2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Protein CLP1
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
5FH9A 3VHLB 5L8VA 1UBEA 4AWXA 1KSFX 1NVVR 2HYDA 3Q7QA 4B3GA 4NDZA 2HUPA 4QOSA 5JSZA 2J9RA 1XCMA 4A8JA 3VKHA 3PITA 2OUKA 2ZJ8A 1EX6A 2PLRA 5AJYA 4URUR 1KOFA 5JJLA 1RVDA 3LAWA 1XWIA 3NBXX 1GKIA 1TNDA 3R9WA 2DFTA 4B6EA 3R9IA 1Z8FA 4LBVA 2CK3D 4L16A 4DB2A 3I5XA 3BC1A 5JWHA 2WAXA 3LX8A 2AN9A 3AKYA 3QJYA 3CWQA 4F91B 1UDXA 1Q3HA 1ANKA 3EA5A 2X1VA 2FX3A 2EQBA 4V02A 4L4UA 2HCJB 1ZD1A 3WNDA 4F4IA 5M04A 1QHYA 3U6KA 1NG9A 4QNRA 5IK2A 2R6FA 3AVYA 4RSGA 4LHWA 3IBGA 2RGBA 2GVZC 5JSZB 4MA4A 4FINA 1ZINA 4M1TA 3WP0A 3JVUA 4AG5A 3NIBA 5E7MA 1AM4D 3CUEF 4O2RA 1XMIA 3CR7A 4ZV4A 2ZROA 3CW2A 3QF4B 1QHHB 3WYFA 4PTLA 2QRZA 3UANA 3K0FB 4BFWA 4BRUA 1W2HA 4UXIA 4JT4A 1TU4A 1IONA 3B85A 4XWKA 2CVHA 4XVRA 2W58A 2V6JA 3MAAC 4B34A 3T15A 2C78A 3KKPA 1HV8A 3CR8A 4BLOA 4R98A 4DEXA 1MABB 1DADA 3H86A 1ZNZA 3X1XA 1YR7A 1GAJA 1TTTA 3T35A 2FF7A 4KFUA 2ZRHA 4F4CA 3Q9LA 4ARZB 2IWRA 1N3BA 1RKBA 3A37A 4LC0A 5CIQA 2ZS9A 3HPRA 4Q4HB 4C2TA 1YR6A 3EG5A 5G41A 1XPOA 4QJ3A 3SBEA 2KSQA 3AF3A 5GVSA 4PR0A 1Z28A 3X1YA 4MUBA 2KB0A 1F3OA 2VSXA 2VTKA 3SJBA 4MDEA 4TMVA 1DBSA 1M74A 3SC3A 3QENA 1HTWA 1AGPA 1KI3A 1OIWA 3THYB 3O47A 1W47A 4HAUA 2A5FA 4D80A 1Z6YA 5HKKD 1XZQA 3CX8A 4DUGA 5CM8B 4RD2A 2FPKA 3MFYA 1VCNA 1P9RA 3AVQA 4GMDA 2JATA 1G8PA 1H8ED 3W6OA 1J8YF 2ASEA 3ICEA 2R6CA 4Q03A 4MRVA 5DIFA 1WXQA 4PO1A 1G4UR 2QMUA 2CLSA 3QE0A 5DN6A 3SYLA 4WW0A 4Q48A 5J4HA 2OCYC 4HZIA 4LYFA 2OHFA 2WPDD 1W0KA 5AWFC 1W49A 2TMKA 3CF0A 2JLSA 1TL7C 2A2ZA 4UNNA 2GA8A 1UBCA 3ZS9A 3R7WA 3EASA 2X19A 1KHTA 1KNQA 4G0NA 4HB2A 4KFRA 4B73A 2X77A 1KI7A 4PAMA 1DARA 2ZE5A 2GJ8A 2H1LA 4IOMA 3OIVA 1KTVA 2QT0A 1P2UA 1XNJA 2VP4A 2ZI6A 4MKIA 5C4GB 3QKUA 4QM7A 4OK5A 2FSFA 4HLQB 1P62B 4GOJA 4IJMA 4JT2A 1TEXA 5HKKA 1R10A 2ZE6A 4Q9HA 3GLGE 5DO9A 2CNWA 4DLVA 4PSVA 1G20E 2J87A 2Q9BA 2DR3A 3C15C 1JPJA 4B3FX 3V00A 1ZJ6A 4Z1MD 1Q0UA 1NIPA 4M1OA 4MUAA 5BWMA 3IO5A 2H16A 3BE4A 3SQXA 1CS4C 2XZLA 2CHQA 4JJZA 1ZBDA 4RJLA 2GWHA 2IYSA 1JNYA 3S1AA 4EQ6A 4FMDB 1NMZA 1Z5ZA 1KZ7B 4RZ2A 1TEVA 1PUJA 1IJFA 4ARZA 1G7SA 3LD9A 3QIAA 4QJ5A 1G7RA 1KO8A 2BIFA 4W7SA 3CF2A 1EG7A 4BFSA 2VRWA 3ZDQA 4OI1A 4HZUA 1ZM4A 1HT2E 5GJCA 3K9GA 5HZKA 1E2JA 4HYYA 5DI3B 2GXQA 2VYFA 3DM5A 1TU3A 4D4JA 3TW8B 4CEIA 3T06B 1VYUA 1FX0B 4NCKA 5CK4A 2QAGA 1E69A 1QRAA 4YMVA 3OEEA 3HR8A 5KOYA 2V1XA 2YYZA 4P4TA 3CNNA 2WWYA 1S3GA 4TLDA 3TAHA 1SHZA 3D7MA 2W6JA 4RFSA 2O8BB 3K9NA 2BCGY 4B6FA 2WBLC 4CYMA 3BS4A 3FGNA 5E95A 2ATVA 3W9YA 5F9HA 1KDOA 1PUIA 5DGXA 1JQLB 1W36D 2O8CA 1OW3B 4LJ5A 5DHFA 5EE1A 2ZITA 2ZRGA 4C2UA 3THYA 1M34E 2NQ2C 2HXSA 1J70A 2JLQA 1UEJA 2VP6A 3ECCA 2WPDA 5KNBA 1F6BA 4TTRA 5HZHA 1VHLA 4LGMA 4E07A 4N3NA 4PHHA 1JR3E 5H70A 5EP4A 4P4UA 3LW7A 2P65A 1DEKA 4TL6A 1W4AA 4BE7B 4HAZA 3TK1A 4CZ2A 1CR1A 1PLJA 1FP7A 3NHBA 4CF7A 1RC8A 1A5TA 2O8FA 2V54A 1H8EA 4ERNA 1CJVC 2ZRLA 1N5JA 5HTKA 4P0TA 4JYBA 1CULC 3LBHA 4WOPA 3EC1A 4QBGB 2FG5A 2PT7A 2H7VA 1CLUA 1NKTA 3RS3A 1OIVA 2IYWA 5FPHA 3C5HA 4B47A 2F7SA 1E0AA 3VKGA 2JJ1A 3FMIA 4FI3C 2OXCA 4HDCA 4IHQA 3PFIA 5GJWC 4JVLA 1UEIA 1DAEA 2WSMA 2BEJA 3MUFA 1AS0A 4R7ZA 2JLRA 4UNQA 2N1BA 4OBEA 3I8SA 5FOWA 4F4JA 3W3ZB 1QBKC 5TV2A 1BH2A 4ON9A 5EXPA 1M8PA 3W6PA 2ZETA 1JAHA 1FMJA 1W4BA 4IOJA 1JI0A 4XVUA 4ZI3A 4GL2A 5FBWB 3J81k 2ZJ2A 4GNKA 1OXUA 2PL3A 5FOUA 3F5FA 1NVWQ 2CCJA 2QG6A 3M1IA 4YMSA 2CE7A 4IVQA 1ZU4A 1TAGA 4ACAA 3M0EA 4RD0A 3GEIA 4F92B 2DWOA 1TQ6A 2IW3A 2QAGB 4I99A 2I1QA 3G0HA 1AKYA 3GQBA 5JJIA 1KI8A 2WOOA 1KDRA 5L3SA 4LYHA 1U9IA 4KLZA 1DELA 4YMUA 3RS5A 1GOTA 4JVNA 5KUTA 2RHDA 4QHTA 2V1UA 1G21E 1G3RA 3C41J 1WF3A 2OFXA 2XTZA 3CF6R 2FFBA 4E5UA 3C7KA 1JEEA 3SYKA 3LXXA 1F2UB 4LZZA 1IN5A 1GL7A 1YQTA 2ZM5A 2IA5A 1CP2A 1E2DA 1YZLA 8OHMA 3K70D 2WSSA 2JJ2D 1AA9A 4ASUA 1SQ5A 2QZ4A 4V03A 1XCPA 3OFND 3P32A 1ZCAA 2P6UA 3OHMA 3RWMB 5EJEA 1UKZA 1E96A 5IK2D 1HE1C 1CTQA 3KQLA 5JS7A 4LV6A 5D3MB 4A4DA 4MGKR 2RB4A 3OE7D 4S35A 2OEPA 2ZSFA 121PA 3SE0A 4B44A 3I61A 2R44A 2AXNA 3EAQA 4JLKA 3LBNA 1CIPA 2IYZA 4RZ3A 1E9RA 2RGAA 1MOZA 2J0UA 1XXHA 5J4KA 3TVDA 3VR6A 4OHZA 3AVXA 3BFXA 1G7CA 3SJZA 3BIFA 221PA 1E2IA 1MO3A 4HAXA 3UG6A 2JASA 3VX3A 3F8TA 2ZI9A 5JECA 1AGRA 5BYJA 1BKDR 1X3SA 3AH8A 1MT0A 1J2JA 1P75A 1Z0IA 2QL6A 1AIPA 3T5DA 3KFXA 1XMJA 3AF4A 5GADl 3K0SA 1IOZA 1OSNA 1GFIA 1IHUA 3I73A 2QI9C 1JR3A 1NVVQ 2ANCA 1TQ4A 3I72A 2ZRBA 4JBXA 1KMHA 3D8BA 4RKEA 2ZXUA 2BKUA 5CYPA 5AUQA 3OEHD 5C2JB 3KZ1E 1Q12A 2HV8A 2YINC 4JJKA 4WZ6A 1XJCA 4CEJA 2EW1A 3CKLA 4TZ0A 3IILA 4G5QA 1WB9A 4DC9A 1M1YE 5EE3A 1OFHA 1TMKA 3K0FA 3KQUA 2R65A 4QBHA 1X8JA 3WYAA 1GM5A 3LV8A 2WJGA 1KI9A 2KBEA 4Q9KA 4DJTA 5SZIA 3THXB 3I5YA 1UDWA 1G4AE 4N1AA 3UG7A 2DFLA 5FUYA 2OFWA 2IYRA 3IHWA 1OH8A 2DFNA 2BDTA 2FN4A 1E79D 3AGQA 3EZ6A 1ZNWA 2FZLA 1W36C 3P1JA 1DG3A 4A0RA 4EPWA 2XXAB 3QBTA 3AVOA 4BWYA 4JS0A 2Z6VA 1NSFA 2IS4A 2UZ3A 2HJVA 2VQSA 1F2TB 2WTUA 3AB3A 1GRQA 4OKSA 1KDTA 3HR7A 4QHSA 4QNMA 3V9PA 2FSHA 4I81A 3GEHA 4H1VA 4OHXA 1KGDA 