4CCLA

X-ray structure of e. coli ycfd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
372
structure length
371
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 50S RIBOSOMAL PROTEIN L16 ARGININE HYDROXYLASE
total genus 79
structure length 371
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4cclA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4cclA01
5FYHA 2P5BA 5FY4A 4D6RA 3PU3A 5FZBA 4UF0A 4QXHA 5IVFA 3DXUA 3PUQA 5FZ7A 5FJHA 5ISLA 2GP5A 5FZDA 1VRBA 5IWFA 4LITA 5FJKA 4URAA 3ZPOA 5K4LA 4AAPA 3AVSA 5FUPA 5A7SA 5FPAA 5FWEA 5FXVA 5E6HA 5IVYA 2YU1A 5A3PA 5F2WA 3NJYA 2XDVA 5FYSA 3OPWA 5FZOB 3KV4A 5FZ9A 5FZGA 5A3WA 3K3NA 5FXZA 4QX7A 5FY8A 5FY1A 5FZ3A 2YPDA 2VD7A 4IGPA 4EZ4A 4HOOA 4Y4RA 5FP3A 5FY0A 5FZCA 2OS2A 5F32A 5FYUA 4GD4A 3PTRB 4D6QA 4Y3OA 5FZKA 5FBJA 5A7WB 3U78A 5A7OA 5F3EA 5FYBA 4LIVA 3N9MA 5FYCA 4CSWA 3AL6A 5LW9A 5FPVA 3N9PA 4EZHA 5FZHA 5FYMA 2YBKA 5LY1A 4E4HA 5F37A 5A3TA 5IVBA 2XUEA 4CCMA 4TN7A 3N9OA 5LY2A 3UYJA 5FWJA 2Q8EA 4CCNA 2PXJA 2XMLA 2YBSA 2YBPA 3PURA 3K3OA 4V2WA 4ASKA 5FYVA 3N9LA 4XDOA 5FPBA 5FP7A 3PUSA 4V2VA 4QX8A 5FY7A 3U4SA 3OPTA 4C8DA 3RVHA 5LWBA 4Y33A 5A80A 5FP4A 5FZMA 5F3IA 5IVCA 4HONA 3PU8A 5FYTA 2WWJA 4EYUA 3PUAA 3LD8A 5A1FA 5A7WA 5FZ6A 2XXZA 5FXXA 4CUGA 4CCOA 3N9NA 5A7QA 4DIQA 4BXFA 4NUBA 5FUNA 5FP9A 2OX0A 5FZ1A 4CCKA 3KVBA 5KR7A 4UF0B 4QXCA 5A7PA 5A1LA 3AL5A 4BU2A 5FZLA 5FZAA 3KVAA 4DO0A 5FYIA 5F3CA 5CEHA 2OQ6A 5ANQA 5FZ8A 4AI9A 2WWUA 5FP8A 5FZEA 5F5IA 5FZIA 5FPUA 5F5CA 4D6SA 3KV9A 2GP3A 2W2IA 3LDBA 5IVJA 4CCLA 4QXBA 3AVRA 4GAZA 5F2SA 3KV5A 4GJYA 4GJZA 5FYZA 5FZ4A 5IVVA 5FY9A 2Q8DA 4BISA 5FPLA 3KV6A 5FZOA 5A7NA 4IGQA 3N9QA 5F3GA 5A3NA 5FV3A 4QU1A 2OQ7A 3DXTA 4XDPA 5F39A 4CCJA 2YU2A 4IGOA 2Q8CA 5FZFA 3K2OA 3PDQA 4QWNA 5FYYA 5F5AA 4LIUA 5FZ0A 5FXWA 2OT7A 5IW0A 3ZLIA 5IVEA 4LXLA 5FY5A
chains in the Genus database with same CATH superfamily
1ZZCA 3HOVJ 3HBKA 3V0AA 1FOXA 2ARXA 1W2NA 2OAZA 3K4AA 1NG7A 1VQ7I 2Z16A 4OVEA 5HDKA 1VMFA 1TW3A 4GXOA 5E1XA 5HS9A 3WG4A 4AVVA 5EHDA 1JT6A 2JRMA 4E4SA 2L0KA 2WWSA 5DUVA 1C28A 3ZMZA 2VKDA 4Q4Y3 3PJYA 4BIOA 3BIWE 2GNMA 2UYAA 1V55H 1Z05A 4DXRA 5FPVA 4BQAA 1A8DA 2EV5A 4JDMA 1FOD3 4C1XA 4FISA 3ES4A 1DP3A 4QGMA 5HOOA 5I0UA 5DCMB 1JH5A 5LBEA 4LBNA 2M8GX 2DURA 3H9GA 1ULYA 2JN6A 5FQ0B 2VBXA 2P17A 5L9RA 2DYCA 4Q48A 1VB2A 3B93A 3SZPA 5DAPA 2XJVA 3ZYGA 2ECCA 5ILVA 1W5CC 4FQGA 4JDNA 2UXXA 2GH2A 2F4OB 4XF3A 1H89C 4A12A 1W9WA 1JYNA 1YQ8A 2LG4A 1FPN3 2VO5A 3Q9OA 2ID6A 1N3OA 2QQ8A 1ZK8A 3D5OA 4RHV1 3IH4A 1OPOA 4YW4A 4QPGB 5KHGA 2K40A 5J4YA 4MFDA 2OPWA 5GADJ 3VGIA 3VD5A 3J80K 1F1ZA 2KIMA 2L7ZA 2EIDA 1AYM2 1AWCA 2R32A 4A41A 4IVNA 5L36A 2VBYA 1ASJ1 1STZA 4XRMA 2ADEA 4LE3A 4HK9A 3KX2A 4RS5A 5I8TA 1QJY2 4XSXF 4UXAA 5LRSA 2BGOA 3K51A 3I2OA 4XMIA 4A3BJ 2R5ZA 2DMNA 3QBQA 1CGPA 1ZRRA 3DLAA 4CDXA 3ASIA 5JI6A 4DW6A 3VZMA 4IQJA 2OQGA 4Y4RA 2DLLA 2D6KA 3PTRB 5FMBA 1OT5A 3AX4A 5B4NA 5KC5A 5F9TA 2RG4A 4IPAA 1MZ6A 1LHVA 2A6TA 3I59B 2DTZA 4ZYAA 1YRNA 4NIDA 3C2HA 2M87A 1KD7A 2WZR2 4GB33 3CF2A 1ZELA 4I09A 3LEKA 4KIBA 4WZCA 3NARA 1GFF2 3QOEA 3GTLJ 4L9NA 4K40A 1XX5A 5M0TA 2DT5A 1ZBA2 1S29A 2HWB3 3OGVA 1WWXA 1O7FA 2BOIA 3ITQA 1VTNC 3HWJA 4TYSA 2ZGLA 1WFXA 4IESA 1O4YA 3SCHA 5CKMA 4EGYA 3TOJA 1PJRA 2HR3A 4EJWA 1U9NA 2X1DA 1SAXA 1XNKA 3OGRA 4XTMA 2VZUA 2QE3A 1ETYA 1RUI1 4XUPA 1GXQA 2Q8CA 1RIOH 5F5AA 4Z6YA 1VQ9I 2GXAA 3SH4A 2ISYA 3TGNA 4ITCA 4WM7C 2VOTA 5FO7B 2EFWA 5FJHA 5ISLA 3UJOA 3ZYRA 1SBDA 5GZGA 4KMUX 1PMJX 2YS9A 1VFCA 3N97A 1VQNI 1ACIA 1Y56A 3TMOA 2VJ4A 2R062 2F5EA 5B5EC 3SQOA 1S0DA 3ELKA 1DP0A 1A04A 2VZTA 3OPZA 1BR2A 1W5TA 4IV1B 2LS6A 4AHXA 2ZZQA 2VNOA 2VU9A 2OBPA 3Q8CA 4DEVA 1UIJA 3BTXA 4X0GA 4MTEA 4EQQA 3HPNA 3WDWA 2DU0A 1H8TC 3LL7A 5FIXA 1U5ZA 3CU7A 1ACCA 2VPLA 3AMQA 3WU0A 1P92A 2RJLA 3N9NA 4XFIA 3TP3A 3E6MA 1RYYA 1MGTA 5JUVA 1NTCA 1T8IA 3WQ0A 1F4KA 3HG9A 2EA7A 1IUFA 3HAGA 1B09A 2A7AA 1WQ2A 4L11A 4HAMA 2ET1A 3D5LA 4JYKA 5K0UC 4LOCA 3BVCA 3J7YJ 3J80Z 4A3DJ 3WHCA 4Y4YA 3ABTA 3WNLA 3CP2A 1VBC3 1NY71 2Y6KA 4O3MA 3OS2A 4EJTA 1ND2C 2ARBA 5FYHA 4G7HF 5T5PA 1GANA 2UYBA 4JBAA 4LLNA 3RCOA 3APBA 3H9QA 3HC7A 5FJKA 1VBC1 3LAGA 4CDQB 4H2AA 4ZTFA 3JRFA 3TNPB 2FJ1A 3IL2A 3O1RA 1W6MB 4OLLA 1Z0HA 1NCQC 1RUF1 1OCTC 4BY1J 4L9TA 5J48A 1XTAA 1ZG1A 3J8F2 3OEBA 3A0BC 3FMGA 1WJDA 1OSGA 3ZFEC 2Y6FA 1WJBA 4PJJA 2EZKA 5IATA 3MUZ1 1JOJA 5T3NA 1GQPA 5DM7F 1P4AA 3DPTA 1KDKA 2MLGA 3CCJI 1RXGA 4HONA 4O61A 4FHTA 3NWKA 2RQQA 4AFBA 3DTKA 4BXSV 2VODA 2HJIA 1AA7A 4ZZ5A 5KAFC 2DA5A 2V09A 1MEC1 2GC3A 3A22A 1HRV1 5T5LA 1WLDA 1WMFA 1KU7A 3JW4A 1IAWA 1CZSA 4NDLA 4HKLA 1W36C 4HXCA 1X3WB 5F5IA 2XV4S 4UV8A 2JWPA 2RR11 2QQPA 1URXA 1JUIA 1B9NA 1CD3G 4XABA 3FBYA 4QWNA 1CZTA 4HSLA 2Z1DA 3ZXLA 3U14A 4LBQD 4II2A 1T6BX 4YELA 4BA6A 3B73A 3H42B 1UXXX 2PHLA 4Y1UA 1GDTA 3FJSA 1UFMA 1LDDA 1X1AA 3RKYA 1FSHA 2QBXA 2R7FA 4WXCA 1X3ZB 2GM4A 4UYBA 5CG9A 5ACA1 2LROA 3BPZA 1MZBA 4C0HA 2VMCA 4PLNA 5K9YA 1K5MB 2LSOA 4RS8A 4XF0A 2QF7A 4Y13A 3HGYA 1H4GA 3IP4B 1OUSA 1ZKGA 4LIVA 3BQYA 3O0VA 4CCEA 4XDQA 4P08A 2ESNA 2DN0A 3EXUA 5KAIC 