3I4IA

Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
VFTHFGEGFDYYDSQLWEKADGWGNGGVFNCIWRAYNIELKDGILNLSITDDMPSSSKPYAGAEYRTRDKFGYGLYQVRMKPAKNPGIVSSFFTYTGPVHGTPWDEIDIEFLGKDTTKVQFNYYTNSAGNHEYIYDLRFDASEDFHIYAFNWQPNYIAWLVDGEEVYRAYDDIPVHPGKIMLNIWPGIGVDEWLGAYDGKTNLTASYDWVAYDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 1,3-1,4-beta-glucanase
publication title Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome
rcsb
source organism Uncultured murine large bowel bacterium bac 14
total genus 47
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3i4iA00
1LGNA 5T50A 3GALA 4PBOA 4YM1A 1S0CA 4DRVA 4XXPA 1UPSA 1UZYA 2R0HA 1MACA 1LCLA 4FPYA 2I2SA 1WLWA 1Q8PA 3VKOA 2D7FA 1YI7A 2A6XA 2OVUA 3PVNA 4Y24A 3WDTA 4GA9A 3VKMA 1AXZA 3JUUA 4AVTA 2JE7A 2P2KA 3ZSJA 1Q8VA 1BJQA 1N3PA 3OPZA 2DVFA 5BYNA 4U36A 4PCRA 4K1YA 1PZ8A 4LBKA 4BOWA 1XQNA 4P9WA 2YZ4A 4XE9A 1AXKA 1V6OA 4K1ZA 1KDKA 3WHUA 5GLWA 2RHPA 2D43A 1GANA 3AXEA 1DQ1A 2ZMLA 3B69A 3KM5A 4KBBA 3WG1A 1C1FA 3ZXKA 1BKZA 2AH2A 1V6MA 1X50A 3WDWA 1JW6A 1AX2A 4ISRA 4YFWA 1DQ6A 4RL7A 1BQPA 2GMMA 4XDQA 2D44A 1FX5A 2E7QA 1LHOA 1W0OA 4BPZA 1LODA 1WUVA 1W6PA 1GZWA 2SBAA 2GN7A 1F9KA 5E88A 3ZVXA 4R9AA 4M3CF 1U0AA 2ZGPA 3CNAA 4YG6A 3H0OA 1HKDA 5EYXA 4WV8A 1JXNA 2W08A 1Q8SA 1MVEA 2ARBA 3SISA 1W6PB 1I1EA 1GZWB 4XJ8A 3ZXJA 2D3PA 2WNEA 1DQ2A 4Y22A 2GNTA 1CR7A 5DG2A 5FRAA 3VV1A 5DG1A 3WNXA 4UW4A 1SLIA 3BOPA 4M3CA 1UAIA 1W6OA 1N47A 2PHXA 3B00A 1SFYA 1GZ9A 2FMDA 3V0AA 3L2YA 1SLLA 1MVQA 2R1DA 3OYWA 5T5OA 4YW2A 3TB0A 1CN1A 5HCFA 4XBLA 1UX6A 4Y22B 4YG0A 3N7JA 1EPWA 5L73A 3T1MA 1LOAA 1S0FA 2EF6A 2DUOA 1FATA 1SLCA 3PVOA 4M3CB 4Y1YA 1G9FA 3HMYA 4FPLA 1W6OB 1UL9A 2BQPA 3D4KA 3SH5A 1R1ZA 3O5SA 3V0AB 2ZMKA 3AJYA 1YXWA 3OYWB 4CRQA 4XHXA 2DVDA 2YXSA 2D6PA 4Y1ZA 3W58A 1J1TA 1IS5A 4YW1A 4XJAA 1CJPA 4F83A 3FUOA 4FOQA 4M3CE 5DUVA 2OW4A 3D5OA 1O4ZA 5GZEA 4XTMA 1OFSA 3WDYA 3ZSLA 3KQRA 1PZ7A 2C9AA 2ZACA 3AP7A 3ZSMA 5JMCA 1CQ9A 2W52A 3AYCA 4HL0A 5CB7A 3NV2A 2HYKA 2ZKNA 2V5YA 4H55A 1ZA4A 1GLHA 2CTVA 4FQ4A 1JN2P 4LBQA 1CPMA 5FREA 3ATGA 1WW6A 2R49A 4M00A 1IKQA 2KM2A 1JBCA 4XBNA 4XZPA 3C2UA 1FV3A 5E8AA 2NM1A 2DWRA 5GLZA 3RG0A 1CPNA 2A6ZA 2PHUA 5DUUA 2DUPA 1ENRA 4LBQB 4YGDA 1GICA 2UURA 1WD4A 2EIGA 4TYSA 1G86A 3RS6A 4UW6A 1G9CA 3WG4A 2D6MA 3SH3A 2YV8A 3I4IA 3WZ1A 4YZ1A 1SLBA 2A5ZA 3ILFA 2D6KA 1AF9A 1LOGA 3R4SA 5IK5A 1ULFA 1WW5A 5GJ6A 5T52A 3M2MA 4HANA 3B3QE 1HQLA 2DVAA 3ASIA 3INAA 3ZXLA 1BZWA 2UWBA 2WSVA 2WJSA 3NV3A 4YLZA 1V00A 4U2AA 2PHWA 2Q5TA 3PVEA 3T1LA 1JHNA 3V65A 3ZXFA 1LHNA 2DU1A 3QCWA 3SITA 4YM2A 4LBQD 3WUDA 3WVJA 1V6IA 5T5PA 1MS8A 1W0PA 4BM8A 1SBFA 4GALA 4XIKA 5IK7A 1ULEA 5LK5A 2NYYA 1LGBA 4M01A 1S0IA 1QF3A 2P3JA 1MZ6A 5IK8A 1DYPA 3MEPA 4FPKA 1GBGA 2ARXA 1ULGA 4Q1RA 1JOJA 3RSJA 1URXA 3Q9OA 1Q8QA 1MS9A 1HQWA 2JECA 4FP2A 1AX0A 1KJLA 3A0NA 4YW5A 2P3IA 2LALA 1WLCA 3IM0A 3W59A 1V6JA 5CNAA 1LU2A 3WDUA 1S0GA 1CVNA 2VH9A 2TEPA 3OY8A 1GV9A 4P14A 2C5DA 1N1TA 1QGLA 5CBLA 1QNYA 2WT0A 1UMZA 1DQ4A 4UW5A 2JKBA 4JC1A 1CIWA 4FPHA 5T54A 5GLUA 1S0BA 1G8WA 3OY8B 4DRRA 2ZGLA 3AJZA 1ULCA 4XXAA 1DFQA 4WVWA 2H0BA 4XJ9A 5HCBA 1WBFA 3AK0A 3GNEA 2GALA 1SACA 3N7LA 4UW3A 1Q8OA 3WCSA 1S1AA 1GKBA 3WDVA 1QKQA 2GNMA 2EXHA 2DURA 4WVVA 4W65A 2VY0A 5GZGA 2D6NA 1MS4A 3FLRA 4PQ9A 2DYCA 1DIWA 3UJQA 2A6YA 1H30A 5EYYA 1DLLA 2DUQA 4Q26A 4JRAA 1UN1A 3AZYA 2VU9A 1BYHA 3ENRA 2EXKA 2JDZA 2ZHKA 3M3CA 4ATFA 4R9DA 3AYDA 5E89A 1LJ7A 1LULA 1YO8A 3IN9A 2ZA9A 3APBA 1ZM1A 4Y1XA 1LOFC 1DZQA 1WLDA 2ZBJA 5JOXA 3NV1A 3AFKA 3M1HA 4RA0A 1MS5A 1W6NA 2W39A 5GLTA 1S0EA 5JOZA 4LBNA 4YM0A 4ATEA 1LESA 2ZHNA 4GWNA 4D69A 1W6QA 2VW0A 4FPCA 4AGRA 2A3WA 4Q8KA 2WSUA 1GNZA 1VAMA 2ZABA 2UWAA 5T5LA 5CA6A 2WQZC 1CESA 3DUIA 3LCPA 5KXCA 3TAYA 2A6WA 4ZXKA 2CY6A 4FOVA 1W6QB 2A75A 2EAKA 1WD3A 3FFZA 1MR5A 2D3RA 4GKYA 4YW3A 3AYAA 3N35A 3O0XA 2VW1A 2W68A 1Z78A 2R16A 1H9PA 4R9BA 2GN3A 4ISQA 2R1BA 3POSA 2ZGSA 4YGEA 1GZCA 1FNYA 4Z8BA 2D3SA 2VUAA 5HCAA 2ZGUA 1H9WA 2WLQA 4Q8LA 5DZFA 2GDFA 3FLPA 2FHRA 4P9YA 3MW2A 1DBNA 4XOGA 2EXJA 4TZDA 4YW4A 2ZGNA 1N1SA 3USUA 1Y7BA 5JOWA 3WOGA 2YMZA 2ZGOA 1LGCA 3SLIA 1LOCA 2ZMNA 3FBYA 2GNDA 3ZPYA 2E53A 2YY1A 2XB6C 2P34A 3NWKA 1JYCA 1S0JA 3O0WA 2D6OX 1CONA 1DQ0A 3AP9A 1A78A 3USUB 4Q2FA 1A3KA 1FV2A 1FNZA 2DU0A 3R05A 2R0FA 4PF5A 1IS3A 2AYHA 1VAVA 3OBRA 3VUOA 2JD4A 3IKWA 3V64A 4FQZA 5DXDA 1QU0A 2ZGTA 5DZEA 1V6LA 3R4UA 4BMEA 4I30A 4Q1PA 4WZFA 4YFZA 4FOWA 1MS3A 1N3QA 4FPFA 3U4XA 2GMPA 2LTNA 2OUHA 1SLAA 1IS4A 4K20A 1D2SA 2B7YA 1AJKA 3ZXEA 1KDMA 2CWMA 1LHVA 5F9TA 1F5FA 2V73A 1RIRA 2JE9A 4FPOB 5JLVA 1LTEA 1NXD1 1WW4A 2ZAAA 4LBLA 1YIFA 4XBQA 4XIOA 4Y1VA 1SCSA 2Z42A 1GSLA 1MS1A 1QOSA 3ILRA 3MW4A 2PHRA 1S0DA 3AZWA 3RRDA 3RMYA 3AP5A 1SBEA 1G9AA 2EXIA 4JCKA 4FP3A 5H9QA 2ZGRA 3M3OA 4SLIA 3QLQA 4FPGA 5AVAA 4CZSA 4DQAA 3UJOA 5GALA 2GNBA 5CAZA 4P9XA 1MS0A 5EXOA 3N7MA 5IT6A 1QNWA 1RITA 3DGTA 3FLTA 4GWMA 5T55A 1OQ1A 1DYKA 1NLSA 2AGSA 1GYKA 1WCSA 1W6MA 4MYEA 3LSEA 3WV6A 4BMBA 3OJBA 1KRIA 3UL2A 4PBPA 3PJQA 5JOYA 3MPPG 5KXDA 2UWCA 4XMIA 3IPVA 2AR6A 4FPJA 3ILNA 1G9DA 2D6LX 1OKQA 2DV9A 1QOTA 3M3QA 5JVVA 1W6MB 