2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Protein CLP1
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
5GJWC 1CR4A 3TBKA 1KI4A 2ZANA 3N2EA 2I3BA 4JLOA 5DI3A 4CIDA 4CYMA 2ZRGA 1JI0A 1N25A 1HURA 2ONJA 1TQ4A 3T1OA 4FXPA 4TQAA 3N5CA 2VEDA 4IDOA 4JL8A 4P3YA 2BCJQ 3QBVA 4PQRA 1Q12A 4HZIA 4MRRA 3IIKA 3GPLA 3AUYA 4JT4A 5GJBA 2J0VA 4ESHA 1JAHA 2PLRA 4BFUA 2HT6A 2NMVA 2D7DA 1CRQA 4PHHA 4QG7A 2JATA 3S1AA 1T4GA 2KBEA 2YWGA 3D3QA 2B6HA 2WWGA 4WBSA 3T15A 3SEAA 2R9VA 4M0LA 3ZD7A 1GL6A 2GNOA 4DIDA 3PUVA 1R4AA 4ZCLA 2JJ1D 3TW4A 1IXRC 2PJZA 4QM6A 1R8QA 1G6HA 1WXQA 2VO1A 3MCAA 5LD2B 5F3WB 1ZM9A 4PSKA 3OAAA 721PA 3QF4B 4I1SA 2MSEB 2QGNA 5CDFA 3PEWA 1SHKA 3U7EB 3GFPA 4IJMA 1KOFA 2GZHA 4GP6A 2WTUA 3K8YA 3TUIC 2WJHA 3EZ7A 3RABA 1NMYA 1E2PA 5CK5A 1MH1A 1E9EA 1KDTA 4TMTA 2AXNA 3OIVA 4KHZA 1WBBA 1TUIA 4YDHB 5FOWA 1DAKA 4D4MA 1U8YA 3FDIA 1C1YA 2ZYTX 5C4GB 2IK8A 2C98A 1XJCA 4TL7A 1Z22A 4DC9A 3CPHA 4LHWA 1W4CA 2P67A 2AX4A 3TMKA 4DSOA 3KQHA 3RC8A 5DISB 3UWOA 2ZS9A 1DAGA 3TW8B 4LI0A 1NLYA 4AKIA 5G41A 4ESVA 5C18A 4Q01A 2HV8A 5SZJA 1AIPA 1D2EA 1ELOA 3K53A 2BEJA 3QJYA 3RS7A 1QG4A 4A9AA 4XOIA 3ADBA 1UDXA 2RGEA 2ZI6A 1SVOA 3KFVA 4Q4HB 3X1DA 3KQKA 3TVTA 5B2ZA 4QBIA 2ANCA 2J59A 1MABB 3P4YA 2Q9BA 2IEYA 1LNZA 2VHUA 1C4OA 3DZ8A 4PANA 2FSGA 3CRMA 1ZVQA 3B85A 3AVOA 2IT1A 1ZMXA 2J1LA 4HZUB 3QF7A 2HF9A 2AFHE 1OJLA 4B71A 3U7HB 1U98A 1FUKA 1OLOA 2YZ2A 4URVR 3FHTA 1BMFD 1W0JD 1W4BA 1Z0AA 2PZFA 3THYA 1S0UA 4JSYA 4R7ZA 1GILA 1G21E 5HZKA 3K09C 1RRCA 4DCVA 2FDCA 4ACAA 1AQYA 1E9BA 3MMPA 4C0QC 1Q0UA 4JKIA 5JWOA 2ZJZA 1A2BA 2IS6A 5JI3E 5FH9A 2ZJYA 4UXJA 4XTCS 4HYYA 4RZ2A 4EFMA 2PBRA 2JJ8A 1Z6GA 4FWTA 3MRSA 2YOFA 4MA4A 1N0VC 4AURA 2CL7X 1M74A 1E9AA 4KSBA 3B1YA 3RLFA 1QHHA 3F5FA 4QHSA 2F55A 2ZROA 4B35A 2ZEJA 3GLHA 1E69A 5K8LA 4QBHA 2IX3A 3AF4A 1IXSB 2RHDA 3C16C 1KMHA 3K0CC 4ZO4A 2GXAA 2GK6A 4M21A 3AP1A 4G01B 4BZPA 5JWRA 1GDDA 2I1VB 3CRQA 4V02A 1GNPA 2EFEB 2KI5A 3W6PA 2QNRA 4X8MA 3R9WA 1L2TA 3FHCB 2IUSA 4TMZA 1Z6TA 4NYJR 1F2TA 4JS0A 4TN1A 3OZXA 3QKUA 2OCAA 4DB4A 1KSJA 2G1KA 4ZPXA 1YVDA 1E2EA 1N6LA 1KI1A 3LXXA 2OLKA 3WMEA 2WMNB 4IVPA 2BVNA 4EKDA 1F6BA 1UF9A 1FZQA 4RFSB 4CT5A 1JJ7A 2CLSA 3QI2A 1AJEA 3T1VA 1P60A 2FFHA 2BM0A 2EU8A 4RD1A 3WBJA 5BYKA 2J3EA 4JLDA 1J70A 1R6BX 1P2TA 4LV5B 2QAGA 1W0KD 2NIPA 3MJHA 1RRFA 2BMEA 4JVLA 4Q02A 1XXHA 3A1TA 4I1OA 4Q9KA 1Z29A 3KB2A 3LW7A 3NBYC 4IOKA 3LXRA 1N5LA 1UDWA 5G3YA 5JECA 2J7PD 4JT2A 1UKVY 4EJSA 2YOGA 2RKOA 4TLEA 4Z51A 1NG9A 5C46F 3NDPA 3CF2A 1ZU5A 3QEJA 5FL3A 2G9NA 4IDNA 3K0SA 1T0JB 5JMTA 1ZCAA 4DIEA 3VR4A 3NH6A 1YZLA 4Q1BA 3AV0B 3DKVA 3U3RA 2Z83A 1YE8A 3SNHA 1VPLA 2BBWA 3THOA 2QG6A 2AFIE 1GRRA 4CDGA 4Z54A 5L3SA 1FTSA 4E22A 5AUPB 1P9NA 2WZQA 2BOVA 1Z07A 1KI9A 4BFZA 3OESA 3A1SA 3CONA 2ECKA 3PEVA 3UMRA 4B75A 4YMTA 5ANRB 3LW8A 4MQBA 4HUQB 1W46A 2XAUA 4AYXA 4N1AA 4B48A 4RCYA 3GJ3A 1Z6YA 3MWJA 1OXTA 1QHXA 4O2RA 3GLIE 2BKEA 2FFBA 2N42A 3W9YA 3LX5A 3NEYA 3I8SA 1UM8A 4Y0AA 4HDOB 3PIRA 4KJZA 2GILA 4ILEA 2CK3A 3B2EA 1K6MA 5F9HA 3CRRA 4MRVA 3W8NA 1WF3A 4IW3B 5FPTA 2YJTD 3SI7A 1S9DA 3SJCA 4FMCB 1WMSA 4TL9A 3UWKA 4BLRA 2QBYB 5IRCD 1OXVA 2ERXA 2VYFA 1KO4A 2XSZA 3KKMA 1GM5A 3CLVA 2CHVA 2ZPTX 2OT3B 3LNCA 1HY3A 3NH9A 4LJ5A 1G8PA 4U00A 3LLUA 1ZU4A 4JJZA 4TLDA 3CF6R 5DSZA 2WKQA 1XTSA 4RD0A 4HLUA 1GKIA 1SVLA 4HUTA 5HZHA 4W5JA 1CXZA 2WV9A 3PR1A 4FMBB 1E0KA 3NG1A 1E2FA 2XEXA 4OK3A 1G7RA 3U6BA 5FR2A 1WBDA 5EQTA 1VMAA 3CZPA 2HLDA 1AN0A 2J9RA 2PT5A 3V4FA 1XP8A 2ZUDA 2ZYWX 3BC1A 2C78A 2P3SA 4DZZA 1GL7A 1KNQA 4UNSA 5DI3B 5L3QA 2P6UA 4CEIB 3L43A 1JXMA 1E2MA 2DCUA 3B13B 1U81A 2W2VA 3GP8A 4LV8B 3U3JA 1U2RA 3H0KA 2ZJ8A 5CDFE 1S2MA 2WJGA 4Q7MB 2JLVA 1ZNZA 1P61B 2HXSA 3ZS9A 2P5TB 3HU3A 1ZW6A 4QJ5A 1CEEA 1ZM3A 5C4MA 3C4JA 1KAGA 1KY2A 1P3JA 1BYUA 4ZDWA 1DAHA 4US2R 1T8TA 2OFWA 1UEJA 3K0EA 2D4HA 3L0PA 2DYKA 1KSHA 3LAWA 2OCYC 1EFRA 1BH2A 1P72A 4HATA 3EZ2A 2AR7A 4HLCA 4A6XA 2QE7A 3OIWA 4ZKEA 1KIMA 2ZR9A 4JL5A 2IYZA 4GOXA 2FN4A 4PSVA 5TY0A 2ZR7A 1XDBA 1U0LA 2PX3A 5TARA 4DLWA 1E9RA 2BHRA 4WVFA 3UK6A 1QHNA 1XD2A 1XD2B 1SXJD 1ZM7A 2QSYA 4LYFA 3TH5A 1W2GA 3RRZA 1PZNA 4E5UA 5JEEA 4URUR 4MDFA 3AVVA 2ZRPA 1GP2A 2BDTA 4RD2A 3GFTA 1TQ6A 3W6NA 1FP6A 2P6RA 5KU1A 3B60A 2XOKA 2J87A 2JLRA 2QY9A 2ZYUX 4RD4A 1QHGA 5E7IA 1SHZA 2WWYA 2REXB 1NJGA 4ITRC 1QHHB 2IEZA 2UVQA 3ETLA 4KFUA 1T3SA 1W1WA 4TYQA 2R8RA 4QFMA 3VR5A 1E79A 5AJWA 2NZ8A 1G17A 1SVKA 3WY9A 2YVUA 4H1UA 1W0JA 2O0JA 4MUAA 5FOVA 2JASA 3LQQA 5L3QB 3RRNA 3M0EA 3K0FB 4JVSB 2BBOA 3U3MA 3RS5A 2WPDD 1NMXA 4O0MA 1DO0A 3CKLA 1IN6A 2E9SA 2XJ9A 2J0QA 1HUQA 4JL6A 2FWRA 4Q1DA 4URZR 1G18A 4OYHA 2FE4A 2Z6VA 5FOTA 4GRAA 5JJLA 1IN8A 4NBSA 2W6JA 1SULA 1Q21A 4JBWA 1HA3A 4DEYA 2IHYA 1VCMA 2F1HA 1UKZA 2B7CA 1LS6A 2NZJA 1VYTA 2HF8A 2QENA 1G5TA 2WWHA 1UBCA 2CLCX 1NI3A 1CJUC 1H8EA 3W5IA 5FBRB 2IS2A 2C77A 1XNJA 2CCGA 3OEHD 5TDHA 4D82A 5SZIA 2ZJOA 4UNNA 4D4KA 4TQ9A 3R9IA 3U5ZB 4C0AC 1K5GA 1TMKA 4Q21A 1Z0IA 5BXQC 1HE8B 3PEUA 621PA 4JLBA 2QAJA 2LKCA 5FFMA 3A37A 1WP9A 4RZXA 3VU9B 3EAQA 5BYJA 