2LUWA

Solution structure of vep c-ter 100
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
101
structure length
101
Chain Sequence
GNVLKNNTPVSNLTGNKGSEVFYTFTVDRNATAVVSISGGSGDADLYLKAGSKPTTSSWDCRPYRYGNNESCSVSAAPGTTYHVMIKGYSNYSGVTLKLQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metalloprotease
publication title C-ter100 region of vibrio extracellular metalloprotease
rcsb
source organism Vibrio vulnificus
total genus 7
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2luwA00
1DF0A 3JQXA 3JQWA 4I3GA 5FBZA 4DY5A 1NQDA 3DF0A 1QXPA 1U5IA 1KFXL 3AFGA 2QFEA 1KFUL 4HPKA 4DZGA 2O8OA 2XVGA 4DXZA 4HPKB 5SV5A 1NQJA 5FAXA 3BOWA 1WMFA 1WMDA 4G9SB 2XVKA 2LUWA 4DY3A 1WMEA 2XVLA
chains in the Genus database with same CATH superfamily
3WNOA 5E88A 1MZ5A 2XLFA 3N7KA 4K21A 4IEOA 4HVQA 2ZX4A 1BKZA 1X33A 2YPJA 1U5XA 1K5MA 4K7JA 1GR3A 5L73A 3H42B 5KXDA 2W95A 2NM1A 1SCRA 2D3RA 4FI9A 4HOOA 4IV3B 4M0NA 1PVC2 4ZU5A 2X10A 5FP4A 4CXXA 2WFF2 2HWF3 1VJ2A 1XNDA 5HV0A 3ZXKA 1D2SA 1UY1A 4AK3A 1W9YA 4AR2A 4AVSA 1W8NA 2ZGPA 3N9QA 3GNEA 4AVCA 2XBO1 1G7YA 3ZYPA 3POEA 1UXXX 3WCSA 4NE9A 1LU2A 1SG3A 1VMHA 2EAKA 2O0OA 3ZIWA 1DZQA 1POV3 1EV13 3MFCA 1VRH3 2JG8B 1WBLA 5CIRA 3OPZA 2C9KA 1K5JA 4FVVA 4I02A 4OQ9A 2Y6GA 4RL7A 2YFUA 3IPVB 1MACA 3WDUA 4Y5TA 4FPLA 5IHRA 5LBBA 1DHKB 1SDDB 2CSGA 3MF6A 2DVDA 5C70A 4XQDA 1RJ7A 1ZZ9A 2XLAA 3AYAA 4CDWC 1UKRA 3I54A 4GMP0 3VD4A 4LE4A 5IJRA 5KHKA 4D69A 2BQPA 1SDWA 2JE9A 4Y1VA 5DXDA 1ZVFA 4JRLA 4AL9A 4Q4Y3 5IYYA 1BZWA 1OQEA 3ZXAC 1FMD3 1CJPA 1V9U3 5DAPA 5EFUA 1SCSA 4FPFA 4AAPA 4GKXA 3SCFA 1TME3 1ONAA 2TEPA 3O1VA 2A3YA 1GUIA 4PLOA 3AZWA 4NO4A 5LY2A 3WP4A 5K9YA 1WCQA 1OQ1A 5FZDA 5K0UC 4LBLA 4B1LA 2VZSA 4YW2A 1N47A 4K6BA 1NAEA 5EZWA 1XNAA 4H2AA 4Y24A 4UF0A 3UT0A 2ZCWA 5FKCA 1NY71 5IUQA 1XE7A 5ABJC 1JODA 1BYHA 1ALYA 3B5LB 5CG8A 2WO1A 4XJ8A 3U4XA 4XJAA 2DVFA 4HN0A 3G6JB 5J98B 3K51A 5F3GA 3ZKUA 1YJKA 1LODA 2ZGOA 5BNOA 3WF4A 5DDJ3 1J1TA 2FMDA 2YBPA 3VDDC 2UY8A 2B46X 4QU2A 1PO21 2R1BA 4V2WA 1W6MB 1Y7BA 5FY1A 5FJHA 1LOEA 3GZAA 5AFEA 1VB2A 4JVAA 1SLCA 2DF7A 1I5ZA 4W65A 5FREA 5A7WB 3HR9A 3TB0A 3JQWA 1RVF1 1F31A 1RUH3 2YBKA 3SLIA 5KC6A 1BLZA 2LRPA 2D6KA 2CV6A 2OA2A 3UKTA 3KF3A 1OH3A 5CFDC 1JH5A 5FYTA 3UV9A 4DXSA 1OOPC 1GV9A 1EUTA 2WA3A 3KCXA 5FYBA 3TNQA 3HJRA 4ZXEA 3MLJA 4YGEA 1QY4A 1UOBA 4A41A 4AFMA 1GQPA 2WSVA 5FUNA 2HKXA 2EIBA 2DTWA 1OVSA 4RS5B 2RR13 1W9WA 4A6SA 2LUWA 1QIQA 2CAUA 1MVQA 3VBHA 2Y60A 4BWOA 1W8OA 5K0UA 3ETPA 1CPNA 1MQTB 3WOGA 1MS1A 4ZKTB 4P9JA 2DVAA 3IKWA 3RZLA 2V4AA 3ACGA 4RFT0 1YUDA 2WNOA 3PUIA 1SLBA 1WCSA 1MZ6A 1XB9A 4UT5A 4XACA 4HONA 4DS0A 4ORFA 1PVC3 2HWF1 2C0ZA 3OYWA 1XNTA 5FIXA 2XWJB 2DBNA 2BERA 1H8TB 2WFF3 1RUI2 3HT2A 5EYYA 3RYKA 3V0BB 1VBC2 3KQ4B 4BQ2A 1ULEA 5FP3A 3PVBB 4JGZB 5LBEA 1JZ2A 2JDNA 2WQ8A 1NOVA 3O7OA 3VDDA 5AC92 2YHJA 4J25A 5LCWL 3ILRA 1POV1 4RR3C 2BP6A 5C4WA 3NV1A 1VRH1 4CSWA 3O0WA 2OPKA 3ME2A 2ZACA 2BFUS 4ZHNA 5A3PA 3OBZA 1O8SA 4H55A 2ZGKA 3AKTA 2WO2A 5D8AC 2XUMA 4MOAA 4MVTA 4ZS3A 1OKOA 4TSVA 4DQAA 2XXZA 3IMMA 3LZZA 4NWVA 5HV4A 5IVJA 4CEWA 2YU1A 1GZTA 3GZUC 4CU9A 4CCOA 5C3SA 2E53A 1QHDA 2BTVC 1KS4A 1E5SA 2A73B 2NYYA 3PU8A 1UY0A 4Q4Y1 1OI6A 2NMNA 1FMD1 3C7EA 4LKSA 4OUSA 1V9U1 1VMFA 3ZXGA 4QWNA 3AK0A 1TME1 1REEA 4QX5A 5LA1A 4LO8A 4W6WA 4UOJA 5A7PA 4Y22A 1RUJ2 1FXZA 4DFSA 4LBKA 3FLPA 5I93A 1IOAA 5KR7A 4MV2A 1NQDA 3VBOA 3KD4A 1R083 2PAKA 4HKLA 1AUYA 2MEV3 3VBUA 5J09A 3M4FA 1KFUL 3OCPA 4DUVA 1IHMA 5A1FA 2DTYA 5C7GA 4LORA 4UFJA 1RUC2 1ZREA 4YG6A 2XKOA 5DDJ1 2D5FA 3ON7A 3J9SA 3VZNA 4LUKA 5JXHA 4RR3A 4QKBA 4YVWB 3L2HA 4BIOA 3O1UA 1XYNA 1DIWA 2DCTA 4COUA 5D21A 1QNYA 1S0FA 3SISA 2Z42A 1JZ4A 1GU3A 2QCSB 4QKDA 4LUMA 3RDIA 1Q43A 4EZHA 5I0SA 5KC5A 2BWAA 1JI6A 1SLTA 1CR7A 1NE6A 4NJ4A 1W9FA 5F5QA 1AR92 3HPNA 1FT9A 5FZ3A 2P3JA 3CIHA 3QH7A 1W99A 3HBZA 1BQPA 4XETA 1OFSA 4R9AA 2E6VA 3S5QA 1XYOA 2BGCA 1U5ZA 2JD4A 2P3IA 1V6LA 4FOWA 4JDOA 4K3UA 3UYJA 2RR11 4NRPA 3LKJA 5DZFA 3RJ2X 3PMSA 4B7KA 1W6PA 3ELNA 4QQOA 5GALA 2JE8A 2WN3A 5CADA 4HETA 2VUDA 5H9PA 1N1VA 5FY0A 3U10A 3CU7A 1B35B 5EP9A 2WA4A 4CPBA 1W2TA 5AVAA 3P3NA 1C1LA 1R1ZA 4Q27A 3S7IA 1PVC1 3WDYA 2WFF1 2X5IB 1H8TC 2RVAA 1YFUA 3O1OA 3MYXA 1RUI3 2YV8A 4OMCA 3S30A 3ZN5A 2Y6HA 4EN9B 1IKQA 1VBC3 2Q1MA 5E89A 5L7OA 4E2SA 5JXJA 3ACHA 5FZBA 3WDVA 1NCRB 5AC93 1GANA 3ZN4A 2OPWA 4Z2AA 1KDMA 5KHIA 5FQ0B 5KXCA 3O1PA 1AZDA 1U12A 2J1SA 4QPGC 4EZ4A 3B69A 4OHWA 3GM8A 1ENQA 1YI7A 2E51A 3AX4A 4XAAA 4IW3A 5FCCA 1ZA7A 3VZJA 4XXPA 3EMRA 1J58A 1W0PA 1CAUB 1PMJX 4XFAA 3O0VA 2Y8KA 2E7QA 1S0JA 1H8VA 2SBAA 3X29B 2W5FA 1ODMA 1DQ4A 2B9UA 4GIQA 1US2A 4HFSA 4QX7A 4TYSA 4AFBA 1I6XA 1KXGA 2VZOA 3Q8FA 1POV0 3NW4A 1UL9A 3BCWA 3EB7A 1CJDA 4K40A 4MUVA 2FZ2A 3K2OA 5FY9A 2R042 3WQBA 1BVVA 4FPEA 1S1AA 2IVJA 5CFCB 4Q0SA 3KMHA 4S2DA 4XFFA 5A7OA 3VLBB 1RUJ3 2BGPA 2ZMNA 4LBQB 4OI2A 4OI4A 1K45A 5FY4A 5T55A 3AKSA 1PK6C 1NCQB 1US3A 4AQSA 4BMBA 4MG2A 1R081 3CO2A 1W28A 4URTA 2MEV1 5LWBA 4FFIA 2RDNA 1H2LA 3HN3A 5F8PA 2VAUA 2ET1A 4QPIA 4XOGA 4BPZA 1AYN2 1RL3A 4Q1PA 1V6NA 4FP3A 2GH2A 4XXAA 5FYSA 4J1WA 4P9YA 3NAPA 1RUC3 4IESA 