1MQTA

Swine vesicular disease virus coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
271
structure length
271
Chain Sequence
b'RVADTVGSGPVNSESIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTVENFLCRSACVFYTTYKNHDSDGDNFAYWVINARQVAQLRRKLEMFTYARFDLELTFVITSTQEQSTTQGQDTPVLTHQIMYVPPGGPVPTKVNSYSWQTSTNPSVFWTEGNAPPRMSIPFIGIGNAYSMFYDGWARFDKQGTYGISTLNSMGTLYMRHVNGGGPGPIVSTVRIYFKPKHVKTWVPRPPRLCQYKKAGNVNFIPTSVTEGRTDITTMKTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
molecule tags Virus
total genus 42
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtA00
1POV0 2RS51 1AR62 1RUI2 1PO11 4Q4X2 3JB4C 4YVSC 4YVWB 1ASJ2 4RQPB 3TN93 1RHI2 5DDJ1 5A32B 3S6PA 4WM8C 3JBG3 1CD3G 1C8NA 1Z7S2 1W39A 3VBOC 1BBT1 5C8CA 4CEYA 2R062 1F8VA 2IZWA 4Q4Y1 1FOD3 4PDWA 5CFDB 1EAH3 2MEV1 2RMU2 2RM22 1COV2 5C9AB 1ND3B 1H8TB 3CJIB 2WFF1 1AR61 4GMP0 1RUI1 3VDDC 1K5MC 1BEV2 1D4M3 2RS13 3VBSA 1ASJ1 1TMF2 4Q4X3 5L7OB 4CDXB 4QPGB 5C4WC 4NWWA 1VBB1 1RHI1 1NA1B 1POV3 4RFT0 1X33A 4RR3B 1Z7S3 3JD72 2RR12 2R063 1F2NA 1OOPC 4WM7A 2R041 4FSJA 1SMVA 1NOVA 2RMU3 2RM23 1VB2A 3VBUB 1RVF3 1HRI2 1HRV2 4QPIB 1RUH1 1QJX1 4N43A 1FPN2 2RS33 1HQNA 5K0UA 1TMF1 1BEV3 5C8CC 5C9AA 4Q4V2 1ND3A 4NWVA 3VBHC 5ABJA 1QQP3 2X5IA 2HWD2 2FZ1A 5D8AC 3JD71 1AR82 1HXS2 4JGYC 1AYN1 2RR13 4QPGA 5ACA2 2HWF2 1C8M2 1HRV1 1RUG2 5CFCB 1HRI3 4WM8A 1IHMA 1EV11 1FPN3 1VRH3 3VBOA 2QQPA 1MEC1 1NY71 2RS52 4YVWC 2VQ0A 4RQPC 2GSYA 1R081 2BFUL 1AR81 4CDUA 5BNNB 5DDJ2 4N53B 1RB8G 1HXS3 1TME1 1K5MA 4N43C 3VDDA 4JGZA 1R093 3J8F1 3VBFA 4CDQB 5ACA1 5AC91 4FTEA 5BNPB 1C8M1 3LOBA 2R071 1NCRB 5CFDC 5C9AC 2HWF3 1RMU3 1ND3C 1H8TC 2MEV2 1RUG3 3CJIC 4CDWB 1B35A 1AL23 1VBC1 4GB33 1VBA3 2WFF2 4IV3A 4AEDA 1PVC3 4LLFA 5L7OC 5GKAC 2RS53 1ND2A 1OOPA 2Y26A 4QPGC 1AR71 4RHV1 1PO13 1NA1C 4Y5Z0 1QJU2 3ZFFB 1VBB2 5J98B 1VBE1 1AR93 4RR3C 5DDJ3 1RUE2 2WZR2 5JZGA 4FTBA 1DDLA 1QJY1 1BBT3 5A33A 5J96B 4Q4W2 3DPRB 3ZFGB 1RUJ3 5FMOL 2R042 4Q4Y3 3VBHA 4QPIC 5D8AA 4CDUC 1AYM1 1RUH2 1QJX2 5LK7B 1RUC2 1RUF2 4JGYA 1BMV2 1AR63 4JGZC 1V9U1 3VBFC 1RUI3 2HWC2 2FZ2A 1QJU1 3NAPB 5FMOS 1ASJ3 1VBB3 1HX6A 1RHI3 1PIV1 1RUE1 2WZR1 2BUKA 1B35C 4GH4B 1OPOA 1QJZA 4IV3C 4YVWA 4AEDC 4Q4W1 1ND2C 1AYN2 4RQPA 2RS11 4Z92B 5A32A 1COV3 4BCUA 2R043 5CFCC 5FOJB 4YVSB 1RUC1 4RS5B 1RUF1 4SBVA 1BMV1 1RUH3 1QJX3 5BNOB 5JZGC 1EV12 2HWC1 2PLV1 1MEC2 4FTSA 1NY72 1MQTB 5CFDA 1TMF3 1AL0G 1H8TA 4IV1B 2HWB1 2XBO1 3CJIA 3JB8A 1X36A 1PO22 4GMP3 1RUD1 1VB4A 1R082 1RVF1 4N53C 4CEWB 1PGW1 1R1A2 4CDQC 3JD73 1NCQB 1TME2 5L7OA 2RS31 4CDXA 5BNPC 2ZTNA 3J8F2 5AC92 1AYN3 1NA1A 2R072 4CDWC 2WS91 4RR3A 1HRV3 1QQP1 3VBRB 2XPJA 1VBC2 1EV13 1FMD1 1MEC3 4Q4V3 3ZFFC 1AR72 3VBUA 4RHV2 1PO21 1ZBA1 4QPIA 2WLPA 4RS5A 1R1A1 2HWD3 1R083 1VBE2 1AR83 1ZBE2 3J8F3 1QJY2 5ACA3 3ZFGC 2TBVA 5AC93 1C8M3 2R073 2BFUS 5C8CB 4CEYB 1VBD1 3TN92 4PDWB 1AYM2 4CDXC 1R091 1V9U2 3NAPC 2HWE1 1AR73 5CFCA 4RHV3 1PGL1 1FOD2 3VBSB 4Y4YA 2BPA2 4GH4C 1PIV2 1VBE3 1ZBE1 4GB31 2BBVA 2ZAHA 3FBMA 1PVC1 1QJY3 1D4M2 2RS12 3VBUC 5BNNA 2MEV3 4N53A 3TN91 4RS5C 4WM7B 1E57A 1AR91 4CDQA 3ZXAC 5BNOC 2GH8A 1M06G 3JBG1 2WFF3 1CJDA 1AYM3 5BNPA 3ZFEB 1MQTC 1NCRA 2PLV2 1V9U3 4N43B 4IV1C 1QJU3 1FOD1 4CDWA 5K0UB 1EAH1 1RUJ1 2HWB2 4CEWC 2XBO2 3IDEA 1RUD2 1PIV3 1RUE3 1RVF2 2WZR3 1NCQC 1PGW2 1OHFA 5ABJB 2X5IB 2RS32 3ZFFA 1D4M1 1NG0A 4EJRA 4Q4W3 4Q4X1 1POV1 2WS92 1VAKA 3VBRC 1QQP2 1RUC3 1RUF3 1Z7S1 3DPRA 4WM8B 3ZFGA 2HWC3 2PLV3 1FMD2 2R061 3VBOB 2RMU1 2RM21 1COV1 5BNNC 1ZBA2 2HWB3 2XBO3 1RUD3 3ZFEA 3NAPA 1NCRC 1VRH2 3HAGA 4CDUB 1BEV1 1A6CA 3VDDB 1K5MB 4JGZB 4CEYC 3VBFB 2DF7A 4GH4A 5C4WB 4PDWC 1VBD2 2WS93 4GMP1 1B35B 2RR11 1R092 1FMD3 4IV3B 2HWE2 4YVSA 4AEDB 3VBSC 1ND2B 1OOPB 1PO23 1PGL2 1RMU2 1ZBA3 1HRI1 5BNOA 1R1A3 1WCDJ 1MQTA 1FPN1 1AL22 1TME3 1VRH1 4GB32 1VBA2 3DPRC 4IV1A 1PVC2 5JZGB 4Q4V1 1GFF2 4CEWA 1PO12 3M8LA 4WM7C 2ZZQA 5A33B 1NCQA 1VBD3 2HWD1 1AR92 3VBHB 3ZFEC 1HXS1 1VBC3 3JBG2 5D8AB 5K0UC 4JGYB 1BBT2 2HWE3 2HWF1 1RMU1 5C4WA 1EAH2 1RUG1 3VBRA 1RUJ2 4Q4Y2 1AUYA 2WWSA 1AL21 5ABJC 1ZBE3 1VBA1 2X5IC
chains in the Genus database with same CATH superfamily
4C1WA 2YC0A 2RS51 3LFIA 4YPJA 4OLLA 4BHPA 3O1MA 1RUI2 1N1TA 3KCCA 1HKDA 1A3KA 2B4KA 4YGEA 4YVSC 2ZOEB 5FZ9A 1ASJ2 2DVBA 3ZN6B 3MW2A 4RQPB 1OKOA 3TN93 5HV0A 5A32B 4UBGA 1D0GA 3LSEA 4WZFA 4AHWA 3S6PA 2IVIB 4WM8C 1Z7S2 3AYAA 2ADEA 1V00A 3USUA 4A3XA 3A22A 3VBOC 1BK1A 1OXCA 2XHKA 4CCKA 2R062 4QX3A 4X6RB 1F8VA 2IZWA 4U36A 4K9SA 2YU1A 3MIDA 1TG7A 5JMCA 1COV2 2KXLA 1OFSA 2VAUA 3O5SA 2BERA 2QZ2A 1QOSA 5JR7B 1H8TB 1OLME 1AXKA 2JE9A 3PVBB 1P8JA 4Q0UA 5FXZA 5C70A 1CAUB 3NNLA 5EJZB 3HN3A 4HXCA 1AR61 5F9TA 3PJQA 5FP7A 1IG0A 3N9NA 4URTA 2BJSA 4QHBA 1XNAA 1PM4A 1QU0A 5FYMA 1AX1A 3SLIA 3O12A 1W9YA 1CN1A 1TMF2 3VBSA 4HK8A 3N7LA 1DCSA 3I59A 3RGBA 1OKQA 3ZXLA 4URAA 2UWCA 4RFT0 2W95A 1GZWA 4UW5A 4H55A 4LBQD 2WDBA 2D97A 4Y5SA 5EPAA 1W03A 5T5PA 1Z7S3 3ES4A 4XEZA 5LZ6A 2PHWA 3M3EA 4YZ1A 2YDEA 5LEJA 4MGTA 1Y4WA 2R063 2TNFA 1WBLA 2PHUA 1GSLA 2Y6LA 3KQRA 4TWTA 5FZIA 1AF9A 1W0OA 3OEAA 5K9YA 1SFPA 4IE4A 2Q8OA 1LNSA 1QJX1 4ZONA 3AKSA 