1DGWA

Structure of the rhombohedral crystal of canavalin from jack bean
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
178
structure length
178
Chain Sequence
NNPYLFRSNKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLLLPHHSDSDLLVLVLEGQAILVLVNPDGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTKRLPSYLSAFSKNFLEASYDSPYDEIEQTLLQEEQEGVIVKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule keywords CANAVALIN
molecule tags Plant protein
total genus 35
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1999-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1dgwA00
2DCTA 1QXJA 4QMAA 5C8WA 1UW8A 3S0MA 4EWAA 3EO6A 2PA7A 3CLPA 3SCHA 3GYDA 3LA2A 4MH0E 1O3SA 2MNGA 3E5XA 4Z82A 1J59A 4TLFA 2VECA 3CEWA 3NJZA 5JAXA 4IEVA 3I59A 2O8QA 3B02A 2D5HA 1SEFA 2CAVA 1ZRCA 2H6BA 4F7ZA 2OPKA 1QY4A 1UPIA 1Y9QA 3D0JA 2ETEA 2ZKLA 4IETA 3O14A 2Q1ZB 4BHPA 4MZUA 4Q0QA 1YFXA 3HT2A 5FLIA 5BXXA 2PQQA 3NL1A 3BU7A 5AVPA 4KU7A 4HVOA 1GQHA 1Q3EA 4MUVA 1EP0A 4EWDA 1YFUA 1ZZ7A 4EWEA 2VQAA 3HT1A 3RZZA 1WGPA 3FWEA 1DZTA 4PIYA 5KHKA 1SFNA 1DGWA 4KL1A 3ZDSA 5FPZA 5FLHA 2XL7A 2B8MA 2GH2A 4FBFA 3UKVA 3PLQA 3MZHA 1PM7A 2ATFA 3ES4A 4OFGA 2FQPA 4XFAA 4E2GA 5J3UA 1O7FA 1EYBA 1CAXB 5D1IA 2UYBA 4FAGA 3M70A 4XF0A 3H3ZA 1UIJA 1ZZBA 4N9IA 3H1MA 4YNIA 1UCXA 3ROUA 1NE6A 2CGPA 1I5ZA 2V09A 4LULA 5CU1A 5KBFA 3I59B 3RYPA 4CYDA 5FPXA 5K8SA 5FCCA 3UKNA 3MPBA 4RD7A 5FDBA 1H1MA 2BEOA 3I54A 2CAUA 4AVBA 2N7GA 4O9GA 4R8HA 4HBNA 1FI2A 5J48A 4JTOA 5JR7B 4XF9A 1ZX5A 1RC6A 5JCTA 3MYXA 1EY2A 3R6SA 4MGIE 1VP6A 4B29A 1DGRA 2EAAA 3FX3A 2OZ6A 2KXLA 4DINB 3TNPB 3CO2A 3LAGA 2PAKA 1YFYA 2PFWA 3NSTA 1JUHA 2QNKA 4HLTA 1ZZCA 1RUOA 1PMIA 3KGLA 3OF1A 1NYWA 4I0AA 4KWJA 1O3RA 2XL9A 4MGZE 4IERA 3HIFA 4HSLA 2WFPA 1ZRDA 3SCFA 4QM9A 1J3PA 1CAXA 3BCWA 1Y3TA 2XKOA 2IXKA 1LRHA 1ZRRA 2BNNA 1X8EA 5E16A 5KHHA 4HSJA 2Y0OA 1H1IA 3CL1A 2ZCWA 5KHJA 4KWLA 4FT8A 5BUVA 1RUNA 2OYZA 3H3UA 3E6DA 2FMYA 4JV4A 4IEQA 2Z69A 1Q43A 4I3PA 3S7IA 3E5UA 4R52A 1RL3A 4XETA 3IDBB 2XLGA 2I45A 3H8UA 5BY5A 3BALA 3EQEA 2PHDA 3MDPA 3OGJA 1J3QA 4ZU5A 4WBBA 2HJIA 4XFGA 4BIFA 4LUMA 1RGSA 3E97A 4N9HA 1V70A 4XF3A 1ZVFA 2IXJA 4EV0A 3EJKA 1Q5OA 2PHLA 2XLFA 4WZCA 1NZCA 3USSA 1HW5A 4YRDA 3LZZA 4AVCA 1UIKA 3H9AA 1SQ4A 1X82A 1O4TA 4MX3A 2MHFA 3BPZA 3JZVA 1UD1A 2B9UA 1QXRA 4Q0SA 4PIXA 1NXMA 1LR5A 1OI6A 1VR3A 1IPKA 1LKNA 2VPVA 5F1RA 3L2HA 3N4MA 3NVCA 4J1WA 2UYAA 4ZU7A 5I0RA 2F4PA 3NKTA 4HZFA 2UY9A 2H6CA 3EBRA 3KGZA 3NW4A 2K0GA 1J1LA 3KCCA 4QGMA 3WW2A 3HQXA 3U10A 2XHKA 3DN7A 3D0SA 4X6QB 2EA7A 5LRSA 1WLTA 1LB2A 4J1XA 2C0ZA 3CF6E 4D7TA 4QGNA 3GBFA 1CAUB 1YWKA 3QOPA 2QVSB 4IEUA 1CAVB 3H7JA 1O5UA 2EVXA 4META 4ORFA 5I93A 4XFIA 1U12A 1WA4A 4IEYA 5LRRA 1QWRA 3H7YA 4Q0VA 4IEXA 2XGXA 2XLAA 4MV2A 4MGKE 4GULA 3VHRA 3WW3A 4I2OA 3E6CC 1GQGA 3FE5A 3M3IA 2HKXA 1OFNA 4I09A 5J7MA 2D5FA 3KMHA 2BYVE 1ZZ9A 4IEOA 3U0ZA 3FZ3A 4UBHA 3OTFA 5T3NA 5LEKA 3C3VA 5HI0A 2GC1A 4IEPA 2K9ZA 1YLLA 2ET7A 4PJYA 1RTVA 1YFWA 5C6CA 5FLJA 5JSPA 2OA2A 4ONUA 4AQ6A 4PIZA 3RPQA 1ZRFA 2QCSB 5JSRA 4Q29A 3D82A 4XFFA 4BYYA 2IXLA 3U11A 4YYOA 3E6BA 4EROA 5BV6A 3FHIB 1CAUA 1VJ2A 3DL3A 3KSCA 4AXOA 3OCPA 2IC1A 2IXHA 3FFQA 1IPJA 3G7DA 2Z2SB 1CAVA 3LWCA 1CX4A 2D40A 4XFHA 3PVBB 4LUKA 3S7EA 4XF4A 1O3QA 3FJSA 4H7LA 1J58A 3EHKA 3OD0A 4I0BA 3UKTA 2IXIA 4QX5A 4I01A 1CGPA 2PTMA 1ZZ6A 3LA7A 4Q0PA 4UXAA 2MPFA 3BB6A 5CVRA 3H1WA 4YSFA 3CJXA 3ETQA 2OZJA 3LA3A 4LTAA 1XE8A 4IESA 2GC2A 3RDIA 4AVAA 2E9QA 5FQ0B 2QJVA 2PAMA 2GZWA 4I02A 5JSOA 3LOIA 4LA3A 3ES1A 5CADA 4KWKA 1OD5A 4L11A 4XFCA 4XEZA 3ST7A 3SXWA 1EPZA 3IBMA 4HN0A 4JTNA 3SHRA 5I8TA 1O3TA 1FT9A 3WW4A 3H1YA 3RYKA 4IEZA 4HVRA 1CAWA 4HVQA 1OMIA 2IXCA 4ZU4A 2QDRA 3E5QA 2ET1A 2BNMA 3WW1A 4X6RB 1G6NA 4Q0UA 5I8SA 4F8AA 1I6XA 4LEJA 3ELNA 1XE7A 3TNQA 2BNOA 4D7SA 5I8YA 3RNSA 4A2UA 2PYTA 2B5HA 4NVPA 1TQ5A 5KHGA 2P17A 1ZZ8A 4L2NA 3ACLA 1YHFA 4XF1A 1NE4A 4QM8A 4KU8A 4OLLA 1ZREA 1L3JA 4UBGA 3SMHA 4E2QA 2WC2A 2UY8A 5I0TA 3H50A 2H0VA 5I91A 2CV6A 4IEWA 4P9GA 2XKPA 2GAUA 3PNAA 3QACA 2GC0A 5EZWA 2Q0AA 4BH9A 4AQ2A 4MGYE 5EFUA 2PAEA 3SCGA 4LA2A 1DZRA 4QGLA 2Q30A 3I7DA 1J3RA 2O1QA 2GC3A 4YARA 5FQ0A 4QXKA 1YUDA 3DKWA 4O9EA 1FXZA 4K8FA 2BGCA 4HMZA 4FAHA 5I0SA 4Z07A 1X8MA 1XRUA 3DV8A 5E1RA 5KHIA 1ZNPA 3RYRA 1O5LA 2Q4SA 3IWZA 1X7NA 4WVZA 3IDCB 1CAWB 5I0UA 5BPXA 2D93A 4HN1A 4E2SA 4XFBA 5LEJA 2GU9A 4LLOA 3IIAA 4JVAA
chains in the Genus database with same CATH superfamily
