2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CLP1
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
4NONA 2VRWA 1LB1B 5GJVC 3X1ZA 2CEAA 1R5BA 2J87A 4ZKEA 3WBJA 1JALA 2I3BA 3KTAB 4O2LA 2RCNA 3GJ0A 3T5DA 3TLXA 2EWWA 2HF9A 1FPMA 3EPLA 3H0KA 4HB3A 2R6CA 2IYSA 3EWSA 1SVLA 2QE7A 4RCYA 1E9DA 3RRZA 4MYHA 2QZ4A 3NH6A 1C9KA 1J7KA 1ZIPA 3QVUA 1DG3A 4U5XA 4A6XA 1UFQA 1TQDA 1KSGA 2ZM5A 1S9HA 2WMOB 1TQ4A 4B2IA 1D9ZA 3B9QA 1J99A 3ADKA 2BKUA 3M0EA 3OZXA 3KQLA 2J3EA 3VMFA 3P4YA 2WPDD 1LTQA 2J5XA 1E9CA 3QKRB 3VR1A 2PBRA 2H57A 3VHXA 3L82B 2AKYA 2W0MA 1E99A 4B47A 2FGKA 3MFYA 4HLDA 3PUWA 4M21A 4HAWA 4YMTA 4EQ6B 1NMYA 3CNLA 3A58B 2HT1A 3BB3A 2ZS8A 2AN9A 4C0SA 5BN4A 2WM9B 3Q85A 3CB4A 2Z0MA 5GJBA 3K9HA 3FOZA 4C0BA 1XJ0A 4DKXA 4ESVA 2D2FA 3SQXA 2A3RA 4JJKA 4AG6A 1P60A 4NCKA 3V9PA 1WCV1 5JSZB 2MSDB 1A1VA 1Z6AA 3GLHB 1KMHB 3PUYA 4WXPA 4BE7B 721PA 5E95A 4DUGD 3CKLA 3O8DA 1S0UA 1G6HA 3TUZC 3B1XA 4URXR 2CLSA 4P33A 4X8LA 1GL7A 4LBVA 2J46A 3GD7A 1CJKC 1TF5A 3P27A 2G0NA 2JLWA 2P5TB 1W46A 4BFZA 1DARA 1G8YA 1KKMA 4LCBA 5GVSA 2OCYC 4B34A 2OT3B 2H92A 4IXMA 1S3SA 2BJWA 5FUYA 121PA 1X6VA 3EASA 2PZGA 2HXSA 5EE0A 4CVNA 2R8RA 2LKDA 2IXEA 4MYTA 1MH1A 4AG5A 4L9WA 1D2MA 4GT1A 1QG2A 1ZMXA 3LY5A 2IS4A 3IEVA 1KYIA 1P75A 3GEIA 5FTNA 2JJ1D 4A2WA 5F2EA 5TVKA 1EGAA 2Q3MA 1KAGA 1MO6A 3H4MA 4RKFA 3RHFA 4F7WA 3G0HA 2AHOA 4BZPA 821PA 3QXSA 3KX2A 3BGWA 4JVNA 2FF7A 4PQRA 3T1OA 4N0DA 1KGDA 4NP6A 4PO8A 5KPDA 3B7GA 5J5CA 4ZV4A 4TLEA 4ZDWA 3TE6A 1XDBA 2JEOA 2QAGB 4LYHA 2ZRLA 4JSTA 3TW8B 4JT4A 4B75A 3WHLA 2VYFA 3CWZA 4FWTA 3R9WA 4URVR 1HYQA 3RWOA 3SC3A 3LXRA 1M74A 3W34A 3Q3JB 1OXSC 3NG1A 1R0YA 1E9AA 5FPHA 3KFXA 4P31A 1QF9A 4ZCMA 4CGZA 1YR8A 2GJSA 2QPTA 3OEHA 1FQJA 5CIWA 1H8ED 4CEIB 3W5IA 2XB4A 1W36B 3QENA 2V54A 4IOJA 2FFQA 1PVOA 4BFWA 1H8HD 1Z0KA 2DR3A 4QBGB 4D4KA 1YZUA 3CLVA 4Q47A 3AVQA 3U3JA 5FOSA 3R7WA 1WBBA 2IYQA 2ZEJA 4B71A 4C0LA 4BLPA 2E9SA 4LYAA 1KDOA 3CH5A 3NBXX 1SVOA 1HH4A 4QC2A 5KDLA 4JLJA 3A4NA 3HR8A 3QG5A 3X2SA 3B8HA 1VHTA 2QG6A 2H18A 3VKWA 3EARA 2Q6TA 2XOKD 4FMCF 4BPBA 3ZDQA 1HT1E 2V6JA 3AF0A 1E1RA 3I32A 4U02A 4W9MC 1RPZA 1M7HA 1ZUHA 2W00A 2HCJB 2WJYA 5E7IA 3HJNA 4RZUA 1UEJA 4RD3A 1GWNA 3CRRA 3KTAA 2WBLC 2EU8A 3F0TA 2VQSA 3BFXA 3V00A 3HYRA 1R5NA 2IYLD 3QUSA 3OEED 4JVSB 4FCWA 5DI3B 5JCZA 1I4DD 4QBIA 2GVZC 2EFHB 4GSYA 4U00A 1G5PA 3T5GA 4AC9A 1OXUA 3IGFA 5FBLB 1IBRA 1OYWA 2ZRDA 2ODNA 3Q9LA 5JHGB 2PZFA 4UQOA 2BCGY 3T1VA 3NBYC 4HLQB 3QKRA 5A4JA 1R8SA 5JJKA 2IWRA 4G5OA 1HV8A 3LD9A 2R6AA 1OXVA 2QMUA 4BEBA 1TU4A 1NSTA 1AS0A 2BMEA 1G291 1VECA 2C77A 2OILA 4EQ6A 2GESA 4JSYA 1SZPA 4UKDA 4YXWA 2R44A 1R7RA 2MMGA 2GDJA 4TLAA 4JYCA 5AJZA 4E09A 2GF9A 1X1SA 2UZIR 4LJ7A 1E3MA 4PAQA 1QRAA 2H7VA 3QOFA 4AK9A 1FW6A 1OFTA 3DOFA 4NCIA 2WJJA 4Q02A 5JSZA 1X8LA 1L4UA 3GLHA 1KMHA 3OIWA 5SZJA 4DB4A 3GQBA 4NL4H 3E5HA 5K8UA 3CF6R 2QQ0A 1W4RA 4OHXA 1T5LA 2CCKA 1E79D 4I1SA 4F92B 3DZ8A 2XEXA 2ATVA 4JLVA 1X1RA 4N3NA 5L8VA 4GBMA 2RGXA 4B73A 1XPUA 3RSOA 4C30A 2DHRA 3KFVA 4PC7A 5AUNB 1P9WA 4QBFA 4W5WA 2Z43A 5EP3A 1NY5A 5CYPA 5HE8A 1SQ5A 2R65A 4OJQA 2ZYWX 4MKHA 2GF0A 4B3BA 2O0KA 2ZYUX 3WYAA 4PPQA 2ZRKA 1LS6A 2ZE6A 1S1MA 5EP1A 1Y3AA 2BM0A 4BFTA 4RD4A 2AFHE 3FMFA 2FSHA 3FE2A 2O8EB 2XTZA 4IEEA 5KNCA 2YV5A 4K46A 5HTKA 2PCJA 4TQUS 4HUTA 5FTLA 4AWXA 1Z0DA 2VHJA 2OCPA 4R2IA 5KDOA 4G1UC 3FB4A 3AKEA 4BFSA 5H70A 1KNXA 4XSGA 4ZDKA 3KUDA 5DYGA 1G7RA 3PUZA 4EKDA 1XTJA 1XPRA 1SXJD 3H86A 1U9IC 3K0CA 4M1YA 2QAGA 3AF2A 1AGRA 2B6HA 1CR1A 3AP1A 2JA1A 3B13B 1MRSA 1U8ZA 5EUMA 1JQLB 2BCJQ 4MGYR 4I81A 5JLJA 4BWYA 1JJVA 2IUSA 3SYKA 2G83A 4ACBA 5H1YA 1U94A 2FPMA 2YWFA 4PC1A 5CITA 1US8B 1FUKA 4JJZA 1YZKA 2NO6A 4G3XA 3K53A 1KK1A 1Z08A 4CEIA 3TBKA 5CK5A 4ZKDA 1P73A 2C96A 2FMXA 4MUBA 2CHGA 2ZJZA 4IDOA 4LPKA 1U99A 2BC9A 1BO6A 5CYOA 3FHCB 2GVDC 1W2HA 4Q03A 2GBLC 3TJZA 2P65A 3AVYA 1Z29A 2PL3A 1ZM4A 3C14C 2NIPA 4WOPA 1G7TA 5LBIA 3PEVA 5DHAA 3C4JA 3UANA 3VKHA 5LDDC 2KWIA 2GK6A 2CL6X 2Z4SA 1G8HA 2GZDA 2IYXA 1KIMA 1ZD1A 2O8DB 3SJAA 1W48A 3PUVA 3PXGA 2WPDA 4IVPA 2UVQA 5B57C 2ODWA 3HU3A 5B64A 2REXB 2BKEA 1YE8A 4LDJA 3WMGA 5JHHB 2F9MA 2WOOA 4B3GA 1NVWQ 2HJGA 3QNUA 2AR7A 1OKKD 5EE5B 3R8CA 4CEJB 4DJTA 2GEVA 4HATA 4KFTA 4A8JB 1DAHA 3PEUA 3PQCA 4IXNA 4DDVA 1LV7A 1P2TA 5DI3A 3OIYA 3P20A 2A9KA 4FMDF 1IONA 3BJIC 3G5UA 2IEYA 2VEDA 4Q18A 2WKRA 5GJWC 4US1R 4DUGA 1W2GA 4E22A 4PO1A 1IN4A 2XNDA 1Z0IA 2WVJA 4C2TA 1OFHA 5CDFE 2QT0A 2I4IA 1KK0A 2KBEA 1R5OA 3CIOA 3QQ5A 2ZJ2A 1FMLA 2C9OA 5G53C 2IWHA 4HLUC 1AN0A 2VH5R 3UMFA 1G20E 4P4UA 4A15A 1NMZA 3AB3A 2VSOA 1ESNA 1ESMA 1U0HC 1OJLA 4Q4HB 2D7DA 2QBYB 1TADA 1WXQA 3W6OA 2W2VA 3NDBB 2QY9A 4MITA 1KSJA 1OIWA 3TUJC 1GL9B 1VPLA 2ZANA 1PLKA 1W49A 4MRVA 5CJPA 3SFVA 1FNNA 1Q0UA 1Z28A 3EIHA 2JJ1A 4LJYA 4AKIA 2DFLA 1HURA 2DWQA 2FOLA 3C8UA 4DCTA 4HYYA 4C4PA 3V4RA 3AF3A 1VDZA 2ERXA 3D3QA 2O8FB 4E5UA 3CW2A 4ESHA 4V0NA 4N1AA 4OI4A 5C2JB 2C5LA 1XZPA 3N2IA 1D2NA 4YDSA 1SXJB 1YHNA 3PEYA 5JJIA 1N0VC 4GMXA 1AKYA 1VCIA 5FOTA 2J0SA 2DY1A 2ZUCA 2JGNA 3BIFA 1E9FA 5DSZA 1P4SA 