4CCLA

X-ray structure of e. coli ycfd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
372
structure length
371
Chain Sequence
MEYQLTLNWPDFLERHWQKRPVVLKRGFNNFIDPISPDELAGLAMESEVDSRLVSHQDGKWQVSHGPFESYDHLGETNWSLLVQAVNHWHEPTAALMRPFRELPDWRIDDLMISFSVPGGGVGPHLDQYDVFIIQGTGRRRWRVGEKLQKQHCPHPDLLQVDPFEAIIDEELEPGDILYIPPGFPHEGYALENAMNYSVGFRAPNTRELISGFADYVLQRELGGNYYSDPDVPPRAHPADVLPQEMDKLREMMLELINQPEHFKQWFGEFISQSRHELDIAPPEPPYQPDEIYDALKQGEVLVRLGGLRVLRIGDDVYANGEKIDSPHRPALDALASNIALTAENFGDALEDPSFLAMLAALVNSGYWFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L16 ARGININE HYDROXYLASE
publication title Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 79
structure length 371
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.14.11.47: [50S ribosomal protein L16]-arginine 3-hydroxylase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08007 Cupin_4 Cupin superfamily protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4cclA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4cclA01
3NJYA 2XXZA 2Q8DA 5FYYA 5A7WB 3N9QA 5FV3A 5LY1A 5K4LA 5FPUA 2YPDA 3RVHA 5FXVA 2VD7A 4D6RA 4D6SA 3KV5A 2OQ6A 5FZ3A 5A7SA 5FYBA 4CCNA 5FYSA 3PURA 5FP7A 4BU2A 4BISA 4CCMA 3N9MA 4GJYA 5IVYA 5IVCA 5IVVA 5FJHA 5ANQA 4LIVA 5F2WA 5A7WA 4LIUA 5A7OA 5FZLA 2YBKA 5FY1A 5FY0A 2WWJA 5F39A 2GP3A 5F5CA 5A7NA 4EZHA 2W2IA 4CCOA 5A3TA 4GJZA 4TN7A 5FXXA 4QXCA 3LDBA 4DIQA 4LITA 5FZEA 3UYJA 4C8DA 5F2SA 4QXHA 4ASKA 2GP5A 3AL6A 3KV4A 4XDPA 5FZ4A 5A80A 3AVSA 3DXUA 3KV9A 3N9PA 4V2WA 5FYZA 4CCLA 4IGQA 5FUPA 5FY9A 5FZ1A 4GAZA 5FYIA 5FZ7A 5FYHA 4D6QA 2OT7A 5F37A 4BXFA 5FWEA 1VRBA 3PTRB 4CSWA 5FPVA 3KV6A 5FYUA 5FZDA 3U78A 2PXJA 3ZLIA 5CEHA 4GD4A 5FP8A 3KVBA 5FZHA 5KR7A 5ISLA 3PUSA 5FZMA 3N9LA 4CCKA 2WWUA 5FY8A 2OS2A 5FY4A 5A3NA 4V2VA 5FZOB 4CCJA 5F3EA 5FP9A 5FZBA 4EYUA 5IW0A 4DO0A 4QWNA 4URAA 5A1LA 5FXZA 4QXBA 2OX0A 5IVEA 5A1FA 5F32A 4AI9A 4AAPA 3K3NA 2YU1A 5FZFA 5FZ8A 3N9OA 5FZ9A 5FPAA 5FZGA 4IGOA 2YBSA 4Y4RA 5FY5A 3K3OA 5FYMA 5LY2A 5IVJA 5FPBA 5A3PA 5FZOA 5LW9A 3DXTA 5F3IA 2XUEA 5F3GA 3OPTA 4HONA 4IGPA 4Y3OA 5IWFA 5LWBA 2YU2A 4CUGA 3U4SA 5E6HA 5FJKA 2OQ7A 3PUQA 2XDVA 4UF0B 4LXLA 3LD8A 2Q8CA 4EZ4A 5FWJA 5IVFA 4XDOA 5FXWA 5FPLA 5A7QA 5FZ0A 4QX7A 3PUAA 5FZIA 2Q8EA 3AL5A 5FUNA 3PU8A 3ZPOA 4HOOA 4QU1A 5FYCA 4E4HA 5FP3A 3PDQA 5FYTA 3N9NA 5F3CA 4Y33A 5FZKA 5F5AA 5A7PA 5IVBA 2YBPA 3KVAA 3AVRA 2XMLA 5FYVA 5FZCA 4NUBA 2P5BA 4UF0A 5F5IA 3OPWA 5FP4A 5A3WA 5FZ6A 3K2OA 5FBJA 3PU3A 4QX8A 5FY7A 5FZAA
chains in the Genus database with same CATH superfamily
2Q8DA 2IVJA 1MJ9A 2VZ1A 1ZELA 3BR3A 4U2AA 2RS53 5DD4A 5E20A 4XORA 2M4GA 3F8NA 2ZMEA 5FXVA 2J42A 4A3FJ 1QO0D 5M0TA 4C1XA 1AR72 5EDNA 3P6BA 2ZJPF 2K02A 3HTUA 2CRGA 3BR1A 1QOTA 2Y0MA 2QDRA 4FCYA 1C5HA 4CVUA 2ZGMA 3T1BA 4XQDA 1OC1A 3WNLA 1IUFA 4KU7A 4N9IA 2W9XA 4IHVA 1XDUA 2LALA 4COZA 1XCVA 1UO9A 3JQWA 4L0ZB 2JG9A 2WYSA 2MD5A 1USTA 4KMQA 3VBOA 1PIV2 1POQA 4JGZC 4MG2A 5I0TA 2R0QC 1O59A 2XJRA 5DAWA 3JXSA 4KT6A 4JX6A 5EF6A 2YHJA 2D3RA 3EUKL 1BOBA 2F5CA 2BTVC 4OHYA 2K27A 1S3JA 1RINA 5HNFA 1K3IA 2BY3A 3WTTC 5ACA2 2LY9A 3WTYC 3POBA 4U7BA 4XQFA 5GKAC 3OYJA 4WXHA 1VBB2 3WE2A 2WAFA 1R5HA 2P3YA 3FXUA 3PJQA 5IY5H 1RUF3 4N90A 4XMAA 2ZGSA 3FWEA 1HRV1 3RG0A 5JVVA 4I30A 4L9VA 4A6DA 4JVAA 4JDNA 5T3NA 1O57A 3JSPA 2XR4A 4LK0F 4HW0A 4QX0A 2PMWB 2GN3A 2QKMB 3MN2A 1OQ1A 5JXIA 3KVAA 2QQVA 5ICGA 1POGA 3D6EA 4ONUA 3VKLA 1YUDA 3TMOA 2BNNA 1D8KA 1AJOA 2LRPA 5FPUA 4KNYA 1A6QA 1VNDA 2IGKA 4C1WA 4AFCA 2JDAA 1TP4A 2W25A 2LW8A 3V0AA 1I5ZA 4B8XA 3FBNB 1U5IA 3M07A 2C6YA 1VB2A 2PELA 3FC0A 3LDRA 2RDRA 3RIRA 4A6EA 4AR2A 2WYFA 3AP4A 2OCEA 4UV8A 2XASA 5FZ7A 3OSGA 1FAYA 4RMNA 2NVXJ 1FLIA 2X10A 3ZX7A 3JBG2 2VUDA 4MHRA 1HW1A 4XJZA 1UHSA 4ZS2A 3DU6A 4CDWA 1BR1A 4N43C 1Y43B 5JCTA 4U0YA 4EJUA 1FMVA 1FPN1 4ZDOA 5BNOA 3ACIA 2JE9A 5JMOA 4KWJA 2FMDA 5GZGA 1ZZ8A 4AYBN 1J2XA 5EEHA 1N47A 1S5LC 2K9MA 1GP6A 4DZGA 3C1DA 4WX9A 4PDWA 4IE7A 3MPPG 2IA0A 3VD4A 5CNAA 1MS5A 4MGKE 1VRH2 1QIQA 4IXAA 3JB8A 3E1F1 1KQ8A 2YYOA 5DYMA 3BTAA 5IUQA 4WM7A 1SBFA 1UZVA 4IDZA 5DM7F 3IH4A 2QCOA 1HCRA 2ZAHA 1W2NA 1Q3EA 5JIUA 3OEAA 3ZN6A 1PMJX 1TL8A 2X53S 3RTRA 1DF0A 4XKBA 3BR2A 4YYOA 4Z2AA 1HKQA 2FMYA 1GUIA 3VL9A 4ZTFA 1B35C 2X1EA 1OCPA 1V9U3 1IS4A 2E32A 3KCXA 4A69C 3MKYB 1LESA 3CUQA 4G9SB 2ZC2A 4GWIA 3MCZA 2ARBA 3BU7A 3KF3A 4BA6A 4UW3A 1EH7A 3K4MA 1JZ5A 1DQ5A 3POJA 1D1CA 1TME3 2JB4A 1RUC2 3SMHA 2RS13 2OCCH 4ZHNA 1H9PA 1L0OC 3MV11 2BDRA 3M3IA 5DG1A 5A6YA 2EAKA 1XYPA 4R4XA 3KSCA 1XSVA 2AREA 4E7ZA 3I71A 2Y69H 1DP3A 3I2KA 1AXYA 1ZNPA 4BQ4A 1HN1A 4CDQC 3OYGA 2XUEA 2CYYA 1I39A 2M4KA 2UWMA 1UY4A 2GQQA 4UF0B 2JA7J 4HQMA 1I1GA 1UYZA 3LWCA 3OOUA 4IE5A 1REEA 2VULA 4JRLA 5FMBA 4QU1A 2Y0SA 4XLNF 3UKNA 5CFDA 3I7DA 2HH9A 1Q8PA 3CCRI 4AHWA 1NAEA 1RL3A 1T95A 1WCMJ 1HC8A 1LRHA 1UF2C 2VZVA 1YG2A 1IXSB 4KH9A 4AFBA 2A07F 2XPVA 2QZ2A 4KBZA 1QA6A 1SEUA 3HIFA 5A3LA 3UESA 4XUPA 1A78A 1APLC 1HV1A 2PHWA 2E35A 3GCWA 4A0ZA 1YOVB 3J7LA 1PM4A 1O4ZA 4Y20B 4CDGA 4AU7A 4QHZA 3OS0A 2DVDA 1ZRDA 4D0PA 4XBLA 1T8IA 4AEDB 3MD2A 4Q4W1 1YQ8A 2R041 1IRGA 1HDPA 4YZ2A 3RZOJ 4AHXA 1W0OA 1JKQC 4R1HA 3N9OA 4TLFA 3KEQA 