2NPFA 4LBZA 3A58B 3OAAA 1YZQA 4BLPA 3A6PC 3QOFA 1OH7A 4B2PA 2QMOA 4Q1EA 2H8KA 4Q1AA 1E2NA 2G1JA 3VKWA 5B57C 4RD3A 4MRSA 3B5JA 4HLDA 4HEJA 2DCUA 5CM9C 3QPUA 1PLKA 2AXPA 2H57A 4LJYA 4WA7A 5L3QA 3VAAA 4LHZA 3LX5A 3U44A 2F1IA 2AK2A 2IXGA 2JLXA 4URZR 1B0UA 3SU8A 2JJ2A 4ZPXA 2G9NA 1G3UA 2WKQA 4D26A 1R0YA 3VX4A 1FQKA 4JVSB 2GEDA 2WIBA 3DO6A 3ZVRA 4DSNA 1WBBA 1A4RA 4MGZR 2D7CA 4ZIRA 2FOLA 1GIAA 3KUCA 2RHMA 1RIFA 3DHWC 1FX0A 4OHVA 2CMKA 3AUYA 3PUWA 3B6EA 1P61B 1YKSA 1NLZA 4ZCIA 2DWQA 2R8RA 3N2IA 1RZ3A 1ZC4A 1CJKC 2F3TA 2QU8A 4GOXA 1R0WA 4IVRA 2AD5A 3GJXC 1NRJB 1P9WA 1NBMD 3PG5A 5FL7A 1VMAA 3GEEA 4GRAA 4PPFA 5IDVA 3SBDA 4YONB 5BW8A 1Z6XA 2PX3A 4KYIB 4B71A 1CJTC 1S1CA 4MYHA 4DBLC 4DLYA 2CL7X 2ODNA 3TMKA 1W48A 2GF0A 1Z6TA 4MGIR 3ADBA 2FGJA 4Z8XA 4HAYA 4TLEA 3Q5DA 3RHFA 2B6HA 4C0BA 4C3ZA 5DHAA 1ELOA 3UMRA 2IYTA 3GLIE 2ODBA 2VHTA 4H9GA 1GILA 3CLVA 2FNAA 4TTPA 3GFPA 3MWKA 1N5IA 1S3SA 4MKFA 4Y0VA 1KJYA 1SKQA 2J7PA 3C4JA 2AKYA 1QDEA 3IIKA 2EYQA 2VF8A 4HLUA 2ZRCA 3LBIA 5LB4A 1RYHA 2ZEJA 5EE5B 2C98A 1Z07A 2CVFA 2JLVA 2FEMA 4KLNA 2IWHA 1KI1A 1LVGA 5AJZA 2IEYA 4H1UA 4NCJA 4V0MA 2QPOA 4R2IA 5CDFE 2WWWA 4G5OA 4C0HA 4M53A 4DLUA 3ZVNA 1KI6A 3Q7PA 3B1VA 2LKCA 2QP3A 5ANRB 1Z0DA 1EX7A 3ADKA 3PR1A 2JLWA 2C95A 3MGCA 1ZCBA 2QUZA 1KK1A 5L3QB 1HQYE 2P5SA 3T61A 1P6XA 1W0KD 2NOAA 5J5CA 2WVJA 4A1FA 3B78A 5FPKA 3K9LA 1FOEB 2GZDA 3OIWA 2HEIA 1CR4A 1DAHA 2QORA 3AEZA 1G8GA 4HB4A 4LJAA 5AUNB 5DN6D 3CWZA 2VP2A 1W44A 3NH9A 2W0SA 1GL6A 3IGFA 4Q4AB 1YZGA 4O0MA 2E1RA 1MR3F 3TGPA 3WNCA 1KJZA 4AKGA 2JDID 2RCNA 2W6JD 3Q8XB 3SDZA 1DG1G 4EJSC 3QI2A 4HLCA 2EWVA 2HF8A 4HDQB 4RY2A 5FTLA 4Q9LA 4JYCA 4XD7A 5FOTA 5BQ5A 4AYTA 2RGNC 3O8DA 4IDHA 2VSOA 1N6HA 1T9HA 5A0FA 1SKYB 5KPJA 2E9SA 2OT3B 1FZQA 3CRRA 4IDPA 1YVDA 1G7TA 3EZ9A 3U4QB 4M1MA 4LX0A 1G41A 1ZM7A 4L9WA 2MMCA 3B2EA 1MKYA 3Q3JB 1OH5A 2ORVA 1IBRA 2IBMA 4PPQA 5JCZA 1Z3IX 1DPFA 2ZRPA 3K9HA 4GMXA 3UK6A 4C4PA 3GLHA 1E2LA 5LDDC 2FZ4A 2QMHA 4AKIA 2GJKA 2QSZA 3A1WA 2QPTA 1D2NA 2NMVA 2O8EA 2AWNA 5FTNA 3K0CC 4IRUB 3RNLA 3NBZC 2O52A 2FU5C 1J8MF 1XD2A 1G3MA 3LY5A 5CK5A 4I1SA 4F93B 2NO0A 2UZIR 4FWTA 2P6RA 3SEAA 3VU9A 4IDQA 4AYXA 3L2OB 1D9XA 1XDBA 4RCYA 3CM0A 5SZJA 1SXJA 1T5IA 3ZYCA 4HAVA 2GF9A 4BECA 4WVFA 2Q21A 2WKPA 2F43A 2PMDA 3GPLA 4ZDWA 1SVLA 3QXHA 4C0JA 3NH6A 4LK2A 3UKDA 4DSOA 4TL7A 4BEBA 1IY0A 3BXZA 4PSKA 3OIYA 2Z4SA 1ZIPA 2HYIC 3C14C 3O8CA 1P72A 2OBLA 2J45A 1A7JA 5SZHB 6Q21A 1DO0A 4CEHA 2J0UB 5FI1B 2LKDA 4XD7D 4M0LA 1L4UA 2QTFA 2GDJA 3R9XA 4KITB 3RS4A 1HT1E 2X2FA 2GK6A 3QQ5A 2W00A 4YDSA 4DLTA 4BLRA 4PX9A 2JDIA 5JMTA 3WHLA 4F38A 4D81A 2IHBA 5BYKA 1JALA 3WMFA 4Q4JB 2HT1A 1P7CA 3FMOB 5TMPA 1VIYA 2WAYA 4NYMR 3PEWA 5FL3A 4B3DA 1T6NA 2Q9CA 4C0AC 4DLZA 2K5UA 2KE5A 1EFHA 1BO6A 2RKOA 2MSDB 2BWJA 2RAPA 1GDDA 2OXRA 2PEZA 5E4FA 3KDSE 4QXAA 5BN4A 1AQUA 1NN0A 2P2LA 3A1SA 4S2EA 3UIEA 2BKEA 3EIHA 3IO3A 4DIEA 4BLQA 5SZKB 3IQWA 2C99A 3VR1A 1SVSA 5BN5A 3JZMA 1MABA 1UADA 2XSZD 5FOXA 1E99A 3AVWA 3W5IA 2ZUBA 1E3MA 1NP6A 3MMPA 4G5GA 3WHKA 1MV5A 4IDOA 3TUIC 1XEXA 1GSIA 3HP1A 3FWYA 2YOGA 3K8YA 3QG5A 1NMYA 1VHTA 4ESVA 1E0KA 2B92A 4A2PA 4DSUA 3SQWA 1G291 2OAP1 2ZSEA 4Q01A 4QGFA 5ELXA 2FPMA 5FBVB 1CXZA 3RVBA 2CCKA 3AP3A 1Z29A 3BAFA 1XD8A 2C9OA 3NC1C 4LJ8A 1EFTA 4DLRA 3A36A 3LRPA 1S1MA 3EXAA 3SFVA 3CNLA 1Z0JA 1CF4A 3MLEA 3TUJC 3DKVA 1E2EA 5TXGA 4Q4AA 3B1YA 3KXKA 2QTVB 3SJCA 3TQCA 1Q1BA 1JPNA 2HLDA 1DOAA 821PA 5B2ZA 3OF5A 3ADDA 3CZQA 2Q9AA 1AZSC 2D2FA 4B48A 3WYGA 1YZTA 1L7VC 4US0R 4AKEA 5JCPA 2ZYVX 4HUTA 5J4YA 3NKVA 4U00A 2E87A 2R6AA 4LHVA 3RRZA 2GESA 3FKSD 4YMWA 5FL7D 1E2FA 4DXAA 4LY6A 2ATXA 2MMGA 4DLXA 1WRBA 1FP6A 1VG8A 1UKYA 4OL0A 4BZXA 4C0KA 2QBYB 1OFUX 3P26A 3NHAA 1Q1QA 3L0IB 4M8NE 1SZPA 2IC5A 4C30A 1NLYA 4OQNA 1KO4A 2ZRDA 5L3SB 2PCJA 4AYWA 1OB2A 1JXOA 2WJVA 4E09A 4JLBA 1VECA 2ZUCA 4HI0E 1T4GA 3EZ7A 4BRWA 4TMKA 1J90A 1I4DD 3NWJA 5KYKA 3QBVA 2ZJZA 3VR4A 3T1QA 2IUTA 3QG1A 1DS6A 1R6BX 1BMFA 2RGDA 4KV9A 2ODWA 4MQBA 4NCNA 4IFEA 2J7PD 4ZO4A 1OFTA 2PJRA 3MWJA 1LV7A 2B8TA 1KY3A 3FHOA 4V0LA 5A4JA 1P60A 1U0LA 1X1SA 5FI0B 2QE7D 4CT5A 4URVR 4IKEA 1N5LA 2W2XA 4BUJA 1M2OB 2ZRIA 4JSYA 2ZRMA 4PC3A 3RANA 2ZI3A 5KDLA 2ZS8A 4OJKA 4JBWA 1KAGA 2WV9A 3L8ZA 4TL9A 4ESHA 1I2DA 2O8BA 1ZW6A 4KAXA 2GAOA 1QHHA 2SHKA 2W83A 3IDQA 1R7RA 1LB1B 1CRQA 1G1MA 1FTSA 2ZJYA 1G64A 1KO5A 3CH5A 2YZ2A 3H84A 3REGA 4WXRA 1A1VA 1G6OA 5AJXA 4CVNA 1W4CA 2A5DA 3ZS8A 3RC8A 1BYUA 1ZNXA 1NI3A 4Q1DA 1R2QA 3A4MA 2O0KA 3KTAA 4XSHA 4ZDJA 1QVAA 2EVWX 5FBRB 4BZQA 4JL5A 1OIXA 4TT3A 4D0GA 2QRNA 1E9DA 2DWPA 2GBLA 4UJ5A 3IUYA 1KI4A 2GJAA 4M9ZA 2C2HA 1XTRA 2OSBA 4G1UC 3WMGA 2IK8A 1OKKD 4LJ6A 2H5EA 3EA0A 1U0JA 4Q4LA 2ONJA 1IN8A 1MO5A 2EFHB 3B1XA 1G3IA 2QMEA 4M9XA 2P5TB 3BH6A 4MRPA 1E2MA 4M1YA 3THXA 1M7BA 3FFBA 2EFCB 3QUSA 4TLCA 1XB2A 2BV3A 4E22A 5KU1A 4D25A 1VPLA 521PA 2XAUA 4PANA 1IAQA 4LSGA 2PT5A 3TIFA 1GWNA 2Z83A 3CX7A 4HDOB 4FD2A 4NE2A 1KZGB 3F3YA 3U6BA 4A6XA 5F9FA 5KNCA 3PUYA 2CL6X 3JZAA 2YOFA 5KTYA 2QPAA 4I1UA 3KL4A 1IXZA 4BEJA 3DPUA 3NEYA 3SJAA 4NYMQ 1IQPA 