2LUWA

Solution structure of vep c-ter 100
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
101
structure length
101
Chain Sequence
GNVLKNNTPVSNLTGNKGSEVFYTFTVDRNATAVVSISGGSGDADLYLKAGSKPTTSSWDCRPYRYGNNESCSVSAAPGTTYHVMIKGYSNYSGVTLKLQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloprotease
publication title C-ter100 region of vibrio extracellular metalloprotease
rcsb
source organism Vibrio vulnificus
molecule tags Hydrolase
total genus 7
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2luwA00
1QXPA 4DXZA 4G9SB 2O8OA 4DY3A 3JQWA 3AFGA 2QFEA 5FAXA 1WMEA 1KFXL 1NQDA 1WMDA 2XVKA 4HPKB 1WMFA 2LUWA 4DZGA 3JQXA 1KFUL 5FBZA 5SV5A 1DF0A 1U5IA 1NQJA 2XVLA 4I3GA 2XVGA 4HPKA 4DY5A 3BOWA 3DF0A
chains in the Genus database with same CATH superfamily
1UX7A 5EP9A 2E9QA 2E7TA 3J8F3 3ZFFC 4HKLA 4D3WA 1Q56A 3VN4A 3V0BA 1HIXA 5CFDC 3K4DA 1OLQA 1OQ1A 2JE7A 3WP4A 1QEXA 1HB1A 1FT9A 1WCUA 4QGLA 3RYRA 1AR71 3OBRA 1NAEA 2MPFA 4XFHA 3VD4A 2GU9A 3THTA 2Y0OA 4ZU7A 1Y7BA 1IS4A 2YROA 2JG8B 1JS9A 2VXRA 4H7MA 3PL0A 4AQSA 3ON7A 2DFBA 1D0GA 1DQ5A 2GNDA 4DFSA 4A2UA 4D7YA 4YW4A 4BXFA 2RVAA 2R063 3MO4A 2A6XA 2E63A 4IQPA 1L3JA 4CUCA 5JAXA 2WINB 4P08A 5D1IA 4E27A 3WDVA 2AR6A 2D43A 4Q4V1 3WXPA 1RUJ1 2QQWA 1U5XA 4PDWB 3TAYA 3UGHA 4YW6A 3T09A 5JPNB 3USUB 3GM8A 3ZSLA 1VBD1 1IQAA 4GWNA 4YM2A 5JCTA 4CCOA 3NW4A 3OBZA 3ZFGB 5IVVA 4NWWA 3IAQA 4FFGA 5JIAA 5JSPA 3WQ1A 1XNBA 2V4AA 4EN9B 4QGNA 5FZDA 4EN7B 1TNRA 5FZ4A 3MF9A 3RS6A 2RM22 3WHTA 1O5UA 1JYXA 1N3PA 5LCWL 3AYEA 3L9JT 3O1RA 4E4DX 1RMU1 4QHOA 2Q30A 4LTAA 4RGKA 5G05L 3VV1A 3GZUC 3A21A 4Z2AA 2VXJA 5A7WB 2VNOA 1OQDA 1FNYA 2DCZA 4JKLA 2XPJA 2NZ9A 3BN6A 2XG3A 2CSGA 1KS4A 5GLZA 5IK8A 1F2NA 1QF3A 1W6NB 3B9CA 2HJIA 4Y22A 2O0OA 1VBC1 2XVLA 1FYUA 2PAEA 5FIXA 4BIFA 4D6RA 2ZZQA 4GXLA 4XZPA 4Y26A 5A7PA 4X6QB 3UT0A 4D7SA 2X5IC 2ZAHA 2BDRA 3T2PA 5EHDA 1X8EA 2DCJA 4AHXA 1PK6B 1W2TA 4DXTA 5IK5A 2VULA 5DUUA 4JVAA 1H8TA 2W39A 2RR13 3HT1A 4HVRA 4I09A 3VBFA 1ZREA 4Q4X1 4FTSA 1JW6A 1GWKA 3WNPA 2IXHA 4XMAA 4Z82A 3NWKA 4QB6A 3VZLA 1H6XA 2XUEA 1KITA 2I2SA 2VQUA 4OHWA 1GANA 4GWJA 3RG0A 2JKBA 5FZ1A 3U10A 1MS4A 1A34A 3K3NA 4JKMA 1TME3 3W58A 5BY5A 2IVJA 1XSQA 3NMBA 5FYBA 3I59B 1CD3G 2JDMA 1YI7A 2PQQA 5C8CA 4FBFA 3AXDA 4N9HA 4S2GA 3ECQA 4XUQA 3HNBM 5FYCA 5DUVA 4KWJA 1D4M2 2WO2A 3GF6A 2JG8A 4IEWA 5DDJ3 1QH7A 2ZHLA 4QU2A 1HJGA 3OY8B 5HCHA 1NE6A 1J58A 5DAVA 3W21A 1LHUA 4P5HA 1RJ7A 3I2KA 1DYOA 3BPZA 1NA1C 3I2DA 4RHV2 5HV0A 3NV1A 4URAA 1AL0G 4AYUA 1OOPC 1W0NA 2XOMA 3AP5A 4LOSA 1CZSA 2A70A 3H0OA 2R072 4UXAA 3T4HB 4M0HA 5DG1A 3H1MA 2GP3A 1W0OA 4LITA 4OUEA 4PDWA 3DYPA 1W8UA 4PQQA 5EFUA 3MEPA 1GV9A 2ZGMA 3EBRA 5FYYA 3ASIA 3USUA 5IAXA 4FP3A 3ZPOA 4FPHA 3ZFGA 3HMYA 4AAXA 2OS2A 2IXLA 1M4WA 1ACCA 1O91A 2HWB3 3KCCA 5CZKA 2XB6C 2R042 2YYOA 1K42A 4RQPC 5FXVA 4DPNA 4CEWA 5B4NA 1BXHA 3GGLA 5EJ3A 4XUPA 3RMXA 1N1VA 3GJBA 4AEDB 4ATFA 2ZBJA 2X10A 4CCJA 3L2YA 1GSLA 1DFQA 4WVMB 4W8JA 5LA2A 4BQ4A 5A7WA 2NMOA 2B46X 1UZWA 3ACHA 1J1TA 4J25A 4JX0A 4FTBA 4LBQD 1PVC2 2WUHA 2YGMA 3VKLA 4C0HA 4CRQA 3N3HA 3FBMA 4WZCA 1JBCA 4MGYE 4CTEA 1W6NA 4BMBA 5DZGA 4DXZA 1J3PA 4KG8A 3SH3A 2HWD3 4Y1YA 2XL7A 2RV9A 1WKYA 4PBOA 4XDQA 1V6JA 2BUKA 3DXTA 3MW4A 5FPZA 4V2WA 5DAXA 3ZXDA 1NX9A 1B35B 3RZJA 4Y1VA 1VR3A 3T3YA 2IVIB 5AVAA 4GMP3 2WABA 3H1YA 5CKQA 3VBRC 4PBPA 5A6YA 3K46A 4GMP0 1NE4A 2JE8A 1WD4A 3WY6A 4CSWA 3TWIA 5IVCA 1JZ4A 1NXMA 5K0UC 5FMOS 5JMOA 5JOZA 1AR62 3S5AA 1AYN1 2FDJA 3ZFFB 5LRRA 5CFDB 5FY1A 1QIQA 4EWAA 1W8OA 1DHKB 3U11A 1ND3B 4LT5A 1BEV3 4OI2A 1C1FA 3I59A 4Q8LA 5L9VA 1UCXA 1MS0A 1OD3A 3WDTA 1JZ8A 3O1PA 1VBB3 3KV9A 1MZ5A 2PYTA 4OULA 2JE9A 3D4KA 4IV3A 5BXXA 2WC2A 1NOVA 4JDOA 1PX3A 4ASKA 3OY8A 3S5QA 2VZ3A 3O7OA 2R16A 2VQ0A 5FZIA 3DECA 4CXWA 4DOUA 2YUEA 1I9RA 4JGZC 3H1WA 5JWPA 1D4M1 3P1IA 3UJOA 1ZNPA 2JD9A 5T55A 3E6DA 1SEFA 3M3EA 3MLLA 5FY0A 2ADEA 2JDZA 1NZIA 2OXBA 4LBLA 1S0CA 2VQTA 3AB0A 4TLFA 4A4AA 3EJKA 5BNPA 3IKWA 1QH6A 2D6LX 4JRAA 4AEMA 4CP9B 5A6XA 1O5LA 5EIYB 1S0DA 4HVQA 3EXUA 2H6BA 3BGAA 1R082 4LUKA 2VCCA 3TBDA 1CZTA 1UOJA 3WNOA 1FPN3 4L8QA 3JBG1 5LEJA 1ZRRA 2PHFA 1EAH3 2RS12 1WLWA 2VTXJ 2YC2A 3I49A 2BJSA 3GXUA 3PJQA 4QDSA 4UW6A 3ZM8A 1IKQA 4EV0A 4WVMA 2QFEA 4FAHA 4DS0A 5C3QA 4FQZA 3SNMA 1Q43A 4EWEA 1KFXL 1QXRA 2C5DA 2PHRA 1FI2A 4CDQC 1OH4A 3BTZA 4A45A 3R6SA 3FJSA 4P5YA 4QB1A 2VW1A 2WYFA 2LTNA 3LD8A 1W9YA 3OD4A 3WT3A 3UNPA 4MG2A 5FPXA 5FXZA 4D0QA 1W28A 3I54A 3VBHC 3R4UA 1WCKA 2X5IB 3C8XA 5GLUA 2G9GA 4YFZA 2OVUA 2Q8EA 4I01A 4RSUA 4XFBA 1S2KA 4NPLA 4P14A 1QJX2 5KHGA 2XR4A 2RJKA 3MYXA 4QX1A 1B35A 1X8MA 2YU1A 3SKVA 1SPPA 2VOXA 4GB32 5JZGA 1A78A 4M0NA 2RMU2 1QXJA 4PI2A 4O7XA 5FPVA 1S0FA 2H0BA 3GZTB 3ZPYA 2VZRA 2I07B 2VMEA 3NL1A 4OFGA 3POFA 2OUJA 2WIIB 1EPZA 4BJ0A 1DLCA 1CWPA 1WMXA 2WO7A 3H8UA 5A1FA 4YM0A 4AVSA 5FO8B 2P3YA 1BBT2 2RHPA 3P6BA 3ZFFA 2DUPA 3O1MA 4DINB 3IB3A 1JYTA 3MIFA 1S4CA 5T5OA 4NMIA 3TYJA 1LJ7A 2XBO3 4KWKA 1ND3A 2I45A 2FCTA 5T50A 2XVGA 4PIXA 3I2FA 3T4VA 4E9KA 1H9WA 4CP1A 2Q0AA 1V9U2 1O8SA 1VBE3 1APNA 4LBQB 4ZZ5A 3H7JA 4JQRA 4QPWA 2G1MA 2EA7A 3MDPA 2JIGA 3T1LA 4BM8A 