4CCLA

X-ray structure of e. coli ycfd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
372
structure length
371
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S RIBOSOMAL PROTEIN L16 ARGININE HYDROXYLASE
total genus 79
structure length 371
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4cclA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4cclA01
5CEHA 4HOOA 5FYTA 3K2OA 5FUNA 2P5BA 5F3CA 2XDVA 2OQ7A 5FZ0A 5FY4A 3N9MA 5IVCA 2Q8CA 5LWBA 4GAZA 2WWJA 3K3NA 2YBPA 3PUAA 5A7OA 4CSWA 3U4SA 3PTRB 5IVEA 5FZ8A 4BXFA 4D6RA 5FZCA 2OQ6A 5FY7A 5LY1A 5F3GA 2Q8DA 5IVFA 5FZ9A 4GJYA 3RVHA 4TN7A 5FZAA 5IVBA 5F32A 5FYVA 4XDPA 2Q8EA 2YBKA 3DXUA 5FV3A 4CCNA 5FYIA 4URAA 5FY9A 5FZMA 5F37A 4Y4RA 3PUSA 5ISLA 5FJHA 3PUQA 5FWEA 2XMLA 4QX8A 5FZOB 3ZPOA 2YPDA 5F3IA 5IWFA 3U78A 3OPTA 5FYHA 2OX0A 5FZ3A 3KVAA 4EYUA 5FYBA 5F5CA 5A3NA 5FPAA 5FZLA 3ZLIA 5FZ1A 3N9LA 5FYZA 5FZGA 4AI9A 4CCMA 4LITA 3PURA 4XDOA 5FY0A 5FY1A 5FP8A 2OT7A 4BU2A 5A80A 2XUEA 3AVSA 3KV4A 5FP3A 5FYCA 4BISA 3KV6A 1VRBA 4CCJA 4CCOA 5FYMA 3N9PA 5FYSA 2YU1A 5A7PA 2OS2A 4LIUA 5FPLA 2W2IA 4IGQA 3N9NA 5IVVA 2YBSA 4Y33A 5IW0A 5FYYA 5IVJA 2PXJA 4CCKA 4QX7A 5FXZA 4CUGA 5A1LA 3PU8A 3KV9A 4E4HA 5FYUA 5FJKA 5F2SA 5A7SA 3OPWA 3KV5A 5FWJA 3K3OA 5F2WA 2XXZA 5K4LA 5FPVA 4HONA 5LW9A 5FXWA 5A7WA 4EZHA 4QXBA 4IGPA 3LD8A 3PU3A 5FXVA 5A7WB 5F5IA 5KR7A 5FZ7A 3DXTA 3N9QA 5FZEA 4V2VA 5A3PA 5FY8A 5A7QA 4C8DA 5IVYA 4LIVA 4D6QA 5A3TA 2WWUA 3PDQA 4IGOA 4LXLA 5FXXA 3AL6A 5E6HA 4GJZA 5FZ4A 5FP7A 4QU1A 5ANQA 4V2WA 5F3EA 4UF0B 5FUPA 4AAPA 5FZKA 5FZDA 4ASKA 5FZBA 4QWNA 3AL5A 3NJYA 5FZHA 4UF0A 5LY2A 3AVRA 3UYJA 5FZFA 4EZ4A 2GP3A 5FY5A 4DIQA 4DO0A 4D6SA 2GP5A 2YU2A 5FP4A 4Y3OA 3N9OA 4QXHA 5FZOA 3LDBA 5FBJA 4GD4A 2VD7A 4QXCA 3KVBA 4NUBA 5A3WA 5FPBA 5FZ6A 5FPUA 5F5AA 5F39A 5A1FA 5A7NA 4CCLA 5FP9A 5FZIA
chains in the Genus database with same CATH superfamily
2GMPA 2P1BA 5JOYA 3K2OA 1PJRA 1VBE1 2IA2A 2YUSA 4E4SA 3ZFEC 1AX1A 5KXCA 5EYRA 2P4WA 3QH6A 4B1RA 4ZONA 4PT6A 5A6ZA 4JCKA 4KL1A 3PUQA 4Z6YA 5LLQA 2CDPA 2WN2A 3WTYC 5FZ1A 1AUYA 4LO8A 3WW2A 2JTVA 1IGOA 3BB6A 3G4SI 2N7GA 5I8SA 4PCRA 3RZOJ 1YYNA 4LNVA 1RUH3 4CPBA 2VT3A 4GA9A 3JSOA 4F7ZA 1U9NA 3VWBA 3RKWA 2FQPA 3N7KA 2CDOA 3LSTA 2VC1A 2VCAA 2EA2A 3JD72 3KEYA 1Y43B 3H3VK 2JA2A 1C1LA 1JHFA 3V65A 2ZS6B 2FQ4A 2PAKA 1O3TA 1UKRA 1UL9A 2HWC3 4DXRA 5K7PA 3CC7I 3N35A 2IS6A 2G9FA 4ZXKA 3G1OA 4B43A 4L0ZB 2A73B 4XOGA 1R092 3K4NA 2HZDA 4IE5A 1SVLA 4RQPA 5D5VB 3QWLA 3LSJA 2BEOA 5JR7B 4AEKA 4IQ4A 2CTVA 3GBWA 1R58A 2PAMA 3WNKA 2EV5A 4QXCA 2A1XA 2XAQA 4WK8F 1AR83 3NO8A 2P5LC 1DQUA 2X6OA 5B5EC 1S7OA 2VZ3A 1VE0A 4KIFA 2GXAA 1UW8A 5A6YA 4KGGA 1FPQA 3WE2A 2OQ7A 1H9GA 4XLAA 1DF0A 3FM5A 3I4NJ 2KD7A 2YBPA 3NAPC 2VBBA 3HGGA 3U4SA 4BXFA 4XILA 5J1RA 2VVDA 5KC5A 1S0GA 3UV9A 1HN0A 2JKXA 5FZAA 1MBHA 4LK0F 2NQYA 4W8JA 2A05A 3MIBA 3VDDC 3HTSB 1S0DA 5HXVA 2WNVA 5T5LA 1UMZA 2VBYA 4W1UA 3S2DJ 3KFWX 1SFEA 1S4CA 5KVRA 5I0RA 2IS4A 1MSEC 4B44A 3HJRA 5D8AA 1P6RA 3BVCA 4AVTA 1NA1C 1RUC3 3K77A 4Q4Y1 5EHDA 1UY4A 1DGWY 2J22A 3O1TA 3GDBA 2L54A 3Q0WA 1YO5C 1ZGJA 2OQGA 1DHKB 5JI6A 1YX5A 1Y1VJ 1YW9A 3KB5A 1NCQA 2EB7A 3FZ3A 3FXKA 4M73A 2IUWA 1AOYA 1IN8A 1YNAA 3J7YJ 2LKXA 4JX4A 5E6HA 4KUMA 1URXA 2V09A 3NNLA 1JKQC 5FBZA 4COYA 2DVGA 3WU2C 4LHSA 4EQQA 4LBNA 4QB6A 2R32A 5F9TA 5DD4A 4BQXA 4AGGA 3RSJA 3DYPA 2ZJRF 4Q47A 4EN0A 5A2QZ 2GH2A 4G7ZF 1PMJX 1OC1A 2IFRA 4XSXF 4KH9A 5FZ0A 3BJOA 2PQ8A 4OI2A 2V26A 4IDZA 3K3NA 5T5PA 4XSZF 3SXWA 3USUB 3RTRA 1X1CA 4JQTA 1ZVFA 5F32A 1RITA 1TLHB 1LVAA 3BQYA 1CVNA 1GP5A 3KLNA 1DPUA 2O61A 3CO2A 2BY0A 1JUPA 2AO9A 1UYXA 2KZVA 1OSGA 3KQ4B 1V5EA 1TWFJ 2X29A 1IO2A 2EAKA 4MQ9F 3ZX7A 3ZR5A 4P9WA 5C9AA 4N53C 4EJRA 3ON7A 1XPWA 4XQ4A 5C4WC 2BU9A 3GYDA 3V8KA 1SLCA 5JVVA 3OGGA 3PFYA 1ZBE3 5FXZA 1Y1WJ 4NO4A 3WTSC 1RVF1 1P7IA 2ET1A 5DDJ1 2HI3A 3KV5A 3IRQA 3AZWA 3H36A 5EEGA 3VDAA 4IEPA 1ND3A 1XSVA 2FXAA 4EN8B 4XZUG 2WWUA 1ODMA 1EV11 1LOFA 1ZBA1 4LG0B 2R071 1Z21A 1PO22 1TW2A 4Q0QA 2DCTA 1VLNA 3T5XA 4KN4X 2BY3A 3LA2A 2VL8A 3B69A 2P81A 2EICA 4YZ4A 2FZ1A 1RL3A 1N1TA 5LB6A 3ZMNA 2BE5F 3OYHA 2FD8A 1QHDA 2WY7Q 1UNBA 3EUAA 1KONA 1K12A 3I2HA 4D0QA 5IFTA 1OISA 3KD4A 2ZNZA 3VOEA 1F31A 2PLYA 3K4ZA 1QNTA 4AUXA 1K78A 2LY1A 2QWWA 4JGYA 2B7EA 1LHVA 5IVBA 3KGLA 2V5DA 3PUSA 1G86A 5FLJA 1HBXG 1IRGA 3CHXA 4HKLA 3ISPA 3MLKA 1CIWA 3PUHA 3MW3A 1JHNA 2V5YA 5FDBA 1B72B 5FZGA 4LB6B 5FD5A 1PO12 1GXPA 2LH9A 1DCSA 1XD7A 2RS52 3S30A 1DP0A 4Y33A 2PXJA 1X82A 2PG4A 5HLHA 3B9CA 2OA2A 3J81K 2BBVA 4CDQA 4UAPA 1CONA 2QM3A 3WTTC 2WQ8A 1G7YA 1GWMA 3OSDA 2H94A 4IERA 1T8IA 1IRXA 3ZRGA 2JENA 3ACGA 4FX4A 1S0CA 4PDWC 4QD2A 2IWGB 4OHVA 1TWHJ 4QU1A 1QZZA 5FUPA 4FFFA 4CP9A 1L7QA 1PYVA 2YUEA 4WZCA 2WNEA 2WZPP 4HQMA 1ASJ3 3ES4A 1QOOA 2DMPA 2QBXA 4Z1VA 3OIQA 2LTPA 2C6SA 5H6RA 2YV8A 4Y22A 5FK8A 2NS8A 3ZXJA 3CF2A 2H6BA 1OPCA 1BBT3 1JYVA 1V55H 1K7AA 1BM9A 2XDVA 1JZ2A 2ZGOA 4OI4A 3A2KA 2OZUA 1VB2A 2NOJB 4RR3C 1X8MA 2DVBA 1IUYA 3VKOA 4YNIA 4LJHA 1HQCA 4F91B 4C0HA 2W5FA 3POEA 5BNPC 5E1WA 2ZGTA 1RVF3 2JSPA 1G3YA 5DDJ3 1IS6A 5FWEA 2QQPA 