2ZX1A 1OLQA 1W8WA 1W8NA 1XU2A 2O14A 3CBNA 3HBKA 3KHBA 4QPWA 2K46A 4QMAA 1JZ5A 2GN3A 5FP7A 2RVAA 3ACIA 3N7JA 1CQ9A 2VGDA 4AGVA 4L97A 3AYCA 2NLRA 3SCHA 3VN4A 1NQDA 5AFEA 4EE2A 1GWMA 1YC61 4MH0E 1H2KA 3RMXA 1KJRA 5ISLA 2FZ1A 2Z79A 4Q8LA 4KG8A 2JDYA 3NMBA 3WNKA 3I2JA 5DUVA 1STMA 2RM23 3HN1A 2VU9A 1AUYA 1LHUA 2VW2A 4JGYA 5DAVA 1DHKB 5FOBB 2ZBJA 2JG9C 1DYPA 3UYJA 2Q8CA 5JAXA 4IEVA 2Y6JA 3B02A 2D5HA 3TAYA 4YG3A 1SEFA 2CAVA 4FTEA 3FBYA 2OPKA 4LJHA 1QY4A 1MVQA 1Y9QA 5LY1A 4IETA 1AYM3 2ZKLA 3O14A 2BVVA 1RIRA 1BLZA 2IZWA 1VRH2 2WSUA 1XBFA 1ZBE1 3RG0A 5LZ6A 3GZUC 5FLIA 2V72A 2EIEA 2RHPA 1B09A 1O91A 4CDXA 5FPVA 4ES9A 2MEV2 5ABJC 3DXTA 1YI7A 1R081 4KU7A 4HVOA 4YVSB 5F2WA 4ZS2A 3ZLIA 5LA0A 4TTGA 4MUVA 4A42A 4EWDA 3V64A 4X8NA 4BCUA 4R4ZA 3RZZA 5A32A 3FWEA 1OA2A 2UWAA 4PIYA 1SFPA 2O8OA 3SISA 1V6LA 5KHKA 1A78A 5EJ1B 1Q8VA 3WF4A 4JRAA 2AYHA 4C1WA 1ONAA 2D3PA 1C57A 1KQRA 3Q8CA 5FPUA 3KB5A 4FBFA 4S2DA 4FQ4A 2DCYA 2D98A 3KS7A 3R0RA 3UKVA 4LT5A 4W6WA 3OBAA 3VDBA 5J3UA 1WW6A 1L7QA 1KFXL 1O7FA 1S0JA 1CAXB 4RGAA 5F37A 2ADEA 1R092 1F31A 5D1IA 1IGOA 2DUQA 5L73A 2UYBA 3NNGA 1QJY2 3KT7A 3ZR5A 5A6XA 2XUEA 2DBIA 2J1EA 2OW4A 1ZZBA 3HWJA 3JB4C 4CXWA 2Q1FA 1JYXA 1YJLA 5FK8A 1FOD1 2WLQA 2BBVA 3AFGA 3GJAA 5FZ6A 2P1BA 5FMOL 3T09A 4A44A 5BNOB 4YG6A 1JHNA 2Y64A 2LS6A 2XJTA 1HLCA 2WNUA 2QQLA 2XPJA 4CDWB 2JDPA 5FREA 4BIOA 3U4XA 2X5IC 3TN91 2JE7A 2Z42A 3ETPA 2HWB1 3S5AA 2X09A 3LFMA 5FDBA 3MV11 2XB6C 4LBOA 2FBEA 3MBWA 3ZN5A 2VOXA 4FPCA 3ON7A 2ZZQA 4Y33A 3ZFFC 4XJ9A 5LASA 1BJQA 2WFF2 4XHBA 4KBBA 4B3NA 3FLPA 4YVSA 2EXJA 5J48A 4JTOA 4XMIA 3SH4A 3HNYM 4XF9A 4AI8A 1ZX5A 1PHMA 1RC6A 1OT5A 4RS5C 1EY2A 2EF6A 2RJ2A 4WM7B 4EYUA 1XYOA 4BOWA 4ET7A 1VP6A 4H14A 5L7OC 4QQ2A 1DGRA 2EAAA 5JOYA 4KBZA 1TZOA 2OZ6A 2KXLA 3JQXA 3WF0A 3HJRA 2JIGA 3PMSA 4LBQB 1AYM2 1OF3A 4ISQA 4A45A 5FZGA 1KEXA 1YFYA 2HEVF 2QBXA 5CB7A 4OVEA 4W4ZA 5JIAA 1S0IA 1RUOA 1CZTA 1NYWA 3GNEA 4KWJA 1QJX2 2XL9A 4P9XA 2YU2A 2OIIA 2BU9A 2NYYA 4W6XA 1S0DA 4K9SA 2YGMA 3HIFA 3Q8AA 4E4DX 5DUXA 2P6HA 1AR62 2DDUA 1CAXA 1HN1A 2XQXA 1EUUA 4LIUA 1OLRA 4Y5Z0 5K0UB 2XJUA 5GLWA 4AI2A 3AMNA 3KF3A 2VOWA 4LO6B 1B35A 1DBNA 3ZYJB 2YMZA 3I2IA 2R071 2BNNA 4XACA 4Q8KA 1X8EA 4HK8A 2ZGPA 1ASJ1 1DGLA 1J83A 1QH6A 1W6PB 1LCLA 2VM9A 3AMHA 4Q4W2 4BPZA 1OUXA 3PJYA 4QX0A 3THTA 5BNOA 3CDZB 3CL1A 4XIKA 2BERA 3ZOIA 5KHJA 2JXAA 2FHRA 5BUVA 3FLTA 1PK6B 1HB2A 4NHKA 4CDWA 3SH5A 3E6DA 1GR3A 4JV4A 1H6YA 1S0BA 4JGYC 3S7IA 5FYZA 3VKMA 3B69A 4PDWB 4AI0A 3TEWA 4LE4A 5FXZA 1QNYA 5FR3A 3E5UA 1RL3A 5IW0A 2WN2A 2WS91 1KGYA 4OI2A 1AR71 2BWCA 2XLGA 4EQVA 2I45A 1ND3B 5BY5A 4FCAA 3SEEA 3O1RA 4K6BA 5FTTC 3OGJA 1TE1B 2VTXA 2W46A 1J3QA 4DPNA 4ZU5A 4XFGA 2HJIA 4BIFA 1CONA 1M4WA 3N3HA 1XNKA 1AYN3 4K3UA 2HWC2 1RGSA 3E97A 3AMPA 4QDSA 2PHRA 5HXVA 3DYOA 1ZVFA 3J4UH 1R083 4PF5A 1Q5OA 4CDXC 2XLFA 4BU2A 4CRQA 4LHSA 4AVVA 4K1ZA 4AFAA 1AR81 4KMQA 4YRDA 2RDQA 4XBQA 4Q26A 4AVCA 3AP9A 2WN3A 1UAIA 3GCXA 4IV1B 1N3PA 4GMP1 4COVA 2MHFA 2HH9A 4XBLA 2VZRA 3ME2A 1JH5A 3KVBA 1JXNA 1LR5A 4LHNA 5FY4A 3TEZA 4MADA 3VDAA 4D69A 1OI6A 2FDIA 4BQXA 4XW3A 1AR92 1SHWB 3NJXA 3T2QA 5K0UA 1ULEA 3IT8A 3ZO0B 4AVSA 1WUVA 1LGNA 1A8MA 2VQTA 5T55A 1DDLA 1S4CA 2XHNA 5DG1A 2WLPA 1DQ5A 1I3HA 1SDDB 3K3NA 4GD4A 3T4VA 1HRV1 1O59A 2A7AA 1ENRA 2C4XA 1IKQA 3KD4A 1W6PA 3RMYA 4OMDA 2AC1A 4YW2A 3USUB 3EBRA 3VBSB 1C1FA 5DZEA 1NCQA 2BP6A 4LOTA 5FXWA 1FOD3 2JD9A 4TYSA 5C8CB 2JB4A 3HQXA 1C28A 1W8ZA 4X6QB 5LRSA 1MPXA 5H9SA 1WLTA 4CU6A 4NO4A 4EZ4A 4NAMA 4NHMA 1YRZA 1UYZA 1GOGA 2K2SA 4J1XA 4PDWA 3T1MA 2BPA2 1BK1A 1QHDA 4XJZA 4QGNA 1CAUB 1YWKA 1JMUB 2WKKA 5EYXA 3QOPA 2VZSA 4X8PA 3RI8A 3VBHB 1JZ8A 2QVSB 5FWEA 1W9FA 4IEUA 1GU3A 2C9AA 2WNUC 3AZZA 5CFDA 5FZOB 2EALA 2R041 4QB2A 5A1FA 3CZJA 3FUQA 1JI6A 4UFIA 2VBPA 3RFRA 1UU6A 2YBKA 4GQ7A 1FATA 1UXZA 3WD5A 2WZ8A 2QFEA 3KV9A 5F5IA 3NV3A 1Y7BA 3QBQA 1RUJ2 1EAH1 1W6MB 3HBZA 3N7MA 4BQYA 1ULCA 2XGXA 1ND2A 4MGKE 2ZGQA 5AFBA 3VHRA 3H3LA 3T3YA 4YVSC 4YW6A 5FP4A 2XMLA 3FE5A 2WQ4A 3Q8EA 5FP8A 5HCBA 2YYOA 4PF1A 4DRRA 3C8XA 3B93A 4IV1A 1QF3A 3OGVA 5J7MA 5FZ4A 4NPMA 3SKJE 3BOWA 3U14A 1UU4A 1ZZ9A 2VOKA 1H6XA 5IAXA 3M3CA 4TZDA 4M3CF 2HWE1 5FZ1A 2W1UA 3OTFA 3PJQA 5CFCB 1AYN2 2A3XA 1T6GC 2I2SA 4K40A 2CDOA 4Q5OA 2HLEA 2A3YA 2G4IA 2J1AA 2JKBA 2P3KA 3IB3A 4UI9L 4GJZA 2G9FA 2RMU1 2K9ZA 2WT2A 1UY2A 5EQUA 1IKPA 4ZPIA 2P3JA 3BTAA 4B7KA 5ACA3 5CBLA 4RA0A 1W9SA 2DVGA 4XDPA 1F35A 3PUSA 5DAWA 4YPJA 5IVFA 4F3JA 1S2KA 2JG8A 4IUGA 5FMOS 1G86A 5JSPA 2OA2A 2FDFA 2YPJA 2R073 2ZGMA 1LGBA 3VBSA 1BMV1 4PIZA 4YZ4A 1LULA 3W21A 5C8CA 4XHXA 1VALA 1B35C 5D2AA 2D97A 4CCKA 5IVEA 5L9BA 5IAVA 3D82A 3GZAA 1V6KA 2NZ9A 4HG6B 2NQYA 2VMIA 5A3UA 1VBA1 3O12A 3E1F1 3W20A 1G9DA 4ASKA 3U11A 1CZVA 4EROA 1PO22 4NWWA 2QQIA 3OEBA 1CAUA 3GBWA 5BNOC 1I9RA 3LSEA 1W2AX 4FFIA 1WKYA 3VBHA 3JBG2 4Q1RA 3PUIA 5FZOA 3BTXA 1D4M1 4CDWC 3NNMA 1CX4A 1EV12 4AWDA 2D40A 3U07A 3K46A 2D3RA 1O3QA 1F4HA 2D6PA 2WS93 4H7LA 2RDNA 1AR73 4RR3B 1PGL1 2NMOA 3EHKA 5BNNB 1FOD2 1W6MA 2X29A 2DBNA 5FP9A 1PZ9A 4O65A 1M06G 2R32A 3UESA 2G9GA 4K20A 1NY72 2P6CA 4GA9A 1GKBA 4QXCA 2QQPA 3UV9A 1O6UA 4DXTA 3MF6A 4A7ZA 5A1AA 2HWF1 4E9KA 4NHLA 1NZIA 5F6KA 3POYA 1LHNA 3UT0A 1W2NA 2MPFA 3VHNA 2LUWA 4QPGA 4WM7C 3IMMA 1L7LA 4MGSA 4CCOA 4IE4A 1X9TA 3R4UA 2CWSA 1AR83 2BFUL 2OZJA 2BGPA 4JC1A 4ZKTB 1US2A 1BXHA 1W2UA 3GZTB 3LDBA 1LAJA 5CFCA 4K7JA 3T0BA 2XONA 5BNQA 1NX9A 1KS5A 3N9OA 4GMP3 3NV4A 4TLGA 4XFCA 3WEZA 1DFQA 4AI9A 4D94A 3SXWA 4RQPB 5KXEA 1AXYA 2ES3A 3G6JB 3HR9A 3H1YA 1URXA 1UMIA 3RYKA 3VKOA 4RGGA 5F5CA 5A7NA 4AK3A 1CPNA 5J96B 2WSVA 2WBKA 3QH7A 3JUUA 1V6JA 3HOBA 3RRDA 3M3EA 1YQCA 2ET1A 5K0UC 3A0KA 3ZYBA 2GH8A 4X6RB 2VQUA 4QU2A 5FPAA 2ZHNA 1HRV3 5H9PA 2ILMA 4LEJA 1JUIA 1LODA 1Z7S2 3DEMA 3BOPA 2BNOA 3TNQA 3V65A 4NE9A 1MS5A 1HB4A 4L0PA 3WNMA 