1HIXA

Crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ITTNQTGTNNGYYYSFWTDGGGSVSMNLASGGSYGTSWTNCGNFVAGKGWANGARRTVNYSGSFNPSGNAYLTLYGWTANPLVEYYIVDNWGTYRPTGTYKGTVTSDGGTYDVYQTTRVNAPSVEGTKTFNQYWSVRQSKRTGGSITAGNHFDAWARYGMPLGSFNYYMIMATEGYQSSGSSSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Analysis of Family 11 Endo-[Beta]-1,4-Xylanase Xyl1 from Streptomyces Sp. S38
pubmed doi rcsb
source organism Streptomyces sp. s38
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 51
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hixA00
1REDA 1W2UA 3WQ1A 1QH7A 3WQ7A 3WR0A 2BVVA 1XNKA 1BVVA 2B46X 2VG9A 2DFCA 3AKSA 2JEMA 2D97A 3WY6A 1AXKA 3VZNA 3WP3A 3WQ0A 1XXNA 5HXVA 1C5IA 3M4FA 1H8VA 2DFBA 1OLRA 1KS5A 4HKLA 3MF6A 2B42B 3VZJA 4IXLA 2BW8A 1H4GA 3WP5A 3WP4A 2QZ2A 1M4WA 3HD8B 2JICA 1REEA 3AMPA 4HKWA 3VHOA 3LGRA 4S2GA 1HV1A 1T6GC 2QZ3A 3RI9A 3VZOA 5K7PA 3VZMA 3AKTA 3RI8A 3AMMA 3WXPA 2BWCA 1F5JA 1HIXA 2D98A 4XQWA 4NPRA 3AMHA 1UU6A 3VL9A 2DCKA 2VULA 1XNCA 1H0BA 4S2FA 3WT3A 1PVXA 1C5HA 2VUJA 5EJ3A 4HKOA 4S2DA 3AKPA 1UU4A 4HK9A 3VL8A 2B45X 1BCXA 1OA3A 1UU5A 2DCYA 1BK1A 3MF9A 3VHPA 3MFAA 4H7MA 1XNBA 3B7MA 3AKQA 1OA4A 3VZKA 2JENA 3O7OA 1IGOA 1ENXA 2Z79A 5K9YA 1XYPA 1H1AA 3B5LB 1XNDA 1NLRA 1YNAA 3VZLA 2NLRA 1KS4A 2F6BA 3EXUA 3VHNA 1OA2A 4XPVA 4HK8A 2VGDA 3WP6A 1TE1B 2C1FA 3LB9A 1XYOA 3MFCA 2BWAA 2DCZA 1REFA 4XQ4A 3AMNA 3AMQA 2NQYA 3WX5A 4S2HA 1H4HA 3ZSEA 3VLBB 3AKRA 1HV0A 2DCJA 4XQDA 1UKRA 1XYNA 3VGIA 1OLQA 1QH6A
chains in the Genus database with same CATH superfamily
1REDA 2VQAA 4LO7A 3WNLA 2D5FA 4SBVA 4CEYB 4KBZA 5C4WC 3WQ1A 2BBVA 4D6QA 1VRBA 4OUEA 3ZXDA 1JMUB 4GMP1 2X29A 3RZMA 3S7EA 4BQYA 3TOJA 2GDFA 1ODNA 1XRUA 4CDXA 1LECA 2Q5TA 2RM21 5J09A 5IVJA 2TUNA 3LOBA 3OPTA 3W5MA 1ND2A 1R093 2AZ5A 1HDKA 5FOJB 5C33A 2I74A 1GKBA 4YLZA 2XQRA 1N1VA 4D6SA 2ET7A 3I59B 5IVYA 3WG2A 3ZN4A 5IATA 4PIYA 4BYYA 2XG3A 2WJSA 5C71A 5C7GA 1RVF2 1AUYA 4Q4X3 2BERA 3FHQA 4UOJA 1KJRA 5B4NA 1U5ZA 3GJBA 2BW8A 2VW2A 3ZKYA 5FZDA 4NN0A 4Q4W1 1MR5A 3CZUA 2RJLA 4AFCA 1EPWA 5LBCA 2GU9A 1REEA 5EWSA 2OYZA 2PLV1 1WGPA 5K0UC 2ZABA 2Q8EA 3POEA 3FLPA 5AVPA 3WEZA 3ZMOA 2PAMA 5FZAA 1RUG1 2ZBJA 4XHXA 1FX5A 4RQPA 1S1AA 2WFF1 5GLTA 3ZFEB 2BVBA 1HIXA 2D98A 4DXRA 1LKNA 5C3QA 3RZHA 1GV9A 1K3IA 5F5CA 1A8DA 1H30A 4CP9A 4IE6A 1DQ6A 3B00A 2FZ1A 2DCKA 2VBBA 2VULA 5FMDA 1H0BA 5FJKA 1GWKA 1I3HA 1LR5A 4ISQA 5A32A 2XVKA 4UWDA 5FK8A 3HN3A 3AFGA 1JYIA 2H0BA 4MXVA 1WA6X 4QGNA 5LEKA 4CUCA 4YZ1A 3H1YA 4AHXA 4CEYC 4QPYA 3V0AA 3AZYA 1ULDA 4RS5B 4GJYA 4NUBA 1NA1C 2WLPA 5K4LA 3VBFA 4CCDA 5G05L 5A1AA 4AE2A 3PIJA 1H8TA 1QQP1 3MLJA 3KVAA 5FJHA 4PF1A 1V9U3 2LALA 4RR3C 1LENA 2A71A 2XQXA 3LWCA 4DY5A 2YC4A 1C28A 4FAHA 3TAYA 1J3PA 1FPN1 3N3HA 4HK8A 2JXAA 3WUCA 4BLJA 2JB8A 1OXCA 1US3A 4FPJA 1LEMA 3B69A 3B02A 1UZVA 3ZFFC 3BN6A 5DMYA 4FTEA 5FP7A 2VZ1A 1GUIA 4OQ8A 4AFAA 3T4VA 2QUOA 3CJIB 2XJSA 3RZZA 4OI1A 1AYN1 3S57A 2YC0A 5DAVA 4XILA 1Z0HA 4FFHA 1LODA 2VVEA 4YSFA 5J7MA 4M0NA 3AB0A 4FP2A 3IBMA 1DBNA 1CAUA 4C8DA 5L19A 1W6PA 3ZSMA 5SV5A 4QQLA 2HWE3 4YG3A 3ZYJB 1OLQA 2WZR3 1TME1 1V6IA 4AVVA 4BU2A 1UIKA 4XUOA 3O0VA 3OGVA 4QKNA 5FZ8A 2AEZA 2CWSA 3MI8A 3H3UA 5A7WA 3ZOIA 1RUH3 2VNVA 2ATFA 2CTVA 3Q8CA 3WR0A 4DRRA 4ZU7A 3VD3A 4HPKB 3RS6A 4XF3A 1UNBA 1TNRA 3DXUA 2VJXA 4QMAA 3MDPA 1MS5A 5FOBB 5I0TA 1POV3 3QOPA 2ZTNA 4XJAA 3MUZ1 4QD2A 2AYHA 3OUHA 4JGYC 1S0JA 5F3EA 4Q4Y3 3B3QE 5HV0A 4Q4V1 4D0QA 3P3NA 4CXWA 1H2NA 3BKZA 1G8WA 3FUOA 3W58A 2B5HA 2IFRA 4FT8A 3TN93 4HZFA 1OFNA 5IWFA 4CU8A 3BI3A 2Y6FA 1FI2A 1DG6A 2XGXA 4IEQA 4LHLA 2BOIA 4BQ4A 1QWRA 1A78A 4M0HA 2A5ZA 5GZDA 4AHYA 4NOTA 1YQ5A 2D6MA 4XJWA 3DKWA 5K7PA 5JIAA 4ES8A 1RUC1 4FFFA 1G86A 5LA2A 1ZBE3 2BP6A 3MLLA 3VBSA 3VBHA 3ZO0B 2O8QA 2Z2SB 3A0NA 3VBOB 3T1LA 4HN1A 1BK0A 1HXS1 4D8MA 1HRV1 4KU8A 4KGQA 4Q0VA 3POGA 3SEPA 1HQLA 3T09A 1QKQA 5JVVA 4EZ4A 3S0MA 5F2WA 1QMJA 3WW4A 1RUG3 5FZFA 2PAKA 3M8LA 3U14A 5CU1A 2ZGLA 1W6MA 5L9RA 2J1EA 2Y6LA 3VDDA 3C7FA 2P4EA 3KQRA 4JTNA 4UXAA 4URAA 5BUVA 3ZN6A 2Q1FA 3HBKA 2ENRA 1RUC3 3JCIA 1UU5A 1GQGA 3RQ0A 1KFUL 1XU1A 4I02A 2W94A 1YEWA 4YW5A 5LBEA 1UW8A 5F2SA 4YM2A 4HVRA 4L2NA 4O65A 1Q8OA 2Z79A 4AFMA 2V09A 5FP3A 1COV3 2PHXA 3AX4A 3TN91 4XBNA 2DUOA 4D69A 3FZ3A 5T50A 5A6YA 4AL9A 4L97A 5F3IA 3WW1A 2VNGA 3PU8A 4TWTA 3NMBA 2RDQA 5A3WA 2B9UA 4I01A 1TE1B 2AC1A 1BEV2 4X6RB 3A7QA 3AXEA 3O0WA 4LA2A 2DVGA 4AHZA 1PM4A 2LS6A 4OZXA 1RUI3 3HT2A 1UIJA 4QXCA 3WSOA 3BALA 4B8EA 5BNOA 1SDDB 2VOXA 4CEYA 1R1A1 2D3SA 3HMYA 3T2PA 2VMHA 4LBJA 5E6HA 2DURA 1UWWA 5FYSA 4LR4A 1GBGA 3N35A 4PF5A 4L9BA 2KD7A 1W6QB 4HT1T 4MH0E 3OG2A 2ARBA 2BUKA 3PTRB 3I2HA 1V9U2 3U1XA 1S0EA 2XLAA 2E33A 2XBO3 3LE0A 4RGAA 3IDBB 2JX9A 5CA6A 1S0FA 4MV2A 5A80A 1AYM1 1GR3A 3TEXA 5G04L 5CFCC 2BNMA 5D8AB 3J26N 5L36A 4B1MA 5ABJB 2VC9A 4CZSA 4OCTA 1PVC3 4O9GA 3WY6A 5IW0A 3B93A 4QX8A 5A33B 3PDQA 5J48A 4XBLA 1O8SA 3USUA 2RR11 4QQPA 2VZPA 1RYYA 1EPZA 3M7AA 4P9XA 3QD6A 3RMYA 4IGPA 4QPGA 2Y34A 1W6OA 2DFBA 4IETA 5DUWA 5J96B 1V9U1 3LCPA 4QM9A 4XFHA 2FDGA 3GDBA 5FZ6A 2UURA 1O91A 3J8F2 4QHBA 4RS5A 2ZA9A 5HBAA 3EYPA 2CGPA 