2NPIA

Clp1-atp-pcf11 complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
428
structure length
428
Chain Sequence
b'TGDNEWHKLVIPKGSDWQIDLKAEGKLIVKVNSGIVEIFGTELAVDDEYTFQNWKFPIYAVEETELLWKCPDLTTNTITVKPNHTMKYIYNLHFMLEKIRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVDDVYKRSLQRTSIREYFYGSLDTALSPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALITEVNEKRRKLRVLLPVPGRLPSKAMILTSYRYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CLP1
publication title Structure of a nucleotide-bound Clp1-Pcf11 polyadenylation factor
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 105
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1
A PF16573 CLP1_N N-terminal beta-sandwich domain of polyadenylation factor
A PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1030 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2npiA01
3.30.70.2410 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2npiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2npiA02
3QPWA 2D7CA 3KL4A 4KODA 1ZNXA 1II8B 3CZPA 5AJVB 2ZJ5A 3NBYC 2FDCA 2A5DA 4D6PA 5AK0A 2J5XA 1YZLA 4QGFA 3X1YA 2GZAA 1XMSA 2EYUA 3AF1A 4LRWA 1XF9A 3DPUA 1W1WA 1CBUA 5IK2D 5L3SA 2QSYA 2BMEA 4OHVA 4LJ8A 4Q4AA 1BO6A 2BKEA 3LVQE 1WCV1 4HI0E 1G9XA 5JS7A 1ZCAA 4MRRA 2ZRLA 3U7EB 3MGCA 4ZDWA 4LBVA 3EPLA 3KXKA 2J45A 1S1CA 5TY0A 2KE5A 1E9BA 1I2DA 3WBKA 5KPJA 1RFLA 4ZDJA 1US8A 1Z0JA 1KSFX 1EGAA 4Q02A 1TU3A 3FKQA 4DT1B 3QKTA 1VG8A 2H5EA 4O25A 2GWHA 3R9XA 2IBMA 3KJIA 2FMXA 3IILA 4YONB 4MA4A 3NBXX 1G64A 3CKLA 5KO2A 3ADKA 1CR0A 2QPOA 1JXMA 3PEUA 4BEJA 1FFHA 1G7RA 3THXA 1G3QA 1E6CA 4DLWA 4L15A 1XEXA 2JDIA 1KZ7B 5J4KA 1ETUA 2VHCA 5DYIA 1OIXA 5TARA 2NMVA 2WJGA 4JLNA 4JL6A 2FG5A 3HU2A 3X1ZA 3ZYCA 2XB2A 3SHWA 4G5SA 2R6DA 1SXJE 2CLCX 1AGRA 2HJVA 4U7DA 2BHRA 1IN5A 3EPJA 2QBYA 3LDAA 1FTNA 2ZRNA 1VTKA 2PT5A 2JJ1A 3QKRA 3W3ZB 4Q1DA 1BS1A 3RS7A 2GF9A 4ZCLA 4EIWA 1MOZA 1P75A 2QUZA 3THWB 3U44A 4PAQA 1HQYE 4Q7JB 4M1WA 4M8NE 4QL3A 2A5YB 4EQ6B 4IDOA 2PLRA 3KZ1E 1R7RA 1E4YA 4RJLA 4WZAE 2SHKA 4PHGA 3LLMA 1YR6A 4LJ5A 3RS4A 2F6RA 1A5TA 4W7SA 5L3RA 1P9WA 5E7IA 1QRAA 2WSMA 2X19A 3GLIB 2IS6A 4C2UA 2YYZA 3UK6A 4YMSA 3U7HB 2CLSA 4DZZA 1KIMA 3OAAD 4QJ3A 1DE0A 1KK2A 2YWGA 1XTJA 2GTPA 2WWXA 1RW4A 3AVOA 4ZKEA 3Q72A 5CYPA 1ZRHA 2EFDB 3BAFA 1CR2A 3DHWC 5FOWA 3RNLA 1IXSB 3HDTA 3BWDD 5A0FA 5EE9A 1N5LA 2PMKA 4JLVA 4Q9LA 4EFNA 1PUJA 5FPYA 1Y63A 3BORA 1N5JA 4C0SA 3GPLA 1ZU5A 3CR7A 2CL7X 3KDSE 4PO8A 3I73A 1HY3A 4QHYA 4R98A 4TQAA 1HURA 1P3JA 4RFSB 2IT1A 1Q1ZA 5FR2A 2VL7A 1EX7A 2PEZA 2XTZA 2RGCA 4LK2A 4NBSA 1E2KA 2CK3A 2FX3A 3O47A 3ZQJA 1QHYA 1T0HB 3RSLA 4A6PA 2YWEA 3RS2A 1JQJC 2ZRJA 2WV9A 4BFTA 2R6FA 4HZIA 1B0UA 1VYVA 2BJWA 4LJYA 1NNEA 2P6RA 4PAOA 4RD6A 2C9YA 3B5JA 2J1LA 3OEHD 4P31A 3C5CA 3NHAA 2VHUA 1KZGB 1DAMA 4OK3A 5KSOA 2N46A 3PENA 3CRQA 4WZ6A 2A5FA 3I92A 1E99A 1CTQA 4RZUA 3K0CC 5KUTA 1OXSC 1OFIA 4KU4A 4PPFA 4DB2A 4Q4JB 3DKPA 5LB4A 4IEIA 4L9SA 4A0HA 4YQFA 3ZD6A 4HAXA 2FEOA 4JVSB 4AYTA 2GXQA 1KSHA 3QKSB 2BMJA 3M6AA 5EE0A 1HUQA 2PT7A 1KI8A 2A3RA 3BK7A 3I8XA 1KKMA 1XTSA 6Q21A 1UFQA 2FGKA 1SKQA 3CF0A 3KTAB 5EE3A 5FI0B 5JRJA 3ONWA 5EE1A 4DCSA 1RRFA 1G6OA 2GNOA 4EJSC 1T6NA 3I3SR 3M4YA 2IHBA 1KAOA 3WNCA 1Q57A 4RD3A 4L16A 5DI3A 3P27A 1LS1A 3AUXA 3ZH9B 1Q12A 3D7MA 3OEEA 4DEXA 1E0KA 1GTVA 3DEFA 4JT2A 4ZPXA 4BPBA 2HCBA 3KB1A 5JZVA 1U9IA 4A36A 3UIEA 3ICEA 3CR8A 1XXHA 3C41J 3W6PA 3I72A 2ERYA 5CB8A 1YZUA 2D74A 1T3SA 2LCFA 3SBEA 1E9CA 3B82A 1WF3A 3QQ5A 4CT4B 2F55A 4EPTA 2ORIA 1VCIA 2IUSA 3ECCA 3K53A 3NC1C 4LJ6A 5JSZA 3U4QA 5EP3A 1IOZA 1UDWA 4TMVA 4BGDA 4QBHA 2Q3HA 2WIAA 2NQ2C 2QT1A 3W90A 2W2VA 1TEXA 2JLZA 1JAIA 4ARZA 2EVWX 4NYMR 4RFVA 4JKIA 3KQNA 4KSBA 2MSEB 1NY6A 4I99A 3SYNA 5KDDA 3RSOA 1VIYA 1DAFA 3B1WA 4G01B 3TSOA 2H18A 2ZYWX 3LO5A 4D80A 4Z51A 2WKRA 2QE7A 5DGXA 5FUWA 4HB3A 1X1SA 4MDFA 1XZQA 3DDCA 1AJEA 3SJCA 4AYXA 1FQJA 3TH5A 3GEEA 3A6PC 3WRXC 2QG6A 3AVTA 2Q9AA 1YZTA 4B3GA 1TX4B 3LXXA 3ZVNA 4BLPA 1N5IA 3SBDA 3VR5A 5KOYA 2HEIA 2ZM5A 3HYRA 3A1UA 3EG5A 3UATA 3PR1A 2X2FA 1X8KA 3OIYA 1YVDA 3QNUA 4TYWA 4KVAA 1VCOA 3KKMA 3AQ4A 3WMGA 1MR3F 1JNYA 2BMDA 1Q21A 1LFDB 3NC0C 1JB1A 2AK3A 2W6ID 2PL3A 4JL8A 3WBJA 3LW8A 3GLFA 1JALA 2H17A 3I62A 2ZR0A 1MV5A 4QBFA 1GDDA 3TVDA 4B2PA 2CMKA 2CNWA 1EFTA 1E94E 2ZTSA 4GP6A 2FZLA 4RSGA 3BFKA 3PITA 1UM8A 821PA 3PEWA 3EZ9A 1G7SA 2ERXA 1COWA 3S1AB 3WMFA 4BFXA 5JS8A 4G5OA 1ODFA 3K0FA 1XMJA 4PPGA 3LNCA 5EUMA 1VG9B 1TADA 3VKGA 3CM0A 2J7KA 1YRAA 2WWIA 2H1LA 1G4AE 1W4RA 4WAUA 4A2QA 1P7CA 2ZU0C 2WAYA 1E98A 4DDUA 2J7PD 1NRJB 4HB4A 2CJWB 1XWIA 4C3ZA 2OILA 2VSFA 5FPKA 2E9SA 4CYMA 3SJAA 4EJSB 3C5HA 2QRZA 2Z0MA 2QRNA 4CEJB 1XMVA 5J4VA 4KYIB 1NIJA 1Q44A 1YU9A 4OJKA 4M1MA 3KKNA 5E7JA 3TSWA 3WNDA 4DCNA 2AWOA 2G6BA 3CRVA 2R6GA 2VP0A 1ZM3A 3SYLA 2FPKA 1XJQA 1NG1A 3GLIE 1G5PA 4JVNA 3AP1A 1P60A 1QG4A 2BBOA 4Q4HA 2ZU6A 2QMHA 3C7KA 1AS0A 1SULA 4MGKR 4BLTA 1KI1A 4TLAA 1ZD9A 2FV8A 3K0AA 2ONKA 3QXSA 4P4UA 1NVWQ 4B3DA 3IHWA 1N0UA 1FL9A 2ZAMA 1Z0KA 2O8BB 5JFGA 4DDWA 3A1WA 2HUPA 3QVVA 5G3ZA 2W83A 1E2IA 1G4UR 1XTRA 4F91B 2IUTA 2VQSA 1RPZA 2G1KA 4PHHA 4TTPA 2GK6A 1UKYA 5FL7A 3R7WA 3EWAA 