4A2UA 4DIQA 1TQ5A 2JE8A 2EIDA 5GZFA 3AK0A 1W9YA 1NCQC 4UF0A 1VRH1 2E7QA 2LTNA 3WG4A 4EZHA 3TEXA 1JZ4A 1IQAA 2JG9B 4XVHA 5ACA2 4P5YA 5FZ7A 2MEV1 4ZZ8A 3B94A 4KGQA 2IVIB 4PDWC 1ZREA 1Q8SA 2BW8A 5T52A 4RR3A 4E2QA 2JJ6A 2YPDA 4ISRA 3WHUA 1R1ZA 1OA4A 1S2BA 2R043 4DRVA 1LHVA 4QXHA 2RS12 1OBNA 1NLQA 4OUSA 1ND3C 4IEWA 5CFDC 2VCCA 4C91A 1HB1A 2GAUA 4DZGA 3O1VA 1UX6A 1EAH3 2GC0A 4OI4A 3OB8A 2YHJA 4BH9A 2PLV1 4AQ2A 3J9SA 1BVVA 4Y5TA 2P34A 5EFUA 3SCGA 2Y6GA 1SFYA 1H8TB 3OBZA 4QGLA 1ND2C 2DVAA 2Q30A 3PUQA 3MIEA 4UFLA 2O1QA 4CP2A 5C70A 5HBAA 1SG3A 4XUOA 5FY0A 3HEIA 2DUOA 5L9RA 4SBVA 4BK4A 1MZEA 3ASIA 4E4HA 5JVVA 4HMZA 1O8PA 3OUIA 4IV1C 1R091 2HWE3 4URTA 1KJLA 4XUNA 1X8MA 5TSWA 1XRUA 2WQ8A 1QJY1 3FC0A 5E1RA 3IAQA 5KHIA 1ZNPA 2CYFA 3N9NA 4DXRA 5T50A 5FK7A 1O5LA 1X7NA 3ZXLA 1UOFA 1UZ0A 4CEYB 3C2UA 3ZFEB 1POV1 1VRBA 2BVBA 3EMRA 4P14A 4E2SA 3AYDA 4XFBA 3I3BA 2GNTA 4YW5A 2E32A 3IIIA 5GLTA 3WHTA 3IIAA 5FKCA 2YGLA 5EPAA 5IK8A 4QX3A 4CCCA 2JG8C 5F3CA 1V9U2 3S0MA 1RXFA 1W0OA 3VBSC 5AC91 5C3PA 2WWJA 2PA7A 5C8CC 1VBA3 3ZIXA 2BOIA 3WDXA 2BTVC 4G4FA 3DCQA 2WFF1 1VMHA 3I3EA 1FV3A 2MNGA 3E5XA 2VOTA 3JQWA 1GOFA 1GNHA 5FZHA 1D4M3 4CE8A 1VBD3 2VE1A 3VBHC 2CGOA 2X5IB 3GHMA 1JOJA 1U5YA 4JHZA 3I59A 2O8QA 4HFSA 1W6OB 4PI0A 4HOOA 5GLUA 4MXWB 2OT7A 3ZN6B 1GZTA 2H6BA 3J26N 1AYM1 1SLTA 1PM4A 2JX9A 3TRSB 5FZ0A 3ORJA 2A6WA 1QOSA 4YGCA 2E33A 2WAOA 3FHQA 3ZFFB 1XYNA 2W95A 4IL7A 5B4NA 1QJX1 2QZ2A 1YFXA 2W1QA 4RS5B 4BB3A 1W6NA 4ES8A 4QXBA 3NL1A 2QQMA 1AR61 2JDUA 1ZA7A 2ZACA 3PL0A 2ZGOA 4XQDA 1RUI3 1POQA 1XNTA 2R042 4NPLA 4FOVA 3WX5A 1GQHA 5DDJ2 1AHSA 4NMIA 1VPHA 1EP0A 1H30A 1PMJX 4YW7A 2BBAA 4AW7A 2UWCA 1YFUA 5FWJA 2ZAHA 2H0BA 4CEYA 3HNMA 5CFCC 3I97A 3ZFEA 5G05L 4AG4A 1ENXA 2FDKA 3OD4A 1A8DA 2W39A 4C90A 4Q4W1 4K1YA 4Q2FA 4L99A 1WMEA 1MVEA 2EIBA 2J22A 3JU9A 3WY6A 1RUD2 2ADDA 2G9ZA 5CKNA 1K42A 4UFMA 1R1A2 3K4DA 4YGDA 5FLHA 1HJGA 4JZRA 2QQVA 2R49A 1UX7A 1OH4A 2B8MA 4IE6A 1DQ0A 4Y26A 2ZGNA 3D4KA 4YZ3A 4ZS3A 4YZ2A 1VE0A 4OQ9A 2JENA 3MZHA 4XCAA 1PX3A 4OFGA 4E2GA 2FQPA 4XFAA 4P5HA 1REFA 4ITCA 1NCRA 4V1PA 4QKBA 3I2GA 4FSJA 2OXBA 2ZX3A 3PUAA 4COYA 4JQTA 4FAGA 1UIJA 2W1WA 2D6KA 1ENQA 3P5BA 4AQSA 1YI9A 3I2KA 2HWC1 2ZGUA 1E5HA 1VAVA 5EYYA 4DXSA 1MZ5A 2XJPA 5JMCA 4XILA 4LULA 4ARXA 1W6OA 3CU7A 5F6LB 2ZGKA 3AXEA 4FTBA 5CU1A 3H8RA 1UY0A 3I4IA 1BMV2 4FVVA 3ZN6A 4LQRA 5K7PA 2XBO3 4P02B 3BTYA 1BEV3 3AB0A 4RR3C 5FPLA 1HX6A 4AHWA 2VTXJ 2GNBA 3MPBA 4CU7A 3CJIB 1H1MA 1WBLA 1ZYBA 2BFUS 4H3WA 4KNCA 4UT5A 5JUVA 2R16A 4CVUA 2PLV3 4R8HA 5ANQA 2YB7A 3FLRA 5IJRA 1VBD2 3GF6A 1AR91 2YBSA 4CDXB 4FOWA 1NT0A 4HANA 2AH2A 2VCMA 2VW0A 4INDA 3O5SA 3GHNA 2B46X 2HBUA 1HJFA 1J1TA 2GALA 3UGHA 3K48A 1FNZA 3MIFA 1RUH2 1F8VA 2SLIA 1R093 3FX3A 5A7OA 5IK7A 2JDHA 1QJY3 2A70A 2Y6KA 3CO2A 3LAGA 5A32B 3TNPB 1W8UA 2PAKA 2WL1A 4MOAA 5FMDA 1E57A 3NSTA 2QNKA 1OH3A 4XDOA 4HLTA 1ZZCA 1POV3 1CPMA 2YC4A 4J6GA 5FRAA 5FYYA 5B4XA 2D43A 2JDKA 3LPFA 1H1AA 3M3OA 3R05A 5FZLA 1SLLA 1RUI2 1WD4A 2C6SA 1YCIA 2YDEA 5D8AB 3AYAA 4HSLA 2WFPA 5BNPA 2UWBA 3VZNA 1SACA 3BCWA 2ENRA 1Y3TA 4ARYA 5JOXA 3LOBA 3B9IA 2D7FA 4AI3A 4JDOA 1FX5A 5FY1A 3ZMOA 1SCRA 2DF7A 5AC93 4RHV3 1IZ3A 2EXKA 4JX0A 2F6BA 1JYTA 1KRIA 1HDKA 2HWD2 4GWNA 5FOJB 4HSJA 4BDVB 2ARCA 1AX2A 3I3DA 3GGLA 4IGPA 1RUJ1 2V5DA 2WFF3 1RMU2 3MW3A 1H1IA 3K3OA 1NG0A 5SV5A 1XSRA 1Y43B 5FUIA 5CG9A 2OYZA 5IK5A 3B7MA 2WNUB 4XIOA 1TEIA 3ILRA 2DCZA 2PHTA 3CJIA 4JKLA 1GWKA 1GSLA 4YFWA 1DQ4A 3ZYIB 4XETA 1RUE3 2CL2A 4LKDA 1ULOA 1DF0A 2CSGA 2W47A 1NOVA 2W2IA 2OS2A 1AYN1 1ACCA 2QDNA 3SH3A 1QJX3 4P00B 5KXDA 4LUMA 2VW1A 2QKDA 4NIHA 3HAGA 1H8TC 1U0AA 3U1XA 4UWDA 2ZEZA 1AR63 3CKHA 2XBO2 3EJKA 5JXGA 1BEV2 4AHXA 4DS0A 1P8JA 2PHLA 3W5NA 4WZCA 1NZCA 1UOBA 5IVVA 1CESA 4P9YA 1C1LA 3JCIA 1SZBA 2WA3A 2Q8DA 2WA4A 1QJU2 1UIKA 3H9AA 1SQ4A 3LEIA 5GZEA 3MLKA 2PLV2 3ZKYA 1O4TA 5FZDA 4MX3A 4Q4W3 4NHXA 4CEYC 4IV3A 5FFOC 3VBUA 3ZFEC 3JZVA 4Y1UA 1UD1A 2B9UA 5IWFA 1QXRA 3RZMA 1OF4A 1PO21 2VQ0A 1NXMA 5D8AA 3UJQA 5DZFA 1PIV2 5A3TA 3CIHA 3ZDVA 3AJZA 1IPKA 1DQ1A 3MUZ1 4QQOA 2B9VA 1IS5A 1F5JA 2V5YA 3JBG1 5DQ0A 1A34A 5DUUA 3J8F1 5F1RA 1JW6A 3L2HA 1EV11 4FPLA 4DY3A 5HPOA 3NVCA 3K4AA 1WD3A 3ZSEA 1B35B 1UKGA 5I0RA 3MGUA 4E4SA 2F4PA 3NKTA 3J7NA 4OYUA 2OKXA 4DMIA 2ARAA 2VL4A 2UY9A 4MSVA 1NY71 2DCKA 4QGMA 5F2SA 2HWC3 2XHKA 1QOTA 2C1FA 3BIWE 3ZYPA 4DUXA 4A7YA 2DTYA 2F17A 1C8M3 1MQTB 1LB2A 4I30A 5FP3A 3N9PA 1OQDA 3I49A 4QPYA 1ALYA 1WMDA 4COUA 2QTWB 1SLBA 4HL0A 5AC92 4RHV2 3B3QE 4N7IA 4DQAA 5C3QA 1AL0G 4QKDA 4LXLA 4LO5B 2W0XA 1O5UA 2EVXA 4ORFA 5I93A 2XUMA 1WMXA 3VLBB 1UQXA 3H7YA 4RL7A 1UZZA 4IGQA 5DMYA 2Q8EA 4LR4A 4UFHA 4CP0A 4H7MA 2W3JA 5I0DA 4BQ2A 4N90A 2DURA 4IEXA 1AR93 1YQ6A 3PTRB 4NIAA 1HXS3 4MV2A 2DVFA 1JZ7A 1JYWA 2ZA9A 5IT6A 4JQRA 3WW3A 1GP4A 2A3WA 4GIQA 2VMGA 4I2OA 2Y26A 3M3IA 2HKXA 4B1LA 1VBC3 4CSWA 5KXCA 4XABA 1RUE2 2DUPA 3AM2A 2D5FA 1OVSA 2JE9A 5DN2A 3PMEA 4CDUA 3P3PA 1Z7S1 1V6OA 2TEPA 4CZSA 1HQWA 5T3NA 1BZWA 2A75A 5FZ8A 3C3VA 1ULFA 1F9KA 3NNLA 1XNCA 3OPWA 5FAXA 4IDZA 1G9CA 2ZGLA 1NXD1 3T4HB 2GC1A 5ACA1 3DPRB 2OQ7A 2WO2A 3OY8B 1RTVA 1F4AA 1YFWA 5FZ3A 4NRQA 