1MQTA

Swine vesicular disease virus coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
271
structure length
271
Chain Sequence
RVADTVGSGPVNSESIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTVENFLCRSACVFYTTYKNHDSDGDNFAYWVINARQVAQLRRKLEMFTYARFDLELTFVITSTQEQSTTQGQDTPVLTHQIMYVPPGGPVPTKVNSYSWQTSTNPSVFWTEGNAPPRMSIPFIGIGNAYSMFYDGWARFDKQGTYGISTLNSMGTLYMRHVNGGGPGPIVSTVRIYFKPKHVKTWVPRPPRLCQYKKAGNVNFIPTSVTEGRTDITTMKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
molecule tags Virus
molecule keywords Polyprotein
total genus 42
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtA00
1NCRB 3TN92 3LOBA 2GH8A 3JBG2 1M06G 4GB33 2BPA2 2RMU1 3JD73 1RUJ2 5FMOS 4FTEA 2Y26A 3VBFA 4CEYB 4CDWC 2HWD2 4RR3B 1AYM1 1VBD3 4GB31 1R083 2WZR3 2HWD1 4CDUC 1NG0A 5ABJC 4QPIB 1RB8G 1ZBA2 1C8M2 1MQTC 2HWB3 2HWE1 4RS5B 3JBG1 1OOPC 3DPRA 1AR72 1RUG3 1VBE2 1EAH1 1AR92 4GH4B 2R041 2XBO2 1HRI1 2DF7A 2ZAHA 1AR71 1DDLA 1NCRA 5BNOB 4GMP3 3VBRA 5K0UC 1PVC3 3J8F3 1NCQB 1ZBA1 4IV1C 3NAPC 1C8NA 4WM7B 4FTBA 4JGZB 3ZFFC 4RR3C 1AL22 1RHI2 2R071 5A33B 2FZ1A 2RMU3 3J8F1 1QJX3 2RS53 1F2NA 2WS91 1RUJ1 1BBT3 3VBHC 4CDXA 1TME2 2IZWA 4Q4W3 1PIV1 2WFF2 1RUG2 5AC91 1R081 1HRV1 1MQTB 1RUE3 4AEDA 1ND2C 5CFDA 1VBC1 3IDEA 1MEC1 2WLPA 1HRV3 3S6PA 1RHI1 1AL21 2R072 1PVC2 1VBA1 1RUH3 1BEV1 1QQP1 1HQNA 1FPN3 2BUKA 4IV3C 1AL23 1QJY1 1TMF1 5C8CA 1QJX2 3DPRB 1BMV1 1AR91 1FMD2 2WWSA 1COV3 3VBSC 5BNPB 4CDWA 3CJIC 1Z7S3 4YVWA 4RFT0 3HAGA 3VBRB 4Q4W1 2WZR1 1GFF2 1RUI2 1AR62 1B35A 1QJX1 1OOPA 3JD72 4GH4C 1POV3 1X36A 5BNOC 2HWD3 2BBVA 4GMP1 1RUD1 1QQP2 4IV3B 3NAPA 5GKAC 2RM22 4YVWC 1AYN3 1NA1A 3NAPB 5BNPC 1COV2 2PLV3 1VBA3 4SBVA 3ZFEB 1B35C 1A6CA 1VAKA 4GH4A 1CD3G 1QJU2 4QPGA 4JGYC 4CEWC 2RS51 3J8F2 1QJZA 5C9AA 3JB8A 5A33A 5BNPA 5D8AB 1RUF1 1BBT2 4CDWB 5JZGB 4CDUA 4CEYC 1HXS3 4Q4X3 4N43B 1VBB1 1AYN2 2MEV3 3DPRC 1PGL1 1VBB3 4CEWB 1RUG1 1PGW1 1RUF3 1VBE1 1AR81 1VRH2 1B35B 1QJY3 1TMF3 2HWF2 4GB32 3VBSA 5C9AC 4Q4V2 4YVSC 1WCDJ 4Q4Y2 5BNNC 4QPIA 5K0UB 2ZZQA 3VBOC 3ZFFA 1NA1B 1FOD3 2BFUS 1HX6A 5C8CB 3VBHA 4CDXC 1FMD1 1VBB2 1R091 2RS11 2R043 1R093 1VBC3 4QPGB 1POV0 5CFCA 3TN93 3VDDB 2R062 5DDJ2 4Y5Z0 1ND3A 1R1A3 4JGZA 5C9AB 3VBSB 1NCQA 4RQPC 1H8TA 1ASJ1 2BFUL 2GSYA 1NOVA 4WM8C 2HWC3 2RMU2 5L7OB 2QQPA 1R082 5FOJB 1TME3 4WM8B 4N53A 2RS32 1PGW2 3VBUC 1PIV2 1COV1 2TBVA 2FZ2A 3VBHB 5CFCC 3ZFEA 2RS13 1ND3C 2WS93 1VB2A 4RQPB 1HRV2 2X5IA 1ZBE3 2VQ0A 4GMP0 1H8TC 3VBFB 3CJIB 1FOD1 1RUH2 2WFF1 1RUD3 5FMOL 1R1A1 2HWE3 1E57A 1PO23 1VBD2 2XPJA 2RS52 1HRI3 1C8M3 2HWB2 5A32A 1CJDA 4CDXB 1HXS2 3VBOB 1V9U3 4Q4W2 2PLV1 1AUYA 1RUC2 4YVWB 4N43C 1IHMA 2MEV2 1D4M2 3ZFGB 1NA1C 1VBE3 4QPIC 1AR93 1RUC1 2RR13 1MQTA 1RUE2 1QJY2 1TMF2 2HWF3 1BMV2 5CFDB 4JGYA 4LLFA 1RUJ3 1OOPB 2HWE2 4FTSA 1PO11 3JB4C 4JGYB 1PO13 5K0UA 3VBRC 4CDQB 1RHI3 5LK7B 5JZGA 1RUI1 5D8AC 4N43A 4RHV2 1QQP3 3ZFFB 4JGZC 4CDQC 2MEV1 4Z92B 4AEDB 2PLV2 4IV1B 3ZFGA 1D4M1 1AR73 2RS31 3TN91 1ND2B 5BNOA 1R092 1TME1 2R073 2R063 5DDJ3 1PGL2 1R1A2 1X33A 1BBT1 4AEDC 1ASJ2 1NY71 1V9U1 1K5MA 3ZFEC 4NWVA 4WM7A 5ACA2 4CDQA 1RMU3 5A32B 4NWWA 1OHFA 4IV3A 4N53B 1FMD3 2WFF3 2RM23 1PIV3 4CEWA 1MEC3 1RVF3 1ZBE1 1QJU1 1SMVA 4Y4YA 1EAH3 1NCRC 2WS92 4EJRA 1AR63 1C8M1 1AYN1 2RM21 1W39A 3CJIA 1H8TB 4RS5C 5C4WB 1RUD2 1ASJ3 4BCUA 4CEYA 4RR3A 1PO22 2HWC1 2R061 5DDJ1 2HWF1 4WM8A 3VBUB 5L7OC 1HRI2 3JD71 4Q4X2 1RUC3 2RR11 4N53C 4Q4X1 1F8VA 5ABJB 1AL0G 1RVF2 1ND2A 3VBFC 1RUE1 2X5IB 5CFDC 5JZGC 5AC93 4YVSA 1ND3B 1RUF2 1QJU3 1HXS1 2HWB1 1RUI3 1RMU1 2X5IC 3VDDA 4PDWC 5CFCB 4Q4V1 1AYM2 5C4WC 3ZFGC 1K5MB 4Q4Y1 4Q4V3 5L7OA 1FPN1 1PO12 3ZXAC 5C8CC 1PO21 2HWC2 1RUH1 1OPOA 4RHV3 1AR82 1VRH1 1PVC1 2RS33 5BNNB 1K5MC 1BEV2 3FBMA 4IV1A 1VBA2 4WM7C 1EV12 1Z7S1 4PDWB 3VDDC 2ZTNA 4PDWA 5AC92 1NCQC 1VRH3 4RQPA 4YVSB 1VBC2 5C4WA 5ACA1 1ZBE2 3JBG3 1AYM3 1VBD1 1POV1 1FPN2 4Q4Y3 5ACA3 3VBUA 1RMU2 1AR61 1FOD2 4CDUB 5J98B 2WZR2 1AR83 5D8AA 1ZBA3 4RS5A 1NY72 1V9U2 1RVF1 5BNNA 4FSJA 1BEV3 3M8LA 1D4M3 3VBOA 5ABJA 1VB4A 1EV13 5J96B 1MEC2 2R042 2XBO1 2RR12 1Z7S2 4RHV1 1EV11 1EAH2 2XBO3 2RS12 4QPGC
chains in the Genus database with same CATH superfamily
3SKVA 2SLIA 3TN92 3N7LA 1BJQA 1ENQA 2RG4A 4Y26A 3LOBA 3Q8CA 3T2QA 2V72A 4NAMA 4YGBA 4QDQA 2W68A 2Z69A 5AVPA 5EJZB 5FMOS 1X50A 4FTEA 3MI8A 4HL0A 3D0JA 2WLQA 1N1VA 5BNQA 3ME2A 1W8HA 3AB0A 5E6HA 3WHUA 4E8DA 4MV2A 3AJYA 1OKOA 4GWIA 4CP1A 1C57A 3OD4A 1XU2A 4GB31 1L7LA 1A3KA 1XU1A 4E2QA 5ABJC 1IKQA 4KI5M 4YG6A 1Q8SA 5F5AA 4OI4A 1S2KA 2P1BA 4DEQA 2ZPXA 5A1AA 3BB6A 1V6NA 1XNBA 3KVAA 1OOPC 2BBAA 1KITA 3WLUA 2GAUA 3URFA 2WO3A 2FMYA 5DG2A 1WCUA 1VBE2 2HEYF 4R9AA 5F39A 1EAH1 2X05A 1GOHA 2UWAA 3J9SA 2ZMKA 4XZPA 2ZAHA 1EPWA 1AR71 2QCSB 1W28A 1NCRA 2XXZA 3CHXA 3AFKA 3KSCA 3Q8AA 2AEZA 4IL7A 3ZKUA 3RZGA 1FNZA 3CU7A 4UF0A 3ZN4A 4ZXEA 1JI6A 2FDIA 4IGPA 1LOFC 1B09A 1ZBA1 2J1VA 4IV1C 3NAPC 4L11A 2Y6FA 3AL5A 1C8NA 1Q8OA 2Q1MA 4I0BA 2QQVA 4WM7B 3U4SA 3FHAA 4I3PA 2WBKA 3Q8FA 4OVEA 4QPWA 2EAKA 4RR3C 4HPKA 1AL22 2A3YA 1H9PA 2BQPA 3J8F1 1QJX3 1HKDA 2RS53 3WG2A 3IWZA 3H8RA 3N7JA 1SLBA 1LTEA 2B42B 3WDUA 4RSUA 