1MQTA

Swine vesicular disease virus coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
271
structure length
271
Chain Sequence
RVADTVGSGPVNSESIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTVENFLCRSACVFYTTYKNHDSDGDNFAYWVINARQVAQLRRKLEMFTYARFDLELTFVITSTQEQSTTQGQDTPVLTHQIMYVPPGGPVPTKVNSYSWQTSTNPSVFWTEGNAPPRMSIPFIGIGNAYSMFYDGWARFDKQGTYGISTLNSMGTLYMRHVNGGGPGPIVSTVRIYFKPKHVKTWVPRPPRLCQYKKAGNVNFIPTSVTEGRTDITTMKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
molecule tags Virus
total genus 42
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtA00
1VBE1 1PGW1 4JGZC 1COV2 2MEV3 4CDXB 1AUYA 4N43B 1RHI2 1AYN3 4Y4YA 3NAPB 5C9AC 4YVWB 4FSJA 5D8AB 1ZBE2 4N53A 3HAGA 1RUJ3 1HRV2 1FOD3 1QQP3 5FMOS 5BNNB 1QJU1 2BFUS 1OOPB 2ZTNA 1RUG1 4Q4W3 4JGZB 3VBRC 1VBC3 1BBT1 4LLFA 4EJRA 1R082 1RUC2 2X5IA 5DDJ3 2HWC2 5C9AB 2WFF3 1RUH3 3JD71 4FTSA 5ACA2 4CDWA 3CJIA 4PDWA 1FPN1 3JBG2 1D4M2 1RHI1 1ND2A 3IDEA 1TMF2 1ZBA2 4JGYB 1FMD1 2RR13 1QJX2 1NA1A 1ZBE1 1F8VA 1VBE3 1PO11 5J98B 4WM7A 1VAKA 4CDQA 2R061 1AR93 3VBOC 1RMU2 4GH4C 1BEV2 5AC92 2BUKA 1VRH3 1AR82 3TN91 3J8F2 2HWF2 1E57A 1HRI1 4BCUA 1X36A 2HWC1 2PLV1 1MQTA 4IV3C 4FTBA 1RUG3 1SMVA 4Q4V1 1BBT3 1NCRB 1MEC1 1HX6A 4GH4B 1VBB1 5CFDB 1TMF1 2RS51 4YVSC 1ND3C 2MEV1 4CDXA 3JD73 3NAPA 1VBD2 4YVWA 1HXS2 4IV3B 1B35B 5D8AA 5BNOC 1CD3G 5JZGA 1VBA2 1H8TC 1QQP1 5BNNA 2FZ2A 1RHI3 5AC91 5L7OB 1K5MA 1OOPA 1OPOA 4WM8C 1V9U2 1ZBE3 4Q4Y2 4JGZA 1AR72 1AYM1 4YVSB 1ND3B 3VBHB 5CFCB 1RUF2 2HWB2 2RS32 2R063 2DF7A 2WLPA 4GMP1 1PVC1 5C9AA 3TN93 1R083 1RUC3 3VBSC 1H8TB 1HRI3 5LK7B 4NWVA 5C8CC 2HWC3 1R091 1Z7S1 2PLV3 3LOBA 1RUD2 4CDUC 2WZR2 1EAH2 4FTEA 2RM22 5GKAC 4Q4V3 1NCQC 2RMU2 4JGYA 1MEC3 4CDQB 1D4M3 1C8M2 1VBB3 1NY72 3ZFFC 1TMF3 2RS53 2QQPA 1AR91 5BNPC 5C8CB 3FBMA 1VRH1 4IV1B 2R071 4GMP0 1AL0G 1RUE1 5AC93 1QJY2 1AR62 2RS12 5K0UB 2HWF3 1AYM3 5FMOL 1AL22 1NCRA 2BFUL 1F2NA 1PIV1 1NOVA 1RUD1 5BNPB 1ASJ2 4GH4A 2HWE2 3ZFGC 4GMP3 1PVC3 5CFDA 1RB8G 1VB2A 1RUI2 4Z92B 1POV1 4CEYC 1PGL2 2GH8A 1R093 4IV3A 1Z7S3 3ZXAC 3JB8A 1B35A 4GB32 4QPGC 1COV1 2XBO2 3VBRB 1RVF2 5L7OA 2R042 3VBUC 1HRV1 1PO22 4RR3C 4YVSA 1ND3A 3VBHA 5CFCA 4RHV2 5C4WC 1V9U3 1EV12 1AR73 2HWD2 2R073 4QPGB 1R081 1RUC1 4NWWA 1RUE3 1IHMA 1POV0 3VBUB 3VDDC 1HQNA 1AYN2 5ACA1 3M8LA 5C4WB 1PIV3 1RUD3 1R1A2 1RUJ2 2WZR3 2XBO1 3JBG1 3VBOB 1D4M1 2RM23 2ZZQA 4AEDC 1QJZA 1ZBA1 1BMV2 2RMU3 1QJX1 4Q4W2 4N43A 1POV3 5C8CA 1VBC2 4IV1A 4RHV1 4CDWC 3VDDB 3CJIC 4RQPC 1COV3 4PDWC 5DDJ2 2TBVA 1RMU1 1BEV1 1ND2C 5K0UA 1OHFA 1AR81 2HWD1 2WFF2 3J8F1 2HWF1 1RUH2 4AEDB 1NA1C 1HRV3 5A32B 5FOJB 2RS13 1X33A 5A33B 5BNPA 2IZWA 5BNOB 3CJIB 4RQPB 2WS92 1R1A1 2FZ1A 1DDLA 4SBVA 1VBE2 2XPJA 1RUI3 4WM8B 3VBRA 5ACA3 1VBD1 2BPA2 1HXS1 4QPIC 2XBO3 1VBA1 3JBG3 3DPRC 1A6CA 1QJU2 1ZBA3 2ZAHA 3VBSB 2R043 1RUG2 1V9U1 1QJX3 4Q4Y1 1AR71 1PO23 1BBT2 3NAPC 1RUF1 4QPGA 4RHV3 5ABJC 2HWB1 4CDUB 2RS31 3VBFC 5JZGC 1RMU3 2GSYA 1BEV3 1NCQB 1K5MC 1OOPC 4QPIB 1AR83 2HWD3 3J8F3 3VBUA 2WS91 1TME2 3DPRB 1NG0A 4RS5C 3ZFFB 3JD72 5C4WA 4Q4X2 2WZR1 3VBOA 1EAH1 1FPN2 2RM21 2RMU1 5ABJB 1FMD2 3VBFB 3S6PA 1R1A3 5JZGB 1C8M1 1NY71 1K5MB 1PO12 4CEWC 3ZFEC 3VDDA 2R062 4RS5B 1WCDJ 1VBD3 1HXS3 3TN92 4JGYC 1HRI2 4AEDA 5A32A 1VBA3 3ZFGB 1AR61 1QJY1 2RS11 2PLV2 5A33A 1TME1 4Q4Y3 4CEYB 4Q4V2 4CEWB 3ZFEB 1AL21 5BNOA 1RUF3 4RQPA 1MEC2 4Q4X1 2HWB3 1H8TA 2RS33 1ASJ1 1GFF2 4N53C 2HWE1 1VBB2 2RS52 1CJDA 1RUI1 4WM8A 2MEV2 2WS93 4RFT0 4RR3B 1PGL1 4GB31 1NCRC 2Y26A 1FOD2 1EAH3 1QQP2 2X5IC 1RVF1 5CFDC 3VBSA 2R041 4N53B 1W39A 1PO21 1C8M3 1AYM2 1QJU3 1VB4A 2VQ0A 4CDUA 1B35C 1EV11 1PVC2 1NCQA 5L7OC 4QPIA 2X5IB 3DPRA 3ZFFA 1R092 1AR63 1QJY3 1Z7S2 3VBHC 5CFCC 4WM7C 5J96B 1TME3 1AYN1 1M06G 2WWSA 4CDWB 5ABJA 1AL23 2RR12 3VBFA 4Q4X3 4PDWB 1RUJ1 1FOD1 1FPN3 1ASJ3 3JB4C 2HWE3 1PGW2 1ND2B 1BMV1 1FMD3 1MQTC 1AR92 1NA1B 4RS5A 4Q4W1 1VBC1 1VRH2 1PO13 2R072 4WM7B 4GB33 1RUE2 5DDJ1 3ZFGA 4CDQC 2BBVA 1RVF3 2WFF1 4CDXC 1RUH1 4CEYA 4N43C 1C8NA 4CEWA 4Y5Z0 3ZFEA 4IV1C 1MQTB 4YVWC 1PIV2 5D8AC 1EV13 5BNNC 5K0UC 2RR11 4RR3A
chains in the Genus database with same CATH superfamily
1VBE1 1PGW1 4DEVA 3NV2A 4M3CB 3LPGA 4J1XA 4WBBA 1CAWB 3AP9A 4OI1A 1QOTA 5E88A 4N43B 1RHI2 2P4EA 2CDOA 3VHOA 5LK5A 4RGGA 4HLTA 3ZYPA 5E1RA 5FP8A 4YM2A 4LUMA 3SHRA 3OY8B 5T55A 5FZGA 4CP1A 4NE9A 1S4CA 4GJZA 5BNNB 4NPRA 4DIQA 4ZS3A 4XUPA 3G7DA 1OOPB 2FCUA 3T30A 2G9GA 3POJA 1QHDA 1FYUA 1RUG1 4Z2WA 5HBAA 4IEPA 4LEJA 4BK5A 4QAWA 4J1WA 4LMFA 1BBT1 1VAMA 1LJ7A 4LLFA 1JZ6A 3KVAA 4CCDA 4DY5A 2X5IA 4FPCA 4W8JA 2QE3A 3KF5A 5K8SA 2Y34A 4DUVA 2VOWA 3BVCA 3ST7A 1W9TA 5IVYA 1EUUA 2QCSB 5GLVA 3VD5A 3ZSKA 1DIWA 4BYYA 4ISRA 1OVPA 1UOJA 1V6NA 3F95A 2W92A 4J6GA 4PDWA 1D7PM 1FPN1 1D4M2 2B39A 2IFWA 3BTXA 3AP5A 2W1UA 1ZBA2 2YC4A 3OSDA 4Q26A 4JGYB 2ZKNA 3N36A 4QHOA 1UZZA 5IAXA 4NIIA 2EXJA 1F8VA 3R0RA 4LBQA 3WNOA 4B1LA 5H9QA 1PO11 5J98B 4WM7A 3WQBA 2GMMA 2ZEYA 1REDA 1X9PA 2A6ZA 2ZHKA 3K4AA 1AR93 1SDWA 3KF3A 4Y20A 1BEV2 4JVAA 2BUKA 2WL1A 4RGKA 3MIDA 2JD4A 4YGBA 3AP7A 3OF1A 3PIGA 3B5LB 1W6QB 1F5FA 4XF1A 5A80A 4GAZA 1DQ5A 4QDQA 3WDUA 