3O0VA 3JU9A 2ZGKA 4XHBA 4XJUA 5GZFA 3POYA 2AREA 1AVBA 1IKPA 3IPVB 3WDXA 2A3XA 1VLNA 1N1YA 2DVBA 3A0KA 3FUQA 4XJWA 4YGCA 3AYEA 5DUXA 3N7KA 1VALA 1O4YA 1ULDA 1C4RA 3AP4A 3LSDA 1C57A 3AX4A 4XILA 3RMXA 1G9BA 3B9CA 1VIWB 5JDBA 1Q56A 3SH4A 3N3HA 2P3KA 1N3OA 4K21A 1ENSA 2A71A 3D6EA 3ZYPA 2NMOA 4XJZA 1HDKA 2ERFA 2CWSA 2DTWA 2XG3A 4XYXA 2NN8A 2WT2A 2NP0A 1IOAA 4YGBA 4IQPA 1FYUA 3IMNA 4AVVA 2OUJA 1ENQA 4DFSA 4XMAA 1DQ5A 1AZDA 1LHUA 3BIWE 1BXHA 3ZSKA 4AWDA 2DTYA 2G4IA 5SV8A 3V0BA 5H9RA 4LBJA 5GZCA 1SBDA 1UKGA 2PELA 3M3EA 4BQ1A 3T2TA 1N1VA 1W6NB 1KITA 4GKXA 4L8QA 4NO4A 1V6NA 3AXDA 3I8TA 2WKKA 1AXYA 4ASMB 2E6VA 1AJOA 2ZHMA 3WG3A 1Z0HA 3V0BB 4DS0A 5IUQA 2NMNA 2ZHLA 4LBMA 3WLUA 1G7YA 2CL2A 2A3YA 1RINA 2EALA 3POWA 4OZXA 5H9PA 1SCRA 1IS6A 1I3HA 4R9CA 3VKLA 1MZ5A 3B01A 1QDCA 4DPNA 4AGGA 3PMEA 1LU1A 4FVVA 5EWSA 2GMEA 1DHKB 1A8DA 4C1XA 1JYIA 2VW2A 2WT1A 1FAYA 1SLTA 3OBTA 5T5JA 2AUYA 5H9SA 5DZGA 3UK9A 2YROA 3RQ0A 1B09A 1V6KA 4BLIA 5KXBA 1PZ9A 1QMJA 4YM3A 5DUWA 3AZZA 1LOFA 4AGVA 3AZXA 1LECA 1UZZA 1LEDA 3HR9A 4YG3A 4YZ5A 2AENA 4Y1UA 1C1LA 3MW3A 1WBLA 5GM0A 3A4UA 2E51A 3WCRA 1AX1A 1KQRA 2A70A 4FOYA 2E7TA 1QOOA 3ZYRA 1KJRA 4Y26A 2ES3A 1JUIA 1LENA 3N36A 1LEMA 2CNAA 5GZDA 3WG2A 4YZ2A 4Q27A 4ZKTB 4FPEA 3HN1A 2CYFA 2ZGMA 3WUCA 5IK4A 1TEIA 1ONAA 1QDOA 1HLCA 4YZ3A 3OGGA 4LBOA 3NV4A 3SNMA 1LOBA 1YRZA 2A6VA 1D0HA 4Y20A 2DVGA 2JJ6A 3AP6A 1F31A 2P37A 4NOTA 1DGLA 2VXRA 1LOEA 2ZGQA 4XTPA 4ITCA 2ENRA 4AYUA 5F5QA 3O12A 4C1WA 3WHTA 3AZVA 5KXEA 4AVSA 1WW7A 1LHWA 2A7AA 4Y20B 2NZ9A 3BODA 2PHFA 3BTAA 2UU8A 4BLJA 4CTEA 1YYNA 5GLVA 1APNA 2SLIA 2PHTA 3VKNA 4GXLA 1GNHA 2ZZJA 3VKFC 4YZ4A
chains in the Genus database with same CATH superfamily
1NE4A 4PBOA 2AC1A 2QDNA 1CD3G 2MPFA 1S0CA 2PHLA 1WCKA 1UPSA 1UZYA 4IE6A 2YU1A 4FPYA 1LCLA 5DMYA 1RUI2 1WLWA 2D7FA 1YI7A 2A6XA 1AYM2 3PVNA 4HETA 1GWMA 3BOWA 2JDPA 2WQ8A 5I0TA 3JUUA 4AVTA 2P2KA 3GF6A 1AL23 3NVCA 4QU2A 3OUHA 5BYNA 1NZCA 4RR3B 1LNSA 5A3MA 2EICA 4OHYA 5FZ1A 2X5IA 1XPWA 4A2UA 1H2MA 1XQNA 1YEWA 4P9WA 4EQVA 1V6OA 2VM9A 2VL4A 5A3WA 3WHUA 2YU2A 3AXEA 2ZMLA 4JAAA 3ZDVA 1BKZA 3ZXKA 1V6MA 3W21A 1X50A 2JE8A 3R0RA 4AG4A 2RDQA 1U5YA 4COYA 3C7OA 1JZ2A 1XYNA 2K9ZA 2H6BA 4RL7A 1BQPA 2PAKA 2XBO1 4H3WA 3LEGA 4XDQA 4AXOA 2D44A 1FX5A 1AR61 2FMYA 3K4AA 3LAGA 3KS7A 4BPZA 1WUVA 2VVFA 5FKCA 5DDJ3 4NIHA 5A3OA 5FZ4A 3VHOA 2HWE3 3E1F1 1TME3 1SZBA 1YI9A 2WO7A 1X33A 3Q8CA 2F6BA 4E4DX 3O1PA 3LDBA 1U0AA 5EPAA 4YG6A 3H0OA 3NKGA 1CAWA 4IGPA 2HWF3 5C9AA 4RHV3 2ET7A 5ABJC 4QGLA 2ZKLA 4Y22A 1OBNA 4XFGA 5IW0A 4AI3A 5DG1A 3DPRB 1SLIA 3BOPA 3PIGA 1UAIA 4M3CA 5BNOA 1W6OA 3HWJA 5F5CA 1SFYA 1GZ9A 1Q5OA 2FMDA 2X10A 4QGNA 3L2YA 3OYWA 3ZR6A 5K0UC 1UY3A 2XKPA 5T5OA 4NHYA 2YC0A 2K2SA 4XBLA 4IXLA 3TBDA 3KF3A 1EPWA 1J3QA 1PM4A 3PVOA 4LMFA 4Y1YA 3RYKA 4LR4A 2HWC1 3ZFFA 5CFDC 4FPLA 2HBUA 4IL7A 3LPFA 1R1ZA 3RVHA 2ZMKA 1SQ4A 1YXWA 2NPIA 3ACGA 4QWNA 4CRQA 4ZY9A 1NLQA 2WFF2 3KZ4C 4DO0A 2DVDA 3FHIB 4FFIA 4RQPB 5E6HA 3HT2A 1ZBA1 3HIFA 3J7HA 3NSTA 4L9BA 3ZFEC 5BNPB 4QPWA 1CJPA 4YW6A 1D4M3 2KD7A 1X9PA 2R062 3IAQA 3W5MA 2JENA 2OW4A 2YHJA 3D5OA 1XBFA 3D3AA 5GZEA 3LOIA 1C3HA 1OFSA 5JR2A 2TUNA 3LGRA 3WDYA 5LEJA 3POGA 4MOAA 3I2KA 1UMHA 1V9U2 3LFIA 1DGWX 3NV2A 2ZX3A 5JZGA 1W2AX 3E6DA 4H55A 3ST7A 3GCWA 4DXRA 3OTFA 4LBQA 1QIQA 3VZKA 1QJU1 1WW6A 3UKVA 2KM2A 1VBA3 3ZYIB 4AI1A 5JXHA 3C2UA 3KV9A 5GLZA 3D8CA 4BB3A 1CPNA 4L2NA 5F7UA 4B8EA 3WT3A 3TN91 3WNLA 4YGDA 4IV3C 2VOWA 4A3XA 1G86A 1GWLA 2VBPA 3HOBA 4UW6A 3WP3A 1IGOA 2D6MA 4JTOA 4TLGA 3HPNA 4KWUA 3WZ1A 5LA1A 5E16A 5FXZA 5C8CA 2D6KA 1AF9A 5LZ6A 1S2BA 2QQJA 2Y64A 3SCHA 1ASJ3 1DYOA 4ASLA 4E4ZA 5AC92 1WW5A 3E97A 5T52A 4EE2A 1F4HA 3K46A 4AEDA 1AR91 5F3EA 2ARCA 3INAA 2UWBA 4C8DA 4LK7A 5FPBA 1V00A 4OUEA 1VBC3 4ZU7A 1JHNA 5C4WA 3VBSB 4IW3A 3B94A 1VBE3 3ZXFA 3SITA 4LBQD 1GP6A 1F4AA 3RZHA 1SPPA 3WVJA 4A42A 4B4PA 4I0WB 4GALA 4BM8A 2VUJA 4BH9A 2NYYA 4M01A 4CDUB 2VTXA 2DBIA 2HEWF 2VZVA 2P3JA 5IVVA 1VAKA 4HK8A 5DPNA 4EN7B 4D94A 2HEVF 4JGYC 2WUHA 3KCCA 4Q1RA 3OOXA 2N7GA 3Q9OA 1FMD2 2XLAA 4FTSA 2E31A 4BQYA 2FDKA 1KS4A 3MIHA 4WM8A 2OXBA 4LO7A 3A0NA 3A7QA 4MVTA 4R4XA 3T09A 2LALA 3T3YA 1PO22 4ARXA 1CVNA 2VH9A 1MEC1 2VZOA 4P14A 1H4GA 3DKQA 1N1TA 2EAAA 1VRBA 4XFFA 3F2ZA 3MUY1 1DQ4A 4GB32 5FPXA 4QX2A 4FPHA 3CL1A 1WA4A 4UF0A 1G8WA 3OY8B 5JXIA 2ZGLA 3AJZA 4META 2DCZA 4XXAA 5L7OC 4MUVA 4UBHA 3U11A 1VRH3 3ZMOA 4B4QA 2XJUA 3GNEA 3GHMA 4UW3A 3N7LA 2BERA 4B4RA 4QX8A 2JICA 2G1MA 2JIJA 3K4ZA 1E5HA 1OKOA 1UY4A 3D0SA 1CWPA 2YDEA 2EXHA 1K5JA 2DURA 3WW1A 5GZGA 2Y8KA 4PQ9A 3PHMA 3UJQA 1NA1B 3LWCA 1DLLA 3ACLA 2VE1A 1UOFA 2BP6A 4Q26A 4JRAA 1BYHA 2WN2A 2LROA 2EXKA 5F2WA 3VBFC 1FPN1 5LK7B 1RUH3 3M3CA 3OBAA 2MHFA 3AYDA 4HN0A 5CU1A 3WW2A 4ATFA 4HKLA 4CXWA 1WCUA 3C3VA 4NWVA 1RUC2 4CEYC 5FK8A 1NCRC 3MLLA 4LO6B 5F3GA 2QQOA 1CAWB 2JB4A 5HV0A 1WLDA 2DF7A 1JOPA 4N43C 2ZBJA 3I2DA 3AKQA 3NV1A 4WM7B 3AFKA 5LB6A 5FPLA 4JKMA 4RA0A 1MS5A 1W6NA 5JI7A 3RWNA 5GLTA 3A21A 3UT0A 3VD9A 4P08A 3MFCA 5KHGA 4YM0A 5CG8A 2V4AA 3ZXDA 4GWNA 4XUOA 2VW0A 1H1MA 4LEJA 1O4TA 2E9QA 2A3WA 4B3NA 5LCWL 3BN6A 2WQZC 1U5XA 4XCAA 