2G1MA 1X9PA 4XUPA 5G04L 1NE4A 1X8MA 4AGRA 2PA7A 4QB2A 3JQWA 4Y5SA 1YLLA 2GP3A 2X09A 2Y60A 3AVRA 1RUG2 3USUA 5EIYB 3W58A 1UKRA 3U14A 1JTZX 1R081 5IAVA 3WVJA 2VY0A 1LOCA 1VBC1 2D5HA 5JXJA 5DPNA 2X53S 2CGOA 2NM1A 3S6PA 3SEEA 1AL21 3DUIA 3LDRA 3POYA 4QX7A 4LNVA 4ET7A 4A6OA 1QQP1 1VALA 1TNFA 2DU1A 1LEDA 5FO8B 5FUPA 1LULA 3OOXA 4ZPIA 5FLJA 1US2A 4TTGA 2CGPA 3NV1A 2A6ZA 3I8TA 4MGZE 4YSFA 2PAMA 2WNVA 5LEJA 2RVAA 1DQ4A 4X8PA 1NQDA 1TMF1 3KF5A 1C3HA 4S2GA 4D7TA 2D6NA 1DGRN 4IGQA 5FP7A 3ASIA 5FMDA 1LHUA 4XZUG 1LB2A 2WWSA 2Y6GA 5EJ1B 3APBA 1DZQA 4URAA 4CDWA 1OF3A 2ZGKA 2D93A 1YQ6A 2VULA 4KG0A 4B4RA 4RFT0 2ORXA 5T55A 2WC2A 2VG9A 4Q4W1 4AFDA 1K3IA 3D5OA 1XYNA 1AR62 2WFPA 4PLOA 2UYBA 3RRDA 1B35A 5C3PA 3I2KA 2JENA 5LRRA 1POV3 1ZRRA 4CSWA 4UT5A 1W6NA 4KMQA 1KEXA 2KR2A 1X36A 5B4XA 4XDPA 3GM8A 2WL1A 4MHUA 3WW3A 4S2HA 4XFCA 2TEPA 4I09A 5JR7B 5L9VA 3UGHA 3LE0A 5FZEA 5F3GA 3GZTB 4NRMA 3I59B 1QQP2 1QNWA 2B46X 2B8MA 3HT2A 3DECA 4YVWC 2YGLA 2PLV3 1W90A 1UOJA 2JDZA 3LIGA 4A4AA 1H6YA 4EN8B 5BYNA 5I8YA 3PTYA 4IEQA 1N3PA 2DBNA 2B7YA 2VQUA 3WDXA 4BE3A 3H7YA 4W4ZA 2XR4A 5F3EA 1NE6A 3ZSMA 4D94A 4F3JA 2K2SA 1CD3G 3J7MA 4GH4A 1I1EA 1QJU2 4J6GA 3C8XA 1J3RA 2W95A 5FYSA 4JGYC 3UYJA 3AYEA 4MVTA 4CEWC 1CAUA 5ERLA 5FYTA 5E88A 3OJBA 1DYOA 4ZONA 1XE7A 5FXZA 3TNPB 4QXHA 2VTXJ 4EN7B 5KXBA 2H6BA 3PVOA 1UIJA 1ZX5A 3AZYA 1NZCA 4FPGA 4B4PA 3JUUA 3RWKX 2JIGA 4U2AA 3NQHA 4XDQA 3ZN6B 2I45A 4LHLA 5IK7A 1BBT2 5FRAA 1UWWA 4AEKA 4ZZ8A 4CEYC 5F6KA 4Q4X3 3NVCA 2YXSA 4EV0A 1GYKA 1MS0A 2ARAA 2XKPA 3RPQA 2VPVA 4FBFA 5FYHA 1W8WA 3DF0A 1VBB3 4CU8A 1E5IA 3I97A 2JD9A 4QDSA 2FQPA 1SDWA 2GALA 4UYBA 4LORA 4QHBA 5GLUA 4YW6A 3ZPYA 1UZYA 1AR81 2AENA 1B35B 1FT9A 2G4IA 3RZMA 3VN4A 3B5LB 3IMNA 3LA7A 4ES9A 5C3RA 4BQ5A 3CDZB 1W0PA 4AEJA 4TZDA 3VBSA 4FP3A 5FZOB 1NZIA 1WGPA 3MFCA 4N9IA 1WCDJ 1N47A 2VC9A 3A21A 1BVP1 1ZZ7A 3K51A 4FPOB 1GZCA 4IGOA 2WSUA 4IEWA 4NJ4A 5FZOA 2QNKA 3VBOC 3ZFFA 4UW6A 2YDEA 3ENRA 5FR3A 1JW6A 1JOPA 3OEBA 3S7IA 1LGCA 2W2IA 1UKGA 5FZAA 2B9UA 1ODNA 2QDRA 1F15A 5C7GA 2LALA 2PFWA 1QY4A 3VLBB 3BVCA 5KHHA 2P5BA 4RN5A 3VHOA 3UGGA 3LQCA 4QAWA 1JN2P 4BH9A 1R093 1AVBA 1POV0 5CFCA 4BQWA 1W8OA 3FJSA 4XJAA 3ILRA 3N4MA 1SLAA 2R062 5DDJ2 5FY9A 1R1A3 5C9AB 5J1XA 4MGTA 1QEXA 5CA6A 2BRTA 4FP2A 4YZ3A 1OFNA 1GNYA 3OPWA 2D3RA 2ZA9A 3NL1A 2VL4A 2WNVC 3AMPA 3LSEA 2ZGQA 5FO7B 2DV9A 1OT5A 4HSLA 5L7OB 3I2HA 1R082 2YMZA 1S2BA 3CF6E 3HT1A 3IZOA 4Y22B 4WM8B 2W47A 1MS4A 1XRUA 4CU6A 1YWKA 3OUIA 1OA4A 1V6LA 2FCTA 4D6SA 4DRRA 1PIV2 1COV1 2TBVA 4NHYA 2W52A 3IM0A 4QB6A 1Y4WA 2YU1A 4C1XA 3ITQA 2RE9A 1DGRA 1QNYA 2CTVA 2RS13 1VMJA 1ND3C 1VB2A 2GZWA 4RQPB 1CESA 2X5IA 3ACHA 5CU1A 1IS5A 3SQOA 2CV6A 4H55A 2GNBA 1H8TC 1VIWB 2F4PA 2NMOA 2ZOEB 3CJIB 1FOD1 1S0IA 4BLIA 4E4SA 3OEAA 5FMOL 1R1A1 4P9WA 4DINB 2DFBA 4NUBA 1G9FA 4FO9A 2VTFA 1WW4A 2WA3A 1PO23 5FFOC 5FZ9A 1IZ3A 4IEZA 4DB5A 2ERFA 4BZ4A 1JYNA 5GZFA 2Y33A 4ES8A 3V0BA 2WDBA 1KDKA 1SFNA 3LA2A 4Q4W2 1H8VA 4YVWB 3RWNA 3HN3A 1BVVA 4RGKA 3WG1A 4AVAA 1NA1C 2EIGA 3T0DA 4XQDA 4QPIC 5GLWA 1AR93 2QQJA 3POIA 5L9RA 1RUE2 3SITA 2Q4SA 1HN0A 3P1IA 5BY5A 3E6CC 2WWJA 1SBEA 4QU1A 2WZ8A 4O61A 3ETQA 4ZU7A 2ENRA 1RUJ3 1D0HA 1WBLA 2H6CA 4BB3A 1VE0A 2ZEYA 2HWE2 4N7IA 3V65A 5CBLA 2OZ6A 4JKKA 3JB4C 4HG6B 4MHRA 1EY2A 1PO13 1LHVA 2WNVB 1Q56A 3KWVA 3LSDA 4GQ7A 4M0HA 4QX1A 1RHI3 5LK7B 4IDZA 4Y1UA 2G9ZA 2A3WA 2ZGOA 1MZFA 1NLQA 2B39A 4WBBA 5FWJA 4JGZC 1LECA 2ZAAA 3B69A 4AYUA 1W9SA 5CKMA 4Z92B 4P08A 3MICA 3N9NA 3OSDA 2VMDA 3NNFA 4IV1B 3ZFGA 3ZOIA 2K9ZA 2DCYA 2DYCA 1CGPA 2JDUA 4QGMA 5F5CA 3TN91 1KJRA 2XDVA 3TEXA 4ISQA 1JMUB 2OUJA 1TME1 1W99A 2IXLA 3OB8A 4R9CA 5FLHA 2GH2A 4Y3OA 3H9AA 2A6VA 1W9FA 3UJQA 1BBT1 2ZGNA 5FPXA 2WUHA 5DAPA 2Q1FA 2ZX3A 1K5MA 3H0OA 1GSLA 2I07B 4IQPA 4EWEA 2ZMNA 5FZBA 3RZHA 3DYMA 2VUDA 2BZDA 1CAWA 2E53A 1RMU3 5IWFA 2VR4A 3HNMA 4LO8A 1OLME 5KBFA 1DCSA 4OUEA 2QQOA 3MUY1 3TB0A 3ZR6A 5FMBA 1OHFA 4OQ9A 1UU5A 3K46A 3U10A 2RM23 3ZYIB 4Y4RA 4ZU5A 1E5RA 3KCCA 1PIV3 4BWOA 4CEWA 1YFXA 3ZXFA 3DYOA 2BP6A 4E8CA 2WYSA 5FUNA 1ZZ8A 4FPCA 3U0ZA 2X29A 4XJ9A 1A34A 3GZUC 4FQ4A 3GZEA 1W39A 5A6YA 3AZVA 1C28A 1H8TB 2HEWF 3DGTA 3VKLA 1HJFA 1ASJ3 3I2IA 1ZA7A 4UF0B 3KCYA 1YIFA 4AR2A 2ZS6B 3L2YA 1REDA 1J1LA 1V6JA 1PO22 2HWC1 1PM4A 4O65A 4OHVA 5C33A 5F9TA 4FXGB 3K4DA 1NLSA 4XFFA 4X8NA 1LNSA 4AL9A 3AYAA 1UU6A 1CONA 4F83A 4MXVA 3MIFA 5DUWA 2A7AA 4D6RA 4N53C 3MF9A 3EHKA 1LENA 2E7TA 2P3IA 2WT0A 3PVNA 2RJKA 4X6RB 2JG8A 1UY0A 3IPVB 2Q8DA 3CQOA 3PVEA 4XFAA 1RUE1 1D7PM 2UWCA 3SHRA 2ZX4A 2PHRA 4OUMA 2TNFA 1Q43A 2XH6A 2XUMA 2EIBA 4LA2A 4ARYA 2Z79A 4YVSA 3AYCA 5LA2A 3VD5A 1OKQA 1HXS1 5LZ6A 4I01A 1WWYA 2X5IC 4CU7A 2PAEA 4PDWC 5J7MA 3LD8A 1Q8PA 3ZFGC 1K5MB 1G86A 4PIYA 2DURA 3O12A 1GKBA 2ZX1A 5FXVA 4FPFA 3FX3A 4OUSA 3I3QA 3MIGA 3ZXAC 5CG8A 1STMA 1PO21 2HWC2 2XUEA 3AKQA 3AX4A 4JVAA 1OQEA 5FZ1A 4JTNA 4RHV3 4EZ4A 3MO4A 1JYTA 4EQVA 3C7OA 3UV9A 1WLTA 2RS33 5BNNB 5FQ0A 3PUAA 2XHNA 1LOFA 4IV1A 1SLCA 2AACA 4MGIE 4BA6A 3GCXA 1Z7S1 1J59A 3HNYM 3T0AA 5EQUA 2P3KA 1NCQC 3WQ7A 2EIDA 4RQPA 4LO6B 4ZXKA 2VU9A 2VMIA 1RXGA 1ULPA 2PQSA 4Y1ZA 3T4VA 1ZZ9A 4JQRA 