZGT A;  1NA1 C;  3AKS A;  3J7M A;  4PIY A;  4XHX A;  4AED B;  2VCM A;  3TWI A;  4PF5 A;  4AVS A;  1CAW B;  1UXX X;  2JG9 B;  3PTR B;  1I3H A;  1RUD 2;  1XPW A;  4TLG A;  5T54 A;  2Z5W A;  3NQH A;  4ARY A;  5FZA A;  5BNP C;  2YY1 A;  3ABZ A;  3CDZ B;  4NVP A;  2ZAC A;  5IW0 A;  3IIA A;  5HV4 A;  1GZW A;  3VD3 A;  4D7Y A;  1YCI A;  2Y60 A;  4URA A;  4JQR A;  3I2H A;  1MZ6 A;  3P3N A;  1X8E A;  4C8D A;  4DUX A;  2YRO A;  3HIF A;  4AQS A;  4BPZ A;  3ZSJ A;  1HB1 A;  3ES4 A;  4YPJ A;  3BI3 A;  5HCF A;  3IM0 A;  3NMB A;  5C5T A;  1HN1 A;  2GH8 A;  5GM0 A;  1NZI A;  2C26 A;  4CUA A;  4XF4 A;  4DXR A;  1RXF A;  3O1R A;  2I07 B;  1DZR A;  1R1Z A;  5LRR A;  1AYN 2;  2JEM A;  4Z07 A;  4FAH A;  1F8V A;  1NKG A;  4ZU5 A;  4S2G A;  4DUW A;  1GQH A;  3NNL A;  2FDI A;  2NPI A;  2NYY A;  3WEZ A;  1KRI A;  1VAK A;  1W9W A;  2K9Z A;  1FAT A;  4LJH A;  1XNB A;  4AED C;  3O1V A;  4QB2 A;  3THT A;  2ZKN A;  1ENQ A;  2YC4 A;  3I8T A;  1LED A;  1BVV A;  1PK6 B;  4P02 B;  2JG9 C;  1PZ7 A;  5CIS A;  2ZHN A;  3VZJ A;  3BU0 A;  3RMX A;  4JKK A;  5GZD A;  4YGB A;  4FQZ A;  2VNO A;  3WVJ A;  3O1S A;  3EBR A;  4CCD A;  4CCM A;  5A3N A;  1NY7 1;  3IAQ A;  2YB7 A;  3CJI B;  5F8P A;  5FYH A;  3WNO A;  1ENS A;  1FMD 2;  5F32 A;  3B7M A;  3VBO A;  5IAV A;  3LFM A;  4XFH A;  1IKP A;  1CAU B;  4OUL A;  2WS9 1;  4PI0 A;  1OH4 A;  2P3K A;  3I3Q A;  3POW A;  5KHH A;  1MPX A;  3V0A B;  4DO0 A;  4HFS A;  4CDQ B;  3L2Y A;  4BQW A;  2D40 A;  3SIT A;  3KS7 A;  3AKP A;  4LO5 B;  2E9Q A;  1WLT A;  1RIN A;  1ULP A;  2ARX A;  3CQO A;  4XDO A;  3T4V A;  3O1U A;  4NWW A;  5T5P A;  1QJE A;  2EIC A;  2E7T A;  4IV1 B;  4LO7 A;  2HWC 3;  4COV A;  5K0U B;  4A44 A;  2ET1 A;  1CES A;  5FZ1 A;  1EUT A;  3ZX7 A;  1PK6 C;  3LFI A;  4FPE A;  1H2M A;  4LE4 A;  3HNM A;  3PUR A;  4TZD A;  2JD4 A;  4XXA A;  1BLZ A;  4BMB A;  1PGS A;  5EJ3 A;  3CJI C;  1W8H A;  1NY7 2;  2XUE A;  5JLV A;  3BIE A;  3WG1 A;  3MDP A;  2W1Q A;  3A22 A;  1D4V B;  3FHI B;  5EYY A;  3ZXF A;  1AXY A;  1CON A;  1RYY A;  2WS9 2;  3LCP A;  3POJ A;  1W05 A;  2GMM A;  3TN9 1;  1YXW A;  1WZX A;  1NOV A;  1WD4 A;  4OI2 A;  4CDQ C;  2P3I A;  4I30 A;  1QJZ A;  2R1B A;  3BTY A;  3ATG A;  3N36 A;  3HN3 A;  4JGY A;  3TEY A;  3I3M A;  4Q0V A;  3TAY A;  4YZ1 A;  1ZVF A;  3GGL A;  1TQ5 A;  1UU4 A;  3RZK A;  5I0T A;  1OA2 A;  3ENR A;  3EB7 A;  4AQT A;  3BOD A;  1IS6 A;  3WQB A;  1REE A;  1GFF 2;  4HKW A;  4IV1 C;  4CDW A;  2J1T A;  1UOF A;  3ZXE A;  1DQ4 A;  1CPN A;  2RS3 3;  5FRE A;  2O1Q A;  4Q8L A;  4Z1V A;  4Y22 B;  4JDO A;  3ZYJ B;  5HCB A;  3NJZ A;  4W65 A;  5ACA 1;  3S5Q A;  3HT2 A;  4K8F A;  4ET7 A;  1EAH 1;  3NJX A;  1HRI 1;  1JZ8 A;  5GLT A;  3RYK A;  1XND A;  4HSJ A;  2BFU S;  5LBE A;  1FPN 1;  1OKO A;  2KD7 A;  2X09 A;  3OBA A;  5T5J A;  3PL0 A;  2W87 A;  2WNV B;  4KU8 A;  1XSQ A;  3SC7 X;  2CY6 A;  5FY8 A;  2CGP A;  1WMX A;  3T30 A;  4H7M A;  3NJV A;  2ZEX A;  1OD3 A;  4IEX A;  3TN9 2;  4AYU A;  5FYZ A;  4NPL A;  1EY2 A;  4WVV A;  1OUS A;  2DVD A;  4L8Q A;  1I6X A;  4XFB A;  3QLQ A;  4MAD A;  5EXO A;  3I49 A;  3HQR A;  1TME 3;  1WA4 A;  3BPS A;  1S1A A;  4CTE A;  3VL8 A;  2HWE 1;  4R9C A;  4L9B A;  2ZPX A;  1BK0 A;  3KCY A;  4JDM A;  4QD2 A;  3KT1 A;  3SCH A;  2IXH A;  1CAV A;  2ZGN A;  5C3O A;  2PMW B;  4IET A;  3WDW A;  4KGG A;  2PXJ A;  1A8M A;  1SFP A;  5J7M A;  5BUV A;  2WA3 A;  5FJH A;  1OI6 A;  1XYO A;  2PFW A;  1S0C A;  5FZF A;  5JDB A;  5FZK A;  3T4H B;  1J3R A;  4FTB A;  2JX9 A;  1RIT A;  1LRH A;  2VE1 A;  5LBF A;  3RMY A;  3AVR A;  1FYU A;  3RSJ A;  5ACA 2;  2G4I A;  4CU7 A;  1HRI 2;  3RQ0 A;  1DGR A;  4OMC A;  5GLV A;  5FYB A;  3L9J T;  4AFD A;  5CIR A;  3C7O A;  3MPP G;  4HSL A;  1BYH A;  1FPN 2;  2WNV C;  4QQP A;  4UFJ A;  1ONA A;  4GWN A;  4WZF A;  2ZBJ A;  5AFB A;  5CG9 A;  1GIC A;  1VBA 3;  2VY0 A;  4Q0S A;  3MUY 1;  4UFH A;  4OYU A;  3VUO A;  3RZL A;  2IFW A;  1PO1 3;  2XJU A;  2JXA A;  4CPB D;  2AR6 A;  2YC2 A;  1K12 A;  5FXV A;  4XZP A;  5BPX A;  3W9A A;  1UKR A;  2OA2 A;  2W47 A;  5EQU A;  1XOY A;  5T50 A;  2Y64 A;  3APB A;  1R64 A;  3EYP A;  5JWP A;  1OA3 A;  1RJ8 A;  1RUH 1;  3AMP A;  4PHZ A;  2V09 A;  4BA6 A;  