1W8ZA 1DZQA 2J42A 1YQ2A 1MQTA 4IV3C 1BVVA 4NR1A 4DFSA 4EN6B 5CBLA 1O5UA 4QX1A 2H6CA 3MF6A 2C24A 5FXXA 3QLQA 4NIHA 1WA4A 5FYVA 3SKVA 1Q8SA 3OBTA 2YBPA 5KXCA 1OF3A 5CKQA 1XRUA 3AMHA 2D98A 4GH4B 4W4ZA 5EZWA 5JCTA 1TMF1 1WW5A 4M3CA 1CAWA 4AF9A 1W9WA 1MZ5A 4M01A 3WNLA 2BZDA 3H3ZA 1NXD1 2KR2A 5FLIA 3JD73 2IXCA 3ITQA 1LECA 1EPZA 4LK7A 1B35B 2XVLA 3S7IA 2Q1FA 3OY8A 2JIGA 3IM0A 1H8TC 1DGWX 1XNCA 2VZVA 2ZGLA 3MW4A 2CSGA 4I3PA 4IUGA 4Z2AA 4E8CA 4XDQA 5BNNA 1OOPA 3MW3A 5LBEA 5IVBA 5IT6A 2V72A 3MPPG 4B3NA 1OPOA 1V9U2 1OD3A 2DWRA 2XJPA 1GWKA 1DP0A 3IDAA 3B94A 1RUF2 2RDNA 5FBJA 1OH4A 5CKMA 2Y6GA 2E7AA 1PVC1 1V6JA 1WMXA 2KXLA 1J3QA 3AYDA 1RGSA 4GMP1 4OI2A 3UKVA 3HNYM 4IEYA 3M2MA 5KHJA 2XL7A 4Q0SA 1R083 3MZHA 3KV9A 5LK7B 3IN9A 4CU8A 4E4ZA 4JQRA 5C8CC 3O1MA 2HWC3 3C7HA 5F2WA 4UBGA 4C0HA 3ZPOA 2DBIA 3ON7A 4CDUC 4KBZA 1EAH2 4AG4A 2VMDA 2VULA 2PAEA 5L9VA 2NZ9A 4Q4V3 3FMGA 5FKCA 1WW6A 4JGYA 1SACA 2YU2A 4UI9L 1VLNA 1MEC3 3HPNA 3HQXA 2PHDA 4Y22B 1W9YA 4N8MA 2HH9A 1XXNA 2EVXA 2WIIB 4YZ3A 4UW3A 5KC6A 1Q43A 2Y6HA 1SZBA 4W6WA 5AVPA 2G4IA 2WZ8A 1UZYA 2VE1A 2VO5A 5BNPC 1F31A 4MXWB 5BYNA 3SITA 4A44A 3FBMA 5H9PA 2IFRA 1CAUB 4XCAA 1YQ5A 4GMP0 5I0RA 3HOBA 4JZRA 5FWEA 1W6QA 2UWBA 5FYBA 2K46A 1S0EA 3U75A 5AC93 1QJY2 2WFPA 2RS12 3WG4A 5IVCA 4FT8A 5L9RA 5K0UB 3O1PA 1DBNA 5A1AA 1AX2A 5FYMA 5DMYA 4G3YC 3WR0A 4XZUG 5C3QA 4W6XA 3KCYA 3POGA 2C26A 4K8RB 5FMOL 4E2GA 1AL22 5A7QA 1NOVA 2P17A 1ASJ2 4GH4A 4QU2A 3WSOA 1HB2A 3ZFGC 4P9LA 4PIZA 1RB8G 1VB2A 2B4KA 4YFWA 3WNXA 1DQ1A 4B4RA 4Z92B 1UY2A 2C9AA 4F3JA 1IKQA 5FP7A 4HK9A 1H4GA 1SFYA 4OMCA 3WP4A 1UMHA 1UKRA 5KXEA 3ZXAC 1B35A 4XACA 2K9ZA 4QPGC 3ZXGA 1HQWA 4AFBA 4MO3M 2XQXA 4ES9A 1QF3A 1RVF2 4MLOA 4GA9A 4S2GA 2DCKA 2QJVA 2H6BA 2I07B 3AXEA 5BPXA 1SFNA 1PO22 4XFFA 2Q30A 5GJ6A 5E16A 3P1IA 2WN2A 5T5JA 5C4WC 5K9YA 3D0JA 1JI6A 3S5QA 1AR73 2OQ6A 3AM2A 1QNYA 1E5RA 4F7ZA 4ARYA 1I5PA 1YQCA 3NRUA 5DPNA 4URAA 2ZCWA 1OSGA 3AYAA 1N1VA 3QCWA 1DGRA 4UFKA 1PMJX 1JZ5A 1ULFA 4Y24A 4MSVA 5DAVA 4AVAA 1VE0A 5T50A 1HB1A 4QGLA 4G9SB 1UXXX 4CU9A 3M8LA 2R49A 2VTXJ 1NUKA 2OT7A 1RUD3 3I7DA 4ZU4A 2XBO1 1RUJ2 3RZJA 1IZ3A 1D4M1 4Y22A 1QJZA 2DV9A 2OW4A 2A3WA 1ZBA1 2XXZA 2DVDA 2E7QA 1W2AX 3ALQA 4YZ5A 1DLLA 1FX5A 4Q0PA 1JZ3A 1W03A 1YYNA 3FL7A 4MXWA 1POV3 5IYYA 4HN0A 3PURA 1HN0A 3W9AA 4CCEA 1Y9QA 5JR7B 1CAUA 1OLQA 2KM2A 4CDWC 3CJIC 1LTEA 4HOOA 1COV3 3GHMA 3K4DA 2JG9C 4FOYA 1BEV1 3CNAA 1ND2C 2B45X 2VH9A 5K0UA 4ES8A 4Y1YA 3OUJA 5E6HA 1E5HA 1URXA 1NA1C 2WO7A 5F3EA 5KXDA 3POYA 4BQ3A 4ZU7A 5FOJB 5JIUA 3VGIA 1DYOA 2OPKA 1LHWA 4GWNA 3ZN5A 3KQRA 2YBKA 3QH7A 4FPFA 5A6YA 2Y60A 1W6NB 3IDCB 5FYIA 3BUCA 2TEPA 1GOHA 3OGJA 1H2LA 1R1A1 3AMMA 1W3XA 4V2VA 4AHWA 4EWEA 4JRAA 5FXVA 4AQ2A 2VUDA 2I2SA 4BIOA 4PIXA 1W9FA 1Q8PA 3POSA 4FPOB 1RUNA 4EN9B 1H4HA 5FY0A 1UOGA 5FPZA 3GYDA 3ZSJA 1BZWA 4H55A 4QMAA 4ORFA 5G04L 4BQWA 1JXNA 1QOOA 4D7SA 1UZVA 2PHLA 5FK8A 2FQPA 3WG2A 5A7WB 1W28A 2D6KA 1UOBA 5CKNA 4UFHA 3JBG3 4IW3A 5LCWL 1F15A 2EIEA 1XJAA 4XFHA 5LY2A 2ZAHA 4IE7A 2VM9A 3LKJA 4CCLA 5IFPA 3PMSA 5FZMA 5GZDA 1N3QA 3Q8EA 1V9U1 5FV3A 1QJX3 4AVSA 2D5HA 4UT5A 1Q5OA 1JYXA 4PI0A 4TLGA 3NAPC 1RUF1 2VUJA 4WVVA 2ARAA 4CDUB 1DCSA 4V1PA 2XKPA 2Y0OA 4HSJA 4PF1A 3INAA 1C1LA 3IPVB 2Z69A 3F2ZA 3JQWA 1O4TA 1QH7A 3HMYA 4K6BA 1AR83 3LZZA 4LKFA 4PQ9A 4QPIB 2F4LA 4XILA 4XUOA 1LHNA 2DVBA 5EYYA 4QU1A 1FAYA 2XHNA 2VBBA 2WQ8A 2Y38A 5FZ3A 3MIEA 4AZZA 1JUIA 2VW0A 3Q8CA 4IEQA 1EAH1 1QEXA 1CIWA 2XJRA 3LPFA 4IEXA 2WQZC 5F5IA 2V5DA 5ABJB 1LOFC 4XFIA 1O4YA 2VCCA 2Y8KA 3FE5A 3W21A 2JDYA 2GDFA 5JMOA 1J3RA 1Q8VA 1UL9A 1H1IA 3FN9A 1JU4A 1K5MB 2EAKA 3DYPA 5FXWA 3ZFEC 1GR3A 4XIOA 1EPWA 4A42A 1JYNA 3NV1A 3AKRA 4JTOA 2ZGPA 5FXZA 3WY6A 2G9ZA 2WNOA 1PNGA 3TN92 3WCRA 2ZX4A 4OI0A 2ARXA 4CUCA 2BGCA 5F3IA 4O65A 3ZFGB 2R0FA 3VDCA 5DABA 2JKXA 4FFGA 2QZ2A 1QJY1 2WZPP 2RS11 5A70A 1ALYA 1W3VA 4NHKA 4YW6A 1L7RA 1LOEA 4Q4Y3 1GOGA 2GMEA 4IESA 4M0HA 3M4FA 5A6ZA 4EV0A 1LODA 1DHKB 5J3UA 1AL21 3LA3A 4CXYA 1FV2A 2BW8A 1H8TA 1T2XA 2ZABA 1ASJ1 4BB3A 1ENSA 2BVBA 2ZHLA 1VIWB 5LRSA 4YM3A 2D43A 5A7SA 1C57A 1XNDA 3IBMA 3L2YA 4OUSA 4FOWA 1HQLA 1NE4A 1OH3A 3RZLA 1DFQA 2WS93 1TG7A 4MHUA 1V00A 4QB2A 4N9HA 3EO6A 4WVWA 1LEMA 1O7FA 5F3GA 3ZYIB 3NJXA 5H9RA 4BLIA 3GNEA 3A23A 3MLLA 2VQAA 2O14A 3EB7A 2JDHA 2X5IC 4HFSA 2A71A 1YCIA 1RVF1 5BXXA 3VD4A 3BCWA 1YHFA 4TXWA 3BIWE 1W2UA 3LEKA 1UQXA 4Q8KA 2DUQA 2XJSA 4DQAA 1W6OA 2DUOA 1PO21 2AACA 1H30A 4AI9A 3S0MA 2VOVA 1SLBA 4K1YA 1QXJA 1VB4A 4YYOA 4CA9A 1DLCA 2VQ0A 4P9XA 1ODMA 2FBEA 3IB3A 3BB6A 1OI6A 3ZIWA 1UU4A 5EV7A 4CDUA 4F8AA 3GDBA 4QDSA 3N35A 5ERLA 2ZOEB 3IPVA 4OHXA 1YO8A 5L7OC 4QPIA 2DURA 2JG8C 2RV9A 3B02A 4HT1T 5DZEA 4L0PA 1R092 1ZX5A 3ZX7A 1S0DA 1Z7S2 3WG1A 5JPNB 5A3WA 5FZ8A 3LWCA 4WM7C 4D6SA 5C70A 1UD1A 2HKXA 2WYSA 2VVFA 5FBZA 1GNYA 2R32A 2DFCA 4P9YA 4CDWB 5ABJA 4Q4X3 5FZKA 1RUJ1 3PMEA 1FPN3 3M3QA 4UFIA 2HWE3 1PGW2 5FUPA 1ND2B 4Z1VA 1DU3D 4I0BA 2P3YA 1VMHA 1UN1A 4A3ZA 1MQTC 1BK1A 2PELA 4W6YA 2EXIA 1NA1B 1UMIA 1L7QA 2E51A 4ZHNA 1KS5A 2UYBA 4H2AA 3DXTA 4Q29A 4NVPA 3RWKX 4YNIA 1IQAA 1ULEA 1PO13 2R072 5FMBA 1RUE2 3WNPA 5EYXA 1BK0A 