2NIPA 3FMFA 2BBWA 3OESA 5IF9A 1S1MA 2UKDA 2V4ZA 5SZIA 5JBQA 4GSYA 4TMXA 1QHSA 3QENA 4GDFA 1U8ZA 2ZITA 5H1YA 3UMRA 3LLUA 4PHFA 2ZR7A 2DFTA 1GP2A 1VCNA 4P0TA 4B74A 3ZIAD 4QFMA 1EWQA 2BMFA 4OHZA 4K46A 1P72A 1CIPA 3L0OA 4OL0A 2OXCA 1E0AA 3K9LA 3TR5A 4CEIA 4A0FA 4XVRA 2WICA 4F93B 1GG2A 2P2LA 1W0KD 1N0VC 3T35A 3GJ7A 3WP0A 4Q1CA 1G5TA 2HLDD 1WDTA 2WWGA 2C2HA 4LJ9A 2QY9A 1K5DA 1OXVA 2ZROA 4PR0A 4NL4H 2J87A 1DO2A 4IXNA 4MGIR 4PO9A 3UKDA 2ECKA 2QM7A 1FUKA 1MO3A 2WAXA 2ZS8A 3Q85A 4HUQA 1C1YA 4G3XA 3G82C 3EC1A 1E1QA 1I4LD 1KI6B 4PFSA 4LHXA 1II0A 4JSTA 3BFXA 4OQXA 2VHTA 2A9KA 5P21A 1WP9A 4PAMA 4MKIA 3ZJYA 4B35A 1DPFA 2V1UA 2X2EA 1IXZA 5FTKA 3WY9A 1Q1EA 2F7SA 2QMEA 3KJHA 1G7TA 4OQLA 5FOUA 1KI2A 5GVSA 2BBSA 3LQRA 1IM2A 3A1SA 4B47A 1VHTA 1DAGA 4X8HA 5HCIA 4D82A 4FMCB 2ZRFA 4WVFA 2EU8A 4F7WA 5GJCA 4PSKA 3IBYA 4A2PA 2R62A 1EFHA 2WMNB 4EPWA 4F4IA 4O3MA 2O52A 3CX8A 3QKUA 3EXAA 2ZE5A 3BXZA 4FD2A 1ESMA 4QJ5A 3QXJA 3WMEA 4BRUA 5JECA 4B3CA 2V6IA 3CNLA 3IEVA 1GIAA 2C98A 1Z47A 3CRMA 5F9HA 1IBRA 3FHCB 4JYCA 5JWOA 1SKYB 2WBLC 3HU3A 4V0OA 1S9DA 3G5UA 5FUXA 4A0RA 1NKTA 1H65A 1NN3A 1KI4A 1T0JB 2P0EA 2P67A 1J2JA 1TU4A 5E7MA 4GOJA 2VF7A 4JKYA 1BYUA 4MUBA 3GCGA 1AKYA 1G18A 3VQTA 4DSOA 2XZOA 5G3YA 1UF9A 4JVLA 3RVBA 2HCJB 5HZKA 5IDVA 4IDQA 3B1VA 1GILA 5K8UA 1U99A 2IXGA 2JCSA 3U3OA 1GRQA 4GBMA 4LPSA 4A15A 1LF0A 2D06A 4TYQA 2Z6VA 4NKRA 2W2TA 5CK5A 5L3SB 5GADl 4Q4AB 2IYUA 1FPMA 1ZU4A 1W49A 2QPTA 3CPJB 2OFOA 4M9XA 3UWOA 3DMDA 1RVDA 1E79A 3TAHA 4RVCA 4OHYA 2XTMA 3B9PA 3U6KA 4Q7MB 3K1JA 1US8B 3UANA 2PCJA 3RC3A 4X8LA 3TMKA 3T5GA 1R10A 5DN6A 2GXUA 3RDPA 3VR6A 2IYTA 5EXXA 3KJGA 5FTNA 1D2MA 1M74A 3BC1A 1GRNA 4ZI3A 1KAGA 3I5YA 1ANKA 4EUNA 3P4XA 3CO5A 4NCJA 2RAPA 5DHFA 3IDQA 5HE9A 1ZM9A 3CBQA 5EJEA 3THXB 3QG1A 2IS4A 1XEXB 3B85A 1NN1A 1P5ZB 2PX0A 1SVOA 1UPTA 2AFIE 4DHEA 4MQBA 2J9RA 1YZGA 2YOGA 3WYFA 4EFLA 1H8HD 1X8LA 3OFNA 5J40A 2G0TA 2OBLA 2RH5A 3W34A 1U9IC 2JLRA 5G41A 1ZCBA 2JJ2D 1G8GA 1NF3A 2IL1A 3GJ0A 1JR3E 1N6KA 1P2SA 4JT4A 3VKWA 1OB5A 1L8QA 2QBYB 2O8FA 1GKUB 2ZI6A 2ZSFA 2V8OA 2PZFA 2EWVA 2YOHA 3IGFA 2ZUBA 2REOA 1KO1A 2Z83A 3QKRB 2A78A 2NO7A 4MKGA 1XTQA 2GVDC 1HTWA 4XSGA 3MJHA 3U44B 4HLQB 1P4SA 4RKFA 3J81k 4ESVA 4I1SA 2VIIA 1NLYA 5AJZA 1M1YE 2J0VA 3QJYA 2OXRA 3PJRA 3HYTA 2UZIR 1U81A 1E2FA 4R2HA 3PEYA 1GNPA 1G7CA 4ERNA 2ZUCA 1Z2AA 3ETLA 1IAQA 1W5TA 2H92A 4V0KA 3U6BA 3SC3A 2QU8A 3Q5EA 4UQOA 4B2IA 4YC7A 1KI7A 1Z63A 4Q7LA 2MSDB 1N6HA 1T3LA 2OBMA 5A4JA 3EASA 4LY6A 2JIZA 4PSVA 1JJVA 3T1QA 2FSFA 4UNSA 2J0UA 3VNVA 1XD8A 1Z0FA 1E32A 4LV6A 1P2UA 2NO1A 3UXMA 5TVKA 2HF9A 2VTKA 3BE4A 2HXYA 3IO5A 2CXXA 2YOFA 3VR1A 3K9NA 4Q01A 5CYOA 1W46A 5E95A 3R9IA 1CJUC 1KMHA 1E9RA 1MRNA 3CRRA 3AVUA 5H70A 1H8EA 1WA5A 4CDGA 4URXR 1T91A 4GRAA 3PUZA 4C0JA 4IFEA 3VNUA 4A4DA 4I4LA 3GMTA 4QRHA 4KFSA 1S0UA 4LOAA 3AB3A 3FMPB 2JLUA 1OXTA 4BZPA 4G5GA 4FCVA 2ATXA 1NBMA 2PCLA 5J4YA 1AS2A 4LHWA 5F98A 3R9WA 1L4UA 2OCPA 3HJNA 2AWNA 2FFQA 2RKOA 4PO1A 1EFRD 4X8OA 1AZSC 1HT1E 3DM5A 4HAWA 2VLIA 1TMKA 4GNKA 5JWRA 1UBEA 1UEJA 2IYWA 1A82A 1Q1BA 3K8YA 5FI1B 1A2KC 4TZ6A 1HE8B 5IK2A 5UKDA 1QHIA 1LY1A 3FKSD 4LBYA 5HTKA 2PH1A 3V4RA 3KX2A 4D25A 3NKVA 4M1YA 2C99A 3EA5A 1DEKA 4ZO4A 2GCNA 1VIAA 2ZJ2A 1EESA 4JLBA 2V9PA 1XZPA 4TZ0A 4YDHB 2FJUA 2QMOA 1N25A 4N1AA 2F43A 1PV4A 4DSTA 1LVGA 2BBTA 4JZKA 1NMXA 5DI3B 4HAVA 2IS2A 1U0LA 3P4YA 4TMKA 4D26A 3BS4A 5CK4A 3GJ4A 4IOJA 3BRWD 1KO4A 1OH5A 3AEZA 4CF7A 4TLCA 1VPLA 1XXHB 2GCOA 4BFSA 4CW7A 2WJJA 1M7HA 1ZIOA 3LY5A 1OKKA 3ASYA 3GJ8A 4PC6A 2XOKD 2DBYA 1SKYE 1Z08A 4ZDIA 4HDQB 4Q9IA 5JSZB 3U4QB 5TMPA 1SHZA 1E2DA 2DCUA 3RS0A 1KNXA 1R0YA 4L4UA 1GSIA 1G8HA 2ZXUA 4ARZB 4WW0A 2NZ8A 2HT1A 3K70C 4OI0A 4JL5A 1AM4D 4R9UC 1UBFA 2Q9CA 2ZAOA 2REBA 4Q9KA 4ZI2A 4EPYA 2AN9A 4N3NA 1EFUA 3DZ8A 2OSBA 3CX7A 4URUR 3TE6A 1MT0A 3QXXA 3FTQA 1TQ2A 4IVRA 4AC9A 4XWOA 1N5KA 3QF4A 2ZYTX 5LDDC 1W0JD 4KHZA 2GCPA 2GRJA 2B8TA 1CULC 2HF8A 3M1IA 2YKGA 3NTUA 4ZIRA 3OAAA 3BOSA 4OYHA 4B73A 5CIWA 1SXJD 4DCVA 3SNHA 1G19A 121PA 2DHRA 5KTYA 1KY2A 2YC2C 1XFAA 2IWRA 2F1HA 1DG1G 1XJ0A 5JI3E 1E0JA 2GZDA 2XJ9A 1F3OA 4XD7D 3NDPA 3AVXA 3DZDA 3RRMA 2ZRIA 2O8EA 4B2LA 1OJLA 3W6NA 3IBGA 2QTHA 4Q9HA 1M6NA 1OFTA 2FFHA 5H8WA 2Z43A 4R2IA 3GLFB 4PC1A 4UNPA 1XDBA 3VU9A 2JLWA 2IXEA 1NLFA 1YHNA 2BKUA 4NDZA 1T8TA 4HB0A 4JMPA 2P3SA 4QC2A 1QHHA 4A8JA 1ESNA 3MSXA 5EP2A 2O0JA 4B6FA 3K0FB 1U0HC 3RS5A 1D9XA 4BWYA 4NMMA 2VYFA 2EQBA 2JLSA 2ZJ8A 1U8AA 3OEHA 2YJTD 1E2EA 3L0PA 1TAGA 2W6JD 1L7VC 1C4OA 1S3GA 5KSZA 2GF0A 4B3XA 1FTSA 1JI0A 3EZ6A 3MCAA 2BC9A 4D4LA 3CLVA 3E5HA 2JAQA 2BJVA 4LV5B 3PG5A 3MMPA 5FBWB 4QBIA 5CDFA 3LRPA 1NY5A 3RANA 2OAP1 4BLOA 1NVVR 3OE7D 4L8GA 4Q18A 2OAQ1 1WQ1R 1YR9A 3H1TA 3VAAA 2HV8A 4JBXA 2O8FB 5KDOA 4Z8XA 3E70C 3IEUA 2AKYA 4HEJA 2WOJA 3C4JA 1J70A 2D7DA 3AF2A 3AKYA 4WBSA 1J90A 3T12A 4Q4HB 2C04A 1VECA 1CJMA 2JGNA 3NIBA 3BB3A 4B43A 2B21A 4DXAA 3K0AB 4AI6A 3DVLA 4RD4A 3W5JA 1JQLB 2QZ4A 2QN6A 2F9MA 5EXTA 1R0WA 2NO9A 1X8JA 3MJRA 1OHHA 5E4FA 1KK0A 1N3BA 4TTRA 4S35A 3AKEA 4JLJA 1P62B 1M7GA 4YXWD 2NOAA 4J0QA 4LPKA 2Q3FA 4C0LA 2QEQA 2WPDD 3R7WB 3K70B 3SJZA 2ZI7A 4RCYA 5BQ5A 5BYJA 2IX3A 1TUIA 