3AJZA

Crystal structure of ancestral congerin con-anc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNANRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Ancestral congerin Con-anc
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ajzA00
2ZGMA 1LTEA 4R9AA 2ZGUA 4BMBA 1BJQA 3AX4A 4WV8A 2GN7A 3AP9A 1J1TA 4YW3A 3OYWA 4YM3A 1W6PA 4FOVA 2WQZC 4GWNA 4R9CA 1JOJA 1H30A 3LCPA 1ULDA 3I8TA 3VUOA 3RSJA 4TYSA 4BLJA 1DQ2A 3APBA 2DUQA 1W6OB 2WKKA 1F9KA 1HDKA 1DQ1A 3CNAA 5GLVA 2E7TA 4RL7A 5DUWA 1CR7A 2SBAA 1WW5A 5H9PA 1W6QB 4ASMB 1V6NA 1WD4A 3O12A 3KM5A 2ZACA 5F5QA 2D43A 2ZGRA 5E89A 1WLWA 5T5LA 5GZFA 3ZYRA 1N1SA 3O0WA 4XJ9A 3O0VA 4ITCA 5H9QA 1CJPA 1YI7A 1YXWA 1AJKA 3VKNA 3OYWB 2OUHA 5GZDA 5DXDA 4DRVA 2WT2A 1LHUA 1UKGA 2R1DA 3AZXA 4Q8LA 3A4UA 4P9WA 5F9TA 1I1EA 4ATEA 3SITA 4AGGA 3UJQA 3ZSLA 5T5OA 1V6IA 2B7YA 4P14A 1TEIA 4LBMA 3OGGA 1GZWB 2VW2A 2KM2A 3AP4A 3B3QE 1S1AA 3IM0A 2WSVA 3MEPA 4YM2A 1DQ4A 3PJQA 2P3JA 1N1VA 1S0BA 2WLQA 2JKBA 4YG0A 4UW4A 1ZA4A 1KDKA 4DQAA 4XJZA 2DVFA 4YGDA 3RG0A 3ZXEA 2CYFA 4FQ4A 3V0BB 1GBGA 1DBNA 2JJ6A 3PVEA 4DRRA 3SH5A 1DLLA 1Q8OA 1UZYA 1VAMA 3AP6A 2D6MA 2UWCA 2VH9A 2E6VA 1JYIA 1KRIA 1FX5A 4KBBA 2EALA 3ILNA 5HCFA 4M3CB 3FUQA 3O0XA 3ZXKA 1GNHA 3N7JA 3HMYA 4BM8A 1F5FA 2D6LX 3OBTA 1DGLA 5HCAA 1GYKA 3M3QA 1F31A 3WG1A 5JLVA 5DUUA 2W68A 4FPLA 1SBFA 1CPNA 4YGBA 1LESA 2GMPA 1FV3A 3O5SA 5T5JA 4YFWA 4GXLA 1DYPA 3AZWA 2G4IA 4FPEA 2WJSA 2ZGNA 1HKDA 1W6OA 4FOQA 1Z0HA 4LBJA 5IUQA 2GNBA 4LBLA 4XMIA 2ZGLA 5EYXA 2A3WA 3IKWA 4OZXA 1UAIA 1LOBA 2WT1A 4Y20B 2E53A 1JYCA 1OKQA 3N36A 1N1YA 2R16A 4K1YA 2VXRA 1MS8A 1W0OA 1BKZA 3N7MA 4BLIA 3AYCA 2VUAA 2ENRA 3VKFC 1SFYA 4W65A 3NV2A 3M1HA 2OW4A 1FAYA 2D3SA 5GALA 4UW5A 1LU1A 3ILFA 4FVVA 2YMZA 3BOPA 3A0NA 2AH2A 1G8WA 4GA9A 4BOWA 1V6JA 4R9DA 2EF6A 4HL0A 2ES3A 2R49A 2NMOA 3IMNA 4FPFA 1ULGA 1CN1A 2A3YA 1DQ5A 3FLRA 4Y26A 2R1BA 5FREA 3WHTA 1LOEA 4XJWA 3AFKA 1MVEA 1AXZA 1ULFA 1X50A 4FPCA 4GKXA 4XDQA 4Y1XA 3OBRA 4LBKA 4ZXKA 4XYXA 1DIWA 2CWMA 3USUA 1UMZA 3BIWE 1G9DA 3T1LA 1UN1A 4Y24A 3GALA 3WOGA 5IK5A 1VIWB 1V6OA 5JOZA 4YZ3A 5CBLA 1G9AA 3MPPG 3SISA 3WDVA 4ZKTB 5GLUA 3POWA 1NXD1 3B69A 1VLNA 1JN2P 1S0CA 2AENA 4LBOA 2UU8A 1LJ7A 4WVVA 2VY0A 2XG3A 1LGBA 1FYUA 1GICA 1AXKA 3INAA 4XBQA 4XE9A 4XILA 3VKLA 2DURA 4LBQB 2ERFA 4PBPA 3ZXFA 2AGSA 1R1ZA 1A8DA 5IK8A 4UW3A 4Y1YA 1GZWA 1S0FA 1Y7BA 3AYDA 3HR9A 3OY8B 3SH3A 1OQ1A 2GMMA 2ZGSA 4MYEA 4YZ4A 1MZ5A 2H0BA 3VV1A 3V0AB 1Q8VA 5DG2A 1LGNA 4YG6A 1GSLA 3T2TA 5JOXA 3WV6A 1N3QA 1C57A 1U0AA 1FNZA 4Q1RA 2ZAAA 2JE9A 1LHVA 3V0BA 1AX0A 4YW4A 3M3EA 4ATFA 4XIOA 4P9XA 4DPNA 2NYYA 2ZBJA 4XMAA 3TB0A 3RRDA 1JBCA 2DV9A 2EXHA 2ZZJA 4NO4A 4ISRA 1JW6A 1LGCA 4FPYA 4LBQA 1A78A 3ZYPA 2ZA9A 3N3HA 4Q8KA 1PZ9A 5IK4A 1SLIA 4AVVA 2LTNA 5H9SA 5CAZA 1QF3A 4XTMA 3UL2A 3ZPYA 3AJYA 1MS1A 2C9AA 2P3KA 2PHFA 3IN9A 4FPHA 1CESA 3AZVA 2A6VA 1AVBA 2A6ZA 1APNA 2W52A 1AX1A 2A6WA 1LECA 1ENSA 1SACA 1SCSA 2VW0A 1MVQA 3W59A 4NOTA 3AYAA 4XJ8A 4XZPA 4PCRA 1FNYA 1MZ6A 4XHXA 2EXJA 1G86A 2D44A 5DZEA 3JUUA 3TAYA 1O4ZA 1Q8PA 5KXBA 4GKYA 1W6MA 1G9CA 1OFSA 1CPMA 1YO8A 2DTYA 2ZGKA 1UL9A 3OPZA 4XJUA 1H9WA 2Q5TA 1I3HA 2JECA 2TEPA 1NLSA 5E88A 2DVBA 5H9RA 5IT6A 1XQNA 2PHTA 1CONA 3ZXLA 4Y1UA 2W39A 2ZMKA 1RIRA 4YFZA 1GKBA 1ULCA 4GWMA 4YW1A 3ZVXA 1JHNA 2DWRA 1S0IA 2A7AA 1W6PB 2YY1A 3MW4A 4JCKA 1N1TA 3B01A 5GLZA 4BQ1A 1LEMA 2D3RA 1G9FA 1SLTA 2UURA 1DYKA 3L2YA 4Z8BA 1YRZA 2GNMA 2A71A 2E7QA 3ILRA 4XXAA 1LOCA 4GALA 4Y1ZA 2DUOA 2BQPA 1GZCA 1B09A 4U2AA 3R4SA 3FFZA 1N47A 5DZGA 4XBLA 2R0FA 1H9PA 2AR6A 1V6MA 4UW6A 1S0DA 5T5PA 2W08A 1ENRA 5EXOA 3C2UA 1Q56A 2NMNA 4FPGA 5JMCA 2A6XA 1LOFA 4M01A 2R0HA 2AYHA 1QNWA 3JU9A 3WLUA 2D6PA 1LOGA 3OY8A 2CWSA 4YZ1A 1W6MB 5AVAA 1PZ8A 1UX6A 1YYNA 5JOYA 4YW5A 1AJOA 1W6NA 1JXNA 3I4IA 1JUIA 2P37A 2DVAA 1PZ7A 1W0PA 2EIGA 2D6OX 2ZGTA 3ASIA 1V6LA 1HQWA 1WLCA 3BTAA 3W58A 2A70A 5DUVA 5EWSA 3WDWA 1MACA 4XJAA 3WCSA 2NP0A 5HCBA 2PHUA 2V73A 2GDFA 3T1MA 3AZYA 2DYCA 1QKQA 3N35A 2RHPA 1KJLA 4WZFA 1SBDA 4AGRA 3SNMA 1WCSA 5GM0A 2ARBA 4PBOA 1HQLA 1VAVA 1BQPA 2ZGOA 1V00A 3VKOA 2DU1A 1QU0A 4TZDA 1GV9A 4Q27A 4YG3A 4C1WA 1IOAA 4DS0A 2JDZA 1IS3A 2OVUA 4XTPA 1MS4A 3Q9OA 1DZQA 1WW4A 2A75A 3M3OA 1C4RA 2DTWA 1QMJA 1Q8SA 5FRAA 3AP5A 3H0OA 4Y22A 3ZSKA 1C1LA 1MS3A 5DG1A 3WHUA 1A3KA 1YIFA 1D2SA 1N3PA 3DUIA 2Z42A 1DQ0A 3B00A 3WDTA 5KXCA 2C5DA 2P3IA 4JRAA 3AP7A 2E51A 2ZGPA 1O4YA 4YM1A 4Y1VA 2YXSA 2ZGQA 4DFSA 2ZABA 5CB7A 4AVTA 3FLTA 4K1ZA 1QNYA 2GNTA 2PHXA 3WG2A 3DGTA 3MW3A 2OUJA 3IPVA 4K21A 3WDXA 4AYUA 3POSA 2D7FA 4CRQA 5T55A 1ENQA 2CTVA 2ZHLA 3FBYA 1QDOA 4I30A 1S0JA 4YGCA 4D69A 3LSEA 1WLDA 3POYA 2JD4A 4AGVA 3PVNA 1EPWA 2A3XA 3D4KA 3NWKA 3D5OA 4FOWA 3V0AA 1AXYA 1CQ9A 2A6YA 2GNDA 4R9BA 2UWAA 3RMYA 3USUB 3ZXJA 3FLPA 4Y20A 5JDBA 2CL2A 2A5ZA 1IKPA 3RQ0A 4XXPA 5KXDA 2AUYA 2P34A 1MS0A 1V6KA 2XB6C 1Q8QA 3N7LA 5L73A 1LOFC 1S0EA 2VW1A 3GNEA 2DVGA 3WCRA 1GZ9A 4XIKA 3RS6A 4BPZA 1FV2A 2WT0A 2PELA 4XBNA 4M00A 3A0KA 1KITA 5T54A 3ZSJA 4FPJA 1FATA 2EXIA 1QOTA 1IS4A 2HYKA 1LODA 2WSUA 1GANA 1GNZA 1QOOA 3D6EA 5T50A 1WD3A 4K20A 