3ZFGA 4LT5A 5C7GA 1RUOA 5F5QA 5JOWA 3ZN6B 3O1VA 4CE8A 1VAVA 2F17A 3VKNA 1ZZCA 4LO5B 2O1QA 3PNAA 4LQRA 1GBGA 1WLTA 1QMJA 2QQNA 3H1MA 4LIVA 4JDNA 2D3RA 4N43C 1GZCA 1RXFA 4OUEA 4IV1C 2RE9A 3RYRA 1DZRA 3NNLA 1H0BA 5BNNC 3GBFA 1V70A 3I49A 2HBUA 2UY9A 1X7NA 3H8UA 3M7AA 5C33A 1YFXA 4FPLA 1UCXA 4NUBA 1W8OA 3CZUA 2XONA 1O4ZA 3AX4A 4AGRA 4YZ2A 4HONA 4Y3OA 4TZDA 3KCCA 2QTWB 2P2KA 3I54A 3BIEA 1TNFA 1ZRRA 1SPPB 2YC2A 1BCXA 3AZVA 3NAPB 4DEQA 4YVWB 2ZXQA 1XSRA 4FSJA 5LA9A 1LHVA 1O59A 3RYPA 3NL1A 1FOD3 1XYOA 4XMAA 4CSWA 4EZ4A 3QH6A 2NYYA 3C3VA 4MOAA 4I3GA 5AFBA 4BQYA 3NKGA 2QQOA 3KMHA 3A22A 1GOFA 1H1MA 4PCRA 1Y7BA 1RUC2 1GLHA 2P5BA 1NE6A 2D5FA 5DDJ3 1KXGA 3ATGA 1DQ2A 2BV4A 2ZGKA 1OF4A 3WD5A 1K5JA 2AEZA 1Q56A 2NN8A 4NOTA 4NIDA 1W99A 2QQIA 2WFF3 4QT6A 3RI9A 3K3OA 2OXBA 4XJUA 4XHBA 3N9PA 1HKDA 4Y4RA 3V56A 4CU7A 4Q1PA 1O5LA 2VCMA 4CDWA 1A8MA 3CJIA 3I2IA 1G6NA 3MIHA 1YI7A 4OQ8A 2CGPA 1ND2A 3IDEA 1TMF2 4LUKA 1I6XA 2IXLA 4YW3A 2XHKA 4EN7B 4J25A 4B4PA 2RR13 1OA3A 5FYZA 3ZYHA 1ZBE1 1NA1A 3DYMA 3O0VA 1AHSA 3KT4A 3RG0A 3UL2A 4FAHA 5GZCA 2DCZA 1VAKA 1GV9A 1SBDA 1N1SA 1RXGA 1ULCA 3SH5A 1RITA 3VBOC 1RMU2 3I8TA 4GH4C 2VU9A 3A4UA 4YG3A 1CWPA 3B93A 1EP0A 1W6PB 4NAOA 5FUNA 3ZN6A 4DINB 3VKOA 2HLEA 2RDSA 3TN91 3J8F2 3URFA 2EA7A 3I3MA 2GN3A 4WVZA 1X36A 1AX0A 4RA0A 2DVFA 5G05L 3NNJA 3E5XA 4ZU5A 5J36A 3KV5A 1ZZ8A 3T2TA 3K48A 4DS0A 5FZEA 1OMIA 1QH6A 3VL9A 1HX6A 4Y26A 4WVMB 2TNFA 4HKOA 2VZ1A 2YPJA 1UYYA 3ME2A 2XJUA 4PF5A 5I91A 3WUCA 5DUUA 2JDAA 2UWCA 3SCGA 5GLUA 3WVJA 1SPPA 2ZEXA 1G9FA 1GZ9A 1Z0HA 3FFZA 3NAPA 1VBD2 2BOIA 1C5HA 1HXS2 3M70A 4KGQA 4O9GA 4QDRA 3FHIB 2OIIA 1CD3G 4BU2A 1E5IA 5E8AA 2BGOA 1VBA2 2FMYA 4ZXKA 3DV8A 1RHI3 3RQ0A 5LATA 3VB9A 4FPJA 4PT6A 5L7OB 3PL0A 1DG6A 1XC6A 1GYKA 1LCLA 1IG3A 1OUSA 2JG8B 2VZOA 3DEMA 3DXUA 1YNAA 3N7MA 2W46A 3WW1A 5DG2A 4QPWA 4QHBA 2W68A 2N7GA 4JCKA 3ZR6A 4YVSB 4AQ6A 1LRHA 2JKBA 3J7LA 1H9PA 3BYWA 2R063 4Y5TA 2DF7A 5F9TA 4ASLA 1OC1A 4AL9A 1LOCA 1LOFA 3S30A 4BPZA 2UWAA 3B3QE 3PU8A 1HRI3 1U5XA 5FZOB 3VDBA 2JEMA 3OUIA 1R091 2G9FA 2ID4A 2FDJA 1Z7S1 3I2DA 4LTAA 1Y43B 2J1TA 2PLV3 5FY7A 4QQ2A 2RM22 4QPYA 5FZ4A 2HYXA 2JE8A 5GKAC 2YBSA 5FPXA 5KXBA 1Y4WA 2VW2A 1REEA 2RMU2 5DXDA 4RFRB 1Y9MA 4QQOA 1GZWB 5FZLA 3NNGA 4Q1RA 2ZHMA 1D4M3 4IE0A 4XJ9A 1C8M2 4OYUA 1VBB3 1GKBA 2CHHA 2WDBA 3OEAA 4Q0QA 4RYDA 2RS53 3ZFFC 3ZR5A 2J1SA 1MS9A 3LQCA 5EWSA 1IKPA 4K3UA 2A5ZA 3KD4A 2QQPA 3K2OA 4XUQA 4FXGB 4XJAA 1W6PA 2P3IA 4O61A 1POQA 3WDTA 4IV1B 4BE3A 1A34A 2R071 3HBKA 5FP3A 3BOPA 3BI3A 1RUE1 2IC1A 3EBRA 4MH0E 4BWOA 3DECA 5JPMB 4CP0A 1AR62 3H3UA 3MBWA 1UO9A 4C8DA 2HEWF 3H8RA 1T6BX 1ENQA 2WLQA 5K4LA 2VPVA 3KZ4C 3THCA 3RRDA 1IS6A 3WT3A 3J26N 3MDPA 3VL8A 2Z2SB 3KGZA 3ZYJB 1AYM3 5LEJA 3DL3A 4XAAA 3K4ZA 3LEMA 2R1DA 1F2NA 2VD7A 2NLRA 2ENRA 2IUWA 4WVMA 5A3PA 1UU6A 3CJXA 4GZ9A 1RUI2 5FYTA 1ENXA 1XNKA 5LW9A 1UY0A 5KC5A 2ZEWA 3CKHA 4QM8A 4EZHA 4JV4A 1U12A 3MIFA 3O0XA 2ADDA 2W1SA 1PGL2 2DVAA 5FQ0B 3JQXA 1YQ8A 3LDBA 3JB8A 4QQLA 2DCTA 1WLCA 4GB32 3HEIA 4P5YA 3JU9A 3V65A 1W0OA 3L9JT 2XBO2 4LA2A 4P00B 5CISA 4MG2A 1D2SA 4AVCA 2C4XA 3PTYA 2JDKA 5L7OA 2GMPA 2R30A 3NSTA 3TYJA 3OGGA 2ZHNA 1G9BA 4F83A 5F3CA 1PGSA 3LA2A 1SLTA 4YM0A 2JG8A 5DAWA 5F5AA 3RYKA 4E9KA 5J48A 5L19A 2GC1A 4CPBD 4MGYE 4RR3C 2WC2A 4YVSA 1ONAA 2ZMKA 4ASMB 3N9NA 5EFUA 3ZXDA 1XYNA 1S2BA 1W2NA 3I3BA 1IPJA 1V9U3 3NWKA 5GLZA 4MADA 2Y64A 3WOGA 2W39A 4M4PA 1JH5A 3L2HA 1GQHA 1PMIA 1RUC1 3E5UA 5FZOA 3AP6A 3M1HA 4KWLA 2ARCA 4E2SA 2D97A 1LESA 2NP0A 5EJ3A 1MVEA 3LDKA 1TEIA 1VR3A 1QGLA 2WT2A 3ZO0B 3O1UA 2ZMLA 4DRRA 1XBFA 5FMCA 5JXIA 3K75B 4WZCA 5A3NA 1GZWA 1WW4A 1PIV3 2E53A 4UWDA 1R1A2 3VBOB 2O8QA 4OZXA 2Y6FA 3E6CC 5F6LB 2VVEA 1OQ1A 3BODA 5FLJA 4NPMA 1J3PA 3CMGA 4NHYA 3T3YA 4B8EA 1BMV2 4MGTA 2JDMA 1FT9A 1YI9A 4PJYA 2D44A 1OA4A 4N43A 2DU0A 1XE8A 4M3CE 2VCAA 4BQ1A 1REFA 4BXSV 3ELNA 4IV1A 3UNPA 2ZX1A 4RHV1 3JZVA 2W87A 3TBDA 2A6YA 5DAXA 3VZOA 3TOJA 1RMU1 2CAVA 3SC7X 1KDMA 1UKGA 2P6CA 4KL1A 4NROA 2OS2A 2HWD1 3EJKA 1KITA 2WA4A 2Y6JA 3J8F1 4GULA 5CYYA 2BEOA 1M4WA 4QQPA 5KBFA 3H0OA 1HRV3 5A32B 4PBPA 4PI2A 3NJVA 3ECQA 3AKPA 2E32A 2RS13 1XQNA 3KQ4B 1N3PA 4Z8BA 3RSJA 5A33B 1WZXA 1J59A 2IZWA 1YUDA 5LA0A 2FCTA 2W0XA 3WW4A 4A6OA 1NLRA 3UT0A 3JUUA 4LO4B 4RQPB 5IVJA 3Q8AA 2WKKA 5GZGA 2FZ1A 2E7TA 1QXRA 2A75A 2C9KA 5IK4A 1UWWA 1I5ZA 1SLAA 1XSQA 1CZTA 4AEKA 1EY2A 4OMDA 5HCFA 5FQ0A 3WP6A 1OFNA 4K40A 4XUTA 4IE5A 5A6XA 5AVAA 1UOFA 4NRQA 1MZFA 3VKFC 1T6GC 1UU5A 2GAUA 3CF6E 1CX4A 3IAPA 5CEHA 1S2EA 2QQWA 2EALA 3OPZA 5ACA3 1VBD1 3IIIA 1HXS1 2PHFA 4FPGA 4LBKA 5FPAA 4QPIC 2BPA2 3B9CA 3FHQA 4LBNA 1UAIA 3A0NA 4O7XA 4ZKTB 1VBA1 5HPOA 2R7EB 1JUHA 3CO2A 1QJU2 3BTAA 3SXWA 1WLWA 1SQ4A 4RN5A 3AB0A 4LBLA 3WW2A 5IVEA 4GALA 3D3AA 4NRMA 4DPNA 3VN4A 3WLUA 1RC6A 1KD7A 3AZWA 2P6HA 5LY1A 1PO23 1W06A 5FZAA 1PK6C 3WQ7A 1GNZA 2FDFA 4FPHA 5ABJC 2A7AA 3S7EA 1UX6A 3C2UA 5GZFA 2GSYA 4CCOA 2XJQA 1LKNA 3C8XA 3FLTA 5DG1A 3MF9A 3T08A 1K5MC 2VOKA 4HG6B 3J7HA 2Y0IA 1AJKA 5C8WA 3DPRB 1NG0A 4IE6A 2X09A 3MUZ1 3ZFFB 3JD72 4QX0A 3CIHA 3M3EA 1JYCA 2ADEA 3KV4A 1NKGA 4ZZ8A 3D4KA 4XE9A 4JC1A 3VBOA 3NW4A 