3P6BA

The crystal structure of celk cbm4 from clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
HMALEDKSSKLPDYKNDLLYERTFDEGLCFPWHTCEDSGGKCDFAVVDVPGEPGNKAFRLTVIDKGQNKWSVQMRHRGITLEQGHTYTVRFTIWSDKSCRVYAKIGQMGEPYTEYWNNNWNPFNLTPGQKLTVEQNFTMNYPTDDTCEFTFHLGGELAAGTPYYVYLDDVSLYDPRFVKPVEYVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulose 1,4-beta-cellobiosidase
publication title Structure of CBM4 from Clostridium thermocellum cellulase K.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3p6bA00
2ZEXA 1PX4A 3PUHA 3MO4A 4M4PA 3CMGA 2VMEA 2BGOA 5G04L 1SHWB 3P1IA 2OKXA 3WNNA 1TVGA 4JKLA 2Z4FA 3LEGA 5CYYA 1HN1A 3P6BA 4BK5A 4A41A 2HLEA 3LPFA 4GWJA 4W4ZA 2BERA 4A6OA 2ID4A 3IAQA 1OT5A 3OBAA 3DECA 3I2GA 3NJVA 2BZDA 2Y6HA 3WEZA 3VDBA 5J1XA 1TG7A 4HG6B 3ETPA 2WYSA 1ULPA 2JKXA 2W94A 4CU7A 2L9LA 4BXSV 2WO2A 2W1WA 2XONA 1JU3A 1UXXX 2Y6LA 3NQHA 2VZRA 3NRUA 4XURA 1JYWA 3F2ZA 1US2A 2JD9A 3I2HA 4W8JA 4ZZ8A 2WZEA 1UY4A 2VZTA 2XOMA 3WSOA 5LA1A 5I0DA 4M4RA 3OB8A 4QAWA 4XUOA 2W5FA 2HYXA 1UMHA 1K12A 4QX1A 1T2XA 5JXJA 2E33A 1NUKA 2J1UA 3K4DA 3MV11 1GMMA 2W91A 3W5NA 3EB7A 2LW8A 3OGVA 1W9WA 1EUTA 2WUHA 3U37A 3IAPA 5C7GA 3W5MA 4LHSA 3WNOA 1BHGA 4DUVA 3VD3A 1DYOA 3DYMA 4XVHA 3T08A 5LA2A 1GU3A 4BK4A 4FI9A 2VMDA 4TTGA 1DP0A 1W0NA 1JYXA 4DUWA 3OEBA 2VQUA 5A1AA 5LA0A 2EIDA 1CX1A 2VZVA 5C71A 2YC2A 3FHQA 2J1AA 1H6XA 1KGYA 3ABZA 5FUIA 3WF3A 1K3IA 3ACIA 3A23A 3IB3A 3I2FA 3DYOA 3A7QA 1UYXA 1SG3A 2J1TA 3WF1A 3NNGA 1XNTA 4A3ZA 1OF4A 3GDBA 3WF2A 3OGSA 2YC4A 2WQ8A 3T2QA 2VR4A 4P08A 4OMDA 1O59A 3ACHA 2VZPA 2WN2A 2CDPA 1IQDC 4XZUG 2X05A 4JKKA 3JXSA 2VZ1A 5EJ1B 2XHNA 1UY3A 4MADA 2ZXQA 3CDZB 2VMCA 1O8SA 2ZEWA 3CQOA 1UX7A 2VL4A 5B4NA 3HEIA 2W3JA 3SEEA 4RYDA 4P00B 3IDAA 3VDAA 2WO1A 5HPOA 3OG2A 2V5DA 3ACFA 3ZM8A 4QX2A 5IYYA 4JHZA 1PMJX 3VD7A 3GGLA 1PX3A 1ULOA 4ZY9A 1O8PA 1WCQA 4BDVB 1OD3A 1UWWA 4D8MA 4CU6A 4QB1A 2EIBA 3HNMA 2VOTA 4QX3A 4A4AA 1CZTA 3HNYM 4MGSA 4ET7A 4P5YA 2CDOA 4P02B 3WQBA 3THCA 2VZSA 3UETA 2QQKA 2KD7A 2WO3A 3T0BA 2E26A 5JXGA 2VCAA 4A45A 2DCKA 1NAEA 4XUQA 4GZ9A 2EIEA 2Y64A 4KI5M 4W50A 2B9VA 2VMFA 3LQCA 2VZQA 1JZ7A 4BJ0A 2W1SA 4XUPA 5EJZB 3LEIA 2Y6KA 4AG4A 4MOAA 4DXRA 4KMQA 2J1SA 3K4AA 2JDAA 1JZ6A 3VD4A 2Y8KA 1GOFA 2WBKA 5EIYB 2VM9A 4QDRA 3HPNA 3T0DA 3WNPA 2V4VA 4QDQA 4QPWA 4Z2AA 3K46A 4E8CA 2QQMA 1GNYA 2ZEYA 3CIHA 5CZKA 3MUY1 2VZ3A 3J7HA 1XNAA 4A42A 1R64A 2YG0A 1CIYA 4ZXEA 3GXUA 4AAXA 4DXSA 1K45A 2WAAA 3AC0A 1L7QA 5JR2A 3PUIA 4PQQA 1KEXA 1UY2A 2VTFA 2ORZA 2YFZA 1CZSA 1JZ4A 2WZ8A 1JHJA 3VD9A 1UY0A 4MGQA 3CZJA 3GM8A 1YQ2A 4DUXA 2VZUA 2X09A 4LKSA 2VZOA 2VJXA 2WABA 2RJ2A 4LQRA 1DLCA 2C4XA 2YB7A 2QQNA 3T09A 1US3A 4QDSA 4OZOA 3LPGA 3ECQA 4UI9L 3THDA 2W95A 3I2KA 3MBWA 2RVAA 4CVUA 2BGPA 2LS6A 2W92A 3C7FA 4UAPA 2B4KA 1W8OA 2WN3A 2Y6GA 1CZVA 3IIIA 3C7EA 1JZ2A 5DQ0A 2VQTA 2QQLA 2DDUA 1GUIA 2QQOA 2W1QA 3T2OA 5JMOA 3C7GA 1GOGA 2DCJA 2XQXA 4RN5A 3UNPA 2W1UA 3FHAA 4CUAA 3LE0A 3NJXA 3VDCA 2YFUA 3VD5A 3K75B 3I3BA 4PT6A 4QB6A 1W9SA 1OH4A 4JX0A 2QBXA 1JZ5A 4ZZ5A 1F4AA 3I2IA 2J1VA 2QQJA 3ACGA 1J84A 2Y6JA 5JXIA 4DXTA 5DN2A 3CZUA 2X10A 1OF3A 2RV9A 3OEAA 4MO3M 2R7EB 4ARYA 1EUUA 5DPNA 4OMCA 2JE8A 4DEVA 1NKGA 2W47A 2J1RA 1J83A 3LEKA 1MPXA 2C26A 4XUNA 4PF1A 2QQIA 2BBAA 3C8XA 5DMYA 2C9KA 3WNKA 1JZ8A 4DEQA 4TXWA 5IFPA 3FN9A 5C70A 3T0AA 3A22A 1LNSA 3A21A 3I3EA 1XC6A 1UZ0A 4JKMA 4D0QA 1P8JA 3FL7A 3I97A 3MV01 2J7MA 1L7RA 4GWIA 1UXZA 2E32A 5IHRA 5JXHA 2VCBA 2EICA 3E1F1 3OGRA 3UESA 4E8DA 4OYUA 3WNLA 3SEPA 3DYPA 3WF0A 1PMHX 2W46A 2E31A 5LCWL 1JI6A 3HN3A 4QB2A 2W87A 1K42A 4UOJA 1JYNA 3I2JA 4CU9A 1I5PA 4CUCA 3EYPA 3MUZ1 4ARXA 3WF4A 4OUEA 4YPJA 3HNBM 2J22A 3D3AA 3HOBA 2ORXA 2W9XA 1W99A 2ZEZA 2VC9A 4LPLA 2WDBA 1GQPA 3I3DA 3K77A 2WAOA 3BN6A 4KWUA 1H6YA 1NX9A 1JU4A 3C7HA 5JUVA 4L0PA 5IJRA 4A44A 1W8NA 2J1EA 4XUTA 1UYZA 2VCCA 3WNMA 3SKVA 1WKYA 1W9TA 1JZ3A 1JYVA 4IUGA 4QX0A 1UMIA 3HJRA 3SKJE 3CKHA 1UY1A 3BGAA 3C7OA 1GOHA 5F7UA 1D7PM 1F4HA 1XPWA 1UYYA 3T2PA 2VO5A 5B4XA 4CUBA 1RYYA 1SDDB 2PQSA 5IFTA 2V72A 5G05L 5HXMA 4CU8A 3K4ZA
chains in the Genus database with same CATH superfamily
2ZEXA 3AP9A 1VBD2 3CMGA 3QOPA 1BXHA 3ZMNA 2BGOA 1HV1A 4QKBA 5DAXA 4ASLA 1SDWA 4IV3A 1SHWB 1YEWA 2HWF3 2ZMNA 4RS5C 3P1IA 3PU8A 4IGPA 3WNNA 5FYYA 3B94A 4R52A 2ARXA 3DPRC 4JKLA 5GLZA 4E2GA 1SQ4A 2IZWA 3JB4C 4F8AA 1VAMA 2Z4FA 3VHOA 5FYVA 5JZGA 2FDHA 1HDKA 1YIFA 5GZDA 1LHVA 2BVBA 3FWEA 2HLEA 3SNMA 2HWD2 3B7MA 4QMAA 2BERA 4A6OA 2ID4A 4AFBA 2Q8OA 4NROA 4KWLA 1VBB3 4F7ZA 1OT5A 3RZJA 1XNDA 1ZZ7A 2R1BA 3DECA 5TSWA 3I2GA 4PIXA 1RUI3 3NJVA 2BZDA 3WEZA 3V0BA 1MS1A 1OQEA 5JCTA 4HG6B 1F9KA 1TEIA 2XBO1 1FV3A 1DYPA 1XBFA 3ETPA 3NV4A 1AL23 4LUKA 3X29B 1NLQA 1VBA3 2W94A 3CU7A 3KHCA 2NP0A 4MGTA 1ND3C 1SBDA 4AGGA 1PGL1 1PNGA 4G9SB 2WO2A 4LA2A 2HWB3 4P9JA 1VE0A 2W1WA 4OHVA 2VECA 3PHMA 4IDZA 1VMHA 1WD3A 1UXXX 2JDPA 3O0WA 4EROA 1RVF2 1C8M2 5FLJA 3UGFA 3NRUA 3J7LA 4LBKA 4XURA 5D8AA 5I8SA 3F2ZA 5J36A 2JD9A 2A6YA 2O0OA 3I2HA 2GAUA 1NYWA 1E5HA 1MS8A 4XTMA 4YZ4A 3BPSA 4EZHA 1UY4A 2IVJA 2VZTA 4KWKA 3WSOA 2ZZQA 3VGIA 5T50A 3S5AA 5LA1A 5F6LB 3OB8A 1RUOA 1FNZA 3M8LA 2E63A 4XUOA 5BNOA 5K0UC 1A34A 3IPVA 2P2KA 4DMIA 4W65A 1W9YA 3CJXA 3K2OA 1CX4A 4LTAA 1T2XA 2YGMA 5FY9A 4G4FA 4A7YA 1DQ1A 4CCEA 2J1UA 4N7UA 1ODMA 2Y26A 2A75A 1G9AA 2W91A 3W5NA 1W2AX 3EXUA 2JDYA 4YWAA 5BNNB 3OBTA 2JDHA 5FY7A 3K3NA 2YDEA 3DGTA 5C7GA 4LUMA 1XB9A 4GQ7A 3HR9A 4HVRA 2WZR2 1BHGA 3KLSA 4E9KA 3BU0A 3OYWA 3OUHA 4S2GA 4XFAA 2D44A 4ATFA 5FPBA 5M0TA 2XB6C 2VW2A 5FJHA 2XVKA 4YGDA 4I02A 1Q8QA 1UU4A 3VBRC 4CDXA 3KZ4C 4YSFA 5J09A 2WSVA 3DYMA 3MIHA 1VBC2 1BBT1 2OUJA 1GU3A 4Q0QA 4BK4A 4Z07A 2EAKA 4AHZA 2A71A 2PAEA 1RXGA 1OQ1A 4ISQA 5FLIA 1JYXA 5DG2A 5C3OA 1H4GA 4UBGA 5CFDA 2GNDA 4P9IA 3IZOA 1CJPA 4XJZA 1WZXA 2F17A 5LA0A 5JI9A 1GICA 2D43A 4FFGA 1B35C 1WLCA 5C71A 2YC2A 4C0BA 5L9RA 5LBBA 4FXKB 5EQUA 3E97A 1KGYA 1YIPA 2RDRA 3WF3A 1K3IA 3J7MA 1A78A 5A3WA 3S30A 3A23A 1CPNA 3ZSKA 5SV5A 4BLIA 4HKLA 4LIVA 1IG0A 1OH3A 2A5ZA 2BNMA 3MW3A 5IVYA 2J1TA 4RFRB 3WVJA 2F4LA 2DU1A 4GAZA 5F3EA 3V56A 1QXJA 2BWCA 1XNTA 1CAXB 2XBO2 4C1WA 3ATGA 1SFPA 5DZGA 4NRMA 1BLZA 2CAVA 4GH4C 5A32A 4OLLA 1UIKA 5GLVA 5C9AC 3I2OA 3LGRA 3OGSA 3WF2A 3WY6A 2YU2A 3TNPB 4K1YA 5C8CC 2WQ8A 3T2QA 2TUNA 1W6NA 5FWEA 4P08A 4XW3A 4IEVA 1CAVA 1DHKB 4RQPC 5KHHA 3WW1A 5IVFA 4XEZA 4J1XA 4XZPA 4IXLA 4YFWA 1UL9A 4NN0A 1YFYA 4DXZA 1RUNA 2D6MA 3WUDA 1UPIA 4O9EA 4BWOA 2CDPA 1IQDC 4JKKA 3LA7A 1FMD3 4XBNA 4OVEA 4AL9A 4O61A 3AYCA 3VHRA 1Q43A 3ZFFC 4FPEA 4HSJA 2ARBA 3CL1A 4AQSA 3LWCA 3LAGA 4IE7A 4A7ZA 1VRBA 3O7OA 2RS31 1FAYA 3A0KA 3N9NA 1UX7A 2DCZA 2VL4A 3KCXA 1W6QB 2HWC2 4UXAA 5B4NA 1WW7A 1YC61 3HEIA 4TLFA 3N9MA 4H55A 3SCFA 4D69A 1RUH3 1D0HA 3ALQA 2GNMA 4P00B 3VDAA 5JSOA 4OHYA 5KC6A 5KC5A 4Q5OA 3OG2A 5H9PA 3O0XA 4IE0A 2SBAA 4MX3A 2G19A 4K1ZA 3ZMOA 3RFRA 1I9RA 5ANNA 3OJBA 4MHRA 1PMJX 4FT8A 5IYYA 3JB8A 4CEWC 3AP7A 1J3RA 5APAA 1R093 1TZOA 1HXS3 1MVEA 3ZR6A 3H8OA 4N53C 1CPMA 4WVMA 1MACA 1SFNA 1MQTB 1WCQA 4FAHA 3O1PA 4FTSA 1OD3A 4CU6A 1U5XA 2CAUA 5FV3A 2MEV1 3HNMA 5FZ6A 4BMEA 1BBT2 1PMIA 3ZFEC 2RM21 4QGMA 5AFEA 3LDBA 1QH6A 5IK4A 3KT4A 3HNYM 1AXKA 4LBNA 1PO13 1Z0HA 3QH6A 4UF0B 5FPAA 5C3RA 1OHFA 2Q8EA 4ET7A 4XMIA 3KCYA 4RGGA 1FOD1 1VIWB 3BODA 1JHNA 1KJRA 3N7MA 2DUOA 4M01A 3THCA 4Y5SA 4GXLA 4AEDB 1LOBA 4Q4Y3 1R083 5T5LA 4LOSA 3FUOA 1RUF1 1Y9GA 2BNOA 1OVSA 5JXGA 5IUQA 4LOTA 2YY1A 4HMZA 2K46A 1COV3 2VOVA 1W8ZA 3CF6E 3H1YA 1UX6A 4QXCA 4EWEA 3BOWA 1R1A3 3R4SA 3J26N 2VZQA 2R061 4XYXA 4HONA 4BJ0A 1ZBE3 3HIFA 2QE3A 5FZHA 4XUPA 2RMU3 5CA6A 1U12A 1GZTA 2PN5A 5C5TA 4KMQA 1J58A 3GHNA 4CEYA 5F3IA 1AVBA 2JDAA 3VHPA 5ACA3 3VD4A 1GOFA 5FYIA 3AJYA 1YYNA 3NL1A 1H8TB 3R0RA 4TYSA 1W3VA 4LITA 2VM9A 3OBZA 4CZSA 1VBD3 2O1QA 1GANA 2ZGTA 4GALA 3RS6A 3U75A 3L2YA 1BVVA 1PVC1 1QY4A 4QKDA 3HPNA 3VN4A 3LSDA 5DAPA 2ZGMA 1V00A 4ISRA 4CDWB 3MZHA 4JVAA 3N9PA 3WNPA 2YBSA 3S6PA 2HJIA 2VPVA 4D6SA 4JZRA 2P5BA 4Z2AA 1A3KA 2RS32 3FC0A 2NZ9A 1HW5A 3T1LA 3H3ZA 2EXHA 2XJTA 5CZKA 3CIHA 2AREA 3POEA 5E16A 2VZ3A 2VY0A 4L8QA 1IS3A 4Q2FA 4AEMA 2ADDA 2WSUA 1E57A 3GBGA 1SLBA 3WNXA 3OD0A 1XNAA 2HWD3 1AR91 3AYDA 1X8MA 1GSLA 2YG0A 3U4XA 4DO0A 3GXUA 4IV1A 2Q8CA 1UYPA 3H1MA 2BNNA 4FPKA 5FMCA 3JQWA 3T3YA 1Y9QA 1KDKA 4JDOA 4ONUA 3O14A 1JH5A 1OA2A 1UY2A 4RD7A 1U5YA 2ORZA 1DQ0A 1OKQA 2MEV2 4FTEA 1I1EA 1XSRA 3VDDC 1JZ4A 3HBKA 2RM22 5C3SA 2ZGNA 4MVTA 4AVCA 1EAH3 4MGQA 3WCSA 4XHXA 1RVF3 1UOFA 4CP0A 1C8M3 4DQAA 5A3PA 4DS0A 2FBEA 2VVEA 1WA4A 4AAPA 5IAVA 3CO2A 2WABA 2RJ2A 1FOD2 1NCQB 3KS7A 4RR3A 2KXLA 5GKAC 4UYBA 1US3A 4QDSA 4FP2A 3LPGA 3JZVA 4LKEA 2QQUA 2Z79A 4UT5A 4XFFA 1NE6A 4YM2A 1G9FA 2XDVA 1RUF2 2BGPA 4Q26A 2BQPA 1YQ5A 2W92A 4CVUA 5ABJC 1SLAA 2ZMKA 5EV7A 4AXOA 1W8OA 2WNUA 4NPRA 4YW7A 5L7OC 1HQWA 1C1FA 4B4PA 4BQ2A 3ZFGC 1ULEA 4YVSC 3WUCA 2VNOA 3S7EA 1JZ2A 3D82A 2PHXA 3AVSA 1IS4A 4LMFA 2F6BA 2QQLA 2O8OA 5GM0A 1LGNA 2R062 1GUIA 2QQOA 4XOGA 5AVAA 5FPXA 4CP9B 2EALA 4RN5A 2XJUA 3ZYIB 3UNPA 3KD4A 4PIYA 3NV3A 4JTOA 5LB6A 4WVVA 2WZR3 4ES9A 2A7AA 5CAZA 1BQPA 3SH5A 1AHSA 3H9AA 4IV3B 4OQ8A 3H8RA 4AWDA 2VW1A 2BEOA 3OSDA 3RMYA 3ZKUA 4C8DA 4CE8A 4KG0A 4Q4W1 1QJY1 1LECA 3I3BA 3UKNA 4FOYA 2OYZA 4JGYC 3KHBA 4K20A 4QB6A 5JZGB 4P9GA 4LXLA 4JX0A 1PK6A 2PTMA 3BTYA 4IW3A 1PVC2 3M2MA 1F5FA 1QMJA 4WM8B 1O4ZA 4CDQC 4H7MA 3I2IA 3RZKA 1WCDJ 2QQJA 4EYUA 4BQXA 2OW4A 2BPA2 1KJLA 1OBNA 2JECA 1RINA 1VAVA 2X10A 5JPNB 2A73B 2HEYF 1NCRA 3LF7A 3R4UA 4XJWA 2VVDA 4ARYA 2R7EB 3WOGA 3POIA 2IUWA 2P6CA 2ZX1A 3OBRA 2QQVA 4OMCA 2RJKA 3JQXA 3WG1A 2JE8A 5T5PA 5BNNA 3PVEA 4NE9A 3C3VA 4DEVA 2JG8A 1NKGA 2FDGA 4NAMA 1AR92 2QNKA 4DZGA 3MI8A 4NOTA 1MZFA 3M1HA 3LEKA 1NA1C 2WT0A 4S2DA 3O1VA 5ISLA 1LULA 1XNKA 2GSYA 3AP6A 3RDIA 1UAIA 4YM1A 1UOJA 2QCSB 5D8AB 4BA6A 5KXBA 2ZKNA 2XBO3 3WDYA 2XJSA 3OGJA 4MGIE 1X9TA 4R9AA 2DVDA 3PURA 2JDUA 2CGOA 4PCRA 3A22A 1FPN1 1Z78A 3IM0A 4JKMA 5BNOB 1DQ5A 1Y4WA 3MV01 3V0AA 1L7RA 2VBPA 1UXZA 5IHRA 5JXHA 3IMNA 2VCBA 2EICA 4W6XA 1QDCA 2R0FA 5FO7B 1BK0A 5GLWA 3U14A 4EN8B 3KV5A 1KRIA 5LCWL 2ZMLA 5KXEA 5EPAA 2W87A 5H9SA 3VKLA 1QWRA 3RJRA 3BIEA 3N4MA 2D3PA 1U0AA 2HYKA 4CUCA 3MF9A 4AE2A 4AOCA 2BJSA 2Z5WA 3VBUC 4CDXB 1CAXA 4I3GA 5FZ7A 5JMCA 3HNBM 1W05A 3D3AA 5C3QA 2DUPA 4YG0A 2GN3A 5E89A 2GC1A 1GWLA 5DUVA 1H1IA 4JV4A 3KT1A 3PL0A 2BOJA 3ES4A 5CFDB 1MS9A 4FSJA 2AACA 3BN6A 2RS11 1G8WA 4Q4W2 1QJY2 2Y0IA 5JUVA 5E88A 1Q8VA 1W8NA 2J1EA 5FOJB 1T6BX 1BBT3 4QD2A 4XUTA 4XF4A 1SZBA 1AR62 5IW0A 2P17A 4NR1A 1WKYA 2D5FA 3H0OA 1JZ3A 1H8VA 2IXKA 1WLTA 3IWZA 3D8CA 1JXNA 3LCPA 3SKJE 