4D0GA 4KLZA 3I61A 1OH6A 3WXMA 4L5BA 4C2TA 1DVRA 3CH4B 3TLXA 1X86B 3Q3JB 3P1JA 3IIMA 2DFNA 1CR4A 5FFMA 4Q1AA 2JLYA 1SQ5A 3GLHA 4AY2A 1P73A 1QG2A 5HKKA 1E9DA 2ZE8A 1TF5A 1IN8A 4NYJR 4TQUS 2XEXA 5KDLA 3ICQB 3ADBA 2QP4A 2ZRMA 2ZUDA 4CEIB 2GEVA 2J46A 1BYIA 1F48A 2PLFA 4HLCA 2GJSA 2XTNA 3AH8A 3B1XA 2ZSAA 2AXNA 4US2R 2WKQA 1BOFA 1CS4C 4B33A 3QXCA 3EW9A 4AYWA 1GM5A 1ZAKA 4HUQB 4B76A 3EAQA 2EFHB 2O8CA 2ZE7A 1RRPA 1S9HA 3DL0A 4A6XA 4AKIA 2KI5A 1CKEA 4EPVA 3I4LA 2ZS9A 5FOVA 2FU5C 4I1VA 2R9VA 1XTKA 5DLQC 4NONA 2G0NA 2W6IA 3C8UA 1MO5A 2QTFA 5K8IA 1DTSA 4FIDA 1E2JA 1FP7A 1Z3IX 2I3BA 3L0SA 1KI9A 3EIHA 5D3QA 1R4AA 1SVIA 5J4LA 4OQFA 2CE7A 4Q03A 2DYKA 2VP6A 4ZV4A 1D8TA 1GKYA 1XXHE 2ZJYA 4XIGS 1RE0A 2ZR9A 2IYXA 4YDSA 1N6NA 2FSGA 2XSZD 3RAPR 3VR2A 2O8DB 5B57C 5CITA 1R0XA 3SHFA 4RY2A 2BEJA 4Q1BA 1W44A 2R2AA 3QPVA 3LX5A 3GJ3A 2J7PA 3EIEA 1MH1A 4LBWA 3IQWA 4M4SA 4QHTA 1RC8A 1ZUNB 2ZJOA 2WOOA 1Z28A 4ZKDA 3B13B 4LI0A 1G3UA 3CW2A 4IDHA 1JEDA 2DWPA 1E2NA 1NVVQ 1KNQA 4HAYA 2VHJA 4JLAA 1CU1A 5FPSA 3ZZ0A 2D2FA 3UPUA 2AKAB 2VSXA 1XCPA 2B92A 4JBWA 4TL6A 4IVQA 3FOZA 3U60B 4XWKA 3WNBA 2J59A 2FA9A 4FMDF 1HV8A 3LW7A 4H1VA 3TW4A 5FBQB 3U5ZB 1KY3A 4MRNA 3LBNA 4DSUA 621PA 2VEDA 4OBEA 5H68A 4AKEA 2KSQA 3E1SA 1CRQA 4JIMA 4Q21A 4U00A 4DCUA 1GAJA 5AJYA 3M0EA 1XD2A 3RLFA 3LWNA 2AXPA 4CZ2A 4Q19A 2ZI4A 1ZW6A 3NH6A 3TAUA 3JVVA 3VMFA 4AWXA 3FWYA 3GLFE 2C03A 3B7GA 3FVQA 2OV2A 2F1JA 2ZRKA 3F0TA 4QXAA 5IRCD 3SOPA 1PZNA 1AKEA 1F5NA 1Z07A 2VPPA 2PZGA 1S2MA 3F8TA 2WWYA 4GMDA 3W5IA 721PA 3IPXA 3NEJA 4GZLA 3ZIAA 3BD9A 4US1R 1SVLA 2RGEA 1BMFD 3FGNA 1YZQA 2ZS7A 3AUYA 3FHOA 4O2RA 1E0SA 1R2QA 4C4PA 1RIFA 3NH9A 3W3AA 3ZDQA 4Q00A 1Y3AA 1IJFA 4ACBA 1E2GA 1W7AA 2VF8A 1E9FA 1W0KA 2KBEA 3V4FA 1U0JA 3ZVLA 4ASUA 4X8MA 1ONBA 3F5FA 4TT3D 2N1BA 4BLQA 1NG9A 2ZSDA 1N6IA 2HLDA 2OUKA 4GOXA 4LJ7A 4URVR 1ELOA 2GESA 4DB4A 4QM7A 3VFDA 5FR1A 3QBTA 4AURA 3AV0B 2G1JA 5CB6A 1Q3TA 4OI4A 2BDTA 2G83A 3U61B 2ORWA 2WIBA 3SN6A 1JR6A 3B6EA 1QVRA 1NVUQ 4Q48A 4NYMQ 1XPUA 4UNRA 1DS6A 4YMUA 3AP2A 2ZRPA 4DUGD 4RD1A 5JMTA 2RHDA 3A37A 3DOEA 3ND8A 1FW6A 1A1VA 1TQ6A 4TMZA 2F1IA 4FWTA 2F9LA 3THYA 1ZM7A 2FPLA 3N2EA 3GFPA 3UMSA 5KNDA 3H2YA 1DAEA 1Q1QA 2ZI3A 2GBLA 3OIWA 3SS8A 5CM9C 5LBIA 4F4JA 4DDTA 1NJGA 1KK3A 2YHSA 2ZYUX 2IEYA 2NG1A 5D3MA 5KSPA 2Q0HA 1XPRA 4CVNA 1KKLA 1S4QA 4JS0A 2FFAA 2P5SA 4NZYA 3FFBA 1CJKC 3FPAA 1LW7A 3O8BA 3B2EA 3A4LA 2J0UB 3R8CA 2WWWA 3Q8XB 2DY1A 4B34A 1MRSA 3SJBA 4XVQA 4TSFA 2GEDA 3AVPA 3BFVA 4C0AC 3CNOA 3EZFA 1IY0A 2LKCA 5AJXA 3GLGA 4FI3C 4Q5IA 4TMTA 4D4JA 4W5JA 2FFBA 3JVUA 1KMHB 5J47A 1VG0B 3FB4A 2VH5R 3U3RA 1Z6AA 4B44A 5GJBA 1KJZA 4QJ4A 221PA 1OF1A 2CBZA 2PX3A 5FOTA 2RGDA 4PC3A 2WWHA 5CJPA 4NCNA 2O8DA 2JATA 5FBVB 1TF2A 3NVAA 4NYIR 4OK6A 4V02A 3UMFA 1R5NA 2NPFA 2XNDA 2AD1A 2WSSD 5DI9A 1HEIA 3GFOA 2QQ0A 4TMWA 4WA7A 2BOVA 2RGNA 4BZQA 2G88A 1KO8A 1MABA 4A8JC 1E2PA 1AS3A 2RCNA 1TUEA 4KFRA 4NH0A 4QNRA 1LNZA 3WHKA 4N0DA 1CEEA 5G40A 4KFUA 1KGDA 4G0NA 3PUYA 1V43A 1W36C 1FQKA 5HZHA 3LQQA 4KI0A 2B7BA 5IHPA 4JLOA 4KBGA 3NBFA 4TL7A 3TNFA 2ZJZA 1V5WA 2F3TA 3QEJA 4IFBA 1KDPA 4LHYA 4YMWA 2CVHA 3U3MA 2GHIA 2MMGA 4ZCMA 3QIAA 5C4MA 4DIDA 3G0HA 2QAJA 2RB4A 3T1VA 2YZ2A 2RGAA 3PVSA 2F43B 5DIFA 3VHXA 1OFUX 4I81A 1DARA 4DLZA 3I1FA 5BN5A 5C4GB 4O2LA 5AUPB 2IYVA 3CIOA 4RD0A 4LX0A 3KQLA 4PTLA 2DWQA 1OW3B 1WRBA 2CHVA 2GCOB 3D6TB 4A0GA 3CRW1 3CF6R 4BECA 1CJVC 2XJ4A 1XP8A 4E09A 5AUOB 1E2QA 3QEOA 3VR4A 4GT1A 5BWMA 1H8HA 2IK8A 2CDNA 5DNYB 5FPHA 2HJGA 3TJZA 1AQYA 4DLXA 4EPXA 1L2TA 3WP1B 5K8TA 2JJ2A 4A92A 2WVJA 1KDOA 5F3WB 3HU1A 1AA9A 1Z6YA 1G3MA 4OQMA 3CUEF 4R7ZA 4FCWA 2IYRA 5K8LA 1XEFA 1NL3A 1DO0A 3NBZC 1B23P 2FOLA 5CLLA 2Z5FA 5SZHB 1ZBDA 2XXAA 1Z22A 2C78A 2OE2A 2YC4C 1JECA 4LWZA 1L4YA 2WM9B 3SEAA 3RRZA 2ASEA 3ZVMA 2OT3B 4NCIA 2CVFA 4M1TA 4B75A 2REXB 3OZXA 4GFDA 5HE8A 3TUIC 4M9ZA 4MRPA 3MWJA 2ZI5A 5KNCA 3MFYA 3QF4B 2E87A 2DFLA 2Y8EA 1KMQA 2FWRA 4P4TA 1G8PA 5F9FA 1G21E 3NEYA 521PA 3QI2A 4ZIRB 3IUYA 4LDJA 3R8FA 2W0SA 3GJ5A 3AVQA 1TTTA 2WJVA 1JR3D 4B6EA 2LKDA 4IKEA 1R5BA 2C96A 1E1RD 1JJ7A 2JEOA 5FOSA 4C30A 2NO0A 1U90A 2BEKA 1AK2A 1Z83A 1A7JA 1D5CA 1X1RA 1RKBA 4HSEA 1MO4A 5IT5A 2WKPA 2OZEA 4PPQA 1R8SA 4CIDA 2O8EB 4F92B 2G77B 5LD2C 1R5OA 1E3MA 3HR8A 1E79D 3QG5A 3ZS8A 1A2BA 3FDIA 2RGXA 1E96A 2HXSA 3ND9A 5EQTA 1G20E 1IQPA 4KV9A 3VU9B 3KUCA 3Q7QA 3TIFA 4OI1A 2YNMA 2ODNA 4B3BA 4B3FX 2ZRBA 1YRBA 1QHHB 2IA5A 4A8JB 1EXMA 1IN4A 4IJMA 3SQWA 3Q7PA 2KBFA 3K09A 4AKGA 4Z1MA 3FMOB 3HP1A 1GOTA 1G17A 4JLMA 1EFRA 1W36B 1JPJA 2WJYA 3L2OB 3PV0A 1XNJA 5B58C 1TEVA 3QPUA 1A4RA 3V00A 4MKHA 3AM1A 1UKEA 4MGYR 1W4BA 1E9EA 2C9OA 3FKSA 3QE0A 2A5JA 1SZPA 1OIWA 4ITRC 4IVPA 4NTZA 2J0SA 3D3QA 2IYQA 5CM8B 3KFXA 1Z5ZA 1Z0IA 4C7OA 2DWOA 3PEVA 4U02A 2F1RA 2QP9X 4UNNA 2FF7A 5DO9A 2J0QA 2P6NA 3RRYA 4BZXA 1WBDA 4MRSA 1R6BX 2X1VA 1NIPA 1W47A 4C0HA 4C0BA 1F2TA 1NP6A 2A5GA 5EZ6B 4B71A 4LYJA 4YMTA 2HDNB 4C9BA 2FE4A 3BIFA 4XOIA 1CXZA 1Q3HA 2WMOB 4QHSA 3REFA 2ANBA 2GILA 1TQDA 3BJIC 3AKDA 1FMJA 4YMVA 1ZJ6A 4TLDA 2KB0A 2X8AA 1WE2A 2B6HA 2IYYA 5DSZA 3W8RA 1GFIA 4KAXA 2QAGA 3L0IB 4TTQA 1WB9A 1OV4A 3A4NA 1FNMA 1IY2A 1J7KA 2A30A 2XOKA 