1WGPA 2RM21 1MS8A 3T4VA 3THTA 3TB0A 3ZN4A 2Z4FA 1LGBA 2RMU1 2F4PA 3VBFB 5K7PA 1AZDA 3S6PA 5JZGB 3V64A 2D6PA 4E4HA 1WUVA 2GNDA 1VJ2A 3AZZA 1C8M1 3OGRA 4MGQA 5A6QA 4EYUA 2XVGA 1OKOA 4D3WA 1W9SA 3E1F1 2OX0A 2I45A 4GJYA 4B7KA 4CXXA 4RS5B 1ULOA 1K3IA 3J7NA 5FCCA 1HLCA 3IZOA 5F2SA 2XUEA 2RDRA 3U07A 1Q8OA 3GJAA 3PUAA 1XNBA 1JN2P 1W8HA 1V6MA 4A41A 4AEJA 3UGHA 3NQHA 3TEWA 5A3OA 5A32A 2W1QA 1H2KA 1Y3TA 3LEGA 1AR61 3WG3A 2R1BA 4UW6A 5FY1A 5A33A 1H2NA 5BY5A 2OZ6A 1TME1 4L97A 2JE9A 5DUWA 1OUXA 4E2QA 3MLJA 4Q4V2 2XDVA 3IMNA 4CEWB 5JXHA 4BK4A 3PDQA 4BQXA 4RQPA 3ZSEA 1MEC2 1NAEA 1SDDB 2HWB3 2RS33 3KT7A 3ZPYA 4BQ2A 1GFF2 3T2QA 2NQYA 3VZNA 3MFAA 4Y1XA 1VALA 2WN3A 2CL2A 2ET7A 2VQUA 1RUI1 2MEV2 1AX1A 3T4HB 3HIFA 4RR3B 3O5SA 3VHPA 4XQDA 2XLFA 3AYEA 1PGL1 4GB31 3DYOA 1NCRC 2A3XA 2W1WA 1CJPA 3SNMA 4AHZA 1C1FA 5L73A 1QQP2 1LNSA 3M3IA 4FO9A 2OKXA 3ILRA 3D0SA 5KHHA 3HT1A 3HBZA 4MZUA 4EN8B 5CVRA 1D2QA 3FX3A 4XMIA 4N53B 1W39A 3PVBB 3AYCA 4FFFA 5JVVA 1ZZ7A 1XNAA 4TSVA 3VD9A 2D3SA 3HT2A 3I4IA 1UIKA 5F6KA 4YPJA 2XVKA 1S2KA 2V4VA 3AP4A 3HN3A 3KLSA 3USSA 1QJEA 4OCTA 4X6QB 3UETA 4AQTA 5FO8B 1WCUA 4R4ZA 1SBEA 4IGQA 1W04A 5A7PA 1YFWA 3KWVA 3ES1A 4LBQD 3SH3A 3DPRA 2A6VA 3RI8A 4CRQA 3HVDA 1TVGA 3ZFFA 2VTXA 3ENRA 4MV2A 2QNKA 2ZMNA 4S2DA 3WF2A 5J96B 2F6BA 3Q8FA 1YIPA 2BBAA 4KH9A 2AGSA 2D3PA 1LU2A 1D0HA 2VUCA 4QX3A 1MS4A 3AL6A 1DZTA 2VECA 2WWSA 4XTMA 4DRVA 3AKSA 4BQ5A 3LSDA 2ZBJA 4GXLA 3VBFA 1JYVA 3JXSA 4Q5OA 4QX7A 2YMZA 1FI2A 1DQ0A 2V73A 5T3NA 4YGCA 1WD4A 1BMV1 3I2KA 3LA7A 4IGPA 3E97A 3I2OA 2WZEA 3Q9OA 1GP6A 4LULA 4GD4A 4RS5A 2WAOA 4I2OA 4HVOA 1VRH2 4YZ4A 3HQRA 2W9XA 2AZ5A 5F8PA 1G7YA 1NXMA 1HB4A 4XDOA 3AMQA 1H9WA 4GWMA 1QOSA 2XL9A 3N7LA 4UBHA 1AF9A 3MFCA 3SCHA 3WHUA 2VY0A 5I0DA 2WAAA 4XF0A 1C8NA 1SFPA 1C28A 4CEWA 4COUA 4LITA 3HNBM 4YVWC 2YZ4A 4X8NA 3ETPA 4LO6B 1L3JA 3HR9A 4LHKA 1EV13 2QQMA 4P9GA 2EXHA 4DUWA 3BU0A 2ZACA 3MICA 1H8VA 2XKOA 4HL0A 3VD3A 4DMIA 2VZRA 2CGOA 2VXRA 1VMFA 4RR3A 2GP5A 5FZHA 2G19A 4LO7A 4EE2A 1GZTA 4XAEA 1UIJA 1Q3EA 3J7MA 2DDUA 1RJ8A 4AE2A 1COV2 4AR2A 4CDXB 1XOYA 1RINA 1TZOA 1O3RA 4M4RA 1QKQA 1PK6B 1AYN3 4XF4A 5T54A 4A4AA 4IE4A 3AL5A 1ZBE2 2PHWA 4N53A 2Q8CA 5HXMA 1EUTA 5C6CA 3HWJA 1QJU1 1ZA7A 2OUJA 2BFUS 4NPLA 4XQWA 4HKWA 3U78A 3VZJA 1GQPA 3E6DA 3LF7A 1NT0A 1XE0A 2CTVA 2PAMA 2PQQA 4AHYA 2MNGA 4FBFA 4IEUA 4Q4W3 4JGZB 3VBRC 5JLVA 3GF6A 4XJZA 5I8SA 2PMWB 1FATA 1VBC3 1W8NA 2VMFA 4EJRA 1YWKA 3PHMA 5C5UA 3VKLA 5A3UA 4QX2A 3GGLA 2YC0A 4PLNA 5C9AB 1AVBA 1S0CA 5FZFA 4W65A 1RUH3 3MI8A 4XHXA 3OD0A 2B9UA 2GU9A 3JD71 4FTSA 1W6NA 1I9RA 2GC0A 3RWNA 4D0QA 3LDRA 3T1MA 5KHGA 1F4AA 3JBG2 4XIKA 1MS1A 5A7NA 5IWFA 1OXCA 5CA6A 3FHAA 1QJX2 2CU5A 1R1ZA 1MVQA 4JHZA 2D6LX 1IPKA 4YVWA 3ZXKA 1W2OA 3C7EA 1VBE3 3PVEA 2LS6A 2VZUA 5FFOC 3DUIA 2Q5TA 1J84A 2VZQA 1ZZBA 3KS7A 2C1FA 4XF9A 5A7WA 2MPFA 3PLQA 4INDA 4RGAA 4DXZA 4IL7A 4ISQA 4AEMA 4HKLA 1BKZA 4JX0A 4Y5SA 5CNAA 5IJRA 1YXWA 1LHOA 2IWGB 1AR82 2HEVF 5EJZB 1H6YA 3UGFA 2HWF2 1E57A 2Y6KA 1H2MA 3OTFA 4YARA 1W8UA 1GUIA 3ACHA 4Y1UA 5FIXA 4DB5A 3CBNA 5I8TA 1C3HA 1CAVB 2HWC1 1XU2A 4K1ZA 4YW5A 4HK8A 2JB4A 3U1XA 1PX3A 2VZPA 2YFUA 4JQTA 5FYHA 5FZIA 3ETQA 3M3CA 1RUG3 3GCWA 4KNCA 1SMVA 1C4RA 1RYYA 3QOPA 4Q4V1 3T2PA 3A0KA 2Q8EA 5I8YA 1BBT3 1NCRB 1MEC1 5EHDA 1S0BA 1FXZA 3UJQA 3DCQA 1HV0A 4HN1A 4LOTA 1IOAA 2BTVC 1GICA 1KFUL 4YVSC 1W0PA 2XWJB 2MEV1 2WJSA 4CDXA 4CCNA 5JUVA 4KQ7A 1JW6A 3T1LA 5HI0A 2RDQA 3NVCA 4RL7A 1PK6A 2VNVA 1UX7A 1DGRN 3ZSLA 2X8KA 5BNOC 1N3OA 1WLDA 1X8EA 1QQP1 1WMDA 3VV1A 2XH6A 4D69A 5AC91 3X29B 1K5MA 3NNFA 2LW8A 3AC0A 3AKTA 3GALA 3ZYBA 1MACA 4Q4Y2 2GN7A 2ORXA 2VW1A 1YC61 5DQ0A 1UF2C 4JGZA 3O7OA 1JZ4A 2BYVE 4B1MA 1ND3B 2QZ3A 1ZA4A 2YFZA 1W0NA 2O8OA 4Q8LA 2JWPA 5FO7B 5C3SA 1JOBA 2AYHA 2YDEA 3G6JB 3GXUA 4L2NA 5CIRA 5GM0A 5C9AA 4UFMA 3WNNA 3IT8A 5LBBA 1RUC3 4BXFA 5HCHA 2W91A 1XYPA 4HMZA 4NWVA 4LNVA 5FY5A 5JOYA 1ZRCA 1IPSA 3FBYA 4YW7A 1DF0A 3APBA 4OLLA 4UFJA 2LM3A 3TAYA 1GSLA 5SV5A 4AFCA 3PUSA 4IERA 2WZR2 4FTEA 3W20A 2A70A 4QHZA 4XC9A 2ZEZA 1FNZA 3MV01 2W2IA 4NHLA 4AI3A 4QX5A 3VZLA 1I3HA 3PUQA 3QBQA 3I3QA 1JODA 1GWMA 4KU8A 2W08A 4OZOA 2Q8DA 3IKWA 4MXVA 1TMF3 4BJ0A 5F37A 5FPUA 1QJFA 3CEWA 4SLIA 3H7JA 2GH2A 2L9LA 1OLRA 1NZIA 4ZONA 4PLMA 1JYWA 1VRH1 1LOBA 2VGDA 3D6EA 2J1RA 2CGNA 3WINE 4M00A 1PZ9A 1AL0G 2VOTA 4FFHA 2RJKA 5FYYA 3AMNA 1CAVA 5F1RA 3T2OA 2OVUA 2AH2A 1AXKA 2GNMA 3K51A 3WDVA 4XURA 1WD3A 1WW7A 1ULDA 3B00A 3NO8A 3BU7A 4OI4A 5FREA 4KI5M 5JWPA 4N7UA 3ZIXA 1QWRA 2ARBA 3R4DB 3VZMA 2BJSA 2D93A 2Q1MA 4CPBA 1NCRA 4FI9A 4QQHA 3WHTA 1RUD1 2VVDA 3GZAA 5T5LA 4XFBA 4M3CF 5FUIA 2HWE2 4A7YA 4GMP3 1JHJA 1PVC3 1UMZA 2GZWA 2X05A 2QBXA 1ZYBA 1ULPA 2BRTA 2JD9A 3EXUA 4FQZA 3BPSA 4IEOA 4UAPA 5IHRA 4Z82A 2OYZA 2AEYA 5F39A 4D8MA 1POV1 2W94A 1HDKA 5JOZA 3I3DA 2B42B 2QQJA 4JKLA 1MS5A 2GH8A 4YGDA 4CEYC 4CYDA 4COWA 4XVHA 1A3KA 5EIYB 1SLIA 5I0UA 5A7OA 5B2GB 1COV1 3C7GA 3ZMNA 1O3QA 5DUVA 3AFGA 3VBRB 3AZYA 4QGNA 2D40A 2J22A 5JIAA 2BVVA 4DUXA 2DU1A 4S2FA 3EYPA 3VD7A 3RZMA 2DFBA 2R042 2WO2A 4K21A 4AFDA 3VUOA 1KRIA 4ONUA 4QKNA 4LHLA 1KEXA 5GLTA 1OURA 4OHZA 4TTGA 4LE4A 