3OPWA 2I07B 4UOJA 1FPN2 2YFZA 3D4KA 1OD5A 3H50A 1JYNA 1D2QA 4YWAA 4ES9A 4IEOA 3WF2A 1S0GA 5FRAA 5JXGA 5HXVA 1ND3A 2GAUA 3S30A 2AC1A 4UW3A 5EXOA 3EB7A 3KCXA 1ZZ6A 4EROA 5A3MA 5FYUA 4AFAA 3FUQA 5DUWA 2RJLA 3VHPA 1Z0HA 3K51A 2LROA 3H1YA 1ZZ7A 1W6NA 4FXGB 4JGYC 3ENRA 1NXD1 4LBNA 4QPGA 5F39A 1W2OA 2C5DA 4UWDA 2VOWA 1G9AA 4CU8A 2CHHA 1HRV1 3TRSB 1OLQA 5HI0A 3V0AA 3EJKA 4YW1A 2K0GA 2PHXA 4UW4A 3RZJA 1RC6A 1FPN3 1VRH3 3LD8A 4AGRA 1MEC1 3MUZ1 1NY71 3I4IA 4B8EA 5LA0A 4N7IA 5GZFA 3POFA 3OUIA 4Q26A 2HEVF 2ZHKA 5LK5A 4BK5A 3RYPA 1W6OA 3VHNA 2BFUL 4XILA 4XIOA 2CGOA 3VD5A 2OS2A 1CAVA 2DUQA 3NKTA 5DDJ2 4A44A 2A7AA 2BNNA 4N53B 4JCKA 3VDDA 1K5MA 1GV9A 4QT6A 2AH2A 4XACA 4JGZA 3TNQA 1CPNA 1R093 3VBFA 5ACA1 4K21A 1H6XA 3TWIA 2B39A 4H2AA 1C8M1 1WBFA 2R071 2A6YA 1NCRB 2XL7A 3FLPA 4D8MA 1YI7A 5DZGA 1G86A 5LA9A 5B4XA 3DYOA 3DGTA 4IGQA 2IWGB 2DYCA 2OXBA 3CJIC 1YXWA 2OQ6A 4CDWB 4PCRA 5A7OA 3HT2A 3HD8B 3ZYPA 3OBZA 3SCHA 3S7IA 4E2SA 4UI9L 1VBA3 2C6SA 4IV3A 1QOTA 3EBRA 4P9YA 1PVC3 2G4IA 3PIJA 5L7OC 4LKSA 3OJBA 2EXJA 4XBLA 1UIKA 3W59A 1PO13 2PXJA 4TZDA 5EV7A 1H4HA 1LOFC 1KQRA 1UY1A 2WUHA 4HONA 5A3TA 3RPQA 2QZ3A 2WNUA 5BPXA 4IERA 4Q8KA 4OI4A 2GC0A 1GQHA 2JDUA 5M0TA 4YW7A 1LEMA 5DDJ3 2FMDA 2WZR2 2QUOA 2VO5A 4YG0A 3DXTA 4BLJA 5IK4A 2IUWA 1QF3A 4XQ4A 4AI9A 4P02B 2JIJA 2VNRA 3IWZA 5A1AA 1FXZA 2Y6KA 4JKKA 1O8PA 2LTNA 5FY8A 3NNFA 4C0BA 4DS0A 3IB3A 4AGVA 5HCHA 3DPRB 4XUOA 4R4ZA 1YUDA 2DCTA 5ANQA 1JYXA 2R042 4Q4Y3 2JWPA 4CE8A 2UWAA 3AMHA 4QPIC 5D8AA 3UL2A 5KBFA 4BYYA 1SG3A 1RUC2 3ETQA 4MZUA 3VD7A 4MXWB 2QQKA 1LHOA 4LO7A 1TVGA 3ZMNA 3SISA 3OPTA 3U78A 2HWC2 5IYYA 1DQ5A 2Z4FA 2VMFA 2VBPA 4CP9B 3SEPA 3T0AA 5HCBA 3L2YA 3L2HA 4QM8A 2O1QA 3GYDA 1PK6C 1GR3A 2JE8A 5IHRA 1JZ8A 5HPOA 2VH9A 2AREA 1IS4A 1HB3A 2F6BA 1DBNA 1UKRA 1XNTA 2QQMA 3OEBA 3PNAA 4E4ZA 3ZN6A 1ND2C 1AYN2 4KBZA 4RQPA 1V6IA 1W99A 4XJUA 3W9AA 4JKLA 4CTEA 4OFGA 4Z92B 1IPSA 1IPJA 4FPFA 5A32A 1DQ0A 1OURA 2R043 5FOJB 2IXJA 4K1ZA 2Q1ZB 2WA3A 4YVSB 2ZX1A 4P9LA 3JXSA 1RUF1 5I0DA 1D0HA 4LITA 1FYUA 2VTFA 1ULFA 3MPBA 3U4XA 3VKFC 4LE3A 2GDFA 4WVWA 3D0SA 1MQTB 1LOCA 1C1LA 1SLBA 1OQDA 4FXKB 3E5XA 1H8TA 2ZGNA 3JB8A 1CAUA 1S55A 2WZEA 1PO22 4GMP3 5FMDA 1RUD1 1VB4A 1RVF1 3GZUC 4CEWB 5LRSA 1HDKA 3C7HA 3D82A 4CCEA 4CUGA 4CDQC 3IIAA 4AXOA 5BNPC 2ZTNA 3GJAA 2ATFA 2GN7A 3GCXA 3J8F2 5AC92 5F5CA 1LENA 1AYN3 2J1VA 1WCUA 5T50A 4M0NA 3AP5A 3AVRA 4IW3A 5JVVA 2OVUA 4Y1XA 5A7WB 5LY1A 4FQ4A 1J59A 1QWRA 4EN7B 5FZKA 4V2WA 1WD4A 2HBTA 4CUCA 2QVSB 5GLTA 5JSOA 1W6MB 5C33A 1DFQA 2P6CA 3GM8A 5LASA 4DXZA 4GWIA 4MO3M 3ZYFA 5LA2A 2R0FA 4IEVA 4Q4V3 1PGSA 2Q5TA 2ZX4A 1LAJA 4IXLA 2XJUA 2HYXA 2PQQA 2ZS6B 3CZUA 1SFYA 1URXA 3BB6A 4XYXA 4XAEA 5CISA 2WLPA 4Y24A 1YLLA 4OVEA 4OQ9A 2I74A 3D5OA 3PHMA 4IE6A 3RJ2X 3POJA 3AL5A 1MS9A 3TNPB 1SLCA 5FYBA 1H2KA 3BPSA 5FFOC 2G19A 4CCDA 2RDNA 1XNBA 4M4RA 2X53S 1JBCA 3WNPA 2VULA 3J8F3 4OMDA 3W20A 2D44A 3T08A 3ZFGC 5AC93 2QQIA 2VW2A 5J09A 1IKQA 4UBHA 2Z42A 2BFUS 4J1WA 1DHKB 4MLOA 4DUXA 1OF4A 1LESA 4WVVA 2QJVA 4PDWB 3WCRA 2WO1A 2WWJA 2D5HA 2OX0A 1J3RA 4MOAA 4LBMA 3NJZA 4XCBA 2P3JA 1DZRA 4DMIA 1V9U2 3IT8A 1HLCA 1ULDA 5FR3A 4D7SA 1WCSA 2VD7A 5KHHA 1TZOA 2P3YA 2E51A 4WVZA 1S0DA 1VMHA 1J58A 1RXGA 4GH4C 1PIV2 3POYA 4RSUA 5EYXA 2VOKA 1ACCA 4AQ6A 3I3MA 4LO4B 1WW5A 2NM1A 5FTTC 3KS7A 4GB31 4LLOA 2UYBA 1ZVFA 2ZAHA 4MX3A 4W6WA 4BOWA 5LA1A 2EXIA 3LAGA 5LEKA 1UZ0A 3AKRA 5FKBA 2RS12 2P34A 1XOYA 4ZHNA 4QGLA 2ET1A 3OOXA 2A3WA 4N53A 3TN91 2XQXA 4RS5C 4AW7A 4UFLA 1U5XA 1AR91 1M06G 3MZHA 5BNOC 2JB4A 4DPNA 2H0VA 1NCRA 1STMA 5EIYB 1UF2C 1V9U3 1F35A 4GD4A 4XF0A 1C4RA 1G9CA 1RUNA 2WN3A 4CDWA 4AI2A 5J36A 5K0UB 2BBAA 2VZPA 2ZGLA 1F31A 1Y9MA 3UK9A 1OQ1A 1PIV3 1RUE3 4UYBA 1DP0A 3I2JA 4G9SB 1PGW2 2P3IA 2YGLA 4UT5A 2YZ4A 3FLRA 4JAAA 3VZKA 4OHWA 5ABJB 1UWWA 5H9SA 2X5IB 3RNSA 4AE2A 3RSJA 4IEWA 5LRRA 4N7UA 4Q4W3 4RL7A 3RJRA 5GJ6A 2CV6A 4Y33A 2IXIA 4ZU7A 5I8YA 3IM0A 2FDKA 1YHFA 1VPHA 5LBBA 2Q8CA 1X9PA 3O1PA 4OHZA 2GH2A 1NLRA 2UY8A 3AXDA 4XF1A 1ULEA 3UV9A 3EMRA 2IFWA 3NV3A 4AHYA 2WC2A 3JUUA 4XABA 3H9AA 1EUUA 1UMZA 2ZEWA 5F3EA 2Q0AA 2B8MA 1QH6A 1QQP2 3PU3A 3T4HB 3WNOA 4B4PA 1Z7S1 4EN0A 3ZKYA 3AP4A 3RZGA 2Q30A 2ZBJA 1IS6A 3DPRA 1AXZA 4LOTA 4N8MA 4EN6B 1ZZCA 5F3IA 2R061 3K3NA 2A6ZA 2D6KA 4NO4A 5FKCA 1UIJA 3MI8A 2B42B 3MW3A 5BUVA 2VQUA 5GZEA 2VMHA 1BJQA 1COV1 4GKXA 1ZBA2 5BNNC 1UX6A 5KR7A 2RJKA 1LCLA 1YRZA 3OBAA 4F3JA 4MXWA 1BYHA 2WQ4A 1XE8A 2VZ3A 2CWMA 1QNYA 4E27A 4CUBA 3SCFA 2RDSA 3LA2A 3HMYA 4CP9A 5DQ0A 2BVBA 4Y22A 4MGYE 2DUOA 4JDMA 1T6GC 1ENQA 3CO2A 5FIXA 1JUIA 1S0EA 2VUJA 3LE0A 3ELNA 4HANA 5A3LA 2FBEA 3Q9OA 4IE5A 4M0HA 1UMIA 3WLUA 1Q8VA 5C4WB 3S57A 1XB9A 2D6OX 1FV3A 1H8VA 3DF0A 4HMZA 4QU2A 5FYHA 3I49A 1GZ9A 1NAEA 5KHIA 3AZXA 4GWMA 1Q8SA 2IXCA 1AHSA 1ST8A 1UYZA 2J1SA 3OG2A 5FZMA 3KWVA 4KGGA 5L19A 1JYIA 4QDQA 1YQ2A 3MIBA 3CHXA 2HWE2 3H42B 4AOCA 4YVSA 1GANA 2VCMA 1YJKA 4YGCA 3E6CC 1ND2B 1JTZX 3PLQA 1H2LA 1J84A 1RMU2 1ZBA3 1LHNA 1PGL2 3I2IA 2WNVC 2GN3A 2LM3A 4W50A 5KC6A 4YRDA 1W8NA 1H9WA 1MQTA 1FPN1 1AL22 1RINA 1VRH1 3ZXKA 3M4FA 4D7TA 3KHBA 4ATFA 4B1LA 4KU8A 3VZLA 3OF1A 4LKEA 