1HIXA

Crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
185
structure length
185
Chain Sequence
ITTNQTGTNNGYYYSFWTDGGGSVSMNLASGGSYGTSWTNCGNFVAGKGWANGARRTVNYSGSFNPSGNAYLTLYGWTANPLVEYYIVDNWGTYRPTGTYKGTVTSDGGTYDVYQTTRVNAPSVEGTKTFNQYWSVRQSKRTGGSITAGNHFDAWARYGMPLGSFNYYMIMATEGYQSSGSSSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title Crystallographic Analysis of Family 11 Endo-[Beta]-1,4-Xylanase Xyl1 from Streptomyces Sp. S38
pubmed doi rcsb
source organism Streptomyces sp. s38
total genus 51
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hixA00
1REEA 1HIXA 2D97A 1F5JA 1BK1A 1UU6A 3VHOA 3LGRA 2BWAA 2F6BA 2VULA 1HV1A 1OA2A 2B46X 5K9YA 4HK9A 4HK8A 4HKLA 4S2GA 4S2DA 1T6GC 1KS4A 3WR0A 1TE1B 3WY6A 1H1AA 3VZKA 2BVVA 1QH6A 1QH7A 2B42B 3WQ1A 3M4FA 4HKWA 2DFCA 2QZ3A 3ZSEA 1UU4A 2DCJA 4XQDA 3HD8B 1UU5A 1NLRA 2DCZA 1W2UA 3VZLA 3MFCA 3VLBB 3EXUA 3VZNA 2C1FA 3B5LB 4H7MA 1OLQA 1H4HA 3VL9A 1XNDA 3WQ0A 2NQYA 1BVVA 1M4WA 2JENA 1OA4A 3WP4A 2VUJA 3AMPA 3AMHA 2JEMA 4IXLA 3WX5A 1YNAA 1XNBA 3VZOA 1XNKA 1XNCA 3WP6A 4HKOA 3VGIA 2DCYA 3VHPA 2JICA 1XYNA 3VZJA 2BWCA 3MF6A 4XPVA 1C5HA 3WP3A 2Z79A 2NLRA 1OA3A 4XQ4A 1REDA 3WP5A 1H4GA 1UKRA 1H0BA 1HV0A 3AMNA 3B7MA 2VGDA 1ENXA 5HXVA 3WQ7A 1XYOA 2VG9A 3VZMA 3MFAA 3LB9A 1IGOA 3VHNA 1XYPA 1AXKA 3AKPA 5K7PA 4XQWA 1OLRA 3RI8A 3VL8A 1C5IA 3O7OA 1REFA 1H8VA 2D98A 2QZ2A 2DCKA 2DFBA 1KS5A 3WXPA 3AKTA 4S2HA 2BW8A 3AKRA 2B45X 5EJ3A 3WT3A 1BCXA 4S2FA 1PVXA 3AKSA 4NPRA 3AMQA 1XXNA 3AMMA 3AKQA 3MF9A 3RI9A
chains in the Genus database with same CATH superfamily
1DYKA 1R64A 1OPOA 2D6KA 4YZ1A 2JG9C 1BK1A 1XSQA 3Q9OA 1H8TC 4R8HA 2WBKA 2RS52 4L99A 3VD9A 2TNFA 4CP2A 1Y4WA 3ZXAC 1ZBA2 3TB0A 4YZ5A 3IPVA 2WL1A 3T4VA 3GJBA 3AZVA 1OA2A 3M3QA 4GXLA 4RL7A 4WVWA 1O3RA 2Y38A 3J7MA 1LB2A 2WINB 4HKLA 3CHXA 4BIOA 4S2DA 4W65A 2Y6JA 5C33A 1UYYA 4HLTA 4WVMA 3HQXA 2W91A 2N7GA 3P3NA 2C24A 1W0NA 1JN2P 5DDJ3 1CJPA 2K46A 4MUVA 5FZ1A 1BQPA 4BK5A 5IAXA 3D82A 3KGZA 3D3AA 2FDHA 1ODMA 1IKQA 2JX9A 1H6XA 4N53B 1S0FA 3WQBA 1UU4A 3RJRA 3O1MA 4OFGA 3J7NA 4UW4A 4PF5A 2ZX3A 1VR3A 2JECA 1PVC3 3LFMA 2BDRA 3AVSA 5FZDA 4CPBD 5J36A 1RGSA 3V56A 5EV7A 1DIWA 4AEMA 4O61A 1XU2A 3DUIA 1S0BA 2VW0A 4YVWC 2JG8A 4BDVB 3A21A 1AXYA 4QB1A 2RS11 1UQXA 1AR81 1XNDA 1JZ2A 3WQ0A 1UCXA 3T0DA 1BVVA 1VBB3 5FYMA 2R0HA 4FTBA 2EIGA 4QHBA 4LHNA 3IDAA 3RVHA 2XL7A 5FP9A 5GLZA 5BXXA 2BV4A 3U75A 2IFRA 2VQAA 4F8AA 5FOJB 1FMD3 4ZHNA 4Z2AA 2ENRA 4C90A 4L9BA 2VMCA 2KR2A 1K5JA 4QHZA 1UYZA 1ND2B 2OT7A 4QT6A 1X33A 3T30A 1YRZA 4FPLA 1MS5A 2ZHMA 2I2SA 4P08A 3ZFEB 3WVJA 4NIAA 1IPSA 2C6SA 4CCMA 4Y5Z0 2E7QA 1FPN2 2VAUA 4QB2A 3ZYHA 1PO11 4IE0A 1A3KA 2IUWA 1OURA 2TBVA 4N43C 2V4AA 5CFDB 3OEBA 5FR3A 1FOD3 1LU2A 4OYUA 1WD3A 5HXVA 5CYYA 1RUH3 3I49A 4JDMA 1NA1A 4OZOA 5KC6A 5J37A 2ZMNA 1VBD1 4LBQA 4PBPA 1NZIA 2Z4FA 3VHNA 1CVNA 4YZ3A 3AYEA 4QPGB 4XQWA 1BBT3 2VZPA 3VDBA 2CAUA 1Q8PA 4HSLA 1BEV3 1OT5A 4FPGA 2VVEA 4SBVA 5A32B 1W6MA 5JSRA 1NCRC 5M0TA 1RUE3 3C7HA 3CNAA 5FJHA 2AEZA 2X8KA 1AL22 4NPRA 4QPIC 3O0XA 3NNGA 3S6PA 2VQ0A 4MADA 1KD7A 4NRPA 2HWD3 1E57A 2UY8A 5D8AA 1VMJA 1JU4A 2WFPA 2YZ4A 4FFIA 4P9GA 2HWC3 1MVQA 1QQP1 1Q8VA 3I2KA 1B35A 3VHOA 3KSCA 1JOJA 3INAA 4L8QA 4BQYA 2GZWA 4GWMA 3POEA 1CD3G 3NJVA 4GALA 1UY0A 2A6WA 2VMFA 3PJYA 4M4RA 1YFUA 3MUY1 1CAWB 4JKMA 2YC0A 1MEC1 2J1SA 2Y26A 3OEAA 4LKEA 2CDPA 2B8MA 3HN1A 1WGPA 4JX0A 1Q8OA 3USUB 3O14A 5E16A 3S5AA 2D6PA 1AXZA 3ACGA 2ZHLA 3GALA 4TSVA 4MZUA 1DQ5A 4MGQA 1UIKA 2WUHA 3Q8BA 5GALA 3N35A 3D5OA 2K0GA 1LESA 1UU5A 1UY2A 2W3JA 3LE0A 2JKXA 5FXXA 2FBEA 2BNOA 3DYMA 4XMIA 2WNUC 1F35A 1R091 1S0EA 3FFQA 4QPWA 4DUWA 3JCIA 5JI7A 4CCDA 3SNMA 2GNBA 4M00A 5LBBA 3VZNA 5JXIA 4DY3A 3WEZA 2XUEA 4N53A 2IXJA 3ZFGB 2VMEA 1YQ6A 4CE8A 2J1TA 4TLGA 1H4HA 3NKGA 3TNPB 3DECA 4JRAA 4OHZA 2JE9A 4BYYA 3VBRC 3VKOA 3DN7A 2YBSA 1TEIA 5FZ7A 4AE2A 1UZWA 3WX5A 4K21A 4XZUG 1L7RA 1MS4A 4LO4B 5A33B 2YXSA 5L36A 2RS13 4UW5A 3GCWA 1AR83 3IIAA 5BNQA 4LMFA 2C9KA 3M70A 1SFPA 3ZXGA 2OX0A 1AYN1 2WLPA 4AL9A 4Q1RA 4DPNA 1F8VA 3PLQA 2VY0A 4C1WA 3E6CC 2MEV3 1WW5A 1GU3A 5DZFA 2OZJA 4YRDA 5LRSA 1OKQA 1CAVB 4OCTA 2F17A 3JQWA 5CISA 1OA3A 1W6OB 4I0WB 2GC2A 4XQ4A 1W6QB 4ISRA 1H0BA 3WD5A 4RR3A 2WFF3 1X9TA 2C0ZA 2VZQA 4I3GA 3UK9A 4O7XA 1J84A 3E1F1 4KGGA 1Q5OA 1RIRA 4Z07A 2RG4A 4UBHA 4UFIA 4Y20B 1PO13 3VZMA 1ULEA 3FUQA 3T4HB 3VBSB 3MV01 5AC91 1IGOA 4XFGA 1EPZA 1TNFA 4UFKA 1KRIA 4D69A 1RXFA 2LUWA 2BOIA 1RHI3 2A73B 2D98A 4JDNA 3K51A 4E8DA 2YB7A 5EPAA 1NUKA 5LWBA 3CU7A 1MQTC 3TRSB 1SDDB 3VBHB 2CGPA 1E5HA 5FY8A 3SCFA 3N7KA 1POV3 1BCXA 1KEXA 3W21A 1C1FA 3TBDA 4DINB 4AI2A 2A3WA 4QPGA 4Y4YA 3TN92 5FZHA 3VBOB 1PIV1 2ADDA 1JZ8A 4JHZA 2FZ2A 5IFPA 1Y9GA 3WF0A 3ZMOA 5A32A 1XU1A 3AJZA 1QJX1 5C3QA 4LUKA 5FXVA 3AP6A 3C7EA 1PGSA 4WM7C 2DVAA 4ZS2A 2JDYA 3OGSA 4M3CF 4EN9B 3U1XA 3M2MA 1VBC2 4M0HA 5FZBA 1WMFA 4M4PA 3WG4A 1W9SA 2XWBB 3A0KA 4U36A 2J1RA 4LXLA 1SLTA 5IHRA 3OGVA 2OZ6A 4CDXA 5LB6A 4BIFA 4CU6A 2E53A 4XDQA 2DUPA 5JOYA 4JDOA 3WF2A 2G9GA 1R1A1 4B1MA 5JIUA 4ZPIA 5IATA 4FFHA 2ZEZA 4RGGA 5K4LA 3K2OA 4PT6A 4PCRA 1UY4A 4WM8A 1CAWA 1HB1A 