3AJZA

Crystal structure of ancestral congerin con-anc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNANRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ajzA00
4LBQA 1R1ZA 1N1YA 1WBLA 1C57A 1WLWA 4ZKTB 1GBGA 1QU0A 4DQAA 1YO8A 1A3KA 2BQPA 5DZFA 1BQPA 4YW4A 5GZCA 2ZGRA 2DVFA 3AP4A 1WD4A 2PELA 3SITA 2JECA 3NV4A 3WDUA 1JHNA 1PZ7A 1Q56A 2AENA 1CONA 2JKBA 3RSJA 2NN8A 1QNYA 4XDQA 4YGCA 2D6LX 2V5YA 1C1LA 4UW5A 2XB6C 5JVVA 2P3KA 1HKDA 2OUJA 3AXEA 3AZYA 1N1TA 1Z78A 2ZHKA 2OW4A 1VIWB 3AZWA 4DPNA 3OYWB 4ISRA 4SLIA 1GKBA 3ATGA 1DQ0A 4LBQB 1WLCA 4YLZA 3M3CA 4JC1A 3WOGA 2ZGPA 2DVGA 2Q5TA 1F9KA 1SLCA 2D3RA 3UJQA 1DYPA 1SLBA 1WD3A 4GKXA 4Q8KA 1F5FA 4XBNA 2RHPA 3OJBA 3ZSKA 1LESA 1FNYA 1YI7A 4M3CA 1LOFA 1J1TA 1V6OA 1LODA 4AVVA 1S0FA 3AP9A 1BXHA 2DU1A 1GSLA 3I4IA 3NV1A 1W0PA 2ZAAA 3WVJA 4FPOB 2XG3A 3ZXLA 1CJPA 4IQPA 1HQWA 1G9AA 3N35A 3O0WA 3DUIA 1LECA 2WKKA 5GLVA 2YY1A 3HR9A 2FMDA 4Y22B 2ZGMA 2GN3A 3FUQA 1ULGA 1MS8A 3LSDA 4I30A 4XILA 3V0AA 2ZGTA 3PVEA 4FPEA 1YRZA 1IS4A 1MS1A 1FAYA 2ZHLA 1MS4A 4GWMA 2EXKA 2YXSA 1LOFC 5T5PA 1WUVA 2CYFA 3AZVA 2CL2A 4Q8LA 4FVVA 5HCBA 2VXRA 5EWSA 2ZGQA 1AJKA 2HYKA 3GALA 1GICA 4PF5A 5JLVA 4AWDA 3V0AB 1QDCA 5T54A 2FHRA 4LBKA 5H9RA 4YZ2A 5GJ6A 4FP2A 1UL9A 4M01A 1BJQA 5CAZA 4ISQA 1DGLA 2VU9A 3FLTA 4XTPA 1IS5A 3AP7A 4XIOA 4Q26A 3ZYRA 1GZ9A 5IUQA 3AYDA 1SCRA 2PHTA 2ZACA 1F31A 3R4SA 5GZFA 2A71A 4YM0A 4ATEA 4BOWA 2TEPA 4XJUA 2NMOA 2G4IA 3MW3A 3AX4A 1DQ6A 3SH3A 2DU0A 1AXZA 1GV9A 2VY0A 3APBA 4WZFA 5H9PA 3SLIA 2ZGSA 3V64A 3VV1A 5KXDA 4UW4A 2PHXA 2ZMNA 3B9CA 3IM0A 2AGSA 4R9AA 3A0NA 5JOZA 2JE7A 4XYXA 2LALA 4P9YA 1SLLA 2AR6A 4TZDA 3BODA 3HMYA 1W6PA 4R9BA 4YFWA 5T50A 3WCSA 4CRQA 1U0AA 2YMZA 2NM1A 3VKNA 1N1VA 2R1BA 1GNHA 3ZXKA 3B69A 1SLTA 5JMCA 2C5DA 1UAIA 2CY6A 2UU8A 3AYEA 1VLNA 4XZPA 2ZKNA 1LOCA 3WUCA 5JOXA 1XQNA 1GZWB 2DV9A 4U2AA 5IK8A 4XJWA 1LGNA 4DFSA 1S0EA 1N3QA 4R9DA 1RINA 4MYEA 3N7KA 2C9AA 1G9FA 1S0GA 2GNBA 4PBOA 1UN1A 1DBNA 3AFKA 1V00A 1LTEA 1SLIA 2P2KA 1APNA 1JYCA 3ASIA 3N7LA 4FPHA 4Q1RA 5GZEA 1UX6A 2VW1A 1LHVA 1LGBA 1D2SA 5T5JA 3VKOA 3AYAA 5T5LA 1JXNA 3AP5A 2D3SA 1WBFA 1UKGA 1KJRA 2R1DA 2A6YA 3OY8A 3WZ1A 5E89A 1AXKA 2D3PA 2AREA 1C1FA 1N3PA 3ZSJA 2ARBA 1G86A 2PHWA 4PCRA 3O12A 1DIWA 4W65A 2WT1A 5GALA 1ENRA 1LENA 2A6WA 4U36A 4YG3A 2A70A 5GLUA 3TAYA 4KBBA 3FUOA 2A5ZA 3FFZA 3O0VA 5HCAA 4P9XA 1MZ6A 1BZWA 1W6OA 3LSEA 1MS9A 5E88A 3OY8B 3INAA 3KQRA 1SACA 3WG1A 4FOYA 1LGCA 5F5QA 3ZVXA 3KM5A 4Y20A 5DUVA 5EYYA 2DYCA 4DS0A 3B00A 4Q27A 4XJ8A 4BM8A 4UW3A 2GMMA 5FRAA 1HQLA 2WSVA 3RG0A 3A4UA 1WCSA 1OKQA 5EYXA 2VH9A 1LOAA 1WW6A 3TB0A 3POSA 2NYYA 1QKQA 1G7YA 2P3JA 3NWKA 5CNAA 1LU2A 5HCFA 4YG0A 5FREA 1DQ4A 1EPWA 2OUHA 3ZSLA 4YZ4A 1LCLA 4UW6A 4Y24A 1V6KA 1UPSA 3WG4A 2ENRA 2GNTA 3N7MA 4Y20B 1DQ1A 2A3WA 4LBJA 4K21A 4YM1A 1LEDA 2W68A 4FPFA 1DLLA 4L8QA 1ULFA 2SLIA 1H9WA 1HLCA 4HANA 4M3CB 3VKFC 1LU1A 1GANA 3T1MA 5T55A 1Z0HA 2D6PA 4JCKA 3VUOA 1WW4A 4XJZA 2D6NA 3USUA 1S0IA 1WW5A 1ENQA 1AZDA 1OQ1A 1YYNA 2P3IA 4FOQA 4XBQA 4ATFA 1G9DA 2EF6A 4BMEA 1ZA4A 2JDZA 3QLQA 3FBYA 4FOWA 1VAVA 3N3HA 1ENSA 4FOVA 5IK7A 2A3XA 2JD4A 3VKMA 4P14A 2GMEA 1QOSA 2LTNA 5GM0A 5GZDA 2WT2A 4F83A 5L73A 4AGRA 1KRIA 2W08A 1YXWA 3L2YA 1IKPA 1SLAA 1QOOA 4AVTA 1Y7BA 1SFYA 1LOBA 1V6JA 2WLQA 4YM3A 1UZYA 2NZ9A 3Q9OA 1JBCA 4XJAA 3UK9A 1AJOA 4BMBA 1BKZA 4AVSA 1QGLA 1CVNA 3ZPYA 1A78A 3ZSMA 4AGVA 4DRRA 1MVQA 4Y1XA 5H9SA 3WV6A 3GNEA 1LJ7A 3WHUA 1G8WA 4XJ9A 3O0XA 2D6MA 3WLUA 3IPVA 5F9TA 1DQ2A 3W58A 1O4YA 1ZM1A 3D5OA 4XHBA 3OBRA 4LBOA 5KXCA 4ITCA 5JOYA 2ZGKA 4XHXA 1AVBA 4LBMA 3D4KA 2DVDA 3PMEA 1B09A 2E7TA 2ZA9A 4K20A 1S0DA 4YW1A 2YV8A 5IK4A 1JUIA 2B7YA 1S0BA 2UWBA 2W52A 2ZGNA 3R4UA 3RMXA 1LOEA 1H30A 2UWCA 1SCSA 3WDXA 2DVAA 1QF3A 5CBLA 3D6EA 2R0HA 5BYNA 1OFSA 1JOJA 1PZ9A 4FPJA 3O5SA 3N36A 4Y26A 2SBAA 2WQZC 1V6NA 3ZXFA 4CZSA 4WVVA 2A3YA 1I3HA 3AZZA 1IS3A 1X50A 1SBDA 3M3EA 2WT0A 3AP6A 2E53A 2P37A 1Q8PA 2A7AA 3AJYA 2YZ4A 4M00A 1G9CA 5IK5A 2D7FA 3M2MA 4Y1ZA 2WJSA 3T1LA 1W6PB 4YZ1A 1A8DA 2ZMKA 4Y1UA 3SH4A 4YM2A 4FP3A 2D6KA 2DURA 3ILFA 3ZYPA 1CQ9A 1UMZA 3RRDA 3WDWA 2GALA 2V73A 2E6VA 1IS6A 5DZEA 4YW3A 1KDKA 2A6XA 1WLDA 2E7QA 4FPCA 3NV2A 5DZGA 2ZGLA 1SBEA 3WUDA 2CNAA 2AUYA 4BPZA 2R0FA 1DFQA 3WG2A 4ASMB 1I1EA 3SNMA 3AYCA 3V65A 1Q8OA 4LBLA 4M3CF 1QNWA 2P34A 2VW0A 4Y1VA 1FV2A 4YW5A 3OGGA 1GYKA 4XMAA 4R9CA 4Q2FA 5DUWA 2E51A 2VUAA 1O4ZA 4FQZA 3AJZA 2JE9A 3ZXEA 2ZHNA 2PHRA 1H9PA 1MR5A 2R16A 4ZXKA 3RQ0A 1DYKA 1LHUA 3WHTA 4XXPA 3IMNA 5T5OA 2DUOA 4C1XA 2UURA 4PQ9A 4NOTA 3HN1A 5LK5A 1YIFA 1JW6A 3RS6A 4YZ3A 1TEIA 5GLTA 1IKQA 1GNZA 3PVOA 3BIWE 4GA9A 4Y1YA 1N47A 2CWMA 5DG1A 3M1HA 4XBLA 1VAMA 2ERFA 1KJLA 2D6OX 2DWRA 3AXDA 1W6OB 1V6IA 3PVNA 3N7JA 1MS5A 3NV3A 3POWA 2AH2A 4Z8BA 2ZABA 1RIRA 2EXJA 1MACA 3UJOA 4XTMA 3WCRA 1MZ5A 4Y22A 1FYUA 1GLHA 2DVBA 3M3OA 1G9BA 1MS0A 1CESA 3IN9A 1AXYA 4H55A 1LEMA 2H0BA 4XMIA 1FV3A 2WSUA 3I8TA 2Z42A 5GLZA 2GN7A 3H0OA 4Q1PA 2ZMLA 3SISA 2GNMA 1IOAA 1D0HA 2ZHMA 4OZXA 4XIKA 5CA6A 4HL0A 2I2SA 4D69A 3U4XA 5KXEA 3WDVA 1KQRA 3LCPA 4M3CE 2GNDA 1BYHA 4WVWA 