4NIAA 2GP3A 1ND3A 2Q8OA 4RHV2 3ZYRA 2EIBA 2ZKLA 4KMQA 4R4XA 1N47A 4GWJA 5FDBA 2DYCA 2JXAA 2QQVA 3POIA 5FY9A 4QB6A 1NX9A 2HWD2 1MR5A 4XUNA 4KG8A 1ZREA 1JTZX 4NWWA 4S2HA 3KGLA 4KWJA 5EJ1B 1BJQA 1NLSA 1LU1A 2WNVB 3UJOA 5BUVA 4OHVA 1IHMA 2C0ZA 2VJXA 1POV0 2WWJA 3VBUB 3AFKA 1HQNA 5H9SA 4A6SA 4QKBA 1YFYA 3P6BA 1F9KA 2SLIA 1O3TA 1H6XA 4N7IA 3JBG1 1ULGA 2RM23 2ZZQA 4LBJA 3SKJE 4A45A 3MO4A 5EPAA 2RMU3 4R8HA 2NMOA 1QJX1 2A3YA 4Q0VA 1QDOA 1ZNPA 1MS0A 4H14A 4OHWA 4X8PA 3MIBA 4Y1ZA 1VRBA 4BH9A 2NPIA 2YUEA 3P3PA 4AAXA 4P9IA 3VDDB 4RQPC 3QD6A 1WA6X 4KBBA 4UF0B 1RL3A 4YRDA 5DDJ2 3CL1A 2A6WA 5LA2A 4BQ4A 4U36A 5FZ0A 1OHFA 5FZBA 1AR81 2WFF2 3RZZA 3TEYA 4DO0A 3AMPA 1EYBA 2HWF1 1UPIA 3ZSMA 1NQJA 4AEDB 4CP2A 2I74A 3T0BA 2A6XA 2WINB 4NAMA 3UK9A 1GU3A 3ZVXA 4IEVA 4DXSA 5FP9A 3EMRA 5JXJA 5A3MA 1ST8A 5BNOB 3LGRA 3K46A 3O1RA 1DDLA 1PZ7A 1QY4A 1S55A 4SBVA 2V09A 3GBGA 5CU1A 2VTFA 3ZDSA 4HVQA 4IEWA 3I59B 4JAAA 1X50A 3M3OA 3PIJA 5AFEA 3KVBA 3LOIA 4XW3A 2XPJA 1RUI3 4FFIA 4LOSA 1VP6A 2Z5WA 3A21A 4M0NA 2ZX0A 3VBRA 4H7LA 3VDAA 4COZA 2TUNA 4FAGA 1SCSA 2J1UA 1UW8A 3ACGA 2UU8A 1WBFA 2B46X 3HD8B 3MGUA 1ZRDA 2XBO3 3DPRC 1W05A 4K20A 2BOJA 1A6CA 2OZJA 1GP5A 2FMDA 1ZBA3 3U11A 4XF3A 4YG6A 2ES3A 3POEA 1HV1A 4Q4Y1 1SCRA 3ZXEA 1VPHA 4KU7A 1R64A 3DGTA 3S57A 1K45A 4D7TA 1UYZA 2ZX3A 2EICA 3PTRB 3VBFC 2B7YA 5JZGC 4C1WA 2WNVA 5HV0A 3U14A 1BEV3 4EROA 4DXRA 3FFQA 2OUHA 3I2JA 4IQPA 3H1WA 3VBUA 2E33A 2WS91 1TME2 2LALA 4RS5C 1SLLA 1WKYA 2E6VA 3CHXA 1JYTA 1F35A 1PVXA 2XR4A 5DZFA 1KFXL 2WZR1 2QKDA 5DAPA 4AOCA 2RHPA 2FDIA 4I09A 3ZYGA 2SBAA 3KV6A 4P9WA 5IAVA 1FMD2 5CAZA 1U5ZA 4I0AA 2JDZA 1R1A3 4H3WA 4A7ZA 5FY8A 5D1IA 5HXVA 3O1TA 4PIYA 2ZGTA 4YZ1A 1OKQA 1V6OA 2ZPXA 3FLPA 4H7MA 3C7OA 3VDDA 4CEWC 2YB7A 3WUDA 2R062 5JOXA 2B8MA 3BOWA 4UF0A 2FDKA 4AWDA 2WWUA 4BMBA 1DGWA 3ORJA 4MGIE 1S0JA 2VQTA 5C5TA 1NZCA 1HRI2 2ET1A 4AEDA 4Z07A 1OA2A 1UY3A 4P02B 4FPEA 2WO1A 5JI9A 1V0AA 2PLV2 4AYUA 4BDVB 2VMHA 1ZZ6A 3AKQA 4IETA 5FYCA 2R0HA 4CEYB 4JDMA 3U4SA 4NO4A 2X29A 3N7KA 5BNOA 5ANQA 1RUF3 3WEZA 4Q4X1 2XOMA 5L36A 3UYJA 5T52A 1CONA 4V2WA 3W5MA 1JZ8A 4N53C 1TNRA 2HWE1 1VBB2 2P1BA 3NV4A 3I59A 5FZCA 2RS52 2C5DA 1UNBA 4E4DX 2OA2A 2WQ4A 3O1SA 1RJ7A 2KD7A 1OFSA 3MUY1 4LK6A 1LB2A 1PX4A 1U5YA 2JIJA 3GM8A 4XFGA 4QKFA 2PA7A 2BNMA 3POWA 1DYPA 2MHFA 2Y26A 4XFCA 3NJZA 5E89A 1EAH3 2VMEA 4I0WB 4O9EA 4AFMA 5C3PA 5CFDC 3RZKA 3RJRA 3NMBA 4BZ4A 2VNOA 2J7MA 1A78A 2B9VA 2R041 2JB8A 3O12A 2ZAAA 4OFGA 2XLGA 2QQKA 3WQ0A 4NIGA 1AYM2 1QJU3 3AVSA 4X6RB 1OVSA 3N9MA 5FZDA 2PHUA 4L92A 4DNYA 4XYXA 4JDOA 2X10A 4LR4A 3WX5A 4UW5A 2CYFA 3OB8A 3LD8A 4XJ8A 3FJSA 5GALA 3BALA 2WT0A 1SG3A 3PUIA 4LA3A 2BERA 4B4QA 4L9BA 1JHNA 4IGOA 4Q2FA 1GP4A 4FPKA 1QJY3 2Q0AA 2XMLA 4TWTA 3VBHC 1YIFA 5CFCC 4BMEA 3EQEA 2UYAA 3NV3A 3ZKUA 3LCPA 4EWAA 3R4SA 4BHPA 1M06G 1QIQA 1AL23 3UKTA 5IK5A 3KT1A 1W2TA 5IATA 1FOD1 1ASJ3 3BPZA 4LORA 2QQLA 3RZHA 4URTA 3DKWA 4CCCA 5BV6A 4NHXA 3WNKA 1AR92 3WF0A 1B09A 1ZRIA 2W52A 5JDBA 2CY6A 1YEWA 4CP9B 1FNYA 1LENA 2IXIA 2WSUA 2YHJA 4COYA 3SMHA 4ZXEA 4KGGA 1LGNA 2XUMA 2AR6A 3RPQA 2PQSA 4KWUA 2EAAA 4XBNA 5DDJ1 4CDQC 4YSFA 5LBCA 3R05A 4FXKB 2BBVA 4CUGA 1CX1A 1RVF3 1LR5A 1DQ6A 1GNHA 1F4HA 4MVTA 4E27A 3ZKYA 2WFF1 5EXOA 1CZVA 3MEPA 4DY3A 1O6UA 2VNRA 4L8QA 4PHZA 4CDXC 4OHYA 4B29A 4CEYA 3GZUC 4YFZA 5EP9A 3DN7A 4Y5Z0 2YGMA 3ZXFA 3JCIA 1PIV2 2VR4A 5I93A 4JHTA 2WA3A 2D6MA 3H3LA 5FYSA 1AJOA 4CVUA 2FCVA 4L99A 3TEXA 5A1LA 1JOPA 1ZVFA 1BYHA 5JSRA 4QXKA 3H9AA 2CNAA 2RR11 4HETA 2VXJA 3SEEA 3RGBA 3IMMA 3I3EA 3HN1A 4JGZC 5D21A 4HPKB 4AI0A 4YG0A 4QXHA 1LGCA 3T0DA 2MEV3 3LAGA 3N4MA 3KHBA 1AUYA 4GIQA 3LIGA 4K9SA 5B4NA 5C71A 4IEZA 5FZ9A 4Y4YA 5C9AC 4LKDA 2VZ3A 2BWCA 2IXJA 4MX3A 3ASIA 4QXBA 2BDRA 2NMNA 2UURA 3EHKA 1LHUA 3AK0A 5D8AB 3HAGA 5FZ6A 1RUJ3 1HRV2 3CZJA 2VG9A 1QQP3 4PQQA 5FAXA 5FMOS 4D7YA 3TRSB 2DTWA 1QU0A 4NRPA 2P3JA 2ZTNA 4MGKE 4JKMA 1K12A 1JZ2A 4XXAA 2HEYF 1PMHX 4XJWA 1W8FA 2E9QA 4N90A 3WW3A 4PLOA 3PUHA 3H50A 2Y6LA 3R4UA 1R082 2JX9A 4GQ7A 1ENRA 4CUBA 5HCBA 2HWC2 1HB3A 2AC1A 3D82A 5T5PA 4QB1A 4GKYA 4DXTA 1ZM1A 1UY4A 4ATFA 2BGPA 1JMUB 3N9QA 4P08A 5JMCA 3V0BB 3RFRA 3SH4A 5ACA2 4W50A 4D94A 3OGVA 5CB7A 2YPDA 5IUQA 1SLCA 3SLIA 3GCXA 3WF4A 1W6MB 1GQGA 1XU1A 1IS4A 1PHMA 1RHI1 4MUVA 4QD2A 4FOVA 3TEZA 1V6IA 4LHNA 4YW1A 1FMD1 2LTNA 5DZGA 4XFAA 3ES4A 3WNMA 3Q8BA 4CP9A 3C7FA 2P37A 4XOGA 4LKEA 4EN0A 1CPMA 1IQDC 2UY8A 3PJQA 3RVHA 2R061 3BGAA 1IG0A 1TE1B 5GLWA 4YW4A 1GMMA 3POBA 1LEDA 3N3HA 5AC92 1VRH3 3OOXA 4GWIA 4ASKA 3WZ1A 4EQVA 1HJFA 2PYTA 1HRI1 3LB9A 4BCUA 5FR3A 3GBWA 2DBNA 4LKSA 4XCBA 5L9BA 2R16A 2WNUC 4NJ4A 3ZLIA 3V0AB 3PVNA 2PLV1 5EQUA 3NJYA 4BIFA 2XG3A 3USUB 3P3NA 4FTBA 3U4XA 2QUOA 4XBLA 3TWIA 5FY4A 1HW5A 2B5HA 2DUPA 4ITCA 4A3XA 2Q4SA 2V5YA 2XLAA 5KHIA 4CCJA 4UXAA 5F32A 3S5AA 5IK7A 2DCJA 3KHCA 3A7QA 3SCFA 1VBB1 1LAJA 4HPKA 5CFDB 4BLJA 2RS51 4WZFA 1KDKA 1ND3C 4NHMA 3W5NA 4XETA 2HYKA 2JICA 2WABA 1E5SA 1X8MA 1YLLA 4U2AA 4L11A 5TSWA 4IV3B 5FZ7A 1QNWA 2WT1A 5D8AA 2LROA 4FCAA 5JZGA 2O0OA 2G1MA 2WSVA 1BVP1 4AGVA 2P3KA 4BOWA 2FZ2A 5IK8A 1OLMA 1WMFA 1O8PA 2PXJA 2CWSA 4QM9A 3ZXJA 