4KG8A 2R30A 2GN7A 1VBD1 1OH3A 5F2WA 5J09A 1G9BA 4JQTA 3E5UA 3OPTA 3UETA 4FVVA 5JWPA 3X29B 2VNGA 1FAYA 2W94A 3ACLA 3MF6A 4DNYA 5ACA3 1UPIA 3M7AA 3VBUA 1CX1A 1R1ZA 5A3LA 1AR61 1GZ9A 4XMIA 4CDUB 3PMSA 1JZ8A 5A3UA 4FFIA 1ZBA3 1V6KA 4IERA 3O0WA 4CPBD 4D6QA 3LDBA 3N7KA 4I3GA 3E97A 3LGRA 5ABJA 1VB4A 5J96B 1NYWA 3OYWB 4YPJA 4Y1XA 2P37A 2P3YA 1W3VA 1EAH2 1JHJA 2EIEA 3ZR5A 5IVJA 2XBO3 3WW1A 1SPPB 4QPGC 2WT1A 1GANA 3WG4A 2JE7A 1I6XA 4O9GA 1NXMA 5IVYA 3A0NA 3IMMA 2PMWB 3O1UA 3WF1A 4P5HA 4GB33 4XW3A 2Q8EA 5FMCA 4MSVA 3HIFA 3E6DA 4IEPA 5FOBB 1C1FA 2JE9A 3QOPA 4CUAA 2ZEXA 4B7KA 1YEWA 1AHSA 2LTNA 3CEWA 4CDWC 4RR3B 3CLPA 4HN0A 5LY1A 1TVGA 4HVRA 3KCXA 2R49A 2Y64A 1VBD3 1RB8G 2WZR3 3NO8A 4CDUC 2KA3A 2VZVA 3EJKA 2Q8CA 3VV1A 1C8M2 2HWB3 4CZSA 2HWE1 3EYPA 3C7FA 1CAXA 3DPRA 4UW5A 2XL9A 1G9DA 4MYEA 1QJFA 1TNRA 3OGRA 4Q1RA 4AOCA 4GH4B 3ZXJA 2F6BA 5LBEA 3T30A 3ZDSA 1HRI1 2DF7A 3MBWA 1GWLA 5L19A 2AEYA 3POBA 1OVSA 2DBIA 4ISRA 1D0GA 4GMP3 2FDGA 3VBRA 3POGA 5B4NA 3WDTA 2JX9A 4NOTA 2I2SA 1NCQB 3N35A 3MW4A 2J1SA 4UXAA 4D8MA 4R4ZA 1VAVA 1UMZA 4G4FA 4QHOA 5A7QA 4WVVA 5IW0A 1W9YA 2LW8A 4UFLA 2ZJCA 2GNTA 2RMU3 3WNKA 1NXD1 3HWJA 3J7LA 1F2NA 2WS91 4M00A 2J22A 1BBT3 3VHRA 4XXPA 1TME2 4BQYA 2IZWA 5HI0A 1SBDA 3WNOA 3B02A 3M3EA 3VB9A 2PHTA 2P6HA 1W04A 3ZYBA 1C4RA 2VQAA 4P9YA 3L2HA 4AE2A 3VDBA 4HN1A 3RGBA 5A3PA 2RDNA 3Q9OA 2ADDA 1U5YA 3NV4A 2OVUA 5DZFA 3I3DA 3LB9A 4AQSA 4QM9A 1F5JA 2AUYA 3VHNA 1S4CA 3ZSJA 4FPKA 4IXLA 1RHI1 1PVC2 3AM2A 5I93A 5FYUA 1RUH3 4JRAA 1O8SA 4QHZA 2C5DA 1C5HA 4AAPA 2VBBA 2Y6KA 4OZXA 2WO2A 3V64A 4GWJA 2BUKA 3PTRB 2XJUA 3WP6A 4IV3C 1HIXA 1CIWA 4NHKA 4QX3A 5IHRA 3H42B 4CPBA 1OSGA 4Q0VA 1V6IA 1XQNA 4N7UA 1UZ0A 5KHIA 3AZXA 4HSJA 3KT4A 3GBGA 5HCFA 4UFIA 4XUQA 3DPRB 3MPBA 4D7YA 1AR91 1FMD2 1CPMA 1UZZA 3VBSC 4DO0A 4HBNA 5K4LA 3WG3A 4BQ4A 1H6XA 3ACFA 4G9SB 5BNPB 4XBNA 4C90A 1QKQA 1G7YA 1UU4A 1UMIA 3ES4A 4W8JA 2CU5A 3CMGA 3SH5A 3UK9A 1Y3TA 1ZRCA 4OLLA 1RUI2 1GWMA 3ZKYA 2W91A 3J7NA 4LOTA 4AHWA 1WMFA 1Q3EA 2VOKA 1Y9QA 4QU2A 1G6NA 4OULA 1LOBA 2XGXA 5BNOC 1WA4A 3MIHA 4CP2A 2XG3A 4QGNA 4S2FA 1BXHA 1DIWA 2W1SA 3KQRA 5APAA 2JD4A 5GJ6A 2EALA 3T4HB 4AI0A 3MIEA 2PHLA 4B3NA 2BW8A 2WSVA 5DN2A 2JDAA 4GMP1 4D69A 3WP3A 1NQJA 5D21A 1ZYBA 3AP9A 3M1HA 4NIIA 4IV3B 1X8EA 2O14A 5EFUA 5GLTA 5FYCA 3VZKA 4OCTA 1AYN3 1NA1A 3BTZA 1COV2 3FE5A 2JG9C 3NJXA 4SBVA 4XQ4A 1ZM1A 3TAYA 3PIGA 4XTMA 1TZOA 2HBTA 2OPWA 3CBNA 2R1BA 4YW2A 5IFTA 3Q8BA 4P9JA 1PX4A 4TYSA 4CTEA 5T52A 1QOTA 2RS51 1O7FA 3J8F2 4Q0QA 3ILNA 3H8XA 3MDPA 1Q5OA 5C6CA 4LKDA 1KDMA 4LBJA 4KGGA 5HPOA 4JTOA 4E2SA 1O5UA 1PNFA 5A33A 4NIHA 2PELA 4XUOA 5BV6A 4LXLA 1HB2A 4CDWB 2YY1A 4CDUA 3VL9A 1POQA 4PI2A 1HXS3 1UZWA 3S0MA 3GALA 3LZZA 4XFIA 1XJAA 3P3NA 3WW2A 4UI9L 5EP9A 2A6WA 5CAZA 3AMQA 3NMBA 5DZEA 1XB9A 5EYYA 3DPRC 1UF2C 1UIKA 2QQUA 4QXBA 4X6QB 1GOFA 3CJXA 2ZHKA 1WCSA 2NQYA 1Y9GA 1RUF3 2P17A 1GQPA 1VBE1 1VRH2 2JDMA 3POEA 2XJRA 2OZJA 1KS4A 5FKCA 1UW8A 1DGWA 1OUSA 4Y5TA 4UFJA 4PIXA 3CNAA 4HZFA 4AI9A 3UNPA 4Q4V2 3AKSA 4YVSC 3LFMA 3RZLA 4SLIA 2W1UA 3FLTA 5BNNC 5K0UB 4I2OA 3POSA 2OKXA 1J84A 2P2KA 2Y38A 1FYUA 2XVKA 4ITCA 2WNUB 1FOD3 2L9LA 5HXMA 5FP8A 1UPSA 3WW4A 3K4ZA 5A3OA 5FIXA 3VBHA 2R0HA 1JODA 4YRDA 2RDSA 1JYCA 3HR9A 5FZCA 2XMLA 4PQQA 3WUCA 2LROA 2R043 4ZHNA 1G9AA 5L36A 4FOQA 1CAUB 2AR6A 4L0PA 3D3AA 3LEKA 3O1VA 3MLKA 4QPGB 1UXZA 2JDPA 2QQMA 4PIZA 3ZIWA 2BJSA 2BWAA 3D0SA 4LT5A 2JDYA 3GJBA 2HH9A 1NCQA 1JOJA 4CCDA 5BUVA 5JLVA 1H8TA 1IS6A 2BERA 2E33A 1BYHA 2BFUL 1V0AA 4ORFA 4FPLA 4AF9A 5JOXA 4FQZA 3FFQA 1NOVA 4WM8C 2VMHA 5FV3A 1J83A 1UX6A 4E4ZA 4M4PA 5FOJB 1MS1A 2XLGA 1TME3 3THDA 4NVPA 4XDOA 1ZVFA 1FATA 1MZ6A 2CHHA 2FD8A 4TXWA 1OBNA 1CX4A 1VP6A 2FZ2A 3TOJA 1W8TA 3VBHB 1YFWA 3BI3A 3ZFEA 1UY2A 2YHJA 1GUIA 4AAXA 3JXSA 4AI2A 4TN7A 1QDCA 4UAPA 4NPMA 2Y34A 3BODA 5CB7A 2AYHA 1JZ3A 1ZBE3 4K8FA 2VQ0A 3GF6A 2YV8A 3HD8B 3ALQA 3AK0A 5FZFA 5T3NA 4AVVA 5IVFA 4NPRA 3MLJA 4B1LA 4LKEA 3AFGA 2HWE3 2E9QA 2DCJA 3ELNA 4EWAA 2VO5A 3PUQA 2W46A 4Q8LA 5JIAA 1RC6A 5JOYA 3ZO0B 3JQXA 2QJVA 4I0WB 3EBRA 3GBWA 4W6XA 3RYPA 5L73A 2XPJA 1QF3A 5DQ0A 2O8OA 3RYRA 5A6XA 1GBGA 3C7EA 3WINE 3DYPA 4A7YA 1HXS2 1XSRA 2BVBA 1V9U3 2DCZA 1YRZA 5A3TA 4FXKB 2OA2A 2YBPA 3KB5A 4K8RB 1IHMA 2MEV2 5IK8A 1D4M2 3ZFGB 4CCNA 4M3CA 3VKNA 5IK4A 1VBE3 2OT7A 4B7EA 1OUXA 2RR13 4FCAA 4KGQA 1CJPA 1MS8A 4QM8A 1CAVB 1OMIA 2YGMA 3AKPA 4Q29A 5LWBA 3SKJE 3FLRA 2VZSA 2VBPA 1SFPA 4XC9A 1BMV2 2VD7A 5A70A 2VNOA 4RGGA 4XQWA 5K7PA 3KT1A 4CXWA 4PCRA 2ZGPA 1CZTA 4AHZA 4BU2A 4MGYE 2BNOA 3ZLIA 4CE8A 2BYVE 3D6EA 5JDBA 4LKSA 5HCAA 4BHPA 2D6KA 3NWKA 2OQ6A 5K0UA 1CAWB 2VCCA 1LOEA 5HCHA 4R9DA 2D6LX 2QE3A 5FZLA 4CUGA 2V4VA 4RHV2 4XVHA 5D2AA 1LODA 1QQP3 5IJRA 2YPJA 1W8NA 4CDQC 1F4AA 3E5XA 1KS5A 5FTTC 3HN1A 2PLV2 4AEDB 4AK3A 1NUKA 4KWLA 1LU1A 2DFCA 3NKGA 1D4M1 4AHYA 3WNNA 2RS31 3QCWA 1ND2B 5BNOA 1OF4A 5EHDA 5J3UA 1NLRA 2YG0A 4XJWA 4GULA 5B2GB 5FPZA 3BTXA 2O0OA 2VAUA 3JCIA 4JCKA 1PGL2 4GKXA 5C3QA 1YIPA 1X33A 4MOAA 5GZEA 4DZGA 4Y1YA 5IK5A 3A0KA 1ASJ2 1NY71 2E26A 4UBHA 4XUNA 4I0AA 3P5BA 1NKGA 1W6MA 3PUIA 1PHMA 3AZWA 4JAAA 3PURA 5ACA2 1SDDB 2JG9B 