3AJZA

Crystal structure of ancestral congerin con-anc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
GVEVKNITFKLGMYLTVGGVVNSNANRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ajzA00
1Y7BA 2DVFA 3AP4A 1KRIA 1LEDA 2Q5TA 3VUOA 1X50A 2A6YA 4FOWA 4ZXKA 4HL0A 5L73A 2D6KA 3M3OA 1A78A 1WBLA 2GN7A 2DURA 4PCRA 4Z8BA 5CAZA 3R4SA 4DFSA 4FQZA 2P37A 4YGCA 4MYEA 2XB6C 1UMZA 5GLUA 2A3XA 5GLVA 2WJSA 4XIOA 1NXD1 2R16A 4Q26A 3VKLA 1OKQA 1DQ0A 3ASIA 5FRAA 2D6LX 4AWDA 4DS0A 4SLIA 3ZSLA 5KXDA 1LESA 1OQ1A 5F5QA 4P9WA 4BMBA 2NM1A 2OW4A 4BLIA 2W68A 3H0OA 1QMJA 1YRZA 2HYKA 4YG6A 1PZ9A 3V0BB 5FREA 1PZ7A 1WLDA 1CVNA 2JJ6A 2AREA 4DRRA 1VAVA 5DUUA 1DZQA 1BYHA 5DZEA 3L2YA 5GZDA 1LU2A 1W6PB 4P9XA 1Q8PA 4GA9A 4AVSA 1IS4A 2JECA 1UZYA 1LECA 3KM5A 3V65A 1CONA 1JYIA 1KJLA 1AZDA 2A6ZA 4Y26A 1LJ7A 1V00A 1H9WA 4XTPA 5T5OA 1CJPA 1G9AA 1JN2P 3ZYRA 1FV3A 5EXOA 3FLPA 3VV1A 3AP9A 1GANA 1SBFA 4XYXA 1MS3A 3SNMA 3O0XA 5EWSA 2JD4A 4Y20A 3V64A 2ZGMA 3QLQA 4XXAA 1URXA 5JOYA 3N35A 4XJUA 2E51A 1S0GA 3IN9A 1DBNA 2PELA 2ZGRA 2V73A 2VW2A 4Q27A 4XIKA 4DRVA 5KXCA 3N7JA 3WG3A 1MS4A 4YG3A 1B09A 4K1YA 2VY0A 3RRDA 3UJOA 3UL2A 2A70A 1GICA 1Z78A 2DV9A 3N7LA 3WDYA 3WDTA 2GMPA 2P3JA 4BLJA 4YM3A 2UURA 2EF6A 4GKXA 5HCBA 3AYEA 2FHRA 3Q9OA 3PVEA 1JOJA 3OPZA 3AXEA 4M3CE 4Y20B 3RMYA 3PVNA 4BMEA 2DVAA 2VH9A 3A4UA 1V6IA 3ILFA 4FPHA 1AX1A 1QF3A 1MZ5A 2DUQA 3R05A 5T55A 2PHFA 3O0VA 1ULEA 2Z42A 3WV6A 2GALA 1PZ8A 4ITCA 3IPVA 5E89A 3M1HA 3AZWA 1N1YA 1D0HA 2D7FA 2P3KA 5GZCA 4XILA 4ATFA 2ZGQA 1QDOA 5JMCA 1C1FA 1WW5A 1QNYA 2EXJA 4I30A 5GZFA 4Y24A 1YYNA 4PQ9A 1LOCA 1DQ2A 2NN8A 1S1AA 3INAA 3LSEA 1AXYA 4WV8A 4XMAA 1WW6A 2R0HA 4Y1YA 4TZDA 4YW1A 3RQ0A 3AJZA 1WCSA 2PHTA 5GJ6A 5IK7A 5KXBA 1I1EA 4CTEA 1O4ZA 3IPVB 1W6QB 4YM1A 5E8AA 2D6OX 4P14A 5JVVA 4Q8LA 2ZHLA 3VKOA 1HQLA 1LOFA 3BOPA 3GNEA 3LCPA 3BODA 3WDWA 3WVJA 2WT1A 4YFWA 2D3RA 4LBQD 1FAYA 1GBGA 2VXRA 1SLLA 2D6PA 3MEPA 1N3QA 1KJRA 2WT0A 1SLTA 1LU1A 2JKBA 1GSLA 2WSVA 2DVGA 1S0JA 1ZM1A 1WLCA 1LCLA 3A0NA 4XJWA 4LBKA 2P34A 4FPOB 3W59A 3POSA 3WDVA 1JHNA 1JYCA 5GALA 4ISRA 3M3CA 3IKWA 3M3QA 1XQNA 2DVDA 4YG0A 1W0PA 1GZWB 1CPNA 2E6VA 1YXWA 2ZBJA 3SISA 5EYYA 3W58A 1W0OA 1V6LA 2JE7A 3AJYA 2R1DA 1UX6A 4FP3A 4F83A 3V0BA 5CNAA 1AXKA 2DU1A 3FBYA 1DGLA 1CQ9A 2BQPA 3T1LA 4XHXA 2D3PA 3SLIA 5CBLA 4LBLA 4M01A 4M3CA 2CL2A 1LODA 1GNHA 2GDFA 2AENA 4FPFA 3SH4A 4P9YA 1RIRA 2UU8A 2VW1A 1W6PA 2ZACA 2OUJA 2WSUA 1NLSA 3AXDA 3OYWB 2ZMLA 1QOTA 2CYFA 1CR7A 1W6OB 4FPCA 2OVUA 5IUQA 4UW6A 2WLQA 1V6JA 1JUIA 3D6EA 1MS9A 1UPSA 3ILRA 4HANA 2E7TA 4R9AA 3WG2A 4ZKTB 3FUQA 3POWA 3WUCA 4XE9A 1SLAA 3WDUA 5IK4A 4Y1UA 4LBNA 5H9RA 3N3HA 4M3CB 4UW5A 3LSDA 2EXHA 4PF5A 1CPMA 4XJAA 5DXDA 2DYCA 2EXKA 3MW4A 5IT6A 1RINA 2A3YA 4WVVA 3GALA 2DUPA 1GLHA 1QGLA 4DQAA 3ILNA 4GWNA 4XJZA 3WHUA 2DWRA 4FPJA 4WZFA 1SBEA 5DUXA 1IS5A 4LBJA 1DIWA 5GZEA 4D69A 2CTVA 4FPEA 2DTWA 1AX2A 2A71A 2LTNA 4PBPA 1SCRA 2D44A 1FNYA 1N1TA 5T52A 5HCFA 2I2SA 4K1ZA 1IS6A 1QNWA 2EXIA 3ZSMA 1QOSA 2EALA 4NOTA 1H9PA 1JW6A 3DUIA 1BXHA 4XOGA 5T5LA 5F9TA 4C1XA 5LK5A 4GXLA 1LHUA 1SLIA 1ENQA 3AZVA 1LOGA 4YGDA 4M3CF 3NV3A 2UWCA 1BKZA 3ZXJA 1G86A 1N3OA 3AYDA 4RA0A 4DPNA 3O0WA 4GALA 2JDZA 2AR6A 3AP5A 2SLIA 2SBAA 3CNAA 4FVVA 1RITA 4YW3A 3ATGA 3ZXLA 3WHTA 3ZSJA 2OUHA 3APBA 4OZXA 4WVWA 1QKQA 2D3SA 4IQPA 3T1MA 4ASMB 4FP2A 5SV8A 3D4KA 1MVEA 1APNA 2GMEA 1C57A 1Q8QA 2D43A 1G9FA 3OY8A 3RG0A 5JDBA 1Q8VA 4YZ5A 1EPWA 2C9AA 1G9BA 3WLUA 1N1VA 1GZ9A 1W6MA 2A6XA 2LALA 2UWBA 2ZGNA 4YM0A 4XDQA 1ULCA 1FX5A 1UAIA 1LULA 5DUVA 5DZGA 1AJOA 1JBCA 3PMEA 5H9QA 1W6QA 2ZHMA 2EAKA 4AVVA 3OBRA 2VW0A 3FFZA 3O12A 4L8QA 1GKBA 1DHKB 2ZZJA 1SCSA 4UW3A 2D6NA 3OY8B 3ZSKA 5JOWA 4LBOA 1DQ5A 2ZKNA 3DGTA 4YFZA 4YZ4A 2YXSA 1U0AA 3HR9A 1F31A 1W6MB 1S0EA 2RHPA 5GLTA 2UWAA 2WNEA 1IS3A 1S0FA 4XHBA 4FPYA 4BOWA 3HN1A 1Q8SA 1DYPA 4U36A 4XBLA 3AZYA 2GNMA 2ZGLA 1YO8A 1GZWA 1MVQA 1C1LA 3UJQA 1FYUA 3V0AB 4Q2FA 2A3WA 3WOGA 3OGGA 4FPGA 3IM0A 4Y1XA 3AYCA 1JXNA 3FUOA 2GNTA 3I4IA 2AUYA 1AJKA 1J1TA 1CIWA 2A6VA 3WZ1A 1S0IA 1DYKA 3PVOA 4YW2A 2NMOA 1LGNA 1MZ6A 1AVBA 2W52A 1GNZA 2ZA9A 3AX4A 1SLBA 2R49A 3VKNA 4YZ1A 3OJBA 3OYWA 4JCKA 2ZGKA 1ULFA 3U4XA 2JE9A 4YLZA 2ZGSA 2ERFA 1W6OA 4C1WA 1G8WA 3B00A 2ZHNA 4AGGA 1IOAA 3C2UA 1VALA 1N47A 1MR5A 1VAMA 1AXZA 3N7MA 5DZFA 4R9DA 5GLZA 1WW4A 2GNDA 1YIFA 5CB7A 2KM2A 1DFQA 3TAYA 2P3IA 1I3HA 1KITA 4FQ4A 5JOZA 1AX0A 4U2AA 3WDXA 1KDMA 1LEMA 2V5YA 4W65A 5DG1A 1WBFA 1KQRA 2ENRA 2YV8A 1O4YA 2AGSA 4BM8A 5BYNA 4XJ9A 1ULDA 1UKGA 1MS5A 1W6NB 1ZA4A 2GMMA 3AZZA 1R1ZA 2G4IA 4AVTA 5HCAA 4GWMA 5IK5A 2GNBA 3OBTA 5EYXA 4PBOA 3WCRA 1LHNA 4TYSA 1WD4A 4Y22A 3N36A 1SFYA 4FOVA 1Z0HA 1FV2A 5T5JA 2PHUA 3MW2A 1UN1A 2YMZA 4YGEA 5E88A 1ENRA 3USUB 3NV1A 3NWKA 3ZXFA 2CWSA 4CRQA 4R9CA 3A0KA 3N7KA 5KXEA 1F5FA 2ES3A 1WD3A 3B9CA 4YW5A 3ZXEA 3MPPG 2PHWA 1TEIA 2P2KA 2VU9A 1LOBA 2CNAA 1V6MA 1SBDA 1HLCA 3WNXA 3KQRA 3ZYPA 2WKKA 2EIGA 4CZSA 1C4RA 1KDKA 4Y22B 2A75A 5GLWA 2D6MA 2A6WA 1GYKA 1MS0A 1G7YA 3IMNA 4Q1PA 1WUVA 3NV4A 2VUAA 3RS6A 1H30A 3JUUA 2C5DA 3ZXKA 1FATA 1LGCA 1IKQA 1QDCA 2ZGOA 