4YGEA 2ZBJA 1CPNA 1W6MA 3FLPA 2AYHA 1N1SA 3CNAA 4GALA 1FNZA 1Q8VA 2D44A 3DGTA 2EXHA 4AYUA 4XE9A 2UWAA 5T52A 3V0BA 4YW2A 2W39A 1AX1A 2KM2A 3USUB 1QOTA 4NO4A 1KDMA 2ARXA 1C4RA 2VW2A 4FPGA 3VKLA 1CIWA 4AGGA 1ONAA 4BLJA 1MS3A 3WNXA 5GZGA 1ULCA 2YROA 2DUQA 2GMPA 1FX5A 1GZCA 4LBQD 3AK0A 4BQ1A 1VALA 4JRAA 4GKYA 1W6MB 4P9WA 1NLSA 2JJ6A 1FATA 1SBFA 2EALA 4RL7A 4XXAA 2ZZJA 4RA0A 1W6NA 1DHKB 2ZGOA 5EXOA 5SV8A 2EIGA 5E8AA 5H9QA 4FPYA 3V0BB 2D43A 2GDFA 4GXLA 3OBTA 1AX2A 2PHUA 4YGDA 2OVUA 1LULA 1LOGA 3MPPG 1LHNA 2CWSA 1CPMA 3JU9A 1V6MA 3BOPA 5DUUA 3QCWA 3JUUA 3WDTA 2EAKA 5KXBA 3IPVB 5DUXA 3R05A 1WW7A 4YGBA 4K1YA 1QMJA 2A6VA 4TYSA 5IT6A 3WDYA 2NMNA 4LBNA 1DQ5A 1W6NB 3WG3A 1Q8QA 5GLWA 1AX0A 5DXDA 4FQ4A 3MW2A 1ULEA 2ES3A 3FLRA 1PZ8A 1DZQA 3B01A 1MVEA 1GZWA 1QDOA 1V6LA 4XOGA 3RMYA 3BTAA 2A75A 4CTEA 5CB7A 2DTYA 4FPKA 2R49A 2CTVA 4PBPA 3SH5A 3ILRA 3MEPA 3ENRA 4K1ZA 4WV8A 3PJQA 1S1AA 4YFZA 1NXD1 1CN1A 4GWNA 1W6QA 1CR7A 1S0CA 4C1WA 4YG6A 3B3QE 1Q8SA 2ZGUA 1W0OA 2NP0A 2EXIA 4YZ5A 3W59A 1AF9A 3POYA 5JOWA 5JDBA 4FPLA 3OPZA 1UZZA 5AVAA 3ZXJA 3MW4A 3T2TA 3UL2A 2A6ZA 2DUPA 1S0JA 1HDKA 3C2UA 3IKWA 1JYIA 1LHWA 1KITA 1URXA 1LHOA 3A0KA 1RITA 1W6QB 1ULDA 2PHFA 3ILNA 1JN2P 3AZXA 2DTWA 2WNEA 4BLIA 3M3QA 1N3OA 5DG2A 3OYWA 4DRVA
chains in the Genus database with same CATH superfamily
3OGVA 4LBQA 1RUH3 3OCPA 1WLWA 1L7RA 4OMCA 1NG0A 2BERA 3H42B 4CXYA 2IFRA 1BQPA 2XBO1 2YHJA 3MIBA 3DEMA 3THTA 1PIV2 3MIFA 2PELA 4XF1A 2BGPA 3W20A 3WDUA 3O1MA 1CONA 2NN8A 5F8PA 4DEVA 1HV1A 1UIKA 4XDQA 1JYXA 4CUBA 4CU8A 2XB6C 1J1LA 5F3EA 3EQEA 2Q4SA 1N1TA 1W2TA 1Z78A 5FZKA 4W4ZA 4RYDA 5CU1A 1QEXA 3I49A 2ADEA 4LBQB 1WLCA 3PTRB 3M3CA 2A73B 2R041 5EPAA 1SLCA 1SLBA 3T2OA 3OJBA 1LESA 2HEYF 5A7WA 1ACCA 1QJY1 1J1TA 1GP5A 2P4EA 1XU2A 3AP9A 4BWOA 3RZMA 2JG8A 4EN7B 3O14A 4CEYA 2VTFA 5FJKA 5FV3A 2ZAAA 3WVJA 2XG3A 3THCA 3ZXLA 4IQPA 4BQ3A 1YJKA 5CKMA 2UYBA 1WCUA 3O0WA 3MIDA 4YVSA 3MO4A 4Q0SA 3SHRA 2YY1A 3HR9A 2FMDA 4IL7A 4ZHNA 1I5PA 3LSDA 4KU8A 4N9HA 3V0AA 4YSFA 4L97A 3PVEA 5M0TA 2QQPA 4QX2A 5A7WB 1TME2 4MO3M 3CZUA 4ARXA 1W2AX 1MS1A 5EV7A 4DMIA 2EXKA 2JG8B 2YXSA 1LOFC 4WZCA 1JOBA 3BGAA 4P5YA 1W28A 4KQ7A 3IAPA 5LEJA 3MF9A 4M4RA 2D98A 4XVHA 4NRMA 1ZBA1 4WM7A 4YVSB 2VUDA 4OCTA 3O1RA 4WM8C 1AJKA 2HYKA 3C8XA 2RS33 2VMEA 3HT1A 4LJHA 4QMAA 4AWDA 1R1A2 5ACA3 3V0AB 4W50A 2EA7A 4OUMA 2W47A 1QDCA 3S30A 4IEYA 5T54A 4JHZA 1NCQC 2VPVA 3J7NA 4FXKB 4KWKA 4LBKA 2QZ3A 1UL9A 1E5IA 2Y6HA 2RR13 3BOWA 4PDWA 3V56A 4BDVB 1PVXA 4DUWA 2YYOA 3I59A 3ZOIA 2VU9A 3FLTA 2QVSB 3BALA 2BGOA 3J9SA 5D8AA 3OEAA 4LE3A 5IUQA 3WW3A 4WM7B 3LPFA 5LRRA 2YBKA 3C7EA 4YM0A 1ODMA 2WNVB 1AR71 4GB31 3I54A 4XJUA 1SZBA 3WNNA 1NA1A 4J1XA 4OULA 3H8RA 2DU0A 3QH6A 5FLHA 3IBMA 1RUD3 4LKEA 3ZMNA 2P3YA 2ZGSA 4GAZA 3I59B 3B9CA 5LEKA 1DLCA 5L7OB 1G6NA 1DF0A 1YQ6A 2CGNA 1H0BA 4RFT0 4R9AA 5F6LB 3RDIA 2JE7A 4XYXA 3T0AA 1PO13 2JB8A 2AR6A 1I9RA 2WFPA 4RFRB 1R64A 5GKAC 2WZR3 5LATA 3ZFEC 5IHRA 3CHXA 1VBB2 1W6PA 2RS52 3WCSA 3LEGA 5JMOA 3HIFA 5C4WA 1XYNA 2NM1A 5G05L 1NA1B 2EIEA 4I09A 2Q1FA 5FQ0B 4LHSA 1XXNA 2C5DA 3B94A 2ZKNA 4URTA 5B2GB 4AI2A 3WUCA 1ND2A 1HB4A 1HW5A 4V2WA 4LK7A 1ZBE3 4U2AA 5IK8A 1LGNA 5FY5A 2Y64A 2BU9A 2WZPP 2W46A 1MEC2 3K4DA 4R9DA 3C7FA 4OFGA 1RINA 1PMIA 4N53A 3N7KA 4PBOA 1OH4A 4RQPC 1DBNA 4HOOA 3N7LA 4C1XA 4AEKA 2P2KA 1APNA 3ASIA 5C4WB 5CFCB 5CFDB 4DOUA 1YI9A 2Q8EA 1EAH1 2VW1A 2QBXA 5T5JA 1R093 3WQBA 2VTXJ 1ND2B 4BQXA 1ULOA 1QJU1 5IVEA 3I2KA 5E89A 4RGGA 4BXFA 2AREA 3ZLIA 1OUSA 1VB2A 4N53B 2WZEA 1X8EA 3GHMA 1ENRA 4LKDA 1H1IA 2VTXA 2XQRA 2HYXA 2R063 2WO2A 4Q4V2 4NIAA 3SQOA 4UWDA 4QB2A 4H7LA 1QJX3 2BFUS 4F8AA 1PO21 1RJ8A 1RUH1 4J25A 3HVDA 5L9BA 2JIGA 3U75A 4FFHA 2JDAA 4YVWA 1TQ5A 1ZRCA 1EV12 1SACA 1SHWB 4K6BA 4JGYB 4E8CA 4CCDA 2EAAA 2DYCA 3I3MA 2XDVA 1Q5OA 5C7GA 1RUNA 2BVBA 3C7HA 4UW3A 3OG2A 2V4VA 3LDRA 3RG0A 5FY7A 1WCSA 1OKQA 2PXJA 1ND3A 3CMGA 1UOFA 2NYYA 2KXLA 4E2GA 1LU2A 4NPRA 1BK0A 2R7EB 1GWMA 3WINE 4YVWB 3RZHA 3M70A 5C9AA 5F5IA 2BNNA 5AC92 5C8WA 2ENRA 4DXRA 1RC6A 1JMUB 4JZRA 1VMFA 1CX4A 3IMMA 2ZEZA 2XJSA 2RM21 2YPJA 4Q0PA 4YW7A 5DDJ3 1AYN3 4M3CB 1HLCA 1Z7S2 4HANA 3UESA 1WLTA 1GANA 2W5FA 4K7JA 1CX1A 1RJ7A 5I0RA 1Z0HA 4AQ2A 1CGPA 2HWF2 1OOPA 1NE4A 1QH6A 1WW4A 3LD8A 5BPXA 3WT3A 5C5UA 4H14A 4UYBA 1XNBA 2IXKA 1ENQA 4KH9A 2YB7A 1OQ1A 1YYNA 2P3IA 4AVCA 4KG0A 1OA3A 4XBQA 2VQ0A 2EF6A 3M4FA 4HONA 2GP5A 4N8MA 4QKFA 5HXMA 1OBNA 4FOWA 3FZ3A 4I3GA 4AFCA 1PGSA 3ITQA 3E97A 5FP4A 2JD4A 4P14A 3UETA 2LTNA 2ZEXA 5GZDA 3VBHC 3WP3A 5LBCA 3ZDSA 5HV0A 5KHHA 1SLAA 4AVTA 3JBG3 1OOPB 3M8LA 2WC2A 2Y6GA 3Q9OA 5FY0A 3UK9A 2JIJA 4RGKA 4GZ9A 3BUCA 5EIYB 1U5YA 1XU1A 2MEV2 2WNOA 4WVMA 2RS31 3WV6A 5ACA1 1H8VA 2D6MA 1DQ2A 3RJ2X 2DCTA 5JI7A 2WO3A 4JTNA 3VBFA 2IXLA 4IUGA 5I0TA 4LBOA 5KXCA 1RUC3 2RR11 3H1MA 1UYZA 1OPMA 3THPA 4RR3C 1J59A 5BNNA 3RFRA 5FK7A 2ARAA 3DYOA 5DMYA 2YFZA 4CEWA 3O1OA 3T30A 1O4TA 1W8TA 4OI2A 3Q8AA 4XDOA 4E8DA 1XRUA 3PMEA 3VD4A 1RUG2 5IK4A 2HEWF 4WVMB 2K0GA 2HWB2 4P9IA 2HBUA 4RN5A 5FY4A 1D4M2 4OI0A 2W52A 2ZGNA 3R4UA 3RMXA 1LOEA 4YRDA 