1E57A 4P9YA 4IOAF 4XMAA 3GFLA 5CBLA 5CFDC 1EA3A 5FYZA 4H2AA 5H9RA 2VOPA 3A0BC 4OMZA 1L0OC 4WM7A 4QGMA 3MFCA 3VYRB 1R081 4H55A 2ERFA 4JGZA 2Y0MA 5FYUA 1OLME 2CL2A 3QYEA 1MMNA 4BYYA 5JI7A 5F27A 1LEMA 1CAVA 4X6RB 5I8TA 2ZNYA 3M8JA 5E18F 3RWNA 3CJIA 5SV8A 5LRRA 4A93J 4GFBA 2DMUA 1UY3A 3MHZA 1O4XA 3OIPA 3THCA 2VXDA 3TKYA 3O1PA 3MUZ1 4YEJA 3FF5A 4HVQA 3VZNA 2H1LA 3HBZA 1FYLA 5EXOA 4U0WA 3RZZA 4MGTA 1QQP2 4WM8A 3LPGA 4JTOA 3VD4A 5FZOA 4HMZA 1I27A 5FZ6A 1ENHA 2ZZQA 5F08A 2DOEA 4XK4A 4JTNA 1YFWA 2X48A 2O14A 3LNQA 3CKHA 3RS6A 5E1ZB 3JAMZ 4IQJA 3H50A 5FUIA 2E2IJ 3S3MA 3ECQA 1OYWA 2BWAA 4ZHNA 4H7LA 2RQQA 4IHVA 3LSDA 3BCBA 3RJPA 2VZVA 3RYKA 3R61A 1POV0 1AHSA 2BW8A 3D4KA 1CR7A 2BJSA 4LOSA 1NG6A 2J1SA 3KP6A 2V72A 4E8CA 1BI3A 3MQ0A 1LU2A 3U10A 3WUCA 4A44A 4A6DA 2R7SA 2TDXA 1HRV1 1QJU3 1XGOA 3WP4A 3SCFA 4YVSA 5L3CA 2DA2A 5GZFA 1USSA 4BOWA 3IAPA 5KHHA 3BGAA 4QPGB 1ZG1A 1O3SA 3BUCA 3SJMA 3KZZA 4BM8A 3HOVJ 1SD7A 2DW4A 5EYYA 3BIEA 1R6RA 2DYCA 4D69A 3RQ4A 4CEWB 4FP3A 1SD6A 2G0EA 1W9SA 2ZMEA 5CISA 1UMQA 3J7AO 5FZKA 1DZQA 1KQ9A 4U36A 4Q29A 5HDNA 1WW7A 1EV7A 1LJ9A 1FI2A 4M3CB 1YWKA 3C8XA 1JKOC 5BNGA 2IGOA 2WZEA 1ZHFA 5FOJB 4LKSA 3ZSKA 1OKRA 4CXWA 3VBFC 1VMHA 1UXXX 3EYPA 4GB33 2QQJA 3GCMA 3HG9A 1EPZA 4LKDA 1HDDC 3IDEA 4PLNA 2E1MC 2JMWA 5CA6A 3CUQC 2G1MA 5D5XB 2YBKA 4IEJA 1LCLA 2BBYA 3VDDA 1W7PD 2LY2A 2FOKA 4JRAA 4JGZC 2WO3A 1I1GA 3PFIA 3NWKA 4NHLA 5A33B 1EH7A 1NYWA 2HWB2 3EQLF 3M3CA 3TRSB 1WCKA 2NMOA 1BEV2 3ZMZA 1F15A 4OUSA 2FDGA 5J4VA 1PK6C 4IRIA 1IV6A 5FXWA 3CTAA 2JDUA 3ABTA 1MS9A 2EFNA 2XGDA 2BTVC 2O8QA 1X2NA 1AYM1 1SACA 2CG4A 4NC8A 3THDA 3VDCA 4M72A 4MUVA 2Q8KA 3VBRB 3GTKJ 1JUSA 2B5HA 2YFZA 1MS1A 1ZQ3P 3DU5A 3L1PA 4D8MA 3T0BA 4YZ1A 4Q4Y2 5HI0A 2DYRH 3L2QA 1WI9A 2FCTA 4RS5A 3IH2A 1Z9CA 3D5SC 3MZYA 5FPUA 4HLTA 3WHUA 1H4HA 3UKTA 2VQLA 2N8GA 4LK7A 5JXHA 2QKLB 2B9VA 5KHIA 4A69C 3QCWA 4BQ5A 5EJ3A 3SMHA 3W59A 2JPCA 1NLRA 5IUQA 3HWJA 3ZIWA 1SZBA 2VE8A 1WQ2A 2F48A 2RJKA 2YPDA 4M6YA 2V1UA 2V1XA 5JPMB 1LOGA 4PBOA 1LTEA 3O8GA 4HANA 2UU8A 2X05A 3DTEA 4G12A 4ORFA 5LBQA 3N9NA 3S15J 4Q48A 5KHJA 2TRTA 4GRIA 5HCFA 4UXNA 3VDBA 1TVGA 3GNEA 4E9KA 2QBYA 3ABZA 2WA0A 2JWTA 1ETQA 3O7OA 5CYYA 3NRVA 1CAWA 2HYKA 3BR5A 4XLPF 3HTUA 4QXBA 2QZ2A 2I74A 2V4VA 1WLDA 1VQ5I 4W6XA 4XF0A 3OYBA 2ETHA 4QPIA 3INAA 1PM7A 4KMQA 3S32A 4ITVA 4OMYA 2B9SA 3AFGA 3MVPA 4AYBN 3HPHA 4PF1A 4AU7A 1IKQA 2D1VA 4BQAA 4L5IA 3ASOH 3MV11 4X0GA 4UB6C 4CA0A 5LASA 1XGMA 1LNWA 1JMUB 5JXIA 5JFRA 3HPNA 1Y8RB 1UN1A 3PNVA 2FF4A 1U2WA 3BN6A 3PUAA 4CHUA 3O1SA 3F23A 1ULDA 1W6OB 4K1YA 1FNYA 1GQGA 1CAUA 4AIHA 3ZKYA 2FZ2A 1YX3A 2L9NA 1SFNA 2DFIA 3BTLA 1LGNA 4NN0A 1HXS3 1FOD3 5FYBA 1AR71 2F17A 1ZG5A 4AI9A 4FAHA 3V0BA 4IV1B 2LKSA 1R1A1 5KHKA 3T8TA 3JBG1 3FHIB 5F7UA 5A7PA 1AU7A 4IGQA 2QFEA 3VDDB 1H89C 2D5FA 1H2KA 3IHUA 5HLIA 2VC0A 1RUD1 2WV0A 4MO3M 2OC6A 1SPPB 4EN9B 5IP6A 3BKZA 1UZYA 5ANNA 4E4DX 1ULGA 4E8DA 5GAHJ 1RUE3 4DOUA 4OQ9A 4AXOA 5TRDA 3WDYA 2HWF1 3FMRA 4LBLA 4BQ2A 1DGWX 4S2FA 1H0BA 2RS51 1W6NB 1CIYA 3O3KA 2KXLA 3WW1A 1BC7C 3DEWA 4WM7C 1MIJA 4OHXA 3TWIA 3JCUC 2XF5A 1MEC2 1MZ6A 2WAFA 2J42A 5A70A 2MHFA 2WS93 1MMDA 4HK9A 1JUHA 4Z92B 1ULCA 3RGBA 2HXIA 3A0HC 3WR0A 3EUHA 2IC1A 5M0TA 2XGCA 2D3SA 3IUOA 4LT5A 1SMVA 2PQSA 5LD2C 2JB8A 2XJSA 2LBFB 3WTUC 3U07A 3K6GA 1KA8A 2DOAA 3C7GA 3URFA 3CLQA 4LEJA 2YZ4A 4YYOA 4NRMA 1KU2A 3RQIA 1Q56A 3PURA 2J7MA 3AVSA 1MVEA 1IC8A 4YZ2A 3EO6A 3TO7A 1KGSA 4DFSA 1PP8F 1U5ZA 4QGNA 4C9YA 4RGXA 4Q0SA 1GUUA 4GXLA 4RR3A 3EUKL 2QQNA 2ZFWA 3MW2A 2VNVA 1JHJA 4W6YA 3QBQA 1A34A 3QYFA 1VTNC 4EJUA 5ACA3 3EETA 4ZZ8A 2HVQA 3O14A 4NJ4A 3T4VA 4NAMA 4RAYA 3WNOA 5HPOA 1F35A 4Q4V3 4NIDA 3F9KA 1BVP1 4LLLA 2BXZA 5D6EA 4XRSG 4LUMA 1UXZA 3T3YA 1O4ZA 2CU7A 3OYLA 2CUEA 2XB0X 4AI0A 1JZ8A 2F4PA 3BG9A 4CU6A 1ORKA 3NNGA 1FOD2 4L97A 5HLTA 1GV2A 2ZO4A 4CP0A 3NAPB 4OUEA 2H0BA 3BG6A 1DYOA 3HSRA 1Y3TA 3LAPA 3B6CA 2XL7A 1PM4A 4UUTA 1RC6A 1RUJ3 3H5AA 4DEVA 2JDKA 2ZKZA 4E6KG 4YGDA 3PIJA 5FO8B 1RZ4A 1MJBA 2ZAAA 1YIOA 3ATGA 4DUWA 3WF0A 3WXPA 2K9LA 2HOAA 3MKLA 3EHKA 2UYAA 2RS33 4PSWA 3I3BA 3IWZA 1GZWA 1QHHD 2HPMA 4HSLA 3WDVA 3KYCB 5FZ3A 1LB2A 4IHTA 1U5TC 1WH7A 5ABJA 1D4VB 2VMIA 5EGOA 5IVEA 3I3QA 3SCHA 1QVUA 4A6EA 2W2IA 2LOOA 1QJX1 2CGNA 4LMYA 5E3MA 2RNJA 4HF1A 2C6YA 4HX4A 2JDZA 5BV6A 3ZN6A 3QOPA 3GJAA 2DJNA 1VBD2 5K0UA 4RB2C 3NJXA 3S93A 1F5JA 2HDDA 2W95A 3HYIA 3N9QA 2XH6A 2R5YB 3BTIA 3TOAA 3PDQA 1VBE2 2ZJPF 1PO23 4NC7A 3I56I 2XGEA 5FZDA 1QQP1 5FLVA 3CCLI 3FZVA 2R6QA 1W2UA 1OFSA 3JRCA 5HDGA 5E3OA 3ZXGA 1ETVA 4DNCA 5C9AC 2XPVA 2V9KA 3SFIA 1FMD3 2BGCA 5AC92 1GSLA 2IS2A 1W7PB 1SFOJ 3CCVI 3MCZA 5JZGC 2V9PA 2KJCA 4HNVA 2ZMEB 2VUDA 1REDA 3APBA 4PJYA 2KP6A 3B7MA 1JN2P 4F92B 1VIWB 2V7FA 2VW1A 2DFEA 4HDVA 3PTYA 3O6BB 5F3IA 3WGHA 2PJPA 3AMPA 4CUAA 4BJ5C 5GZEA 1LOBA 2WC2A 1IPSA 1JODA 2PA7A 4IVNA 2WS91 4XMIA 4FTSA 5E8GA 3LFUA 4RM3A 2A71A 4E7SA 5IK5A 3HMYA 5I91A 5IVVA 1U12A 2LW8A 2E63A 4EROA 1WA4A 3DFGA 5FWJA 4DZJA 1PGSA 5DCFA 5CIRA 1K78B 3OYWB 1O6UA 1X19A 2JEMA 1U5YA 3KT4A 1I9RA 2G9WA 4E4ZA 4D5CA 3F3XA 5K5OA 4L2NA 2CYFA 