1T6NA 1VCNA 1ZD9A 4HI0E 4PC7A 4V0MA 3W3ZB 3I62A 1JEDA 3CRW1 4M8NE 3GLGB 3WHKA 2QN6A 1G4UR 3TK1A 5GVSA 1NVWQ 1ONBA 4TTRA 2XOKD 2RH5A 5E7JA 3EPKA 4DDTA 3IIJA 4ZV4A 1YR7A 4XIGS 1L7VC 1J7KA 2HYDA 4LZZA 1HEIA 2EWVA 3I92A 4UNQA 5K8UA 1SZPA 1W4AA 4D81A 5IT5A 4R9UC 4DLVA 1KO5A 1KO7A 1EFRD 3WXMA 3ADKA 3LO5A 4CRWB 4QM7A 2XZLA 2ZUCA 3T5GA 1Z0JA 4PZYA 2JLWA 5J4YA 4EPVA 4TMKA 2BC9A 3B9PA 4B47A 5M04A 4C7OA 1E1QD 2F1RA 1AGPA 3K70B 4UNRA 1SXJE 1XCPA 3ICEA 3C8UA 1OH5A 5JI2E 3OE7D 1XXHE 4LJ8A 1N6IA 4OI2A 3TR0A 2WKPA 1BOFA 4C3ZA 4F4IA 2QUZA 3MFYA 3Q7QA 4D4JA 2IS1A 1Z6AA 5DLQC 3AVQA 4LUCA 4PFSA 4PQYA 2ANBA 2NO1A 5FTLA 1K5DA 1E9SA 3AF0A 2N1BA 1AZSC 5HTKA 1T3HA 4Q1EA 3A4LA 4V0KA 1EK0A 2RGXA 4MGZR 3EPLA 4Q1AA 3HYTA 2B21A 5E3HA 4YQFA 4XD7A 4RFVA 5JSZB 1U0JA 4KFSA 2RHMA 4LC0A 2BKUA 2GXSA 4B32A 1EX7A 1SKYB 4D6PA 2C96A 2YC4C 2W0SA 3BERA 3IDQA 4Y0VA 1G3IA 4RFSA 3U3KA 3C41J 1JQJC 1V43A 4LV6A 1Y63A 4DKXA 1S3GA 4TT3D 3ZQJA 1XMVA 1JR3A 3MWKA 1EX6A 4DEXA 3IEVA 3AVYA 2ZUBA 1E9DA 4GBMA 1ZC3A 2GEUA 1R7RA 1T91A 4O2LA 1DS6A 1US8A 1W36C 5EE3A 4Q7JB 2C9CA 4U5XA 1D5CA 4F7WA 2NTYC 4IFBA 3M4YA 3QXSA 4PXAA 2W6IA 2WAYA 2NGRA 3WYGA 4KFTA 2FMXA 1P9WA 2MMGA 1G3RA 1N6PA 3TSZA 2CJWA 4GZMA 2ZJ2A 2VL7A 1KI7A 3KUDA 1VHTA 5JRZA 1I4DD 1NNEA 4KITB 1IXZA 3IO5A 5IHPA 4HUQA 1P2SA 1ZNYA 2Z5FA 1Y3AA 3C15C 3FMFA 5DN6A 4PHFA 1NLFA 4IOMA 3IPXA 4L9SA 2QT0A 1W47A 2BIFA 4JLPA 3B6EA 2ZTSA 1AQUA 1G3UA 3EC2A 3RNLA 4NCHA 5HCNA 2WJIA 2REOA 1N5KA 3KKNA 5BWMA 2A2ZA 3U4QA 2H5EA 3ASYA 3OFNA 3VQTA 3ZYCA 4A8JA 2A5FA 1NIPA 5KOYA 4HAXA 5G3ZA 2QPTA 4MGKR 1ESNA 3AVTA 2J5XA 2XNDA 3OIUA 4IDPA 1F48A 4R2IA 4HAYA 3SHWA 1E1QA 3TAHA 3GCGA 4IVQA 4PC2A 4C0JA 1M7GA 3J81k 1ZYUA 2ZU0C 4OJKA 4BECA 4XWAA 1KDPA 4PAMA 2FF7A 1COWD 4Q66C 1N5IA 1O3YA 2G0TA 3BOSA 1MV5A 4JVNA 1NVVQ 5FTNA 1F2UA 3WP0A 1Z63A 2CCKA 3H84A 2YYZA 2QTFA 1GKUB 4FW9A 3VR2A 3U44B 1XZPA 2EYQA 4GSYA 4A6PA 2GBLC 2QRNA 4EPXA 3KQUA 4F4CA 3PV0A 3TGPA 5DNYB 3AEZA 3FTQA 4TYNA 5L3VA 1LF0A 3T34A 3FGNA 3Q8XB 4LX0A 3TAUA 1JBKA 5CITA 1NJFA 3PQCA 2O8BB 3EASA 4NL4H 1OYYA 4W9MC 3CIOA 1XFAA 2VHQA 1OHHD 3AKDA 3T5DA 5JJIA 1XPUA 4KAXA 4Z8YA 4M9QA 4DLZA 1U94A 3BWDD 2ZAOA 3R7WA 1RVDA 1J90A 1LS1A 3WBKA 3TKLA 1UEIA 1OH8A 5FI0B 2OFXA 2XGJA 5FL7D 3PUWA 1A5TA 2RGBA 2YC2C 5FBVB 1RJ9A 4B2PA 1D9ZA 3TRFA 3DHWC 4XWOA 4NYJQ 2WAXA 4QGFA 2A30A 4FCWA 1N5JA 2BBSA 4LYAA 2A5YB 4JYCA 3SC3A 1PLLA 3QF4A 2R6GA 1OIXA 5SZHB 2ZM5A 5DN6D 2QE7D 4O3MA 2WPDA 4KLNA 4L5BA 1GFIA 1EGAA 2F3TA 2A5JA 1NBMD 3K9GA 4Z8XA 1CJMA 4TYWA 3GJ0A 1MRNA 1F60A 2ODWA 5EE1A 3WMGA 3DOFA 3LQRA 1LW7A 2OEPA 2FEOA 5JHGB 4YMUA 2ZU6A 3HPQA 3QUSA 1RPZA 3AGQA 2DFNA 1E2JA 1ZM4A 4NH0A 2ZRLA 4LJYA 4CEIA 3AVWA 3FKQA 2BM1A 1H8ED 1MO4A 4A0RA 4ARZB 1M2OB 5HKKA 3C5CA 2QM8A 3NDBB 2EYUA 2J7KA 5AR1A 2Q9CA 3RWMB 3WYFA 4BZXA 4D26A 4AKHA 2YKGA 4NDZA 1FNNA 4OHVA 4OKSA 4OK5A 1W48A 3WHLA 3ZS8A 4B44A 3LVRE 2BV3A 4PZZA 1KK3A 2BEKA 5DIFA 1NKSA 4BRUA 4JKYA 1G5RA 3CNNA 5LPNA 2LCFA 4LRWA 4QJ3A 1DAIA 3AVUA 5KSYA 1YHNA 5D3QA 2OZEA 4NKRA 3E1SA 4S35A 2GF0A 1XD8A 3SU8A 4NYMQ 1T0HB 1Z47A 2V3CC 4EPTA 1XTKA 2AD5A 1VG0B 1VHLA 3B1ZA 1E0SA 1KZGB 4A0HA 4MGIR 5HR5A 4EPRA 1G8YA 3ZIAA 2BMFA 3LDAA 2VP4A 3ZH9B 1ZNXA 2V6IA 3UANA 4AC9A 1YKSA 3LLMA 2OV2A 4UXHA 1CR0A 4LHVA 3SBDA 1BIFA 2RGNC 2QTVB 4KBFA 2AD1A 5H68A 1W0KA 3QKRA 4TL6A 3K09A 2JCSA 4YC7A 1ZC4A 1DBSA 2UZ3A 2W58A 3KJEA 1KK2A 2QM7A 2QGZA 4MYHA 1P4SA 4MKGA 1TEVA 3RS4A 4Q47A 4BASA 4URWR 4TSFD 3B82A 1X8JA 1AA9A 3WRYC 4HB2A 1JPNA 2J41A 4EAQA 3K0FA 4DDUA 1AM4D 5GJCA 1JQLB 2IYXA 2MMCA 4CT4B 4OI0A 1PJRA 5UKDA 2H7VA 2ZRAA 3AP3A 4X8OA 4PPFA 3G5UA 2PX0A 1JXOA 1CJKC 1UBGA 2W00A 3ASZA 4HAZA 5FOUA 2IBMA 2KWIA 2VHTA 3DKPA 2ZSDA 1P2VA 2HCBA 2ORWA 2EFHB 4RKFA 4EUNA 4P4SB 3D8BA 2ATVA 3G0HA 3LVQE 4L15A 1DAMA 1GUAA 4C0KA 4D0NA 3QE0A 2Z4RA 1NKTA 2FOLA 2X2FA 2VP6A 1QVAA 4FMDB 3QVUA 4Q4AB 1JR3E 3GEIA 1U9IA 3A1WA 4I1VA 3A8TA 4KV9A 4C0BA 3WNDA 3NBXX 3UIEA 1AS0A 3IBYA 5AUNB 1CLUA 4US0R 4CEJB 4OHWA 4XD7D 2QA5A 5EP4A 1FP7A 2GZDA 2WKRA 2XZPA 3SJBA 1CRPA 1M7HA 3QKRB 2QAGB 2J0SA 4ZIRB 2V1UA 1VECA 3TQFA 2A5DA 1FOEB 3CWQA 3GMTA 3JVUA 3I5XA 1OPXA 4OJQA 4FWIB 2C03A 2OLJA 1SXJB 2WSSA 3CNOA 1E2GA 5AJYA 3U61B 4LSGA 1S1MA 1UFQA 3GJ5A 4JVMA 5FUWA 1JR3D 2CLDX 2AWNA 1FW6A 2JIZA 3BB3A 3FVQA 4NYIR 2ASEA 2ZETA 4DUGA 4RZ3A 3IPYA 1G19A 5DHFA 1D9XA 3UXMA 4HLQB 2HT1A 3MUFA 1OH7A 3T35A 4MKIA 1T8UA 2O8CA 4XSGA 1DELA 2GHIA 4KFRA 3R8CA 4EPWA 2G77B 4JLNA 2ORVA 2YWEA 4JLMA 1IY2A 3RRYA 4CW7A 1EWRA 3IO3A 5A5GA 1GITA 1P6XA 4J0QA 2O8EA 3VNUA 1LFDB 3RANA 3QPWA 4C30A 5L3SB 1KO1A 1TX4B 3WMFA 4LJAA 2ZSBA 1DPFA 1Z28A 3MWLA 4GL2A 1AGRA 1T5IA 2VBCA 2R62A 4TMVA 4KCGA 3THWA 4EPYA 1EG7A 1Z0KA 4Q4HA 3CUEF 4CVNA 5KTYA 1G64A 2ZE5A 2FZ4A 2RGCA 3OEED 3FWYA 3D31A 4R71A 3SBEA 2EFCB 2QSZA 4E07A 1JJVA 5KO2A 4C2TA 2XITA 3K70C 1KI8A 2GJAA 4Q1FA 3DMDA 2GZAA 4M53A 2A78A 3PFIA 1JR6A 4AI6A 2J7PA 4E03A 3NC0C 3HDTA 1Q1QA 1VTKA 2IYVA 1MO5A 4EDHA 5LD2C 1DADA 4Q1CA 1DE0A 3O8CA 1ZIPA 1R5OA 2HJVA 5B58C 3GLIB 2RGNA 2X19A 2ZRDA 4G0NA 3T06B 1VDZA 2W6JD 