2F55A 4UXJA 4Q9IA 2HDNB 4CIDA 2P3SA 5CJPA 1S9HA 3CO5A 4D82A 2KJQA 1AK2A 4EFNA 2BOVA 4A0HA 1NN3A 1IXSB 1E1QD 2PEYA 3V4RA 5KSYA 2H17A 4Q7KA 1GNPA 1E1QA 3FYHA 3E1SA 1CRPA 1SHKA 2ZRNA 4KSCA 5B64A 1E9EA 3CRVA 4QM6A 3PQCA 1E1RD 2A5YB 3X2SA 2ZYUX 2ZYWX 3ZD7A 5C4MA 1U9IC 1VG0B 4Q66C 3F0TA 1ONBA 5KSPA 1W36B 4B74A 2VA8A 4ZI2A 4QBFA 3RRYA 2IS1A 4QC2A 1NJFA 3L43A 1J99A 4C7OA 1D9ZA 1E2GA 1XXHB 4KJZA 3AUXA 1ZM9A 2REXB 2MSEB 1X8LA 1ZUIA 4JSTA 3BORA 2BBTA 3DVLA 4OHYA 3K0AA 1G17A 3R20A 4FCTA 4OI0A 1OXTA 3ZIAA 2CHGA 1A2KC 5EE9A 3P20A 4WBSA 1W0JA 1LF5A 1XZPA 2VBCA 1E94E 3CRQA 2A5GA 1DAKA 2GCNA 2WSSD 1W5TA 3QPVA 1HE8B 1G16A 1XJQA 4YLGA 4NH0A 3L0SA 2ZTSA 5JWRA 1QHIA 4MYCA 4TN1A 2XZPA 4HUQB 3KJGA 1N6IA 1NVXQ 3KB2A 4G5SA 4JLOA 2V8OA 2X8AA 4JL6A 3QSYA 3LXRA 2DB3A 1NY5A 2F1JA 1GZSA 4C9BA 2D7DA 3PJRA 1MRNA 3AM1A 1EWQA 5CB8A 4V0OA 2HJGA 2IF2A 1SVWA 1E0JA 3L0OA 4HSEA 1S9DA 4WIAA 5E3HA 1Z83A 2QM8A 5AUOB 2UVQA 3ZD6A 1JXMA 1YR8A 4DWJA 5K8IA 1K6MA 1N0UA 2ZR7A 3U7EB 4KCGA 4A0GA 1WP9A 5FUVA 1E32A 1U99A 4KFTA 2VL7A 3WP1B 2FMXA 4Q47A 4US2R 2R6GA 4EPRA 1D2MA 4NL4H 3PVSA 3OZXA 2KI5A 3FOZA 3G5UA 1P2SA 1VTKA 2FDCA 1K8RA 1AN0A 4UQOA 2FFQA 3GCGA 3QEJA 1HH4A 2RGXA 2XNDA 3K0AB 2OBNA 4FMCB 3ZIAD 2NTYC 3I8XA 5JFGA 4NMMA 3UPUA 1KAOA 2ZIAA 4K8OA 2V7QA 4JLVA 2WIAA 2RH5A 3KFVA 4XSGA 5KDOA 4FCVA 1XEWX 5C18A 1XTJA 4PHTA 4TSFD 5TY0A 4GI7A 3WBKA 4JBYA 2DY1A 4ASUD 4M22A 1T8UA 5JI2E 3RABA 4HB3A 3U3KA 4C0LA 4MITA 1I4TD 1TPZA 3T1TA 2ECKA 3IEUA 2O8EB 1RRPA 2IX3A 1YRBA 4PHGA 1H65A 3HU1A 4Q21A 5J4LA 3KJIA 4FMBB 5G40A 3THWB 2OE2A 3DEFA 4M4SA 1BYIA 5L3VA 2W2TA 4TZ6A 3BFKA 2C5LA 3ND8A 1RRCA 3B1ZA 2WICA 1S0UA 2QQ0A 2XX3A 5EXXA 3FDIA 3U2QA 5JRZA 1LF0A 2FSGA 1XPRA 3KJEA 1DO2A 4QFMA 4TYNA 3FE2A 1DAIA 3TSOA 4YXWD 3LA6A 1MH1A 5P21A 1GRNA 2NPIA 4KSBA 4JIMA 3E5HA 2QGZA 1TX4B 1R5OA 1Z47A 2BM0A 3VFDA 1KDPA 3B9QA 1OB5A 5TARA 4JKIA 5LPNA 1TF5A 1N6RA 2QQEA 3TJZA 2D3WA 3CPJB 4GP7A 2IS6A 2V9PA 1KKMA 1E9CA 5IT5A 2WMNB 5EQTA 2IS2A 1LFDB 3KQHA 3PENA 3R8FA 3KTAB 4U7DA 2J0QA 1Q20A 1Q44A 3NDBB 2REBA 4W9MC 3FKQA 4NYIR 2B7BA 2BBSA 3GLFB 4Q00A 3W6NA 5JLJA 1KSHA 1LTQA 2VHCA 3EZ2A 2GEUA 2O5VA 4NZYA 5EUMA 1UBGA 1OF1A 4Q7JB 1TUIA 5CITA 3UMSA 2D62A 2QAJA 2QM7A 2GCOA 1E2QA 3N2EA 2GXUA 1RRGA 3UATA 2J41A 4TMXA 2J5XA 2XTNA 2Z5FA 1BS1A 4Q5IA 1EFRA 421PA 1GKYA 2YNMA 4AKHA 1IN7A 3VQTA 2GTPA 2OM2A 1LW7A 3BK7A 3A1VA 2QT1A 3FMFA 5IRCD 1NG1A 2IL1A 1KYIA 4CGZA 3ASYA 5A5GA 4A15A 1SVKA 3SZRA 1KK0A 1UKEA 2XOKD 4KFSA 4JMPA 5G53C 2C9YA 3TH5A 4KVGA 2WWHA 5LD2B 3EARA 2GZAA 4XJXA 4OQMA 4BASA 3A8TA 3UMFA 2WWGA 4PHFA 1OXVA 2N46A 3SHWA 2JIZA 1KKLA 1Z6GA 1NY6A 3AP2A 4GSYA 4BFXA 2HXYA 1R4AA 2BMFA 3BB3A 1ZUNB 3TSZA 1BOFA 3RYTC 3VU9B 2PCLA 1S2MA 3GFTA 4NPHA 1EWRA 2QE7A 4WZAE 5LB2A 3THWA 2ZE7A 2EFGA 4ZCMA 2GXAA 1U2RA 1EXMA 4K46A 2NO9A 5F2EA 4DDUA 1Z08A 2R2AA 3ZZUA 3CB4A 4LYJA 1BMFD 1RYFA 2CNWD 3IKJA 4URXR 3K70B 3GLIA 2VLIA 3SR0A 4Z54A 1AS3A 3OEED 2FPLA 3SI7A 2FH5B 2FFAA 2ZUDA 4TYWA 5JHGB 4UJ3A 3K1JA 3K70C 4Q19A 4A2QA 1Z22A 4OQXA 4QHYA 2LWIA 3FB4A 4BZPA 2ZPTX 4ZCLA 4DDTA 2EYUA 4OJQA 3RWOA 1X6VA 3EPJA 1K5GA 2JIZD 2IXEA 4PQYA 1LY1A 1QZXA 1DE0A 3LVQE 1RFLA 3QXSA 4BFUA 4R71A 1DTSA 3AP1A 3I1FA 1YR9A 4RCZA 1N0VC 3SNHA 2J0VA 3FKSA 1MO4A 4LYAA 2OFOA 3W3AA 1NJGA 4W5WA 3ZVMA 4OYHA 2DBYA 2OV2A 3L8YA 1WE2A 4M2LA 4I1OA 2Z0MA 3GP8A 3MWYW 2OAQ1 2F3RA 5EZ6B 3FHCB 1SXJC 4B35A 1MO6A 1RE0A 2OBMA 1TADA 2D4HA 3EC2A 4O25A 1QHSA 1T0JB 1YHNA 1EFRD 1T5LA 3DOFA 3GJ8A 1XEWY 4B2IA 3GD7A 3WXMA 5EP1A 4D4MA 4LRWA 2VHQA 5JEDA 4QJ4A 4DUGD 3TR5A 3KJHA 4M1WA 4UNPA 2G83A 4EKDA 1XRJA 5HCIA 1Z6AA 4DKXA 1KI6B 5G3YA 2O0HA 2VF7A 3BFVA 1PLLA 2ZJ5A 2NZ8A 4PC7A 4J0QA 1MRSA 2YC2C 1PVOA 1G8FA 1HQCA 3CRMA 2ZAOA 4LC1A 4Q1FA 3R8CA 4TLAA 3U44B 3TR0A 1M7HA 3VNUA 5HCNA 1VIAA 4PC1A 2ZRKA 3AV0B 2PX0A 1P2TA 2AR7A 2BBWA 4TMWA 3QY0A 5EUQB 2RGNA 1FPMA 2UKDA 2XJ4A 1T8TA 2RGGA 3GJ6A 3MD0A 3TQFA 2A78A 3QF7A 4FXPA 2IYLD 2JJ8A 1R0XA 3HJNA 4EJSA 2GCPA 2G0TA 1WA5A 2XSZA 1HURA 1E9AA 1U94A 3EPKA 1WBDA 1IM2A 2B21A 3TSWA 3GLHE 4TQAA 2ZANA 5EXSA 3QVVA 1WQ1R 3HU2A 4X8LA 1C9KA 3BRWD 4PZYA 5EXTA 2NO1A 3H0KA 4TYYA 3L0PA 4C0SA 4ZDIA 3GJ0A 2QROA 4MYTA 4LPKA 4RD6A 1RJ9B 3U3MA 4AG6A 2JA1A 1E9BA 1F2UA 4Z8YA 4EPTA 4X8MA 2CJWB 2OLKA 3A1TA 1XTIA 2IYYA 1XJ0A 2FJUA 5F98A 2BJVA 3GLGA 4D4KA 3EIQA 2VO1A 1Z0FA 1M7GA 2JCSA 2OCPA 4ZDKA 1EESA 1OXXK 4FIDA 4B33A 4KYUA 2CXXA 4PZLA 4B3XA 3B13B 1W5SA 3AVVA 3B7GA 4Q1CA 3NEJA 1Z06A 1XBTA 1SVIA 2H18A 4MH0R 2GEVA 2AD1A 5AJWA 1X86B 3BB1A 3ADCA 4Q4HA 3QEOA 1L8QA 3BD9A 2NGRA 2CK3A 2Q6TA 3C16C 5HE8A 4TMTA 3ETLA 3EZFA 4K81B 2ZI7A 3DOEA 3NVAA 5TVKA 4JKYA 1XXHE 1YU9A 2IEZA 1VDZA 1P73A 2ZSBA 3GLIB 3X1WA 1II9A 2XOKA 2IYUA 1UPTA 2G77B 3KKOA 1D5CA 4HB0A 1NBMA 3I62A 1AQYA 3C5CA 1ZMXA 2VIIA 4EIWA 2KBFA 1X8KA 2WJJA 3BH0A 3HDTA 1W7AA 2PBRA 2ONKA 1S4QA 5D3MA 1NNEA 4BFVA 1SGWA 3LO5A 3P4YA 1GUAA 1GG2A 2FA9A 4NTZA 1XF9A 3MSXA 2CEAA 3O8BA 1T3SA 1TUEA 3WBJA 2GJ9A 3QXJA 1AS2A 1ESMA 5KSZA 1U8YA 1G9XA 4AIIA 3BJIC 1N5KA 1JJVA 5AK0A 1GTVA 4PAOA 4DRZA 1FW6A 1IN4A 