2E51A 2Y0IA 4WVZA 4AVTA 2KR2A 3B02A 5FY9A 2B45X 3FUOA 5KXCA 4HG6B 3I2JA 1C8M1 1ZZ8A 1JOJA 1Z7S1 4NHKA 5I0TA 1VRH2 3OEBA 5CKMA 3I7DA 3J7NA 2OPWA 3OGVA 2XLGA 3OSDA 1HW5A 2VZTA 4FCAA 1UX6A 4W6YA 4XBNA 5DAPA 4AI9A 2VZ1A 5CISA 1Z78A 1SLTA 2JB8A 3PURA 4MO3M 4TN7A 4YZ1A 2QQOA 1RUD1 3IDEA 4AI8A 3FUQA 4WZFA 1BHGA 1WLDA 1YWKA 4BCUA 1DDLA 5I0DA 1G9FA 4WM7A 1ASJ3 3PUIA 3VDCA 4KH9A 1PMIA 4QDQA 3Q8FA 1IPKA 2VO5A 5FP9A 1URXA 1GNZA 1WZXA 4XF0A 2BGPA 1VAVA 4AVBA 5IVFA 4XURA 2UWBA 1TMF2 3SXWA 4XFAA 1X9TA 3WD5A 2VCAA 4XUOA 4XPVA 3SQOA 2A3XA 1RUI3 2PA7A 1R081 5FZLA 2XJPA 3WW1A 4QX3A 2LM3A 4LUMA 4LO5B 3WQBA 3K4ZA 1ULCA 1HRV3 2MNGA 4Q0PA 3LFMA 4NPMA 3AYCA 5DAQA 3GNEA 2QZ2A 1J59A 3DKQA 2K9ZA 3D0JA 5FYUA 3WP5A 1CAXA 4D7TA 4CDXC 5FZ0A 3U0ZA 1B09A 5K9YA 5FKBA 3CJIA 1I5ZA 1S0GA 2O8OA 1NXD1 4HFSA 4O9EA 5J1XA 4I0BA 1X36A 3HAGA 1H6YA 3MGUA 4Q26A 5ACA2 5JXJA 1UYZA 3WX5A 2ET7A 2RS52 1RUF2 1OA3A 1C5HA 1SBDA 3K2OA 3VHNA 3IIIA 4N9IA 5FXXA 3VBRB 1UD1A 2ZGSA 4IW3A 1A8MA 3KB5A 5FTTC 2WS93 1C4RA 4AFDA 3RVHA 2Y34A 5IUQA 1R1A3 4AEKA 1H8TC 1U5IA 5E1RA 2XHKA 3VBFC 4AI0A 4CYDA 5K0UB 1QJY2 4HVOA 5LK7B 3H3ZA 4FPEA 1PIV1 3VKFC 1AL22 1QJX1 1AYM1 2VD7A 2Y6FA 1PO12 2JB4A 2JIJA 5LBBA 3ZXGA 4J1XA 5F7UA 1LODA 1VBA3 2LW8A 2XUMA 5F3EA 5FO9B 2RMU1 1KDMA 3N7MA 1VAKA 5FZAA 1OMIA 1PM4A 2JENA 3KF3A 2R6QA 4N90A 4B7EA 4L11A 1RIRA 4NIDA 3JB4C 2YG0A 1WCSA 1DQ6A 1HQWA 3Q8EA 1H4GA 2RS32 1RUC3 3AVRA 3LGRA 3QD6A 5C8CC 3OGSA 3VD9A 3VKMA 4DUXA 1PM7A 1LEMA 4COYA 1YJKA 4GKXA 5FLIA 1AR83 3HVDA 4Z92B 1OPMA 5CFCC 2ZEYA 2VAUA 4JGZB 1GBGA 4HL0A 4N53B 3UKVA 4LHSA 2DBNA 4LO4B 1YO8A 4Q4W1 4LBJA 1O3TA 2VW0A 4XQ4A 5LW9A 4BQ3A 4OI4A 1OLMA 1QU0A 4GH4B 1W6QB 3OF1A 5FMCA 3WCRA 2Q4SA 1EP0A 1BVP1 4PDWC 3NAPC 2VZVA 2XL9A 4QGMA 4W4ZA 5FYIA 3WDYA 1H1MA 3ZFGC 3HN1A 5A32A 1PO23 2EF6A 1O3RA 4AK3A 5SV5A 1XBFA 4M3CB 1WGPA 4YW2A 4NOTA 4UFHA 1JHJA 3N9MA 4CEWC 5FZ7A 5FV3A 5T5LA 1XB9A 3CQOA 4IEXA 4QPGC 2CHHA 3QH6A 2BGOA 4XAAA 4NAMA 2HWC1 2JJ6A 2XLAA 4PQ9A 2BFUL 5JI7A 2P34A 2VH9A 3NJYA 3T1MA 1COV3 1QJU3 2WQZC 1JUIA 5GJ6A 1GQGA 3OOXA 1OH3A 2VECA 3LWCA 1TMF1 4CDQB 1UU4A 5A1AA 1RUE2 4QWNA 3OD0A 4Y3OA 5EZWA 3PLQA 4TZDA 4TYSA 3OG2A 1HB2A 2ZMKA 3VBHB 2WNEA 5M0TA 4E4ZA 5HCBA 2AEYA 1AR91 4IEOA 5CIRA 2G9ZA 2PLV1 5FY5A 5FWEA 2PMWB 1MS3A 2GALA 3PHMA 3Q8CA 4GWIA 4H7LA 3WINE 2DURA 4EYUA 1LRHA 2WRAA 1ZA7A 1ZZ7A 3FHQA 2C9KA 4BPZA 5C6CA 3WVJA 3RPQA 3KD4A 1I5PA 1RVF2 1LEDA 1MVQA 2D98A 3LAGA 3ZVXA 3DCQA 4HMZA 1UZVA 2QQLA 3WDXA 4Y5SA 1CAVB 3GBFA 3ILNA 1WMDA 2D6NA 3HD8B 4IEZA 4PF5A 5T5JA 3AFKA 3LA7A 1ZBA2 3TN91 3WZ1A 3FE5A 1LU1A 4KGGA 3ZO0B 1TZOA 1XNKA 1YFUA 3A23A 5JXGA 1MS5A 1PNGA 4AEJA 2MEV2 4ASMB 1K3IA 3HR9A 3TNQA 4AFMA 1QJY1 2CDOA 2PHTA 3OB8A 5CB7A 1VRBA 3KWVA 3BCWA 3OJBA 2UYAA 1GOHA 1JU3A 1BZWA 2UWAA 1YFWA 2DFCA 2PHUA 5FJHA 1AR73 3SCFA 1RXFA 2CGNA 4A42A 4ZY9A 3LKJA 4YRDA 1YQ6A 4W6WA 5FY8A 1C1LA 1AXYA 3FZ3A 3UK9A 5DQ0A 4B29A 1JXNA 4IV3C 3K51A 2HWF2 4DRRA 1TVGA 1POV3 4DMIA 3NKGA 5IHRA 1SDWA 3FBYA 2RS31 4N53A 4E2GA 5J37A 1POV0 5IW0A 1MPXA 4XEZA 5FXWA 4Q4V3 4IEQA 2QQUA 2XJRA 2XWJB 2HYXA 5FQ0A 2W91A 3AP7A 3QCWA 1RUJ3 4NHYA 3JD72 5EPAA 4QXHA 4AGRA 4GH4A 1H2MA 4XTPA 2JXAA 4TXWA 4XFGA 1ZRIA 5E6HA 1VBD3 4XVHA 4LKEA 5BNPC 4XXAA 3LSDA 5GLWA 4RGGA 3SMHA 2EXHA 3M4FA 1DZRA 1OKQA 5FJKA 2QQPA 4S2FA 1A8DA 3LDKA 1G7YA 4YZ4A 1GU3A 2ILMA 4OVEA 1SLAA 5LASA 4YG6A 1QGLA 4MUVA 4QM8A 4HK9A 1V6IA 1YYNA 2F4PA 3K77A 1GYKA 2QDRA 3ZIWA 2K46A 3ZR6A 3AKPA 1G86A 1RMU3 1AX2A 1POQA 3BI3A 2RDSA 3POJA 4LIVA 1AXKA 1C5IA 2D3PA 2DCKA 2HWE2 4UBGA 3WQ7A 2PTMA 5IVBA 5JXIA 3CHXA 5F3IA 1ND2A 1VAMA 4K20A 3THPA 5HPOA 4CDXB 4B4RA 3IIAA 4CDQA 2E32A 1WCQA 1YQCA 2GZWA 4MGTA 5J96B 3PVOA 3HNMA 2B8MA 3ACLA 1DCSA 4BQWA 5DMYA 2PN5A 5BNOA 3VBHA 3H8XA 1RTVA 1GUIA 2GMMA 3CL1A 3J7MA 4Y22B 1VBC3 2CAVA 2QCSB 3MW2A 5FZOB 3SEEA 3W9AA 3I3DA 4AQTA 4Y20A 3WP3A 1J84A 4AFCA 4FSJA 1MS9A 5T52A 3LDBA 1E5IA 1Y9QA 3AP9A 3B7MA 2EICA 4GD4A 1WMFA 5H9RA 3D5OA 4BLIA 5F8PA 3FWEA 2BFUS 1REFA 4EROA 1H8TB 2J7MA 1ULGA 1W3VA 3VBFB 1W9WA 1B35C 4CVUA 4Q4X3 5JZGC 5C70A 1KQRA 1Z0HA 1A6CA 2BEOA 3M8LA 5FOBB 3ZOIA 4I3GA 1CAVA 2ZGUA 4IESA 4UOJA 4AF9A 3O1OA 1Y9GA 3PIJA 2P3KA 1LOFA 2BNOA 4KBBA 4K21A 2J1EA 2ZKNA 4PF1A 5FYSA 5I8YA 5JSOA 1UOGA 4OMCA 5BNNB 1V6MA 1EPWA 1W2OA 2W3JA 2VZOA 3HPNA 1F35A 1HRI2 5FAXA 3TEXA 1ZBA1 2RDRA 2Z79A 1G8WA 5C8CB 2QUOA 2QQMA 3ZSEA 3ZYGA 1ND3C 3IZOA 2UY9A 3W5MA 1BCXA 1EYBA 5F5AA 2HBTA 3J8F2 4WM8C 4XHBA 3VZOA 1OFSA 5SV8A 3WF3A 4CDUA 3GZEA 1R091 5I8SA 2RG4A 1POV1 2TUNA 2XDVA 2ET1A 4NJ4A 4UW5A 4XABA 3O0XA 4Y5TA 2B39A 1OA2A 2VCMA 4IV1A 1VMJA 1CAUB 2BNNA 2JX9A 4M00A 2HWF1 3KQRA 3INAA 4M4RA 2BU9A 4HT1T 3NAPB 2R062 3MV01 4K7JA 4I02A 4R52A 2IC1A 3WR0A 4YW1A 5FWJA 3ZXFA 3H9AA 3FN9A 2ZHMA 4MGKE 4GWMA 1W05A 3AKRA 3IWZA 1UU5A 4QXCA 1UZ0A 1VB4A 3A0KA 1OXCA 3RWNA 1VB2A 3JD71 3WG2A 1L7LA 1GR3A 4WM7C 4CEWB 3P5BA 4YVSA 2O8QA 3MIGA 1JH5A 1OPOA 4FFHA 2D40A 4QPGB 4XIOA 3MV11 4QQLA 1XU1A 2XJVA 1HXS1 3LEMA 3OUIA 3PTYA 4KMQA 2W46A 3ZN4A 1JODA 4MHUA 1HV0A 1NCRA 5D21A 1XYPA 3UKNA 3KZ4C 5F9TA 5EQUA 3VL8A 1LOBA 4QKNA 5EXOA 2GN3A 2QQKA 4A7ZA 5KC5A 