3CKHA 3WR0A 3EMRA 3WW3A 4RSUA 3H50A 2ERFA 3C7OA 2VMIA 2WNVC 1PM7A 1LOFA 1XPWA 4AI3A 3M7AA 4FPGA 2ENRA 5LZ6A 2QQWA 3INAA 3LZZA 1RYYA 2AYHA 3E5UA 2DBIA 5FQ0B 4CUBA 5I93A 1ZRFA 2PQSA 4S2FA 4ZKTB 1ZBA1 4X6RB 2E7TA 5EHDA 4QGNA 2Q1MA 2AENA 1GR3A 1R1ZA 4CU8A 1OMIA 1G9DA 2RR11 3HT1A 3K4ZA 4AQ2A 3BOPA 3VZOA 2GMMA 3VKMA 3PUHA 2A6XA 1CAVB 1NLSA 2OS2A 4B7EA 2PHFA 2KM2A 3VBOA 5AFBA 3WCRA 3WLUA 2DCTA 1Y9MA 5FIXA 5F5IA 2D3SA 1AJOA 1UU5A 1E5IA 1UZZA 2GH8A 2P37A 5A7QA 4QT6A 4ZHNA 1O91A 3LEGA 2DVAA 2NMNA 2Y0OA 3FZ3A 3I59A 1YLLA 3P6BA 2GZWA 5FXWA 3MICA 2PMWB 4W4ZA 3T30A 3UYJA 1HRI1 1D4M1 1MEC2 4XPVA 1HB1A 3BTXA 1JS9A 3I49A 4BU2A 4LT5A 1C1LA 4N9IA 3VDBA 1O3TA 5J1XA 3EBRA 5JOZA 4KWJA 1ULPA 4YGBA 4XIOA 2RS33 1MZ6A 4B1MA 2L9LA 4BXSV 4Y1ZA 4Q1PA 4LBLA 4Z82A 1LEDA 4WVMB 3AZWA 3ILNA 2Y6LA 3TBDA 2NM1A 5LK5A 2AH2A 1WBFA 1HQNA 4BQ4A 5FK7A 5IVVA 3TWIA 5A7WA 4B4RA 4YZ2A 4XQWA 5LW9A 3ZXGA 3RZZA 1ENSA 2G9FA 4A6SA 2JENA 2YU1A 4UFIA 4LO5B 1DGRN 3N35A 3NJYA 1F15A 1UKRA 4QAWA 2RS12 2K9ZA 2DVFA 2XG3A 4EN9B 2WIIB 2OQ7A 2W5FA 2HYXA 2BP6A 3DL3A 2MEV3 1K12A 1GZCA 4MXVA 4XJ9A 5F39A 2RM23 3PTYA 2IFRA 4H14A 2CYFA 1C4RA 3K4DA 3AKTA 3MV11 5FYTA 3EB7A 3AP4A 3U11A 2B39A 3OGVA 3BTZA 1VAKA 1FOD3 1ZZCA 1RUJ1 4TWTA 3W5MA 2JG9B 3EJKA 4CSWA 5A6XA 1Q5OA 4LHSA 4PDWC 5A3NA 1S0CA 3ME2A 3PUSA 5FCCA 3VD3A 3SH4A 1K5MC 4QKFA 2JEMA 4OI0A 1REDA 1OKOA 1DYOA 1RUF3 3LEMA 4COYA 1OFNA 1VALA 1AF9A 2RR12 4JRLA 5LA2A 4Y5Z0 3FMGA 5CNAA 4CEYB 3GNEA 2VMDA 4Q8KA 4TTGA 2Q4SA 3MLKA 5CFCB 3MW2A 1VB2A 1MQTC 1GYKA 2J42A 2OVUA 1VMFA 4HL0A 3ZPYA 2G9ZA 2R063 3KF3A 1AX2A 2XGXA 1MVQA 5GJ6A 4COUA 4AEJA 5FZAA 2EIDA 2VZVA 3RJ2X 3URFA 3NKTA 3PJYA 1FNYA 4W6YA 4LK6A 2J1AA 3ES1A 1H6XA 1X7NA 3ABZA 4Q29A 5BUVA 5FMOS 3FLTA 3ACIA 3I3QA 1XU2A 4QQHA 2B42B 4FPJA 4HKWA 1HRI2 4IEPA 2FDKA 1D4M2 1LHUA 3KSCA 1DQ6A 1MS5A 1AXYA 1W2TA 2CGNA 3A7QA 3DXTA 1G9CA 1PVC3 4AEDC 5DZEA 4ATEA 2QUOA 5CKNA 4LO4B 2LRPA 2YUEA 3E5QA 4UW4A 3UJQA 3ELNA 2OZ6A 3VZLA 5I8TA 1N3QA 1YNAA 3N36A 4XFCA 1LODA 1ZZBA 2P3KA 4J6GA 4AHWA 2WZR1 4URAA 3GDBA 3NAPB 5CIRA 2GC3A 2E53A 4CXXA 1YJLA 4FFIA 2DVGA 1HJFA 4RL7A 2VR4A 2ADEA 2GC0A 4OI4A 1VBC1 1AR93 3VKFC 4XF9A 1U5ZA 3ACHA 2VZPA 2WN2A 4CP9A 5A6ZA 3FUQA 2EIGA 4XZUG 1RUD1 4A3XA 2AEZA 3B93A 4BLJA 2VZ1A 4ASKA 2XHNA 3LA2A 1ASJ1 1MR5A 1LTEA 3AL5A 4NIHA 4PQ9A 2ZXQA 2VMCA 5IK8A 4N43C 4RR3B 5BPXA 2BGCA 1N3PA 1STMA 1JODA 4Q0SA 1W04A 1BJQA 5F37A 5KXDA 4P5HA 2W3JA 1UW8A 3KF5A 3FFZA 4WM8A 4CCLA 2CGPA 2DCYA 3JD71 2MNGA 3IDAA 4KGQA 4Q0UA 1X36A 5HCHA 4QPIA 4IQPA 2WO1A 5HPOA 3DV8A 2WNUB 3ZYFA 2R32A 4JHZA 5T52A 1RUJ2 1LHNA 2VNVA 5DAQA 3Q8EA 2FCUA 3VD7A 5CU1A 2ZHKA 4AGRA 3POJA 4YZ3A 1J3QA 2N7GA 5LATA 4R9CA 4CTEA 1ULOA 4Y1UA 3WX5A 5FP8A 2ZHLA 3NNJA 1O8PA 3P3PA 3MPBA 4D8MA 1OURA 2G1MA 4R9BA 5JI7A 5FO8B 3HAGA 1UOGA 1KFXL 4S2HA 1REEA 2VOKA 4A4AA 2R49A 4COVA 1QGLA 1VR3A 2EA7A 1H1AA 4R9DA 5DUUA 5FZFA 1EV11 3A4UA 3EQEA 4D6RA 4CDUA 4XCAA 5C5UA 2W39A 3ZVXA 3BTAA 4P5YA 2JX9A 2ZA9A 4IEOA 4AVSA 1PK6B 2EXIA 4NWVA 4P02B 1BK1A 3LIGA 2WNOA 2JDZA 1OOPC 2VZSA 2DUQA 4WZFA 3ORJA 3AKPA 3FX3A 2NMOA 2VULA 4Q4W3 1QJY3 2E7AA 4GH4A 2ZGSA 4PIZA 4IE5A 3BI3A 1ULCA 1AXZA 1NCRB 2HWC1 1NCQC 4XDOA 4XQDA 3T0BA 2VCAA 2XLAA 1JN2P 2DCKA 1RMU1 2TNFA 4FOWA 2P3JA 4QU2A 1ND2A 1YO8A 1QJU2 4XUQA 4RQPA 2EIEA 4QPGC 1KQRA 2JG8B 4FFHA 1GNZA 5CKQA 2XKOA 4I30A 4W50A 5FPVA 1WBLA 2B9VA 2VMFA 2WQZC 3LQCA 5JSPA 1TNFA 5FZBA 1OPMA 2ET7A 2KA3A 1PO21 5EFUA 1XYOA 4COWA 5D21A 4BQ5A 4O9GA 4Q27A 5FZEA 4AG4A 3S0MA 4HK9A 4HBNA 2VUAA 4ZS3A 5L9VA 4JQRA 4D7TA 4KBZA 1SMVA 1REFA 4LBOA 1DGWA 2VMHA 1YI9A 2OIIA 2WBKA 3MHZA 4YG3A 5DDJ1 4XC9A 3KV4A 1O3SA 4LBJA 2F4PA 2VNRA 1ENQA 3FHIB 4XFGA 5FZLA 2W52A 2UURA 1RUD2 3N7JA 3VBFA 2R30A 4IV3C 1ASJ2 2K2SA 4IL7A 4CCCA 3V0AB 2XPJA 3Q8CA 3T0DA 3J4UH 4Y1VA 3CJIA 2DV9A 2V4VA 5CEHA 4MHUA 5K8SA 1SPPB 4QDQA 4QPWA 3K46A 1QJX1 3OY8A 4LKDA 4K6BA 3BU7A 3C2UA 5I0TA 1FPN3 2JJ6A 2FDIA 1F2NA 2ZEYA 2JB4A 1TE1B 4NO4A 3PTRB 3JD72 3HVDA 4AW7A 5B2GB 4CCMA 4Z92B 4MLOA 5T54A 2IXCA 2RDNA 3ZFEA 4Q1RA 1R64A 4NUBA 1CIYA 4ZXEA 2PHTA 3E6DA 5CISA 4K7JA 1JYIA 5FYCA 1U5IA 4YW6A 4ZU4A 5FPLA 4DXSA 3BALA 2FZ2A 2YPJA 5FQ0A 4BZ4A 3AC0A 5FY0A 2FCVA 1YHFA 5HCAA 3AYAA 3HQUA 4BIOA 5FZMA 2G9GA 3HD8B 4NHYA 2YFZA 2VQAA 2EXKA 4QX8A 1JHJA 2GNTA 5D8AC 1JYTA 1F31A 1EV12 5FBZA 2CHHA 4HT1T 1ZRRA 4R4ZA 4DUXA 2VZUA 1MZEA 2ZX2A 1TQ5A 4AFDA 1I6XA 4ZU5A 3THPA 1WGPA 2WFPA 4LQRA 1H30A 4YVWA 4E2QA 2QQNA 1PGW1 3PMEA 1GP5A 3ACLA 3AMNA 5EP9A 5BNOC 3I3MA 4HANA 1RUE1 2D6KA 3KV6A 3ECQA 2RS13 2IXJA 4UI9L 5A3MA 3OPZA 1PZ8A 2RVAA 2XJVA 1V9U1 1O3QA 2ATFA 1C28A 3C7FA 4J1WA 2WN3A 2Y6GA 1CZVA 1V0AA 4OFGA 1RMU2 2OUHA 3SHRA 1KD7A 2BRTA 4HVQA 3C7EA 1OLQA 3B3QE 1LAJA 1AL0G 2VQTA 4YLZA 3WDTA 4CRQA 3LKJA 2DYCA 3MF6A 5JMOA 4ZONA 1GOGA 1F8VA 1PO22 1WW4A 1UQXA 1QNWA 3TYJA 1POQA 1FX5A 4CP2A 4XIKA 4FOQA 2AC1A 4WM7B 5FYSA 2Q0AA 3VBOB 3WP5A 4CDXC 2WA4A 4ITCA 1IZ3A 1ZBA3 2YMZA 2XHKA 5CKMA 5FZDA 5L73A 5CG8A 1ST8A 1IKQA 2XL7A 4N7IA 2EF6A 2RR13 3KGZA 5DDJ2 3ZSEA 3HT2A 4Z1VA 2DTWA 1W9SA 1OH4A 4DNYA 3O1OA 3OTFA 2QBXA 1YI7A 4EN0A 3I59B 4ZZ5A 3GJBA 4Y4YA 2FMYA 3CHXA 3NWKA 5FZ4A 3MLLA 2FDJA 4DXTA 4YM0A 1CVNA 1QJX2 2Z2SB 3JU9A 3ZLIA 4FPFA 3FBMA 1IOAA 3OEAA 1TMF1 5F2WA 4M3CF 1WW5A 5DPNA 2XQRA 2FHRA 2HH9A 3APBA 4FXGB 2PXJA 3ZXDA 2VG9A 1HQLA 1HRI3 2W47A 1D4M3 3D0SA 1DGRA 2QDRA 2WT1A 1J83A 3ZPOA 2Q30A 1XE0A 2YBPA 2JG9A 4XF1A 4XUNA 3ZIXA 1G7YA 1HRV2 4B29A 2RG4A 2JD4A 2WQ4A 5T5OA 1TNRA 3AXDA 5A7WB 3AZXA 5L19A 4XHBA 1CD3G 2P4EA 4OHWA 2EAAA 4B4QA 3VV1A 3WNKA 2V5YA 4FCAA 4DEQA 4TXWA 5C4WA 5IFPA 4UWDA 3R6SA 4AGVA 1RHI1 3H8UA 3PIGA 4KU7A 1ONAA 2VU9A 2X29A 3W58A 1LNSA 5C70A 4D7SA 1ULFA 3M70A 5CFCA 1GP6A 5DAVA 3ILRA 1UZ0A 2P34A 4UW5A 1P8JA 1QDOA 3FL7A 1QQP1 3VZKA 3I97A 4BH9A 1XU1A 5ABJA 2J7MA 1W2NA 2GN7A 3OUIA 3ZYGA 5E6HA 5L7OA 4NIGA 3UESA 1X9PA 3OGRA 1OD5A 3WD5A 3U07A 4HKOA 4OYUA 3MFAA 3DKQA 4CPBA 1PGW2 1DYKA 3B02A 3DYPA 1E5RA 3WDWA 5BNPB 2W46A 2E31A 3VBSB 1RUE2 1OFSA 2XXZA 3O5SA 3HN3A 3J9SA 4I3PA 2OA2A 4IEUA 4NJ4A 1WCKA 1K42A 2D6LX 5FZ1A 1V9U2 1JYNA 1Q8PA 5FZGA 3WHUA 1GKBA 4CU9A 1H9WA 3GZUC 5KHGA 4OHXA 3EYPA 2GC2A 4X8NA 1XOYA 4KL1A 2OX0A 5BNQA 5KWRA 4ARXA 2BBVA 4HPKA 3FE5A 3WF4A 2BFUL 3DPRB 4OUEA 4OULA 4YPJA 3J8F1 4H3WA 4L99A 4P9WA 3HOBA 2FD8A 4OI1A 1SEFA 2W9XA 1JOJA 1RUJ3 2B45X 1LR5A 2ZEZA 1M4WA 3NAPA 4META 3FJSA 1BCXA 4YZ5A 5A3UA 5LRSA 1NLRA 1HKDA 4AFAA 2BU9A 3POBA 3RYKA 2BDRA 1V6IA 3H42B 1HV0A 3LB9A 1NX9A 1APNA 4LNVA 2D40A 4Y20A 2D98A 4PF5A 1QJZA 1UYZA 2VBDA 2ET1A 1LOCA 4QX7A 3WNMA 4E2SA 2G4IA 3UV9A 4IUGA 1K5JA 4D3WA 3NNLA 1WLWA 3USSA 1YFXA 3VBHA 1L7LA 3HQRA 4AI2A 3BGAA 3AK0A 4JRAA 4FP3A 4QPYA 3OUJA 3PVBB 4DB5A 1G86A 1KFUL 2D6OX 1N1YA 1WMEA 3KGLA 1TMF2 3T2PA 2VO5A 1LRHA 4OQ9A 3SCHA 1RGSA 3AYEA 3WINE 2FDFA 2V72A 4WBBA 3TOJA 1GWKA 2P1BA 2ZGRA 4K8RB 5G05L 4A7KA 1IGOA 4EWDA 5FY8A 1FT9A 5DXDA 1QJU3 1PHMA 1WW6A 5JPMB 3LD8A 3MO4A 2NLRA 1LEMA 2H0VA 5K0UB 1UN1A 4Q8LA 4YW4A 1LHWA 4YW5A 4J25A 2PLV1 4JGZA 1O4YA 3MFCA 3HQXA 4CP1A 5DUXA 1IPKA 3AKSA 5T55A 2R1DA 1AR81 3RVHA 4CEYC 3WG3A 1RHI2 3DKWA 2VVFA 1JBCA 4LJHA 1EY2A 3TEWA 1QH7A 4I01A 1C57A 4P14A 1OLME 5GALA 4IESA 4V1PA 2VXJA 5I91A 2AR6A 1HN1A 1H2MA 2D5HA 3JUUA 3Q8FA 1QQP2 1S2EA 4BK5A 1VBC3 4Y3OA 4YW1A 2ZCWA 3POWA 5T3NA 1RIRA 1ZZ8A 1AR61 1JMUB 3LPFA 4FPHA 1OC1A 2WWSA 4GWJA 4K40A 4CCDA 1O6UA 2CTVA 1RXFA 1RUD3 4HVOA 3OBAA 3VBUA 2VMGA 3DF0A 1ASJ3 4JDNA 4L11A 4LBQA 5LEKA 2D6PA 4YFZA 1C8NA 1V6JA 4QPIB 2XR4A 1NE4A 1W8WA 2ZGKA 5KXCA 3HWJA 2WYSA 1C3HA 4YGCA 2JKXA 5FZIA 1ENRA 2QTWB 4NPMA 1SLTA 3O1SA 3FLRA 4QQOA 3ETQA 2UYBA 3OOXA 4N8MA 4H2AA 2XONA 1E5SA 1JU3A 2X5IC 3JD73 5FXVA 3T1MA 4C0HA 4GKYA 3NQHA 3UJOA 4XTPA 1B35B 5GLUA 1JYWA 4IV1C 4GJZA 2CWSA 3J8F2 5D2AA 1WWYA 2WLQA 3LFIA 3U0ZA 5F32A 4ZZ8A 1A8MA 3AXEA 4DIQA 1NQDA 2XOMA 4CDUB 3CEWA 3PU3A 4RHV1 4QM8A 2Q1FA 5I0DA 1H9PA 1KS5A 3GBFA 1AX0A 1BVP1 1SLIA 4BXFA 4EQVA 1Y7BA 4B8EA 5KHJA 4BCUA 1RB8G 1DGWX 3ZDVA 3NW4A 2E33A 1NUKA 5JOYA 1EV13 5J98B 4GH4B 5CADA 5FZOA 1GMMA 5FYZA 1KDMA 4UFMA 4RR3C 1MEC1 3VUOA 4UFKA 1SPPA 4HZFA 1UZYA 1VJ2A 2MHFA 2WUHA 2YC0A 1ND2B 4RQPB 5H9RA 4DPNA 1ZVFA 1XXNA 2C5DA 1UD1A 4DUVA 4I0BA 5EJ3A 2CWMA 2WNUC 1ULGA 1VP6A 5GLTA 2HWC3 4NIDA 1QKQA 3POSA 1PZ7A 3MLJA 1OSGA 2V73A 5AC91 1RMU3 3ASIA 4XVHA 3T08A 2HWE1 2ZTNA 3NV1A 3RZLA 4AR2A 4CCKA 2JIGA 4IEWA 1CWPA 1W0NA 3R4DB 1IPJA 4M0NA 3MIBA 4DUWA 1V70A 2PLV2 4LE3A 4TLGA 1EYBA 4QKNA 1PO23 3M3OA 5A1AA 5JOWA 1Q56A 1AR82 3VBFB 4Z8BA 1W8TA 1CX1A 1PNFA 2PHRA 4CCOA 1VBA2 5A3OA 2XLGA 3FHQA 1UIJA 3CJIB 3KQRA 1RJ8A 3OY8B 4CEWB 1TME1 5A1LA 2JE9A 2XJQA 4LR4A 5DDJ3 3IB3A 4A2UA 3V64A 2YZ4A 1WMDA 1LJ7A 5LRRA 1SG3A 4AVBA 3RSJA 4AEKA 5FYBA 1DU3D 4OI2A 3ZFEB 1NCRC 3GHMA 4A3ZA 5EYYA 3VB9A 1OF4A 1QJX3 4LKFA 2ZGUA 3O0VA 3TRSB 4AQTA 2R071 5FK8A 4YGEA 4EN6B 5BNNC 1OVPA 1LOAA 5FR3A 2JG8C 2YC4A 1Z7S1 2WFF1 2ES3A 2C1FA 3G6JB 4EZ4A 5KHKA 1JTZX 5CVRA 2I45A 2WR9A 3HBZA 2ZJCA 1ODNA 1VBE1 5IVEA 4QQPA 2WL1A 5KR7A 2VE1A 5A7SA 5EJ1B 1HJGA 1LKNA 4TZDA 3ZO0B 4WM7A 2NPIA 2A1XA 4RHV2 2VBBA 4AQ6A 3MEPA 3CDZB 4M0HA 1W3XA 4IEYA 2PAKA 3JBG1 2R0HA 3SC7X 4YVWB 4RFT0 4FO9A 3EO6A 4PDWA 5JWPA 2I2SA 2ZKLA 5A6QA 5IK5A 1FXZA 3ZYHA 2W08A 5FY4A 3MDPA 3LDRA 4M00A 4XBLA 5FZ8A 4QX2A 4HSLA 2ZACA 5JVVA 5A33A 3Q8AA 4JC1A 3OCPA 4RGAA 2C9AA 1RTVA 1RUE3 2X53S 1PX3A 2E6VA 4IGOA 1N47A 2VGDA 4NIAA 1S4CA 1D4VB 1V9U3 3AP5A 3OF1A 2TEPA 4XAEA 3WT3A 2IXLA 1V6KA 1GZ9A 4TSVA 5K7PA 3VHNA 5AC92 1O3RA 1YFWA 2HWE2 4OHZA 3M4FA 1CZTA 2I74A 5HCBA 4URTA 2XJPA 2RHPA 4TN7A 4U2AA 4MGSA 1UNBA 5C8WA 1SACA 2JDKA 3LA3A 3NMBA 4QGLA 1G6NA 3S7IA 1AJKA 1N1TA 3W20A 2CDOA 4IE6A 5AVPA 4YYOA 3KWVA 3RI8A 3NSTA 5FUPA 1VPHA 4YG6A 1GZWB 4XETA 2Q8DA 3R05A 1YRZA 1J1LA 1JUHA 4AVVA 2DVBA 3UETA 4DRRA 2VW0A 3AMMA 1OQDA 1TME2 3GF6A 1LOGA 2I07B 3MIFA 3SXWA 4YM3A 3NVCA 4XFHA 5FREA 1CR7A 1VLNA 3ZDSA 2PHUA 5FKCA 1NAEA 5BNPA 4IGQA 4MSVA 3AB0A 3VL8A 3QCWA 3VBSA 2Y64A 3UKVA 2WWUA 1QOTA 2ZOEB 4UW3A 4YW3A 1LOFC 3SLIA 4XJUA 4WZCA 3I4IA 3ZSLA 2R072 5FMDA 1ACCA 3LEIA 3UGHA 1TMF3 2Y6KA 5JLVA 4RS5A 4LHKA 3TB0A 2J1SA 4EV0A 1Z7S2 2C0ZA 2OQ6A 1IQAA 2WFF2 4N43A 1FYUA 5FZ3A 5GZEA 4BIFA 2ZGLA 3DPRA 2E7QA 1NG0A 2Y8KA 5C4WB 1JZ6A 4AHXA 4ES8A 5EIYB 2E9QA 4YRDA 1VBE2 4XCBA 3VBOC 4QDRA 3ZN6A 1CGPA 1S2KA 3I8TA 1YWKA 3LIHA 5ABJB 2NQYA 3QBQA 3WQ1A 1X82A 5L7OB 4AFCA 1HXS2 5BY5A 2UWAA 3JBG2 1JYCA 5ERLA 4Q0PA 5IWFA 1ENXA 1RC6A 1RHI3 1FV2A 1GP4A 2QQMA 3M3QA 1GNYA 4XACA 3MUY1 2D93A 4DRVA 3ZYBA 2AZ5A 1ND3A 4CCNA 3ZSMA 1XYPA 4HLTA 4Y26A 1QQP3 2DBNA 3V65A 2BVVA 2RE9A 4EE2A 3O1RA 1DZTA 