3P6BA

The crystal structure of celk cbm4 from clostridium thermocellum
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
186
structure length
186
Chain Sequence
HMALEDKSSKLPDYKNDLLYERTFDEGLCFPWHTCEDSGGKCDFAVVDVPGEPGNKAFRLTVIDKGQNKWSVQMRHRGITLEQGHTYTVRFTIWSDKSCRVYAKIGQMGEPYTEYWNNNWNPFNLTPGQKLTVEQNFTMNYPTDDTCEFTFHLGGELAAGTPYYVYLDDVSLYDPRFVKPVEYVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CBM4 from Clostridium thermocellum cellulase K.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
molecule keywords Cellulose 1,4-beta-cellobiosidase
total genus 38
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3p6bA00
3HJRA 4IUGA 3W5NA 1JI6A 2BGOA 1IQDC 2W3JA 5C70A 5F7UA 3WQBA 2ID4A 1BHGA 3CMGA 2E32A 2W94A 4P02B 5JXGA 3OBAA 2WBKA 3MO4A 1CX1A 2WN3A 3K4AA 4DUVA 2YFUA 3P6BA 1UY4A 5DMYA 2KD7A 2V5DA 4CUCA 2J22A 4D8MA 2VZTA 1OF4A 2Y6KA 2W95A 1K42A 3CQOA 4CVUA 3IB3A 4W4ZA 2WAAA 3VDCA 1UX7A 1NX9A 3LEGA 5G05L 2QBXA 4XVHA 4P08A 1JYVA 2Y6HA 3I2JA 3GXUA 3D3AA 3NQHA 4DXRA 1WKYA 4TXWA 2WZEA 4OMDA 4A44A 2W87A 3VD3A 1K12A 2VTFA 2W92A 2W1QA 4XUOA 3LPGA 3I3BA 3DYMA 1XNAA 2YB7A 2W1SA 2VZSA 2QQLA 2WO1A 3I2KA 3W5MA 1W8NA 3A7QA 4HG6B 4QX0A 4QPWA 2W1UA 3UESA 2WAOA 2J1EA 3GGLA 3IDAA 3C7GA 2VZOA 4CUAA 5FUIA 3CZUA 5JXJA 2W5FA 4FI9A 3HNYM 2VMCA 2C4XA 1WCQA 3K4DA 5HXMA 3T0AA 1DLCA 3I2FA 2J1AA 2V72A 2WYSA 4DEQA 1I5PA 3SKVA 4QX2A 1K45A 3GDBA 1J84A 3T0BA 3J7HA 1JZ6A 2QQOA 4L0PA 1XNTA 3C7OA 5EJZB 2VZRA 3K4ZA 2C9KA 3WNKA 1MPXA 1US2A 3FHQA 4UAPA 3SEPA 2VL4A 3SKJE 3FHAA 1PMHX 2VC9A 2E33A 3DYOA 3MUZ1 4P00B 1JZ5A 3NJXA 3NRUA 1JYWA 4A45A 2EIDA 1W9SA 4JHZA 1NAEA 5G04L 1UYYA 4QDRA 2W1WA 1LNSA 4BK4A 1GMMA 1OH4A 2CDPA 3LEKA 4PF1A 3UNPA 5IYYA 3U37A 2XQXA 5DPNA 2ORXA 2RVAA 2ZEYA 4W8JA 1JYNA 3LPFA 4CU6A 2WABA 2WO3A 3EYPA 2CDOA 3WF3A 4MGSA 3EB7A 3IAPA 2EIEA 3HNMA 1O8PA 3ECQA 3FL7A 2J1SA 2ORZA 1R64A 4OYUA 4CU7A 3ACGA 1UY0A 1GNYA 4PQQA 5CYYA 2VZVA 2W91A 4AG4A 2BERA 2VMDA 4DUWA 5I0DA 2WO2A 3A22A 4UOJA 3I2IA 3ACFA 5JMOA 3I3DA 2J1UA 1UZ0A 4E8DA 1T2XA 4QX1A 1GOFA 4XUNA 3VD7A 4AAXA 3CDZB 1UMIA 2VCCA 5LA0A 4CU9A 3OGRA 1PMJX 2WN2A 1JZ2A 2Y6JA 5IJRA 2PQSA 2J1TA 1UXXX 4BJ0A 1PX4A 5IFTA 3A21A 3HOBA 4XUPA 3K46A 5CZKA 5JUVA 1H6XA 1H6YA 4JKMA 2YC4A 5HPOA 1UWWA 3THDA 4DXSA 3VDBA 5LA2A 3ACHA 3VD4A 2YC2A 1GQPA 4KWUA 3HPNA 1TG7A 3LEIA 4LPLA 2YG0A 4KMQA 5C7GA 3BN6A 3GM8A 2YFZA 1JHJA 3I3EA 4ZY9A 3WNPA 5B4XA 2RJ2A 3P1IA 1ULPA 3PUHA 1JZ4A 4M4PA 1JZ7A 3MUY1 5C71A 1JZ3A 2BBAA 2XHNA 3T08A 1XPWA 2W9XA 4A4AA 1GUIA 4QAWA 3HN3A 3C7FA 2VJXA 4JKLA 4DEVA 3CKHA 4YPJA 3OEAA 1L7RA 2XONA 3I2HA 4LQRA 2VR4A 3AC0A 3OG2A 4RYDA 4PT6A 1L7QA 2B4KA 3SEEA 4XURA 5LCWL 1UXZA 2DCKA 2VM9A 3WF0A 3DECA 2VZQA 4LKSA 2QQMA 2HLEA 3MV01 2JKXA 2EICA 2C26A 1GOGA 4JKKA 4GWIA 2QQJA 2VCAA 5JR2A 1DYOA 1W9TA 1HN1A 1ULOA 5DQ0A 2ZXQA 4ET7A 2B9VA 2W46A 4QDQA 5LA1A 2DCJA 1OD3A 5IFPA 2VOTA 3C7EA 1DP0A 3DYPA 5B4NA 2VZ3A 4ZXEA 3I2GA 4A42A 2Y6GA 3WNMA 1W99A 3OEBA 3ABZA 4MO3M 3F2ZA 3NJVA 1W8OA 1O8SA 3VD5A 1OT5A 5EJ1B 3E1F1 1YQ2A 5JXHA 1EUTA 2ZEZA 2X10A 2X05A 4A6OA 1CZTA 3MV11 3WNLA 1D7PM 4BDVB 2OKXA 3A23A 4OMCA 2Z4FA 3T09A 2E26A 2J1RA 3LE0A 3WF4A 1UYXA 1SDDB 3MBWA 3OB8A 1J83A 1NUKA 1SG3A 1UY3A 2VZ1A 2J7MA 5DN2A 3T0DA 3WF1A 2LS6A 2JE8A 4QX3A 3WSOA 4UI9L 5EIYB 3ETPA 1CZSA 1JU4A 3HNBM 2Y64A 3C7HA 3VD9A 4TTGA 4DUXA 3T2QA 4W50A 4P5YA 1XC6A 2VCBA 1O59A 4ZZ5A 3PUIA 2E31A 4BK5A 4M4RA 2DDUA 3THCA 1CZVA 4MOAA 5IHRA 4GWJA 2RV9A 4QB6A 4OZOA 2XOMA 3ZM8A 4Z2AA 3K77A 3T2PA 4JX0A 4ARXA 3LQCA 3WF2A 1NKGA 2R7EB 1OF3A 4XUTA 4ARYA 1JZ8A 2VQUA 2VZPA 1TVGA 4E8CA 3IIIA 2QQIA 2WUHA 1KEXA 2VMFA 2WQ8A 4GZ9A 1RYYA 4D0QA 3CIHA 3K75B 1UMHA 2L9LA 1JYXA 5A1AA 1PX3A 4XUQA 3ACIA 1JU3A 1KGYA 4OUEA 5JXIA 4A3ZA 2HYXA 1UYZA 3WNOA 4KI5M 2VO5A 2J1VA 2Y8KA 2QQKA 4A41A 1UY2A 3WEZA 1US3A 2QQNA 2ZEXA 2LW8A 2ZEWA 1F4HA 2V4VA 3JXSA 4MGQA 1W0NA 4QDSA 4DXTA 3IAQA 3VDAA 3C8XA 1CIYA 2EIBA 2Y6LA 1EUUA 1F4AA 3OGSA 4BXSV 3WNNA 2VZUA 2VMEA 4CU8A 5J1XA 3CZJA 4MADA 2JDAA 3NNGA 3UETA 1K3IA 2WDBA 2BGPA 3T2OA 1UY1A 1SHWB 2W47A 4ZZ8A 1W9WA 4RN5A 4CUBA 3HEIA 4QB1A 4XZUG 3FN9A 1GU3A 2X09A 3BGAA 4LHSA 4QB2A 3OGVA 2WZ8A 2JD9A 3I97A 2VQTA 1P8JA 1GOHA 2BZDA
chains in the Genus database with same CATH superfamily
2CTVA 3HJRA 3WCSA 3ZO0B 5FZEA 3JB4C 2YROA 4N53A 2WL1A 5CISA 2XJQA 1XBFA 3RYRA 5C70A 3USUA 2J42A 1RUOA 1DIWA 1VBC3 2B45X 1O4YA 3SISA 2Q8DA 4AOCA 1WW7A 3MW3A 4LO4B 1RUJ1 2TNFA 1RINA 2W94A 1DGWA 4SLIA 1AXYA 2WBKA 1O3QA 3K48A 1REDA 2VECA 1RUG1 4QPGC 3AP9A 2ZHLA 1S0FA 2YFUA 3KLSA 4QPIC 4UFHA 4O7XA 1Q5OA 4CTEA 3OBTA 1TE1B 3UKTA 1OC1A 4FAHA 1E5RA 4OVEA 1AR73 2XVKA 1OF4A 2RS11 5DAWA 1D0HA 3LAGA 3P3NA 1QEXA 1HXS1 2W95A 1K42A 1QJY2 3WCRA 5F39A 2WNUB 1U5YA 4RS5B 3IB3A 1TQ5A 5FY5A 2WNUA 1O3RA 2ZHKA 4ZU7A 5IVEA 1HJGA 5JOZA 2I2SA 1UX7A 3AP4A 4I3PA 2VVDA 1D4M2 4PIZA 5G05L 1G6NA 1V9U2 5JR7B 5JXGA 4C0HA 4HLTA 4LBNA 4CDUA 2FDIA 2Y6HA 4QKBA 3GXUA 3WG2A 4EZ4A 3TN92 3D3AA 2D97A 4WVZA 1UIJA 3E6DA 3POYA 3MFCA 2JIGA 4GA9A 3VD3A 3RZMA 5EWSA 2VTFA 2D3RA 2W92A 3WR0A 5T5LA 4HANA 2OQ6A 1DGLA 1PVXA 3ACLA 3KHBA 3MIHA 4G4FA 4XFFA 5F9TA 1TEIA 1O6UA 5EZWA 3PU8A 3SCFA 5J37A 4GALA 2H0BA 2SBAA 2R1BA 4N7UA 4IGOA 1DZTA 2TBVA 1XNAA 4QQPA 1W8WA 3AMMA 4OQ9A 1RUE3 2QQLA 3W5MA 3A7QA 5A3WA 4HG6B 4CXYA 1F5JA 3JD71 2RE9A 1UZVA 4F3JA 2WAOA 1LGCA 4Q4Y1 5FYCA 1YLLA 4YZ1A 4PBOA 1ND2B 2VZOA 4WZCA 3FZ3A 3EXUA 5FOJB 4YW3A 1OH3A 4RQPC 2ZZJA 2JDUA 4IEUA 4DMIA 5I8YA 5KXCA 5DUWA 5IATA 1DZQA 3AJZA 4EWEA 5F37A 5JCTA 1WMXA 2GU9A 1BBT2 2QUOA 5F5IA 1VB2A 2DFBA 1W39A 2MHFA 3POSA 3U78A 1DLCA 5FZ3A 3ZFEC 5C6CA 2PLV2 4WVWA 4UFLA 2VNOA 1ENXA 2VBPA 3W21A 1OFNA 3LSDA 5FBZA 3TRSB 2WNEA 4K1YA 4QX2A 3EHKA 4P9WA 1IS4A 3T2TA 4L92A 3J7HA 3Q9OA 1Q43A 2KR2A 3M3QA 2RM22 3MICA 2QQOA 1VBB3 3ZKUA 4EWAA 1XNTA 2D98A 2E7QA 3UGGA 4LKEA 2VZRA 2A6VA 2OS2A 4D6RA 1PK6A 3IT8A 3K4ZA 4KWJA 1MPXA 1US2A 5FZIA 3FHQA 1HRV1 1CAWA 3GCWA 2YU1A 2ARCA 1AL0G 4H7MA 3BTXA 3SEPA 4P5HA 2VL4A 4BQ1A 1CAWB 1OXCA 3MUZ1 1ZA4A 2Q1ZB 2CYFA 1G9BA 4A2UA 3DPRC 1PK6C 4PJYA 4CCNA 1REFA 1NLSA 1X9TA 2DU1A 2OXBA 4A45A 1WGPA 1W8ZA 1W9SA 2EIDA 4AFCA 4DB5A 4JGYB 4JHZA 1LOEA 4TYSA 3IPVA 2GH8A 4XFGA 3WDXA 3UKNA 2C1FA 1CWPA 2DUQA 4W6YA 2RS13 3H3ZA 1OH4A 4M00A 4DY3A 2GAUA 1IKPA 3FLTA 4PF1A 4IE0A 3U37A 2O14A 1XRUA 1OQEA 1QMJA 1UX6A 4COWA 4YM0A 4ZPIA 2VCMA 3OUJA 4FT8A 1CAVA 2ORXA 5DPNA 2UWAA 4BWOA 2CGOA 2LUWA 2Q0AA 4YNIA 4JRAA 5FZOB 4O9EA 2GALA 4HK9A 3ZXKA 1AYN1 1VAMA 2BU9A 3BOPA 4EN8B 4HKLA 1A34A 2RMU1 1YQ8A 2EIEA 1OVSA 4MGTA 2YPDA 3ECQA 3O1UA 4C91A 1I1EA 1UZZA 2J1SA 4NUBA 1W2NA 2CNAA 4CEYC 1WW4A 1XE0A 3ASIA 5LA9A 3WQ7A 4B7KA 5FK7A 3JD72 3ZKYA 1GNYA 3KZ4C 5FYUA 1FNZA 5CYYA 1LGNA 3BOWA 2W91A 4V2VA 5FZAA 5DXDA 4AG4A 4Q4Y3 5A1FA 3WXPA 4TLGA 2VMDA 4YVSA 4LBOA 5I0DA 3B02A 2WO2A 4UOJA 5FTTC 1G86A 3WT3A 3I2IA 3N9NA 5GZFA 4PDWC 3D8CA 4XYXA 3IMMA 2ZJCA 4MHUA 2GDFA 4HKOA 1FXZA 4MH0E 1UZ0A 1IPJA 5EFUA 3NWKA 1XNKA 1H4HA 3JBG3 4AGRA 1BYHA 4XCBA 1JS9A 2UY8A 1RHI3 2Z79A 4LBQA 5FR3A 5JSRA 1MS4A 4RR3B 5CVRA 1PGW1 1UCXA 1WD3A 2GNDA 4XDPA 2PQQA 2KM2A 2A71A 5BY5A 1LAJA 1VMJA 4G9SB 1JN2P 2PQSA 2J1TA 3RWNA 1UXXX 1W8FA 5H9PA 4YZ2A 5FZBA 2YHJA 3KV5A 1SBFA 2IVJA 3MW2A 5A7QA 1ZREA 2DCZA 3A21A 3AL5A 3HOBA 3S6PA 3I54A 2X29A 5DDJ2 2HWC1 1SLTA 4BMEA 4Y5TA 4JKMA 1PM4A 3LOIA 3Q8BA 5HPOA 5IVCA 3POGA 4LO7A 3KGZA 4RGAA 3ACHA 2BNOA 5CNAA 2YC2A 4WM7A 4D7TA 2Z69A 2YG0A 3U75A 5C7GA 5A80A 3RQ0A 4NN0A 4R52A 4BISA 4FPJA 1JHJA 1V6LA 2VAUA 4ZY9A 3RYPA 3WNPA 4J6GA 1YRZA 2RJ2A 3SLIA 3NV3A 1OPOA 2FMDA 1W6OB 3X29B 2LRPA 2H6CA 4Y4RA 3R4UA 4M4PA 5FMCA 3VZLA 4GAZA 1BEV3 1JZ7A 1JZ3A 3T08A 2W0XA 1GLHA 1QJU1 4DIQA 2H0VA 1L3JA 1OVPA 4QU2A 3VBUA 3NV2A 3ZN6A 3DL3A 4YVWA 3H8OA 1AR72 3ILNA 4NRPA 1MQTB 2ZA9A 3ATGA 3OJBA 4IGQA 5FREA 3ZIWA 4CXWA 2VUJA 5JIAA 1MQTA 3OEAA 1AL23 3I2HA 4LQRA 4RHV3 4Y26A 1MZ5A 4AHWA 1RUD2 2ATFA 2X5IC 4FAGA 1VBC1 3NW4A 4QHBA 3VUOA 3I49A 4MXWA 4KL1A 4MLOA 1FNYA 4D7SA 2GC2A 2Q1FA 3H9AA 4KH9A 5FDBA 4R4XA 4CXXA 2VZQA 3OF1A 2VTXJ 1ST8A 1TME1 3TAYA 4JTOA 4PIXA 4HETA 3WP6A 4A7KA 1V6NA 4KU7A 4LA2A 1QJX2 1PVC3 1R092 2DTWA 1RUH1 4HOOA 5KXDA 2B39A 2W52A 3EO6A 2WZR2 5KR7A 2DU0A 4YARA 1HN1A 5FZ7A 3H3LA 4CPBA 5GALA 4AI1A 2ZX4A 1C8NA 1NLQA 4R9AA 3BU0A 4LKDA 1W04A 2GMMA 4O65A 4ET7A 5FPVA 5C3SA 1AJKA 1UOFA 2BTVC 4QDQA 1POV1 5LY1A 3BKZA 3QH7A 2PELA 5IFPA 2DFCA 4DO0A 4XQDA 3FE5A 4NIHA 1ZYBA 1QQP2 1RTVA 4U36A 1AYM1 2YXSA 1VRBA 2V09A 3WP4A 1HLCA 1VALA 3AMNA 4JDNA 2IFRA 1H0BA 3ZXGA 3O1TA 3VD5A 2VD7A 3NJVA 1W9FA 4JGZC 1OT5A 2JD4A 5JZGB 2R042 3E1F1 2IWGB 1YQ2A 5JXHA 5JZGA 2FCVA 1JOBA 2XBO1 3SCHA 2ZOEB 1UNBA 1FV2A 1QXPA 4XQ4A 5J48A 1OOPA 2IXIA 3OD4A 1CZTA 1YNAA 2P1BA 5CB7A 1CGPA 1H2LA 1FATA 1VPHA 1S0DA 2OKXA 1AR81 3TOJA 4FTEA 2YZ4A 5K9YA 1IHMA 4UW5A 3R6SA 1Q8SA 1AR71 1YC61 3T09A 3EBRA 3LE0A 1GZCA 2FMYA 3SXWA 1UYXA 2WT0A 2C5DA 3O5SA 3KV4A 5FYYA 4BLJA 4KG0A 4DZGA 3O1MA 3HQUA 2BJSA 3RGBA 1QF3A 1GBGA 4K8RB 1MVQA 2XJSA 1VBE1 2WJSA 5ABJA 2XWBB 4QMAA 1W6PB 4DXZA 2EXJA 3DCQA 2ZGPA 2J7MA 3MGUA 4TN7A 2RS31 3T0DA 1Y7BA 1RMU3 1WCKA 4HSJA 2UWBA 1BVP1 4QX3A 4K7JA 2G9ZA 1RITA 4TLFA 3TWIA 4DY5A 4GMP1 1OHFA 1NT0A 1HQLA 1R083 3HNBM 2XHKA 4BXFA 1QJX1 3KF3A 4UF0B 1N3QA 1VBA2 2BBVA 4Q4V3 2JG9A 2OVUA 1XJAA 3PUQA 1Y9MA 3C7HA 3L2YA 4JGZA 1ZA7A 4XZPA 3B7MA 5F32A 5EP9A 4PI2A 2JKBA 2PHWA 2GP3A 1KFXL 3GNEA 3T30A 1PO12 3G6JB 4LO6B 4Y1VA 1X8EA 2DVAA 2R071 1WLCA 1MZ6A 4QGMA 2HWE1 3KVBA 5FAXA 2D5HA 3POEA 2AR6A 1SLAA 2AEYA 4NIAA 2JWPA 2F4PA 4GWJA 1W2TA 1SPPA 5JPMB 4HKWA 1ULCA 4DFSA 3KSCA 2WO7A 2XOMA 1QWRA 4OZOA 2NYYA 3TEWA 1RUD3 4JX0A 5CG9A 3N9MA 1G7YA 1AL22 1NKGA 4RHV2 4ARYA 3N7LA 4XJAA 4AXOA 3ZMOA 2VZPA 2YV8A 3GHNA 4Y3OA 3VB9A 4D6QA 1X36A 1ZBA1 1OA4A 1OUSA 1KEXA 2ZX3A 5HCHA 1LU1A 1Q8QA 1EV13 3V0BA 4KBZA 3P3PA 3JZVA 3CNAA 4MGKE 1ALYA 4BQ3A 5FPXA 5D21A 3AZZA 1O4ZA 3K75B 4QT6A 1PO21 2Y0OA 2H6BA 2UU8A 1SZBA 5A1AA 1SLIA 3K3NA 2JEMA 3D0SA 2BP6A 5A6XA 1QXRA 4XUQA 4AR2A 1C8M1 1YFUA 2D93A 1PIV2 4LUMA 5FO9B 1AR91 3E5XA 1KJLA 1YJLA 5K0UA 1YO8A 3J4UH 4PLOA 2B42B 2NQYA 2OYZA 2MEV2 2HWF2 1AVBA 1HKDA 1LHNA 2YU2A 3M3OA 4IEOA 4IESA 1HXS3 2HJIA 4JRLA 3EJKA 2J1VA 2ZGTA 1YJKA 3N9QA 5LK7B 1SACA 2QQKA 2UWCA 4IW3A 1UY2A 1ZBE1 5GLZA 3BTYA 4N90A 4CSWA 5FMDA 3BU7A 4LBQB 2WLPA 3LWCA 4YW2A 5LBBA 3VBFB 5F3CA 4LLOA 4MGQA 3V0AB 1SCRA 2D3PA 4DXTA 5C3RA 2XJPA 2ZKNA 4XXPA 5I0SA 4IEZA 2XMLA 1RUJ3 1TNFA 4IL7A 4M01A 3MDPA 4XJ8A 2EIBA 2EALA 1SDWA 1Y43B 4BXSV 3ZYPA 4JCKA 4C1WA 4LORA 4CU8A 4FPYA 3WX5A 3N35A 1Z7S3 5LATA 4ZHNA 1N3OA 3ZR6A 2FD8A 1QGLA 2JB8A 2R30A 2BGPA 1ODMA 2YBPA 2W47A 