4KU8A 5CISA 3FL7A 3O1SA 5FBJA 3BUCA 4N53B 2D6OX 2WFF3 3K4AA 4HVQA 2YB7A 2ZCWA 2DCKA 4YG0A 1MEC3 2D7FA 1A8DA 2E7AA 2G9FA 2VOWA 4ATFA 2FCUA 1SMVA 1EAH3 5E16A 2XB6C 4XJZA 5FZ3A 1LGBA 3M3OA 2XQRA 3SH3A 3AP7A 1YQCA 4L8QA 1YI9A 4N90A 1XPWA 4OI0A 1ENSA 2PXJA 3AP4A 4XABA 1HB1A 1SLIA 1UY4A 2NP0A 2IFRA 1KRIA 2A70A 1S0JA 5L9BA 3KD4A 3HJRA 3IIIA 3J26N 3QD6A 1VR3A 4W50A 4DPNA 1C5IA 4K40A 4CEYA 3BIWE 3LAGA 2QQKA 3SXWA 2ZGTA 2BGOA 2PHWA 5JI9A 4L97A 1YYNA 3GHNA 3KMHA 2HWF1 3LKJA 4WM8A 2D3SA 4AVSA 1J3QA 4MADA 4AI8A 2BTVC 4HK9A 4Q4X2 4CCMA 3U11A 2XQXA 4H7LA 3ZPOA 3C7GA 3T0BA 4GALA 4Q4X1 5JAXA 4NMIA 1F8VA 4B29A 2FDFA 1RVF2 1WW7A 2X5IB 4CP9B 2ZEZA 5JZGC 3KHCA 5KXCA 5FUIA 1LOAA 5FDBA 4A41A 1U12A 2J1AA 1RMU1 2K0GA 2VH9A 1WA6X 1SQ4A 1O3QA 1W8ZA 1DBNA 3ZIXA 1RJ8A 1AYM2 3PJYA 1CIYA 1KJLA 3R4SA 4JKMA 4E4DX 4Q4Y1 1MVEA 3I3BA 2CL2A 5J36A 5L7OA 3UKVA 1FPN1 1GOGA 3BGAA 3K3OA 4P14A 1F35A 3VZJA 5C8CC 1OPOA 5JXGA 1WMDA 4PF5A 3KQ4B 2DUQA 4Q26A 4FI9A 5E89A 4OYUA 4DMIA 4LO7A 4QKFA 1K5MC 1BEV2 1KD7A 3H1MA 3H8UA 4COVA 2ET1A 1EUTA 2CNAA 2NZ9A 4DS0A 3POFA 3RI8A 1VAMA 3M3QA 4Y33A 4PDWB 1QH7A 2PHDA 2CSGA 2WR9A 3O0XA 4META 1E5SA 5I8TA 5JMOA 3LPGA 2IVJA 5GALA 4YVSB 4ZKTB 2W3JA 5C4WA 5F1RA 1QWRA 4BM8A 1UX7A 3WXPA 1HDKA 3E6BA 5FZHA 5LA0A 5J48A 2GMPA 2F4LA 3OTFA 3MYXA 5FO9B 1POV1 3IBMA 3QBQA 2UURA 1PMJX 1YFYA 4LEJA 4KWKA 2D97A 3RMXA 4TLGA 1REEA 3UESA 1IG3A 3I2JA 3RZKA 3CZUA 3N9OA 2DVDA 4K6BA 4AVCA 1G9CA 5FPVA 1H1MA 2WZR2 5FK8A 4CP0A 1AR83 4I30A 4XBLA 4GZ9A 4DIQA 1V9U2 4JC1A 1H1IA 3HQUA 1WZXA 3FHIB 1T6BX 4AVBA 1TEIA 4BQ3A 3VBOA 5H9PA 5LB6A 2D98A 1FXZA 2VUCA 1EV13 3N3HA 2WN2A 4WZCA 3U75A 1MEC2 1PZ8A 1ULGA 1UO9A 2JDHA 2RR12 2XBO1 3N9MA 1W3XA 2IWGB 3MV01 1WW5A 2HJIA 4AEMA 5C71A 4XXAA 3KF3A 1CWPA 4MX3A 1YFUA 2KXLA 2GH8A 3EO6A 2VVEA 3JBG2 1M06G 3TYJA 2BPA2 2RMU1 3AJZA 4XF3A 1RUJ2 3SISA 1MS3A 2YYOA 2VW1A 2Q1ZB 2Y26A 3D82A 3FN9A 4YW3A 5K0UC 4M3CE 3WT3A 4E2GA 2DVGA 1JZ5A 4CEYB 1O3TA 3VD3A 1MS9A 2IXCA 2C6SA 2ATFA 3RNSA 4E9KA 4UOJA 5JPMB 3RDIA 4INDA 2QQWA 1AYM1 1R083 1YXWA 2E63A 2HWD1 1NG0A 2PQQA 3N7MA 4QPIB 4ASLA 4PQ9A 1MQTC 4RS5B 1I9RA 2E7QA 2OXBA 1MZEA 1XE0A 3VKMA 1AZDA 4Q2FA 1RUG3 3AP5A 5LW9A 1O8PA 4CCCA 1GQGA 5JSRA 5T5JA 1FV2A 1QHDA 2R041 4GWMA 4M01A 5BNOB 5DAVA 2DCTA 3B01A 1O3RA 3ORJA 3J8F3 3ACIA 4CU9A 2RV9A 5JPNB 4HPKB 5LY2A 4YGEA 4FTBA 2KD7A 2BVVA 2OIIA 4FPYA 4JGZB 3RFRA 3LEGA 3HEIA 2R071 1RHI2 4AI1A 1DQ5A 1JOBA 2FZ1A 3PU8A 3GJAA 1I3HA 2J1EA 4XIOA 1OPMA 3MIBA 5FZ7A 3T09A 4LBKA 5M0TA 1RUJ1 3JU9A 4CDXA 1NAEA 4LITA 4XF0A 2JG8B 2WFF2 3EXUA 1ULEA 4DXSA 3WQ1A 4FOVA 1PX3A 1RGSA 4ARXA 3HPNA 1QDOA 3WF2A 1ALYA 3ZYPA 2GC0A 1DLLA 3VDAA 4OHWA 4DUVA 5DAXA 1HRV1 1MQTB 1RUE3 4LBNA 5F8PA 1FX5A 4QWNA 3W59A 1MEC1 2VMFA 3GDBA 1HRV3 4Z07A 1ZREA 2PN5A 2EXKA 2WA4A 3AMNA 1PK6A 3HQXA 3WDWA 2R072 3K75B 2J1RA 1VBA1 4K20A 2W08A 5C3SA 4LE4A 4M0NA 3AXEA 3BTYA 1HQNA 5JOZA 1JUHA 5SV8A 4A2UA 5DXDA 5H9QA 2R0FA 2YFZA 3I2GA 1AL23 3R05A 1JBCA 4OI2A 1QJX2 1SEFA 4R9BA 5CVRA 3VKFC 5LA1A 2CDPA 1IQAA 5DG1A 5BXXA 3RS6A 4LK6A 4CRQA 4QPYA 4BIOA 1W06A 4XF9A 3VGIA 5EXOA 3AYDA 3CJIC 4EN9B 4C91A 1Z7S3 3T2OA 3I49A 1H30A 2C24A 5T5LA 3EB7A 3ZDVA 5KXDA 2P4EA 4XHBA 1SLTA 1W6PA 4LTAA 1URXA 3OUJA 2QFEA 4LUKA 1GLHA 1OOPA 4OQ8A 1XBFA 2VM9A 3B9IA 2P34A 4LBQB 1W8UA 1S0EA 1JXNA 5FP3A 2HYXA 2ZXQA 3POJA 5IVBA 3I7DA 5A7NA 5F37A 2HWD3 3WF4A 1H4GA 2OYZA 2R7EB 4JHZA 1AXKA 1YI7A 1XC6A 5IUQA 3W21A 4BIFA 3O1MA 4OFGA 4NIAA 3SEPA 2XVLA 1RUD1 3B7MA 2VZ3A 3WNLA 2C9KA 1ONAA 4YZ1A 4LBOA 1PM7A 4C1WA 5GKAC 2QVSB 2RM22 3OYWA 5E1RA 5A7OA 3NAPB 3OUHA 1WW6A 4IEUA 4OHXA 3ZFEB 2J42A 3BN6A 3H3LA 3I59A 3MHZA 3ZN5A 1HQWA 4CVUA 5FZ8A 4CUBA 2GMEA 1LOGA 1OURA 4AGGA 1W05A 2IFWA 1ULDA 1AX2A 4P9XA 4NN0A 1B35C 1VAKA 4LMFA 5JXHA 1YQ2A 1LHOA 1VJ2A 1DGLA 4H7MA 3PU3A 1VMFA 2WABA 3KGZA 5FCCA 2JEMA 2Q8OA 2OW4A 3WR0A 1JZ2A 3PDQA 1QJZA 1O59A 1W6PB 2IC1A 2B45X 1CN1A 4QQPA 2OX0A 3JB8A 4UFMA 1ZZCA 4JDNA 5LEKA 4FT8A 4E4HA 5HV0A 1XXNA 2WQZC 1LU2A 2EICA 1HLCA 5D8AB 5BNPA 1RUF1 2Y0OA 4IEYA 1N1YA 4ZS3A 3U1XA 5JZGB 2A3XA 1GICA 2JXAA 4N43B 4V2WA 3OG2A 4M3CB 4XHXA 4BYYA 1JS9A 2MEV3 3ILFA 2I74A 4TWTA 3H1WA 4PHZA 5GLZA 4LHSA 1PGL1 1QXJA 4CEWB 2VCMA 1REFA 3PJQA 4LLOA 1HB3A 3OY8A 5FREA 3RG0A 2ET7A 4Q5OA 3V0BB 1S55A 2XONA 5DAQA 4QX2A 1TMF3 5LK5A 5KHJA 2BOIA 1QXRA 1J58A 4GB32 1V70A 5EYXA 3AC0A 5FY7A 2GP5A 3H50A 5C9AC 2C4XA 1QJEA 1UOGA 4YYOA 3NRUA 1W6QB 2IUWA 4Q4Y2 3T1MA 4G3YC 1KQRA 4HT1T 2E31A 3F2ZA 4GWNA 5F5IA 5T5OA 1NA1B 3J4UH 4P9IA 1RUNA 3PUHA 3FZ3A 2BV4A 3DXTA 1HX6A 3CZJA 4WVWA 5C8CB 4CDXC 2Z4FA 1KXGA 1YNAA 5IYYA 3IDCB 2QQNA 3IPVA 4CA9A 1FMD1 5FLIA 3KGLA 5IT6A 1S0FA 1BHGA 2OS2A 3LF7A 1VBB2 2E6VA 1Z78A 2RS11 4TLFA 5EWSA 5G05L 1VBC3 2VCBA 4UW4A 2DTWA 3CKHA 3W20A 4EYUA 4P9GA 3TN93 3C3VA 3WP5A 4Y5Z0 1ND3A 1OD5A 2YBKA 1C1LA 2WYFA 5HXVA 3UKTA 4RQPC 1W03A 4QX0A 4K9SA 1OI6A 4W65A 2ZZJA 3ECQA 1EP0A 3WQ0A 4FFHA 2WAAA 1O5LA 3BIEA 4YW4A 2D6MA 1ZRDA 2RMU2 4FAHA 2FDKA 2WKKA 4DY3A 2QQPA 3B93A 2BNNA 3AMMA 4YW5A 2WQ8A 3I2DA 2XHKA 4HVOA 1AJKA 3GBFA 4YWAA 1H4HA 5EV7A 2JE8A 5FZ0A 2JB4A 3VBUC 3ZSKA 3NNLA 2BGPA 5A3MA 4P5YA 3NKTA 