1IXRC 2IK8A 3EC2A 3TUIC 1ZNWA 5JWOA 1U90A 1QHXA 2Z4RA 4URWR 3ECCA 1VTKA 4NYJR 1KY2A 3FMIA 2N1BA 2O8EA 4TLBA 3CRQA 4PPFA 3FFBA 1G6OA 1IHUA 1H8EA 1OLOA 1DTSA 1OYYA 3LQRA 5KSPA 1QHNA 2GNOA 4G5GA 2NGRA 1Z5ZA 3V4FA 3QPWA 2GAAA 1TAGA 3TSOA 5LPNA 2X19A 3ZYCA 5FR1A 3WMEA 3X1YA 3OFND 5JMTA 1KSHA 5FI0B 1E0KA 4WZAE 1OW3B 3VNVA 1DO0A 1E9RA 5GJCA 1NN3A 4YC7A 3CONA 2XOKA 4QRHA 4MKIA 2RAPA 1HA3A 2P2LA 1XMSA 1US8A 2GAOA 3NEJA 1GNQA 1V43A 5E4FA 3KQUA 2FA9A 5HKKD 3WP1B 5FOWA 1QHHB 1NY6A 5KNDA 2WWHA 3RABA 2FPKA 2FPLA 3M6AA 3WP0A 2JCSA 4UNSA 4C7OB 3BFVA 4RFVA 3RS3A 4Q7LA 3FHTA 3LNCA 4BZQA 3CPHA 4KSBA 6Q21A 3OEEA 3RLFA 2SHKA 2FN4A 1N6NA 4C0AC 3U7HB 5AWFC 4O2RA 5BYKA 3EZ7A 1EG7A 1ZCAA 5BN5A 3EG5A 4KBGA 1O3YA 3X1XA 2O8DA 2ATXA 3T35A 2NO0A 2W2XA 2ZSBA 5DE3A 2PLFA 2ZJAA 4LX0A 2VP0A 3QXCA 1AA9A 1BIFA 1F6BA 4Q9JA 4IKEA 1GL6A 1NVXQ 1ZD9A 2FZLA 1SHKA 4EJSC 3AGQA 1N6IA 1G18A 1YRAA 2A5GA 2MMCA 3H1TA 4MGZR 1K6MA 2XTMA 3B6EA 4KO8A 1UADA 3PR1A 2REBA 3VX4A 1NF3A 1U81A 4B6EA 4CEJA 4LV6A 1DELA 1AQUA 2P67A 1P2SA 3I5XA 1ZM2A 2F6RA 4A8JA 1RIFA 1MO5A 3LWNA 1NKSA 1G16A 2C98A 1PJRA 2IX3A 3WXMA 1JB1A 1U2RA 2FGJA 1GKIA 3EWAA 1NVUQ 1J70A 4D4LA 4YQFA 5K8IA 1WBDA 3TVTA 1Q12A 1QZXA 4HEJA 3ADBA 1QDEA 2A78A 3BB4A 5CM9C 1MKYA 1VCNA 3MGCA 5KSZA 1XEXB 1F2UB 1E9EA 4B3XA 1JXMA 4BLSA 3U7GA 3UATA 1E79A 2QTHA 2Q21A 2ZE5A 1MABB 1LW7A 5KSYA 1GUAA 4LUCA 1OB5A 4B32A 1J2JA 1L2TA 1OXXK 2FSGA 1JEEA 2IA5A 2CK3D 4M1MA 2IBMA 2OXRA 3DM9B 4PZLA 5EE9A 3VQTA 3WYGA 1EX7A 4ARZB 5J4HA 4L4UA 1BKDR 1CJTC 1YZNA 3SYLA 4HB0A 3U61B 5BN3A 1VHLA 3HPRA 1FQKA 4IFEA 4Q4HA 3K1JA 1N5IA 4ZI2A 4J0QA 2QBYA 3ZS9A 1FMJA 4PZYA 1E0SA 2ZSEA 1XRJA 4X8OA 4XVUA 3QKTA 3SZRA 5HZKA 2V6IA 3UG7A 4M1OA 5KUTA 2C8VA 2XZPA 3JZMA 3L2OB 3BORA 4WVFA 3RNLA 3SBDA 2NO7A 4X8MA 3N2EA 1N3BA 2OESA 4KVAA 1Q1EA 4I1OA 5TB5A 3T34A 4Q19A 2WJVA 2O8FA 1EFHA 3IBGA 5P21A 1XPOA 3U44A 3AVPA 2ONJA 2QPAA 2ZTSA 3EXAA 1BMFD 3UWKA 2ZQ5A 1ETUA 1SXJA 4D82A 2GRJA 4Q7MB 4IDNA 1F5NA 4PZZA 2V4ZA 3UKDA 1N25A 2X1VA 4M4SA 2B8TA 3A1WA 4M1KA 4NTZA 5FTKA 4F93B 1HY3A 3QBVA 2BBSA 2ZUDA 4EFMA 4D25A 4PO9A 3I62A 4XJXA 3SR0A 2IXFA 2JJ8A 4TSFD 621PA 1E2FA 2Z83A 4TL9A 3NBZC 1CR0A 3RVBA 4IVQA 4HDCA 1E2IA 3CX8A 3GEEA 1G4AE 2YKGA 4HAYA 2F55A 3SHFA 1G4UR 1XD2B 3H2YA 1DADA 3T06B 3X1DA 3VFDA 1FP6A 4RCZA 5JFGA 4II7A 5FUXA 4NPHA 4QM6A 2GCNA 5DO9A 5DHFA 5TV2A 3AVVA 4GMDA 4L5BA 4PFSA 1BOFA 4C3ZA 1K5GA 1VMAA 2DFTA 2Q9BA 3QG1A 2GXUA 4Z1MD 3K70D 3SJBA 3CO5A 2ZRFA 3JZAA 1GP2A 1KOFA 3BOSA 4OI1A 2QNRA 1SXJE 1W36D 3MJRA 1D2EA 1G5TA 5JEEA 1R10A 5E7JA 4L8GA 2J7KA 4A4DA 1NIJA 1KAOA 4DC9A 3B82A 4FCTA 3ADCA 2ZYTX 1ZNXA 2VLIA 4PC2A 2VHUA 3CR7A 2PJRA 3WNDA 1F2TB 1QHHA 1U0JA 1E2QA 3EZ6A 1NN5A 2FU5C 4GP7A 1TPZA 5EXXA 3TSZA 4OHWA 3CX6A 3LBNA 3NXSA 1GG2A 1OKKA 4FINA 5EXTA 4B35A 1UAAA 4MKGA 2B21A 3RS4A 4YDHB 1S8FA 1RC8A 4TWZA 2A5YB 2AD5A 4DT1B 3CNOA 4AI6A 4Z54A 2QEQA 3KJIA 4Q9KA 2F3TA 1IN5A 5AUOB 4TQ9A 2ZS9A 3GFOA 4PX9A 2ZAMA 3MJHA 1GZSA 2D62A 3B1WA 3NIBA 1Q1QA 1P9RA 2YNMA 3LW7A 4JS0A 4CW7A 2ZSAA 4CT4B 3SN6A 1UKZA 3GJ6A 1NMXA 3AM1A 1JR6A 3R9XA 1XJQA 2FH5B 1ZUNB 3IIMA 2AD1A 4UNPA 4A1FA 2VA8A 2OCBA 3VU9A 4TYWA 4EFNA 3TAUA 3SHWA 1PZNA 1NI3A 2A2ZA 2JLXA 4QHYA 1GIAA 2XNSA 4HAZA 3E70C 2A5FA 3JVUA 4NYJQ 3W90A 4R9UC 1QBKC 3UIEA 1SGWA 4DLTA 4EFLA 3IDQA 3Q5EA 2XB2A 2ZR9A 3QKUA 4RD0A 2VF7A 4TQAA 5B2ZA 2RGGA 4GPTA 1E0JA 3A37A 4LBWA 5IRCD 5JRZA 2XNDD 1KO1A 1LF0A 4RD2A 3W3AA 1RJ9B 1P72A 3K0FB 3HR7A 3FKSD 4OQXA 4Z51A 2V3CC 1XEXA 1F2UA 2VSXA 2GTPA 1DO2A 1FL9A 1KY3A 1RFLA 1KJWA 3C16C 3K0EA 3I4LA 1GRRA 2VBCA 1OH6A 1D5CA 4BFXA 2J0UA 2QA5A 2C78A 4LV5B 1YZTA 4KAXA 1ZM3A 2W6ID 3AEZA 3CZQA 4ILEA 4ARZA 4DRZA 4JVLA 1EFCA 1HTWA 1NJFA 1NLYA 4FMCB 3FWYA 4QL3A 4AD8A 4JLKA 3TH5A 2DWOA 2QP4A 2CLDX 2ZPTX 1GILA 2J7PD 2QMHA 2ANBA 2H1LA 5H68A 3BK7A 4IW3B 1B23P 1M1YE 2F1HA 5LD2C 4TMWA 3I72A 2XZLA 1LY1A 4AYWA 4BECA 2D3WA 2JATA 2HLDD 4DSTA 1SKQA 3QI2A 2BIFA 5CLLA 5E3HA 4AKHA 2YINC 1OFIA 4HZUB 4HAXA 4JL5A 1G1MA 1II8B 4RFSA 5G3YA 3U7EB 1DEKA 3SE0A 1KZGB 4R71A 1YZQA 5C46F 2JLYA 2C2HA 3J81k 4DDTA 1ZM7A 2Z6VA 3QPVA 2O8CB 1OT3A 4A6PA 5IK2D 2O0HA 2K5UA 2ZRMA 2WWXA 4LI0A 1G3UA 1U98A 3O47A 4A0RA 2AK2A 5SZIA 1XEFA 1I4TD 2BMFA 3CBQA 4TLCA 3IQXA 1JAIA 3OFNA 5FBWB 2O8BB 1PV4A 3MSXA 3W8NA 2R2AA 3K70B 2G1KA 4QJ4A 1QHIA 3SOPA 1EXMA 1R6BX 1L4YA 3DEFA 3AVUA 5FUWA 5BWMA 2WAXA 1N6RA 4DLZA 4GFDA 2BMJA 4G5QA 3MWJA 5EXSA 5GVRA 2DYKA 4F91B 5HKKA 2VL7A 5FOXA 1XZQA 2P0EA 1VCOA 2XX3A 2IHBA 3GEHA 3K0AB 3KKQA 3ZIAD 2F1RA 4DVGA 1Z6GA 4Q48A 4BLTA 1UBCA 4LJ4A 4NYIR 1GM5A 3ZZ0A 4D2IA 2Q3FA 1JR3A 3IILA 1ZD8A 3PFIA 4Q1CA 4M8NE 5DISB 1TEXA 5JECA 3FKQA 3VAAA 2J1LA 2A5DA 4Y0VA 2ERYA 2YOHA 2RGCA 1SVMA 1M6NA 1MR3F 1T0HB 1OH7A 2AWNA 2G77B 3IUYA 3EZFA 1E2NA 4XWAA 3W5JA 5J40A 2NO9A 3MCAA 3DOEA 2QENA 1IQPA 2EFGA 3NC0C 4KODA 5JJLA 1XCMA 1F2TA 3NH9A 5DYIA 4TMKA 2GJ8A 4ZCIA 3M4YA 5DH9A 4US2R 4POAA 1T5IA 2P6UA 1W5SA 2VP2A 3P32A 4JT2A 4DT1A 4EPTA 5J4KA 4LRWA 1JECA 2Q9CA 3OHMA 1YR7A 3WNCA 1L8QA 2I1VB 1UDWA 3CWQA 1XXHB 2QRZA 3HU1A 