4A42A 3NO8A 1DF0A 3VZJA 1QJU1 3ZR5A 1UO9A 2ZX0A 4AAXA 5BV6A 1O5UA 4LO8A 3WQ0A 3S5QA 4HPKB 2WAAA 4JAAA 4BQ1A 3SCGA 3IKWA 1LGBA 5JR2A 4KH9A 1XNBA 4L97A 1KEXA 2B7YA 2O8QA 3MIDA 2LTNA 3NJZA 1OOPA 1CAUA 1WMXA 2WZ8A 1RJ7A 3VD9A 1DIWA 5K0UA 4GMP0 2B46X 3CZJA 4RGKA 1YQ2A 4Y20B 5F5AA 4F3JA 5IATA 2PA7A 5JIUA 1WCUA 2VD7A 3IN9A 3J8F3 1POV1 2NYYA 4FPLA 4I0AA 4LKSA 3RGBA 5A7PA 1J3PA 2PYTA 1CQ9A 1DQ4A 1R1A2 3AX4A 1QXPA 2C4XA 2V4AA 3AKRA 4LBMA 5CBLA 2JE7A 4QPGA 3T09A 5FZ9A 1SBFA 2Z69A 4NHKA 4NIIA 3VBHB 2WKKA 1H8TC 3LOBA 4L92A 4HFSA 2WNEA 1XJAA 4MGZE 2JDMA 3THDA 1QNYA 5FMBA 1ZRIA 3QACA 5C6CA 2B4KA 1IS5A 4UFLA 4CDWC 5A3TA 3IIIA 3RZMA 4K21A 1AYM1 1KITA 1QF3A 1A6CA 2D7FA 3VBRA 1Q8OA 3UT0A 5FFOC 2XVLA 3BUCA 2DFCA 1GBGA 3ZKYA 2DDUA 2W1QA 1W39A 4MV2A 1W28A 4C1XA 1ZRDA 2XQXA 4I09A 5FDBA 4BQWA 4Y24A 2W1UA 3FHAA 3AVRA 5FY5A 3LE0A 4AI0A 1A8DA 2YFUA 3U1XA 4JGZB 3VD5A 3AMQA 2W2IA 1B35A 3KMHA 1GWMA 1AX1A 1GQHA 2O14A 1W06A 4QXKA 3W59A 4LO6B 3KVAA 3BIWE 1N1SA 2VUDA 2IC1A 4QXHA 3USUB 4DFSA 4QQ2A 5J37A 1C5IA 1UZWA 5F2SA 1JZ5A 4Y22A 2VH9A 2A6WA 5HBAA 2JIJA 3KM5A 2PLV3 4NRPA 1BEV1 4EN7B 2GDFA 1J84A 2Y6JA 2Q1ZB 5JXIA 1PIV1 1RUC1 4WVWA 1CIWA 3I7DA 4XJAA 1AR83 5DN2A 5F8PA 3VBUB 4CPBD 1W6PA 4LBQB 2JWPA 3RRDA 3AZZA 1NZCA 2GU9A 3DXUA 2RV9A 3WP4A 4MO3M 2AGSA 2XVGA 4M3CA 2ZHNA 3N9QA 1EUUA 2AEYA 2XWJB 1L3JA 1QEXA 5C9AA 1VB4A 1EAH2 3BB6A 2BOIA 1AR63 5C8CA 2CNAA 4GMP1 5FPZA 2PQQA 5LBEA 1DGLA 4KU8A 4QU1A 2C26A 1DG6A 1B09A 1SCRA 1W0PA 5I0SA 1NXD1 5A80A 2QQIA 2BBAA 2HEWF 3IIAA 3C8XA 1D2QA 5BYNA 2Q5TA 2C9KA 1YQCA 1Y3TA 1JZ8A 4MG2A 3VL9A 4B1LA 1H1MA 4LHLA 3FN9A 3ZFFA 2ZAHA 1CAWA 1ULDA 3ZN4A 5HCFA 3RWKX 1GV9A 3A21A 1V6NA 1RITA 4D0QA 2WNVB 4DINB 1YJKA 5C33A 2UU8A 3GYDA 4Y1XA 4GWIA 4AHYA 5A6YA 2VTXA 5BXXA 3ITQA 2PFWA 3ZYPA 2ILMA 4LLOA 4E8DA 3WNLA 5FZOB 2OXBA 3I2DA 3THTA 3WF0A 4RHV3 1AYN1 2P3IA 4L9BA 3TEZA 5JZGC 3E6BA 1IG3A 2ZX4A 3CNAA 1JI6A 4CEWA 3O1MA 1GFF2 2QDNA 4K3UA 4K8FA 1S0IA 3BCWA 4UOJA 2H0BA 4N53A 3I2JA 1T6GC 4IETA 4WM8C 1I5PA 3GCXA 3H7YA 4BMBA 4NRQA 4QPIC 1AYM2 4EWAA 3MUZ1 4JHTA 3RNSA 3NV2A 5L9BA 1WCSA 2RDSA 1MEC3 4XAAA 4GJYA 3ST7A 2J22A 1M06G 2GH2A 1HRV1 3HN1A 3T4HB 1W99A 3MIEA 3WP3A 4LA3A 1ZX5A 2VC9A 4LPLA 3IDEA 5FBJA 2WDBA 4XDQA 2H6CA 5HV0A 4G3YC 4E4DX 1BZWA 4E4SA 3BVCA 5JR7B 4KWUA 5J48A 1H6YA 1X33A 4XXPA 1S2BA 3I54A 1DQ2A 1OXCA 5AC93 3T4VA 3PUQA 1WD4A 2QKDA 2HWE3 3WP6A 4BQYA 4CDUC 2ZABA 4DOUA 2VCCA 3D4KA 5A3LA 3PNAA 4QX0A 4W6WA 4QX5A 1UMIA 1BEV2 3AZVA 2BTVC 1PIV2 1RUC2 1S0BA 4JQTA 5E8AA 1UF2C 4ZU7A 4NVPA 4LBQD 4LE4A 1D7PM 3AM2A 1F4HA 2QFEA 2XL9A 3MYXA 1UYYA 4QQLA 4NHMA 1ZA4A 5IVJA 1PGL2 4OUMA 4Q4X1 4JCKA 1VRH1 1TME3 2OPWA 1Q8SA 1ND2C 1SBEA 4O7XA 4NHLA 1AZDA 1WA6X 2QZ2A 1PX4A 5IVCA 1S0EA 3JCIA 4GB31 4M4PA 1SCSA 2VMEA 3TN91 1JUIA 3P5BA 4IE4A 1DLLA 5FP9A 3VZNA 4QXBA 5F3GA 4FAGA 4FPOB 5G04L 2UY8A 5LBFA 4LK7A 5HV4A 3IDBB 4MXWA 5FXXA 2OKXA 3SMHA 1DFQA 2R073 2HEVF 1TVGA 3PLQA 1XRUA 2R6QA 1O4TA 2CL2A 4GWMA 5DZFA 1Z7S3 1KXGA 2OPKA 2WFF3 4R4XA 5CYYA 4XFIA 1ZYBA 4IEXA 3W21A 2WS91 3RG0A 3VBFC 3B9IA 4PDWB 4A41A 4MUVA 1VBE3 4P9LA 1YQ8A 5A1FA 5CFDC 1NOVA 1QHDA 1K5MB 2R041 3IAQA 3ZXAC 3CJIC 3TNQA 2E51A 2ZGPA 1GZWA 2Y6HA 1AYN2 3NNFA 1H2KA 1TG7A 4FQZA 5K9YA 1V6LA 5FUNA 2XUEA 2B5HA 1MZ5A 1H0BA 3JBG3 5A33B 4CU7A 4H7LA 1LCLA 3POGA 5DUWA 2XUMA 4XMAA 5FP4A 5IK7A 2YGLA 1H2LA 4NPLA 2VCMA 1W6MB 4MGKE 4QHBA 4GKXA 4BOWA 5T5JA 3L9JT 4D6QA 2RS51 2VZRA 3VDDA 1DBNA 4BISA 2UY9A 2EVXA 3ZOIA 1US2A 5A70A 3ZYJB 4AZZA 5FOBB 1YUDA 4W8JA 2C6SA 4XBQA 2WZEA 4Q4V1 1PZ9A 1OA3A 3WW2A 1OLRA 4HN1A 4BB3A 4M4RA 4CA9A 3P3NA 4GWNA 3WW4A 4F83A 1UMHA 4WVZA 2QJVA 4QX1A 4NAOA 2D6NA 2B8MA 4YW2A 5FLHA 2UYAA 5JXJA 4N90A 5FYUA 4COZA 3LOIA 3NKGA 3H3UA 1OPOA 2DU0A 2WC2A 2ZX3A 2LW8A 4OUSA 4YVWC 4AVAA 4ASMB 2Y38A 2Z42A 1W90A 1W9WA 3WDXA 3ZFGA 4YVSA 2KR2A 4I0WB 1EUTA 3TEXA 4NMIA 3U37A 3IAPA 3U78A 1Q3EA 1HB2A 4MYEA 3ENRA 3QH7A 4HOOA 2Y33A 3FFQA 3WNOA 1I5ZA 3B00A 4O65A 1QU0A 4X8PA 1W6OB 3QLQA 4PHZA 4Q4X2 1VRH2 4NWWA 3PDQA 1LGCA 2LUWA 1VMJA 5J7MA 4V2VA 2GMEA 1RL3A 2TBVA 4KG8A 1AR71 4JDMA 4PI0A 2OT7A 3K3OA 2PHWA 4RS5B 3ROUA 4FI9A 2YYOA 3G7DA 4GB32 4N43B 4P9XA 3AKQA 4UW6A 5LBCA 3TN92 1RUG1 4JGYA 1DP0A 5FJKA 3CBNA 3OEBA 5K4LA 1F5JA 1BYHA 4C91A 2DTYA 2JXAA 2VQUA 5F9TA 3FLPA 3ZN6B 4CDQA 1YFUA 3AMHA 2HKXA 5CB7A 3SH3A 1QIQA 4Y33A 5FUIA 1JOPA 4BYYA 3B5LB 2WS92 3Q8BA 4CYDA 5JSRA 1W8HA 1SLCA 3I2FA 4LORA 4ZXKA 3DYOA 2R042 2X5IA 1ND3B 3H7JA 1UYXA 4PLOA 4XILA 2XMLA 3GZTB 3OD4A 3WF1A 1NA1A 5GZFA 3NNGA 2A3XA 4FQ4A 3N9LA 2HBUA 3RYRA 3PVOA 2HWF1 2JICA 1PVXA 3WXPA 4LHNA 2YROA 2CV6A 4XE9A 1Y43B 4NHXA 4FPYA 3WG4A 5F6KA 3KB5A 2JB8A 4OZXA 1GQGA 3N9OA 3RMXA 1QOSA 1DCSA 2RS52 3LSEA 4LO7A 4CCJA 2LM3A 5KHIA 4OMDA 5FMOL 2JG9C 1BKZA 1O59A 1OOPB 1CAUB 4PLNA 2IVIB 1MS3A 1UZVA 5F3CA 2X05A 1VBB1 2JKBA 3JXSA 4Q4V2 3WZ1A 2AUYA 1UY3A 1W9FA 1RUI1 4MADA 2PELA 5C4WC 5A7OA 2DWRA 1UOBA 1JOBA 2IFWA 2WJSA 4QWNA 3VZMA 4XXAA 1LU2A 3PIJA 3WDVA 1CONA 2EXJA 1AL21 2XH6A 5F1RA 1O8SA 1VBA1 2ZEWA 3USUA 5CFCC 4QPGB 3CQOA 3NNMA 4BE3A 1LU1A 2HWB1 1AUYA 2BUKA 4X6QB 5IAXA 4U36A 3SEEA 4SBVA 3GALA 4RYDA 1POV3 1UCXA 1GLHA 1LB2A 2V5DA 3ACFA 3AMPA 3OPTA 4FPCA 4HXCA 2UWCA 3ZM8A 3GZEA 4LEJA 3VBRB 3H8XA 3SQOA 4BM8A 2D97A 5C3PA 2ZPXA 3GGLA 1S0JA 4JTNA 2Y6FA 4ZY9A 1N3OA 3KVBA 4V2WA 4PBOA 4BDVB 1H4HA 1UWWA 1OUSA 1LESA 3D6EA 5FRAA 5LEJA 4QB1A 1G9BA 2EIBA 4KQ7A 5J96B 1AR72 5EZWA 1YQ6A 1AYM3 2VOTA 2YV8A 4QX3A 3RZHA 4D7YA 5FP3A 1RUG2 5LWBA 3SISA 5A7NA 3NAPC 3N7KA 4XF3A 5JDBA 5FYMA 5I8YA 3ZXEA 3ON7A 4CXYA 4Y22B 3WQBA 1I3HA 2IXHA 5JAXA 3M3CA 3ZXKA 1S0DA 3AFGA 4AK3A 4B7KA 1DDLA 3V0BB 1HX6A 3AJZA 2FCTA 2WRAA 2WNVA 2QQKA 4IEQA 5FKBA 2KD7A 1W6PB 2WO3A 1XE8A 4MZUA 2BWAA 2E26A 3MIGA 3RYPA 4A45A 2RJLA 3VBHC 5IT6A 4BPZA 4M3CB 2GALA 1BMV1 2P3YA 2WINB 4AI1A 2XJRA 5C9AB 4GZ9A 1S0GA 1BEV3 4KBBA 3POYA 4PLMA 5C8CB 3M3EA 1O5LA 4KI5M 4R8HA 3DN7A 1FATA 1PIV3 1RUC3 1W8FA 3RPQA 1JZ7A 2HWF2 4QHOA 3ZYRA 1ZM1A 2VQ0A 2P6HA 3QD6A 4Z2WA 2W1SA 5E1RA 5L36A 5EJZB 4DY3A 1HLCA 3B69A 1W8UA 3O12A 4MOAA 4DXRA 3K4AA 3IDCB 4AFMA 2R16A 4C90A 4PJYA 1W03A 2K0GA 3KCCA 3UKTA 2VOXA 4GMP3 1S1AA 3ZFFB 1CAWB 3IPVB 3WHTA 1CESA 4JGZC 3RWNA 1VBB2 3LFMA 4Y1YA 3WG2A 3O1UA 1XYNA 1RUI2 5FZKA 3TEYA 2VUCA 4FVVA 4Y4RA 3IT8A 2Y60A 3CLPA 2JDNA 1NY71 5FAXA 5FYHA 1AL22 4E8CA 5EXOA 4ORFA 4YZ1A 3ZX7A 2GNBA 1GNHA 3WDUA 3S57A 3D5OA 4WV8A 2WLPA 2HWB2 2PAMA 5H9QA 5FY1A 2ZS6B 5JOXA 3J7HA 1PK6C 4UBHA 3TAYA 5HI0A 3OYWB 4N53B 5CG9A 3W9AA 1OA4A 2ZGOA 4XFBA 4INDA 3KV9A 4DY5A 5FP7A 1D0GA 2A3YA 1OUXA 4AVTA 3BKZA 1FMD1 1K45A 1AYN3 1X8EA 1ZZ9A 4MGYE 5FXZA 1ZNPA 4EJRA 1L7QA 3RZGA 3K48A 2QVSB 3OGGA 3GZAA 3BYWA 4OCTA 3ZIWA 1J59A 1C5HA 3PUIA 4PQQA 2VTFA 3AZYA 3PVNA 2ZGQA 3ZXFA 1CZSA 2WWJA 4FBFA 1QJFA 1FI2A 2FMDA 1UY0A 1QJEA 2A6ZA 1EP0A 3D0JA 5LA9A 3T2TA 3GM8A 3DCQA 5DG1A 2V09A 3UL2A 5GZGA 1J1TA 1RUH1 3F95A 2ZHMA 1S55A 1W0OA 1JW6A 4QHZA 2X09A 2VTXJ 5LK7B 2VZOA 2SLIA 2X8KA 4GA9A 1HRV3 2VJXA 2DFBA 4D94A 1DLCA 2YB7A 1EPZA 4P9YA 5D1IA 4BQ3A 1W6QA 4OZOA 1R091 5GZCA 1HXS1 3IMMA 4KGGA 2CY6A 2W95A 3I2KA 4Y5TA 3MBWA 4UFJA 1LOEA 2LS6A 3N3HA 3N7LA 3VKNA 3GBWA 4UAPA 5A32B 5LASA 1K5MA 1PGSA 3FBYA 1BMV2 4B3NA 1S0FA 1UPSA 4XABA 2A6VA 3E6CC 3MW4A 4AYUA 1W6NB 5DQ0A 2XWBB 4PBPA 4SLIA 1PO11 4XF0A 1IPSA 3BPZA 3T2OA 3O1TA 1D2SA 1MQTA 2PHDA 2DCJA 2QZ3A 3C7GA 1CN1A 5EWSA 4LLFA 5HXVA 4CUAA 3NJXA 3VDCA 1W6MA 1XE7A 3K75B 1LHOA 2VOWA 2WT2A 3DUIA 4XDPA 1YXWA 1FPN2 4Q4X3 1HB4A 1VRH3 3GCWA 4MXWB 4Q4Y1 1R081 4L2NA 4HETA 4PT6A 4M3CE 4UF0A 1H2NA 4HK8A 4AF9A 5JIAA 3DEMA 1HIXA 2BW8A 4GB33 2YBKA 5ANQA 3TN93 2GMPA 1COV1 2B9UA 1F4AA 2C24A 2J1VA 4IEZA 5KBFA 3ACGA 5J3UA 1IS6A 1R1A1 4AEDA 1UKGA 1NY72 3UK9A 4LIUA 2PHLA 3CZUA 1ZBE1 2XLFA 3Q9OA 4FFFA 3UGGA 1OF3A 2RDQA 2RMU1 1OLMA 4BHPA 3KQ4B 4Q0VA 1CJDA 2WA3A 4RA0A 4LULA 3SITA 4GULA 2WS93 1ZA7A 2A70A 5ACA1 2BYVE 4I2OA 1POV0 2VUJA 2J1RA 4UFHA 2HBTA 3H3LA 4CXWA 2R043 2XKPA 2D3RA 4AI8A 3ZXLA 1MPXA 1VBD1 3IBMA 4GIQA 3U10A 3B9CA 1FMD2 1ZZ6A 2ZAAA 4PF1A 1HB3A 3VDDB 4ZPIA 1WUVA 2BV4A 1W6OA 4CUGA 3VLBB 4QM9A 2Y34A 5IVBA 1ZREA 3VKOA 1F35A 1LENA 2LALA 1WLDA 5DMYA 2DF7A 1XNCA 2MPFA 3LDKA 2GP5A 2ARCA 2FZ1A 3K51A 3T0AA 3U4SA 4FTBA 1H8TA 2YXSA 1DZQA 2WYFA 2DURA 4YARA 2W0XA 1XC6A 3I3EA 2RS53 1DZRA 2BFUS 3MPPG 3ZN5A 1RUH2 1NXMA 5SV8A 5FWJA 4CDWA 2HWD1 1HN0A 3B01A 4WM7C 5FTTC 2E32A 3E1F1 5EYXA 2VXRA 2FQPA 4Q4V3 5F5QA 1YCIA 3SEPA 2GP3A 5I0UA 1PMHX 3HMYA 1R092 3PJQA 2YHJA 1KS4A 2LROA 4K9SA 1EPWA 2H6BA 3RI9A 1MS4A 1SLLA 1XQNA 3ZFGB 4YVSB 4QB2A 5DABA 3PUAA 1URXA 3ILFA 5I0RA 2IWGB 1ZBA2 5FO9B 1NZIA 3H1WA 1X50A 4YNIA 2ZZJA 2QQPA 3MGUA 1EAH1 1QOOA 1NT0A 1RVF1 5FZCA 1C8M1 3GJAA 1PO12 1NQJA 5LY1A 5F5CA 5FPUA 4KNCA 1W2OA 2ORXA 4E4HA 1V6MA 3OPWA 4JGYB 4N9HA 1W2UA 2YPDA 1GQPA 3A0NA 1ALYA 2A3WA 3I3DA 3K77A 1SFYA 2ARAA 4FOVA 3M3IA 2WAOA 3EHKA 3WV6A 4PI2A 3POFA 4Q4Y2 1R082 1WMFA 4XQ4A 2VNGA 1O7FA 1JU4A 3C7HA 4CDQB 2CU5A 2VAUA 4L0PA 1OI6A 5IJRA 1AR73 4A44A 2IXIA 1ZRCA 4E4ZA 4MH0E 3AL6A 3J7NA 3SKVA 1W9TA 2ETEA 1JYVA 1NCQA 1RUG3 1UMZA 3KT7A 1COV2 1QXRA 4GD4A 2NN8A 3AFKA 3HJRA 1UU6A 4HN0A 4IERA 1UY1A 4E27A 4ZS2A 1PM4A 2X5IB 4XJ8A 1GOHA 2W68A 3ZXJA 1IHMA 1ZBE2 3WQ7A 5F7UA 5DAWA 2WZPP 1XSQA 2RMU2 4IV1B 4AI9A 3RQ0A 1NA1B 5B4XA 3PMSA 2OZJA 1SDDB 1MS0A 5IFTA 5LY2A 1N1VA 5HXMA 1V6OA 2CSGA 2WO7A 3L2HA 5FZ0A 5ACA2 1IKPA 2ZBJA 3E5XA 5BNPC 3ZSJA 2UWBA 3VBSC
chains in the Genus database with same CATH topology
