2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Protein CLP1
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
2ZJ8A 2D62A 4M2LA 2YWEA 2F7SA 1G9XA 1VPLA 5FPTA 4AI6A 4M8NE 1ZBDA 4C0BA 4Q01A 2PBRA 5DHFA 2XXAA 4RFSA 1B0UA 4KCGA 4LDJA 1QVRA 4OBEA 4TMXA 3VKHA 4A2WA 1JEDA 1Q22A 3JVUA 1MO4A 3TUIC 2QQ0A 1NL3A 2YNMA 1OKKA 1HE8B 5G53C 3A1SA 2ZJYA 2IYWA 3LBNA 1E2NA 1KYIA 4OQXA 4AD8A 1W0KD 1W4BA 1PVOA 2IWHA 3SR0A 1GIAA 1SKYE 1RJ9A 3VHLB 2YYZA 4H1UA 4RZ3A 1F3OA 1OFIA 4Q03A 3ADDA 1EGAA 2AR7A 3LVRE 5GJCA 4Y0AA 2CLCX 5DN6A 2AN9A 4CZ2A 1E2MA 2AL7A 4BLQA 2GDJA 1N6LA 2N46A 4LHWA 2OG2A 1ANKA 5FBQB 3SYLA 1OYWA 1E0KA 3KFXA 3THOA 2GF0A 4PAQA 1KK2A 3CO5A 4MYCA 3W90A 1SXJD 3GLFB 3LV8A 3HPRA 1KDPA 4HZIA 5KSZA 4BRWA 1XBTA 2ZE6A 2IYTA 1E4VA 4MUAA 2VH5R 4NMMA 2F55A 4TQAA 1C9KA 5BQ5A 1KHTA 4IKEA 4RKEA 3TR5A 3KTAA 2JJ8A 1W4RA 4QFMA 4MGKR 5GJWC 5HTKA 1E9BA 2O0HA 1ZP6A 1P9WA 1OH6A 2D7DA 4JLPA 4X8HA 5P21A 2PCJA 1JNYA 1N0VC 4ZV4A 1E1QA 2A7QA 1L8QA 2ZJAA 1CJVC 1SXJA 1R10A 1Q44A 1GKYA 3THWA 4P31A 4BLTA 3SI7A 2BKEA 3DHWC 5JCPA 3C8UA 1AS2A 2OXRA 5K8TA 1VG8A 3ZVRA 3OHMA 2ZRJA 3UG7A 2IW3A 3RS2A 1L7VC 3QXCA 4M1TA 1KI6B 2R6FA 4XSGA 3IIMA 1IONA 3FWYA 2HYIC 3EX7C 3B13B 4MDFA 4WIAA 2WWXA 1KO1A 2A5DA 3BXZA 4R7ZA 2G3YA 1CTQA 2GTPA 2VEDA 2YJTD 1YRAA 1Q20A 3SN6A 3LW8A 3R7WA 4KAXA 5FTJA 1G3IA 2HF9A 2A30A 1Z2CA 1NN3A 2FSGA 3NC0C 4IHQA 1NVWQ 1OFTA 4C0JA 5DISB 3EZ7A 3AH8A 1KNQA 3NBFA 5EE0A 1UDXA 4QGAA 2O8FA 2CLDX 3QNUA 3QXJA 4PC2A 4AIIA 4W5WA 2O8CA 5L8VA 2V4ZA 3R7WB 4NYIQ 4FMDB 2WWYA 1E9EA 2YOGA 4QC2A 3K0SA 1AKYA 5CYPA 1LTQA 4RSGA 2GCOB 4Q4JA 2IXGA 221PA 4DCVA 1MRNA 3B8HA 5EE1A 2W00A 4FN5A 1BOFA 4URWR 2F1JA 2BM1A 1JJ7A 1C4OA 4TWZA 1FPMA 2EU8A 2CJWB 1EFTA 5F2EA 1FQKA 1MT0A 3CNLA 3CIOA 1NN0A 4CRWB 3RYTC 1EK0A 2NIPA 3LVQE 3IEVA 1XCPA 3QG1A 4A36A 2RB4A 3QVUA 1HV8A 5FR1A 2ECKA 3X1ZA 5JZVA 1JEEA 4W9MC 3BBPA 4ACAA 1T3LA 2YOFA 3EG5A 3QIAA 1G21E 1XD9A 1XEXA 3MAAC 2XZOA 3EZ6A 5L3SB 1CR2A 1CR4A 2DHRA 1WRBA 2Q3HA 1YJ5A 5FUWA 2BEJA 1YZKA 4D81A 2QNRA 4LK2A 4XD7D 4FMDF 2Z4SA 3GJ6A 2VO1A 3IQWA 3THXA 2ZI5A 1IAQA 3ZDQA 4A4DA 3R8FA 2OT3B 3U3MA 3VNVA 1E0JA 4JZKA 2DWOA 121PA 1KI4A 2BHRA 3D31A 4EIWA 4TMWA 5M04A 1RZ3A 2BBTA 2Q3FA 4NCNA 2VIIA 2W6IA 1E1RA 4PANA 3I73A 4PQRA 4D4MA 5C18A 5JFGA 1SVMA 2BC9A 5FUVA 2QM7A 1Z0IA 3KKMA 4P4SB 4Q21A 3MSXA 1DS6A 2QT0A 1FMLA 4TYQA 1OB2A 1FUUA 1G5TA 1KO5A 4AKIA 1RC8A 1MH1A 4OKSA 4EJSA 2HCBA 3VU9B 1QHGA 4BFUA 5H8WA 2D7CA 2JJ1A 1J70A 5SZIA 3LQRA 4PSKA 1JQLB 3FHTA 4WZAE 3VTKA 5A4JA 3U3JA 4GBMA 2ONJA 3PV0A 4QJ3A 1W2HA 3HR8A 3NIBA 2XITA 2ANCA 4L9WA 1U8AA 3WHLA 4C0HA 2LWIA 4MRRA 4EJSB 1WDTA 1G18A 1FOEB 4EQ6A 1YRBA 1XB2A 1WMSA 4ZCIA 4DJTA 3VKWA 2XXAB 4IDPA 3RNLA 1Z63A 3RS4A 3OEHD 1QHYA 1Z0DA 2C9OA 4BWYA 2OHFA 4F4CA 2PEYA 3MJHA 4KFTA 3SNHA 1W44A 4MYUA 1ZAKA 1ZINA 3IGFA 5TB5A 1Q57A 4PFSA 3HDTA 4QGFA 2OCBA 1LS1A 3RRZA 1Q1ZA 5EP2A 5G40A 1PUIA 4EDHA 2JDID 2B6HA 1KTVA 2B92A 2VPPA 4KXFB 1E0SA 4LJ9A 5JCZA 3F3YA 4Q7MB 5L3SA 2PJRA 4S2EA 3AM1A 3FMFA 3KUDA 2F1RA 3IQXA 4JLJA 4EKDA 1VG0B 1VDZA 1J90A 2Z0MA 1RFLA 2CVHA 3WBKA 1XD2B 1E3MA 3QVVA 2JJ2D 1OPXA 3NDBB 2DFKB 1TUEA 4UXJA 2CJWA 1U99A 3E1SA 1A2BA 3Q5EA 3PCRB 4YQFA 5LD2C 2QE7D 4GL2A 2HLDD 2NQ2C 2NG1A 2PX3A 3AKYA 3W5JA 1ZUHA 3SJZA 4KU4A 4QJ4A 4Q4AB 2A5GA 2PH1A 4DLRA 5BN4A 4RKFA 4DLZA 4U7DA 3LY5A 2ZS7A 2IEYA 1G3RA 4L9SA 3K1JA 1W36C 2BBOA 4C2TA 1XZQA 3EARA 2JJ2A 1XXHB 1YZTA 3TR0A 2W83A 1AN0A 4RVCA 4E22A 2VTKA 3BRWD 2ZJBA 4JJZA 2CK3D 1JR3A 4E5UA 1Z6TA 2C98A 2FZLA 3GJ0A 2R2AA 4TL8A 1UKYA 5AUQA 1IN4A 4G5OA 5JWRA 2W2XA 4D0NA 2H92A 4CVNA 2HV8A 2ZM5A 3ETLA 3K9GA 3KJHA 5GVRA 2XNDA 4RJLA 4RZUA 2OCPA 3GJ8A 3QF7A 3QUSA 1D2NA 1HQYE 4TMKA 1KI6A 2AD1A 1BYUA 2P0EA 4GPTA 4S35A 3DPUA 3N5CA 4OHYA 3CONA 2ZROA 4TMZA 4IOMA 2GEUA 4RD4A 2V1UA 5TDHA 1S96A 2XNDD 2ZRMA 5ELXA 3HP1A 3THWB 3E2IA 1W49A 3CNNA 2PZGA 4JKYA 4A9AA 1U9IA 4PHGA 3C7KA 1AZTA 3B85A 4Z1MA 2BJVA 1VG9B 1FUKA 3O8DA 5B2ZA 3V4FA 1LF5A 2QY9A 5H68A 1DAMA 2F43A 3K9LA 4KVAA 1OJLA 3DKPA 5EP3A 4UNNA 5JJIA 1NIJA 3NH6A 1HY3A 5DNYB 1DO0A 3A4MA 4QXAA 1E9CA 1DADA 2IA5A 2MMGA 4UXIA 2GEDA 3I4LA 4NCJA 1P5ZB 2O0JA 3FPAA 4XWAA 3GLFA 2IUSA 2J1LA 4JLMA 2HLDA 721PA 2GESA 4D4LA 2D74A 2QRNA 2CHGA 3CWQA 1E9DA 1Z83A 4URUR 4EQ6B 2A9KA 4AYTA 1P72A 3B2EA 2PJZA 2ODNA 2RHDA 4D0GA 1JBKA 1GNRA 3FKSD 4YLGA 3F8TA 3A37A 5AUNB 1ZD9A 1GL6A 2ZYUX 1RJ9B 4A2QA 4L5BA 4EPRA 1XCGB 4K46A 2XAUA 5G3YA 2ZREA 3ZIAD 3BIFA 1HE1C 1YQTA 2OCAA 3FOZA 1JXOA 2FPKA 2QG6A 1TQDA 2DR3A 5CB8A 3VR5A 5B57C 1E9AA 4PHHA 2O0KA 3MMPA 2VSXA 4D82A 2OBNA 4TLAA 1OE0A 1D6JA 2ZUCA 4MDEA 3X1WA 3OEED 3W8NA 1NVVQ 1WXQA 1TNDA 2HUPA 1BIFA 4IVRA 3SE0A 4M22A 2LCFA 3PEWA 1GSIA 2W2TA 2CE7A 3T5DA 1XEWY 4YDHB 4BFXA 1XFAA 3ZIAA 3QKRB 4HAYA 2YWGA 2W2VA 3QJYA 4L16A 1FNMA 2VLIA 4BFWA 1XTSA 4EJSC 2OSBA 2HDNB 5DH9A 2F9MA 2B7CA 3BERA 5JMTA 3B1YA 3K09A 3GCGA 2REOA 2ZRCA 4PC1A 4WW0A 1P2UA 1XEXB 4KFSA 4QBHA 5FI0B 3K0EA 4Z51A 5CIQA 4TYYA 2IUTA 4JJKA 4MKIA 1PZNA 4CYMA 2G77B 2ZETA 2HT1A 1OH8A 2QAJA 4LYFA 4GP7A 3A1TA 6Q21A 