2ZI5A 5J47A 4O0MA 2AK3A 1NRJB 3TGPA 1SHZA 4G01B 2QU8A 4Q1AA 2IYUA 2ZRPA 4QJ3A 1RYFA 1JR3E 5EJEA 2RGNA 2QL6A 4DWJA 1JI0A 1DE0A 2JAQA 3RS2A 4DLUA 4Q7KA 4PXAA 3L0OA 4FXPA 4MYCA 1UM8A 1RRFA 2CK3A 1Z6TA 4MA4A 3THWB 221PA 3MMPA 3RYTC 3CX7A 3NDPA 5JBQA 1DOAA 2ZI7A 1W7AA 4CF7A 1DAFA 2Q9AA 3RS0A 1SVSA 1R4AA 2VP5A 5FH9A 4AY2A 4DLSA 3GMTA 2IYWA 3K9LA 1CRPA 3VR5A 3D7MA 1RJ9A 2HYDA 2R9VA 1RRCA 5JWHA 5CIQA 2WZQA 2BBTA 3K0CC 4X8HA 2ZJOA 3GJXC 2RHDA 4IRUB 2N46A 1SKYB 2BOVA 5FUVA 2IYZA 3ZH9B 1SVWA 4TYYA 4ZDJA 2ZXUA 2IW3A 2IYYA 3FHOA 1BMFA 2GCOB 4OHYA 1XTIA 3CRVA 2GXQA 3KB2A 1Z6XA 1XCGB 2FE4A 2W6JD 3BERA 1P2UA 4DLXA 5DI9A 2CBZA 2F1JA 3K09C 2BMDA 5GADl 1Z0JA 1E94E 3DVLA 2FSFA 4P0TA 4YMUA 4JYBA 4OL0A 4LOAA 2RB4A 4NCJA 2JDID 4QNMA 4G0NA 4TSFA 2GILA 3A1VA 3NTUA 1VIAA 3I61A 421PA 4MDFA 5J4LA 4FN5A 1IJEA 2EVWX 4IOLA 4HZUA 4DBLC 1II8A 3AVTA 3C5HA 3N5CA 4PPNA 4WIAA 4D4MA 1DAEA 1ZINA 2PZEA 2PEYA 1A2KC 4BLOA 1GDDA 2O8CA 2CNWD 3TQFA 1Q22A 4YMWA 5TXGA 4FMDB 3FMPB 4NKRA 5KDDA 2JIZD 5TARA 4M2LA 5F9FA 4O25A 2D2EA 2GA8A 4MH0R 1KO4A 5FPKA 2O8BA 5HE9A 2DFKB 3GJ5A 4Z1MA 3LLMA 1CR2A 4AURA 2NPIA 3KXLA 4TN1A 1G7CA 1E2MA 2C95A 2PH1A 3MWLA 1YVDA 4S2EA 2GXAA 2GZAA 2ASEA 5AJVB 5JCPA 4DEXA 3LBHA 2FSIA 3QY0A 4URYR 1RRPA 1AS2A 1UBGA 2AKAB 1J8YF 3ONWA 2QP3A 1EWQA 4IOMA 3I73A 3K0AA 2FEOA 2KI5A 1ZRHA 2LWIA 2ZU6A 5CDFA 2IS6A 1OH5A 2ZRGA 1IY1A 1CXZA 3OIVA 3AP2A 3CH4B 2V8OA 4LHWA 2GCPA 3U5ZB 3ETLA 4MGKR 4WXRA 4RD6A 2P3SA 1BYUA 2E87A 3KXKA 2Y8EA 3A4LA 1ZC4A 4KU4A 1DAKA 1KDRA 1NG1A 1WE2A 2WJIA 3OE7A 2ZRAA 1E2HA 4DSUA 4TZ0A 4PQYA 4MKFA 3X1WA 1W0KD 1UBFA 2CCJA 2VP4A 4ON9A 1Q1BA 2V55B 2ZAOA 5BYJA 2DFNA 1TQ2A 3L8YA 1YJ5A 1SULA 1W5TA 2IYVA 2YJTD 1QVRA 4AYXA 1UKVY 4F4CA 1CF4A 2FDCA 3FFAA 4D0NA 3LQQA 2ZJYA 1AZSC 4JBWA 1JEDA 1NN1A 4KJZA 5CLQA 3RRMA 1FFHA 3ZLJA 4WZ6A 2KJQA 2VPPA 3GLGB 2IS2A 5TY0A 3VR6A 3FKSA 4ASUA 2PLRA 1RW4A 2H17A 2J41A 1FZQA 1TEVA 5JS7A 3DMNA 4Q4JB 3TIFA 3GFPA 4H1UA 2WAYA 3CRMA 2P5SA 4QBHA 3SDZA 2OEPA 4IOKA 2G3YA 2OLKA 3EZ2A 5C4GB 5FI1B 2W6IA 1E9BA 3THWA 1WF3A 2ZRIA 4F4IA 1XU4A 3QIAA 2JLVA 4LK2A 4QXAA 2CL0X 1XMVA 4LJ5A 2J7PA 4URZR 2CXXA 3IO5A 3MWYW 3K9NA 4UXJA 5CB6A 3ZS8A 3EC1A 4KV9A 5EUQB 2OXCA 4KBFA 5HZHA 1IOZA 4YMSA 4LGMA 2GK7A 3ZQ6A 3D6TB 4NBSA 4ABYA 4NYIQ 1NKTA 2HCBA 5AUPB 2BEKA 2HLDA 2JLQA 1ZU5A 3VTKA 1FTNA 3AV0B 2QAJA 2ZVPX 4EPYA 1H65A 1XXHE 1ZBDA 4D81A 4DSNA 3FTQA 4G5SA 1WMSA 2ZU0C 2Q3HA 4TL7A 5IK2A 4BLQA 2GCOA 1AQYA 4NYMR 5B58C 3GCGA 2BHRA 4PC3A 1OFUX 4CZ2A 2L0XA 1Q3TA 3W8RA 4OK5A 4TL6A 4EUNA 3FPAA 2EFEB 4JBYA 1IN8A 4XOIA 3IEUA 4DZZA 5K8TA 3Q5DA 3B2EA 2QTFA 4HDOB 1GRNA 1Z22A 1FUUA 1KSFX 1X86B 4LYJA 1Q21A 1KHTA 2HV8A 2PMKA 5L3VA 4TTRA 3DKPA 3DHWC 4BZXA 3VR2A 3M1IA 1HUQA 4HLUA 2XITA 2GXSA 3THOA 1P9NA 3IBYA 1OXTA 4LJ9A 1N6LA 1Q20A 4LBZA 5CK4A 3ZIAA 4P4TA 1S4QA 1HE1C 4EDHA 5FPYA 4RZ3A 4DCUA 5AJYA 3NHAA 4TLDA 1ANKA 5EP2A 1G8GA 4DXAA 1OIXA 2VP9A 2OE2A 1IN7A 1COWD 1OIVA 1Z83A 1HT2E 4NDZA 3K9GA 4A0GA 1YQTA 1SKYE 2D4HA 5A0FA 3MG9A 3SEAA 1Z2CA 4CIDA 5FPSA 1Z2AA 1QHYA 4A8JC 5DN6D 4QFMA 1PLLA 2RHMA 3I8XA 1VYUA 1R8QA 1JQJC 3SQWA 4LWZA 2FWRA 4FD2A 3R20A 3PENA 2IF0A 4PHHA 4B3DA 4B76A 2YOGA 4A9AA 1KI8A 1ZUIA 1EFRD 5JEDA 1OF1A 2ZR7A 3AQ4A 1JR3D 4RZ2A 2PX0A 3PG5A 3AKDA 2G1JA 1AKEA 3KQNA 1P2VA 4DLYA 3WHKA 2EYQA 5FBQB 5HCNA 4C0KA 4XVRA 1XCPA 1E6CA 4A0FA 1G3IA 3T1TA 1VYVA 2YWEA 2NTYC 1FNMA 1NLZA 4BFUA 1HQCA 3EPJA 2WWWA 1D8TA 3O8BA 4RKEA 3CF0A 4P4SB 4Q1EA 2XAUA 1R0ZA 3KUCA 2NO1A 3GLIB 1KI3A 2MSCB 1OE0A 5L3SB 2WHXA 1N6HA 3GJ8A 1KKLA 1CIPA 4KCGA 2KBFA 3N70A 4MUAA 4Q9HA 3BWDD 1GOTA 3UMRA 1M8PA 3VNUA 4HLCA 4LJ6A 2REOA 3S1AB 2CMKA 1OB2A 2FX3A 3GFTA 3U7FB 5FFMA 1MT0A 2ODEA 1CJUC 3HU2A 5SZKB 1G7SA 2GEDA 2WKPA 4EAQA 3GLGA 2IC5A 4LBYA 1U8AA 3BH0A 3I1FA 5BXQC 2X2FA 4L15A 5AJWA 5FL3A 3R8FA 2HUPA 2WSSD 1T3SA 2EFCB 1UF9A 2XTNA 3QBTA 5EP4A 2NPFA 1KJZA 4Q4JA 3CF2A 3PEWA 2X8AA 3AF4A 1N6PA 3ZVRA 2QMOA 1AIPA 3AGPA 1UKYA 5D3MB 2WICA 1ONBA 4US0R 2BBWA 2V7QD 2WJGA 3MD0A 4WBSA 3ASZA 2IYRA 1GITA 3KKMA 4IVRA 3TMKA 1XTKA 1VG0B 2W6JA 4RVCA 1EWRA 1ZAKA 4B6FA 5KSOA 2DB3A 2VP6A 1XF9A 3MAAC 3O8CA 3PITA 4RD1A 521PA 1CRQA 1V5WA 2JDIA 3CR8A 2HT6A 4B44A 1N0UA 2F43B 2GEUA 2D7CA 2NOAA 4LHVA 4P3YA 2OBMA 4OQNA 2R6GA 1E98A 3BAFA 5ELXA 1Z0AA 5B30A 2ZJBA 4Q9LA 3K8YA 1GRQA 4NZYA 2F7SA 5AR1A 4TZ6A 1E4YA 3KL4A 1A2BA 4LHYA 3GLGE 2XJ4A 2CNWA 2BM1A 3NBFA 3QEOA 1TMKA 4URUR 2XSZD 4JLOA 2GETA 2OUKA 4LHXA 4D0LB 2JIZA 3KQKA 1AS3A 4TYQA 2QT1A 3PVSA 4R98A 1JXOA 1A7JA 3LH5A 1N6KA 1CU1A 1GTVA 3NVAA 2QMEA 1FP7A 2X2EA 2ZI6A 3KKPA 3QPUA 4PAMA 4Z8YA 1D9XA 1GKUB 1T0JB 4Q5IA 4HSEA 5C4MA 2QN6A 2WWIA 1GNPA 4DEYA 3PIRA 4BGDA 1U0LA 3LBIA 2HYIC 1QHSA 3MRSA 1G8PA 1RYHA 5EXPA 3QXHA 1KI9A 1C4OA 2ZREA 4GOXA 1XEWX 1JPNA 1ZNZA 2F9LA 3AUXA 2ECKA 4Q01A 2VIIA 5FPTA 4GZMA 5HCIA 1DBSA 1GFIA 4V0OA 4XH9B 3UXMA 3AKYA 4KHZA 2PT7A 4M1SA 3QXJA 3IO3A 4XVQA 3WY9A 5LD2B 1IXSB 1NBMD 3PUXA 4XWKA 1X8KA 2ZROA 4HUQB 5AK0A 2UZ3A 3WBKA 4TTQA 2ANCA 4TYPA 4JKIA 2AWOA 1PLJA 4C2UA 4TT3D 2A7QA 2OBNA 4PSAA 2J9RA 5G40A 3U2QA 