3HMYA 2XG3A 1Q56A 2B7YA 2WT2A 2E7QA 4NO4A 1LENA 1LHWA 2DTYA 3RSJA 1GZCA 1BQPA 1ULGA 3QCWA 1VIWB 1CESA 2CWMA 1LOFC 2DU0A 4XBQA 1HKDA 3AP7A 1LGBA 1LOAA 4XXPA 2WQZC 4XJ8A 4YGBA 4BPZA 4H55A 5GM0A 3AP6A 4Y1ZA 5T50A 1QU0A 1D2SA 1UL9A 2NYYA 1G9CA 4FOQA 1N3PA 5T5PA 5DG2A 2CY6A 3ZPYA 3POYA 2ZGTA 1OFSA 4XMIA 1S0DA 2ZAAA 3SH5A 5IK8A 1UZZA 1IKPA 3SITA 3MW3A 2H0BA 1HQWA 1ENSA 4FOYA 2YY1A 1V6OA 3VKMA 3WG1A 1HDKA 1WLWA 5DUWA 4AGRA 4JC1A 3V0AA 3RMXA 3B3QE 3WUDA 4Y1VA 1DQ4A 5H9SA 4GKYA 3ZVXA 5AVAA 2NP0A 2DVBA 4YZ2A 1V6NA 3PJQA 1DLLA 4LBQA 2W39A 4KBBA 5H9PA 2NMNA 1A3KA 2ZHKA 1ONAA 2R1BA 4ISQA 2GN3A 3AK0A 2ZABA 2PHXA 2ZGUA 1BJQA 4JRAA 4M00A 2R0FA 1S0BA 3BIWE 4Q8KA 1G9DA 1CN1A 2E53A 3BTAA 4Q1RA 4XTMA 1AF9A 4YM2A 1SACA 1LHVA 1LTEA 3I8TA 2W08A 1VLNA 4K21A 3TB0A 3VKFC 5JLVA 2ARXA 4XBNA 1Q8OA 4RL7A 2ZMNA 2ZMKA 4LBQB 3T2TA 2YROA 1YI7A 5JOXA 2FMDA 4YZ3A 4YW4A 1BZWA 2A5ZA 4FPKA 1GV9A 3B01A 3D5OA 4LBMA 3WG4A 4ATEA 3R4UA 4FPLA 1DQ6A 3FLTA 1A8DA 1N1SA 3WCSA 1S0CA 1FNZA 4AYUA 2A7AA 1LOEA 1MS8A 2TEPA 2NZ9A 1DQ1A 1W6NA 2ZGPA 3JU9A 3M2MA 3FLRA 1LHOA 3M3EA 4XZPA 4AGVA 2PHRA 3B69A 4K20A 5T54A 1QOOA 3AFKA 2AH2A 3UK9A 1MACA 2YZ4A 3AYAA 4UW4A 3SH3A 1SLCA 1V6KA 3AZXA 1WW7A 1F9KA 3O5SA 3USUA 4R9BA 5CA6A 5GZGA 3NV2A 3ENRA 4BQ1A 1MS1A 2DUOA 2ARBA 2AYHA
chains in the Genus database with same CATH superfamily
1Y7BA 2DVFA 1ZVFA 3NKGA 3PUSA 5I93A 1PGL2 2Q5TA 2VJXA 2E26A 3N9NA 3BGAA 4ZXKA 2VUDA 3VBFA 4AFDA 3DPRC 3U1XA 4X6QB 4AK3A 4PCRA 4YGCA 3FJSA 4B7KA 3Q8FA 2XB6C 3AKSA 2XQRA 2QQVA 3SEPA 4IGPA 5FTTC 3VKLA 4FCAA 2VCCA 5C6CA 1H0BA 1D4VB 1DQ0A 1NQJA 4Y5TA 3CBNA 1LESA 1S4CA 4P9WA 4OHVA 5J37A 4BMBA 2WO2A 2W68A 3H0OA 3ZSEA 1QMJA 1YRZA 2WC2A 4DUXA 2HYKA 2NPIA 4QXKA 1PZ9A 4JDOA 3ACIA 1PIV1 2RMU1 1CVNA 2WO3A 4KU8A 1RVF2 5FZGA 1WKYA 3K4DA 2AREA 3T2QA 1AYN3 1VAVA 1DZQA 3A7QA 4MOAA 3JXSA 1NY72 5LA9A 3AKPA 1Q8PA 2J1UA 2JECA 1LECA 2ARCA 2X09A 3V65A 4L99A 3UKNA 1AR93 2TUNA 1W2NA 1H9WA 2CV6A 5CIRA 4R4XA 2JG9C 2VVFA 4R52A 2K0GA 1G9AA 1UYXA 5ISLA 2W1SA 2VMHA 5IW0A 1CX4A 3IT8A 5A3NA 4LULA 3AP9A 3PU3A 1GOFA 1KS4A 1MS3A 3BCWA 3E6CC 2JD4A 3H1YA 3V64A 4XXAA 1EUTA 1URXA 3N35A 3PJYA 4PI0A 1S0GA 3T0BA 1DBNA 3POFA 3OGRA 2V73A 2VW2A 4Q4Y3 5FZ3A 3ZIWA 5JCTA 5KXCA 1JZ6A 1MS4A 1UPIA 4QPWA 1HXS2 2VY0A 3ZLIA 2WS91 1W8NA 2Z2SB 4XW3A 1NE4A 2TBVA 4LEJA 1GZTA 3N7LA 4JGZC 1W03A 4XETA 2PFWA 3WDTA 3WX5A 4D6RA 1RHI2 2UURA 2VVDA 1HN1A 4FT8A 2XGXA 4YNIA 5BNPB 3ZR6A 3AYEA 5K0UB 4OI4A 3OPZA 4Q4Y1 4DMIA 4O9EA 5HI0A 3AXEA 5K8SA 1RL3A 1ND3A 4KG0A 4BMEA 3FFQA 3AL6A 1V6IA 5FPLA 2BOIA 2PLV2 4GH4A 1AX1A 2ET1A 4H7MA 4XCAA 4WBBA 4P02B 4BQWA 1ULEA 2X8KA 2YG0A 2Z42A 4J1XA 4UF0B 3DPRB 4DUVA 4QPIA 3M1HA 1N1YA 1D0HA 1JZ3A 4CEYA 3TN92 4CP1A 5C33A 4ATFA 3HD8B 4AEDA 4EN7B 4FXGB 4YW6A 5JMCA 3GZEA 1HQNA 5FY7A 1RXGA 4Z92B 3B5LB 3WR0A 1YYNA 1LOCA 1DQ2A 1NUKA 1S1AA 2AACA 2NN8A 3AM2A 3INAA 1XOYA 4Y1YA 2ZXQA 5ACA2 4YW1A 4PQQA 5HXVA 2O8QA 4NRPA 1WCSA 2PHTA 2XJTA 4NHYA 4PLMA 1DZRA 1BHGA 1O4ZA 1W6QB 2OYZA 5JVVA 3AVRA 2ZHLA 3VKOA 4CUBA 4QU2A 3GCXA 1RB8G 4A44A 5LA0A 1FAYA 1GBGA 2VXRA 5FYYA 4YWAA 1SLLA 1NCQA 1SHWB 2D6PA 1IPJA 3L9JT 4IERA 4E4ZA 1QXJA 5F7UA 5L19A 1SLTA 3OUIA 1NA1A 4BXSV 3A0NA 4CUAA 1JS9A 1YFWA 1JHNA 4P5YA 4RFT0 5C7GA 3M3CA 2YC4A 5FO9B 2JG9B 1AR63 4BWOA 1QJFA 3TNPB 5FZFA 2E6VA 1YXWA 3POBA 2CAVA 3BOWA 2JE7A 4FP3A 1S2EA 3ZKYA 1UX6A 3V0BA 4JVAA 2P6CA 2DU1A 4OHYA 3FBYA 2BQPA 1CQ9A 3T1LA 3JD72 4RSUA 4XHXA 2D3PA 3BI3A 4CCCA 1NE6A 2ZAHA 1ZZ6A 4HXCA 2YBSA 1LODA 3WF1A 4BQYA 2GDFA 2AENA 4FPFA 5KHGA 2VW1A 5IYYA 1W6PA 2JICA 3U07A 3GZUC 3OYWB 3BB6A 1A6CA 2ZMLA 4AAXA 4CU8A 5BV6A 2OVUA 4UW6A 2YU1A 4JGZB 4W50A 1OI6A 3T0DA 4R9AA 4XVHA 5E16A 3J8F3 2HWD3 4UFJA 2DDUA 3POWA 4XE9A 3VB9A 5L9RA 1R1A1 3AMMA 3WDUA 2BNOA 2Q8CA 3N3HA 3GM8A 3LSDA 5C9AC 4Y33A 1I6XA 1OC1A 1W2AX 4H3WA 1ZRRA 2DYCA 2J1TA 4LLFA 3OEAA 1UCXA 4PLOA 2HWE2 4XF0A 5DABA 3MYXA 1XE0A 4COUA 4GWNA 3M3IA 4LXLA 2XMLA 3O7OA 5IVYA 4WZFA 1XB9A 3WHUA 1SBEA 5D1IA 4D69A 2WUHA 1JHJA 4FPEA 1JI6A 1AX2A 5FY8A 3J7NA 2D44A 3IAPA 1FNYA 5A3OA 1U5XA 1PO23 3BIEA 1HW5A 4FSJA 1QOSA 2EALA 2ADDA 4NOTA 1H9PA 5I0TA 3DUIA 3D0SA 2R32A 3Q8EA 1R082 4GXLA 1ENQA 1HV1A 4A45A 5A7OA 3ACGA 4RA0A 4IEXA 1GOGA 1WCDJ 1KXGA 4Q5OA 4YARA 1TMF2 1ODNA 3VZLA 1PO21 3T4VA 3OSDA 4NPLA 4LO8A 1OBNA 2SLIA 4BCUA 1W05A 3CNAA 1QJEA 5A6XA 4O7XA 3MF9A 5JUVA 4XTPA 1TME1 4R8HA 5KHJA 3ZXLA 4F8AA 5FZ9A 2V72A 3VHPA 1ALYA 1J58A 4WVWA 3W9AA 3E5UA 1QKQA 2D3SA 3AVSA 5C3RA 5BNQA 1MVEA 2P17A 5FKCA 4OZOA 1C5IA 2GMEA 3H3UA 4B4QA 3E5QA 1G9FA 1YQ2A 3ZN4A 3U4SA 4ASLA 5JDBA 5ABJB 5FIXA 5CVRA 4CXXA 1WCQA 4FFHA 5FQ0A 1G9BA 4FTBA 1UF2C 2HJIA 1QJY1 1ZBA3 2RR12 4HZFA 5JR7B 3WNKA 3BTXA 2UWBA 5FZLA 4XDQA 1ULCA 4LO5B 5FY5A 1UAIA 3CL1A 1LULA 3DN7A 2K46A 2XKPA 3PMEA 1D0GA 2FMYA 4QHOA 3OBRA 2EA7A 1W9SA 4C90A 3VBFC 1GKBA 3VBHA 4B4RA 4AQ6A 1DHKB 5TSWA 5FZEA 3ZMNA 5FZIA 4JZRA 5FP3A 3UKVA 3I2KA 2QJVA 3HR9A 2VUCA 3KZ4C 5GLTA 1W04A 3RYRA 2PHLA 3IBMA 4AQSA 3EO6A 4FPYA 1PVC3 4JKMA 4QQHA 1DYPA 5JZGA 1HRI3 4XBLA 3ZDVA 1GZWA 1MVQA 3X29B 3M70A 2XHNA 4TN7A 