3AJZA

Crystal structure of ancestral congerin con-anc
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'GVEVKNITFKLGMYLTVGGVVNSNANRFSINVGESTDSIALHIDHRFSYGADQNTIVLNSMVDDGWQQEQRSKNFPFTAGEHFQITITFDIDTFYIQLPDGHKVEFPNRHGDEAFNFIYLAGDARLTFVRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancestral congerin Con-anc
publication title Tracing protein evolution through ancestral structures of fish galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ajzA00
3AZWA 2JECA 4HANA 1V6JA 3ILRA 2V73A 1BYHA 1IS4A 1UL9A 2CWMA 3O0XA 5E89A 5E88A 4XIOA 1JW6A 5GLWA 3OJBA 5JOXA 1MR5A 1LU2A 1FNYA 5CA6A 2LTNA 3A0NA 2E7QA 2W39A 1WW6A 1KITA 1AXZA 2ARXA 3V0AB 3UJQA 4PBPA 3SITA 3T2TA 3N7LA 4FPOB 1DBNA 5JVVA 1V6MA 1SLCA 3WHUA 1N3PA 2ZGKA 1C1LA 5JLVA 2E7TA 3B00A 3W59A 1G8WA 3AP4A 3UL2A 3WNXA 3ASIA 4FQZA 3POSA 1Q8QA 4ITCA 4D69A 1H9PA 4XJWA 1B09A 2CY6A 3AP7A 4YZ5A 1GZWB 2EALA 4M3CE 1APNA 3RMYA 4GKYA 2SBAA 1IS3A 3B3QE 5L73A 1LJ7A 1F31A 2GN3A 5T5JA 2NN8A 3VV1A 2WJSA 5KXDA 3QCWA 4Y20B 2DU1A 2D44A 1MVQA 4AGVA 3VKMA 2PHXA 1RIRA 2JE7A 1G7YA 4LBKA 3WVJA 3O5SA 3IN9A 2ZZJA 3AZVA 1XQNA 2A6WA 2CL2A 3LCPA 1AJKA 1UPSA 2R0FA 4XOGA 5DZEA 3ZPYA 2FHRA 3ZSMA 3NV4A 1CPMA 1S0CA 2YMZA 4JRAA 1FV2A 1PZ9A 5CB7A 2A75A 1ENQA 1Q56A 2NMOA 1UN1A 3MPPG 1U0AA 2P3IA 1W0PA 5GLTA 5GZFA 4CTEA 3SLIA 4XJUA 4TYSA 3WDXA 4XZPA 2D3SA 1GV9A 5IK7A 5CAZA 1MS5A 2P37A 4K1ZA 2W52A 3D4KA 4UW5A 2WT2A 3O12A 2JDZA 4YM2A 5JOWA 1C57A 1GBGA 3OY8B 3RSJA 1QU0A 2R16A 4LBLA 1TEIA 3OPZA 2VUAA 4XDQA 1HQLA 2EAKA 3R4SA 5T5LA 1ZM1A 3BIWE 4DRRA 4YLZA 4WVVA 4WZFA 2D3RA 3GNEA 4M3CB 2WSUA 1OFSA 3LSDA 4Y24A 4YG6A 1W6NA 4Q1PA 5CNAA 1ULCA 4LBQA 3ATGA 1N1VA 4LBNA 3ZXEA 5DZGA 3B01A 2CYFA 1JBCA 3BTAA 4Q26A 1MS8A 3W58A 3FUOA 1LHWA 4M01A 1Y7BA 1GKBA 4DPNA 1HLCA 1DFQA 4GXLA 2NZ9A 3O0WA 3SH5A 1YI7A 2GNTA 2E51A 2JJ6A 2D6NA 1LOFC 1LOAA 1LCLA 3IM0A 3APBA 4FOQA 4BMEA 5JDBA 1CN1A 3NWKA 2ZGSA 4UW4A 4GWNA 4Y22B 3AZZA 1AZDA 3UJOA 1W6QA 3N7JA 3VKFC 3ZSJA 4YGEA 2EIGA 4YZ3A 3ZYRA 5CBLA 1LENA 1UKGA 1G9BA 4XILA 1KQRA 2FMDA 3V65A 4XXPA 3ILNA 5E8AA 2GMMA 1AF9A 2EXJA 1I3HA 1EPWA 1LHNA 2R49A 1MACA 1A3KA 1PZ7A 2ZGMA 1AX2A 3MW2A 4P9WA 4Q27A 4YW3A 1SCSA 2VY0A 1YXWA 4AVVA 2AREA 5DUWA 3WDTA 1SBFA 1UZYA 3C2UA 4BLJA 1YO8A 4YW2A 3LSEA 1J1TA 4Y1VA 4XXAA 1KJRA 1CPNA 2GNDA 2CNAA 3JU9A 1S1AA 1SFYA 4FPKA 3VKOA 5DZFA 1BKZA 1JXNA 1PZ8A 1Q8SA 3V64A 2ZMKA 4M00A 3UK9A 1URXA 1D0HA 3AK0A 5IUQA 4FVVA 3R4UA 1LTEA 2GMPA 2D6LX 3M3OA 1V6OA 3MW4A 3ILFA 1LOEA 3ZYPA 4OZXA 4XJ8A 4FQ4A 4GKXA 3A0KA 2PHRA 1UAIA 5H9QA 1ULGA 1GNZA 1MS9A 2P3JA 2XG3A 2UU8A 4JC1A 2P2KA 1DQ0A 1S0EA 3FLRA 3AFKA 3WUCA 1NXD1 1G9AA 3DUIA 3U4XA 4CRQA 1FATA 1JYCA 2CTVA 4Q2FA 2EXIA 1G86A 2GALA 2GNBA 3AP5A 2A6VA 5DUXA 1WW4A 5FRAA 4XJAA 1SLIA 2WSVA 2VXRA 1V6LA 3DGTA 4C1XA 3MW3A 4DQAA 3D6EA 2AUYA 3PVOA 4FOYA 4U2AA 1DQ6A 1ENSA 1W6MB 2UWCA 2A6YA 1BZWA 1ULEA 4K1YA 1YIFA 1W6OB 2UWBA 3AYEA 4UW3A 1WLCA 4ISQA 4F83A 5F9TA 3VUOA 2DWRA 4YGCA 5EYYA 2DUQA 3WDYA 2WT1A 3USUA 4AWDA 1O4ZA 1LULA 2V5YA 2OVUA 1BQPA 1D2SA 4XYXA 1A78A 4DFSA 3OYWB 4R9AA 2VW2A 1FNZA 2DV9A 2R0HA 3PJQA 4FP2A 2Z42A 1WD3A 3N7KA 2ZHKA 1QOSA 3M3CA 4Y22A 3AYDA 4XTPA 5DXDA 1H9WA 1AX1A 1SLAA 1QKQA 2DTYA 4BPZA 1GNHA 1UX6A 3AX4A 5IK8A 4H55A 2ZKNA 4YW5A 4YM3A 1KDMA 4PF5A 2A6ZA 1N1TA 1W6PB 2DVDA 3M2MA 2ZGUA 2YXSA 3AXEA 3AXDA 3M1HA 3PMEA 5GZCA 2EXHA 2DUPA 1HKDA 2ZBJA 4LBOA 1LOCA 4YZ4A 5DG1A 1DIWA 2D6OX 3WLUA 1N3QA 4XJ9A 1IKPA 1GICA 2E6VA 3RS6A 3V0BB 3L2YA 3RQ0A 2ZGTA 1GANA 1H30A 1ONAA 2WNEA 1DZQA 2AENA 3FFZA 4LBQD 4FPEA 1QNWA 3TB0A 2PHTA 2PHWA 2W08A 1N1SA 4W65A 5HCFA 2ZA9A 3ZVXA 1LODA 3SNMA 1G9DA 1CR7A 1LHUA 1DYPA 1DLLA 4ATEA 4P9XA 1CJPA 2ZHNA 5GZEA 2D6MA 3WG2A 4Q8KA 2DVGA 1Q8PA 2GNMA 2AYHA 2AR6A 2DUOA 1Q8OA 1ZA4A 1DYKA 4BOWA 2D6PA 4Y26A 1DGLA 4TZDA 2GMEA 3SH4A 1SBEA 5SV8A 1QDOA 4BLIA 4WV8A 1S0FA 2ZGPA 5EXOA 3BODA 2I2SA 4Y1XA 1ULDA 1WBLA 2E53A 4XE9A 4Y1ZA 3D5OA 2BQPA 2DVBA 1YRZA 3V0AA 2OW4A 1ENRA 3AJYA 1MVEA 4SLIA 1WLWA 2ZACA 4FPGA 1KRIA 1LEDA 2PELA 2YV8A 3AZYA 2AH2A 2ES3A 2P3KA 3BOPA 3WCRA 3RG0A 2ZABA 3POYA 4GALA 5GLUA 3FUQA 1X50A 5T55A 3ZSKA 4AVTA 5T52A 1W6OA 4BM8A 5IT6A 4C1WA 1DQ5A 3VKNA 1GZWA 3WV6A 2NYYA 1W0OA 3KM5A 1QF3A 5IK5A 2JD4A 2GN7A 1JUIA 1MZ6A 4FPCA 1AX0A 3NV3A 3B9CA 4RL7A 2ZMLA 5AVAA 4Y20A 2P34A 5EYXA 1SLLA 1MS4A 2A7AA 4LBJA 4WVWA 4ZKTB 2A71A 4DS0A 2A3YA 5GLVA 1CQ9A 4K20A 4L8QA 1S0BA 4ATFA 4FPYA 3AYCA 3O0VA 4XJZA 1WBFA 2C5DA 4XBQA 3IPVB 2H0BA 1GYKA 4ISRA 1LGCA 5LK5A 4AVSA 2R1DA 5JMCA 3ZXLA 3N36A 3NV1A 2XB6C 1WLDA 4Z8BA 1O4YA 2D43A 1VALA 1FYUA 1MS0A 3WCSA 2Q5TA 1WCSA 4LBMA 5HCAA 1JYIA 1WD4A 3OY8A 5H9RA 1JOJA 2GDFA 1F9KA 5KXEA 4DRVA 5GLZA 1W6NB 2WKKA 4FP3A 3WG4A 4AGGA 4XBNA 1SBDA 3R05A 1Z0HA 4Q1RA 2ZHMA 1LECA 2EXKA 5JOZA 3WG1A 2AGSA 3HN1A 4NO4A 4M3CA 1GZ9A 4Y1YA 2DTWA 1N3OA 3RRDA 3I8TA 1GLHA 3T1MA 1KDKA 1QGLA 5F5QA 4ASMB 3RMXA 1QMJA 2ZGLA 4PCRA 4GWMA 3GALA 3AP9A 1Z78A 2ZGOA 3H0OA 1LOFA 3ZSLA 5H9PA 1MS3A 3A4UA 4YGDA 3WZ1A 1W6QB 2JKBA 3WDVA 1G9CA 3AP6A 1MS1A 2ERFA 1QOTA 5KXCA 1N1YA 4YFWA 3Q9OA 4BMBA 4I30A 4U36A 4Y1UA 1C4RA 4YW4A 1CIWA 2SLIA 5FREA 3WUDA 