1REDA 1XYPA 5I8TA 4QQOA 3LZZA 3WDXA 4AI1A 1RB8G 2DVAA 4D6SA 5CBLA 4GIQA 4XF4A 4LTAA 1I6XA 2VVFA 5BYNA 1OFSA 1JOJA 2EIBA 4XAAA 5IATA 3SCFA 1V9U3 4KGQA 5FWEA 1PO11 3AZZA 3NW4A 1X50A 2WT0A 1OI6A 1Q8PA 5IK5A 4Q4X3 4QHZA 3I2GA 1G9CA 1C8M3 1ENXA 1OKOA 1HRV1 2WJSA 3OBAA 1H2LA 1A8DA 3L9JT 2VC9A 4Y1UA 4FP3A 4R8HA 3TN93 1WMEA 1H2NA 3LDBA 1HV0A 3WDWA 4IETA 3I2HA 2E6VA 4H7MA 3GZTB 5IVVA 1WLDA 5DZGA 2WO1A 1OUXA 3WUDA 1A34A 5F3IA 1RUE2 4IE7A 3WG2A 1I1EA 3LKJA 3OEBA 4JQRA 2VZ1A 4GH4C 1PK6A 1RVF1 3E5QA 4NHKA 4XF3A 3SNMA 1L7QA 2RMU2 4EJRA 1JYVA 2Y0OA 4M3CF 2VW0A 5DN2A 3TEZA 1O3TA 3NNFA 3K77A 4QQLA 1DG6A 2YC4A 1E5HA 3PU3A 2DFCA 4Q2FA 1BK1A 2QDRA 1OHFA 4TLFA 5C3SA 3AJZA 4NHLA 2ZHNA 4CCLA 4XURA 3ZXDA 4ZXKA 3RQ0A 1QJZA 1LHUA 4CYDA 5CYYA 1PK6B 3IMNA 1W8HA 4Q5OA 2X5IA 3ZYFA 3DKQA 4HMZA 4X8NA 4B8EA 3HN1A 2FDHA 1NE6A 2WZ8A 1YIFA 2VAUA 2Z79A 3ZYBA 1QJX1 3RS6A 1TEIA 2GH2A 3H1WA 3VD7A 3UGGA 3KF3A 1GNZA 3MLLA 4S2GA 3TYJA 2P1BA 4GA9A 1N47A 1K3IA 3ZFFA 5BNPA 2Y33A 3M1HA 1L7LA 1BEV2 1HIXA 3ORJA 3LB9A 2QNKA 2IXJA 2RDNA 1V6IA 2WUHA 2YU2A 1HB1A 3IDCB 3JQWA 1CD3G 2VMFA 3N7JA 3POWA 5FAXA 1UZWA 1XC6A 2ZABA 3EMRA 4LLOA 3SCGA 1RIRA 1Y9QA 4FAGA 4Z8BA 2V4AA 4W6XA 4V1PA 1GLHA 4L99A 1O91A 1MS0A 4CDUA 1FMD3 1X7NA 1AXYA 2LW8A 4H55A 1CZTA 5JAXA 5J48A 1RUI3 3N9QA 2Z42A 3ZFFB 3H0OA 1IOAA 1D0HA 5FDBA 3JQXA 3AKRA 2ZHMA 3OSDA 3KF5A 4HL0A 1OLQA 4WM8B 3BTYA 4MZUA 5KXEA 3GBFA 2MHFA 5A6ZA 5C9AB 1CZVA 1F2NA 1BYHA 1HRI2 4YGEA 5ABJA 5LRSA 1AYM1 2WFF3 1N1SA 4AYUA 5JXGA 3GF6A 2EXHA 4ZPIA 4CDUB 1DYOA 4CDWA 1PX4A 2Y34A 3FE5A 3HOBA 4Z92B 5FZ9A 1M06G 3HQRA 3MIHA 4CCMA 2VBDA 2O8OA 3DXUA 3USUB 1FPN1 3MICA 1IQDC 5A1LA 1KDMA 2VW2A 1C5HA 2JG8C 3AMNA 1MS3A 4CEYC 5L36A 1ULCA 5LCWL 4LBQD 1ASJ3 4Q4W2 4BQ1A 3ACIA 4MH0E 4QXCA 5ABJB 4LHKA 4RL7A 4YVSC 3RPQA 4CDWB 2HWE2 2ZKLA 2VM9A 4AI9A 2EIGA 3GZEA 1AR62 3OTFA 2D43A 4AVBA 3OBTA 5F3CA 3IIIA 2PHUA 3CJIA 5LBBA 4W8JA 4ZZ8A 4A6OA 1T6GC 4QPWA 4RSUA 3JU9A 3ZFEB 5FR3A 4BJ0A 3UKVA 2HWD2 3AKSA 4BXSV 2QQNA 4AHWA 3VD3A 1RUC1 5BNOA 2C1FA 1WW7A 1POV3 4WM7C 2JENA 1QMJA 2A6VA 3OBZA 1QQP3 5IT6A 3WDYA 1J58A 2NMNA 3WG3A 1C5IA 2WS93 5HBAA 2ZS6B 4Y5Z0 3ETPA 4QGMA 2XXZA 1PVC3 2VZSA 4K3UA 1FXZA 1PNFA 3N4MA 2ZPXA 4UOJA 2VOWA 2VNOA 5FZFA 2R30A 5I0DA 1DZQA 3B01A 2GC0A 1GZWA 1PM7A 1HN0A 1EP0A 4MGKE 4PDWC 5F32A 3ELNA 1OC1A 3MZHA 5A7SA 1RYYA 3KGLA 2A75A 1R081 4GMP0 5C3QA 3VD5A 4CTEA 1AHSA 1VBA3 4JQTA 1JTZX 2OXBA 4FPKA 2B39A 5JSRA 4PBPA 2G9ZA 4UBHA 2GSYA 1K12A 3SH5A 4K1ZA 3I97A 1S1AA 4YFZA 1VBD1 4ET7A 3BI3A 1NA1C 4XQDA 4L2NA 2D5FA 4YG6A 4C1WA 5FJHA 3KCYA 1C8M1 4MXVA 2IWGB 3GHNA 5LA2A 4HVRA 3VHOA 4YZ5A 1EYBA 2FDJA 3TN91 3WW4A 1CAVA 5JDBA 5EP9A 2R071 3A22A 1O8PA 3O1VA 4LA2A 2JDNA 4Y3OA 4CDQA 1S0JA 3H8OA 1O7FA 1URXA 3NAPA 1HB3A 1JHJA 4XACA 4GJYA 5C4WC 1RITA 3RYKA 5FYSA 2ETEA 4A3ZA 3J8F1 2K2SA 1UIJA 3P5BA 2BBAA 3M3QA 4NPLA 1RHI3 1TMF2 1K5JA 1R1ZA 2VQUA 4PIXA 1ND2C 1C57A 4HK8A 1FOD2 4DQAA 1RMU2 4L11A 1GOGA 2BQPA 5DZFA 1IPSA 1B35A 3AP4A 4NWWA 1WD4A 4N53C 1AR93 2JECA 1W8WA 4CDQB 3AKTA 1KFXL 3PIJA 4QWNA 4MGZE 1Y9MA 1OLME 2D6LX 2V5YA 1QWRA 4OYUA 3AXEA 3KGZA 2ZHKA 5LW9A 3AZWA 1RUJ1 5FK8A 2WDBA 1RUF2 3ATGA 3OGRA 1DQ0A 4LOSA 4YLZA 4CE8A 2ID4A 3KV4A 1COV2 4QPGA 4XUTA 5CKQA 2DVGA 2Q5TA 2D3RA 4W6WA 1DYPA 1WD3A 4DXZA 4EV0A 4QQ2A 4Q8KA 1LRHA 3UKTA 5FZ0A 1GOFA 5C5TA 1LODA 1V6OA 4CDXB 4AVVA 1S0FA 1TE1B 4AVAA 4E4DX 4LO4B 1W0PA 1O5UA 4MHUA 4AFAA 2W9XA 4AG4A 1O59A 3SCHA 3BPZA 3AL6A 2VD7A 4Y4YA 4ES9A 1LECA 2CSGA 2WKKA 1ZVFA 1W8FA 2OIIA 4GJZA 4YVWC 1FMD1 1H2KA 4BK5A 3OF1A 1ULGA 1VE0A 2FBEA 4QGLA 1NAEA 4RHV1 2WNUA 3I2DA 4AZZA 4FPEA 1YRZA 4LHLA 1IS4A 1FAYA 2PN5A 2XBO2 4Y4RA 5FP7A 2O0OA 3UGHA 2P5BA 5CEHA 4IXLA 2J42A 5KBFA 1ND3C 1QJFA 2CYFA 4EN8B 3LFMA 2XONA 4UFIA 3VBUA 3DYPA 3PNAA 4KMQA 2WQ8A 3ZKUA 2C0ZA 1XSQA 3QBQA 4IEPA 1PHMA 1GICA 4PF5A 4LEJA 3WD5A 2FZ1A 5FYYA 2HWC1 2VBPA 2R042 2WNUB 4CP1A 5FPVA 4RS5A 4UFKA 5H9RA 2YC2A 4YZ2A 1LKNA 4AXOA 4BK4A 4CXXA 4M01A 2WABA 1F5JA 3R0RA 3I2FA 4BH9A 4O7XA 4YARA 5CAZA 5HI0A 3O1SA 1JOPA 3VBUB 1Q43A 1VRH3 1OOPC 3AFGA 2Q8OA 1NYWA 5IWFA 4NMIA 1GZ9A 3VDAA 1SCRA 4BU2A 2ZACA 4QX1A 3R4SA 3D82A 4QXHA 5GZFA 1J3RA 1T6BX 4BOWA 1MZFA 2QCSB 4ASLA 4ASKA 5CKNA 2G4IA 3MPBA 5DAVA 3A23A 4CVUA 3DF0A 1DQ6A 4Q0VA 4RS5B 4OI1A 4COVA 1UYYA 3VL8A 4X6QB 2ZZQA 5IAVA 4Q4Y1 3BB6A 4IGPA 1HXS1 3J4UH 2IZWA 4MGIE 5TSWA 1M4WA 5KXDA 2PHXA 2ZMNA 4LO7A 3IM0A 1BBT2 4IV1A 4OUSA 2IFWA 3S7EA 3WP4A 2LALA 2WR9A 1QQP1 1SLLA 4A7ZA 4DEQA 4EE2A 1YIPA 4FFIA 4NJ4A 1NCRA 1ZBA2 4QB1A 4CRQA 2YMZA 2QQLA 1PIV3 1W2NA 3JD71 1UQXA 4EN6B 2Y60A 3VBFC 1GNHA 3DN7A 1WMFA 2W0XA 1SLTA 3H3LA 3K48A 1UAIA 4GH4B 5SV5A 5KR7A 1VLNA 4LULA 5BNNC 5JOXA 3WSOA 4CEWC 4XJWA 4DFSA 1C28A 2EIDA 3GDBA 4IV1B 1FT9A 1IPJA 4UFHA 5FXWA 1G9FA 1S0GA 2XLGA 3OPTA 5FZ1A 5FY9A 3HBZA 1JYCA 4AW7A 1YQ5A 2VOTA 3W21A 3O7OA 1W04A 4QB6A 1GR3A 5GZEA 5I8SA 3WR0A 3UT0A 3ON7A 5KHJA 3DECA 1LHVA 1LGBA 3PUAA 4CCNA 3AYAA 1NUKA 2VOKA 3AP5A 2BPA2 2XVLA 4HLTA 1UKGA 5FP9A 3GYDA 3KCCA 1WKYA 3OY8A 4F3JA 1AXKA 5FPAA 2BYVE 1EUTA 3HQXA 4AEDA 3U1XA 4MXWA 3O12A 