3AVWA 1II9A 1OIVA 4HUTA 4FINA 5BN3A 3FE2A 1GRRA 1E2MA 1UKZA 2QQEA 2H16A 2V7QD 4C0QC 2QL6A 1NSFA 4PSAA 3CWQA 4TYPA 2ZSEA 3BGWA 2IYSA 1E69A 4Q1FA 2C9CA 3U3KA 5L3VA 2FEMA 2CHQA 3ZZTA 3PUVA 3WYAA 2XB4A 4TQ9A 4G1UC 2R8RA 4HATA 1AGPA 4WOPA 4ZCIA 1R8QA 1NBME 1XB2A 2ANCA 3GLHB 4M2LA 3SFZA 5AUQA 1UAAA 3A36A 4BUJA 4EKDA 4OKSA 4D0LB 2HYIC 1G8FA 2C8VA 2OBNA 4HAZA 3LX8A 2ZRHA 1CR1A 4JVMA 3TKLA 2QENA 2FPMA 1W0JA 4URWR 5EP1A 3SDZA 1OH7A 3T5DA 4TN1A 1ZC4A 4US0R 3OIUA 2BWJA 3A1TA 5FL3A 5JLJA 4LCBA 1SXJA 1QBKC 2MSCB 4M9SA 5LD2B 1KDRA 2J41A 4ZDKA 4I1UA 1OB2A 2O8CB 3B1ZA 3L43A 2KJQA 1GL7A 4QNMA 1OXUA 1FOEB 3ZD7A 1M7BA 2OESA 2VP2A 4GMXA 4IDPA 4N0EA 4MDEA 4XD7A 3A58B 2IWHA 3X1DA 4UXIA 2YINC 4DCTA 3QVUA 1X6VA 1VDZA 1DADA 4LHVA 3KQHA 1MO6A 2QGNA 5JCZA 2WJHA 4MYTA 3BB1A 3IKJA 3QOFA 1TF7A 5FPTA 2PJRA 1OYWA 1XRJA 3SYKA 5FTLA 5JJIA 3ADCA 5JHGB 4MUAA 1N6OA 1Z2CA 5FUYA 3TSZA 1G16A 2DR3A 4XWAA 1CLUA 4LYHA 4GOKA 3MWLA 1FUUA 1HQCA 1NI3A 2H8KA 3MUFA 2ZVQX 2AK2A 1VHLA 1XD9A 4NP6A 3T06B 3TQCA 4GI7A 1T8UA 3KXLA 1GKIA 1GNRA 1FMLA 3HPQA 3K9GA 2BVNA 1G291 2ODWA 4DJTA 4ABYA 2GBLC 2W6JA 3EPKA 1OKKD 2O5VA 1Z0AA 2R65A 1RRCA 3KXIA 5EXPA 1D2NA 5KHOC 1HH4A 3TW8B 5GVRA 5JEDA 3SQXA 3CX6A 4TYNA 1BIFA 2QTVB 4W5HA 3QSYA 5ANRB 2ODEA 4HLUC 1UEIA 2ODBA 4P4SA 1NMZA 3UWKA 3DM9B 3QXHA 1LV7A 3OE7A 1YZNA 4GZMA 2V55B 4AG6A 1DOAA 1SVKA 5HR5A 2QA5A 1NLZA 3U7GA 2AFHE 4EFMA 4BRWA 4D0NA 1NMYA 5BYKA 1JXOA 3LAWA 1U8YA 1JAHA 4KBFA 5JRZA 2FH5B 1OXXK 2JDID 5DISB 1XCMA 2HT6A 4LZZA 4A9AA 4CGZA 2ZRCA 1K6MA 4BFWA 5M04A 2Q3MA 1Z6GA 3EARA 2YV5A 2QSZA 4BE7B 2CLDX 2PMDA 3PCRB 2FZ4A 2IF2A 4W5WA 3ADDA 1F2UA 1Z06A 4DIEA 4DRZA 2VA8A 3P20A 1ZMXA 4PC7A 1PLLA 2GZHA 3ZS9A 1M2OB 2GXAA 2JJ1D 2HYDA 4IOKA 1DBSA 1E2LA 1ZNYA 3TBKA 4KITB 1E2HA 1HT2E 4JLDA 4V0LA 5BN4A 5L3QA 1XD2B 1XEWX 1M8PA 5TDHA 2RGNC 4YXWA 1OT3A 2IHYA 4LSGA 3GJ6A 4KLNA 2WPDA 3L8YA 4IHQA 1FX0A 5CLQA 3RWOA 1S8FA 3CONA 3KB2A 5FTMA 4R71A 3AP3A 1NN0A 3T1OA 2P6UA 1ZIPA 2QROA 4BFUA 1WBBA 5EXSA 1F6BA 2I1QA 1OFHA 4HDCA 3LD9A 1P9NA 2R44A 3E2IA 3H0KA 5E3HA 2OFWA 4DEYA 3KKPA 3GFTA 5LPNA 1XX6A 1TNDA 3WYGA 1PVOA 3EZ7A 2F3RA 2EYQA 4MYUA 1D9ZA 5AUNB 4CEHA 4FW9A 4DWJA 4HYYA 1N6PA 3TVTA 1W36D 5TB5A 5CDFE 4HB2A 4NPHA 4Y0AA 1KHTA 2EFEB 1DAHA 5HPYB 1I2MA 1I4TD 2CHGA 4GPTA 2ATVA 3LVRE 3CB4A 4M21A 1KI3A 2Z4SA 4PPNA 2CK3D 4URYR 4DLUA 4WIAA 2PEYA 3DOFA 3HR7A 3TUJC 1SVWA 3AF3A 1N6LA 2VSOA 4HZUA 2D4HA 3IIJA 1VYTA 2OFXA 3X1WA 2ZQ5A 2OLKA 1P2TA 5B30A 3RC8A 4V03A 4QG7A 1RJ9A 2OM2A 4OHXA 2ZJBA 2GAOA 2ZI9A 1OYYA 1GITA 5JJKA 1II8A 2OEPA 3GD7A 4GL2A 1AN0A 3B78A 4KFTA 3THYB 1ZP6A 3RYTC 4DLSA 5C2JB 3GEIA 3RS3A 2X77A 2YWFA 2WJIA 4G5QA 5D3MB 3A4MA 3T15A 2IEZA 4UXJA 2C5LA 2XSZA 1ZM4A 2P5TB 4TYYA 1OHHD 2BV3A 4K8OA 1EX6A 3MWYW 2CCGA 4GP7A 2QGZA 4KSCA 2XAUA 1YR8A 2G9NA 5C18A 1SGWA 3MD0A 5JJLA 2IYLD 4PQRA 2GVZC 1UBGA 1PJRA 3GLGB 4DLVA 1RYFA 5J4HA 2GEUA 4NU0A 3VX3A 1SVMA 4D4MA 3C15C 4DT1A 2R6AA 3JZMA 4B32A 1W48A 2ZRGA 4II7A 3EWSA 3GLHE 3RRNA 1KK1A 4MITA 3OEED 4Q66C 2BCGY 5HCNA 2XX3A 3OF5A 1AZTA 1WMSA 2QT0A 2ZRDA 2ZSBA 5GJWC 2V3CC 2ZPTX 3H84A 1RRGA 5HKKD 2FGJA 4XH9B 1T5LA 2GK7A 2NGRA 4QBGB 4KCGA 5B64A 1ZNZA 4XSHA 1NKSA 1IJEA 2QM8A 3H86A 1Q22A 3U3JA 2ZRAA 4ILEA 2R6CA 4XJXA 4FWIB 1IHUA 4RKEA 2ONJA 3B9QA 1FNNA 1XCGB 3LBHA 5C46F 3I8SA 5C1BA 1MABB 5BW8A 1JBKA 3TRFA 1DAKA 2QMUA 5EZ5A 4KJZA 2PBRA 3IIKA 2XITA 1GZSA 3AGPA 3K0SA 1KJWA 1UADA 3K09C 2NPIA 3THWA 3B60A 4LBZA 4DBLC 4P3YA 4F4CA 2DFKB 1YZKA 1JEEA 4OI2A 4EQ6A 3RABA 1G41A 1Q0UA 1U2RA 4O0MA 3IPYA 1G6HA 1UKVY 2RGGA 1ZD1A 3LA6A 3JZAA 4XTCS 5FTJA 4U5XA 2QE7D 2EFGA 3TUZC 2D2EA 2Q6TA 3REGA 3GLIA 2JLQA 4UJ5A 5DHAA 1KTVA 2ZREA 4IW3B 2V1XA 1G5RA 1W2HA 4KXFB 1X3SA 1BMFA 3F3YA 1HA3A 1W4AA 1YE8A 2OG2A 4M1SA 4ON9A 4ESHA 3BH6A 3MLEA 2CEAA 2DB3A 4JYBA 4A2WA 4BLSA 3R20A 1GNQA 1G8YA 2K5UA 1E9SA 2LWIA 3GP8A 4LHZA 5CJ2A 1U98A 4TT3A 1MKYA 4KYUA 3W8NA 1O3YA 2G3YA 2BCJQ 2OHFA 1LB1B 1GWNA 2GA8A 1QDEA 3KJEA 4PZZA 1QZXA 1KOFA 2CNWD 3MAAC 4RFSA 4E22A 1P61B 3BERA 1P2VA 3L8ZA 4AKHA 2YWHA 2QAGC 2VP4A 2P65A 1NJFA 2Z4RA 3KKQA 2QPAA 4JBYA 4E07A 4F38A 2YVUA 3T34A 4P32A 4MH0R 4PHTA 2XXAB 1COWD 4FMBB 2VHQA 5SZJA 1EWRA 4CT5A 4M22A 2N42A 4A82A 4IDNA 4B48A 4FMDB 3PXGA 4MRVA 4DUGA 2Q9BA 4NYJQ 2TMKA 1CJTC 4Q7KA 1E9AA 1XEWY 2VRWA 1XMIA 1T4GA 2CL0X 4WXRA 3QF7A 2XZLA 4Q9JA 1M34E 2QORA 2RMKA 5JEEA 3LH5A 4UKDA 1KYIA 3ZQ6A 5JWHA 4Q4JA 3EPHA 2Q21A 3PUWA 4D4KA 3EA0A 2GKSA 1ZVQA 3N5CA 2BIFA 1HE1C 2QP3A 4JLKA 3QKSA 5FOXA 2ZJAA 3AKCA 5J5CA 4NCKA 2ZYVX 5TXGA 4A1FA 2WTUA 3KTAA 2ZANA 3UG7A 1SXJC 1PUIA 3Q5DA 4ACAA 3O8CA 4JLPA 5FBRB 4LUCA 3X2SA 5KYKA 4LV8B 2QNRA 4NHOA 2XNSA 3CWZA 1VKJA 3FFAA 3SE0A 3VR3A 3O8DA 2KWIA 5FUVA 4H9GA 4BLRA 1LS6A 3I32A 3VHLB 3TGPA 3NHBA 1HYQA 3CZQA 3L82B 4TWZA 4P33A 4DSNA 2B8WA 1N0WA 4HLUA 3RWMB 2W58A 3KQKA 4FMCF 3VKHA 5DE3A 2IUUA 2WSSA 5BXQC 4OHWA 4ASUD 5FL7D 2MMCA 1IXRC 3K70D 4DLTA 4QM6A 1FP6A 5JI2E 1BH2A 3EX7C 3FMIA 3P26A 2H57A 3ZVRA 2I1VB 4AIIA 5KPDA 3CPHA 1QHGA 4POAA 3FHTA 4D81A 1KO5A 1ZNWA 4QGAA 3A1VA 2XZPA 3WRYC 2B7CA 2GETA 4QGGA 4HAUA 4V0MA 4WXPA 1Z0DA 3W6OA 4IXMA 1XU4A 4DLRA 1ZM2A 4C7OB 3EC2A 3VTKA 5G53C 5B2ZA 