1VAMA 1OKQA 1C1FA 2WLQA 4ZXKA 3M3EA 5BYNA 4XIKA 5JOYA 3HR9A 1DQ2A 1QOOA 1GSLA 1HDKA 2DURA 3OGGA 1NLSA 3AYAA 3HMYA 3POWA 2YY1A 2A70A 5HCBA 4KBBA 1LHVA 1SACA 2ZGRA 5T54A 4FOVA 4R9BA 3WDWA 3SH3A 1FAYA 1S0JA 2R1BA 1IKQA 1CESA 2ZGQA 2ZHLA 3VKLA 2ZAAA 1LGNA 1G9FA 3N35A 1N47A 2KM2A 4MYEA 2B7YA 5T5OA 2A6XA 4NOTA 2ZMNA 5GALA 1IS5A 3JUUA 1LESA 1LGBA 2DVFA 4FPFA 4BQ1A 2VU9A 5DUUA 1BXHA 1CVNA 1CONA 2D7FA 3TAYA 1SLTA 2WT0A 5H9SA 3T1LA 3KQRA 4XHBA 1DQ4A 2VH9A 3IPVA 1LOBA 4AYUA 1SLBA 1V00A 1QDCA 3ZXKA 1YYNA 3PVNA 3FBYA 4YG0A 4PBOA 3ZXJA 2D3PA 4XMIA 2PHFA 3INAA 5EWSA 1A8DA 1Q8VA 1GZCA 3ENRA 1VAVA 4HL0A 3WG3A 4YG3A 1LOGA 2DVAA 4YGBA 4XBLA 4YZ1A 2ARBA 1RITA 2NMNA 3AJZA 1AXYA 1AJOA 1UZZA 4XTMA 3MEPA 4IQPA 1DQ1A 1WW5A 2EF6A 2DU0A 3CNAA 2UURA 1JHNA 1FV3A 2A3WA 1VLNA 5DUVA 1W6MA 4UW6A 4XMAA 1S0GA 2YZ4A 3USUB 2VW1A 5GZGA 3N3HA 1LU1A 1IS6A 3M3QA 1WW7A 4R9CA 4YM0A 4AGRA 2JE9A 3OBRA 1V6KA 4FOWA 2TEPA 1V6NA 4CZSA 4YW1A 3FLTA 5GJ6A 3OYWA 1OQ1A 2A5ZA 3IKWA 5GM0A 1LEMA 3N7MA 3AZXA 2W68A 5GZDA 1ULFA 3WOGA 4FPLA 5KXBA 1I1EA 1KJLA 1FX5A 2G4IA 2YROA 3I4IA 1S0DA 2A3XA 2OUHA 5T50A 5IK4A 1AXKA 4P14A 2NP0A 4YZ2A 2ZGNA 4FPJA 4XHXA 4P9YA 1UMZA 3IMNA 3FLPA 1W6PA 2LALA 2ENRA 2D6KA 1WUVA 3WDUA 5T5PA 4RA0A 2DYCA 3NV2A 4YM1A 1F5FA 1DHKB 4YFZA 3QLQA 3SISA 2RHPA 1BJQA 1QNYA 2VW0A 4K21A 1VIWB 4GA9A 2NM1A 2CWSA 3PVEA 4JCKA 3V0BA 1R1ZA 2PHUA 1MZ5A 2C9AA 4M3CF 3WHTA 4PQ9A 1RINA 1SCRA 2OUJA 2WQZC 1JN2P 1IOAA 1LHOA 1S0IA 4R9DA 5DG2A 1HQWA 2UWAA 1AVBA 3B69A 3OBTA 4Q8LA 4FPHA 4LBQB 2HYKA 3ZXFA 1V6IA
chains in the Genus database with same CATH superfamily
1X8MA 3SXWA 3OGRA 5HXVA 3FFQA 5A7QA 4Z07A 2P17A 2YBPA 1UL9A 2CWMA 4XQDA 1JUHA 3GM8A 1IZ3A 3JD71 5GLWA 3SCHA 3MYXA 4XW3A 3UGFA 5JOXA 2XUMA 4LTAA 4UBGA 3MIGA 1VBC2 1FNYA 4AI3A 4Z2WA 1WW6A 2ARXA 1SFPA 2RS13 4PHZA 4AE2A 3WX5A 5JVVA 1DBNA 1VJ2A 1WGPA 4QU1A 4PIZA 4XVHA 5FZ0A 4AI1A 4CDQC 1CX1A 1XNAA 4OCTA 1W9TA 1G8WA 1ZNPA 3W59A 3TEWA 3MHZA 3W5MA 4EN6B 3OG2A 3POSA 2WNUA 1H9PA 2RJKA 2WWSA 4YZ5A 2EALA 3VDBA 2O14A 1CZVA 3ZN6B 3RMYA 1V0AA 3THPA 1PO23 4W6XA 1H4HA 1RHI3 1F31A 3RWNA 3CJIA 2VG9A 4QDSA 3HT2A 3I2KA 3VV1A 5KXDA 1FMD1 2R041 4YNIA 2D44A 1AR92 3K46A 4LLFA 4OLLA 3VBFB 2JE7A 3VDCA 1G7YA 3O5SA 4TTGA 4GH4B 5ABJB 2A6WA 2BOJA 2FCUA 1AJKA 1UPSA 3LFMA 4GH4C 4XOGA 1RXFA 5DZEA 1W04A 1MQTB 2QBXA 5CVRA 5LRRA 4IEVA 4GMP1 3VBOB 1MQTC 3MIEA 3VBOC 4JRAA 1EP0A 1VBD3 2WIIB 3VD9A 2AZ5A 2NMOA 4FTEA 3MPPG 3PUHA 1F5JA 1LAJA 4RHV1 1OF3A 2VZ3A 5GZFA 1UU5A 3ZFEC 1PVXA 2FZ1A 4C0HA 3K48A 3MLJA 4TYSA 4XZPA 3HT1A 4Q29A 1COV3 1U5IA 4K1ZA 4NRPA 5FQ0A 5FZGA 3KCCA 3HVDA 3KT4A 4CCJA 1AYN2 4NHKA 4E8CA 4NIGA 3T2PA 1C57A 3PL0A 2WR9A 4A44A 4C90A 3RSJA 2W1UA 5IVEA 5FKCA 4OHYA 1HQLA 3R4SA 4HT1T 4MSVA 4HLTA 4MX3A 4ZONA 5FP7A 4LO8A 3BCWA 5T5LA 3T0DA 2WN3A 5B4XA 4WVVA 5HBAA 2D3RA 4JKKA 2HYXA 4MGQA 1TVGA 2VGDA 3T09A 1ULCA 3ZYHA 1HRI3 2VQ0A 1N1VA 2QVSB 3ZXEA 4NAMA 3W58A 4Q26A 5DDJ3 1OI6A 4W8JA 1YQ8A 1GKBA 3FMGA 5IJRA 2NZ9A 3O0WA 2GNTA 4YRDA 4IGOA 1LCLA 2VMHA 3J7NA 4FOQA 2VUJA 1EPZA 1O7FA 3HBKA 1DGRA 4XCBA 1CZSA 4CPBD 3MPBA 4PIYA 4B8EA 2C9KA 4AK3A 1J59A 3D0SA 3VKFC 4B3NA 4IW3A 2RMU2 3ZYRA 4YZ3A 2X09A 3MUY1 1OPMA 4CDQA 5FDBA 5E8AA 1AF9A 2QCSB 4BQ2A 1EPWA 4FT8A 1F4AA 2ZPXA 1MACA 1A3KA 4FI9A 3GJBA 3WR0A 5HV4A 1E5SA 4QPWA 1AX2A 1A8MA 4Q4W3 4YW3A 3H3ZA 1SCSA 4AVVA 2UYBA 4YVWB 5LRSA 4XABA 4YVWC 3ZN6A 4JQTA 3WDTA 4BLJA 3N9PA 4LUMA 3Q8BA 3JD72 4NPLA 2PLV3 1J1TA 4X8NA 3K2OA 1KJRA 1R081 3WW3A 5AC92 3B5LB 1YNAA 2CNAA 3JU9A 4QD2A 4WBBA 3X29B 4DMIA 2WABA 3HNMA 4B1MA 2ZEXA 1JYWA 2JD9A 1Q8SA 1SDDB 5IFPA 1K42A 4M00A 3UK9A 4RS5C 1AL0G 2JEMA 2ZJCA 3POGA 3T0AA 4LHSA 1QIQA 2VZOA 1QXPA 4CEYC 3TNPB 2E63A 3MW4A 3OF1A 3TNQA 1YHFA 3PUSA 3KHBA 4NHLA 1J83A 3A0KA 1O8SA 3DV8A 4AEMA 3ZFEA 4FFFA 1GNZA 2XBO1 4QGMA 4JC1A 3CZJA 4CEWA 2MHFA 1DQ0A 2OS2A 3TN93 3IBMA 2QKDA 1GWMA 4NHMA 1FATA 2CTVA 1R1A3 5FY4A 4E4HA 2ATFA 1FMD2 2R042 3VHRA 5J3UA 3BTYA 4AVAA 3LOBA 5IYYA 3AP5A 4DUVA 2A6VA 3I59A 1J3PA 1VP6A 1WCDJ 4K40A 2VZSA 2D93A 2WSVA 3VZNA 3MW3A 4DQAA 3O1OA 5C33A 3PVOA 4FOYA 2A1XA 2JDMA 2LM3A 4IESA 3WINE 1W6MB 2QUOA 3ZXFA 1EAH1 1H6YA 4JGZB 2RVAA 3ZIWA 1HB3A 4JRLA 3K3NA 4K1YA 4JGZC 4UW3A 1UO9A 4EN0A 4RHV2 1OUSA 4F83A 5A3MA 1JZ3A 2IXCA 2YUEA 2HWD2 1JU3A 3WDYA 4BE3A 1AR83 1MZEA 1X7NA 1XPWA 2OVUA 3PHMA 4XYXA 4DFSA 3KZ4C 3OYWB 4MGIE 2VW2A 3EQEA 3RZGA 5FKBA 1S2BA 3N7KA 1QQP3 5D2AA 3M3CA 2J1TA 1AX1A 2DTYA 2PAEA 4ZY9A 2EAAA 3KWVA 2QTWB 4O61A 4DOUA 3JQXA 4LQRA 4YW5A 2PTMA 4NIAA 4YM3A 3NVCA 4G4FA 2DVDA 1W6PB 2C6SA 1IQAA 3H7JA 5GZCA 1H2MA 2EXHA 2DUPA 2RS11 3IAQA 4QX5A 4CUAA 4EJRA 2YG0A 2VZRA 1LOCA 3GDBA 2D6OX 3NNJA 3E5XA 4XJ9A 1GICA 1UIKA 2ZGTA 1GANA 4H3WA 1ONAA 1ND3B 1ND3C 3ZN4A 5A3LA 1JU4A 3U11A 3P6BA 1LODA 3ZVXA 4PF1A 4RS5A 4A42A 1PO21 2XUEA 1DYPA 4EV0A 4CEYA 1HW5A 4IEOA 4A45A 3PTYA 5JXGA 2F6BA 1XSQA 3WY6A 3PLQA 4JDOA 2IXKA 4BOWA 4UAPA 3H8OA 3NNFA 3PDQA 2WBKA 4TZDA 2JXAA 1UMHA 5C4WA 2VZTA 4UFJA 5I0SA 5SV8A 2VBBA 3C7EA 5FK8A 4HVRA 1JZ8A 2R30A 2ZGPA 1VBD1 1MEC1 1W3XA 2E9QA 2OPKA 3C7OA 1R082 3NKGA 4QPIB 1WBLA 4Y1XA 3TRSB 1WMXA 5K0UB 3D5OA 