3CKHA

Crystal structure of eph a4 receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
170
Chain Sequence
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIDEKNIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Crystal Structure and NMR Binding Reveal That Two Small Molecule Antagonists Target the High Affinity Ephrin-binding Channel of the EphA4 Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ckhA00
1JYNA 3ACHA 1UY4A 4JHZA 4KWUA 4E8CA 4DEQA 2VZUA 4IUGA 3GGLA 2J1TA 3MV01 2EIDA 3I3DA 2Y6JA 3T2OA 3OG2A 3A7QA 1W8OA 2ORXA 2VCBA 5JXHA 1NAEA 5IHRA 1GQPA 2J1RA 2X05A 2J1VA 3IAPA 3HNBM 1WCQA 1JZ2A 3PUIA 3EB7A 3GXUA 3LPFA 2QQKA 3HJRA 2QQOA 3JXSA 2VZSA 2W5FA 3I2IA 3HNYM 1GMMA 3MV11 3I3BA 2RJ2A 1UMHA 1NKGA 1JZ6A 4OMCA 3WF0A 2WO1A 2E31A 2VQUA 3T0BA 3FL7A 1JI6A 5I0DA 1UMIA 4BK5A 1GOFA 5IJRA 2W46A 2QQLA 5C7GA 2VZ3A 1W9WA 4P02B 2JKXA 4GZ9A 2ORZA 3HPNA 2W87A 1ULOA 4M4PA 1JYWA 2L9LA 3C7FA 4A45A 3I2GA 1R64A 2WZ8A 4JX0A 2E26A 3C7EA 2VM9A 1GOGA 5G05L 4OYUA 3W5NA 2J1AA 2J22A 3CKHA 1MPXA 3A21A 3CDZB 1RYYA 2BZDA 4BXSV 2C9KA 4CU7A 1YQ2A 4AG4A 3SEPA 2CDPA 3SKVA 2LS6A 4D8MA 4PQQA 4LKSA 2YG0A 3I97A 3VDCA 3WQBA 2WO2A 3I2KA 3PUHA 1JYXA 2ZEZA 5CYYA 4LPLA 1JU4A 3C7OA 4DXSA 1JZ4A 2W94A 4YPJA 1IQDC 2RVAA 2Y6HA 5JXJA 3NJXA 5HXMA 4MGQA 4CUBA 1UYXA 4W50A 3ACFA 4XUNA 1F4AA 3CIHA 3F2ZA 3VDAA 2J1UA 5EIYB 1JZ8A 3MUY1 2EIEA 4W4ZA 1JZ5A 2QQJA 4A41A 3MO4A 2VZ1A 1O8PA 1DLCA 1L7QA 3OGRA 1H6YA 1UY0A 1WKYA 2WN2A 4QX3A 4M4RA 4ZZ8A 2W91A 2C26A 4QX2A 2BGPA 1W99A 2VZTA 5C70A 3VD7A 5B4XA 1PMHX 5FUIA 4ZY9A 3ACGA 4D0QA 1EUTA 2J7MA 3OGSA 3I2JA 1JZ3A 5EJ1B 4JKMA 1CZTA 1PMJX 3ECQA 3P6BA 4LQRA 4JKKA 3GDBA 1D7PM 2VOTA 3GM8A 3IB3A 4XUTA 3LEKA 1XPWA 2LW8A 2V5DA 5JXIA 4DUXA 