3FUOA 1S0GA 2DUPA 2D6NA 4YW2A 3OJBA 1KQRA 2WNEA 3PVOA 4Y22B 4YM0A 2ZKNA 3ZSMA 2DU0A 4C1XA 2SLIA 1LENA 1LU2A 3AK0A 4JC1A 2EXKA 1DQ6A 1WW6A 2ZHKA 3NV4A 3WG4A 4AWDA 1IKQA 1SLCA 1Z78A 4HANA 2D3PA 4M3CE 2ZMLA 4LBQD 1LEDA 1SCRA 5GLTA 4FQZA 2UWBA 4RA0A 1RINA 1AF9A 3ATGA 3V64A 1HLCA 3KQRA 3M2MA 4FP2A 3UK9A 3WG3A 1WUVA 4CZSA 1MS9A 1KDMA 5T52A 2P2KA 2CY6A 3VKMA 3M3CA 4M3CA 4Q1PA 5GZGA 3WVJA 4P9YA 1ONAA 2JE7A 5DZFA 4YZ2A 1KJRA 3SLIA 2ZHNA 5SV8A 2GN3A 5KXEA 3AJZA 5JVVA 1RITA 4M3CF 4WVWA 4F83A 1QOSA 3WUCA 5GLWA 1AZDA 3AZZA 1GLHA 2ZMNA 1SLAA 1CVNA 4FOYA 5EYYA 4BMEA 1SLBA 1SBEA 3SH4A 1WBLA 3IPVB 4FPKA 1LHOA 1LULA 4LBNA 5GZEA 1BYHA 3HN1A 1IS6A 1MR5A 2V5YA 1LOAA 4PQ9A 1ZM1A 5BYNA 2GMEA 3BODA 4IQPA 3WNXA 1AX2A 2YV8A 5CA6A 5JOWA 1BZWA 1LHNA 1SLLA 4FP3A 3V65A 4CTEA 3NV3A 5CNAA 2VU9A 4XOGA 5E8AA 5GJ6A 4AVSA 1W6NB 3B9CA 1G9BA 2D6KA 1W6QA 1WW7A 1UZZA 4H55A 2I2SA 1QDCA 2NM1A 4YGEA 4XHBA 3ENRA 5IK7A 2YZ4A 3WUDA 1VALA 2PHRA 2PHWA 3N7KA 1LHWA 3R4UA 1MS5A 2EAKA 3LSDA 3NV1A 3RMXA 4YZ5A 4U36A 3QCWA 1WBFA 3MW2A 4ISQA 1G7YA 2ARXA 2AREA 2YROA 1QGLA 5DUXA 2NN8A 3PMEA 2GALA 1CIWA 3QLQA 1C1FA 3R05A 4L8QA 4Q2FA 3U4XA 2LALA 1BXHA 2FHRA 3WDUA 3AXEA 2NZ9A 1N3OA 4Q26A 2FMDA 4FPOB 1IS5A 2DVDA 5LK5A 1DFQA 3UJOA 3AXDA 1D0HA 4PF5A 1DHKB 2ZHMA 3WZ1A 1LCLA 1URXA 4SLIA 3AYEA 5GZCA 1UPSA 2CNAA 4YLZA 3WDYA 1ULEA
chains in the Genus database with same CATH superfamily
2ZGMA 4AL9A 2FDKA 4P02B 2UYAA 5FZ4A 3KF5A 2B39A 2JG9B 3AP9A 1J1TA 3GBWA 3LZZA 4JKMA 3LGRA 4YM3A 4FOVA 4GWNA 4CDQB 4BQ4A 1H30A 3H42B 1XPWA 3FMGA 3LCPA 1R081 2B5HA 4Q4W3 4BIOA 2VNRA 3RSJA 5A6YA 3T2QA 1Y9QA 4TYSA 2CDOA 4C0BA 1W6OB 2WKKA 1DQ1A 5GLVA 3DYPA 3HQRA 3TYJA 1PGL1 3WQ7A 5EQUA 4Q0QA 5C9AB 5H9PA 4RHV1 4ASMB 2G9ZA 1WD4A 4A44A 2P6HA 5JMOA 1Q3EA 2ZACA 3KM5A 3ACFA 3I97A 4P9JA 4UFJA 3RYRA 4RYDA 4LO5B 1WLWA 2PHLA 2GC2A 4KG8A 4AE2A 3ZYRA 1X7NA 2VMGA 2I74A 2WINB 3O0VA 4Q4X2 3W9AA 5F37A 5JSPA 3RWKX 5H9QA 4JGZC 1YXWA 4XPVA 1H2NA 4OFGA 1VBB2 3T2OA 4KGQA 5LBEA 3KCYA 4IEWA 5GZDA 5DXDA 3VKNA 1PO11 1UW8A 1UKGA 1Y4WA 3VZMA 3ZR5A 4DRVA 3MV01 4QM9A 5FZKA 3T0AA 3DL3A 5F39A 5IWFA 4ATEA 2HEVF 4GJYA 2C9KA 2P17A 5KHKA 1TEIA 2Z2SB 4MXWB 3VDBA 5LY1A 1IG0A 2KM2A 1ZZ6A 1S1AA 3T0DA 5LASA 2R7EB 4OZOA 4COUA 2UY9A 1HJGA 3SCHA 2IFWA 2P3JA 2WLQA 1S0BA 3ZFGA 2ZJCA 2FCTA 2RS12 4YG0A 1ZA4A 1OMIA 2Y0OA 1PVC2 1TME2 2RS33 3ZXEA 4DQAA 3T09A 5KHIA 5HCHA 3NW4A 1ND3B 4AVCA 5F3CA 2GC3A 2VZ3A 3V0BB 1HB1A 4GH4A 1GBGA 5A3OA 4JGZA 5FPVA 5HV0A 4QWNA 3OEBA 4BQYA 1DLLA 1AR82 2QDRA 4Y5SA 5FZ0A 4DUVA 1FMD3 1YNAA 2D6MA 2JDYA 2XMLA 3E97A 4RQPC 1VB2A 3ILNA 1PM4A 4IEOA 3VBRB 2WS91 4QU1A 4E4SA 2KA3A 3ZXKA 4AI1A 5FPXA 3CF6E 1Y9MA 3ZX7A 5FP7A 4BM8A 1PIV1 5ACA2 2Z5WA 4BH9A 1RUF1 1FPN2 5DUUA 4YGBA 4JQRA 5A7WB 2GMPA 3VD5A 2ZEWA 1PO12 5T5JA 2W87A 5DMYA 4GXLA 3EBRA 2WA3A 2GH2A 3ZPOA 2OIIA 1TMF1 4INDA 4K7JA 4QDSA 1OBNA 1I6XA 2QCSB 3M8LA 3PJYA 3J7LA 3MICA 4A3XA 1W6OA 4FOQA 4NPLA 1NE6A 3RDIA 3H8OA 2Q30A 1Z0HA 5IUQA 1ENXA 1W2AX 3IAPA 3ROUA 1QEXA 4J6GA 3VBOA 4JRLA 1DP0A 1YQCA 1ZRRA 3PMSA 4OZXA 4D7TA 5IHRA 2QBXA 5FZ7A 5JXHA 1BBT3 2XGXA 4K1YA 3I2DA 1W0OA 3BPSA 1IQAA 4ES9A 2CGPA 1VBA1 4XFIA 2P3YA 3BKZA 5LA0A 2JWPA 4W65A 3NV2A 2HWB2 5GALA 3DV8A 1HRI1 2DBNA 2VNVA 3N9QA 3WEZA 1X8MA 2Z4FA 1R64A 4QQHA 2R073 4XDPA 4FVVA 2ET1A 3A0NA 5FK7A 5FZGA 1FMD2 1G8WA 4BOWA 1V6JA 4R9DA 1Y3TA 2W1WA 3TBDA 2ES3A 2X09A 2R041 3HIFA 4N53A 1J1LA 5KWRA 5DAWA 1MVEA 2BWAA 1AXZA 3M3IA 4FPCA 1C28A 1POQA 1QH7A 2XHKA 5EIYB 1JYTA 4PHZA 1IQDC 5IVEA 4QPGA 1NA1A 4ZHNA 2VMDA 3VD4A 1AUYA 1DIWA 2QQVA 1G9DA 1NE4A 3TN92 2JG8B 4Y24A 4IUGA 3WOGA 2FDGA 4GJZA 4ZZ8A 4AQSA 2ILMA 4ARXA 4B7KA 4YZ3A 5K0UA 4XUTA 5FJHA 3GZTB 3WDVA 4LITA 4ZKTB 4MHUA 1RUI1 1U5YA 1YWKA 1VLNA 1S0CA 1W03A 2AENA 4LBOA 2BBVA 1QJFA 3IAQA 1AXKA 1NUKA 4QHZA 4XBQA 4XE9A 1RL3A 1D4M1 4XILA 2ERFA 4PBPA 1FOD3 1L3JA 3T4VA 4HN1A 4YVSB 1RXGA 2HBTA 1BEV2 4Y1YA 1BCXA 3AYDA 1Y7BA 1UWWA 3VDCA 1OQ1A 4EN9B 3GYDA 1O3TA 3WW1A 1MZ5A 2I45A 1RUH2 3J8F1 3LPFA 4Y3OA 2RR11 4E2QA 4YG6A 5ANQA 5JOXA 4YARA 5FXWA 3LOBA 1BHGA 1BK0A 1QY4A 4PJYA 1RUJ1 5LW9A 3TNQA 3LB9A 4NVPA 1POV3 1VR3A 4YW4A 3I54A 3DPRB 2ZBJA 2CSGA 2PTMA 2ZZJA 5ABJB 4ISRA 4CXYA 4YNIA 1ZA7A 1LGCA 3BU7A 4KBZA 4Q4W2 4AEDC 3J9SA 5J48A 2VOVA 2ZA9A 3N3HA 3P1IA 2X8KA 1VBC1 4JHTA 5JPNB 3ACHA 1RUD1 2EA7A 4COZA 4CXWA 1TG7A 2VVFA 5FYHA 4XTMA 3SCGA 2Y33A 3FJSA 4HK8A 5HBAA 4ET7A 5FY8A 2WS92 4CCJA 1ZBE1 4LKSA 3ZM8A 4HT1T 5APAA 3HVDA 3AVRA 4XCBA 1APNA 5BNNC 4BHPA 3RVHA 1DGRA 4O61A 2XJVA 3CQOA 4XJ8A 3O1TA 1E5RA 1MZ6A 1HRI3 1NZIA 1GOGA 3HAGA 4XHXA 5AVPA 4D6SA 4XZUG 4AW7A 2J22A 2RM21 2WC2A 1O91A 1YQ2A 4PLNA 1XU1A 4GKYA 5C9AA 1GFF2 1POV1 1CPMA 2EICA 2DTYA 5FUPA 3O1OA 4NJ4A 2RS31 3NRUA 4EQVA 3BVCA 4IL7A 1ST8A 2Q5TA 3VD7A 5KR7A 5LA1A 3GHNA 5FZBA 1QWRA 5K4LA 5A7PA 1PMHX 1OURA 4GMP1 4E8DA 2DVBA 5C8WA 1K5JA 2YG0A 4QKDA 3S0MA 3RZLA 1CONA 1FT9A 3ZSEA 3ZXLA 2W39A 3IIIA 4HBNA 3RZZA 4J25A 4GWMA 3ZVXA 3GGLA 4DOUA 2GAUA 4BYYA 1XYOA 2YBKA 1S0IA 3I59A 2DFCA 3P6BA 5GLZA 1N1TA 3B01A 1L7RA 5C3PA 2V4AA 3WQ0A 2WLPA 3OOXA 4UFMA 2JICA 2UURA 