4QPIC 3J8F3 4P9GA 5FV3A 2ZX1A 1OQDA 5B4NA 3ZFFA 5FZLA 3O1MA 2DBIA 3RZMA 3ACIA 2ZACA 1COV1 3OPTA 1XBFA 4FPGA 5BNPA 1KRIA 5FPZA 2K0GA 4XUTA 3WCRA 5FZIA 3FJSA 5T52A 3N9LA 4C1WA 1DQ5A 1O4TA 3E1F1 2XBO2 5JPMB 3KM5A 1QF3A 2PN5A 3H50A 5FMOS 3NV3A 1PIV3 2VE1A 2ZMLA 5CU1A 4ARXA 1UYPA 2IVIB 4L92A 1HRI1 3IDBB 4AAPA 5LW9A 4Y3OA 3ZMOA 4MGKE 5DAWA 4DS0A 2A3YA 4AL9A 1VR3A 1W03A 3GHNA 4MXWA 3UETA 2XHKA 3VLBB 1DZRA 2C5DA 2VNRA 1EAH2 3AKQA 4XBQA 4IE7A 5FOBB 1GYKA 4E9KA 4Z1VA 2I07B 4LKSA 3TBDA 1ND2A 5JMCA 1BEV3 1NUKA 3RNSA 3ACHA 3UGGA 4P08A 2J1UA 4Z8BA 2FMYA 1DF0A 1ZZBA 2D43A 5A1AA 1OURA 1W8ZA 1VRBA 3WCSA 1BBT3 3MV11 5CYYA 3S57A 4LBMA 5KWRA 2RJ2A 1B35A 1NE6A 5A7WB 4URAA 2F4PA 1NAEA 4NROA 4D3WA 3M4FA 4N43B 5JSRA 1F9KA 1QY4A 3AL5A 3AVSA 2ETEA 4I01A 2W87A 2HWF3 4N43C 5FY9A 1W6NB 4AGGA 5KXEA 1SBDA 4XF9A 2PLV1 2VC9A 2PYTA 3GBFA 1Z0HA 5KHHA 2ZHMA 2WA4A 3CU7A 5JOZA 1ZZCA 5ISLA 1GZ9A 1MZFA 3RRDA 1N3OA 3I8TA 4INDA 1CAUB 5IWFA 2P1BA 2RS12 1GLHA 1KDKA 4JHZA 4XF4A 2VO5A 1JS9A 4OI4A 5F5QA 4ASMB 3I2FA 1DP0A 4BB3A 1Z78A 3SMHA 2BPA2 4UWDA 3MFAA 3WDVA 1T6BX 3JB8A 3LEIA 2GZWA 2ERFA 1QOTA 1Y9GA 4XQWA 3RWKX 3I49A 4HMZA 2YPDA 1PO22 3TN91 1RHI2 1W90A 4AVBA 2SLIA 4KWJA 2EIDA 1R1A1 2FDHA 1OKQA 3WP6A 4BXSV 5CADA 1AL23 4AI2A 2VTXA 4BISA 2JIGA 3WNPA 1YQ5A 4XIKA 5JOYA 2VOTA 5F1RA 1DQ2A 3RZKA 1QOOA 3OGGA 4XZUG 5FZAA 3ZM8A 3BPZA 1NLSA 4QX2A 3L2HA 5HCBA 1KFXL 2OX0A 1LHVA 5T54A 3IB3A 2JB4A 2WAOA 5FZEA 3WDWA 1LRHA 1VBD2 1MEC2 1IKQA 5JIAA 4AQSA 2ZAAA 2YFZA 3G6JB 3N35A 2KM2A 2OQ6A 4K3UA 4LULA 5F6KA 1XE7A 2V4VA 3TEZA 4NOTA 1AR81 3BU7A 2LUWA 4P02B 1IS5A 1PHMA 5D1IA 1LGBA 1COV2 2WO3A 4YVSA 2J1VA 3DYPA 2BVVA 3WNLA 2HKXA 1CONA 3TAYA 5EPAA 4XHBA 4V1PA 1E5HA 4JHTA 5CFCA 3FHIB 3HN3A 4QGLA 1V00A 3RI9A 1F4HA 1SPPB 3GZTB 1YYNA 3PVNA 3S30A 3TEXA 2QQMA 4XMIA 5EWSA 5K7PA 3INAA 4YARA 2BOIA 2QDRA 5C9AC 2VUDA 4QKDA 1VAVA 1HRI2 4I09A 2ARBA 5JMOA 2Y0IA 4TLFA 1AJOA 1UZZA 4N8MA 4XTMA 1US3A 4IQPA 4QB2A 2QJVA 2DU0A 3CNAA 4N7IA 5IAVA 3KF3A 1O3TA 1FV3A 1W2NA 5FZCA 5J37A 4Y5Z0 1TME3 1PNFA 1DGWX 4IDZA 4XMAA 1LB2A 1V70A 2YZ4A 1RXGA 2VQTA 1UU6A 4KU8A 3BI3A 1YQ6A 4CDUA 2XH6A 3B93A 3N9MA 3N3HA 3NW4A 5FZ7A 2HWE3 3E6CC 2OPWA 4R9CA 5JIUA 5CZKA 2OXBA 1V6KA 3Q8FA 2TEPA 4FOWA 1VMJA 1K5MC 3WT3A 3FLTA 1DCSA 1UY1A 3WF4A 4BCUA 2ZX0A 5DQ0A 2FDGA 1AUYA 2A5ZA 3IKWA 3I2DA 1LEMA 5KXBA 4FPLA 1KJLA 4EE2A 1FX5A 3I4IA 2A3XA 1UY4A 4JTNA 2PQQA 4UFMA 1AXKA 2PLV2 2Z79A 4B4PA 1OQEA 3ITQA 5ANQA 4YZ2A 4V2WA 3D82A 4AEDB 3J8F1 3D3AA 2LALA 4I3PA 3WNOA 3BTXA 4AEDC 3QOPA 2ENRA 4RA0A 3R4DB 4XF1A 3BU0A 4YM1A 1F5FA 1DHKB 1C8M3 3LZZA 3SHRA 5JSOA 2DCYA 4O7XA 1CAWA 3HD8B 1QNYA 3VZKA 4LITA 1JI6A 4GA9A 4JKMA 2NM1A 3V0BA 4HN1A 2XJUA 4M3CF 3USSA 4PQ9A 1RINA 5F5CA 4I0WB 3HNYM 2BJSA 1LHOA 3B7MA 4DXTA 2JDYA 3NL1A 1DG6A 5A6ZA 1HQWA 2XVLA 1OLRA 3TN92 4LBQB 2HYKA 1PIV1 3BPSA 4QM8A 1GUIA 1R1A2 3VBSB 4HANA 1V6JA 3ILRA 1BYHA 2OZJA 3P3PA 5FYCA 1JOPA 4LOTA 3O0XA 1JH5A 2VVDA 4QMAA 1US2A 4ORFA 4PLNA 1OUXA 5CIRA 1HRV3 1MR5A 5FZOB 1NCRA 5F39A 2RM23 1ZZ8A 2LTNA 5FYSA 5CA6A 5CKNA 3W5NA 4MXVA 2VZUA 5C9AA 3V0AB 5FJHA 4Q0QA 4PT6A 3UJQA 2J1RA 4XFGA 4ET7A 3AKSA 4PBPA 5A33B 4FPOB 3KV9A 3BTZA 1QWRA 1V6MA 2QQOA 2ZGKA 2E7TA 2PXJA 2Z2SB 1ZREA 1BEV1 3AP4A 3WNXA 4CUGA 3FHAA 1JYVA 1AR82 3FWEA 4FQZA 5L36A 4ITCA 1RVF3 5IHRA 4KG0A 4XJWA 1BBT1 2E7AA 1B09A 3WNNA 3OGJA 3AP7A 4AEJA 1GZWB 2Y6HA 1ZRFA 1APNA 1UYZA 3Q8CA 4QB6A 2SBAA 1STMA 4EZHA 3B3QE 4FBFA 1LJ7A 2GN3A 5T5JA 4AEKA 5FPXA 3FE5A 3LA3A 5ERLA 2HEWF 2HWF1 1OA2A 2NN8A 3U78A 4B1LA 3OTFA 1CJDA 2JG8B 2Y6KA 1DU3D 4QQOA 3B02A 4L0PA 2JG8C 1R093 4JZRA 4WM7C 2ZEYA 4WM7B 1K5MA 1RIRA 5EQUA 2WO2A 2WUHA 3THCA 4H2AA 3CZUA 3LAGA 4QDRA 5G05L 1YJLA 2X53S 3AZVA 3GHMA 1OSGA 1FXZA 4XEZA 2JDUA 2DCZA 2VBDA 1CPMA 3BALA 3OB8A 5A7NA 4TWTA 1PZ9A 3RZZA 2A75A 5F5IA 1ENQA 1Q56A 1SZBA 2GC1A 1UN1A 1F35A 2Y6JA 1U0AA 2P3IA 1W0PA 4GZ9A 4NR1A 4RR3A 2PQSA 4KU7A 2TUNA 1RC6A 5FYMA 4CTEA 3ZXDA 4I2OA 2WFPA 5FO8B 1O59A 3ZKUA 2BW8A 4AEDA 1UYYA 1AR61 3HQUA 1TQ5A 3T0BA 1MS5A 5CAZA 4WM8B 3D4KA 3SQOA 1VBA3 1GNYA 5EJ3A 3ZOIA 5LCWL 2JDZA 2XLFA 2DCKA 1VB2A 5F32A 1AL21 5CISA 1QU0A 4LBLA 2BV4A 2QE3A 2VUAA 3GCWA 2EAKA 4MO3M 1ZM1A 2WYSA 4GAZA 5CKQA 2HEYF 3HEIA 1POQA 4RQPB 4M3CB 1W2UA 5FXZA 4RQPC 3WEZA 3H8RA 3OBZA 4UFLA 1I5ZA 2Y60A 4LBQA 1MPXA 2W46A 4LBNA 5F3GA 4AQTA 2CAVA 5J98B 3K4AA 3B01A 3VD3A 3BTAA 5SV5A 1UKRA 5LEKA 1LHWA 1XYPA 3J8F2 4LEJA 4M01A 4CXWA 3QACA 1HLCA 3SH5A 4ZXEA 3UKNA 2E51A 2JJ6A 2D6NA 1Y9QA 1LOAA 3CKHA 1JHJA 3GXUA 4AZZA 2J1AA 3APBA 4BMEA 4QKFA 2LROA 4BQ4A 4UW4A 1IPSA 4Y22B 2VCAA 4LJHA 4LOSA 4H14A 5E16A 5FZ6A 5G04L 3ZSJA 1CAVA 1ZBE3 2Q4SA 2WFF3 4JAAA 2AEZA 2FMDA 4LUKA 1QJU3 4NVPA 4XILA 2GMMA 4XXPA 2XR4A 4L11A 2EXJA 4IE5A 2R49A 5BNNB 5FZ3A 2Z69A 3U14A 4P9WA 4A7ZA 1PIV2 3OCPA 4OYUA 1REDA 3DPRB 1YXWA 3DPRC 2AREA 3H1WA 4AQ2A 4LMFA 3U07A 2PHDA 2YC4A 1QXRA 4CPBA 5A1FA 3RZHA 1UZYA 3TWIA 1YO8A 3LSEA 4JV4A 5FY7A 4S2HA 2WZPP 2FBEA 4Y1VA 1OF4A 2H6BA 2VXJA 2Q1MA 2Q8CA 5HXMA 2GNDA 2J42A 3F95A 1SFYA 1CAXB 2B45X 1SG3A 1YJKA 2JDAA 2WNOA 3K75B 1BKZA 3V64A 1RUOA 3NQHA 2Z5WA 2ZMKA 4LO5B 