1CESA 1AL21 4OZOA 5BV6A 4MXWA 5JAXA 4NJ4A 1QJEA 5A7NA 1W6QB 4Q5OA 4CCLA 4IEOA 1UY1A 1W8WA 2VC9A 2XJTA 2I45A 4CDXC 1RUNA 2IUWA 1C5HA 2OPKA 1EAH3 2VW1A 2W68A 2WZR2 5HPOA 1Z78A 3NAPC 5KBFA 4LNVA 4RSUA 4R9BA 3PL0A 4Q0UA 4ISQA 2R1BA 4W6WA 2ZGSA 5FZHA 1GZCA 2Q1ZB 5J96B 4FTEA 5DABA 2ZGUA 5A3UA 2X09A 3JD73 3OEAA 4Q8LA 3TOJA 5HBAA 4UFIA 3HAGA 5FYZA 2FHRA 3CEWA 4P9YA 4BCUA 1DBNA 4OQ8A 3GJAA 4AW7A 1ZBE2 5IYYA 4YW4A 3SCGA 4NAMA 5DDJ1 4ZS3A 3USUA 1YQ8A 2HWE1 1TME1 1PM7A 2RS53 1WLTA 1XE7A 3JBG3 1NCQB 3B93A 1XYOA 2ZMNA 2YY1A 2XB6C 2P34A 1JYCA 4RR3C 4ZZ5A 3TEYA 2HWF1 4O61A 4RHV1 2FDIA 3GBWA 5K0UA 5FZ7A 5J98B 3VBUB 3M70A 4LO5B 3H1YA 1A3KA 2IFWA 2LS6A 2DU0A 3R05A 4K7JA 1IG0A 5K4LA 4N9HA 4NAOA 3ZDSA 4BJ0A 2AYHA 2FDGA 3OBRA 1C28A 1B35B 5CFDA 1JZ4A 1V6LA 3MLKA 3GGLA 3R4UA 4OHVA 5IVFA 3ACFA 3OCPA 4A45A 2Y6JA 1C5IA 2Q0AA 4H14A 1EYBA 5LRRA 3ETPA 4GJYA 2GU9A 4CE8A 4IERA 2IXIA 3ZFEA 4AEDB 1US3A 2YPJA 3HNYM 3ZXEA 1KDMA 3AMNA 2P1BA 3VBRB 1F5FA 1ZNPA 2V73A 2JE9A 5C4WB 4FPOB 1GR3A 1HW5A 2W94A 1NXD1 2ZAAA 2XXZA 3JQXA 1YIFA 4OHWA 2BGCA 2MNGA 4GAZA 4XBQA 2Y6HA 3OPTA 3MW4A 5FCCA 1SPPB 1JMUB 1ENXA 3AZWA 1D4M1 5I0RA 2JX9A 3HBKA 1SBEA 4QX3A 3E6BA 2YBKA 4JCKA 2WZ8A 2ARAA 5A6QA 1OLME 3DPRC 3H9AA 3MV01 2RM21 3UJOA 4AFBA 5GALA 4EJRA 4P9XA 5G05L 4JZRA 4Y5TA 4YVSB 3N7MA 3ON7A 4AHWA 3OSDA 1RITA 2XVLA 3IDBB 5FZDA 1PIV2 2OS2A 4FBFA 1VBA1 2ZZQA 3WV6A 4LA2A 5FMCA 1BBT3 1YFWA 5EJ1B 5F3IA 2UWCA 3IPVA 3TWIA 2AR6A 4DB5A 4FPJA 1YQ5A 4RQPC 4ZONA 2D40A 2F4PA 5F3CA 2D6LX 1OKQA 2DFBA 5BNPC 1QOTA 1SMVA 3M3QA 3RI8A 5FOJB 2ZGKA 2Y38A 4XJUA 2WQ4A 1PMHX 2ADDA 1RUJ3 2EIBA 5J09A 5J3UA 1N1YA 4WBBA 3A0KA 3KT1A 4Q4W3 3THPA 3FE5A 1C8M1 3FUQA 4Q0VA 4XJWA 2CU5A 1CAUB 3N7KA 4GULA 4QB1A 1AYN2 3LSDA 4O9GA 1W06A 4AF9A 1VBE1 1JZ8A 1OD5A 1UXZA 3NJVA 5B2GB 4A7ZA 4JGYA 2J1EA 2MEV2 2TBVA 1O59A 3LOBA 3N9LA 2NN8A 4XFIA 1FOD3 2PN5A 2JDAA 3S7EA 4CCOA 4YGBA 3HBZA 3U0ZA 4A7KA 1PNGA 1WMXA 4LULA 5FJKA 5A3TA 2XQXA 4LE4A 3ZN6B 2DTYA 2G4IA 3V0BA 3DYOA 2R071 4AEMA 4BIOA 1UKGA 2PELA 4DEVA 5GZCA 3FFQA 5L36A 3T2TA 3RZMA 1W6NB 4L8QA 3E6CC 2WKKA 1WA6X 1L7RA 1AJOA 2B46X 2ILMA 4HBNA 3S30A 2IXCA 2P17A 5L7OA 1JI6A 5D1IA 4XQDA 3VLBB 5IUQA 1W90A 2NMNA 4FFGA 1YJLA 3T30A 3VBSC 5FOBB 2Q4SA 2WA4A 4XDPA 1UZVA 2YUEA 2W92A 3NNFA 1QDCA 4DPNA 1CZSA 1WKYA 3RDIA 3BALA 3K3OA 4EN0A 1O5LA 3SXWA 1VRH1 4CDUC 4QDRA 2G9FA 2QQNA 2Q30A 4ARYA 3RZZA 1H6YA 1SEFA 4QHZA 2UY8A 1X36A 2CV6A 1FI2A 1YJKA 2YB7A 5BXXA 4E2GA 1TNRA 5FUIA 2BBAA 1R093 4QU1A 3RQ0A 1B09A 1V6KA 4BLIA 1JYVA 1PZ9A 4CEYA 2ZX0A 4ZHNA 1NCRA 4YM3A 4MHRA 4PI0A 2Q8OA 2ZS6B 3AZXA 2PQSA 4K40A 4G4FA 4N43A 2XHKA 1COV3 1UZZA 4OVEA 3EMRA 2VQTA 5FPAA 5B4XA 5FUNA 1C1LA 4GMP3 1WBLA 1RUH1 1UZ0A 4Q4X2 5BNNB 3MDPA 4L0PA 2VBDA 2W47A 4QXBA 3A4UA 4AQ2A 4NROA 3WCRA 4NHXA 3RJ2X 2VOKA 1AX1A 2E7TA 5JMCA 3ZYRA 4NIAA 4YZ2A 1D4VB 1LENA 4FCAA 4I02A 4ZKTB 1JS9A 1UO9A 1QJY3 2E63A 3PUQA 2ZGMA 4MZUA 5AVPA 3OUIA 4QDSA 4BQ4A 1TEIA 1OF3A 1ONAA 1RVF3 2XBO3 3WW4A 5I8TA 5FYVA 5C3OA 1YRZA 3AVSA 3KGZA 4IEVA 2DVGA 2JJ6A 3NJXA 4ZPIA 3ZIWA 2ZGQA 4CU7A 1DZRA 4DZGA 1LR5A 1J59A 1NA1C 4LK6A 4AYUA 1W9WA 2R7EB 5F5QA 1K12A 1UMIA 2RDRA 3O12A 2CDPA 4CDXA 5CG9A 3WHTA 3AZVA 4KGGA 3NAPA 4FAHA 1WW7A 5DAXA 3QACA 5FP7A 2DCYA 3TNPB 5EHDA 1RUE2 2QUOA 1VB2A 2D93A 4XVHA 4BLJA 1YQCA 1APNA 4S2FA 2SLIA 2ORZA 4PIZA 4NE9A 2PHTA 3VKNA 2GH2A 4QQLA 1LAJA 1EAH1 2JDHA 4Y5Z0 4WM7C 1OQEA 2XWBB 3VKFC 3BI3A 4YZ4A 5T50A 3GALA 1NE6A 4EN8B 3JD71 5AFBA 4YM1A 3BTYA 2ID4A 1PVC3 4XXPA 5FTTC 5FY9A 4RR3A 1MACA 4LOTA 1HRV2 2I2SA 1I5PA 2OX0A 5B4NA 5HCHA 2X05A 5FFOC 3MPBA 3ZYJB 1VBB2 2RS51 4EWAA 1FT9A 3VKMA 1PNFA 5C3SA 1AXZA 4XFAA 2JE7A 3FJSA 3WQ0A 1ND2B 3LE0A 3ZSJA 3ZYGA 1N3PA 2DVFA 3WNKA 4PDWB 4U36A 5C8WA 5FZOB 3J4UH 3C7EA 4XE9A 5FAXA 3VD3A 1M06G 1EV13 1W9TA 4HG6B 2D43A 4KBBA 1DQ1A 3KHCA 4IE5A 1ZRDA 1OVSA 4XF1A 4D6SA 2NLRA 3KVBA 5LBCA 1AR82 2VZRA 2GC0A 1AX2A 1IQDC 3QBQA 4ISRA 4YFWA 2OYZA 2G19A 3I3DA 2GMMA 4GH4B 2C9KA 1GQPA 1GZTA 2E7QA 1LHOA 4Z2WA 4OMCA 4AR2A 2J22A 3BB6A 4AK3A 4CDQB 4AL9A 5F1RA 5JPNB 2HKXA 3PUHA 5ANQA 3LPGA 3CJXA 1VMJA 3POBA 1NCQC 3DPRA 4I0BA 5FMOL 2ZGPA 4JGZA 4LIUA 4WV8A 2ARBA 1I1EA 3DXTA 3CLPA 2ZX1A 1GZWB 4XJ8A 2VQUA 1HQNA 2XR4A 3VBUC 5FRAA 3VV1A 5DG2A 4WVMB 1CX1A 2VNVA 4QQHA 4UW4A 3T4VA 3VZLA 1IPKA 1B35C 3THCA 1W8NA 3B00A 2VZQA 4QKDA 1S55A 1MVQA 1OMIA 4YW2A 1CN1A 3KLSA 5HCFA 4AI8A 4C0BA 4YG0A 1XSRA 5A7PA 3H1WA 2B9VA 3KWVA 2QKDA 5FO7B 5BNPA 2DUOA 1FATA 5A7OA 4AEDC 5BUVA 3SEPA 5FP4A 2YFZA 2VECA 2VMHA 3VBRC 1UW8A 1BBT1 4RFT0 5C4WC 1LKNA 2YXSA 3DV8A 1D0GA 5FZAA 2QZ2A 1PMIA 1J1TA 1IS5A 1XNCA 2YC4A 4YW1A 4XF0A 1HXS3 4DEQA 3FUOA 3URFA 3JB8A 1W03A 4KU8A 5DUVA 4X8PA 1H1IA 5FZ9A 5FZKA 4XTMA 5LATA 1T2XA 3FHAA 3KQRA 2Y60A 1RUJ1 2ZACA 3OBZA 2B45X 2W52A 3LQCA 3J8F3 4FT8A 1G6NA 1Y3TA 4HPKB 4Y33A 2RS33 2Z69A 5F6KA 5FY4A 1MEC3 1RUG2 4BQ2A 5C7GA 1OUXA 2V5YA 3P1IA 3POEA 3T2PA 3M3IA 1ZZBA 4FQ4A 1HB3A 5FZEA 4LLOA 1ZREA 3JB4C 3HT1A 1NKGA 5A33A 1JBCA 4W6YA 4MGIE 3SC7X 2WN3A 2ZJCA 4KWKA 1S2KA 3ECQA 2WBKA 4XZPA 2NM1A 2XJRA 4FXGB 1NYWA 2XJPA 3EJKA 2WO3A 2PHUA 5DUUA 2DUPA 2QBXA 4YW7A 