1DYKA 5JZGC 3M4FA 5C9AC 1RUH3 1H0BA 2R042 3H1YA 4Y1ZA 2ZX3A 2BQPA 4XQDA 3LE0A 3R4SA 4S2FA 1UYZA 5F32A 3WP6A 1CGPA 1HV1A 5IAVA 2HYXA 1IHMA 1US2A 1YQ8A 1YFWA 1S0DA 2QNKA 1ENRA 2Y6LA 5I8TA 3C2UA 4JGZB 4HPKA 5IW0A 3DPRA 1ODMA 3O1RA 2O8OA 4QXBA 2WZR1 1H4GA 1U12A 2AYHA 1RXFA 3JU9A 3C7GA 3UETA 3WLUA 1LOGA 2VL4A 2VNGA 2J42A 3DKQA 2BUKA 4IXLA 3NAPB 4QKFA 3OUHA 1PIV2 2XVLA 4FPYA 3DEMA 3ASIA 2EAAA 2DF7A 5K8SA 2A70A 2J1TA 3K51A 5EWSA 4EN0A 5JXGA 1MACA 1RUC3 1GP6A 3PU8A 4KL1A 4Q0PA 3ZKYA 2Q4SA 2XVGA 1W9SA 2W2IA 1PVC1 2FDJA 1HRV1 2GDFA 3AMMA 5LB6A 5FLJA 3T1MA 5F2WA 1QKQA 3F2ZA 4BB3A 4AI9A 1NOVA 4WZFA 1JYVA 3SNMA 1ASJ2 4KQ7A 4MADA 1UMHA 2OS2A 4LUMA 1TZOA 4PBOA 4AAPA 1ND3C 1LKNA 2XR4A 1EYBA 1OLMA 1OPMA 2JDPA 1REEA 2BFUL 1IPJA 3VKOA 5K0UB 1CAVB 4Q27A 3EJKA 4C1WA 1K5MA 1IOAA 1S4CA 3WF0A 2HWE1 3CJIA 1IS3A 2OVUA 5FZEA 4RQPB 5DAQA 4DXRA 3GJAA 1WW4A 4X8PA 1C4RA 5IVVA 5IFPA 1H2MA 1Q8SA 1QMJA 1QXPA 2XLGA 3LEIA 3AP5A 2R063 5J09A 1C1LA 5DG1A 1YIFA 3WNPA 1N3PA 2WWJA 3NSTA 1DQ0A 1ZZ8A 4GD4A 5KXCA 3WW4A 4A3ZA 4AVAA 2JG9A 4Y33A 4DINB 1MEC2 2ET7A 1Z7S2 1OVPA 1D7PM 3HEIA 4Y1VA 2ZGQA 4GB31 3ZDVA 4CA9A 2CAUA 2BYVE 5CB7A 3W21A 3K2OA 4AVTA 2WR9A 3NKGA 2D40A 4K1ZA 5FZLA 4H7MA 1AYN2 4QQ2A 3W20A 1NCRC 5FP8A 1KXGA 4MHRA 1GP4A 5T55A 2AACA 4CRQA 3JD73 4M0NA 4XUPA 3VZLA 1QDOA 4CU6A 5FXZA 3I2FA 5CADA 3O1UA 5ACA3 3POYA 5JSRA 5FZFA 5LBCA 2VCMA 3KD4A 4ZS2A 4QMAA 3V0AA 1CQ9A 4A45A 5B4XA 3I49A 4HXCA 4Y20A 4GQ7A 1AR71 1BVP1 1RVF1 3NNGA 2VOTA 1IKPA 2A5ZA 5IJRA 3RQ0A 3ZDSA 1M06G 1JUHA 3N7LA 1Q5OA 3P3NA 1PVXA 4EJRA 3THPA 1LOFC 1S0EA 1YI9A 2VW1A 3AMNA 3GNEA 2IVIB 1QJY1 2WYFA 3MLLA 3U4SA 4ZZ5A 1UY1A 1FV2A 4LEJA 4XBNA 3IDBB 5T54A 4XC9A 3SMHA 2BV4A 5F1RA 2FZ2A 2OYZA 1FATA 2C4XA 2HEYF 2RS13 2HYKA 1QOTA 2IXLA 2VOKA 5FYVA 1LODA 3D6EA 3A22A 1NY72 2ZXQA 3KQ4B 5T50A 2X05A 4YW2A 1RMU3 1S0GA 2D6NA 3K75B 3T0BA 4Z2AA 4NROA 3VD3A 3KT7A 3WSOA 3TOJA 2EXKA 3VBUC 3NV4A 1F2NA 3WG4A 1QJX2 1SLCA 1WWYA 1US3A 1C8NA 4BJ0A 1H6YA 1NLRA 1JS9A 3I2IA 3FWEA 1H4HA 5F3EA 4NPRA 1D4M2 4BZ4A 3J26N 3W5MA 1ZBA2 5FQ0A 3M2MA 2DFBA 5FZ9A 1WUVA 1RMU1 3Q8EA 1JZ3A 3CJIB 3IT8A 1KDMA 3HJRA 2Y6JA 2CY6A 2YGLA 3M3CA 3VKMA 5BNOC 4OI2A 4P9YA 4IE0A 1RTVA 4UYBA 5CISA 2VUCA 2RE9A 1KJRA 3CO2A 1W2UA 3JCIA 3AJZA 4GWIA 4A4AA 4NAMA 4F83A 3JB8A 4LIVA 4BK4A 4MGYE 4LOSA 1CVNA 4UFLA 3AKPA 3LPGA 4QHOA 5EYYA 2ZX0A 4BMEA 3MDPA 2GP5A 4N90A 3O1PA 4JQTA 3JBG3 4FPKA 5J3UA 1LULA 4L92A 4LBNA 5FR3A 4FCAA 2QQUA 1IS6A 1MR5A 2EVXA 5C71A 4JV4A 3CEWA 1PO23 5A3UA 5C8CC 1AX2A 2V09A 2VCBA 1LHNA 3MIFA 1RUG1 3V65A 1TQ5A 1H8TC 4UXAA 2IC1A 2VU9A 5FCCA 5FYYA 1ZZ7A 2VQAA 5BNOA 2HJIA 4A6SA 5FOJB 4AK3A 1G9BA 2ZX4A 1AYM3 1W6QA 1WW7A 1UZZA 4IV3A 5D8AA 3VBRA 4ARYA 3ZFEA 4GWJA 5C7GA 3K4AA 4B4QA 5FY7A 1XNBA 2PHRA 4TSVA 4D7YA 1LHWA 1V0AA 5G05L 2EAKA 3HD8B 5FK8A 1AR81 5FY4A 1OXCA 1XNKA 4ISQA 5A7WA 2ARXA 2VZVA 2RMU3 2FMYA 5DUXA 5BUVA 4CP9A 3USSA 4I3PA 4Q2FA 4L8QA 1DG6A 4JX0A 4UFHA 4O7XA 1UCXA 5CKMA 3T4HB 4CCDA 1BXHA 5DDJ1 5JCTA 3AXEA 2BNOA 5FMOS 2W5FA 2FMDA 1IS5A 1CAUA 3U14A 1DFQA 3UJOA 4HOOA 4URAA 1HW5A 1S2BA 3B9IA 3N9NA 4MH0E 4PF5A 5ANNA 4FTSA 4MXWA 1UQXA 3WZ1A 5F8PA 4SLIA 5D8AB 1UPSA 5BNPC 4K6BA 4R9AA 3WD5A 2YUEA 3A21A 5CU1A 5IVFA 1AR62 3MIEA 3H1WA 4NRMA 2XHNA 2J1RA 5CYYA 4LO7A 3CMGA 3GZUC 4IE4A 5A7QA 3POEA 4G4FA 3ZYJB 5FO8B 3APBA 2DUQA 5LRRA 1F9KA 1HDKA 5C70A 2RJ2A 1RHI2 3FL7A 5I91A 3C3VA 4RL7A 3ES1A 1NY71 1UXXX 2SBAA 1WW5A 3AFGA 3ELNA 4FFGA 4MZUA 2LW8A 2VZRA 3T3YA 2IZWA 3LA3A 1VBA3 1ND2B 3LA2A 1NCQA 4BA6A 2WNVA 2DCKA 2TBVA 4N43B 5LEJA 1N1SA 3O0WA 1X82A 2KR2A 2ZEZA 4XJ9A 4Z92B 4ITCA 4RSUA 5L36A 1CJPA 2QDNA 2ID4A 2D93A 2F17A 3D0SA 4GH4B 3OYWB 1VMFA 3A23A 3AL6A 4RGKA 2XXZA 5LY2A 4CCEA 5AC93 3LIHA 3A4UA 1H1IA 4DXTA 3NAPC 2E63A 3O1SA 2VTXJ 3EQEA 1RUC1 1EV12 5E16A 1V6IA 2B7YA 2K9ZA 2YC0A 4P14A 5E1RA 3UKTA 1REDA 2WO3A 4LBMA 3WW2A 1UMIA 2R32A 4K3UA 3B3QE 3DXTA 3RZKA 1EAH3 4YWAA 2PA7A 1AR61 1NA1C 2KXLA 2VE1A 2WSVA 3MEPA 4OVEA 1H1MA 1DQ4A 2YU2A 5A3NA 2WNVB 2JKBA 1J3QA 3VDAA 5LA9A 2O8QA 4CEYC 2D97A 1RYYA 5K0UC 3AC0A 2VM9A 2BRTA 1DBNA 3JQXA 3PVEA 2JD9A 1Q8OA 5F6KA 4LORA 1VAMA 3GCWA 3WNMA 1GQGA 2UWCA 1OUXA 2VH9A 5CFDB 1XRUA 1FX5A 3PUAA 5AFEA 5HCFA 2HBUA 3VBFB 3HN3A 3O0XA 2HWD1 1QXRA 1RUG3 3HMYA 2B46X 1QJY3 1F5FA 2PQSA 4ONUA 5HCAA 5FP9A 3M3QA 1UNBA 5A80A 2VC9A 4G3YC 4UWDA 1W8WA 1A34A 1LESA 1WGPA 3IZOA 1FV3A 4D3WA 1H2LA 3KGLA 4MGTA 1NXMA 1TNFA 4FT8A 2GP3A 4RS5C 5FZDA 3ETPA 1AL0G 3KCXA 1HB2A 2ZGNA 2BNMA 2RMU1 2QZ3A 3UT0A 5FY1A 2EIDA 1RUD3 1JMUB 3D8CA 5B2GB 2H0VA 2IXKA 5C3RA 2C0ZA 4F3JA 4XMIA 5ISLA 2ZGLA 5EYXA 2A3WA 3IKWA 4P5HA 3SQOA 5FMBA 3KVAA 3O14A 3ZYBA 1MZEA 2MNGA 5FYZA 1OKQA 1XNDA 2VOXA 1N1YA 4UOJA 4DXZA 1MS8A 2BBAA 3BU0A 5D1IA 1C5IA 4PI2A 5SV5A 4BXSV 4DUXA 2VUAA 3CBNA 3CJXA 5EHDA 1VRH1 2WAAA 3NO8A 2OW4A 1FAYA 2D3SA 4RGAA 3ZMNA 4KI5M 2ZAHA 4IEVA 3ILFA 4LXLA 1ULPA 5JR7B 2AH2A 3VBSC 4KWLA 2FQPA 4FPFA 2YBPA 4HK9A 1CN1A 2A3YA 1DQ5A 5A3PA 4DEVA 4KWJA 1GWMA 2VMEA 3KT4A 1ULFA 1FOD1 1X50A 4Y1XA 1PK6A 2WFF1 2JEMA 3OBRA 4HVRA 3J7MA 4IDZA 3VBUB 4LBKA 4OHXA 4ZXKA 2QQKA 4XYXA 