4Q4W3 2M4GA 4CYDA 1YS6A 2M8EA 3RVHA 1UU5A 4QMAA 3M7AA 3NW4A 1CJDA 3PU8A 1NH3A 2H1LA 2VOVA 4WVWA 2E7WA 2XGEA 4OAYA 4YIIA 4HNTA 4A3CJ 2BHZA 3WTYC 3WZ1A 2IGMA 3HQUA 2W48A 3PNTA 2VVFA 2VZ3A 3HNYM 1XE7A 1HQLA 1DGWA 1Y8QB 2JX9A 4IE7A 4DO0A 3ZYFA 1MJAA 1XYPA 3F23A 2PHWA 2E19A 1DQ2A 2ZMLA 2FMDA 1XSXA 3MVPA 2QYOA 4LMFA 5H9QA 1UZYA 3C7OA 4J25A 1WGXA 4X8NA 2M5WA 4LJZF 4JQTA 3D5RC 3J7MA 2RS11 1EA3A 4HG2A 2FSWA 3POYA 3VKOA 2VOKA 4YG2F 2CWSA 4GWNA 4UV9A 3WNOA 3NJZA 3MKYB 3ES1A 1D1CA 5D2AA 4AIKA 3EBRA 3W6KB 1FX5A 1ULEA 1ULPA 1WLTA 5DD8A 4AFAA 3I9V2 1EH8A 5E3LA 4KN7X 2AQEA 5H9SA 1K45A 3VDBA 3P5BA 3BKZA 1IS6A 4YWAA 5T5OA 1QZZA 3HRSA 5FFXA 3P6BA 2KT0A 1I27A 2Y9YA 2XAJA 3GFLA 4P5YA 3G1OA 2VVDA 4DUWA 3M4FA 1ST8A 2VLAA 4AHYA 1APNA 1VR3A 1QNTA 3CKHA 2L5QA 1JI6A 1L7RA 2VMGA 2G19A 2NS7A 4EN0A 4FX0A 4A7KA 4FETA 2EICA 2A6VA 2P6SA 3CCYA 1HN1A 5A3OA 2NAZA 3BT9A 3OB8A 2VUDA 4M6XA 3JR9A 2KHMA 4PQ9A 2EIEA 2EIKH 5ABJC 2EIMH 3KP6A 1WA6X 2WNVA 5F2SA 1GV5A 3AC0A 1S5LC 4YM0A 5H20A 3MBWA 1Q56A 1PGSA 1OVSA 1DDLA 4KISA 4A6SA 3K69A 5D5UB 3S14J 4G94A 5JIUA 1YW9A 5CLSA 3CBNA 2GP5A 2DBNA 4CDXC 3R4SA 2PFWA 5CAZA 5EZWA 4P96A 4B8EA 2QLZA 3GCWA 4AIDA 3IH2A 4X6QB 1FPN2 4A3IJ 4XHBA 2OQRA 4Q5OA 4UFIA 5DDGA 4RQPC 4BQ1A 3FM5A 3T4HB 3CJIA 1GVDA 3SH5A 3ZSKA 2PLV1 4RGGA 4LE4A 5C3RA 4MUVA 2W1WA 5E20A 5JZGA 2VQLA 2O3FA 2AXTC 1NZCA 1TQ5A 3K10A 5DTDA 2PLV3 2YXSA 2CUEA 5GTIC 4LHKA 3KMHA 5FP4A 3SXYA 2W7NA 1TME2 4D7NA 1ZRIA 1J1TA 3L2WA 2P4WA 4FPFA 2XJSA 1AR83 2BGPA 1QH6A 4Y5TA 1PUEE 1ON1A 1QKQA 5BNNB 3AP5A 1HJFA 3NNFA 1UXZA 4LG0B 3OYWB 3MV11 2ZX2A 4D69A 2WO1A 1RUC3 2PHRA 1Y1VJ 5IFTA 4URTA 4NVPA 1D1AA 3ZR8X 3T3YA 4YFWA 3FHAA 4NHYA 2A5WA 5CISA 4M9SA 2BOLA 3S93A 4PBOA 3D4KA 1MKMA 3MN2A 5JR3A 3KP4A 3MIGA 2Z42A 4BIFA 4XF1A 1LFPA 4Q5SF 5DAWA 4AK3A 3SKJE 2PMWB 2VM9A 3GZAA 1CR7A 1A5JA 4S2HA 4ASMB 5KXBA 2AEZA 2IVJA 4AQTA 1BBT3 4XCAA 2P3KA 3WD5A 2BY0A 1V6NA 2AZ5A 4LKEA 5HS7A 4BCUA 5LK5A 2W68A 5FB2A 1U8RA 4R1HA 1I3QJ 3MKLA 3S2HJ 1VRH3 4Y20A 1LE8B 4Y33A 1VBE3 1W90A 1K4SA 3ERED 2E1OA 4OUSA 3GDBA 1HRI1 2QQUA 3WGHA 2CU7A 3HNMA 3KVBA 1OR7C 4HETA 4XONA 2ZHNA 4BXUA 1QJU1 1SACA 2WO3A 3MIDA 3KETA 2XWJB 2BBYA 4N0BA 1FTZA 3N35A 1S3JA 1KZHA 3RMXA 1JKOC 2C24A 1VBD2 5FZ4A 1ENSA 1MS1A 4JGYC 2C6SA 2X05A 1JZ6A 3CJNA 1UMHA 1OYWA 5FOBB 4Q4X1 1AR93 1QZYA 3CO2A 4A7ZA 1UCXA 3DU5A 3K70C 3O1PA 4K2EA 3RJRA 4N53A 3PSFA 2GIVA 2NMOA 5CFDC 4LKSA 4CUBA 3RZMA 5C6CA 4YGEA 1EV13 1LKXA 5FUPA 1XSRA 1AHDP 4FPGA 2EV0A 4Q4V2 2CMPA 4CICA 3H1WA 1VJ2A 4PHZA 2ZX0A 4ZYDA 4L92A 3GCMA 2ZO4A 2RM22 5L7OB 2LR8A 2X4HA 2KFDA 4C3IJ 3N9LA 3HSEA 4BDVB 4CA0A 1K4TA 1OOPA 1HRV2 1YRNB 3HZJA 2ZEWA 1RIRA 3WF0A 2QZ3A 1MNDA 3ILNA 3JSOA 1PK6B 1B72B 4FE7A 2AC1A 5J7MA 2R7OA 1W0UA 1OLRA 4G6TB 2LC2A 1APLC 1E5IA 2I2SA 4QXCA 2X09A 2Y64A 4RBOA 1SD5A 2B7EA 2VOOA 4FTEA 2CHHA 4B3AA 4IO9F 4D7YA 4KIGA 4RS5B 1NX9A 2JZYA 5JXHA 1LGCA 3E1F1 1DGRN 2X53S 4AGGA 3I3BA 2AEYA 4PLMA 2GXGA 1QH7A 1YXWA 4ENNA 3ZXFA 5GZEA 1UX6A 5DPNA 2OT7A 4YVWC 3OIQA 1R9TJ 4GIQA 4YM1A 1QJU3 4C2UA 1COV2 1DIWA 2VC9A 4PT6A 5FWEA 4WK8F 3IDBB 1EUUA 2XDVA 5L3CA 4X6RB 2R7DA 2IS4A 3JAMK 2CV1A 5FY0A 3A03A 4Y3OA 4DY5A 2ADUA 1HXS1 5TSWA 4ENKA 3ZGKA 4QPIC 3GFIA 4QDQA 3JTHA 1R082 1KA8A 5CYYA 2TEPA 2LREA 4XFHA 1Q43A 2FDGA 1EH7A 4TZDA 2IGNA 5FKLA 5EJCA 4WM8B 2XIGA 4BUPA 4AVAA 4Y7NJ 5JOZA 4M3BA 3LIHA 5BS6A 4IEZA 4XZUG 1FOWA 2CDPA 1O91A 3B9CA 2FEZA 5FCCA 1G2HA 2IFRA 2WAOA 2H6BA 3LOCA 4RQPB 3DN7A 2EV6A 4EWDA 1ETOA 1CN1A 2O0OA 2V4VA 3UK9A 3BTZA 4O65A 4ZDOA 1O3QA 3QU6A 2VIXA 1V9U3 2M7AA 3O0WA 1X3UA 1UZVA 2MW8A 3LQCA 3ESWB 1JW6A 3RSNA 2RVAA 2GC0A 1XE8A 3PJRA 3ZSMA 2D3RA 4JX0A 5T52A 4E8CA 3G6EI 5DYMA 2L7FP 4OMYA 4BJ0A 5AFBA 4YVSB 3B7MA 1PK6A 1UY4A 5C8CA 4PBPA 1FIAA 3L9JT 3DLLF 3PU3A 5B4XA 5EPAA 1R1UA 5HDGA 3SDGA 3VZJA 5FKNA 4ZYHA 4B8XA 1W6PB 2PMUA 1HDPA 1LGBA 1F8VA 4F52A 3K4DA 1T6SA 3LEIA 5JCTA 2KRHA 3KHCA 1JXNA 1SBFA 2MD5A 3HUGA 5LA2A 2NVYJ 1RUJ1 2E7AA 2Y6HA 2J5OA 3LSDA 2WKKA 3ST7A 4AEKA 1BEV2 2RS12 1W03A 2CQXA 2M1BA 3OOPA 2ORZA 2A3XA 2P5LC 1QQP3 3KB5A 1QXJA 5BNGA 3CUOA 2YPJA 1U12A 3NV2A 4AE2A 4FO9A 3HUGB 5BNNA 2WV0A 2JDPA 1B35C 2VOWA 4AEDC 1R4NB 1PVEA 2Q0OA 2IS2A 3NNMA 3GTKJ 1IS4A 1IDYA 4YW2A 2NXNB 4YFXF 4A93J 4KGGA 5K7HA 3BCAA 2WNVC 5D8AB 2W3JA 5E1RA 4R9BA 1EKEA 5FOJB 1FYMA 4LT5A 4YVSC 5H6QA 2PMHA 2BUKA 2HWVA 5C8CB 3B5LB 2WAQA 2HWD1 1IG0A 1XGMA 4WBBA 4QQOA 4V2GA 2LD5A 2W94A 5GZCA 3SQNA 1SPPB 1NA1A 4QAWA 2M7BA 1UYXA 3T2QA 4AXOA 3CCUI 3KYLA 1NK2P 3BTIA 3RI4A 4UNOA 3H0DA 4YFKF 3OSFA 5FZKA 4J1WA 1BMV2 1C0WA 3JD72 3HOUJ 5HPOA 2VMHA 2RDRA 4F83A 3W2WA 1HBXG 3MICA 1NG6A 3HQXA 4YARA 1QJEA 4F92B 3AAFA 3LNQA 3T0DA 4A3EJ 1C8NA 3Q0WA 5M3FJ 2CG4A 2K27A 4Q0QA 3VFZA 3LA7A 4Z2WA 2E31A 4AVSA 2ZJ2A 1WW5A 4AEJA 3O1OA 4AYUA 1FLIA 2Y0SN 1RUH1 1YHQI 5J8FA 5FP9A 4Q4W2 4D94A 3EJKA 3VBUB 1BR1A 3LE0A 4BY7J 2HBTA 4HA8A 2MABA 3AYEA 4A2UA 3E6BA 2QGUA 1DG6A 4NROA 4BZ4A 1IXSB 1S7OA 5EWSA 1L7QA 3E3VA 4FPYA 3KE2A 2P6HA 4DQ2A 1HW5A 2BBVA 2ZMKA 2XBO3 3NJVA 4UFKA 1RZ4A 1XPWA 4DBRA 5LA0A 2F4IA 2UWAA 3ZFEB 1VQ5I 3MZYA 2F5VA 2JDKA 4DUXA 