3I2FA 4AI2A 4ET7A 5CG8A 1HJGA 4LPLA 2QDRA 4WM8C 1JOJA 1V6KA 3E6BA 1STMA 1ZBE3 3WXPA 1OLME 4QXCA 3GHNA 1AR72 1WMEA 4YLZA 5GZEA 1AYM1 1MZ6A 2NM1A 2VBDA 3GJBA 3VBHB 5CFCB 4META 1K42A 1JZ7A 2ORZA 3WDXA 3RZGA 2BQPA 2HWB2 4YWAA 1MS3A 1TQ5A 1KQRA 2RS32 3IAQA 2WLPA 2H0VA 1UXZA 3PVOA 2ERFA 4NN0A 1XPWA 2XB6C 3AXDA 3B69A 2RG4A 3TN93 5FZ1A 2W47A 3VBSC 5DUXA 1H8TB 2BU9A 2VBPA 4ZY9A 1O8SA 3V0BA 1OPMA 5C3OA 2BNOA 2W95A 3CQOA 4BISA 3LOBA 1G9CA 5LZ6A 4MHRA 1RUD2 3KM5A 3ZDVA 1W6MA 5JXGA 3CDZB 1OBNA 2JDNA 4IDZA 2CV6A 4ARXA 1NCQC 2EIGA 4P9JA 4LIUA 1Q8QA 4A2UA 3ILNA 5LRRA 1G9AA 2BWAA 4CDQB 2DCYA 5DN2A 2Q1ZB 1U5IA 1XE7A 2D6NA 2ZZJA 3HNMA 1LULA 1NY72 1WCQA 2D7FA 4JTNA 4XABA 5IW0A 5FO9B 1O91A 3SISA 2VCBA 1PM4A 3AZXA 4CCKA 4C91A 1AR91 2FD8A 3N7JA 1MPXA 2WNEA 3D5OA 3AJYA 3O1OA 1W6OB 5C8CB 2JECA 1UPSA 3RMYA 5F7UA 2AENA 5FPBA 3I97A 4XPVA 4COVA 5FPVA 2AREA 1UY1A 3VHNA 4AAPA 3GZEA 2VMGA 3SEPA 3V0AA 3OJBA 3ZOIA 4BM8A 1X82A 3FWEA 3USUA 2ZX2A 2HWF3 2GC2A 4JKKA 4Y33A 4A7KA 2YXSA 3MYXA 5LEKA 3K3NA 2HBTA 2BFUL 3LSEA 1PIV1 2WO3A 5BNPB 5M0TA 5FLHA 2GALA 4BA6A 1A8DA 1JU3A 5CFDA 1RIRA 4R52A 4ATEA 1CR7A 3RMXA 3UESA 3ACIA 2PTMA 1RTVA 5LBFA 3H8XA 2JDUA 4ZS2A 2GNBA 2KA3A 4FQ4A 5FMDA 3RS6A 5BNQA 4JRLA 2YV8A 4LJHA 3VHRA 1R093 2YYOA 5FJHA 1IS3A 1Z7S3 4IV3A 4KG0A 4QWNA 3THDA 2XQRA 2Y33A 2CDPA 3OYWB 1N1YA 3THPA 2FDGA 1CPNA 2EF6A 2V4AA 2D6OX 5KR7A 2WNVC 4HZFA 3ZXLA 5APAA 5LASA 3VBUC 3OPTA 2GNTA 1HRV1 1UZ0A 3W58A 3R6SA 2CWMA 2VZTA 3FZ3A 3VBHA 5CFCA 3MV11 4HSLA 1CZSA 4WV8A 3N9OA 1EV12 1UYPA 2X53S 5A3LA 3LIHA 3WCSA 5FK7A 2ZA9A 2R073 4QPGB 3RDIA 1R081 2LRPA 3P5BA 1RUE3 4NMIA 4E8DA 3K77A 1H1AA 1KS4A 4YGEA 4LHSA 1S0GA 3OBZA 2ZGSA 4R9BA 3VDDC 3KSCA 4Q27A 1CESA 5CADA 4CCMA 2EIDA 1AYN2 2W3JA 5ACA1 2ZGMA 3ROUA 5J09A 5C4WB 2WBKA 4CXWA 5FWJA 5J1XA 4CDQA 1G8WA 2WZR3 3J4UH 3WP5A 4AEDC 5IVVA 2HJIA 2PFWA 3BTYA 5B4XA 1YRZA 5HCAA 1AXZA 1YQ6A 2LUWA 4ZZ5A 1JBCA 1Z78A 4Q4W2 5C8CA 2ZGNA 2WNUB 1VBC2 2ZGRA 4HANA 3IIAA 4PDWC 5FRAA 2TBVA 4FP3A 2H0BA 2W5FA 3UKNA 3NNMA 3IWZA 4P5HA 3WF3A 2XGXA 1RUH2 1DQ4A 4AHXA 1J58A 3O14A 4AK3A 4R9CA 4Q0UA 1PNFA 4YM1A 1LOAA 2OQ7A 1X33A 2YU1A 4ZPIA 1HN1A 3T09A 4E4SA 3KB5A 4XZPA 5BNPA 3IDBB 4HBNA 1KJLA 1UZWA 5I0SA 3FUQA 4HXCA 1C5IA 1BLZA 2R6QA 3MIGA 3CJIB 4LXLA 3NKTA 3OG2A 4HVRA 2JG9B 2WS92 5J7MA 4DZGA 5D2AA 1DYKA 1W8WA 3CLPA 1VBE2 2YY1A 1CAXB 4OUMA 2QFEA 5JSOA 3E5QA 1YJLA 4WM8B 3UV9A 3OYWA 2IXHA 4P14A 3ACLA 2K2SA 3ILFA 3SQOA 3H7YA 2ILMA 5J37A 3I2GA 1QDCA 3WP3A 1WBLA 1YJKA 3POFA 4QGMA 1YFUA 1WCKA 1W8TA 1I1EA 4LBMA 1US3A 1D4VB 3OD4A 1ODNA 2E31A 2RVAA 1J83A 1FV3A 3H1YA 2E26A 2R043 2RJ2A 1RUG2 4TYSA 3VBSB 3GZTB 1U0AA 5CZKA 1AR71 3HJRA 2PHTA 5FTTC 1BXHA 2XJVA 1BBT2 1OD5A 3B01A 4QPGA 1WCSA 4RHV3 2HWB1 1W90A 4AI8A 1JS9A 2RS31 2DVGA 4KWKA 1L7LA 2C6SA 4CZSA 2IVJA 1RMU3 4PBOA 3B9IA 5HV4A 5LA1A 3N9LA 1NCQB 4C90A 2RJLA 2FDHA 4RSUA 1OOPC 2HWD3 4AQSA 4OQ9A 4I01A 3J8F3 5JAXA 3U0ZA 2JDPA 3MLKA 2VAUA 5IVFA 1XB9A 4N9IA 5I0TA 1X9TA 2VUAA 5C4WA 4Q4X2 5FYUA 4EWDA 2J1VA 2XJTA 1FPN2 2BP6A 3WDWA 2J1EA 2ZGQA 3ZM8A 1N1TA 3OEBA 4YW2A 5T5OA 4C1XA 2J1AA 3ZMOA 4XQ4A 1NQDA 1SBFA 1IS5A 4XBQA 1GANA 1NLQA 2WNUA 3B7MA 2Z79A 2VOXA 2FHRA 1NY71 2QVSB 1CGPA 5FJKA 1VMJA 2IVIB 1PO12 2EXKA 1ACCA 2PHRA 3OGSA 5ANNA 1SEFA 3W59A 2GC3A 4Y1VA 3MW2A 3U37A 1WCDJ 4DOUA 4UOJA 4I02A 4AGGA 3OCPA 1S0IA 1VBD3 1HXS3 3LEIA 4JGYC 1OQEA 2JENA 4OULA 3U10A 4R9DA 4UW4A 3WQ1A 1F5JA 1VBA3 3BKZA 1GWLA 2VC9A 4UFLA 3PU3A 4XEZA 1CIYA 2E63A 2WRAA 4QKDA 3HQUA 5FP4A 1D0GA 4AXOA 3WF1A 3ZFEB 4AVTA 4QX8A 1NYWA 3ZYFA 1Y9GA 2YG0A 4XXPA 2JG9A 5JSPA 3OBRA 3DKQA 2JE7A 3MHZA 1CAXA 3ABZA 3BTZA 4K8FA 2YGLA 1CJDA 1JYIA 4MGSA 1G86A 4WM8A 4FOQA 1OT5A 1V6LA 4RFT0 3VKMA 5KHKA 3FLRA 1J1LA 2ZJCA 4B7EA 5LB6A 1BHGA 1US2A 2IXKA 4FPYA 3RNSA 1OQDA 1FOD2 3FUOA 4G4FA 2VL4A 5LWBA 3I2HA 2PHXA 3VBSA 3QACA 2PN5A 2WYFA 1PZ8A 4CU6A 3RJ2X 5FKBA 1C8M3 4IXLA 4MGZE 3T0AA 2ATFA 4AVVA 1APNA 3VZKA 1B35C 5A3TA 1EV11 3AJZA 1PVC2 3H42B 4FP2A 1NCQA 2AUYA 2ETEA 2VMIA 4UYBA 5JI7A 3WV6A 4AW7A 1S1AA 2QDNA 3OPWA 1ZZ9A 2X5IB 4RD7A 5F5CA 3UGGA 3ACFA 3KCXA 3BN6A 1G9DA 3DF0A 4AI1A 1AR63 2VNGA 3FC0A 5CG9A 3O0WA 3D8CA 4LE3A 5FPLA 3OBAA 1UYXA 4CUAA 4CTEA 3TNQA 1TME3 3CU7A 2VZSA 2VMCA 1AYN1 1MZEA 4C0BA 5IFTA 5A1FA 2XWBB 2RR12 4AVBA 4PDWB 5SV8A 1WWYA 2A1XA 3JB4C 4LO8A 5ISLA 2ZGUA 1CN1A 2Z42A 3AVRA 3H8OA 1O3SA 2P34A 1FMD3 1LOGA 2QQUA 3TNPB 1QXPA 1XNTA 4OVEA 2DTYA 4D6QA 1PM7A 2BNNA 4Q4W1 5JR2A 4MYEA 1VBC1 2CAUA 2ZGOA 4LBQB 3J9SA 1AXYA 3LFIA 4FVVA 4XDPA 5C3RA 2OPWA 4WM7B 4GB33 4AFAA 4Y20B 4D6RA 1J1TA 3LE0A 5DAQA 2WUHA 1BQPA 4K7JA 1ZRFA 1IGOA 4TN7A 3MPBA 1RUH1 3WDYA 1KGYA 1P8JA 1DGLA 4LBOA 4R9AA 2A73B 3ZFEA 4GKXA 2JJ6A 1HIXA 1KJRA 1MQTB 2WR9A 1SHWB 3OUHA 3PJYA 4TLFA 5D8AC 1S0FA 2K0GA 4LLOA 2YROA 3LFMA 1CVNA 5FOBB 2ZS6B 4XTPA 5K0UC 5KWRA 2PAKA 3VLBB 4I30A 1CQ9A
chains in the Genus database with same CATH topology