4AG4A 1O3RA 5DQ0A 3U0ZA 2XVLA 2YHJA 4SBVA 1UOBA 5F3GA 2VMCA 2ZZQA 4XUNA 3HOBA 4N90A 2FDFA 1NLRA 4ZXEA 5LRSA 4DNYA 1F4AA 1F15A 3JQWA 3OB8A 5JSPA 1CIWA 4A41A 2VO5A 1HRI1 1JZ7A 1V70A 1PX4A 4CSWA 1ZX5A 3ES1A 1LGNA 2QQMA 2R6QA 1H8TA 1RUE3 3AKTA 4JGYA 1J1LA 3I97A 2ZA9A 2R49A 3QACA 1RUNA 4NIDA 3NNGA 1VBE3 3OJBA 4JCKA 3U37A 1ULFA 2QVSB 4XUOA 3H42B 1QQP2 4QQ2A 4Y3OA 3ZYHA 4Q4X1 1GFF2 1IOAA 3BPZA 3OF1A 4BIOA 1RUH3 2ZX0A 4IEUA 4E9KA 3N7MA 2FCVA 3A23A 4MHUA 1WW4A 2JE8A 3LA2A 4CA9A 1XSQA 4ZU5A 2XJRA 4RN5A 1RMU2 3MZHA 3CKHA 4N9IA 1VBE1 5AC93 4B1MA 1CAUB 5FP7A 1JYWA 2P3IA 1I3HA 1VBD2 4AVTA 1KITA 3P3PA 1VBC3 2RM22 1XU2A 3LPFA 4K3UA 1AX0A 1HJFA 2QZ3A 4I02A 1AYM3 1RUH1 4JRLA 1DCSA 4W65A 1PNGA 1ZBE2 1WBFA 3RWKX 1QIQA 4COWA 1XYNA 2XXZA 4EQVA 4AHYA 1UKGA 1MS5A 4HSJA 2GMMA 1IQAA 3AZZA 4KGQA 2RS53 4K40A 4CCEA 3UNPA 2AZ5A 5IK5A 2E33A 2GU9A 4PBOA 4S2DA 3RZJA 3C7FA 1VBC1 2JG8A 3N36A 1AL21 4XZUG 1PMJX 2NLRA 1LB2A 2QQNA 2Z69A 4AVBA 2V4AA 4YGEA 2HH9A 5E88A 1FMD1 1D4M2 4KWLA 1RUD3 3USUB 3ZXFA 2QZ2A 1SZBA 2RS33 2JB4A 4GH4C 3N7KA 4Q0QA 1RJ7A 1RUG3 2BVVA 2RS51 3B9CA 5EV7A 1VRH3 3PLQA 2VZRA 3MPPG 2PHWA 4URTA 2QFEA 4RHV3 1PM7A 4QAWA 1JU3A 3UETA 2FDGA 5C4WA 4IEVA 5FMOS 3VBFB 2YUEA 4CDWA 4QPIC 2RDNA 3ZFFC 5FPXA 3TOJA 4EN9B 1C4RA 4QB2A 4Y22B 3SC7X 2VMFA 2XJQA 4AEJA 1JU4A 4CEYC 1ULOA 1FPN3 5GLWA 2RS31 2PAEA 4QX8A 5FXXA 1DDLA 1KGYA 5A6QA 1RUG1 1LR5A 3IMNA 1J84A 1VRH1 3VZKA 2QQJA 1ASJ3 1RUI3 4QX3A 4NPRA 1H30A 1SFPA 2C5DA 5JMOA 1LGCA 3TEXA 1QDCA 4HN1A 4QX5A 4RGKA 3BKZA 2OXBA 2WT2A 2HWB2 4DUWA 1LHWA 4BHPA 1BMV2 4TWTA 1BQPA 4MXWA 5FZ6A 1CESA 2JENA 5CU1A 4XBQA 3UV9A 1RUJ2 1ND2B 1ASJ1 1QEXA 2IXLA 1JZ4A 1TE1B 4W4ZA 3ACHA 4XJ8A 1NCQC 1W8TA 2ZJCA 1OPOA 4Y1ZA 1QU0A 3WNPA 1H1AA 4FOQA 4HVRA 5DG2A 2CY6A 1NX9A 4QB6A 5B4XA 4E4DX 1OFSA 1S0DA 2ZAAA 4MGQA 1OQDA 3PUHA 4OFGA 4XF4A 1IKPA 4JHZA 3MW3A 4FFIA 1HQWA 4MSVA 4HPKA 4LA2A 3VKMA 3WG1A 5A3LA 5JXGA 5FYUA 3RMXA 3B3QE 1AUYA 4CP2A 1K5JA 5LB6A 3W20A 1U5ZA 3OPTA 5AVAA 2NP0A 1VAKA 3PJQA 5IVCA 4GB32 2BP6A 2NQYA 4UFMA 4I0WB 1B35A 1ONAA 2YU2A 1M06G 2YB7A 1W06A 2GN3A 2JX9A 5FXVA 3ME2A 3OGSA 4JRAA 2ZX1A 1G9DA 4Q1RA 1MZFA 4ZPIA 3I8TA 1VPHA 2X05A 4BH9A 1EAH1 5FZBA 4LMFA 4RD7A 2XBO3 2ZMKA 3D3AA 5CYYA 3FC0A 5AVPA 1YI7A 5LBEA 4LK7A 2JWPA 2BNMA 2Q8DA 5J48A 5JOXA 4YZ3A 4YW4A 2A5ZA 4FPKA 3CMGA 5I0DA 3D5OA 2Y6GA 4CEWA 3WG4A 3LDKA 4JQTA 4K7JA 4QU1A 4ATEA 3ST7A 1DQ6A 5FZ7A 1N1SA 2XBO1 4QPIB 1FNZA 3ZFFB 1QJX3 2A7AA 2QE3A 1LNSA 4Q0PA 2TEPA 5FZ0A 3M2MA 1W6NA 4CEYB 3JU9A 3LFMA 3FLRA 3RI9A 3SCHA 1O3QA 2PHRA 1QOOA 4ONUA 1MACA 2YZ4A 1DP0A 4S2GA 4UW4A 4YVSA 4D7TA 1LAJA 2R073 4D94A 3AZXA 3O5SA 5A6YA 4BQ2A 2MEV2 2LW8A 1QJX1 3NV2A 1GWLA 4IE0A 5APAA 2XPJA 4EJRA 4Z82A 2WYFA 3AMHA 3FBMA 2A6YA 5L73A 4HL0A 4N8MA 3WF4A 2WNVA 1NCQB 1A78A 3M3OA 3ZYGA 2DURA 4BE3A 2ADEA 3R4SA 2WFF2 2P37A 5G05L 1I9RA 2BFUS 1NZIA 2Y64A 3MFAA 3CHXA 5FPZA 5GLUA 4DY5A 1EV13 3UT0A 5C71A 2TNFA 3IAQA 1UD1A 4AWDA 1YEWA 5JR2A 1X82A 4DS0A 3ZSLA 3WW3A 5KXDA 5HV0A 1FOD2 4L9BA 2WRAA 1RJ8A 2NM1A 4XEZA 4BLIA 5D2AA 1W28A 1KD7A 3V0BB 2IXKA 5FMBA 5JXHA 5HBAA 4QX0A 1EV11 1OLRA 5C3QA 3VBHC 4EWAA 4Y4YA 3LKJA 5DUUA 2BJSA 4DOUA 5DZEA 1RUF2 3ACFA 3L2YA 1C8M3 1W6PB 3MLKA 4KWJA 3I2IA 4LHNA 4GA9A 1Z7S1 4PHZA 1IS4A 2ZX4A 4TTGA 3KM5A 2VZOA 3KV4A 1JYIA 4Y26A 2W1UA 4XC9A 4AE2A 1V00A 2X53S 4KI5M 4MGYE 4HMZA 4V2WA 1VJ2A 1W8ZA 2Y33A 3GZAA 5T5OA 1CJPA 5FWJA 1COV2 1JN2P 2YC2A 2B8MA 3VBRB 3VD9A 3GF6A 5EXOA 5KHKA 2VVEA 3EXUA 3MICA 1C8M1 1RUC2 3VV1A 1GANA 4K9SA 2CSGA 3KMHA 1W99A 3K3OA 4XYXA 5BNNA 4XURA 1ZZ9A 1PGW1 1OKOA 3F2ZA 4X8PA 5EWSA 3KSCA 4OUMA 2DCKA 4HKWA 3VGIA 2C0ZA 2ZGMA 5JOYA 2FD8A 3WG2A 2E51A 4Q27A 2JIGA 2ZGRA 4YSFA 1H8TC 4JGYC 3WG3A 2LUWA 4HVOA 3CU7A 3WEZA 5FYZA 1CAWA 1GICA 2DV9A 4YM3A 2P3JA 4IETA 1LRHA 5FFOC 3HBKA 1JOPA 3Q9OA 3DV8A 4N9HA 5G04L 3J9SA 1RVF3 4Y20B 4Z1VA 3KVBA 3PVNA 1TQ5A 5F2SA 3VDDA 2VH9A 1O91A 3ROUA 3VN4A 4IESA 5BNOA 2ORXA 1UYPA 3HQRA 5LASA 4RR3A 1QJU1 3R05A 2XJPA 1JYVA 4META 4IL7A 3T4HB 2FCTA 3R0RA 5FCCA 2JB8A 5FZHA 1UYYA 2H6BA 4ZY9A 1UMHA 2GALA 1GQHA 1VBB2 1RVF1 2BGOA 4LHSA 4Z07A 3VBSA 5GZCA 2D7FA 3ZN5A 4AFAA 3HQUA 4XILA 4BK4A 1NY71 1XYOA 1C1FA 2JG8C 3LFIA 5CKNA 1VBA2 1WW5A 5FQ0B 2EXJA 5IAVA 2K2SA 3WW4A 4DZGA 4CE8A 4Y24A 3LEIA 5FBZA 3NJXA 3MBWA 4OUEA 1W3XA 4Q4V2 1PO12 5FPVA 3OUHA 4AI8A 4Q0VA 1REFA 4AQ2A 3O1PA 4JQRA 1O6UA 3RZKA 1HRV2 1NAEA 3T2PA 5KXBA 2VZ3A 4N43A 3ALQA 3IPVB 1HXS3 4FAHA 3CF6E 2IC1A 5C4WC 3VBHB 4CDWC 1LOFA 4R4ZA 4YFWA 2YDEA 5EJ1B 1RHI3 1ZNPA 2PAKA 4IE6A 3OG2A 3CZUA 3MEPA 2R062 5E6HA 1N3QA 2WT0A 1V0AA 5FAXA 1GSLA 2WSVA 1Q5OA 1S0JA 4OHXA 5JAXA 1UQXA 4BQ4A 4ZS2A 1JYCA 2XJVA 5GALA 3DKWA 1H6YA 2PLV3 4N7IA 1GZWB 4Q0SA 4B4PA 4BU2A 5JI9A 1OT5A 2ZBJA 3SISA 3W58A 1W0OA 4N53A 1O59A 3RNSA 4D8MA 1YCIA 4UFLA 1C3HA 3SKJE 2E7AA 3EJKA 5FZ1A 3HBZA 3TN93 2XL9A 4LBLA 4M01A 4M3CA 5A7WA 5A33A 2CL2A 3LIHA 1GNHA 2PLV1 1RIRA 4JGYB 3CJXA 3POGA 5ERLA 3VBOB 2OUJA 2WSUA 1NLSA 2GZWA 1TVGA 3DL3A 3SHRA 1OH3A 2QCSB 3LGRA 3B02A 3O14A 1CR7A 5ACA3 1JUIA 3ILRA 1MS9A 1UPSA 5CZKA 4CDXC 3ZYJB 2N7GA 