4IEYA 3ACFA 1W0PA 2AH2A 1MEC1 3KCYA 3QLQA 4HPKB 4X8NA 2X09A 4OHVA 4CDXA 3M3CA 5IVYA 3VD5A 4CEYA 3AMHA 1W9TA 4NRPA 2HWE1 4D6QA 4Y5Z0 4HK8A 3GHMA 4XW3A 3N9NA 1UIKA 4P9LA 4PI0A 3CJIC 3FLPA 4YW3A 5FZOA 2OKXA 4MZUA 4YZ3A 4C0BA 1F15A 4YW5A 4ASLA 4KGQA 1QJZA 1GKBA 1BMV2 4IL7A 2AYHA 3NVCA 1UXZA 2PFWA 5LZ6A 4AHWA 1OFNA 1N3QA 2ZOEB 1ZZ6A 2Y6JA 5FRAA 3KV4A 4AW7A 3NNFA 4ZXEA 1I1EA 5A3WA 5A3OA 3FL7A 5LK5A 4XAEA 4MGIE 2Q8OA 1RHI2 4X8PA 3SISA 3AX4A 2XHNA 3FLRA 4OQ8A 5K7PA 3KM5A 4RL7A 2DYCA 4P9GA 1W9FA 1AYN3 2A73B 3WV6A 2VVEA 1BJQA 2RR12 3I2HA 2W5FA 2WNVA 5GZFA 2XXZA 4CPBA 5BNNA 5CYYA 4TLGA 2AC1A 2KA3A 1UY4A 2G19A 2EALA 4KL1A 1YLLA 1CZVA 1UO9A 3WNNA 4JKKA 4IV3B 3WW2A 2CY6A 3BOPA 1LOAA 2WT0A 5L9BA 2DUOA 3PIGA 1TME2 2BNMA 1DQ4A 3ZXEA 4N43B 2J1RA 2JWPA 4FVVA 1V00A 4Q4Y2 1O3SA 4LNVA 1UYYA 1YRZA 3LZZA 3M3OA 1W9SA 4ATEA 3CJXA 4DZGA 4MVTA 1D4M3 4YWAA 5B2GB 1CAUA 5B4XA 5C71A 1OKOA 2IXCA 2PQSA 5DDJ2 5EV7A 2GNMA 2VOTA 3RZGA 3VBUA 1LECA 3W5NA 4PCRA 5BNPB 1MS1A 3NAPA 3URFA 1TQ5A 3FMGA 3VZKA 5I8TA 5FLHA 5J98B 3RZZA 3E5XA 2WDBA 4DUVA 3IPVB 1UQXA 5AC92 2ZX3A 2XLFA 3KGLA 5A3NA 4XF1A 2ZKLA 5IATA 2IFRA 5F1RA 1OURA 3I97A 1NLQA 5FYHA 1DZTA 2DDUA 3JBG3 3VKOA 2DVGA 4KU8A 1GZCA 4QPGA 4Y4RA 4Q0UA 1FNZA 4BMEA 5APAA 5J7MA 4S2HA 2OQ7A 2HWB2 1GZTA 2YV8A 2ZX2A 1AHSA 1OT5A 4NPRA 4Q5OA 2VW2A 5IJRA 2WZPP 1Y4WA 3VHPA 1ZRDA 1NY72 3ZFEA 2WAOA 2VGDA 1YFYA 5E16A 2W08A 2D3SA 2QQIA 2RM21 4JHZA 1JOBA 5EJ1B 5I0UA 4HPKA 1V6OA 1AUYA 1QOSA 2BVVA 2VTFA 4XC9A 3RNSA 2VOVA 3HT2A 4BK4A 2J42A 4QX8A 5I0RA 3POWA 2GH2A 1UMZA 2WN3A 1GP5A 3SITA 1S0IA 4N7UA 5GZGA 3NKTA 3EMRA 4AI2A 1RUG2 1ENRA 2CWMA 2L9LA 2D3RA 1O6UA 5F2WA 4Q2FA 1GZ9A 1H2LA 3PUHA 3ZXLA 3J7HA 4UBHA 1W90A 2R0HA 3C3VA 3ZSKA 2BPA2 1SPPB 2ADDA 5JZGB 4TWTA 1LHOA 3VDBA 4FI9A 1XXNA 2DV9A 2HWD2 2WR9A 5F32A 5T54A 1RUNA 1O8PA 2JDHA 1BMV1 3MPPG 3M3IA 2ARBA 2BV4A 3K4AA 4UWDA 3GBWA 2WYSA 1X9PA 4HETA 3RWKX 3KT4A 2Y6LA 2XQRA 1IG0A 3BTXA 2WAAA 1HLCA 2VMDA 1RHI1 5DZEA 5J36A 4BB3A 2VOWA 4WV8A 2DCTA 5CG8A 1HV1A 1NQDA 2QKDA 5FMBA 4DNYA 3ZMNA 1O4YA 5AFBA 3PU3A 4HLTA 3AYAA 2XKPA 3AP6A 4JRLA 2CGPA 5GZEA 3JZVA 2ENRA 3MUY1 4WM8B 2LRPA 1O59A 5GKAC 4XHXA 1ULDA 2AACA 2ARAA 3LA2A 4UFLA 3NRUA 3MIHA 3UESA 1XJAA 3UV9A 1BEV2 4ISQA 3EYPA 3LCPA 4N43A 3T2TA 4B1MA 5FR3A 4QQ2A 2EAKA 3LQCA 4O9GA 1C8M3 1EV12 4FFIA 4Q1RA 1VBB2 1Z7S3 2VZQA 2VMGA 3A22A 4H2AA 4N53C 4OZOA 3O1TA 3TNPB 4IEUA 2YGLA 2FCVA 1K45A 1GZWA 2H0VA 4FPFA 2FDGA 2NN8A 1CN1A 1W2UA 4Q4Y1 2VUAA 4LORA 4GH4C 1LESA 1RUD3 4MXVA 4RHV1 3THDA 4FPOB 4KU7A 4LJHA 2QTWB 5HXVA 3N9LA 4Y24A 3RYKA 4ARYA 1V6NA 1U5YA 3WF2A 4WM7B 4QDRA 1S0BA 2R071 3IPVA 1QNWA 2ZGLA 2WWSA 3WOGA 4AZZA 1E57A 4YNIA 1YI9A 3I3BA 4BIOA 1UZYA 1Q8QA 2Q8DA 4M3CF 3KVAA 1KJLA 5KXBA 5AC91 1FMD2 1R083 4IEVA 1KD7A 4NHLA 3UGFA 2R041 4FT8A 2QQJA 3JQWA 2VU9A 3KV6A 2HH9A 4NWVA 4A6OA 5F5CA 5A1LA 1ZZCA 2Q1MA 1FPN2 3AZVA 3FC0A 1S55A 2XGXA 2J1AA 1HB4A 1HDKA 2RDNA 3GCWA 1ND2C 2CGOA 1CAXB 2YFUA 1EAH2 2GC0A 3RI9A 3AXEA 2W2IA 5KXDA 1MZFA 2EVXA 1OUXA 4RYDA 4UW4A 3ATGA 3Q8AA 3CJIB 2C4XA 1ULOA 3NJZA 1DF0A 1JOPA 4NR1A 5H9SA 1KXGA 5BNOC 1N1SA 2VL4A 4LBNA 5A3LA 1PVC1 5FPBA 3N4MA 3SC7X 4EJRA 5DPNA 3ALQA 4JGYA 3AZXA 4BQYA 5I93A 2A6YA 2CAUA 3S0MA 2ZX4A 1FATA 1U0AA 2ORZA 4TSVA 1W2NA 1K12A 3NQHA 3POBA 2RJLA 1RUG1 3MF6A 4QX5A 4QQPA 5A3PA 1PZ8A 1G9BA 4NAOA 4BA6A 1PIV3 1AX0A 1QJX3 2QVSB 3CZUA 1AYM3 1PGW2 2WBKA 5KHJA 5C33A 1XSRA 5IYYA 3RZHA 4ES8A 4M3CE 3AM2A 4IEPA 3V64A 5C3OA 1KFUL 2QQVA 1GWMA 5EJZB 3U1XA 4HKOA 2QQNA 1LOFC 2RMU3 3WUDA 2ZPXA 4B4QA 5C3SA 3ORJA 5ANQA 4P9YA 5J48A 5KC6A 2ARCA 1SFYA 1WW7A 1X7NA 1W8WA 1AR61 2ARXA 5ANNA 4QX0A 1XE8A 1W3XA 1RITA 2AZ5A 4HONA 2ZABA 5C4WA 4WM8A 5FBJA 4BOWA 3N7JA 1DGRA 4LK7A 4JQTA 1LNSA 3ZSMA 4D94A 5KWRA 1OBNA 4QQHA 3NNMA 4LOTA 4MV2A 2XBO2 1HN0A 1JHNA 3IBMA 2JKXA 4CDUC 2VZPA 3N7LA 5L36A 4LLFA 4Q4W3 3L2HA 3RZLA 3ZX7A 3AYDA 1SBFA 1ZX5A 2NMNA 3AVSA 4IV1C 4L97A 4Q27A 1OA4A 1TNFA 3DXUA 5F2SA 2GMEA 5KXEA 1N1YA 3F95A 3IMMA 2ZGTA 2ZX0A 3HQUA 5AFEA 5CEHA 2A6VA 1NG0A 1EV11 2W92A 3UYJA 4BWOA 2FMDA 2ZACA 2B9VA 2D44A 2OYZA 5A32B 1OSGA 1YC61 1DQ2A 3PVEA 1H0BA 2BRTA 1WW6A 1CGPA 4YVWC 5JUVA 5FZBA 1N3OA 3TEZA 4YVSC 4F8AA 4YM1A 2RE9A 1PX4A 3WDUA 1JYWA 2HWC3 3LE0A 5IT6A 1IHMA 2Q1FA 2GNBA 4L9BA 1ASJ2 1ZM1A 3ZR5A 4QM9A 3BB6A 1NCRC 1ZVFA 1WLCA 2JDUA 2LS6A 5JSRA 3R05A 1UYXA 1LHWA 3AC0A 1TMF3 3M70A 4Q1PA 5I0SA 2YC0A 4EWDA 2YPDA 3U14A 3N35A 2C1FA 2RS11 3EQEA 1GWLA 4UI9L 5A7SA 4QHZA 1FMD1 3RZKA 1ZYBA 2OPKA 4KBZA 1SLIA 4CEYC 4AAPA 1TEIA 3NV2A 4G9SB 4MHRA 3E97A 3H3UA 5G04L 5FY4A 2Y33A 3VHOA 1AR93 1HRV2 2VCBA 2PLV3 4WVWA 4JC1A 3KMHA 2SBAA 2WFF2 3WG3A 2DVBA 4LQRA 1YUDA 2YBPA 5L7OC 5CBLA 1RJ8A 1UMIA 2O1QA 5KHHA 4E8DA 1QNYA 4XILA 3O5SA 5IFPA 2ZA9A 2ZXQA 2W95A 4XMIA 1BVVA 3WDWA 3ZKUA 4AFAA 5ABJB 3TN93 3WG1A 3AKQA 1OQEA 2ZHNA 5F39A 4GB31 4BLJA 3VDAA 2HEYF 2W87A 1X82A 3AJZA 1VMHA 1R1A2 1LHNA 1QJY3 4YGCA 5E89A 5IK4A 4LXLA 4PHZA 1JN2P 3ZYFA 2WNVC 5BNNC 3OCPA 2ZGKA 4XF4A 4NRQA 4YW7A 5A3UA 3JU9A 1BBT1 1S1AA 4COZA 2WLQA 4UFKA 2HYKA 1LOCA 4BQ2A 4AOCA 5A3MA 5CG9A 4NVPA 1QJEA 1IPJA 1RUH2 4A7YA 1CR7A 