4CCLA

X-ray structure of e. coli ycfd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
372
structure length
371
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 50S RIBOSOMAL PROTEIN L16 ARGININE HYDROXYLASE
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 371
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4cclA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4cclA01
5FUNA 5FZ8A 4URAA 2WWUA 2Q8EA 5A7SA 4XDPA 5F32A 5FZOA 2WWJA 5FWEA 5FZ7A 5A3NA 4DIQA 4BU2A 4C8DA 2YBPA 4CCMA 4CUGA 3AVSA 5IVBA 2XMLA 3KV4A 4CCNA 2XUEA 5FYUA 3NJYA 5FZDA 3DXTA 5F5IA 2OX0A 5FJKA 5FZIA 5FXZA 1VRBA 2Q8DA 4LIVA 4CCKA 4GAZA 5FZ4A 4Y33A 5FYVA 5LY1A 4GJYA 5FBJA 5IWFA 4QXCA 5FXWA 3KV6A 5A1LA 3U78A 4GJZA 5FXXA 5A80A 2XXZA 5FYIA 5FY0A 4GD4A 5FPUA 3AVRA 3KV5A 5FP4A 4Y3OA 2GP3A 5FZ3A 4D6RA 5FZMA 5FPAA 4LITA 5FZ6A 4UF0A 5F3EA 3N9LA 4HONA 5FZ9A 5FZHA 5FZEA 5FP7A 5F5AA 2OQ6A 3PU3A 5FZ1A 4EZHA 4D6QA 5F3CA 3PUQA 5FY4A 4BXFA 5FZ0A 3UYJA 5FP8A 5FYYA 5FYHA 5IVYA 4IGPA 4CCLA 3K3OA 4CCOA 3RVHA 2YBSA 4QU1A 5FYBA 3PUAA 5F5CA 5FZCA 2OT7A 5A1FA 5A7OA 4LIUA 5FZOB 5IVCA 4EZ4A 5IVFA 4XDOA 5A3TA 4DO0A 2P5BA 5FP9A 4CCJA 3KVAA 3KV9A 3PUSA 5A3WA 4BISA 5A7WA 3PTRB 2YPDA 5A7PA 2OS2A 3PDQA 5FYTA 5IVVA 4AAPA 5LWBA 3ZPOA 3AL6A 4TN7A 4V2VA 5FJHA 5FZFA 3N9MA 4NUBA 5F2WA 5FYSA 3LD8A 2Q8CA 5FZAA 5A7QA 5FZKA 4Y4RA 3N9PA 5FP3A 5F39A 5K4LA 5IW0A 5FZLA 2YBKA 4HOOA 4E4HA 2OQ7A 5A3PA 5IVJA 4AI9A 5FYZA 4CSWA 5LY2A 5FXVA 5FYCA 5KR7A 3N9QA 5ANQA 4QXBA 3KVBA 5FV3A 5ISLA 5A7WB 4UF0B 5FWJA 5FPVA 3AL5A 3OPWA 4QXHA 5F2SA 5CEHA 2YU2A 5F3IA 3DXUA 4IGOA 4V2WA 4IGQA 3K3NA 5FYMA 2XDVA 3K2OA 4EYUA 5FY8A 5FPBA 2PXJA 3LDBA 5FY9A 3ZLIA 2YU1A 5F37A 5LW9A 5FY7A 3N9NA 4LXLA 5E6HA 5A7NA 4ASKA 3OPTA 3PURA 2VD7A 4QX8A 5FY1A 3U4SA 5IVEA 4QX7A 5FZGA 2W2IA 3N9OA 5FPLA 5F3GA 5FUPA 4D6SA 2GP5A 5FY5A 3PU8A 4QWNA 5FZBA
chains in the Genus database with same CATH superfamily
5ICCA 2FE3A 1RPWA 2DYRH 2ECCA 4BNCA 1UYZA 4IV3C 2WA0A 5GLVA 4AQ2A 2XLFA 3J7YJ 3KZ4C 3TP3A 3H3UA 4J01A 1HSJA 4XMIA 5EJCA 1S6LA 4NC8A 1TC3C 5M5XJ 4RAYA 1RR8C 3AG1H 1HDPA 2R7XA 4N7UA 3L2YA 1RUC2 2ZHLA 4QM9A 5CQEA 1JZ8A 4N53B 2WQZC 5H9PA 1T2XA 2B0LA 2ZS6B 5KHDA 2WWYA 1UN1A 1R4NB 1NCRA 3K4CA 1TW3A 3OV8A 3NV1A 4A7ZA 2QQKA 1NZIA 3VBRC 2PG4A 2D6PA 4K21A 4UUTA 4AFCA 1ZZ8A 1HXS1 1NE4A 2HYKA 4B4CA 1GLNA 4BQAA 2RQQA 2E1NA 3K0LA 1XDUA 3LAGA 1CONA 2JA8J 1REEA 2WNUC 3JSOA 1TQMA 1KEXA 2PHWA 3A4CA 2A3WA 3O0XA 2KHMA 4URTA 4C0HA 4Y1VA 4YFKF 1QH7A 1RUH3 1W05A 2NVYJ 4HPKB 1WMXA 4DZGA 5GLZA 3SZPA 3H5RA 3WG7H 5CA6A 2TUNA 1SD7A 1RZ4A 3GBGA 2IVIB 4XF4A 4LGWA 3H8RA 1QOSA 5CYYA 5DDJ1 4K40A 3GZ5A 4NIDA 1OCZH 2WN3A 1R5ID 4GWJA 1KQ8A 5EFUA 3JB4C 1WW7A 3B02A 3F8MA 3I9V2 3BR1A 5BNGA 4AXOA 4JX6A 4RA0A 2ZXWH 2BERA 3RSNA 3V65A 4BHCA 3T08A 1UCXA 4GMP1 2PJRB 4FQZA 4HK9A 2GC2A 2YC0A 4LPLA 4LO8A 1LGBA 2G9FA 4LOTA 4LKSA 3I59A 1STZA 2L02A 2BOLA 1MNDA 2CW8A 2VQCA 2IAIA 1TG7A 3VBUA 4QPIC 4HF1A 1LNSA 2WINB 3OBAA 3WU0A 2ZX3A 3GDBA 3H9AA 3ZGKA 4TTGA 1OF3A 3ZXDA 4LLOA 1AL21 1SFPA 3ILNA 3S2HJ 3LPFA 5FZFA 3D5RC 2XUBA 1NTCA 3DN7A 5JR2A 3PUHA 2QFEA 4IRGA 2ZGQA 4TXWA 1IN5A 1XU2A 4M3CE 3E7LA 5FUIA 3AXEA 4QKDA 1YO8A 3F8FA 2Q5TA 3BB6A 4PLNA 2DQRA 2ZPXA 4EM2A 4U88A 3C7HA 3HN1A 1VB2A 2VASA 3OSFA 1YFYA 1CGPA 3C18A 4C1WA 4WM7A 2OIIA 5H9RA 1W9SA 3NJXA 3GF2A 2DMUA 2BV6A 1DQ1A 2HDCA 5ABJB 4BXXJ 1U5XA 2XBO3 1QIQA 1AUYA 1VP6A 2VL4A 2JX9A 1OH4A 3KV6A 2FBHA 1YS6A 4GJZA 5B5EC 4CXFA 3DPRA 5FY0A 3OIOA 5A6ZA 5C3OA 2EA4A 4IHYA 3IH3A 1K6YA 3B01A 2O3FA 5AFEA 5FFXA 2KM2A 1DGWY 2Z5UA 4ZY9A 3V7SA 3RG0A 4BQQA 2JXAA 5JLWA 1TWCJ 5FZOB 5K0UA 4ISQA 3POWA 1CZSA 3QU6A 5JZGA 3D4KA 4XBQA 4JTNA 1JKOC 3SZGA 2VZ1A 2PHRA 5L9VA 3DKYA 1MQTC 4LK7A 2DOFA 2GM4A 2V1UA 4Q4V1 5IVJA 2KP6A 3FHZA 2ZCWA 1G8XA 2QQWA 3ORJA 1JZ6A 1W6PB 4PT6A 3UV9A 1I1GA 3ECOA 1L7RA 2QWWA 1RVF3 4W1UA 1LGCA 1DQ0A 1K79A 5F1RA 4RBOA 1IG7A 3VKMA 1P8JA 2LFBA 4U87A 5JXIA 5JMCA 3KGLA 1VIWB 1R082 1AXKA 3MKLA 4N43A 1OBNA 2LC2A 4QD2A 4AI3A 4O7XA 3A02A 3LB9A 2X5IC 3GXUA 2XMLA 5FR3A 2AXTC 4XSZF 2WO1A 4KG8A 5DAWA 3C3WA 2WT0A 1SFUA 2OCCH 1ASJ3 2XXZA 3S5QA 2PHTA 3AZYA 1R5GA 2GALA 3HOUJ 1RUF2 2R063 3MHZA 2P8TA 5M3MJ 4DY3A 4ZYGA 4Q0SA 4NWVA 1ENQA 4COUA 2HVSA 4A3IJ 3WF1A 5J1YA 4NIHA 2VUMJ 2DODA 3GHNA 1LDJA 2VZPA 1XYOA 4WVMA 5IVFA 2EXIA 1UWWA 2RS32 1X58A 1J84A 2JB4A 1YTYA 3N97A 3ZIWA 1VI0A 4ZDOA 4FPHA 1PMHX 1G9DA 1OCTC 3AP7A 5GZCA 1MJBA 3VLBB 4IEQA 4GH4A 4XUNA 4I3PA 2KT0A 5D21A 4OULA 2DTRA 1RNLA 4XKVA 1UOFA 1Q3EA 3G2BA 3JQXA 2ID6A 2RJKA 4PJMA 4A3XA 2FQPA 4KWJA 3BIEA 4OWRB 5LB6A 2XPJA 2NVUB 2Y9YA 4BHPA 1SFNA 1WLCA 1F4KA 1HV0A 1PP8F 3UETA 3N9NA 1SMYF 3TO7A 4XACA 5EQUA 4AE2A 4OINF 3HPGA 3N7KA 2XHKA 2QBYB 3KPHA 3FXQA 3OL4A 3FL7A 2ID3A 3EYPA 2E1OA 2MGQA 3TBIA 2ZMEB 4P9WA 1WLWA 2PI0A 4HZFA 3RGBA 4LKEA 2HLEA 3KFWX 2K4JA 1R00A 1N77A 1D5YA 2X8KA 4R9DA 4KITB 3HAGA 5AIQA 4HBNA 2L9SA 3K4LA 4F52A 1ZA7A 2DBBA 1ZVFA 1CD3G 2V72A 4CUBA 5EEAA 4BIFA 4MQ9F 1WKYA 2JG9C 4RB1A 1LU2A 1UY4A 5GZDA 2RM21 3IMNA 4QPGA 1OFNA 4C9YA 2D6OX 3BODA 4MFDA 5BNNA 2DTZA 5D5WB 9ANTA 5C7GA 