1URXA 5CKMA 3AK0A 1TMF3 2YFUA 4ARYA 4WVZA 1LTEA 2FDIA 2D6LX 2HWE1 3BVCA 3AB0A 4E4ZA 3I2IA 1BEV2 3ILFA 4XJ8A 4FQ4A 2NQYA 3THTA 2XHNA 1FPN3 1BBT2 5H9QA 2JDHA 2YHJA 3ZKYA 2G9ZA 4O9GA 4J1XA 3PUIA 4MH0E 2X05A 3ZX7A 3ST7A 1S0EA 2PA7A 1NCQB 1PK6A 1NXD1 1G9AA 1NCQC 3U4XA 2HWF2 3W9AA 3VDDB 5AC91 3VDDC 2EXIA 5BNOB 1PGW1 5BNOC 5L7OA 1H8TB 5DUXA 1WW4A 1H8TC 1TNFA 3FBMA 1SLIA 4KQ7A 3DGTA 2VXRA 1V6LA 4I02A 2KR2A 1FT9A 3KHCA 3P3NA 3AVRA 1C8M1 3I3DA 1W2AX 2JENA 1W9YA 3AL6A 4AVCA 4OI2A 4OI0A 2GC2A 2A73B 3KB5A 3I2HA 4RQPA 1YUDA 1KS4A 1UOBA 2UWBA 3AYEA 4OHVA 4EROA 4ISQA 3K77A 4ASKA 5EYYA 4MHUA 1NYWA 1QEXA 1XNBA 3AKPA 3USUA 3FZ3A 3ZYBA 1CZTA 1AR62 4OHZA 3PIJA 2V5YA 4G9SB 2VULA 4DUWA 2VVEA 3PJQA 3I2OA 4FP2A 1QJX3 3VBFC 1AL22 3KVBA 4Y22A 3AYDA 4XTPA 5DXDA 4R8HA 3HQXA 5I0DA 4D7TA 1W8FA 2ZKNA 1HRV1 3NJXA 1Y4WA 1AHSA 1JMUB 3OUJA 2RM21 2A6ZA 3ZXAC 3VD7A 2B5HA 2XWJB 1O5LA 3RGBA 4AFAA 2ZGUA 1PGL1 1ZZ7A 1UU4A 3NSTA 3SKJE 1HKDA 1GP5A 3VZMA 2HWD1 5K9YA 5C3PA 1XNDA 4B4QA 1X36A 2UYAA 1IKPA 1A34A 2W92A 1OA4A 3L2YA 2WNEA 4LBQD 3ES1A 2VCCA 4FPEA 4SBVA 2PHTA 5FMCA 2W08A 3HBZA 5FLIA 1ENXA 1ZA7A 4W65A 4NIDA 5FP8A 4M0NA 2XL9A 3LDRA 2C24A 3RYPA 4A3ZA 3SNMA 1CR7A 3OGVA 1LHUA 2QQIA 1Y3TA 2VMFA 3SCFA 1JYXA 2ZHNA 5FXWA 3WG2A 1NA1B 1YQCA 4Q8KA 2CAUA 1JOBA 2AR6A 2DUOA 4Y5TA 4EWDA 1W9FA 2JWPA 4P9LA 3WP4A 4Q4Y3 1YFUA 2RR13 1SBEA 3ZFGB 4COVA 1Q5OA 3ZFGC 2J1EA 4WV8A 5FPLA 1J3QA 1S0FA 5EXOA 4CP9B 3VDDA 4CDWB 2I2SA 5BUVA 4Y1ZA 2L9LA 5JZGB 4CDWC 5JZGC 3S5AA 1NZIA 1OKOA 2BQPA 1O3RA 1YRZA 1SQ4A 3ORJA 4XUQA 1ENRA 4XETA 3MBWA 3ZPOA 3BN6A 4QHOA 1LEDA 2PELA 1VBA1 2VAUA 2HWE2 3WW4A 3AZYA 1OT5A 2AH2A 2EIEA 4MVTA 3BOPA 2P4EA 3EHKA 3POYA 4GALA 4AVTA 3ZSKA 4DEVA 3FL7A 4XACA 3I3QA 4PJYA 3VKNA 2MPFA 2NYYA 1W0OA 1Y43B 1SDWA 2HWB3 5IK5A 2GN7A 4KBZA 2QQKA 1MZ6A 3VZOA 3VBUB 1ZBA3 3VBUC 4A41A 4DEQA 1WMEA 1PGW2 1SLLA 4GMP0 5EHDA 3VBFA 2QFEA 4LBJA 1RJ7A 2K46A 1W99A 3H8UA 1S55A 4LLOA 1CQ9A 4K20A 4GH4A 2Q8DA 2Y33A 4YW7A 1PO13 4UBHA 5A3NA 4AXOA 5ABJA 5J96B 3CBNA 1C8M2 1MQTA 2ZKLA 3LIGA 5HPOA 2KA3A 4XJZA 3VBOA 5JWPA 1WBFA 3H7YA 5JI9A 2QQLA 4ASLA 2KD7A 3VD5A 4QX3A 1EYBA 3WF0A 3AMHA 2DDUA 3ACGA 3POFA 3NV1A 5I8SA 1JTZX 1IG3A 2WFF1 5FMDA 1O4YA 1QJU1 4GWIA 1MS0A 1YFXA 4L2NA 1RMU1 1WCSA 3EMRA 5CG8A 2IWGB 1RYYA 3MGUA 5FBJA 1EUUA 1H1MA 1NQDA 4FCAA 1WD4A 2JDKA 1W8NA 3RFRA 4DRVA 3POBA 5GLZA 2WKKA 4FP3A 2BGPA 1OLME 4QWNA 4L97A 1HRV2 2QQJA 1LECA 2EXKA 4IETA 4OUSA 2AGSA 2RM22 3PNAA 3KVAA 1PGL2 4Y1YA 4XF0A 2VOVA 1W06A 4JDMA 3TEYA 1SFNA 3T1MA 2VZVA 2WWUA 1QGLA 5FWEA 1OFNA 2Y26A 4A3XA 4GWMA 2ZGOA 1W05A 3H0OA 3ZSLA 1JYTA 1MS3A 3U37A 2XJSA 4IEWA 2BBAA 1W6QB 2JKBA 3WZ1A 3AP6A 1FPN1 1HXS3 2W9XA 2D5FA 3GF6A 2VNVA 2ZZQA 5BPXA 5L9BA 5AFEA 1GP6A 1H2LA 1F2NA 1W9SA 4QB1A 4N53B 4BMBA 3O1TA 5B2GB 1C4RA 2BEOA 4W6WA 2W0XA 1U5XA 2HLEA 4BDVB 5FREA 3WUDA 2BGOA 4ZXKA 3M3EA 4IL7A 4CU8A 4Q0UA 2DF7A 1GSLA 1HDKA 1HJGA 1V9U3 1UWWA 4MGSA 4D8MA 1NKGA 3AYAA 4JDNA 5IVCA 1UY2A 4RD7A 2A70A 2B42B 4YVWA 1PX3A 4W4ZA 2BERA 2R32A 3JQWA 3CDZB 3U1XA 2QQNA 4Z2AA 1FAYA 1W2TA 1QH7A 2VMEA 2ZHLA 4OUEA 2ZGQA 4QT6A 1G9FA 2WQ8A 4HPKB 4MYEA 2B7YA 5FO7B 5T5OA 1BK0A 2WDBA 3WQ0A 5JSPA 1XNCA 1HB2A 2A6XA 3UGHA 2ZMNA 3PIGA 1RHI1 5GALA 4NJ4A 4LA2A 4FPFA 2DVFA 3QBQA 1VBA2 5KC6A 1CVNA 5C8CB 4IEQA 5APAA 2HWC3 5C8CC 1H0BA 2BTVC 1QJX1 3IDEA 4TSVA 4A6SA 4AYUA 1NT0A 3WSOA 4CCEA 1QDCA 2YU2A 1C3HA 4UFHA 3OEAA 3ZXKA 1HN0A 3FBYA 2PHFA 2Q8OA 3PU3A 1A8DA 1Q8VA 3NMBA 4QPGB 1UZVA 3ENRA 3VBRB 1L7QA 4QPGC 3VBRC 3FN9A 5A6YA 1ODNA 3EYPA 2IXJA 2VL4A 3HPNA 5K0UC 1PX4A 2XKOA 4GB33 4KGGA 3KGLA 3SKVA 3LEGA 3DL3A 1XXNA 3MEPA 2EF6A 1S2EA 1WZXA 3O1PA 4BXFA 3T2QA 3ETQA 2IXLA 3VHPA 1OVSA 1WCUA 3NJVA 1W6MA 4IERA 1S0GA 4CCMA 4CU9A 4JGZA 5A3PA 2OIIA 4A2UA 1UW8A 2GP3A 2JX9A 1IS6A 1UYXA 2JE9A 2WFF2 3DKWA 5C3QA 1QJU2 4XF3A 4YW1A 2XL7A 4LR4A 1HV1A 3KF5A 5FK7A 1RMU2 3ZYJB 3OYWA 4Y4RA 1DDLA 1AYM3 5GM0A 3N7MA 2MEV3 3AZXA 1ULFA 3NAPB 4LO7A 4HFSA 4Q4Y1 5DDJ1 3WOGA 3NAPC 1S4CA 2RR11 2G4IA 4Z92B 3ZDVA 3E6DA 3LIHA 4P14A 4AF9A 2NP0A 3OUIA 4B7EA 1GWKA 3MV01 1UMZA 5DPNA 3FLPA 1W6PA 1JZ2A 4ONUA 3JZVA 4ZS3A 2D6KA 5F6LB 5T5PA 2DYCA 4CDXB 1I5PA 3ACFA 4YFZA 4J1WA 4AHZA 3GGLA 4XAEA 4CDXC 5F7UA 5C3SA 2VM9A 4QX8A 2FDKA 2CDPA 4YSFA 2RHPA 2CGPA 1VBB3 2QQPA 4K21A 4Q4V3 5JR2A 4UOJA 2W5FA 3AMQA 4JCKA 4HKWA 2R073 4Q4W1 1ND3A 2QQUA 2OUJA 1FPN2 2WQZC 3BOWA 4F7ZA 1UZWA 1PM7A 1S0IA 5AVPA 2HWB1 2UWAA 2O8OA 3U0ZA 3OBTA 4COZA 2WNVB 4Q8LA 3CQOA 2WNVC 3CF6E 1ZBA1 1RUJ3 2JKXA 4OVEA 3ZYPA 3NJYA 3S7IA 2V73A 4OZOA 3ZYIB 5FO9B 4DXZA 1IS4A 3LE0A 5IVVA 5E88A 4XIOA 3RJRA 4EN9B 5BXXA 3HAGA 2VOKA 2X5IB 1PO11 3I2JA 3ON7A 3A0NA 2E7QA 2W39A 3MIHA 4JVAA 1KITA 3OD0A 1AXZA 2IC1A 3VBRA 3AM2A 2LS6A 1O3QA 2X29A 4QPIA 2LW8A 5A7SA 4HG6B 5K0UA 3D0JA 1SLCA 3WHUA 1IPJA 1EV13 4XFCA 1C1LA 5LEJA 5JLVA 2W91A 3UL2A 2VBPA 4BYYA 3K3OA 4LIUA 3OUHA 3EO6A 1DGRN 4MGTA 1JZ5A 3LB9A 2XQXA 5JCTA 2VUCA 5FZBA 3N9OA 1W28A 3AMPA 1QJX2 4GKYA 1OD5A 4A7KA 4GULA 2XJPA 2Q1ZB 4HK9A 2BNNA 1DZTA 2HJIA 2E32A 2WJSA 2ZXQA 4Y20B 4HSLA 4GJZA 2DU1A 2ORZA 1YEWA 5FJKA 5I93A 5JXIA 1GR3A 3VKMA 2NLRA 4ZZ5A 