4B3NA 1JZ3A 2Z79A 4ES8A 4LR4A 3U11A 1CESA 5JSPA 1DGWX 3A23A 5GZGA 4CEWA 2LW8A 2FCTA 4I01A 1EPZA 1N3QA 3AMQA 3DKWA 1NXMA 5DG1A 2EF6A 4YM3A 2ZMLA 3HBZA 4I02A 2OT7A 2W87A 4Q0SA 3UGHA 3VDAA 3OCPA 3VBHB 3OGRA 3POEA 4Q27A 1ZRRA 4P9IA 1JYCA 3HNMA 4LHKA 1FI2A 2HEYF 1ZRFA 5E8AA 1H1AA 1H1IA 4GZ9A 3ZLIA 2FDGA 4GXLA 3ECQA 4XETA 3RMXA 5A7WA 4BK4A 1BBT2 2XQRA 2HWE3 3WG1A 4LE4A 3E5UA 1EAH2 1UPSA 4L9BA 5JXIA 2E7QA 5A6YA 1W6MA 2A75A 4F8AA 2VXJA 2W0XA 2UWBA 4QXKA 2PHFA 4LHSA 2B9UA 5FYZA 5H9QA 2OPKA 1VBA1 5JIAA 3WDUA 4ATEA 5FY5A 4OI1A 4CCCA 5FZ0A 1AX0A 2ORZA 3OY8B 4CXYA 3BGAA 3GBGA 3BVCA 1PO11 3AL6A 3IPVB 1QGLA 1CX1A 2JKXA 1EUTA 1ZYBA 3BI3A 1XPWA 3PVNA 3SC7X 1RHI2 3B01A 1LU2A 5DDJ1 1NKGA 2WQZC 1GNHA 3WQ1A 2EICA 1MVEA 3AP7A 3IDBB 5FY0A 3NW4A 1SLIA 5JPMB 1RXFA 5DAVA 3HPNA 3A0NA 1C28A 3D3AA 3Q8EA 2VXRA 4LO6B 3KSCA 4UFJA 4Z2WA 4PBOA 5DABA 4Q4Y1 1FOD3 2GMEA 4PDWA 5CFDB 1EAH3 3I97A 2ZABA 5A3WA 1ND3B 4CPBD 4NHMA 3TAYA 2QQNA 4R8HA 2W47A 4C0HA 3M7AA 1F15A 3INAA 4W6XA 4XURA 2WRAA 2VE1A 1SQ4A 1A78A 1Q8QA 2XLGA 1WLCA 1BEV2 4IEPA 4FPJA 1SACA 5FZOB 1BVVA 1D4M3 2JECA 3MIFA 1W6NB 3ZDSA 1JUHA 1HB1A 1GP4A 4QPGB 3NO8A 4NWWA 3T3YA 3KV6A 3CKHA 2XJPA 3O1UA 2P3KA 2HH9A 2VCAA 1X33A 3APBA 3P5BA 4XZPA 4XE9A 4ZPIA 4ZU4A 1FX5A 2VQTA 3KV5A 2ZPXA 5FZLA 3ME2A 1GQPA 3JD72 1VJ2A 2BOJA 4KNCA 3ZXEA 3SKJE 3ZM8A 3N7MA 4S2FA 2RR12 5L73A 4FOWA 3U75A 4ZS2A 4JDNA 2UURA 5B2GB 1O3TA 3WOGA 4MGQA 1F2NA 1OOPC 1OI6A 3VL8A 1ZREA 2JXAA 4L2NA 2R041 4FSJA 4MUVA 1NOVA 3WNMA 1WW4A 4XHBA 3TB0A 5FXVA 3ZO0B 4M01A 1RVF3 5IWFA 3U14A 2QNKA 2DCZA 4UAPA 5E88A 1YFUA 2YB7A 3FUOA 4AVAA 2A73B 1Y9GA 2BZDA 2YBKA 3UGFA 2Y6HA 3LSDA 4YLZA 3WDXA 1APNA 4BWOA 2YU2A 4PLNA 3B69A 1HQNA 3MF6A 5K0UA 1UNBA 1VMJA 2H6BA 1BEV3 2DBNA 4Q5OA 4RN5A 3FN9A 2YG0A 4LIUA 2GZWA 1JZ4A 4RA0A 2ZKLA 4I0WB 3VN4A 1S2KA 3KF3A 4AVVA 3WF0A 3SH4A 4F83A 5DZEA 4NWVA 1PM7A 3WD5A 5FZ8A 4HOOA 5LY2A 5ABJA 4ZS3A 4Y4RA 1PMIA 2X5IA 2HWD2 2H6CA 4IESA 2E33A 1W8TA 2J22A 1AR82 4MHRA 2R16A 2WLQA 3B7MA 2QDRA 3SKVA 1CONA 1AYN1 2RR13 5KWRA 2W2IA 2ZKNA 3WHTA 5I8TA 2JX9A 4XQWA 3UESA 2DDUA 1JW6A 1REFA 1NZCA 1RUG2 2DCKA 2DUPA 2DWRA 2WQ8A 3E1F1 1PZ8A 3E97A 4C1XA 5CFCB 1UZWA 5JSRA 2DURA 1SLTA 3D8CA 1ALYA 4X6QB 5TSWA 5C8WA 3B00A 4GA9A 1NQJA 3FZ3A 2OA2A 4LHNA 3K4ZA 3S7EA 3WQBA 4HKLA 2QQPA 5AFBA 5DXDA 3GJBA 4MYEA 3A4UA 3RMYA 4XFFA 3SH5A 1CPMA 1W3VA 1W28A 4YVWC 2ZGOA 2VQ0A 1XSQA 3KF5A 4XVHA 5AVPA 4HN1A 3UETA 3WCSA 4A7KA 2D5FA 2WR9A 4CP0A 2EVXA 4FPOB 5FPBA 1G8WA 5FZBA 4AHXA 4Y1ZA 2BTVC 4FCAA 3N7JA 4E2QA 5BNNB 1E5SA 4YG6A 2Z69A 4HL0A 2ZGKA 4NVPA 4N43C 3ETPA 4D3WA 1NLQA 5IVBA 1MZ5A 3J8F1 4FTEA 1GKBA 1GYKA 5AC91 1L7LA 2A70A 2DFBA 3C7EA 4BIOA 3LOBA 1UPIA 3ACFA 1X9TA 2BEOA 5C9AC 1QY4A 1MS0A 3T2OA 1RUG3 1K42A 4QD2A 3CJXA 3G7DA 1CAWB 3W58A 3VKOA 1HB4A 3VZJA 4FP3A 2VBBA 4GB33 2WFF2 1LOBA 3IN9A 2SLIA 4RGGA 4CZSA 4LQRA 2R1BA 3KGLA 4LLFA 3CLPA 5GKAC 1ND2A 2ZHNA 2OKXA 1GLHA 1W9FA 4AEMA 1NA1C 4Y5Z0 1QJU2 1Q5OA 2VW1A 1EPWA 4FAGA 1ENXA 1NE4A 4GKYA 5E16A 4D69A 2NP0A 4CU7A 1AR93 4RR3C 3M3IA 5FLHA 5FPXA 3PUAA 2WNVB 3PUIA 4K7JA 4C91A 2WFPA 1E5IA 4QX2A 4BQ2A 4HETA 4DXSA 3CZJA 4YYOA 2GNTA 3TEYA 1KGYA 4DXTA 3PUQA 1TEIA 5J96B 2ORXA 4ORFA 2G9FA 5IVYA 2GNBA 4NPLA 3VBHA 1WMDA 2ID4A 5KHJA 1WZXA 3X29B 3OTFA 4W6YA 5K8SA 1OA4A 4A41A 4CDUC 1LB2A 3N36A 3D6EA 1I5PA 4XUPA 2W52A 1V9U1 1RUI3 1DYPA 1D2SA 3CL1A 3FJSA 3IDAA 5JOXA 4HBNA 3R4DB 3OB8A 4NRQA 1GP6A 4TYSA 4RGKA 3I2GA 1ASJ3 3WNKA 1KS5A 1W9WA 1W6PB 2E31A 2DVDA 3LB9A 4OUSA 5FPVA 2DCJA 1PIV1 1RUE1 2JDNA 4JC1A 5FYSA 5C6CA 4FFFA 3OY8A 4QKBA 1PVXA 3LZZA 5GLVA 1B35C 3H7JA 3NSTA 4QHOA 2X05A 5FPLA 1OPOA 1DG6A 1QJZA 4YW6A 4QX8A 5KXDA 4BQ5A 3IPVA 2HJIA 4PIXA 2ADDA 3DN7A 2XH6A 3MIEA 3MIHA 4Q4W1 4AEDC 4OI2A 4X8NA 5C3SA 1S0JA 4FPLA 4D0QA 3HT1A 3AJZA 2RS11 3R4UA 1N1SA 4EWEA 4QQOA 2DVAA 4FPHA 4YM2A 1COV3 4EYUA 3RZMA 3C7GA 1WWYA 5I0SA 4BQYA 2BNMA 1X8MA 2V4AA 2P2KA 4UFIA 4SLIA 4CYDA 1I5ZA 1BMV1 2V5YA 4XCAA 5JZGC 1EV12 2KD7A 3IIIA 1QXJA 2NMOA 2WT0A 4JTNA 5CFDA 1TMF3 3MV01 2YXSA 2ZEYA 4CCOA 1GNYA 3I7DA 1N3OA 4M3CB 3ZN4A 4AYUA 1VLNA 1X36A 2VPVA 3H8XA 1S2EA 3VLBB 4GJZA 2JIGA 4YM0A 4EE2A 1PGW1 1YCIA 1LOGA 1R1A2 5FZOA 3BIWE 1NCQB 1XU1A 4LK7A 3LDBA 2IFRA 5IVCA 5FDBA 5C5UA 3HQXA 1W8FA 4DRVA 2DU0A 5FV3A 3KLSA 5A6XA 1LTEA 4KMQA 5JOWA 4Y1UA 4FP2A 2VU9A 2OQ7A 3VUOA 4AR2A 2QQJA 5FO8B 1QQP1 3WP3A 1UXZA 3WDVA 3ZSKA 4AQSA 1GOHA 4NRMA 2D98A 2XPJA 1QDOA 5H9RA 1EV13 2XLFA 3PVOA 5J48A 2AEYA 1A8DA 4YFWA 1EYBA 3ZFFC 2ZCWA 1AR72 1W0NA 4L97A 4RHV2 4Y1YA 1ZZBA 3N9LA 1ZBA1 5C5TA 1T6BX 4RD7A 4RS5A 4YNIA 2A6VA 2D6MA 3WDYA 1F9KA 1VBE2 1OQEA 2R6QA 1FAYA 5A1LA 5A7SA 3SITA 1ZBE2 1U5YA 5JLVA 3BTZA 3PVEA 4LUMA 1H9PA 1HJGA 4JV4A 4L92A 3GGLA 1N1VA 4LBQB 2J1UA 2TBVA 5EWSA 3EQEA 5JIUA 1A34A 3ES1A 5DUUA 4DUWA 3OUHA 4A7YA 2GP3A 2Q1MA 5ANNA 3B94A 4O65A 3H8UA 4CEYB 2K9ZA 2PHDA 2K2SA 3ACHA 2AUYA 4LNVA 2JDHA 1ZZ8A 1RL3A 2Z2SB 4LHLA 3DKQA 5G04L 5L9VA 5FZ4A 1ZA4A 2CAVA 3FHQA 1RJ7A 2UYAA 1XYOA 4NIAA 4P9XA 4CDXC 2EAAA 4QQ2A 4QX0A 3NAPC 1HQWA 3B02A 2R49A 4KI5M 2HWE1 1AR73 2QQWA 5CFCA 4RHV3 1PGL1 3PURA 4FPGA 1HN0A 1O6UA 4QM9A 5FLIA 