1VBE1 1PGW1 3NV2A 4M3CB 4J1XA 4WBBA 1CAWB 3AP9A 4OI1A 1QOTA 5E88A 4N43B 1RHI2 3VHOA 5LK5A 4RGGA 4HLTA 3ZYPA 5E1RA 3SHRA 4YM2A 4LUMA 3OY8B 5T55A 4CP1A 5BNNB 4NPRA 3G7DA 1OOPB 2G9GA 1QHDA 1FYUA 1RUG1 4Z2WA 5HBAA 4IEPA 4LEJA 4J1WA 1BBT1 1VAMA 1LJ7A 4LLFA 4DY5A 2X5IA 4FPCA 2QE3A 5K8SA 2VOWA 3ST7A 2QCSB 5GLVA 3ZSKA 1DIWA 4BYYA 4ISRA 1V6NA 4J6GA 4PDWA 1FPN1 1D4M2 2B39A 2IFWA 3AP5A 1ZBA2 4Q26A 4JGYB 2ZKNA 3N36A 1UZZA 2EXJA 1F8VA 3R0RA 4LBQA 5H9QA 1PO11 5J98B 4WM7A 2GMMA 1REDA 4Y20A 2A6ZA 2ZHKA 1AR93 1SDWA 1BEV2 4JVAA 2BUKA 2WL1A 3MIDA 2JD4A 4YGBA 3AP7A 3OF1A 3B5LB 1W6QB 1F5FA 4XF1A 1DQ5A 3WDUA 1DZQA 1MQTA 4IV3C 1BVVA 4NR1A 4DFSA 4EN6B 5CBLA 1O5UA 2H6CA 3MF6A 3QLQA 1WA4A 1Q8SA 3OBTA 5KXCA 1XRUA 3AMHA 2D98A 4GH4B 5EZWA 5JCTA 1TMF1 1WW5A 4M3CA 1CAWA 4AF9A 1MZ5A 4M01A 3H3ZA 5FLIA 1NXD1 3JD73 2IXCA 1LECA 1EPZA 3S7IA 1B35B 2XVLA 3OY8A 3IM0A 1H8TC 1DGWX 1XNCA 2ZGLA 4I3PA 3MW4A 5BNNA 4XDQA 1OOPA 3MW3A 5IT6A 3MPPG 4B3NA 1OPOA 1V9U2 2XJPA 2DWRA 3B94A 1RUF2 2E7AA 1PVC1 1V6JA 2KXLA 3AYDA 1J3QA 4GMP1 1RGSA 4OI2A 5EWSA 3UKVA 3WUCA 4IEYA 3M2MA 5KHJA 2XL7A 4Q0SA 1R083 3MZHA 5LK7B 3IN9A 4E4ZA 4JQRA 5C8CC 2HWC3 4UBGA 4C0HA 4CDUC 1EAH2 4AG4A 2VULA 2PAEA 2NZ9A 4Q4V3 3FMGA 1WW6A 4JGYA 1SACA 1VLNA 1MEC3 3HQXA 2PHDA 4Y22B 1XXNA 2EVXA 2WIIB 4YZ3A 4UW3A 5KC6A 1Q43A 5AVPA 4W6WA 2G4IA 1UZYA 5BNPC 1F31A 4MXWB 5BYNA 3SITA 3FBMA 5H9PA 2IFRA 1CAUB 4GMP0 5I0RA 1W6QA 2UWBA 1S0EA 5AC93 1QJY2 2WFPA 2RS12 3WG4A 4FT8A 5K0UB 1DBNA 1AX2A 4G3YC 3WR0A 4W6XA 3KCYA 4E2GA 5FMOL 1AL22 1NOVA 2P17A 1ASJ2 4GH4A 4QU2A 3ZFGC 4P9LA 4PIZA 1RB8G 1VB2A 4YFWA 3WNXA 1DQ1A 4B4RA 4Z92B 2C9AA 4F3JA 1IKQA 4HK9A 1H4GA 1SFYA 3WP4A 1UKRA 5KXEA 3ZXAC 1B35A 2K9ZA 4QPGC 3ZXGA 1HQWA 4AFBA 4ES9A 1QF3A 1RVF2 4MLOA 4GA9A 4S2GA 2DCKA 2QJVA 2H6BA 2I07B 3AXEA 5BPXA 1SFNA 1PO22 4XFFA 2Q30A 5GJ6A 5E16A 5T5JA 5C4WC 5K9YA 3D0JA 1AR73 3AM2A 1QNYA 4F7ZA 2ZCWA 1OSGA 3AYAA 1N1VA 3QCWA 1DGRA 1ULFA 4Y24A 4MSVA 5T50A 4QGLA 4G9SB 3M8LA 2R49A 4ZU4A 1RUD3 3I7DA 2XBO1 1RUJ2 1IZ3A 1D4M1 4Y22A 1QJZA 2DV9A 2OW4A 2A3WA 1ZBA1 2DVDA 2E7QA 3ALQA 4YZ5A 1DLLA 1FX5A 4Q0PA 1YYNA 4MXWA 1POV3 4HN0A 3W9AA 1Y9QA 5JR7B 1CAUA 1OLQA 2KM2A 4CDWC 3CJIC 1LTEA 1COV3 3GHMA 2JG9C 4FOYA 1BEV1 3CNAA 1ND2C 2B45X 2VH9A 5K0UA 4ES8A 4Y1YA 1URXA 1NA1C 5KXDA 3POYA 4ZU7A 5FOJB 5JIUA 3VGIA 2OPKA 1LHWA 4GWNA 3ZN5A 3KQRA 3QH7A 4FPFA 3IDCB 1W6NB 2TEPA 3OGJA 1H2LA 1R1A1 3AMMA 4EWEA 4JRAA 4AQ2A 2I2SA 4BIOA 4PIXA 3POSA 1Q8PA 4FPOB 1RUNA 4EN9B 1H4HA 5FPZA 3GYDA 3ZSJA 1BZWA 4H55A 4QMAA 4ORFA 1JXNA 1QOOA 4D7SA 3WG2A 2PHLA 2FQPA 2D6KA 3JBG3 4XFHA 2ZAHA 3LKJA 3PMSA 5GZDA 1N3QA 4AVSA 1V9U1 1QJX3 2D5HA 1Q5OA 3NAPC 1RUF1 2VUJA 4WVVA 4CDUB 4V1PA 2XKPA 2Y0OA 4HSJA 3INAA 1C1LA 3IPVB 2Z69A 3JQWA 4K6BA 1O4TA 1QH7A 3HMYA 4QPIB 1AR83 3LZZA 4PQ9A 4XILA 1LHNA 2DVBA 5EYYA 1FAYA 2Y38A 3MIEA 1JUIA 2VW0A 4IEQA 1EAH1 1CIWA 2XJRA 4IEXA 2WQZC 5ABJB 1LOFC 4XFIA 1O4YA 3FE5A 2GDFA 1J3RA 1Q8VA 1UL9A 1H1IA 1K5MB 2EAKA 3ZFEC 1GR3A 4XIOA 1EPWA 3NV1A 3AKRA 4JTOA 2ZGPA 3WY6A 3TN92 1PNGA 3WCRA 2ZX4A 4OI0A 2ARXA 2BGCA 3ZFGB 2R0FA 2WZPP 2QZ2A 1QJY1 2RS11 1ALYA 4NHKA 1LOEA 4Q4Y3 2GMEA 4IESA 4M0HA 3M4FA 4EV0A 1LODA 1DHKB 5J3UA 1AL21 3LA3A 1FV2A 2BW8A 1H8TA 2ZABA 1ASJ1 1ENSA 2BVBA 2ZHLA 1VIWB 5LRSA 4YM3A 2D43A 1C57A 1XNDA 3IBMA 3L2YA 4OUSA 4FOWA 1HQLA 1NE4A 1DFQA 2WS93 1V00A 4N9HA 3EO6A 4WVWA 1LEMA 1O7FA 3ZYIB 5H9RA 4BLIA 3GNEA 3MLLA 2VQAA 2X5IC 4HFSA 2A71A 1YCIA 1RVF1 5BXXA 3BCWA 1YHFA 3BIWE 1W2UA 4Q8KA 2DUQA 2XJSA 4DQAA 1W6OA 2DUOA 1PO21 1H30A 3S0MA 2VOVA 1SLBA 4K1YA 1QXJA 1VB4A 4YYOA 2VQ0A 4P9XA 2FBEA 3ZIWA 3BB6A 1OI6A 4CDUA 1UU4A 5EV7A 4F8AA 3N35A 2ZOEB 3IPVA 4OHXA 1YO8A 5L7OC 4QPIA 2DURA 2JG8C 3B02A 4HT1T 5DZEA 1R092 1ZX5A 3ZX7A 1S0DA 1Z7S2 3WG1A 5JPNB 3LWCA 4WM7C 1UD1A 2HKXA 2VVFA 5FBZA 2R32A 2DFCA 4P9YA 4CDWB 5ABJA 4Q4X3 1RUJ1 3PMEA 1FPN3 3M3QA 2HWE3 1PGW2 1ND2B 4Z1VA 1DU3D 4I0BA 1UN1A 1MQTC 1BK1A 2PELA 4W6YA 2EXIA 1NA1B 2E51A 1KS5A 2UYBA 4Q29A 4NVPA 4YNIA 1IQAA 1ULEA 1PO13 2R072 1RUE2 5EYXA 3ZFGA 4LT5A 1RUOA 5F5QA 5JOWA 3ZN6B 1VAVA 3VKNA 1ZZCA 4LO5B 2O1QA 3PNAA 1GBGA 1WLTA 1QMJA 3H1MA 4JDNA 2D3RA 4N43C 1GZCA 4IV1C 2RE9A 3RYRA 1DZRA 1H0BA 5BNNC 3GBFA 1V70A 2UY9A 1X7NA 3H8UA 3M7AA 5C33A 1YFXA 4FPLA 1UCXA 1O4ZA 3AX4A 4AGRA 4YZ2A 4TZDA 3KCCA 2P2KA 3I54A 1TNFA 1ZRRA 3AZVA 1BCXA 3NAPB 4YVWB 4FSJA 1LHVA 3RYPA 3NL1A 1FOD3 1XYOA 4XMAA 3QH6A 2NYYA 3C3VA 4I3GA 5AFBA 3NKGA 3KMHA 1H1MA 4PCRA 1Y7BA 1RUC2 1GLHA 1NE6A 2D5FA 5DDJ3 1KXGA 3ATGA 1DQ2A 2ZGKA 3WD5A 2NN8A 1Q56A 4NOTA 2WFF3 4QT6A 3RI9A 4XJUA 4XHBA 3V56A 1HKDA 4Q1PA 1O5LA 4CDWA 1A8MA 3CJIA 1G6NA 3MIHA 1YI7A 2CGPA 1ND2A 3IDEA 1TMF2 4LUKA 1I6XA 2IXLA 4YW3A 2XHKA 4EN7B 4B4PA 2RR13 1OA3A 1ZBE1 1NA1A 3O0VA 1AHSA 3KT4A 3RG0A 3UL2A 4FAHA 5GZCA 2DCZA 1VAKA 1GV9A 1SBDA 1N1SA 1ULCA 3SH5A 1RITA 3VBOC 1RMU2 3I8TA 4GH4C 2VU9A 3A4UA 4YG3A 3B93A 1EP0A 1W6PB 3ZN6A 4DINB 3VKOA 3TN91 3J8F2 3URFA 2EA7A 2GN3A 4WVZA 1X36A 1AX0A 4RA0A 2DVFA 3E5XA 4ZU5A 5J36A 1ZZ8A 3T2TA 3K48A 4DS0A 1OMIA 1QH6A 3VL9A 1HX6A 4Y26A 4WVMB 2TNFA 4HKOA 2YPJA 3ME2A 2XJUA 4PF5A 5I91A 5DUUA 2UWCA 3SCGA 5GLUA 3WVJA 1G9FA 1GZ9A 1Z0HA 3FFZA 3NAPA 1VBD2 4KGQA 1HXS2 1C5HA 3M70A 4O9GA 4YVWA 3FHIB 2OIIA 1CD3G 5E8AA 1VBA2 2FMYA 4ZXKA 3DV8A 1RHI3 3RQ0A 5L7OB 4FPJA 1DG6A 1GYKA 1LCLA 2JG8B 3N7MA 3WW1A 1YNAA 5DG2A 4QHBA 2W68A 