1DGWX 1OOPA 1UMZA 1UN1A 3GALA 3VHPA 1MQTA 5IK5A 2ADDA 1VIWB 5A3LA 1TVGA 1OQEA 1W2NA 4IEQA 1HRV3 2GSYA 1HB3A 1U5XA 3ABZA 3IBMA 3THDA 5L7OA 5A33B 3ZYHA 1FI2A 2VY0A 3PTYA 5EZWA 2YBSA 4CP1A 3CJIC 3ALQA 5LA2A 4URTA 2AGSA 1SDDB 1JU4A 1A8DA 2BOJA 4PQQA 5IK8A 1F8VA 5FZ8A 5BNOB 3IDAA 1GZWA 1S0FA 2PLV1 4ZU4A 2BDRA 1XYNA 2ZGSA 4MYEA 2H0BA 2BGPA 3K3NA 5KC6A 1Q8VA 3O7OA 3ZXDA 1GSLA 1OA4A 1PNFA 2HWD3 2RDRA 3WV6A 3DYMA 3ECQA 1FNZA 1U0AA 1VMHA 3LA7A 3LDRA 4Q1RA 1W8FA 1CAXA 5IYYA 4OHWA 4LT5A 1UIJA 4CDUA 3HNYM 5BY5A 1OLQA 4GULA 4ATFA 4P9XA 3TB0A 1YQ5A 3M7AA 2DV9A 2JXAA 1RUE2 4LIUA 4NO4A 3MO4A 4BQ2A 1XE7A 2XJUA 3EHKA 4GAZA 1HJFA 4MX3A 3UGFA 1EPZA 2G9FA 4N53C 4QQLA 1PZ9A 1AYM1 5IK4A 1SLIA 4AVVA 5ERLA 5JPMB 5FZOA 3UESA 5JXJA 5CAZA 5FPUA 4QPIA 1X9PA 2JX9A 3UL2A 4XFBA 5LRSA 3AJYA 1AYN3 3G7DA 4QDQA 1UU6A 2X10A 4QX1A 3I3DA 2PFWA 2P3KA 3D0JA 2PHFA 3IN9A 4FPHA 4N8MA 4V2WA 3AM2A 4CP2A 1B35B 2VR4A 3AZVA 2BP6A 3UNPA 2PN5A 2VXJA 1PX3A 3CU7A 4CDQA 4CDXB 4RGGA 1SCSA 2CDPA 2IXCA 4ZXEA 3W59A 4XZPA 1WCKA 1FNYA 2E31A 2G9GA 4GMP0 5LK7B 4KU8A 4OMCA 1EP0A 1K5MB 2X53S 3SKVA 3THCA 4L99A 1JYWA 1FPN3 2V72A 1W6MA 2EIEA 3ACIA 3TN91 3KWVA 2RDNA 4LHLA 1NX9A 5CKQA 1CAWA 1H9WA 1KS5A 1R1A1 2TEPA 3ZXAC 4XQ4A 1NLSA 5K7PA 2XUEA 2FD8A 2QQPA 5BNPB 5DPNA 1ASJ3 5KBFA 1XQNA 2GU9A 2PHTA 2XBO1 3MF9A 5LATA 4Y1UA 2ZMKA 5HXVA 1JHJA 2Q1MA 2F4PA 1GKBA 1ULCA 3MZHA 3J4UH 1JHNA 1RUC2 3S5QA 3MUY1 1AYM2 1XNAA 5JZGA 1NCRA 1PIV3 5C5UA 1DDLA 1SLTA 4R8HA 3GBGA 1UOGA 1JZ4A 2BOIA 2JDAA 2B9VA 2GNMA 1OD3A 4D0QA 1NKGA 2E7QA 2VTFA 4XXAA 5FZAA 4AEJA 2DUOA 4OI1A 5DABA 3BTYA 4TTGA 1N47A 5DZGA 3ZN6A 4C8DA 1ND2C 3JXSA 4XBLA 4B29A 4ZU5A 4N43C 5IFTA 5C4WB 4AHWA 1V70A 1AR91 5EXOA 1QJEA 1GMMA 4WVMA 4FPGA 4GH4C 3VZJA 3ZKUA 1LOFA 1ZX5A 2R0HA 2JE8A 4P00B 4AEDA 1QNWA 5L7OC 2HWF3 1RUOA 4RQPA 1VRH3 3E6DA 5L19A 4YZ1A 5JOYA 5A7SA 3RGBA 5A6QA 1AJOA 1W6NA 3I4IA 2ZGTA 2DVAA 1PZ7A 1Y9GA 2FZ1A 4IEZA 4XFHA 1V6LA 1WMFA 3BTAA 5FLIA 1SEFA 3WCSA 2Q1FA 5BV6A 2ZX1A 4ES8A 3ON7A 1L7LA 4X8NA 4AOCA 4Q0VA 3BB6A 1F5JA 2WL1A 2D98A 3FHAA 2WNVC 4NIAA 3VD9A 5FXVA 3WF3A 4CUGA 4CEYB 1HV0A 3POJA 5EFUA 1O6UA 4AHZA 2WNUB 4CDWA 2ARBA 3I3QA 1BQPA 3KV6A 1V00A 1TME1 1UF2C 4J1XA 3THTA 3NJZA 5C3QA 4ZPIA 3OCPA 4DS0A 2VZ1A 3IDEA 3K77A 5CFDC 2XJQA 5FZIA 4XTPA 1DZQA 2A75A 2DTWA 4OUSA 3VBFC 4Y22A 3ZYIB 5FPAA 3WHUA 5BPXA 4M0HA 2ZKLA 3LEKA 4P9IA 3WNKA 2QZ2A 2I07B 1ODNA 2JG8A 1QIQA 2C5DA 1OOPC 1UY4A 3CZUA 1ZRIA 4XUQA 3WQ1A 4DEQA 3AP7A 2ZS6B 2XVKA 3VDDA 1O8PA 4DFSA 2ZABA 1QNYA 4X6QB 3BN6A 3WDXA 3DGTA 1RUG2 3PUQA 2D7FA 3PDQA 3Q8AA 3DXUA 2ZHLA 3C8XA 4QX0A 1H8VA 4KGGA 3U78A 2QVSB 2RS51 3BGAA 4IGOA 1PK6B 4CCCA 3BOWA 3D4KA 1JTZX 4AVBA 4FOWA 1AXYA 2LS6A 2UWAA 3JD72 2QQJA 4LLFA 3FLPA 5FV3A 2PHDA 1WMEA 1IGOA 2J1EA 2QJVA 4RFT0 1AHSA 1GWLA 2WAOA 5IVBA 5J1XA 5KXDA 2YDEA 1YLLA 2R071 5L73A 1R082 1Z7S3 2BPA2 1EAH2 4AXOA 2PELA 4M00A 3A0KA 1KITA 4FPJA 2XLFA 1OD5A 4Q0SA 4UFIA 1SDWA 3GZEA 1IS4A 4YVWB 4OQ9A 4AG4A 4CYDA 1GANA 4QPYA 4OCTA 1BLZA 2DUPA 1WA4A 3OJBA 3QH7A 1UIKA 1JZ8A 2XLAA 5FLHA 1JZ5A 1E57A 3AK0A 2ZZQA 1JZ6A 1RUE3 3MHZA 4BU2A 1BMV1 1W9WA 2XWJB 5FZ6A 1Z78A 1XC6A 2QQWA 4NWWA 3N9MA 1S2KA 4FQZA 4AEKA 4Z82A 1AF9A 3PIGA 3RI9A 1REFA 2DCYA 1VBA2 4HKLA 3E1F1 1PGW1 3KQRA 4YW7A 4WM8B 3TRSB 2QUOA 4IV1B 1CZSA 4CZSA 2E9QA 4CEWA 2Y26A 3OPTA 3HT2A 4GB33 5LWBA 4Q1PA 3RYPA 5GZGA 2ZTNA 3EYPA 4QX2A 1ONAA 3WVJA 5DZFA 3T08A 4YZ2A 1ZVFA 1ZZCA 1CZVA 4NHLA 5JVVA 4AAXA 2JB8A 2R072 3OGRA 5FZMA 4WVWA 1JI6A 2LRPA 5LCWL 2WRAA 3AZZA 2ZMNA 3VHOA 3RZHA 4FOYA 1CIYA 1KFXL 2ZOEB 5FY5A 1SBEA 4C0HA 3SH4A 4PLMA 1K12A 1BBT2 1QJU2 3BYWA 4CCOA 1GQPA 4A2UA 2VQUA 3JQWA 2XJTA 1LOAA 2IXHA 1ZM1A 4W6WA 2VQ0A 2GMEA 3BODA 4AEDB 5FAXA 3WNXA 2YV8A 4N53B 5CA6A 2WABA 5JOWA 1SLLA 5CNAA 1UX7A 4XOGA 5E8AA 1R083 4Q4W1 1W6NB 2TNFA 3VBFA 4F7ZA 4YGEA 1QDCA 4QHBA 4XHBA 1NCQC 3ENRA 2YZ4A 2BFUS 1AL23 1PO13 3N7KA 5C3SA 2J1VA 1MS5A 4DO0A 4U36A 5BNNB 1VMJA 3VN4A 2VMFA 4OUMA 3UKNA 1GQHA 2YROA 1QGLA 2XONA 4N7IA 4HZFA 2GALA 1C1FA 2IVJA 3P3PA 2RVAA 1K5MC 2OQ7A 1VBB1 1E5HA 1O7FA 2BWCA 2NZ9A 3NNLA 5KHJA 4FPOB 4YVSA 3LEGA 2O0OA 3WF4A 5LK5A 4EROA 4CUCA 5LBBA 3AXDA 3X29B 3MFCA 2ZPXA 2NQYA 5GZCA 1O4TA 1URXA 3AYEA 1HRI2 2X5IB 4MGQA 4YM0A 3WDYA 2VZTA 1ULEA 2B42B 4BMBA 4UT5A 4OYUA 1BJQA 4E8CA 5K9YA 1TE1B 3AX4A 4WV8A 4O65A 2GN7A 4XVHA 2Q8OA 5A33A 4YW3A 5AFBA 3WF2A 4W6XA 4LULA 5JSOA 3OYWA 5FO9B 1W06A 1W6PA 4R9CA 4QDRA 3DECA 2OXBA 3I8TA 4I09A 5FZCA 3VUOA 1R092 5FWEA 4QX8A 4BLJA 1DQ2A 1C3HA 2J1SA 5FYMA 1K45A 4LA2A 2P1BA 3DCQA 4QXHA 1UYXA 5DAXA 4V1PA 5DUWA 4BIFA 1CR7A 2DBIA 2MPFA 3HBKA 3MFAA 1V6NA 1OH3A 2ARCA 3O12A 1VBB3 3LFMA 3OBZA 4IEXA 4RD7A 5EJ3A 5F5QA 2D43A 1SPPB 5E89A 4EWDA 1OFNA 2WO2A 4Q4X3 5T3NA 5A70A 2CGOA 1RUI2 3MBWA 1O3SA 3BTXA 2K0GA 1EUUA 4LKFA 3C7HA 3KV5A 4LJHA 2VD7A 4HKWA 5I0TA 1KD7A 2D5HA 1UY3A 2OA2A 2WT2A 1LHUA 3GCXA 2R1DA 4Q8LA 2CHHA 5L7OB 5F5CA 3K4ZA 4D7SA 4AGGA 4MG2A 2OX0A 5I8YA 1IPKA 2CV6A 5T5OA 4DXSA 3TEWA 1W99A 2AEYA 3OGGA 1UOJA 1GZWB 1VE0A 1DU3D 2VW2A 5FUNA 4LHSA 2OZJA 2W0XA 5FYUA 1UPIA 4QU2A 4B4RA 3WP5A 3VBUA 