4COYA 2Q5TA 2ZGRA 4WM8A 3ZSKA 2WR9A 4XZUG 4M3CB 5IVYA 3M8LA 1UO9A 1I3HA 3VN4A 1MZFA 2OA2A 3T3YA 4Q0QA 1VMFA 2VW0A 2JD9A 1P8JA 4BH9A 2XJTA 3UKVA 4CYDA 3WDUA 5FO8B 4E2QA 1W28A 5FY8A 5DDJ1 2PLV1 3W5NA 1UPIA 4BLIA 1K5MC 3SH5A 5JAXA 5D2AA 3VL9A 5GLWA 4CCMA 2ZX2A 4X6RB 4LO5B 2JXAA 3ZXAC 3WQBA 3ZLIA 5FYBA 3FLRA 1ZRIA 1I5ZA 3AYEA 1BHGA 3ILFA 4URTA 4Y1YA 1W90A 3I7DA 5CKMA 3HT2A 2AC1A 2K9ZA 2RM21 5IUQA 5CFCC 2ARAA 1BCXA 1W6PA 1IPKA 3J7NA 3LA7A 3SH4A 4Q1RA 2VUDA 1CX1A 4AI2A 2ETEA 2WWJA 4FPCA 3UV9A 3ZPYA 3BCWA 5DMYA 5JMCA 1FOD2 1QDOA 3THTA 3S7EA 1LEMA 2JG8C 2J22A 1B35A 4ASLA 1JODA 1OLMA 4JGYA 4S2GA 2ZABA 4JGZB 4UFJA 4LK7A 2Y6KA 1JUHA 3DKWA 3ZFEA 4AGVA 3M3EA 1ZRDA 1HDKA 5IAVA 3HD8B 5C5UA 3KMHA 4XJZA 4LUKA 1KFUL 2PFWA 3GBGA 4NPRA 3WDVA 2QCSB 3WP5A 1QDCA 2UYAA 2ZHMA 3OBZA 4DOUA 5FY1A 3NSTA 2XGXA 4HZFA 4P08A 5FZOA 2AEZA 1ENSA 1IZ3A 5DAVA 3I2JA 5FYVA 3WUCA 1JYVA 4S2DA 3SHRA 3LZZA 3ZDSA 4N7IA 4DXRA 3GZUC 1AYN2 4QXBA 2XQRA 5IVFA 4NHMA 2LM3A 1ASJ3 1WWYA 1K12A 1ZRCA 2W1QA 3GYDA 1R1A2 3VDDA 1TMF1 1ND3A 4GQ7A 3LPGA 1FMD3 1NOVA 5E6HA 1JOPA 1MZEA 3J8F3 3DYMA 3U14A 5FRAA 3IDEA 4WVMB 3WNXA 2K0GA 1S0EA 2NZ9A 5DAPA 4JQTA 3ZYJB 1PHMA 1W8NA 4BQXA 2ZKLA 4YVSB 4M0HA 4Y1ZA 2W1UA 1YQCA 2F17A 1OKOA 1RUI3 2RJKA 3MPPG 3SITA 3WINE 3IDAA 2OQ7A 5LRRA 4CUAA 5FUIA 3KCCA 5T54A 4F83A 4AL9A 3PNAA 1TZOA 1I9RA 4I2OA 4OI4A 2V5YA 1F35A 4RL7A 5KHIA 1F5FA 5LEKA 1GWLA 4FI9A 2XUMA 5FP3A 1W03A 1R1ZA 4W6WA 1R1A3 1F9KA 3K4DA 2WSUA 1IOAA 5D1IA 4ZS3A 1CONA 3U0ZA 4XFCA 2A75A 3I2FA 1ZRFA 1FYUA 4GJYA 3WW3A 2J1AA 5L9VA 2WYSA 3JQXA 5I8TA 5FYHA 2D6KA 1I5PA 3RZJA 3SKVA 5B2GB 4EE2A 1K45A 2Z42A 2ZPXA 5FCCA 3CO2A 1J84A 1X9PA 2ZHNA 1ND3C 2D44A 3SC7X 3B94A 2ZBJA 2IVIB 4N53B 2EAKA 4UW4A 1JZ6A 4XAAA 3E6BA 2YPJA 4CCDA 3PURA 1D4M3 1G9FA 2QZ3A 3C7OA 4C1XA 2VNVA 1XB9A 1V0AA 3OPWA 3U4XA 1ZBA3 5A7OA 4CA9A 3J7LA 2C9KA 1LU2A 2D40A 4UWDA 3AZVA 3C3VA 2GMPA 3J7MA 2IC1A 1MEC2 3MIFA 3AFKA 4FOWA 4UAPA 3FFQA 1PM7A 2C6SA 5FLIA 3NL1A 5FZ4A 3FHAA 1PMHX 5CFDB 2FDKA 3DYOA 3OSDA 3NVCA 1JZ5A 2WS91 1ULFA 4GD4A 5GLVA 5BV6A 5HV4A 3V0BB 3CJIB 5FMOS 1C1LA 1O4TA 3UT0A 2Q4SA 4QKNA 2WFPA 4IV1B 3AB0A 1GP4A 4AFDA 5CFCB 1O7FA 4QXCA 4AEDA 1LOGA 4I09A 1NAEA 4AF9A 5A3UA 2R073 5CFCA 1UYYA 1J1TA 3HWJA 5C8CC 1W6MA 1NCQB 4XF1A 4DRRA 4PHZA 4H3WA 4COZA 2BNNA 5FYMA 2X53S 1RUE2 4Q4V1 2JG8B 2FDGA 2ZZQA 1FX5A 1PO13 5JI9A 4GMP3 2D6LX 2XVGA 3K2OA 4W8JA 4AQ6A 5ERLA 1JYNA 1UIKA 3NNLA 4FPHA 5FY0A 5H9QA 1WBLA 1VBA3 3NV4A 2WO3A 3I59B 4URAA 1RJ8A 3ME2A 5CBLA 3EYPA 3WF3A 3BPSA 4MGSA 5IVVA 3EB7A 1RUF3 2VMIA 3IAPA 5T5PA 2QZ2A 2YUEA 2JJ6A 1O8PA 3PVOA 4RGKA 1G8WA 5DAQA 4B3NA 5K0UC 2A6XA 2IUWA 1PIV3 2B9UA 2P17A 4QQLA 4YFZA 5FZHA 3N4MA 3I2DA 3KCXA 4P9JA 4C0BA 4AVBA 4OYUA 4QPIB 1LR5A 3PHMA 1UU4A 2C0ZA 3WP3A 5JZGC 3VDDC 1GZTA 5T52A 3H7JA 4PQQA 1C8M2 1LEDA 1YUDA 2ZGMA 4M3CE 1H1MA 1DU3D 3RSJA 3VZMA 5HCAA 5HV0A 5KHJA 5FZCA 2GN7A 3PUAA 4Z1VA 3VKFC 2CWSA 1V6JA 2XJVA 3POWA 4NVPA 3ZFGC 1D0GA 1ND2A 4KWKA 1AXKA 3N7JA 1G9CA 2D7FA 1EPWA 1VRH2 1OUXA 4CZSA 3BIEA 3NMBA 3KT1A 4XUNA 3F95A 1F2NA 5L36A 1FOD3 3VD7A 4AAXA 5A3TA 1H8TB 3CDZB 1UMIA 3CJXA 3CF6E 2VCCA 3VBFC 4AHZA 5F1RA 3ZN5A 4PCRA 4YLZA 2NN8A 1GP6A 5IJRA 3ZYHA 2K46A 4BJ0A 1PX4A 3DF0A 5JSOA 2G4IA 3T4VA 3LFMA 3VZJA 2YDEA 2JIJA 2W08A 2PHRA 2JDZA 2C24A 4UYBA 5F6LB 5IFTA 1X33A 4I0AA 5GLUA 1T6GC 1UZWA 3K46A 1GICA 2Z2SB 3N9PA 2BUKA 4PBPA 5JUVA 1W6QB 2PHLA 2MEV3 1W05A 1C28A 2YC0A 1W6QA 5LW9A 2CAUA 1J3RA 1VBD2 1YCIA 2P4EA 1VBB2 4FXKB 3S57A 4OI2A 2Y6FA 1TG7A 3HPNA 3OYWA 3RPQA 4LPLA 4KMQA 3GM8A 3ZXLA 1MS8A 2DTYA 5APAA 5I91A 1HJFA 1UAIA 2D6PA 3I3EA 4UT5A 2A1XA 4J1XA 1CIWA 3WV6A 1PVC2 1R093 5B4XA 4CDUC 2IXHA 3P1IA 1ULPA 3OUHA 3PUHA 5A3LA 2JG9B 1C57A 3MUY1 3WD5A 2OZ6A 2HBUA 1S0IA 2I74A 1SBEA 2XHNA 4XEZA 5FUNA 2W9XA 3HIFA 3EQEA 3UJOA 4CDQA 5T55A 4A4AA 3N7MA 4Y22A 2A5ZA 1GUIA 1HX6A 4BCUA 3AKPA 4F8AA 1H2NA 2JX9A 3CKHA 4YPJA 5FOBB 1AYM2 2XONA 4FPEA 4SBVA 3ZYFA 4X6QB 4AHYA 1COV2 4J1WA 1C5IA 2BFUS 2TEPA 3P5BA 3VBOC 4LA3A 3LA3A 3N3HA 4FOYA 1BJQA 3NAPA 4P14A 2E6VA 1L7QA 2ZGLA 5AC92 1RUJ2 1ZX5A 2FDJA 2VQ0A 1H8TC 2VM9A 4O9GA 2PN5A 3WF0A 5L7OC 2VW1A 2QQMA 2JDKA 2HLEA 1OA3A 4LULA 4NWVA 1QOSA 1DQ4A 2JKXA 2EICA 3AP7A 3TB0A 2Y0IA 1GOGA 4JKKA 1J1LA 5LBEA 1A78A 2GNBA 5CFDA 3RG0A 3BVCA 5L19A 1C8M3 3UYJA 2R6QA 1W9TA 3WOGA 3I3QA 3WQ1A 4JTNA 3O7OA 2IFWA 4NHYA 3S7IA 2B5HA 2JB4A 2ZXQA 4IV1A 2B9VA 4N43C 4NPMA 2RR12 2JDHA 3URFA 1LB2A 2DCJA 2V4AA 3TNPB 3HMYA 5KHGA 3BYWA 1V9U1 2VOTA 4NR1A 3M3CA 4K6BA 3U10A 1GSLA 3DYPA 1NCQC 3WY6A 5SV5A 1V9U3 3VLBB 5B4NA 4ZXEA 3I2GA 3LA2A 3DXUA 4BB3A 1GANA 2ZAAA 1RHI1 1YIFA 2RS52 1OURA 4X8NA 1G9DA 1SLLA 1O8SA 2JDMA 4YZ3A 2VY0A 4UFKA 4XACA 4DS0A 1W6NB 2D6NA 2X10A 3LB9A 1XXNA 5BNNC 1HV0A 1HRV2 4PDWA 1ODNA 3OY8B 1NY71 4XMAA 4MZUA 1OOPC 4FFHA 4AZZA 1W2OA 1H2MA 1WLTA 2ZCWA 4QPGA 5FP4A 2XVLA 3VHPA 4BMBA 2HWE3 2ZGQA 3HN1A 3MV11 4IERA 4IETA 4QPGB 1HW5A 2O1QA 4WBBA 2E9QA 5FZ1A 3WZ1A 5HBAA 2DCTA 3VBHB 4LXLA 3A23A 4YGCA 4OMCA 2Z4FA 1LOCA 2R043 3VZNA 3RMYA 1YHFA 2E26A 2J1RA 2XB6C 3ZYBA 2GC0A 3MBWA 5CU1A 1MS0A 4FCAA 1AF9A 1W9YA 1R081 3OUIA 3FHIB 3ZR5A 1A3KA 1J83A 1NUKA 4XILA 4EYUA 1N1SA 4RA0A 2GMEA 1X8MA 4GWMA 5L9BA 1QQP3 3EMRA 2EA7A 1C5HA 3K3OA 2CWMA 1AYN3 2VZ1A 1V6IA 4HPKB 4KWLA 2WWSA 4A3XA 2SLIA 3WF1A 1VBE3 2EAAA 3ZPOA 5J09A 3I4IA 3VBOB 3KF5A 4K40A 3ZN4A 4U2AA 2Y64A 4FO9A 4FPGA 4CCCA 2BV4A 1U5IA 4TTGA 4DUXA 3PVEA 1AX0A 1OA2A 4AEDB 1Z0HA 5JPNB 1AR83 3B93A 4YVWB 2DVBA 1RGSA 2AZ5A 4OI0A 3L9JT 3H50A 2JG9C 1S2KA 3D0JA 3HQRA 4YFWA 5FJKA 4BK5A 4CDXC 1HRI3 3THCA 1UZYA 3M3IA 3CLPA 3VBSC 1ACCA 5J98B 5C8CA 3DV8A 1WLWA 2RV9A 2BGCA 1LOBA 4YWAA 4Z2AA 2HWB3 3G7DA 1MQTC 3T2PA 1REEA 4ARXA 5BNOC 1S2EA 3AMHA 4LE4A 4YW1A 4EZHA 3H3UA 3RZKA 3ZSEA 4E8CA 1ZVFA 1I6XA 2LTNA 5A3PA 4CPBD 1FOD1 1VAKA 4ATEA 2HWD1 1JXNA 3ZXEA 3MLJA 2BVBA 1STMA 5F5CA 1QHDA 3CIHA 5ACA2 4BOWA 4XXAA 5T5JA 4Y20B 1UMHA 4FP3A 2L9LA 1Y3TA 4Y22B 2XLGA 1JYXA 1K5JA 2RM23 4ES9A 5IK5A 4MUVA 4B8EA 4L8QA 1BMV2 2WQZC 3AKTA 1JU3A 1UOJA 1XU1A 4YZ5A 4WM7C 1RXGA 2GZWA 4IEXA 2B46X 4GKYA 3WDYA 1RL3A 1CAVB 4R9BA 3M1HA 3Q8AA 5KXEA 4YW7A 5ANNA 3HQXA 3ROUA 4LK6A 3LEMA 3ZXFA 4DRVA 4NIIA 1UKGA 4LOSA 2NPIA 1Q8VA 2F6BA 2QQNA 2WZR3 3JCIA 3OPTA 4LO8A 3DUIA 4BU2A 3JXSA 1QNYA 5FKCA 1WW6A 5A1LA 5BYNA 4LIUA 3VDDB 3PLQA 3M4FA 1GR3A 3AZXA 3KGLA 4Q4W2 3IN9A 4XW3A 4CDUB 4AFMA 2PAMA 1AR61 4OCTA 5FO7B 5KWRA 1JUIA 4R4ZA 2HWE2 3AYDA 4QGLA 1PO11 2Y6LA 1OLQA 4A6SA 1GYKA 1ONAA 2LROA 5HCFA 4RSUA 1V70A 2VZUA 4AVVA 4INDA 4ONUA 3GHMA 1NCRC 4K1ZA 1YWKA 3CZJA 4G3YC 3V56A 4A7ZA 1JBCA 5ABJB 4AVSA 2P3YA 3NNGA 4LJHA 3QBQA 3UETA 1SFNA 1VP6A 2WNUC 1NCRB 1W9WA 2LALA 3LKJA 3W59A 1KITA 4RN5A 5FWEA 1ASJ2 4ZZ8A 1UOGA 2VOWA 3ZMNA 2HYKA 4PDWB 1GU3A 2GH2A 2DBIA 4E2GA 3TN93 5CKNA 2WZ8A 1IS6A 3V64A 4CCEA 1K5MB 1GQHA 1M4WA 2VQTA 1GOHA 1OQDA 2NMNA 4O61A 4FPFA 4QQHA 5EJ3A 4OHYA 2HEYF 3CL1A 1FPN3 4CEYA 4EN6B 3PMSA 3NJYA 1D4M1 1JI6A 3HBKA 4UW3A 3MLLA 1IQDC 4QM9A 4CEYB 2W3JA 3S30A 1VLNA 4XFBA 3A0NA 4QX8A 1POQA 2ID4A 5FYTA 1MS1A 2PYTA 4NO4A 3A4UA 3TBDA 3CHXA 3CMGA 3E5UA 5FBJA 5DZEA 2JDYA 1YI9A 2HWF1 1YXWA 2Q30A 3LDBA 1ZZ6A 2XL7A 3NAPC 4Y1XA 5FPAA 4Q8KA 1RXFA 1Z7S2 1PO23 3K4AA 4DUVA 5A6YA 1WD4A 2DVFA 3P6BA 4MV2A 1O5LA 1D4VB 3WW4A 4IEYA 3DPRB 1BVVA 3PJQA 2WS92 1W6OA 5LZ6A 1TME2 1U0AA 1U5XA 3DPRA 4LTAA 4CUCA 2N7GA 3AZYA 4D8MA 2IXCA 2VZTA 2YGLA 3ZN6B 3NJZA 1BMV1 3SH3A 1ZM1A 1M06G 3CQOA 3VKOA 4ZXKA 4ASKA 1X50A 1W6MB 1N1TA 4CVUA 3AYCA 2VBDA 1RUD1 3FUQA 4W4ZA 3J26N 1KXGA 2WAAA 3R4SA 1ZNPA 3VDCA 1YQ6A 3ZSJA 3I8TA 1NX9A 2EXHA 1Y9GA 5J3UA 4ZONA 1QNWA 2GC1A 1R082 4RFRB 2QVSB 3WVJA 2RDSA 1VBE2 3Q8FA 4B29A 2VU9A 2Y60A 1Q56A 4TXWA 3VBSB 2WZEA 3OY8A 1URXA 4OMDA 4A44A 5JLVA 1RVF1 2JENA 2W87A 3KCYA 3GZTB 2YMZA 1DZRA 3ZOIA 5FPUA 4JDMA 5FKBA 4XUOA 1KQRA 3O0VA 4DQAA 1BBT3 2XWJB 5BNQA 4IE6A 2HEWF 3I3BA 2PAKA 2YB7A 2W1SA 2VZSA 2WO1A 5A3NA 4R8HA 1LKNA 5I0TA 4QX0A 4JC1A 2BVVA 3UESA 1DQ6A 3GGLA 3OTFA 4GULA 1QY4A 4L9BA 3LOBA 2WSVA 3NKGA 4FTSA 4MGIE 3D6EA 1HRV3 3CZUA 3IZOA 4JQRA 5T5OA 2DF7A 3T4HB 5BNPA 2HWB2 4FPLA 2BDRA 5JXJA 1QH7A 3KD4A 2ZGKA 4P9YA 4LBKA 1OBNA 3AM2A 2VQAA 4CDWC 4FSJA 1OI6A 3CU7A 3HNYM 4AI3A 3VKNA 2OZJA 2JE7A 3KS7A 5IVJA 2XBO3 3PMEA 1AR82 1HXS2 1S1AA 3U11A 2V72A 4ATFA 2FCTA 4QU1A 4DEQA 4Q0SA 2VULA 4IQPA 2AUYA 2Z5WA 2PHDA 1VJ2A 3PL0A 4W6XA 4E2SA 5EXOA 2XUEA 5FZFA 4MVTA 4GIQA 5F2SA 3RJRA 2X8KA 3AZWA 5SV8A 5EJZB 1UW8A 4AEMA 3WNKA 5FZMA 1NZCA 1QOTA 1WCDJ 2GNMA 4YM2A 5FXWA 5JOWA 3RI8A 4WV8A 1GNZA 3VGIA 3WW2A 5EYYA 3SKJE 1F31A 4LE3A 1PZ9A 4NMIA 4FPOB 4YW5A 2Q8EA 3MPBA 4P00B 5C8WA 4QKDA 5LEJA 2W68A 3H7YA 2WQ4A 4IGPA 3BTAA 5CKQA 4EN7B 2PMWB 4PLNA 3IPVB 3RRDA 1E57A 1J3PA 2XDVA 4FFIA 4OHZA 4CDWA 2VMGA 1ZZ7A 5LRSA 1QJY1 3U1XA 3HAGA 4QD2A 5G04L 5BXXA 3RYKA 4QDRA 2EVXA 2GNTA 4BHPA 4BK4A 3MIDA 2CDPA 3GZAA 4Q4X1 4K3UA 1D2SA 3UNPA 4XIOA 4FOQA 3MLKA 2XQXA 1VBC2 1BKZA 1WW5A 4FQZA 4I3GA 1BEV2 3FBMA 1BXHA 2RVAA 3OGJA 1X7NA 2QJVA 1EP0A 3B69A 1AL21 4Q27A 4RHV1 1AR92 1LHUA 1L7LA 3RFRA 1ULGA 2RS53 4CU6A 5CFDC 5A7WB 5GZCA 2WABA 3POJA 4QQ2A 2K2SA 4Q0UA 1TNRA 1GZWA 1BZWA 1HQWA 2CDOA 4K21A 2P6CA 1RUH2 2AH2A 5JIUA 5IAXA 1IGOA 3NO8A 3H1YA 5IK8A 3NNMA 5LY2A 1ND3B 4LR4A 4CDQC 4PF5A 2ORZA 4ES8A 5C3OA 3O1PA 2OX0A 4IE4A 4IV3B 5BNNA 5C3QA 5TSWA 1D2QA 1J3QA 5FY7A 4CEWC 5D8AC 3TEYA 1HN0A 2EXIA 3WLUA 5FFOC 1DQ5A 1AR93 4L11A 3ZSMA 4YGEA 1GP5A 3MFAA 4KU8A 3UGHA 5GLTA 4DUWA 3LF7A 4MG2A 2OPWA 3GJBA 1NE6A 1RUG3 1XOYA 3KV6A 1UN1A 4HXCA 1E5HA 4JAAA 2RS51 2XLAA 3I3DA 5C9AC 1RUI2 2J1UA 2VUCA 3C2UA 4E8DA 1T2XA 2QQPA 4QX1A 1GOFA 2X5IA 1KRIA 4Z92B 3AYAA 3B9CA 3DEMA 2BPA2 3OGRA 1DQ1A 1PMJX 2WN2A 2O8OA 1JZ2A 3QD6A 2WFF3 3J8F2 5F3IA 4BQ5A 3N36A 5A6ZA 2NMOA 3B00A 2NP0A 1O91A 1VE0A 4EN9B 1IG3A 1SLBA 3OGGA 4V1PA 4ISRA 2YYOA 5FPLA 1J58A 3UJQA 4HVRA 5A3OA 4XBQA 1NLRA 5DG1A 2FZ1A 5CZKA 4Q29A 1H6XA 4XIKA 5FZGA 1H6YA 3RZHA 1SPPB 2A7AA 1YFYA 1DQ2A 1UWWA 3THDA 2VNGA 1S0JA 4XETA 1O3TA 4YG6A 5LA2A 1IG0A 5FLHA 4Q4V2 5L73A 3E6CC 1A6CA 2PTMA 5FMOL 1PZ7A 3BN6A 1BQPA 4Y33A 1UKRA 2YFZA 2WFF1 4K8FA 4COVA 1RB8G 1W2UA 4YGDA 5LB6A 1NG0A 1QJX3 5FUPA 1OPMA 3AVRA 2QE3A 1LJ7A 5DUUA 4I0BA 1JZ4A 4KQ7A 5KHKA 3R0RA 2BBAA 1XPWA 2RMU3 1LESA 2Y34A 4GXLA 2EF6A 3UK9A 5FWJA 1QXJA 4GMP0 5IK7A 1PGSA 4DEVA 4B7EA 5KHHA 3MF6A 5FJHA 2UY9A 3FX3A 4XCAA 1RHI2 3OG2A 3ELNA 4MXWB 4RYDA 5BNOA 4ZU5A 2BNMA 4AHXA 1F8VA 3JBG2 3ZXJA 3SEEA 2JG8A 1UXZA 4COUA 5ABJC 3FMGA 4NJ4A 2R0HA 3DECA 4AGGA 2BW8A 1NY72 2OUJA 2CU5A 2QDRA 3VKLA 2IXJA 3AL6A 4KNCA 1G9AA 1S0GA 4ZU4A 1S2BA 2C26A 2DVGA 3JU9A 3N7KA 4GWIA 5I8SA 