1TL8A 4IHSA 2RR13 1ETXA 2VQUA 2HVRA 2QTWB 2LBFB 3POYA 3ILFA 4DZJA 3S2DJ 4FE4A 3HNYM 3I2FA 4P9FA 3AZVA 5A6YA 1XGNA 3OBRA 3WHBA 2V1DA 4YELA 4RM2A 5HLHA 2D44A 1ULFA 3FFZA 2WFPA 2ZX0A 2RS52 2WT1A 2M3AA 1RUD1 4KICA 1LU1A 1W6MB 1O5LA 4EATA 4AIHA 1WCUA 4QU2A 1XRUA 1BK1A 4YIRX 1OKQA 5CVIA 2FQ4A 1XSXA 4K8FA 2R072 2A3XA 1E57A 2YROA 1ACIA 4RHV3 4B8EA 2WAAA 1FNZA 2A5ZA 4LMYA 4UB6C 4LTAA 1PO13 1O5UA 2CV2A 4J00A 4D7TA 4OMDA 4I6ZA 2DBNA 4MHGA 2J1UA 3POEA 1Q8QA 3UYJA 1JZ7A 5JOYA 3IAM2 4AGGA 3MUY1 4A3CJ 2KLOA 2ADUA 1O8PA 4D0QA 3FZVA 3UK9A 3KYDB 4XZUG 2DW4A 4COVA 1X4OA 2XSJC 3AG4H 1TWHJ 5FYCA 4OI4A 1UFMA 1H8TA 2NAZA 3PIJA 4JX0A 1W2UA 1QPMA 3CQZJ 1NX9A 3EBRA 3E6DA 1T0FA 3T8RA 2GNBA 2JDZA 1JUIA 5APAA 1SDWA 5LGUA 1FOYA 4X6AJ 1JODA 2LKSA 1K3IA 2L7FP 4NVPA 3CZJA 1ND2B 3LNQA 1J1TA 1XU1A 3LWFA 1O7LA 1MR5A 3F6VA 5FXZA 5C4WB 1HA8A 2BWAA 2AEZA 4ITVA 1ALYA 3FLPA 2ZA9A 3WP5A 4YFWA 4Y22A 3AVSA 3WDVA 2ZACA 3K7AJ 3O5SA 2J1RA 3KZZA 2VAUA 1WJ5A 1TWFJ 5FO5A 5F0CA 4A6DA 2D1VA 4HLXA 3ASOH 1W0OA 2WFF3 2LVSA 4XW3A 2MW8A 3O1MA 4U0YA 2OU2A 3IDEA 4DOZA 1IG0A 4HKLA 4D6QA 5F3CA 4IQPA 1H2MA 4L9NA 3LDRA 3K70C 1T33A 2DOAA 4RAGA 1NZCA 3KZYA 2YX7A 2VW1A 4A0ZA 1BEV1 1MEC2 1VBB3 3LCPA 3ES1A 3HOBA 2VXZA 3OY9A 1GR3A 1MDMA 1HV1A 4HFSA 3CO6C 3VDAA 3AX4A 1FATA 3EPZA 2VG9A 1HRV2 2WUHA 3W2AA 2LY9A 4YPJA 4CEWB 3P1IA 4HOBA 1S0BA 2AREA 1JOPA 3LSDA 1OOPA 4C3HJ 1DYOA 4LBQD 2F4MB 5D8AB 3VBHB 3I53A 2DUPA 4LK6A 5E8GA 3FHQA 4JCKA 3S30A 2GA2A 2ZHKA 2F48A 4YRDA 2Q2EB 1E5RA 2VE8A 3I5UA 3OR2C 2NQYA 1MIJA 1FPN3 3A4UA 3K69A 3HN3A 3PIGA 4BE2A 3PNAA 1X4PA 2IWGB 5DDJ2 4A93J 4CDGA 5FZDA 2EZLA 3O1UA 1V5GA 3GZTB 4Q0PA 5BOXA 3QQAA 5E17F 1CZTA 2W94A 1R22A 3IHUA 2UURA 4OIOF 4X6RB 2FJ1A 4QDQA 3ZFFA 2AQFA 2UV1A 2J1AA 1AKHB 2P3KA 2LG4A 1ZGAA 3ZPYA 3GLLA 3WUDA 2D1HA 3WNXA 1UHMA 4CYDA 1OR7C 3BALA 3S32A 4NQWA 2DI3A 1WJEA 2Y64A 2PQ8A 3GHMA 4N4NB 3ZVXA 3RYKA 4Y13A 3WNOA 3VDBA 3I71A 3DU6A 1OD5A 5CAZA 2O61A 3ST7A 1ODNA 1IV8A 4XFHA 5J1RA 1MS4A 4ABZA 2VZOA 2B63J 1QJY3 3BTCA 4P9IA 1R091 1I5PA 4JQFA 4LB5A 4RM3A 4QXBA 2FCUA 3OL3A 3AFHA 4PUSA 3V4GA 1F8VA 4IGQA 2BE5F 3NRVA 1BW5A 1PGW2 3AKTA 2X09A 3PQKA 2DLLA 4GYGA 1BVP1 3HBKA 2PN6A 1R49A 2K0GA 3U07A 2VOVA 2R93J 1WCKA 1IXCA 5G04L 4XICA 2PQSA 3LIHA 3T2OA 5B66C 3K4NA 3K4MA 2QQ9A 2L4AA 3OYNA 4XDPA 2ZJCA 2VW0A 4F55A 3H1CA 1ZQ3P 4EJTA 4PJLA 4YG3A 1V4RA 4IERA 1KJRA 3OD4A 1H2LA 5DCMA 4XUQA 1FOWA 3SCHA 4NRPA 5BYNA 2LYCA 3USUB 1OQDA 1IC8A 1TW2A 3JBG3 5T5OA 4HRIA 4QGMA 2IGKA 2CGOA 3T1BA 1WA4A 2WIIB 3CESA 4M4PA 1O57A 4FXKB 1QZZA 1W03A 4E7KA 4XHXA 2YX4A 3OJBA 3BR3A 1IPKA 5I8TA 3HHGA 1DGWX 2XJUA 3IBMA 3J7NA 1RIRA 1SMVA 4RB2C 1N75A 1S0JA 3TP0A 5GJ6A 5IOYA 2FBIA 2ZO4A 3RZOJ 5J4VA 4AI0A 2FD5A 2BY0A 3CEWA 4CVUA 5ACA3 5DAVA 3IKTA 1SBFA 1C4RA 2WS93 3DYMA 1X8EA 4TZDA 5A2QK 1Y8QB 3CP8A 1D5VA 1SPPB 3ZN6B 2WWUA 3ZQIA 2YY1A 1QO0D 3SNMA 3IPVA 4JX5A 5FRNA 3M3YJ 5KHHA 2Z33A 4HKWA 4A6EA 3CBNA 1P7JA 1RUG3 2O5RA 1GNYA 3P6BA 1WJCA 3HBLA 5D4SA 1NQJA 1PK6C 1UZWA 2IXIA 3RZZA 3PMSA 4QQ2A 2WZPP 2CQXA 1G2HA 2LK2A 1U8RA 4UF0A 1ZGJA 1V6IA 1YX5A 2W0XA 1DGRA 3L9FA 1GLHA 1XE0A 4CCDA 4L9JA 3TBDA 1HBXG 1A5JA 1ZK8A 2A5YB 3LOCA 3SQOA 2XH6A 3FKIJ 2V5YA 3AZZA 4YYOA 4E70A 1C5IA 4QPWA 2PLV3 1GWKA 4IRIA 1KQ0A 5IFTA 4LOSA 4RAZA 4IE0A 2RKHA 1PDNC 2CRGA 3ACFA 4YG2F 2D3PA 2W1QA 4HSTA 3HRTA 1ZBE1 3WT3A 4WCGA 3ZYJB 1RUE3 5A3LA 3S3MA 4B44A 3BVCA 5C9AB 2ZGPA 2J1VA 4D8MA 4WM8B 2VBDA 2GIZA 1S7AA 4IOCF 5FPVA 3OD0A 4BACA 1I39A 3MFCA 2ILMA 4KMQA 4NIAA 3F0CA 2L4MA 3JRGA 4DXZA 1LEAA 3P5JA 3W6VA 1ULYA 4LLNA 5FY1A 3WNKA 1XX5A 2PQQA 3O1TA 1HRI3 2HWC2 1UYYA 2W39A 3A0KA 4IEOA 1EJ9A 2CU5A 4ZZLA 2E2IJ 1Z91A 3VFZA 3V8LA 3DXTA 4QMAA 3UKNA 1VBD1 4UV9A 1VBC2 3AMMA 3T0AA 4JRAA 1W6QB 2BRTA 4NAOA 3SKVA 2NZ9A 3MIBA 1LEBA 5JFRA 1S7OA 1YJKA 2W4SA 4M3CB 4TSVA 4LHKA 4XF0A 5DMYA 2FZ2A 4G6QA 4NRMA 2HXIA 5JVGF 5B1AH 1MS9A 5A33A 2HI3A 1Z77A 4IEZA 1C1LA 3RJPA 3WR0A 2QBXA 1VQ5I 2GWRA 5CZKA 4CP9B 4BLJA 1EUTA 2VNOA 1BC8C 4XEZA 1GOFA 3LA7A 5I0TA 3JRBA 2X48A 1V70A 4LO6B 4ANJA 4CA9A 1BMV2 3TN93 3TRSB 5FP3A 3DYPA 5F27A 2WAEA 3T2PA 3C2BA 3K2AA 3HIFA 3CMEI 1CAWB 5SV8A 2WRAA 1AYN3 3U0ZA 2E2JJ 3CLOA 2AENA 4QM8A 5FKCA 3KLNA 2VMEA 1PZ9A 2ESNA 2HBUA 4QB1A 5ABJA 2J22A 3ZSKA 3W6JB 4AOCA 5FUPA 4SBVA 2HPIA 2CTVA 3FMGA 2DBIA 1F1ZA 3D8CA 4B7EA 3GJBA 3JQWA 4YW1A 3O1VA 1AWCA 2BPA2 4BE3A 1ND3C 1TQ5A 1QJX1 3AKRA 3HUGB 3AKZA 3PO2J 4UFHA 3BY6A 2RS12 5LHHA 2PAMA 2IXSA 1F5JA 3ACGA 2W24A 4P5YA 4K6BA 4HL0A 1W0PA 1H6XA 2P5LC 1WZ2A 4OMYA 5FMOS 2UYAA 1US3A 2C9KA 1W2TA 5FZEA 1TLHB 2OQ6A 2BTVC 1UF2C 4AFAA 5FZ0A 3JCUC 2EJRA 3OSGA 4D1QA 4YZ5A 4IZZA 4QKNA 4CYCA 4KQ7A 3EB7A 2A71A 4GULA 3OYJA 5CG8A 4FX4A 3BUCA 2P4EA 4IJAA 2G7UA 2K2SA 1UMHA 2X1CA 1A34A 1KQRA 3HOTA 1W6OA 3PDQA 4CZCA 1W6PA 1QF3A 2NS8A 3L2QA 3D5OA 4Z82A 3GBWA 2ZGSA 3GUDA 5F0FA 3AP6A 3GALA 3TAYA 3D5LA 3L2UA 3C7GA 1RKWA 1WRJA 1QRYA 3GTOJ 5FYMA 3POGA 4Q4W2 2D7FA 4JDNA 4A3FJ 3NQOA 1O91A 3LEGA 3GWZA 2LOOA 5J96B 4JBAA 1R36A 1JI6A 2Y0MA 5FZ8A 4KU7A 1DF0A 1GVDA 4LHNA 1QXRA 2E1CA 4BA6A 4EJWA 3RTRA 2GXAA 2A68F 3F23A 4BK4A 3FHNA 