5I0S A;  1G7Y A;  4LIT A;  1PNG A;  1ZZB A;  1JU3 A;  1HJF A;  2WFP A;  5C8W A;  5A7S A;  3UYJ A;  3AXE A;  3JD7 1;  3BPZ A;  4OI0 A;  2UUR A;  1GSL A;  1D0H A;  3WW3 A;  2DU0 A;  1AR6 2;  5HI0 A;  1WGP A;  2A1X A;  4QX7 A;  4IER A;  3VN4 A;  3KHB A;  4KI5 M;  3VBU A;  2ENR A;  4CCK A;  3PVE A;  5IVC A;  1AZD A;  3N4M A;  1BEV 1;  2XB6 C;  4Q1R A;  1G9D A;  1UN1 A;  3PME A;  5BXX A;  2LUW A;  1OF3 A;  1RED A;  1MVQ A;  3AFG A;  3U14 A;  4UFK A;  4AI1 A;  2VGD A;  3PJQ A;  1YI9 A;  3MF6 A;  2Y6L A;  1XNT A;  5KHI A;  5B4N A;  2ZJC A;  3UET A;  1RUH 2;  1OFN A;  1RUE 1;  3D8C A;  4J1X A;  4Y26 A;  4U2A A;  3MI8 A;  5FYV A;  4B4R A;  1BMV 2;  4UW5 A;  3BGA A;  4R8H A;  2RR1 1;  5JR2 A;  1AX2 A;  3C7E A;  1VR3 A;  3GAL A;  4IUG A;  1VB4 A;  3WDX A;  4EN0 A;  1X9P A;  1SBD A;  2VNG A;  2ZGK A;  3E6C C;  5T5L A;  2KM2 A;  2V72 A;  4HON A;  2DU1 A;  1WMD A;  3HN1 A;  2IWG B;  1O4T A;  2IZW A;  2Q4S A;  4LBL A;  2TEP A;  4TLF A;  3EO6 A;  1LR5 A;  4GA9 A;  2BNM A;  1KS5 A;  3M1H A;  4K21 A;  4M00 A;  3VKN A;  3PVN A;  1IKQ A;  1GR3 A;  4LA3 A;  4F8A A;  2RJL A;  4CP0 A;  4NRO A;  1VBD 3;  3GYD A;  1V6N A;  5FMB A;  5J3U A;  1LAJ A;  1BEV 2;  1QOT A;  1QJX 1;  3B69 A;  5FPU A;  1VJ2 A;  2P2K A;  1COV 3;  4PDW B;  4XW3 A;  1URX A;  3ZFE B;  3ILF A;  5FOB B;  1ZZ7 A;  3Q8A A;  4FP2 A;  1YJL A;  4CUC A;  5A6X A;  2XUM A;  3FLT A;  1XNK A;  4FPG A;  2C5D A;  5FWE A;  4HPK B;  5A33 A;  1E57 A;  4LBO A;  4CEW A;  5F6L B;  3U4S A;  1TZO A;  4XMA A;  2GND A;  1RUE 2;  4QDR A;  5FRA A;  4KGQ A;  1W28 A;  2VMI A;  4KBB A;  3J7H A;  2RR1 2;  5A1A A;  4KWU A;  1PO2 1;  1ULF A;  1KIT A;  4JTO A;  3V0B A;  1H1I A;  4DRV A;  1ASJ 3;  1UMZ A;  2XHK A;  2GC0 A;  1J59 A;  1A8D A;  4RD7 A;  2ZGS A;  3BTA A;  1CJP A;  1XXN A;  1G9B A;  2ZGO A;  3ALQ A;  1Q8Q A;  2R06 1;  1H30 A;  1W04 A;  1ZZ8 A;  2G9G A;  2UY9 A;  1CX4 A;  2WYF A;  3HEI A;  4FOV A;  2W1W A;  4JX0 A;  2P1B A;  4Q4X 2;  4XAB A;  1RUG 2;  1ZX5 A;  1JW6 A;  1XNA A;  3AP5 A;  1NAE A;  4TN7 A;  2DVB A;  3UNP A;  1H8T A;  1CIY A;  1W9F A;  2WZR 1;  1D2Q A;  2Q0A A;  3FE5 A;  1QJX 2;  2WQ8 A;  5FYU A;  4PDW C;  3ZFE C;  1K5M A;  4P08 A;  4BH9 A;  4MET A;  4LR4 A;  2XKO A;  4HKL A;  4HN0 A;  1POV 3;  1ZBE 1;  1QKQ A;  4CE8 A;  3PVB B;  4Q8K A;  5DG1 A;  1O3Q A;  2IVJ A;  4FT8 A;  4OHZ A;  2VUD A;  2V73 A;  4YRD A;  4B8E A;  1GWK A;  4QX2 A;  4UWD A;  4K7J A;  2NZ9 A;  2AC1 A;  5LY1 A;  4FTE A;  5CFC A;  1WKY A;  4KNC A;  3O12 A;  2YXS A;  1ZNP A;  3IDC B;  4NHX A;  5C9A A;  1BKZ A;  2CDP A;  3ACF A;  1LHN A;  4MO3 M;  4YW1 A;  3I2D A;  1WCS A;  3WUD A;  4F3J A;  1PNF A;  3WSO A;  2JG8 A;  4CU8 A;  3RVH A;  4A6S A;  2DTW A;  4YW4 A;  3THP A;  3NV3 A;  2J1E A;  2J42 A;  3DYM A;  3HVD A;  4JKL A;  1OBN A;  4XYX A;  2AYH A;  2WZR 2;  2QQL A;  4K8R B;  1BBT 1;  3MLL A;  1HV1 A;  2ETE A;  4A7Y A;  1W6M A;  5FPV A;  1F15 A;  4CP9 B;  3MW3 A;  1FNZ A;  2WIN B;  3T0D A;  2EIE A;  1RHI 3;  4N53 B;  4MGS A;  1LHO A;  3RNS A;  3TBD A;  4AQ6 A;  1SDW A;  2CGN A;  1LOD A;  1K45 A;  3QOP A;  1UYZ A;  4HBN A;  4LUL A;  4RFR B;  3HOB A;  4BK4 A;  1D4M 3;  1TNF A;  1XRU A;  2BEO A;  1W39 A;  2CV6 A;  3IWZ A;  1JS9 A;  3W58 A;  4BU2 A;  5F9T A;  2IXJ A;  4ERO A;  1W8O A;  2VNR A;  3ZXD A;  2QTW B;  3FLR A;  4KWK A;  4AZZ A;  4CXX A;  4CDU B;  3GBG A;  2BFU L;  3SXW A;  3GZA A;  4ZXK A;  2ZMK A;  2D97 A;  3ETQ A;  1AL2 2;  4W4Z A;  4XUO A;  5FYM A;  2JEC A;  2ZGM A;  4QX8 A;  2FDF A;  1N1S A;  4LHK A;  2VR4 A;  5L7O A;  2VTF A;  2UU8 A;  2Y38 A;  4Y20 A;  4RR3 B;  2PA7 A;  3H8U A;  2QQK A;  1ULO A;  3MIH A;  1BBT 2;  3B93 A;  2IXI A;  1YNA A;  4FP3 A;  4XEZ A;  5I0R A;  1ULG A;  1RUF 1;  2D5F A;  3NJY A;  4QKB A;  3LDR A;  4GWM A;  4N53 C;  4XPV A;  1H6Y A;  1NQD A;  1MS8 A;  1HLC A;  5F3E A;  5FUN A;  4XFC A;  3TOJ A;  3H7J A;  3JQX A;  4AK3 A;  4DXT A;  1GQG A;  5C5U A;  1H1A A;  4QQO A;  5FPB A;  2PHW A;  1LHV A;  4LLF A;  3ZMO A;  2D98 A;  4K20 A;  4JZR A;  1WW6 A;  1PX4 A;  3VV1 A;  2LM3 A;  1JHN A;  1S0B A;  1W3V A;  3F95 A;  2ZKL A;  5IVF A;  2KR2 A;  3F2Z A;  4IDZ A;  4XAC A;  2Q30 A;  5C8C A;  2ID4 A;  4CDU C;  5LY2 