1FNNA 2EYQA 4BFYA 2JDIA 821PA 3EZFA 4HATA 1OW3B 2WSSD 4C7OB 1J99A 1K8RA 3T1VA 4QKQA 3FKQA 4NZYA 2BCJQ 5DIFA 4KVGA 2V54A 1BKDR 1T9HA 3CX7A 1T91A 4HUQA 1W0JD 2X2EA 2XJ4A 2GCOA 1CLUA 1S9DA 2PMKA 2GVZC 2P6UA 1F2UA 4RD6A 2XX3A 4HLDA 5EXXA 4DCSA 2BKUA 4TTPA 1U90A 3U3RA 4QBIA 3U2QA 3KKOA 5EP1A 5FBWB 1G20E 4FMCB 4C0KA 2OCYC 4GP6A 2O8FB 4PZZA 2X1VA 3QXSA 2WMNB 3Q5DA 3I72A 4MRVA 4P32A 1KY2A 4HAVA 1GOTA 1N6PA 3A1VA 1F5NA 1W1WA 2ZJZA 2PL3A 3D8BA 3VMFA 5GVSA 2EFGA 3EC2A 1IM2A 4BZQA 1IOZA 1IHUA 3Q72A 5L3RA 3O8RA 2W58A 2E87A 4B3CA 2QGNA 2X77A 3QENA 3S1AB 3P4YA 1ZM4A 3A58B 4Q4LA 1DBSA 4M21A 3QQ5A 2CCGA 3WMGA 3LFUA 2WAXA 1CF4A 2WJVA 1ESNA 3UK6A 4MA4A 1OXVA 5CLQA 3B1WA 3X1DA 4B76A 5JEDA 4AY2A 2ZS9A 1E96A 2KSQA 4LI0A 4HAZA 1EESA 2PX0A 1YU9A 3LXRA 4HAXA 1SXJB 4TMVA 2CMKA 1GFIA 1YR6A 4URZR 1B23P 1NBMD 2ZTSA 1R7RA 2HT6A 4EPWA 2OBMA 4PQFA 3JVVA 1E9SA 3UMRA 2WTUA 2ANBA 3NVAA 5F98A 2P2LA 3ZGXA 3CR8A 2P65A 1AS0A 3KTAB 1P60A 1GVNB 3VQTA 4D26A 1XJCA 3FHOA 2ZE5A 4PHFA 1PUJA 1U8ZA 4M0LA 5A5GA 1U9IC 2Q9CA 2X8AA 1S1CA 4Q18A 3AUYA 3V4RA 1NBMA 4NONA 2KJQA 2DBYA 3OFND 2ORWA 3CX6A 3SS8A 2H57A 4B48A 1YVDA 1MKYA 2A78A 3NHAA 1OH5A 3IO3A 1ZM7A 1KI3A 4Q4HA 3WNCA 3GEHA 4B74A 1A1VA 3T5GA 4C4PA 2IF2A 1WBDA 3NDPA 1AKEA 3ND9A 3DOEA 4BZPA 4G5RA 3LW7A 2CCJA 2ZI4A 3IO5A 4LYHA 4UNPA 3LD9A 4JBXA 3RSLA 1Q1EA 2NO7A 2YINC 3D6TB 5FR2A 3AVQA 2BVNA 4AYWA 1G7TA 5TARA 3U4QB 1HTWA 4HB4A 5GJBA 2G1JA 3BH0A 1NN1A 1OHHA 3TVTA 4X8OA 4C3ZA 4JLOA 3KB2A 4YXWA 5LDDC 4HB0A 2RGNA 1QG4A 3Q3JB 2GILA 2Q6TA 4GRAA 5FBVB 3DZ8A 5CJ2A 2QROA 1F60A 1R0YA 2B8WA 4JLNA 4C30A 3T1OA 3TBKA 4YMVA 1UJ2A 2ZXUA 1T8TA 3NTUA 4G0NA 1GRQA 2VQSA 4R98A 2CBZA 2GJAA 2N42A 2QT1A 1IN7A 1SVSA 4Q9HA 2A5JA 5C4MA 3IPXA 2VP0A 1BYIA 3LNCA 4CDGA 4OQLA 3QPUA 2QRZA 4Q1BA 4RFSB 3BOSA 2HXSA 2R44A 4B6FA 1GILA 5EP4A 2FEOA 2FFQA 1XZPA 2CHQA 2DFLA 1TL7C 2J46A 1S2MA 4XWKA 4YDSA 2ZJ2A 4Q9JA 2V8OA 3CRRA 1G6OA 1PJRA 4XSHA 2FSFA 2B8TA 2A3RA 3EA5A 2FFHA 1I2MA 4HEJA 4US1R 1R4AA 1Z0KA 4FCWA 1AGRA 2SHKA 3MJRA 4FMCF 1KSFX 1AA9A 2IXEA 1G64A 4RZ2A 3GLFE 1KI7A 3L0OA 2ZEJA 4JLKA 3UWKA 1H65A 1Z28A 2TMKA 3I3SR 3KJEA 1E69A 1IJEA 1VHTA 2KE5A 3E70C 5AJWA 1JPJA 1ZMXA 3BFKA 1AGPA 3FKSA 1JAIA 4JVLA 1YR9A 1A2KC 2IF0A 4NL4H 3B9PA 1X8KA 4GNKA 2ONKA 4FMBB 4JSYA 2ZJOA 4B2PA 2GXSA 2IHBA 4Q47A 1Q1QA 2R65A 5D3MB 3ADBA 4A6XA 4Z54A 1QDEA 3RS3A 1KO7A 4Q02A 2UZIR 1GG2A 3BS4A 5DI9A 2REBA 1LVGA 1K5GA 4TSFD 2Z43A 4H9GA 5EXPA 2J0VA 1U8YA 2FN4A 2JLWA 4YONB 2J59A 5KNBA 1WB9A 3GLHB 3D3QA 4G5SA 5KUTA 3K70D 4X8LA 4O2LA 1G3UA 5JSZB 1KSHA 2UZ3A 4HDQB 1OHHD 1NG9A 3QOFA 4DEYA 5DN6D 3AVOA 2V6IA 3KXLA 1VYUA 3DKVA 1F6BA 2FGJA 3UXMA 5E95A 2ASEA 2P3SA 2IC5A 2O8BB 2QMUA 1TX4B 2RMKA 5AJVB 4CT4B 4URYR 4W5JA 1H8HA 2XSZD 1VKJA 5CYOA 2EFEB 2NZ8A 2WKPA 4I1OA 3ZQ6A 3ICQB 1E2DA 1NBME 1NN5A 1G1MA 2X2FA 4OQNA 2D4HA 1SGWA 2H8KA 1I2DA 5J4VA 2VSFA 1BMFD 2QU8A 1GDDA 1HT2E 3B1XA 4O2RA 4B2LA 1T5IA 5HR5A 8OHMA 1UBFA 2G83A 2RAPA 2AHOA 3BORA 4US0R 1L2TA 3QKUA 3VX3A 2VA8A 1KMHA 3UIEA 4FIDA 1E2JA 1JB1A 4WXPA 1KAOA 2GRJA 3C4JA 3SJBA 4B33A 4GZMA 3C41J 2XOKA 4AG5A 5CK4A 2BBWA 1Z6AA 3AGQA 1LV7A 5HCNA 1GNPA 2WHXA 2JA1A 3AQ4A 4A82A 1QHHB 1FP7A 3QPWA 1G17A 1G4AE 3B9QA 3H4MA 4HZUA 2QAGA 4LBVA 1GL9B 1GTVA 5C4GB 3REGA 2QTFA 3K0AB 1QG2A 2W6JA 3I8XA 2BOVA 4YMSA 1FMJA 2C2HA 5LBIA 3K0FB 5AR1A 2K5UA 1VIAA 4A2PA 1JR6A 1LY1A 4P33A 4FXPA 3ZS9A 3KKNA 3GLIA 2C96A 1XRJA 3EW9A 2R62A 1OYYA 4GMDA 4RCYA 1P4SA 1Q21A 2REXB 3HU2A 2D2FA 2DWQA 2FFBA 3AF1A 3T06B 3ZLJA 4LHVA 1RW4A 2GBLC 4NYIR 2Z83A 3WXMA 1KK0A 2PT7A 2GK6A 2HEIA 3TRFA 3FTQA 2L0XA 3MCAA 5FOWA 4OQFA 2JATA 1RIFA 3BWDD 1SVLA 4OK3A 2JAQA 3OIUA 1D8TA 1KI1A 1R2QA 2PMDA 4LJ4A 1QHNA 4PC7A 3ND8A 3P26A 2QZ4A 2FPMA 3MGCA 4KLNA 4RD2A 4A8JA 4PPNA 2XNSA 2OILA 3FDIA 2FPLA 1TMKA 3DM5A 3BB1A 3DVLA 4MKHA 2G6BA 3CBQA 3ZS8A 3FFBA 1LB1B 5KTYA 1FL9A 2FFAA 2IYQA 4HLUA 4TYWA 2WOJA 3THYB 3EPLA 4I1VA 1GKUB 1QRAA 1E2IA 2BV3A 5KU1A 2YC4C 3KJGA 1IQPA 2QP9X 1TUIA 3PR1A 3KKQA 3DO6A 4N0EA 1G8FA 2WZQA 4FW9A 1FTSA 4V0NA 4R9UC 3GLIE 5LPNA 2JGNA 3SBEA 4V0MA 2QBYA 2NO1A 2WICA 4IOLA 1Z47A 1ZNWA 5AUOB 4US2R 3HU3A 3I92A 1K5DA 3SFVA 3GPLA 5AK0A 2JLXA 5L3QB 2WWGA 2CDNA 5LB4A 4AURA 3RHFA 3W34A 5FI1B 3UMFA 3C15C 2XTNA 5J40A 4BPBA 1UBGA 1FX0B 1M1YE 4ACBA 1N6OA 2ZR9A 2WV9A 2P5TB 3A1WA 2ZRGA 4DLTA 4KLZA 4HDOB 1KJYA 3WYAA 5DI3B 1L4UA 3ZQJA 5JJKA 2ZRAA 4DSOA 2ZYTX 4B3BA 3LXXA 3U61B 4OK5A 3Q7QA 3SOPA 1IJFA 1YKSA 3CF0A 4NHOA 4HLCA 3VHXA 4PXAA 3TQCA 4B73A 3JZAA 4URXR 2J87A 3MWKA 4KHZA 5FOSA 4DWJA 1E2QA 4UJ5A 4FINA 1SHKA 4B35A 3KFVA 1P73A 3OF5A 4DB2A 3NBXX 421PA 3AVXA 3K9HA 1KO8A 4M1KA 4NYJQ 4D80A 3PVSA 4QHSA 1KIMA 2J7KA 2F3TA 4EPVA 2J45A 3DOFA 2I1QA 4JL8A 4IJMA 5KDOA 1P61B 2D3WA 1YZNA 4ITRC 1DAGA 1G8HA 4UNSA 1OSNA 2RGEA 4L4UA 3TIFA 1Z08A 2O5VA 1LW7A 3RSOA 2XGJA 2NPFA 1II8B 4LSGA 1US8A 4MUBA 3T15A 2FOLA 1NI3A 2OM2A 3R9IA 3HPQA 2J5XA 1G4UR 1Z0AA 3M4YA 5TY0A 3AF2A 2VF8A 1M7HA 1IXZA 1HURA 1UF9A 1X1RA 3OIWA 3FGNA 3QKSA 4KV9A 2VBCA 4O0MA 2F9LA 1JI0A 5EQTA 1HT1E 3LO5A 1R0XA 3QF4B 