3B9IA 1FNYA 2N7GA 2O14A 3D0JA 3LFMA 1VBE3 5DZFA 2GMMA 2F4LA 2Z5WA 1UU5A 2D6PA 2PA7A 3GXUA 3GZEA 4BMBA 2VZTA 3C8XA 4Y26A 1C57A 3UNPA 4R9DA 1GBGA 5DAPA 4XJWA 4OI0A 2E63A 3VBUC 1NQDA 2B9VA 5BNNA 2VVEA 2FQPA 3CU7A 4COVA 5I93A 3KQ4B 1WD3A 4AI0A 1FV2A 3QD6A 1V6KA 4Q1RA 4WM7B 1UD1A 1XRUA 1ZRIA 2PFWA 4OHXA 1QH7A 2GH8A 5FYTA 5IAXA 4E9KA 2QDNA 1JYWA 5DAWA 1RYYA 3N4MA 2Q1FA 3PUSA 1QXPA 5F3GA 4YW2A 4D6RA 3H8OA 1IS3A 1DQ4A 4N43B 4XFHA 5J7MA 4IV1C 5G05L 5T5LA 1FOD1 4Y22B 1EAH1 1CAWA 1MVQA 3IKWA 3KMHA 5J1XA 4XUQA 1O3SA 2DV9A 1LHVA 2HWB2 2JD4A 1W2AX 3RZKA 3IDEA 4KG8A 4Q2FA 4S2GA 3N9MA 4NIHA 2WZR3 2EXHA 4P00B 3ILFA 2A6XA 1OHFA 3PMEA 1YC61 2RS32 1PMJX 1D4M1 1YQ6A 4K1YA 4L0PA 4ISRA 5GLZA 3ZYBA 5FP4A 3IMMA 2HYKA 2JDYA 2WKKA 1N3PA 2WNVA 2YBSA 2BRTA 3VBRC 1XE0A 2C9KA 4A6SA 1U0AA 2P6HA 1RUC3 1XYNA 4H3WA 1TNRA 5C71A 1QJFA 4QXCA 2O0OA 1GQGA 2PYTA 4LA3A 3SMHA 1HB2A 4WM8B 4AG4A 2HWC3 1FMD2 2WT1A 2ZACA 5KXEA 3VBOB 1K5JA 2Y6FA 5F8PA 5IVFA 2XUEA 1CR7A 2HWB3 2C4XA 5D21A 3WVJA 1W6QB 3PL0A 1YIFA 3E6BA 1J1TA 2P17A 4K8FA 3I3QA 4KL1A 3WQ7A 4HK9A 5A7PA 3WSOA 4AI1A 3PJYA 1U5ZA 5FY1A 2X8KA 1UYXA 3O0XA 5JWPA 3BTYA 4AFCA 2CDPA 4CDUB 1BEV1 2KA3A 1S0BA 1CIYA 1W6PA 2ZEZA 3J9SA 1D4VB 4AFBA 5FZEA 3KVAA 3H3ZA 1KEXA 3NVCA 4QB2A 2DF7A 3K3OA 1MPXA 4HKWA 3DEMA 3U4SA 5CADA 2XJVA 5E89A 5C3RA 5FO7B 4XFGA 1LJ7A 1CVNA 1YYNA 1CZTA 1B35B 1MACA 2RR11 2ZMNA 3I8TA 4XFCA 1DQ2A 1FMD3 4XF4A 1FT9A 5JXHA 3HNBM 4XDPA 2GC3A 4AEDB 2GNMA 3VBSC 2EAKA 1PO23 2O8OA 5GLUA 1ULPA 5D1IA 1XYPA 1POQA 1WCDJ 2BGOA 3NJVA 4BQ3A 4J25A 5AVAA 2VCBA 3ZYGA 2NQYA 3ACLA 3N7KA 2CTVA 4M3CA 4G4FA 2E6VA 1YFWA 3NL1A 2W1UA 3OSDA 5JZGB 2W68A 1UOFA 2JG9C 5F5QA 1V0AA 1DGRN 4JTOA 2ZZQA 4GWJA 1GOGA 3RS6A 5A33B 1NCQA 2Y34A 2HWD1 5IVEA 2XJSA 2J1AA 1OFNA 5F32A 3ZFEC 3WW4A 3ZXDA 1WGPA 1WLDA 3JBG2 2DVFA 2ZX3A 2ZGQA 3JQWA 4OZOA 3PDQA 3K4AA 4JGYB 3OGJA 1TQ5A 4WBBA 1SCRA 3ZPYA 2DTWA 1Q8OA 1RUG1 1RUJ2 1Z78A 2Q8DA 4HLTA 2WZPP 1AUYA 4N9IA 4PJYA 5A80A 3U1XA 1WCKA 1LU1A 2YYOA 4P9WA 4GWNA 3CQOA 4R9AA 4COYA 4DIQA 4EWAA 2FDIA 1X7NA 1N1YA 1AR62 4R52A 5IJRA 1YIPA 4HT1T 3JCIA 2W5FA 4OMCA 3RI9A 4Q0PA 4BPZA 3KB5A 1UXXX 1FATA 2W46A 1O91A 5A6QA 4XAAA 3J4UH 5FYIA 4AFMA 1MZFA 3KM5A 2B7YA 4V2VA 5EYYA 3I3BA 5CAZA 3V65A 3ZXFA 4LBQA 4B7KA 2FDHA 3JBG3 1CD3G 1CZSA 4XBQA 4XOGA 3LEIA 5JDBA 2C24A 2J1RA 3E5QA 5FAXA 1G9DA 3V0BB 4ASMB 1IKPA 3O1OA 4CEYA 5GM0A 4NHYA 1XC6A 4OUEA 3RVHA 3A21A 1US2A 1PX4A 2ENRA 1W2TA 2RMU2 4BQ4A 4AVCA 3NKGA 3MHZA 1MS5A 5LBCA 2C9AA 2X09A 3UKTA 1I3HA 3CJIB 1S2BA 2WFF1 4IEQA 4IL7A 5ERLA 4NIIA 2JG8C 4W8JA 1RUI1 3VDDC 1K5MC 4J6GA 2XONA 3LGRA 1PZ9A 1S1AA 4XF3A 3ZSEA 1KJLA 1HV1A 2RS13 1ASJ1 1CAXB 3LPGA 1UX7A 3Q8AA 4NN0A 3T09A 4CDXB 5L7OB 2D40A 1JU4A 2AR6A 2EA7A 3PUHA 2ET7A 3MV11 1MS8A 2JDMA 3J7HA 4AI8A 3K46A 1W05A 3MEPA 4L99A 4EN9B 3E6DA 1LRHA 4LBJA 3UJOA 1S0CA 1NUKA 2JB8A 4K20A 3BCWA 4WM7A 5FOBB 3TEWA 4LBLA 2A5ZA 1SMVA 3F2ZA 2RMU3 2PN5A 2VJXA 5HCAA 3VBUB 3WW3A 1W90A 1HRI2 1HRV2 2B45X 4NUBA 4JVAA 3HWJA 4QPIB 3W5MA 3AX4A 4ZZ5A 4N43A 1G6NA 2ARAA 3M1HA 3A0KA 3DXUA 1TMF1 4Y20B 4FFIA 1ENRA 4BMEA 5C8CC 2P5BA 4QDSA 1MS4A 2A6WA 3LA7A 4LJHA 3AKTA 4EQVA 2J7MA 5C9AA 1J1LA 4NR1A 4B4RA 3ROUA 5IUQA 2VVDA 5LWBA 1DQ6A 4O7XA 1UU4A 4FPKA 1OT5A 1QQP3 5DMYA 5D8AC 2FZ1A 3MGUA 1JZ6A 1UZZA 2JDKA 3ITQA 4AQTA 1PK6B 3Q8BA 4XDOA 3VKLA 1QDCA 2VW0A 2UY9A 3HQUA 1VIWB 2AZ5A 4CU9A 4HN0A 2X10A 4I3PA 4Z07A 3UT0A 5ACA2 1UKGA 3AYDA 5LCWL 1C8M2 3EXUA 1I6XA 3FBYA 4P5YA 4DO0A 3ZVXA 4E2GA 1HRI3 2TUNA 4WM8A 3DECA 1IHMA 1JZ2A 2AEZA 1EV11 4AAPA 3VBOA 1C5HA 1K12A 1ZX5A 5JPNB 2YFUA 3M3CA 5DAXA 4QKNA 1UU6A 2JDZA 1QIQA 1W6QA 4RQPC 3WHUA 5A70A 3LEGA 2WT2A 3ZSMA 1AXYA 2VG9A 4QMAA 3SQOA 3HN1A 3H8RA 3FLTA 2XUMA 4CDUA 2NN8A 4MGZE 2E32A 3QOPA 2VZOA 2VMCA 4B29A 5D2AA 3WG3A 2FDFA 4IGOA 2P37A 4FPYA 2XXZA 3KVBA 4IETA 3THCA 3WG2A 4CDQB 2GP5A 1V6NA 1J3PA 5BNPB 3RI8A 4DB5A 2LS6A 1RMU3 2ZGTA 3H1MA 3H3UA 5CYYA 2F4PA 3WP6A 1H8TC 2MEV2 3GDBA 2QCSB 3MPPG 4W4ZA 4I2OA 1B35A 4B7EA 1AL23 4IEZA 1SDWA 2WNOA 4OZXA 3FFQA 5JOZA 4J1XA 1KD7A 4AEDA 4XIKA 2PHRA 2YUEA 3CF6E 1AR71 1GP5A 4RHV1 1YFXA 2A1XA 4PHZA 5F6LB 4YFZA 2V73A 1VBB2 4BU2A 1VBE1 1CX4A 4TTGA 5E6HA 1F5JA 4QAWA 3O0WA 4AWDA 1JU3A 4CCLA 4CP1A 2HKXA 5JZGA 4FTBA 3BIEA 2DFCA 4EZ4A 3NMBA 1BZWA 1NZIA 5FUIA 5I91A 5C3QA 4LORA 1BBT3 2OUHA 3VDCA 5A33A 4FBFA 3ZFGB 3A7QA 3N35A 1WMEA 1VRBA 3ZPOA 1VR3A 2CL2A 3OGSA 2JG9B 2YBPA 3O14A 2EIDA 4ARYA 5C3OA 2PQSA 3VDBA 1PNFA 2FCUA 2WYFA 3T1MA 3GZTB 4KBBA 4NJ4A 1HW5A 2ZHMA 1RUH2 5EJ1B 1RUF2 4JGYA 1K3IA 1L7QA 2Y0OA 3FFZA 2FHRA 3B5LB 2ARCA 2CDOA 2FZ2A 1SEFA 1XBFA 2R7EB 3ZKUA 1G7YA 1YI9A 3AK0A 3AZZA 4XFBA 5FMOS 4ASLA 1CZVA 4K3UA 1IS5A 1VBB3 1HX6A 1RHI3 2D3SA 4BZ4A 3AMNA 4P08A 3I2OA 2WZR1 2DVGA 2BUKA 4NRPA 2E9QA 1ONAA 4GH4B 2BNOA 1JI6A 3M3OA 5KHKA 3AYCA 3H7YA 2XVGA 4PIYA 4EV0A 1Y9QA 4ARXA 1W8UA 1JHJA 1WLWA 3BOWA 4QU1A 4C90A 3GBWA 4IEYA 4WZCA 1XSRA 3P1IA 1BKZA 3J26N 1UZYA 3MUY1 2RJ2A 3OGVA 4OULA 3RDIA 2D3PA 2RDRA 1X50A 4EN8B 3V0BA 1RUC1 4RS5B 4HSLA 1DYOA 1XU2A 1RUH3 3JU9A 4TXWA 5IW0A 5BNOB 2YROA 2HWC1 2XL9A 4M3CF 4FTSA 1JZ5A 1KJRA 2JICA 4PQQA 3GHMA 