5I8SA 3NJYA 1DCSA 4YM2A 3ZMOA 3WT3A 3J8F3 3PJQA 1CZTA 3TEZA 4IE5A 1HX6A 2WO1A 4UW4A 2Y6HA 1JZ7A 4YGDA 2DVFA 2WNUC 3C7EA 4B1LA 2CYFA 3GJBA 5ACA1 2NPIA 3TN93 3OG2A 4JDNA 4DRRA 3CLPA 1JH5A 3NNMA 3BCWA 4E9KA 1ACCA 4HG6B 3M70A 3PTRB 4BK5A 3VHNA 1JYIA 1KRIA 1DYOA 4YSFA 1YJLA 2VVEA 3U10A 4DIQA 4FXGB 4M3CB 5L9VA 3U11A 1GNHA 1S2EA 3POBA 4XAAA 1MZFA 4Z07A 4LK6A 5FZOB 2D6LX 5C5TA 3KZ4C 5J37A 2FBEA 1OOPB 5G04L 1DZTA 3WG1A 2Y8KA 5JLVA 3VHRA 1CPNA 4OLLA 3W5NA 4OHYA 4I0WB 4NN0A 4YFWA 2G1MA 2RM22 1OLRA 1DYPA 3AZWA 2XBO3 5FYIA 1NCRB 4W4ZA 4RS5A 4AQTA 3OPWA 1HKDA 2E7AA 1KFUL 1O5LA 2QQOA 2TUNA 3NL1A 4LBLA 2VMCA 5FIXA 2AZ5A 4HONA 1O8SA 1UAIA 1LOBA 2WT1A 3POFA 2ARAA 4XQWA 1RUJ3 2E26A 1LR5A 3ZFFC 2IWGB 2YGMA 2VXRA 1RHI1 4JTNA 4NRQA 4UF0A 3OBAA 1PM7A 1XBFA 2CGNA 2Y6KA 3ZFGB 3O1VA 4QQOA 1ZRCA 4NWVA 3KVBA 4A7YA 4B7EA 3VKFC 1SFYA 5B4NA 1WCDJ 4N9IA 3M1HA 3RI8A 5C33A 1PMIA 3NNFA 2XPJA 4EE2A 5JIUA 4UW5A 1YUDA 3POGA 5F7UA 4NIDA 4LHKA 2Y6GA 2BZDA 2IXIA 4JGYB 3FHQA 4AQ2A 5A7OA 2YMZA 3BOPA 4QX7A 3RNSA 2VCAA 4JDMA 5HPOA 4YVWC 2EF6A 2GZWA 4HL0A 3TEYA 1EUTA 2R49A 2WZR3 3IMNA 1QQP3 3J7NA 3FLRA 4LKDA 4QKNA 2R1BA 4H7LA 4Y26A 5FREA 3GHMA 4BISA 3AFKA 4OI4A 5FZ1A 1SHWB 4S2GA 4XDQA 1UOBA 1VRBA 1YFYA 3VGIA 5JI9A 1UZWA 5FBJA 4FO9A 2RDQA 4MGZE 3USUA 5JI7A 4MOAA 3U0ZA 1ZRFA 3BIWE 2BVBA 2HWD2 2XJSA 4PDWA 3T1LA 2R6QA 2O14A 1WZXA 1QJU1 4EYUA 5IATA 1O5UA 4A6OA 5BNPA 3ZN6B 4CXXA 2VUJA 5A6XA 5JOZA 1FMD1 1PVC3 4WM7A 1G9AA 3WP4A 3SISA 4LK7A 1T2XA 3E6CC 3I7DA 4TN7A 4XDOA 4XFCA 3IDCB 3POWA 5GLUA 3B69A 3J7HA 1X9TA 3MV11 4Q0UA 2UU8A 4WZCA 2DDUA 4WVVA 2XG3A 2XKPA 4IV1C 1GICA 4NAOA 1H1AA 1DGRN 3K48A 5JIAA 4AFCA 2OPWA 1D2QA 1Y43B 3OD0A 4UW3A 4YW6A 1HB4A 3IIAA 5FPLA 1PO21 3SH3A 3ZYGA 4AF9A 1HRV2 2F6BA 4NUBA 3MLKA 4XF0A 4YZ4A 3V0AB 3KT1A 4LTAA 4CCMA 1NYWA 5DG2A 4NIHA 2UYBA 1V9U1 1ZBA3 2HLEA 5FYTA 4Q5OA 4CUBA 4XW3A 3OGSA 3FFQA 1GOHA 1LHVA 3Q8BA 5C4WA 1AX0A 4CVUA 4XIOA 4XFAA 2MHFA 3T30A 4XMAA 4L11A 1JBCA 5IVYA 2H6CA 4D94A 2WFF3 1POV0 2DCTA 3PHMA 4EV0A 1EY2A 1WLTA 3OB8A 4QM8A 5C8CB 3ZYPA 5FY0A 4Q8KA 3VBHB 2BEOA 1H8TB 4Y5TA 1RMU2 3ITQA 2LTNA 3PU3A 3AKRA 2Q8DA 1T6BX 1UZVA 4KU7A 1QF3A 4QPGB 3HNBM 3ZPYA 3MLJA 3OSDA 4E2SA 2ETEA 1NT0A 3K4DA 1MS1A 1UU4A 4CU8A 1NCQB 1XYPA 4UBHA 4IV3B 4NHXA 4HSJA 3ST7A 1W8NA 3FUQA 4KH9A 4NIIA 2PAKA 1AX1A 2A6WA 1LECA 4LKEA 4ORFA 4Y4RA 4YRDA 1MVQA 2L9LA 3AYAA 3PVBB 4H2AA 4NOTA 4TXWA 4MSVA 1PX4A 2VO5A 4Q4Y1 4DY3A 4BCUA 3U1XA 4XFFA 5F6LB 2D44A 3I2OA 3JUUA 4LOTA 4CP9B 4FAHA 1O4ZA 1Q8PA 2QTWB 2ZX2A 5CEHA 2VZOA 2WZEA 2P4EA 4RR3A 5IVCA 1MPXA 5KXBA 4FFIA 4NMIA 4FI9A 1J3PA 1YO8A 2VZSA 4LR4A 1LB2A 2RJLA 5AC91 3OPZA 5FDBA 1CAUB 4TLFA 5CZKA 1CD3G 2MEV1 4JZRA 1JYNA 3KHCA 1Q43A 4H3WA 1X36A 4E4DX 4NHMA 4V2VA 4LO4B 5CFCB 4W8JA 5E88A 4W50A 3S7IA 5H9RA 3S30A 5IT6A 2WN3A 2ORXA 3WW3A 2FCUA 3ACLA 1RIRA 5FO7B 4QKBA 3SHRA 4YFZA 3MF6A 3ZN4A 3B7MA 4YW1A 2RS52 3NNJA 5FWJA 2YY1A 3MW4A 4JCKA 4JTOA 4MV2A 1VBC2 4BQ1A 4EWAA 4N9HA 1F35A 1LEMA 2BJSA 2WBKA 3WX5A 5I0RA 4YVWA 5CG9A 1YRZA 4I01A 1OKOA 3KB5A 2A71A 3ILRA 4GALA 1GZCA 1B09A 3I2JA 4U2AA 1STMA 2OZ6A 3SEPA 3FFZA 2IUWA 2VULA 3S5AA 4D6RA 4TWTA 4HETA 3UKVA 1H9PA 2FDHA 5F2SA 1V6MA 1V9U3 1ZBA1 5T5PA 2WWUA 2R30A 1Q56A 2NMNA 3F95A 5FMCA 3VL9A 5JMCA 1UOFA 2CU5A 4QGNA 2YC4A 2PXJA 4GB32 4XAEA 2VUDA 3IWZA 3BIEA 5DN2A 2D6PA 1NZCA 4DZGA 3OY8A 4AHYA 1PZ8A 1YYNA 5L9RA 1W9TA 4YW5A 1JXNA 2V4VA 1JUIA 2P37A 3KSCA 3PNAA 1RUF2 1W0PA 5FKCA 3OTFA 5FZ3A 5DUVA 3DF0A 3WDWA 4I2OA 2OT7A 4XJAA 4RN5A 3Q8CA 5FY9A 3I2HA 5HCBA 2PHUA 5FYCA 2NP0A 3AB0A 4NHKA 4AEMA 3AZYA 4H14A 3HPNA 2WZR2 2RHPA 1FXZA 1SBDA 5FPZA 3VDDB 1R1A2 4AGRA 4AFAA 2EIBA 2UY8A 2VVDA 3G6JB 3BTZA 1BMV2 2ZGOA 3CKHA 3LDBA 3Q8FA 1QU0A 2XJPA 3AL5A 1GV9A 1OF4A 4YG3A 2PMWB 4D6QA 4TZDA 1NLQA 3I3EA 4LE3A 3U37A 3ME2A 3ES4A 1TMF3 4M4PA 1UYYA 2IFRA 4S2DA 3RZGA 3LOIA 3LWCA 5FRAA 1YCIA 3VBRC 4FTEA 1F4HA 4IEYA 1A3KA 4K40A 3DUIA 4PIZA 3B00A 3WDTA 1ZREA 5FFOC 1BBT1 1COV1 3UV9A 2P3IA 1XU2A 1LRHA 2E51A 2VQTA 1O4YA 2XOMA 4CE8A 1W8ZA 2YXSA 1UXZA 2RM23 2C24A 3MW3A 2OUJA 3IPVA 3E5UA 4K21A 4JKKA 4AYUA 3LFIA 1ENQA 4AI2A 2CTVA 1UKRA 4I30A 2JKXA 2C6SA 1S0JA 4A7KA 4D69A 1GOFA 1ZZBA 3LSEA 3N9LA 2JD4A 4AGVA 2RMU2 3PVNA 1EPWA 3KLSA 1G6NA 2VZQA 4R9BA 2A6YA 1W0NA 3USUB 1SQ4A 3VBHA 4NIGA 1YQ6A 3VBOB 3ZFFB 5EJZB 1VP6A 1XSQA 2DCZA 3JBG1 3ZN5A 4XXPA 1TME3 2AUYA 2B9UA 1MS0A 1V6KA 2P34A 2RS32 2MEV2 5A3WA 5C3OA 1Q8QA 1UYPA 1IZ3A 1RC6A 2ZCWA 1JZ2A 3WCRA 1GZ9A 4XIKA 3RS6A 2QFEA 1QHDA 1VBE1 2J1AA 2WS93 3E5QA 4HVOA 1PO22 4IGQA 4QX5A 2EXIA 4AI0A 4CEWB 3PLQA 1OC1A 1GNZA 2WSUA 1XJAA 4EZ4A 5EPAA 4K20A 2BGOA 2WQ4A 1NQJA 1KQRA 2WNEA 3PVOA 2ZKNA 3ZSMA 2WZ8A 5FTTC 3URFA 4MGSA 2VBDA 5KC5A 1LENA 3HQXA 5F5IA 1LU2A 3QACA 5JR2A 4MLOA 1IG3A 2JDHA 1W2TA 1IKQA 1ZRDA 2JG8C 3S6PA 2D3PA 4PI0A 1UO9A 4M3CE 4UAPA 4CDUB 3ZIXA 1JU3A 5IVJA 3E6BA 1QH6A 1LEDA 1SCRA 5GLTA 5BNNA 4RA0A 3MIBA 3SXWA 3ATGA 3BI3A 2Q1ZB 3V64A 4AFBA 1HLCA 1NAEA 3PUSA 5A3MA 1VPHA 2FDFA 1XNCA 3QOPA 4GZ9A 3UK9A 3MPBA 1MS9A 1VRH2 5LBFA 1EV11 5E6HA 1RUI3 3RJ2X 5T52A 2P2KA 2PQQA 5FUIA 5A32B 