2ZEXA 1PX4A 3PUHA 3MO4A 4M4PA 3CMGA 2VMEA 2BGOA 5G04L 1SHWB 3P1IA 2OKXA 3WNNA 1TVGA 4JKLA 2Z4FA 3LEGA 5CYYA 1HN1A 3P6BA 4BK5A 4A41A 2HLEA 3LPFA 4GWJA 4W4ZA 2BERA 4A6OA 2ID4A 3IAQA 1OT5A 3OBAA 3DECA 3I2GA 3NJVA 2BZDA 2Y6HA 3WEZA 3VDBA 5J1XA 1TG7A 4HG6B 3ETPA 2WYSA 1ULPA 2JKXA 2W94A 4CU7A 2L9LA 4BXSV 2WO2A 2W1WA 2XONA 1JU3A 1UXXX 2Y6LA 3NQHA 2VZRA 3NRUA 4XURA 1JYWA 3F2ZA 1US2A 2JD9A 3I2HA 4W8JA 4ZZ8A 2WZEA 1UY4A 2VZTA 2XOMA 3WSOA 5LA1A 5I0DA 4M4RA 3OB8A 4QAWA 4XUOA 2W5FA 2HYXA 1UMHA 1K12A 4QX1A 1T2XA 5JXJA 2E33A 1NUKA 2J1UA 3K4DA 3MV11 1GMMA 2W91A 3W5NA 3EB7A 2LW8A 3OGVA 1W9WA 1EUTA 2WUHA 3U37A 3IAPA 5C7GA 3W5MA 4LHSA 3WNOA 1BHGA 4DUVA 3VD3A 1DYOA 3DYMA 4XVHA 3T08A 5LA2A 1GU3A 4BK4A 4FI9A 2VMDA 4TTGA 1DP0A 1W0NA 1JYXA 4DUWA 3OEBA 2VQUA 5A1AA 5LA0A 2EIDA 1CX1A 2VZVA 5C71A 2YC2A 3FHQA 2J1AA 1H6XA 1KGYA 3ABZA 5FUIA 3WF3A 1K3IA 3ACIA 3A23A 3IB3A 3I2FA 3DYOA 3A7QA 1UYXA 1SG3A 2J1TA 3WF1A 3NNGA 1XNTA 4A3ZA 1OF4A 3GDBA 3WF2A 3OGSA 2YC4A 2WQ8A 3T2QA 2VR4A 4P08A 4OMDA 1O59A 3ACHA 2VZPA 2WN2A 2CDPA 1IQDC 4XZUG 2X05A 4JKKA 3JXSA 2VZ1A 5EJ1B 2XHNA 1UY3A 4MADA 2ZXQA 3CDZB 2VMCA 1O8SA 2ZEWA 3CQOA 1UX7A 2VL4A 5B4NA 3HEIA 2W3JA 3SEEA 4RYDA 4P00B 3IDAA 3VDAA 2WO1A 5HPOA 3OG2A 2V5DA 3ACFA 3ZM8A 4QX2A 5IYYA 4JHZA 1PMJX 3VD7A 3GGLA 1PX3A 1ULOA 4ZY9A 1O8PA 1WCQA 4BDVB 1OD3A 1UWWA 4D8MA 4CU6A 4QB1A 2EIBA 3HNMA 2VOTA 4QX3A 4A4AA 1CZTA 3HNYM 4MGSA 4ET7A 4P5YA 2CDOA 4P02B 3WQBA 3THCA 2VZSA 3UETA 2QQKA 2KD7A 2WO3A 3T0BA 2E26A 5JXGA 2VCAA 4A45A 2DCKA 1NAEA 4XUQA 4GZ9A 2EIEA 2Y64A 4KI5M 4W50A 2B9VA 2VMFA 3LQCA 2VZQA 1JZ7A 4BJ0A 2W1SA 4XUPA 5EJZB 3LEIA 2Y6KA 4AG4A 4MOAA 4DXRA 4KMQA 2J1SA 3K4AA 2JDAA 1JZ6A 3VD4A 2Y8KA 1GOFA 2WBKA 5EIYB 2VM9A 4QDRA 3HPNA 3T0DA 3WNPA 2V4VA 4QDQA 4QPWA 4Z2AA 3K46A 4E8CA 2QQMA 1GNYA 2ZEYA 3CIHA 5CZKA 3MUY1 2VZ3A 3J7HA 1XNAA 4A42A 1R64A 2YG0A 1CIYA 4ZXEA 3GXUA 4AAXA 4DXSA 1K45A 2WAAA 3AC0A 1L7QA 5JR2A 3PUIA 4PQQA 1KEXA 1UY2A 2VTFA 2ORZA 2YFZA 1CZSA 1JZ4A 2WZ8A 1JHJA 3VD9A 1UY0A 4MGQA 3CZJA 3GM8A 1YQ2A 4DUXA 2VZUA 2X09A 4LKSA 2VZOA 2VJXA 2WABA 2RJ2A 4LQRA 1DLCA 2C4XA 2YB7A 2QQNA 3T09A 1US3A 4QDSA 4OZOA 3LPGA 3ECQA 4UI9L 3THDA 2W95A 3I2KA 3MBWA 2RVAA 4CVUA 2BGPA 2LS6A 2W92A 3C7FA 4UAPA 2B4KA 1W8OA 2WN3A 2Y6GA 1CZVA 3IIIA 3C7EA 1JZ2A 5DQ0A 2VQTA 2QQLA 2DDUA 1GUIA 2QQOA 2W1QA 3T2OA 5JMOA 3C7GA 1GOGA 2DCJA 2XQXA 4RN5A 3UNPA 2W1UA 3FHAA 4CUAA 3LE0A 3NJXA 3VDCA 2YFUA 3VD5A 3K75B 3I3BA 4PT6A 4QB6A 1W9SA 1OH4A 4JX0A 2QBXA 1JZ5A 4ZZ5A 1F4AA 3I2IA 2J1VA 2QQJA 3ACGA 1J84A 2Y6JA 5JXIA 4DXTA 5DN2A 3CZUA 2X10A 1OF3A 2RV9A 3OEAA 4MO3M 2R7EB 4ARYA 1EUUA 5DPNA 4OMCA 2JE8A 4DEVA 1NKGA 2W47A 2J1RA 1J83A 3LEKA 1MPXA 2C26A 4XUNA 4PF1A 2QQIA 2BBAA 3C8XA 5DMYA 2C9KA 3WNKA 1JZ8A 4DEQA 4TXWA 5IFPA 3FN9A 5C70A 3T0AA 3A22A 1LNSA 3A21A 3I3EA 1XC6A 1UZ0A 4JKMA 4D0QA 1P8JA 3FL7A 3I97A 3MV01 2J7MA 1L7RA 4GWIA 1UXZA 2E32A 5IHRA 5JXHA 2VCBA 2EICA 3E1F1 3OGRA 3UESA 4E8DA 4OYUA 3WNLA 3SEPA 3DYPA 3WF0A 1PMHX 2W46A 2E31A 5LCWL 1JI6A 3HN3A 4QB2A 2W87A 1K42A 4UOJA 1JYNA 3I2JA 4CU9A 1I5PA 4CUCA 3EYPA 3MUZ1 4ARXA 3WF4A 4OUEA 4YPJA 3HNBM 2J22A 3D3AA 3HOBA 2ORXA 2W9XA 1W99A 2ZEZA 2VC9A 4LPLA 2WDBA 1GQPA 3I3DA 3K77A 2WAOA 3BN6A 4KWUA 1H6YA 1NX9A 1JU4A 3C7HA 5JUVA 4L0PA 5IJRA 4A44A 1W8NA 2J1EA 4XUTA 1UYZA 2VCCA 3WNMA 3SKVA 1WKYA 1W9TA 1JZ3A 1JYVA 4IUGA 4QX0A 1UMIA 3HJRA 3SKJE 3CKHA 1UY1A 3BGAA 3C7OA 1GOHA 5F7UA 1D7PM 1F4HA 1XPWA 1UYYA 3T2PA 2VO5A 5B4XA 4CUBA 1RYYA 1SDDB 2PQSA 5IFTA 2V72A 5G05L 5HXMA 4CU8A 3K4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEX A;  1PX4 A;  3PUH A;  3MO4 A;  4M4P A;  3CMG A;  2VME A;  2BGO A;  5G04 L;  1SHW B;  3P1I A;  2OKX A;  3WNN A;  1TVG A;  4JKL A;  2Z4F A;  3LEG A;  5CYY A;  1HN1 A;  3P6B A;  4BK5 A;  4A41 A;  2HLE A;  3LPF A;  4GWJ A;  4W4Z A;  2BER A;  4A6O A;  2ID4 A;  3IAQ A;  1OT5 A;  3OBA A;  3DEC A;  3I2G A;  3NJV A;  2BZD A;  2Y6H A;  3WEZ A;  3VDB A;  5J1X A;  1TG7 A;  4HG6 B;  3ETP A;  2WYS A;  1ULP A;  2JKX A;  2W94 A;  4CU7 A;  2L9L A;  4BXS V;  2WO2 A;  2W1W A;  2XON A;  1JU3 A;  1UXX X;  2Y6L A;  3NQH A;  2VZR A;  3NRU A;  4XUR A;  1JYW A;  3F2Z A;  1US2 A;  2JD9 A;  3I2H A;  4W8J A;  4ZZ8 A;  2WZE A;  1UY4 A;  2VZT A;  2XOM A;  3WSO A;  5LA1 A;  5I0D A;  4M4R A;  3OB8 A;  4QAW A;  4XUO A;  2W5F A;  2HYX A;  1UMH A;  1K12 A;  4QX1 A;  1T2X A;  5JXJ A;  2E33 A;  1NUK A;  2J1U A;  3K4D A;  3MV1 1;  1GMM A;  2W91 A;  3W5N A;  3EB7 A;  2LW8 A;  3OGV A;  1W9W A;  1EUT A;  2WUH A;  3U37 A;  3IAP A;  5C7G A;  3W5M A;  4LHS A;  3WNO A;  1BHG A;  4DUV A;  3VD3 A;  1DYO A;  3DYM A;  4XVH A;  3T08 A;  5LA2 A;  1GU3 A;  4BK4 A;  4FI9 A;  2VMD A;  4TTG A;  1DP0 A;  1W0N A;  1JYX A;  4DUW A;  3OEB A;  2VQU A;  5A1A A;  5LA0 A;  2EID A;  1CX1 A;  2VZV A;  5C71 A;  2YC2 A;  3FHQ A;  2J1A A;  1H6X A;  1KGY A;  3ABZ A;  5FUI A;  3WF3 A;  1K3I A;  3ACI A;  3A23 A;  3IB3 A;  3I2F A;  3DYO A;  3A7Q A;  1UYX A;  1SG3 A;  2J1T A;  3WF1 A;  3NNG A;  1XNT A;  4A3Z A;  1OF4 A;  3GDB A;  3WF2 A;  3OGS A;  2YC4 A;  2WQ8 A;  3T2Q A;  2VR4 A;  4P08 A;  4OMD A;  1O59 A;  3ACH A;  2VZP A;  2WN2 A;  2CDP A;  1IQD C;  4XZU G;  2X05 A;  4JKK A;  3JXS A;  2VZ1 A;  5EJ1 B;  2XHN A;  1UY3 A;  4MAD A;  2ZXQ A;  3CDZ B;  2VMC A;  1O8S A;  2ZEW A;  3CQO A;  1UX7 A;  2VL4 A;  5B4N A;  3HEI A;  2W3J A;  3SEE A;  4RYD A;  4P00 B;  3IDA A;  3VDA A;  2WO1 A;  5HPO A;  3OG2 A;  2V5D A;  3ACF A;  3ZM8 A;  4QX2 A;  5IYY A;  4JHZ A;  1PMJ X;  3VD7 A;  3GGL A;  1PX3 A;  1ULO A;  4ZY9 A;  1O8P A;  1WCQ A;  4BDV B;  1OD3 A;  1UWW A;  4D8M A;  4CU6 A;  4QB1 A;  2EIB A;  3HNM A;  2VOT A;  4QX3 A;  4A4A A;  1CZT A;  3HNY M;  4MGS A;  4ET7 A;  4P5Y A;  2CDO A;  4P02 B;  3WQB A;  3THC A;  2VZS A;  3UET A;  2QQK A;  2KD7 A;  2WO3 A;  3T0B A;  2E26 A;  5JXG A;  2VCA A;  4A45 A;  2DCK A;  1NAE A;  4XUQ A;  4GZ9 A;  2EIE A;  2Y64 A;  4KI5 M;  4W50 A;  2B9V A;  2VMF A;  3LQC A;  2VZQ A;  1JZ7 A;  4BJ0 A;  2W1S A;  4XUP A;  5EJZ B;  3LEI A;  2Y6K A;  4AG4 A;  4MOA A;  4DXR A;  4KMQ A;  2J1S A;  3K4A A;  2JDA A;  1JZ6 A;  3VD4 A;  2Y8K A;  1GOF A;  2WBK A;  5EIY B;  2VM9 A;  4QDR A;  3HPN A;  3T0D A;  3WNP A;  2V4V A;  4QDQ A;  4QPW A;  4Z2A A;  3K46 A;  4E8C A;  2QQM A;  1GNY A;  2ZEY A;  3CIH A;  5CZK A;  3MUY 1;  2VZ3 A;  3J7H A;  1XNA A;  4A42 A;  1R64 A;  2YG0 A;  1CIY A;  4ZXE A;  3GXU A;  4AAX A;  4DXS A;  1K45 A;  2WAA A;  3AC0 A;  1L7Q A;  5JR2 A;  3PUI A;  4PQQ A;  1KEX A;  1UY2 A;  2VTF A;  2ORZ A;  2YFZ A;  1CZS A;  1JZ4 A;  2WZ8 A;  1JHJ A;  3VD9 A;  1UY0 A;  4MGQ A;  3CZJ A;  3GM8 A;  1YQ2 A;  4DUX A;  2VZU A;  2X09 A;  4LKS A;  2VZO A;  2VJX A;  2WAB A;  2RJ2 A;  4LQR A;  1DLC A;  2C4X A;  2YB7 A;  2QQN A;  3T09 A;  1US3 A;  4QDS A;  4OZO A;  3LPG A;  3ECQ A;  4UI9 L;  3THD A;  2W95 A;  3I2K A;  3MBW A;  2RVA A;  4CVU A;  2BGP A;  2LS6 A;  2W92 A;  3C7F A;  4UAP A;  2B4K A;  1W8O A;  2WN3 A;  2Y6G A;  1CZV A;  3III A;  3C7E A;  1JZ2 A;  5DQ0 A;  2VQT A;  2QQL A;  2DDU A;  1GUI A;  2QQO A;  2W1Q A;  3T2O A;  5JMO A;  3C7G A;  1GOG A;  2DCJ A;  2XQX A;  4RN5 A;  3UNP A;  2W1U A;  3FHA A;  4CUA A;  3LE0 A;  3NJX A;  3VDC A;  2YFU A;  3VD5 A;  3K75 B;  3I3B A;  4PT6 A;  4QB6 A;  1W9S A;  1OH4 A;  4JX0 A;  2QBX A;  1JZ5 A;  4ZZ5 A;  1F4A A;  3I2I A;  2J1V A;  2QQJ A;  3ACG A;  1J84 A;  2Y6J A;  5JXI A;  4DXT A;  5DN2 A;  3CZU A;  2X10 A;  1OF3 A;  2RV9 A;  3OEA A;  4MO3 M;  2R7E B;  4ARY A;  1EUU A;  5DPN A;  4OMC A;  2JE8 A;  4DEV A;  1NKG A;  2W47 A;  2J1R A;  1J83 A;  3LEK A;  1MPX A;  2C26 A;  4XUN A;  4PF1 A;  2QQI A;  2BBA A;  3C8X A;  5DMY A;  2C9K A;  3WNK A;  1JZ8 A;  4DEQ A;  4TXW A;  5IFP A;  3FN9 A;  5C70 A;  3T0A A;  3A22 A;  1LNS A;  3A21 A;  3I3E A;  1XC6 A;  1UZ0 A;  4JKM A;  4D0Q A;  1P8J A;  3FL7 A;  3I97 A;  3MV0 1;  2J7M A;  1L7R A;  4GWI A;  1UXZ A;  2E32 A;  5IHR A;  5JXH A;  2VCB A;  2EIC A;  3E1F 1;  3OGR A;  3UES A;  4E8D A;  4OYU A;  3WNL A;  3SEP A;  3DYP A;  3WF0 A;  1PMH X;  2W46 A;  2E31 A;  5LCW L;  1JI6 A;  3HN3 A;  4QB2 A;  2W87 A;  1K42 A;  4UOJ A;  1JYN A;  3I2J A;  4CU9 A;  1I5P A;  4CUC A;  3EYP A;  3MUZ 1;  4ARX A;  3WF4 A;  4OUE A;  4YPJ A;  3HNB M;  2J22 A;  3D3A A;  3HOB A;  2ORX A;  2W9X A;  1W99 A;  2ZEZ A;  2VC9 A;  4LPL A;  2WDB A;  1GQP A;  3I3D A;  3K77 A;  2WAO A;  3BN6 A;  4KWU A;  1H6Y A;  1NX9 A;  1JU4 A;  3C7H A;  5JUV A;  4L0P A;  5IJR A;  4A44 A;  1W8N A;  2J1E A;  4XUT A;  1UYZ A;  2VCC A;  3WNM A;  3SKV A;  1WKY A;  1W9T A;  1JZ3 A;  1JYV A;  4IUG A;  4QX0 A;  1UMI A;  3HJR A;  3SKJ E;  3CKH A;  1UY1 A;  3BGA A;  3C7O A;  1GOH A;  5F7U A;  1D7P M;  1F4H A;  1XPW A;  1UYY A;  3T2P A;  2VO5 A;  5B4X A;  4CUB A;  1RYY A;  1SDD B;  2PQS A;  5IFT A;  2V72 A;  5G05 L;  5HXM A;  4CU8 A;  3K4Z A; 
#chains in the Genus database with same CATH topology
 2ZEX A;  3AP9 A;  1VBD 2;  3CMG A;  3QOP A;  1BXH A;  3ZMN A;  2BGO A;  1HV1 A;  4QKB A;  5DAX A;  4ASL A;  1SDW A;  4IV3 A;  1SHW B;  1YEW A;  2HWF 3;  2ZMN A;  4RS5 C;  3P1I A;  3PU8 A;  4IGP A;  3WNN A;  5FYY A;  3B94 A;  4R52 A;  2ARX A;  3DPR C;  4JKL A;  5GLZ A;  4E2G A;  1SQ4 A;  2IZW A;  3JB4 C;  4F8A A;  1VAM A;  2Z4F A;  3VHO A;  5FYV A;  5JZG A;  2FDH A;  1HDK A;  1YIF A;  5GZD A;  1LHV A;  2BVB A;  3FWE A;  2HLE A;  3SNM A;  2HWD 2;  3B7M A;  4QMA A;  2BER A;  4A6O A;  2ID4 A;  4AFB A;  2Q8O A;  4NRO A;  4KWL A;  1VBB 3;  4F7Z A;  1OT5 A;  3RZJ A;  1XND A;  1ZZ7 A;  2R1B A;  3DEC A;  5TSW A;  3I2G A;  4PIX A;  1RUI 3;  3NJV A;  2BZD A;  3WEZ A;  3V0B A;  1MS1 A;  1OQE A;  5JCT A;  4HG6 B;  1F9K A;  1TEI A;  2XBO 1;  1FV3 A;  1DYP A;  1XBF A;  3ETP A;  3NV4 A;  1AL2 3;  4LUK A;  3X29 B;  1NLQ A;  1VBA 3;  2W94 A;  3CU7 A;  3KHC A;  2NP0 A;  4MGT A;  1ND3 C;  1SBD A;  4AGG A;  1PGL 1;  1PNG A;  4G9S B;  2WO2 A;  4LA2 A;  2HWB 3;  4P9J A;  1VE0 A;  2W1W A;  4OHV A;  2VEC A;  3PHM A;  4IDZ A;  1VMH A;  1WD3 A;  1UXX X;  2JDP A;  3O0W A;  4ERO A;  1RVF 2;  1C8M 2;  5FLJ A;  3UGF A;  3NRU A;  3J7L A;  4LBK A;  4XUR A;  5D8A A;  5I8S A;  3F2Z A;  5J36 A;  2JD9 A;  2A6Y A;  2O0O A;  3I2H A;  2GAU A;  1NYW A;  1E5H A;  1MS8 A;  4XTM A;  4YZ4 A;  3BPS A;  4EZH A;  1UY4 A;  2IVJ A;  2VZT A;  4KWK A;  3WSO A;  2ZZQ A;  3VGI A;  5T50 A;  3S5A A;  5LA1 A;  5F6L B;  3OB8 A;  1RUO A;  1FNZ A;  3M8L A;  2E63 A;  4XUO A;  5BNO A;  5K0U C;  1A34 A;  3IPV A;  2P2K A;  4DMI A;  4W65 A;  1W9Y A;  3CJX A;  3K2O A;  1CX4 A;  4LTA A;  1T2X A;  2YGM A;  5FY9 A;  4G4F A;  4A7Y A;  1DQ1 A;  4CCE A;  2J1U A;  4N7U A;  1ODM A;  2Y26 A;  2A75 A;  1G9A A;  2W91 A;  3W5N A;  1W2A X;  3EXU A;  2JDY A;  4YWA A;  5BNN B;  3OBT A;  2JDH A;  5FY7 A;  3K3N A;  2YDE A;  3DGT A;  5C7G A;  4LUM A;  1XB9 A;  4GQ7 A;  3HR9 A;  4HVR A;  2WZR 2;  1BHG A;  3KLS A;  4E9K A;  3BU0 A;  3OYW A;  3OUH A;  4S2G A;  4XFA A;  2D44 A;  4ATF A;  5FPB A;  5M0T A;  2XB6 C;  2VW2 A;  5FJH A;  2XVK A;  4YGD A;  4I02 A;  1Q8Q A;  1UU4 A;  3VBR C;  4CDX A;  3KZ4 C;  4YSF A;  5J09 A;  2WSV A;  3DYM A;  3MIH A;  1VBC 2;  1BBT 1;  2OUJ A;  1GU3 A;  4Q0Q A;  4BK4 A;  4Z07 A;  2EAK A;  4AHZ A;  2A71 A;  2PAE A;  1RXG A;  1OQ1 A;  4ISQ A;  5FLI A;  1JYX A;  5DG2 A;  5C3O A;  1H4G A;  4UBG A;  5CFD A;  2GND A;  4P9I A;  3IZO A;  1CJP A;  4XJZ A;  1WZX A;  2F17 A;  5LA0 A;  5JI9 A;  1GIC A;  2D43 A;  4FFG A;  1B35 C;  1WLC A;  5C71 A;  2YC2 A;  4C0B A;  5L9R A;  5LBB A;  4FXK B;  5EQU A;  3E97 A;  1KGY A;  1YIP A;  2RDR A;  3WF3 A;  1K3I A;  3J7M A;  1A78 A;  5A3W A;  3S30 A;  3A23 