5AFBA 3I2OA 5FZIA 1RJ7A 3VZNA 1AX1A 2ZGLA 5C3OA 2VCAA 2Z42A 4OHZA 4BLJA 3NV3A 4MH0E 2GMMA 5JUVA 3OF1A 5JR2A 1RUH2 1W9WA 4HXCA 1N3QA 5DUVA 5HCBA 3ZYHA 1XNAA 3HVDA 4NHLA 2WFF1 3ZXGA 1DFQA 4ASKA 2VJXA 4O7XA 1E57A 1GP6A 3C2UA 3S57A 4QQLA 1SLLA 1W9TA 4WVMA 1ULOA 1PNGA 2V73A 2YC0A 4HKOA 5JSPA 1LRHA 3BU0A 3WY6A 4COWA 2ZGMA 1SZBA 1VBD2 4ASMB 2J1UA 2RS52 1H2NA 1ZRIA 5A32A 3ON7A 3SC7X 4NHXA 3E1F1 4GXLA 4CDXB 1RTVA 3LEIA 5A1LA 4K3UA 3EMRA 1AUYA 1O3SA 3ZYJB 4COUA 4N43C 2CYFA 3WOGA 3K77A 4DXTA 2W87A 1O4TA 3HQRA 1K12A 5DABA 1RUC1 2D6PA 1L7RA 3MEPA 3HNBM 3RQ0A 1MQTA 5FY8A 1AXYA 1LEMA 4FPHA 4ATEA 1QH6A 3HMYA 1TMF2 2VECA 4LBLA 5CFDB 4JGYA 5GZGA 1O91A 3N9LA 3O1TA 1VLNA 2XJVA 2XOMA 2WAOA 4LBQA 4NRQA 4R52A 3MGUA 4YZ4A 3ZSEA 1OOPB 3B3QE 2B4KA 1CVNA 4CXXA 4FTSA 1S0BA 1GZWB 1L3JA 2AC1A 2H0VA 5CYYA 3MV11 1DQ1A 4JGYB 3H3ZA 3WP4A 2JDKA 4CDQB 1S1AA 2W5FA 4XAAA 2ZGRA 3VHPA 4Z8BA 4XILA 4AHXA 2JJ6A 4NIGA 2ADEA 2QTWB 2EF6A 3PLQA 1VPHA 1GQHA 2WIIB 3T2PA 2W1WA 5FYIA 1QOOA 3RMYA 2MEV1 3VZMA 1D2QA 2XJPA 4BISA 1AR73 4N9HA 3SNMA 4ZU4A 4XFHA 2ZKLA 5KHGA 1RINA 2NN8A 2Q5TA 3A7QA 2UU8A 3G7DA 5FYBA 4IUGA 1UOBA 3AKRA 2GNMA 1HV1A 4CCJA 1YJLA 2IXKA 3O7OA 4XMAA 2JKBA 3RVHA 5IVEA 2VXJA 4AEDC 1W6NB 1V9U1 3S5QA 3ZM8A 4NWVA 3A23A 3FC0A 3L9JT 4I02A 5LBBA 5FPBA 3WHTA 5AFEA 2XJSA 4MLOA 5FPLA 3S30A 3LFIA 4CCOA 4EN6B 2JG9A 2VNVA 5A32B 3OPZA 3ZN6A 2WT2A 3SCFA 2BOJA 4XF1A 2D44A 3M3IA 4LO5B 1CR7A 3W9AA 5CEHA 4JZRA 5KR7A 5FBZA 3I3EA 1SACA 1YCIA 3S5AA 3NV2A 1IGOA 1XE8A 3QACA 4LBMA 2UY9A 1DHKB 1W2UA 1ZBE1 2JB8A 1V00A 2IVIB 4Y4YA 1QIQA 5C5UA 5FXWA 2PTMA 2WNEA 3NJZA 2WS92 2ZACA 4FOYA 2Y6HA 4EJRA 1AR63 1FNYA 4OZOA 3RYKA 1HB4A 4GJZA 1U0AA 2C9AA 2RM21 4IESA 1E5HA 3WDYA 3CJIA 2QQIA 3KHBA 2VZQA 4RS5C 4YM0A 5FP4A 5A7SA 5C4WB 4Z1VA 3I54A 4BCUA 3LA3A 5CG9A 1ULCA 5I91A 5KC6A 4JRLA 4PF1A 4QT6A 2E51A 2XLFA 4RR3A 1SCSA 1GV9A 1UXXX 3LIHA 3ZX7A 2DU0A 1GMMA 1O6UA 3I4IA 4RL7A 3VBUB 2G9GA 4NO4A 1JUIA 1H9WA 1XYPA 2FDJA 2V09A 3SMHA 3JD71 4YFZA 5LASA 2UYAA 1BZWA 5AVAA 1QGLA 1RUC3 3B00A 1RIRA 4LKFA 4C8DA 3ES1A 5ABJB 4FFGA 1U5IA 5F3CA 2Z2SB 4JDOA 3VBFC 4QKDA 4CYDA 1W2AX 3RJRA 2Y6JA 4CCKA 1JZ7A 2V4AA 3ETPA 4BQ1A 4DEVA 3VD9A 2NPIA 3BALA 1Q8QA 1BLZA 1RUF2 5GLVA 3DL3A 1QJU3 1ZZBA 2FBEA 4PBPA 2VQTA 3MPPG 2HWB1 1W0OA 1D4VB 1S0GA 5CFCB 3HBZA 1UAIA 4Q4V1 1PK6B 2ZEWA 3LWCA 3GXUA 5IATA 1UNBA 3PNAA 4AWDA 2WWUA 1OA2A 2PHUA 3IN9A 4HONA 1JYWA 3ABZA 5ANNA 1W2OA 4CCLA 4FAGA 5JI7A 5FZDA 2WNUC 2ZHMA 3AXDA 4HKWA 1OD3A 1VRH1 3T08A 4HK8A 2W1QA 2JG8C 4AGVA 3MIDA 4IETA 2BDRA 4CUCA 3O0VA 5EPAA 2SBAA 2A6YA 1TG7A 3TEYA 1VBA2 2YUEA 1EV12 3K3NA 4FPEA 2GC2A 3VKOA 2C0ZA 2DVBA 3GZAA 3VDDC 2ZTNA 4PDWA 5AC92 4L99A 3FMGA 1VRH3 2TUNA 1IKPA 1OLMA 5ISLA 3KV4A 1F5FA 1ACCA 5ACA1 1ZBE2 3GCWA 1MZ5A 1PMHX 1BKZA 4AFBA 5FYVA 2VMGA 1UYPA 3T3YA 4LK7A 2IXIA 2VZTA 4Y20B 4LR4A 1UY3A 2JECA 2GNDA 4H3WA 5EZWA 4OI1A 3T1LA 4XBQA 4QXKA 1QXPA 5FPAA 3ZYRA 3WSOA 2GN3A 1FPN2 4KBZA 1DLCA 4WVMB 4V2VA 5T54A 5TSWA 1LJ7A 3B94A 4COZA 2HBUA 5JVVA 1T2XA 1X9TA 4S2DA 3ROUA 3CL1A 1XNKA 4YM2A 3FUOA 1FOD2 2LM3A 4N8MA 4A3ZA 1DG6A 1CAXB 5KC5A 1LHWA 1H0BA 4AI3A 1W2TA 4NROA 4RS5A 1NY72 2UY8A 2O1QA 2XWJB 3THPA 2QZ3A 3NW4A 1AX0A 2E32A 3M8LA 1D4M3 4IE5A 5FWEA 4B8EA 3FFZA 3PMEA 3EQEA 5DUUA 1UL9A 2R042 1WLWA 1Z7S2 2VW0A 2VZUA 4RHV1 3OCPA 4MXWA 3C7HA 2XKOA 1QU0A 3KS7A 5SV5A 2RDQA 2RS12 1GNHA 3WZ1A 1AF9A 1NCRB 1SFYA 5I8SA 1IG0A 4Z2WA 1CPNA 2VZRA 3ZMNA 1W2NA 4KBBA 3INAA 2LS6A 1Y7BA 2D5FA 1N1SA 2DVFA 3BYWA 3JD73 2YPDA 1KFUL 3IAQA 1YQ5A 2XJQA 3VBFA 3VZOA 1LCLA 2A1XA 3CO2A 4GKYA 1IPSA 4M4RA 2HWD2 2JWPA 3NNMA 1DQ0A 1DU3D 1R64A 3ACGA 3LPFA 4EROA 5CKQA 4IE6A 5JSOA 1ZBA2 3B9CA 3ZYGA 2ZKNA 2DDUA 5JIUA 3JBG1 2ILMA 1TE1B 1X7NA 3OGVA 3WQBA 3QH6A 3KV6A 1OLQA 4WVZA 4BPZA 1AR72 3DEMA 3F95A 3UT0A 1AR92 2ZHLA 3TRSB 2HLEA 2VTXA 4LQRA 2XBO2 1ZZ6A 1DDLA 4AQTA 3KV5A 4CXYA 4TSVA 4LJHA 4Y20A 4NR1A 1CQ9A 1PZ7A 2H0BA 2OQ7A 4QMAA 1PVC3 4YZ5A 2PAKA 3M2MA 4RYDA 3ZXKA 2YC4A 1KFXL 4F8AA 3GYDA 4K21A 5IVVA 4YG3A 5K8SA 4A42A 4KNCA 4J1WA 1MVQA 5C8WA 4PI0A 1X82A 3ZFFC 1SG3A 1RUOA 3G6JB 1WD4A 3KZ4C 3N36A 1MPXA 3H3UA 5LBCA 3ZMOA 4Y24A 2XL7A 2X10A 5A33B 3MZHA 2C1FA 5A6ZA 4IE0A 2J7MA 3VBHC 5F32A 3MW2A 3JZVA 4NHMA 1PIV1 4Q4W3 5F2SA 4COYA 4JDMA 2MHFA 2VUAA 1MS5A 2HYKA 4NRPA 1YQ8A 4A7KA 5CKNA 2FHRA 4KWUA 2RJLA 2ZABA 3HOBA 4LIVA 4PLMA 4DRVA 5AC91 1APNA 3MW3A 4AEDA 1BK0A 1ND2C 5CFDA 3IDEA 2WLPA 3NJVA 4CCEA 4XAEA 2QKDA 1UYYA 1XSQA 5CZKA 4QKNA 3O1PA 4OMDA 1BEV1 5A3NA 1SHWB 1VRBA 1FPN3 1OA3A 2A71A 4UW3A 4WV8A 5KHKA 3ZXDA 3ST7A 4PBOA 5FPUA 5F3IA 5FZMA 1JYXA 4K7JA 3CIHA 1QJY1 1T6GC 5C8CA 1LKNA 5FKBA 1BMV1 4GJYA 2YC2A 3ATGA 3K48A 4XJ8A 5LBFA 1LAJA 3DXUA 1N3OA 2EAAA 4BOWA 4DXRA 3BPZA 1COV3 1UY1A 2ZX2A 3PHMA 1OH4A 2GDFA 3K2OA 4IE4A 5FP9A 5I0SA 2W9XA 1UYZA 3V0AA 4KWJA 2CWSA 2DTYA 4LA3A 4YVWA 3HAGA 4KL1A 3VBRB 1GNZA 4HETA 1KGYA 2WZR1 1GFF2 4KH9A 5FYMA 3BTAA 2VZ1A 3AL6A 1DP0A 1J1TA 1QJX1 4BQ2A 3JD72 4GH4C 4IEOA 3FLPA 2OPKA 1M4WA 1O4YA 2WZPP 3VD7A 2UWBA 4LHNA 4XPVA 1U5XA 1H2LA 2WO1A 2ZGSA 1EPZA 3FBYA 5CIRA 4YFWA 2VNRA 2ARXA 3WV6A 5F7UA 4MO3M 5FYZA 1W6OB 2BBVA 3H8OA 