4CCLA

X-ray structure of e. coli ycfd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
372
structure length
371
Chain Sequence
b'MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L16 ARGININE HYDROXYLASE
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 79
structure length 371
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4cclA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4cclA01
5FZEA 2YBSA 4IGQA 5FY4A 3K3NA 5FY8A 4C8DA 4DIQA 5IVJA 2W2IA 5FYTA 5FZIA 5FP3A 5A1FA 4QXHA 5E6HA 5F37A 5A7WA 5F32A 5FPVA 3DXUA 2OS2A 2OQ7A 1VRBA 4GJYA 4GJZA 4CCLA 3AVSA 4XDPA 5A7SA 4CCNA 5FZMA 4CCKA 5FWJA 2XUEA 5FP9A 5LW9A 5FP4A 5FZ9A 3RVHA 3N9QA 2WWJA 4QXCA 2OQ6A 4HONA 5FBJA 3PU8A 5FY7A 5FZ8A 4EZ4A 4AAPA 5FPUA 5F2SA 5F39A 3AL5A 5FYHA 5FZ7A 4BISA 5FPAA 2GP5A 3AL6A 3LD8A 5FZKA 4D6SA 5A3PA 4UF0B 5F5IA 5F3IA 5FZ3A 5FYMA 5FZ4A 5FZ6A 2GP3A 5FXVA 5FZ0A 5FWEA 4Y4RA 5IVYA 4QXBA 3ZPOA 4XDOA 5FY5A 3N9MA 5FZAA 5FP8A 4Y3OA 4GAZA 5FY0A 5A7PA 3KV4A 5ANQA 5A1LA 4BU2A 5FPLA 4LITA 4E4HA 4V2VA 2WWUA 5A7WB 3U78A 4Y33A 5FYBA 5FZLA 2YU1A 2XDVA 5FY9A 3K3OA 4V2WA 5F2WA 3LDBA 5FZOA 5A7OA 5LY1A 2P5BA 3PUQA 3N9NA 4QX7A 3ZLIA 5IVCA 5FZCA 3AVRA 5FYZA 5CEHA 4CSWA 4D6RA 2VD7A 3NJYA 4CCMA 5IWFA 4ASKA 4BXFA 4TN7A 5FP7A 5FXZA 5FYCA 2YBPA 3N9PA 3OPTA 5FXWA 5IVVA 3N9OA 3PU3A 5FUNA 5FZHA 2Q8EA 4IGOA 4QX8A 5FZFA 4QWNA 5FZBA 3KV5A 5F3GA 2Q8DA 2XXZA 4CCOA 5A3TA 5A80A 2YBKA 3U4SA 5F5AA 4EYUA 4HOOA 5A7NA 5IVFA 4CCJA 5A3NA 5F3CA 4AI9A 3KV9A 3PUSA 4DO0A 3KV6A 4IGPA 5FYUA 5LWBA 5ISLA 2YU2A 5IVEA 2OT7A 4URAA 5FV3A 4GD4A 3KVAA 3KVBA 5FYVA 5A7QA 5A3WA 3N9LA 5FZ1A 3PUAA 5FJKA 5FZGA 4LXLA 4LIVA 5FZOB 3K2OA 5FYYA 2Q8CA 3PURA 2XMLA 5IVBA 5IW0A 5FXXA 4D6QA 3PDQA 5F5CA 2OX0A 3DXTA 3UYJA 5FPBA 5FJHA 5FZDA 4LIUA 3OPWA 5FYIA 5KR7A 4CUGA 4NUBA 4QU1A 2PXJA 5FYSA 2YPDA 4UF0A 5FUPA 4EZHA 5F3EA 5K4LA 5FY1A 5LY2A 3PTRB
chains in the Genus database with same CATH superfamily
1TT5B 4C8DA 3BVCA 3OSFA 3ZR6A 1H1IA 3UGFA 3DXUA 3CMMA 2QQAA 4MZUA 3WTUC 2FDKA 1DQ2A 2UWMA 3ZMSA 4KNCA 4EGZA 4OHYA 3I2FA 5CJ9A 4CU8A 4COVA 1WW5A 3GTJJ 4A7YA 5K0UC 2JDYA 4B4RA 2LC2A 3R60A 1KJLA 2GP5A 3HBLA 2OPKA 3VZLA 4YM1A 1NE6A 1C4RA 3RZMA 4QB1A 2PHWA 3KGLA 3TMOA 3T4VA 1R1VA 3V8JA 4MXWA 1YW9A 3WU2C 4B4QA 4MHRA 1ZBE1 2C1FA 2Z42A 3UJOA 5FY9A 1QPMA 1HKTA 4DRVA 4LA3A 2IGKA 2JSPA 3CDIA 4G7HF 3JB4C 5GPAA 1H1AA 4Y15A 1O7LA 1WMEA 2VQLA 2XKPA 2OV7A 2WNEA 2H8RA 2JEMA 3TDZC 4B1MA 1FWZA 2XOMA 4GB33 5EEGA 4RM3A 3DEUA 3L2HA 2EIJH 1ZZ8A 3QLQA 2C6SA 4Z2YA 2YU2A 4E4SA 3I5UA 3HAGA 4XF3A 3OSGA 2LY2A 3POBA 2ZOEB 3N9LA 2QQLA 3J8F3 4EM0B 3BTCA 5DDJ3 3B01A 2SBAA 4FTSA 3HOWJ 4AEJA 3UV9A 4LLNA 2PELA 2HWB1 4IPAA 2IFWA 2M34A 3A01A 3S3OA 1JXSA 5ICFA 2CAVA 1X58A 3T2OA 2ESNA 2H0BA 3VV1A 5EZHA 3M70A 5AC92 4ZXEA 2IAIA 5D5WB 2R7OA 2WYFA 1ODMA 4FPLA 5HDKA 1PUFA 2GMPA 4AHXA 1H2KA 5IT9Z 4A3GJ 1W0UA 2M87A 2C4XA 2FZ1A 1QRYA 1X8EA 4QGNA 3DU6A 4LK7A 4QQLA 1PZ9A 5FREA 3M8LA 3FXRA 2JDNA 5GZEA 4CA0A 5DTDA 1VNDA 2P0WA 4V2VA 2KDZA 4P5HA 1RI7A 5IY5H 1G59A 2K3FA 3OF1A 5J09A 3VBFC 5CZKA 4LA2A 5BUVA 1REPC 4PDKA 2C6YA 2D98A 3R61A 4A5NA 1PX4A 3HOSA 1OKOA 3M8EA 4IGOA 1O6UA 2DCYA 2XLFA 3KS7A 4ZTFA 1O5LA 4CCJA 5ISLA 2DT6A 2Z33A 4XABA 3OGJA 4EJWA 3WP5A 3OS0A 4L0ZB 2VBWA 3Q9SA 1WH7A 2KDOA 4MADA 5FMBA 4FISA 2XJPA 2ES3A 3K2OA 1O57A 2VE9A 2QSFX 3ZN5A 2HWVA 4Q26A 3AMQA 2NZ9A 4GXLA 4BQ4A 5F8PA 3JREA 2EK5A 4FPHA 3BZ6A 5M5XJ 3ZSLA 5DN2A 1CPMA 1NCRC 4D0QA 2WIIB 4FQZA 3EO6A 3L2RA 1TLHB 1V9U2 2E2IJ 2K2SA 1W5CC 2HWC1 1X50A 1DDNA 2ZXWH 4N4OB 2Z69A 4EMSA 1PO23 4EZ4A 2E1NA 3MW4A 4CGZA 4NR1A 4KT5C 1ENSA 4RS5B 3ME2A 2VKHA 2BHYA 5FROA 1K4TA 1DU6A 2VBPA 4NC6A 1ND2A 3H5RA 1VBC1 4ONUA 2HGCA 4YARA 2GNTA 1BYHA 2BDRA 5CFCB 1UU5A 2LROA 2VAUA 1WCKA 2WFF1 3WDVA 1I9RA 2B4KA 2QBYA 1RUG3 4IL7A 3VBRA 4DXRA 3ZYFA 5IP7J 4L9VA 1ZGJA 1XCBA 2DCZA 3WNXA 2RKHA 3KCXA 2O3FA 4XFBA 1KDMA 3KV5A 1RC9A 2MC3A 2X1DA 5A80A 1RHI1 5F5AA 4MEYF 1CAVB 2ADEA 3HRSA 3RWKX 1IZ3A 1GBGA 3M3YJ 4NO4A 3NV3A 4OHVA 1PNFA 2IZWA 2VQ0A 2NOGA 2V7FA 4FX0A 1DGRM 1UYPA 2EZHA 2W3JA 4XF9A 3F21A 4BGDA 2K9ZA 3WF0A 5HODA 4IXLA 1YJLA 4AVCA 3BCBA 4AVZA 3O1MA 1Y56A 2ZX0A 2H6CA 3AXEA 4GKYA 2OPTA 4A3IJ 3H50A 4IGQA 3VBSC 1WCUA 2VZOA 4G8XA 5CVRA 4H55A 5FR3A 3LGRA 3HL2A 4JDMA 4KN7X 1U6GA 1N1TA 1WCDJ 1R5HA 4GQ7A 4OVEA 4NRQA 3BKZA 2K27A 4XN3A 2HBTA 1NCQB 4LOSA 1IGOA 1B09A 4K1ZA 2Y38A 4J01A 4LKSA 2WWSA 2JG9C 1PVC3 4JC1A 5A7PA 1WI9A 4Y1VA 4AVAA 2QEXI 1P2FA 1K12A 4C2TA 2XDVA 5ICGA 2O8OA 4CEWB 4S0HB 1UAIA 1MVQA 2NS7A 3W6JB 3VBHA 5J8CA 2QQOA 1UB9A 5IP9J 1R36A 1XE8A 4CHUA 1SEFA 2JE8A 3HPHA 4N9HA 5F3GA 4Q4V2 2MH9A 3KM5A 1ULPA 2VULA 1G3SA 1CZSA 3RSNA 4Y13A 2QZ8A 4HNVA 4CCEA 1WJ5A 2FEZA 3IH4A 5JR7B 2ZAHA 3UKVA 1QVTA 1GZ9A 4YWAA 4P9GA 5C9AC 1GZCA 4MXVA 1RMU2 4DQ2A 4OWRB 3CCUI 4XETA 3ZQCA 4CUAA 1OOPC 1BQPA 1AOYA 2J1TA 1E3HA 3C1DA 1UHSA 4Q0SA 3IZOA 3FWEA 1R091 4IO9F 1R4MB 2JN6A 5IHRA 3GBFA 3HVDA 1OFNA 3DPRA 4UV9A 1YO5C 1Z6RA 2DFEA 3FXUA 3SH3A 3FKJA 4P02B 5F1RA 1RYYA 1LR5A 5KHGA 5CB7A 1K6OA 4A45A 2E5NA 2XAFA 3PVOA 2QUFA 1QNTA 4BHBA 2HBUA 1ZLKA 4FOYA 