5I91A 3KQ4B 4LBNA 3BU7A 1VBD2 2ZGUA 3K4ZA 2ZKNA 3AZWA 2BPA2 3MBWA 2A6XA 4Q29A 4QXBA 1W3VA 1AYM2 3U07A 3ECQA 2VQTA 4Q4V3 1FYUA 1PZ9A 2IXCA 2ZZJA 4FTSA 4E2GA 1ZZ9A 2QZ3A 1T6GC 3IN9A 4GH4C 1SCRA 3I97A 3ES1A 4IE5A 1LHOA 4FBFA 1E5HA 5FZMA 2RV9A 1W3XA 3BPZA 4CDXC 2J1UA 4LO4B 4RQPC 3I3QA 1VAMA 1HX6A 5FZHA 4LBQA 3THDA 2LTNA 1DGLA 3BTZA 3OEBA 1IQDC 3IPVB 4XABA 5F5AA 3CKHA 2ZJCA 3O1PA 1PVXA 3FLTA 4AGRA 4H7LA 1MZFA 4YM0A 4XFIA 4AZZA 1MS0A 4IV1B 4EWEA 2VO5A 1VE0A 2VAUA 5FYMA 4CPBA 2WYFA 4IV3A 3SNMA 5KBFA 4FOQA 5FZOA 2YBKA 3WNPA 5JSRA 3VKOA 1YFUA 1DYOA 1EYBA 1R092 2WAOA 1ODMA 5FZ1A 3BOPA 5C9AA 3T30A 1CESA 2TEPA 2VXRA 3O7OA 1IGOA 4BCUA 1XJAA 3O14A 3PJQA 3LEIA 4Q4W3 1K45A 1XPWA 4UI9L 1SLAA 3S5AA 4DNYA 2OQ7A 1LESA 1OD5A 1R1ZA 2VXJA 5LA1A 2RS51 3LF7A 4XDPA 4MGSA 4AW7A 1UZYA 1XC6A 2EIEA 3PUHA 3WNXA 5JWPA 3H7JA 1PGL1 2GP3A 2WYSA 1YQCA 3OBTA 1H9WA 4FQZA 4Q8LA 4Y22A 3BTYA 3A4UA 4UFMA 1QF3A 3FFZA 1D4VB 1AX0A 3ACFA 3KHCA 1YRZA 3MEPA 2EXIA 2W91A 3JUUA 1WLCA 1OFSA 4MGTA 5FY1A 2ARAA 4PDWA 3O1VA 3IB3A 3I54A 4MVTA 2FZ2A 1VMFA 5APAA 1PMJX 2IWGB 3B01A 4NPLA 3WW2A 1KGYA 1W8NA 5CFCA 4O7XA 4YZ2A 3LA2A 3RFRA 3ZXFA 3H7YA 3UETA 4H3WA 1PMIA 2ZOEB 4XDOA 2ORXA 5FCCA 3ZMNA 2WNEA 3OGSA 4XCBA 4L99A 5L9BA 3T08A 1HN1A 1FXZA 1AR92 4C0HA 5KXDA 5T3NA 2Z4FA 3M70A 3PVBB 1W9SA 2XKOA 5FBZA 1XNAA 3AC0A 4EROA 5C3OA 3WG1A 3M3QA 1QH7A 1QJX1 2DVAA 5JI7A 3N9OA 3ZYPA 1BVVA 5HV4A 4XIOA 1C8M1 2JE9A 3EMRA 4TXWA 4YYOA 3RWNA 3SQOA 2E7QA 3RZGA 1BBT2 1BMV1 1RVF1 3WP3A 4URTA 4AG4A 3WHTA 2BZDA 3W9AA 3LPGA 3G7DA 1WLDA 1COV1 2ZKLA 4OFGA 2HWD1 1W6NB 4WM7B 2WDBA 2ZHNA 2X05A 4XHBA 1F5FA 3HNMA 4XVHA 2OKXA 1GZ9A 1VBD3 2Q0AA 3V56A 3CF6E 1POQA 2IZWA 5HXMA 2RS53 2JIGA 5IVEA 3TEYA 3A23A 4R9DA 1QJY2 4A7KA 1U5XA 1W2AX 5JOZA 4HMZA 1E5RA 3HQUA 1F15A 3J7HA 4YVWC 2BNNA 4OLLA 5H9PA 1FOD3 2C0ZA 1HB3A 4EYUA 1AL22 3SXWA 1VRH3 3PUAA 3GCWA 4GH4B 4ZZ5A 1QGLA 1W9WA 3L9JT 2OIIA 3OTFA 4A41A 1EV12 2MEV1 5EJ1B 3ZIXA 5DZEA 4CU7A 3NWKA 1W6MB 1VAKA 3EHKA 4RFT0 2BDRA 4UW5A 1VBC1 4I3GA 5CBLA 3JBG2 1S0BA 2OUJA 2VZSA 4R9BA 4XFBA 1IPJA 2P2KA 4NAMA 5SV8A 1UX7A 3M3EA 3P5BA 4I0BA 1OSGA 2JIJA 1CX4A 4K8RB 3R0RA 4L92A 2R062 5BNPC 2W87A 1DIWA 3ILFA 3NV4A 4COUA 4HK9A 1N1TA 2UYBA 4A7ZA 1RTVA 3K75B 3DKQA 1V6LA 2UU8A 4XEZA 3FWEA 4LMFA 2R6QA 3RRDA 3HJRA 3OY8A 1X7NA 4N8MA 5LBBA 2QQWA 4BK4A 1VALA 3PUSA 5JR2A 1DU3D 3VD4A 5KXCA 1T6BX 1RUJ1 2W95A 5FO9B 3NKGA 1H8TC 2E7TA 3JB4C 3N7JA 2PTMA 4Q4Y2 3J8F1 5GLVA 4CEWC 2IFWA 1NLRA 2IXKA 1UXZA 5T5LA 4Q4X2 3MUY1 1OBNA 2A73B 4RGKA 3BB6A 2NMOA 3FFQA 2X09A 3E6BA 1GWMA 5JZGA 1LNSA 1Y43B 2UWAA 3GZAA 5FMCA 4ET7A 1XE8A 2C1FA 3KVBA 3LB9A 1HRV2 3CO2A 5F1RA 1NLQA 1OQ1A 2DBNA 3D0JA 2QQJA 4IE7A 5ABJA 2DCZA 4MXWA 5DDJ1 4EQVA 1JZ5A 4H55A 4N7UA 1EP0A 2NQYA 3VBSC 3NAPA 1DZTA 5BNNA 1H4HA 3UT0A 2VCAA 1GWLA 1WLWA 1CONA 5I8YA 1W9YA 4RR3B 4CP9B 2VL4A 3SH4A 3A21A 5EJ3A 3JZVA 1L7RA 2WS91 3AZZA 3ETPA 3IWZA 5CFCB 3LAGA 3AL5A 3WQ7A 1V6MA 4Y24A 5K0UA 4BLIA 2VR4A 2WSUA 1LOFA 2A7AA 2BVVA 3PUQA 4QDSA 1H1MA 3LZZA 3TEZA 2VG9A 2NN8A 1H9PA 1HB1A 1GYKA 2FCUA 2E9QA 5FY0A 3UESA 3BIEA 2YY1A 1O3RA 2XUMA 3I2GA 1RUI2 4P02B 1LRHA 5KR7A 5KC5A 2HYKA 2G9FA 3IMMA 4UFIA 3POIA 2K0GA 2VZTA 3ZFGC 1ZBA1 4KI5M 4D7SA 2XWBB 3MF6A 3MIBA 3LFMA 4FPKA 2D43A 2K9ZA 1PO23 3KCCA 2AREA 2HLEA 2V73A 4COYA 1NXMA 1W0OA 1VPHA 4QHOA 4CPBD 4QKFA 2DVDA 2YPDA 5BNQA 5JMCA 2VD7A 4BQWA 3T2OA 2RDSA 1VRH2 4IE4A 4K6BA 4TSVA 3KF3A 4LBMA 5JOYA 4MGYE 4S2GA 4Y3OA 4IEPA 4UW3A 1VBA3 3I2OA 5LATA 3FC0A 2JECA 2R1DA 1O4YA 3R4UA 5DDJ2 2X10A 4F3JA 4QKDA 1IKPA 4YARA 5DAXA 5JXJA 1Q8PA 1TME3 2WINB 4Y4RA 5FZ7A 4MADA 1LOBA 2ZEYA 3UV9A 1PX3A 1PGSA 2J1TA 5FZ4A 1ACCA 2ZHKA 5FZIA 2JE8A 2DV9A 4RA0A 4P9LA 5GZEA 3BTXA 3VL9A 4Y33A 1AXZA 1U0AA 3ZYFA 3LEKA 3APBA 2VVFA 4COZA 5ACA2 4MSVA 3ROUA 5FY5A 1W03A 4NRPA 3DPRB 4DXZA 1V6KA 2WAAA 3Q8EA 4PIZA 1LGNA 3VL8A 1POV0 4Q8KA 1Y9QA 4AI2A 1OA3A 3NV2A 4KH9A 3VBRB 1KITA 4BOWA 1O59A 1QJFA 5DUVA 4FVVA 1J84A 3CZJA 3ZXJA 2BGCA 4PCRA 1XQNA 1MACA 1WWYA 1VBD1 3EO6A 3POJA 1US2A 5JSPA 2DTYA 2R061 3N36A 4UW4A 3WNOA 1PO11 1H1AA 5FYCA 1CJDA 3NNJA 4NMIA 3VBUB 4A44A 2CDPA 2A3YA 2W9XA 4NVPA 3NNFA 5ACA1 1NYWA 2GSYA 3GBWA 4UT5A 1HJFA 5H9SA 3WVJA 1AJOA 2D7FA 4KU7A 4CA9A 4OI2A 5A3LA 1RMU3 1XBFA 4UAPA 2Y33A 4LEJA 3WX5A 2XDVA 2UWCA 2HBUA 3KHBA 2VM9A 2YROA 1BXHA 3WD5A 2E63A 2MEV2 1F8VA 1Q5OA 1BZWA 1Q3EA 4LK7A 4PDWC 5EFUA 5FZGA 4IEUA 4LKDA 4IL7A 5C8CA 3QLQA 1A34A 4MGQA 4OHXA 2BYVE 3FHIB 5FUIA 1MS4A 1WCUA 2HWB1 1OF4A 3QH6A 2CWMA 3OEAA 3KLSA 2RMU1 2P3YA 3E5UA 4FXKB 4IQPA 1WCKA 4J1XA 5IAXA 2XLGA 4XUNA 2OZJA 2QQIA 2ZGRA 3MPBA 4DXSA 5HPOA 4BWOA 4CXYA 5FYUA 1A3KA 1XNTA 2YFUA 3AP5A 5FP9A 3SC7X 1R083 1D0HA 4B7KA 4GA9A 4IGQA 3ZSKA 3ILNA 3C2UA 5T5OA 3AZVA 3OSDA 2GH8A 5FMOL 5BYNA 3HQRA 3VKLA 2ZPXA 2VVDA 1O3QA 4TTGA 2F4PA 4RHV2 5FZCA 3E6CC 1OLME 1C5IA 3ILRA 1F4HA 3SKVA 5JOXA 3PMSA 1SPPA 1AR91 2B4KA 4RSUA 4OMDA 5AFEA 5FMOS 5J3UA 2JDUA 3SEEA 2CU5A 2Z42A 3VZJA 5DZGA 1Q43A 1SG3A 1G9AA 1H4GA 1VB2A 3NVCA 3N9MA 3WOGA 4B1LA 1RUOA 1KD7A 2ZGPA 3ENRA 1U12A 1RUD3 4LO5B 2RM23 3GXUA 2ES3A 4GULA 4N43A 3ZN6B 1HRI2 1OUXA 1QEXA 