2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein CLP1
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
4FD2A 4EAQA 4A6XA 4W5HA 1ZAKA 2NTYC 2QQEA 1NVXQ 1QHGA 1Z47A 1CXZA 4JLOA 4Q7KA 5KSZA 1X8JA 3AVXA 4JMPA 2R6CA 4CT5A 4JS0A 1G1MA 3U3KA 1S4QA 5AUPB 4ZV4A 2VHTA 2HXSA 5JBQA 2O52A 1JJ7A 3OFNA 1CS4C 3A1TA 2OILA 1XJQA 4ZKEA 3KFVA 1VKJA 1NKTA 4A2QA 2A2ZA 4WW0A 2V1UA 2WIBA 5CJ2A 3QKSA 1RRGA 2V3CC 3WP0A 3K0AA 3TSWA 4JKYA 4D0LB 3QKUA 5DIFA 2GHIA 4DVGA 2VHUA 5C4GB 2OLKA 4HB4A 4TMVA 1VIYA 1LB1B 2IL1A 4QJ5A 1YZQA 1DOAA 2RGBA 4HB3A 1XPRA 3TK1A 1OXXK 1KZGB 1X1SA 4MKGA 1UKYA 1U98A 4OK5A 4HLCA 2Y8EA 5JSZA 1KJZA 1QG4A 3KUDA 4FMCB 4MRRA 4PO8A 4UJ3A 3T06B 3RS5A 4ZCMA 4YQFA 2EWVA 1FZQA 5G40A 3IO5A 4UNSA 2CVHA 2BV3A 3BRWD 1S8FA 2GETA 2OESA 3AH8A 1IXZA 4EQ6A 4M1OA 1GKYA 3GLFE 1WB9A 4H1VA 1YKSA 4KFSA 1YRAA 4PSAA 1G5TA 4B6FA 2HEIA 1VMAA 1E9BA 3D3QA 3C5CA 1H8EA 3IO3A 5G41A 2AKYA 2WJIA 4YDHB 1K5DA 4D80A 2EFEB 2IYQA 1EFRA 4M9QA 4AG5A 2I3BA 2OO7A 1F48A 2CL0X 2ANCA 4KI0A 4LV6A 4OYHA 4Q1AA 1SQ5A 4RD4A 3U44B 2G88A 3A8TA 2ZJBA 1GVNB 1U99A 1HQCA 2OFWA 3GFTA 4LHXA 2RGNA 5JI2E 4LUCA 2ZIAA 1G16A 2Z6VA 1T8TA 1S3GA 4HB0A 3RS3A 1E2KA 2I1QA 1G21E 2VBCA 5BN4A 3QG1A 3X1WA 4ILEA 4M1SA 2C03A 1P9NA 1YR6A 3K53A 1E2PA 3L0OA 1GUAA 4HAUA 3ASYA 3SEAA 4AYXA 1G8YA 5L3QB 2BBTA 1JALA 2ZRKA 2WKPA 4G5SA 5FOUA 5EZ6B 3U3JA 2EFCB 5EE0A 1FQKA 3WMGA 2C98A 4TMWA 4LPKA 4CGZA 1D8TA 4OI4A 3FKQA 5DN6D 2VHJA 4KYIB 4EFLA 1DS6A 1KY3A 1ZD8A 5JI3E 1ZM4A 1IXRC 1Z6TA 3QKTA 1EK0A 3LV8A 4V0LA 4Q1BA 4JYBA 3FFBA 1JR3D 2ZYUX 2AR7A 3GJ8A 3CNLA 1W36C 2H8KA 1JXOA 5D3MB 1TQ4A 4C2UA 1W1WA 2DBYA 2XB2A 2ZRDA 3AKDA 1ZUIA 2C99A 3K09C 4PPGA 4Q4AB 1SVIA 2J3EA 3B1XA 3HDTA 3NH6A 5CM8B 3WYGA 4BECA 2ZRMA 3OIYA 1LV7A 1E2QA 1P2VA 2CEAA 3KKNA 3NC1C 4LYAA 4C30A 1G20E 2QGZA 4U02A 4BFVA 3U5ZB 2YVUA 5JS8A 3VHXA 5J5CA 4WZBE 4B76A 5KU1A 1TADA 2JGNA 5JHGB 4UNPA 2J0QA 2GXUA 1J7KA 1Q21A 1NLYA 3B7GA 4C0HA 5IK2A 1SVOA 2W0SA 1E2IA 3M4YA 4JZKA 2QSZA 2B92A 3PUYA 5HTKA 5AK0A 1D2NA 3DEFA 2FEMA 1M1YE 1BYUA 2XTZA 2OBMA 1N5KA 5CK5A 5CLLA 3A36A 2C5LA 1R2QA 3Q5DA 3CPJB 4LC1A 5FL7D 4ZDWA 1GFIA 5JWHA 5J4YA 1OJLA 1JI0A 4MUBA 3SE0A 2QM8A 5GJCA 2H5EA 3HYRA 2W6ID 1IQPA 3I5YA 5JJKA 1CU1A 1UADA 2NGRA 4ASUD 3WYAA 3LH5A 3U3RA 5JJIA 2QBYA 2NIPA 2ZXUA 3FTQA 4L4UA 3QPUA 3K9NA 3I73A 4E22A 4F93B 1FTSA 4JKIA 2WAXA 1LF0A 4HEJA 3SJZA 2XITA 2GCOA 3CB4A 3DVLA 1KO1A 3OEED 4GNKA 5E4FA 1AS3A 1XMIA 1MRNA 5FOVA 1E0SA 2MSDB 1U9IC 2BKUA 3DHWC 2F6RA 1G41A 4WA7A 2AN9A 1W2HA 4LJYA 4R7ZA 4MYHA 5AJVB 2JIZD 2ZVPX 2FZLA 4ZI3A 5BWMA 2R6DA 1EFCA 3ASZA 1RE0A 1PLKA 5E3HA 5AJWA 3LXXA 3Q5EA 3BGWA 2BJWA 5KDLA 1XTRA 1DAGA 4CT4B 5KPDA 1MO3A 1Z6GA 3F5FA 2JAQA 2FE4A 1PV4A 4ZDKA 1DARA 5KSPA 1UJ2A 5F98A 3AF0A 3EARA 4XOIA 4M1WA 1R0ZA 3ZIAD 3HP1A 2OXCA 3RSLA 3A4LA 2HT1A 2W2TA 2WBLC 4LBVA 3CRMA 1OH8A 2GK7A 3GLHB 4LGMA 1F3OA 3OHMA 4ACAA 1G7SA 4QBFA 3OESA 4URXR 4L15A 5EZ5A 3Q72A 3BC1A 3ZD6A 5P21A 2PX3A 4EKDA 2R6FA 2OSBA 2PEYA 4I99A 4XD7D 5K8TA 1XEWY 1P62B 2HDNB 1Q12A 2VL7A 1Z3IX 4LHWA 4B2LA 1ZCAA 2RGEA 1AZTA 2J0UA 4ITRC 3ZD7A 4U7DA 2ZI6A 3BB4A 2YOGA 2XOKD 3HU3A 4XWAA 4A92A 1Z28A 4NH0A 5F3WB 4AG6A 3R8FA 1E4VA 1U8AA 1OSNA 5BYJA 2N46A 1VG1A 3A1VA 1P2SA 2FU5C 4NZYA 3ZZTA 4DUGA 1JAIA 2OE2A 2BMFA 4M9SA 1P2UA 2IS2A 3FWYA 4DSTA 4D81A 4C0BA 2QGNA 3HJNA 3JZAA 4JLNA 4XTCS 2FNAA 4UNNA 4N3NA 2RCNA 4PO1A 5EXXA 3SYLA 3QG5A 4DRZA 2EFDB 1P72A 1XX6A 3DM9B 5GADl 2C95A 2DPXA 3F8TA 5HKKA 4G5OA 1TF7A 2VHQA 3IEVA 3LWNA 1FP6A 3IPXA 1WXQA 4PC2A 2QMHA 1RPZA 3D8BA 1N5JA 1MR3F 1N6NA 3A4MA 1FNMA 3KX2A 1WBBA 1SULA 1KGDA 2PH1A 1ONBA 3PFIA 2FJUA 2FFQA 1KI9A 2LWIA 3EZ9A 1UBCA 5DYGA 1TPZA 2XTMA 5CB8A 2A78A 5FTMA 1BOFA 2NO7A 1TL7C 1P6XA 2FG5A 4HLQB 3K70D 4I1UA 5B64A 2DY1A 2GBLC 2VRWA 1NBMA 1XD9A 3FVQA 4D2IA 1KI8A 3VKHA 1PLLA 3K1JA 1SKYE 2P0EA 1GKIA 2X77A 2BBWA 3OIVA 1E94E 2AFIE 1GM5A 1SXJB 3KQLA 4TL6A 5DE3A 2J0VA 3PITA 1GNRA 1OE0A 3OAAA 4Q66C 4AKIA 3K0FA 3ZJYA 4X8OA 1EFUA 2DWOA 1WE2A 3T1QA 1W0JA 1GRRA 1RW4A 3K9HA 1CJVC 1ZIPA 3GFPA 4PPFA 3MUFA 4EPVA 5E7MA 4PSKA 2QAGA 1GDDA 2ZRNA 2BBOA 3L2OB 3UWOA 2HF8A 3GLGA 4TL9A 3RS4A 1L4UA 2ZE7A 3P20A 1KMQA 3OE7D 5AUQA 1J2JA 4QGHA 1Z6AA 2FV8A 3CRW1 3CX8A 1E79A 2REBA 4NYJR 5J40A 2NZ8A 2ZU6A 4NONA 1Z2CA 1JBKA 3THYB 4HUQB 1S2MA 3AKEA 5DNYB 3QIAA 4S2EA 4ACBA 5FPHA 3PEUA 4EJSC 2ZJ5A 2ZVQX 4DHEA 1E2NA 2G3YA 2C8VA 1AZSC 4F7WA 4BPBA 4DB2A 1GKUB 2G0TA 1CJUC 4W5JA 1WMSA 3QF4A 3IQWA 1U94A 1X86B 3K9GA 3TSZA 3O8CA 3GEIA 2W2XA 1RRFA 3B1WA 3BFVA 3AVOA 2ZSEA 4IHQA 2EVWX 1OKKA 1X1RA 1XU4A 4FCTA 4K46A 4LI0A 3ADBA 1NIJA 2Z83A 1FX0B 3EPJA 3CF6R 3ZS8A 2MSEB 2PZGA 1OW3B 1VPLA 3PCRB 5L3SB 1AA9A 3AVWA 2CJWB 2QRZA 3RRMA 2AHOA 1G3RA 1H8ED 1RJ9A 1XDBA 1NLZA 2V6JA 4UJ5A 4IOMA 2JJ8A 2PT5A 4OQXA 1ZP6A 1A7JA 4Y0AA 1DO2A 3G5UA 3PUZA 5TDHA 3W6NA 1XTSA 1CJKC 4G5RA 1DAEA 2WWHA 2H57A 4MDEA 2CK3D 2YOFA 4P4SA 4KJZA 2EYUA 1EX7A 1R5BA 2CNWA 2FX3A 4D4KA 2DR3A 1F60A 4KXFB 2FA9A 3VTKA 3KTAA 1WBDA 4KAXA 2XNDD 1E3MA 2ZI9A 5H1YA 5EE9A 3T61A 2G1KA 1US8B 2YJTD 4A8JB 