2ARBA 2VCAA 3J9SA 1H2KA 1BLZA 2OPKA 5JR2A 1DYOA 1H9PA 4BQ4A 3JUUA 2R0FA 4Y5SA 3Q8EA 2WA4A 1H30A 1MR5A 4LT5A 4PI0A 5DQ0A 2A3WA 2R1DA 4IE5A 4Z2WA 4D94A 4CDWB 3IBMA 1XYNA 1QJU2 2Y33A 3ZX7A 4UBHA 4IDZA 5JSPA 2QQUA 1OD3A 3IWZA 1V6MA 3BODA 3C7EA 4PIYA 1DP0A 1IQAA 1XYPA 3KT4A 3USSA 4XFIA 4GKXA 1UYPA 2QQWA 1PMIA 1S55A 5A7SA 1W99A 4CCKA 4Q1PA 2E51A 1LECA 4ZS2A 4MO3M 3F2ZA 2CSGA 2WZPP 1CPNA 3E97A 2XH6A 2YBSA 5EJ1B 1GFF2 2XL9A 3VL8A 1AR63 1EUTA 2ZEZA 4HMZA 2WIIB 1H8TA 2G19A 4P9LA 1PVC1 3AK0A 1WA4A 4FXGB 2Y38A 5ANQA 1UOBA 4NHLA 1O5UA 2CGPA 3E5QA 3IM0A 3FBYA 1LOFC 3AKRA 3WNLA 1TME3 5E8AA 1OLRA 2ADEA 4KG8A 3ALQA 3RZGA 5C9AB 2EIGA 4CP1A 4NAMA 4HONA 1A8DA 4FVVA 4N8MA 3UL2A 1PO22 4JHTA 1NZIA 3FWEA 4Y24A 3PIJA 4AI9A 1SDDB 2XJUA 4Q4Y2 1VAVA 5GM0A 3OB8A 1CPMA 4XJWA 1XNBA 2DWRA 3B5LB 1H1IA 3JD73 3LIHA 5DAXA 4AEJA 1JYIA 1UU5A 1YYNA 3GBWA 4NRQA 5EV7A 1PK6B 5EYXA 4XDQA 4BQWA 4EWDA 1RUE1 3ZXDA 5JWPA 2HWF3 1YFXA 2XR4A 5DN2A 4BQYA 1VIWB 1ZBA2 2WT1A 4D3WA 1QJU3 2JE8A 2QDNA 4UI9L 5IT6A 3ETPA 1CZSA 2ES3A 4I01A 5A7NA 2FDHA 2X5IB 2IZWA 1CN1A 1UU6A 3HVDA 4HSLA 2OT7A 2VVEA 5FQ0B 1YQ5A 4YM1A 5KXBA 4IV3C 4AVCA 3O14A 3WQ0A 4RQPB 1UQXA 4I30A 4CCLA 4YVWC 2RDNA 4R9DA 3VD9A 4CDQB 4W50A 4LBQD 5JOXA 1XC6A 2VCBA 5BUVA 3LFIA 1PNGA 4ZZ5A 4IE7A 2JECA 3PUIA 4K20A 5AVAA 4GWNA 1DG6A 1QOOA 2Q1MA 1CZVA 1T6BX 4Q26A 4YM3A 4MXVA 5GZDA 1OQ1A 4NE9A 5H9SA 2D43A 4IXLA 4QB6A 1QJFA 4XFHA 4NHXA 1QJZA 3LQCA 1CAUA 3WF2A 1DDLA 4XC9A 2R7EB 5A7PA 4KGQA 1JZ8A 2JDPA 1BBT1 1CAUB 1H4GA 1BK0A 3JB8A 1DF0A 4I02A 1GZWB 4META 5JI7A 1HRI2 1ND2C 3GCXA 2QQIA 3IIIA 2WQ8A 2VMFA 3N9LA 2E7AA 1DFQA 1RVF3 3SQOA 4GZ9A 4M0NA 5FYZA 5JOYA 1AR62 4QGNA 1SFYA 1IS3A 1OKQA 3AP5A 4NIGA 1CVNA 1FMD2 5FXVA 5BPXA 2FZ2A 2EXKA 1A8MA 3LIGA 4B1LA 1PX3A 3RWKX 4AFBA 4BA6A 5CAZA 4AWDA 4OUEA 2ZX1A 4XF3A 3VZKA 4EN0A 5K0UB 2R062 3IIAA 2HYXA 4BYYA 5JXIA 3THPA 3MYXA 5D8AA 3WNOA 3PVBB 4RGGA 1WLDA 4KI5M 5FV3A 4EROA 2VMHA 4LBJA 4H7LA 4TZDA 4C90A 3VHNA 3MF9A 1W3XA 1LTEA 2Y8KA 4HFSA 4YZ4A 2R041 4A41A 1XQNA 4B4RA 1Q8PA 1JH5A 1N47A 2ZGSA 3WEZA 2AENA 1W6NA 5A3MA 3AKQA 1US3A 4E9KA 3HT1A 3RJ2X 1AZDA 2LW8A 4NHKA 4OI1A 2V4VA 1VRH1 2ADDA 1VR3A 1U5ZA 4QDSA 2PXJA 2YGMA 1QJEA 2BRTA 4GJZA 3IAQA 5FY9A 5BNPC 2P5BA 1LGBA 4HN1A 3VDAA 2VXRA 4LEJA 1PGW2 4RS5C 3C8XA 2ENRA 5GZEA 2WC2A 4MGYE 5F8PA 1W8HA 3KB5A 3RNSA 2VNRA 4P9IA 3O0WA 1F4AA 4ORFA 1RIRA 4XTMA 1LRHA 2I07B 3WNNA 4FTBA 4AVTA 2XKOA 2Q8CA 3IMNA 4HN0A 4LMFA 2VBBA 1FPN1 3PTYA 3BPZA 3GZEA 3PIGA 3ZVXA 1GQGA 4OZXA 4WM7B 1ZZCA 1C4RA 3QACA 1K3IA 4QPYA 2A3YA 2GC3A 2HWB1 1ULEA 3H1MA 2F4LA 5DUVA 5KBFA 3TN91 3LCPA 3LDKA 3N9OA 3NNFA 3QCWA 4LKFA 2HEVF 5EHDA 1HRI1 1LHWA 1Y9QA 4M3CA 3BGAA 1FV3A 4N53C 1DHKB 3BIWE 1GWMA 2WNVC 1MS5A 3VBUB 3APBA 3I97A 2DYCA 1TMF2 2BZDA 1S0CA 4B4QA 3U4SA 4OUMA 4MHRA 3WHTA 4Z8BA 4IUGA 2B7YA 1PIV1 4OLLA 1LHOA 2BGOA 1VBB1 5BNOB 4E4DX 3WUDA 2RJLA 5F7UA 4QXKA 1PGL1 1N3PA 3KVAA 3Q8CA 2NLRA 2HKXA 3ZDVA 2A70A 5FYSA 4XABA 1W8UA 4CDXA 3B9IA 2E32A 4P02B 1ENRA 3D4KA 2E53A 3O12A 3OBAA 4CEWB 3M70A 4CDXB 3I59A 1XNDA 4Y4YA 3MO4A 2UURA 2WN3A 2V73A 3MI8A 4CEWA 4F7ZA 5AVPA 3FLPA 2P3JA 3QLQA 3H0OA 2CHHA 4LBMA 3OPZA 5ISLA 1UY4A 3KHCA 4AEDC 2KD7A 5E16A 2DBNA 3DN7A 1JYCA 2V5DA 1AX1A 5J96B 3M2MA 2WZR1 1LODA 1R091 4RQPA 2CAVA 1B35B 1MS3A 2P37A 5LBCA 3ZFFC 2P2KA 3MIBA 5C4WC 1N1VA 4LBLA 5EPAA 2VOKA 3ZFEB 5FMBA 5DG2A 1COV1 2RG4A 2MPFA 4ISQA 2WNVA 2ZGOA 3VV1A 1PNFA 1LOAA 3LEGA 5IWFA 2W2IA 3NAPB 2AGSA 2MEV1 2QBXA 4OUSA 3ZFGB 3BUCA 4H55A 4XVHA 5FXZA 4CP2A 1W0OA 5F6KA 5J7MA 1KDKA 3ZYIB 1JYTA 1ZBE2 1HV1A 1MEC1 1JMUB 2HWD3 3NQHA 4IEVA 1H1AA 1KS5A 1QIQA 1WKYA 4E4SA 5FPBA 4CP9A 2WT2A 3IKWA 4EJRA 5F3EA 2ZS6B 5FZ8A 4W65A 1CR7A 1NA1B 3H8UA 5DZGA 2UYBA 2G1MA 2NM1A 3BALA 1QU0A 5LWBA 4IV3A 5BNNB 1EY2A 3DGTA 1EV12 2ZTNA 3W58A 3I2KA 4KBBA 2VOVA 4LITA 1YFWA 1CX4A 2AYHA 4GH4C 5AC93 4BPZA 4QPWA 4L2NA 4MSVA 1VRH3 4RR3C 5KC6A 2J1EA 3WG3A 5KC5A 3C7GA 1ENQA 4L97A 1RUC1 4C8DA 3KT7A 1V6KA 4UFMA 1W8TA 1ZZBA 3NKTA 4JZRA 1WA6X 3T1LA 1JHNA 1NA1C 1NCRA 2W5FA 3WHUA 4D6SA 1C1FA 4XOGA 5GJ6A 4BQ2A 4RR3A 1OSGA 2FQPA 4X8PA 5I0UA 1XU2A 4UF0A 5GKAC 3V0AA 2VMCA 5HCBA 3VBFA 2C4XA 1WCQA 3ILRA 5HXMA 1RUF1 3TNQA 3T0AA 3KQ4B 3L2HA 4AAPA 4BIOA 1QH6A 2Q8OA 2FDFA 1VBA1 5IW0A 4QWNA 2AREA 4Q4X2 2GN3A 1QQP1 3ST7A 3PUSA 3S5AA 3GDBA 4QHZA 1DQ0A 3T0BA 3MIGA 1RUNA 1TMF3 1GZ9A 4HBNA 4KGGA 5FLJA 4L0PA 2PHFA 2WRAA 1QKQA 4UFIA 2PHUA 1RMU2 2TUNA 1XYOA 5CG8A 1B09A 4Q5OA 4CE8A 3ZFFB 2CV6A 2PAEA 1RUC3 1W0PA 4FFFA 4OHVA 1HIXA 2OW4A 2XKPA 4Q0PA 1ZRRA 2VC9A 2E33A 4XBNA 2VPVA 1Q8OA 4N9IA 3NJXA 4NWWA 1EAH3 2WFF2 4BE3A 1UMZA 3NRUA 1JYWA 3KWVA 5C5TA 5JDBA 2R072 4AI0A 4YW6A 3A0KA 5DUXA 2WS93 3K51A 4FQ4A 3D82A 2RDQA 3W9AA 4B4PA 4JV4A 1WMFA 1RJ7A 4MGZE 2W1WA 1LNSA 1GMMA 4JGYC 3MW4A 3LEKA 2JE9A 2A3XA 3POBA 4AQTA 3POFA 5IYYA 2HWC2 4QHOA 5D8AB 4ZKTB 3AXEA 2RS32 4H2AA 3LDRA 4XF4A 1MEC3 2BQPA 2ZEYA 4BM8A 3LPFA 4Q0VA 3B3QE 1E5SA 4TSVA 3AVSA 4Z07A 3M7AA 3DXTA 3HR9A 3FFZA 3ZYRA 3OOXA 2WYFA 4IEWA 4HVQA 1V00A 5FPZA 5ACA1 1YI7A 3HNMA 3QH6A 3QOPA 5F5AA 2Y26A 1DLLA 2HWD2 4MYEA 1GWKA 3FL7A 1S4CA 4OQ8A 3VBRA 2WWUA 4JDOA 4UXAA 2PLV3 3BB6A 1SCSA 1R64A 5DDJ3 4FOVA 5A33A 3VBRB 4CU7A 2VE1A 3ACGA 4LHKA 5EQUA 2JDNA 1UY0A 4Y1UA 2WINB 5F5QA 5FZ0A 5A33B 3NV1A 4R9CA 3UGFA 2VZVA 4DINB 1VBD1 1IS5A 2R16A 2BERA 3AFGA 2WNVB 1DBNA 1DGRA 3VBUC 1IKQA 2D6OX 3A22A 3FC0A 4M3CF 1KD7A 5FY4A 3ACFA 4CP0A 5JMOA 4AYUA 1HQNA 3PVNA 3V65A 3AJYA 4UBGA 3SCGA 4GB33 1WMDA 2CL2A 4QXHA 4XF9A 5BNPB 3BI3A 1DGWX 4S2HA 4WM8B 1JTZX 3VBOA 5K7PA 1RC6A 1AXZA 5CEHA 5IVBA 1Z7S1 1OOPB 4OULA 1W06A 5CA6A 4Q4W3 3OBRA 5LA0A 3O1SA 4CU9A 1SMVA 2XG3A 2P3KA 2VOXA 4FFGA 1E5IA 3VBHC 2Y6JA 2DUPA 3PJYA 3WG4A 3O1RA 4HT1T 4FPKA 2G9FA 2DURA 2MNGA 4H14A 4GB31 2ZGNA 2C9AA 1CJDA 1NXMA 2ERFA 1LHVA 4XUPA 1SLCA 2HBTA 1XSQA 2E7TA 4V2WA 2ILMA 1WCUA 2D3SA 2RDRA 2KXLA 3JQWA 3POIA 1OLME 2YC4A 3VHOA 1X82A 4DXSA 1FPN2 2IXKA 3VDBA 1WCSA 2ARXA 2R063 4Q8LA 3AMPA 3VD4A 1GQPA 4KWUA 4D7YA 3LEIA 1CD3G 4XTPA 3H8RA 4YYOA 2P6HA 4OHWA 1LENA 1HB4A 4BIFA 4CCJA 4DNYA 4P9GA 5T3NA 2XJRA 3WW1A 2DVDA 3ON7A 4TWTA 2XBO2 2BYVE 4GH4A 3FUOA 2WKKA 5CIRA 4J25A 2AACA 4XJ9A 4N43B 5C71A 2RR11 2ZACA 3PTRB 1F15A 1Q3EA 3GBFA 1SFPA 1ZZ8A 1UD1A 5E89A 4QAWA 3HN3A 2I45A 4XDOA 2DV9A 4LHNA 5FYIA 3C7FA 4MX3A 3W20A 5C3PA 4Z82A 2VJXA 4JKLA 2BWAA 4HK8A 3PDQA 1L7RA 2QKDA 2BWCA 2VR4A 3AC0A 2BOJA 1OFSA 2A73B 3ZIXA 3AX4A 5FP9A 2GP5A 2P3IA 4PT6A 5HI0A 4LNVA 2B4KA 5L7OB 4XURA 2P34A 3ENRA 5LCWL 1POV0 1XNCA 2DCKA 2BOIA 4IEPA 3ZFGA 5L7OA 1V6OA 5FZ9A 3AP6A 4LKSA 2WA3A 4XE9A 2FBEA 3BTZA 3MV01 5A7WA 5IK4A 1GKBA 1RUI1 3ES1A 4E27A 1XE7A 1FAYA 3VHRA 2QQJA 3ORJA 4ITCA 3TYJA 2PA7A 4L99A 5T50A 4UW6A 1NA1A 4QM8A 1ULOA 4P9XA 4E4ZA 3D5OA 5JVVA 3RDIA 2BEOA 2G9GA 2CGNA 3J8F1 1FMD1 2W46A 4Q2FA 2D5FA 1SQ4A 1AHSA 1YEWA 1VB4A 2ZMNA 5LA1A 1VMHA 3VBRC 1KDMA 3OD0A 2JICA 1NQJA 4CCOA 1SBDA 1NYWA 1NCQA 4EQVA 4A7YA 4XMIA 1FI2A 1AX2A 3MIEA 2VZ3A 3O0XA 5HXVA 3ITQA 4A42A 1W3VA 5FK8A 2Y6GA 4PQ9A 3KQRA 3IDCB 3WNMA 3OEBA 3ABZA 1XE8A 4YVSC 2QTWB 1FT9A 1W8OA 3H1WA 4RD7A 1RMU1 3T1MA 1J59A 2RS33 5DABA 3AMQA 1KS4A 4DPNA 1RVF2 3KV9A 5FIXA 4AQSA 2VVFA 3VBSA 2R32A 2R49A 1Y4WA 1LULA 4XAEA 2X05A 3RMXA 3HBZA 3TEXA 1CAXB 4AK3A 2RS12 4QX7A 4B1MA 1C3HA 4A6OA 1LOFA 1CAXA 3AXDA 1OMIA 1D7PM 1N1YA 3FJSA 4GB32 1GV9A 3RZZA 4LIVA 4AQ2A 4BDVB 2GSYA 2ET7A 4Y5Z0 4NPLA 3GJAA 1CJPA 1H9WA 2O0OA 4HVOA 4QPIA 3VBHA 3PU3A 3SNMA 3VKMA 2ZX0A 3WF4A 4XQWA 4XFAA 3H42B 5M0TA 2KA3A 3USUB 3OCPA 4LHLA 4NAOA 5AC91 4QQOA 1CQ9A 4CRQA 1SG3A 1RUC2 1UY3A 3ZFFA 4NIDA 2VH9A 2O8QA 3AKSA 2WLQA 1EPZA 4HPKA 3WDWA 1NQDA 2BFUL 2RR13 2LS6A 5EIYB 3WSOA 1GNHA 4OHXA 4NRMA 2A6WA 3VZOA 3RI9A 4YW4A 1R1A1 1JU4A 3ZYGA 2DCYA 1NE4A 1S0BA 2YY1A 1MS9A 3ZSLA 1WUVA 3CJIA 4AFAA 5K8SA 4YRDA 3RZLA 3TEZA 1YIPA 2PHXA 3O1VA 1CESA 4Q4X3 1OD5A 2FHRA 1EYBA 3T2QA 1KJRA 2YBKA 1POV3 4P5YA 1NXD1 4RS5A 1O59A 5J36A 2R061 1QJY3 4NROA 1LCLA 4D69A 2E31A 1BK1A 5DZFA 4M4RA 5F2WA 1DGRN 2B8MA 2DDUA 4FBFA 4AI8A 2DUOA 4K9SA 3RS6A 4XF0A 4MOAA 5IHRA 5AFBA 3SMHA 1HB2A 3ZM8A 2HH9A 4XPVA 1IPSA 1JOJA 5C8CB 3I2OA 3K77A 2VTXA 5E88A 1COV3 4LLFA 1PGL2 5FZ6A 4XUTA 1OF3A 5FZLA 3OYWB 2ZMLA 4E4HA 3O1OA 3CBNA 2IXLA 3WDTA 2VQUA 1EAH2 1TVGA 2VXJA 2CY6A 3DKQA 4Q4W1 5LBFA 1ASJ1 2WUHA 2D6MA 4WVVA 2RMU2 1H8VA 1RUG2 2OUHA 1W2AX 2W39A 1AUYA 1RYYA 3LSEA 4RFT0 4GH4B 1MVEA 4QKFA 4IV1C 3GF6A 2ZMKA 3LD8A 4D0QA 4NOTA 5C33A 2VW2A 2FCUA 3S0MA 1HB3A 3CJIC 3KM5A 5L9RA 4XHBA 3H8XA 4Y20A 5FZDA 1UL9A 3MHZA 5AFEA 2QNKA 3ACIA 3GALA 1KGYA 4A3ZA 1PZ8A 1BEV1 1VBD3 1UYZA 5I93A 4WM8C 1UPSA 2ET1A 1ZBE3 4AW7A 5LASA 1AJOA 5LK5A 3RVHA 3R05A 2XXZA 2VUAA 2OIIA 3LGRA 2VO5A 3MEPA 3S5QA 2E63A 5FZKA 1WBFA 3U07A 5I0RA 2A6ZA 2XLFA 5E1RA 5F3GA 4OFGA 4CP9B 2ZEXA 2RHPA 2ZEWA 5ACA3 1F4HA 5K4LA 2VG9A 1ZZ9A 4I0WB 1W0NA 4LOTA 4YG0A 4WZFA 5FP8A 3I3MA 1WMEA 4YSFA 3B01A 2HWC3 4PLMA 4AVAA 4WVMA 1O3SA 1ULDA 3ETQA 3WG1A 4HL0A 5C4WA 5A70A 5C9AA 1CIYA 5A32A 4AE2A 5C4WB 1EUUA 3IDBB 2XPJA 3OGSA 1B35C 1EV11 5FXXA 5A32B 4CUGA 3R4DB 4QX5A 4AEKA 1AYM3 1UF2C 2VMEA 3MZHA 1U12A 2WNOA 4IEQA 5FP7A 5J1XA 1MACA 2QQVA 1XSRA 3CEWA 4S2FA 4MADA 4EV0A 2JDAA 3JBG1 5A6QA 4YGBA 2WDBA 4XJUA 1DCSA 1UY1A 1SHWB 3T2OA 3ES4A 4XBLA 5GZGA 4BZ4A 4N9HA 4CUBA 1APNA 1SEFA 3HEIA 4QB1A 1EAH1 1JW6A 1DYKA 5CADA 2ZAHA 3FN9A 2X09A 5FQ0A 5H9RA 4LHSA 4QB2A 4N43A 1HB1A 1K5MA 1WZXA 2A6YA 1RUH3 3OGVA 1RUF2 2QFEA 3INAA 4YG3A 1DYPA 3NNJA 2VGDA 2PHTA 4FP2A 4ASMB 4JVAA 2ZGUA 1Z78A 4XHXA
chains in the Genus database with same CATH topology