5CQGA 1COV3 3J7MA 3WW3A 2VY0A 5FYVA 5GZGA 3WTWC 4UBGA 1TNSA 4DUXA 2EF6A 3OG2A 2BNNA 1FMWA 3OYDA 5H9SA 3SLIA 5DD4A 3HOWJ 3PJQA 4R9BA 1FSEA 1RUOA 5J8CA 3NQHA 4XTPA 1TT5B 2L7KA 4NB5A 4XIKA 1EH8A 1ZZBA 1VNDA 2IS6A 3MKZA 4M3EA 1I3HA 3PUAA 1MH4A 1IOAA 1XB9A 1XQNA 4B29A 2W52A 1DQ4A 1U0AA 4XSXF 4NHYA 4I0AA 3PTRB 2I8DA 1SVLA 1VB4A 1O6UA 2V4AA 3MZHA 3M8FA 4Y17A 2XL7A 1BOBA 2LW8A 1AZDA 5C4XJ 3GXOA 4IV3B 4MSVA 2CG4A 1F2NA 3APBA 4ENJA 2QBYA 1CAUB 1JKQC 3F72A 2E32A 1VBA3 2VE9A 5FD6A 2HKOA 3WQ0A 2ERFA 3OUIA 4L9TA 3ZSJA 2JN6A 5KAFC 3BR5A 5T50A 1LPQA 2WO2A 5CVRA 1KS4A 3UR3C 3A23A 3LEIA 2EIKH 4DW6A 2ZXIA 4Q4Y1 1UHWA 2OF7A 2YU3A 4GCVA 2RR11 3KYLA 4XR6A 1DGRM 4S0HB 4UOJA 3J26N 3FDYA 3ASNH 3FHAA 1V0AA 3AP4A 3VD9A 2LD5A 4FXGB 1RUI3 3SH5A 2JICA 3AP9A 2LY1A 3PL8A 1VQ6I 2CMPA 2XJRA 2VMCA 3MICA 3IIAA 2GLOA 3MLJA 4FTSA 1HCRA 1FOD2 5J98B 3OOUA 2WNUB 5JLXA 1B6AA 2RMU3 1BL0A 4JDOA 2QQNA 2WN2A 3R4UA 3CUQC 2FEZA 1HB1A 1PNGA 2VULA 3V8KA 2HPMA 3LOBA 5GP9A 4XDQA 2WQ4A 3OS1A 2EIMH 4BISA 4QX3A 2LBFA 1SMTA 2E51A 4HSLA 2R5ZB 3ZPOA 4UW3A 2DFIA 1WJAA 2BOJA 2P6CA 1MS5A 3TNPB 2CL2A 1WMDA 2VBZA 3RDIA 1FLIA 5EEHA 2IGOA 4Z6YA 1YQCA 4KL1A 2BVLA 3AL5A 3TEZA 1AR72 1W6MA 2GC3A 4IHXA 1GZWB 1DPRA 3WE2A 1W28A 5KC5A 4W6XA 4BBSJ 4XF1A 4JKMA 3POFA 3K6GA 2R5YB 3N9OA 5FK8A 1OXCA 4R4XA 4QSHA 3PVBB 5LA0A 1WGXA 1IG3A 1H30A 4GWNA 5BUVA 3IUOA 2JT1A 4CCMA 3EJKA 1GV5A 2X53S 3CC2I 4IE5A 1G9BA 1VRH3 4CDXC 3MV01 1UG2A 4YFNF 1XSDA 4R1HA 4L97A 5FMOL 1IO2A 4MTEA 3HSFA 1G6NA 4OYUA 1YFUA 1Z21A 5FZHA 2CY6A 2DFBA 2CUEA 2I5UA 4WXDA 1UXXX 2Y33A 2AYHA 4U2AA 1YLFA 1XMXA 4P9GA 4E7LA 2BZDA 4FI9A 1WHUA 3HZJA 3QOEA 3W6KB 4H7MA 2ACJA 4L8QA 4UXAA 1WJDA 2ZHNA 5IYYA 3OYKA 4FPFA 4HW0A 1OLME 2YPDA 3FWEA 1RR7A 4AQTA 4JC1A 2DA6A 3FBNB 1OLRA 3I55I 1FOXA 2P3IA 3GTLJ 2R0QC 2R1DA 5CNAA 2HS5A 1V9U3 4E4HA 3OSDA 2JIJA 2OQ7A 1Y3TA 1LB2A 3ZMOA 3K75B 3LQCA 5E3NA 3FKJA 5F2SA 2EA2A 4OI1A 2LY2A 4BPZA 5C4WA 2STTA 1FYLA 5GLWA 5F0HA 4LBOA 4Y4YA 2GH2A 4LXLA 1V6KA 1VBB1 4KFCA 2I07B 3MZYA 3I49A 2NS7A 1LVKA 5D5VB 1X82A 3B93A 1F31A 4LK1F 4M9XA 1MZ5A 2ZOEB 2EALA 1TME3 2VCAA 4AVBA 1R58A 2CQ7A 3WODF 3OYEA 3N7JA 2WZR1 2D40A 5ED4A 3M2MA 2D6MA 4F8AA 4G4FA 5KVRA 4F92B 3LPGA 3T0YA 1RUNA 4LITA 1RUH2 3FXMA 1AHSA 5DCFA 3ABTA 3J9SA 1IS3A 1PZ7A 2V4JC 3FXLA 4DGWB 2L7MP 2WAOA 4BJ5C 4QU1A 3I4MJ 4LQRA 3ON7A 3BC8A 5IVCA 3LFKA 1BLZA 1Z1DA 2DU1A 4IL6C 4DYRA 4CEWA 4QGLA 5A7PA 3LFIA 4Z2AA 1XCBA 2EBIA 3QPHA 2L54A 3REOA 2DUOA 2ORXA 2P6TA 1WQ2A 5FZLA 2VZ3A 2CWSA 3ZMTA 2X10A 3P9KA 2Q2EA 3WCRA 4OZOA 5A6XA 2X5IB 1A8DA 2O0YA 3G71I 4BQWA 5J1UA 5IAVA 2PMWB 3K3NA 3I2KA 2RDPA 5FY8A 2HDWA 1Y7BA 2B39A 2GNMA 4M3FA 3PIOF 3PURA 2ZKZA 5BPXA 3ZMNA 5HNFA 5I93A 1GP4A 3LIGA 2VOPA 4LBQB 4MLOA 2XLGA 3CQOA 1TT0A 1UIKA 1AX0A 1Q8SA 1QJY1 2C1FA 3UNPA 4AYUA 3OYWB 1UQXA 1NCRC 4II2A 4SLIA 5E89A 4KMUX 1JYXA 2XC7A 2EVXA 2Q1ZB 4P5HA 5E20A 2O1QA 2Z16A 3VDXA 1AKHA 2IVMA 1W9YA 1OKRA 2ESHA 3DUIA 1DQ6A 3X29B 1XXNA 1O8SA 2GP3A 3VKOA 3H3VK 5DUVA 3HT2A 3IDAA 4NO4A 5IK5A 4FOYA 1WWXA 1QNYA 5FMCA 2K5CA 4NJ4A 3ZXGA 1APNA 2YUEA 3TEXA 1OPCA 2WJSA 2W82A 2IW5A 1ULDA 1OLTA 4M71A 2HKXA 4BQOA 1HDDC 2OA2A 5A1AA 1FEXA 3SDGA 5LK7B 2RGVA 5DAPA 2XBO2 3DF0A 2KJCA 4MZUA 4K20A 2R7UA 1GOHA 1S1AA 1OA4A 2G0EA 2UUZA 3O8HA 2C9AA 3RPUD 4FAHA 1TMF1 1ZA4A 2VGDA 3T0DA 3RYRA 3JD73 1RMU1 5EF6A 3AAFA 4V2WA 4FPYA 1EPWA 3THTA 4B4PA 2LH9A 5EYXA 1JGSA 3CIHA 2CO5A 4YW3A 2MEV3 5FTTC 3WF2A 5C3QA 1JUPA 2CUJA 3E5XA 2W1OA 1UD1A 4PI2A 5FO7B 3LSJA 1S0FA 3ZR6A 3VBUC 1UU4A 4LG3A 3E5QA 1SHWB 2JG9B 1AXZA 2F2EA 5FJKA 2DT5A 2KKOA 5B4XA 2R0FA 5IT9Z 5KXCA 4BCUA 4OUMA 4M6YA 2GMPA 5HODA 4BL0B 1DU0A 2IRFG 2Z3YA 3V7RA 2DFEA 3GBFA 1RVF2 3RQIA 4UT5A 1N1YA 3ES4A 3MWMA 3SYTA 1WCQA 1SFYA 2NN8A 4RGUA 5J09A 1DU6A 5K7PA 4XORA 1FMVA 1VQLI 1RL3A 3DPLC 1J2XA 3KZIC 2MBFA 2GOMA 1RUG1 2RDSA 1DP3A 4PFPA 1AXYA 1OD3A 3WTYC 2HQ5A 2FMYA 4UW4A 1W06A 2JDAA 1WLDA 3KCYA 3MKYB 2WSUA 4WM7C 1KYZA 4EWDA 1XC6A 2WZEA 3OCPA 5GLTA 3G1MA 1ASJ2 2C24A 2ATFA 3DXUA 3ZN6A 2R062 2XGCA 2BYVE 3W58A 4AQ6A 1B9MA 2YDEA 1NK2P 3OIPA 3PJYA 4I02A 1TEIA 2CHHA 4E2GA 4N9IA 3K51A 1LEDA 1ULOA 2M0MA 3DPRC 3B5LB 4XETA 5A7SA 1KD7A 1RUE1 3ZQFA 4OMCA 2IXCA 1FX5A 4MGQA 2VZQA 5C5UA 4AFMA 2N7GA 2O8QA 3LL7A 2RVCA 1YJWI 3G6JB 5K0UC 5HDNA 2BXZA 2XSDC 3LA3A 2L7ZA 4FTHA 3C3VA 4Y5Z0 5GAEJ 1EAH3 2OVUA 3URFA 5JZGC 5D5XB 3LEMA 3MLKA 4QHBA 1GVJA 1X1AA 2PFWA 4OIQF 4EE2A 2MA3A 1GQHA 2OKXA 5FCCA 4ORFA 2L2OA 1FC3A 1W9FA 1R5HA 1CAXB 2GMEA 1BR2A 2ID4A 5JR3A 4IHVA 1AR61 2JWPA 1DQ5A 5DQ0A 5JPMB 2XB0X 3RKWA 4E7ZA 1W3VA 4O9GA 3HJRA 1CWPA 1VAMA 4Q8KA 4BHBA 4MHRA 5LLQA 2AR6A 5C3EJ 4A7KA 5LBFA 2NVTJ 2R7VA 2P1BA 4TYSA 3S5AA 1YIOA 3MIEA 1YUDA 2LREA 4KMFA 2OPTA 2JUCA 1DZTA 3VZJA 2WSVA 2GC1A 4E8CA 1S2EA 5IPAA 3NL1A 2VUJA 4BH9A 1IRFA 3LDBA 2QQMA 1HXS3 2ZXQA 2C5DA 5LFAA 4ASKA 5SV5A 1B72B 3BP8A 4RQPB 2IXLA 3PUIA 2DVBA 4Z2WA 2ZNYA 3RKYA 4WVVA 3TN91 5LHGA 3KF5A 4XABA 1W6QA 2RNJA 2R32A 2D6LX 1C0WA 2ZHMA 2ET7A 4L5IA 4M3CA 4FPJA 2B5HA 3V0BA 4CICA 4Y33A 2VNGA 3OOPA 4A44A 2RR12 3R60A 4RFRB 1GOGA 3HB9A 3QLQA 1Y39A 2ZC2A 2VVEA 