3RG0A 5C3PA 1J3RA 1ENRA 5HXVA 3ZYHA 2UURA 4I01A 1XXNA 1G9CA 2ZEWA 1A34A 2E33A 4AVAA 3SH3A 2YV8A 3I4IA 4ES8A 2YBPA 1SLBA 2IWGB 3ILFA 3VBSA 3S7IA 3R4SA 1ASJ2 3VHRA 4Q4V2 2RS12 4HANA 4QX1A 3ASIA 4A6OA 1BZWA 1UKRA 1DF0A 3KCYA 3VHPA 3NV3A 4U2AA 1T6GC 4YSFA 1HV0A 4BYYA 2W5FA 4LHKA 5F39A 3ZM8A 2DU1A 4YM2A 5KHHA 1HN0A 4I3GA 3DEMA 4INDA 1V6IA 1SG3A 5T5PA 1SBFA 3D82A 5IK7A 4HSJA 1ULEA 2VVEA 4D3WA 5I0SA 3CQOA 1HRI2 2WA3A 3RZLA 2XVKA 2B4KA 1MZ6A 2VZ1A 1QEXA 5IK8A 1DYPA 2RV9A 2IC1A 3MEPA 4OI2A 4Q0PA 4FPKA 1RUF3 2ARXA 2YGLA 4NVPA 1NUKA 2VMDA 3K51A 1URXA 3IDEA 1MS9A 2BFUL 1TVGA 1R091 5F6LB 1GP5A 5G04L 3WY6A 1JODA 2HWD3 5LWBA 1MZFA 5CNAA 2ET1A 1LU2A 1GFF2 1S0GA 3OY8A 3S5QA 3POFA 3C7HA 4M4PA 1COV1 1QJFA 3C7GA 1QGLA 5ACA2 1QNYA 1YQ2A 3DN7A 1OFNA 1UMZA 4GMP1 5FYSA 4DMIA 1UPIA 1F15A 2RR13 5FP9A 2XLFA 1CIWA 1XOYA 2C1FA 1X8EA 5T54A 3POIA 3WX5A 2A1XA 1VE0A 4L11A 5GLUA 1O5UA 3MBWA 4WVWA 4Q4Y3 3LA2A 2XJQA 4NPLA 4XJ9A 1SFPA 3VDDB 1QJY1 3VD7A 1SACA 3KQ4B 4ASKA 1BK0A 1NA1A 1RMU3 4QB2A 1RVF1 2B42B 3WCSA 1U12A 1XSQA 3AMMA 3WDVA 1QKQA 5K8SA 1BEV3 1ODMA 3WNMA 1JTZX 4W65A 3ZOIA 2GSYA 4DXTA 2WNVB 3KV6A 1W9SA 2BNMA 3USSA 4MO3M 1DDLA 5KHJA 2VBBA 4N90A 3UGGA 4WM7A 2PYTA 1W0NA 4QPYA 1RUD3 1OOPB 1PO13 2P4EA 4KU7A 3Q8FA 4ONUA 1PX4A 1UQXA 5E89A 1E5RA 5BNNC 4MG2A 4JHZA 5FMDA 1LULA 3APBA 4JGZB 4XACA 4LKEA 3GHNA 4JDOA 1TQ5A 3LEIA 1BMV2 1O91A 1H8TB 1ZRCA 4P9JA 4QDQA 2FDJA 3H42B 3ZXGA 5JOZA 1PVC1 2VMGA 4JDNA 4ATEA 1W6QA 2WFPA 4FPCA 4AEJA 3RZKA 3S6PA 4Q8KA 4CU6A 2IZWA 2RMU2 4I0AA 4P02B 2W3JA 1Z7S3 2XUMA 4NRQA 3E5XA 3TAYA 2A6WA 2JD9A 3IMMA 2P6CA 2WABA 4ZXKA 5C70A 2CY6A 3AB0A 3VN4A 1QHDA 3ZLIA 4XURA 3WNOA 1WD3A 1ST8A 3IZOA 1OH4A 1STMA 3EBRA 2WS92 1PMJX 3NNMA 2Y0OA 3ACHA 3AYAA 3RPQA 4PI2A 1IG3A 1EV11 2RM23 1CGPA 2VCCA 1REFA 4A3ZA 5JXGA 5D8AB 4YGEA 3POSA 2CDOA 3UGHA 2Z4FA 3I3QA 4OQ9A 1NCQA 3PIJA 4COWA 2GDFA 2HLEA 5IVYA 3FWEA 1RHI2 4XOGA 4S2DA 3IDAA 3IB3A 3KT4A 1QQP1 4TZDA 2L9LA 2VZTA 5APAA 5FBJA 1UYPA 4KMQA 2VOVA 1POQA 2D5FA 2ZGNA 3M7AA 1ND3B 1H6XA 5EJ3A 4MGKE 3VBUA 3WOGA 3OGSA 5JIUA 5J48A 2JDYA 4LPLA 1LOCA 4CP9B 1DU3D 1B35A 1ND2C 4K8FA 5A33B 2E53A 3ZKYA 4RN5A 3CZUA 4PDWC 5A80A 3O0WA 3AP9A 5FY8A 4BK4A 3AM2A 4DOUA 1FNZA 1ZVFA 4BQ3A 4PF5A 4LOSA 1C8M3 3VUOA 1YQ6A 1US2A 3UKNA 5DXDA 3P5BA 3VBRA 5DZEA 4D6QA 4YFZA 4QKFA 3ELNA 4I30A 4WZFA 3KV5A 1OLMA 1VBD2 2GMPA 5M0TA 1SLAA 1CAXB 1IS4A 3MUZ1 3MIFA 4NUBA 3WP4A 1ZA7A 4K20A 1W28A 5HI0A 4GH4C 4RD7A 3MICA 3BGAA 3FBMA 1LHVA 5F9TA 4HONA 1RL3A 5I91A 1AL0G 3CMGA 4LKDA 4CDQC 1RIRA 5JLVA 3H8OA 1R083 4NHLA 4E8DA 3HQXA 4XUQA 4AFAA 5HXMA 1GSLA 1QOSA 2JKXA 1PGW1 1JYXA 2PHRA 1HXS1 3ABZA 3MIGA 4EN9B 1W9YA 2R073 2A73B 3RMYA 2YPDA 3FZ3A 4YVSA 1SHWB 2D5HA 1G9AA 3EO6A 2WLPA 4HXCA 5H9QA 5FBZA 3QLQA 4CZSA 3KD4A 4P5HA 3J8F1 2VCAA 2DCKA 3CIHA 3UESA 5FZ8A 2RS31 1A6CA 4IGQA 2ORXA 3G7DA 4AHYA 3AKTA 4IUGA 4ZU5A 3ZSEA 1JU4A 3G6JB 3OG2A 5IT6A 1RYYA 3U37A 1QNWA 5ERLA 3DGTA 2VUDA 3ZN4A 2J7MA 5JSPA 1NLSA 2AGSA 2QJVA 1GYKA 1TMF2 1WCSA 2VVDA 4MYEA 3LSEA 2ZX4A 4ZZ8A 1KRIA 1RUI3 3MIEA 3HQUA 3PJQA 3MPPG 5KXDA 4XMIA 1AYM3 4S2HA 3KGLA 1OLRA 2JDKA 4CCDA 4ES9A 2Y6FA 2R042 3PUAA 5T3NA 3WF0A 2VTFA 1CAUA 2BWCA 1TE1B 2Y34A 1RGSA 3POYA 3DYMA 1VLNA 3R4DB 2RDSA 5JSRA 4Q4W2 4YGCA 2RJKA 4YRDA 1E57A 3MO4A 5DUXA 1C4RA 3B5LB 1I9RA 1C57A 3AX4A 3RMXA 3U10A 1G9BA 3B9CA 4XUNA 1Q43A 2BW8A 3KCXA 5A1LA 3ZN6A 3SH4A 5A6YA 4I09A 4J1WA 4E4SA 2XLGA 3WQBA 2NMOA 4XJZA 2E26A 2XG3A 4XYXA 2Y0IA 4DUXA 2NP0A 1KD7A 1FOD2 3PJYA 2CAVA 4IQPA 1FYUA 3OB8A 2OUJA 3KMHA 4YPJA 4DFSA 4CXYA 3AKPA 4XMAA 3F95A 1AZDA 4RYDA 3BIWE 4KNCA 1BXHA 3ZSKA 1EUUA 1RUF1 1ZRIA 3AVRA 4XABA 5H9RA 4LBJA 5FLJA 4R4ZA 1SBDA 3O1TA 2PLV2 4BQ1A 3N9MA 4O9EA 1AR72 3I8TA 1PGL1 2HWD1 1H0BA 1XJAA 1BLZA 4IE4A 4E4HA 2RDNA 1Z0HA 2X29A 3ZXAC 2BBVA 1OF4A 4N53B 3PMSA 2ZHLA 4OZXA 3LDRA 1VMHA 2CSGA 1QJX2 1SCRA 2B9UA 4JTNA 3VKLA 4AI0A 2RR11 4CCKA 4YARA 1WZXA 2BEOA 4AOCA 2XWJB 2BTVC 2ZCWA 5DAVA 1LU1A 3T2OA 4AGGA 2VQAA 4F7ZA 4CSWA 1SDDB 2HWB2 4Q4Y1 5JIAA 1DHKB 2WFF3 4UFKA 1A8DA 1LRHA 3J7NA 2LM3A 1RMU1 4AI2A 4URAA 5CZKA 4XZUG 1FAYA 3R6SA 3HQRA 4HLTA 1BEV1 2R063 2ZEYA 5DZGA 2CGNA 5L9BA 5BNNA 2YROA 4UT5A 3VZJA 4E8CA 4GWJA 3CJIB 5KXBA 1KEXA 1QMJA 1Y9GA 4CUGA 1V9U3 5C33A 3RYRA 1MZEA 1NQJA 2KXLA 4YNIA 4MX3A 1LECA 4CU8A 4YZ5A 3L2HA 1RUD1 5IVBA 3RFRA 1PO11 4NN0A 5GM0A 3WF2A 4PIXA 4MGZE 5FZ3A 4J25A 1W3VA 2BGOA 1KQRA 1Y43B 5JUVA 4MGTA 1KJRA 3ROUA 2DCJA 1LEMA 2CNAA 5GZDA 3WR0A 3HN1A 3VDDC 2WZEA 3WUCA 1QJZA 2XJVA 4BU2A 1NY71 5KWRA 2XBO2 1QDOA 3OF1A 2WRAA 5FUPA 2FDHA 3NV4A 1AR62 1LOBA 5C71A 1OUSA 3RGBA 1D0HA 4K6BA 3AP6A 1F31A 4NOTA 2VQ0A 2VXRA 2WNVC 1UYXA 2DBNA 2VCBA 4O65A 4KWLA 4M4RA 4XTPA 4COZA 5JMOA 1Z7S1 1D7PM 1I5ZA 4PJYA 5LASA 5KXEA 2W91A 1LHWA 1R1A1 4Y20B 2OKXA 3CKHA 5FK7A 2NZ9A 1ALYA 1OOPC 4FTBA 2UU8A 3QD6A 4NMIA 1YYNA 3I2IA 3IIIA 2RE9A 5GLVA 1JZ3A 4RGAA 3JCIA 5A70A 1W8OA 3GZTB 4JGZC 3ZPOA 1A8MA 2ZZJA 2J1SA 2QCSB 4YWAA 5FZBA 2D98A 3O1SA 3OGRA 5FXWA 1H8TC 1LGNA 2ETEA 4QAWA 4OHZA 1UYYA 4TLFA 5JPMB 1ND2A 2C0ZA 2HWC2 4XCBA 4B1MA 2PAMA 3VL8A 4PDWA 5FZOA 3WINE 3VKOA 1CJDA 2OVUA 1FMD3 