3F2ZA 4URTA 1JU3A 4CCEA 1RMU2 2D6MA 2RR11 2VTXJ 3T2QA 5CFCC 5FZ0A 4BQXA 4IV3B 1VRH3 5C4WC 1NY71 1OF4A 1CWPA 1S2BA 4AQ2A 2VMIA 1AR61 2FHRA 2XLGA 4U2AA 3O1TA 3RGBA 1AX2A 2Y6HA 3B5LB 2W52A 3C3VA 4AEDC 1VBE1 1WLCA 4LBMA 1GZWB 4BHPA 3FX3A 1FI2A 1W6PA 2E6VA 1PZ8A 3APBA 3ZYGA 4A7YA 1OVPA 4CSWA 3CJIB 3UKTA 3H1YA 2YHJA 3M3OA 4AFDA 3HNBM 2EXIA 2P3JA 4C0BA 4K9SA 2QKDA 4OHXA 5IVJA 2AACA 3LDRA 1YUDA 5T3NA 3E6BA 1NE6A 1ZBE1 1YQ2A 2H6CA 2E7TA 1VAKA 3J4UH 3E5UA 4IEQA 1BHGA 3A4UA 1POV0 1X7NA 3BALA 5EIYB 1H30A 1UNBA 2ZKLA 3N9PA 4LHSA 1ZYBA 3WHTA 1DZRA 3MIDA 4DOUA 3N3HA 4C0HA 2HYKA 1AYN3 2JD9A 1F5FA 1V6MA 2YBKA 4FAHA 4ZY9A 3GBWA 1AVBA 2J22A 2XJTA 3BTZA 1K12A 3DPRC 4XDOA 5FZAA 4CUGA 1V9U3 3V0AB 1GP6A 1GP5A 5BNPB 5CVRA 1AL0G 1XYPA 1W6OA 2QQMA 5K7PA 1RUD2 3OBAA 1W6QA 2ARBA 3CEWA 4D7TA 1EYBA 4YM3A 1PM7A 3F95A 3KCXA 1G7YA 1O3QA 3ILNA 2QZ2A 2XOMA 4FFFA 3SISA 2DBNA 3CO2A 3ETQA 4YGDA 5C8CB 4YVSB 2BTVC 5AC93 1DGRA 5CKQA 3PDQA 2Y60A 3KVBA 3B9IA 3DEMA 3KT7A 1SDWA 1ZRIA 2DUOA 2FCUA 4HVRA 1UOGA 2PHFA 1OD5A 2OKXA 1FATA 2XJPA 3TOJA 3RI9A 3NAPB 5LA2A 5JXHA 4O9GA 5IT6A 1TVGA 1C8M2 2OPKA 3VBHA 2XHNA 1JS9A 4D8MA 1S0DA 4HBNA 5LCWL 1PIV3 4RYDA 3POBA 3NV3A 4OMDA 2ZGPA 4K8FA 4N7IA 1ND3A 3VBFC 2ZEYA 1KJLA 2YROA 5A7WB 4AHWA 4CEYB 4F3JA 4PI0A 3DXUA 2D5FA 1PGL2 4AYUA 1W28A 4S2GA 3ZSMA 4XOGA 2NMOA 2XG3A 4W6WA 2X05A 5T5JA 5JXGA 2HWE2 2WKKA 4QD2A 3VDDB 3LEKA 5K0UC 4KWJA 2WT1A 4CP1A 4XILA 4IV1B 4QGNA 4JQTA 4MHUA 4RGKA 3FHIB 5LASA 5T5OA 1YI7A 3AP5A 4G3YC 3ZSEA 4DXRA 3I97A 4RS5A 4QX5A 4B7EA 2AUYA 5JZGC 4HETA 1SG3A 5C7GA 5DN2A 4LBNA 4XDPA 3OGRA 3ME2A 3HQUA 2IXHA 2QQNA 2WNVC 4IEVA 3VLBB 4WZFA 1FNYA 1D4M2 1U5IA 4MX3A 2XBO3 2ZPXA 3K4DA 2RR13 1K42A 5C6CA 2WN3A 5FWJA 2EIDA 2NQYA 4XCAA 1VB4A 3BB6A 1K5MC 1G9BA 2OXBA 4I3PA 2WSVA 3WF4A 5E1RA 3V64A 1JXNA 5DQ0A 1YNAA 1OOPA 1VBE3 5A1LA 3B02A 5T55A 4QKFA 2XMLA 1H9PA 2HWB1 4MGSA 2JDUA 4LUMA 1YI9A 1TG7A 2BP6A 3WP6A 4HKOA 5FREA 5B4XA 1HW5A 1KQRA 1FT9A 1XNTA 2ERFA 3QH7A 2IXIA 4CEWB 5JPMB 2NMNA 3VZJA 4EZ4A 1VB2A 1LOFC 4FXGB 1ZBE3 4D6SA 4NVPA 1NLQA 2R071 3M3EA 2VOVA 1OH4A 2C4XA 1CAUB 4D6QA 3CL1A 1QJU2 5LA1A 1DYOA 4JRLA 4FBFA 3WG1A 3AMNA 1OH3A 4BMEA 2P4EA 4GB32 5J96B 4IEUA 1TMF2 2Z42A 4Q4V2 4E4HA 4GWJA 4KG0A 2Y34A 3THPA 1N3PA 3DF0A 3EYPA 3H3LA 1YQCA 4PLNA 3UT0A 3LZZA 3BIWE 5JMOA 2ORZA 4LKSA 1ULCA 4DUVA 1V6OA 2XWJB 5FJKA 2UURA 3RMXA 2D3RA 4EWDA 1H8VA 2NZ9A 3MIBA 4KWKA 3VBUB 1Q56A 1NQJA 1KS5A 4JAAA 1SLBA 5HV4A 1SEFA 2P3YA 3KT1A 3FJSA 4GWNA 3WNPA 1PMJX 1IPJA 2Q1FA 3N7JA 2ZHKA 3NQHA 4L11A 3RJ2X 3T09A 3RMYA 1CR7A 1VAVA 5BNPA 3URFA 3POJA 1NT0A 4D0QA 3ACIA 3NKTA 3W9AA 4RN5A 1RUC2 2X53S 1WW4A 3AKSA 3EJKA 3ON7A 3AB0A 4FOWA 4QPYA 4ZXKA 4A6SA 1WLDA 5FXZA 5J98B 1DLLA 2A71A 3PVNA 1LGBA 5C8CA 2DUQA 4NAOA 4XUOA 5EWSA 3GBGA 3WUDA 1HRI1 3NO8A 1UOBA 5K8SA 3SLIA 1UYPA 1XBFA 5F8PA 4AVAA 4A3ZA 2VD7A 3USSA 5ABJB 1IS6A 1U5YA 1HV1A 4FT8A 2Q8DA 1LTEA 1IZ3A 1QXRA 2JIJA 4HT1T 3BKZA 2VZ3A 3ZN4A 3RZJA 1CIWA 5K9YA 1Y7BA 2CWSA 4HK9A 4ORFA 1RITA 4IW3A 4K20A 3PTRB 5JOZA 1ZA4A 5FCCA 4CP0A 4ZU7A 5FZLA 2HWF1 2EICA 2XVGA 3SCGA 4CEYA 1C1LA 1X36A 2WSUA 2ZX2A 3SCHA 3DKWA 3ES4A 1NQDA 3M4FA 4LIUA 5CB7A 4KH9A 3U11A 4MGTA 1NOVA 4COWA 4AK3A 4X6RB 2G19A 1SACA 2FDJA 4UFJA 2ZGRA 5FOBB 4ASLA 4HN0A 5A7PA 3RNSA 2X29A 1P8JA 4LHLA 3I2GA 1QWRA 3I2JA 1Y3TA 1EAH3 4TLFA 2QUOA 3O1PA 4CCCA 2HEVF 3AYCA 4Z8BA 2BUKA 3WNNA 4AVTA 3A7QA 2ET7A 4P00B 3IWZA 1ZZ9A 4OI4A 3OGJA 4I09A 4LEJA 5H9RA 1RUG2 4GH4A 1LKNA 2WZ8A 2OYZA 2ZEWA 1PK6C 3KMHA 4AHYA 2WNOA 3FHQA 2JEMA 2ZGLA 3MO4A 5FMCA 5FYIA 2IWGB 4B29A 3W59A 4AI9A 4PF1A 4CDUC 3HBKA 3WHUA 4XAAA 3OJBA 4XACA 2JG8B 2RM22 4NPMA 3ZYJB 2HH9A 3M7AA 1SFYA 1E5RA 2ARXA 1COV2 3WNMA 2BOJA 2HBUA 2RS31 3GZAA 2ARCA 1V6KA 5JDBA 2HWB3 4CTEA 1JZ6A 5CG8A 1AR93 1EP0A 2PLV1 2VOXA 2A6ZA 1MZ5A 3CQOA 5EFUA 4XF0A 1X9PA 4BMBA 5FZIA 1H4GA 3LEIA 2AGSA 1SHWB 2R7EB 3U07A 3LFIA 5KXCA 4UWDA 2R073 2YBPA 2EIBA 2GH8A 1JZ7A 3MZHA 2NP0A 2B39A 2WJSA 3IKWA 3J8F1 4IEWA 2G4IA 2GNMA 3UKNA 4D7YA 2GMEA 4X8PA 1IQDC 2VXRA 1JODA 4QX2A 2BERA 2CTVA 5KR7A 2VMDA 5FPZA 4CA9A 1G9AA 5KXDA 4LE3A 2VZSA 2A6YA 4META 1QJY2 2ZBJA 4FQZA 1W6NB 3BTAA 1J3RA 1NA1B 2V4VA 2VCAA 5KXBA 4AVCA 4LBQB 5DDJ2 1S4CA 3GHMA 3AP4A 3TEWA 1PVXA 3IDEA 1ZRFA 1NXD1 4JGZC 3FLRA 5KHHA 4DXZA 2TUNA 5ANNA 3VBUA 3AKQA 1ZRDA 4YFWA 4IEOA 1W6MB 1ZZ8A 3WCSA 4AFMA 1YC61 4LITA 4XABA 2V72A 1F2NA 3J9SA 3BYWA 4LK7A 3QD6A 2RS51 4NRMA 1QJFA 1OD3A 1ZBA1 4YNIA 5LA0A 3NV4A 1NCQC 4QXCA 1RUJ2 3JZVA 4RQPC 2VBPA 4OHVA 1CQ9A 2QFEA 3K3OA 3ZYBA 3FUOA 3QLQA 5EYXA 4FCAA 2GSYA 4GMP1 5D8AB 1HRI3 3B00A 3KV6A 3WG2A 5GLWA 2BBVA 3T0AA 3PHMA 4BQ1A 1SLIA 3E6DA 3EQEA 4YW6A 4EJRA 1DGLA 1T6GC 1KS4A 1B35B 2ET1A 3IAQA 4JTOA 2YGLA 4MVTA 3ES1A 5C71A 1NE4A 5ANQA 4L2NA 4Y1UA 4ITCA 1GV9A 3ELNA 1FV2A 1Z78A 4OVEA 4RFT0 5FYYA 1LGNA 5DZGA 4R4ZA 3AFGA 3ZIXA 5FMBA 1WKYA 2FZ1A 3GCXA 5FP7A 2K9ZA 2YU2A 3X29B 3CLPA 3NJYA 4XIKA 3FLPA 3WNOA 2HWF3 2VW2A 2ZX0A 4MO3M 3I3DA 3BUCA 5I93A 4IETA 3ZFFA 1KJRA 2IZWA 3EXUA 4BU2A 1MPXA 4CDQA 5A6YA 5D1IA 4BH9A 1LU1A 2XKOA 2BPA2 3MI8A 1JYIA 1DBNA 3U4XA 2J1EA 4MGKE 2RV9A 2VMHA 3EMRA 