1ZM1A 2D6LX 1DQ4A 2B8MA 3NO8A 4D7TA 1JYVA 4MOAA 1PMHX 5LY2A 3OPZA 4LUMA 4KG0A 2Y6HA 1RIRA 3GJAA 5EHDA 1UD1A 2E26A 3ZFGA 4WVMA 4DB5A 2CV6A 3CU7A 2P3JA 4J1WA 1C1FA 1DFQA 1W05A 3DN7A 3O1OA 2RS31 2GC2A 3ZR5A 2HEYF 4HBNA 5FZ9A 1J59A 2JKBA 4LBQB 2XH6A 4I0AA 3SHRA 2WZ8A 3ETQA 1G9DA 5JXGA 3VN4A 3ITQA 4S2FA 2XB6C 2XHKA 2P6HA 3EBRA 2BU9A 5FWEA 2DBIA 4AQ2A 5KC6A 5LEJA 1QJU1 2VUJA 4Q0UA 4GB32 5CNAA 3F2ZA 5IVVA 2V72A 5KXBA 3PHMA 3S7IA 2B9VA 5GM0A 1V6OA 4V1PA 2H0VA 1ALYA 2D6NA 3PVNA 4CEWA 1LOCA 3CBNA 3OCPA 1AR71 1OA4A 4BZ4A 3I49A 5F6KA 4Y20A 3JBG1 3HR9A 5J36A 4AEDC 1SBDA 3HQXA 1RHI1 1RXFA 1XE7A 1K12A 1ULFA 1VLNA 2CL2A 2JDYA 2P34A 2NLRA 4B7EA 1AL21 2BOJA 3CIHA 2F6BA 1S55A 2VY0A 4FP3A 3VHNA 5KHGA 4NIHA 2PHUA 2R043 4XPVA 1YFWA 4KWKA 1OC1A 1W99A 1WW4A 3H1WA 4YVSB 4ZU4A 4Q1RA 1QXPA 4FI9A 2DDUA 4E4SA 5LW9A 1NQJA 3HWJA 1X9PA 4JVAA 4BXSV 1OURA 1X8MA 1GQHA 1R081 3H0OA 4CDQA 1I1EA 4OQ9A 5JR7B 4CRQA 2WNVB 1AX2A 2DYCA 5FR3A 4P00B 4FOVA 1NZCA 3DYOA 3MIEA 3M3OA 3CMGA 2CGNA 2D6KA 2X5IB 2MPFA 4PLMA 2CAVA 3I4IA 5LWBA 5F32A 1UX6A 3AVSA 1QH6A 1KQRA 2GNMA 4Y1YA 3MIFA 3IZOA 3NNMA 2WKKA 2QE3A 2C6SA 1FNYA 1J83A 3F95A 5FPVA 4ZPIA 2VE1A 1OUSA 4KG8A 1K42A 3ZYRA 1UZZA 5I93A 5I8SA 5C70A 3T0DA 1ZBE2 2FHRA 2QQLA 3OOXA 1W28A 2WL1A 3PURA 5FUNA 1VBB1 4P9IA 4ARXA 1D0GA 3DF0A 3MO4A 4WM8C 1KS5A 4META 2A6YA 1LU2A 3VDDC 4WZCA 2JB4A 2JE7A 3BOWA 2B42B 4YVSC 5JUVA 1BQPA 3ACHA 3ME2A 1ZZBA 2C5DA 4QDQA 2ZEZA 2N7GA 3C7HA 2XJQA 1L7QA 4XOGA 4K9SA 4YG6A 4E8DA 1HKDA 1PGW1 5HCAA 4HL0A 2W47A 4YVWA 2EF6A 3SMHA 4A2UA 3AK0A 1CPNA 2WO7A 4DIQA 3ATGA 3GZUC 3VZMA 1WZXA 3ZX7A 1MEC2 4JDNA 2AENA 4Y26A 5IUQA 3SCFA 3VBFB 4JDMA 3NJYA 4GXLA 3ABZA 4AVAA 4Z2AA 5GZCA 2UY9A 4XQWA 5FYHA 2Q1MA 1VAVA 2PHDA 1TNFA 3U37A 1DGRA 2GP5A 2Q30A 2VUAA 3K3OA 2XXZA 1ZX5A 4B4RA 4YGDA 3VBRA 2GALA 1YIPA 2P3IA 3OBAA 2VZVA 4XZUG 3I2DA 3K77A 3LA3A 2OA2A 3WT3A 4LOTA 3CL1A 4UW6A 4JRAA 1GOHA 1W2NA 5IK4A 1IOAA 2OPWA 2Y60A 1QOTA 3GBGA 1OF3A 1QU0A 5A7NA 2D5HA 2YU1A 4BQXA 4C90A 5DPNA 4P9WA 3U0ZA 5A7QA 4C0BA 5FFOC 2A6ZA 1W8ZA 4U36A 4DOUA 3WF1A 1NCRA 4CU6A 3RZKA 4PLNA 1VIWB 4QU2A 3ZXGA 4BMEA 3OY8B 1FAYA 5CFDC 2E51A 3AYDA 3ZN5A 4LE4A 5DABA 2DTWA 4E8CA 1MPXA 4ATFA 1XNDA 2EALA 4CUAA 2W0XA 5IYYA 2B7YA 3T0AA 1ND2C 2FDJA 1POV1 1RINA 1YNAA 2H6BA 2R042 5KHIA 1O7FA 4XF1A 3TB0A 1P8JA 4XTMA 2R071 4H14A 1F4AA 1CAWB 1I6XA 3LD8A 4JRLA 4Y20B 4NHYA 4ZONA 4OHZA 1JI6A 5LA9A 1LOAA 4AXOA 4XUPA 2ZZQA 1XE0A 2Q1ZB 2VTXJ 3P1IA 5FWJA 5IT6A 3UJQA 2O8OA 1QJY1 1W0PA 1YFYA 4M4RA 1W8WA 1MS1A 2BFUS 3AMQA 3LEGA 5F7UA 1MVQA 3VD9A 5C8WA 2JG9C 1OVSA 4FXGB 1NG0A 4KL1A 4K21A 3AZXA 2FMDA 1N3OA 1A8MA 3LA7A 4JGZC 4YZ3A 2A3WA 4RR3A 5JLVA 5LCWL 2BNOA 5IAVA 3MZHA 2XUEA 3VDBA 1K5MA 4WVMB 4CP1A 1OQEA 3KV6A 1ZBE1 4XUTA 3MPPG 4QXKA 1YLLA 2X5IA 1MVEA 1DGWA 4Q4V2 2ZX2A 4XACA 1QJEA 1RL3A 3VBFC 2B46X 2GC3A 5CIRA 5KXEA 4MGKE 3O12A 2ZGSA 5T55A 3VBSB 1UL9A 4RHV1 3ZYIB 2CAUA 4IEVA 4FAGA 1C8NA 4OHYA 2QDNA 4DY3A 1Z7S3 2VZQA 4BXFA 3J8F3 1S4CA 1GANA 3AYAA 1N1YA 3AVRA 4PJYA 4YM1A 4HKLA 4CEWB 4TZDA 2W08A 4MLOA 2ZAHA 4LOSA 1JZ7A 3VKMA 5FZKA 5FY9A 4ARYA 5ISLA 3FX3A 4BA6A 4EN6B 1G9BA 4QDRA 2W5FA 1M4WA 2CY6A 2D40A 3KT4A 1DDLA 4YW1A 4EV0A 4OI0A 4Q26A 5LA0A 2IVJA 5FXWA 2JDKA 4Z07A 3RZLA 4NE9A 4XF4A 4COVA 2LM3A 1FV2A 2C26A 2AACA 3KT1A 3H50A 3UJOA 1OD3A 5E1RA 5FQ0A 4F83A 5B4XA 2DUQA 1J1TA 2BWCA 4D94A 4YW6A 2WZR1 2XKPA 4WV8A 4N53A 1APNA 2TNFA 2WZPP 4RL7A 1ZZ6A 1W04A 1QNYA 4ZS3A 3LOIA 1VBE1 3HNYM 4X6QB 4EN7B 1UO9A 4IDZA 1LHUA 2I2SA 4UF0A 5BNPB 5DG2A 3AXDA 1DYPA 4XIKA 3G6JB 3ON7A 2XJPA 2JG8C 1KFXL 2YZ4A 2BGOA 4XJ9A 4HKOA 5BNOB 4DUXA 4LIVA 2W3JA 1JZ3A 2WN2A 4XJZA 1UYYA 2B45X 5JMOA 2IC1A 5IFTA 5AC91 3TRSB 5L9VA 3LKJA 3VHPA 1B35B 4M3CE 1LEDA 1MEC3 3B7MA 2ARCA 3AKQA 5GZGA 3ZPYA 1JOBA 2CGOA 1LOFC 2XJRA 1JOJA 1LOEA 1CR7A 4QX1A 5JDBA 5KWRA 3T3YA 2X53S 3O5SA 1QHDA 1PGW2 5FYVA 1SFNA 4FPOB 3MW4A 2ETEA 3NJXA 2EIBA 2LRPA 1AR93 2V5DA 3RMXA 5HCHA 2GN7A 2QQUA 3CLPA 4P08A 5F5QA 2RR12 2E31A 4IEZA 3EJKA 3ACLA 1MQTA 5FZBA 4LBQD 2D93A 4EE2A 2QBXA 4CP0A 1OMIA 3O1RA 5I0DA 3MFCA 2J1SA 3LIHA 3MLKA 1DHKB 1SBFA 1X8EA 2BEOA 4XQ4A 3AMNA 1RUC2 2D6OX 3HVDA 1ZVFA 2J1VA 1NCRC 2WZEA 2ZS6B 2BFUL 3B9IA 4G3YC 4LLOA 1NZIA 3H8UA 5FPLA 2VUDA 2G9GA 1HQNA 1AR61 3POSA 1AR81 4A7YA 1JYTA 4XF9A 3V65A 3VLBB 1CX1A 3VDCA 1L3JA 3WDYA 3RJRA 4K8FA 2ZGQA 4N90A 4FQ4A 5FYYA 1ZRFA 5C5UA 1IS4A 1AR83 1SFYA 1SCSA 2D44A 1ASJ1 3DPRA 3IDCB 3ZSJA 3L2HA 4CYDA 1ZRIA 1CAVB 1WLTA 2DU1A 3ORJA 4QX5A 3UGFA 1OPMA 2GAUA 1JUHA 1XNKA 4PI0A 3WNNA 3NQHA 1PK6C 1TME2 4X8NA 1BEV1 1Z7S2 2QQPA 4FPGA 3H3LA 1K5JA 3IMNA 3PLQA 1QJX2 1CAXA 3BVCA 3K51A 4Y22B 1CD3G 5IVFA 4DRVA 4PI2A 1CAWA 1Y4WA 4PQQA 1AR62 4JKLA 1C1LA 1DZRA 1WW6A 3N7LA 4MX3A 5J98B 4CU9A 2WNOA 2OPKA 4P9GA 2VCBA 4YWAA 3NJVA 1S0GA 2Q8CA 2JDMA 1OOPC 3ZR6A 2WQ4A 2QZ2A 1SLIA 2C24A 1CGPA 4IV3B 2VW1A 3JD72 5FRAA 4Y1ZA 2WO1A 5BY5A 4WM8A 2W2IA 1PNGA 2QQVA 4GWMA 3SH3A 2ORZA 2R49A 4YG0A 5L7OC 5LRSA 1IPKA 1CWPA 4IEYA 2G1MA 4XF0A 4QB6A 3K3NA 4EJRA 1JXNA 1OT5A 1GNZA 2ZGOA 2KM2A 4YRDA 5F8PA 3U4SA 2O14A 2AUYA 4TN7A 2LW8A 2ZMNA 1W39A 5KHKA 4EWAA 4E4DX 