2ZGQA 5A1LA 3WNPA 5A6ZA 1V6JA 3LEMA 2GALA 1OKQA 3CQOA 4LTAA 4XF1A 5FZIA 4YVWC 1MS3A 1SFYA 4DY3A 2C4XA 3K77A 2VOWA 4FPKA 5DQ0A 1WKYA 3JZVA 4XF3A 2YXSA 4KG0A 2YY1A 4W50A 3ZFEB 2PHFA 1AXKA 1UOFA 2QQIA 3LSEA 4B4QA 1GOGA 2DCZA 2GZWA 4MXWB 2ZX0A 2EIDA 3FLRA 3KCYA 5ANNA 1FNYA 1LGCA 1LHNA 1A8DA 3JBG2 3OEAA 1AR93 4P9WA 2QQOA 1W04A 4XJZA 2VBPA 2JD9A 2EXKA 4UFIA 5EV7A 1DGRN 1ENSA 2GNTA 1OD3A 2ZBJA 5F5IA 4YG0A 4QHOA 4CDQB 3Q8BA 1W8ZA 3HIFA 3GALA 4PF5A 2GMPA 1CAVA 3GZTB 4XUOA 5BUVA 3PHMA 1B35C 3POBA 1ND2B 5FY7A 5HXVA 3SH3A 1H2MA 1TG7A 1UYXA 5DAQA 4NWWA 5F7UA 1CWPA 3W5NA 4ARXA 2AZ5A 1K12A 4KI5M 4S2HA 1H9PA 1F5FA 4RSUA 3T0DA 5LZ6A 2HWE2 4MYEA 4WM7A 1JOPA 5EWSA 3WVJA 1RUI1 3FZ3A 5K4LA 3EO6A 5T5OA 3O0XA 3TOJA 1KRIA 2QUOA 1VBC1 4CP9B 2GC1A 3E97A 4D6QA 4N90A 3VZMA 3QH6A 1L3JA 5AC91 2VMHA 5C3RA 3FJSA 2Y38A 1YHFA 2I74A 3R05A 3L2YA 5ISLA 3U11A 1UW8A 2JECA 3HNMA 4C90A 4LIVA 3LCPA 3N35A 4LJHA 1N1YA 4GULA 3ZYIB 3AP9A 1HW5A 1ZM1A 1DQ1A 2H0VA 2IZWA 1WLCA 3S5AA 4Q0QA 4BXFA 1KD7A 4D7SA 5A3WA 5JOXA 3MIHA 1SFPA 5FZCA 4CEYC 3S0MA 3V56A 3E5UA 5FYMA 3GYDA 1E5HA 5L9BA 5HCHA 4IUGA 2I45A 4DUWA 3BTAA 2FDGA 3VBFC 3WY6A 1I9RA 1J1LA 4AGGA 1AVBA 3K4DA 4DEQA 2R043 4XMIA 3AMQA 3H7YA 5CFCC 1E57A 4O61A 3WCRA 4BA6A 3E6BA 3TEYA 4PBPA 4OHYA 1RUJ1 3B02A 3HEIA 4IETA 2R062 1RIRA 3E1F1 1Y9MA 2DURA 2R073 4KU7A 4E9KA 3ZXEA 4KNCA 2WNVC 2D6LX 3AL5A 3MW2A 3ZYRA 1MS5A 1YC61 3NV3A 4NVPA 3H50A 3LOBA 1H1IA 2XR4A 4YRDA 1AYN3 2B7YA 2XHNA 4PDWA 5K7PA 4I01A 4N43A 1CZVA 3B94A 4Z1VA 1RUC1 5JR7B 4DIQA 1WLWA 3ABZA 3KCCA 2XDVA 1VR3A 5JIAA 1AR82 3FHAA 4N53B 1NG0A 2OQ7A 3BVCA 1GMMA 3JQXA 1BVP1 2Z69A 1CGPA 5KXBA 2R1DA 2OUJA 1UNBA 2WWSA 1S4CA 4ASMB 4YW3A 3T3YA 3M8LA 5BV6A 1ZNPA 3IAQA 3GBGA 2R32A 1K5MB 1Q56A 3NNGA 4XFHA 3ZFGA 2WABA 1AR91 3JBG3 2JE7A 5CVRA 3U75A 3KVBA 4CCKA 4ARYA 4IE7A 4COWA 3D0SA 3OG2A 1BBT2 1NZIA 3GBWA 2A1XA 3SKJE 1DQ0A 2F6BA 3VZLA 3VKFC 1ENRA 2YBSA 3NSTA 2QBXA 2GN3A 2UWBA 2VCAA 4L11A 1C57A 3D0JA 1OBNA 2Q5TA 2WINB 1ACCA 2YMZA 3OF1A 2XL7A 5G04L 3WG4A 3ZXDA 4I30A 1K3IA 3ZLIA 5J7MA 3SEEA 4AEDA 3DL3A 4E8DA 5C3QA 4BB3A 1PHMA 4UW5A 3CNAA 4PI2A 1IGOA 1OA4A 1YIPA 4LEJA 5FPXA 5LY1A 1AX2A 4N7UA 3R4DB 5ACA2 2VZQA 3FE5A 1G9DA 3K3NA 3U1XA 2O14A 2W91A 1WCUA 3VBRA 5LEJA 5FPUA 1OXCA 2HWE3 3LAGA 4LO7A 5HCAA 1UPIA 5FPAA 3PVNA 5EYXA 4CDXA 5H9QA 2QE3A 4E2QA 3PLQA 2ZGNA 4Z2WA 4JZRA 5FZ9A 2ZAAA 1ZRDA 4G9SB 1BJQA 1PIV2 4YFWA 3WQ7A 4ZPIA 3R6SA 3T30A 3WDWA 1JYCA 1ZRRA 1GNHA 1OPMA 5DN2A 4FSJA 4V1PA 1OUXA 3FX3A 1UY2A 1EPZA 1PGSA 1VE0A 3WQ0A 4AI3A 2C24A 2JJ6A 1LRHA 4QGLA 5EIYB 2R16A 3DF0A 3GJBA 4DB5A 1H2KA 4MGQA 1A3KA 1J59A 5E1RA 4RN5A 5FPLA 3WF2A 2ZMLA 1S0DA 5A3LA 4UF0B 1RJ8A 3MW4A 3ETQA 3ORJA 2PHLA 5C5TA 1TMF2 4XHXA 2RE9A 3UESA 1H6XA 5FP9A 1NX9A 4TWTA 2CL2A 1G8WA 2CY6A 4LQRA 4QAWA 2A6VA 1JYNA 3DEMA 4JGYC 1CPMA 2R041 5BNOB 2W08A 3PIGA 1D7PM 1MEC2 4ES8A 1TNRA 3VHOA 2JENA 4I3GA 2E7TA 4UBGA 1LGNA 2ADEA 2ARXA 3U37A 3D82A 2RM22 1VIWB 2IFWA 4PJYA 4PT6A 3OEBA 1LAJA 4BYYA 4LOSA 1COV2 1F4HA 1AYN1 5EJ3A 4HVRA 4NHXA 1C1FA 3H7JA 3POJA 5JWPA 5A32A 2X09A 1LJ7A 1UOJA 4GWNA 3J26N 1RUNA 4CP2A 5SV5A 1AF9A 4QM9A 1OFNA 1AHSA 4NMIA 4YW6A 4ITCA 4FAGA 1JZ3A 4M00A 1N1TA 2GC0A 4DMIA 3ZR6A 3UNPA 1DQ5A 2GN7A 1QKQA 3J8F2 3LPGA 3MW3A 3ZYBA 3BU7A 4Y20A 3MICA 4QB6A 5JAXA 1SLIA 1AR83 1T2XA 3NMBA 1JYTA 2YYOA 3I8TA 5FR3A 1KQRA 3LB9A 4LNVA 2PMWB 3VBHB 1W2OA 3JU9A 3VDCA 3A0KA 1MR5A 3N3HA 2NLRA 5K0UB 2YFZA 2X05A 4NUBA 5KHJA 3GCXA 1LOBA 3S6PA 4B3NA 4GWIA 2VW1A 4K8FA 1U5IA 4ZS2A 3JBG1 2ZX3A 3H3UA 3KF5A 4N9HA 4NRQA 2AREA 4JV4A 4LBOA 4XE9A 5FKBA 4LO5B 1S0EA 3A22A 4XFGA 3OYWB 1GSLA 4IEVA 3KV5A 1BBT3 2AH2A 1HRI2 4JGYA 1RYYA 3ZIXA 1SBFA 1YFYA 4YSFA 4K1ZA 3VL8A 5A1AA 1C8NA 2JEMA 2XJQA 4CUGA 2FDKA 1W8HA 3VDDB 2CDOA 1VB4A 4CU6A 2JIGA 2TNFA 2P17A 2ZGMA 2GC3A 2PXJA 1V6OA 2VW0A 5FUIA 5FMDA 4LXLA 5ACA3 2RG4A 3I3QA 5CFDB 2K46A 4AI9A 1CAXA 2H6CA 1O59A 5JMOA 1O3RA 1OOPB 5FXWA 3VB9A 1LEDA 1UD1A 2HWE1 2W92A 4CEWB 2VNRA 4W6YA 5A7SA 1IS5A 4HXCA 3CKHA 3GHNA 4TZDA 3B9IA 3MIDA 4FOYA 3WR0A 4LKEA 3WUCA 3URFA 1PIV3 5T54A 2IVIB 4JC1A 4QXKA 4E2GA 4B7EA 2DV9A 4Q5OA 1A8MA 1CVNA 3AP6A 3B01A 4WM8A 3MI8A 2MNGA 4Y22B 2WL1A 1DCSA 1QQP3 1V6IA 1QH7A 1Q8SA 4JTOA 4LBQD 4Z82A 3WUDA 5TSWA 1LOCA 5F6KA 4Q1RA 3UL2A 4IEUA 4OFGA 2Y34A 1REFA 1W6OB 3MHZA 3VBOB 1VMJA 3F95A 4NAMA 4FTBA 3VBUB 2ZPXA 1AR72 4AAXA 3C7OA 1L7RA 1RC6A 1TMF3 4YZ3A 2ARBA 1VBE2 2ERFA 2WYSA 5F2WA 3BODA 3H1MA 1GLHA 1WGPA 1X8EA 4KU8A 1IZ3A 5I91A 3WV6A 3ZMNA 3DYPA 3ZDVA 3VHRA 2A6ZA 2J1RA 3IT8A 4KBBA 4V2VA 5BNOC 4CUBA 3MF9A 2XMLA 2RDQA 1UU5A 4JCKA 1BMV2 4MH0E 4RR3B 3OBRA 3OB8A 1MEC3 4M0HA 2IWGB 1LHUA 4CUAA 3I59B 2WZEA 4XPVA 2HEVF 1XNCA 2G1MA 1U0AA 1OVPA 5FLIA 4BMEA 5D8AB 3VUOA 3F2ZA 1F35A 5FMBA 1E5IA 2FZ1A 4HBNA 2Q8CA 4AVAA 5CG9A 1BCXA 4IXLA 3MGUA 4MX3A 4PI0A 1COV3 2P3KA 1S0CA 1PZ7A 5DUUA 3W20A 5FK7A 4LO4B 4CU7A 2WWJA 4Y4YA 2WN2A 1W06A 4KG8A 4PIXA 3DUIA 1JHNA 1WD4A 4Y5SA 3SITA 3VKNA 4XAEA 5FZAA 1WMFA 2XJPA 2VQUA 1PO13 3J8F3 3C7HA 4ONUA 1O7FA 3D6EA 1OURA 1AR81 2V72A 3AXDA 4OZOA 4LE3A 2D43A 1O3QA 5IVYA 2Q8DA 5JXIA 3VBHC 2OT7A 3LEKA 1UZYA 