1D0YA 1XGNA 1Q5OA 1JTZX 1TNFA 2WFF1 3M1CA 3B9IA 4RYDA 2VR4A 4FPLA 2XB5A 2R7UA 3VBUA 4CEYA 1MEC3 1J75A 1Z78A 3UYJA 3POGA 1Z91A 2M8EA 2O8OA 1Y56A 2L3DA 3QACA 5J8CA 2VMHA 3M7AA 4IXLA 4BNCA 3JXSA 1BIAA 2E9QA 1YQ8A 1CX4A 5T50A 3O1UA 2LVSA 5B1BH 1U5XA 3TEYA 3NV1A 1VQKI 3BT9A 3D5LA 1YS6A 4XLEA 2KDOA 1B9MA 3A23A 4C2TA 3A21A 2ORXA 2DA7A 1Y9MA 2VNGA 4WVVA 1QBJA 4OHYA 1WJBA 1IXSB 1JOBA 3W20A 2IXJA 1R1TA 3OYWA 2UY8A 3KV4A 3ZO0B 2YFUA 4NIIA 2L2OA 3K46A 3P9KA 3GM8A 3AKSA 3O5SA 1MPXA 4IEVA 1ST8A 3I4IA 4M01A 1HV0A 4A3JJ 2WINB 5JHUA 5CKQA 1XPXA 3FHAA 4F3JA 1TL8A 2JZYA 1DZRA 1VAMA 5J98B 3M9AA 2X9DA 5IP7J 2UXXA 2BUKA 4JAAA 5A7WB 4WVWA 3ZYGA 2JT1A 2RVAA 4IE0A 3I55I 2MD5A 4D6QA 2HYXA 3BJ6A 3LFKA 3JTHA 1XE0A 5FK7A 3I54A 2VMEA 3SXYA 1W5SA 2RNGA 3RKXA 3HOYJ 1RXFA 3W5MA 2GA1A 3DKYA 4OZXA 3AYDA 1BR2A 3KP7A 4BUPA 5C3OA 2XB6C 2L4AA 4C90A 1SMYF 2WR9A 4LB5A 1Z7UA 6PAXA 4X1EA 1YFYA 2L7FP 3JQXA 1GP6A 4FCAA 5C8CA 1AR92 4DXTA 1GDTA 3ZFFA 4PSXA 2VASA 3MPBA 2H0VA 2JG8C 3MKZA 2I2SA 4Q5SF 1TMF1 2LM3A 4CP9B 2C4XA 2IBDA 1V6KA 5ICGA 1D7PM 3NSTA 3DP7A 1G8WA 3W2VA 4QX3A 1P92A 1D4M1 5FOBB 1BOAA 4NAOA 4XACA 5D8AB 2LRPA 2X6YA 4RA2A 4XONA 4QDRA 4CUCA 1MS8A 3ZGKA 2YDEA 4LLNA 3KIOA 1FLIA 2O8XA 4FFHA 2A5YB 3AMQA 3WNLA 1J7KA 3Q0UA 1ETXA 1BC8C 2WFF3 2YMZA 5KAIC 4OI0A 5IOZA 4XF1A 3NV3A 1HKSA 1FJLA 2GC2A 5F1RA 3VBSB 2ZXQA 3HXLA 4AG4A 2O7OA 2YHJA 3OYJA 1ODNA 2R5ZA 2Q4SA 4C91A 1O91A 1IN7A 5DYMA 4E7IA 3EBRA 4HBLA 3FKIJ 1RMU3 2X51A 4UF0B 2FUG2 1UMIA 4KGQA 1YQCA 1LHUA 3KETA 1W6PA 3PQKA 1ZELA 2RR11 2DDUA 1OOPB 4UFIA 5T5JA 1X33A 5F04A 1BJZA 4YVWB 4QPIC 5LA0A 3L9FA 4N43A 5HV0A 2KR2A 3IB3A 1ZBE1 3BTYA 4E7HA 5FYTA 2D3PA 4MX3A 5IVCA 4H3WA 4BY7J 1CD3G 4Y17A 2VUAA 2GALA 1MH3A 1IS5A 3PJYA 2K9NA 1RTVA 1RUG1 3I3MA 4J1WA 4XDPA 2X6WA 5HCHA 4COVA 1FTZA 2FJ1A 4W97A 1FIAA 2DA5A 3AK0A 1RMU2 1J83A 3EYIA 1WD3A 4TLGA 1ASJ2 5FZLA 3PUFA 3SYTA 4C2UA 1HQLA 2RDSA 2CY6A 2CUFA 1QJX2 3POBA 2LKPA 4CUGA 2Q30A 1LVKA 4HW0A 3B5LB 4XBNA 1ZLKA 1S2BA 3JW4A 2E34A 5J1YA 5DTDA 1O8PA 2E33A 2L5QA 5B66C 4GB32 4A3XA 4TTGA 4RMNA 2HYFA 1VAVA 3CP2A 4MQVA 2FQ3A 2HZTA 3R60A 4BE3A 5L3EA 4XC9A 1MH4A 1XB9A 5HBAA 3GUDA 4XDQA 4WM7B 2P3YA 1FIPA 5FO9B 4RD7A 3HSEA 4ZS3A 2IJLA 1D5VA 1VJ2A 2D6NA 4E2QA 4KICA 3ZVXA 3JQWA 3KHBA 4KT5C 1W2AX 3KT7A 1X3UA 3LGRA 1W5CC 2WAEA 1B4AA 2GH8A 1FNNA 5K9YA 2AQEA 2OPTA 4BIFA 2E5ZA 3GVAA 1W6NA 2OQ6A 3LPFA 5F6LB 3TO6A 3HR9A 3OYNA 4IEXA 1NCQB 4YW4A 4XRFA 1P4AA 1VQLI 5FYHA 3R4SA 3U9GA 3AFKA 3LKJA 3LCPA 4PIYA 1SAXA 1X9PA 2HWE1 3MFKA 4LITA 5ICCA 3VBHC 2KIMA 2CW0F 5A80A 4UHTA 2O9LA 4DW6A 2OS2A 4P55A 1OA4A 2A3XA 1ZK8A 3QPSA 2DBBA 2AH2A 5HS9A 3LIGA 4XPVA 1WMDA 4KQ7A 2VZSA 1AXZA 3IKTA 4QPQA 3V0BB 2WNOA 3MV01 4N0BA 4N4NB 2GIVA 1U5TB 4QM9A 1F5TA 1BOBA 3AXEA 3CMEI 5FJ8J 5K8SA 2LNBA 5A33A 5JPNB 3C2GA 9ANTA 5FRAA 3OY8A 1T08B 1FX7A 2OTLI 3VHNA 1OOPC 2M4GA 4G9SB 3MD2A 3N7MA 1EYBA 1NE6A 1GV9A 3AKZA 1VRH1 1BBYA 4BDYA 4LR4A 4OYUA 1W9YA 1R083 2Z79A 2F5CA 3IPVA 5FKMA 1QNWA 3SEEA 3IC7A 3FK7A 2P5BA 2EQRA 2LD5A 3ZMSA 4FE4A 5D6FA 1Y9QA 1RINA 2XWBB 1UAIA 2MSYA 4CVUA 3CMMA 5GTIC 3CZ6A 4N9IA 5FYVA 1T98A 3AP9A 5LA1A 1HQWA 3RG0A 1W7PA 3CUQB 1RETA 4D0PA 1SCSA 5IWFA 3P9CA 3PLQA 4XE9A 4BHCA 5GAEJ 3KZIC 2Y8KA 3MPPG 3BPZA 4P9GA 1RKWA 4HVRA 2KPMA 3HNYM 4YG6A 5FY0A 3ESWB 1AKHB 1DU3D 4HPKB 5JZGB 2ZGRA 4Y52J 4QX0A 1OCTC 1VBC2 4Q4X3 2Q2EB 4CEWA 2JDMA 3OB8A 5FB2A 5JCTA 1LPQA 2XXZA 2KZGA 3DYOA 4KG8A 1SHWB 1Z7S3 4QPGA 4IEUA 1Y7BA 1JXSA 4FBFA 1WKMA 5M5YJ 1AR72 4AQSA 4BHPA 4AVAA 5EEAA 4QAWA 2BHZA 2P5KA 4BL0B 3PNYA 3ETQA 4MGRA 4M3DA 3NJYA 2ELKA 4YRDA 2BOLA 1W8NA 5M3MJ 3I3DA 4Q8KA 5GLWA 1K42A 1BCXA 2BY2A 2GWRA 2HWE2 1XNCA 3TW6A 2E6VA 2GZWA 3ACHA 1BL0A 2ZGSA 2NPIA 4FPCA 1SQ4A 3CCMI 1HQNA 3POYA 1V9U1 3F6OA 1J59A 2M0CA 5GM0A 3WOGA 4HF2A 5HCBA 5KXEA 4ZU5A 4I99C 3AKTA 1RUNA 4MXWB 2J1AA 2Q8DA 3DGTA 3Q9VA 2H27A 3K1NA 3FHZA 5EFUA 3SNMA 1YI9A 2ZBJA 5D21A 4R8HA 2R93J 1NQDA 1ZRIA 4YZ5A 2YB7A 3UETA 5EIYB 3TBDA 1UPSA 3OYEA 4RB3C 4W65A 2FNPA 4AQTA 4FPGA 4MHRA 1CZVA 2VTFA 1ENSA 2VJIA 3KV9A 1FX5A 4ZZ5A 3R0JA 4OUMA 4FQ4A 3OYIA 3BR0A 5CKNA 2DO7A 4BK5A 4Z2AA 4L0YB 1APNA 3B3QE 5FZ7A 4CCCA 4XF4A 1QPMA 4DYCA 2GMEA 1GANA 2HWD1 3COAC 2BXYA 4YIFA 2F4IA 3K69A 5IK4A 4Y20A 5DUIA 1RXGA 4COWA 3JCIA 4QSHA 4UT5A 4RR3B 3QU6A 1CPNA 4P02B 5F6FA 3CUQA 2JDAA 4G6QA 1OD5A 2B9UA 1PX4A 1XC6A 1C8NA 2P6HA 3S1NJ 1XNDA 2PLV1 3IH3A 1R36A 4BBRJ 5C8WA 3H3UA 3Q8FA 4DPNA 2F5VA 3FJSA 1ETOA 5DUWA 4DJAA 5A7OA 1COV2 3U4XA 1FPN2 3K51A 3PL8A 4X8PA 3ZFFB 3LAJA 1PHMA 3WT3A 3CL1A 5FLIA 3BLYA 1ZN2A 2Q1FA 2M1BA 3GZNB 2Z42A 4F93B 2LUWA 3IMNA 3UESA 2YPRA 1LHWA 3RYPA 4B4CA 3LA3A 3WUDA 2MPFA 3M07A 1JYXA 1TME1 3RKQA 5GZCA 2D6MA 3VSLA 5A1LA 3ABMH 2JB4A 4IX7A 1T56A 1PVC1 4YELA 3NARA 1IF1A 5A7WA 2HQRA 3FXRA 3CLPA 1RUF3 1R23A 3IMMA 2M5WA 1WJAA 3RRDA 3E0JB 3ZQGA 3K48A 3OGJA 4PJ0C 3G6JB 3UJOA 4NPRA 4NRQA 3RNSA 1I39A 3JREA 4YFKF 2A75A 1KYZA 4QM8A 4NWVA 1UOFA 1T95A 4AI2A 5JAXA 1WJFA 4ZDLA 2HWB3 1Q3EA 4A3BJ 1I5PA 4JK1X 3MW4A 4P00B 4TLFA 5F0FA 3CMAI 2W00A 1WHUA 2EIBA 4QB1A 5FROA 1AWCA 5GP9A 2DBIA 4YWAA 5CKMA 