2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CLP1
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
3TQFA 2FEOA 4DCSA 1EFRA 1O87A 4E03A 4DUGD 2C8VA 4IXNA 4RFSB 2A5GA 2WKPA 3DZDA 1OFIA 4Q1CA 4GOKA 3C41J 4JLJA 2YC4C 2CHQA 2WJGA 3LV8A 2BWJA 1ZIOA 1N6KA 4BEBA 2IS1A 1JEEA 3PEWA 2FPKA 1DAKA 1HH4A 1EFUA 3GLIE 1Z6XA 2GJKA 2H7VA 4V0LA 3SI7A 5KHOC 4LJ7A 1OFUX 4XD7A 2RGNC 1FTSA 1OW3B 2ZE6A 3IEUA 1GL9B 5DYGA 4M9SA 5HZKA 2QSZA 2ZVQX 4I1VA 5KNDA 1WDTA 2Q21A 1A2KC 3LRPA 1E69A 1E2LA 2CDNA 1HY3A 2NZ8A 2OT3B 4I1UA 3SNHA 4AKEA 1HT1E 4XSHA 2DCUA 4TSFA 3RWOA 1A2BA 3QG5A 4BASA 3WMFA 4DEXA 4E09A 1GTVA 1W2HA 1AM4D 3T1QA 3GJ0A 2GVDC 1CR4A 1T0HB 4ARZB 3MJRA 2I3BA 3G82C 5HCNA 5FTMA 2VQSA 2C03A 1CEEA 4G5SA 3VTKA 4QHTA 1OFTA 3CZQA 4I1SA 4P4SB 3RWMB 2ZYTX 1QHGA 2W6JA 3BAFA 5HE9A 2F1JA 2ZU0C 4G5GA 2XJ4A 4TLEA 2JLXA 2Z0MA 2ZM5A 3QKRB 2J5XA 1P62B 3KTAB 3CB4A 4TL6A 1VYUA 1XD2B 5LB2A 4DC9A 1ZUHA 1E2DA 4I4LA 2YINC 2QP3A 1XXHA 1PLKA 2ODWA 5C18A 2QPOA 4IVPA 3SQXA 1GZSA 3O8DA 2PCJA 4DRZA 1R5OA 1PJRA 2F1IA 2FGJA 2FMXA 3W6OA 4D4KA 3PITA 1P60A 1CU1A 3I4LA 3D6TB 4QGGA 3H84A 1C4OA 5DN6A 1SVSA 4CRWB 2W6ID 4QM6A 1KI6B 4U5XA 1PLJA 4CT4B 5DLQC 3THYB 3OIUA 4RJLA 5E3HA 3OEHA 4AY2A 3QEJA 5CM9C 2AFIE 4PZZA 2BMDA 4HI0E 4X8MA 1FP7A 3QF4A 4JMPA 5JJKA 1M2OB 3L0OA 2GCOB 4UNPA 2ZQ5A 1OSNA 4JYBA 2BMFA 2ECKA 1AK2A 4HATA 2BCJQ 4UJ3A 4U00A 1BH2A 4DDUA 4QHYA 4D26A 1SVWA 3PXGA 3IO3A 4IVQA 3NC1C 3Q5DA 1HE1C 3GEHA 2IYYA 4NCKA 2VSOA 1G6OA 1G1MA 3GJ3A 4V03A 3BE4A 4GMXA 3D7MA 5GJWC 4YQFA 3AVUA 2REXB 3SFVA 1D2MA 2VF8A 3E70C 1AJEA 2IUUA 3MWJA 4NYJQ 4IW3B 1DVRA 1P2SA 3O47A 5EZ6B 3RS2A 2ZS7A 2XSZA 2ZRPA 4RZ3A 1YZQA 4Q4HB 1GKYA 2QA5A 4FXPA 4XWAA 3T1TA 3GJXC 3CKLA 1OJLA 3E2IA 3I8SA 1QHHB 2OAQ1 1E2KA 2F1HA 3AEZA 5UKDA 5IK2D 4RD3A 4BZXA 2MMGA 5IF9A 1VKJA 5IHPA 4C7OA 3UMFA 1KSJA 4IDHA 1ZCAA 4UNRA 2QE7D 2QORA 1RJ9A 3SYNA 3EWAA 1VIYA 2IT1A 3I32A 1JR3A 4B2LA 2L0XA 2ZJ2A 3TJZA 4FINA 2F9LA 5F98A 2BCGY 2ODNA 4UXIA 1KK1A 4PQRA 4XVUA 4MGKR 4M1TA 3BRWD 1XPUA 2QTHA 2D2EA 2GEDA 5EUQB 2NO9A 5F3WB 4FCTA 1NG9A 2GF9A 4PPQA 2KWIA 4EJSB 3VNVA 5FI1B 4B34A 1UAAA 2G0NA 2V55B 2QQ0A 4QOSA 1E2JA 3TQCA 1JXOA 2C95A 2BC9A 1T5IA 2D7DA 1FUUA 2RHMA 4FCVA 2Z83A 2OCBA 4TTPA 5CK5A 3AF2A 4LHZA 2OFWA 3CF6R 3CH4B 1NBME 4HLUC 2J45A 4QBIA 4C30A 1KYIA 2GWHA 2MSCB 1EFTA 4ITRC 1SHZA 2RGDA 1WXQA 4G5OA 3S1AB 5TV2A 3SU8A 3ADCA 4QBGB 1KI4A 3REGA 4A8JA 1E0JA 3L43A 2OAP1 1UBCA 2J0VA 2E1RA 1E1QA 1E2QA 3ASYA 4QM7A 2VP9A 4FI3C 1UBGA 2J59A 1OYWA 2GJSA 1KMQA 4NKRA 1ZAKA 3CF2A 5AJXA 5DE3A 1OIXA 3KQKA 3PEUA 5DHAA 1EG7A 2VO1A 4LI0A 4NYIR 2KB0A 2WIAA 3LA6A 4G5RA 4V0NA 1XMSA 2AD5A 3W5IA 1DAEA 1AS0A 4DCNA 1XWIA 5TMPA 1ZUIA 4W9MC 1SVOA 4CZ2A 2G77B 1Z63A 1KI2A 1KY2A 4KFUA 1GL6A 2RKOA 5C4MA 2RGEA 2P3SA 3CF0A 2OXCA 4BZPA 2HUPA 1YZNA 4MA4A 3MD0A 4PHGA 4Q4AA 2ZI4A 4QGHA 3PUXA 5BN3A 2WPDA 3L0PA 3LX8A 4TL9A 1X86B 2ZJZA 2WTUA 2KSQA 5K8TA 2WMOB 1NLYA 2ZJYA 1QHYA 3AF0A 1MRSA 1NN1A 2D06A 5AUNB 3QVUA 1OB5A 1R0ZA 1BS1A 1ZNYA 2EFGA 1W49A 1T5LA 2PEZA 1RRPA 2IYZA 1GP2A 1RW4A 4U02A 4V02A 5TVKA 1KSHA 4LYJA 1PVOA 2JLSA 4TMKA 3WYFA 5FTKA 3AVYA 5FUWA 4Z8YA 3C4JA 3R7WB 1OT3A 3JZMA 3QPVA 2HV8A 1ZNWA 5SZHB 2AKYA 1QHIA 5E7IA 4JBXA 3MFYA 1ZU5A 2ANCA 4M21A 3VKHA 1UJ2A 3W34A 2ZR7A 4FN5A 3VFDA 2YNMA 2YVUA 4A2WA 1KHTA 3EG5A 4Q7KA 3MGCA 4FD2A 4A6XA 3UWOA 3E5HA 3UG6A 2IF0A 2JLUA 1G9XA 1XJ0A 1MH1A 1TADA 3M4YA 2FGKA 3TVDA 5KPDA 1GRQA 3AUYA 1YHNA 2VP6A 2C2HA 2XGJA 2P5TB 4JJZA 3ZVNA 4TQUS 2LKCA 1IY1A 4M1KA 1L7VC 4C0AC 3U4QB 5DO9A 4POAA 4RD0A 3GLFB 3AKCA 3GLHB 1M8PA 2ZROA 3M0EA 1A4RA 3MRSA 3SQWA 1SZPA 3H0KA 2BBWA 4IEEA 1S4QA 3B9QA 4P3YA 2GXSA 2WJHA 4D6PA 1IXSB 5D3QA 1II9A 5E95A 2NG1A 2QTFA 4LDJA 3W5JA 2P5SA 2O0HA 4IOMA 1J7KA 2F9MA 1IXRC 2QMUA 1G7RA 3OZXA 4LCBA 4PSAA 1CR1A 2GA8A 3Q85A 4HZIA 3U3RA 1HE8B 2XNSA 3K0FA 4F7WA 3RC8A 4HYYA 2ZTSA 3CNNA 3VR4A 1KKMA 2H8KA 1SXJE 4BLPA 5TY0A 1U8ZA 1Z0IA 2ZITA 1T9HA 4ZIRA 2OXRA 3TUJC 1SVLA 5G53C 2ORVA 2VYFA 2CE7A 5D3MB 4MKHA 4O25A 3MCAA 4DDTA 1KO8A 1E6CA 1G17A 2OV2A 3MWKA 2D2FA 4L4UA 4M1OA 3TIFA 4P4TA 3B82A 1F2UB 5CLLA 3I61A 2UVQA 3U7HB 4TYNA 2R62A 1ZYUA 1N6IA 4MKGA 2SHKA 2G88A 5CJPA 2X2FA 4DCTA 4ZKEA 2VEDA 1C9KA 3RHFA 3U3MA 1FUKA 4DCVA 2OO7A 3F3YA 2ASEA 3W90A 4JYCA 3KKOA 3H2YA 4RD2A 5CLQA 1QRAA 1SKYE 3ZLJA 1TU3A 3CX8A 2ZYVX 4JS0A 4HAUA 1C1YA 1Z08A 1U9IC 1WP9A 4B6EA 1GILA 2ZRMA 4UXHA 1I2MA 1XB2A 4TMXA 1I4DD 4JLVA 5GVSA 5L3RA 3LD9A 2O8BA 1LTQA 2BV3A 4DSOA 4AG5A 4DT1A 2FNAA 1BYIA 1RZ3A 2OG2A 2P2LA 4WXRA 2JLRA 1N6OA 2NIPA 3JZAA 4QBFA 1W0KD 2GBLC 2NPFA 1VMAA 4JIMA 4RSGA 1ZP6A 2ZI3A 1TL7C 3SBDA 1CBUA 4AURA 5JWRA 4Q4LA 4O3MA 3WY9A 4F4CA 4M1YA 1DARA 2JJ2D 4ZI3A 4F93B 2F3RA 4GMDA 4BFXA 1E96A 4KXFB 4WAUA 3IGFA 1NN5A 3AF1A 3VMFA 1US8A 4EDHA 3UWKA 2O8DA 2AK3A 2HCBA 4B3FX 3HPRA 4NYJR 3K70B 3EC2A 2O8FB 1J70A 3BFVA 1G3MA 3EPHA 2A30A 2ZREA 3K0CC 4AYTA 2AWNA 3TK1A 4LHVA 3B1YA 3UPUA 4LC1A 4TMWA 1VG8A 2DBYA 3PG5A 3PUYA 4DBLC 4OHVA 1IN4A 2F55A 2C98A 1MO5A 1YR7A 4NBSA 3THWB 1M1YE 2GXUA 3TLXA 2GK6A 3L2OB 1R8SA 