4JL6A 2FJUA 5FPYA 5J4HA 3QEJA 4NTZA 5BXQC 2PZFA 4GZLA 4L8GA 1LF0A 4TTQA 4ZIRB 1FQJA 1W4AA 2OFXA 2VP5A 1CS4C 1QHXA 3PUXA 4N0DA 1XPUA 3Q9LA 3KXKA 3IIKA 1P62B 2OBLA 4EFMA 3TMKA 3R20A 3ZZ0A 1YZGA 3ZD7A 1P2TA 3EZ2A 2DCUA 2ZAOA 3PQCA 3SQXA 4OQMA 4C9BA 3B82A 1DELA 1QHIA 3QXHA 3LQQA 3MWYW 1SKQA 2IT1A 2ZU6A 4TYPA 3WMFA 3GJXC 4CW7A 5CDFE 5HKKA 4BQSA 3SHFA 1D9XA 5KNDA 3F5FA 2WSSA 4PAMA 4OHXA 3SBDA 1WF3A 2CHVA 2O8EB 2FNAA 2C99A 4N1AA 5HPYB 1JR3E 1PLJA 1E94E 2Q9AA 4XIGS 3IPYA 3WNDA 4TTRA 1JJVA 1R0WA 2E9SA 1VYTA 2DYKA 3PFIA 3W6OA 4MKGA 5J4LA 3CKLA 1J7KA 2FEMA 2ZS8A 4QM6A 3Q8XB 4DDWA 1NVXQ 5J4YA 2GXAA 3PIRA 4LBWA 2GCNA 3CX8A 3X2SA 2LKCA 5IDVA 3GFPA 4I4LA 3QG5A 3UMSA 3J81k 1P7CA 4ESHA 1DAKA 3QI2A 3UATA 3K53A 2QE7A 2PLFA 1E6CA 1AQUA 4PO9A 3B5JA 3QE0A 4MGZR 3WP0A 5KPJA 3GLGB 2GA8A 4F92B 2N1BA 1MO6A 2UKDA 1JECA 1ELOA 1G7SA 4Q9LA 1DVRA 2J9RA 3B1ZA 5FPHA 4UNRA 2J0QA 4WXRA 3U44B 4Q5IA 4IXMA 2WJIA 2VL7A 3TAUA 1FTNA 3DM9B 1JQJC 5TXGA 2CK3A 1K6MA 3CPEA 3TSOA 3MD0A 4TT3D 3SHWA 4EFLA 2FSIA 2JLSA 3IILA 4BE7B 3UANA 4HAUA 4P3YA 1OIVA 2H16A 1GL7A 2QP4A 5F3WB 4WAUA 1MO3A 4YMWA 3WYFA 1W46A 1ESMA 2R6GA 2X19A 2ATXA 1F2TA 5HE8A 3T61A 3IHLA 2HF8A 5J5CA 2GZAA 3IDQA 2EWWA 5JEEA 3RRNA 5DO9A 3KXIA 4TT3A 1TEVA 1Z5ZA 2WPDA 2F6RA 3ASZA 3EIHA 3EASA 3H86A 2YV5A 3PG5A 3T1QA 3I5YA 5KO2A 1R5BA 1X6VA 5EZ6B 2VF7A 3BH6A 5A0FA 1N6IA 5J47A 3B60A 3R8CA 2JASA 4HI0E 1E2PA 2W0MA 3SU8A 4TLEA 3RDPA 3AVYA 1IN8A 1SVIA 2FF7A 1GM5A 5KHOC 1Q1BA 1Y63A 3MFYA 3EWSA 1N5LA 2IL1A 4MGYR 2QENA 3PEUA 1G8PA 4GI7A 3VR1A 1JALA 1XU4A 1Z6XA 3LWNA 2XTMA 3RS5A 2KBFA 4LWZA 1OKKD 2WM9B 2ZRLA 5HE9A 1YR8A 4I1SA 2H7VA 3RC3A 5EUMA 4A1FA 4OYHA 1OXXK 5G3ZA 2XSZA 3CZQA 1KI9A 1R5NA 4GFDA 4MITA 1Z3IX 5EJEA 2YKGA 1NMYA 2ZITA 3GP8A 2P6NA 2A5YB 2NO9A 2JLQA 3H2YA 4JT2A 2QA5A 1G7RA 1T5LA 2Z4RA 2ZE8A 4PAOA 2V55B 3W9YA 1G3QA 1R8SA 3H84A 1DARA 2BIFA 3HWSA 5SZJA 2CNWA 2VHCA 2IS6A 3G82C 4HUTA 3U44A 4O25A 4DSNA 3I1FA 4QOSA 2VHUA 3ONWA 2BBSA 2QN6A 4TLCA 4V0ME 4G1UC 3TJZA 4A0HA 1YZLA 4V03A 4DT1B 2YWFA 4R2HA 3GLGA 3QY0A 1NNEA 2QL6A 5F9HA 1OF1A 2QQEA 2J0UA 3OE7A 1V43A 4JMPA 2XEXA 4K8OA 2I1VB 1OIWA 3GEEA 4LX0A 4MRSA 4XTRA 4LUCA 2O8DB 1ZRHA 3BJIC 4M1SA 3CF6R 5EXSA 3ZJYA 1N5JA 4PX9A 4RCZA 4OI2A 1UBCA 1Q3HA 2J7PD 2JLVA 1NLFA 1XJQA 3RS0A 5TV2A 5CM9C 3KUCA 5HZHA 4B43A 2JLZA 4ZCLA 3I61A 4OK6A 2ZRFA 1EFRA 4DZZA 3U6KA 2WWHA 1DAHA 1YE8A 1E2LA 2O8EA 3ZVLA 1GZSA 4QHTA 3Q85A 1XP8A 5CLLA 3KX2A 1WE2A 4IOJA 1X86B 2IYVA 1NLZA 1KJZA 2GJKA 2VP2A 3C5CA 3TAHA 4AWXA 1DPFA 1T0JB 3SFZA 1NJGA 3N70A 1XWIA 3U3OA 4ZO4A 4CEJB 1J2JA 1G8YA 3A1UA 2CVFA 2QI9C 2ZANA 1M34E 3WRXC 1S4QA 1NJFA 4A92A 4B3FX 3TKLA 1UBEA 2ZUBA 2NZJA 4WBSA 5CIWA 5JWOA 3M1IA 3SC3A 5E7IA 4ZCMA 2F1HA 3PUYA 2GHIA 4F93B 5BYJA 5DE3A 2O8DA 4TL9A 2GETA 5ANRB 3QF4A 4AG6A 3P4XA 1IY1A 1SKYB 3NG1A 3QKSB 4AC9A 1HEIA 5GJVC 2ODEA 3VR6A 1RKBA 2XZPA 4IVQA 4IRUB 3EIEA 1ZC4A 4WA7A 3AP1A 4WOPA 4BFTA 5BN5A 2WWWA 4IOKA 5F9FA 4DT1A 1U2RA 1GWNA 5TMPA 3K0CC 3TUZC 1EFCA 3CM0A 1E0AA 2IYUA 1US8B 3BH7A 1VMAA 2CXXA 4D4JA 1NG1A 2DFNA 1XMVA 3O8BA 3WYGA 1AM4D 2WJYA 3FYHA 3GQBA 2GK7A 3AGPA 3EA0A 4ZDWA 4BLSA 2KB0A 2R8RA 3IBYA 2FH5B 4PC3A 4CIDA 3U7FB 4O3MA 1N2CE 1P2VA 1T6NA 3M6AA 4Q48A 2NGRA 3ZZUA 5KDDA 4M1MA 4PTLA 2GZHA 3FVQA 5C2JB 4QM7A 4P0TA 3ECCA 3GJ5A 4M9ZA 4CEHB 1N6NA 4DVGA 2R9VA 4JKIA 3GEIA 1ZW6A 4FD2A 2GCPA 3WP1B 1UKVY 4FWIB 2G0TA 1OB5A 4Q9KA 4ARZA 3PUVA 5JBQA 5BW8A 2Y8EA 1U0JA 3OFNA 4CEIA 4DLUA 1UKEA 4Q7JB 2GAOA 2IX3A 2BMJA 4NBSA 4ESVA 5E7JA 4TYNA 1UEJA 2EWVA 1TQ6A 2W6ID 4PO8A 2ZSFA 2GXQA 4DBLC 1NMXA 4QJ5A 2WWFA 1EX6A 4U5XA 3OEHA 1E1QD 4DHEA 4Z1MD 1DTSA 1E2EA 3B7GA 3GFTA 4Y0VA 1E4YA 1SVOA 4LJAA 5LD2B 5L3QA 3L0IB 4IFEA 3U60B 3AVVA 4LPSA 2WKRA 4ARZB 4QGGA 2FA9A 3FMIA 1XCMA 5FUYA 3IUYA 4IDQA 1OLOA 4HLQB 1AS3A 3NXSA 2RGGA 4XTCS 1TQ2A 3L8ZA 4D2IA 3C16C 2RGAA 1E79A 3SJAA 1TADA 4EPXA 1CR1A 3UKDA 2IYYA 4F4IA 1XEWX 4IDNA 1KZ7B 4JSTA 1E99A 2ZI7A 1MABB 4M9SA 5L3VA 2QMEA 4PPQA 4H1VA 2YZ2A 3TUJC 1QHSA 3R9WA 3AF0A 3CPJB 3RS7A 2WIAA 3V00A 5H70A 1TQ4A 2RHMA 3LAWA 2DY1A 3EPJA 1XMJA 3U5ZB 1KDTA 1ZIPA 4QRHA 5JHGB 2D2EA 4MH0R 4XWOA 3ASYA 3NKVA 4WVFA 3A36A 3HYRA 4XD7A 1U94A 2XZLA 1T4GA 2YWHA 2BJWA 1KK1A 1DE0A 3LLUA 2HYDA 5FPKA 2CNWD 4G5QA 5CJPA 1X8LA 1Z22A 2QMHA 3CRVA 1Z0JA 2V6JA 1T3HA 3N2IA 2MSCB 4BUJA 1GITA 2Q9BA 1O3YA 1VCNA 1EXMA 1UPTA 4PPGA 2CL7X 4KSBA 1EFRD 4NDZA 1H8HD 4UXHA 2RCNA 3PEVA 5DYGA 4NYMR 2AWOA 4IDHA 4AKGA 1R0ZA 2ORIA 4XOIA 3M0EA 1XTIA 3O47A 3VKGA 3SZRA 621PA 1OFUX 3AP2A 4LHXA 5DLQC 1CULC 1BMFA 1H8EA 1ZYUA 1JPNA 2AK2A 1Z07A 4LPKA 2ZE7A 4QBGB 5AWFC 1VTKA 1TF5A 2R6DA 4QBFA 1IBRA 1OXSC 4OI1A 1P9NA 1NKTA 3DZDA 4M53A 5JWHA 1EX7A 1F48A 2OZEA 4M1YA 1E2GA 4TSFA 3DL0A 3ZVMA 4UNQA 2ZIAA 3B6EA 4NH0A 3CRQA 5HZKA 3GLHE 1Q12A 4WZ6A 1X3SA 2ZVPX 2OFOA 1OH7A 4OHVA 4WZBE 1MR3F 2GJ9A 4OJKA 1FW6A 4FCTA 5BN3A 4DDUA 3D7MA 3LDAA 1EFHA 5SZKB 4LOAA 3P27A 1RYHA 4PC6A 2YOHA 1N6HA 3C5HA 2YHSA 1UDWA 3LH5A 3RWOA 4M9XA 1N0WA 3KDSE 1ZD1A 1FZQA 4EAQA 4DLXA 2VHQA 2QSYA 2XTZA 4ASUD 1VCMA 3MWJA 4JBWA 