3PENA 3LH5A 4ZDJA 2AXPA 3RYTC 5KSPA 3FFBA 2JIZD 3SR0A 2JLQA 2IWHA 4BRWA 4U02A 1WDTA 1NG1A 3KZ1E 4KBGA 4LBYA 1VIAA 1QRAA 3OEHA 4RSGA 4Q4LA 1G7SA 1IAQA 5GADl 1YZQA 4HAVA 1W36D 1GRNA 1T3LA 3KXIA 1W2HA 1TF2A 1OIVA 2ZI5A 2RGAA 2QU8A 4OQLA 4M9ZA 1X86B 1YZKA 2H57A 1H8HA 1PUIA 3KUCA 2FPMA 3PUYA 4XJXA 4Z1MD 1GNRA 4GI7A 4IFEA 1ZRHA 3V00A 3P20A 2PZEA 2CNWD 3BXZA 1R0YA 2O5VA 1HV8A 2O0KA 2GEVA 3FMPB 4TMWA 1N6RA 2OBLA 2HUPA 2LWIA 3L0OA 1LV7A 3Q7PA 3I32A 2J46A 2CK3D 4NPHA 6Q21A 1ZD8A 2WBLC 2ZI7A 3TQCA 5F98A 2OXCA 3FYHA 1R5BA 4YMSA 1RJ9B 1KMQA 4XWKA 1Z5ZA 2RMKA 4EQ6A 3R9XA 1D2NA 4EQ6B 2R6CA 1U0HC 1II0A 1G291 2CCJA 1IM2A 3GJ8A 3OF5A 1AKYA 2CHGA 2J0UA 3OAAD 5TVKA 4DJTA 4IOLA 1XB2A 4TTPA 1L8QA 4LYHA 1ZP6A 1IN5A 1G8GA 1OYWA 2IYLD 3X1XA 4BLTA 4ZKDA 2VF8A 2ZRNA 3FKSD 2D7CA 2F3RA 3E2IA 1OXXK 3BAFA 2JAQA 5JLJA 4L9WA 1XPRA 3NBZC 5FTJA 1UADA 4DRZA 2DB3A 2ZSAA 3OE7A 4JZKA 5B64A 4NTZA 1XXHB 4OK6A 2NG1A 4ASUD 1E9FA 4OQXA 2FPKA 2VSFA 4DBLC 1WE2A 1NSFA 1E32A 1AS2A 4ZI2A 2HLDD 3NKVA 2FG5A 1SVIA 4IEIA 4Q18A 5C2JB 1K8RA 4WXPA 1GAJA 2WWFA 3I72A 1B23P 2GA8A 4A2QA 2OUKA 5AUOB 2FV8A 4IXNA 3GJXC 2V54A 2Q0HA 2B8TA 4PO1A 3CH4B 4JBYA 4B73A 1Z0FA 2OFOA 5L8VA 5DE3A 2OG2A 1RZ3A 2QPAA 1OB2A 3A4MA 3KJGA 1LTQA 3KQNA 4Q00A 1S3SA 3EPHA 3UMFA 3RRMA 3ZZTA 3HYRA 4DXAA 2D2FA 2VP5A 3REGA 5FUXA 3IQWA 2XZOA 4OL0A 1M6NA 2ZYVX 5A4JA 4B2LA 1XTJA 5KPJA 3HJNA 5CIQA 4AY2A 2PLFA 3RDPA 4DB2A 1A1VA 3VHXA 4IDQA 2FSHA 2Z0MA 1XMJA 4HLDA 4EFLA 3GLFA 1E99A 5J47A 4OI1A 1CKEA 2G6BA 4PX9A 1XMIA 3E70C 1H8HD 3K1JA 2IXEA 4HEJA 2ZRFA 3BGWA 3CW2A 4L16A 1W5SA 4LHYA 3TSWA 4H1VA 1KJYA 1JALA 1TF5A 2O0HA 1ZM2A 3L8YA 3FKSA 1KO8A 2R65A 2AKYA 3ND9A 4EJSB 1KI2A 2V4ZA 4PPGA 2VLIA 1FMLA 3M1IA 2PJRA 1QDEA 4MKFA 4QBGB 3TNFA 4TYPA 3THXA 3SN6A 2C2HA 2VQSA 3VU9A 2C5LA 2GAOA 1XTQA 1CR2A 3NIBA 4PAOA 4PO9A 2X8AA 4A36A 3BH6A 1IJEA 3DM5A 2FGKA 4QOSA 4QBFA 4AWXA 3REFA 3DDCA 2XNSA 2H92A 3RHFA 1R0XA 5J40A 4LCBA 2D06A 3U44A 2HYIC 5LBIA 5JWHA 1SKQA 1P73A 1KSGA 3TSOA 2AWOA 2ZI3A 2V1XA 4AYWA 4Q5IA 3MAAC 4TLAA 2HXYA 3EXAA 3VKWA 1D2MA 4KLZA 4D2IA 2DFTA 4DWJA 4DDVA 2IL1A 1Z06A 1N0WA 3IBGA 4NCJA 2F1IA 4PC6A 4XVQA 5EXPA 2ATXA 1G3MA 3GLFB 4QGAA 2WWXA 1W4RA 3P27A 5DI9A 3DO6A 2E1RA 1MABA 1P5ZB 5DH9A 3P26A 1CIPA 1XWIA 3I1FA 2C8VA 4GZLA 5EP1A 4NZYA 1IY0A 3QG1A 3N70A 4V0NA 5E7MA 1E1RD 3QXJA 4LJ7A 1TL7C 4DSNA 2GJ8A 1KI3A 2IYWA 4ZDIA 4URXR 2Q3HA 1PUJA 1TUEA 1VG1A 1ETUA 4QRHA 2FNAA 2XNDD 4BFVA 4QHYA 2X1VA 4M1MA 1HH4A 3C5HA 3EG5A 3QVVA 4A4DA 4PHGA 4CGZA 1X8LA 2PMDA 1QVRA 1WRBA 3EA5A 3LWNA 3RSLA 3BJIC 3ZDQA 1RC8A 2XB2A 4YXWA 3P1JA 3SYLA 1ZNWA 2GCOA 3ZGXA 3NHAA 4UKDA 1SGWA 1YRBA 4LJ4A 4TL8A 1CBUA 4FCVA 3C14C 2YINC 3MG9A 2CL0X 4Q03A 1CTQA 1M7BA 2WM9B 2OM2A 2OHFA 2FH5B 1FX0B 2KJQA 5KSOA 1G7CA 4W7SA 2CE7A 1CJTC 3ONWA 4M4SA 1G16A 3MWYW 2AHOA 3X1ZA 3FOZA 4YLGA 1MRSA 4MRNA 3SFVA 5KDDA 2DFLA 1FTNA 4OQMA 1XBTA 2Z4SA 3PJRA 3KQLA 4LPSA 1ZIOA 4MH0R 2NO9A 4QHTA 1X3SA 1NBME 4FMDF 4B74A 3AP2A 3KX2A 3SDZA 3NWJA 1OE0A 3UATA 3ECCA 5KNCA 1W44A 2FFQA 4B3FX 1O87A 4UQOA 5HPYB 4PTLA 3TE6A 4YMVA 2G1JA 4MYCA 4Q9JA 3ND8A 3WP1B 4D25A 2CXXA 4NCNA 1E3MA 2ZRHA 5E95A 1G8FA 2IYQA 3IUYA 4BLSA 1KDOA 1YZNA 1TPZA 1XJQA 2ZRBA 3WNBA 2GVDC 5AK0A 3KB1A 2P2LA 1A82A 4C7OB 1NSTA 4LOAA 1X1RA 5E4FA 3OEEA 1GOTA 3AQ4A 4V0OA 4L4UA 5HCIA 2PMKA 1TEXA 5H70A 5IDVA 5TV2A 4BGDA 2PEYA 3IQXA 1A2KC 1VIYA 3UMSA 2FSFA 3X2SA 1II9A 4Q48A 4M1YA 3LV8A 4UJ3A 5H8WA 4NCIA 4A1FA 1E98A 1ZINA 1TNDA 1ZAKA 3FMIA 2ZRIA 2RGGA 1RYFA 4A2PA 3DM9B 2WSMA 3BBPA 2VHCA 1T9HA 2WIBA 5IF9A 1TU4A 4TTQA 3K0AA 3W3AA 1DOAA 2K5UA 2TMKA 4HDCA 5G40A 3CB4A 4DLRA 2MSCB 1Z08A 4IXMA 3DEFA 4FI3C 4EFNA 2IXFA 2IYUA 3EX7C 1TADA 1J8YF 4NU0A 5CJPA 1II8B 4LYJA 2ZRCA 2VSOA 4G5SA 1FX0A 1KI6B 1TTTA 4GMXA 4IKEA 4FN5A 1NP6A 1FNMA 2Q9AA 2GXUA 4A15A 4I81A 1BMFA 5J4VA 1P62B 1KMHB 4LK2A 2W6ID 2ZE8A 1E4VA 2EWWA 1KDRA 3AB3A 1NL3A 5CJ2A 4MYUA 2XX3A 1PLKA 4QNRA 1ZUHA 1JPJA 4WA7A 2G0NA 2Q3MA 3SJAA 1DAFA 1U8ZA 3AVPA 5SZKB 1X8KA 3FE2A 3WYAA 4DSTA 2IC5A 1KAOA 3WRXC 1G20E 4DCSA 2DBYA 3AUXA 1ESMA 2ZR0A 1MKYA 4TZ6A 4V0ME 5EE0A 1UPTA 3CF0A 3KTAB 4B3XA 1YR8A 2ZRMA 3SS8A 5CB6A 1KTVA 4C2UA 1N6NA 4M22A 2ZAMA 2O8DB 3EZ9A 4BEJA 2ZITA 2JJ2D 4NCKA 3THWB 2CMKA 3JZAA 5LB2A 1Q1ZA 2FFAA 4MKHA 3BORA 3B78A 5F2EA 4B3DA 4TYYA 1NY6A 2XTMA 3FHOA 2VSXA 4X8LA 3VR6A 2QMHA 5CIWA 2FX3A 4BEBA 1KKLA 1UKEA 1Q3HA 4IHQA 3U3OA 2XB4A 2D62A 2W2XA 5TXGA 4Q4JA 2XTNA 4BFYA 5FUVA 4KXFB 2VP2A 3O47A 1GKYA 4L8GA 1EFUA 1CS4C 1R8SA 4PHTA 4QL3A 3GQBA 2JDID 4AG6A 2UZIR 4G5QA 3P4XA 2ZREA 3V4RA 4IDHA 5CK4A 1CR1A 2F43A 2VHJA 4GP7A 4JIMA 4NE2A 4TSFA 2AL7A 4M1WA 4RD3A 1NVVR 2FU5C 4F91B 2AK3A 2X77A 4M9SA 3SQWA 5KDLA 5KDOA 3IHWA 3BRWD 1KK1A 1OW3B 4G5GA 4V03A 1OF1A 2E87A 4AD8A 4C4PA 1HE1C 1S8FA 1GZSA 4DVGA 3LA6A 5EUQB 5KHOC 1W5TA 3U60B 1XD9A 3QY0A 1R2QA 2AN9A 2ZS7A 1DARA 3NHBA 5AJVB 3ZZUA 2PEZA 3JZMA 1G3QA 2IF0A 2WOOA 4DLUA 1WQ1R 2ZJ5A 3B1WA 4PAQA 3BE4A 2ZJAA 3QKSB 2HDNB 5B57C 4PPNA 3BB4A 1FFHA 1QF9A 2J0UB 5AJXA 1XEXA 1D8TA 1XTIA 3QPVA 1Z6XA 4HZUA 3X1YA 4DCNA 