2JE9A 3WW1A 3CJIC 4GAZA 4Y1XA 2M5WA 1B8IB 4LBJA 3HG9A 4BIOA 2HWF1 4AQTA 4CPBD 1YFWA 1I1SA 4XLFA 4DBQA 1NY71 3KCYA 2OYZA 2HQAA 4NMIA 1RUE1 4ESBA 1NK2P 4EE2A 1SLLA 4XURA 3ZXKA 5C3EJ 3AP4A 1VPHA 1PGW2 1GOFA 4IXAA 4ZJZA 3URFA 1HQNA 4NRMA 4A7ZA 4RSUA 1R9TJ 3BODA 1T08B 1KGSA 2WZEA 1VQ4I 2GXBA 2ZGTA 3A0HC 1AL22 4TLGA 4PUSA 2MFZA 4RGXA 1BBT1 2AH2A 1ZBA2 4M6XA 4DW6A 4HBLA 2M4KA 5DUIA 3NNJA 4QTRA 1MNDA 2HXOA 2VOWA 1DZRA 1KEXA 4HBNA 3OPZA 5EFUA 5LHGA 3F22A 3DTEA 3MAJA 3CDZB 4KGGA 2VTXJ 4QM9A 1FMD1 4NWWA 2P4WA 4KWKA 2JJ7A 1AYN2 5HXVA 5KC5A 3I2JA 3RI9A 2BXYA 3JZVA 5DPNA 3K4AA 4PF5A 4LO4B 3TEYA 1S7EA 4LORA 2X85A 4ZKTB 4RYDA 3A0BC 1OQEA 3AL0B 1LHWA 1LU1A 5JUVA 5LEKA 2DVBA 1QJX3 1MJBA 1W6MB 2R1DA 5EDNA 1G9AA 1DGWX 4IEZA 2IFRA 1BOBA 1LOEA 2V9VA 3KV4A 3CDLA 3PNVA 1MZ6A 3NMBA 4XBQA 2ZGUA 3RJRA 1ETKA 1W04A 2X4HA 2W7NA 1B6AA 3FUOA 2RREA 4XLHA 4Q48A 2DJIA 4RAYA 4ENMA 4OULA 1VMFA 4A44A 1QQIA 1BI0A 5DAVA 2Y2ZA 2CSOA 4KN4X 3R4SA 3WDTA 3J7AY 2QA4I 4A0ZA 1TC3C 2VOTA 2R7RA 3V8LA 1S2KA 3JSOA 3OUHA 1FP1D 2D97A 3HN1A 1PZ8A 2IGOA 5DXDA 4DINB 2XH6A 2LP0A 4LHSA 4GO1A 4IETA 3SNMA 1R23A 2DK8A 5IW0A 5LBCA 4NRPA 2AO9A 1JTYA 3ERMA 2GAUA 3AXDA 1Q8VA 1UOFA 3IB3A 3OPWA 2BW3B 3WUCA 2CRGA 2K9LA 4UW4A 5D8AC 1RIRA 2IC1A 4AOCA 2M8EA 3LSRA 4XBFA 4IERA 4M01A 5JWPA 4Y5SA 4XK4A 2EF6A 2YC0A 3WU1B 2ZC2A 2BQPA 2XUEA 1KYWA 4N7UA 1I3HA 1UPSA 1D5VA 4BUPA 4BISA 5H6RA 3CL1A 2ARAA 3FXJA 4L18B 1RUD1 2WT0A 1UELB 2MEV1 2Z4FA 4MTDA 3WVJA 2CYYA 5FPLA 1QY4A 2LFBA 2R7ZJ 2HEYF 3KT7A 3I2OA 2YPJA 1S8NA 4BMEA 5CBLA 3WF2A 1FMVA 1Z91A 1EH7A 3CUQB 5K7ZA 3AP5A 3LDBA 2G4IA 2XQXA 3BG6A 4C0BA 3LL7A 1G9BA 1DLCA 5FP7A 2ZMLA 3M1CA 1O5UA 5GLZA 1VTNC 4QX8A 2R4GA 2AS5F 2FXAA 3TN93 3KLNA 2VJ4A 2ESHA 2ZCWA 1Q5OA 3DPTA 3KV9A 3PUSA 2NN8A 5FB2A 1ZNPA 1AKHB 2K5CA 3MHZA 5B4NA 4BXSV 4KMFA 3KVBA 1MH3A 5ED4A 3WV6A 4CXWA 4D6QA 1OISA 2H8WA 2WS92 2OX0A 5JLVA 1I39A 1CVNA 4IRIA 4LB5A 4RS5A 3U10A 5ERIA 4RDUA 3HOVJ 3ACFA 2D6LX 1LOFA 3DLLF 1EJ9A 4P5YA 1LRHA 5HBAA 4FX4A 5A6YA 2YU3A 3CLPA 4W4ZA 1GXQA 1JN2P 3AG3H 4FO9A 2EIGA 4CDQC 4CCLA 2HPIA 3P9KA 1AUYA 1JYCA 1MVEA 4CEYC 3ZDVA 5A6ZA 2W82A 1Q8QA 2Y26A 3MLJA 4MSVA 1SFKA 3WGGA 3FHIB 2JWTA 3HHHA 2RN7A 4Y1ZA 5J6XA 2A75A 1FYLA 3LWFA 4XORA 2CGNA 1CAVA 2DMNA 5SV8A 2JDAA 3FHZA 2WZ8A 3POEA 5C70A 2V4VA 4XHBA 2RE9A 4YFZA 2R7UA 4YSFA 2WN3A 3P7NA 3SJMA 1MS4A 1QQP3 2NVXJ 2BVBA 2OZUA 4SLIA 1LHUA 4FQGA 1F4HA 2VW2A 3JBG1 3PJRA 4LEJA 4A6OA 5I8YA 5I8TA 2DQRA 3FFQA 4YGBA 3RKQA 3DKWA 3HKZN 3C7EA 3EYIA 3W3CA 3Q8BA 4PF1A 2XR4A 3ZR8X 3N9OA 5F64A 3B69A 2ATFA 5JMCA 5A3TA 1IUFA 2YBKA 3KYDB 1POGA 1SLCA 5A7NA 5JPMB 2CW7A 3FBMA 2QQJA 2W08A 5LGUA 3IV5A 3VDDB 5CPRB 4G94A 1OLME 3B7MA 5EXOA 2ME6A 2W47A 3KYLA 1NCQA 1GT0C 3T1BA 1FEXA 1AYM1 1BC7C 1ZZBA 4HZFA 2E7TA 1UF2C 5E89A 3RI8A 3VBFB 2A5ZA 3PTYA 1R5GA 4HX7A 3MKZA 2VJ5A 2GIZA 1DP0A 1XQNA 1W3VA 4AVVA 1OR7A 3J7ZI 5I93A 5J98B 2LLKA 2G9WA 4CEWA 4ZYHA 5FQ0B 5GP9A 2W0XA 3ZIWA 2LF7A 1VBC2 1HXS3 4AAPA 1KU3A 3P9IA 1VP6A 5JVTA 2F5VA 1MJ9A 2DU9A 2KM2A 1CAXB 3AFKA 2ZJQF 2WBMA 3GVAA 3RZKA 4DEVA 2QGUA 1H8TC 2A6ZA 5KXBA 4JCKA 4UI9L 1KU2A 3RYKA 1RINA 2VN2A 1WMFA 1FTTA 2UXXA 4UV8A 4QSHA 1U78A 5IJRA 1XSRA 3GJBA 1R083 3O1PA 4F93B 4IF4A 4JX4A 3DWLE 4XFIA 4NNJA 3I3MA 5FZBA 5JIUA 3LQQA 3THCA 1ULYA 4ISRA 4KIGA 5A3NA 2KA3A 2VKVA 3HGGA 4YIRX 4YG6A 4LPLA 1WD3A 1EAH1 4GD4A 4E2GA 1B1BA 4HNTA 3HPNA 2AQFA 3OS1A 1NA1C 1IRGA 2NXNB 3VD9A 2OQGA 1J3RA 1G3TA 2ID6A 4EM1A 2IGNA 4Z8BA 4FT8A 4B8XA 3D82A 5A2QK 4IE7A 1PVEA 2GU9A 1DCSA 3FC0A 3GFJA 2DV9A 1W03A 2HYKA 2QQUA 1B8IA 5FO5A 1LPQA 4I02A 1JYXA 1HB1A 2DVFA 2LTNA 3RPUA 2D3PA 5DCMB 4YFKF 5FKBA 5ABJB 3GFMA 4HT1T 1HV0A 2XJUA 2JDMA 4QPYA 4YW1A 3DBHB 2HR3A 2JIGA 2IXCA 1ZZ7A 5GZFA 3UT0A 2XAUA 4RGUA 3ON7A 1US3A 2AEZA 4DRRA 2HWD1 3MF9A 1TQMA 3I3EA 4BBSJ 5FYMA 3CCJI 5FZ0A 3HEFA 4DZPA 4GWNA 3NJZA 1VB4A 3W6KB 3NV1A 4HL0A 5E18F 4ZZ5A 2YMZA 2DFBA 1W8NA 1Q8SA 5FAXA 1CAWB 2GXAA 1VR3A 3GZEA 5E16A 4GGGA 3VBSB 3AAFA 1OFSA 1QJY1 3AJZA 4U0WA 1TME3 3WQ0A 1YJKA 3IM0A 1RNLA 2W92A 4EYUA 4OQ9A 4JGZC 1WRJA 4UUTA 1IN5A 3HOTA 1SDDB 4DXZA 2P34A 3TBDA 2L0KA 2WNVB 5FJKA 3DTIA 3WTXC 1R092 4OMDA 1SFEA 5GPCA 1EPZA 1TW3A 5GTHC 2O1QA 3PDQA 3U14A 2JG9B 2IP2A 4PFOA 4A7KA 5JZGB 3O12A 1XCVA 3CC7I 1W6MA 2VUJA 3OJBA 1OYIA 3CESA 4LBMA 4AEKA 3M3IA 2OVUA 5L3GA 3MN2A 4I3PA 1J3QA 1OLMA 3U1DA 3LOBA 4I6ZA 2UXNA 1CN1A 3OBZA 1IGNA 1D4M3 4HX8A 5FP4A 3MLLA 4MH0E 1PVXA 3JXSA 5AVAA 1F4AA 3RMXA 4LJZF 2M0MA 3N4MA 1DG6A 1XE7A 2Y75A 3J9SA 4F52A 3C2BA 3ILNA 3C3WA 2UY8A 2WNUB 4AQ6A 5J1RA 1S7OA 2WNOA 3AM2A 2E33A 3LPGA 3ZPOA 1W7PD 3SYTA 5EF6A 5C9AB 2RMU2 1RVF3 4C1XA 1KDKA 4MGKE 2WWUA 2JUGA 3EQLF 2JE7A 4AVSA 1T56A 2O7OA 2PMUA 1G2HA 4I99C 1WVRA 3CJNA 3VFZA 3DP7A 4JTNA 4F3JA 1FYMA 3L2QA 2LD5A 3GCMA 1RUJ3 3QP5A 2F2EA 4HX4A 2DI3A 2X29A 2QDNA 3IDEA 2VC9A 1W9TA 4P9YA 1U3EM 3KQ4B 2F4IA 2OT7A 4CDWC 1U12A 5FMOL 1O3QA 1JYVA 3Q9VA 1QJY3 3VB9A 2DTWA 4ZYAA 2ZBJA 4X6RB 3CJIB 4LT5A 1FI2A 4JVAA 3W5MA 3SQOA 2LY1A 2PJPA 1O4YA 3I3DA 4PSWA 1U5XA 2XAGA 4AEDC 3CHXA 3GHMA 3C7JA 4B47A 2XBO1 3IBMA 3OR2C 3PIPF 4Q4W1 