A;  1CPN A;  3ZSK A;  5SV5 A;  4BLI A;  4HKL A;  4LIV A;  1IG0 A;  1OH3 A;  2A5Z A;  2BNM A;  3MW3 A;  5IVY A;  2J1T A;  4RFR B;  3WVJ A;  2F4L A;  2DU1 A;  4GAZ A;  5F3E A;  3V56 A;  1QXJ A;  2BWC A;  1XNT A;  1CAX B;  2XBO 2;  4C1W A;  3ATG A;  1SFP A;  5DZG A;  4NRM A;  1BLZ A;  2CAV A;  4GH4 C;  5A32 A;  4OLL A;  1UIK A;  5GLV A;  5C9A C;  3I2O A;  3LGR A;  3OGS A;  3WF2 A;  3WY6 A;  2YU2 A;  3TNP B;  4K1Y A;  5C8C C;  2WQ8 A;  3T2Q A;  2TUN A;  1W6N A;  5FWE A;  4P08 A;  4XW3 A;  4IEV A;  1CAV A;  1DHK B;  4RQP C;  5KHH A;  3WW1 A;  5IVF A;  4XEZ A;  4J1X A;  4XZP A;  4IXL A;  4YFW A;  1UL9 A;  4NN0 A;  1YFY A;  4DXZ A;  1RUN A;  2D6M A;  3WUD A;  1UPI A;  4O9E A;  4BWO A;  2CDP A;  1IQD C;  4JKK A;  3LA7 A;  1FMD 3;  4XBN A;  4OVE A;  4AL9 A;  4O61 A;  3AYC A;  3VHR A;  1Q43 A;  3ZFF C;  4FPE A;  4HSJ A;  2ARB A;  3CL1 A;  4AQS A;  3LWC A;  3LAG A;  4IE7 A;  4A7Z A;  1VRB A;  3O7O A;  2RS3 1;  1FAY A;  3A0K A;  3N9N A;  1UX7 A;  2DCZ A;  2VL4 A;  3KCX A;  1W6Q B;  2HWC 2;  4UXA A;  5B4N A;  1WW7 A;  1YC6 1;  3HEI A;  4TLF A;  3N9M A;  4H55 A;  3SCF A;  4D69 A;  1RUH 3;  1D0H A;  3ALQ A;  2GNM A;  4P00 B;  3VDA A;  5JSO A;  4OHY A;  5KC6 A;  5KC5 A;  4Q5O A;  3OG2 A;  5H9P A;  3O0X A;  4IE0 A;  2SBA A;  4MX3 A;  2G19 A;  4K1Z A;  3ZMO A;  3RFR A;  1I9R A;  5ANN A;  3OJB A;  4MHR A;  1PMJ X;  4FT8 A;  5IYY A;  3JB8 A;  4CEW C;  3AP7 A;  1J3R A;  5APA A;  1R09 3;  1TZO A;  1HXS 3;  1MVE A;  3ZR6 A;  3H8O A;  4N53 C;  1CPM A;  4WVM A;  1MAC A;  1SFN A;  1MQT B;  1WCQ A;  4FAH A;  3O1P A;  4FTS A;  1OD3 A;  4CU6 A;  1U5X A;  2CAU A;  5FV3 A;  2MEV 1;  3HNM A;  5FZ6 A;  4BME A;  1BBT 2;  1PMI A;  3ZFE C;  2RM2 1;  4QGM A;  5AFE A;  3LDB A;  1QH6 A;  5IK4 A;  3KT4 A;  3HNY M;  1AXK A;  4LBN A;  1PO1 3;  1Z0H A;  3QH6 A;  4UF0 B;  5FPA A;  5C3R A;  1OHF A;  2Q8E A;  4ET7 A;  4XMI A;  3KCY A;  4RGG A;  1FOD 1;  1VIW B;  3BOD A;  1JHN A;  1KJR A;  3N7M A;  2DUO A;  4M01 A;  3THC A;  4Y5S A;  4GXL A;  4AED B;  1LOB A;  4Q4Y 3;  1R08 3;  5T5L A;  4LOS A;  3FUO A;  1RUF 1;  1Y9G A;  2BNO A;  1OVS A;  5JXG A;  5IUQ A;  4LOT A;  2YY1 A;  4HMZ A;  2K46 A;  1COV 3;  2VOV A;  1W8Z A;  3CF6 E;  3H1Y A;  1UX6 A;  4QXC A;  4EWE A;  3BOW A;  1R1A 3;  3R4S A;  3J26 N;  2VZQ A;  2R06 1;  4XYX A;  4HON A;  4BJ0 A;  1ZBE 3;  3HIF A;  2QE3 A;  5FZH A;  4XUP A;  2RMU 3;  5CA6 A;  1U12 A;  1GZT A;  2PN5 A;  5C5T A;  4KMQ A;  1J58 A;  3GHN A;  4CEY A;  5F3I A;  1AVB A;  2JDA A;  3VHP A;  5ACA 3;  3VD4 A;  1GOF A;  5FYI A;  3AJY A;  1YYN A;  3NL1 A;  1H8T B;  3R0R A;  4TYS A;  1W3V A;  4LIT A;  2VM9 A;  3OBZ A;  4CZS A;  1VBD 3;  2O1Q A;  1GAN A;  2ZGT A;  4GAL A;  3RS6 A;  3U75 A;  3L2Y A;  1BVV A;  1PVC 1;  1QY4 A;  4QKD A;  3HPN A;  3VN4 A;  3LSD A;  5DAP A;  2ZGM A;  1V00 A;  4ISR A;  4CDW B;  3MZH A;  4JVA A;  3N9P A;  3WNP A;  2YBS A;  3S6P A;  2HJI A;  2VPV A;  4D6S A;  4JZR A;  2P5B A;  4Z2A A;  1A3K A;  2RS3 2;  3FC0 A;  2NZ9 A;  1HW5 A;  3T1L A;  3H3Z A;  2EXH A;  2XJT A;  5CZK A;  3CIH A;  2ARE A;  3POE A;  5E16 A;  2VZ3 A;  2VY0 A;  4L8Q A;  1IS3 A;  4Q2F A;  4AEM A;  2ADD A;  2WSU A;  1E57 A;  3GBG A;  1SLB A;  3WNX A;  3OD0 A;  1XNA A;  2HWD 3;  1AR9 1;  3AYD A;  1X8M A;  1GSL A;  2YG0 A;  3U4X A;  4DO0 A;  3GXU A;  4IV1 A;  2Q8C A;  1UYP A;  3H1M A;  2BNN A;  4FPK A;  5FMC A;  3JQW A;  3T3Y A;  1Y9Q A;  1KDK A;  4JDO A;  4ONU A;  3O14 A;  1JH5 A;  1OA2 A;  1UY2 A;  4RD7 A;  1U5Y A;  2ORZ A;  1DQ0 A;  1OKQ A;  2MEV 2;  4FTE A;  1I1E A;  1XSR A;  3VDD C;  1JZ4 A;  3HBK A;  2RM2 2;  5C3S A;  2ZGN A;  4MVT A;  4AVC A;  1EAH 3;  4MGQ A;  3WCS A;  4XHX A;  1RVF 3;  1UOF A;  4CP0 A;  1C8M 3;  4DQA A;  5A3P A;  4DS0 A;  2FBE A;  2VVE A;  1WA4 A;  4AAP A;  5IAV A;  3CO2 A;  2WAB A;  2RJ2 A;  1FOD 2;  1NCQ B;  3KS7 A;  4RR3 A;  2KXL A;  5GKA C;  4UYB A;  1US3 A;  4QDS A;  4FP2 A;  3LPG A;  3JZV A;  4LKE A;  2QQU A;  2Z79 A;  4UT5 A;  4XFF A;  1NE6 A;  4YM2 A;  1G9F A;  2XDV A;  1RUF 2;  2BGP A;  4Q26 A;  2BQP A;  1YQ5 A;  2W92 A;  4CVU A;  5ABJ C;  1SLA A;  2ZMK A;  5EV7 A;  4AXO A;  1W8O A;  2WNU A;  4NPR A;  4YW7 A;  5L7O C;  1HQW A;  1C1F A;  4B4P A;  4BQ2 A;  3ZFG C;  1ULE A;  4YVS C;  3WUC A;  2VNO A;  3S7E A;  1JZ2 A;  3D82 A;  2PHX A;  3AVS A;  1IS4 A;  4LMF A;  2F6B A;  2QQL A;  2O8O A;  5GM0 A;  1LGN A;  2R06 2;  1GUI A;  2QQO A;  4XOG A;  5AVA A;  5FPX A;  4CP9 B;  2EAL A;  4RN5 A;  2XJU A;  3ZYI B;  3UNP A;  3KD4 A;  4PIY A;  3NV3 A;  4JTO A;  5LB6 A;  4WVV A;  2WZR 3;  4ES9 A;  2A7A A;  5CAZ A;  1BQP A;  3SH5 A;  1AHS A;  3H9A A;  4IV3 B;  4OQ8 A;  3H8R A;  4AWD A;  2VW1 A;  2BEO A;  3OSD A;  3RMY A;  3ZKU A;  4C8D A;  4CE8 A;  4KG0 A;  4Q4W 1;  1QJY 1;  1LEC A;  3I3B A;  3UKN A;  4FOY A;  2OYZ A;  4JGY C;  3KHB A;  4K20 A;  4QB6 A;  5JZG B;  4P9G A;  4LXL A;  4JX0 A;  1PK6 A;  2PTM A;  3BTY A;  4IW3 A;  1PVC 2;  3M2M A;  1F5F A;  1QMJ A;  4WM8 B;  1O4Z A;  4CDQ C;  4H7M A;  3I2I A;  3RZK A;  1WCD J;  2QQJ A;  4EYU A;  4BQX A;  2OW4 A;  2BPA 2;  1KJL A;  1OBN A;  2JEC A;  1RIN A;  1VAV A;  2X10 A;  5JPN B;  2A73 B;  2HEY F;  1NCR A;  3LF7 A;  3R4U A;  4XJW A;  2VVD A;  4ARY A;  2R7E B;  3WOG A;  3POI A;  2IUW A;  2P6C A;  2ZX1 A;  3OBR A;  2QQV A;  4OMC A;  2RJK A;  3JQX A;  3WG1 A;  2JE8 A;  5T5P A;  5BNN A;  3PVE A;  4NE9 A;  3C3V A;  4DEV A;  2JG8 A;  1NKG A;  2FDG A;  4NAM A;  1AR9 2;  2QNK A;  4DZG A;  3MI8 A;  4NOT A;  1MZF A;  3M1H A;  3LEK A;  1NA1 C;  2WT0 A;  4S2D A;  3O1V A;  5ISL A;  1LUL A;  1XNK A;  2GSY A;  3AP6 A;  3RDI A;  1UAI A;  4YM1 A;  1UOJ A;  2QCS B;  5D8A B;  4BA6 A;  5KXB A;  2ZKN A;  2XBO 3;  3WDY A;  2XJS A;  3OGJ A;  4MGI E;  1X9T A;  4R9A A;  2DVD A;  3PUR A;  2JDU A;  2CGO A;  4PCR A;  3A22 A;  1FPN 1;  1Z78 A;  3IM0 A;  4JKM A;  5BNO B;  1DQ5 A;  1Y4W A;  3MV0 1;  3V0A A;  1L7R A;  2VBP A;  1UXZ A;  5IHR A;  5JXH A;  3IMN A;  2VCB A;  2EIC A;  4W6X A;  1QDC A;  2R0F A;  5FO7 B;  1BK0 A;  5GLW A;  3U14 A;  4EN8 B;  3KV5 A;  1KRI A;  5LCW L;  2ZML A;  5KXE A;  5EPA A;  2W87 A;  5H9S A;  3VKL A;  1QWR A;  3RJR A;  3BIE A;  3N4M A;  2D3P A;  1U0A A;  2HYK A;  4CUC A;  3MF9 A;  4AE2 A;  4AOC A;  2BJS A;  2Z5W A;  3VBU C;  4CDX B;  1CAX A;  4I3G A;  5FZ7 A;  5JMC A;  3HNB M;  1W05 A;  3D3A A;  5C3Q A;  2DUP A;  4YG0 A;  2GN3 A;  5E89 A;  2GC1 A;  1GWL A;  5DUV A;  1H1I A;  4JV4 A;  3KT1 A;  3PL0 A;  2BOJ A;  3ES4 A;  5CFD B;  1MS9 A;  4FSJ A;  2AAC A;  3BN6 A;  2RS1 1;  1G8W A;  4Q4W 2;  1QJY 2;  2Y0I A;  5JUV A;  5E88 A;  1Q8V A;  1W8N A;  2J1E A;  5FOJ B;  1T6B X;  1BBT 3;  4QD2 A;  4XUT A;  4XF4 A;  1SZB A;  1AR6 2;  5IW0 A;  2P17 A;  4NR1 A;  1WKY A;  2D5F A;  3H0O A;  1JZ3 A;  1H8V A;  2IXK A;  1WLT A;  3IWZ A;  3D8C A;  1JXN A;  3LCP A;  3SKJ E;  3CKH A;  3WR0 A;  3EMR A;  3WW3 A;  4RSU A;  3H50 A;  2ERF A;  3C7O A;  2VMI A;  2WNV C;  1PM7 A;  1LOF A;  1XPW A;  4AI3 A;  3M7A A;  4FPG A;  2ENR A;  5LZ6 A;  2QQW A;  3INA A;  3LZZ A;  1RYY A;  2AYH A;  3E5U A;  2DBI A;  5FQ0 B;  4CUB A;  5I93 A;  1ZRF A;  2PQS A;  4S2F A;  4ZKT B;  1ZBA 1;  4X6R B;  2E7T A;  5EHD A;  4QGN A;  2Q1M A;  2AEN A;  1GR3 A;  1R1Z A;  4CU8 A;  1OMI A;  1G9D A;  2RR1 1;  3HT1 A;  3K4Z A;  4AQ2 A;  3BOP A;  3VZO A;  2GMM A;  3VKM A;  3PUH A;  2A6X A;  1CAV B;  1NLS A;  2OS2 A;  4B7E A;  2PHF A;  2KM2 A;  3VBO A;  5AFB A;  3WCR A;  3WLU A;  2DCT A;  1Y9M A;  5FIX A;  5F5I A;  2D3S A;  1AJO A;  1UU5 A;  1E5I A;  1UZZ A;  2GH8 A;  2P37 A;  5A7Q A;  4QT6 A;  4ZHN A;  1O91 A;  3LEG A;  2DVA A;  2NMN A;  2Y0O A;  3FZ3 A;  3I59 A;  1YLL A;  3P6B A;  2GZW A;  5FXW A;  3MIC A;  2PMW B;  4W4Z A;  3T30 A;  3UYJ A;  1HRI 1;  1D4M 1;  1MEC 2;  4XPV A;  1HB1 A;  3BTX A;  1JS9 A;  3I49 A;  4BU2 A;  4LT5 A;  1C1L A;  4N9I A;  3VDB A;  1O3T A;  5J1X A;  3EBR A;  5JOZ A;  4KWJ A;  1ULP A;  4YGB A;  4XIO A;  2RS3 3;  1MZ6 A;  4B1M A;  2L9L A;  4BXS V;  4Y1Z A;  4Q1P A;  4LBL A;  4Z82 A;  1LED A;  4WVM B;  3AZW A;  3ILN A;  2Y6L A;  3TBD A;  2NM1 A;  5LK5 A;  2AH2 A;  1WBF A;  1HQN A;  4BQ4 A;  5FK7 A;  5IVV A;  3TWI A;  5A7W A;  4B4R A;  4YZ2 A;  4XQW A;  5LW9 A;  3ZXG A;  3RZZ A;  1ENS A;  2G9F A;  4A6S A;  2JEN A;  2YU1 A;  4UFI A;  4LO5 B;  1DGR N;  3N35 A;  3NJY A;  1F15 A;  1UKR A;  4QAW A;  2RS1 2;  2K9Z A;  2DVF A;  2XG3 A;  4EN9 B;  2WII B;  2OQ7 A;  2W5F A;  2HYX A;  2BP6 A;  3DL3 A;  2MEV 3;  1K12 A;  1GZC A;  4MXV A;  4XJ9 A;  5F39 A;  2RM2 3;  3PTY A;  2IFR A;  4H14 A;  2CYF A;  1C4R A;  3K4D A;  3AKT A;  3MV1 1;  5FYT A;  3EB7 A;  3AP4 A;  3U11 A;  2B39 A;  3OGV A;  3BTZ A;  1VAK A;  1FOD 3;  1ZZC A;  1RUJ 1;  4TWT A;  3W5M A;  2JG9 B;  3EJK A;  4CSW A;  5A6X A;  1Q5O A;  4LHS A;  4PDW C;  5A3N A;  1S0C A;  3ME2 A;  3PUS A;  5FCC A;  3VD3 A;  3SH4 A;  1K5M C;  4QKF A;  2JEM A;  4OI0 A;  1RED A;  1OKO A;  1DYO A;  1RUF 3;  3LEM A;  4COY A;  1OFN A;  1VAL A;  1AF9 A;  2RR1 2;  4JRL A;  5LA2 A;  4Y5Z 0;  3FMG A;  5CNA A;  4CEY B;  3GNE A;  2VMD A;  4Q8K A;  4TTG A;  2Q4S A;  3MLK A;  5CFC B;  3MW2 A;  1VB2 A;  1MQT C;  1GYK A;  2J42 A;  2OVU A;  1VMF A;  4HL0 A;  3ZPY A;  2G9Z A;  2R06 3;  3KF3 A;  1AX2 A;  2XGX A;  1MVQ A;  5GJ6 A;  4COU A;  4AEJ A;  5FZA A;  2EID A;  2VZV A;  3RJ2 X;  3URF A;  3NKT A;  3PJY A;  1FNY A;  4W6Y A;  4LK6 A;  2J1A A;  3ES1 A;  1H6X A;  1X7N A;  3ABZ A;  4Q29 A;  5BUV A;  5FMO S;  3FLT A;  3ACI A;  3I3Q A;  1XU2 A;  4QQH A;  2B42 B;  4FPJ A;  4HKW A;  1HRI 2;  4IEP A;  2FDK A;  1D4M 2;  1LHU A;  3KSC A;  1DQ6 A;  1MS5 A;  1AXY A;  1W2T A;  2CGN A;  3A7Q A;  3DXT A;  1G9C A;  1PVC 3;  4AED C;  5DZE A;  4ATE A;  2QUO A;  5CKN A;  4LO4 B;  2LRP A;  2YUE A;  3E5Q A;  4UW4 A;  3UJQ A;  3ELN A;  2OZ6 A;  3VZL A;  5I8T A;  1N3Q A;  1YNA A;  3N36 A;  4XFC A;  1LOD A;  1ZZB A;  2P3K A;  4J6G A;  4AHW A;  2WZR 1;  4URA A;  3GDB A;  3NAP B;  5CIR A;  2GC3 A;  2E53 A;  4CXX A;  1YJL A;  4FFI A;  2DVG A;  1HJF A;  4RL7 A;  2VR4 A;  2ADE A;  2GC0 A;  4OI4 A;  1VBC 1;  1AR9 3;  3VKF C;  4XF9 A;  1U5Z A;  3ACH A;  2VZP A;  2WN2 A;  4CP9 A;  5A6Z A;  3FUQ A;  2EIG A;  4XZU G;  1RUD 1;  4A3X A;  2AEZ A;  3B93 A;  4BLJ A;  2VZ1 A;  4ASK A;  2XHN A;  3LA2 A;  1ASJ 1;  1MR5 A;  1LTE A;  3AL5 A;  4NIH A;  4PQ9 A;  2ZXQ A;  2VMC A;  5IK8 A;  4N43 C;  4RR3 B;  5BPX A;  2BGC A;  1N3P A;  1STM A;  1JOD A;  4Q0S A;  1W04 A;  1BJQ A;  5F37 A;  5KXD A;  4P5H