1MQTA

Swine vesicular disease virus coat protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
271
structure length
271
Chain Sequence
RVADTVGSGPVNSESIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESTVENFLCRSACVFYTTYKNHDSDGDNFAYWVINARQVAQLRRKLEMFTYARFDLELTFVITSTQEQSTTQGQDTPVLTHQIMYVPPGGPVPTKVNSYSWQTSTNPSVFWTEGNAPPRMSIPFIGIGNAYSMFYDGWARFDKQGTYGISTLNSMGTLYMRHVNGGGPGPIVSTVRIYFKPKHVKTWVPRPPRLCQYKKAGNVNFIPTSVTEGRTDITTMKTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Polyprotein
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
total genus 42
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtA00
4IV3A 1VRH1 1R1A1 3DPRB 1AYM3 4GB33 2WS92 1NCQA 2BFUL 4RHV3 1AYN1 1ND3A 4Q4X1 1ZBE1 2R073 2HWD1 4RQPB 1NA1C 5C8CB 1HRI1 1TME3 3HAGA 4QPGC 1QJU2 4N53C 1RUF1 2Y26A 1ZBA1 3TN92 5BNNC 1NA1A 1FMD1 5K0UC 3NAPB 2WWSA 4QPIB 2WS91 2MEV2 2FZ2A 4N53A 1MQTB 1VRH3 1W39A 5A33B 1R1A3 5BNNA 1VB2A 1AYN3 3JB8A 5K0UA 4Q4X3 2R062 1ZBE3 1RHI2 2HWD3 4AEDB 1PGL2 1QJU1 1HRI3 1B35A 4CDQC 1QQP2 1RUH1 1RUF3 1QJY1 1WCDJ 1EAH3 1ZBA3 1FMD3 3ZFEC 1RMU1 4CEWB 2WS93 1AR81 4CDQA 3LOBA 2X5IC 1SMVA 2R061 5D8AB 2HWF2 4WM7C 1TMF2 1ASJ2 5BNOB 5BNPB 2HWC1 3FBMA 1H8TA 3ZFFB 1BMV2 1X33A 1QJU3 1AYM2 4GB32 5A32B 4GH4B 2X5IA 1RUJ2 5C4WB 4RHV2 1PGW2 1RVF2 5ABJB 1RUH3 4EJRA 2GH8A 1TME2 3DPRC 1AL22 2XBO1 1PVC1 2HWF1 1RMU3 1AR83 4CEYB 1TMF1 1ASJ1 2R063 1VAKA 1AR92 1Z7S1 3DPRA 4LLFA 1EV12 2RS12 1RUJ1 3ZFGB 1OOPB 2HWC3 3VBFC 1RVF1 5C9AB 1VRH2 1BEV1 1GFF2 4Q4X2 1AL21 4WM8B 4FSJA 1F2NA 1MQTC 1HRI2 2ZTNA 2XBO3 1RUI1 4YVSB 1PO22 2HWF3 4GMP3 1AR91 4IV1C 1TMF3 1ASJ3 1EV11 2RS11 2XPJA 2WLPA 1FMD2 1MQTA 2RMU2 5A33A 1RUJ3 1AR61 4YVWC 1RVF3 2R041 4IV1A 1BEV3 4BCUA 5CFDB 4FTBA 1M06G 1AL23 1PO21 4YVWA 5J98B 2BPA2 1RUI3 3S6PA 1RUC1 1AR93 4Z92B 2RMU1 1RUH2 1E57A 1QJY2 1RUD2 3ZFFC 4CDUB 1EV13 1PO11 2RS13 3VBSC 1QJX2 4RR3B 1RMU2 1B35C 1VBC1 1COV1 1AR82 5LK7B 1AR63 2R043 3ZFFA 1FPN1 1HXS1 3VBSA 1NCRB 5A32A 3J8F1 5AC91 1POV1 3JBG1 2HWC2 5ABJA 1PO23 4JGYB 1VBD1 3VBHB 3CJIB 1RUD1 4CDWB 2BUKA 4IV3B 1QJX1 2RMU3 1NCQB 1VBE2 5L7OC 4CDXB 1H8TC 4CEYA 1HRV1 1ND3B 1OHFA 3VDDB 5JZGC 2XBO2 1IHMA 2HWE2 5FOJB 1PVC2 1K5MB 1VBC3 1COV3 4NWVA 1R092 1DDLA 5L7OA 4JGZB 1FPN3 2ZZQA 1HQNA 1HXS3 1Z7S2 3VBUB 5JZGA 1CD3G 3J8F3 4PDWC 2DF7A 5AC93 1POV3 3JBG3 1HX6A 1BEV2 1VBD3 4RS5B 1VBE1 1QJY3 1RUD3 4QPGB 3JB4C 4N53B 1QJX3 2HWE1 5BNNB 4PDWA 1A6CA 5K0UB 1HRV3 4RQPC 1RUI2 1R091 5C8CC 5J96B 5GKAC 1R082 4RQPA 3NAPC 5C8CA 1VBA2 1AR62 4QPIC 4CDUC 4FTEA 2WZR2 2R042 1VBE3 4RFT0 4RR3C 2RS52 1MEC2 5CFCB 2HWE3 1PVC3 3NAPA 1VBB2 3ZFEB 4QPIA 1BBT2 4CDUA 4Q4Y2 4AEDC 1R093 1R081 4RR3A 1RUC2 1Z7S3 1PO12 4JGYC 3JD72 1VBA1 4WM7B 3CJIC 4CDWC 2GSYA 4GMP0 5DDJ1 2WZR1 4AEDA 1VBC2 1COV2 2RS51 1NCRA 4Q4W1 1MEC1 1AUYA 4CDXC 4N43B 4CEWC 4Q4V2 1FPN2 3VDDC 1HXS2 4JGYA 4NWWA 1VBB1 3CJIA 5D8AC 1BBT1 2IZWA 3J8F2 1K5MC 4Q4Y1 4CDWA 5AC92 3JBG2 2RR12 5BNOC 1ND2B 5BNPC 1D4M1 1OPOA 1VBD2 1PIV2 4CDXA 4JGZC 4CEWA 3JD71 3VBUC 1R083 3VDDA 4GH4C 3VBRB 5D8AA 5C4WC 1K5MA 1QJZA 2FZ1A 1HRV2 5ABJC 4RS5C 1VBA3 1VB4A 5BNOA 5BNPA 2RS31 5DDJ3 2WZR3 1AL0G 4JGZA 4Q4V1 3VBOB 3VBFB 2RS53 3VBUA 1EAH1 4Q4W3 1C8M2 1MEC3 4GH4A 5C4WA 4CEYC 2RR11 4FTSA 4RS5A 1VBB3 2BBVA 1BBT3 1PIV1 4Q4Y3 4QPGA 1NG0A 1F8VA 1RUC3 1D4M3 3ZFGC 1RUE2 1OOPC 1CJDA 5C9AC 1PO13 1V9U2 3JD73 4IV1B 3M8LA 2HWB2 4SBVA 5FMOS 2PLV2 5ACA2 4WM8C 1C8M1 3TN91 2WFF2 3IDEA 2RS33 3ZFGA 1OOPA 1FOD2 4Q4V3 1RUG2 5CFCC 5C9AA 2QQPA 4YVWB 2MEV1 4YVSC 1NA1B 2ZAHA 2RM22 2RR13 4WM8A 1RUE1 1PIV3 1AR72 1V9U1 5CFCA 1RHI1 2HWB1 1PGL1 1C8NA 4YVSA 3ZFEA 2PLV1 5ACA1 1POV0 2WFF1 1QQP1 2VQ0A 1FOD1 5CFDC 3VBSB 1RUG1 4N43C 1C8M3 3TN93 1B35B 4WM7A 2R072 2RM21 5FMOL 2MEV3 1AR71 1ND2C 5CFDA 5DDJ2 4N43A 4GMP1 1RUE3 4CDQB 2BFUS 4Q4W2 3VBRC 1V9U3 1RHI3 2HWB3 1BMV1 4Y4YA 1AYM1 1ND2A 4GB31 2PLV3 5ACA3 1RB8G 4RHV1 3VBOC 1NY72 2WFF3 5L7OB 1H8TB 1PGW1 1QQP3 1NCRC 1FOD3 2R071 1R1A2 1X36A 5JZGB 1RUG3 1D4M2 3VBRA 2X5IB 1AYN2 1TME1 1ZBE2 3VBHC 2RM23 2HWD2 2TBVA 3VBOA 4IV3C 3VBFA 1AR73 4Y5Z0 1NCQC 2RS32 4PDWB 1ND3C 1NOVA 3ZXAC 1RUF2 1EAH2 1ZBA2 3VBHA 1NY71
chains in the Genus database with same CATH superfamily
2IWGB 4BPZA 2A6XA 3O1RA 2XONA 4GB33 2OQ7A 1NCQA 1PGSA 3N9MA 3TEWA 2BVVA 2XL9A 5FLJA 3VKLA 5A3MA 2W2IA 3WV6A 4AK3A 3ZKUA 1DGWX 2VJXA 3AKTA 5IUQA 2W1QA 4C1XA 1OUXA 2VOVA 4PBOA 4CYDA 2VR4A 5C8CB 5JXIA 1G86A 5FPUA 3WP4A 1TME3 2ZHLA 4XZUG 1IQAA 3HT2A 4OFGA 4CXXA 2VZ1A 3HAGA 3MLJA 2J22A 1F9KA 4YM0A 4YM2A 3RZLA 5KC5A 2VQUA 2WIIB 4Y24A 2J1EA 2DCYA 5FZGA 4FPOB 4Q0VA 4XF9A 3TN92 2GC0A 2ZGPA 4QXBA 2VY0A 5IFPA 1FMD1 1A3KA 2EF6A 4BMEA 2WO3A 5KHJA 4PLMA 4IGOA 4E8CA 2MEV2 5FZLA 2FZ2A 1XE0A 4AI2A 4AQTA 3U37A 3PTYA 1GLHA 5A33B 3RI8A 2A70A 4Q26A 1DGWA 2WNVA 3WXPA 1GOHA 3SQOA 4RGAA 1WGPA 1ZBE3 2DTWA 1FATA 3UGHA 2HWD3 3KHBA 4Y26A 3OPZA 3I49A 3U11A 1ULDA 1EYBA 4X6QB 1YJLA 2RJKA 1WWYA 3B02A 4A6SA 1B35A 1G8WA 1PM7A 1QDOA 1QQP2 1BVP1 1SLIA 2WAOA 3HQXA 3L2YA 4UFJA 5T55A 1PVXA 4XJWA 1NE4A 4Q8KA 2P3IA 3E5QA 1WCDJ 1ZBA3 3VGIA 2JDMA 1FNZA 4Q0SA 4PHZA 3ZFEC 3ZSMA 4UT5A 3OD4A 4BXSV 4AE2A 