2QI9C 2HLDA 1CJTC 3CPHA 3U61B 1BYIA 3A1WA 2VEDA 4IFEA 2Q3MA 4QBIA 4A82A 4CYMA 3RS0A 2ZREA 2OBNA 5FOXA 1RKBA 1XZPA 1KKMA 4ZPXA 1ESMA 1UEIA 2F1HA 4EUNA 5E7IA 5JHHB 2XJ4A 4BFTA 3LXRA 1YQTA 3TR5A 4RD3A 1W4BA 3DOEA 3KJEA 3SFZA 2GJSA 2WMOB 3FHCB 2AK2A 2VSOA 2OFOA 1OT3A 2EWWA 4HLUC 4CVNA 5CB6A 1XRJA 2WV9A 2NO6A 4DLZA 5BN5A 2ODBA 2O8CB 5IRCD 4US2R 5AJXA 1XBTA 1TF2A 2WJVA 3EZ2A 4RD0A 4B75A 3TW8B 1E1QD 3FMPB 2VQSA 3IKJA 4UXJA 2A5FA 621PA 4N0DA 1GNQA 1XTKA 2WKRA 4W5WA 1KI6A 3NKVA 1OB5A 5AUOB 1IJEA 1KK2A 1E4YA 1A2KC 2ZJOA 5HCNA 1IM2A 1HUQA 4G5QA 4MGKR 4RD2A 5JLJA 1KK0A 3P26A 2D74A 4RZUA 1D2EA 1ZNWA 1Q3HA 4L8GA 3SDZA 4EPRA 3QPVA 4HDQB 4DIEA 1DBSA 4KCGA 2A7QA 3THOA 1Z29A 2FFAA 1DAFA 1F2TA 1HA3A 1ZNXA 5KSOA 2JJ2A 4HB2A 3P1JA 4KLNA 1TMKA 3QKSB 3T12A 1EX6A 3K0AB 4L16A 2XSZA 1WQ1R 4LBWA 2AWOA 5JWRA 3MWKA 3B78A 1G18A 5F2EA 3TE6A 4HUTA 4ZDJA 1G291 1Q1QA 4IFBA 5HCIA 1OV4A 1ZNYA 5FI0B 1OIWA 3SZRA 4QGGA 4B3FX 1QBKC 4QRHA 2H92A 2MMGA 521PA 5JSZB 3PEVA 5HZHA 4PXAA 2G1JA 2WMNB 3MJHA 1DTSA 3WMEA 3TUZC 3MJRA 4DT1A 6Q21A 1ZBDA 1YR9A 2QT1A 1E0JA 3EXAA 4QHTA 3TQFA 1CR0A 3T5DA 3CO5A 1KDOA 4EQ6B 3L8YA 3QEOA 4NYIR 1W0KA 2G6BA 2RGCA 2J87A 2V4ZA 4OJKA 2WPDD 2O8FA 4M1TA 1ZNZA 2PCJA 2ORWA 1GL9B 2ZS8A 3FDIA 4RY2A 1E1RD 1ZM2A 3IGFA 3CRQA 4TLEA 1KDRA 1E0KA 2ZROA 2O8DB 5JEDA 1Z06A 4ESVA 2F9LA 4AIIA 4Q4HA 2QENA 1Q1EA 2ODNA 2OG2A 3CM0A 3THYA 4ZCIA 4PHTA 2PL3A 1II0A 4P4UA 3EG5A 3W34A 4L5BA 4GT1A 1G5RA 2KSQA 4A0FA 1N6LA 1HV8A 4IVPA 4US0R 2YZ2A 4JLVA 3UMRA 4MGYR 221PA 3W3AA 5E95A 4B6EA 1RFLA 2CDNA 2KB0A 1E2EA 1L2TA 4BLTA 4BLSA 3NBZC 4W9MC 3AEZA 1NVUQ 4FWTA 3GLIE 5KPJA 1BO6A 2QL6A 1VG0B 3M6AA 4JSYA 3LQQA 2PLFA 3Q9LA 4QGFA 3VR2A 1HTWA 2C2HA 2ZQ5A 1NVWQ 3NHAA 1FOEB 4LZZA 1R0YA 1U8ZA 3KUCA 1NP6A 1W48A 4KHZA 4YXWA 1KK1A 1Z08A 1PUIA 1JR3E 4Y0VA 3T1OA 3GLFA 1FMJA 3L43A 4HAWA 3U4QA 4L9SA 3T1VA 1WRBA 2O0HA 2GA8A 3C4JA 3W9YA 4CEHA 2QEQA 2Q3FA 4CEIA 2FZ4A 1C9KA 1XD8A 2KJQA 2W83A 4OJQA 2XNSA 4URVR 1CR2A 4HSEA 4TYWA 5FBVB 5EE1A 4GPTA 2X19A 2VIIA 3B85A 1NN3A 3N2EA 3W6OA 1NMYA 1PVOA 1AS0A 4RD1A 3UXMA 2CE2X 4RKEA 4URWR 3UMFA 1OHHD 1E98A 3PUWA 1NMZA 2E87A 2YKGA 1LF5A 4Z54A 3OIUA 4E09A 2V54A 2B7BA 4ARZA 4GZMA 2QNRA 4NDZA 4EDHA 4JYCA 5DYIA 3GJ4A 3UWKA 2GXAA 2X2EA 2GAAA 1XEFA 3QENA 3B60A 3NXSA 3KQNA 1IY1A 3FKSA 2P67A 4IEIA 2ZSAA 1P73A 2QM7A 1L4YA 2K5UA 1D9XA 3FMIA 2ZYWX 4TWZA 2JLUA 2XZLA 2CXXA 4QM6A 4FI3C 4BE7B 4JLAA 3ZS9A 2XTNA 5HPYB 4ZKDA 1XPOA 2DFNA 2V8OA 1AQUA 2ZI5A 5FR2A 2ZRAA 4XJXA 2DWPA 4KYUA 4LJ8A 2I1VB 4GMDA 2A9KA 3E2IA 2V1XA 3MMPA 1NLFA 2FMXA 1KAOA 5EE3A 2DFTA 1I4DD 2LKCA 2YC4C 1KJWA 4MGZR 1IN5A 2B8WA 3RC8A 2UZ3A 2ODEA 3C8UA 4PTLA 1DPFA 3X2SA 3I5XA 4PR0A 2L0XA 4IW3B 4Q9LA 5HR5A 2QBYB 1WP9A 1KO8A 3ND9A 3RWMB 4MYTA 4JBWA 3SQWA 2J1LA 1UKEA 2ANBA 4JLBA 1SZPA 2ZUBA 2IBMA 1VG9B 2GCOB 5BQ5A 3C15C 4FN5A 3K0CC 1QZXA 3I8XA 2ZANA 4P33A 3GJ5A 1VCMA 4GFDA 1YR7A 5EP1A 2XEXA 2ZRCA 1K5GA 2CL7X 1J70A 2BMJA 1EWRA 2ZRGA 4I1OA 3K70C 2F43A 2J7PA 1RZ3A 2EFGA 1KYIA 4PAOA 3EAQA 5LD2B 5KDOA 4QM7A 3BK7A 5KUTA 1G4AE 3J81k 1JECA 5AR1A 2OBLA 2JLZA 5A4JA 3GCGA 1TU4A 2BBSA 3N2IA 1EFHA 4Q9IA 2P3SA 4BRWA 1YZTA 4GP6A 4TZ0A 4RCZA 2OCBA 1AM4D 1A4RA 1ESNA 3BE4A 2PMDA 2RGXA 2OV2A 4NKRA 4NMMA 2OEPA 2O8DA 4MA4A 1TX4B 1PJRA 4DZZA 3UKDA 3IIJA 2QY9A 3REFA 2AWNA 3A6PC 5IDVA 4XVUA 2R65A 2AFHE 2P65A 3C5HA 4Q1DA 1RC8A 2WM9B 1UDXA 2DFKB 1ZC4A 1W5TA 1W5SA 3EZ6A 4XWKA 2QE7D 2ZE8A 1OXVA 2J0UB 4DEYA 3W5JA 3CLVA 3UG7A 4G0NA 2ZR0A 1NSTA 1ZVQA 2C78A 2R6GA 4BZPA 2QPOA 2QT0A 4RD6A 2D62A 4DXAA 1MT0A 3IHWA 2P6UA 5FTJA 1OIVA 2IYTA 2NPFA 2PJZA 1KI7A 5KNCA 3CF2A 3QSYA 5L3VA 3UMSA 4D0GA 4QJ4A 1OFTA 3NTUA 4QHSA 2JJ1A 3K09A 3W90A 3TVTA 4BUJA 2BC9A 1M34E 1ZW6A 4LCBA 3BORA 4G01B 1SVKA 5B57C 4YDSA 4U5XA 2DB3A 1E2GA 1F6BA 2OLJA 1EWQA 2NO0A 2D2FA 4GBMA 4DDVA 2FPMA 2J59A 4A2PA 2VF7A 1A5TA 2Q6TA 1XXHE 4Q01A 4TT3A 5FUVA 2XAUA 3AF2A 1W49A 2CHVA 1P60A 1P61B 8OHMA 1W47A 1RYFA 2NG1A 2GTPA 2KBEA 1HT1E 4B3DA 1YVDA 3TR0A 2N1BA 2ORIA 4BLQA 1S9HA 3DM5A 2ZRIA 2QP9X 1Z0DA 2Q9CA 1S1MA 4JLKA 2ATXA 1DO0A 1LTQA 1SHZA 3QBTA 1E69A 1TNDA 3GJ6A 3A4NA 4YC7A 1GITA 3A37A 4GZLA 3ZVNA 5FUYA 1K6MA 2FWRA 1S96A 3HWSA 4TYPA 3DDCA 5EXTA 3U7EB 5EUMA 4TMTA 3LX5A 1WDTA 3K0FB 5J4HA 2ZRLA 5CM9C 1NVVR 1UFQA 4A4DA 4Q02A 1KNQA 4M22A 2JDIA 4F91B 3QJYA 1FMLA 2WOJA 1S0UA 2ECKA 3THWA 4PPQA 2QAGB 3GLGB 2CCJA 1W2GA 4TYNA 2WZQA 3VNVA 4HI0E 1E0AA 3C7KA 4BFWA 2RAPA 1N5IA 1TUIA 3QXSA 3V4RA 3PEYA 3T5GA 5JWOA 4UQOA 2FPKA 1KZ7B 4GDFA 3X1XA 3AVUA 4EPTA 2CHQA 2WJJA 1OXTA 2RGDA 4WVFA 1XB2A 4V02A 3LFUA 4LHZA 1OH6A 1ZM7A 2C96A 1SXJD 4W7SA 1FUKA 1ZU5A 1Z2AA 4XVQA 3U6KA 2Q9BA 4LYFA 4BLRA 2WWYA 4BZQA 1UKVY 4YMTA 4AKGA 3NHBA 4NPHA 1F2UA 2JLRA 3QF4B 1AS2A 4Q4JA 5ANRB 4D82A 3QXJA 4DCSA 4TMKA 2VPPA 4O0MA 1LFDB 2V55B 2QROA 1N2CE 4TTQA 1TAGA 3TW4A 5D3QA 1HE1C 4D26A 4RFSA 2YINC 3PVSA 1HH4A 1QF9A 1XCPA 1COWA 1TF5A 3B1ZA 3DZ8A 3LLMA 1RJ9B 4A0HA 5JJLA 2KBFA 3FE2A 4RVCA 2SHKA 4GOXA 3RNLA 3E1SA 1Z5ZA 5KOYA 1AK2A 3SI7A 4WAUA 5L3RA 1IAQA 4P4SB 3RSOA 1KI4A 5IHPA 4NYJQ 