5FBVB 4JBXA 2ZUBA 3BH6A 1W0KA 4ZI3A 2BV3A 4DLRA 4YMVA 1GKYA 1ZU4A 4C7OA 2ZI3A 4R7ZA 3WRXC 3CZPA 4CRWB 1YRBA 1XFAA 3QXXA 3LX5A 3O8RA 1XTSA 2OFOA 1Q3HA 4XSHA 4LHZA 4MQBA 4IDQA 3B85A 4TYNA 1YZLA 1IY0A 4JL6A 4DCNA 4QGFA 4C0QC 1RKBA 2GHIA 3OE7D 4XTCS 5C1BA 4I99A 1Z47A 4F38A 3ZVLA 4KXFB 2GJAA 2HJVA 3LLUA 3NEYA 4NYMQ 1MRNA 1LF5A 3THXB 1KTVA 4XIGS 2ZRHA 4IHQA 2R6FA 3L43A 5BW8A 1UJ2A 4P4SA 2OV2A 1KO7A 1KDPA 5L3QB 1S96A 2OZEA 2ZYVX 3ND9A 3GLIA 2FV8A 3QF4B 5L3SA 4GRAA 4C9BA 2B92A 1LS1A 4V0ME 3FGNA 1XEWY 4WZBE 4D4JA 3S1AA 1VYTA 3KXIA 1YU9A 3QF7A 1NJGA 1UDXA 5AUQA 4B3CA 1MV5A 1BS1A 4ASUD 4BQSA 4PQFA 3I8SA 2J0QA 2O5VA 3IIJA 4V03A 3RWMB 1RZ3A 3IIKA 3VR4A 1UPTA 4RZXA 2J45A 1E1QD 2C99A 4QGGA 1AJEA 4M1TA 3C41J 1MABA 4M9XA 4QKQA 1Z63A 2RGEA 4JLPA 1NNEA 1I2DA 1X8JA 4NE2A 4OK6A 4LPSA 2PMDA 1G64A 4OHVA 3DM5A 3LXXA 5BQ5A 3EZ9A 3DPUA 5D3MA 4B48A 4I4LA 2XXAB 1K5DA 3T61A 1IY2A 4JMPA 1M7BA 2Q0HA 2QM8A 3VR3A 1F3OA 3VHLB 1N6OA 3GLIE 4DB2A 1DAGA 1W1WA 3F8TA 4UNQA 2C04A 1WB9A 2OHFA 4AIIA 3DL0A 3ZVNA 2IEZA 4DCVA 3WRYC 3BD9A 3BRWD 3KQHA 1E2KA 2F43A 2WMNB 3EA0A 2XZOA 2XGJA 4D0GA 2DCUA 4UXIA 2EYUA 1RRGA 1E2DA 2IUUA 3B1VA 4BASA 1LNZA 4L9SA 2NQ2C 1GVNB 3TK1A 5IHPA 4A0HA 1YZGA 3BB1A 3CPJB 4AYTA 2GWHA 1CTQA 1P62B 4W7SA 3C5CA 4RJLA 1RVDA 1G17A 2FNAA 2OBLA 5KNBA 4Q7JB 1KDTA 4PANA 3OAAD 1COWA 2YZ2A 1XD9A 1N5JA 2VHCA 2EFDB 4V02A 2WJHA 3BFKA 5LB2A 2X77A 1ZW6A 4QHTA 1XD2A 2G0TA 2ONKA 3U4QB 5DN6A 4NU0A 5FOVA 1E2LA 1I2MA 4LSGA 3VKGA 4MRSA 1ZCBA 2A30A 2WV9A 2BJVA 3L0IB 2KSQA 3LDAA 3ZD7A 1EFRA 5CM8B 3RC8A 4B3FX 2F1IA 3AKCA 4TTPA 1P7CA 4K8OA 1UKEA 4KITB 5TMPA 1YKSA 3SS8A 2NG1A 3THYB 2RGNC 1XBTA 4OI2A 2QRNA 4IDHA 2W83A 1VKJA 1FOEB 3SJZA 4HUQA 1NLFA 1JPJA 1II9A 4WA7A 3TVDA 2PJZA 1G9XA 2ZSFA 4LYFA 3WYFA 4XD7D 1D6JA 3GLFB 2ZE7A 3W6NA 1DPFA 2YYZA 1BYIA 3T15A 4QG7A 2VO1A 2H16A 1T3HA 1VG8A 2CJWB 2LKCA 2PEZA 4D26A 1MO3A 2FFBA 2IYTA 3A1UA 4FMBB 4EPXA 3C15C 3I92A 2AXNA 5D3QA 2ZJ5A 4ERNA 4LJ8A 1S3GA 4Q9IA 4W5HA 2AXPA 4A92A 4TL8A 2ZI4A 3CM0A 4ZO4A 3RC3A 1VG9B 3IHLA 4OQMA 2VSFA 3OF5A 4DDWA 3U6KA 4V0LA 4I1UA 2ZS7A 5CB8A 2D06A 3KJHA 3TRFA 4B2PA 1G21E 4OYHA 4R2HA 2VHQA 4QOSA 5DGXA 3E1SA 1FTSA 2ZJ8A 1N2CE 4CEHB 4QHSA 3THXA 3FVQA 4A2QA 5EZ6B 1EX6A 2WSSA 5FTMA 1E9SA 1XWIA 4Q00A 5L3QA 3GJ3A 1ZC3A 4FW9A 4GZLA 2NZ8A 3B1ZA 3QF4A 4ZPXA 2YOFA 4WW0A 1NN0A 1T3LA 1R0XA 2OCAA 4JIMA 1B0UA 1DAIA 2VTKA 2BVNA 3SJCA 2JJ2D 3PCRB 4C0HA 2BWJA 2NZJA 2V7QA 4KFSA 3U3KA 2CE7A 2RGBA 2QUZA 1AGPA 1XD8A 3K0FA 3RRNA 2JLSA 1NVVR 1G3RA 4Q1FA 3IPXA 1AK2A 3AP3A 2QAGC 5JI2E 4CDGA 2P6RA 1NSFA 4G5RA 1DAMA 3Q8XB 4GI7A 3C7KA 5EQTA 3UK6A 3ZZUA 4BRUA 4M9SA 2AL7A 3BH7A 3NHBA 5J4YA 1XMJA 1IM2A 3K70C 5FL7D 1TX4B 4KFRA 1JAHA 1J8MF 1WRBA 3G82C 5KTYA 2F3RA 3FMOB 4TMTA 5IDVA 4PHFA 4ZIRB 2CVHA 3DKVA 2YWHA 2V9PA 3TNFA 5KOYA 1W36C 2XSZA 1Z06A 5KO2A 2XXAA 3A36A 4H1VA 2VF8A 3ZVMA 4MRNA 4B33A 1IAQA 3LAWA 2FFHA 3DO6A 3UPUA 4DLWA 3P26A 4EPRA 5KU1A 1C1YA 3LW8A 4DLVA 4EPWA 1WP9A 1TL7C 3LRPA 1T6NA 3RS5A 1L7VC 3EPHA 2WIBA 3CPEA 3A6PC 3DZDA 5IT5A 1LFDB 1Z07A 4NH0A 2QSYA 3KKOA 1CLUA 1TF7A 4M9QA 5FBRB 3EA5A 1CP2A 1P5ZB 5LB4A 4BEJA 5F98A 3NC1C 1S9DA 1Z0FA 1M2OB 1GNRA 1T9HA 4P32A 5AJXA 2FFAA 4HZIA 4MRPA 2YC2C 3GLHE 1Q57A 1IN6A 5M04A 2ZI9A 4E03A 1K8RA 2FJUA 1NBMA 3L0PA 1S1CA 4HDQB 2JLRA 3PV0A 3RRYA 3RSLA 1SVIA 1CR4A 2GJKA 2RKOA 1DS6A 4M1WA 1XNJA 1W0JD 2WIAA 4TT3A 1KI2A 4DCSA 3U4QA 3B60A 1DG1G 1Q1ZA 2W2TA 4PHGA 4EPVA 1IXZA 3KJEA 1J90A 2PCLA 4M0LA 1I4LD 3AVWA 5SZHB 3IKJA 2QROA 5DLQC 4DIDA 3T12A 4ACAA 3HYTA 1Y63A 3OESA 5KHOC 4GDFA 2NMVA 4FIDA 3UMSA 1CULC 3LV8A 2C03A 1XP8A 4GP6A 1T8UA 1KI6B 4HB4A 5FOUA 5HPYB 2J59A 3IPYA 1N5LA 2E1RA 1O87A 2B8WA 2RGDA 3MWKA 4LC0A 3K09A 2G9NA 3THYA 3ICEA 4MRRA 3L8ZA 2IL1A 2W58A 4B2LA 3ZZTA 4BUJA 3TQCA 4JLBA 1JJ7A 1OPXA 5TDHA 3AVXA 3Q7PA 3GP8A 1ZJ6A 1VIYA 1CJVC 1ZP6A 1OHHD 4HAUA 3GLFA 4PPGA 4OJKA 1XTRA 4LV8B 1AZTA 2CJWA 1TNDA 3U3MA 1NBME 3UWOA 4Z8XA 1CEEA 1U9IA 5ANRB 4BFYA 2GJ9A 1DVRA 4M22A 3KJGA 3QKSB 1Q44A 3TR5A 1QHGA 4GNKA 3AH8A 3P4XA 2I1QA 4OHZA 2WSMA 2WWGA 1XXHA 2OM2A 4QM7A 2QM7A 2ZRBA 3B1YA 2CVFA 2QE7D 3TSWA 1EESA 1VG1A 3E2IA 4KFUA 1N0WA 1WQ1R 2QI9C 3SNHA 2QSZA 4PHTA 3SYNA 3A1SA 3U3RA 4PSVA 4CEHA 3LO5A 2WTUA 1E1QA 4CT5A 2O0JA 1FX0B 1A5TA 4OKSA 2H5EA 3BC1A 5J4VA 1KK2A 1KJYA 4HAVA 2GBLA 3TKLA 1RE0A 2IXGA 4I1VA 4IFBA 1F48A 1HEIA 4NHOA 4D6PA 3SU8A 4JVMA 1KI7A 2N42A 3ASYA 3LFUA 4Q21A 3GLFE 4JZKA 1R0WA 1ODFA 4DSOA 1CS4C 3QEJA 4KLZA 4C0JA 2ZIAA 3U3OA 1S2MA 4O3MA 1ELOA 1E2PA 1PUJA 3EAQA 4FCVA 2OO7A 4YLGA 5KPJA 2BBOA 3GPLA 4EJSB 2ODBA 3F3YA 5A5GA 4TMXA 2GKSA 2GZHA 1A82A 1G3MA 1EFUA 3WNBA 2QP9X 2KB0A 4D80A 4Q1BA 4JKYA 2C9YA 4RSGA 4JL8A 4Q4AB 2W0SA 1P61B 1TF2A 4QGAA 1ZM9A 2IS1A 1KNQA 1E32A 4ZIRA 4L16A 4ZDIA 4ITRC 1WDTA 2O52A 4JLAA 3DMDA 3UG6A 2QORA 1KK3A 2CL7X 1W47A 2ORVA 2R6DA 3LA6A 2ORIA 3LX8A 4AKGA 4KVGA 3U44B 4UNNA 3KDSE 3OAAA 1BH2A 4OQFA 4PSKA 3AUYA 4M9ZA 2P6NA 3ZQJA 2CDNA 5G41A 2WOJA 4DIEA 1R2QA 3OIUA 2JASA 5JI3E 1TU3A 3WMFA 5C18A 2EW1A 4Q1DA 4KI0A 1JNYA 2PX3A 1W4AA 