3WV6A 4LBQA 4NHXA 3K4LA 3K75B 2Y9ZA 1RUI3 4YFNF 2BJSA 4FBFA 5CVRA 1GU3A 2DJNA 2O14A 1IQDC 3LSKA 3H5RA 4OFGA 1IUYA 3POIA 5FYSA 1G7YA 1T95A 4GB32 2G9GA 1ZM1A 5I93A 3RJPA 1G86A 3RYKA 3W59A 3VDAA 2WJSA 5FYMA 5BPDA 3KEOA 4A0YA 5G05L 1PX3A 4QPIA 2BVVA 1T39A 1XC6A 1A3KA 1FI2A 1X50A 2RS13 1BEV3 1CONA 4MGRA 2UWMA 2HKOA 3ZXGA 4CXWA 1Z3XA 3I2DA 5FY7A 1QPMA 1X4PA 1AR81 4QM8A 2HDWA 3TO7A 5FZMA 4J1XA 3O1TA 3QOPA 4MVTA 4S0HB 3P9KA 2V6CA 2PJPA 3SEQA 2X6OA 3SH3A 1NLRA 3SXWA 3CDLA 3J7AO 3I2KA 1AR63 3I0TA 5L73A 3J8F3 1E3OC 3UGGA 3HR9A 5L3FA 4Z8BA 5IOYA 2ZSHB 2FZ2A 2YSRA 1YQ5A 1QGLA 3LOBA 5HBAA 1SD4A 2KA3A 1MBHA 2RE9A 1Q1VA 2OIIA 1YI2I 3E5QA 2EQRA 1S6LA 1GBGA 4LIUA 5K0UB 3ZXDA 1H1MA 2R072 1YIJI 1VIWB 5CFDA 2OPTA 4EJRA 3OG2A 3L2CA 2VQTA 1GZ9A 1KQRA 4XJAA 2CJJA 4QHBA 3ULQB 4AD9A 5GPCA 4L99A 4AVBA 5CQEA 4MNUA 2V72A 2VBDA 1RUI2 2GMEA 2VULA 3FLPA 3VBUA 2ZXWH 3FBNB 2J5PA 1SVLA 3SEPA 3ZSJA 3HOYJ 3HMYA 4AQSA 1J3QA 3IKTA 3VKMA 3H5AA 3GZNB 1IJWC 3M4OJ 4HN0A 5C3QA 2IWGB 2Y0IA 4QX8A 4NPLA 2CQNA 3S17J 1AF9A 1R083 2YFUA 2VJXA 3F9KA 1ZZBA 4DINB 4UUSB 1EAH3 1K83J 5CPRB 3FE5A 5DAQA 5GAHJ 3A4CA 3OGJA 2WFF1 5L9VA 2B8MA 4OHZA 4C3JJ 2VMIA 3BROA 3OBRA 2A6ZA 4XRFA 4AEDA 1RKTA 4GYIA 3UGHA 1UPIA 1A31A 4FVVA 4QKNA 1LOFA 2B5HA 1JYTA 4G7ZF 1Y6IA 2VVEA 5CVJA 4IE0A 5F3GA 3AYAA 4YVSA 4W50A 3FC0A 4E7SA 2VPVA 3I2HA 1QJZA 1CIYA 4UY8I 2HWF1 1U5YA 2OC6A 2Z5UA 3ACGA 3TBIA 1XQNA 3HSFA 1QJY1 2LALA 4LUKA 4Y22A 3BU0A 1Z6TA 2QKDA 5EYRA 4EZ4A 4BK5A 4RGXA 2Q8KA 4ZTJA 2A1XA 3BR2A 2HTJA 5CKQA 1DQ6A 3O1SA 2AH2A 3ZFEA 4Z92B 4GWMA 3H1YA 2V4JC 4QDSA 1XMXA 4UFHA 4LMYA 5JIAA 4OUMA 3DGTA 4P5OA 3WP4A 5A6ZA 3W58A 4Y22B 5ICFA 4AVPA 4FPLA 1S0FA 1TNTA 2R043 3VBHA 2QQBA 2YYOA 3O3KA 3RZKA 2D1VA 2GH8A 4S2DA 3GTJJ 1U5TA 4LORA 5FK8A 5GPAA 4GA9A 3BOQA 4JQRA 4UVBA 4PF5A 5ICEA 3C1DA 1LNWA 4J19A 3VBSB 5AIPA 4RGKA 1ITYA 1VF9A 5JI7A 4RGAA 3PMEA 1NQJA 4FTHA 2AACA 2EWNA 4FPJA 2I74A 3IMMA 3I2FA 5FPUA 1HX6A 3U07A 3BZ6A 2B7YA 4ZDLA 5J47A 3P9IA 5CFCA 4UUSA 1NCRA 3BP8A 4XBFA 4U7DA 4CEYA 2ZACA 1QJX1 2HYJA 3TNQA 2Y38A 2JIJA 4AOCA 4C30A 5CB7A 3DXUA 2E60A 5AFEA 2YROA 3ZXSA 2DUPA 1LE8A 4HQMA 1HKTA 3CLPA 1GMMA 2J42A 1YIFA 3CMGA 4BQWA 4W8JA 3SZTA 5CKNA 3OPWA 2D43A 1W9TA 1PMHX 2NPIA 3ZYPA 1RR7A 4HPKA 4NRMA 1YO8A 2LKPA 4MH0E 4M6YA 2CRGA 3NNLA 1AVBA 3O6BB 5I91A 2R30A 4JGZA 3V64A 3WDXA 1GHCA 3GZTB 2FBKA 4AI8A 5CA6A 1AR62 3OY8A 4KA4A 3KM5A 2VY0A 3ORJA 4PFPA 4C2MJ 2ZMEB 2YU3A 1FV3A 4GZ9A 2LKSA 1RUNA 1AL21 2VBWA 2A5ZA 2IC1A 1KRIA 2JD9A 1K12A 3S6PA 4A3KJ 1UYYA 1JJ8C 2VXDA 1VE0A 3ELNA 4KNCA 3WUDA 2VJ5A 1T38A 2A61A 5JPNB 2E51A 5HLHA 2VBBA 4QQPA 2IGKA 5EV7A 2YC4A 1X36A 1TQPA 1T6GC 3AYDA 3QYFA 4X1EA 3CMEI 4AFCA 2J1RA 4GAZA 3SLIA 2WO2A 4N53B 4YZ1A 1OURA 1HCRA 4ZY9A 4JGYA 2DMTA 1BBT1 3SJMA 5F39A 2W0XA 1ZA4A 1DYOA 4KIFA 3PSIA 4Z2YA 4HLTA 4BACA 3MW4A 5KHIA 2DQLA 4CXXA 3UNGC 1FJLA 4QXHA 1DZRA 5FMOS 1W8HA 2P3JA 4ATFA 5K7PA 4ATEA 1ENHA 5BUVA 3V0BA 1JTZX 3LSPA 1I5ZA 4XLAA 4E70A 1TMF3 1NLQA 1AR82 1KS4A 2ACJA 2DFFA 1RMU2 4LB6B 4PI0A 1FNNA 1C1LA 4XJWA 3WNXA 1OYYA 2PLV2 1AKHB 2NQYA 3IAPA 5JFRA 2DCYA 1DHKB 2BVMA 4IRGA 2RDSA 2DA1A 1S2KA 5JDBA 1C5IA 4CRQA 1SZBA 2DOEA 1FPN1 2KP6A 3I55I 5C9AC 1USSA 3K4MA 2RAEA 1AR91 3ZR5A 1JGGA 3AP6A 1IZ1A 4D9JA 2HWF2 3ZFFA 3KQRA 1TG7A 1ND3C 4U2AA 3VBRC 1R5GA 3OUHA 3A01A 3UGFA 4KWJA 3EO6A 5IJRA 4B43A 1SFEA 3GJBA 1W0TA 1R1TA 2XAHA 1FBQA 4DS0A 5BV6A 3TOAA 1SMYF 1TL8A 4Q2FA 3QWLA 1ZBE3 2M34A 3CCVI 1ZREA 3DKYA 1RUC1 1G9AA 2JMWA 4XBQA 1YYVA 1EAH2 2VI6A 1J59A 3WTWC 2HDDA 1REEA 2R7VA 4MGYE 3CMMA 3EDPA 4KMFA 3KF3A 4WM8C 3WGGA 2YV8A 2I45A 2E2IJ 3TEZA 3MAJA 4BB3A 1MBEA 4HOOA 2KIUA 1B6AA 2EK5A 3RZGA 1OLQA 4M3CE 3OD4A 4J6GA 1K61A 5LEJA 3LSRA 2DVBA 5C4JJ 4FOYA 2IPQX 3MFKA 4U0WA 1Q8PA 2Q30A 4E9KA 2JA6J 1IXCA 2H6CA 1QWRA 2E33A 4IDZA 4XF4A 4V2WA 3JTGA 3I59A 4XJ8A 1VBB1 3LEMA 5JPMB 5A80A 3R61A 2R7TA 2Y26A 2DCZA 1XNTA 3RWNA 2R073 4IX7A 3WU2C 2CO5A 2VZOA 4LHSA 2FNAA 4AM3A 1UN1A 1YI7A 2GAUA 3U1XA 3W20A 1SAUA 3HHHA 3WDTA 1OOPB 3JQXA 4RDUA 2ZJCA 1SFNA 1FIPA 3LSJA 2D6OX 3LDBA 3MIHA 2DFHA 1SLCA 3KP7A 4E4DX 4YG0A 3WW3A 4M3CF 2YX7A 4P9UA 2XLFA 4XQ4A 4P9FA 1Y1WJ 2XPJA 5IYYA 3ZFFB 2ZGPA 4CYCA 1W0OA 4ZYGA 2LK2A 3JRDA 2P5BA 3ABLH 2Y2ZA 4UI9L 1JKQC 1O3SA 2WZR1 2FU4A 5DS9A 3OYGA 3OYFA 5FMDA 5K5QA 3H1MA 4WXDA 2WQZC 1LFUP 1ND3B 3AXEA 1XPXA 3GLLA 2DA2A 2Q1ZB 1PO21 5F1JA 2XUMA 2QQAA 2BERA 1LUJB 2HQ5A 4RGSA 1XYNA 3Q8FA 2P3IA 4RA2A 2E5NA 3OR2C 1NY72 4K1ZA 4C8DA 1FXZA 5EZGA 1WBFA 1JZ5A 2BFUL 1WSUA 3PVOA 1PIV3 3OSDA 2A6EF 3FFQA 1AYM1 3WDYA 2UY9A 1UOJA 4JZRA 5F6LB 4WWCA 2HQRA 4NPRA 2ID3A 3LSTA 1SFOJ 4CHUA 3DCFA 2MEV1 4AU7A 1YIPA 1FATA 1OH4A 2D93A 2VG9A 3M70A 2R5YB 4XVHA 4OIRF 3MEPA 4G12A 2JPBA 2DYRH 1FBUA 1FOKA 3OS1A 2EA2A 2D5VA 3GWZA 1Z0XA 3CUQC 4DBQA 1ORKA 4QD2A 2EVXA 1TNFA 4RGRA 2R071 2VTXJ 1U8BA 2N7GA 5LBQA 4BQ2A 2E32A 1SG3A 5IW0A 4G6DA 1WUVA 1A36A 4P9JA 1BC8C 1RL3A 2A5YB 2W46A 1H8AC 2O8QA 2K02A 3ZQCA 3PUQA 2KDOA 5HODA 3ZPOA 4GMP0 2O8KA 1U5IA 2MC4A 1PDNC 3G2BA 1VI0A 1UMIA 1REFA 4IEQA 5FO8B 4MEXF 1RRJA 1MMAA 3JD73 2CAUA 1OF4A 2WBKA 