A;  2W3J A;  1UW8 A;  3KF5 A;  3FFZ A;  4WM8 A;  4CCL A;  2CGP A;  2DCY A;  3JD7 1;  2MNG A;  3IDA A;  4KGQ A;  4Q0U A;  1X36 A;  5HCH A;  4QPI A;  4IQP A;  2WO1 A;  5HPO A;  3DV8 A;  2WNU B;  3ZYF A;  2R32 A;  4JHZ A;  5T52 A;  1RUJ 2;  1LHN A;  2VNV A;  5DAQ A;  3Q8E A;  2FCU A;  3VD7 A;  5CU1 A;  2ZHK A;  4AGR A;  3POJ A;  4YZ3 A;  1J3Q A;  2N7G A;  5LAT A;  4R9C A;  4CTE A;  1ULO A;  4Y1U A;  3WX5 A;  5FP8 A;  2ZHL A;  3NNJ A;  1O8P A;  3P3P A;  3MPB A;  4D8M A;  1OUR A;  2G1M A;  4R9B A;  5JI7 A;  5FO8 B;  3HAG A;  1UOG A;  1KFX L;  4S2H A;  1REE A;  2VOK A;  4A4A A;  2R49 A;  4COV A;  1QGL A;  1VR3 A;  2EA7 A;  1H1A A;  4R9D A;  5DUU A;  5FZF A;  1EV1 1;  3A4U A;  3EQE A;  4D6R A;  4CDU A;  4XCA A;  5C5U A;  2W39 A;  3ZVX A;  3BTA A;  4P5Y A;  2JX9 A;  2ZA9 A;  4IEO A;  4AVS A;  1PK6 B;  2EXI A;  4NWV A;  4P02 B;  1BK1 A;  3LIG A;  2WNO A;  2JDZ A;  1OOP C;  2VZS A;  2DUQ A;  4WZF A;  3ORJ A;  3AKP A;  3FX3 A;  2NMO A;  2VUL A;  4Q4W 3;  1QJY 3;  2E7A A;  4GH4 A;  2ZGS A;  4PIZ A;  4IE5 A;  3BI3 A;  1ULC A;  1AXZ A;  1NCR B;  2HWC 1;  1NCQ C;  4XDO A;  4XQD A;  3T0B A;  2VCA A;  2XLA A;  1JN2 P;  2DCK A;  1RMU 1;  2TNF A;  4FOW A;  2P3J A;  4QU2 A;  1ND2 A;  1YO8 A;  1QJU 2;  4XUQ A;  4RQP A;  2EIE A;  4QPG C;  1KQR A;  2JG8 B;  4FFH A;  1GNZ A;  5CKQ A;  2XKO A;  4I30 A;  4W50 A;  5FPV A;  1WBL A;  2B9V A;  2VMF A;  2WQZ C;  3LQC A;  5JSP A;  1TNF A;  5FZB A;  1OPM A;  2ET7 A;  2KA3 A;  1PO2 1;  5EFU A;  1XYO A;  4COW A;  5D21 A;  4BQ5 A;  4O9G A;  4Q27 A;  5FZE A;  4AG4 A;  3S0M A;  4HK9 A;  4HBN A;  2VUA A;  4ZS3 A;  5L9V A;  4JQR A;  4D7T A;  4KBZ A;  1SMV A;  1REF A;  4LBO A;  1DGW A;  2VMH A;  1YI9 A;  2OII A;  2WBK A;  3MHZ A;  4YG3 A;  5DDJ 1;  4XC9 A;  3KV4 A;  1O3S A;  4LBJ A;  2F4P A;  2VNR A;  1ENQ A;  3FHI B;  4XFG A;  5FZL A;  2W52 A;  2UUR A;  1RUD 2;  3N7J A;  3VBF A;  2R30 A;  4IV3 C;  1ASJ 2;  2K2S A;  4IL7 A;  4CCC A;  3V0A B;  2XPJ A;  3Q8C A;  3T0D A;  3J4U H;  4Y1V A;  3CJI A;  2DV9 A;  2V4V A;  5CEH A;  4MHU A;  5K8S A;  1SPP B;  4QDQ A;  4QPW A;  3K46 A;  1QJX 1;  3OY8 A;  4LKD A;  4K6B A;  3BU7 A;  3C2U A;  5I0T A;  1FPN 3;  2JJ6 A;  2FDI A;  1F2N A;  2ZEY A;  2JB4 A;  1TE1 B;  4NO4 A;  3PTR B;  3JD7 2;  3HVD A;  4AW7 A;  5B2G B;  4CCM A;  4Z92 B;  4MLO A;  5T54 A;  2IXC A;  2RDN A;  3ZFE A;  4Q1R A;  1R64 A;  4NUB A;  1CIY A;  4ZXE A;  2PHT A;  3E6D A;  5CIS A;  4K7J A;  1JYI A;  5FYC A;  1U5I A;  4YW6 A;  4ZU4 A;  5FPL A;  4DXS A;  3BAL A;  2FZ2 A;  2YPJ A;  5FQ0 A;  4BZ4 A;  3AC0 A;  5FY0 A;  2FCV A;  1YHF A;  5HCA A;  3AYA A;  3HQU A;  4BIO A;  5FZM A;  2G9G A;  3HD8 B;  4NHY A;  2YFZ A;  2VQA A;  2EXK A;  4QX8 A;  1JHJ A;  2GNT A;  5D8A C;  1JYT A;  1F31 A;  1EV1 2;  5FBZ A;  2CHH A;  4HT1 T;  1ZRR A;  4R4Z A;  4DUX A;  2VZU A;  1MZE A;  2ZX2 A;  1TQ5 A;  4AFD A;  1I6X A;  4ZU5 A;  3THP A;  1WGP A;  2WFP A;  4LQR A;  1H30 A;  4YVW A;  4E2Q A;  2QQN A;  1PGW 1;  3PME A;  1GP5 A;  3ACL A;  3AMN A;  5EP9 A;  5BNO C;  3I3M A;  4HAN A;  1RUE 1;  2D6K A;  3KV6 A;  3ECQ A;  2RS1 3;  2IXJ A;  4UI9 L;  5A3M A;  3OPZ A;  1PZ8 A;  2RVA A;  2XJV A;  1V9U 1;  1O3Q A;  2ATF A;  1C28 A;  3C7F A;  4J1W A;  2WN3 A;  2Y6G A;  1CZV A;  1V0A A;  4OFG A;  1RMU 2;  2OUH A;  3SHR A;  1KD7 A;  2BRT A;  4HVQ A;  3C7E A;  1OLQ A;  3B3Q E;  1LAJ A;  1AL0 G;  2VQT A;  4YLZ A;  3WDT A;  4CRQ A;  3LKJ A;  2DYC A;  3MF6 A;  5JMO A;  4ZON A;  1GOG A;  1F8V A;  1PO2 2;  1WW4 A;  1UQX A;  1QNW A;  3TYJ A;  1POQ A;  1FX5 A;  4CP2 A;  4XIK A;  4FOQ A;  2AC1 A;  4WM7 B;  5FYS A;  2Q0A A;  3VBO B;  3WP5 A;  4CDX C;  2WA4 A;  4ITC A;  1IZ3 A;  1ZBA 3;  2YMZ A;  2XHK A;  5CKM A;  5FZD A;  5L73 A;  5CG8 A;  1ST8 A;  1IKQ A;  2XL7 A;  4N7I A;  2EF6 A;  2RR1 3;  3KGZ A;  5DDJ 2;  3ZSE A;  3HT2 A;  4Z1V A;  2DTW A;  1W9S A;  1OH4 A;  4DNY A;  3O1O A;  3OTF A;  2QBX A;  1YI7 A;  4EN0 A;  3I59 B;  4ZZ5 A;  3GJB A;  4Y4Y A;  2FMY A;  3CHX A;  3NWK A;  5FZ4 A;  3MLL A;  2FDJ A;  4DXT A;  4YM0 A;  1CVN A;  1QJX 2;  2Z2S B;  3JU9 A;  3ZLI A;  4FPF A;  3FBM A;  1IOA A;  3OEA A;  1TMF 1;  5F2W A;  4M3C F;  1WW5 A;  5DPN A;  2XQR A;  2FHR A;  2HH9 A;  3APB A;  4FXG B;  2PXJ A;  3ZXD A;  2VG9 A;  1HQL A;  1HRI 3;  2W47 A;  1D4M 3;  3D0S A;  1DGR A;  2QDR A;  2WT1 A;  1J83 A;  3ZPO A;  2Q30 A;  1XE0 A;  2YBP A;  2JG9 A;  4XF1 A;  4XUN A;  3ZIX A;  1G7Y A;  1HRV 2;  4B29 A;  2RG4 A;  2JD4 A;  2WQ4 A;  5T5O A;  1TNR A;  3AXD A;  5A7W B;  3AZX A;  5L19 A;  4XHB A;  1CD3 G;  2P4E A;  4OHW A;  2EAA A;  4B4Q A;  3VV1 A;  3WNK A;  2V5Y A;  4FCA A;  4DEQ A;  4TXW A;  5C4W A;  5IFP A;  4UWD A;  3R6S A;  4AGV A;  1RHI 1;  3H8U A;  3PIG A;  4KU7 A;  1ONA A;  2VU9 A;  2X29 A;  3W58 A;  1LNS A;  5C70 A;  4D7S A;  1ULF A;  3M70 A;  5CFC A;  1GP6 A;  5DAV A;  3ILR A;  1UZ0 A;  2P34 A;  4UW5 A;  1P8J A;  1QDO A;  3FL7 A;  1QQP 1;  3VZK A;  3I97 A;  4BH9 A;  1XU1 A;  5ABJ A;  2J7M A;  1W2N A;  2GN7 A;  3OUI A;  3ZYG A;  5E6H A;  5L7O A;  4NIG A;  3UES A;  1X9P A;  3OGR A;  1OD5 A;  3WD5 A;  3U07 A;  4HKO A;  4OYU A;  3MFA A;  3DKQ A;  4CPB A;  1PGW 2;  1DYK A;  3B02 A;  3DYP A;  1E5R A;  3WDW A;  5BNP B;  2W46 A;  2E31 A;  3VBS B;  1RUE 2;  1OFS A;  2XXZ A;  3O5S A;  3HN3 A;  3J9S A;  4I3P A;  2OA2 A;  4IEU A;  4NJ4 A;  1WCK A;  1K42 A;  2D6L X;  5FZ1 A;  1V9U 2;  1JYN A;  1Q8P A;  5FZG A;  3WHU A;  1GKB A;  4CU9 A;  1H9W A;  3GZU C;  5KHG A;  4OHX A;  3EYP A;  2GC2 A;  4X8N A;  1XOY A;  4KL1 A;  2OX0 A;  5BNQ A;  5KWR A;  4ARX A;  2BBV A;  4HPK A;  3FE5 A;  3WF4 A;  2BFU L;  3DPR B;  4OUE A;  4OUL A;  4YPJ A;  3J8F 1;  4H3W A;  4L99 A;  4P9W A;  3HOB A;  2FD8 A;  4OI1 A;  1SEF A;  2W9X A;  1JOJ A;  1RUJ 3;  2B45 X;  1LR5 A;  2ZEZ A;  1M4W A;  3NAP A;  4MET A;  3FJS A;  1BCX A;  4YZ5 A;  5A3U A;  5LRS A;  1NLR A;  1HKD A;  4AFA A;  2BU9 A;  3POB A;  3RYK A;  2BDR A;  1V6I A;  3H42 B;  1HV0 A;  3LB9 A;  1NX9 A;  1APN A;  4LNV A;  2D40 A;  4Y20 A;  2D98 A;  4PF5 A;  1QJZ A;  1UYZ A;  2VBD A;  2ET1 A;  1LOC A;  4QX7 A;  3WNM A;  4E2S A;  2G4I A;  3UV9 A;  4IUG A;  1K5J A;  4D3W A;  3NNL A;  1WLW A;  3USS A;  1YFX A;  3VBH A;  1L7L A;  3HQR A;  4AI2 A;  3BGA A;  3AK0 A;  4JRA A;  4FP3 A;  4QPY A;  3OUJ A;  3PVB B;  4DB5 A;  1G86 A;  1KFU L;  2D6O X;  1N1Y A;  1WME A;  3KGL A;  1TMF 2;  3T2P A;  2VO5 A;  1LRH A;  4OQ9 A;  3SCH A;  1RGS A;  3AYE A;  3WIN E;  2FDF A;  2V72 A;  4WBB A;  3TOJ A;  1GWK A;  2P1B A;  2ZGR A;  4K8R B;  5G05 L;  4A7K A;  1IGO A;  4EWD A;  5FY8 A;  1FT9 A;  5DXD A;  1QJU 3;  1PHM A;  1WW6 A;  5JPM B;  3LD8 A;  3MO4 A;  2NLR A;  1LEM A;  2H0V A;  5K0U B;  1UN1 A;  4Q8L A;  4YW4 A;  1LHW A;  4YW5 A;  4J25 A;  2PLV 1;  4JGZ A;  1O4Y A;  3MFC A;  3HQX A;  4CP1 A;  5DUX A;  1IPK A;  3AKS A;  5T55 A;  2R1D A;  1AR8 1;  3RVH A;  4CEY C;  3WG3 A;  1RHI 2;  3DKW A;  2VVF A;  1JBC A;  4LJH A;  1EY2 A;  3TEW A;  1QH7 A;  4I01 A;  1C57 A;  4P14 A;  1OLM E;  5GAL A;  4IES A;  4V1P A;  2VXJ A;  5I91 A;  2AR6 A;  1HN1 A;  1H2M A;  2D5H A;  3JUU A;  3Q8F A;  1QQP 2;  1S2E A;  4BK5 A;  1VBC 3;  4Y3O A;  4YW1 A;  2ZCW A;  3POW A;  5T3N A;  1RIR A;  1ZZ8 A;  1AR6 1;  1JMU B;  3LPF A;  4FPH A;  1OC1 A;  2WWS A;  4GWJ A;  4K40 A;  4CCD A;  1O6U A;  2CTV A;  1RXF A;  1RUD 3;  4HVO A;  3OBA A;  3VBU A;  2VMG A;  3DF0 A;  1ASJ 3;  4JDN A;  4L11 A;  4LBQ A;  5LEK A;  2D6P A;  4YFZ A;  1C8N A;  1V6J A;  4QPI B;  2XR4 A;  1NE4 A;  1W8W A;  2ZGK A;  5KXC A;  3HWJ A;  2WYS A;  1C3H A;  4YGC A;  2JKX A;  5FZI A;  1ENR A;  2QTW B;  4NPM A;  1SLT A;  3O1S A;  3FLR A;  4QQO A;  3ETQ A;  2UYB A;  3OOX A;  4N8M A;  4H2A A;  2XON A;  1E5S A;  1JU3 A;  2X5I C;  3JD7 3;  5FXV A;  3T1M A;  4C0H A;  4GKY A;  3NQH A;  3UJO A;  4XTP A;  1B35 B;  5GLU A;  1JYW A;  4IV1 C;  4GJZ A;  2CWS A;  3J8F 2;  5D2A A;  1WWY A;  2WLQ A;  3LFI A;  3U0Z A;  5F32 A;  4ZZ8 A;  1A8M A;  3AXE A;  4DIQ A;  1NQD A;  2XOM A;  4CDU B;  3CEW A;  3PU3 A;  4RHV 1;  4QM8 A;  2Q1F A;  5I0D A;  1H9P A;  1KS5 A;  3GBF A;  1AX0 A;  1BVP 1;  1SLI A;  4BXF A;  4EQV A;  1Y7B A;  4B8E A;  5KHJ A;  4BCU A;  1RB8 G;  1DGW X;  3ZDV A;  3NW4 A;  2E33 A;  1NUK A;  5JOY A;  1EV1 3;  5J98 B;  4GH4 B;  5CAD A;  5FZO A;  1GMM A;  5FYZ A;  1KDM A;  4UFM A;  4RR3 C;  1MEC 1;  3VUO A;  4UFK A;  1SPP A;  4HZF A;  1UZY A;  1VJ2 A;  2MHF A;  2WUH A;  2YC0 A;  1ND2 B;  4RQP B;  5H9R A;  4DPN A;  1ZVF A;  1XXN A;  2C5D A;  1UD1 A;  4DUV A;  4I0B A;  5EJ3 A;  2CWM A;  2WNU C;  1ULG A;  1VP6 A;  5GLT A;  2HWC 3;  4NID A;  1QKQ A;  3POS A;  1PZ7 A;  3MLJ A;  1OSG A;  2V73 A;  5AC9 1;  1RMU 3;  3ASI A;  4XVH A;  3T08 A;  2HWE 1;  2ZTN A;  3NV1 A;  3RZL A;  4AR2 A;  4CCK A;  2JIG A;  4IEW A;  1CWP A;  1W0N A;  3R4D B;  1IPJ A;  4M0N A;  3MIB A;  4DUW A;  1V70 A;  2PLV 2;  4LE3 A;  4TLG A;  1EYB A;  4QKN A;  1PO2 3;  3M3O A;  5A1A A;  5JOW A;  1Q56 A;  1AR8 2;  3VBF B;  4Z8B A;  1W8T A;  1CX1 A;  1PNF A;  2PHR A;  4CCO A;  1VBA 2;  5A3O A;  2XLG A;  3FHQ A;  1UIJ A;  3CJI B;  3KQR A;  1RJ8 A;  3OY8 B;  4CEW B;  1TME 1;  5A1L A;  2JE9 A;  2XJQ A;  4LR4 A;  5DDJ 3;  3IB3 A;  4A2U A;  3V64 A;  2YZ4 A;  1WMD A;  1LJ7 A;  5LRR A;  1SG3 A;  4AVB A;  3RSJ A;  4AEK A;  5FYB A;  1DU3 D;  4OI2 A;  3ZFE B;  1NCR C;  3GHM A;  4A3Z A;  5EYY A;  3VB9 A;  1OF4 A;  1QJX 3;  4LKF A;  2ZGU A;  3O0V A;  3TRS B;  4AQT A;  2R07 1;  5FK8 A;  4YGE A;  4EN6 B;  5BNN C;  1OVP A;  1LOA A;  5FR3 A;  2JG8 C;  2YC4 A;  1Z7S 1;  2WFF 1;  2ES3 A;  2C1F A;  3G6J B;  4EZ4 A;  5KHK A;  1JTZ X;  5CVR A;  2I45 A;  2WR9 A;  3HBZ A;  2ZJC A;  1ODN A;  1VBE 1;  5IVE A;  4QQP A;  2WL1 A;  5KR7 A;  2VE1 A;  5A7S A;  5EJ1 B;  1HJG A;  1LKN A;  4TZD A;  3ZO0 B;  4WM7 A;  2NPI A;  2A1X A;  4RHV 2;  2VBB A;  4AQ6 A;  3MEP A;  3CDZ B;  4M0H A;  1W3X A;  4IEY A;  2PAK A;  3JBG 1;  2R0H A;  3SC7 X;  4YVW B;  4RFT 0;  4FO9 A;  3EO6 A;  4PDW A;  5JWP A;  2I2S A;  2ZKL A;  5A6Q A;  5IK5 A;  1FXZ A;  3ZYH A;  2W08 A;  5FY4 A;  3MDP A;  3LDR A;  4M00 A;  4XBL A;  5FZ8 A;  4QX2 A;  4HSL A;  2ZAC A;  5JVV A;  5A33 A;  3Q8A A;  4JC1 A;  3OCP A;  4RGA A;  2C9A A;  1RTV A;  1RUE 3;  2X53 S;  1PX3 A;  2E6V A;  4IGO A;  1N47 A;  2VGD A;  4NIA A;  1S4C A;  1D4V B;  1V9U 3;  3AP5 A;  3OF1 A;  2TEP A;  4XAE A;  3WT3 A;  2IXL A;  1V6K A;  1GZ9 A;  4TSV A;  5K7P A;  3VHN A;  5AC9 2;  1O3R A;  1YFW A;  2HWE 2;  4OHZ A;  