1VLNA 3ALQA 5FLJA 1PGW2 5FYUA 3UJOA 5A6ZA 4FPOB 2RS11 4M4PA 3DKQA 4BXFA 3W58A 4XTPA 1NLSA 3O0XA 3CZUA 1ZRFA 5JSRA 1NCQB 4Q29A 3M4FA 1RUJ3 1I5PA 3PVEA 5CYYA 2R1DA 1Q56A 4XFFA 4BYYA 4NIDA 2WO7A 2DCJA 3W5MA 1UU5A 4RFT0 1MQTA 5A7WA 1AVBA 2ZS6B 5BV6A 1K3IA 3DL3A 3KSCA 4LBMA 2XG3A 3EYPA 4AXOA 2IC1A 4KI5M 3T2TA 4DUWA 5JPNB 2IXHA 2ZOEB 1XNAA 1IPJA 4W6YA 3G7DA 3LWCA 2R1BA 4HKOA 4B4RA 1U5ZA 1JODA 5CFDB 5FZEA 4QAWA 1GV9A 1OA3A 1YQ2A 4XFHA 3PVBB 2ZMLA 4CUAA 1NQJA 1KS4A 4U2AA 2WR9A 3CJIC 1S55A 4FXKB 4E27A 4LBNA 1N1VA 5A3LA 1RVF2 2FDGA 4QWNA 1UMHA 3ITQA 3UGFA 3M2MA 2WRAA 4AEDB 3O1TA 5AVAA 3T1LA 3MFAA 3UKTA 2VJXA 1HN0A 4NAOA 1DCSA 5DAQA 2ZZJA 1C8M2 4QX5A 1KITA 2GN7A 3I3MA 1CGPA 1ND2B 1WCDJ 3KQRA 4ZY9A 3LPGA 2P5BA 2JDZA 1ZZ6A 1VMJA 1GYKA 1S0GA 4XTMA 4AGRA 4AQTA 3O1SA 2JEMA 5CVRA 3H1WA 5FO7B 3WCSA 3ETQA 1MS4A 3LA3A 1SMVA 4OHZA 4A6OA 2OPWA 4NR1A 4GB33 4IESA 5LK5A 3TB0A 3N36A 3VUOA 5A7PA 4AVAA 1V9U1 1DZQA 4IXLA 2GZWA 4YM3A 1ULDA 2VNVA 1Q8PA 5HV0A 3ST7A 2X10A 2HYKA 4OHVA 4AFDA 3DPRA 1NA1A 4HN0A 5D21A 3SHRA 1PO23 1HXS2 1FT9A 1SBEA 3ZSLA 3MIDA 1MS8A 1E5SA 3KQ4B 2ARBA 3POEA 3OY8A 4HT1T 3WG1A 3ZXAC 3V0AB 3OGRA 2BOJA 4HVRA 5EXOA 4M3CB 5FYMA 3ZPYA 3JBG3 1GP6A 4K21A 1OMIA 3NNFA 5D8AC 3VD7A 4AEMA 3S57A 3J8F3 1VBC2 2IXCA 3LIHA 1YO8A 2QDRA 3E5QA 1NUKA 3M8LA 1EV13 2BRTA 2BNMA 4PBOA 4J25A 5JZGA 2PMWB 2JG8B 4LO4B 1AX1A 4XQWA 5IFTA 3F2ZA 4Y1XA 3HN3A 1I6XA 3WG3A 2VMEA 4V2WA 2JD4A 2VXJA 1PNFA 4CCDA 1RITA 1XE7A 1MS9A 1OLMA 3OYWB 4PQ9A 3ILFA 4DB5A 4RYDA 2JDNA 3POBA 4BMEA 5KHGA 3KV5A 3LCPA 3CNAA 3A23A 1KXGA 3U75A 3GDBA 4N53B 2OVUA 1YHFA 5J36A 2D44A 2IFWA 1NE4A 2FCVA 5C4WA 4D7YA 1WBFA 4XXPA 5APAA 1L3JA 3SMHA 3LQCA 5DDJ1 1YQ5A 5FYBA 5KXBA 4AEDA 5I0TA 4YVWA 3CMGA 4JKMA 3KLSA 2CV6A 3BN6A 4OUEA 1TG7A 3ZYFA 2WJSA 4AOCA 4EN0A 3N9MA 1BBT3 3QACA 4ATEA 2XWJB 1PGSA 4QDRA 2Q0AA 1RUD1 4MGYE 3R4SA 5EV7A 1HIXA 1R1A1 4R9BA 1HRI2 5T5PA 1N3QA 3VL8A 4QPGB 3AL5A 1DU3D 4YW4A 1J3RA 2UURA 1XE0A 4WVWA 3VZOA 3IDAA 4QXKA 1YUDA 4Y5SA 3DKWA 3ZXGA 4Z92B 4K8FA 1JU4A 4FAHA 5I0SA 1Z7S3 1H0BA 2WIIB 4Z07A 1JYCA 3VL9A 3DV8A 4OCTA 1LEMA 3V0AA 3MHZA 3KV4A 4GWMA 4PLNA 4M3CA 4TN7A 1C4RA 4XC9A 3IDCB 2NMNA 4N43B 5BPXA 5CIRA 1H2LA 1C5IA 1X36A 2FCTA 5EJ3A 4ZXKA 3Q9OA 2Z4FA 1LESA 3BYWA 4UYBA 3T2PA 3DECA 3THCA 4GB32 2PN5A 4BLIA 2AR6A 3ZXEA 2RS13 3UK9A 2AZ5A 2AUYA 2UU8A 4YZ1A 1JHJA 2DCTA 3OYWA 5JXJA 1QXJA 4WM8A 1UW8A 1WCKA 1VIWB 2E7TA 3N35A 3PTYA 4EWAA 1O4ZA 4N53A 3EO6A 4XMAA 4YGEA 4D6RA 1GLHA 4UF0B 1QH7A 1JS9A 2R0FA 2VG9A 2ZEYA 3WLUA 4ASLA 1VBD1 3J8F2 1A6CA 1MQTC 2YV8A 1AXZA 4Z82A 5FZBA 5K9YA 1J59A 4P9JA 3WVJA 1BCXA 1YEWA 2VECA 2EIGA 3CEWA 3NJZA 2C26A 1U5XA 3BODA 3SNMA 4XJWA 4UFJA 3A0NA 3J7MA 2A6YA 1RUH1 3LEGA 4QB1A 4Z2AA 2J42A 3MLJA 5FYIA 4Y22B 1ZRCA 2E26A 4F7ZA 2J1SA 3KM5A 4GAZA 1JZ6A 3D0JA 4OI1A 1RXGA 2VNGA 4JAAA 2Q1ZB 3AJYA 4MZUA 4YW3A 4AZZA 3RVHA 2P37A 1RUI1 2I07B 1PVXA 3WDYA 3WF1A 4HKLA 5CNAA 3AVRA 4JGZA 5EWSA 5BXXA 3ACGA 5T5JA 1OQEA 4MHUA 4IE7A 1MR5A 3WF3A 1JZ3A 2WDBA 1JTZX 3Q8FA 1V9U3 2PHFA 1CIYA 1H2MA 1QKQA 2Q1MA 3AKPA 1BBT2 5DG2A 1MEC2 2HWD1 1OPMA 2RR12 4H2AA 2XVKA 1D4VB 2DVDA 5LBBA 4N43A 2QQKA 5LA9A 1RMU1 5CKQA 5C3SA 4LHKA 3DPRC 1DP0A 1DGWA 1LU2A 1NA1C 5A7SA 4V2VA 3WG2A 3ZDSA 1Z0HA 1CZSA 5FPZA 2JDMA 4AGGA 3KHCA 5FY8A 2GH2A 2GMMA 4K8RB 3IMNA 2WWUA 3OPZA 1X33A 1PM7A 1N1TA 2ATFA 2GNDA 1AJOA 3ES4A 4A41A 5JZGC 5CG8A 2VZTA 3WNXA 4WZFA 1XXNA 4AE2A 4CP9A 2R063 2RDSA 4KG0A 2D3SA 4XF0A 5E6HA 3H3ZA 3NQHA 4G3YC 4N9IA 1COV1 3H1MA 5JPMB 2QQJA 3GZEA 2R6QA 3NV2A 3JXSA 4PBPA 2PELA 4XZPA 3ROUA 3SKVA 1NE6A 1QMJA 2WT1A 4QT6A 4EJRA 3WUCA 4Y1VA 1I5ZA 1UY1A 1PVC3 2XBO1 4YM1A 5LA2A 1BEV1 4CPBD 3I59B 4Y22A 5DDJ3 3WR0A 2GDFA 1FAYA 3VB9A 3RYPA 5FPXA 1VAKA 5K8SA 5FCCA 2ZMNA 1QJU1 1IQDC 3LF7A 4AEDC 3UKNA 5JI9A 4QKNA 4YVWC 4RD7A 5ANNA 3ZYHA 2BEOA 3I54A 4GZ9A 4CDQA 5C3RA 2CAUA 1UYPA 2N7GA 4C8DA 1UWWA 1RUD3 2CY6A 1R1A3 1RB8G 1UY4A 1QQP3 1D2QA 2WNVB 3RS6A 1PIV1 1W6NB 1RUF2 2E31A 3BU0A 1FI2A 2VCBA 5HXMA 3KF5A 4QX7A 5JR7B 2JECA 5JCTA 5ERLA 2VVEA 4Y20B 4EN7B 4R9CA 4M00A 1JYVA 3N7LA 4MGIE 1ODMA 2A6VA 3EXUA 1H8VA 4ZXEA 1LGCA 5JR2A 3BIEA 2KM2A 4W50A 2IVJA 5GZCA 1RUG2 3WNOA 1OHFA 5IYYA 4MGTA 3RQ0A 1JUHA 5FJHA 1PMIA 3KGLA 3LDKA 4UW4A 3X29B 2V4VA 1Z78A 3MI8A 3DXUA 1O3RA 4CUBA 1NKGA 4FI9A 2TBVA 5C7GA 2VH9A 2W52A 1GP5A 1SLIA 2XXZA 4HONA 3SCFA 3S6PA 1WZXA 3WT3A 4OHXA 3OUJA 4QM9A 2W08A 4RHV1 5G04L 1AXKA 1NCRB 2JWPA 3BGAA 4YM0A 3PUHA 5F8PA 1LRHA 3ZFGA 5DZGA 1Q8OA 4LKFA 1VBB2 4WM8C 1TMF3 1R64A 4GALA 3I3QA 5E16A 4XCBA 5FZKA 3FN9A 3SITA 1CJPA 3AKTA 4N53C 3W59A 2Y0OA 1Y9MA 3C7HA 5L9VA 4AI1A 2ZCWA 4WV8A 3WDVA 3O1UA 3ZX7A 2ARXA 4LOSA 1Y4WA 4GKYA 4R4XA 4LBKA 3ACFA 2Y38A 3H3UA 2ZX0A 1N3OA 1W2TA 5L36A 2Z69A 1Q43A 2PXJA 3MUY1 4I3PA 4Q4X3 1RUH3 5IFPA 4EN9B 3AP6A 3RZGA 3MF9A 2DWRA 1RUE1 4N8MA 5L19A 1UNBA 2VC9A 2R062 5A6YA 3LEMA 4BA6A 4O61A 3IDBB 5HCHA 2R30A 3DYPA 2YG0A 2WNVA 3EQEA 1C3HA 2PHDA 3MDPA 1T6BX 3N9LA 5CEHA 3RJRA 1PVC2 1G9AA 4BLJA 3POSA 5CISA 2ZAAA 4QPGC 3MIHA 5GM0A 4Y20A 4JCKA 2EXIA 4PLOA 2IXJA 2QE3A 4XF3A 5J1XA 4NROA 2FDHA 3WINE 3ACHA 2WYSA 3C7OA 1PGW1 2E63A 3WQ1A 