4DINB 1OLQA 1POV3 1YQ2A 4LBKA 5FMOL 4NPMA 3UV9A 3WVJA 1GQGA 2ZZJA 4BIOA 4Q5OA 5FY1A 4CUCA 1XQNA 4CU6A 3ZSMA 3QH7A 3CEWA 5FPAA 3S5QA 2FHRA 1AR93 3NV4A 1S0CA 2ADEA 1XJAA 4WVMB 1FV2A 1M4WA 2BFUL 2ZS6B 4QX1A 4IXLA 4DY3A 3VBHB 4KH9A 1VMHA 5EP9A 3VBHC 3SLIA 3H1YA 1NOVA 3S7EA 5C70A 5IATA 1HXS1 3POIA 3WDXA 2YBKA 3NRUA 1QQP1 2D3SA 1PMHX 3ZYGA 5A6QA 4I0AA 3VZJA 1UD1A 4UW5A 1PMJX 4CDXA 2WT2A 4CCDA 1GOHA 1C5IA 1UOFA 5FPVA 3OY8B 4MZUA 2R16A 3MLKA 4XDQA 3H1MA 1F15A 3HNBM 5A7WA 1ZRRA 3BIWE 1VE0A 2QQWA 2WO1A 4MGYE 4LORA 4N43A 4Q0VA 4YLZA 4Q4Y2 5DDJ2 4PDWB 2WSUA 2RR12 3LSDA 4Y24A 4ES8A 1W6NA 2VQAA 4PDWC 4A7YA 2WNVA 1VBE3 3ATGA 3MICA 3KD4A 4IV1B 2CYFA 1JBCA 3U75A 1MS8A 4IV1C 3FUOA 1O6UA 4Y4YA 1Y7BA 5FYYA 1YLLA 4QX0A 4GXLA 1CAUA 2VQUA 3MIDA 4R4ZA 4UT5A 4DPNA 1LOFC 3I3BA 3PUQA 4EQVA 4OMCA 3BYWA 1JODA 4XFFA 4HOOA 5JDBA 2ZGSA 2XKPA 5A3TA 2HWC1 2VCBA 1AZDA 1BVP1 1RUF3 1C5HA 4Q4W2 5LY2A 3N7JA 4CCNA 4D94A 4YGEA 2EIGA 4FSJA 1UKGA 4KWLA 1G9BA 1KQRA 2ZEZA 1X33A 2YBSA 2HWB2 3FHQA 1LHNA 1PZ7A 4PQQA 2ZGMA 1TG7A 4DZGA 4I0BA 2W1QA 1IPKA 1ZBA2 4IE4A 3WNKA 5JUVA 3UKVA 3C2UA 4GB31 2ZOEB 5FIXA 3LQCA 2J22A 1GP4A 4XFHA 4E4SA 1X8EA 3CHXA 3DCQA 4HKOA 1PO12 4AFBA 1I9RA 2ET7A 3H42B 5DZFA 3VB9A 1JXNA 2CGOA 2LRPA 5ABJC 2JE8A 4OFGA 3JBG3 4D0QA 3OD4A 4OQ9A 1D0HA 5IUQA 3UYJA 4MLOA 3R4UA 4QQLA 2GMPA 2K9ZA 3LEKA 2J1SA 4S2FA 4LKFA 4LT5A 5F37A 1CD3G 1LOEA 3W20A 4OZXA 4GKXA 2PMWB 2QZ3A 1UAIA 3MF6A 3K4DA 1ULGA 2EA7A 1MS9A 4QAWA 3VBSC 2UU8A 1AYM1 2P2KA 3KT1A 2MEV1 2E26A 4V2VA 4BQXA 3WUCA 1BCXA 2C26A 4CRQA 1JYCA 2W1WA 3MF9A 4Q2FA 4IV3B 1SPPA 4IV3C 3LA2A 5DMYA 2W1SA 2YC0A 2YDEA 4KWKA 3VHOA 4XJAA 1YI9A 4C1XA 1REFA 1RJ8A 3U10A 4XDPA 1VAKA 5LASA 2BGCA 3R6SA 4NAOA 1H1AA 1ENSA 3KSCA 4AG4A 1VBB1 2UY8A 1BZWA 4Q4V1 4ZS2A 5F9TA 2DCTA 4E27A 3AKTA 2DWRA 2R071 4C91A 3PURA 4B7KA 2WL1A 2DUQA 3AMNA 5C5UA 1HXS2 1X9TA 2J7MA 4NPRA 1QQP2 4IGPA 1O4ZA 1LULA 3I2GA 5FZ8A 5C3RA 1YC61 1BQPA 4OMDA 1D2SA 1A78A 2DFBA 3GBGA 4R9AA 5IW0A 5CFDB 1FNZA 2DV9A 2R0HA 4CA9A 1PM4A 1RUJ1 3ZR6A 5F8PA 5CFDC 1WD3A 3A21A 2ZHKA 1L3JA 1SLAA 4W50A 2W3JA 1QKQA 2RS53 5FYVA 1G6NA 2W2IA 4UF0B 3AX4A 5IK8A 2CSGA 4L9BA 4B4RA 5F3CA 2GH8A 2WWJA 4PF5A 4JGYB 4B29A 2VZPA 3M2MA 4JGYC 1KGYA 3EBRA 1QXJA 3PMEA 4IEZA 1HB4A 4GJYA 5A32B 3N4MA 4QQ2A 4YZ4A 3WLUA 2VNOA 1EV11 3I54A 3OEBA 2O0OA 5A7OA 3WW2A 4WM8C 2IZWA 2ID4A 3PTRB 3TB0A 1DZQA 2AENA 4HK8A 4K6BA 4XPVA 1HX6A 2PHWA 2Q30A 3ZSEA 1RL3A 3U4SA 1N1SA 1Y9MA 4XUPA 3VDAA 1GQPA 2ZA9A 2HWC2 3POJA 1RUNA 1G9DA 5FZFA 4D6SA 5FTTC 4OULA 4QXKA 1DLLA 2QZ2A 4R52A 5GZEA 2D6MA 2ZX2A 2DVGA 1Q8PA 1OH4A 2B39A 2W47A 2AYHA 5DABA 3W21A 1POV1 3CLPA 3HOBA 1DYKA 4XAAA 3SEEA 3WNMA 3O1UA 1OPOA 2JICA 3VBSA 1D4M3 1DGLA 4COUA 5D8AB 2GP5A 2GMEA 2RDSA 5D8AC 2K2SA 2W95A 5K4LA 4GB32 4BLIA 4XQ4A 4XC9A 4DB5A 4JQRA 5L9RA 3VL8A 3H8XA 1H2NA 4RFT0 3PJYA 2GC3A 5FZOA 4XE9A 2E53A 3KMHA 4EWAA 5EIYB 3Q8EA 2IXIA 2X10A 2DVBA 5LBEA 3V0AA 3MZHA 2Y6LA 1L7RA 1HIXA 4SLIA 5A33A 4J6GA 5J48A 3WF1A 3B94A 2YV8A 1ZZ6A 4QKBA 3J4UH 2P3KA 4AR2A 4BIFA 4CP0A 3RG0A 5BNNC 5GLUA 3FUQA 1X50A 1RUH3 1P8JA 3CJIB 2XXZA 3WV6A 1GZWA 3CJIC 3ZN5A 1AYM2 5LA1A 2MEV2 1VB4A 5FZDA 1UY0A 4CCLA 4RL7A 2BP6A 3O1RA 2XQRA 3DF0A 3BKZA 2JG8A 3NNGA 2XBO3 4Q0SA 4WM7A 1H2KA 2YYOA 1TME1 1KXGA 4QXCA 4M4PA 4WVWA 3CO2A 3T08A 4ZKTB 2WZEA 1CIYA 2WYFA 1RB8G 1UOJA 4FTSA 5GLVA 1O8PA 1XE0A 4L8QA 4LK7A 4CCCA 5A3WA 4ATFA 4FPYA 5JXJA 3AYCA 3O0VA 2VNGA 4CCOA 2QNKA 5FZMA 1VBB2 1GMMA 1UF2C 3C7HA 2AEYA 3KGZA 2XDVA 4Q4V2 1E5RA 4W6YA 5A7PA 4AVSA 1LGCA 5LK5A 5FQ0B 2D98A 1RUF1 4UXAA 2R072 3N36A 1WCKA 3OOXA 2XB6C 4KMQA 1WLDA 2PFWA 4FFIA 1FYUA 1UXZA 4WM8A 5FUNA 1ZVFA 2YC2A 3D8CA 1RUJ2 2RS33 1JYIA 1IHMA 2CV6A 3KS7A 5H9RA 2GDFA 4CXXA 4D7YA 2D5HA 1POV0 2P3YA 3WG4A 4NWVA 1Z7S3 4XBNA 4OHXA 4CYDA 1UY3A 3M70A 1XYNA 4AFMA 2ILMA 1T2XA 4NHXA 1RUC3 3HN1A 1VPHA 3MIBA 1AR73 4M3CA 4NO4A 1O91A 2DTWA 5DAQA 3LD8A 4BQWA 3DXUA 1Q3EA 3JBG1 5FZ1A 5I0TA 3AKRA 4CVUA 3ZYFA 3VL9A 5D8AA 1EV12 1QMJA 1KD7A 1REEA 2ZGLA 3PUAA 4PCRA 3RMXA 1SMVA 5BY5A 2ZX3A 3DECA 5C6CA 2VMDA 4YGDA 2EICA 4ZU7A 4C0BA 1G9CA 1FOD3 2TBVA 2BWCA 3AFGA 4CDQB 4KI5M 1N1YA 5LA0A 2VMCA 2ZX4A 3Q9OA 1E5IA 4I30A 4Y1UA 2XPJA 3GZUC 4KWUA 4YW6A 4YW4A 1WMDA 1CIWA 1KFUL 4P9JA 5FZ4A 2ZTNA 1VAMA 1C1FA 3KCXA 4AOCA 5AFBA 5BYNA 4CP1A 3BGAA 3LEMA 1LNSA 4LO6B 5BNNA 3HR9A 3ZMNA 5EJ1B 2DURA 2FDJA 4QKNA 3DPRA 2D97A 3LKJA 3POWA 4P00B 3J26N 2N7GA 4G3YC 4JTOA 3A22A 2VTXJ 5I0UA 4DY5A 4R9BA 1E57A 1PGSA 3WQ1A 5JXHA 1S0JA 5C71A 1CESA 1RVF1 4GWJA 2R6QA 3DKQA 4BA6A 1LGNA 2NPIA 1N47A 5JAXA 1CAXA 4EWEA 3HQRA 2WS93 1IGOA 1K3IA 3JCIA 4BZ4A 4XUOA 4NUBA 1MEC3 2G9FA 2JDNA 1O3SA 1U12A 3ZFEB 1RUG3 3C7FA 1VRH3 4PLMA 4ZU5A 1GFF2 3SCGA 1IG0A 1NA1C 1RUI3 1SLTA 1R091 2D7FA 2WT0A 3LWCA 3T1LA 4CEWB 2VH9A 3B9IA 4CEWC 4N90A 2ZEWA 1SLBA 4PI0A 1OBNA 1ODMA 4MGZE 1UXXX 1GZTA 3V56A 2RS51 4DNYA 3TOJA 5JPNB 4MG2A 1XE8A 1LR5A 4D7SA 2F17A 5FFOC 5LBFA 2D3PA 3I97A 1NCQA 3I59B 2DCJA 1RUD3 3MLLA 3LOIA 4PIXA 2Y38A 1K5JA 4HL0A 2RE9A 2XLGA 4MADA 1OXCA 4YG3A 5BNOA 1LOGA 1VBE2 4OUMA 4XBLA 5IVYA 4EZ4A 4NE9A 1TME2 1H8TA 1RITA 2NMNA 1AXYA 