1YR6A 2QP4A 2A5GA 4C0LA 1KK0A 3KL4A 1N6HA 2V55B 3B5JA 3WNCA 3QQ5A 1R10A 1TQDA 2WMOB 3EC1A 3UKDA 1Q1BA 1NN1A 4DT1B 2JLYA 1XJ0A 5EP2A 2GCOB 4YDSA 4A92A 3DOEA 2PCJA 1OT3A 2VIIA 2W0MA 2O8DA 2OESA 3F3YA 1MOZA 1NIJA 1ANKA 3RS3A 2HJGA 2R6AA 4X8HA 1EXMA 4A0FA 1QHIA 4P4TA 4LGMA 1NN0A 121PA 2PZGA 1LB1B 5DYIA 3VKHA 1IHUA 2JJ2A 2V8OA 3EZ6A 2GWHA 3SZRA 3LX8A 5JJKA 1TF7A 2FEMA 2IS4A 2BMJA 3ICQB 2KSQA 1FL9A 1HYQA 3HPRA 1S1CA 3UG7A 1IJFA 2CDNA 1GNQA 4JLJA 4RVCA 4DSUA 1OFTA 1JAIA 4OHYA 1VKJA 4AKGA 2B8WA 3PVSA 1GRQA 2XSZD 2ZIAA 5K8IA 2ZVQX 1FMJA 2SHKA 2WJJA 3LBNA 2GESA 1AKEA 1U8AA 3CX6A 4PPQA 5EJEA 3HR7A 3PITA 3AGPA 4TLCA 4US1R 2PCLA 4KODA 5FPKA 1G9XA 4TWZA 1M8PA 2YWHA 1XTRA 1YR9A 4LY6A 1E0JA 1E94E 1TU3A 2HEIA 4QJ4A 4AK9A 4R2HA 1N3BA 3BFKA 4BLPA 3PUXA 1S4QA 2BJVA 3HWSA 4QKQA 2EFGA 5JFGA 5AUQA 2I1QA 3NXSA 1R5NA 3A1VA 5FI1B 1U9IC 5HKKD 5FUYA 5KYKA 2QQEA 3B7GA 2ERYA 2ZSEA 4Z1MA 5C1BA 5KNDA 1IOZA 1E1RA 1KSFX 1ZUNB 3W34A 4TZ0A 1KKMA 2GCPA 3CZQA 3KFXA 3KDSE 1OXUA 4B76A 3NTUA 4M9XA 4F93B 2OCBA 4HB4A 3GLIA 1IY1A 3KJHA 2WVJA 4KSCA 4TQUS 4PSAA 2ZI9A 1QBKC 5D3MB 3QXCA 4U7DA 2X2EA 1N0UA 3THYB 1W7AA 3GLHB 2F9MA 3W5JA 3HU1A 2ZXUA 2JLUA 3K0CA 1DO2A 1ZD1A 5IK2D 2WICA 4NYMR 2QTHA 3CWZA 4LBZA 5KPDA 2OBNA 3CR8A 3UPUA 2YNMA 2G3YA 4KVAA 1C9KA 2OBMA 3BFVA 3I3SR 2IW3A 3W8RA 4A8JC 3P32A 1H65A 3ZD6A 4FINA 5F9FA 3K9LA 2DFKB 2C9OA 2CE2X 4MDEA 2ORIA 3DL0A 2HCJB 5J4KA 4XSHA 3ZVNA 2DWPA 4LJ9A 1KJZA 4C0HA 2IUTA 3SOPA 1XF9A 1Q1EA 3O8RA 2NQ2C 4URYR 2IHBA 2IF2A 3JVVA 3LFUA 2RGDA 2EQBA 2VRWA 4ABYA 3ZVLA 5HE8A 1I2MA 3RC3A 3AKEA 1Q3TA 4RY2A 1EESA 4JJKA 2YOHA 2O8FA 2GJSA 3GEHA 1J8MF 3PXGA 3L2OB 1GL9B 1XCMA 2FA9A 4C9BA 2EVWX 3V9PA 5EXXA 4IVRA 2QL6A 4BWYA 4ZIRA 3VMFA 2KBFA 2GF9A 4NP6A 4CEJA 1XEWY 3C7KA 4DHEA 4DLYA 1JNYA 2QRZA 5CM8B 3GLGA 1W36B 4DLSA 5GVRA 2G83A 4NMMA 2DPXA 2OE2A 5BQ5A 3ZJYA 1US8B 3Q5DA 4GOJA 4OI4A 4NONA 1OHHA 2KE5A 3U6KA 4A2WA 1E96A 1Q57A 4LWZA 4BZQA 4D0LB 1KI6A 2JJ1A 1I4TD 1E2DA 4HAWA 3TR5A 2OAP1 5FTKA 821PA 1U90A 1VG9B 4RKEA 1MR3F 1LF5A 1TAGA 4V0LA 1YRAA 2G88A 1UAAA 4P0TA 3SHFA 3CPEA 3MLEA 1NN5A 2Z43A 5KNBA 1FUUA 2IYRA 1DAEA 2O52A 1IBRA 1AK2A 3HP1A 5FPHA 1XEFA 1RKBA 4WOPA 1Z2CA 3ZZ0A 1G5PA 2WWIA 2YV5A 2D3WA 1RFLA 3KTAA 3OIYA 1F2TB 1E2NA 2OSBA 2GKSA 2ZSFA 3CX8A 1CU1A 221PA 2FJUA 2WIAA 2FZLA 2VA8A 2GTPA 3Q5EA 1GG2A 5FL7A 3TVDA 2ODBA 3EARA 2BWJA 3BK7A 2NOAA 3DPUA 3EPJA 1HTWA 3A36A 4PR0A 1OKKA 3CO5A 3K9NA 4PZLA 4YONB 1ZBDA 2C99A 3NC1C 3T61A 1FPMA 1RRGA 5JS7A 3IIMA 3SJZA 4MRSA 1UJ2A 2O8FB 4E09A 2GDJA 5JZVA 1DTSA 3DMNA 3OHMA 2GK7A 2GRJA 3RVBA 1U99A 3BD9A 4XVRA 1OFIA 3BH0A 4B3GA 2CHQA 4JLKA 4S2EA 3VX4A 4MUBA 1M34E 2VP0A 2CEAA 3D6TB 4PQFA 3KXKA 4OQFA 3EIQA 4JLVA 4MYTA 1P9RA 2PL3A 1L4UA 3TLXA 4AG5A 4KYIB 1NF3A 2GBLA 3EW9A 4PC3A 3PG5A 1VG8A 3ZVRA 2H17A 4AYTA 2JLXA 2BBTA 3GLFE 1S96A 1Z0DA 3IKJA 4A0GA 4EIWA 2DY1A 5HE9A 5TMPA 3Q3JB 2AKAB 4GPTA 1X6VA 5FBWB 2RB4A 2H16A 2ZI4A 1Q22A 4IRUB 2JLSA 4ARZA 4BLQA 2VP9A 1A7JA 1DEKA 3O8BA 4XVUA 2WWWA 5J4HA 2NPFA 3T12A 5DGXA 1HQYE 1G41A 1FQKA 5AWFC 4B34A 4F92B 4M1OA 1NLZA 1E9CA 3M6AA 2F6RA 3NVAA 3ZIAD 3Q72A 3EWAA 3ADCA 3MGCA 2GXQA 4YXWD 2EFDB 3CH5A 2F1JA 4LDJA 1D6JA 3O8DA 4TT3A 3IHLA 1XEWX 2AK2A 4P4SA 2O8EB 4LHXA 4F38A 1TQ2A 3AVXA 3K9HA 4K46A 4QNMA 4Q4AA 3QKSA 2GETA 4M1TA 4I4LA 2B7BA 2N46A 2B92A 1F3OA 1GIAA 1SVWA 3H4MA 3AM1A 5EUMA 2ZE6A 3AF3A 1KHTA 3EIHA 1CP2A 1NMZA 1KYIA 1VCIA 3D7MA 1E2IA 2VTKA 5BN3A 2Q3FA 3H1TA 3KKOA 3LY5A 3F8TA 4B43A 1NN3A 1XU4A 2QROA 1OXSC 2IYTA 1GVNB 1YJ5A 2LKDA 3A58B 3U2QA 5JRJA 2V9PA 4DCUA 3L82B 3LBHA 2GCNA 2XXAA 1SXJA 2CBZA 3RSOA 4ASUA 2EW1A 2ODNA 5BN5A 1JB1A 4LBWA 4MITA 5JCZA 1E4YA 4YMWA 3RS2A 2R6FA 1RIFA 3CBQA 3IILA 4RD6A 3QEOA 1OB5A 4II7A 3VR3A 3I73A 4UNPA 2QAGC 3LD9A 3UG6A 2H8KA 2V7QD 2ZE7A 1PLJA 3E5HA 4Q9LA 4KI0A 4ZCMA 5TB5A 4LBVA 3W90A 4MGYR 3KKPA 4R98A 4C0SA 3BIFA 2ODEA 1T5LA 5KUTA 1XZQA 1OKKD 1NVXQ 3CRVA 4GMDA 5KSZA 4IOJA 4TMXA 2BMDA 2I4IA 2QMUA 3B1VA 5ELXA 1E2LA 2IYSA 1KY3A 1BYIA 4TLBA 3G82C 3AKYA 1OV4A 5GJVC 3ZLJA 5FBLB 2KB0A 5EZ6B 3BFXA 4GFDA 2CJWB 4BFWA 4B6EA 2J45A 2ZQ5A 5DO9A 1J2JA 3A6PC 1JEEA 1WA5A 2QMOA 4ERNA 2JLZA 2QZ4A 3MD0A 2FPLA 3HR8A 2NO6A 2IUUA 1BS1A 1OSNA 3B1XA 4JSTA 4KU4A 3S1AB 3QBTA 4GNKA 1I4LD 3VR1A 1QHYA 3PUZA 3SE0A 3H86A 3HU2A 3AF1A 3SYKA 5CLLA 5JBQA 3TJZA 4NYIQ 4HB0A 1L4YA 5BW8A 2P65A 2QP3A 2R44A 2GJ9A 1KNXA 4GDFA 3MSXA 1Q44A 4Q19A 3U7GA 3I5YA 2L0XA 4BFTA 5CYOA 2C95A 1YQTA 4JMPA 1BKDR 3U7FB 3A1UA 2JEOA 2NO0A 4WAUA 3CNLA 4B3CA 4DT1A 5BN4A 2OO7A 1Z83A 2QP9X 4KVGA 3BB1A 5D3MA 4GOKA 4CZ2A 2OXRA 2QQ0A 4BPBA 3THXB 4LJ6A 1I2DA 3W6OA 1DG3A 1XRJA 2BCGY 2QI9C 4CF7A 2IXGA 1UBEA 1IONA 1MT0A 1PVOA 4N3NA 1OIWA 3QENA 1KZ7B 4KO8A 5DHAA 1WB9A 2NPIA 3IGFA 3VHLB 1XCGB 1IN4A 3GEEA 4XH9B 2QEQA 1Z2AA 1E2HA 4HSEA 1XPOA 1HT1E 4DLXA 1JECA 2WJVA 4DCTA 1BO6A 5EE5B 2IA5A 2PH1A 1E0AA 3QNUA 2P5SA 4IEEA 4RCZA 5FTMA 3GJ6A 3TIFA 2RCNA 4G3XA 2IWRA 2BJWA 1HT2E 4B3BA 4CEHB 3QIAA 4ZDKA 1HQCA 1Q20A 2PT7A 3BH7A 5LB4A 1SVSA 3I4LA 4A82A 1Z3IX 2O8BA 3GLGE 3RWOA 2VPPA 