3GCWA 4EWEA 5FP7A 4GH4C 3AYEA 3DKWA 1GBGA 4GA9A 4HF2A 1B9NA 1ZBA1 4CU8A 1QJU1 5A7OA 5A2QZ 2D2WA 2LTPA 2ZJPF 1LEMA 2RHPA 1JZ3A 4BQ3A 3EXUA 4ASMB 4GMP3 3SCFA 3CCJI 3R4DB 4MGTA 1CAWA 3THPA 4AAPA 5FJHA 5BNOA 4I3GA 1HSTA 5KNLA 4OHVA 4RHV2 5I91A 1IRZA 2V7FA 4XIOA 2XVKA 5DYMA 2HYGD 2QVSB 1PO12 3DEWA 2QZ8A 1ENRA 2LUWA 2WL1A 2VMIA 1OUXA 1GXQA 1AL23 1UZCA 1CPNA 5LW9A 4YIFA 2L01A 3WW1A 3KP4A 4XFIA 3HUGA 1MD0A 1GQPA 3IAS2 1PX4A 3AYCA 1IV6A 3CZ6A 3W21A 4FSJA 1MSEC 4M9SA 4XF3A 2HWVA 1FMD1 2DU0A 4ATFA 2YS9A 4S04A 1QZYA 3FK6A 2FU4A 1PUFB 4DYQA 4R9CA 3T2QA 1CX4A 2R30A 3S1QJ 1LOAA 2DQLA 4QPGC 4RLFA 2Z69A 1WCMJ 4HBLA 1X3UA 4COZA 1YRZA 5BNNC 2PN5A 1V6LA 2G9WA 1D1AA 4K2EA 4PJYA 3UGGA 2ZABA 2CQQA 1DP0A 5KCMA 1T95A 2VECA 4A3MJ 4EZ4A 5CFDB 3WF0A 3MEPA 5I0RA 4IEJA 4CZZA 2EWNA 4G7OF 1LHOA 5FK7A 1FNNA 1DLCA 1K5JA 2YYOA 4KNYA 2R7EB 3ASIA 1QA6A 1HB4A 2DFFA 1LODA 4KN7X 2PFBA 2OUHA 3WNNA 3LSMA 2WFF2 4JK1X 4DEVA 5L3GA 4UW5A 4AVAA 5FY9A 1NCQB 5J6XA 1NT0A 5J8FA 4XQFA 4MXWB 3JUUA 4AI1A 1DGWA 5FZGA 4AW7A 5ICEA 3F95A 4CXWA 4URAA 4LHLA 2OZ6A 5K9YA 1D0GA 4Q4V3 2ARCA 1VBB2 2LALA 4OQ9A 1ZAOA 1YQAA 4YG0A 2YV8A 4HSJA 1OCCH 3OIQA 3GFIA 4LR4A 4QQOA 2WB1A 2ET1A 2O8KA 1VBA1 3HJEA 1H8VA 3FE5A 1OMIA 2E1MC 4HDUA 3NKTA 2DURA 5BY5A 4OZXA 2BGCA 2DF7A 3E6BA 3ZQLA 3K4DA 4CCLA 3P5BA 1H8TC 1XNAA 4A4AA 1MVQA 1D0XA 2X6YA 3KP2A 2OTJI 3OOXA 2HWD1 2DV9A 5FDBA 1FPN2 4XPVA 2R16A 1SFOJ 1FOKA 2ZGNA 3ZYHA 4IPAA 1SLIA 1H9TA 1CAUA 4S2GA 4CE8A 1JU3A 3B9CA 5LD2C 2TBVA 3H0GJ 2M7AA 3RWKX 2QQ8A 2JVHA 1YITI 5JXJA 2DK8A 2RMU1 3WDYA 4F3JA 4GB33 2HWF1 1U12A 2XB5A 1IN7A 4RGRA 1LFPA 1W5CC 4AHZA 1ULCA 1PK6B 2V09A 2EAKA 1O4ZA 4L92A 1FBSA 4C2MJ 1RINA 3IKWA 4YW2A 3BU0A 4OMZA 4HLYA 4FOWA 3VYRB 3CMGA 4Z07A 5FOJB 1IN6A 3K4ZA 3LSTA 5HS9A 2ZFWA 1TQPA 3HTSB 1X2MA 5L3BA 5FB2A 1WFXA 1VMFA 2LKXA 1QJY2 1KGSA 1KFXL 1X2NA 5J1XA 3AKQA 4XQ4A 3G6EI 4JVAA 2QEXI 3C2UA 5GLUA 4WVZA 3AVRA 4Z2YA 5FZMA 1XJAA 1T2KA 2A6TA 3N9LA 4FE7A 1Z0HA 3ZMUA 2VNVA 2HOAA 1Z67A 4CEYB 5FKMA 3LFUA 3IWFA 5EJ3A 4KUMA 3SJMA 5BS6A 2VQTA 5CVJA 2R5ZA 5JPNB 4V1PA 1HN1A 1X19A 1SCRA 1LAJA 4YVWB 3FC0A 2HWB1 4D3WA 1GZWA 4WZFA 4I98B 2TNFA 3MLLA 3JCIA 1FBUA 2IZWA 2P3YA 3ESWB 1Q8PA 2ZFUA 4FETA 1NOVA 2GH8A 3GZUC 2Z2SB 2Y48A 2R5YA 3JBG2 3S7EA 2BW8A 1OURA 1B8IB 2I10A 2WYSA 5FKNA 2RM23 3SFZA 1VQNI 3JSPA 2YU1A 3H5AA 4HVRA 4LLFA 1WI3A 4ZU4A 3AZXA 3NKGA 1JT0A 2V73A 3IRRA 1SAXA 4FFHA 1PGSA 3MFKA 4IL7A 3BOWA 1Z3YA 1UIJA 3VZLA 1ZN2A 3ZFFC 2BNOA 2VZSA 3M1EA 2WDBA 3NVCA 3DTEA 2EIEA 4G12A 2XAGA 1ERDA 2EXKA 2ZGRA 4YSFA 4IX7A 4EQVA 4XRFA 2Y0SN 1R1VA 1J83A 1RUD3 4LD5A 2E36A 4D94A 3EDPA 3CDLA 2JTVA 5ACA2 4CZSA 1QOOA 2WS92 4CXYA 5A32B 1OQEA 1HC8A 4RA2A 1TME1 1YXWA 3QD6A 1D0YA 4YM0A 3S3NA 4U0WA 4OI2A 5HXVA 1J5YA 3ABKH 4RGKA 1OYYA 5CKTA 3PFYA 4I0BA 1YFWA 2HR3A 3CNAA 3ZN4A 3DKQA 4XNFA 2WR9A 3JTGA 3MO4A 4XRSA 4LMFA 1ND3B 4FP3A 4BM8A 5DM7F 4BMEA 3CCVI 1I6HJ 3IB3A 4CDUB 3MQ0A 3EYIA 3CDHA 1T08B 5HS7A 3NW4A 3H8XA 1ETVA 2G9GA 3NNMA 4GALA 5ILUA 3M3EA 4YGDA 2NNNA 4K7JA 3VWBA 2IS4A 2CSGA 3I3MA 3P9CA 4ZZ8A 1W2NA 1AR91 2Q0AA 2B8MA 2PLV2 3WHCA 4XCBA 1LDKB 3ZMSA 1FTZA 4ES9A 5HCBA 2ISZA 1RC9A 3Q8CA 1VBE1 4XN3A 1NG7A 2UWCA 5IFPA 3MZ8A 1EA3A 4CRQA 5LGTA 3AJZA 1GZTA 1RUE2 3K48A 1LJ7A 1DFQA 3NAPC 1VF9A 2MD5A 1R71A 2JSCA 2DT6A 1PMJX 2KIMA 4BE0A 1H0MA 3J7AO 1V6JA 2P0WA 5KHGA 4LBKA 4MEXF 5FO8B 2E19A 1AR83 4QQPA 1Z0XA 2DA3A 4OUSA 3ZFGB 4I99C 2GMMA 4QX0A 1Z6RA 5C5TA 2VJ5A 2GQQA 2PHFA 3WG4A 2VLAA 2JE8A 1YFHA 2R7DA 4XYXA 2ZMNA 4JGZB 3N7LA 4LFUA 4EN9B 2R92J 1HRI2 1BBT1 5DS9A 2FCVA 5ICGA 4FCAA 2IXJA 3AK0A 3CJXA 2X4HA 3B73A 5C3SA 2BW3A 5B2GB 3E1F1 4J6GA 3MPPG 3BTLA 1Z3XA 1CAVB 1CZVA 3U37A 3SH3A 3S57A 1RJ7A 1H4GA 4UNOA 3EQEA 4MOAA 4UB8C 1RC6A 2F5FA 1ON1A 2A5WA 4LBQA 3HTUA 3OS0A 1SVMA 1BEV3 4WZCA 3KCXA 4EJUA 3GM8A 2IP2A 5FPBA 4PI0A 1R1TA 2HWE2 1S0GA 2V5DA 5DABA 4XF9A 4PK4A 1OPOA 3DBHB 5IJRA 2M30A 3G7DA 3TO6A 3KCCA 1ETWA 4X8PA 2ZJQF 3IDBB 5M3FJ 3BJAA 2XUEA 1WA6X 2HXOA 3TN92 2V79A 3JD71 5FQ0B 3MVPA 4GAZA 1Y43B 1HKQA 4Q1PA 4E7HA 4QXCA 4B3AA 2F5EA 3COAC 5BPDA 2H0BA 3DXJF 4YW5A 4ETSA 5E8AA 3WP4A 4XFBA 4Y52J 2WY8Q 1AYN2 4BDVB 2VTFA 4XZPA 4E7SA 1I50J 1R23A 2PMUA 3K3OA 1LOFA 3KE2A 4KH9A 4LJHA 4LIUA 1UKRA 1PO22 1J3QA 5HLTA 2CSOA 1OH3A 2DJNA 5CVVA 1BW6A 2GN7A 1YNAA 1LFUP 3WLUA 1UZYA 4Y20B 3ZYFA 2K9MA 1R9TJ 3HXLA 3T8TA 4LO5B 3KVBA 3T1LA 4UYBA 3H35A 4FTBA 1I1SA 5HCAA 5I0DA 3WDWA 3JRDA 1Q56A 1X8MA 3P9IA 4LLGF 2VQLA 1W6NB 3J80Z 1MPXA 3M4FA 4V2FA 1U5TA 2VE1A 3I3EA 1H9WA 2NS0A 4IHTA 1R093 1RUF3 5F32A 1E3PA 1DGRN 2WWJA 5FKBA 2KA3A 3LA2A 2D3SA 4BU2A 4Y26A 1O4XA 5L9RA 1PYVA 3KQ4B 1H1IA 3AP5A 5AVAA 3DPUA 5JXHA 2EV6A 3CUQB 4LE3A 3J7AY 1VZ0A 2Z9OA 4ET7A 2W68A 1T56A 3DEMA 4A3KJ 1FV2A 3OYBA 3TQNA 1WMFA 1S3JA 1NA1A 4MVTA 2QYOA 1FYMA 1GFF2 3KP6A 3LFMA 4G9YA 4FQGA 1DQUA 1LE8B 2VJJA 3PJRA 2VMFA 1IRXA 4OI0A 4AD9A 3NWTA 2LSOA 1DDLA 2DVDA 5C3PA 2VZTA 1PVC1 1K5MB 3O14A 4HQMA 1JYNA 5ABJC 4L2NA 3O8GA 1HKDA 1COV2 1JE8A 4C2UA 4GIQA 4KWUA 2ETEA 4KI5M 1C8M1 4Q48A 4XOPA 3RZKA 2IXKA 1R6RA 4BBRJ 1MGTA 1F35A 1QOTA 3VL9A 1Z7S1 4LKDA 