3WF4A 1V0AA 3POGA 4AVCA 4OMDA 1FX5A 4SBVA 2RS33 1O4TA 4BU2A 3DF0A 1PNFA 2VMHA 1V9U1 4RR3A 4COVA 4A6SA 3O1SA 2PELA 2XJUA 1QXPA 2IZWA 3LFIA 4EQVA 4OUSA 2PXJA 3I2GA 4RA0A 5FQ0B 1WA6X 1AR82 1LCLA 4CCDA 5CAZA 1CESA 1X50A 1LOEA 1GQHA 2X05A 1DYPA 2XH6A 2ES3A 3VBUC 3ST7A 1OLRA 1XC6A 3B9IA 4CCEA 2YFZA 2LUWA 4IXLA 3RI8A 2R0FA 3AL6A 3N7KA 2IFWA 2DVFA 4V2VA 3VHRA 4EN0A 1VRH1 4LULA 3MLKA 5EYYA 2FZ2A 2WZ8A 4LO6B 3POIA 1PGL2 1QDCA 4LEJA 5FP8A 4OHZA 2F17A 4K8RB 5FYMA 1CPNA 2P6HA 1WBLA 4XF3A 2D6KA 1G9DA 1U5ZA 1UY1A 2BYVE 1FOD2 3D3AA 4CPBD 1PO22 3HJRA 4GZ9A 5F5QA 3A4UA 1MACA 3OYWB 4UF0A 2J1TA 4YLZA 2A75A 1ND2B 1A3KA 1LU2A 4O65A 3ZN6B 4XXPA 3ZFEC 4HBNA 3KSCA 5F6LB 4FFFA 4XDOA 4DEVA 1XPWA 5BNOB 2ORXA 1LOGA 2BGCA 1NQJA 4WBBA 1BYHA 4AG4A 1OF4A 4Y20B 2P3JA 3WG4A 3ZYHA 1H1AA 3FHIB 4MYEA 4HSLA 2C0ZA 3A0NA 2NYYA 3E5UA 4E2SA 1NYWA 4F83A 3WW4A 5IVJA 2C9AA 4LE4A 3MI8A 4P9JA 5KHKA 3I2IA 1F4AA 3MUZ1 4BYYA 1PGSA 1UNBA 2UYBA 4BE3A 4ZHNA 3MLJA 4XIKA 2B4KA 4L92A 1N1TA 5ACA1 2AENA 4OYUA 4PLOA 5E88A 2WFF1 2RS51 4R8HA 3U4XA 1RUF1 1PVXA 2W1WA 3ZYRA 4Z8BA 4B8EA 5ABJA 5J09A 2FD8A 1LGBA 1REDA 3OGGA 3B01A 4QB2A 4UW3A 4HSJA 4CE8A 4B1LA 4JTOA 4S2DA 2NP0A 5IVEA 3LOIA 2E31A 5BYNA 2J1UA 1RL3A 1US2A 2WZR2 4LBOA 3V65A 4OCTA 2WNUA 4AFBA 2Z42A 1AL21 1ZBA3 4FPKA 2Q5TA 1PO11 4XETA 3APBA 1OVSA 3RMYA 4R9DA 2YDEA 1ZZBA 3PDQA 3H3LA 2BWCA 1RUOA 2WQ4A 2CNAA 3AKTA 4MLOA 1I6XA 2VNVA 4K1ZA 1UW8A 3CDZB 4ZU4A 4CDUB 1WUVA 3HBKA 3R4SA 2E53A 1R093 5BUVA 2X53S 1DG6A 1AR72 4ARXA 4DQAA 3H8RA 1PZ9A 4N43C 4RGAA 4FP2A 1CIWA 4IV1B 4UFJA 1W6MB 1UOFA 1I3HA 4ZXKA 1UMHA 4UYBA 1RUH1 1UWWA 2DCYA 4J6GA 3RGBA 2HWF3 3C7EA 3AL5A 4RD7A 1QJFA 2BZDA 4G3YC 4NE9A 4Q0QA 2ZMLA 2D5FA 4JDMA 2TNFA 3T08A 1MS8A 1XU2A 4HN0A 4XJ9A 5JXHA 5FPLA 4Z2WA 4N7IA 2WKKA 3JD73 4YVWB 3BTAA 2W1UA 1RUJ2 1CPMA 2ZTNA 1QQP2 5L9RA 3ZXJA 4YVSB 5LA0A 2PHLA 2C26A 1VBD2 4KNCA 3BIEA 4XYXA 4FTEA 3WF0A 2VVFA 3FHAA 4PJYA 1HXS3 2V5YA 4ET7A 2YB7A 5J3UA 1DU3D 3OGRA 3JQXA 4LK6A 3T0AA 1NCRB 1OUSA 3MFAA 2WO3A 1C3HA 4HN1A 4INDA 1PGL1 3DYOA 3OYWA 3ZDSA 3S30A 2EIBA 1UKRA 1MEC3 5GZCA 3ZN6A 2QDNA 5FP4A 5CFCB 4I2OA 5HCFA 4BH9A 1FOD1 3FFZA 4CEYB 2D6PA 1AVBA 1RMU2 4ISRA 1QOTA 5FZKA 1O3QA 2JDPA 2HWE3 4Q0VA 4Q29A 1E5RA 1F8VA 5FYTA 3DEMA 3ZYJB 3BU0A 5H9PA 1IKPA 1QOOA 2W52A 4P9WA 4XBQA 1GOFA 1RUE1 5FPAA 5A7NA 5L7OB 2VC9A 1YNAA 4IDZA 1WD3A 5T3NA 2QZ3A 1K5MB 3ETQA 3MHZA 4JGYC 4RS5A 4DB5A 4R4XA 3TEYA 2GAUA 2Z5WA 2JG9C 4SLIA 3PUSA 5JLVA 3KLSA 2JDYA 1NLSA 3LOBA 3CO2A 2Q8CA 1YCIA 1W8TA 1PZ7A 3ABZA 2JECA 4Z1VA 1YIFA 1RVF1 4XFFA 5LRSA 3M7AA 4Q4X2 1Y9MA 1ZRFA 2WNVB 1T6GC 1KJRA 1N47A 3CKHA 3AMQA 3HQXA 5FP7A 1ZBE2 3SLIA 4RN5A 1FV3A 4QD2A 1JYNA 5TSWA 2Y6KA 4C8DA 3PMSA 5F3CA 2MEV1 1ONAA 2E26A 1P8JA 3PUAA 4C1XA 3WF1A 3AZZA 2AUYA 1OHFA 1QWRA 1WLTA 2WZR1 5C4WC 4CCKA 2VVDA 2WWJA 3OTFA 4LHLA 4AGVA 1ODNA 4LBKA 4XACA 1C8NA 3J7LA 4IE4A 3ZSJA 1OC1A 4COUA 2XONA 2DWRA 2ZEWA 4C91A 4CU7A 2ZCWA 2Z69A 3AK0A 2DBIA 2BERA 2P4EA 3GHNA 4FO9A 1NT0A 1W6MA 1SBEA 3VBOC 5A7OA 3OPTA 1LENA 2BWAA 3EO6A 2WZEA 3GBGA 2AGSA 4MSVA 4NHXA 1RINA 3NNJA 3VBUB 1AF9A 3VDDA 4GA9A 4C1WA 1GMMA 3G6JB 4DUWA 1D0HA 4QHBA 2A3WA 5HV4A 4BK5A 4YG0A 4OLLA 1TG7A 4M4PA 4U2AA 1LTEA 1WBFA 4XCAA 2GP5A 4NIIA 4YVWA 5JOYA 4L2NA 4BXSV 3FFQA 3KF5A 4CDWA 1G9AA 2UURA 3ITQA 1IPSA 2IUWA 4CUBA 1SMVA 5CKNA 3LIGA 3WNKA 4AWDA 3ENRA 4XZUG 3WNXA 4BDVB 3T2OA 4QPIC 4FPYA 1HN1A 1YJLA 3BYWA 3KGZA 4AL9A 1QQP1 5KBFA 1JUHA 1DP0A 3ZFEB 4EZ4A 4AXOA 4K40A 1JZ5A 3WSOA 4DIQA 1WW5A 2RM23 5C3PA 5BPXA 2RJ2A 2WLPA 2WO1A 4PIYA 5CFCA 1Y43B 3N9OA 2HKXA 1H1IA 3SKJE 4ONUA 3U78A 2I74A 1GNHA 3DPRB 4AVAA 4IETA 4J1WA 2HEVF 1YIPA 4RFRB 2ZEXA 1V6KA 2WJSA 4R9CA 2OZ6A 5FYZA 1O7FA 3O14A 1CAWA 4XFCA 5FFOC 4CCNA 4DRVA 5L7OA 2WA3A 5DN2A 1ULFA 1AXZA 3IDBB 5DAWA 1K5MA 3S6PA 1HX6A 2WSUA 3ILFA 5FLJA 2BVBA 3RQ0A 3MZHA 1ULPA 4LHKA 4QAWA 1D2QA 4LA2A 4NHMA 2W68A 5FP3A 3WHUA 2VZUA 5KR7A 3WNLA 5FMOL 4W50A 3ZYPA 3CEWA 4PT6A 4U36A 4XQWA 3THCA 2W47A 2A1XA 1OVPA 4YG3A 4P9IA 3VZNA 3CBNA 3TB0A 4KWUA 5HI0A 5FUNA 3VGIA 3ZYBA 3MIDA 1W04A 5E8AA 1SQ4A 3GDBA 1NCQB 3KT7A 4LMFA 4P9XA 1PMJX 2LALA 2JEMA 1RHI3 2QJVA 2VY0A 3HWJA 3E1F1 3LA3A 3NNGA 3NV3A 1SCRA 2W9XA 4H3WA 3U37A 5FZFA 2JDAA 2SLIA 1J3QA 1W6OB 3BIWE 4IERA 2EIDA 2VUDA 1S2EA 4FXKB 1AYN2 2NM1A 4CU6A 1MZEA 2P37A 4K3UA 1YXWA 4QX7A 3RSJA 1HQLA 4YFWA 5EYXA 2HEWF 2Y26A 2CTVA 4AI1A 4YPJA 2P6CA 5A70A 2FCUA 1HRI1 3WNMA 1HQNA 1KEXA 4FPLA 1ZBE1 3MIBA 1XRUA 3SCGA 3NNLA 4OHXA 2HBUA 1F5FA 5D8AA 3WP6A 4YARA 3OGJA 1X33A 1F5JA 1H8VA 2VMCA 4MGQA 1GFF2 4NO4A 4RR3C 1DQ1A 2GC3A 2R49A 3J8F1 1C28A 2OUHA 4JCKA 4XUNA 4CUGA 4EE2A 1LKNA 1LB2A 4PLNA 2X8KA 4I0WB 5F5IA 5A33B 1GZWB 1MQTB 1XE7A 4NUBA 1XYOA 2OT7A 3H7YA 1VPHA 4Q4Y3 2B5HA 2C6SA 2YPJA 4D8MA 1W8FA 1Y3TA 4RHV3 3W59A 4XJUA 2CWSA 3ZMOA 4X6RB 1ENXA 2D5HA 2NPIA 4ZZ8A 1IZ3A 3IN9A 5LBEA 2R073 2ATFA 4A44A 3LEGA 4JHTA 1DGWA 1W03A 2WFPA 5CNAA 2R061 4W6XA 3B93A 4GULA 4XFIA 5LEKA 1ULEA 4FPGA 1CONA 3OPZA 1UXXX 2R1BA 4CXXA 3DGTA 4ITCA 5JDBA 4LO8A 5DZFA 5C5UA 3W20A 4AQ6A 2VJXA 5AC93 4MGSA 2R043 2VMFA 5CADA 3WCSA 4GQ7A 5C3RA 3JBG2 1JYIA 3EB7A 