3EB7A 3VLBB 4M3CA 4LPLA 4YVSC 4EN6B 3U07A 4P9GA 1BEV3 1SFNA 1VBE3 1XNTA 1ZBE2 2JE7A 4QB1A 5DAPA 5HI0A 1W9YA 5FMOL 4AI3A 3PL0A 3PURA 4MGIE 2GN3A 4CUAA 2J1UA 3AKQA 2QQNA 3N9OA 4Q4X1 4QXKA 1RITA 4IEUA 4M3CF 2PYTA 4EWEA 5D2AA 1CAXB 2E32A 3GZAA 2FCVA 3WUCA 4OHZA 1QJX3 1GLHA 3LD8A 1SLAA 1R093 1JOPA 2HKXA 1XE0A 2DCJA 4BXFA 3FHIB 3NMBA 4L97A 1WBLA 3IPVB 3AMQA 4FTBA 1BYHA 1CX4A 3FX3A 3HN1A 3BUCA 5FJKA 3VBSB 3FBMA 5BYNA 1GWKA 1PGL2 2MEV3 4IQPA 3KF3A 1S55A 3LAGA 4PIYA 1H6XA 4DNYA 1BZWA 4CTEA 3POIA 2Y38A 3GDBA 1JYXA 3NV3A 4Q4V1 4DMIA 5GJ6A 3B9CA 1DF0A 3B93A 2RS11 5DDJ2 3D3AA 4F8AA 4K8RB 4H55A 2NM1A 3SCFA 1W8UA 1B35A 5IK7A 3WUDA 5I0DA 1MQTC 1UD1A 2PHWA 1GUIA 4LO8A 1F4AA 4YZ5A 1YEWA 2H6BA 3NV1A 4YPJA 1X8EA 1K42A 4RHV3 4HPKB 4Y4YA 2RR13 4ZONA 2LROA 2AREA 4R4ZA 2NN8A 4O9EA 4CCKA 3PMEA 1CIWA 4QAWA 3KMHA 3ETQA 1EAH1 5FMDA 1N3OA 4Q26A 4QQPA 3ZLIA 1SFPA 4CPBA 4LA3A 3CHXA 1D0HA 4ZS3A 1DHKB 4FFFA 4SBVA 2WQ8A 3OUJA 5A3TA 1LCLA 4OHVA 2YHJA 1XXNA 4YLZA 3HNMA 3K46A 1TMF2 3MGUA 1LTEA 4W6YA 2ZGUA 4E4ZA 1RGSA 2WNUA 5GKAC 3ZR6A 2PAEA 2R062 4AR2A 3MYXA 4FBFA 5BXXA 3K3OA 4NHYA 2WQZC 3ORJA 1JOJA 3R6SA 1P8JA 3HWJA 3WY6A 1ULDA 2Q0AA 1UZ0A 2FDIA 1COV3 4I02A 2RJKA 2A73B 2YU1A 3V56A 1QXJA 1OLME 3CNAA 4IGPA 4P9LA 4QX3A 4E27A 2E7TA 5JZGB 4HVQA 1F15A 1WA6X 3L9JT 1W6QB 5LEKA 2YFZA 2VCCA 4XF3A 2VAUA 2ZGRA 3MIDA 3WINE 2HH9A 3O1MA 5T5LA 5GZFA 3WR0A 5C4WC 5EJ1B 4WVMB 4XUNA 4FAGA 3H50A 4HN0A 1OI6A 5LZ6A 1YI7A 4HMZA 1AJKA 3VB9A 5A1AA 3EO6A 4XEZA 2OUHA 1OT5A 4EN7B 3H8RA 4AI8A 3AZXA 4L2NA 4XACA 4XF9A 2PLV2 4P9WA 4WBBA 4B4PA 4BWOA 5F9TA 1I1EA 4FSJA 2W47A 1OA3A 2HEWF 2C1FA 3SITA 3UJQA 2O1QA 3ZSLA 4IE7A 2VZUA 2VOWA 2W46A 4IE6A 2ZEYA 2RDSA 3AP4A 3OF1A 3IM0A 3NVCA 4AHXA 4ASKA 3KGZA 1N1VA 3CIHA 1D0GA 1YJKA 4MVTA 3VDDC 5KHGA 3TEXA 1KDKA 4XJZA 3NJXA 3RG0A 1QJZA 2RS53 2RG4A 4FQ4A 2C26A 3ACGA 2JJ6A 2ATFA 3H9AA 3SH5A 4I3GA 1UZYA 5L9BA 3AP6A 4UBGA 4BE3A 4LLOA 1HQNA 2E6VA 2WIIB 4CPBD 4KBBA 5I0SA 4HSLA 4QPIC 2EALA 1K3IA 4XF1A 5FYBA 1ZYBA 2WN2A 2OQ6A 1UY0A 3N7JA 3MUZ1 5D21A 3OBTA 4PT6A 1H2KA 1DGLA 1U5IA 1WKYA 1GYKA 4N43A 1F31A 4RHV2 1XE8A 4K8FA 2W68A 2E33A 1KEXA 3C7FA 1SBFA 3AMPA 4FPLA 1J84A 4A7ZA 2JDUA 3ZFEC 5CVRA 3O5SA 4CP0A 2ORZA 4E4HA 4JGYA 3QH6A 1ND3A 2KD7A 2VNOA 2G4IA 5CIRA 3VZNA 5JXIA 4FPEA 2WJSA 3SEEA 1RUD2 4C90A 2XL7A 2D5FA 4LBJA 2GNBA 1TNRA 1PK6C 2VPVA 4HFSA 1U5ZA 4Y20B 1RUNA 2E53A 2RV9A 4LUKA 1JYCA 2N7GA 3N36A 3RPQA 3IMMA 3VBOC 2P6CA 2R16A 3OD4A 4A41A 2VJXA 2ZEXA 1BKZA 3N7MA 4BLIA 3AYCA 3HBZA 1QJY2 2ENRA 2WFF2 4CDWC 3TNPB 4Q4Y3 4IW3A 1E5IA 3MI8A 4D8MA 4XCAA 1LU1A 4WM8A 2OPKA 1VJ2A 4DY5A 2R061 4XURA 1CAVA 4P5YA 4GA9A 4CEWC 4NE9A 1OA2A 1VB4A 2W1UA 1O3RA 2NMOA 3EMRA 1ULGA 4I0AA 4JAAA 5F3GA 3WHTA 1LOEA 4XJWA 4GKXA 3FZ3A 1E5SA 1X33A 4JDOA 4NPMA 4L9BA 5HXMA 2VMHA 2CWMA 5FZHA 2B4KA 4CDUC 4LE4A 1GR3A 5CFCA 1V6OA 2HWF2 4AQ6A 3JD71 4LQRA 1W3XA 2PAMA 2WWSA 5CBLA 3MPPG 1FPN1 3B94A 4RFRB 3WQBA 1EV13 1NXD1 2XDVA 2K2SA 2W9XA 2VMIA 1JN2P 1LJ7A 3QD6A 2W3JA 4WM8C 1FOD2 1FYUA 1LGBA 3INAA 3VKLA 1WMXA 2DURA 4LBQB 3ZXFA 1VAKA 4RR3C 1R1ZA 1AR73 1J58A 1RVF3 3DYOA 5AC92 1T6GC 1W8HA 2VZPA 2BERA 3OY8B 3HR9A 2GMMA 4BQ5A 3LDKA 1WCQA 2JB4A 3MIHA 3GM8A 3VV1A 4B8EA 2PLV3 4FXKB 1LGNA 2WUHA 1BVVA 3T2TA 4CU7A 2VBPA 3UGGA 1N3QA 4O9GA 1O3QA 1C57A 3A7QA 1D4VB 4B3NA 3CL1A 2ZAAA 5CG8A 2JE9A 3KV4A 5JAXA 3V0BA 2GC0A 3CZJA 1W05A 3DN7A 3M3EA 2OKXA 4ASLA 4CEYA 1RHI3 4DPNA 2NYYA 5FXXA 5FKBA 2YB7A 3RRDA 2EXHA 3RYKA 1JOBA 1CJDA 1JW6A 3LKJA 5FQ0B 1OF3A 3ZXGA 1RB8G 3L2HA 4LBQA 4OUEA 1A78A 1I9RA 3D82A 2W95A 2VTXA 1DZRA 5H9SA 1AR63 4AFDA 2HWB3 4EZHA 3GBFA 2X5IA 1KGYA 4NR1A 2BGCA 1QQP1 3SC7X 2C9AA 1MQTB 4PDWC 3ZFEB 3VL8A 1CESA 2YFUA 3KV9A 1NG0A 2A6VA 1AVBA 2A6ZA 2W52A 4MXVA 4R52A 1ENSA 1SACA 1VBD3 2VW0A 1HXS2 4WM7C 1W8TA 3UYJA 1XSRA 3IB3A 5JWPA 4QD2A 2VECA 4PCRA 2W92A 2EXJA 1G86A 5HV4A 4X6RB 5DZEA 3TAYA 1YFUA 4A42A 2GC1A 3I2KA 4R4XA 1G9CA 1OFSA 4JKLA 1GU3A 1LNSA 5J36A 2ZGKA 1UL9A 4XETA 4XJUA 3HOBA 1PHMA 3B5LB 4MO3M 1KS4A 1L7QA 4Z2WA 1ASJ1 1I3HA 1HXS1 2JECA 5D8AC 5C6CA 2X5IC 3BPZA 3R0RA 3H1MA 4Y5Z0 1W39A 4KWUA 4Q29A 2RR12 1R1A3 2Y6FA 4LHNA 4YYOA 4BDVB 2JG9C 2Y64A 3NJVA 2XH6A 2XJRA 4IEPA 1GNYA 2XQXA 3OGVA 1OPOA 4CDQC 3WP3A 3KCCA 5ABJA 2DWRA 2A7AA 3I3BA 5A32A 1W6PB 3RJRA 3H7JA 1OHFA 4QPWA 1AR92 1AR83 1RUH1 2D3RA 1G9FA 3J8F2 4CCLA 3WNOA 2BU9A 4Z8BA 1AR72 1RVF2 1YIPA 2YYOA 3JBG2 3L2YA 2WZPP 2F4LA 2QE3A 1LOCA 2XKOA 4UI9L 2G19A 1OQDA 2WDBA 3ZFFA 2V5DA 1C8M3 5IAXA 1J83A 4LNVA 5FOBB 2R0FA 1W9FA 1W3VA 2AR6A 5M0TA 4UW6A 1ZZ9A 1HN1A 3KS7A 4CDXA 1O59A 2W08A 2HWC2 1YHFA 4NRPA 2Q8EA 3AMHA 4IERA 1W28A 2HWF1 2A6XA 3RWNA 4M01A 1HN0A 1WMDA 2WNOA 3AVSA 2W1SA 2JDNA 2CWSA 1W6MB 5AVAA 1UX6A 3I3MA 3GF6A 2P5BA 2YPJA 1VBE2 1ZBE3 3U75A 2NLRA 3WXPA 1D4M3 2EIGA 1YFXA 2BNNA 2D6OX 3FC0A 4QB6A 3W58A 1HQWA 1WLCA 1CAWB 4LO6B 2X29A 1OH4A 4COVA 4QGMA 4OULA 4E2GA 1GP5A 2Z69A 2V73A 3AKTA 4QB2A 1NA1B 2DYCA 3N35A 4Q4Y2 1I5ZA 1KJLA 1LAJA 1WCSA 1ND2A 1W2OA 1DLCA 2HWC3 4PF1A 4AFMA 3KHBA 5GM0A 5EV7A 1HQLA 1VAVA 4JHZA 2BTVC 2QKDA 3T2PA 3WNLA 1W8OA 1C8M2 