1Y9GA 2DU1A 3OD0A 4LHLA 3J7MA 3H42B 1AR81 1RYYA 4LEJA 5A6QA 2FCTA 3C3VA 2YMZA 3KM5A 2BNNA 4V1PA 4YG6A 5FV3A 4MHRA 2YC4A 5BNOB 5CAZA 3MBWA 3OSDA 4NAMA 2ZGRA 1O3QA 1H8TA 1OD5A 4MGKE 1KD7A 1VE0A 1X33A 5HXVA 2D6PA 3HNBM 1AYM2 5A32B 2O8QA 3ZLIA 4OMCA 5FYUA 3B9IA 5FPVA 5FZ3A 3UETA 2Y38A 5C3SA 1JHNA 1HLCA 3SLIA 2V4VA 4P5YA 4JTOA 4EJRA 5FP7A 2Y6JA 1RC6A 1W0OA 2GH8A 4J1XA 4NJ4A 1V6KA 1W9SA 4LKDA 3ZSLA 2IXJA 5A6YA 4XC9A 3N7LA 3KLSA 2HYXA 4CP9A 1XYNA 1QWRA 2BZDA 2PHDA 3NKTA 1TMF1 4XFHA 5FZOB 1ASJ1 4OQ9A 5EIYB 1WLWA 5FBZA 1UOFA 3HWJA 4QKNA 4ES9A 2PMWB 3Q8FA 2XJUA 1AR92 2DBNA 2E32A 2FD8A 3I54A 2IXKA 5A7SA 4K3UA 1RUJ1 2JDUA 3BB6A 5SV8A 1OOPB 2EIBA 1DZQA 4LKFA 4UFMA 4LBQA 3POGA 3GGLA 4MXWB 3USUA 1LRHA 1MZ5A 5K7PA 1JH5A 1KITA 3I2IA 3SCFA 5J3UA 2VOKA 4ARXA 3KZ4C 3OUHA 2GMEA 5FY7A 2VMIA 3VN4A 4LOTA 2JENA 3APBA 3IBMA 4JHTA 4BISA 1AL21 3BALA 4O9EA 4YYOA 3WT3A 4E27A 2W46A 3WHUA 3ZN4A 1BQPA 1F2NA 2EICA 1JZ6A 4LIUA 3KVBA 2UY8A 4C90A 5B4NA 5IT6A 1CAXB 1RUI1 4FP3A 2GP5A 2OKXA 1PO22 1O91A 1UZZA 4YW3A 4LK7A 3ZXKA 1DGRA 3VL8A 1LOBA 2G19A 1ZRDA 1B09A 3CF6E 3KSCA 4HSJA 5FP8A 1FMD2 2QDNA 5JAXA 1JBCA 4MGYE 1RJ8A 2GMPA 2ZEZA 4CE8A 1BJQA 4QDQA 4DFSA 4XCBA 2R041 4IV1A 1VALA 1CPMA 1WW7A 1BEV3 2ZXQA 2BEOA 4S2GA 4AL9A 4S2HA 3I3BA 3BU7A 3AYCA 1UQXA 3H1WA 4NIHA 3ECQA 4QWNA 1Y9MA 5KXBA 2VUAA 3MFAA 1UZYA 4FPGA 4V2VA 5DAVA 2GMMA 3UJOA 1M4WA 2XWJB 5FR3A 1UMIA 3MO4A 1EPWA 1JTZX 4FPHA 1HIXA 3HNMA 5IVFA 1RUC1 1AR93 3CLPA 4IE0A 1DU3D 4YGEA 4CDUB 1XNBA 4CCMA 1VRBA 1GP4A 1PO11 5LA0A 2ATFA 4RR3B 3N3HA 3JQXA 2WZPP 4ZXEA 4NE9A 2DCZA 4J25A 4E4SA 3T0DA 4NHLA 4NOTA 1AR82 1N1VA 3C2UA 1OKOA 3WDYA 2CNAA 5L7OA 3PUIA 4QQLA 3MZHA 2Q1FA 5JOZA 5C3PA 4UAPA 1L3JA 2BRTA 2UYBA 5DUXA 3KCYA 4YZ1A 4HXCA 2KD7A 3AB0A 3VBSA 3NKGA 4HSLA 4F7ZA 3EO6A 5H9PA 2QBXA 1SLCA 4A41A 1W6OA 4QGMA 2A3XA 5ABJA 1PO23 2ZHKA 5FY9A 4R4XA 1Q8PA 2W08A 5FYZA 2BUKA 2XLAA 2W68A 3LE0A 1IGOA 4IV3B 3OG2A 1QJX1 1UD1A 2NN8A 4Z07A 5EHDA 1W9YA 2ORXA 3AZVA 1X7NA 4MZUA 4QKDA 1VBE2 4AFCA 4R9CA 4CDXB 2IC1A 1EUUA 4QXHA 4BA6A 1UKGA 2C24A 3ELNA 3RDIA 3WX5A 2GP3A 1IHMA 4LLOA 3UKNA 4A7ZA 1D0HA 3KCXA 5BY5A 2ZMKA 3CIHA 3IDCB 4Q29A 5FZBA 1GYKA 1JHJA 3OF1A 3VZNA 2XKPA 3PHMA 1R092 1V6LA 2IUWA 3JXSA 4AI8A 1QXJA 2C0ZA 2VCAA 4COZA 4FVVA 5IW0A 3IIIA 3J8F3 1UY4A 2DVAA 1CQ9A 3WEZA 2VCBA 2IXLA 4PF5A 2XVKA 4QPWA 1UMHA 1LCLA 1ODNA 3IIAA 4QPGB 3C7OA 3JB4C 4AAXA 3AMMA 2QUOA 5FBJA 5H9QA 4LOSA 1CWPA 3VKFC 2WWJA 1CZTA 3LFMA 4OUSA 3WUDA 1LU1A 4YFWA 4ZXKA 5K0UB 4IL7A 1CESA 2CGNA 4AFAA 4RQPC 2UU8A 3NNMA 4GJZA 1RUI2 4LTAA 5IAXA 1W0PA 1C1FA 5KBFA 2A71A 1YUDA 2VCCA 3KMHA 4H55A 2PAEA 3VV1A 1D7PM 5LASA 5GKAC 4HETA 4NR1A 4LE3A 1R082 2ZPXA 5GZCA 3LQCA 3A23A 5FKBA 1NE6A 3WDVA 1LHVA 3ETQA 3OEBA 3WG1A 4CPBA 3SEEA 3VZKA 4BXFA 1PZ8A 4P9XA 5C3QA 2AC1A 2P6CA 3MPPG 3HMYA 1U5ZA 3NAPC 4QM9A 5C8CA 5IK7A 4RGGA 4YG0A 3ZIWA 1OI6A 4CDUC 1J3RA 2R042 3N35A 2RV9A 3AYDA 4P9JA 5BXXA 4BQ3A 4CU7A 1VBE3 2JG8A 4RFT0 4G4FA 4RR3C 4EN9B 3O1SA 2VUDA 2D98A 2G4IA 2VXJA 3FLRA 4QD2A 1H9WA 1H1IA 5BPXA 4IQPA 5IVCA 3O0XA 3THPA 4YFZA 5A3OA 3FMGA 4YLZA 1GICA 3ALQA 1LOEA 4DRVA 5K9YA 2PA7A 1R093 1S0DA 3O1MA 1RUC2 2RVAA 3NJZA 3POJA 3CMGA 4UW4A 1YI7A 1UYYA 1PO12 4GA9A 4X8PA 1WW4A 2X53S 2YBKA 2NPIA 3MW4A 1L7LA 4FOQA 5DDJ1 4GMP0 4M00A 2VCMA 2WZR1 3AL5A 4Z82A 2LS6A 5LA2A 3RYKA 1PNGA 4D6RA 1N47A 3QH7A 1NCRA 4EZ4A 1OKQA 2D3RA 1MEC1 1AUYA 1S2EA 4CDXC 1ZRCA 1DGRN 4D6QA 4Q4V2 5FYYA 3GJAA 3V65A 1UW8A 4AEMA 2Z2SB 2BW8A 1UWWA 3ZYIB 1O8SA 3D8CA 4D69A 3UESA 3ZPOA 4CDWA 5F37A 5LWBA 2ZEXA 1DYPA 2D93A 2XJQA 4E9KA 3USSA 5A3NA 1JU3A 5CBLA 4OHXA 1TQ5A 3MDPA 4AVVA 3KD4A 1QXRA 3IN9A 3N7MA 1R083 3VDDA 5KXDA 5A1FA 1OUSA 4EN0A 1LR5A 3SNMA 4CCNA 3WF4A 5C4WC 5I0RA 1UXXX 3IDAA 1QJZA 2AACA 4MVTA 3DYOA 5BNOA 4E2GA 2RS31 1UNBA 4QM8A 1GWLA 3IT8A 3VBOB 1JZ7A 4WZCA 1HKDA 2F17A 1HB4A 3LFIA 1BK1A 1EAH1 4Q4W3 5FZMA 3RS6A 4CEYC 5T52A 4L99A 2XQRA 4BMBA 1GOGA 2UY9A 2YU1A 3J7LA 4XUPA 5JSPA 4TYSA 3VZLA 4YM3A 3H7YA 1LHUA 1RUC3 4OLLA 3S7IA 5H9SA 1V6IA 1CJDA 1DBNA 1RXFA 3KT4A 1PO13 3OB8A 2GNMA 5A1AA 1RJ7A 2VBDA 4JC1A 3HBZA 3UGFA 4TWTA 1HQLA 3WVJA 5DABA 3PVNA 5FP3A 2NP0A 4QX5A 3LEIA 3AYAA 1AX2A 5LRRA 4P9GA 5IYYA 5JR7B 1OLMA 1OOPA 1GZ9A 4Q4V3 1MS3A 1RUG2 3OEAA 4MXWA 2QQPA 3U4XA 4FPCA 5HI0A 3RZGA 5FY5A 2E26A 4JDMA 4AFDA 2YPDA 2JIJA 2PHXA 5GALA 3TRSB 2ZAHA 3LF7A 2KR2A 4OYUA 2OPWA 5C5UA 4UW5A 1JYNA 4LA2A 4URTA 2VMCA 4ISQA 3NV3A 3LSEA 4W6WA 3EJKA 2ET7A 4K1YA 5HCHA 2BGCA 2ZAAA 2W92A 3CNAA 4IDZA 5LATA 3T2OA 2HWB1 1CAXA 2CL2A 1S0CA 1SHWB 1PGL1 3P1IA 1C8NA 2C9AA 1ALYA 4XF1A 5FFOC 2WNVB 3H1MA 2H0BA 3I3EA 3R6SA 4IEXA 1ULPA 3WW2A 5KXEA 4YM1A 2VTXA 1LEMA 2G9GA 2VQ0A 4XTMA 1J59A 5CFDC 5FRAA 3B69A 4BM8A 2E53A 2VZVA 2XHKA 1ST8A 1NLQA 1B35B 5FPAA 3DV8A 4A45A 3RZJA 4WM7A 1Q8VA 2EAKA 2R072 3A0NA 4ZHNA 4AQ2A 2OX0A 3ZKYA 1JZ8A 3TWIA 2HEWF 1O59A 3E1F1 5FYSA 3WY6A 1AXYA 1MVQA 4LQRA 4XVHA 4K9SA 5DDJ2 3MLKA 1W2NA 4N9HA 3H50A 2B46X 4XAAA 2JECA 1GV9A 1RHI3 3LAGA 4Y1YA 5KHHA 2XVGA 4GB31 1LOCA 2UWBA 4DB5A 1G9FA 3VBOC 4F3JA 4KBBA 1H8TB 2ZGUA 2ZJCA 3ABZA 3NNJA 4XUTA 1R1A2 5JZGB 1RUG3 2X10A 4DUWA 4EN7B 