5A3UA 1SLIA 2KJBA 4Y1XA 2Z9OA 2X1CA 3UYJA 1X58A 4MV2A 3W5NA 2QJVA 3BUCA 3C7GA 1S1AA 1VQ4I 1C1FA 5JR7B 1BOBA 3R4KA 1RHI2 4QHZA 2MEV2 2LKXA 1HRV3 3NKTA 1KYZA 5HV0A 3O5SA 1POGA 1K3IA 4UF0B 1O4TA 3WDVA 3I4MJ 1PGW2 2KKOA 3FKJA 2VQGA 3ZO0B 4QX2A 5B3SH 2M0MA 3RZDJ 5BNPC 3BPSA 1GT0C 4O7XA 4QXBA 3F8BA 4XLEA 2M9HA 4C91A 1YRZA 4L9VA 2CFOA 2R5ZB 3N9QA 3W3CA 3JZVA 2CH0A 3IRRA 3GFJA 4AHZA 2LOOA 3KEYA 3B3QE 1C8M1 2ZHLA 1V9U1 2FBIA 4QLCU 5JXJA 1OI6A 3CJXA 5J1RA 2UV1A 3VBSA 5FO5A 4CDGA 1H30A 5E3OA 4CCDA 2WTEA 4ESBA 1Z9CA 2NRAC 3HBLA 2XVKA 3ERMA 3SEEA 5IHRA 3TDUC 4Q29A 2HI3A 3ZXAC 4YNIA 2B4KA 4PJ0C 4HRIA 2L7KA 4Y1ZA 2E1NA 4LA3A 3JUUA 2XAFA 1RUH3 2L9LA 2YGLA 3CHXA 4QXKA 4PF1A 5DDJ1 5AVPA 3AKSA 4LFUA 1F36A 5BXXA 2A3WA 2B45X 3KLNA 4B4QA 1GQGA 5HCAA 4A0XA 1XDSA 3OPTA 2F4MB 1SQ4A 2FE3A 4Q4V1 1YFUA 2WINB 5FRMA 3Q8AA 2ZJRF 1DU3D 2EXJA 1Y9GA 5FXXA 3T8RA 1FTTA 3OYBA 3PQJA 1Y39A 2J1TA 1H9PA 3I97A 2P6CA 3GTPJ 1C3HA 2BTVC 2JG8C 3WF2A 1W28A 1BMV1 2W4SA 1US3A 1BKZA 2JICA 4XF9A 3RYRA 3MW2A 5D5VB 1OPMA 4EJUA 4HBNA 4L97A 3OYMA 1ZYBA 4OZXA 4ZHNA 1VMJA 3S3NA 3BODA 2Y0MA 1XJAA 3AMHA 2VASA 3A2KA 1W8TA 2Q8DA 5C3OA 2FDIA 1ALYA 2XSDC 1K78B 3GBGA 1ZA7A 2R4GA 2IXIA 1D4M2 4XDPA 4PIXA 2K9SA 4AEMA 5EEAA 1QY4A 2F6CA 2FOKA 1FOD2 2ZFUA 3R6SA 2K3PA 5GM0A 2DU9A 2PLYA 1LEMA 1H1AA 4LITA 2IXCA 1ZBA1 1W6QB 9ANTA 1TMF2 3IT8A 3NJYA 1HB2A 2FZ1A 2JSCA 2MNGA 4NIAA 1PIV2 2RR13 1JT0A 3AL0C 1ZBA3 3FBIB 1DBNA 2WAEA 3R05A 3MPBA 2EZIA 3ILRA 2GOXB 3K4JA 3H1CA 1POQA 5GAEJ 2BDRA 4RAGA 5ICGA 1ZQ3P 2E7QA 5ICCA 1IPJA 5A33B 2Y75A 3FHZA 3VBHB 2BPA2 1R1A2 1YJ9I 1HF0A 2BE5F 4AL9A 4N4OB 4AVCA 5FP7A 4N4NB 1RUF2 1RUD3 4QQHA 3QP6A 4BE2A 1RTVA 2N8GA 4YG3A 2IAIA 5FYTA 4XN0A 2WWJA 4RR3A 4RL7A 2XL7A 3B69A 1SFPA 4KWKA 1W06A 2V9PA 1ON2A 2HOSA 5BNOC 2Z33A 2ZMEC 2JEMA 3F2ZA 3VBRA 2ZGUA 3HDDA 1ZHFA 2O8XA 4JC1A 1UZCA 3AL5A 5K7ZA 2WB1N 1T08B 4HL0A 4XAAA 3LIGA 4CP1A 1RUOA 2BWCA 2LUWA 2W2IA 5IVJA 3WTZA 1UAAA 2R0HA 2IA2A 3W21A 3CP8A 3WINE 5A7NA 5A3NA 1MMGA 3HN1A 1RMU1 2IS1A 3BC8A 1GUUA 3WEZA 5JZGB 3VDCA 3I53A 3ABUA 2PAMA 1YX3A 4XXAA 4NAMA 4XHXA 3V0BB 4RM3A 1UNBA 1LOAA 4BE1A 1XN7A 2WA0A 2V4AA 5IY5H 4M74A 3DEEA 3VBOB 2EJRA 4GD4A 1I3HA 4DXZA 4QKDA 2DMUA 1W6NB 3T30A 1KEXA 5FZHA 3TN93 5JWPA 2WA4A 3IZOA 4L0YB 3BTAA 1W2TA 2IA1A 1JKPC 2JIGA 2JE9A 3JCIA 4M3DA 1GNZA 4PUSA 1AL22 4CXFA 2Y6JA 1F43A 1S9HA 2D7FA 4YW5A 3TDZC 3USUB 2LLKA 2FCVA 1O8PA 2LMDA 2WUHA 2ISZA 1LESA 4B48A 4NUBA 5D8KB 3DBRB 2BBAA 1G8XA 1U5TC 1V4RA 4GCVA 4XM3A 3L00A 3FWEA 3BTJA 4EWAA 1X9TA 1OA4A 5ANNA 3JBG3 4META 2EFPA 2QQWA 1NT0A 4FAHA 2LF7A 4OMCA 5LRRA 2M0CA 1JN2P 4F8AA 3JBG1 2VTXA 1ONVA 1QZEA 4WM7A 1QJU2 1YEWA 3GFMA 2JVGA 2BU9A 1G3SA 1PK6C 2DU1A 3ZM8A 2X5IA 5KHJA 3PL0A 5IOZA 2GA1A 1S0BA 4OZOA 3CJIB 2M2EA 1Q5OA 1ZZ8A 3HOSA 1FV2A 4RSUA 1FP2A 1BK0A 5GAGJ 2JG9B 3H8UA 2D3SA 5CZKA 4LOSA 1XB4A 2WY7Q 5DG2A 3VYUB 3NQOA 1DDNA 5EYXA 1H8TA 4BK4A 2CV2A 1PM7A 3AJZA 5GZFA 3OYLA 4MGZE 5FKOA 2AQFA 2HDCA 3W6JB 1IG3A 3AFKA 4MZUA 2ERFA 4B3NA 3DKXA 3FF5A 1EF4A 4FX4A 3ROUA 1IPKA 3F72A 3C7HA 2Y34A 1FPQA 5C4WB 3AZWA 4LQRA 3BR3A 2KRFA 1H2MA 2WFF3 2JD4A 1SFXA 4ZYEA 4UT5A 2GP3A 3I58A 2XQRA 1XBFA 1V6OA 4UBHA 2CAVA 3I71A 2BZDA 1M1EB 1EV12 2O61A 1HSTA 4EVIA 1RVF2 4NC7A 2E71A 4LO6B 3ZX7A 4DXTA 3BR0A 2E26A 1OXCA 3ZIXA 5ERIA 1Y0UA 5KBFA 5CG8A 1C57A 1DZQA 4BKXA 4BQXA 4DYRA 2IW5A 1U78A 4WCGA 1H0MA 2VE9A 4WVZA 5FUIA 1RITA 5FY1A 2JG9C 3TBDA 2VD7A 2W1UA 4MX3A 3PIOF 2VZQA 1N1TA 2XASA 2ZKZA 1POV3 1V6JA 4UW4A 1ZRFA 4MGQA 2Q0AA 4AGRA 1HRI2 1TEIA 4EM2A 4DZPA 1LVAA 1JYVA 1H6XA 5FAXA 1G9CA 1OA2A 4V2VA 2V5YA 4JHZA 2HPIA 1IW7F 2CV6A 4B09A 1VQKI 3O1VA 4E2QA 5IK5A 4BPZA 1IRZA 3J4UH 1HIXA 5F7UA 1W9FA 3JQWA 4M73A 3NQHA 3KZ4C 1X1DA 1GWKA 1RETA 3WQ1A 2G0EA 2W47A 1QNYA 5C8WA 2JKBA 5F6FA 2LP0A 1D8JA 4PJYA 5FZEA 2R7RA 5FZIA 1Z7S2 4N9HA 1COV1 1U3EM 3DBHB 3LSHA 4QKBA 2V9KA 3AG3H 3QQAA 3TQNA 1W2OA 1X7NA 5FBZA 5LGTA 1WLWA 3VUOA 4DOZA 1MS8A 4M9ZA 1MJBA 2WIIB 2TUNA 1FMWA 1IS5A 1QJX2 1CAWA 5IK7A 1WD4A 1HQWA 1WI9A 3HTUA 5LHIA 5DZFA 4XFCA 3KZIC 2P8TA 1JUHA 3HB9A 1RUF3 1R58A 3S3MA 1R1A3 4KUMA 3SMHA 4CCOA 1DGRM 3GTQJ 2V6EA 4XTPA 5FYUA 3UV9A 2ECBA 1WMDA 5FLVA 4AQ2A 3VBOC 3WHBA 2CDOA 2VCCA 1VAVA 1M06G 2R3SA 3EQLF 1E57A 2XMLA 4PCRA 2RS33 2XBO2 4BM8A 2Z3YA 2OZJA 3LWFA 3TW7A 2BVBA 3K1MA 1N47A 4D1QA 2WABA 4DXSA 1RJ8A 4FT8A 3K0LA 4A69C 3RGBA 3J26N 1MQTB 1JYCA 3C8XA 4XEZA 3EMRA 4RAZA 1D0XA 1JUSA 4ZJZA 3FX3A 3CD6I 2E9QA 4KBBA 1ZZ9A 3VZKA 3V56A 5AC91 2W82A 2Z5WA 3T4VA 5J4VA 2JG8B 5FYZA 2P81A 4LBLA 1G3YA 1BJQA 5E89A 1ZLKA 4PJMA 4XUTA 2X29A 2ELHA 2MPFA 2WLPA 4CCJA 3C7EA 1PIV1 3K70D 4YZ2A 4H14A 1W8ZA 4GH4C 4GB31 2XJQA 1YFHA 3AB0A 2OYZA 2H0BA 3SZGA 4JK1X 3N7MA 2MG4A 2PA7A 1GQHA 3LFKA 4JX5A 4D8MA 2AS5F 1LODA 1FP1D 4EGZA 3L2HA 4HFSA 2X10A 1SDDB 1HQCA 1JHJA 3J7ZI 1MS3A 1GSLA 5DN2A 4Q4W1 3S0MA 4UFJA 4S05A 1GICA 1RUH2 3PL8A 3T0BA 2ELJA 3U10A 1GR3A 3N9OA 2CSGA 4XKWA 5LEKA 4C9YA 1QBJA 2QQIA 3J7LA 5SV8A 3CJQB 1PO13 1FOD1 1GOHA 3K9TA 3LFIA 2QKLB 3OWTA 4BJ5C 3PTYA 4Q0UA 4MTDA 4DB5A 2B42B 4XFFA 4EM0B 3MPPG 3VYRB 1JKRC 3TEYA 4M3EA 