3NBZC 2JJ1D 5DHFA 1CS4C 1I4TD 3DMDA 3TAUA 4MRSA 3Q3JB 3KKMA 1U8YA 2WSMA 3OEEA 1W48A 4CEJB 4TYYA 1NBMA 4QGAA 4TT3D 4D0LB 4QJ5A 2QRNA 4HZUB 4CF7A 4BE7B 4DDWA 1IN8A 2QGNA 2ERYA 5DSZA 1IN6A 3BH6A 4B43A 4ACBA 3ADBA 4GZMA 1PV4A 4QBHA 1N6RA 4GP6A 4EAQA 4KSBA 1FL9A 2RGAA 4NZYA 1P5ZB 4CYMA 821PA 1PUJA 3VR5A 3OFNA 1NL3A 1W4RA 1F6BA 3KJHA 5EQTA 2ZRKA 3QQ5A 1XRJA 2ZETA 1CR2A 2ZRAA 3QBTA 3RRMA 2Q3HA 4CGZA 1G16A 1GL7A 2PT5A 4M22A 1ESNA 2EWWA 4C2UA 3AM1A 1E9CA 1OPXA 2VF7A 3DOFA 4OJQA 1NMYA 2D62A 4XTRA 1Q1EA 3FMFA 3AKYA 3AV0B 2XEXA 1NVXQ 1XCGB 3OESA 3T61A 3EX7C 5G41A 4Z1MA 1JBKA 2CNWD 2A5JA 2KI5A 3TE6A 4C0JA 2XZOA 1ZIPA 3RVBA 1ZVQA 1Q1BA 3FHTA 3TRFA 1IJFA 5A0FA 2FSFA 5JI2E 4MGIR 1WE2A 1KNXA 2IXEA 3ADKA 2XAUA 3GEIA 1R5NA 4MUBA 4JZKA 4CW7A 3PEYA 2ZE8A 1PUIA 5HR5A 3FOZA 3B6EA 2CK3A 2P0EA 1UKVY 4ZDKA 3K70C 3VNUA 4G5QA 1L4UA 3MJHA 4URVR 4ZDWA 4HLDA 4PANA 3DO6A 1IJEA 1DTSA 3I62A 3TW4A 4RZXA 2A2ZA 3J81k 2ZSAA 5F9FA 4BGDA 4HAWA 2JLZA 4OKSA 3RS4A 3BB1A 4DUGA 3R8CA 1BOFA 3NEJA 3QPWA 3W9YA 1DG1G 1T3LA 5HKKD 3ZZ0A 1E2IA 4KV9A 4B74A 3GJ5A 2F6RA 4KBGA 1N25A 2WBLC 3MAAC 4MYTA 4QC2A 4AKHA 2YWFA 4JL5A 2NO0A 4NP6A 3CRMA 4KITB 2ZI5A 3FDIA 3I73A 4YMTA 4ZV4A 1NP6A 2O0JA 1FZQA 1JEDA 4A82A 2G9NA 4MKIA 4DLRA 1II8A 2Z43A 121PA 2AD1A 4QFMA 5JCPA 1COWD 4XVRA 4M9XA 1IBRA 3X1WA 1OE0A 3B60A 4LY6A 3CZPA 5FBQB 3TAHA 5J47A 3U44A 1LNZA 2ONKA 1MOZA 2ZUBA 5LPNA 3CH5A 3RRZA 1FX0B 1NY5A 4BFUA 2CXXA 2VHCA 8OHMA 3IILA 1KSGA 4ASUD 3HR7A 4LJ5A 1AGPA 4H9GA 4PZYA 1GDDA 2QT1A 3EXAA 5FL3A 1AGRA 2V8OA 3NIBA 1DBSA 4GOXA 1MO4A 4QJ4A 1GOTA 4E22A 1O3YA 1KSFX 1UF9A 5F9HA 5B58C 4QNMA 2V7QA 2B8TA 1U99A 5HZHA 1OHHA 1OH7A 4N1AA 3MSXA 4TTQA 1E9FA 3VR3A 1Z6TA 4DEYA 2Z4SA 1XD8A 1F2TB 1GAJA 1SXJA 3BIFA 3QXHA 3WYAA 4Z51A 3X1YA 3T5DA 1AKYA 2RGCA 4LV6A 4M1MA 4Q9HA 1U0HC 1IXZA 4NMMA 2J9RA 2PX0A 5FPTA 1SGWA 3D3QA 4ZCMA 3WRXC 4EFNA 5H1YA 1F3OA 3VAAA 3A8TA 2GVZC 3NG1A 1N5IA 1OIVA 2GETA 4HAZA 4NL4H 1I2DA 5P21A 2IK8A 5FTJA 2YWEA 3EZ9A 1E4YA 3PV0A 3GPLA 5DI9A 3TGPA 2ZRIA 3Q5EA 3I1FA 3IKJA 1EX7A 3SS8A 3VKWA 5JEEA 4CIDA 3QF4B 2JGNA 5FOXA 4HLQB 1GRNA 3IBYA 1MABB 4BZQA 2EFDB 3IQXA 1JI0A 4Q01A 3OE7D 4BEJA 4Z54A 3V9PA 3EZ6A 2FSIA 4D4JA 2XXAB 2D3WA 4LX0A 4XSGA 5KNBA 2WOOA 3HDTA 1MV5A 2WSSA 4HDQB 1N0UA 3DM9B 4DLUA 3K09A 1W0JA 4S35A 3WMGA 1GG2A 1TQ2A 3ZIAA 4AI6A 1NIPA 3KX2A 1XCPA 3DMNA 3KQUA 1ZBDA 3WBKA 4Q9IA 4B75A 1BMFD 1VIAA 5B64A 2ZRDA 4EPXA 3SR0A 1KMHB 2GZHA 2H16A 4FMDF 2JDIA 4DXAA 3THXB 1P2VA 3CRQA 2BM1A 1UKEA 3SC3A 3QF7A 5FL7A 2C9YA 1HQCA 5DI3A 3LX5A 2IYLD 3EZ2A 2QL6A 2J3EA 2WJJA 1HV8A 1KI3A 3FGNA 2GEUA 3DDCA 5F2EA 4A6PA 4NCNA 5JRJA 4NCJA 3G0HA 3T34A 2QG6A 2QUZA 3HPQA 3RRYA 3EPJA 3VU9A 3CPEA 2C96A 3TR5A 2FSGA 3N2EA 2PMKA 2R6AA 3LW8A 3GLGB 1OF1A 5SZKB 1AA9A 4LJ8A 1E79D 2IA5A 3B1WA 4XJXA 3FVQA 5FPYA 3T1VA 4QL3A 2K5UA 3AVPA 4ZCIA 1SQ5A 5GADl 4B73A 3U2QA 1N3BA 4EUNA 3ZS8A 2C99A 1X8JA 4NU0A 2OBLA 3VR2A 5ELXA 2ZE7A 3NWJA 1OXXK 4OK3A 3Q7PA 5FPSA 4TL7A 3RSLA 3B13B 1VCMA 2XB2A 4UNSA 2QSYA 4NE2A 4EQ6B 1HQYE 2J7PA 2IW3A 1GVNB 1Z0AA 5GVRA 4EIWA 3T5GA 3K70D 3QI2A 4XTCS 5HE8A 3NBFA 5EP2A 1XEWY 1S8FA 2WWYA 3SEAA 3B85A 1JXMA 2NGRA 3KKPA 4YMUA 1JPJA 4WBSA 4RZUA 4DLVA 2WKQA 5JWHA 1XNJA 2FF7A 1S2MA 1W7AA 1Z6YA 2ZJ5A 2QM8A 3K8YA 3EZ7A 1N2CE 2QAGB 4DLZA 2CHVA 1D8TA 1YZGA 3AVVA 4WA7A 4Q4JA 3AKDA 3RYTC 3EW9A 2WAYA 2O8EB 2OILA 5KDOA 3PVSA 2RMKA 3B8HA 1WF3A 2QI9C 3W8NA 1YJ5A 5C2JB 3LLMA 2QNRA 2F1RA 5IDVA 3QENA 1ZM7A 1TQ4A 3OAAD 1UM8A 1LVGA 3K0AA 5DGXA 2IS6A 3W8RA 3VR6A 2RGNA 1JECA 5JFGA 1F60A 4TQ9A 2FPMA 1SULA 4LJYA 4G0NA 4XWKA 3GMTA 5CB6A 1Z0KA 2CLCX 2QP4A 3OIYA 1XPOA 1P72A 1KK3A 4FWIB 2CCKA 1D2EA 3TSWA 5GJVC 1Q57A 3CR8A 3VKGA 4L8GA 4TLCA 1FTNA 3P4YA 2WV9A 4LBWA 1AZSC 4BLSA 5KSYA 1OH6A 2FV8A 2O5VA 5BN4A 2AXNA 5KTYA 4YMSA 3KFXA 3QNUA 3ZVLA 5TARA 2OESA 5FH9A 1JQLB 2FEMA 2QM7A 2OLKA 2YOFA 3IPYA 1GIAA 4F92B 3ND8A 1KZGB 5DYIA 5CDFE 5CB8A 1DEKA 4GI7A 3SN6A 1S1MA 2IL1A 5K8UA 3LAWA 5KU1A 1G8PA 2A3RA 2W00A 3KKQA 3FKSD 1ZM2A 2E9SA 3PCRB 1OXUA 3NBXX 1U0LA 4LZZA 4LYAA 2NO6A 2GK7A 3LQRA 4LSGA 4JSTA 2A78A 2CL6X 2VRWA 5C4GB 2CJWB 4JBYA 4RFSA 1Z06A 2QENA 1EFRD 1IY0A 2EYUA 2QAGC 2FZ4A 1W4BA 2NOAA 2IHBA 4D0GA 1G8YA 3FKQA 1AZTA 2H5EA 5B2ZA 3UXMA 1L2TA 1GNRA 4HUQB 4KLNA 4JT2A 1Q3TA 1R7RA 4CEIB 3PUWA 3SJCA 5EXPA 2QZ4A 2WWIA 4IDQA 2HDNB 4PO8A 1EESA 2BJVA 2I1VB 1NG1A 4JL8A 4LWZA 4IVRA 2RB4A 5J4KA 1FMLA 3VHXA 4A2PA 4Q21A 4E07A 1E1RD 1FMJA 3EASA 2VP4A 3FPAA 3PFIA 5EP1A 2IHYA 2PZGA 4YLGA 1MRNA 2IBMA 4A0GA 2ZRNA 3OF5A 5GJCA 2CVHA 1S3SA 1LV7A 3H4MA 4OQFA 3Q72A 4KI0A 3ZD6A 1G8FA 1QZXA 4EPWA 1Q21A 4PPNA 4ARZA 4TYPA 1VCIA 4IOKA 1EFCA 3C7KA 1W47A 3M1IA 2VL7A 3FWYA 1UEIA 4DLXA 3KDSE 3K53A 4P4SA 1Z22A 2FOLA 2EFHB 2DB3A 2W6JD 3QKRA 3KTAA 3CX6A 1XD2A 2ZI6A 3W6PA 4BPBA 3GLFE 4L15A 5KSOA 3C5HA 3AVWA 3GLHE 4U7DA 1YRAA 4DDVA 5FOWA 3GJ4A 2D7CA 3L0SA 3LNCA 4A15A 2BVNA 3QPUA 4C0KA 3FFAA 4NHOA 2IXGA 4QJ3A 3EIQA 1TTTA 2A9KA 1U94A 1CRPA 2W83A 1VTKA 2WKRA 5EE1A 3LQQA 4ACAA 4KVAA 4ESVA 1QDEA 2ZE5A 1DAHA 2RGBA 2ZAOA 1KI6A 