5CG9A 2XBO2 1UG2A 2ZSHB 3WF3A 4R9CA 3TDUC 3I2DA 2KFDA 3V8LA 4ON0A 1IG3A 4UW3A 2XAFA 1B6AA 5A6XA 4LLGF 5KHGA 3POWA 4CXFA 3KZ4C 2D1HA 3V8JA 2Q1MA 2K86A 2DA6A 5FYCA 5K7FA 2RKHA 1SFYA 4AWDA 1CWPA 3MIFA 5FYSA 4Y5SA 3M4FA 2L0KA 1SFXA 1RIOH 1W90A 3VB2A 2K40A 2PX9A 3GBGA 2F5EA 4P5HA 2OPWA 4FPKA 2OAZA 2VMCA 5CAZA 4JVAA 3C7OA 4AYUA 3NV4A 2KKOA 4ET7A 1XXNA 1E3PA 2A6HF 4EZHA 4IEZA 1D0ZA 2HTSA 3H1WA 3USSA 1QO0D 1B8IB 2L7KA 3FISA 3OSGA 1KDMA 2ZX1A 2WQZC 3WP3A 2LRDA 4YARA 2CRGA 2EPFA 3AMNA 3SKJE 2CWMA 3JRIA 3AVRA 3K4MA 4KG0A 4CP2A 1ZH5A 5HCAA 3T1LA 3KWVA 2XIGA 4XIDA 2VZRA 2EA4A 1RUH1 5IOYA 3I2FA 1D1CA 1I3QJ 5FPBA 2BFUL 4J1XA 4PIZA 4QX5A 4YVWC 2OZ6A 2D5VA 3ZN5A 1GLNA 2JA8J 2DLLA 2ZHNA 4Q1RA 4ENMA 3I3LA 1A36A 5H9QA 2ZGNA 3S3NA 2BHYA 2DCEA 2AXTC 5CU1A 3BTXA 3AZZA 4CA9A 5A3NA 2K9SA 1VBA3 3CC4I 2JQ7A 4S2GA 3FDYA 2AC1A 4BE2A 3FFQA 1YIJI 4A7ZA 4XUNA 4Y24A 2B63J 2R063 1W0NA 4P9XA 4RDUA 4QKFA 1G9DA 5KHDA 1WCSA 4HV6A 2CH0A 2M0MA 4ABZA 5B3SH 1QQP3 1MZBA 4CPBD 2VCBA 1W3XA 1DQ0A 1YFXA 4YM2A 3T1MA 1VMJA 2UV1A 2XJRA 4U87A 2HWD2 1DYKA 1RUG2 4G94A 1UX6A 4GGGA 2RC4A 2QDRA 1T6SA 3BYWA 1I3AA 4OFGA 2NNNA 2IPQX 4B1MA 1YIFA 1SLAA 4X6AJ 5FFOC 5CFCB 2UWMA 1UY2A 3WDUA 4G4FA 3QODA 4A5MA 1EJ9A 3KEOA 1WZ2A 2B46X 2I10A 3WE3A 4HXCA 2L7MP 5C3RA 1ETKA 2OCEA 1LHOA 1DYPA 5GADJ 1MBKA 2DT5A 3U1DA 1HKTA 1DQ5A 1MBEA 5DV5A 3WNMA 2E2JJ 3AP7A 2IFWA 1OQ1A 4N7IA 3E3VA 1CF7A 2Y69H 3WG9A 3LSPA 1PMIA 5AIQA 2WA3A 3MIEA 2ZMEC 2CAUA 3IDAA 5FZCA 2QQIA 1MR5A 2A6VA 4LG0A 4XMYA 5D8AC 3K4AA 1Q1HA 2ZJQF 4WVMB 1KJRA 3ZSLA 3LSHA 4QQPA 1JYCA 1GOHA 5I93A 1EY2A 2M7AA 2AUYA 5FRNA 1W6OA 1ZR2A 4COZA 4CDGA 3E5XA 4E7ZA 2ZCWA 5L3DA 4ZDOA 1BBT2 1LOFC 2JDHA 4P14A 5FKLA 1W5TA 1H1MA 2B7YA 5H2FC 2E35A 2BDRA 1V4RA 4IHXA 3MZHA 1YXWA 3GXUA 3VPRA 3EDPA 1H4GA 3OGVA 3AG2H 4WXCA 4FSJA 4Z82A 4AD9A 5GTHC 3E1F1 5LHIA 2XPWA 1FMD2 4XFAA 5IATA 4NIAA 5A7QA 3KF3A 1J09A 2BZTA 4FCYA 3P7NA 1W6QB 2DA3A 4PGGA 4IL7A 2HPIA 1MNEA 5JSRA 2HVSA 2ZX2A 2VQCA 3Q0VA 1BZWA 3GHMA 3VYTB 4DO0A 4B1LA 2LF8A 3HAGA 1MGTA 3B6AA 4OOIA 1US3A 1P7JA 2X1CA 2X6XA 3O0XA 2W7NA 5BS6A 1O7FA 2P6CA 2W3JA 1PGL2 1TWAJ 4C3JJ 3SHFA 4A3DJ 4NVPA 4DOZA 1B9NA 1UELB 2Y0OA 1B35C 2BRTA 4FASD 2CAVA 2FMYA 4TSVA 2RVCA 4TN7A 2PHXA 5F37A 3I9V2 1ULFA 5CNAA 4MLOA 1GNYA 3O12A 4YG0A 2R5ZB 1EV13 4M3CF 2AHQA 1PO11 3FN9A 3S1MJ 4A6OA 1X3ZB 4B4PA 4CYCB 2QCOA 2CMPA 3DPRB 5GPAA 5FYMA 2FOWA 4M4RA 2C1FA 3UGGA 3JAMK 4BY1J 4M00A 3POIA 2DOFA 4I3PA 3V42A 1H6XA 3QPTA 4M9SA 5A7SA 5G04L 4N43B 3G1LA 4K20A 2E26A 4WF2A 2DA1A 4P96A 2A6WA 1JYIA 3ZKUA 4YZ3A 2ZKNA 2QTWB 4BWOA 1WMEA 1CAVB 5F3EA 4II3A 2E32A 3ZFGA 2DMNA 1MKMA 1POV1 2VUJA 3VZOA 2HWVA 2Q8OA 1ZBE2 5BUVA 1BR1A 5KK1A 2VVFA 3RZDJ 3U21A 4O6JA 2KA3A 5FD6A 1N47A 2VLAA 2EIJH 1J58A 4A7KA 2W9XA 1NY72 3PSFA 3UKGA 2JN6A 5ACA2 3FXOA 5LWBA 3DPRC 4I0AA 4IW3A 1WMFA 1RB8G 1XYPA 3PNAA 1ULEA 1W0TA 4FETA 1DUXC 1MSFC 5B4XA 3A1YA 1F4KA 4Y4RA 3CO6C 1TWCJ 2PELA 1OVSA 4UUSA 3H7YA 3V0AA 2BVBA 4NC6A 3U2RA 3KZYA 4AW7A 1X4PA 4QQOA 1IJWC 4O61A 4XIKA 2CV1A 1D4M3 1U9OA 2WL1A 1FOYA 1XMKA 1V5FA 2A07F 1WCMJ 2EA7A 1LENA 4DZGA 1U5TA 3LB9A 4OAYA 4LGWA 4IGOA 2KIFA 2CFXA 4XORA 3ZYHA 3J81Z 1DQ4A 2DQRA 5SV5A 1HOMA 3JRDA 3G7DA 3VKNA 2E1CA 2IRFG 1FY7A 2D93A 4DBQA 2QBYB 1S2KA 3QP5A 5JMCA 1R1A2 4EN7B 1QNYA 2CQ7A 1JBCA 1K5JA 2ZMLA 1HA8A 3VD7A 1W0UA 3CEWA 1NX9A 2OU2A 1ND3B 2UXNA 4AFMA 2EIKH 3J7NA 3VHOA 4EGYA 3S8PA 4EMSA 3H0OA 1R9TJ 4FXKB 4ZZLA 3WG1A 1BEV1 5JLWA 4XTPA 4RGGA 5FV3A 2FU4A 2X4HA 2VOOA 1UPIA 4BBSJ 2XONA 2VTXA 3IH4A 3GBFA 1X1DA 2G7HA 4NQWA 2VBDA 3S0MA 2F5FA 1JZ4A 3NMBA 1YIPA 1V3FA 2BW3A 1JI6A 4K1ZA 1OPMA 2NYYA 3IN9A 1IRZA 1V6OA 3AP6A 3O0WA 4ZZDA 3K1PA 3DU6A 5E3LA 1D1AA 4X8NA 5AFEA 1H9PA 3L7WA 1J9IA 1VBE3 2V9VA 2WLQA 5TSWA 3ZDVA 4LO5B 4OQ8A 4ZU7A 1VF9A 4AEJA 2HWC2 3PVEA 5JIUA 4AE2A 2IS1A 2W1UA 4QWQA 5HVQC 1VI0A 1VQMI 4GJZA 4N8MA 2E31A 1OFCX 5T55A 3CJIB 4ZC3A 1VQNI 1OUSA 4D6SA 1VQOI 2JSCA 4R9DA 4UFJA 3ECHA 2JXAA 1OCZH 1YQ5A 3AKPA 4G7HF 5L36A 3JD71 4HT1T 3TGNA 3L9JT 1NZCA 4E7KA 1LEBA 2IT0A 3W5NA 1NE4A 1V5GA 1V54H 5K5RA 3NRUA 5LA2A 4ANJA 2PHWA 1FBQA 4ATEA 2MEV2 3RVHA 2K3PA 4XUOA 4URAA 1XJAA 2VQGA 2E7QA 5J3LA 4M6XA 4YW5A 1AR62 4GQ7A 4XFFA 3VKLA 1ZZCA 3PNTA 1UZVA 1OI6A 3L2WA 2E1MB 4XQFA 3OYMA 1SFKA 5CVRA 4UOJA 1Q8PA 3G71I 3S2HJ 4LA2A 2DVAA 4DQ2A 3OY8B 4HSTA 4HQEA 2W91A 1HRV2 1ZNPA 1YRNB 3JRAA 4ZY9A 1PX3A 1R00A 1KXGA 3Q8BA 2R7FA 5EGOB 4FQZA 3I0TA 1WGXA 3ACIA 2CGPA 4EATA 3VD9A 1A31A 3OUJA 3TP3A 4YIRX 2KIUA 3CF5F 3B94A 1VBB1 5JLXA 3BU7A 2XGXA 2ZACA 4KMFA 2JA6J 4G3YC 4L0PA 1T0FC 3LSRA 4MV2A 2ZC2A 4JC1A 1ZGAA 1BA5A 4RGAA 1DIWA 1IZ3A 3FMQA 3RWKX 2GAUA 4F55A 5GLVA 2ARCA 4JRLA 4NHYA 3ZN6B 3BOWA 4K21A 2XF6A 1GFF2 2HLEA 3Q8EA 3ACFA 1J5YA 2MW8A 1PVC3 3M3OA 1T6BX 1HF0A 4BXXJ 1EH6A 3CJIC 1D5YA 1TC3C 4Y7NJ 4PK4A 1VRH3 3BJAA 1V70A 2EK5A 3ML6A 1R091 1BK1A 1DGWA 1NXMA 1SG3A 3DEMA 4M9XA 4XBFA 2KISA 4RSUA 2VH9A 3GTLJ 1OH4A 4R4XA 5FP8A 2BVVA 2JUGA 2VOKA 3BZ6A 4CDWA 2EFPA 1CX1A 3ZYPA 2JG8B 1N25A 2WTEA 2VBPA 3HT2A 1Z1DA 5H6QA 4QPIB 1MNMC 4BE0A 1MBFA 3FBNB 4UVBA 1HB4A 3DQVC 4GB31 