A;  5I8S A;  2YPJ A;  2WQ4 A;  5JR7 B;  4IW3 A;  1DGW A;  1ND2 A;  2W95 A;  4HXC A;  1QQP 2;  4BLJ A;  1HRV 2;  1H2K A;  1OLM A;  4CUB A;  4H55 A;  1AR8 3;  1OQD A;  1CZS A;  5T55 A;  2VPV A;  1T2X A;  1AUY A;  4RR3 C;  4AGR A;  1ZRD A;  4L2N A;  5AC9 3;  1C8M 1;  1XC6 A;  1OOP A;  3K3O A;  4L0P A;  4MGK E;  4YVW B;  1RMU 1;  5A32 A;  2BPA 2;  1W8T A;  3N7M A;  3ZKU A;  1RUF 2;  4WM7 B;  3LSE A;  5L73 A;  5CAZ A;  2AH2 A;  2W1U A;  3WXP A;  3ST7 A;  3D3A A;  3V56 A;  1TMF 1;  4AXO A;  2VBB A;  2OQ7 A;  1VPH A;  2HEW F;  3LF7 A;  3QH7 A;  4M3C F;  4XUP A;  3VKM A;  2P5B A;  5FQ0 A;  5DQ0 A;  1S0G A;  1PGL 1;  2YFZ A;  3P6B A;  2FBE A;  4DMI A;  1W03 A;  4OHX A;  4BB3 A;  2YZ4 A;  1JZ5 A;  3W20 A;  3WDY A;  1GNH A;  2VZR A;  1AJO A;  1JBC A;  3MIB A;  2CWM A;  4P5Y A;  5LEK A;  1KEX A;  4WM8 B;  5CFD A;  2PAM A;  1Y4W A;  2BRT A;  2OYZ A;  4AEK A;  3S5A A;  1A34 A;  1SZB A;  4XDQ A;  4NHM A;  1G8W A;  2H0B A;  1RUC 3;  3T09 A;  4OQ8 A;  3H3U A;  5FKC A;  1L7L A;  4XAA A;  1Q8V A;  1NE4 A;  4Q4W 3;  1V00 A;  2VOX A;  1C8M 2;  2F17 A;  4YVW C;  1RMU 2;  2BU9 A;  3I4I A;  4WM7 C;  5GKA C;  3WDT A;  4HVR A;  1G6N A;  3N9O A;  1VBB 1;  4A6O A;  4AVV A;  4QU1 A;  4CP2 A;  5LWB A;  1N3P A;  1YI7 A;  3LA2 A;  4YFW A;  5KBF A;  1TMF 2;  2AGS A;  1UCX A;  4XMI A;  2MEV 2;  5FR3 A;  1CGP A;  2R04 1;  1PGL 2;  4ITC A;  1PGW 1;  1UYP A;  4K3U A;  4YSF A;  1WCU A;  3E5Q A;  3AVS A;  4CSW A;  3VBF A;  5BNN B;  1QF3 A;  4PBO A;  4CYD A;  1UY0 A;  1SLI A;  3PUA A;  2XVG A;  3SH5 A;  4WM8 C;  3WP3 A;  4KL1 A;  1W2N A;  2ZZQ A;  2LRO A;  3PHM A;  2DYC A;  2W3J A;  1HXS 3;  5FZ9 A;  1ULE A;  2VMF A;  5F6K A;  2PLV 3;  1AR9 3;  1G9C A;  2EXI A;  1CZT A;  1UYY A;  3DF0 A;  2QQJ A;  5JOY A;  3I97 A;  4LIV A;  3UGF A;  3BTX A;  4JGZ A;  1O3S A;  2PHU A;  3AL5 A;  5K8S A;  2FD8 A;  3KT7 A;  1NXM A;  4GWJ A;  5FY0 A;  1RGS A;  4I0A A;  3OBZ A;  1VBB 2;  4BQX A;  4IND A;  1ZA4 A;  4KG8 A;  4JC1 A;  4JHZ A;  1DZT A;  4AR2 A;  3ME2 A;  3WNL A;  3ZDV A;  2R04 2;  5EJ1 B;  2P6H A;  3R05 A;  1PGW 2;  1I9R A;  2BP6 A;  3D82 A;  3ZYG A;  1VRH 3;  1WME A;  5BNN C;  5KXB A;  2DCK A;  3S7E A;  3RZH A;  2HBU A;  1V9U 3;  4AHX A;  3A23 A;  2LTN A;  1D0G A;  2VZP A;  2YMZ A;  4OQ9 A;  3ROU A;  3ZN5 A;  4D0Q A;  2ZX2 A;  4EZH A;  1WBF A;  2YGM A;  1QU0 A;  5I91 A;  3III A;  1QNW A;  4LTA A;  4XBL A;  1W8N A;  1XJA A;  1ZM1 A;  2JKB A;  3N3H A;  4UXA A;  3V64 A;  3WF2 A;  4OHY A;  5IFT A;  1GUI A;  2Z2S B;  4ZU4 A;  1YHF A;  1YYN A;  2Q5T A;  4LBQ B;  3ZFF A;  4XCA A;  2FDK A;  2CYF A;  3LD8 A;  2HWD 3;  3S7I A;  2JDU A;  1K42 A;  4ISQ A;  1FOD 3;  1R1A 3;  4GH4 B;  4ARX A;  3N35 A;  1YC6 1;  2H6B A;  2NN8 A;  1W8W A;  5KHJ A;  2XWB B;  3HT1 A;  1LOB A;  3MUZ 1;  1S0I A;  4M0H A;  5FY9 A;  2ZGL A;  1VBE 3;  2JKX A;  3FFQ A;  2A6X A;  4SBV A;  1UMH A;  4V2V A;  3SEE A;  1LCL A;  1R09 3;  3B94 A;  2GSY A;  2VZ3 A;  2Z4F A;  5C70 A;  4JAA A;  2DV9 A;  4X6Q B;  2BGP A;  2DWR A;  2D6P A;  3GJB A;  5FP4 A;  2Q8O A;  4DXZ A;  4YVS A;  2Z42 A;  5FLJ A;  1UIJ A;  3D4K A;  2D6K A;  4YW3 A;  1SLA A;  4RQP A;  4RYD A;  3OGS A;  3JBG 3;  2HWC 1;  2WII B;  3VZM A;  4DIQ A;  1WLW A;  4NRQ A;  4E4D X;  1BCX A;  3H3L A;  1WUV A;  3KLS A;  2XL9 A;  3Q8B A;  4JCK A;  4QXC A;  1MR5 A;  1QEX A;  5DDJ 3;  2VUL A;  3I3E A;  1FNY A;  1KD7 A;  3OD4 A;  5FO8 B;  1XNC A;  3M3O A;  4WVZ A;  2R07 3;  2BGO A;  5EFU A;  1W0O A;  4GD4 A;  1X82 A;  4LK6 A;  4M3C B;  2E51 A;  3AJZ A;  3NKT A;  3NL1 A;  4GH4 C;  1AYM 2;  4RSU A;  2XLF A;  3UKN A;  4F83 A;  2JDA A;  3AMH A;  4LNV A;  1SMV A;  1MS9 A;  2VQU A;  2YBP A;  2WO1 A;  1T6G C;  4QXB A;  4MGZ E;  2P34 A;  4Q5O A;  3W5M A;  4IGP A;  3MW2 A;  5LZ6 A;  4KMQ A;  1J1L A;  2WAO A;  2GMP A;  1UX7 A;  2DBN A;  2WFF 3;  5E16 A;  1ENR A;  1YFX A;  3O1M A;  2YUE A;  3AYA A;  4LKD A;  3U0Z A;  1EPW A;  2WLQ A;  1F2N A;  3K3N A;  4YG0 A;  2Q8E A;  3NNG A;  4QKF A;  1BHG A;  4QGL A;  5FYI A;  3I2O A;  1NLS A;  2HWC 2;  2WSV A;  2HLE A;  2X29 A;  5F3I A;  1MS3 A;  2RS3 1;  4ZZ5 A;  1MQT A;  2P3J A;  1PIV 3;  1LB2 A;  2AUY A;  4LT5 A;  3A0N A;  2VUJ A;  1YQ8 A;  2FMD A;  