2Y60A 1AL0G 1HQLA 1TE1B 2CAUA 2XJTA 4LIVA 2OPWA 2JEMA 2XWJB 4JRLA 3S5AA 2HWB1 3POIA 3CJIA 3GF6A 3MICA 3ON7A 3WEZA 2JENA 5JOYA 1R082 3KT7A 4N53C 2JJ6A 4XJAA 2WIIB 4DQAA 1O4YA 3LQCA 1J3QA 2EIGA 3JD73 4KWLA 2VR4A 2NZ9A 3KHCA 1TME2 1CAXA 5L7OA 2RS31 1WUVA 4CDXA 1KS4A 5FZ1A 2WZ8A 2XHNA 3T0BA 4YZ5A 1ULCA 1LOFA 2JG8B 4LK6A 3POSA 5JAXA 4YG3A 4CDWC 3J7NA 1JOPA 1MZEA 4DY3A 3W5NA 4XDQA 3R0RA 1IQDC 3IMNA 4FAHA 1Y7BA 2PAKA 4W65A 1DLLA 1VBC2 4H14A 2ZEXA 1Q8PA 2I2SA 1FMD1 2YC4A 3AB0A 3TEZA 4C8DA 5C3PA 2JDPA 1LULA 4YSFA 2SBAA 3DL3A 4OYUA 2VNGA 3I3DA 4CSWA 4COUA 3VBUA 1PO21 2OZJA 4QPIA 1O3QA 2Y6GA 4GULA 4EWDA 2XGXA 2CSGA 2HWD3 5DUVA 1R083 3WDTA 3WV6A 5GZCA 3ZYHA 4QDRA 1AR83 4Y20A 3SCGA 3NV2A 2GALA 5JI7A 1ZZ9A 3I2DA 1GNZA 5FWJA 4A7ZA 1NE6A 1X8EA 2BWCA 4NROA 5A1FA 3BU0A 1QJY2 1RITA 1WKYA 3U37A 3T2QA 5EP9A 4NE9A 3K48A 4ZXEA 5C8CB 3ILNA 4FO9A 2GMPA 1H1MA 1PK6A 4QGNA 5SV5A 3FC0A 4A3ZA 3TN92 1O4ZA 2Q4SA 4FPEA 2A71A 1DF0A 1AYM2 3HQRA 4IQPA 3KCYA 4YM1A 5FZGA 2VMIA 2VC9A 2W92A 5FZFA 5DG2A 2BW8A 1CQ9A 3L9JT 3NV4A 1CIWA 1LOAA 2R32A 4LXLA 1US3A 3GCWA 2B46X 1IQAA 3HVDA 4PI2A 5GZDA 3N9PA 1QKQA 1QXRA 1IZ3A 2OIIA 5FREA 4DXRA 2VMEA 3H3LA 4Z82A 4NMIA 2BPA2 3N9QA 1OVSA 3T4VA 3VB9A 1RGSA 3VGIA 1O7FA 3VZOA 1AJKA 4CUAA 1HV0A 3FBMA 2AENA 1QJY3 1LGNA 1MZ6A 2R30A 3BOPA 3GALA 3NNMA 2BVVA 3I3EA 2YMZA 4A2UA 2VBDA 3WX5A 4HVQA 3B9CA 2RVAA 2FCVA 1LGCA 1SHWB 1E57A 4Z1VA 4CDQA 4H7LA 4I0AA 4JKMA 3ZIWA 3JBG1 2J1EA 1CJDA 1AYM3 1X82A 2WFF3 3AZVA 5BNPA 3WW2A 1MQTC 1NYWA 2PLV2 2DBIA 2HLEA 5K4LA 2QKDA 5CEHA 3RZZA 5CKQA 4TLGA 4DRRA 1QJU3 5GALA 2HBUA 3ASIA 5FUPA 2GNDA 4MGSA 1RUJ1 3AZYA 3K2OA 2FDJA 3KGZA 4PBPA 2XBO2 4DEVA 2UU8A 4CEWC 4AEJA 5A3OA 3IZOA 5I0RA 2GC2A 2JDAA 2YV8A 2RG4A 3HEIA 3VL9A 2VY0A 3MBWA 4IEXA 1C5IA 2MPFA 1DGLA 4DINB 4XHXA 2E53A 3HIFA 3F95A 4DNYA 4ZXKA 1BHGA 3OD0A 3VD9A 5KXBA 3MFCA 3ZR5A 4EJRA 4QHZA 3I2KA 1XNCA 2WNEA 2E7AA 2VZQA 3O1RA 3WT3A 1LEDA 2JE7A 1H2NA 2WS92 3AC0A 4MV2A 4NHKA 1O3RA 2YGMA 1G9BA 2ZGRA 2VNOA 2VUCA 5KC5A 4BXSV 5J37A 2BP6A 5IAVA 2ZGPA 4E8DA 3ZFGA 4P9GA 1H0BA 2Y6JA 2PLV3 5CG9A 4O61A 4GALA 3WF1A 2JG9A 3ATGA 2RMU1 2C1FA 2WINB 1GWMA 2AACA 2XBO3 1QOOA 1BK0A 3IAPA 3LIGA 5IK8A 1DZTA 3ALQA 4ITCA 3ZFEA 4G3YC 1OD3A 1V6JA 1ZA7A 3RRDA 4JDOA 4Z2AA 3RG0A 4DOUA 4NOTA 5FP8A 1NX9A 1VRH2 1GWKA 5A6ZA 4BISA 1BXHA 3ST7A 2VUDA 5E1RA 1A6CA 4QGMA 4Q1PA 4EZHA 1KRIA 5CKMA 2WJSA 5JR2A 3RYKA 4BH9A 4KWKA 3M70A 4YW4A 5F2SA 1HJFA 5BYNA 4RGAA 3T0DA 1BCXA 4GH4A 4PDWC 1VBD2 2WS93 5DAQA 3AP6A 4M3CE 1UN1A 2VZ1A 2ILMA 5KHGA 2XKOA 4MXVA 2WSUA 4NIGA 1SPPB 1WMFA 1R092 4Q29A 3AYEA 3SXWA 1JOBA 2QQVA 1PZ7A 4LBKA 1I1EA 1EY2A 1OOPB 1OBNA 5FPAA 2CGNA 1DIWA 1HRI1 3QCWA 3WR0A 5BNOA 1R1A3 2BV4A 3M2MA 3QH6A 4BA6A 3PMSA 5LBFA 2IC1A 5FLJA 2GU9A 1QHDA 4MHUA 4QX5A 1VBA2 5A7NA 4QXHA 3NRUA 4AFDA 1PVC2 1NLSA 1O4TA 1S0FA 1OA2A 2ZX0A 1ZRDA 3RWKX 4Y3OA 3FWEA 1PO12 3M8LA 3MF9A 2YY1A 3HNYM 1VAVA 4RYDA 1BQPA 5T5JA 1VBD3 1O5LA 4XMAA 5EFUA 1LR5A 1QJEA 2W1QA 3AMPA 1SFNA 4QXBA 5FJHA 5K7PA 2PTMA 2XDVA 2JG8A 4QPWA 4LT5A 2XJQA 2EXKA 2VCCA 3AFGA 4U2AA 3RYRA 2BGCA 5K0UC 1UO9A 5CU1A 2RDQA 2LRPA 4RFRB 1RMU1 3BYWA 1BLZA 4XTPA 2V72A 3CDZB 3QBQA 2CNAA 4Q4Y2 3BUCA 1SBEA 1UY2A 3AJYA 4LO5B 4FT8A 1AL21 1GICA 1XJAA 2PELA 4CPBA 3IAQA 5ABJC 1ZBE3 3O1TA 1PHMA 2X5IC 1POV0 1U5IA 1V6MA 3KD4A 3AFKA 2VL4A 5T55A 1KITA 4Y5TA 1JH5A 4Q4X2 3JB4C 4FOQA 4HKOA 3C3VA 4YVWB 2QQLA 4LKDA 1ULOA 5FYCA 4FVVA 4PQ9A 3AKPA 4IE0A 3ZN5A 4KWJA 4XXPA 1ZRCA 1O5UA 3WQ0A 2ARBA 1C8NA 2WN2A 2AYHA 1W39A 4XJZA 4ET7A 4YARA 3ILRA 1BBT1 3FHAA 4E4DX 1LOEA 4NPRA 4E4SA 5C7GA 5C8CA 2XWBB 4LTAA 4MADA 1WCQA 3ORJA 2W39A 2XVKA 2MEV1 2ERFA 4TN7A 2RM22 5C9AB 1H30A 4HVOA 1GU3A 4XFIA 4BM8A 4CXXA 1H4GA 3MIGA 1OUXA 3C2UA 2QFEA 3OPZA 2WO7A 2ZJCA 4I0BA 2VMDA 5FZCA 4L8QA 4XPVA 3WP4A 4GMP0 2WA4A 3THPA 2KR2A 3QACA 4HZFA 5FZ6A 5HXMA 2Y33A 1LHWA 1NT0A 4Q4X3 3VKMA 2PAMA 1F5FA 2CU5A 1UOJA 2BQPA 2HEWF 4PLOA 1VBB1 5C4WC 1RHI1 4NHLA 4HG6B 3RWNA 1NA1B 4PF5A 4XTMA 1POV3 4XXAA 5FZHA 2ZX2A 4YGBA 1OF3A 2R1DA 3Q8CA 1XXNA 3DYMA 3OYWB 4RR3B 5FQ0B 2Y64A 4LUKA 4MVTA 3H0OA 2LALA 1OLMA 2RHPA 3N3HA 4XQDA 2OYZA 4LO8A 1UCXA 5CA6A 4O9EA 5F37A 4HFSA 4DZGA 3FL7A 1ENSA 4DFSA 2X29A 4FI9A 4L11A 2WSVA 4XJ8A 3BU7A 1HN1A 2RM23 2XOMA 1VB2A 5A7QA 3DUIA 1WA4A 2ZHLA 1W2UA 1RUH1 4QB1A 1H2MA 2RS33 3P3NA 4D6SA 2W9XA 4JQTA 5FBZA 5FP3A 1YNAA 4JX0A 4AZZA 2W1WA 1KDKA 2Y38A 4Q4V2 3WF4A 3DYPA 2OUJA 5FXXA 4CRQA 2GC1A 4IGPA 5DPNA 3VBHC 2WL1A 3KT1A 3K4DA 4INDA 4LULA 4YGDA 2WAOA 3LOIA 3JD71 2VZUA 1W06A 4YW5A 2R0HA 2VTXJ 1HXS2 3BN6A 4S2DA 5FZDA 4BDVB 4UFKA 3UJQA 4BE3A 3LEMA 3LF7A 4HPKB 5CB7A 3T30A 3IBMA 5IVVA 3NNGA 2HWF2 1JZ7A 5I8SA 3TEXA 1SZBA 2WWUA 5IK7A 1R1ZA 3AM2A 4BXFA 1DYKA 1C1FA 2EIEA 4GQ7A 1GOFA 1W8WA 1AVBA 2G1MA 2QE3A 4GIQA 2FMYA 3U07A 1RUOA 2V09A 3NJYA 4FOYA 4H7MA 4MH0E 5H9PA 2WABA 4CA9A 5FWEA 3LEKA 1L7RA 1UY0A 2RS52 3BODA 3FHIB 4PI0A 1VP6A 3O1SA 1KFUL 5A3NA 1GUIA 4XMIA 5LW9A 1JYTA 3VD3A 1IPKA 2GSYA 3MDPA 4LEJA 1R081 3OBTA 4AI3A 3RQ0A 1AR81 2D6LX 4YZ3A 1M4WA 1XNDA 5F7UA 1HXS3 1TME1 5F5IA 1SLAA 1V70A 1XQNA 2XJRA 1RB8G 3B93A 3KT4A 1GZTA 1SLLA 