2VE1A 4H7LA 1GNZA 1BBT2 3BTYA 1Y9QA 3LEMA 4CUCA 4Y24A 5FYVA 1VALA 3TEZA 2ATFA 1WUVA 3KQ4B 2IVJA 1ZNPA 3ZVXA 4XAEA 2GC3A 2UYBA 4NIHA 3PIGA 1A34A 5JOWA 1NXMA 3POGA 5A3WA 4LNVA 2VR4A 1FPN1 1BXHA 2DVDA 3WINE 4LBQD 2Q1MA 3MICA 4JGYC 4LPLA 3PMEA 2WO3A 1BK0A 4Y1XA 2CHHA 4MXWB 2R1BA 5HI0A 4COZA 4A45A 3FMGA 5FBZA 4D3WA 3B94A 4P9LA 1YQ5A 4AI3A 1RXGA 3WNXA 3UGFA 1ENXA 1LOAA 2CL2A 4HPKA 5A3TA 2JG9A 4JHTA 4MGYE 4ZU4A 3MLLA 3I3QA 3RQ0A 1I9RA 2PLV3 1H8TA 3B3QE 4EN8B 3EO6A 4N9HA 2B4KA 4DFSA 4NPLA 2NM1A 5A3NA 3KCCA 3AYDA 4BK4A 4TXWA 1W99A 3QCWA 1QNYA 1TNRA 3QBQA 4RR3B 5KBFA 2VBBA 4BA6A 1PZ7A 3DYOA 1O59A 1TME2 2DCKA 3BU7A 3J8F3 4GJYA 4QDRA 3HQRA 3H3UA 1G9DA 2B9VA 3IMMA 5IAVA 2WNUB 1AL21 4KGQA 4EV0A 2VOTA 5L7OB 3T08A 2CGOA 4PIYA 4URAA 2O8OA 1DP0A 2H0VA 3AMQA 1OUSA 5DUXA 4CDWC 4CCOA 1HDKA 1W6NA 5BY5A 3N36A 2FDIA 2OQ7A 1SFNA 1HIXA 2QQLA 1WCUA 5T54A 3VBRB 2BNNA 3ZYRA 1BMV2 4Z2WA 1MS3A 3DL3A 2XJRA 1U0AA 2P1BA 3SC7X 2YV8A 2EVXA 3GNEA 4YVWA 4YPJA 1HJGA 5TSWA 1H2MA 4LA3A 1S0IA 1POQA 1JTZX 4R9BA 5FFOC 5FYBA 4AOCA 4XJZA 4YM0A 1TZOA 1N1VA 1ZBA3 2P3KA 5ACA3 4NR1A 3NV2A 4P9XA 3VUOA 2V5DA 3N7LA 4OI0A 4NHMA 2DU0A 1ENSA 4XBLA 1OQ1A 4WVVA 4AFAA 4MOAA 1DFQA 1OI6A 4Q4W2 1G8WA 4XUPA 3R4DB 1UXZA 5GLTA 5EYYA 1DGWA 4GQ7A 2DFCA 2QZ3A 2XB6C 1N47A 3CDZB 5C5UA 1BZWA 1N1SA 2MEV2 4INDA 4CU8A 4CXWA 4CDXB 2XGXA 1HJFA 1YIPA 2OW4A 2JDNA 3TYJA 4Z92B 1AX0A 5IWFA 2VXJA 3MFCA 1UF2C 4P9IA 5FXWA 5SV5A 5JPNB 4QAWA 3LDKA 2VW1A 1JBCA 1QDOA 2WFF2 4N43A 5ISLA 4QQ2A 1N3QA 3FL7A 4WM8B 1D2SA 3RZGA 3EBRA 2WR9A 4FOVA 4MYEA 1SZBA 4WV8A 4XJWA 3WDWA 1ASJ2 4CCNA 2C26A 5CKMA 1PNFA 2ZKNA 2ZOEB 3UL2A 4BLJA 1UN1A 3BIEA 3H7YA 5GLVA 3RRDA 1XE7A 4RSUA 2HKXA 3VZOA 2XLAA 2QQVA 1RHI2 3MIEA 3HAGA 4XFAA 5LY1A 1XNCA 2WN2A 3LD8A 1LECA 3CF6E 2GDFA 5EJ1B 2GC0A 5FPBA 5D21A 1W6PB 2LRPA 5IVCA 4ES9A 3VGIA 3O5SA 2JICA 1NCRA 4Q4X2 5E88A 4LBOA 1JZ4A 3MF6A 3AL5A 4J1WA 4XPVA 3M3CA 2Z79A 4QPIA 5F6LB 3ACFA 2WAOA 2D3PA 2XQRA 5A3PA 5C9AB 1MZEA 4Y4RA 4LO6B 1BJQA 4YZ4A 5FPLA 3HJRA 1FPN3 5L9RA 2ZEXA 1JMUB 1HQWA 2PN5A 1A6CA 1W9TA 2YYOA 3E5XA 1ND2C 1YCIA 3MGUA 3MIFA 1HQLA 1QXJA 4JZRA 3RZHA 2QQOA 3P3PA 1IOAA 1ONAA 5FYSA 3JD72 1MACA 3LB9A 5F6KA 4J25A 3VN4A 3ZFEC 4MXWA 4PHZA 5DABA 3THDA 4DUXA 2ZGTA 3RI8A 4JTNA 5A6QA 1L7LA 3LPFA 4A7ZA 3NW4A 2OUHA 2VC9A 4AZZA 4KBBA 5CFDC 2WS92 2AC1A 4Q2FA 3WT3A 3JBG2 1JYWA 5KHIA 1EY2A 1LJ7A 3TN91 2DF7A 1DHKB 3ZIWA 1DQ1A 1XE0A 2F4LA 2ZGQA 5CBLA 4QPGC 4AG4A 4XJ9A 4B4QA 5FWEA 3VV1A 4Q0PA 1VRH2 2ZX4A 4KG8A 4QQHA 2PELA 4XUTA 4BISA 3THTA 4W4ZA 4BOWA 4BZ4A 1AL23 1O8PA 4H14A 4IE5A 3TEYA 1EUUA 2WNUA 1LHOA 1UMIA 1DQ2A 1CX1A 5BNOC 3LGRA 4CU9A 1WA6X 4YGCA 1VBC1 2PA7A 5L7OA 2P5BA 1W8HA 4K1ZA 5FLIA 3A23A 5J1XA 1RC6A 2GN7A 1YYNA 4MGZE 1VBD3 1S2KA 2FCTA 2ZGNA 3T2PA 3AP7A 1LENA 3VBRA 1ZZ6A 5C3SA 2WYSA 5B4NA 4LK6A 4E4SA 2DDUA 4A41A 3VZKA 4QM8A 5EJZB 3S7IA 2FCVA 1QH6A 5FPXA 1ND3B 3I2OA 1UKGA 1AX1A 4GWIA 2QQPA 3WQ1A 2XUMA 1LGCA 2J7MA 2JJ6A 1RMU1 3ZYIB 1OKOA 5FY1A 1KFUL 2JKBA 2DBIA 4AR2A 2YG0A 2RVAA 1UZ0A 2GMMA 2YMZA 3DPRB 3GYDA 4FVVA 3KHCA 1DGWX 1K45A 2DYCA 3PUIA 4XF3A 4XFIA 1LAJA 1MS1A 2WQ4A 4E2GA 3AXDA 5FP4A 5D2AA 1S2EA 2ZAAA 4YW1A 5F1RA 2BYVE 2C1FA 1QQP3 1Y43B 2JB4A 4RS5B 5FO7B 3ROUA 5FPUA 2YC4A 4NMIA 2VTXA 4XF4A 3ZYPA 1V9U2 4KU7A 1F4AA 1US3A 2Q8OA 1VAMA 4UFLA 3CZJA 4YYOA 4ET7A 3UNPA 3I54A 5I8SA 1T2XA 4R9CA 1O3TA 3IDCB 2VNGA 5FRAA 2JXAA 2XLFA 4BPZA 1MEC3 2VL4A 2BGCA 1IPKA 2Z2SB 4IE7A 5F3EA 3ZR6A 5F5CA 2ZTNA 5FQ0B 3VKFC 5LW9A 4CXYA 2UWAA 4FPYA 1MQTA 4EE2A 3ZFGC 1UOJA 3GM8A 2GC1A 2V5YA 1W90A 2JDPA 1Y9MA 2O14A 3VKNA 2WQZC 5IK4A 1OOPB 1C5HA 4DIQA 5JSOA 3AJYA 5FZEA 5LATA 5I0SA 2UWCA 3K75B 2YFZA 5A7NA 2QCSB 5FMOS 3PIJA 1QOSA 4EWAA 1YFXA 2OA2A 1HRV2 1W9YA 1R093 2ZGKA 3N7MA 3O0VA 2P2KA 2YUEA 3UV9A 2E26A 2LTNA 2R1DA 1V00A 2LW8A 4QHOA 4CU7A 3BODA 1W8WA 5HCAA 4QM9A 4WM7A 1QJEA 2R062 1RUD1 2RMU2 3MFAA 4K1YA 4Y1ZA 1FAYA 5K0UB 2CV6A 2R30A 2DCTA 5C9AA 2HJIA 1IKPA 5HCFA 1VBA1 3RWNA 3VD4A 1DDLA 1WMEA 1SBDA 4E8CA 4XBQA 1JUHA 4CVUA 4LKDA 2WNEA 1ZRCA 1GP4A 5FY9A 2ES3A 4UAPA 5L9VA 1Q3EA 3HNYM 4YW5A 1WW6A 1F31A 5AVPA 1PO22 5H9QA 2SBAA 4BQ5A 3VBSC 4LTAA 5DAWA 4IE6A 5DAQA 1XC6A 5FZKA 5FZCA 2DWRA 3AMMA 1C8M1 3I4IA 5FTTC 3LWCA 3TN93 5CFCA 3RSJA 4JV4A 4RGAA 1IS4A 5C4WA 1IS3A 1QOOA 1FYUA 5A3UA 4FPCA 1LEMA 2XBO2 2F6BA 1WLTA 2FMDA 2SLIA 1JOBA 1UX7A 4G4FA 4AEDA 4E27A 1EV12 3OOXA 1N1TA 4Q4Y2 3VBOC 1UZVA 4AVVA 3BU0A 4OLLA 1AR72 2O8QA 4AGVA 1JW6A 3DGTA 4HK8A 5GM0A 3ZPOA 1QGLA 2HWE1 4NHXA 3NSTA 1RL3A 3RG0A 1VBC3 2EIEA 2OVUA 4YG3A 3WR0A 2VM9A 1TE1B 1V6LA 4XJ8A 1H1AA 5JXJA 2EXJA 2VMGA 5FMDA 1WA4A 1X8EA 5FY4A 5H9SA 4HFSA 3GGLA 3WDTA 3DXTA 1YO8A 1HB3A 2DVGA 3I8TA 2KXLA 4PDWB 3WG3A 3GZTB 1W3VA 1J59A 2RHPA 3AYAA 1RVF2 3FBMA 1D4M1 5J3UA 2QQKA 3ZXFA 1DQ6A 3H8XA 4WVZA 2DTWA 3W58A 5E8AA 1RMU3 4A3XA 4NOTA 1GQGA 5FZ6A 3WW2A 1QJX3 4QX0A 3LQCA 1UIJA 4H7MA 3O1SA 4D6RA 1KXGA 2W68A 3ILRA 1JYVA 4W6XA 4RHV2 3DPRA 1SLLA 4CXXA 2Z69A 4XUQA 4AFBA 4P9JA 4NE9A 4IGQA 4K6BA 4IUGA 1Z7S2 3AMPA 3LCPA 4DRRA 3KLSA 5JR7B 4IV3C 4LOSA 1PX3A 3LPGA 2ZCWA 5FP3A 4LO5B 1AYM2 3SEEA 2ZZJA 1NG0A 2WWUA 2VQUA 