3M4F A;  1CZT A;  2I74 A;  5HCB A;  4URT A;  2XJP A;  2RHP A;  4TN7 A;  4U2A A;  4MGS A;  1UNB A;  5C8W A;  1SAC A;  2JDK A;  3LA3 A;  3NMB A;  4QGL A;  1G6N A;  3S7I A;  1AJK A;  1N1T A;  3W20 A;  2CDO A;  4IE6 A;  5AVP A;  4YYO A;  3KWV A;  3RI8 A;  3NST A;  5FUP A;  1VPH A;  4YG6 A;  1GZW B;  4XET A;  2Q8D A;  3R05 A;  1YRZ A;  1J1L A;  1JUH A;  4AVV A;  2DVB A;  3UET A;  4DRR A;  2VW0 A;  3AMM A;  1OQD A;  1TME 2;  3GF6 A;  1LOG A;  2I07 B;  3MIF A;  3SXW A;  4YM3 A;  3NVC A;  4XFH A;  5FRE A;  1CR7 A;  1VLN A;  3ZDS A;  2PHU A;  5FKC A;  1NAE A;  5BNP A;  4IGQ A;  4MSV A;  3AB0 A;  3VL8 A;  3QCW A;  3VBS A;  2Y64 A;  3UKV A;  2WWU A;  1QOT A;  2ZOE B;  4UW3 A;  4YW3 A;  1LOF C;  3SLI A;  4XJU A;  4WZC A;  3I4I A;  3ZSL A;  2R07 2;  5FMD A;  1ACC A;  3LEI A;  3UGH A;  1TMF 3;  2Y6K A;  5JLV A;  4RS5 A;  4LHK A;  3TB0 A;  2J1S A;  4EV0 A;  1Z7S 2;  2C0Z A;  2OQ6 A;  1IQA A;  2WFF 2;  4N43 A;  1FYU A;  5FZ3 A;  5GZE A;  4BIF A;  2ZGL A;  3DPR A;  2E7Q A;  1NG0 A;  2Y8K A;  5C4W B;  1JZ6 A;  4AHX A;  4ES8 A;  5EIY B;  2E9Q A;  4YRD A;  1VBE 2;  4XCB A;  3VBO C;  4QDR A;  3ZN6 A;  1CGP A;  1S2K A;  3I8T A;  1YWK A;  3LIH A;  5ABJ B;  2NQY A;  3QBQ A;  3WQ1 A;  1X82 A;  5L7O B;  4AFC A;  1HXS 2;  5BY5 A;  2UWA A;  3JBG 2;  1JYC A;  5ERL A;  4Q0P A;  5IWF A;  1ENX A;  1RC6 A;  1RHI 3;  1FV2 A;  1GP4 A;  2QQM A;  3M3Q A;  1GNY A;  4XAC A;  3MUY 1;  2D93 A;  4DRV A;  3ZYB A;  2AZ5 A;  1ND3 A;  4CCN A;  3ZSM A;  1XYP A;  4HLT A;  4Y26 A;  1QQP 3;  2DBN A;  3V65 A;  2BVV A;  2RE9 A;  4EE2 A;  3O1R A;  1DZT A;  4A42 A;  3NO8 A;  1DF0 A;  3VZJ A;  1QJU 1;  3ZR5 A;  1UO9 A;  2ZX0 A;  4AAX A;  5BV6 A;  1O5U A;  4LO8 A;  3WQ0 A;  3S5Q A;  4HPK B;  2WAA A;  4JAA A;  4BQ1 A;  3SCG A;  3IKW A;  1LGB A;  5JR2 A;  4KH9 A;  1XNB A;  4L97 A;  1KEX A;  2B7Y A;  2O8Q A;  3MID A;  2LTN A;  3NJZ A;  1OOP A;  1CAU A;  1WMX A;  2WZ8 A;  1RJ7 A;  3VD9 A;  1DIW A;  5K0U A;  4GMP 0;  2B46 X;  3CZJ A;  4RGK A;  1YQ2 A;  4Y20 B;  5F5A A;  4F3J A;  5IAT A;  2PA7 A;  5JIU A;  1WCU A;  2VD7 A;  3IN9 A;  3J8F 3;  1POV 1;  2NYY A;  4FPL A;  4I0A A;  4LKS A;  3RGB A;  5A7P A;  1J3P A;  2PYT A;  1CQ9 A;  1DQ4 A;  1R1A 2;  3AX4 A;  1QXP A;  2C4X A;  2V4A A;  3AKR A;  4LBM A;  5CBL A;  2JE7 A;  4QPG A;  3T09 A;  5FZ9 A;  1SBF A;  2Z69 A;  4NHK A;  4NII A;  3VBH B;  2WKK A;  1H8T C;  3LOB A;  4L92 A;  4HFS A;  2WNE A;  1XJA A;  4MGZ E;  2JDM A;  3THD A;  1QNY A;  5FMB A;  1ZRI A;  3QAC A;  5C6C A;  2B4K A;  1IS5 A;  4UFL A;  4CDW C;  5A3T A;  3III A;  3RZM A;  4K21 A;  1AYM 1;  1KIT A;  1QF3 A;  1A6C A;  2D7F A;  3VBR A;  1Q8O A;  3UT0 A;  5FFO C;  2XVL A;  3BUC A;  2DFC A;  1GBG A;  3ZKY A;  2DDU A;  2W1Q A;  1W39 A;  4MV2 A;  1W28 A;  4C1X A;  1ZRD A;  2XQX A;  4I09 A;  5FDB A;  4BQW A;  4Y24 A;  2W1U A;  3FHA A;  3AVR A;  5FY5 A;  3LE0 A;  4AI0 A;  1A8D A;  2YFU A;  3U1X A;  4JGZ B;  3VD5 A;  3AMQ A;  2W2I A;  1B35 A;  3KMH A;  1GWM A;  1AX1 A;  1GQH A;  2O14 A;  1W06 A;  4QXK A;  3W59 A;  4LO6 B;  3KVA A;  3BIW E;  1N1S A;  2VUD A;  2IC1 A;  4QXH A;  3USU B;  4DFS A;  4QQ2 A;  5J37 A;  1C5I A;  1UZW A;  5F2S A;  1JZ5 A;  4Y22 A;  2VH9 A;  2A6W A;  5HBA A;  2JIJ A;  3KM5 A;  2PLV 3;  4NRP A;  1BEV 1;  4EN7 B;  2GDF A;  1J84 A;  2Y6J A;  2Q1Z B;  5JXI A;  1PIV 1;  1RUC 1;  4WVW A;  1CIW A;  3I7D A;  4XJA A;  1AR8 3;  5DN2 A;  5F8P A;  3VBU B;  4CPB D;  1W6P A;  4LBQ B;  2JWP A;  3RRD A;  3AZZ A;  1NZC A;  2GU9 A;  3DXU A;  2RV9 A;  3WP4 A;  4MO3 M;  2AGS A;  2XVG A;  4M3C A;  2ZHN A;  3N9Q A;  1EUU A;  2AEY A;  2XWJ B;  1L3J A;  1QEX A;  5C9A A;  1VB4 A;  1EAH 2;  3BB6 A;  2BOI A;  1AR6 3;  5C8C A;  2CNA A;  4GMP 1;  5FPZ A;  2PQQ A;  5LBE A;  1DGL A;  4KU8 A;  4QU1 A;  2C26 A;  1DG6 A;  1B09 A;  1SCR A;  1W0P A;  5I0S A;  1NXD 1;  5A80 A;  2QQI A;  2BBA A;  2HEW F;  3IIA A;  3C8X A;  1D2Q A;  5BYN A;  2Q5T A;  2C9K A;  1YQC A;  1Y3T A;  1JZ8 A;  4MG2 A;  3VL9 A;  4B1L A;  1H1M A;  4LHL A;  3FN9 A;  3ZFF A;  2ZAH A;  1CAW A;  1ULD A;  3ZN4 A;  5HCF A;  3RWK X;  1GV9 A;  3A21 A;  1V6N A;  1RIT A;  4D0Q A;  2WNV B;  4DIN B;  1YJK A;  5C33 A;  2UU8 A;  3GYD A;  4Y1X A;  4GWI A;  4AHY A;  5A6Y A;  2VTX A;  5BXX A;  3ITQ A;  2PFW A;  3ZYP A;  2ILM A;  4LLO A;  4E8D A;  3WNL A;  5FZO B;  2OXB A;  3I2D A;  3THT A;  3WF0 A;  4RHV 3;  1AYN 1;  2P3I A;  4L9B A;  3TEZ A;  5JZG C;  3E6B A;  1IG3 A;  2ZX4 A;  3CNA A;  1JI6 A;  4CEW A;  3O1M A;  1GFF 2;  2QDN A;  4K3U A;  4K8F A;  1S0I A;  3BCW A;  4UOJ A;  2H0B A;  4N53 A;  3I2J A;  1T6G C;  4IET A;  4WM8 C;  1I5P A;  3GCX A;  3H7Y A;  4BMB A;  4NRQ A;  4QPI C;  1AYM 2;  4EWA A;  3MUZ 1;  4JHT A;  3RNS A;  3NV2 A;  5L9B A;  1WCS A;  2RDS A;  1MEC 3;  4XAA A;  4GJY A;  3ST7 A;  2J22 A;  1M06 G;  2GH2 A;  1HRV 1;  3HN1 A;  3T4H B;  1W99 A;  3MIE A;  3WP3 A;  4LA3 A;  1ZX5 A;  2VC9 A;  4LPL A;  3IDE A;  5FBJ A;  2WDB A;  4XDQ A;  2H6C A;  5HV0 A;  4G3Y C;  4E4D X;  1BZW A;  4E4S A;  3BVC A;  5JR7 B;  4KWU A;  5J48 A;  1H6Y A;  1X33 A;  4XXP A;  1S2B A;  3I54 A;  1DQ2 A;  1OXC A;  5AC9 3;  3T4V A;  3PUQ A;  1WD4 A;  2QKD A;  2HWE 3;  3WP6 A;  4BQY A;  4CDU C;  2ZAB A;  4DOU A;  2VCC A;  3D4K A;  5A3L A;  3PNA A;  4QX0 A;  4W6W A;  4QX5 A;  1UMI A;  1BEV 2;  3AZV A;  2BTV C;  1PIV 2;  1RUC 2;  1S0B A;  4JQT A;  5E8A A;  1UF2 C;  4ZU7 A;  4NVP A;  4LBQ D;  4LE4 A;  1D7P M;  3AM2 A;  1F4H A;  2QFE A;  2XL9 A;  3MYX A;  1UYY A;  4QQL A;  4NHM A;  1ZA4 A;  5IVJ A;  1PGL 2;  4OUM A;  4Q4X 1;  4JCK A;  1VRH 1;  1TME 3;  2OPW A;  1Q8S A;  1ND2 C;  1SBE A;  4O7X A;  4NHL A;  1AZD A;  1WA6 X;  2QZ2 A;  1PX4 A;  5IVC A;  1S0E A;  3JCI A;  4GB3 1;  4M4P A;  1SCS A;  2VME A;  3TN9 1;  1JUI A;  3P5B A;  4IE4 A;  1DLL A;  5FP9 A;  3VZN A;  4QXB A;  5F3G A;  4FAG A;  4FPO B;  5G04 L;  2UY8 A;  5LBF A;  4LK7 A;  5HV4 A;  3IDB B;  4MXW A;  5FXX A;  2OKX A;  3SMH A;  1DFQ A;  2R07 3;  2HEV F;  1TVG A;  3PLQ A;  1XRU A;  2R6Q A;  1O4T A;  2CL2 A;  4GWM A;  5DZF A;  1Z7S 3;  1KXG A;  2OPK A;  2WFF 3;  4R4X A;  5CYY A;  4XFI A;  1ZYB A;  4IEX A;  3W21 A;  2WS9 1;  3RG0 A;  3VBF C;  3B9I A;  4PDW B;  4A41 A;  4MUV A;  1VBE 3;  4P9L A;  1YQ8 A;  5A1F A;  5CFD C;  1NOV A;  1QHD A;  1K5M B;  2R04 1;  3IAQ A;  3ZXA C;  3CJI C;  3TNQ A;  2E51 A;  2ZGP A;  1GZW A;  2Y6H A;  1AYN 2;  3NNF A;  1H2K A;  1TG7 A;  4FQZ A;  5K9Y A;  1V6L A;  5FUN A;  2XUE A;  2B5H A;  1MZ5 A;  1H0B A;  3JBG 3;  5A33 B;  4CU7 A;  4H7L A;  1LCL A;  3POG A;  5DUW A;  2XUM A;  4XMA A;  5FP4 A;  5IK7 A;  2YGL A;  1H2L A;  4NPL A;  2VCM A;  1W6M B;  4MGK E;  4QHB A;  4GKX A;  4BOW A;  5T5J A;  3L9J T;  4D6Q A;  2RS5 1;  2VZR A;  3VDD A;  1DBN A;  4BIS A;  2UY9 A;  2EVX A;  3ZOI A;  1US2 A;  5A70 A;  3ZYJ B;  4AZZ A;  5FOB B;  1YUD A;  4W8J A;  2C6S A;  4XBQ A;  2WZE A;  4Q4V 1;  1PZ9 A;  1OA3 A;  3WW2 A;  1OLR A;  4HN1 A;  4BB3 A;  4M4R A;  4CA9 A;  3P3N A;  4GWN A;  3WW4 A;  4F83 A;  1UMH A;  4WVZ A;  2QJV A;  4QX1 A;  4NAO A;  2D6N A;  2B8M A;  4YW2 A;  5FLH A;  2UYA A;  5JXJ A;  4N90 A;  5FYU A;  4COZ A;  3LOI A;  3NKG A;  3H3U A;  1OPO A;  2DU0 A;  2WC2 A;  2ZX3 A;  2LW8 A;  4OUS A;  4YVW C;  4AVA A;  4ASM B;  2Y38 A;  2Z42 A;  1W90 A;  1W9W A;  3WDX A;  3ZFG A;  4YVS A;  2KR2 A;  4I0W B;  1EUT A;  3TEX A;  4NMI A;  3U37 A;  3IAP A;  3U78 A;  1Q3E A;  1HB2 A;  4MYE A;  3ENR A;  3QH7 A;  4HOO A;  2Y33 A;  3FFQ A;  3WNO A;  1I5Z A;  3B00 A;  4O65 A;  1QU0 A;  4X8P A;  1W6O B;  3QLQ A;  4PHZ A;  4Q4X 2;  1VRH 2;  4NWW A;  3PDQ A;  1LGC A;  2LUW A;  1VMJ A;  5J7M A;  4V2V A;  2GME A;  1RL3 A;  2TBV A;  4KG8 A;  1AR7 1;  4JDM A;  4PI0 A;  2OT7 A;  3K3O A;  2PHW A;  4RS5 B;  3ROU A;  4FI9 A;  2YYO A;  3G7D A;  4GB3 2;  4N43 B;  4P9X A;  3AKQ A;  4UW6 A;  5LBC A;  3TN9 2;  1RUG 1;  4JGY A;  1DP0 A;  5FJK A;  3CBN A;  3OEB A;  5K4L A;  1F5J A;  1BYH A;  4C91 A;  2DTY A;  2JXA A;  2VQU A;  5F9T A;  3FLP A;  3ZN6 B;  4CDQ A;  1YFU A;  3AMH A;  2HKX A;  5CB7 A;  3SH3 A;  1QIQ A;  4Y33 A;  5FUI A;  1JOP A;  4BYY A;  3B5L B;  2WS9 2;  3Q8B A;  4CYD A;  5JSR A;  1W8H A;  1SLC A;  3I2F A;  4LOR A;  4ZXK A;  3DYO A;  2R04 2;  2X5I A;  1ND3 B;  3H7J A;  1UYX A;  4PLO A;  4XIL A;  2XML A;  3GZT B;  3OD4 A;  3WF1 A;  1NA1 A;  5GZF A;  3NNG A;  2A3X A;  4FQ4 A;  3N9L A;  2HBU A;  3RYR A;  3PVO A;  2HWF 1;  2JIC A;  1PVX A;  3WXP A;  4LHN A;  2YRO A;  2CV6 A;  4XE9 A;  1Y43 B;  4NHX A;  4FPY A;  3WG4 A;  5F6K A;  3KB5 A;  2JB8 A;  4OZX A;  1GQG A;  3N9O A;  3RMX A;  1QOS A;  1DCS A;  2RS5 2;  3LSE A;  4LO7 A;  4CCJ A;  2LM3 A;  5KHI A;  4OMD A;  5FMO L;  2JG9 C;  1BKZ A;  1O59 A;  1OOP B;  1CAU B;  4PLN A;  2IVI B;  1MS3 A;  1UZV A;  5F3C A;  2X05 A;  1VBB 1;  2JKB A;  3JXS A;  4Q4V 2;  3WZ1 A;  2AUY A;  1UY3 A;  1W9F A;  1RUI 1;  4MAD A;  2PEL A;  5C4W C;  5A7O A;  2DWR A;  1UOB A;  1JOB A;  2IFW A;  2WJS A;  4QWN A;  3VZM A;  4XXA A;  1LU2 A;  3PIJ A;  3WDV A;  1CON A;  2EXJ A;  1AL2 1;  2XH6 A;  5F1R A;  1O8S A;  1VBA 1;  2ZEW A;  3USU A;  5CFC C;  4QPG B;  3CQO A;  3NNM A;  4BE3 A;  1LU1 A;  2HWB 1;  1AUY A;  2BUK A;  4X6Q B;  5IAX A;  4U36 A;  3SEE A;  4SBV A;  3GAL A;  4RYD A;  1POV 3;  1UCX A;  1GLH A;  1LB2 A;  2V5D A;  3ACF A;  3AMP A;  3OPT A;  4FPC A;  4HXC A;  2UWC A;  3ZM8 A;  3GZE A;  4LEJ A;  3VBR B;  3H8X A;  3SQO A;  4BM8 A;  2D97 A;  5C3P A;  2ZPX A;  3GGL A;  1S0J A;  4JTN A;  2Y6F A;  4ZY9 A;  1N3O A;  3KVB A;  4V2W A;  4PBO A;  4BDV B;  1H4H A;  1UWW A;  1OUS A;  1LES A;  3D6E A;  5FRA A;  5LEJ A;  4QB1 A;  1G9B A;  2EIB A;  4KQ7 A;  5J96 B;  1AR7 2;  5EZW A;  1YQ6 A;  1AYM 3;  2VOT A;  2YV8 A;  4QX3 A;  3RZH A;  4D7Y A;  5FP3 A;  1RUG 2;  5LWB A;  3SIS A;  5A7N A;  3NAP C;  3N7K A;  4XF3 A;  5JDB A;  5FYM A;  5I8Y A;  3ZXE A;  3ON7 A;  4CXY A;  4Y22 B;  3WQB A;  1I3H A;  2IXH A;  5JAX A;  3M3C A;  3ZXK A;  1S0D A;  3AFG A;  4AK3 A;  4B7K A;  1DDL A;  3V0B B;  1HX6 A;  3AJZ A;  2FCT A;  2WRA A;  2WNV A;  2QQK A;  4IEQ A;  5FKB A;  2KD7 A;  1W6P B;  2WO3 A;  1XE8 A;  4MZU A;  2BWA A;  2E26 A;  3MIG A;  3RYP A;  4A45 A;  2RJL A;  3VBH C;  5IT6 A;  4BPZ A;  4M3C B;  2GAL A;  1BMV 1;  2P3Y A;  2WIN B;  4AI1 A;  2XJR A;  5C9A B;  4GZ9 A;  1S0G A;  1BEV 3;  4KBB A;  3POY A;  4PLM A;  5C8C B;  3M3E A;  1O5L A;  4KI5 M;  4R8H A;  3DN7 A;  1FAT A;  1PIV 3;  1RUC 3;  1W8F A;  3RPQ A;  1JZ7 A;  2HWF 2;  4QHO A;  