4QPGA 4LTAA 3TN91 5L36A 3K46A 3KGLA 4ZZ8A 3THTA 1XYPA 2VZQA 1SLAA 1JMUB 5IK4A 3O1OA 4HKLA 4LBNA 4Q0UA 4UW5A 1TZOA 4QKNA 3RZZA 5LWBA 4PF5A 4WM8A 4AHXA 3FN9A 5DXDA 2EXKA 2Y6KA 3MW4A 4K6BA 4J6GA 4XF3A 5CISA 1RINA 3R4DB 4WVVA 5IT6A 3AKQA 1C5HA 1MEC2 2WABA 1YJKA 1GLHA 2LS6A 1QGLA 3GALA 3LQCA 3ILNA 3UGGA 2WO7A 2YBPA 4CYDA 3EB7A 4EYUA 4FPJA 4ES8A 4BQ5A 4LBJA 4DXSA 1DIWA 5DN2A 4HKOA 5GZEA 5DDJ3 2DTWA 1AYN1 2EICA 4EZHA 1EP0A 1OOPC 4HBNA 4V2VA 1N1TA 2B39A 4A3XA 1KFUL 1WCUA 4K1ZA 4MGTA 4LE3A 2Z4FA 4TXWA 3T09A 1JW6A 2OQ6A 4XOGA 5F9TA 4C1XA 2FZ1A 3T3YA 4NIAA 3D8CA 5LK5A 2FDKA 1LHUA 1AR91 3AZVA 3JD73 3IDAA 3C8XA 4YGDA 4CDUC 5A1FA 5FDBA 1Q43A 4IV1C 5LBFA 3FHQA 5DDJ1 4DPNA 2GAUA 3J7HA 3O0WA 4YVWA 5I8YA 4L92A 5I0RA 4BQXA 4B3NA 4CEWC 5FPBA 2SBAA 2VBBA 4UXAA 4YW3A 2WNUA 1OUSA 2FDHA 1SDWA 5C4WB 2D98A 2WR9A 3ATGA 3I2DA 2FQPA 1WA4A 4CDWB 5FK7A 1RYYA 3APBA 1GOHA 1W3VA 4IQPA 3ZFGC 4FP2A 2FDIA 4W8JA 4AI0A 5IVEA 4MGSA 2Z5WA 4M0NA 3OY8A 1Q8VA 4YZ5A 2FBEA 4AQTA 4YVSC 2C9AA 5FZDA 2WIIB 3WLUA 4XUPA 1ST8A 1N1VA 3NNLA 3KT4A 4EWEA 2AEZA 2BVBA 2ZGNA 2HWE3 1FX5A 4MXVA 4YPJA 5DZGA 4KWKA 5H9QA 4LIVA 4OYUA 1NCRC 2D5FA 2ZHMA 3B93A 2QDRA 4UI9L 4ARYA 1UKRA 2VW0A 3FFZA 3PHMA 4L8QA 1P8JA 4XABA 1T6GC 3ZXAC 5JOWA 3ZSKA 4LBOA 5LRRA 1STMA 2HWE1 3DGTA 2VOXA 2QBXA 3S7EA 4YFZA 1W9FA 4MH0E 4YZ4A 1R083 3VHRA 1F31A 1W6MB 3OGJA 4IEOA 4QWNA 2UWAA 2B4KA 4XHBA 3O1SA 4HETA 4BOWA 2B42B 3HN1A 4HFSA 1QWRA 2IUWA 4NAOA 2JDHA 1TMF3 3KCYA 5GKAC 4CDXB 2ZGLA 3LB9A 4XQ4A 1C1LA 4MLOA 4FFFA 1FYUA 4A6OA 2IFRA 3ZYBA 1GNYA 4FAGA 2GC3A 2A3WA 2R043 4M0HA 1X36A 3WOGA 4FPGA 1RC6A 2ZEYA 3LD8A 2FDJA 1JXNA 1PIV2 2RMU2 4CCDA 5A3TA 1UIJA 1UOJA 3I4IA 2AUYA 4PJYA 5JPMB 1JOBA 4X6RB 1TMF1 1S0IA 1DYKA 3PVOA 4YW2A 2ZEWA 1K45A 4P00B 4AI9A 3F95A 1S2KA 4FTEA 1SLBA 4PDWA 3VKNA 2R041 4HSLA 2RR13 5FR3A 3KGZA 2JE9A 3P3NA 1OOPB 1H4HA 1G8WA 2JDYA 4NRMA 4NN0A 2J22A 3C2UA 1VALA 1N47A 4KG8A 2VGDA 5IWFA 3THPA 5GLZA 3MF6A 2VL4A 2HWF3 2B9VA 4CDUB 4KL1A 4A7KA 1W2UA 4IV1B 1Y9MA 1YUDA 3B7MA 1AR61 1DFQA 4XFCA 3TAYA 3VD5A 4AL9A 1PK6A 1SG3A 2X10A 2XVGA 1JH5A 4UBGA 4CEWB 5I0SA 3GHMA 1KFXL 5CG8A 3ELNA 2VOKA 1MZEA 1EPZA 4PIYA 1RTVA 1GU3A 1O4YA 2AGSA 1AHSA 2DCJA 2HWF1 4XJ9A 4E8DA 1W6NB 2WS92 1SFNA 3ZFGB 5K4LA 3C7GA 1DGRA 1I5ZA 2G4IA 1W8UA 2HLEA 3N9MA 4KWUA 2YGMA 5KHHA 4GWMA 4HONA 2PQQA 3OBTA 1Y4WA 4A42A 5KWRA 2J1SA 3H3ZA 1K42A 1GWMA 4FOVA 4YVSB 5LA1A 5T5JA 3VDDC 1J3RA 2VNRA 1WWYA 4NWVA 1ENRA 2XUMA 3NWKA 1OLME 2CWSA 4QGLA 4RFRB 4AVAA 4COYA 5BNOC 3RGBA 5KXEA 1KS5A 3J8F1 4RR3C 2ES3A 2HWD1 1BK1A 3HAGA 4IGOA 2H6CA 5FUNA 3SEEA 3NVCA 3ZXEA 3VZNA 2VMDA 1TEIA 5C3PA 1NCRB 2P2KA 2VU9A 5F6LB 2CNAA 3BN6A 1V6MA 1SBDA 3KQRA 1QQP3 2WKKA 2GP3A 5F3CA 1O3SA 2D6MA 2J1EA 1CWPA 2VULA 2Y26A 4E2GA 2EAAA 4GIQA 1GYKA 4S2HA 1XE8A 1G7YA 5A6ZA 1IZ3A 1X8MA 2WINB 5CFDA 1RMU3 1WUVA 3NV4A 2YYOA 2VUAA 1MQTA 3RS6A 2V5DA 2W1QA 1FATA 2XOMA 3LEKA 4OHZA 3HWJA 1IKQA 1XBFA 1VBD3 3MIEA 4PT6A 4GJYA 2QKDA 2RM23 1QQP1 4NO4A 4UYBA 5CFCA 3L2HA 4OUSA 1GZCA 1W9WA 1ZBE3 2XONA 4A4AA 4W6YA 2CWMA 4LE4A 1LOFC 4LUMA 4XDPA 1RMU1 3RJRA 1CX1A 5DAQA 1LOAA 1W39A 2WQZC 4BPZA 2VMIA 4QGNA 5GM0A 1VBD1 2DBNA 4B1LA 2BW8A 2IWGB 1PMHX 2NYYA 1G9CA 1N3PA 5T5PA 1NLQA 2W92A 2XVKA 4G3YC 2ZGTA 4XMIA 4AFMA 2IVJA 2QQIA 1D4M3 4IW3A 5K7PA 3SITA 3VZOA 4LKEA 1OSGA 3VHNA 3BALA 1ENSA 4JKKA 3PIGA 2BV4A 4XF1A 2Q8EA 4QB1A 2BTVC 1WLWA 4W6WA 5DUWA 1JZ8A 2Q1ZB 4JC1A 4O65A 3V0AA 1OD5A 3A22A 3WUDA 3KF5A 1DQ4A 5FZOB 3ZYIB 3ZVXA 5F39A 1VE0A 2CGNA 2DVBA 4YZ2A 1V6NA 1ZBA1 4FBFA 4KGGA 4UFKA 4LBQA 2DFBA 1QY4A 2NMNA 2WDBA 2J1AA 3PUIA 4IDZA 2VXJA 3AB0A 5LBCA 2FCUA 2Y6FA 3AK0A 2WZR2 4NRQA 3SCFA 3W21A 1BJQA 1W2OA 1AR83 1CN1A 3BTAA 3GBWA 5L9BA 1AF9A 4OI1A 2ZTNA 2XLGA 4QPGC 1LTEA 2HWB3 2OZ6A 4NHXA 1FT9A 4K21A 3VKFC 5JLVA 2ARAA 4XBNA 2IFWA 5C9AB 3JZVA 1Q8OA 2ZMNA 2FZ2A 5A32A 1R1A2 4WVZA 3VDDB 1PVC1 3ZKUA 3ZXDA 1BEV2 5BNOB 2HYXA 5A70A 1AR81 3OTFA 4RR3B 5FMCA 1XNKA 2CHHA 2VNVA 1UNBA 2HWB1 1W9TA 4LBMA 1BMV1 1BBT3 2BWAA 2OPKA 4NVPA 2CDOA 1X9TA 1BLZA 2WZEA 3FLTA 2B9UA 4OMCA 4IEZA 5F8PA 5I8SA 4AYUA 1IPKA 1YQ6A 1W8FA 2NZ9A 1DQ1A 4XF9A 3MI8A 1NOVA 3JCIA 4E2QA 4K20A 4NMIA 5T54A 4XUQA 1RUE1 4ZONA 3WNLA 2CGPA 4Q4W2 5HCHA 3UK9A 4QX2A 3AYAA 3NW4A 3SH3A 1SLCA 1BBT1 4GB33 4PIZA 5JPNB 4FI9A 1ENXA 4YVWC 4R9BA 5GZGA 1GQPA 4LBKA 4YW7A 1PO22 2WNUC 4AEMA 3S7IA 3WF2A 1ZZ8A 4MHRA 3AP4A 3VUOA 1K12A 1V9U2 5FMDA 5AC91 1TME2 1Y9QA 1YQ5A 5A3WA 3KHCA 5EIYB 2D6KA 1BVP1 2E31A 4GB31 4Z8BA 3GZTB 1GUIA 2W91A 3HNBM 4DFSA 3MLJA 4MYEA 3GGLA 1AYM1 1ND3C 2WJSA 3THDA 4WZCA 5J7MA 3M4FA 3ASIA 5FRAA 2D6LX 3KB5A 1KEXA 4GULA 2JIJA 2XL7A 4SLIA 3WF0A 5F5QA 5FPUA 1QJY2 4ORFA 5F5AA 4MV2A 1NZCA 2IZWA 5FYMA 4QX1A 2V09A 3D0JA 5FREA 4K8FA 5SV5A 1GP5A 3BU0A 1G6NA 3E6BA 3PIJA 3IIIA 4AEDC 4F7ZA 1RUD1 5A7WB 4DRRA 5JI7A 4RQPA 1CJDA 1HN0A 2RDRA 3PDQA 1GR3A 5EQUA 3ETPA 4AR2A 4KMQA 3QH7A 2R7EB 4QPYA 3BUCA 1UZYA 4RHV1 3NAPA 5FYCA 1CONA 1NT0A 5F5CA 1KJLA 4B7EA 5I91A 2IXIA 1LJ7A 2JEMA 2MEV3 3KCCA 1HX6A 1TNFA 2UYBA 3LIGA 4QPGB 4OMDA 2VD7A 1FPN1 1YIPA 2Q1FA 4QMAA 1FV3A 2BRTA 