2FCVA 1NY72 4GWNA 2ZGKA 2WQ8A 5LK7B 2YFZA 2ZCWA 4M00A 3UKNA 4WVZA 1V6JA 1MQTB 3MIDA 1LTEA 2VNRA 2YPJA 2OT7A 3PUIA 4AAPA 5IHRA 2AR6A 2HJIA 5A1LA 2W39A 2KA3A 5L7OA 1H2LA 1NA1A 1DQ5A 4N53C 1YQ6A 1G9FA 1LGBA 1V70A 3JXSA 4R9AA 1UYZA 2R30A 5K9YA 3WDWA 1MS9A 3S30A 4CDWB 1FV3A 1TQ5A 1U5YA 2IXIA 1RMU1 3LFIA 3TWIA 4YGEA 2RR13 2ZGTA 2HH9A 3GBFA 1PVC1 1UY0A 4LIUA 2YGMA 4DXTA 4QX3A 1LHNA 1ZRCA 4AWDA 4CDWC 1LB2A 2ZXQA 2WN3A 1UY2A 4FPCA 4GAZA 4DUVA 4XMIA 4ES9A 4AYUA 2VMFA 1HRI3 3H42B 4RHV3 1HLCA 2QTWB 1N1SA 1XOYA 1QDCA 1WW7A 2BWAA 4GKYA 5IVBA 3O0XA 4DEVA 2YBPA 4QQOA 2Q4SA 4MHUA 1COV2 1JOPA 3RYPA 5CISA 4LQRA 5EXOA 5FO7B 4LKSA 3UL2A 3IPVA 3VHRA 2P1BA 4Z8BA 5IK8A 2YGLA 4G9SB 4N9HA 2RHPA 1KJLA 3M3IA 5I0RA 2GC1A 3N7MA 4B4QA 4PHZA 1RUI1 1W2UA 2L9LA 3CNAA 4IW3A 2E6VA 3VBOA 3PMEA 3AJZA 3O1UA 4N43B 2BQPA 2MNGA 1NOVA 1AR82 1H2MA 4AI9A 3INAA 4LXLA 2Z69A 2DFCA 3AKSA 3B9CA 4Q0SA 3N7KA 4QHZA 4NHKA 3VZNA 3MYXA 1EAH2 4NPMA 2ARXA 2OQ6A 3GHNA 4QU1A 3WCSA 1XXNA 1YO8A 3H8OA 5FYTA 4YPJA 1MQTC 5TSWA 1AF9A 4MYEA 1UY1A 3SKJE 1OH4A 4IV3C 4K1ZA 3I8TA 2ERFA 4F8AA 3OPWA 3AJYA 1CZTA 4AQTA 3RG0A 4NWWA 2EXKA 2R1BA 2WBKA 3OGRA 3HT1A 2CHHA 2XL7A 4I09A 2XBO2 3LEMA 5E88A 3WP4A 4P5YA 1CVNA 4LO8A 5FY4A 3L2YA 3N4MA 5EIYB 1W6QA 4CTEA 2HWF2 3RJ2X 2W68A 3AMPA 1IQAA 3LSDA 1AX1A 5DN2A 1W6PB 2UYAA 3EQEA 5FUPA 1W8FA 4EN9B 5JAXA 3KT7A 1X36A 4QGLA 2QJVA 2WNVA 3AKTA 4Q0QA 1NAEA 2WT1A 4QAWA 4BIFA 2XJTA 2PMWB 3FLRA 4FPFA 3WXPA 4AEDB 5H9RA 4LITA 2A75A 4LULA 3I7DA 1RUJ2 1HXS3 2V5YA 4W6XA 4ZZ8A 1ZZ7A 1JZ2A 2BTVC 2JG9A 1GZWB 1GP5A 1CZVA 1UU6A 1GU3A 2J1AA 2J42A 3V0BA 1CJPA 1UF2C 3VBOC 4QX0A 2E53A 3DYMA 4Y1UA 4M4PA 4EN8B 5HI0A 4JV4A 5A3OA 1C5HA 5FPXA 1IKQA 3WNKA 2XR4A 1OLMA 3QH7A 1RUH2 2PQSA 4LK6A 3W20A 2RJ2A 3WDUA 4NROA 2WUHA 3MF9A 1KDMA 2B39A 2EXJA 5K8SA 5DDJ3 2W1WA 1TG7A 1BLZA 2OUHA 2R041 3GYDA 2YC2A 3J7LA 4P14A 4GWJA 4LHNA 4B29A 1G7YA 1PZ8A 1JZ8A 3O1SA 3MW3A 3DL3A 3NAPC 5BNNC 2FDIA 3AP7A 1SACA 1U5IA 2PYTA 5T5JA 2MHFA 3PVEA 4R9CA 1PM7A 3TN92 5JIUA 5L7OB 4PLOA 1KS4A 1T2XA 1UYXA 4P5HA 4GD4A 1D2QA 1AR73 2QNKA 3Q9OA 1RUG2 1RUH1 3URFA 1ZBA2 2VMIA 3WP6A 5EJZB 2D6PA 1ULEA 2FD8A 4XW3A 2O1QA 3MIHA 1ENQA 1VMHA 4AR2A 2QQOA 4NIDA 1G6NA 2K2SA 4OZOA 2C4XA 3KCXA 5F39A 4QQHA 2PHTA 1TVGA 2GNDA 1VP6A 3BODA 4FPLA 4FPYA 4E2QA 4O61A 4QPIC 2HWD2 1JU3A 1NCQC 4QXHA 3SCGA 2G9ZA 1AYN3 3WQBA 3NJZA 3OF1A 4XQDA 4BH9A 3ST7A 1QJZA 1KEXA 4JGZA 3I3BA 2XMLA 1V0AA 1S2EA 4XBQA 1QOOA 4CCEA 2WIIB 4PQ9A 2HWF1 3RPQA 1BYHA 2UY8A 4QQ2A 2RM22 4KWLA 5CKNA 3JU9A 3VBUA 4Z92B 5E16A 3OB8A 3GGLA 1ND3A 2MEV3 1B35C 1KRIA 1OPOA 3V0AB 3D3AA 3WQ0A 4DMIA 2ADDA 2DU0A 2WO3A 2ZX0A 3X29B 5D21A 4B3NA 1W8OA 5FK7A 2XL9A 5BNOC 3ES4A 1GP6A 1L7LA 1OLRA 4J25A 4ORFA 3LDRA 1UQXA 4PDWB 2BJSA 2PFWA 1YJKA 3ZFFB 2EAAA 1BVP1 3THPA 4A6SA 1PIV3 1B09A 1ENRA 4UFJA 1DQ0A 2ZX1A 5FZEA 1R082 1WD3A 2VOKA 3U10A 3K2OA 4Q4X1 1OOPA 4MUVA 2G4IA 1BEV3 2YXSA 3VBUC 5CFDA 1O4ZA 1UY4A 4LT5A 5EPAA 2XVLA 1PNFA 3U78A 3OGGA 3ZXKA 1CQ9A 3VZOA 1RUD2 1BBT3 1NCRB 2PHFA 4OMCA 3KMHA 3BYWA 3WNMA 4AOCA 4BM8A 3W21A 4K7JA 3R4SA 5LZ6A 1BHGA 3M2MA 2ADEA 3B94A 4HG6B 1YJLA 3J7NA 1Q8VA 1QJX3 4K1YA 3GF6A 1NCQA 2EVXA 1TMF1 2QQNA 4FOYA 2ZAAA 1AR63 2AEYA 4NO4A 3I3DA 3OBRA 3VDAA 2W1SA 2VBPA 3R4DB 1D4M2 1MZ6A 2VOTA 1DLLA 1YHFA 2ZACA 4FCAA 2HWB2 5GLZA 4QB2A 4EN0A 5CVRA 4NIIA 2W46A 3ZKUA 4CDUB 2IXHA 4JZRA 5ABJC 5C8CB 1OH3A 3VKFC 3AKPA 1UU4A 3I3EA 1F35A 3H3ZA 4I0WB 5K0UB 1JHJA 4MG2A 1WUVA 3OUJA 4AGGA 4BE3A 4KGGA 1BK1A 4IESA 3VUOA 2QFEA 4ZHNA 1UZWA 1NUKA 2Y0OA 4AVTA 1QNWA 2WC2A 5FP8A 3D4KA 1O5LA 1PHMA 1V6NA 4KNCA 1ZREA 1HXS2 3E1F1 1XYPA 3H9AA 2Y38A 4XFAA 1O4TA 2WO2A 5GJ6A 3WUDA 5C3PA 3RWKX 3U4XA 1PO13 1AR72 4NIAA 2R7EB 5JCTA 2A3XA 3VZLA 1H6XA 5JZGC 3IIIA 3LPFA 4JGZB 4RN5A 1ND2B 1UPSA 2DVFA 2R32A 4W4ZA 2P5BA 2V4AA 1MEC1 2WFF2 5BV6A 2OXBA 4OI4A 5A6QA 1JU4A 2C9AA 4QM8A 5HCFA 2HWF3 5ERLA 1FMD2 3DUIA 1FOD2 1RUF1 1F9KA 1I5PA 5EQUA 5A3PA 4QGMA 3RGBA 5FZLA 3HPNA 5I0UA 3V0BB 1SFPA 3J4UH 4HFSA 4JKKA 4AI1A 4S2HA 1UMZA 4CXXA 2LROA 3ZSEA 1S2KA 3QBQA 1VBE3 2PA7A 3AKRA 3BGAA 3MHZA 5A1FA 2VOWA 3UYJA 4UFHA 1MS8A 2YG0A 4A42A 3HBZA 3K4DA 4LE3A 4INDA 1ULOA 1XB9A 2V4VA 4UF0B 5BNPA 5FLHA 5FO8B 3WZ1A 4BJ0A 1VBB2 2RS11 4A4AA 1YCIA 1E5IA 1E57A 4CUGA 4C91A 1BBT1 2YBSA 2RS33 1R1A3 2HEWF 1F2NA 3KV5A 1BMV2 1RITA 1AHSA 1GZCA 4WZFA 3ZFGB 2VCMA 3D8CA 3THTA 1ULPA 4H2AA 3V64A 1AXKA 5A3TA 1IZ3A 1RJ7A 2WT0A 3AL6A 2XVGA 1YWKA 3LDBA 3HIFA 3ZVXA 1JW6A 1Z78A 4XXAA 4Q4W2 5C8CC 1JS9A 2EICA 2Z5WA 1WCSA 2A1XA 1ZZ8A 5CB7A 4RD7A 3T1MA 2VMCA 3ASIA 4CDQB 2PQQA 1SPPB 3I3MA 3CJIA 1GICA 4U2AA 2RG4A 5FAXA 4OULA 1Z7S1 2WNUC 1MZEA 3RSJA 1UZ0A 4Y1XA 5EYYA 1J3QA 5L73A 1HB4A 3KZ4C 2R0HA 1RXGA 1WW5A 2JDPA 2JICA 1ULCA 4UBHA 2GN3A 2HKXA 4CCLA 4XYXA 2YU2A 2GNTA 1FATA 1LULA 4YW7A 3RI9A 4L11A 3AM2A 3K48A 1DP0A 4EZHA 4IEWA 5DAPA 1W0NA 2ZEXA 1J1LA 2GH2A 4DEQA 1F5JA 1D4M1 3I2IA 2VW0A 4ASKA 1UOFA 2FBEA 1TMF2 2VTXA 4JX0A 4NPRA 1IHMA 4AQSA 3WF3A 2GMEA 3AMHA 4E4HA 3WDVA 1PIV2 4NRMA 4FFGA 3VD7A 3U11A 1PZ7A 3TEWA 3HOBA 5JXHA 3EB7A 1TEIA 1JUIA 2VZUA 1HRV3 3I2KA 4LTAA 3VDDB 1LOGA 4LBOA 3NW4A 