1FYKA 5I91A 3O3KA 4BGDA 5FIXA 1DP7P 5K0UA 1UMQA 3TRSB 2EVXA 3TP3A 5DS9A 4YVWA 5I93A 1KFUL 2E7QA 4M4RA 2ZGQA 1HOMA 1DGRM 1ONVA 5LZ6A 1I3AA 4WCGA 1D4M2 3ZXFA 3QP6A 4CZCA 2IS4A 1RVF2 1I3QJ 3FFQA 4R9AA 3SEPA 2XRNA 4NDLA 1QGLA 3H35A 3ZSEA 3ZYJB 1PZ7A 5J4YA 1A5JA 4IO9F 3S93A 3TBIA 4B7KA 1RUE1 5FMOS 3BKZA 5ERLA 4LO6B 1ZAOA 2BE5F 3I58A 1OFCX 3PSIA 3FMSA 4NWWA 1SFYA 3OYHA 4XAAA 1XE0A 3C7EA 3WTZA 4CP0A 3WDXA 2O0OA 2F2EA 2XLFA 2RV9A 1ULYA 1BR4A 1X1AA 2R7EB 5GTHC 3H3VK 5A7WA 3LAPA 4AQTA 1A3KA 4PJYA 5F5CA 4D7TA 1QJU1 4M6XA 2DCZA 4DIQA 2O8XA 3KLNA 4C30A 1CAVB 3LWFA 1CZSA 2QQBA 2H6CA 2H8WA 3CQOA 5CVUA 3GGLA 4EE2A 2HWB2 4COYA 1AUYA 1X9TA 4CU9A 4BQAA 4FFHA 5ICEA 1PK6A 2DUQA 3OUIA 3VBHC 1MMNA 4C0BA 4IGOA 5DAPA 2YXSA 5BNPA 3WDWA 1K5MA 4EN7B 5F3GA 2DV9A 1Z7S1 4D7MA 4DNYA 3ZMSA 5J37A 3OYNA 4N8MA 2B0LA 2DTRA 3GW2A 2PLV2 1JZ6A 2NS0A 3LA7A 4M0NA 1TE1B 3DPRC 4U7DA 3GHMA 4Q4Y3 2VOTA 5GLZA 3MLLA 2DN0A 1WW7A 2E9QA 5FPZA 2BW3B 2OKXA 1ZZ9A 3HYIA 2YFUA 3UNPA 2VB6A 1B9NA 3MUY1 4DINB 3JTGA 2EFPA 2YY1A 3S2HJ 3J8F1 1APNA 4P55A 4BE3A 3CDHA 2MFZA 3DCFA 3FHIB 2WO1A 5ANNA 4NRPA 4QDSA 4QPQA 1OFSA 1N3PA 3IWZA 3AVSA 4ZH4F 5F37A 4EN8B 1W8WA 4KT5C 2GNTA 5EG0B 4CXYA 1RJ7A 3N9LA 1OCCH 5DZEA 4A3CJ 4EJRA 5FY4A 4XXAA 4URAA 5GLTA 1UG2A 2QM3A 2HVQA 1XMXA 2OAZA 3G73A 3AMQA 3DTEA 4A45A 4GXLA 3GALA 4JKLA 2ARXA 5KBFA 2J1VA 1OVSA 2HDWA 2RMU1 2VM9A 1SEFA 1F43A 3KP7A 3GTQJ 4YM2A 1EY2A 1W06A 1JTXA 4MLOA 1SMTA 2Y8KA 3WLUA 1SFXA 2NAZA 1Z7LA 2R92J 3LSDA 1LHNA 3LEKA 3KZIC 5IYYA 1Y8RB 2QWWA 1BR2A 1TNSA 1HKTA 3H0DA 4WM8A 2LY2A 2V5YA 3FUQA 2KFDA 2OV7A 2ZXIA 3OGRA 4RR3A 1CVNA 1PDNC 2GBYA 1T33A 3BLYA 2QVSB 4DW6A 1ND2C 2JUGA 1NCQC 4D9JA 2WNEA 1V6JA 1SC7A 2V79A 4OQ9A 3SYTA 4BNCA 2VZQA 5JR7B 2AENA 5IVCA 2VBDA 3IDEA 4AYBA 1ZTRA 3K77A 2ZBKA 4J1XA 4A41A 1JXNA 4XBNA 2E6VA 1GBGA 3UGHA 1R23A 1TQIA 3GTKJ 3DPTA 1HRV3 5BOXA 4URTA 3I2IA 2AC1A 4UVBA 3MW4A 3F23A 5FO7B 3HPGA 1XXNA 3OYEA 2BXYA 5F08A 4PCQA 1X3UA 4OAZA 3RKXA 3M1HA 4LK6A 3AP7A 1OOPA 2HNHA 4UFKA 4YZ3A 1PZ8A 1UOBA 4D5CA 1ZYBA 3ILFA 1XS9A 5HS7A 4PHZA 4QSHA 4PSWA 5F32A 2ZNYA 1X36A 3RPUA 5EXOA 2VI6A 1NG7A 1LEBA 2O3FA 2QZ8A 3G1OA 4QTRA 1UY0A 2YGLA 3BCBA 4UBHA 3QU6A 2J1UA 3DXTA 3A0HC 2CV6A 1WLWA 3ZQQA 3GF2A 3LFUA 4IOCF 1S55A 2DU0A 3CDLA 2OIIA 4AVBA 1RUG1 3OD4A 4L5EA 2XVCA 2W1UA 5GTIC 2D97A 2WTEA 4XVHA 3ZSKA 1X1PA 3VPRA 3FHQA 4LBMA 3BALA 3OV8A 2DVFA 5FV3A 4AFDA 3GDBA 1SACA 1W7PA 2A73B 3PIPF 4PJMA 1FPN3 1DGWX 4QX5A 3BCWA 2Y2ZA 2JN6A 3VLBB 4LIUA 3AX4A 5KXBA 4QQOA 3VZMA 2V7FA 4TN7A 2CV1A 3MZ8A 3U37A 4MTEA 2W1OA 1GKBA 2XL9A 2UURA 4AI2A 1N3OA 3DKYA 3KV6A 3ZSLA 1D0HA 3RRDA 2YX4A 3AKTA 3CJRB 4K9SA 2ZJQF 1W2TA 2RNJA 4GFBA 4LUMA 1EPWA 2BBYA 2V4AA 1HA8A 4DYCA 3HKZA 3VYRB 5J3LA 2XSDC 3VOEA 3SH3A 4QB2A 3UT0A 1GVDA 2RQQA 3E7LA 4YPJA 4OWRB 3K1PA 4E4ZA 4QPOA 2YBSA 5JVGF 2WZR2 5FAXA 4AIKA 1COV1 5FLXK 5JI6A 2HR3A 1OKQA 2CGNA 2WAQN 4XJUA 5JWPA 3NNJA 3HOXJ 5FZ0A 5DUKA 4IL7A 5FMDA 2X5IC 1OPOA 3NNGA 2P4EA 3DV8A 5JAXA 2C9AA 5C9AB 1IOAA 3ISPA 4LO5B 2JWTA 1LOFA 4LO8A 5FYYA 3HN1A 1GQHA 1SFNA 2DA3A 1MVEA 3QACA 3CLOA 2Q4SA 4HETA 2AS5F 1XGSA 4LOSA 3L2YA 1PO12 2RREA 5E18F 2NZ9A 2CMPA 4R9BA 3WNXA 3R0RA 3AFKA 2CU5A 4JX0A 2LTPA 2QUOA 3WUDA 2ZGRA 3K51A 3MIDA 5AFBA 3IP4B 1W0UA 3I55I 1ON1A 5K5QA 4ZZDA 3MKZA 1FV3A 3RDIA 3I64A 2W94A 3F8CA 2EXIA 1QPMA 2A6VA 3N9PA 4GAZA 1DQ2A 1T2KA 4FAGA 3H36A 1X2MA 3KYCB 1WWXA 3K4CA 4FETA 1TG7A 2MW8A 4CEWB 1W1WE 3HOBA 2DA1A 4Z1VA 4KI5M 1HB3A 2HDDA 2XHKA 3KETA 1Q56A 4IRGA 4XKCA 3AG4H 1QNWA 1SQ4A 4CYCB 3RI4A 2WABA 2BZDA 4A7YA 1FBSA 4RQPA 1W6PB 2B63J 3VBUB 1UYPA 3S3OA 2OD5A 4XDQA 4QDRA 5I8YA 3C3VA 1EAH2 4A3EJ 3LQQA 2TDXA 4Q5OA 5IYDJ 4LBOA 1RUOA 2OTJI 4P9WA 1H1AA 1VB4A 4I76A 4LBQB 1JUSA 4AFAA 1CJDA 4KGQA 4B1RA 5F6KA 4CA0A 2WKKA 4Q4W3 2PMZA 2R043 3FZ3A 3KV5A 4IV1C 1V6IA 3ZN0A 4E7IA 2DFHA 1TBXA 4LFUA 3N9MA 2VIXA 2DW4A 2JE7A 1MQTB 1JH5A 2BERA 2P81A 2HWE1 1UB9A 1IN5A 2ZGTA 2IXHA 2OPKA 2YGMA 4HSRA 3NO8A 3GYHX 4YW2A 4HK9A 4QX3A 5KHIA 2DXIA 3QOPA 3I5UA 4C3IJ 4QXHA 4MFDA 3FKJA 5IT9K 1ETQA 2MGQA 2QA4I 1JYXA 2NS8A 3JCUC 4BXFA 4HDVA 3EQEA 3U78A 1Z67A 1LGNA 1LHWA 2H09A 3PVBB 1JZ7A 2LTNA 3SXWA 3T2PA 3ZRGA 1FYLA 2ZHNA 3VZNA 2DF7A 2WIIB 5TSWA 3HAGA 1BXHA 2OA2A 2VOXA 4UHTA 1GV5A 1A6IA 4QWNA 1RUE3 2OQGA 5FPAA 1LCLA 3DBLB 5C71A 2YU3A 4Y4RA 5BPDA 3BZKA 4FTEA 1RHI1 4FFIA 3R0JA 4CP9B 1GNHA 2ISYA 1H2MA 2OUJA 4LQRA 5F7UA 2YPJA 5K8SA 1TZLA 2ES3A 4IESA 2AUYA 3UL2A 4IL6C 3MHZA 4LHNA 1QJU3 2EIEA 4XILA 1TWGJ 1J75A 5F3CA 1HF0A 1JHJA 4KWLA 5CVVA 3R0AA 2Z99A 4XIDA 1BZWA 3Q9VA 4XFHA 4BLJA 5AVAA 2CDOA 4ASMB 4CPBD 1EUTA 1SPPA 4FTSA 1R081 2J1EA 2XJSA 1S6LA 1MIJA 3LL7A 2X1DA 5F04A 2MSYA 3RZKA 1GYKA 5C4XJ 3HRUA 3ILRA 1IQAA 3U14A 3GZNB 2EFQA 3B94A 4WVZA 2JG9C 3CMGA 2WZ8A 2MA3A 3HVDA 3CC2I 3ITQA 4LTAA 2LUWA 1Z7S3 3VBOC 1LOAA 1LULA 3A23A 4CUCA 2D93A 3NEUA 4P02B 1XE7A 1NK3P 1H1IA 1UAIA 5I8SA 3D3AA 3ZQIA 4O3MA 4XFBA 5FPVA 3FM5A 5EFUA 2WQ4A 2IWGB 3WDUA 3RMYA 4NAOA 4LNVA 2VNVA 2FZ2A 4MEXF 3QLQA 3SISA 2HGCA 2OUHA 4FOWA 1J3PA 2JX9A 5A2QK 4ZY9A 1AR82 4A6SA 4BHBA 1BLZA 3IH2A 2P4WA 4PQ9A 3CO6C 1XD7A 4MGRA 3CMEI 4A3KJ 1F31A 4RGSA 3NAPA 3J8F3 5HCFA 3FE5A 3BTLA 1MS3A 