4US1R 4LJ4A 1N3BA 5KO2A 3CIOA 3NVAA 3TH5A 3WXMA 5FUXA 3KTAB 3QKRA 2IEZA 4Z1MD 2IXGA 2QTVB 4O2RA 3REGA 2JLSA 4LBZA 3TSOA 2HT6A 3OF5A 4IDPA 4MRPA 5TVKA 4M4SA 2D7DA 1E2LA 3DMDA 4V0ME 4BFSA 3SC3A 3G0HA 2BCJQ 2VTKA 4RCYA 3ICEA 4B48A 5JS7A 4F92B 1JR6A 3BBPA 3ADKA 4OQFA 1FP7A 5FOSA 4OL0A 4H1UA 2V7QD 5C4MA 1LVGA 1QG2A 4POAA 1PUJA 3LD9A 3MWYW 4D25A 1KI1A 1CKEA 3AF3A 4Z8YA 2GEUA 5JEEA 3OEHD 4DLYA 1NY5A 2Z4SA 1AIPA 3O8DA 2RH5A 2WWIA 2AXNA 3IUYA 2ONJA 5AUNB 2LKDA 4IRUB 3WBJA 3Q7PA 3BH0A 1KNXA 1KI6B 4LJ9A 5TMPA 3AUYA 1N6IA 3WP1B 3BFXA 5JFGA 2IYXA 1VYUA 2QMUA 3WHKA 2GBLA 4LYHA 1N0VC 3KQUA 3VNUA 1I2MA 4DLVA 2GF0A 4KV9A 4M9ZA 1ZM3A 3LY5A 4HZIA 1HQYE 5JMTA 1JEDA 3ICQB 3UPUA 2WAYA 4FWIB 1XMVA 1MO4A 1M7HA 1Q1BA 1XJCA 3TLXA 1R8QA 2IW3A 3LBNA 1F2TB 1UM8A 4NCJA 1GAJA 3FKSD 1DEKA 2REOA 1YZNA 4TSFD 4PFSA 4B35A 1G5PA 1P4SA 1N6KA 3HR7A 2XGJA 3W3ZB 5CITA 3IPYA 2W6JD 1H8HA 1BMFA 5HE9A 3N70A 3E5HA 2B7CA 1IN6A 5B30A 2IT1A 4WZAE 1Z0FA 2P5SA 2XB4A 4LJAA 5JCPA 2A3RA 1KSFX 3NBYC 4LRWA 4X8MA 3X1YA 4M1MA 3B6EA 2GZDA 2QORA 1FTNA 3MWJA 3QNUA 1P2TA 4QOSA 1IBRA 4JLJA 5GJWC 2D2EA 4TLDA 1YHNA 1ODFA 3OFND 2CLDX 2IWHA 2IXEA 4DT1B 2IC5A 2RGAA 2O8BA 2CVFA 3JZMA 1W4RA 3LLUA 4EJSA 4KU4A 1FL9A 4NBSA 2GILA 2F1IA 4CZ2A 4JSTA 2XX3A 3GMTA 1XPUA 2O8FB 4Q5IA 3IBGA 1GWNA 1P9RA 3W5IA 4R2IA 4O3MA 1G3IA 4XWOA 3VKGA 2FGJA 4MKHA 3TUJC 2P6NA 2UZIR 1JQJC 4WZ6A 4Q4HB 3JVUA 4IVRA 4N0EA 4PC6A 3SNHA 1UBEA 3GJ0A 3AQ4A 1JXMA 2JLYA 4TN1A 1D6JA 2J7PD 5DHFA 3ZZ0A 2GESA 2G0NA 2HV8A 3LVQE 5JCZA 3IILA 4OHXA 5FBRB 5H70A 3CPEA 3VU9A 4JBYA 1QVAA 1N6RA 3KKQA 1FFHA 1VIAA 2W00A 4HDCA 4IXMA 1Z0IA 1Z8FA 2ZEJA 2YWGA 4X8HA 5FUWA 2ASEA 3VMFA 4A9AA 5CDFE 3PQCA 1I2DA 4EFNA 1P7CA 3BOSA 3AP2A 3EZ7A 2BHRA 3NDPA 1C4OA 4BLOA 4BFUA 2ZAMA 5EQTA 5GVRA 2BVNA 3BB3A 2YWEA 3I1FA 1DG1G 1G3MA 4NYIQ 3EIEA 3RVBA 1KSJA 2WKQA 5CIWA 1U0JA 3L8ZA 2R44A 2GVZC 3SU8A 1HT2E 4LDJA 3I72A 3T35A 1KO7A 2ZJ8A 1T91A 1EFRD 2G77B 3NEJA 4FMBB 5KNDA 3Q8XB 5LB4A 1N0UA 4PSVA 2GZAA 1X3SA 3ECCA 1E2JA 4XTRA 5M04A 3GLFB 3U4QB 2X8AA 1HYQA 1M8PA 2QP4A 1ZUHA 2HCBA 3AVQA 3RDPA 4CEHB 3FYHA 1SHKA 4CEIB 5LPNA 1JJVA 2I4IA 2HCJB 1XD2A 2CMKA 1GOTA 2GJ9A 1I4LD 4BZXA 4ZDIA 3P4YA 1UBGA 3QVVA 1IHUA 3KXIA 2WTUA 2O8EA 3I3SR 4UXIA 3SJBA 2HXYA 4JVLA 3C41J 5F9FA 1Z6YA 4PC1A 4TYYA 3U7HB 1GSIA 2C9CA 5CYPA 3S1AA 3FMOB 4FMDF 2JJ1D 4ARZB 5JZVA 3Q85A 5CYOA 5LDDC 2LCFA 1QRAA 2A5JA 3K8YA 3R8CA 4P0TA 2J5XA 2R9VA 4MRVA 2YOHA 1ZYUA 2FSGA 2NOAA 4LV5B 4QFMA 1OLOA 3PIRA 1NN5A 3GLIA 2KWIA 1HEIA 1J90A 1OXSC 4C0SA 1UAAA 1KI3A 1E9DA 2IA5A 5DISB 3T15A 3VR6A 5C2JB 4IEEA 1CJMA 2IEYA 4OBEA 1YZKA 4IKEA 4KODA 3GFOA 2HF9A 2B8TA 4KVGA 3ZDQA 1II8A 1JR3A 3AGPA 3DL0A 1EG7A 1G6HA 3K9LA 2RMKA 3B82A 1NG1A 2QQ0A 3SS8A 1F5NA 1RIFA 4NU0A 1IY0A 4KITB 2WJGA 4A36A 2GF9A 1CF4A 4TMXA 5GJBA 4MITA 4ZCLA 2NPIA 3IBYA 4AYWA 4CEJA 3ZQ6A 2Z4RA 4IVQA 5IK2D 1UDWA 3FMFA 1E9EA 2A5GA 2D4HA 1ZD9A 4HAXA 4Q1FA 4URUR 1P3JA 2CLSA 2PBRA 3CRVA 2GCPA 4E07A 1NN1A 5GVSA 4Q4LA 1VTKA 4EFMA 3KJHA 3AM1A 1R7RA 1YZUA 4DDTA 4NYMR 5DH9A 3GJXC 3CBQA 4UXHA 3TQCA 4MGIR 1SVSA 2YWHA 1C1YA 4MKIA 3T34A 1E9AA 4NP6A 5AJZA 4LWZA 3TKLA 3MG9A 4B71A 2F43B 2OAP1 5TXGA 5EE5B 5C1BA 2X1VA 3LBHA 1AN0A 4IDOA 3UIEA 1WA5A 1XFAA 2GVDC 1KKLA 3I4LA 4D4JA 2P6RA 2PZEA 2UKDA 5FL7A 3RHFA 3H4MA 4PC7A 2GJ8A 4C9BA 1TQDA 2VA8A 4WOPA 1E99A 4DJTA 4JJZA 2W6IA 1XZQA 2ZI3A 4WXPA 1UPTA 3R7WA 2AKAB 4P3YA 3SBDA 3QVUA 2WSMA 3LRPA 4TTPA 2YNMA 1I4TD 1Q22A 2QMEA 3AVTA 4M0LA 2QN6A 2ZUCA 4DSNA 3CH5A 2O0KA 2WWXA 2AD5A 4GOJA 4QC2A 1G3UA 3W6PA 4AI6A 4DLWA 1QVRA 3HYTA 2H1LA 2DFLA 4OI1A 2ATVA 2CE7A 2R62A 4HAZA 3BXZA 4LJ6A 4NL4H 3CNNA 3OEEA 2RHMA 3U60B 1P9WA 2BOVA 1OYWA 2ERYA 3NEYA 4X8LA 3R20A 2VP5A 4PZLA 4ZO4A 4K8OA 4DCTA 1U81A 2JASA 4YONB 4BFZA 3KKMA 4Q48A 1SXJC 2ZYTX 1R0XA 1U90A 4ZIRA 4BRUA 2IYLD 3GLHE 4AK9A 1R0WA 3SN6A 2FSIA 1ZINA 4BEJA 1W36B 1CRQA 4Q9KA 4MUAA 1DADA 1K8RA 3B1VA 3L0IB 2ZSBA 2IYZA 4LV8B 1E9RA 1EESA 4Q19A 5CJPA 2JLVA 4OKSA 3ZIAA 4PHGA 1TEXA 2GDJA 2QU8A 4G5GA 3SR0A 4BLPA 5DSZA 3HPRA 3EWSA 3KKPA 3MRSA 4LY6A 3R9WA 2JA1A 4YMVA 1NG9A 121PA 1OFHA 4RZ2A 3PG5A 4KSCA 1ZU4A 5FPSA 5G3ZA 4UNRA 2ODWA 3BAFA 2GK6A 5JECA 5SZJA 3M1IA 4K81B 2IS4A 4DUGD 2WVJA 2XOKA 1W7AA 2P2LA 1M74A 3JVVA 2IXFA 2ZS7A 3BH7A 1OYYA 1ZM9A 5FOTA 1KJYA 3VX4A 5A5GA 2BMDA 5HKKD 2JLWA 1S1CA 2GCNA 1CLUA 4XIGS 5HZKA 3RYTC 1U0HC 2AD1A 1LY1A 1XCGB 3U6BA 3CZPA 2Z0MA 3QXXA 4Q18A 1Z07A 2GAOA 1YR8A 1Z0JA 1Z22A 2H16A 4ABYA 4CF7A 3ADDA 4E5UA 2ONKA 3EPKA 4AC9A 3TNFA 2AK3A 3W8RA 2PLRA 1EFTA 2QPAA 3O47A 421PA 1DVRA 1QHXA 2FFBA 4C7OA 5EUQB 1G8GA 3THWB 1IN4A 3IHLA 1E2MA 2FF7A 2ZE5A 3FPAA 3PXGA 2FGKA 4Q03A 3HPQA 4QNMA 3K0CA 3I8SA 3HU1A 1SXJE 1NBMD 4JL8A 2VP2A 4DLXA 2WOOA 2W0MA 4A8JC 5BYKA 5E7JA 1YRBA 4E03A 2WWFA 4B44A 1XXHA 3B5JA 3CR7A 3AUXA 3U7GA 4PHHA 1KMHA 2VHCA 1H65A 4R2HA 1N6HA 4P4TA 4B32A 3OAAD 1AKYA 1RYHA 5DLQC 2FOLA 3DMNA 3CR8A 5FI1B 1FNNA 2VP6A 3P4XA 3QXCA 3PJRA 2O5VA 1TUEA 3EASA 3NDBB 1F2UB 3NC0C 4C0QC 4Q4JB 2XZPA 2IK8A 4DLTA 1V5WA 1W0JD 2J41A 2ZSDA 5CK4A 3AVVA 