3CNLA 5DN6D 1NKSA 2CCJA 2HT6A 3THYA 1UADA 3C16C 4R7ZA 1N5KA 4Q19A 4OQMA 4CT5A 2UKDA 3BGWA 3HYTA 1VHTA 3KB1A 3FHOA 2QBYB 1XMIA 5CITA 2WAXA 3RSOA 1E9BA 3TSOA 2A5FA 1IM2A 3R9IA 2GCOA 5C1BA 2EFCB 2FN4A 3CO5A 2V9PA 4NYMQ 2YC2C 2VHTA 2R44A 4AYXA 1W0KA 5JHHB 4D82A 5H68A 5LBIA 3GLIA 3AGPA 2QMEA 2A5YB 4HLUA 3P27A 1YKSA 1YRBA 1Q12A 4Q1EA 2H18A 1T8UA 2JJ2A 4EJSC 4JL6A 1XTIA 1UKYA 1X3SA 3T1OA 1D2NA 4A0FA 4AK9A 3U61B 4R2IA 2DY1A 1GRRA 2PH1A 2RAPA 3KFVA 4ZCLA 5AUOB 2V3CC 4JLAA 4ZI2A 2QT0A 4DLSA 2YHSA 3ZS9A 3SZRA 3KQHA 4QG7A 2J1LA 1KAOA 3W3ZB 2ZRJA 1CF4A 2VHJA 2H17A 5FR2A 5L3SA 2GESA 4OQXA 2IYWA 4EKDA 1KY3A 4Y0VA 1RRFA 2XSZD 1F48A 1TF2A 4RD1A 4OI1A 4C2TA 1A1VA 5EE0A 1QHHA 2XOKD 3WNDA 3P26A 2Q0HA 1XU4A 5EP4A 2ZU6A 1W5SA 4DKXA 1MO3A 3U5ZB 4KO8A 3EPKA 1D6JA 3VX4A 2RGXA 1U98A 1GKUB 4TT3A 2O52A 3HU1A 5SZIA 3HWSA 2C78A 2AKAB 3AB3A 3MUFA 3GD7A 4M9QA 3AP1A 1NLZA 3WP0A 1IN5A 1E2NA 3SHWA 2R8RA 4WZBE 4G01B 4CDGA 1G3RA 1JR3D 1XDBA 4TTRA 4DLTA 1FP6A 4OK5A 4US2R 1HT2E 3NXSA 1KI7A 3EA0A 4C0QC 1N6NA 1GSIA 1M7BA 2O8CB 4IOJA 4KODA 4FMDB 2GRJA 4YMVA 1NLFA 1HURA 1ZCBA 1WMSA 2F43A 1T91A 4LPSA 4Q02A 1XTSA 3QBVA 2KBEA 2YWHA 2PJZA 4L5BA 4Q1BA 4F38A 3L8ZA 4HEJA 3A1WA 2IS2A 4ON9A 1AQUA 3P20A 2GJ9A 1DPFA 1NMZA 1VPLA 2ZYUX 5J5CA 4A0RA 3ICEA 3ZH9B 4B48A 1NVWQ 2WICA 1MO6A 4BFYA 4C0HA 4B3GA 3TSZA 4EFLA 2V54A 4RCZA 4M1WA 4S2EA 3LDAA 3S1AA 3R8FA 1XBTA 4WOPA 3ZQ6A 4V0OA 1AS3A 2HLDA 1VYVA 2UZ3A 3F5FA 2FA9A 4QXAA 5DISB 2CHGA 1S1CA 3MLEA 1KTVA 3FE2A 3MWYW 4IDNA 421PA 2IEZA 2IUSA 1BIFA 4YXWA 4DZZA 2CMKA 2OZEA 2DFLA 1E1QD 3N70A 1DADA 5CDFA 3O8CA 2NMVA 1NRJB 4B33A 1T0JB 4P33A 4F91B 2G6BA 1B0UA 4HAXA 3K0SA 4XIGS 4W5HA 1Y63A 5JI3E 3EIEA 3SFZA 2FFAA 4Q1DA 4FMCF 2OCPA 3GQBA 4PFSA 2CL0X 2HCJB 1EFHA 4KCGA 3QXCA 1WBDA 4LUCA 2WHXA 1WCV1 2N46A 5AK0A 3RS0A 4PZLA 3U3JA 1ONBA 5J4LA 2LWIA 4LV5B 2J87A 5C46F 3IHWA 5LB4A 4KFRA 2JJ8A 1KJYA 2ATVA 2ZPTX 1H8ED 5BYJA 4AD8A 4JKYA 1X6VA 1W36D 3NHBA 2WPDD 2IS4A 1B23P 4B3CA 1LW7A 2VHQA 1TQDA 2XNDA 3FYHA 4KAXA 4TMZA 2XTNA 3SJAA 1KO1A 4LHWA 1G3UA 3PQCA 1UEJA 2Z5FA 3R9WA 2IYXA 4Q1FA 4DSNA 1GM5A 2NO7A 1YZUA 1OKKA 1CULC 4YC7A 4ASUA 4AKIA 4TZ0A 3WYGA 4DCUA 1HUQA 2DWPA 2YYZA 3ZYCA 1OXSC 5E4FA 2CEAA 3ND9A 1E4VA 1EWRA 4TYQA 1LS6A 4AC9A 4P4UA 4RKEA 2QN6A 2QROA 2GILA 3LFUA 1AKEA 1YR6A 1ZJ6A 3QXXA 1XMVA 4PTLA 5E7JA 3RAPR 2HYIC 2PBRA 1U9IA 2CVFA 4MUAA 4UNNA 1ZUNB 3KJGA 4R98A 4D25A 2GCNA 3CM0A 4HDCA 1KI9A 3WHLA 4D4LA 2YJTD 2G1JA 3AGQA 3ZQJA 4JLOA 3NH9A 1IQPA 5AUQA 3R9XA 1CJMA 2XZLA 2GBLA 3ZJYA 3K1JA 1R8QA 2ZRLA 1P2UA 1G7TA 1W46A 4NTZA 3U4QA 1X8KA 1QG2A 3TBKA 3GLFA 1NJFA 3GLHA 1KO5A 1Z6AA 1KKLA 2IWHA 1X8LA 3QIAA 4MGYR 1TF7A 2ZR0A 4FCWA 5B57C 1ZD9A 5KDDA 2X77A 3OIVA 1R10A 3V4FA 3SYKA 1S96A 4A2QA 2X8AA 2IXFA 3Q7QA 3O8RA 4CEHA 1ZC3A 1XFAA 2I4IA 3LVRE 3OHMA 1AN0A 1CJKC 4MYUA 4GRAA 4PPFA 1KOFA 1SKQA 1KNQA 3A58B 2REBA 3UANA 4B35A 3BFXA 3K0CA 1JAHA 1YZTA 2REOA 2ZRCA 1F5NA 1XZPA 1M34E 4OYHA 1SVIA 1HEIA 3NVAA 3FMOB 2WIBA 1IONA 3ZZTA 1TX4B 2C9OA 1HYQA 1P7CA 2ZR9A 2FSHA 4M8NE 3D31A 3TR0A 3TW8B 2JLYA 2CL7X 5FFMA 1E2EA 5D3MA 2ZIAA 3B5JA 4BFTA 1U8AA 3QKSB 2GKSA 3FTQA 3T06B 2B7BA 3BBPA 4QKQA 1JPNA 4OHWA 4DLYA 2PX3A 1BO6A 2IC5A 1ZNZA 4P0TA 2FFQA 2C77A 5FI0B 4E5UA 1TQ6A 3HJNA 4URZR 3X1XA 3F0TA 1VG0B 4AYWA 1KZ7B 1OFHA 2BIFA 1BMFA 3VR1A 1JJVA 3KKNA 4M2LA 4XWOA 1XPRA 1FFHA 1G8HA 5FPKA 1E3MA 2Q3MA 1S9HA 3QXJA 1II0A 3ECCA 5HTKA 3IEVA 1H8HD 1M74A 1R6BX 3IIMA 4R2HA 2Z4RA 1TPZA 1LF5A 1TUIA 3GEEA 4PC2A 4ZDIA 5G3YA 5BW8A 1JNYA 3DEFA 4HB0A 1G64A 3KQLA 5DIFA 3ZD7A 1E32A 1DE0A 3CRW1 1MT0A 3GFPA 3IPXA 3NH6A 1UFQA 3P32A 4RFVA 3RRNA 1YU9A 2B6HA 5EP3A 3VQTA 4BFWA 4RZ2A 4B76A 5KO2A 2WWGA 2ONJA 2ZI9A 4EPYA 3I5XA 3A6PC 3K9HA 3BERA 5JHGB 4KLZA 2QMHA 4HAVA 1G4UR 4P31A 4YDHB 2QGZA 1IY2A 1LF0A 1AS2A 1CJUC 2JIZD 1OLOA 4NH0A 1VHLA 2P6NA 4UJ5A 4EPVA 5JWOA 4M0LA 2XJ9A 4HB3A 4OK6A 1TMKA 2HT1A 2O8FA 3N2IA 5JSZA 1AQYA 1I4LD 4V0ME 3T35A 3ZDQA 2PL3A 2ZJOA 4BLTA 4DIDA 3DZ8A 2E87A 2P6RA 1CIPA 1W5TA 2OCAA 1N5LA 5K8LA 1UDXA 3PR1A 5BYKA 1Z0JA 1NKTA 2ZJAA 3B1VA 5JS8A 3THWA 3U3KA 3TUZC 3RDPA 1FW6A 2YOHA 3GLGE 1KI1A 2WJVA 4DVGA 4D0NA 1G7SA 5A5GA 1XXHB 2PZFA 4TN1A 1P4SA 2J0UA 5HPYB 1PLLA 1U2RA 3A4NA 3SOPA 1OIWA 1UBEA 4CEJA 1LY1A 1XX6A 3QKUA 1D9XA 3OEED 3LY5A 1KDOA 1VG9B 1WB9A 3AVTA 4HZUA 4KHZA 5CYPA 521PA 3ZVMA 1NBMD 4US0R 4KSCA 2WJYA 2W6IA 4HUTA 1ETUA 2G83A 1FQJA 2QMOA 1K5GA 4BLQA 1NF3A 3T15A 1DO2A 2Q9AA 3K0AB 1JR6A 2YZ2A 5CJ2A 4IRUB 5EJEA 1CJVC 2QAJA 2XTZA 1DAMA 4M9ZA 5FTNA 5IT5A 4O2LA 5H8WA 1Z0FA 1T8TA 4NYIQ 2B7CA 1J8YF 3OFND 4EPTA 1S0UA 1XTRA 2ODBA 2V4ZA 2A5DA 221PA 3QXSA 3WRYC 3IHLA 2VHUA 4PC7A 3V00A 1VDZA 2WWFA 2ZJBA 4MYHA 3B9PA 4TZ6A 3A36A 2NPIA 4YMWA 2EW1A 2GJ8A 1X1SA 2WWXA 1UDWA 3AKEA 3BD9A 3QOFA 2EU8A 4QHSA 1G291 3BWDD 1S3GA 2ZRGA 3BH0A 3X1ZA 5IRCD 3CWZA 1RKBA 3CLVA 3DOEA 5CYOA 4Z1MD 3LBHA 1H65A 1ZM9A 4LBVA 3SJBA 2X2EA 4B6FA 1XEWX 5FR1A 2AL7A 1Q1ZA 3CRRA 1P75A 1E2MA 4KYUA 1FPMA 4W5WA 2BBSA 1KK2A 3SJZA 3TNFA 4NONA 1CLUA 2IYQA 4G1UC 2FFHA 1E0SA 3SDZA 2DWQA 3C15C 