1N6RA 1IN7A 2WHXA 3CNNA 2AHOA 4BFZA 4EAQA 3B1YA 4LC0A 1GL9B 1LF5A 1W4CA 3KUDA 3VX4A 2JJ8A 1PLKA 4Q4LA 1F2TB 3TQFA 5L8VA 3C14C 2OCYC 3OHMA 3NDBB 1EK0A 3Q9LA 3ZZUA 4OJQA 2DPXA 1OH8A 4DDVA 1G1MA 3LFUA 2CCKA 2GJAA 1ZD8A 4PX9A 3IO3A 1E1QD 5AJWA 3HWSA 1Z6TA 2JASA 5KNBA 2AR7A 2NO6A 2QAGB 3GLGE 4UNQA 4TSFD 2JA1A 4LYFA 3RHFA 2D3WA 2AD5A 1YQTA 2IW3A 3HPRA 4MKFA 1RYHA 1UJ2A 4QGHA 2XGJA 1J8MF 1DG3A 2E1RA 1I4DD 1YR7A 2VP9A 4OQNA 4DLYA 2IXFA 2C95A 1S3SA 3T1TA 5LB2A 3MG9A 4V0ME 4XTRA 4Y0VA 1J8YF 3ZLJA 1VMAA 2ORVA 4L9WA 2A2ZA 2OO7A 3S1AA 4MGZR 1RZ3A 4PQYA 4M53A 3GQBA 3K0CA 3O8RA 5AWFC 4HDOB 4XVUA 3SZRA 2I4IA 2BM1A 1QHNA 8OHMA 3TK1A 1GUAA 1XJCA 1OPXA 1YKSA 4Q47A 1Q20A 2XNDD 1XBTA 4YLGA 3W9YA 3OIVA 4LJAA 1OE0A 1C9KA 2GJ8A 2FNAA 3NXSA 2OLJA 2PZEA 1N2CE 2CJWA 1K8RA 2ZIAA 4IOMA 4OK5A 1JPNA 1W5SA 4I1OA 3WHLA 4LYAA 4M9QA 4BFYA 4BEBA 1IY1A 1T9HA 1SXJB 1S96A 4EJSA 2UVQA 3TR0A 2FSHA 3QBVA 4JSYA 2CE2X 1JR3A 3EZ2A 1F60A 1KJYA 3C16C 2NTYC 4NCHA 4CEJA 1E1RA 5ELXA 1LTQA 3H4MA 4RD2A 1GL6A 4EPRA 5AR1A 5SZKB 5GJVC 2VP5A 1QHXA 1OSNA 4MYCA 4C0KA 2WWFA 3X1XA 5DH9A 2J3EA 2CL6X 3PUXA 1XPOA 5EP4A 1P9RA 2GJ9A 4RZ2A 3K9HA 2VBCA 1WXQA 2AL7A 5DYGA 2PJZA 2O0HA 1IN6A 1YJ5A 3PFIA 3KFVA 4URZR 3MRSA 3BB4A 2FSIA 3P32A 5CIQA 1E4VA 2W00A 3DO6A 4W9MC 4G5RA 2WZQA 4LC1A 2O8BA 2IF0A 4M1OA 4LGMA 4QKQA 3NWJA 4PANA 3AVVA 3ASZA 3CPEA 4NE2A 4Z8YA 1OLOA 3BH0A 3GJXC 3N70A 4WZBE 5KU1A 2JLVA 2QI9C 4TL9A 3BH7A 1TL7C 1ZYUA 1T3HA 4MYHA 3U2QA 4DKXA 5A5GA 4Z54A 1QVAA 1K5GA 4KO8A 4PZYA 2ZETA 3SI7A 3KKOA 4E03A 5EUQB 4PC2A 1Z6XA 4P4SB 1ZUHA 3QY0A 5DN6D 1QF9A 4BFVA 2W0MA 1BKDR 3IQXA 1KO7A 4M1KA 3GEHA 1J99A 3NG1A 1TQ4A 1NVXQ 2CCJA 2RGBA 2RHMA 4S2EA 4TLBA 4DVGA 3SFVA 5JHHB 1Z8FA 3KQUA 2EFCB 4IEEA 1R0ZA 4RZXA 4V0NA 1FZQA 1VCMA 3A8TA 1SHKA 1GVNB 2OCAA 2ZEJA 2D62A 4RZ3A 4KVGA 4NYIQ 3OFND 4IRUB 4UJ3A 4IOLA 1EG7A 2W2XA 3K0EA 4EDHA 1AIPA 3AGQA 3THOA 4D2IA 1F2UB 1G3RA 4JJKA 5JCPA 2V54A 3SR0A 1KSJA 1W2GA 4FN5A 4M0LA 1NN5A 2NZJA 4QOSA 4BQSA 1KI6A 5TV2A 2GAAA 1VG1A 5L3QB 2H7VA 3CF2A 1CP2A 2EW1A 1IONA 2O0KA 2JLXA 2A7QA 2GDJA 1UDXA 4E5UA 3SU8A 1CF4A 2V6JA 1FX0B 1Z29A 3N2IA 3B8HA 3ZGXA 1P6XA 3IHLA 4LJ4A 2V7QA 2L0XA 4JJZA 4BASA 1AQUA 2BM0A 4TLEA 3V9PA 3CH5A 2EWWA 2AX4A 4H1UA 1U94A 2ZE6A 1PLJA 5EE5B 1ZC3A 421PA 3LXRA 2C77A 4TL8A 4PZLA 2FN4A 4AG5A 1VYUA 4Q1EA 3MWKA 2VO1A 2GXSA 3DMNA 2OCBA 3AF4A 2JIZD 4K81B 2ZVPX 3LV8A 4RCZA 4CRWB 2UZ3A 3I5XA 4CEHB 3EIQA 3BBPA 2IYZA 4AK9A 4Z1MD 1ZINA 1EFCA 4PXAA 3T61A 5KSYA 4DC9A 2IS1A 1DELA 1O87A 3U7FB 3AVYA 4PQFA 2IC5A 1KSGA 1DAIA 1D6JA 3FYHA 5FH9A 2GJKA 1SVSA 3QUSA 1H8ED 4FXPA 5FBLB 3PQCA 1T5IA 3LBIA 1ZUIA 3D8BA 4HLDA 1UBCA 1D2EA 3D31A 4HZUB 1CRPA 3DKVA 4UXHA 1XTIA 1KDTA 3AF0A 5F2EA 4FCTA 1TPZA 3UG6A 1G3IA 1NSTA 1NBMD 3PIRA 4AD8A 1RJ9B
chains in the Genus database with same CATH superfamily
2IXLA 3HKEA 4LN1A 5K0SA 5FYTA 5GINE 2YQ1A 2P6PA 3EXCX 2AC1A 4ECVA 4NYPA 5D7NA 3TKYA 3K32A 1TT5A 2I8AA 5BNFA 4C22A 1ABFA 3I5UA 4ZDWA 2R8JA 3U9SA 3IDAA 3D5EA 3DE4X 2B4VA 4J6EA 4HRXA 5GAHI 4JI1J 1YDEA 1S6QB 1ICIA 1SHJA 4LGCA 3F2ZA 3LGSA 1QRTA 1FFHA 1J0AA 4DLWA 1OIXA 3WRYA 5I0UA 3RR2A 1XJAA 4WCFA 4G5SA 2EKZA 5J2PA 1WTBA 4F25A 2B46X 1HPZA 2ZBRA 2WABA 5AKZA 1I2BA 3SIPB 2P2SA 5ALVA 2PUFA 1A8DA 1R7RA 1PVDA 3IUJA 1XO1A 3HJGA 4FFVA 1ZBE2 1JYSA 1VB5A 3B12A 3IAEA 2F8SA 2ADDA 4NY1A 3PGKA 1HT0A 5FOWA 2I1WA 1N5LA 4GSKA 4EFNA 1HI1A 2O2IA 1CPZA 4C0SA 3GPLA 4A16A 4IEFB 2J5BA 3O03A 5F0WA 4F6RB 2J1SA 3EDCA 3KVBA 3IALA 3OTBA 1FDRA 1VHJA 1I0ZA 4LJYA 2BONA 4P31A 4PIMA 1ZNQO 3CG4A 3CRQA 3I92A 5GGXA 4HCJA 4LRCA 4ZONA 4L0CA 2F4PA 4Q4JB 4LDPA 1X92A 1ND2C 2ZTLA 3SHRA 2VBBA 3BEGB 4J5OA 5J2TA 1YTLA 1VFNA 1JJAA 3CF0A 2PXXA 2GNOA 4JFAA 3OOWA 1AQJA 1D6MA 4KHPJ 5LXTF 3OWOA 2R42A 4L16A 2ATCA 4CM4B 3D7MA 4O08A 2E1MC 2ZTNA 1GY8A 3RROA 2EALA 4CLPA 2VYQA 3WS7A 6PFKA 2VMHA 4CTJA 1NNLA 4FQ7A 5CB8A 2F55A 1OSDA 4URSA 3M9WA 4C21A 3C2QA 1PM7A 1C4AA 5B55A 1KETA 1XLTA 2NV0A 3PXAA 2YCLA 2B3TB 3S44A 3BQ2A 2VH2A 3TZZA 3W7VA 2WKRA 5IDWA 4ETXA 4HB3A 4MDFA 4TS4A 1VC5A 4REMA 1CDEA 2B20A 4ECZA 4KWUA 3ZVNA 1JQEA 4M3NA 1ZI8A 4Q4Y3 5EUCA 1S01A 4BCDA 4OJNA 2CNBA 3TD2A 1EVZA 4DV4B 2R7XA 3N75A 4BVGA 2DNQA 3RAJA 4E4TA 4ECXA 3BHMA 4MINA 3EF3A 4WBNF 2PFDA 1C30A 2ZR0A 4HH4A 1IKYB 1PFUA 2CMKA 2APJA 2XF8A 4KBYA 2QQGA 4S2GA 5KWRA 4X65B 4WNYA 2XHZA 1AZSA 4U9UA 3WMFA 3S1AB 2CXOA 4W6YA 5BNPC 1OZGA 1R37A 1F0YA 3CM0A 3AJ1A 3DEAA 4CMGA 3H5TA 1W4RA 4DAEA 2PFFB 2ZJRQ 2JAHA 2WAYA 2VONA 4N8OA 3PX0A 4BN5A 4OJ3A 1GFZA 3IESA 4Z6KA 2QRZA 2Z0MA 1FNDA 4AZTA 2VMFA 5FZ3A 3H25A 1NG1A 3GLIE 3LGHA 4JVNA 2W9XA 1U9YA 3EGXB 4YPJA 1SULA 1ZH5A 1UODA 1E58A 3GYBA 3QXSA 5RUBA 2JE8A 2V4AA 2RM21 1Z0KA 4G2NA 1WBJB 4JIGA 2OB1A 1I94F 4BRSA 1P4AA 3ZHVA 1YQCA 3LQYA 1K6EA 4D5EA 5IF9A 2G6TA 2IY5B 3S2FA 1S2BA 3QYYA 1HPLA 3FOFC 4N56A 1NJWA 1X0VA 3ID6C 4WADA 1A8PA 4Y2XA 1P72A 1OY9A 2GTIA 1K4KA 5L7WA 4BIFA 2FF5A 3CVXA 2WFLA 4KE9A 4FO9A 5FP4A 3VR0A 3CV3A 4ICLB 2OLWA 1V25A 3OG2A 1YQHA 5EIHA 4LDZA 1ZK3A 5IVFA 4INAA 4HUQA 4EFAC 3K4HA 1N8KA 4RETA 4Y1EA 1C1YA 2PZLA 4G3XA 5FWNA 5FZKA 4P5YA 4KNVA 4MWZA 1YT5A 4WCFC 2A9RA 3JALA 2V1UA 2AACA 1GYQA 4OQLA 3P5BA 