2VECA 3CBNA 1VAMA 4XJ9A 4P5HA 2YPDA 3MW4A 1LHUA 5DN2A 5CFDC 3BALA 4X8PA 3VKNA 2HWF3 1W0PA 4QKDA 3LDRA 3EO6A 4AK3A 1ND3C 2VZSA 4TLFA 1WLTA 3LIHA 4XW3A 2BOIA 4FPCA 4LBOA 1SCSA 1SPPA 5JUVA 5IK5A 2C0ZA 2NLRA 1VBC1 5EQUA 2XLAA 4D6QA 4KQ7A 1ODNA 1MS3A 1OUSA 2VOTA 2ZMKA 4K6BA 2RS53 3GBFA 1OOPA 4P9JA 3VHOA 2Y26A 4QPGC 2OZ6A 5FMCA 2LUWA 5J3UA 1KXGA 3BPZA 1PMHX 2ETEA 3ZFFB 3U0ZA 3FX3A 5FP9A 5IT6A 1REEA 3ACGA 2PHTA 5J98B 3O1VA 3S5QA 3O7OA 1RUE2 1SDDB 5L9RA 2V4VA 5T3NA 4A42A 4R9BA 4FFGA 2XKPA 4BQXA 5EJ3A 1DDLA 1QJY1 2WBKA 4XFAA 3R4SA 4KG0A 3ZYIB 4E8CA 3I2FA 1JS9A 1OMIA 4Q4W2 2W3JA 2ZA9A 3CIHA 4DUVA 4N9HA 3PTYA 1W9SA 2P4EA 2W91A 1RUJ3 3GZAA 1WW6A 1YQCA 1YFYA 2BYVE 3Q8FA 5FMOL 2YHJA 3SHRA 4YZ2A 3KV9A 1JN2P 1O8SA 3ZSLA 4AAXA 3AZWA 1AYM1 2W08A 2YC2A 3MLLA 2Q8EA 1QJX2 5LK7B 1Q3EA 4AVTA 4YZ4A 1AR63 1BMV2 3R6SA 1Y3TA 4JGZC 3VBFC 3LWCA 3LPFA 4ONUA 4CVUA 2ZGUA 3P6BA 5JMOA 1N47A 1QJU1 3ZYJB 3U10A 1IGOA 2E7TA 3NAPB 4I09A 4WV8A 1W8OA 2W1SA 3TBDA 1UAIA 5GLWA 4OCTA 2MNGA 2BU9A 4FQZA 1OH3A 1CWPA 4GAZA 1K45A 1WW7A 5FK8A 4IV3C 1CJPA 4LA2A 4BLIA 4YVWA 1W2NA 2VMGA 4QB6A 4QKFA 4MGIE 5APAA 5BV6A 4HSJA 3WUCA 3S0MA 1QNWA 1BVP1 1UY3A 1UL9A 3GNEA 1WMXA 2VZVA 3QLQA 4BCUA 3WP5A 5CFCC 2ZGMA 2WNUC 5LATA 2DCYA 4KWUA 3V56A 3N9OA 1OLRA 1SBFA 2EIBA 3WINE 2IVJA 4QX7A 4SBVA 1YQ5A 3ZR6A 1QJX3 3WXPA 4UFHA 3WUDA 1A8MA 2DTYA 2A3YA 2PLV1 1MEC2 1NY72 1UOBA 3EHKA 3K77A 1UMHA 5FCCA 4R4XA 1MR5A 3PU8A 4IV1B 2AGSA 3TYJA 2XBO1 3HJRA 3VD4A 4QQLA 4OQ8A 2C26A 2XG3A 4QQHA 4CXWA 1GWLA 2J1TA 5FUNA 5CBLA 1DQ1A 1U12A 3B3QE 1Q56A 1Y43B 3C7FA 4GJYA 4Q8LA 2XR4A 4UF0B 1AZDA 3POGA 4UXAA 4PF1A 5CNAA 3WNLA 4A45A 4COWA 2MHFA 2ARXA 4NPMA 4K8RB 2VZRA 2A3XA 1NA1A 2R072 1S4CA 5FY4A 3VZMA 5CG8A 4I3GA 5F5AA 1DU3D 2WS91 1W3XA 1S0IA 3OYWA 1OH4A 4RR3A 1HRV3 2J42A 3H1WA 3MFAA 3USSA 4WVMB 5FQ0A 3TOJA 5FPUA 1CGPA 4KGQA 2QBXA 5A3PA 5F3CA 3KV4A 3VBRB 1JMUB 1TNFA 1O59A 1ULGA 3ZOIA 4ZKTB 1KDMA 1QEXA 1AX2A 1MEC3 4V1PA 3KZ4C 5BY5A 2IXHA 4LPLA 3P3PA 1F4HA 2VTXA 4CU6A 2RE9A 1UQXA 1XNKA 4PT6A 1RTVA 2G9GA 2KM2A 4HVRA 2CGPA 3T2TA 1R1A1 1H6YA 3THTA 1OPMA 2XVLA 2VVFA 4JZRA 4LKFA 3T1LA 4MG2A 4QQPA 2VOXA 4UW6A 3UKNA 5FYYA 1LODA 4QWNA 3LCPA 3WG4A 4A4AA 5BXXA 3UGGA 3J7MA 1YJLA 1UY4A 3NQHA 4ASKA 3CNAA 5ACA3 3NJXA 1YQ8A 5IFTA 4B4QA 1C8M3 2R073 3OUJA 4FOVA 3ACIA 4PLMA 3USUB 1I9RA 5I0TA 3WDWA 5I0UA 1VBD1 4B1MA 2VUAA 2F17A 2JKBA 1T2XA 3AP9A 4HPKA 5JCTA 3IDCB 2BGPA 4O9GA 2VOVA 1C3HA 1Q43A 5CVRA 4ZY9A 2QTWB 1R091 2D3RA 2CYFA 3DV8A 3ZDVA 4BIFA 2D93A 4AGGA 1JHNA 3AMMA 4DEQA 4ISQA 4CCJA 4OHVA 1UZVA 3HR9A 5FBJA 4COZA 1FOD2 1GMMA 2XMLA 4TSVA 3VBSB 1WA6X 2BWAA 3VV1A 4BJ0A 2E26A 4Y4YA 4D7YA 2D43A 3BTAA 3I59B 5T52A 1IG3A 1ZBE1 1EP0A 3NNJA 4AEKA 4CP2A 4OHYA 1OSGA 4QPYA 1SBDA 4F7ZA 1OC1A 5IFPA 2BBVA 3WNNA 3POBA 1GZWB 1PVC1 1OA3A 3G6JB 5FMBA 3WZ1A 3ZX7A 3RZHA 1UYPA 1D7PM 1D4M2 2G9ZA 2K46A 2Y8KA 4LOSA 5DUXA 3BKZA 3AKQA 2MEV3 4AL9A 3SNMA 4K40A 4Z8BA 4KH9A 5HV4A 4AHZA 4IDZA 3OGGA 1ZNPA 1DZQA 2WYSA 3ZXAC 4OUMA 1MS1A 3WW1A 3NV1A 5L36A 3J7LA 2YPJA 5FY9A 3ZFEB 2IXKA 1YEWA 2B5HA 3QH7A 1UYYA 3SH3A 4META 2DU1A 1HIXA 4FFHA 4XUNA 4IUGA 5FJKA 4NAMA 4AF9A 3O0VA 2P1BA 4BB3A 3UYJA 1V6LA 3AVSA 2NMNA 3ZXGA 1W8ZA 3V64A 1LECA 4JQRA 5T54A 1RUD2 5F6KA 1RVF2 3M3QA 1NCQC 5JXJA 1E5RA 2WO3A 1E5HA 1VMFA 5LBEA 3NWKA 2JD9A 1XE7A 4IEUA 3MYXA 1JYVA 3URFA 3ZFFA 5FO9B 1DGWA 1NG0A 3OD4A 4ZU5A 4Q4X1 4XUTA 4S2HA 2D6NA 4JHZA 5FZ7A 5SV8A 1GZCA 2CWSA 3PIGA 3JZVA 4DY5A 5B4NA 2PAEA 2QQUA 4Y1VA 5KXCA 3PTRB 1QMJA 1B09A 1POV1 3AXEA 3C7OA 4M4PA 4LMFA 4QX1A 1VAKA 3VZNA 1JXNA 4JRAA 3UKVA 4XZUG 5HCFA 1KFXL 2QQOA 3MLJA 3V0AB 1RUF3 1UOGA 2OW4A 2NYYA 3WF3A 2WAAA 3I2HA 1W04A 1IOAA 3ZSJA 3FMGA 1OVPA 1DLCA 1JOJA 1L3JA 3THDA 1YO8A 3K75B 2RM21 1YWKA 4IE7A 2XB6C 1RUD3 2VNVA 2W94A 5AFEA 4NAOA 3I54A 5CZKA 3ZYRA 1W6OB 2EALA 4XF9A 2TEPA 2Y0IA 2ZAAA 1NCRC 3HAGA 1CAVB 3NAPA 4AVBA 4BQ1A 3LKJA 3VDDB 1K5MB 1LGBA 4MGKE 4AQ2A 5FZ3A 4JGZB 4CEYC 3RFRA 3VBFB 1J83A 4N90A 3WNXA 3HOBA 2I45A 1V6OA 2H0BA 5JI9A 4A6OA 4GMP1 2RV9A 5FY7A 3VHRA 1DGRA 3MLKA 5FK7A 5FZAA 3CMGA 2O8QA 4Q0QA 5A3UA 4R9CA 4XC9A 4KU7A 4UFMA 2CY6A 4Q0VA 5T5OA 3OBRA 4IV3B 1G9FA 1W8HA 5EHDA 3T2PA 1UW8A 5EZWA 5LB6A 1F4AA 1JODA 5FYVA 1RJ8A 1FNZA 2IXLA 4CCMA 1LKNA 4MSVA 5HBAA 3DCQA 2VQAA 5CIRA 3WY6A 2WNUB 1RIRA 1TME3 5FPZA 4PIZA 4GB32 4AVSA 3DPRC 5F2WA 4I30A 4IV1A 3SEEA 2VGDA 2VM9A 4Q4V1 2ZXQA 1W9TA 1GFF2 4NIDA 3GHNA 3RZLA 4WM7C 3JQXA 4NHXA 1PX3A 2PMWB 3POWA 4UF0A 3MO4A 5L9BA 3R05A 1AR92 4CCNA 2L9LA 4XBNA 1HXS1 3EYPA 3FE5A 1VBC3 1VE0A 2BDRA 2ZGSA 4JHTA 5D8AB 2WO2A 4ZZ8A 4D94A 3ZXJA 5BNQA 2FD8A 3ZMOA 2V5DA 3W21A 3CEWA 3LDKA 2HWF1 4E4HA 4WVMA 5C4WA 3BTXA 5F1RA 2ES3A 4M00A 5IVJA 2D7FA 1PNGA 1AJOA 3ABZA 4P14A 3VBRA 5FXWA 2ZZJA 1R64A 2PHLA 2WWSA 1ZM1A 3HBKA 4YW3A 1VALA 4BQWA 3ZIXA 2NPIA 5CKNA 3LA3A 1REDA 5IATA 5ISLA 1ODMA
chains in the Genus database with same CATH topology