1W0JD 1RRFA 3T1VA 3U61B 4RD4A 1US8A 2CL0X 3GLHB 4L9SA 2NO7A 2BEKA 2BCJQ 4FW9A 4QG7A 2WZQA 2OCAA 4NHOA 3RC3A 1XX6A 3D3QA 4M9QA 3NBFA 3K09C 4KU4A 2Z4RA 4DCNA 3GJ5A 3RS0A 2IYQA 1II0A 2O8CB 5FOSA 4W5JA 3AKCA 1OH6A 1II8A 1D6JA 2GKSA 1ZM2A 1G5PA 1OFIA 1JR6A 1QF9A 4RFSB 1CEEA 3X1DA 1VG9B 4DDVA 1R8QA 1G8HA 3R7WB 3QVUA 4DHEA 3LQRA 3MG9A 4FWIB 3U3JA 3AKDA 1KMHB 2CJWA 4O3MA 3KKMA 1ZC3A 2I1VB 3LH5A 4NYIQ 3TAUA 3RS2A 3HPQA 2WWIA 3T1OA 2JEOA 4ZIRB 4EUNA 4D6PA 2XTMA 4FMDF 3GLFA 2IT1A 4QGHA 3RAPR 3AVPA 2WJHA 3THOA 5KDDA 1T3HA 4GZMA 1KK2A 2ZU0C 5C1BA 5AR1A 5G3ZA 2AX4A 5FUWA 3B82A 3MRSA 2NO6A 2XNDD 4NBSA 4HUQA 4DCTA 5KHOC 1Y3AA 3RRMA 5LD2C 5AUPB 1KMQA 2HF9A 3HU3A 4NCIA 4P32A 2G3YA 1HA3A 2QBYA 4LV8B 1OKKA 2QNRA 4QBIA 4KXFB 4IDNA 1Q22A 5C46F 1DAMA 1FNNA 5KSOA 2FEOA 2QTHA 3K0CA 1Q1ZA 1KSJA 4LV5B 3U3OA 3ZLJA 1XD9A 1VKJA 1CJMA 4E03A 2WM9B 3CZPA 2ERYA 2O0JA 1RPZA 3ZZ0A 2C03A 2F9MA 4P4SA 5JBQA 2XGJA 1T3LA 1R8SA 1SKYE 4AC9A 4PC6A 1NBME 4GBMA 3HWSA 1HEIA 1E9FA 3SOPA 4FMCF 3I32A 3QXCA 1CJUC 3VNVA 3RSLA 1JB1A 3CPHA 2Q3HA 3AGPA 1YJ5A 3W5JA 2GK7A 4R9UC 2CHVA 5H68A 1W46A 5DSZA 3KUDA 1B23P 2Q0HA 1AJEA 2QY9A 1KO7A 3EW9A 4KHZA 4LPSA 3EIEA 3SHFA 3U7FB 2I3BA 2VEDA 3OE7A 1ZYUA 5J4VA 1Z0KA 2YV5A 1US8B 3IIJA 3O8RA 5GJBA 3TUZC 2FGKA 3DKPA 2DFKB 5KPDA 3AKEA 1XMSA 3LLMA 4ILEA 1CR0A 4P4SB 3OFNA 1GNQA 1YZUA 4A2WA 1W4RA 2YWHA 2ZU6A 4TMZA 2JLUA 4HLUC 2V4ZA 4Y0AA 4GDFA 1PZNA 2EWWA 3A4NA 4IW3B 1E4VA 2FE4A 2GBLC 1R5NA 2QENA 2ZREA 1DVRA 2OCBA 2BVNA 4IOKA 4QKQA 3ZQJA 2DHRA 3AF2A 4EPVA 1UFQA 2ZRFA 2QP9X 2RMKA 4M1KA 2NIPA 1Z0AA 2R62A 4JZKA 5UKDA 4LWZA 4D4LA 2P6NA 1LS6A 4TLBA 2PZFA 1Q57A 5H1YA 3FPAA 3CRW1 3WRXC 4NCHA 4ITRC 4O2LA 4OQFA 1XD2B 2DPXA 2A7QA 1FUUA 4Q18A 1QG4A 3CIOA 3B60A 2PLFA 4MYUA 4NYJR 3LFUA 3CPEA 2EU8A 3QKSB 3TNFA 3B8HA 2HLDD 1ZAKA 3NG1A 4B75A 4BLSA 4EJSB 4DT1A 5FFMA 1EK0A 1GITA 1COWA 1PJRA 3QKRB 3DMNA 1XEXB 1DAFA 2YWGA 2VP0A 1OV4A 2IYVA 2YWFA 3CONA 5DYIA 1G5RA 3GLFE 3BGWA 4MKHA 2G88A 3QKTA 1HY3A 2A30A 1ZU5A 4CRWB 3MJHA 3N5CA 2G1KA 4F7WA 1ETUA 2ZYTX 3KQKA 3PV0A 2PH1A 1U90A 5EP3A 1P9NA 3BOSA 1H8HA 5EZ5A 2V3CC 1A2BA 3VR5A 2ZI4A 5JI3E 2VSFA 1OT3A 4TT3D 3TVTA 4BPBA 4A92A 4LI0A 5CIWA 4URYR 4OHWA 4EQ6B 5HR5A 5GJVC 4MDFA 2HCBA 5K8TA 1RW4A 3DZ8A 4DT1B 2VPPA 5FR2A 5FPTA 4US1R 2IHYA 5JEEA 3IPXA 3X1ZA 1W2GA 3ND9A 4EPXA 1NN1A 4JLJA 2PJZA 4GOKA 1F2TA 4Q1BA 4OK6A 1R0ZA 3SYNA 2F9LA 3VR3A 4A8JC 1U81A 3G82C 4X8HA 2J59A 4XWAA 2RGCA 2C8VA 4EDHA 5BN3A 2J0SA 3UXMA 3AVUA 4MKGA 4QRHA 2C77A 4JVMA 4GFDA 4WAUA 4CW7A 1D2EA 1G5TA 1OXSC 1NVUQ 2NG1A 1XFAA 1YZNA 3LNCA 2R6DA 3TBKA 2J3EA 4V0KA 1ZNYA 2OZEA 2EFEB 4C0QC 3WRYC 2A3RA 1TF2A 4BGDA 4PZZA 2ZJBA 3RRNA 2G6BA 1FMLA 1ZUHA 3TLXA 3ASZA 4WZBE 4XOIA 3WY9A 2GZHA 4KBFA 1BIFA 4BQSA 1ODFA 2YWEA 4KBGA 5DH9A 3BERA 1N6NA 3RLFA 4RD1A 2IUSA 2AHOA 2FSIA 4V0NA 4M1SA 3WMEA 1U0HC 2XXAA 3KKNA 4POAA 4QL3A 3EWAA 4BFTA 3B1WA 3RS7A 1Q3TA 1QVRA 1C4OA 3ZH9B 3OESA 4UNRA 2WMOB 4ZKEA 1IN6A 1SXJD 1J7KA 1E2PA 1O87A 1KY2A 2MSCB 2QEQA 3QKRA 4X8OA 3TKLA 1NIJA 2WJYA 4HATA 2ZSAA 4XVQA 4TQUS 4YDHB 3M6AA 3NC0C 2CBZA 3TRFA 4LCBA 1N0WA 5BXQC 1XU4A 5CDFA 2AL7A 2J1LA 2Y8EA 4TWZA 4UKDA 4B2LA 2QA5A 2REOA 5FR1A 2XNSA 5LBIA 2GRJA 3KXIA 3GFOA 1E6CA 1XP8A 4CEJB 1AKEA 1UAAA 1JECA 2BMDA 4PPGA 1OJLA 4B43A 2WJIA 4DVGA 3ICQB 3LLUA 1QG2A 3ZVLA 3SS8A 1G18A 1KNXA 3V4FA 4U5XA 1ZP6A 4QGAA 3IIMA 5EP2A 4Z1MA 2GCOB 5KNDA 3OIUA 3TE6A 2CE2X 3PEUA 3NBYC 1N6PA 1N6OA 4YC7A 5FOVA 2JLYA 4L15A 4L5BA 2JJ1D 3Q72A 5CLLA 5DI9A 1CU1A 3EPLA 1T91A 1Q21A 5TB5A 5J47A 1AZTA 1VYTA 4A8JB 1M6NA 3GJ3A 4AK9A 1L4YA 4URWR 3FHTA 2G0NA 2ZAMA 2OG2A 1GNRA 2CCGA 3CX6A 4IXMA 3A4LA 3T34A 5FUXA 1Z63A 2CDNA 5GVRA 1SVMA 4JL8A 3IHLA 3K0EA 2VHJA 1HUQA 4M9SA 5CYOA 4HZUB 5KO2A 1LS1A 4PAQA 4A9AA 1NSTA 2ZVPX 2OO7A 4RVCA 2BBOA 4YXWA 4MGYR 2XJ9A 2F1RA 5JWOA 2RGEA 3WNBA 5JRJA 3GJ7A 2WWFA 1Z2AA 1LNZA 4PPNA 3Q5EA 1EFCA 1N6LA 1TQDA 3QPWA 2GILA 4II7A 2ZVQX 1UKVY 2YOHA 5L3RA 3N70A 3FVQA 1N2CE 4OI2A 721PA 4LJ9A 5B58C 2FFHA 2ORIA 3U60B 3BH7A 4LUCA 2IF0A 5H8WA 4NONA 3LW8A 2D06A 1NN5A 2GJSA 4YMTA 1ESNA 2V55B 1UBFA 1ZRHA 3PEVA 3T5GA 4BLTA 3HYRA 1U8ZA 2QN6A 4TQ9A 3IPYA 4TSFA 2YVUA 4B3BA 4KODA 2JGNA 4B32A 1ZD9A 1Y63A 5B30A 5JZVA 2VHUA 4GP6A 5FTKA 2V7QD 4MRNA 4DCVA 1XTQA 2F43B 2ZS7A 3AVTA 3VHXA 4U02A 2ZJAA 4XIGS 4Q4JA 4PSAA 1OLOA 4EPYA 1VG1A 1JQJC 3D31A 3I3SR 2VP5A 2QSYA 3P4XA 1Q1EA 3E70C 1R5BA 2ZR9A 2AWOA 4IEEA 3VTKA 4GZLA 2B8WA 1NF3A 1JJ7A 4G01B 2PZEA 2ZI5A 3E2IA 4DLSA 4A36A 2CLCX 4DCSA 2D2EA 4KI0A 2GXSA 4MRRA 5FPSA 3BBPA 1UF9A 3LQQA 4IXNA 4BFYA 1KI2A 4P31A 2R9VA 3KX2A 1SXJE 3ZQ6A 4NYJQ 4CEIB 1OYYA 4IFBA 5FBLB 4A0FA 1U98A 2WOJA 4I1VA 3Q85A 1O3YA 2Q3FA 3NDPA 4JLMA 3IQXA 2WHXA 1QHNA 1PV4A 4A6PA 4AY2A 4PO9A 3K09A 1I2MA 1W1WA 3MCAA 1FFHA 1P2VA 2YJTD 3H2YA 1Z2CA 1OYWA 4LJ4A 4JLDA 5J40A 2ORWA 2NZJA 3MJRA 5DISB 1S96A 2W0MA 1VCMA 4EFLA 4PXAA 4YQFA 2ZJOA 1IY2A 2PMKA 5E7IA 1YRAA 2GETA 3FMPB 3W8RA 1N6KA 4CT4B 4G3XA 3HYTA 1IY1A 4RKFA 2XB4A 4JLPA 1U8AA 2KWIA 1ZVQA 1F5NA 1P3JA 4UXHA 3M4YA 1YZKA 2VH5R 4I4LA 