5IK2A 3REFA 3A1SA 2RHDA 2QEQA 4B47A 5KNCA 3A1UA 2JA1A 1EX6A 2OSBA 2QE7A 1W44A 4XVQA 4C7OB 1FNNA 4RVCA 2GJAA 2F3TA 3HYRA 1N0WA 2ZANA 3BXZA 1HA3A 1PZNA 1RJ9B 1RRGA 2PZEA 5B30A 4R9UC 4CVNA 4ABYA 3GFTA 1IOZA 2YKGA 1ZW6A 3HU2A 1WQ1R 4TQAA 1E9DA 3AF3A 4OI0A 1QHXA 621PA 2G3YA 1YZLA 2J0QA 3IUYA 2AN9A 3AH8A 4C9BA 2AFHE 3BS4A 4A4DA 3C8UA 4D81A 1XJQA 3EA5A 4HB4A 4ERNA 1E1RA 2XITA 4LOAA 4OJKA 1AIPA 4BUJA 3K0EA 2P6UA 1FX0A 3NKVA 2GNOA 5FPHA 1R0YA 1EWQA 2VBCA 1G19A 4FMCB 2V1UA 3KJIA 2PLFA 4GDFA 1IHUA 4X8HA 2O8DB 1Q22A 2FJUA 4C0SA 1CKEA 4MQBA 1P2TA 2BOVA 3NHAA 2Q9CA 1RPZA 3NDPA 6Q21A 3V4RA 4HSEA 4LV8B 1W1WA 721PA 4BLRA 5FTLA 4PO1A 2XZPA 1R4AA 1XEXA 4Q47A 3QE0A 4A8JB 4WVFA 2IF2A 3W3AA 2TMKA 4N0DA 1Z29A 2FE4A 1J99A 2V7QD 2G0TA 2ZRBA 1OV4A 3A4MA 1OHHD 3PUVA 1F2TA 3KXKA 1DAFA 1QBKC 1SXJD 2C9CA 3WNCA 3KUCA 1U90A 4PQFA 4IDOA 3O8BA 4A0HA 2DHRA 4LBZA 1LS1A 1VCOA 1KK0A 1G8GA 1ESMA 1N5JA 3JVVA 1DS6A 2GXQA 3KUDA 5FOTA 2FFBA 4M53A 4A92A 2VP0A 1KI8A 1EK0A 2IYSA 3X1DA 1TUEA 1CRQA 4LPKA 1EGAA 1E0AA 3BC1A 1Q3HA 2YWGA 3DPUA 4WZAE 2W0SA 3FMPB 2IX3A 5AR1A 3WMEA 4BECA 2PEYA 3LLUA 2OCYC 1V5WA 4Q4AB 5FBVB 4YONB 5KPJA 2GHIA 1W36B 1JJ7A 5AWFC 5TB5A 3LW7A 1S9DA 3DM5A 2JATA 3QKTA 1MABA 3K9NA 1G20E 2HEIA 1XF9A 4LK2A 4PAMA 2XXAA 3GLIB 2BMJA 2OHFA 3PENA 1Z5ZA 2ZEJA 2MMCA 2IYTA 4RCYA 5JS7A 2BKUA 4TMVA 3AVQA 2WSSD 3GJ7A 4JVMA 1CXZA 5L3QA 1P9NA 1OB2A 4J0QA 1W0JD 4AIIA 2GAAA 3H1TA 3AVXA 4PPGA 4PSKA 3ZIAD 2JAQA 4BFVA 3IBGA 1GUAA 4DJTA 1XMJA 1XD9A 1KMHA 3THXA 5HCIA 1Z07A 4JJKA 1Q0UA 4L9WA 4BWYA 5L3SB 4JBWA 2PCLA 3T12A 3E1SA 2JDID 4A8JC 4PC1A 2XOKA 1T4GA 2R6FA 1J8MF 3CUEF 1HTWA 5FL7D 4V0MA 4Q7JB 5JJLA 2GTPA 1GKIA 1QHNA 4MRPA 4WZ6A 2ZSBA 1TEXA 4OHXA 3WNBA 2ERXA 2Q3FA 5JBQA 4I81A 3RC3A 2W58A 2HF9A 2V6IA 5J40A 3GLGA 1YVDA 1OXVA 2W0MA 2AWOA 4XD7D 2VSXA 3B7GA 5ANRB 4C3ZA 5G3ZA 5CIQA 3HR8A 4PAQA 1MKYA 1RVDA 3RS5A 2WZQA 4K8OA 3X2SA 2YV5A 5KUTA 3SYLA 5K8IA 1BKDR 5LDDC 4M1SA 1D5CA 2QPAA 4OBEA 3EPLA 3UMSA 2W2VA 4TSFD 2ZXUA 1KO7A 1RRCA 3DVLA 1IAQA 1ZU4A 2CBZA 3RABA 2F43B 4JKIA 4B44A 4EQ6A 3K0FB 4NDZA 1R0WA 4URUR 4KJZA 3NEYA 3WBJA 2J7PD 4NCIA 1W36C 2WVJA 3RLFA 4B3BA 1LB1B 5EXXA 2C5LA 4JLKA 4TYWA 4PO9A 4ZIRB 5JLJA 4AWXA 1SHKA 1ANKA 4KFTA 1P73A 4QRHA 4US1R 3TUIC 4PHHA 1E94E 1YQTA 4DB4A 2G1KA 4HLCA 3WP1B 3U60B 4TLDA 4JSYA 1NVVQ 4KFSA 2WWHA 2QAGA 1G41A 1Z47A 1P3JA 2GF0A 4HB2A 1G7CA 1CP2A 2YOGA 2IWRA 4A9AA 5JECA 1Z28A 4WXPA 2O8EA 5FBLB 2WM9B 2AK2A 3RNLA 3K9LA 3NTUA 2FDCA 4P32A 1UPTA 2VPPA 4ZKDA 4Q1AA 1D9ZA 1Z83A 2GZDA 3PEVA 3SE0A 4IFEA 4JVLA 3MMPA 4RD6A 4KBFA 2JLQA 4EFMA 3U6KA 5CK4A 1K6MA 4DLWA 4N3NA 5JRZA 4ZO4A 3OEHD 4W7SA 2GCPA 5A4JA 5AUPB 2PMDA 2V1XA 2BM0A 5H70A 3I8XA 2O8BB 1DOAA 5FUYA 4DT1B 3P4XA 4LJ4A 3CR7A 3BH7A 3UG7A 4MRVA 2GEVA 3AF4A 5FOVA 1QHSA 3H86A 2N1BA 2ZSDA 4LYFA 4OHYA 1NMXA 1H8EA 4FMBB 4B3DA 3B2EA 4X8LA 1G3QA 4Q18A 4LGMA 2WJIA 4BFZA 2EQBA 3AUXA 3A4LA 2BEKA 2BMEA 3N5CA 5EXTA 4BRWA 3IIJA 1US8B 4ZDJA 3LVQE 4O0MA 1ZNXA 3LXXA 4GOJA 4Q00A 3RS3A 1WRBA 3RS7A 3UK6A 4PSVA 2Y8EA 1K8RA 1WA5A 2KJQA 4IHQA 1WBBA 1CJTC 4TMTA 2WOJA 2BHRA 5HKKA 5EZ5A 5J4HA 2OE2A 3CRVA 4Q4HA 4FWTA 4B2PA 3A1TA 4PQYA 1Z3IX 1M6NA 3R20A 4D80A 3DKVA 4MDEA 4TLBA 2MSDB 5FBWB 1KJZA 2JJ1A 1GFIA 3DKPA 3L82B 3A37A 4MRRA 5J4YA 4A36A 3KZ1E 4BLOA 2CJWA 1Z6GA 2A7QA 4ILEA 4GL2A 1OXTA 4WIAA 1G18A 2R6DA 4UNQA 3BJIC 2BEJA 2GAOA 2GDJA 1IN7A 3FMIA 4F4IA 1NIJA 2HJGA 3ZGXA 1V43A 1KDTA 4Q9JA 4HUQA 1RFLA 4GBMA 2QRZA 4CEIA 5GJBA 3QVVA 3TMKA 3SBEA 1ZC4A 1N6PA 5G40A 2BKEA 3KXIA 1U81A 1Y3AA 1XTKA 4MRNA 4URXR 1NI3A 1SVMA 4EJSA 1KIMA 4B32A 1G4AE 1ZD8A 1GITA 3IO5A 3LO5A 1U0JA 2JLVA 1E9AA 2FPLA 3EZFA 2FZLA 2DR3A 2QY9A 1DAIA 4FIDA 2ZSFA 1G5RA 4X8OA 4CEHB 1G5TA 2EWVA 3BB4A 1KJWA 1GWNA 2CNWA 5FBRB 2ORIA 1UBFA 1YE8A 4I99A 4LJ9A 4D4MA 1RIFA 1YR8A 3UIEA 3DL0A 4PHTA 5BWMA 2NQ2C 2B8WA 2AR7A 4IDPA 4IOLA 4GFDA 3ASZA 3ONWA 2QP9X 4PX9A 3U7FB 5CIWA 1NSTA 3AP3A 2DFKB 1FOEB 1VCNA 1YZKA 2N42A 3UATA 3A1VA 4PHFA 4NCHA 2UZIR 3U3OA 5KYKA 4MITA 4H1UA 5J4VA 2J0SA 1JALA 1DG3A 2DWOA 4G3XA 1MR3F 2JCSA 3GCGA 3QJYA 5KSPA 1M7HA 1QG4A 4KU4A 3ZVRA 2IYVA 1TF5A 1OYYA 2ZUDA 4C4PA 1H8HA 1Z2CA 4JVSB 3IDQA 1RE0A 2ZJ8A 4GNKA 4NPHA 5SZJA 3B1XA 1VECA 3FFBA 1GNQA 2X19A 2LCFA 3L0IB 3VHLB 1A82A 1XTJA 2FWRA 5LD2B 2B92A 1L8QA 3NDBB 2JEOA 1KDPA 2PLRA 1XJCA 3FB4A 2QBYA 2RGGA 4IFBA 1R0XA 4Q66C 2ZI7A 4GP7A 1COWA 3NC0C 4LYHA 1ELOA 1II8B 2KE5A 2RCNA 1E9SA 3CPHA 5AJZA 2ZUCA 4Q7MB 1E9EA 1A7JA 3THOA 1J90A 2B21A 2IYUA 2ZYWX 5TXGA 4N0EA 3WXMA 3NBYC 3U44B 3C14C 2LKDA 4GSYA 5BQ5A 4JLBA 5AJVB 2AXPA 4RY2A 4RD4A 1E2FA 1Z2AA 3P1JA 5BXQC 1DELA 3QUSA 4DSUA 4KYIB 1M7GA 2JIZA 1L4YA 1TU4A 2J7KA 1A5TA 3KB2A 3C5CA 4MKFA 4UKDA 3R7WA 5JCZA 3CW2A 1N0VC 5FOUA 1NJGA 5JEDA 4PXAA 3LXRA 1T6NA 4IKEA 2BDTA 2DFNA 3EIHA 4I1OA 4DHEA 5M04A 3CONA 1QF9A 2I1QA 2XTMA 1EXMA 2FH5B 4GZLA 4QNRA 2OBMA 5JSZB 1KDRA 2VIIA 4IXMA 4PC3A 2HYDA 4RKFA 1ZRHA 2P65A 3KJEA 2PT7A 5AJYA 4B71A 1T3SA 3EC1A 1SXJB 4OHZA 1G5PA 1P61B 3GJ8A 3AVOA 4Q9LA 1G6HA 1XCMA 1G21E 4Q5IA 4OL0A 2XX3A 3TKLA 