4E27A 3PUQA 4AXOA 2W47A 3ZFEA 1ZRDA 2GC0A 1R64A 3ZX7A 1DGRN 3MIBA 1RUI1 1SBFA 4NHKA 3PL0A 4QDQA 4QT6A 5FZCA 4CU7A 5K0UA 1M4WA 4GWJA 3WP3A 5LA2A 2GP5A 3H7JA 1YFYA 4XFBA 1NA1C 4DRVA 2PELA 4I0AA 5FYBA 1PVXA 3H8XA 4YRDA 4P5HA 2YFUA 1SPPA 4AI1A 2F6BA 4PDWC 3S5AA 1B09A 3WW1A 4K1YA 4RGGA 3DXTA 3CEWA 3RRDA 4LHKA 3UJOA 1NXMA 2JDKA 3WDYA 1Z78A 2Y34A 4BLJA 5IATA 4NAMA 4OLLA 3E5XA 5A7SA 2EF6A 2XJSA 4LJHA 4Q4X2 4GKXA 4UF0A 5HCBA 2BU9A 3PVEA 1JOJA 2VTXA 3JBG2 4QKFA 3RMYA 4EWDA 3I49A 1OA4A 2HWC2 4XAAA 1BCXA 1W90A 4RYDA 3U14A 3A4UA 2RE9A 1PK6C 1DGWX 1RUF3 1ZZCA 3ILFA 3OPWA 5F3IA 3AL5A 4ZU7A 1QF3A 5LATA 2DUQA 2B45X 2WNUB 3H7YA 2W5FA 4QQPA 2PMWB 4JTOA 3ZDSA 1W8HA 5J98B 4HK8A 1PZ8A 3V56A 5JSOA 2P1BA 1COV3 2DBIA 5FK8A 1VR3A 1YNAA 3HPNA 5A3UA 4OI2A 5FV3A 3IDEA 4IEQA 5LY2A 3RVHA 3PTRB 1RUC3 4XFFA 1ND3B 4FO9A 1QNYA 1YJLA 3LDRA 3M7AA 1AL22 4I30A 4KU7A 3IZOA 4PQ9A 3VZMA 4GH4B 3WQ0A 1J3PA 3EHKA 4WV8A 4XMAA 1WW6A 2R0HA 2B5HA 1FMD2 4BB3A 4M4RA 4TZDA 3ZN6A 2JG9A 4DEQA 5DAPA 2RS52 5F1RA 4YM1A 2D6OX 1F2NA 4P14A 3G6JB 1NG0A 2RG4A 4Q8LA 4AHWA 2PYTA 4AAPA 1HQLA 2X5IA 3BOPA 3GNEA 3LCPA 3OCPA 3WVJA 4AEDB 5LEKA 1QH6A 3K75B 4LBQD 5FLJA 1J59A 1YHFA 3NSTA 1R092 4QXBA 1IG0A 1KJRA 1AR72 4HVQA 5CFDC 1ZM1A 2F4PA 3RDIA 3QH6A 1LCLA 4DXRA 1MQTC 2P34A 3FX3A 4FPOB 3W59A 4E4HA 5FUIA 1SQ4A 1VP6A 3M3QA 4LO7A 4YG0A 1W0PA 5CFCC 4AOCA 2A73B 2PN5A 1V6LA 4F83A 1YC61 2R1DA 4AF9A 5CNAA 3H8UA 4D3WA 3VDBA 1VBB3 2W94A 3O1UA 1DGLA 2R071 2Y6LA 3IDCB 5CBLA 4LITA 2VZTA 5IAXA 5JIUA 1NA1B 3SH4A 4P9YA 1XJAA 2L9LA 1VBA3 2BZDA 1UW8A 5FZ8A 2ZACA 5IJRA 3ZXGA 2VQUA 3FZ3A 4JTNA 4PDWB 3VD7A 4D0QA 4COVA 5C8CA 4Q4V3 1PO13 2D93A 5AFEA 1L7QA 1OQEA 1QOTA 2V4VA 2CYFA 4FPCA 5IUQA 3KHBA 5C5UA 3RZGA 2QQLA 3CLPA 3D6EA 4HANA 4ZKTB 2ZKLA 1HRV3 2E7TA 1WA6X 1ZRFA 4EE2A 3PUAA 3S0MA 3MV01 4QDSA 3WUCA 4Y1UA 2VZ1A 3OGVA 4PLNA 4QHBA 5H9RA 2X29A 1YQ8A 3K48A 2EXHA 2BYVE 4MVTA 1PO11 4XJAA 1PK6B 2BNNA 2R063 1DU3D 2DUPA 2C6SA 1UO9A 1K5MA 1U5IA 4XJZA 4QXHA 5JZGC 1IS5A 3NNMA 3MO4A 2A71A 2LTNA 2XLAA 4P9GA 1XNDA 4DO0A 2WFPA 2I2SA 1WGPA 2EXIA 2XHKA 3VDCA 2KR2A 3ZSMA 2XR4A 3U10A 4GWIA 1BXHA 4DXZA 2MNGA 4Z2AA 1EAH2 2DCTA 2VZPA 2VCMA 5FLHA 4M3CF 5FKBA 2OQ7A 3RZLA 1HIXA 4V1PA 3NV3A 2UWCA 5ABJA 4ES9A 4XQWA 1G86A 1N3OA 3AYDA 3N9LA 1UY1A 2GSYA 4JHTA 2YFZA 2AR6A 2OPWA 3KF3A 1RXFA 4P9JA 3TEWA 2BEOA 1UX7A 2VBPA 1PGL1 1RGSA 4OULA 1PX3A 4GQ7A 4TSVA 4QD2A 3B9IA 3WHTA 3HQXA 2XBO2 4OZXA 3ES4A 5DAVA 3ZSJA 4ASMB 4NIIA 5SV8A 1Y9GA 3H9AA 4QHZA 3D4KA 1APNA 1NYWA 2RV9A 5DPNA 2ZS6B 3AMQA 1C57A 1Q8QA 3CZJA 3H3LA 4LKDA 1CAVA 5CFDB 3TWIA 5JXIA 1MQTB 3S30A 3T0AA 1O8PA 2WA4A 2Y0IA 3DEMA 1JYTA 3ZPOA 4I09A 2RJ2A 2A6XA 4LIUA 2LALA 5L9VA 4XPVA 1DF0A 4HOOA 1VRBA 4CU6A 4P9LA 3ITQA 5C70A 5CFCB 3WP5A 1TNRA 5BPXA 1JBCA 1D7PM 1L7RA 2VCAA 5F6KA 2VC9A 4AVVA 2EAKA 1OA2A 3VD4A 2ZZJA 3I7DA 1SCSA 4UW3A 1DQ5A 2UY9A 2ZKNA 1MPXA 2WWSA 4NHLA 3PTYA 2YXSA 1U5YA 1O8SA 3UKTA 1S0EA 1SEFA 1H8VA 3IWZA 1IS3A 1S0FA 3Q8BA 1O5UA 1UZVA 2VOTA 4LK6A 1ZREA 4U36A 3RJ2X 1BK0A 3AZYA 4LHLA 5A3MA 3UGHA 1UIKA 4CUGA 3V0AB 2ZX2A 5FO8B 3LA7A 2HEWF 3I54A 3AKRA 4Q2FA 3S6PA 3OGGA 4XUTA 1GMMA 3SKVA 4Y1XA 4DB5A 3AYCA 2ET7A 2GNTA 1EV12 5FY9A 1QHDA 4RQPC 1GQGA 1AJKA 1J1TA 2UY8A 2A1XA 1T2XA 3WNNA 2VCBA 2W95A 3DECA 3WZ1A 4ET7A 4LR4A 2NMOA 3GCWA 1CAUA 2VOWA 3NAPC 4IXLA 1HXS1 4E8CA 1GNZA 3AX4A 1Z7S2 5JZGB 3HNMA 3U4XA 2ZGKA 1EY2A 4YLZA 2WO1A 1RHI1 2ZGSA 1W6OA 2C1FA 2VPVA 3SXWA 3TRSB 3B00A 2ZHNA 1XE7A 4CVUA 3ZFEC 4B8EA 3KV6A 2XWBB 4PI2A 5A32B 2IXCA 3NJZA 1SDDB 2WA3A 2GNDA 1QXRA 1WMDA 2IXJA 5K0UC 3E1F1 4GZ9A 4COZA 2KM2A 4WM7A 2P4EA 3J7LA 2C24A 1PGW2 2PTMA 3GHNA 1H8TB 3GYDA 2BDRA 3NKTA 4O9GA 5FY4A 3I2HA 3KCXA 4JX0A 4EROA 3N4MA 4AI3A 2G9FA 4LORA 4U2AA 5JOZA 3GXUA 5FZMA 2WWJA 1KDMA 2D5HA 2ZEZA 1LEMA 2QQWA 2ZX3A 4KNCA 1FI2A 1IPSA 2V5YA 5DG1A 1JYNA 2OA2A 2VQAA 1YQCA 2ENRA 4BM8A 2YV8A 3FWEA 3DKQA 3BTZA 1ZA4A 2WAOA 2G9ZA 2DCZA 2C9KA 2QTWB 4A7ZA 4XCBA 3J26N 2GNBA 1QJZA 5EP9A 3WCRA 1WD4A 3C7HA 4Y22A 5FOBB 2D40A 2JDMA 2OIIA 5JXJA 1PIV3 2RMU3 3ZMOA 3LE0A 2PHUA 3ETQA 5C3OA 1UN1A 2YMZA 5ACA1 1XXNA 2J42A 4IE7A 1B35C 2I45A 3MIGA 4R9CA 1ZRCA 1SMVA 2ILMA 1CZSA 4L2NA 1WD3A 4M4PA 4YW5A 4FFGA 3ZM8A 5FP4A 5T3NA 5HV4A 1QJU2 3MHZA 1T6BX 3H1MA 1LOBA 4CP9A 2WBKA 3WNXA 2IVIB 5A1AA 1H6XA 2PA7A 3ZYPA 5FP9A 5FUPA 1KDKA 2GC2A 2A75A 1CZVA 2JG8B 2YC0A 5K9YA 5FYSA 1ND2A 4D6SA 4AEKA 2Y6HA 2F17A 4D7YA 2JDNA 3P6BA 4Q1PA 2DFCA 1ZZBA 3CIHA 4BQ3A 1ZA7A 3ZXKA 4LPLA 3MFCA 4MZUA 4XQDA 3HMYA 2EIDA 2VZSA 2XG3A 1OXCA 3WNMA 4FTSA 1LENA 2DTYA 2R30A 3CO2A 4QKBA 4XFIA 3QCWA 5EZWA 3DYOA 5FBJA 1VIWB 4HK9A 4S2FA 3JD71 1HJGA 2X5IC 2Y60A 2VMGA 2DU0A 4JDMA 2WS93 1DLCA 4G4FA 5A7QA 4RQPB 4XXPA 3DYMA 1J3QA 4QDRA 3HVDA 1S55A 3AP6A 5T50A 5LZ6A 3NAPB 1UZWA 3QD6A 3T30A 2RS12 5J1XA 3ZPYA 3POYA 4LO6B 2E63A 3RI8A 3SH5A 1XRUA 4AI2A 1AL0G 5FLIA 1QXPA 4B29A 1F5JA 2WN2A 3H50A 4MXWB 4FOYA 2YY1A 4CP0A 3ZFEB 2PAMA 1HDKA 4TLGA 1PGSA 1LKNA 1Y3TA 4OQ9A 5F3EA 1OFNA 4H14A 3KT1A 5H9SA 5D21A 2WNVC 3G7DA 3KLSA 4DIQA 5A1LA 5IFPA 1JYXA 1DLLA 5C5TA 2W39A 4KBBA 5H9PA 