3HJRA 4IUGA 3W5NA 1JI6A 2BGOA 1IQDC 2W3JA 5C70A 5F7UA 3WQBA 2ID4A 1BHGA 3CMGA 2E32A 2W94A 4P02B 5JXGA 3OBAA 2WBKA 3MO4A 1CX1A 2WN3A 3K4AA 4DUVA 2YFUA 3P6BA 1UY4A 5DMYA 2KD7A 2V5DA 4CUCA 2J22A 4D8MA 2VZTA 1OF4A 2Y6KA 2W95A 1K42A 3CQOA 4CVUA 3IB3A 4W4ZA 2WAAA 3VDCA 1UX7A 1NX9A 3LEGA 5G05L 2QBXA 4XVHA 4P08A 1JYVA 2Y6HA 3I2JA 3GXUA 3D3AA 3NQHA 4DXRA 1WKYA 4TXWA 2WZEA 4OMDA 4A44A 2W87A 3VD3A 1K12A 2VTFA 2W92A 2W1QA 4XUOA 3LPGA 3I3BA 3DYMA 1XNAA 2YB7A 2W1SA 2VZSA 2QQLA 2WO1A 3I2KA 3W5MA 1W8NA 3A7QA 4HG6B 4QX0A 4QPWA 2W1UA 3UESA 2WAOA 2J1EA 3GGLA 3IDAA 3C7GA 2VZOA 4CUAA 5FUIA 3CZUA 5JXJA 2W5FA 4FI9A 3HNYM 2VMCA 2C4XA 1WCQA 3K4DA 5HXMA 3T0AA 1DLCA 3I2FA 2J1AA 2V72A 2WYSA 4DEQA 1I5PA 3SKVA 4QX2A 1K45A 3GDBA 1J84A 3T0BA 3J7HA 1JZ6A 2QQOA 4L0PA 1XNTA 3C7OA 5EJZB 2VZRA 3K4ZA 2C9KA 3WNKA 1MPXA 1US2A 3FHQA 4UAPA 3SEPA 2VL4A 3SKJE 3FHAA 1PMHX 2VC9A 2E33A 3DYOA 3MUZ1 4P00B 1JZ5A 3NJXA 3NRUA 1JYWA 4A45A 2EIDA 1W9SA 4JHZA 1NAEA 5G04L 1UYYA 4QDRA 2W1WA 1LNSA 4BK4A 1GMMA 1OH4A 2CDPA 3LEKA 4PF1A 3UNPA 5IYYA 3U37A 2XQXA 5DPNA 2ORXA 2RVAA 2ZEYA 4W8JA 1JYNA 3LPFA 4CU6A 2WABA 2WO3A 3EYPA 2CDOA 3WF3A 4MGSA 3EB7A 3IAPA 2EIEA 3HNMA 1O8PA 3ECQA 3FL7A 2J1SA 2ORZA 1R64A 4OYUA 4CU7A 3ACGA 1UY0A 1GNYA 4PQQA 5CYYA 2VZVA 2W91A 4AG4A 2BERA 2VMDA 4DUWA 5I0DA 2WO2A 3A22A 4UOJA 3I2IA 3ACFA 5JMOA 3I3DA 2J1UA 1UZ0A 4E8DA 1T2XA 4QX1A 1GOFA 4XUNA 3VD7A 4AAXA 3CDZB 1UMIA 2VCCA 5LA0A 4CU9A 3OGRA 1PMJX 2WN2A 1JZ2A 2Y6JA 5IJRA 2PQSA 2J1TA 1UXXX 4BJ0A 1PX4A 5IFTA 3A21A 3HOBA 4XUPA 3K46A 5CZKA 5JUVA 1H6XA 1H6YA 4JKMA 2YC4A 5HPOA 1UWWA 3THDA 4DXSA 3VDBA 5LA2A 3ACHA 3VD4A 2YC2A 1GQPA 4KWUA 3HPNA 1TG7A 3LEIA 4LPLA 2YG0A 4KMQA 5C7GA 3BN6A 3GM8A 2YFZA 1JHJA 3I3EA 4ZY9A 3WNPA 5B4XA 2RJ2A 3P1IA 1ULPA 3PUHA 1JZ4A 4M4PA 1JZ7A 3MUY1 5C71A 1JZ3A 2BBAA 2XHNA 3T08A 1XPWA 2W9XA 4A4AA 1GUIA 4QAWA 3HN3A 3C7FA 2VJXA 4JKLA 4DEVA 3CKHA 4YPJA 3OEAA 1L7RA 2XONA 3I2HA 4LQRA 2VR4A 3AC0A 3OG2A 4RYDA 4PT6A 1L7QA 2B4KA 3SEEA 4XURA 5LCWL 1UXZA 2DCKA 2VM9A 3WF0A 3DECA 2VZQA 4LKSA 2QQMA 2HLEA 3MV01 2JKXA 2EICA 2C26A 1GOGA 4JKKA 4GWIA 2QQJA 2VCAA 5JR2A 1DYOA 1W9TA 1HN1A 1ULOA 5DQ0A 2ZXQA 4ET7A 2B9VA 2W46A 4QDQA 5LA1A 2DCJA 1OD3A 5IFPA 2VOTA 3C7EA 1DP0A 3DYPA 5B4NA 2VZ3A 4ZXEA 3I2GA 4A42A 2Y6GA 3WNMA 1W99A 3OEBA 3ABZA 4MO3M 3F2ZA 3NJVA 1W8OA 1O8SA 3VD5A 1OT5A 5EJ1B 3E1F1 1YQ2A 5JXHA 1EUTA 2ZEZA 2X10A 2X05A 4A6OA 1CZTA 3MV11 3WNLA 1D7PM 4BDVB 2OKXA 3A23A 4OMCA 2Z4FA 3T09A 2E26A 2J1RA 3LE0A 3WF4A 1UYXA 1SDDB 3MBWA 3OB8A 1J83A 1NUKA 1SG3A 1UY3A 2VZ1A 2J7MA 5DN2A 3T0DA 3WF1A 2LS6A 2JE8A 4QX3A 3WSOA 4UI9L 5EIYB 3ETPA 1CZSA 1JU4A 3HNBM 2Y64A 3C7HA 3VD9A 4TTGA 4DUXA 3T2QA 4W50A 4P5YA 1XC6A 2VCBA 1O59A 4ZZ5A 3PUIA 2E31A 4BK5A 4M4RA 2DDUA 3THCA 1CZVA 4MOAA 5IHRA 4GWJA 2RV9A 4QB6A 4OZOA 2XOMA 3ZM8A 4Z2AA 3K77A 3T2PA 4JX0A 4ARXA 3LQCA 3WF2A 1NKGA 2R7EB 1OF3A 4XUTA 4ARYA 1JZ8A 2VQUA 2VZPA 1TVGA 4E8CA 3IIIA 2QQIA 2WUHA 1KEXA 2VMFA 2WQ8A 4GZ9A 1RYYA 4D0QA 3CIHA 3K75B 1UMHA 2L9LA 1JYXA 5A1AA 1PX3A 4XUQA 3ACIA 1JU3A 1KGYA 4OUEA 5JXIA 4A3ZA 2HYXA 1UYZA 3WNOA 4KI5M 2VO5A 2J1VA 2Y8KA 2QQKA 4A41A 1UY2A 3WEZA 1US3A 2QQNA 2ZEXA 2LW8A 2ZEWA 1F4HA 2V4VA 3JXSA 4MGQA 1W0NA 4QDSA 4DXTA 3IAQA 3VDAA 3C8XA 1CIYA 2EIBA 2Y6LA 1EUUA 1F4AA 3OGSA 4BXSV 3WNNA 2VZUA 2VMEA 4CU8A 5J1XA 3CZJA 4MADA 2JDAA 3NNGA 3UETA 1K3IA 2WDBA 2BGPA 3T2OA 1UY1A 1SHWB 2W47A 4ZZ8A 1W9WA 4RN5A 4CUBA 3HEIA 4QB1A 4XZUG 3FN9A 1GU3A 2X09A 3BGAA 4LHSA 4QB2A 3OGVA 2WZ8A 2JD9A 3I97A 2VQTA 1P8JA 1GOHA 2BZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJR A;  4IUG A;  3W5N A;  1JI6 A;  2BGO A;  1IQD C;  2W3J A;  5C70 A;  5F7U A;  3WQB A;  2ID4 A;  1BHG A;  3CMG A;  2E32 A;  2W94 A;  4P02 B;  5JXG A;  3OBA A;  2WBK A;  3MO4 A;  1CX1 A;  2WN3 A;  3K4A A;  4DUV A;  2YFU A;  3P6B A;  1UY4 A;  5DMY A;  2KD7 A;  2V5D A;  4CUC A;  2J22 A;  4D8M A;  2VZT A;  1OF4 A;  2Y6K A;  2W95 A;  1K42 A;  3CQO A;  4CVU A;  3IB3 A;  4W4Z A;  2WAA A;  3VDC A;  1UX7 A;  1NX9 A;  3LEG A;  5G05 L;  2QBX A;  4XVH A;  4P08 A;  1JYV A;  2Y6H A;  3I2J A;  3GXU A;  3D3A A;  3NQH A;  4DXR A;  1WKY A;  4TXW A;  2WZE A;  4OMD A;  4A44 A;  2W87 A;  3VD3 A;  1K12 A;  2VTF A;  2W92 A;  2W1Q A;  4XUO A;  3LPG A;  3I3B A;  3DYM A;  1XNA A;  2YB7 A;  2W1S A;  2VZS A;  2QQL A;  2WO1 A;  3I2K A;  3W5M A;  1W8N A;  3A7Q A;  4HG6 B;  4QX0 A;  4QPW A;  2W1U A;  3UES A;  2WAO A;  2J1E A;  3GGL A;  3IDA A;  3C7G A;  2VZO A;  4CUA A;  5FUI A;  3CZU A;  5JXJ A;  2W5F A;  4FI9 A;  3HNY M;  2VMC A;  2C4X A;  1WCQ A;  3K4D A;  5HXM A;  3T0A A;  1DLC A;  3I2F A;  2J1A A;  2V72 A;  2WYS A;  4DEQ A;  1I5P A;  3SKV A;  4QX2 A;  1K45 A;  3GDB A;  1J84 A;  3T0B A;  3J7H A;  1JZ6 A;  2QQO A;  4L0P A;  1XNT A;  3C7O A;  5EJZ B;  2VZR A;  3K4Z A;  2C9K A;  3WNK A;  1MPX A;  1US2 A;  3FHQ A;  4UAP A;  3SEP A;  2VL4 A;  3SKJ E;  3FHA A;  1PMH X;  2VC9 A;  2E33 A;  3DYO A;  3MUZ 1;  4P00 B;  1JZ5 A;  3NJX A;  3NRU A;  1JYW A;  4A45 A;  2EID A;  1W9S A;  4JHZ A;  1NAE A;  5G04 L;  1UYY A;  4QDR A;  2W1W A;  1LNS A;  4BK4 A;  1GMM A;  1OH4 A;  2CDP A;  3LEK A;  4PF1 A;  3UNP A;  5IYY A;  3U37 A;  2XQX A;  5DPN A;  2ORX A;  2RVA A;  2ZEY A;  4W8J A;  1JYN A;  3LPF A;  4CU6 A;  2WAB A;  2WO3 A;  3EYP A;  2CDO A;  3WF3 A;  4MGS A;  3EB7 A;  3IAP A;  2EIE A;  3HNM A;  1O8P A;  3ECQ A;  3FL7 A;  2J1S A;  2ORZ A;  1R64 A;  4OYU A;  4CU7 A;  3ACG A;  1UY0 A;  1GNY A;  4PQQ A;  5CYY A;  2VZV A;  2W91 A;  4AG4 A;  2BER A;  2VMD A;  4DUW A;  5I0D A;  2WO2 A;  3A22 A;  4UOJ A;  3I2I A;  3ACF A;  5JMO A;  3I3D A;  2J1U A;  1UZ0 A;  4E8D A;  1T2X A;  4QX1 A;  1GOF A;  4XUN A;  3VD7 A;  4AAX A;  3CDZ B;  1UMI A;  2VCC A;  5LA0 A;  4CU9 A;  3OGR A;  1PMJ X;  2WN2 A;  1JZ2 A;  2Y6J A;  5IJR A;  2PQS A;  2J1T A;  1UXX X;  4BJ0 A;  1PX4 A;  5IFT A;  3A21 A;  3HOB A;  4XUP A;  3K46 A;  5CZK A;  5JUV A;  1H6X A;  1H6Y A;  4JKM A;  2YC4 A;  5HPO A;  1UWW A;  3THD A;  4DXS A;  3VDB A;  5LA2 A;  3ACH A;  3VD4 A;  2YC2 A;  1GQP A;  4KWU A;  3HPN A;  1TG7 A;  3LEI A;  4LPL A;  2YG0 A;  4KMQ A;  5C7G A;  3BN6 A;  3GM8 A;  2YFZ A;  1JHJ A;  3I3E A;  4ZY9 A;  3WNP A;  5B4X A;  2RJ2 A;  3P1I A;  1ULP A;  3PUH A;  1JZ4 A;  4M4P A;  1JZ7 A;  3MUY 1;  5C71 A;  1JZ3 A;  2BBA A;  2XHN A;  3T08 A;  1XPW A;  2W9X A;  4A4A A;  1GUI A;  4QAW A;  3HN3 A;  3C7F A;  2VJX A;  4JKL A;  4DEV A;  3CKH A;  4YPJ A;  3OEA A;  1L7R A;  2XON A;  3I2H A;  4LQR A;  2VR4 A;  3AC0 A;  3OG2 A;  4RYD A;  4PT6 A;  1L7Q A;  2B4K A;  3SEE A;  4XUR A;  5LCW L;  1UXZ A;  2DCK A;  2VM9 A;  3WF0 A;  3DEC A;  2VZQ A;  4LKS A;  2QQM A;  2HLE A;  3MV0 1;  2JKX A;  2EIC A;  2C26 A;  1GOG A;  4JKK A;  4GWI A;  2QQJ A;  2VCA A;  5JR2 A;  1DYO A;  1W9T A;  1HN1 A;  1ULO A;  5DQ0 A;  2ZXQ A;  4ET7 A;  2B9V A;  2W46 A;  4QDQ A;  5LA1 A;  2DCJ A;  1OD3 A;  5IFP A;  2VOT A;  3C7E A;  1DP0 A;  3DYP A;  5B4N A;  2VZ3 A;  4ZXE A;  3I2G A;  4A42 A;  2Y6G A;  3WNM A;  1W99 A;  3OEB A;  3ABZ A;  4MO3 M;  3F2Z A;  3NJV A;  1W8O A;  1O8S A;  3VD5 A;  1OT5 A;  5EJ1 B;  3E1F 1;  1YQ2 A;  5JXH A;  1EUT A;  2ZEZ A;  2X10 A;  2X05 A;  4A6O A;  1CZT A;  3MV1 1;  3WNL A;  1D7P M;  4BDV B;  2OKX A;  3A23 A;  4OMC A;  2Z4F A;  3T09 A;  2E26 A;  2J1R A;  3LE0 A;  3WF4 A;  1UYX A;  1SDD B;  3MBW A;  3OB8 A;  1J83 A;  1NUK A;  1SG3 A;  1UY3 A;  2VZ1 A;  2J7M A;  5DN2 A;  3T0D A;  3WF1 A;  2LS6 A;  2JE8 A;  4QX3 A;  3WSO A;  4UI9 L;  5EIY B;  3ETP A;  1CZS A;  1JU4 A;  3HNB M;  2Y64 A;  3C7H A;  3VD9 A;  4TTG A;  4DUX A;  3T2Q A;  4W50 A;  4P5Y A;  1XC6 A;  2VCB A;  1O59 A;  4ZZ5 A;  3PUI A;  2E31 A;  4BK5 A;  4M4R A;  2DDU A;  3THC A;  1CZV A;  4MOA A;  5IHR A;  4GWJ A;  2RV9 A;  4QB6 A;  4OZO A;  2XOM A;  3ZM8 A;  4Z2A A;  3K77 A;  3T2P A;  4JX0 A;  4ARX A;  3LQC A;  3WF2 A;  1NKG A;  2R7E B;  1OF3 A;  4XUT A;  4ARY A;  1JZ8 A;  2VQU A;  2VZP A;  1TVG A;  4E8C A;  3III A;  2QQI A;  2WUH A;  1KEX A;  2VMF A;  2WQ8 A;  4GZ9 A;  1RYY A;  4D0Q A;  3CIH A;  3K75 B;  1UMH A;  2L9L A;  1JYX A;  5A1A A;  1PX3 A;  4XUQ A;  3ACI A;  1JU3 A;  1KGY A;  4OUE A;  5JXI A;  4A3Z A;  2HYX A;  1UYZ A;  3WNO A;  4KI5 M;  2VO5 A;  2J1V A;  2Y8K A;  2QQK A;  4A41 A;  1UY2 A;  3WEZ A;  1US3 A;  2QQN A;  2ZEX A;  2LW8 A;  2ZEW A;  1F4H A;  2V4V A;  3JXS A;  4MGQ A;  1W0N A;  4QDS A;  4DXT A;  3IAQ A;  3VDA A;  3C8X A;  1CIY A;  2EIB A;  2Y6L A;  1EUU A;  1F4A A;  3OGS A;  4BXS V;  3WNN A;  2VZU A;  2VME A;  4CU8 A;  5J1X A;  3CZJ A;  4MAD A;  2JDA A;  3NNG A;  3UET A;  1K3I A;  2WDB A;  2BGP A;  3T2O A;  1UY1 A;  1SHW B;  2W47 A;  4ZZ8 A;  1W9W A;  4RN5 A;  4CUB A;  3HEI A;  4QB1 A;  4XZU G;  3FN9 A;  1GU3 A;  2X09 A;  3BGA A;  4LHS A;  4QB2 A;  3OGV A;  2WZ8 A;  2JD9 A;  3I97 A;  2VQT A;  1P8J A;  1GOH A;  2BZD A; 
#chains in the Genus database with same CATH topology
 2CTV A;  3HJR A;  3WCS A;  3ZO0 B;  5FZE A;  3JB4 C;  2YRO A;  4N53 A;  2WL1 A;  5CIS A;  2XJQ A;  1XBF A;  3RYR A;  5C70 A;  3USU A;  2J42 A;  1RUO A;  1DIW A;  1VBC 3;  2B45 X;  1O4Y A;  3SIS A;  2Q8D A;  4AOC A;  1WW7 A;  3MW3 A;  4LO4 B;  1RUJ 1;  2TNF A;  1RIN A;  2W94 A;  1DGW A;  4SLI A;  1AXY A;  2WBK A;  1O3Q A;  3K48 A;  1RED A;  2VEC A;  1RUG 1;  4QPG C;  3AP9 A;  2ZHL A;  1S0F A;  2YFU A;  3KLS A;  4QPI C;  4UFH A;  4O7X A;  1Q5O A;  4CTE A;  3OBT A;  1TE1 B;  3UKT A;  1OC1 A;  4FAH A;  1E5R A;  4OVE A;  1AR7 3;  2XVK A;  1OF4 A;  2RS1 1;  5DAW A;  1D0H A;  3LAG A;  3P3N A;  1QEX A;  1HXS 1;  2W95 A;  1K42 A;  1QJY 2;  3WCR A;  5F39 A;  2WNU B;  1U5Y A;  4RS5 B;  3IB3 A;  1TQ5 A;  5FY5 A;  2WNU A;  1O3R A;  2ZHK A;  4ZU7 A;  5IVE A;  1HJG A;  5JOZ A;  2I2S A;  1UX7 A;  3AP4 A;  4I3P A;  2VVD A;  1D4M 2;  4PIZ A;  5G05 L;  1G6N A;  1V9U 2;  5JR7 B;  5JXG A;  4C0H A;  4HLT A;  4LBN A;  4CDU A;  2FDI A;  2Y6H A;  4QKB A;  3GXU A;  3WG2 A;  4EZ4 A;  3TN9 2;  3D3A A;  2D97 A;  4WVZ A;  1UIJ A;  3E6D A;  3POY A;  3MFC A;  2JIG A;  4GA9 A;  3VD3 A;  3RZM A;  5EWS A;  2VTF A;  2D3R A;  2W92 A;  3WR0 A;  5T5L A;  4HAN A;  2OQ6 A;  1DGL A;  1PVX A;  3ACL A;  3KHB A;  3MIH A;  4G4F A;  4XFF A;  5F9T A;  1TEI A;  1O6U A;  5EZW A;  3PU8 A;  3SCF A;  5J37 A;  4GAL A;  2H0B A;  2SBA A;  2R1B A;  4N7U A;  4IGO A;  1DZT A;  2TBV A;  1XNA A;  4QQP A;  1W8W A;  3AMM A;  4OQ9 A;  1RUE 3;  2QQL A;  3W5M A;  3A7Q A;  5A3W A;  4HG6 B;  4CXY A;  1F5J A;  3JD7 1;  2RE9 A;  1UZV A;  4F3J A;  2WAO A;  1LGC A;  4Q4Y 1;  5FYC A;  1YLL A;  4YZ1 A;  4PBO A;  1ND2 B;  2VZO A;  4WZC A;  3FZ3 A;  3EXU A;  5FOJ B;  4YW3 A;  1OH3 A;  4RQP C;  2ZZJ A;  2JDU A;  4IEU A;  4DMI A;  5I8Y A;  5KXC A;  5DUW A;  5IAT A;  1DZQ A;  3AJZ A;  4EWE A;  5F37 A;  5JCT A;  1WMX A;  2GU9 A;  1BBT 2;  2QUO A;  5F5I A;  1VB2 A;  2DFB A;  1W39 A;  2MHF A;  3POS A;  3U78 A;  1DLC A;  5FZ3 A;  3ZFE C;  5C6C A;  2PLV 2;  4WVW A;  4UFL A;  2VNO A;  1ENX A;  2VBP A;  3W21 A;  1OFN A;  3LSD A;  5FBZ A;  3TRS B;  2WNE A;  4K1Y A;  4QX2 A;  3EHK A;  4P9W A;  1IS4 A;  3T2T A;  4L92 A;  3J7H A;  3Q9O A;  1Q43 A;  2KR2 A;  3M3Q A;  2RM2 2;  3MIC A;  2QQO A;  1VBB 3;  3ZKU A;  4EWA A;  1XNT A;  2D98 A;  2E7Q A;  3UGG A;  4LKE A;  2VZR A;  2A6V A;  2OS2 A;  4D6R A;  1PK6 A;  3IT8 A;  3K4Z A;  4KWJ A;  1MPX A;  1US2 A;  5FZI A;  3FHQ A;  1HRV 1;  1CAW A;  3GCW A;  2YU1 A;  2ARC A;  1AL0 G;  4H7M A;  3BTX A;  3SEP A;  4P5H A;  2VL4 A;  4BQ1 A;  1CAW B;  1OXC A;  3MUZ 1;  1ZA4 A;  2Q1Z B;  2CYF A;  1G9B A;  4A2U A;  3DPR