3RZLA 4YLZA 4UFKA 1DIWA 5GALA 2P3IA 1HW5A 3USSA 4PHZA 1KFUL 3FHAA 4A4AA 5CKMA 3BUCA 1N1YA 4FPJA 4FP2A 1HQNA 1HB3A 1ODNA 3K75B 1FV2A 1XJAA 2HWD3 3NRUA 4QDQA 5FUPA 1RUC2 2KA3A 1DLCA 1HV1A 3O1MA 4BQ5A 3WF2A 5H9QA 1QQP2 2JIJA 1RMU3 1W90A 3IM0A 4LLFA 1W28A 2RS33 4N43C 3H0OA 2BQPA 3P6BA 4BZ4A 2BDRA 2CNAA 1QJFA 1RHI2 1IS4A 1XPWA 1VR3A 3WUDA 2KD7A 4LK6A 2RV9A 1LKNA 2JDAA 4GKXA 5BNPB 4NIIA 3V0BB 4E8DA 2Y60A 3N4MA 2Z5WA 4L92A 4J1WA 1HV0A 4LBQD 1FMD2 2A5ZA 2VBDA 5FZMA 4ZU7A 3KV6A 1RVF1 4DEVA 4UW5A 2H6CA 4S2HA 1J1LA 3KCCA 1COV3 1CN1A 3S5QA 3CQOA 1C8M1 2CGNA 3GM8A 3N7KA 4LMFA 3DN7A 2FMDA 3U10A 3WW2A 1AJKA 3VDDB 1W8OA 3AKQA 5FMCA 5F32A 3TYJA 2C0ZA 3CF6E 4D7TA 4Y1ZA 5GLVA 2ZEXA 5EHDA 5IUQA 1CD3G 1WWYA 3AMMA 3VZJA 2A73B 2NN8A 1GOHA 1QJU3 2J7MA 5F39A 1TMF2 1XNBA 5FZAA 3H7JA 3L9JT 2VBBA 1W2OA 1WMFA 3EB7A 3IAPA 4XPVA 1US3A 2OX0A 1U12A 2X53S 4XFIA 1WA4A 4IEYA 4CEWB 2DU1A 4Z8BA 1QWRA 2VD7A 1WCQA 5C5TA 1ZBA2 5M0TA 1HXS1 4CDQC 3AMQA 4AHYA 3J7LA 1PIV3 3AC0A 1XC6A 2WWSA 2L9LA 4GULA 2PHWA 4Q4X2 3VKLA 1VBC1 1D2SA 3UGGA 4MG2A 4XQ4A 3E6CC 4GH4A 1F2NA 4U36A 3ZIWA 4JKKA 2ZEWA 1QJEA 3KMHA 4DO0A 2BYVE 3RWNA 1K5JA 4IEOA 3DF0A 4FOYA 1LOBA 3C7EA 4UBHA 2Y6HA 3I2HA 4IV3B 1GMMA 3VBUB 3VHPA 2DFCA 1QNWA 4I0WB 3ZXJA 4BE3A 1H2NA 4IEPA 3V0BA 3P1IA 1BQPA 1G8WA 3R4DB 3BTZA 3AL6A 4FFFA 1YLLA 2ET7A 2WUHA 3WP6A 3HQUA 4KGGA 2ZPXA 4ZZ5A 5IVJA 2LALA 1Q8QA 1XYPA 4KH9A 4A3XA 4NJ4A 5IK4A 5A6QA 1AX0A 1LOGA 1LTEA 2OQ6A 4ONUA 3UNPA 1C5HA 4OI0A 3RPQA 1H9WA 4RGKA 2WABA 2VZQA 2RS32 3ATGA 3JD73 3ZSMA 2YC0A 3U4SA 3VDDA 4XUTA 3IZOA 3NJYA 2IXLA 1ENSA 3E6BA 4XE9A 4W8JA 1HRI1 5IHRA 3WDTA 1VJ2A 2SBAA 2RS53 2FDJA 4XJ8A 5SV8A 3FFQA 4CU8A 3M3QA 2VULA 2YU1A 1DLLA 1V6MA 4FPYA 5FZ9A 2D6MA 4BJ0A 2VZ1A 1WW7A 5IVYA 2ERFA 1UMZA 4QHBA 4CEWA 1W3XA 4LUKA 2ZHLA 4UW6A 5A33B 1WCUA 4OQ8A 1COV2 1J58A 1GICA 1LHOA 2YXSA 4A6SA 5LY2A 5KC6A 2AGSA 1XB9A 5FXVA 4D3WA 5E88A 4Y24A 3OD0A 4BM8A 4I0BA 5CZKA 2WNVC 5K4LA 1E5RA 1AL23 1V6IA 4GMP0 1IG0A 4TWTA 5F7UA 3PU8A 5LA1A 1VB2A 2PTMA 4Q0PA 3D5OA 3UETA 1JN2P 4FO9A 1IS6A 3BB6A 1OC1A 2XJSA 2J1UA 2W1SA 4MLOA 5FBZA 4GB31 1UZVA 2ZGRA 5T5LA 3WP3A 3CJXA 4YSFA 5A3NA 4D8MA 4FTSA 4QPIA 3I2OA 4B8EA 4LTAA 4SLIA 3WDUA 2YROA 5FIXA 4P9WA 4CDUB 1GNYA 4AL9A 2WZR2 4Q4V2 2E9QA 3Q8BA 3ZPOA 5JSOA 2ZX2A 4I02A 1IG3A 4LA3A 4RFRB 5HV4A 5CADA 1X50A 3V56A 4XEZA 1OD5A 4D6QA 4CUCA 1CWPA 1TME1 3IBMA 1FPN3 3KVAA 4JTNA 3DUIA 3TWIA 5DPNA 2Y6LA 1UPSA 3NAPB 3MIGA 4CCMA 1REDA 1CAWA 1PO13 4AFMA 4B4PA 1LHWA 2G19A 2LW8A 2P3YA 2C5DA 2RE9A 3O7OA 4E4ZA 2JKXA 1VBE2 1GUIA 1NCRC 5FYSA 1G6NA 1LECA 2Y33A 3WDWA 4CPBA 2HYXA 1RVF3 5I8SA 3VHOA 3WNLA 4F8AA 1OPOA 1WLCA 4WVMB 1YIPA 4BQ1A 1H4GA 2R7EB 3THPA 2VVDA 3BVCA 4D7SA 3RNSA 3M1HA 4LORA 4NVPA 2B5HA 2VZVA 5A7WB 4AFBA 1DG6A 1OUSA 4OHWA 2E53A 1ZZ8A 3LEKA 4XOGA 1XQNA 1QU0A 2Q8OA 3PU3A 2WINB 4L2NA 5FKBA 1HKDA 1S2EA 1S0EA 2J1VA 4XF1A 1CJDA 5FZFA 2XH6A 2J1TA 4OLLA 3PVNA 5GJ6A 3AZXA 4CCNA 4EN6B 5B2GB 5A33A 2WC2A 3IKWA 5A7QA 5DABA 5T54A 4CU9A 3TEYA 2AEZA 2HEYF 5J09A 3ZYGA 2H0VA 3K4ZA 4YW1A 4Y4YA 5E8AA 3JD72 5I91A 1BBT1 1MZ6A 2RJLA 1MEC1 1QDOA 2RR11 4NN0A 4P9GA 4NIGA 2W94A 2XKPA 4QD2A 3NV1A 2VZUA 4FQZA 4YWAA 3PIGA 2RJKA 3PNAA 1DGRN 5EZWA 4HXCA 4AAPA 3C7FA 5A70A 5JIUA 2RS52 2OUHA 1ULGA 4IE0A 2ZKNA 3PHMA 1DZRA 4BXSV 1GQPA 2VUDA 3OOXA 5CA6A 5CAZA 1YQ8A 2Q5TA 2ZTNA 3VGIA 1QOOA 2RM22 2XQRA 4DUVA 3MW4A 3KWVA 2Y6FA 4GH4C 3SLIA 1ZM1A 1FXZA 1XNDA 2ZHKA 1VAMA 4MXVA 4M0NA 1GZWB 3MLLA 1UZYA 5IVCA 1W0PA 1AL22 4UW3A 1NA1B 2C24A 2VXRA 3RYRA 3NAPA 3IWZA 4WVZA 3WOGA 3O1OA 4UAPA 5FYHA 2LROA 4HETA 5DAPA 5I0UA 2BV4A 3B9CA 3ZXFA 2W87A 5BNPC 4M4RA 2XVGA 3T0AA 1CX1A 2QQOA 2P2KA 3LIGA 5LEJA 5FY9A 4AEKA 5JZGB 2EXHA 3MICA 4JDNA 4NRMA 1SLCA 4WVMA 2VMFA 3I8TA 4QX8A 2DTWA 4QQHA 5C8WA 3VD5A 2VAUA 4QQPA 5HCFA 5A3WA 4LITA 3TBDA 1FPN2 1NLRA 5FBJA 5FUNA 4NOTA 1AF9A 3MO4A 1A3KA 1ST8A 3FBMA 4XURA 2B7YA 3ZN4A 3CLPA 1PZ8A 3GYDA 5LBFA 4Q4Y1 4COZA 1PO12 3LA2A 1MACA 3OBTA 1HRI3 3IDEA 1O3SA 2W92A 3MFCA 3VDDC 1TNFA 1W8HA 1RUF1 1IS3A 4Q27A 4XUQA 2VZOA 1O4YA 1DQ2A 5C4WB 1BYHA 4TLFA 5H9RA 3AZVA 2RDRA 4XAAA 2LRPA 5LCWL 3AVSA 4YVWB 4FPHA 4EN8B 4AFCA 4CEWC 4E8CA 1RUG1 2WNEA 1U5IA 2W68A 3B5LB 4AF9A 1UPIA 5FZIA 1GNZA 3RSJA 1GANA 2ETEA 1BK0A 4BHPA 4CUGA 4XJAA 1OOPB 4GWIA 2NP0A 3IPVB 3PDQA 4Q0QA 3HT2A 1JZ2A 5A1LA 4LNVA 1OKOA 4XXAA 4N7UA 2FD8A 3ECQA 4C0HA 1W03A 2PQQA 2YFZA 1RYYA 2W91A 1ZBE3 3BU7A 5AVPA 3VBFB 1T2XA 3TOJA 5DXDA 1GZWA 1Q3EA 4WM7A 4JVAA 4QPIC 5FYTA 2X8KA 3NJVA 2YBPA 2VVFA 1ZZ7A 2WZPP 3WNPA 4IV3C 5GZGA 5JOWA 1VBB1 3VBUC 2VQAA 3HT1A 4LBQA 1WGPA 4EWEA 1PX4A 2PHXA 1DZTA 1TME3 1W8FA 1GBGA 2W5FA 2YUEA 3BPSA 4GJYA 4JHTA 3VV1A 1SFNA 3HMYA 1GZCA 3AP4A 2B39A 1UN1A 4KL1A 4Y1YA 2XL7A 3KT1A 3VKFC 4FPGA 3WQ0A 1LOCA 3VBOB 2O0OA 2ZHMA 1UYXA 2ZGTA 5LBEA 4BQ4A 2YC2A 3PLQA 2A71A 3POIA 1F5FA 1KD7A 2RG4A 5E89A 2R061 5KR7A 1SBFA 3L2YA 4WM8B 3POFA 4CCLA 5JMOA 1MS1A 3KT4A 1EYBA 3OG2A 2E7AA 2ID4A 3M70A 4GWJA 4JRLA 2BUKA 1WLDA 3RJ2X 3DYMA 1PVC1 1UCXA 4Y4RA 4YNIA 1LENA 2CGPA 1CIWA 2IFRA 4RSUA 3RI9A 3ABZA 4B4QA 3VKNA 3LSDA 2V09A 2WAAA 2XJVA 5A3MA 3GXUA 5KBFA 1J84A 1PK6A 