4J19A 4L9TA 4A12A 1NXD1 1GICA 5M3FJ 2NMOA 5HLTA 1S8NA 5EQUA 4FT8A 5AFEA 4RFRB 4B29A 3BPSA 2BV4A 2UYAA 4ITVA 3U75A 1JN2P 4W6XA 1H8TB 2X09A 2ZOEB 1SLLA 3R05A 3KPHA 4AC0A 2ZFWA 3MKWB 5LA2A 3PFYA 2BWCA 1E0EA 3JRDA 3CBNA 1V6MA 1OISA 2XH6A 1FMWA 4KA4A 1LJ7A 1TVGA 1YRNB 2RMU3 2L9VA 3QODA 3ZQFA 4B4QA 2XWBB 2L0KA 1ASJ1 3AKQA 1UY2A 4N9HA 3LSMA 2ZEZA 4XF9A 1RR8C 2STWA 1O91A 2UV1A 1XNAA 1YQ6A 2FNAA 5BNOC 2PMHA 5IAVA 4ZU4A 1NLRA 5L73A 3FM3A 4LA3A 3JRBA 3MI8A 3L09A 3VSKA 4KN7X 4MQ9F 1U5TB 2EBIA 1AYN2 2VECA 1OD5A 1XJAA 3O1VA 2EQRA 5CVJA 4DO0A 3BZCA 3OUHA 3ZMOA 1N3QA 2N8GA 1ZA7A 2K9SA 1WW4A 3PHMA 4QPGA 5GM0A 3MF9A 1VBA1 4OVEA 3U21A 1DZQA 3NSTA 5I0DA 4ISQA 2LK2A 1X82A 1JU4A 3C7JA 3DXJF 1SD7A 3V7RA 3AB0A 5JUVA 3WP4A 1W9WA 1ZRIA 1IPKA 1BI2A 1IRZA 3RKWA 2BWAA 4E9KA 1W9YA 2J5OA 4EQVA 2G4IA 3TL4X 4UYBA 3VFZA 1T6BX 3I3BA 1YJ9I 2HI3A 3MEXA 2VTFA 1UXZA 2CW8A 3D8CA 3SZPA 5KWRA 1Z3XA 4RS5C 3F72A 3DTKA 4UUSA 1LFBA 3ONQA 2F4LA 2VNGA 3BYWA 3F6OA 4W97A 5EYXA 1AR92 2VMDA 2K46A 4ZYEA 3VKMA 3O0WA 4IZZA 4GMP1 3FL7A 2EFOA 3N36A 2WNUA 1U0JA 4FHTA 1PUEE 1RUG3 2C0ZA 1AR61 1QJFA 4DS0A 3BG6A 1VRBA 3D0SA 1HXDA 2VC1A 3HOSA 1ULOA 4YZ1A 1LB2A 1LDDA 1RUD1 1TWFJ 3PM1A 1S0DA 5FRAA 2DYRH 3OTFA 4FX4A 3S1RJ 3LSTA 1I1SA 4RA0A 1P4AA 3DYMA 2CAUA 5AVPA 5HCBA 3X2QH 3G1LA 4WVMB 5FZOA 5CFDC 3L00A 1F8VA 4YW6A 3K1MA 3GYDA 3BCAA 1N1YA 1RXGA 2XONA 1HW5A 1JHNA 2ZKLA 2ZGNA 3T2QA 3NRVA 1YNAA 2D5HA 1R091 3KT4A 1IRXA 4BK5A 4CRQA 1KQ0A 4N53A 2E2JJ 3Q8CA 3VZJA 4HKWA 3BR5A 3BTXA 4IV3A 5IT3A 1ZRCA 2MEV2 4CDWB 4CZSA 3ON7A 4IEPA 2LP0A 5IPAA 1UNBA 1O8PA 5BNNB 5EGOB 2PHDA 2FZ1A 5JIAA 4UW6A 2LROA 1Z21A 2XGCA 3T1LA 5D4SA 2AACA 5F0HA 3VHRA 4BEHA 3VBRA 2R7FA 4JQFA 1IZ3A 1QJX1 1COV3 4P9GA 3H8XA 2ACJA 5FXXA 4LLFA 3WQBA 4ESJA 2XBO2 3ZFGA 2Y64A 5FUPA 1CX1A 3WW4A 3ZYPA 2VGDA 3TN91 2LVSA 5CEHA 4XKWA 1PUFA 2KJCA 4K2EA 2FHRA 1UD1A 1YLFA 5K0UC 2Q8KA 1FBUA 2VJIA 3S2WA 1WZ2A 3U1KA 3NQOA 1RITA 3NNFA 4YVWC 5L7OA 3B6CA 3A0NA 5LRRA 4CU7A 4RB2C 2RS32 1XE8A 2HEOA 3EQLF 1YFHA 1LNWA 4E7JA 1IV8A 4X8PA 2ZPXA 3OYMA 3CJNA 1IN6A 1F15A 4FOYA 4C9YA 4LJHA 4N43B 2XJUA 1OFNA 4W6WA 1ND3C 2D6PA 5D6EA 2XJQA 1T0FA 4CGZA 3ZXEA 2J5PA 4AEMA 5C4JJ 2R5ZA 4K3UA 4XJ8A 5BQTA 4PBOA 3WGIA 4CDUB 1WJBA 1YFYA 3AG2H 1BI3A 3I54A 1XB4A 4P5OA 4HZFA 1EH8A 4F7ZA 3CC4I 2ET1A 3B73A 1VMHA 2PQSA 1OPCA 4I7HA 1U12A 3NJVA 3H8OA 1YITI 1S7AA 2DWRA 4P9XA 2A75A 2ID6A 4GO1A 2VXJA 2E51A 1HSTA 1HV0A 4E7KA 3CF2A 2VPLA 3PURA 4FE4A 2L7FP 3CCEI 4P08A 5FY0A 2Y48A 4XLFA 3DQVC 3ZQHA 1ALYA 5B4XA 1WH7A 1GDTA 1W2OA 1QJY1 1LGBA 2V4VA 1MMGA 5L3EA 1PX4A 5BPIA 2E1MB 2I5UA 4C3JJ 5EYRA 3TAYA 1PK6C 3IZOA 1DU3D 2QBXA 3Q8BA 4W50A 2IEKA 5C4WC 4CHUA 4NROA 4AK3A 3GTGJ 3NAUA 5BY5A 1ZREA 2PQQA 4CCKA 1BC7C 5BNPC 1K5MC 3H3UA 1S2KA 3CTAA 1H8VA 1UWWA 2X85A 3ZMNA 5FXZA 1R1ZA 1DGRN 1KS5A 4XF0A 2YUSA 2OZJA 3H7JA 5FPBA 1GZTA 5GZCA 4Q4V1 4HKLA 3O2PE 3I56I 2YZ4A 3I2OA 2BW8A 2HWE3 4PBPA 2W1SA 4XF4A 5J36A 3L2UA 2BBVA 2QEXI 4A5NA 4JGYA 3J9SA 1S9HA 2D3PA 2CU7A 2R7SA 3IDBB 3M7GA 5DAXA 3MFCA 3DLAA 4CDQB 2EIGA 2FQPA 2HU9A 5EIYB 2BY0A 2KDOA 5K7PA 2D45A 1VQLI 2K3PA 4XBFA 3POYA 5CKTA 3AL0B 3EUAA 4C91A 4CCMA 3SC7X 3URFA 2Z5UA 1HKSA 4Q47A 4LBLA 1JU3A 4B3XA 2Y9YA 3QPLA 4OHZA 2O9LA 3KQ4B 1RHI3 3OGVA 2F4IA 2WFF1 2JENA 3ZXLA 1AR71 4D7YA 4CE8A 3CZ6A 3ZKYA 2VAUA 3K4DA 4A7ZA 2J7MA 1P4WA 4P1WA 3RFRA 4E7HA 4W6YA 5EWSA 4HG6B 4CSWA 4XOTA 4BIOA 1JODA 2XF5A 5E8IA 5FZHA 4DQAA 3TDZC 1QMJA 4XJWA 4BIFA 2RM22 2Y30A 4V2VA 2IVMA 1UCXA 3BIEA 3H3LA 4TZDA 3RZJA 4EN9B 4UFLA 2B9VA 2JRMA 3TO9A 1R083 5J6XA 2WS92 2KLOA 4NPRA 5IWFA 3KP4A 1DPUA 3RWKX 3VZOA 1D3YA 3KLOA 5ACA1 3LSIA 4WK8F 3G3ZA 3RGBA 4RR3C 5HLIA 3W5MA 1R22A 1TW2A 1WJ5A 1K7AA 4BJ0A 3GFIA 5C5TA 3UJOA 3ZIXA 3TKYA 5FTTC 1Y39A 4LBKA 1JS9A 4D6QA 4ISRA 2LKPA 5HNHA 2LOOA 5JOWA 2Q1ZB 5FLIA 1W03A 2W39A 3ZFFC 2VBBA 4GH4C 1ZLJA 3W20A 4P96A 3WD5A 2CUZA 3AAFA 2RV8A 3GZAA 4J00A 1PGL2 2E19A 3CJIC 3GX4X 5LASA 3H9GA 1OSGA 4QX1A 1KZHA 3VHPA 2MC3A 2DT6A 1LVKA 1JUPA 3ZOIA 1G3YA 2VMCA 1CPNA 2G1MA 4Q1RA 1HIXA 4IEOA 4COVA 1VBD1 3SH5A 3IPVB 2RS52 3AKRA 4X1EA 1UZ0A 4L11A 2XKOA 2CV0A 5FZ9A 2WADA 1GV2A 4NC8A 4FO9A 1OCZH 4YZ4A 5FYMA 5K7FA 4E8CA 2CAVA 4I3PA 3GLXA 5CADA 4CUGA 1ZBE1 1Z0XA 4JC1A 2YC4A 4IOAF 3N7JA 3P9CA 1N75A 3AL5A 3FHAA 1D8JA 1ASJ3 3PDQA 1JZ8A 1G9BA 3BTZA 2HJIA 3W6JB 2JPCA 5FK7A 2NOJB 3BG9A 1VRH1 4BYYA 5E3NA 5T5PA 1ZBA2 3O1RA 3NJYA 1ZZ6A 4HKOA 1O4YA 1WWYA 2VU9A 1OLMA 4BQWA 3ZDSA 4B4CA 5M3MJ 2ATFA 2EV5A 3F2ZA 4Q29A 3DPRB 2BHYA 2CQNA 1ETOA 1YFXA 1VBA3 3BC8A 4EN0A 1NLSA 4IERA 2E7AA 3QH7A 3ACLA 2QVOA 1CF7B 1O7FA 1F9KA 3LGRA 1JZ2A 3CCMI 4CXFA 1RUF2 1B09A 4P9LA 2GP5A 2HYFA 1OQDA 4AI0A 1GZWB 1EUUA 3Q9SA 1ZVFA 4F83A 1DLCA 4ZYDA 4Y5Z0 2QJVA 1HXS1 4RHV1 1NYWA 4B09A 2VQGA 3ERED 1R1UA 2P6HA 4NC6A 2OBPA 2W5FA 1JYCA 4XEZA 4OI1A 5EP9A 4H0EA 1WJCA 2M3AA 3PO3J 3FMGA 2X6YA 2X1CA 4EM0B 3LD8A 5ICFA 2RKHA 4GMP3 1W2UA 3RZGA 4XHBA 1YX5A 2F4PA 3IKTA 2G9FA 3MIEA 4FQZA 4ET7A 1VFCA 4OCTA 2J1TA 4XCAA 3POWA 4UF0A 1AR63 3FHNA 3VEPA 1A04A 4BQYA 3QPHA 3GCXA 3RZMA 2NVUB 1RUD3 1VPHA 3PNYA 2X51A 3SDGA 1EV11 1YQAA 2L9RA 3HQUA 2I8DA 2HDCA 2QKDA 3LCPA 4AZZA 2EV6A 4NIHA 5C70A 3CHXA 1PGW2 