4C1WA 2YC0A 2RS51 4OLLA 4BHPA 1RUI2 1N1TA 3KCCA 1HKDA 1A3KA 4YGEA 4YVSC 2ZOEB 1ASJ2 2DVBA 3ZN6B 3MW2A 4RQPB 3TN93 5A32B 4UBGA 1D0GA 3LSEA 4WZFA 4AHWA 3S6PA 4WM8C 1Z7S2 3AYAA 1V00A 3USUA 4A3XA 3VBOC 1BK1A 2XHKA 2R062 4X6RB 1F8VA 2IZWA 4U36A 4K9SA 3MIDA 5JMCA 1COV2 2KXLA 1OFSA 3O5SA 2QZ2A 1QOSA 5JR7B 1H8TB 2JE9A 1AXKA 3PVBB 4Q0UA 1CAUB 1AR61 5F9TA 3PJQA 4URTA 4QHBA 1QU0A 1AX1A 3SLIA 3O12A 3VBSA 1CN1A 1TMF2 4HK8A 3N7LA 3I59A 1OKQA 3ZXLA 2UWCA 4RFT0 1GZWA 4UW5A 4H55A 4LBQD 2D97A 5T5PA 1Z7S3 3ES4A 4XEZA 2PHWA 3M3EA 4YZ1A 2YDEA 5LEJA 2R063 2TNFA 1WBLA 2PHUA 1GSLA 3KQRA 4TWTA 1AF9A 1W0OA 5K9YA 2Q8OA 1QJX1 3AKSA 2I07B 1FPN2 3D4KA 1OD5A 3H50A 1D2QA 4ES9A 4IEOA 1S0GA 5FRAA 5HXVA 1ND3A 2GAUA 3S30A 4UW3A 5EXOA 3KCXA 1ZZ6A 5A3MA 4AFAA 3FUQA 5DUWA 2RJLA 3VHPA 1Z0HA 3K51A 3H1YA 1ZZ7A 1W6NA 4FXGB 4JGYC 3ENRA 1NXD1 4LBNA 4QPGA 2C5DA 2VOWA 1G9AA 1HRV1 3TRSB 1OLQA 5HI0A 3V0AA 3EJKA 4YW1A 2K0GA 2PHXA 4UW4A 1RC6A 1FPN3 1VRH3 4AGRA 1MEC1 1NY71 3I4IA 4B8EA 4N7IA 5GZFA 4Q26A 2HEVF 2ZHKA 5LK5A 3RYPA 1W6OA 3VHNA 2BFUL 4XILA 4XIOA 2CGOA 1CAVA 2DUQA 3NKTA 5DDJ2 2A7AA 2BNNA 4N53B 4JCKA 3VDDA 1K5MA 1GV9A 4QT6A 2AH2A 4JGZA 3TNQA 1CPNA 1R093 3VBFA 5ACA1 4K21A 3TWIA 2B39A 1C8M1 1WBFA 2R071 2A6YA 1NCRB 2XL7A 3FLPA 1YI7A 5DZGA 1G86A 3DGTA 2IWGB 2DYCA 3CJIC 4CDWB 1YXWA 4PCRA 3ZYPA 3HT2A 3HD8B 3SCHA 3S7IA 4E2SA 1VBA3 4IV3A 1QOTA 3EBRA 4P9YA 1PVC3 2G4IA 5L7OC 3OJBA 2EXJA 4XBLA 1UIKA 3W59A 1PO13 4TZDA 5EV7A 1H4HA 1LOFC 1KQRA 3RPQA 2QZ3A 2WNUA 5BPXA 4IERA 4Q8KA 4OI4A 2GC0A 1GQHA 1LEMA 5DDJ3 2FMDA 2WZR2 2QUOA 4YG0A 4BLJA 5IK4A 1QF3A 4XQ4A 2VNRA 3IWZA 1FXZA 2LTNA 4C0BA 4DS0A 4AGVA 3DPRB 4R4ZA 1YUDA 2DCTA 2R042 4Q4Y3 2UWAA 3AMHA 4QPIC 5D8AA 3UL2A 5KBFA 1RUC2 3ETQA 4MZUA 4MXWB 1LHOA 4LO7A 3ZMNA 3SISA 2HWC2 1DQ5A 5HCBA 3L2YA 3L2HA 4QM8A 2O1QA 3GYDA 1PK6C 1GR3A 2VH9A 2AREA 1IS4A 2F6BA 1DBNA 1UKRA 3PNAA 4E4ZA 3ZN6A 1ND2C 1AYN2 4RQPA 4XJUA 1V6IA 3W9AA 4CTEA 4OFGA 4Z92B 5A32A 1IPJA 4FPFA 1DQ0A 2R043 5FOJB 2IXJA 4K1ZA 2Q1ZB 2WA3A 4YVSB 2ZX1A 4P9LA 1RUF1 1D0HA 1FYUA 1ULFA 3MPBA 3U4XA 3VKFC 4LE3A 2GDFA 4WVWA 3D0SA 1MQTB 1LOCA 1C1LA 1SLBA 1OQDA 4FXKB 3E5XA 1H8TA 2ZGNA 3JB8A 1CAUA 1S55A 1PO22 4GMP3 1RUD1 1VB4A 1RVF1 3GZUC 4CEWB 5LRSA 1HDKA 3D82A 4CDQC 3IIAA 4AXOA 5BNPC 2ZTNA 2ATFA 2GN7A 3J8F2 5AC92 1LENA 1AYN3 5T50A 4M0NA 3AP5A 5JVVA 2OVUA 4Y1XA 4FQ4A 1J59A 1QWRA 4EN7B 1WD4A 2QVSB 5GLTA 5JSOA 1W6MB 5C33A 1DFQA 4DXZA 2R0FA 4IEVA 4Q4V3 1PGSA 2Q5TA 2ZX4A 4IXLA 2XJUA 2PQQA 2ZS6B 4XYXA 1SFYA 1URXA 3BB6A 2WLPA 4Y24A 1YLLA 4OVEA 2I74A 3D5OA 3PHMA 3TNPB 3RJ2X 1MS9A 1SLCA 1H2KA 5FFOC 1XNBA 2X53S 1JBCA 2VULA 3J8F3 2D44A 3ZFGC 5AC93 2VW2A 5J09A 1IKQA 4UBHA 2Z42A 2BFUS 4J1WA 1DHKB 4MLOA 1LESA 4WVVA 2QJVA 4PDWB 3WCRA 2D5HA 1J3RA 4LBMA 3NJZA 2P3JA 1DZRA 4DMIA 1V9U2 3IT8A 1HLCA 1ULDA 4D7SA 1WCSA 5KHHA 2E51A 4WVZA 1S0DA 1J58A 4GH4C 1PIV2 3POYA 4RSUA 5EYXA 2VOKA 4AQ6A 4LO4B 1WW5A 2NM1A 5FTTC 3KS7A 4GB31 4LLOA 2UYBA 1ZVFA 2ZAHA 4MX3A 4W6WA 4BOWA 2EXIA 3LAGA 5LEKA 3AKRA 2RS12 2P34A 4QGLA 2ET1A 2A3WA 4N53A 3TN91 4RS5C 4AW7A 1U5XA 1AR91 1M06G 3MZHA 5BNOC 4DPNA 2H0VA 1NCRA 1UF2C 1V9U3 4XF0A 1C4RA 1G9CA 1RUNA 4CDWA 4AI2A 5J36A 5K0UB 2ZGLA 1F31A 3UK9A 1OQ1A 1PIV3 1RUE3 4G9SB 1PGW2 2P3IA 2YGLA 2YZ4A 3FLRA 4JAAA 3VZKA 4OHWA 5ABJB 5H9SA 3RNSA 2X5IB 4AE2A 3RSJA 4IEWA 5LRRA 4N7UA 4Q4W3 4RL7A 3RJRA 5GJ6A 2CV6A 4ZU7A 2IXIA 5I8YA 3IM0A 1YHFA 4OHZA 2GH2A 1NLRA 2UY8A 3AXDA 4XF1A 1ULEA 3UV9A 3NV3A 2IFWA 4AHYA 2WC2A 3JUUA 3H9AA 1UMZA 2Q0AA 2B8MA 1QH6A 1QQP2 4B4PA 4EN0A 1Z7S1 3AP4A 2Q30A 2ZBJA 1IS6A 3DPRA 1AXZA 4EN6B 1ZZCA 2R061 2A6ZA 2D6KA 4NO4A 1UIJA 3MI8A 2B42B 3MW3A 5BUVA 5GZEA 2VMHA 1BJQA 1COV1 4GKXA 1ZBA2 5BNNC 1UX6A 2RJKA 1LCLA 1YRZA 4F3JA 4MXWA 1BYHA 2WQ4A 1XE8A 2CWMA 1QNYA 4E27A 3SCFA 3LA2A 3HMYA 2BVBA 4Y22A 4MGYE 2DUOA 4JDMA 1T6GC 1ENQA 3CO2A 1JUIA 1S0EA 2VUJA 3ELNA 4HANA 5A3LA 2FBEA 3Q9OA 4M0HA 3WLUA 1Q8VA 5C4WB 2D6OX 1FV3A 1H8VA 3DF0A 4HMZA 4QU2A 1GZ9A 5KHIA 3AZXA 4GWMA 1Q8SA 2IXCA 1AHSA 4KGGA 5L19A 1JYIA 3MIBA 2HWE2 4YVSA 1GANA 1YJKA 4YGCA 3E6CC 1ND2B 1JTZX 3PLQA 1H2LA 1RMU2 1ZBA3 1PGL2 1LHNA 2WNVC 2GN3A 2LM3A 5KC6A 4YRDA 1H9WA 1MQTA 1FPN1 1AL22 1RINA 1VRH1 3ZXKA 3M4FA 4D7TA 4ATFA 4KU8A 3VZLA 3OF1A 4B3NA 2Z79A 4ES8A 4LR4A 3U11A 1CESA 5JSPA 1DGWX 5GZGA 4CEWA 4I01A 1EPZA 1N3QA 3AMQA 3DKWA 1NXMA 5DG1A 2EF6A 4YM3A 2ZMLA 3HBZA 4I02A 4Q0SA 3OCPA 3VBHB 4Q27A 1ZRRA 4P9IA 1JYCA 4LHKA 1FI2A 2HEYF 1ZRFA 5E8AA 1H1AA 1H1IA 4GXLA 3ECQA 4XETA 3RMXA 1BBT2 2HWE3 3WG1A 4LE4A 3E5UA 1EAH2 1UPSA 4L9BA 2E7QA 1W6MA 2A75A 4F8AA 2W0XA 2UWBA 4QXKA 2PHFA 5H9QA 2B9UA 2OPKA 1VBA1 5JIAA 3WDUA 4ATEA 4OI1A 1AX0A 3OY8B 3GBGA 1PO11 3IPVB 1QGLA 1ZYBA 3PVNA 1RHI2 3B01A 1LU2A 5DDJ1 2WQZC 1GNHA 3WQ1A 1MVEA 3AP7A 3IDBB 3NW4A 1SLIA 5JPMB 3A0NA 1C28A 2VXRA 4LO6B 3KSCA 4Z2WA 4PBOA 4Q4Y1 1FOD3 2GMEA 4PDWA 5CFDB 1EAH3 2ZABA 1ND3B 4NHMA 3TAYA 4R8HA 4C0HA 3M7AA 3INAA 4W6XA 1SQ4A 1A78A 1Q8QA 2XLGA 1WLCA 1BEV2 4IEPA 4FPJA 1SACA 1BVVA 1D4M3 2JECA 3MIFA 1W6NB 3ZDSA 1JUHA 4QPGB 3NO8A 4NWWA 2XJPA 2P3KA 3APBA 1X33A 4XZPA 4XE9A 4ZU4A 1FX5A 2ZPXA 3ME2A 4KNCA 3JD72 1VJ2A 3ZXEA 3N7MA 4S2FA 2RR12 5L73A 4FOWA 1O3TA 4JDNA 2UURA 5B2GB 3WOGA 1F2NA 1OOPC 1OI6A 3VL8A 1ZREA 2JXAA 4L2NA 2R041 4FSJA 4MUVA 1NOVA 1WW4A 4XHBA 3TB0A 3ZO0B 4M01A 1RVF3 2QNKA 2DCZA 5E88A 1YFUA 4AVAA 3FUOA 2A73B 