2KMUA 3U0ZA 2FXAA 4E4ZA 1MH3A 4F93B 3ZQLA 5FZLA 2RGVA 2WZR3 1FT9A 4NBQA 3OIOA 5EYYA 5JHFA 5T50A 5B2GB 5FLIA 2R042 1US2A 1QO0D 1WW4A 1QJFA 1FMD3 5BOXA 2YG0A 2PN6A 5FD6A 2LFBA 1L3JA 2HOTA 1S0GA 5D4RA 1UOBA 3T1LA 2X0LA 2XOMA 1W3VA 2JXAA 2VL8A 2JRTA 2BXZA 3ZQFA 2W95A 3KF5A 5FZBA 3LEGA 2LBFB 5IP9J 3HBZA 3IWZA 2IBDA 3JB4C 3NVCA 4RM2A 5E6HA 1V54H 3F8CA 2R1BA 1N3PA 3BPXA 1Z6RA 4BJTA 1AX0A 1C8M2 2DT7B 3TO6A 1MQTC 1YI9A 1GZTA 2VN2A 3ZMDA 3AMNA 3DL3A 3VHOA 3L1PA 2VUAA 4IRIA 1VB4A 3ZN1A 5L3DA 1N1YA 2DBBA 2J7MA 3CESA 4CTEA 1B72A 4N43C 1STMA 3UR3C 1J3PA 1V9U2 1XE0A 2YB7A 5ACA3 5L7OA 4ES9A 1OFCX 1GWMA 3PUAA 1OOPC 1FY7A 2E34A 2EAAA 5JVGF 5EJZB 3QCWA 5J40A 2PFBA 5FZ1A 3B01A 4DZGA 1LFBA 2JA5J 5DUWA 1GOFA 4RN5A 3ECQA 4F55A 3OYJA 1QGPA 2A73B 1D1BA 4CPBD 4GULA 4YGDA 3K1PA 3QAHA 3WOGA 1K6OA 2Z99A 4Y1VA 1AR71 4YG6A 2R93J 2FMLA 2HZDA 3HKZA 4OIQF 1OCOH 4XUQA 3OOXA 2MA3A 4LBQB 1UU6A 1YTYA 5DUUA 1NCRC 2FRHA 1ZZ7A 1Z7UA 1F9NA 4RHV2 3H5NA 1MNEA 4Y1YA 2XBO1 3DTEA 2VCBA 3C18A 5E88A 2DQRA 2LNBA 5FZ7A 2ZZJA 2Y60A 3POGA 2HTSA 4RLFA 3ZFGB 2WRAA 4B29A 3WR0A 4UB6C 2EXHA 1IC8A 1X2NA 4JGZB 3H36A 2WT1A 5KC6A 4GALA 2CFXA 2WZ8A 3N9MA 4XKBA 3IKWA 3O12A 4YM3A 3TYJA 1MEC3 3WP6A 1OISA 2HWD3 4EROA 3Q3SA 3U37A 2Z4FA 1WZ2A 4JAAA 2FMYA 3ZYHA 1V0AA 4L0PA 1QHGA 2BV6A 1NZIA 3H3VK 3ONQA 1X19A 4P02B 4RB0A 4AUXA 4AI1A 4XKCA 2ZB9A 4KBZA 1C8M3 2VGDA 4LHLA 1X2MA 2RV9A 2E2HJ 1I1GA 4AIHA 2QBYB 3LPFA 3CNAA 4NHLA 3IB3A 1H0BA 4AG4A 4QPGA 3TO9A 1OBNA 1B8IA 1ZRCA 2IFWA 2XJTA 4EM1A 4F3JA 2FD5A 1WJEA 2DFBA 2YPRA 4BLIA 2WSUA 1XNAA 3OBZA 1R64A 4DRVA 2O03A 3T1MA 1TTYA 3OYEA 4GH4A 1SLAA 2JJ7A 4XUOA 4Q8LA 3P3PA 4OINF 3FXLA 2HYGD 4AW7A 1JOBA 1ZARA 4BHCA 1MDMB 1QVTA 1PHMA 2G7UA 3AG1H 3WNPA 1W5SA 1GWLA 1E2XA 2XG3A 2AXLA 5DCMA 3ZN5A 2RREA 2E2JJ 3VL9A 4XICA 4PDWB 3WU1B 4U0YA 3CCSI 1HXDA 4XYXA 2ID4A 5FY8A 3ON7A 3VDDC 4R4ZA 4P55A 3VBUC 5J36A 4LK7A 1RC9A 1CF7A 1BLZA 5KHHA 3MIEA 2KL4A 1D4VB 4QIWN 3KCCA 2OD5A 2VKHA 2QQKA 4IV3B 3FXJA 3GVAA 4A3ZA 5FLXZ 1MZ5A 3FK6A 2QKMB 2DCJA 3CDHA 1A6IA 1O8SA 4QGLA 1RUJ2 5IT3A 2EALA 5LA9A 2DO7A 4RR3C 1W6NA 2XJUA 2ZA9A 4DRRA 4F7ZA 2G9FA 4YZ5A 2HVRA 1VBA3 2L9VA 5K7FA 3AP9A 2L54A 3WX5A 3HRTA 4MHRA 4YW7A 2E1CA 2L4MA 4HLYA 4XIKA 2AREA 2O6GE 3ZN0A 4NAOA 4TLGA 1U2WA 4BISA 5JLXA 2EILH 3HL2A 2IXJA 2NYXA 1XGSA 1BCXA 3PDQA 3VD9A 5HLIA 3WCSA 1V5EA 3IKVA 3HIFA 2VXZA 3FMSA 1SDWA 2M45A 4RMNA 3ZCOA 4KWUA 5A70A 2ZHMA 2RS51 4XMYA 5FLXK 5D8AC 1D8KA 5C7GA 4II3A 5FFZA 2ZAHA 1JZ4A 3RWKX 3UNPA 4V1PA 1N3QA 3DCQA 1O4ZA 2XPUA 4ITVA 2WS92 3HHGA 5JVTA 1XSVA 4M01A 4E4HA 1W0PA 4HDVA 1Y43B 1EH6A 1RUG2 2JWTA 2K46A 5L3EA 4K20A 5JR2A 4PDKA 4YEJA 5IT9Z 3CDZB 1USTA 2Y8KA 2XGDA 3BQZA 1QDOA 2RKHA 1AX1A 4RR3B 4DFSA 1LEAA 4NJ4A 1RUC2 1SLBA 5F3IA 1D4M1 3L2QA 4HANA 4UFMA 1NG0A 1MD0A 3RKQA 5C9AA 5EP9A 1TE1B 1WD3A 5FREA 2BNMA 5H9PA 3LSGA 4CDUB 2CTVA 3SFZA 1COV3 3WSOA 3F22A 5CVIA 4BHBA 3BJAA 5F0HA 5BNPA 3NNGA 3JB8A 3LZZA 4ES8A 2WT2A 4GMP3 1QJX3 3WDUA 1IZ3A 2R7ZJ 3BN6A 4A3GJ 4UOJA 3AP7A 1PVC3 4UVAA 2VKVA 5C44J 1R36A 4I3GA 1BVP1 2WNUA 2VW1A 4JKLA 3REOA 4ESJA 5C8CC 1O6UA 4IHYA 4PDWC 1NCRB 4CO8A 5DXDA 1I3AA 4ZZLA 1BI3A 4FQ4A 4KDPA 5IWFA 3J7NA 4OHXA 4NIIA 1H8VA 2EPFA 3JRGA 2VE1A 5JHUA 4QPIB 4XCBA 2CUZA 3Q8EA 4GFBA 1NK3P 3MDPA 3K2AA 2JA7J 3RFRA 3ZDVA 3CJTB 4WM7B 4R9CA 5F3EA 4DNCA 1CVNA 4EZHA 4TN7A 3C7JA 2QQ9A 4HLXA 3P7NA 3U21A 2RM23 4GGGA 2EIBA 4BEHB 1ZVFA 4CP0A 4OWRB 2OUMA 4XOGA 2IXLA 1OC1A 3PIPF 3KGZA 2R92J 2XVCA 2ZKNA 5C3SA 4NOTA 1JTYA 1YQCA 1ASJ3 4LO4B 5BNOA 2XGXA 1POV1 1E3HA 5LATA 1J7KA 2D97A 2GBYA 1WA4A 3POJA 2TCTA 2GC2A 1NLSA 3KD4A 3RQ0A 4BEHA 1GOGA 3TB0A 2VT2A 3ZQGA 1MDMA 3G3ZA 2RNGA 1XDUA 3RDIA 4LBOA 4QPGC 5FPZA 2ZBJA 5C71A 4QHOA 4LLGF 1O4XA 2DK8A 2K3FA 5A6QA 3UKVA 1QPIA 3K77A 5C4WA 2EH3A 3GZ5A 3ZOBA 1QHDA 4U36A 4BE3A 4D7MA 5JXGA 2M3AA 5HLTA 2E35A 2XF5A 1DGWY 1TQIA 4Q1RA 4RGUA 3T5XA 3KGLA 2WN3A 1ZG3A 1IN5A 2F17A 4MGSA 1E5SA 4XQWA 3SCFA 2GC1A 3I56I 3FFZA 1XS9A 4IOAF 1JZ2A 5H6RA 1DQ1A 3M8LA 3MFAA 4EN6B 1DLCA 1SBEA 1CAVA 3QPSA 2JG9A 5GLWA 3MCZA 5A7OA 4BQQA 1BHGA 4MXVA 5ABJB 4IHWA 4NHJA 3POSA 3ZXJA 4KWLA 2ICWG 5KVRA 1TMF1 4IEYA 3NSTA 4MGKE 3EB7A 4KL1A 4JV4A 3GEZA 3MIBA 4LR4A 3DYMA 3HPHA 2ZGKA 3KHBA 5FKCA 2R16A 2HEWF 4MGIE 1V5GA 5IVCA 2LDUA 1JOPA 2VBZA 1T56A 2CGOA 1MS0A 1TWGJ 1OQDA 2JA2A 1WCDJ 3LGRA 3V7RA 1NYWA 1OD3A 1EV11 3IAS2 4AI9A 1YIOA 1XOYA 5JLVA 2JVHA 2COMA 2A6YA 1UOGA 1ZR2A 2OCEA 3V7SA 4Y24A 1VAMA 3GF6A 4PIZA 4QU1A 4OOIA 4ZDPA 3IH3A 4CE8A 3ZMOA 2ZPXA 3PVBB 5J6XA 2NYYA 2KIQA 1YCIA 2CNAA 2OU2A 2EAKA 2Q1FA 1WCKA 3S2WA 4PJLA 2HWE1 1CX4A 5IYDJ 1YQ6A 3DKWA 2DVGA 3CDIA 1OQYA 5E3MA 3DV8A 5IT6A 3H92A 1PO22 3OCPA 1QOTA 1NOVA 4UXNA 1H2NA 4EJVA 3VBFA 2M30A 2DODA 3U9GA 5F8PA 2HU9A 2BOJA 2RVCA 3BR5A 1MSFC 3ISPA 2JDZA 2Y31A 3DKQA 2VT3A 2C26A 3PIJA 4CP9A 3ML6A 3QLQA 3BCBA 4J00A 3POWA 1XC5A 1VBD3 2DMQA 4K3UA 2GMMA 5HXVA 5D1IA 5LASA 4S2FA 3N05A 2X1EA 5H9RA 3B9IA 1YJWI 3ZN6B 5CQGA 5A1FA 4NB5A 4I3PA 3VD4A 2DDUA 1OR7A 1JODA 1S0CA 3E97A 1TWFJ 3VL8A 3DBLB 2ENRA 2JG8A 2B0LA 2H1KA 5KNLA 3L7WA 4QM9A 1AR73 3ZYIB 3LWCA 