2RS32 1SPPA 4IEZA 1R64A 1DBNA 4EWDA 1UO9A 4SLIA 2A6YA 2XHKA 3M2MA 1NZCA 5F6LB 1RB8G 1JXNA 2PLV2 3ENRA 1W8WA 1GYKA 5F37A 2WRAA 3TNPB 1JYWA 1BBT1 2D44A 1H6YA 5FDBA 2GMEA 3R4SA 1HRI3 5A6YA 4JHTA 3PJQA 3VZKA 2AACA 2BFUL 3TN92 2DBIA 3MUY1 4XILA 3UK9A 4YM1A 1LR5A 3BIWE 1YQ2A 1ULFA 2BU9A 2P5BA 2P4EA 2P37A 5C4WC 3ZFFA 4EQVA 4ZY9A 3VGIA 5ACA1 4DNYA 2Q8EA 2BYVE 3HMYA 5FMOS 2MHFA 5C8WA 3AKRA 2VOTA 1HB2A 4H7LA 2BJSA 2YDEA 4HANA 2KD7A 4YW4A 3DXTA 5LA2A 3B7MA 3WG1A 4CEWC 5FXVA 2QJVA 1VBA2 2GC2A 2PHXA 4HMZA 4R52A 2JDAA 3C8XA 1UKGA 4BQ4A 1NQJA 3HBKA 4Q4X2 5FLHA 1XOYA 4LA2A 1GZCA 4NOTA 4E4ZA 2R6QA 4A4AA 3ZSJA 1IQAA 1CX1A 1PIV1 1LB2A 1WBFA 1OT5A 1M06G 1OC1A 4MHRA 2VD7A 5LA9A 3MLLA 2W1SA 1JYIA 1CAWA 1QJZA 2W47A 1QQP1 1LECA 2BVVA 2YGLA 1ZBE2 4XW3A 4B4PA 5FZMA 2VJXA 4BE3A 3U4SA 3GJAA 2IUWA 1AYM2 2Y6FA 4QHBA 4IEWA 1GZWA 4P9LA 3OGGA 2XL9A 3LD8A 4GQ7A 3VBOC 3ZN6A 4B29A 1I1EA 4YGDA 1HX6A 1LOFA 2JDYA 2XH6A 5FZ7A 3VBUC 3C7GA 1TMF1 3LIGA 1AR73 2N7GA 2JKXA 3VDAA 5FLJA 2HWC2 1JZ8A 1H30A 4QPWA 4XURA 5BNPA 2WT2A 4UI9L 4LKDA 4D6RA 2YB7A 2W2IA 5CISA 1PX4A 2VUJA 3P3PA 3LIHA 3AP5A 4O9EA 3VL9A 1MEC1 3LSDA 1OD5A 1H0BA 2R0FA 3I2OA 1H9WA 1UMZA 4QPGB 5CZKA 1LCLA 1G9CA 3LFIA 1GP4A 2I07B 2CGPA 4X6RB 2JG9C 1T6GC 1UX6A 2RM21 3I2HA 2Y33A 4Y5Z0 5C8CA 4XFIA 3KV4A 3UETA 4S2FA 3M3IA 2WAAA 3FHIB 5DG1A 3ZYGA 5BNNA 4EV0A 1COV1 3B93A 4GB32 2NP0A 4LBNA 3I2KA 3V0AB 4YW1A 2WYFA 4IQPA 2XGXA 1UYYA 1VAMA 2OUHA 1QDOA 1R1A2 3HQRA 5I8YA 1H1AA 1QGLA 2QQJA 4PCRA 3CHXA 2ZHNA 1D4M2 2J42A 1UU6A 3LGRA 2UU8A 3J8F1 4AEKA 1PO11 4Q8KA 1WMDA 3WF3A 1DYKA 2VZUA 3AYCA 2RHPA 4AHXA 3MPBA 2XVLA 4QGMA 4DRRA 1W6NA 4FTEA 2AC1A 4AEJA 1LGBA 1YQ6A 2KXLA 3MV11 1NUKA 1UN1A 3IDBB 1PK6B 2RS33 1X9TA 1G6NA 2Q0AA 4QQPA 5FUPA 2ARAA 4XJWA 2GNDA 3W21A 3ZR5A 3A23A 2VY0A 3KWVA 4FT8A 4R4XA 1Q8VA 3WW4A 3S57A 4AFAA 3USUB 4BK4A 3AL6A 2ZHLA 4WM7B 3DPRC 4XCBA 4ZZ5A 2ZAHA 1HRI1 1UOGA 4FFFA 1GP6A 1QJY2 1W6QB 1IKPA 1YYNA 4L92A 4Q29A 4RQPA 1UMHA 4NPMA 3ZYJB 4CDQA 1WLDA 3V65A 5L7OC 2NQYA 2YROA 3HQXA 3TN93 1J84A 2XQRA 4MGKE 4E4DX 4TXWA 1V6KA 1UYZA 5DUVA 1IPKA 1J3PA 2HEWF 5IWFA 2DYCA 1QXJA 2PAMA 2ZA9A 2D3SA 2JG9A 3RJRA 1PMHX 2H0BA 4FFHA 5FZ8A 4EN8B 4HSJA 3JB8A 1DQ2A 2RJ2A 3J7HA 3KVAA 2OIIA 4QXCA 2JIJA 3FFQA 4QM8A 4OI0A 3BYWA 4AXOA 1VBA3 4DZGA 5CKQA 3U78A 2A6WA 4IEXA 2VQ0A 2D7FA 1UIJA 4DO0A 4OCTA 1N3QA 3I4IA 3UJQA 2VCBA 5J3UA 4Q4X3 3VBSC 4YM3A 2ZZQA 4A3ZA 1CZTA 1QEXA 1VP6A 1WW4A 5FXZA 2WSUA 5GM0A 5JXGA 2BV4A 4KGGA 5FZ4A 1F9KA 1XJAA 2JDZA 2PA7A 4AF9A 3IPVA 1LU1A 4ES9A 1OLME 5JPNB 2WNUA 3CL1A 4IDZA 4FQ4A 3RWNA 3R4UA 1S55A 5A33A 1ZBE3 2EAAA 2W1QA 3EXUA 1Z7S2 1AXZA 3N7JA 1BEV2 1AYM3 4AEMA 2FDIA 1DP0A 1JU3A 1WA6X 1XRUA 1VBB2 1YO8A 1AR71 2P6HA 3IDEA 4QPIC 4AWDA 4CCJA 5IVVA 3DPRA 4ISQA 2R0HA 1VBE1 2WKKA 4PDWB 2HBUA 4N43B 1DG6A 5IW0A 4L8QA 5JOZA 1CONA 3NAPC 2ORXA 4U2AA 2RDSA 1MZEA 2YC4A 4AZZA 4LITA 4FFGA 4L2NA 1BMV1 2IC1A 5FZGA 1UX7A 1WD3A 3H1WA 3LDBA 4M01A 4ATEA 1A34A 5BNQA 4ATFA 2WR9A 4P5YA 2FDJA 4H3WA 3PUSA 4YPJA 1O4TA 5G05L 4B1MA 1SQ4A 4BH9A 2WLQA 3CF6E 3PL0A 2HWD2 4GB33 1TE1B 1NE4A 4CEYB 4J1XA 2O8OA 2AYHA 2J7MA 2XVGA 3LWCA 3NWKA 1R1A3 4PBOA 1W0OA 5SV8A 3ZFGB 4LHKA 3VBSA 2Z4FA 3JB4C 4CCEA 2NMOA 1D4M3 4EN0A 3FFZA 4BXSV 4X8PA 3TAYA 3VBFB 1H1MA 1F2NA 1GQHA 2Y0IA 3PTRB 4YVSA 4NR1A 3WG2A 4C0BA 1UY3A 1RINA 5JZGC 1IG3A 3IIIA 1S0IA 3QCWA 4BQXA 5LA0A 5DZGA 4D7TA 2JDPA 4CU8A 3HQUA 4AEDB 5M0TA 1FAYA 2RMU2 2RS31 3IAPA 5FZKA 1YQCA 1DLLA 2HWB2 2KR2A 3M7AA 4A42A 5IVEA 2WNVB 4CYDA 4P00B 3FLTA 1U5YA 3VD7A 3NQHA 1SLAA 4XJUA 3WF1A 1QJFA 2QKDA 5F5CA 5F39A 3B9CA 3OBTA 4I0WB 4WM7C 1JUIA 5GZCA 3ILNA 2WDBA 5JVVA 4BLJA 1W90A 5GKAC 3ES4A 4XQWA 2HLEA 2VQAA 1QJY3 3HNBM 5A70A 4UFMA 3AVSA 5IAVA 3TN91 3I2GA 1MQTA 1PX3A 3EJKA 4AQTA 2ZX1A 4XCAA 5FPVA 2W87A 4QKNA 3NO8A 1TEIA 4GD4A 3W59A 3JUUA 4XVHA 3HVDA 5I8TA 3KV6A 3V0BA 2AEZA 3IBMA 2EXJA 1NA1C 2ZX2A 3BTYA 4JGZA 3WF0A 1VBA1 1OQDA 4HK8A 3THCA 4CCDA 1IG0A 1ZRFA 1S0GA 3OUHA 5FOBB 4NPRA 1C8M2 4Q4X1 4MZUA 3VD3A 3NV2A 2YU2A 4NIAA 4AG4A 5BXXA 1RUF2 1XSRA 2BRTA 3DV8A 3C7FA 3D8CA 4A45A 3OUJA 5JZGA 3ZOIA 2HYKA 5FPZA 5FYHA 4A6OA 1PM7A 1C5HA 2QDNA 4GZ9A 5EJ1B 5FZFA 3SCGA 4K9SA 4I2OA 4IL7A 4PLMA 4XQ4A 1ZBE1 4QQHA 1UZZA 2VMCA 4AE2A 1AR62 1AYM1 1Z7S3 4LT5A 1BEV3 4DXRA 1FX5A 1O5UA 3ZVXA 3EQEA 1VBB3 1W3XA 5CYYA 1JYVA 5E16A 1G9FA 1S2EA 3ES1A 5CNAA 3AMHA 1PMIA 4QXHA 4WVMB 3Q8EA 5CBLA 4PDWC 4MGYE 4UYBA 1NLRA 4N43C 2WNEA 5A32B 2XJSA 4R9CA 3T1LA 1HQLA 2ID4A 2ZJCA 4XZPA 2BNOA 5T5LA 1DZRA 3PTYA 2BWCA 4AW7A 2WZPP 2H6BA 5JIUA 2F4PA 1F4AA 4RHV2 1ZA4A 3LE0A 1D0GA 4P9GA 4Y20B 1APNA 5CB7A 5EHDA 4YZ1A 3DYOA 4I3PA 4LBJA 3E6DA 2WIIB 2DWRA 1A78A 4I09A 5B2GB 1JMUB 2DFBA 4BHPA 4AI0A 5FYYA 1QXPA 5ANQA 1NA1A 3SC7X 4GB31 5IK5A 2B42B 4LR4A 4CPBD 4IE4A 2R30A 2HWD3 5JPMB 4AGVA 1UQXA 1YXWA 2QQLA 3SXWA 1ND3A 1ULCA 1RUG2 1R1A1 2PYTA 1HDKA 1KS5A 3ZFGC 1DGWX 2DCKA 4FTSA 2VOKA 2QVSB 3AXEA 1D4M1 2ZXQA 3JXSA 1OLMA 3P6BA 5LK7B 2IXJA 2RS52 1YQ8A 2VMIA 3BOWA 4JGYB 5BYNA 2RS12 1ZZ7A 1NLSA 3KB5A 3WNKA 2K2SA 1O8PA 2O1QA 5F5AA 1H4GA 4KWJA 1HRV2 1UF2C 4QDRA 4AEDC 5GJ6A 5K8SA 2RMU3 3WDTA 