4NJ4A 2JG8B 1BCXA 2HWB3 3DECA 1SLTA 3NSTA 1KXGA 3FMGA 4LPLA 2HWC2 2DUPA 2WNUA 4CUBA 5CEHA 2WNVC 1HN0A 1R64A 4KQ7A 5CADA 1RUE3 2JDAA 1QJU2 2IUWA 2C9KA 3BUCA 4CCOA 3ZDVA 4A3ZA 4HSJA 1PO12 3AP9A 4HOOA 4O9EA 4Y5Z0 4Z2WA 4XXPA 1VB4A 2XLFA 4ZXEA 1PIV1 5LB6A 4HONA 3TNQA 4CDUC 2RS52 5FTTC 1TZOA 2E32A 4FO9A 5CG8A 5BXXA 2BGPA 1UOGA 4LO6B 2QKDA 3VV1A 1JHNA 2VZOA 1OA2A 1ZRRA 4Q4Y1 2OX0A 2VPVA 3DEMA 2WA4A 2ILMA 1PK6B 4JAAA 5AC93 4LUKA 1QOSA 1AJKA 2WQZC 3MW2A 3ZXAC 2VMEA 2EXHA 1XYOA 2R063 5LBFA 3E6DA 2VTFA 4PIXA 2UWBA 1GSLA 4ZXKA 1OHFA 1UXXX 2ZX4A 2Y0IA 5FPUA 5JPMB 1ZZCA 1CIWA 3PIGA 5FLIA 2A70A 5LRRA 2ZEWA 4L0PA 5C5TA 1JYCA 3PU3A 3GALA 1OVPA 5B2GB 1HV0A 3WF0A 1VBC3 3NRUA 1LHWA 3AYEA 4JTOA 4YVWB 4XZPA 5A6XA 1EY2A 3VGIA 5A3NA 3A22A 4XCAA 2JD9A 5LK5A 1OI6A 1GFF2 5FPBA 1JYNA 3P3PA 4LHSA 5D8AA 1ZA4A 3POWA 4GIQA 1VRH1 5A7OA 2NP0A 4LBLA 1X50A 5HCBA 2BV4A 2D3PA 1FOD1 1RUF2 4N7IA 4WM8B 4AEMA 1JBCA 2Y6GA 4HLTA 2XHNA 2CNAA 3IAPA 1SHWB 2P17A 1F31A 4Q0PA 4BHPA 5C3SA 4AI0A 2WLQA 5JZGB 4BQ3A 2RJKA 4XURA 2VH9A 4JGYB 1W8UA 3RDIA 4CDWA 4NAOA 3WG4A 1GLHA 2R073 3JBG3 5GLWA 5J1XA 2W92A 3OD4A 2F17A 3BTAA 1N3QA 4C1XA 1O5UA 2HWD3 3Q8AA 5IFPA 4W8JA 1QQP3 1OKOA 1VBB3 2VMGA 1PO21 2P37A 3CEWA 4X8PA 4E2SA 1C3HA 1UY3A 1ZBA3 3T0BA 1S0IA 2NYYA 1RMU2 3E5QA 4YVSA 1GOFA 2FDKA 2R0FA 3WDTA 3S5QA 2VECA 2ZMKA 3Q8BA 2BRTA 1IG0A 3DGTA 1HV1A 5FXZA 1HJGA 1C8M2 2EIDA 2SLIA 5A3MA 5FBJA 4D6RA 2WWSA 5A33A 3KF5A 4QKBA 3ZLIA 1MS3A 4DO0A 1SLCA 2Y6KA 3ZSLA 3KSCA 4ZS2A 2KXLA 4YFZA 4ZY9A 5IVCA 3D6EA 3USUB 1HW5A 4K3UA 2RE9A 1GNYA 1ZNPA 4CVUA 3U75A 5GKAC 4GKXA 4IV1A 4V2WA 3JB8A 1FMD1 5A7SA 2RS32 5T5PA 1YYNA 2P6CA 1RUD1 4MGIE 3TBDA 3NNLA 4PBOA 3ZXEA 5F3CA 3ZPOA 4M3CA 4YW3A 2DCYA 3E97A 1KDKA 2HWC1 2CYFA 2OS2A 1D2SA 2TBVA 1G9CA 1EAH3 3Q8FA 3POBA 2K46A 4RQPB 4YZ4A 1ENXA 4YGBA 3FUQA 4XFFA 5LY1A 1RHI3 5LASA 3H8XA 5KHHA 1WBLA 2FQPA 3PJYA 1GOGA 2WWJA 4K20A 3EXUA 1IG3A 1WD4A 4HN0A 1PX4A 3WV6A 2JDHA 5IK7A 2SBAA 1C57A 4CCKA 3WF4A 1E5SA 4QPGB 3DCQA 4Z1VA 4AVCA 1R091 2XJUA 3D0SA 2RS13 4KWJA 3THCA 2OVUA 5FZOB 1O3SA 5DXDA 2PAEA 1QJU3 1NQDA 1STMA 4MHRA 3IM0A 5H9QA 4XUQA 2J22A 2CSGA 1XSQA 4K40A 5A7PA 1GMMA 1VBC2 3ZFEC 4UYBA 1IPSA 3KB5A 2FDFA 3DPRC 3JD71 1EUUA 4HETA 2JG9B 1ST8A 4FPHA 4ITCA 2DCJA 4F7ZA 2A6VA 2WS92 1D4M3 3C3VA 1PO22 3QACA 1IS6A 1O8PA 2IXJA 3I2JA 1XSRA 5DG1A 5I0SA 3WINE 1RUF3 3SITA 2IVIB 1AVBA 1CN1A 4AI3A 2WR9A 3HN1A 5JPNB 3O1TA 1YI7A 3ZYGA 3OYWA 5GALA 3W59A 2WSVA 4N9IA 2WFF3 3GM8A 3IKWA 4A45A 3WW3A 4QX7A 4WVVA 5DAQA 4L8QA 4Y5TA 1DLCA 4FTBA 2WT2A 3A0KA 3IDEA 4HVOA 1PVC2 2I07B 3M4FA 1XU2A 4AEDA 4AFBA 4G4FA 1NXD1 1WCQA 2PELA 4FFIA 4IEOA 3MICA 1SZBA 3LSEA 1PK6A 4YFWA 4MO3M 5FPAA 5GZFA 4NWVA 3ZXLA 1WA4A 1JYXA 2WRAA 1HB2A 2AGSA 5F9TA 2NMNA 4IXLA 4AVBA 3HAGA 4R4ZA 1RUNA 3KM5A 5CG9A 2XJVA 5JI9A 5CKQA 4B4PA 3KV9A 5C9AB 4TLFA 2A6WA 3HD8B 1DGWX 3LDKA 4QPWA 5FY7A 2EAKA 5CYYA 2O0OA 3VHOA 3LGRA 3UKVA 2Q8DA 3NV3A 2X5IC 3GHMA 4AF9A 1WMXA 1ZRDA 1AYM3 5ANQA 3OGJA 3RZJA 1ASJ3 4JCKA 4MZUA 3KCYA 4UFKA 5GLUA 3AMMA 4IEXA 4E27A 5FYZA 3PVOA 2W52A 4E4ZA 3IDAA 3J7MA 4JQRA 1JODA 4CP2A 4IUGA 5FV3A 1CPMA 4N53B 5EV7A 4ASMB 1JZ4A 2RMU3 1URXA 2WNUB 2KR2A 3RVHA 3RYRA 2XONA 5J37A 4AEJA 1LHVA 4YW2A 1WBFA 1VJ2A 1I5ZA 4XJUA 1SEFA 2EIGA 3OD0A 4ONUA 1W06A 2QVSB 4RYDA 1R1A2 4AEKA 4DFSA 3JD73 4CSWA 3HNBM 5A7WB 5F5IA 5IJRA 4CDUA 5D8AC 2ZHMA 3IAQA 4BDVB 5M0TA 4TYSA 1WMEA 3RYKA 3H1MA 5CKMA 3VBHB 4W6WA 5CZKA 5F6LB 4LHKA 1B35A 4JQTA 4JC1A 2JDZA 2JENA 1S0CA 3OBZA 2ZMLA 4IGOA 1IS5A 1RHI2 1S2BA 3LIGA 4YW4A 1WMDA 4FPEA 4OHWA 5JOWA 2GC0A 4CCJA 2J1RA 4EWDA 3B5LB 5T52A 4AQ6A 2DCTA 4GH4A 2H6CA 3ZFFA 4R4XA 4GALA 3POYA 4Q1PA 5C9AC 1Y7BA 4HSLA 3CQOA 4DPNA 4XFGA 2YHJA 4DZGA 2NZ9A 2JKXA 3AYCA 3ZIWA 4ISRA 2VGDA 3FN9A 4LORA 4A6OA 3KS7A 1Q8SA 1J3RA 4QPIA 4RS5C 5AVAA 2PN5A 4AFDA 2P3KA 3M1HA 1REFA 4OYUA 1SLLA 3C7EA 1UMHA 2NM1A 5ANNA 4JHTA 2HWC3 2JWPA 4GMP0 4UFLA 4SLIA 4FSJA 4KMQA 3D82A 1W90A 2BBAA 2XWJB 3FE5A 3TNPB 1D7PM 4GWIA 1ENSA 1TMF3 2GZWA 2Y6JA 5FY8A 2WABA 3N9PA 1NCQB 1YXWA 3C7OA 3M3CA 1K5MC 4I2OA 2W1QA 1DQ1A 1UKRA 1XYNA 2X8KA 5E89A 1DQ2A 1QDOA 4W65A 2ID4A 2HYXA 1M06G 1OOPB 4LJHA 4Y4YA 5FZ3A 1VBA2 4GB33 3ZYHA 2D3RA 3ELNA 4Q5OA 3MGUA 4GZ9A 1HQWA 1VBA1 4IE0A 4QX2A 5CFDB 2VBDA 1AL0G 2YUEA 5CAZA 2DF7A 3CDZB 1W9TA 4HANA 1NT0A 1H1IA 1WKYA 2D97A 2PLV2 3WHUA 1X33A 4DINB 4JDOA 4PBPA 4BQ5A 1Y9GA 2DWRA 5HXVA 1YFXA 2JJ6A 3PTYA 3JQXA 5I8TA 1H8VA 2ZGMA 2OZ6A 1RUJ3 1IS3A 3NAPB 4I3PA 2IXLA 5D2AA 5FMBA 5BNNB 5ACA3 4CDXB 3K4AA 3ZDSA 4QPGC 5T54A 3H8RA 1GP4A 1EAH1 1PGL2 1JN2P 4NR1A 3T2TA 5EZWA 5DUUA 5FIXA 3SISA 2VZRA 3CHXA 1V00A 4Q2FA 2R16A 1WMFA 4QT6A 5C6CA 3UK9A 5A3UA 4W6YA 3MIGA 1H6YA 4CCMA 1JH5A 1FMD3 3PL0A 5FKBA 4NHLA 2G19A 3BPSA 4GQ7A 3J9SA 5FREA 5A70A 1OKQA 4LNVA 3T4HB 3AFKA 1AXYA 1RC6A 3CJIC 1NY71 3FL7A 5DZFA 2FDHA 2RMU2 3R05A 4BPZA 3SLIA 1W6OB 2HEVF 2HWE1 2PHRA 4XMAA 3AP6A 5FP4A 1VBE2 1SLBA 2QQMA 2E7AA 3N9NA 3MV01 3DYPA 3DV8A 2GMPA 4M3CB 2QDRA 4LLFA 4P9YA 1S0DA 2CDOA 4GJZA 3NNGA 3ZM8A 5C4WA 3NL1A 3VBRC 2WZR2 2R072 1QJY3 2Y64A 4MXWB 1BJQA 4YM3A 3ACGA 4AI8A 2WWUA 4BQ1A 