1X33A 4HG6B 2WT1A 4UXAA 3VLBB 2O1QA 4C90A 1TNRA 3DV8A 5LA1A 3K3OA 4NROA 4A45A 1E57A 2A70A 4JKLA 1TME3 2R6QA 4ONUA 3K51A 4B1MA 3TAYA 1HX6A 1W9SA 4HT1T 1QY4A 3H7JA 4LE4A 5HCAA 4DXTA 1DGRN 4HN1A 1PM4A 2D5HA 1W0NA 1W6OA 3NJYA 1MS9A 5E88A 3OY8B 2X29A 3INAA 3KQRA 1VJ2A 3K2OA 4I0BA 5F5QA 3KM5A 4K8RB 5FYHA 3AB0A 3ACGA 5DUVA 4PIYA 2YPDA 4MXWB 3WNPA 1PK6C 4AEDB 4DS0A 1IQAA 2VMHA 3ES4A 4MGQA 4NE9A 4XJ8A 3TNPB 1R1A3 4AAPA 2GMMA 3ABZA 3HD8B 1HQLA 4HXCA 1UF2C 1E5SA 3A4UA 2QQWA 3WNKA 4AL9A 4Z2AA 1JODA 2VH9A 4J1WA 2VOVA 1A6CA 1AR81 1X36A 2VQAA 1EAH2 1EPWA 1CAUA 4UW6A 1UOJA 1UPSA 1V6KA 3WG4A 1XBFA 1OPOA 1ZZCA 5FYTA 1QJU2 3R6SA 5K0UA 1DQ1A 4D0QA 4EZHA 1DLLA 3CDZB 1ULFA 3VKFC 3ROUA 1LU1A 2D6PA 4CEYB 5FOJB 2FD8A 2XGXA 3U07A 3ZFFC 1WW5A 3S5AA 5BNPC 2D93A 3NJVA 1PO22 5J36A 3ACFA 1OMIA 2WYSA 1ZRRA 1ZA4A 1RUH2 2JDZA 5JR2A 3FBYA 3RZLA 3N3HA 4URAA 5C9AC 1K42A 2GMEA 1VBB3 1QOSA 1UYPA 2RS53 2WT2A 2W3JA 4AGRA 2IVIB 3L2YA 2WBKA 4IE4A 3IWZA 4UFLA 3FMGA 4CDUC 2XVKA 1YFYA 1UZYA 3EYPA 4OHYA 1JBCA 4XJAA 3MFCA 3F2ZA 1BKZA 4AVSA 4K40A 4AGVA 1ZZ9A 1MVQA 2XHNA 3GNEA 1LJ7A 3HJRA 1G8WA 1MEC3 4DXSA 2GAUA 3IPVA 3WLUA 4AQSA 5FZ3A 3AC0A 1OLRA 4BCUA 5EFUA 4BHPA 1V70A 1XSRA 1XPWA 2JG9A 2RS11 2XJRA 4ITCA 2ADDA 5FP8A 4CP2A 2RM22 4XHXA 4DUVA 1VRH1 4P08A 5FZGA 3BVCA 4PDWB 4CDWC 2X05A 1XB9A 2DVDA 2PLV1 3KZ4C 1ZRDA 4EZ4A 2ZA9A 2OQ7A 5D8AB 4D6RA 1JUIA 2JDHA 1Y9GA 4LITA 1FI2A 5FYZA 5IFTA 1ZZ8A 2Q0AA 5A3LA 5JZGA 3N9OA 3THDA 3NQHA 2UWCA 1QHDA 1STMA 2BP6A 4GQ7A 1QF3A 3D6EA 5FYMA 1JZ6A 5KHGA 1NLRA 3AMMA 3PUSA 4XQWA 5G04L 4MLOA 1W3VA 3O5SA 3N36A 4Y26A 2J1AA 2SBAA 2WQZC 2FCUA 3WF0A 3TWIA 4PF1A 4WVVA 1JYNA 1I3HA 1VR3A 1H4HA 3FC0A 1SBDA 2QFEA 3ZYJB 2QQUA 1EV13 3CJIC 4M00A 3N9PA 3ZMOA 3TEYA 2D7FA 1W8UA 4MHRA 5JZGB 3T1LA 1W6PB 2RS32 5ACA2 4YM2A 5JSOA 3PUIA 5BNOC 3C7GA 2D6KA 3ILFA 4XF0A 3RRDA 2GALA 3T2PA 5FOBB 2PQSA 2XHKA 2YBSA 3KB5A 4FPCA 3VHPA 3NV2A 2ZGLA 1SBEA 1UU5A 2WO7A 3AYCA 1GZTA 1U12A 4JVAA 3NNJA 4XEZA 4ES8A 1C8NA 3I3DA 3MLJA 2XVGA 2W95A 4DY5A 4R9CA 3GJBA 4IESA 4DINB 5DUWA 2E51A 2B4KA 2VUAA 4M4PA 4XFGA 1K5MA 2UY9A 3PLQA 2HWF3 3ZXEA 2PHRA 4FBFA 1H9PA 1MR5A 4LO8A 3WHTA 3VZLA 4XXPA 4DNYA 3ZN6A 3H50A 2UURA 2BJSA 1PO12 4NOTA 4O65A 1JYTA 1UZ0A 2VMIA 4UF0A 4AR2A 4OHVA 4XETA 4Y5SA 5LK5A 3ZYHA 2TNFA 4XFIA 2WWSA 2WQ4A 4YZ3A 1D7PM 1ALYA 1HRV2 1OSGA 4OVEA 5CZKA 5F2WA 4CCCA 4CDQC 2QTWB 1P8JA 3S0MA 2DWRA 3AXDA 3LOBA 2VE1A 4B4PA 2BWCA 2XJQA 5JPMB 1MS5A 2MEV3 3NV3A 1O6UA 4Y5TA 3ZN6B 1YQ2A 1MACA 3FX3A 3ZR6A 2RDQA 4IE5A 4UF0B 2Y6KA 4Y22A 2WWJA 1RVF2 3M3OA 4ZS3A 2QQOA 4M0HA 5BY5A 3WNLA 2H0BA 2OKXA 1ND3B 1FV3A 3I8TA 3KMHA 5I0UA 5LB6A 1B35C 2E9QA 2GN7A 3GJAA 4CU9A 5JSPA 1JZ3A 2OQ6A 3HN3A 4ZS2A 2VL4A 3NVCA 4CDXC 4XIKA 1OF4A 3BCWA 4ZU7A 5C70A 1RUG3 1RUOA 1BMV2 5EJ1B 2VCBA 1ZRIA 1DZTA 3LCPA 2HWB3 3C3VA 4M3CE 4NIIA 3ZXAC 5J37A 3BN6A 5IAXA 1CPNA 1D4M3 2WINB 4KWUA 2CGPA 3CNAA 2DCYA 4DB5A 1FNZA 5B4XA 2BTVC 2D44A 3DGTA 4NAMA 4QPGC 4A2UA 3TNQA 5CG9A 1MPXA 4NHYA 1QJX2 2B9VA 1GQHA 3E6BA 1AX1A 4GWIA 4PT6A 2KM2A 3BU7A 4YW2A 4UAPA 4HKOA 1QOTA 2BWAA 4NO4A 3M7AA 4FPGA 1UX7A 2ARXA 3HNBM 3MHZA 1S2KA 3U4SA 4E4HA 4AEJA 2HLEA 3AK0A 2BUKA 2JD9A 3U78A 3AMPA 1W8ZA 3USSA 2QQMA 4I2OA 1RXGA 1SBFA 4XXAA 5LY2A 5A1AA 3D3AA 4QHBA 5F2SA 1W6NA 1SEFA 4OMDA 5EXOA 4DO0A 1CZSA 5SV8A 4DUXA 4QDRA 3QD6A 5E8AA 2GDFA 2WNUC 5JXJA 1AX2A 3NO8A 1LB2A 1X82A 4D94A 2XJUA 2C24A 2Q30A 1RUE3 3OB8A 4NPMA 2RMU3 4L9BA 3VBUC 1SPPA 3NNMA 4XZUG 3WQ0A 3LDKA 5FYBA 4IE0A 3VBFB 1KS5A 1VBE2 3ACHA 4FTSA 3KT4A 3C7OA 1RUD1 2PQQA 3GGLA 1JZ8A 4TYSA 1UY3A 4YW6A 1DQ5A 1W6NB 1AYM2 4K8FA 1GUIA 5BNNB 2ZEWA 3IZOA 2J7MA 3ZIWA 4LORA 4COYA 5GLWA 4LPLA 4CEWB 1HN1A 1AX0A 5KC5A 5DXDA 2PYTA 4OQ9A 2HH9A 5FLIA 3MW2A 5FZ4A 1KXGA 4RS5C 3WY6A 3FLRA 1PZ8A 2ATFA 3MDPA 4QXBA 2WZR1 1MVEA 3E5UA 3VHNA 3FBMA 1UU6A 1QDOA 1FPN2 3WW2A 4Z1VA 3CIHA 2DBIA 1SPPB 3JZVA 2RE9A 1NX9A 2DTYA 2R49A 5I93A 3B7MA 4E2SA 2RDSA 1YFUA 3ILRA 3KD4A 1K45A 1IG0A 5FFOC 4YYOA 1ZBE1 3VBRA 4OHWA 1NXD1 3VZKA 4GWNA 1CR7A 1UXXX 4IEOA 3E6CC 4OI4A 5T3NA 3OUJA 1Q8SA 1BEV3 1XJAA 5C3PA 2EXIA 1OA4A 1AF9A 3POYA 4QXKA 4GMP3 1QJEA 4BIOA 3CBNA 4QKNA 2VUCA 4IV1C 5FUPA 2P6CA 5FKCA 3FHQA 3C2UA 1R091 1RUC2 3IKWA 1KITA 2JE8A 1LHOA 2QKDA 5L19A 2PHFA 1HJGA 5FXVA 5CISA 2ZOEB 3OPWA 3AZXA 3T2QA 2DTWA 1QXPA 2MPFA 3J7LA 3MF6A 1OA2A 4LIVA 4LUMA 3I3EA 1O5LA 5DG2A 3OYWA 3ZPOA 3GCXA 2V72A 4PQQA 5FO9B 1PGW1 1XNDA 1N1YA 1WBLA 2R061 4LUKA 5JXIA 5F5CA 1GBGA 1HRI3 1QU0A 4D3WA 5I0SA 1W2OA 2DVFA 1R082 1DGWX 4QKBA 4H2AA 2H6BA 2XWJB 4MUVA 2JKBA 3RSJA 3POEA 5CVRA 1DU3D 2VNVA 4QDSA 3E1F1 4SBVA 2OYZA 1OXCA 3NJZA 2GC1A 2W91A 1VBD2 4AE2A 4BQ2A 3OYWB 4SLIA 1J84A 3E6DA 1WCQA 4TN7A 4XFCA 1YFWA 3K3NA 2X5IB 4QAWA 3WOGA 4P02B 2ZGPA 4LT5A 3H9AA 4Q4W3 5LA0A 1F9KA 2W1SA 3UJQA 4GKXA 4WVZA 5L9VA 4XBNA 2RHPA 3VGIA 3ZSKA 3CEWA 3MV11 4AEDC 1FNYA 1YI7A 2HWE3 1LOFA 4BQWA 2R072 2RJ2A 4BE3A 5IYYA 5BNPB 3JB4C 4QX5A 1RL3A 3I4IA 1AR63 1BXHA 2DCZA 2DU1A 5EHDA 4BISA 4FPOB 5A33A 2XPJA 1HQWA 1U5XA 4GULA 3N35A 1UD1A 3DUIA 3J8F2 2HWD3 5DDJ1 1AYN1 2XLAA 3FUQA 