3BN6A 2HWB3 4NROA 1YWKA 1MS0A 2G9FA 1FV2A 3WW2A 1ZZBA 4ZONA 3J4UH 4HSLA 4Q0PA 2TBVA 4D7YA 2IFRA 4QU1A 3VKMA 1CAXB 3POGA 3K48A 4XF4A 3VBRC 4ASLA 5FFOC 4HPKA 3WSOA 4UWDA 4HZFA 2A6XA 2ZGTA 4GMP3 3GF6A 1QJY1 4CDXC 5JSOA 2W3JA 2P6CA 2BW8A 3TYJA 3POSA 3Q9OA 2Y6KA 3J7LA 1GKBA 2VVDA 4MSVA 3ZX7A 2LROA 1LEMA 1TNFA 5F32A 3ZDSA 2G9ZA 2DVBA 1C28A 2ORZA 4CXWA 1W3VA 2VZTA 3MIBA 4LBMA 2VOXA 3J7MA 1VPHA 3SH4A 1HV0A 3AMNA 1QJX2 3W5MA 1FPN2 2HYXA 3OSDA 5F1RA 4DOUA 1NCRA 1IPJA 3EYPA 3GZEA 1C8M3 2WAOA 5FQ0A 4KWLA 3M3EA 5DMYA 3A0NA 3OY8A 2GMMA 2E31A 3ECQA 1RUF3 4META 4A3XA 1RUOA 3HT1A 3IIAA 4JDMA 4NHLA 2BBAA 3POFA 1DU3D 1OH4A 3K4AA 2WBKA 5FO9B 1O3SA 4RD7A 5EJZB 3AYEA 3N9PA 1NLQA 2VNGA 4NAOA 1AR63 1Z7S1 3I49A 1BEV1 4R8HA 2LTNA 3T0BA 3ZXJA 2ZKNA 3PMEA 1VBB1 3OUIA 4IEPA 4XUQA 4GKYA 3BPSA 2Q1ZB 3RI8A 3ZYFA 1AJOA 1LULA 1BK0A 2VZ3A 3HD8B 3GXUA 3DN7A 3QBQA 4RGGA 2VW2A 3BPZA 3ZPOA 1HN0A 4LKFA 2VUCA 3MPPG 3NNJA 5IVCA 4INDA 1GNYA 2CAVA 1DYOA 4I0BA 4DUXA 1PGL2 4WV8A 4Q8LA 5CEHA 1KEXA 1PGW2 1JW6A 4MGSA 5GLUA 2PHUA 4O9GA 3BB6A 3ASIA 3M3OA 3IM0A 5LK5A 2FDHA 1YCIA 1DYPA 3MDPA 3UKVA 2QZ2A 4TTGA 1OA3A 1SPPB 3APBA 3PVOA 4IEYA 5LBFA 2YGMA 3ZKYA 2HWD1 3ACLA 5FZLA 5A3MA 2XLGA 1RUD2 1L7LA 1JN2P 4UAPA 3I3BA 1X8MA 5F2SA 5KHHA 1O91A 1RUG3 4P08A 1KDKA 5FYIA 4IV1A 1KGYA 4RGKA 2JB4A 1HQWA 1Y9QA 4XIKA 3ZSKA 3RQ0A 2RS13 1UXZA 3GGLA 2BPA2 3MIGA 4YNIA 5FZOA 3ZFEA 1WMXA 2IXLA 1HRV3 2R063 2RMU1 4G4FA 2WWUA 2XONA 3AZYA 2HWB1 2BZDA 2HEYF 4IE6A 1I3HA 2NN8A 2A7AA 2RJKA 3CJIA 3NKGA 3ZFFB 5CA6A 2XB6C 3K75B 5A6XA 4XIOA 1DQ6A 1QJU2 2JKBA 3KHCA 3SQOA 3I2DA 1OF4A 1Z0HA 1YIFA 4YWAA 5LEKA 4GH4A 2VPVA 2A5ZA 3AMPA 4GMP1 5IK8A 3E6CC 3ACIA 1UZVA 3QLQA 1EYBA 3A4UA 4YZ2A 1HB1A 3RZHA 1UAIA 1PZ9A 4XF9A 1EV12 3KT4A 1FYUA 2BVBA 1VRH2 5ERLA 4FXGB 3RPQA 3FUQA 4BISA 2CTVA 3IB3A 2F4LA 4JKMA 4WM8C 1CAWB 2OW4A 2GH8A 1UYPA 4CDUA 3LDKA 1C4RA 3OOXA 4GAZA 4TLFA 1GOFA 3OGRA 3T4VA 4DINB 3THTA 2FDFA 3D3AA 2WT1A 1GZWB 1BHGA 1N3OA 1NXMA 1QJX3 4XBLA 4PLNA 2C26A 3M1HA 4Q4Y2 4QB1A 1C8M1 2CHHA 3AFKA 1QF3A 2J1VA 2XWBB 1FMD2 1QDCA 3K4ZA 4MLOA 2CGOA 4QQLA 5C9AA 5JSPA 1RUF1 4JHZA 1SHWB 4AHWA 2QQUA 2VMDA 4GWMA 4YZ5A 4M4RA 1RGSA 1WMEA 5J36A 1QXRA 4Q0UA 4QDSA 3TEWA 5C33A 3BIEA 3BTXA 1HIXA 5GZFA 5FMCA 5C4WB 3PU3A 4Z92B 5FXXA 3ZYHA 1AR61 2C5DA 1ULOA 1J83A 2UWAA 2VQTA 5A7NA 1N3PA 3IZOA 2B8MA 2ZHMA 3BOPA 1W2NA 4P9IA 3A21A 3RI9A 4E4HA 2OVUA 1XU1A 1IS6A 1XYPA 2LW8A 1UY4A 2EICA 4TN7A 1SMVA 3KT7A 2ARCA 1DGLA 2VZPA 2VZRA 2VM9A 1X82A 2QQMA 3KHBA 2Y6LA 4KQ7A 5F3EA 4BQWA 5DABA 4Y4RA 2QQPA 2DUPA 4RHV1 4WBBA 5A7QA 5C71A 5GZGA 3LPFA 5JMCA 1RUH2 2OZJA 2DCJA 4L9BA 1VLNA 4FOQA 1W6NB 3UJOA 5L36A 1XNBA 4AQ6A 4D8MA 3I3DA 2VVEA 2VC9A 1X36A 1VRBA 4FPHA 1H4HA 4YGCA 4AHZA 3LEIA 5H9RA 4A7ZA 1TZOA 1WA4A 3AB0A 1HV1A 4BJ0A 2VULA 1RUD3 4XUNA 4BLIA 2JICA 2PQSA 1RUG1 2ZEWA 2G4IA 2W9XA 4XTMA 1LNSA 3NJVA 4URAA 3TEXA 4M3CE 2CDPA 4FOVA 4LHLA 3UGHA 2J1AA 4PQ9A 1ULDA 4E8CA 3ZO0B 5FZ0A 3KT1A 3WINE 2RS11 3DGTA 2B39A 4CA9A 1PNFA 4C0HA 4HKWA 4XC9A 1EY2A 1SBDA 2JB8A 4LIUA 4OHXA 4RA0A 2VXJA 2R061 1Y4WA 1HRV1 3QACA 5FMOL 2E9QA 1FI2A 4OI1A 5FYCA 4XHBA 3ZFFC 2JG9B 1LOAA 5J96B 3KM5A 5C3OA 2WC2A 1I5PA 2RM23 4LK6A 1XC6A 2OX0A 3LOIA 2Q8OA 1QJU3 1HKDA 3RYRA 2D6OX 2VNVA 4CP0A 5F3CA 1DGWA 4LA3A 2RV9A 1JZ6A 2VBDA 4FO9A 1JBCA 1RTVA 4XABA 5H9SA 3E5QA 3CDZB 1R092 4AI2A 4EWEA 2QDRA 1WCKA 3KS7A 2X29A 2YG0A 1LTEA 1KJLA 2J1TA 3WLUA 1Q8OA 4YW7A 1SFNA 4CE8A 4WVVA 2W68A 2UURA 3CJXA 1W6PB 3VHPA 2B5HA 5J1XA 1X50A 3GBFA 2FHRA 5FYVA 2VMFA 3W9AA 2UYBA 2WNUB 4OYUA 5LRSA 1POQA 5A33B 2C1FA 3HN1A 4IE0A 2ENRA 5BY5A 1TVGA 2D6NA 4KBZA 1JZ7A 3AZXA 3AC0A 4UFKA 4Y33A 4D6SA 4EWAA 2QFEA 1DGRA 2GNMA 1QJX1 1FPN1 1LOFC 3CZUA 4AHYA 2WLPA 2A70A 3R0RA 4AFCA 5IT6A 3RG0A 1GWLA 1DZTA 3DPRB 3ATGA 2D5HA 3WW3A 1HJFA 3OD4A 4CVUA 5L7OB 2W1UA 2ZGUA 3RWKX 5BNPC 1AL0G 1J3RA 2P1BA 1O3TA 3UGGA 2VZ1A 2VTFA 2BOJA 5FRAA 3POIA 2V09A 3M3QA 3I3MA 4XBQA 1W39A 2L9LA 2W52A 3P5BA 5DAVA 1R082 5JDBA 3VZOA 2MEV2 1STMA 1HJGA 4X8NA 1UZ0A 1OA2A 2Q1FA 5C8CC 3RZJA 1WW6A 5BNNC 1AX1A 2B9VA 1SLLA 4GJZA 4MGTA 5L9VA 2D93A 2UYAA 3WP5A 4DXZA 4A7KA 1CIWA 2OXBA 5HCBA 5FZ1A 1XNKA 2UY9A 3L9JT 2BOIA 2K9ZA 3VBSB 5GZDA 1PGL1 3PIJA 2G19A 4EE2A 3NVCA 1GWMA 5FJKA 1PGW1 4YVSB 3CZJA 5JSRA 1TQ5A 2TUNA 4HK9A 4R9DA 3PJYA 5DPNA 4QPYA 2E33A 4BQ1A 1JS9A 3VD9A 4QDQA 3I2JA 2D98A 4OMDA 1AX0A 3RZKA 4XDOA 2ZS6B 1WW5A 2BDRA 4CDWA 3ALQA 4BQ3A 1RUD1 4Z07A 4CTEA 3MFAA 5J48A 2CGNA 3JD72 4QPIB 4UW4A 1ST8A 1W9SA 3NRUA 1VBE3 2DCYA 3H8RA 4W8JA 1O4ZA 2A3XA 3N36A 1YRZA 2YZ4A 2Q4SA 3DYMA 3NAPB 4MO3M 2XVKA 4RQPC 4QGNA 4CDQC 4K8RB 2J22A 2EIEA 4QMAA 4UW6A 3WX5A 4XFBA 1HN1A 3H8XA 4QKFA 4GXLA 1VALA 1DFQA 2GSYA 2SLIA 2YPDA 1REDA 4IV3C 5ABJA 2XJRA 1QJU1 5I0DA 2FBEA 3MZHA 4QX2A 2GP3A 4JX0A 5JR2A 4EYUA 2A71A 4G3YC 1WW7A 4AOCA 2ZGSA 1JUHA 4RYDA 3AP4A 1EP0A 5IFTA 4UBHA 2WJSA 3WG3A 4O65A 4YZ4A 4YGBA 1R093 1EV11 2R7EB 2WZ8A 5F9TA 3PUQA 2DU0A 1QNWA 2JG8C 5GLZA 5JUVA 5CAZA 5JZGB 3LF7A 4GALA 5CFDA 1CAVB 1YNAA 2JWPA 3NV4A 4FBFA 3H9AA 2WNUC 1OOPA 1C3HA 4OUEA 2ADDA 2ZMKA 4M3CA 4XUTA 5DAXA 3WT3A 3INAA 4FCAA 