1I39A 2VQHA 4M0NA 1BVVA 4YFZA 3KT1A 3QU3A 1VBE2 3M3EA 1IF1A 1PO11 3RQIA 1PNFA 2PX9A 1OQEA 4K21A 4N9IA 3KV9A 2RHPA 2UURA 1IS3A 4E7HA 3DU6A 1GV9A 2FQPA 4NMIA 1PP8F 2QQNA 5IPAA 1G8WA 1PYVA 2QDNA 5BNOB 2WBMA 4QSHA 2PQQA 4OAZA 3NV1A 5FY4A 1YFYA 4IRHA 2RMU1 4PDWA 4MXWB 5F64A 1LDKB 3RZHA 3VB2A 2ESHA 3B6CA 1KQ0A 4Q4X3 3VSLA 5A6YA 4O9EA 5FRNA 3I4IA 4M72A 4JTOA 3THDA 4A42A 1HB1A 4A6EA 5FK7A 1WBLA 2NNNA 4LBKA 2QVOA 2V1NA 5EEGA 4XC9A 3ZXEA 4PGGA 4A3FJ 4NQWB 4BXXJ 5F08A 5LY1A 2SLIA 2CU5A 3W2AA 3KPHA 5DDJ2 1B8IB 5EF6A 2VPRA 2EZHA 5EQUA 5EGOB 4BE0A 2FQ3A 3DWLE 1DYPA 1YX5A 3THPA 1WMXA 2CW8A 2GNBA 1OCZH 1MZEA 2YY1A 1XMAA 2HWE3 2DAOA 3I5UA 2VMFA 3AZXA 3AKZA 1R49A 3RRDA 4CDQC 3A23A 4I30A 1N1SA 2BWAA 4LOTA 4OMDA 1F35A 4BWOA 4ZU7A 3A0HC 1BW5A 2CYFA 2QQMA 1D0ZA 3V0AB 1FMD2 4G9SB 3BTLA 3HQRA 1NA1B 1VQPI 5F5CA 3WUCA 4UBGA 3R0AA 2LH9A 3H8XA 3F8FA 4G7OF 1I5PA 4XRSG 2KM2A 2F5DA 4IKFA 1OPCA 3K2OA 4ABZA 3PJQA 3VD7A 4Q1PA 4B44A 3TAYA 2OVUA 2VW0A 4D5FA 1YW8A 2QQOA 4A7YA 3BG9A 2VZ1A 4QB2A 4KQ7A 1XNCA 3HSRA 2BFUS 3WW4A 2Q2EB 3WNKA 2L9RA 1ENXA 3CQZJ 3OOUA 3CMAI 2DA6A 1SMVA 1TWCJ 1JMUB 2PMZA 3IBMA 3V8KA 1S0EA 4IEWA 5EJ3A 2P0WA 3FIWA 3ZKUA 4CCMA 4FP2A 2HGCA 3IDAA 1PZ7A 3SCGA 5KHDA 4BGDA 1FEXA 3ABZA 3FISA 1EPZA 5J98B 3WT3A 4ZXEA 3CC2I 1FMD1 3DPLC 3OYIA 3MW3A 1SEUA 2WSVA 3KZYA 1XRUA 4IW3A 5F1RA 2HKXA 2NOJB 4CA9A 3A4UA 3MD2A 2JDYA 3L2YA 2WS91 2X6YA 1GVJA 4E2GA 5DD4A 2AO9A 2EXKA 1KXGA 5IP7J 1OF3A 1R22A 4CUCA 1O5UA 2HH9A 2BGCA 4LBMA 3BG7A 4CPBA 3KP5A 1AJKA 1CQTA 4LHNA 3VODA 2VNGA 2BRTA 3O1MA 1OCCH 4KU8A 5HDNA 5FO9B 4JQFA 3CZJA 1REDA 5JOXA 5IUQA 3QRFF 2VB6A 3QPHA 1MR5A 3B94A 4IEUA 4I02A 1OH3A 3PVEA 2W1OA 2PHFA 4XZPA 3WF1A 2XAGA 1WJFA 3OGSA 1WPKA 4IEJA 4YLZA 2ZXQA 4O6JA 1H2LA 4HBLA 3EYPA 1MBFA 1CF7B 2DF7A 2MHFA 1RHI3 2OXBA 2QEXI 1IV6A 1Y3TA 3WVJA 4XOTA 1W9SA 5CNAA 2XAUA 2P3YA 1SMTA 4NQWA 1JGSA 5CVVA 4C0BA 2MD0A 4KNYA 2BY2A 1LNSA 4MQVA 3ZMSA 3PNAA 4OULA 5JZGC 2D5FA 4JVAA 4CH7A 3AZVA 4RB2C 2C5DA 3JXSA 2IS6A 4E7LA 3LPGA 4OYUA 1T33A 2EINH 3QODA 3FN9A 3F3XA 1B35A 4AI2A 2A05A 4PFOA 2QFEA 3EETA 4I01A 2D6LX 1YITI 5C70A 1UWWA 2QSFX 1YG2A 5HNHA 1WCQA 3HJRA 1VBC2 2HEVF 5DAVA 2XB0X 5DM6F 1O3RA 4XMAA 4COUA 1F5JA 3VD3A 1CAUA 3LQQA 4K9SA 3SNMA 4PGHA 1W4MA 2DFIA 1BYHA 3K6GA 4DGWB 4Q4ZF 1ULCA 5IVEA 2WR9A 2ZXIA 1GYKA 4CEYB 1PGW1 3OL3A 3E5UA 4L9JA 1BEV1 3R4UA 5FZDA 3B6AA 4HKOA 5A3LA 4Q4Y2 2RN7A 3AVSA 2UWBA 2HWC2 2KZVA 2QQVA 1QVUA 2I8DA 3BPVA 2B9SA 3UKTA 2FBHA 3T1BA 1ZN2A 3HOTA 1QU3A 3VHNA 3IIIA 2Q4SA 4A6OA 5JSPA 1JXSA 4HV5A 3JRAA 5A3MA 2W39A 4MSVA 5A3TA 4Q0VA 2JUGA 1HW1A 1MNMC 4COWA 3U4XA 2RDPA 3ZXKA 3C2UA 2Q8OA 3ETQA 1U5TB 1PZ9A 3EYIA 1P8JA 5DUIA 4ZS3A 2VR4A 4MGTA 1YFWA 1XSQA 1B1BA 3A1YA 3E0JB 2JECA 2W9XA 4HDUA 4BBSJ 4IV1A 1J0RA 4DJAA 4W6XA 1FYLA 1IGOA 1R23A 3PHMA 3F6OA 1LULA 3OYWA 4CEWA 1LOBA 4UHTA 4CXYA 2HBUA 2Q2EA 3V8JA 3BR6A 3LMMA 1LQ1A 1Z7LA 4QTRA 2K2SA 2WFF2 1AZDA 3TEXA 2VONA 2W24A 4R79A 4R52A 3FMRA 3AKRA 5GALA 1O59A 5GLUA 4IGOA 3ACFA 2JE8A 4N8MA 1HA8A 3GLXA 3NAPA 5D21A 3JSPA 1WW6A 4BLJA 1WJAA 4M6VA 4W97A 1QXRA 2O8OA 4I2OA 3AKPA 3BIEA 2J22A 2RV8A 2V26A 2EIJH 3M1EA 1A8MA 1R081 3H3UA 3WTVC 3HD8B 2BYVE 3WHTA 3VLBB 1D0HA 2ZNZA 1N1VA 1BXHA 3JRHA 3Q9SA 3VBFC 1ZGJA 2W91A 3T0YA 5GLVA 3C3WA 1OKRA 5F37A 2XHNA 2ZABA 1XD7A 2OF7A 4Y20B 3ZQ7A 1DGLA 1X33A 1UQXA 3K7AJ 5HS8A 3BG5A 6PAXA 3BZKA 1G3TA 1LPQA 3BG3A 4HEA2 4I0BA 3RKWA 1Q8SA 3WY6A 4HN1A 1UO9A 1E5RA 2YUEA 2YC2A 1GP4A 3VYTB 4HX7A 2NVQJ 2VJIA 5D5XB 4C3HJ 1QJY3 4ARYA 2WNVB 2RM21 4D3WA 1L0OC 3VSKA 4OHWA 1QEXA 3A01B 1JYXA 5IVVA 1BBYA 4XL9A 2IRFG 3ABMH 4LK6A 3BTYA 5T55A 3CJRB 3SHFA 1F4HA 2C4XA 1N25A 4QWQA 4MXWA 2R061 1TME1 4PSXA 5FYYA 1G3WA 3OYHA 2HWC3 4TSVA 4XKVA 2F5CA 5TGTA 2BNNA 2VXRA 4JTNA 3KEQA 4YVWA 2R063 1DQ5A 4D0QA 4CZSA 2V1XA 1DQ0A 5GP9A 1UHMA 2X9DA 4ESFA 4A45A 4AI3A 2E63A 4XFAA 4B4CA 4G6QA 5ERLA 5FZ3A 3Q9VA 2FCUA 3UT0A 1VBB2 3PNYA 1WH7A 2DCEA 2B63J 3V42A 4FCAA 4X8PA 2HYFA 4DZJA 3TN92 1DFQA 1VBD1 4IXAA 2DVAA 1F5TA 3A0NA 1K5MA 2A6WA 5DABA 2DJIA 1PVC1 3RTRA 2KLOA 4QB1A 2L9SA 4HOBA 1RB8G 3RZLA 4R9DA 3M3IA 3K1NA 4DIQA 1LOGA 1J09A 3I4NJ 5KR7A 2YUSA 2AYHA 1YNAA 2JKXA 1RUE2 2DW4A 1FMVA 3UKGA 1X82A 2JDMA 4XW3A 5ANQA 3ZQHA 3NWTA 1TC3C 1W6OB 4P9IA 5F6KA 1UZZA 3S16J 4OI4A 4A5MA 2W87A 5LFAA 3AK0A 1WW7A 3KYCB 5LHGA 1W8NA 3ZOIA 3NEUA 4LKFA 4HYEA 3L2VA 4FPCA 4KITB 2D6NA 1OLTA 3TEDA 4NE9A 1ZR4A 4MEYF 1GKBA 2R7XA 3IUOA 3LB9A 4HSRA 2XGCA 1VZ0A 4PI2A 3AFHA 3FLRA 3VDDA 5FZGA 3BOPA 3CQOA 1GP5A 3DPUA 1NE4A 4EMSA 5EXOA 2RS53 4H4KC 1HDDC 3N9PA 4QGNA 4LO5B 1Y8RB 2DYSH 4AVZA 2ARCA 5IVBA 2HWC1 3PIGA 1M4WA 4TV7A 3TP0A 2O9LA 4I99C 5LZ6A 4QU2A 2ZEYA 1P2FA 3NV4A 3W5MA 4MADA 2Y6GA 1E17A 3VBHC 5A33A 1FYUA 2QVSB 5FKBA 4QDRA 1LJ9A 1MS4A 3S5QA 5BPXA 4YRDA 3GMEA 2CV0A 1N77A 2L02A 3CCRI 3CIHA 5LLQA 1UPSA 3ZSEA 2LBFA 3GTMJ 2RJKA 5CFCB 4HPQA 2K9ZA 5FLMJ 2PTMA 3LA2A 2VQCA 5A1LA 1TWAJ 4ZU5A 3KVAA 1W3XA 1IRFA 2CW0F 2BNOA 2ETHA 2BHYA 1QF3A 4XN3A 4UW5A 2ORXA 2L9NA 2VZRA 3DPRA 2PAKA 1VBB3 4CZZA 2D6PA 4CDUA 1BK1A 1V6LA 4GMP1 3EUKL 4YYOA 3S8PA 2H8RA 4MHUA 