4Y1VA 4H2AA 3WF0A 2W92A 2MPFA 3RZJA 3NAPA 4XIKA 5LA9A 2R1DA 3OGGA 1ENXA 2XWBB 4QD2A 5FZKA 5FXXA 5BNPC 1VBA3 4WZFA 1H2KA 2XJTA 3P3PA 1G8WA 3PVBB 4Q0PA 4C0HA 1A8MA 4J25A 3U4XA 3AKTA 4YLZA 2VZPA 4EE2A 1A6CA 1DQ6A 3IT8A 1PMIA 4HANA 5C70A 2WNOA 4QPGA 5I0DA 4NIDA 4BK5A 3T2TA 3O1RA 1PZ9A 2JIJA 3IAPA 1F31A 3ZYFA 1WMEA 4F7ZA 4ZZ5A 5LRSA 4AFAA 2CAUA 3OGJA 2R16A 2WQ4A 2DWRA 1Z0HA 2R6QA 2J1TA 1W0NA 5C9AA 3WEZA 2VW2A 3HBKA 3NJYA 4FPJA 1MR5A 2Z5WA 3MFAA 2N7GA 4P02B 5IFPA 3BOWA 1DZTA 5HV4A 3A4UA 4H14A 1F4HA 3R4UA 2WZEA 1RYYA 1LR5A 1VBB1 1AYN2 4YW1A 2VVFA 3W5MA 3DCQA 2FMDA 1IQDC 2CAVA 1UD1A 4L2NA 4XEZA 3V56A 1WBFA 2A6XA 1RUG1 5GM0A 4MGKE 1JZ6A 1PGW1 4RGAA 5F5QA 4HMZA 5A6QA 5GZCA 4XCAA 4MXWB 2EXHA 5CADA 4AFMA 5KXEA 1QMJA 1QJY3 2HWF2 2FCVA 3P6BA 4QXCA 1HW5A 4OHYA 5FK7A 3QH7A 4XFBA 3UJOA 4AZZA 4MUVA 2IXJA 4NE9A 2GC3A 1OVPA 2C26A 3O5SA 1Y9MA 2NMNA 3AZZA 5HBAA 4QPIA 3ZXEA 4J1XA 2ZZQA 1N1TA 1JHNA 3FWEA 2X8KA 4LPLA 5IAXA 1IPKA 5FY4A 4YGCA 2BFUS 2WINB 4DUXA 2GU9A 3OBRA 5A7WA 2BEOA 1DYKA 1QOSA 2YU2A 1OC1A 1WKYA 2NYYA 3LDKA 4A7ZA 4YARA 4D0QA 3ZXLA 4LOSA 2V5DA 4Q27A 1R091 3D8CA 4UBGA 4BDVB 1EUUA 4E27A 3M3CA 1SPPA 3USSA 1HV0A 4Q1PA 1OFSA 3H1YA 3WCSA 1D2SA 4MGSA 2VOXA 4A44A 3VDDB 1RL3A 3NSTA 2RHPA 1WMXA 2BU9A 4QB1A 4XACA 1JYIA 4JGZA 3VBSB 5FAXA 2VE1A 1K45A 3OBTA 5GZDA 1ASJ1 1YJKA 1US3A 2CGNA 5FZ4A 2GSYA 1WD3A 2Y0IA 2W0XA 4Z2AA 2DUPA 4AXOA 3PL0A 4XJUA 3WNMA 3M4FA 1BQPA 1W6OA 4XOGA 2G19A 2HWC3 1O4ZA 2ORZA 3LOIA 4QQOA 5T5PA 4A3XA 4B4QA 4Q8KA 4XTPA 3THCA 2VOTA 3SLIA 4KU7A 4N53A 2EA7A 4Y22A 3TWIA 5BPXA 2RS32 4DOUA 1P8JA 2WO7A 5J37A 4NPLA 1PGW2 2CWMA 4PT6A 2VUJA 1LESA 1ULFA 2D40A 5CFCC 3RI9A 3WCRA 2D3PA 4AVTA 5A7PA 3THTA 4JKLA 2WS93 1HRV2 2D43A 3VUOA 1OXCA 3KM5A 4GMP0 5I0TA 3VBFB 4QKBA 1DYPA 2JDNA 1AXZA 1RUD3 3TEWA 3S7EA 2B5HA 4UWDA 1HN1A 4O9EA 4DXZA 1EYBA 2YZ4A 5FZ6A 4Z82A 1XNDA 3VDCA 1RXFA 3U37A 3UKNA 3OD0A 3WF3A 4R8HA 2HEVF 4RA0A 4V1PA 3LCPA 4URTA 1HJGA 2ARCA 5LCWL 1HRI3 1C8M3 2HWB2 3RJ2X 1CJDA 4D7SA 3DN7A 4EWDA 1ZA4A 1XYOA 3VBOB 2PLV1 1RUC2 2MNGA 1IS4A 4DY5A 1Y43B 4ZS2A 5A80A 3VD4A 1PK6C 1S0CA 3WD5A 5A1FA 2RJ2A 5FY1A 5A3WA 3UGFA 1JYVA 3Q8EA 4K1YA 1GP4A 5DUXA 5EJ3A 3SCHA 1K5JA 1YUDA 2ZGUA 2AREA 1QJY2 2HWF3 4AW7A 2JKXA 2ID4A 3N9PA 5D1IA 3BOPA 4AG4A 4GA9A 3ZVXA 4LBQD 4LLFA 4UFHA 5FYYA 1GZWA 4EZHA 2W39A 1PO11 4YNIA 4YW7A 3WNPA 2A73B 2BWCA 2ZX0A 3A22A 1S2EA 2AH2A 3VBRC 4QX8A 3NNJA 5H9SA 1DQ2A 3U78A 5JXIA 2ES3A 5JZGA 1W6QA 1GP5A 1RUI1 2QZ2A 3UL2A 3WNXA 5D8AC 2DUOA 2VVDA 4JV4A 1GZTA 4N43A 3ZFFB 1JU3A 3GHMA 4A6SA 5KWRA 4IEXA 5C5TA 4LE3A 2PHXA 4XFGA 4YGDA 2XLAA 3IDAA 5K9YA 1LHNA 4XCBA 4OMCA 3USUB 1JH5A 4C0BA 3OGSA 3AMHA 1Q8VA 1J3PA 2EXIA 5H9RA 4U36A 1R092 2VMCA 3BKZA 5FJKA 1F9KA 4R4XA 4AQ6A 3O1OA 2R073 1YC61 2R32A 2VGDA 1DF0A 2VXRA 2R063 1CAVA 1XNTA 2IXHA 5DDJ3 1CZVA 2ZMLA 1R1A2 5JOWA 2V5YA 3DKWA 3MLLA 4DUWA 4UFKA 5IVCA 2KM2A 2ZHNA 4W6WA 3ZFEC 2BNMA 4WM7A 2PHFA 4YM1A 1H1AA 5JCTA 4CP9A 3BCWA 3M70A 4CDQA 2HKXA 3R4DB 2VMEA 4NAOA 4NWWA 1WLDA 2VBDA 4HKLA 1UQXA 4HFSA 3GGLA 1UMHA 3V0AB 1A78A 4IV3A 3IKWA 2P3JA 1FMD3 1V6MA 4YZ2A 3OY8B 1PVXA 3DKQA 3ZSLA 1SBFA 2XVGA 4DQAA 1RVF3 1L7QA 1QJU1 2O8QA 2FDHA 1NCRC 2NLRA 2ZBJA 3BPSA 1VMHA 4IE7A 4MZUA 4Q0SA 4QDRA 1BCXA 4D3WA 2LUWA 2VZOA 1C8M1 5CNAA 1AYN1 3KV9A 1WLCA 3KVBA 5FJHA 1RUD2 4BK4A 1AJOA 5F6LB 3E5QA 1S0DA 4AFCA 1ZNPA 1HQLA 2YROA 3KT7A 1GU3A 4QGLA 3WX5A 3O14A 4GAZA 3TBDA 2R061 5DDJ1 1W6MB 2Y6LA 3IDBB 2K46A 5DAWA 3OBAA 5L7OC 4IW3A 5DMYA 1UOFA 3DV8A 4LUMA 1HRI2 4MGQA 2QUOA 4ONUA 2Q0AA 2RR11 5FY0A 2LRPA 5LATA 4BJ0A 3TNQA 4BMBA 4L92A 4A45A 3AVSA 3POWA 1GR3A 1IOAA 1AL0G 4L9BA 3W5NA 1ND2A 5CFDC 1IS3A 2B9VA 3NNGA 1IPJA 2EVXA 4LIUA 4XUTA 5AC93 4K1ZA 1UZVA 1UYXA 4P9LA 1ND3B 5ANQA 4QQHA 3RSJA 1NX9A 2EXJA 1RUI3 3RZZA 3SCGA 3VDDA 3I2FA 2Y8KA 3BU7A 4M3CF 3SH4A 2BGCA 4LULA 4EN0A 1PGSA 4RD7A 4BXFA 5C4WC 1GWKA 2YBSA 3VZLA 1XOYA 4PLNA 3H7JA 4Q4V3 2ETEA 1K42A 2QDNA 2CY6A 4RFRB 4KQ7A 4BMEA 1PO12 4PJYA 4JX0A 4FOWA 4QX5A 2F17A 1I5PA 5I0UA 2A5ZA 1RUH1 1CZSA 1AR82 1OLRA 1OQ1A 4QQ2A 2WN3A 5A7WB 1PVC1 1XNCA 2AZ5A 3FBMA 1RITA 4HLTA 5E8AA 4JHTA 5FZGA 4AQ2A 2A75A 1V6OA 4WM7C 2GC1A 4BXSV 4DFSA 3IB3A 5JMCA 1JZ4A 3KLSA 1WCKA 3PUSA 4XF4A 4XURA 5T50A 2ARBA 4MG2A 3QLQA 2JICA 4LO4B 2WJSA 2AGSA 1I5ZA 2WRAA 4W6YA 1VBC2 4B1MA 4BQXA 1UCXA 3I3MA 3JBG3 4HOOA 3U07A 1ENRA 1NT0A 1AYM3 1ST8A 1MACA 5I0RA 4ZY9A 3FHQA 1SCRA 4XE9A 1FI2A 3N9QA 4GIQA 2Q30A 3AP6A 3FUQA 4Q4Y3 2CDOA 1ODMA 2DVAA 1BK1A 2WNUA 4XETA 2QQLA 4GD4A 1YHFA 4YM3A 1WUVA 1W8FA 1TQ5A 1YO8A 1RMU2 1WCQA 3WDVA 3TEZA 5J98B 1FV3A 3R0RA 3WUDA 2YFUA 2P6CA 3LEMA 5D8AA 3VL8A 1UN1A 1DZRA 1DGWX 1H2MA 3D4KA 3MUZ1 4FFFA 4LHKA 4XYXA 1JU4A 1RVF1 1U5ZA 5FQ0B 3IIAA 5BNNA 4FSJA 1BEV3 3OBZA 2VOVA 1ZRFA 2RDRA 4Q0UA 1LGNA 2PYTA 3J7HA 2OUHA 5DZGA 1EV11 1OQDA 4P00B 2QBXA 3GNEA 4IEVA 5FY5A 3R6SA 3PIJA
chains in the Genus database with same CATH topology