3NKTA 5FO8B 4XYXA 5FBJA 4NHYA 1WZXA 2GDFA 4YG3A 2PLV3 4CCNA 3HWJA 3EHKA 1IS4A 4KL1A 3ROUA 4DXTA 3N7MA 5FZEA 1IPSA 3FL7A 4K1YA 4F7ZA 4TLGA 3BGAA 4JAAA 3U14A 4BM8A 1YQ5A 3DKQA 4CZSA 3WQ1A 3FN9A 3NNMA 3MO4A 1MS9A 2VR4A 1HXS2 5DG2A 3OPWA 5FOJB 2D40A 1MVEA 3AKQA 2C9AA 3UKNA 3MIFA 2B4KA 4NRMA 1W6OA 4JQRA 4LHNA 4IV3A 4KH9A 4OQ8A 1RXFA 2DDUA 1CX4A 4AVVA 3ZXFA 3A7QA 1W2UA 4UW3A 1RHI2 2YC2A 1Q5OA 4JDNA 1NA1B 1ZZ8A 2VBBA 2ZGRA 1XSQA 3FC0A 1ODNA 5AVPA 3N4MA 2ZEYA 3OD0A 5FY5A 4QX8A 1ND3B 2JDKA 3VV1A 2V5DA 1AL22 4KWKA 4LOTA 3N9LA 1DDLA 3BALA 3ZM8A 5IVFA 1HB3A 3T0AA 4BZ4A 3I59A 2JG8A 5A80A 2ZOEB 4XJ9A 3KGLA 2KA3A 4YVSC 3NJYA 2R49A 4UFHA 5BPXA 3DXUA 2VG9A 5HPOA 1RUH1 2W39A 3H8OA 5D8AA 3WDXA 4DRVA 4YM0A 1ZRCA 3S7EA 1XPWA 5FP7A 3U07A 4JQTA 2XOMA 3T2OA 3RGBA 1ASJ2 2C6SA 2CWMA 1RITA 2PHDA 3VKLA 1JOBA 2BBVA 3MBWA 5CKMA 1CIYA 1DLCA 1UCXA 4BIFA 1RUE2 5J37A 1QOTA 4OLLA 3JD73 4NPLA 4QT6A 1D0HA 4HPKB 4P02B 5FAXA 3J7NA 5E8AA 1V70A 2HWC3 1UMIA 4RS5C 3SMHA 2V73A 4WVWA 1XE8A 3CMGA 3D4KA 2AGSA 4OHZA 3LA3A 3Q8AA 2CU5A 3DCQA 1MQTC 4LHSA 5IFPA 4MHUA 4ISRA 2VCCA 3AKPA 1QOOA 4XDQA 5FV3A 4COZA 4F3JA 1H2NA 5T50A 2JXAA 3SNMA 4HL0A 1PNGA 3HAGA 4BCUA 2Z79A 1W2AX 5FWEA 2AENA 1XBFA 4NIIA 1Z78A 5LBCA 4MGIE 2XJVA 3OJBA 4JGZC 4XZUG 4E4SA 2EF6A 3M70A 4Q4W2 3O1TA 3BTZA 2I2SA 3MEPA 1WUVA 2EVXA 1W6MA 4BOWA 1R091 4LPLA 1OLQA 4QX3A 3OY8B 2VOVA 2VL4A 5A7WA 5D2AA 2ZGLA 4M3CF 1B09A 2ETEA 2VVFA 4AVBA 5GLVA 1ULGA 1EPWA 2HBTA 3WP3A 4BK5A 5FBZA 3RVHA 3MIEA 4HN1A 5FP8A 5EQUA 1QMJA 1MS8A 2KM2A 1QWRA 2HJIA 2OS2A 2P3YA 2PTMA 2V5YA 1UZWA 4AVTA 2OZ6A 1JOJA 5I0RA 3TBDA 4MGZE 4YYOA 2PLV1 4COVA 4UFLA 3VBRB 2D97A 4XUPA 2XG3A 4EN6B 4RS5A 2EXIA 4FPJA 1UIKA 2Z2SB 2Y26A 2VXRA 4CDXB 2XQXA 4NN0A 2Q30A 3NNFA 1XU2A 2AEYA 2R072 4CRQA 1HXS3 5JOWA 1F8VA 2IXHA 1MPXA 2P2KA 4HT1T 1OMIA 2EXHA 2Z5WA 1QOSA 2J1EA 4Q4V2 4Y1YA 3T1MA 2WZR2 1W03A 2WS92 5JLVA 2VH9A 4QXBA 1W9TA 1RMU2 4BQYA 1H8TA 3PUAA 4PIZA 5F3IA 2EA7A 3GDBA 2VTXJ 2VZVA 1RHI3 4E27A 2PHWA 1YJLA 1W8UA 4XEZA 3CEWA 4Y26A 3THDA 2Y64A 5JI9A 1W8FA 2W46A 4U36A 3KZ4C 2WFPA 3VHNA 1JHJA 3AZVA 1ND3C 1GQGA 4WVZA 3V64A 1VAKA 1GP5A 1ZBA2 2ZTNA 3ITQA 4LK7A 1AL23 4IV1B 3IWZA 1J3QA 2ES3A 1AJKA 2XKPA 4MXVA 3FBMA 3ZPYA 2FD8A 3WEZA 4CXYA 4QPGA 3AP7A 1GFF2 3ILFA 3BKZA 2ATFA 2LALA 4W6XA 5LASA 3WNMA 1G9AA 1BK1A 2XUEA 4XMAA 2QTWB 5I8SA 2D3PA 5FZOB 5A3OA 4Y1ZA 5HI0A 1O4YA 1ZYBA 2W1WA 3IN9A 1FOD2 5KBFA 5A6QA 3V0AA 3POWA 5FZHA 3OGSA 2O8QA 2P34A 5LRRA 3AMMA 1ASJ3 3CJIB 4A2UA 3O12A 4XF0A 4LO6B 1JU4A 1CD3G 1YI9A 2FQPA 3JD71 1OSGA 1RUE3 5KXEA 1EAH2 3LDRA 4OZXA 1D2QA 1AXYA 1Q8QA 1PVXA 2HWC1 4GH4B 3RS6A 3POYA 4A44A 4PHZA 4X6QB 2E7AA 3SKVA 1VBD2 1ZZ6A 5A3NA 5IVBA 3KQRA 5GLTA 3RMXA 2WUHA 3SHRA 3G7DA 3LA7A 4F8AA 3T2PA 1Q3EA 2V4VA 2ZKLA 1PK6A 4OUMA 4PF1A 2YC0A 4LLFA 5HCFA 3HNYM 1W0NA 3P1IA 2VTXA 1XE0A 3I3EA 4ET7A 4OULA 5IK4A 1YLLA 4FPYA 4FPCA 4IGQA 4DEVA 2X5IC 2VCMA 2QQNA 3USUA 1GICA 4CDUB 4Q0VA 1JZ5A 5DUXA 1HQNA 1HLCA 1ULPA 3VDBA 4OHVA 2EIGA 4NHKA 1W6QA 4JTNA 4AFDA 3RNSA 4Q4W3 4F83A 1OF3A 1NCRC 5I0UA 1NKGA 4YVWA 3RZGA 1X9PA 5C9AB 1V0AA 2VECA 3FUOA 4Y1UA 3KLSA 4FXKB 1ZX5A 4ZZ8A 1K42A 3BUCA 1DF0A 3VD5A 3FWEA 2IXKA 3PDQA 4KWUA 1RXGA 5T52A 1OHFA 2FMYA 3C3VA 1JYXA 4WZFA 2JDMA 1YFXA 3M3CA 1URXA 2CNAA 3K3OA 1T6BX 4BQ5A 2RDRA 4ZXKA 3C2UA 1GOHA 3LQCA 4XFCA 4FPOB 4KGQA 5CKNA 3FBYA 5KWRA 4JKKA 3T08A 2XBO2 3WD5A 1GZ9A 1FNZA 1UPSA 2QZ3A 4IE5A 4D94A 1F15A 4L97A 1LKNA 2ZHKA 3FHQA 5JCTA 1B35A 3OGVA 3H3LA 2GNBA 1CQ9A 2D6PA 1HXS1 3NJZA 3O5SA 2E26A 4L0PA 3QOPA 4L99A 4OVEA 1NCQC 1OLRA 1QJEA 2BNNA 4HKOA 2XJTA 4B4RA 2CWSA 2DUQA 1XQNA 4Q4V3 3WZ1A 2WZR3 4WM8B 2WS93 2X5IA 4UXAA 1RMU3 3AVRA 3ZXLA 2FCTA 1RHI1 3AYDA 4GJYA 3B3QE 5FYUA 3T4HB 2ZEZA 4HLTA 4PQQA 4W4ZA 4C1WA 3H1YA 3T2QA 2XJUA 4HVOA 5FTTC 1AL21 1ZBA3 3Q8CA 2JDHA 3WHUA 4IV1C 1W8TA 2K0GA 2PHRA 2OYZA 4LLOA 4N7IA 2QNKA 4H14A 5LATA 4COYA 1D4VB 2MPFA 2ET7A 5HXMA 5C5UA 3ST7A 1PM4A 3GHMA 4IEQA 3ZFEC 4R4ZA 2Y6JA 1CAUA 1GWKA 4MADA 3WNNA 2PFWA 1FOD3 1FATA 5GLWA 4CEYA 1ASJ1 3CJIC 3MUZ1 5KHGA 4YFZA 1NY72 5BNNB 5T5JA 2J1UA 4IGOA 1RUE1 1S2KA 1GNZA 1L7QA 2QQWA 3VBFA 5DAWA 2VUAA 4N9IA 1Y43B 1EAH3 2HH9A 4N8MA 5DZEA 3ZSLA 4GH4C 4P5HA 5D1IA 2XPJA 3N9NA 1SEFA 4QX1A 5CFCA 1VBD3 1SBEA 3AJZA 3O1RA 1PO22 4M4PA 1LHWA 4LBQA 1N1SA 3LFMA 2ZZJA 3K46A 5FK8A 4LMFA 1NCQA 3O1SA 1ND2C 2NPIA 1G86A 2WNVA 4RHV3 3MLKA 1Y9GA 3WNLA 4Z8BA 1ENXA 1RVF2 1WWYA 3I2IA 4EJRA 3KGZA 2CYFA 3WP6A 1ZRIA 5EXOA 3GCWA 2WT0A 1X7NA 3CLPA 1LHVA 4EROA 1PZ8A 2UWCA 3ZSEA 4CDUC 3OGJA 1SACA 3KV9A 4ZU4A 5JOYA 1G9BA 3AFGA 1V00A 4YLZA 2PAEA 1LOGA 2VMGA 3N7LA 2EALA 3H0OA 2E63A 2X8KA 3NJXA 4NHMA 4YM2A 4Q4W1 3BI3A 5FO7B 2OKXA 4XTPA 3NNLA 3O14A 4KMQA 3SEPA 5FY8A 1XXNA 4WZCA 3WHTA 4FAHA 5E6HA 2RS53 1LHOA 5C9AC 1P8JA 4QD2A 1S2BA 2BNMA 3AZZA 1OPOA 4J6GA 1M4WA 1Q8PA 1IS3A 4CCMA 4AGRA 1UWWA 3B00A 5FPBA 4QQ2A 2DVGA 3RFRA 2FCVA 3ZSMA 1QQP2 3BU0A 2LS6A 2PQQA 3I7DA 1S0BA 3I97A 4DY5A 1QU0A 3N9MA 3H8UA 5A3TA 2WO7A 5A3UA 1EUUA 2WO3A 4MXWA 4ZU7A 4XDPA 1KJRA 4QB2A 4AI8A 3ZMOA 2Y0OA 2W94A 2HWF2 1HB4A 3RRDA 2PN5A 1UU4A 2VNOA 1MS4A 4H7MA 4DPNA 3LA2A 