5DYGA 2I4IA 3ZGXA 4DCUA 1E2HA 2WWXA 4ZKDA 2YKGA 2F6RA 1NL3A 2O8DB 3SN6A 1XPUA 1JBKA 2IYXA 4XH9B 1FUKA 1E1RA 1FL9A 4JLAA 5D3QA 3BWDD 3U3RA 4XTCS 1NLFA 4GT1A 4OK3A 3NTUA 2IUUA 3MWLA 1KSGA 4RFVA 3UWOA 4Z51A 3GLGB 4Q7LA 3UWKA 3PXGA 2Z43A 4AURA 3CBQA 3DL0A 4LHXA 2ZQ5A 1VCOA 4G5RA 5HE9A 2XEXA 1S8FA 2GNOA 3DDCA 4UNSA 3H1TA 2EFDB 2ZSDA 1E4YA 4XTRA 1G6HA 1CKEA 4GPTA 2JLZA 1E79A 1YE8A 4LJ7A 1UM8A 4IVPA 4P3YA 1H8HD 4NU0A 4P33A 5FPYA 2W2VA 1TQ2A 4AD8A 2XB2A 2A5JA 3LVRE 3T12A 1XEFA 5DLQC 4CEHB 4C7OB 2ZR0A 4HAWA 1HYQA 4PO8A 3U7HB 3W90A 1CBUA 4LBWA 4DDWA 1SVOA 1CR2A 2IXFA 3IEVA 3LDAA 3PUVA 3PIRA 4EAQA 3EWSA 1SULA 3ONWA 3IBYA 1WDTA 1EGAA 3RSOA 1P5ZB 2BC9A 4JLNA 2FV8A 4DEYA 3AF1A 2GHIA 2C04A 1JAIA 4AI6A 1COWD 1SXJB 4D0LB 4PQFA 3AF0A 3QKSA 2WKRA 1KO1A 5CB6A 1XTSA 2W6IA 4N0EA 1JEDA 2Q3MA 1G3QA 2C96A 2FWRA 2J46A 3OEHA 5JJKA 3ZZTA 1G8YA 1K5DA 3D6TB 1JR3D 1FNMA 2D74A 2X2EA 1WMSA 3VR2A 3W34A 3P27A 3KQNA 2VP9A 1RJ9A 3RDPA 1KK3A 3PCRB 1L2TA 1KIMA 1E2KA 2QAGC 4CDGA 3SFZA 5JHHB 2ERXA 1E0SA 2YHSA 2P0EA 3I92A 4Q02A 4ACBA 2CLDX 3CH4B 2YC4C 5EE0A 3U5ZB 1GVNB 2BMEA 4Q9JA 4R2HA 2V6IA 2BM1A 2AFHE 5TDHA 3EX7C 1V43A 2O8FB 4TYQA 5DNYB 3CNOA 2PZGA 5JS8A 3FTQA 2O8DA 5FBQB 2P67A 5AJVB 2N42A 3W8NA 4NKRA 2BJWA 3GJ4A 1FQJA 1D8TA 1NKSA 3C8UA 2AFIE 2LCFA 4KVAA 1F48A 4IEIA 3JVVA 3B9PA 3DZDA 1G19A 3REFA 4DSTA 4DIDA 2F1HA 4BFZA 3U4QA 1VYVA 1EFUA 1XCGB 1QHGA 2A9KA 1IXRC 3DMDA 4KO8A 3BB4A 2XITA 3OAAD 2AK3A 4DB4A 3I4LA 3KXLA 3A1UA 1FTNA 2BMJA 4L8GA 1IJEA 1VCIA 2ANBA 4TTQA 4RZXA 2GVDC 4B3CA 4RZUA 4B76A 2JAQA 3DM9B 4LDJA 1C1YA 4PFSA 3U7GA 1QHXA 4EFMA 1I4LD 4PQRA 1P4SA 4ABYA 1UJ2A 2ZRAA 5E7JA 1X1RA 1GL9B 4FCWA 1V5WA 2HT6A 2XZOA 4IOLA 1T0HB 5K8UA 1GP2A 2BHRA 4LOAA 4TYPA 3QNUA 4WXPA 3KB1A 5CJ2A 2QGNA 2DYKA 4FN5A 3QF4A 1XMVA 2OLJA 3GMTA 4M21A 5K8LA 4PC2A 4QGGA 2W6ID 4OQLA 1KJWA 1OPXA 3QXXA 4OI4A 3TW4A 2H92A 3LWNA 4DLWA 1ZIOA 2J7KA 2QP4A 3ZJYA 1N25A 1WCV1 3PUXA 1OHHD 3H4MA 2ZE8A 4Q7MB 3KKQA 5F3WB 2OESA 3EPHA 4N0DA 3PEYA 2ZRJA 1XTKA 3FFAA 5CLQA 4XWOA 1E98A 1F60A 4TL8A 1OHHA 1E9SA 1ZD8A 4A82A 1ZM3A 1II8B 1NMXA 3S1AB 1GRRA 1A82A 5IF9A 2B7CA 5FTMA 4V0ME 3NXSA 3L82B 4LBYA 5HPYB 4LHYA 2GAAA 3AQ4A 2L0XA 3VMFA 621PA 5DE3A 4D0NA 4D2IA 2ODEA 1OE0A 1TF7A 3PUZA 5IHPA 1GKUB 4DZZA 2AKAB 3K53A 2C9CA 2OILA 4NP6A 4W5HA 5DI3A 5FTJA 1DAGA
chains in the Genus database with same CATH superfamily
4GM0A 4QX2A 4CMGA 4PRZA 4NDZA 5KFAA 3L7NA 3Q9NA 3N76A 3PITA 4AI2A 2P9CA 5DG1A 2J6CA 3QBCA 4NN0A 1Z8FA 2NYAA 1LWCA 4M3CE 2VE1A 3WGKA 2PEHA 1KH1A 2J76E 1X74A 4F91B 1ONSA 3TTTA 4DRVA 2X1VA 2ZUTA 3TQ1A 1V5IA 3OM8A 4L4RA 3U4MA 2RGBA 4MA4A 4DA6A 1V0JA 5ETJA 3IBFA 3T5BA 1PE0A 1S1WB 4OULA 3AHGA 2QRZA 4RJJA 5K0EA 3HPNA 4P84A 1HN1A 4CJXA 5LRSA 5C4WC 1UKRA 3LVBA 1JEYA 2V8VA 4KNVA 2WM8A 2ZRHA 1U8CB 4LW8A 2JB9A 2CD9A 2ZBCA 1AR71 4ECTA 4KTQA 1Z25A 2DQ4A 5IVKA 3DRYA 4OLHA 1F2NA 4K6HA 1H4GA 3P9RA 2DH9A 1RT7B 2W68A 2GO1A 3O47A 1EAMA 2IMWP 2TMGA 3L1HA 3SZ2A 2JGMA 1YQUA 3P0FA 1UBJS 3HJCA 4IO9Q 2R061 1QU3A 1C7JA 3V7NA 1YH3A 3ZV4A 1G8PA 4ELUA 2GHTA 1P9OA 2RDMA 3SYLA 4COOA 1FYUA 4F67A 4HZIA 2A73B 3VC3A 4BNGA 5C3PA 3GGJA 1EWTA 3A23A 4B9UA 4AEJA 5H9FJ 1E3DA 1TL7C 1YFYA 3AR3A 4K9MA 5ACA1 3ZQUA 5E3AA 3R7WA 2XDAA 3DXXA 2JFHA 1H7XA 4IX9A 3UUWA 1I5RA 1FFWB 1KTVA 3UAGA 5COBA 5EX0A 3QKUA 1UAIA 4JDNA 1JYSA 4DLVA 2Q9BA 1SD1A 2CQ0A 2VMFA 1IKWB 5CBPA 5KFSA 5IV4A 3WIVA 4ZOBA 4E11A 3K5PA 4W98A 2GBCA 4BMPB 2CHQA 2GWHA 4DYDA 1IM8A 2EEPA 4JDUA 1Z5ZA 2DGQA 4DPOA 1N6QB 3UDEA 1NJIT 2JCVA 4IQGA 4G0QA 4BUZA 2W4MA 4JUFA 2V9CA 3MFIA 4HQ6A 2OOSA 4QT4A 3FTNA 3MR5A 4CEIA 3M9LA 1AK1A 5AVWA 1W7WA 3FFZA 2PUJA 5ALUA 1HFEL 3CNNA 1IULA 4FBTA 4B3RF 1PS9A 2EC2A 5ITVA 2H9YA 4BLJA 5ETSA 1USUA 2ATVA 4JFRA 3IAM9 5CH5A 3EFBA 3P9NA 4U2EA 3KO8A 4K3UA 3IPVB 3E7PA 1M5RA 1UQUA 1F6BA 1ASJ1 3AHHA 1Y11A 4E07A 2Y9HA 1AE1A 3NVCA 2IDLA 5HFNA 4HAZA 1CHDA 1S4FA 5BR1A 3KR1A 3VOTA 2AIRB 3W5AA 1UT6A 3HHPA 4OX9F 4BB9A 3FMIA 1T95A 2FDNA 3RK4A 2OXCA 2I2BA 4YW1A 5CCEA 3VA7A 2XVGA 2AV5A 3I8SA 2RNEA 4HN4B 2FCRA 3IBSA 2EATA 3EWNA 2P9TA 4YRDA 4XVUA 3WYBA 2YMLA 4E2SA 5CYGA 1PSDA 2OPPB 2PL3A 4RA6A 1R8CA 1RRKA 2IW3A 3DP7A 5C1PA 4ZP7A 4DA8A 2BX6A 2VDQB 4W1PA 1TYCA 4YMUA 3DR5A 4AO8A 3SZUA 1HQEA 2J6BA 1FXWF 2TECE 4PIYA 2KU7A 3VPFA 2B25A 2ZH3A 1ZOTA 1GWKA 3DLJA 1AQNA 4ASUA 3PUJA 4FDAA 4XM2A 3T54A 3EXUA 1TDJA 1A96A 2HWIA 5DPMA 121PA 1K1QA 2HURA 2XZWA 4FEGA 4QXCA 2P62A 3N9QA 1XXHA 1OR8A 4JGYA 5AW7A 3D3AA 4NLSA 5GZ3A 2R8OA 3C3WA 3WLRA 3EVMA 2HGLA 3M4JA 3H4BA 1EZ1A 3AH8A 1R3DA 1RI5A 3LQYA 1BZYA 4WCFA 2QL9B 1R0RE 1YVEI 4DZRA 3TSYA 4YRZA 4O2AA 5AUQA 1SFNA 1FNZA 4WZ6A 1Z45A 3NOGA 4AP6A 4Z2XA 4IV1B 2NU6A 3O1UA 4RW9B 5M2QA 1EP3B 4O44A 1Q0QA 3MZHA 1RC0A 2WFMA 3I5YA 3D1QA 3HSSA 3KT8A 2HQSA 2B1QA 1O6XA 1PTJA 1J84A 1NZ8A 3AW8A 3AGQA 3P1JA 2ID7A 1U6KA 2HJVA 4DUZF 2A1BA 2X0FA 3HR7A 3ZCTA 3BRQA 2DNPA 1H7WA 4FOQA 3V6KA 2HHSA 1Z4PX 1UBSB 1SCIA 2QSUA 1KFKB 3KVVA 2PNJA 1T3NA 1Q82T 3MFCA 4FPYA 3FRIA 4NJOA 2FZ5A 5DBOA 3DLGB 4IFVB 2DFVA 4P9GA 1F1BB 4Q1EA 3ZU6A 1SELA 2OHOA 