3VBRA 2OVUA 4XACA 4XFFA 1AYN2 1TME1 2RDRA 4TXWA 5DZFA 1UOBA 4L0PA 4ZY9A 5F39A 1LJ7A 1VP6A 4CXYA 2TBVA 5LY2A 4FPJA 1A34A 1JYTA 4KNCA 5FLHA 2W47A 3BKZA 3LWCA 1HN0A 1NCQC 2B8MA 1WCUA 2RS32 3RRDA 4PDWB 2W1SA 5FZ8A 3ZXAC 4CP9B 4C91A 4KQ7A 2DBIA 3CQOA 1EAH2 1FT9A 2QQMA 2NYYA 5CG9A 3MIFA 4HVRA 1LOGA 1Y7BA 2VZ3A 2WN2A 2RDQA 4MGIE 4IV3A 1YQ8A 3MHZA 3GXUA 2EIEA 2PELA 5CEHA 4KU8A 5HCBA 2JKBA 4LBQB 4LHKA 3VKNA 4LT5A 3USUB 4IGQA 1ZBE1 1Q56A 5F1RA 1J58A 2R073 2EVXA 4AHWA 1OURA 2HWD1 3VUOA 2E7TA 1GOFA 1NAEA 2K2SA 4CCOA 4AVSA 3RPQA 4Z8BA 2P37A 1UKRA 2PQQA 3R0RA 2BQPA 5FOBB 1J3QA 2ID4A 2VUJA 4MGZE 3ACGA 4WVWA 3LSDA 1QJU2 4M4RA 4Y20A 3V0AA 3SEPA 3WG3A 5CNAA 1REDA 1BKZA 1ZBA1 1WLDA 3NRUA 2P34A 3LZZA 5FIXA 4AYUA 5JCTA 1BLZA 1HJFA 1OLME 3PVOA 3CDZB 1MACA 2E51A 3A22A 3AC0A 1UL9A 3AJZA 2J7MA 1V70A 1VRH3 1W39A 2ZGOA 1R1A3 3CKHA 3FUQA 4I02A 4K8FA 4QX2A 4ZU5A 3ZVXA 4DNYA 1U5IA 2ZHNA 4IESA 1AYN3 1TNFA 1D4VB 2DDUA 4X6RB 5K0UA 2YG0A 1JMUB 1I3HA 4G9SB 1NYWA 4Q4X3 4XDPA 4FPYA 5IVYA 4COVA 5JWPA 4MUVA 3LEKA 1PGL2 1GBGA 3PIJA 1O4YA 2QQVA 3ZYJB 4PIZA 1PZ9A 4B7KA 4XJ8A 1KS5A 2VMGA 3W5MA 4FPKA 4LBJA 1OH3A 3ZYBA 3ZX7A 4W65A 2FCVA 4B1LA 1I5PA 5FZKA 2JE7A 3SCGA 5HXMA 2VD7A 1QH6A 1VLNA 4XTPA 1SG3A 2BOIA 1EAH3 3WF2A 3MIEA 2DURA 2E31A 1CAUB 1MVEA 1YI9A 1KQRA 4YW6A 3BI3A 3D0SA 3LOBA 4NRPA 2PHTA 3GZAA 4U36A 2VE1A 1SMVA 2G9ZA 3N9PA 2HWF2 4PI0A 2C4XA 1F8VA 2ZABA 5FWJA 2Y34A 3A21A 1URXA 4I3PA 5EJ1B 1CAVA 4LORA 4DY3A 2VAUA 5LBBA 2XUMA 5HCFA 1QJU3 3U75A 4GB32 4C0BA 2DU0A 3W59A 3R4UA 5KC6A 1C28A 1YNAA 3QOPA 5DUWA 5FXWA 1W6OB 4LBOA 4NROA 5ABJB 4Q0PA 3KT7A 1REEA 2ZS6B 1RUH3 4XBNA 4EWDA 2XMLA 1RUNA 1TME2 1SFYA 3OJBA 2WNEA 4QDSA 1U12A 4RL7A 3LEMA 2WWUA 5J48A 4FBFA 2WSVA 2A3WA 4BOWA 1ULGA 4KMQA 4P00B 1IG3A 3TNPB 4FXGB 2VOWA 2ZKNA 2K0GA 4NUBA 4IEVA 1VAKA 4P9IA 1Z7S1 3M3EA 4BB3A 1NKGA 2YUEA 2ZGTA 4LLFA 5LCWL 4OQ8A 1EV12 5F3EA 5FZ6A 3T30A 3MICA 4LR4A 4BIOA 1TZOA 5F5QA 3VBFC 2A3YA 4MO3M 4YSFA 1KRIA 1F35A 5CYYA 4Y3OA 1BEV1 4CTEA 1OD3A 1VIWB 1ZX5A 2D5HA 2LTNA 1WKYA 4LO4B 4AGVA 3H3UA 1W0NA 4E4DX 1H9PA 4AGGA 1F15A 1SBFA 2SLIA 1UIKA 2XBO3 2ZTNA 4E2QA 1ZM1A 5BV6A 1YFUA 3AKSA 5LB6A 4KWKA 3ZIXA 2HWF3 4AG4A 2ORZA 1AR91 5JMOA 4ORFA 4IV1C 1XNKA 2A5ZA 3H8UA 2VNGA 3VZMA 5I93A 2WLPA 1MQTA 1T2XA 3E5XA 1ZZBA 5T5JA 1W9FA 1WMFA 1N1TA 4M01A 4Z2WA 1TVGA 3C7EA 4AAPA 5HV0A 2XGXA 1JZ4A 2Y8KA 1KDKA 4AEKA 3RQ0A 3ZMOA 3AKPA 4BCUA 1R64A 1OA2A 4GWIA 5IVEA 3ASIA 2ENRA 4FFFA 1HV1A 3M1HA 3WOGA 1AVBA 2UWAA 3ZR6A 2JG8B 1PO21 2OXBA 2VZSA 1XPWA 4AR2A 2XJSA 1AX1A 4L2NA 5LK5A 1Q43A 2OT7A 2JDKA 1SCRA 4YZ3A 3UT0A 4QKFA 3O0WA 3WP5A 1S0JA 1RUD2 1EV13 1OC1A 2JG9C 3VBSC 2ZX2A 5KHGA 1EY2A 5JSRA 2NMOA 3VD3A 1CGPA 2DUPA 2GALA 4IE4A 2BJSA 4IE6A 4YW2A 2DCKA 4PIXA 2Y6FA 3JCIA 4MH0E 3NJVA 1SLBA 5FPZA 5IHRA 5C71A 3AYEA 2GDFA 4INDA 4IETA 3AMQA 3J26N 3LA2A 4LKEA 1NCRB 5GZDA 3PUHA 4AI1A 5F2SA 3J8F1 1A8MA 1QDCA 4A44A 4CU9A 3BTXA 2HH9A 1DQ1A 4A7YA 1E5HA 1PHMA 3AP7A 5IWFA 3H8RA 2WQZC 3WNXA 4CDWB 4DIQA 2FBEA 4NHMA 4HLTA 4BDVB 3MI8A 3HN1A 3VKMA 3RYPA 1CIWA 3FHAA 2WQ4A 3FFZA 5FUNA 2K9ZA 2XDVA 3E6CC 1GQHA 1MS9A 2BNOA 4A6OA 1ND3B 2JICA 1ZREA 1OHFA 3VDDB 5CADA 1QEXA 2R16A 3KB5A 1N3PA 2HWE2 4OCTA 5GM0A 3D3AA 1IKQA 4NPLA 2VOXA 3HOBA 1COV3 4XF3A 5KR7A 3ZDSA 4MOAA 5FZ9A 1UCXA 1SBEA 4FXKB 3SH5A 1PZ7A 2VULA 2VMFA 3MV01 1FPN3 2BP6A 2RHPA 1NQDA 3BTAA 3JZVA 2JE8A 4R9DA 3WNNA 1Z7S2 3EHKA 3ZPYA 4CA9A 5JZGA 2BVBA 1O4TA 1MS1A 2DF7A 2QCSB 3KF3A 5JXJA 2PAKA 1HX6A 1ZVFA 3ST7A 1IQDC 2TNFA 4XDOA 1BEV2 1VBD3 4UBGA 4UYBA 1VBE1 4K20A 2DVBA 1RUD3 1HB2A 3NV1A 1XOYA 4WZFA 3ZYHA 4N53B 5JOXA 4JCKA 3A0KA 1I9RA 1GQGA 1OLRA 5BNNB 4PDWA 3VD4A 4BQ5A 1HRV3 3EYPA 3MEPA 1DQ0A 2HEYF 2A73B 4P5HA 1R091 5C8CC 1O5UA 3LEGA 1H4HA 3O1OA 2AH2A 2JG8C 3OY8B 1SQ4A 5JUVA 2DUOA 3N4MA 4QQ2A 2VMEA 3AZYA 4JDOA 1BCXA 2YC0A 2QQIA 4YNIA 4IGPA 1YCIA 4CU6A 5FCCA 1G9CA 1VBA2 4YZ4A 4AHXA 4ET7A 1QIQA 1UY1A 2P1BA 2RS52 4X8NA 5C33A 1U5XA 4LBQD 1E5RA 4H2AA 1MZFA 2HWE3 5IK8A 1DQ4A 2CYFA 2LRPA 4PQ9A 3LDKA 1H6YA 3ILFA 1QH7A 3RYRA 2J1SA 1BBT2 4OZXA 1AZDA 1W8FA 1R081 3AMNA 4P14A 1HB1A 5F5IA 2AUYA 2R7EB 5G05L 2XL7A 1Z7S3 4I3GA 1ENSA 4CUCA 5FPLA 3NJYA 4R9AA 3JD72 4KWJA 4WM7B 1WMDA 2VZQA 3AXEA 4Q1RA 4CDWC 1WCSA 4WVMA 2GC3A 2JWPA 1F4AA 3MW3A 2C26A 4Q4W1 4GWNA 1LECA 1XRUA 1HW5A 4P9WA 4AEJA 1IOAA 1HV0A 1IPKA 1SFNA 5C3OA 4ZU7A 3VD9A 3BODA 3S5AA 4XAEA 2EALA 3VDDC 2OA2A 4JGYA 2RG4A 4UFLA 4LBMA 3J8F2 3VZOA 3U14A 4QQOA 3VDAA 1ZRFA 1CAUA 3W20A 5BNOC 4O61A 1WMEA 1VMHA 4ZZ5A 4YW5A 2Y60A 1XU2A 1W06A 3GF6A 5CKNA 3EXUA 4YGBA 1NLRA 4BQ4A 2FDIA 3I97A 3VBRB 4CVUA 1K5MA 1IS3A 3NVCA 1LGCA 5FZDA 2XKOA 1CONA 3ZXEA 3VKOA 1VBA3 2QZ2A 2WQ8A 4JDNA 5L9RA 3HJRA 2H6CA 3MIDA 1AL0G 4Q4V1 1RINA 1V0AA 2RS53 3QLQA 3VBUA 4BYYA 4KG0A 5DXDA 4BLIA 4R52A 3VHNA 5JOYA 1OSGA 5GJ6A 4NHYA 2AZ5A 4DUVA 3JU9A 4IEPA 2QQKA 4RS5A 1UOJA 2BBVA 1BBT3 3FBYA 1ONAA 2IXCA 2QTWB 4EV0A 4JKKA 1JYXA 1D4M3 3J4UH 1RUE2 1OOPC 1SPPB 4W6XA 3POIA 3E6BA 1RGSA 1LAJA 3OBTA 2XWBB 1DQ5A 1DFQA 1V9U2 3CU7A 3JD73 4XJ9A 3M8LA 5D1IA 4QQHA 2CAVA 3Q8BA 2GNDA 5F3IA 2J1TA 2VH9A 3PNAA 5ACA2 1W28A 2W94A 2VW2A 2IVIB 1KFXL 