1GSIA 2H18A 4NHOA 4BLOA 1J99A 5AJZA 3GJ7A 1OFUX 2YWFA 2JDIA 1V5WA 4P31A 4ACBA 4JBXA 4M1KA 2QMEA 1LY1A 3RAPR 3A4NA 4DLTA 2RAPA 4HLUC 1RYHA 4RZUA 3ZQ6A 2V6JA 2W83A 3L0IB 3L8ZA 4N0EA 1MO6A 4QC2A 1QG2A 3GJ4A 5JHHB 5LDDC 4BFXA 5JS8A 3VKGA 1WCV1 2VF7A 2D2EA 5JSZA 2OAQ1 3AH8A 2CVHA 5CLQA 2QORA 1GTVA 1S9HA 3I8XA 2XTZA 4QXAA 1YZUA 4I1UA 1X1SA 4BQSA 4O25A 1EFTA 2ZRKA 3GD7A 3QKTA 4K81B 1VCOA 2C9YA 1G7TA 4RJLA 1YZTA 3FPAA 2CNWA 4HB3A 1UBFA 5L3RA 4FD2A 1N6KA 1SQ5A 1VYUA 3KKQA 4Q7KA 3QOFA 5CB8A 3GFOA 3EIEA 3OFND 1EFCA 2R6DA 2A7QA 3PEYA 1N2CE 2WHXA 2ZVPX 4POAA 3T1TA 1II8A 1CJVC 4G1UC 2CL6X 2ZJBA 4UXIA 3X1WA 5P21A 1RE0A 8OHMA 1W49A 3R7WB 1LVGA 2JA1A 5B30A 3K70D 2W2TA 2XJ4A 3H2YA 3N2IA 3ZVMA 1SKYE 1XMSA 4D4LA 2P6NA 3FMOB 4LPKA 2O8CB 2A9KA 2ONKA 3L0SA 4W5WA 2F7SA 2Y8EA 1ZCBA 3CPJB 4M2LA 3EWSA 1YU9A 3KJIA 4A8JB 1CULC 1EWQA 1XEXB 2FGJA 2QBYA 4JLAA 521PA 3SYNA 4Q9IA 3AF2A 3SQXA 4OHXA 3GLHE 3TUJC 5DYGA 4LHZA 4BUJA 2DWQA 4B33A 1E2QA 4B6FA 1QZXA 4ZCIA 1EFHA 2ZS8A 2UKDA 2WOJA 3Q85A 4P4UA 3LRPA 5CYPA 2MSDB 3NBFA 4FIDA 4WZBE 5EE9A 2XXAB 1P75A 2GAAA 3K0AB 3VNVA 3ADDA 1KGDA 1P7CA 5JCPA 2IYYA 4WZAE 2GVZC 2H1LA 3CM0A 1F5NA 1E6CA 4I99A 3CX7A 3QXHA 3IEUA 1KJWA 2GJKA 3NEJA 2REBA 3EA0A 1N6OA 2P0EA 3R20A 4BFSA 2ZRJA 1G8HA 4D80A 2F43B 4W5HA 5FBQB 4AIIA 4JYBA 5A0FA 5JEDA 3I61A 1COWA 4N0DA 1OFHA 4UJ5A 5FR1A 4ON9A 4GT1A 4OQNA 1G1MA 1DG1G 3QPUA 1F2UB 2Q21A 3QSYA 4EJSC 1NY5A 3BS4A 4QGGA 2F9LA 1DVRA 3SFZA 4DUGD 3TUZC 3CR7A 4G5OA 4HDQB 3T1QA 4D0GA 1NRJB 1G6OA 421PA 2WJYA 4FCTA 1PV4A 1YZGA 1E79D 1XX6A 3B8HA 1ODFA 4P33A 3VFDA 2GEDA 4Q7LA 1IN7A 4LC1A 2WSSD 4AKEA 1IQPA 1A4RA 4FMCF 5G53C 1R0ZA 1G4AE 3F0TA 4KYUA 4WW0A 4HAUA 4WXRA 3DZDA 4CEHA 4OBEA 1RRPA 3DVLA 5H1YA 1CF4A 1QHSA 4H9GA 4PC1A 1B0UA 1ZJ6A 5EP3A 3B9QA 2D74A 3QG5A 1RW4A 3FB4A 3QXXA 4DDWA 4MRPA 4BE7B 1AS3A 1OH6A 4WZ6A 2C04A 2CVFA 3PCRB 2DWOA 2NO7A 1P2UA 5K8TA 1SVMA 3VAAA 1R0WA 3EZFA 4WIAA 1NVUQ 2QPOA 4G5RA 5EXSA 4B2IA 1SXJC 3Q9LA 5J5CA 2JGNA 3R8FA 3U4QB 2A3RA 5FPSA 4XTRA 1FQJA 3FFAA 2OILA 4PO8A 5EXTA 1M1YE 3VTKA 1AZTA 2QT1A 4QGHA 2FSIA 3LBIA 1NBMA 4F4JA 1MO3A 5FPYA 4Q9HA 1E2KA 3RS0A 4Q4JB 5J4LA 1ZUIA 3MJRA 4ZI3A 5FOSA 5IK2A 5EZ5A 5CM9C 3KXLA 2DR3A 1Z8FA 4P32A 2Q6TA 1GWNA 2YHSA 2R2AA 2OCPA 2VH5R 1VYVA 4M1SA 4OHZA 2V7QA 1UKYA 2DHRA 3AKCA 3VX3A 4K8OA 5FOXA
chains in the Genus database with same CATH superfamily
2MZSA 5T8KA 2CC2A 7FD1A 4K1YA 4X84A 2VU9A 3B52X 5FK7A 4PCVA 5LXTF 3WGJA 4C89A 3GV8B 2Q2WA 3T52A 3R24A 3N3AC 3RG0A 1UEVA 2POCA 4C6TA 2JFOA 4YECA 5KNLA 4GKYA 2NXEA 2ZDQA 5M2PA 3EHKA 1JYWA 2VO1A 1HLFA 3EXYA 2D8AA 2J1TA 3GFPA 3K8YA 3GSDA 1FYXA 3II6X 1E2PA 3DA8A 3PEEA 2W1SA 4LC9A 1QG0A 1FYDA 1I10A 2ZULA 4QYWA 5EI5A 1CWUA 2QN2A 1YGPA 2ZYTX 2WIKA 5A0TA 4Q1PA 4ZI7A 5HWSA 1JHJA 1IEVA 1HRKA 3H4BA 2WINI 4Z3KA 2SICE 3FR7A 4MZDA 3JSMA 2OSQA 3W6ZA 1OTHA 3OL7A 4P08A 1I4WA 1RS0A 2C7VA 3L3BA 4EARA 1JTFA 4OV1A 1S6PB 1E6UA 1E1YA 3IKWA 4OX6A 4HVCA 2JS7A 3AIKA 1U25A 4QR0A 1G9BA 4L76A 1RZRA 3W06A 3U3DA 5FZIA 1OJ7A 1K5MA 1MR5A 2KM8C 2EBUA 5FUBA 4ANFA 1DYKA 2ZEZA 4E3ZA 5AI8A 2FW8A 3HJAA 2F8HA 2EJUA 4QYIA 3FVVA 1S9EA 5HATA 1BX3A 4LSLB 5K03A 4FNOA 4Q27A 3WBBA 1SLLA 4CMIB 1XQYA 3FYUA 2VC0A 1ATZA 1IXSB 4CMKA 1J5XA 3KK1B 4ZO4A 1VZ3A 3LEGA 3VB9A 5KBYA 2QNRA 1L2TA 5BQXA 2XNRA 4AEDA 1Y9AA 5ICMA 3OPYI 2HG4A 4ZPXA 1SJQA 4JP3A 3LXXA 1KI1A 4HK9A 1Z0UA 4YYOA 3BDVA 1HLCA 1ADBA 3V0AA 1TRHA 3LF1A 5BYKA 4AQYB 3KLFB 5DW0A 4JVLA 4ED4A 1XNQF 1PG5A 4RK7A 3LW7A 4B79A 5BUSA 1FK8A 1UKVY 4L27A 4USJC 3E97A 2HYIB 1Q7YT 3NDPA 2O0LA 4DIEA 1NDUA 1F3VA 3JSYA 1P29A 3PRDA 3DYVA 1VBD3 3SNHA 2QG6A 4WFYA 4Z54A 1JDPA 4MVJD 1UJ4A 4QX3A 3DW3X 5C8ZA 3OD5A 3NIDB 4B75A 1ZPVA 3DWIA 2W91A 1KBZA 3O8LA 4KQWA 4P3XA 4OB7A 4JB0A 1PJQA 2N42A 4DIMA 2CNDA 3I3OA 4UUXA 4MRVA 1KMMA 3ISVA 4IW3B 2YJTD 3GYGA 3H9JA 1OXVA 2B78A 3FJYA 3PDIB 3I3EA 1H7XA 5JFTA 4DL5A 4H60A 2OT3B 5FKBA 3B8EA 3E6DA 4LJ5A 1SU6A 4U0KA 2VC9A 2WDPA 4C3UA 4P3KA 3JQFC 4Y28C 2JCBA 2Q1SA 4IUBS 1JEQA 4G2NA 4OK3A 4YRDA 2ZM6F 2JFDA 2HEWF 2W39A 4NZ6A 4NLWA 2A9QA 2WO3A 1LGBA 3VBUB 2K1RA 2O9JA 3ZR4B 4CODB 2C4UA 2IEIA 1DXHA 4DG1B 1ZNQO 5H9WA 3LOPA 4WXOA 1T2EA 1NNDA 3G8TA 3KEQA 1HB3A 3OCVA 3A1CA 3ZS9A 1HKUA 1HB4A 2NYIA 1M5UA 1KY2A 2JFYA 2R3SA 4US2R 1VLZA 2OCYC 4MUXA 4HATA 4UPEA 1ZWLA 1ZMBA 1XRNA 3NRUA 3DF9A 2YXNA 1F9EB 2Y0BA 2OXBA 1K98A 3BO3A 1Z2EA 1GNZA 3BMCB 3MGKA 2DCYA 5JEEA 2QFEA 3V6KA 1M67A 3T1YF 5K5MA 3ZXGA 3NVCA 2DNLA 1R6VA 4KFUA 5F23A 3WG9A 3I9FA 2OKGA 4DARA 5AVQA 3UNYA 4QA9A 4HSLA 1F17A 5JG7A 2BBOA 4X61A 2NSBA 2HVEA 1JKIA 2FE4A 5D4NA 5FOTA 5EV7A 1KHHA 10MHA 2I7CA 3H3XA 2AGVA 4GH4A 1KL7A 4UQTA 1LX6A 2OFPA 1VZ2A 4WZQA 1HZJA 1ST3A 5KREA 2C77A 2PUVA 1RTJA 4D82A 2W6MA 1W25A 1JJ2R 5DPNA 1O1YA 1IXYA 4Q12A 5BYJA 2OPKA 4V0MA 4EYSA 1EDOA 5J23A 3GLGB 3TK1A 5GVSA 4MW9A 1YR7A 3VXKA 4AR2A 4LZZA 4O1HA 4I6EA 2PXHA 1IG3A 4EG3A 3BPZA 4EA9A 3KSBC 1B4SA 5GM2A 1ACCA 3UN5A 4M7WA 4KR0A 1EFRD 3HB0A 3WDLA 3LXMA 2OECA 4QM7A 5KKAA 1NBHA 4L2IA 4UHJA 4XC9A 4PZYA 4L99A 5J4YA 3B9PA 4TV8A 1NDQA 1B7YB 