2P30A 3IV6A 5EN1A 2Z3ZA 3QPUA 5CM9C 2AXPA 4LFCF 2BUCA 1PYTA 4PHCA 2K2QB 1SMVA 5KHLB 3PNKA 1OROA 1Y1LA 4EY8A 3PHBE 1RAHA 2FZCA 3VDDC 3DVRX 2MT9A 3M82A 4J1SA 5ALTA 3BHIA 2ZAIA 8AT1A 3W9AA 4HYKA 3URKA 1LHWA 5EQUA 3AOGA 2L17A 3E22A 3AHJA 4DF3A 1E6VB 1OPZA 1XZMA 4TLEA 4P5EA 4I4TB 1OGIA 1MEJA 4BC1A 1ECCA 2HNBA 3JQXA 1I3OA 2Z04A 1SKQA 1Q8VA 4GC5A 3R7NB 1M5KC 1E3TA 1N7GA 4XUNA 3KLNA 3OPQA 1RIRA 3JB4C 2NYHA 1QG0A 4H1UA 3TAMA 4HQ0A 4X97A 3C7DB 4IQ4A 2QZZA 4HN0A 5J43A 2NYIA 3B94A 4UY8T 1BHJA 2EKBA 4X1KA 1NLUA 1KMIY 1VPHA 2HEIA 3WB2A 4A8OA 1W26A 3DWEX 4J76A 4N5SA 1RYBA 4YVWA 2XQGA 2IVIB 5DNVA 4KL8S 4KWTA 3DO8A 1EUQA 1LFPA 1NULA 1GPNA 4AKGA 3PYLA 4YBRA 1QJU1 4AI3A 2R47A 3MILA 3D59A 2L2QA 1T9HA 2PTGA 1NR7A 3VR5H 2YRFA 4ZVTA 2B1GA 3WLLA 3NPAA 5AOAA 1FRHA 1KEKA 2W0XA 4O3RA 4RTQA 5IWFA 4AZ0B 1LPBB 2QSZA 4QQFA 4XXAA 1D09B 1WCIA 1DJOA 3DEHA 5AHXA 1FLVA 1HWIA 4PUOB 2NO0A 2HWF3 1I3HA 4ABTA 2BGIA 4DNOA 4TKMA 4C0JA 4YFUA 2EFVA 3ZU5A 4OX9Y 4UU1A 2HYIC 2O6HA 1THTA 2JBHA 2VGDA 4I2QB 2GDJA 4ZLJA 4KITB 2GK6A 3FN9A 2JDIA 2NXCA 1JALA 3FMOB 1NQWA 1FLDA 3BKTA 4FE4A 2JVKA 2WR9A 1EFHA 2A5LA 3TM5A 3I8OA 2PLV1 3KDSE 2VUGA 5CDFE 3LX4A 1O5LA 3P2OA 4DV2B 4X1KB 2WB4A 5CTAA 4NMWA 1FFEA 1M2WA 2EIGA 5G2OA 3HUDA 3UOAB 4WESA 1VRH3 1GSIA 3GL9A 4L08A 1TZJA 5E6RB 2PT9A 4HPKA 2LMIA 4OQEA 4OUSA 5IBRA 4QDUA 1DXQA 2AZ1A 1JJFA 4HETA 2H65A 3WWPA 1E6LA 1LQTA 3L6CA 4C06A 4MQUA 3LO3A 3TLGB 2I1LA 1JYEA 3G96A 1E1CB 1SK8A 1VJRA 1BGWA 3R0IA 1KR2A 4Q4AA 1K42A 1NRXA 1ECGA 3OF5A 2PYDA 5LQAA 2DYAA 2GK4A 2QJRA 1SU6A 2H1OA 2FN8A 3LC7O 3R27A 1QZZA 4DLXA 2BZDA 1Y7TA 1OFUX 3GG9A 1L5FA 4JGIA 4H27A 1AHSA 4HX5A 2OHDA 4FOOA 2AQHA 2W9AA 4XJ9A 2YVLA 3MCWA 4IFTA 1E59A 1GNZA 3E4CA 1MS3A 3VYVA 1DS6A 1M34B 2XQFA 2AR6A 5FI0B 1NY72 3PL1A 2VF4X 1MQSA 1FMD2 1BVUA 1MZVA 2ZRIA 2QRRA 2IZ1A 1POV0 3RANA 5KFYA 3MIEA 2FVCA 1ZSYA 1A8DA 1H1TA 3RIHA 3HQXA 1VJQA 4JKMA 1JLGB 5E2QA 4TL9A 5ALJA 1BEEA 5C71A 2VATA 1CRQA 1V7PC 4NROA 5ER9A 3CH5A 2I5PO 1JR2A 2XZDA 2XUFA 5EJZB 2DVBA 5FWXA 4XSHA 3WDMA 2XGQA 3VGVA 1HI9A 5FBRB 3W5CA 4F3NA 5IN4A 4Y2SA 4F4UA 5L9XA 4ZVGA 4IUGA 3ZBUA 1E8NA 1RLDA 1W8ZA 4YT8A 2ZKLA 3B1XA 5KC5A 4ZU3A 2LD4A 5J2UB 4E22A 2NXNA 4WKGA 1N34J 1V1RB 4WY2A 3ER8A 3OT9A 3ZNOA 2BW0A 1FXUA 4UXAA 3KOAA 1YSCA 5GINE 3C7CB 1ZBE3 1YACA 1IKVB 3UJ9A 3V0BB 4YVSB 5J2MB 1Y0HA 3R5KA 2BEFA 2BGPA 1GARA 1JFSA 4LRCA 3NRBA 3AFKA 4OLAA 2RBGA 4QM6A 4Q66C 1PJ8A 3CHYA 1NW4A 4BCAA 3BYZA 5KJCA 3SLRA 1PBTA 1XXHB 3EVEA 1LGBA 3NV2A 2QR2A 5EMKA 1EP4B 3K0AA 3R20A 3DCYA 1TKTA 4MR9A 5DWDA 2F00A 1PGL1 3KOXA 4JR1A 3TBDA 1ZZFA 3W20A 4EHHA 1XZ8A 5ETMA 2DB3A 3OPMA 4K4VA 1S8AA 1J4AA 1WD5A 2W46A 1VBE2 3N7MA 3WX4A 2YMZA 5JVHQ 2VJPA 2QM8A 4RNNA 1X1BA 2KN4A 2C83A 1WP9A 5FUVA 1PX2A 4FOTA 4Y1RA 3A3NB 1RLIA 4ONUA 2QMXA 1D2MA 2JFXA 3SSMA 3DMHA 1O57A 2XNDA 3PXEA 4AY3A 2VVTA 1ST3A 2E5LJ 4QOIA 2YJNA 3JD4A 3I0SB 1FLNA 1NAIA 1MB4A 5FZDA 4I1PA 1VBMA 1OLME 3WXBA 3VZRA 4C0LA 5E41A 2ECKA 1C3XA 3FOFC 4UW9A 4IXDA 1RSZA 3HU1A 3FR7A 2Z6UA 4CO2A 4OYOA 5J2TF 1NZJA 3ND8A 4CKYA 2WICA 1F8VA 4B8WA 4E21A 2FSGA 1CNMA 1S0OA 5K0FA 1WF2A 4QX0A 4KSBA 3VFDA 5I42B 4G9GA 2GHRA 1P2GA 4B0OA 2V9PA 2J0XA 2ID9A 3R8FA 2V69A 2JGIA 4KQMA 1RT1A 1JXLA 4Z4GA 2G1HA 4RA9A 5FWJA 2RJ2A 3H90A 4X9XA 1N1GA 3G17A 5B5SA 3DV9A 4RK4A 1PO11 5EHHA 1HMPA 421PA 3PACA 2QT1A 4DR2J 4YSFA 1F2VA 3BRSA 4X66F 4HRAA 5DBHX 4A15A 1UKEA 1O6UA 2XOKD 2C9YA 5LD2B 1K06A 4I1YA 2RS32 2GZAA 2EXHA 2QXTA 1S6QB 1W2TA 3I2HA 4B9NA 2Y34A 5FLYA 3V6LA 4MI3A 2R1UA 3VBFA 4WZAE 4JX0A 1K7CA 4HAOA 1SCBA 1B0ZA 2WMYA 4NYPA 1RHQB 4NLVA 2RIJA 3AB4B 3SI7A 2RS53 3N0VA 2F9DA 2P1RA 3RNSA 1HDOA 1YDHA 4F56A 3RWOA 3MVEA 4OYZA 5C35A 1J27A 3VJMA 2HHCA 2HK7A 3DHNA 1GWLA 1LY1A 3R6WA 3OT1B 4BFUA 4R71A 4EARA 2HO4A 4LYAA 1IBKF 3W3AA 4NMXB 5AQEA 4Z7NB 3L8YA 1IKPA 2XCIA 4TKLA 2WZCA 1XPJA 2WU4A 4B35A 4YDRA 2PUHA 1BKSB 3M2TA 1YHNA 3DOFA 3GD7A 3NKGA 2QQNA 2JLBA 2GMMA 1NH7A 4L0DA 1UQRA 3QOWA 2VDWB 4W8JA 2NZ8A 2Q5LA 2AGSA 4MO9A 2CXUA 1MRSA 5I45A 2E7VA 1MU2B 2AR7A 3A9UA 3QY0A 4X4RA 1T6XA 1JLGA 4KG0A 1JE0A 3DJYA 2QKDA 4B9EA 1RLJA 1G2OA 1W34A 1ZOOA 3WJ2A 1Z5WA 3HU2A 3HJAA 4JD5A 1W96A 2MNGA 1XP5A 3NIDB 3S70A 4AEDC 1UEUA 5MAOA 1FXRA 4MYTA 4Q3DA 4RD6A 4UZFA 3L92A 4PZ0A 3NAPB 3ESDA 3AJ1A 3CZRA 4Y6PA 3DRRA 2JCSA 5I9NA 1QZTA 3MMXA 2ZH6A 5LA1A 3J7LA 2GEVA 3R6GB 5AJWA 1ZBA2 2ZUWA 2IKSA 2Q6TA 2X0KA 3D2BA 3K5HA 2VOXA 3ETLA 1RUH1 1KYTA 5CFNA 2IEZA 4C0XA 1N36F 5DDJ3 4IGKA 4RDCA 4DFDA 2ZYHA 4CCMA 3MYYA 3O3CA 3E5QA 2ZIXB 4HANA 1SUAA 2V7EA 5D3MA 1YI2S 2P11A 2FLNA 4BZWA 1ENQA 3ANXA 4EY4A 3F49S 3MSXA 3K1ZA 3V2GA 1SBEA 1K4KA 1AS2A 5BVHB 3C8XA 2PN6A 5BY5A 3ZPXA 1DNPA 2AS0A 3WP3A 2VAXA 4CM4B 4FW9A 3E9DA 3KLFA 3CMAS 3A2NA 1CAUB 2Z4RA 3HKCB 3T5HA 1VL0A 1D6JA 3UXEA 2DV9A 4J16A 3FBMA 2RH8A 5T3YA 3TI9A 3M6VA 2ZOEB 3BM7A 1E57A 1KC3A 3ASVA 3ZTOA 2JIPA 3LQRA 4XMIA 3VU3A 1WAMA 2PX8A 4RETA 3PG9A 2IEIA 5BW6B 1K8ZB 3MTJA 3JZDA 4C14A 1C8M3 4ZOLB 4EUKA 1U1QA 2FEKA 3K15A 4CTOA 3ZMNA 3OU2A 4C4ZA 4F60A 5IFKA 3I5BA 5FUWA 2ZUVA 4L5AA 4HUQA 3ZXSA 