1UY2A 4UYBA 3MI8A 4NRPA 3WDTA 4QPIB 1UOBA 1ZBA2 5CISA 4CU9A 1Q8VA 3QH6A 3D0JA 4GZ9A 1PO23 2O0OA 3LEMA 4PCRA 1IPSA 4XUTA 4LBKA 4BOWA 1AXKA 4X8NA 4K1ZA 1REEA 3AL6A 4GB33 5GLWA 4GH4A 2RHPA 1GANA 3KM5A 3NL1A 3WG1A 5IVEA 1C1FA 1GUIA 5D8AC 4CDQA 3WDWA 1JW6A 4GWIA 1T6BX 2F17A 1SDWA 2JIGA 2Q1FA 1DQ6A 1QJU2 5FKBA 4ZXEA 5LEKA 1XNKA 4JX0A 4JHTA 3ALQA 3HEIA 3ZR5A 1JOBA 1GZWA 2SBAA 5E88A 1F9KA 1ND3C 2IVJA 4OUMA 1R081 4R9AA 4WVMA 2JG9B 5DAPA 3TN92 4Z2AA 5FYBA 4M3CF 3WF3A 3O7OA 4M0NA 1YC61 5EYXA 4PQQA 1HKDA 4Q4V1 2BU9A 4HVOA 2W08A 2LUWA 5GKAC 1W6PB 1X8MA 5I8SA 4COVA 3ZXJA 2D3PA 4QD2A 2WNEA 4OI4A 2GNTA 3NKTA 4UFLA 4XFCA 4FFHA 2P3YA 3SEEA 2XL7A 5FY7A 1GP4A 1RUC3 4YVWB 3CHXA 1AR92 2VG9A 2O8OA 1GNYA 1VJ2A 3CO2A 3H7YA 5LA0A 2IVIB 3AKRA 4KL1A 3TB0A 4QHBA 3NJZA 1WCDJ 3I3EA 1BHGA 3WSOA 3H8UA 4AAXA 5FWEA 3T1MA 1LOAA 1S0FA 2EF6A 3LIHA 4IV1B 4C1XA 3WNNA 1JYIA 1L7QA 3HMYA 5L9RA 2BQPA 1UL9A 1OQDA 3D4KA 3RYPA 3V0AB 3ES4A 3AJYA 1RUI1 1QY4A 3JZVA 4NIGA 2OZ6A 1AYM1 2D6PA 3VB9A 3LEKA 4HPKA 1QXPA 2FQPA 4DINB 4XJAA 3OUJA 1POV0 4F83A 4XFHA 2JEMA 5FMOS 4FOQA 1O4ZA 4GD4A 4AAPA 3OD4A 3ZSMA 2DFCA 5A7SA 2VNOA 4QX0A 2QQVA 3HNBM 4PIYA 2QNKA 4HL0A 3C7FA 1OC1A 2WDBA 5CB7A 1MEC2 2HYKA 2WZR3 2VAUA 1O3TA 1ZA4A 1LB2A 2CTVA 1JN2P 4J1XA 4Z07A 2I07B 5FREA 2Y6GA 3ATGA 5F37A 4M00A 2R49A 1IKQA 1OVPA 2O8QA 1H8VA 4V1PA 1ZZ9A 4XBNA 5EFUA 2BZDA 5F2SA 4A44A 1ZBE3 5E8AA 1FV3A 4BK5A 4KBZA 2DWRA 3W20A 4RS5B 2A6ZA 1XU2A 3MLJA 1K45A 1UOGA 4X6RB 2JG8B 2FCUA 2GAUA 3NNGA 2EIGA 4OMDA 3FC0A 4TYSA 3RS6A 1DCSA 4IEXA 3WG4A 3ZN5A 4HVQA 4NIDA 2X8KA 4CCNA 2ZXQA 4DNYA 5FP8A 1LOGA 3PVBB 4IEZA 5C6CA 3K77A 4PLMA 1RB8G 5GJ6A 1HB4A 2WL1A 2RJLA 1W99A 2DVAA 5A7WA 2C26A 3ZXLA 2WSVA 2W87A 2WJSA 3TEWA 2IXHA 2PHWA 1FPN2 2Q5TA 3PVEA 4FXKB 1H1AA 4BQXA 3H3ZA 2BOIA 2J1TA 4BXFA 4BDVB 1LHNA 3GBGA 3QCWA 1GU3A 5JR7B 5J37A 1MS8A 1TNFA 1W0PA 4JQTA 5IATA 3WP6A 2WFF1 2WO1A 3OGJA 2WINB 3PU8A 1GBGA 3SKVA 2VPVA 5LY1A 2R061 4DY5A 3RSJA 1JZ5A 5FYYA 2BJSA 1UY0A 4LHNA 4WVZA 4W50A 4FP2A 1AX0A 1KJLA 4YW5A 5LA9A 2P3IA 1AL22 4NR1A 3IM0A 1V9U1 2VCMA 1W05A 4AZZA 2TEPA 4B1LA 4N53C 2Z79A 4PLOA 4K9SA 5CBLA 3VDDA 4QPGB 1J83A 3Q8BA 2JKBA 3RZGA 4K8RB 1PIV3 1ACCA 1UU6A 1YIPA 4KGQA 4Q29A 3WQ1A 1Y4WA 2VULA 1ULCA 3PNAA 1DFQA 1XNTA 2H0BA 2WNVA 5HCBA 4A7YA 4JV4A 3L9JT 2J1AA 4UFMA 4MXVA 1Q8OA 4IV3B 1S1AA 2ZEZA 4CP1A 3IT8A 1QQP3 3I59A 5DDJ2 1PK6B 1GOFA 5L9VA 3VD4A 1OOPA 2HWE2 1JHJA 1TME2 1WGPA 2VY0A 5D2AA 1DIWA 2B39A 2WO2A 3CU7A 5SV5A 2A6YA 5AC91 1H30A 3CJIC 5EYYA 5FV3A 2DUQA 4LUKA 5FZIA 4BQ5A 4Y3OA 1UN1A 1X82A 2BFUS 2HWF2 3U07A 3NQHA 2VU9A 4LORA 4RHV2 3ENRA 1AYN3 3VDAA 5CEHA 2JDUA 1H8TA 2ZHKA 3NNLA 4B7KA 5K9YA 1YO8A 1Y9QA 3IN9A 4L99A 4XETA 5FY0A 2W2IA 3FN9A 4COUA 1UCXA 1ZM1A 4EROA 2W95A 4Y1XA 3VBHB 4IE0A 2PHDA 3M1HA 4TN7A 3TRSB 3M8LA 3U14A 3U4SA 3KSCA 3J9SA 4JKKA 1ULOA 3ZYBA 4DUWA 4XC9A 3AMQA 3RNSA 4D69A 2PAEA 3DXUA 2QDRA 1FMD1 2WSUA 1VAMA 5CKMA 5CA6A 4I2OA 3LCPA 4QB6A 2JDNA 3N9QA 1PO21 1D4M2 5D8AA 1ZZ7A 4FOVA 3WF1A 2TNFA 1W8TA 3KV4A 2XQRA 4ZU4A 3FFZA 1MR5A 1PGSA 3PU3A 1OH3A 4O7XA 2RM22 4GB31 3O0XA 1W8ZA 2PXJA 4OULA 2VGDA 5F5IA 4HFSA 2CGPA 4NPMA 1K3IA 2QZ3A 2GN3A 3IWZA 2D97A 1ND3A 4YVSC 1FNYA 1K42A 2D3SA 2VUAA 1H2KA 2C4XA 4YYOA 4E2QA 1CAVB 4MGYE 5BNQA 4FSJA 4CP9A 3FLPA 4SBVA 1J58A 3MW2A 2XVGA 1R64A 1VBA2 3TNQA 2G9GA 1NX9A 1N1SA 1DGRN 3BPZA 5JOWA 1S2EA 1X9TA 4AFDA 3I3MA 4QPIC 2E7AA 5FPZA 3FBYA 2GNDA 4IESA 4QM9A 2WAAA 1UF2C 2VJXA 5FZ0A 5CFCB 2BWAA 2WAOA 2Q8EA 1CONA 5DAQA 2YC2A 4IEWA 1A78A 3M4FA 1E5IA 3VBFB 4Z1VA 4Q4X3 4CDWB 1CAXA 2R0FA 3FL7A 1IS3A 4XF3A 1RUC1 5FIXA 2JD4A 3IKWA 3V64A 2CGOA 4HOOA 1QU0A 2ZGTA 4KWJA 3I97A 1VBC2 3U78A 4Q1PA 4BMEA 1W2UA 4FOWA 1MS3A 1N3QA 5FY1A 2XPJA 3U4XA 3B9IA 1VBE2 2LTNA 4V2WA 1YFUA 4QX5A 5FYCA 1IPJA 3LZZA 1WWYA 5FMBA 3VBOB 5A7WB 4URTA 4HMZA 5BPXA 5JXJA 3O1OA 2CWMA 1ULPA 4BIFA 1DLCA 1LTEA 4A41A 1VMFA 3N9NA 4LBLA 2JG9C 4Y1VA 1W8UA 1SCSA 2Z42A 4ZS2A 4K3UA 5CKNA 3VD5A 1RTVA 2W0XA 2R072 3AP5A 1PHMA 1TZOA 1W9FA 1RUE3 3A22A 4CUAA 4GQ7A 2ZGRA 3M3OA 5AVAA 4YVWC 3S5AA 3Q8AA 4DQAA 2QFEA 2WZR1 2YFUA 1MS0A 5ANNA 2Y33A 3DYPA 3K3NA 2GZWA 3TYJA 4QKBA 1OQ1A 3IAPA 1HN1A 5J1XA 4IV1C 4UAPA 3BPSA 1P8JA 1JH5A 1HRV3 1ZBE1 1VRH2 4PBPA 2O1QA 2WWSA 1KFUL 1VBB3 1XB9A 4XAAA 5FP3A 2RG4A 2VNGA 3ILNA 2ZOEB 1G9DA 4AI9A 1NZIA 2DV9A 4Q0SA 5JVVA 1W6MB 3O0VA 1HB1A 3O1UA 1OPOA 1W2OA 3VZOA 1AVBA 1W2NA 1IKPA 2Z2SB 2A3XA 4UBGA 2DVBA 3RWKX 3ZYFA 2QE3A 1JZ6A 1JUHA 5F8PA 3AYEA 1GQGA 4Y4RA 3I59B 5TSWA 1NOVA 5C3QA 1VALA 1O4YA 4HT1T 1ULDA 3AP4A 1RXGA 3MHZA 4XILA 1AR83 3U1XA 1RUH2 1YLLA 2Y26A 1JYWA 1HJGA 2DDUA 3MFAA 3MYXA 3N3HA 5CIRA 4CP2A 2P3KA 4K21A 1ENSA 3D6EA 1MQTB 3ZYPA 3H3LA 3WP5A 3LF7A 4Z92B 2ERFA 2CWSA 2ZAHA 3DF0A 4V2VA 4UFHA 1H2LA 3A23A 1IOAA 4RS5C 3MIBA 3IMNA 4AVVA 1H2NA 2KR2A 2WNUB 1DQ5A 2JG8C 5IWFA 5SV8A 5FLIA 4N53A 3ZFGB 2OA2A 2R6QA 5C5TA 3KVAA 3M3EA 3MGUA 2FCTA 1N1VA 1KITA 3I2JA 4GKXA 1U5IA 4NO4A 3V56A 3P6BA 1WMFA 5FXVA 1NXMA 1AXYA 4ASMB 3GZEA 2VZSA 2IXKA 3J26N 3WG3A 2PA7A 1UD1A 4QQ2A 1R1A3 4DUVA 4XPVA 1UIKA 3VDCA 4CEWB 1ZZ6A 4LBMA 3WLUA 1G7YA 2CL2A 3POWA 1U5ZA 