1R1A3 4GH4B 1W8NA 1G9FA 5T50A 1O3SA 4LHKA 1VMHA 3VHPA 2K2SA 5FBJA 4DO0A 2YC2A 1XYNA 2MNGA 2WQ8A 4H55A 3CJIC 1I6XA 2P3IA 3IM0A 4XFCA 3KT4A 2WRAA 5SV8A 1QJU1 2P17A 4IGOA 1QY4A 4Q0UA 1RUF2 2BZDA 2A70A 2OUJA 2QNKA 4GB31 3HNMA 4PIXA 5FQ0A 4DZGA 1X50A 5FK8A 5IJRA 1TMF1 4Q4V1 2R042 2DV9A 2QTWB 3CKHA 5F5QA 3KS7A 5FUPA 2EF6A 2JIGA 1G9CA 1AR63 4QQOA 1MS9A 4NIIA 5F39A 4ASMB 1H1IA 1DQ0A 4LLOA 2ZGSA 4YARA 3ATGA 3LOIA 1ZZ7A 4G9SB 4OI2A 4LIVA 4C1XA 1RUI2 4ZU5A 1GBGA 2A75A 2AENA 2MHFA 4UW3A 2YPDA 3LSDA 4Y26A 3FC0A 4DB5A 3D6EA 2E33A 1RUD3 2WZEA 1JYNA 2FD8A 1OLMA 4AEJA 4GULA 5LA9A 4AI8A 1DF0A 2CYFA 5K0UA 1VBA3 1R082 4I01A 1ULGA 2VZVA 1LHVA 3TWIA 5EP9A 5BNPC 4IERA 5DUVA 1E5IA 1QOTA 3PUHA 4M3CA 2O0OA 2XVLA 3ZXDA 1EAH2 1H9WA 3MLJA 3Q8CA 3JUUA 3H8UA 1QU0A 2XDVA 2EALA 2WNVA 1HX6A 2VCMA 2W1SA 4YVSC 4UI9L 2G1MA 2NYYA 3P1IA 1C8M3 4A44A 4B1LA 2WO1A 4L97A 4A7KA 1CX4A 2Q5TA 5KHKA 5FPAA 3WUCA 1MZ6A 2B46X 2P6HA 2W1QA 2YDEA 3LAGA 3WNKA 1CZSA 3G7DA 4FI9A 4P9WA 3K3NA 1K5MA 4FXKB 4AF9A 4AQTA 1O5LA 1XB9A 3NAPC 2OS2A 3H8RA 5FKCA 4W50A 4X6QB 5FLJA 5A70A 1E5SA 3OBZA 5BNNB 1YJLA 3SMHA 1NX9A 2HWE3 4XJUA 2BVBA 2ZX1A 5I0UA 1CJDA 2ZAHA 2R32A 3ZM8A 5JR2A 3VDAA 5ABJA 1LOFA 4IEXA 1AR92 4N8MA 3VZLA 5I0DA 2PAEA 3M8LA 3ZSLA 3WW3A 1HB4A 1W2TA 2A7AA 2VECA 2VO5A 3RS6A 1M06G 1PGW2 3VDDC 2ZS6B 2PYTA 1RUG1 4L0PA 2P34A 2DVFA 4IV1C 1OLQA 3POIA 2ZZQA 2XJQA 4PDWA 4XMAA 5FYZA 1D4M3 1WCQA 2RJKA 1ZREA 3WP4A 2W87A 5J09A 1JI6A 2VUJA 4D94A 3AMHA 3HT2A 3HPNA 3POYA 4LE4A 1V6NA 4AW7A 1W8TA 5CA6A 2RJ2A 2JD4A 1W8ZA 2BFUS 2PMWB 3KGLA 4UXAA 2RM21 3H50A 3KQRA 3ZFFB 1W06A 4CDQB 3GXUA 3D8CA 2BBAA 2BQPA 5A3OA 3WDUA 1COV1 2X5IC 1R1ZA 4XEZA 1S0GA 2OQ6A 2ZGMA 4EWEA 1J83A 4P5HA 3B93A 3OD4A 1W3XA 1DZQA 2D44A 2WZR1 3IBMA 2WIIB 3NNFA 5GJ6A 2E32A 4XZPA 2Q0AA 2D5HA 3J7HA 2Y0IA 4PQQA 3POWA 4CUAA 1SPPB 1OXCA 1BYHA 2JE8A 4XJAA 1QKQA 5JUVA 2VGDA 3LF7A 2LS6A 4FFGA 3N9MA 4I2OA 5CAZA 1W0PA 1UPSA 5DG2A 1QJU3 1RINA 4H3WA 1O8SA 4CEWC 4GB33 4JC1A 3BGAA 4XXPA 2YGMA 1TMF3 3ABZA 2X10A 2BRTA 4Q4V3 5DAVA 3RYRA 1DQ4A 1QJY1 1F4HA 5IFTA 1HXS2 2I07B 3ZDVA 3ZPYA 1GOFA 1SBFA 4HPKB 1GOGA 3NWKA 5DDJ1 3I59B 2JG9B 5JOXA 3ZN6A 3MEPA 4ONUA 1U5XA 3I2DA 3PUSA 1GZTA 5FZGA 2B45X 4HN1A 4OQ8A 1H8TB 4XHBA 2EA7A 5HCHA 1OC1A 5FZ8A 3E5QA 4UBGA 1I1EA 4AHXA 4DRVA 2GN3A 1W04A 3PVOA 2Q8CA 1LCLA 2CDOA 3ZKYA 5I8TA 3SEPA 3MPBA 4OHYA 1X82A 1H2LA 1REEA 3OBTA 2JDKA 3C8XA 3VBUC 2D97A 1PHMA 1GFF2 1F5JA 3MIHA 5FP8A 5J48A 4BWOA 4HXCA 2D6OX 4UFMA 1RUJ1 2W46A 5JI9A 5F3IA 5JCTA 1S0CA 4QKDA 2WWJA 4C91A 4YWAA 5G05L 2JDHA 3ACLA 1WW7A 1W9FA 4BB3A 2QQUA 1JHJA 1YHFA 4FPEA 5DUUA 3N4MA 1BLZA 3HN3A 3UYJA 1PK6A 4AAXA 3OD0A 4OULA 1Z0HA 1SLAA 3LIHA 4SLIA 3AZWA 3N9LA 4DEVA 1KDKA 1U12A 1RTVA 3TAYA 1PX4A 4YVWB 3KHBA 3ZLIA 1GWKA 4OMCA 2R6QA 3PURA 1PVC2 4XFBA 5ABJC 2ORXA 3MYXA 4I0BA 4A6OA 1IS5A 1IHMA 1OBNA 4QX7A 2VZOA 2FDFA 4B4RA 2BU9A 2BNMA 3VKLA 2NPIA 2PHXA 1GOHA 4Y3OA 5AFEA 1CIYA 2WO7A 5BNNA 3WDXA 2ZABA 2ZA9A 4TZDA 1QNWA 2WA4A 1VBB2 3NNMA 4TYSA 2WO2A 1FXZA 1GNHA 3ETPA 3S57A 3U10A 2H6BA 4MHRA 2XXZA 3KV9A 4HANA 3IIIA 1PNGA 4CRQA 1BBT1 3OUJA 4E2SA 4J1XA 3RPQA 1FMD2 5FIXA 3I2FA 3C2UA 3HWJA 4XF1A 3U78A 1RUG3 2VCBA 1LNSA 3Q8AA 2I74A 1CAXA 2XR4A 4XTMA 1A78A 4XFFA 1WBFA 4N43B 3WW4A 4ATFA 1OSGA 2E9QA 4GZ9A 4QKBA 2ZGUA 3ENRA 4TN7A 2DCYA 3OSDA 1UD1A 3S30A 1UY1A 2ARAA 2R0FA 1FOD2 4JGZA 4NIDA 3LA2A 3EHKA 1COV3 1GZCA 1GSLA 2NLRA 1RUH2 5DPNA 5AFBA 2DU1A 3NL1A 4FPKA 1VPHA 4ZZ8A 3PU8A 5LY2A 1HV0A 2VOKA 3HMYA 2JWPA 2JG8C 3MW4A 1C8NA 4MLOA 2PHLA 1US2A 2WZR3 1NCRB 1YFYA 1OHFA 1BVP1 4YW2A 2W2IA 4XW3A 3T0BA 1BEV2 2V09A 4O9EA 5IVBA 2TEPA 1NCQA 3AL6A 4H2AA 4K3UA 4QPIB 5CKNA 3QACA 4RQPA 1CZVA 1H6YA 3AKPA 1SPPA 3VL8A 1OLRA 1LODA 4J6GA 4K40A 4LOTA 5HCBA 3BI3A 1C5IA 1TME1 5L9BA 3DYPA 5ACA2 2VH9A 1KGYA 1JOPA 1REFA 1RUE2 3P5BA 4HZFA 5E6HA 5A6ZA 5B2GB 5F3CA 4ARXA 2CGNA 2GH2A 2BW8A 1ZA7A 2C9AA 1LHNA 5EJ3A 1ULPA 4XUNA 4DY5A 1QJY3 2HWD2 3S0MA 1NLSA 1UPIA 3FN9A 5FAXA 3UKVA 3EB7A 2Y8KA 2HWC2 4KL1A 2RS33 5GZEA 3KV4A 5EXOA 2HBTA 1ODNA 2QBXA 3KVAA 5CU1A 1S0JA 1H2NA 3I59A 4FPJA 1BMV1 3T2TA 4IEPA 4OUMA 1NA1C 1N3OA 3ILFA 4HVQA 5FLHA 4KU8A 2VULA 3I3MA 5HBAA 2VZTA 1C4RA 2BJSA 5EQUA 1LEDA 3G6JB 1XE8A 4XE9A 2C5DA 1XOYA 1RUJ3 1UXXX 1G86A 3I2IA 3PJQA 3H9AA 4OHWA 5IVVA 4LULA 1CN1A 3GBFA 4Q4W1 1GNYA 2W94A 4AFCA 1ZZBA 2BVVA 2W1UA 4RFRB 3V0BA 1O7FA 4IE4A 4P5YA 5LK7B 1D7PM 2MEV1 3DKQA 4LQRA 4UF0A 1URXA 5T5PA 4BQ3A 1AJOA 2Q1ZB 3W20A 3KCYA 3HD8B 4GKXA 5D8AC 1ZZCA 2D6NA 2MPFA 3IMNA 1W2UA 3JB4C 4JGYA 1QDCA 1SCSA 3O12A 4AWDA 1S55A 1GWMA 2AYHA 2WFF1 3RDIA 4YSFA 4TTGA 1B35C 1PM4A 4CCKA 2W5FA 1O6UA 1YFWA 1U5ZA 5DMYA 1XRUA 2RS53 1ASJ1 1NAEA 2XVKA 1O91A 4PQ9A 4QDSA 4LT5A 5T5LA 2VZ1A 1M4WA 1DU3D 2L9LA 2RS12 4YG0A 1AR82 4E9KA 3O1VA 1CZTA 4CPBA 1RHI1 4GMP3 1QIQA 1SBEA 2J1VA 3I3BA 2VUCA 3K48A 3TEXA 3A0NA 2ADEA 4LO7A 3OF1A 5DAPA 4O65A 5A6XA 1POV1 2PQQA 4DQAA 2J42A 3MUZ1 3BN6A 3RFRA 4A2UA 4Q4X1 4NHYA 4QXBA 2UWBA 2WT0A 3GF6A 4FOQA 2R49A 2JDZA 4UOJA 2QJVA 4YZ2A 2VZUA 4GKYA 2YFUA 5BNOB 4ARYA 4NIGA 3AZXA 1CESA 3WP3A 5FYCA 5FUNA 2CNAA 2XKPA 3OPWA 4P14A 4IGPA 