4IV3A 4QKDA 2ZHKA 1SPPB 3J7MA 4ISQA 2XUEA 2ID4A 2RJLA 3UESA 5EFUA 5FPAA 1HB1A 5C8CC 2ZGUA 5F32A 5CG9A 4HPKB 5B2GB 4C0HA 2ORZA 2R0FA 4M00A 2VBDA 5A7NA 2E53A 4CCMA 5FZAA 1OURA 1O5LA 2F4LA 2ZPXA 4EN8B 1LHVA 2OZJA 1JZ5A 4UWDA 3HIFA 3WP6A 5J96B 2GH8A 3ZFFA 2ARXA 2J7MA 4CXWA 1R081 3A21A 3EBRA 2P3YA 1OA3A 3JB8A 4RL7A 3NL1A 2BBVA 3ECQA 1F8VA 4ZU4A 1REDA 1B35B 4IGQA 2Y6JA 1IQDC 2VAUA 4BZ4A 5EJ3A 1K5MC 3B01A 3VL9A 3CJIA 5FP8A 5KR7A 2QUOA 4QM8A 3PMSA 3NRUA 4FPLA 1YFXA 2VTFA 2VZVA 4Z2WA 3URFA 5JWPA 3N9PA 4Y4RA 2JD9A 1MS8A 1XPWA 1HB3A 1AYN2 1VB4A 1PM4A 1XSRA 2Y0OA 3I59A 4XZPA 2EIBA 4XAEA 1UY2A 5FZ4A 2VG9A 3B69A 4QXCA 5BNNC 5I8TA 4BDVB 5FWEA 3AFKA 3RFRA 2AH2A 1ODMA 3BTYA 3WY6A 4NE9A 3KV9A 1XU1A 2RR11 3O1TA 5ABJC 1AR92 4A3ZA 4LT5A 2W3JA 3ACLA 3MUZ1 4G9SB 2VTXJ 4TLFA 5DDJ2 2VQTA 3ENRA 3ZN6B 4BISA 4BQ1A 2DUOA 2ARBA 3RYKA 3S5QA 2WL1A 5IVJA 2WZR3 4FXKB 1REEA 5D8AA 4ASKA 4JDNA 2X5IB 1KRIA 1LEDA 4UFIA 1X50A 1OHFA 2C26A 3ORJA 4FOWA 4QQLA 2WNOA 5BUVA 1WBLA 2GN7A 3MIHA 4CPBA 5CAZA 4AHZA 1GWKA 4FQZA 4LOSA 4AZZA 3NJYA 1UMZA 1GP4A 1X9PA 2A3XA 4Q4Y2 5GLVA 4XIOA 1R1A3 1NXD1 3ZO0B 2R16A 4Q26A 1OH4A 1OKQA 2WZR1 3IMMA 4EN0A 3HJRA 5KHIA 4OQ8A 1BEV3 1OQ1A 1H2KA 1E5RA 2OW4A 3VHOA 2BPA2 1C8NA 1D2QA 4IE5A 1E5SA 4YG6A 4BXFA 4LKSA 1PZ7A 3VBRA 3VBSC 1WLDA 2W1WA 2WNVB 4ZHNA 2HBUA 1E57A 2JJ6A 5L7OA 4UT5A 1PNFA 1H1IA 1BYHA 5LW9A 1BEV1 3OD4A 4NHMA 2G1MA 5GZDA 1LU2A 1O4TA 4P9XA 4Q4W3 3K3NA 1XNBA 4WVMA 4AVSA 3O1MA 2CU5A 2VR4A 3BVCA 5C8CB 1AZDA 2A6ZA 3BYWA 1TG7A 1OUXA 4XACA 2VNOA 3I3DA 5C8WA 5IVFA 2H0VA 1DYOA 4N43C 2LRPA 3ZYRA 5CADA 1HV0A 2BUKA 3FLPA 2KXLA 4CCNA 3WSOA 4Q4W1 2QQOA 1ZYBA 2O1QA 4OVEA 1V9U3 5A80A 2AEYA 4CUCA 1TME3 3AMPA 3SNMA 3SCGA 3O0XA 2HEYF 4Y20A 2QDNA 2RM21 3QLQA 3U75A 3H8RA 4GAZA 4JKLA 4XJUA 2YBKA 1K5MB 3IN9A 4XIKA 5HCFA 2W9XA 1DZTA 3SQOA 3WF3A 1ZBE1 3N7JA 4UFHA 2Q8OA 4YG3A 1CZTA 4HT1T 2YPJA 5F5IA 3AC0A 1QJY3 3UL2A 1V9U1 2R042 2A70A 3VZJA 2GMPA 4N53C 5HCAA 2CDPA 4EV0A 2AC1A 2G19A 2WYSA 3IIAA 4HLTA 4PIXA 5BNNB 2FHRA 2KA3A 5FYHA 4M3CE 4JAAA 5J36A 4UOJA 4NIGA 1D4M1 4OI0A 3SMHA 4WM7C 2DVAA 3JQXA 3LZZA 2QQPA 4FPHA 3ZYFA 2WLPA 3I3QA 1AR62 4E2SA 1E5IA 1POQA 2JKXA 1MZ5A 1W0NA 3K2OA 5T55A 1IG3A 3RPQA 3VBUA 2I07B 1A34A 1CAWB 3R6SA 1EUUA 2PHFA 1POV3 1OVSA 2XLFA 3O0VA 4DXTA 3WV6A 4ITCA 3UGFA 4CU9A 3IPVA 3AFGA 5E89A 4AVCA 3CDZB 1H2NA 2HWF2 2EIEA 1UU6A 2P3KA 3AZWA 2B46X 4I2OA 3M8LA 4NWWA 2CGOA 1A8MA 2ZGQA 1CAVB 1QDOA 3HEIA 3WW2A 1QH7A 4J25A 1CAXA 1RUJ3 1X7NA 4RS5A 4WM8C 4AFBA 2Q1MA 4ARXA 1VB2A 4QM9A 5GZFA 4GD4A 3I3MA 2XKOA 4MGKE 4L0PA 1POV1 3LSEA 3POIA 1AXYA 4BIFA 5KBFA 2O8OA 4GMP3 2RVAA 5FJKA 3RQ0A 3O1VA 5E1RA 3AJZA 5GJ6A 1PMIA 4CDQA 1I1EA 5IK7A 4CTEA 2OX0A 3J8F2 2HWD2 3QBQA 5I0UA 3T2OA 1W9YA 5E8AA 3VBSB 3NJVA 4C8DA 4F3JA 1RUJ1 3TEYA 3WDWA 3BODA 3KS7A 2WT1A 1VMJA 2D3RA 4CCOA 3LDBA 1H1MA 4NR1A 4Q4X3 4KQ7A 1ND2C 3LOIA 2VQ0A 4GMP1 5DAWA 3JBG3 1LU1A 2JKBA 2DVGA 2VM9A 1WLCA 1WZXA 3LEMA 4XJWA 2HWC3 3POSA 3VBOA 3WDVA 5J09A 4ISRA 3IKWA 1XQNA 2DVDA 3WQ7A 4MUVA 1CPNA 4N43B 4MX3A 5M0TA 1UY4A 5EYYA 3WD5A 3OUJA 3AJYA 1AXKA 3JBG1 1W8OA 2HKXA 3KQ4B 4JV4A 1UY0A 3IB3A 3C7OA 2HWC1 4I0BA 5ANNA 3DF0A 3SLIA 2XH6A 3HT1A 1VMFA 1CD3G 5HPOA 1OF3A 4D7SA 2UU8A 4NROA 5FMOL 1AL23 4MGZE 3FHIB 3AXDA 3NQHA 4MGIE 2Z79A 1W6OB 2IXHA 2VUJA 1FMD3 3ON7A 2WLQA 1V6JA 1UYZA 2Y8KA 4N53B 3FUQA 3IDBB 4Y5Z0 1W2TA 3I2JA 4MG2A 4URAA 3HNYM 5EHDA 4M3CB 4EN6B 1YWKA 5A33B 4WM7B 4IEPA 1YI9A 1CPMA 3FE5A 3OD0A 3KV5A 3OEBA 4QQOA 1E5HA 3UYJA 1R093 1VMHA 1ZBA2 2O14A 4IV3C 5DMYA 2A3YA 4HG6B 1AR73 5J3UA 3THCA 3VDAA 4DQAA 3U78A 2DWRA 2RDQA 2I74A 5DUXA 3WINE 2CTVA 2OKXA 4PBPA 3DCQA 3LWCA 1SCRA 3K77A 1UXXX 1UU4A 5T52A 4CPBD 4IUGA 5B4NA 2CAUA 1IS6A 1R091 3OBAA 1QNWA 5BNPA 5FXWA 5DAXA 5T5LA 4GJZA 1AR71 4KBZA 4WM8B 3W5NA 4OCTA 1SLIA 4A7YA 1LOGA 2VNGA 2WFF3 1BKZA 2MEV1 4CCLA 5BXXA 3ZXJA 1PVC2 4N7UA 1HRI2 4GALA 4QGMA 2JDZA 2JDAA 5LEJA 1JUHA 1AR82 3AP5A 3CJIC 4LA3A 1XNCA 2OT7A 4FVVA 1RITA 1FOD3 4CP9B 2RJKA 2D97A 2P5BA 3MUY1 4LUKA 2OUHA 2XJUA 2LM3A 3T1MA 2WFF1 3DPRA 3E6DA 2W2IA 1YFUA 3JB4C 4MO3M 4EZ4A 5LY1A 1UOFA 4J1WA 2D43A 3TEZA 3RG0A 2XDVA 1EPWA 1RUE2 1X8EA 2ETEA 4YVWB 1FOD1 1VBE2 2WQ8A 5ANQA 1BBT2 1GZ9A 1W6MA 2VECA 5FO7B 3RZHA 4YM0A 2ZEXA 4O61A 1NKGA 1WMFA 3LOBA 4BYYA 3TNQA 5DUVA 5D8AC 1AJOA 1RUH2 4Q29A 4CDXA 5IVVA 4RGAA 3LEGA 1W6QA 2BERA 3MIDA 3EYPA 4MADA 3O12A 1UWWA 1CGPA 3PVBB 3LF7A 1UZ0A 1RUF1 4C91A 2PQSA 2D6NA 3OY8B 3POJA 5EPAA 5AC92 3NMBA 3K4ZA 1VBC2 1FXZA 3FHAA 1EAH3 5CKQA 1U0AA 1CIYA 3B94A 2RHPA 1AYM2 4I3PA 4PF1A 2WNEA 5JSRA 1IHMA 1Q8SA 1COV1 3WT3A 1JZ2A 2GNMA 2YPDA 1YO8A 1ULPA 2MHFA 2QQKA 3GJAA 3UJQA 2JDUA 4LOTA 1OOPA 1RUC1 5BY5A 5FJHA 3VBRC 4NUBA 3IM0A 3ZR5A 5F37A 1OLQA 5L7OC 3FUOA 4UBHA 1Y43B 3P1IA 3FMGA 3H1WA 4IV3B 1RUD2 4CDUA 1IGOA 2RS32 2A6VA 1I5PA 4IV1A 1ZZ7A 3EQEA 4LO4B 4H2AA 1RUG2 1MZ6A 1AVBA 3GDBA 2W52A 1VRH2 5EJZB 2WZPP 3FL7A 3W5MA 3USSA 3I2OA 2O0OA 3C3VA 4RHV2 4DINB 5FYVA 4YZ1A 3OYWA 4L11A 3I2GA 2BFUL 5F2WA 5IVBA 2ERFA 4C1WA 4JGZA 4AGGA 1WMXA 1XC6A 2LROA 1BVVA 2Q30A 3PNAA 4QX7A 2BBAA 1FPN2 