3B5LB 1BQPA 4JZRA 2WA4A 1STMA 1MZ6A 2GSYA 2GMPA 3VZMA 3BUCA 3IAPA 2VNGA 1G9CA 1BKZA 2YHJA 3DPRA 4NIAA 1T6BX 3T30A 4UAPA 1NLRA 3E6CC 4UT5A 2EIGA 5HCAA 1DIWA 1KDKA 3CU7A 4K9SA 1WMEA 1WA4A 2ZGQA 1PVC3 5HBAA 2A71A 3WEZA 2KM2A 5T5PA 1Q5OA 4JGYB 1OLME 3Q9OA 5A80A 4JTNA 3T0BA 2JG9B 1WCDJ 1QMJA 2ZEZA 1RUG3 5FKCA 2MHFA 3VBSB 3WLUA 2ETEA 2OA2A 4XJ8A 1UY3A 4CCLA 3ILRA 2XJTA 2IXJA 3R0RA 1GP6A 2P1BA 3S7IA 3P3PA 5K8SA 5ABJC 3QH7A 4I0AA 4CXYA 2WT1A 5GALA 3RFRA 1NCQA 3M3QA 3DKWA 3KQ4B 4NIHA 4GJZA 5JOWA 2XVKA 2Y8KA 2ZJCA 2VE1A 2WNUC 1W6OA 1W2AX 2WT2A 1PK6A 4B3NA 1AR63 5C9AB 3KS7A 4WVVA 3R4DB 3UJQA 1JZ3A 3SEPA 1JZ7A 5C4WB 2JD4A 2RR11 3ACGA 4YGBA 4BISA 3OUJA 3B69A 4NIGA 1LHVA 1ENQA 5HXMA 4OZXA 2D7FA 4G4FA 5FDBA 2QNKA 1UKGA 2KD7A 4FQ4A 4BQXA 3CF6E 3BOWA 4P00B 5DXDA 3VBOB 1IS5A 3J26N 4KWLA 5F37A 3K75B 1D4VB 3D82A 4FPCA 3MICA 3HEIA 5FYVA 1TME1 3B94A 3O12A 3T0DA 2Z4FA 2CV6A 4XJZA 3UGGA 1RYYA 5A33A 1MQTA 2Y6GA 4AHYA 4DO0A 1NUKA 3V0AB 1DYKA 3PNAA 1EY2A 2D6MA 2P2KA 1AX1A 1EV13 4IE7A 4B7KA 3WQ0A 2DU0A 1C8M2 1XYNA 2ZZJA 5FZEA 1Z7S2 1IS6A 2YXSA 3EHKA 2OZJA 3HOBA 4LBMA 4C90A 1LAJA 5FBZA 4XTMA 5DDJ1 1UU6A 2OW4A 2V5DA 5IK7A 3I2OA 1IQDC 1ENSA 1UY0A 2ZGOA 2ZS6B 5LB6A 1ZA4A 1UN1A 4MADA 1H2NA 5CA6A 1ZRCA 2UY8A 1DGWX 2V4VA 2B7YA 1RB8G 1RUD2 4MH0E 1Q8OA 4QPIB 3RYPA 1US3A 2FDKA 1F4HA 4F3JA 4IE0A 4O61A 4Q0SA 2N7GA 4YGDA 3GYDA 4OI0A 1MR5A 2DU1A 4AVVA 1RXGA 2DTWA 4FPJA 2RS13 5JR7B 4OQ9A 5ISLA 1LR5A 2A5ZA 2Y6HA 2OIIA 4FOQA 4ZONA 1FMD3 2WQ8A 3PU8A 1QY4A 2HWB1 3D0SA 2GN7A 4LHNA 3HN3A 2YU2A 5FMDA 1NY71 3N9PA 4IGPA 5FZ3A 1GOGA 2CYFA 2VM9A 1SLCA 3FX3A 2W1QA 3X29B 1QDOA 2A6WA 3IMNA 4AEDA 2UWCA 4CZSA 1YQ5A 1V70A 2Y38A 3WUCA 4LO7A 3PVNA 4FAGA 4OUMA 5LATA 3NJXA 3KT1A 4URTA 2X29A 3C7GA 2XQXA 4DY3A 4ZS2A 1H30A 1XNDA 2JG9A 4NROA 3DN7A 4RS5C 5FPUA 5JMCA 5LY2A 2XJQA 2ZX1A 4CCMA 2UU8A 2W0XA 3VBSA 3LPGA 1SLLA 3CNAA 4LKSA 1CQ9A 3CIHA 4YZ5A 1UIJA 3FLTA 1OD5A 1UZZA 2HLEA 3WW3A 1YQ8A 3SH5A 1IG3A 3MIEA 4BHPA 4LR4A 3AKSA 5KHIA 3TOJA 4BQ5A 4GB33 2DUQA 3AZYA 5BNQA 2HWD1 5LY1A 2FBEA 2EAAA 3IDAA 3QBQA 5GZDA 1PIV2 3LEIA 1SHWB 4LKDA 1AYM2 4L0PA 5LBFA 2BBVA 2BQPA 3T2QA 4N8MA 1JMUB 5C9AA 3ETPA 2D93A 1BBT3 4GMP1 4AI3A 3QOPA 4I3PA 2B9UA 2VUJA 3HQRA 3C7OA 4IE5A 3OEAA 2K2SA 2NLRA 3CZJA 1F31A 2PAKA 4E2QA 4XCBA 3KHBA 4A3ZA 3MFCA 2EXIA 2R32A 4Y1XA 3PVBB 3C2UA 3DUIA 5FZGA 3UKTA 4RR3B 1V9U3 3VBOA 2A6ZA 1VBE2 4MGZE 4GALA 5FK7A 5LA9A 4RFT0 2VR4A 5CFDA 2VBDA 4AR2A 2PHWA 5FZ8A 3J9SA 2WNOA 1MVEA 3IM0A 1EUUA 4LE3A 3PMEA 4E4HA 5AVPA 3E5QA 1BEV1 4L99A 3BTYA 4R4ZA 1SLBA 2GNTA 3OUHA 5IAVA 1TE1B 3VDDC 5F6KA 1EUTA 4IGOA 3V0AA 5GLVA 1REEA 1VBB1 2CU5A 4Q4W2 4MOAA 5JVVA 4HXCA 1PMHX 5CU1A 2F4LA 1W39A 3ME2A 5JI9A 1VRH3 3BALA 3JB8A 3Q8BA 5DABA 3ROUA 1CIYA 1KRIA 4CP0A 1NA1B 2ZHKA 3OBAA 1D7PM 3KHCA 3DYMA 1F9KA 3ES4A 1OOPB 1J3RA 1VALA 1VMFA 2Y64A 4CDWC 4Y33A 1LULA 1JZ2A 3VL9A 3IDCB 1UAIA 3LF7A 4QPIA 1W6PB 1T2XA 2O14A 2FDIA 3VLBB 2AEZA 1KS5A 4HKWA 2GH8A 3ACIA 3AP4A 3G7DA 4H55A 3KVBA 4UF0B 1PHMA 1LGCA 3GZAA 5FO7B 2J1VA 2VQAA 3MBWA 1KGYA 4CP9A 4DY5A 4XDPA 3E6BA 2HWC2 4HANA 3D6EA 1GICA 1DGRN 2CDPA 4RQPB 2V09A 3HIFA 3JCIA 3UL2A 2AREA 4A3XA 4HZFA 1RUI2 3OBTA 3VB9A 5CVRA 2CL2A 2FMYA 2R30A 4AE2A 1VP6A 1FPN1 4A41A 2VUCA 4COWA 1JYCA 1D2SA 1OF3A 1FXZA 5H9QA 1EAH1 2P5BA 2WN2A 1H4HA 1BK0A 1JU4A 1Q3EA 4K6BA 4TTGA 5I91A 3A7QA 1SFPA 4IE6A 1ALYA 1W06A 2OQ6A 1K5MC 2GC2A 3VUOA 1AR92 2DTYA 1YHFA 4V1PA 2PLV2 3RRDA 5ACA3 2VPVA 4QT6A 5LA1A 2WFF3 2RS53 1ODMA 1GNYA 4EN8B 1RUF3 2BTVC 3ZLIA 1CJDA 2DVDA 3NSTA 4QPYA 1UPSA 3I4IA 1HKDA 5L19A 2B42B 2VMIA 3POYA 4Y1UA 4BQ1A 2E6VA 3AMNA 4AGGA 2WS92 4HOOA 5A6ZA 3VZJA 2X5IA 3VD3A 5FUIA 3RZMA 2WNUB 1XOYA 1BK1A 2V72A 3ZXAC 1IS3A 1AL23 2W94A 3MW3A 2ZGPA 3ZN5A 1NZCA 1PGW1 3TN92 4W65A 1PO13 2A3YA 4CUAA 1SG3A 2WSVA 2EXJA 2PAMA 1S0JA 1VBA2 3ZDVA 4META 3ZYIB 2YBKA 4YYOA 1W99A 1W8ZA 5LBCA 1J1LA 5IWFA 4ZS3A 1CX4A 1SFNA 2E7QA 2GC1A 4ORFA 3O1VA 3QACA 3BODA 1UL9A 4R9AA 2PHXA 4A7KA 1GQPA 2FDFA 1RUC2 5D2AA 3ELNA 1CJPA 5D8AC 1E5HA 2EIEA 2F6BA 4CU8A 1RUH3 2KXLA 3AMMA 2W1SA 1O4ZA 4E8CA 3I3MA 1W8HA 5DUXA 2XBO1 1FAYA 1UPIA 2VG9A 2H6CA 3F2ZA 2P3IA 1VLNA 3KV5A 3U4SA 5FOJB 1H9PA 3USSA 4QXKA 2FDHA 1C57A 4LBQA 1VBE1 4Y4YA 4MX3A 4CCCA 1BLZA 2DVAA 1W8NA 2J22A 5A7QA 2JG8C 2D6OX 4GKYA 1HJFA 1UYPA 4MXWB 4ZPIA 4YM3A 3ES1A 4DXSA 1QKQA 1HB3A 1NA1A 1E5SA 5JOXA 2ZAAA 5DUWA 5K4LA 1OOPA 4KG0A 2BBAA 4LA3A 4D6SA 1DBNA 2BP6A 2A7AA 3GJAA 4CP2A 2XJSA 1AJKA 1W6PA 3M1HA 3VKNA 4DXRA 1XNCA 3H8OA 2K0GA 3I8TA 4I30A 2G9FA 2ZGNA 5EWSA 1CX1A 3HBZA 2WWUA 2QE3A 4NN0A 3N36A 1FOD3 2LROA 2R1DA 3B3QE 2E33A 3J4UH 5FZ9A 2VBPA 2ID4A 4RQPA 3O0WA 2ERFA 1ASJ1 1Q8VA 2G4IA 4H14A 1COV2 3DPRC 1QJU2 1WWYA 2FQPA 2Y60A 1S0EA 3BVCA 1XQNA 1QHDA 4CA9A 2JDNA 4ZKTB 1J83A 1RUE3 2QBXA 3D8CA 3N9QA 2FZ1A 2YC4A 1R64A 3IT8A 2VBBA 1ZZ9A 4PIZA 1RUI1 1SACA 4RS5B 1VIWB 5FZMA 3B00A 1H2KA 2WL1A 4XF9A 4XE9A 4XQDA 2FHRA 3LB9A 4YSFA 2YMZA 5FZCA 4OHYA 1HRV1 2IXKA 3PJYA 3M2MA 3DV8A 3H50A 5DG2A 1YQ2A 1GP4A 2VZSA 4IGQA 3BPSA 2P17A 1RVF3 3CLPA 4GIQA 5F3GA 1OI6A 3I3EA 3ZXKA 2DF7A 2R7EB 2GDFA 2XKOA 2XMLA 4XJWA 4FOWA 