1SQ4A 4XTPA 4QWNA 5D1IA 4D3WA 5FPZA 1CZSA 2WA3A 1EUTA 4Y1VA 4LA3A 3VKNA 1Q8QA 2RDNA 4RGGA 1QIQA 3MFAA 4XJ8A 1GNHA 4AHWA 1Q56A 1XNBA 5E8AA 3WF2A 2XPJA 1LAJA 1YQ2A 1O3TA 1CAXB 2ZX3A 3GNEA 3VZKA 1DGRN 1FPN2 3FHAA 4ZU5A 2HWE2 4V2VA 3WLUA 5JXIA 1UYPA 1DZQA 2GMMA 1JYWA 3N9LA 1MZ5A 4DS0A 3TYJA 4COWA 5FXXA 1A6CA 1AZDA 1QQP2 1UCXA 3GZTB 3ZYBA 4DUWA 2RDRA 4WBBA 4FOWA 3E5XA 4BISA 1YI9A 1UN1A 5FZ0A 3I2FA 3VB9A 2YV8A 3GCXA 4AGVA 1QXRA 2W1UA 3CJXA 3KGZA 1FNZA 1BKZA 4PT6A 3ZFEA 1GZWA 1VMJA 4Z82A 4ATEA 1NE6A 3NV1A 4MGZE 3QCWA 4BK5A 4LKEA 1LCLA 3LQCA 2ZHLA 1RUE1 1ASJ2 4NRQA 5FYBA 1UAIA 4JGYA 2OW4A 4C1WA 4LBKA 5A32B 1JZ6A 1C4RA 3JQWA 5FDBA 1GQPA 1YUDA 2VOVA 4KWUA 4R52A 4HVQA 5BPXA 5FLJA 1UOBA 1W8TA 2VMDA 3N9QA 1ZYBA 5FQ0B 4XC9A 1QY4A 3BCWA 2JD4A 4M3CF 3VBHC 3K46A 1HRI1 5DUXA 2JDNA 2Y26A 3SCHA 1SBEA 3I59A 3UNPA 4JKMA 3SH5A 4I30A 4WM7C 1DCSA 2JEMA 2EA7A 4CDQC 1RUE2 2I45A 1QXJA 1I9RA 4YGCA 2GNBA 3UKTA 1J58A 1O6UA 5EP9A 2Y8KA 2RS12 1UOJA 4A3XA 5DQ0A 3KV4A 2ZGNA 2QCSB 4BQ2A 3D5OA 1AYN2 1ND3C 2YDEA 3OJBA 1N3PA 4ASLA 5C3RA 3UGHA 4XETA 2VCCA 1W2TA 3WP5A 3NKTA 1Y9MA 1RVF3 4NHXA 1GZTA 4R8HA 3C8XA 2JG8A 4HKWA 3PNAA 4BIOA 1JTZX 3MV11 4AAXA 3DXTA 4GMP3 1UKGA 4W50A 4E9KA 1FT9A 3O1MA 1K5MB 4AK3A 3RI8A 1CAVA 3AP4A 2J7MA 4UBGA 2NPIA 1OQDA 3ALQA 4XE9A 5F3GA 3WG3A 4QPIB 5IK5A 1W6NA 4WM7A 2Q8OA 5A6ZA 2HBTA 2WFPA 1DF0A 4Y5SA 4OUSA 4TLGA 4GB31 3USSA 2LUWA 1SMVA 2DVBA 3FJSA 4CCNA 2WS93 2VU9A 2F4LA 4ZKTB 1XNCA 2FCTA 2FMYA 1EV11 1YIFA 4OUMA 4WVWA 3HEIA 3POFA 2AH2A 1WCDJ 4BB3A 4IV1C 2VQUA 4YNIA 4S2DA 1LGCA 1Y3TA 5DAWA 4AVSA 3WCRA 1YC61 1H8TB 4P9JA 4HXCA 4XDQA 5AC92 4OVEA 4H7MA 5C4WB 2PLV3 3S6PA 3KD4A 2PHWA 1AL23 4XAEA 4LKFA 4N43C 2VQ0A 3BIWE 1NKGA 3ACIA 4RFRB 3KWVA 5FXVA 1FPN3 4OHVA 4JHZA 4QB1A 4KBBA 4Q27A 1ONAA 2PHLA 3R6SA 3GZEA 3KGLA 5KHJA 5JSOA 1N47A 1RJ8A 1LJ7A 2PXJA 1VR3A 2QQKA 2YB7A 2VUCA 1NX9A 3C7GA 3P6BA 1X82A 5F37A 1SDWA 5FYIA 3OYWB 2YMZA 5AFBA 1W2OA 1ND3B 1W9FA 4M01A 4XAAA 1LU1A 3W5NA 1CAUB 1ZA7A 2XBO1 2ET1A 1H2KA 1C8M3 2RVAA 1X9TA 3BU0A 3IIAA 2VZ3A 4NHMA 1EV13 5FKCA 3RNSA 2XOMA 4IERA 1UPIA 1UMIA 4D7YA 4BMBA 5EYXA 1W8HA 3FBYA 4XFCA 4YZ5A 1CIYA 3OUIA 3FBMA 1YQ8A 4J6GA 3T2QA 4DQAA 1NE4A 4CE8A 2YYOA 3IT8A 1RB8G 4CCCA 1NLSA 3VD5A 4HPKA 1NA1B 2VNOA 3WDXA 4NIGA 1RGSA 3UGGA 1ULGA 1DYKA
chains in the Genus database with same CATH topology
1REDA 2VQAA 4LO7A 2D5FA 4SBVA 4CEYB 5C4WC 2BBVA 3WQ1A 3ZXDA 4GMP1 2X29A 3S7EA 3TOJA 2GDFA 1XRUA 4CDXA 1LECA 2Q5TA 2RM21 5J09A 3LOBA 2TUNA 1ND2A 1R093 2AZ5A 1HDKA 5FOJB 5C33A 2I74A 1GKBA 4YLZA 1N1VA 2ET7A 3I59B 3WG2A 3ZN4A 4PIYA 4BYYA 2XG3A 2WJSA 1RVF2 1AUYA 4Q4X3 1KJRA 1U5ZA 2BW8A 2VW2A 4NN0A 4Q4W1 1MR5A 2RJLA 4AFCA 1EPWA 2GU9A 1REEA 5EWSA 2OYZA 2PLV1 1WGPA 5K0UC 2ZABA 3FLPA 5AVPA 3ZMOA 2PAMA 1RUG1 2ZBJA 4XHXA 1FX5A 4RQPA 1S1AA 2WFF1 5GLTA 3ZFEB 2BVBA 1HIXA 2D98A 1LKNA 1GV9A 1A8DA 1H30A 1DQ6A 3B00A 2FZ1A 2DCKA 2VULA 1H0BA 1I3HA 1LR5A 4ISQA 5A32A 2XVKA 3AFGA 1JYIA 2H0BA 4MXVA 4QGNA 5LEKA 4YZ1A 3H1YA 4AHXA 4CEYC 4QPYA 3V0AA 3AZYA 1ULDA 4RS5B 1NA1C 2WLPA 3VBFA 4AE2A 1H8TA 1QQP1 3MLJA 1V9U3 2LALA 4RR3C 1LENA 2A71A 3LWCA 4DY5A 1C28A 4FAHA 3TAYA 1J3PA 1FPN1 3N3HA 4HK8A 2JXAA 3WUCA 4BLJA 4FPJA 3ZFFC 1LEMA 3B69A 3B02A 4FTEA 4AFAA 2QUOA 3CJIB 2XJSA 3RZZA 4OI1A 1AYN1 2YC0A 4XILA 1Z0HA 1LODA 2VVEA 4YSFA 5J7MA 4M0NA 3AB0A 4FP2A 3IBMA 1DBNA 1CAUA 5L19A 1W6PA 3ZSMA 5SV5A 4QQLA 2HWE3 4YG3A 3ZYJB 1OLQA 2WZR3 1TME1 1V6IA 4AVVA 1UIKA 3O0VA 2CWSA 3MI8A 3H3UA 1RUH3 2ATFA 2CTVA 3WR0A 4DRRA 4ZU7A 4HPKB 3RS6A 4XF3A 1TNRA 4QMAA 3MDPA 1MS5A 5FOBB 5I0TA 1POV3 3QOPA 2ZTNA 4XJAA 4QD2A 2AYHA 4JGYC 1S0JA 4Q4Y3 3B3QE 4Q4V1 3P3NA 1H2NA 1G8WA 3FUOA 3W58A 2B5HA 2IFRA 4FT8A 3TN93 4HZFA 1OFNA 1FI2A 1DG6A 2XGXA 4IEQA 4LHLA 1QWRA 1A78A 4M0HA 2A5ZA 5GZDA 4AHYA 4NOTA 2D6MA 4XJWA 3DKWA 5K7PA 5JIAA 4ES8A 1RUC1 1G86A 3VBHA 1ZBE3 3MLLA 3VBSA 3ZO0B 2O8QA 2Z2SB 3A0NA 3VBOB 3T1LA 4HN1A 1O3TA 1HXS1 1HRV1 4KU8A 4KGQA 4Q0VA 1HQLA 1QKQA 5JVVA 3S0MA 1QMJA 3WW4A 1RUG3 2PAKA 3M8LA 5CU1A 2ZGLA 1W6MA 3VDDA 4JTNA 3KQRA 4UXAA 5BUVA 3ZN6A 2ENRA 1RUC3 3JCIA 1UU5A 1GQGA 3RQ0A 1KFUL 1XU1A 4I02A 4YW5A 1UW8A 4YM2A 4HVRA 4L2NA 1Q8OA 2Z79A 4AFMA 2V09A 1COV3 2PHXA 3AX4A 3TN91 4XBNA 2DUOA 4D69A 3FZ3A 5T50A 4L97A 3WW1A 2VNGA 4TWTA 2B9UA 4I01A 1TE1B 1BEV2 4X6RB 4LA2A 3AXEA 3O0WA 2DVGA 4AHZA 4OZXA 1RUI3 3HT2A 1UIJA 3BALA 4B8EA 5BNOA 2VOXA 4CEYA 1R1A1 2D3SA 3HMYA 2VMHA 4LBJA 2DURA 4LR4A 1GBGA 3N35A 4PF5A 4L9BA 1W6QB 4HT1T 4MH0E 2ARBA 2BUKA 1V9U2 1S0EA 2XLAA 2XBO3 4RGAA 3IDBB 2JX9A 5CA6A 1S0FA 4MV2A 1AYM1 1GR3A 5CFCC 2BNMA 5D8AB 3J26N 5L36A 5ABJB 4CZSA 1PVC3 4O9GA 3WY6A 5A33B 3B93A 5J48A 4XBLA 3USUA 2RR11 4QQPA 1EPZA 3M7AA 4P9XA 3QD6A 3RMYA 4QPGA 1W6OA 2DFBA 4IETA 5DUWA 5J96B 1V9U1 3LCPA 4QM9A 4XFHA 2UURA 1O91A 3J8F2 4QHBA 4RS5A 2ZA9A 5HBAA 2CGPA 5I91A 4LBNA 3BU7A 1VBD2 2ZGUA 2BPA2 2ZKNA 3AZWA 2A6XA 4Q29A 1AYM2 3U07A 3ECQA 4Q4V3 1FYUA 1PZ9A 2IXCA 2ZZJA 4FTSA 1ZZ9A 2QZ3A 1T6GC 3IN9A 4GH4C 1SCRA 3ES1A 1LHOA 4FBFA 3BPZA 4CDXC 4LO4B 4RQPC 1VAMA 1HX6A 4LBQA 2LTNA 1DGLA 3IPVB 2ZJCA 1PVXA 3FLTA 4AGRA 4H7LA 1MZFA 4YM0A 