3ZH9B 1ETUA 1M7GA 3PITA 2C5LA 3G0HA 3CWZA 1G16A 1YR7A 3BC1A 3FHCB 4PZLA 4ZI2A 2DB3A 2RGXA 2R6CA 3TW4A 2J0UB 2QSZA 2HXYA 2WMOB 3SYNA 3NH9A 2MMCA 2KWIA 4MRPA 3JZMA 4KODA 2F1IA 5B58C 2FDCA 1G5RA 2GEVA 2QPAA 3P32A 3U7EB 1I4DD 2OE2A 3CUEF 3RVBA 1DEKA 1R6BX 2NO6A 1ZUIA 2WOOA 3AKEA 5FUXA 3EWAA 1E98A 2ZI6A 4ABYA 3L82B 4ASUA 2ERYA 4OI4A 4Q1DA 2XOKD 2O8BA 1CU1A 1V5WA 4TLDA 1I4LD 2EQBA 1MABA 4Q7LA 1CRQA 2QORA 2ZSAA 4C0SA 1KY3A 1JXMA 1E2FA 4G3XA 3ADCA 3DEFA 2ZRKA 4B3XA 1UM8A 1XD8A 2JLRA 4Q00A 5LB2A 5JLJA 3U7GA 5C1BA 1QVAA 3GD7A 3C14C 5JS8A 3Q7PA 4BFZA 4B47A 1BO6A 2UVQA 3WRYC 4YXWD 2V3CC 3U3KA 4YMTA 4DLWA 3CZPA 2G9NA 2WJJA 2W6JD 2Z6VA 1NP6A 4DUGA 4NKRA 4R71A 1W48A 1Q3TA 5IF9A 5FFMA 2OO7A 5DI3A 4LV5B 1NVUQ 2VP4A 3PUZA 3QEOA 4B3DA 5IT5A 3RC8A 3ADKA 1G6HA 1GRNA 5IHPA 3VAAA 4XVUA 4JVNA 5KNCA 3KQNA 4E07A 2IYLD 2MSDB 3FMPB 2OFWA 1SHZA 2GVDC 1KK3A 3BB3A 5TVKA 3K70C 3CLVA 1VIYA 1AIPA 2VSOA 4D4KA 1DO2A 3PJRA 4CEIB 1W5TA 1G7CA 5K8UA 4KITB 4QHYA 4RD3A 2QBYB 4U02A 4HB3A 1XPRA 1KAGA 2V1XA 3FMOB 5G41A 4GDFA 4CEHA 2CE2X 2QGZA 2OAP1 4E03A 1VYVA 1W0KA 2IK8A 4R2IA 2D06A 1UFQA 1ZCAA 3ZYCA 4XH9B 3B78A 4QL3A 3MUFA 2EW1A 1NRJB 5FL7D 3TH5A 5AJZA 3TLXA 1WP9A 1IN5A 3TW8B 3GJ7A 3IIJA 3AVPA 1OT3A 4G5GA 5AJXA 1P75A 2QTHA 4DC9A 1NIPA 3RAPR 1JR3D 1S3SA 1KDOA 1DAIA 2EYUA 3U6BA 3HU1A 4RD1A 4W5HA 2G1KA 5E4FA 1ZCBA 5FPSA 5JRZA 4BGDA 5HKKD 2EFHB 4DEXA 1HQCA 2AX4A 1ZNYA 2W0SA 1WQ1R 3AF4A 4M1WA 2R6AA 4ZDIA 5FTLA 2C9YA 4GOKA 4EUNA 3A8TA 2WJGA 4Q66C 2IHYA 1TPZA 3U4QA 3EPKA 3ZZTA 3KJIA 2CCKA 4QNRA 1R8QA 3KKPA 5FBRB 1II0A 1ZM9A 3SYKA 4G01B 1HYQA 4IEIA 3VR3A 4BEBA 4DXAA 2BM0A 4Q7KA 4TZ0A 3WY9A 1WCV1 2WIBA 3DMNA 4CEJA 4KJZA 2C8VA 3VR4A 1G41A 4IEEA 5EZ5A 2FZ4A 2GAAA 5FOXA 4NCIA 3K0AA 1Z8FA 4MRNA 1NKSA 3FB4A 3B1VA 2QAGB 3GFOA 4HZUB 5CDFA 1UKZA 4B75A 4MYTA 4BZXA 2E1RA 2WSMA 3TQFA 1KZGB 1W0JA 2F3RA 3E5HA 5GADl 1COWA 1T0HB 1XTJA 5JI3E 1KNXA 1LNZA 4BLRA 3QXXA 3GJ4A 3MWLA 2IWRA 3WNBA 4V0OA 4DSUA 3MRSA 4TZ6A 1W36B 2BMFA 4IDOA 3AKDA 4DCUA 3EPHA 1XEFA 4UQOA 5AUPB 4E09A 1O87A 3PXGA 3QSYA 4B3GA 3L0SA 2C77A 2GWHA 2WWIA 3ZVNA 1RRGA 2ZI9A 3VR2A 1M6NA 2NO0A 2B21A 3H1TA 2IYZA 4ZDJA 5JECA 3OIYA 1PV4A 5FBLB 2FE4A 3AVTA 1YZQA 4NCKA 2HJVA 4YMUA 5DGXA 5FOVA 2H17A 3MLEA 2FWRA 4P4UA 4ZKEA 2ZR0A 4DSTA 3VX4A 4Q1EA 3KZ1E 4PO1A 1DAEA 5IK2D 4PQYA 4B6EA 1ZD8A 2IYXA 1XJ0A 5KSPA 2G0NA 1G291 1UAAA 1XNJA 2ZSEA 4EFNA 1KMQA 1GAJA 3BB4A 4II7A 5DSZA 1OFHA 4HYYA 1ZJ6A 4DDVA 4JIMA 521PA 4Z8XA 4RD0A 1GRRA 1VECA 1XTQA 4Q1AA 2ZPTX 5J4KA 1U0HC 4QNMA 1E2KA 5JSZA 2JCSA 2RKOA 2IBMA 1FFHA 2OAQ1 1RRPA 1SXJE 4POAA 5IRCD 1T8UA 4LC1A 3A6PC 3NEYA 4BFSA 2BEKA 4B71A 2JJ1D 2DFTA 1N3BA 2I4IA 2CL0X 4C0LA 3OAAD 1E32A 2P5SA 4FI3C 1IXSB 2OV2A 1NY6A 1RYFA 1NLYA 2V7QA 2ZI3A 4GSYA 4M1OA 4UKDA 5BYKA 1TTTA 3N2EA 1XX6A 2GKSA 5D3MA 4W7SA 4C7OA 1ZIOA 2A5FA 5JS7A 4FWTA 1KDRA 4M9QA 5BWMA 3EAQA 1OIXA 3RLFA 1AZSC 2GF9A 2WJHA 1GP2A 1E2HA 4BRUA 1W2GA 3VFDA 4CT5A 3IKJA 3KQUA 3QBVA 1ODFA 2C04A 1E79D 2P67A 4I81A 3V9PA 4GOXA 2RGBA 2IYRA 1ZNXA 3OAAA 4LBZA 5JRJA 4DDTA 1NMZA 1EWQA 1F2TB 1XMSA 2BDTA 5KDLA 4GT1A 2FSHA 4C2UA 1A82A 1ZNZA 3O8CA 5FTNA 3K70B 1Z6YA 2VHJA 3CH4B 2EFDB 1Y3AA 4LJ6A 1LFDB 3THYA 1VHLA 3UPUA 2ZRHA 3W6PA 1UEIA 2NTYC 4QGHA 1Z06A 1Z29A 3SQWA 3A4LA 4K81B 3RANA 3KQLA 4JS0A 2IYSA 1W7AA 1CJMA 3DMDA 3K0CA 2KBEA 3T1TA 1KSGA 3IEUA 1SZPA 4DLVA 4ZPXA 2C9CA 2Q0HA 4C0QC 1RRCA 1AK2A 2RH5A 2IEZA 2YC2C 2B7BA 2ZRDA 1W4CA 3AF3A 4LHYA 5FL3A 5E7MA 4C0AC 3AVUA 2GNOA 1A4RA 1Q0UA 1SVWA 1N6RA 4Z8YA 4LV8B 4XVQA 5CB6A 2Q3MA 3NC1C 2VHTA 1TF7A 1S1MA 2ODBA 2WBLC 2IS2A 3TE6A 2QAGC 3P20A 1UADA 3RWMB 2CEAA 1EG7A 3WBJA 4OI0A 1HA3A 3REFA 2KI5A 3BFXA 1M74A 3NEJA 4TLBA 1OXUA 3GLIB 2ZSDA 3L2OB 1SQ5A 3OIVA 3AV0B 3CR7A 2O52A 3IBGA 4PSVA 2XJ9A 1CBUA 4KFUA 1P9RA 4F38A 2VRWA 1JAHA 4NP6A 4DIEA 1RE0A 1Z6GA 2XB4A 2GBLA 4BASA 1CIPA 1CP2A 4DRZA 1GUAA 4F91B 3TSWA 4BFVA 1G5PA 1X8JA 1QHHA 4NU0A 3DDCA 5H1YA 1L4YA 1W5SA 3TK1A 2IS4A 3SDZA 5EE5B 1U0LA 3I32A 5EE3A 2JLYA 4PR0A 4JLDA 2AKYA 4NE2A 5JI2E 2J41A 4B32A 1TU4A 1LS6A 4LJ7A 2WVJA 5EUQB 1S8FA 2RGNC 2ZYVX 4PZYA 1D2EA 4F7WA 1U81A 5CITA 1P6XA 1WBBA 3NBYC 1N5IA 1T3SA 2AKAB 1VCOA 3L0PA 5HCIA 4LC0A 2LKDA 4DUGD 4ZIRA 1S0UA 1KMHB 4JBYA 1KKLA 3OESA 1IN6A 5SZHB 4KSCA 4KYUA 4J0QA 1SXJC 4JVMA 2ZVQX 2OLJA 2ZSBA 2PCLA 3IHWA 1RRFA 1II8A 2BMDA 3TVDA 1ZM2A 4JLVA 3HYTA 3KQHA 2QM8A 1NF3A 3LBIA 1EFUA 2VP6A 4AK9A 2ZRPA 1E9FA 3TSZA 4NPHA 2J7PA 4A0RA 3LX8A 1C1YA 2FG5A 2OXCA 4ILEA 3QKTA 4JLAA 1CKEA 5UKDA 2NPIA 1CJKC 1MOZA 3RABA 4DCNA 4TQUS 4U00A 1QBKC 3L8YA 1XXHA 1ZVQA 1TEXA 3ICEA 2ZU0C 3BFVA 4JLBA 4IFBA 2H1LA 4MGIR 3I5XA 4D0LB 2ODWA 3GJ3A 1DAFA 4LJYA 1AQYA 1OXTA 5EE9A 5KPDA 4EPTA 4Q4AA 4LHZA 1NVVR 4DKXA 1YZUA 1BS1A 3BK7A 2Z5FA 1CJTC 3K8YA 2EVWX 3EZ9A 3T35A 4GOJA 4ZDKA 1Z0FA 4KBGA 4LYJA 4ON9A 5K8IA 4FCVA 1QF9A 1FX0A 4Q1CA 3K9NA 2OEPA 1D5CA 3LLMA 4LZZA 3T34A 2GJSA 2MSEB 4NCHA 1X1SA 3OEEA 2HJGA 4JYCA 2JIZD 5KYKA 3PUWA 2OLKA 1W36D 4HDCA 4IW3B 2ERXA 4JL5A 3I8SA 3QPVA 3LA6A 4N3NA 4X8MA 4V0KA 3FFAA 1G19A 4XVRA 