2DCYA 3ZFGA 1ACCA 1MR5A 1AXZA 1VAMA 3Q8AA 5DZFA 4NIHA 4R9DA 3C7EA 4IE4A 1HB4A 5FOJB 2BGPA 1HB2A 3KD4A 1ASJ2 1YIFA 1RUI2 5CB7A 4KH9A 4BA6A 1Q3EA 4IEYA 4FQ4A 3K4AA 4I3GA 3CJIB 2W87A 3PU8A 3N9OA 2G9GA 1OMIA 3WDXA 1L7LA 5IFTA 3NNJA 1RUOA 3D82A 1VBB1 2W0XA 2WN3A 1DG6A 1KQRA 3BU7A 3LPGA 4C0BA 1ULDA 5BYNA 1NCRA 4LLOA 4LKFA 1R1ZA 3I59B 3E97A 3LAGA 1H2MA 1VBA1 3EMRA 5EYXA 3VL8A 1LHNA 4TYSA 2ZOEB 4I01A 1SFYA 1OPMA 1Z0HA 4D6QA 1FV2A 3AMNA 4Q4V1 3MW2A 2HBTA 4ZS3A 3NNFA 3NV1A 4CRQA 2E9QA 3A0KA 1HRV1 1US2A 2BOJA 2RDSA 1F5FA 3J4UH 3ZOIA 4BJ0A 3VBUC 5D8AB 2MPFA 2YGLA 1Z7S3 4E4SA 5FZKA 5FYTA 2J1RA 2Y38A 1C28A 2BGCA 3MPBA 2HEVF 1EYBA 1HLCA 2W46A 4DEVA 5FYIA 3TBDA 5A7PA 2EIGA 1POV0 2OS2A 2J1VA 2R061 4XFHA 4CZSA 5KC5A 1J83A 2A6WA 4LQRA 5LCWL 1MS0A 4RS5C 3PURA 1JTZX 1K3IA 2Q0AA 1H4GA 3K51A 4XFAA 3VLBB 4P08A 1XNAA 1O3TA 3JUUA 2K9ZA 3MLLA 5KC6A 1UXZA 3WXPA 2ZGOA 2EVXA 2GH2A 3HT2A 1Q56A 3CQOA 2B7YA 2E7QA 4CDQC 3T08A 5CEHA 3GJBA 4IEWA 5C3SA 3VD3A 3BPSA 5FXZA 3RSJA 4GMP0 3GBGA 1ULGA 2XQXA 3MGUA 2JXAA 5L7OB 1US3A 1HKDA 3AP7A 3WQBA 2ATFA 1L3JA 1LGBA 1UY3A 3I3EA 3WP4A 4A6SA 5FZOA 2QQUA 4YGBA 1F4HA 2WZ8A 4H55A 3S57A 3OOXA 3GBFA 1W8WA 3MIFA 4WVMB 3WQ1A 5FY1A 5JIAA 1D2SA 1UL9A 1ZRIA 3VBOC 5IK8A 5A3PA 1UZZA 1MEC3 2H0BA 4UAPA 1QJX2 3MV11 1WMEA 2ZCWA 2C4XA 3U11A 1PHMA 1V6OA 4XFGA 4AGRA 4INDA 1QJU3 2WAAA 1DGWA 4XDOA 4Y1VA 4BK5A 2UYAA 1U12A 4GKYA 1UMIA 1OD3A 2JDPA 3HN3A 2XWJB 5C9AA 4X8NA 1H2LA 3P5BA 3I3BA 4L97A 2R072 1MEC1 2DF7A 1X33A 2VZUA 4H7LA 2QNKA 1A3KA 3O1RA 1OVPA 2Q4SA 2R1BA 1OLMA 2VMEA 1OF4A 4NPMA 3OBZA 2ZABA 1UU5A 1F35A 2PHXA 3N9QA 5CKMA 3RYPA 1S0BA 2VOVA 3ABZA 3BIWE 4CCKA 4Q8KA 3WNOA 3DYPA 3QOPA 4XTMA 4YM2A 5HXMA 4HN0A 1SACA 5IHRA 3KT7A 2W08A 1VLNA 4LNVA 5AFBA 3TB0A 2P6HA 5LK7B 1S2BA 4CXYA 4ZZ5A 4LBQB 4NJ4A 3T2TA 1WCKA 2WWUA 3H8OA 2PXJA 4Y5SA 3MDPA 2YROA 4OHWA 1O7FA 5FY0A 2E32A 2GC1A 1YLLA 2FMDA 3RZMA 1GP6A 1BZWA 3ZIXA 2WQ4A 4K8RB 1JODA 2BWCA 3TYJA 1GV9A 4P9IA 3VBUB 3RWNA 4AW7A 3NO8A 3Q8CA 2RS13 3R4UA 4AFCA 1A8DA 3WCSA 3KVAA 2PHDA 1S0CA 5LBBA 1LOEA 1UOGA 2ZGPA 1LHOA 3M3EA 5BNPC 4AGVA 3KWVA 3DXUA 4CCJA 1CAXB 4DY3A 1C8M2 4RS5B 1NQDA 2RS11 2VE1A 4YYOA 1V6KA 3LA3A 1WW7A 1F9KA 3USUA 1WLTA 1XNTA 2KD7A 4W6XA 3I2FA 4A2UA 5CA6A 4CDQB 1MS1A 3POEA 2AYHA
chains in the Genus database with same CATH topology
1Y7BA 2DVFA 1ZVFA 3NKGA 5I93A 1PGL2 2Q5TA 4ZXKA 3VBFA 4AFDA 3DPRC 4AK3A 4X6QB 4PCRA 4YGCA 3FJSA 2XB6C 3AKSA 5C6CA 5FTTC 3VKLA 4FCAA 1H0BA 1D4VB 1DQ0A 1NQJA 1LESA 4P9WA 4OHVA 5J37A 4BMBA 2W68A 3H0OA 3ZSEA 1QMJA 1YRZA 2WC2A 2HYKA 2NPIA 4QXKA 1PZ9A 4JDOA 1PIV1 2RMU1 1CVNA 4KU8A 1RVF2 2AREA 1AYN3 1VAVA 1DZQA 1NY72 3AKPA 1Q8PA 2JECA 1LECA 3V65A 4L99A 3UKNA 1AR93 2TUNA 1H9WA 2CV6A 5CIRA 4R4XA 2JG9C 2VVFA 4R52A 2K0GA 1G9AA 2VMHA 1CX4A 3IT8A 4LULA 3AP9A 1KS4A 1MS3A 3BCWA 3E6CC 2JD4A 3H1YA 3V64A 4XXAA 1URXA 3PJYA 3N35A 1S0GA 5JCTA 1DBNA 2V73A 2VW2A 4Q4Y3 3ZIWA 5KXCA 1MS4A 1UPIA 1HXS2 2VY0A 2WS91 2Z2SB 4XW3A 1NE4A 2TBVA 4LEJA 3N7LA 4JGZC 3WDTA 4XETA 2PFWA 3WX5A 1RHI2 2UURA 2VVDA 4FT8A 4YNIA 2XGXA 5BNPB 3AYEA 5K0UB 4OI4A 3OPZA 4Q4Y1 4DMIA 4O9EA 5HI0A 3AXEA 5K8SA 1RL3A 1ND3A 4KG0A 4BMEA 3FFQA 1V6IA 2PLV2 4GH4A 1AX1A 2ET1A 4H7MA 4WBBA 1ULEA 2X8KA 2Z42A 4J1XA 3DPRB 4QPIA 3M1HA 1N1YA 1D0HA 4CEYA 3TN92 4CP1A 5C33A 4ATFA 3HD8B 4AEDA 4EN7B 4FXGB 5JMCA 1HQNA 4Z92B 3B5LB 3WR0A 1YYNA 1LOCA 1DQ2A 2NN8A 1S1AA 3INAA 3AM2A 4Y1YA 5ACA2 4YW1A 5HXVA 2O8QA 1WCSA 2PHTA 2XJTA 4PLMA 1DZRA 1O4ZA 1W6QB 2OYZA 5JVVA 2ZHLA 3VKOA 4QU2A 1RB8G 1FAYA 1GBGA 2VXRA 1SLLA 1NCQA 2D6PA 3L9JT 1IPJA 4IERA 4E4ZA 1QXJA 5L19A 1SLTA 1NA1A 3A0NA 1YFWA 1JHNA 4RFT0 3M3CA 5FO9B 2JG9B 1AR63 4BWOA 3TNPB 2E6VA 1YXWA 2CAVA 3BOWA 2JE7A 4FP3A 1UX6A 3V0BA 4JVAA 2DU1A 4OHYA 3FBYA 2BQPA 1CQ9A 3T1LA 3JD72 4RSUA 4XHXA 2D3PA 1NE6A 2ZAHA 1ZZ6A 1LODA 2GDFA 2AENA 4FPFA 5KHGA 2VW1A 1W6PA 2JICA 3U07A 3GZUC 3OYWB 3BB6A 1A6CA 2ZMLA 5BV6A 2OVUA 4UW6A 4JGZB 1OI6A 4R9AA 5E16A 3J8F3 2HWD3 3POWA 4XE9A 3WDUA 1R1A1 3AMMA 2BNOA 3N3HA 3LSDA 5C9AC 1I6XA 4H3WA 1ZRRA 2DYCA 4LLFA 4XF0A 1UCXA 4PLOA 2HWE2 3MYXA 4COUA 4GWNA 3M3IA 3O7OA 3WHUA 4WZFA 1SBEA 5D1IA 4D69A 4FPEA 1AX2A 2D44A 1FNYA 1U5XA 1PO23 1HW5A 4FSJA 1QOSA 2EALA 4NOTA 5I0TA 1H9PA 3DUIA 3D0SA 2R32A 1R082 4GXLA 1ENQA 1HV1A 4RA0A 4IEXA 1WCDJ 1KXGA 4YARA 1TMF2 3VZLA 1PO21 4LO8A 2SLIA 4BCUA 3CNAA 3MF9A 1TME1 4R8HA 5KHJA 3ZXLA 4F8AA 3VHPA 1ALYA 1J58A 4WVWA 3W9AA 3E5UA 1QKQA 2D3SA 5BNQA 1MVEA 2P17A 4B4QA 1C5IA 2GMEA 3H3UA 3E5QA 1G9FA 3ZN4A 4ASLA 5JDBA 5ABJB 5CVRA 5FQ0A 4FTBA 1G9BA 1UF2C 2HJIA 1QJY1 1ZBA3 2RR12 4HZFA 5JR7B 2UWBA 4XDQA 1ULCA 4LO5B 1UAIA 3CL1A 1LULA 3DN7A 2XKPA 3PMEA 1D0GA 2FMYA 3OBRA 2EA7A 4C90A 3VBFC 1GKBA 3VBHA 4B4RA 4AQ6A 1DHKB 5TSWA 3ZMNA 3UKVA 2QJVA 3HR9A 3KZ4C 5GLTA 3RYRA 2PHLA 3IBMA 4AQSA 3EO6A 4FPYA 1PVC3 4QQHA 1DYPA 5JZGA 1HRI3 4XBLA 1GZWA 1MVQA 3X29B 3M70A 4AG4A 1O3RA 3U0ZA 2XVLA 2YHJA 4SBVA 2ZZQA 4N90A 1NLRA 5LRSA 4DNYA 5JSPA 3JQWA 1CIWA 1HRI1 1V70A 1ZX5A 3ES1A 1LGNA 2R6QA 1H8TA 1RUE3 3AKTA 4JGYA 1J1LA 2ZA9A 2R49A 3QACA 1RUNA 3OJBA 1VBE3 4JCKA 