4FFGA 4MHRA 2DVBA 4NHYA 3ILNA 3T30A 1OVPA 2Y34A 4CYDA 2AEYA 1GWLA 1H9PA 3POWA 2BZDA 4ZONA 1MEC3 2RR13 1RUC1 3O0VA 1QEXA 5GZDA 1OOPA 2QQWA 1QQP1 3TN93 1V6NA 1WW5A 3AX4A 3IPVA 3W9AA 2HWB3 1ND3A 1LEDA 1PNGA 3GALA 4O9GA 4AVBA 1UF2C 4XBNA 3PURA 3INAA 2GP3A 4FXGB 4HBNA 1N47A 1RHI1 4MYEA 3LKJA 3LDRA 4JGZB 3AFKA 1POV0 3O0WA 1UZWA 4YGBA 3VBFA 3FFZA 5DAXA 3AP5A 4XZUG 4NUBA 4A7KA 1IHMA 3MYXA 3R6SA 4QHZA 2VMDA 3THDA 3LE0A 3VD3A 2NM1A 4CDUC 1W39A 4B29A 1FMD1 2OUJA 4D0QA 1QIQA 4DINB 3VD4A 3BKZA 2VMCA 4BQWA 5FY7A 3RGBA 1G9BA 2CWMA 1GZ9A 3FUOA 3OGGA 2PFWA 4NRPA 5IATA 1DGWX 1PMHX 3NAPC 3WZ1A 2VUAA 4A3ZA 3OF1A 4F83A 5FO9B 3VBOA 4I0AA 2WNOA 1K5MB 4MGZE 5C9AB 2B42B 1ZBE2 4IERA 3OBRA 2WO3A 4RN5A 1ZRDA 1UOGA 3MV01 1J3PA 1R082 4YZ5A 3NKGA 1APNA 2XKOA 3VBRB 4IW3A 2IXKA 1TMF1 5F3EA 4CP9B 2A6ZA 1TME2 3OEAA 4OZXA 4CCEA 5KWRA 1ZRRA 1JYNA 4AVTA 4R9DA 1ZBA1 4FPEA 5KHHA 1BKZA 1JBCA 1EUTA 2DYCA 4Q4Y3 4QX1A 3USUA 2NPIA 4OULA 1OQ1A 1QXPA 1RUF3 1LOFA 2J1RA 3I2FA 3K51A 1L7RA 1Y9GA 1ASJ3 4Q4X1 4KWLA 4FT8A 1I1EA 2ZJCA 2GP5A 1W9TA 1RUNA 2CTVA 2FMYA 4IEQA 3VZMA 3NO8A 4KQ7A 4DNYA 3QLQA 2ZABA 2GSYA 4OZOA 2BGOA 2VO5A 3SQOA 1W0NA 1DYOA 2DU0A 4QKFA 3GBGA 1RUG3 2V73A 5BYNA 5KC5A 4R52A 4C1XA 4Q1PA 1RJ8A 1LU1A 3ZVXA 3LFIA 4CDQB 1W99A 3H8UA 4DEQA 3BALA 2XJRA 3VD9A 2QZ3A 5FYVA 3N9QA 1XU1A 4Z1VA 2WZEA 3PVOA 1NAEA 3A4UA 4WBBA 4AR2A 2W9XA 3C7GA 4QX2A 2TUNA 2VOVA 4CXXA 1FNYA 1QGLA 3D6EA 3K2OA 4H55A 4N9HA 4BQ3A 3HVDA 1OKQA 1V70A 3LGRA 5A3OA 4EV0A 2FCUA 2G1MA 2XR4A 2KR2A 1YNAA 2I74A 2QQUA 1IOAA 3AP7A 4OUMA 4G9SB 2IWGB 2VZPA 3LZZA 4BK5A 1UO9A 3TN92 1VBB3 4P9LA 2FZ2A 2HWB2 3S30A 2VNRA 4AEJA 1X82A 2RS31 1YIFA 5C71A 4HK9A 4LE3A 2DFBA 2CDPA 1K5MA 3BPZA 5C9AA 3CHXA 2VUCA 1OURA 3AKRA 4PIXA 4Q0SA 5JWPA 3SC7X 3UL2A 4DOUA 2LM3A 4Z2WA 2BJSA 3VBRA 2VPVA 4FOQA 3T08A 1S0CA 4QB6A 1SBDA 2UYAA 3ZFGB 1WW4A 3FMGA 3ZSJA 4XJUA 4I3GA 4HZFA 2E6VA 4QQLA 4BMBA 4LBJA 3J7HA 3NW4A 3KGZA 4L8QA 2K0GA 3LB9A 3WP5A 3AZYA 4CA9A 2AENA 3LD8A 4XAEA 1CVNA 1X9PA 3OSDA 3D0SA 3T0DA 1JYIA 4CCJA 2EA7A 5C4WC 3OPTA 2F4LA 1HQLA 4L9BA 1QDCA 3GBFA 5LWBA 3VZLA 2DV9A 1SLAA 4GXLA 3KCXA 1UYYA 1PK6C 1OD3A 1TVGA 3U78A 4AHZA 1RUC3 1CAVB 2WZR1 3OGSA 4Q4V1 5JXIA 4META 4Q4Y2 5C3OA 3MW2A 2R072 1LOAA 1UY3A 5LRRA 2ZMKA 5BNNA 4BISA 1G7YA 1OOPC 2YZ4A 4Q0VA 1S1AA 1MZFA 1ASJ2 2XOMA 1RHI3 3WCRA 2D6LX 5J98B 1DYKA 2XLAA 1W04A 2ZXQA 3D8CA 5EJZB 1K12A 3IN9A 3AKSA 3D3AA 1FYUA 2XDVA 2XVLA 4ATFA 2R0HA 5JI7A 1AZDA 1F15A 3VBFC 1UXXX 5FPBA 1GQGA 2ZGSA 1VBE1 4NPRA 3QCWA 4NWVA 3SEPA 3WSOA 5ABJB 1FMD3 1OFNA 4I09A 3ZYRA 2YFUA 1YYNA 1UKRA 1ZA4A 3ZKUA 4IE5A 5LB6A 3AYEA 4C0BA 4LIVA 5JDBA 3U0ZA 1KDKA 1XOYA 2WS92 3A7QA 3FZ3A 1AR72 2AREA 3WNNA 3MPPG 3WXPA 5LEKA 3AXDA 3URFA 3FL7A 4FP3A 2VMHA 3BI3A 1RINA 4RQPA 4DFSA 5HI0A 4O7XA 3HD8B 1EPWA 2WYFA 2VUJA 1QJZA 3VBOC 4QU1A 1VB4A 1W8TA 4FPFA 2P4EA 4PJYA 4YM2A 3WQBA 2RMU3 1LNSA 5C6CA 1GFF2 1E5IA 5F3GA 5LATA 1XSQA 3RZJA 1AR82 4LKSA 3JD71 4XDQA 4LHLA 1OFSA 1OXCA 4OMCA 1S0FA 4AQ6A 2QCSB 5JOZA 4MGQA 1ZBA3 5LW9A 5C5UA 4LO7A 4TSVA 3H42B 5F5QA 5A80A 5JLVA 1O8SA 3MIBA 1CR7A 5IVBA 2B4KA 4W65A 2RS51 4QHOA 4YYOA 2Y0IA 4YFZA 3FHIB 3ZXKA 1LOFC 2E51A 1PZ7A 4PCRA 2CHHA 3OCPA 5FO8B 2JG9A 1SPPB 2AACA 1LOEA 2RM21 2TNFA 2QUOA 2Z2SB 1CAVA 4BWOA 1REEA 2VNOA 4B7EA 4TXWA 3S7EA 2ORXA 2ORZA 4XF4A 3FJSA 2GMPA 1W6QB 2HEWF 1HRV2 1YXWA 5F3IA 1AL21 3F95A 5FMBA 4AAXA 5HCAA 2VTFA 1OSGA 2XWBB 2IXIA 2JICA 3OJBA 1MS3A 4LBLA 1K45A 4I01A 4PQQA 4CXYA 4JGZC 1TNRA 4HPKB 4MVTA 5J37A 4FFHA 3LA7A 4UXAA 2WQZC 2PQSA 5GLZA 1H4HA 5ABJA 4LK7A 5FJKA 1H8TA 2BWAA 2HWF3 4GH4B 4AYUA 3ZMNA 2V4AA 3ZR6A 2A6XA 1KDMA 3B01A 1W06A 1XE8A 1OLME 3I2DA 2GC2A 4PT6A 5L7OB 1SDWA 3KZ4C 3RDIA 5FQ0B 2QJVA 2PAMA 1FPN1 4CTEA 3LOIA 2VCAA 4COWA 3ES1A 1V0AA 4ZHNA 4KWKA 4L11A 3M7AA 5I8TA 1EPZA 1PO11 2ZX4A 5EP9A 5FY5A 3ENRA 1WCSA 2YY1A 3WW4A 1O3TA 2JB8A 1K5MC 1EAH2 5C9AC 4IEZA 1D7PM 2CU5A 4HVQA 3NNJA 4ASMB 4ZU4A 1JU3A 4P9IA 4S2GA 3VBRC 1RJ7A 5F9TA 3WW1A 5EIYB 4M01A 5DUWA 3H8XA 4Q0UA 4JDMA 1G9FA 2C9KA 3POJA 3ELNA 3H8OA 5I8YA 4KWUA 2HWE2 5LBCA 1ZRIA 4LPLA 2PYTA 3QD6A 2P17A 5GKAC 1SPPA 2VR4A 4FPKA 3ACLA 2QQNA 4R9AA 4LKEA 2RMU2 4QM8A 2X05A 3RWKX 3AZWA 1VRH3 1W9WA 4KU8A 5F5AA 2XJQA 3APBA 1W3VA 4LO8A 4UBGA 3WQ7A 1W6QA 2X5IA 2MEV3 2UY8A 2WZR3 4JGYB 2IUWA 4Q4V3 3GCWA 3H50A 4Y3OA 2GNMA 4MXWA 5C33A 4M3CE 2EAKA 4IQPA 1BHGA 3U37A 4IGOA 3KCYA 2VZ3A 4HKWA 4UOJA 5JXHA 5FYCA 3A21A 4HPKA 3ZFFA 3VZKA 4DY5A 5BNNC 1VBA2 3QH6A 1BVP1 4XYXA 3HQRA 3T2OA 4PI2A 1YJKA 2PAEA 2WO1A 2HBTA 4LA2A 2B45X 3A22A 3WP4A 4RS5A 2A1XA 1DQ6A 3B00A 3I7DA 1UOJA 4XUPA 1VBE3 1V00A 3JB8A 2GMEA 2EICA 4QPIB 1MS0A 4PLMA 3RZKA 2GC3A 5L7OA 1D4M2 4URAA 4YARA 5FQ0A 4S2FA 3RZHA 2Y8KA 4O9EA 4YG0A 1C8NA 1D0HA 2BGCA 1D0GA 3POGA 3VDCA 1PGL2 1WA6X 1JOBA 2PHUA 2VY0A 5FZCA 3GJBA 3NWKA 5FXXA 3HPNA 3ZXDA 2Q4SA 3ZSKA 3PIJA 4B1MA 1N1SA 1W05A 3DGTA 3K77A 4CP1A 3P3NA 2WT0A 3HNBM 1CAWB 1ULPA 3MEPA 1LJ7A 1SCSA 4RQPC 2HWF2 5FV3A 2D93A 4MO3M 4P08A 2D6NA 1IPSA 4HN1A 2D6OX 4M0HA 5T5OA 3WV6A 4WVVA 4D6SA 5A3PA 3OUHA 4OHYA 1WLWA 2GU9A 4DXZA 1JOPA 5LK7B 4LLOA 3ZM8A 3ZFGC 1UL9A 3O1PA 1VMFA