2J0UB 1Q1QA 4URYR 2CLDX 4W5JA 2FG5A 4GT1A 1E2HA 3QSYA 1VG1A 4UQOA 1VYTA 4A1FA 1P9WA 2D74A 4B3XA 5JMTA 3SHFA 1NSFA 2ODEA 3DHWC 5EUMA 4BFSA 4F4JA 2O0KA 3I72A 2W2XA 4XOIA 2J46A 2FX3A 4Z8XA 4BRUA 3I3SR 1UKZA 2H1LA 3G5UA 3EARA 2O8CA 3CBQA 1CTQA 2OM2A 5AJWA 1E2GA 3K9GA 5EE5B 1OH8A 2R6GA 2VP5A 3UKDA 2CCGA 4UXJA 3LBNA 1SKYB 2VP2A 4LJAA 5LD2C 3CPJB 1NN3A 1BYUA 4K46A 2X1VA 5KSZA 1RYHA 3OE7A 3UMRA 1KO4A 1XEFA 2CE2X 3U7EB 1XXHE 3WHKA 4LHYA 3ZZUA 2R65A 1F2UA 1NVVR 2PJRA 2ZAMA 2VH5R 2AHOA 2BBTA 3BFKA 5DH9A 3BB3A 3RANA 1GNPA 1E0KA 1E99A 3F8TA 3PJRA 1N6LA 5E7MA 3U6BA 1OH5A 1ODFA 4DB2A 3LH5A 4XH9B 2OBNA 4DWJA 3LWNA 2HLDD 1SVKA 1QVRA 4JT4A 2DFTA 2D4HA 1TAGA 1JQJC 1R5BA 5BN5A 3OIWA 1P9RA 1TEVA 3M6AA 1W2GA 2Q6TA 2KBFA 3AQ4A 4YXWD 4OI2A 2FU5C 3QY0A 3PUZA 4FW9A 5DI3B 1J2JA 1P6XA 4LRWA 1XZQA 3Q8XB 2ANBA 2ZS9A 1DO0A 4KVGA 2R2AA 4OQNA 4AG6A 4MGZR 1T3HA 4V0KA 1KAGA 5DNYB 3IQWA 4L9SA 1SXJC 4NYMR 4MDFA 5FUVA 2R6CA 4M4SA 3CNOA 4B2IA 5JZVA 5L8VA 1Q44A 2VTKA 3QEOA 3VU9B 2C04A 1QVAA 2WMNB 2F7SA 4TL8A 1E79A 1YR9A 2W2TA 1R2QA 4IJMA 3L8YA 4ZPXA 2NO1A 3GP8A 5L3VA 2IEYA 3BOSA 4QGFA 2J41A 1NY6A 4L16A 3AP2A 3HU3A 2VLIA 4OQLA 3U7GA 2NZJA 5EE9A 2JLWA 5JJIA 2IYRA 2QPTA 3CWQA 2WWWA 2ZS8A 3KQNA 2XB4A 4LJ6A 4DSTA 4JLPA 2QU8A 1ZINA 2OFOA 4HAYA 4C0BA 2MSEB 3VX3A 3CX7A 2HXYA 2GZAA 2ATXA 2XNDD 4WW0A 3W6NA 1E2PA 2ZSEA 1E9RA 2EFEB 4JLMA 1NVUQ 4Q9KA 2AX4A 1X1RA 4LHXA 4II7A 4YDSA 2EVWX 2VA8A 1OKKD 1W4AA 3CIOA 2H92A 4EPRA 5KOYA 1TNDA 1JAIA 1E98A 1W4CA 1ZM3A 2HF8A 2ZRHA 4PR0A 5FOSA 3LBIA 2GXAA 5FUXA 1JR3E 3PIRA 4JLDA 3MG9A 3B1ZA 5CM8B 2OFXA 2VSFA 2QQEA 5EE3A 4ESHA 1XEXB 3K09C 3IIKA 4Q4JB 1Z0DA 4JVNA 3MWLA 4C0LA 1LFDB 3OAAA 2HXSA 3ICQB 4TWZA 4IEIA 1G3IA 2QTVB 1XTQA 4O2RA 4OI4A 1FNMA 4LBYA 1ZM4A 4TLAA 1Q20A 4MH0R 3KXLA 2CLSA 2Q9BA 4JLNA 4PC6A 2ZRFA 4Q7LA 3I5YA 5EXSA 3I92A 4K81B 3EWSA 5KDLA 2H57A 1ZMXA 2BBOA 2HJVA 2OUKA 1ZD1A 4AKGA 1DAGA 1Z8FA 4R71A 3ADDA 2ORWA 2R9VA 4URWR 4HDOB 4Q03A 3Q9LA 1XP8A 2EYQA 2JASA 2OLJA 4H1VA 4PAOA 4BQSA 2NTYC 3BORA 3BK7A 2ZVPX 2P67A 3D8BA 3FHCB 2RH5A 3ETLA 3HP1A 3B78A 1NNEA 1JB1A 1CR0A 1KGDA 4LC0A 4D2IA 3KL4A 3EAQA 1N6HA 1FQKA 4MYCA 2BJWA 1K5DA 2V6JA 3FKSA 3QKSA 3TH5A 4Q48A 4GPTA 1NN0A 5TDHA 3GFOA 3TVTA 2CK3D 3JVUA 2DPXA 3GJ6A 1RYFA 3QG1A 2IUTA 5L3QB 2OEPA 2DYKA 4DIEA 2Z6VA 1RC8A 4Y0AA
chains in the Genus database with same CATH superfamily
4FP3A 4Q3EA 1YJQA 4IXNA 3VJKA 4AM8A 5CADA 2RF2B 5ES3A 2R072 3K9BA 1D4FA 5F6KA 2W7PA 4QT4A 4RVUA 2CHQA 3TAMB 4HJXA 1N6KA 3F4BA 3HSGA 1BW9A 3PNBA 4P0PB 5CKNA 2Y27A 3FVYA 4MO2A 1OFUX 1FTSA 3IEUA 1GL9B 2QUOA 3OMWA 2VPIA 2GN6A 2FLNA 1L3VA 2BD0A 5IT9A 1QVFR 4X4OA 1I0ZA 5TQVA 2A9VA 2O2JA 5HJ2A 1YI9A 3AP5A 4BIFA 1ZOIA 5EJ1B 4M8SA 1NWHA 4BMYA 5GTDA 3MINA 2ZU0C 1TVCA 4AS3A 4B3MF 5L38A 3QKRB 4XM0A 4LWQA 1XTBA 2GASA 4Y1ZA 4NRUA 3AHEA 1S1XB 2R062 4IVPA 1T15A 2ACKA 4AB1A 2PUHA 3J7Z5 2PCJA 4QXMA 2XKKA 1P29A 3IODA 3PITA 3CCBA 3E2EA 1SVSA 1TJ4A 2C7GA 2WSUA 3ORHA 1TKTA 4AY2A 1Q0SA 3ZQKA 4IINA 1T8PA 3RVPA 3V6HA 3L0OA 3GZEA 3OTOB 4QHYA 5M2RA 2N3LA 2V7XA 1IN1A 2I4NA 2VYND 1LK5A 1IHXA 3ZC4A 2WVHA 4BXOB 3D4JA 3C6TB 2IAJB 5FMBA 3QWUA 4J9MA 1A4UA 2FVPA 2EP7A 1UJ5A 3VGIA 3MVEA 4FXPA 2BDPA 2DNGA 4LZWA 1VQNS 1GOGA 3AOEC 1JH5A 1PBTA 3EPRA 1KE1A 2YBEA 3DZKA 4QX3A 1XVUA 4P9SA 4UNRA 2WMDA 1RC6A 4DCCA 3L84A 3PU6A 2I2CA 4RHEA 2GMEA 2VG9A 3E82A 4PQRA 2HYKA 4AEJA 5B4NA 1OOPA 4FCTA 3UN5A 3OX1A 2KYRA 3T7CA 3AR7A 1FSZA 4YZ5A 2XLGA 4YP1A 1MVLA 2RHMA 5JMNA 2VUHB 3S2EA 3DXUA 2VJDA 3VNRA 3AF2A 3DBVO 1TO6A 1ENXA 3CH4B 4HLUC 4ITRC 1SCSA 1N32J 2NM1A 4DSKA 1UU6A 5FO1A 2MTBA 2MYPA 2J0VA 4DG1B 3U81A 4C03A 4DUYF 1EDZA 1UOQA 4ZOLB 1OIXA 5CT6A 4RBTA 4M3CF 3WL7A 5DBFA 4V0NA 4Y6IA 1T6BY 4LI3X 3GMSA 4XE5A 3B3GA 2GN2A 1Z63A 2DJIA 5A6ZA 3GNSA 4AO7A 4NLLA 2OXCA 1Z4IA 1YOVB 3NNDA 4AVCA 4G9EA 1M0WA 3NAQA 1NCRC 4I64A 3JSMA 5F5CA 4P5EA 1QHYA 1T9ZA 3SEQA 4EFAC 3EIOA 1OJ7A 1Q81T 4UCXA 2EFGA 1SZBA 3OCXA 4LO6B 2QDNA 1IUKA 3TTTA 3R5HA 3AVYA 4IG9A 4G26A 4YRCA 4RFRB 4Q82A 2BUKA 2Z4PA 1ZU5A 4C43A 5COQA 2CAUA 4TNOA 4E6PA 4Q7KA 2AKWB 2R8BA 3PNMA 1JDBC 4PWYA 2CLMB 1X7WB 3LX4A 1R9GA 5BV1A 3V4ZA 5G4DA 3HHPA 3MJTA 1JQEA 2QQIA 5IJAA 2JFPA 4OZLA 4TQUS 4NJEA 1K4MA 1QZUA 5DO9A 5IX8A 1S6PB 4HT7A 2Y0SD 1FX5A 1QH6A 4K9OA 1ORRA 3D64A 2O0HA 1ZVKA 4IEFB 1FYDA 4BY9E 3L9JT 2YQ1A 5C5UA 4HZIA 2H54B 2W6NA 4PU0A 4IEXA 4HYYA 3A2LA 2DJWA 5HF5A 1S57A 3TUJC 1M2GA 3E22A 1CS4B 4AGRA 4QPXA 5A71A 1G17A 3HCBA 1HBMA 2D2FA 2WB1D 2V9ZA 3ZIWA 1L7OA 1LPAB 4LTMA 3IBTA 1UW4A 1X2EA 5DDQC 4CM9A 2D6PA 5KKNB 4ASMB 3ZJUA 3V48A 4GJYA 4URFA 2ZUTA 4G1EB 5CFPA 5DTQA 3WGTA 4ES1A 2XLBA 2FP4B 2E51A 1XZ8A 1ST2A 3GH3A 1QNFA 3Q8CA 1XU9A 5H9FK 3D0QA 4CDXA 4R9SA 5L3RA 3Q3HA 2XECA 4DT1A 4WXRA 2NIPA 5ADWA 3EYWA 3VI3B 3RS6A 4HGOA 5GP1A 1AHSA 2VDMB 2JHAA 4NR0A 2B46X 2AJFE 2VJKA 5JNUA 4NZ6A 1KP3A 4HGYA 4YEAA 3QWPA 1EWVA 3ZVXA 4B3FX 3EFBA 3K70B 2ZAHA 1G66A 2Y6LA 3OTHA 1GZWB 4X63A 2G5PA 2DF7A 1S4CA 5C3RA 4NBSA 2VG6B 1SLBA 1AL23 5CDUA 5T57A 3OY8B 1JODA 1FSFA 2LV8A 3I0RA 1I4TD 5L4SA 4NIIA 5KFNA 