3LPFA 3CZJA 2R32A 2WFF2 3IDEA 4TLFA 5F6LB 4OUMA 2B5HA 1G9BA 5LBFA 4Y20B 3V0AB 1YQ2A 3O5SA 4OULA 1VAMA 2GN7A 1C1LA 1JUHA 2YFZA 4YVWB 3DL3A 5EFUA 5I0SA 3B01A 2YFUA 2P6HA 1XYPA 2WBKA 5ANNA 2VW1A 2RM22 3ZYRA 4Q1PA 5FZ4A 5IVJA 2B39A 1I6XA 5A3PA 3T3YA 1N1SA 1XB9A 1AR72 1O7FA 2VUCA 4CUAA 1O3RA 3LDRA 1RHI1 2XLFA 3D5OA 4YWAA 1AXKA 4MYEA 4RGKA 3V0BA 1UPIA 1ENXA 2CWMA 2VZRA 3ZFEA 4K6BA 4DUXA 4FCAA 4CP2A 5FJKA 1PK6A 2P17A 1OLQA 3C8XA 4UWDA 1QOTA 4LHSA 2YU2A 4HZFA 4COUA 5F6KA 1UYPA 2JE9A 1RUG1 1IPSA 2ZGQA 5LA1A 2WA4A 1QY4A 3U1XA 5A1LA 3ZYGA 4AZZA 1QMJA 1FXZA 5CZKA 2VXRA 2Q1MA 2VECA 5FMOL 3TYJA 3BYWA 4C8DA 3P3PA 2ARXA 4EN8B 1UY2A 1C5IA 4M0NA 1S55A 3PVEA 2GNTA 3ES1A 2F6BA 2Y64A 1RUE3 3PTRB 4RN5A 4Q4W2 1H2NA 3K51A 3VBRC 1V9U3 4BLJA 1A8DA 4CPBD 1UAIA 3FE5A 4LIVA 5A3UA 2ZX1A 4GWJA 1ND2A 4TZDA 2JEMA 3POYA 2VVEA 4ZU4A 5ACA3 5JR2A 2FQPA 4RFRB 1CAVB 1NY72 2WFF3 2Z42A 2Z69A 5E89A 5L7OB 2D6NA 1X36A 2R071 2VW0A 3OGVA 4B3NA 4P9LA 1LKNA 2MNGA 4NIGA 4I01A 1NUKA 3MIHA 1XXNA 2RJLA 1GWKA 3N7JA 4D0QA 1EP0A 3BOPA 2RM23 4M0HA 3DYPA 4BWOA 4E4HA 1KEXA 2DFBA 2VZTA 4XUOA 3K48A 3OYWA 5FZIA 4IV3C 2VBPA 1PMJX 3LA3A 1AXZA 1H2MA 1AR73 3QACA 4QB6A 2WABA 1SEFA 4QQPA 4D7SA 5C7GA 1WW5A 4WVVA 2OUJA 3H8OA 3G6JB 1DIWA 2DVFA 1RUF2 2K46A 2DTYA 2YGMA 4NAOA 1NXD1 2AEYA 2FMYA 1HJGA 4KBZA 1OXCA 5A7PA 4K1ZA 4CRQA 4CU8A 3O1UA 4MX3A 2I45A 2FMDA 1JI6A 1SZBA 1VRH1 1R1A1 4LBLA 1BVVA 2WS92 1SBDA 2BFUL 3GYDA 1LNSA 4RHV3 2WFPA 1AYN1 5J1XA 1ND3A 1W6PB 3NNGA 4FOYA 4Q4X1 1DCSA 4XYXA 4TLGA 3BPSA 4HBNA 5FZHA 3O12A 2SBAA 5GZEA 1W90A 4CCJA 1ZZCA 2FDHA 2WNUA 1AX0A 1DYOA 3WNOA 2FDGA 4BZ4A 5G04L 4QPGC 3I3QA 3OBRA 1WLTA 2ARAA 4OI1A 3TNQA 2J1RA 1OF3A 2LUWA 2C6SA 2Y26A 4S2DA 4QX8A 3KV4A 3EB7A 3SC7X 1QOOA 3UV9A 2E6VA 4XFGA 1E5SA 1NA1A 5FO8B 5K0UC 5T54A 5GZFA 5A3LA 1YQCA 2R6QA 2WWSA 4QPIB 3ZXJA 2A6VA 3P6BA 1J1TA 4B8EA 5F5CA 4HVQA 1ZRRA 4N53A 1MQTB 5JVVA 2BBAA 2VL4A 2PXJA 3AZWA 4K8RB 5BNNA 2UYAA 4FO9A 1ZA7A 3AXDA 2L9LA 3N9NA 1K3IA 2WDBA 2R062 3MF6A 1RHI2 3K3NA 5JMCA 2B7YA 4AEDB 1IS5A 1K42A 5C5TA 1QJU1 4PT6A 3AJYA 1HRI3 4AF9A 3O1TA 1LHOA 4Q27A 3PURA 4JRLA 4ARYA 1ULOA 3MFCA 1UZVA 4YW4A 4LK6A 1V6MA 3BU0A 3OY8A 1FI2A 1RUH1 1RUF3 2BV4A 1QJY1 3M3OA 4H3WA 3W58A 4KGGA 3M3IA 1W8ZA 1OPMA 4OHZA 5DAQA 3FC0A 2VVDA 2YV8A 3IDBB 5T5OA 3UK9A 2VU9A 5GZGA 1W8WA 4CEWB 1U5YA 2WS93 1LESA 4BK4A 1KFUL 3FLTA 3N36A 4CDQA 5I8TA 5J37A 3ZXFA 1JOPA 4FAHA 4XMIA 3MYXA 4XFIA 4HOOA 5D8AB 4TTGA 2VPVA 5FLIA 3PL0A 1PMHX 1W8OA 2ZGSA 3H0OA 4ITCA 5BNPB 1Y43B 1UN1A 2A6YA 2WINB 3ES4A 2GC2A 4UW3A 4NN0A 4LMFA 1UYXA 2VNRA 3ZSJA 1V6NA 3AX4A 5JOWA 4GH4B 1RL3A 2X5IA 3V64A 1UIJA 3ZXGA 2AR6A 1JS9A 4ZONA 4BK5A 1J3PA 1RVF2 3MUY1 3BUCA 2ARCA 2NQYA 4XUQA 3OTFA 2ZX0A 5M0TA 4QDRA 2WRAA 2XBO1 5A7NA 3ZN6A 1GR3A 1DLCA 1PVC1 3TEZA 4D7TA 2HWF1 1RMU3 3HBKA 1CVNA 1MZ6A 2WLQA 3DXTA 4N7IA 1K45A 5AVPA 5FY8A 1IPJA 1KJLA 5JI7A 4DEVA 5JPMB 4HL0A 4QXKA 2BYVE 3KQRA 2WO1A 3DCQA 3RMYA 1STMA 4XCAA 3VD7A 1UX7A 2W95A 2R063 3PDQA 3T08A 3DPRA 4PBPA 1QNYA 1CZVA 2BGOA 2EXIA 1H2KA 2OZJA 2R1DA 2RS12 3DN7A 4I0BA 4LBNA 3ZFGB 2HWC3 3I2KA 4LA3A 4L11A 3NNLA 2ZHMA 1FYUA 1VRH2 3OGGA 3LKJA 5C9AB 1VMJA 4MGSA 4GAZA 4LXLA 4NHXA 4O65A 4PCRA 5FMDA 3I2HA 1GFF2 5A7WB 1AJOA 3HD8B 2P3KA 1SFPA 2JDYA 3HR9A 3I59A 4Q4X2 4WM8B 1WW6A 5DUUA 5EV7A 2G9FA 4LBKA 4DXSA 3S57A 1LGNA 3C7GA 4DXTA 4PLOA 1MQTC 1ULFA 1LODA 1N1YA 2VQAA 2BNMA 3OPWA 4HN1A 1GZWB 2Q30A 3GBFA 4L8QA 4O7XA 4YVSB 1GNHA 1JZ2A 5DAPA 2HYKA 1XYOA 2VTXJ 1EV11 3ILRA 3ZSKA 4CP1A 2VMDA 1YHFA 3FHQA 1Q5OA 2O1QA 3B3QE 2RMU2 3HT1A 5CU1A 4QX3A 4QHZA 3AK0A 1SPPA 5FXZA 2CDOA 2CHHA 2JXAA 2WL1A 4KWLA 3GZEA 4NIIA 2CWSA 1RVF3 1NXMA 1JOJA 3O14A 5KXCA 3TBDA 2W39A 1N3QA 3OGRA 4HVOA 3ITQA 1APNA 3WNLA 4FTBA 3PMEA 1M06G 5FPBA 3WNKA 3T2PA 1HN1A 4UFKA 4K7JA 5LEJA 3ON7A 4M3CB 2BOJA 1V6OA 4QB2A 4YVWA 2YXSA 3IPVB 3RGBA 2YZ4A 5J98B 4AHZA 2WSUA 3S6PA 2WNVC 5GLVA 3M3CA 5FZCA 4Z92B 4QHOA 2NLRA 4I0AA 2W52A 2LROA 1RUH2 3OGJA 1QJY2 4XXAA 3CJXA 1CIYA 1BHGA 2DVGA 2RS13 1VPHA 1Y4WA 2QNKA 3THTA 4D94A 4P02B 2FHRA 3I3DA 2Y33A 1KDMA 1BXHA 4PF1A 5IJRA 1B35C 2EXKA 5F9TA 1COV1 1XNCA 4HKOA 2MPFA 1DGLA 4NVPA 5FZ7A 2PN5A 1AR63 1Z78A 5LK7B 5LW9A 3F2ZA 5FYIA 3NV2A 4MHUA 4KH9A 4URAA 1WA6X 2NZ9A 4WVMB 3ZFFA 5HV4A 1DF0A 1FPN1 3KF5A 3WDXA 1HDKA 1OH4A 3LCPA 2O0OA 3K77A 4KL1A 2F4PA 4QU1A 1Z0HA 3VHRA 3WHTA 3O7OA 3RVHA 3T0BA 5C6CA 2DVDA 4JGYB 1VBD1 2JIGA 4XQWA 3TB0A 3VBHB 3WF3A 1RUD1 4HONA 3GZTB 5JIAA 3HPNA 1DQ6A 1OQ1A 5GLWA 2QQNA 4DINB 2RMU3 4Y22B 2D44A 4NRQA 3WINE 4META 5FO9B 1H8TC 1OF4A 4CEYA 1HRV1 2NMNA 1LULA 2IFWA 5JZGC 2XBO2 3AKRA 3Q8EA 5E8AA 1PVC2 2VNOA 1O6UA 1K5MB 3LB9A 1VBC3 2FDKA 2WYSA 2W87A 5EYYA 3SMHA 4NHKA 1DDLA 4YARA 2DWRA 4IEQA 4M3CF 3NNFA 4XIOA 1SDWA 2ZZQA 5FYTA 5FZEA 1HXS3 5D2AA 1PNFA 5JXHA 3VBUB 2LW8A 3IZOA 3MPBA 2D3PA 1O4ZA 3JUUA 4I09A 4PDWC 3BTYA 5AC93 1POV3 3AFKA 1KXGA 1WD4A 3JBG3 1WBLA 5C3RA 1VAVA 4FFHA 2CSGA 4ZZ8A 1W8NA 2BGPA 2CGOA 3HN3A 4RS5B 4XHBA 3NJXA 5T50A 1JYWA 1QJY3 5IFTA 4L9BA 3IM0A 4IEZA 1W2OA 1C4RA 4JZRA 3R05A 2XJRA 2HWE1 1UPSA 1OVPA 4A3XA 4UF0A 1NZCA 5CKQA 1A6CA 1QJEA 5I0TA 5A3WA 4XQ4A 5IAVA 