chains in the Genus database with same CATH topology
2ZX1A 1OLQA 1XU2A 4QMAA 2GN3A 3N7JA 1CQ9A 2VGDA 4AGVA 4L97A 3AYCA 2NLRA 3SCHA 3VN4A 1NQDA 5AFEA 4MH0E 1H2KA 3RMXA 1KJRA 2FZ1A 2Z79A 4Q8LA 4KG8A 5DUVA 3HN1A 2RM23 2VU9A 1AUYA 1LHUA 2VW2A 4JGYA 5FOBB 1DHKB 2ZBJA 2JG9C 1DYPA 5JAXA 4IEVA 3B02A 2D5HA 3TAYA 4YG3A 1SEFA 2CAVA 4FTEA 3FBYA 2OPKA 1QY4A 1MVQA 1Y9QA 4IETA 1AYM3 2ZKLA 3O14A 2BVVA 1RIRA 2IZWA 1VRH2 2WSUA 1ZBE1 3RG0A 3GZUC 5FLIA 2RHPA 4ES9A 1B09A 1O91A 4CDXA 2MEV2 5ABJC 1YI7A 1R081 4KU7A 4HVOA 4YVSB 4MUVA 4EWDA 3V64A 4X8NA 4BCUA 4R4ZA 3RZZA 5A32A 3FWEA 1OA2A 2UWAA 4PIYA 2O8OA 3SISA 1V6LA 5KHKA 1A78A 1Q8VA 4JRAA 2AYHA 4C1WA 1ONAA 2D3PA 1C57A 1KQRA 3KB5A 4FBFA 4S2DA 4FQ4A 2DCYA 2D98A 3KS7A 3R0RA 3UKVA 4LT5A 4W6WA 5J3UA 1WW6A 1KFXL 1O7FA 1S0JA 1CAXB 4RGAA 1R092 1F31A 5D1IA 1IGOA 2DUQA 5L73A 2UYBA 1QJY2 3KT7A 2OW4A 3JB4C 1ZZBA 3HWJA 1YJLA 1FOD1 2WLQA 2BBVA 3AFGA 5FMOL 5BNOB 4YG6A 1JHNA 2XJTA 1HLCA 2WNUA 2XPJA 4CDWB 5FREA 4BIOA 3U4XA 2X5IC 3TN91 2JE7A 2Z42A 2HWB1 5FDBA 2XB6C 4LBOA 2FBEA 3ZN5A 2VOXA 4FPCA 2ZZQA 3ZFFC 4XJ9A 1BJQA 2WFF2 4XHBA 4KBBA 4B3NA 3FLPA 4YVSA 2EXJA 5J48A 4JTOA 4XMIA 3SH4A 4XF9A 4AI8A 1ZX5A 1PHMA 1RC6A 4RS5C 1EY2A 2EF6A 4WM7B 1XYOA 4BOWA 5L7OC 1VP6A 4H14A 4QQ2A 1DGRA 2EAAA 5JOYA 3JQXA 2OZ6A 2KXLA 3PMSA 4LBQB 1AYM2 4ISQA 5CB7A 1YFYA 2HEVF 4OVEA 5JIAA 1S0IA 1RUOA 1NYWA 3GNEA 4KWJA 1QJX2 2XL9A 4P9XA 2OIIA 2NYYA 4W6XA 1S0DA 4K9SA 2YGMA 3HIFA 4E4DX 5DUXA 1AR62 1CAXA 4Y5Z0 1OLRA 5K0UB 2XJUA 5GLWA 4AI2A 3AMNA 2VOWA 4LO6B 1B35A 1DBNA 3ZYJB 2YMZA 4Q8KA 2R071 2BNNA 1X8EA 4HK8A 2ZGPA 1ASJ1 1DGLA 1QH6A 3AMHA 1W6PB 1LCLA 4Q4W2 4BPZA 3THTA 3PJYA 5BNOA 3CL1A 4XIKA 5KHJA 2JXAA 2FHRA 5BUVA 3FLTA 1PK6B 4NHKA 4CDWA 3SH5A 3E6DA 1GR3A 4JV4A 1S0BA 4JGYC 3S7IA 3VKMA 3B69A 4PDWB 4AI0A 4LE4A 1QNYA 3E5UA 1RL3A 2WS91 4OI2A 1AR71 2BWCA 2XLGA 2I45A 1ND3B 5BY5A 4FCAA 4K6BA 5FTTC 3OGJA 1TE1B 1J3QA 4DPNA 4ZU5A 4XFGA 2HJIA 4BIFA 1CONA 1M4WA 3N3HA 1XNKA 1AYN3 4K3UA 2HWC2 1RGSA 3E97A 3AMPA 2PHRA 5HXVA 1ZVFA 3J4UH 1R083 4PF5A 1Q5OA 4CDXC 2XLFA 4CRQA 4AVVA 4K1ZA 4AFAA 1AR81 4YRDA 4XBQA 4Q26A 4AVCA 3AP9A 1UAIA 4IV1B 1N3PA 4GMP1 4COVA 2MHFA 4XBLA 3ME2A 1JH5A 1JXNA 1LR5A 4LHNA 4D69A 1OI6A 4XW3A 1AR92 5K0UA 1ULEA 3IT8A 3ZO0B 4AVSA 1WUVA 1LGNA 1A8MA 5T55A 1DDLA 5DG1A 2WLPA 1DQ5A 1I3HA 1HRV1 2A7AA 1ENRA 1IKQA 3KD4A 1W6PA 3RMYA 4YW2A 3USUB 3EBRA 3VBSB 1C1FA 5DZEA 1NCQA 1FOD3 4TYSA 5C8CB 3HQXA 1C28A 4X6QB 5LRSA 5H9SA 1WLTA 4NO4A 4NHMA 1YRZA 2K2SA 2BPA2 4J1XA 4PDWA 3T1MA 1BK1A 1QHDA 4XJZA 4QGNA 1CAUB 1YWKA 2WKKA 5EYXA 3QOPA 3RI8A 4X8PA 3VBHB 2QVSB 4IEUA 3AZZA 2C9AA 2WNUC 5CFDA 2EALA 2R041 3FUQA 1UU6A 4GQ7A 1FATA 3WD5A 2QFEA 3NV3A 1Y7BA 3QBQA 1RUJ2 1EAH1 1W6MB 3HBZA 3N7MA 1ULCA 2XGXA 1ND2A 4MGKE 2ZGQA 5AFBA 3VHRA 4YVSC 3FE5A 2WQ4A 5HCBA 2YYOA 4DRRA 3B93A 4IV1A 1QF3A 5J7MA 3BOWA 1UU4A 1ZZ9A 2VOKA 3M3CA 4TZDA 4M3CF 2HWE1 3OTFA 3PJQA 5CFCB 1AYN2 2A3XA 1T6GC 2I2SA 4K40A 2A3YA 2G4IA 2JKBA 2P3KA 2G9FA 2RMU1 2K9ZA 2WT2A 1IKPA 2P3JA 3BTAA 4B7KA 5ACA3 5CBLA 4RA0A 2DVGA 4F3JA 1S2KA 2JG8A 5FMOS 1G86A 5JSPA 2OA2A 2YPJA 2R073 2ZGMA 1LGBA 3VBSA 1BMV1 4PIZA 4YZ4A 1LULA 5C8CA 4XHXA 1VALA 1B35C 2D97A 3D82A 3GZAA 1V6KA 2NZ9A 2NQYA 2VMIA 1VBA1 3O12A 1G9DA 3U11A 4EROA 1PO22 4NWWA 1CAUA 3GBWA 5BNOC 1I9RA 3LSEA 3VBHA 3JBG2 4Q1RA 1D4M1 4CDWC 1CX4A 1EV12 4AWDA 2D40A 3U07A 2D3RA 1O3QA 1PGL1 2D6PA 2WS93 4H7LA 4RR3B 1AR73 2NMOA 3EHKA 5BNNB 1FOD2 1W6MA 2X29A 1PZ9A 1M06G 2R32A 2QQPA 2G9GA 4K20A 1NY72 4GA9A 1GKBA 3UV9A 3MF6A 4A7ZA 2HWF1 4E9KA 4NHLA 5F6KA 3POYA 1LHNA 2MPFA 3VHNA 2LUWA 4QPGA 4WM7C 3R4UA 2CWSA 1AR83 2BFUL 2OZJA 4JC1A 4ZKTB 1BXHA 1W2UA 3GZTB 5CFCA 4K7JA 5BNQA 1KS5A 4GMP3 3NV4A 4D94A 4XFCA 1DFQA 3SXWA 4RQPB 5KXEA 1AXYA 2ES3A 3G6JB 3HR9A 3H1YA 1URXA 3RYKA 3VKOA 4RGGA 4AK3A 1CPNA 5J96B 2WSVA 3QH7A 3JUUA 1V6JA 3RRDA 3M3EA 2ET1A 5K0UC 3A0KA 2GH8A 4X6RB 4QU2A 2ZHNA 1HRV3 5H9PA 2ILMA 4LEJA 1JUIA 1LODA 1Z7S2 3TNQA 3BOPA 2BNOA 3V65A 1MS5A 4A2UA 1TQ5A 5GZFA 3AK0A 1NCQC 1VRH1 2E7QA 2LTNA 3WG4A 1IQAA 2JG9B 5ACA2 2MEV1 3B94A 4KGQA 4PDWC 1ZREA 1Q8SA 2BW8A 5T52A 4RR3A 4E2QA 2JJ6A 4ISRA 3WHUA 1R1ZA 1OA4A 1S2BA 2R043 4DRVA 1LHVA 2RS12 4OUSA 1ND3C 4IEWA 5CFDC 4C91A 2GAUA 4DZGA 1UX6A 1EAH3 2GC0A 4OI4A 2YHJA 4BH9A 2PLV1 4AQ2A 3J9SA 1BVVA 2P34A 5EFUA 3SCGA 1SFYA 1H8TB 4QGLA 1ND2C 2DVAA 2Q30A 3MIEA 2O1QA 4CP2A 5HBAA 2DUOA 4SBVA 1MZEA 3ASIA 5JVVA 4HMZA 4IV1C 1R091 2HWE3 4URTA 1KJLA 5TSWA 1X8MA 1XRUA 1QJY1 3FC0A 5E1RA 5KHIA 1ZNPA 2CYFA 5T50A 1O5LA 1X7NA 3ZXLA 4CEYB 3C2UA 3ZFEB 1POV1 2BVBA 4P14A 4E2SA 3AYDA 4XFBA 2GNTA 4YW5A 3WHTA 5GLTA 3IIAA 2YGLA 5IK8A 2JG8C 1V9U2 3S0MA 1W0OA 3VBSC 5AC91 2PA7A 5C8CC 1VBA3 3ZIXA 3WDXA 2BTVC 4G4FA 2WFF1 1FV3A 2MNGA 3E5XA 3JQWA 1GNHA 1D4M3 1VBD3 3VBHC 2CGOA 2X5IB 3GHMA 1JOJA 1U5YA 3I59A 2O8QA 4HFSA 1W6OB 5GLUA 4MXWB 3ZN6B 2H6BA 3J26N 1AYM1 1SLTA 3TRSB 2JX9A 2A6WA 1QOSA 4YGCA 3ZFFB 1XYNA 4IL7A 1QJX1 2QZ2A 1YFXA 4RS5B 1W6NA 4ES8A 3NL1A 1AR61 2ZACA 2ZGOA 4XQDA 1RUI3 2R042 3WX5A 4FOVA 1GQHA 5DDJ2 1AHSA 1EP0A 1H30A 4AW7A 2UWCA 1YFUA 2ZAHA 2H0BA 4CEYA 5CFCC 3ZFEA 4AG4A 1ENXA 3OD4A 1A8DA 