2VM9 A;  5LBC A;  4MUV A;  1E5S A;  1OLM E;  2QQI A;  1QH7 A;  1H0B A;  1QJU 3;  1ULC A;  2JEN A;  3WR0 A;  1V70 A;  1LU1 A;  1Y9G A;  5FXW A;  3IKW A;  2UY8 A;  4XJU A;  3U75 A;  5FZ7 A;  3OGJ A;  5AFE A;  2AEZ A;  3WQ7 A;  4A42 A;  1DYP A;  3P1I A;  3ZYB A;  3AMN A;  2GNB A;  2VW2 A;  1UZZ A;  3AMQ A;  1UL9 A;  1X8M A;  3OD0 A;  3ES1 A;  3WG3 A;  4OI4 A;  2HYK A;  4IV3 B;  4Q4V 2;  5FXX A;  3VDC A;  3ZVX A;  4MHR A;  1TME 1;  4OCT A;  5LB6 A;  2D6O X;  1UOJ A;  1JYW A;  3VHP A;  3T1M A;  1NT0 A;  1X50 A;  3HBK A;  4BJ0 A;  4MSV A;  1RUI 3;  5J37 A;  1TE1 B;  1IPK A;  4AVC A;  2W94 A;  3CBN A;  4I0B A;  4LMF A;  2RMU 2;  4YM1 A;  4CZS A;  4L11 A;  1CQ9 A;  1DGL A;  5IWF A;  1SG3 A;  4XHB A;  3POE A;  3FHQ A;  3VKF C;  2VOT A;  2WNE A;  4IES A;  3SH4 A;  4DUV A;  5JZG A;  5C3S A;  1JUI A;  5FPZ A;  3ZSL A;  5FMD A;  5D8A A;  1BQP A;  2E32 A;  5BY5 A;  3USU B;  4PQQ A;  3TRS B;  3VDD A;  3PIG A;  1W99 A;  3AC0 A;  2L9L A;  4FOW A;  1B35 B;  4NID A;  5J1X A;  1HJG A;  1U12 A;  1O7F A;  3E5X A;  4Y1X A;  1OSG A;  1LTE A;  1VBA 1;  4MHU A;  2QDN A;  3QBQ A;  3THD A;  4BDV B;  4Z92 B;  2W0X A;  2XGX A;  5I8Y A;  3W59 A;  1PO1 1;  1JYC A;  1RTV A;  3U07 A;  3MID A;  4IV3 C;  3R6S A;  1TNR A;  5FDB A;  1ZZ6 A;  4MVT A;  5JCT A;  4CP1 A;  5LW9 A;  2W1S A;  2FCU A;  1RXG A;  3WW2 A;  2OPW A;  4E8C A;  4RHV 3;  1W2T A;  1AXZ A;  5T3N A;  4XXP A;  1FV3 A;  2JB4 A;  5EJZ B;  1VE0 A;  1W6O B;  2JWP A;  4JHT A;  3WT3 A;  3MGU A;  1KGY A;  4N43 B;  5A7W B;  5BNO A;  2LS6 A;  4QPG A;  4Y4R A;  4IE0 A;  4WV8 A;  1W6Q A;  1VB2 A;  1SLT A;  5L9R A;  1GYK A;  2Y6J A;  3MFA A;  5C4W A;  3ILR A;  4JRL A;  2PAE A;  3UV9 A;  1PVX A;  4E27 A;  1B35 C;  4DRR A;  3FFZ A;  4WVM A;  1JYI A;  5JSO A;  1SEF A;  3ZIW A;  1S55 A;  3B9C A;  5FY4 A;  3ZYI B;  4Y33 A;  3PVO A;  2JDZ A;  1MS0 A;  1H6X A;  5L36 A;  2GP3 A;  1PO1 2;  2SBA A;  1U5I A;  4EZ4 A;  1R08 3;  1M4W A;  1Q43 A;  2ATF A;  2VZU A;  1SPP B;  4XJZ A;  4N9H A;  1VP6 A;  2BER A;  1NXD 1;  3ZN6 A;  1WCQ A;  4UI9 L;  5F37 A;  1RUN A;  4Z82 A;  4YG3 A;  2XVL A;  3T2Q A;  3H1Y A;  4WZC A;  4YLZ A;  2ZA9 A;  4CCE A;  3RZG A;  4N43 C;  4CA9 A;  5CBL A;  3KQ4 B;  5DUV A;  3AM2 A;  4YGE A;  5IK4 A;  2FCT A;  4FOQ A;  2IXL A;  2XBO 3;  3ACI A;  4XZU G;  4EWA A;  1JOJ A;  2XG3 A;  5FZD A;  1I1E A;  3BYW A;  3AYE A;  3OPZ A;  3OUJ A;  5A6Z A;  5A70 A;  4LO8 A;  5JUV A;  3RJR A;  4PT6 A;  3ITQ A;  1ODN A;  3TYJ A;  3U4X A;  3JUU A;  1K3I A;  1G86 A;  3KB5 A;  4Y5S A;  5J36 A;  4V1P A;  3T1L A;  3SMH A;  3OSD A;  1O3R A;  5FK7 A;  4Q4Y 3;  2NQY A;  3U78 A;  3AP7 A;  1VBD 1;  3B3Q E;  3E6B A;  3HBZ A;  2PQQ A;  1Z7S 3;  2VQT A;  3O1T A;  4AFB A;  5T5O A;  3ZXA C;  3VBR A;  1COV 1;  1NCQ B;  2PQS A;  2WNU B;  1N3O A;  4AEM A;  3VBH A;  1W90 A;  1VBC 1;  4OUS A;  1NZC A;  1YQ5 A;  2TUN A;  3HMY A;  3X29 B;  4CVU A;  4DFS A;  2XJP A;  5L9B A;  3AXD A;  3NAP A;  5F5A A;  5FZ4 A;  3DUI A;  4D7S A;  2D43 A;  3VD7 A;  4GMP 3;  4HLT A;  5D2A A;  2VCB A;  3IDB B;  1JN2 P;  3O0X A;  4GB3 3;  3AMM A;  3SH3 A;  2WWU A;  5BV6 A;  3IPV B;  3OPT A;  4XQ4 A;  2VXR A;  5LA9 A;  1ASJ 1;  4N9I A;  4UF0 B;  3WD5 A;  3HNY M;  2HYX A;  1LOF C;  2YC0 A;  3IMN A;  3G7D A;  4LBJ A;  2QJV A;  3IAP A;  1F5J A;  2ES3 A;  4A2U A;  4AFM A;  1HQW A;  3O5S A;  2R0F A;  3UKT A;  1E5H A;  4LHL A;  2JB8 A;  2OQ6 A;  2V4A A;  1GMM A;  4MXW A;  4OLL A;  2X05 A;  3JQW A;  2WBK A;  3GDB A;  2YGL A;  3K4A A;  1V6J A;  4LBN A;  4UW6 A;  4ZXE A;  2O8Q A;  2JE8 A;  2ZTN A;  4WBB A;  1NCQ C;  3OJB A;  2E6V A;  1COV 2;  2WNU C;  3DPR B;  4N8M A;  4Q2F A;  5FZ0 A;  5I0U A;  3VHO A;  2C1F A;  2RS1 3;  4B7K A;  5LK7 B;  1POV 1;  1W6M B;  1VBC 2;  4AEJ A;  2VCC A;  5JXG A;  5LEJ A;  3VBS B;  1L7Q A;  3THC A;  3I59 B;  2EID A;  1EAH 2;  3MV0 1;  4IEO A;  1MZE A;  4UW3 A;  5F39 A;  3ZFG A;  5IT6 A;  1NA1 A;  2W39 A;  4XBQ A;  1QXR A;  4A41 A;  5A3T A;  2V5D A;  3H0O A;  5A6Q A;  1HN0 A;  5FUP A;  5ANQ A;  2HJI A;  3M4F A;  2IXC A;  1HQL A;  1YEW A;  2G1M A;  3GBF A;  3Q8F A;  3D5O A;  3O0V A;  1IG0 A;  2EXK A;  4HKO A;  5BNP A;  1H2L A;  1HW5 A;  5B4X A;  1H8V A;  3OYW A;  