2D40A 2HKXA 3AFGA 2ZGLA 4XPVA 3POWA 5J96B 4O9GA 3PUQA 2D6OX 1EPZA 2JJ6A 2XJTA 5FAXA 5FK7A 3N9QA 2P3YA 1S0FA 3BPZA 3NMBA 3ZM8A 3ACLA 3KQ4B 4JKLA 2QQOA 1ODMA 1W6PA 3SH3A 3WSOA 2YBPA 3T4VA 1G9DA 3S7EA 1W6MB 3WCSA 3KHCA 1J1LA 2ZGNA 1FNYA 2CDPA 2VM9A 4Y1UA 4G3YC 5F3GA 3SXWA 3T2TA 4ZS3A 5LY1A 1Y3TA 3WP6A 3PIGA 3AM2A 3HEIA 3AP5A 4GULA 4EWEA 1PVC3 4IE7A 3V0BB 1QU0A 2E33A 3URFA 1VBB2 3ZFEB 1LOFA 4QPIA 3NQHA 2C9KA 5FUPA 1PK6B 1ZYBA 1W03A 1YJKA 4Q4Y2 4QMAA 4HG6B 1KGYA 2W1UA 4YPJA 1V00A 2D6LX 1ENQA 1CX4A 1YXWA 3OOXA 4PLNA 4UW6A 1ULCA 4HMZA 4JGYC 1VBA1 2JD4A 2P5BA 1DZTA 3I4IA 1VMFA 1H6XA 2GSYA 2VBBA 2UURA 3OBZA 2P4EA 4AVTA 4AW7A 4AEDA 3B00A 4Z1VA 1COV2 1SDDB 1XE8A 2RS51 4QAWA 4XJUA 1MPXA 5CISA 4ZPIA 3FZ3A 5BUVA 4IUGA 4W50A 4WV8A 3MLLA 2EAAA 1NLSA 1W8TA 1FPN2 3PU8A 3VLBB 4DO0A 2WR9A 1SLTA 4IERA 1SACA 3CJIA 1BBT1 1GWMA 3B94A 1K5MC 4FFGA 4XJZA 4DQAA 1YQ6A 1S4CA 2RR12 2XLGA 3K3OA 4ES8A 3IKWA 3MF9A 1ND2B 1D4M1 4XURA 1VBD2 3WG2A 4XILA 2PTMA 1JOBA 1PIV2 2Y0OA 3G7DA 1JYIA 4CEWA 1FX5A 5E16A 4J1WA 1NX9A 3JD71 3VBUC 4HK9A 2XXZA 1W3XA 2CTVA 3H1YA 1MS5A 2ADDA 2QDRA 1T6BX 5D8AA 1GQPA 3KV6A 5ABJC 1HRV2 3T2QA 3UKTA 3RWKX 3WW4A 4RS5C 4CCKA 5C8WA 3ACFA 5AFBA 4TN7A 2OPKA 5BNPA 4OUEA 1S0IA 1S0EA 1UMZA 4XABA 4EE2A 4EROA 5BNQA 5JSOA 3D4KA 3LOIA 1O8PA 3OYWB 3Q9OA 4JGZA 5DZGA 3BIEA 1UU5A 4XFBA 3H8XA 5FTTC 2QJVA 1C8M2 5FZ0A 1CN1A 1H0BA 2JDPA 4GH4A 4ISRA 4BQ1A 5FO7B 4Y4RA 4A7KA 1WZXA 3WZ1A 2ZZJA 4AWDA 3RJRA 2Y6GA 5EXOA 4FTSA 4LJHA 4MV2A 1VBB3 1WD3A 4MSVA 1H1MA 2Q0AA 4Q4Y3 5FQ0A 3N9OA 3TAYA 2JDZA 4XHXA 2Y6LA 3WQ7A 4CUBA 1CAWB 1MR5A 2ERFA 3KV9A 1R1ZA 5CA6A 5DPNA 4QKBA 5BYNA 5I91A 3WDUA 3HQUA 1XJAA 1ZZ9A 1LU2A 2G1MA 3GHNA 4UOJA 4TSVA 3POSA 1QNWA 3WQ0A 1JYCA 3WW1A 5J09A 2PLV2 2YYOA 2B45X 2GH2A 3OBAA 3S30A 2WNUB 3HQRA 2QQWA 4LE4A 2PAMA 3ZFGA 3U10A 1FOD2 2W9XA 1GU3A 2Y6KA 2VC9A 4B4QA 5C9AA 4BQYA 3MIGA 2QKDA 4SLIA 4Q0QA 3I7DA 3I2DA 5A7WA 1W99A 1J84A 4B1MA 1NA1B 5EP9A 1YO8A 2RR13 1PK6C 2TEPA 3I2GA 3NW4A 3MW2A 4WM8A 4DS0A 5LZ6A 1YRZA 1RUE1 3SHRA 2E9QA 1PIV3 4P08A 3WQBA 3L9JT 5J7MA 3PJQA 2V09A 1W05A 2VZPA 1V9U1 5CFCA 1GZWA 4XXPA 4OI2A 2XB6C 2ZEWA 4D3WA 2YROA 4YVSA 2EIDA 4MGTA 4YGDA 4ATFA 5ACA1 1GZTA 2ILMA 4ATEA 3BN6A 2JDHA 2WFF1 2E7AA 4OHWA 1O3TA 1DQ2A 1QHDA 3ETPA 2Z5WA 5A7QA 5JLVA 2RJ2A 4AVCA 4YZ2A 4LPLA 3U78A 4COWA 1W2UA 1C8M3 3AMHA 2FCUA 3EMRA 2WYFA 5T3NA 1NQJA 2GN3A 3KS7A 1AJKA 5I0UA 4UFHA 1LOAA 1XU1A 1UZ0A 2WN3A 2YB7A 2YDEA 2RM21 3M70A 3DXUA 4H14A 5SV5A 1REFA 2ZBJA 3S5QA 2ARBA 1O3SA 2ES3A 2MEV3 5LA9A 5FXXA 1AR71 1ND2C 1XNTA 4N43A 2QQJA 4GMP1 2EXHA 2A1XA 3IB3A 1XSRA 3E97A 3T1MA 3ZMNA 4CDQB 3RZMA 3M4FA 4JQTA 5FDBA 4M3CA 5L36A 4XF0A 3VB9A 1ULEA 1W8UA 3IPVA 5DAWA 3POEA 4HPKA 1BMV1 1JW6A 4Y4YA 2OS2A 4YW7A 2PHRA 4KWUA 2PLV3 5AFEA 4LNVA 1RB8G 4RHV1 2D7FA 2DFCA 4AFMA 4FP2A 4H7MA 4IEUA 1PGW1 1QQP3 1MS8A 2R1BA 2UWCA 3NSTA 1NCRC 1FOD3 1ZZ6A 4GKYA 4IW3A 4S2FA 4QHBA 2WT0A 3H3ZA 2WC2A 4LO8A 1D4M2 5EQUA 2X5IB 5LBCA 2OIIA 1SCSA 4QPYA 1RXGA 2BTVC 1S1AA 1RIRA 1W6NA 1ZRIA 3U0ZA 2AGSA 5I8SA 2ET1A 2V4AA 3VZJA 3VBFA 4MGQA 4HFSA 3VL9A 1G7YA 4OHVA 2Z79A 4DOUA 4AI3A 1DZRA 4HK8A 3ZN6B 1S0BA 4I2OA 2QE3A 5HPOA 1ND3C 1C3HA 1NOVA 1FV2A 3U07A 4DXZA 2RDSA 3BIWE 4BQ2A 1XQNA 2OQ6A 4N90A 4Q8LA 3VBHA 2X05A 1Q3EA 3PVBB 2N7GA 4LUKA 4CXWA 1NY71 1Q8QA 2OUHA 2WNUC 4ASMB 2MHFA 3DPRB 1AYM3 2PHLA 5FY4A 4AQ6A 4Y22A 4ONUA 4XF4A 5GLZA 3VDCA 4GD4A 3OUIA 2ZCWA 4GALA 4XBQA 2OZ6A 1YLLA 4OMDA 4RQPB 1NA1C 1YFWA 1P8JA 1HRI1 1LENA 1ZZ7A 1LEDA 3I59B 3QH6A 1CJPA 1GSLA 1W9TA 1W6QA 5FMBA 5IVBA 2AYHA 1YFYA 4N53C 1ACCA 1RUF1 1DG6A 4GWMA 4B7EA 1AHSA 3D6EA 3SITA 1W2TA 2VZUA 5BNNC 2Q8EA 3ZYPA 3IWZA 4JV4A 4LO5B 3NAPB 5DQ0A 2X09A 3CBNA 2JD9A 4YW1A 4AFBA 3W21A 1RTVA 2WS91 1UU6A 4HT1T 1K12A 2WKKA 1OT5A 2B4KA 2GAUA 2KA3A 1K5JA 2WA3A 3AP4A 1S0GA 2W5FA 2X8KA 1S2KA 5B4XA 2VOTA 3FWEA 2CAUA 3MV11 3KV5A 5KHKA 3FL7A 4CCDA 1VB2A 3JB8A 4LULA 1L7QA 2DUQA 3ILNA 5F32A 2FDJA 2VQTA 2XVLA 5CKMA 2JG9A 3WQ1A 3BTZA 1L7RA 4HKWA 1AF9A 5FYBA 5HBAA 1CR7A 4CDQC 2VG9A 3X29B 1F5JA 2EIGA 5CVRA 2Q8CA 4DMIA 3W9AA 1W6MA 2BU9A 3AL6A 2I74A 3AKQA 1FMD3 4KI5M 4XIKA 3SKVA 2BWAA 3ZXDA 5JI9A 1RMU1 2E63A 2W1WA 2ZACA 3KGLA 2X5IC 2R061 2WNOA 5D21A 3UJQA 2ZX4A 1F31A 2A6ZA 2WZEA 3KWVA 3LIGA 4WM7C 2D6MA 3U4SA 1TMF2 1LB2A 1ASJ2 3CL1A 5GLTA 4UFIA 3PLQA 4M3CE 2ETEA 2HWC1 5EWSA 2ADEA 1NT0A 3DUIA 3FBMA 1US3A 3ZFFB 1BMV2 2Y0IA 1Q8OA 5E88A 1QGLA 1X82A 1G9AA 1QKQA 3Q8AA 4CCLA 1UXZA 5FREA 1RUJ2 4IEOA 4QX7A 5C4WB 2VVFA 4QT6A 4FPEA 1F5FA 1X9TA 4RHV2 3ZDVA 2IXHA 1JU4A 1PGW2 5F5AA 3VD5A 4K40A 4B4PA 2XG3A 2PHWA 3HIFA 4FPLA 1T6GC 4RA0A 3DPRC 1AL22 1OVSA 3FN9A 3N9LA 3TEXA 2XOMA 2Y6HA 1O5LA 4YG3A 2PQSA 1HB3A 4HKLA 3BCWA 1AR83 4CEYB 5K4LA 1WLCA 1IG0A 3CEWA 3J7NA 4AVAA 4P9YA 1UY0A 1D2QA 4OVEA 1F4HA 1GMMA 4ASLA 2QQUA 3UL2A 4BIFA 2P2KA 2D6KA 5ANQA 1UU4A 4LUMA 2ZGMA 3B93A 3TOJA 5IK4A 3AP9A 1CZSA 2V72A 1ZNPA 2WAAA 2XJVA 2WT2A 1J83A 3GALA 3KCCA 1RVF1 4GQ7A 5LBEA 4D7YA 5F7UA 4C0HA 3I2OA 4XEZA 4IXLA 3K4ZA 3VHPA 3LGRA 4DXRA 4F83A 1OFSA 1HQWA 2JB8A 1GP6A 3KT1A 4Q5OA 4FSJA 4A4AA 3F95A 2VO5A 2D43A 2WT1A 4XBLA 5FMCA 3RMXA 1HRI2 