1NZCA 5FY5A 1DQ1A 1WW5A 2JIJA 2UURA 2A3WA 5DUVA 3C8XA 1W0NA 2BNOA 3RI8A 1XU2A 4CCKA 2VTFA 4LE3A 1VMFA 1OVPA 1RUF2 1ZRCA 3J7HA 3ABZA 4QHBA 3M3QA 4CXYA 3LDKA 4YM0A 2VJXA 4LHLA 3LF7A 1RUE3 3HJRA 4Q4X3 2WINB 4M4RA 4AI0A 1HB1A 5KHGA 1D4M1 2WZ8A 4E2SA 3O1VA 5HCHA 1WCQA 4LKDA 5M0TA 1I1EA 1IQDC 1D7PM 5T50A 1S0DA 1PVC3 2PAMA 4LA3A 2OKXA 4RN5A 3WXPA 2VCMA 2OT7A 2XJQA 5KR7A 1DLCA 3H3UA 2O1QA 2XJRA 1J58A 2RV9A 4AHYA 2XVKA 3VN4A 1QJFA 2WAAA 4FTBA 1HN1A 1OC1A 2WO7A 3JBG2 2BYVE 3I7DA 1ZBE1 3SISA 3JXSA 2XONA 3THDA 2X8KA 4HZFA 4TLGA 1VIWB 2CWSA 4AW7A 1R1ZA 4RS5B 5I8TA 4QHZA 3WHTA 1RUH1 3ALQA 3NKTA 4HN0A 4FAGA 4RGAA 1JN2P 1NG0A 4CEYB 5LA9A 1PNGA 4A6OA 4R9DA 5DG2A 3E5UA 5FCCA 3WW1A 5FMBA 3UT0A 4CP2A 3LPGA 2P3JA 5HV0A 5I0RA 4GD4A 1DGWA 3C3VA 3T30A 4MHRA 3AZWA 1NA1A 2JECA 5C4WB 4R4XA 4YPJA 4NIHA 5FYIA 4QXBA 2ZAHA 5E89A 5C4WC 3I3EA 1JW6A 1CGPA 3OJBA 5HI0A 2P5BA 2G9GA 5IFTA 1TMF1 5KBFA 4IUGA 1QJY3 1LU2A 3ZIXA 1ST8A 1UMIA 3KT7A 4A4AA 3ZFGA 4F8AA 2R7EB 1BMV1 1J3RA 3DEMA 1WWYA 3AMMA 3ZFFB 3EB7A 1C8NA 1OA3A 4LXLA 2XGXA 3ZFFC 4CP9A 1RVF2 3SITA 1XC6A 2VR4A 3N7LA 3T2TA 4CDWA 4DXSA 5JZGA 3KQ4B 5BNPB 1N3PA 5BNPC 5LWBA 3O1SA 3B00A 3IIIA 4N53C 5J09A 4J25A 3ASIA 1OMIA 3IAPA 3N9NA 5F3IA 5JR7B 1Q8QA 4D69A 2IVJA 2CY6A 5FYZA 4M3CE 1GWLA 1R092 4MV2A 4ZPIA 4OI1A 2Y6GA 1RTVA 2RS31 1IS3A 2GC0A 5L73A 3ZR5A 5IAXA 3ZDSA 2BVBA 1W8UA 4IEPA 5TSWA 2RS52 3ZLIA 1Z7S1 4X6QB 3QCWA 3RDIA 3S6PA 1MVQA 3A23A 3MUZ1 1D0GA 2PHXA 3SEPA 4AGVA 3T3YA 4MUVA 1RUC1 3VBUA 1AR71 4M0HA 4NN0A 5FUPA 3IN9A 2RDQA 5T3NA 2CL2A 3T4VA 3LCPA 2R0FA 4MXWB 3RPQA 3ZPYA 2C1FA 1OOPB 2YMZA 4HONA 1OOPC 5CB7A 4NMIA 2Y0OA 1SEFA 3HIFA 1ULOA 3P1IA 3IMMA 5FPUA 1YFYA 2FCTA 5GKAC 1ND2B 4FFGA 4K7JA 1FOD1 2GSYA 4FFHA 4XJUA 1ND2C 1XRUA 4BQYA 1GV9A 2HBTA 3F2ZA 5IK7A 3R0RA 1ASJ3 1NE4A 2P37A 3T2OA 2W52A 4JKLA 3O12A 5J7MA 3HWJA 5ACA3 1B35B 4NRMA 4YM2A 1B35C 2VZQA 5JOWA 2YU1A 1GBGA 4RFRB 5IVJA 2ZCWA 3NNMA 2G1MA 3LGRA 1TEIA 2WZR3 3OPZA 2JDPA 3IDCB 5A3UA 4ZU4A 5BV6A 1D4M2 4DRRA 2B9UA 5C3OA 1JZ6A 2BZDA 4IE0A 4WZFA 1JZ7A 5F2SA 3GNEA 4YG6A 1OFSA 3GJAA 2JG9B 4Q1PA 3IT8A 5CNAA 4C8DA 2JG9C 2R063 2B8MA 4IEYA 3AC0A 4BJ0A 3BIEA 5J36A 5DZGA 5A1LA 4DXRA 4QQHA 1OHFA 3CJXA 1DFQA 2WS91 2H6CA 1HQNA 3H3LA 1YI7A 4AI9A 1X82A 2IUWA 4TXWA 2Q8EA 3A7QA 3MIFA 1ZBE2 3IM0A 1XNTA 1CN1A 3DXTA 3NWKA 1RUG1 4S2DA 1VRH1 5FP3A 4GWNA 1RUI1 3AZZA 1SHWB 3UJOA 1W6QA 4RGKA 5CBLA 1RUH2 3TYJA 1LENA 4PI2A 5A3OA 3V65A 4Q0PA 3ILNA 3I3MA 3Q8AA 4N53A 4KNCA 1I3HA 4TN7A 3CIHA 3MW2A 1RUD1 4HKLA 4Q27A 4Y33A 4BK4A 2VY0A 1ZYBA 3PU8A 4OQ8A 1DYOA 4XFIA 1XSRA 5FYHA 3CL1A 5DUWA 1SBFA 1OD3A 4GQ7A 4YW2A 4BK5A 4L99A 3QD6A 1ZX5A 4IEUA 1TMF2 2RG4A 1NX9A 1NQJA 4XXAA 1W3VA 2VPVA 4AHWA 1CPNA 3ROUA 3M8LA 1S1AA 5FZHA 1BMV2 4FPKA 3VKOA 1PZ8A 1W8WA 1J84A 5FPBA 2BFUS 1HV0A 4FVVA 3DYMA 1QH6A 3ES4A 4YVSB 3VGIA 4HPKA 4YVSC 3M3OA 1M06G 1OOPA 1V6OA 5IVFA 4FAHA 2VMIA 3GZAA 5LA2A 4E2GA 5CFCB 2PHRA 1RUE1 5D21A 5CFCC 1ACCA 4LKEA 4Q4X1 2XG3A 5C8CA 4H7LA 3IWZA 2O8QA 2RS32 2XOMA 3FLRA 3KV5A 3AFKA 2Z4FA 2XLAA 2AC1A 3DUIA 4O9EA 1GU3A 3FC0A 1ZRDA 1Z7S2 1PVC1 3M7AA 2X5IC 4LPLA 1G86A 2GALA 1FI2A 2GNBA 2VOXA 3EJKA 3ZO0B 3NJZA 4QPGA 1RUC2 4XFBA 5FRAA 1AR72 2Y34A 5LBBA 4BQ5A 2C4XA 5C7GA 3ELNA 1BK1A 3D6EA 4RSUA 2AUYA 3C7GA 1VBC3 4I3GA 2CDOA 4U2AA 4UFKA 5F5AA 1DQ6A 3J9SA 2UWCA 1ZZ9A 2BRTA 3ME2A 4X8PA 2A6YA 4K9SA 3DN7A 1HJFA 1ULEA 3ACLA 1YIFA 1W6OB 2JG9A 1WLCA 4CDUB 1H4GA 3VUOA 4YGCA 4HETA 4CDUC 1FOD2 5FBZA 2Y6FA 4Y5SA 5DAPA 5KHKA 2WT1A 4XUNA 3T4HB 3WQ7A 1RGSA 4AWDA 1KEXA 4IGQA 4OHWA 4URTA 5IVBA 2H0VA 4E8DA 5GLTA 5JI7A 4QPYA 1WKYA 3GZEA 4QGNA 4NHYA 1YFWA 2IFRA 2Z42A 3NO8A 3RJ2X 1YIPA 1AR63 1QOSA 3O14A 2VD7A 1H9WA 4BPZA 4DIQA 4QQPA 1GNHA 1UX6A 4H55A 5DAXA 1KDMA 1W39A 1QJY1 2ARAA 3NAPA 4IE6A 2C0ZA 3UESA 1K45A 1XB9A 1N1TA 5KHIA 2HH9A 4E4DX 2YXSA 1UZ0A 3AXDA 3AXEA 3M1HA 3NNLA 5FZ9A 2ZBJA 4HVQA 4LBOA 4CE8A 5DG1A 1DIWA 2BWAA 1CAWB 1N3QA 3BUCA 2FZ2A 1F8VA 2QDNA 4EN7B 2WS92 2E6VA 3KV6A 2JB8A 4LO4B 3RS6A 3V0BB 2OQ7A 3RQ0A 4QU2A 5A80A 1H30A 2YGMA 1XYOA 3FFZA 2MNGA 3O7OA 1QNWA 1RUG2 4YYOA 5A70A 1VRH2 1RUI2 2DFCA 2WRAA 3IZOA 5HCFA 1NLRA 2WN2A 4N9IA 1UIJA 3ECQA 4META 1V9U1 4QM9A 2V4AA 1AYN3 1S2KA 4P9XA 1CJPA 4RGGA 4ATEA 1L7LA 2E33A 5FP4A 3WF3A 2F4LA 4NIIA 2GNMA 4LK6A 4FXKB 1OH3A 1Q8OA 1ZA4A 1RUD2 2WC2A 4LHNA 2D6PA 4HXCA 1Q43A 4XURA 4Y26A 1NCRB 1NCRC 1UQXA 4S2GA 2KXLA 3SH4A 1QDOA 4K8FA 5C9AB 3KCYA 2HBUA 1W9WA 1YWKA 4NRQA 3K51A 2DBNA 3BODA 2X5IA 5LATA 2RDRA 1ULDA 3GCXA 5CG9A 1BHGA 2I45A 5DAVA 1GOGA 1H1IA 2OW4A 3AJYA 1MVEA 1ASJ1 1WLWA 3RZJA 1NY71 5BNQA 1UX7A 2CGNA 3KV4A 1W8HA 2Y64A 3OSDA 2ES3A 4D6QA 3E6BA 4N7UA 5ACA1 2ZABA 5J1XA 5T55A 2XJVA 2RMU3 4BM8A 4CSWA 3LFIA 1RUE2 1W6OA 2XJTA 5FZKA 5IT6A 2WZR1 2V09A 4Q4X2 2BNMA 2ARCA 5K8SA 3IIAA 2JD4A 4BQ3A 1JUIA 4ZZ8A 1K5MB 4FPCA 1AX0A 3B9CA 4HSJA 3PMSA 2GAUA 1BLZA 1QJZA 2ORXA 3GYDA 1PVC2 3JB4C 4Y20A 5AVAA 2P34A 2R061 5EYXA 1MS4A 2A7AA 2YGLA 3LA7A 1UOGA 5F3EA 2RDNA 4GIQA 5FY8A 2A71A 3JD73 1D4VB 2UY9A 1CX4A 2IFWA 1S0BA 2WQ4A 4RR3B 5AC93 4RR3C 2TNFA 4CUBA 1H6XA 4WVMA 1WA4A 3IPVB 1ALYA 3FX3A 2H0BA 