C;  1PK6 C;  4PJY A;  4CCN A;  1REF A;  1NLS A;  1X9T A;  2DU1 A;  2OXB A;  4A45 A;  1WGP A;  1W8Z A;  1W9S A;  2EID A;  4AFC A;  4DB5 A;  4JGY B;  4JHZ A;  1LOE A;  4TYS A;  3IPV A;  2GH8 A;  4XFG A;  3WDX A;  3UKN A;  2C1F A;  1CWP A;  2DUQ A;  4W6Y A;  2RS1 3;  3H3Z A;  1OH4 A;  4M00 A;  4DY3 A;  2GAU A;  1IKP A;  3FLT A;  4PF1 A;  4IE0 A;  3U37 A;  2O14 A;  1XRU A;  1OQE A;  1QMJ A;  1UX6 A;  4COW A;  4YM0 A;  4ZPI A;  2VCM A;  3OUJ A;  4FT8 A;  1CAV A;  2ORX A;  5DPN A;  2UWA A;  4BWO A;  2CGO A;  2LUW A;  2Q0A A;  4YNI A;  4JRA A;  5FZO B;  4O9E A;  2GAL A;  4HK9 A;  3ZXK A;  1AYN 1;  1VAM A;  2BU9 A;  3BOP A;  4EN8 B;  4HKL A;  1A34 A;  2RMU 1;  1YQ8 A;  2EIE A;  1OVS A;  4MGT A;  2YPD A;  3ECQ A;  3O1U A;  4C91 A;  1I1E A;  1UZZ A;  2J1S A;  4NUB A;  1W2N A;  2CNA A;  4CEY C;  1WW4 A;  1XE0 A;  3ASI A;  5LA9 A;  3WQ7 A;  4B7K A;  5FK7 A;  3JD7 2;  3ZKY A;  1GNY A;  3KZ4 C;  5FYU A;  1FNZ A;  5CYY A;  1LGN A;  3BOW A;  2W91 A;  4V2V A;  5FZA A;  5DXD A;  4AG4 A;  4Q4Y 3;  5A1F A;  3WXP A;  4TLG A;  2VMD A;  4YVS A;  4LBO A;  5I0D A;  3B02 A;  2WO2 A;  4UOJ A;  5FTT C;  1G86 A;  3WT3 A;  3I2I A;  3N9N A;  5GZF A;  4PDW C;  3D8C A;  4XYX A;  3IMM A;  2ZJC A;  4MHU A;  2GDF A;  4HKO A;  1FXZ A;  4MH0 E;  1UZ0 A;  1IPJ A;  5EFU A;  3NWK A;  1XNK A;  1H4H A;  3JBG 3;  4AGR A;  1BYH A;  4XCB A;  1JS9 A;  2UY8 A;  1RHI 3;  2Z79 A;  4LBQ A;  5FR3 A;  5JSR A;  1MS4 A;  4RR3 B;  5CVR A;  1PGW 1;  1UCX A;  1WD3 A;  2GND A;  4XDP A;  2PQQ A;  2KM2 A;  2A71 A;  5BY5 A;  1LAJ A;  1VMJ A;  4G9S B;  1JN2 P;  2PQS A;  2J1T A;  3RWN A;  1UXX X;  1W8F A;  5H9P A;  4YZ2 A;  5FZB A;  2YHJ A;  3KV5 A;  1SBF A;  2IVJ A;  3MW2 A;  5A7Q A;  1ZRE A;  2DCZ A;  3A21 A;  3AL5 A;  3HOB A;  3S6P A;  3I54 A;  2X29 A;  5DDJ 2;  2HWC 1;  1SLT A;  4BME A;  4Y5T A;  4JKM A;  1PM4 A;  3LOI A;  3Q8B A;  5HPO A;  5IVC A;  3POG A;  4LO7 A;  3KGZ A;  4RGA A;  3ACH A;  2BNO A;  5CNA A;  2YC2 A;  4WM7 A;  4D7T A;  2Z69 A;  2YG0 A;  3U75 A;  5C7G A;  5A80 A;  3RQ0 A;  4NN0 A;  4R52 A;  4BIS A;  4FPJ A;  1JHJ A;  1V6L A;  2VAU A;  4ZY9 A;  3RYP A;  3WNP A;  4J6G A;  1YRZ A;  2RJ2 A;  3SLI A;  3NV3 A;  1OPO A;  2FMD A;  1W6O B;  3X29 B;  2LRP A;  2H6C A;  4Y4R A;  3R4U A;  4M4P A;  5FMC A;  3VZL A;  4GAZ A;  1BEV 3;  1JZ7 A;  1JZ3 A;  3T08 A;  2W0X A;  1GLH A;  1QJU 1;  4DIQ A;  2H0V A;  1L3J A;  1OVP A;  4QU2 A;  3VBU A;  3NV2 A;  3ZN6 A;  3DL3 A;  4YVW A;  3H8O A;  1AR7 2;  3ILN A;  4NRP A;  1MQT B;  2ZA9 A;  3ATG A;  3OJB A;  4IGQ A;  5FRE A;  3ZIW A;  4CXW A;  2VUJ A;  5JIA A;  1MQT A;  3OEA A;  1AL2 3;  3I2H A;  4LQR A;  4RHV 3;  4Y26 A;  1MZ5 A;  4AHW A;  1RUD 2;  2ATF A;  2X5I C;  4FAG A;  1VBC 1;  3NW4 A;  4QHB A;  3VUO A;  3I49 A;  4MXW A;  4KL1 A;  4MLO A;  1FNY A;  4D7S A;  2GC2 A;  2Q1F A;  3H9A A;  4KH9 A;  5FDB A;  4R4X A;  4CXX A;  2VZQ A;  3OF1 A;  2VTX J;  1ST8 A;  1TME 1;  3TAY A;  4JTO A;  4PIX A;  4HET A;  3WP6 A;  4A7K A;  1V6N A;  4KU7 A;  4LA2 A;  1QJX 2;  1PVC 3;  1R09 2;  2DTW A;  1RUH 1;  4HOO A;  5KXD A;  2B39 A;  2W52 A;  3EO6 A;  2WZR 2;  5KR7 A;  2DU0 A;  4YAR A;  1HN1 A;  5FZ7 A;  3H3L A;  4CPB A;  5GAL A;  4AI1 A;  2ZX4 A;  1C8N A;  1NLQ A;  4R9A A;  3BU0 A;  4LKD A;  1W04 A;  2GMM A;  4O65 A;  4ET7 A;  5FPV A;  5C3S A;  1AJK A;  1UOF A;  2BTV C;  4QDQ A;  1POV 1;  5LY1 A;  3BKZ A;  3QH7 A;  2PEL A;  5IFP A;  2DFC A;  4DO0 A;  4XQD A;  3FE5 A;  4NIH A;  1ZYB A;  1QQP 2;  1RTV A;  4U36 A;  1AYM 1;  2YXS A;  1VRB A;  2V09 A;  3WP4 A;  1HLC A;  1VAL A;  3AMN A;  4JDN A;  2IFR A;  1H0B A;  3ZXG A;  3O1T A;  3VD5 A;  2VD7 A;  3NJV A;  1W9F A;  4JGZ C;  1OT5 A;  2JD4 A;  5JZG B;  2R04 2;  3E1F 1;  2IWG B;  1YQ2 A;  5JXH A;  5JZG A;  2FCV A;  1JOB A;  2XBO 1;  3SCH A;  2ZOE B;  1UNB A;  1FV2 A;  1QXP A;  4XQ4 A;  5J48 A;  1OOP A;  2IXI A;  3OD4 A;  1CZT A;  1YNA A;  2P1B A;  5CB7 A;  1CGP A;  1H2L A;  1FAT A;  1VPH A;  1S0D A;  2OKX A;  1AR8 1;  3TOJ A;  4FTE A;  2YZ4 A;  5K9Y A;  1IHM A;  4UW5 A;  3R6S A;  1Q8S A;  1AR7 1;  1YC6 1;  3T09 A;  3EBR A;  3LE0 A;  1GZC A;  2FMY A;  3SXW A;  1UYX A;  2WT0 A;  2C5D A;  3O5S A;  3KV4 A;  5FYY A;  4BLJ A;  4KG0 A;  4DZG A;  3O1M A;  3HQU A;  2BJS A;  3RGB A;  1QF3 A;  1GBG A;  4K8R B;  1MVQ A;  2XJS A;  1VBE 1;  2WJS A;  5ABJ A;  2XWB B;  4QMA A;  1W6P B;  4DXZ A;  2EXJ A;  3DCQ A;  2ZGP A;  2J7M A;  3MGU A;  4TN7 A;  2RS3 1;  3T0D A;  1Y7B A;  1RMU 3;  1WCK A;  4HSJ A;  2UWB A;  1BVP 1;  4QX3 A;  4K7J A;  2G9Z A;  1RIT A;  4TLF A;  3TWI A;  4DY5 A;  4GMP 1;  1OHF A;  1NT0 A;  1HQL A;  1R08 3;  3HNB M;  2XHK A;  4BXF A;  1QJX 1;  3KF3 A;  4UF0 B;  1N3Q A;  1VBA 2;  2BBV A;  4Q4V 3;  2JG9 A;  2OVU A;  1XJA A;  3PUQ A;  1Y9M A;  3C7H A;  3L2Y A;  4JGZ A;  1ZA7 A;  4XZP A;  3B7M A;  5F32 A;  5EP9 A;  4PI2 A;  2JKB A;  2PHW A;  2GP3 A;  1KFX L;  3GNE A;  3T30 A;  1PO1 2;  3G6J B;  4LO6 B;  4Y1V A;  1X8E A;  2DVA A;  2R07 1;  1WLC A;  1MZ6 A;  4QGM A;  2HWE 1;  3KVB A;  5FAX A;  2D5H A;  3POE A;  2AR6 A;  1SLA A;  2AEY A;  4NIA A;  2JWP A;  2F4P A;  4GWJ A;  1W2T A;  1SPP A;  5JPM B;  4HKW A;  1ULC A;  4DFS A;  3KSC A;  2WO7 A;  2XOM A;  1QWR A;  4OZO A;  2NYY A;  3TEW A;  1RUD 3;  4JX0 A;  5CG9 A;  3N9M A;  1G7Y A;  1AL2 2;  1NKG A;  4RHV 2;  4ARY A;  3N7L A;  4XJA A;  4AXO A;  3ZMO A;  2VZP A;  2YV8 A;  3GHN A;  4Y3O A;  3VB9 A;  4D6Q A;  1X36 A;  1ZBA 1;  1OA4 A;  1OUS A;  1KEX A;  2ZX3 A;  5HCH A;  1LU1 A;  1Q8Q A;  1EV1 3;  3V0B A;  4KBZ A;  3P3P A;  3JZV A;  3CNA A;  4MGK E;  1ALY A;  4BQ3 A;  5FPX A;  5D21 A;  3AZZ A;  1O4Z A;  3K75 B;  4QT6 A;  1PO2 1;  2Y0O A;  2H6B A;  2UU8 A;  1SZB A;  5A1A A;  1SLI A;  3K3N A;  2JEM A;  3D0S A;  2BP6 A;  5A6X A;  1QXR A;  4XUQ A;  4AR2 A;  1C8M 1;  1YFU A;  2D93 A;  1PIV 2;  4LUM A;  5FO9 B;  1AR9 1;  3E5X A;  1KJL A;  1YJL A;  5K0U A;  1YO8 A;  3J4U H;  4PLO A;  2B42 B;  2NQY A;  2OYZ A;  2MEV 2;  2HWF 2;  1AVB A;  1HKD A;  1LHN A;  2YU2 A;  3M3O A;  4IEO A;  4IES A;  1HXS 3;  2HJI A;  4JRL A;  3EJK A;  2J1V A;  2ZGT A;  1YJK A;  3N9Q A;  5LK7 B;  1SAC A;  2QQK A;  2UWC A;  4IW3 A;  1UY2 A;  1ZBE 1;  5GLZ A;  3BTY A;  4N90 A;  4CSW A;  5FMD A;  3BU7 A;  4LBQ B;  2WLP A;  3LWC A;  4YW2 A;  5LBB A;  3VBF B;  5F3C A;  4LLO A;  4MGQ A;  3V0A B;  1SCR A;  2D3P A;  4DXT A;  5C3R A;  2XJP A;  2ZKN A;  4XXP A;  5I0S A;  4IEZ A;  2XML A;  1RUJ 3;  1TNF A;  4IL7 A;  4M01 A;  3MDP A;  4XJ8 A;  2EIB A;  2EAL A;  1SDW A;  1Y43 B;  4BXS V;  3ZYP A;  4JCK A;  4C1W A;  4LOR A;  4CU8 A;  4FPY A;  3WX5 A;  3N35 A;  1Z7S 3;  5LAT A;  4ZHN A;  1N3O A;  3ZR6 A;  2FD8 A;  1QGL A;  2JB8 A;  2R30 A;  2BGP A;  1ODM A;  2YBP A;  2W47 A;  4COY A;  2Q5T A;  2ZGR A;  4WM8 A;  3ZSK A;  2WR9 A;  4XZU G;  4M3C B;  5IVY A;  3M8L A;  1UO9 A;  1I3H A;  3VN4 A;  1MZF A;  2OA2 A;  3T3Y A;  4Q0Q A;  1VMF A;  2VW0 A;  2JD9 A;  1P8J A;  4BH9 A;  2XJT A;  3UKV A;  4CYD A;  3WDU A;  5FO8 B;  4E2Q A;  1W28 A;  5FY8 A;  5DDJ 1;  2PLV 1;  3W5N A;  1UPI A;  4BLI A;  1K5M C;  3SH5 A;  5JAX A;  5D2A A;  3VL9 A;  5GLW A;  4CCM A;  2ZX2 A;  4X6R B;  4LO5 B;  2JXA A;  3ZXA C;  3WQB A;  3ZLI A;  5FYB A;  3FLR A;  1ZRI A;  1I5Z A;  3AYE A;  1BHG A;  3ILF A;  4URT A;  4Y1Y A;  1W90 A;  3I7D A;  5CKM A;  3HT2 A;  2AC1 A;  2K9Z A;  2RM2 1;  5IUQ A;  5CFC C;  2ARA A;  1BCX A;  1W6P A;  1IPK A;  3J7N A;  3LA7 A;  3SH4 A;  4Q1R A;  2VUD A;  1CX1 A;  4AI2 A;  2ETE A;  2WWJ A;  4FPC A;  3UV9 A;  3ZPY A;  3BCW A;  5DMY A;  5JMC A;  1FOD 2;  1QDO A;  3THT A;  3S7E A;  1LEM A;  2JG8 C;  2J22 A;  1B35 A;  4ASL A;  1JOD A;  1OLM A;  4JGY A;  4S2G A;  2ZAB A;  4JGZ B;  4UFJ A;  4LK7 A;  2Y6K A;  1JUH A;  3DKW A;  3ZFE A;  4AGV A;  3M3E A;  1ZRD A;  1HDK A;  5IAV A;  3HD8 B;  5C5U A;  3KMH A;  4XJZ A;  4LUK A;  1KFU L;  2PFW A;  3GBG A;  4NPR A;  3WDV A;  2QCS B;  3WP5 A;  1QDC A;  2UYA A;  2ZHM A;  3OBZ A;  4DOU A;  5FY1 A;  3NST A;  2XGX A;  4HZF A;  4P08 A;  5FZO A;  2AEZ A;  1ENS A;  1IZ3 A;  5DAV A;  3I2J A;  5FYV A;  3WUC A;  1JYV A;  4S2D A;  3SHR A;  3LZZ A;  3ZDS A;  4N7I A;  4DXR A;  3GZU C;  1AYN 2;  4QXB A;  2XQR A;  5IVF A;  4NHM A;  2LM3 A;  1ASJ 3;  1WWY A;  1K12 A;  1ZRC A;  2W1Q A;  3GYD A;  1R1A 2;  3VDD A;  1TMF 1;  1ND3 A;  4GQ7 A;  3LPG A;  1FMD 3;  1NOV A;  5E6H A;  1JOP A;  1MZE A;  3J8F 3;  3DYM A;  3U14 A;  5FRA A;  3IDE A;  4WVM B;  3WNX A;  2K0G A;  1S0E A;  2NZ9 A;  5DAP A;  4JQT A;  3ZYJ B;  1PHM A;  1W8N A;  4BQX A;  2ZKL A;  4YVS B;  4M0H A;  4Y1Z A;  2W1U A;  1YQC A;  2F17 A;  1OKO A;  1RUI 3;  2RJK A;  3MPP G;  3SIT A;  3WIN E;  3IDA A;  2OQ7 A;  5LRR A;  4CUA A;  5FUI A;  3KCC A;  5T54 A;  4F83 A;  4AL9 A;  3PNA A;  1TZO A;  1I9R A;  4I2O A;  4OI4 A;  2V5Y A;  1F35 A;  4RL7 A;  5KHI A;  1F5F A;  5LEK A;  1GWL A;  4FI9 A;  2XUM A;  5FP3 A;  1W03 A;  1R1Z A;  4W6W A;  1R1A 3;  1F9K A;  3K4D A;  2WSU A;  1IOA A;  5D1I A;  4ZS3 A;  1CON A;  3U0Z A;  4XFC A;  2A75 A;  3I2F A;  1ZRF A;  1FYU A;  4GJY A;  3WW3 A;  2J1A A;  5L9V A;  2WYS A;  3JQX A;  5I8T A;  5FYH A;  2D6K A;  1I5P A;  3RZJ A;  3SKV A;  5B2G B;  4EE2 A;  1K45 A;  2Z42 A;  2ZPX A;  5FCC A;  3CO2 A;  1J84 A;  1X9P A;  2ZHN A;  1ND3 C;  2D44 A;  3SC7 X;  3B94 A;  2ZBJ A;  2IVI B;  4N53 B;  2EAK A;  4UW4 A;  1JZ6 A;  4XAA A;  3E6B A;  2YPJ A;  4CCD A;  3PUR A;  1D4M 3;  1G9F A;  2QZ3 A;  3C7O A;  4C1X A;  2VNV A;  1XB9 A;  1V0A A;  3OPW A;  3U4X A;  1ZBA 3;  5A7O A;  4CA9 A;  3J7L A;  2C9K A;  1LU2 A;  2D40 A;  4UWD A;  3AZV A;  3C3V A;  2GMP A;  3J7M A;  2IC1 A;  1MEC 2;  3MIF A;  3AFK A;  4FOW A;  4UAP A;  3FFQ A;  1PM7 A;  2C6S A;  5FLI A;  3NL1 A;  5FZ4 A;  3FHA A;  1PMH X;  5CFD B;  2FDK A;  3DYO A;  3OSD A;  3NVC A;  1JZ5 A;  2WS9 1;  1ULF A;  4GD4 A;  5GLV A;  5BV6 A;  5HV4 A;  3V0B B;  3CJI B;  5FMO S;  1C1L A;  1O4T A;  3UT0 A;  2Q4S A;  4QKN A;  2WFP A;  4IV1 B;  3AB0 A;  1GP4 A;  4AFD A;  5CFC B;  1O7F A;  4QXC A;  4AED A;  1LOG A;  4I09 A;  1NAE A;  4AF9 A;  5A3U A;  2R07 3;  5CFC A;  1UYY A;  1J1T A;  3HWJ A;  5C8C C;  1W6M A;  1NCQ B;  4XF1 A;  4DRR A;  4PHZ A;  4H3W A;  4COZ A;  2BNN A;  5FYM A;  2X53 S;  1RUE 2;  4Q4V 1;  2JG8 B;  2FDG A;  2ZZQ A;  1FX5 A;  1PO1 3;  5JI9 A;  4GMP 3;  2D6L X;  2XVG A;  3K2O A;  4W8J A;  4AQ6 A;  5ERL A;  1JYN A;  1UIK A;  3NNL A;  4FPH A;  5FY0 A;  5H9Q A;  1WBL A;  1VBA 3;  3NV4 A;  2WO3 A;  3I59 B;  4URA A;  1RJ8 A;  