4XFIA 1MS0A 4IV1B 4EWEA 5KBFA 4IV3A 3SNMA 4FOQA 5JSRA 3VKOA 1YFUA 1EYBA 1R092 3BOPA 5C9AA 1CESA 2TEPA 2VXRA 3O7OA 1IGOA 4BCUA 3O14A 3PJQA 4Q4W3 1SLAA 4DNYA 1LESA 1OD5A 1R1ZA 2RS51 4AW7A 1UZYA 3WNXA 5JWPA 3H7JA 1PGL1 3OBTA 1H9WA 4FQZA 4Q8LA 4Y22A 3A4UA 1QF3A 3FFZA 1D4VB 1AX0A 1YRZA 3MEPA 2EXIA 3JUUA 1WLCA 1OFSA 4PDWA 2FZ2A 4MVTA 3I54A 2IWGB 3B01A 3WW2A 5CFCA 4YZ2A 3LA2A 3ZXFA 3H7YA 4H3WA 1PMIA 2ZOEB 5FCCA 3ZMNA 2WNEA 4L99A 1FXZA 1AR92 4C0HA 5KXDA 5T3NA 3M70A 3PVBB 2XKOA 5FBZA 4EROA 3WG1A 3M3QA 1QH7A 1QJX1 2DVAA 5JI7A 3ZYPA 1BVVA 4XIOA 1C8M1 2JE9A 4YYOA 3RWNA 2E7QA 1BBT2 1BMV1 1RVF1 3WP3A 4URTA 4AG4A 3WHTA 3W9AA 3G7DA 1WLDA 1COV1 2ZKLA 4OFGA 2HWD1 1W6NB 4WM7B 2ZHNA 4XHBA 1F5FA 1GZ9A 1VBD3 2Q0AA 3V56A 3CF6E 2IZWA 2RS53 4R9DA 1QJY2 4A7KA 1U5XA 5JOZA 4HMZA 4YVWC 2BNNA 4OLLA 5H9PA 1FOD3 2C0ZA 1AL22 3SXWA 1VRH3 4GH4B 1QGLA 3L9JT 2OIIA 3OTFA 1EV12 2MEV1 3ZIXA 5DZEA 3NWKA 1W6MB 1VAKA 3EHKA 4RFT0 4UW5A 1VBC1 4I3GA 5CBLA 3JBG2 1S0BA 2OUJA 4R9BA 4XFBA 1IPJA 2P2KA 5SV8A 3M3EA 4I0BA 1OSGA 1CX4A 3R0RA 4L92A 2R062 5BNPC 1DIWA 3ILFA 3NV4A 4COUA 4HK9A 1N1TA 2UYBA 4A7ZA 1RTVA 1V6LA 2UU8A 4XEZA 3FWEA 2R6QA 3RRDA 3OY8A 1X7NA 1VALA 1DU3D 5KXCA 1RUJ1 5FO9B 3NKGA 1H8TC 2E7TA 3JB4C 3N7JA 2PTMA 4Q4Y2 3J8F1 5GLVA 4CEWC 2IFWA 1NLRA 2IXKA 5T5LA 4Q4X2 2A73B 3BB6A 2NMOA 3FFQA 3E6BA 5JZGA 1Y43B 2UWAA 3GZAA 1XE8A 2C1FA 3LB9A 3CO2A 1HRV2 5F1RA 1OQ1A 3D0JA 2DCZA 4MXWA 5DDJ1 4H55A 4N7UA 1EP0A 2NQYA 3VBSC 3NAPA 1DZTA 5BNNA 1H4HA 1WLWA 1CONA 5I8YA 4RR3B 3SH4A 5EJ3A 3JZVA 2WS91 3AZZA 3IWZA 5CFCB 3LAGA 3WQ7A 1V6MA 4Y24A 5K0UA 4BLIA 2WSUA 1LOFA 2A7AA 2BVVA 1H1MA 3LZZA 2VG9A 2NN8A 1H9PA 1GYKA 2E9QA 2YY1A 1O3RA 2XUMA 1RUI2 1LRHA 5KC5A 2HYKA 2G9FA 2K0GA 3ZFGC 1ZBA1 4D7SA 2XWBB 3MF6A 3MIBA 4FPKA 2D43A 2K9ZA 1PO23 3KCCA 2AREA 2V73A 4COYA 1NXMA 1W0OA 2DVDA 5BNQA 5JMCA 4TSVA 1VRH2 4K6BA 4LBMA 5JOYA 4MGYE 4S2GA 4IEPA 4UW3A 1VBA3 3FC0A 2JECA 2R1DA 1O4YA 3R4UA 5DDJ2 4F3JA 1IKPA 4YARA 1Q8PA 1TME3 2WINB 1LOBA 3UV9A 1PGSA 2ZHKA 2DV9A 4RA0A 4P9LA 5GZEA 3VL9A 1AXZA 1U0AA 3APBA 2VVFA 4COZA 5ACA2 4MSVA 3ROUA 3DPRB 4DXZA 1V6KA 4PIZA 1LGNA 3VL8A 1POV0 4Q8KA 1Y9QA 4AI2A 1OA3A 3NV2A 4KH9A 3VBRB 1KITA 4BOWA 5DUVA 4FVVA 3ZXJA 2BGCA 4PCRA 1XQNA 1MACA 1VBD1 3EO6A 5JSPA 2DTYA 2R061 3N36A 4UW4A 1PO11 1H1AA 1CJDA 3VBUB 2A3YA 4NVPA 5ACA1 1NYWA 2GSYA 3GBWA 5H9SA 3WVJA 1AJOA 2D7FA 4KU7A 4OI2A 5A3LA 1RMU3 4LEJA 2UWCA 2YROA 1BXHA 3WD5A 2E63A 2MEV2 1F8VA 1Q5OA 1BZWA 1Q3EA 4PDWC 5EFUA 5C8CA 4IEUA 4IL7A 3QLQA 4OHXA 2BYVE 3FHIB 1MS4A 2HWB1 3QH6A 2CWMA 4IQPA 3KLSA 2RMU1 3E5UA 4FXKB 4J1XA 1WCKA 2XLGA 2OZJA 2ZGRA 3MPBA 4BWOA 1A3KA 3AP5A 1R083 1D0HA 4B7KA 4GA9A 3ZSKA 3ILNA 3C2UA 5T5OA 3AZVA 2GH8A 5FMOL 5BYNA 3VKLA 2ZPXA 2VVDA 1O3QA 2F4PA 4RHV2 3E6CC 1C5IA 3ILRA 5JOXA 3PMSA 1AR91 4RSUA 5AFEA 5FMOS 5J3UA 2Z42A 3VZJA 5DZGA 1Q43A 1G9AA 1H4GA 1VB2A 3NVCA 3WOGA 1RUOA 1KD7A 2ZGPA 3ENRA 1U12A 1RUD3 4LO5B 2RM23 4GULA 2ES3A 4N43A 3ZN6B 1HRI2 1ZM1A 2D6LX 1DQ4A 2B8MA 3NO8A 4D7TA 3OPZA 4LUMA 4KG0A 1RIRA 1UD1A 3ZFGA 4WVMA 4DB5A 2CV6A 3CU7A 2P3JA 4J1WA 1C1FA 1DFQA 3DN7A 1J59A 2RS31 2GC2A 2HEYF 4HBNA 2JKBA 4LBQB 2XH6A 4I0AA 3SHRA 3ETQA 1G9DA 3VN4A 4S2FA 2XB6C 2XHKA 3EBRA 5KC6A 4AQ2A 5LEJA 1QJU1 2VUJA 4Q0UA 4GB32 5CNAA 5KXBA 3PHMA 3S7IA 5GM0A 1V6OA 4V1PA 2H0VA 1ALYA 2D6NA 3PVNA 4CEWA 1LOCA 3OCPA 1AR71 1OA4A 4BZ4A 5F6KA 4Y20A 3JBG1 3HR9A 5J36A 4AEDC 1SBDA 3HQXA 1RHI1 1XE7A 1ULFA 1VLNA 2CL2A 2P34A 2NLRA 4B7EA 1AL21 2F6BA 1S55A 2VY0A 4FP3A 3VHNA 5KHGA 2PHUA 2R043 4XPVA 1YFWA 4KWKA 1WW4A 3H1WA 4YVSB 4ZU4A 4Q1RA 1QXPA 4E4SA 1NQJA 3HWJA 5ABJA 4JVAA 1X8MA 1GQHA 1R081 3H0OA 4CDQA 1I1EA 5JR7B 4CRQA 2WNVB 1AX2A 2DYCA 4FOVA 1NZCA 3MIEA 3M3OA 2CGNA 2D6KA 2X5IB 2MPFA 4PLMA 2CAVA 3I4IA 1UX6A 1QH6A 1KQRA 2GNMA 4Y1YA 3MIFA 2WKKA 2QE3A 1FNYA 4KG8A 3ZYRA 1UZZA 5I93A 5I8SA 1ZBE2 2FHRA 2WL1A 1VBB1 4P9IA 1D0GA 3DF0A 4WM8C 1KS5A 4META 2A6YA 1LU2A 3VDDC 4WZCA 2JE7A 3BOWA 4YVSC 2B42B 1BQPA 3ME2A 1ZZBA 2C5DA 2N7GA 2XJQA 4XOGA 4K9SA 4YG6A 1HKDA 1PGW1 5HCAA 4HL0A 4YVWA 2EF6A 3SMHA 4A2UA 3AK0A 1CPNA 3ATGA 3GZUC 3VZMA 3ZX7A 1MEC2 4JDNA 2AENA 4Y26A 5IUQA 3SCFA 3VBFB 4JDMA 4AVAA 4GXLA 5GZCA 2UY9A 4XQWA 2Q1MA 1VAVA 2PHDA 1TNFA 1DGRA 2Q30A 2VUAA 1ZX5A 4B4RA 4YGDA 3VBRA 2GALA 1YIPA 2P3IA 3I2DA 3LA3A 2OA2A 3WT3A 4UW6A 3CL1A 4JRAA 5IK4A 1IOAA 1QOTA 3GBGA 1QU0A 2D5HA 4C90A 4P9WA 3U0ZA 4C0BA 5FFOC 2A6ZA 4U36A 4DOUA 1NCRA 4PLNA 1VIWB 4QU2A 3ZXGA 4BMEA 3OY8B 1FAYA 5CFDC 2E51A 3AYDA 3ZN5A 4LE4A 2DTWA 4ATFA 1XNDA 2EALA 2W0XA 2B7YA 5KHIA 1ND2C 1RINA 1POV1 1YNAA 2R042 2H6BA 1O7FA 4XF1A 3TB0A 4XTMA 2R071 4H14A 1CAWB 1I6XA 4JRLA 4Y20B 4OHZA 1LOAA 4AXOA 2ZZQA 2Q1ZB 5IT6A 3UJQA 2O8OA 1QJY1 1W0PA 1YFYA 1MS1A 2BFUS 3AMQA 1MVQA 5C8WA 2JG9C 4FXGB 1NG0A 4KL1A 4K21A 3AZXA 2FMDA 1N3OA 1A8MA 3LA7A 4JGZC 4YZ3A 2A3WA 4RR3A 5JLVA 2BNOA 3MZHA 1K5MA 4WVMB 4CP1A 1OQEA 1ZBE1 3MPPG 4QXKA 1YLLA 2X5IA 1MVEA 1DGWA 4Q4V2 2ZX2A 1RL3A 3VBFC 2B46X 2GC3A 5CIRA 5KXEA 4MGKE 3O12A 2ZGSA 5T55A 3VBSB 1UL9A 4RHV1 3ZYIB 2CAUA 4IEVA 4FAGA 1C8NA 4OHYA 2QDNA 4DY3A 1Z7S3 3J8F3 1GANA 3AYAA 1N1YA 4PJYA 4YM1A 4CEWB 