2XL9A 5B1AH 2JB8A 2ES3A 3HRUA 1GXPA 4FP3A 4RB1A 5EIYB 3BU7A 2ZKLA 3THTA 2BW3A 3J7AY 1HXS3 3HXLA 4NR1A 4JDOA 4JX6A 4ZONA 1I1EA 5JOWA 3MF9A 4XURA 2BZTA 3UKNA 4AR2A 2I10A 2LRDA 3K4CA 1NCQA 2WO7A 3IPVB 1CPMA 1FSEA 2RS31 3WP5A 2NZ9A 4G4FA 2DPDA 1LOCA 5I0RA 4ETSA 2PXJA 4OQ8A 3MUY1 2ZGOA 4BQ3A 1W8UA 1CESA 4N43A 2ZCWA 2KISA 1V70A 1UMQA 1BIBA 2VQ0A 1YW7A 2LVSA 2QUOA 3GZEA 4YW6A 4C2TA 2Y0SA 5BY5A 3IMNA 3U1KA 3VZLA 2WYFA 2Y33A 4FQZA 4H0EA 3BJOA 2P5VA 3ZQIA 4A3JJ 1HDKA 3M8EA 1F5FA 2D40A 5JXIA 5F0FA 5T54A 5J1YA 1ZAOA 3PM1A 4ZZDA 1PP7U 1OQ1A 5FGMA 3HOBA 4QPOA 3KS7A 1JHFA 3BB6A 3OBAA 1BW6A 5DZEA 4R4XA 4UF0A 1X9PA 2QQJA 4URAA 1BI2A 3QP5A 1XU1A 1V6MA 5KXCA 1SVOA 1X4OA 3M8JA 2L01A 5EDNA 4U87A 3CUQB 3U78A 1BJAA 2JSPA 1AYN3 2XVLA 1E0EA 3H8RA 1SFYA 4A0ZA 3E5XA 5FYCA 3TWIA 3SITA 4ZPIA 2A6HF 2MFZA 1K5MC 2LRPA 4YGBA 3ZIWA 3QD6A 2ZTNA 5C9AB 2RC4A 2D45A 4IE4A 3VDDB 2HEYF 4OUEA 3N7KA 3OY8B 2K9QA 2L4AA 3FBMA 2E6VA 1R1A1 2DV9A 2R0QC 3ABKH 3EYYA 1H2KA 3DF8A 3KLSA 4ZS2A 4HPKB 1JI8A 5DUXA 1S4CA 1FNZA 5C5TA 2LY2A 3WG9A 5FYIA 1UJ8A 1KDMA 4E8DA 5SV5A 1H9GA 4A4AA 1AL0G 4WVMA 1K6YA 3VB9A 4XNFA 2L2OA 5ABJA 1I9RA 4CDWC 2MSYA 3DPRB 1DP7P 5IK4A 3ENRA 3WCRA 4AZZA 4IEVA 1PO23 3DXJF 1MIJA 2WQ4A 1W6QA 4YW3A 1ND2A 4DY3A 1YFXA 3D1NI 5HLGA 4K8FA 2Z2SB 1W2AX 4ASLA 2WADA 1RNLA 2VXJA 5K4LA 2HWE2 2E5ZA 1AXYA 1UMZA 1UB9A 3RPUA 2JENA 5FZ9A 2K9MA 5JMOA 5EG0A 1TW2A 3CCLI 1UKGA 1OLMA 4AC0A 3VZNA 5ACA2 3SKVA 4MLOA 2QCOA 2ZEXA 4KFCA 4XE9A 1RINA 3I7DA 2DA3A 1RJ7A 1Q8QA 3E6CC 2PELA 2NLRA 2QUFA 1D5VA 2ZJQF 2CYYA 4JRLA 4Q4X2 5CKTA 1F2NA 1CAUB 4QPWA 2YDEA 4YM2A 5C3EJ 4IHVA 3O8GA 1WHUA 1W7PD 4Q8KA 1ND3A 3D0JA 2DCTA 3LOIA 1HV1A 1Q3EA 3M1HA 2ZC2A 1XMKA 3ZDSA 3N7JA 5KXEA 2DVDA 1VQMI 1F4AA 2UY8A 5F3CA 1RR8C 1P9QC 3WNMA 2XLAA 2XH6A 1GLNA 3EUHA 1HOMA 1XNDA 5GZDA 2VL4A 4HT1T 3AP4A 1EPWA 2IGOA 1YO5C 4LTAA 3R0RA 3NAUA 3MWMA 3QYBA 2KIFA 1VLNA 2ZGRA 4TLFA 3WG2A 5HV4A 4RLQA 2GN7A 3JCUC 2IA0A 4IHXA 2QQLA 2MH9A 1F9KA 2BY1A 4LD5A 2AR6A 5H2FC 3PLQA 1CX1A 1GV2A 2WAFA 1R091 4V19K 3S7IA 3TN91 2QTWB 3TW6A 2STTA 4MHGA 5A1AA 4FE4A 1T0FA 3VKNA 3PUIA 3RPQA 1WCSA 4QQ2A 5FFOC 3K4BA 2E36A 1R093 2A71A 4RD7A 3OSGA 3CJIC 1Q1HA 3IRQA 1QXPA 3K3OA 4GWJA 4IQPA 3FKIJ 4PIYA 4Y15A 1KJLA 1QU0A 4OIOF 3Q0UA 3MLLA 2JJ6A 3AJYA 4M0HA 3LSMA 4BAYA 2H8WA 3RKXA 1BL0A 3FXRA 5K1YA 1HQNA 3H3LA 1IN7A 1IDZA 1UYPA 1ONAA 1ZBE2 4KG8A 3OEAA 1YC61 4DQAA 4IQ4A 2X6XA 2OW4A 1VP6A 3AMMA 4AYBN 4BMEA 1WJCA 4ASNA 3CO7C 4P1WA 1C4RA 3FHQA 4WF2A 2A3YA 2DI3A 2JPCA 2JTVA 2V79A 3AMPA 3I4PA 5B1BH 3VKFC 2YU2A 2R6QA 2WNUC 3P5JA 3NWSA 2HWB2 2WAQN 1ETQA 1DPUA 1JUMA 5FY5A 1PZ8A 2K9LA 5BNQA 2CQQA 3OGGA 3DEMA 2MYSA 2R041 2RMU2 1UG0A 2DDBA 1LDJA 1IN8A 3SEZA 2YU1A 1W9YA 5E16A 2XJPA 1G59A 3X29B 3GHNA 4XORA 2R49A 1D3YA 2E1MC 3MKWB 2DFEA 2BW8A 5GLZA 1JUPA 2VTFA 2AHQA 2RQPA 2LTNA 3F8MA 2E7TA 1P7IA 3TKYA 1NXD1 1VBE1 1S0IA 2RS32 3I49A 1QDCA 1NE6A 4Q0PA 3L09A 3CF5F 1LOEA 4HW0A 2V1DA 4RFT0 1CIWA 3LSIA 4ISQA 2EZLA 1EV7A 2XAQA 4UWDA 4BJ6C 1LKNA 2FOWA 1NHAA 3ZQQA 1HJGA 2J1UA 2QM3A 2OCCH 4LK0F 1HB4A 3UJQA 2ZS6B 5E3NA 4PZJA 3GUDA 2DA7A 3D82A 5BYNA 4IV3A 3ZKYA 2MH2A 1ZH5A 3MGUA 1LOFC 2Y0OA 4RA0A 2W85A 1V6KA 4GXLA 3HKZN 1HLVA 4B7KA 1U0AA 1DLLA 4EWEA 2GIZA 4BHPA 4U7BA 3H8OA 3GF2A 2UUZA 4FFIA 2R0FA 1H9WA 3GBFA 4JHTA 1R1VA 1SFKA 2XQXA 1TBXA 3HRMA 5JMCA 4CU8A 4OU0A 3TL4X 4O9GA 4A3LJ 2Y30A 3VYSB 1FAYA 2VMDA 2OKXA 4G8XA 5FZCA 5F32A 2CGNA 2QZ2A 1B59A 2OJED 5TJJA 3FZ3A 4ORFA 4SLIA 3BCWA 2YC0A 2WYSA 4M3FA 3OYCA 5LBBA 4XAEA 5FWJA 4H3WA 3ZR6A 2DA4A 4CCNA 1YQ2A 1RHI1 4N90A 1N75A 2ZX3A 1BN5A 1LENA 1DYKA 1SHWB 4IE5A 4ZXKA 1PVXA 5IAVA 5TRDA 5LB6A 1W6MA 4V2FA 2BQPA 1LJ7A 3M3YJ 3I3QA 1VAKA 5JSOA 4LG0A 1MS5A 1UY3A 4PLOA 4UW3A 1MJ9A 3I2JA 2VKEA 3U2RA 3BR1A 3FDYA 3ASNH 5J3UA 5J3LA 3LF7A 1A78A 1CAWB 3NJXA 3P3NA 1AUYA 1SD6A 2FQ4A 1KU9A 3GGLA 1D2SA 3PMSA 2W57A 3MMYB 3AKTA 3WE3A 1U6GA 1Y9MA 4FPOB 1LHNA 1DUXC 4FOVA 5CFCC 2OTJI 4GJYA 3ZMNA 2W1QA 5D5WB 4KGQA 4TTGA 4FPHA 1EAH1 3N4MA 3C3VA 1W1WE 3OMYA 1PUFB 1DU6A 2XONA 2KDZA 4Y52J 1RUE1 3DYPA 2AGSA 4OIPF 4IEXA 3LDKA 2V1UA 3AL0B 1WJ5A 2DT6A 4BQYA 2ZBKA 5J1UA 3VHRA 1RUG1 1RUE3 5C5UA 1EP0A 1O7LA 4WM8A 5LCWL 5A3PA 3GZUC 2HLEA 1TQMA 1RC6A 3FHIB 2JDHA 1YJNI 3A21A 2OS2A 1J1LA 2HXIA 2ZJPF 4JGYB 3LQRA 2BP6A 4JGZC 4EN7B 1T0FC 1BA5A 1ND2B 5LK7B 1MMNA 4NWVA 3JRCA 1XCVA 3ECOA 1V6IA 3QPTA 4XUNA 3K48A 3UL2A 3FLTA 4WVMB 1HW2A 1KGYA 2FDFA 4XIDA 3L2UA 3J7HA 4YSFA 1WGPA 1JJ6C 2BEOA 2VMEA 1BZWA 1L7LA 4LB5A 3H9AA 4IV1C 4WXHA 4Z07A 1ZTRA 2FDJA 4XOPA 4B1RA 2F2EA 5HCBA 4YRVA 1WVRA 1OYIA 3BDDA 4BXFA 1KJRA 3DECA 2FNPA 4AHWA 5AC93 2XVGA 1UKRA 5DEQA 1T2XA 1AKHA 2Y6LA 1QMJA 4HF1A 2LY9A 1PNGA 2UXNA 2D1HA 2QWWA 3PO3J 5CFDB 3FL7A 2X85A 2PJRB 1N78A 4XJUA 2KPMA 1T2KA 1AU7A 2JE7A 2L3DA 3KV5A 4UW6A 1QNWA 2WT0A 4PQQA 1SCRA 3V65A 4XPVA 3H0OA 3DYOA 2WFPA 3O1UA 5E8IA 4N7UA 1YLFA 4JOMA 3I3EA 3SYTA 4PSWA 2IP2A 3GYHX 3CL1A 5T5JA 4KH9A 3VBFB 3G6JB 4AAPA 1UZ0A 1BM9A 5CJ9A 4HF2A 5IVYA 3ZPLA 5F2WA 5FXZA 4PCQA 2QNKA 3I2IA 2ZGQA 4L2NA 4HNUA 4LNVA 4KN4X 2GOMA 5FBJA 5J8CA 2OZUA 3FXKA 2PN5A 