2SLIA 3TN92 3N7LA 1BJQA 1ENQA 4Y26A 3LOBA 4YGBA 2W68A 2Z69A 5AVPA 5FMOS 1X50A 4FTEA 3MI8A 4HL0A 3D0JA 2WLQA 1N1VA 5BNQA 3ME2A 3AB0A 3WHUA 4MV2A 3AJYA 4CP1A 1C57A 3OD4A 1XU2A 4GB31 1A3KA 1XU1A 4E2QA 5ABJC 1IKQA 4YG6A 1Q8SA 4OI4A 1S2KA 2ZPXA 3BB6A 1V6NA 1XNBA 1OOPC 3WLUA 1KITA 2GAUA 3URFA 2FMYA 5DG2A 1VBE2 2HEYF 4R9AA 1EAH1 2UWAA 3J9SA 2ZMKA 4XZPA 2ZAHA 1EPWA 1AR71 2QCSB 1NCRA 3KSCA 3AFKA 4IL7A 1FNZA 3CU7A 3ZN4A 1LOFC 1B09A 1ZBA1 4IV1C 3NAPC 4L11A 1C8NA 1Q8OA 2Q1MA 4I0BA 4WM7B 4I3PA 4OVEA 4RR3C 2EAKA 4HPKA 1AL22 2A3YA 1H9PA 2BQPA 3J8F1 1QJX3 1HKDA 2RS53 3WG2A 3IWZA 3N7JA 1SLBA 1LTEA 2B42B 3WDUA 4RSUA 1NE4A 1X8MA 4AGRA 2PA7A 3JQWA 1YLLA 3USUA 1RUG2 3W58A 1UKRA 1JTZX 1R081 3WVJA 2VY0A 1LOCA 1VBC1 2D5HA 2X53S 2CGOA 2NM1A 3S6PA 1AL21 3DUIA 3POYA 4LNVA 1QQP1 1VALA 1TNFA 2DU1A 1LEDA 5FO8B 1LULA 2CGPA 5FLJA 3NV1A 2A6ZA 3I8TA 4MGZE 4YSFA 2PAMA 2WNVA 5LEJA 1DQ4A 4X8PA 1NQDA 1TMF1 1C3HA 4S2GA 4D7TA 2D6NA 1DGRN 3ASIA 1LHUA 1LB2A 2WWSA 3APBA 1DZQA 4CDWA 2ZGKA 2D93A 2VULA 4KG0A 4B4RA 4RFT0 5T55A 2WC2A 2VG9A 4Q4W1 4AFDA 3D5OA 1XYNA 1AR62 2WFPA 4PLOA 2UYBA 3RRDA 1B35A 2JENA 5LRRA 1POV3 1ZRRA 1W6NA 1X36A 2WL1A 3WW3A 4S2HA 4XFCA 2TEPA 4I09A 5JR7B 3GZTB 3I59B 1QQP2 1QNWA 2B46X 2B8MA 3HT2A 4YVWC 2YGLA 2PLV3 2JDZA 5BYNA 4EN8B 5I8YA 3PTYA 4IEQA 1N3PA 3WDXA 2B7YA 4BE3A 3H7YA 3ZSMA 4D94A 1NE6A 4F3JA 2K2SA 1CD3G 4GH4A 1I1EA 1QJU2 4J6GA 1J3RA 4JGYC 3AYEA 4MVTA 4CEWC 1CAUA 5E88A 3OJBA 1XE7A 3TNPB 4EN7B 5KXBA 2H6BA 3PVOA 1UIJA 1ZX5A 3AZYA 1NZCA 4FPGA 4B4PA 3JUUA 4U2AA 4XDQA 3ZN6B 2I45A 4LHLA 5IK7A 1BBT2 5FRAA 4AEKA 4CEYC 5F6KA 4Q4X3 3NVCA 2YXSA 4EV0A 1GYKA 1MS0A 4FBFA 2XKPA 3RPQA 2VPVA 3DF0A 1VBB3 2FQPA 1SDWA 2GALA 4QHBA 3ZPYA 5GLUA 1UZYA 1AR81 2AENA 1B35B 1FT9A 2G4IA 3VN4A 3B5LB 3IMNA 3LA7A 4ES9A 4AEJA 1W0PA 4TZDA 3VBSA 4FP3A 1WGPA 3MFCA 4N9IA 1WCDJ 1N47A 3K51A 1BVP1 1ZZ7A 4FPOB 1GZCA 2WSUA 4IEWA 3VBOC 3ZFFA 2QNKA 4UW6A 2YDEA 3ENRA 1JW6A 3S7IA 1LGCA 1UKGA 2B9UA 2QDRA 2LALA 2PFWA 1QY4A 3VLBB 5KHHA 3VHOA 1JN2P 4BH9A 1R093 1AVBA 1POV0 5CFCA 3FJSA 4XJAA 3ILRA 3N4MA 1SLAA 2R062 5DDJ2 1R1A3 5C9AB 5CA6A 4FP2A 4YZ3A 1OFNA 2D3RA 2ZA9A 3NL1A 3LSEA 2WNVC 3AMPA 2ZGQA 5FO7B 2DV9A 4HSLA 5L7OB 1R082 2YMZA 1S2BA 3CF6E 3HT1A 4Y22B 4WM8B 1MS4A 1XRUA 1YWKA 1OA4A 1V6LA 4DRRA 1PIV2 1COV1 2TBVA 2W52A 3IM0A 4C1XA 2RE9A 1DGRA 1QNYA 2CTVA 2RS13 1ND3C 1VB2A 2GZWA 4RQPB 1CESA 2X5IA 5CU1A 1IS5A 2CV6A 4H55A 2GNBA 1H8TC 1VIWB 2F4PA 2NMOA 2ZOEB 3CJIB 1FOD1 1S0IA 4BLIA 4E4SA 5FMOL 1R1A1 4P9WA 4DINB 2DFBA 1G9FA 4FO9A 1WW4A 2WA3A 1PO23 5FFOC 1IZ3A 4IEZA 4DB5A 2ERFA 4BZ4A 5GZFA 4ES8A 1KDKA 1SFNA 3LA2A 4Q4W2 1H8VA 4YVWB 3RWNA 1BVVA 3WG1A 4AVAA 1NA1C 2EIGA 4XQDA 4QPIC 5GLWA 1AR93 1RUE2 3SITA 2Q4SA 5BY5A 3E6CC 1SBEA 4ZU7A 3ETQA 2ENRA 1RUJ3 1D0HA 1WBLA 2H6CA 4N7IA 2HWE2 3V65A 5CBLA 2OZ6A 3JB4C 1EY2A 1PO13 1LHVA 2WNVB 1Q56A 3LSDA 4GQ7A 4M0HA 1RHI3 5LK7B 4Y1UA 2A3WA 2ZGOA 1MZFA 4WBBA 2B39A 4JGZC 1LECA 2ZAAA 3B69A 4AYUA 4Z92B 3MICA 4IV1B 3ZFGA 2K9ZA 2DCYA 2DYCA 1CGPA 4QGMA 3TN91 1KJRA 4ISQA 2OUJA 1TME1 2IXLA 4R9CA 5FLHA 2GH2A 3H9AA 2A6VA 3UJQA 1BBT1 2ZGNA 5FPXA 2ZX3A 1K5MA 3H0OA 1GSLA 2I07B 4IQPA 4EWEA 2ZMNA 1CAWA 2E53A 1RMU3 4LO8A 5KBFA 3TB0A 1OHFA 1UU5A 3U10A 2RM23 3ZYIB 4ZU5A 3KCCA 1PIV3 4BWOA 4CEWA 1YFXA 3ZXFA 1ZZ8A 4FPCA 3U0ZA 2X29A 4XJ9A 3GZUC 4FQ4A 1W39A 3AZVA 1C28A 1H8TB 2HEWF 3DGTA 3VKLA 1ASJ3 3KCYA 1YIFA 2ZS6B 3L2YA 1REDA 1J1LA 1V6JA 1PO22 2HWC1 4OHVA 5C33A 5F9TA 4FXGB 4XFFA 1NLSA 4X8NA 3AYAA 1UU6A 1CONA 4F83A 4MXVA 3MIFA 5DUWA 2A7AA 4N53C 3MF9A 3EHKA 1LENA 2E7TA 2P3IA 2WT0A 3PVNA 2RJKA 4X6RB 2JG8A 3IPVB 3PVEA 4XFAA 1RUE1 2UWCA 3SHRA 2ZX4A 2PHRA 4OUMA 2TNFA 1Q43A 2XH6A 2XUMA 4LA2A 2Z79A 4YVSA 3AYCA 1OKQA 1HXS1 4I01A 2X5IC 2PAEA 4PDWC 5J7MA 1Q8PA 3ZFGC 1K5MB 1G86A 4PIYA 2DURA 3O12A 1GKBA 2ZX1A 4FPFA 3FX3A 4OUSA 3MIGA 3ZXAC 5CG8A 3AKQA 1PO21 2HWC2 3AX4A 4JVAA 1OQEA 4JTNA 4RHV3 3UV9A 1WLTA 2RS33 5BNNB 5FQ0A 1LOFA 4IV1A 1SLCA 4MGIE 4BA6A 1J59A 1Z7S1 2P3KA 1NCQC 3WQ7A 4RQPA 4LO6B 4ZXKA 2VU9A 2VMIA 4Y1ZA 1ZZ9A 4JQRA 4KG8A 2R30A 2GN7A 1VBD1 5J09A 1G9BA 3E5UA 4FVVA 5JWPA 3X29B 2VNGA 1FAYA 3ACLA 3MF6A 4DNYA 5ACA3 1UPIA 3M7AA 3VBUA 1R1ZA 5A3LA 1AR61 1GZ9A 4XMIA 4CDUB 3PMSA 1ZBA3 1V6KA 4IERA 3O0WA 3N7KA 4I3GA 3E97A 3LGRA 5ABJA 1VB4A 5J96B 1NYWA 3OYWB 4Y1XA 2P37A 1EAH2 2XBO3 3WW1A 4QPGC 2WT1A 1GANA 3WG4A 2JE7A 1I6XA 4O9GA 1NXMA 3A0NA 4P5HA 4GB33 4XW3A 4MSVA 3HIFA 3E6DA 4IEPA 5FOBB 1C1FA 2JE9A 3QOPA 4B7KA 1AHSA 2LTNA 3CEWA 4CDWC 4RR3B 3CLPA 4HN0A 4HVRA 3KCXA 2R49A 1VBD3 1RB8G 2WZR3 3NO8A 4CDUC 2KA3A 3EJKA 3VV1A 1C8M2 2HWB3 4CZSA 2HWE1 1CAXA 3DPRA 4UW5A 2XL9A 1G9DA 4MYEA 1TNRA 4Q1RA 4GH4B 3ZXJA 2F6BA 3ZDSA 1HRI1 2DF7A 5L19A 4ISRA 1D0GA 4GMP3 3VBRA 3WDTA 2JX9A 4NOTA 2I2SA 1NCQB 3N35A 3MW4A 4UXAA 4R4ZA 1VAVA 1UMZA 4G4FA 4WVVA 2ZJCA 2GNTA 2RMU3 1NXD1 3HWJA 1F2NA 2WS91 4M00A 1BBT3 3VHRA 4XXPA 1TME2 5HI0A 2IZWA 1SBDA 3B02A 3M3EA 2PHTA 1C4RA 2VQAA 4P9YA 3L2HA 4AE2A 4HN1A 3Q9OA 1U5YA 3NV4A 2OVUA 5DZFA 3LB9A 4AQSA 4QM9A 1F5JA 2AUYA 3VHNA 3ZSJA 4FPKA 4IXLA 1RHI1 1PVC2 3AM2A 5I93A 1RUH3 4JRAA 2C5DA 1C5HA 4OZXA 3V64A 2BUKA 2XJUA 3WP6A 4IV3C 1HIXA 1CIWA 4NHKA 1OSGA 4Q0VA 1V6IA 1XQNA 4N7UA 5KHIA 3AZXA 4HSJA 3KT4A 3GBGA 5HCFA 3DPRB 3MPBA 4D7YA 1AR91 1FMD2 1CPMA 1UZZA 3VBSC 4HBNA 5BNPB 3WG3A 4G9SB 4XBNA 4C90A 1QKQA 1G7YA 1UU4A 