1FDOA 2EZ9A 1TME2 4G5HA 4PZEA 1QLNA 4R3NA 4PYKA 2BYTA 2XHZA 1OT5A 1H0BA 5KSOA 5IFLA 2E2WA 4ECWA 3K0CA 2AT1A 2GCGA 4ARYA 4F4FA 2J1SA 5B7GA 2EQAA 1E5SA 2DNNA 3P9QA 3KV6A 3C14A 4NHEA 1R8SA 5CVCA 1N2IA 4D45A 3S4YA 4FHZA 2QRJA 5IT9U 1LHVA 4I3HA 3CC2S 4XO0A 1DG9A 1KY4A 1AJEA 5GADU 3WO0A 3IS9B 1SMKA 4MCAA 1Z26A 3MLJA 1D1UA 3BB5A 2O0LA 2WFAA 3OFNA 1QQP2 2YWHA 3AUKA 3NAPC 3MOSA 1FQOA 2O5EA 4X64J 2EWWA 2R00A 3JRWA 5AC93 3KLIB 2C0CA 3DE2X 5BR7A 3AF2A 4NLYA 4FQ5A 2E4XA 1ZGZA 1K6JA 4U7TB 2C5DA 2CWWA 3A05A 5H7XA 5BYSA 5J23A 1EVZA 4KH0A 2RD2A 4CEYB 2QNKA 1SXGA 3G5TA 4E1AA 4PXBA 1XT6A 1MN9A 3CJIA 3CIOA 3QRPA 4NBVA 3TNFA 3GWZA 1K8XB 2GK3A 2A33A 3HSJA 3DMNA 3NYRA 9GPBA 2Q3LA 5BOVA 3X29B 4EENA 3RZKA 2Z2YA 3FDJA 5IJZA 4ETXA 4FT8A 1F5CA 1L6IA 2PH1A 1FSZA 2RGYA 5G4DA 2I6UA 4R0MA 3NGSA 5B3LA 3TVTA 4AW9A 1TL5A 1RYDA 2AMYA 3DZ8A 2C5HA 4N5DA 5L95A 4OUKX 3PHEA 1Y9ZA 4F12A 4A8MP 1QXSA 1U81A 2HSDA 2I7XA 1X4AA 3CCRS 4OYAA 1T0PA 3T9AA 2B5WA 3WSWA 1G5TA 4B3MJ 1NLRA 1DQ2A 3DXBA 5CNJA 1VPWA 1DFIA 4Q29A 1KEUA 1RUE3 2UYAA 4Z8BA 3NBPA 4BQSA 4WACA 5AXMA 3LOPA 3AR2A 3OY8A 2AOUA 3BN3A 1A88A 2IHR1 4AQ2A 4ZPDA 3VHXB 4CDXB 3WI7A 4UOEA 5K03A 1L0BA 5FYYA 3G9XA 4FKYA 1RMU2 1UVIA 1QFZA 4QOHA 4DGSA 2Y92A 1AA6A 1M0TA 1CAXB 5JVGQ 4LXQA 2H4YB 4FTBA 2AL7A 5FZGA 3DKKA 1MLDA 2NVWA 1PEDA 5ALKA 4HL9A 2IU3A 2DVDA 1V6JA 1SB6A 1KONA 4RQPC 1QC5B 1JFLA 5KHIA 1RPTA 4DV3J 3KGLA 4NSNA 5LASA 5F73A 3CCQS 4M46A 4R2XA 4ZVSA 2O2ZA 3JYPA 5BYRA 3CJ0A 2RBEA 3L9WA 3ETNA 4URWR 4X3CA 2EA7A 2BEVB 1FDWA 2CDNA 1S2DA 4CUBA 2UVPB 2LDIA 3RTBA 3WW4A 3C7FA 1LS1A 1I13A 1NSTA 3ETQA 1V6IA 3ZXLA 1M33A 5D8AB 4CLDA 2EK1A 4YM1A 3SM3A 2XCTB 2ZVQX 2VASA 3N70A 3Q8VA 4JA0A 3O5AA 4IIHA 2I78A 3E5NA 2ZIZA 3LW8A 5KYUB 1ZRHA 3WV6A 1MMDA 5LNK6 2QN6A 2WUFA 3LPCA 5B30A 4FJ0A 1XNCA 2O4CA 2OFGX 2VCYA 4I4IA 1ZH5A 4NMXA 3IAM6 1OWOA 4MKRA 5IKMA 1YJXA 3HB5X 2XADA 2MTLA 3VZOA 2VCEA 4Z07A 3QVGA 3E70C 3OF3A 1WLWA 3EVTA 1B14A 2D2EA 5F5IA 3BBPA 1NCRC 2A0FB 3WHIA 1BX0A 4P31A 4R2JA 1L3SA 4IDDA 2R7EB 1SXJE 1KD7A 1FYVA 3HVDA 2W2LA 4MHRA 1EAH2 1JTZX 1DU4A 3RVRA 1HFWA 1P81A 2HF2A 4BIMA 4IDZA 5I3QA 5BNIA 3TF5A 3B53X 3Q8FA 3E9EA 5JISA 3L1UA 3CCUS 1V7ZA 2X7HA 3CO2A 1PHMA 5JIAA 1DZIA 5KYNA 1FNDA 3HACA 3EEOA 3EDRA 4NR0A 3O4FA 2AMLA 4Y1UA 3TGLA 1KH2A 3SN6A 1BD3A 1FJ2A 3OSDA 1UZDA 5D3QA 2WN2A 3V55A 2C2XA 2CXSA 3VVUA 4HONA 1NLFA 1P7ZA 1K47A 1JWBB 4RFVA 5B3KA 2HUNA 2VHZA 2ZDQA 3PXGA 3L7LA 4BE3A 4DMIA 5JFOA 3DDCA 2EFDB 3IVAA 1U63A 5FPZA 1EUCB 1KQ3A 4CEHB 3T3FA 3QGIA 1R88A 4CDUB 2X3FA 3H50A 1QTNA 3IBYA 1W0CA 3RSOA 1MXFA 1RHI3 4IW3A 3HCOA 4X85A 1SXJB 2VQFF 1AK9A 3UK0A 5CB6A 3VYRB 4K9PA 5J63A 1K5DA 4DKJA 3OUTA 1PK8A 3UAVA 1RYYA 4CM9A 2D7JA 5SV2A 2O2XA 5IVCA 4RULA 1W8NA 5EKUA 2P0EA 3HULA 2FUCA 1FP2A 1JHYA 4EABA 4G5YA 2ZSJA 4CFZA 3LI2A 1LJ8A 1VJWA 1FZTA 5FBQB 1EE1A 1GPJA 4QQBA 2P67A 4KVAA 2JDHA 4Y1GA 1JLRA 1JJBA 3B9PA 3ON7A 5FKBA 2ZHMA 4EKEA 4FKMA 3TD6A 1O8CA 3H1WA 3A1UA 4P9SA 5IJXA 2HIYA 4L8GA 3ETDA 3CT9A 2VYNA 4ITUA 3NBQA 3VBCA 5IXUA 1YFKA 4TXNA 5D7BA 4AJHA 1A1SA 2RM21 1EZZA 1EUTA 1JLBB 1T0HB 3IHKA 2WBRA 3G1WA 1J0CA 1G5IA 4S2HA 4QMAA 4R1MA 2NU9A 4P81A 3PU8A 4YP0A 5FO8B 5EPUA 1FFWA 1D4M1 2A0WA 4W99A 5F3WB 3PEYA 4N0DA 1E98A 5B4VA 3JQBA 3HCXA 1Q3EA 1AF9A 4HXEB 4DV7F 4EKNB 3P3NA 4LHYA 4CXWA 1ACCA 5GWXA 621PA 2WL1A 1AROP 1HNZB 2C9CA 4W5HA 3R97A 2ZBUA 1YJ8A 2ONYA 3I5MA 1UBEA 1OLXB 1EPUA 2HYDA 4B3GA 3HHKA 3NHZA 3C3DA 4JAVC 1YT5A 3ETGA 5F0WA 3AOAA 1TNDA 3VDDA 3R9IA 3BC1A 3A3OB 3BMOA 2EFQA 1MF7A 3GGGA 1B43A 3P94A 3EBLA 2ADCA 3KMSA 4AQSA 3R0RA 1G0NA 1PNVA 1W0NA 1YRZA 4ZJOA 3CUEF 1NJ1A 1OOEA 1RC1A 3H8OA 3J8F1 3MHYA 5EZYA 3MLLA 2Z30B 1X1EA 5ECDA 5F8PA 3O75A 4R98A 4E2FA 3G0OA 1U1RA 4K5RA 1BC6A 2ECOA 5LUAA 4YB6A 5HI7A 5ETQA 1J0DA 4KE5A 3PQ3A 4MW9A 3SIXA 3JB9k 4FEEA 1PFYA 3VKUA 1BJQA 5FP4A 4E32A 3C66A 2XNCA 5CADA 4L3VA 5FAKA 1CBKA 3H9QA 1IFXA 2JGDA 3AT1B 2IJRA 1R64A 2PXAA 3LGHA 2PX6A 3WRXA 1S97A 3PTYA 4NRTA 1J8YF 4I09A 3D5QA 1VLMA 3IOYA 4YP5A 4Q82A 3U3XA 1X4BA 1LRKA 4KACA 1W9SA 2EJTA 1PWXA 2QLMA 3E1KA 2CPZA 4DL3A 1NHKL 4UNNA 4GIQA 2OTJS 4UCXA 3D6FA 1RI3A 4EEXA 4KFRA 4Z1VA 1DARA 2HFUA 4MIKA 4IOMA 1Z38A 1N2GA 3UM9A 2EKPA 2WTNA 2EF1A 3ZR6A 1K3UB 4JQRA 3VHNA 4PSVA 1OLUA 2DR3A 2OB2A 4DW8A 2BFBA 4RK1A 3S8MA 4DY3A 3FYUA 3K75B 4L50A 1P1HA 1H5QA 1AR93 1O6BA 4JGZA 3WGTA 4KEAA 4U2AA 4MGQA 4GJZA 3FC9A 4OYXA 2B8NA 2OX0A 4BFSA 2VRWA 2O01C 2WRAA 2XWJB 4Z9YA 2GXQA 2D5LA 4B6SA 4K9OA 3TW8B 1SZBA 4JI3F 2BL4A 4I5GA 3RU3A 4E0BA 1F1JA 5CK4A 3L0YA 1UIJA 1ZRSA 4QBKA 4AUKA 1U0GA 2V1XA 3MUNA 1K12A 3SH4A 4DV4J 5JCJA 3CS3A 2MLZA 2FVPA 1W5AA 4UM5A 2O8BB 2DHAA 5FNZA 4TRRA 3V4MA 2GP5A 4EE2A 3VZIA 3EUEA 2OV6A 1E5TA 1ZN8A 4GBJA 3RUIA 2AA3A 3ZOZA 4YYZA 4EA6A 3WRYA 4TTRA 1T05B 2CXQA 4IV3A 1JR3E 2P65A 4CDRA 4LJLA 3LQ4A 2J6UA 3M6MD 3DVSX 4P0TA 4Q0MA 4QBGB 2PT7A 4LRBA 3AL5A 1RB0A 4RLSA 2WV7A 4O0NA 5KTMA 1T5OA 3IRVA 4IHQA 1DC5A 1GNVA 1KZ4A 2VHWA 2NUAB 4OBEA 3I2KA 4W9NC 4F4JA 2OHHA 3VZQA 1OYOA 2VVFA 5E9AA 3W6PA 2IYOA 4JELA 1PO12 5KYTA 1XRLA 1H42A 1S0BA 