4HKLA 4TZDA 2W08A 4MLOA 2ZAHA 3VKMA 3FX3A 4BA6A 4EN6B 1G9BA 1M4WA 2CY6A 2D40A 3KT4A 1DDLA 4YW1A 4EV0A 4OI0A 4Q26A 4Z07A 4XF4A 4COVA 1FV2A 2LM3A 3UJOA 3KT1A 3H50A 5E1RA 5FQ0A 4F83A 2DUQA 1J1TA 2BWCA 4D94A 2WZR1 2XKPA 4WV8A 4N53A 1APNA 2TNFA 2WZPP 4RL7A 1ZZ6A 1QNYA 3LOIA 1VBE1 4X6QB 4EN7B 1LHUA 2I2SA 5BNPB 5DG2A 3AXDA 1DYPA 4XIKA 3G6JB 2XJPA 2JG8C 1KFXL 2YZ4A 4XJ9A 4HKOA 5BNOB 4XJZA 2B45X 2IC1A 5AC91 3TRSB 3LKJA 3VHPA 1B35B 4M3CE 1LEDA 1MEC3 3B7MA 3AKQA 5GZGA 3ZPYA 2CGOA 1LOFC 2XJRA 1JOJA 1LOEA 1CR7A 5JDBA 5KWRA 2X53S 3O5SA 1QHDA 1PGW2 1SFNA 4FPOB 3MW4A 2ETEA 1AR93 3RMXA 3CLPA 2GN7A 5F5QA 2RR12 4IEZA 3EJKA 3ACLA 1MQTA 4LBQD 2D93A 4CP0A 1OMIA 3MFCA 3MLKA 1DHKB 1SBFA 1X8EA 2BEOA 4XQ4A 3AMNA 1RUC2 2D6OX 1ZVFA 1NCRC 2ZS6B 3B9IA 2BFUL 4G3YC 4LLOA 3H8UA 3WX5A 2G9GA 1HQNA 1AR61 3POSA 1AR81 4A7YA 4XF9A 3V65A 3VLBB 1L3JA 3WDYA 3RJRA 4K8FA 2ZGQA 4N90A 4FQ4A 1ZRFA 1IS4A 1AR83 1SFYA 1SCSA 2D44A 1ASJ1 3DPRA 3IDCB 3ZSJA 3L2HA 4CYDA 1CAVB 1WLTA 2DU1A 4QX5A 1OPMA 2GAUA 1JUHA 1XNKA 1PK6C 1TME2 4X8NA 1BEV1 1Z7S2 2QQPA 4FPGA 3IMNA 3PLQA 1QJX2 1CAXA 3K51A 4Y22B 1CD3G 4DRVA 1CAWA 1AR62 1C1LA 1DZRA 1WW6A 3N7LA 4MX3A 5J98B 2OPKA 4P9GA 1S0GA 1OOPC 2WQ4A 2QZ2A 1SLIA 1CGPA 4IV3B 2VW1A 3JD72 5FRAA 4Y1ZA 5BY5A 4WM8A 4GWMA 1PNGA 5L7OC 3SH3A 5LRSA 2R49A 4YG0A 1IPKA 4IEYA 4XF0A 4EJRA 1JXNA 2ZGOA 1GNZA 2KM2A 4YRDA 2AUYA 2ZMNA 1W39A 5KHKA 4EWAA 4E4DX 1NY72 4GWNA 2ZGKA 5LK7B 2ZCWA 4M00A 3UKNA 4WVZA 1V6JA 1MQTB 3MIDA 1LTEA 2VNRA 2YPJA 2AR6A 2HJIA 2W39A 2KA3A 5L7OA 1H2LA 1NA1A 1DQ5A 4N53C 1G9FA 1LGBA 1V70A 4R9AA 2R30A 5K9YA 3WDWA 1MS9A 3S30A 4CDWB 1FV3A 1TQ5A 1U5YA 2IXIA 1RMU1 3TWIA 4YGEA 2RR13 2ZGTA 3GBFA 1PVC1 2YGMA 1ZRCA 1LHNA 4AWDA 4CDWC 1LB2A 4FPCA 4XMIA 4ES9A 4AYUA 1HRI3 4RHV3 1HLCA 1N1SA 2BWAA 1QDCA 1WW7A 4GKYA 3O0XA 4QQOA 2Q4SA 1COV2 3RYPA 5EXOA 5FO7B 3UL2A 3IPVA 3VHRA 5IK8A 4Z8BA 2YGLA 4G9SB 4N9HA 2RHPA 1KJLA 3M3IA 5I0RA 2GC1A 3N7MA 4B4QA 1RUI1 1W2UA 3CNAA 2E6VA 3VBOA 3PMEA 3AJZA 4N43B 2BQPA 2MNGA 1NOVA 1AR82 1H2MA 3INAA 2Z69A 2DFCA 3AKSA 3B9CA 4Q0SA 3N7KA 4NHKA 3VZNA 3MYXA 1EAH2 3WCSA 2ARXA 3GHNA 1XXNA 1YO8A 5TSWA 1MQTC 1AF9A 4MYEA 4IV3C 4K1ZA 3I8TA 2ERFA 4F8AA 3AJYA 4AQTA 3RG0A 4NWWA 2EXKA 2R1BA 3HT1A 2XL7A 4I09A 2XBO2 3WP4A 5E88A 1CVNA 4LO8A 3N4MA 3L2YA 1W6QA 4CTEA 2HWF2 3RJ2X 2W68A 3AMPA 1IQAA 3LSDA 1AX1A 1W6PB 2UYAA 3EQEA 4EN9B 5JAXA 3KT7A 1X36A 4QGLA 2QJVA 2WNVA 3AKTA 4Q0QA 2WT1A 4BIFA 2XJTA 3FLRA 4FPFA 3WXPA 4AEDB 5H9RA 2A75A 4LULA 3I7DA 1RUJ2 1HXS3 2V5YA 4W6XA 1ZZ7A 2BTVC 2JG9A 1GZWB 1UU6A 3V0BA 1CJPA 1UF2C 3VBOC 2E53A 4EN8B 4Y1UA 5HI0A 4JV4A 1C5HA 5FPXA 1IKQA 3QH7A 1RUH2 3WDUA 3MF9A 1KDMA 2B39A 2EXJA 5K8SA 5DDJ3 2OUHA 2R041 3GYDA 4P14A 4LHNA 4B29A 1G7YA 1PZ8A 3MW3A 3DL3A 3NAPC 5BNNC 3AP7A 1SACA 1U5IA 2PYTA 5T5JA 2MHFA 3PVEA 4R9CA 1PM7A 3TN92 5JIUA 5L7OB 4PLOA 1KS4A 4P5HA 1D2QA 1AR73 2QNKA 3Q9OA 1RUG2 1RUH1 3URFA 1ZBA2 2VMIA 3WP6A 2D6PA 1ULEA 4XW3A 2O1QA 3MIHA 1ENQA 1G6NA 2K2SA 3KCXA 4QQHA 2PHTA 2GNDA 4FPLA 1VP6A 3BODA 4FPYA 4E2QA 4QPIC 2HWD2 1NCQC 3SCGA 1AYN3 3NJZA 3OF1A 4XQDA 4BH9A 3ST7A 1QJZA 4JGZA 4XBQA 1QOOA 2WIIB 4PQ9A 2HWF1 3RPQA 1BYHA 2UY8A 4QQ2A 2RM22 4KWLA 3JU9A 3VBUA 4Z92B 5E16A 1ND3A 2MEV3 1B35C 1KRIA 1OPOA 3V0AB 3WQ0A 4DMIA 2ZX0A 2DU0A 3X29B 2XL9A 5BNOC 3ES4A 4ORFA 1OLRA 4PDWB 2PFWA 1YJKA 3ZFFB 2EAAA 1BVP1 3THPA 1PIV3 1B09A 1ENRA 1DQ0A 2ZX1A 1R082 1WD3A 2VOKA 3U10A 4Q4X1 1OOPA 4MUVA 2G4IA 1BEV3 2YXSA 3VBUC 5CFDA 1O4ZA 4LT5A 2XVLA 1PNFA 3OGGA 3ZXKA 1CQ9A 3VZOA 1RUD2 1BBT3 1NCRB 2PHFA 3KMHA 4BM8A 4K7JA 3R4SA 3M2MA 3B94A 1YJLA 1Q8VA 1QJX3 4K1YA 3GF6A 1NCQA 2EVXA 1TMF1 4FOYA 2ZAAA 1AR63 4NO4A 3OBRA 3R4DB 1D4M2 1MZ6A 4FCAA 1DLLA 1YHFA 2ZACA 5GLZA 2HWB2 4EN0A 5CVRA 4CDUB 2IXHA 5ABJC 5C8CB 5K0UB 3VKFC 3AKPA 1UU4A 3H3ZA 4I0WB 1WUVA 4AGGA 4BE3A 4KGGA 1BK1A 4IESA 3VUOA 2QFEA 2Y0OA 4AVTA 1QNWA 2WC2A 3D4KA 1O5LA 1PHMA 1V6NA 4KNCA 1ZREA 1HXS2 3H9AA 1XYPA 2Y38A 4XFAA 1O4TA 3WUDA 3U4XA 1PO13 1AR72 5JCTA 2A3XA 3VZLA 5JZGC 4JGZB 1ND2B 1UPSA 2DVFA 2R32A 2WFF2 1MEC1 5BV6A 4OI4A 2C9AA 4QM8A 5HCFA 2HWF3 1FMD2 3DUIA 1FOD2 1RUF1 1F9KA 4QGMA 5I0UA 3V0BB 3J4UH 4HFSA 4AI1A 4S2HA 1UMZA 3ZSEA 1S2KA 3QBQA 1VBE3 2PA7A 3AKRA 2VOWA 1MS8A 3HBZA 4LE3A 4INDA 5FO8B 5BNPA 5FLHA 3WZ1A 1VBB2 2RS11 1YCIA 1E57A 4C91A 1BBT1 1BMV2 2RS33 1R1A3 2HEWF 1F2NA 1RITA 1AHSA 1GZCA 4WZFA 3ZFGB 3D8CA 3THTA 3V64A 1AXKA 1IZ3A 1RJ7A 2WT0A 2XVGA 1YWKA 3HIFA 3ZVXA 1JW6A 1Z78A 4XXAA 4Q4W2 5C8CC 2Z5WA 1WCSA 1ZZ8A 5CB7A 4RD7A 3T1MA 3ASIA 4CDQB 2PQQA 3CJIA 1GICA 4U2AA 5FAXA 4OULA 1Z7S1 2WNUC 1MZEA 3RSJA 5EYYA 4Y1XA 5L73A 1J3QA 3KZ4C 2R0HA 1WW5A 2JICA 4UBHA 1ULCA 2GN3A 2HKXA 4XYXA 2GNTA 1FATA 1LULA 3RI9A 4L11A 3AM2A 3K48A 4IEWA 1J1LA 2GH2A 1F5JA 1D4M1 2VW0A 2FBEA 1TMF2 4NPRA 1IHMA 4AQSA 2GMEA 3AMHA 3WDVA 1PIV2 3U11A 1PZ7A 1TEIA 1JUIA 4LTAA 1HRV3 3VDDB 1LOGA 4LBOA 3NW4A 2JG8B 1BCXA 2HWB3 3NSTA 1SLTA 1KXGA 3FMGA 2HWC2 2DUPA 2WNUA 2WNVC 4KQ7A 5CADA 1RUE3 1QJU2 4HSJA 1PO12 3AP9A 4O9EA 4Y5Z0 4Z2WA 4XXPA 1VB4A 2XLFA 1PIV1 3TNQA 4CDUC 2RS52 5FTTC 5CG8A 4FO9A 5BXXA 4LO6B 2QKDA 3VV1A 1JHNA 1OA2A 1ZRRA 4Q4Y1 2VPVA