2RGAA 4PR0A 2OAP1 2FEMA 2VHTA 1GSIA 1XB2A 5FTJA 2B7BA 2OFWA 3RS7A 2OFXA 3SI7A 3L0SA 4A82A 3U60B 2OSBA 3Q72A 3ADDA 4OK3A 2V1XA 2QPOA 3B5JA 3KKNA 1M7GA 1UEIA 4ZCLA 4B43A 1XTQA 3HDTA 2HXYA 2ZSDA 3QJYA 1H8HA 4NCHA 2LCFA 2CHQA 1EFTA 4OI0A 2XJ9A 3H84A 1G41A 4IJMA 4YONB 4OBEA 3BS4A 4V0KA 1P3JA 5JRJA 4AKEA 1T91A 4XD7A 3I3SR 4BRWA 4EIWA 2JLZA 4QNRA 4HI0E 3I5YA 4HB2A 1NVVQ 3OEHD 1QVAA 1Z3IX 2DWPA 2HEIA 3A4MA 1UBEA 4IDPA 3REGA 3REFA 3FDIA 1QG4A 5JZVA 4Q4LA 1KZ7B 1XX6A 5IF9A 3PJRA 3ND8A 4RY2A 3TW4A 4QGHA 4LY6A 4DDUA 2UKDA 4FI3C 1KI6A 1W4BA 2PT5A 4LJAA 1P6XA 1NIPA 2JLUA 4W5JA 4JLDA 2IF2A 3D31A 1KMQA 3Q7QA 3D8BA 1E2GA 2G88A 1JBKA 3LVQE 1U8YA 1Z6YA 3QE0A 4IEIA 3JVVA 4H9GA 3RANA 1XMIA 5K8LA 5CJ2A 3SBEA 1W4CA 3GJ7A 4KYUA 1CJMA 4Y0AA 2OG2A 1HE8B 2Z5FA 1E1RD 5EE3A 4TMVA 3QVVA 3CRW1 3A1TA 4MYUA 5F9HA 5UKDA 3ICQB 2BDTA 3ZGXA 4KLNA 4A2PA 3EIEA 4N0EA 3KB1A 1OV4A 2YC4C 3QKSA 2QQEA 3B9PA 5FR2A 1E69A 2R62A 3VU9B 4MDEA 4CYMA 2JJ2A 5DIFA 3VX3A 3U6BA 1TTTA 1T8TA 4TMZA 3R9IA 2YWGA 1SXJC 4Q66C 3LVRE 3HP1A 3HPQA 4XWOA 1MO4A 1XJCA 2FZ4A 4LZZA 5KYKA 4FWIB 1CKEA 1KI1A 1E4VA 1G5RA 4KYIB 4E07A 2B7CA 4NCNA 3BBPA 5G3ZA 1FX0A 1II0A 2D74A 3KZ1E 3MLEA 2KE5A 2OLJA 2ZE8A 2ZRJA 2ZR0A 1IJFA 5FL7A 1YR9A 3AVOA 4PTLA 4JLMA 3MUFA 1GAJA 4S35A 5L3RA 2QGNA 1ZYUA 5HR5A 3IQWA 4YXWD 5E7MA 5F3WB 2CLCX 3RAPR 3SFZA 1Z8FA 1AM4D 2YHSA 2J0UB 2QGZA 1E2EA 2C9CA 2CHVA 3TAHA 4DHEA 1KI4A 4UJ5A 1LVGA 8OHMA 2H8KA 2QTVB 1MOZA 3IHWA 2HF8A 3BE4A 3A8TA 2EQBA 3FYHA 1N5KA 4GOKA 3TR0A 3GJ4A 4OQLA 4EJSA 4PAOA 2EWVA 4PC6A 2IUTA 4UNRA 2AFIE 3W3ZB 2IT1A 1ZIOA 4WAUA 5JS8A 3HWSA 1TUEA 1WA5A 2G6BA 4Q4AA 5EZ5A 1SVKA 4MGIR 2WWYA 3EIQA 4NMMA 1T4GA 3RDPA 2DPXA 5DNYB 2TMKA 4RFSB 1ZVQA 4A36A 1E2JA 1NG9A 1X3SA 2AX4A 2CCGA 2J0VA 2WKQA 4KSCA 4GL2A 4B74A 3CUEF 2CE2X 2V1UA 2ZETA 3F5FA 2ZVQX 4QJ5A 2WWFA 2IHYA 3NKVA 4UXHA 3T1QA 5EE1A 4XTRA 3W9YA 3QSYA 1YR6A 4BFVA 1W0JA 2DBYA 1E96A 1HQYE 2MSEB 2RMKA 1W44A 1VCMA 1PUIA 3EX7C 2ZRNA 3EW9A 3CNNA 1ZNYA 1E0AA 1F60A 3ZD6A 1NP6A 3K0SA 1EK0A 2ZRCA 5H8WA 1M34E 2BEJA 2FG5A 1OSNA 1A4RA 1NL3A 2A5JA 2ORWA 3R7WB 1KO5A 1TUIA 3ZJYA 3B78A 4F4JA 2OAQ1 2YVUA 1OH8A 2RH5A 3NWJA 4M53A 4BLRA 3BXZA 4K81B 1G8FA 4JLNA 3DDCA 4V0MA 5JWRA 3W6PA 4LC1A 3EPKA 1KO8A 1G19A 4U7DA 3P1JA 3AF1A 1CBUA 2HDNB 4GOJA 1G3QA 1OHHA 4UJ3A 2ZITA 1TQ6A
chains in the Genus database with same CATH superfamily
1A71A 3MJVA 1M54A 1T6BY 2YKMA 4ZKEA 5IVPA 4EGLA 5T8KA 3DLKB 4DF4A 1HDYA 2FVYA 2PRIA 2R6CA 1GLGA 3RRZA 2J1UA 4K6FA 3NH6A 5KG6A 4ANFA 1H4GA 1ADGA 3M0EA 3VBRB 2J3EA 3AG5A 4O4JA 1HNZB 3QMWA 5A4KA 2W0MA 4LRXA 3O8WA 4MLDA 2GZ2A 2B4OA 3F41A 3MFYA 3R3XA 2CD7A 4EQ6B 3VTZA 5CABA 4I0BA 2VBWA 1GPWB 1MH9A 3OHPA 4FFSA 3D0QA 2J07A 3LQKA 4M8KA 3OOXA 2PUTA 4NCKA 1EWYA 4TV9F 3N9UC 1HI8A 4H4OA 2HFZA 5KZMB 2FUNB 2I22A 3VOBA 4LRQA 3WLOA 4J9RA 1N8TA 5B3LA 3DZBA 1IVZA 1VQLS 2R7QA 2WHPA 2XTJP 2G9RA 1FDNA 4B09A 3KQOA 2HB6A 3RB4A 4BUZA 1KQSR 3ROGA 1XLWA 2AT1B 3ATGA 2F62A 4QAWA 3ZFFC 1NFFA 1WPXA 1ISSA 1Q5PA 4PINA 1BMQB 4HCJA 4BC9A 2X0DA 4TXMA 2N3OA 3B36A 5K8SA 4EB6A 4PQRA 5FHRA 2V7TA 4CIAA 4JUAA 3K1YA 4TLEA 5FIUA 3RZJA 4BWOA 3WHLA 4D8TA 3GIRA 5LZ2A 2XLJA 4EELA 1HYQA 5LBEA 1TNRA 5C24A 3GELA 1FQJA 1MR5A 5JC8A 3LP1A 3J8F1 2V54A 1HB3A 4PWWA 4QM9A 1PCXA 1V9CA 4K88A 1TCCA 1D1PA 2ZX4A 1C0TB 3NNDA 1PL6A 3VKWA 3TW0A 3WDUA 2XSFA 2XT9A 1VC6A 1BKSB 1AKMA 4C05A 1HNWB 1KTQA 4OYPA 2P1ZA 3RBZA 3PBKA 4EVSA 4ZYWA 2C7RA 1BXNA 4P75A 2H0BA 1UKUA 4W8GA 4ZQGA 2HRZA 1NLKL 3VAGA 1I32A 3QA9A 4UBJA 1QZ3A 4LOLA 1VKNA 2GVZC 5FF9A 4HHUA 2LA4A 1RXIA 1I7QB 5IN4A 1YQ9A 5JHGB 3GN1A 4N9QA 4FYYA 2QU7A 2O2GA 1M6HA 2WG1A 1NLUA 4NO4A 3PFNA 1UZ0A 5HNKA 2CDOA 1SU8A 4LHSA 2PL5A 3ZBPA 4KGMA 3DR3A 3KLGA 1R7RA 2QD2A 5EIXA 2VBBA 4OHMA 1VKOA 2WFAA 4DV7F 4O1MA 5E9AA 4NCIA 3OIWA 1O03A 5K8UA 3CLTC 3IQFA 5IW8A 2ZJCA 1I5EA 3SXWA 3F5SA 5E8JA 2FSSA 3CJRA 2FSUA 1CVRA 4MKVA 1RADB 4CTEA 3DYAB 3BHNA 2XCLA 2ZEYA 1X13A 3H11B 1OY9A 2IY7A 1TLFA 5C8CC 2QDXA 3VJLA 4IEEA 5DXFA 3ZTQA 3IP5A 3FJSA 3BCUA 4G1UC 1GZVA 3WINE 4XTMA 4A8OA 1EGQA 1FNXH 4M1YA 2KHCA 4NQZA 1AGRA 1T05A 4LFBB 3WG4A 4QPIC 5KFGA 1U94A 3OL8A 3CCQS 2MHCA 2NO6A 1LHVA 1HYSB 1R3DA 1KFSA 3O4FA 4TTIA 1X7WA 2W11A 4YW5A 4I36A 2HAEA 3V1NA 4JV4A 4ITSA 3R4CA 1KS2A 3VZSA 5DHAA 1IBCA 4DUZF 3OQJA 4G07A 2VBXA 2C5DA 1SBHA 3O84A 4J16A 3U1BA 1RU2A 4TRJA 5DHPA 5EIAA 3SQOP 3ENWA 3MS2A 1FJHA 1YBTA 4A8JB 1KFUL 4N5LA 4ENTA 1FKOA 1IOVA 4DMRA 3LC0A 1BGWA 3FWZA 4US1R 1W2GA 3BK1A 2XQIA 3TFQA 4RADA 5K51A 2I4IA 2WABA 3MMAA 4AX8A 1NJYA 4JLSA 4IIHA 1QNFA 4MKAA 1M2FA 4ZPWR 2NZXA 1RJGA 2QXUA 2QWXA 5BNWA 3EVFA 3FB1A 2W2VA 3ELHA 2NWQA 1JIJA 1OGYA 3TUJC 1SC1A 4D8UA 1GL9B 1SC3A 1I5PA 2ZANA 4MRVA 1PNGA 1B99A 4EWTA 4FPGA 1TDJA 5F5CA 5AI9A 3COSA 1D4FA 5EJZB 2YJ4A 4WE1B 2ZBUA 5LU8A 3R09A 4MW1A 4BNXA 5F32A 1ZEMA 2J0SA 4QDXA 1OWLA 1HO3A 4J9OA 4ATFA 1PJ7A 2X5OA 2N1BA 1UQUA 3AF6A 3OEBA 4M7PA 3ZGYA 3JRNA 4FQ7A 4KAAA 3BBLA 3WYEA 4FXKB 2CF6A 4U7JA 4R8VA 4UU8A 3QHPA 1CB7A 3JQDA 1OW3B 1DO0A 1NWHA 3TTWA 2FCRA 3S3TA 3I0RA 2PUAA 4L0CA 4O3OA 