1QU3A 4OZOA 5F0FA 5DUVA 3S7EA 2E1CA 4KDPA 4BPZA 1Y1WJ 1LE8B 1Z77A 2X05A 1NCQB 2KL4A 3J7YJ 3IDAA 1IXRC 3LSRA 4HK8A 2ETEA 2IA1A 4Y20A 1XNKA 1I6XA 1O3RA 3HDDA 1S7OA 1DPRA 2DMPA 1CZVA 1OURA 4NR1A 1R093 5CQGA 4AFMA 3AFGA 4RQPC 1IHMA 3R4DB 4L99A 4Q4ZF 1TQPA 2MLGA 1LPQA 4BJ6C 4ENJA 1Y4WA 2FQ4A 4AEDA 4PIXA 4U87A 4OMCA 4I3GA 3D0JA 2KRHA 4IGPA 5J96B 4Q26A 2PX9A 1NOVA 4QB6A 2OZUA 1V9U2 3EB7A 4LKDA 3RS6A 1V00A 2YROA 1UL9A 1YWKA 5LA9A 1R5GA 1QJX3 1OCRH 3KWVA 2LYCA 4OIOF 2DU9A 1SMVA 3F22A 2GSYA 5DCFA 4Y17A 2RS12 1V6OA 3TN93 1I9RA 4CDXB 2ZX0A 1RVF1 3ZXDA 4FPOB 3CQZJ 4H7LA 1AHSA 4RYDA 4UY8I 5DCMB 3OBAA 5E1WA 3AP6A 3UR3C 2O7OA 5AC92 4BXUA 3NJXA 1Y7BA 3OR1C 4BCUA 1SAUA 2VNRA 3GFMA 1F5FA 4M6YA 2V1UA 3H9AA 1GLHA 3CDZB 3ASIA 4UB6C 3USUB 4ASKA 2LG4A 3ABZA 4V2WA 2HKXA 4CCLA 5FY9A 2I07B 3SDBA 2D40A 2XF7A 5DD8A 1HBXG 3KT1A 4IETA 2BHZA 1L3LA 2QNKA 2VR4A 4X8NA 3UGFA 4ENKA 3G2BA 3PVNA 2ZGUA 5CPRB 3OYLA 5IATA 4R4ZA 4HSJA 1RC9A 1ENQA 2ZS6B 4YG2F 3S57A 1IN7A 4AGGA 5IP9J 4P9YA 1NX9A 2Z42A 4YIRX 1DG6A 2KA3A 2D6OX 2A3XA 3QYEA 2W68A 1S29A 3FLRA 1H88C 4META 1GFF2 3IV5A 2VQLA 3WG3A 1W36D 2MC4A 2E5NA 1PGSA 5FMOL 3HBZA 5LBFA 1W0PA 1REDA 1W8UA 4XZPA 1UAAA 4EJVA 5LB6A 1QJY3 3O8HA 3AYEA 3PMSA 4IHYA 3J7AO 3A02A 2HVSA 1EF4A 3EDPA 3B93A 4OMDA 4S2HA 3HQRA 1BJZA 1MSEC 1XC5A 1X4OA 3VBSB 1W99A 3QU3A 4D6RA 2P2KA 3QP5A 4PJJA 2Q1FA 1RUJ1 2XB0X 2Z5WA 2A5YB 2BW3A 2VKVA 2X5IB 4LK7A 3WNMA 5HS9A 3H1YA 3GZTB 3HSFA 2GP3A 2HZDA 2ZMNA 4Q4V3 3KMHA 5FCCA 1EPZA 1MNEA 1UU6A 1OYIA 5KAFC 3WG4A 2XRLA 5SV8A 1ZR2A 2IGOA 3RZDJ 1NXMA 4P00B 2R16A 1LDJA 5LCWL 2MH2A 4IEUA 2OW4A 5EYYA 5FY8A 1CAWB 5F3EA 5LHHA 3NAPC 4QM9A 3FXQA 3R4SA 3ELKA 2DAOA 2VZSA 5IVEA 5EG0A 4CUBA 3WG2A 5FROA 5CIRA 1ZK8A 4OINF 3DWLE 2BJSA 1UELB 1XSQA 1KJRA 3PQJA 4HN1A 3FJSA 5JSRA 3HXLA 2WFF3 4KICA 1O8SA 3EO6A 4LB6B 3SEQA 4NHJA 1AR73 1C1LA 1DCSA 3WQ1A 4MTDA 1WLDA 3OIPA 5FZCA 2K40A 1UXXX 2C5DA 4HDUA 2A68F 3ZQGA 1AX2A 4QIWN 4NRMA 2FEZA 2E7XA 1J3QA 4E27A 1HKDA 1PNGA 4FCAA 2VCAA 3P5JA 5FD6A 2LC2A 1KU7A 5DV5A 3WF4A 1T08B 4M4PA 2A69F 2EINH 5DUIA 2ZX3A 4YFZA 2EA2A 1UOJA 1GMMA 4FPFA 1MH4A 4KIGA 2ZGOA 4D7SA 5K7ZA 5F5QA 1MS4A 5ACA3 5L3CA 5LATA 4XDPA 4IV1B 3IUOA 2Q8OA 5LHGA 4Q4Y2 1R9TJ 1WA6X 4UB8C 3EXUA 3OY9A 4CP1A 1H4HA 3LE0A 2KRCA 3BZ6A 1C8NA 4XE9A 5F0CA 4YVSC 3NV4A 1PM7A 1B4AA 3CL1A 2ADDA 4LPLA 2DCKA 2Q5TA 4MXWB 3SEEA 3ST7A 5LWBA 3BY6A 5D8AC 2XDVA 4AIDA 3ZO0B 5EZGA 3RSNA 1JGGA 5FPLA 2IVIB 2RJKA 4TXWA 2LF7A 4YZ5A 5JHUA 3WF3A 4AVTA 3SEZA 2V5DA 2XPWA 1WUVA 1JW6A 1QZEA 4YM3A 2JPBA 1NCRB 4NNJA 4R79A 3QAHA 1GLNA 1U0AA 1IDYA 1GQPA 2VONA 5HPOA 1DU0A 4J01A 1MSFC 3WINE 1VBD3 2E7WA 5FO8B 2WNUC 3CCQI 2YB7A 4BHCA 4B43A 2C26A 5HDKA 1W5SA 2PEXA 2HPIA 4SBVA 1ZBE3 4MSVA 5FJ8J 3GTLJ 3FBYA 2EA4A 4F8AA 2HTSA 3FZVA 3BJOA 2FQ3A 2LY1A 5DM6F 3IRQA 2BYVE 1JUMA 4AM3A 1XQNA 4GD4A 4BH9A 1SVLA 1VRH3 5D5VB 2ZXQA 2PMUA 1KU2A 1ULGA 1RUI1 2GIZA 4XJ9A 4QX2A 4M9SA 3CCSI 3G7DA 3CU7A 3HBLA 3T4VA 4BXXJ 1LEAA 3PUFA 4BDYA 1LFPA 3A1YA 2DOFA 1L7LA 5LA1A 1W6MB 2ZXWH 5JXGA 3LPFA 3ULQB 2Q30A 2WN2A 2NLRA 2K86A 1EP0A 5K7HA 1ETKA 2XB6C 4FFGA 2WZR1 3AC0A 1C57A 2R49A 4PUSA 1UFMA 2ZKZA 1HRV2 3TOBA 3FN9A 1JHFA 1QGPA 4JX5A 4W65A 3M3EA 2BP6A 2CQXA 4AVSA 4RGGA 1CR7A 3S0MA 4HLYA 1OR7A 2HZTA 1U5ZA 1HXS3 4RHV3 2XAQA 5C8CB 1AXKA 1IV6A 5C9AA 3IH3A 5FP7A 5BPXA 3LOBA 5H9PA 3KP6A 1ULDA 4M72A 2ECBA 2R062 3HOTA 1HRI1 3ZFGC 4XF3A 2ZXJA 2V1XA 3SHFA 1CQTA 4S2DA 4L9JA 1FIPA 1JE8A 5FLHA 1NLQA 5TRDA 5EJZB 2TUNA 1W8TA 3A03A 4UV9A 3PQKA 2Y60A 2EJRA 3GXUA 1MZ6A 2H6BA 5D5XB 2ZO4A 3BOQA 3UKGA 1GANA 5CBLA 3TNQA 4HSLA 4GMP0 2QQ9A 5LEKA 3SCHA 1SVOA 3S32A 4H2AA 3WW2A 4BBRJ 3NV2A 1WI9A 3KLSA 1MZ5A 2X8KA 1RZ4A 2ELKA 3LIHA 1EV13 1FPN2 4XMYA 3KD4A 4CEWA 1EH6A 3JAMK 4TSVA 2Y31A 3FXKA 4QWQA 1R4NB 1YHQI 1ITYA 4M3CB 4XIOA 1XMAA 3JW4A 3QWLA 5M5XJ 3EYYA 3IMNA 4WF2A 4CYCA 5A32B 4Q0VA 3U9GA 2QQAA 2K4BA 5KHGA 3ZSMA 5IVBA 1Y1VJ 4IHSA 3VBUA 1BJAA 2QQUA 1WJFA 2VMIA 1XSRA 3ZYFA 1EAH1 5GZDA 1F36A 4BQXA 3ACGA 4PGGA 3ABUA 4LBQA 1DYPA 4YWAA 3DKXA 4NOTA 3H92A 1K79A 4AQSA 2VZUA 2G19A 5FY1A 1KYWA 4JRAA 2A05A 3MO4A 2LKXA 5LBQA 1VMFA 1MQTA 2WZPP 3AL6A 3TEXA 5F1JA 4HV5A 2AHQA 2ZX2A 4RS5B 3T09A 1S0IA 4P5HA 1NE4A 2OT7A 2P5VA 5C3EJ 3W58A 4XETA 5IHRA 3UKVA 3LA3A 2FD8A 4AW7A 3G71I 5FKKA 1R1A1 3V65A 1J5YA 1YO5C 2FDIA 2H27A 2WRAA 2XWJB 2QQMA 5J8CA 4R8HA 3JRCA 2XQXA 1RVF3 2Y6JA 3AKZA 1VBC1 4JGYC 5CYVA 2XHNA 2D1HA 4A3XA 5H9QA 4XRMA 4L9NA 3O8GA 1ODNA 3B7MA 1KXGA 5FMCA 3LEIA 1G2HA 1AHDP 2GLOA 3I4MJ 1V4RA 2V9KA 3LFKA 1A6CA 1ZGWA 3VDDB 3RZHA 1HQCA 4HV6A 3HTSB 2V6EA 2ZA9A 1IXCA 4CP9A 5CKQA 4AG4A 1OYYA 1OLQA 1PYVA 2Y38A 3KP2A 2NYXA 5KCMA 1MPXA 5AIPA 2EILH 4BJ5C 3S5QA 2ESHA 2ARCA 2ZEYA 3OOXA 4DYQA 2RNGA 2HQRA 3J7AY 2PHTA 1FI2A 4DUWA 4AEJA 1DQ1A 4BMBA 1ZARA 1YJNI 3D4KA 1H6YA 3CKHA 1KU3A 2PTMA 2JDNA 3W3CA 5FZLA 1YS7A 4MOAA 4GJZA 5E16A 3WGGA 3PL0A 2F48A 2DQRA 3T0YA 1U5YA 3DXUA 3B69A 4DJAA 2VTXA 3T2OA 1KU9A 4AYUA 2VLAA 2G9GA 1YW8A 4OIQF 4ZYHA 4UNOA 2JJ7A 4M3EA 1Z6RA 5LD2C 3HOUJ 1OCOH 5FFXA 1GWLA 1HDDC 1Y9QA 3LSEA 4RAZA 4JYKA 1B72B 2EIDA 4KWKA 5JXJA 2CO5A 4DYRA 2JD9A 3AG1H 4HXCA 4LB5A 2DA2A 1RUJ3 4XCBA 1MS0A 4XFCA 