4S12A 2GN0A 3WYDA 1QRSA 3VDBA 3R7SA 3SKJE 4IH7A 3LUGA 4O2BA 3T3HA 2HA0A 1AZDA 3PXBA 4AVBA 1GMVA 5EJ9A 2VSQA 3IDSA 4G63A 4NR1A 3HEBA 4F9EA 3UVJA 3H0OA 5A70A 2LCQA 4CKCA 2RAUA 5G4KB 4MJ7A 4FS1A 2W37A 5F4BA 3TAPA 1GZVA 3GEIA 3TYJA 4ZU6X 2VAXA 4ZDKA 2P2CB 4G5QA 3MJHA 1IJEA 2ORYA 5EJ4A 1QTQA 1GNLA 5T7LA 4X20B 1KD7A 2YPYA 4EHAA 5JCOA 5L7TA 4P5YA 4L8WB 5KC9A 5ER9A 2AACA 1RMU2 5AVRA 3I5BA 3MAAC 1NB2A 1G9AA 4IIXA 3PW4A 1C80A 4ZV4A 5CG1A 4A6EA 2QW1A 4MKIA 3ZI4A 3PX6A 2Z43A 4D8YA 3X1WA 1OE0A 1VRTA 2V5HG 2G09A 2J8SA 2JDHA 2OP1A 4RWXA 5E1DA 2PUTA 2WNUA 1T1IA 4H9GA 4MWZA 3H8UA 3E4CA 5DNDA 2I6WA 3QT7A 1AGRA 4Y1FA 4QDQA 2YNGA 4ZN1A 4XIFA 3ZSEA 2I7DA 3K4DA 4KXVA 1WORA 1VLVA 2B4TO 4WD3A 1ZNPA 3TS1A 1IXZA 1REVA 1KERA 1MXFA 3TXXA 4EFNA 5K8CA 1AOXA 2PGIA 4YFYA 2A9OA 2QG9A 3POJA 4CMCA 1OVPA 3ASVA 1EK6A 2EC2A 4KR0B 3B1KA 2EW8A 6REQA 4MWEA 1G6Q1 3IQXA 1DC5A 4KAAA 3A3NA 1AKVA 3AILA 2ZUVA 3B93A 4H17A 4JBIA 1U2CA 2MZRA 2W6ZA 1AUSL 2JJQA 4YGCA 2G0CA 2Q4DA 2ZRDA 2ROGA 3DDSA 1FKPA 2C5FA 4FR0A 1N0HA 5K20A 2PD3A 5LA1A 1YQQA 3QF7A 4L99A 4LOHA 3MOGA 3UJPA 1QYRA 4EHBA 2JDNA 2J3EA 4KG7A 2B69A 5C31A 4M60A 5CA6A 2PA8D 5JRJA 2H11A 2QG6A 3WHIA 3WIEA 4CKWB 1KEEA 4C7XA 3TR5A 2G67A 5E3IA 1G21A 4C5AA 1FVQA 4YM3A 1B00A 4JJAA 3L02A 1U6BA 2WFLA 2RAQA 4FFRA 3VBSB 1IKWB 2XSFA 3DQPA 5F3CA 1NOIA 3NT4A 1EFPA 1OOPB 3NWOA 4UHDA 1EX1A 2KB2A 5H59A 3P9QA 4L3NA 3I8OA 3MJCA 4JWKA 1OZ0A 4YP9A 4G4GA 3KK3A 1RT3A 3W60A 5I9SA 1G2QA 3E5XA 4ZPAA 3D7SB 4CIOA 1ZZFA 1QS0A 1KWKA 4MAKA 5LLSA 1YKWA 1LCLA 2QJFA 3KV3O 2ZZQA 2I3GA 1PDOA 1QRTA 4KN9S 4XWKA 3EYPA 4HSJA 2JKXA 3OIYA 3R23A 4I9NA 3Q22A 4XM2A 3I9ZA 1YMQA 5CBKA 2X0DA 2AYEA 3G82A 3D0RA 1WMDA 4MRAA 2VHZA 2VFSA 2OPPB 5TARA 4UVHA 4ZD6A 5FH9A 5C1IA 4R41A 2DGSA 3AOBA 1DEKA 4PLMA 2JHFA 1KE2A 2ZWPA 3DVAB 4P7FA 1NFQA 3EZUA 4F4ZA 3IE1A 4QPZA 2O2SA 2HLEA 4TS4A 4PE5B 1LOCA 3I59B 4KE5A 4ZQIA 5JR3A 5CZVA 4U67Q 1FFSA 5KR7A 3HSSA 1YJCA 4HDNA 3LGSA 1PX0A 1L2TA 1R7RA 2RHGB 3PUWA 1J8DA 1O0SA 3L4BA 4P75A 3T5TA 4QQOA 1RB0A 4PO8A 2RT3A 1X19A 3IVXA 5LZ9A 3DBLB 2GS8A 3HCAA 3U48A 2VLBA 1XA3A 4ZICA 4OGLA 4BFCA 1E6UA 4MUNA 4FUTA 4PIYA 2W4QA 1Q21A 3KT1A 2X15A 2M6KA 1QSSA 4RGVA 4IDAA 3E58A 3C1AA 3P1IA 3E81A 3P0JA 1PQPA 1NXD1 4OXRA 1DJPA 3YASA 1EETB 1G20B 4LBJA 4IE5A 4EYHB 2D7CA 3LNCA 5SY4A 5A7GA 5DV9A 2GYYA 2WP0A 4L02A 1U7TA 3PO5A 1KJQA 2XYQA 1U5IA 5DN6D 2HWTA 2XBLA 4LVOP 5ABJA 1N5KA 4F8JA 2UKDA 3MCUA 1FFGA 3KE8A 4DCPB 5RUBA 2W01A 4EY3A 5ETNA 3VKFC 2M70A 4RKUC 4F4KA 1XMIA 5CITA 1CZOA 4NA3A 3DYPA 4NYMQ 2KLHA 4MZUA 3EMDA 2BZDA 5LZ8A 2QMEA 2GO8A 1TVMA 5CNMA 1NXVA 3VZMA 1MS3A 4NEZA 4HZFA 4RQPB 3ZGNA 4KXWA 1W87A 2RAPA 1FA0A 3K72B 1H0BA 1T35A 3VVTA 5FMCA 3QYYA 5K2OA 2J3HA 4S3MA 1P3Y1 1TIPA 4P4LA 3IMFA 1R8JA 1ACLA 1BJKA 2ZU6A 3I0RB 4NA2A 1NE7A 2VC9A 4GXTA 5KVAA 4CCOA 1YVPA 1IN5A 4CDGA 1KJRA 4TTRA 4Q4Y3 2E63A 3U13A 2ZUUA 1AX9A 1Y4ZB 2WIIB 4BNUA 2L9WA 1SU4A 3FFQA 1NLFA 1NNSA 3EZ5A 2ATFA 1X39A 3KPVA 3R5AA 1WTBA 4Z6KA 4B48A 1NVWQ 1O89A 5F32A 3ZFEB 1MO6A 4CMAA 4H0FA 2IMOA 1HNNA 2FKAA 3PRJA 3WKCA 2RM23 3MLEA 4IDNA 3UWSA 5FJHA 1D4OA 3RYCA 5J5VA 3MA0A 4HAXA 1NCQB 1Q1GA 2NUPB 4KQCA 3HXKA 4XYGA 4WZQA 1T0UA 4R0EA 3GQBA 4PFSA 3MMAB 5F8JA 2E85A 1AGXA 2ZTLA 3ZWBA 3N2YA 1UC4B 1UBLS 1C5KA 2YL2A 4R7GA 2FDGA 1X6VA 2JKZA 1W5AA 4AQYF 2XNDA 2R1TB 2IY5B 5DWQA 4Q1FA 5EJIA 1OKKA 4YC7A 4EN9B 1VE1A 4DCUA 2WNUB 1TE1B 2G80A 3HDHA 2BGPA 2IZ7A 4LBPA 3IV7A 3DI6A 1FFCA 1Q8LA 1APBA 3ZPYA 2BH9A 4IIYA 4QODA 1XE7A 4O4LA 4PNPA 4J0KA 2HYIC 1U9IA 4V1CB 4HOOA 1KWGA 4YACA 1EDDA 3CZUA 1UVKA 1WEHA 2G1JA 2QE6A 2YWJA 3ZXYA 1REVB 4XASA 2VFVA 5LEKA 4Y2IA 2XQVA 1Z6AA 4MUMA 1ECGA 3FLAA 4CCEA 2XDQA 2IWHA 5AT1A 2QG9B 2OUHA 2F1OA 4HSLA 3RV4A 3O9VA 1VE7A 2L9LA 2HGNA 2HWD3 2JZOA 2YC0A 3RYFB 4IJVA 4HSGA 1M34E 3PQEA 3WK5A 3NKYA 4B3SJ 1IONA 1V3ZA 2ZJPQ 3HLUA 3FTQA 3BBPA 5E3AA 2V7WA 3HNMA 4V0SA 2H0QA 1HDZA 1VDMA 3VPGA 3HBLA 5CVCA 4L3WA 3K0KA 1W0NA 2X3DA 4TRRA 2ZH5A 3QXJA 2NN8A 3QFCA 1L1RA 1TPZA 1LF5A 4S1OA 4TSKA 3COWA 4A8SA 3MTBA 1DE0A 5GIOE 3OCCA 3CNQP 1Z34A 4ESOA 3LWBA 2BE9A 1YO8A 4BGEA 4BFWA 1K1SA 4MQ4A 1G21B 1V3RA 3DF7A 2CKDA 3HY6A 5AXAA 3RVQA 4YMLA 4JDOA 3FOBA 2P0AA 1G4UR 2E5GA 4MK4A 2VDNB 4RK0A 1ADJA 2WFLB 4QFDA 1OLOA 2NXNA 2AEEA 3THDA 4L0MA 1KBQA 2WHPB 2P3KA 4F9FA 1HYGA 3TLAA 5B2GB 3EB9A 3N2IA 2XBO2 5AICA 4DIDA 3BO4A 3W61A 1VQ8S 2VDVE 2QQJA 3Q4GA 2ZJAA 3H1WA 3GWGA 1P1FA 2YOHA 1LK0A 1P1TA 4BB0A 4CL0A 1RAAA 1UJNA 2RMU1 2IOYA 3T0BA 5BSRA 1BNCA 2DPJA 4YO7A 2LROA 3RM3A 5JXIA 4KSCA 1RZRA 1C5IA 3WIVA 1GPDG 3MMBB 3A7EA 2ZJCA 4B3SB 5HANA 5IVEA 4F50A 2QQNA 2J1EA 3TLCA 2B7CA 1D2AA 5T52A 3E7WA 4KFBB 1VE9A 221PA 1AL22 3VI4B 2Y6UA 4TZ6A 3BIJA 5A3TA 3QE2A 4KDRA 3KB8A 5T64A 4E14A 5KMGA 3QLUA 3AETA 4NXNF 1SV5A 5CYOA 1ZM9A 3SJBA 3JQEA 2VH2A 3EGVA 3CUSA 3RQSA 3H75A 2BFOA 3C15C 3ZN5A 3KLBA 4QBTA 3REFA 4PLYA 2WD7A 1TZCA 2JA1A 2QE7A 1I7LA 3THSA 2HHJA 3IGNA 2EPIA 1MX1A 2QA4S 3ZK7A 1GCOA 3DOUA 1BDBA 5LXTB 4FYYA 5JPDA 3O8QB 3VDDC 4R2XA 2UZ1B 1WQ4A 1H5QA 4EJFA 5JC1A 1IAVA 4COKA 4X8HA 5F3TA 