3DMJB 1RUJ3 2XULA 3RF7A 2LQJA 3HFGA 3K8OE 1AUXA 1QF3A 2ODQA 2WWHA 3R5BA 4NJ4A 2CXTA 2DD8S 5JYEA 2CF5A 3ET6A 4Q7LA 3QZUA 2HYIB 1MFPA 4EHFA 2FLKA 3MF9A 1KHVA 3KLIA 3T35A 1R27B 3H5IA 1QONA 2I34A 3UESA 1YQQA 1CCWA 3PUKA 4YUDA 1N6IA 3CNHA 2IOFK 5CNIA 4ZCSA 2Z8XA 3EBRA 1P0PA 3NGTA 1L5WA 1VSUA 1HRV1 1TA4A 5HQ3B 2KYZA 3CJIC 4OGKA 3KLOA 4Q4W1 3ETDA 4DR7F 2EW2A 1XNDA 2KZZA 5CFCB 2ZEWA 1I3LA 1IAVA 4A8FA 4BLSA 1L4LA 3GBGA 1UZDA 2AOXA 1DJPA 4ZZ0A 4M1MA 3UV7A 1PVC2 1BKDR 1ES9A 2O8VA 2JI8A 2Q49A 3ZDZB 3W77A 3W2WB 3DLEB 4EMDA 4J0QA 3LPFA 1M5PC 1TZ0A 1QH1A 5HZKA 2D7JA 3RWNA 4DG9A 2ZT5A 2IWGB 3MJTA 2PGLA 2CZ4A 3QWHA 3AVPA 1LCIA 2RF2B 1HI9A 1EUZA 4X3CA 4DSAA 3AJYA 2V4ZA 3H5LA 2DBNA 3RAMA 3M32B 1MWZA 3F6EX 4PBRA 4IEYA 3K96A 4TSFD 3Q9SA 1J8VA 1DCMA 1MAUA 1SBRA 1AYN3 4QR0A 4R83A 5SYMA 5BNPB 3CX8A 4R1UA 1RP5A 3BL6A 2B1JA 5JOWA 3Q11A 1LGNA 3ZXYA 4L4YA 1P7VA 3FUUA 5JFGA 3H3JA 3BGIA 2IZ7A 1YJLA 1EDEA 1SLLA 3E9MA 2KXNB 1VMAA 3RIHA 1ULBA 2ZRFA 4RK7A 4OXQA 5KHHA 1NYTA 2CJFA 1F5FA 4FYXB 4L8GA 2WQ8A 1RAOA 3TNVA 2MYFA 4EA7A 5LZ7A 4KN9S 3JALB 3K58A 4LUBA 1H8TB 3E9ZA 5LLSA 4MGIE 3NLLA 4PSDA 2GA7A 1WUYA 3R5HA 4Z54A 2JX2A 3VPDA 1Z0SA 2X9LA 4CW7A 3DYIA 3HUUA 4UPDA 2FH5B 2QO3A 2PZBA 2VHXA 2D6KA 3KHHA 3JVUA 5A3RA 2DUNA 4R9UC 1FA9A 1WG8A 5M7EA 2D41A 1XDDA 1R8JA 1S77D 5TF0A 2I6TA 4DOMA 5GLZA 5ALVA 3UH0A 1BFKA 1E5IA 4EQZA 3F7OA 7ABPA 1F2DA 3AONB 3ESRA 3K0EA 4XQCA 2UVWA 3RB3A 4BO2A 4WHMA 2CIMA 2WSEC 1K1EA 3CUSA 1SB6A 1BN6A 1SQEA 2IXDA 3KBBA 3VPAA 2J7PD 1O6CA 2ANBA 5H68A 3BK7A 4IW3B 1X0FA 3OPQA 5E3HA 2IZOA 1U1QA 1KONA 1SD2A 3SE0A 1KZGB 4U2KA 4OQYA 1H2ZA 2EBFX 4H08A 1WOPA 1H2FA 2IIVA 1U3UA 1U98A 4A0RA 3HZRA 3CS3A 1I4TD 1SCRA 3OFNA 1Y4AE 2YXBA 3K70B 2HK6A 3ZW9A 3G82B 1JA0A 2E5FA 3G89A 1W3VA 4Z3DA 1MV8A 3EGCA 2NUPB 4AZSA 1RHJB 1PO12 1WNTA 4QPNA 2P0EA 4I09A 3J7AN 2G5CA 3G8DA 3A0UA 3H9AA 1WW2A 1U2PA 4YVSA 3ZZ0A 2Q5HA 3SISA 1ZD8A 1NNI1 5EUHA 1NFRA 2ALYB 1HL7A 1ADJA 5LDGA 2MY8A 2PD6A 4OP2A 1M6NA 4EFAC 4A7PA 3LO8A 1XWFA 1TQ8A 3RZLA 2QENA 4QFBA 5JD3A 4A7ZA 4KNVA 3ETOA 4OV6A 2X8JA 3CLUC 2COLA 3C4QA 4IO0A 3E6DA 5COAA 5FBHA 1XZBA 4EROA 3CGIA 4LRWA 1YR7A 3AFNA 3WNCA 2JZOA 2I1VB 1KZHA 3ZTRA 2M6LA 1UZNA 1DOZA 1Z3CA 1E4EA 2ZI5A 4WY2A 5J47A 1DZQA 1W8UA 4Y33A 3LHKA 3BHMA 2O5RA 1MROA 3H8YA 1OX4B 3W61A 4DWJA 3E2MA 4DLUA 4L8YA 3SM9A 3J8F3 2G4CA 1TD1A 3G5TA 4J7XA 1DGQA 2WT4A 3A05A 1QQAA 4QWBA 1WC6A 1SVSA 4QHBA 5IS2A 2VP5A 4EJ2A 3K9LA 1O6BA 4P34A 1AL22 4XBLA 2CFIA 4LNUA 1LA2A 1ZAWA 3C3DA 3WFZA 1HB1A 4IRUB 1H98A 2ZQYA 5K4GA 1QH9A 1SPBP 3AY7A 4ID9A 4B4QA 4ZDJA 2YBKA 1GWLA 4EY5A 4XAQA 3L0CA 3Q1KA 4U0JA 1ZQ9A 3LF1A 1Z0JA 3DVLA 2QSFA 4P0TA 4BGUA 3ZWXA 4ES9A 3HH8A 5TEWA 3AL6A 2JDID 4DU7A 3WB1A 3I61A 4MDFA 4IOLA 1KJQA 4IFYB 2YWBA 4LXGA 2PZEA 3QBEA 5KDDA 1MZPA 2E6VA 5C3SA 4O25A 4J16C 5FPKA 3K57A 2V69A 4PZEA 4EBEA 3K5NA 1MQTB 2Z98A 3NATA 3UGKA 4MROA 2ZE2A 4Q4V3 5J2TB 2ODTX 4KQEA 3W7AA 2CW5A 1XXNA 4DCPA 1K66A 5L53A 2OMOA 1YJXA 2HOQA 5KT5A 4BYMA 2OEKA 3CU5A 2JFKA 3OB8A 1QOSA 3GIKA 4OJNA 4YASA 1GZWA 2W6PA 3VGUA 2BSQA 4MGKR 5A2QY 1FDDA 3KXKA 3MD3A 4XHXA 2VUTA 4ZP1A 5FY0A 1WE2A 1SRQA 4IIJB 5A8RB 3M2TA 1EXDA 2YC2A 3KK3A 3VU1A 2QN8A 7AT1B 1Q1BA 5T6BA 2JFHA 3F7MA 1ZA2A 1AZDA 3LRTA 1SULA 2CWWA 3OQMA 4JUFA 3WIUA 1WLWA 5G1PA 4KRGA 3A6GA 5IULC 4X92A 2CGPA 3GLGB 5DPNA 1ULFA 1CT9A 4NWIA 2J41A 3QO9A 4DCJA 3O03A 4QQLA 3LPAA 1KVUA 4QBHA 4IOKA 2W6IA 4IV8A 5JOZA 2FIUA 4GX0A 4F4IA 1XU4A 4DAEA 4P6QA 2JLVA 4LK2A 4PX3A 3BF8A 4YO7A 4URZR 3WCRA 4DA9A 4DIMA 1UETA 3CUWA 4CT9A 4MGTA 3D6TB 4PABA 2OHIA 1VE5A 4WADA 4E7PA 2QYGA 3DGVA 1H65A 1PZEA 4BBZA 4MQ6A 5IK2A 5ITZB 4NFHA 4UM9D 1D1UA 2LV8A 3TB0A 1XAIA 3LE8A 5T64A 3AQPA 3RJZA 3CDWA 2BR3A 2JICA 3HDHA 1GA6A 4OK5A 4EUNA 1HQLA 1T6XA 1Q21A 4WVZA 4ARVA 2HV8A 5L3VA 1RTHA 1XDGA 1ZH0A 3ZU3A 3JYQA 1RT7A 4H35A 4URQU 3IBYA 4MS4A 1GNKA 3URKA 1ANKA 3T7EA 4OZ1A 4LYGA 1QIDA 4J43A 1DBIA 3MUEA 4C4SA 2YHAA 3SEAA 5EJ6A 4KO0B 3FL7A 4OBWA 1Y4SA 2PX5A 4B1LA 1VQ9S 5JQGF 1OUMA 4KY3A 5HRUA 3GAZA 1K2WA 2Q50A 1LRKA 2HDWA 5A5VA 2DWRA 3EVGA 2B78A 4C0KA 3LC7O 1ZL0A 2FQQB 2KL8A 2NTYC 4GICA 1YD7A 3WL3A 1W04A 3CF0A 3JAWB 2YPDA 2V5HG 1ADBA 2V4QA 3OKCA 3EQ8A 1KI3A 1UAIA 4M5DA 1CIPA 2NLWA 2ZMKA 4JI6F 4BU1A 5J2UF 2ZXEA 1E8NA 3EYPA 4R2WA 3LUBA 5A8KB 4K4ZA 1B6TA 5IWCA 2Y0BA 4QR2A 4PZAA 4HXCA 1QE1A 1WSRA 4ECWA 1HJGA 2PFGA 3TNPB 4Y24A 3WSOA 2VP6A 3KLFB 3TEMA 3VZDA 3J9SA 3CC2S 4YY3F 3PIGA 1OU0A 1PAEX 2NSCA 1IUJA 1PWYE 1A9QA 3U49A 1KEWA 1C30B 4ECQA 4F3JA 3CKYA 1UA0A 2XSZD 1JLBA 5DLYA 4D0LB 1U1FA 3NY0A 4UCFA 3NVAA 1SG0A 3OT9A 2A1UB 3M8KA 5JU6A 2WONA 1KPIA 1XZ8A 1PS8A 1WMXA 2IP2A 4QOTA 4GOXA 2FLLA 1ZXLA 4DV3B 5COQA 3OPYA 3N7LA 4Z2YA 3T1HJ 3QXJA 3IO3A 4BVBA 1JJCB 4KVZA 1DGRN 2YBSA 4JKIA 5IKPA 1PZ8A 2OBNA 3TSCA 1WSBA 2R25B 4C7OA 4I7EA 3WRXC 3X1JA 1O5LA 4FYWA 2P6OA 3MMBA 3QXXA 3LX5A 1HB2A 1PC4A 3RJTA 1R4NB 3RIXA 1J20A 2J5RA 3PIIA 4I99A 2VPZA 4NYMQ 4NVPA 5LXRA 3OCVA 1Q7EA 2WNIA 5DNEA 4LREA 5ADZA 3EMDA 2O59A 4LGYA 3BGOP 1YK1A 1UWAA 2BZGA 1VR6A 5IKEA 2C2RA 1XEWY 4UFLA 