3LSDA 4YLZA 3WDXA 1APNA 4BWOA 4PLNA 3B69A 1HQNA 3MF6A 5K0UA 2H6BA 1BEV3 2GZWA 4RA0A 2ZKLA 4I0WB 3VN4A 1S2KA 4AVVA 3SH4A 4F83A 5DZEA 4NWVA 1PM7A 3WD5A 5ABJA 1PMIA 2X5IA 2HWD2 2H6CA 4IESA 1AR82 2R16A 2WLQA 3B7MA 2QDRA 1CONA 1AYN1 2RR13 5KWRA 2ZKNA 3WHTA 5I8TA 2JX9A 4XQWA 1JW6A 1REFA 1NZCA 1RUG2 2DCKA 2DUPA 2DWRA 4C1XA 1PZ8A 3E97A 5CFCB 5JSRA 2DURA 1SLTA 3D8CA 1ALYA 4X6QB 5TSWA 5C8WA 3B00A 4GA9A 1NQJA 3FZ3A 2OA2A 4LHNA 3S7EA 2QQPA 4HKLA 5AFBA 5DXDA 4MYEA 3SH5A 3A4UA 3RMYA 4XFFA 1CPMA 4YVWC 2ZGOA 2VQ0A 3WCSA 5AVPA 4HN1A 4A7KA 2D5FA 4CP0A 2EVXA 4FPOB 4AHXA 1G8WA 4Y1ZA 2BTVC 4FCAA 3N7JA 4E2QA 5BNNB 4YG6A 2Z69A 4HL0A 2ZGKA 4NVPA 4N43C 4D3WA 1MZ5A 3J8F1 4FTEA 1GKBA 1GYKA 5AC91 2A70A 2DFBA 4BIOA 3LOBA 1UPIA 2BEOA 5C9AC 1QY4A 1MS0A 1RUG3 4QD2A 3CJXA 3G7DA 1CAWB 3W58A 3VKOA 3VZJA 4FP3A 4GB33 2WFF2 1LOBA 3IN9A 2SLIA 4RGGA 4CZSA 2R1BA 3KGLA 4LLFA 3CLPA 5GKAC 1ND2A 2ZHNA 1GLHA 4AEMA 1NA1C 4Y5Z0 1QJU2 1Q5OA 2VW1A 1EPWA 4FAGA 1ENXA 1NE4A 4GKYA 5E16A 4D69A 2NP0A 1AR93 4RR3C 3M3IA 5FLHA 5FPXA 2WNVB 4K7JA 4C91A 2WFPA 4HETA 4YYOA 2GNTA 1TEIA 5J96B 4ORFA 2G9FA 2GNBA 3VBHA 1WMDA 5KHJA 3X29B 3OTFA 4W6YA 5K8SA 1OA4A 4CDUC 1LB2A 3N36A 3D6EA 2W52A 1V9U1 1RUI3 1DYPA 1D2SA 3CL1A 3FJSA 5JOXA 4HBNA 3R4DB 4TYSA 1ASJ3 1KS5A 1W6PB 2DVDA 3LB9A 4OUSA 2DCJA 1PIV1 1RUE1 4JC1A 5C6CA 3OY8A 5GLVA 1PVXA 3LZZA 1B35C 3H7JA 3NSTA 1OPOA 1DG6A 1QJZA 5KXDA 3IPVA 2HJIA 4PIXA 3DN7A 2XH6A 3MIEA 3MIHA 4Q4W1 4AEDC 4OI2A 4X8NA 1S0JA 4FPLA 3HT1A 3AJZA 2RS11 3R4UA 1N1SA 4EWEA 4QQOA 2DVAA 4FPHA 4YM2A 1COV3 5I0SA 2BNMA 1X8MA 2P2KA 4SLIA 4CYDA 1I5ZA 1BMV1 2V5YA 5JZGC 1EV12 1QXJA 2NMOA 2WT0A 4JTNA 5CFDA 1TMF3 2YXSA 3I7DA 1N3OA 4M3CB 3ZN4A 4AYUA 1VLNA 1X36A 2VPVA 3VLBB 4YM0A 1PGW1 1YCIA 1LOGA 1R1A2 3BIWE 1NCQB 1XU1A 2IFRA 5FDBA 3HQXA 4DRVA 2DU0A 3KLSA 1LTEA 5JOWA 4Y1UA 4FP2A 2VU9A 3VUOA 5FO8B 1QQP1 3WP3A 3WDVA 3ZSKA 4AQSA 2D98A 2XPJA 1QDOA 5H9RA 1EV13 2XLFA 3PVOA 5J48A 1A8DA 4YFWA 1EYBA 3ZFFC 2ZCWA 1AR72 4L97A 4RHV2 4Y1YA 1ZZBA 1ZBA1 4RD7A 4RS5A 4YNIA 2A6VA 2D6MA 3WDYA 1F9KA 1VBE2 1OQEA 2R6QA 1FAYA 3SITA 1ZBE2 1U5YA 5JLVA 3PVEA 4LUMA 1H9PA 4JV4A 4L92A 1N1VA 4LBQB 5EWSA 2TBVA 3EQEA 5JIUA 3ES1A 5DUUA 4A7YA 2Q1MA 3B94A 3H8UA 4CEYB 2K9ZA 2PHDA 2K2SA 2AUYA 4LNVA 1ZZ8A 1RL3A 2Z2SB 1ZA4A 2CAVA 2UYAA 1RJ7A 1XYOA 4CDXC 4P9XA 2EAAA 4QQ2A 3NAPC 1HQWA 3B02A 2R49A 2HWE1 1AR73 5CFCA 4RHV3 1PGL1 4QM9A 4FPGA 5FLIA 3B9IA 1FNYA 2N7GA 3D0JA 5DZFA 1VBE3 2GMMA 2Z5WA 1UU5A 2D6PA 2PA7A 4BMBA 4Y26A 1C57A 4R9DA 1GBGA 4XJWA 4OI0A 2E63A 3VBUC 1NQDA 5BNNA 2VVEA 2FQPA 3CU7A 4COVA 5I93A 1WD3A 4AI0A 1FV2A 3QD6A 1V6KA 4Q1RA 4WM7B 1UD1A 1XRUA 2PFWA 4OHXA 1QH7A 2GH8A 4E9KA 2QDNA 3N4MA 1QXPA 4YW2A 1IS3A 1DQ4A 4N43B 4XFHA 5J7MA 4IV1C 5T5LA 1FOD1 4Y22B 1EAH1 1CAWA 1MVQA 3IKWA 3KMHA 1O3SA 2DV9A 1LHVA 2HWB2 2JD4A 3IDEA 4KG8A 4Q2FA 4S2GA 2WZR3 2EXHA 3ILFA 2A6XA 1OHFA 3PMEA 2RS32 1D4M1 4K1YA 5GLZA 4ISRA 2HYKA 2WKKA 1N3PA 2WNVA 3VBRC 1U0AA 1RUC3 1XYNA 4H3WA 1TNRA 2O0OA 1GQGA 2PYTA 4LA3A 3SMHA 4WM8B 4AG4A 2HWC3 1FMD2 2WT1A 2ZACA 5KXEA 3VBOB 1CR7A 2HWB3 3WVJA 1W6QB 4KL1A 1YIFA 3E6BA 1J1TA 2P17A 4K8FA 3WQ7A 4AI1A 4EWDA 4HK9A 3PJYA 1U5ZA 2X8KA 3O0XA 5JWPA 4AFCA 4CDUB 1BEV1 2KA3A 1S0BA 1W6PA 3J9SA 1D4VB 4AFBA 3H3ZA 3NVCA 2DF7A 5CADA 4HKWA 2XJVA 5E89A 5FO7B 4XFGA 1LJ7A 1CVNA 1YYNA 1B35B 1MACA 2RR11 2ZMNA 3I8TA 4XFCA 1DQ2A 1FMD3 4XF4A 1FT9A 2GC3A 4AEDB 2GNMA 3VBSC 1PO23 2EAKA 2O8OA 5GLUA 5D1IA 1XYPA 1WCDJ 5AVAA 3ZYGA 2NQYA 3ACLA 3N7KA 2CTVA 4M3CA 4G4FA 2E6VA 1YFWA 3NL1A 5JZGB 2W68A 2JG9C 5F5QA 1DGRN 4JTOA 2ZZQA 3RS6A 5A33B 1NCQA 2HWD1 2XJSA 1OFNA 3ZFEC 3WW4A 3ZXDA 1WGPA 1WLDA 3JBG2 2DVFA 2ZX3A 2ZGQA 3JQWA 4JGYB 3OGJA 1TQ5A 4WBBA 1SCRA 3ZPYA 2DTWA 1Q8OA 1RUG1 1RUJ2 1Z78A 4HLTA 2WZPP 1AUYA 4N9IA 4PJYA 1WCKA 1LU1A 2YYOA 4P9WA 4GWNA 4R9AA 4COYA 4EWAA 1X7NA 1N1YA 1AR62 4R52A 1YIPA 4HT1T 3JCIA 3RI9A 4Q0PA 4BPZA 3KB5A 1FATA 1O91A 3J4UH 4AFMA 1MZFA 3KM5A 2B7YA 5EYYA 5CAZA 3V65A 3ZXFA 4LBQA 4B7KA 3JBG3 1CD3G 4XBQA 4XOGA 5JDBA 3V0BB 3E5QA 5FAXA 1G9DA 4ASMB 1IKPA 4CEYA 5GM0A 2ENRA 2RMU2 4AVCA 3NKGA 1MS5A 2C9AA 3UKTA 1I3HA 3CJIB 1S2BA 2WFF1 4IEQA 4IL7A 2JG8C 1RUI1 3VDDC 1K5MC 4J6GA 3LGRA 1PZ9A 1S1AA 4XF3A 3ZSEA 1KJLA 1HV1A 2RS13 1ASJ1 1CAXB 4NN0A 5L7OB 4CDXB 2D40A 2AR6A 2EA7A 2ET7A 1MS8A 4AI8A 3MEPA 4L99A 4EN9B 3E6DA 1LRHA 4LBJA 3UJOA 1S0CA 4K20A 3BCWA 4WM7A 5FOBB 4LBLA 2A5ZA 1SMVA 2RMU3 2PN5A 5HCAA 3VBUB 3WW3A 2B45X 1HRI2 1HRV2 4JVAA 3HWJA 4QPIB 3AX4A 4N43A 1G6NA 3M1HA 3A0KA 1TMF1 4Y20B 1ENRA 4BMEA 5C8CC 1MS4A 2A6WA 3LA7A 3AKTA 5C9AA 1J1LA 4NR1A 4B4RA 3ROUA 5IUQA 2VVDA 1DQ6A 1UU4A 4FPKA 1QQP3 5D8AC 2FZ1A 3MGUA 1UZZA 4AQTA 1PK6B 3VKLA 1QDCA 2VW0A 2UY9A 1VIWB 2AZ5A 4HN0A 4I3PA 5ACA2 4Z07A 1UKGA 3AYDA 1C8M2 3EXUA 1I6XA 3FBYA 3ZVXA 4E2GA 1HRI3 2TUNA 4WM8A 1IHMA 1EV11 3VBOA 1C5HA 1ZX5A 5JPNB 3M3CA 1UU6A 2JDZA 1W6QA 4RQPC 3WHUA 2WT2A 3ZSMA 1AXYA 2VG9A 4QMAA 3HN1A 3FLTA 2XUMA 4CDUA 2NN8A 4MGZE 3QOPA 4B29A 3WG3A 2P37A 4FPYA 4IETA 4CDQB 3WG2A 1V6NA 1J3PA 5BNPB 3RI8A 4DB5A 1RMU3 2ZGTA 3H1MA 3H3UA 3WP6A 2F4PA 1H8TC 2MEV2 2QCSB 3MPPG 4I2OA 1B35A 4B7EA 1AL23 4IEZA 1SDWA