2W39A 4C90A 4Q4W1 4K1YA 4Q2FA 4L99A 1WMEA 1MVEA 3JU9A 3WY6A 1RUD2 1R1A2 5FLHA 4YGDA 2R49A 2B8MA 1DQ0A 4Y26A 2ZGNA 3D4KA 4YZ3A 4YZ2A 2JENA 3MZHA 4OFGA 4E2GA 2FQPA 4XFAA 4P5HA 1REFA 4ITCA 1NCRA 4V1PA 4FSJA 2ZX3A 4COYA 4FAGA 1UIJA 2D6KA 1ENQA 4AQSA 1YI9A 2HWC1 2ZGUA 1VAVA 5EYYA 5JMCA 1MZ5A 2XJPA 4XILA 4LULA 1W6OA 3CU7A 5F6LB 2ZGKA 3AXEA 4FTBA 5CU1A 3I4IA 1BMV2 4FVVA 3ZN6A 5K7PA 2XBO3 1BEV3 3AB0A 4RR3C 1HX6A 4AHWA 2GNBA 3MPBA 3CJIB 1H1MA 1WBLA 1ZYBA 2BFUS 4H3WA 4KNCA 2R16A 2PLV3 4R8HA 3FLRA 1VBD2 3GF6A 1AR91 4CDXB 4FOWA 4HANA 2AH2A 2VW0A 4INDA 3O5SA 3GHNA 2B46X 1J1TA 2GALA 3K48A 1FNZA 3MIFA 1RUH2 1F8VA 2SLIA 1R093 3FX3A 5IK7A 1QJY3 2A70A 5A32B 3CO2A 3LAGA 3TNPB 2PAKA 2WL1A 1E57A 3NSTA 2QNKA 4HLTA 1ZZCA 1POV3 1CPMA 4J6GA 5FRAA 2D43A 1H1AA 3M3OA 3R05A 1SLLA 1RUI2 1WD4A 1YCIA 2YDEA 5D8AB 3AYAA 4HSLA 2WFPA 5BNPA 2UWBA 3VZNA 1SACA 3BCWA 2ENRA 1Y3TA 3LOBA 5JOXA 3B9IA 2D7FA 4AI3A 4JDOA 1FX5A 3ZMOA 1SCRA 2DF7A 5AC93 4RHV3 1IZ3A 2EXKA 2F6BA 1KRIA 1HDKA 2HWD2 4GWNA 5FOJB 4HSJA 1AX2A 1RUJ1 2WFF3 1RMU2 3MW3A 1H1IA 1NG0A 5SV5A 1Y43B 5CG9A 2OYZA 5IK5A 3B7MA 2WNUB 4XIOA 1TEIA 3ILRA 2DCZA 2PHTA 3CJIA 1GSLA 4YFWA 1DQ4A 3ZYIB 4XETA 1RUE3 2CL2A 1DF0A 1NOVA 1AYN1 2QDNA 3SH3A 1QJX3 5KXDA 4LUMA 2VW1A 2QKDA 3HAGA 1H8TC 1U0AA 1AR63 2XBO2 3EJKA 1BEV2 4AHXA 4DS0A 2PHLA 4WZCA 1NZCA 1CESA 4P9YA 1C1LA 3JCIA 2WA3A 2WA4A 1QJU2 1UIKA 3H9AA 1SQ4A 5GZEA 3MLKA 2PLV2 1O4TA 4MX3A 4Q4W3 4CEYC 4IV3A 5FFOC 3VBUA 3ZFEC 3JZVA 4Y1UA 1UD1A 2B9UA 1QXRA 1PO21 2VQ0A 1NXMA 5D8AA 3UJQA 5DZFA 1PIV2 3AJZA 1IPKA 1DQ1A 4QQOA 1IS5A 1F5JA 2V5YA 3JBG1 5DUUA 3J8F1 5F1RA 1JW6A 3L2HA 1EV11 4FPLA 4DY3A 3NVCA 1WD3A 3ZSEA 1B35B 1UKGA 5I0RA 3MGUA 4E4SA 2F4PA 3NKTA 4DMIA 2UY9A 4MSVA 1NY71 2DCKA 4QGMA 2HWC3 2XHKA 1QOTA 2C1FA 3BIWE 3ZYPA 4A7YA 2DTYA 1C8M3 1MQTB 1LB2A 4I30A 1OQDA 4QPYA 1ALYA 1WMDA 4COUA 1SLBA 4HL0A 5AC92 4RHV2 3B3QE 4N7IA 4DQAA 1AL0G 4LO5B 2W0XA 1O5UA 2EVXA 4ORFA 5I93A 2XUMA 3VLBB 3H7YA 4RL7A 1UZZA 4LR4A 4CP0A 4H7MA 4N90A 2DURA 4IEXA 1AR93 1HXS3 4MV2A 2DVFA 2ZA9A 5IT6A 4JQRA 3WW3A 2A3WA 4GIQA 2VMGA 4I2OA 2Y26A 3M3IA 2HKXA 1VBC3 5KXCA 1RUE2 2DUPA 3AM2A 2D5FA 2JE9A 3PMEA 4CDUA 3P3PA 1Z7S1 1V6OA 2TEPA 4CZSA 1HQWA 5T3NA 1BZWA 2A75A 3C3VA 1ULFA 1F9KA 1XNCA 5FAXA 1G9CA 2ZGLA 1NXD1 2GC1A 5ACA1 3DPRB 3OY8B 1RTVA 1YFWA 1VLNA 3ALQA 5FLJA 1PGW2 3UJOA 4FPOB 2RS11 3W58A 4XTPA 1NLSA 3O0XA 1ZRFA 5JSRA 1NCQB 4Q29A 3M4FA 1RUJ3 3PVEA 2R1DA 1Q56A 4XFFA 4BYYA 2DCJA 1UU5A 4RFT0 1MQTA 1AVBA 2ZS6B 5BV6A 3DL3A 3KSCA 4LBMA 2XG3A 4AXOA 5JPNB 2IC1A 3T2TA 2IXHA 2ZOEB 1IPJA 4W6YA 3G7DA 3LWCA 2R1BA 4HKOA 4B4RA 1U5ZA 5CFDB 1GV9A 1OA3A 4XFHA 3PVBB 2ZMLA 1NQJA 1KS4A 4U2AA 3CJIC 1S55A 4FXKB 4E27A 4LBNA 1N1VA 5A3LA 1RVF2 4AEDB 3M2MA 5AVAA 3T1LA 3MFAA 3UKTA 2ZZJA 1C8M2 4QX5A 1KITA 2GN7A 1CGPA 1ND2B 1WCDJ 3KQRA 2JDZA 1ZZ6A 1S0GA 1GYKA 4AGRA 4XTMA 4AQTA 2JEMA 5CVRA 3H1WA 5FO7B 3WCSA 3ETQA 1MS4A 3LA3A 1SMVA 4OHZA 4NR1A 4GB33 4IESA 5LK5A 3TB0A 3N36A 3VUOA 4AVAA 1V9U1 1DZQA 4IXLA 2GZWA 4YM3A 1ULDA 1Q8PA 3ST7A 2HYKA 4OHVA 4AFDA 3DPRA 1NA1A 4HN0A 3SHRA 3ZSLA 1PO23 1HXS2 1FT9A 1SBEA 3MIDA 1MS8A 3WG1A 4HT1T 2ARBA 3ZXAC 3OY8A 3V0AB 4HVRA 3ZPYA 5EXOA 4M3CB 3JBG3 4K21A 5D8AC 1OMIA 4AEMA 3J8F3 1VBC2 2IXCA 1YO8A 2QDRA 3E5QA 3M8LA 4PBOA 1EV13 2BNMA 5JZGA 2JG8B 4LO4B 1AX1A 4XQWA 4Y1XA 1I6XA 3WG3A 2JD4A 1PNFA 1RITA 1XE7A 1MS9A 3OYWB 4PQ9A 3ILFA 4DB5A 4BMEA 5KHGA 3LCPA 3CNAA 1KXGA 4N53B 2OVUA 1YHFA 5J36A 2D44A 2IFWA 1NE4A 5C4WA 4D7YA 1WBFA 4XXPA 1L3JA 3SMHA 5DDJ1 5KXBA 4AEDA 5I0TA 4YVWA 3KLSA 2CV6A 2WJSA 4EN0A 1BBT3 3QACA 4ATEA 2XWJB 1PGSA 2Q0AA 1RUD1 4MGYE 3R4SA 5EV7A 1HIXA 1R1A1 4R9BA 1HRI2 5T5PA 1N3QA 3VL8A 4QPGB 1DU3D 4YW4A 1J3RA 2UURA 4WVWA 3VZOA 4QXKA 1YUDA 3DKWA 3ZXGA 4Z92B 4K8FA 5I0SA 4FAHA 1Z7S3 1H0BA 2WIIB 4Z07A 1JYCA 3VL9A 3DV8A 1LEMA 3V0AA 4GWMA 4PLNA 4M3CA 1C4RA 3IDCB 2NMNA 4N43B 5BPXA 5CIRA 1H2LA 1C5IA 1X36A 5EJ3A 3Q9OA 1LESA 4GB32 2PN5A 4BLIA 2AR6A 3ZXEA 2RS13 3UK9A 2AZ5A 2AUYA 2UU8A 4YZ1A 2DCTA 3OYWA 1QXJA 4WM8A 1UW8A 1WCKA 1VIWB 2E7TA 3N35A 3PTYA 4EWAA 1O4ZA 4N53A 3EO6A 4XMAA 4YGEA 1GLHA 1QH7A 2R0FA 2VG9A 3WLUA 4ASLA 1VBD1 3J8F2 1A6CA 1MQTC 2YV8A 1AXZA 4Z82A 5K9YA 1J59A 4P9JA 3WVJA 1BCXA 2VECA 2EIGA 3CEWA 3NJZA 3SNMA 1U5XA 3BODA 4XJWA 3A0NA 2A6YA 1RUH1 3MLJA 4Y22B 1ZRCA 4F7ZA 3KM5A 3D0JA 4OI1A 2VNGA 4JAAA 2Q1ZB 3AJYA 4MZUA 4YW3A 2P37A 1RUI1 2I07B 1PVXA 3WDYA 4HKLA 5CNAA 4JGZA 5EWSA 5BXXA 5T5JA 1OQEA 1MR5A 1JTZX 1V9U3 2PHFA 3AKPA 1H2MA 1QKQA 2Q1MA 1BBT2 5DG2A 1MEC2 2HWD1 1OPMA 2RR12 2XVKA 1D4VB 2DVDA 4N43A 1RMU1 4LHKA 3DPRC 1LU2A 1DGWA 1NA1C 3WG2A 3ZDSA 1Z0HA 5FPZA 4AGGA 2GH2A 2GMMA 3IMNA 3OPZA 1X33A 1PM7A 1N1TA 2ATFA 2GNDA 1AJOA 3ES4A 5JZGC 5CG8A 3WNXA 4WZFA 1XXNA 4AE2A 2R063 4KG0A 2D3SA 4XF0A 3H3ZA 4G3YC 4N9IA 1COV1 3H1MA 5JPMB 3NV2A 2R6QA 4XZPA 4PBPA 3ROUA 2PELA 1NE6A 1QMJA 2WT1A 4QT6A 4EJRA 3WUCA 4Y1VA 1I5ZA 1PVC3 2XBO1 4YM1A 1BEV1 3I59B 4Y22A 5DDJ3 3WR0A 2GDFA 1FAYA 3RYPA 5FPXA 1VAKA 5K8SA 5FCCA 2ZMNA 1QJU1 4AEDC 3UKNA 5JI9A 4YVWC 4RD7A 2BEOA 3I54A 4CDQA 2CAUA 2N7GA 1RUD3 2CY6A 1R1A3 1RB8G 1QQP3 1D2QA 2WNVB 3RS6A 1PIV1 1W6NB 1RUF2