3W58A 5C71A 3P6BA 4E7JA 3OL4A 5KNLA 2RMU1 5FZEA 1IN5A 1GNZA 3ACLA 3CF6E 3HHGA 3ZFEA 2E2HJ 2WO7A 2XVLA 2PFWA 4FVVA 4Q4X1 4BA6A 5E79C 2JG8A 3THTA 3H92A 5FCCA 2QVOA 1FT9A 2WZ8A 3J8F2 4HBNA 3KF5A 5D4RA 5FBJA 2ACJA 3DTKA 3IT8A 3BR6A 2NOGA 4WBBA 1DBNA 3WTZA 2ZEZA 3HNBM 1ACIA 1HRI2 3UR3C 3J7MA 1QZEA 2HJIA 1TMF2 2XR4A 1DDLA 4PQQA 3WTWC 3AG4H 2MC3A 2JPBA 1GKBA 5J7MA 4Q27A 2VNRA 1WPKA 1XNAA 4GJYA 1Y0UA 3Q9SA 2VXRA 3S7IA 3I49A 3J4UH 2OX0A 5D8LB 1P2FA 3J9SA 2NVUB 4GKYA 1JGGA 1XMXA 2NLRA 2DPDA 1OCCH 3VODA 3ZOIA 3ZMUA 3W3CA 4P5YA 4RN5A 2LTNA 1OR7A 5LHHA 3O0VA 4GIQA 2DCYA 3H7JA 4XETA 2DK8A 4FQGA 2V73A 3RZMA 1U3EM 1D0XA 4JQFA 5FJKA 3CBNA 2NVXJ 2K9QA 3ILFA 4IEYA 2VPRA 2GQQA 4AEDC 5L9VA 1RUH2 1OYIA 3BG7A 2E60A 3TEDA 4IGPA 4JHZA 2KRFA 4MGIE 1ERDA 2E1NA 2VUMJ 1LODA 4V2VA 2G7UA 4QQLA 4A3IJ 5BNOA 2R0QC 4IE4A 4A3ZA 5C70A 2VQUA 4C30A 3OY9A 2I8DA 4XUPA 2XAGA 1HKDA 1DZTA 3H8UA 2X10A 4NNJA 1XSQA 5BNNB 3CP8A 2G4IA 3GALA 3L00A 1SMTA 5A1FA 3LF7A 4LBMA 1HW2A 1JH5A 2R5YA 1H88C 1RHI3 4EM0B 4EJVA 1S0EA 1KQ0A 5LK7B 3HGYA 3TN92 1B35B 3JZVA 2XJUA 2YX4A 5C4XJ 3ZQIA 2O8KA 3ALQA 1W04A 1OH3A 3M8FA 1B1BA 2WB1N 1L3LA 1YG2A 1ASJ1 3QPHA 3LEIA 4KISA 4XTMA 1NCRA 1MDMA 2EIMH 3I5UA 2P6TA 1POQA 3E6CC 4RAZA 5ABJB 2HGCA 3V7RA 5J47A 4R9AA 5K4LA 3H3LA 3HM5A 4L9NA 5EJZB 2VXZA 1J1LA 4LK6A 2NVTJ 3H9JA 2QUFA 4LJZF 2VOWA 4PI0A 4S2HA 4BB3A 2CV6A 3WEZA 4IEQA 2WSVA 5LBEA 1K83J 4O65A 5FZ4A 5JDBA 4DRVA 2WNVC 4JKLA 4M4PA 5J6XA 4IKFA 4LBJA 4KA4A 3NAPA 1R1A3 2FE3A 1W0PA 4NRPA 3KHCA 2EAAA 1R5ID 3GX4X 4JDOA 3OS0A 4EVIA 4NUBA 1LQ1A 2LROA 1RUD3 1V00A 2H09A 4CUBA 4QHZA 4I7HA 5IYYA 4Q4W2 2EILH 3T0YA 5T54A 2G19A 2CSOA 5ICEA 5DAQA 1DLLA 5CKTA 3TEZA 3R4KA 1MS4A 2WBKA 2MGQA 4OU0A 2D3RA 4BQOA 1VBB2 4XJUA 1YCIA 2VXJA 5IYDJ 2GXGA 1DU6A 3PVBB 1ALYA 2RS53 5FZOB 4I02A 3WSOA 1NT0A 1Q8VA 5LRSA 2AGSA 5LGUA 4HPKA 2E36A 3H5RA 4Q0UA 5C4WA 3MLLA 3E1SA 4A5NA 4GMP3 4PI2A 2OVUA 3OS1A 3GFJA 4QX7A 3VB9A 1CGPA 1LR5A 1DGLA 4NQWB 3VKMA 4H0EA 4MOAA 1S6LA 3N05A 2R7ZJ 5C8CC 4HPQA 5C33A 3LD8A 1P9QC 1IHMA 1S29A 2AZ5A 3DXTA 4IETA 3FXLA 2DFBA 3DN7A 1HJFA 2YSRA 1JOPA 3I7DA 1P8JA 3MF6A 2HTJA 1AX2A 1CJPA 4LO6B 4A45A 5T5OA 1FYMA 4BGDA 3GZAA 1DQ6A 3WY6A 2FBKA 2R7VA 1V0AA 1OF4A 2Z16A 2K3FA 2P2KA 2HEWF 3H0DA 1MS3A 2ZJCA 1AKHA 4M3CA 3WDXA 5EG0A 4RGSA 3WF1A 5KXBA 2GC3A 4ENJA 2ZFUA 2B8MA 5CB7A 2DDAA 4CDXA 3CNAA 2NVYJ 4LTAA 3WCRA 3ZMTA 4PGHA 3J7HA 4BDZA 1OA3A 3I4PA 1KU7A 3VZMA 3KQRA 4E2SA 4CDXC 2D2WA 2AENA 1JU4A 1UHMA 2MC4A 1AL23 2IXKA 3FBYA 2LF7A 2E7XA 4I30A 4BZ4A 1YJLA 1RHI1 4AGVA 1TT5B 4GULA 5FR3A 1GZ9A 3N9PA 1C28A 3VV1A 2Y30A 4URTA 2VOXA 3S5AA 3T0DA 1J2XA 1T33A 4CCKA 5LEJA 1KITA 1QGPA 4BXUA 4UUSB 4ONUA 2MEV1 4K3UA 2XJPA 1REFA 3J8F3 4INDA 1QA6A 4OMDA 1G9CA 1H1IA 4UFLA 2EINH 2QKMB 2DDBA 4Y26A 3OV8A 4FP2A 3F22A 5FQ0A 1UY1A 2DTZA 2X09A 3T1BA 1K6YA 1IAWA 3LFMA 3ITQA 1JUIA 3ZFFC 2EFQA 4OZOA 1KYWA 4B3NA 3SEZA 1W05A 2OKXA 2K85A 2ISYA 2IAIA 1N1VA 3WHTA 1RYYA 3FMGA 4XUTA 5FFXA 2VG9A 1U0JA 3POSA 4BKXA 1RJ7A 2HWF3 5AFBA 4AM3A 3CDIA 4IRHA 5J48A 4RS5C 3X2QH 1AYM2 2UYBA 1WJCA 1VQPI 4XCBA 3LEMA 1F1ZA 2WWJA 1OCPA 5DAVA 1GVJA 2RS13 5C3QA 2JVGA 1SC7A 4QPYA 5IHRA 3V7SA 3RI8A 2VJ4A 1E17A 1ULOA 4CE8A 2X53S 4P9FA 4XABA 3HUGA 3O2PE 1ITYA 1LUJB 4HK8A 3ZSJA 5CG8A 2R1DA 2VJXA 1A78A 2R7RA 1NG0A 1OCOH 1SLIA 2JVHA 3S16J 3T30A 4E4HA 1RUF2 1VQ4I 3NEUA 3LL7A 3DLAA 2OUJA 3OBTA 4ZJZA 2BWCA 5FPVA 2VECA 1KFXL 3B00A 5C8CB 2Q5TA 4G6TB 1HXS2 2K4BA 2XAUA 1BQPA 2STWA 1XSDA 2WABA 3PU3A 1YUDA 1O3QA 1R22A 3C3WA 4SLIA 5HLGA 2FHRA 3D0SA 3ECOA 3BTJA 2X5IA 2WV1A 1FBUA 1NK3P 2Y38A 4OCTA 1SBEA 4Q5OA 4XUQA 5ANQA 3MKYB 4A2UA 1RUC1 1AR61 1XSRA 1ONAA 3DF8A 3AJZA 1GT0C 1UY0A 1WUVA 4ZYDA 4UBHA 3CMGA 1OF3A 2DBNA 2GNBA 3LEGA 4PQ9A 2MLGA 2JDPA 1H2NA 2D43A 1FV2A 2IEKA 3D82A 3NNJA 4F83A 3CJNA 3FBIB 2OZJA 1JT6A 2E7TA 5FUNA 1OBNA 4N53B 1C5HA 2D7FA 3U1XA 4UFHA 3BPXA 4RFT0 2DMTA 2P7VB 5AONA 3KCXA 3Q8AA 5FZMA 3TN91 2MEV3 2QQWA 4YLZA 1N78A 1JJ6C 2AR6A 2B0LA 4RGUA 1E0EA 2PN5A 2QQAA 2W57A 3I2GA 1IS3A 2R042 4B8XA 1J1TA 1MQTA 2WT0A 4B48A 1TZOA 1I5ZA 3WG7H 2F4LA 3I59A 4BE1A 3HVDA 1W28A 2EBIA 2O0OA 4NE9A 5L7OB 4HAMA 2M87A 3KM5A 1UZ0A 5F2WA 4AI1A 1P4XA 4JHTA 3RFRA 1POV3 4WVMA 1YOVB 3HRTA 4KIGA 4UBGA 2QVSB 1BR4A 5LATA 2FDFA 5E8AA 2OXBA 3NJVA 1W6QA 2L9LA 1WI3A 4AHYA 2DT7B 3I71A 4YRVA 1ZZ7A 2AEYA 4Z2WA 1QXPA 3LDRA 3NAUA 1QDOA 2BYVE 4KDPA 2UWBA 4B3AA 2RS11 5GZDA 1L7RA 2BNOA 3ZXSA 2I07B 4XJZA 2XWJB 3J80Z 2WNVB 2XJVA 1VQ9I 2VD7A 3MGUA 4YGCA 4KWUA 4C3HJ 4Q4Y3 4AF9A 5LBFA 3TBIA 2HS5A 2C9AA 5I0SA 4CU7A 3DEEA 3ZSEA 2ATFA 3EMRA 2UURA 1AZDA 1I50J 1X2MA 5K0UC 1OMIA 5J37A 1YLFA 1Y39A 5L73A 4RQPB 5F5CA 2EFOA 1Z6TA 3GLXA 4LMFA 3PL0A 1IDZA 2BPA2 2CSGA 1VRBA 1LDJA 4XRMA 1TME2 1R49A 1XBFA 2ORZA 4JX0A 1OLMA 2IVIB 4EJTA 5IW0A 3VZKA 3FMSA 4MTEA 5BXXA 2W1SA 3M3YJ 4IZZA 3AYCA 4XLFA 1JTYA 4AHWA 4O5VA 1L3JA 4KFCA 4QB2A 2GM4A 4AZZA 5A3TA 2QQVA 3OR2C 2RMU2 3AKQA 1SBDA 5JR3A 3DV8A 4R52A 1RUC2 1MZFA 2VY0A 2MLKA 2Z9OA 5BNNC 2XF7A 2VVEA 2W08A 5LGTA 4AL9A 2YU2A 3MICA 4ZTJA 1OPOA 1W39A 2XLAA 4NPLA 5DG2A 3I58A 4PZJA 2VZQA 