4IGOA 2ZX4A 2BOJA 4QX7A 4XFHA 4MOAA 4MVTA 4PI2A 1U5ZA 1MS4A 4GWMA 2WA3A 1CJDA 5T5PA 3ETQA 3SC7X 1W8OA 2HKXA 2G19A 3AZVA 3U37A 4A3XA 5IFPA 4I02A 5FPBA 5FMCA 1D4M1 2RDRA 2CL2A 4N9IA 3VBSA 4ZZ5A 4NIHA 2GU9A 2ORZA 4P9GA 2ZEYA 2VXRA 3OGJA 4NRPA 2VCMA 1RUJ2 3GALA 5AFEA 2IVJA 1F35A 3JBG1 4CPBA 3KV5A 1PMHX 2TBVA 4QPIA 4D7TA 5K0UC 2AEYA 2VZTA 3PUQA 3K4ZA 3PIGA 4M0NA 2WYFA 2X53S 4INDA 4A7KA 1H8TA 3AMQA 1DGLA 3I3BA 2TUNA 3IIAA 4A44A 4BA6A 3AP7A 2ET7A 3OOXA 2GC2A 4Q26A 5FMBA 3ZYRA 3AYDA 3VBSB 4FFFA 4G9SB 1F31A 1NLQA 4TTGA 4ATEA 3BTZA 3RWKX 1GMMA 2AEZA 1S4CA 2NMOA 4HK9A 4LR4A 3LEIA 2GZWA 1FMD2 3MW3A 4NN0A 3G6JB 3WEZA 4Z2WA 3IB3A 3SH3A 1GV9A 4JX0A 2VQTA 1RUE1 3APBA 3NSTA 4RHV2 4WZFA 4V2VA 5H9PA 1GWLA 3CJIB 4UW4A 1H8TB 5FXZA 4FXGB 2BNOA 1YUDA 1TMF3 3KCXA 1H4GA 2W1UA 4QX0A 5FUIA 5BNOB 1KEXA 5D8AC 2DCJA 4PLOA 1FOD3 3BODA 1RMU3 3LA2A 5A3OA 5T50A 1V9U1 2Q1MA 3DYMA 3VKNA 1N1VA 2OPKA 5JIUA 1AL22 2RJLA 1YFXA 3ZXKA 2YGLA 2ZX2A 5JMCA 1XE8A 2CY6A 2JG9C 3AYEA 4XZPA 5IVBA 2HWC2 1DDLA 2XLFA 4Q4X1 1XQNA 2BBVA 1KGYA 1JS9A 4W6YA 1GZWB 3POIA 4YWAA 4D8MA 3NRUA 4JV4A 4QDQA 1RUF3 4XCAA 5FZMA 2VOXA 4MYEA 1LAJA 2C9AA 4C0BA 5A6YA 2GNBA 3LEKA 1UN1A 1V00A 1LTEA 1SLIA 4Q1RA 4XABA 1X9TA 5JZGC 4AEMA 1UX6A 3KV9A 3S5QA 4N7IA 1CAXA 1D2SA 2HEVF 3LQCA 5HV4A 3BPSA 5T5LA 1JXNA 5A7PA 3J26N 4EQVA 1KJRA 2R1DA 2YDEA 3AKPA 4Q4Y2 4JDMA 5CIRA 3WZ1A 2LRPA 5GZCA 1HXS2 2D3PA 1OLMA 3SEEA 1N3PA 1CAVB 4LHNA 2PHWA 1G86A 1VB4A 2BNMA 1DIWA 3O1PA 5GALA 2A6WA 4U36A 4KGGA 4JHTA 1GP6A 2W1WA 1Y43B 2VBBA 3NAPB 1W06A 3MYXA 3POJA 1D0GA 3K4AA 4S2DA 5DPNA 1CAXB 5GLUA 3ZXGA 4CU6A 4FTBA 3VZNA 3FFZA 3JD72 3O0VA 2Y26A 4CP9A 1BZWA 1W03A 1NOVA 3GM8A 4FO9A 4A42A 1WMDA 2XWBB 4YPJA 2MNGA 1LGCA 3ALQA 4RD7A 3MLKA 4Y20A 2CV6A 5EYYA 3B93A 3MFAA 3HNMA 1WZXA 2C26A 1B35B 5FRAA 5FPXA 2WSVA 1SMVA 2R043 5EYXA 1VBC3 1O8SA 1LOAA 2B46X 3H7YA 3POSA 4K9SA 4UFJA 3TB0A 3AMHA 4E2QA 1G7YA 2P3JA 3NWKA 5CNAA 4YG0A 2JB4A 4WBBA 1K5MC 3ZSLA 1DQ4A 4XUQA 5FZDA 5FYCA 2Y38A 1LCLA 3RWNA 4Y24A 1SFPA 2L9LA 2GNTA 5L9RA 4QPGB 4PJYA 2VZPA 4Y20B 1RUI1 4LBJA 3GZUC 4K21A 4YM1A 5D1IA 1LEDA 5DAXA 4C91A 2VO5A 2WA4A 4COWA 3AL5A 4GD4A 3ACLA 1ODNA 2SLIA 1H9WA 4QQPA 5FCCA 2BVVA 4G4FA 4B3NA 4XQ4A 5T55A 4JCKA 1WA4A 3ZFGA 4BQYA 2PAEA 4XJZA 2HWD1 1S0IA 1AZDA 4HPKA 3G7DA 2J1SA 3LWCA 2WFF1 4FOQA 5BXXA 4BQ5A 4BMEA 1BBT3 3B9IA 4HVOA 4FTEA 2RV9A 5LBEA 3LIHA 3QLQA 1YNAA 4AHXA 2XOMA 1VAVA 5FBZA 1ENSA 3AM2A 2A3XA 5LK7B 1ZNPA 3TEWA 1ZBA3 5GM0A 4HKWA 1LNSA 5L73A 1KRIA 1EY2A 1YXWA 2W08A 1W9WA 2W94A 5FUNA 1IKPA 4AF9A 2CGOA 2VMGA 1Y7BA 1A8MA 1SFYA 1YQ8A 4KNCA 2WLQA 4LO6B 5FZEA 1QJY2 4YM3A 2NZ9A 1ASJ1 3DCQA 4BMBA 4NWVA 1JU4A 3GXUA 3VHRA 1CVNA 1ZA7A 3ZSMA 4IV3A 4DRRA 4LKSA 4Y1XA 5H9SA 4QX8A 3WHUA 1AR82 2VULA 5DQ0A 4XJ9A 1Y3TA 3O0XA 5E1RA 5F9TA 1UZVA 3W58A 4I0WB 1ZM1A 4OLLA 3EXUA 3D5OA 3VZJA 1PGL1 3OBRA 4COZA 3K75B 2VZQA 4P5HA 5KHKA 4LIUA 1NY71 4AI3A 2XR4A 5FPUA 1BLZA 5J3UA 2H6CA 3ZX7A 1CWPA 5A7QA 3I2OA 2JXAA 1C3HA 3RI9A 1CAWA 1B09A 2E7TA 3AKQA 5AFBA 4XCBA 2YV8A 1POV1 1X8MA 5D21A 4KG8A 3PTYA 2UWBA 2B42B 3PJYA 2J1RA 2WS91 4PHZA 3U10A 1H30A 2NQYA 1PVC1 3LPGA 1OVSA 1ZYBA 2CU5A 2DCKA 2R0HA 1PZ9A 4FPJA 2I45A 1NZCA 4CZSA 1TMF1 5LY1A 2A3YA 2LS6A 4OHXA 4FSJA 2R32A 3MGUA 1VBA1 2QQVA 1RTVA 1RMU1 3AP6A 5FZAA 2Z5WA 4HETA 3AJYA 3Q8BA 4IDZA 1NCRB 2ZMKA 1BCXA 3SH4A 1XE0A 3GZAA 3IDBB 3CLPA 4TLGA 2OS2A 4GB32 1AR72 5BUVA 3ZYGA 5EJ3A 1UMZA 2F6BA 4EWEA 1SG3A 1KDKA 2A6XA 2RS12 3KWVA 2XKOA 1RUF1 4IE6A 2CNAA 4MGSA 2R0FA 4L92A 4ASMB 3K46A 3LAGA 5FMDA 2PLV2 4LBLA 4Y1VA 4AAXA 3UGFA 1FV2A 1S2EA 2ZX0A 1IG3A 1UWWA 4YW5A 3NKTA 2DF7A 1J3QA 4LO5B 4XMAA 3POGA 4ZONA 3PVBB 1QXJA 5KC6A 5LWBA 1XNKA 2YC0A 1NT0A 1RHI1 4LMFA 3URFA 4FQZA 2CDOA 4Q0QA 2WN2A 2JE9A 4IEUA 4COUA 1WCKA 4JAAA 4E9KA 1DYKA 5F6KA 3VBOA 2VZRA 2P17A 3SMHA 2CAVA 1PO23 4A7YA 4E27A 5T5OA 1AR91 3HNYM 4PQ9A 2E33A 4NHXA 2YU1A 5K7PA 3FHAA 1JZ5A 1W3XA 1W8NA 5DAPA 2WRAA 3MBWA 2QZ2A 3QOPA 5GLTA 1SDDB 3FWEA 4R4XA 2VMDA 4B7EA 4HKLA 3L2HA 3PVOA 3BIWE 2CWMA 5DG1A 4A6SA 4CP0A 1CIYA 4EN9B 1VAKA 2ERFA 2FZ2A 1KJLA 2D6OX 1W6OB 2WLPA 1GWKA 3VBOB 5C6CA 2Z4FA 1WA6X 4AQTA 2AH2A 1OD3A 2EXJA 2BZDA 3RYRA 2ZCWA 2YG0A 2VGDA 2K9ZA 2JX9A 1VBC1 4MADA 2X5IC 1REEA 4B4QA 2VVEA 3WP5A 1UNBA 4XMIA 2WSUA 5GLZA 2RM23 3ME2A 4F7ZA 4Q1PA 3P3PA 3SISA 4MG2A 2J1EA 2ZAHA 4BIFA 2VNRA 4OZXA 3KVBA 4QD2A 1JH5A 3CL1A 1AUYA 4Y33A 3RZJA 1CAUB 4D69A 2AACA 3U4XA 5DAQA 4XC9A 4PLNA 4WVWA 2CAUA 4EWAA 5K0UB 2ZBJA 3RVHA 3I2IA 3LFIA 1D4VB 5EJZB 2BDRA 3LF7A 3ZM8A 3ZKYA 4JKMA 2PTMA 1BBT1 1GFF2 3VB9A 3VKLA 2Y0IA 3EHKA 4ZY9A 3GCWA 1ONAA 5GZGA 4CUGA 2YROA 2GMPA 2ARCA 1GZCA 2PHLA 3PURA 2JDKA 1SQ4A 5JR7B 1VALA 4JRAA 4GKYA 1XNAA 1VMHA 5JPNB 2JJ6A 2WNVA 1FATA 2EALA 2ZZJA 2V5DA 4N43A 1BVVA 4N90A 4RA0A 5FZHA 3H8XA 4XF9A 1NQDA 1YQCA 5IVYA 3ZN5A 5IVCA 1D2QA 4YGDA 5EZWA 3ZIXA 1LOGA 1LHNA 3VZOA 2CWSA 3A7QA 2VMCA 5L7OA 1V6MA 4LA3A 5DUUA 5KXBA 4XW3A 1F15A 3IPVB 5DUXA 3WP6A 3T0DA 4K1YA 4HSLA 3VBSC 4OZOA 2JG9B 5IJRA 4N43B 4DZGA 5C8CA 4Q4V3 4AFMA 1ULPA 3DPRA 3Q8CA 1Q8QA 4HSJA 5FQ0A 4S2FA 3WX5A 