3ZYR A;  1ZM1 A;  2VQ0 A;  2P6H A;  3QD6 A;  4Z2W A;  2W1S A;  5E1R A;  5L36 A;  5EJZ B;  4DY3 A;  1HLC A;  3B69 A;  1W8U A;  3O12 A;  4MOA A;  4DXR A;  3K4A A;  3IDC B;  4AFM A;  2R16 A;  4C90 A;  4PJY A;  1W03 A;  2K0G A;  3KCC A;  3UKT A;  2VOX A;  4GMP 3;  1S1A A;  3ZFF B;  1CAW B;  3IPV B;  3WHT A;  1CES A;  4JGZ C;  3RWN A;  1VBB 2;  3LFM A;  4Y1Y A;  3WG2 A;  3O1U A;  1XYN A;  1RUI 2;  5FZK A;  3TEY A;  2VUC A;  4FVV A;  4Y4R A;  3IT8 A;  2Y60 A;  3CLP A;  2JDN A;  1NY7 1;  5FAX A;  5FYH A;  1AL2 2;  4E8C A;  5EXO A;  4ORF A;  4YZ1 A;  3ZX7 A;  2GNB A;  1GNH A;  3WDU A;  3S57 A;  3D5O A;  4WV8 A;  2WLP A;  2HWB 2;  2PAM A;  5H9Q A;  5FY1 A;  2ZS6 B;  5JOX A;  3J7H A;  1PK6 C;  4UBH A;  3TAY A;  5HI0 A;  3OYW B;  4N53 B;  5CG9 A;  3W9A A;  1OA4 A;  2ZGO A;  4XFB A;  4IND A;  3KV9 A;  4DY5 A;  5FP7 A;  1D0G A;  2A3Y A;  1OUX A;  4AVT A;  3BKZ A;  1FMD 1;  1K45 A;  1AYN 3;  1X8E A;  1ZZ9 A;  4MGY E;  5FXZ A;  1ZNP A;  4EJR A;  1L7Q A;  3RZG A;  3K48 A;  2QVS B;  3OGG A;  3GZA A;  3BYW A;  4OCT A;  3ZIW A;  1J59 A;  1C5H A;  3PUI A;  4PQQ A;  2VTF A;  3AZY A;  3PVN A;  2ZGQ A;  3ZXF A;  1CZS A;  2WWJ A;  4FBF A;  1QJF A;  1FI2 A;  2FMD A;  1UY0 A;  1QJE A;  2A6Z A;  1EP0 A;  3D0J A;  5LA9 A;  3T2T A;  3GM8 A;  3DCQ A;  5DG1 A;  2V09 A;  3UL2 A;  5GZG A;  1J1T A;  1RUH 1;  3F95 A;  2ZHM A;  1S55 A;  1W0O A;  1JW6 A;  4QHZ A;  2X09 A;  2VTX J;  5LK7 B;  2VZO A;  2SLI A;  2X8K A;  4GA9 A;  1HRV 3;  2VJX A;  2DFB A;  4D94 A;  1DLC A;  2YB7 A;  1EPZ A;  4P9Y A;  5D1I A;  4BQ3 A;  1W6Q A;  4OZO A;  1R09 1;  5GZC A;  1HXS 1;  3IMM A;  4KGG A;  2CY6 A;  2W95 A;  3I2K A;  4Y5T A;  3MBW A;  4UFJ A;  1LOE A;  2LS6 A;  3N3H A;  3N7L A;  3VKN A;  3GBW A;  4UAP A;  5A32 B;  5LAS A;  1K5M A;  1PGS A;  3FBY A;  1BMV 2;  4B3N A;  1S0F A;  1UPS A;  4XAB A;  2A6V A;  3E6C C;  3MW4 A;  4AYU A;  1W6N B;  5DQ0 A;  2XWB B;  4PBP A;  4SLI A;  1PO1 1;  4XF0 A;  1IPS A;  3BPZ A;  3T2O A;  3O1T A;  1D2S A;  1MQT A;  2PHD A;  2DCJ A;  2QZ3 A;  3C7G A;  1CN1 A;  5EWS A;  4LLF A;  5HXV A;  4CUA A;  3NJX A;  3VDC A;  1W6M A;  1XE7 A;  3K75 B;  1LHO A;  2VOW A;  2WT2 A;  3DUI A;  4XDP A;  1YXW A;  1FPN 2;  4Q4X 3;  1HB4 A;  1VRH 3;  3GCW A;  4MXW B;  4Q4Y 1;  1R08 1;  4L2N A;  4HET A;  4PT6 A;  4M3C E;  4UF0 A;  1H2N A;  4HK8 A;  4AF9 A;  5JIA A;  3DEM A;  1HIX A;  2BW8 A;  4GB3 3;  2YBK A;  5ANQ A;  3TN9 3;  2GMP A;  1COV 1;  2B9U A;  1F4A A;  2C24 A;  2J1V A;  4IEZ A;  5KBF A;  3ACG A;  5J3U A;  1IS6 A;  1R1A 1;  4AED A;  1UKG A;  1NY7 2;  3UK9 A;  4LIU A;  2PHL A;  3CZU A;  1ZBE 1;  2XLF A;  3Q9O A;  4FFF A;  3UGG A;  1OF3 A;  2RDQ A;  2RMU 1;  1OLM A;  4BHP A;  3KQ4 B;  4Q0V A;  1CJD A;  2WA3 A;  4RA0 A;  4LUL A;  3SIT A;  4GUL A;  2WS9 3;  1ZA7 A;  2A70 A;  5ACA 1;  2BYV E;  4I2O A;  1POV 0;  2VUJ A;  2J1R A;  4UFH A;  2HBT A;  3H3L A;  4CXW A;  2R04 3;  2XKP A;  2D3R A;  4AI8 A;  3ZXL A;  1MPX A;  1VBD 1;  3IBM A;  4GIQ A;  3U10 A;  3B9C A;  1FMD 2;  1ZZ6 A;  2ZAA A;  4PF1 A;  1HB3 A;  3VDD B;  4ZPI A;  1WUV A;  2BV4 A;  1W6O A;  4CUG A;  3VLB B;  4QM9 A;  2Y34 A;  5IVB A;  1ZRE A;  3VKO A;  1F35 A;  1LEN A;  2LAL A;  1WLD A;  5DMY A;  2DF7 A;  1XNC A;  2MPF A;  3LDK A;  2GP5 A;  2ARC A;  2FZ1 A;  3K51 A;  3T0A A;  3U4S A;  4FTB A;  1H8T A;  2YXS A;  1DZQ A;  2WYF A;  2DUR A;  4YAR A;  2W0X A;  1XC6 A;  3I3E A;  2RS5 3;  1DZR A;  2BFU S;  3MPP G;  3ZN5 A;  1RUH 2;  1NXM A;  5SV8 A;  5FWJ A;  4CDW A;  2HWD 1;  1HN0 A;  3B01 A;  4WM7 C;  5FTT C;  2E32 A;  3E1F 1;  5EYX A;  2VXR A;  2FQP A;  4Q4V 3;  5F5Q A;  1YCI A;  3SEP A;  2GP3 A;  5I0U A;  1PMH X;  3HMY A;  1R09 2;  3PJQ A;  2YHJ A;  1KS4 A;  2LRO A;  4K9S A;  1EPW A;  2H6B A;  3RI9 A;  1MS4 A;  1SLL A;  1XQN A;  3ZFG B;  4YVS B;  4QB2 A;  5DAB A;  3PUA A;  1URX A;  3ILF A;  5I0R A;  2IWG B;  1ZBA 2;  5FO9 B;  1NZI A;  3H1W A;  1X50 A;  4YNI A;  2ZZJ A;  2QQP A;  3MGU A;  1EAH 1;  1QOO A;  1NT0 A;  1RVF 1;  5FZC A;  1C8M 1;  3GJA A;  1PO1 2;  1NQJ A;  5LY1 A;  5F5C A;  5FPU A;  4KNC A;  1W2O A;  2ORX A;  4E4H A;  1V6M A;  3OPW A;  4JGY B;  4N9H A;  1W2U A;  2YPD A;  1GQP A;  3A0N A;  1ALY A;  2A3W A;  3I3D A;  3K77 A;  1SFY A;  2ARA A;  4FOV A;  3M3I A;  2WAO A;  3EHK A;  3WV6 A;  4PI2 A;  3POF A;  4Q4Y 2;  1R08 2;  1WMF A;  4XQ4 A;  2VNG A;  1O7F A;  1JU4 A;  3C7H A;  4CDQ B;  2CU5 A;  2VAU A;  4L0P A;  1OI6 A;  5IJR A;  1AR7 3;  4A44 A;  2IXI A;  1ZRC A;  4E4Z A;  4MH0 E;  3AL6 A;  3J7N A;  3SKV A;  1W9T A;  2ETE A;  1JYV A;  1NCQ A;  1RUG 3;  1UMZ A;  3KT7 A;  1COV 2;  1QXR A;  4GD4 A;  2NN8 A;  3AFK A;  3HJR A;  1UU6 A;  4HN0 A;  4IER A;  1UY1 A;  4E27 A;  4ZS2 A;  1PM4 A;  2X5I B;  4XJ8 A;  1GOH A;  2W68 A;  3ZXJ A;  1IHM A;  1ZBE 2;  3WQ7 A;  5F7U A;  5DAW A;  2WZP P;  1XSQ A;  2RMU 2;  4IV1 B;  4AI9 A;  3RQ0 A;  1NA1 B;  5B4X A;  3PMS A;  2OZJ A;  1SDD B;  1MS0 A;  5IFT A;  5LY2 A;  1N1V A;  5HXM A;  1V6O A;  2CSG A;  2WO7 A;  3L2H A;  5FZ0 A;  5ACA 2;  1IKP A;  2ZBJ A;  3E5X A;  5BNP C;  3ZSJ A;  2UWB A;  3VBS C; 
#chains in the Genus database with same CATH homology
 2ZEX A;  1PX4 A;  3PUH A;  3MO4 A;  4M4P A;  3CMG A;  2VME A;  2BGO A;  5G04 L;  1SHW B;  3P1I A;  2OKX A;  3WNN A;  1TVG A;  4JKL A;  2Z4F A;  3LEG A;  5CYY A;  1HN1 A;  3P6B A;  4BK5 A;  4A41 A;  2HLE A;  3LPF A;  4GWJ A;  4W4Z A;  2BER A;  4A6O A;  2ID4 A;  3IAQ A;  1OT5 A;  3OBA A;  3DEC A;  3I2G A;  3NJV A;  2BZD A;  2Y6H A;  3WEZ A;  3VDB A;  5J1X A;  1TG7 A;  4HG6 B;  3ETP A;  2WYS A;  1ULP A;  2JKX A;  2W94 A;  4CU7 A;  2L9L A;  4BXS V;  2WO2 A;  2W1W A;  2XON A;  1JU3 A;  1UXX X;  2Y6L A;  3NQH A;  2VZR A;  3NRU A;  4XUR A;  1JYW A;  3F2Z A;  1US2 A;  2JD9 A;  3I2H A;  4W8J A;  4ZZ8 A;  2WZE A;  1UY4 A;  2VZT A;  2XOM A;  3WSO A;  5LA1 A;  5I0D A;  4M4R A;  3OB8 A;  4QAW A;  4XUO A;  2W5F A;  2HYX A;  1UMH A;  1K12 A;  4QX1 A;  1T2X A;  5JXJ A;  2E33 A;  1NUK A;  2J1U A;  3K4D A;  3MV1 1;  1GMM A;  2W91 A;  3W5N A;  3EB7 A;  2LW8 A;  3OGV A;  1W9W A;  1EUT A;  2WUH A;  3U37 A;  3IAP A;  5C7G A;  3W5M A;  4LHS A;  3WNO A;  1BHG A;  4DUV A;  3VD3 A;  1DYO A;  3DYM A;  4XVH A;  3T08 A;  5LA2 A;  1GU3 A;  4BK4 A;  4FI9 A;  2VMD A;  4TTG A;  1DP0 A;  1W0N A;  1JYX A;  4DUW A;  3OEB A;  2VQU A;  5A1A A;  5LA0 A;  2EID A;  1CX1 A;  2VZV A;  5C71 A;  2YC2 A;  3FHQ A;  2J1A A;  1H6X A;  1KGY A;  3ABZ A;  5FUI A;  3WF3 A;  1K3I A;  3ACI A;  3A23 A;  3IB3 A;  3I2F A;  3DYO A;  3A7Q A;  1UYX A;  1SG3 A;  2J1T A;  3WF1 A;  3NNG A;  1XNT A;  4A3Z A;  1OF4 A;  3GDB A;  3WF2 A;  3OGS A;  2YC4 A;  2WQ8 A;  3T2Q A;  2VR4 A;  4P08 A;  4OMD A;  1O59 A;  3ACH A;  2VZP A;  2WN2 A;  2CDP A;  1IQD C;  4XZU G;  2X05 A;  4JKK A;  3JXS A;  2VZ1 A;  5EJ1 B;  2XHN A;  1UY3 A;  4MAD A;  2ZXQ A;  3CDZ B;  2VMC A;  1O8S A;  2ZEW A;  3CQO A;  1UX7 A;  2VL4 A;  5B4N A;  3HEI A;  2W3J A;  3SEE A;  4RYD A;  4P00 B;  3IDA A;  3VDA A;  2WO1 A;  5HPO A;  3OG2 A;  2V5D A;  3ACF A;  3ZM8 A;  4QX2 A;  5IYY A;  4JHZ A;  1PMJ X;  3VD7 A;  3GGL A;  1PX3 A;  1ULO A;  4ZY9 A;  1O8P A;  1WCQ A;  4BDV B;  1OD3 A;  1UWW A;  4D8M A;  4CU6 A;  4QB1 A;  2EIB A;  3HNM A;  2VOT A;  4QX3 A;  4A4A A;  1CZT A;  3HNY M;  4MGS A;  4ET7 A;  4P5Y A;  2CDO A;  4P02 B;  3WQB A;  3THC A;  2VZS A;  3UET A;  2QQK A;  2KD7 A;  2WO3 A;  3T0B A;  2E26 A;  5JXG A;  2VCA A;  4A45 A;  2DCK A;  1NAE A;  4XUQ A;  4GZ9 A;  2EIE A;  2Y64 A;  4KI5 M;  4W50 A;  2B9V A;  2VMF A;  3LQC A;  2VZQ A;  1JZ7 A;  4BJ0 A;  2W1S A;  4XUP A;  5EJZ B;  3LEI A;  2Y6K A;  4AG4 A;  4MOA A;  4DXR A;  4KMQ A;  2J1S A;  3K4A A;  2JDA A;  1JZ6 A;  3VD4 A;  2Y8K A;  1GOF A;  2WBK A;  5EIY B;  2VM9 A;  4QDR A;  3HPN A;  3T0D A;  3WNP A;  2V4V A;  4QDQ A;  4QPW A;  4Z2A A;  3K46 A;  4E8C A;  2QQM A;  1GNY A;  2ZEY A;  3CIH A;  5CZK A;  3MUY 1;  2VZ3 A;  3J7H A;  1XNA A;  4A42 A;  1R64 A;  2YG0 A;  1CIY A;  4ZXE A;  3GXU A;  4AAX A;  4DXS A;  1K45 A;  2WAA A;  3AC0 A;  1L7Q A;  5JR2 A;  3PUI A;  4PQQ A;  1KEX A;  1UY2 A;  2VTF A;  2ORZ A;  2YFZ A;  1CZS A;  1JZ4 A;  2WZ8 A;  1JHJ A;  3VD9 A;  1UY0 A;  4MGQ A;  3CZJ A;  3GM8 A;  1YQ2 A;  4DUX A;  2VZU A;  2X09 A;  4LKS A;  2VZO A;  2VJX A;  2WAB A;  2RJ2 A;  4LQR A;  1DLC A;  2C4X A;  2YB7 A;  2QQN A;  3T09 A;  1US3 A;  4QDS A;  4OZO A;  3LPG A;  3ECQ A;  4UI9 L;  3THD A;  2W95 A;  3I2K A;  3MBW A;  2RVA A;  4CVU A;  2BGP A;  2LS6 A;  2W92 A;  3C7F A;  4UAP A;  2B4K A;  1W8O A;  2WN3 A;  2Y6G A;  1CZV A;  3III A;  3C7E A;  1JZ2 A;  5DQ0 A;  2VQT A;  2QQL A;  2DDU A;  1GUI A;  2QQO A;  2W1Q A;  3T2O A;  5JMO A;  3C7G A;  1GOG A;  2DCJ A;  2XQX A;  4RN5 A;  3UNP A;  2W1U A;  3FHA A;  4CUA A;  3LE0 A;  3NJX A;  3VDC A;  2YFU A;  3VD5 A;  3K75 B;  3I3B A;  4PT6 A;  4QB6 A;  1W9S A;  1OH4 A;  4JX0 A;  2QBX A;  1JZ5 A;  4ZZ5 A;  1F4A A;  3I2I A;  2J1V A;  2QQJ A;  3ACG A;  1J84 A;  2Y6J A;  5JXI A;  4DXT A;  5DN2 A;  3CZU A;  2X10 A;  1OF3 A;  2RV9 A;  3OEA A;  4MO3 M;  2R7E B;  4ARY A;  1EUU A;  5DPN A;  4OMC A;  2JE8 A;  4DEV A;  1NKG A;  2W47 A;  2J1R A;  1J83 A;  3LEK A;  1MPX A;  2C26 A;  4XUN A;  4PF1 A;  2QQI A;  2BBA A;  3C8X A;  5DMY A;  2C9K A;  3WNK A;  1JZ8 A;  4DEQ A;  4TXW A;  5IFP A;  3FN9 A;  5C70 A;  3T0A A;  3A22 A;  1LNS A;  3A21 A;  3I3E A;  1XC6 A;  1UZ0 A;  4JKM A;  4D0Q A;  1P8J A;  3FL7 A;  3I97 A;  3MV0 1;  2J7M A;  1L7R A;  4GWI A;  1UXZ A;  2E32 A;  5IHR A;  5JXH A;  2VCB A;  2EIC A;  3E1F 1;  3OGR A;  3UES A;  4E8D A;  4OYU A;  3WNL A;  3SEP A;  3DYP A;  3WF0 A;  1PMH X;  2W46 A;  2E31 A;  5LCW L;  1JI6 A;  3HN3 A;  4QB2 A;  2W87 A;  1K42 A;  4UOJ A;  1JYN A;  3I2J A;  4CU9 A;  1I5P A;  4CUC A;  3EYP A;  3MUZ 1;  4ARX A;  3WF4 A;  4OUE A;  4YPJ A;  3HNB M;  2J22 A;  3D3A A;  3HOB A;  2ORX A;  2W9X A;  1W99 A;  2ZEZ A;  2VC9 A;  4LPL A;  2WDB A;  1GQP A;  3I3D A;  3K77 A;  2WAO A;  3BN6 A;  4KWU A;  1H6Y A;  1NX9 A;  1JU4 A;  3C7H A;  5JUV A;  4L0P A;  5IJR A;  4A44 A;  1W8N A;  2J1E A;  4XUT A;  1UYZ A;  2VCC A;  3WNM A;  3SKV A;  1WKY A;  1W9T A;  1JZ3 A;  1JYV A;  4IUG A;  4QX0 A;  1UMI A;  3HJR A;  3SKJ E;  3CKH A;  1UY1 A;  3BGA A;  3C7O A;  1GOH A;  5F7U A;  1D7P M;  1F4H A;  1XPW A;  1UYY A;  3T2P A;  2VO5 A;  5B4X A;  4CUB A;  1RYY A;  1SDD B;  2PQS A;  5IFT A;  2V72 A;  5G05 L;  5HXM A;  4CU8 A;  3K4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...