4YAR A;  5IVJ A;  2ILM A;  4QM8 A;  3OGG A;  3SLI A;  1DYK A;  1J83 A;  4MOA A;  5A7P A;  2ZS6 B;  2ET7 A;  1FMD 3;  5LK5 A;  3UL2 A;  3NST A;  2HWE 2;  5L9V A;  3OEA A;  1SLL A;  1VAV A;  1WCK A;  2CHH A;  3AP6 A;  4Q29 A;  4RS5 B;  3DPR C;  1Y9Q A;  1EUU A;  3OY8 A;  1REF A;  5GLW A;  4MXV A;  2VZO A;  2WAB A;  3VBS C;  1AL0 G;  2JDM A;  2X5I B;  4HMZ A;  4P9W A;  4EJR A;  3B5L B;  3E5U A;  3CZJ A;  3KM5 A;  4QHZ A;  1C8N A;  4UBH A;  4FPO B;  1W6P A;  1QWR A;  2KA3 A;  2OW4 A;  2ORZ A;  3LZZ A;  4AED A;  1SHW B;  1D4M 1;  2VZ1 A;  3M8L A;  4KH9 A;  2RE9 A;  2RDR A;  5FO7 B;  1CAW A;  2I74 A;  5F7U A;  2JG9 A;  5GZC A;  2OS2 A;  2GC1 A;  5JIU A;  1V6L A;  4XVH A;  1M06 G;  4XUQ A;  1UIK A;  3N9L A;  2RG4 A;  2ZAH A;  4P14 A;  4P9Y A;  1RC6 A;  1UD1 A;  2DTY A;  4EN7 B;  1QY4 A;  4YZ2 A;  3WUC A;  1ND2 B;  3HQU A;  3VHR A;  3V65 A;  4YW7 A;  5ABJ B;  3CU7 A;  3GF6 A;  3PUI A;  2QKD A;  1A6C A;  2RM2 1;  4R9A A;  5FXZ A;  1OT5 A;  4RS5 C;  1IPS A;  5A3U A;  3LEM A;  3WCR A;  5HXM A;  5DAB A;  1Q8P A;  1V6O A;  1LGB A;  2VVF A;  3ZPO A;  2NMO A;  4X8N A;  4CCJ A;  1NQJ A;  2ZEW A;  2LRP A;  2CU5 A;  3RWN A;  2X5I C;  3H3Z A;  4L97 A;  2D6M A;  3I2K A;  3WDU A;  4QT6 A;  1X9T A;  4DS0 A;  2GNT A;  3JD7 2;  5CKQ A;  4AW7 A;  3FBY A;  4E9K A;  4Q0Q A;  5JMC A;  5ERL A;  4CCC A;  3AZZ A;  1D7P M;  4D7T A;  3MIE A;  2BYV E;  4JV4 A;  4IEY A;  4V2W A;  3NNJ A;  1MZF A;  2JD9 A;  1PK6 A;  4RL7 A;  4E4H A;  2BV4 A;  1VMJ A;  3B00 A;  4BE3 A;  4XJW A;  4ZPI A;  4A3Z A;  3RZZ A;  3LAG A;  2Y33 A;  1ND2 C;  3CJI A;  1UF2 C;  1F9K A;  5ABJ C;  1AR8 1;  3RYP A;  4YGC A;  2VMD A;  5HBA A;  5K7P A;  3MBW A;  3OUH A;  3TEX A;  1QXP A;  3S30 A;  1CAU A;  5IJR A;  2QZ3 A;  1W06 A;  2PHR A;  2RM2 2;  4UAP A;  5AC9 1;  4KU7 A;  3V0A A;  4B4P A;  4CDQ A;  1N47 A;  4IE5 A;  1QXJ A;  1S4C A;  3TN9 3;  5C3R A;  4LLO A;  4NAM A;  2R7E B;  4GUL A;  4LOR A;  4CCO A;  3K4Z A;  2RS5 3;  5FZM A;  4EN6 B;  1O91 A;  2OT7 A;  4D6R A;  2QCS B;  2WLP A;  1IZ3 A;  4GAZ A;  1JOB A;  2XJV A;  4IV1 A;  1WMF A;  4Y24 A;  1ZBA 3;  2ZHM A;  3VD9 A;  1CJD A;  4XFA A;  5JPN B;  3GCX A;  2A6W A;  4I3P A;  4QM9 A;  5FUI A;  4BHP A;  4UFI A;  1GQP A;  3KV9 A;  3NV1 A;  1DG6 A;  2R49 A;  4IEV A;  5FY5 A;  2Z79 A;  1LES A;  2HWB 3;  5JOW A;  1LEM A;  1WW5 A;  2B5H A;  3ECQ A;  5ACA 3;  5FLH A;  5C3P A;  1P8J A;  4RGA A;  4YM0 A;  5DZE A;  3DKQ A;  5CNA A;  1AR8 2;  4FPJ A;  4OVE A;  4M0N A;  1RUC 1;  2GH2 A;  5FOJ B;  4FXG B;  1JH5 A;  1CIW A;  2R1D A;  2VU9 A;  4COZ A;  2E53 A;  2D44 A;  2B46 X;  2YBK A;  2ZHL A;  4Q4W 1;  5AC9 2;  2FZ1 A;  1YLL A;  1PHM A;  2BWA A;  3GNE A;  1LU2 A;  2FHR A;  3BU7 A;  3ZYF A;  5A7O A;  3H1W A;  3GCW A;  1PO2 2;  2WQZ C;  1Y9M A;  4IEP A;  2RJK A;  1CN1 A;  1D2S A;  1CVN A;  2EAA A;  1RVF 3;  3O0W A;  1E5R A;  4IGO A;  4PQ9 A;  5A3W A;  3T3Y A;  3U37 A;  1GKB A;  3WF0 A;  1CAX B;  2OZJ A;  3AKT A;  1I5P A;  2R06 2;  3INA A;  5JMO A;  1GV9 A;  2DVA A;  2ZML A;  1LJ7 A;  4Y22 A;  5BYN A;  4IQP A;  4SLI A;  2V4V A;  3L2H A;  5FY1 A;  5DAP A;  3NW4 A;  4FPY A;  4LPL A;  5FAX A;  4AGV A;  2C0Z A;  5FMC A;  1DIW A;  2E7Q A;  4AE2 A;  4EYU A;  4CDX B;  1HXS 1;  3N9N A;  4G3Y C;  4JRA A;  4PBP A;  4QXH A;  2PLV 1;  1AR9 1;  1JOP A;  1C5H A;  1AR6 3;  5FZC A;  4XOG A;  2GP5 A;  4MH0 E;  1OQE A;  3RPQ A;  1RUC 2;  2WNV A;  1GP4 A;  4QPI B;  4C90 A;  1TG7 A;  4EN9 B;  1QMJ A;  1ZBE 2;  3BVC A;  5FMO S;  3WHU A;  4QB1 A;  4Q4W 2;  4D94 A;  3HWJ A;  2B39 A;  3CZU A;  3WNN A;  4L99 A;  5KXE A;  4LE3 A;  3LA3 A;  4FQ4 A;  1Y43 B;  4AFC A;  2PHD A;  1OLQ A;  4PI2 A;  3VLB B;  2VTX J;  5DUU A;  4NPM A;  1AX0 A;  2LAL A;  5K0U C;  4GWI A;  3RG0 A;  3UGH A;  2EAK A;  3QD6 A;  4QPY A;  1C28 A;  2EXH A;  4AG4 A;  2WUH A;  2NP0 A;  3M3C A;  2JIC A;  3VZK A;  1VRH 1;  3SEP A;  1BXH A;  4GIQ A;  2SLI A;  4ES9 A;  1W6N B;  3KT4 A;  2ZXQ A;  4IE6 A;  2Q8D A;  3MF9 A;  2BGC A;  2QQW A;  3HQX A;  4CDX C;  4ES8 A;  3M3Q A;  1OUR A;  1HXS 2;  2OKX A;  1ALY A;  3NKG A;  1DYO A;  1OQ1 A;  1AR9 2;  2PLV 2;  1V6M A;  2WN2 A;  5FYS A;  1O3T A;  4QPI C;  2XH6 A;  3MEP A;  1WCD J;  1IPJ A;  1PMJ X;  4NAO A;  1SCR A;  3BUC A;  3ZLI A;  2HWD 1;  2Q1Z B;  2E7A A;  1IOA A;  2CL2 A;  2ZHK A;  2R6Q A;  3ORJ A;  5A6Y A;  4GZ9 A;  1FOD 1;  4EE2 A;  1GP6 A;  1R1A 1;  4B7E A;  1KJR A;  2PHX A;  4WVW A;  5CZK A;  4BIO A;  3SCF A;  3PUH A;  3NRU A;  3P3P A;  1V6I A;  4LBM A;  4DXS A;  1R09 1;  3FN9 A;  2Y6K A;  4R9B A;  4OHV A;  5GJ6 A;  2WZ8 A;  1DQ2 A;  2Y26 A;  3ZKY A;  4E4S A;  2J7M A;  5ANN A;  3RZJ A;  3AFK A;  1JUH A;  2WC2 A;  4LKF A;  5IK8 A;  3FC0 A;  3N9Q A;  4Y1U A;  2NLR A;  4AOC A;  1RUE 3;  4COW A;  4CU9 A;  4K6B A;  4XDP A;  4CCL A;  4P9X A;  2P6C A;  3I2I A;  4X6R B;  3JBG 1;  4XIL A;  3KF5 A;  5FZ6 A;  1QDO A;  4QGN A;  4YZ5 A;  1C1F A;  5LCW L;  4J1W A;  4ONU A;  2Y6G A;  2BVB A;  4NWV A;  1WBL A;  2BW8 A;  5EV7 A;  2ZX0 A;  4PLO A;  4Q0U A;  1YWK A;  1W3X A;  3I2J A;  5DDJ 1;  1OH3 A;  3ASI A;  4NJ4 A;  1MS1 A;  2B42 B;  4MLO A;  5IK5 A;  2R16 A;  2QQV A;  1O8P A;  4Q4X 3;  3POI A;  2VJX A;  5IVY A;  1RUG 3;  2HWD 2;  4KWL A;  4LXL A;  4NPR A;  1ND3 B;  1V0A A;  2XR4 A;  4NHY A;  1G9F A;  1R1A 2;  3TNP B;  3QH6 A;  4X8P A;  5DZF A;  4XF9 A;  2D93 A;  1O6U A;  1QJX 3;  4NIA A;  1NCR B;  4QX5 A;  1ENX A;  3SKV A;  3C3V A;  1DHK B;  4OMD A;  2WFF 1;  3UT0 A;  1IHM A;  4DQA A;  2J1A A;  1F35 A;  4AI2 A;  1W9Y A;  3FZ3 A;  4Y5T A;  4YNI A;  5F3C A;  4CEY B;  4K1Y A;  4KG0 A;  3IDE A;  3GZE A;  1MS5 A;  1DQ1 A;  1NG0 A;  3DCQ A;  3MPB A;  2I2S A;  2VZQ A;  4QMA A;  2VBP A;  3RJ2 X;  4Z2A A;  3DEM A;  3POF A;  4P9J A;  2E26 A;  1J84 A;  5SV8 A;  4FPK A;  4AL9 A;  1PIV 1;  1JHJ A;  1JYT A;  5KXC A;  1HQN A;  1GZW B;  3K2O A;  5A3O A;  4P9G A;  4PIZ A;  5DDJ 2;  1U5X A;  2X8K A;  4NOT A;  3Q8C A;  2XWJ B;  1LNS A;  1L3J A;  1ZRI A;  2IUW A;  1QJU 1;  2ZX4 A;  3BIW E;  1KDM A;  3ILN A;  4IE4 A;  2QQM A;  1ST8 A;  2QFE A;  5IUQ A;  1CPM A;  1ND3 C;  3LEK A;  2F4P A;  1YIP A;  4FPF A;  5FPL A;  3VZL A;  3OBT A;  4PDW A;  1NCR C;  4Y5Z 0;  5LBB A;  3VKL A;  3ZFE A;  1PM4 A;  2GAL A;  2QDR A;  4HK9 A;  2WFF 2;  3USS A;  3ZSE A;  1IG3 A;  1W8Z A;  4HPK A;  5FY7 A;  2A6Y A;  2ARC A;  3R4U A;  4CEY C;  4S2F A;  4ZON A;  1QDC A;  1F4A A;  1OFS A;  4U36 A;  1RUI 1;  4K40 A;  1AXK A;  1E5I A;  3A0K A;  2WO3 A;  3AKR A;  1KDK A;  3J8F 3;  3UJO A;  3PUS A;  3R4D B;  4AHY A;  4ASK A;  1VAM A;  3I3B A;  2J22 A;  3C7H A;  2VUA A;  4FFI A;  4IEW A;  3BTZ A;  4HET A;  4XIK A;  1PIV 2;  4ZS3 A;  4E2S A;  2W92 A;  3WIN E;  1WD3 A;  2IVI B;  3CKH A;  5JPM B;  2G19 A;  5FZ8 A;  4A7Z A;  3PNA A;  3VBO B;  1QJU 2;  4W50 A;  1AL2 3;  1RUJ 3;  3C7F A;  3ZOI A;  3ZXJ A;  3D6E A;  3MHZ A;  3LEI A;  4LO4 B;  3H8O A;  4AQ2 A;  4R9D A;  1W2U A;  3J7L A;  4JKM A;  4FOY A;  4OZO A;  4BWO A;  2CSG A;  3R0R A;  4ATF A;  2NMN A;  2XLA A;  3HAG A;  2A73 B;  1H9W A;  1MEC 3;  4XJA A;  3WY6 A;  4B29 A;  2D3S A;  1OKQ A;  4H14 A;  2A3X A;  2ZEZ A;  2R30 A;  3T2P A;  5GLZ A;  2R32 A;  1OA4 A;  1RUI 2;  4P5H A;  3N7L A;  5GZF A;  1GP5 A;  1Y7B A;  1F31 A;  2A75 A;  3Q9O A;  4UT5 A;  2WO2 A;  5T52 A;  5IVE A;  3LOI A;  4FFG A;  4O61 A;  2DVG A;  2IXK A;  1KFU L;  1CD3 G;  2VME A;  4YZ4 A;  3VD4 A;  2VQ0 A;  4JVA A;  3SNM A;  3ZR5 A;  5FWJ A;  1QIQ A;  1H9P A;  3WNX A;  4BQY A;  5J09 A;  3VBO C;  2G9F A;  1JMU B;  1QQP 3;  4ORF A;  1HRV 3;  1VRB A;  1SAC A;  1FAY A;  3K51 A;  4QQH A;  4QHO A;  1DF0 A;  4W8J A;  3TB0 A;  3FUQ A;  4DEV A;  2XHN A;  3VL9 A;  4JGY B;  4MGQ A;  1W0P A;  4C1W A;  1ACC A;  1U0A A;  3C7G A;  4CP9 A;  1XE7 A;  4N53 A;  2EXJ A;  5FP3 A;  1R08 1;  3OG2 A;  1DFQ A;  2ADE A;  4JQT A;  5IYY A;  4PJY A;  1WWY A;  3CLP A;  4YM3 A;  1JU4 A;  1PZ8 A;  2EAL A;  4QB6 A;  4CDW B;  4EWD A;  2Q1F A;  4NRP A;  4BOW A;  1YFU A;  4FO9 A;  4ZHN A;  3KZ4 C;  5DN2 A;  1W2A X;  2WT0 A;  2A71 A;  3R4S A;  3UKV A;  5J48 A;  1UY4 A;  4BM8 A;  2XBO 1;  4CDU A;  1PM7 A;  4YFZ A;  4R4Z A;  3VB9 A;  3WP6 A;  2WWS A;  1UNB A;  1KS4 A;  2ZAB A;  3M2M A;  1BJQ A;  2PAK A;  4DIN B;  4GKY A;  2CNA A;  2XJT A;  1S0E A;  1YO8 A;  4AWD A;  3ZXK A;  2EVX A;  4EWE A;  4QQL A;  3PIJ A;  2A3Y A;  4RR3 A;  5EZW A;  2BVV A;  3UJQ A;  4YW2 A;  1N1T A;  3E6D A;  3WP4 A;  3P5B A;  