3SXWA 3K77A 4CDWA 1REDA 1ALYA 2GNDA 2XJVA 3VD5A 3B7MA 3L9JT 3RZMA 1PO12 4PIZA 4N53C 1MQTB 2A3YA 4LO8A 4XFHA 2W95A 3TNQA 5FUIA 3JD71 3GHNA 1XYOA 3PTYA 4N7UA 4FAGA 2AREA 1VP6A 4FPOB 1W8FA 5DUWA 3UJQA 2CU5A 2W08A 4DMIA 4PJYA 1VBD2 2XHKA 3U4SA 3ZDSA 2FDKA 2RDSA 1GWLA 5I8YA 4R52A 2WS91 1H2KA 1JH5A 5E89A 4FTSA 5EZWA 2DFBA 3JBG1 3GDBA 1JHNA 2Q8EA 1JYCA 2GNTA 3OPZA 5FV3A 3SITA 3WDYA 4BE3A 1GKBA 1SQ4A 4WM7B 3L2HA 2YPJA 5GZCA 2XL9A 5C3OA 1TME3 1UW8A 1JZ3A 5I91A 2GALA 2VNOA 4QX3A 2Q4SA 4GJZA 1VRH1 4HVOA 3O1UA 1RYYA 2D93A 3KWVA 3NJZA 2V73A 1W0OA 2PQSA 1XSRA 2R16A 4RR3C 2VOWA 2X09A 3PUQA 1CGPA 1QEXA 3T1MA 4XCBA 4EN6B 3CJXA 1V70A 2QQJA 4MXVA 5LK5A 4NN0A 1RB8G 1UU6A 4Q5OA 1QQP2 1LOEA 3OB8A 1FX5A 3NVCA 2VJXA 3V65A 1ULDA 4V2VA 4FP2A 2WC2A 2VCCA 1ACCA 5CADA 2KA3A 2WABA 2ILMA 3IDBB 4AI0A 5L7OC 3WNLA 2NN8A 4XHXA 5F5AA 1ZVFA 5CFCB 4GMP0 2ETEA 2PAMA 5HV0A 1VMFA 1WCDJ 5C4WB 3O1OA 4ISQA 4Y22B 2RDQA 3FHAA 3KF3A 5FO9B 1MEC2 1UOFA 3AX4A 4OQ9A 4NHKA 3WY6A 1ULFA 1A8MA 4EROA 2J1AA 1RUNA 5GKAC 4AEDB 5FMOL 5LBCA 3K46A 2E7AA 1W03A 2Y6GA 4NAMA 4BJ0A 2CAVA 3RYKA 3MDPA 2LROA 2JB8A 4YLZA 1ULOA 1YWKA 3AC0A 2D43A 2QDRA 3AK0A 4Q4W3 4UW6A 2GU9A 3SH5A 2A6VA 4Q26A 1MS0A 2AR6A 2Y64A 3AP9A 4YGBA 5F2WA 3M1HA 2D40A 3ZXEA 3MHZA 1R092 2WDBA 4V2WA 4W8JA 1W05A 4IESA 3H1WA 1V9U1 5C70A 2KM2A 1GZ9A 1D0GA 3LEGA 4FSJA 3AZZA 3BVCA 1S1AA 1ND2A 3OG2A 4CUBA 1WWYA 1QXPA 1OA4A 1O4YA 4CDXC 3R4UA 1OVSA 2Y0OA 2PTMA 5FZ3A 3ZFEA 3I7DA 2G9FA 1ASJ3 4R4XA 5FYTA 3UESA 1RUOA 1CPNA 4QX8A 4XF9A 5C3PA 4Q1PA 3A22A 1J3QA 4YFZA 5IK8A 1YXWA 3LKJA 5CFDA 4WM8C 3ORJA 3RYPA 2HYXA 2PHWA 3D0JA 1V6JA 3H42B 1AYN2 3ASIA 5DXDA 1DGRN 2VUAA 4Y33A 1YLLA 1O4ZA 2RDNA 3GZEA 1WMDA 4Q4X3 1HRV1 5CEHA 1W8UA 4XYXA 1W39A 3O0WA 4NUBA 1UKRA 3OUIA 3WLUA 4Y1YA 1VE0A 4JKKA 1SMVA 3H1MA 1JYTA 4HSJA 1HB2A 2R061 2RMU1 2VNVA 3H0OA 4M0NA 3WQ7A 4CYDA 5BNOA 5FY5A 2DVBA 4HG6B 4QQPA 4EYUA 3KM5A 2PHRA 1I5ZA 3OGGA 3NRUA 4XXAA 4Q0SA 1QJZA 4JVAA 5IVFA 2VTFA 3GJAA 5AC92 2IVIB 3VHRA 3JD73 2VU9A 5C9AC 2BEOA 4L92A 4N9IA 3AKTA 4I02A 3B69A 3E97A 1OMIA 1PO21 5FYHA 5FZOB 5JVVA 1LHWA 3I3EA 5IVEA 4F7ZA 2F4PA 1C28A 2I45A 3VBFB 4YW7A 5IYYA 2WS93 1LHUA 1D0HA 1D4VB 1A8DA 4QQLA 5CNAA 1FV3A 3JBG3 4B7KA 3B9CA 4E4ZA 1C57A 3MF9A 1UX6A 1PIV2 3QOPA 2H0BA 2XH6A 5EHDA 4MGIE 2XBO1 4PBOA 2Y6KA 1HQNA 3OUHA 2Z5WA 5IVYA 1QJX2 2BWAA 2WYFA 3FFZA 5G04L 4LBLA 1EV11 3OY8B 2G9ZA 4Q4Y1 5A1FA 2W0XA 3USUA 4EN7B 2UYAA 1AR71 5A80A 3P6BA 3JU9A 4ZXEA 5JZGB 4HL0A 4M3CB 3LDBA 3VDCA 3MV11 2LALA 2AH2A 2A6XA 1CPMA 1GQPA 2WNVB 3D4KA 4DEQA 4QGLA 1UMZA 4XURA 2W39A 3NMBA 1MZFA 3C7GA 2Y6FA 5FKBA 1QH7A 1R1A2 4FPHA 4QB6A 3NNJA 4XVHA 3MW2A 2B42B 1J58A 1GICA 2EAKA 4IDZA 3R6SA 3MW3A 3JB8A 4XTPA 1MVEA 2Y33A 1K5MB 5LBEA 4XQDA 3ZFGA 3C7FA 4FQ4A 1RVF1 1PMHX 4HMZA 3BTXA 1NLRA 4Y22A 2ZXQA 3FE5A 4COYA 5DZEA 3VBHC 1TQ5A 2RR12 2VVDA 4OUEA 3VD3A 2Y6LA 4R9AA 3FBYA 3IAPA 3UGHA 3O1RA 4IEZA 4RA0A 1KDMA 2WLQA 1NY72 1PGL1 4FTEA 2ID4A 5A33A 4XBNA 1ND3C 4BM8A 1GYKA 2HLEA 3MIGA 4RHV1 1AR62 3CMGA 5HPOA 4Y5TA 4LR4A 1L7QA 5LZ6A 1Z7S1 1VBE2 4FOYA 1DG6A 4XETA 3BOPA 5LBFA 3U37A 5A3LA 2VBDA 4QX1A 5FZ4A 2VVFA 5F5IA 2JE7A 1AYM1 4YW4A 4Y5SA 4BQ2A 4I0AA 1PMIA 1J1TA 1CAVA 1F15A 4KQ7A 5I0TA 1ENQA 1QHDA 1WCKA 1V6IA 4QXHA 1OUXA 2UY9A 1GANA 1UZYA 1ZBE2 2GP3A 3HBZA 3KD4A 4COVA 1LRHA 4RS5C 1VBA2 2DTYA 2W9XA 5GZGA 1L3JA 1DLCA 4KMQA 4B8EA 1CONA 3DCQA 3KB5A 5ERLA 1LR5A 4Y20A 1RUF1 2EAAA 3VBSA 5BYNA 2IXKA 3AVRA 4Q8KA 3JXSA 4P02B 2HEWF 1GUIA 2R041 4V1PA 4AEKA 4EZHA 1KITA 4A42A 4XC9A 2RE9A 4AI1A 1VIWB 1W2NA 4DXTA 5IUQA 2ZJCA 4GIQA 1HRV3 5J7MA 3N9NA 3BCWA 2BGPA 3HR9A 3K4ZA 4MSVA 4YGEA 2OIIA 1RUI1 3K4AA 4I30A 1ZX5A 1OOPC 2VPVA 2VUDA 4BXSV 1UY3A 3VBOA 4HONA 1ZM1A 4RD7A 1UWWA 2D7FA 2R063 2RMU3 3OYWB 4FP3A 4PI2A 5FZFA 5JLVA 3KF5A 3WXPA 1SLCA 2IC1A 3Q8FA 2P37A 1GR3A 3FWEA 4PLMA 3AKRA 1F9KA 1R081 3OBRA 3R05A 2HEYF 3CBNA 5LEJA 1HKDA 5LRRA 1W2AX 3BPSA 4KWUA 4E4DX 5IK5A 2VQTA 4DXSA 3WV6A 1B09A 1WLWA 5A1AA 1UL9A 3L2YA 4ZZ5A 1T6BX 1NYWA 1EAH1 3RZKA 1PO23 5CIRA 3NNLA 3ZN6B 4FPFA 3HEIA 4MV2A 4W6YA 1LULA 4AHZA 3ITQA 1APNA 4NWWA 5FZOA 3WOGA 1UAIA 2BFUL 4UT5A 4YW3A 5BPXA 1G6NA 1KFXL 4AAPA 5C8WA 1QF3A 4AQ6A 3VBFA 1VRBA 2PAKA 3U14A 3LA3A 3LSEA 2WA3A 3IZOA 3ZOIA 1X8MA 4FO9A 1OF3A 4Z1VA 1AUYA 1LOBA 2X5IB 1OQEA 3CIHA 3RZZA 4N90A 1XJAA 4BLIA 1IG3A 1UZZA 2DURA 4ZKTB 3SH3A 2VZRA 4AVBA 2GAUA 1EV13 1RUC1 3UETA 3ZSJA 4Q4Y3 2PHDA 4IV3A 4PLOA 4KNCA 5JMCA 4IQPA 3IT8A 1AR73 2KD7A 5F32A 3OY8A 4KI5M 2ZHNA 4Q0VA 5KHGA 2XQXA 3OPTA 2A5ZA 4HKWA 5JZGA 3HVDA 5GZDA 3W5MA 1PK6B 2DCJA 1GZWA 1AR91 1V0AA 1QMJA 1GLHA 3HIFA 4QDQA 4QWNA 2AEYA 5C8CC 1YIFA 2DCZA 3FZ3A 3CJIA 3WW1A 4GAZA 1PGW1 5A7SA 2XJUA 4CDUB 5FZ9A 4Q8LA 2JDMA 3PUAA 3VKMA 5AVAA 1YJKA 5F9TA 2Q30A 3JQXA 2PFWA 1WBLA 1RVF3 4COUA 1UO9A 4Q27A 3ZMNA 4LBKA 3ZO0B 3VL9A 3IB3A 4BXFA 5APAA 4QGMA 2P6CA 4UFHA 5I0RA 4CP9B 4PDWC 1O5UA 5F37A 2W92A 5JIAA 5C3RA 4IXLA 3THCA 4RHV3 2QE3A 1LOCA 4Z82A 1H1MA 1RJ7A 1XNKA 2B5HA 5GZFA 3ZXJA 1Z7S3 4JKLA 5L73A 4CEYC 3DV8A 3I2HA 2HWB2 3H3ZA 4WBBA 3PMSA 1J3PA 5F3GA 4Y1VA 3UJOA 1AYM3 3WCRA 2PHTA 3KV5A 4HOOA 5L19A 1RJ8A 3ACHA 1Q43A 3LA7A 4KWLA 3MLKA 3V0AA 4P9YA 1CAXB 3PVBB 3FLTA 1OFSA 4ASKA 1N1YA 3ZR5A 2R072 3H8OA 3WDVA 3R4SA 2A3XA 4AQSA 4ATEA 2GMPA 2XONA 4JQRA 5IW0A 1JZ5A 1AF9A 1OLME 4D7SA 1GMMA 4QKNA 4QXKA 1VLNA 4GH4C 1RUF3 5DAXA 4LORA 2VG9A 4YVSA 1NZCA 2CSGA 4QMAA 3LIGA 3D0SA 4JGZB 2R043 3MPPG 4OI1A 1Q8QA 1HXS1 4MH0E 5GLUA 4ZONA 2FMYA 4NJ4A 3UGGA 4EQVA 1YQ8A 1XQNA 3O7OA 4M3CE 2UU8A 3PL0A 3OCPA 2QDNA 4Q0QA 2PXJA 1ZRRA 3ZYFA 3NAPA 4CCJA 5JWPA 3AM2A 3ZSKA 4S2HA 3WZ1A 5BV6A 4ZS3A 1HN0A 1RUI3 1PZ9A 1ST8A 2EXHA 1NCQB 1OPMA 3CZUA 1I3HA 5FO8B 2IXLA 4IEYA 4RQPB 1LOGA 5LEKA 2IFWA 2WAAA 2E63A 1MR5A 3J7LA 4NWVA 1W2OA 3OYWA 5A7WA 2YU1A 2E51A 3IPVB 5FY7A 1R083 3N9QA 3T2OA 5A3MA 2WZPP 5H9PA 2GP5A 3R0RA 1IQAA 3AFKA 4K8RB 3M3IA 4M01A 4YM2A 4QU1A 4A4AA 3N9OA 4OUSA 2O1QA 4WVMB 5T52A 3SKJE 2CY6A 1HRI2 3GZUC 3VB9A 1HLCA 2XJSA 3VDDA 4MG2A 3B01A 2FQPA 2ZGOA 3WSOA 5KWRA 3ZKUA 4IV1A 3J26N 1WD4A 1OQDA 2QQWA 2J1UA 4XIOA 3T1LA 4F83A 5FPVA 3POFA 1D2QA 3HT1A 1UYXA 3RZLA 2IXCA 1DCSA 1AHSA 2B9UA 1DYPA 1FNZA 1PVC1 4UYBA 4BQWA 1EUTA 4QU2A 4CZSA 2X5IA 1ENRA 4YM1A 1AZDA 2HWF2 1MS8A 2W47A 1RUC3 4EN0A 3WF1A 1BKZA 3ZXLA 4JCKA 4DS0A 2LM3A 5IK7A 2WWSA 3S5QA 1VBB1 5FY0A 3V0BB 3LOBA 2FDGA 3MBWA 2XPJA 2RDRA 2WT2A 4UF0B 4NRQA 2WZR2 3OTFA 2QQIA 1WZXA 2ZMLA 4AGRA 1YEWA 5BNNC 1UMHA 2ZMKA 3S7EA 4B4PA 1FMD1 4GD4A 4TWTA 5HXMA 3T3YA 2JENA 1HN1A 3W5NA 3Q8EA 1JUIA 1K3IA 4JGYB 4OZXA 4CEWA 5KC5A 4CDUA 5DG1A 3RWKX 1XNBA 1AJKA 2VNRA 2B7YA 3BPZA 4C8DA 4GA9A 1CAUA 4NO4A 2D3SA 1GQHA 2ZACA 3KZ4C 4NROA 5F2SA 5FK7A 4DNYA 2QVSB 5JAXA 1XNAA 1SCRA 3PNAA 4BQ4A 4CP9A 3POSA 3QH6A 1FOD1 3NJXA 4AXOA 2BWCA 3AXEA 3IN9A 2YY1A 2RS32 1RUH1 3ZXKA 4BCUA 2A1XA 4WZCA 4X8NA 5CG9A 1XPWA 1IG0A 1Q8SA 2JDAA 5FYUA 1C3HA 2RJLA 3AZYA 4LLFA 3WP5A 3ZFFC 5FDBA 2PLV2 3PVEA 3BOWA 3ZX7A 4CDQC 1JYXA 4LBJA 2PHUA 2W1WA 2BGOA 1DZTA 3SH4A 3PU3A 1BEV1 5JSPA 3SHRA 5KXEA 3ST7A 2OPWA 3NV1A 5BUVA 4B3NA 5CZKA 2AZ5A 3J8F2 4NHLA 3WF3A 1AXKA 4IL7A 4AVSA 1RUE1 4CDWB 1W8OA 4KBZA 5ACA1 3U0ZA 3VD7A 3H7JA 1O4TA 5F7UA 1WMXA 5KHJA 4R9DA 4CCLA 4AGGA 4LA2A 4Q29A 5FZMA 1NKGA 4ES8A 1EPWA 1VJ2A 2RM23 2E31A 3ALQA 2HWD1 1HXS3 4YG6A 3ECQA 2HWC1 4S2FA 4K7JA 4E2QA 1J1LA 1I5PA 2EXKA 3C7OA 4LKFA 1STMA 2CWMA 4LJHA 1OFNA 5A7QA 5A7OA 3SQOA 2D6LX 1W9WA 1WCSA 3SKVA 5C5TA 1XXNA 3ZN5A 3HOBA
chains in the Genus database with same CATH topology
1DYKA 1OPOA 2D6KA 4YZ1A 2JG9C 1BK1A 3Q9OA 1H8TC 4R8HA 2RS52 4L99A 2TNFA 4CP2A 3ZXAC 1ZBA2 3TB0A 4YZ5A 3IPVA 2WL1A 3AZVA 1OA2A 3M3QA 4GXLA 4RL7A 4WVWA 1O3RA 2Y38A 1LB2A 2WINB 4HKLA 4BIOA 4S2DA 4W65A 5C33A 4HLTA 4WVMA 3HQXA 2N7GA 3P3NA 1JN2P 5DDJ3 1CJPA 4MUVA 1BQPA 3D82A 3KGZA 1IKQA 2JX9A 4N53B 1S0FA 1UU4A 3RJRA 4OFGA 4UW4A 4PF5A 2ZX3A 1VR3A 2JECA 1PVC3 5J36A 1RGSA 3V56A 5EV7A 1DIWA 4AEMA 1XU2A 3DUIA 1S0BA 2VW0A 4YVWC 2JG8A 1AXYA 2RS11 1AR81 1XNDA 3WQ0A 1UCXA 1BVVA 1VBB3 2R0HA 4FTBA 2EIGA 4QHBA 4LHNA 2XL7A 5BXXA 5GLZA 2IFRA 2VQAA 4F8AA 5FOJB 1FMD3 2ENRA 4C90A 4L9BA 1ND2B 4QT6A 1X33A 1YRZA 4FPLA 1MS5A 2ZHMA 2I2SA 3ZFEB 3WVJA 4Y5Z0 2E7QA 1FPN2 1PO11 1A3KA 2TBVA 4N43C 5CFDB 1FOD3 1LU2A 1WD3A 5HXVA 1RUH3 4JDMA 1NA1A 5KC6A 5J37A 2ZMNA 1VBD1 4LBQA 4PBPA 3VHNA 1CVNA 4YZ3A 3AYEA 4QPGB 4XQWA 1BBT3 2CAUA 1Q8PA 4HSLA 1BEV3 4FPGA 2VVEA 4SBVA 5A32B 1W6MA 5JSRA 1NCRC 1RUE3 3CNAA 2X8KA 1AL22 4NPRA 4QPIC 3O0XA 3S6PA 2VQ0A 1KD7A 2HWD3 1E57A 2UY8A 5D8AA 2YZ4A 2WFPA 4P9GA 2HWC3 1MVQA 1QQP1 1Q8VA 1B35A 3VHOA 3KSCA 1JOJA 3INAA 4L8QA 2GZWA 4GWMA 1CD3G 4GALA 3PJYA 2A6WA 1YFUA 1CAWB 2YC0A 1MEC1 2Y26A 2B8MA 3HN1A 1WGPA 1Q8OA 3USUB 3O14A 5E16A 2D6PA 1AXZA 2ZHLA 3GALA 4TSVA 4MZUA 1DQ5A 1UIKA 5GALA 3N35A 3D5OA 2K0GA 1LESA 1UU5A 2FBEA 2BNOA 4XMIA 2WNUC 1R091 1S0EA 3FFQA 3JCIA 5JI7A 3SNMA 2GNBA 4M00A 3VZNA 4DY3A 4N53A 2IXJA 3ZFGB 1H4HA 3NKGA 3TNPB 4JRAA 4OHZA 2JE9A 4BYYA 3VBRC 3VKOA 3DN7A 1TEIA 4AE2A 3WX5A 4K21A 1MS4A 4LO4B 5A33B 2YXSA 5L36A 2RS13 4UW5A 1AR83 3IIAA 5BNQA 3M70A 3ZXGA 1AYN1 2WLPA 4Q1RA 4DPNA 1F8VA 3PLQA 2VY0A 4C1WA 3E6CC 2MEV3 1WW5A 5DZFA 2OZJA 4YRDA 5LRSA 1OKQA 1CAVB 3JQWA 1OA3A 1W6OB 4I0WB 2GC2A 4XQ4A 1W6QB 4ISRA 1H0BA 3WD5A 4RR3A 2WFF3 2C0ZA 4I3GA 3UK9A 4KGGA 1Q5OA 1RIRA 4Z07A 4UBHA 4Y20B 3VZMA 1PO13 1ULEA 3FUQA 3VBSB 5AC91 1IGOA 4XFGA 1EPZA 1TNFA 1KRIA 4D69A 2LUWA 1RHI3 2A73B 2D98A 4JDNA 3K51A 3CU7A 1MQTC 3TRSB 3VBHB 3SCFA 4DINB 3N7KA 1POV3 1BCXA 1C1FA 3TBDA 4AI2A 2A3WA 4QPGA 4Y4YA 3TN92 3VBOB 1PIV1 2FZ2A 3ZMOA 5A32A 1XU1A 3AJZA 1QJX1 4LUKA 3AP6A 1PGSA 4WM7C 2DVAA 4M3CF 4EN9B 3M2MA 1VBC2 4M0HA 1WMFA 3WG4A 2XWBB 3A0KA 4U36A 1SLTA 2OZ6A 4CDXA 4BIFA 2E53A 4XDQA 2DUPA 5JOYA 4JDOA 2G9GA 1R1A1 5JIUA 4RGGA 4PCRA 4WM8A 1CAWA 4URTA 1RMU2 2D6MA 2RR11 5CFCC 4IV3B 1VRH3 5C4WC 1NY71 1S2BA 4AQ2A 2VMIA 2XLGA 1AR61 2FHRA 4U2AA 1AX2A 4AEDC 3B5LB 2W52A 3C3VA 4BHPA 1VBE1 1WLCA 4LBMA 1GZWB 3FX3A 1FI2A 1W6PA 2E6VA 1PZ8A 3APBA 3ZYGA 4A7YA 3CJIB 3UKTA 3H1YA 2YHJA 3M3OA 4AFDA 2EXIA 2P3JA 4C0BA 4K9SA 2QKDA 4OHXA 1YUDA 5T3NA 3E6BA 1NE6A 1ZBE1 2H6CA 2E7TA 1VAKA 3J4UH 3E5UA 4IEQA 3A4UA 1POV0 1X7NA 3BALA 1H30A 2ZKLA 1ZYBA 3WHTA 1DZRA 3MIDA 4DOUA 3N3HA 4C0HA 2HYKA 1AYN3 1F5FA 