1ZA4A 1ZLKA 1AR81 4DEQA 3E5XA 2EK5A 1BEV1 2LDUA 2XKPA 2YFZA 2KR2A 1FP1D 2MPFA 1NZCA 4U36A 1MGTA 1X1BA 1G9DA 1JUHA 1LTEA 2QF7A 3TGNA 5FYCA 3BPZA 1NY72 1D0YA 2NNNA 2LRDA 1MBHA 5GAGJ 2LD5A 4IXLA 2VNOA 4Y1XA 4ZONA 2WB1N 1JI8A 4AVAA 2DT5A 4XLHA 1KONA 4XF1A 3E6CC 4HG2A 5M5WJ 2XC7A 3PVEA 1JYNA 3K4JA 1DLLA 3D5RC 4ES9A 1ND3B 4F92B 3SFZA 1JYWA 1XSXA 2RDQA 1RUE2 1J9IA 1IKPA 2XJPA 4D7NA 3V64A 1H8TA 5JVTA 4LIVA 4JKKA 4RGUA 2W48A 4RAGA 1V5GA 3AYAA 1W3VA 3HSRA 1FYUA 4AVZA 1Q8QA 4IHWA 5D8KB 3GMEA 4YW1A 5B1BH 4CEYC 1U8BA 2R7XA 3HOVJ 1W36C 5L9RA 1PHMA 2BOLA 4KFCA 4EMSA 2HWF1 2VUMJ 2L2OA 4OHWA 3EHKA 4RGRA 1NHAA 1YRNA 1SANA 4JOMA 5LEJA 4FPHA 5KR7A 1LAJA 4KWUA 3IIIA 2ZMKA 4GGGA 2DBIA 4E4SA 4UI9L 2W4SA 5A1LA 1FBQA 1WD3A 4LLOA 2XGDA 2QDNA 1ZQ3P 1QJEA 3FUOA 3SXYA 4FPLA 1GZCA 1U5TA 2UXNA 1XDSA 4M3CF 3MKLA 4XN3A 1H0BA 3DN7A 2PJPA 4QKNA 5C4WB 2LS6A 1SCSA 3RMXA 2EIKH 4PZJA 1S0CA 2P17A 5IVFA 3FXOA 2SLIA 4QX7A 3NJZA 1LOEA 4E4HA 2UWCA 2M9HA 2JDYA 1ETXA 4A7KA 1QDOA 3H7YA 3INAA 5HVQC 3ZYRA 2B4KA 3V4GA 3JTHA 2W00A 1M4WA 5KXCA 4KG8A 2YUEA 5LLQA 1U8RA 2E1OA 2CFOA 5TJJA 1GT0C 3RVHA 5E3OA 3CZJA 1GP5A 3D5LA 3LSJA 3I9V2 3V8JA 2OZ6A 2GA1A 2V73A 2WWSA 2DCEA 1LR5A 1Q1HA 4GYGA 4M6VA 4QMAA 1V5EA 1KS4A 1D5VA 2RVAA 3J8F2 3NKTA 3POIA 4FFFA 5G04L 2E53A 1ZG3A 4WZCA 1SFKA 5FZ1A 4EV0A 3IT8A 4AWDA 3IBMA 2ZB9A 5ABJC 2GNMA 1OCTC 2HTJA 5B5EC 4DUXA 3OYIA 1S0EA 3CLQA 2DFCA 4FISA 4CCJA 3PMEA 4HX7A 4DMIA 4ITCA 2G7HA 2IFWA 4EWEA 4XPVA 3D1NI 4YFNF 2B9SA 2VVFA 2FOKA 2XL7A 1L7RA 1SD4A 1TWAJ 1MMDA 4KIBA 2JG8B 3KIOA 2B7YA 4AE2A 2BVMA 1WCUA 2ID4A 4N7UA 3U0ZA 2V1DA 1WCQA 1KGSA 4WVMA 4FAHA 1LGCA 2XQRA 2C9KA 4Y33A 5KNLA 4L5JA 2A3YA 4YGCA 2ZNZA 4W1UA 2H8RA 4Z2WA 3EJKA 1H4GA 1J7KA 2KD7A 3TB0A 3J7NA 5J48A 3MEPA 2ZJ2A 1ZG1A 1LOGA 2D7FA 1BK1A 4Q8KA 3ZM8A 1OPMA 1QNTA 1RUI3 1RTVA 2MEV1 1TT0A 3WHCA 4BOWA 5BNNA 5EGOA 4K1ZA 2Y6HA 3ABKH 3CCYA 3ELNA 4QKDA 5DAVA 5HCAA 1IAWA 3JREA 3HZJA 5E3MA 5BXXA 5JI9A 2GMPA 2WZR3 4IQ4A 4GH4B 2AO9A 1FX7A 1QJZA 1OQYA 3CUOA 2O8OA 2VW1A 5HDGA 2GC0A 3PTYA 1CZTA 2L7MP 5CFCB 2XBO1 3CJIB 3OJBA 4MGIE 3OF1A 3MIHA 3ASOH 3MIFA 2MYSA 4R52A 1F1ZA 4NIIA 3IN9A 6PAXA 4Z92B 5DG2A 3K3OA 2P3IA 4QLCU 4HX4A 3LFIA 1KDMA 4HONA 4YW3A 2G9WA 4ENMA 4FTHA 2EWNA 4DOZA 4PCRA 2OQ7A 1KGYA 1HRI3 1W9SA 1VALA 5I0SA 1F4AA 2JA6J 2RS31 1BVVA 4XXPA 2Z79A 1Z0HA 2R0HA 4I0BA 4RGXA 2COMA 1DIWA 4MH0E 1PVEA 1RUG2 4N43A 1QVUA 3M70A 1XNBA 5GP9A 4FQGA 2DLLA 2P6SA 2DDUA 2BPA2 1R4MB 2DQLA 3EYPA 5I0RA 2ECCA 3AP5A 2KJBA 4CDUA 2PLYA 2Y9ZA 3PUIA 1ORKA 2ZZQA 3E6MA 5APAA 2GN7A 3LQCA 1VAVA 2QQKA 4LKFA 1C28A 4E2QA 4MVTA 3GFLA 3IAM2 3GCMA 4ESFA 3SITA 3OGJA 4JKMA 3I3EA 1DQ0A 3A0KA 4E70A 5FYZA 2PAKA 2WBMA 3A2KA 4LHLA 1YIOA 3H5RA 1OA4A 3WY6A 3JQXA 2NPIA 3RI8A 2E33A 1EAH3 2VQUA 3O14A 2QQ8A 3GJAA 2BEOA 2BZTA 1B35A 3SZTA 4WWCA 4ETSA 5ED4A 4YRVA 4RB3C 2PA7A 4BJTA 1CESA 1SD6A 5FXWA 2EIMH 3VKNA 1COV2 4Y1VA 3FDYA 3JRHA 1HLVA 4NHLA 3K4KA 2VMFA 4K7JA 4EGZA 1O4TA 3GZEA 4HF2A 3HQXA 2OA4A 3KP3A 3ZXGA 4OAYA 3MIBA 4BL0B 3N9QA 4FQ4A 2OU2A 4ENNA 5GPAA 1ZHFA 1ACIA 2JD4A 1R1A3 2ERFA 5FZ3A 2D6LX 4CDQA 3ECOA 1IS5A 2EFNA 4XUTA 2O61A 2ZACA 2HLEA 1GWMA 1VBC3 3M3OA 1M1EB 2LKSA 2VT2A 5A6XA 1LEMA 1XYOA 1LOBA 1WSUA 1SFUA 5FREA 2YPRA 2CSGA 3HJRA 4RAYA 3VUOA 4N4NB 2YDEA 3FISA 2JTVA 3OD0A 4BHPA 2NS7A 2QSGX 1XPXA 5LA0A 3NWTA 1Z05A 4KUMA 3ZLIA 3QH6A 4QKFA 4OMYA 2ZMLA 4H3WA 2KMUA 3SKVA 5FKNA 1MEC1 3K2ZA 3WU0A 5IK8A 1JMUB 3CP2A 3WF1A 1WMXA 2ELHA 3WDVA 1E2XA 5H2FC 3Q3SA 3ZSJA 3RWNA 4JCKA 4XRFA 1VE0A 5LW9A 5T55A 4BQ1A 1XX5A 3M3YJ 2BXZA 4ES8A 2IXSA 5CVIA 4MGSA 3OGGA 3H9JA 2GH2A 1MACA 4Y15A 2WS91 2B46X 2K5CA 3TO7A 1GHCA 2BOJA 3J4UH 3LZZA 2FBKA 1AL22 4HMZA 1W5CC 2EV0A 4YNIA 1R71A 5L3GA 3K2OA 3KFWX 2WV1A 2ZABA 4DOUA 4ZYAA 1VI0A 4DPNA 4UOJA 4FSJA 2OQ6A 5ICCA 4A2UA 2IXKA 4HNUA 1SBDA 3SCGA 1A8MA 4YW5A 1QQIA 1D1AA 3B00A 1H9TA 3ZFEC 1AR83 5J8FA 4RD7A 1BEV3 3MIGA 1VQOI 3O1PA 2FDFA 2ZJRF 2WLQA 2VPRA 4GKYA 3LSKA 3T1MA 4MO3M 3W2WA 3THPA 1JGSA 5J98B 1UYYA 5T50A 2M8EA 3ETQA 1BBT1 2PXJA 2VE1A 3WP5A 3GEZA 4AQ6A 2Y6KA 1DBNA 2YC2A 2DYCA 4HEA2 3RSJA 2EZKA 3ACFA 4YG0A 1POV1 1ENSA 4AI9A 2Z2SB 3HUGB 5A3PA 4HF1A 2XV4S 3IPVA 1X3WB 1LODA 2CQQA 4G6TB 2IBDA 3CJXA 2X6WA 1XN7A 2L9NA 4XABA 4G6DA 3OY8B 2DTYA 2IRFG 2O5RA 2K4JA 4EQQA 2XAHA 2NP0A 1P8JA 4OI0A 4NUBA 2HWF3 4MADA 3WW1A 4LHSA 2GM4A 1PVC2 1KYZA 1JOJA 1Z9CA 3BG3A 1F9NA 3GO5A 1VBE2 5JOXA 4BQ2A 2GMEA 1DQUA 2NVYJ 3O1OA 4IPAA 3S5AA 1ZBA1 3HB9A 5J7MA 1FP2A 5FKBA 1QHDA 2JDMA 1JJ8C 2HVRA 2V09A 1IGOA 1PO21 4U0VA 1R082 1AWCA 1S2BA 3ZOBA 4AQ2A 3M3QA 3DPRA 4EJWA 4BMEA 3HG9A 3L2QA 1LKXA 4CO8A 4Q0SA 2W46A 3L9FA 3KV9A 2Y6LA 5JOZA 1JXSA 3WU2C 2WDBA 5JLWA 1CF7A 1Y0NA 3CJQB 1VAKA 5CG9A 4YGDA 3OSDA 1SFEA 3PUSA 2VZRA 1ZH5A 1BYHA 1OH3A 2MH9A 5LGTA 2DVBA 1GZWA 1KQRA 1TQMA 3VB2A 1DGLA 1EKEA 2ORZA 3HGYA 1QNYA 4BQOA 1GOGA 3WDTA 3DEEA 2STTA 5GLWA 4NIGA 2R7DA 1G8WA 3HNYM 4LE3A 3J7HA 3A0BC 2GMMA 3OSFA 4QHBA 1OR7C 2NVQJ 4D3WA 4LHKA 4Z2YA 5JXHA 3GUDA 1RNLA 2P34A 3MW3A 3KYLA 2Y0IA 1FOWA 3OEBA 4IRIA 1F35A 2WT1A 4B48A 2UWBA 2Y26A 1X8MA 1PMHX 5D21A 2MBFA 3OS2A 5K5OA 2IA2A 5EZHA 2VZ3A 2VCMA 2M7BA 2KZGA 2DJIA 2WLPA 4AIJA 2R4GA 4LMFA 