1NSTA 2AXNA 3OE7D 4Q19A 4DCTA 3SJCA 3UG6A 4ZKDA 2QP3A 2OUKA 2NOAA 2IS1A 1VG1A 5KSOA 4A15A 3CRMA 1ZUNB 3F0TA 2C03A 1HH4A 1PLLA 2AD5A 3MG9A 5E3HA 2RGDA 1D2MA 1YHNA 3CB4A 1G3MA 1M7BA 4HAWA 5CK5A 2RGCA 1IY2A 4KBFA 3W3AA 4RZXA 2JEOA 2PZEA 2ZJ5A 4A8JC 4LGMA 5KOYA 2BMEA 2VYFA 3AB3A 5AJYA 3HJNA 2H5EA 1DOAA 2BWJA 1XTKA 1XTRA 4LV6A 3LRPA 1E1RD 4DIDA 4A8JB 1J8MF 4TMTA 3L43A 5FH9A 4TQ9A 1N25A 1WA5A 1EWRA 1ZU4A 1D9ZA 4DB4A 3CW2A 4LBYA 1U98A 4MKFA 1N5KA 3AP3A 1A7JA 4AYXA 3H0KA 5JJLA 4PSAA 1E9RA 2AXPA 2I3BA 3KB1A 2GXUA 3RRMA 3VU9A 5KSYA 1KI2A 4B44A 1MRSA 1XF9A 4HSEA 4IVPA 4OJQA 2VP9A 4DLYA 2YVUA 4KYIB 1VCIA 2CLSA 4P4SA 3I62A 3BAFA 1KO4A 1ZC3A 1CXZA 1A5TA 4LYAA 4Q4HB 4UJ3A 2CL6X 3K0FA 3KQKA 3EC1A 1IXRC 3CRW1 2AWNA 4V02A 1XDBA 1P3JA 2FU5C 4ZI3A 2ZRBA 3BGWA 3NWJA 3ZD6A 3AKCA 4BLPA 1RVDA 1M2OB 1M8PA 2WPDD 5K8LA 4EPYA 5CM8B 2HCJB 3THXB 2P6RA 1KGDA 3OZXA 2F43B 5B30A 2IXFA 2QTVB 3T12A 4JYBA 1OV4A 1PLKA 4LCBA 3WMEA 4GMXA 4ERNA 4LRWA 4TL7A 4A0GA 3PENA 4DLSA 4M4SA 3TGPA 1FP6A 1ZU5A 2J3EA 3A4NA 1GKIA 4LJ8A 3WHKA 4URVR 2FGKA 2A2ZA 2ZR7A 2ZYWX 4I1UA 1RPZA 3CF2A 3EXAA 4P4TA 3CPHA 4B34A 4Q1FA 1CR0A 1SVKA 2ORVA 3BE4A 1CEEA 3X1XA 2V9PA 3BD9A 1CJUC 5IK2A 5JHHB 2C95A 5D3QA 3AVWA 4CF7A 4JT4A 1QZXA 2ZUDA 4A0FA 1MV5A 1DG1G 1R5OA 4NYJR 4MQBA 2NMVA 2AFIE 4OHWA 5DYIA 3W6NA 4A6PA 1XPOA 1AJEA 2H18A 4Q4JB 2PLRA 4CGZA 1ONBA 4TL6A 3S1AA 4BLOA 1TAGA 3CH5A 2FX3A 2Q21A 4BECA 1NY5A 3AEZA 3AUXA 1TU3A 1HUQA 1KJWA 4HB2A 4MYHA 4V0LA 2WKQA 2O8CB 5C46F 2XB2A 2G88A 3VNUA 2ZQ5A 3PEYA 1H8ED 3K09C 3RRYA 2QPOA 3TNFA 3W8RA 4KI0A 4D6PA 1CRPA 3CNOA 1N0UA 4JVSB 5FOTA 2QUZA 2ZRNA 2DWPA 3G5UA 2PEZA 2QEQA 3GLGE 2FV8A 4LY6A 3GLHA 3W3ZB 4I99A 3UWOA 3LBHA 3NHBA 2JLUA 1DG3A 1S3GA 1XMIA 1F2UB 1MO5A 4B2IA 1N6KA 2J0SA 3P1JA 2WAYA 4NYMQ 2FMXA 4HUQB 2QPTA 2AFHE 4TN1A 3W5IA 4IXNA 4RY2A 1XXHE 3LX5A 3QBTA 4AKHA 3U7HB 1KI8A 2C78A 1SULA 2JIZA 1KKMA 5FL7A 2DPXA 1XD2A 2BCGY 2EFCB 4RFVA 5EXTA 4BEJA 4XJXA 5B64A 4Q9IA 1KOFA 1IY0A 5DHAA 3FE2A 4L15A 1KSJA 1P2SA 2ZAMA 4KO8A 1W47A 3NBZC 3X1YA 1COWD 2PT5A 4LJ5A 5FOUA 5FTKA 2GZDA 3HR7A 4OHZA 1S9HA 3GMTA 4QG7A 1G8GA 3KL4A 4PPFA 1GNQA 1TF2A 2V7QD 3SEAA 4OL0A 1II9A 4F4JA 1J8YF 2QMOA 1BH2A 2AK3A 1ZM3A 2ZRIA 3EIQA 3QKRA 4AKEA 1I4TD 2IUUA 1NSFA 2GJ8A 4KFRA 4YC7A 2ATVA 4HLUC 3R9XA 1Z2AA 5FTMA 4PHTA 2OESA 4D25A
chains in the Genus database with same CATH superfamily
3NGSA 1VMEA 5DPMA 4LE4A 5EPOA 3ZQUA 2X6TA 4E2SA 2F7SA 3ZSLA 3UB3A 3DE2X 4M8NE 2PBRA 4JTNA 1FS4A 1V6SA 5EOVA 4NE7A 4YMGA 1GZ5A 1Q22A 2DURA 1W4BA 1PVOA 4PGFA 3SR0A 5J2TA 4PW0A 2ENRA 4SLIA 3VGJA 1VHJA 1FFSA 4HTJA 5DN6A 4C1BA 1W88A 4X62F 1BE4A 4KJXA 3KFXA 2E5JA 3IVAA 2X8JB 3HN1A 3JAWA 4UM9B 4I6AA 1OUSA 3HFJA 4HZIA 2MJUA 4ISRA 1YCIA 2HWB3 1PJLA 4EEKA 2UU9B 4H1HA 2DK2A 4AN1A 2RM23 5DHUA 3ZY5A 2HNDA 1ZP6A 4YXFA 4X8HA 4RVSA 3OIDA 2EBWA 4EN6B 4M7OA 5JCPA 4G56A 4MWEA 1JF8A 3AERB 5E9WA 4MZUA 1R1DA 4PYQA 1FS5A 1RGSA 1VQ5S 1Y7HA 2YXNA 5FTJA 2OB2A 2WEKA 3I2OA 2Z79A 1HA1A 3JQAB 2ES3A 1JMYA 3B1JA 1UD1A 5DISB 5EE0A 3DEIA 3S2EA 1OFSA 2FIUA 2O3JA 1NY71 1ZHHA 4HPWA 3BODA 4CBVA 4XEHA 4KUGA 2JEIA 4CWAA 1XZAA 4Q4JA 3JALA 1M5TA 3RQSA 4IDKB 1N33F 4GX5A 1EK0A 1EP0A 3DXBA 4RHYA 1Y1KE 2Z6AA 1A8MA 1UUFA 3LDRA 1MNEA 4R8SA 3W2WB 4M87A 5T7LA 4EFKA 1YJ5A 3CLHA 4CKEA 3IQWA 4KZPA 3THXA 3F47A 4FT4A 4FOWA 1VOMA 1QHEA 2R6QA 3AXKA 2BHRA 3D31A 3EWNA 3VRHA 2PSDA 4CCOA 2RH8A 1VBB1 5C18A 4OJHA 3I5BA 4NPOA 4IIJB 2VHZA 3OX2A 3MSXA 2ZT6A 1SCIA 3KZXA 1UDRA 1JUHA 1FDDA 4P83A 1COV3 5EPUA 2NXWA 2JJ1A 5E38A 2YBDA 2OHOA 1HI9A 2O2IA 5DDOC 5CXQA 4EYSA 5BSKA 4FQ7A 3AU9A 1PHRA 4CDRA 3OSDA 4D0RA 1FOEB 5LMNF 3QLUA 4XR9A 4H7DA 1SJ1A 3Q4GA 1KDMA 2D44A 1HNZF 4QSMA 1Z0DA 1THZA 3ISND 1ZIYA 4HWPA 1TL5A 3M32A 3UJ3X 1FFBA 4OLPA 3RRZA 3NNFA 2BI8A 4Y9DA 3K9CA 3E2PA 1KYYA 5EP2A 1VCTA 4Z92B 1ZRRA 2B92A 2CDPA 2X8LA 3NWKA 1W6MA 4K6MA 5LWBA 3MGJA 5LA6B 4EKDA 3LTNC 2Z0MA 3I0RA 3R41A 4EKNB 2BRUA 4UXJA 1JBCA 1U99A 4CDQC 2GAIA 2EKPA 5DAQA 2B98A 1USKA 3RF7A 3GG0A 4CP1A 1RTHA 4PS1A 2PRSA 4CZSA 2WZCA 3EVMA 1D7AA 1QAYA 1MH9A 1PO7A 3I82A 2AG1A 5MHTA 1XZMA 1QMGA 3RZJA 4D0NA 5KJ6A 4LF7J 1I7PA 3ETLA 5DG7A 1CFJA 3N6XA 3RF6A 3U3XA 3CJ3A 2R7WA 1OVMA 4LXQA 4MWBA 1KVIA 4TTSA 2HU7A 3I2GA 3VR3D 4WQMA 3G0DA 4S05A 3DEYX 1ZTTA 2M8DB 3CW2C 2VT7A 3CNNA 2KZMA 4AJHA 3B3QA 3M2TA 1UTAA 4WXEA 1R082 1OJLA 1DTWA 4MAAA 1EQMA 3A6LA 1E9CA 2P5VA 2LA6A 4P00B 3HCWA 5K2OA 2O0JA 2AOVA 2LVBA 2WY2D 4JLMA 1YCGA 5C7PA 1L0BA 3NJ4A 4AO6A 1VQ6S 3QGMA 4DHWA 4R1MA 2X9VA 2AX0A 3QX7A 1CP3A 5E9QA 5J2TB 3Q5GA 4YLGA 4TV8A 2ZYUX 2CQIA 3WGHA 4L5BA 4P2BA 4K46A 2ZEYA 1DI0A 3NU1A 2B4KA 1PMIA 2ILMA 4FNOA 5CB8A 1C50A 1ZOPA 2H1WA 3UGGA 3MMPA 5DP2A 2ZDHA 1TYCA 1F2GA 4XE9A 2XHWA 1U0BB 2HSEA 5FPBA 3Q8SB 2OSRA 3EFBA 5GP1A 5FA5A 1WY7A 4L16A 1YJ7A 1YHZA 4JV2A 2DNHA 4DCCA 2R25B 2Y9HA 3FPGA 4QPDA 4NMXA 1FRQA 4QSHA 5SY4A 2Q29A 1I94B 2RBEA 4KFSA 3PE3A 2BE9B 2GNKA 4WESA 4HMOA 3KPWA 1GXUA 1VLZA 3DGEC 4MJKA 4CYMA 4JYAF 1QB8A 5BNZA 1QP0A 5KFVA 1LODA 4JOUA 3U80A 1SA0A 1SCUB 3RKUA 1I33A 4K20A 1C8NA 2BSQA 