4EM1A 1YJ9I 1IRGA 4N4OB 3LSHA 3T0BA 4CDXB 3CMMA 5IVEA 2W2IA 3PTYA 2ZEZA 3KEYA 2Y9ZA 4QWNA 3LZZA 2O03A 1YQ8A 4ZYHA 2JVGA 2ZZJA 1YX3A 3TEYA 3FJSA 3O1RA 5K5OA 1S2KA 6PAXA 4R9AA 2MC3A 2QQVA 3WHTA 2AUYA 5T5JA 2ZNZA 2WO7A 3HWJA 4C2TA 2XOMA 4FPGA 3BI3A 4JV4A 3IDCB 4C30A 1E5SA 1JZ4A 4XJ9A 1P4AA 1CAXA 2ZB9A 2BQPA 4LBJA 1D3YA 2P34A 4RR3B 4XBLA 1BK0A 4BOWA 1H2NA 1CVNA 2WLQA 4AIKA 1OHFA 2RNGA 3W2VA 1VBA2 4IGPA 5CFCC 3C7EA 1R64A 2CWEA 4A42A 1QJZA 2UXNA 3WP6A 3VHOA 5A3TA 2MPFA 2R7ZJ 2VOTA 5HVQC 3WDTA 3VN4A 4BQ5A 1YLLA 3F8CA 5FD5A 3KHBA 2W1WA 1E3HA 4RMNA 1NY71 4WK8F 4NPMA 3FUQA 1NAEA 3ZKYA 3LQRA 1RITA 4BGDA 5F39A 4OHWA 4AI9A 1UL9A 3HMYA 4BXUA 4MG2A 3BT9A 2BY1A 4KGQA 2A6WA 1RUI2 5FWJA 1B72A 1QXJA 4RQPA 4LBNA 3QYFA 3RZGA 3WE3A 4CXXA 4O5VA 4PZJA 2KMUA 2VW2A 2L3DA 3AB0A 2QCSB 2RMU2 3ENRA 2ECBA 5FPLA 3GFMA 1ZBE3 3E5UA 1XBFA 4W8JA 3PHMA 3WY6A 2CV0A 2ZJ2A 3IN9A 4FP2A 5HDGA 3JU9A 5JI6A 4MV2A 2CYYA 2N8GA 2D98A 2R041 4AIDA 3S6PA 1D8JA 4AI2A 3KEOA 5JHFA 2AHQA 3AZWA 2GIVA 5DTDA 3GGLA 1T6BX 1YFXA 3KT4A 3POIA 3F6OA 2DFCA 4O3MA 1WKMA 3GF6A 2V9PA 3EHKA 4A5NA 1YG2A 3H7JA 2VKHA 5FFZA 4B7KA 3LDKA 4W50A 1EP0A 5B1BH 3IL2A 2WV0A 1PZ8A 1OQYA 4X0GA 5HLGA 4DEQA 1VBD3 4BZ4A 3MKWB 3GLXA 2QQPA 4I0WB 1VQ9I 1AYM1 4UBHA 2M2EA 4AL9A 3S1RJ 1LHVA 4F93B 3AL6A 1OJLA 4NIIA 3DV8A 1O7FA 3QP5A 5FYZA 2KZGA 1VRH2 3N9QA 2VH9A 5ISLA 4DNYA 2XAUA 4PHZA 5C44J 5FIXA 1VAKA 3RZDJ 3ZDSA 2A1XA 2QUOA 3KB5A 4XK4A 4UUSB 3Q3SA 5L7OB 2W1SA 3VL8A 3THCA 3HOXJ 2DXIA 4X6QB 4ZZ5A 4MQVA 4AR2A 4J25A 1C5HA 1U9OA 2CWMA 2M45A 1QU3A 5E8IA 3PMEA 1YI7A 5F64A 2JB8A 1JXSA 5EPAA 1RUJ1 2PAEA 2XJTA 1DP7P 1GP6A 2KRFA 4MH0E 1G3SA 2A3YA 3VYSB 1V9U2 4P55A 3PNVA 1UPIA 1URXA 4R8HA 4ZDPA 1D0HA 4BJ6C 5KHKA 3ML6A 3M4OJ 5CFDA 2E33A 3AMHA 2V1NA 3M3QA 3ETQA 4JGYB 3SMHA 1PHMA 1XMKA 4JHTA 3I0TA 1QJX3 1R1A1 1P4WA 3ZO0B 1U5ZA 2G19A 4ATEA 5BMZA 2XPWA 1TME2 2CU7A 1SVOA 3MW4A 5IK8A 4PCQA 2DDBA 2QVOA 5JOWA 1Y1VJ 2E53A 4X1EA 1F9NA 3I59B 1BJAA 5IP6A 1O4YA 3ZSEA 1JHFA 5EDNA 1NCQA 4RS5A 4G7ZF 4MXWA 3SXWA 4AWXB 2XJSA 3DBLB 2ZGMA 4HMZA 3WW2A 4H0EA 1PVEA 4FHTA 1GHCA 3MBWA 1XG1A 5E6HA 2VQ0A 1IJWC 2PHDA 1VLNA 3WINE 2PLYA 1LTEA 1RHI1 4XONA 1UZ0A 2E7AA 5TGTA 4BDYA 4FOQA 5C4JJ 3UJOA 5HI0A 3U2RA 4AU7A 1DQ2A 1S29A 2P81A 4P14A 2EIBA 2Y30A 1YW8A 3SDBA 2TDXA 1E2XA 4ZXKA 4GB31 3T4VA 3DLLF 1DCSA 3H36A 5FXWA 3RS6A 1VQOI 4Q4X1 2V6EA 1P7IA 4XLCA 3FLTA 2W25A 3PSFA 3UGFA 2E34A 2H94A 1MJ9A 4YG6A 4CDWA 4PJNA 1MVEA 3KT1A 2BP6A 1VALA 3ZOBA 3ZQ7A 3V42A 4CP2A 1V54H 1UHSA 1RYYA 4WM7B 4NWWA 1MMNA 4W65A 2YSRA 4I09A 5M5YJ 3FLRA 5LATA 4XLHA 3HOSA 3A2KA 2FSWA 5IK7A 5C4WC 3ZXEA 3F8BA 2VR4A 4H14A 3MV11 4TN7A 1UYPA 5F2WA 2VCCA 2ZBJA 3MIGA 3QPTA 4M0NA 3T3YA 3S1NJ 1JU4A 1GICA 1RKTA 2M4KA 3K1NA 4IETA 4BKXA 1B35B 2J5OA 3TO9A 4A3BJ 3BPSA 4C91A 3WGGA 3DF8A 1G9AA 1YE9A 2ZMLA 5F3IA 4BS9A 3WVJA 4IE4A 2ME6A 2VL8A 2X0LA 5K0UB 2A6VA 2WO3A 4M3GA 3TW7A 4RYDA 4A0XA 2D5FA 2QUFA 4B8XA 4PDWC 1VE0A 3BCBA 5DD8A 1QXPA 2EZIA 3SITA 2YBPA 3MD2A 3JB8A 3JZVA 3MPBA 5F6KA 2OX0A 1UX6A 3HKZN 2DCTA 5M0TA 4CEYA 4CDQB 4XJAA 3JRAA 2FDFA 3M8LA 2V4VA 2ZX2A 3N3HA 2XGXA 5LASA 2E35A 4CEWC 4ZU7A 1H1AA 4RS8A 1QU0A 3JD72 3OGVA 3KS7A 2WV1A 3HSEA 2XQRA 4YVWA 4Q4Y3 3G4SI 1RUC1 1RIOH 1CPMA 3AKPA 1GNZA 2MEV2 2J7MA 4GDFA 3VBOC 2C6SA 5DN2A 2YG0A 2PMHA 4KISA 2W5FA 1B09A 1XNDA 1LOCA 3CC7I 4QPQA 2OQGA 5AFBA 5L3DA 2KQRA 2YPJA 1A36A 3ZFEB 3B6AA 3PO3J 2OA4A 4LKFA 1QHGA 3OYLA 2M0CA 5A7QA 3A0HC 1MMAA 2HVQA 2X6OA 2FD8A 3B9IA 4OHXA 2XKPA 4IHWA 1HW2A 3AMPA 3W5NA 2OW4A 4XURA 3H50A 3PVOA 4HV5A 3L7WA 3IM0A 4EYUA 2D3RA 3ELKA 1CJDA 1CN1A 3HNMA 3QACA 4RAFA 4D69A 3BIWE 2K27A 5FY5A 1XTAA 1OLMA 2MC4A 2DFHA 3INAA 5FZBA 4BQ2A 1MS1A 4QX5A 1XGMA 4HNVA 3VDDA 1SLTA 4UWDA 2K3FA 4YEJA 2E7QA 4ZU5A 1G4DA 2WNVB 4GH4B 1IN8A 2PHXA 2YB7A 1DYKA 2AGSA 1PM7A 5F08A 3GO5A 4LIVA 2Y26A 1POV1 3K46A 1I27A 2MH9A 3C7FA 3KV5A 1LJ9A 1USTA 1PGL2 1QKQA 3Q0WA 1VQ8I 1F15A 2KIQA 2GSYA 3GTKJ 3WGIA 1CIYA 4O65A 4H3WA 5L3EA 5DG2A 2Y8KA 2I45A 3WXPA 1YQ6A 2F5DA 4B1MA 4G9SB 1W7PA 1D2SA 3HVDA 5A3WA 3OUJA 4XMAA 5ANNA 5LWBA 2JPCA 3G1LA 2XF5A 2LF7A 1V6OA 5J7MA 2BFUS 1ODDA 1GUUA 4CDUA 2XF7A 3AJYA 3OYGA 1AR81 1J1LA 1C1FA 4OOIA 3RI8A 1XYPA 4KN4X 4XOGA 1EAH2 4L0YB 5E16A 2FCTA 2G9ZA 4PGGA 4OAYA 2Z4FA 3U1DA 3RIRA 2JUGA 3KHCA 2LKPA 1NHAA 2RREA 5FY7A 1E5IA 5LRRA 3CUOA 1R1UA 3LF7A 3ZDVA 3VZNA 2AACA 3WTSC 3ZR8X 4IEXA 4YGBA 4JTOA 4ES8A 2BBYA 4Y5TA 2M1BA 1F36A 2BV4A 5BNNB 3ZXJA 3E1SA 2KIUA 3SKJE 2A73B 4HETA 4GQ7A 1ZRCA 2FQ3A 1W2OA 1AVBA 3MI8A 3OB8A 2CFOA 3NV2A 4P9UA 5IYCJ 4P5OA 2Y34A 1IF1A 3ZFGA 4Q47A 2IS2A 2EZHA 3KP3A 2O14A 3ABUA 4YM2A 4E7IA 2K7LA 2Y0SA 3V0AB 5D1IA 4P9YA 1FYKA 4JGZA 1IKQA 4XIDA 4JYKA 3BOQA 4OAZA 2JG8A 3CJIB 3LSEA 3RZJA 5IT9K 4EN7B 4V2GA 5FY4A 3LSIA 1HXS2 2HFHA 4UY8I 1VAVA 2VT2A 1Z7UA 1HB3A 1VJ2A 1LUJB 1GXPA 1OA3A 2JEMA 3HRUA 2WZR3 1JUSA 3I7DA 2AEYA 3AYAA 4CUCA 1NG6A 1OYIA 5BNPB 3O3KA 4XFGA 1E17A 1Q43A 1OYWA 3CMAI 5IW0A 2EA7A 1IGNA 2HJIA 2W08A 2W7NA 2DCYA 3QH7A 3H92A 5T3NA 3H9GA 4IO9F 5ILVA 2Z5WA 1MBJA 3M1CA 1W04A 2JENA 2GXGA 1YHFA 2Z99A 2UXXA 1UY0A 2ICWG 