3ME2 A;  5CBL A;  3EYP A;  3WF3 A;  3BPS A;  4MGS A;  5IVV A;  3EB7 A;  1RUF 3;  2VMI A;  3IAP A;  5T5P A;  2QZ2 A;  2YUE A;  2JJ6 A;  1O8P A;  3PVO A;  4RGK A;  1G8W A;  5DAQ A;  4B3N A;  5K0U C;  2A6X A;  2IUW A;  1PIV 3;  2B9U A;  2P17 A;  4QQL A;  4YFZ A;  5FZH A;  3N4M A;  3I2D A;  3KCX A;  4P9J A;  4C0B A;  4AVB A;  4OYU A;  4QPI B;  1LR5 A;  3PHM A;  1UU4 A;  2C0Z A;  3WP3 A;  5JZG C;  3VDD C;  1GZT A;  5T52 A;  3H7J A;  4PQQ A;  1C8M 2;  1LED A;  1YUD A;  2ZGM A;  4M3C E;  1H1M A;  1DU3 D;  3RSJ A;  3VZM A;  5HCA A;  5HV0 A;  5KHJ A;  5FZC A;  2GN7 A;  3PUA A;  4Z1V A;  3VKF C;  2CWS A;  1V6J A;  2XJV A;  3POW A;  4NVP A;  3ZFG C;  1D0G A;  1ND2 A;  4KWK A;  1AXK A;  3N7J A;  1G9C A;  2D7F A;  1EPW A;  1VRH 2;  1OUX A;  4CZS A;  3BIE A;  3NMB A;  3KT1 A;  4XUN A;  3F95 A;  1F2N A;  5L36 A;  1FOD 3;  3VD7 A;  4AAX A;  5A3T A;  1H8T B;  3CDZ B;  1UMI A;  3CJX A;  3CF6 E;  2VCC A;  3VBF C;  4AHZ A;  5F1R A;  3ZN5 A;  4PCR A;  4YLZ A;  2NN8 A;  1GP6 A;  5IJR A;  3ZYH A;  2K46 A;  4BJ0 A;  1PX4 A;  3DF0 A;  5JSO A;  2G4I A;  3T4V A;  3LFM A;  3VZJ A;  2YDE A;  2JIJ A;  2W08 A;  2PHR A;  2JDZ A;  2C24 A;  4UYB A;  5F6L B;  5IFT A;  1X33 A;  4I0A A;  5GLU A;  1T6G C;  1UZW A;  3K46 A;  1GIC A;  2Z2S B;  3N9P A;  2BUK A;  4PBP A;  5JUV A;  1W6Q B;  2PHL A;  2MEV 3;  1W05 A;  1C28 A;  2YC0 A;  1W6Q A;  5LW9 A;  2CAU A;  1J3R A;  1VBD 2;  1YCI A;  2P4E A;  1VBB 2;  4FXK B;  3S57 A;  4OI2 A;  2Y6F A;  1TG7 A;  3HPN A;  3OYW A;  3RPQ A;  4LPL A;  4KMQ A;  3GM8 A;  3ZXL A;  1MS8 A;  2DTY A;  5APA A;  5I91 A;  1HJF A;  1UAI A;  2D6P A;  3I3E A;  4UT5 A;  2A1X A;  4J1X A;  1CIW A;  3WV6 A;  1PVC 2;  1R09 3;  5B4X A;  4CDU C;  2IXH A;  3P1I A;  1ULP A;  3OUH A;  3PUH A;  5A3L A;  2JG9 B;  1C57 A;  3MUY 1;  3WD5 A;  2OZ6 A;  2HBU A;  1S0I A;  2I74 A;  1SBE A;  2XHN A;  4XEZ A;  5FUN A;  2W9X A;  3HIF A;  3EQE A;  3UJO A;  4CDQ A;  5T55 A;  4A4A A;  3N7M A;  4Y22 A;  2A5Z A;  1GUI A;  1HX6 A;  4BCU A;  3AKP A;  4F8A A;  1H2N A;  2JX9 A;  3CKH A;  4YPJ A;  5FOB B;  1AYM 2;  2XON A;  4FPE A;  4SBV A;  3ZYF A;  4X6Q B;  4AHY A;  1COV 2;  4J1W A;  1C5I A;  2BFU S;  2TEP A;  3P5B A;  3VBO C;  4LA3 A;  3LA3 A;  3N3H A;  4FOY A;  1BJQ A;  3NAP A;  4P14 A;  2E6V A;  1L7Q A;  2ZGL A;  5AC9 2;  1RUJ 2;  1ZX5 A;  2FDJ A;  2VQ0 A;  1H8T C;  2VM9 A;  4O9G A;  2PN5 A;  3WF0 A;  5L7O C;  2VW1 A;  2QQM A;  2JDK A;  2HLE A;  1OA3 A;  4LUL A;  4NWV A;  1QOS A;  1DQ4 A;  2JKX A;  2EIC A;  3AP7 A;  3TB0 A;  2Y0I A;  1GOG A;  4JKK A;  1J1L A;  5LBE A;  1A78 A;  2GNB A;  5CFD A;  3RG0 A;  3BVC A;  5L19 A;  1C8M 3;  3UYJ A;  2R6Q A;  1W9T A;  3WOG A;  3I3Q A;  3WQ1 A;  4JTN A;  3O7O A;  2IFW A;  4NHY A;  3S7I A;  2B5H A;  2JB4 A;  2ZXQ A;  4IV1 A;  2B9V A;  4N43 C;  4NPM A;  2RR1 2;  2JDH A;  3URF A;  1LB2 A;  2DCJ A;  2V4A A;  3TNP B;  3HMY A;  5KHG A;  3BYW A;  1V9U 1;  2VOT A;  4NR1 A;  3M3C A;  4K6B A;  3U10 A;  1GSL A;  3DYP A;  1NCQ C;  3WY6 A;  5SV5 A;  1V9U 3;  3VLB B;  5B4N A;  4ZXE A;  3I2G A;  3LA2 A;  3DXU A;  4BB3 A;  1GAN A;  2ZAA A;  1RHI 1;  1YIF A;  2RS5 2;  1OUR A;  4X8N A;  1G9D A;  1SLL A;  1O8S A;  2JDM A;  4YZ3 A;  2VY0 A;  4UFK A;  4XAC A;  4DS0 A;  1W6N B;  2D6N A;  2X10 A;  3LB9 A;  1XXN A;  5BNN C;  1HV0 A;  1HRV 2;  4PDW A;  1ODN A;  3OY8 B;  1NY7 1;  4XMA A;  4MZU A;  1OOP C;  4FFH A;  4AZZ A;  1W2O A;  1H2M A;  1WLT A;  2ZCW A;  4QPG A;  5FP4 A;  2XVL A;  3VHP A;  4BMB A;  2HWE 3;  2ZGQ A;  3HN1 A;  3MV1 1;  4IER A;  4IET A;  4QPG B;  1HW5 A;  2O1Q A;  4WBB A;  2E9Q A;  5FZ1 A;  3WZ1 A;  5HBA A;  2DCT A;  3VBH B;  4LXL A;  3A23 A;  4YGC A;  4OMC A;  2Z4F A;  1LOC A;  2R04 3;  3VZN A;  3RMY A;  1YHF A;  2E26 A;  2J1R A;  2XB6 C;  3ZYB A;  2GC0 A;  3MBW A;  5CU1 A;  1MS0 A;  4FCA A;  1AF9 A;  1W9Y A;  1R08 1;  3OUI A;  3FHI B;  3ZR5 A;  1A3K A;  1J83 A;  1NUK A;  4XIL A;  4EYU A;  1N1S A;  4RA0 A;  2GME A;  1X8M A;  4GWM A;  5L9B A;  1QQP 3;  3EMR A;  2EA7 A;  1C5H A;  3K3O A;  2CWM A;  1AYN 3;  2VZ1 A;  1V6I A;  4HPK B;  4KWL A;  2WWS A;  4A3X A;  2SLI A;  3WF1 A;  1VBE 3;  2EAA A;  3ZPO A;  5J09 A;  3I4I A;  3VBO B;  3KF5 A;  4K40 A;  3ZN4 A;  4U2A A;  2Y64 A;  4FO9 A;  4FPG A;  4CCC A;  2BV4 A;  1U5I A;  4TTG A;  4DUX A;  3PVE A;  1AX0 A;  1OA2 A;  4AED B;  1Z0H A;  5JPN B;  1AR8 3;  3B93 A;  4YVW B;  2DVB A;  1RGS A;  2AZ5 A;  4OI0 A;  3L9J T;  3H50 A;  2JG9 C;  1S2K A;  3D0J A;  3HQR A;  4YFW A;  5FJK A;  4BK5 A;  4CDX C;  1HRI 3;  3THC A;  1UZY A;  3M3I A;  3CLP A;  3VBS C;  1ACC A;  5J98 B;  5C8C A;  3DV8 A;  1WLW A;  2RV9 A;  2BGC A;  1LOB A;  4YWA A;  4Z2A A;  2HWB 3;  3G7D A;  1MQT C;  3T2P A;  1REE A;  4ARX A;  5BNO C;  1S2E A;  3AMH A;  4LE4 A;  4YW1 A;  4EZH A;  3H3U A;  3RZK A;  3ZSE A;  4E8C A;  1ZVF A;  1I6X A;  2LTN A;  5A3P A;  4CPB D;  1FOD 1;  1VAK A;  4ATE A;  2HWD 1;  1JXN A;  3ZXE A;  3MLJ A;  2BVB A;  1STM A;  5F5C A;  1QHD A;  3CIH A;  5ACA 2;  4BOW A;  4XXA A;  5T5J A;  4Y20 B;  1UMH A;  4FP3 A;  2L9L A;  1Y3T A;  4Y22 B;  2XLG A;  1JYX A;  1K5J A;  2RM2 3;  4ES9 A;  5IK5 A;  4MUV A;  4B8E A;  4L8Q A;  1BMV 2;  2WQZ C;  3AKT A;  1JU3 A;  1UOJ A;  1XU1 A;  4YZ5 A;  4WM7 C;  1RXG A;  2GZW A;  4IEX A;  2B46 X;  4GKY A;  3WDY A;  1RL3 A;  1CAV B;  4R9B A;  3M1H A;  3Q8A A;  5KXE A;  4YW7 A;  5ANN A;  3HQX A;  3ROU A;  4LK6 A;  3LEM A;  3ZXF A;  4DRV A;  4NII A;  1UKG A;  4LOS A;  2NPI A;  1Q8V A;  2F6B A;  2QQN A;  2WZR 3;  3JCI A;  3OPT A;  4LO8 A;  3DUI A;  4BU2 A;  3JXS A;  1QNY A;  5FKC A;  1WW6 A;  5A1L A;  5BYN A;  4LIU A;  3VDD B;  3PLQ A;  3M4F A;  1GR3 A;  3AZX A;  3KGL A;  4Q4W 2;  3IN9 A;  4XW3 A;  4CDU B;  4AFM A;  2PAM A;  1AR6 1;  4OCT A;  5FO7 B;  5KWR A;  1JUI A;  4R4Z A;  2HWE 2;  3AYD A;  4QGL A;  1PO1 1;  2Y6L A;  1OLQ A;  4A6S A;  1GYK A;  1ONA A;  2LRO A;  5HCF A;  4RSU A;  1V70 A;  2VZU A;  4AVV A;  4IND A;  4ONU A;  3GHM A;  1NCR C;  4K1Z A;  1YWK A;  3CZJ A;  4G3Y C;  3V56 A;  4A7Z A;  1JBC A;  5ABJ B;  4AVS A;  2P3Y A;  3NNG A;  4LJH A;  3QBQ A;  3UET A;  1SFN A;  1VP6 A;  2WNU C;  1NCR B;  1W9W A;  2LAL A;  3LKJ A;  3W59 A;  1KIT A;  4RN5 A;  5FWE A;  1ASJ 2;  4ZZ8 A;  1UOG A;  2VOW A;  3ZMN A;  2HYK A;  4PDW B;  1GU3 A;  2GH2 A;  2DBI A;  4E2G A;  3TN9 3;  5CKN A;  2WZ8 A;  1IS6 A;  3V64 A;  4CCE A;  1K5M B;  1GQH A;  1M4W A;  2VQT A;  1GOH A;  1OQD A;  2NMN A;  4O61 A;  4FPF A;  4QQH A;  5EJ3 A;  4OHY A;  2HEY F;  3CL1 A;  1FPN 3;  4CEY A;  4EN6 B;  3PMS A;  3NJY A;  1D4M 1;  1JI6 A;  3HBK A;  4UW3 A;  3MLL A;  1IQD C;  4QM9 A;  4CEY B;  2W3J A;  3S30 A;  1VLN A;  4XFB A;  3A0N A;  4QX8 A;  1POQ A;  2ID4 A;  5FYT A;  1MS1 A;  2PYT A;  4NO4 A;  3A4U A;  3TBD A;  3CHX A;  3CMG A;  3E5U A;  5FBJ A;  5DZE A;  2JDY A;  1YI9 A;  2HWF 1;  1YXW A;  2Q30 A;  3LDB A;  1ZZ6 A;  2XL7 A;  3NAP C;  4Y1X A;  5FPA A;  4Q8K A;  1RXF A;  1Z7S 2;  1PO2 3;  3K4A A;  4DUV A;  5A6Y A;  1WD4 A;  2DVF A;  3P6B A;  4MV2 A;  1O5L A;  1D4V B;  3WW4 A;  4IEY A;  3DPR B;  1BVV A;  3PJQ A;  2WS9 2;  1W6O A;  5LZ6 A;  1TME 2;  1U0A A;  1U5X A;  3DPR A;  4LTA A;  4CUC A;  2N7G A;  3AZY A;  4D8M A;  2IXC A;  2VZT A;  2YGL A;  3ZN6 B;  3NJZ A;  1BMV 1;  3SH3 A;  1ZM1 A;  1M06 G;  3CQO A;  3VKO A;  4ZXK A;  4ASK A;  1X50 A;  1W6M B;  1N1T A;  4CVU A;  3AYC A;  2VBD A;  1RUD 1;  3FUQ A;  4W4Z A;  3J26 N;  1KXG A;  2WAA A;  3R4S A;  1ZNP A;  3VDC A;  1YQ6 A;  3ZSJ A;  3I8T A;  1NX9 A;  2EXH A;  1Y9G A;  5J3U A;  4ZON A;  1QNW A;  2GC1 A;  1R08 2;  4RFR B;  2QVS B;  3WVJ A;  2RDS A;  1VBE 2;  3Q8F A;  4B29 A;  2VU9 A;  2Y60 A;  1Q56 A;  4TXW A;  3VBS B;  2WZE A;  3OY8 A;  1URX A;  4OMD A;  4A44 A;  5JLV A;  1RVF 1;  2JEN A;  2W87 A;  3KCY A;  3GZT B;  2YMZ A;  1DZR A;  3ZOI A;  5FPU A;  4JDM A;  5FKB A;  4XUO A;  1KQR A;  3O0V A;  4DQA A;  1BBT 3;  2XWJ B;  5BNQ A;  4IE6 A;  2HEW F;  3I3B A;  2PAK A;  2YB7 A;  2W1S A;  2VZS A;  2WO1 A;  5A3N A;  4R8H A;  1LKN A;  5I0T A;  4QX0 A;  4JC1 A;  2BVV A;  3UES A;  1DQ6 A;  3GGL A;  3OTF A;  4GUL A;  1QY4 A;  4L9B A;  3LOB A;  2WSV A;  3NKG A;  4FTS A;  4MGI E;  3D6E A;  1HRV 3;  3CZU A;  3IZO A;  4JQR A;  5T5O A;  2DF7 A;  3T4H B;  5BNP A;  2HWB 2;  4FPL A;  2BDR A;  5JXJ A;  1QH7 A;  3KD4 A;  2ZGK A;  4P9Y A;  4LBK A;  1OBN A;  3AM2 A;  2VQA A;  4CDW C;  4FSJ A;  1OI6 A;  3CU7 A;  3HNY M;  4AI3 A;  3VKN A;  2OZJ A;  2JE7 A;  3KS7 A;  5IVJ A;  2XBO 3;  3PME A;  1AR8 2;  1HXS 2;  1S1A A;  3U11 A;  2V72 A;  4ATF A;  2FCT A;  4QU1 A;  4DEQ A;  4Q0S A;  2VUL A;  4IQP A;  2AUY A;  2Z5W A;  2PHD A;  1VJ2 A;  3PL0 A;  4W6X A;  4E2S A;  5EXO A;  2XUE A;  5FZF A;  4MVT A;  4GIQ A;  5F2S A;  3RJR A;  2X8K A;  3AZW A;  5SV8 A;  5EJZ B;  1UW8 A;  4AEM A;  3WNK A;  5FZM A;  1NZC A;  1QOT A;  1WCD J;  2GNM A;  4YM2 A;  5FXW A;  5JOW A;  3RI8 A;  4WV8 A;  1GNZ A;  3VGI A;  3WW2 A;  5EYY A;  3SKJ E;  1F31 A;  4LE3 A;  1PZ9 A;  4NMI A;  4FPO B;  4YW5 A;  2Q8E A;  3MPB A;  4P00 B;  5C8W A;  4QKD A;  5LEJ A;  2W68 A;  3H7Y A;  2WQ4 A;  4IGP A;  3BTA A;  5CKQ A;  4EN7 B;  2PMW B;  4PLN A;  3IPV B;  3RRD A;  1E57 A;  1J3P A;  2XDV A;  4FFI A;  4OHZ A;  4CDW A;  2VMG A;  1ZZ7 A;  5LRS A;  1QJY 1;  3U1X A;  3HAG A;  4QD2 A;  5G04 L;  5BXX A;  3RYK A;  4QDR A;  2EVX A;  2GNT A;  4BHP A;  4BK4 A;  3MID A;  2CDP A;  3GZA A;  4Q4X 1;  4K3U A;  1D2S A;  3UNP A;  4XIO A;  4FOQ A;  3MLK A;  2XQX A;  1VBC 2;  1BKZ A;  1WW5 A;  4FQZ A;  4I3G A;  1BEV 2;  3FBM A;  1BXH A;  2RVA A;  3OGJ A;  1X7N A;  2QJV A;  1EP0 A;  3B69 A;  1AL2 1;  4Q27 A;  4RHV 1;  1AR9 2;  1LHU A;  1L7L A;  3RFR A;  1ULG A;  2RS5 3;  4CU6 A;  5CFD C;  5A7W B;  5GZC A;  2WAB A;  3POJ A;  4QQ2 A;  2K2S A;  4Q0U A;  1TNR A;  1GZW A;  1BZW A;  1HQW A;  2CDO A;  4K21 A;  2P6C A;  1RUH 2;  2AH2 A;  5JIU A;  5IAX A;  1IGO A;  3NO8 A;  3H1Y A;  5IK8 A;  3NNM A;  5LY2 A;  1ND3 B;  4LR4 A;  4CDQ C;  4PF5 A;  2ORZ A;  4ES8 A;  5C3O A;  3O1P A;  2OX0 A;  4IE4 A;  4IV3 B;  5BNN A;  5C3Q A;  5TSW A;  1D2Q A;  1J3Q A;  5FY7 A;  4CEW C;  5D8A C;  3TEY A;  1HN0 A;  2EXI A;  3WLU A;  5FFO C;  1DQ5 A;  1AR9 3;  4L11 A;  3ZSM A;  4YGE A;  1GP5 A;  3MFA A;  4KU8 A;  3UGH A;  5GLT A;  4DUW A;  3LF7 A;  4MG2 A;  2OPW A;  3GJB A;  1NE6 A;  1RUG 3;  1XOY A;  3KV6 A;  1UN1 A;  4HXC A;  1E5H A;  4JAA A;  2RS5 1;  2XLA A;  3I3D A;  5C9A C;  1RUI 2;  2J1U A;  2VUC A;  3C2U A;  4E8D A;  1T2X A;  2QQP