1ULFA 2QVSB 1QQP2 4QQ2A 4Q4X1 1GFF2 1IOAA 3BPZA 3OF1A 4BIOA 1RUH3 2ZX0A 4IEUA 4E9KA 3N7MA 1WW4A 3LA2A 4ZU5A 2XJRA 1RMU2 3MZHA 4N9IA 1VBE1 5AC93 1CAUB 2P3IA 1I3HA 1VBD2 1KITA 3P3PA 1VBC3 2RM22 1XU2A 4K3UA 1AX0A 2QZ3A 4I02A 1AYM3 1RUH1 4JRLA 4W65A 1PNGA 1ZBE2 1WBFA 4COWA 1XYNA 4AHYA 1UKGA 1MS5A 4HSJA 2GMMA 1IQAA 3AZZA 4KGQA 2RS53 4K40A 2AZ5A 5IK5A 2GU9A 4PBOA 4S2DA 1VBC1 2JG8A 3N36A 1AL21 2NLRA 1LB2A 2Z69A 4AVBA 4YGEA 5E88A 1FMD1 1D4M2 4KWLA 1RUD3 3USUB 3ZXFA 2QZ2A 2RS33 4GH4C 3N7KA 4Q0QA 1RJ7A 1RUG3 2BVVA 2RS51 3B9CA 5EV7A 1VRH3 3PLQA 3MPPG 4URTA 2PHWA 2QFEA 4RHV3 1PM7A 5C4WA 4IEVA 5FMOS 3VBFB 2YUEA 4CDWA 4QPIC 3ZFFC 5FPXA 3TOJA 4EN9B 1C4RA 4AEJA 4Y22B 4CEYC 2XJQA 5GLWA 1FPN3 2RS31 2PAEA 1DDLA 1RUG1 1LR5A 3IMNA 1VRH1 3VZKA 1ASJ3 1RUI3 4NPRA 1H30A 2C5DA 1LGCA 1QDCA 4HN1A 4QX5A 2WT2A 2HWB2 1LHWA 4BHPA 1BMV2 4TWTA 1BQPA 4MXWA 1CESA 2JENA 5CU1A 4XBQA 3UV9A 1RUJ2 1ND2B 1ASJ1 2IXLA 1TE1B 4XJ8A 1NCQC 2ZJCA 1OPOA 4Y1ZA 1QU0A 1H1AA 4FOQA 4HVRA 5DG2A 2CY6A 4E4DX 1OFSA 1S0DA 2ZAAA 1OQDA 4XF4A 4OFGA 1IKPA 3MW3A 1HQWA 4MSVA 4HPKA 4LA2A 3VKMA 3WG1A 5A3LA 3RMXA 3B3QE 1AUYA 4CP2A 1U5ZA 5AVAA 2NP0A 1VAKA 3PJQA 4GB32 2NQYA 4I0WB 1B35A 1ONAA 1M06G 2GN3A 2JX9A 3ME2A 4JRAA 2ZX1A 1G9DA 4Q1RA 1MZFA 3I8TA 4BH9A 1EAH1 4RD7A 2XBO3 2ZMKA 3FC0A 5AVPA 1YI7A 2BNMA 5J48A 5JOXA 4YZ3A 4YW4A 2A5ZA 4FPKA 3D5OA 4CEWA 3WG4A 4K7JA 4ATEA 3ST7A 1DQ6A 1N1SA 2XBO1 4QPIB 1FNZA 3ZFFB 1QJX3 2A7AA 2QE3A 4Q0PA 4CEYB 2TEPA 3M2MA 1W6NA 3JU9A 3FLRA 3RI9A 3SCHA 1O3QA 2PHRA 1QOOA 4ONUA 1MACA 2YZ4A 4S2GA 4UW4A 4YVSA 4D7TA 2R073 4D94A 3AZXA 3O5SA 2MEV2 1QJX1 3NV2A 2XPJA 4EJRA 4Z82A 3AMHA 3FBMA 2A6YA 5L73A 4HL0A 2WNVA 1NCQB 1A78A 3M3OA 3ZYGA 2DURA 4BE3A 3R4SA 2WFF2 2P37A 1I9RA 2BFUS 3MFAA 5FPZA 5GLUA 4DY5A 1EV13 2TNFA 1UD1A 4AWDA 1X82A 4DS0A 3ZSLA 3WW3A 5KXDA 1FOD2 4L9BA 1RJ8A 2NM1A 4XEZA 4BLIA 1KD7A 3V0BB 2IXKA 5HBAA 1EV11 1OLRA 3VBHC 4EWAA 4Y4YA 3LKJA 5DUUA 4DOUA 5DZEA 1RUF2 3L2YA 1C8M3 1W6PB 3MLKA 4KWJA 4LHNA 4GA9A 1Z7S1 1IS4A 2ZX4A 3KM5A 1JYIA 4Y26A 4AE2A 1V00A 2X53S 4MGYE 4HMZA 1VJ2A 3GZAA 5T5OA 1CJPA 1COV2 1JN2P 3VBRB 2B8MA 3GF6A 5EXOA 5KHKA 2VVEA 3EXUA 3MICA 1C8M1 1RUC2 3VV1A 1GANA 4K9SA 5BNNA 3KMHA 4XYXA 1ZZ9A 1PGW1 4X8PA 5EWSA 3KSCA 4OUMA 2DCKA 4HKWA 3VGIA 2C0ZA 2ZGMA 5JOYA 3WG2A 2E51A 4Q27A 2ZGRA 4YSFA 1H8TC 4JGYC 3WG3A 2LUWA 4HVOA 3CU7A 1CAWA 1GICA 2DV9A 4YM3A 2P3JA 4IETA 1LRHA 5FFOC 3Q9OA 4N9HA 3DV8A 3J9SA 1RVF3 4Y20B 4Z1VA 3PVNA 1TQ5A 3VDDA 2VH9A 1O91A 3ROUA 3VN4A 4IESA 5BNOA 4RR3A 1QJU1 3R05A 2XJPA 4META 4IL7A 3R0RA 5FCCA 2H6BA 2GALA 1GQHA 1VBB2 1RVF1 4Z07A 3VBSA 5GZCA 2D7FA 3ZN5A 4AFAA 4XILA 1NY71 1XYOA 1C1FA 2JG8C 1VBA2 1WW5A 5FQ0B 2EXJA 2K2SA 3WW4A 4DZGA 4Y24A 5FBZA 4Q4V2 1PO12 4AI8A 4Q0VA 1REFA 4AQ2A 4JQRA 1HRV2 5KXBA 4N43A 3ALQA 3IPVB 1HXS3 4FAHA 3CF6E 2IC1A 5C4WC 3VBHB 4CDWC 1LOFA 4R4ZA 4YFWA 2YDEA 1RHI3 1ZNPA 2PAKA 3MEPA 2R062 1N3QA 2WT0A 5FAXA 1GSLA 2WSVA 1Q5OA 1S0JA 4OHXA 5JAXA 1JYCA 2XJVA 5GALA 3DKWA 2PLV3 4N7IA 1GZWB 4Q0SA 4B4PA 5JI9A 2ZBJA 3SISA 3W58A 1W0OA 4N53A 3RNSA 1YCIA 1C3HA 2E7AA 3EJKA 3HBZA 3TN93 2XL9A 4LBLA 4M01A 4M3CA 5A33A 2CL2A 1GNHA 2PLV1 1RIRA 4JGYB 3CJXA 3VBOB 2OUJA 2WSUA 1NLSA 2GZWA 3DL3A 3SHRA 2QCSB 3LGRA 3B02A 3O14A 1CR7A 5ACA3 1JUIA 3ILRA 1MS9A 1UPSA 4CDXC 3ZYJB 2N7GA 4QPGA 4LTAA 3TN91 5L36A 3KGLA 3THTA 1XYPA 1SLAA 5IK4A 4HKLA 4LBNA 4Q0UA 4UW5A 3RZZA 4PF5A 4WM8A 4AHXA 5DXDA 2EXKA 3MW4A 4K6BA 5IT6A 4J6GA 4XF3A 1RINA 3R4DB 4WVVA 3AKQA 1C5HA 1MEC2 3GALA 1YJKA 1GLHA 1QGLA 3ILNA 4CYDA 4FPJA 4ES8A 4LBJA 1DIWA 5GZEA 4HKOA 5DDJ3 2DTWA 1AYN1 1EP0A 1OOPC 4HBNA 4A3XA 1N1TA 2B39A 1KFUL 4K1ZA 4LE3A 1JW6A 4XOGA 5F9TA 4C1XA 2FZ1A 3D8CA 5LK5A 1LHUA 1AR91 3AZVA 3JD73 5FDBA 4YGDA 4CDUC 1Q43A 4IV1C 5DDJ1 4DPNA 2GAUA 3O0WA 4YVWA 5I8YA 4L92A 5I0RA 4B3NA 4CEWC 2SBAA 4UXAA 4YW3A 2WNUA 1SDWA 5C4WB 2D98A 3ATGA 3I2DA 4CDWB 2FQPA 1WA4A 3APBA 4IQPA 3ZFGC 4FP2A 4AI0A 2Z5WA 4M0NA 3OY8A 1Q8VA 4YZ5A 2FBEA 4AQTA 4YVSC 2C9AA 2WIIB 3WLUA 1N1VA 3KT4A 4EWEA 2BVBA 2ZGNA 2HWE3 1FX5A 4MXVA 5DZGA 4KWKA 5H9QA 1NCRC 2D5FA 2ZHMA 3B93A 2QDRA 1UKRA 2VW0A 3FFZA 3PHMA 4L8QA 1T6GC 3ZXAC 5JOWA 3ZSKA 4LBOA 5LRRA 2HWE1 3DGTA 2VOXA 3S7EA 4YFZA 4YZ4A 4MH0E 1R083 3VHRA 1F31A 1W6MB 3OGJA 4IEOA 2UWAA 4XHBA 4HETA 4BOWA 2B42B 3HN1A 4HFSA 1QWRA 1TMF3 3KCYA 5GKAC 4CDXB 2ZGLA 3LB9A 4XQ4A 1C1LA 4MLOA 1FYUA 2IFRA 4FAGA 2GC3A 2A3WA 2R043 4M0HA 1X36A 3WOGA 4FPGA 1RC6A 1JXNA 1PIV2 2RMU2 1UIJA 3I4IA 2AUYA 4PJYA 5JPMB 4X6RB 1TMF1 1S0IA 1DYKA 3PVOA 4YW2A 1S2KA 4FTEA 1SLBA 4PDWA 3VKNA 2R041 4HSLA 2RR13 3KGZA 2JE9A 3P3NA 1OOPB 1H4HA 1G8WA 4NN0A 3C2UA 1VALA 1N47A 4KG8A 2VGDA 3THPA 5GLZA 3MF6A 2HWF3 4CDUB 4KL1A 4A7KA 1W2UA 4IV1B 1YUDA 3B7MA 1AR61 1DFQA 4XFCA 3TAYA 1PK6A 2XVGA 5I0SA 1JH5A 4UBGA 4CEWB 5CG8A 3GHMA 1KFXL 3ELNA 2VOKA 1MZEA 1EPZA 4PIYA 1RTVA 1O4YA 2AGSA 1AHSA 2DCJA 2HWF1 4XJ9A 1W6NB 2WS92 1SFNA 3ZFGB 1DGRA 1I5ZA 2G4IA 4AVTA 5HCAA 5KHHA 2YGMA 5KWRA 4GWMA 2PQQA 3OBTA 3H3ZA 4FOVA 4YVSB 5T5JA 3VDDC 1J3RA 2VNRA 4NWVA 1ENRA 2XUMA 3NWKA 4QGLA 2CWSA 4AVAA 4COYA 5BNOC 5KXEA 1KS5A