1YZGA 5TARA 3H86A 4NCNA 4RFVA 3N5CA 3EIHA 1SKYB 4IOJA 2YV5A 3LNCA 1NVVQ 1KAGA 3IDQA 5FTKA 4RFSB 1T5IA 1FW6A 3U7FB 3AB3A 4MYUA 3UANA 1E79D 4CRWB 2MSCB 4A15A 1QHNA 4KFTA 3X1DA 3CNOA 3M0EA 2WWGA 4D4MA 3OE7A 1M2OB 2OM2A 3KB1A 4C3ZA 1NJGA 1L8QA 4ZI2A 2IYVA 1Z0KA 4OQLA 3LAWA 4Q21A 1DAMA 2A30A 3QKRB 1MOZA 3EA5A 3BFKA 1Q57A 3CW2A 1GZSA 5H8WA 3AVPA 4JIMA 1OKKD 3SHWA 2ZPTX 1HE8B 2VH5R 2OXRA 1P5ZB 4AURA 1L7VC 721PA 3IIMA 2NMVA 1E2HA 1ZCBA 4U00A 4FINA 1AJEA 3BS4A 1G6OA 1GL7A 5J4KA 2O0JA 4M2LA 4C4PA 3AGQA 5FL3A 3DKPA 2BJVA 2ZRBA 4GRAA 1JB1A 4M9XA 5K8LA 4JL6A 4OHVA 1A82A 1QHHA 2F1RA 3GJ7A 5KSYA 3GEHA 2YHSA 3ZLJA 4B2IA 3THXA 3LX8A 3NBFA 3AVYA 3EPLA 4GL2A 3FGNA 5EP4A 4ERNA 2CNWD 2CCKA 2IX3A 4KBGA 2XZOA 4YMWA 5LB2A 1GILA 2XXAA 1T6NA 2ZJZA 3B2EA 4B3BA 2E1RA 3WYFA 5B58C 3KKOA 2CK3A 5IF9A 1J8MF 2VO1A 2HLDD 1CR1A 3EC1A 3WNCA 3X1ZA 1YZLA 3GEEA 4F4IA 4M1KA 2GWHA 2PMKA 1AGPA 3AF1A 2XNDA 3RANA 1KI2A 5KTYA 3UG6A 3TUIC 2GEVA 1KDPA 1VYVA 2BM1A 2PZFA 4HYYA 1SGWA 5IT5A 4O2LA 2ZJYA 1XEXA 3MFYA 2FFHA 2A5DA 2AL7A 1GRQA 4B47A 1OFIA 4HAYA 4HDOB 4A0GA 3MGCA 3R9IA 1OF1A 4I81A 4V0MA 2CCGA 1TU3A 1HY3A 3ND8A 2PJRA 2ZETA 4MYCA 4PZYA 3PEWA 4NCHA 4OQMA 4CDGA 1D9ZA 4WBSA 5J4VA 1OIXA 3A58B 3AKYA 4DB4A 1OH7A 1MABA 4TMZA 2RGNC 1KOFA 4QXAA 4TQ9A 2D7CA 2HJGA 2J0SA 4PPNA 5EXSA 4DLRA 1JPNA 1PLJA 1U2RA 3VKWA 2VSFA 3D6TB 2H18A 1SVMA 1E1QA 3C14C 5DI3A 3CRRA 3LO5A 3OZXA 4YMUA 3HR8A 4G1UC 1XJ0A 4DBLC 4H9GA 3VHLB 3QPWA 2WSSA 2OUKA 4ESHA 4EPYA 4N1AA 3VR5A 4FXPA 2WJYA 4GI7A 4JL5A 1XP8A 2QMOA 2O8BB 4Q1EA 2NO1A 1G19A 2ORVA 3KQHA 4EJSB 4HZUA 2JJ2D 4DCUA 2OFXA 2R8RA 4GOKA 1CIPA 3F0TA 5SZIA 2XSZD 4RJLA 3MWLA 4II7A 3QQ5A 1B23P 1NRJB 3Q3JB 1ANKA 1OFUX 1U9IA 4QBGB 4QL3A 3CX7A 1X8KA 4HLDA 4F4CA 1EGAA 1ZMXA 4C0LA 1IY2A 5KHOC 2C9OA 4YMSA 4QNRA 2AXPA 5EJEA 3A1UA 3VU9B 4IXNA 4DWJA 4Q00A 4A0RA 1T8UA 2QTHA 3TAHA 1A2BA 5J47A 2FSFA 3MLEA 3SOPA 5FOWA 1Z83A 2D06A 4PC3A 2OCAA 1XWIA 1P75A 2FN4A 4I1VA 4A1FA 1W0KD 4V0NA 3CWZA 4PAMA 3BIFA 2ZRPA 1T9HA 1CULC 3D31A 2ZRHA 1W4CA 2NQ2C 1OPXA 4JVNA 4Q7MB 1E9CA 4OHYA 3GJ3A 2IYUA 2YWFA 4P32A 3KJGA 4Q1CA 1MRSA 1QDEA 4B34A 2GZHA 3I61A 2YYZA 1VHLA 2EW1A 2B6HA 2WPDA 2PX0A 3RS2A 2PCLA 4FMDB 3WY9A 4C0AC 3L82B 4CIDA 3V9PA 1R5OA 1E1RA 5BN3A 2QZ4A 1VG8A 5G53C 1UBFA 4KO8A 3PUXA 1XF9A 5ELXA 1YJ5A 1R10A 1ETUA 5F9HA 4GSYA 3MCAA 4HATA 3FB4A 4LJ5A 1T3HA 3SQXA 1A1VA 3RS7A 1S3SA 1WF3A 1XCMA 4D0NA 5FH9A 4EPXA 1XD2B 1RRCA 4BFYA 1N6PA 3ZVLA 3B13B 3TBKA 1GL6A 3ZGXA 2O8EB 5BXQC 5G3YA 4IDQA 4BASA 5L8VA 4C2TA 3QXHA 1XNJA 2J9RA 5EP2A 3IQXA 1SKQA 2BEKA 3QUSA 4JBXA 4GP7A 2ZITA 3S1AB 2JLXA 2IWRA 4MDFA 2IYRA 3SYKA 2ZUDA 3WMFA 3SHFA 3DPUA 2IUUA 1ZC3A 4Z8XA 3VR3A 1E2DA 3B9PA 4WIAA 5CDFA 1U0LA 3MAAC 4AWXA 5FPTA 3O8RA 4JLDA 2ZAOA 3KZ1E 2G9NA 4YXWD 2OCPA 1LS1A 4KLZA 3RWOA 4LJ7A 1Y63A 3EW9A 4PHFA 1Z0AA 1G8HA 4R9UC 5C46F 4LC0A 2CLCX 3GLIB 4UNQA 5LD2C 1GP2A 1CEEA 3I92A 5GJVC 4DEXA 2IS6A 1T0HB 2TMKA 1NMXA 1AQYA 4FMCF 4LHYA 2N42A 4DCVA 4EIWA 1KTVA 4Z51A 3RAPR 2HYDA 3CZQA 1IJFA 1BH2A 3U44A 4OI2A 1II8B 3D7MA 3NWJA 4KFRA 1W46A 2QA5A 3AKCA 2IUSA 1UKZA 3KDSE 3TJZA 1ZJ6A 4P31A 3SJCA 3IEUA 2GEDA 3B1YA 1G7CA 4LBYA 1O3YA 3CWQA 3QE0A 3ZYCA 1QHSA 3EA0A 2E9SA 4CW7A 4KSBA 821PA 4C0JA 2BCGY 1OHHA 3EC2A 3F3YA 3SJAA 4MQBA 1DELA 2NZJA 1S9DA 4AYTA 1VDZA 4CEJB 3V00A 1T0JB 4PQFA 2C9YA 1NJFA 4C0KA 2CL6X 1N0WA 2REXB 3KJIA 3DZDA 4JLMA 3LDAA 2QTFA 4S35A 5L3QA 4BQSA 4TL8A 1XEWX 1AKEA 2WJHA 4FIDA 2IHYA 2GRJA 2Q3HA 2BEJA 5UKDA 1JQLB 3PR1A 1E9FA 1Q20A 4KVAA 4F38A 3KQKA 3WRXC 4DLSA 2KE5A 2ZU0C 3RABA 1FQJA 2OZEA 2ZJ2A 2VP9A 5FPKA 1J8YF 2JEOA 3B9QA 4TL7A 5D3MA 2CHGA 2C77A 1DAKA 4M21A 4HAVA 4ON9A 1Z6XA 2VF8A 1XMJA 2ZI4A 3A1SA 3MSXA 4Q4AA 1R8SA 1OB2A 5LBIA 1MO6A 5AWFC 4Q7LA 2C04A 1R4AA 2G83A 2ZM5A 3UATA 1CR4A 1G9XA 2J46A 4PX9A 3R7WB 2RKOA 5FPYA 4NCKA 3WBKA 4TTRA 5KYKA 2PEZA 3I32A 5K8UA 4LYJA 4BGDA 5EXPA 4DSUA 2P5TB 1NY6A 2BMEA 3EZFA 5SZHB 3L0PA 1O87A 1ZRHA 1DAHA 1XTIA 3DOFA 3VR4A 2QAJA 2F3RA 4PO9A 5BW8A 2GJAA 1IXSB 4LX0A 4NYMQ 3LW7A 3GP8A 4B3GA 1MKYA 4PQYA 5J4LA 1R6BX 3U3MA 5TV2A 1RVDA 2DWQA 2QUZA 3H1TA 1X8LA 1KK3A 4V0OA 4ZIRB 1D2MA 4M53A 2GXQA 3TMKA 3TGPA 2FDCA 3R9XA 2EYQA 1JNYA 3FFAA 4IOLA 4L9WA 4OK6A 4OQNA 1IONA 3SFVA 1E9SA 3FHOA 5H68A 3WRYC 3ZVMA 4R71A 4JVMA 4NCIA 1DG3A 3U2QA 2QAGC 4Q9JA 4LHVA 5FBQB 2QG6A 4B3XA 3WNDA 3FOZA 1G7TA 2F7SA 4DSOA 3PV0A 4V03A 2F9MA 3MD0A 2FPLA 4RZXA 4FW9A 1ZIOA 4URYR 3PUVA 4RKFA 5JRZA 4MKFA 1Q3TA 4TLAA 4XSHA 1M7GA 2JCSA 2OT3B 2WHXA 1SVLA 1CTQA 4HLUA 2ZS9A 4NE2A 4B33A 3TRFA 1KY2A 1UEJA 3RRNA 3LBIA 2QE7A 2WWWA 2ERXA 3UK6A 2CBZA 4QBHA 5FR1A 3ADCA 3P27A 4IJMA 3O8BA 3H0KA 4XVRA 1W36D 2WIAA 1J99A 1KO5A 4DCNA 3DKVA 4TYQA 1IN8A 1Q1ZA 1W44A 2IYYA 3EX7C 4R98A 3T1TA 2JATA 1U8YA 5FBLB 2FSHA 2F3TA 2VP0A 1VCOA 1Q0UA 5FTNA 3ZQJA 3AV0B 3QBVA 1NSFA 3GLHA 3HU2A 1NI3A 1MH1A 3AP3A 2Z5FA 4XH9B 5KNBA 2ZR7A 3I62A 1E6CA 2W58A 2Q9AA 4JVSB 1VECA 4M1YA 4AD8A 3TAUA 4O25A 4TT3D 4DC9A 2GNOA 2PT7A 4LK2A 3BJIC 3VQTA 4B3CA 1VCIA 3CF0A 4DKXA 4C7OB 1KDTA 1G7RA 2HUPA 2ZJAA 1GNPA 1NBME 