A;  4QX1 A;  1GOF A;  2X5I A;  1KRI A;  4Z92 B;  3AYA A;  3B9C A;  3DEM A;  2BPA 2;  3OGR A;  1DQ1 A;  1PMJ X;  2WN2 A;  2O8O A;  1JZ2 A;  3QD6 A;  2WFF 3;  3J8F 2;  5F3I A;  4BQ5 A;  3N36 A;  5A6Z A;  2NMO A;  3B00 A;  2NP0 A;  1O91 A;  1VE0 A;  4EN9 B;  1IG3 A;  1SLB A;  3OGG A;  4V1P A;  4ISR A;  2YYO A;  5FPL A;  1J58 A;  3UJQ A;  4HVR A;  5A3O A;  4XBQ A;  1NLR A;  5DG1 A;  2FZ1 A;  5CZK A;  4Q29 A;  1H6X A;  4XIK A;  5FZG A;  1H6Y A;  3RZH A;  1SPP B;  2A7A A;  1YFY A;  1DQ2 A;  1UWW A;  3THD A;  2VNG A;  1S0J A;  4XET A;  1O3T A;  4YG6 A;  5LA2 A;  1IG0 A;  5FLH A;  4Q4V 2;  5L73 A;  3E6C C;  1A6C A;  2PTM A;  5FMO L;  1PZ7 A;  3BN6 A;  1BQP A;  4Y33 A;  1UKR A;  2YFZ A;  2WFF 1;  4K8F A;  4COV A;  1RB8 G;  1W2U A;  4YGD A;  5LB6 A;  1NG0 A;  1QJX 3;  5FUP A;  1OPM A;  3AVR A;  2QE3 A;  1LJ7 A;  5DUU A;  4I0B A;  1JZ4 A;  4KQ7 A;  5KHK A;  3R0R A;  2BBA A;  1XPW A;  2RMU 3;  1LES A;  2Y34 A;  4GXL A;  2EF6 A;  3UK9 A;  5FWJ A;  1QXJ A;  4GMP 0;  5IK7 A;  1PGS A;  4DEV A;  4B7E A;  5KHH A;  3MF6 A;  5FJH A;  2UY9 A;  3FX3 A;  4XCA A;  1RHI 2;  3OG2 A;  3ELN A;  4MXW B;  4RYD A;  5BNO A;  4ZU5 A;  2BNM A;  4AHX A;  1F8V A;  3JBG 2;  3ZXJ A;  3SEE A;  2JG8 A;  1UXZ A;  4COU A;  5ABJ C;  3FMG A;  4NJ4 A;  2R0H A;  3DEC A;  4AGG A;  2BW8 A;  1NY7 2;  2OUJ A;  2CU5 A;  2QDR A;  3VKL A;  2IXJ A;  3AL6 A;  4KNC A;  1G9A A;  1S0G A;  4ZU4 A;  1S2B A;  2C26 A;  2DVG A;  3JU9 A;  3N7K A;  4GWI A;  5I8S A;  2ARB A;  2VCA A;  3J9S A;  1H2K A;  1BLZ A;  2OPK A;  5JR2 A;  1DYO A;  1H9P A;  4BQ4 A;  3JUU A;  2R0F A;  4Y5S A;  3Q8E A;  2WA4 A;  1H30 A;  1MR5 A;  4LT5 A;  4PI0 A;  5DQ0 A;  2A3W A;  2R1D A;  4IE5 A;  4Z2W A;  4D94 A;  4CDW B;  3IBM A;  1XYN A;  1QJU 2;  2Y33 A;  3ZX7 A;  4UBH A;  4IDZ A;  5JSP A;  2QQU A;  1OD3 A;  3IWZ A;  1V6M A;  3BOD A;  3C7E A;  4PIY A;  1DP0 A;  1IQA A;  1XYP A;  3KT4 A;  3USS A;  4XFI A;  4GKX A;  1UYP A;  2QQW A;  1PMI A;  1S55 A;  5A7S A;  1W99 A;  4CCK A;  4Q1P A;  2E51 A;  1LEC A;  4ZS2 A;  4MO3 M;  3F2Z A;  2CSG A;  2WZP P;  1CPN A;  3E97 A;  2XH6 A;  2YBS A;  5EJ1 B;  1GFF 2;  2XL9 A;  3VL8 A;  1AR6 3;  1EUT A;  2ZEZ A;  4HMZ A;  2WII B;  1H8T A;  2G19 A;  4P9L A;  1PVC 1;  3AK0 A;  1WA4 A;  4FXG B;  2Y38 A;  5ANQ A;  1UOB A;  4NHL A;  1O5U A;  2CGP A;  3E5Q A;  3IM0 A;  3FBY A;  1LOF C;  3AKR A;  3WNL A;  1TME 3;  5E8A A;  1OLR A;  2ADE A;  4KG8 A;  3ALQ A;  3RZG A;  5C9A B;  2EIG A;  4CP1 A;  4NAM A;  4HON A;  1A8D A;  4FVV A;  4N8M A;  3UL2 A;  1PO2 2;  4JHT A;  1NZI A;  3FWE A;  4Y24 A;  3PIJ A;  4AI9 A;  1SDD B;  2XJU A;  4Q4Y 2;  1VAV A;  5GM0 A;  3OB8 A;  1CPM A;  4XJW A;  1XNB A;  2DWR A;  3B5L B;  1H1I A;  3JD7 3;  3LIH A;  5DAX A;  4AEJ A;  1JYI A;  1UU5 A;  1YYN A;  3GBW A;  4NRQ A;  5EV7 A;  1PK6 B;  5EYX A;  4XDQ A;  4BQW A;  4EWD A;  1RUE 1;  3ZXD A;  5JWP A;  2HWF 3;  1YFX A;  2XR4 A;  5DN2 A;  4BQY A;  1VIW B;  1ZBA 2;  2WT1 A;  4D3W A;  1QJU 3;  2JE8 A;  2QDN A;  4UI9 L;  5IT6 A;  3ETP A;  1CZS A;  2ES3 A;  4I01 A;  5A7N A;  2FDH A;  2X5I B;  2IZW A;  1CN1 A;  1UU6 A;  3HVD A;  4HSL A;  2OT7 A;  2VVE A;  5FQ0 B;  1YQ5 A;  4YM1 A;  5KXB A;  4IV3 C;  4AVC A;  3O14 A;  3WQ0 A;  4RQP B;  1UQX A;  4I30 A;  4CCL A;  4YVW C;  2RDN A;  4R9D A;  3VD9 A;  4CDQ B;  4W50 A;  4LBQ D;  5JOX A;  1XC6 A;  2VCB A;  5BUV A;  3LFI A;  1PNG A;  4ZZ5 A;  4IE7 A;  2JEC A;  3PUI A;  4K20 A;  5AVA A;  4GWN A;  1DG6 A;  1QOO A;  2Q1M A;  1CZV A;  1T6B X;  4Q26 A;  4YM3 A;  4MXV A;  5GZD A;  1OQ1 A;  4NE9 A;  5H9S A;  2D43 A;  4IXL A;  4QB6 A;  1QJF A;  4XFH A;  4NHX A;  1QJZ A;  3LQC A;  1CAU A;  3WF2 A;  1DDL A;  4XC9 A;  2R7E B;  5A7P A;  4KGQ A;  1JZ8 A;  2JDP A;  1BBT 1;  1CAU B;  1H4G A;  1BK0 A;  3JB8 A;  1DF0 A;  4I02 A;  1GZW B;  4MET A;  5JI7 A;  1HRI 2;  1ND2 C;  3GCX A;  2QQI A;  3III A;  2WQ8 A;  2VMF A;  3N9L A;  2E7A A;  1DFQ A;  1RVF 3;  3SQO A;  4GZ9 A;  4M0N A;  5FYZ A;  5JOY A;  1AR6 2;  4QGN A;  1SFY A;  1IS3 A;  1OKQ A;  3AP5 A;  4NIG A;  1CVN A;  1FMD 2;  5FXV A;  5BPX A;  2FZ2 A;  2EXK A;  1A8M A;  3LIG A;  4B1L A;  1PX3 A;  3RWK X;  4AFB A;  4BA6 A;  5CAZ A;  4AWD A;  4OUE A;  2ZX1 A;  4XF3 A;  3VZK A;  4EN0 A;  5K0U B;  2R06 2;  3IIA A;  2HYX A;  4BYY A;  5JXI A;  3THP A;  3MYX A;  5D8A A;  3WNO A;  3PVB B;  4RGG A;  1WLD A;  4KI5 M;  5FV3 A;  4ERO A;  2VMH A;  4LBJ A;  4H7L A;  4TZD A;  4C90 A;  3VHN A;  3MF9 A;  1W3X A;  1LTE A;  2Y8K A;  4HFS A;  4YZ4 A;  2R04 1;  4A41 A;  1XQN A;  4B4R A;  1Q8P A;  1JH5 A;  1N47 A;  2ZGS A;  3WEZ A;  2AEN A;  1W6N A;  5A3M A;  3AKQ A;  1US3 A;  4E9K A;  3HT1 A;  3RJ2 X;  1AZD A;  2LW8 A;  4NHK A;  4OI1 A;  2V4V A;  1VRH 1;  2ADD A;  1VR3 A;  1U5Z A;  4QDS A;  2PXJ A;  2YGM A;  1QJE A;  2BRT A;  4GJZ A;  3IAQ A;  5FY9 A;  5BNP C;  2P5B A;  1LGB A;  4HN1 A;  3VDA A;  2VXR A;  4LEJ A;  1PGW 2;  4RS5 C;  3C8X A;  2ENR A;  5GZE A;  2WC2 A;  4MGY E;  5F8P A;  1W8H A;  3KB5 A;  3RNS A;  2VNR A;  4P9I A;  3O0W A;  1F4A A;  4ORF A;  1RIR A;  4XTM A;  1LRH A;  2I07 B;  3WNN A;  4FTB A;  4AVT A;  2XKO A;  2Q8C A;  3IMN A;  4HN0 A;  4LMF A;  2VBB A;  1FPN 1;  3PTY A;  3BPZ A;  3GZE A;  3PIG A;  3ZVX A;  1GQG A;  4OZX A;  4WM7 B;  1ZZC A;  1C4R A;  3QAC A;  1K3I A;  4QPY A;  2A3Y A;  2GC3 A;  2HWB 1;  1ULE A;  3H1M A;  2F4L A;  5DUV A;  5KBF A;  3TN9 1;  3LCP A;  3LDK A;  3N9O A;  3NNF A;  3QCW A;  4LKF A;  2HEV F;  5EHD A;  1HRI 1;  1LHW A;  1Y9Q A;  4M3C A;  3BGA A;  1FV3 A;  4N53 C;  1DHK B;  3BIW E;  1GWM A;  2WNV C;  1MS5 A;  3VBU B;  3APB A;  3I97 A;  2DYC A;  1TMF 2;  2BZD A;  1S0C A;  4B4Q A;  3U4S A;  4OUM A;  4MHR A;  3WHT A;  4Z8B A;  4IUG A;  2B7Y A;  1PIV 1;  4OLL A;  1LHO A;  2BGO A;  1VBB 1;  5BNO B;  4E4D X;  3WUD A;  2RJL A;  5F7U A;  4QXK A;  1PGL 1;  1N3P A;  3KVA A;  3Q8C A;  2NLR A;  2HKX A;  3ZDV A;  2A70 A;  5FYS A;  4XAB A;  1W8U A;  4CDX A;  3B9I A;  2E32 A;  4P02 B;  1ENR A;  3D4K A;  2E53 A;  3O12 A;  3OBA A;  4CEW B;  3M70 A;  4CDX B;  3I59 A;  1XND A;  4Y4Y A;  3MO4 A;  2UUR A;  2WN3 A;  2V73 A;  3MI8 A;  4CEW A;  4F7Z A;  5AVP A;  3FLP A;  2P3J A;  3QLQ A;  3H0O A;  2CHH A;  4LBM A;  3OPZ A;  5ISL A;  1UY4 A;  3KHC A;  4AED C;  2KD7 A;  5E16 A;  2DBN A;  3DN7 A;  1JYC A;  2V5D A;  1AX1 A;  5J96 B;  3M2M A;  2WZR 1;  1LOD A;  1R09 1;  4RQP A;  2CAV A;  1B35 B;  1MS3 A;  2P37 A;  5LBC A;  3ZFF C;  2P2K A;  3MIB A;  5C4W C;  1N1V A;  4LBL A;  5EPA A;  2VOK A;  3ZFE B;  5FMB A;  5DG2 A;  1COV 1;  2RG4 A;  2MPF A;  4ISQ A;  2WNV A;  2ZGO A;  3VV1 A;  1PNF A;  1LOA A;  3LEG A;  5IWF A;  2W2I A;  3NAP B;  2AGS A;  2MEV 1;  2QBX A;  4OUS A;  3ZFG B;  3BUC A;  4H55 A;  4XVH A;  5FXZ A;  4CP2 A;  1W0O A;  5F6K A;  5J7M A;  1KDK A;  3ZYI B;  1JYT A;  1ZBE 2;  1HV1 A;  1MEC 1;  1JMU B;  2HWD 3;  3NQH A;  4IEV A;  1H1A A;  1KS5 A;  1QIQ A;  1WKY A;  4E4S A;  5FPB A;  4CP9 A;  2WT2 A;  3IKW A;  4EJR A;  5F3E A;  2ZS6 B;  5FZ8 A;  4W65 A;  1CR7 A;  1NA1 B;  3H8U A;  5DZG A;  2UYB A;  2G1M A;  2NM1 A;  3BAL A;  1QU0 A;  5LWB A;  4IV3 A;  5BNN B;  1EY2 A;  3DGT A;  1EV1 2;  2ZTN A;  3W58 A;  3I2K A;  4KBB A;  2VOV A;  4LIT A;  1YFW A;  1CX4 A;  2AYH A;  4GH4 C;  5AC9 3;  4BPZ A;  4QPW A;  4L2N A;  4MSV A;  1VRH 3;  4RR3 C;  5KC6 A;  2J1E A;  3WG3 A;  5KC5 A;  3C7G A;  1ENQ A;  4L97 A;  1RUC 1;  4C8D A;  3KT7 A;  1V6K A;  4UFM A;  1W8T A;  1ZZB A;  3NKT A;  4JZR A;  1WA6 X;  3T1L A;  1JHN A;  1NA1 C;  1NCR A;  2W5F A;  3WHU A;  4D6S A;  1C1F A;  4XOG A;  5GJ6 A;  4BQ2 A;  4RR3 A;  1OSG A;  2FQP A;  4X8P A;  5I0U A;  1XU2 A;  4UF0 A;  5GKA C;  3V0A A;  2VMC A;  5HCB A;  3VBF A;  2C4X A;  1WCQ A;  3ILR A;  5HXM A;  1RUF 1;  3TNQ A;  3T0A A;  3KQ4 B;  3L2H A;  4AAP A;  4BIO A;  1QH6 A;  2Q8O A;  2FDF A;  1VBA 1;  5IW0 A;  4QWN A;  2ARE A;  4Q4X 2;  2GN3 A;  1QQP 1;  3ST7 A;  3PUS A;  3S5A A;  3GDB A;  4QHZ A;  1DQ0 A;  3T0B A;  3MIG A;  1RUN A;  1TMF 3;  1GZ9 A;  4HBN A;  4KGG A;  5FLJ A;  4L0P A;  2PHF A;  2WRA A;  1QKQ A;  4UFI A;  2PHU A;  1RMU 2;  2TUN A;  1XYO A;  5CG8 A;  1B09 A;  4Q5O A;  4CE8 A;  3ZFF B;  2CV6 A;  2PAE A;  1RUC 3;  1W0P A;  4FFF A;  4OHV A;  1HIX A;  2OW4 A;  2XKP A;  4Q0P A;  1ZRR A;  2VC9 A;  2E33 A;  4XBN A;  2VPV A;  1Q8O A;  4N9I A;  3NJX A;  4NWW A;  1EAH 3;  2WFF 2;  4BE3 A;  1UMZ A;  3NRU A;  1JYW A;  3KWV A;  5C5T A;  5JDB A;  2R07 2;  4AI0 A;  4YW6 A;  3A0K A;  5DUX A;  2WS9 3;  3K51 A;  4FQ4 A;  3D82 A;  2RDQ A;  3W9A A;  4B4P A;  4JV4 A;  1WMF A;  1RJ7 A;  4MGZ E;  2W1W A;  1LNS A;  1GMM A;  4JGY C;  3MW4 A;  3LEK A;  2JE9 A;  2A3X A;  3POB A;  4AQT A;  3POF A;  5IYY A;  2HWC 2;  4QHO A;  5D8A B;  4ZKT B;  3AXE A;  2RS3 2;  4H2A A;  3LDR A;  4XF4 A;  1MEC 3;  2BQP A;  2ZEY A;  4BM8 A;  3LPF A;  4Q0V A;  3B3Q E;  1E5S A;  4TSV A;  3AVS A;  4Z07 A;  3M7A A;  3DXT A;  3HR9 A;  3FFZ A;  3ZYR A;  3OOX A;  2WYF A;  4IEW A;  4HVQ A;  1V00 A;  5FPZ A;  5ACA 1;  1YI7 A;  3HNM A;  3QH6 A;  3QOP A;  5F5A A;  2Y26 A;  1DLL A;  2HWD 2;  4MYE A;  1GWK A;  3FL7 A;  1S4C A;  4OQ8 A;  3VBR A;  2WWU A;  4JDO A;  4UXA A;  2PLV 3;  3BB6 A;  1SCS A;  1R64 A;  5DDJ 3;  4FOV A;  5A33 A;  3VBR B;  4CU7 A;  2VE1 A;  3ACG A;  4LHK A;  5EQU A;  2JDN A;  1UY0 A;  4Y1U A;  2WIN B;  5F5Q A;  5FZ0 A;  5A33 B;  3NV1 A;  4R9C A;  3UGF A;  2VZV A;  4DIN B;  1VBD 1;  1IS5 A;  2R16 A;  2BER A;  3AFG A;  2WNV B;  1DBN A;  1DGR A;  3VBU C;  1IKQ A;  2D6O X;  3A22 A;  3FC0 A;  4M3C F;  1KD7 A;  5FY4 A;  3ACF A;  4CP0 A;  5JMO A;  4AYU A;  1HQN A;  3PVN A;  3V65 A;  3AJY A;  4UBG A;  3SCG A;  4GB3 3;  1WMD A;  2CL2 A;  4QXH A;  4XF9 A;  5BNP B;  3BI3 A;  1DGW X;  4S2H A;  4WM8 B;  1JTZ X;  3VBO A;  5K7P A;  1RC6 A;  1AXZ A;  5CEH A;  5IVB A;  1Z7S 1;  1OOP B;  4OUL A;  1W06 A;  5CA6 A;  4Q4W 3;  3OBR A;  5LA0 A;  3O1S A;  4CU9 A;  1SMV A;  2XG3 A;  2P3K A;  2VOX A;  4FFG A;  1E5I A;  3VBH C;  2Y6J A;  2DUP A;  3PJY A;  3WG4 A;  3O1R A;  4HT1 T;  4FPK A;  2G9F A;  2DUR A;  2MNG A;  4H14 A;  4GB3 1;  2ZGN A;  2C9A A;  1CJD A;  1NXM A;  2ERF A;  1LHV A;  4XUP A;  1SLC A;  2HBT A;  1XSQ A;  2E7T A;  4V2W A;  2ILM A;  1WCU A;  2D3S A;  2RDR A;  2KXL A;  3JQW A;  3POI A;  1OLM E;  2YC4 A;  3VHO A;  1X82 A;  4DXS A;  1FPN 2;  2IXK A;  3VDB A;  1WCS A;  2ARX A;  2R06 3;  4Q8L A;  3AMP A;  3VD4 A;  1GQP A;  4KWU A;  4D7Y A;  3LEI A;  1CD3 G;  4XTP A;  3H8R A;  4YYO A;  2P6H A;  4OHW A;  