4QKBA 5FCCA 4QU1A 5FUPA 1NCQC 4E4SA 4ES9A 2BOIA 3KCXA 4YGEA 3VBRA 4B4PA 3U75A 1S2BA 1PK6C 2YY1A 3LEKA 4YZ2A 2MEV3 4F7ZA 2WS91 5FY7A 1UOBA 2ZMNA 3RJRA 1R1A1 2WZR3 2TEPA 1UF2C 4QMAA 3TEWA 5K0UA 3HNYM 5GM0A 4AQ2A 1DQ0A 1WW4A 1XNAA 4EZHA 2YBSA 3AJYA 1VJ2A 4FOVA 1V6LA 2TBVA 3S7EA 2VOKA 3K48A 4JV4A 4QKFA 3POEA 5C7GA 1VBA1 3C7HA 3DL3A 3PUQA 3NJVA 3V0BB 2BOJA 3C7FA 4JAAA 2JDKA 1FV2A 5A6QA 5JR2A 3O0VA 5L73A 3VDDB 3VD7A 3NV4A 1VE0A 3BU7A 1R092 1SCSA 3BKZA 1AZDA 3SCHA 1MQTC 3NO8A 4FOYA 3TRSB 1RUC1 3PTRB 5BV6A 4BZ4A 4IUGA 4Q4V2 3LIHA 4M01A 5C8WA 4GJYA 1AR81 5IFTA 1K5JA 2EXKA 2J1SA 2RDQA 4MXWA 4CDWB 4XJAA 1JZ6A 4JGZA 3GCXA 4DEQA 1L7QA 5ERLA 4NRMA 3V56A 1JI6A 1GLHA 4LPLA 3OPWA 4XUTA 1YEWA 5GLTA 2PHDA 1CVNA 4QKDA 3UETA 5C5TA 1AJOA 1QQP3 1LGNA 1W6QA 2IWGB 1Q8PA 2IXIA 2C24A 4K1YA 3SH4A 4D69A 5FREA 2JICA 5LWBA 5FZ6A 2OX0A 4OI1A 1U12A 2E7AA 1HXS2 4XBLA 1JYVA 3POSA 1IOAA 4R9BA 1PO21 4QX2A 4JDNA 4M3CA 3AFGA 3SHRA 3ZIXA 1JTZX 4LLOA 4KI5M 1IGOA 1R1ZA 3ZKYA 1M06G 4UFMA 1MEC2 1UY2A 4LIUA 1CAWB 4K8FA 4LKFA 4Q8KA 3LSEA 4Y1ZA 4AHZA 2Z2SB 3I3QA 3AZWA 4AEDC 1DGLA 1ST8A 4FXGB 1DZQA 1NKGA 2Q1ZB 2YZ4A 4QQOA 1COV1 2VNRA 1QJU1 1G6NA 3U07A 2D97A 2BW8A 3CMGA 3P3NA 1VBC2 1RC6A 5JIUA 5FZHA 3VBSC 4UFIA 5FK8A 5JPMB 4P02B 3LDRA 4ZU5A 4KQ7A 3GALA 3RJ2X 3JXSA 4EN6B 1YFXA 1L7RA 4GAZA 3O1UA 3AMPA 1SDDB 1RGSA 5A3TA 2VTXA 4CU9A 2ZGRA 2V73A 3S57A 1SZBA 4PLMA 3K3OA 2NQYA 1Q8SA 5C9AC 1XE0A 2XWBB 1HRI3 3RDIA 3H42B 3JUUA 3LPFA 1ZBE3 4Z07A 4QXBA 1DLLA 1XNTA 4XOGA 5D8AB 3MPBA
chains in the Genus database with same CATH topology
2E9QA 2E7TA 3J8F3 3ZFFC 4HKLA 4D3WA 1Q56A 3VN4A 3V0BA 1HIXA 5CFDC 1OLQA 1OQ1A 2JE7A 3WP4A 1FT9A 4QGLA 3RYRA 1AR71 3OBRA 2MPFA 4XFHA 2GU9A 3THTA 2Y0OA 4ZU7A 1Y7BA 1IS4A 2YROA 2JG8B 2VXRA 4H7MA 4AQSA 4DFSA 2DFBA 1D0GA 1DQ5A 2GNDA 4A2UA 4D7YA 4YW4A 2R063 2A6XA 2E63A 4IQPA 1L3JA 5JAXA 2WINB 5D1IA 4E27A 3WDVA 2AR6A 2D43A 4Q4V1 3WXPA 1RUJ1 1U5XA 4PDWB 3TAYA 5JPNB 3USUB 3ZSLA 1VBD1 1IQAA 4GWNA 4YM2A 5JCTA 3NW4A 3ZFGB 4NWWA 5JIAA 5JSPA 3WQ1A 1XNBA 4EN9B 4QGNA 4EN7B 1TNRA 3MF9A 3RS6A 2RM22 3WHTA 1O5UA 1N3PA 3AYEA 3L9JT 4E4DX 1RMU1 2Q30A 4LTAA 3VV1A 3GZUC 2VNOA 1OQDA 1FNYA 2DCZA 2XPJA 2NZ9A 2XG3A 1KS4A 5GLZA 5IK8A 1F2NA 1QF3A 1W6NB 3B9CA 2HJIA 4Y22A 2O0OA 1VBC1 2XVLA 1FYUA 2PAEA 4BIFA 4D7SA 2ZZQA 4GXLA 4XZPA 4Y26A 4X6QB 2X5IC 2ZAHA 1X8EA 2DCJA 4AHXA 1PK6B 5IK5A 2VULA 5DUUA 4JVAA 1H8TA 2W39A 2RR13 3HT1A 4HVRA 4I09A 3VBFA 1ZREA 4Q4X1 4FTSA 1JW6A 2IXHA 4XMAA 4Z82A 3NWKA 3VZLA 1KITA 2I2SA 4OHWA 1GANA 3RG0A 2JKBA 3U10A 1MS4A 1TME3 3W58A 5BY5A 3I59B 1CD3G 2PQQA 1YI7A 5C8CA 4FBFA 3AXDA 4N9HA 4S2GA 3ECQA 5DUVA 4KWJA 1D4M2 3GF6A 2JG8A 4IEWA 5DDJ3 1QH7A 2ZHLA 4QU2A 3OY8B 1NE6A 1J58A 1LHUA 4P5HA 1RJ7A 3BPZA 1NA1C 3I2DA 4RHV2 3NV1A 1AL0G 4AYUA 1OOPC 3AP5A 4UXAA 2A70A 3H0OA 2R072 4M0HA 5DG1A 3H1MA 1W0OA 4PDWA 5BNPB 5EFUA 3MEPA 1GV9A 2ZGMA 3EBRA 3ASIA 3USUA 4FP3A 4FPHA 3ZFGA 3HMYA 2IXLA 1M4WA 1O91A 2HWB3 3KCCA 2XB6C 2R042 2YYOA 4RQPC 4DPNA 4CEWA 1BXHA 5EJ3A 3RMXA 1N1VA 4AEDB 4ATFA 2ZBJA 3L2YA 1GSLA 1DFQA 4WVMB 2NMOA 2B46X 1J1TA 4LBQD 1PVC2 2YGMA 3VKLA 4C0HA 4CRQA 3N3HA 3FBMA 4WZCA 1JBCA 4MGYE 4CTEA 1W6NA 4BMBA 5DZGA 4DXZA 1J3PA 4KG8A 3SH3A 2HWD3 4Y1YA 2XL7A 4PBOA 4XDQA 5FPZA 1V6JA 2BUKA 3MW4A 3ZXDA 1B35B 4Y1VA 1VR3A 5AVAA 4GMP3 3H1YA 3VBRC 4PBPA 4GMP0 1NE4A 3WY6A 1WD4A 3TWIA 1NXMA 5K0UC 5FMOS 5JOZA 1AR62 1AYN1 3ZFFB 5LRRA 5CFDB 4EWAA 1DHKB 3U11A 1ND3B 4LT5A 1BEV3 4OI2A 1C1FA 3I59A 4Q8LA 1UCXA 1MS0A 3WDTA 1VBB3 1MZ5A 2PYTA 4OULA 2JE9A 3D4KA 4IV3A 5BXXA 2WC2A 1NOVA 4JDOA 3OY8A 3O7OA 2R16A 2VQ0A 4DOUA 2YUEA 1I9RA 4JGZC 3H1WA 5JWPA 1D4M1 3UJOA 1ZNPA 5T55A 3E6DA 1SEFA 3M3EA 3MLLA 2JDZA 4LBLA 1S0CA 3AB0A 4TLFA 3EJKA 5BNPA 3IKWA 1QH6A 2D6LX 4JRAA 4AEMA 1O5LA 1S0DA 4HVQA 3EXUA 2H6BA 1R082 4LUKA 3TBDA 1FPN3 4L8QA 3JBG1 5LEJA 1ZRRA 2PHFA 1EAH3 2RS12 1WLWA 3PJQA 4UW6A 1IKQA 4EV0A 4WVMA 2QFEA 4FAHA 4DS0A 4FQZA 3SNMA 1Q43A 4EWEA 1KFXL 1QXRA 2C5DA 2PHRA 1FI2A 4CDQC 3R6SA 3FJSA 2VW1A 3OD4A 2LTNA 3WT3A 5FPXA 3I54A 3VBHC 3R4UA 1WCKA 2X5IB 5GLUA 2G9GA 4YFZA 2OVUA 4I01A 4RSUA 4XFBA 1S2KA 4P14A 5KHGA 1QJX2 2RJKA 3MYXA 1B35A 1X8MA 2VOXA 4GB32 5JZGA 1A78A 4M0NA 2RMU2 1QXJA 1S0FA 2H0BA 3GZTB 3ZPYA 4OFGA 2I07B 3NL1A 2OUJA 2WIIB 1EPZA 3H8UA 4YM0A 4AVSA 5FO8B 1BBT2 2RHPA 3ZFFA 2DUPA 4DINB 3MIFA 5T5OA 3TYJA 1LJ7A 2XBO3 4KWKA 1ND3A 2I45A 5T50A 2XVGA 4PIXA 4E9KA 1H9WA 4CP1A 2Q0AA 1V9U2 4LBQB 1VBE3 1APNA 3H7JA 4JQRA 2EA7A 3MDPA 3T1LA 4BM8A 2E51A 2Y0IA 4WVZA 4AVTA 3B02A 2B45X 3FUOA 5KXCA 1C8M1 1ZZ8A 1JOJA 1Z7S1 4NHKA 5I0TA 1VRH2 3I7DA 2XLGA 4FCAA 1HW5A 4XBNA 1UX6A 4W6YA 1Z78A 1SLTA 4YZ1A 1RUD1 3IDEA 4AI8A 3FUQA 4WZFA 4BCUA 1WLDA 1YWKA 1DDLA 1G9FA 4WM7A 1ASJ3 4KH9A 1PMIA 1IPKA 1URXA 1GNZA 4XF0A 4AVBA 1VAVA 2UWBA 1TMF2 3SXWA 4XFAA 3WD5A 4XPVA 2A3XA 1RUI3 2PA7A 1R081 2XJPA 3WW1A 2LM3A 4LUMA 4LO5B 1ULCA 1HRV3 2MNGA 4Q0PA 3AYCA 3GNEA 2QZ2A 1J59A 2K9ZA 3D0JA 3WP5A 1CAXA 4D7TA 4CDXC 3U0ZA 1B09A 5K9YA 3CJIA 1I5ZA 1S0GA 2O8OA 1NXD1 4HFSA 4O9EA 4I0BA 1X36A 3HAGA 4Q26A 3MGUA 5ACA2 3WX5A 2ET7A 2RS52 1RUF2 1OA3A 1C5HA 1SBDA 3VHNA 