5DN6A 2R2AA 3GD7A 4OHWA 3ZZUA 1JEEA 5C18A 3VR1A 3EPHA 5B2ZA 1TQ2A 5KDDA 2ZI7A 3CX6A 1XTQA 2V6IA 5TY0A 4IOKA 1FUUA 4KBFA 5DHAA 1KSHA 2QRNA 4QHYA 4B73A 2NO9A 1NF3A 1TTTA 2H17A 1XXHB 1BKDR 4DIDA 3TIFA 4FCWA 1KMHB 3K70B 1XTJA 1NKSA 1XMSA 3DO6A 4QGAA 1E2FA 2H7VA 2A5YB 3QY0A 2EU8A 4PQRA 4Q7JB 2WSSD 1N25A 3GLGE 1GTVA 2JDID 2W2VA 2YC2C 5DGXA 2KI5A 1B0UA 2RGGA 1T4GA 3SYNA 1LW7A 3NH9A 1LS6A 2HYIC 2AX4A 4AKHA 2GJKA 3G82C 1QHIA 5FTLA 2GXSA 3AP1A 5FBWB 5EP3A 1DAIA 3RRYA 1G17A 5DI9A 2XJ9A 3PENA 4PZZA 1N6OA 1V43A 2BIFA 1BS1A 4JT4A 1M7BA 5SZKB 3LW8A 3LA6A 1BIFA 4V0KA 2VLIA 2ZSFA 5A0FA 3EIQA 1KSGA 2B21A 2R6AA 4OI0A 4MRNA 2DHRA 4LSGA 4DLUA 4BFXA 4YLGA 3ZH9B 1EXMA 1MO5A 1KHTA 4G3XA 4ASUA 1CP2A 2QPTA 1ZUNB 1SXJA 1GIAA 3OIWA 3FHTA 3BERA 4PANA 2D3WA 1VYTA 4RSGA 4B2PA 2QP3A 1YE8A 2RHDA 4MRSA 5AJYA 1OXUA 4JT2A 3L0SA 5CLQA 3RRZA 4B74A 3K0EA 4UKDA 4IDNA 4A6PA 1COWD 1Y3AA 3LQRA 2DCUA 3KXLA 1JPJA 4BEBA 4M8NE 4GMXA 4OK3A 2IF0A 2FH5B 3BD9A 5FFMA 4QKQA 1NN0A 1TQ6A 4RZ3A 3U3OA 5TB5A 1QHHB 1T3LA 4DDUA 1IOZA 2DYKA 3QI2A 1ZD1A 2Z43A 4TQAA 3THXB 1LNZA 2JIZA 2MMCA 3P32A 4I4LA 5DO9A 3RC3A 4QJ3A 2IF2A 3IIKA 5K8IA 2EQBA 3CUEF 4EPWA 4XSGA 3TVDA 1VCNA 3V4FA 2XXAB 2BM0A 4A2WA 3NG1A 1HURA 4HUQA 2F1JA 1E96A 3ETLA 3GPLA 4NTZA 1T5LA 4LOAA 2IUTA 3QF7A 2GKSA 2VSXA 4FCVA 4Q9HA 1YU9A 1NL3A 3EWAA 2Q21A 4IDHA 3VX3A 3KFXA 4Z1MA 1GRNA 1II9A 1UF9A 3H2YA 1D5CA 3LVRE 1GG2A 2ZRJA 1Z63A 3VFDA 1N5LA 1XEXB 1AGRA 2BWJA 3AF4A 1FX0A 2Q0HA 3KB2A 4MH0R 4Q47A 2BKEA 4TLBA 4D6PA 5JRJA 3RLFA 1OH5A 4B43A 2FEOA 2OHFA 4JJKA 5L3SA 4XD7A 2CJWA 1NIPA 1VHTA 2VYFA 4KFUA 3K0SA 2V7QA 1M6NA 4QG7A 1R5NA 4DDWA 1G4UR 2OCYC 3E70C 4AY2A 1IN7A 1T3SA 3KXKA 4D4LA 1E32A 1MABB 4F4JA 2F55A 3BWDD 3Q7QA 4I1SA 1WCV1 2VP4A 2QSYA 1Q44A 3OEHA 1G3QA 1FPMA 2EFHB 2HJVA 2J45A 4J0QA 4LPSA 5DI3B 1KO4A 4AKEA 4TZ6A 3NBXX 3BB1A 3C16C 4OHZA 4JLPA 1NNEA 1US8A 4A8JA 1CBUA 3CH4B 3VAAA 3CONA 1G8FA 3ONWA 2UVQA 1SVWA 3QOFA 2ZYVX 2X2FA 3B8HA 4PAQA 2ZRFA 2ZTSA 3KL4A 3BH6A 4URZR 2IHBA 1DE0A 4TQUS 1CRPA 4HZUB 2V9PA 1QHYA 2RB4A 2JLQA 1RRPA 3WNBA 3SBEA 1MV5A 3GQBA 2ZE6A 4WXRA 2ZR9A 1W4AA 1H8HD 4NHOA 1BMFD 1JAHA 2IYSA 3QEJA 2WICA 4BWYA 1X6VA 3WHLA 1ELOA 4TSFA 1KIMA 4TLCA 3ZVRA 2O8CA 1PZNA 1G8PA 3W8NA 1TEVA 3H84A 1G64A 2BDTA 2OAQ1 2W6JA 3CKLA 5CIQA 2J7KA 2IYWA 3NIBA 2IS1A 5HE8A
chains in the Genus database with same CATH superfamily
5A6ZA 1ZAKA 5IFPA 1Z47A 3OE1A 2B2NA 1S4QA 5LOVA 1YJBA 1K45A 5HCFA 1WW8A 4GL4A 2CNLB 1M10A 3I9V9 3GLJA 4PIXA 4K88A 2N0SA 4ZKEA 3D6AA 5D2AA 1XZHA 2V1UA 2WFZA 1WLSA 2E44A 4B5LA 4O4LB 3TSWA 1UMDA 5FAXA 4MS4A 2Q3BA 3ZR6A 2Q8DA 4Q16A 1NQDA 2ODQA 4XOUA 1SA0B 4WCFB 2WYUA 2VZSA 3P3PA 1U3TA 4N76A 4H4DA 4FMCB 2V9KA 4UJ3A 4K0KB 1HNZJ 3AERB 1FB5A 3PTWA 2HHUA 1BDMA 2VW1A 1VPDA 1GKBA 2CVHA 2A94A 1SJ9A 4FYVB 1X7HA 3N6RA 1EDDA 4W50A 4N48A 3IO3A 4M36A 5G41A 2CNOA 2WJIA 1CPYA 3LC1O 5KT6A 2GO7A 2XWJI 4D80A 2KI2A 5GAEI 1WD3A 3DP9A 3G2LA 1ZH2A 3RI3A 1AQ6A 3KOZA 2G88A 3GN2A 1UPCA 1U99A 1V5IA 2F1FA 5JI2E 1G16A 2ZK7A 3EH2A 3A3PA 3QG1A 1KAMA 1O6UA 3SX0A 3QJGA 1GUAA 3LPCA 2ZRKA 4FYHA 2EFCB 1RUH1 2VF4X 3FKQA 1S0EA 1Z5PA 3Q12A 1I4EB 1JIJA 4JYBA 2ZYUX 2GAUA 3ANTA 3KETA 4F1KA 1VYAA 3GJRA 1A71A 2C99A 1PC5A 1DEHA 4E0BA 1PEDA 4F1WA 2BKOA 4BO7A 3A25A 5E2BA 4YFZA 5EZYA 5JHGB 3HVHA 1FK9A 3NTOA 2A6YA 4D3SA 1SVOA 1E2IA 2QL7A 3EPRA 2DT9A 3W61A 3I0SA 3MM5B 5FFOC 5HTKA 5FWYA 4RN5A 3ZDDA 1D2NA 2FEMA 5F3IA 1VRH2 3AY0A 5CLIA 4AK3A 3W5DA 4ND8B 2RDQA 1H30A 4H15A 1SC4B 4RYLA 4KSYA 4M9RA 3RYCB 3DUFB 1B0PA 3H2SA 3PZRA 3B1FA 1CU1A 3VKVA 4CZCA 3C7DB 2NIPA 4L0PA 1J21A 3QPUA 5JLAA 2QC3A 2XY5A 4CLFA 1ONOA 3H3JA 4LF7F 2I6TA 3NBAA 3DVLA 3FGZA 5FO7B 3PXCX 2X4IA 3WGUA 3RO7A 2QLTA 1HM5A 1YZYA 3E5RA 4A48A 1W2HA 3RG0A 3CO2A 5AJVB 1HETA 2JIZD 2ID9A 2OT7A 4QAJA 4A45A 1Y5RA 4I4CA 4E15A 5F98A 3IO1A 3RSLA 1A6LA 4AVVA 3DXBA 5AVVA 3BAZA 4RU1A 4LGMA 4RNMA 2QVXX 3JD2A 3P9IA 3F71A 4ZWNA 2YNGB 5A7HA 1QNLA 5J2TF 3LOUA 5KFUA 4OU4A 2PEYA 2L08A 2AOTB 2ADEA 3SS9X 4YN3A 4EO7A 2R073 4LBMA 3VAYA 3HU3A 3JATA 3RZJA 1X9SA 2Q1XA 1F9HA 4RTLA 3ZKAA 1QGED 3DLGB 3CMGA 3AESB 4Y33A 4IJ6A 3PT9A 2WN2A 2DPJA 3F8TA 4OH7A 2VHQA 1RB0A 3ELUA 3N9QA 1XC6A 3AJ1A 3MR7A 3GRCA 4MW7A 3R4SA 2M7SA 4IIEA 3N9PA 1CUVA 2DWRA 3ZWMA 5L1KA 2VJUA 1H2ZA 3L7CA 3LDHA 1YZFA 1QFMA 1S0NA 2MSKA 1PLLA 4Y2GA 3KG1A 1LBTA 3R44A 2WSEC 3CSKA 4OFGA 5KQRA 1TJ4A 4OUMA 4GI2A 4ZP9A 1TL4A 2JEIA 2OIHA 2JDHA 2XVLA 1B09A 2AJBA 2H1SA 1QQ7A 2ZE2B 2CQ0A 1SC3B 4TL9A 1EUYA 1LBEA 3DDWA 4JKLA 4H77A 2IYAA 2NZ8A 5LT5A 2ZU6A 4JOQA 5F78A 1N7IA 1LTKA 3QU5A 3W5NA 4FNOA 1ZD4A 2OXIA 1D4OA 4IL7A 4UTXA 4HDGA 2B69A 2J6HA 5FPXA 3DLCA 2G3YA 4M3CB 1NI4A 5C5IA 4HDSA 3AYZB 1H2RS 2PT6A 3T3PB 3GZ4A 5AW2A 1AHHA 5IUKC 2GAFA 3HNOA 3WF4A 3RUEA 9ATCB 3CUVA 2ZYGA 2FW0A 4Z2XA 3IFSA 3OL6A 3G5UA 4MI1A 5K0SA 1BVRA 2NU6A 3N6MA 2OD7A 3FNGA 1OMIA 5LEJA 1TM7E 4WNYA 2MB0B 4BYYA 3DLKA 1WBDA 4QPNA 4O4HF 4ZU7A 2MZ1A 3DPRC 3DD1A 2O2ZA 3EGEA 4YZ4A 1TLTA 2VEDA 2FZ5A 1VBD2 5FOXA 5BNPA 3R5HA 3R5XA 3JQKA 4GC6A 3HXQA 4M1EA 2DRAA 2O2SA 5DMXA 