1OLXA 4BM8A 5EV7A 1FK8A 2XVGA 4ZXKA 4AXBA 4PQFA 1JYXA 1YJAA 4B17A 2PS0A 3F74A 1SJRA 1MABA 2WYOA 4N53C 1GGFA 4XABA 1CDDA 3GQBB 4FKYA 1FMD2 2K7FA 3VR6H 3DM5A 3LXXA 2W95A 5A9TA 2XODA 4PZCA 4ZAZA 2CYYA 2AEJA 1KOOA 1RLJA 4WPGA 1GP4A 2QD3A 1N6OA 2X4GA 2W9BA 2OHFA 3OM0A 3DPRA 3ZVNA 1EBFA 3WL8A 3BRWD 4YVSC 5JTUA 4RVGA 4ZT2A 4H4MA 1APSA 3IRWP 1XSRA 2OBXA 4DJFC 1CY8A 4DQVA 2QX9A 2I2WA 4A0HA 1OMSA 2QRMA 2DYAA 2P4UA 1G17A 2WU3A 3ZH2A 4EYQA 4NCGA 4IQXA 4V0RA 1CC7A 4M76B 2HJHA 3CSSA 3MMZA 1XFDA 1N2SA 5HROA 4Z2AA 2HQIA 4JI4J 4ODIA 3RC8A 3HO6A 3G85A 5CFQA 3TVKA 2AZXA 2VDRB 3OR2B 3CJQA 3LEIA 2ZHMA 2A59A 4G9EA 1GMWD 1RUSA 2M2IA 2FVCA 2C2OB 2W92A 2PXXA 1TME3 3D59A 1PV1A 1VG9B 4K2JA 5I7VA 3IVAA 3R3ZA 3BB5A 3M9OB 4XIKA 4JJ4A 1N2XA 1P27B 3KAJA 1NFQA 2CZ9A 1EI9A 2Q5QA 3LL4A 1DKUA 2DGOA 4Y98A 1X4AA 1ISMA 1LJLA 4G63A 4J7UA 2W2IA 2HBTA 3K0FA 4Q1FA 2DNNA 3H83A 4D6QA 5IT6A 3W5MA 1NSFA 3FEZA 1YB6A 3OC0A 2FWJA 3N05A 5IQ6A 1P4JA 2BE7D 3E8SA 3P49B 5JADA 3IR7A 2V59A 1LTKA 1WLYA 3MCTA 3EF0A 1URXA 3VPBA 2E32A 1JJBA 3HEIA 4FFLA 2UZ0A 2A5ZA 2QLBA 2A0FA 3R7NB 1P1CA 4QX3A 2OFPA 5J2PA 1A2OA 3HKBB 1Z07A 1FE4A 2WB4A 1P5ZB 4TYSA 2NR0A 1S9DA 2D0DA 1H2LA 1DCFA 4JGGA 1UEKA 2DUPA 2FFAA 4WN3A 2YC2C 5J9FA 5ALOA 5BRAA 3MT9A 4J1TA 4E03A 3L0PA 1NBMA 2J1SA 1BJQA 4NX9A 1HMPA 2X6TA 2YYSA 3PYEA 4XAKA 2FHPA 1KDVA 2RDRA 4CCHA 3GLVA 4BQNA 4EKEA 4AJ4A 3ZDRA 4ZAYA 4ZQHA 1I4LD 3RSHA 4ACAA 2VG7A 4ILMA 4QZVA 4EHAA 3LV8A 2IIHA 5FOUA 3PXXA 4HVCA 3Q8KA 4QU7A 4Z07A 4TT8A 3G0OA 5DM60 3K9CA 2FFJA 5C9ZA 4USJC 5JROA 2MDAA 1U4BA 4G2TA 3F90A 1AB8A 1Z5UA 1AZTA 5LATA 3PPXA 2C5AA 4G36A 1PVC1 5AHKA 4UT4A 4OXXA 5J98B 4S1NA 4PQUB 3IOYA 3N0VA 5I8WA 4A42A 1N0WA 3A7EA 2EWHA 2WU0A 5H9RA 4R01A 3SCFA 2MNGA 3JARB 1KK2A 3J80Y 5HO4A 3SU8A 2EIDA 1BAPA 4Q21A 3A1YG 3TL2A 4O0NA 4DSOA 2AZ3A 3AG6A 2ENRA 3KL2A 2OY0A 2WJPA 3RQIA 3EAQA 3KC2A 4QT6A 1VI6A 1VPEA 5AM0A 3PACA 4IRKA 4F9TA 1S9FA 2XWSA 4GO1A 1WCDJ 3RWKX 2YKOA 3IPCA 4JL8A 1P61B 2QRQA 4IUBS 1CUSA 4MVJI 1Y9QA 5E38A 3MBOA 1A9XA 4DQSA 3N2ZB 3LX8A 4IXDA 2CPEA 4B4UA 4OCTA 4JP3A 1A7AA 4KO1S 1XMBA 4PDWA 2CZVC 3HHLD 5A7SA 4ZPBA 1X0XA 2JNWA 4GRSA 5EJ8A 2DWUA 5EFOA 1JIIA 5H02A 1L8AA 4RVDA 4LDAA 3FOEC 5CR9A 2YPYA 4M5GA 5F1KA 1V6SA 5LJIA 1YAHA 1GTHA 4JI1J 3BD6A 2ZUGA 1V2GA 1MAVA 4WKPA 5I45A 1RLOA 1NY72 2ZHOA 3N8IA 4JHTA 1C7RA 3FDIA 3NP5A 1SH7A 1CPYA 5IAKA 1FP2A 1DT5A 4TKZA 3LI2A 1WI8A 4MTPA 5LYJF 1DYPA 4JLDA 1HYBA 4GLLA 2VDWA 4CHTA 3LF0A 3NNHA 1VC0A 2MT9A 5FIXA 1GDTA 1CJMA 5FZ3A 1G0OA 4KPFC 2D1CA 3OJFA 4EJRA 3QVVA 5UKDA 3Q7TA 4X7RA 4LR4A 3OOSA 1ZY2A 2XH6A 2FP4A 3QKSA 3ENAA 3VU9B 3DOJA 2AZ4A 1H2UX 1RK8A 1L3IA 3KE9A 3UYLA 4LIVA 4NLOA 4XWOA 4Y65A 4F04B 1WHYA 1E4VA 3PDIA 4QDTA 4QTXA 1QYRA 2D74A 4M87A 3JD2A 1YFLA 2YH2A 1U0RA 1XYOA 2BW8A 2ZR0A 2M70A 1DQPA 4DY3A 1YVFA 4YW7A 1SD1A 1W8IA 3K2EA 3MMSA 4C7MA 4N43C 3OA2A 1OGIA 3A8TA 2X8KA 1T4BA 5IKXA 4ILRA 3CNBA 4TKUA 1PO11 3A32A 1HDEA 1GPNA 3HWSA 4QW9A 4F60A 3PVCA 4IH4A 4NMMA 3ABSB 1T4GA 3K5WA 1RE1A 4ZVSB 2DY0A 4A36A 1Y7LA 2OK8A 2FGCA 2YHJA 1DBWA 3KVAA 3O21A 3CUEF 1JYVA 1E5XA 1BRTA 4LZNA 2XS5A 4QPJC 3O38A 4YT5A 2Q1FA 4IH9A 1FRFS 5CA1B 2OD9A 4EO6A 1S2KA 2HSDA 1RUJ2 1TL3A 3EIOA 1SIUA 2GBPA 4F02A 3HXPA 4V0MA 2KH9A 2DKOA 3NHJA 3ZZMA 3HBFA 1QGOA 4X62F 4YVFA 5EZYB 3AF1A 3WQ0A 1VBFA 1RAAB 1SOWA 3FMWA 4IWNA 1Z37A 2ZJPQ 3QV1A 2GN0A 5HCUA 5LQNA 4N56A 4E6EA 2AG0A 4WN9A 3Q3HA 3N9IA 3AR7A 1AL21 1E9DA 1UIRA 1DG3A 4HWRA 5KTKA 2WMOB 1TQ4A 4JV1A 1ZNPA 4DDKA 5K3EA 1HR0J 4HDAA 2ZHBA 3DPRC 4Z7CA 2WVAA 4V2UA 2HA4A 5LOVF 5TEVA 4JYMA 2R8HA 2JPDA 4DR2F 4DQQA 3BAZA 1L7MA 4RMGA 3CB4A 4D9HA 1VB2A 4UUOA 1XRNA 5AJHA 2LRPA 4HN1A 2HEGA 4BE7B 4EN8B 4R81A 1VCHA 3LKZA 2J3MA 2J46A 5KI6A 3EGZA 1CJKC 1NCQB 3AJRA 1WOMA 4IINA 4YRNA 2ISQA 3QPDA 1YSJA 4H3HB 3WZLA 4EW6A 2LKDA 4QGMA 4P4GA 4NAMA 2KJVA 3OU7A 3IEVA 5TSWA 4BVJA 4CNQA 5F2EA 3GP9A 2Q3MA 1RBAA 2AHOA 1AYN2 3VGPA 1MIOB 3CBNA 1J0XO 4MIAA 4X3OA 3OXLA 1LDNA 3IBTA 4EEZA 1T0IA 1UXXX 2UDPA 3RWOA 1HRKA 3SC3A 3W34A 3ZLVA 4CU5A 3OQ2A 1XR7A 1XVVA 4RHEA 4IFTA 1H8ED 2YMZA 1IG3A 1PVOA 6LDHA 2WUEA 1GGMA 3OI7A 1YOVB 2E9SA 1KDOA 3CH5A 3HCFA 4YJ2F 1YBUA 4D3YA 3TB6A 5L45A 3TWIA 3IURA 2V6JA 2D13A 4EHIA 4LIPD 3M9MB 1IHMA 4AQ2A 3O1SA 5KNDD 4R52A 3HHKA 5CVJA 4UDNA 4BK5A 3F0TA 1SLTA 1H42A 1XQWA 4FCWA 1UW4A 1WABA 3GV8B 1QIKA 2YB7A 3I8TA 1R1DA 2XRYA 3AP4A 2ODNA 5A4MS 3ENRA 4NOJA 1H0HB 5H9FK 2VHGA 2VJUA 1HV8A 1OBOA 2QMUA 1X7VA 3WK5A 2OGZA 1PSZA 5CZKA 4GBGA 5AJZA 4DTIA 3MHTA 5ARDA 2I4MA 1EAH1 4LJ7A 1PFGA 1LQ2A 2M0GB 1S0NA 3NBKA 3VU3A 3WQBA 3GLHA 5KTPA 3WKCA 2PAFA 4DHVA 5FV7A 3P2MA 5GJ6A 2F3PA 4J1TC 2CCKA 3K7RA 3ZIUA 3USES 4KWUA 5HMWA 2BZSA 3CVJA 3SC2A 3H4BA 4FYIA 4KR2A 2ZB7A 1IWGA 1VLOA 4IL7A 2XO6A 2VKRA 1NY5A 1M1ZA 3FAKA 4MKHA 3C98A 2XTZA 3KQTA 2OAGA 4QD2A 1TKCA 1JIHA 3IKVA 2Y66A 3ZWVA 4CUCA 1TR0A 1T2CA 4W1SA 4XSGA 1PL0A 3GFQA 3NJRA 1C8LA 2IDLA 3SS9X 3VDBA 2R8PA 2JGAA 4MGYR 3ILXA 3GN2A 2HY7A 5H1YA 3CEMA 1V3RA 2YFUA 4CEIA 2TMGA 2AE2A 1C3HA 4KTQA 4QKDA 1U99A 1BO6A 1D04A 2FWBA 3N0RA 4KHRA 1I30A 