5IT9K 1HV1A 1ETYA 4M74A 4M6YA 3ISPA 3LA3A 1IN6A 2WA3A 5L9VA 3S2HJ 3CUQA 3A4CA 3CO6C 2J1EA 1R1TA 2IA2A 3O8GA 5BYNA 4HYEA 1XSXA 4JQRA 4OMZA 2OQ6A 2M9HA 3U37A 3HEIA 2WR9A 5GLTA 4XBLA 2NQYA 2CQKA 1OT5A 1GSLA 1W2UA 1UMZA 5C4XJ 4CTEA 3S1QJ 2PQSA 1AKHA 4A3BJ 4Q5SF 4R8HA 1OA2A 1K42A 5JLWA 1SPPB 4QX1A 2DBBA 1YI9A 3CCRI 3NQOA 3K51A 2CTVA 1QBJA 2K4JA 4BXFA 3OBAA 3K69A 3O1OA 1LOGA 4GA9A 2VNVA 3GCXA 3BR2A 3VB2A 3FN9A 2P8TA 4HVOA 3NL1A 5IVFA 1S0BA 1PMIA 4D7TA 1ETOA 1VBE1 3VDBA 4LB6B 2PFWA 4IEOA 3ZKYA 2W1WA 2MA3A 1HBXG 1HRI3 3K4JA 4CDXC 1W2AX 3E5UA 2WZR1 4I0WB 2R3SA 2R49A 2W84A 4UYBA 3ETPA 1ST8A 4ZZDA 3BWGA 2IWGB 3MIFA 2DK5A 4D0PA 2D93A 4QB2A 1P9QC 1JZ6A 1MZFA 2WV1A 1QHHD 2E6VA 3SHFA 1IQDC 4XONA 3MIHA 3NKTA 4NAOA 2MEV2 1V55H 5H9QA 2DFFA 4QX2A 5GKAC 2UV1A 2ET7A 1RUF1 1NYWA 4YVWB 3CMGA 2XL9A 2DBIA 1ZELA 2QJVA 3ZYIB 1T0FC 4XACA 1AR82 3MIDA 4YPJA 3N05A 2HS5A 5JPNB 4YFWA 2E19A 5LK5A 1XGSA 2P3JA 1IPKA 2W1UA 4SBVA 3TNPB 1LOCA 2HWE2 4PLNA 4F83A 5T5LA 2XPWA 1W8FA 5IK5A 4JZRA 1QJFA 1FNZA 3AKZA 3VDDA 5FYZA 2WABA 5D8AB 3U9GA 4UVCA 3CQZJ 1CF7B 1LHVA 4LOTA 3FXQA 3RKWA 3KB5A 3SEQA 3T5XA 1B4AA 2EALA 4YW2A 2BBVA 3RGBA 2BOJA 2PLYA 1YFXA 1DQ0A 3VBFA 1Y6IA 4O3MA 4G9SB 3GZTB 4HSTA 2DVDA 2J22A 2BTVC 1PMJX 3TEXA 3VDAA 5IAXA 3FKIJ 2PJRA 5JI9A 4S2GA 3CZJA 2K46A 2HOTA 2OUMA 1MS3A 5FQ0A 4IE6A 5FLIA 3NRUA 5J3UA 4Y20B 4JGYC 3V7RA 4IV3B 4K9SA 1HJGA 2A05A 2R92J 1ZG3A 2M1BA 5JSRA 5IOZA 4DBRA 1CAXA 2ZAAA 4DIQA 2ZGLA 2K3PA 1VQLI 1R7JA 4C1WA 1COV1 5T3NA 3SITA 2LKPA 2BV6A 2IUWA 3WW3A 2KRHA 3DPUA 2FBKA 1CIWA 1WWYA 2M0CA 1DQ6A 4HRIA 2A68F 1R71A 1CZVA 2C9KA 3VZOA 3JTHA 5M0TA 3PHMA 4DYCA 3JBG2 3S1RJ 3DF8A 3NV2A 4ZS3A 5IUQA 3H8RA 3LF7A 3BTIA 3TGNA 4P14A 1MS5A 4DNCA 2CQQA 3I2DA 1HN1A 2G9GA 1MEC2 3ZGKA 2CV6A 2I45A 3UJQA 4YFNF 5LBEA 3RMYA 3LSTA 3JCUC 2D44A 4TN7A 1JHNA 4BNCA 3PNAA 2Q2EB 2XONA 3ZFGC 2VW0A 4AQ2A 1BOAA 2KRCA 2GH2A 1JKRC 1G9CA 3JD73 2GH8A 5DUWA 4CEYB 1AYM2 5C3QA 5L9RA 1AR61 1WA4A 1R58A 1DYPA 4M3CF 4QQHA 5EV7A 1PIV1 2EH3A 4TYSA 2FMYA 4MHUA 1N75A 1JXNA 4V2FA 4A3LJ 2R7TA 2ZGQA 4XFHA 4HPKB 1XS9A 2EA7A 2Q4SA 4P9IA 2D5VA 2XHNA 2HI3A 3V4GA 1YRNB 5BY5A 3CCMI 1C5IA 4BJ0A 2ZNYA 2HOEA 3ASOH 5HI0A 5T55A 3WT3A 1A04A 1X4OA 4U7DA 4BQXA 1CAWA 3M4OJ 5GAHJ 1MZEA 4S05A 3GUDA 3CJRB 1Z67A 3VBSA 3A1YA 3JB8A 2JVHA 4BQ5A 4DXTA 3MV01 3A03A 4YRDA 4YW7A 5FPAA 2VZVA 1CONA 4V2GA 3LFMA 4Q4Y1 4YYOA 4OIRF 5GLWA 2HKOA 5A32B 3QYFA 4BU2A 2ZJRF 4G3YC 4UFIA 3TYJA 4JKKA 2RS52 3I0TA 1VQ5I 3S14J 4KWLA 2WNVA 1W28A 4OQ8A 5J37A 5JSOA 4NC7A 3ZLIA 2VNOA 1L0OC 3Q8EA 4YIFA 3WW4A 1XMXA 2JG9A 1IS6A 4G7OF 5JZGA 2R043 4I2OA 3ZR5A 4I7HA 3VSLA 1UL9A 3O1RA 1OBNA 1YEWA 2XUBA 2DF7A 1ACIA 1D1AA 1FX5A 3U4SA 3WEZA 4AWDA 4AAXA 1BZWA 2QCOA 5EGOB 3KHBA 3KV6A 3IH3A 3K6GA 2VI6A 2ZMNA 2I10A 1A3KA 2YFUA 2PN5A 4GWJA 1XYOA 2XWJB 3OR1C 4LK0F 5LCWL 1FMWA 1W39A 2UU8A 1YI7A 2OCCH 2W00A 1H8TB 2WNUA 1GP4A 3OYFA 2VXRA 2KL4A 3USSA 3AZVA 2Z99A 5C9AA 4IHXA 1W36D 1YXWA 5T50A 2HWD2 2ZXJA 2P6SA 3F8BA 3HNMA 4KGQA 1ETXA 4ENNA 2VCCA 1OUXA 1K5MC 1HLVA 1WMDA 3LOIA 2HOSA 3Q0WA 3I55I 2E31A 1NUKA 1XNCA 4NHJA 3NNGA 1NA1B 3ZXJA 1PGL2 1VF9A 4BQQA 4KDPA 2Z79A 4LBQB 2DA7A 2F4MB 2ET1A 3K4ZA 1Z6TA 2Y9ZA 4RMNA 5LHHA 5E3OA 2PHDA 3QODA 1CZTA 4Y33A 2WO1A 2VZ3A 1RUOA 1ONAA 5IYYA 5BPIA 1C57A 1ZX5A 4RB0A 2I07B 5IVCA 1IRFA 3MBWA 5CEHA 2VM9A 4U0YA 3I4MJ 3CJIA 4M73A 4ASKA 3N7JA 4XZUG 1ZRDA 4Q4Y3 2GQQA 2ZGRA 2RR11 4NHYA 4UBGA 2HKXA 3SMHA 5E1RA 4P9UA 2YV8A 5BOXA 4IGPA 3JSPA 2JIJA 4KBBA 4ABZA 2E63A 5FZ1A 1X3ZB 2BOLA 2DA3A 5L7OC 3OOXA 3J8F2 4AGVA 3WX5A 5FKLA 3HTSB 5FZDA 3FHQA 2IPQX 1JGGA 4AYBN 3MPPG 2UURA 4XDQA 1UW8A 4OYUA 1H8AC 1UHWA 4A3CJ 4P9XA 1ZHFA 5T52A 4WM7C 2HPMA 5HVQC 3POYA 5IFPA 4A42A 2FBEA 4EQVA 1SD6A 1H4GA 4Q47A 2QVOA 1SPPA 2X6OA 2RJKA 1XNDA 2N7GA 3AZYA 1TWFJ 2DA4A 1BEV1 2JRMA 3FMRA 3IIAA 4JGZB 2RDQA 3MVPA 1ZRFA 2P7VB 1AU7A 5B3SH 5LA2A 1FPN1 1U8BA 3QD6A 4AIDA 2ZPXA 4CU9A 2CGOA 1TWAJ 4LMFA 1Y3TA 3HRTA 1DU3D 3K3OA 4V2WA 4Q1RA 2K7LA 1LNWA 3FUQA 2DA5A 2G1MA 5C4JJ 1PNGA 4WK8F 3BPXA 1OQDA 3SISA 1UG0A 5FJ8J 1TG7A 3N35A 4FASD 1JKOC 3U07A 2BYVE 4IJAA 3S57A 2EJRA 4XIDA 2CHHA 2XLGA 3GZNB 4LR4A 2FMLA 3CC2I 3GM8A 1W6OA 4OIPF 2D6PA 3CCQI 3EMRA 3BTJA 1H9TA 3HMYA 2OIIA 1EH8A 4LIVA 4EEFG 2JPBA 5FYYA 3OWTA 2LUWA 2Y34A 2Y48A 4Q4W2 4YVWA 2RR13 3THPA 4RR3C 4KG8A 4MOAA 2BEOA 5BNNB 3MWMA 1MACA 3O14A 4XAEA 4XUQA 5EP9A 4XJ8A 3OUJA 3WG7H 4IEXA 5FZEA 4DOZA 3T0DA 5L19A 1AR71 4XM3A 1RGSA 3HRUA 3VYTB 3ZO0B 3WD5A 1FTZA 5DV5A 1G4DA 3BUCA 1BVVA 3BG9A 1KGYA 4CCKA 4NN0A 4DFSA 3LSDA 1ETWA 4M72A 5D8AA 1D0XA 3S1NJ 1E5HA 1CF7A 4ASNA 3KX2A 3OBTA 4KISA 1XU1A 1PM4A 2VQGA 4ORFA 2JVGA 1PO22 1WZXA 4L5JA 3ABLH 2WZPP 1HRV3 2VASA 4U7BA 2DN0A 4UXAA 1SAXA 3CMAI 4A3JJ 3C2UA 2R5YB 2WSUA 4EV0A 1OFCX 2M2EA 4RN5A 2LR8A 2BWAA 1V00A 4IV3A 1RUG2 3LA7A 1DP3A 5M5WJ 1CESA 1JH5A 3GZUC 4FXKB 4P55A 3H0GJ 3AG1H 3LQCA 2MD0A 1F9KA 3K4NA 3VUOA 2EZIA 4RHV3 3IDAA 4M9XA 3E3VA 1VMHA 3SKVA 5A3WA 1ODNA 1MBGA 4YFXF 1QXRA 2W52A 1P4AA 4YIIA 4DYQA 2EXIA 2UWAA 4O9GA 5D5VB 2RQQA 1HN0A 1JZ5A 1E2XA 1P7JA 1X9TA 1M06G 4HLXA 4NHMA 1H1MA 