2N7GA 4JCKA 4YVSB 4AQ6A 1LRHA 2JKBA 1H9PA 2R063 2DF7A 5F9TA 4ASLA 1LOCA 1LOFA 3S30A 4BPZA 2UWAA 3B3QE 1HRI3 1U5XA 2JEMA 1R091 2G9FA 3I2DA 1Z7S1 4LTAA 1Y43B 2PLV3 4QQ2A 2RM22 4QPYA 5FPXA 5GKAC 5KXBA 2VW2A 1REEA 2RMU2 5DXDA 4QQOA 1GZWB 4Q1RA 2ZHMA 1D4M3 4XJ9A 1C8M2 1VBB3 1GKBA 4Q0QA 3ZFFC 2RS53 1MS9A 1IKPA 4K3UA 2A5ZA 3KD4A 2QQPA 4FXGB 4XJAA 1W6PA 2P3IA 3WDTA 4IV1B 4BE3A 2R071 3BOPA 1RUE1 2IC1A 3EBRA 4MH0E 4BWOA 5JPMB 4CP0A 1AR62 3H3UA 2HEWF 2WLQA 1ENQA 2VPVA 3KZ4C 3RRDA 1IS6A 3WT3A 3J26N 3MDPA 3VL8A 2Z2SB 3KGZA 3ZYJB 1AYM3 5LEJA 3DL3A 2R1DA 1F2NA 2NLRA 2ENRA 4WVMA 1UU6A 3CJXA 1RUI2 1ENXA 1XNKA 5KC5A 4QM8A 4JV4A 1U12A 3MIFA 3O0XA 1PGL2 2DVAA 5FQ0B 3JQXA 3JB8A 4QQLA 2DCTA 1WLCA 4GB32 3VKFC 3V65A 3JU9A 1W0OA 3L9JT 2XBO2 4LA2A 1D2SA 4AVCA 3PTYA 5L7OA 2GMPA 2R30A 3NSTA 3TYJA 3OGGA 2ZHNA 1G9BA 4F83A 1PGSA 3LA2A 1SLTA 4YM0A 2JG8A 3RYKA 4E9KA 5L19A 5J48A 2GC1A 4MGYE 4RR3C 2WC2A 4YVSA 1ONAA 2ZMKA 4ASMB 5EFUA 3ZXDA 1XYNA 1S2BA 1IPJA 1V9U3 3NWKA 5GLZA 3WOGA 2W39A 1JH5A 3L2HA 1GQHA 1PMIA 1RUC1 3E5UA 3AP6A 3M1HA 4KWLA 4E2SA 2D97A 1LESA 2NP0A 5EJ3A 1MVEA 1TEIA 1VR3A 1QGLA 2WT2A 3ZO0B 2ZMLA 4DRRA 4WZCA 1GZWA 1WW4A 1PIV3 2E53A 1R1A2 3VBOB 2O8QA 4OZXA 3E6CC 5F6LB 2VVEA 1OQ1A 3BODA 5FLJA 1BMV2 1J3PA 4B8EA 1FT9A 1YI9A 4PJYA 2D44A 1OA4A 4N43A 2DU0A 1XE8A 4M3CE 4BQ1A 1REFA 3ELNA 4IV1A 2ZX1A 4RHV1 3JZVA 3TBDA 2A6YA 3VZOA 3TOJA 1RMU1 2CAVA 1KDMA 1UKGA 4KL1A 2HWD1 3EJKA 1KITA 2WA4A 3J8F1 4GULA 1M4WA 2BEOA 4QQPA 5KBFA 3H0OA 1HRV3 5A32B 4PBPA 3ECQA 3AKPA 2RS13 1XQNA 1N3PA 4Z8BA 3RSJA 5A33B 1J59A 2IZWA 1YUDA 2W0XA 3WW4A 1NLRA 3JUUA 4LO4B 4RQPB 2WKKA 5GZGA 2E7TA 1QXRA 2A75A 2FZ1A 5IK4A 1I5ZA 1SLAA 4AEKA 1EY2A 5HCFA 5FQ0A 3WP6A 1OFNA 4K40A 5AVAA 1MZFA 1T6GC 1UU5A 2GAUA 3CF6E 1CX4A 2EALA 3OPZA 5ACA3 1VBD1 4FPGA 1HXS1 2PHFA 4LBKA 2BPA2 4QPIC 3B9CA 4LBNA 1UAIA 3A0NA 4ZKTB 1VBA1 1JUHA 3CO2A 1QJU2 3BTAA 3SXWA 1WLWA 1SQ4A 3AB0A 4LBLA 3WW2A 4GALA 4DPNA 3VN4A 3WLUA 1RC6A 1KD7A 3AZWA 1PO23 1PK6C 3WQ7A 1GNZA 4FPHA 5ABJC 2A7AA 3S7EA 1UX6A 3C2UA 5GZFA 2GSYA 2XJQA 1LKNA 5DG1A 3FLTA 3MF9A 1K5MC 2VOKA 2Y0IA 1AJKA 5C8WA 3DPRB 1NG0A 3ZFFB 3JD72 3M3EA 1JYCA 3D4KA 4XE9A 4JC1A 3VBOA 3NW4A 1WGPA 2RM21 1MS8A 3THTA 3TB0A 3ZN4A 1LGBA 2RMU1 2F4PA 3VBFB 5K7PA 1AZDA 3S6PA 5JZGB 3V64A 2D6PA 1WUVA 2GNDA 1VJ2A 3AZZA 1C8M1 2XVGA 4D3WA 2I45A 4B7KA 4RS5B 5FCCA 1HLCA 3U07A 1Q8OA 1XNBA 1JN2P 1V6MA 4AEJA 5A32A 1H2KA 1Y3TA 1AR61 3WG3A 2R1BA 4UW6A 5A33A 1H2NA 5BY5A 2OZ6A 1TME1 4L97A 2JE9A 5DUWA 4E2QA 3MLJA 4Q4V2 3IMNA 4CEWB 4RQPA 3ZSEA 1MEC2 2HWB3 2RS33 3KT7A 3ZPYA 1GFF2 2NQYA 3VZNA 3MFAA 4Y1XA 1VALA 2CL2A 2ET7A 1RUI1 2MEV2 1AX1A 3HIFA 4RR3B 3O5SA 3VHPA 4XQDA 2XLFA 3AYEA 1PGL1 4GB31 1NCRC 2A3XA 1CJPA 3SNMA 4AHZA 1C1FA 5L73A 1QQP2 3M3IA 4FO9A 3ILRA 3D0SA 5KHHA 3HT1A 3HBZA 4MZUA 4EN8B 5CVRA 1D2QA 3FX3A 4XMIA 4N53B 1W39A 3PVBB 3AYCA 5JVVA 1ZZ7A 4TSVA 2D3SA 3HT2A 3I4IA 1UIKA 5F6KA 2XVKA 1S2KA 3USSA 3AP4A 4COUA 3KLSA 4X6QB 4AQTA 5FO8B 4R4ZA 1SBEA 1YFWA 3ES1A 4LBQD 3SH3A 3DPRA 2A6VA 3RI8A 4CRQA 3ZFFA 3ENRA 4MV2A 2QNKA 2ZMNA 4S2DA 5J96B 2F6BA 1YIPA 4KH9A 2AGSA 2D3PA 1LU2A 1D0HA 1MS4A 1DZTA 2VECA 2WWSA 4XTMA 4DRVA 3AKSA 3LSDA 2ZBJA 4GXLA 3VBFA 2YMZA 1FI2A 1DQ0A 2V73A 5T3NA 4YGCA 1WD4A 1BMV1 3LA7A 3E97A 4LULA 3Q9OA 4RS5A 4I2OA 4HVOA 1VRH2 4YZ4A 2AZ5A 1G7YA 1NXMA 3AMQA 1H9WA 4GWMA 1QOSA 2XL9A 3N7LA 4UBHA 1AF9A 3MFCA 3SCHA 3WHUA 2VY0A 4XF0A 1C8NA 1C28A 4CEWA 4YVWC 2YZ4A 4X8NA 4LO6B 1L3JA 3HR9A 4LHKA 1EV13 4P9GA 2EXHA 2ZACA 3MICA 1H8VA 2XKOA 4HL0A 4DMIA 2CGOA 2VXRA 4RR3A 4LO7A 1UIJA 1Q3EA 4AE2A 1RJ8A 1COV2 4CDXB 1O3RA 1RINA 1QKQA 1PK6B 1AYN3 4XF4A 5T54A 1ZBE2 2PHWA 4N53A 5C6CA 3HWJA 1QJU1 2OUJA 2BFUS 4XQWA 4HKWA 3VZJA 3E6DA 2CTVA 2PQQA 2PAMA 4AHYA 4FBFA 2MNGA 4IEUA 4Q4W3 4JGZB 3VBRC 5JLVA 3GF6A 4XJZA 5I8SA 1FATA 1VBC3 4EJRA 1YWKA 3PHMA 3VKLA 2YC0A 4PLNA 5C9AB 1AVBA 1S0CA 4W65A 1RUH3 3MI8A 4XHXA 3OD0A 2B9UA 2GU9A 3JD71 4FTSA 1W6NA 1I9RA 2GC0A 3RWNA 3T1MA 5KHGA 3JBG2 4XIKA 1MS1A 5CA6A 1QJX2 1R1ZA 1MVQA 3ZXKA 2D6LX 1IPKA 1VBE3 3PVEA 5FFOC 3DUIA 2Q5TA 3KS7A 4XF9A 1ZZBA 4AHWA 2C1FA 2MPFA 3PLQA 4INDA 4RGAA 4DXZA 4IL7A 4ISQA 4AEMA 4HKLA 1BKZA 5CNAA 1YXWA 1LHOA 2IWGB 1AR82 2HEVF 2HWF2 1E57A 3OTFA 1H2MA 4YARA 4Y1UA 5I8TA 4DB5A 1C3HA 1CAVB 2HWC1 1XU2A 4K1ZA 4YW5A 4HK8A 3ETQA 3M3CA 1RUG3 4KNCA 1SMVA 1C4RA 3QOPA 4Q4V1 3A0KA 5I8YA 1BBT3 1NCRB 1MEC1 1S0BA 1FXZA 3UJQA 1HV0A 4HN1A 1IOAA 2BTVC 1KFUL 1GICA 4YVSC 1W0PA 2XWJB 2MEV1 2WJSA 4CDXA 4KQ7A 1JW6A 3T1LA 5HI0A 4RL7A 3NVCA 1PK6A 1DGRN 3ZSLA 2X8KA 5BNOC 1N3OA 1WLDA 1X8EA 1QQP1 1WMDA 3VV1A 2XH6A 4D69A 5AC91 3X29B 1K5MA 3GALA 3AKTA 1MACA 4Q4Y2 2GN7A 2VW1A 1UF2C 4JGZA 3O7OA 2BYVE 1ND3B 2QZ3A 1ZA4A 2O8OA 4Q8LA 5FO7B 2AYHA 2YDEA 3G6JB 4L2NA 5CIRA 5GM0A 5C9AA 3IT8A 1RUC3 1XYPA 4HMZA 4NWVA 4LNVA 5JOYA 1ZRCA 3FBYA 1DF0A 3APBA 4OLLA 2LM3A 3TAYA 1GSLA 5SV5A 4AFCA 4IERA 2WZR2 4FTEA 2A70A 1FNZA 4AI3A 4NHLA 4QX5A 3VZLA 1I3HA 3QBQA 4KU8A 2W08A 3IKWA 4MXVA 1TMF3 3CEWA 4SLIA 3H7JA 2GH2A 1OLRA 4PLMA 1VRH1 1LOBA 2VGDA 3D6EA 2CGNA 3WINE 4M00A 1PZ9A 1AL0G 2RJKA 3AMNA 1CAVA 5F1RA 2OVUA 2AH2A 1AXKA 2GNMA