5HCAA 2D97A 1H8VA 1GUIA 2WO2A 3GBGA 3R4DB 5LRSA 2A7AA 4BQXA 4CUGA 5FXVA 3J9SA 4RSUA 4UF0B 4GMP3 2C1FA 2GU9A 3LIHA 4IEYA 3IMNA 3WG4A 4BE3A 2CV6A 1TMF3 1ASJ3 1OFNA 2RS11 5F2WA 2XPJA 4A42A 2IXIA 4Q0UA 5F8PA 2J42A 3MGUA 4Y5SA 3K4AA 1W2AX 3AP6A 5A33A 1CAWA 3NO8A 1LHWA 1U0AA 2CU5A 2XH6A 5FJHA 1RUJ3 2H0VA 3NV4A 3E6DA 3ORJA 3PUSA 1AR61 1V6JA 1C57A 5FK8A 4YVWC 3SKJE 4ASKA 1X8EA 1YC61 3RG0A 4DEQA 4QGNA 2JX9A 4N8MA 4W4ZA 1OQDA 2BDRA 2LM3A 4GIQA 4F8AA 3IAQA 5CFDB 3GZUC 2KM2A 2EA7A 2RDNA 1AL23 1XC6A 4H7LA 3LD8A 3T09A 4E2SA 2B9UA 2GZWA 1JUIA 2F4LA 3POFA 4Q2FA 4M4PA 3RZKA 1OA4A 1EUTA 1H2LA 1IS4A 1GNZA 2YC2A 3DEMA 3FUOA 2QVSB 4BJ0A 4ZKTB 2FDFA 4MG2A 1WUVA 2BPA2 1RUI3 4XOGA 1W3VA 2R0FA 1PX4A 1SLLA 4K21A 3NWKA 3GNEA 1TEIA 1UO9A 4JTNA 4FQ4A 4BU2A 1QJFA 2RMU1 4U2AA 1E57A 2PHUA 3ZFFC 3BVCA 4BHPA 3AZXA 3C7FA 3FHIB 4R4ZA 1H4GA 1QJX2 2XJPA 4AI0A 2YPJA 1E5IA 5FKCA 3DGTA 4A3ZA 1RMU2 3K75B 2HJIA 4LITA 1VBC1 2W91A 3RSJA 4DZGA 3S0MA 1YYNA 2AREA 1YQ5A 5FZAA 2VTFA 3B7MA 4R8HA 2R043 4XUNA 3A7QA 2O8OA 5DZEA 1CX1A 1HXS1 2C5DA 4IE5A 5A80A 4W8JA 5A32A 1OQEA 3EBRA 4C1WA 4NPRA 1POV1 3JBG1 5EYXA 3V56A 2HWC2 3ZSEA 5AC91 4OI0A 5DMYA 5DN2A 4ZS2A 2XR4A 2JB4A 3OGSA 4QX0A 3THDA 1YIFA 1X8MA 3CJIB 4OHYA 5DUVA 5E6HA 1YFXA 3I8TA 1ZA4A 2ZX3A 4J6GA 3GBWA 4D8MA 1NCQB 1JXNA 4NMIA 3PUAA 5L7OC 1I1EA 1X9PA 3O1VA 2IFRA 5IK5A 5FZOA 3UNPA 3TN93 4AOCA 4A2UA 1BZWA 2HBTA 4IEWA 3T4HB 5FOJB 3RWNA 4I0WB 4KGQA 2V5DA 1XBFA 1RUOA 3DECA 4PQQA 3FJSA 4NWVA 1OBNA 5A70A 4COYA 1IZ3A 1VJ2A 4XMAA 3PJYA 1DLLA 3P3NA 2R30A 4JGZB 1KJRA 1GKBA 1YIPA 1HQNA 5IVVA 5JPNB 4GKXA 2CGPA 1CD3G 3MUZ1 2QZ3A 1MZEA 1A78A 4Y1XA 4JRAA 5FP4A 2YBSA 1S2BA 5L19A 1UOGA 1MS4A 3T0AA 2DV9A 3M7AA 3Q8CA 4NIDA 2RE9A 3GDBA 5FQ0B 4RD7A 2NM1A 4XE9A 3WDWA 3O1PA 1MS0A 3FX3A 3WF0A 1QJX3 3HNYM 2ZEYA 4MADA 4FOWA 4CCEA 2YHJA 4BH9A 4FFIA 3L2HA 1ENRA 4AXOA 3FFQA 4JVAA 4GZ9A 3WLUA 1TE1B 1BYHA 2D3SA 2JDAA 2VGDA 1IKPA 4YZ5A 3CZUA 5I8YA 2WO7A 1JYVA 5L73A 3FLPA 1KS4A 3NL1A 5ERLA 4YRDA 3MIBA 3I3MA 3AVSA 4CP0A 2AEZA 4I30A 4D6SA 5EJ3A 4YGCA 3QD6A 5CIRA 4RQPA 3R4SA 1JZ5A 1Q8SA 3WDTA 3ACHA 3HVDA 4EQVA 3DKWA 5FPXA 1LOFC 1AR62 3DYMA 3LA7A 4QPIC 1LGBA 4FTEA 2WZR2 5H9RA 5FWEA 3ZOIA 2B9VA 1XE7A 5LEKA 2EXJA 2W0XA 3GCXA 1MEC2 5CFCB 3AVRA 3I2FA 3RFRA 4FI9A 3POBA 2WUHA 5B2GB 4LKSA 2DCJA 2ZOEB 1DYKA 2A6WA 3NAPA 4QB1A 4RYDA 4EYUA 2BERA 4XJAA 3EQEA 4CDUA 4AEDC 5KWRA 2H6BA 4RR3A 4EN6B 4LHNA 5FZFA 3ATGA 3A4UA 4OI4A 4WBBA 5FYVA 4WVZA 3TEYA 4KU7A 3K4DA 3UKVA 2I2SA 1GANA 4JKMA 3RZHA 2J1AA 3CJIC 2Q8DA 3QBQA 1UZWA 1LHNA 5FZ1A 1W8HA 4EWAA 1VBC2 4AI9A 1IS6A 5FY1A 1XSQA 3B5LB 4OZOA 3O0VA 3LDBA 2Q5TA 3ENRA 4FPFA 4N43B 3WF1A 4CEWC 4QGLA 1RITA 2Q1ZB 2KXLA 1HXS2 3PU3A 4NWWA 4XQDA 2OYZA 1I5ZA 1VBB1 3OUJA 3IAPA 3UYJA 4AGRA 5D8AC 4E8DA 2IZWA 4Q4Y1 1DHKB 4UI9L 5AC92 3JBG2 4DY5A 4HPKB 3ZO0B 2PFWA 5DG1A 2Q8OA 5I0DA 1C5HA 2DCTA 5BNPC 1OPOA 3AMPA 2LALA 4CDXA 4JGZC 2ZMNA 1WCKA 3ZR5A 4PI2A 3WW3A 4DPNA 5K8SA 5APAA 2WJSA 2Z4FA 3QCWA 2HEVF 4JX0A 4GH4C 5KHIA 4R9BA 2JKXA 2PYTA 1TNRA 3DF0A 2X29A 2FZ1A 4JHZA 3I2JA 5AVAA 1JN2P 1D0GA 1VB4A 1OA3A 1W04A 1W6NB 2P3JA 2GNBA 3IMMA 3JQWA 5DDJ3 2WZR3 4B29A 1H30A 2HBUA 2B42B 4XDQA 3VBFB 3GJBA 4XFAA 3KVAA 3J7HA 1MEC3 3T1LA 3W5NA 5C4WA 1SLAA 2RR11 4FT8A 4N7UA 1JODA 3GHMA 4PIYA 1PIV1 3DKQA 3B9CA 4QPGA 4GJYA 4Y5TA 5CB7A 3ZXLA 1PMIA 1NG0A 4L97A 3RI9A 4Y1VA 3RJ2X 1LTEA 1G6NA 2XHNA 3ZFGC 2VMHA 2XUEA 5TSWA 1ZZ8A 4Y1ZA 3WD5A 2A75A 1CPNA 5C9AC 2PHFA 4FQZA 3ZN5A 4IV1B 4BQWA 2D5FA 3LPGA 1WMXA 2HWB2 3ROUA 4SBVA 4NRMA 2QQLA 5FMOS 5T5LA 3GM8A 1FV3A 4L92A 4WM8C 1WBFA 1C8M1 5EZWA 3TN91 4NO4A 3ME2A 1PM4A 4AHYA 5CG8A 1W6QB 2J1UA 1N3OA 2RS33 1FAYA 3M3QA 5EJZB 5CFCC 1GNYA 1XNDA 3KGZA 2MEV1 3GCWA 4YVSC 3P5BA 1X50A 5FYCA 5FUIA 4HANA 4JAAA 4QU2A 2E7QA 2ZGKA 5L9BA 2HLEA 4MLOA 3UGGA 3K46A 4V2WA 4Z2AA 4UXAA 4FOVA 5JIUA 1JZ3A 3AZZA 1TG7A 1WA4A 2R0HA 3BGAA 5C70A 5IATA 3H7JA 3INAA 3K2OA 3CO2A 1QXPA 2YGLA 4XFCA 3RNSA 2QFEA 2V5YA 1PX3A 4CSWA 2YY1A 4KG8A 4XW3A 2PLV1 5DG2A 1POV0 5JDBA 4NIAA 1NZIA 1QQP1 2ZKLA 4CCCA 5A6XA 1FOD1 2R49A 4LO6B 2JG9B 3VBSB 2CY6A 4N43C 4XETA 4E4ZA 4PJYA 1POQA 1UY3A 3RZZA 4DRRA 4FAGA 2VZOA 3PMSA 3N7KA 1H1AA 4QXCA 1UF2C 3H9AA 4UBHA 3WNMA 3THCA 2AENA 4AVBA 3E5UA 5EPAA 1VR3A 2IVJA 5CFDA 1GZCA 2Q4SA 2V73A 3ACIA 2WZ8A 3SH4A 2JDNA 3D0JA 4QX1A 5DAXA 3SISA 5L9VA 5A3TA 5E1RA 3OPTA 5FP9A 3SCHA 2BFUS 2BWCA 2O14A 2ZMLA 2OW4A 4JQRA 2I07B 4W6YA 5FYHA 1DP0A 3BOWA 2HWB3 4NPMA 3VHOA 3WNPA 5GLUA 4HN0A 4GXLA 2W3JA 1AYM1 1GP5A 1QOSA 2TUNA 3D82A 3C7HA 3WCRA 5J36A 3VDBA 1D2SA 1Y9QA 4LO7A 1OMIA 2DYCA 2GC1A 1YWKA 1W9WA 3WP3A 1UX6A 3M2MA 1ZBE2 3H3LA 3VBHC 2HWD2 2J1VA 5T5PA 1XNAA 3VBOA 4EZHA 3OCPA 4Y33A 5FYMA 1UYZA 5JXGA 2VNVA 4CZSA 1WCQA 4N9IA 5A7OA 4Y5Z0 3WR0A 1YEWA 4MXVA 4B4RA 1QF3A 2XQXA 1US2A 3ZYFA 4AQSA 3WUCA 5A6ZA 4XZPA 3CHXA 1ZBA2 5FY0A 2ZA9A 1BK0A 5ISLA 5F3CA
chains in the Genus database with same CATH topology