4HKOA 1IS6A 3WXPA 2WWJA 3DECA 1J3PA 3W9AA 3I2OA 1EAH2 1PIV1 1OD3A 1OPMA 3PMEA 4XF4A 4KI5M 3WEZA 4AQSA 4DXZA 4HSLA 4OI1A 3I49A 4LT5A 2GMEA 2VOXA 2QQLA 3SKJE 3J7LA 3JD72 5FYHA 3CJIA 4CXXA 1F2NA 5FPVA 2UY9A 2VW2A 3H3UA 5FYUA 1VR3A 4CP0A 3OBTA 2CAUA 3CF6E 2LRPA 4IEUA 3NO8A 2AUYA 5H9SA 5A32B 4HN1A 2RS52 3B02A 3KHBA 3GDBA 3UK9A 3JBG2 3I3BA 4LKSA 2VD7A 5DUWA 1ZZ8A 3AZZA 1RUG3 3E5UA 1O3SA 3CZJA 1AYN1 2AENA 4Y1UA 3ETQA 3KT7A 5FXXA 4L92A 4QPGC 2H6CA 1GOGA 2VZ3A 3GXUA 4JKLA 2P5BA 4MH0E 5CVRA 4FOYA 2MEV1 5I0UA 1K5MB 4Y26A 3N36A 3WG2A 3MZHA 3AKSA 4MLOA 4Q27A 4CPBA 1D2QA 1W8HA 1XNBA 3B7MA 1HV1A 4P9GA 1SFNA 1WCQA 5A6ZA 5IK4A 2BYVE 1HLCA 2EA7A 3OGGA 1EUTA 2JWPA 4YZ3A 3SNMA 5F32A 1ZX5A 2XL9A 2EIDA 3WNPA 1DGRA 4Y20A 1PK6C 2P37A 1VP6A 5A3PA 1C8NA 1DGLA 2PQQA 1X7NA 2VMIA 3I2GA 4ITCA 2ATFA 2BGPA 4KG0A 5FZCA 4ORFA 4Q4V3 4C0HA 2K46A 4NRMA 2RS13 4C1WA 3AL5A 1CX4A 2PMWB 4XFBA 4AVSA 3H8RA 5L19A 1DZTA 5HV4A 3VGIA 3BODA 4CTEA 3BTAA 3N9PA 4EWDA 3RJRA 3LIGA 4S2GA 1EPZA 2FCVA 3PDQA 3PUIA 4GXLA 1UYZA 2HJIA 5BY5A 3VDBA 3EQEA 3VBHC 5IFTA 1JZ7A 3BTZA 4IE7A 1I6XA 1J84A 1RJ7A 5KHKA 4QPIA 1HRI3 2R32A 3OGVA 4CPBD 3UNPA 2VXJA 3BVCA 4DRVA 1NQDA 2R0HA 2G9ZA 2BVBA 4LE3A 4MSVA 1Q8PA 4H7MA 1BBT2 4LA3A 5FQ0B 5I93A 1ZYBA 4Y24A 4GA9A 3GZUC 3ITQA 4EZ4A 3K2OA 3KB5A 3ZIXA 1BJQA 3OPZA 5FZ6A 2OZJA 1RXFA 4K1YA 1QH7A 2XGXA 1PZ8A 5ACA3 2YZ4A 4Q4X1 1RUJ2 3ORJA 2XMLA 1KDKA 3H8XA 3PUSA 3VZNA 1AHSA 3B69A 2FZ2A 1BK1A 2AH2A 5FYTA 4IEQA 2HEYF 3CDZB 4EWEA 1QXJA 2X5IB 2JG9A 4BE3A 4LUMA 2JB8A 5JWPA 3MF9A 1UU4A 2WR9A 2ZTNA 1W0OA 5LW9A 1W3XA 2K0GA 3H50A 4CCEA 1LODA 5I0DA 1W6PA 2BNOA 5CKQA 4LITA 1OXCA 1YUDA 2BRTA 2GN7A 3ZVXA 4GIQA 3EXUA 4YVWA 3CNAA 3AMHA 2BUKA 3FX3A 1JXNA 1UZWA 1UU5A 2CHHA 1Q8SA 2QQIA 1MVEA 3SISA 1QXRA 5CFCC 2E32A 4TSVA 2VMFA 2P6HA 5FZLA 1RUE1 1DQ2A 2C24A 1CR7A 4CDWC 1BVVA 3WNXA 4IV1A 5LBBA 4EYUA 2FZ1A 1N47A 2PHXA 2YYOA 3V0AA 2ZEXA 4HZFA 1OA3A 5C9AB 1SLLA 2R1DA 4IETA 4KQ7A 5A1FA 1UX6A 4Y22B 3K48A 5K7PA 3N7JA 3E5QA 4H7LA 1REDA 5L73A 3VBOC 4M3CB 1SLCA 3NMBA 5BNOB 1G9FA 1W6OB 3SH5A 4CUBA 1HRV1 3O5SA 3ME2A 3OPWA 3OYWB 1NLRA 4PT6A 4XHXA 1Y9MA 2DCTA 2Y6KA 1VBB1 4N9IA 5CYYA 2RMU3 4Y1ZA 2FBEA 3W58A 1XYPA 4NHMA 3NW4A 3HN3A 3ZFFB 2J1UA 3LB9A 4CCJA 4M3CE 4CCCA 5EP9A 2W1WA 4LTAA 2FD8A 1R092 3ZSLA 4JRLA 1PZ7A 2C9AA 2WS93 3AP7A 2V5DA 1CQ9A 1RUOA 2Z5WA 3AYCA 4BA6A 4FFFA 5EQUA 1VPHA 4LO8A 2ZKNA 5LBEA 1OURA 1COV2 4RGGA 2B5HA 3WD5A 5EV7A 1AR81 4RS5A 1GLHA 4N7UA 4A6SA 1O8PA 2VMCA 1CPMA 4PLNA 4UI9L 1O8SA 2JG8A 2OQ6A 4RGKA 5FWJA 3J7MA 4FAGA 1RHI3 4XDOA 5JZGB 1YFXA 3GBFA 4AHZA 1JYNA 5ABJA 3I7DA 1YWKA 1ZRRA 3PTRB 1QJY2 3MF6A 4X6QB 1OSGA 3POJA 4LBQB 1RVF2 3S0MA 1GICA 1HB2A 3T2QA 1WD4A 4AVCA 2IXLA 3H1MA 4FI9A 3CBNA 3MIDA 1WMDA 1IQAA 3SHRA 4YZ1A 2A5ZA 4XF9A 5AC93 3IIAA 5IK5A 1ULFA 2VZPA 4TXWA 3M2MA 2O14A 3BCWA 3B3QE 1HQLA 5IAXA 4YLZA 3T1LA 2GC1A 3LA7A 5ISLA 4G9SB 5C8CB 1VBD3 1W2TA 1JYTA 3V65A 3AC0A 4E27A 1DG6A 1XRUA 1O7FA 4I3PA 3KF5A 1MQTC 4IDZA 3PLQA 3WUDA 4B7EA 1O3QA 4KG8A 3GCXA 3N9OA 4XIKA 2Q8CA 2OQ7A 4QHOA 4QM8A 1LGBA 1NT0A 5LK5A 3SCFA 1J1LA 1S0IA 3UYJA 1QF3A 2VMEA 1CZVA 2WNUC 5EIYB 1IZ3A 4AHXA 4D8MA 1PVC2 4H2AA 3RZJA 1ZRFA 2VR4A 3UGFA 1ULGA 3ZFGC 1JOJA 1Q8QA 3NRUA 4QPGA 1HQWA 2Y6LA 2JECA 1V0AA 3HNMA 1GMMA 1NAEA 1XU1A 1WLCA 4R52A 3W59A 1V6JA 3LA3A 3WDUA 1RUG1 1GV9A 1HJFA 2C5DA 1FXZA 2UYAA 3VZMA 5A3LA 4CEWC 2C6SA 2WT0A 2GP3A 4UW5A 4WM8B 2RVAA 1UIJA 1EV12 2LW8A 3FHQA 4IV3A 4JC1A 4Y4YA 5JCTA 3IBMA 4E2SA 1OT5A 1S0BA 1TMF3 4DRRA 1PK6A 4DXSA 2R30A 4BXSV 1WBFA 4Z82A 3AK0A 4P9IA 2GALA 1F5JA 5LA2A 2IXJA 4LLFA 4J6GA 4LHLA 2R043 4UF0B 1GKBA 1QQP2 2W46A 2JXAA 5I8YA 2GNMA 3BUCA 4WVVA 3P3NA 2NQYA 2D6NA 1MS4A 3FLRA 4XW3A 2DYCA 3T0BA 3UKTA 4AQ6A 5LY2A 1DGWA 1ASJ1 3U75A 2ADEA 5A7QA 2WWUA 1W39A 2RS11 3AZYA 1OI6A 3K4DA 3VBHA 4AE2A 2W1UA 1VBC1 2EIEA 2JDZA 2X53S 5CADA 4R9DA 2WYSA 1LJ7A 3WW3A 3VL9A 2VZUA 2ZA9A 1POV3 1O3RA 5IJRA 1LOFC 1DZQA 3LKJA 4MADA 4CUCA 2VUCA 1K5MC 3T08A 5JOXA 1UOJA 4OFGA 2QQKA 2HBTA 2J1VA 4MGSA 4D0QA 2W39A 4HKWA 1HRI1 4AFMA 5FZGA 3K75B 1CIYA 1S0EA 4HVRA 4LBNA 4WZCA 1L3JA 4JDMA 1LESA 2ZHNA 3JQWA 4GJZA 4RFRB 4AGRA 5J7MA 5IAVA 3ZX7A 2GC3A 1XNDA 2PLV3 2YGMA 1W8FA 1AR73 1GNZA 1EY2A 2UWAA 2ZABA 3I54A 5T5LA 4KH9A 2QTWB 1PGW2 4N8MA 3DUIA 1HXS2 2XONA 5KXCA 2W1SA 4D7SA 2BOJA 2XDVA 5A1AA 1XNAA 2A75A 4C91A 2EAKA 3BTXA 5ACA1 5FO8B 5KR7A 2D3RA 1CAVA 1QJX3 4GKYA 4YW3A 4AQTA 1M4WA 3J8F2 2YBSA 3N35A 4QQPA 3T4HB 2RS32 3RI9A 4BHPA 5A3NA 5C5UA 4QQOA 4MXWB 2AZ5A 2R16A 1H9PA 4TWTA 1JU3A 2HWB3 2YG0A 2I74A 2XJSA 4Z8BA 1GQHA 5HCAA 4OI0A 1H9WA 2WLQA 5DZFA 4JQRA 4XEZA 2EXJA 4QKNA 5CFCA 1L7LA 1KGYA 3PURA 2QQPA 1OA4A 3VBFA 1Y7BA 2V72A 2YMZA 2ZGOA 4CDWA 3W5NA 2BDRA 1LGCA 3SLIA 5IHRA 3EYPA 3EHKA 3O14A 1OHFA 3ZPYA 4OHXA 3LFMA 4E9KA 3NWKA 1S0JA 4LKFA 5ABJB 1OLQA 2D6OX 4QT6A 3ES1A 4LIVA 4XAEA 1DQ0A 3USUB 5KHIA 3S57A 4Q2FA 1FV2A 2XUEA 4LHSA 4MHUA 4XQWA 2WNOA 1VAVA 3LDKA 3VBOA 5FDBA 5LBFA 5JI9A 4FQZA 3NJYA 1UWWA 1HIXA 2BVVA 5K0UB 1GWKA 4QMAA 2X5IC 4FPFA 1TG7A 1BMV1 4B29A 2OUHA 2RJ2A 3WF4A 3BYWA 1D2SA 3I2FA 2B7YA 3THTA 1AJKA 1AR63 1ZZCA 5CFDB 4W8JA 