2DU1A 2JENA 3JZVA 3JB4C 3H7YA 3ZOIA 2W94A 1UU5A 2JDZA 2QQMA 1W04A 1IPSA 4BQXA 1C5HA 1MS4A 3EXUA 3P5BA 3Q9OA 3M3OA 1SMVA 4QPIB 5I93A 4J1WA 2JDMA 3H0OA 4K9SA 3VZKA 3ZSKA 1MS3A 4UF0B 4QXCA 2LM3A 1XOYA 1AR93 4S2HA 1ULOA 1D2SA 4KNCA 2Z42A 3RZMA 2HWC1 2WFPA 3RZJA 1PNGA 5JUVA 4JRAA 4YM1A 2Y34A 2ZGPA 3ZYFA 2BW8A 5FP3A 4HKOA 1ZNPA 4XFGA 2AC1A 1PMJX 3FLTA 2VBBA 4RS5B 2GNTA 2PHXA 2B8MA 3WG2A 4C91A 4FFHA 3N4MA 3POSA 5A1FA 3FBYA 5J7MA 1AL22 4L0PA 4M4RA 4IETA 4YGCA 1WLDA 5F5AA 4BQWA 4EN8B 2A3XA 3NWKA 5CFDA 3D5OA 4COYA 2GNDA 3ZXJA 3RMYA 1HIXA 5DQ0A 1CX1A 1OSGA 1RJ7A 4P08A 1MEC3 4G9SB 4JVAA 5A6ZA 3TWIA 5JDBA 2CL2A 1BK1A 2WYSA 3ZFGC 1ALYA 1GZTA 3H8XA 4Q4V2 2XB6C 4TLGA 1HXS3 1VBD2 4QT6A 4CDWB 1C8M1 4OQ8A 1QJU3 2VG9A 2DVGA 4XF4A 5TSWA 3S57A 1PGSA 4JGYC 2WT0A 4BPZA 4DB5A 3ZSJA 2XUMA 3FN9A 4Z1VA 4CU9A 5J96B 1SG3A 1JODA 1NQDA 1A6CA 1QOOA 2Y60A 4MGKE 5J98B 3UGHA 1WD3A 4KMQA 4PLOA 3FUOA 4GIQA 5FPBA 1W90A 4Y22B 2ADEA 4C1XA 2DU0A 2SLIA 2CAVA 3CDZB 3OEAA 1VBD1 3N9PA 4JC1A 1CWPA 1DQ6A 1WW6A 1I5PA 2ZHKA 4AWDA 5F3IA 2J7MA 2QQIA 3LEMA 4WVZA 3VZOA 4HANA 2Q8CA 2Y0IA 3ZIWA 2ZMLA 2BVVA 1SPPA 1RUE1 4LBQD 3I2GA 1M4WA 3OUIA 2HWE3 2GH8A 5A1LA 2UWBA 5KHHA 4ZU7A 4AZZA 1RINA 4DUWA 2XL9A 1SZBA 1MEC1 3LF7A 1AL21 3WG3A 4FP2A 3OGJA 3WNNA 3ZO0B 2HWB1 4GMP3 3VBSA 4RR3B 3I59B 3SKJE 2W1QA 1RUF3 1QQP2 1UY2A 4ZY9A 4MUVA 1COV2 2QQLA 2A1XA 3SLIA 2HWE2 2ZHNA 1OVSA 1Z7S1 2AEZA 2K46A 1BEV1 4IESA 2Z79A 5SV8A 5KXEA 3E5XA 2XQRA 4BQ3A 4XABA 1QOSA 3R4DB 3HQUA 5GLWA 1AYN1 1AZDA 5A7NA 2JDKA 2B45X 3S7EA 1V9U2 2R043 5FP4A 1SLBA 4HLTA 4N7UA 4QGLA 1DGWA 3DPRC 1LHOA 1RUJ2 5ABJC 5GZEA 5CKNA 3H3ZA 4PIXA 2V5YA 3PIJA 4PQ9A 1H8TA 3WF1A 3H8UA 4FP3A 3VBHC 2W91A 3MIGA 5C8CA 1RJ8A 2IXJA 3NAPA 3BALA 5I0UA 4QPGC 4AVSA 4LMFA 2D6KA 1VBC3 2XBO2 4CSWA 1YC61 2I2SA 2WA4A 1XB9A 4Q4V3 5DAVA 4KG0A 3RFRA 4IV3C 2JIJA 1VALA 3C7OA 1WCUA 3NQHA 3QBQA 3R4UA 4PDWB 3DKWA 3LSDA 4XUOA 1B35C 3AKSA 3HT1A 3NKTA 3RMXA 1J59A 4KWKA 3QCWA 4CDXC 1PGW2 1WBFA 3H3UA 3MW2A 4WM7B 4B1MA 1G7YA 2XWBB 3H3LA 3PUIA 4META 4COWA 4UFKA 1J3RA 5DDJ3 4IV1A 2JIGA 3PUHA 3QLQA 4OI0A 3U4XA 3R05A 4I0BA 1A8MA 2LALA 3FE5A 2FHRA 3GXUA 3LQCA 1OUSA 3WDUA 5EP9A 2YPDA 1QJX1 2YC2A 5BNQA 3B02A 5FBZA 2DVDA 2LUWA 2WO7A 1R091 3LIGA 4OMDA 2ZHMA 2VGDA 4CCNA 5FYSA 2CNAA 5CFCC
chains in the Genus database with same CATH topology
2ZGMA 2UYAA 2B39A 2JG9B 3AP9A 1J1TA 3GBWA 3LZZA 3LGRA 4YM3A 4FOVA 4GWNA 4CDQB 1H30A 3LCPA 3FMGA 1R081 2B5HA 4Q4W3 4BIOA 2VNRA 3RSJA 1Y9QA 4TYSA 4C0BA 1W6OB 2WKKA 1DQ1A 5GLVA 3TYJA 1PGL1 3WQ7A 4Q0QA 5C9AB 5H9PA 4RHV1 4ASMB 1WD4A 1Q3EA 2ZACA 3KM5A 4P9JA 3RYRA 4LO5B 1WLWA 2PHLA 2GC2A 4KG8A 4AE2A 3ZYRA 1X7NA 2VMGA 2I74A 2WINB 3O0VA 4Q4X2 3W9AA 5JSPA 5H9QA 4JGZC 1YXWA 4XPVA 1H2NA 4OFGA 1VBB2 3VKNA 4KGQA 3KCYA 4IEWA 5GZDA 5DXDA 1PO11 1UW8A 1UKGA 3VZMA 4DRVA 4QM9A 3DL3A 4ATEA 2HEVF 2P17A 5KHKA 1TEIA 2Z2SB 4MXWB 2KM2A 1ZZ6A 1S1AA 4COUA 2UY9A 3SCHA 2IFWA 2P3JA 2WLQA 1S0BA 3ZFGA 2ZJCA 2RS12 4YG0A 1ZA4A 1OMIA 2Y0OA 1PVC2 1TME2 2RS33 3ZXEA 4DQAA 5KHIA 3NW4A 1ND3B 4AVCA 2GC3A 3V0BB 4GH4A 1GBGA 4JGZA 1DLLA 1AR82 2QDRA 1FMD3 1YNAA 2D6MA 3E97A 4RQPC 1VB2A 3ILNA 4IEOA 3VBRB 2WS91 4E4SA 2KA3A 3ZXKA 4AI1A 5FPXA 3CF6E 3ZX7A 4BM8A 1PIV1 5ACA2 2Z5WA 4BH9A 1RUF1 1FPN2 5DUUA 4YGBA 4JQRA 2GMPA 1PO12 5T5JA 4GXLA 3EBRA 2WA3A 2GH2A 2OIIA 1TMF1 4INDA 4K7JA 1I6XA 2QCSB 3M8LA 3PJYA 3MICA 4A3XA 1W6OA 4FOQA 1NE6A 3RDIA 2Q30A 1Z0HA 5IUQA 1ENXA 3ROUA 3VBOA 4J6GA 4JRLA 4OZXA 1ZRRA 3PMSA 4D7TA 1BBT3 2XGXA 4K1YA 3I2DA 1W0OA 4ES9A 1IQAA 2CGPA 1VBA1 4XFIA 4W65A 3NV2A 2HWB2 5GALA 3DV8A 1HRI1 1X8MA 4QQHA 2R073 4FVVA 2ET1A 3A0NA 1FMD2 1G8WA 4BOWA 1V6JA 4R9DA 1Y3TA 3TBDA 2ES3A 2R041 3HIFA 4N53A 1J1LA 5KWRA 1MVEA 2BWAA 1AXZA 3M3IA 4FPCA 1C28A 1QH7A 2XHKA 4QPGA 1NA1A 1AUYA 1DIWA 1G9DA 1NE4A 3TN92 2JG8B 4Y24A 3WOGA 2ILMA 4B7KA 4YZ3A 5K0UA 3GZTB 3WDVA 4ZKTB 1RUI1 1U5YA 1YWKA 1VLNA 1S0CA 2AENA 4LBOA 2BBVA 4XBQA 1AXKA 4XE9A 4XILA 1RL3A 1D4M1 2ERFA 4PBPA 1FOD3 1L3JA 4HN1A 4YVSB 4Y1YA 1BEV2 1BCXA 3AYDA 1Y7BA 1OQ1A 4EN9B 3GYDA 1O3TA 3WW1A 1MZ5A 2I45A 1RUH2 3J8F1 2RR11 4E2QA 4YG6A 5JOXA 4YARA 3LOBA 1QY4A 4PJYA 1RUJ1 3TNQA 3LB9A 4NVPA 1POV3 1VR3A 4YW4A 3I54A 3DPRB 2ZBJA 2PTMA 2ZZJA 5ABJB 4ISRA 4YNIA 1LGCA 3BU7A 4Q4W2 4AEDC 3J9SA 5J48A 2VOVA 2ZA9A 3N3HA 5JPNB 2X8KA 1VBC1 1RUD1 2EA7A 4COZA 2VVFA 3SCGA 4XTMA 3FJSA 4HK8A 5HBAA 2WS92 1ZBE1 4HT1T 1APNA 5BNNC 4BHPA 1DGRA 2XJVA 4XJ8A 1MZ6A 1HRI3 3HAGA 4XHXA 5AVPA 4AW7A 2RM21 2WC2A 1O91A 4PLNA 1XU1A 4GKYA 5C9AA 1GFF2 1POV1 1CPMA 2DTYA 2RS31 4IL7A 2Q5TA 3GHNA 1QWRA 4GMP1 5C8WA 2DVBA 3S0MA 1CONA 1FT9A 3ZSEA 3ZXLA 2W39A 3RZZA 4HBNA 4GWMA 3ZVXA 4DOUA 2GAUA 4BYYA 1XYOA 1S0IA 3I59A 2DFCA 5GLZA 1N1TA 3B01A 3WQ0A 2WLPA 2JICA 2UURA 1DYKA 5JZGC 3M4FA 5C9AC 1RUH3 1H0BA 2R042 3H1YA 4Y1ZA 2ZX3A 2BQPA 4XQDA 3R4SA 4S2FA 3WP6A 1CGPA 1HV1A 1IHMA 1YFWA 1S0DA 2QNKA 1ENRA 5I8TA 3C2UA 4JGZB 4HPKA 3DPRA 2O8OA 2WZR1 1H4GA 1U12A 2AYHA 3JU9A 3WLUA 1LOGA 2VNGA 2BUKA 4IXLA 3NAPB 1PIV2 2XVLA 4FPYA 3ASIA 2EAAA 2DF7A 5K8SA 2A70A 3K51A 5EWSA 4EN0A 1MACA 1RUC3 4KL1A 4Q0PA 