1OUSA 2E32A 2XBO3 1CN1A 3IMNA 3DECA 2JX9A 1WLTA 4EN7B 5AFBA 4LULA 3W58A 2OQ6A 5L9RA 1ZZCA 2A75A 4GWJA 3RMYA 3VN4A 3RZMA 1ND2A 1WCDJ 2R071 2VE1A 4CUCA 1E5RA 4JKLA 1LENA 4P14A 1C5IA 2AR6A 2NZ9A 1F5JA 4FQZA 5C3PA 1MZFA 1O6UA 4FP2A 4Q4V1 2WZR1 5CU1A 2WS91 3RSJA 3ACFA 4BU2A 1RMU1 4Y3OA 3USSA 4CCLA 4WVMA 3VKOA 1KFXL 5APAA 3E5XA 5FYZA 5T3NA 5EPAA 4ASKA 4YW5A 5T5PA 4CDWB 5IAXA 5IATA 3D5OA 4CP9A 3U0ZA 4QHZA 2PELA 3ZN6B 4C8DA 3SH5A 1FPN3 3PURA 3THPA 5C6CA 1ZBA1 2AUYA 3AM2A 4YARA 4RGAA 2DUOA 2GAUA 2ZEXA 5JI7A 1PO12 1V9U2 2PHTA 3IDAA 3OBAA 3DKWA 5IK7A 2VU9A 3CBNA 4N53C 1TME2 1W05A 2JDUA 3WNXA 3LEGA 5LW9A 1FV3A 4PIYA 5BNPB 1CESA 1KITA 1Y3TA 1JTZX 2ZABA 4AYUA 5FWJA 4K20A 1V6MA 4BDVB 3HOBA 4XBNA 4A7YA 5DUWA 4C1XA 1FOD1 1LESA 2F17A 3EBRA 4Y1XA 1K5MC 1O5LA 1CZSA 1QH6A 3UGFA 1A6CA 2RJLA 5L19A 5GZEA 5C8CB 3WW1A 5ABJB 2DFCA 2G9GA 3T2TA 4GA9A 3OPTA 3T09A 3TWIA 2WQZC 3OTFA 4QX0A 2YUEA 2X53S 4R9BA 3RYPA 3FMGA 3NL1A 1EAH1 4RFRB 2LM3A 5I0TA 2IXIA 2WQ4A 4CCCA 3TEZA 4D3WA 2GU9A 3I2FA 5DDJ2 1NXD1 1VBD1 4D0QA 2A3WA 5B4NA 2GP5A 2VGDA 3AJYA 3H3ZA 3PVEA 2BEOA 1PO23 2D6MA 1YEWA 4JRAA 4S2GA 4CP1A 2VMEA 4C91A 5HBAA 4Q26A 3TRSB 4IGPA 2W0XA 3QD6A 4AI1A 1RVF3 3PUHA 1NYWA 1NT0A 4FPGA 1SZBA 2BGOA 5B4XA 4IERA 4Q2FA 2QQKA 1VAVA 2FCUA 2QQVA 4I0AA 3SCHA 3WXPA 2BUKA 1YFWA 1IQDC 2DU1A 4HG6B 4SBVA 3O1MA 4M3CB 4O7XA 4NIDA 3JCIA 3IDCB 3KSCA 2VO5A 3PNAA 2IXCA 3MV01 4NIGA 4AQ2A 5LB6A 2ILMA 4P9XA 2RS51 4N53A 2B45X 2RR12 4B8EA 4NIHA 1GBGA 3N9OA 4RQPB 3RZZA 5FZ6A 1BXHA
chains in the Genus database with same CATH topology
5E88A 1MZ5A 2XLFA 3N7KA 4K21A 4IEOA 4HVQA 2ZX4A 1BKZA 1X33A 2YPJA 1U5XA 1K5MA 4K7JA 1GR3A 5L73A 5KXDA 2NM1A 1SCRA 2D3RA 4M0NA 4IV3B 1PVC2 4ZU5A 2WFF2 2HWF3 1VJ2A 1XNDA 3ZXKA 1D2SA 4AK3A 4AVSA 2ZGPA 3GNEA 4AVCA 2XBO1 1G7YA 3ZYPA 3WCSA 3ZIWA 1LU2A 2EAKA 2O0OA 1DZQA 1POV3 1EV13 3MFCA 1VRH3 2JG8B 1WBLA 5CIRA 3OPZA 4FVVA 4I02A 4RL7A 3IPVB 1MACA 3WDUA 4FPLA 1DHKB 3MF6A 2DVDA 4XQDA 1RJ7A 1ZZ9A 2XLAA 3AYAA 4CDWC 1UKRA 3I54A 4GMP0 4LE4A 5KHKA 4D69A 2BQPA 1SDWA 2JE9A 4Y1VA 5DXDA 1ZVFA 4JRLA 4Q4Y3 1BZWA 1OQEA 3ZXAC 1FMD3 1CJPA 1V9U3 5EFUA 1SCSA 4FPFA 4GKXA 3SCFA 1TME3 1ONAA 2TEPA 2A3YA 4PLOA 3AZWA 4NO4A 3WP4A 5K9YA 1OQ1A 5K0UC 4LBLA 4YW2A 1N47A 4K6BA 5EZWA 4Y24A 2ZCWA 1NY71 5IUQA 1XE7A 5ABJC 1BYHA 1ALYA 3B5LB 5CG8A 4XJ8A 3U4XA 4XJAA 2DVFA 4HN0A 3G6JB 5J98B 3K51A 1YJKA 1LODA 2ZGOA 5BNOA 5DDJ3 1J1TA 2FMDA 3VDDC 2UY8A 2B46X 4QU2A 1PO21 2R1BA 1W6MB 1Y7BA 1LOEA 3GZAA 5AFEA 1VB2A 4JVAA 1SLCA 2DF7A 1I5ZA 4W65A 5FREA 3HR9A 3TB0A 3JQWA 1RVF1 1F31A 1RUH3 5KC6A 3SLIA 2D6KA 2CV6A 2OA2A 3UKTA 5CFDC 1JH5A 3UV9A 1OOPC 1GV9A 2WA3A 3KCXA 3TNQA 3MLJA 4YGEA 1QY4A 4AFMA 2WSVA 2HKXA 2DTWA 4RS5B 2RR13 2LUWA 2CAUA 1MVQA 3VBHA 4BWOA 5K0UA 1CPNA 1MQTB 3WOGA 1MS1A 4ZKTB 4P9JA 2DVAA 3IKWA 4RFT0 1YUDA 1SLBA 1WCSA 1MZ6A 4DS0A 4ORFA 1PVC3 2HWF1 2C0ZA 3OYWA 2XWJB 2WFF3 1H8TB 1RUI2 3HT2A 5EYYA 3RYKA 3V0BB 1VBC2 1ULEA 3PVBB 4JGZB 1NOVA 3O7OA 3VDDA 5AC92 2YHJA 3ILRA 1POV1 4RR3C 5C4WA 3NV1A 1VRH1 3O0WA 2OPKA 3ME2A 2ZACA 2BFUS 4H55A 2ZGKA 3AKTA 5D8AC 2XUMA 4MVTA 4TSVA 4DQAA 3LZZA 4NWVA 4CEWA 3GZUC 2E53A 1QHDA 2BTVC 1KS4A 2A73B 2NYYA 4Q4Y1 1OI6A 2NMNA 1FMD1 4OUSA 1V9U1 3ZXGA 3AK0A 1TME1 1REEA 4QX5A 4LO8A 4W6WA 4Y22A 1RUJ2 1FXZA 4DFSA 4LBKA 3FLPA 5I93A 1IOAA 4MV2A 1NQDA 3VBOA 3KD4A 1R083 2PAKA 4HKLA 1AUYA 2MEV3 3VBUA 5J09A 3M4FA 1KFUL 3OCPA 1IHMA 2DTYA 1RUC2 1ZREA 4YG6A 2XKOA 5DDJ1 2D5FA 3J9SA 3VZNA 4LUKA 4RR3A 4YVWB 3L2HA 4BIOA 1XYNA 1DIWA 2DCTA 4COUA 1QNYA 1S0FA 3SISA 2Z42A 2QCSB 4LUMA 3RDIA 1Q43A 5I0SA 5KC5A 2BWAA 1SLTA 1CR7A 1NE6A 5F5QA 1AR92 1FT9A 2P3JA 3QH7A 3HBZA 1BQPA 4XETA 1OFSA 4R9AA 2E6VA 1XYOA 2BGCA 1U5ZA 2JD4A 2P3IA 1V6LA 4FOWA 4JDOA 4K3UA 2RR11 3LKJA 5DZFA 3RJ2X 3PMSA 4B7KA 1W6PA 3ELNA 4QQOA 5GALA 5CADA 4HETA 5H9PA 1N1VA 3U10A 3CU7A 1B35B 2WA4A 5AVAA 3P3NA 1C1LA 1R1ZA 4Q27A 3S7IA 1PVC1 3WDYA 2WFF1 2X5IB 1H8TC 1YFUA 3MYXA 1RUI3 2YV8A 3ZN5A 3S30A 4EN9B 1IKQA 1VBC3 2Q1MA 5E89A 5L7OA 4E2SA 3WDVA 1NCRB 5AC93 1GANA 3ZN4A 5KXCA 1KDMA 5KHIA 5FQ0B 1AZDA 1U12A 4QPGC 3B69A 4OHWA 1ENQA 1YI7A 2E51A 3AX4A 5FCCA 3VZJA 4XXPA 1J58A 1W0PA 1CAUB 4XFAA 3O0VA 2E7QA 1S0JA 1H8VA 2SBAA 3X29B 1DQ4A 2B9UA 4GIQA 4HFSA 4AFBA 4TYSA 1KXGA 1I6XA 1POV0 3NW4A 1UL9A 3BCWA 4MUVA 1CJDA 4K40A 2FZ2A 2R042 1BVVA 4FPEA 1S1AA 5CFCB 4Q0SA 3KMHA 4S2DA 4XFFA 3VLBB 1RUJ3 2ZMNA 4LBQB 4OI2A 4OI4A 5T55A 3AKSA 1PK6C 1NCQB 4AQSA 4BMBA 1R081 3CO2A 4URTA 2MEV1 1H2LA 2ET1A 4QPIA 4XOGA 4BPZA 1AYN2 1RL3A 4Q1PA 1V6NA 4FP3A 2GH2A 4XXAA 4J1WA 4P9YA 3NAPA 1RUC3 4IESA 2ZGQA 1V6JA 2GALA 1OKQA 4LTAA 4XF1A 4YVWC 1MS3A 1SFYA 4DY3A 2VOWA 4FPKA 3JZVA 4XF3A 2YXSA 4KG0A 2YY1A 3ZFEB 2PHFA 1AXKA 3LSEA 4B4QA 2DCZA 2GZWA 4MXWB 2ZX0A 3KCYA 3FLRA 1I1EA 1FNYA 1LGCA 1LHNA 1A8DA 3JBG2 1AR93 4P9WA 4XJZA 2EXKA 5EV7A 1DGRN 1ENSA 2GNTA 2ZBJA 4YG0A 3HIFA 3GALA 4PF5A 2GMPA 1CAVA 3GZTB 5BUVA 3PHMA 1B35C 1ND2B 5HXVA 3SH3A 1H2MA 4NWWA 2AZ5A 4S2HA 1H9PA 1F5FA 4RSUA 2HWE2 4MYEA 4WM7A 5EWSA 3WVJA 1RUI1 3FZ3A 3EO6A 5T5OA 3O0XA 3TOJA 1KRIA 2QUOA 1VBC1 2GC1A 3E97A 4N90A 3VZMA 3QH6A 1L3JA 5AC91 