3UW3A 3ADAC 3H11B 3DXSX 1KFBB 4KPFC 4D97A 1HRI1 4PFSA 4LBQA 1RVV1 2OFGX 2XYRA 1P27B 1AZSC 5CA1A 1U7PA 1BBT2 4K3UA 2DU0A 4RGAA 3UMVA 5E3HA 4NHYA 5GGXA 4YQFA 1BROA 1U0JA 3IAAA 1OOPC 2IXBA 1HI8A 2AOTB 1JAYA 2Q5HA 2OP1A 1JQJC 2UVDA 1VQYA 1O59A 2QC3A 3AMVA 1EX8A 3I56S 2XE6A 1TNFA 1HL6A 2ARKA 4L97A 1FOD3 4JDNA 2GAGC 2YWJA 2QYGA 3IRXA 4C11A 1T91A 3P8BB 4PX2A 1EV13 2C9CA 3HX9A 4XPCA 1WD7A 4C87A 1N2XA 3W79A 1XNCA 2MZTA 4E5YA 4UREA 1S4CA 5K3FB 3IO5A 4K21A 2EG5A 3FMFA 3KJXA 4B3IA 4EI2A 3K15A 3LHFA 3BA6A 5FY7A 2JDMA 1NI5A 2JA2A 4WCEQ 1PZ8A 1LQUA 2QRVB 4OGWA 2M32A 4ZOBA 2J5XA 5B3KA 3KSCA 4CCKA 5CUQA 1UVKA 5CDUA 1X1AA 2P2SA 1SURA 1DUSA 3DCQA 5JT1A 5T7LB 2FEKA 2IVIB 2VPIA 3P45A 5DIZA 3RC2A 3J81k 4DQKA 1T5HX 1FPN2 1TB4A 1MW8X 1UEXC 1DQNA 4F4CA 2ECOA 4ZEVA 2ZGTA 4Z86A 5C5TA 3FGNA 2XB6A 1U0NA 1V1RA 5GMOA 4JI7F 4HWSA 2WEKA 3I9V1 1IKPA 5LC1A 4POOA 8ADHA 2FZGA 4J8PA 2AQ4A 2X0FA 1S1WB 1DIBA 4GKKJ 3DUWA 1RJ9A 2RMU2 2APJA 2P9BA 3Q2IA 3TRFA 2YUTA 3K48A 4X20B 4BQXA 2GM3A 5FZOA 1OA0A 1V95A 1FFEA 5SZHB 4TLFA 3IR7A 2ZOFA 1EZZB 3S57A 2Q46A 5C51B 3WADA 1Q15A 4TYMA 8LDHA 1F60A 5AHWA 3C2QA 3O1MA 4BZ4A 3HYNA 4GX0A 1S10A 3L7OA 1ODKA 1C3EA 3AP6A 1PGW2 1XSRA 3QYAA 3AVWA 4I9FA 1ADGA 2FAXA 1N1TA 2DTWA 2A5LA 4EYOA 4OHVA 4Y4YA 2XGOA 2EW8A 3PHBE 5CA1B 5F76A 4MIYA 3D54A 1F20A 4ZJQA 1OI4A 4ED1A 3DGEC 1J1LA 2SXLA 2QG4A 2QD3A 3UDEA 1HPZB 1FKAF 5HR5A 1JG4A 3ZIAA 2EFVA 2VR1A 4UW6A 1GPH1 3IP6A 3P1IA 2PRSA 1B8VA 4WBFA 1LWCA 3R3YA 1J3QA 5GLWA 1THTA 2YYSA 4RYLA 3A7DA 3ONVA 5L95A 2WHOA 4Z0HO 4EN7B 4Z4GA 3CC4S 2PFFB 2LUWA 4OHPA 1JHOA 5KG0A 4AHWA 4R9SA 4XASA 1KH3A 3RB3A 5DNWA 4B80A 3VBRB 2C9KA 1NXPA 2HMUA 4N54A 3VNSA 3NHYA 2GUGA 1MCZA 5L9BA 2VHTA 4GVXA 3NT5A 4S2HA 4FNGA 4RE5A 4P4NA 1A8MA 4Y1YA 1VQ1A 2X5IA 3A4UA 5K20B 1MDFA 4RIIA 3MB8A 2Z4RA 4FMDB 2OZLB 5DBEX 4BYYA 1U0OC 1MEEA 3DXFA 3OTHA 2UXCF 4QUEA 1GUZA 4RA0A 5AE1A 5IFMA 4XRGA 5A4MS 2WG0A 1GZWB 3JVUA 3R40A 2BOPA 1OPXA 1LWCB 3MT0A 4UD2A 4BWVA 1MOQA 3U61B 3H1MA 3HWJA 4QVKA 1YKWA 4Z0PA 3FMVA 2ZAIA 1T8PA 1SIZA 3ZDBA 1XXNA 1BXNA 3QTTA 2G77B 1NQUA 5EJAA 2ZM6J 3RAFC 1PK8A 1CF9A 1GSAA 4IAOA 1K92A 1GITA 4F3MA 5JXIA 1D1QA 2XVGA 4ZZ2A 4NNPA 2ZSBA 2IRYA 2R62A 5KWVA 2WZ8A 3C87A 1YRXA 5K0CA 1L5GB 2PIDA 2WHPA 4EB8A 3RKUA 3S1LA 2PHUA 2CDRA 3AJ8A 5EUBA 3IMCA 3CZJA 3EPPA 5U9CA 4WN9A 3NV4A 3RZKA 4NCAA 1JZ6A 2A84A 2VPZA 2CMFA 2QL5A 3IQGX 3S4YA 3WNZA 2JIZD 4EB6A 4BRWA 5IVEA 4E15A 1LGCA 2XVLA 4DCPB 2YY1A 4B0OA 3KUCA 2FPIB 1C9EA 3BCHA 1R0YA 3OZBA 1WW7A 2J08A 4OCZA 1MP0A 2GEVA 5GIPE 5BPFA 1GEHA 3Q7PA 3D6MA 5DNDA 3WWDA 1BHSA 1NJ2A 3IP0A 4AECA 1XZGA 1HWYA 1UJ6A 1R9GA 1DUVG 2CHGA 2AJQA 1YBTA 5FP8A 1IJKA 2LCIA 3T3HA 1Z7S3 2PK3A 1I0LA 1DKPA 4CTNA 5FTJA 3OE7A 4EZ6A 4JI7B 4OQXA 2VSFA 4I2PA 2BFDB 4GO1A 5H0IA 2Z2ZA 3NKVA 4Q18A 2ZLBA 4E8DA 1XNRJ 3ESRA 1LLDA 4IXNA 1RKXA 4CMAA 1K3FA 3CMQA 3ITEA 3L09A 3V8RA 2PEHA 2GN9A 3VPCA 5FUXA 3B94A 2PGAA 5JANA 1L8LA 2GO8A 9LDBA 3CLPA 7YASA 3M9OB 3ZFEB 4BOWA 5J47A 1D2QA 4I6YA 2P5BA 3UQYS 1R083 3F3MA 5AHKA 4IQXA 3LIIA 5MFPA 1ZL2A 1K44A 4OYMA 1REGX 2VONA 1RUC1 2FWPA 4FDMA 4S2FA 3HBZA 4IO0A 1EM8A 4HQ6A 3NGKA 2PIIA 3JD4A 2PT0A 4I4NA 4I55A 3K5NA 4MMYB 3SN6A 2C2HA 3OTOF 4LKSA 3UNGC 5K5EA 2P5VA 1ONSA 4LUBA 3IDCB 1P3Y1 2GBCA 2C00A 4OVKA 5HMMA 3VBHB 4LBIA 5BNZA 4D8MA 5H9PA 2TMDA 5LBIA 3B89A 1NA1C 3AI2A 4NZOA 3EXAA 3VKWA 3MLLA 4G07A 3LP8A 4DWJA 3ACIA 4I9HA 1NSQA 1SG3A 3LSDA 2H2GA 2XYGA 4PC6A 4Y2IA 1R3DA 3BR8A 4PQEA 4QPYA 1WTBA 3JQKA 4AI3A 3SJUA 2WS92 4B3MF 3UUEA 1S1XB 2MY8A 2EK1A 2C8VA 3KAPA 1NNSA 3PS9A 2AN4A 1KI3A 3OOSA 3QVVA 4Q1RA 3BJMA 4MUGA 3ZGXA 3DHXA 1KZ6A 1ORHA 1HBMA 3HHLB 1X5OA 4NHMA 3R6TA 4XDYA 1E6WA 3L7MA 4XTMA 5GONF 4FXDA 1CJDA 5LBCA 5F3EA 3A25A 4RKWA 2VLBA 2IFTA 2XKAA 4QU5A 1LJ7A 2PZ8A 2Z8YM 5KWEA 3B1KA 2V7GA 2ECFA 2R1TB 5LL6d 1X8MA 2R4QA 1RHJB 1WP4A 3ZXFA 2VDKB 1E3MA 5E95A 1WEHA 3NW4A 3QLQA 1TPZA 4JQCA 2QJOA 3IBFB 3TGWA 1B16A 5BNQA 1NSTA 1JYFA 3DW1X 3GOQA 5C37A 3DVAB 1BEV2 3L7DA 2FSFA 1N1DA 3LV8A 1ZRRA 3TNVA 2WA4A 1D6NA 3M2RB 4AQYJ 3JTNA 1BK1A 4ALKA 2FHOB 4E33A 5K8JB 2X7XA 4RGYA 3IMQJ 2CN1A 1FNMA 1BVP1 3AR9A 1BMFA 4HYQA 3K3OA 2QCSB 5FO7B 3KYCA 3J80Y 3HKCA 5CCLA 5FYHA 3CCJS 2R7MA 1FDBA 1GQPA 1E6YA 5JSYA 3MR3A 2GLXA 5JXHA 3NONA 2XCPA 2Q6LA 1X8KA 1CAWA 2PVPA 4L9RA 4V3BA 1XTVA 3WYAA 5HRUA 5G4KB 1PS0A 1SWVA 3EUAA 3JR7A 1IOWA 1NXTA 5EE0A 1GFWB 1TQ5A 4DUZJ 4KYZA 2C7OA 2AUYA 1H38A 3RF7A 5L1KA 1OWMA 4XUEA 3WLKX 1AYN2 4BVLA 5AXBA 4X4TA 1NY6A 1PGPA 2XTMA 3IKVA 4MUMA 2DHCA 2OD9A 4X8LA 3VR6A 4HHHA 4WXMA 3CC2S 5BSHA 5F3GA 2WNVC 1NQJA 4OP3A 3GVHA 4XTPA 5D87A 1EFUA 4PHTA 4RFT0 3G8CA 4QL3A 4K28A 4F8EA 3EDMA 1CAXB 5C0OE 3E7XA 3NBPA 1H93A 4G2TA 3I4CA 1UPCA 4IJVA 1SACA 4C4PA 1ZZ6A 3LOIA 4E4HA 1BN6A 4ZZ1A 2D5IA 1EM6A 5PNTA 4M0UA 4X66J 1VP9A 2X8JA 2HDNB 4PPNA 1JIQA 1QF9A 5AJXA 1CY8A 1YR6A 5KR7A 1LNQA 4M3CF 1KK0A 1SQFA 2XV1A 2XMZA 1HDXA 2J85A 4YDSA 2OGWA 1RBOB 3M1HA 1R7IA 2H4XA 3LI2A 3ZHSA 1B6GA 3F67A 4IH7A 4ARAA 4GEKA 3VKHA 4ZLPA 2JBAA 2JNJA 5J36A 5JJKA 3IALA 3O5TB 5E41A 3GGSA 4LTAA 