1LEN A;  1HB4 A;  4BIF A;  4CCJ A;  4DNY A;  4P9G A;  5T3N A;  2XJR A;  3WW1 A;  2DVD A;  3ON7 A;  4TWT A;  2XBO 2;  2BYV E;  4GH4 A;  3FUO A;  2WKK A;  5CIR A;  4J25 A;  2AAC A;  4XJ9 A;  4N43 B;  5C71 A;  2RR1 1;  2ZAC A;  3PTR B;  1F15 A;  1Q3E A;  3GBF A;  1SFP A;  1ZZ8 A;  1UD1 A;  5E89 A;  4QAW A;  3HN3 A;  2I45 A;  4XDO A;  2DV9 A;  4LHN A;  5FYI A;  3C7F A;  4MX3 A;  3W20 A;  5C3P A;  4Z82 A;  2VJX A;  4JKL A;  2BWA A;  4HK8 A;  3PDQ A;  1L7R A;  2QKD A;  2BWC A;  2VR4 A;  3AC0 A;  2BOJ A;  1OFS A;  2A73 B;  3ZIX A;  3AX4 A;  5FP9 A;  2GP5 A;  2P3I A;  4PT6 A;  5HI0 A;  4LNV A;  2B4K A;  5L7O B;  4XUR A;  2P34 A;  3ENR A;  5LCW L;  1POV 0;  1XNC A;  2DCK A;  2BOI A;  4IEP A;  3ZFG A;  5L7O A;  1V6O A;  5FZ9 A;  3AP6 A;  4LKS A;  2WA3 A;  4XE9 A;  2FBE A;  3BTZ A;  3MV0 1;  5A7W A;  5IK4 A;  1GKB A;  1RUI 1;  3ES1 A;  4E27 A;  1XE7 A;  1FAY A;  3VHR A;  2QQJ A;  3ORJ A;  4ITC A;  3TYJ A;  2PA7 A;  4L99 A;  5T50 A;  4UW6 A;  1NA1 A;  4QM8 A;  1ULO A;  4P9X A;  4E4Z A;  3D5O A;  5JVV A;  3RDI A;  2BEO A;  2G9G A;  2CGN A;  3J8F 1;  1FMD 1;  2W46 A;  4Q2F A;  2D5F A;  1SQ4 A;  1AHS A;  1YEW A;  1VB4 A;  2ZMN A;  5LA1 A;  1VMH A;  3VBR C;  1KDM A;  3OD0 A;  2JIC A;  1NQJ A;  4CCO A;  1SBD A;  1NYW A;  1NCQ A;  4EQV A;  4A7Y A;  4XMI A;  1FI2 A;  1AX2 A;  3MIE A;  2VZ3 A;  3O0X A;  5HXV A;  3ITQ A;  4A42 A;  1W3V A;  5FK8 A;  2Y6G A;  4PQ9 A;  3KQR A;  3IDC B;  3WNM A;  3OEB A;  3ABZ A;  1XE8 A;  4YVS C;  2QTW B;  1FT9 A;  1W8O A;  3H1W A;  4RD7 A;  1RMU 1;  3T1M A;  1J59 A;  2RS3 3;  5DAB A;  3AMQ A;  1KS4 A;  4DPN A;  1RVF 2;  3KV9 A;  5FIX A;  4AQS A;  2VVF A;  3VBS A;  2R32 A;  2R49 A;  1Y4W A;  1LUL A;  4XAE A;  2X05 A;  3RMX A;  3HBZ A;  3TEX A;  1CAX B;  4AK3 A;  2RS1 2;  4QX7 A;  4B1M A;  1C3H A;  4A6O A;  1LOF A;  1CAX A;  3AXD A;  1OMI A;  1D7P M;  1N1Y A;  3FJS A;  4GB3 2;  1GV9 A;  3RZZ A;  4LIV A;  4AQ2 A;  4BDV B;  2GSY A;  2ET7 A;  4Y5Z 0;  4NPL A;  3GJA A;  1CJP A;  1H9W A;  2O0O A;  4HVO A;  4QPI A;  3VBH A;  3PU3 A;  3SNM A;  3VKM A;  2ZX0 A;  3WF4 A;  4XQW A;  4XFA A;  3H42 B;  5M0T A;  2KA3 A;  3USU B;  3OCP A;  4LHL A;  4NAO A;  5AC9 1;  4QQO A;  1CQ9 A;  4CRQ A;  1SG3 A;  1RUC 2;  1UY3 A;  3ZFF A;  4NID A;  2VH9 A;  2O8Q A;  3AKS A;  2WLQ A;  1EPZ A;  4HPK A;  3WDW A;  1NQD A;  2BFU L;  2RR1 3;  2LS6 A;  5EIY B;  3WSO A;  1GNH A;  4OHX A;  4NRM A;  2A6W A;  3VZO A;  3RI9 A;  4YW4 A;  1R1A 1;  1JU4 A;  3ZYG A;  2DCY A;  1NE4 A;  1S0B A;  2YY1 A;  1MS9 A;  3ZSL A;  1WUV A;  3CJI A;  4AFA A;  5K8S A;  4YRD A;  3RZL A;  3TEZ A;  1YIP A;  2PHX A;  3O1V A;  1CES A;  4Q4X 3;  1OD5 A;  2FHR A;  1EYB A;  3T2Q A;  1KJR A;  2YBK A;  1POV 3;  4P5Y A;  1NXD 1;  4RS5 A;  1O59 A;  5J36 A;  2R06 1;  1QJY 3;  4NRO A;  1LCL A;  4D69 A;  2E31 A;  1BK1 A;  5DZF A;  4M4R A;  5F2W A;  1DGR N;  2B8M A;  2DDU A;  4FBF A;  4AI8 A;  2DUO A;  4K9S A;  3RS6 A;  4XF0 A;  4MOA A;  5IHR A;  5AFB A;  3SMH A;  1HB2 A;  3ZM8 A;  2HH9 A;  4XPV A;  1IPS A;  1JOJ A;  5C8C B;  3I2O A;  3K77 A;  2VTX A;  5E88 A;  1COV 3;  4LLF A;  1PGL 2;  5FZ6 A;  4XUT A;  1OF3 A;  5FZL A;  3OYW B;  2ZML A;  4E4H A;  3O1O A;  3CBN A;  2IXL A;  3WDT A;  2VQU A;  1EAH 2;  1TVG A;  2VXJ A;  2CY6 A;  3DKQ A;  4Q4W 1;  5LBF A;  1ASJ 1;  2WUH A;  2D6M A;  4WVV A;  2RMU 2;  1H8V A;  1RUG 2;  2OUH A;  1W2A X;  2W39 A;  1AUY A;  1RYY A;  3LSE A;  4RFT 0;  4GH4 B;  1MVE A;  4QKF A;  4IV1 C;  3GF6 A;  2ZMK A;  3LD8 A;  4D0Q A;  4NOT A;  5C33 A;  2VW2 A;  2FCU A;  3S0M A;  1HB3 A;  3CJI C;  3KM5 A;  5L9R A;  4XHB A;  3H8X A;  4Y20 A;  5FZD A;  1UL9 A;  3MHZ A;  5AFE A;  2QNK A;  3ACI A;  3GAL A;  1KGY A;  4A3Z A;  1PZ8 A;  1BEV 1;  1VBD 3;  1UYZ A;  5I93 A;  4WM8 C;  1UPS A;  2ET1 A;  1ZBE 3;  4AW7 A;  5LAS A;  1AJO A;  5LK5 A;  3RVH A;  3R05 A;  2XXZ A;  2VUA A;  2OII A;  3LGR A;  2VO5 A;  3MEP A;  3S5Q A;  2E63 A;  5FZK A;  1WBF A;  3U07 A;  5I0R A;  2A6Z A;  2XLF A;  5E1R A;  5F3G A;  4OFG A;  4CP9 B;  2ZEX A;  2RHP A;  2ZEW A;  5ACA 3;  1F4H A;  5K4L A;  2VG9 A;  1ZZ9 A;  4I0W B;  1W0N A;  4LOT A;  4YG0 A;  4WZF A;  5FP8 A;  3I3M A;  1WME A;  4YSF A;  3B01 A;  2HWC 3;  4PLM A;  4AVA A;  4WVM A;  1O3S A;  1ULD A;  3ETQ A;  3WG1 A;  4HL0 A;  5C4W A;  5A70 A;  5C9A A;  1CIY A;  5A32 A;  4AE2 A;  5C4W B;  1EUU A;  3IDB B;  2XPJ A;  3OGS A;  1B35 C;  1EV1 1;  5FXX A;  5A32 B;  4CUG A;  3R4D B;  4QX5 A;  4AEK A;  1AYM 3;  1UF2 C;  2VME A;  3MZH A;  1U12 A;  2WNO A;  4IEQ A;  5FP7 A;  5J1X A;  1MAC A;  2QQV A;  1XSR A;  3CEW A;  4S2F A;  4MAD A;  4EV0 A;  2JDA A;  3JBG 1;  5A6Q A;  4YGB A;  2WDB A;  4XJU A;  1DCS A;  1UY1 A;  1SHW B;  3T2O A;  3ES4 A;  4XBL A;  5GZG A;  4BZ4 A;  4N9H A;  4CUB A;  1APN A;  1SEF A;  3HEI A;  4QB1 A;  1EAH 1;  1JW6 A;  1DYK A;  5CAD A;  2ZAH A;  3FN9 A;  2X09 A;  5FQ0 A;  5H9R A;  4LHS A;  4QB2 A;  4N43 A;  1HB1 A;  1K5M A;  1WZX A;  2A6Y A;  1RUH 3;  3OGV A;  1RUF 2;  2QFE A;  3INA A;  4YG3 A;  1DYP A;  3NNJ A;  2VGD A;  2PHT A;  4FP2 A;  4ASM B;  4JVA A;  2ZGU A;  1Z78 A;  4XHX A; 
#chains in the Genus database with same CATH homology
 3HJR A;  4IUG A;  3W5N A;  1JI6 A;  2BGO A;  1IQD C;  2W3J A;  5C70 A;  5F7U A;  3WQB A;  2ID4 A;  1BHG A;  3CMG A;  2E32 A;  2W94 A;  4P02 B;  5JXG A;  3OBA A;  2WBK A;  3MO4 A;  1CX1 A;  2WN3 A;  3K4A A;  4DUV A;  2YFU A;  3P6B A;  1UY4 A;  5DMY A;  2KD7 A;  2V5D A;  4CUC A;  2J22 A;  4D8M A;  2VZT A;  1OF4 A;  2Y6K A;  2W95 A;  1K42 A;  3CQO A;  4CVU A;  3IB3 A;  4W4Z A;  2WAA A;  3VDC A;  1UX7 A;  1NX9 A;  3LEG A;  5G05 L;  2QBX A;  4XVH A;  4P08 A;  1JYV A;  2Y6H A;  3I2J A;  3GXU A;  3D3A A;  3NQH A;  4DXR A;  1WKY A;  4TXW A;  2WZE A;  4OMD A;  4A44 A;  2W87 A;  3VD3 A;  1K12 A;  2VTF A;  2W92 A;  2W1Q A;  4XUO A;  3LPG A;  3I3B A;  3DYM A;  1XNA A;  2YB7 A;  2W1S A;  2VZS A;  2QQL A;  2WO1 A;  3I2K A;  3W5M A;  1W8N A;  3A7Q A;  4HG6 B;  4QX0 A;  4QPW A;  2W1U A;  3UES A;  2WAO A;  2J1E A;  3GGL A;  3IDA A;  3C7G A;  2VZO A;  4CUA A;  5FUI A;  3CZU A;  5JXJ A;  2W5F A;  4FI9 A;  3HNY M;  2VMC A;  2C4X A;  1WCQ A;  3K4D A;  5HXM A;  3T0A A;  1DLC A;  3I2F A;  2J1A A;  2V72 A;  2WYS A;  4DEQ A;  1I5P A;  3SKV A;  4QX2 A;  1K45 A;  3GDB A;  1J84 A;  3T0B A;  3J7H A;  1JZ6 A;  2QQO A;  4L0P A;  1XNT A;  3C7O A;  5EJZ B;  2VZR A;  3K4Z A;  2C9K A;  3WNK A;  1MPX A;  1US2 A;  3FHQ A;  4UAP A;  3SEP A;  2VL4 A;  3SKJ E;  3FHA A;  1PMH X;  2VC9 A;  2E33 A;  3DYO A;  3MUZ 1;  4P00 B;  1JZ5 A;  3NJX A;  3NRU A;  1JYW A;  4A45 A;  2EID A;  1W9S A;  4JHZ A;  1NAE A;  5G04 L;  1UYY A;  4QDR A;  2W1W A;  1LNS A;  4BK4 A;  1GMM A;  1OH4 A;  2CDP A;  3LEK A;  4PF1 A;  3UNP A;  5IYY A;  3U37 A;  2XQX A;  5DPN A;  2ORX A;  2RVA A;  2ZEY A;  4W8J A;  1JYN A;  3LPF A;  4CU6 A;  2WAB A;  2WO3 A;  3EYP A;  2CDO A;  3WF3 A;  4MGS A;  3EB7 A;  3IAP A;  2EIE A;  3HNM A;  1O8P A;  3ECQ A;  3FL7 A;  2J1S A;  2ORZ A;  1R64 A;  4OYU A;  4CU7 A;  3ACG A;  1UY0 A;  1GNY A;  4PQQ A;  5CYY A;  2VZV A;  2W91 A;  4AG4 A;  2BER A;  2VMD A;  4DUW A;  5I0D A;  2WO2 A;  3A22 A;  4UOJ A;  3I2I A;  3ACF A;  5JMO A;  3I3D A;  2J1U A;  1UZ0 A;  4E8D A;  1T2X A;  4QX1 A;  1GOF A;  4XUN A;  3VD7 A;  4AAX A;  3CDZ B;  1UMI A;  2VCC A;  5LA0 A;  4CU9 A;  3OGR A;  1PMJ X;  2WN2 A;  1JZ2 A;  2Y6J A;  5IJR A;  2PQS A;  2J1T A;  1UXX X;  4BJ0 A;  1PX4 A;  5IFT A;  3A21 A;  3HOB A;  4XUP A;  3K46 A;  5CZK A;  5JUV A;  1H6X A;  1H6Y A;  4JKM A;  2YC4 A;  5HPO A;  1UWW A;  3THD A;  4DXS A;  3VDB A;  5LA2 A;  3ACH A;  3VD4 A;  2YC2 A;  1GQP A;  4KWU A;  3HPN A;  1TG7 A;  3LEI A;  4LPL A;  2YG0 A;  4KMQ A;  5C7G A;  3BN6 A;  3GM8 A;  2YFZ A;  1JHJ A;  3I3E A;  4ZY9 A;  3WNP A;  5B4X A;  2RJ2 A;  3P1I A;  1ULP A;  3PUH A;  1JZ4 A;  4M4P A;  1JZ7 A;  3MUY 1;  5C71 A;  1JZ3 A;  2BBA A;  2XHN A;  3T08 A;  1XPW A;  2W9X A;  4A4A A;  1GUI A;  4QAW A;  3HN3 A;  3C7F A;  2VJX A;  4JKL A;  4DEV A;  3CKH A;  4YPJ A;  3OEA A;  1L7R A;  2XON A;  3I2H A;  4LQR A;  2VR4 A;  3AC0 A;  3OG2 A;  4RYD A;  4PT6 A;  1L7Q A;  2B4K A;  3SEE A;  4XUR A;  5LCW L;  1UXZ A;  2DCK A;  2VM9 A;  3WF0 A;  3DEC A;  2VZQ A;  4LKS A;  2QQM A;  2HLE A;  3MV0 1;  2JKX A;  2EIC A;  2C26 A;  1GOG A;  4JKK A;  4GWI A;  2QQJ A;  2VCA A;  5JR2 A;  1DYO A;  1W9T A;  1HN1 A;  1ULO A;  5DQ0 A;  2ZXQ A;  4ET7 A;  2B9V A;  2W46 A;  4QDQ A;  5LA1 A;  2DCJ A;  1OD3 A;  5IFP A;  2VOT A;  3C7E A;  1DP0 A;  3DYP A;  5B4N A;  2VZ3 A;  4ZXE A;  3I2G A;  4A42 A;  2Y6G A;  3WNM A;  1W99 A;  3OEB A;  3ABZ A;  4MO3 M;  3F2Z A;  3NJV A;  1W8O A;  1O8S A;  3VD5 A;  1OT5 A;  5EJ1 B;  3E1F 1;  1YQ2 A;  5JXH A;  1EUT A;  2ZEZ A;  2X10 A;  2X05 A;  4A6O A;  1CZT A;  3MV1 1;  3WNL A;  1D7P M;  4BDV B;  2OKX A;  3A23 A;  4OMC A;  2Z4F A;  3T09 A;  2E26 A;  2J1R A;  3LE0 A;  3WF4 A;  1UYX A;  1SDD B;  3MBW A;  3OB8 A;  1J83 A;  1NUK A;  1SG3 A;  1UY3 A;  2VZ1 A;  2J7M A;  5DN2 A;  3T0D A;  3WF1 A;  2LS6 A;  2JE8 A;  4QX3 A;  3WSO A;  4UI9 L;  5EIY B;  3ETP A;  1CZS A;  1JU4 A;  3HNB M;  2Y64 A;  3C7H A;  3VD9 A;  4TTG A;  4DUX A;  3T2Q A;  4W50 A;  4P5Y A;  1XC6 A;  2VCB A;  1O59 A;  4ZZ5 A;  3PUI A;  2E31 A;  4BK5 A;  4M4R A;  2DDU A;  3THC A;  1CZV A;  4MOA A;  5IHR A;  4GWJ A;  2RV9 A;  4QB6 A;  4OZO A;  2XOM A;  3ZM8 A;  4Z2A A;  3K77 A;  3T2P A;  4JX0 A;  4ARX A;  3LQC A;  3WF2 A;  1NKG A;  2R7E B;  1OF3 A;  4XUT A;  4ARY A;  1JZ8 A;  2VQU A;  2VZP A;  1TVG A;  4E8C A;  3III A;  2QQI A;  2WUH A;  1KEX A;  2VMF A;  2WQ8 A;  4GZ9 A;  1RYY A;  4D0Q A;  3CIH A;  3K75 B;  1UMH A;  2L9L A;  1JYX A;  5A1A A;  1PX3 A;  4XUQ A;  3ACI A;  1JU3 A;  1KGY A;  4OUE A;  5JXI A;  4A3Z A;  2HYX A;  1UYZ A;  3WNO A;  4KI5 M;  2VO5 A;  2J1V A;  2Y8K A;  2QQK A;  4A41 A;  1UY2 A;  3WEZ A;  1US3 A;  2QQN A;  2ZEX A;  2LW8 A;  2ZEW A;  1F4H A;  2V4V A;  3JXS A;  4MGQ A;  1W0N A;  4QDS A;  4DXT A;  3IAQ A;  3VDA A;  3C8X A;  1CIY A;  2EIB A;  2Y6L A;  1EUU A;  1F4A A;  3OGS A;  4BXS V;  3WNN A;  2VZU A;  2VME A;  4CU8 A;  5J1X A;  3CZJ A;  4MAD A;  2JDA A;  3NNG A;  3UET A;  1K3I A;  2WDB A;  2BGP A;  3T2O A;  1UY1 A;  1SHW B;  2W47 A;  4ZZ8 A;  1W9W A;  4RN5 A;  4CUB A;  3HEI A;  4QB1 A;  4XZU G;  3FN9 A;  1GU3 A;  2X09 A;  3BGA A;  4LHS A;  4QB2 A;  3OGV A;  2WZ8 A;  2JD9 A;  3I97 A;  2VQT A;  1P8J A;  1GOH A;  2BZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...