1LULA 2BQPA 3JBG2 1CAXA 4I6ZA 5DXDA 2M8GX 3HKZA 3VZLA 1SLLA 1JKPC 5J09A 2AREA 1W2NA 4PDWB 5DUXA 1LOEA 4DQAA 3OEAA 5F3CA 3UNPA 3VSKA 4MNUA 2DTRA 3JR9A 4K7JA 2CV0A 1ND2B 1Y8QB 2ZMNA 4AFCA 4L9BA 2A69F 3RPQA 3S3OA 3ORJA 1HDKA 4A42A 3T2TA 3FXMA 3FBMA 2VM9A 5BNPA 3WP5A 4YG3A 1Y4WA 3WINE 2QQLA 2HDWA 5FP3A 4CCOA 4HYEA 1OVPA 1QJU2 4R9BA 4LIUA 2RM21 4MXWA 4KMUX 3RYRA 5FFZA 2EZHA 1YJNI 3C7FA 5DD8A 2KT0A 4YVWA 4IUGA 3OYKA 2VE1A 2LK2A 2WAAA 1DDNA 1F9KA 3S57A 4YM1A 3H3ZA 3JD73 2PJRA 1BK0A 5J1XA 4QMAA 1A8MA 3OGSA 1ND2A 2Y6FA 2W48A 3K2AA 3ULQB 3OD4A 5FLXK 3OD0A 1N3OA 5G05L 3SH4A 5GALA 3I3EA 4V1PA 1WLTA 4C1XA 4D7YA 3ES1A 2SBAA 3ZYBA 4XBQA 3FX3A 1K4SA 1H6YA 1HJGA 4IHYA 2RM23 4D7TA 1FYUA 4IJAA 5DG1A 1RGSA 3VL8A 4KI5M 3ASNH 3AP5A 2X8KA 1QPIA 4XL9A 3ZYIB 5C3EJ 3P5JA 4L92A 5CQEA 3ZQFA 4XCAA 3ZMOA 1S1AA 1XOYA 2TCTA 4AK3A 3MEXA 3ERMA 1SDDB 4AOCA 3LEKA 4MGSA 2QDNA 2R7OA 1GMMA 1SLTA 2QQKA 2RHPA 1G2HA 2E19A 4HVOA 4B8EA 5JZGA 4GH4B 2B39A 2GBYA 1TBXA 3RZGA 1PO21 3HPGA 2R073 4QX8A 4YM3A 3ZN0A 3OPTA 3ZM8A 5M5WJ 5A3MA 3I53A 2NP0A 2D44A 4GWNA 3MZ8A 2ID3A 1OD3A 2RDPA 5LK5A 4QLCU 2RDRA 1B72A 4K2EA 2XSDC 3KEQA 1VBB3 3HRSA 3F8FA 2L9VA 5KBFA 2YC0A 4M0HA 3UKNA 3BP8A 1P4WA 2XKPA 3IL2A 1CQTA 3ZYRA 2EXKA 3W6KB 1ON1A 4PDKA 4LHLA 2WAQN 3H9GA 1IXCA 1UU5A 1K3IA 4DINB 4A3MJ 2XVGA 4LXLA 2V79A 5FMOL 4MGYE 3B73A 1FP2A 5DCMA 2JUCA 2HWE3 1ZA7A 4LBQA 4DYRA 2ZGUA 4FPYA 1C1FA 3F0CA 5D8KB 3ENRA 2JD4A 2QKDA 4QKBA 3WCSA 2DN0A 5AVAA 3F95A 4UV9A 5LEKA 1UU4A 4CEWC 4TWTA 1ZZBA 2C24A 4UI9L 1WFXA 3D3AA 1OKOA 1U0AA 4KBZA 1UO9A 3ME2A 5DM7F 5KWRA 2DFHA 3KP5A 4A3GJ 1TTYA 5K5QA 1LKNA 2QJVA 2J5PA 4N53A 5HS7A 3GF2A 3TL4X 2CHHA 3A02A 1XGSA 3JU9A 4Q4X2 1VBC3 1D0HA 1Q8OA 1NHAA 1AYN2 2M34A 4AEDB 5EG0B 1R64A 4X6QB 4XF3A 1DGRN 1W36C 1XYNA 2PHUA 4BQ1A 3QAHA 2HU9A 1OHFA 3UNGC 2FBIA 3N4MA 1OLTA 2E7AA 1MQTC 5H9SA 3DLLF 4KWKA 3AX4A 4JKMA 1TG7A 4HRIA 3NNMA 4M0NA 4KWJA 5J40A 3R4DB 4L99A 2XPJA 3N7LA 1I3HA 1J0RA 2VZOA 5FP4A 3NKTA 2P6SA 2RN7A 2ZXHA 2L02A 3VBFB 4ESJA 2PLV2 1K4TA 2K0GA 3I64A 2VW0A 4P08A 2NM1A 4BMBA 1IGNA 3CCQI 4O7XA 4G6DA 2Y6KA 5A32B 2P3IA 1CAWB 4NHJA 3M8EA 2C5DA 1TQPA 3AJYA 3HUGB 1YLLA 3NW4A 5BYNA 1MBJA 2GMMA 4MHGA 4HEA2 5FZ8A 2RREA 3F8CA 3BROA 3VFZA 2HBUA 5HODA 3USUA 5IK7A 2ZPXA 3ZQ7A 2VI6A 3K4DA 4CDWB 3WU1B 5FY9A 2WNUB 4EWDA 3OOUA 3ONQA 1HLVA 4LE4A 2R1BA 2J1TA 4PJLA 1GICA 2VZPA 2WT2A 3G3ZA 4PJJA 3OPZA 2OF7A 2BVLA 3DXJF 3WQ1A 5I8YA 4WCGA 4L5JA 3OL3A 3GFIA 5FYYA 4C1WA 1XDUA 4FAGA 1HN1A 2FMLA 2UWAA 2BBAA 4IE7A 1GQPA 3FWEA 5E8IA 2OQRA 1TMF3 4S0HB 3V7CA 3H9AA 4QQ2A 1JU3A 1NKGA 3CZJA 1FPN1 4XQWA 5JR2A 4HOBA 4EM1A 4TZDA 4CDUC 2P8TA 5FXVA 3CQZJ 1ZTRA 1VQ8I 4C8DA 3HDDA 1REEA 5EP9A 3CESA 3TAYA 1HDPA 4I76A 2YR2A 1U8RA 3WW4A 4UW6A 5JXGA 3OYFA 3BY6A 1W8UA 1QJEA 2CQKA 2FCVA 5CVUA 1G9FA 4YVSB 4Q8LA 4OAZA 1IKPA 4IV1A 3OWTA 1ZAOA 3GZ5A 3ERED 1A5JA 2HYGD 4WXHA 5E88A 1DPRA 2QSGX 2JKBA 5FO7B 2IVJA 2QSFX 1BVVA 4AVBA 2K46A 4CDUB 3IRRA 4MVTA 1CAUB 1L7LA 3ZXAC 2RMU3 1AA7A 4AAXA 2M45A 4Q4W3 2K2SA 4WM8C 1K61A 2DUQA 2VCCA 4QHBA 3E5UA 3NJZA 3BR2A 3LE0A 3A03A 3PJRA 4A0YA 1QJY2 4BXSV 1F8VA 1Q43A 4BU2A 2Y64A 2DTWA 1GP4A 2XRLA 1NTCA 3AZVA 2J1VA 2EV6A 2YC4A 3FLTA 1UCXA 5EEHA 1VRH2 1TE1B 3QD6A 2R16A 2O3FA 4AR2A 1S9HA 1HW5A 1PVC2 3BCWA 3Q3SA 4BEHB 3MYXA 2D6OX 5CQGA 2FDJA 2A61A 3ABKH 3FIWA 3VBSC 3QOEA 3J7ZI 3S17J 5A3PA 4V2GA 2XPUA 5C4JJ 3KGZA 2EJRA 1WJEA 2LSOA 3ZQHA 3HQXA 3W21A 3M70A 2VQ0A 1IPJA 4A3CJ 1YW7A 1ZG3A 1Z77A 2LYCA 3GJBA 3S2WA 5DUUA 2ZZJA 5FZHA 4UYBA 1S2EA 3H8RA 4QKNA 4WXDA 3ZXFA 1W1WE 4CZCA 4GWIA 1RUI3 5LFAA 1WCQA 1W8OA 5CVVA 4H14A 2MYSA 2Z99A 2JICA 4Y1XA 3A01A 1HV1A 3BQZA 4XLNF 2WKKA 3WDWA 3FXJA 1AJOA 1RUF1 4ITCA 2NYXA 2VQHA 4I3GA 1HRV3 4WZFA 2GLOA 1NUKA 3AAFA 4E70A 3BTZA 3LOCA 4B4RA 2MABA 4ES9A 2A3YA 1WJ5A 1QEXA 5FPAA 4I98B 3PIOF 4HNTA 4KWLA 3IWFA 2A7AA 5CLSA 3MAJA 4RA0A 4Y5TA 1T2XA 2XAHA 3FXQA 4F8AA 2HWD3 3C2BA 1W2TA 4HA8A 5D4SA 2HWB1 5E89A 3IAS2 1QIQA 3AP4A 3FK6A 1SBFA 1K6OA 1G9BA 1FOWA 3PVOA 4LHNA 4DGWB 3ZYFA 1XNKA 1TQ5A 4CGZA 3E7LA 2DK5A 1U6GA 2E71A 4QX2A 3MIHA 3QQAA 4WM8B 2NZ9A 5LHGA 2ZTNA 4LBQD 4MGQA 2STTA 1D2QA 5IFPA 4XKCA 4AIJA 4AWXB 3QU3A 1SD5A 1N3PA 2DYSH 1YJKA 3A0NA 3LDBA 3FM3A 4P9JA 1ODDA 3PJQA 2V4JC 3O8HA 1ZZ6A 1FATA 2E51A 4B09A 3VBOA 1HB2A 3H1CA 1FV3A 3FL7A 4DYQA 1OURA 1H8AC 1W8WA 3DXUA 2JD9A 5GLTA 4U0YA 4UB8C 3BR3A 1TQMA 4MIMA 4DB5A 1UZCA 2HOSA 1JYWA 4GH4A 3WP6A 3WF4A 1TNTA 4NWWA 3LQRA 5D5UB 1JI8A 2C0ZA 4TXWA 2XAJA 4GYIA 2DUOA 4YVSC 3BTAA 4GH4C 1WLWA 3EXUA 2G9ZA 4BJ6C 1ZYBA 1Q8SA 1NCRC 1WBLA 3RSNA 4BCUA 1XE7A 4ZDPA 1ZRDA 4CU9A 2A3WA 2NVQJ 5T52A 2JDNA 2XLGA 3L2UA 5AVPA 1BHGA 5JIAA 2BV4A 3T08A 1TNRA 3J8F1 2QQ9A 3GZTB 2D6LX 4YM0A 3S7EA 3PUIA 3HT1A 4OULA 4QPOA 3LQCA 2RE9A 5FMBA 3DYMA 3HOBA 2WWYA 2FD5A 4RHV2 1LRHA 4XQDA 1U5IA 5IK8A 3K4CA 2DI3A 3VDXA 4D94A 3VYSB 2DF7A 1R1ZA 4KJZA 3HJEA 2ME0A 3A0KA 1REPC 1D4M2 1WA6X 1J3PA 3CCSI 2DFCA 3GZUC 4Q4V1 2VMFA 2GIZA 5BNOC 4P1WA 4M3EA 3MLJA 5L7OC 1XDSA 4DXSA 3PUBA 4K8RB 4FISA 4BS9A 3J7AY 1US2A 3OTFA 2MH9A 4CXYA 5LBBA 1MACA 3VBOB 2BNNA 2PMWB 4UW5A 