4ISRA 4XFAA 3VBHA 1U5YA 2R1DA 4P9IA 5LY1A 2XMLA 3ZXLA 5EFUA 3RVHA 3WP5A 1VALA 2Q5TA 4E2QA 3LPFA 5HCAA 1CWPA 5EV7A 4BWOA 3VD4A 1W8OA 4EYUA 3OY8A 1JOJA 3LDBA 1X9PA 2PHLA 1C28A 2GH2A 3ZXGA 1H8VA 2P6HA 4AFCA 4D6RA 2BDRA 3WQBA 1FMD3 1I6XA 2R043 3POEA 4NWWA 3EXUA 3R05A 1JYNA 4H7MA 4Q1RA 2B46X 1QJY2 3WG1A 4PDWA 4KG8A 3MI8A 2FCVA 5FLJA 5LK7B 4COYA 4IV1A 4GMP3 5FP9A 1U5ZA 3DYOA 4AFDA 3GALA 3AP9A 2WA3A 1LOFA 1ULPA 5H9PA 2EVXA 2RJLA 2VECA 3A4UA 4RHV3 4ZHNA 5DN2A 4IEXA 1WMFA 3MDPA 2XWBB 1CAVB 4LE4A 4UFIA 2HWD3 1MS1A 3OBAA 5KXCA 3MFCA 4YFWA 4U36A 3J7MA 1ZRIA 1V9U2 3OGSA 4FXGB 1XNKA 1W8TA 4RYDA 5F2WA 4WZCA 2WLQA 5LZ6A 5L19A 3SC7X 2ADDA 2CU5A 1TE1B 4XCAA 1A6CA 3WF2A 3HMYA 4P5YA 2YY1A 3E5QA 1GOFA 4COWA 1O5UA 1VBC1 4KBBA 5KHJA 3IDAA 3OPWA 1SACA 4HVOA 2ZGRA 5I8YA 2QQVA 4FOVA 2Q1FA 2E31A 2IXHA 2YPJA 5C5TA 2W94A 3SH3A 4MOAA 2R1BA 4XDOA 4UI9L 4LIVA 2GU9A 3VKLA 5LBCA 3KLSA 4AI8A 4ES9A 4LHKA 2OYZA 1BVVA 5ANNA 4QXHA 3WD5A 3JUUA 2I74A 5FXVA 1ASJ2 1LESA 5FXXA 1NY72 1JZ4A 4BQ1A 2VU9A 1W2OA 1BXHA 5DUUA 3J7LA 1NXMA 2EIBA 2VOWA 4HBNA 5H9SA 5ACA2 2HEVF 2BU9A 3KQRA 1DQ4A 3M3IA 1WA6X 3IPVA 1WLTA 1LOBA 1K12A 1PK6B 4BU2A 1PK6C 2WZR2 2B9VA 4KL1A 4KGQA 5FAXA 2Y8KA 3E97A 1AR91 4YG0A 1XOYA 4PBOA 2VMGA 4Z82A 3WP3A 3ZXJA 5L7OB 2YB7A 4F3JA 5CEHA 5L7OC 1GZCA 3UNPA 3RZLA 3WG3A 2OZ6A 5C8WA 5L9VA 2XVGA 4IV3A 1R64A 3N9QA 2DVAA 3CMGA 2R062 4YGBA 4YZ1A 1YCIA 5LB6A 4AAXA 4EN8B 2FD8A 3AJZA 5FUIA 3VZLA 4QX7A 5A6XA 1D2QA 2AACA 2FQPA 3GBWA 4FO9A 4QDQA 2WNUB 1R083 3ETPA 1JHNA 2WNUC 1VLNA 2P6CA 4UW6A 3S0MA 3VHNA 3USUB 1QHDA 2ET1A 4X6RB 1TZOA 2OA2A 1GQHA 2VW1A 5FLHA 3UKTA 5GZGA 5I91A 1QJEA 1KS5A 4YWAA 1LU1A 5FY0A 4AGRA 1WW7A 1AYN1 3OBRA 4UYBA 1EY2A 1EUTA 1V6NA 4P5HA 5EJZB 4CZSA 1NLQA 3PVBB 3QH6A 5GJ6A 3K4ZA 1XU1A 5CFDA 1VBE1 4K8RB 1OQ1A 1LKNA 2BUKA 5GZDA 2W68A 4DO0A 4AQ6A 3P5BA 2FDFA 2YROA 2CHHA 2V5DA 2OUHA 2Q0AA 2VVFA 2G19A 1RMU3 4UF0A 5FYBA 5IK4A 3H9AA 2WLPA 2ZGNA 4FPJA 1UPIA 4P9YA 4XHXA 3IMNA 5FYTA 1T6GC 4JGYA 4PLOA 5KC5A 2B4KA 2PAKA 1UCXA 2VZ1A 1WUVA 3RYKA 3URFA 3WDUA 1PMIA 5FR3A 3NV2A 5FWJA 4BHPA 5A32A 3QLQA 4O65A 3RYRA 5EZWA 1BJQA 1EAH3 2VW0A 4DUXA 3L9JT 2V72A 2BBVA 3PVEA 3BB6A 4BH9A 3MO4A 2PHUA 1MZ5A 5E1RA 2C9AA 4JX0A 2D40A 2RMU1 1SCRA 1IOAA 3G7DA 1OLMA 1UNBA 4N9HA 4CU7A 5E6HA 4AHXA 3B69A 1AVBA 4FPHA 4LNVA 1J1LA 5FOJB 5FYUA 1TNRA 1V6IA
chains in the Genus database with same CATH topology
1X8MA 3SXWA 5HXVA 3FFQA 4Z07A 2P17A 1UL9A 2CWMA 4XQDA 1JUHA 1IZ3A 3JD71 5GLWA 3SCHA 3MYXA 4XW3A 5JOXA 2XUMA 4LTAA 4UBGA 3MIGA 1VBC2 1FNYA 4AI3A 4Z2WA 1WW6A 2ARXA 2RS13 4AE2A 3WX5A 5JVVA 1DBNA 1VJ2A 1WGPA 4AI1A 4PIZA 4CDQC 3W59A 1G8WA 1ZNPA 4EN6B 3POSA 2WNUA 1H9PA 2RJKA 2WWSA 4YZ5A 2EALA 3ZN6B 3RMYA 3THPA 1PO23 4W6XA 1H4HA 1RHI3 1F31A 3RWNA 3CJIA 2VG9A 3HT2A 3VV1A 5KXDA 1FMD1 2R041 4YNIA 2D44A 1AR92 4LLFA 4OLLA 3VBFB 2JE7A 1G7YA 3O5SA 4GH4B 5ABJB 2A6WA 4XOGA 1AJKA 1UPSA 4GH4C 5DZEA 5LRRA 5ABJC 1MQTB 5CVRA 4IEVA 4GMP1 3VBOB 1MQTC 3MIEA 3VBOC 4JRAA 1EP0A 1VBD3 2WIIB 2AZ5A 2NMOA 4FTEA 3MPPG 1F5JA 4RHV1 5GZFA 3ZFEC 1UU5A 1PVXA 2FZ1A 4C0HA 3K48A 3MLJA 4TYSA 4XZPA 3HT1A 4Q29A 1COV3 1U5IA 4K1ZA 5FQ0A 3KCCA 3KT4A 1AYN2 4NHKA 1C57A 4C90A 3RSJA 4OHYA 1HQLA 3R4SA 4HT1T 4MSVA 4HLTA 4MX3A 5T5LA 4LO8A 3BCWA 4WVVA 5HBAA 2D3RA 2VGDA 1ULCA 1HRI3 2VQ0A 1N1VA 2QVSB 3ZXEA 3W58A 4Q26A 5DDJ3 1OI6A 1GKBA 3FMGA 2NZ9A 3O0WA 2GNTA 4YRDA 1LCLA 2VMHA 4FOQA 2VUJA 1EPZA 1O7FA 1DGRA 3MPBA 4PIYA 4B8EA 4AK3A 1J59A 3D0SA 3VKFC 4B3NA 2RMU2 3ZYRA 4YZ3A 1OPMA 4CDQA 5FDBA 5E8AA 1AF9A 2QCSB 1EPWA 4FT8A 2ZPXA 1MACA 1A3KA 3WR0A 1AX2A 1A8MA 4Q4W3 4YW3A 3H3ZA 1SCSA 4AVVA 2UYBA 4YVWB 5LRSA 4YVWC 3ZN6A 3WDTA 4BLJA 4LUMA 3JD72 2PLV3 1J1TA 4X8NA 1KJRA 1R081 3WW3A 5AC92 3B5LB 1YNAA 2CNAA 3JU9A 4QD2A 4WBBA 3X29B 4DMIA 1Q8SA 4M00A 3UK9A 4RS5C 1AL0G 2JEMA 2ZJCA 1QXPA 4CEYC 3TNPB 2E63A 3MW4A 3OF1A 3TNQA 1YHFA 4NHLA 3A0KA 3DV8A 4AEMA 3ZFEA 1GNZA 2XBO1 4QGMA 4JC1A 4CEWA 2MHFA 1DQ0A 3TN93 3IBMA 2QKDA 4NHMA 1FATA 2CTVA 1R1A3 2ATFA 1FMD2 2R042 3VHRA 5J3UA 4AVAA 3LOBA 3AP5A 2A6VA 3I59A 1J3PA 1VP6A 1WCDJ 4K40A 2D93A 2WSVA 3VZNA 3MW3A 4DQAA 5C33A 3PVOA 4FOYA 2LM3A 4IESA 3WINE 1W6MB 2QUOA 3ZXFA 1EAH1 4JGZB 3ZIWA 4EN0A 4JRLA 4K1YA 4UW3A 4JGZC 4RHV2 4F83A 5A3MA 2IXCA 2YUEA 2HWD2 3WDYA 4BE3A 1AR83 1MZEA 1X7NA 2OVUA 3PHMA 4XYXA 4DFSA 3KZ4C 3OYWB 4MGIE 2VW2A 3EQEA 1S2BA 3N7KA 1QQP3 3M3CA 1AX1A 2DTYA 2PAEA 2EAAA 4DOUA 3JQXA 4YW5A 2PTMA 4YM3A 3NVCA 4G4FA 2DVDA 1W6PB 1IQAA 3H7JA 5GZCA 1H2MA 2EXHA 2DUPA 2RS11 4QX5A 4EJRA 1LOCA 2D6OX 3E5XA 4XJ9A 1GICA 1UIKA 2ZGTA 1GANA 4H3WA 1ONAA 1ND3B 1ND3C 3ZN4A 5A3LA 3U11A 3ZVXA 1LODA 4RS5A 1PO21 1DYPA 4EV0A 4CEYA 1HW5A 4IEOA 3PTYA 2F6BA 3WY6A 3PLQA 4JDOA 2IXKA 4BOWA 4TZDA 2JXAA 5C4WA 5I0SA 5SV8A 4HVRA 2R30A 2ZGPA 1VBD1 1MEC1 2E9QA 2OPKA 3NKGA 1R082 4Y1XA 4QPIB 1WBLA 3TRSB 5K0UB 3D5OA 4QPIC 3J8F3 4P9GA 2ZX1A 1OQDA 3ZFFA 2ZACA 1COV1 4FPGA 1KRIA 5BNPA 5FPZA 2K0GA 3WCRA 3FJSA 5T52A 4C1WA 1DQ5A 1O4TA 2XBO2 5JPMB 3KM5A 1QF3A 2PN5A 3H50A 5FMOS 3NV3A 1PIV3 2ZMLA 5CU1A 4L92A 1HRI1 3IDBB 3ZMOA 4MGKE 4DS0A 2A3YA 1VR3A 3GHNA 4MXWA 2XHKA 3VLBB 