4O61A 4JQTA 2BV6A 5IJRA 1JJ6C 4WXDA 5F39A 4IEJA 3V7SA 2A5ZA 2P3KA 2GU9A 4LITA 4GCVA 2FUG2 1CAXB 4DY5A 1A31A 3WE3A 4OHVA 4HAMA 3GM8A 1ASJ2 3IC7A 1S7EA 4EJTA 5L3DA 1LE8A 1NCQA 3ESWB 1HQWA 3VDCA 5L36A 2XSJC 5BNGA 2H94A 4AF9A 4UUVA 2BGPA 5IYCJ 4HN0A 2YU1A 2GC3A 3ZXJA 2D98A 1C8M2 4Y24A 3VL8A 3U4SA 1MBKA 1R00A 2JECA 2MEV3 2EIBA 1VBA2 4WVWA 1S4CA 1CAUB 4FXKB 5H20A 2WL1A 4FOVA 4YVSB 5HV4A 3J80Z 3VBFC 3ILNA 4RL7A 1RUNA 1ACCA 4XNFA 2RDNA 4BE0A 3SZGA 1RB8G 3ASNH 2A70A 5D8AB 2BBAA 3A01B 2EZIA 4E8DA 3IDCB 5LGUA 5JMCA 4GWNA 5J1XA 4NPMA 2XBO3 1E5SA 1JBCA 2L4AA 4DXZA 5I8TA 4OOIA 5IVYA 1XC6A 4CDXA 1PNFA 4Z82A 2CS3A 3BODA 3VHOA 5DCMA 3HPHA 5AC91 4GB31 1GP4A 4H14A 1B8IB 4OFGA 2RS33 5EJCA 2DFIA 3PNTA 4HLXA 3TOJA 2HWC2 1BIAA 3H0OA 1BKZA 1W8NA 5CLSA 4NIDA 4XBQA 3PO2J 1OLRA 3KVBA 4QGMA 5K1YA 3USUA 1AR62 4I2OA 3SFIA 2LNBA 5FP9A 3S1MJ 2D43A 5JZGB 2EZHA 2LMDA 1WMDA 1REFA 2Q0AA 3AJYA 4YW7A 3K6GA 2PHRA 3L2CA 3I2HA 1IG0A 3P5BA 2ETHA 1LEDA 2F4OB 2R32A 3A21A 3W2AA 1NA1C 1BL0A 2Q0OA 5GLVA 1YXWA 2JEMA 4EROA 2AH2A 1BVP1 4CU8A 1J58A 4YG3A 1WW6A 3V0BB 4KG0A 1OLME 5ILVA 4AI8A 3MYXA 1C4RA 3HRTA 1TNTA 3EUHC 3ZCOA 1ULPA 4O9EA 1NH3A 5GPCA 1FNYA 1J3RA 1FOD2 2ZHMA 2X6XA 1W05A 3K2AA 4ZDLA 2D6KA 4QPIB 4BAYA 2GALA 1WA4A 1YQ2A 5L3FA 3HM5A 1AF9A 1WVRA 2XG3A 3JD71 5F2WA 3HPNA 3TEWA 3VBSA 3NARA 4W4ZA 4BLIA 3I2DA 1MH3A 1OUXA 3FX3A 3BR6A 5DDGA 1QDCA 4SLIA 3U1XA 5IP6A 1K6YA 3ZXAC 3ES1A 2X5IA 4LMYA 4Y4YA 3RYKA 1QJX2 2DYSH 4LJZF 2BRTA 3DLLF 1PVXA 4KU8A 5J4VA 3WU1B 1GNYA 3HNBM 2K7LA 2WNVC 1FNZA 4WV8A 1SFPA 1VLNA 4OZXA 2Y0SN 4DEVA 5IT6A 1OKOA 2WY7Q 3ZR5A 4YSFA 1CAWA 1QXRA 5E8GA 3TW6A 2WO2A 1GXPA 3WHTA 1BW6A 3ZR6A 4XFGA 4GKXA 3AXEA 2VOPA 2A7AA 4D5FA 3KCYA 2JRTA 3LNQA 2VVEA 2DBBA 5IFPA 2COBA 4D94A 4ZZ5A 1CPMA 2JKBA 4B4PA 1FOKA 4XQ4A 3WGHA 1HQNA 1MS8A 2YU9J 1H8TC 5CKNA 2DU1A 5HLGA 1JTYA 1OA3A 4UFIA 1MEC3 1FT9A 5BMZA 1MS9A 2EF6A 1GOFA 5JI7A 2ORXA 4OULA 1PP8F 1H2KA 1YEWA 3WG9A 4EZHA 2W2IA 1QHHD 1AX1A 2D44A 4GZ9A 3FBMA 2DTWA 4C8DA 2GOXB 5HODA 3BN6A 4A93J 3ZR8X 1QH6A 1Q8VA 2WS93 2W08A 1H1MA 4NHYA 4BB3A 1JYTA 1U5TC 1QJY2 1TTYA 4YIFA 1YW9A 1G9AA 4RBOA 1CQ9A 1DDLA 3J80K 4BWOA 1IN4A 2QQNA 4IV1A 4IVNA 1W6QB 1LOCA 4XLPF 1E3HA 2ZX1A 1U9NA 3HHHA 2ZMEC 1YIPA 1FNNA 5FZFA 1EJ9A 3RPUD 1ONAA 3SQNA 2O14A 4JBAA 2QQJA 4AWXB 5DQ0A 4AHYA 5GALA 4Y22B 5IAXA 4GQ7A 3QCWA 4QQ2A 3OPTA 4WBBA 2YU2A 4PF1A 5DDJ1 4M9XA 3W6KB 4LOCA 2QQIA 4M0HA 3DKWA 1XNDA 4MXWA 5KXEA 1LECA 1GQGA 5JLVA 3VD3A 2CW7A 2VOVA 3UV9A 1OVPA 2K9LA 2VBXA 4DBRA 2Q2EA 4QX8A 1X50A 4KNCA 1RMU1 3I59B 3HC7A 1BBT3 4JTNA 1W39A 4QQHA 3ECQA 2W84A 3GHNA 3K9TA 4KQ7A 2KQRA 1W7PD 4DXTA 4LUKA 1WMEA 5BNQA 3KCCA 1NCRA 1POV3 1LHUA 3BQYA 4A3IJ 2VXRA 1AYM2 2P1BA 4CCOA 2VZTA 1T98A 5LBCA 2GDFA 3J7MA 3K46A 1DFQA 2KIUA 5IFTA 5KHJA 4J6GA 2WFF2 1LHOA 2Z16A 2R30A 1X1DA 4BE1A 4XQWA 2UY8A 2DURA 1YLLA 1ZM1A 5ISLA 1QPIA 2ADEA 4IX7A 3WODF 4PF5A 4A0YA 1WBLA 4L2NA 2JICA 3TNPB 4N7IA 3R4UA 3BTIA 4YM0A 2NOGA 2VCBA 1A34A 4BBSJ 1W6OB 3VYTB 4UBGA 4XMIA 4QPWA 4HF0A 3TDUC 1V6NA 1ZBA3 5J3UA 5T5OA 1X33A 3TOAA 2A3WA 3ABMH 1UQXA 4NHMA 2KRFA 1PO23 4RFT0 2M7AA 4M73A 1Z78A 4BXSV 2Z33A 1O3QA 4YM1A 1WKYA 2RJLA 1RUH1 4IQPA 1W6MA 1X19A 5F5AA 4U0WA 1S72I 2KDZA 5GJ6A 5FKCA 1TLHB 2UWAA 4CDWC 5JLXA 1QKQA 5A3UA 3VYUB 2GC2A 2XVKA 2V9VA 4K8RB 1YI2I 1R7JA 5BNNC 4AAXA 3FLTA 3HSEA 1E3PA 1SMYF 3POSA 4N4OB 3FK6A 4V2GA 4RLFA 5HLHA 1JTZX 2DCYA 2XAFA 1H0MA 3N4MA 5C8CA 2JK3A 4PDWC 2DCTA 4LG0B 3MF6A 1QF3A 1XYNA 4I0WB 2R061 4XIKA 4XUQA 5A6ZA 5FZ4A 5F8PA 5A80A 4LGWA 2NYYA 3S17J 2PJRB 2HXOA 3K48A 1MBFA 3D5SC 2IS2A 4WM7C 2QQOA 3RJPA 3LOIA 1FMD2 3ZXSA 2R7TA 1K78B 3V7CA 1MMSA 1G3SA 4CEYB 2VJ5A 1KRIA 5JHFA 3Q0WA 5FKMA 1REPC 2XLGA 2R0FA 1NUKA 1H30A 5M5YJ 1X9PA 1VBD2 1G8XA 3O12A 3HN3A 4HLTA 4A3DJ 3VN4A 2RVCA 3GBGA 2KIQA 2Z1DA 3CF6E 3Q8AA 3RZLA 3T0BA 2GA2A 3CUQC 4DZJA 1ZBE2 4YFKF 3ZGKA 1JYIA 5F27A 5A7PA 4CDUC 1AU7A 2TNFA 3F8MA 3ZQLA 5F64A 4M3CA 2AYHA 4QT6A 1W2AX 1IKQA 3F9KA 3KZYA 4EATA 1QQP2 5A32A 3BOWA 2WAQA 4JAAA 3MFAA 2YPDA 3V42A 2AR6A 3LA2A 1PX3A 4Y26A 4HA8A 5A7SA 2A6ZA 5HDNA 1MBEA 5IVVA 3BTCA 3PIGA 2FE3A 3RPQA 4Q48A 3KB5A 4IEYA 4HFSA 5A7NA 1WFXA 3S3NA 2VASA 5FR3A 5FRMA 4KN4X 2ESNA 3UK9A 2OXBA 1IDZA 2DT7B 1ZRFA 4FOQA 1W6NB 1VQ8I 3T5XA 2E1MC 5J1UA 4Q0QA 2HFHA 4UFHA 3CO7C 1DYKA 3PSFA 4G6QA 4EM1A 1QZYA 4XURA 4AD9A 2R071 2VL4A 4JGZB 2VMEA 5KHHA 2QCSB 4S05A 3WTVC 4RS5A 5F6LB 5DZFA 1OF3A 2UXXA 2XVLA 4YIIA 4I98B 2W1QA 4KYWA 1HXS2 4RHV2 2R6QA 2JE8A 3JSOA 4KGGA 1LU1A 4KMUX 2FCTA 4MX3A 2WT2A 4HOBA 1LVAA 4F3QA 2VCCA 5ABJB 4IEXA 5ILUA 3NW4A 2NNYA 4HVRA 3UKTA 1LKNA 2ICWG 4Q2FA 1ULCA 1Q1VA 3THCA 5CU1A 4PIYA 4E6KG 2LLKA 2FD5A 1V5FA 2L4MA 5AC93 4GB33 1CIWA 2ZX4A 1VJ2A 3UETA 1FPQA 5LK5A 2VH9A 2V26A 3VDXA 2IXLA 3VWBA 3VDDA 3R6SA 2RHPA 3UNGC 1O3TA 4BQ5A 1C5IA 5D8LB 3CCJI 3AMHA 5F9TA 5FKLA 2XJVA 1STMA 3UGGA 3AL0C 3Q8FA 5FYBA 2ZTNA 3AFHA 3K69A 2EZLA 1UY1A 2M2EA 1WJDA 1Q43A 3DYOA 1OD3A 3GTMJ 1WW5A 3W2VA 1MDMB 2J1AA 1EV12 2JVHA 3SKJE 3BWGA 1QZZA 3U4XA 4XKVA 1L3JA 5B4NA 3HKZN 5FB2A 2OJED 4UFMA 4ZXEA 2UZKA 4PDKA 1Y9MA 2JB8A 3I2GA 4P9JA 2VW2A 1MNMC 3G6EI 2NXNB 9ANTA 1G9CA 2M87A 1FV2A 1BQPA 1FYMA 3MGUA 