4N9IA 3VBRB 1UD1A 2ZGSA 1A8MA 3KB5A 5FTTC 2WS93 1C4RA 4AFDA 5IUQA 1R1A3 4AEKA 1H8TC 1U5IA 5E1RA 2XHKA 3VBFC 4AI0A 4CYDA 5K0UB 1QJY2 4HVOA 5LK7B 3H3ZA 4FPEA 1PIV1 3VKFC 1AL22 1QJX1 1AYM1 1PO12 3ZXGA 4J1XA 1LODA 1VBA3 2XUMA 5FO9B 2RMU1 1KDMA 3N7MA 1VAKA 1OMIA 2JENA 2R6QA 4N90A 4B7EA 4L11A 1RIRA 3JB4C 1WCSA 1DQ6A 1HQWA 1H4GA 2RS32 1RUC3 3LGRA 3QD6A 5C8CC 3VKMA 1PM7A 1LEMA 4COYA 1YJKA 4GKXA 5FLIA 1AR83 4Z92B 1OPMA 4JGZB 1GBGA 4HL0A 4N53B 3UKVA 4LO4B 1YO8A 4Q4W1 4LBJA 1O3TA 2VW0A 4XQ4A 4OI4A 1QU0A 4GH4B 1W6QB 3OF1A 3WCRA 2Q4SA 1EP0A 1BVP1 4PDWC 3NAPC 2XL9A 4QGMA 3WDYA 1H1MA 3ZFGC 3HN1A 5A32A 1PO23 2EF6A 1O3RA 4AK3A 5SV5A 4M3CB 1WGPA 4YW2A 4NOTA 4CEWC 5T5LA 4IEXA 4QPGC 3QH6A 2JJ6A 2XLAA 2HWC1 4PQ9A 2BFUL 5JI7A 2P34A 2VH9A 3T1MA 1COV3 1QJU3 2WQZC 1JUIA 5GJ6A 1GQGA 2VECA 3LWCA 1TMF1 4CDQB 1UU4A 1RUE2 3OD0A 5EZWA 3PLQA 4TZDA 4TYSA 2ZMKA 3VBHB 2WNEA 4E4ZA 5HCBA 1AR91 4IEOA 5CIRA 2PLV1 1MS3A 2GALA 3PHMA 4H7LA 3WINE 2DURA 1LRHA 1ZZ7A 5C6CA 4BPZA 3WVJA 3RPQA 3KD4A 1RVF2 1LEDA 1MVQA 2D98A 3LAGA 3ZVXA 4HMZA 3WDXA 1CAVB 3GBFA 3ILNA 1WMDA 2D6NA 3HD8B 4IEZA 4PF5A 5T5JA 3AFKA 3LA7A 1ZBA2 3TN91 3WZ1A 3FE5A 1LU1A 4KGGA 3ZO0B 1XNKA 1YFUA 1MS5A 1PNGA 4AEJA 2MEV2 4ASMB 3HR9A 3TNQA 4AFMA 1QJY1 2PHTA 5CB7A 3OJBA 3BCWA 2UYAA 1BZWA 2UWAA 1YFWA 2DFCA 2PHUA 1AR73 3SCFA 2CGNA 3LKJA 4YRDA 4W6WA 1C1LA 1AXYA 3FZ3A 3UK9A 4B29A 1JXNA 4IV3C 3K51A 2HWF2 4DRRA 1POV3 4DMIA 3NKGA 1SDWA 3FBYA 2RS31 4N53A 4E2GA 5J37A 1POV0 4XEZA 4Q4V3 4IEQA 2XJRA 2XWJB 5FQ0A 3AP7A 3QCWA 1RUJ3 3JD72 4AGRA 4GH4A 1H2MA 4XTPA 2JXAA 4XFGA 1VBD3 5BNPC 4XXAA 3LSDA 5GLWA 4RGGA 3SMHA 2EXHA 3M4FA 1DZRA 1OKQA 2QQPA 4S2FA 1A8DA 1G7YA 4YZ4A 2ILMA 4OVEA 1SLAA 4YG6A 1QGLA 4MUVA 4QM8A 4HK9A 1V6IA 1YYNA 2F4PA 1GYKA 2QDRA 3AKPA 1G86A 1RMU3 1AX2A 1AXKA 1C5IA 2D3PA 2DCKA 2HWE2 4UBGA 3WQ7A 2PTMA 1ND2A 1VAMA 4K20A 3THPA 4CDXB 4B4RA 3IIAA 4CDQA 2GZWA 5J96B 3PVOA 2B8MA 3ACLA 2PN5A 5BNOA 3VBHA 1RTVA 2GMMA 4Y22B 3CL1A 3W9AA 3WDUA 1VBC3 2CAVA 2QCSB 3MW2A 3ZIWA 4AQTA 4Y20A 3WP3A 4AFCA 4FSJA 1MS9A 5T52A 1Y9QA 3AP9A 3B7MA 5H9RA 1WMFA 3D5OA 4BLIA 3FWEA 2BFUS 1REFA 4EROA 1H8TB 1ULGA 3VBFB 1B35C 4Q4X3 5JZGC 1KQRA 1Z0HA 1A6CA 2BEOA 3M8LA 5FOBB 4I3GA 1CAVA 2ZGUA 4IESA 4AF9A 2P3KA 1LOFA 2BNOA 4KBBA 4K21A 2ZKNA 5I8YA 5JSOA 5BNNB 1V6MA 1EPWA 5FAXA 1HRI2 1ZBA1 2Z79A 5C8CB 1G8WA 2QUOA 3ZSEA 3ZYGA 1ND3C 2UY9A 1BCXA 1EYBA 3J8F2 4WM8C 4XHBA 3VZOA 1OFSA 5SV8A 4CDUA 1R091 5I8SA 2TUNA 1POV1 2ET1A 4UW5A 3O0XA 2B39A 1OA2A 4IV1A 1CAUB 2BNNA 2JX9A 4M00A 2HWF1 3KQRA 3INAA 4HT1T 3NAPB 2R062 4R52A 4K7JA 4I02A 2IC1A 3WR0A 4YW1A 3ZXFA 3H9AA 4MGKE 2ZHMA 4GWMA 3AKRA 3IWZA 1UU5A 1VB4A 3A0KA 3RWNA 1VB2A 3JD71 3WG2A 1GR3A 4WM7C 4CEWB 4YVSA 2O8QA 3MIGA 1JH5A 1OPOA 2D40A 4QPGB 4XIOA 4QQLA 1XU1A 2XJVA 1HXS1 3ZN4A 3PTYA 1HV0A 1NCRA 1XYPA 3UKNA 3KZ4C 5F9TA 3VL8A 1LOBA 5EXOA 2GN3A 4A7ZA 5KC5A 4IEYA 1W0PA 2AH2A 1MEC1 3KCYA 3QLQA 4HPKB 4X8NA 4CDXA 4OHVA 3M3CA 4CEYA 3AMHA 2HWE1 4Y5Z0 4HK8A 3GHMA 4XW3A 4P9LA 1UIKA 4YW3A 3CJIC 3FLPA 4C0BA 4MZUA 4YZ3A 4YW5A 4ASLA 4KGQA 1QJZA 1GKBA 1BMV2 4IL7A 2AYHA 3NVCA 2PFWA 4AHWA 1OFNA 1N3QA 2ZOEB 1ZZ6A 5FRAA 4AW7A 1I1EA 5LK5A 4MGIE 2Q8OA 1RHI2 4X8PA 3SISA 3AX4A 3FLRA 5K7PA 3KM5A 4RL7A 2DYCA 4P9GA 1AYN3 2A73B 3WV6A 2VVEA 1BJQA 2RR12 2WNVA 5GZFA 5BNNA 2KA3A 2EALA 4KL1A 1YLLA 4IV3B 3WW2A 2CY6A 3BOPA 1LOAA 2WT0A 2DUOA 1TME2 2BNMA 1DQ4A 3ZXEA 4N43B 4FVVA 1V00A 4Q4Y2 1O3SA 4LNVA 1YRZA 3LZZA 3M3OA 4ATEA 3CJXA 4DZGA 4MVTA 1D4M3 5B2GB 1CAUA 2IXCA 5DDJ2 5EV7A 2GNMA 3VBUA 1LECA 4PCRA 1MS1A 3NAPA 3URFA 1TQ5A 3FMGA 3VZKA 5I8TA 5FLHA 5J98B 3RZZA 3E5XA 3IPVB 5AC92 2ZX3A 2XLFA 3KGLA 4XF1A 2ZKLA 2IFRA 5F1RA 1DZTA 3JBG3 3VKOA 2DVGA 4KU8A 1GZCA 4QPGA 4Q0UA 1FNZA 4BMEA 5J7MA 4S2HA 2YV8A 2HWB2 2ZX2A 1AHSA 4NPRA 2VW2A 2WZPP 3VHPA 1ZRDA 1NY72 3ZFEA 2VGDA 1YFYA 5E16A 2W08A 2D3SA 2RM21 5I0UA 4HPKA 1V6OA 1AUYA 1QOSA 2BVVA 3RNSA 2VOVA 3HT2A 5I0RA 3POWA 2GH2A 1UMZA 3SITA 1S0IA 4N7UA 5GZGA 3NKTA 4AI2A 1RUG2 1ENRA 2CWMA 2D3RA 4Q2FA 1GZ9A 1H2LA 3ZXLA 4UBHA 2R0HA 3ZSKA 3C3VA 2BPA2 5JZGB 4TWTA 1LHOA 1XXNA 2DV9A 2HWD2 1RUNA 5T54A 1BMV1 3MPPG 3M3IA 2ARBA 3GBWA 4HETA 3KT4A 1HLCA 1RHI1 5DZEA 5J36A 2VOWA 4WV8A 2DCTA 5CG8A 1HV1A 1NQDA 2QKDA 4DNYA 3ZMNA 1O4YA 5AFBA 4HLTA 3AYAA 2XKPA 3AP6A 4JRLA 2CGPA 5GZEA 3JZVA 2ENRA 4WM8B 5GKAC 4XHXA 1ULDA 3LA2A 3MIHA 3UV9A 1BEV2 4ISQA 4N43A 3LCPA 3T2TA 4QQ2A 2EAKA 4O9GA 1C8M3 1EV12 4Q1RA 1VBB2 1Z7S3 2VMGA 4N53C 3TNPB 4IEUA 2YGLA 1GZWA 2H0VA 4FPFA 2NN8A 1CN1A 1W2UA 4Q4Y1 2VUAA 4GH4C 1LESA 1RUD3 4MXVA 4RHV1 4FPOB 4KU7A 5HXVA 4Y24A 3RYKA 1V6NA 1U5YA 4WM7B 2R071 1S0BA 3IPVA 1QNWA 2ZGLA 2WWSA 3WOGA 1E57A 4YNIA 1YI9A 4BIOA 1UZYA 1Q8QA 4M3CF 1KJLA 5KXBA 5AC91 1FMD2 1R083 4IEVA 1KD7A 4NHLA 2R041 4FT8A 3JQWA 2VU9A 4NWVA 1ZZCA 2Q1MA 1FPN2 3AZVA 3FC0A 1S55A 2XGXA 1HDKA 1ND2C 2CGOA 1CAXB 1EAH2 2GC0A 3RI9A 3AXEA 5KXDA 1MZFA 2EVXA 4UW4A 3ATGA 3CJIB 3NJZA 1DF0A 4NR1A 5H9SA 1KXGA 5BNOC 1N1SA 4LBNA 5A3LA 1PVC1 3N4MA 4EJRA 3ALQA 4JGYA 3AZXA 5I93A 2A6YA 2CAUA 3S0MA 2ZX4A 1FATA 1U0AA 4TSVA 2RJLA 1RUG1 3MF6A 4QX5A 4QQPA 1PZ8A 1G9BA 4BA6A 1PIV3 1AX0A 1QJX3 