3U11A 4QPIC 1DCSA 4PIZA 1ULEA 2ES3A 2X8KA 4TXWA 2K46A 1TNFA 4FFGA 3EO6A 2FMYA 2QE3A 2XUMA 2I07B 2WAOA 1V6LA 1H8TC 3RMYA 1PIV1 2DBNA 4OHZA 2HJIA 3WNOA 3HQUA 5J98B 1JZ2A 2FDKA 5CB7A 4FAHA 3KHCA 5LBFA 4C0HA 1E5RA 4KBZA 1IHMA 1XNTA 1UYXA 2EICA 5CFCA 5C8CB 5CFDA 3FHIB 3SKVA 3DPRB 2FDFA 1HRV3 3MEPA 4WV8A 4XFBA 3AVRA 4MX3A 1ZX5A 2RR12 5FZCA 3GBWA 1S0CA 4JGZA 4B4RA 1H2MA 1XOYA 5A80A 1IPKA 1V0AA 5C71A 4H3WA 3H1YA 2ZGUA 1W0OA 2DFBA 5AC93 2NP0A 3B02A 2XL9A 4HFSA 1BVP1 4XUNA 4FPLA 4META 3BIEA 2W1QA 2JEMA 5AVAA 1RVF3 3ZXJA 1WMXA 3MW4A 1UOBA 2QDNA 2G1MA 2FCVA 1YLLA 1LHWA 1Z7S3 4FT8A 4IGQA 4P00B 4CPBD 3FN9A 2BW8A 5F37A 3P3NA 1RUD2 2VZ3A 3IAQA 4JGZB 2X09A 1N3OA 2E7AA 2Y6JA 4DRVA 1OURA 2E31A 3BYWA 3CQOA 1OD5A 2N7GA 2VECA 4JGYA 4JTOA 3RNSA 4XPVA 2WZR2 1TME1 3DL3A 4ZKTB 1YO8A 1A3KA 4X6RB 3RI8A 4YW4A 3J7HA 5ANQA 5JWPA 2ZGRA 3SITA 5I91A 2F4LA 3NV4A 3UV9A 1JHNA 1PZ7A 1Q56A 2AENA 1K5MB 3H3ZA 5FZ6A 1QNYA 4YGCA 1C1LA 2KA3A 4UW5A 2OA2A 3NAPC 4IEWA 2KD7A 5JVVA 2P3KA 5F1RA 1HKDA 2OUJA 3TBDA 3KS7A 1ZBE2 1OT5A 3AZYA 4R52A 4DPNA 2OW4A 1VIWB 2E26A 4ISRA 5FZIA 1GKBA 5FMOL 1VPHA 1R1A1 5B4NA 4JC1A 3VD9A 4C8DA 2XJTA 1F5FA 1I5ZA 5KWRA 1MQTA 2J1TA 4J6GA 4KWLA 2XL7A 3VN4A 4M3CA 4NR1A 3EB7A 4QU1A 4CUAA 3MUY1 3OUHA 3N9MA 1OVPA 1GSLA 1QH7A 2RJKA 1R092 2IC1A 2OZJA 1SDWA 2WAAA 2Y6LA 3NV1A 3OUIA 4QM8A 5A7OA 1CJPA 2VZOA 4LK6A 1G9AA 4QX3A 4E4ZA 5GLVA 1OH3A 3B5LB 4Y22B 2XJPA 2GN3A 2ZGMA 1H1AA 2FQPA 5L7OC 1MS8A 4I30A 4XILA 1VBE3 2ZGTA 1PGW2 2R062 1MQTB 4NAOA 3ZYIB 2ZHLA 1AYM3 4ORFA 3TOJA 5FYVA 2Z2SB 2VR4A 3BU0A 3PU8A 5ISLA 1WUVA 4AOCA 1UMHA 4B7KA 2WWUA 5E16A 1YEWA 1POQA 1VBB1 1EUUA 2RS51 3AVSA 4FVVA 4Q8LA 5HCBA 1YC61 1FPN3 5A3WA 2OT7A 1US3A 3N9LA 5EWSA 2ZGQA 1OFNA 1UY0A 5HCHA 4EYUA 5JLVA 1JU3A 1UU4A 2BOIA 4P9JA 2JDYA 3PHMA 2Z69A 1WCDJ 3H8UA 4IW3A 4QKDA 1TVGA 2FHRA 3ECQA 5GJ6A 3OD0A 4FP2A 1BJQA 1DGWA 1ZZBA 4UBGA 1MEC1 3IDEA 5C3RA 2VNGA 4IEVA 4ISQA 4XTPA 1ZREA 1IS5A 4CCKA 3ZFGC 4XIOA 1J3PA 2PHTA 3HBKA 2A71A 3JXSA 5IVJA 1OQEA 4TSVA 4DIQA 2TEPA 5DDJ2 1AYN2 3KT1A 5LZ6A 3AX4A 2IXHA 3KT7A 2UYAA 1AXZA 2VY0A 3H3UA 3SLIA 3ZSEA 2IXCA 3V64A 1YJLA 1NKGA 3MUZ1 4P9LA 4UT5A 3VV1A 3BKZA 2AGSA 3A0NA 5JOZA 4NIGA 3HAGA 4P9YA 3T08A 4IV3C 1UXZA 4Q4V1 1H1MA 4TZDA 3WF1A 3HMYA 1S2BA 4R9BA 4YFWA 3I3QA 4NVPA 1U0AA 2W2IA 5FKBA 1GQPA 3VDDA 1R083 4CU7A 2W92A 3W5MA 4QQHA 2R1BA 5A3PA 3JBG2 1UY2A 3B69A 4AFDA 2UU8A 4XUPA 1EV11 2Q1ZB 3CZJA 1LOCA 3RZGA 2DV9A 1VBD3 3RZKA 1S0EA 1N3QA 2W87A 3RGBA 2JDMA 4AQ6A 3A21A 1GNYA 3AFKA 2QQIA 1DP0A 4YZ4A 5A1FA 5A3NA 3KHBA 1H6YA 3CJXA 3NNGA 3Q8EA 3PL0A 4FPHA 3VDDB 5FYUA 1NCRC 3WF3A 3VBRB 3RJRA 2R073 1TZOA 4MSVA 1O3RA 2D40A 4UFMA 3VKOA 4NIDA 5AC91 4XFFA 4IEZA 5FZOA 3MIGA 2D3SA 1WBFA 5C33A 5CG8A 2A6YA 3PDQA 4NRQA 1C1FA 1W99A 3J8F3 3ZDVA 3ZSJA 2ARBA 4PCRA 2ZJCA 2BRTA 4AFBA 1Z7S1 4W65A 1VP6A 4MGTA 1LENA 3I7DA 3KVAA 4N7UA 4ZU5A 4YG3A 2HWF1 1W9FA 1IGOA 2IXIA 5K9YA 2F17A 1V9U2 4KBBA 1BMV1 3FUOA 2A5ZA 4X8PA 5FO7B 5FZOB 4P9XA 1MZ6A 5BNQA 3QH7A 3LSEA 4MGYE 3T3YA 1ST8A 5JI9A 3WG1A 4FOYA 4Q4X2 5FBJA 3ZVXA 4LQRA 1RXFA 1C8M2 5HXVA 3B00A 2WN3A 4Q27A 1RUJ3 4MV2A 3TN92 2RVAA 4BM8A 1JYWA 2J22A 1VRBA 3IDAA 2Q8DA 3SKJE 1WW6A 2GH8A 1PMJX 1QKQA 2MEV1 2QJVA 5HCFA 1S55A 1OQDA 5FREA 2OUHA 4WM8A 2GC3A 2CHHA 5KHIA 2ZX1A 3UKNA 2WL1A 5FMOS 2PMWB 1RGSA 5FWJA 3N7MA 1W9TA 1HQNA 3VBOC 3WQ1A 2A3WA 4XFAA 2PAKA 1NCQA 2JDUA 3M3IA 3GBGA 2W68A 3OD4A 4BYYA 4FPFA 4L8QA 4IEQA 1UKRA 4B29A 3UNPA 3JCIA 5CADA 3IT8A 3T1MA 5IVFA 1RUG1 3E5XA 4HBNA 2E32A 2VXJA 4RHV3 2D6NA 2HWB1 2PHDA 4CA9A 3USUA 5A33B 5JXHA 4QT6A 2EVXA 4YNIA 1G9DA 5F39A 4ATFA 2B9UA 3WF4A 1VBE1 3RZZA 2PFWA 4Z82A 3U0ZA 5HPOA 4KU7A 1YWKA 4FOVA 5IK7A 1UO9A 3VKMA 2NLRA 4IEXA 1NCQB 4OQ8A 1PX3A 3ZR5A 4CCEA 4D6QA 2RG4A 3WF2A 4F83A 1US2A 4LKFA 2OZ6A 1AL23 1QOOA 1V6JA 1LOBA 1XE7A 4CCJA 3BTXA 2HWC3 1AJOA 4I3PA 4Z07A 5F5AA 1QGLA 4O61A 3ZPYA 1A78A 3HWJA 3ZFEA 5I8YA 5J09A 1W90A 4AHYA 2FDGA 3D8CA 4Q29A 2G9FA 1SFNA 1KFUL 1O4YA 5AVPA 4XHBA 2DDUA 3NL1A 3POBA 3WXPA 4QPIB 5BV6A 3J7MA 1W9YA 5ABJC 3SEPA 4DY3A 5JOYA 4A41A 1RUI2 2AC1A 2ZGKA 2O14A 3TRSB 1AVBA 3T4VA 1ZZ6A 2JKXA 2JICA 3P6BA 3PUHA 3D4KA 4LBMA 2RMU1 4XUOA 4D7SA 3OGSA 2KR2A 1NZIA 5C3OA 1JUHA 4K20A 1S0DA 4YW1A 4RQPA 2B7YA 3WNMA 1S0BA 4Q4Y3 5FPLA 1HXS3 5IW0A 5A32A 2D97A 2WFF2 5JIAA 3NNLA 1UMIA 1NQJA 1LR5A 3W5NA 1SCSA 3MV01 1ZRFA 3KLSA 3UYJA 3WW1A 2WNVC 2OX0A 3O1UA 2QQKA 4N43C 1F4AA 1YHFA 1V6NA 1Y4WA 3ZXFA 4HVQA 2P6HA 3EBRA 2B5HA 2YFUA 2NPIA 3JD73 3LA3A 4JKKA 1DZRA 5K8SA 3VUOA 5J1XA 1IS3A 1GP4A 2FCTA 4RQPB 3M3EA 4AHZA 5FO8B 1H6XA 2E53A 3QACA 2P37A 1ASJ2 2A7AA 2YZ4A 1XYOA 1COV3 2OPWA 1WWYA 3M2MA 4Y1ZA 5A32B 1UW8A 5FTTC 4HZFA 2VUJA 5FXXA 3VDCA 4EN0A 4YZ1A 2HBTA 4LOTA 2XMLA 2DURA 1REFA 3ZYPA 1CQ9A 4O9EA 1PGL2 1F4HA 1QIQA 1BEV1 2BV4A 3R4DB 5FLJA 4PI0A 2V73A 4YW3A 1IS6A 5DZEA 3U14A 5C8CC 2E7QA 1HJFA 5JOWA 1XNCA 3DPRC 1NY72 2C9KA 4GMP1 2AUYA 3F95A 3FFQA 3MIEA 1DFQA 4BPZA 5FYIA 4ARYA 3V65A 1Q8OA 1HB2A 1L3JA 1QNWA 2P34A 5A3TA 5DAWA 3OGGA 2A1XA 1GYKA 1QQP2 5JUVA 2G9GA 1W2UA 2WS92 3N9NA 2ORXA 1GU3A 4BZ4A 