4JLJA 5DAQA 3LALA 4HL9A 2AZXA 5IAVA 1U3VA 2O3TA 4G0ZA 5K8IA 4GL4A 1OQ3A 4ORFA 3VDDB 2Q5OA 1LJ8A 4IIGA 3O6QA 5LA6F 1QR2A 4AK9A 3R6GB 1N3BA 1ENOA 1S4QA 4LTNA 3HWSA 4JB8A 4UHEA 3BU0A 1YJBA 5FI1B 4AQSA 5FUYA 1TO6A 5EIWA 3MM9B 1K5HA 3CZQA 2CXQA 3GT0A 1XLTC 1KLMA 2EEZA 4PZ9A 2AREA 4EHLA 4RVHA 2W5FA 4FLEA 4RLQA 1R74A 3C3XA 2JLUA 4RPJA 3EVTA 3A1NA 3UPUA 2XJQA 1BHQ1 1RB8G 2CE2X 3D5MA 1D8ZA 1RWOA 4IV1B 4FKBA 2VBFA 4ENTA 3LGNA 1JA1A 3O8RA 1ECPA 3JVVA 4NE9A 4ABYA 3W5CA 1D2HA 1YUMA 2WS91 3PZRA 4AJOA 5BNNB 1T2NA 1CQMA 1O6CA 1RHUA 1A9ZA 1RI4A 1H6CA 1M75A 2GYYA 2FA9A 2CNOB 2EP7A 3QMPA 2NMNA 1TIKA 4NP6A 4MPPA 1U7DA 2VZ1A 1RRMA 1R0BG 2W8LA 3JU9A 4K9RA 4JROA 4UULA 3HU5A 4R9CA 4DUVA 4CN9A 3I59B 3NYRA 1Q16B 3VD4A 4Z7CA 4B9LA 3PYFA 2JJ1A 1H8TA 4DQXA 1TAGA 1XCBA 2FK8A 2CJAA 2XCAA 1NN5A 2R6HA 3LJKA 2PFSA 2CGOA 4AF7A 1EK2A 5BV7A 1GG5A 3DT6A 3C0KA 3K2EA 3HP1A 3BTSA 1XTPA 1ZVMA 3T9DA 1KYXA 4GC5A 1Z4IA 3ZX5A 2CJKA 2WNUB 3H20A 4PZVA 2OSBA 1OQ6A 5CLIA 3BM7A 1M2GA 2G07A 1YQHA 2GDJA 5IVIA 1T2AA 1GQ2A 4DU8A 1YJ9S 2JB8A 3VMMA 2AGOA 3QGIA 3Q3VA 3GUZA 3NL1A 4LKDA 4HLBA 2JHEA 1VB4A 3NNLA 1K3TA 4F7DA 3RUCA 4ZAZA 2FMYA 4BATA 1KDYA 4LSMA 1EH5A 2JIJA 4OYAA 3TRIA 4GPTA 5BSTA 1DEKA 4GO5X 3O8BA 1TDJA 4AX4A 5AWFC 4CEYA 5IHXA 1NLZA 1XE3A 3PJEA 2YNGB 1V1RB 2J1SA 3FDSA 5HVHA 2EZ4A 4LDJA 5JYDA 2G9FA 1XEWX 2ALZA 1PE0A 5KG5A 4DLAA 2QX6A 5LEKA 1AHNA 4K5RA 4K46A 2VUGA 4ALLA 1XHLA 2XKOA 2X8JB 5ACA3 2VTXJ 1BEUB 1MAHA 5I7RA 4G4JA 4E2YA 3HT2A 2IDEA 4HXCA 3J81Y 2ROPA 2Y77A 1Z36A 2V8GA 4V1CI 1WC6A 3ED1A 3FZEA 2FCVA 3AJ9A 4Z0NA 4IY1A 2OEKA 1QJZA 1QSLA 4BQ3A 3T5PA 4INAA 2AI3A 3UG6A 4Q9LA 1JFVA 3SHOA 1HNXF 4ZREA 1LDBA 4KL8S 3UENA 3WYEA 5BW6B 4JLUA 4OJYA 4LFCJ 3H3JA 1QYWA 2EAAA 2BMDA 5ELXA 1VBD1 4RZQA 2IY8A 3AKYA 3O12A 3HLTA 2J9FA 3QX9A 4K0RA 2XE8A 1GQGA 2VFTA 1CY0A 2PO7A 4MV0A 1H2FA 3A6PC 4WBBA 2DPGA 2FPLA 4Y9UA 13PKA 5C31A 2FKNA 3DD5A 3PQ5A 3U07A 4A46A 1CAUB 4R83A 1QV7A 2QP3A 1X50A 1VJQA 1QB7A 3F9IA 1LD3A 5LLSA 3TZKA 3U7GA 3E6BA 4KQ1A 2IEBA 4NU8X 3BTXA 5BN4A 1K89A 4YUVA 2JCVA 4KVGA 1HD1A 3PNIA 1KFSA 5KXBA 1X4BA 2DXFA 3I55S 1X42A 4FK8A 4GH4C 1RRVA 2ATIA 2OMEA 5IDQA 3WRWA 3VKUA 1MT0A 1OIWA 3KAJA 5C2CA 4ABTA 2JJ4D 4KH0B 4KXMA 4YJDA 4MVJH 2IA5A 2V5DA 2DQZA 4CDXC 1HNWF 3T5AA 5CM2Z 1NMEB 2JGFA 3Q8WA 3UN3A 4FPXA 2H18A 1FKOA 3LUDA 2X4LA 3GLSA 2WDBA 1CE8B 1TYDE 2R7OA 3COYA 4JBXA 3TRSB 3SF8A 1LY1A 2ID7A 3O3NB 4HLUC 4RZUA 3PKMA 2AU0A 2XF8A 1MU0A 3HY4A 1C8BA 4M9CA 4ZCTA 3I76A 4KVFA 3G82A 3AUSA 4OX8A 4N8DA 3U37A 4E2GA 1Y8RA 1WC3A 1P4RA 4MS4B 4DEQA 5HDBB 1RTJB 2PHWA 4RJLA 3VGSA 4C3MA 2FSVC 4WKNA 3ZIXA 4YALA 4FD2A 2P6TA 1SQ5A 4YI5A 2EBWA 3AJ2A 1U1FA 2EGUA 2DVBA 5FO8B 2WFF1 1N3IA 3BJEA 4L85A 1GGMA 4RDIA 4LKEA 3FUVA 2OG1A 3ONDA 2A57A 5ALDA 1HBOB 4XZUG 4QWDA 4HRYA 3RIHA 5I7EA 1S0IA 5F39A 3ZIUA 2QBYA 4RACA 1NXWA 2D0OB 2GYWA 2J6CA 4KAAA 1MG0A 4P2MA 1EVJA 3PM9A 1GLHA 3LRPA 3FCUB 2ZIXA 1KGDA 2IYYA 2AXEA 5KT7A 2G40A 4CTOA 3ZDVA 4DHVA 3KL2A 4ZCKA 3HA3A 5FBQB 4FQ4A 5ACA2 1E3WA 1Z7WA 1YJRA 2C5AA 2WT4A 1LHVA 1IKXA 5EJ5A 1F2UB 3BS4A 1DVRA 3DRYA 3A1FA 1GMUA 4XM1A 2H1OA 421PA 1LEDA 4OZ5A 4MLPA 2Y33A 2YB7A 4UCFA 1X0XA 4O7XA 3R5GA 2H7CA 2M6RA 5G0SA 5I42B 3IV7A 4KU8A 3AEYA 5K0JA 1EBUA 2JC0A 4MIBA 1UK8A 1JDSA 4RPKA 3UN1A 3B9QA 1RW4A 4A48A 5BPHA 2FLNA 2CVFA 1KBRA 2CV0A 1R0WA 2Q30A 1EJ7L 4WIAA 4WZZA 2XRZA 4RF4A 5J5CA 2F8TA 4PLHA 4UBLA 3CS3A 1X4EA 4FDVA 4PO8A 3P49B 1M1YE 4EF5A 1NBMA 3C8XA 1GPBA 1ZRIA 1E2KA 5KYUA 2B0JA 3TD2A 5F7OA 3OE4A 2BFDA 4OTZA 4ALMA 3K4AA 1WMXA 2J9EA 1GWNA 2LXNA 5K9FA 4OX7A 3NLCA 1SG0A 5I7FA 3NHFA 3KAQA 3FRHA 2XADA 4CYMA 2AV6A 4RQBA 2BJ8A 4KDCA 3UH0A 2D1SA 4CMJA 5L6LB 2LQ8A 1UK6A 1T4CB 4HZIA 5E1MA 5BUZA 5BYBA 4FB5A 4JT4A 4WERA 3QMMA 1T9ZA 2KBEA 2ABWA 5CBKA 4GKKB 4Y20A 4C2AA 3ZFFC 3V7YA 3LUKA 3QWFA 5GAHI 2BY4A 3TW4A 4CH7A 1N56A 3QYFA 2C20A 4FHFA 4USIA 721PA 4OKNA 3VNAA 5BMVB 2R7LA 1AK1A 2J7MA 4QFDA 4I55F 1IWPB 1P0FA 2J0EA 5HLFB 1HQNA 2MJUA 3QJ5A 1WF2A 3T7AA 1F4HA 1W4CA 2EFNA 5C7PA 5DT9A 2FMIA 2QD2A 1MWYA 3O73A 5BYNA 2C5BA 4OZ3A 3GE9A 4AEMA 4BQNA 5DBIA 4AUKA 2YPYA 1YJCA 2B9WA 3DVAA 1GX6A 4R7GA 3AEXA 2RGEA 2K06A 1F6WA 3R3TA 3KZVA 5JSPA 3UAXA 3P4YA 1RDRA 1Z88A 5T50A 4QT6A 3B6IA 3WL6A 4NCGB 5KNCH 5FDBA 3T7CA 4XDHA 2JJYA 1QQAA 3L05A 4HTFB 1TUBB 3DE7X 4P5PA 2JXAA 4ACAA 4NZ9A 2UUAF 3JWIA 3W8GA 4Z4CA 3OOYA 3TO5A 4ZU5A 5FH9A 3HSGA 2IOHA 1GAQA 1G7YA 3TD6A 1JWLA 4FWTA 1NXOA 4BO9A 3M8SA 1N0VC 1OQ1A 2P68A 1ARZA 2YPJA 3EMVA 2OQ6A 2LVWA 4KXWA 3GJBA 1UBMS 1K12A 2ZB4A 1E58A 4I5GA 1U5BA 1VBE1 2B69A 4FF1A 3DT8A 3JBG3 3P97A 2GK6A 5FZ4A 1CIVA 4FT2A 3OM9A 3LPDA 5LWBA 2OBBA 3TIXB 3GVXA 3IBCB 4KN6A 1IEWA 4L78A 1FJ7A 2VOVA 2JH3A 3PU8A 5MDHA 4IIDA 2C4WA 3RU0A 3HACA 2ISCA 4GUAA 4Q4Y2 3DMYA 1G1XA 4LF7F 1Y7HA 2RKOA 1XZBA 5CTJA 3W9HA 1JKHA 3ZXWA 4LSNB 3VDQA 1MMNA 1U2EA 1MN6A 4EQZA 4UUOA 4IIJB 1B09A 3E4CA 4UMFA 4ASKA 3LW8A 3IFEA 4M0DA 1E5DA 1L7QA 2ZZTA 3KM5A 4FEAA 2OV4A 1Q8VA 4NI2A 3TLMA 4WKPA 1DQZA 4Q29A 3I8SA 3OZCA 2X0DA 2ENRA 1VI2A 1YIPA 1ZIDA 4IQMA 3OHBA 1HF3A 1YB7A 2AQHA 