3VGIA 1V6KA 4IRHA 2DMUA 3T30A 3WVJA 4Y3OA 1UG0A 1R1VA 4ANJA 5FRNA 3JD73 2NN8A 1B72A 3KP5A 2HYGD 3SLIA 3FKIJ 1SAXA 2VO5A 3CD6I 1BMV1 3O0XA 3MFKA 2IUWA 3WEZA 3ZPOA 2M30A 3FHZA 1H89C 1J59A 3PNAA 3U11A 4QQLA 2M1BA 1FOYA 4AGVA 2ZZJA 5FBJA 4GRIA 2W3JA 3NWKA 4LA2A 4YW4A 2QBYB 1NY71 4M3FA 2IZWA 1ZR4A 5LY1A 2HWD2 1F4KA 2PG4A 4XACA 1NQDA 2CYFA 2GNBA 2NVTJ 5G05L 1V3FA 1KQ9A 3BB6A 1YIFA 4YG6A 5FKOA 1AJKA 4QU2A 1U2WA 4QGNA 4GDFA 4UW5A 2HPMA 1OH4A 1VP6A 1OA2A 5FOBB 4XLAA 1B35B 3K75B 2FA5A 1ND3A 3SH4A 1G86A 2CY6A 4Q4X1 2JDKA 4AOCA 3CDIA 4YFXF 3DF0A 4B47A 4COWA 1BJQA 2B5HA 1K5JA 4L9BA 2PFBA 1JOBA 2VUCA 3FLPA 2IXJA 2IP2A 4F52A 1OUSA 3WQ7A 3ZYIB 3B5LB 2OS2A 5A3NA 2KT0A 3LAJA 4MIMA 3U10A 3E3VA 3H0GJ 4Q1PA 1MZEA 5IYBJ 3H8UA 2VW0A 2W82A 5KVRA 2DDAA 1FSEA 3AM2A 2V1NA 3J7ZI 1YFWA 5JDBA 2QUFA 2IT0A 2PMZN 2IS6A 4D1QA 1W5TA 3F0CA 2CW0F 1AKHA 1J1LA 4PJ0C 1TMF1 1X1CA 3M8LA 2HYKA 3HJEA 1ETWA 5C4WA 3O1TA 4LE4A 2PN5A 4R9CA 3W59A 1I1EA 1Y8QB 3BPXA 1FWZA 2R5YB 2XXZA 2Z4FA 4K40A 5KAIC 3WSOA 3TEYA 2A5WA 4GWJA 4K20A 1W8HA 2A6TA 3NV3A 3C7GA 2K0GA 4L92A 2P3JA 4GJYA 3WXPA 2R7OA 2HBTA 4Y5TA 1USSA 3KGZA 5E88A 1UZCA 3OCPA 5B66C 5T5LA 1RUJ2 1MBJA 2RR12 2VMGA 4QXCA 4HVOA 5DDJ3 3CMYA 3VD5A 5FLXZ 1PIV1 3KV4A 3VHNA 3OYWB 5FLJA 3NMBA 4K6BA 2VTXJ 1K4TA 4OIPF 1TQ5A 4WM8C 1S1AA 2K85A 3OPZA 3DGTA 1RMU3 1QVTA 1XGOA 2XB5A 4OYUA 1VBB1 4G94A 2LF8A 5DMYA 4ARYA 5DUUA 2OPWA 1EV7A 1IC8A 1MS1A 1W0TA 5E1RA 2PI0A 3GF6A 4BZ4A 5C8WA 1P6RA 3M9AA 3ZP5A 1GZ9A 2Q8CA 1POV0 1JZ4A 4XDOA 4AI1A 2HS5A 4XJAA 3GTPJ 4L0YB 3WR0A 5CKMA 3BJAA 2FJ1A 4HVQA 2JG8A 3CP8A 4II3A 2BQPA 4O65A 4GXOA 1W9FA 5C3SA 1NKGA 1K83J 4NHKA 4RB0A 2EPFA 1OOPC 4V1PA 1WRJA 3FXJA 4N0BA 2FDJA 5L3BA 4PLNA 2XAGA 3AZWA 2EALA 1HDKA 5KHDA 2CDPA 2BY2A 2CWEA 2C4XA 2ZKNA 5CYYA 4IEWA 3KF5A 2VZPA 1GV9A 3I4NJ 3JBG1 3JU9A 2IJLA 4LD5A 3L2HA 1IW7F 3G1MA 4P9FA 4II2A 4I99C 1OT5A 3C7FA 1WGXA 2K3FA 1RETA 2XAUA 5E3LA 1RUH3 1QWRA 2FDKA 1LDKB 4OUMA 5FZMA 3DECA 2ADUA 4X0GA 1WKMA 4G7OF 2CWMA 5D5UB 2Y33A 1KDKA 3ZFFA 4GH4A 3ZFEB 1CONA 3M1EA 1LHVA 5BS6A 1NG0A 3VBHB 2VOWA 3AMNA 5CFCA 4XOGA 3CJIA 3Q8EA 1XMKA 3OR2C 2NRAC 4CUAA 1ZGJA 1G7YA 4M71A 1ZG5A 4J1WA 2VQTA 2X6OA 3GZUC 1T39A 2D2WA 4IQJA 1XRUA 2JSPA 1IRFA 3BT9A 2R063 1RIOH 4AGRA 3S15J 3OIOA 2V4JC 1O5LA 5IT9Z 2JMWA 2VBZA 3E6BA 5DTDA 4CDXC 4CPBA 4JDOA 1WPKA 2Y75A 5FQ0B 3PL8A 4XFAA 1RKWA 4A42A 2RG4A 2YSRA 5HXVA 3NWSA 1ULEA 4UVCA 5J47A 5H6QA 3IL2A 4EWAA 3WNNA 2RDSA 3M2MA 1IZ1A 5DZGA 2WBKA 3NNLA 1RUC1 1R64A 3CLPA 3HOZJ 2E63A 3ZYBA 3WV6A 5FFZA 1FSHA 2W95A 2V9PA 1KEXA 3CCLI 3DTIA 4UT5A 5D5WB 4KMFA 2KISA 1IPJA 4O5VA 3BG5A 3TQNA 2PN6A 3J81Z 4DZPA 5FP8A 2XLAA 1UX6A 1MBGA 5JR2A 1W8OA 1WJAA 2VVDA 2FU4A 1LOFC 1GXQA 1D0GA 5HS8A 1W04A 3ZMZA 3ALQA 2ILMA 1LENA 2P5KA 3OL3A 5D1IA 2Y0OA 1AX0A 2CWSA 4IUGA 1STZA 3M4OJ 5LY2A 3AXDA 1UZYA 1J09A 1RUI2 4UVAA 2WC2A 1R5ID 1S0FA 1MKMA 3KM5A 1UPSA 3WF2A 4GALA 3IHUA 4MO7A 2L54A 2VE8A 1SZBA 1YCIA 1E17A 3FXRA 2Z69A 4YGBA 2DJNA 2B8MA 3WZ1A 4CA9A 2LBFA 2E60A 5FZAA 3VBSC 2A6WA 4LEJA 3KHCA 1OJLA 4RAFA 1ND2B 1WCDJ 4DRVA 2R073 2G7UA 1QXJA 5FYSA 3D82A 4BISA 2ZGPA 1D5YA 3EYIA 4Q27A 3WCRA 5A2QZ 5A7OA 4FE7A 4IEQA 2KHMA 1IQDC 1XG1A 3M1CA 1HRI2 4MHGA 3KS7A 2DA6A 5EEAA 3I49A 3TYJA 2ZCWA 2QLZA 4LLLA 2DMQA 4QKBA 3RYRA 4NJ4A 4CXXA 1HQLA 5AONA 3P9KA 4XW3A 2VJ4A 3ZMUA 3ECHA 1S2EA 1D7PM 3OYBA 1YW7A 4XYXA 1XPWA 3IAQA 1JHHA 3TBDA 3ETPA 4FPKA 2ME6A 1TME2 3OYKA 3MW2A 4GYIA 4UUTA 1D4M1 3C2BA 3JRIA 2BGOA 1NZIA 1S0JA 1TWHJ 3N3HA 4B44A 4JHZA 4TV7A 2L3DA 2VQHA 1I5PA 3LMMA 2VODA 1DGRA 2ZHKA 2E31A 4QHOA 1VIWB 5D4RA 2DUPA 1WLCA 2MNGA 1DZRA 3RI9A 3CF5F 4NWVA 2L9SA 1YIJI 2VT3A 1AL21 1SG3A 2W92A 5DXDA 2A3SA 5A33B 3MBWA 4WZFA 2O6GE 1HSJA 1UOFA 3VBFB 4HQEA 5FJHA 1OI6A 1AOYA 2Y6GA 3I3QA 1IS3A 1XOYA 2XROA 3DPUA 4OHXA 5A3MA 1DYOA 3MAJA 4A3LJ 3ES4A 1GSLA 3N7LA 2HWB1 2BU9A 3DYPA 2CJJA 3CESA 4GWMA 2E7TA 5L9BA 4OLLA 4F55A 2B39A 2DFEA 4NBQA 3RCOA 1AZDA 5D2AA 2UYBA 1YQCA 3WNPA 2JVGA 3K7AJ 4XAEA 3T2TA 4M01A 5A1FA 1X3ZB 3BIWE 1BA5A 1R1A2 3A7QA 2CGOA 3HEIA 4AI3A 3QYBA 5A1AA 4LK1F 2IS1A 1Y3TA 2PLV1 1CJPA 2VC0A 5TISC 1JUIA 3I3LA 3X29B 2EFWA 3GTOJ 4OI2A 3ACHA 4M74A 3T8TA 1VBC2 3CEWA 5CAZA 3K4AA 5KHKA 2I74A 5J09A 5E8AA 5JOYA 5JFRA 3HUGA 4Q4X3 1B9MA 3CMMA 2MG4A 2VOOA 2P8TA 2WZEA 3NNMA 2P5BA 3LIGA 4FI9A 1NCRC 2FOWA 3OY8A 4BE2A 1NA1B 3S2DJ 3DKQA 1E57A 2W0XA 2CUFA 5LGNA 3BR0A 1PVC1 3J81K 2R7ZJ 1D4VB 3N7MA 3A22A 5FOJB 1VBE1 2WR9A 4O7XA 2GZWA 2M0CA 2A61A 1T56A 5JR3A 2GAUA 4M00A 2MABA 4ZU7A 5E17F 1Z91A 1ENRA 1MJBA 3B01A 2OC6A 4A4AA 2DCJA 4Y52J 4B7EA 5FYIA 1FJLA 5FYHA 2QQPA 1TMF3 5EJ1B 3S8PA 1LFUP 2IXCA 3ZMDA 2DMTA 5AIQA 2W7NA 5IK7A 4DBQA 4NQWB 5EEGA 3TP0A 5LFAA 4FPYA 2M45A 3OBTA 2DDBA 4LORA 2JDUA 1V70A 3B3QE 3O1SA 4BUPA 1MVQA 4NIAA 3KZZA 3H9QA 3ERMA 3D5OA 1IG7A 2B45X 3HOYJ 4HNTA 4XOPA 3VKOA 3HOWJ 2WNVB 2BFUS 2VJXA 5EJ3A 3EMRA 2F4MB 2I45A 3J26N 4HT1T 4XLEA 1BEV2 1PMIA 2H0VA 3O6BB 2VE9A 1PIV3 4CCDA 1VR3A 1FATA 3LPGA 2ZHLA 3A4CA 2L5QA 4S2FA 2K9ZA 1H9GA 3NQHA 4G8XA 2TBVA 4MGQA 3ZN1A 3WUCA 5C8CC 3O0VA 3ROUA 1YS6A 5JSPA 4RDUA 1VBB3 3I4IA 4GIQA 1QY4A 4OUEA 1U5XA 4QPGC 2TCTA 2RAEA 1CIYA 5I0UA 2NM1A 3WHBA 