1ZZ9A 3PFYA 4GFBA 1E5RA 3CJQB 4XCAA 3NAPB 3LSGA 1OCTC 4Q0QA 1F36A 4XC9A 1SLBA 2VXZA 4NIAA 4HW0A 3IKWA 1WJEA 5C5TA 1OCRH 1R49A 3JRIA 1C8M1 2K0GA 1JZ8A 4AC0A 4QKBA 5FRNA 5GLUA 1D3YA 1KZHA 2Q2EA 2R7QA 2DPDA 1DIWA 2GSYA 4CDXB 4FXGB 4PIXA 2E7QA 2WT2A 4PCRA 4CEYA 2VUCA 4H3WA 1R1ZA 1SFXA 4AI2A 1PVC2 1GDTA 1IAWA 1DBNA 2CUEA 4PIYA 4LO8A 3I49A 4JQFA 5BPXA 3R0JA 3A0KA 3JRAA 4P9FA 5FD6A 4QQ2A 1K4SA 4YZ1A 2PAKA 4BY7J 3ECHA 4A6DA 1GYKA 5EG0B 4RFRB 1ZK8A 1AA7A 1GLNA 4HPKA 3UGGA 4ZS2A 3QRFF 4XILA 2BWCA 5FZFA 4AI3A 3M9AA 3OY8A 4JV4A 3DECA 4BOWA 4HXCA 2VMIA 1D0GA 1YRNA 4B3NA 3POWA 3CF6E 4Y24A 4CP2A 3K70D 1A36A 4O9EA 1RXGA 3BTAA 3T1MA 4NOTA 3TEDA 1E3OC 2QKLB 3BG5A 1COV2 4HA8A 3O0XA 5FXXA 1GP6A 3MF6A 3J81K 4EJTA 5GLVA 4XUPA 3UL2A 1XGNA 4FFIA 4E4DX 2BE5F 1VB2A 5JI7A 3CUOA 4AEMA 4WBBA 2A69F 2PTMA 4FAGA 1JYWA 1BHGA 3EETA 1FX7A 2CW8A 3OGRA 3TBIA 4LUMA 1GXPA 1XJAA 2NYYA 4CDUC 4B43A 2RNJA 3R05A 1QHDA 4HEA2 2JICA 2COMA 1GZWB 2WL1A 4HQMA 1O91A 1TNTA 2AEYA 2BOIA 4PDWC 5EGOA 1YJWI 1UOJA 5FKMA 1BIBA 1GOHA 2O5RA 2VOXA 5IT6A 1RETA 4BACA 3BP8A 4JGYB 1HOMA 2R071 2LRDA 4QQOA 5JXIA 2X51A 3ZFFC 1UZWA 2HQRA 2CFOA 5A33B 4YGEA 5FD5A 1JHJA 5JHFA 3CF5F 3OV8A 3K77A 4AWXB 5K5RA 1LFPA 5K5OA 2R062 2LY9A 1A8DA 1H8TA 5JXJA 3AK0A 2JD9A 3CJXA 2CYFA 2ZJCA 1PIV2 5F0FA 5TISC 4I76A 2MLGA 5FKKA 5FPXA 1H0BA 4I3GA 2L9LA 2WC2A 3KEQA 1L7RA 3HOYJ 1TT0A 4O7XA 5JOWA 4MHGA 4XUNA 2IS4A 1R1UA 2JRTA 1CGPA 2E60A 2IW5A 3ZQQA 4W8JA 4BQ2A 4QB6A 1WUVA 1NA1A 1W8UA 2E2JJ 4UFLA 4N0BA 4LBQA 1H88C 4Y22B 5C8CC 1BN5A 1R22A 2B0LA 3O1UA 4ZTJA 1FBUA 1H2MA 5LBFA 5DM7F 3AKSA 3B6CA 3ZFGB 2GC3A 5FPUA 2VXJA 4XMAA 4ETSA 2IJLA 2DMPA 2Z9OA 2VZQA 1TMF1 1YC61 2JJ6A 3I4IA 4U2AA 3ST7A 3ES1A 1QJX2 5J4VA 3FHAA 2RM23 3FMGA 3D5RC 1GNZA 3X29B 1WI3A 2TCTA 3MKYB 3ZYRA 4XQ4A 3CCEI 1WKYA 4CE8A 4QPQA 1VQ7I 2IT0A 1NLQA 2KFDA 2AC1A 2X48A 3OB8A 1AXKA 4WM8C 1UIKA 1HJFA 1YQCA 4QT6A 3P5JA 2JQ7A 4A12A 3N9PA 2CSGA 4BE1A 2YR2A 1UY4A 1FYUA 1V0AA 4E7LA 4ANJA 2XLAA 4Y26A 2XRLA 3RYRA 2HDWA 1P8JA 1Y9GA 3HUGB 4HSLA 2QQMA 2DU1A 2IVMA 2V9KA 3O8HA 4GIQA 2RHPA 1XBFA 3G73A 2PAMA 2UWCA 3H36A 2Y64A 4JGZA 3LCPA 3P3PA 1PO12 1F5TA 1Y1WJ 1ULOA 2BUKA 2LH9A 2NNYA 2LMDA 3LOCA 4UB6C 5D6EA 4L0YB 1DGRN 3MO4A 3B94A 2H1LA 2DDBA 2K9SA 3J7NA 1VRH3 1XB4A 2Q30A 1LGCA 4BXXJ 3ABUA 2VNGA 1UZZA 3ZQGA 2PX9A 4BK5A 1J1TA 2EFQA 1LHNA 3WSOA 4M3DA 4ASLA 3PUBA 1KONA 1IG0A 3PIOF 4WZFA 2VE8A 3OYDA 1L7LA 4LMYA 2VCAA 3T2TA 4IHWA 5L3FA 3I2KA 2CWSA 3N36A 3S2WA 4O61A 4N43B 2Y60A 3RJ2X 4LLOA 4N53C 2SLIA 1B35C 3NSTA 5FGMA 2BY1A 1S0IA 5APAA 1GV2A 1G8XA 3AJYA 1XDSA 2XASA 3RFRA 4URAA 5LASA 2AREA 5KBFA 3PM1A 1P4XA 2VC1A 3CNAA 2NM1A 1B72B 4ES9A 3OTFA 1FSEA 3OS2A 2R0HA 3UGHA 1FV3A 3H0OA 4OZXA 2W5FA 3TNQA 4J1XA 3VD7A 1V6LA 4CDWA 4B8EA 3ZQHA 5C3OA 3HYIA 1VQNI 5K4LA 3ZIXA 1ERDA 4QHBA 3O7OA 5J40A 3V65A 2L7KA 5CLSA 3JU9A 2KIMA 1FPN2 2R5YA 4KUMA 1GKBA 1TTYA 3PIJA 4RQPC 5BNPC 3GX4X 2BNMA 1BK0A 2O14A 1STMA 2DCTA 2MNGA 5E8GA 4Z82A 1ENHA 1UY2A 4CRQA 1OJLA 3PU8A 2CS3A 2XF5A 3SKJE 2XVKA 2EIBA 5HNFA 1PP7U 2NVUB 5KHHA 2Z3YA 5GZGA 2ADUA 2CFXA 2ISZA 1N3PA 2AACA 3WW2A 3DGTA 1B9NA 4BE3A 5L7OB 2HDDA 3WP4A 4JKMA 5FLJA 2L7ZA 5FZLA 1YTYA 2PEXA 3BTLA 3PSIA 2ZJPF 4S2DA 1WGXA 2QQ8A 5BPDA 5L3EA 2YSRA 2MH2A 1WGPA 4L9BA 2ZS6B 1HB4A 1UD1A 4E7KA 3CLQA 2ERFA 2XSDC 2EQRA 4XKWA 2EFWA 3NAPA 4BWOA 4R4ZA 2BW8A 2NRAC 3HOBA 5H20A 2L4AA 4IQJA 3MKLA 3MIGA 2H6BA 1XXNA 1OPOA 2LBFB 3AYEA 2FD5A 1LULA 1AR72 4XTPA 1N3QA 3AG2H 3H8UA 4XLPF 2BY2A 4RA0A 1IG3A 5IVVA 4CDXA 1F2NA 4B7EA 5AFBA 3AP9A 1V4RA 1GV9A 4PJYA 5F37A 3G7DA 2GN7A 2OU2A 2B9UA 2WO2A 2O8QA 1HCRA 3VD5A 4U36A 5EG0A 3S16J 5AC93 4LULA 1HXS2 1CQTA 5FZKA 3RPQA 4BY1J 5FPZA 1F35A 2OUHA 1CD3G 4UUSB 4LTAA 1NZCA 2W25A 4YW3A 1IV6A 3FBIB 4OIOF 1TBXA 1D2QA 3QQAA 3MQ0A 2BPA2 3BIEA 1RUH1 3GYHX 1XGOA 5K9YA 2ZABA 4IV1C 1KYZA 2CDPA 5DG2A 4DS0A 2JT1A 4L5EA 2DYCA 5CISA 1FOD3 4XJUA 2GNMA 3U75A 2AYHA 2DCJA 2PHFA 4PBPA 3PUHA 3T0YA 5D5XB 1GNHA 2NYXA 2PBIA 3LSKA 4KL1A 1HKSA 5J8FA 3VBUC 3ZSMA 5IVEA 3AFGA 1Q1VA 3RZZA 4FCYA 1LDKB 1TWHJ 1OD5A 5E8AA 3GTLJ 3GFIA 4CCDA 1T6GC 1AR93 1S3JA 4OI2A 1SBDA 1GZWA 2HDCA 1MS9A 2CO5A 2R7DA 5LY2A 2G9ZA 3ERED 4JQTA 1IS3A 1WBLA 2R0FA 1GV5A 3I2GA 3KZYA 4BBRJ 1O3SA 2V4JC 3WDYA 3DKYA 1BKZA 2ZEWA 4AR2A 2RVAA 3ILFA 4PQQA 4JGYA 1NLRA 1PUEE 4QPIC 4CICA 3DCQA 5A33A 2BU9A 3BDDA 4R9BA 3P5BA 1LVAA 5LA9A 1HIXA 4XLEA 3OD4A 4IDZA 1TVGA 3B00A 4BCUA 2PMWB 1V9U3 5E1XA 5CQGA 3P9CA 1Q1HA 2Y6KA 3OYJA 3AMMA 3MICA 3ABZA 3F9KA 1O3RA 1J83A 4LLLA 4DUXA 1BCXA 1GWKA 2WAOA 1S29A 2YZ4A 5FZCA 2FNPA 3S8PA 4IVNA 1KJRA 4CCMA 1KFUL 5DDGA 3ELKA 3HHGA 5J4YA 1DLLA 1K6YA 1QIQA 3LZZA 4RGKA 3LEIA 4BA6A 2WLPA 3IMNA 4PQ9A 1TME2 4XLNF 2OZJA 4Y22A 5LD2C 1WJBA 2ENRA 4XFCA 3ZOBA 2WJSA 1JZ4A 1GOGA 2STWA 2A3WA 1YIFA 4XEZA 3F72A 2KIUA 5F08A 3ZFGA 4L8QA 2M8GX 2PLV1 3PQJA 2QE3A 4RAGA 3GTGJ 1SFNA 3WQ1A 1OCZH 4HSRA 2IXSA 3ZQIA 1HA8A 1IZ1A 3MEPA 3OD0A 3K70C 4JOMA 2V26A 3LAPA 4Z2AA 4LG0B 1S6LA 2F5DA 2GALA 5FOJB 4M71A 1YRZA 5KCMA 2P4EA 2QQNA 5DMYA 4PLMA 2ZHMA 2G7UA 4M3CB 1S5LC 3S15J 1J5YA 2JZYA 2R7SA 3N9QA 