2PEBA 5IRCD 1FJHA 3O5SA 1LULA 2JI7A 2MLYA 1FNSA 3SQNA 1RJWA 1C0LA 5JATA 3TZEA 4NATA 3GP3A 3LT4A 3AWDA 1WCIA 3OCYA 4FMBB 3SEOA 1G7RA 2YFYA 3MK31 3D6AA 3V4FA 2ZYWX 4DZZA 1BBT3 4CEIB 3L43A 5GONB 2HGMA 1B7FA 1ZMOA 4EYGA 3C3EA 4NESA 4BCUA 3SQLA 1U81A 1C3VA 3DEZA 2VBYA 1KTIA 5B55A 4I8DA 3KHTA 3AF6A 2HXSA 1L5UA 4A73A 3H3ZA 1L7RA 4DXTA 3MTJA 2ZIEA 1QJEA 3WLJA 4ZS3A 2IV3A 4LSWA 1JILA 1CR7A 3KHBA 3AFNA 3HPOA 3W8DA 2W8ZA 4B3MB 3KPYA 2BDTA 2XOKA 3UF0A 4U4AA 3VH1A 3S7ZA 4EEKA 5LXTA 1W9MA 1DU4A 3Q0EA 3O03A 2KS6A 4AJKA 4FEYA 2BU9A 3LQQA 5L3QB 2AFHA 4PW0A 3BQMB 4ZOEA 5GAHU 1IOAA 2C5HA 2ACKA 4WZCA 4LFBB 1NSKL 4NA2A 1V71A 3G7NA 3ZYHA 2IHYA 4AZ3B 1NUUA 1UK7A 1YHZA 1G5TA 3EQEA 5JOZA 3WMXA 2BW2A 2CDQA 1KIAA 5FBRB 5D21A 3C24A 4JUAA 4C0AC 2UVPB 1ZISA 5CG1A 4Z53A 5AXAA 2HWIA 3I6MA 1RUD1 2JLVA 2QTMA 5AK4A 4CWAA 1BCRB 3H59A 1L7VC 3IULA 3A3PB 5HKLA 3V7WA 2J9GA 5IAGA 3CH6A 4K2JA 1TJ5A 1DWUA 4M7OA 3MAAA 3VR4H 3I39X 3OLZA 1N1YA 3Q1KA 3KLVA 4HHUA 3KLNA 4L57A 3KPVA 16PKA 2UUAB 5E2AA 3K70B 1S4MA 2CLFB 1M4WA 3ZG6A 1N7HA 1MU2A 2QA4S 1TVRB 1FUIA 3I64A 1ORWA 2VQDA 3H11A 3GRAA 4X62J 5D85A 5DLQC 3AVQA 4P7FA 2AFRA 1GZCA 3VL9A 1RUOA 1EJ6A 2EERA 1ATIA 4HVQA 2BFCB 2B21A 1WHWA 3DFEA 2Q1UA 2BZSA 2XQIA 4X85A 3DVSX 2A1IA 2IUWA 1OI7A 2FR8C 1EEHA 1S3GA 5BNOA 4FYIA 4WE1A 2E1AA 2VRCD 1DKUA 5CEJA 3MI8A 4GNRA 4Q7JB 1VR6A 4BLGA 2G25A 4F7WA 2G1MA 2BZ0A 3DLAA 1O9HA 5BY5A 2YIVX 1VBE2 1G3RA 3PC2A 4FQ7A 2OHDA 3MCSA 4U2GA 3VBHC 1TM2A 1YQGA 2VDVE 3M49A 2Z5FA 5CPBA 3RYFB 2W70A 5IPFA 1JQ5A 4L9SA 4KWEA 3TVZA 3AQPA 1XA3A 3B6EA 2B34A 3CT4A 3HLUA 4D94A 2WOMA 5JTUA 3LWMA 2BPOA 1YUBA 1P7WA 4HAXA 3N8NA 1Y98A 1COV2 3OB8A 1GAWA 4KH1B 5DZ7A 1WABA 2OHJA 4AL9A 4GKKF 2COKA 1J5OA 4D9NA 3L77A 3E7WA 4YJ3F 1HMYA 1KDPA 4ZN1A 2AMJA 3I58A 3GM8A 1V8ZA 2E6VA 2XHEA 1GKUB 5EUCA 4ZP9A 2D9PA 2HWUA 1PW5A 2HCFA 5GM0A 3V4ZA 2MKYA 4MW2A 2AB0A 3W5MA 4BJ3A 3NAPB 1RUG2 1CQPA 2FEXA 1A77A 4F4KA 2W6PA 1RM5A 1DFDA 3ZKWB 2FJAB 5F41A 3FNEA 3JQRA 2OFXA 4JGZC 1T11A 1Q43A 1DKOA 3A06A 4Z7YA 3HGQA 3PHTA 3DHWC 3FPSA 5AOVA 4UTOA 2A30A 4FCWA 2BBSA 1JQAA 2YH1A 2UAGA 5AE3A 4UARA 4IWNA 3BD6A 1B0PA 4L5BA 3Q8FA 4HVAA 2F3TA 1HL7A 3CUNA 3IMEA 1CJMA 1IKWA 4MW7A 1EY2A 2YNHB 1IHYA 2YASA 3HPNA 2AN1A 5F9MA 3IUMA 4R1PA 4S1NA 3OZSA 3O1OA 3ZV6A 5DZGA 4Y7CA 5GMEA 2B3TA 3ZGLA 1QIIA 2GN3A 3ROXA 4JI1J 3SM9A 2MHEA 2DR5A 5A6SA 2DWRA 3LBYA 4FFWA 2WZBA 4ND2A 5FR3A 2ABYA 5DX8A 4H1WA 4JKYA 3MC1A 1YRQA 1WY7A 2X0IA 5DUWA 1U0BB 3QLVC 1UWLA 5G0WA 4MGIR 2PV0A 5LJ5Y 4LMPA 1YKSA 1SOWA 2RGNC 5JS1A 1CRWG 1DB3A 1J58A 4IR9A 4PRLA 4JXKA 2FRDA 4JGYC 2XMBA 1JIIA 3B2NA 3K5OA 1R0AA 1A8SA 1P4SA 1ICEB 4CM9A 4LQDA 3WLHA 1TJ4A 2C7GA 3ASVA 2AFHB 1ZMRA 4AFBA 2MMCA 3PQDA 4HPKA 4WF9Q 1M1YB 3DBHB 2OZVA 1Y5LB 2VJLA 4HAZA 3ROUA 4WY5A 3PNOA 2AWZA 4YY3F 1E5IA 5FY9A 3A7QA 4TM7A 1UWAA 3GAAA 4EUNA 3G0HA 4DSJA 2WUVA 5D8DA 4E12A 4DB5A 1RI1A 5BORA 1EGHA 4P9IA 1RJGA 4IH6A 3BMXA 3VPXA 2VZOA 1NU6A 1X7NA 1DCFA 4R9VA 3WW4A 1EP4A 1J27A 4DV4F 1T1EA 1SDWA 3WKCA 4AVBA 1OWOA 4JVMA 4MTCA 3RSHA 2VBGA 2YL2A 1KR4A 1I30A 1R0CB 1HFEL 1XVAA 3WIEA 5FYSA 3BH6B 2BUBA 1RUC3 3CLSD 4EPWA 1QS0B 2P79A 1ZK0A 5B2GB 3RRJA 3QBQA 3L49A 1RTHA 2Q1ZB 3BKFA 1SBRA 5HL7Q 3UD4P 2ZBUA 5BV1A 3ZZNA 4GL2A 2UXDJ 5IVHA 3AYCA 2HMIA 2Q5QA 2KN4A 4RVOA 1EG7A 4FBFA 1XDWA 5FY1A 2G6TA 3GIIA 2JG8C 2QQKA 2XBPA 2WUEA 4URAA 2HBYB 3PVZA 3DMDA 4KQJA 4QASA 3DPSA 2J7PA 4E03A 3QA3E 5CFMA 1XYNA 4PYIA 1Q1QA 4EDHA 1OD6A 2XY7A 1R5OA 2HJVA 2O57A 1KR2A 3C45A 2TBVA 4ZDJA 4RS5A 2AXPA 3RASA 1I3NA 1P4HA 5HVFA 2JLQA 1QJFA 3AP7A 1NHWA 4RSGA 1Z2OX 1YZQA 4R0MA 1TD9A 1CJTB 5KFZA 3D2WA 4NEHB 1O94D 3C4QA 3GUHA 1V8OA 1GPDG 4F97A 2FSUA 4CN8A 3P20A 2LTAA 4Q3EA 1G8JA 3ZFGC 5C3QA 4PVCA 3G23A 1VE7A 3FMPB 2LYVA 2R86A 5E6RA 1PO23 3GC6A 4X1KB 4RWWA 3B9BA 3GJRA 5EIEA 1N34F 1WKLA 2GTIA 1EB8A 2ZI7A 2ZHAA 3JARB 2JHCA 2RMKA 2QQNA 2IWGB 1FW8A 1UAWA 3OY8A 4JQTA 1G291 2PZMA 4JKKA 2KFZA 5I0SA 1L1RA 4RV9A 4IOLA 2IYLD 2UUCJ 3E2IA 4G0MA 5EWFA 4EW3A 1XZ8A 2EG2A 1CY2A 4GXNA 3SGLA 3DAFA 4ASUD 1DEOA 3KT6A 1SVDA 3QZ7A 3TZBA 3I2JA 1J20A 2FG5A 4IEIA 4NPAA 3GLJA 1A78A 4ECYA 4MW5A 2RKWA 2X3FA 1J3PA 3UCGA 4WK1A 2DPMA 4Y2JA 4DS0A 4WKCA 1I14A 1FTQA 4KUHA 4DR5F 3HJNA 5CIQA 1EQ2A 1S7HA 4YX9A 1L5FA 3IEKA 4WLVA 2FSHA 2Z0MA 4OI1A 2TECE 2R7KA 1TUBA 4LYGA 5U4QA 2I3DA 3RFCA 1SLBA 3M82A 1JTVA 4QZVB 4EYUA 2O0HA 3ABOB 4CQMA 3FKSA 1WD6A 1KO8A 5FEMA 3ND9A 1MTOA 2PSDA 3NM5A 3WP5A 1FMLA 1S2DA 2GAOA 1DXYA 5T55A 3RUBL 3DDCA 4LI3X 1SZJG 4AJJA 2JI8A 2Y1JA 3RZMA 3G68A 1B99A 3MM4A 3CJIA 1WD5A 5DM7Q 4CGYA 1YKFA 2I2WA 1EWYA 2F1IA 1GCUA 3A0NA 2E1RA 5EJMA 3OPYB 3OYWA 1K6XA 2G0AA 1EKSA 1PL0A 1JNRB 4MZUA 4QR2A 5EZSA 3QG1A 1DQ6A 4KMRA 4LJ7A 4MVJI 2PX6A 3LC2O 1JZ3A 1DURA 2OI2A 3JQ8B 4QHYA 1X15A 1CUEA 3EEFA 1AKRA 4CJXA 3KQWA 3LWNA 4L74A 2Z9CA 5MAOA 3E5MA 4A0QA 1Q7BA 3KU1A 4KEAA 4FGKA 4HVTA 1N3QA 2CAVA 4JCKA 1XLUA 3MWYW 4HTIA 1MRSA 4QGLA 3W9AA 4B6JA 3JD1A 4L2NA 2IYGA 4ZU3A 5D3ZA 2MXYA 5JDIC 4MQEB 3BR9A 4YW7A 3L7KA 5ADHA 4PTLA 4H2DA 2ALYB 1DGRN 3WP1B 2AW0A 2CXXA 4HKTA 2VZUA