4XUPA 2AEZA 2OIIA 5AFEA 4NHKA 2B8MA 1KXGA 3H7JA 1WW4A 4XIOA 4GMP0 5FLHA 2RMU1 2W1QA 1F35A 1MS1A 3ILRA 3ZFEB 1PX3A 2WYFA 3JXSA 3NNJA 3ZO0B 1RUF2 4BQWA 1S0DA 4CA9A 4DY3A 3RRDA 3BIEA 1H4HA 4Q0QA 1UNBA 4OYUA 1UX7A 2EXIA 2V09A 4FP3A 5FPUA 3TEZA 4SLIA 2WS91 1PGL2 4FPGA 2HWD2 5C3RA 1QWRA 4EZHA 3IDCB 1OA2A 3P3PA 2GNBA 5CAZA 3DL3A 3MV11 3DKWA 1QH6A 5EXOA 5C9AC 2BPA2 1EP0A 1KFXL 5J36A 5IVCA 2RR12 3FLTA 4GWMA 5T55A 4D7TA 1DYKA 1S4CA 2VNRA 2HWC3 4IEPA 5FYMA 1RHI1 5D21A 2IFRA 1W6MA 3SQOA 5BNOC 2EVXA 4BMBA 3OJBA 1YNAA 4OLLA 4Q4Y2 4LQRA 2PTMA 3UL2A 5JOYA 3EB7A 1RMU2 4P00B 3JBG1 4XQ4A 2Q8DA 2QQUA 1ZBA3 4PHZA 2KA3A 3ZFFC 1BEV2 3DCQA 4F8AA 3LD8A 1YHFA 3JU9A 4FO9A 4XHBA 4QXHA 5GZFA 2AREA 1CZTA 3WDXA 3IPVB 1UXXX 1Q3EA 3HJRA 1MPXA 3I2HA 1ODNA 2WIIB 1MQTA 4CYDA 3OEBA 2HH9A 4JVAA 3BU0A 4OUSA 4EV0A 3WQ7A 4CVUA 5DAWA 1RUD2 3QOPA 4ET7A 1PO12 2HYXA 3UETA 1XE0A 4R8HA 1VBD1 4M0HA 1VIWB 1YFYA 5JDBA 2WNUA 1Q56A 1QJU3 1N3OA 3THDA 4D6RA 2A71A 3PTYA 2MEV3 4BISA 3HVDA 5JZGC 1HDKA 3ZFGA 3Q8EA 2DTWA 5DQ0A 1YCIA 3QH7A 2WT2A 5FY5A 2H0VA 2VTXJ 4BWOA 1NY72 3TN93 1ENQA 3ACIA 3AFGA 2BNNA 3OD0A 1LHUA 4JGYB 2UYBA 4OCTA 4AWDA 4A4AA 4NWWA 4QX7A 2OT7A 4CEWA 5A6XA 3T0DA 2XOMA 4PF1A 3GZAA 1V6NA 3AXDA 1IHMA 1Z7S2 3UV9A 1AR93 2E6VA 2ZHMA 5FJHA 1KS5A 1V70A 1R1A2 2ZPXA 4G3YC 4W4ZA 5EJZB 2XH6A 3TEXA 3V0BB 4DS0A 2BV4A 1BVP1 2V4VA 5C8CC 4C90A 2A3YA 1RINA 2EALA 2WC2A 4HK9A 4IGOA 5H9PA 1I3HA 4R9CA 4TTGA 4RQPA 1MZ5A 3N4MA 3O1RA 3GM8A 3B01A 4QXKA 5IFPA 5KC5A 1TMF1 4UWDA 4UXAA 5A32A 5L7OB 4MGQA 4FVVA 4W6XA 5EWSA 3HD8B 5IVJA 5FO9B 2AEYA 1XE8A 2Q1MA 2QQMA 1XC6A 5F5AA 4BZ4A 2R041 2ZX2A 3O1MA 1PVXA 2WT1A 1GOHA 3GJBA 3SMHA 4CCMA 1SLTA 5T5JA 3O1VA 2QQWA 4N7IA 3X29B 4Y5SA 4AVBA 3VHNA 1BCXA 4LJHA 4D7YA 2GP5A 5FZFA 4L97A 4IEYA 4Q4W1 5FYIA 4LO4B 3T0AA 4DIQA 1LOFA 4AGVA 2J1RA 1K5MA 2QVSB 1W04A 2J42A 1LEDA 3HR9A 4YG3A 5FR3A 5LRSA 3GYDA 3MW3A 4AFCA 5FZMA 3BU7A 4WM8C 1C8M2 2E51A 2GC2A 4CEYB 1NCRB 1POV1 2A70A 1QOOA 4N43B 2ES3A 1JUIA 2W9XA 2FDFA 5DN2A 1FOD1 4FPEA 2CYFA 5KC6A 5EZWA 1DP0A 4NPRA 4MV2A 1VB4A 4QGMA 4LBOA 2WZPP 2OPWA 1O6UA 1HX6A 2A6VA 1AUYA 2GH8A 4EN6B 4UOJA 2VO5A 1R082 2JDMA 1LOEA 2PLV1 4P5YA 2VOTA 4F3JA 1AR71 1NG0A 2ENRA 4NIIA 2F4LA 3ZMNA 3AMPA 1E5SA 2XHNA 1RJ8A 1F8VA 1WMEA 2A7AA 3ZKUA 1FPN3 4CDUA 3FMGA 2PHFA 2XKOA 4UFJA 4P9LA 2PFWA 1RC6A 1QJX1 4LXLA 4AEKA 3BKZA 4CDXB 5JSOA 1GNHA 3NAPB 5E1RA 3C8XA 5FQ0A 2AACA 2HWB1 4QXCA
chains in the Genus database with same CATH topology
1NE4A 4PBOA 2QDNA 1CD3G 2MPFA 1S0CA 2PHLA 1WCKA 1UPSA 1UZYA 4FPYA 1LCLA 1RUI2 1WLWA 2D7FA 1YI7A 2A6XA 1AYM2 3PVNA 4HETA 3BOWA 5I0TA 3JUUA 4AVTA 2P2KA 3GF6A 1AL23 3NVCA 4QU2A 5BYNA 1NZCA 4RR3B 5A3MA 4OHYA 2X5IA 4A2UA 1H2MA 1XQNA 4P9WA 1V6OA 3WHUA 3AXEA 2ZMLA 4JAAA 3ZXKA 1BKZA 1V6MA 1X50A 3R0RA 4AG4A 1U5YA 4COYA 1XYNA 2K9ZA 2H6BA 4RL7A 1BQPA 2PAKA 2XBO1 4H3WA 4XDQA 4AXOA 2D44A 1FX5A 1AR61 2FMYA 3LAGA 3KS7A 4BPZA 1WUVA 2VVFA 5DDJ3 3VHOA 2HWE3 1TME3 1YI9A 4E4DX 1X33A 2F6BA 1U0AA 4YG6A 3H0OA 3NKGA 1CAWA 2HWF3 5C9AA 4RHV3 2ET7A 5ABJC 4QGLA 2ZKLA 4Y22A 4XFGA 4AI3A 5DG1A 3DPRB 1SLIA 3BOPA 4M3CA 1UAIA 5BNOA 1W6OA 3HWJA 1SFYA 1GZ9A 1Q5OA 2FMDA 4QGNA 3L2YA 3OYWA 5K0UC 5T5OA 2XKPA 2YC0A 2K2SA 4XBLA 4IXLA 3TBDA 1EPWA 1J3QA 3RYKA 3PVOA 4Y1YA 4LR4A 2HWC1 3ZFFA 5CFDC 4FPLA 4IL7A 1R1ZA 2ZMKA 1SQ4A 1YXWA 2NPIA 4CRQA 2WFF2 3KZ4C 2DVDA 3FHIB 4RQPB 3HT2A 1ZBA1 3HIFA 3NSTA 4L9BA 3ZFEC 5BNPB 1CJPA 1D4M3 2R062 2JENA 2OW4A 2YHJA 3D5OA 5GZEA 3LOIA 1C3HA 1OFSA 2TUNA 3LGRA 3WDYA 5LEJA 1V9U2 1DGWX 3NV2A 2ZX3A 5JZGA 3E6DA 4H55A 3ST7A 3OTFA 4LBQA 3VZKA 1QJU1 1WW6A 3UKVA 2KM2A 1VBA3 3ZYIB 4AI1A 3C2UA 5GLZA 3D8CA 1CPNA 4L2NA 4B8EA 3WT3A 3TN91 4YGDA 4IV3C 2VOWA 4A3XA 1G86A 3WP3A 4UW6A 1IGOA 2D6MA 4JTOA 3WZ1A 5E16A 5C8CA 2D6KA 1AF9A 1S2BA 5AC92 4E4ZA 3SCHA 1ASJ3 4ASLA 1WW5A 3E97A 5T52A 4AEDA 1AR91 3INAA 2UWBA 1V00A 1VBC3 4ZU7A 1JHNA 5C4WA 3VBSB 3B94A 1VBE3 3ZXFA 3SITA 4LBQD 3WVJA 4B4PA 4I0WB 4GALA 4BM8A 2VUJA 4BH9A 2NYYA 4M01A 4CDUB 2HEWF 2P3JA 1VAKA 4HK8A 4EN7B 4D94A 2HEVF 4JGYC 3KCCA 4Q1RA 3Q9OA 2N7GA 1FMD2 2XLAA 4FTSA 1KS4A 3MIHA 4WM8A 4MVTA 4LO7A 3A0NA 4R4XA 2LALA 1PO22 1CVNA 2VH9A 1MEC1 4P14A 1H4GA 1N1TA 2EAAA 4XFFA 1DQ4A 4GB32 5FPXA 4FPHA 3CL1A 1WA4A 1G8WA 3OY8B 2ZGLA 3AJZA 4META 2DCZA 4XXAA 5L7OC 4MUVA 4UBHA 3U11A 1VRH3 3ZMOA 4B4QA 2XJUA 3GNEA 3GHMA 4UW3A 3N7LA 4B4RA 2JICA 3D0SA 2YDEA 2EXHA 2DURA 3WW1A 5GZGA 4PQ9A 3PHMA 3UJQA 1NA1B 3LWCA 1DLLA 3ACLA 4Q26A 4JRAA 1BYHA 5LK7B 2EXKA 3VBFC 1FPN1 1RUH3 3M3CA 4HN0A 2MHFA 3AYDA 5CU1A 3WW2A 4ATFA 4HKLA 3C3VA 4NWVA 1RUC2 4CEYC 1NCRC 3MLLA 4LO6B 1CAWB 1WLDA 2DF7A 4N43C 4WM7B 2ZBJA 3I2DA 3AKQA 3NV1A 3AFKA 4RA0A 3RWNA 1MS5A 1W6NA 5JI7A 5GLTA 3MFCA 5KHGA 4YM0A 5CG8A 3ZXDA 4GWNA 2VW0A 1H1MA 4LEJA 1O4TA 2E9QA 2A3WA 4B3NA 2WQZC 1U5XA 1CESA 1AL21 5BV6A 4MXWA 5JAXA 1W6QB 4IEOA 2XJTA 2I45A 4CDXC 1RUNA 1C5HA 2OPKA 1EAH3 2VW1A 2W68A 2WZR2 1Z78A 3NAPC 5KBFA 4LNVA 4RSUA 4R9BA 4Q0UA 1M06G 4ISQA 2R1BA 4W6WA 2ZGSA 5J96B 1GZCA 2Q1ZB 4FTEA 2ZGUA 3JD73 4Q8LA 3TOJA 5HBAA 3HAGA 2FHRA 3CEWA 4P9YA 4BCUA 1DBNA 4AW7A 1ZBE2 4YW4A 3SCGA 5DDJ1 