3ES4A 3SH5A 3UK9A 1Y3TA 1ZRCA 4OLLA 1RUI2 1WMFA 1Q3EA 2VOKA 1Y9QA 4QU2A 1G6NA 4OULA 1LOBA 2XGXA 5BNOC 1WA4A 3MIHA 4CP2A 2XG3A 4QGNA 4S2FA 1BXHA 1DIWA 3KQRA 5GJ6A 4AI0A 2JD4A 2EALA 3MIEA 2PHLA 4B3NA 2BW8A 2WSVA 4GMP1 4D69A 3WP3A 1NQJA 1ZYBA 3AP9A 3M1HA 4IV3B 1X8EA 5EFUA 5GLTA 3VZKA 1AYN3 1NA1A 1COV2 3FE5A 2JG9C 4SBVA 4XQ4A 1ZM1A 3TAYA 4XTMA 4YW2A 2R1BA 4P9JA 4TYSA 4CTEA 5T52A 1QOTA 2RS51 1O7FA 3J8F2 4Q0QA 3ILNA 3MDPA 1Q5OA 5C6CA 1KDMA 4LBJA 4KGGA 4JTOA 4E2SA 1O5UA 1PNFA 5A33A 2PELA 5BV6A 4CDWB 2YY1A 4CDUA 3VL9A 1HXS3 3S0MA 3GALA 3LZZA 4XFIA 3P3NA 3WW2A 5CAZA 2A6WA 3AMQA 5DZEA 5EYYA 3DPRC 1UF2C 1UIKA 4X6QB 3CJXA 2ZHKA 1WCSA 2NQYA 1RUF3 2P17A 1VBE1 1VRH2 2XJRA 2OZJA 1KS4A 1UW8A 1DGWA 4PIXA 3CNAA 4HZFA 4Q4V2 3AKSA 4YVSC 4SLIA 3FLTA 5BNNC 5K0UB 4I2OA 3POSA 2P2KA 2Y38A 1FYUA 2XVKA 4ITCA 2WNUB 1FOD3 1UPSA 3WW4A 3VBHA 2R0HA 4YRDA 1JYCA 3HR9A 3WUCA 2R043 1G9AA 5L36A 4FOQA 1CAUB 2AR6A 3MLKA 4QPGB 4PIZA 3ZIWA 2BWAA 4LT5A 3D0SA 1NCQA 1JOJA 5BUVA 5JLVA 1H8TA 1IS6A 4AF9A 1BYHA 2BFUL 4ORFA 5JOXA 4FPLA 4FQZA 3FFQA 1NOVA 4WM8C 2VMHA 1UX6A 4E4ZA 5FOJB 1MS1A 2XLGA 1TME3 4NVPA 1ZVFA 1FATA 1MZ6A 1CX4A 1VP6A 2FZ2A 3TOJA 3VBHB 1YFWA 3ZFEA 2YHJA 4AI2A 1QDCA 3BODA 5CB7A 2AYHA 1ZBE3 4K8FA 2VQ0A 3GF6A 2YV8A 3HD8B 3ALQA 3AK0A 5T3NA 4AVVA 4NPRA 3MLJA 3AFGA 2HWE3 2E9QA 2DCJA 3ELNA 4EWAA 4Q8LA 5JIAA 1RC6A 5JOYA 3ZO0B 3JQXA 2QJVA 4I0WB 3EBRA 3GBWA 4W6XA 3RYPA 5L73A 2XPJA 1QF3A 3RYRA 2O8OA 1GBGA 3WINE 4A7YA 1HXS2 2BVBA 1V9U3 2DCZA 1YRZA 4FXKB 2OA2A 3KB5A 1IHMA 2MEV2 5IK8A 1D4M2 3ZFGB 5IK4A 4M3CA 3VKNA 1VBE3 4B7EA 4FCAA 2RR13 4KGQA 1CJPA 1MS8A 4QM8A 1CAVB 1OMIA 2YGMA 3AKPA 4Q29A 3FLRA 1BMV2 2VNOA 4RGGA 4XQWA 5K7PA 3KT1A 4PCRA 2ZGPA 4AHZA 4MGYE 2BNOA 5JDBA 2BYVE 3D6EA 5HCAA 4BHPA 2D6KA 3NWKA 5K0UA 1CAWB 1LOEA 4R9DA 2D6LX 2QE3A 4RHV2 1LODA 1QQP3 2YPJA 4CDQC 3E5XA 1KS5A 5FTTC 3HN1A 2PLV2 4AEDB 4AK3A 4KWLA 1LU1A 2DFCA 3NKGA 1D4M1 4AHYA 2RS31 3QCWA 1ND2B 5BNOA 5J3UA 1NLRA 4XJWA 4GULA 5B2GB 5FPZA 2O0OA 3JCIA 4JCKA 1PGL2 4GKXA 1YIPA 1X33A 5GZEA 5IK5A 4DZGA 4Y1YA 3A0KA 1ASJ2 1NY71 4UBHA 4I0AA 1W6MA 1PHMA 3AZWA 4JAAA 5ACA2 2JG9B 4KU8A 4N53B 2D6OX 2WFF3 4HVQA 2ZCWA 2DCKA 4YG0A 1MEC3 2D7FA 1A8DA 2E7AA 2G9FA 2VOWA 4ATFA 1SMVA 1EAH3 5E16A 2XB6C 4XJZA 1LGBA 3M3OA 3SH3A 3AP7A 4L8QA 1YI9A 4N90A 4OI0A 1ENSA 3AP4A 1SLIA 2NP0A 2IFRA 1KRIA 2A70A 1S0JA 3KD4A 3J26N 3QD6A 1VR3A 4DPNA 1C5IA 4K40A 4CEYA 3BIWE 3LAGA 3SXWA 2ZGTA 5JI9A 2PHWA 4L97A 1YYNA 3GHNA 3KMHA 2HWF1 3LKJA 4WM8A 2D3SA 4AVSA 1J3QA 4AI8A 2BTVC 4HK9A 4Q4X2 3U11A 4H7LA 4GALA 4Q4X1 5JAXA 1F8VA 4B29A 1RVF2 1WW7A 2X5IB 5JZGC 5KXCA 1LOAA 5FDBA 1U12A 1RMU1 2K0GA 2VH9A 1SQ4A 1O3QA 1DBNA 3ZIXA 1RJ8A 1AYM2 3PJYA 1KJLA 3R4SA 4E4DX 4Q4Y1 1MVEA 2CL2A 5J36A 5L7OA 3UKVA 1FPN1 3VZJA 4P14A 5C8CC 1OPOA 1WMDA 4PF5A 2DUQA 4Q26A 5E89A 4DMIA 4LO7A 1K5MC 1BEV2 1KD7A 3H1MA 3H8UA 4COVA 2CNAA 2NZ9A 2ET1A 4DS0A 3RI8A 1VAMA 3M3QA 4PDWB 1QH7A 2PHDA 3O0XA 4META 5I8TA 5GALA 4YVSB 4ZKTB 5C4WA 5F1RA 1QWRA 4BM8A 3WXPA 1HDKA 3E6BA 5J48A 2GMPA 3OTFA 3MYXA 5FO9B 1POV1 3IBMA 3QBQA 2UURA 1YFYA 4LEJA 4KWKA 2D97A 3RMXA 1REEA 2DVDA 4K6BA 4AVCA 1G9CA 1H1MA 2WZR2 4CP0A 1AR83 4I30A 4XBLA 1V9U2 4JC1A 1H1IA 3FHIB 1TEIA 3VBOA 5H9PA 2D98A 1FXZA 3N3HA 1EV13 4WZCA 4AVBA 1MEC2 1PZ8A 2XBO1 1ULGA 2RR12 2IWGB 1WW5A 2HJIA 4AEMA 4XXAA 4MX3A 1YFUA 2KXLA 2GH8A 3EO6A 2VVEA 3JBG2 1M06G 3TYJA 2BPA2 2RMU1 3AJZA 4XF3A 1RUJ2 3SISA 1MS3A 2YYOA 2VW1A 2Q1ZB 2Y26A 3D82A 4YW3A 4M3CE 3WT3A 4E2GA 2DVGA 1O3TA 4CEYB 1MS9A 2IXCA 2ATFA 3RNSA 4E9KA 5JPMB 3RDIA 4INDA 1AYM1 2PQQA 1R083 1YXWA 2E63A 1NG0A 2HWD1 3N7MA 4QPIB 4ASLA 4PQ9A 1MQTC 4RS5B 1I9RA 2E7QA 1MZEA 3VKMA 1AZDA 4Q2FA 1RUG3 3AP5A 5JSRA 1GQGA 5T5JA 1FV2A 1QHDA 2R041 4GWMA 4M01A 5BNOB 2DCTA 3B01A 1O3RA 3J8F3 5JPNB 4HPKB 4YGEA 4FTBA 2BVVA 2OIIA 4FPYA 4JGZB 2R071 1RHI2 4AI1A 1DQ5A 2FZ1A 1I3HA 4XIOA 1OPMA 3MIBA 4LBKA 1RUJ1 3JU9A 4CDXA 4XF0A 2JG8B 2WFF2 3EXUA 1ULEA 3WQ1A 4FOVA 1RGSA 1QDOA 1ALYA 3ZYPA 2GC0A 1DLLA 4OHWA 1HRV1 1MQTB 1RUE3 4LBNA 1FX5A 3W59A 1MEC1 1HRV3 4Z07A 1ZREA 2PN5A 2EXKA 2WA4A 3AMNA 1PK6A 3HQXA 3WDWA 2R072 1VBA1 4K20A 2W08A 4LE4A 4M0NA 3AXEA 1HQNA 5JOZA 1JUHA 5SV8A 4A2UA 5DXDA 5H9QA 2R0FA 1AL23 3R05A 1JBCA 4OI2A 1QJX2 1SEFA 4R9BA 5CVRA 3VKFC 1IQAA 5DG1A 5BXXA 3RS6A 4CRQA 4QPYA 4BIOA 4XF9A 3VGIA 5EXOA 3AYDA 3CJIC 4EN9B 4C91A 1Z7S3 1H30A 5T5LA 5KXDA 4XHBA 1SLTA 1W6PA 4LTAA 1URXA 2QFEA 4LUKA 1GLHA 1OOPA 3B9IA 2P34A 4LBQB 1S0EA 1JXNA 3I7DA 2HWD3 1H4GA 2OYZA 1AXKA 1YI7A 5IUQA 4BIFA 4OFGA 2XVLA 1RUD1 3B7MA 4YZ1A 1ONAA 4LBOA 1PM7A 4C1WA 5GKAC 2QVSB 2RM22 3OYWA 5E1RA 3NAPB 1WW6A 4IEUA 4OHXA 3ZFEB 3ZN5A 3I59A 1HQWA 2GMEA 1LOGA 4AGGA 2IFWA 1ULDA 1AX2A 4P9XA 4NN0A 1B35C 1VAKA 1LHOA 1VJ2A 1DGLA 4H7MA 3KGZA 5FCCA 2JEMA 2Q8OA 2OW4A 3WR0A 1QJZA 1W6PB 2IC1A 2B45X 1CN1A 4QQPA 3JB8A 1ZZCA 4JDNA 5LEKA 4FT8A 1XXNA 2WQZC 1LU2A 5BNPA 1HLCA 5D8AB 1RUF1 2Y0OA 4IEYA 1N1YA 5JZGB 2A3XA 1GICA 2JXAA 4N43B 4M3CB 4XHXA 4BYYA 4TWTA 2MEV3 3ILFA 2I74A 5GLZA 3H1WA 1PGL1 1QXJA 4CEWB 3PJQA 1REFA 4LLOA 3OY8A 5FREA 3RG0A 2ET7A 3V0BB 1S55A 1TMF3 5LK5A 5KHJA 1QXRA 1J58A 4GB32 1V70A