2QVSB 1AYM3 1PGW2 5KHJA 5C33A 4ES8A 4M3CE 3AM2A 4IEPA 3V64A 1KFUL 4HKOA 1LOFC 2RMU3 3WUDA 2ZPXA 4B4QA 4P9YA 5J48A 5KC6A 1SFYA 1WW7A 1X7NA 2ARXA 1AR61 1XE8A 1RITA 2AZ5A 2ZABA 5C4WA 4WM8A 4BOWA 3N7JA 1DGRA 3ZSMA 4D94A 5KWRA 4QQHA 4MV2A 2XBO2 1JHNA 3IBMA 4CDUC 3N7LA 5L36A 4LLFA 4Q4W3 3L2HA 3ZX7A 3AYDA 1SBFA 1ZX5A 2NMNA 4IV1C 4L97A 4Q27A 1OA4A 1TNFA 2GMEA 5KXEA 1N1YA 2ZGTA 2ZX0A 5AFEA 2A6VA 1NG0A 1EV11 4BWOA 2FMDA 2ZACA 2OYZA 2D44A 5A32B 1OSGA 1DQ2A 3PVEA 1H0BA 1WW6A 1CGPA 4YVWC 1N3OA 4YVSC 4F8AA 4YM1A 2RE9A 2HWC3 5IT6A 1IHMA 2GNBA 4L9BA 1ASJ2 1ZM1A 4QM9A 3BB6A 1NCRC 1ZVFA 1WLCA 5JSRA 3R05A 1LHWA 1TMF3 3M70A 4Q1PA 5I0SA 2YC0A 4EWDA 3N35A 2C1FA 2RS11 3EQEA 1FMD1 1ZYBA 2OPKA 1SLIA 4CEYC 1TEIA 3NV2A 4G9SB 3E97A 3H3UA 3VHOA 1AR93 1HRV2 2PLV3 4WVWA 4JC1A 3KMHA 2SBAA 2WFF2 3WG3A 2DVBA 1YUDA 5L7OC 5CBLA 1RJ8A 2O1QA 5KHHA 1QNYA 4XILA 3O5SA 2ZA9A 4XMIA 1BVVA 3WDWA 4AFAA 5ABJB 3TN93 3WG1A 3AKQA 1OQEA 2ZHNA 4GB31 4BLJA 2HEYF 1X82A 3AJZA 1R1A2 1LHNA 1QJY3 4YGCA 5E89A 5IK4A 1JN2P 2WNVC 5BNNC 3OCPA 2ZGKA 4XF4A 3JU9A 1BBT1 1S1AA 4COZA 2WLQA 2HYKA 1LOCA 5A3MA 5CG9A 4NVPA 1IPJA 1RUH2 4A7YA 1CR7A 4AVCA 4SBVA 1FX5A 2RS33 1O4TA 3DF0A 1PNFA 2VMHA 1V9U1 4RR3A 4COVA 2PELA 2XJUA 1QXPA 2IZWA 4OUSA 4RA0A 5FQ0B 1AR82 1LCLA 5CAZA 1CESA 1X50A 1LOEA 1GQHA 1DYPA 2XH6A 2ES3A 3VBUC 3ST7A 1OLRA 3B9IA 2LUWA 4IXLA 3RI8A 2R0FA 3N7KA 2IFWA 2DVFA 3VHRA 2FZ2A 4EN0A 1VRH1 4LULA 3MLKA 5EYYA 4LO6B 1PGL2 1QDCA 4LEJA 4OHZA 1CPNA 4XF3A 1WBLA 1G9DA 2D6KA 1U5ZA 2BYVE 1FOD2 1PO22 5F5QA 3A4UA 1MACA 3OYWB 4YLZA 2A75A 1ND2B 1A3KA 1LU2A 3ZN6B 4XXPA 3ZFEC 4HBNA 3KSCA 5F6LB 5BNOB 1LOGA 2BGCA 1NQJA 4WBBA 1BYHA 4AG4A 4Y20B 2P3JA 3WG4A 1H1AA 3FHIB 4MYEA 4HSLA 2C0ZA 3A0NA 2NYYA 3E5UA 4E2SA 1NYWA 4F83A 3WW4A 2C9AA 4LE4A 3MI8A 4P9JA 5KHKA 4BYYA 1PGSA 2UYBA 4BE3A 3MLJA 4XIKA 4L92A 1N1TA 5ACA1 2AENA 4PLOA 5E88A 2WFF1 2RS51 4R8HA 3U4XA 1RUF1 1PVXA 5J09A 3ZYRA 4Z8BA 4B8EA 5ABJA 1LGBA 1REDA 3OGGA 3B01A 4UW3A 4HSJA 4JTOA 4S2DA 2NP0A 3LOIA 5BYNA 2WZR2 1RL3A 4LBOA 3V65A 2WNUA 4AFBA 2Z42A 1AL21 1ZBA3 4FPKA 2Q5TA 1PO11 4XETA 3APBA 3RMYA 4R9DA 2YDEA 1ZZBA 2BWCA 1RUOA 2WQ4A 2CNAA 3AKTA 4MLOA 1I6XA 4K1ZA 1UW8A 4ZU4A 4CDUB 1WUVA 3R4SA 2E53A 1R093 5BUVA 2X53S 1DG6A 1AR72 4DQAA 1PZ9A 4N43C 4RGAA 4FP2A 1CIWA 4IV1B 1W6MB 4ZXKA 1I3HA 1RUH1 2DCYA 4J6GA 2HWF3 4RD7A 4G3YC 4Q0QA 2ZMLA 2D5FA 4JDMA 2TNFA 1MS8A 1XU2A 4HN0A 4XJ9A 4Z2WA 4N7IA 2WKKA 3JD73 4YVWB 3BTAA 1RUJ2 1CPMA 2ZTNA 1QQP2 3ZXJA 4YVSB 2PHLA 1VBD2 4KNCA 4XYXA 4FTEA 2VVFA 4PJYA 1HXS3 2V5YA 5J3UA 1DU3D 3JQXA 1NCRB 3MFAA 1C3HA 4HN1A 4INDA 1PGL1 3OYWA 3ZDSA 3S30A 1UKRA 1MEC3 5GZCA 3ZN6A 2QDNA 5CFCB 4I2OA 5HCFA 4BH9A 1FOD1 3FFZA 4CEYB 2D6PA 1AVBA 1RMU2 4ISRA 1QOTA 1O3QA 2HWE3 4Q0VA 4Q29A 1F8VA 3ZYJB 5H9PA 1IKPA 1QOOA 2W52A 4P9WA 4XBQA 5L7OB 1RUE1 1YNAA 5T3NA 1WD3A 2QZ3A 1K5MB 3ETQA 4JGYC 4RS5A 4DB5A 4R4XA 2GAUA 2Z5WA 2JG9C 4SLIA 5JLVA 3KLSA 1NLSA 3LOBA 3CO2A 1YCIA 1PZ7A 2JECA 4Z1VA 1YIFA 1RVF1 4XFFA 5LRSA 3M7AA 4Q4X2 1ZRFA 2WNVB 1T6GC 1KJRA 1N47A 3AMQA 3HQXA 1ZBE2 3SLIA 1FV3A 4QD2A 5TSWA 3PMSA 2MEV1 1ONAA 4C1XA 3AZZA 2AUYA 1OHFA 1QWRA 1WLTA 2WZR1 5C4WC 2VVDA 3OTFA 4LHLA 4AGVA 4LBKA 1C8NA 4COUA 3ZSJA 4C91A 2DWRA 2ZCWA 2Z69A 3AK0A 3GHNA 4FO9A 1W6MA 1SBEA 3VBOC 1LENA 2BWAA 3EO6A 3GBGA 2AGSA 4MSVA 3VBUB 1RINA 1AF9A 3VDDA 4GA9A 4C1WA 3G6JB 1D0HA 4QHBA 2A3WA 4YG0A 4OLLA 4U2AA 1LTEA 1WBFA 4YVWA 5JOYA 4L2NA 3FFQA 4CDWA 1G9AA 2UURA 1SMVA 4AWDA 3ENRA 3WNXA 4QPIC 4FPYA 1YJLA 3KGZA 1QQP1 5KBFA 1JUHA 3ZFEB 4AXOA 4K40A 1WW5A 2RM23 5BPXA 2WLPA 4PIYA 5CFCA 1Y43B 2HKXA 1H1IA 4ONUA 2I74A 1GNHA 3DPRB 4AVAA 4IETA 4J1WA 2HEVF 1YIPA 1V6KA 2WJSA 4R9CA 2OZ6A 1O7FA 3O14A 1CAWA 4XFCA 5FFOC 4DRVA 5L7OA 2WA3A 1ULFA 1AXZA 3IDBB 1K5MA 3S6PA 1HX6A 2WSUA 3ILFA 5FLJA 2BVBA 3RQ0A 3MZHA 4LHKA 1D2QA 4LA2A 4NHMA 2W68A 3WHUA 3ZYPA 5FMOL 3CEWA 4U36A 4XQWA 4YG3A 4P9IA 3VZNA 3TB0A 5HI0A 3VGIA 3MIDA 5E8AA 1SQ4A 1NCQB 3KT7A 4P9XA 2LALA 3HWJA 2QJVA 2VY0A 1RHI3 2JEMA 3LA3A 3NV3A 4FTBA 1SCRA 4H3WA 2SLIA 1J3QA 1W6OB 3BIWE 4IERA 4FXKB 1AYN2 2NM1A 1MZEA 2P37A 4K3UA 1YXWA 3RSJA 1HQLA 4YFWA 5EYXA 2HEWF 2Y26A 2CTVA 4AI1A 1HRI1 1HQNA 4FPLA 1ZBE1 3MIBA 1XRUA 3SCGA 4OHXA 1F5FA 5D8AA 3WP6A 4YARA 3OGJA 1X33A 1F5JA 1H8VA 1GFF2 4NO4A 4RR3C 1DQ1A 2GC3A 2R49A 3J8F1 1C28A 2OUHA 4JCKA 1LKNA 1LB2A 4PLNA 2X8KA 4I0WB 5A33B 1GZWB 1MQTB 1XE7A 1XYOA 3H7YA 4Q4Y3 2B5HA 2YPJA 1Y3TA 4RHV3 3W59A 4XJUA 2CWSA 3ZMOA 4X6RB 1ENXA 2D5HA 2NPIA 1IZ3A 3IN9A 2R073 2ATFA 1DGWA 2WFPA 5CNAA 2R061 4W6XA 3B93A 4GULA 4XFIA 5LEKA 1ULEA 4FPGA 1CONA 3OPZA 2R1BA 5JDBA 3DGTA 4ITCA 4LO8A 5DZFA 4AQ6A 5AC93 2R043 5CADA 3WCSA 4GQ7A 3JBG2 1JYIA 3B5LB 1BQPA 2WA4A 1MZ6A 2GSYA 2GMPA 3VZMA 2VNGA 1G9CA 1BKZA 2YHJA 3DPRA 3E6CC 1NLRA 2EIGA 5HCAA 1DIWA 1KDKA 3CU7A 4K9SA 1WMEA 1WA4A 2ZGQA 1PVC3 5HBAA 2A71A 2KM2A 5T5PA 1Q5OA 4JGYB 3Q9OA 4JTNA 2JG9B 1WCDJ 1QMJA 1RUG3 2MHFA 3VBSB 3WLUA 2ETEA 2OA2A 4XJ8A 3ILRA 2XJTA 2IXJA 3R0RA 3S7IA 3P3PA 5K8SA 5ABJC 3QH7A 4I0AA 2WT1A 5GALA 1NCQA 3M3QA 3DKWA 5JOWA 2XVKA 2ZJCA 2WNUC 1W6OA 2WT2A 4B3NA 1PK6A 1AR63 5C9AB 3KS7A 4WVVA 3R4DB 3UJQA