2B7Y A;  2W9X A;  3M70 A;  4JGY C;  4IEZ A;  1C8M 3;  5HXV A;  1PVC 3;  2J1U A;  1RMU 3;  1SFN A;  1AX1 A;  1HKD A;  1Z7S 1;  5CYY A;  5L19 A;  1AF9 A;  5FZI A;  1W9S A;  2WYS A;  1R08 2;  3MO4 A;  3PTY A;  4AAP A;  4E2Q A;  3M3I A;  4CDW C;  1CX1 A;  1CAV B;  2ZAA A;  2GZW A;  1IS4 A;  2MEV 3;  3ACH A;  4CU6 A;  1MAC A;  3KV6 A;  5A7N A;  1EV1 3;  2VW1 A;  3D0S A;  2UWC A;  2PHF A;  3DYO A;  4QAW A;  4XE9 A;  1LOA A;  3SHR A;  3VKO A;  1G9A A;  4XJ9 A;  5FZE A;  3OTF A;  5FZB A;  2WAA A;  1ZZ9 A;  4GMP 1;  5F2S A;  4GB3 1;  2C4X A;  3GM8 A;  1IQA A;  5FKB A;  1C4R A;  1J1T A;  3ZFG B;  2XOM A;  1T6B X;  1H4G A;  1AVB A;  1UXZ A;  2F6B A;  2VMG A;  3DEC A;  2O14 A;  3ACG A;  5EYX A;  4LHN A;  4QDS A;  4BQ3 A;  2EIG A;  1XSR A;  2JDP A;  3OGR A;  2IFR A;  3SQO A;  3H42 B;  4FFH A;  3T2T A;  5KHK A;  3GZU C;  1UQX A;  4DY5 A;  5DAW A;  2HEY F;  1UOG A;  3ACL A;  5BNQ A;  4YVW A;  1QGL A;  2DFC A;  4I01 A;  4WM7 A;  1FXZ A;  1UKG A;  1Z7S 2;  1DP0 A;  3AX4 A;  4C91 A;  5JXI A;  3S57 A;  3KV5 A;  2VW0 A;  5A1L A;  1YJK A;  1BK1 A;  4UW4 A;  4HVQ A;  2RS1 1;  2RS3 2;  1VIW B;  1Z0H A;  3FL7 A;  3VZO A;  4N7U A;  1OF4 A;  1QOO A;  2P17 A;  1XYN A;  3SCG A;  2VVE A;  1X36 A;  3H8X A;  3WG2 A;  3DXT A;  5FZH A;  4B1L A;  5FJK A;  2DCT A;  2DDU A;  1STM A;  4E2G A;  4WM8 A;  4MX3 A;  3I2F A;  3ZFG C;  4NRM A;  4CXW A;  3WV6 A;  3VDA A;  1YFW A;  1GBG A;  4D3W A;  4HK8 A;  5F2W A;  1C3H A;  2NM1 A;  2W5F A;  1JZ3 A;  2J1V A;  3VBU B;  3IMM A;  2XJS A;  2BOI A;  1OPM A;  4PLM A;  5C7G A;  4BIF A;  4KWJ A;  1TME 2;  4YW5 A;  5H9Q A;  4KQ7 A;  5H9R A;  1TEI A;  3VGI A;  1FMD 1;  2MNG A;  5CEH A;  4XF0 A;  2DCZ A;  5SV5 A;  1FX5 A;  2TBV A;  3O1P A;  4JTN A;  3RYR A;  5C6C A;  4NIH A;  3TNQ A;  4MGY E;  1S0F A;  3N7J A;  2GN7 A;  3VDB A;  4NIG A;  3NNM A;  2RS1 2;  1DLL A;  4BQ5 A;  1BZW A;  4M01 A;  2QUO A;  4LIU A;  4N7I A;  1LOE A;  3MW4 A;  2WWJ A;  5BNN A;  2Y6F A;  4PIX A;  2ZX1 A;  2A6V A;  4RN5 A;  2CWS A;  4UBG A;  4CCN A;  2VAU A;  5A3P A;  3PU3 A;  2XVK A;  4QX1 A;  2LW8 A;  4NMI A;  4CXY A;  5HV0 A;  3HNB M;  1MZ5 A;  4XF1 A;  2ZMN A;  4QGM A;  2G9Z A;  1VBA 2;  3B9I A;  5FYY A;  1V6K A;  5CB7 A;  1DZQ A;  1GOF A;  3IBM A;  3VBU C;  1UU6 A;  2C6S A;  3RGB A;  4ZZ8 A;  3SKJ E;  4AF9 A;  4LBK A;  1JTZ X;  3DXU A;  3JU9 A;  1CWP A;  3AL6 A;  1QHD A;  3D0J A;  4XAE A;  2B9U A;  4ZY9 A;  3WP5 A;  3WF3 A;  4NN0 A;  1AYM 3;  5C71 A;  3O1O A;  3GHM A;  2YBS A;  1ULD A;  3FX3 A;  3ZSM A;  1YQC A;  4CEW B;  2RDS A;  2RVA A;  5A33 B;  5LA0 A;  1W8F A;  2RDQ A;  1PZ9 A;  1LHU A;  4ASM B;  2PHL A;  4BZ4 A;  4AGG A;  1DQ6 A;  3B01 A;  5KR7 A;  3V0B B;  2VEC A;  1US3 A;  1XBF A;  2ZZJ A;  4I2O A;  1AR7 3;  3POG A;  4EV0 A;  3S6P A;  1HB4 A;  2JDH A;  3ZSK A;  1US2 A;  4A4A A;  2P37 A;  4E4Z A;  2HBT A;  3KD4 A;  5IHR A;  1NE6 A;  3PU8 A;  3LDB A;  1QJY 3;  2CTV A;  4XQW A;  2GME A;  3T0A A;  4QKN A;  3PUQ A;  2XON A;  3IN9 A;  2W46 A;  1IQD C;  4LBQ A;  1CZV A;  1H8T B;  1O4Y A;  3OF1 A;  5E89 A; 
#chains in the Genus database with same CATH homology
 1XC6 A;  5IJR A;  4L0P A;  1TVG A;  4UAP A;  4P00 B;  4QPW A;  3MV1 1;  2W1U A;  3VD5 A;  3C8X A;  3D3A A;  5JXJ A;  3WF1 A;  2R7E B;  4XUP A;  3K4Z A;  3LPG A;  1PX3 A;  3DYP A;  5DQ0 A;  2YFZ A;  3HJR A;  3P6B A;  4E8D A;  2RJ2 A;  1JZ5 A;  1UZ0 A;  3JXS A;  3IDA A;  3VD9 A;  2VZR A;  4UOJ A;  4P5Y A;  5FUI A;  1KEX A;  1GQP A;  4QX0 A;  3ECQ A;  1JYV A;  3LE0 A;  1P8J A;  3T09 A;  2B9V A;  3WF4 A;  2ZEY A;  2W91 A;  1L7R A;  3I2G A;  4TTG A;  3K77 A;  1UMI A;  2C9K A;  4A6O A;  2EIB A;  2VMC A;  3LPF A;  3IB3 A;  3ZM8 A;  2CDO A;  3U37 A;  3WF0 A;  4PF1 A;  1I5P A;  3T08 A;  1UY0 A;  5JMO A;  2ORX A;  5DMY A;  1UXX X;  2V4V A;  1XPW A;  2W3J A;  4LPL A;  2VMF A;  3NQH A;  4ARY A;  3ABZ A;  3CDZ B;  3E1F 1;  1CZT A;  1UYY A;  3VD3 A;  2QQJ A;  5HPO A;  3I97 A;  3I2H A;  1TG7 A;  4QB1 A;  4DUX A;  4GWJ A;  3WNN A;  3CZU A;  1PMH X;  4YPJ A;  4A45 A;  1HN1 A;  2C26 A;  4CUA A;  4DXR A;  4D8M A;  4JHZ A;  2J1R A;  3WNL A;  1NKG A;  5EJ1 B;  4DUW A;  4GWI A;  4QDQ A;  3WEZ A;  1W9W A;  3FHA A;  2DCK A;  4AG4 A;  