4EO8A 4Q03A 1KQFB 5D0HA 3IIAA 4NG5A 5L4NA 2VT3A 5BN5B 3OTGA 4Q8EA 1E5QA 3W5CA 4N7JA 1QR2A 2G7MC 4DUWA 5HOEA 1SHLA 2ST1A 2AOVA 2O3SA 2OHVA 4PIXA 4I50B 3P20A 3SCZA 4RPIA 4JELA 3AOEA 4AKTA 4EBDA 4DL4A 2AEYA 5KQGA 2QMZA 3V1MA 1CQJB 2ABYA 1HQKA 5GZ3A 1T7PA 3MFIA 2XG3A 4PDWC 1UPFA 3GGDA 3T3YA 1A97A 3U4AA 3GYDA 1W6PB 4ARXA 3DWFA 4Y5TA 2LUWA 1NBEA 3WGZA 2D7DA 3SCGA 3QVTA 4KNYA 1KSJA 3ITKA 3ACFA 4QE3A 4OX8A 4U63A 2QTCA 1M1GA 2BH2A 3EIHA 4UTXA 4TTGA 2DFLA 2XE4A 4CQMA 4DCTA 4C4PA 4B3IA 2IEAA 1ZUD1 1PK8A 5MGNA 2F1OA 2ZGMA 4MVJP 5DK6A 4YDSA 2B39A 3SF8A 2W1SA 1ZRCA 1JWWA 5LZ8A 3M1AA 5A7WB 5HP1A 4UF4A 3DMTA 1JAYA 4K2XA 4HPWA 2M5YA 5IG2A 1LRHA 1S1VB 4L78A 1C8KA 2XI4A 3ROMA 3SZOA 1QHNA 4GECA 4Q4V2 1M1NA 4Z2XA 2YICA 1B16A 2JDMA 3G8CA 4I02A 2W7OA 4D8YA 2BPOA 4OLJA 4YC7A 1HA3A 1G9DA 2Q4DA 5HMLA 1QYWA 5HF9A 3KLNA 4B9NA 2FA9A 2ZGNA 5FOWA 4AMYA 2YYYA 2VR4A 3EVOA 2VZVA 1VQNS 4FX5A 3TOXA 5TIIA 4QGBA 2LW8A 3CPHA 1U5ZA 3OPKA 4K9SA 3G6VA 3FJOA 2XTAA 4U7TB 3FIJA 1CZUA 4YFUA 2IIBA 1FMD1 5FOBB 3KV4A 3EJ6A 4PSCA 5IKMA 1NVXQ 2FZLA 2Y68A 1K6MA 3M4XA 4I9NA 4AQ7A 3TQHA 3VX4A 3ZDBA 2AC1A 2Z58A 2EI5A 2C4HA 1J70A 3HVUA 4MR7A 4JCCA 1D7PM 4IJ5A 2GPAA 2ZT8A 1EE2A 2WE7A 1XA4A 1XL0A 3MWGA 4H15A 2PY6A 4BNVA 3UI3A 3F46A 2C0ZA 5IJWA 1OXXK 2NTJA 1D7AA 2J42A 3DM9B 3I3DA 2AW0A 5AW8A 1HB4A 5KOHA 1J6UA 3F3KA 3D5QA 3H2KA 1FQKA 2H1IA 4GPEA 4YT2A 4Q4HA 3WLJA 3K1JA 2O5EA 3I45A 5BYRA 1XRJA 3QACA 3QKTA 2IPNA 4FPKA 4M1OA 4WFKA 2QW1A 3TZLA 4WVFA 1RKXA 3UJQA 3NV7A 2Y0IA 5TB5A 4Q19A 1YQWA 2YXPX 1XPOA 1CJUA 1KYQA 2QPAA 1TA9A 5K4LA 3MEEB 3ZV6A 4AZ0B 2MZTA 3M2VA 2E49A 2JVOA 3A1WA 1ZW1A 2ZMLA 1N7GA 3QEAZ 2C5FA 1NXQA 3FQKA 2IXFA 3GDWA 1E2FA 4ALKA 2Z83A 4TL9A 2QL7B 2YVKA 4HDCA 3R7SA 5IF3A 5FDBA 1GFWB 1SUSA 5T5PA 1HNIB 5KNCH 4N77A 2JHPA 3I9OA 5EXEA 4TV9B 3TLEA 4PAGA 5DO9A 2MSSA 5CEEA 2DYCA 4QIWD 2GXUA 3K70D 1ZZFA 1VRUB 2QVSB 2M3DA 1D2EA 3RWBA 3DLAA 4Y0FA 4KUEA 1YACA 3I3QA 4PC2A 2VHUA 1EZ4A 5BMOA 1KVQA 1QQ6A 3D3WA 4XGNA 1G9TA 4IGQA 3K73O 3ZCSA 1I14A 3NCTA 4B83A 2AD5A 3KJIA 2RI6A 3ES1A 4Q8FA 2C4NA 2FRDA 4CT4B 3ISVA 4J6FA 1NMXA 4WKRA 3MM6B 4M5NA 3E48A 2UUAJ 3ZLBA 3SHWA 2IRXA 4G1BA 4M95A 3IDQA 5CBKA 5DLPA 2ZR9A 4IP0A 3VYVA 3FI0A 3RLIA 3A37A 4UD2A 1Z5NA 1LF0A 3ZU4A 2QLFB 1MEEA 2HZAA 5CD9A 3JWPA 1PZHA 2DGVA 4MPPA 3B6KA 1W90A 2BI4A 2NU9A 2NSBA 1YQ8A 2KTQA 1GRRA 1D5CA 4UU7A 5ENDA 4CG3A 4ILEA 2PG3A 3FWYA 2PHLA 2P9EA 2QP4A 3ER9A 1OQEA 5JVHQ 4HT3B 5GZDA 4DMGA 1B23P 1M1YE 2F1HA 1YR2A 1XKQA 2CJKA 1Z4LA 2JATA 3L41A 4MOAA 3ZV3A 2GNPA 2VJMA 4ZJZA 1AH2A 3PTWA 3J81k 2Z6VA 1DTEA 5D77A 4KQ6A 2O0HA 1JKHA 4AICA 5EA2A 2NVOA 4O4IA 4LI0A 1H5UA 3O47A 2HIAA 1BWEA 5JUWA 5T3NA 1UPIA 1L5ZA 4NJMA 3AVUA 4CDWA 3ZCUA 4DLZA 1X9HA 4RHV3 1H4HA 3W2VB 3BMCA 2D7SA 2BOJA 1JU3A 3A25A 4JJ8A 4U2EA 3VTIA 1UC8A 2B9YA 2XX3A 4DV7B 2K6GA 3R6LB 3N2KA 2EIEA 1N48A 2WEKA 1Z78A 4G4SO 4CM4B 3GGOA 1JWLA 1SLCA 2VDUE 1EEHA 1N9GA 2J1LA 3CJ0A 5LMUF 5ALRA 3ZFFA 2YZ7A 4FGJA 4ZONA 4H0CA 3HVHA 5I42B 2VK2A 4J6EA 5AI0A 5JDCA 1DLJA 4QDJA 1Y5IA 5C5DA 4DM7A 1S72S 4JT2A 3O0TA 1W8DA 1UMBB 2FR0A 2AUTA 1SH0A 2AK3A 1C3OA 2ZRPA 3DCIA 3H9JA 1U1GA 4NIMA 2RS33 4RY9A 3UHAA 1JUDA 1UKCA 2PLWA 5CU7A 4XUGB 3RW7A 1OCEA 4Q0UA 4EATA 4C7KA 5LKRA 3QU4A 1DOAA 4LITA 1PT7A 4H2AA 1IULA 1X8MA 1FFXB 2QY6A 5I4MA 2LP4A 3VR5A 1TTPB 4DR6J 2BEVA 4FTBA 2NZ4A 4MARA 4YAEA 3S29A 4WZAB 4EK9A 1H1IA 1ESEA 2BUCA 1UFLA 4URFA 5K8CA 4R0NA 3NWPA 3AFIA 4OHYA 1CS0A 1DP4A 4DUZB 4RUHA 3PSHA 2GVZA 3I6QA 4EGQA 2MY7A 1PGPA 2A6OA 1VRBA 4ZPVR 5EJ9A 1UWBB 4YB6A 1NY71 4FGUA 5J4LA 1CBKA 2EVWX 4PXYA 2RKIB 3IX7A 4WIAA 3OGSA 1CQXA 2B1RA 4L22A 3QZ7A 1A9RA 3GFYA 4YCLA 2B7BB 1FYUA 2JIZD 1AUPA 2FQPA 5JJBA 4F8AA 3UN2A 5LXTF 5CBPA 1EAH3 3RYFA 3AINA 5HDQA 2W5FA 4ISRA 1SXQA 4JK3A 2WMDA 4Z6KA 2OHGA 3BMOA 2H1SA 3FETA 3QY0A 5DBEX 1EWQA 1C1XA 3HLKA 3AOEC 1WXEA 1FAYA 1FDRA 3HNPA 2ZU6A 5JVDF 1TME2 2WT9A 3OF1A 3SY8A 4RK5A 1QZTA 2W6CX 2EZ8A 1G20A 1UK7A 3I9V1 2BFUL 1JEQB 2ADFA 3OEAA 1KDRA 2ZRAA 4JODA 4LK7A 3V3TA 1UBFA 2VDHA 4HEQA 4F3QA 3LAMA 4V1CI 1VHJA 2BKNA 1LX7A 7GPBA 4TX1A 2DT8A 3J7NA 1IQUA 5D2CA 5ARBA 5K9FA 5A02A 4JBWA 4QPIA 2QW8A 4PO3X 2MLZA 3OV7A 4DS3A 2QLTA 5D8AA 5FQ0B 2N9UA 3WG9A 3VUFA 3BSYA 4M5JA 2YFZA 3DS8A 2PN1A 5CKQA 1MEJA 5C35A 4ASKA 3HSYA 3BJRA 3OCUA 4KV9A 3HA3A 5HZHA 5A9RA 1C5HA 2ZSUA 5CYMA 3A04A 3VR4D 4NBSA 3AXKA 2E5LJ 1XMQJ 3QSIA 3NNCA 5C42A 2JLQA 2AI1A 4IJ6A 3AV0B 1RUJ1 3A2KA 1U31A 3AUUA 1ZBDA 5CH7B 1WMSA 4HT1T 3R2DJ 1TVMA 2ACKA 2GCOA 1AQYA 3DNPA 4AB1A 5AOAA 3I04A 1C28A 2A86A 2BFFA 2HRUA 2I29A 3QYPA 1SC4A 3BMNB 1XZLA 4J2HA 4ZJYA 1KOGA 3N8KA 3UO8B 1GZ5A 4W65A 3E3AA 2P3IA 4FQ8A 3DBVO 1Y7PA 3WGOA 2AZ1A 2B7LA 2P5BA 1JDTA 4RDHA 4GR9A 3KJNA 3RRXA 2XJPA 1O3SA 4DR7B 5AI6A 2DXDA 5C7PA 4LFCJ 2C28A 1Z56C 1SKYE 4JV5J 2W2NP 3MB5A 4LNHA 1Q50A 3NZEA 1J0DA 5BV6A 2EATA 2I76A 4FD2A 2QFIA 4W6QA 1UBJS 1RXUA 2W2MA 5JEDA 1YQ2A 2ZR7A 3WR0A 1XYNA 3IRXB 1G6BA 1VGRA 3WGQA 1F3FA 3AKDA 1QSSA 1VKRA 1JA1A 4B7EA 4QJIA 5CU1A 4CUAA 1NQ5A 5TF4A 4A6DA 4M8IA 5KYGA 4M36A 5L3SB 3PPVA 1EQAA</