4QPYA 3LAPA 3IV5A 2PXJA 1A04A 2M87A 4B1LA 3KWVA 3GCMA 2F4IA 5LBEA 4YRVA 4HPQA 4LT5A 5D6EA 2E1MB 5FQ0A 1Q5OA 1UZVA 2XV4S 3OGJA 1P92A 4BMBA 1R1ZA 2CV1A 2X85A 2ARXA 1R081 3VSKA 3ZP5A 1O3QA 4IF4A 3WSOA 3I3DA 5CG9A 3TNQA 1W9WA 5CKMA 5A1LA 1QJFA 3WG9A 3AG3H 2P6SA 3WV6A 5GAGJ 3H8UA 2B9UA 2VUDA 4EVIA 2QA4I 4Q1RA 3I8TA 4KYWA 2GDFA 2COMA 5EEGA 1UY3A 3CLPA 1AL22 1RUF1 4Y20A 2HEWF 2EXHA 2WA3A 2JDKA 1MW7A 1RJ8A 3BWGA 4AFBA 2UU8A 1FJLA 2QZ3A 4U7DA 4BB3A 3I4NJ 3ZXAC 3HOYJ 4PJ0C 3OGRA 1SD5A 5JUVA 3MFAA 1IN4A 3L2RA 1Q8OA 1W0UA 3CDIA 3UGHA 4ZDLA 4V19K 2X9DA 3MW3A 1OPMA 1GYKA 3EMRA 3IWZA 5DAXA 2HEYF 2ZJRF 5BV6A 1XOYA 2OUMA 2WZ8A 3B69A 1K45A 5FLXK 1KGYA 1YEWA 5EGOB 1ZZCA 2NMNA 1OCPA 2VIXA 1JZ2A 2H8RA 4E9KA 1BI3A 5FROA 1BI2A 2JRMA 5L3CA 4P1WA 3TOBA 2KL4A 4FASD 2VUCA 1QVUA 1TMF3 1ZX5A 4FCYA 3I2OA 4YZ4A 4DYCA 1RMU3 5G05L 2L5QA 3WCSA 3M3IA 3D6EA 1TWAJ 4KIFA 2VKDA 2GNDA 5AC93 4D5CA 4D0PA 4N7IA 2X29A 2DVGA 2P2KA 3BG3A 4BYYA 3BTXA 2Q8KA 1ORKA 2LR8A 3MIDA 3T5XA 5BNOC 3OY8A 1SLCA 4I01A 1K5MA 1RXFA 1GDTA 4J19A 3C7OA 4BY7J 4TV7A 4D7NA 2YBSA 3WZ1A 3I56I 5KC6A 1LOBA 3K1MA 4XFCA 2QSFX 3NMBA 2XRLA 1BHGA 3NWKA 2NM1A 4UI9L 4XLEA 5KXDA 4Q4V2 3QBQA 2K9ZA 3TEDA 2HDDA 4ESBA 5EP9A 2QKDA 4ASNA 3DBRB 3D0SA 4HVOA 5KXBA 1UOJA 4QHOA 4LUMA 3L2WA 1JHNA 1UKGA 2R0HA 2XG3A 2E31A 3WQ7A 4NC6A 1TQIA 3BG6A 3ZFFB 5DZFA 5KHJA 3BTZA 3NNGA 4LHSA 2B46X 4YVSC 1LNWA 1DIWA 3ITQA 1XNBA 4N53A 4NQWB 1REFA 3FHIB 2K3PA 1UNBA 2E7XA 4UV8A 4EN0A 1X33A 3IH2A 1EV7A 1D8KA 2WY7Q 5FKOA 1AL0G 1BI1A 3NJVA 5HV0A 2QNKA 3VBFB 1XNTA 2YXSA 4MYEA 3B94A 3ZXLA 1Q8VA 3I4PA 3LSKA 4RR3A 2DA7A 1R4MB 4RSUA 4L11A 3E6MA 3BPVA 1H2KA 4AAXA 2R071 3K10A 4OIRF 5IT3A 3OUHA 5FPUA 3OWTA 4UXNA 2JD4A 1XS9A 1UELB 4GB32 4HPKA 2LTNA 4XJUA 5FZ1A 1Z6TA 3CF6E 2EFPA 4ZS2A 4IV1B 2MABA 1JBCA 3TOAA 4XM3A 2FDKA 3GW2A 3TB0A 3BTAA 3BKZA 3EUAA 4D9JA 5B3SH 2RAEA 2NRAC 4RN5A 2E9QA 2ZEXA 1X36A 3R0AA 1UPSA 2VBBA 4M0HA 2JJ7A 3WTZA 2IBDA 3P7NA 5I8YA 1WLTA 2VXDA 3R61A 3K70D 5F04A 3SHRA 1A6CA 2ME0A 1K12A 2UWBA 2ELJA 1D7PM 4OQ8A 2PJRA 3H5NA 4MGIE 1K61A 2G4IA 3Q0UA 2VOXA 2P37A 3HEFA 1SC7A 3H42B 5DPNA 1AR63 4AEDB 3CJTB 2M4GA 3FUOA 4BEHB 3NAPB 3DCQA 3O0VA 2WAQN 3ERMA 4QXKA 3RSJA 4QKBA 4QQHA 1XSVA 4HLTA 3BQYA 4QKFA 3FX3A 1MBKA 3ZIXA 1UU6A 3BG7A 1J0RA 2MLGA 2ZBKA 2EINH 3NJYA 1IXRC 4N9HA 3C1DA 1N47A 4HEA2 1UOBA 4ZS3A 4CGZA 4HT1T 2ELKA 1UY1A 4ZZDA 1S4CA 2JA2A 5F3EA 2NOGA 2BVVA 2ADDA 1XNCA 5E1ZB 1GANA 2RM22 2FX0A 4EZHA 1W99A 1LESA 3PM1A 3QYBA 2H09A 4PJJA 4COWA 5HS8A 3IPVB 1G86A 2PX9A 3UKTA 5GM0A 2IUWA 2GZWA 2H8WA 3S7IA 1MEC1 4PGHA 4UUSA 5L7OA 2DCJA 3CTAA 4INDA 2E63A 3RMXA 1H9GA 4XQDA 3GTMJ 2BWCA 2ORZA 4LNVA 2CGPA 4UF0B 1RUD2 4BWOA 3VBSB 4A3GJ 1HRV1 1ZBA3 2ES3A 1QJU3 3DKXA 2K46A 4NHLA 4KIGA 2EFOA 3ZQHA 2WB1N 1IAWA 3I64A 2MHFA 1YS7A 1YC61 1Q1VA 4CU7A 1PM4A 1FY7A 1AU7A 2JDHA 5FZOA 1ST8A 2E26A 2AXLA 1HXDA 2K40A 2DA5A 5C8CB 2AS5F 2LNBA 2DTWA 4MGKE 4E4ZA 1OCRH 5LY1A 1SD4A 4JGYA 4KJZA 1QWRA 4XILA 1ITYA 4P9LA 4D7MA 5LEKA 2YC4A 2HYXA 4EWAA 2BU9A 4P9JA 1FMD3 3HQXA 4JKKA 4DS0A 1QGPA 1YIPA 1QBJA 2QQJA 2IEKA 4EJOA 1XGSA 2QQBA 1DUXC 2CAUA 2FDJA 5JIUA 4KG0A 4CUAA 4GKYA 5IK4A 3VSLA 3ZQGA 1HIXA 2XJPA 5IY5H 3CMYA 1F5TA 1GZCA 3WTVC 3I2JA 4AEKA 3WX5A 3USSA 4NPLA 4CCEA 4YLZA 2VJ4A 3FXRA 3LSRA 1Y0UA 2WQ8A 4RB3C 5HBAA 1YJNI 5A7WB 4IXLA 4B4QA 2EK5A 3PQJA 3CHXA 1YJLA 2YFZA 1WPKA 1IXSB 5HLIA 2EIGA 1AR82 3RQ0A 5A33B 4RLQA 3WW4A 4AVTA 3BZKA 2A69F 1TVGA 1IGOA 4Y1ZA 2NYYA 1PMIA 2A3SA 1N3QA 1FZPB 1PGW1 2GNTA 2JK3A 3A0NA 3C7JA 4QB6A 3BJOA 5A70A 3WG2A 4CCCA 2CUFA 3P3NA 1JJ8C 4K1ZA 2LP0A 3GTGJ 3KMHA 4Q26A 2DA1A 1VQ7I 4EGZA 4YFXF 3TGNA 2VBYA 2WT2A 4NPRA 1PIV3 4DXSA 2VJXA 4HONA 1PJRA 2CYFA 1SANA 1Y8RB 3PUFA 3OTFA 1BEV2 3F22A 4B48A 2P17A 3BOPA 4GYIA 2W46A 4HK8A 2VBWA 1QQIA 5D4RA 1FNYA 4PSWA 5DG1A 3F9KA 2TCTA 3ZM8A 1SFKA 1GU3A 1HLVA 2KZVA 4CP1A 1B35A 3J4UH 3SISA 2MFZA 5JXGA 2ZMEA 3UNGC 1X1CA 2R7FA 2R7WA 3N05A 4F91B 4CPBA 1W5TA 4HVQA 3TEWA 2ZXJA 4A3ZA 1TE1B 3OPWA 3ABLH 1KFUL 1EY2A 3TKYA 5C70A 2EAAA 2HWD3 4CYCB 4UAPA 2YR2A 4ZXEA 3VBRB 3ZQCA 4BQ1A 4QWQA 1SQ4A 4DRRA 4A3EJ 2ARAA 1X1PA 3HQRA 1QVTA 1LHUA 3MUZ1 1W6OB 2FOWA 4CDQA 1U0JA 5L19A 4XMYA 2WBKA 3K1PA 3DPTA 5EJZB 3OYHA 2W57A 2A6EF 5CFCB 2NMOA 3KP7A 2HWF3 3ZXFA 4PF1A 1W8OA 3I3LA 1VQ4I 2HNHA 3FF5A 2Y0IA 2QE3A 5FYIA 1XNKA 2JMWA 1N3OA 4L0PA 1REDA 5L3FA 2ZX1A 5LGNA 2PAKA 3R0JA 1W36C 1S0DA 5BQTA 1KDKA 2VVDA 3ALQA 3ZFEA 5L36A 4YIIA 3V7CA 1ZREA 1EUUA 3QU3A 2OT7A 3HT1A 3HM5A 3A21A 1Z7LA 3ZKUA 1R092 2QF7A 5E1RA 2FOKA 4I2OA 1O3SA 3HOZJ 4OHZA 4XL9A 4OIPF 1WMEA 4CSWA 3HL2A 3K4BA 3CCSI 3FBIB 2BY3A 4WV8A 3G73A 3IH4A 2HEVF 1SZBA 4PF5A 1N3PA 4QPIB 4ZYAA 3M9AA 4N90A 1T6GC 4D5FA 2DPDA 3T1MA 2K85A 1TNTA 1RRJA 4PBOA 2WNVA 4W6YA 2HWB3 4NHKA 4F83A 2TEPA 3I2GA 2Y6GA 2DN0A 2JPBA 1ZYRF 5FZ7A 2HBTA 2HWC1 2IA0A 3SEQA 1W8TA 3HQUA 1LOFC 1GQGA 2RN7A 3Q8FA 5EXOA 3ZYPA 1S0CA 4L0ZB 2PELA 4OFGA 1WH7A 3JXSA 3HKZA 1WJBA 2BZTA 2M9HA 2CAVA 1N78A 3H3ZA 1VBC1 2M8EA 4ISRA 2WLPA 3DWLE 1ZG5A 3VGIA 2V9VA 3SCGA 2EFNA 1SLAA 5T52A 4W97A 1ND2A 2KJBA 1YW7A 1OFCX 2Q0OA 2M5WA 2A70A 