2IWGB 4BPZA 2A6XA 4GB33 1NCQA 1PGSA 2BVVA 2XL9A 5FLJA 3VKLA 5A3MA 3WV6A 4AK3A 1DGWX 3AKTA 5IUQA 4C1XA 4CYDA 2VOVA 4PBOA 5C8CB 1G86A 3WP4A 1TME3 2ZHLA 1IQAA 3HT2A 4OFGA 3HAGA 3MLJA 1F9KA 4YM0A 5KC5A 2WIIB 4Y24A 2DCYA 4FPOB 4Q0VA 4XF9A 3TN92 2GC0A 2ZGPA 2VY0A 1FMD1 1A3KA 2EF6A 4BMEA 5KHJA 4PLMA 2MEV2 2FZ2A 4AI2A 4AQTA 3PTYA 1GLHA 5A33B 3RI8A 2A70A 4Q26A 1DGWA 2WNVA 3WXPA 4RGAA 1WGPA 1ZBE3 2DTWA 1FATA 2HWD3 4Y26A 3OPZA 3U11A 1ULDA 1EYBA 4X6QB 1YJLA 2RJKA 3B02A 1B35A 1G8WA 1PM7A 1QDOA 1QQP2 1BVP1 1SLIA 3HQXA 3L2YA 5T55A 4Q8KA 1PVXA 4XJWA 1NE4A 2P3IA 3E5QA 1WCDJ 1ZBA3 3VGIA 1FNZA 4Q0SA 3ZFEC 3ZSMA 3OD4A 4AE2A 2DU1A 3OD0A 4LHLA 1AR81 4LEJA 3C3VA 2YMZA 3KM5A 2BNNA 4V1PA 4YG6A 5BNOB 5CAZA 2ZGRA 1O3QA 1H8TA 1OD5A 4MGKE 1KD7A 1X33A 5HXVA 2D6PA 1AYM2 5A32B 2O8QA 3B9IA 2Y38A 1JHNA 1HLCA 3SLIA 4JTOA 4EJRA 1RC6A 1W0OA 2GH8A 4J1XA 1V6KA 3ZSLA 2IXJA 3N7LA 3KLSA 1XYNA 1QWRA 2PHDA 3NKTA 1TMF1 4XFHA 1ASJ1 1WLWA 5FBZA 3HWJA 4ES9A 2XJUA 1AR92 3I54A 2IXKA 4K3UA 1RUJ1 5SV8A 3BB6A 1OOPB 1DZQA 4LBQA 4MXWB 3USUA 1LRHA 1MZ5A 5K7PA 1JH5A 1KITA 3SCFA 5J3UA 2VOKA 3KZ4C 2GMEA 2VMIA 3VN4A 2JENA 3APBA 3IBMA 1AL21 3BALA 4O9EA 4YYOA 3WT3A 4E27A 3WHUA 3ZN4A 1BQPA 1F2NA 4C90A 2UY8A 5IT6A 1CAXB 1RUI1 4FP3A 1PO22 1O91A 1UZZA 4YW3A 3ZXKA 1DGRA 3VL8A 1LOBA 1ZRDA 1B09A 3CF6E 3KSCA 4HSJA 1FMD2 2QDNA 5JAXA 1JBCA 4MGYE 1RJ8A 2GMPA 1BJQA 4DFSA 2R041 4IV1A 1VALA 1CPMA 1WW7A 1BEV3 4S2GA 2BEOA 4S2HA 3BU7A 3AYCA 3H1WA 3ECQA 5KXBA 2VUAA 3MFAA 1UZYA 4FPGA 2GMMA 3UJOA 1M4WA 2XWJB 1EPWA 1JTZX 4FPHA 1HIXA 1RUC1 1AR93 3CLPA 1DU3D 4YGEA 4CDUB 1XNBA 1PO11 2ATFA 4RR3B 3N3HA 3JQXA 2WZPP 2DCZA 4E4SA 4NHLA 4NOTA 1AR82 1N1VA 3C2UA 3WDYA 2CNAA 4QQLA 3MZHA 5JOZA 1L3JA 2UYBA 5DUXA 4YZ1A 3KCYA 3AB0A 3VBSA 3NKGA 4HSLA 4F7ZA 3EO6A 5H9PA 1SLCA 1W6OA 4QGMA 2A3XA 5ABJA 1PO23 2ZHKA 4R4XA 1Q8PA 2W08A 2BUKA 2XLAA 2W68A 1IGOA 4IV3B 1QJX1 1UD1A 2NN8A 4Z07A 4MZUA 3AZVA 1X7NA 1VBE2 4AFCA 4R9CA 4CDXB 2IC1A 4BA6A 1UKGA 3ELNA 3RDIA 3WX5A 1IHMA 4LLOA 3UKNA 4A7ZA 1D0HA 3KCXA 5BY5A 2ZMKA 3IDCB 4Q29A 1GYKA 3OF1A 3VZNA 2XKPA 3PHMA 1R092 1V6LA 4AI8A 1QXJA 2C0ZA 4COZA 4FVVA 3J8F3 2DVAA 1CQ9A 2IXLA 4PF5A 2XVKA 1LCLA 3IIAA 4QPGB 3JB4C 3AMMA 2QUOA 5H9QA 3VKFC 4OUSA 3WUDA 1LU1A 4YFWA 4ZXKA 5K0UB 4IL7A 1CESA 2CGNA 4AFAA 4RQPC 2UU8A 1RUI2 4LTAA 1W0PA 1C1FA 5KBFA 2A71A 1YUDA 3KMHA 4H55A 2PAEA 3VV1A 5GKAC 4HETA 4NR1A 4LE3A 1R082 2ZPXA 5GZCA 1NE6A 3WDVA 1LHVA 3ETQA 3WG1A 3VZKA 1PZ8A 4P9XA 3MPPG 3HMYA 1U5ZA 3NAPC 4QM9A 5C8CA 5IK7A 4RGGA 4YG0A 3ZIWA 1OI6A 4CDUC 1J3RA 2R042 3N35A 3AYDA 4P9JA 5BXXA 1VBE3 2JG8A 4RFT0 4G4FA 4RR3C 4EN9B 2D98A 2G4IA 3FLRA 4QD2A 1H9WA 1H1IA 5BPXA 4IQPA 3O0XA 3THPA 4YFZA 3FMGA 4YLZA 1GICA 3ALQA 1LOEA 4DRVA 5K9YA 2PA7A 1R093 1S0DA 1RUC2 3NJZA 4UW4A 1YI7A 1PO12 4GA9A 4X8PA 1WW4A 2X53S 2NPIA 3MW4A 4FOQA 5DDJ1 4GMP0 4M00A 2WZR1 4Z82A 3RYKA 1PNGA 1N47A 3QH7A 1NCRA 1OKQA 2D3RA 1MEC1 1AUYA 4CDXC 1ZRCA 1DGRN 4Q4V2 3V65A 1UW8A 4AEMA 2Z2SB 2BW8A 4D69A 3ZYIB 3D8CA 4CDWA 1DYPA 2D93A 2XJQA 4E9KA 3USSA 5CBLA 4OHXA 1TQ5A 3MDPA 4AVVA 3KD4A 1QXRA 3IN9A 3N7MA 1R083 3VDDA 5KXDA 4EN0A 1LR5A 3SNMA 5I0RA 5C4WC 1QJZA 4MVTA 5BNOA 4E2GA 2RS31 4QM8A 3IT8A 3VBOB 4WZCA 1HKDA 1BK1A 1EAH1 4Q4W3 3RS6A 4CEYC 5T52A 4L99A 4BMBA 2UY9A 5JSPA 4TYSA 3VZLA 4YM3A 3H7YA 1LHUA 1RUC3 4OLLA 3S7IA 5H9SA 1V6IA 1CJDA 1DBNA 3KT4A 1PO13 2GNMA 1RJ7A 4JC1A 3HBZA 4TWTA 1HQLA 3WVJA 3PVNA 2NP0A 4QX5A 3AYAA 1AX2A 5LRRA 4P9GA 5JR7B 1OOPA 1GZ9A 4Q4V3 1MS3A 1RUG2 4MXWA 2QQPA 3U4XA 4FPCA 5HI0A 4JDMA 4AFDA 5GALA 2PHXA 3TRSB 2ZAHA 4UW5A 4LA2A 4URTA 4ISQA 3NV3A 3LSEA 4W6WA 3EJKA 2ET7A 4K1YA 2BGCA 2ZAAA 3CNAA 2HWB1 1CAXA 2CL2A 1S0CA 1PGL1 4XF1A 1C8NA 2C9AA 1ALYA 5FFOC 2WNVB 3H1MA 2H0BA 3R6SA 4IEXA 3WW2A 5KXEA 4YM1A 1LEMA 2G9GA 2VQ0A 4XTMA 1J59A 5CFDC 5FRAA 3B69A 4BM8A 2E53A 2XHKA 1B35B 3DV8A 4WM7A 1Q8VA 2EAKA 2R072 3A0NA 4AQ2A 3TWIA 2HEWF 3WY6A 1AXYA 1MVQA 4K9SA 5DDJ2 3MLKA 4N9HA 3H50A 2B46X 2JECA 1GV9A 1RHI3 3LAGA 4Y1YA 5KHHA 2XVGA 4GB31 1LOCA 2UWBA 4DB5A 1G9FA 3VBOC 4F3JA 4KBBA 1H8TB 2ZGUA 2ZJCA 1R1A2 5JZGB 1RUG3 4EN7B 3VBRA 2OVUA 4XFFA 1AYN2 1TME1 5DZFA 1LJ7A 1VP6A 2TBVA 4FPJA 4KNCA 5FLHA 3LWCA 1NCQC 2B8MA 2RS32 3RRDA 4PDWB 4C91A 3ZXAC 4KQ7A 1EAH2 1FT9A 2NYYA 5CG9A 3MIFA 4HVRA 1LOGA 1Y7BA 4MGIE 4IV3A 2PELA 4KU8A 5HCBA 2JKBA 4LBQB 4LHKA 3VKNA 4LT5A 3USUB 5F1RA 1ZBE1 1Q56A 1J58A 2R073 2EVXA 4AHWA 2HWD1 3VUOA 2E7TA 2K2SA 4AVSA 3RPQA 4Z8BA 2P37A 1UKRA 2PQQA 3R0RA 2BQPA 5FOBB 1J3QA 2VUJA 4MGZE 4WVWA 3LSDA 1QJU2 4Y20A 3V0AA 3WG3A 5CNAA 1REDA 1BKZA 1ZBA1 1WLDA 2P34A 3LZZA 4AYUA 5JCTA 3PVOA 1MACA 2E51A 1UL9A 3AJZA 1V70A 1VRH3 1W39A 2ZGOA 1R1A3 3FUQA 4I02A 4K8FA 4ZU5A 3ZVXA 4DNYA 1U5IA 2ZHNA 4IESA 1AYN3 1TNFA 1D4VB 4X6RB 5K0UA 4Q4X3 1I3HA 4G9SB 1NYWA 4COVA 4FPYA 5JWPA 4MUVA 1PGL2 1GBGA 1O4YA 3ZYJB 4PIZA 1PZ9A 4B7KA 4XJ8A 1KS5A 2VMGA 4FPKA 4LBJA 3ZX7A 4W65A 2JE7A 3SCGA 1QH6A 1VLNA 1EAH3 3MIEA 2DURA 1CAUB 1MVEA 1YI9A 1KQRA 3D0SA 3LOBA 2PHTA 3GZAA 4U36A 1SMVA 2HWF2 2ZABA 1URXA 4I3PA 1CAVA 4DY3A 2XUMA 5HCFA 1QJU3 4GB32 4C0BA 2DU0A 3W59A 3R4UA 5KC6A 1C28A 1YNAA 3QOPA 5DUWA 1W6OB 4LBOA 5ABJB 4Q0PA 3KT7A 1REEA 2ZS6B 1RUH3 4XBNA 4EWDA 1RUNA 1TME2 1SFYA 3OJBA 2WNEA 4RL7A 1U12A 5J48A 4FBFA 2WSVA 2A3WA 4BOWA 1ULGA 3TNPB 4FXGB 2VOWA 2ZKNA 2K0GA 4IEVA 1VAKA 4P9IA 1Z7S1 3M3EA 2YUEA 2ZGTA 4LLFA 