2VMHA 3FJSA 2Y38A 1YHFA 2I74A 3R05A 3L2YA 3U11A 1UW8A 2JECA 4C90A 3LCPA 3N35A 3ZYIB 1N1YA 4GULA 3AP9A 1HW5A 1ZM1A 1DQ1A 2H0VA 2IZWA 1WLCA 4Q0QA 1KD7A 4D7SA 5JOXA 3MIHA 4CEYC 3S0MA 3V56A 3E5UA 3GYDA 2I45A 3BTAA 3VBFC 3WY6A 1I9RA 1J1LA 4AGGA 1AVBA 2R043 4XMIA 3AMQA 3H7YA 5CFCC 1E57A 3WCRA 4BA6A 4OHYA 3E6BA 4PBPA 1RUJ1 3B02A 4IETA 2R062 1RIRA 2DURA 2R073 4KU7A 4E9KA 3ZXEA 4KNCA 2WNVC 2D6LX 3MW2A 3ZYRA 1MS5A 3NV3A 4NVPA 3H50A 3LOBA 1H1IA 4YRDA 1AYN3 2B7YA 4PDWA 5K7PA 4I01A 4N43A 3B94A 4Z1VA 1RUC1 5JR7B 1WLWA 3KCCA 1VR3A 5JIAA 1AR82 4N53B 1NG0A 3JQXA 1BVP1 2Z69A 1CGPA 5KXBA 2R1DA 2OUJA 2WWSA 4ASMB 4YW3A 3M8LA 5BV6A 1ZNPA 3GBGA 2R32A 1K5MB 1Q56A 4XFHA 3ZFGA 1AR91 3JBG3 2JE7A 5CVRA 4COWA 3D0SA 1BBT2 3GBWA 1DQ0A 2F6BA 3VZLA 3VKFC 1ENRA 3NSTA 4L11A 2GN3A 2UWBA 1C57A 3D0JA 2Q5TA 2WINB 2YMZA 3OF1A 3WG4A 2XL7A 3ZXDA 5J7MA 4I30A 4AEDA 3DL3A 1PHMA 4UW5A 3CNAA 5FPXA 1IGOA 1OA4A 1YIPA 4LEJA 1AX2A 4N7UA 3R4DB 5ACA2 3FE5A 1G9DA 3VBRA 5LEJA 2HWE3 3LAGA 5HCAA 4LO7A 1UPIA 3PVNA 5EYXA 4CDXA 5H9QA 2QE3A 4E2QA 3PLQA 2ZGNA 4Z2WA 2ZAAA 1ZRDA 4G9SB 1BJQA 1PIV2 4YFWA 3WQ7A 3WDWA 3R6SA 1JYCA 1ZRRA 1GNHA 1OPMA 4FSJA 4V1PA 3FX3A 1EPZA 1PGSA 3WQ0A 4AI3A 2JJ6A 1LRHA 4QGLA 2R16A 3DF0A 4DB5A 1H2KA 1A3KA 1J59A 5E1RA 2ZMLA 1S0DA 5A3LA 1RJ8A 3MW4A 3ETQA 2PHLA 1TMF2 4XHXA 2RE9A 2CL2A 1G8WA 2CY6A 2A6VA 4JGYC 1CPMA 2R041 5BNOB 2W08A 1MEC2 4ES8A 1TNRA 3VHOA 2JENA 4I3GA 2E7TA 4UBGA 1LGNA 2ARXA 3D82A 2RM22 1VIWB 2IFWA 4PJYA 4BYYA 1COV2 1AYN1 5EJ3A 4HVRA 1C1FA 3H7JA 5JWPA 5A32A 1LJ7A 1RUNA 4GWNA 3J26N 4CP2A 5SV5A 1AF9A 4QM9A 1OFNA 1AHSA 4FAGA 4ITCA 4M00A 1N1TA 2GC0A 4DMIA 1DQ5A 2GN7A 1QKQA 3J8F2 3MW3A 3BU7A 4Y20A 3MICA 5JAXA 1SLIA 1AR83 2YYOA 3I8TA 1KQRA 3LB9A 4LNVA 3VBHB 3JU9A 3A0KA 1MR5A 3N3HA 2NLRA 5K0UB 5KHJA 3S6PA 1LOBA 4B3NA 2VW1A 4K8FA 1U5IA 3JBG1 2ZX3A 3H3UA 4N9HA 4XE9A 2AREA 4JV4A 4LBOA 4LO5B 1S0EA 4XFGA 3OYWB 1GSLA 4IEVA 1BBT3 2AH2A 1HRI2 4JGYA 3ZIXA 1SBFA 1YFYA 4YSFA 4K1ZA 3VL8A 1C8NA 2JEMA 2XJQA 3VDDB 1VB4A 2TNFA 2P17A 2ZGMA 2GC3A 1V6OA 2VW0A 5ACA3 5CFDB 1CAXA 2H6CA 1O3RA 1OOPB 1LEDA 1UD1A 2HWE1 4CEWB 2VNRA 4W6YA 1IS5A 3GHNA 4TZDA 3B9IA 3MIDA 4FOYA 3WR0A 3WUCA 3URFA 1PIV3 5T54A 4JC1A 4E2GA 4QXKA 4B7EA 2DV9A 1A8MA 1CVNA 3AP6A 3B01A 4WM8A 3MI8A 2MNGA 4Y22B 2WL1A 1QQP3 4JTOA 1V6IA 1QH7A 1Q8SA 4LBQD 4Z82A 3WUDA 5TSWA 1LOCA 5F6KA 4Q1RA 3UL2A 4IEUA 4OFGA 1REFA 1W6OB 3VBOB 4FTBA 3VBUB 2ZPXA 1AR72 4YZ3A 1RC6A 1TMF3 2ARBA 1VBE2 2ERFA 3BODA 3H1MA 1GLHA 1WGPA 1X8EA 4KU8A 1IZ3A 5I91A 3WV6A 3ZMNA 3VHRA 2A6ZA 3IT8A 4KBBA 5BNOC 3MF9A 4JCKA 1UU5A 1BMV2 4MH0E 4RR3B 3OBRA 1MEC3 4M0HA 2IWGB 1LHUA 3I59B 4XPVA 2HEVF 1XNCA 1U0AA 5FLIA 4BMEA 5D8AB 3VUOA 5CG9A 2FZ1A 4HBNA 4AVAA 1BCXA 4IXLA 3MGUA 4MX3A 1COV3 2P3KA 1S0CA 1PZ7A 5DUUA 4LO4B 4Y4YA 4KG8A 4PIXA 3DUIA 1JHNA 1WD4A 3SITA 3VKNA 1WMFA 2XJPA 3J8F3 1PO13 4ONUA 3ZSKA 1O7FA 3D6EA 1AR81 3AXDA 4LE3A 2D43A 1O3QA 3VBHC 1UZYA 2RS32 4IEZA 1DBNA 4EWDA 4SLIA 2A6YA 2XHKA 3M2MA 1NZCA 5F6LB 1RB8G 1JXNA 2PLV2 3ENRA 1GYKA 3TNPB 1BBT1 2D44A 5FDBA 2GMEA 3R4SA 1HRI3 3VZKA 3PJQA 2BFUL 3TN92 4XILA 3UK9A 4YM1A 1LR5A 3BIWE 5C4WC 1ULFA 2P37A 3ZFFA 3VGIA 5ACA1 4DNYA 2BYVE 3HMYA 5FMOS 2MHFA 5C8WA 3AKRA 4H7LA 2YDEA 4HANA 4YW4A 3B7MA 3WG1A 4CEWC 2QJVA 1VBA2 2GC2A 2PHXA 4HMZA 4R52A 1UKGA 1NQJA 4Q4X2 5FLHA 4LA2A 1GZCA 4NOTA 4E4ZA 2R6QA 3ZSJA 1IQAA 1PIV1 1LB2A 1WBFA 1M06G 3MLLA 1JYIA 1CAWA 1QJZA 1QQP1 1LECA 2BVVA 2YGLA 1ZBE2 4XW3A 4B4PA 4BE3A 1AYM2 4QHBA 4IEWA 1GZWA 4P9LA 3OGGA 2XL9A 4GQ7A 3VBOC 3ZN6A 4B29A 4YGDA 1HX6A 1LOFA 2XH6A 3VBUC 1TMF1 1AR73 2N7GA 5FLJA 2HWC2 1H30A 5BNPA 2WT2A 2VUJA 3P3PA 3AP5A 4O9EA 3VL9A 1MEC1 3LSDA 1OD5A 1H0BA 2R0FA 1H9WA 1UMZA 4QPGB 1G9CA 1LCLA 2CGPA 2I07B 4X6RB 2JG9C 1T6GC 1UX6A 2RM21 4Y5Z0 5C8CA 4XFIA 4S2FA 3M3IA 3FHIB 5DG1A 3ZYGA 5BNNA 4EV0A 1COV1 3B93A 4GB32 2NP0A 4LBNA 3V0AB 4YW1A 4IQPA 2XGXA 1VAMA 2OUHA 1QDOA 1R1A2 5I8YA 1H1AA 1QGLA 4PCRA 2ZHNA 1D4M2 1UU6A 3LGRA 2UU8A 3J8F1 4AEKA 1PO11 4Q8KA 1WMDA 1DYKA 3AYCA 2RHPA 4AHXA 3MPBA 2XVLA 4QGMA 4DRRA 1W6NA 4FTEA 4AEJA 1LGBA 2KXLA 1UN1A 3IDBB 1PK6B 2RS33 1G6NA 2Q0AA 4QQPA 4XJWA 2GNDA 4R4XA 2VY0A 4FT8A 3WW4A 1Q8VA 4AFAA 3USUB 2ZHLA 4WM7B 3DPRC 2ZAHA 1HRI1 1QJY2 1W6QB 1IKPA 1YYNA 4L92A 4Q29A 4RQPA 3ZYJB 4CDQA 5L7OC 1WLDA 3V65A 2NQYA 2YROA 3HQXA 3TN93 4MGKE 4E4DX 1V6KA 5DUVA 1IPKA 1J3PA 2HEWF 2DYCA 1QXJA 2PAMA 2ZA9A 2D3SA 2JG9A 3RJRA 2H0BA 4EN8B 4HSJA 3JB8A 1DQ2A 2OIIA 3FFQA 4QM8A 4OI0A 4AXOA 1VBA3 4DZGA 2A6WA 4IEXA 2VQ0A 2D7FA 1UIJA 5J3UA 1N3QA 3I4IA 3UJQA 4Q4X3 3VBSC 4YM3A 2ZZQA 1VP6A 1WW4A 5GM0A 2WSUA 4KGGA 1F9KA 2JDZA 2PA7A 4AF9A 3IPVA 1LU1A 4ES9A 5JPNB 2WNUA 3CL1A 4FQ4A 3RWNA 3R4UA 1S55A 5A33A 1ZBE3 2EAAA 3EXUA 1Z7S2 1AXZA 3N7JA 1BEV2 1AYM3 4AEMA 1XRUA 1VBB2 1YO8A 1AR71 3IDEA 4QPIC 4AWDA 3DPRA 4ISQA 2R0HA 1VBE1 2WKKA 4PDWB 4N43B 1DG6A 4L8QA 5JOZA 1CONA 3NAPC 4U2AA 1MZEA 4L2NA 1BMV1 2IC1A 3H1WA 1WD3A 4M01A 4ATEA 5BNQA 4ATFA 4H3WA 1O4TA 1SQ4A 4BH9A 2WLQA 3CF6E 2HWD2 4GB33 1TE1B 1NE4A 4CEYB 4J1XA 2O8OA 2AYHA 3LWCA 2XVGA 3NWKA 4PBOA 1R1A3 5SV8A 1W0OA 3ZFGB 4LHKA 3VBSA 3JB4C 2NMOA 1D4M3 4EN0A 