4QDSA 5DPNA 3WEZA 3BGAA 2VTFA 4UAPA 4ARXA 3A22A 4A4AA 3J7HA 1W0NA 3CQOA 1J84A 2KD7A 4AAXA 3K4DA 1CX1A 4QAWA 3C7HA 2W95A 1PX3A 2ZEXA 1ULPA 1GUIA 3I2HA 1JZ7A 3NNGA 1O59A 3I3EA 3OEAA 1K3IA 2VMFA 2QBXA 2YC2A 3WSOA 3E1F1 4XUQA 4FI9A 4A6OA 1US2A 2B9VA 3LPGA 4ZZ5A 2DCJA 4QDQA 4CU6A 1KEXA 5IYYA 2W3JA 3T2PA 4GWIA 3ZM8A 3WNNA 3HN3A 2XQXA 5DMYA 2HYXA 4BJ0A 2E32A 3K75B 3IAQA 3FN9A 2Y8KA 3HOBA 1US3A 1XNTA 3I2FA 4HG6B 2B4KA 1K12A 2QQIA 5JR2A 3HNMA 3LQCA 5LA2A 3UESA 3ETPA 2VQTA 1L7RA 3EYPA 5CZKA 2VZRA 4KMQA 1W8NA 2W92A 4A3ZA 1UWWA 4A44A 1K45A 5J1XA 3WNMA 2ID4A 3K46A 3P1IA 2OKXA 2W1UA 2E33A 2VR4A 3MBWA 5C71A 4DUWA 4P00B 2VL4A 2VCCA 3ABZA 3LE0A 3OGVA 1UXZA 4RYDA 2ZEWA 1W9SA 4TXWA 1LNSA 4QPWA 2XHNA 3VD5A 4DXRA 4L0PA 2WDBA 5B4NA 2X09A 1HN1A 1UX7A 1PX4A 3BN6A 2ZXQA 1K42A 3K77A 1UXXX 4QDRA 1OH4A 2DDUA 3LEIA 3W5MA 2WAOA 2VZPA 4CUCA 2W1WA 1GNYA 2V72A 4QX1A 3T0DA 2QQMA 2W1QA 1H6XA 2W47A 5EJZB 2YFZA 3VD3A 3VD4A 3MUZ1 2DCKA 3FHAA 5LCWL 3WF1A 1OD3A 4PT6A 2Y6KA 2WUHA 2Z4FA 4GWJA 2RV9A 3T08A 2J1SA 1XC6A 1DP0A 3UETA 2VJXA 3VD9A 3SEEA 1F4HA 4P08A 1DYOA 3T2QA 4CUAA 3HEIA 5JMOA 3WNPA 3WNOA 5JXGA 2WYSA 4TTGA 1JU3A 3NJVA 4DXTA 3WF2A 2WZEA 2BGOA 3D3AA 2VZQA 2J1EA 4E8DA 2R7EB 4PF1A 4CU8A 1TVGA 3K4AA 4XUPA 3THDA 1OF4A 3DYMA 4XVHA 1I5PA 4MADA 2VC9A 5HPOA 4CVUA 2EIBA 1XNAA 1OT5A 2WABA 4ZXEA 4UI9L 4MGSA 2Y64A 4OZOA 2VMDA 4JKLA 3C8XA 2VZVA 1UY1A 2WBKA 3OEBA 1JYVA 1CIYA 2VO5A 3DYPA 2C4XA 4OUEA 3THCA 1SG3A 1O8SA 1JHJA 5LA0A 3C7GA 2YC4A 3WNLA 1UYZA 3NRUA 2WAAA 3SKJE 3T0AA 2JE8A 2YFUA 1NX9A 1CZSA 5G04L 2WN3A 5IFPA 2QQNA 4XURA 1W9TA 3FHQA 2W1SA 3IIIA 2JDAA 3IDAA 4W8JA 2Y6GA 5LA1A 1P8JA 3OB8A 4QX0A 4XUOA 3ACIA 4P5YA 3WF3A 2WO3A 1CZVA 4LHSA 2VZOA 4MOAA 2X10A 4XZUG 3CMGA 4Z2AA 