3BL5A 2D3OR 3MRTA 4Q0PA 5C4IA 2BDPA 2XJ4A 2JLBA 5FMCA 4EI9A 1SC4B 3ADPA 1BW9A 2DUOA 5JH7A 3DHEA 3B3QE 2IVFA 1N6PA 3AI7A 2RMLA 1ESCA 3MM5B 2IYIA 1T8SA 1HN1A 1YC2A 3BTXA 3TTVA 3AHEA 2KDOA 2MINA 3D1VA 3R6TA 3X1DA 1X7XB 4MVJG 2IE8A 2VG7B 3P19A 2X0IA 4XDQA 4PGHA 4E11A 1EVKA 3ILOA 3R4VA 3U78A 4LJMA 4IXLA 1IQ0A 1PYTA 1DOZA 1W4ZA 3VTFA 1JZSA 4M5GA 4NA3A 4MUVA 2PYTA 3DT8A 1ZY2A 3JQGB 3GFBA 2FJ0A 2VDKB 4NIDA 1JJ4A 1LV8A 4JB0A 5T3UA 2UURA 2I03A 2H57A 4UTVA 4LZLA 1ZM7A 2OH2A 5KWVA 3WNCA 1EE2A 4KR9A 5J2QA 3R7FA 3OBZA 5K4GA 2NU7A 4UNPA 4FOTA 1U26A 5DRTA 2BVNA 1PEKE 3EG9B 4IZOA 1TKBA 3HNMA 1J5EJ 4ZYLA 2B5JA 1H4HA 1JFVA 3UK0A 2DCTA 4Q9HA 4DN9A 2E44A 4R1QA 4R1OA 2VICA 1EDZA 4K8RA 1PL0A 1UOEA 4PS0A 3SGLA 1EX9A 1W6NB 1U0OC 1YK9A 1BHJA 3EA5A 3G3EA 2PKQP 2Q5CA 2J6SA 5C53B 1KSFX 3DOHA 2A70A 3NBUA 3IDBB 4WOJA 4B0PA 4OIFA 3KJEA 1V11A 3O4RA 1UXZA 4E51A 3WJ2A 3FKSA 2O23A 3NR2A 1YR9A 1T3TA 3DDIA 1ZD4A 2QJRA 2JIJA 3MM8B 2HFSA 3RYFA 2UVRA 2DEJA 4HVQA 5D3MB 4JV4A 4KVFA 1GEGA 2ZH8A 1T7PA 1TJ3A 2XKAA 3CY6A 2N47A 1ZUWA 2QAIA 2HWKA 4F3NA 5EJGA 3Q6IA 1U8YA 4O3PA 1RMYA 4N82A 4MVJH 4TZDA 1AQNA 2I4OA 2PVPA 4BQ4A 4ILKA 1HW5A 4N43C 3AVOA 5L45A 4DJDC 3VPDA 3CCBA 3DKVA 4N4AA 3FAKA 3ZGOA 4V0RA 9ATCB 1H8HA 4ENVA 1SXPA 1VKJA 4LPLA 2WKKA 3JQ7A 1T35A 2R8PA 4FYMA 3ILRA 1KOGA 2AV5A 3LKJA 8OHMA 3SJUA 4GQBA 3L7PA 3X2EA 4PQEA 4FFVA 1KY4A 1E2JA 1OI6A 2G2YA 5IVIA 3Q8YA 5AW7A 4P08A 2QTBA 2WZ8A 3NJXA 4CCNA 3ILNA 5B3JC 4K0KJ 1DBWA 4IIFA 3R24A 4MUXA 1ULRA 2C0CA 3SCHA 3MOZA 3REGA 2AW0A 2QTFA 3K0AB 4YMSA 1RWPA 2VPZA 3C46A 4ZU6X 4A2PA 4WFJA 1N8NA 2WC1A 2A1UB 3S5AA 4QFDA 5BN1A 2REXB 3INYA 3RM3A 1N3PA 4LRAA 3WGIA 1SFRA 4OQJA 4TMYA 1ZRDA 2EALA 5FOWA 5J2NB 3TEWA 4S2DA 2WMYA 3I64A 1PT9A 4QD2A 5AKLA 4PQQA 1Z4NA 2FOIA 4JGYB 4U36A 1C4AA 5FY9A 5H02A 1AYM1 2GBCA 4F26A 4ES9A 3BB1A 3SX2A 1FPQA 2RJLA 3CINA 4B4UA 3EPLA 3RJTA 1V5IA 4LOHA 4XWGA 4QPIC 3PJ9A 3U4IA 4QO8A 3PE4A 2AYBA 3A12A 4FP2A 1Z47A 4JVOA 2JLXA 3E5UA 2WWGA 1U65A 1M54A 4ED0A 4AE2A 2QSWA 3C15C 2GJ4A 3TZYA 2XTNA 2ZUVA 1UBGA 2RS11 4DFJA 1FX0B 3RUAA 2ZR9A 1TFYA 1ORWA 1RP1A 1QJEA 4DV6J 3RIMA 2XMLA 3ZCPA 1SKUB 4XA8A 4A16A 2YXEA 2GK4A 3ZWXA 2WLPA 1VFPA 3AR7A 3B69A 5JVDF 4OYRA 2XI4A 3U7RA 1W3VA 4YACA 2F3TA 4EPVA 3JB8A 4DA8A 3JD2A 5A6WA 3QVSA 3SCJE 3ZCSA 1DYKA 1B8VA 2RGEA 5F3IA 4ATFA 1SUEA 3ZWWA 3DMJA 2B7LA 4UAJA 3JUUA 1M7HA 1AF7A 2ZE2B 2F9LA 4W7IA 3K73O 4MQLA 5FPYA 3SZMA 4MVJD 1W4AA 1N3QA 3UCFA 3GZ4A 4DMZA 3WF3A 3PYXA 2J32A 2QJOA 1OA3A 3H42A 4KI5M 3PLNA 5LZ9A 4FDAA 1M6WA 1T3GA 5F9TA 3UI3A 1LWOA 4XWYA 2I7XA 1LOBA 1KVTA 4HEHA 3AI3A 2C3MA 4ZQGA 4USJC 3MJVA 1PTJC 3JXSA 4Z49A 3MI8A 1P7CA 4X6UA 2FMIA 2PLFA 2Q6OA 4RNMA 1K6IA 2J9RA 4ZVUA 3U44B 3D6VA 2ZGSA 2CK3A 1S12A 4INPA 3TECE 2H5LA 3UANA 3KQWA 2ZHKA 1H1LA 2H16A 1Z6PA 4DNXA 3GRAA 2ADEA 1SEPA 2AW5A 1X8DA 4LHSA 5HOEA 3KLHA 2DWUA 2WVCA 3LGNA 2GZAA 3FCCA 1QJ4A 5JEEA 2JFHA 4H1TA 2YV5A 2HBTA 3KTOA 1WDMA 4O4HB 1LR5A 2XCAA 5CT4A 2MPUA 5A7SA 3AVYA 1AXQA 2HWYA 2I87A 3C19A 1TFUA 3PHTA 1DRKA 2VNKA 3MFYA 1Z7GA 3EWSA 5EERA 2ZSIA 2IFRA 4ZLJA 3RIEA 2Y0SD 4P86A 5C34B 2MLXA 3DU5A 4ZOSA 2KBFA 2BPOA 4LUKA 2QX7A 3UHPA 5BORA 2XSZA 1OBHA 5AYVA 1PO13 3H20A 1GOGA 2HCTA 2WZPP 2H2AA 4Y6PA 2ZE8A 1XNRJ 4RKWA 4WT7A 1E3WA 2AX3A 4FSDA 4N01A 4U6NA 3KYBA 2ZACA 3GFXA 2BBSA 2P9JA 3PUJA 4A0HA 4AMYA 3PMSA 3VUEA 4ZPAA 2P6MA 4LX0A 3VZMA 4L4RA 4XJVA 2RHWA 5F6LB 1N5JA 1G21B 1TMF1 2JLVA 1W85B 2QUBA 4MR9A 1KP2A 4B43A 2JLZA 2JIOA 3MWFA 3MW2A 4INAA 3ZK9A 5F9MA 4O4IB 3NLLA 4C8NA 5CLLA 5IT4A 1Y0BA 5LQDA 3W8GA 1YIFA 2W2MP 3C5CA 1EX8A 1JLGB 3UA3A 2ZAIA 5KAPA 1P74A 4E32A 3BHMA 2BGUA 3BUCA 1YQQA 1CVJA 5KC6A 5CAEB 3MINA 1QFSA 2QS9A 1TKTA 4ZCMA 5E7IA 5BSMA 3AB7A 1TGVA 4QFCA 5LOQA 3HM2A 3MI7X 4Y6QA 4AUNA 5A0TA 5D8AA 5DTIA 2FN8A 3IR6B 5CU7A 4CL3A 3HDHA 3KLEA 1GWNA 3ZHOA 1VLMA 4N53A 3NETA 3BH7A 5KFUA 1NG1A 3VO8A 2R6JA 2WLTA 2F63A 2XZTA 3AGPA 4XMIA 3I96A 3RBDA 1WW6A 4PC3A 2F48A 3WRVA 4CIDA 1P2VA 5E4YA 3EXEB 1HR0F 3ZZUA 4DTIA 1EETA 4D9CA 1NY72 2QIFA 4J6EA 1C8M1 4M9ZA 3DOOA 5ETKA 1FV2A 8LDHA 1WWYA 5J1NA 2GCPA 3TWOA 4ZPWR 1GPAA 5MF6A 4IRDA 1F9FA 3TLGB 2OX0A 1R0RE 3HMKA 1MWYA 1Z2EA 2W6ID 2P27A 2R751 5LL6P 1NBEB 3QRWA 2W4DA 2G0IA 2VKRA 4QIFA 4AVAA 1UVKA 2KLBA 4TWJA 5LD2B 3JSRA 3E5QA 1TL7A 3DTTA 4YP1A 2WWUA 3HCFA 3KLHB 4HLQB 1QSGA 2PZ8A 4KNYA 2LTNA 3L8ZA 5F23A 3J7YU 1BAPA 1E79A 3ZR5A 4F4IA 2CXNA 3RQ0A 2R96A 1HFEL 2RS32 3M6WA 3AF0A 2IZ0A 2Q5JA 3ZN5A 1YJLA 1YJUA 5ALHA 3S1SA 4XWOA 3DPIA 2OO4A 1XVUA 2GQ2A 5EN1A 3O8QA 1PYDA 4AZ0B 4E8DA 1T9BA 4FYHA 1DLJA 1O96A 1DUVG 4FFNA 2BV4A 5LQCA 4I6GA 3CBNA 1YGYA 4BO3A 3VAHA 4XOIA 2JFUA 5BT8A 1OFUX 4V1CB 4IEUA 3ZKWB 2EX0A 2XYRA 4J2OA 1IZ7A 1EMDA 3LOPA 4J9QA 3PXCX 3KMHA 2P9EA 5FDBA 5TS3A 3ETMA 4TSFA 5G0WA 1TKAA 2QZ9A 3CRQA 1Q12A 3AXTA 16PKA 4KG8A 3P5SA 2AR9A 5LP6F 1SAYA 3MQFA 4Y6SA 1OPZA 5A0VA 3FYUA 5BMVA 3GY0A 1T25A 5CDSA 5DCLA 1H8TA 3RDIA 2J3HA 3ZH9B 1GQRA 1YJVA 2SBTA 2KO1A 1IBLJ 4QIGA 1S0NA 3FPSA 2YYSA 4I9HA 4YQZA 1PZ8A 5B58C 5JZSA 3R3VA 2UXDB 2FWIA 2J9FB 4NEZA 5IM0A 