2X58A 2JFQA 5K3CA 4EY5A 4H0FA 4JSRA 4YMSA 5AT1A 2BU9A 3DLBA 3S2GA 1QOZA 3FWEA 2RGWA 5B4TA 2OCDA 3NRJA 1CN1A 2WHQA 1Y7BA 2ZIXA 5LJIA 3AAWB 4TKUB 2JDPA 4J0JA 3PWKA 2PGCA 1W39A 1H1AA 3U56A 2HR1A 4UM8B 2REQA 2PMFA 1UK8A 2C1FA 1AA9A 3WLMA 5EPEA 1A8IA 4MZUA 1XCPA 2X23A 2ZWVA 3T5LA 2XNRA 2FDIA 4ID8A 5CDGA 2JCGA 1AQIA 2DKFA 1U25A 2P75A 4M0DA 4UZBA 1IKQA 4IY1A 4Q24A 3RYRA 1KYWA 2OQ2A 1JDBB 4HTJA 3GZJA 2FDKA 4GI2A 5TEVA 2Y6KA 1MT0A 4XF9A 1FJEB 5KNDH 3P2JA 1IG3A 4MIWA 3R6SA 1NVVQ 1FJ7A 3D8BA 4O0LA 3UR0A 4ETNA 2HV8A 4DHWA 4DY4A 3GGPA 5D01A 5H81A 3AEKA 3ZHQA 4PFQA 5KR7A 3QUTA 3TQTA 5DM0A 2KBEA 4XYMA 2MXYA 4EMSA 4YP7A 3GFXA 3M49A 4YIHA 4P22A 1FDIA 4MZXA 4YT4A 1YVRA 3OHAA 2C3PA 2Q6KA 1A9YA 2R2UA 4WFJA 3OA2A 3NJRA 1MD9A 3ZLTA 3ISND 2LNDA 3IAM1 5KQSA 2BVBA 2BGGA 3N9UC 4Y6SA 2XR1A 5KFQA 1WCKA 2NPFA 4EJMA 4YHHJ 1VQ8S 1TM5E 2G70A 2QMOA 4G89A 3P4UB 4ALKA 1ZNPA 3EG9B 1FF2A 2QD5A 4B46A 4QYXA 1I5OB 1AVTA 4RK0A 1EE2A 2KXFA 1W4LA 2K2WA 3VX4A 2I74A 3QV1A 4X00A 4Y6GB 2RHMA 2J3LA 2V5DA 2VSYA 3PUAA 2F59A 3B6EA 1NLZA 1GDTA 4A0SA 1SLIA 2PWYA 4C97A 4G4SO 3AUJB 3UL2A 1U0BB 3W60A 1YFUA 3ICLA 1JP7A 4OJYA 3TNDA 1WI6A 1KP2A 4ZLPA 5C42A 3CUYA 3VNQA 4AL9A 3C87A 4MGIR 4TLFA 2XUKA 3RHFA 3DFZA 5HP1A 3PKMA 2H4HA 4W1SA 4EK2A 2P1DA 2HBRA 4HSLA 1N5IA 3QNWA 1DEHA 1F2HA 2VZQA 2C0ZA 4O2AF 1R8JA 5LEKA 1I10A 4JC4A 5LP6C 2IEYA 3CYFA 3SJUA 3IAEA 4UQTA 5U1PA 4F3CA 1K63A 1KFSA 2LKCA 4NY1A 1GNHA 5ANRB 3ADKA 4WK3A 1IUNA 3TSAA 1RUJ2 3GSDA 3DEAA 5A0YB 2WVJA 1H2VZ 1X0VA 4IIVA 2VP3A 4HDNA 3NH9A 1CIYA 4TY8B 4S1OA 2LUWA 4DMMA 3TGPA 2I0XA 2E9ZA 2CJPA 4EI9A 4X64F 2EWVA 2P9YA 1Z2DA 2RJNA 2C3OA 1NR5A 1ZOSA 3W58A 1QCDA 3CRRA 1HKHA 2YIVX 3TLZA 2PSSA 4GC6A 3V6HA 4R8KA 3ENNA 1I5PA 4Y2CA 2H4JA 4ECQA 3TMYA 2P1BA 2HLTA 2V4AA 1RI7A 4IDFA 4PYIA 4YO8A 2WT0A 1XD2A 4X94A 1K86A 3DUFB 3BQ9A 1N1VA 3VU9A 3I9ZA 1SCAA 2GZSA 4YB7A 1XDBA 1VGRA 3P0RA 4LEJA 5EZWA 3AR7A 2W2MP 3I2JA 1RTIB 3JWGA 3OIYA 4OY3A 1UOFA 2WUVA 2J0UB 2Y99A 1OTHA 4XABA 5KHKA 2VWQA 1XMQB 1CGPA 2JGDB 2E1CA 1AHNA 1P7CA 1R1DA 2VOWA 3QEMA 1EHCA 2HQIA 3D0JA 2MSDB 4XCBA 2VVEA 1TRKA 5SZKB 4LR8A 1P1JA 3WKEA 1C1FA 4R9AA 1F4AA 2ZKNA 1OYVA 1IIBA 1ILWA 1OX4A 4IZHA 3PNYA 4QIWD 1NDKA 1NJ2A 1QRTA 4IEXA 3C43A 1G291 3EICA 3VB9A 3T95A 3AX4A 3AM3A 5G0VA 1WULS 2C26A 2C9OA 3N28A 3H2HA 4JI4B 4GX2A 3NJXA 4R05A 4G2NA 1GP6A 3DE6X 4ZHRB 1H8VA 5D4OA 5EMJA 4CG0A 5A3MA 4Y8VA 3BAZA 3RM3A 1IZ7A 1GKBA 2IY9A 4HK4A 4YUXA 4XURA 3ZMOA 3FOBA 3W7VA 3PFKA 2R48A 5K1ZA 4LY6A 3NSTA 5C9ZA 1EX1A 5T7LB 2ORZA 3BT7A 1LOUA 3MRVA 1T9ZA 1SZPA 3OCJA 2IC5A 2PSDA 5DEIA 2ZRDA 1XO1A 1PJ5A 1TCVA 2RHQB 4NESA 1JLHA 4FOWA 1J9GA 2GPSA 3EVAA 4YPOA 5CAAA 4E5DA 4YAEA 5JR2A 3MWJA 4OVKA 5A4JA 4YI3A 4J6FA 4RHXA 4JSYA 4KQXA 2RR13 1Q2XA 2R1ZA 2M1XA 2Y66A 2Z2YB 3CR3C 4OHRA 1VBA1 2HMIB 1HG0A 2Q29A 4AFFA 4JI4F 5BSTA 1KEPA 5CGQB 3DYVA 1SL2A 4LJ6A 2W43A 2QMEA 4N53C 2FMYA 1YG0A 4DYVA 3FKBA 4H3VA 4ENWA 1PT5A 2O8NA 2IYGA 4NIIA 4IGEA 4PANA 1UYXA 2AZXA 5DTMA 4P7TA 1CQJA 3PUYA 4WTOB 2PYZA 1G6KA 1PJ4A 1DYOA 4NYMQ 3N8DA 1NN3A 5GZFA 3ZDXB 3ZSEA 1TW3A 5KS2A 2A6WA 1ZD5A 4UFJA 5C3UA 3NRCA 4DC0A 3QWBA 4MFBA 4OYLA 2Y3IA 4PZUA 1B3BA 5CEHA 4J9SA 4RW4B 1BX1A 1YB4A 4KJZA 2IHZA 1D2HA 5AI6A 2B1IA 3D2CA 4MH8A 1ND3A 1BQPA 4X71A 1OXTA 4MQMA 7GPBA 1CPMA 5BUVA 3DKWA 3BGSA 2ZTSA 4JXXA 2W3JA 4CR6A 4HUQB 4G5SA 1SKUB 2FXVA 5KTRA 2XJPA 2D41A 4C9BA 2DFBA 4H2AA 2G9GA 1QP0A 1HC7A 4GJYA 3A12A 4LVCA 1SIWB 1X9SA 4QZVB 1IYZA 3T9CA 5H9VA 5IVEA 4KFTA 3KJQA 2YWKA 2X8LA 3WP1B 2FX2A 1PQWA 1JFFA 3OQ6A 1XK8A 4UQOA 3GCGA 4FMCB 1D1TA 1NBOA 5CYFA 3KFVA 2PK3A 5AVQA 1XTJA 2YFUA 1TUBA 4K8FA 1PW7A 1EBUA 1T2VA 1H94A 3S5AA 3SBOA 2D3UA 3RABA 4MGKE 5A3QA 1WKYA 1HW9A 1U7UA 2IX3A 2CJXB 4ARCA 2R6HA 5J4LA 5G40A 3WNQA 3MPPG 4HY3A 5JZGC 1GTRA 4NXMB 3I0SA 1Q95A 5F5CA 3FE2A 1DAIA 4GYJA 2BH2A 5LPNA 3D7LA 3I0RB 3TJZA 1TLLA 3BN7A 1W9TA 2UUCJ 3JQMA 5EQTA 1NW6A 1LFDB 1VR3A 3HYSA 5L1LA 3KTAB 3PJ9A 2OPBA 3NDBB 3W9BA 3W8GA 1BCRB 1DC6A 1Q8BA 1ISPA 2VC1A 1JHZA 5CA5A 1ZBE2 2I8EA 1A8PA 2CMGA 4Q5IA 2IU6A 4Y1XA 4MKAA 2IJGX 1AYN3 4XJTA 2KL8A 2ILZA 4BASA 4ZLNA 5DNCA 3L1IA 1CZLA 1Z6GA 1XNRB 2ZZTA 2V5YA 3BB3A 1XQNA 3RJ9A 5F23A 4NX2A 5AJTA 4UHKA 1KFDA 2K2PA 2A4MA 4F7ZA 4KAIA 3CB4A 2GERA 2XTJA 5CH3A 1QTMA 3DN9A 2H1CA 1O2DA 2ZUDA 3F74A 4D9IA 4HN2A 3DBLB 4Q19A 4QHYA 1TL4A 2LWIA 4XVHA 1NOKA 3V4ZA 3QNWB 2WONB 5EHZA 2YUEA 4H4OB 2WLPA 1WUJS 3TCKA 1K2VN 1YR9A 4LR9A 4G1CA 1SCQA 2F3RA 3NDIA 5B0FA 3VVCA 3MMNA 5CG9A 4TWBA 1U09A 4I19A 4C4OA 2CD7A 4IEOA 4KSYA 3TEYA 1DV2A 1VMIA 4HVZA 1Q7CA 2RHRA 1Z6AA 4XW2A 2GQ0A 2FHKA 2IZ0A 5JIBA 4AGVA 2BZ2A 2GX8A 4J0QA 4Y6OA 2UY9A 2AC7A 4UD2A 1T8TA 4BJ0A 1LGYA 5C70A 4OMUA 4DWWA 4Y30A 3CX3A 2ZTNA 1GV9A 1YVUA 4LR4A 1Q8IA 3H0KA 2BQPA 2G08A 3N7UA 3A10A 3VKFC 3SDBA 3TECE 3U3MA 1MQAA 3DDKA 1VBA3 5A4MS 5BR4A 1NQAO 2OA2A 3B36A 3IC5A 4O5OA 1OVMA 4TYMA 3ZI4A 3UAYA 4AQYB 1WACA 4K20A 1NQTA 2D97A 1CT9A 3C16C 2DXFA 4Z82A 3ZXAC 5J1NA 3JZIA 5JYBA 3HSZA 2ZWMA 2X8JB 2XOKA 2G77B 3PI6A 1T9BA 4ZZ3A 4ANFA 2NT4A 1HQ2A 3P4YA 2QJVA 4KGGA 2HQCA