3FFZA 4X8PA 3TAYA 3VBFB 1H1MA 1F2NA 1GQHA 2Y0IA 4YVSA 3WG2A 4NR1A 4C0BA 1RINA 5JZGC 1S0IA 3QCWA 5DZGA 4D7TA 4AEDB 1FAYA 2RMU2 2RS31 3M7AA 1DLLA 2HWB2 2WNVB 4CYDA 3FLTA 1U5YA 1SLAA 4XJUA 2QKDA 3B9CA 3OBTA 4I0WB 4WM7C 1JUIA 5GZCA 3ILNA 5JVVA 4BLJA 5GKAC 3ES4A 4XQWA 2VQAA 1QJY3 3TN91 1MQTA 3EJKA 4AQTA 2ZX1A 3NO8A 1TEIA 3W59A 3JUUA 5I8TA 3V0BA 3IBMA 2EXJA 1NA1C 2ZX2A 4JGZA 1VBA1 1OQDA 4HK8A 1ZRFA 1S0GA 5FOBB 4NPRA 1C8M2 4Q4X1 4MZUA 3NV2A 4AG4A 5BXXA 1RUF2 3DV8A 3D8CA 5JZGA 2HYKA 5FPZA 1PM7A 1C5HA 2QDNA 3SCGA 4I2OA 4K9SA 4IL7A 4PLMA 4XQ4A 1ZBE1 4QQHA 1UZZA 4AE2A 1AR62 1AYM1 1Z7S3 4LT5A 1BEV3 1FX5A 1O5UA 3ZVXA 3EQEA 1VBB3 5E16A 1G9FA 3ES1A 5CNAA 3AMHA 1PMIA 4WVMB 5CBLA 4PDWC 4MGYE 1NLRA 4N43C 2WNEA 5A32B 2XJSA 4R9CA 3T1LA 1HQLA 4XZPA 2ZJCA 5T5LA 2BNOA 1DZRA 3PTYA 2BWCA 4AW7A 2WZPP 2H6BA 5JIUA 2F4PA 4RHV2 1ZA4A 4P9GA 1D0GA 4Y20B 5CB7A 1APNA 4YZ1A 4I3PA 4LBJA 3E6DA 2WIIB 2DWRA 1A78A 4I09A 5B2GB 4BHPA 2DFBA 4AI0A 1QXPA 1NA1A 5IK5A 4GB31 2B42B 4LR4A 5JPMB 2R30A 2HWD3 4AGVA 3SXWA 1YXWA 1ND3A 1ULCA 1RUG2 1R1A1 2PYTA 1HDKA 1KS5A 3ZFGC 1DGWX 2DCKA 4FTSA 2VOKA 2QVSB 3AXEA 1D4M1 5LK7B 2IXJA 2RS52 2VMIA 3BOWA 4JGYB 5BYNA 2RS12 1ZZ7A 1NLSA 3KB5A 2K2SA 2O1QA 1H4GA 4KWJA 1HRV2 1UF2C 4AEDC 5GJ6A 5K8SA 2RMU3 3WDTA 2HWB3 1YWKA 1MS0A 2G9FA 1FV2A 3WW2A 1ZZBA 3J4UH 4HSLA 4Q0PA 2TBVA 4D7YA 2IFRA 3VKMA 1CAXB 4ASLA 3K48A 4XF4A 3VBRC 5FFOC 4HPKA 4HZFA 2A6XA 2ZGTA 4GMP3 3GF6A 1QJY1 4CDXC 5JSOA 2BW8A 3TYJA 3POSA 3Q9OA 3ZX7A 1GKBA 2VVDA 4MSVA 1LEMA 1TNFA 3ZDSA 2DVBA 1C28A 3MIBA 4LBMA 2VOXA 3SH4A 1HV0A 3AMNA 1QJX2 1FPN2 5F1RA 4DOUA 1NCRA 1IPJA 1C8M3 5FQ0A 4KWLA 3M3EA 3A0NA 3OY8A 2GMMA 3ECQA 1RUF3 4META 4A3XA 1RUOA 3HT1A 3IIAA 4JDMA 4NHLA 1DU3D 1O3SA 4RD7A 3AYEA 2VNGA 1AR63 1Z7S1 1BEV1 4R8HA 2LTNA 3ZXJA 2ZKNA 3PMEA 1VBB1 4IEPA 4GKYA 2Q1ZB 3RI8A 1AJOA 1LULA 3HD8B 3QBQA 3DN7A 4RGGA 2VW2A 3BPZA 3MPPG 4INDA 2CAVA 4I0BA 1PGL2 4WV8A 4Q8LA 1PGW2 1JW6A 5GLUA 2PHUA 4O9GA 3BB6A 3ASIA 3M3OA 3IM0A 5LK5A 1YCIA 1DYPA 3MDPA 3UKVA 2QZ2A 1OA3A 3PVOA 3APBA 4IEYA 2YGMA 2HWD1 3ACLA 5A3MA 2XLGA 1RUD2 1JN2P 1X8MA 5KHHA 1O91A 1RUG3 1KDKA 4IV1A 1HQWA 1Y9QA 4XIKA 3RQ0A 2RS13 2BPA2 3MIGA 4YNIA 3ZFEA 2R063 2IXLA 1HRV3 2RMU1 4G4FA 3AZYA 2HWB1 2HEYF 1I3HA 2NN8A 2A7AA 2RJKA 3CJIA 3NKGA 3ZFFB 5CA6A 2XB6C 4XIOA 1DQ6A 1QJU2 2JKBA 3I2DA 1Z0HA 5LEKA 1YIFA 4GH4A 2VPVA 2A5ZA 3AMPA 4GMP1 5IK8A 3E6CC 3QLQA 1EYBA 3A4UA 4YZ2A 1UAIA 1PZ9A 4XF9A 1EV12 3KT4A 1FYUA 2BVBA 1VRH2 4FXGB 3RPQA 3FUQA 2CTVA 4WM8C 1CAWB 2OW4A 2GH8A 4CDUA 1C4RA 4TLFA 4DINB 3THTA 2WT1A 1GZWB 1N3OA 1NXMA 1QJX3 4XBLA 4PLNA 3M1HA 4Q4Y2 1C8M1 3AFKA 1QF3A 4MLOA 2XWBB 1FMD2 1QDCA 4QQLA 2CGOA 5C9AA 5JSPA 1RUF1 4AHWA 4GWMA 4YZ5A 1RGSA 1WMEA 5J36A 1QXRA 4Q0UA 5C33A 1HIXA 5GZFA 5C4WB 4Z92B 1AR61 2C5DA 2UWAA 1N3PA 3RI9A 2B8MA 2ZHMA 3BOPA 4P9IA 2OVUA 1XU1A 1IS6A 1XYPA 1SMVA 3KT7A 1DGLA 1X82A 4KQ7A 2QQPA 2DUPA 4RHV1 4WBBA 5GZGA 5JMCA 1RUH2 2OZJA 2DCJA 4L9BA 1VLNA 4FOQA 1W6NB 3UJOA 5L36A 1XNBA 4AQ6A 2VVEA 4YGCA 1X36A 4AHZA 4FPHA 1H4HA 5H9RA 4A7ZA 1WA4A 3AB0A 1HV1A 4BLIA 2VULA 1RUD3 2JICA 1RUG1 4XTMA 2G4IA 4M3CE 4FOVA 4LHLA 4PQ9A 1ULDA 3ZO0B 3WINE 3KT1A 2RS11 3DGTA 2B39A 1PNFA 4C0HA 4HKWA 1EY2A 1SBDA 4OHXA 4RA0A 2R061 3QACA 1HRV1 5FMOL 2E9QA 1FI2A 4OI1A 4XHBA 3ZFFC 2JG9B 1LOAA 5J96B 3KM5A 2WC2A 2RM23 2Q8OA 3LOIA 1QJU3 1HKDA 3RYRA 2D6OX 4CP0A 1DGWA 4LA3A 4FO9A 1JBCA 1RTVA 5H9SA 3E5QA 4AI2A 1R092 4EWEA 2QDRA 1WCKA 3KS7A 2X29A 1LTEA 1KJLA 3WLUA 1Q8OA 1SFNA 4WVVA 2W68A 2UURA 3CJXA 1W6PB 3VHPA 2B5HA 1X50A 3GBFA 2FHRA 3W9AA 2UYBA 2WNUB 5LRSA 5A33B 2C1FA 3HN1A 5BY5A 2ENRA 2D6NA 3AZXA 4EWAA 2QFEA 1DGRA 2GNMA 1QJX1 1FPN1 1LOFC 4AHYA 2WLPA 2A70A 3R0RA 4AFCA 5IT6A 3RG0A 1DZTA 3DPRB 3ATGA 2D5HA 3WW3A 3OD4A 5L7OB 2ZGUA 5BNPC 1AL0G 1J3RA 1O3TA 5FRAA 2V09A 3M3QA 4XBQA 1W39A 2W52A 1R082 5JDBA 3VZOA 2MEV2 4X8NA 5C8CC 1OA2A 1WW6A 5BNNC 1AX1A 1SLLA 2D93A 2UYAA 3WP5A 4DXZA 4A7KA 1CIWA 5HCBA 1XNKA 2UY9A 3L9JT 2K9ZA 3VBSB 5GZDA 1PGL1 3NVCA 1PGW1 4YVSB 5JSRA 1TQ5A 2TUNA 4HK9A 4R9DA 3PJYA 4QPYA 4BQ1A 2D98A 1AX0A 2ZS6B 1WW5A 4CDWA 3ALQA 1RUD1 4Z07A 4CTEA 3MFAA 5J48A 2CGNA 3JD72 4QPIB 4UW4A 1VBE3 2DCYA 1O4ZA 2A3XA 3N36A 1YRZA 2YZ4A 2Q4SA 3NAPB 2XVKA 4RQPC 4QGNA 4CDQC 4QMAA 4UW6A 3WX5A 4XFBA 4GXLA 1VALA 1DFQA 2GSYA 2SLIA 1REDA 4IV3C 5ABJA 2XJRA 1QJU1 2FBEA 2A71A 4G3YC 1WW7A 2ZGSA 1JUHA 3AP4A 1EP0A 4UBHA 2WJSA 3WG3A 4YZ4A 4YGBA 1R093 1EV11 5F9TA 2DU0A 1QNWA 2JG8C 5GLZA 5CAZA 5JZGB 4GALA 5CFDA 1CAVB 1YNAA 3NV4A 4FBFA 3H9AA 2WNUC 1OOPA 1C3HA 2ZMKA 4M3CA 3WT3A 3INAA 4FCAA 3NKTA 5FO8B 4XYXA 2GDFA 4YG3A 2PLV3 3HWJA 3EHKA 1IS4A 4KL1A 3ROUA 3N7MA 4K1YA 4F7ZA 4JAAA 4BM8A 4CZSA 3WQ1A 1MS9A 1HXS2 5DG2A 5FOJB 2D40A 1MVEA 3AKQA 2C9AA 3UKNA 3MIFA 1W6OA 4JQRA 4LHNA 4IV3A 4KH9A 1CX4A 4AVVA 3ZXFA 1W2UA 4UW3A 1RHI2 1Q5OA 4JDNA 1NA1B 1ZZ8A 2ZGRA 3FC0A 5AVPA 3N4MA 3OD0A 1ND3B 3VV1A 1AL22 4KWKA 1DDLA 3BALA 4BZ4A 3I59A 2JG8A 2ZOEB 4XJ9A 3KGLA 2KA3A 4YVSC 2R49A 5BPXA 2VG9A 1RUH1 2W39A 5D8AA 3WDXA 4DRVA 4YM0A 1ZRCA 3S7EA 3U07A 1ASJ2 2CWMA 1RITA 2PHDA 3VKLA 2BBVA 4BIFA 1UCXA 1RUE2 5J37A 1QOTA 4OLLA 3JD73