2RGVA 2K40A 5IOYA 3QU3A 1U8RA 2EVXA 3IDCB 2R0QC 1MJAA 5DYMA 2QKMB 2BNNA 5JCTA 4LKFA 4NVPA 4NIHA 2GBYA 4IEWA 5EJ1B 3CTAA 4DPNA 1RVF2 3HUGA 1X9PA 2OBPA 4WVZA 2HEWF 4K21A 1R1A1 2WSVA 4B3XA 1JI6A 2XGEA 3V0BB 4Z92B 1RUJ2 2VTXA 1F15A 3L9JT 2F5EA 4XBNA 2WAFA 3CU7A 5EJCA 1KQ9A 4DYRA 2XXZA 3V7SA 5HLTA 5CVJA 1AL21 2YC4A 3TOJA 4YRVA 3DU5A 3ESWB 2M7AA 1XYNA 1HW5A 1ZBA1 4MGRA 1EUUA 1ENRA 3ZDSA 3PJQA 3U1XA 3BGAA 3Q9OA 4QAWA 5DEQA 5A2QZ 1IO2A 1FNNA 2RVCA 2P81A 4QX5A 2I74A 2ICWG 4Q4V3 4PDWB 5HXMA 2ELHA 3DYOA 1AYN1 1GICA 4LHLA 4PJNA 2E36A 2O61A 1RMU3 1QJU3 4ZPIA 2KZGA 3E6DA 1K7AA 4Z6YA 3WDUA 2CQ7A 4Q4ZF 4GJYA 2ZO4A 2ZFUA 4BAYA 3W2VA 1W8TA 5GJ6A 4XJ9A 5FBJA 2ARXA 1C8NA 3KP6A 4N43A 2P6CA 4WF2A 5I0DA 2XGDA 2GDFA 4DUVA 5C4WB 1YYVA 3IAPA 1AL0G 3O1SA 2R6QA 4BYYA 2DUOA 4PHZA 3CMYA 5FZ4A 5FZ6A 2CQNA 4UFJA 2W4SA 1YQ6A 2YUEA 4IEPA 3N9MA 5FY0A 2F6BA 1HC8A 4D7YA 1DQ1A 2AXTC 2RAEA 3ACLA 3J7MA 1GU3A 4Z07A 1B72A 1Q8OA 2AENA 4XXPA 3N9NA 3SEPA 5KHJA 4AUXA 3KIOA 2XJTA 3T4HB 3OEAA 5C8CB 1VBA1 3D0JA 3S17J 4E8CA 4FETA 2VMCA 4FOVA 2WO7A 4HOOA 1O7FA 3LAGA 2CU7A 4F55A 4IEVA 1OHFA 4IQ4A 5CVIA 4A3MJ 1JI8A 4XUTA 3GWZA 3NJVA 1BA5A 1EF4A 3OYWB 3POSA 4BE2A 1H9PA 1XPWA 1W4MA 1HRI2 2JENA 2A07F 5D4RA 3S0MA 1YFYA 3SXWA 2B45X 5FY4A 5FMCA 3G3ZA 1JU4A 5FMOS 3H0DA 1ZBA3 3CEWA 5L7OA 5E6HA 1S7AA 3ZXSA 2VZRA 5BXXA 2K4BA 4WM8B 2X1CA 5A1AA 3DEEA 5KHDA 1TQ5A 3EB7A 4FPKA 5L36A 4AIJA 2VQTA 4FSJA 2Y9YA 1YHQI 4PJMA 2QKDA 2YS9A 4BQAA 2A5YB 5A3LA 3IKTA 5E8IA 3IC7A 1W0OA 3ZFEC 2EFNA 2VW1A 4X6QB 1QH7A 1JODA 1W5SA 2FDHA 3O1VA 1WJFA 2JA5J 1POV1 3EPZA 3O2PE 4MEXF 4OUSA 4W97A 3RDIA 1IS5A 3GTOJ 3KLSA 2LBFA 1MMNA 4RGAA 2OTLI 1W8ZA 1Z0HA 4BZ4A 1US2A 4GMP1 1JYIA 3MD2A 1ZZCA 3CO2A 4C91A 1SBEA 2ZTNA 3UKGA 4M3CE 3ZOIA 2KHMA 5JAXA 4BDZA 3DKXA 4PFPA 2HQNA 1A35A 2MD5A 2EPFA 3U2RA 2PHXA 4KFCA 1UX6A 1TNSA 2LTPA 1ZG1A 3H9QA 4PBOA 1W7PA 4XKVA 2WS91 3MYXA 1SCRA 1IXCA 5H9PA 3AX4A 2A6XA 2XAJA 3D6EA 3RKXA 5F5CA 1K45A 2I5UA 4XRSG 1XNTA 5FUPA 2J42A 4UUSA 1NG6A 5FRMA 3QYEA 2G9FA 5TSWA 1VQ8I 2VJJA 3QPHA 4IOAF 1LECA 2AZ5A 3DPLC 4NDLA 2VONA 2WV0A 4N53B 2VODA 1K83J 3DF0A 1B35B 4ZDOA 3C7HA 3FJSA 3POIA 2UWBA 5BNGA 1OF3A 2HTSA 3ZCOA 4UVBA 3MFKA 2ZACA 5FZ3A 3ZSEA 4KITB 3EXUA 4D9JA 2VY0A 3APBA 2C9AA 1KQRA 1S0FA 5ACA1 3KLOA 2Y6FA 2ZGSA 4OFGA 1ZBE3 2CMPA 1J59A 2FDIA 4CA9A 3GBGA 3VODA 4EQQA 4C3IJ 2ADDA 3NAUA 2VD7A 2YC2A 3WHTA 4E7JA 3BR0A 3GZAA 1AF9A 3VKLA 1D8JA 3LKJA 3VBOB 4RQPB 4NB5A 4AFAA 4KIBA 3WGIA 3G1LA 1LOBA 1FYKA 1TWCJ 2B63J 3JD72 4XOTA 4MO7A 2PHUA 3AKPA 2VB6A 4LUKA 1RKTA 1LU2A 2QZ2A 4AHYA 3UYJA 3R6SA 3AC0A 4H7LA 1P7IA 2HWB3 3RPUD 1LGBA 3LFIA 5A3MA 4PJJA 1G9DA 1MMSA 1W99A 1XC5A 2WQ4A 4QXHA 5T5OA 3T3YA 3BJOA 2MYSA 1YW8A 3OYCA 4LO5B 4COUA 3O6BB 3ASNH 5L3DA 4ZZ8A 4HONA 2V5YA 4P1WA 2LK2A 1RUH2 4AW7A 4J6GA 2QYOA 3PFIA 2VBZA 5HS8A 1YG2A 1NKGA 4LE3A 2E1MC 3A21A 1H6XA 2A6YA 1UZYA 2P7CB 4MGZE 1RUI1 1BBYA 3RZDJ 1REEA 3D3AA 5JIAA 2W91A 4XICA 3H3ZA 1WA6X 4DMIA 3TOBA 4RAFA 1QOSA 3AMNA 1HW2A 1LJ7A 1XNAA 4K40A 3D4KA 1W6NB 3VBHC 3THTA 1O4ZA 2D45A 2CU5A 2R042 2VUAA 1X82A 3GJAA 4LG0A 4JX6A 3ZYJB 3Q8FA 4K20A 2WDBA 4DUWA 3BTYA 4M3CA 3E6MA 2VZTA 2DURA 2VPVA 3PURA 2QFEA 3A02A 1VBD1 1PZ7A 3J80Z 4JX0A 4FFHA 2NVYJ 3L7WA 3AZZA 1JHFA 3T09A 4Q2FA 5LHIA 3BZKA 4LE4A 2QQVA 5JDBA 1UO9A 1OCOH 1JE8A 2JB4A 5E17F 1EYBA 4HOBA 3ZQ7A 4FP2A 1FV2A 2HWC3 4I0BA 1N3OA 2EIDA 3ZX7A 3NWTA 5ILSA 4GALA 4RB2C 2FMDA 3NNLA 3R4UA 4BJ6C 3V0BA 1OLQA 3TWIA 5AIQA 4LHKA 3FK7A 3VBUB 3LD8A 3G6JB 1MZ5A 3ZQFA 2RDNA 3KEYA 4NROA 2X5IB 4FPYA 4FOQA 4CDUA 2VJIA 3ELNA 1V5GA 2VE1A 1VBC3 4C2MJ 2BVVA 4KIFA 3RI4A 1IC8A 3AP7A 1SDWA 3PUQA 2DMQA 4G4FA 2WFF3 3UESA 4AQSA 4P08A 4PDWA 3GZ5A 5LRRA 2XF7A 2EILH 2P1BA 1Y0UA 3TO7A 5JOXA 2JSCA 5FK8A 2PLV2 4YLZA 2CQXA 1RHI3 5LA1A 1UU6A 2VTFA 2EA2A 2WQZC 3WQBA 5JOZA 4QM8A 5C6CA 4L9JA 4NIGA 5IYDJ 3G6EI 2ID3A 2DYRH 5AONA 1Y8QB 2CUJA 4OLLA 1WSUA 2E1OA 5ILUA 1W9YA 2ZEXA 4IHYA 2CL2A 5C4WA 3QP6A 3DL3A 3VDXA 3UETA 3AMPA 3PL0A 2FA5A 3CLOA 3OG2A 4IHVA 1WBFA 4A3KJ 3VZMA 4CXYA 1SLIA 3ACGA 4GJZA 2KISA 2QM3A 1XGMA 1JZ3A 1OSGA 2D40A 2BY0A 3AZXA 2WWJA 2M3AA 3GTQJ 4BQYA 5FY7A 1W0NA 5C8CA 2PFBA 4E8DA 4ON0A 3GTPJ 1BM9A 2L9VA 1JT6A 3W59A 2ZGPA 1YQ5A 2ORZA 1DFQA 2RMU1 1VLNA 3OYMA 3BG3A 3G2BA 1R1A2 5CFDC 4ZDPA 4GWIA 4XF1A 5DCFA 3OYWA 3K4DA 3D1NI 3BOQA 1UG2A 5G05L 3JRGA 2OA4A 3C2HA 4BS9A 2R7VA 3NJYA 2E34A 3EQEA 1I1EA 3SH4A 3K4LA 1SVOA 5G04L 2Y0IA 1WPKA 2FU4A 2R7XA 2CV1A 1QO0D 1J7KA 3IPVA 5F3CA 4AI9A 4DO0A 4U87A 2W94A 3HWJA 4WM8A 1SCSA 1S72I 1BVP1 1DYOA 2GM4A 2Q8CA 3Q0VA 2AUYA 1I50J 3ABTA 3WR0A 5EJ3A 3Q0UA 2X9DA 1UMIA 4A41A 4E9KA 2O8XA 3K0LA 5KWRA 4IESA 1H4HA 2VMHA 4CU7A 3SC7X 1Q56A 2ZX2A 5FY8A 3J4UH 3HN3A 2RV8A 4M4RA 1BJAA 2BGPA 1R093 3ETQA 4E6KG 1TNRA 1JUSA 1F4KA 3IAM2 1KITA 3I2IA 4Y4YA 2P3YA 1KXGA 2J1VA 3MUY1 4KU7A 2GA1A 1VI0A 4X6AJ 5SV5A 2JDUA 1HW1A 5DUUA 1Y9QA 1WJAA 1ORKA 4MLOA 2X05A 2CH0A 2C26A 4OU0A 5LK7B 3GYDA 2HYFA 2YDEA 4HKLA 4Y4RA 3WG1A 1OPMA 1IPSA 1VBA2 5DUXA 3KWVA 2MG4A 2LW8A 4LLFA 2BFUS 4IHTA 3CC4I 1HRV2 1P6RA 2HWF3 2GXGA 4XFGA 2H1KA 1AJKA 1FOXA 4P96A 