3PZBA 4B82A 3NDPA 1W1WA 1HIXA 3KMSA 2P9EA 1JKIA 1JHXA 1IFXA 3UR0A 3DXXA 1UZAA 1GGJA 2SKDA 3WNCA 4QDRA 3VU1A 3AUFA 1HTTA 3O8BA 3U26A 5CYMA 1RPTA 2GXQA 4ED1A 1E1DA 1GVHA 3KSMA 5T5LA 2YS6A 1YOBA 4KMSA 1HMYA 2FZWA 1CHDA 2H5JA 4F1JA 5LP6A 1MN6A 2I9PA 3PQ3A 3BGAA 5AWFC 1SJ1A 2PMBA 2I5JB 5JVDF 4HTFB 3BZQA 5CNKA 4ZRDA 1WUYA 1QQAA 3DE2X 4KRGA 1SHUX 3VTIA 1Q0PA 3QBEA 2JF0A 2BAGA 3RWKX 2DFPA 3IBGA 2EKYA 2KH9A 4KO2S 5K7SA 1PL6A 4D9HA 2JDID 1VBE3 1KITA 1HTWA 3BOWA 3E7XA 1N7JA 1ZPDA 1GKIA 1RBOB 3JQAA 2VBDA 2KYXA 2X9VA 1KJLA 1JXVA 4I81A 2G9FA 4ZAYA 4XFAA 1TO2E 1RMQA 4CV0A 1F5BA 1RVDA 3PUKA 4MV7A 2YV5A 3SYLA 4Z4QA 4UFMA 3D7NA 4FX5A 1MEJA 1X9IA 4ER0A 3TEXA 5EKTA 2XB2D 2ZGRA 4ZEVA 1YLLA 1MU2B 5ICFA 5C70A 2VOEA 4PO9A 4K5SA 3B12A 1Y48E 4YDRA 2PUVA 2X3YA 1F12A 1GZ7A 3JQWA 4CCHA 4ITVA 2A0KA 3U56A 3FDFA 4EMSA 1SJQA 2J6BA 4JI3J 1IEWA 2I5PO 1LQ2A 4MUHA 3KSBC 2FXIA 1VBYA 1NDLA 1Z37A 2I9KA 4UW4A 1O5TA 3ROEA 4RORA 1FFWB 3Q87B 5H70A 1C8NA 2E2WA 4E15A 3IT2A 4OXXA 3HJHA 4GMP1 1XMOJ 5AVUA 2MEWA 1WTAA 3N2ZB 2R7VA 1P6QA 2G9RA 3TQEA 1LLCA 2GJFA 4B3DA 5FADA 2NV2B 1K06A 4LNHA 4O0MA 2MQLA 1FNCA 4PSVA 2DKNA 3DFMA 1H2FA 4NZZA 4BYMA 5DGTA 2AFHA 2BHRA 1IGOA 1LDEA 1UZYA 1F1BB 4OKIA 3HA5A 3OXFA 1RUE3 4EEZA 4YR2A 1Q15A 4MDEA 1F8FA 2JJ1A 2GSDA 3FDSA 3H1PA 4G4JA 2DZDA 4QU1A 1PHRA 3UDCA 3VAMA 5CDSA 2G4IA 1NDPA 1CPZA 1IXYA 4ECRA 3GEPA 1UVJA 3DN7A 4IDFA 1V43A 3HSDA 2ILZA 4CEIA 2VG7B 3MR7A 4TQRA 2H6BA 1W26A 1GMUA 3IP6A 1U81A 3O1UA 5AKIA 1U1PA 1ZD8A 2JLVA 1YIOA 1P4AA 5KFDA 4M86A 5AC93 5IC6A 4ZVMA 3GA7A 2WFF3 1PEAA 4ZOSA 3STWA 1RIFA 1PJAA 2NQ2C 1NV8A 5ANNA 2B36A 3GDOA 4JYMA 2FFRA 1ZS9A 2CHEA 1U7XA 5EIEA 5C8CC 5KTKA 3UXYA 1LOFC 5FJIA 3RROA 5DTMA 5IARA 1L8OA 1X31C 1T2NA 4MITA 4JH0A 3L1KA 4FBGA 5HKKA 3RG2A 1SH3A 2IYVA 3GBGA 4BNFA 2FK8A 3OUUA 4ZVSB 5AI6A 1GNQA 2VMGA 5KAMA 1WDWB 2W4MA 4CDUB 1DKLA 1N8RT 1FP4A 4R5PA 4A3ZA 1BMV1 4G37A 1QFJA 1RBQA 5A3VA 1L4YA 4J0FA 3OWXA 2ZGSA 4JQYA 4IKEA 2JJ6A 3LPFA 1UY4A 1GNKA 4DHEA 4GX1A 1ZL0A 5A33A 4FOTA 1GWKA 4FNMA 2FH5B 3UTCA 1JZTA 3FFTA 3GRPA 2B4RO 5LQRA 1JXNA 3QIDA 4HACA 1EXVA 1FQWA 2CMHA 2WA3A 4CU6A 4FPJA 5KWIA 2CLDX 3H25A 1DGLA 1E4EB 5JMTA 3GIMA 4F3JA 1DY3A 5IV4A 1HQEA 5ALSA 2VD7A 4X66B 2C5EA 3BRSA 5FZ1A 2DTYA 5J2TB 4LAFA 4X1YB 3W9AA 3N05A 4EBFA 1A4XA 1KLMA 5KSZA 4EX6A 1KAMA 5CCXA 3T7TA 4OFWA 2DNHA 1ND3C 3SH3A 2X0NA 1U1OA 2ZZKA 3K59A 3ZHOA 2QLBA 1A9NB 3HP4A 4OXQA 4N5IX 1SV5B 4QKNA 5FBJA 3V0AB 2HZAA 3BSCA 1Z8NA 1ODFA 4O44B 4FQ5A 3FMVA 4NHKA 2D8AA 3NWBA 2HWB3 1ZWLA 4FHEA 4OJGA 1I2CA 3JQBC 1HXHA 4AG6A 1GFSA 3EGWA 1FMCA 2IEAA 2Y67A 3LAMA 1QVAA 2W2TA 3L8YA 2CJXB 2B5VA 1RXVA 4JC0A 2NXJA 2NZJA 4F67A 4U6QA 2RM22 2WWWA 2Q99A 3FRIA 1CQIA 2WG2A 1P6UA 5BMOA 2IVFB 2VG8A 1IC6A 5L9NA 3AA8A 1X7XB 1PEKE 3POSA 2CNNA 3R6TA 3UMYA 4YDSA 2EVWX 2R00C 3IJPA 3HHLB 2CXHA 4PR0A 4UHCA 2JCXA 2QDXA 3WYNA 2XM3A 1DQPA 3P8BB 4AJ2A 3R9KA 3CU7A 1UXZA 2HFZA 4KRWA 4RK7A 3HVJA 3K8QA 4TTTS 3ZGLA 4UFJA 3OAAA 4LHKA 3JASB 2XB9A 5FFOC 3EVMA 2I3DA 3H9EO 5KBYA 1JT2A 1Q20A 1Z18A 1WI8A 2G76A 4RW7A 4WXEA 3SCKE 1YJVA 2R7TA 1ISSA 1D7OA 2AYYA 3WW4A 4WFKA 3IAHA 4EMBA 3QTBA 2FPRA 3NGXA 2ORWA 3L09A 2ZUFA 3MB5A 3DEZA 3M9MB 4BQSA 3IAUA 1NNEA 4KL8S 3WQRA 3B78A 4FAHA 1EV13 5I3UA 1QU2A 2A59A 3FBTA 4AQ7A 5I47A 2NZYA 5ESRA 2C20A 3DWGA 2VR4A 5DDJ1 1LECA 1H4SA 4CUBA 3NV1A 5I0TA 1IHMA 1XK6A 2HWD2 4Q1CA 3IMKA 2A58A 4JHXA 4JI0J 1FTRA 3G9QA 5JAPA 3CCSS 3HHEA 3X3HA 3V0BA 3OYWA 2MZJA 3HSJA 1SWVA 2ZE6A 1KH2A 2OCLA 5F7JA 5EPAA 3LRPA 1OWPA 4Y4RA 4I1UA 4WFAQ 4QXBA 2XMWA 3JXOA 4MIWA 1Z13A 4WM7A 3H5XA 4MUKA 1B64A 3QA9A 5F8MA 5KT3A 3SEEA 1U09A 1CEEA 4KRXA 3VTKA 2RJ2A 2Y2UA 3H3FA 1RKQA 1G0OA 1AR71 5AKXA 4ZITA 1EAYA 1MPXA 1ZRCA 1Z17A 3AK0A 4DABA 3I9V1 1LHWA 1R6AA 4UU1A 4AHYA 1NRXA 4ZC8A 5ARBA 1GWMA 2ODAA 1QAXA 2UZ0A 1N3PA 1Y6RA 3IAXA 5EMHA 4ILMA 2WF8A 1JYTA 1ONSA 2CF5A 2J3DA 5CHYA 3LCJA 3MSCA 1T8WA 1AF9A 3NV2A 1Y4SA 3EDOA 2BMDA 3FZ3A 5ESDA 3VV2A 5JJKA 4GE3A 1WKLA 3I2OA 4BAGA 4BNMA 2FI1A 3VKUA 2R751 2XHNA 3T4PA 5A32A 4EARA 1KR4A 3ZTRA 3DMYA 2G0JA 4IVQA 1W8OA 1BQNB 3ORJA 1LGBA 3I5UA 1M6VB 2EL7A 3GEHA 3H4TA 1HE4A 2I80A 3BE4A 1SPBS 1G9TA 3UBTA 1SHLA 2A4KA 2IUUA 4JI0B 1J3PA 2JK1A 4D46A 1NOJA 1PZMA 3CCES 1FDTA 4O6VA 2A0FA 5ETSA 2PR7A 4HTIA 4BZXA 3L4SO 4DJFC 1GLHA 2RHSB 2HWC3 3SZOA 2ZJ2A 5FXVA 2F9FA 3AX6A 2VUCA 3JTPA 3D1LA 2QQWA 2KPOA 2VCHA 1T6BX 1HQDA 2D2EA 3OEWA 2HA7A 3JBG1 2HBRA 2CFSA 4BC1A 1WG5A 2BQUA 3LFHA 1ZBE2 3VBUC 2YW2A 1HNIA 2JFQA 1TUWA 2Z83A 4K3UA 3X29B 4I4IA 5CK5A 3V1MA 2CFTA 2HMTA 2HRRA 5K0UB 1VPTA 5TV2A 2WA1A 1QJHA 3SZMA 1E0JA 1NA1C 1UL1X 4JUCA 2OAP1 4Q0VA 2E1RA 3IGVA 3TPZA 1E2QA 3ASYA 2VP9A 4OZ0A 2L48A 4HS4A 3KPYA 3H42B 1KMQA 2E1MC 1E3QA 3DTNA 1MEOA 3L8GA 5DP2A 4B3HA 2BBEA 2RE8A 2OV8A 1XMSA 4CETA 2AMCB 3BD8A 2VYCA 2FJXA 4DS5A 1FNSA 3KLEA 5KFJA 3RYKA 2JGFA 4PHGA 4Q4AA 3GFBA 4QFBA 4F3KA 4DEQA 2J5RA 3AF0A 1E5VA 1ZLYA 2KS6A 4GC6A 4OYIA 1HNWJ 4HYQA 4GKYA 3AKTA 5IWCA 4BO9A 3V64A 4NOLA 4TMKA 1RP7A 1W06A 3GLVA 3P0EA 5SZHB 2ANCA 4GJZA 1J97A 3DE5X 2AEMA 4FN5A 3U1MA 