3D8CA 3I3LA 1ENQA 3POEA 3KT4A 1IGNA 4Q4Y1 2WC2A 4CZCA 5EZHA 3J9SA 3E6DA 2NOGA 1UY1A 3PURA 1YOVB 1LAJA 3ECHA 1J9IA 3U1DA 3RZZA 4M3CB 1POV0 3CO6C 2G9ZA 1WKMA 4HKWA 5G04L 2WL1A 3WTUC 4CDXB 5EJ1B 5FUNA 4WVVA 3HTSB 1KITA 3QH7A 2TRTA 1PX4A 4IV3C 3SFIA 5AONA 2WWUA 2O0YA 4OI2A 3GCXA 4B1MA 1OHFA 2FDHA 1CAXA 3K4ZA 4E2SA 5FZOA 1LCLA 3IN9A 3CUQA 3WNNA 1XNBA 2R7EB 4GRIA 2CW7A 4K7JA 2DVFA 1IN4A 1AXKA 4AGVA 4D6RA 3ZYJB 2RS52 3A02A 4MO7A 3AG4H 1NKGA 1KGSA 4WV8A 3O2PE 5APAA 1GZCA 1TT5B 1LR5A 3O7OA 3HGGA 2Z79A 3HYIA 1Z67A 1IRGA 3RS6A 3HVDA 1PVC2 2QDRA 3WTTC 4P9YA 3T2TA 5M5XJ 1SEFA 5E17F 3G71I 3RJ2X 2XRLA 1IPSA 1PGL2 3DFGA 1WWYA 3VBOA 4CVUA 1W7PB 4P9XA 1R4MB 1S2BA 1IXRC 4HG6B 1YS7A 1CWPA 2W25A 2P34A 3SHRA 4IZZA 4IL7A 3MHZA 2B39A 4AQ6A 5E18F 4XLPF 2J1SA 1FC3A 2X51A 2XF6A 4L8QA 3S5AA 1DQ4A 3MLKA 2BXYA 2RR12 3KZZA 2JQ7A 3FXQA 2DCKA 1UY0A 3M8FA 4KJZA 1PO12 2HWB1 3N3HA 3WQBA 2DTRA 2NM1A 2H0VA 3TRSB 2XC7A 3CCMI 2ZFWA 3MKZA 4LG3A 1W36D 3AVRA 2EXIA 2NVXJ 1EYBA 5J96B 4W1UA 2FUG2 4MOAA 3D6EA 5L3GA 5KCMA 1ETXA 4IEOA 1DQUA 4P9WA 1BR4A 5JSRA 3I54A 4F3QA 4RAFA 2WLQA 3EPZA 5FRAA 3RIRA 4KICA 4BS9A 2GWRA 1IN6A 2ZX1A 4DYCA 1MH4A 4DNYA 5A7SA 3K46A 2ZX4A 2C9KA 5A3WA 1SD7A 1X8EA 3AM2A 5TISC 2UWCA 2KZGA 1LECA 2IZWA 3HN3A 2F5FA 4ZKTB 2WNOA 3ASOH 1FOYA 1WCUA 2EFOA 3KP3A 3Q0VA 1UF2C 2WAAA 3V4GA 1UD1A 4OQ9A 2NNYA 3DQVC 4AWXB 1CAVB 5ED4A 4Y5SA 3IHUA 3GZ6A 4N7IA 3I64A 2F48A 4GDFA 5FTTC 4HSJA 1H9TA 2ELKA 5BQTA 3VWBA 2TBVA 4NHKA 4RFRB 3Q5FA 4XJZA 1K78A 1QOOA 4HX4A 5CIRA 3GNEA 1OD5A 4G3YC 2EFQA 5AIQA 2XJRA 3GW2A 3FXUA 1ZZ6A 3VOEA 4CEWC 3ZPYA 4F91B 2GQQA 3CC7I 1GZWA 4HVQA 1L3LA 2CQKA 1J84A 4MG2A 1GP6A 4XRSA 3R0JA 4IL6C 3JREA 1ODMA 2HYXA 3KV6A 1MBJA 3M2MA 3NAPB 1AX2A 4A5NA 1R1ZA 1JYIA 3OJBA 1FZPB 5DDJ3 5AVAA 2W52A 2K9NA 4FFHA 4COVA 1E3PA 5K8SA 3AG2H 3POFA 1ZNPA 4LEJA 4AFDA 4E7ZA 1VRBA 3B00A 1U5XA 4DOUA 2OV7A 3W6VA 2ME6A 3RPUD 1J3RA 2DUOA 5FZOB 2JK3A 3S1NJ 4ENMA 3DEUA 3C7FA 4RQPA 1VQ6I 1AJOA 3PVNA 4DUVA 2ARAA 2ZXJA 3F8NA 5IYBJ 3HT1A 4I6ZA 1NUKA 1JHHA 5EEHA 4GWIA 3J81Z 5I0SA 5FJ8J 4XETA 2TDXA 2Q5TA 3H0GJ 1ZYRF 3WW1A 4ZC3A 3AKQA 2DMPA 2VE8A 1WMEA 2DK5A 3JD71 2J1EA 1ENRA 1P4WA 3S1MJ 4QKFA 4BDZA 3U4SA 4YPJA 2PBIA 3DP7A 5LWBA 1UL9A 3ACIA 2KXLA 2HOEA 2ZAAA 4OHYA 1FNYA 1U0JA 3G1MA 5FQ0A 1LHWA 1W8WA 5LGNA 1W7PA 1AR72 4CCKA 2NP0A 1J2XA 4UAPA 2D3PA 2FCTA 2QSGX 4HX8A 4BU2A 3K4KA 2HWD2 2GNDA 2IXSA 1R092 4CUAA 2ET7A 3F95A 2WZPP 5FLJA 4BNCA 2IXHA 3KQ4B 1PUFA 2XR4A 2ZGNA 3ZN4A 2WDBA 2NN8A 3M1CA 2CL2A 3EUHC 5FMCA 1Z78A 2W1SA 1ZRDA 4LUMA 3RSJA 1Z1DA 2XKOA 3D0SA 3D5SC 4MQ9F 1LRHA 4YZ4A 3WG3A 2YFZA 3POBA 1YWKA 4J01A 4A3MJ 2V73A 2VNRA 2GALA 5C33A 4XACA 1LU2A 3M3OA 2WN2A 3ZMTA 4QT6A 3TOBA 1IV8A 3G7DA 4QX7A 5KXDA 1AXZA 2FX0A 2VZSA 1MSEC 3OV8A 1JYWA 4ZZ8A 1UU4A 3S57A 2KJCA 3AYCA 4BQ4A 4K8RB 2YBPA 2HEOA 2O1QA 1K79A 4M3CA 3DEWA 4D7TA 4B3XA 5L9BA 4E7IA 3IV5A 1K42A 5DUKA 2ZHKA 3LAPA 3OUIA 3VPRA 5FZ6A 5K5RA 4LK1F 4NNJA 4LLLA 4NC6A 3I8TA 2HPMA 4CDWB 2VNVA 3JAMZ 2YX4A 5J1XA 1UCRA 4ZU4A 4AF9A 3RQ4A 1JZ8A 3HT2A 3G73A 2VZPA 4Y5Z0 1IRXA 3GXUA 2HYKA 5C4WC 2F4LA 1H6YA 4LO7A 3ACHA 2XPVA 4NWWA 3ZYBA 5FZFA 1UAIA 1UOFA 5HI0A 3GYDA 2L7MP 5LBFA 1X1PA 1KQ8A 4FPEA 2I07B 1J75A 1NXMA 1Z3YA 4R8HA 2BVLA 3HOWJ 3MIFA 3HJEA 5F27A 2A07F 5FPAA 5FXVA 4TWTA 4XLCA 2MC3A 3FHNA 3ZFGA 2D98A 3F21A 2A75A 1H1IA 1LGNA 2EF6A 3BZCA 3JBG2 4N43B 2PMZN 2A3SA 5E79C 1W05A 4EE2A 2YBKA 4XK4A 1V00A 2CS3A 2PQ8A 4L5JA 3GTGJ 1FX7A 4XFGA 2Q8EA 3GX4X 2YZ4A 1O5LA 4ASKA 1HXS2 1I6HJ 3PFIA 3KCYA 2YHJA 3LA3A 1KONA 1Q8VA 1UW8A 1B9MA 3S1QJ 3IPVA 5EGOA 2P7CB 1Q8OA 4FFFA 2VQUA 2QCSB 2EFNA 2OUJA 2VJJA 4CUGA 5A7QA 2XUBA 5E8AA 4A3XA 2GMPA 1YQAA 4FXGB 1NAEA 5AC92 4FOWA 2COBA 4QPYA 3ZFFC 2VBPA 2XF7A 1LHUA 3S32A 2GN3A 2K5CA 1OKQA 5CBLA 1ASJ2 1SANA 2HS5A 3VV1A 4QX1A 2VQAA 1J83A 3H3ZA 3K4NA 4P00B 4GJZA 2OA2A 1J5YA 4X6AJ 3H7YA 3DXTA 1W8FA 3NL1A 2IUWA 3NAPC 4RYDA 2WQ8A 3FK7A 2R5YA 3S7EA 3R60A 3HEFA 1KYWA 4XQFA 1ETKA 1SC7A 1DCSA 1VRH2 1MBKA 1WCMJ 3V8LA 4BDYA 4QB6A 5M5YJ 1ZGWA 3FMQA 4EQVA 2WV1A 2ZGSA 4XR6A 1BQPA 4JKKA 1K5JA 2PI0A 2CY6A 4HVRA 2HFHA 3D3AA 1BBT2 1G9DA 4LULA 1HKQA 2ZMNA 2DXIA 1S2EA 3ZN6A 4P14A 4L5EA 5LD2C 4LPLA 5GJ6A 1QRYA 2DPUA 3Q8BA 5F04A 1HKDA 2YBSA 4IERA 3W9AA 3S1RJ 3MQ0A 2W00A 2ATFA 3RG0A 5ILSA 2PHTA 2PJRA 3BALA 3SC7X 3WW2A 5EFUA 1FBSA 5A2QK 3WTXC 3FZVA 1IKQA 4DMIA 1UX7A 1ULGA 4LGWA 1FYKA 4XJ9A 5CYVA 1UHWA 5LBCA 1RUD2 3VN4A 4NC8A 3CC4I 3NO8A 5A6XA 2C9AA 4CEWB 4I98B 5JOYA 4AAXA 4Z2AA 2ZSIB 2ADDA 1A34A 1R5HA 2LM3A 4CCLA 1RUD1 3OIPA 4CEYC 4KYWA 1AR61 3DPRC 3GXOA 4IETA 1DGRA 3HM5A 5FMOL 4E7KA 2Y69H 3UETA 5K5OA 1S72I 4EJOA 4BQ5A 4MFEA 2NMNA 2GA2A 4XBNA 1VQ8I 2NS0A 4HNVA 3CCEI 3T8TA 4OCTA 2YMZA 3I2GA 2ZGMA 2LW8A 3ME2A 1TME3 1JHNA 2X5IC 1BI0A 5CVUA 3JU9A 1LTEA 3AZZA 1IG7A 1J58A 4M4RA 4KT6A 2ME0A 3M3CA 1IHMA 1UZWA 4PJNA 4YIRX 2ZXHA 4XXPA 3S2DJ 3M3QA 3ZRGA 2W84A 3V7CA 2VUJA 2G4IA 1OJLA 2HNHA 1T98A 1D0GA 2CWEA 3O8HA 5EG0B 1QIQA 5D8LB 2P37A 4IHTA 1RVF1 3NMBA 5JVVA 4E27A 2WZEA 2GLOA 2IXKA 2R7QA 5BNNC 3RMYA 4C1WA 1MVEA 3URFA 2STWA 3CLQA 2RNJA 4MO3M