1EV12 3MICA 4LR4A 4BIOA 1KRIA 5F5QA 3VBFC 2A3YA 4YSFA 1BEV1 4CTEA 1ZX5A 1VIWB 2LTNA 2D5HA 4LO4B 4AGVA 3H3UA 4E4DX 1H9PA 4AGGA 1SBFA 2SLIA 1UIKA 2XBO3 2ZTNA 4E2QA 1ZM1A 5BV6A 1YFUA 3AKSA 4KWKA 3ZIXA 2HWF3 4AG4A 1AR91 4ORFA 4IV1C 1XNKA 2A5ZA 3H8UA 2VNGA 3VZMA 5I93A 2WLPA 1MQTA 3E5XA 1ZZBA 5T5JA 1WMFA 1N1TA 4M01A 4Z2WA 2XGXA 1KDKA 4AEKA 3RQ0A 3ZMOA 3AKPA 4BCUA 1OA2A 3ASIA 2ENRA 1HV1A 3M1HA 3WOGA 1AVBA 2UWAA 2JG8B 1PO21 2XJSA 1AX1A 4L2NA 5LK5A 1Q43A 1SCRA 4YZ3A 3O0WA 3WP5A 1S0JA 1RUD2 1EV13 2JG9C 3VBSC 2ZX2A 5KHGA 1EY2A 5JSRA 2NMOA 1CGPA 2DUPA 2GALA 4YW2A 2DCKA 4PIXA 4MH0E 3JCIA 5FPZA 1SLBA 3AYEA 2GDFA 4INDA 4IETA 3AMQA 3J26N 3LA2A 5GZDA 1NCRB 4AI1A 3J8F1 1A8MA 1QDCA 1DQ1A 4A7YA 1PHMA 3AP7A 2WQZC 3WNXA 4CDWB 2FBEA 4NHMA 4HLTA 3MI8A 3HN1A 3VKMA 3RYPA 1CIWA 2WQ4A 3FFZA 2K9ZA 3E6CC 1GQHA 1MS9A 2BNOA 1ND3B 2JICA 1ZREA 1OHFA 3VDDB 5CADA 2R16A 3KB5A 1N3PA 2HWE2 5GM0A 1IKQA 2VOXA 1COV3 4XF3A 3ZDSA 1UCXA 1SBEA 4FXKB 3SH5A 1PZ7A 2VULA 4XTPA 1FPN3 2RHPA 3JZVA 1NQDA 3BTAA 4R9DA 3ZPYA 1Z7S2 3EHKA 5JZGA 2BVBA 1O4TA 1MS1A 2DF7A 2QCSB 2PAKA 1HX6A 1ZVFA 3ST7A 2TNFA 1BEV2 1VBD3 4UBGA 1VBE1 4K20A 2DVBA 1RUD3 3NV1A 4WZFA 5JOXA 4N53B 4JCKA 3A0KA 1I9RA 1GQGA 1OLRA 5BNNB 4PDWA 1HRV3 3MEPA 1DQ0A 2HEYF 2A73B 4P5HA 1R091 5C8CC 1O5UA 1H4HA 2AH2A 2JG8C 3OY8B 1SQ4A 2DUOA 3N4MA 4QQ2A 3AZYA 4JDOA 1BCXA 2YC0A 4YNIA 1YCIA 1G9CA 5FCCA 1VBA2 4YZ4A 4AHXA 2RS52 4X8NA 5C33A 1U5XA 4LBQD 1MZFA 2HWE3 5IK8A 1DQ4A 2CYFA 4PQ9A 3ILFA 1QH7A 3RYRA 1BBT2 4OZXA 1AZDA 1R081 3AMNA 4P14A 2AUYA 2XL7A 1Z7S3 4I3GA 1ENSA 4R9AA 3JD72 4KWJA 4WM7B 1WMDA 3AXEA 4Q1RA 4CDWC 1WCSA 4WVMA 2GC3A 3MW3A 4Q4W1 4GWNA 1LECA 1XRUA 1HW5A 4P9WA 4AEJA 1IOAA 1HV0A 1IPKA 1SFNA 4ZU7A 3BODA 2EALA 3VDDC 2OA2A 4JGYA 4LBMA 3J8F2 3VZOA 4QQOA 1ZRFA 1CAUA 5BNOC 1WMEA 4YW5A 1XU2A 3GF6A 3EXUA 4YGBA 1NLRA 3VBRB 1K5MA 1IS3A 3NVCA 1LGCA 2XKOA 1CONA 3ZXEA 3VKOA 1VBA3 2QZ2A 4JDNA 2H6CA 3MIDA 1AL0G 4Q4V1 1RINA 2RS53 3VBUA 3QLQA 4BYYA 4KG0A 5DXDA 4BLIA 4R52A 3VHNA 5JOYA 1OSGA 5GJ6A 2AZ5A 3JU9A 4IEPA 4RS5A 2BBVA 1BBT3 3FBYA 1ONAA 2IXCA 4EV0A 1D4M3 3J4UH 1RUE2 1OOPC 4W6XA 3E6BA 1RGSA 3OBTA 2XWBB 1DQ5A 1DFQA 1V9U2 3CU7A 3JD73 4XJ9A 3M8LA 5D1IA 4QQHA 2CAVA 2GNDA 2VH9A 3PNAA 5ACA2 2VW2A 1KFXL 2R32A 2WFF2 3IDEA 4TLFA 5F6LB 4OUMA 2B5HA 1G9BA 4Y20B 3V0AB 3O5SA 4OULA 1VAMA 2GN7A 1C1LA 1JUHA 4YVWB 5EFUA 3DL3A 5I0SA 3B01A 1XYPA 2VW1A 2RM22 3ZYRA 4Q1PA 2B39A 1I6XA 1N1SA 1AR72 1O7FA 1O3RA 1RHI1 2XLFA 3D5OA 1AXKA 4MYEA 3V0BA 1UPIA 1ENXA 2CWMA 3ZFEA 4K6BA 4FCAA 4CP2A 1PK6A 2P17A 1OLQA 1QOTA 4HZFA 4COUA 5F6KA 2JE9A 1RUG1 2ZGQA 2WA4A 1QY4A 3ZYGA 1QMJA 1FXZA 2VXRA 2Q1MA 2VECA 5FMOL 3TYJA 3P3PA 2ARXA 4EN8B 1C5IA 4M0NA 1S55A 3PVEA 2GNTA 3ES1A 2F6BA 1RUE3 4Q4W2 1H2NA 3K51A 3VBRC 1V9U3 4BLJA 1A8DA 1UAIA 3FE5A 2ZX1A 1ND2A 4TZDA 2JEMA 3POYA 2VVEA 4ZU4A 5ACA3 2FQPA 1CAVB 1NY72 2WFF3 2Z42A 2Z69A 5E89A 5L7OB 2D6NA 1X36A 2R071 2VW0A 4B3NA 4P9LA 1LKNA 2MNGA 4I01A 3MIHA 1XXNA 2RJLA 3N7JA 1EP0A 3BOPA 2RM23 4M0HA 4BWOA 2DFBA 3K48A 3OYWA 4IV3C 3LA3A 1AXZA 1H2MA 1AR73 3QACA 4QQPA 1SEFA 4D7SA 1WW5A 4WVVA 2OUJA 3G6JB 1DIWA 2DVFA 1RUF2 2DTYA 2YGMA 1NXD1 2FMYA 4CRQA 4K1ZA 4MX3A 2I45A 2FMDA 1VRH1 1R1A1 4LBLA 1BVVA 2WS92 1SBDA 2BFUL 3GYDA 4RHV3 2WFPA 1AYN1 1ND3A 1W6PB 4FOYA 4Q4X1 4XYXA 4HBNA 3O12A 2SBAA 5GZEA 1ZZCA 2WNUA 1AX0A 4BZ4A 4QPGC 3OBRA 1WLTA 4OI1A 3TNQA 2LUWA 2Y26A 4S2DA 3UV9A 1QOOA 2E6VA 4XFGA 1NA1A 5FO8B 5K0UC 5T54A 5GZFA 5A3LA 2R6QA 2WWSA 4QPIB 3ZXJA 2A6VA 1J1TA 4B8EA 4HVQA 1ZRRA 4N53A 1MQTB 5JVVA 3AZWA 5BNNA 2UYAA 4FO9A 3AXDA 2R062 3MF6A 1RHI2 5JMCA 2B7YA 4AEDB 1IS5A 1QJU1 3AJYA 1HRI3 4AF9A 1LHOA 4Q27A 4JRLA 3MFCA 4YW4A 1V6MA 3OY8A 1FI2A 1RUH1 1RUF3 3W58A 1QJY1 3M3OA 4H3WA 4KGGA 3M3IA 1OPMA 4OHZA 3FC0A 2VVDA 2YV8A 3IDBB 5T5OA 3UK9A 2VU9A 5GZGA 4CEWB 1U5YA 2WS93 1LESA 4CDQA 1KFUL 3FLTA 3N36A 5I8TA 5J37A 3ZXFA 4FAHA 4XMIA 3MYXA 4XFIA 5D8AB 2VPVA 5FLIA 5BNPB 2ZGSA 3H0OA 4ITCA 1Y43B 1UN1A 2A6YA 2WINB 3ES4A 2GC2A 4UW3A 4NN0A 2VNRA 3ZSJA 1V6NA 3AX4A 5JOWA 4GH4B 1RL3A 2X5IA 3V64A 1UIJA 3ZXGA 2AR6A 1J3PA 1RVF2 2NQYA 3OTFA 2ZX0A 2XBO1 3ZN6A 1GR3A 1PVC1 4D7TA 2HWF1 1RMU3 1CVNA 1MZ6A 2WLQA 4N7IA 5AVPA 5JPMB 1IPJA 1KJLA 5JI7A 4HL0A 4QXKA 2BYVE 3KQRA 3RMYA 2R063 3DPRA 4PBPA 1QNYA 2OZJA 2R1DA 2EXIA 1H2KA 3DN7A 2RS12 4I0BA 4YM2A 4LBNA 3ZFGB 2HWC3 4LA3A 4L11A 2ZHMA 1FYUA 1VRH2 3OGGA 3LKJA 5C9AB 4PCRA 1GFF2 1AJOA 3HD8B 2P3KA 3I59A 4Q4X2 3HR9A 5DUUA 4WM8B 1WW6A 5EV7A 2G9FA 4LBKA 1LGNA 4PLOA 1MQTC 1ULFA 1LODA 1N1YA 2VQAA 2BNMA 4HN1A 1GZWB 2Q30A 3GBFA 4L8QA 4YVSB 1GNHA 2HYKA 1XYOA 1EV11 3ILRA 3ZSKA 4CP1A 1YHFA 1Q5OA 2O1QA 3B3QE 2RMU2 3HT1A 5CU1A 3AK0A 2JXAA 2WL1A 4KWLA 2CWSA 1RVF3 1NXMA 1JOJA 3O14A 5KXCA 3TBDA 2W39A 1N3QA 4HVOA 1APNA 4FTBA 3PMEA 1M06G 4K7JA 5LEJA 4M3CB 1V6OA 4YVWA 2YXSA 3IPVB 2YZ4A 5J98B 4AHZA 2WSUA 3S6PA 2WNVC 5GLVA 3M3CA 4Z92B 2NLRA 4I0AA 2W52A 3OGJA 1RUH2 1QJY2 4XXAA 3CJXA 2RS13 2DVGA 2QNKA 3THTA 4D94A 2FHRA 1KDMA 1BXHA 1B35C 2EXKA 5F9TA 1COV1 1XNCA 4HKOA 2MPFA 1DGLA 4NVPA 2PN5A 1AR63 1Z78A 5LK7B 3NV2A 4KH9A 2NZ9A 4WVMB 3ZFFA 1DF0A 1FPN1 3WDXA 1HDKA 3LCPA 2O0OA 4KL1A