4QDRA 4XC9A 4IKFA 1GWMA 3HPNA 3L1PA 2VO5A 1BQPA 3LMMA 1WD4A 4AVVA 3D5SC 5FLIA 2NLRA 5FMDA 4QDSA 1SFXA 1U5TC 4XUPA 2VMHA 3VUOA 4H4KC 1BMV1 1H9PA 2GBYA 5C71A 2K9NA 5EZWA 1USSA 1NLRA 3HHHA 5IT6A 1YWKA 2LLKA 5A3OA 1UYXA 2PHUA 2XJQA 2F4LA 5EJ1B 1LDDA 2MNGA 3WU1B 1JUMA 3LWCA 2EICA 2XAQA 4C3JJ 1G3WA 1MQTB 1K78B 1NA1C 4D7YA 2E71A 4AQSA 4IXAA 3J80K 3U1XA 3J7HA 2CQNA 2DA2A 3V0AA 5F5IA 1BCXA 2AO9A 5LHIA 4ZC3A 4UFIA 2FDGA 3QRFF 1BOAA 3O6BB 4TWTA 4A41A 3CJIA 4M74A 3EQLF 1I5ZA 1MZEA 1CESA 2RG4A 3J7ZI 4UVAA 1OQ1A 4AEMA 2ISYA 1QQP3 2PTMA 5DAQA 2RS11 2BXYA 3G1OA 3TYJA 2XJVA 4BQ4A 1XB4A 2Y6HA 2W91A 4MGRA 4PFOA 1XPWA 3GYDA 1T38A 5F5AA 1EH7A 3CJNA 5D8AA 5FFOC 3T30A 3VBHA 1AR93 4AYBA 3JRCA 3TWIA 3PL0A 3CJRB 1NXD1 3NNLA 5BNPA 4MFEA 4NN0A 2P3JA 2P5KA 2VQHA 2ZAAA 2PMZN 2G7HA 1VBE3 1I1EA 4LB6B 2OAZA 1ZBE2 3WQ1A 5T55A 1V6MA 2CW0F 1BJQA 1W3XA 3GJAA 1BI0A 4HF0A 3ELNA 5IVVA 5K1YA 5J47A 3OGGA 3CF5F 2FRHA 3WTTC 4NAMA 3RMYA 5DUKA 3NNFA 3ECHA 3IMMA 1MBEA 2HTSA 4L18B 1MMGA 2A75A 3RNSA 5C33A 4PQQA 5I0SA 1ZG3A 1BIAA 1QY4A 2I2SA 3WG3A 1XSRA 4XN0A 1DDNA 2OZJA 1BBT3 3ATGA 2VM9A 3U4XA 2DWRA 3OPTA 3FXUA 3K77A 3U4SA 3WQBA 3QPLA 1G9CA 4FQ4A 4R52A 1J3RA 4Q4W1 5J3LA 1JYWA 3ILRA 1UB9A 5H6QA 2BJSA 1VBD2 5LCWL 4EQQA 4WWCA 2FNAA 3AFGA 3ECQA 3KQRA 3M70A 2Z1DA 5FZIA 2MG4A 4XLAA 1A3KA 2VTXJ 2GXBA 1GSLA 1TNFA 3ABMH 1XE8A 4RFT0 5CJ9A 3U21A 3AXDA 1CJPA 1RTVA 4XXPA 4QT6A 1B59A 2H6CA 2EB7A 2CGNA 1SD6A 2XHNA 1SEFA 4A6OA 1UU5A 1IQAA 1S5LC 1MSFC 2V6CA 1DLLA 1POGA 2BHYA 3H1YA 3QODA 2C26A 4EMSA 2JDUA 3DYOA 2UWAA 1NG0A 2DVFA 4RQPC 3VPRA 4JKLA 1RGSA 2IA2A 3HGGA 3RI9A 1G9FA 4E4SA 2R7TA 3CC4I 1IW7F 2K9SA 5F5QA 3IRQA 3F21A 3VKLA 3OF1A 5AC91 4L5EA 2JJ6A 4PDWB 2EFQA 3T09A 5EGOA 1QJEA 4B09A 3USUA 5H2FC 2BBAA 4EV0A 3KLSA 2XGDA 2EFWA 3OYMA 1ONVA 1BR4A 2VZRA 1W36D 2EXJA 1UJ8A 3D82A 1UZZA 3BU7A 5EG0B 3SZTA 2R3SA 1QJX2 5JAXA 1JTYA 4Y7NJ 1JYCA 2OCEA 4Z1VA 4ZKTB 2HZDA 4IESA 5IVBA 1ULGA 2CFXA 1D0ZA 1UAAA 3IIIA 3BGAA 1S55A 4HANA 1BBYA 3VBOB 4BY1J 1K83J 2CV6A 3POBA 2MSYA 1XN7A 3PUBA 1LVAA 4C1XA 4EM0B 4RB0A 3C2GA 4ENMA 5J36A 1FOD1 1AHDP 2IC1A 4A3LJ 3OGSA 4MUVA 1PNFA 1SBDA 4LA3A 1SPPA 2Y0OA 3ZMDA 1G3YA 4FISA 3QP6A 2M8GX 3DEUA 1X9TA 3ERED 3J7LA 1E5HA 1T8IA 4HOOA 4QAWA 4CH7A 4Q0VA 2VTXA 5CLSA 2KISA 3CU7A 1X3ZB 2JDPA 3RPQA 1ZRDA 1YO5C 4NNJA 1BZWA 2NVXJ 3NO8A 3D1NI 1KDMA 4GWMA 3VBFA 1JZ5A 2FDHA 4BJ0A 1AR71 5H20A 3O1PA 1C3HA 1NH3A 1PVC3 2VPLA 3H0OA 2A07F 4QX7A 4QX1A 2UY8A 3H0DA 2A6ZA 1QEXA 2IPQX 4DIQA 5CFDC 2X6XA 1IPJA 5FKLA 3U75A 4DQAA 1C8M3 3B3QE 2WTEA 4AK3A 3BROA 1U3EM 4LBLA 2CQKA 2JWTA 4IQ4A 1IUYA 4KDPA 5FBJA 1X1DA 5HOOA 2EV5A 1OI6A 4IV1A 1Z7S3 5FRAA 1MNEA 3LAJA 1W8NA 4AC0A 5C9AA 3W5MA 3CF2A 3FN9A 5FZ3A 4WM8A 5J37A 4KA4A 2ZKLA 2SLIA 3JTHA 1QHHD 1XC5A 4Z92B 2CDPA 1HW1A 4DXRA 1V3FA 4CU9A 1US2A 4CCOA 2YMZA 1LRHA 3DCFA 4JP0A 5FLXZ 5K5QA 1NCQC 4N43C 2R49A 4RS5C 2E60A 2W00A 2B7YA 4HDVA 2XWBB 2XUMA 3GZEA 5CB7A 2BUKA 2D6KA 4AG4A 1L3JA 5A6QA 4XKCA 3PFIA 1JN2P 3VEPA 4P00B 3RQ4A 2BNMA 4Y4RA 3O1OA 4RGAA 3VV1A 4AEDA 1F4HA 4R79A 1GNHA 4BK5A 4LE4A 4BEHA 3CCRI 4MO3M 2VT3A 3NAPA 2CW7A 3VZOA 5AVPA 4XRSG 4JDMA 1QNTA 1VMJA 3MAJA 3EUHA 5LZ6A 2P5VA 1S0IA 3J8F3 3K2OA 3VD5A 4IUGA 4Q4Y2 3RFRA 2Y38A 5IP9J 2HU9A 5DM6F 2LF8A 4YW6A 3PU8A 4DXTA 2FBKA 1A35A 5FUNA 1T98A 2WNEA 4E4DX 2ZGUA 2HQNA 1P6RA 5DV5A 2W95A 4JQRA 4NROA 3AL0C 1CQTA 2R1BA 4CDWC 1LHWA 4CP9A 5DEQA 1Z9CA 4BQNA 1SCSA 3BDDA 3PSIA 3IAPA 2FMDA 3WNMA 4C3IJ 1ZZ7A 1U2WA 5A80A 2XROA 1GZ9A 2BGOA 2M34A 1M06G 2O9LA 1IQDC 2E6VA 2DPUA 3I58A 2ZSIB 3ZMVA 1BR1A 3THDA 3QPSA 3M3OA 4X8NA 4EJRA 4IW3A 3PIPF 1FSHA 4A7YA 2HH9A 3BCWA 1RUH1 1O3TA 2R043 2JDNA 1C57A 1IPSA 1ZARA 4XKBA 4FFFA 1T39A 3TW6A 1EKEA 4M72A 1HQLA 2WNOA 3LQQA 2XGEA 3VBSA 3EYYA 4HG6B 3U10A 4GKXA 5K4LA 5A3PA 1MS0A 1A78A 1J58A 3E6CC 5LY2A 1YHQI 3GFJA 1MBFA 2DDUA 2ZGOA 3KLOA 1VQPI 3UL2A 1PVXA 2JA7J 2E2HJ 2K9QA 3ZCOA 2VPRA 4YM3A 2WABA 4YW7A 2VMGA 2Y6FA 3GZ6A 4CEYC 1V55H 1AYM3 2B9VA 2IVJA 2RJLA 5C8CA 3H9JA 3AMNA 3B6CA 4E6KG 2OUJA 2WAQA 4XBFA 4AIJA 1DPUA 3LOIA 4G7HF 4XXAA 5DUWA 4CP0A 5JCTA 2OJED 4YVWC 1H88C 3HDDA 1OVSA 1WJFA 2RDNA 4HNTA 1IDYA 3RYPA 3LGRA 5GKAC 2F5VA 4A69C 3POJA 4ESJA 3W59A 2F6BA 1XGOA 1WZXA 3UJQA 2DAOA 3D0JA 3WGHA 1BKZA 1EV13 4FFIA 4IEVA 2KRCA 1TWGJ 4NIGA 1YRNB 2YPRA 5GAHJ 1RUJ3 3WUCA 1O3RA 3QYEA 5F5CA 1UOGA 2QSGX 3MN2A 5FP9A 3FISA 2WC2A 4COYA 5A7WA 1LECA 2WKKA 3V0BB 3TDUC 4MHUA 1PIV1 3C8XA 1JJ6C 4HV6A 2HWE3 3O12A 3ULQB 1JYVA 1WSUA 2EILH 4LLLA 1D4M3 1SLLA 4YFZA 3OEAA 5D5UB 1D2QA 5E79C 4ZYDA 2XBO1 4ESFA 3VDDC 1L3LA 1RETA 1JS9A 2TRTA 2K02A 3O0WA 3N4MA 1H8AC 3ONQA 4AHXA 3RI4A 3L00A 4N0BA 1R1A3 2IFRA 5L9BA 2NOJB 3BN6A 4ZJZA 1DYPA 1CQ9A 4LULA 4BE1A 4KT5C 3I3BA 1FBQA 2VVFA 1EF4A 1I3QJ 5FWEA 2WZR2 4H55A 1J09A 2CH0A 5BNOB 3OBTA 1FIPA 3S2WA 4UVCA 4AF9A 4H2AA 2XRNA 1W0NA 1JMUB 1JXNA 4NBQA 3RWNA 2R7QA 1PO23 2I74A 2G1MA 2VJIA 4LA2A 1T0FC 5HPOA 1YW9A 2VBPA 3HC7A 4G8XA 4A0YA 4HXCA 1RHI3 1K4SA 4IV3A 4P08A 1FPQA 1IKPA 1POQA 3I2DA 4BXFA 5E3OA 4CDUC 3E0JB 1IS6A 2QDRA 4IE7A 5FGMA 1RVF1 4LBMA 4WXCA 1C8NA 5LK5A 5ERIA 