1V6MA 4FAHA 3GBWA 1AVBA 2XJTA 3DPRC 1V9U3 3V0AB 5BNPB 5CVRA 1AL0G 1XYPA 1W6OA 5K7PA 1RUD2 1W6QA 2ARBA 3CEWA 4D7TA 1EYBA 4YM3A 1PM7A 3KCXA 1O3QA 1G7YA 3ILNA 2QZ2A 3SISA 3CO2A 3ETQA 4YGDA 5C8CB 4YVSB 2BTVC 5AC93 1DGRA 3B9IA 3KT7A 1SDWA 2DUOA 4HVRA 2PHFA 1OD5A 1FATA 2XJPA 3TOJA 3RI9A 3NAPB 4O9GA 5IT6A 1C8M2 2OPKA 3VBHA 1S0DA 4HBNA 1PIV3 3NV3A 2ZGPA 4K8FA 4N7IA 1ND3A 3VBFC 1KJLA 2YROA 4AHWA 4CEYB 4F3JA 2D5FA 1PGL2 4AYUA 4S2GA 3ZSMA 4XOGA 2NMOA 2XG3A 4W6WA 5T5JA 2HWE2 2WKKA 4QD2A 3VDDB 5K0UC 4KWJA 2WT1A 4CP1A 4XILA 4IV1B 4QGNA 3FHIB 5T5OA 3ZSEA 1YI7A 3AP5A 4G3YC 4RS5A 4QX5A 4B7EA 2AUYA 5JZGC 4HETA 4LBNA 3ME2A 2IXHA 2WNVC 4IEVA 3VLBB 4WZFA 1FNYA 1D4M2 1U5IA 4MX3A 2XBO3 2ZPXA 2RR13 5C6CA 2NQYA 1VB4A 3BB6A 1K5MC 1G9BA 4I3PA 2WSVA 5E1RA 3V64A 1JXNA 1YNAA 1OOPA 1VBE3 3B02A 5T55A 1H9PA 2HWB1 4LUMA 1YI9A 3WP6A 4HKOA 5FREA 1HW5A 1KQRA 1FT9A 2ERFA 3QH7A 2IXIA 4CEWB 5JPMB 2NMNA 3VZJA 1VB2A 1LOFC 4FXGB 1ZBE3 4NVPA 2R071 3M3EA 2VOVA 1CAUB 3CL1A 1QJU2 4JRLA 4FBFA 3WG1A 3AMNA 4BMEA 4GB32 5J96B 4IEUA 1TMF2 2Z42A 4Q4V2 4KG0A 3THPA 1N3PA 3DF0A 4PLNA 3LZZA 3BIWE 1ULCA 1V6OA 2XWJB 2UURA 3RMXA 2D3RA 4EWDA 1H8VA 2NZ9A 3MIBA 4KWKA 3VBUB 1Q56A 1NQJA 1KS5A 4JAAA 1SLBA 1SEFA 3KT1A 4GWNA 3FJSA 1IPJA 3N7JA 3RJ2X 2ZHKA 4L11A 3RMYA 1CR7A 1VAVA 5BNPA 3URFA 3NKTA 3W9AA 1RUC2 2X53S 1WW4A 3AKSA 3EJKA 3AB0A 4FOWA 4QPYA 4ZXKA 1WLDA 5J98B 1DLLA 2A71A 3PVNA 1LGBA 5C8CA 2DUQA 5EWSA 3GBGA 3WUDA 1HRI1 3NO8A 5K8SA 3SLIA 4AVAA 3USSA 5ABJB 1IS6A 1U5YA 1HV1A 4FT8A 5GZGA 1LTEA 1IZ3A 1QXRA 4HT1T 3ZN4A 1CIWA 5K9YA 1Y7BA 2CWSA 4HK9A 4ORFA 1RITA 4K20A 5JOZA 1ZA4A 5FCCA 4CP0A 4ZU7A 2HWF1 2XVGA 3SCGA 4CEYA 1C1LA 1X36A 2WSUA 2ZX2A 3SCHA 3DKWA 3ES4A 1NQDA 3M4FA 5CB7A 4KH9A 3U11A 1NOVA 4COWA 4AK3A 4X6RB 1SACA 2ZGRA 5FOBB 4ASLA 4HN0A 3RNSA 2X29A 4LHLA 1QWRA 1Y3TA 1EAH3 4TLFA 2QUOA 2HEVF 3AYCA 4Z8BA 2BUKA 4AVTA 2ET7A 3IWZA 1ZZ9A 4OI4A 3OGJA 4I09A 4LEJA 5H9RA 1RUG2 4GH4A 1LKNA 2OYZA 1PK6C 3KMHA 4AHYA 2JEMA 2ZGLA 2IWGB 4B29A 3W59A 4CDUC 3WHUA 3OJBA 2JG8B 2RM22 3ZYJB 3M7AA 1SFYA 2ARXA 1COV2 2RS31 3GZAA 1V6KA 5JDBA 2HWB3 4CTEA 5CG8A 1AR93 1EP0A 2PLV1 2VOXA 2A6ZA 1MZ5A 5EFUA 4XF0A 4BMBA 1H4GA 2AGSA 3U07A 5KXCA 2R073 3MZHA 2GH8A 2NP0A 2B39A 2WJSA 3IKWA 3J8F1 4IEWA 2G4IA 2GNMA 3UKNA 4D7YA 2GMEA 4X8PA 2VXRA 2CTVA 5FPZA 1G9AA 5KXDA 4LE3A 2A6YA 4META 1QJY2 2ZBJA 4FQZA 1W6NB 3BTAA 1J3RA 1NA1B 5KXBA 4AVCA 4LBQB 5DDJ2 3GHMA 3AP4A 1PVXA 3IDEA 1ZRFA 1NXD1 4JGZC 3FLRA 5KHHA 4DXZA 2TUNA 3VBUA 3AKQA 1ZRDA 4YFWA 4IEOA 1W6MB 1ZZ8A 3WCSA 4AFMA 1F2NA 3J9SA 3QD6A 2RS51 1ZBA1 4YNIA 3NV4A 1NCQC 1RUJ2 3JZVA 4RQPC 4OHVA 1CQ9A 2QFEA 3FUOA 3QLQA 5EYXA 4FCAA 2GSYA 4GMP1 5D8AB 1HRI3 3B00A 3WG2A 5GLWA 2BBVA 3PHMA 4BQ1A 1SLIA 3E6DA 3EQEA 4EJRA 1DGLA 1T6GC 1KS4A 1B35B 2ET1A 4JTOA 2YGLA 4MVTA 3ES1A 1NE4A 4L2NA 4Y1UA 4ITCA 1GV9A 3ELNA 1FV2A 1Z78A 4OVEA 4RFT0 1LGNA 5DZGA 4R4ZA 3AFGA 3ZIXA 2FZ1A 3X29B 2K9ZA 3CLPA 4XIKA 3FLPA 2HWF3 2VW2A 2ZX0A 5I93A 4IETA 3ZFFA 1KJRA 2IZWA 3EXUA 4CDQA 5D1IA 4BH9A 1LU1A 2XKOA 2BPA2 3MI8A 1JYIA 1DBNA 3U4XA 4MGKE 2VMHA 4H7LA 1GNZA 1BBT2 1Y9QA 4Y24A 1VALA 2ATFA 1WUVA 1ZNPA 3ZVXA 2GC3A 2UYBA 5JOWA 1NXMA 4LNVA 1FPN1 1BXHA 2DVDA 3WINE 4LBQD 2Q1MA 3MICA 4JGYC 3PMEA 4Y1XA 4MXWB 2R1BA 5HI0A 4COZA 3FMGA 5FBZA 4D3WA 3B94A 4P9LA 4AI3A 3WNXA 1ENXA 1LOAA 2CL2A 4HPKA 2JG9A 4MGYE 4ZU4A 3MLLA 3RQ0A 1I9RA 2PLV3 1H8TA 3B3QE 4EN8B 3EO6A 4N9HA 4DFSA 2NM1A 3KCCA 3AYDA 3QCWA 1QNYA 1TNRA 3QBQA 4RR3B 5KBFA 4BA6A 1PZ7A 1TME2 2DCKA 3BU7A 3J8F3 3H3UA 1G9DA 2WNUB 1AL21 4KGQA 4EV0A 5L7OB 2CGOA 4PIYA 2O8OA 2H0VA 3AMQA 5DUXA 4CDWC 1HDKA 1W6NA 5BY5A 3N36A 1SFNA 1HIXA 3VBRB 5T54A 2BNNA 3ZYRA 1BMV2 4Z2WA 1MS3A 3DL3A 2XJRA 1U0AA 2YV8A 2EVXA 3GNEA 4YVWA 5TSWA 1H2MA 4LA3A 1S0IA 5FFOC 1JTZX 4R9BA 4XJZA 4YM0A 5ACA3 1N1VA 1ZBA3 2P3KA 4NR1A 3NV2A 4P9XA 3VUOA 3N7LA 4OI0A 4NHMA 2DU0A 1ENSA 4XBLA 1OQ1A 4WVVA 4AFAA 1DFQA 1OI6A 4Q4W2 1G8WA 3R4DB 5GLTA 5EYYA 1DGWA 4GQ7A 2DFCA 2QZ3A 2XB6C 1N47A 1BZWA 1N1SA 2MEV2 4INDA 4CDXB 2XGXA 1YIPA 2OW4A 3TYJA 4Z92B 1AX0A 3MFCA 1UF2C 4P9IA 5SV5A 5JPNB 2VW1A 1JBCA 2WFF2 1QDOA 4N43A 4QQ2A 1N3QA 4WM8B 1D2SA 3EBRA 4FOVA 4MYEA 4WV8A 4XJWA 3WDWA 1ASJ2 1PNFA 2ZKNA 2ZOEB 3UL2A 4BLJA 1UN1A 3H7YA 5GLVA 3RRDA 1XE7A 4RSUA 2HKXA 3VZOA 2XLAA 1RHI2 3MIEA 3HAGA 4XFAA 1XNCA 1LECA 3CF6E 2GDFA 2GC0A 1W6PB 4ES9A 3VGIA 3O5SA 2JICA 1NCRA 4Q4X2 5E88A 4LBOA 3MF6A 4J1WA 4XPVA 3M3CA 2Z79A 4QPIA 5F6LB 2D3PA 5C9AB 1MZEA 4LO6B 1BJQA 4YZ4A 1FPN3 3OPZA 1HQWA 2PN5A 1A6CA 3E5XA 2YYOA 1ND2C 1YCIA 3MGUA 3MIFA 1HQLA 1QXJA 3P3PA 1IOAA 1ONAA 3JD72 1MACA 3LB9A 5F6KA 3VN4A 3ZFEC 4MXWA 2ZGTA 3RI8A 4JTNA 4A7ZA 3NW4A 2OUHA 4KBBA 5CFDC 2WS92 4Q2FA 3WT3A 3JBG2 5KHIA 1EY2A 1LJ7A 3TN91 2DF7A 1DHKB 3ZIWA 1DQ1A 2ZGQA 5CBLA 4QPGC 4AG4A 4XJ9A 4B4QA 3VV1A 4Q0PA 1VRH2 2ZX4A 4KG8A 4QQHA 2PELA 4BOWA 4BZ4A 3THTA 1AL23 4H14A 2WNUA 1LHOA 1DQ2A 5BNOC 3LGRA 4YGCA 1VBC1 2PA7A 5L7OA 4K1ZA 5FLIA 1RC6A 2GN7A 1YYNA 4MGZE 1VBD3 1S2KA 2ZGNA 3AP7A 1LENA 3VBRA 1ZZ6A 4E4SA 3VZKA 4QM8A 3S7IA 5FPXA 1QH6A 1ND3B 1UKGA 1AX1A 2QQPA 3WQ1A 2XUMA 1LGCA 2JJ6A 1RMU1 3ZYIB 1KFUL 2JKBA 3GYDA 2GMMA 