2WUH A;  3A23 A;  4QB2 A;  2VZP A;  2YC4 A;  3SEP A;  4D0Q A;  4P02 B;  2ZXQ A;  3III A;  2VC9 A;  1GU3 A;  1W8N A;  4JKK A;  3WF2 A;  2OKX A;  5IFT A;  1DYO A;  1GUI A;  3IAQ A;  2YB7 A;  2WN2 A;  3WNO A;  4OUE A;  4DEQ A;  1K42 A;  1PMJ X;  4BXS V;  1OH4 A;  4ARX A;  1MPX A;  2B4K A;  4GZ9 A;  3HPN A;  3MUZ 1;  2XQX A;  5CZK A;  2JKX A;  3SEE A;  1UMH A;  3PUH A;  3NRU A;  2Z4F A;  1ULP A;  2VZ3 A;  3CQO A;  5C70 A;  4DXS A;  3FN9 A;  2Y6K A;  2BGP A;  2EIC A;  2WZ8 A;  1JZ6 A;  2VCA A;  2J7M A;  4A44 A;  4CU9 A;  4RYD A;  3OGS A;  1EUT A;  3I2I A;  3T2O A;  3HNM A;  2QQO A;  1DLC A;  5LCW L;  2Y6G A;  3I3E A;  1NUK A;  2VZV A;  2BGO A;  3I2J A;  2W1Q A;  3A22 A;  2VZT A;  1O8P A;  1RYY A;  4HG6 B;  2VJX A;  3WNP A;  2JDA A;  2VQU A;  1JYX A;  5LA2 A;  2WO1 A;  3HN3 A;  3W5M A;  4KMQ A;  2WAO A;  3K75 B;  1UX7 A;  3GGL A;  3SKV A;  4OMD A;  3EB7 A;  3CMG A;  2J1A A;  3WQB A;  3WNM A;  2J1T A;  3NNG A;  1GOH A;  1BHG A;  2HLE A;  2VZQ A;  4ZZ5 A;  3K46 A;  4Z2A A;  4ET7 A;  2E26 A;  1J84 A;  3NJX A;  1JZ8 A;  1JHJ A;  2VM9 A;  2QQI A;  2X09 A;  2KD7 A;  3OBA A;  2W87 A;  1LNS A;  2BZD A;  2QQM A;  3NJV A;  2ZEX A;  1OD3 A;  3LEK A;  4A42 A;  3P1I A;  4MAD A;  3W5N A;  3VDC A;  1JYW A;  4BJ0 A;  1F4A A;  2W94 A;  2WO3 A;  3OEB A;  1SG3 A;  4DUV A;  3FHQ A;  2VOT A;  3I3B A;  2J22 A;  3C7H A;  4XUT A;  1SDD B;  4CU7 A;  3A21 A;  3WNK A;  2W92 A;  4OMC A;  4M4P A;  2E32 A;  4PQQ A;  3CKH A;  3C7O A;  2VO5 A;  1W99 A;  1JZ4 A;  3AC0 A;  2L9L A;  5J1X A;  4W50 A;  3C7F A;  2YG0 A;  3MUY 1;  4OYU A;  2RV9 A;  3LEI A;  2BBA A;  2YFU A;  3THD A;  4BDV B;  2YC2 A;  4JKM A;  1K12 A;  3ETP A;  4OZO A;  2W47 A;  4M4R A;  1W9T A;  3UES A;  2W1S A;  2Y64 A;  1YQ2 A;  4E8C A;  1R64 A;  3EYP A;  5LA1 A;  2ZEZ A;  5EJZ B;  3T2P A;  4FI9 A;  1KGY A;  2Y6H A;  1JYN A;  2LS6 A;  1JU3 A;  5I0D A;  2WO2 A;  2Y6J A;  2VME A;  3VD4 A;  4QX3 A;  3K4D A;  4XUR A;  4KI5 M;  2J1S A;  1UY1 A;  4W8J A;  2QBX A;  1H6X A;  4DEV A;  2XHN A;  1OF3 A;  4MGQ A;  1UYX A;  3C7G A;  2VZU A;  3OG2 A;  2BER A;  2Y6L A;  1XNT A;  1WCQ A;  4UI9 L;  5IYY A;  5B4N A;  1JU4 A;  4QB6 A;  3UET A;  3T2Q A;  3BGA A;  5JR2 A;  3C7E A;  4IUG A;  3ACI A;  4XZU G;  5DN2 A;  1UY4 A;  2V72 A;  2WDB A;  5JUV A;  4PT6 A;  1GNY A;  1K3I A;  3A7Q A;  2W9X A;  2VQT A;  2J1U A;  5CYY A;  2PQS A;  4CUC A;  1W9S A;  2WYS A;  3MO4 A;  5JXH A;  3GXU A;  4CVU A;  1CX1 A;  4QDR A;  4CU6 A;  3ACH A;  1GOG A;  3J7H A;  5A1A A;  4KWU A;  3DYO A;  3OGV A;  4QAW A;  3VD7 A;  3LEG A;  2VCB A;  5G04 L;  2WAA A;  3OB8 A;  2C4X A;  3GM8 A;  3HNY M;  2HYX A;  1F4H A;  3BN6 A;  2XOM A;  1UXZ A;  3HEI A;  3DEC A;  4JX0 A;  3ACG A;  4LQR A;  4QDS A;  3IAP A;  2W1W A;  3OGR A;  1XNA A;  1NAE A;  3UNP A;  1CIY A;  1GMM A;  2X05 A;  2WBK A;  3GDB A;  3K4A A;  4ZXE A;  2WQ8 A;  2JE8 A;  4P08 A;  3T0B A;  4LKS A;  1DP0 A;  5JXI A;  1JZ7 A;  2VCC A;  5JXG A;  1L7Q A;  4QX2 A;  3FL7 A;  3THC A;  1OF4 A;  2EID A;  1WKY A;  3MV0 1;  2WN3 A;  5IFP A;  4XUN A;  4A41 A;  2CDP A;  2DDU A;  2V5D A;  3ACF A;  4MO3 M;  3I2F A;  5EIY B;  1O59 A;  3WSO A;  3LQC A;  4CU8 A;  3VDA A;  2J1E A;  2W5F A;  2Y8K A;  3DYM A;  3I3D A;  4JKL A;  1JZ3 A;  2J1V A;  5B4X A;  2X10 A;  4MOA A;  1J83 A;  2QQL A;  4TXW A;  5C7G A;  3OEA A;  1EUU A;  3T0D A;  2EIE A;  4MGS A;  3VDB A;  2VZO A;  2WAB A;  1K45 A;  2E31 A;  1UYZ A;  4LHS A;  3HOB A;  2VL4 A;  4AAX A;  3CZJ A;  4BK4 A;  2ORZ A;  4RN5 A;  1SHW B;  1W8O A;  2VZ1 A;  1W0N A;  5G05 L;  5F7U A;  4QX1 A;  2LW8 A;  4XVH A;  3HNB M;  4XUQ A;  1JZ2 A;  4W4Z A;  4XUO A;  1GOF A;  2VR4 A;  2E33 A;  4ZZ8 A;  3SKJ E;  2VTF A;  3PUI A;  2QQK A;  1ULO A;  5HXM A;  1OT5 A;  4ZY9 A;  3WF3 A;  2QQN A;  5C71 A;  1H6Y A;  2ZEW A;  1NX9 A;  2RVA A;  4DXT A;  5LA0 A;  1O8S A;  3I2K A;  2DCJ A;  1PX4 A;  1US3 A;  1UY3 A;  3F2Z A;  1D7P M;  2VZS A;  2JD9 A;  2ID4 A;  1US2 A;  4A4A A;  1JI6 A;  1UY2 A;  5DPN A;  5IHR A;  2W95 A;  3CIH A;  4BK5 A;  1UWW A;  4A3Z A;  4CUB A;  3T0A A;  2WZE A;  1CZS A;  2XON A;  2W46 A;  1IQD C;  1CZV A;  1T2X A;  2VMD A;  3MBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...