1HB2A 2VJXA 1A34A 2ZXIA 1RUE3 4COWA 1V6NA 2IXLA 4XJZA 1YLLA 4GRIA 1L3JA 5DZEA 4IEJA 5LEJA 1W8WA 1F43A 5DAWA 3OYHA 4OMYA 3WZ1A 4AHZA 4A69C 4QGMA 2F4OB 4O6JA 4N53A 5FK7A 1B35A 4HDUA 1BBT3 3V0AB 1OF4A 1Y4WA 3L9FA 3RZLA 5KR7A 1PM7A 3M3EA 4PZJA 4KICA 4D1QA 1URXA 2DUQA 3P1IA 4OUMA 3T8TA 1FMD3 2KP6A 3LA2A 1FXZA 1XSVA 4RS5C 3U0ZA 4QD2A 3BLYA 4GDFA 3S6PA 2PHLA 1S4CA 5LBBA 1RUC1 1POQA 2I2SA 2BY3A 3WE3A 2V9PA 1UXZA 4R9CA 5CFCC 4EWDA 1QXPA 1AR81 4RFT0 3VKOA 5F5IA 3VBOA 4RM2A 4Q0PA 2X8KA 4RQPA 5LBQA 2Q0OA 2HWE1 4Y5Z0 4E7IA 3QH6A 3T0BA 4E2QA 4CP0A 3MMYB 4LITA 2STTA 4Y7NJ 1JT0A 2EIEA 1EV11 5DG1A 1DZTA 4BH9A 4Q4X1 5K0UB 4XIOA 3LE0A 4B7KA 1MMDA 3WUDA 2VCMA 3M3CA 5C44J 2ZGMA 1UYZA 4AU7A 2JDZA 3ENRA 4C9YA 2XVGA 5I0UA 2TUNA 1MSFC 1UJ8A 1UNBA 3T2QA 4V1PA 3TO9A 3VHNA 2GN3A 3CCYA 4P9LA 4CDGA 3ZFEB 2IXKA 1C1FA 4ZYGA 2W87A 3AG4H 1IN4A 2J5OA 1YI2I 4Y52J 2QUOA 1YS6A 2W39A 3PUFA 2JA6J 2VO5A 2Z16A 4H0EA 2F6CA 3MLKA 3KT1A 3AMHA 1NCQC 3WG4A 1E0EA 1V6KA 4BQOA 1J3PA 1SMVA 3DCFA 1XC6A 1ASJ1 1NQJA 2DTYA 4BM8A 3BTZA 3AZWA 1LDDA 4M0NA 4AHWA 1OR7C 2L01A 1V70A 5ACA2 1D8KA 4CEWC 3SZPA 1OCPA 2R1BA 1SMYF 1W6NA 1C0WA 2KIQA 5M3FJ 1RUD3 5FO8B 2VMFA 1A8MA 2MEV3 2RC4A 3EUAA 2RS11 4BQ3A 2A3XA 2W1SA 1WQ2A 2P3KA 4HVRA 2P5KA 1HDDC 1MEC1 3TP0A 1GQHA 1TEIA 4ZU5A 3OGGA 2P5BA 1H9GA 2PN6A 1AJOA 1WLDA 4FPOB 1JUMA 3BR6A 4R1HA 2VLAA 3MI8A 1AWCA 3S2DJ 2NNNA 2MPFA 2VZSA 1IXRC 1HLCA 2FBHA 3LIGA 3OIQA 1VJ2A 2YU9J 1R5ID 1N47A 2V1NA 1JTZX 5HLIA 2PJRB 1XDUA 3KT4A 3VBUA 5ICCA 5EYRA 1AX1A 4A3FJ 5BS6A 4Q5OA 2X5IA 3MZHA 3KMHA 4KQ7A 3ZMZA 3DFGA 5FUIA 1LOAA 3K46A 2D43A 1BI1A 4HF2A 1BIAA 5D5UB 3KP4A 2B9VA 3SXYA 2E5ZA 4OI4A 2A6EF 4EM2A 5HV4A 1Y7BA 3HOZJ 1RUI2 2EXJA 4EN0A 4QIWN 3E6CC 4R52A 4BJTA 2Y0SA 1NCRB 3K75B 1MBHA 2WRAA 2W1QA 2XAQA 1X19A 4XQWA 4MVTA 1T98A 1F5FA 4QPIA 2RS51 1QU0A 1YCIA 1BMV1 4A6SA 1DP7P 2JDHA 4EWEA 4XVHA 3NNMA 3BTXA 5A7OA 3JBG3 5IFTA 2ZSIB 2E7AA 4UFKA 4FI9A 3OYIA 2IGMA 4JDNA 1ULCA 4OUEA 4Q0UA 2E7XA 4YW6A 3HT2A 4HNUA 1YITI 3ZMDA 5CKMA 3HBKA 1Z7S1 3M3QA 1VBD2 4HG2A 4MIMA 2BZDA 5FDBA 5FYUA 1T6BX 3T1LA 1UAAA 2K86A 3CP8A 4XSZF 1UMHA 4L99A 3J81Z 3HNYM 1UXXX 2P37A 3KD4A 3GNEA 2RS31 1DU0A 5AIPA 3FZVA 1YIOA 1AYM3 3ES4A 3NV4A 3R4DB 2DWRA 1S1AA 2ZZJA 1RR8C 2GWRA 3V42A 5KVRA 4HPQA 3S93A 2DDUA 4PSXA 1GANA 1DDLA 5IAVA 2PMZA 2WT1A 1ZA4A 3WTZA 5BNOC 2OD5A 5JVGF 1XRUA 2KJCA 5D8KB 4XOPA 4DB5A 1CJPA 2EV5A 5IYCJ 3K2ZA 1PGSA 4XUOA 1PGL1 3DUIA 4TXWA 3HPGA 1TQPA 3JR9A 5LATA 1AZDA 5HV0A 3UK9A 4L11A 2HOAA 3BJ6A 4ZU4A 1SACA 2DTZA 4YG0A 3G1OA 3THDA 4RLQA 5M5YJ 2NMOA 4HF0A 3SCHA 1JZ2A 2L9SA 2QTWB 1GVDA 4CCCA 2K9QA 3DN7A 2J1SA 5DZFA 1EY2A 3INAA 2FUG2 2IXHA 2RS53 4GB31 4HF1A 5FZHA 2Q8EA 3Q3SA 2L2OA 1EAH3 5A7QA 3PVNA 1VFCA 2PYTA 3J8F1 4FP3A 3RRDA 1QVUA 2W46A 2OPWA 5DDJ1 4JK1X 4BEHB 1WJDA 1MQTC 5E1WA 1ZZ6A 1YIPA 3N7LA 4YG3A 3ZN6B 2PXJA 4M3FA 1NOVA 3O0WA 4BL0B 4BHPA 3HSFA 5FZIA 1ZRCA 3WNKA 4PLOA 4HN0A 2XWBB 1QOOA 3F0CA 2A70A 4D5CA 1VQ9I 2ECCA 5H2FC 3W2WA 1BLZA 2VQUA 3N7MA 1UOGA 1I27A 5DS9A 3AYDA 1OOPB 1LFBA 4G7ZF 2FQ3A 4HETA 4JP0A 4LKDA 4W6YA 5ICEA 4FQ4A 2HWD3 4XTMA 2VOPA 2M7BA 3OOPA 2HZTA 3ECOA 3T30A 3I4NJ 1TWGJ 2JG8C 1W6QB 3LFKA 4CP9B 5FBZA 1WZ2A 2L5QA 2UZKA 2EV6A 3MW2A 5DAQA 2GMEA 4UXNA 3V0AA 1CAUB 1YX3A 1U5TC 1I1GA 3ZMVA 1POV0 1N78A 2JX9A 1MW7A 2HYGD 2BBAA 3GTKJ 1Z3YA 5DUKA 3BQZA 2DOFA 1CIYA 3OPTA 1O8SA 3WG2A 2VQCA 5LGNA 1BR4A 1C5HA 1WKMA 4WV8A 5H9SA 3JRCA 4GMP0 1AHDP 3OYKA 2GC0A 1W9WA 4XXAA 4OHXA 4BIFA 1AHSA 3E6BA 2WN2A 4KJZA 5EZWA 1B9MA 3CO7C 1W6PB 5CFDB 9ANTA 1JKPC 1ZVFA 3NWSA 1UOBA 2D6NA 4QWQA 2MLKA 4AD9A 1WLCA 1KU9A 5KXDA 2WA0A 3K3NA 3H1MA 5GAGJ 4IRGA 2HJIA 2BGCA 1T8IA 2Y6GA 3ZN4A 4PGHA 5B1BH 5E20A 5K0UA 1XU2A 4B09A 1PP8F 2ZGKA 4UAPA 2ME0A 4HN1A 3OYGA 1W90A 4LKEA 1PO21 3WNPA 3UKNA 2BVLA 1LB2A 5FZ7A 3A2KA 2B7YA 1E3PA 5T5JA 2DA2A 3LSIA 2GP3A 1M1EB 1ND3C 2WO3A 4W6XA 2A6HF 3NKGA 1W8OA 2J5PA 4DJAA 3QCWA 4PI2A 2DLLA 3VYUB 1EP0A 4R9DA 2LVSA 4IL6C 4QMAA 3ZFEA 1HF0A 3ML6A 2NAZA 1ULEA 3WCSA 1S55A 1FT9A 1RUG1 1XN7A 5TJJA 1OVPA 1W8HA 3VDDC 1IKQA 1JMUB 1ZRRA 1VMJA 1FOD2 1VQKI 3OYLA 2ZXQA 3OGSA 1XX5A 3DYPA 4QPGC 4UW3A 3WY6A 1V54H 1W6OB 1HDKA 1IDYA 4UB8C 2MC4A 1GLHA 4JDOA 1SAUA 2W48A 5J1UA 3ACHA 2OW4A 4AFDA 1RUC2 4ZU7A 2YGMA 1ZYBA 1YIJI 1MBEA 2YG0A 1AR92 5F3EA 3L09A 4D7MA 3A0NA 5CQEA 4X1EA 2HVSA 4QHZA 3M7AA 2XBO3 1BJQA 4Q4W3 5J47A 2XB6C 2VZUA 2DOEA 1QDOA 2ECBA 3BU7A 2D6OX 3X2QH 4QXCA 2OTJI 3LEGA 1XSDA 1G6NA 2OA2A 1EV12 4E27A 2KD7A 4E7ZA 2FRHA 4Q4X2 5F27A 2ZHNA 4ZH4F 1PVC1 3G71I 2BZTA 1IW7F 2E1CA 4XR6A 3KETA 2EICA 4ARXA 2WB1N 2E35A 1JZ7A 1Y1VJ 1WCMJ 2B7EA 2CY6A 2DYSH 3ZYHA 4NC8A 4A4AA 1JU3A 4EGYA 2HEOA 4N7IA 1V5FA 2WQ8A 1GVJA 3NJXA 3W20A 2RDRA 1C3HA 3MCZA 1VZ0A 3ABKH 5K5QA 5E3MA 5C5UA 1HKDA 2Q5TA 3HXLA 3WE2A 1NX9A 2CW0F 3ZKUA 5C33A 3MW3A 2L9RA 4BLJA 1VBE3 3BG7A 1UKGA 4FFFA 4XSXF 3EHKA 2M4GA 4KT6A 3J80K 1O4TA 2X6XA 3D0SA 2WZR3 2P5VA 1F5JA 4DNYA 4LBQD 2ISYA 1UY3A 3E5QA 4YW4A 1ASJ2 5FKCA 1LFUP 1RC6A 4B3AA 2O03A 4EROA 5ABJC 1DQUA 3MFCA 1NCRA 4K3UA 5LA0A 3FLTA 1T33A 4QDRA 3PTRB 1QWRA 3O5SA 1WHUA 2IVIB 