3I3OA 1K75A 4RVOA 3CZ9A 3L93A 3IBFB 3A13A 1TZJA 3CHXA 2IAJA 3BIWA 3D5TA 1CRQA 3EPGA 3WY6A 5HRCA 1ECJA 5EIYB 2FPOA 4IDZA 2H59A 4QTUB 4CLYA 1W48A 4OJYA 1UDBA 3PUZA 3ADKA 5GIPE 3S40A 3EEFA 3MTIA 3N6LA 3KQNA 1HE4A 4HZGA 5FYBA 3ODGA 5TVKA 4FDUA 5DUXA 2FEWB 4JI0F 3F98A 5IYZA 5L51A 3OZEA 4LUBA 2R0QC 3KZMA 4F7DA 3KQOA 4NXNJ 2VG8A 2XVLA 3IH5A 1CAVB 3OMXA 1LBQA 1IN5A 1HIXA 1FDUA 1KY5A 3VYTB 3MMBA 1LW2B 1F8UA 1PDOA 3AF4A 2XMRA 2OGWA 3A1CA 1Q8SA 4HK9A 1X33A 1P27B 4E5PA 4H3HB 3KLGA 3EPKA 3MEPA 1LDMA 2ID9A 3KKPA 5IAGA 3C74A 1TKTB 1L3UA 2ICAA 1CDZA 2IOHA 2E5WA 4FDMA 2OHDA 3SM9A 2C5DA 1U3WA 4W5TA 4Y7CA 2L9DA 1EP4B 4ZPIA 3ZTPA 2JDYA 5CXSA 4Z0HO 4O4IA 1ZGCA 1UU5A 1KNXA 3I3QA 2WAQD 4PYJA 3VB9A 2XBUA 4LF7F 4KIAA 3NAPB 3L0SA 3MJCA 5C24A 2PDAA 3CLRC 5F6KA 2DKOA 2H17A 4Q1EA 3TN93 3V0BA 1B0ZA 1I6WA 4EZ4A 3LA0A 1SI9A 3R3XA 1AY0A 4X1YB 4RPFA 1RC1A 4HH4A 1JL3A 1RXSA 4RDCA 4CKBB 2FQPA 1WD4A 2V5DA 2AXEA 1LI7A 1MS9A 1TAQA 3HHPA 4ZQBA 2G72A 3GJQA 2XMDA 4W82A 1U2PA 4A0QA 1TT7A 4ZP1A 5BYKA 3C7AA 5CG1A 2DXIA 4DPYA 4GZ3A 2WTFA 5EDWA 1KDVA 4BTEA 3NTOA 2WNIA 2UVDA 2IBOA 1ZN9A 4ZOBA 3B12A 4M5HA 1RAIB 3ZQKA 1JJBA 4UEJA 3I0ZA 3UGKA 3F9IA 5FTNA 3ZDYB 3GIWA 4W8JA 3PW0A 4YR7A 3BPZA 1RXUA 2XQRA 2DBBA 4M38A 4ZVUB 2WJSA 5KS2A 1SZPA 4CLSA 3RPQA 1SH3A 2WU3A 3CTPA 1X1AA 3AF3A 4I08A 4LHYA 3OL7A 4MGTA 2GMEA 2DVGA 1P4AA 4LV8B 4RHEA 3EFOA 4X41A 2VHTA 2YKAA 3TVZA 5I7OA 3KR9A 2NU7B 4JI3J 1EUYA 2P37A 2I4RA 1YXWA 2I55A 3L4BC 2Y8KA 3GLIB 5B0CA 1PGW2 2IYGA 1BGVA 4KH0A 2V3WA 3UN1A 3CUWA 1JAHA 4O63O 3C14A 5G4DA 5FZ8A 2WA4A 3LYHA 4NOTA 1OOEA 2CNOA 2R6HA 4XCAA 2V7BA 4Y2RA 1SLCA 4QWNA 4X4PA 5EUQB 4F7WA 1GPLA 1PR0A 2R85A 2RDMA 1IY8A 4IESA 3EXHC 1JDJA 3UHAA 3WNPA 5D4NA 3QFHA 5AH0A 3N79A 5A0YB 5FD1A 4IEWA 4NENB 4LJKA 4JLVA 2J67A 4AQYB 1OLSA 3BZWA 1E9FA 3KSCA 4UU1A 4X4QA 2MGZB 1EVZA 2H1HA 2O9JA 3K15A 1MOZA 3LP2B 4U00A 2W9AA 5I01A 4Y26A 1PQPA 3BFVA 4X66B 4JLBA 3OFEA 1W9MA 1SOWA 4N76A 2JD0A 1KORA 3TFOA 4AT1B 1FJGB 1RUG3 2QQIA 1RWMA 4GRSA 1B7GO 1DFGA 5ALSA 1G8SA 1RI3A 4ZDKA 4E46A 2OEPA 4NX2A 4AN4A 3PUWA 2OPRB 3J80Y 2ERXA 4DOMA 4N3NA 4V0KA 2UUBF 3PNYA 2PQMA 2M70A 5IX8A 3KYDA 3NWRA 4ZZ3A 3LHFA 3QA9A 5F3CA 4OX9B 3DW1X 1RUC1 4QUDA 4KN8A 2O8NA 2JEOA 1RT6B 1C5KA 1PC4A 3VZHA 1Q2UA 4RZSA 3QVGA 1J8MF 4LRFA 2EIGA 2FVQA 4MXWB 5FH9A 3NBAA 1EWRA 2I62A 4CMJA 1OQDA 2R8XA 1H5NA 1D4VB 5BXIA 4KNVA 2MXYA 4EUVA 3RAJA 4YW6A 4NAMA 5KSYA 3P1IA 1PKXA 3CXCR 2GFHA 2AEJA 4G23A 4OJQA 1QO7A 4DV6F 4BHPA 4Q4HB 3E82A 4CUCA 4RK0A 4X4TA 3SZOA 4YVSA 1FFGA 2PM8A 4EABA 2A7AA 3REOA 2P6RA 3NX4A 2WM2A 4PLGA 4MK9A 2XA1A 3I3BA 5DZGA 1ACJA 3WX5A 1E1CA 5AD1A 4XIYA 1RPZA 5I8WA 4FYVB 1CR0A 3AVWA 2NAFA 3LPAA 5DUVA 1BE8A 2H4XA 3E7XA 4OHWA 1HL6A 1D0VA 2M6LA 4G4JA 4CTMA 4F4KA 4PF5A 1G9TA 4TL6A 4WZZA 1T6XA 2XBMA 3M1YA 4K2AA 4XWWA 4FGJA 4CCLA 1IHYA 3UUWA 1KL7A 3BSSA 4A8FA 2Q62A 4N6OA 4Q4CA 4U0KA 5B08A 4ND8B 3BXFA 2DIUA 1X7NA 1XBFA 3QJPA 1S7CA 5DM70 4Z2YA 1R27A 5FHQA 3IOBA 2GKOA 1MW9X 3LGAA 3VR0A 4MPRA 4U7FA 2QRVA 2MMYA 1SULA 3UJBA 3QACA 1OC2A 2EFCB 5K3EA 4BEJA 1JQ5A 2VDIA 4XFJA 2PLV1 2R8OA 4D9JA 3BA1A 5FTKA 2GZDA 3GMTA 4N65A 2R7EB 1DXYA 1CB7A 2ID7A 2IUYA 1C1XB 1QKKA 2ISSD 3USUA 2QMOA 3QKRA 3EEYA 3NAGA 5ACA1 3MTGA 1E3SA 5J1XA 3G6XA 4PINA 2RAFA 2ZJ8A 5HIKA 5C8YA 3VZSA 3WHTA 3EF3A 2GX6A 4KR6A 1P1HA 2QQ0A 4KWLA 3DZJA 3L92A 2IYWA 5KCMA 3OZDA 5I93A 5IMBA 4AD8A 5IM4A 2IWHA 3H8YA 2BSAA 3SSRA 1YUMA 1SUCA 2O2EA 3RZHA 3WDSA 2B4OA 4C6TB 4CF4A 4KLAA 3LVRE 4F8AA 4OIMA 2NZWA 1AXZA 3SXLA 1UBKS 3WL8A 2WQ7A 5C8YB 2QD3A 3W9JA 3QVLA 3BX1A 4YI5A 3NNJA 1P45A 3ES9A 3PQ7A 4L50A 1MT3A 4CXWA 4YUDA 1WWKA 1R89A 2JX9A 1C7EA 4QZVA 1W4RA 3P96A 3QO9B 4RWXA 4MYRA 1P9WA 1J8DA 4FOVA 4HX2A 1QZ3A 4PU0A 4CODB 3UCGA 3THWA 4OXIA 4WCEQ 2GGPA 4ZEMA 4LQ9A 4N40A 1HEYA 3HU5A 2DQSA 3OTGA 4Q3NA 2F8EX 2IXTA 4LT6A 2DBRA 2JGJA 4AGVA 3SN6A 2XRYA 4AG4A 2GA7A 1N88A 4BJ6A 4HFMA 4FXGB 3QNWB 2NSDA 4E2YA 4QGAA 3QEKA 2RK4A 2WWYA 1CQJA 3PX2A 2YOGA 3HUUA 3K0SA 3CGGA 3ISZA 3QJ5A 3V8NA 2A35A 1V0AA 4NMWA 4IINA 2M8HA 4D6SA 2DHSA 2DUNA 2FHJD 1CULA 1YKWA 4EY3A 2NIPA 4A36A 4FYWB 2RB4A 4J0HA 5FLJA 2I0XA 4QWEA 1X2EA 5HXVA 1XEXA 4YT4A 3F8SA 1IUNA 1CR4A 5AKZA 1G1AA 3CLUC 4RULA 3A1FA 1LWCB 5ESDA 4FMDF 3A6GA 1W87A 2WIJA 1ZD3A 4UAUA 2J9ZB 2DT8A 4R4XA 2DWOA 4X65J 3UAGA 2VRCD 5HKBA 1FX5A 2P1RA 5L7YA 3HNOA 2UYOA 4H3VA 4Q0BB 3VU9B 2P2CB 4JUAA 4RUCA 3LQRA 2R87A 1H5QA 4KQXA 3MUEA 2GLTA 5A4JA 2B3TA 2RR11 3CWJA 3F90A 2JK0A 2VCCA 2VUJA 4MXWA 1ZKMA 2R073 5EQDA 4EQ6A 4G2TA 2IU0A 1PF7E 4YS2A 3QSIA 5JS2A 4AXBA 1B2RA 2HQCA 4CT9A 4KFTA 1NZFA 3V1MA 1ZINA 3HBMA 3B00A 1PFQA 1MJNA 5H5JA 3PNPA 2R7RA 2D7JA 2QL9A 1PUIA 2JDID 4DJBA 4GAZA 3KJQB 3RVOA 2ZBFA 4DV2F 4N3AA 4ZAGA 2YXBA 4H3SA 4GMKA 1GTSA 2RU3A 4EGJA 3BTUA 2I67A 2Z4PA 5FZIA 2R3SA 3M6MD 3SF0A 2DZDA 1VQ4S 5HVFA 3D0QA 4U7DA 1DQPA 1WOPA 3E9EA 1IPHA 2WMDA 1U2GC 3S5JA 2B9UA 1YJAA 4G6ZA 2IVMA 4JAVC 4MWOA 2DSNA 3V81A 1B1CA 3O93A 3SHVA 1RXWA 2ROEA 1UKYA 5IASA 2HV8A 3KS9A 1XCBA 4RZUA 4CDXC 1K0VA 1U2ZA 2CMDA 1H4GA 1HKDA 1NCQA 1BYUA 3VMMA 