5MGNA 4B9LA 3EEYA 4X8HA 5KT2A 2ZRFA 5FYBA 2H54A 2P4HX 4FBGA 1I6WA 2ZE5A 1PG2A 5JECA 4KO0B 3GSIA 3CNLA 3I12A 3OX3A 1PX4A 5KCMA 4GEGA 4ZZ3A 3E48A 1NXOA 3P2YA 4DJEC 3T1HF 3GLJA 3C5WP 4D3YA 3T19A 2ZZKA 3V1UA 4AY4A 2CNLA 2P6CA 1TU4A 1OF3A 4RBVA 3DKIA 3LGXA 4RCVA 3UV7A 1D0GA 4R81A 1LK7A 4MK4A 5DDJ2 2HM7A 4IDQA 4Z9YA 2WAOA 2F3SA 4GBMA 2AJFE 5AYVA 2C57A 5FULA 3H2HA 1G21A 3Q6NA 5A0YA 1OZ0A 2IYUA 2QPTA 3MMZA 3LDUA 4M9XA 2H11A 3F6BX 2RHCA 4RVCA 4Q7MB 2WD9A 5JNRA 3H20A 4XB6B 1Q3EA 1ND6A 2GH1A 1J27A 4H31A 3G82B 3Q6MA 3IEXA 2XS7A 2MSTA 3QT5A 3IRXA 1UMCB 4DXZA 5T5PA 3NS5A 4LT6A 1T9XA 3NVKI 4HLQB 1XLTC 3KQRA 1NZFA 1D2AA 1N78A 2AEEA 1M1YE 3UMMA 3I59B 3Q8SB 1S4EA 1E2FA 4AQYB 4IGQA 4ERNA 5DT2A 5BW4A 5FLHA 2OXIA 4BLIA 1J1ZA 1N6HA 2NSYA 3EASA 2OPRA 4Y20B 4AN4A 1AR93 5CH7B 4QSMA 2XUPA 5HXVA 1FKOA 1EE9A 4LG1A 2YOFA 3EIXA 2DGUA 3BIWE 5CYOA 3MJCA 3Q3GE 2REQA 2XE6A 3CRRA 1EA5A 1AO0A 2QNBA 4OSEA 4CDGA 1YL5A 3GZNB 1QIDA 3WGNA 2UXDF 4NVPA 3IX7A 5CH5A 4HACB 3PKIA 3OVBA 4YGDA 1HRKA 4BZPA 2CLKB 1FU8A 1HZZA 1AZSC 4Z1VA 2A94A 5GQSA 3D6NB 1UEJA 2HR1A 4ZO6A 4UVDA 1J2TA 5FI1B 1RUNA 4PLVA 2WAQD 1FD8A 3TS1A 3KV5A 2J0SD 4CT9A 3OCCA 3QWUA 1LSOA 1JW6A 4N1AA 1AXRA 1N3YA 5B53A 2P75A 3IVAA 5G0UA 4R1PA 1ODSA 3THVA 1G59A 4LA3A 4BQNA 2VJDA 2UU8A 4TLCA 5CMLA 3KYBA 1ROFA 4PR3A 2WJJA 4DEZA 2IJRA 3NJRA 2XOKD 2KYRA 3MAJA 4ZDIA 2CD9A 3CN9A 3ET6A 4C6AA 5KQGA 1A27A 2DGQA 2XMQA 3BGUA 3WKBA 5T8KA 4YJ2F 1N4LA 4U95A 5EIYB 1ZJZA 2JGMA 4AT1A 2HHJA 1T9GR 4JB3A 3TE6A 1DQZA 4E9KA 5DWVA 2B8MA 4FX2A 4BV9A 3I0RA 1IEQA 2GRJA 3WKAA 4GX5A 3COYA 1RYEA 4C1NA 4P7FA 3H75A 5BY5A 121PA 1ABEA 4HK4A 5AK5A 2F1HA 3FHQA 4LE4A 4NR0A 1N34F 1AFIA 4Y1UA 3Q2OA 2YY5A 4TLMB 1AF7A 3H42A 3N0RA 2AYMA 1ILWA 4TPKA 3OW2R 1JDSA 4RX6A 1LQTA 3I0SA 1DX6A 2PWAA 2SBAA 4GALA 3AEQA 3PXCX 1O94A 3GVHA 1ATIA 4G23A 4M7RA 4UVHA 2I03A 4KQ6A 3OEHA 4ZVGA 1XSEA 2I3GA 1W2WB 5IFLA 5L7OA 1QXSA 4F3JA 2GF0A 1SB6A 4DUYJ 2JPDA 3O0TA 1QK3A 1DC6A 4L3VA 3W5MA 3UA3A 2MKIA 1RVV1 3RANA 3HVAA 4DUVA 3CC7S 1WNTA 5ITSA 2DRBA 3QLVA 1N2JA 2HU8A 2P9TA 1AYEA 3DLKB 3I01A 3IEUA 4YJGB 2G7MC 1CPMA 1TCBA 2IYFA 3AF2A 1Q74A 1NBHA 3THRA 2XVYA 3PA8A 4JV1A 3QBQA 1EFAA 3WL6A 1O5TA 1X8JA 3LPYA 4R25A 5E4FA 2XOEA 2XDYA 1OXBB 3TN93 1N3BA 4FONA 1RCOB 3RQIA 1Q95G 5IBRA 4C0LA 1G5HA 3U26A 2YC4A 5FXMA 2B8PA 5A0TA 4X24A 5HP1B 4B7EA 2WHEA 3R6LB 4MPDA 1G8JA 3HSGA 2ZRMA 4GR9A 3DPRA 1QU3A 2C29D 1QKQA 2IJFA 4IO0A 1BYIA 3H8SA 4F8AA 1SEPA 3PQ8A 3AH8A 3B1XA 2WKQA 3BTUA 3RKUA 3BMCB 4NOTA 2ZWMA 2CXQA 1G4CA 4KQEA 4TV9B 4RPLA 3KO8A 5DLQC 2J22A 1RAOA 1Q5YA 1LWEB 3UK9A 5DK4A 1SVIA 1KFUL 3PWTA 1CZUA 2VA3A 1UKAA 5EIBD 2IYXA 3E0QA 3N7TA 3FUYA 1HE4A 5LASA 4DSZA 2CQ2A 5H3CA 4Q1BA 1PZ8A 1W6MB 5IC5A 3RZHA 4UVEA 3D0SA 2PRKA 3QEMA 3RNSA 1Z4JA 5DYYA 2IRWA 5DJBA 3ZC4A 3DBOB 5F1PA 2JKVA 3ETPA 3CRZA 1WZEA 5FREA 1SUWA 1K1EA 1SIOA 4N53B 1U11A 1QOPB 2F3PA 1ACMB 2WMDA 3TEGA 1GD1O 3PFWO 2Z6AA 1OO0B 3E01B 4HQKA 3F56A 4DSUA 2GIRA 1U2GA 621PA 3AV3A 3LNTA 1FFSB 2GN0A 4Q21A 2PYIA 3ABIA 2R2RA 2J4CA 1YV9A 1N7JA 3GLFE 1TCCA 3B7GA 3ZWXA 2VUTA 2F1JA 2DIUA 2WYSA 3BGLA 4X4SA 2ZFUA 3VZQA 1C57A 4E7OA 2GN4A 4RS4A 2J3IA 2YBVA 3RZMA 3FGNA 4U6SA 2FZGA 4XFKA 1MQTA 1EP1B 4L02A 1W0KA 3ASUA 4X8MA 3RNOA 1HYHA 2HLDA 1CZTA 1SPPB 2J0XA 3K9QO 1L5FA 2GESA 4XDGA 1UK9A 4IDBA 4ZYLA 3GCWP 2WU0A 1MA3A 4QGNA 1Y5LA 1RIRA 3FDXA 1LHUA 1PNFA 3BXXA 4ZTZB 2Y34A 3RZKA 4TMZA 5DULA 1WEYA 3VNQA 1IS5A 4YVSA 2VG6B 2GBLA 1Y10A 4JP8A 4CLLA 4NZYA 3MUZ1 2F63A 4YWHA 4OPMA 3AFGA 3DV0B 4WZMA 3DTYA 4XVQA 4IE4A 3E6DA 3AP9A 5LKRA 3BXOA 3IOYA 4UBHA 3MOJB 3S8EA 3GM8A 2OQ6A 3JVUA 3OJCA 3K9BA 3N36A 2DNGA 3DFMA 4AG3A 1T15A 3WI7A 3E9NA 4UU1A 4F7VA 1TM5E 3B9IA 2XDQB 4LYYA 4O1MA 3S8SA 2VXJA 3V0BB 1O94C 3LLCA 1JHYA 5DO2A 4E8UA 1GTEA 4NCXA 3LE0A 3OLCX 2P5UA 1IHMA 4QNRA 2ZNYA 5L7OC 2CDOA 5IHPA 3MM6B 3D6FA 3NBFA 1KY4A 5F32A 2YQ3A 2FDHA 3O7WA 3N7AA 1OURA 3STYA 4O65A 3ZWCA 2XNJA 3QLVC 1RKQA 2IYOA 3U39A 4IW3A 3T1NA 1H0SA 2VJLA 4IEWA 5C4GB 1HX7A 5FD1A 1W96A 4RKYA 4G36A 5LC1A 2Q5CA 4HQ0A 4Y1FA 5F3WB 4LSZB 3UMGA 2NPOA 3RBAA 3BWVA 4I6JA 4LCJA 5EJ9A 1ZBDA 2J6TA 2C4XA 2YC4C 5I3UB 1O97C 3LQ2A 1L7OA 3LFTA 1PW5A 3BMNB 3DE7X 4B75A 2REXB 1EX9A 4J0JA 4K4YA 1KXJA 4U7HA 1ST3A 4JBIA 1X2EA 3DPRC 2WJVA 3VV3A 1QM9A 4B6EA 1EP2B 4CKZA 3V8VA 4JYZA 4XZPA 5B4VA 1AK2A 1WHTA 3EMVA 3QI7A 1R8SA 1ZZ8A 3WP6A 2R061 4CUKA 2R9LA 3KV6A 3JCIA 1G20E 1JKMA 4HNAB 1YACA 3TIFA 3HB0A 2Z1MA 4LITA 4Y28C 2VH1A 1Z15A 1JDVA 4M99A 1EXWA 5EHDA 5CFDA 1Y6ZA 4A26A 1KARA 1WXHA 1SUEA 4DRXA 2OGZA 4Y3CA 4JQOA 1MUUA 3OXLA 1G17A 5IHXA 5EFZA 2H7XA 3EZGA 1MQ8B 3KHHA 4MGYR 2C9OA 5IQQA 3UVJB 1AV6A 1ZA4A 2HWF1 1MFPA 4IVPA 4RYDA 4OYAA 1WMDA 5G0SA 4YP1A 3RZAA 1R6BX 3QWIA 3TANA 3WGYA 1CXZA 1LFPA 3REFA 2ANBA 3OYWB 3ORQA 3V5RA 5F8JA 1Z2LA 2CWKA 2XNHA 4Q4V1 3HXKA 1IY2A 3P3PA 1KH1A 3V8RA 5IABA 1QYRA 1XRUA 1U2GC 1H8TC 2VDKB 2QQEA 3ZDDA 2H16A 2LTNA 2GO7A 5AI0A 4I02A 3ILIA 1BDBA 1DLJA 2ROGA 1E69A 2X1GA 4Q1FA 5J2UF 3WVJA 1FA0A 4ZCIA 4M2LA 2RAQA 3A36A 3OY8A 1MNEA 3HNMA 2YQZA 4HAZA 2GQ2A 3GXBA 3B52X 5AW8A 3F71A 2X5IA 3T5DA 3ZE9A 5IH7A 4JC8A 1UYZA 1RP7A 4ZPTR 2LR0A 1MQTC 2PL1A 1FWLA 2KJQA 2II6A 3MOIA 