3H3VK 1E17A 4YZ3A 2EA4A 1D5YA 4DXSA 4EWAA 3FZ3A 1YW7A 3O0VA 3FK6A 2RS12 3BOPA 3FBYA 2DVAA 3PL8A 4LG3A 1RUF3 4IOCF 1DHKB 4AK3A 4UFMA 1RRJA 5F2SA 1ITYA 2NMNA 1S0GA 4I09A 1G86A 4A0YA 2XB0X 4AI0A 2ZXHA 1OMIA 4BQWA 5FLMJ 4CDQB 3CMEI 4N4NB 4LBNA 3L2CA 3M4FA 2V73A 1SHWB 3GW2A 2LF8A 1ZR2A 2WNVC 3LB9A 2KLOA 2R061 3WHBA 3LMMA 4K8FA 2BVMA 2B39A 3A22A 3U4XA 2CUZA 3RZJA 2QVSB 1GUIA 3PU3A 1FY7A 2VC0A 2KQRA 3FBNB 4R4XA 1G7YA 2Q8DA 3GHNA 5JZGC 4XCBA 2VVEA 2ZNZA 1LEDA 1JOJA 5IYBJ 2YFZA 3OY8B 2Z5WA 5FFXA 2W68A 1DQ4A 2HZDA 5E3NA 2VUDA 1I6XA 2EFOA 4LFUA 1DF0A 2IS1A 4NHKA 3VHOA 3ZXDA 5KC6A 3QPSA 1ZGAA 5J96B 4YW5A 5JR2A 2WINB 4A3DJ 3FM3A 2VGDA 2AR6A 1QXJA 3S7EA 2VPRA 4Q8LA 2WNUC 3PMEA 3L1PA 1DGRA 4JRAA 4PT6A 2XC7A 4MGIE 3GLLA 1COV3 3BYWA 1VBB2 3TOAA 1QJU2 5FP9A 3WHCA 5K8SA 4YVSC 1BMV2 1V5EA 1XNKA 4CXXA 1J0RA 5FZ8A 3HRMA 1L7QA 5FTTC 1QJX1 3CZUA 4QKNA 2XB5A 2H27A 5H9RA 4EN9B 2XG3A 2XPUA 2ZX3A 3OBRA 2R16A 3WLUA 1GWMA 4E4HA 3TAYA 2XGXA 3VKFC 1Z7S2 4XJAA 1APNA 3HDDA 4BEHA 3FLPA 3ZN6A 5E88A 5ERLA 4AF9A 1D7PM 3W2AA 1R4NB 3IAS2 1K78B 2RS32 2VKEA 1VQ6I 3CBNA 1N25A 3H92A 2DTRA 1X3WB 1YJ9I 3S5QA 3I53A 1AR63 1QJEA 4KMQA 2JA8J 2R063 1VALA 2LRPA 3ZSKA 1VQPI 1PO11 1PIV3 1OOPA 2L4MA 2VBDA 5I91A 3HNBM 2FBIA 3BB6A 1D1CA 4LQRA 1S0CA 4XRSA 4XE9A 1LESA 4BXUA 1NZIA 1W6QA 4CP9A 4XKBA 3ZSJA 1O4XA 2XPVA 2FQ4A 1O59A 1MH4A 1QDCA 5L73A 3VHRA 5EYYA 1CAUA 4B4CA 3VGIA 3I71A 3FHNA 2EWNA 3V7CA 5F6FA 3M7GA 4Q1PA 4MX3A 1FNYA 1C28A 2GC1A 1OI6A 3ZVXA 4FE4A 2LKSA 2F4PA 3IIIA 3C7OA 1AX2A 3RQ4A 1XG1A 1Z7UA 1RIOH 5ANQA 2ELKA 1RXFA 4GB32 3T08A 1ON1A 1UCRA 1UKRA 5F2WA 2L7FP 1Z3XA 1UHMA 1IQAA 4PCQA 3WTYC 3B5LB 5HOOA 5LGTA 4AXOA 1M4WA 1W6PA 2TBVA 1KQ8A 5DAPA 2XAHA 3V56A 4QQPA 5CFDA 1LEBA 2JXAA 1PJRA 3H9AA 3K9TA 5DDJ2 3TN91 1BJZA 3M8JA 1H2LA 3Q8AA 5BNOB 1CX4A 4HSJA 2H94A 5J3LA 1U5IA 5HNHA 4UHTA 1A6CA 2KZVA 1FATA 4D8MA 1GHCA 1OVSA 2X10A 3NVCA 3CIHA 1SD5A 2Y6HA 2FF4A 2WY8Q 2BFUL 3F95A 2DCKA 3BROA 4YVWC 2GNBA 1UZCA 3KP7A 3EJKA 4F3QA 4C3JJ 1U2WA 1CR7A 1YE9A 3H5NA 5A70A 2VOOA 4YNIA 1PYVA 2XJQA 4KMUX 2G19A 1JJ8C 4F91B 2P5LC 3PO2J 4XYXA 2NOJB 1PO13 3AKTA 4AFCA 5LW9A 5F7UA 2HYXA 1ZAOA 2MHFA 4E7SA 3VD3A 3AL6A 3LPFA 1DZQA 5LB6A 2YB7A 2QDRA 1FJLA 1ENXA 2VL4A 5F0CA 1S0DA 3BI3A 1QHGA 1MQTB 2WYSA 1QQP1 1GQGA 4LGWA 4WWCA 1ZBE2 4ZZLA 4QLCU 2VQAA 4A3XA 4XOGA 1OA4A 1WFXA 2YY1A 4I30A 3MEXA 4JAAA 2H0VA 1I5ZA 3IRQA 1CPNA 3L2YA 4IV3C 2FSWA 4GYIA 4K1YA 1DGLA 3BR3A 5I0TA 2IRFG 3S7IA 1KQ0A 2ZFWA 4K2EA 3SFIA 4OINF 5BQTA 3BQYA 1K79A 2R30A 1T6SA 2ZA9A 2CWMA 3H42B 4MFDA 1PDNC 3B93A 4XFAA 1OURA 2JG8B 4XRFA 2WAQN 2DPUA 3OIPA 2HWB2 4CDWB 4FPEA 5FYTA 1U5TB 3ALQA 3UR3C 2WADA 3SCFA 4HK8A 4AFMA 3FMQA 3VWBA 2Y0MA 3WF1A 1V6IA 1ZKGA 1RZ4A 2CGPA 2D6KA 2AXLA 2A1XA 4HK9A 5FZ9A 4AG4A 1ZTRA 4XW3A 1BEV3 2PQQA 1HXS1 1IG7A 2UYBA 5FRAA 4KWJA 5F39A 3K1MA 4AEDB 1FPN3 1X1BA 2VVDA 1W0PA 4XHXA 1Z05A 1S9HA 5CFCA 2JECA 3RG0A 3K4KA 4IRHA 4NWVA 3J7LA 4RA2A 5HCAA 1ZN2A 2QSGX 1ETVA 1ZQ3P 2CDOA 1G8WA 1SVLA 3T2PA 5FOBB 4CSWA 3TW7A 1HB3A 3VL8A 2WA4A 2HFHA 3WOGA 3KYCB 1XNBA 3LAJA 1R081 4XQFA 1J09A 1S0EA 3ATGA 5HCFA 3HJRA 1USSA 4F92B 2N8GA 1U0AA 3U11A 5JVVA 4B1RA 3N7KA 2JD4A 3JAMK 4ZYDA 2JA7J 3KZIC 1F9NA 4L97A 4WXHA 1LTEA 1ENQA 2QNKA 1SFOJ 1QNYA 4B44A 4U0VA 3M8FA 3NARA 4BLIA 1ND3B 1LUJB 4I98B 2E53A 4KNYA 2OZ6A 4IQPA 3FF5A 4CDQA 3M3OA 2OJED 1AR73 1HQWA 3FLRA 1DUXC 3HR9A 4ZHNA 2XKOA 2HEVF 2JKBA 3WNOA 2LKXA 2HVRA 3F8NA 2OQ7A 4MQ9F 1F1ZA 2O0YA 5KXCA 1I3AA 1OQYA 1QF3A 1Z21A 2V4AA 1MDMB 2HWC2 5KAIC 3BC8A 4QPGB 2DT7B 3WTWC 3WU0A 5M3MJ 4FHTA 1I3QJ 5I8SA 4NJ4A 1W2TA 2E32A 1JYNA 5K7HA 4B48A 1SC7A 1SBFA 2GIVA 3IRRA 4CU6A 4A5MA 5FYBA 2V1UA 3S1MJ 2VZPA 1A31A 4HV6A 2RDSA 4NIIA 4QX7A 3E0JB 1NLSA 4ISQA 1X2NA 4H7MA 5HCHA 5IWFA 3W21A 4ENKA 2WFF2 2CUFA 1TME1 4UY8I 4QPWA 4JKLA 1G9FA 3WNLA 5CA6A 2FD8A 2VKDA 4AVBA 1VAKA 3EYPA 3COAC 1JUPA 2FDJA 1RHI2 4NAMA 2F48A 2OAZA 3S30A 4OIQF 3ORJA 1SLAA 3GFLA 5IVBA 3F2ZA 3K48A 2WWYA 1SFUA 4OOIA 3LFUA 2Y8KA 2ZZQA 5ANNA 2GC2A 4EJUA 3MFAA 2KRFA 5D4SA 2CV2A 4Q27A 5F6LB 2A6TA 5KNLA 2D5HA 1DGWY 4OZOA 2W2IA 1PK6C 5CU1A 2FDFA 3KZZA 2JDKA 4M9SA 4BDYA 3TO6A 3CD6I 3GF6A 1D4M1 3HIFA 3LDRA 3M1EA 3RVHA 2BGOA 2Q1MA 1C8M3 5AVPA 1BR1A 1JYTA 1YYNA 1Z78A 1DPUA 1K78A 3M07A 3KQRA 5IVYA 2UYAA 4IZZA 5FLXZ 3H7JA 1RVF1 3LSJA 2HXIA 4ZC3A 2VU9A 3V8KA 3P6BA 1BW6A 3S32A 1MD0A 3WODF 1X33A 1P4WA 4COYA 1RUJ1 4RGGA 1D2SA 1MS8A 1BI2A 2LSOA 1L3LA 4AIHA 3IUOA 1JUHA 5DM6F 1KD7A 4BQ1A 4XMIA 4MO3M 2IS6A 3GO5A 4CCOA 1ZM1A 1S2EA 5LWBA 4DZGA 4W1UA 4IW3A 2QCSB 3IH2A 4KG0A 3ZXGA 2M30A 1ULDA 5FYVA 1JJ6C 4LXLA 4XZPA 1BI3A 4M3EA 2L3DA 1Z1DA 4S04A 2VNRA 1ODDA 1UYXA 4LLGF 5I0SA 4LD5A 4EZHA 5J48A 3BPSA 4JTOA 3DQVC 3C8XA 3I3BA 2IVJA 4P00B 5FPVA 3QACA 1G3WA 1W9FA 2R7FA 1USTA 2GOXB 2VOKA 2VMGA 4XDPA 2O8KA 2V6EA 1SANA 3A4UA 2DDAA 4GULA 5C7GA 3BPZA 3OCPA 1QGLA 1HSJA 2EAAA 1TQIA 1N1VA 3VEPA 1KA8A 5EEHA 1KFXL 1KS4A 2DXIA 1X36A 3ZN1A 2DW4A 1F8VA 5LFAA 1AX0A 1Q43A 5BNOA 2P6TA 1OXCA 4PJ0C 5FKNA 1OH4A 5J1XA 2WBKA 4AL9A 3R0RA 3MZ8A 3KE2A 4XFFA 1HKQA 1QEXA 1K3IA 2R073 3OMYA 3DTKA 