2VVDA 1PVC2 1O4ZA 1PNGA 2XBO3 3LGRA 1GOHA 1U5IA 5CFCC 5CFDC 2R16A 1HRI1 2QUOA 4EWDA 5FZ7A 3SXWA 4JGZC 2GP3A 4FCAA 3HPNA 5A6XA 2DUOA 2J1VA 2XQXA 5K4LA 5D2AA 2XJVA 4HN0A 3ZO0B 1VBA2 2H0VA 4I01A 4IERA 1JI6A 1UCXA 1JW6A 4KL1A 4B1LA 2CDPA 2BGCA 4G3YC 2YBPA 3X29B 1IKQA 2O8QA 5FIXA 5F7UA 3CKHA 4JRLA 4Y1YA 3FL7A 4TWTA 4CDXA 2QQJA 4XBLA 1Q3EA 1VAMA 3D0JA 4CP9B 1KS4A 1QJY3 3JB8A 2IUWA 4Q4W1 4QM9A 1NXMA 2X10A 3PVNA 3PMSA 1W39A 3ST7A 3I2JA 1AR83 5FZBA 5ANNA 3ES1A 5FZLA 3VBHA 2AZ5A 2HWE1 3UJOA 4XTMA 3WCRA 1JZ4A 4Q0UA 1AL0G 1MZ5A 2FDIA 1FYUA 4CXWA 2DVBA 1AR61 1G9BA 3S57A 4JGYC 1CESA 3CU7A 1KD7A 3HT2A 3IN9A 2C4XA 3DKWA 4E4SA 1LEMA 3RYPA 3ZN4A 3KQ4B 2E63A 2ZMLA 3P1IA 4QU2A 2GNMA 1EPZA 4GWJA 1YCIA 4PLMA 4BQ4A 5CA6A 1RHI2 2I2SA 2B45X 4RGAA 4EROA 3WDVA 1KQRA 3S7IA 2GNDA 4ZXEA 3VBHB 4A4AA 5F3GA 1UPIA 1W6MA 3FLPA 4RR3A 3TEXA 3LEMA 2AYHA 4GALA 2J1UA 4KWJA 5EQUA 1Q8VA 5A70A 1AR92 4L0PA 4XE9A 4CCOA 2VCCA 5LASA 1UY4A 2UWAA 1TG7A 2I74A 3NMBA 2F4PA 3ZFGB 5T52A 1MQTC 3V0BA 2W39A 3FJSA 1WGPA 4AI0A 5E6HA 2ZTNA 4HPKB 3T4HB 1C4RA 3VL9A 4AGGA 4BLJA 1CIWA 5A3UA 4O9GA 1JZ7A 3WNXA 2V09A 2DUQA 5JCTA 1FX5A 2VJXA 4QHOA 3VDBA 1W6MB 4P9WA 1POV0 4RR3B 1NLSA 1AL21 2YUEA 2B8MA 4I0AA 4OUEA 2VZVA 2LUWA 2ZGOA 1DHKB 3KV6A 3T0BA 4GB33 1AR73 1X9PA 2JDPA 1VBC2 1F8VA 5H9QA 1DGRA 4FPYA 5LA9A 3V0BB 3LE0A 4GXLA 2LM3A 2OVUA 1LULA 2RS13 2ZXQA 2WIIB 3MPPG 2VZUA 1MZEA 1CPMA 3Q8FA 4IV3B 4LNVA 3BOPA 3KSCA 3QCWA 3JUUA 2Q8CA 2EAKA 3WDTA 3T09A 2PLV3 4FI9A 1O3QA 3R05A 1W05A 2YGMA 4YGBA 2BEOA 4ZU4A 3MI8A 2C6SA 5ERLA 5FPZA 4BB3A 4QGNA 2Y8KA 1ZZ7A 4LBNA 1GQGA 1O3SA 1VMJA 5DABA 3NKGA 4UI9L 4GH4A 5A6QA 4FQ4A 1UY1A 4R4ZA 1OF3A 1CAWB 1BHGA 2Y6FA 1FOD1 2ZX3A 3CO2A 4XOGA 2LROA 3BTAA 3POFA 4KI5M 5A7NA 4CUCA 5FY8A 4JDNA 2ILMA 5J7MA 4LLFA 2CTVA 5FP3A 4XDPA 1QXRA 3HEIA 2PAMA 3ENRA 2ET1A 3LA7A 3PJQA 2XH6A 5APAA 3DXTA 1CN1A 1T2XA 1W6QA 3NJXA 1IZ3A 3S6PA 4JDOA 2XUEA 1VRH2 2VG9A 1COV1 1EAH3 2JWPA 2XKPA 3B3QE 3EJKA 5FZ8A 2PA7A 4AI8A 4CSWA 3W9AA 4NHMA 3W59A 1QJU3 4S2HA 5A3MA 3OPZA 1UZZA 4AK3A 3T2TA 3UL2A 2A6ZA 2DUPA 1HDKA 5FY1A 1UOGA 2VCAA 1JYIA 3LOIA 3WQ7A 4LXLA 2BFUL 3A0KA 1W6QB 1ULDA 4QPYA 3LIGA 4NUBA 1J83A 3VDDC 3ILNA 3O1TA 3VZMA 1JN2P 4XAEA 2UY8A 2WNEA 3VBRC 4D7YA 4BLIA 3CF6E 5J96B 3D0SA
chains in the Genus database with same CATH topology
4LBQA 1RUH3 3OCPA 1WLWA 1NG0A 2IFRA 1BQPA 2XBO1 2YHJA 3MIBA 3THTA 4BE3A 1PIV2 3MIFA 2PELA 4XF1A 3WDUA 1CONA 2NN8A 1HV1A 1UIKA 4XDQA 2XB6C 1J1LA 3EQEA 2Q4SA 1N1TA 1Z78A 5CU1A 4LBQB 1WLCA 3M3CA 2A73B 2R041 1SLCA 1SLBA 3OJBA 1LESA 2HEYF 1QJY1 1J1TA 1XU2A 3AP9A 4BWOA 2JG8A 4EN7B 3O14A 4CEYA 2ZAAA 3WVJA 2XG3A 3ZXLA 4IQPA 1YJKA 2UYBA 3O0WA 3MIDA 4YVSA 3SHRA 4Q0SA 2YY1A 3HR9A 2FMDA 4IL7A 3LSDA 4KU8A 4N9HA 3V0AA 4YSFA 4L97A 3PVEA 2QQPA 1TME2 1MS1A 5EV7A 4DMIA 2EXKA 2JG8B 2YXSA 1LOFC 4WZCA 4KQ7A 5LEJA 3MF9A 2D98A 1ZBA1 4WM7A 4YVSB 4WM8C 1AJKA 2HYKA 2RS33 3HT1A 4QMAA 5ACA3 4AWDA 1R1A2 3V0AB 2EA7A 4OUMA 1QDCA 3S30A 4IEYA 5T54A 1NCQC 2VPVA 4KWKA 4FXKB 4LBKA 2QZ3A 1UL9A 4PDWA 2RR13 3BOWA 3V56A 1PVXA 2YYOA 3I59A 2VU9A 3FLTA 2QVSB 3BALA 5D8AA 3J9SA 4LE3A 5IUQA 4WM7B 5LRRA 4YM0A 2WNVB 1AR71 4GB31 3I54A 4XJUA 1NA1A 4J1XA 4OULA 2DU0A 3QH6A 5FLHA 3IBMA 1RUD3 3ZMNA 2ZGSA 3I59B 3B9CA 5LEKA 5L7OB 1G6NA 1DF0A 2CGNA 1H0BA 4RFT0 4R9AA 5F6LB 3RDIA 2JE7A 4XYXA 1PO13 2AR6A 1I9RA 2WFPA 5GKAC 3ZFEC 2WZR3 1VBB2 1W6PA 2RS52 3WCSA 3HIFA 5C4WA 1XYNA 2NM1A 1NA1B 4I09A 5FQ0B 1XXNA 2C5DA 3B94A 2ZKNA 4URTA 5B2GB 4AI2A 3WUCA 1ND2A 1HW5A 4U2AA 1ZBE3 5IK8A 1LGNA 2WZPP 1MEC2 4R9DA 4OFGA 1RINA 1PMIA 4N53A 3N7KA 4PBOA 4RQPC 1DBNA 3N7LA 4C1XA 4AEKA 2P2KA 1APNA 3ASIA 5C4WB 5CFCB 5CFDB 4DOUA 1YI9A 1EAH1 2VW1A 5T5JA 1R093 1ND2B 1QJU1 5E89A 4RGGA 2AREA 4N53B 1VB2A 1X8EA 3GHMA 1ENRA 1H1IA 2R063 4Q4V2 4F8AA 4H7LA 1QJX3 2BFUS 1PO21 1RJ8A 1RUH1 4YVWA 1TQ5A 1ZRCA 1EV12 1SACA 4K6BA 4JGYB 2EAAA 2DYCA 1Q5OA 1RUNA 2BVBA 4UW3A 3RG0A 1WCSA 1OKQA 1ND3A 2NYYA 2KXLA 4E2GA 1LU2A 4NPRA 3WINE 4YVWB 3M70A 2BNNA 5AC92 5C8WA 2ENRA 1RC6A 1CX4A 2XJSA 2RM21 2YPJA 4Q0PA 5DDJ3 1AYN3 4M3CB 1HLCA 1Z7S2 4HANA 1WLTA 1GANA 4K7JA 1RJ7A 5I0RA 1Z0HA 4AQ2A 1CGPA 2HWF2 1OOPA 1NE4A 1QH6A 1WW4A 5BPXA 3VUOA 3WT3A 4H14A 1XNBA 2IXKA 1ENQA 4KH9A 1OQ1A 1YYNA 2P3IA 4AVCA 4KG0A 1OA3A 4XBQA 2VQ0A 2EF6A 3M4FA 4FOWA 4I3GA 3FZ3A 4AFCA 1PGSA 3E97A 2JD4A 4P14A 3WP3A 2LTNA 5GZDA 3VBHC 3ZDSA 5KHHA 1SLAA 4AVTA 3JBG3 1OOPB 3M8LA 2WC2A 3Q9OA 3UK9A 1U5YA 1XU1A 2MEV2 4WVMA 3WV6A 2RS31 5ACA1 1H8VA 2D6MA 1DQ2A 3RJ2X 2DCTA 5JI7A 4JTNA 3VBFA 2IXLA 5I0TA 4LBOA 5KXCA 1RUC3 2RR11 3H1MA 3THPA 1OPMA 4RR3C 1J59A 5BNNA 4CEWA 1O4TA 4OI2A 1XRUA 3PMEA 1RUG2 5IK4A 2HEWF 4WVMB 2K0GA 2HWB2 4P9IA 1D4M2 4OI0A 2W52A 2ZGNA 3R4UA 3RMXA 1LOEA 4YRDA 1REDA 1XYPA 5I8TA 4QQOA 3LZZA 3WDXA 4AI1A 2DVAA 5CBLA 4GIQA 4XF4A 4LTAA 1I6XA 2VVFA 5BYNA 1OFSA 1JOJA 3SCFA 1V9U3 4KGQA 1PO11 3AZZA 3NW4A 1X50A 2WT0A 1OI6A 1Q8PA 5IK5A 4Q4X3 1G9CA 1C8M3 1ENXA 1HRV1 2WJSA 1H2LA 1A8DA 3L9JT 4Y1UA 4FP3A 4R8HA 3TN93 1WMEA 1H2NA 1HV0A 3WDWA 4IETA 2E6VA 4H7MA 3GZTB 1WLDA 5DZGA 3WUDA 1RUE2 