2Q4SA 2XVGA 1PVC1 2GDFA 1HRV1 3AMMA 3T1MA 5FLJA 1QKQA 1NOVA 4WZFA 3SNMA 1ASJ2 4KQ7A 4LUMA 4PBOA 1ND3C 1LKNA 1EYBA 5K0UB 1OPMA 1REEA 2BFUL 1IPJA 3VKOA 1CAVB 4Q27A 3EJKA 4C1WA 1K5MA 1IOAA 2HWE1 3CJIA 1IS3A 2OVUA 4RQPB 1WW4A 4X8PA 1C4RA 1H2MA 1Q8SA 1QMJA 1QXPA 2XLGA 3AP5A 2R063 5J09A 1C1LA 5DG1A 1YIFA 1N3PA 3NSTA 1DQ0A 1ZZ8A 5KXCA 4AVAA 2JG9A 4DINB 1MEC2 2ET7A 1Z7S2 4Y1VA 2ZGQA 4GB31 2CAUA 2BYVE 5CB7A 4AVTA 3NKGA 4K1ZA 2D40A 4H7MA 1AYN2 4QQ2A 1NCRC 1KXGA 4CRQA 5T55A 3JD73 4M0NA 3VZLA 1QDOA 5CADA 5ACA3 3POYA 5JSRA 3KD4A 4QMAA 3V0AA 1CQ9A 4Y20A 4GQ7A 1AR71 1BVP1 1RVF1 3ZDSA 1IKPA 2A5ZA 3RQ0A 1M06G 1JUHA 3N7LA 1Q5OA 3P3NA 1PVXA 4EJRA 3THPA 1LOFC 1S0EA 1YI9A 2VW1A 3AMNA 3GNEA 3MLLA 1QJY1 4AFBA 1FV2A 4LEJA 4XBNA 3IDBB 5T54A 3SMHA 5F1RA 2FZ2A 2OYZA 1FATA 2HEYF 2RS13 2VOKA 1QOTA 2HYKA 2IXLA 3VBSB 1LODA 3D6EA 5T50A 1NY72 4YW2A 1RMU3 1S0GA 2D6NA 3KT7A 3TOJA 2EXKA 3VBUC 3NV4A 1F2NA 3WG4A 1QJX2 1SLCA 1C8NA 1NLRA 3FWEA 1H4HA 4NPRA 1D4M2 4BZ4A 3J26N 1ZBA2 5FQ0A 3M2MA 2DFBA 1WUVA 1RMU1 3CJIB 3IT8A 1KDMA 2CY6A 2YGLA 3M3CA 3VKMA 5BNOC 4OI2A 4P9YA 1RTVA 2RE9A 1KJRA 3CO2A 1W2UA 3JCIA 3AJZA 4F83A 3JB8A 4MGYE 1CVNA 3AKPA 5EYYA 2ZX0A 4BMEA 3MDPA 4N90A 3JBG3 4FPKA 5J3UA 1LULA 4L92A 4LBNA 4FCAA 1IS6A 1MR5A 2EVXA 4JV4A 3CEWA 1PO23 5C8CC 1AX2A 2V09A 1LHNA 3MIFA 1RUG1 3V65A 1TQ5A 1H8TC 4UXAA 2IC1A 2VU9A 5FCCA 1ZZ7A 2VQAA 5BNOA 2HJIA 5FOJB 4AK3A 1G9BA 2ZX4A 1AYM3 1W6QA 1WW7A 1UZZA 4IV3A 5D8AA 3VBRA 3ZFEA 4B4QA 1XNBA 2PHRA 4TSVA 4D7YA 1LHWA 2EAKA 3HD8B 1AR81 1XNKA 4ISQA 2ARXA 2RMU3 2FMYA 5DUXA 5BUVA 3USSA 4I3PA 4Q2FA 4L8QA 1DG6A 1UCXA 1BXHA 5DDJ1 5JCTA 3AXEA 2BNOA 5FMOS 2FMDA 1IS5A 1CAUA 1DFQA 3UJOA 1HW5A 1S2BA 3B9IA 4MH0E 4PF5A 4FTSA 4MXWA 3WZ1A 4SLIA 5D8AB 1UPSA 5BNPC 4K6BA 4R9AA 3WD5A 2YUEA 5CU1A 1AR62 3MIEA 3H1WA 4LO7A 3GZUC 4G4FA 5FO8B 3ZYJB 3APBA 2DUQA 5LRRA 1F9KA 1HDKA 1RHI2 5I91A 3C3VA 4RL7A 3ES1A 1NY71 2SBAA 4MZUA 1WW5A 3AFGA 3ELNA 2IZWA 3LA3A 1VBA3 1ND2B 3LA2A 1NCQA 4BA6A 2WNVA 2DCKA 2TBVA 4N43B 5LEJA 1N1SA 3O0WA 1X82A 4XJ9A 4Z92B 4ITCA 4RSUA 5L36A 1CJPA 2QDNA 2D93A 4GH4B 3D0SA 3OYWB 5AC93 3A4UA 1H1IA 3NAPC 2E63A 3EQEA 1RUC1 1EV12 5E16A 1V6IA 2B7YA 2K9ZA 2YC0A 4P14A 5E1RA 3UKTA 1REDA 4LBMA 3WW2A 3WW4A 2R32A 4K3UA 3B3QE 1EAH3 2PA7A 1AR61 1NA1C 2KXLA 2WSVA 3MEPA 4OVEA 1H1MA 1DQ4A 2WNVB 2JKBA 1J3QA 2O8QA 4CEYC 2D97A 5K0UC 1DBNA 3JQXA 3PVEA 1Q8OA 5F6KA 1VAMA 1GQGA 2UWCA 2VH9A 5CFDB 1XRUA 1FX5A 5AFEA 5HCFA 3VBFB 3O0XA 2HWD1 1QXRA 1RUG3 3HMYA 2B46X 1QJY3 1F5FA 5HCAA 4ONUA 3M3QA 4G3YC 1LESA 1WGPA 1FV3A 4D3WA 1H2LA 3KGLA 1NXMA 1TNFA 4FT8A 4RS5C 1AL0G 3KCXA 2ZGNA 2BNMA 2RMU1 2QZ3A 1RUD3 3D8CA 5B2GB 2H0VA 2IXKA 2C0ZA 4F3JA 4XMIA 2ZGLA 5EYXA 2A3WA 3IKWA 4P5HA 3O14A 1MZEA 2MNGA 1OKQA 1XNDA 2VOXA 1N1YA 4DXZA 1MS8A 5D1IA 1C5IA 5SV5A 2VUAA 3CJXA 1VRH1 3NO8A 2OW4A 1FAYA 2D3SA 4RGAA 3ZMNA 2ZAHA 4IEVA 3ILFA 5JR7B 2AH2A 3VBSC 4KWLA 2FQPA 4FPFA 4HK9A 1CN1A 2A3YA 1DQ5A 4KWJA 3KT4A 1ULFA 1FOD1 1X50A 4Y1XA 1PK6A 2WFF1 2JEMA 3OBRA 4HVRA 3VBUB 4LBKA 4OHXA 4ZXKA 4XYXA 1DGWX 1OOPA 1UMZA 1UN1A 3GALA 3VHPA 1MQTA 5IK5A 5A3LA 1VIWB 4IEQA 1OQEA 1HRV3 2GSYA 1U5XA 3IBMA 5L7OA 5A33B 1FI2A 2VY0A 3PTYA 5EZWA 4CP1A 3CJIC 3ALQA 4URTA 2AGSA 1F8VA 1A8DA 5IK8A 5BNOB 1GZWA 1S0FA 2PLV1 4ZU4A 1XYNA 2ZGSA 4MYEA 2H0BA 5KC6A 1Q8VA 3O7OA 3ZXDA 1GSLA 1OA4A 1PNFA 2HWD3 3WV6A 3ECQA 1FNZA 1U0AA 3LA7A 4Q1RA 1CAXA 4OHWA 4LT5A 1UIJA 4CDUA 5BY5A 1OLQA 4GULA 4ATFA 4P9XA 3TB0A 3M7AA 2DV9A 2JXAA 1RUE2 4NO4A 1XE7A 2XJUA 3EHKA 4MX3A 1EPZA 2G9FA 4N53C 4QQLA 1PZ9A 1AYM1 5IK4A 1SLIA 4AVVA 5JPMB 5CAZA 4QPIA 3UL2A 2JX9A 5LRSA 4XFBA 3AJYA 1AYN3 3G7DA 1UU6A 2PFWA 2P3KA 3D0JA 2PHFA 3IN9A 4FPHA 4CP2A 3AM2A 1B35B 3AZVA 2PN5A 3CU7A 4CDQA 4CDXB 4RGGA 1SCSA 2IXCA 3W59A 4XZPA 1WCKA 1FNYA 4GMP0 2G9GA 5LK7B 4KU8A 1EP0A 1K5MB 2X53S 4L99A 1FPN3 1W6MA 3TN91 4LHLA 1CAWA 1H9WA 1KS5A 1R1A1 2TEPA 3ZXAC 4XQ4A 1NLSA 5K7PA 2QQPA 5BNPB 1ASJ3 5KBFA 1XQNA 2GU9A 2PHTA 2XBO1 3MF9A 4Y1UA 2ZMKA 5HXVA 2Q1MA 2F4PA 1GKBA 1ULCA 3MZHA 3J4UH 1JHNA 1RUC2 1AYM2 5JZGA 1NCRA 1PIV3 1DDLA 1SLTA 4R8HA 3GBGA 2GNMA 2E7QA 4XXAA 4AEJA 2DUOA 4OI1A 1N47A 5DZGA 3ZN6A 1ND2C 4XBLA 4B29A 4ZU5A 4N43C 5C4WB 4AHWA 1V70A 1AR91 5EXOA 4WVMA 4FPGA 4GH4C 3VZJA 1LOFA 1ZX5A 2R0HA 4AEDA 1QNWA 5L7OC 2HWF3 1RUOA 4RQPA 1VRH3 3E6DA 5L19A 4YZ1A 5JOYA 1AJOA 1W6NA 3I4IA 2ZGTA 2DVAA 1PZ7A 2FZ1A 4IEZA 4XFHA 1V6LA 1WMFA 3BTAA 5FLIA 1SEFA 3WCSA 5BV6A 2ZX1A 4ES8A 4X8NA 4Q0VA 3BB6A 1F5JA 2WL1A 2D98A 2WNVC 4CEYB 1HV0A 4AHZA 5EFUA 4CDWA 2WNUB 2ARBA 1BQPA 1V00A 1TME1 1UF2C 4J1XA 3THTA 3NJZA 3OCPA 4DS0A 3IDEA 5CFDC 2XJQA 4XTPA 1DZQA 2A75A 2DTWA 4OUSA 3VBFC 4Y22A 3ZYIB 3WHUA 5BPXA 4M0HA 2ZKLA 4P9IA 2QZ2A 2I07B 2JG8A 2C5DA 1OOPC 3WQ1A 3AP7A 2ZS6B 2XVKA 3VDDA 4DFSA 2ZABA 1QNYA 4X6QB 3WDXA 3DGTA 1RUG2 2D7FA 2ZHLA 1H8VA 4KGGA 2QVSB 2RS51 1PK6B 3BOWA 3D4KA 1JTZX 4AVBA 4FOWA 1AXYA 2UWAA 3JD72 4LLFA 3FLPA 2PHDA 1WMEA 1IGOA 2QJVA 4RFT0 5KXDA 1AHSA 2YDEA 1YLLA 2R071 5L73A 1R082 1Z7S3 2BPA2 1EAH2 4AXOA 2PELA 4M00A 3A0KA 1KITA 4FPJA 2XLFA 1OD5A 4Q0SA 1SDWA 4AG4A 1IS4A 4YVWB 4CYDA