3DXYA 3J7AC 3AHEA 3DOEA 1G63A 5I9LA 2EWWA 4Y2HA 1N9KA 2BFBB 2J1TA 5FYQA 3DLTA 2J0SD 4X65B 4DUZJ 4B6SA 2RIPA 4RD0A 3FMPB 3TQSA 2VQSA 1U6BA 2MXYA 2A5FA 2QL5B 4XRGA 5H59A 1Z4NA 2A9PA 2XUGA 1IHXA 3E8SA 1KJNA 3BHNA 1IJEA 3FHIB 2ZM6B 4JXXA 1HUQA 5EJMA 4LJHA 4RD2A 1QX3A 4RZUA 2GYVA 4WK2B 2ZGPA 5LQSA 2B0GA 3QEBZ 1LPOA 3B3QA 3OZFA 2NU8A 2YIVX 1WQ1R 2VRCD 4YREA 4YCSA 3KLNA 2K8GA 4GA9A 2HFSA 4ESOA 3QUAA 3DNPA 4NZ7A 1JA0A 4NR0A 2ZGTA 1XL1A 2D8AA 1SG6A 3JQPA 5CDUA 1A1SA 3NV3A 2HPVA 3MJRA 5GV8A 4MW6A 5HOQA 1HMVA 1EK6A 2LRPA 4G63A 2BRKA 1EUQA 1OTHA 4NYIR 1O7FA 2HJIA 3DYBA 2W5FA 2BGRA 4AGRA 4MUIA 5AM5A 1M06G 4D6XA 2AZXA 2PQ2A 4Q4HA 1XKXA 2PGXA 4RK4A 4URHA 1T24A 5J48A 2NP0A 4Z9BA 4R6XA 2C8KA 4A0FA 1N6LA 2PX2A 4Q4X1 4JLVA 3K2OA 3NXKA 4HQ6A 4C6HA 4PWDA 4V1CI 2P1BA 4M83A 1NJ8A 1DJLA 1LSSA 3H8RA 1NVUQ 2HB6A 4YJGB 5J2UA 1NYWA 3I49A 3U9LA 2Q1MA 3M6AA 3EAFA 4MR9B 2QSJA 5FRAA 1GAQA 4DV7J 5KFJA 3DBRA 1I3MA 4DABA 2A7AA 2JLFA 4EO8A 1FMJA 1WRBA 3OPXA 1ZBA3 4CEIA 2OZVA 4OKIA 1QRRA 4RO0A 1TCCA 2W46A 3OXGA 1X7DA 1ID8A 5JR2A 1EMDA 3OIUA 1CUEA 4N5DA 4Z0HO 5HJXA 3RYIA 2GAAA 2Q5JA 5JSKA 1XEFA 4ENPA 3DOLB 1X42A 1X80A 1FRXA 1P73A 3FMIA 2K5UA 5KHIA 5C1OA 3ER6A 1XZKA 2XTNA 4NXNJ 2EVXA 2BRUA 2E66A 2UUWA 1V3RA 2IELA 1XE8A 3V6LA 4I9GA 5DNEA 2YDEA 2HCTA 3NJYA 3OL7A 1JDBC 1EP0A 3MICA 3UCGA 1EEXB 2NQ8A 1UY2A 5HQ8A 2GP3A 5ERGB 5IHRA 2AACA 1FMD2 2GZRA 1HMPA 3RE1A 4I6WA 4U1RA 1JLAB 4IYRA 2WUWE 3QFHA 3K4AA 2CL7X 4Z9AA 2OSRA 2HF7A 1RAIB 3H2JA 2ONCA 4X24A 3AZOA 3EODA 1V8FA 2G6TA 3OJCA 2ZX4A 3BK7A 3OJLA 2IMWP 2AIRB 2GZ3A 1U2TA 3SYRA 4K3UA 3ZTQA 2JLZA 4WLUA 2J6IA 3RI8A 2NXUA 3I09A 1KDNA 3PX0A 4OGGA 2ZBQA 2OV2A 2CXOA 3MM6B 4ARIA 1EX9A 3H1FA 3DKKA 3R4UA 2OVFA 4M5KA 4IIUA 3NO4A 4OYWA 2QE7D 4KWUA 4LZOA 3UG7A 1WXHA 1X9MA 4KI5M 3PFNA 1XTVA 1Y3BE 3ET5A 3UAOA 4ES8A 1ZDMA 2NPFA 4L02A 3LLSA 2R79A 5KNCA 1F7UA 5DLGA 2H2HA 4RIFA 4NBRA 2HSWA 3D54A 1XP5A 2AMFA 3UMSA 3LCUA 3O83A 1RIRA 3UH0A 3OU6A 1ITZA 3REQA 4BGVA 4Q01A 3KWVA 3HRHA 3GFZA 4OJGA 5GZFA 2QEXS 2RJOA 3S99A 1W49A 3DE3X 4QFCA 4JAAA 5B3JC 4CCJA 1RYFA 3TLGA 2GTPA 1ZZGA 3TR0A 4KU7A 1S9HA 1EAH2 1HFJA 2PQ0A 2ATXA 3UK0A 4YP6A 1W87A 4COYA 5IASA 2R3VA 3A4NA 3UV3A 1UVLA 3TIXB 3PSHA 4GECA 5JDIA 3L1JA 1OX6A 4Q02A 1GGNA 2O59A 1CRWG 4OZ1A 1AT1A 1GZCA 1S1AA 4Q0BA 1UC8A 2R7KA 1N9GB 5KCZA 2DHCA 4XBQA 1DB3A 3L7IA 4YQEA 1XMQJ 3OW2R 4CEWA 3AHPA 3KSDO 1KE2A 2CQ3A 4C2BA 2P6MA 2YQ3A 4XVQA 4ER8A 2C6SA 1B0TA 2MLYA 1CY6A 3UJ6A 2IY9A 1RA7A 4Y2VA 4DS5A 1F2UA 4K5SA 4WJZA 4M0CA 1A8PA 4RV4A 2RDNA 3IT2A 4IHJB 4LVOP 2HHXA 1K5MB 2R7OA 4R4XA 1LQTA 4DXDA 3BDIA 4OX9B 1K7FB 1OH3A 3LALA 5KO2A 2Y1LB 1SFNA 1NU4A 2IXGA 3LAKA 5DG2A 3TSOA 2A9QA 4F72A 1U4NA 3LFIA 1RUG2 1M2VA 1KOLA 1XCJA 4Y2PA 4WK3A 2PR7A 1RYMA 1Q8KA 3CG0A 3VPHA 3CLKA 3ONDA 4FOPA 4H1UA 2XNJA 3LRXA 3CJ0A 3OBRA 5KZMB 3K6RA 1NCRC 2PTHA 3AF3A 4HDNB 1VMBA 2NLRA 5LJ5Y 3G8YA 1JXNA 3BB5A 1R0AA 2BE9B 1U0OC 5KWIA 4ZVKA 2ZBCA 1XLTA 3PUIA 2HBYA 1UBKS 5JOYA 3RUHA 4UBKA 4K6OA 4KV9A 4ZKTB 4EARA 2XOEA 4XDCA 4XIJA 3UPUA 4GB32 4FMPA 1T2CA 4GD3Q 4MWDA 1Q1AA 5DDIP 3BFJA 3ZHSA 3H2LA 3K2QA 2WSVA 4KX5A 4UFJA 2ZTLA 2FWPA 1H8HA 3JALB 1T9WA 1OX4A 3TXYA 5IVDA 2A3RA 4ZVRA 5AKEA 3ZOZA 2V74B 3AETB 4RHCA 2EKQA 3PVBB 5LLSA 1QGUB 3JRNA 2O8BA 1UJMA 3UC5A 4WJLA 2UP1A 1TZKA 2IUEA 3T38A 3GMTA 2O8FB 1GWNA 5L9VA 5EMLA 4RW4A 3TW0A 1AUSL 1RUJ2 3WFZA 3DPIA 4F12A 1I94F 4AF8A 3JVUA 5HZGA 4E5VA 1OYVA 3GJ0A 1MT3A 3E58A 3SCIE 4UHJA 2RJ3A 2HQBA 3GFFA 5FUWA 4NPRA 5LMUB 1R8XA 3CUNA 3SLIA 3GJBA 3LQCA 3HXLA 2FAXA 3LZCA 3QQPA 2LQBA 4DS3A 3TG8A 2XI2A 3WVNA 1KSJA 1ZIDA 1JLCB 3SU8A 4ZJQA 1T91A 2EATA 3W5VA 2GJ2A 2FPIA 1BWSA 1D4ZA 4D5GA 2KS6A 5D3GA 4RY0A 3WDXA 1JVBA 4ID8A 2P37A 2JDKA 4WKBA 4HNAA 1UXZA 5KNDH 5JH7F 4QIHA 2XMUA 3IUBA 3NHLA 4MIEA 1QGOA 3ZXYA 2PIDA 3UW1A 3EY4A 3K8YA 3B9RA 2QXUA 1KYTA 1JYFA 1Z7S1 4MMOA 2LEAA 2IA5A 2DR6A 5K20A 2B5OA 6AT1A 4YW7A 2ZX3A 1D6SA 4B3IA 4E5NA 4ANDA 3PY8A 2OD6A 1GD1O 2QQ0A 3MGKA 3PQFA 5L7OB 3UWPA 4B3OA 3UNPA 3HN1A 5C24B 3D4IA 4URUR 5C3UA 2PBRA 1YZUA 4M3NA 2ZGVA 3K17A 4RCVA 3DOMB 1H2VZ 2QN1A 4AZWA 3IC5A 5IDYA 1M1YB 1BNCA 2VA8A 4BJHB 1E6EA 5FY0A 4AAPA 2Z69A 3QVUA 4WDRA 4TTPA 1Q22A 1S1UB 3IS9B 4C98A 3IMEA 1IYZA 3OBTA 1V1RB 1VKZA 1GZ4A 3HYTA 1AYM1 3JX9A 5KYUA 4PAAA 2YV2A 5AM1A 4LZAA 3V34A 4HNUA 3RGBA 1CAWB 1RJDA 3PX3A 3B7PA 5FBZA 3VBFB 4X64F 1QH8A 2DV9A 5I7OA 2ZJ1A 2Q30A 3GU0A 3Q3GE 2TS1A 2Y1WA 1J2TA 3NS5A 2L9LA 5FOQA 3DH0A 4LVCA 4RNHA 4LV8B 1EBUA 2I87A 4YW3A 4Q19A 2JLVA 1DHKB 3C74A 3WIDA 1WXEA 2CFTA 1GT91 4REQA 4BNZA 1AR71 4B3RJ 1THZA 2YKNB 5C7IO 1KRIA 2IA0A 4NBUA 3GUUA 4EU0A 2GTIA 4MB0A 5I7AA 4E5SA 5K8SA 2CWDA 5H4HA 2GN6A 3AX4A 2Q79A 2DBRA 5CFDB 5JZGA 1GFWA 3HP7A 4LZLA 1ZM9A 2JLWA 3NL1A 2VKTA 4F4ZA 2AD1A 2G7ZA 5LATA 3LX4A 1Z0JA 2HRDA 4KPEC 1S1WA 2PLRA 4D9MA 1AF4A 3HPQA 3P3NA 1WTAA 2YVSA 1SXJE 3SXWA 1S9EA 1YRBA 3WC2A 5FBKA 2I3DA 1MS0A 1XXLA 3TF5A 3QWAA 5KFRA 3RRXA 2FOLA 5KHJA 3NDBB 4LFAF 3PU6A 4JT8A 2Z1NA 4XQWA 4CP9B 2ZIFA 3ZKWB 4G4FA 4K4WA 1F0NA 4Y2JA 1KAGA 1DKLA 4UHEA 4QU8A 2AYZA 