1DZRA 2C5DA 2VNRA 1EAH2 3AKQA 4XBQA 5FOBB 1GYKA 4E9KA 4Z1VA 2I07B 3TBDA 1ND2A 5JMCA 1BEV3 3RNSA 4Z8BA 2FMYA 1DF0A 1ZZBA 2D43A 3WCSA 1BBT3 4LBMA 5KWRA 1B35A 1NE6A 2F4PA 4D3WA 3M4FA 4N43B 5JSRA 1F9KA 1QY4A 4I01A 4N43C 2ETEA 5KXEA 2HWF3 1W6NB 4AGGA 1SBDA 4XF9A 2PLV1 2PYTA 3GBFA 1Z0HA 5KHHA 2ZHMA 2WA4A 3CU7A 5JOZA 1ZZCA 1GZ9A 1MZFA 3RRDA 1N3OA 3I8TA 4INDA 1CAUB 2RS12 1GLHA 1KDKA 4XF4A 5F5QA 4OI4A 4ASMB 1Z78A 3SMHA 2BPA2 3MFAA 3WDVA 3JB8A 2GZWA 2ERFA 1QOTA 4XQWA 4HMZA 1PO22 3TN91 1RHI2 4AVBA 2SLIA 4KWJA 1R1A1 1OKQA 3WP6A 5CADA 1AL23 4AI2A 4XIKA 5JOYA 5F1RA 1DQ2A 1QOOA 3OGGA 3BPZA 1NLSA 3L2HA 5HCBA 1KFXL 1LHVA 5T54A 3WDWA 1LRHA 1VBD2 1MEC2 1IKQA 5JIAA 4AQSA 2ZAAA 3G6JB 3N35A 2KM2A 4K3UA 4LULA 5F6KA 1XE7A 4NOTA 1AR81 3BU7A 2LUWA 1IS5A 1PHMA 5D1IA 1LGBA 1COV2 4YVSA 2BVVA 2HKXA 1CONA 3TAYA 4XHBA 4V1PA 5CFCA 3FHIB 4QGLA 1V00A 3RI9A 3GZTB 1YYNA 3PVNA 3S30A 4XMIA 5EWSA 5K7PA 3INAA 4YARA 2QDRA 5C9AC 1VAVA 1HRI2 4I09A 2ARBA 2Y0IA 4TLFA 1AJOA 1UZZA 4XTMA 4IQPA 2QJVA 2DU0A 3CNAA 4N7IA 1O3TA 1FV3A 5J37A 4Y5Z0 1TME3 1PNFA 1DGWX 4XMAA 1LB2A 1V70A 2YZ4A 1UU6A 4KU8A 4CDUA 2XH6A 3B93A 3N3HA 3NW4A 2HWE3 3E6CC 4R9CA 5JIUA 1V6KA 4FOWA 2TEPA 1K5MC 3WT3A 3FLTA 4BCUA 2ZX0A 1AUYA 2A5ZA 3IKWA 3I2DA 1LEMA 5KXBA 4FPLA 1KJLA 1FX5A 3I4IA 2A3XA 4JTNA 2PQQA 1AXKA 2PLV2 2Z79A 4B4PA 1OQEA 4YZ2A 3D82A 4AEDB 3J8F1 4I3PA 2LALA 4AEDC 3QOPA 2ENRA 4RA0A 3R4DB 4XF1A 4YM1A 1F5FA 1DHKB 1C8M3 3LZZA 3SHRA 5JSOA 2DCYA 1CAWA 3HD8B 1QNYA 3VZKA 4GA9A 2NM1A 3V0BA 4HN1A 2XJUA 4M3CF 3USSA 4PQ9A 1RINA 4I0WB 1LHOA 3B7MA 3NL1A 1DG6A 1HQWA 2XVLA 1OLRA 3TN92 4LBQB 2HYKA 1PIV1 4QM8A 1R1A2 3VBSB 4HANA 1V6JA 3ILRA 1BYHA 2OZJA 3P3PA 3O0XA 1JH5A 2VVDA 4QMAA 4PLNA 4ORFA 5CIRA 1HRV3 1MR5A 1NCRA 2RM23 1ZZ8A 2LTNA 5CA6A 4MXVA 5C9AA 3V0AB 3UJQA 4Q0QA 4XFGA 3AKSA 4PBPA 5A33B 4FPOB 1QWRA 1V6MA 2ZGKA 2E7TA 2Z2SB 1ZREA 1BEV1 3AP4A 3WNXA 1AR82 3FWEA 4FQZA 5L36A 4ITCA 1RVF3 4KG0A 4XJWA 1BBT1 2E7AA 1B09A 4AEJA 3OGJA 3AP7A 1GZWB 1ZRFA 1APNA 2SBAA 3B3QE 4FBFA 1LJ7A 2GN3A 5T5JA 4AEKA 5FPXA 3FE5A 3LA3A 2HEWF 2HWF1 1OA2A 2NN8A 3OTFA 1CJDA 2JG8B 4QQOA 1DU3D 4WM7B 3B02A 2JG8C 1R093 4WM7C 1K5MA 1RIRA 3LAGA 1YJLA 2X53S 3AZVA 3GHMA 1OSGA 1FXZA 4XEZA 2DCZA 3BALA 1CPMA 4TWTA 1PZ9A 3RZZA 2A75A 1ENQA 1Q56A 2GC1A 1UN1A 4RR3A 1U0AA 2P3IA 1W0PA 4NR1A 5GLTA 4KU7A 2TUNA 1RC6A 4CTEA 3ZXDA 4I2OA 2WFPA 5FO8B 2BW8A 4AEDA 1AR61 1TQ5A 5CAZA 1MS5A 4WM8B 3D4KA 1VBA3 5EJ3A 2JDZA 2XLFA 2DCKA 1VB2A 1AL21 1QU0A 4LBLA 2QE3A 2VUAA 2EAKA 1ZM1A 2HEYF 4RQPB 4M3CB 1W2UA 4RQPC 1I5ZA 4LBQA 4AQTA 4LBNA 2CAVA 5J98B 3B01A 3BTAA 5SV5A 1UKRA 5LEKA 1LHWA 1XYPA 3J8F2 4LEJA 4M01A 3QACA 1HLCA 3SH5A 3UKNA 2E51A 2JJ6A 2D6NA 1Y9QA 1LOAA 3APBA 4BMEA 4UW4A 4Y22B 5E16A 4H14A 3ZSJA 1CAVA 1ZBE3 2Q4SA 2WFF3 4JAAA 2FMDA 4LUKA 4NVPA 1QJU3 4XILA 4XXPA 2GMMA 3VHOA 4L11A 2EXJA 2R49A 5BNNB 2Z69A 4P9WA 4A7ZA 1PIV2 3OCPA 1REDA 3DPRB 1YXWA 3DPRC 2AREA 3H1WA 4AQ2A 3U07A 2PHDA 1QXRA 1UZYA 3TWIA 1YO8A 3LSEA 4JV4A 2WZPP 4S2HA 2FBEA 4Y1VA 2H6BA 2Q1MA 2GNDA 1SFYA 1CAXB 2B45X 1YJKA 1BKZA 3V64A 1RUOA 2Z5WA 2ZMKA 4LO5B 1URXA 3AK0A 1TMF3 4WVZA 1LTEA 2D6LX 2HWE1 3AB0A 4E4ZA 1BEV2 3ILFA 4XJ8A 4FQ4A 2NQYA 3THTA 1FPN3 1BBT2 5H9QA 2YHJA 4O9GA 4J1XA 4MH0E 3ZX7A 3ST7A 1S0EA 2PA7A 1NCQB 1PK6A 1NXD1 1G9AA 1NCQC 3U4XA 2HWF2 3W9AA 3VDDB 5AC91 3VDDC 2EXIA 5BNOB 1PGW1 5BNOC 5L7OA 1H8TB 5DUXA 1WW4A 1H8TC 1TNFA 3FBMA 1SLIA 4KQ7A 3DGTA 2VXRA 1V6LA 4I02A 1FT9A 3P3NA 1C8M1 2JENA 4AVCA 4OI2A 4OI0A 2GC2A 2A73B 3KB5A 4RQPA 1YUDA 1KS4A 2UWBA 3AYEA 4OHVA 4EROA 4ISQA 5EYYA 1NYWA 1XNBA 3AKPA 3USUA 3FZ3A 1AR62 4OHZA 2V5YA 4G9SB 2VULA 2VVEA 3PJQA 4FP2A 1QJX3 3VBFC 1AL22 4Y22A 3AYDA 4XTPA 5DXDA 4R8HA 3HQXA 4D7TA 2ZKNA 1HRV1 1AHSA 2RM21 2A6ZA 3ZXAC 2B5HA 2XWJB 1O5LA 4AFAA 1PGL1 2ZGUA 1ZZ7A 1UU4A 3NSTA 1HKDA 3VZMA 2HWD1 5K9YA 1XNDA 4B4QA 1X36A 2UYAA 1IKPA 1OA4A 3L2YA 2WNEA 4LBQD 3ES1A 4FPEA 4SBVA 2PHTA 2W08A 3HBZA 5FLIA 1ENXA 4W65A 4M0NA 2XL9A 3RYPA 3SNMA 1CR7A 1LHUA 1Y3TA 3SCFA 2ZHNA 3WG2A 4Q8KA 1NA1B 2CAUA 2AR6A 2DUOA 4EWDA 4P9LA 3WP4A 4Q4Y3 1YFUA 2RR13 1SBEA 3ZFGB 4COVA 1Q5OA 3ZFGC 4WV8A 1J3QA 1S0FA 5EXOA 3VDDA 4CDWB 2I2SA 5BUVA 4Y1ZA 5JZGB 4CDWC 5JZGC 2BQPA 1O3RA 1YRZA 1SQ4A 1ENRA 4XETA 1LEDA 2PELA 1VBA1 3WW4A 2HWE2 3AZYA 2AH2A 4MVTA 3BOPA 3EHKA 3POYA 4GALA 4AVTA 3ZSKA 3VKNA 4PJYA 2MPFA 2NYYA 1W0OA 1Y43B 1SDWA 2HWB3 5IK5A 2GN7A 1MZ6A 3VZOA 3VBUB 1ZBA3 3VBUC 1WMEA 1PGW2 1SLLA 4GMP0 3VBFA 2QFEA 4LBJA 1RJ7A 3H8UA 1S55A 4LLOA 1CQ9A 4K20A 4GH4A 5ABJA 1PO13 4UBHA 4AXOA 5J96B 1C8M2 1MQTA 2ZKLA 2KA3A 4XJZA 3VBOA 5JWPA 1WBFA 3H7YA 5JI9A 4ASLA 1EYBA 3AMHA 3NV1A 5I8SA 1JTZX 2WFF1 1O4YA 1QJU1 1MS0A 1YFXA 4L2NA 1RMU1 1WCSA 5CG8A 2IWGB 3MGUA 1H1MA 4FCAA 1NQDA 1WD4A 4DRVA 5GLZA 2WKKA 4FP3A 4L97A 1HRV2 1LECA 2EXKA 4IETA 4OUSA 2AGSA 2RM22 3PNAA 1PGL2 4Y1YA 4XF0A 2VOVA 4JDMA 1SFNA 3T1MA 1QGLA 1OFNA 2Y26A 4A3XA 4GWMA 2ZGOA 3H0OA 3ZSLA 1MS3A 2XJSA 4IEWA 3WZ1A 1W6QB 2JKBA 3AP6A 1FPN1 1HXS3 2D5FA 3GF6A 5BPXA 2ZZQA 5AFEA 1H2LA 1F2NA 4BMBA 4N53B 5B2GB 1C4RA 2BEOA 4W6WA 2W0XA 1U5XA 5FREA 3WUDA 4ZXKA 3M3EA 4IL7A 4Q0UA 2DF7A 1GSLA 1HDKA