1SCUA 3MGCA 3DLCA 1TTQB 1XJ0A 3ZU4A 2YKQA 3T3OA 5KPDA 1GRQA 5B3LA 3D67A 1H7WA 4H4KA 4DR2F 4ZQCB 2AG8A 2MR6A 4XBLA 3RZGA 1IBSA 4FFSA 2LVBA 1MGOA 2J8ZA 2PD4A 1UXOA 1IXSB 1H6DA 1UMBA 3O21A 2YHAA 5E95A 3TA2A 2B8NA 4LYEA 2F9MA 3HXLA 1U7ZA 3UVEA 1A8MA 3H6KA 4PSAA 3D8HA 1U5BB 2XNSA 4CDWC 1ZL2A 1KKMA 3SAJA 3WSWA 1VBE2 1NMQA 3AHJA 2A35A 4BLPA 2VWHA 3QUAA 4P5DA 3FCOA 1O3TA 3O1LA 2B7BB 1RUC3 3SCFA 1E6CA 1TD1A 5DYYA 2QLBB 1IUPA 3SXJA 2IW1A 3MEGA 3U7HB 3JRXA 4MKGA 4WMLA 5CJPA 3NG8A 1K4YA 3NOOA 2EP8A 4FS3A 1JNXX 2QJWA 4KC5A 5E0OA 4HYKA 2BFNA 3ZHQA 5H9VA 4FMPA 1NAHA 2YVLA 1ZM1A 2WU1A 2PHDA 3ZHVA 1VMAA 4BX0A 3EX7B 4AURA 5I8TA 1BE1A 1PIEA 4AG4A 3BMOB 4WZBB 1E96A 1T24A 4AL9A 3GJTA 4OHFA 1G3MA 3G9TA 4AEDA 3SDEB 4OHVA 1G38A 1V45E 2X4DA 2GK6A 4TMYA 4XJSA 3HBFA 4P6VF 4B84A 1SJRA 4CEJB 3FUYA 5CU1A 4QJ5A 4HZUB 2GN1A 5JAOA 5I9BA 3GI1A 4HDRB 4MUJA 3ADBA 2ZUGA 1ICEB 4OQ4A 3RK4A 3HMJG 4AQ2A 3FRYA 1P5JA 1Q1AA 2GNMA 2DXFA 4WBNF 1CR2A 4RW7B 2MDAA 4M7OA 4IR1A 1M2FA 2VF7A 1PGQA 1WX1A 1WD3A 1TVRB 4RW4A 5FZ7A 5C3UA 3LANA 3MJSA 1ZIPA 1DRWA 4MAMA 1IJFA 5I3UB 2IXEA 4CPBD 2HRTA 1NXPA 2WYHA 2ZE8A 3B6EA 1P2DA 1CIYA 1L4UA 4PANA 4IRDA 5DRTA 3E3NA 1UOJA 1H2RS 2A2ZA 5KBFA 3HYSA 2P91A 4HAIA 1Y5MA 4DRYA 2HIMA 1TKZA 3RASA 4LHSA 1QM5A 5AC92 1Q78A 1R091 1E2IA 5A2QA 3NGSA 2XJTA 2B7YA 2WFF2 2JH9A 5I7FA 3LL4A 3UA3A 3OV7A 3CJTA 4YAGA 1FZQA 4ECWA 4A16A 3T5HA 3F98A 3O5TB 3B60A 3H2IA 3UD5A 5ALLA 2GQ0A 3L8EA 1ACCA 4ASUD 4DPOA 2O05A 4DR5B 4WM7B 1RTIB 3ZGOA 3VYTB 3EXAA 3J80A 1AF7A 3BMQB 3WNOA 1K6IA 2Y1DA 4LRAA 4QPDA 3H5UA 4HUJA 2G0AA 4TY8B 2VA9A 3HCOA 4BLVA 1TAHA 5A0VA 3WF2A 3KLFA 1IBCA 3WYAA 5FAXA 1G4HA 2J9RA 1NSKL 5CA1F 5EY5B 4ZCRA 1QZTA 1B0AA 1HMPA 1FXLA 3J7AN 1CEXA 4Y2VA 2ZWAA 1Y7HA 2Q5FA 1FE8A 5A8WA 4Z8BA 3A6EA 3I31A 1HNVB 3ZDCA 1PW5A 1ZKMA 3VV2B 4H4DA 1E3TA 4D4JA 1C57A 5KNBA 4DZ6A 4MOWA 2QVZX 4DL0C 4ZOCA 3C70A 4W6QA 2GYWA 1E18A 1GTMA 1GP5A 4KGDA 4ZPWR 4XUDA 2VOPA 1OXKB 4B75A 4DXAA 5EIXA 4C1XA 2M3DA 5CEFA 1YYNA 5DGIA 2DH5A 2PTMA 4GU5A 1LENA 4RR3B 2JAUA 2MEV1 4TTIA 4A26A 1UFKA 2MHCA 3IA7A 2O3RA 5IABA 4B9NA 2I3ZA 1E79D 4XJXA 5GADl 1REQA 1N3BA 2BM9A 3ZYRA 2X1LA 3G71S 4NHEA 5IYZF 1GYQA 3AL2A 4IH5A 4UNSA 1BWQA 4P80A 1VSQA 3E2PA 2LFVA 4CEYC 2HBRB 1QH1B 4BB3A 1KU0A 1PSWA 4O3PA 3AM2A 5D6OA 5FYTA 1V16B 2WKQA 2P7IA 2EBEA 3AL5A 5KOJB 2OQRA 4DLZA 4MJKA 5HI0A 2X1MA 3SLRA 4Q4JA 2R8YA 5DQHA 4UOHA 1OAOA 4ZEWA 4W9NA 4QW8A 2F1RA 4NRMA 2VBWA 2FD2A 1OUSA 4LA2A 3PPXA 1HQKA 1R081 1XPOA 4FWIB 1KK3A 3GPBA 3OE4A 3FY4A 5GJVC 2CLIB 3ZE0B 4YQZA 1ZICA 4ZI7F 1W8IA 5AJTA 3WICA 2JCYA 3FPHA 5E6UA 3VVCA 2O5VA 3KLEB 1Q0RA 3FYUA 2NN3C 5HRUA 1JQLB 2LA6A 1O3RA 5HJ5A 5LZ7A 5E9QA 1TJ5A 3AB8A 4AS2A 1YASA 3HHDA 2C1EB 3LF7A 1OXUA 2Q0QA 4MWBA 3I2YX 5GZDA 3L49A 3KR2A 1QG6A 1W8HA 1C30B 2Z8QA 1RHRB 1N7IA 4TWTA 2FY8A 4C78A 2XUHA 2RF2A 4EVRA 4YEDA 1D09B 3FWKA 4YRKA 3UXMA 3TAMA 4HUQB 4NVPA 2OMLA 4JT2A 3DOOA 1CEQA 2ENRA 1EV12 3GGJA 3FSXA 3DG9A 4X7BA 2VHWA 2I1VB 4KNWA 4JL8A 5KJFA 1BH6A 3HRKA 4GGOA 4Y98A 2RMLA 5FWYA 4Y1XA 3W3AH 3LOUA 4OQFA 3ZD6A 3HPOA 2C54A 1QZXA 1GCGA 3ABSB 1SZCA 3GRCA 2J0EA 1X7ZB 5EOVA 1SACA 4AI0A 1A98A 1O4TA 4F2HA 3W3AD 4AMBA 5BSFA 5JTTA 2I6TA 3TM5A 3QKRA 2TRSB 2IV2X 3M2TA 5HFJA 3W6PA 1C0TA 1S1XA 4U7DA 2EK6A 3IFSA 1VL8A 3UAWA 1PT9A 4DF4A 3MEGB 3L0SA 4CMKA 3DRSA 4NG5A 4Q4V1 2W9AA 5HI7A 1E5SA 3R6LA 2M6LA 3LQQA 4OTZA 3ZDAA 1SOAA 4I8IA 2FW9A 2CXTA 1MWQA 4GP9A 4OQMA 4DBLE 1DC3A 4EF4A 1S79A 4RQTA 4QXRA 1XJAA 3UB2A 2QBYB 1ZX1A 1DQ1A 2YN2A 1VLMA 4R0NA 3H11B 3CKKA 1DX6A 3QJJA 2O2CA 3P27A 3RUAA 1VLLA 5HJ7A 5CX1B 3MFQA 1D2NA 1GRRA 5L1JA 1IPEA 4BXOA 3UAXA 2PEHA 2EFPA 5LXRA 3U9LA 3I9MA 4OUDB 1W6NB 2V9KA 3C6TA 4NG4A 1O0CA 2IAJA 2VNVA 4QG7A 1L7RA 4IQFA 2E4ZA 1R0CB 2VZ0A 1HRI1 4PLGA 2XVKA 4AEDB 2VH7A 1RRFA 2ORED 4C2TA 1JUIA 2CV2A 1TE2A 1MO3A 3AR2A 2R2RA 1RT4B 3ZSMA 4OZ5A 1D6JA 2Z58B 4TT3A 3VOBA 2G2YA 3O8WA 2AKAB 3W05A 4QAJA 4M8IA 1OFNA 4DLTA 4IO1A 4DOZA 4WF9Q 5BNWA 3RFVA 1N6NA 1M7BA 5DG9A 2P6MA 4CDQC 4XLTA 1KRIA 4CEWB 1E77A 2LD4A 2VZPA 3IKWA 1YRXA 4CO4A 2DWCA 2OORA 3OLYA 4M5DA 3HR9A 2V59A 5H9WA 4UZEA 2BDEA 1IZ0A 4NLRA 3VNSA 2AYMA 1JWBB 2HWC2 1EZZB 2OYSA 1RMU3 4GRDA 3QIVA 3LDAA 3R8FA 4MS4B 3GYXB 2CYYA 2XGGA 3MWYW 2IY8A 2OZEA 2ZKIA 2AXQA 2YY7A 3W5ZA 2ZBEA 4ZOLA 5E8AA 4K88A 1HV0A 1A76A 4XDDA 4MMZB 5FFFA 1NF8A 3ZNJ1 2OP0A 4DRVA 2YN0A 3M9NB 3D4LA 4I6YA 1Q8OA 4CUCA 4LV5B 1YOVA 3FA2A 4Y5SA 4DV2F 4XF0A 4EUSA 1W36D 3WI7A 1GEEA 1OKQA 1TQDA 4H3KB 3CX4A 4YRFA 3IE2A 4C6SA 4JGBA 3NT5A 4GVBB 1CULC 4BBPA 1UCNA 1PTKA 3FFWA 2IEDA 3MRXA 3ZXDA 2FMTA 5JI7A 2FDHA 4FILA 7FD1A 2WA2A 4UNNA 1X7WA 2GCNA 1IBCB 4FYMA 1R18A 2VHYA 3NH9A 2JGRA 4DR7F 1R8QA 1W46A 2X5KO 3OPNA 5D0EA 1URXA 2WJ3A 1S6PA 4DA6A 5HA5A 2FN8A 3WYBA 1I7PA 1VRH1 2R3SA 5KC6A 4JNKA 5F33A 4FOYA 4LFBF 1SQSA 3TFWA 4EFKA 4UW5A 2ZFUA 1PL8A 4JDUA 1AUPA 5A8WB 2QM0A 1QRRA 3UANA 2H54A 3RG0A 5F3DA 3SEOA 4OYHA 4DFDA 5JALA 2WIBA 2F40A 3VV3A 2ZIAA 1CS4A 2MSKA 2B43A 3FF4A 3GPAA 1C0UB 3BYWA 1BO6A 1EGVB 2PX3A 4P0TA 1E64A 1C7RA 4PPDA 4FF4A 3X1XA</