5AI9A 4IOMA 5E1DA 1QDCA 2QQVA 2Z30A 3GHMA 5ELXA 4NVRA 3THWB 4JKYA 2FHPA 5HMLA 5F35A 1N36F 2Q8EA 3KCNA 2XULA 1J22A 2LROA 2XRFA 4NDAA 1M6EX 2AMVA 4N7TA 1AMUA 1H6KX 1SCDA 2G08A 5CCBA 2JFNA 3INAA 1IK4A 2CFIA 2MMGA 4XFCA 1EJ0A 5AJUA 5IMSA 3G79A 1XYYA 2Z9BA 3GDGA 5CLGA 1OI7A 2B9EA 2QVYX 1QIMA 4Q4V1 3CLTD 4I7FB 1K0TA 1YTYA 1Z83A 4HEA1 1P72A 4WLNA 3FGOA 4TXMA 4G37A 1I7NA 3WQBA 1DUSA 3CBGA 2OHIA 2FPRA 3LQFA 2FHJA 3OOSA 3ZJTA 5G3YA 1DRUA 4XTTA 3FOZA 2ZOGA 2QG6A 5DYTA 1RUJ2 3FBWA 3K9BA 2F3JA 2FDGA 2OBNA 3GB9A 2EJVA 3PRHA 1U6KA 3W8NA 2ZUUA 4Q3OA 1JSRA 3HMJG 5BRNA 3T5DA 3OFFA 2ASDA 4DV3F 3IR5A 1BBT3 3ZXXA 2HPVA 1L1RA 5JZGC 4BCCA 1PKEA 3NW9A 4W9NA 4IJWA 2XUAA 2GM5A 1B00A 2HS3A 2VA2A 4FGSA 1U6IA 4JJKA 3GBFA 4MKIA 3CV3A 8ABPA 3BMNA 3ZXIA 1ZXLA 3Q9UA 3ILYA 2XO6A 1OFNA 4C7OB 3EXIB 1VDMA 3IP0A 2O19A 2LGJA 5I0DA 2LNDA 3DFFA 1RVV1 2NZUG 3PC4A 1JOPA 2XB8A 3I1JA 4RW9A 2X1VA 3T9BA 2IYPA 1UH5A 2VIHA 3C3XA 1XR7A 2ZJZA 3VMFA 3WFZA 1LDEA 2BHNA 2E87A 4ZPVR 5FO9B 5LQRA 2VQFF 5K0GA 3VUFA 13PKA 2FZGB 2IXJA 3SDEB 1SIOA 2BEVB 4XGQA 5ALWA 3W3AH 3VOTA 2W70A 4HAXA 5LK5A 3G5AA 4JYAJ 3GZNB 3N9QA 1WIWA 1K73T 1HBOB 4H77A 2WHQA 4UOZA 5J1PA 3HY6A 3CMMA 2DNRA 3VPXA 1GQEA 1U8ZA 3KT4A 4KO0A 1IWPB 4II2A 5KFSA 3D59A 1N2OA 3IFEA 2BFAA 4NLLA 3SS8A 3USZA 2BF4A 5MLCV 1OH5A 4ZIVA 5L46A 3NDPA 5F2OA 2VT3A 3TJMA 2JVOA 4LYHA 2DBIA 4J9SA 2QE3A 5GGXA 5I42A 4AYWA 2EDAA 4HB4A 5BV0A 2NAPA 4D74A 4HETA 2PFKA 3KB2A 4ND7A 3VJKA 4GRAA 4OXRA 1NXPA 1BVHA 4YMVA 1OY6A 3TYJA 3G2IA 3EIWA 2QZSA 1Z75A 2GJAA 3DN7A 2RFLA 2WN3A 2C0ZA 3PJDA 4D3ZA 1VBFA 4LTDA 3OL8A 1P9LA 5DBOA 1OZAA 2J46A 3QH7A 3Q7TA 5FY8A 4B4QA 3PKYA 3IDFA 1SIWA 2RH9B 1NUPA 5KCZA 1VJGA 2IXEA 1RACA 3DC7A 3D8TA 3HXLA 1FYVA 2UXCB 1Y3TA 1IJEA 3QFRA 5AJWA 1JPJA 1JHMA 1TME1 3PXUA 3N7TA 2IIBA 2IF0A 4NL4H 3WP6A 2GXSA 4PLTA 4O3RA 1K6JA 2HJIA 2L17A 3D0OA 1PFUA 5K9YA 4HACB 1D4M3 4ENSA 1W75A 4NOJA 3RIGA 4Y4YA 4AL7A 2Q1UA 2ZWMA 3STXA 3AL2A 4MGYE 2DHHA 2CNAA 4DAEA 2ZWIA 2H7XA 2K1RB 4Z1OA 1VSBA 1OHHD 3BHJA 4FFFA 1YNSA 4KB7A 3GLQA 3IBFA 3U14A 5BUZA 4R8HA 2L3MA 1HDRA 3JSMB 1MVLA 2CXHA 3DZHA 3PFNA 4EW1A 3TPFA 1XPJA 4KEAA 5FQOA 5HXAA 3UCZP 2FPGA 2EW9A 4MR8B 5EJMA 3HAGA 5CDTA 5E5NA 4BS9A 1ETHA 4FIDA 4Z0PA 4BKPA 1OSGA 3C41J 3NYQA 3RT1A 4II3A 3DLAA 4NOKA 3POIA 5CK4A 3SV3A 4D7TA 3A4YA 4A82A 5K8CA 5COQA 5FY4A 4L99A 3HZEA 3TN92 1VLYA 3C14B 3CQ9A 3MPBA 4LBVA 3MUMP 3PPVA 3K1YA 2JK1A 2Z5LA 3NHUA 2BD0A 1JR6A 4G41A 5JROA 4JV5F 1V3SA 5G04L 2H1OA 1R8PA 3ZLJA 4JI4J 1HORA 2CU5A 3R5CA 4ELTA 3GELA 4F46A 1YDHA 2IYEA 1HWLA 3R5FA 4KDRA 3MERA 1KRPA 3OXGA 3OIUA 3EJ6A 4C4SA 2OILA 4HG2A 3A6EA 3E8XA 1T9VA 1N34F 1PK8A 2FFAA 1GKUB 1KBRA 2BV3A 4GQAA 3L09A 5FWAA 2R2SA 3E51A 1G8FA 5IT9U 3AK4A 4LJSA 4ZQIA 3PRBA 2VNJA 4ZKTB 5DGAA 3O95A 2XQKA 2PUGA 1EHCA 5CT9A 2B5HA 1GZWB 2CV2A 2HU5A 2VDRB 5J40A 1M1YE 4EMBA 2UYQA 3SOPA 4PXAA 2VT6A 5DOVA 1S72S 4XQ0A 1RBAA 4YQYA 1PZMA 4PCRA 1SHKA 4EZ6A 3KFVA 3H2GA 4Y3OA 2IPOB 3L4JA 4KPFC 3OOYA 4QHSA 1OQ3A 1JQBA 3M7AA 4CKBA 1RL3A 1TU0B 4GO7X 2R8JA 2IC1A 4H6VA 1QRSA 4KQJA 3F46A 1II8B 3ILLA 3T15A 2FOLA 3CUNA 4BDPA 2HXGA 4M0MA 1Z0AA 1RCXB 3FYUC 2IDLA 1RU3A 4KV9A 3GONA 4L8VA 2VBCA 3DRRA 2JJ4D 3LO5A 4YP7A 3M6IA 3FH0A 2YS7A 4N0DA 4MR7A 1X9IA 3HBZA 5JD5A 4D9NA 2HNZB 1AYN2 1YZGA 3BQ0A 4AGGA 5G0VA 3AFIA 1BEEA 3SQXA 3KALA 1DELA 1IR1A 1ECPA 4UMEA 4YRRA 1SKQA 4ZAXA 4CW7A 3WXPA 4BQSA 5AM4A 3LGXA 3R4UA 5JMCA 4U2KA 4ZS3A 4XIGS 3VKNA 5L9VA 3OR2B 1QIFA 4Z37A 3BSOA 2MKHA 2XIJA 3VKMA 2Z2ZA 4L3NA 4DDWA 4P9WA 1QK5A 3ESBA 2IBKA 1VMJA 1AQUA 1LW2A 2HK6A 5TF4A 1O6GA 3KV3O 2PMHA 1E5TA 5C1OA 2OZPA 1HWYA 2QR3A 2M2BA 3SHWA 3HCBA 3EJMA 2P4SA 1BDJA 1FPN2 1WUKS 1KBZA 2IIVA 1ZVKA 1FVOA 4P6QA 4L95C 3DEZA 4MKZA 4P3NA 4TT3A 1NMSA 2NUHA 3DJFA 3T1QA 1EE1A 2VZTA 1RHQB 1RYZA 4LCEA 2O2SA 1UXJA 2JASA 3DMRA 3JAKB 3IXMA 5F9NA 3O0DA 4RE5A 4H6XA 2JFWA 5KQGA 1VR6A 1Q95A 3WRWA 4YUWA 1XQ6A 4JBLA 4BX8A 1AZWA 4MAMA 4GKXA 2DISA 1X74A 5G3ZA 1KI9A 3GAFA 5ACA2 2XUGA 2IPNA 3IZOA 2UUCJ 3AK0A 1W581 2EBFX 1VLLA 4ZQEA 4C5AA 2VHCA 1XMOJ 4DSNA 3I1FA 1QKIA 4MP8A 1VI6A 2IY5B 2Z5GA 1HQUA 3JPYA 3QY0A 2QL6A 3OE7A 3RU3A 3QSYB 5ETLA 4ZKAA 2ZYHA 3WZ0A 3F0NA 3KUCA 2DJIA 4FDTA 1I1EA 4B4OA 1P8GA 2LDIA 2O8EA 2HLPA 1XL0A 4RDXA 5B55A 4IOJA 5ALJA 3SYMA 3R9LA 1H2ZA 1QP7A 3MYXA 4Z9AA 1KH2A 1E2BA 1NX6A 3U3OA 4LKOA 1PR9A 2QSUA 4X0EA 3H5AA 3H42B 3WRXC 3O4IA 4V1CA 5FZOA 2CHUA 2G9UA 3PHBE 3ANNA 5JWOA 2IY9A 5B7NA 5HS6A 1OGJA 2QQPA 4IGKA 3L4KA 3HVHA 4DV7F 4TL9A 1ZK0A 5DLYA 4AP9A 4KGGA 1EZ1A 3KDAA 4DIBA 4J0GA 1RAOA 5BQPA 3HB5X 2RKIB 1U2RA 3POTB 1LOFC 5TMPA 2XHCA 5F33A 3VC3A 1ZQ1A 3HVUA 4L0CA 3B89A 2I2SA 4JXJA 1JOJA 1I3KA 1GANA 2XE6A 3H2KA 4KSYA 1C1BA 2P3KA 5J3UA 4UHBA 5HIAA 2NGRA 1VPDA 1PBAA 2VUTA 3GJ5A 4CEHB 1HOXA 3FI9A 1CIVA 2WT8A 1D4OA 3PDUA 4GPD1 4MIBA 3BMCA 1GU3A 1WLCA 2JIGA 1G0NA 1MEC2 2C6SA 8AT1B 1MEEA 5E1MA 5D3KA 1S1AA 1U0JA 3M5PA 1TL7B 2ZGQA 2BMJA 1DRZA 1NI5A 1H4QA 3QVTA 3FRZA 2VQFJ 4DXSA 2RK3A 3RG8A 3GFTA 1RUD3 5C70A 3I6IA 3U60B 4UE3S 4BMNA 4J4HA 4LPSA 3P49B 4QGGA 4QXCA 2AU0A