4YVSB 2L9NA 2JE7A 3PVEA 3KV9A 2A6YA 4UFJA 4Q4X3 2D5HA 2IXHA 3ISPA 3A01B 3LD8A 5EZHA 1IHMA 2H1KA 2XAHA 4XLPF 3VBRA 5JSRA 1YI2I 2FDIA 1FWZA 2OPWA 1JUHA 4QXHA 4P96A 3VZMA 3WF3A 2UY9A 1ASJ1 5LA9A 4AI8A 4ZTFA 3ZFGC 5JHUA 4NHXA 2R061 2WNUA 2Y6LA 5L73A 5CFCA 1JKPC 1VMHA 5K7FA 1DU3D 2DO7A 4XTMA 4RGGA 4AGRA 3H9QA 3NRUA 3S3OA 4JGZC 4Q0UA 2DMPA 3AKSA 3F3XA 4WBBA 2JG8C 4YM1A 1XCVA 4B4RA 4FFGA 1UO9A 1GMMA 2QQUA 3SFIA 1REPC 3ZYRA 3U78A 1OOPC 5CKQA 2W48A 3N36A 4ARXA 1S8NA 4HX4A 2YGLA 5GALA 2CUZA 1YI9A 2DK5A 1F9KA 3H1WA 4ENNA 4W4ZA 5JI9A 4W6WA 1XDSA 5AONA 4AHYA 4IEUA 4L5JA 4NC7A 4KU8A 3FFQA 4XHBA 3NAUA 4DO0A 2DYCA 1UY2A 3UKVA 1FV3A 2F4PA 2AQEA 1DG6A 2C6YA 4QPIA 1TMF2 2XIGA 1RMU2 3K2ZA 2XWJB 5KR7A 1MJAA 5ANQA 3M8EA 2OZUA 1RUC3 4H7LA 5AC92 2FF4A 1W8HA 2FXAA 3V64A 3GZAA 1ULEA 3L9JT 4XOTA 3HR9A 1W9TA 3R4SA 3NARA 2NXNB 5HV4A 2WYFA 5CYVA 3ZLIA 4LEJA 1XPXA 4GO1A 4XFFA 1J75A 1UX7A 2V9KA 5GZFA 4MNUA 1E0EA 3A03A 2VC1A 4DJAA 1ZELA 1JW6A 2QQAA 4CCKA 1KJLA 4ZHNA 2VOKA 1AA7A 1SACA 4GJYA 2D93A 4XCAA 1LENA 1S9HA 1QZEA 1IS5A 1V00A 2ZGLA 1IUFA 3V56A 1WW5A 2EZKA 4Q0QA 2VONA 3IT8A 2OTLI 2HQAA 3S16J 4KNCA 4KIBA 2R4GA 3HYIA 4PCRA 2DMQA 3VD3A 3RKQA 1RUG2 1Y4WA 3LEKA 3LE0A 3VOEA 1Y9QA 2XF6A 2W84A 4A6SA 2QSHX 1W8WA 3ZN5A 1IZ3A 3BCAA 2P5BA 3I2HA 1POV3 3FXKA 4TLGA 5TJJA 4XLFA 1FI2A 4IDZA 4KBBA 1RESA 3CZUA 4XJWA 2A05A 1WCDJ 4KGGA 4V2VA 4XQWA 1IS4A 2MD0A 2F5CA 2BHZA 2X1DA 4F7ZA 3Q9SA 5GPAA 3M7AA 2WAFA 1QQP1 4ONUA 1OVPA 5FRMA 1S0EA 4GZ9A 3UESA 5TISC 1ULPA 5C6CA 1ETYA 4RHV1 3ROUA 2XR4A 2DTYA 2HYJA 1U9NA 4GRIA 1MQTA 1K78A 3VHPA 2V1XA 4KBZA 5H9QA 3KGZA 3ZYGA 1PO11 4Y1YA 4FO9A 2QLZA 1HKSA 2RJ2A 2J5PA 4D6SA 1OC1A 1MH3A 2XLAA 1K6OA 3M1HA 4WF2A 4FPCA 3PNTA 2R6QA 3Q9VA 4AHWA 4M01A 3I97A 4P9XA 1K5MC 3GNEA 5J3UA 3RKXA 2WA4A 1CF7B 1VRBA 5DZGA 1YIJI 4MEYF 3JRFA 5FZ4A 5K5RA 1DBNA 1GWLA 3CL1A 4ZH4F 1HJGA 3PVNA 4LUKA 3OPZA 4XJZA 4L99A 2O6GE 2X5IA 5T54A 2Y60A 1U8BA 2W47A 3GVAA 1AR62 3H8OA 5FP8A 2F17A 3ZYIB 1ZRFA 4DRVA 3QOPA 4E8DA 2ZKNA 3ABZA 3DL3A 5A1FA 2D5VA 1EYBA 1QMJA 3A7QA 1P9QC 3OMYA 1W4MA 4N53C 2OS2A 1ZH5A 1G8WA 2Q8CA 3OYWA 3JRIA 2J42A 4QTRA 3DFGA 1KZHA 3MCZA 2WWSA 1TZLA 1XYNA 3VD7A 1P4XA 4UVBA 5EYYA 5FLMJ 1W7PD 2JIGA 1XD7A 1VQMI 4RR3C 5E88A 4QPOA 1G3TA 4FVVA 2WFF1 1PUEE 1I3AA 2FUG2 5FAXA 2GP5A 5FO9B 4LO7A 5FMBA 3VKNA 1OSGA 2E7TA 1HW5A 1UMIA 3L2HA 1BJZA 3DLAA 1ZYBA 2EPFA 5JWPA 4QX2A 2JQ7A 4DY5A 2BVMA 1A8MA 4B3NA 2O7OA 5C8WA 3KX2A 4K9SA 2M7BA 1KA8A 5BPIA 3FM3A 4HX7A 5A3UA 1YOVB 2HQRA 4CHUA 4UFMA 2SBAA 3VKFC 3EETA 4WX9A 4ZTJA 3UKGA 3J81K 2E7WA 1ZBA2 1QJU2 2DOEA 3DTKA 4PQ9A 2H0VA 4U7BA 1LKXA 4Q4ZF 3WEZA 2B42B 1FAYA 5JIAA 5FLJA 4A2UA 3E97A 4E2QA 4B3XA 1R083 1UG0A 2XAJA 3CCUI 1GV9A 3ETPA 4PDWA 5FOBB 3JAMK 1ENXA 2PMZA 1J9IA 3O1SA 2YHJA 4R4ZA 3PUSA 1LKNA 4Q5OA 1JT6A 4JRLA 3POSA 1M1EB 1FYUA 4DBQA 3CO2A 4ZYEA 3GX4X 3GCXA 4O61A 1FPN1 2JG9A 5CU1A 1OUSA 1B4AA 4AUXA 1ETOA 2X1EA 1DZQA 5FV3A 1ZZ9A 4HN1A 2K9LA 5EG0A 4M3CF 4PBPA 2Y6JA 3VHNA 3DU5A 4XJ8A 5E3MA 1MS3A 1WD3A 4NHMA 3CJQB 5LA2A 4WVWA 3ZRGA 2HEOA 2VU9A 4M3BA 5CISA 1C28A 1PX3A 1NLSA 3IZOA 1HN0A 4XUTA 1FMD2 5LBCA 2QZ2A 2RS33 1ETQA 4U0VA 5EZGA 3VBOA 3VDCA 1B1BA 4BXSV 2VN2A 4XRMA 2BW3B 4PDKA 3ZQQA 1MMSA 3WNPA 3OYFA 5FKKA 4LO4B 4K8RB 2IA1A 1H6YA 4ITCA 3OYCA 1ZG1A 2KPMA 3FM5A 4E2SA 2IGNA 1JI8A 1D1CA 4M73A 4LG0B 1NYWA 3QAHA 5J40A 5FPAA 1T6SA 4YZ1A 4NR1A 4M6XA 3NWSA 4E27A 2BDRA 5L7OC 4HA8A 3I4IA 2NPIA 1ZR2A 1JOBA 1KQ9A 5FZCA 1K7AA 3VODA 2XL9A 3WU2C 5E1XA 2LS6A 3MIFA 2OQRA 4AEJA 1HQCA 3OEBA 3VHRA 2X51A 1U6GA 2LMDA 3WHUA 3TOJA 3CLQA 1WBFA 1J3PA 4K1YA 2QJVA 3CCMI 2ZAHA 2Z79A 2XPUA 3KM5A 1PIV2 3FBYA 3WP3A 3BG9A 1TNRA 2FHRA 1LFBA 3CCYA 2P6HA 4E7JA 3JBG1 4XKWA 2KD7A 4XUOA 3U11A 3HEIA 1LQ1A 3QCWA 4QGNA 2AZ5A 4JGYC 1NXMA 2EV0A 2XVGA 2Q8EA 3B7MA 2O8OA 1F4AA 4Q8LA 1VFCA 2KIFA 3HRMA 2MYSA 4JZRA 1KXGA 3C2HA 1DZRA 3K4AA 3BR6A 2Q8DA 2R7OA 1L7QA 1HQNA 2NVQJ 1QPIA 2YU9J 4Y1UA 5LBQA 3SC7X 2B9SA 1CX1A 1W1WE 3DGTA 3J8F1 1P2FA 3ZR5A 2JD9A 5D2AA 3JRHA 1ZKGA 3FK7A 3SXYA 4GFBA 1FTTA 2RS53 3S14J 4BJTA 3WD5A 3S17J 1MKMA 2HWD2 1XMAA 1U5TB 3HG9A 5GZEA 4F3QA 5CBLA 3GTPJ 2L9VA 1X3WB 4XDOA 5KHIA 5ACA1 1K42A 4O6JA 2WS91 2AC1A 1HB2A 2JE9A 1U5IA 2H27A 1IDZA 3Q5FA 1GT0C 2R073 4NUBA 4S2DA 4A3JJ 4FTEA 2KR2A 2NP0A 2HWF2 2FMLA 3KYCB 2XPVA 3DEEA 1NA1B 4FBFA 1AX2A 3KT7A 4EJVA 1QGLA 4IEWA 5IUQA 2PYTA 5DUUA 1OISA 1OT5A 5A7NA 1G59A 2QQIA 2E5NA 1AF9A 3D3AA 4DOUA 1BVVA 2FNPA 2AH2A 2VMDA 3RJ2X 5JR7B 3HBZA 4AVSA 1U5YA 3O7OA 2VPVA 3AM2A 3R6SA 2VQGA 4CCNA 4AZZA 2P4WA 2PLV1 4GMP0 4OVEA 3WDXA 3ACIA 4AVPA 4DBRA 2XVCA 1JGGA 1B35C 1OA2A 3MF6A 4GXOA 2HZTA 1GP5A 4IEYA 2ZMEC 3CCLI 2OXBA 2NYXA 2XVLA 5DDGA 2KXLA 3WOGA 1KS5A 4DUWA 3BTYA 5FYHA 4LORA 1VR3A 1FXZA 1Y56A 1LOGA 2A6HF 2HYFA 3FIWA 4HX8A 2HWB2 1VTNC 1H1MA 1N25A 2IT0A 4RL7A 3HSRA 3MYXA 4YARA 3ZN0A 3VZKA 1NCRB 1ZR4A 1AX1A 1A31A 4NRQA 5KWRA 1MZ6A 1W90A 1FP2A 1LULA 5ERLA 4N8MA 1JOJA 4IVNA 3SQNA 1HRI1 4DFSA 3SEZA 1ACCA 4B1RA 3N9PA 1HX6A 5HCHA 1ZRIA 4AM3A 1WW6A 2J1TA 1OR7A 3L09A 3VB2A 1ZLKA 4L9BA 1EV11 1PUFA 4CDQC 1WCSA 1DGLA 4QLCU