4GMXA 4Q3KA 2DPGA 3AOEA 3B93A 2O5EA 4R5PB 2PT9A 1CE8B 3NW4A 1VJQA 5KC6A 4WZAA 3KOXA 3K5HA 4UULA 3MWLA 1UVLA 2R47A 3QUCA 4IGEA 4R5MA 3LAMA 1MVNA 1QYIA 1CB7A 5JG7A 4R41A 1DINA 3ZKUA 3R7NB 3KHSA 1PZ7A 2GBLC 2HS3A 2J67A 1HH4A 4Z4IA 5F77A 5GVRA 4YAJA 3SQXA 1BIFA 4JV5F 4HQRA 3CD0A 3RZJA 1ZISA 3GGCA 1V6KA 3PC4A 3SG0A 2XUEA 4B0PA 2CQ4A 2Q2NA 3R3UA 4CLHA 5HR5A 4HKTA 1PK6B 3R41A 4CQMB 4RXMA 4BC1A 2HWE1 4PAGA 4DV3B 4UVIA 3GYDA 5KX5A 4GVXA 5C33A 4EJMA 4N3BA 3J4UH 3UWMA 3LUGA 2YXSA 3U9LA 3ZWOA 4ME6A 1PLLA 5JCOC 3GG0A 3ZNOA 1DURA 1DBPA 1QGUA 5IWAJ 1PJ4A 1CZLA 1PBAA 4IHQA 3QJJA 1REQA 1ZIPA 4ISRA 2QROA 1KN6A 1EWKA 4R0EA 3MBOA 3WLLA 5HUQA 1TC2A 3KHCA 2CNAA 1A6CA 2I1RA 1I51A 1JU3A 3U1BA 2GNBA 1LDMA 1SUCA 5ALIA 5T64A 2Z08A 4CEHA 2R1TA 3WSTA 2DQ4A 3FLMA 1W36D 1FDUA 1BD4A 3KZMA 2BEOA 5FI5A 2GPWA 1SC1A 3TD6A 4S0MA 4PPNA 3HR7A 5FPVA 1N6LA 4QDKA 1L5WA 5FYHA 3UF0A 1QHEA 4P08A 2ZGTA 1ZNPA 5LNK1 4UHHA 4JI2F 2XL9A 2NUTB 4Z2AA 1FWKA 5A3MA 1G0OA 4EY4A 4K8OA 3ZCSA 1ZN2A 3JPWA 2R7KA 1XRQA 4LIWA 4HVCA 1VJCA 1JSLA 1SGWA 4HMZA 3V46A 2BGPA 1M2JA 3Q0TA 3VYRB 1XHEA 4OOEA 2EZ4A 3AEKB 3IDEA 5C4WB 4U8YA 4B32A 3GLHE 1N2XA 4MSUA 3TTYA 3VNAA 1O9BA 1AZTA 2IITA 2QQMA 4NMLA 1K73T 4RNOA 1NKSA 3MD1A 1W88B 3LT5A 1SC3B 3HBJA 2RF2A 2GHVC 2DXFA 4MROA 3L7UA 1QRUA 1ZY2A 2PBRA 3AGPA 3E2EA 1IJBA 3GUCA 2PWYA 1TVKA 1WMEA 4PDWA 5T5OA 2KYXA 2ZQYA 1FJ7A 3TM4A 5FYYA 1SCBA 4J76A 1YWGO 1IRIA 2YHBA 3GUUA 1OPMA 5FBZA 4Q4DA 3QO9B 4YGEA 3B00A 5BN5B 3MM8A 5B4NA 3BH6A 4X9XA 3ZTTA 4I14A 3RF6A 1QDUA 5DUWA 2K5UA 4OXNA 1NY72 2XR1A 2UUTA 1VBD2 2LA4A 2PVCA 1LB1B 4H7LA 4X94A 3BERA 2IH4A 4MVXA 2VP4A 1U2TA 2Z4RA 3KSZO 3ETDA 4ND8B 4RTKA 1ZAVA 1NXTA 1DAXA 1FF2A 4A82A 3RK4A 1HNVB 2GZMA 1KHVA 4G1QB 3IKMB 2CG8A 2RHGB 2CL0X 3QF7A 5FOQA 1VMHA 2Y0SD 3VDDB 5JWHA 6REQB 1H0RA 4KG8A 1H9AA 2X5IC 3TI0A 3AKCA 4BAUA 4WV3A 4G5FA 2X0DA 2ALJA 4PCLA 4D43A 2C7PA 1DLOB 3M6FA 4ACAA 3WP5A 2FMIA 5KYKA 1LU1A 3FZ2A 1NQTA 3O8DA 5EWSA 5LSAA 1EP4A 3ZLIA 1LDBA 3AOEC 3MRTA 3VKHA 1MJNA 5DE3A 5IAJA 3WSVA 2R6ZA 4LPLA 2E4UA 1DXYA 4JR2A 4OHWA 1Y43B 1J1UA 3EX7C 1US3A 2JIBA 3MM7A 1WVIA 3WSWA 3NHJA 4XETA 5AKYA 5AVOA 2AZDA 2HWWA 5FADA 4EL0A 1BQMB 1DC7A 4CU6A 1XVUA 2E7ZA 1HDIA 2ZIZA 2ZPXA 3INTA 2W0XA 3TZQA 2HZCA 1C0UB 4D3GA 3AY3A 1SRRA 3ZZUA 2HQRA 2VTEA 5T4BA 3WAKA 4PZ0A 1UU6A 2NN8A 4H7MA 5KNBA 1U02A 2JAUA 1KJ8A 3ICLA 1RTJA 4RW6A 3TB4A 2MQPA 4NFSA 3VPXA 2E51A 5F7OA 3C74A 4FOWA 4MKFA 1DJPA 2XGJA 3W8GA 3HRHA 3POSA 4OFBA 2D2XA 4TKVB 1GNKA 5F8IA 1RADA 2ZGKA 3BKWA 5DHSA 1E5RA 2HW8A 3W2GA 3GQBA 2CVZA 1ZITA 2YVAA 4CN8A 3QNWB 8OHMA 4IXDA 4Q47A 2UUWA 5MDHA 4LE3A 2P9JA 1N5DA 1PAEX 3DXUA 5FX2A 4RMHA 5ELXA 3VZHA 1OWNA 2BEVA 3BRSA 2JIJA 5TPWB 4BMNA 2MKSA 4M3CE 3ZXUB 1K7XB 3JTNA 3CVJA 5DYGA 3N6XA 4IUCS 2O0HA 2QYHA 4QRDA 1SEFA 2HQSA 3NPAA 3RIGA 4CFSA 4CMHA 3ZX7A 2RHSB 5EINA 4R3NA 3DEHA 3AVVA 2VRCD 3ASZA 3Q8VA 3N70A 4WZBE 1R0AA 1OWOA 1WO8A 2V7PA 2VJAA 1HWLA 4JCOA 3P9ZA 1K06A 1N33B 5DDIP 2B4AA 1O1YA 1GU7A 3SJUA 2RB7A 1YSCA 3NNCA 1J99A 2QVYX 2Q4RA 2A58A 4IMRA 2W71A 5FZ0A 3A8TA 1NHWA 2J6BA 1J56A 1RZUA 1TYDE 1A04A 3O9ZA 5ICMA 3SQGB 2FLPA 4L4YA 3MLKA 2YUIA 1HV0A 1J06A 3CLPA 4B3TF 5TV2A 4M7OA 4O02B 5AI6A 4JBLA 3JWJA 1KVQA 5CIRA 2O0KA 1YIPA 1UDXA 3KEMA 4RHUA 3R9LA 3B8HA 2CFSA 3N9IA 3WGKA 1DPGA 2MMYA 5A3OA 4JLUA 1CZKA 5A7QA 5AVSA 1LU9A 2Q1SA 4PZLA 4PDWC 2FN4A 1R091 1H0HA 4NDAA 2E9ZA 1TD1A 1XQXA 3J7AN 3OHPA 4RIHA 3ZCQA 2C42A 1L4HA 3WC4A 2GU9A 1TOAA 3QUSA 4INDA 3GV7B 4U0JA 3HMYA 1X4BA 1D2RA 4U9IS 3EMDA 1RWWB 2XB8A 4F4UA 1BW9A 4HZUB 1FW8A 4CRQA 5IVEA 1NSTA 3ANYB 2JFBA 3K35A 3HUTA 4DSKA 2FDCA 2FPRA 3PNPA 5FWEA 1OI3A 2Y64A 5MFZA 2QSYA 1H3DA 4ZY9A 5JCXA 3QSIA 2NMNA 4E4RA 4BQPA 4OMFG 4JI7B 1PL7A 1UEKA 2UYGA 1R081 4HPKA 4TTAA 3EHDA 4TTGA 3G8TA 4PZ9A 1F14A 5KWEA 3R9XA 5IBCA 2FSUA 4EYUA 2P9ZA 3LKVA 3FNFA 3ETOA 4DPOA 2XCIA 3M1HA 1G3QA 1OC4A 2ETXA 3H6HA 1VC0A 1XEXA 3V4OA 2PSJA 3ANSA 3BCSA 3VPFA 1F0XA 4DQUA 1NCQC 2R6DA 3KF5A 3ZU3A 1E5SA 1Q8VA 3LDAA 2QBYA 3C70A 4HH1A 3SK0A 2JARA 4N77A 3W3ZB 2LCIA 5HQTA 4ITUA 5DDJ1 4YI3A 2XKBA 3G2MA 5SV2A 5SUHA 2Y4OA 5C7OO 4M38A 2YKNA 2JKYA 3TVKA 3NOGA 5JE8A 2QQJA 3DOKA 2F6RA 2QR5A 1VKZA 5E7IA 2WSMA 3W5UA 3WADA 4MZDA 3JYQA 3U7HB 3T1YB 2IXTA 3W9HA 1XTJA 3AVOA 3IDSA 4P9GA 3EGZA 2AC7A 2NZWA 1IM8A 5FPYA 4HXGA 1CONA 3LK6A 1WUYA 2EBWA 4QHYA 3PJGA 1V47A 2XRYA 1LUAA 2VK1A 3OVAA 1RUH1 1NAHA 2CK3A 3O47A 3N0VA 1L1RA 4QXHA 5C8WA 4ZAYA 4ZQGA 2FXVA 3EOZA 3N8GA 4CDQA 5TR9A 5EESA 5LBBA 1TUBA 3CJ5A 1L8LA 4ZICA 4M0HA 1YBMA 1E99A 4LSNA 4D3WA 4DB2A 3F6CA 5LB4A 4K6FA 4L9SA 1T7PA 1DQ1A 1UO9A 1UKUA 4HEA9 3LDGA 3NV3A 2H1HA 1KI8A 3QW2A 1KKMA 5GALA 4LQLA 2Z9CA 3KSRA 5EE1A 4ECUA 3C3XA 3AZXA 3P27A 1SCJA 2UVPA 3N9UC 3WG2A 3I72A 3WR0A 2LU2A 4QYRA 2IP1A 2IUSA 1FMD1 2GC3A 4ZOCA 1UDWA 4QBHA 4ZZIA 2BZDA 5BRNA 5ACA3 3TX2A 2X15A 2NQ2C 3C8ZA 4AE5A 2V98A 4UCWA 3I54A 4I5FA 1X9HA 4EZ6A 4TZDA 3GNSA 3OKCA 2H6EA 2P5YA 3F73A 3TSOA 4F2GA 4URGA 3MYYA 1NBAA 1I4WA 5DU2A 3A8IA 2C1XA 1H1DA 2EXJA 3SJCA 1FQJA 1M2GA 1ACJA 2IXDA 2NUAB 4YRTA 4BLPA 5AKLA 2IUYA 3CULA 3K2IA 5IK5A 3GR1A 3MPBA 2M6KA 3AZVA 1HORA 1MR3F 3H11B 1Z5PA 4PZAA 1XRMA 1JALA 1MV5A 