3USUA 2HWE1 1TME1 1PM7A 2RS53 1WLTA 1XE7A 3JBG3 1NCQB 3B93A 1XYOA 2ZMNA 2YY1A 2XB6C 2P34A 1JYCA 4RR3C 2HWF1 4RHV1 3GBWA 5K0UA 5J98B 3VBUB 3M70A 4LO5B 3H1YA 1A3KA 2IFWA 2DU0A 3R05A 4K7JA 4N9HA 3ZDSA 2AYHA 3OBRA 1C28A 1B35B 5CFDA 1V6LA 3MLKA 3R4UA 4OHVA 3OCPA 1C5IA 2Q0AA 4H14A 1EYBA 5LRRA 2GU9A 4IERA 2IXIA 3ZFEA 4AEDB 2YPJA 3ZXEA 1KDMA 3AMNA 3VBRB 1F5FA 1ZNPA 2V73A 2JE9A 5C4WB 4FPOB 1GR3A 1HW5A 1NXD1 2ZAAA 3JQXA 4OHWA 1YIFA 4XBQA 2BGCA 2MNGA 3MW4A 5FCCA 1ENXA 3AZWA 1D4M1 5I0RA 2JX9A 1SBEA 3E6BA 4JCKA 3DPRC 3H9AA 2RM21 3UJOA 4AFBA 5GALA 4EJRA 4P9XA 4YVSB 3N7MA 4AHWA 1RITA 2XVLA 3IDBB 1PIV2 4FBFA 1VBA1 2ZZQA 3WV6A 4LA2A 1BBT3 1YFWA 2UWCA 3IPVA 3TWIA 2AR6A 4DB5A 4FPJA 4RQPC 2D40A 2F4PA 2D6LX 1OKQA 2DFBA 5BNPC 1QOTA 1SMVA 3M3QA 3RI8A 5FOJB 2ZGKA 2Y38A 4XJUA 2WQ4A 1RUJ3 5J09A 5J3UA 1N1YA 4WBBA 3A0KA 3KT1A 4Q4W3 3THPA 3FE5A 1C8M1 3FUQA 4Q0VA 4XJWA 1CAUB 3N7KA 4GULA 1AYN2 3LSDA 4O9GA 4AF9A 1VBE1 1OD5A 5B2GB 4A7ZA 4JGYA 2MEV2 2TBVA 3LOBA 2NN8A 4XFIA 1FOD3 2PN5A 3S7EA 3U0ZA 4YGBA 3HBZA 4A7KA 1PNGA 4LULA 3ZN6B 2DTYA 2G4IA 3V0BA 4AEMA 2R071 4BIOA 5GZCA 1UKGA 2PELA 5L36A 3FFQA 3T2TA 1W6NB 4L8QA 3E6CC 2WKKA 4HBNA 1AJOA 2B46X 2ILMA 3S30A 2IXCA 2P17A 5L7OA 5D1IA 4XQDA 3VLBB 5IUQA 2NMNA 1YJLA 3VBSC 5FOBB 2Q4SA 2WA4A 2YUEA 1QDCA 4DPNA 3RDIA 3BALA 4EN0A 1O5LA 3SXWA 1VRH1 4CDUC 2G9FA 2Q30A 3RZZA 1SEFA 2UY8A 1X36A 2CV6A 1FI2A 1YJKA 5BXXA 4E2GA 1TNRA 1R093 3RQ0A 1B09A 1V6KA 4BLIA 1PZ9A 4CEYA 2ZX0A 1NCRA 4YM3A 2Q8OA 2ZS6B 3AZXA 4N43A 4K40A 4G4FA 4OVEA 2XHKA 1COV3 1UZZA 1C1LA 4GMP3 1WBLA 1RUH1 4Q4X2 5BNNB 3MDPA 4AQ2A 3A4UA 3WCRA 3RJ2X 2VOKA 1AX1A 2E7TA 3ZYRA 4YZ2A 1D4VB 1LENA 4FCAA 4I02A 4ZKTB 1QJY3 2E63A 4MZUA 2ZGMA 5AVPA 1TEIA 1RVF3 1ONAA 2XBO3 3WW4A 5I8TA 1YRZA 3KGZA 4IEVA 2DVGA 2JJ6A 3ZIWA 2ZGQA 1DZRA 4DZGA 1LR5A 1NA1C 4AYUA 5F5QA 3O12A 4CDXA 5CG9A 3WHTA 3AZVA 4KGGA 3NAPA 4FAHA 1WW7A 3QACA 2DCYA 3TNPB 1RUE2 2QUOA 1VB2A 2D93A 4BLJA 1APNA 4S2FA 2SLIA 4PIZA 2PHTA 3VKNA 2GH2A 4QQLA 1EAH1 4Y5Z0 4WM7C 1OQEA 2XWBB 3VKFC 4YZ4A 5T50A 3GALA 1NE6A 4EN8B 3JD71 5AFBA 4YM1A 4XXPA 1PVC3 5FTTC 4RR3A 1MACA 1HRV2 2I2SA 5FFOC 3MPBA 3ZYJB 1VBB2 2RS51 4EWAA 1FT9A 3VKMA 1PNFA 1AXZA 4XFAA 2JE7A 3FJSA 3WQ0A 1ND2B 3ZSJA 3ZYGA 1N3PA 2DVFA 4PDWB 4U36A 5C8WA 3J4UH 4XE9A 5FAXA 1EV13 2D43A 4KBBA 1DQ1A 1ZRDA 4XF1A 2NLRA 1AR82 2GC0A 1AX2A 3QBQA 4ISRA 4YFWA 2OYZA 2GMMA 4GH4B 2E7QA 1LHOA 4Z2WA 3BB6A 4AK3A 4CDQB 5F1RA 5JPNB 2HKXA 3CJXA 5FMOL 1NCQC 3DPRA 4I0BA 2ZGPA 4JGZA 4WV8A 2ARBA 1I1EA 3CLPA 2ZX1A 1GZWB 4XJ8A 1HQNA 3VBUC 5FRAA 3VV1A 5DG2A 4WVMB 4QQHA 4UW4A 3VZLA 1IPKA 1B35C 3B00A 1S55A 1MVQA 1OMIA 4YW2A 1CN1A 3KLSA 5HCFA 4AI8A 4C0BA 4YG0A 3H1WA 2QKDA 5FO7B 5BNPA 2DUOA 1FATA 4AEDC 5BUVA 2VECA 2VMHA 3VBRC 1UW8A 1BBT1 4RFT0 5C4WC 1LKNA 2YXSA 3DV8A 1D0GA 2QZ2A 1PMIA 1J1TA 1IS5A 1XNCA 4YW1A 4XF0A 1HXS3 3FUOA 3URFA 3JB8A 4KU8A 5DUVA 4X8PA 1H1IA 4XTMA 3KQRA 2ZACA 1RUJ1 4FT8A 4LE4A 2B45X 2W52A 5JMCA 3J8F3 4HPKB 1G6NA 1Y3TA 2RS33 2Z69A 5F6KA 1MEC3 1RUG2 2V5YA 3M3IA 1ZZBA 4FQ4A 4LLOA 1ZREA 3JB4C 3HT1A 5A33A 1JBCA 4W6YA 4MGIE 2ZJCA 4KWKA 1S2KA 3ECQA 4XZPA 2NM1A 2XJRA 4FXGB 1NYWA 2XJPA 3EJKA 3RG0A 2PHUA 5DUUA 2DUPA 1J3RA 1ENRA 5HXVA 2UURA 4I01A 1XXNA 1G9CA 4AVAA 3SH3A 2YV8A 3I4IA 4ES8A 1SLBA 2IWGB 3ILFA 3VBSA 3S7IA 3R4SA 1ASJ2 3VHRA 4Q4V2 2RS12 4HANA 3ASIA 1BZWA 1UKRA 1DF0A 3KCYA 3VHPA 3NV3A 4U2AA 1T6GC 4YSFA 1HV0A 4BYYA 4LHKA 2DU1A 4YM2A 5KHHA 4I3GA 4INDA 1V6IA 5T5PA 1SBFA 3D82A 5IK7A 4HSJA 1ULEA 2VVEA 4D3WA 5I0SA 1HRI2 2WA3A 2XVKA 1MZ6A 5IK8A 1DYPA 2IC1A 3MEPA 4OI2A 4Q0PA 4FPKA 1RUF3 2ARXA 2YGLA 4NVPA 3K51A 1URXA 3IDEA 1MS9A 2BFUL 1R091 5F6LB 3WY6A 2HWD3 1MZFA 5CNAA 1LU2A 2ET1A 1GFF2 1S0GA 3OY8A 1COV1 1QGLA 5ACA2 1QNYA 3DN7A 1OFNA 1UMZA 4GMP1 4DMIA 1UPIA 2RR13 2XLFA 1CIWA 2C1FA 5T54A 1X8EA 3WX5A 4L11A 5GLUA 1O5UA 4WVWA 4Q4Y3 3LA2A 2XJQA 4XJ9A 3VDDB 1QJY1 1SACA 1NA1A 1RMU3 1RVF1 2B42B 3WCSA 1U12A 3AMMA 3WDVA 1QKQA 5K8SA 1BEV3 1JTZX 4W65A 2GSYA 2WNVB 2BNMA 3USSA 1DDLA 5KHJA 4N90A 4WM7A 2PYTA 4QPYA 1RUD3 1OOPB 1PO13 4KU7A 4ONUA 5BNNC 5E89A 1LULA 3APBA 4JGZB 3GHNA 4JDOA 1TQ5A 1BMV2 1O91A 1H8TB 1ZRCA 4P9JA 3ZXGA 5JOZA 1PVC1 2VMGA 4JDNA 4ATEA 1W6QA 2WFPA 4FPCA 4AEJA 3S6PA 4Q8KA 2IZWA 2RMU2 4I0AA 1Z7S3 2XUMA 3E5XA 3TAYA 2A6WA 4ZXKA 2CY6A 3AB0A 3VN4A 1QHDA 1WD3A 3EBRA 2WS92 2Y0OA 3RPQA 3AYAA 2RM23 1EV11 1CGPA 1REFA 5D8AB 4YGEA 3POSA 1NCQA 4COWA 2GDFA 3FWEA 1RHI2 4XOGA 4S2DA 3KT4A 1QQP1 4TZDA 2VOVA 2ZGNA 2D5FA 3M7AA 3VBUA 1ND3B 5EJ3A 4MGKE 3WOGA 5JIUA 5J48A 1LOCA 1DU3D 1B35A 1ND2C 4K8FA 5A33B 2E53A 4PDWC 3O0WA 3AP9A 3AM2A 4DOUA 1FNZA 1ZVFA 4PF5A 1C8M3 3VUOA 3UKNA 5DXDA 3VBRA 5DZEA 4YFZA 3ELNA 4I30A 4WZFA 1VBD2 2GMPA 1SLAA 1CAXB 1IS4A 3MIFA 3WP4A 4K20A 5HI0A 4GH4C 4RD7A 3MICA 3FBMA 1LHVA 5F9TA 1RL3A 5I91A 1AL0G 4CDQC 1RIRA 5JLVA 1R083 4NHLA 3HQXA 4AFAA 1GSLA 1QOSA 1PGW1 2PHRA 1HXS1 3MIGA 4EN9B 2R073 2A73B 3RMYA 3FZ3A 4YVSA 2D5HA 1G9AA 3EO6A 2WLPA 5H9QA 5FBZA 3QLQA 4CZSA 3KD4A 4P5HA 3J8F1 2DCKA 2RS31 1A6CA 4AHYA 3G7DA 3AKTA 4ZU5A 3ZSEA 3G6JB 5IT6A 1QNWA 3DGTA 3ZN4A 5JSPA 1NLSA 2AGSA 2QJVA 1GYKA 1TMF2 1WCSA 2VVDA