5B6PA 2C2ZB 1UFOA 3C6QA 3RSJA 3LT1A 3WV5A 2HQ3A 2WWGA 3ANSA 4IV3C 4JYAB 3RVHA 3O1RA 1JTVA 3COVA 1IM6A 4J0EA 2JENA 2ALYB 3KT7A 2ZPTX 2NMVA 3FSXA 3TIVA 3HLTA 2QVGA 4CM4B 4ER3A 4HQFA 1NLRA 1X9GA 4SLIA 3MWGA 4X1OA 4JR0A 1YXWA 2ZWIA 1XYPA 4YJFA 4GL2A 2CCKA 3G13A 5GM2A 1G7YA 4MT1A 1GILA 2ESRA 3KKOA 3SZ3A 2F8HA 3FJSA 2OQIA 4FFFA 2QMUB 1RJWA 1NA5A 3CIFA 2A1IA 1VYVA 5IWAB 3TZEA 1AURA 1F8FA 2JIGA 3M8LA 3EFEA 1Y34E 3MFYA 5J2MB 3GRAA 1FU7A 5GMKa 1N1SA 3IXMA 3JYQA 3QVXA 3MGCA 5A0VA 2PLWA 4LXTA 3UUWA 1WEYA 2EIEA 3KJNB 1OH7A 4TQ9A 2QGFB 4NYPA 5ALTA 2J0SA 2QUIA 3D6TB 5DI3A 4F9EA 2CPYA 5KOXA 2V6FA 4WSOA 4DUVA 5IZCA 3NT4A 3ET6B 4KQWA 3VISA 1WI6A 2WJYA 4LRUA 5KBFA 4EJSB 3HCAA 5BVGB 4HVTA 1RD4A 4UU0A 4DCUA 2JKXA 3F0TA 2BFUS 3NNDA 2JBAA 4DSFA 3KUXA 4ILRA 3HKCA 5B55A 1JYIA 1NRJB 1ANKA 2VQEB 3IKTA 1R6AA 3D2LA 1TKDA 1ZMXA 2VRCA 3MECB 3GQCA 1RWBA 4YALA 4IMJB 4TXJA 3BKUA 3ETHA 3U1TA 4A0RA 2YY6A 3R5JB 1UKCA 3OQIB 2OHJA 3V42A 2OPSB 1XWIA 2OCAA 1TDJA 3UN1A 3CJXA 4A4JA 3OOWA 5ENVA 3B3AA 1SOAA 3T8YA 3QPCA 4Q1CA 3L4JA 5IVVA 4Q3KA 4RK1A 3MM8B 2OZPA 1UBFA 3R3TA 3KQRA 5ELXA 3MELA 4G8JA 1KYVA 1U25A 5F9HA 1XQVA 4BHTA 2AYXA 3P5BP 1WF3A 3VHPA 1X7ZB 1N6PA 2HGSA 3TBKA 3LTEA 1K0FA 4RXMA 1UZ0A 1TYZA 3QUSA 4BKQA 1R4MA 2VG7B 2PH3A 4O4LF 5SYAA 1VQ9S 4JR1A 4UF0A 2OZLA 4DEQA 3O8RA 3GX1A 4YXWD 3ADAC 1DJNA 4P73A 1YQQA 3BB6A 2JHAA 2B2CA 1LEHA 1T0HB 5F2SA 4FMCF 1RUOA 4K0KF 5KFYA 4UBNA 1U0FA 1VJ2A 1OOEA 1BH2A 3U44A 4HXYA 4ES9A 3L8FA 2Z04A 4NZOA 2GEDA 4Q3LA 1RWNA 4F0HA 3LQKA 2BHLA 3V00A 1TMGE 1NJFA 3KJIA 2REXB 4GWKA 5K3DA 5IVCA 2GPTA 2YZMA 3LDAA 1RC6A 2C5EA 5KYWB 4FIDA 4ZYWA 4PG8A 3HSDA 2ILZA 4NHYA 8RUCA 3NNFA 2A10A 3D0IE 1YJAA 1K0TA 1WOOA 1YVEI 4TL7A 5KX5A 2CHGA 1DAKA 2ZSKA 4X9XA 4NLSA 2DXEA 1G9XA 2FZWA 3M6LA 4PX9A 1REQB 5FPYA 4FYDA 1UBJS 2CY6A 4B3SJ 1O4ZA 3M3HA 3EF3A 1GP5A 4J37A 4CM0A 4N41A 3PX2A 4QWEA 1RT1A 4NYMQ 2VN8A 2GVZA 3L84A 2CXEA 4EZBA 3G2JA 2ZQYA 3RTEA 3SZMA 1YBUA 3WE7A 4BO8A 5EC8A 5KFVA 4OK6A 4CMIA 1DFDA 5H68A 1LGNA 3C16B 1EE2A 2RHWA 1YO8A 2RJNA 2KU7A 4YGYA 4AZ3B 4LKOA 4I1PA 4M63A 1PFKA 2WG0A 1G7TA 2F7SA 1WHXA 4ML3A 3HQUA 3C2QA 1QHEA 1LJLA 4FW9A 4CUBA 2WP8J 3ZPXA 4HLUA 5EL0A 2BGOA 1QANA 4LF6B 3EISA 3DV8A 1PE0A 4CL2A 2QE7A 2ABWA 2JFXA 2Y4NA 1R9GA 2AFHB 3TA0A 3A1YG 4B3TF 4P74A 1T1IA 4A3ZA 4OBBA 2FHPA 5K0EA 4F26A 2N1MA 4R8VA 2JFYA 1W8ZA 1K5MC 2GZ2A 3LPNA 2BGNA 1EK2A 2ZT5A 1XR6A 1QUVA 4RELA 4G23A 2JGIA 3D3WA 2CQDA 3A9TA 3O84A 1H38A 2BJ7A 2QR5A 1PVC1 1NF3A 4J3FA 1XXHB 3RWKX 3JQBC 4XDPA 3HKZD 3FOEC 3K70B 1BD4A 2AQIA 3A12A 3PNKA 4PQRA 1Y5NA 5AQ1A 4MV5A 5B0EA 1P1LA 4CH0S 1B0UA 1TVKA 1AB6A 3H1BA 3FSGA 5DNUA 5FBWB 3O7WA 1N3QA 3NV1A 1DAIA 1RT3A 1LPNA 1DG9A 3NHYA 3UGJA 1V43A 5SZKB 2BTVC 3U0BA 4V0KA 1XRMA 1C3XA 4LXQA 3KT1A 4AP9A 2DHRA 4LSGA 4DLUA 3H1YA 1A50B 1KEEB 4BX2A 5L95A 4ZAYA 1RUI3 3BD6A 1CPZA 1I0LA 2GJFA 3CZ4A 3ZV3A 3N2NA 3IDCB 3S2YA 4B6JA 2G9FA 1S2NA 3HEBA 4YMGA 3M3EA 1VQPS 1I0ZA 3UJ8A 3RBXA 3MUMP 1RB8G 2DCUA 2G76A 1ZAVA 4ATFA 3CD5A 2Q4DA 3P0RA 3MCTA 2H0RA 4JI0J 2IF2A 2VBFA 5D21A 3WTBA 2BFCA 1KQPA 4YGXB 3ETLA 1SKSA 2VNJA 4DGQA 3T3NA 1VPVA 1D8AA 4QXOA 1Z4MA 3G6VA 2ZAHA 1GRNA 1X7WB 5CD9A 3LL7A 4H18A 5F5IA 1D5CA 3JCIA 4M86A 1OH5A 4LHSA 4PGMA 3CCCA 1ZVVA 4ZT6A 4DDWA 4ZN3A 1PJCA 1R0SA 3AZQA 2RHPA 1S7HA 2RRNA 1MABB 4M3CF 1QY7A 3CQOA 5DCLA 1G4CA 3J81Y 1ASJ1 3N0VA 1O6FA 5E3AA 4ZS2A 4ZCSA 5JD4A 1A9XB 3VAAA 3MERA 5LXYA 1NV9A 3CONA 4RAOA 4UPVA 3B8HA 1X74A 3B3QE 4KXWA 1CRPA 4URZR 2W1QA 4TQUS 1LJ7A 1OA3A 1QHYA 2CNKA 3MWEA 1QLHA 2VPTA 4MVJH 4KL1A 1M5HA 2KTQA 3EM1A 3WHLA 5BUSA 4TLCA 3B3FA 3BWBA 3X2FA 1D3WA 1BEUB 3EXEA 1ECJA 4H7FA 5K14B 1LW2B 3MMCA 4JLOA 3W9AA 3A6FA 2R7LA 3X1MA 4OUEA 1UETA 4L28A 3OT1B 4B0PA 2A2ZA 4WW0A 1XNBA 3BKZA 4K9NA 3KLBA 3NORA 1OUXA 3LBYA 4AZZA 1DZIA 5DIFA 4PXEA 5AM2A 2ZM6F 2IXDA 4YVWA 5GONF 3OZIA 2RGBA 2FSVC 5L7OC 1GMUA 1QJU3 5TNXA 1HBMA 4MRRA 4PO8A 3O1JC 2BF4A 3N4WA 1P7YA 4OAOA 2G4VA 5LASA 1H2HA 2PRSA 2FZEA 5LP1A 3HSKA 1KU0A 4TUYB 5EWLB 2IHR1 3OUUA 3PXBA 1Q53A 5DU2A 2DUQA 2IZ7A 4Z07A 4TKZA 5CBLA 1PYGA 1UOGA 4X7RA 2WL1A 4JTOA 3JVDA 3AH6A 1W3VA 4YT5A 3PDQA 1IJFB 1GVNB 3KHRA 3LY8A 4AFFA 2ZGRA 4TXSA 1USGA 3C46A 2V4AA 2PKWA 1I5ZA 4J9RA 5K0UC 3AUAA 5ICGA 1VE6A 3L0OA 5F5XA 3LQ1A 5FOUA 5FP7A 3VBFC 3POJA 5FBJA 3A28A 1LVHA 1W7WA 2AR7A 3BA6A 1LCIA 2D1RA 1RHJB 1UBLS 4C2UA 1NXSA 3K09C 1TZ2A 3NH6A 1C9YA 2P7IA 1X7YA 1CJUB 4BFVA 3NWPA 3U7QB 1KEKA 3F4KA 1NLYA 2MDTA 5G0VA 2QSZA 3A05A 1F31A 1BMDA 4DVJA 5CFDC 4XPVA 3PJ9A 1L5HB 3Q5DA 3DMRA 4QQKA 3R9XB 2H5EA 1UPUA 1NHUA 1N3LA 2I71A 3SHQA 4JJGA 1YU6A 2ZVSA 2QYSA 3KLPX 2DECA 1A5SB 2NUPA 2R4TA 3N8DA 2ZX2A 5CIYA 3LH5A 1HRKA 5KWVA 2VPWA 4KY3A 2Q66A 3D8HA 1H9BA 2COKA 4RQTA 2J8AA 1E0SA 3NCTA 2F6RA 2G1UA 3HKDB 4INDA 5BR1A 2J5RA 1EFCA 1ZWKA 1CY8A 3THSA 3W9SA 1X4HA 4DWOA 2FJVA 5D78A 4JGBA 1QFSA 4XHBA 3HHDA 1UJ2A 3BCSA 1ECFA 3LP0A 4Y22B 4QR0A 3HP1A 2NSCA 2W2TA 3CRMA 2HW3A 4O0IA 5ILQA 4PRLA 2P9JA 2JDNA 3UMGA 4EKDA 2OSBA 3RYHB 5K8TA 4EG8A 4RK5A 1Z3IX 3DRSB 4LHWA 4B2LA 2JZNA 1R082 2Y1DA 