1X2NA 2VZOA 3WTWC 4JP0A 2WV0A 5C44J 1OMIA 1S0GA 5FZEA 4JDMA 3ZN4A 3KYDB 4IJAA 3U07A 3AMMA 1W8ZA 4EN6B 1WCKA 3N7KA 4RGKA 3MDPA 4RLQA 1JT6A 2ZSIB 3KEYA 5B2GB 3B9IA 3HT1A 4EM2A 2HWF2 1CAXA 4MEYF 2WWUA 3C2HA 3R61A 2L7KA 1UN1A 2Q2EB 1X8EA 1AA7A 2P7VB 4PGHA 1U78A 3OYDA 3KGLA 2DPDA 4Y13A 3BTYA 3K4BA 4Y7NJ 2FCUA 5FO9B 5C7GA 2F5FA 5E6HA 3V8LA 4LO4B 1OF4A 1IUYA 2DO7A 1TNRA 3NVCA 4YGEA 1C8M1 5F6FA 1IN8A 1WI3A 2CSOA 4C2MJ 1YRZA 4HOOA 1VQ5I 3JBG3 2JZYA 2YBPA 4RM3A 2ZMEB 2XMLA 1EYBA 3NL1A 3KHBA 3GNEA 3HBKA 1CAUA 1SLTA 2EXHA 2AEYA 2EXKA 4YVSA 1BI0A 5K4LA 2DK5A 2RGVA 2CHHA 2ZXHA 4INDA 2OPTA 1GU3A 3K70D 1ZRRA 2JXAA 1P9QC 5DEQA 2XIGA 4D69A 3CCVI 5ANQA 5D8AA 3A01A 4JQRA 4TWTA 2HOAA 1QEXA 4XM3A 4BY1J 1RJ8A 2JG9B 2FF4A 3HT2A 3VZLA 4BS9A 3AZYA 5HOOA 4FPEA 4YARA 3LSHA 1X7NA 3VBOB 3DU5A 5ERIA 5C3OA 2H1LA 2N7GA 4A5MA 1O3SA 1D2QA 3OB8A 2P6TA 1RR7A 4M9ZA 1B8IA 1ZX5A 3S6PA 2VKDA 4AXOA 2HWC1 1GOHA 4N53C 4TLGA 2EAAA 2YG0A 2PAEA 3M3CA 2JSCA 1HX6A 3N35A 4IV3C 3DUIA 2KIMA 2WQ8A 5T52A 1ODMA 3T8RA 3FMQA 4KIFA 4LLGF 2J1SA 5FLVA 4RN5A 2Z9OA 2G0EA 1V0AA 5JZGA 1JKPC 3G4SI 4FXGB 3VDDC 3VBRC 5FWJA 2WY8Q 1RUC3 2LR8A 1K6OA 1VQ6I 2JIGA 1B59A 2IAIA 2RN7A 5FP3A 2W24A 4X6QB 5EHDA 2XGXA 2HYXA 2VJJA 3IIAA 5F5IA 2W91A 4X6AJ 4HPKA 3M8FA 5FY7A 1PO11 2L9LA 3V0AB 4WXCA 4AUXA 1WJEA 1ZN2A 3V0BA 3K1NA 2J1RA 1FC3A 4P9UA 5L19A 3HNMA 2F5VA 1ERDA 3M8EA 3F8BA 2VMHA 2NQYA 1F5TA 3OBRA 4Q0PA 2BNOA 1OHFA 3HMYA 4HSTA 1RESA 4PSXA 5L7OC 1FOD1 4HBNA 3POGA 1BI1A 1SD5A 4P14A 4QPIA 4XC9A 1JT0A 4MGYE 3IKVA 2VKHA 3QOEA 3GVAA 3K4LA 4ABZA 5JSOA 1T0FC 5BNOB 2BNMA 3V56A 1E5HA 1BBYA 4ZDPA 1H2LA 5CISA 4NO4A 2VQCA 5LRSA 4KITB 4G9YA 1SLCA 3F95A 1A8DA 5FZBA 4PDWB 3AJZA 4AL9A 2GH8A 3N97A 4XTMA 2QE3A 1AVBA 1LU2A 2AXLA 4YFWA 5C3QA 2ZAAA 1OQEA 2H1KA 4A3BJ 4NMIA 4XL9A 3W5NA 3LB9A 3E1SA 2KIFA 3AKPA 4WM7B 1FXZA 3LDKA 3WDYA 5A6QA 1XU2A 3T08A 3EETA 3W21A 2C1FA 3NV1A 2EICA 3PU8A 3ZN6B 3WF0A 3L2VA 1QH7A 4QPYA 1W8FA 3NKGA 1Q8OA 4BDVB 2XUBA 4BM8A 5BUVA 3LSGA 1O7LA 3PVOA 1T6SA 1P92A 3POFA 3PIJA 1SDWA 2CG4A 5GAEJ 4F3JA 3ZPYA 1W0NA 4MNUA 1B1BA 4PI0A 3OYAA 5EZWA 1YJWI 4FPJA 3CUQB 3WNOA 4KL1A 2GXAA 2YS9A 4BU2A 1I3HA 2LSOA 1VQ7I 2WSUA 1NE6A 4DFSA 4XRSA 2R7UA 4NN0A 1BOAA 2WFPA 2XGEA 4KBBA 3I3MA 5D6FA 4V2FA 3R4KA 4I0AA 3EBRA 2EXJA 3T3YA 1D4M3 5JPNB 3C3WA 3H1WA 2LH9A 5C3RA 3ME2A 2D5VA 1SLIA 1IJWC 2YMZA 1K45A 4XUNA 1XB9A 1K12A 2WWYA 2FX0A 3OOPA 5FUIA 1SLBA 2DMNA 4Y1YA 2BGCA 4EYUA 2ZFUA 4QXBA 4Y1ZA 2MLKA 3S14J 1AL23 2TEPA 1GNZA 1T6GC 4B3NA 3K3NA 2DTZA 2VBPA 3L1PA 4XSXF 2IGMA 3LKJA 5CFDB 2D1VA 4ZKTB 1W6QA 2K9NA 1D2SA 3MVPA 5ILSA 3QPTA 4A3ZA 2HQ5A 4LT5A 4Y22A 4HPQA 2DFFA 2UU8A 3A4UA 4H4KC 2JT1A 2BVVA 5CQEA 2HWB3 4EEFG 2WN3A 1MD0A 1RRJA 3T0DA 3OG2A 4JTOA 2OF7A 2M34A 1RI7A 3SQOA 1RXFA 3DEMA 1YJLA 2DPUA 1N77A 4HRIA 4CH7A 1O6UA 3CJTB 5E1XA 4LBJA 5LK7B 1Z7UA 3OMYA 3Q5FA 3L2RA 4B4RA 2VOKA 3I59A 1QOOA 3JR9A 1CGPA 4LKSA 3ZPLA 5E1ZB 4A6OA 2BVBA 2PLV3 1J84A 2AZ5A 4M3DA 3I2FA 1VQ9I 2VUJA 2IC1A 2FRHA 3OYFA 5A3OA 2JKXA 2JQ7A 1HB2A 3CC7I 5B1AH 3AKSA 4Q4W2 1AYM1 2R042 2XVGA 3AK0A 1JKOC 1XGNA 2CL2A 4G3YC 3DL3A 2EB7A 3FF5A 2EIJH 5DPNA 4NPLA 1FOXA 1YO8A 3ATGA 1MW7A 2JDHA 1LNSA 5K0UB 1V54H 4OMZA 3LEGA 1R1TA 1G4DA 3RJRA 2PBIA 4AAPA 4YVWB 3REOA 2A6EF 1MEC2 1PVC3 4COUA 2JA5J 4ASNA 4ASLA 1QBJA 4DXRA 4RA2A 2JG8C 4GULA 1W6OA 2J22A 1VBE3 2WA0A 4YLZA 1D0ZA 4U88A 1E5IA 3JRFA 3WP3A 4Q5SF 3PLQA 2X48A 4H7MA 3BI3A 2O0YA 3ZQCA 3HD8B 1D0XA 1ON2A 2W85A 2WAOA 4S04A 4DNCA 5C3PA 3GJBA 3LF7A 5A7WB 3BJ6A 3H3ZA 2KZVA 4DB5A 1OYWA 2FNPA 3GLLA 2DI3A 1QJU2 5HXMA 2P37A 3H42B 1UY3A 1I6HJ 1WLTA 2OQRA 5IOZA 4BK4A 3BGAA 4PK4A 2RE9A 3BG7A 1E3OC 3RNSA 3OS1A 5CJ9A 2BOIA 4NB5A 1AYN1 1WGPA 1AKHB 1DU6A 3DPLC 4B1LA 1PK6B 4LG0A 4MQVA 4E2SA 5CFCC 3QRFF 2L01A 4BQQA 5BNPB 1NK2P 1BN5A 1K5MB 5T5JA 3ZYHA 3O5SA 4IEZA 1BBT2 2PJRA 1Z7S2 3TO6A 3DEUA 3HEFA 4LULA 2OVUA 3K0LA 1QXPA 1FMD1 1YX3A 5FZGA 3V8KA 4Z6YA 2BUKA 4XLCA 1DP0A 4QQPA 1K78A 2X9DA 2E26A 4UXAA 1NT0A 2I2SA 1UJ8A 4CEYA 4ATEA 2F5EA 1WBFA 2BVLA 5LBBA 4OUSA 4IE0A 3PIOF 4C2TA 2CNAA 2CH0A 2HXIA 3BOPA 3PU3A 4A3MJ 3F6VA 1L7QA 1RKTA 3HRSA 3CCUI 3GBWA 2ID3A 2CGPA 3K4NA 3C2GA 4LBQD 1AR91 1QQP1 4OIRF 2PAMA 1H2NA 3FMRA 2HEYF 2VXDA 3H8RA 4ZS3A 3E5UA 1BC8C 2WWJA 3VYSB 4FPGA 1URXA 3O1MA 4K8FA 2WO7A 2IXIA 1Z6TA 1PO22 3P9IA 3SNMA 3GZ5A 1N25A 3RQ4A 1C8M3 4G7HF 2KXLA 4X6RB 1MMAA 2LREA 5FZDA 1QHGA 3OL4A 4DXSA 2FBHA 1WCSA 1W6NA 5TGTA 2QYOA 4Y1UA 3LOCA 5IW0A 3EPZA 2VG9A 2V6CA 2RMU2 1TEIA 2OX0A 3TEDA 2OUMA 4A0XA 5FZ8A 1ZYRF 2LFBA 3CZUA 4JGZA 4ZZLA 1XBFA 5F3IA 2VY0A 3O1UA 1FEXA 4L5IA 2D3SA 2R1DA 2CV2A 2YR2A 4WM8B 4MZUA 5A7QA 3HWJA 4RR3B 2KM2A 4ATFA 2WJSA 1KFXL 5ABJA 1J1TA 1KJLA 4D8MA 3AVRA 4XHXA 4J25A 5JPMB 5IK4A 4IE6A 1HLCA 2PHLA 4MFEA 4JHTA 5GZFA 1FX5A 4NRQA 1SLAA 3ZQ7A 4LBNA 1HJGA 2HWC3 4PLMA 2JWPA 3ZFFB 1BK0A 2X4HA 4FPCA 4RM2A 1Z3YA 4AEDC 1XNCA 3THTA 4P9IA 3WTUC 3DEWA 4M3BA 4UW4A 3WTSC 4V19K 3R60A 1JYVA 1OOPB 3UYJA 2E2IJ 1IGNA 3P7NA 1P7IA 3K10A 1MDMA 3IMMA 1QU0A 1KA8A 4CYDA 1JOPA 1H8AC 2JA8J 2G9ZA 1R49A 2ZJCA 1DUXC 4CP2A 3HGGA 1IS6A 5E79C 1DDNA 3N05A 1PO13 2A6XA 3WHUA 4CICA 1SVMA 5F1RA 2M0MA 3BTJA 2GNDA 3K70C 3WNKA