2V6EA 3CJRB 5L3BA 3HC7A 3AXDA 3AG3H 4O9GA 4M74A 1UIJA 3LSMA 2ELHA 2DU0A 2OTJI 1MJ9A 1FAYA 1KQRA 3VD3A 4HLYA 2JG9C 1F36A 3NV2A 5CZKA 3ELKA 5KAFC 3GTGJ 3E6DA 5JOXA 1DFQA 4DRRA 4PFPA 2EFWA 5BPIA 3KCYA 3OYDA 2XRNA 3HOTA 3DECA 3VBRA 1F4HA 4JYKA 2ZGPA 1LDDA 1O57A 5EYXA 3N3HA 4J01A 3A01B 3MMYB 3T0AA 2VOVA 4I0BA 2EXIA 2YPJA 1COV3 3DCFA 3D8CA 5CFDB 2VMGA 3ZXLA 5EV7A 2LR8A 1NY71 4E27A 1VZ0A 3ZR6A 5J96B 2ZGKA 4V19K 2W1WA 5F39A 2VCMA 5DMYA 2R7EB 3FUQA 2KM2A 1QWRA 2EALA 1S8NA 2PN6A 1JZ6A 3I97A 2R7DA 5BY5A 4BQNA 3K1MA 1EAH2 3A7QA 5BPDA 3KPHA 2ECCA 2FX0A 4AVZA 1NLQA 1BMV1 3B02A 3WZ1A 2GNMA 1IN4A 3GTQJ 3AFHA 1TQIA 3DKWA 3M3EA 1MJAA 1JS9A 4XXAA 4XFCA 2J1UA 2YROA 1EV12 1UQXA 2Y34A 2WJSA 3LSKA 5FPLA 1RC9A 4DUXA 1WMXA 4FE7A 2L9RA 2FDIA 1LFPA 1MNDA 3DPLC 3LSEA 5JUVA 2WIIB 2ID6A 1QJZA 2O5RA 1GUIA 4QDSA 1Q8QA 1VBA1 1E2XA 4XOTA 1Y9GA 2I5UA 2WYSA 2Y6GA 3IZOA 1KS5A 1LE8A 3WG3A 2XHNA 2X85A 4M3GA 2R061 1Z3YA 1LE8B 4FHTA 3ZXEA 2V1NA 4GYGA 2ESNA 5JI9A 4HETA 5L9RA 2F2EA 2Y2ZA 1ETYA 2ZJ2A 1G59A 4UF0A 1YRNA 1QHGA 4DMIA 2NXNB 2Y6JA 2VKEA 3T8RA 1BYHA 4GMP0 3EB7A 3NNFA 3CJQB 2GDFA 4YW3A 1QJX3 2MFZA 4RFRB 2HQAA 1AF9A 4W4ZA 3TP0A 2P5VA 4A12A 4GWMA 3SKVA 3V64A 2D45A 2GSYA 4MHUA 1T38A 1BW6A 5DN2A 4CTEA 2PYTA 2Y6HA 2VU9A 3DWLE 4XN0A 1ZBA2 3GEZA 5AIPA 1X7NA 2Z33A 4BHBA 5KCMA 5IYCJ 1KDKA 2WNUC 2AYHA 3I59B 4C2MJ 1OJLA 3W6VA 2RQPA 3AMMA 3MEPA 4UVCA 1C57A 3RPUD 1Z0XA 3K0LA 1JZ5A 4HN1A 3K9TA 3Q9OA 4MADA 1EF4A 3F8MA 1TP4A 4BQQA 3TNPB 1UKGA 1YE9A 2AEZA 1AYN1 1JUMA 4JOMA 4I2OA 4CP1A 2W24A 2VULA 4FPJA 3DBLB 3OMYA 3LAGA 3K3OA 1F5FA 3H5NA 1SEUA 1C0WA 1NG7A 1GZWB 2A6XA 2ARAA 5A2QK 5F8PA 1XSXA 3F21A 3M1HA 1BEV3 2HOTA 5B2GB 3AKRA 2HDCA 3QP6A 3H0GJ 4LO4B 2OUMA 2VBXA 3TN93 3GTMJ 3JB8A 2XG3A 5EF6A 1H8TA 3G6EI 1QJY3 3WGIA 1ZLJA 5IAVA 1C8M2 1VBC1 4NMIA 5HV4A 3QYBA 3MUY1 2VN2A 1H2LA 2LALA 2VW2A 2X5IB 4KU7A 4U88A 4GD4A 1MS0A 1NOVA 1WH5A 2W1OA 4L18B 3K7AJ 2LBFA 3HOSA 2PJRB 3IKVA 1RR7A 5L3GA 1BI0A 4YSFA 1PVEA 4UW4A 2QSHX 1ND2C 3L2VA 3AM2A 2ZEYA 4XN3A 5A1AA 4OIRF 5F3GA 3KP3A 1QXRA 2QENA 4MG2A 2CQNA 1COV1 2HEYF 1E5RA 1MMAA 3R4UA 3LDKA 3ZSMA 2EXJA 2NMNA 5DABA 1T6GC 3H1MA 4FOVA 2XROA 4A3KJ 3U14A 1WW4A 4B47A 1AR93 2KL4A 2Y0IA 5EJ1B 4Z2YA 2LC2A 4IXAA 5IVJA 4EE2A 1GV5A 2LS6A 1UWWA 1VNDA 3F8NA 3ASIA 2EZLA 1ZA4A 1WGPA 1HX6A 2A6TA 2GOXB 4L11A 2UY9A 4IPAA 3A22A 1M4WA 1PGW2 4Q0PA 3GF6A 3CC2I 4EQVA 3SHRA 2Z3YA 1FMD1 3PO2J 1QRYA 4LBKA 1YQ6A 2L9SA 1STMA 4G9YA 3TEWA 3KYDB 2GC1A 2LDUA 1APLC 1CESA 5JHFA 1LDKB 4IHSA 2F6BA 4CDQC 4PFOA 1S0FA 3AYAA 5D1IA 2VJJA 3CCYA 5B1AH 4UWDA 2FSWA 5A7NA 2UWCA 3VHPA 2YU9J 5E3NA 4M71A 2MD0A 1A6QA 3M7GA 1TNSA 3I2OA 1PGW1 4UFMA 5C44J 5C5UA 1IOAA 4JV4A 2WQ4A 4PCQA 4RQPC 3DL3A 1W06A 4ASNA 1YHFA 2K9MA 1R4NB 3HBLA 2ZEWA 5C3SA 2VJ5A 1W0OA 2F6CA 2XMLA 1RMU1 2WUHA 4W50A 2P4EA 1XQNA 1BLZA 1VQ6I 1IQDC 2RV8A 3CDLA 2OW4A 2WZR1 2VUCA 3P1IA 5FREA 4FFGA 3ABLH 2D5HA 1JKRC 4ZXEA 5K1YA 2CFOA 4JX6A 3H1YA 3LWCA 4AQ2A 1X4OA 4GCVA 3VKFC 4FOWA 1WCDJ 4CDXB 2CW8A 3ILNA 1X8EA 1X50A 5C3PA 4UUVA 4HLXA 4XZPA 2DCZA 5DZGA 4HZFA 4CO8A 1UHSA 2R3SA 1Z7LA 5DPNA 5FPZA 1BMV2 1QDCA 3WD5A 1RRJA 2EVXA 3LQQA 1ND3C 2ZEXA 1S7AA 1YTYA 5FXXA 3DKXA 2ESHA 1AXYA 4FPOB 2Y31A 2MBFA 1TWGJ 1PVXA 4LORA 3T09A 1OKQA 1PK6A 3MBWA 2PEXA 3P5BA 3CCEI 4EM2A 3SITA 1JTXA 1GNHA 4R4ZA 5FZIA 3UL2A 5DAXA 4AI3A 2DWRA 3BZKA 3HD8B 3EJKA 3N97A 2YC2A 1D3YA 4F3QA 5D2AA 3R6SA 4AVPA 4L9VA 4CRQA 1FSEA 5FYIA 5ILSA 4LE3A 2COBA 2Y0SA 3E5QA 4RM2A 2NNYA 1ZBA3 4J6GA 4GALA 1BBT1 2JDYA 4PLMA 2VKDA 1G9AA 3ILRA 2FNAA 1UIKA 3HRMA 2VE9A 1OYYA 3SH5A 2NS7A 1U78A 1MZEA 2RG4A 2XUMA 1F43A 2W68A 2QUOA 2WT1A 4KNYA 3RQ0A 4HONA 2GN3A 4ZYGA 5CFDA 1G6NA 1O3RA 1JT0A 4XAEA 1RUG3 5CJ9A 5F5IA 2JG9B 2CS3A 3FFZA 5FY8A 1DU0A 3PIPF 1V6LA 4YG2F 1B8IA 4AEMA 4V2FA 1PO13 3HNMA 3GCWA 1Z67A 1FP1D 4P5OA 2HKOA 4CU8A 5IT9K 3ELNA 1QH6A 1CZTA 4RS5B 1K5MB 3DEUA 4A3EJ 1UAAA 2A3SA 2D6KA 2A5ZA 1RR8C 3VL9A 4BK4A 4CCJA 2YYOA 1HKQA 1V6IA 1YFUA 5JMOA 2KHMA 2QCSB 2HNHA 2GNTA 4J00A 5L9BA 2Z1DA 4FFIA 1H1AA 5BNQA 3WLUA 3BG5A 2Q2EA 1KS4A 2DT6A 4QQHA 4HKWA 4ZYAA 4IV3A 1F2NA 3CD6I 1ZREA 4OLLA 4R1HA 4AVVA 1GQHA 4M6VA 2W92A 3VBSA 4MGZE 4IF4A 2ZOEB 2FCUA 1FOXA 2RDQA 2XOMA 4LLOA 3T4HB 2P37A 3ZQQA 4LOTA 1IG7A 5LBCA 2VGDA 5FY1A 2OT7A 4XYXA 3ZXKA 1O59A 2H1KA 5CVJA 2EIDA 3MKWB 1LNSA 4WV8A 4P9IA 2OV7A 3HN3A 1KGYA 4XKWA 1WWYA 3CCUI 1SEFA 1PIV3 2RR13 4W6WA 1UZWA 4DEQA 4L5EA 3SQNA 3HRUA 2OCCH 2A70A 4MTDA 3IDCB 2M2EA 1SVMA 1A35A 2HQNA 2LY9A 3AL6A 1IQAA 3LIHA 3BPVA 2DCJA 3OBAA 3RIRA 2HEOA 5DAWA 3JUUA 1ENRA 1CJDA 4P9UA 4Q4ZF 1RI7A 2OIIA 4Q26A 2VOTA 3N9OA 4KBBA 3ZXDA 3WU0A 2WSUA 4BLIA 3LZZA 2A6YA 3WNXA 4ZTFA 3DBRB 1ZKGA 5A3WA 3U75A 4OHZA 5M5XJ 5EZWA 1RUOA 1WWXA 1Z05A 4N9HA 1WKYA 3PVNA 2C26A 4NBQA 1DQ2A 2HR3A 1W9WA 3RPUA 3ZPLA 2BZDA 5IVFA 1IPKA 4AFBA 4D3WA 3LOBA 3ROUA 1ZRCA 2RJ2A 1UOJA 1NCQC 4K40A 2ZX4A 3KVAA 1RKTA 4IRGA 1EPWA 1IRFA 5H9PA 2F4OB 3FLRA 2D98A 1E5IA 3EPZA 3S1QJ 1FNZA 3HHHA 2FDKA 4OIPF 4Q4W1 3KCCA 5LZ6A 5DDJ2 3ZMVA 3WDTA 3OCPA 3ZFGC 1FZPB 1BXHA 1V9U3 4YW7A 2VBWA 5GLUA 2P7CB 4GXOA 4LK1F 