3CG4A 1XNRB 3QU7A 4Q3OA 2K7JA 2WVFA 3ZTSA 3C1AA 2QTAA 2UUOA 1VG1A 3H9QA 4Y1FA 3DXSX 3UT5A 3AEXA 3E22A 2PX8A 4XWYA 1PFWA 1HTBA 3K16A 2QGNA 2GNAA 1P72A 4MGSA 4ZP8A 4I2PA 5CG8A 2D4AA 2I3GA 1N5JA 4O5AA 1JFTA 4BISA 5CB4B 1L7QA 3RYFB 3EZ9A 3UXYA 2I4OA 1I5RA 3EF0A 3H17A 3WNKA 4EY7A 2BHTA 2MJUA 1IUOA 4A0SA 3EBPA 1H9WA 1VRQC 1Z45A 1NNUA 2WSBA 4PG7A 4B9EA 3GRVA 2LW7A 1UZDA 3HA7A 3BN7A 3UK1A 3V56A 3AB4B 1KEZA 4H14A 3K3OA 1JXAA 4AKIA 5B7WA 1VRWA 3H5IA 2W7AA 3VDXA 4BNVA 2P3IA 3GFPA 1V9U3 4UDOA 3V4SA 3UWOA 4KV8B 2UUAJ 1L4UA 1FOD1 5U1PA 1KFCB 3HFSA 1FXWA 1BQPA 3E7XA 1KITA 1S2MA 4M5NA 5A71A 4ENUA 4S12A 4EJSC 1FNSA 1LLCA 4R1QA 2C8VA 2GKOA 3R05A 1NK7A 3K9GA 3PICA 2PFFB 5A6XA 3AVOA 5FDBA 2KG1A 5KTQA 1U0HB 3ORYA 1ZSYA 4CT8A 4A6DA 2J08A 3WGLA 3PX6A 3W5ZA 4Y67A 4FSXA 3CVVA 3NSTA 2IV3A 1DO2A 4Q6WA 1CUAA 3WFJA 2H57A 3GHNA 1R5BA 2L9WA 2EXHA 3AM4A 5KFCA 2HVDA 4IHJF 4KAXA 3T61A 4A8JB 1JZ2A 1GFZA 3AZZA 4OX9F 3D1VA 3C97A 3FIJA 4U7TB 1YQTA 5CT6A 4EATA 4B6OA 5KT4A 1AX2A 4QR2A 1RPNA 1Q8VA 2YQ5A 3C85A 4PLZA 2X0DA 1MH9A 5F51A 5AE2A 1BUXA 3L5KA 3DV9A 1LV5A 1MB9A 4BHQA 1HKDA 1C7IA 3VHRA 3QRRA 4KGXB 4EN0A 1L8XA 2ZVJA 1H6AA 2ZJOA 4U6SA 1ECBA 4RNCA 3OZUA 4BBYA 3D6NB 4C20A 1Q3HA 4L8GA 4NG4A 5CYGA 5J1NA 3NMAA 3TZLA 4JC8A 3K58A 1N6QA 4W4MA 2QF7A 2AI1A 4KLNA 3JAWB 5EKSA 3BD7A 4L16A 5F2EA 4JHLA 1HWUA 1HR0B 2DCKA 4U2DA 2I45A 5EMJA 3OA0A 2P5VA 3G9TA 5FLIA 3UJ7A 3VKMA 4RQPA 1UTAA 1UW9A 3U9TA 5KG3A 4RZHA 3MCZA 3EXAA 1UYPA 3CO5A 3AB2B 5EYXA 5TMEA 5FO0A 2F9JA 2NR0A 1P6TA 2VQ0A 3V8BA 3HWJA 1ZZ7A 3QUQA 3THYA 1VBC1 5DW3A 5BSMA 2KSQA 4LLOA 1TB4A 1JUDA 1W6MB 4CCKA 2AJDA 5FZ9A 1OGIA 4PZEA 2BGJA 2ZQZA 4URFA 1OBNA 4LPLA 3L05A 1QLNA 1LRHA 5C9AA 5C42B 2C2HA 3EMTA 1YS6A 4CSWA 3TQTA 1AOXA 1U48A 4BP9A 1NP6A 1FFGA 1SU6A 3O8QB 4YXWA 3I9MA 5CXXA 2QYGA 4J9UE 3GLFA 3R5DA 3HA2A 2I1RA 4WNAA 2DO4A 4OIXA 3O1SA 1P5HA 5LMUF 2GW8A 1ENOA 3ZI7A 1CR2A 4HSEA 5HROB 1VMFA 1I51B 1S79A 3UPFA 1P5JA 3S28A 2QW1A 4R2JA 4WTOB 3G7UA 3U10A 1LZLA 2HK3A 4B6QA 1JWBB 3NAIA 5EJ7A 3QV2A 2V54A 3GCWP 3R0IA 2EI5A 3KCCA 5K03A 1D9XA 4TWZA 3J81A 1PAUA 4F6LA 1HBOA 3V81A 3CUWA 3H5UA 1UX7A 3RUPA 3SQMA 1UK8A 4EJ0A 1PX0A 4LF1A 3GARA 4MGZR 2NYVA 3T3EA 2DQKA 4IQ8A 4UUMA 2WRZA 1O51A 4EGQA 2Q3JA 5JAUA 1WP9A 5K05A 2IOFK 1S2EA 2NQYA 1F17A 1Q3EA 5TF4A 5FYUA 1JZ8A 1RTDB 2FEWB 4KIAA 4BMDA 1YR7A 1Y4ZA 4PAGA 5E6SB 4AZSA 3G8CA 1JYSA 2XR4A 3CC8A 1XKLA 3QNMA 3K70C 4I1OA 1Y9GA 4TOIA 3DBLA 1SKUB 4M76B 3GIIA 3HXTA 1OFSA 4XJWA 1B0ZA 5K5EA 2BBAA 3OLAA 2LU1A 2LCWA 5FZHA 3H5TA 4QPPA 2R84A 4AMZA 3Q87B 3WB0A 2PE5A 4RCZA 3S5AA 1AM4D 2HFJA 2OEPA 4NMLA 2O8DA 1QP4A 2D69A 1J1IA 2CWWA 2E49A 4BMBA 3WKDA 4QQ8A 3ZWYA 1TT7A 3JQAD 2DFKB 3LHKA 1ZC4A 1W5TA 1E3TA 5JO9A 2BZ0A 4CU6A 1OXVA 5HVFA 4ZEXA 4BZPA 2R6GA 2QPOA 4FFRA 4OYOA 4WT7A 1WUVA 1NBHA 3NV2A 3D8UA 1QGAA 4IGIA 1U9CA 4C8YA 2CGEA 2P30A 3HDVA 5JQWA 2O8NA 4IICA 4FZRA 1NJ5A 4D0GA 1CUWA 3NTUA 2EW2A 1RU2A 1ISRA 1BMQA 2WQ6A 5H9FJ 4I3FA 4GQ7A 2A86A 5B57C 3TQQA 5FOBB 1RXYA 2JGAA 5JAMA 3O9VA 1U4OA 2Q6TA 2XAUA 4AO8A 4EJ2A 1MN9A 3WO1A 3IQGX 3NIGB 2X0RA 4JB2A 2WT2A 2ORIA 1AJOA 4DL3A 1JG7A 5GKAC 2F1OA 2B9UA 3J7LA 3EVOA 2F62A 1WC6A 2RG1A 1C80A 1LTQA 1SHZA 3QBTA 4NENA 3W9BA 3O3CA 3HD2A 4PNPA 2VH9A 1BTOA 4DSLA 3T09A 3TNVA 3ODPA 1NU6A 3K75B 5LCWL 1RU3A 4UEJA 5K8CA 4UQOA 4AQSA 4BDVB 3FCOA 3GA5A 3WBZA 4W7SA 4K9DA 1J4AA 4C76A 1E8NA 1ADYA 3TXXA 2D3TA 3REOA 3TIGA 1H8VA 4WXEA 4WM7A 1T3NA 4I55B 5IWFA 4B08A 2L48A 2OAUA 2Q0XA 3ESYA 1GPBA 2C94A 1HE1C 3ROXA 3PVSA 4R69A 2FWBA 1CUYA 3LLMA 4DR4B 3K35A 2VTXA 2VG8A 3Q40A 4DCJA 3IAEA 3RSOA 4RS4A 3DUWA 1N3BA 1Y4UA 1GLVA 3EGDB 7REQA 4L0CA 1PTJA 2YY7A 4O4GB 3REGA 2JLSA 3EGIA 2WT4A 3GG1A 2POKA 4M4SA 2CGPA 3M9LA 3JD4A 3SC3A 3E0QA 3C2PA 3OICA 4F11A 2AYHA 3ZPOA 5ACA2 4UOHA 1LLFA 1FSZA 1QAXA 1JEOA 4KE6A 2W7TA 3FDSA 3O4FA 5ELMA 3Q2KA 7MHTA 2WT0A 2DX7A 2AXNA 2LKDA 4FWBA 4BS2A 4KHMA 1UFVA 2G1DA 4AKTA 2HBTA 3N2KB 2WOMA 3OGSA 2A8YA 1N2EA 4NYOA 2WBRA 3D6MB 5FV7A 4D5EA 1KFDA 2C2EA 2ZUUA 2QNBA 1XJCA 3KKEA 3ZHRA 4KGQA 1GAJA 2Q6LA 3ND6A 1ISPA 1TCVA 1CJVA 2O2HA 1TQLA 2WR9A 2XYPB 5L45A 3PJGA 3N70A 2B7CA 4HVAA 4LYGA 4BQFA 5IWAF 1EM8B 2P9BA 2Q0QA 4KGVB 3BTZA 3THDA 3TZCA 4KPFC 1QIJA 4U2CA 2K2QB 4KRYA 1N33B 2IC5A 2CVFA 3O1OA 2CZ9A 4GRIA 2F1IA 4BCCA 1BDBA 1S02A 2ILTA 3B5EA 2GFHA 1C4RA 3AKPA 4DZDA 3N8HA 1R0RE 3B4DA 1VSTA 4BBPA 2OZ6A 3E3LA 2C2OA 1LUAA 4DBQA 3OT4A 3PFFA 3LVQE 2BGLA 4FAHA 3NNJA 3MUEA 3KV1A 1UKBA 2P8IA 1VIAA 1KKHA 5EIAA 2IODA 3ZOKA 1HEYA 5J9FA 3TEJA 1M5KC 3IPVB 4PQGA 2YFYA 3EZ7A 3RSQA 3WZ1A 3MMAA 3VOAA 2NYHA 2VQEF 1X1BA 1G3MA 2X76A 1IZ7A 2CXQA 4BBAA 4LDJA 1CV2A 3FWHA 4M5JA 3DVAA 2WVEA 5M04A 2RKIB 4UW3A 1BVUA 1W03A 4OVKA 2MZSA 4MTPA 3AVQA 3IELA 3FWKA 4IFVB 2XDYA 2CXPA 4USIA 2I4IA 4E2YA 4DLPA 1I4LD 1TT5B 3UKVA 1TJ3A 2Y0BB 1WU7A 1RWVB 1W59A 5HK4A 3WMXA 1TMF3 2CVEA 3O90A 1CQXA 4JP8A 1DKNA 2LEPA 1ZTWA 4GMKA 2BW0A 4RR3C 5TMBA 3BIOA 3OIDA 3GFYA 4FM9A 5LZ9A 5D8AA 1QAOA 5KYXB 3T15A 4BMSA 1NBEB 3K6KA 2OEKA 2XB2D 2VDHA 4ETXA 3V6JA 1WDKA 2ZPAA 1ZWLA 3M2RA 1KQO