3WG2A 1I1EA 3LKJA 4JQRA 4NHKA 4GH4C 4XF3A 1PK6A 1RVF1 3E5QA 3SNMA 3WW3A 4EJRA 1RB8G 2RMU2 2Y0OA 4M3CF 2VW0A 1O3TA 4QQLA 1DG6A 2DFCA 4Q2FA 1BK1A 2QDRA 1OHFA 4TLFA 3AJZA 4NHLA 2ZHNA 3ZXDA 4ZXKA 3RQ0A 1QJZA 1LHUA 4CYDA 1PK6B 3IMNA 2X5IA 4B8EA 4HMZA 4X8NA 3HN1A 1NE6A 1YIFA 2Z79A 1QJX1 3RS6A 1TEIA 2GH2A 3H1WA 1GNZA 3MLLA 4S2GA 3TYJA 4GA9A 3ZFFA 1N47A 5BNPA 3M1HA 1BEV2 1HIXA 3LB9A 2QNKA 2IXJA 1V6IA 3JQWA 3IDCB 3N7JA 1CD3G 3POWA 5C9AA 5FAXA 4LLOA 2ZABA 4Z8BA 3SCGA 4FAGA 1RIRA 1Y9QA 4W6XA 4V1PA 1GLHA 4L99A 1O91A 1MS0A 4CDUA 1FMD3 1X7NA 1AXYA 4H55A 5JAXA 5J48A 1RUI3 3ZFFB 2Z42A 3H0OA 1IOAA 1D0HA 5FDBA 3JQXA 3AKRA 2ZHMA 4HL0A 1OLQA 4WM8B 4MZUA 5KXEA 3GBFA 2MHFA 5C9AB 1F2NA 1BYHA 1HRI2 4YGEA 5ABJA 5LRSA 1AYM1 2WFF3 1N1SA 4AYUA 3GF6A 2EXHA 4CDUB 4CDWA 4Z92B 3FE5A 1M06G 3MIHA 2O8OA 3USUB 1FPN1 3MICA 1KDMA 2VW2A 1C5HA 2JG8C 3AMNA 1MS3A 4CEYC 5L36A 1ULCA 4LBQD 1ASJ3 4Q4W2 4BQ1A 4MH0E 5ABJB 4LHKA 4RL7A 4YVSC 3RPQA 4CDWB 2HWE2 2ZKLA 2EIGA 1AR62 3OTFA 2D43A 4AVBA 3OBTA 2PHUA 3CJIA 1T6GC 3ZFEB 4RSUA 3JU9A 3UKVA 2HWD2 3AKSA 4AHWA 1RUC1 5BNOA 2C1FA 1WW7A 1POV3 4WM7C 2JENA 1QMJA 2A6VA 1QQP3 5IT6A 3WDYA 1J58A 2NMNA 3WG3A 1C5IA 2WS93 5HBAA 2ZS6B 4Y5Z0 4QGMA 1PVC3 4K3UA 1FXZA 1PNFA 3N4MA 2ZPXA 2VOWA 2VNOA 2R30A 1DZQA 3B01A 2GC0A 1GZWA 1PM7A 4MGKE 1EP0A 4PDWC 3ELNA 3MZHA 4GMP0 3KGLA 2A75A 1R081 4CTEA 1AHSA 1VBA3 1JTZX 4FPKA 2B39A 5JSRA 4PBPA 4UBHA 2GSYA 3SH5A 4K1ZA 4YFZA 1S1AA 1VBD1 1NA1C 4XQDA 4L2NA 2D5FA 4YG6A 4C1WA 3KCYA 1C8M1 4MXVA 2IWGB 3GHNA 4HVRA 3VHOA 4YZ5A 1EYBA 3TN91 3WW4A 1CAVA 5JDBA 2R071 4LA2A 4CDQA 1S0JA 1O7FA 1URXA 3NAPA 5C4WC 1RITA 3RYKA 2ETEA 3J8F1 2K2SA 1UIJA 3M3QA 1RHI3 1TMF2 1R1ZA 4PIXA 1ND2C 1C57A 4HK8A 1FOD2 4DQAA 1RMU2 4L11A 2BQPA 5DZFA 1B35A 3AP4A 4NWWA 1WD4A 4N53C 1AR93 2JECA 4CDQB 3AKTA 1KFXL 4MGZE 2D6LX 2V5YA 1QWRA 3AXEA 3KGZA 2ZHKA 3AZWA 1RUJ1 1RUF2 3ATGA 1DQ0A 4YLZA 1COV2 4QPGA 2DVGA 2Q5TA 2D3RA 4W6WA 1DYPA 1WD3A 4DXZA 4EV0A 4QQ2A 4Q8KA 1LRHA 3UKTA 1LODA 1V6OA 4CDXB 4AVVA 1S0FA 1TE1B 4AVAA 4E4DX 4LO4B 1W0PA 1O5UA 4AFAA 4AG4A 3SCHA 3BPZA 4ES9A 4Y4YA 1LECA 2WKKA 1ZVFA 2OIIA 4YVWC 1FMD1 1H2KA 3OF1A 1ULGA 2FBEA 4QGLA 4RHV1 2WNUA 3I2DA 4FPEA 1YRZA 4LHLA 1IS4A 1FAYA 2PN5A 2XBO2 2O0OA 4IXLA 5KBFA 1ND3C 2CYFA 4EN8B 3VBUA 3PNAA 2C0ZA 4IEPA 3QBQA 1PHMA 1GICA 4PF5A 4LEJA 3WD5A 2FZ1A 4CP1A 2HWC1 2WNUB 2R042 4RS5A 5H9RA 4YZ2A 1LKNA 4AXOA 4M01A 1F5JA 3R0RA 5CAZA 4BH9A 4YARA 5HI0A 3VBUB 1Q43A 1VRH3 1OOPC 3AFGA 2Q8OA 1NYWA 1GZ9A 1SCRA 2ZACA 3R4SA 3D82A 5GZFA 1J3RA 4BOWA 1MZFA 2QCSB 4ASLA 2G4IA 3MPBA 3DF0A 1DQ6A 4Q0VA 4RS5B 4OI1A 4COVA 3VL8A 4X6QB 2ZZQA 4Q4Y1 3BB6A 1HXS1 3J4UH 2IZWA 4MGIE 5TSWA 1M4WA 5KXDA 2PHXA 2ZMNA 4LO7A 3IM0A 1BBT2 4IV1A 4OUSA 2IFWA 3S7EA 3WP4A 2LALA 1QQP1 1SLLA 4A7ZA 1YIPA 1NCRA 1ZBA2 4CRQA 2YMZA 1PIV3 3JD71 4EN6B 3VBFC 1GNHA 3DN7A 1WMFA 2W0XA 1SLTA 3K48A 4GH4B 1UAIA 5SV5A 1VLNA 4LULA 5BNNC 5JOXA 4CEWC 4XJWA 4DFSA 1C28A 4IV1B 1FT9A 1IPJA 1G9FA 1S0GA 2XLGA 3HBZA 1JYCA 4AW7A 3O7OA 5GZEA 1GR3A 5I8SA 3WR0A 5KHJA 1LHVA 1LGBA 3AYAA 3AP5A 2VOKA 2BPA2 2XVLA 4HLTA 1UKGA 3GYDA 3KCCA 3OY8A 4F3JA 1AXKA 2BYVE 3HQXA 4AEDA 4MXWA 3O12A 1X33A 2WT1A 4UXAA 3VLBB 2O1QA 4C90A 1TNRA 3DV8A 1E57A 2A70A 1TME3 2R6QA 4ONUA 3K51A 3TAYA 1HX6A 4HT1T 1QY4A 3H7JA 4LE4A 5HCAA 1DGRN 4HN1A 2D5HA 1W6OA 1MS9A 5E88A 3OY8B 2X29A 3INAA 3KQRA 1VJ2A 4I0BA 5F5QA 3KM5A 3AB0A 4AEDB 5DUVA 4PIYA 4MXWB 4DS0A 1PK6C 1IQAA 2VMHA 3ES4A 4XJ8A 3TNPB 1R1A3 2GMMA 3HD8B 1HQLA 1UF2C 3A4UA 2VH9A 4J1WA 2VOVA 1A6CA 1AR81 1X36A 2VQAA 1EAH2 1EPWA 1CAUA 4UW6A 1V6KA 1UPSA 3WG4A 1OPOA 1ZZCA 1QJU2 3R6SA 5K0UA 1DQ1A 1DLLA 1ULFA 3VKFC 3ROUA 1LU1A 2D6PA 4CEYB 5FOJB 2XGXA 3U07A 3ZFFC 1WW5A 5BNPC 2D93A 1PO22 5J36A 1OMIA 1ZRRA 1ZA4A 1RUH2 2JDZA 3FBYA 3N3HA 5C9AC 2GMEA 1VBB3 1QOSA 2RS53 2WT2A 4AGRA 3L2YA 3IWZA 3FMGA 4CDUC 2XVKA 1YFYA 1UZYA 4OHYA 1JBCA 4XJAA 3MFCA 1BKZA 4AVSA 4K40A 4AGVA 1ZZ9A 1MVQA 3GNEA 1LJ7A 1G8WA 1MEC3 2GAUA 3IPVA 3WLUA 4AQSA 1OLRA 4BCUA 5EFUA 4BHPA 1V70A 2JG9A 4ITCA 2RS11 5ABJC 2XJRA 4CP2A 2RM22 4XHXA 1VRH1 4PDWB 4CDWC 2DVDA 2PLV1 3KZ4C 1ZRDA 2ZA9A 5D8AB 1JUIA 1FI2A 1ZZ8A 2Q0AA 5A3LA 5JZGA 2UWCA 1QHDA 4GQ7A 1QF3A 3D6EA 5KHGA 1NLRA 3AMMA 4XQWA 4MLOA 3O5SA 3N36A 4Y26A 2SBAA 2WQZC 3TWIA 4WVVA 1I3HA 1VR3A 1H4HA 3FC0A 1SBDA 2QFEA 3ZYJB 1EV13 3CJIC 4M00A 3ZMOA 2D7FA 5JZGB 3T1LA 1W6PB 2RS32 5ACA2 4YM2A 5JSOA 5BNOC 2D6KA 3ILFA 4XF0A 3RRDA 2GALA 5FOBB 2XHKA 3KB5A 4FPCA 3VHPA 3NV2A 2ZGLA 1SBEA 1UU5A 3AYCA 1U12A 4JVAA 4XEZA 4ES8A 1C8NA 3MLJA 2XVGA 4DY5A 4R9CA 4DINB 4IESA 5DUWA 2E51A 2VUAA 4XFGA 1K5MA 2UY9A 3PLQA 2HWF3 3ZXEA 2PHRA 4FBFA 1H9PA 1MR5A 4LO8A 3WHTA 3VZLA 4XXPA 4DNYA 3ZN6A 3H50A 2UURA 1PO12 4NOTA 2VMIA 4OHVA 4XETA 5LK5A 2TNFA 4XFIA 2WWSA 2WQ4A 4YZ3A 1ALYA 1HRV2 1OSGA 4OVEA 4CDQC 3S0MA 2DWRA 3AXDA 3LOBA 4B4PA 2BWCA 2XJQA 5JPMB 1MS5A 2MEV3 3NV3A 3ZN6B 1MACA 3FX3A 4Y22A 1RVF2 3M3OA 4M0HA 5BY5A 2H0BA 1ND3B 1FV3A 3I8TA 3KMHA 5I0UA 5JSPA 1B35C 2E9QA 2GN7A 3NVCA 4CDXC 4XIKA 4ZU7A 3BCWA 1RUG3 1RUOA 1BMV2 4M3CE 1DZTA 3LCPA 2HWB3 3C3VA 3ZXAC 5J37A 1CPNA