4RN5A 4BDVB 4QB2A 4DUVA 2VMCA 2YB7A 3VDBA 1SHWB 4ET7A 3LEGA 1BHGA 4KI5M 3WF4A 3CZUA 1GOHA 4A42A 1GU3A 3CZJA 1NUKA 4DEVA 1SDDB 1J83A 3T09A 4QB1A 3DYOA 2PQSA 1OF3A 1UYYA 3A23A 4UOJA 2V4VA 2JD9A 4CU9A 5DQ0A 2BERA 3OBAA 2VCAA 1T2XA 5DN2A 5IFTA 4ARYA 2W9XA 4BK4A 1KGYA 1TG7A 2BBAA 2HLEA 1UY2A 1EUUA 1UZ0A 4OMDA 2CDOA 2EICA 3NQHA 2VMEA 3WNKA 2ZEYA 2WQ8A 3AC0A 4QB6A 4MO3M 3U37A 2XOMA 5JUVA 5F7UA 1UY3A 5A1AA 3K4ZA 3UNPA 2XONA 3DECA 2Y6LA
chains in the Genus database with same CATH superfamily
1NYWA 4S2FA 4YM2A 2DUOA 4URTA 4LBMA 4XBQA 3SITA 1E57A 1YQ8A 5FYUA 1COV1 1LHUA 1UY4A 4KWUA 1RITA 2OXBA 4IUGA 4Q4Y1 3GGLA 2D97A 3MV01 2Y6JA 4EWAA 1U12A 2P3KA 3OG2A 5FKBA 3UYJA 2ZGNA 1DQ1A 4MGKE 1WMFA 2VNGA 5JXHA 1RUE2 3AP5A 5C8CC 1PO13 4LJHA 2G9GA 1GQPA 1YQ5A 2X05A 2VD7A 2ZX3A 3IAPA 4PLMA 3HNBM 2R071 4E2GA 3WG3A 4IDZA 1G9BA 1GZWA 1XOYA 1SCSA 1VBB1 3EB7A 4G9SB 4QX5A 5F2SA 5HV0A 3HJRA 4FPGA 2GC3A 1ZBA1 2W5FA 4RR3B 4XEZA 4Q4W1 1DYKA 3OY8A 1NG0A 3HVDA 3WDVA 3MIFA 1UOBA 1XJAA 1YC61 3POJA 1AR81 3MPPG 1PO12 2D6MA 2RJ2A 3KGZA 4NIAA 4AOCA 1NKGA 2K46A 4QPGA 4UYBA 2IXLA 4R9DA 5CU1A 1CR7A 4K6BA 4G3YC 5BXXA 2ZX4A 1LOFC 1V6LA 4A6SA 2VQUA 1QJX1 4MVTA 4MXWB 4YGBA 5A7OA 3T0BA 3VKLA 5KHKA 3I3MA 4K1ZA 3KF5A 1JI6A 1IS6A 2F4LA 5I0DA 4URAA 3S30A 2ARBA 1ZBE1 5FZMA 1D2QA 1GOFA 2W46A 5FY5A 1Z0HA 3HQRA 4QQLA 2CTVA 4UW4A 2Q8OA 4X8NA 2ZHKA 4IEPA 5F1RA 1NY71 2ZMNA 3AKSA 4PLNA 3AKRA 1KDKA 2JKXA 3AMHA 1VB2A 3WCSA 1RUD1 3N7KA 4FCAA 1VB4A 4CCCA 2FDGA 4E27A 2PXJA 3CHXA 3I2GA 1R64A 4RS5B 4IV3A 2WZ8A 1OD5A 4GH4C 3C7EA 3RZMA 5F6KA 1H1IA 4HANA 2JWPA 3O5SA 1HQNA 3CDZB 4JRAA 4P9IA 1RYYA 1JODA 4Q5OA 5JOZA 4Q0QA 1AJOA 2FCVA 2YPDA 1O4TA 3GCXA 3U14A 1W03A 3MFCA 3R6SA 5JPNB 4PDWC 1PGL1 5M0TA 4KGQA 