2YMZA 4FVVA 3DPRB 1DGWX 2DYCA 4XF3A 4XFIA 1MS1A 2WQ4A 4E2GA 3AXDA 2ZAAA 4YW1A 5F1RA 2BYVE 2C1FA 1QQP3 1Y43B 4RS5B 5FO7B 3ROUA 4XF4A 3ZYPA 1V9U2 4KU7A 2Q8OA 1VAMA 4YYOA 3I54A 5I8SA 4R9CA 1O3TA 3IDCB 2VNGA 5FRAA 2JXAA 2XLFA 4BPZA 1MEC3 2BGCA 1IPKA 2Z2SB 2ZTNA 5FQ0B 3VKFC 2UWAA 4FPYA 1MQTA 3ZFGC 2GC1A 2V5YA 3VKNA 2WQZC 5IK4A 1OOPB 1C5HA 5JSOA 3AJYA 5I0SA 2UWCA 2QCSB 5FMOS 1QOSA 4EWAA 1YFXA 2OA2A 1HRV2 2ZGKA 1R093 3N7MA 3O0VA 2P2KA 2YUEA 3UV9A 2LTNA 2R1DA 1V00A 3BODA 5HCAA 4QM9A 4WM7A 2R062 3MFAA 1RUD1 2RMU2 4Y1ZA 4K1YA 5K0UB 1FAYA 2CV6A 2R30A 2DCTA 5C9AA 2HJIA 1IKPA 5HCFA 1VBA1 3RWNA 1DDLA 1WMEA 1SBDA 4XBQA 1JUHA 1ZRCA 2WNEA 2ES3A 1Q3EA 4YW5A 1WW6A 1F31A 5AVPA 1PO22 5H9QA 2SBAA 3VBSC 4LTAA 2DWRA 3AMMA 1C8M1 3I4IA 5FTTC 3LWCA 3TN93 5CFCA 3RSJA 4JV4A 4RGAA 1IS4A 5C4WA 1IS3A 1QOOA 1FYUA 4FPCA 1LEMA 2XBO2 2F6BA 1WLTA 2FMDA 2SLIA 4G4FA 4AEDA 4E27A 1EV12 1N1TA 4Q4Y2 3VBOC 4AVVA 4OLLA 1AR72 2O8QA 4AGVA 1JW6A 3DGTA 4HK8A 5GM0A 1QGLA 2HWE1 3NSTA 1RL3A 3RG0A 1VBC3 2OVUA 4YG3A 3WR0A 1TE1B 1V6LA 4XJ8A 1H1AA 2EXJA 2VMGA 1WA4A 1X8EA 5H9SA 4HFSA 3WDTA 1YO8A 2DVGA 3I8TA 2KXLA 4PDWB 3WG3A 3GZTB 1J59A 2RHPA 3AYAA 1RVF2 3FBMA 1D4M1 5J3UA 3ZXFA 1DQ6A 4WVZA 2DTWA 3W58A 5E8AA 1RMU3 4A3XA 4NOTA 1GQGA 3WW2A 1QJX3 1UIJA 4H7MA 1KXGA 2W68A 3ILRA 4W6XA 4RHV2 3DPRA 1SLLA 2Z69A 4AFBA 4P9JA 4K6BA 1Z7S2 3AMPA 3LCPA 4DRRA 3KLSA 5JR7B 4IV3C 2ZCWA 4LO5B 1AYM2 2ZZJA 1NG0A 1R1A3 4GH4B 1G9FA 5T50A 1O3SA 4LHKA 3VHPA 2K2SA 1XYNA 2MNGA 4H55A 3CJIC 1I6XA 2P3IA 3IM0A 4XFCA 3KT4A 5SV8A 1QJU1 2P17A 1QY4A 4Q0UA 1RUF2 4PIXA 2A70A 2OUJA 2QNKA 4GB31 5FQ0A 4DZGA 1X50A 1TMF1 4Q4V1 2R042 2DV9A 5F5QA 3KS7A 2EF6A 1G9CA 1AR63 4QQOA 1MS9A 4ASMB 1H1IA 1DQ0A 4LLOA 2ZGSA 4YARA 3ATGA 3LOIA 1ZZ7A 4G9SB 4OI2A 4C1XA 1RUI2 4ZU5A 1GBGA 2A75A 2AENA 2MHFA 4UW3A 3LSDA 4Y26A 4DB5A 3FC0A 3D6EA 1RUD3 4AI8A 4AEJA 4GULA 1DF0A 2CYFA 5K0UA 1VBA3 1R082 4I01A 1ULGA 1LHVA 3TWIA 5BNPC 4IERA 5DUVA 1QOTA 4M3CA 2O0OA 2XVLA 3ZXDA 1EAH2 1H9WA 3MLJA 3JUUA 3H8UA 1QU0A 2EALA 2WNVA 1HX6A 4YVSC 2NYYA 1C8M3 4L97A 4A7KA 1CX4A 2Q5TA 5KHKA 3WUCA 1MZ6A 2B46X 3LAGA 2YDEA 3G7DA 4P9WA 4AQTA 4FXKB 1K5MA 4AF9A 1O5LA 3NAPC 4X6QB 5FLJA 5BNNB 1YJLA 3SMHA 2HWE3 4XJUA 2BVBA 2ZX1A 5I0UA 1CJDA 2ZAHA 2R32A 1LOFA 4IEXA 1AR92 3VZLA 2PAEA 3M8LA 3ZSLA 3WW3A 1M06G 2A7AA 2VECA 3RS6A 1PGW2 3VDDC 2ZS6B 2PYTA 1RUG1 2P34A 2DVFA 4IV1C 1OLQA 4PDWA 2ZZQA 2XJQA 4XMAA 1D4M3 2RJKA 1ZREA 3WP4A 5J09A 2VUJA 4D94A 3AMHA 3HT2A 3POYA 4LE4A 1V6NA 4AW7A 5CA6A 4UXAA 2JD4A 2BFUS 3KGLA 2RM21 3H50A 3KQRA 3ZFFB 4CDQB 3D8CA 2BQPA 3WDUA 1COV1 2X5IC 1R1ZA 4XEZA 1S0GA 2ZGMA 4EWEA 4P5HA 3B93A 3OD4A 2D44A 1DZQA 2WZR1 3IBMA 2WIIB 5GJ6A 4XZPA 2Q0AA 2D5HA 2Y0IA 3POWA 1BYHA 4XJAA 1QKQA 2VGDA 4I2OA 5CAZA 1W0PA 1UPSA 5DG2A 1QJU3 1RINA 4H3WA 4CEWC 4GB33 4JC1A 4XXPA 2YGMA 1TMF3 3RYRA 4Q4V3 1DQ4A 1QJY1 1HXS2 2I07B 3ZPYA 1SBFA 4HPKB 3NWKA 5DDJ1 3I59B 2JG9B 5JOXA 3ZN6A 3MEPA 4ONUA 1U5XA 3I2DA 2B45X 4HN1A 1H8TB 4XHBA 2EA7A 3E5QA 4UBGA 1I1EA 4AHXA 4DRVA 2GN3A 3PVOA 1LCLA 5I8TA 3MPBA 4OHYA 1X82A 1H2LA 1REEA 3OBTA 3VBUC 2D97A 1PHMA 1GFF2 1F5JA 3MIHA 5J48A 4BWOA 2D6OX 1RUJ1 5JI9A 5JCTA 1S0CA 4C91A 3ACLA 1WW7A 1YHFA 4FPEA 5DUUA 3N4MA 1PK6A 3OD0A 4OULA 1Z0HA 1SLAA 4SLIA 3AZWA 1KDKA 1U12A 1RTVA 3TAYA 4YVWB 2R6QA 1PVC2 4XFBA 5ABJC 3MYXA 4I0BA 1IS5A 1IHMA 4B4RA 2BNMA 3VKLA 2NPIA 2PHXA 5AFEA 5BNNA 3WDXA 2ZABA 2ZA9A 4TZDA 1QNWA 2WA4A 1VBB2 4TYSA 1FXZA 1GNHA 3U10A 2H6BA 4HANA 4E2SA 4CRQA 1PNGA 1BBT1 4J1XA 3RPQA 1FMD2 3C2UA 3HWJA 4XF1A 1RUG3 4XTMA 2I74A 1CAXA 1A78A 4XFFA 1WBFA 4N43B 3WW4A 4ATFA 1OSGA 2E9QA 2ZGUA 3ENRA 2DCYA 1UD1A 3S30A 2R0FA 1FOD2 4JGZA 3LA2A 3EHKA 1COV3 1GZCA 1GSLA 2NLRA 1RUH2 5AFBA 2DU1A 3NL1A 4FPKA 1HV0A 2VOKA 3HMYA 2JG8C 3MW4A 1C8NA 4MLOA 2PHLA 2WZR3 1NCRB 1YFYA 1OHFA 1BVP1 4YW2A 4XW3A 1BEV2 2V09A 4O9EA 2TEPA 1NCQA 4K3UA 4QPIB 3QACA 4RQPA 3AKPA 3VL8A 1OLRA 1LODA 4J6GA 4K40A 5HCBA 2CGPA 1C5IA 1TME1 5ACA2 2VH9A 1REFA 1RUE2 5B2GB 4HZFA 2CGNA 2GH2A 2BW8A 2C9AA 1LHNA 5EJ3A 4DY5A 1QJY3 2HWD2 3S0MA 1NLSA 1UPIA 5FAXA 3UKVA 2HWC2 4KL1A 2RS33 5GZEA 5EXOA 5CU1A 1S0JA 1H2NA 3I59A 4FPJA 1BMV1 3T2TA 4IEPA 4OUMA 1NA1C 1N3OA 3ILFA 4HVQA 5FLHA 4KU8A 2VULA 5HBAA 1C4RA 1LEDA 3G6JB 1XE8A 4XE9A 2C5DA 1RUJ3 1G86A 3PJQA 3H9AA 4OHWA 4LULA 1CN1A 3GBFA 4Q4W1 4AFCA 1ZZBA 2BVVA 3V0BA 1O7FA 5LK7B 2MEV1 5T5PA 1URXA 1AJOA 2Q1ZB 3KCYA 3HD8B 4GKXA 5D8AC 1ZZCA 2D6NA 2MPFA 3IMNA 1W2UA 3JB4C 4JGYA 1QDCA 1SCSA 3O12A 4AWDA 1S55A 2AYHA 3RDIA 2WFF1 4YSFA 1B35C 1YFWA 1U5ZA 1XRUA 2RS53 1ASJ1 2XVKA 1O91A 4PQ9A 4LT5A 5T5LA 1M4WA 1DU3D 4YG0A 2RS12 1AR82 4E9KA 1RHI1 4GMP3 1SBEA 3K48A 3A0NA 4LO7A 3OF1A 1POV1 2PQQA 4DQAA 4A2UA 4Q4X1 2UWBA 2WT0A 3GF6A 4FOQA 2R49A 2JDZA 2QJVA 4YZ2A 4GKYA 5BNOB 3AZXA 1CESA 3WP3A 2CNAA 2XKPA 4P14A 3SXWA 4CDWA 1REDA 1ALYA 2GNDA 2XJVA 3B7MA 3L9JT 1PO12 4PIZA 4N53C 1MQTB 2A3YA 4LO8A 4XFHA 3TNQA 3JD71 3GHNA 1XYOA 3PTYA 4N7UA 4FAGA 2AREA 1VP6A 4FPOB 5DUWA 3UJQA 4DMIA 2W08A 4PJYA 1VBD2 2XHKA 3ZDSA 5I8YA 4R52A 2WS91 1H2KA 1JH5A 5E89A 4FTSA 5EZWA 2DFBA 3JBG1 1JHNA 3WDYA 1JYCA 2GNTA 3SITA 4BE3A 1GKBA 1SQ4A