3FXMA 2Z1DA 1MBJA 3NQHA 4O5VA 4FBFA 2HWF2 5DUVA 5LRSA 1NY72 3T0AA 1RUE2 2ZHLA 1BR2A 2Q1ZB 1E5SA 1CX1A 2J1AA 2CV0A 4A0XA 5BNNC 2E2HJ 1IRZA 4J1WA 4YVSB 2DFCA 3CF2A 1JGSA 1OPCA 1LHOA 3MV11 3WG3A 1HRI1 1RPWA 4W6WA 4LNVA 4TTGA 2F5CA 3VDCA 2BW3A 5HDGA 1BBT2 3LSEA 2ZX1A 3H8XA 1SMTA 1ZARA 4LIUA 1REFA 1LAJA 4QPOA 3DBRB 5HCBA 2D3SA 1J2XA 1W36C 1FMD2 4A6EA 1QNWA 1MQTA 2O9LA 5FFOC 1WJCA 2X09A 2O0OA 4XJWA 4EN8B 3IT8A 1MGTA 1XPXA 4ATFA 4AYUA 2V1DA 1IN8A 4NQWB 3LEMA 3AL5A 1T2XA 3LEKA 1QA6A 4MGSA 3J26N 2LREA 1TMF3 4ENJA 4ET7A 3OL3A 3I56I 2GNDA 1LGNA 1D4VB 3POGA 4ZDLA 1W05A 5FP8A 5GZDA 3W58A 1Y43B 3QPLA 4R79A 3ZRGA 4P5OA 1P92A 1JTXA 3TN92 4DOUA 1IKPA 1K5MB 3EUHC 5CNAA 2ZKZA 2B5HA 1DYKA 2D5FA 2QQKA 1V6JA 2ZKNA 5CKQA 2EFPA 2JG8A 1Z9CA 3QOEA 5FUNA 1UQXA 3GCWA 2HLEA 5F1JA 4CPBA 1QMJA 2R7WA 1HX6A 1ONVA 1U5TA 3WXPA 1YO8A 2D3RA 4L2NA 4CZCA 1AVBA 3NAPC 2COBA 1ZG5A 4M4PA 4OMCA 1ZYRF 5FZGA 3IMMA 3MPBA 4IEYA 2QBXA 2B9SA 1HQLA 1LVKA 2VT3A 1W5TA 4DEQA 2HU9A 3T8RA 3W9AA 2VG9A 4O65A 4AEDA 1A6IA 3E97A 1A5JA 1UMQA 2RJ2A 1UZ0A 5FP3A 2V72A 2JMWA 2OS2A 4OI0A 4PI0A 5IATA 1LCLA 2MSYA 3OYBA 5A6XA 2IXJA 4CH7A 4K6BA 1FOKA 5CG8A 1ZLJA 5A3UA 2ETEA 1IS4A 1V6MA 1RKWA 2ILMA 1APLC 1QQP2 3POJA 1O8PA 5D21A 2W24A 1TW2A 3MUZ1 1REDA 4WM7B 4CZZA 5LLQA 1RUD2 3WHUA 1FOWA 4KYWA 3MDPA 3BJAA 5GADJ 2V09A 1H89C 4JX5A 1YQAA 2LDUA 1FZPB 2PQ8A 1SG3A 3OEBA 3CDHA 3I9V2 4Y1UA 1UPIA 3IDBB 2WKKA 3RZHA 1ND3A 3QYBA 2ZHKA 5FXZA 5F9TA 4HLYA 2EXKA 4EN6B 1SFPA 1WCSA 3F23A 3JD71 3L2UA 4XIKA 3RNSA 3HSEA 2QF7A 3F6OA 3I59B 4GH4C 2XHKA 1MS1A 2QQBA 3H1CA 3H3UA 4G9YA 4K7JA 5EWSA 1TNFA 3KPHA 4RL7A 1MDMA 3B02A 1W7PB 1XOYA 2QSHX 5FJHA 3VPRA 2EZKA 2RDPA 2JKXA 4QPGA 4LBKA 4I0AA 3PSFA 1U0JA 4M3BA 4EVIA 1T39A 2A6WA 1NT0A 4RS8A 2FNAA 3QAHA 4V19K 3KEOA 3RQIA 2DVGA 1DQ5A 3IWZA 5A7SA 1IOAA 5FWJA 3ZMOA 4RR3B 3HZJA 1R00A 2HNHA 5F04A 4COZA 1T0FA 2QQIA 2X1EA 2NS8A 3MGUA 2CAUA 2G7HA 1VQOI 3F3XA 2WAAA 4XLCA 2JDPA 3B9IA 1Y8RB 1WMXA 1MR5A 4IUGA 1ZA7A 3QU6A 4HV5A 1YUDA 4QXBA 4PIZA 5FZAA 1X8MA 4B4PA 2DMTA 2Y0OA 3JQXA 1R082 4URTA 5EPAA 5FLVA 3TQNA 3WF3A 2DQLA 1GMMA 2YX7A 1NG7A 3M2MA 3K2AA 3GALA 1UFMA 3UNPA 3C2GA 3I8TA 4G6DA 1N1YA 3S3NA 2R041 4CP1A 1YJNI 2GA2A 1MNMC 1F31A 4QKFA 1IJWC 2YXSA 4LHNA 3HD8B 4ITCA 5F0HA 3HQXA 1YFHA 4C3HJ 4BPZA 4E2SA 4YM3A 1WH5A 2FOWA 1RR7A 1YFUA 3PUAA 2ZMEC 2DFHA 2YROA 2L9NA 2WTEA 3Q5FA 4YZ4A 2IEKA 4K8RB 4LBOA 4KBZA 2PI0A 1GWLA 3REOA 4LOCA 2KPMA 4BE0A 1WW4A 5DCMA 4HQEA 5ABJA 1LJ9A 1UN1A 3NO8A 2IS2A 4TSVA 4MGTA 3H7YA 1QPIA 4FFGA 5I0RA 1IV8A 2K9NA 1FBQA 1JS9A 1FOYA 3SFZA 1ZGWA 4PK4A 3SDBA 3KGZA 3ROUA 4LO6B 5L3CA 1UYYA 4QDQA 2K85A 1ULGA 3B9CA 1U9OA 4I01A 1BXHA 5A1LA 5JHUA 1X3UA 2LNBA 4C2UA 2VPLA 2L54A 4YEJA 1RUH3 3ITQA 1ZRIA 1XYPA 1EKEA 1ALYA 2UUZA 2EZLA 3PJYA 4HVQA 3NW4A 5IP6A 2VVFA 3VKMA 3KP2A 4ZYEA 1SEUA 2A3YA 3CQOA 5C3RA 2FDGA 4DY3A 3I54A 3MIEA 3GZ6A 4WZCA 2HTJA 2ID4A 3WDWA 4MYEA 4G12A 5FV3A 1GR3A 5HPOA 2D2WA 2BERA 5BNQA 1EA3A 2DODA 5KK1A 3I58A 1O3TA 1EAH2 2XMLA 3ACIA 4G6TB 1FP2A 2QZ3A 2TEPA 2L02A 1QKQA 3IN9A 1D4M2 2BJSA 4AE2A 1MMGA 1JUIA 3G4SI 1OLRA 1Y9MA 3ZXLA 1YHFA 4JHZA 5JLXA 3POFA 5IK7A 2ORXA 2DU0A 2R5ZB 5IK8A 5FFZA 5BMZA 2QWWA 1AXZA 3HT1A 5GTIC 4A3ZA 5FLHA 3K4BA 2J7MA 4WCGA 4X8PA 1T95A 4N43C 2LM3A 2K02A 4D5FA 3IAQA 3BZCA 1T38A 4YVSA 2Z2SB 2VBBA 3S5AA 5EHDA 1UY1A 1U9NA 3J7YJ 5FCCA 1ETQA 4CDUB 2YU1A 4BMBA 1IUYA 2IA1A 2XSJC 4FTHA 3HGYA 2RNGA 2RQPA 4BKXA 2Y0SN 4MNUA 1PK6B 1FBSA 1VAMA 5DABA 2IBDA 1NE4A 3IHUA 1QJY2 2VXDA 2R32A 2QENA 3RS6A 1PMHX 2PAEA 1X1PA 5CKNA 1OH3A 2WUHA 1NQDA 3CP2A 3ZFFB 2HVQA 2JTVA 4RGRA 4TLFA 2Y30A 3TRSB 1SZBA 3PNTA 1Z77A 3ONQA 2XROA 2VBYA 2PLV3 1D0HA 4Z2WA 4FPCA 3DXTA 4JBAA 4NQWA 2XGCA 3OOUA 4QDSA 2HH9A 2YBPA 3N97A 4INDA 3ZXAC 2FCUA 4D7NA 1K5MA 4IE0A 3BY6A 3EDPA 3FDYA 3VZJA 2YYOA 2ZMKA 4ES8A 1FIPA 2A61A 5JOYA 5JR3A 1ULFA 3CCSI 1WD4A 4UF0B 2ELJA 3D5SC 2PHTA 4GZ9A 4YZ5A 4W50A 1HRV1 1SQ4A 2PMZN 3MIBA 3SHRA 2ZSHB 3NWKA 1YOVB 3ZQLA 3E1F1 5FIXA 1D0ZA 2DFIA 3AVRA 6PAXA 5FKOA 1NTCA 5T54A 1R1A3 4FAHA 4X0GA 2JA2A 1XB9A 4IKFA 2NPIA 4WVWA 4WVVA 1AL23 2ZX4A 1IRXA 4RHV1 3LSHA 4N90A 1UIJA 3IPVB 4FTEA 2KKOA 5T5PA 4MQVA 4YELA 1JOBA 5FZOB 3AYAA 3CZ6A 2QLZA 2FQPA 3WG9A 3DYMA 2J1UA 4KI5M 3WCRA 2YUSA 2DJNA 2XUMA 5FYIA 4OI1A 3OYEA 3RYPA 5FYSA 2OCEA 1QZYA 1AYN3 4BDVB 4WM7A 4M6VA 2BP6A 1ACCA 5A1FA 1W2OA 2EINH 4IHSA 3ECQA 1R6RA 2XBO2 1VRBA 4ESFA 2JUCA 4MGYE 1LNSA 5KAFC 4MV2A 3QOPA 2L7MP 3ABMH 3RZGA 4EJVA 1I6HJ 2WLQA 3RJPA 4AVPA 4UUVA 3OIOA 4UFHA 4CVUA 3HKZA 2LS6A 2DOAA 2QQ9A 3SCGA 4EATA 1RB8G 4HANA 1OCCH 1VAVA 3I59A 2A71A 3SEEA 5CAZA 5IK4A 1RL3A 2KT0A 3WTTC 1UCXA 2VL8A 3ILRA 1QJZA 4Y17A 1RUNA 3HSRA 5B4XA 1RJ8A 3OY9A 4KWUA 1E57A 5AFEA 2DUPA 3RTRA 1VBA3 5FYCA 2FOKA 3OUIA 2OUJA 1GFF2 4NE9A 1WLWA 3I7DA 5EEAA 3SQNA 3BPVA 3VN4A 1IPJA 4UBHA 5C71A 5B66C 5J1YA 2E26A 5IT3A 1VBE2 3C7GA 3A7QA 1EUTA 4OAZA 2H09A 4Y20A 3E5XA 4RR3A 1UWWA 4Y5TA 2WZR2 5GM0A 4A2UA 1Y39A 5FO7B 2D1HA 1SVMA 2A7AA 1OQ1A 3P3NA 5HLGA 1UY0A 1QZEA 4YGCA 4FE7A 4YG2F 1B59A 3RIRA 4IEUA 4QHOA 4L5IA 3OYNA 1K5JA 4F7ZA 3F8CA 4M9ZA 2XQRA