2DU1A 1VR3A 1I1EA 1TME3 4FT8A 4XF9A 4CYCA 4ETSA 1WVRA 3CQOA 4J19A 3AC0A 1Y6IA 5IY5H 1DG6A 4DY5A 4M9ZA 5FY5A 2QEXI 2DUPA 2BVMA 2BGPA 2VTXJ 5LA9A 1HB1A 4N43C 3OEBA 5IT6A 3EYYA 3PO3J 3K2ZA 5GJ6A 4LFUA 2QE3A 4QGLA 5DZFA 4YW1A 3PQJA 3GO5A 4S2DA 2NAZA 4RB1A 3CDZB 1UZZA 3JB4C 1K5MA 2E5NA 1FPN3 1M06G 1OOPA 2B45X 4EJWA 1YQ2A 4UY8I 1ON2A 1JGSA 4PDWA 4LPLA 4K6BA 4C3IJ 4DNYA 2Y6LA 4ARYA 4F52A 3UGFA 2VQTA 1YO8A 4BEHA 2H6CA 3I2IA 2BOIA 3KV6A 3UJQA 1X1AA 1UYYA 3CIHA 3JSPA 4BLJA 1LGCA 2CWSA 2LP0A 2R30A 3V0AB 2Y9ZA 1HC8A 4HV5A 1GWKA 1B59A 4HNUA 4ATFA 1MMGA 4OWRB 4XNFA 1HXDA 4ZYHA 2X0LA 5IVYA 1FC3A 4HN0A 4KNCA 2FDHA 2WRAA 3GWZA 4HDUA 1ZM1A 4JGYC 1VQ7I 4ASKA 5FZBA 1AXKA 1PIV1 2R043 4EZ4A 1T2KA 5E17F 1PDNC 2VKVA 2ZB9A 2ELJA 5BPXA 4II2A 3WTXC 1S3JA 1EUTA 2XASA 4LULA 2IXIA 1QJU1 5F0HA 2M3AA 1UD1A 3IIIA 1XMAA 4XJAA 3MN2A 2R49A 1GXQA 2ARXA 3I8TA 3MI8A 3CJXA 4BQWA 2KMUA 4KITB 3OR1C 2W52A 4R79A 4BMEA 4D6RA 3C2UA 4Y13A 4YGEA 3AL0B 1SDWA 4LUKA 2B42B 2XC7A 1G3SA 2XHKA 5K0UB 2UZKA 3HN1A 3DKQA 1HLCA 2G9GA 2R041 3WQ7A 3WQ0A 3D0JA 1BKZA 3TOBA 5CFCA 1UJ8A 2CQXA 2FA5A 3DBHB 2VZTA 4N7UA 2W82A 4BAYA 3BR1A 2H8WA 3F8BA 1RUI2 3VUOA 2TEPA 4L9JA 3R05A 1YW8A 3C7EA 1ZZ9A 3T2QA 1AR73 4COUA 5J3UA 2YGLA 4XW3A 1YYVA 4XFBA 5F0CA 3HOZJ 5HNFA 4DUVA 4QX1A 1WW6A 1Z7S2 2KIQA 1XG1A 1XX5A 3OS2A 1V9U2 2CUJA 5EQUA 2HXOA 3OOPA 2Y9YA 4XFIA 4WWCA 3D5RC 1GWLA 5GAGJ 2R92J 1POGA 3T2PA 4KU8A 4ZU4A 1LJ7A 3KT1A 4BQ3A 4XRSA 2CYYA 4IHWA 3SISA 3GFMA 3OSFA 3TOJA 2WS92 5I0UA 2W87A 3Q5FA 2DPUA 3K70D 3HQRA 5FMCA 5FRMA 3I2JA 2PHRA 4OVEA 3H35A 3PTRB 4MO7A 3FHNA 1E3OC 3U1KA 3HOUJ 2OJED 2ECBA 2IXCA 2NS0A 3GLLA 4JGYB 3E97A 5ISLA 2A5WA 5FJHA 2WADA 3GXOA 2JA5J 1JOJA 4PIXA 2XQRA 1W4MA 1KZHA 2DCKA 1OLQA 2K5CA 1IN6A 2J1EA 3ZQLA 1JZ3A 4XDOA 4NOTA 2X1DA 4HKOA 3LMMA 1UX7A 5FLMJ 4PF5A 2ZXJA 3G1MA 5EPAA 1W6MA 3VZJA 5DM6F 1H8TB 4IV3C 2IA0A 1AVBA 1XC5A 1MVQA 3DUIA 1EH8A 4JX5A 1GU3A 3BOPA 2B4KA 3IP4B 4XJWA 1KQ8A 4JP0A 1NH3A 5M3FJ 1VBA2 3ZP5A 1N1YA 1X1BA 5KR7A 1H8VA 2BGOA 3KLSA 4GMP1 2BERA 2W47A 1OQYA 1CQ9A 1RUJ1 2Y48A 3W6JB 1EKEA 2EV0A 2RR12 4G8XA 2ENRA 3AL5A 3ZN4A 3VBHB 2VODA 4CCDA 1KD7A 3G2BA 1AL22 1W6MB 4KYWA 2GP5A 3Q8CA 1QKQA 3S14J 4B7EA 2Y60A 1B09A 1W36D 2FBHA 1W8ZA 3NKGA 1GOFA 1PZ9A 3RZJA 5IAXA 5E16A 4BPZA 2Z5UA 2ZBKA 1BI1A 4CICA 1PNGA 2W39A 4RGRA 3REOA 5C9AB 5F6KA 3IAQA 1MW7A 4FPFA 1K79A 2EXHA 3SDGA 4XKBA 2PHLA 1JYTA 1FEXA 4CSWA 3KX2A 5JVTA 3G73A 1CZSA 4FTHA 3BOQA 4JBAA 4ESFA 3TQNA 5FO5A 1RUE1 5E20A 1OA2A 2YY1A 4Z07A 1EAH1 2RDNA 1ENXA 2R7QA 2VO5A 3TW7A 3FXUA 1H2MA 1QQIA 1W8HA 3CCJI 1AR63 2DA4A 2MH2A 2IGKA 1JW6A 1LOCA 1XYOA 5IP9J 3RJRA 2QYOA 3FHQA 3LWFA 1D1BA 4BQYA 4BISA 2CUZA 3NVCA 1CF7B 1QU3A 1FXZA 1GYKA 2EWNA 4MGKE 2RS31 3TDZC 4JDMA 3PIGA 1XS9A 3X29B 3D1NI 2VL4A 1YJ9I 1AR81 4QT6A 2ILMA 2WWSA 1MD0A 2KQRA 3WG4A 4ASLA 2IVMA 2W46A 4HG6B 2VZUA 4NROA 4NPMA 4LLFA 3TNQA 5IYBJ 4U7BA 2R7WA 5FKCA 1YEWA 4NDLA 1ULPA 2XUBA 4YIIA 1W3VA 2V4AA 2O03A 1N77A 1B35A 5FP7A 4MZUA 2XVKA 3ZDSA 3KMHA 3RDIA 1C8M3 2KLOA 1XU1A 2WZR3 3KYLA 1WCUA 2W25A 2M7BA 4A3LJ 5I0TA 3SZPA 3BWGA 1OLRA 2OD5A 2VB6A 2UUZA 4A0ZA 5BQTA 4QXHA 1A6CA 5FAXA 1FMVA 3BZCA 2OPKA 3U37A 4CDWC 4XLCA 3RMXA 4ESBA 1E3HA 5ACA1 2Y0SN 3BCAA 3H8XA 1PNFA 4A4AA 1RJ8A 1MDMB 5DS9A 1G4DA 3VBUC 3WF2A 4CEYC 1JJ8C 4PHZA 5C7GA 1YI7A 1NLSA 4CZSA 2JRMA 2PI0A 2ZX3A 1UYZA 5FLHA 3UK9A 1NQJA 3TMOA 3OIOA 3CU7A 1YRZA 1C8M1 5FMDA 5JOWA 3W9AA 2P34A 2K02A 1PZ8A 2EIGA 5TGTA 1FTTA 3RJ2X 2YU1A 3RMYA 2R7TA 3EQEA 2KDZA 4WX9A 4H7MA 3ZMDA 2GOMA 1PUFB 3SFZA 1MEC1 1XNTA 4MYEA 4YW6A 2FMDA 5L7OA 3GW2A 1RESA 5BNNA 3H9QA 5LCWL 3BIWE 2W4SA 5CPRB 2JJ6A 3SC7X 1W9FA 4EGZA 4TYSA 1NXD1 4Y4YA 1R7JA 4TV7A 2F4MB 2ME6A 4OINF 3LFIA 5HXMA 2M4KA 1V6JA 4B29A 1H30A 1ZX5A 5JXJA 1Z6RA 3MDPA 2KRCA 5BNOB 4L9TA 3GMEA 2HWF2 3KLOA 1I1SA 1GR3A 4META 1QVTA 1O8SA 2IXLA 4QDQA 4QWNA 3HQUA 4Q1PA 3VD5A 2K7LA 2WFF2 2WB1A 3HZJA 1IXRC 2A6ZA 2JG9A 2H8RA 5FPXA 1PUFA 3N7JA 2JIJA 1ZARA 5GLZA 2ZKLA 2PMHA 1EP0A 2DV9A 4YW2A 3BU0A 5CVIA 1IZ1A 5J4YA 1XCBA 4CCLA 3F6VA 1DGRM 4B3XA 4IE6A 1W99A 3LA7A 3GTPJ 4XXPA 1XB4A 1UU6A 1WW5A 2M9HA 4DS0A 4QU2A 1E5HA 2D97A 1SANA 2DVFA 1LFUP 3IKWA 5FKOA 3L2CA 4DXZA 2GN7A 1XRUA 2TBVA 1UB9A 1K45A 3FC0A 5ERIA 3O1RA 1PZ7A 2WBMA 1Q1VA 2PHFA 3BODA 5A32A 1MZ5A 4RBOA 5DCMB 1OXCA 2FRHA 5IPAA 3B93A 2HEVF 1OUXA 2RM22 2RS32 3RI4A 4AIKA 2XV4S 1FWZA 1J84A 1EAH3 4C0BA 1ZYRF 2E53A 2O6GE 3ZYJB 2IW5A 3M1EA 1HCRA 4O3MA 4EJOA 4QIWN 1GZCA 2DXIA 3VBUB 4LKEA 4CEYB 1LAJA 3DCQA 1WJDA 3HEIA 5DEQA 3CLOA 5ABJC 1RUJ2 3JTGA 1IUFA 1UHWA 4OIQF 1HIXA 4Q0VA 1C5IA 3OF1A 4E7LA 4JDNA 1QU0A 1R71A 1AL21 4MFEA 3H8OA 1DGRA 4DIQA 3JRHA 3AZYA 2VT2A 1W9TA 4QPGC 2CW7A 3MIGA 5FTTC 4U0VA 2PMUA 1O4TA 3GHNA 5F5AA 4BIOA 1PUEE 4CZZA 1LESA 5CEHA 2HWC1 1CPMA 2DQLA 1H9WA 5FY4A 3SZGA 3MWMA 1GZTA 1D0GA 1WZXA 5HNHA 4NHXA 1VFCA 2QNKA 4KIBA 3OYGA 1J3RA 3K10A 5J1UA 1C4RA 3S5QA 3RI9A 3EUHC 4IV1C 4RHV1 1IDYA 3IIAA 4AI8A 4BJ0A 2COMA 2V1DA 2EZIA 2AACA 1JZ7A 2BV6A 3GGLA 2ET7A 3NL1A 5K7HA 2M30A 3RCOA 3C2HA 2LLKA 3OBZA 1SFUA 2DURA 4HSRA 3DTIA 3NWTA 2WLPA 1A6IA