1Q1KA 1EFTA 3LKJA 4ZIWA 3DNPA 1R16A 3QYAA 4BFXA 1FTQA 1N36F 4G5OA 1ODIA 4L95C 1OIAA 3IQGX 3R05A 2ARAA 2GBPA 2H1LA 2E32A 4IH7A 4A2QA 2Q2QA 1QJY1 2OFGX 2O4UX 4ECRA 4DQIA 3N4WA 3RTCA 4M1ZA 3B6BA 3BHIA 2AMVA 4F11A 4RF3A 1SKAA 5F3CA 3RTVA 1YFZA 2F17A 4OJKA 1XNQJ 5D8AA 3ANLA 3G2IA 4D8TA 1HJGA 1VPEA 4QOIA 5CKNA 2BBOA 3EGVA 3OPWA 1UUFA 3TEZA 3EPPA 4DIUA 4INPA 1FL9A 3HJTA 1U7PA 2J3DA 1H6KX 2H85A 1GAEO 2EV9A 2VVFA 3H5IA 4ELVA 3PX7A 5KG4A 1Y4AE 2MYTA 3N05A 5SZIA 2PI5A 1GTRA 4IJKA 1GUIA 3STUA 1YJNS 1W04A 4P0TA 1VCNA 2IHUA 3DHXA 3ZIAD 2OC4A 3L0OA 2TMDA 4EB3A 4E4SA 2Y1FA 4XVRA 2XMZA 4AVSA 5KHIA 3VM6A 4LJ9A 4FB5A 1CUIA 2D6LX 5L3ZA 2RH4A 5E8RA 1I4LD 2AVNA 3EXYA 1RWXB 5C2GA 4JSTA 2I2WA 3RV3A 2VHTA 3ZJYA 4LK3A 3EFEA 1YA8A 3GRYA 2VJNA 1V41E 4DAOA 2I6GA 2B0CA 2RH9B 5JYEA 5HQ8A 4Q3OA 3M3OA 4EPWA 4LE2A 2HWD1 2BYTA 2CQCA 3SDSA 3E6CC 4KOEC 5KFAA 1DL5A 5F78A 4Q2FA 4LF4J 3BILA 3GRRA 4PFQA 2H0BA 4L6IA 1RXFA 4TY8A 4A0RA 4L97A 1NKTA 5A7WB 2GR9A 5LP6F 1J2JA 4A44A 1YK9A 3F3MA 2KM2A 4HNTA 5LBFA 1YIOA 5DXAA 4DSOA 1EINA 2ISSD 1MWZA 3O2SB 2ET7A 3QVLA 2G4VA 4TUYB 1NBOA 2UUAB 1U99A 1IYZA 3GGSA 2WUHA 2D6PA 5BSEA 1KEEA 3TZ6A 1X33A 4LQDA 4YYOA 4CDQC 1YDGA 4EG6A 3FCUB 2H63A 1YXWA 3WISA 4ZO8A 3POYA 2DM6A 3DKRA 1POQA 2WF6A 2XF2A 2BD0A 3D54A 3A06A 5CYFA 2A1BA 5FFOC 1KLMA 2E3JA 1ZQ9A 4C8YA 3S2IA 1P74A 1QH8B 2ETEA 1NJ2A 3TQHA 1GXSB 4K03A 1FY2A 2PUGA 1QYCA 1OD5A 1CS4A 5KHLB 3OCJA 5JZGC 2FUKA 4MQBA 2GD6A 1M6EX 5F8MA 2L9LA 1E3WA 1Y9JA 4ES3A 3BIWA 1YQGA 1ZZNA 3V1YA 4F5ZA 4IH4A 2YOHA 1KO1A 4LISA 2Z09A 5FUIA 3MJHA 1O3QA 2PJDA 4DS3A 1JLBB 2DG2A 4K7JA 3FBBA 3NTLA 1G7CA 3LDKA 3U6BA 3S2ZA 3ZZYA 2OZ6A 4ED4A 3NEPX 1PHMA 2OBMA 4OIMA 1A9TA 1DKRA 4E5KA 5E2QA 5BNOB 2LEBA 3H90A 2HF9A 3L93A 3T0GA 2ORZA 1N5VA 4GA9A 3IO5A 3ZTRA 2VM9A 1I9GA 2ZR8A 4LUKA 3NOXA 4Z7QB 1N1GA 4B3MF 3L92A 2QQPA 1PQYA 3PNLA 2W68A 1VIVA 3FYUA 1NSAA 3UQYS 3N53A 5DRKA 3GMTA 3ZV3A 5IFPA 3ENZA 3ZVKA 4LF8J 2L41A 4I2PB 3ZGOA 5F98A 4GM1A 4I2QA 2Z2XA 1HETA 1LQ9A 3FCSB 1E0DA 3PQ7A 1CESA 3HFSA 3MXHP 1UBEA 5FWXA 2FJDB 3EFHA 1N9GB 2PH1A 1M1GA 3QUBA 5ADHA 4HSGA 1SUBA 1OS5A 2C99A 1EJBA 1DEKA 4ZO4A 1IIRA 1EFPA 2XMAA 1BDHA 2F43A 2X8BA 3PEHA 2CDBA 2DUNA 3BPDA 5D8AC 4QVIA 3M2UA 2V2KA 4AFNA 4DCOB 1QEXA 4DQAA 4X6QB 2JFVA 1P8JA 5FJIA 4C7BA 4UUBA 4FGJA 2GVDB 3B36A 3HMJG 4DQQA 2FVCA 4QW9A 1KNXA 4EUFA 2RS13 1BEEA 1JHXA 1X19A 1Y1RA 3EW7A 2SBTA 3OOHA 4WW0A 1I1NA 1H5QA 5A3WA 5BMVF 1OY8A 1LDYA 5HATA 3HNOA 4N0PA 4ZQFA 4YR7A 3NTUA 4HEA1 4I1RA 5F8GA 1H7WA 1ZCZA 1AHIA 3L02A 2DURA 3B02A 2DVMA 1UK7A 4LJHA 2W90A 1VI6A 2ZCUA 3OCXA 1CY8A 3VWSA 3G2NA 5TT1A 2DT5A 1PL0A 3LDRA 3HBFA 4B2LA 2O8EA 4N7MA 4F9EA 4Q9HA 2QNIA 1H4QA 3KD2A 3ODGA 3ZO7A 4MLOA 2C2YA 5K3AA 2MLXA 5M34A 2VNRA 1P1BA 1ZVMA 4JMPA 1ESNA 1E61A 2ZUTA 3K0FB 1NFRA 4DSEA 4IRDA 5IVIA 3ZYRA 4O3FA 2CQ0A 4BNDA 4QWWA 3UJNA 1UZZA 1JEQA 5KNBH 3V6DB 1W52X 5A6SB 2WNVA 2P78A 1ULRA 3F6YA 2DF7A 4DMGA 5LL6P 4O4LF 4L9BA 3QATA 3NIBA 2H3HA 1CUHA 4RGYA 1FP2A 3W21A 3KVRA 4RFT0 4KT0C 3QLQA 2H4YB 2FCRA 2HBRA 5KOHA 4KH0B 2E33A 4WXMA 3A9UA 3SJZA 3HT3A 5LUBA 3HVUA 4X92A 2D0PB 4EA9A 2TMYA 4CEWA 3VBRA 2CGEA 4DEVA 5FFMA 2FCUA 1UETA 1RKJA 1SJFA 4EA8A 4I9GA 4MJKA 1QG2A 4UBJA 4ZHQA 3WMXA 4P02B 3HMQA 3QJPA 3WIBA 2FPOA 4HLCA 2QTMA 3NYWA 2M98A 1C3LA 1CS4C 2ZJ7A 3B4MA 1ENRA 5GONB 1YZ6A 4WU2A 1S9HA 3AX6A 4WDQA 3JAWB 2FDXA 1NF9A 1S3FA 3KYIB 2PN5A 2PLAA 1VE0A 3VH1A 1KI9A 3WQRA 5J1TB 5I7RA 5JQWA 1D8TA 2D1SA 1LI4A 5FHRA 1SVDA 3D7SA 1GYKA 4KIFA 2CZ4A 1DGQA 3HDGA 4OXQA 3E5MA 4OJGA 3NM4A 4F04A 1WZIA 4EY7A 1VP6A 1SH2A 1X14A 4Z2YA 3EZOA 3RVSA 4GC7A 4IDHA 5IAAA 1SBDA 3DRRA 5ILOA 4Y2CA 4PIXA 4H60A 1SPBP 3WLPA 3HB7A 3THDA 4PYAA 3R7BA 3FYUC 3E3XA 4XWKA 1QIGA 4Q34A 4FYHA 5G0WA 1S1VB 5FMBA 1HV8A 1PO13 3BT7A 2R062 1JLFA 1U1MA 3DP9A 4QT4A 4NIMA 1K6IA 1UJBA 1V9OA 2R4FA 1XZKA 2JLCA 3DUWA 4M00A 4JIMA 3HXTA 3BTZA 3NAIA 4YUWA 1WZXA 3CLUD 2FLWA 3TAUA 1VXRA 3M8PA 5FZIA 1PJTA 4KE5A 1Q8QA 1DLIA 1E1DA 3HY3A 4L2NA 4YVFA 1W59A 2GSDA 3IMNA 4MOAA 2DQZA 4WJZA 5FZFA 4TRNA 2IM2A 2ILVA 5HFNA 721PA 1KAMA 4GZLA 4BLJA 3OXGA 4FFOA 4FPIA 4KVFA 1NRXA 2XUKA 1TO6A 1RZVA 2HWF2 3K0BA 1E2GA 5HBMA 5KFZA 5BSKA 1XLWA 1I6XA 3CGWA 3E4CA 3FHJA 3QBTA 2Z98A 5CLIA 3BD6A 3D6AA 4ARXA 3U61B 5FY0A 4QDXA 2DWCA 4Q4V2 4DUGD 2XQRA 4LKEA 1YQ9A 5J2MA 3K8QA 3GFPA 3M1VB 3NBAA 4UMFA 4F4JA 4TTIA 3UESA 1NJGA 1KK3A 4E12A 2NG1A 1WEXA 2PKQP 3AZQA 2WN3A 2P5SA 5D7BA 1IOWA 2OXBA 3C3LA 2CFCA 4UQPA 2XCUA 1VBB3 3PFCA 3VH3A 4FNHA 2GVNA 2WWWA 5EJAA 5E9AA 3GZ7A 2GZSA 1OMSA 2HHCA 3K9CA 3FPGA 3WBBA 2PR2A 4HDHA 1F5FA 4GHWA 3AK4A 3DMJA 2HRYA 4K0KF 2XE8A 3S81A 5DB4A 1VE5A 4ZJPA 4YS6A 5ULLA 4UTPA 4CTOA 5H1SV 3RQSA 1CBKA 1FDAA 1MVOA 3MW4A 2ZH2A 3USUB 1YDFA 3A4YA 3ND7A 1V45E 1HFJA 5KHAA 3JYOA 2ATIA 3CTMA 1PNRA 1VQNS 4OQJA 2XWBF 1T43A 2V0CA 3AOGA 1N5SA 3HNBM 3DHEA 1Q17A 2OCKA 3TNFA 5HX7A 3QEJA 2MSWA 2YJ5A 2GHIA 1NNDA 4ZCMA 5K7PA 4NE7A 5H7XA 1OFUX 1KE2A 5ECDA 3IM9A 2NU9B 4OYLA 2LM3A 5AM2A 1GPMA 4HPWA 4CDUB 3S0MA 1QGAA 5BVHA 2VD7A 4DR7F 1Z6ZA 3PU6A 3MWFA 4BECA 4XWGA 2HMSA 3VR4A 4GT1A 3GQVA 1W25A 4LBJA 3A3KA 4X45A 2OOSA 1KDOA 1RWPB 5A7FA 4CDNA 1G3MA 3MWDA 1B23P 2EBHX 3BQN