3RZZA 4IV1A 4D8MA 4PQQA 1X8MA 2YG0A 1LU1A 1GANA 3QCWA 3M70A 2WO2A 5J48A 5FZ1A 2JDKA 1H8VA 3QD6A 1O3SA 4QQ2A 3K3NA 4I2OA 5FMOS 3BTZA 2IUWA 5SV8A 3CJIA 1NT0A 1R093 2D98A 3AKTA 4GKYA 4FOYA 4JCKA 4N90A 5FMBA 5ACA1 1G6NA 1PM4A 5F8PA 1MQTA 1W9YA 4LLFA 2RVAA 2Y6HA 1H1MA 4K9SA 5HXMA 4I30A 3AMQA 3AX4A 5C4WB 4EN9B 5FYTA 5T54A 1I6XA 5IT6A 1HV0A 1L3JA 2PAEA 4EWDA 1C5HA 1RUI3 3VDDB 3I2DA 4D7YA 1G9CA 1F4AA 1AYN1 3O14A 5T55A 3S7IA 4YGEA 1HRI1 1R081 5T52A 5EIYB 1JZ8A 1UZZA 5FJKA 4L92A 2QQJA 3MEPA 4XJZA 3VV1A 4QPYA 2CL2A 3MO4A 2VZ1A 5K9YA 2D6PA 2UWAA 1BCXA 4COVA 1ENXA 5J36A 1QJFA 2NM1A 3A0KA 3PJYA 4M4RA 4LEJA 2MEV3 3NW4A 4GJYA 2BGPA 2ZJCA 1BEV1 3WINE 4MLOA 2A6XA 2JICA 4K3UA 5FUPA 2KR2A 2VZTA 5A3LA 2ADEA 3E6BA 1ZNPA 4FTSA 1PMHX 1XBFA 3NJYA 1AYM3 4D0QA 1UU4A 3HR9A 3MLKA 2WIIB 2V5YA 4E4SA 1SBDA 2A71A 1RL3A 3I2JA 3OGSA 2O8OA 1PMJX 2ZGKA 2MEV2 2UWCA 4LQRA 2DVAA 1WCDJ 3GDBA 1D7PM 4LT5A 5FZ8A 4JAAA 2IC1A 1SDWA 4NHYA 3V56A 3KVBA 4MYEA 1UIKA 4NO4A 3WW4A 5IVVA 1FOD3 5L36A 1AYM2 1OLQA 4CXXA 5I91A 4AFDA 1XPWA 2W52A 2LW8A 4UF0A 1BZWA 3LDKA 5FP4A 1R1ZA 2JD4A 1STMA 4OQ9A 3SC7X 2BWCA 4HN0A 5I8SA 2C6SA 1XU1A 5J3UA 2HEYF 2VTFA 3IDBB 4ARXA 2WNUA 3E5QA 4PLOA 3J7HA 2XQRA 3T30A 1UO9A 2RS51 4H14A 1W0NA 2BTVC 2ET7A 4N7UA 4XJ9A 5LY2A 4AI9A 2KD7A 1F5JA 1OBNA 1FOD2 5HCFA 3W20A 4QAWA 1PX3A 3J8F3 4H3WA 3NV3A 1GUIA 4RS5C 4AI0A 1IKQA 5F3GA 1UCXA 4QPIA 2OUJA 4OULA 5FZOB 2UY9A 5IWFA 3WDWA 4ZS2A 5SV5A 1H9WA 4CXWA 4CCMA 1K3IA 3RZGA 1V6IA 4YSFA 4WVWA 5EV7A 3WX5A 3OPTA 2BBVA 1S0FA 2A5ZA 1OVSA 3WSOA 1MEC3 1CAXA 3E1F1 1US2A 2G1MA 2BOJA 1TNRA 4HK8A 3J8F2 3LPGA 3GCWA 5A80A 3ES1A 1N3OA 3QOPA 4BH9A 4CU6A 2ZS6B 1W8ZA 1YIFA 5D8AC 1J3PA 2BFUL 3R4UA 5C3OA 5DAXA 4JGYA 4PI0A 2R1BA 2XVGA 2YC0A 3N9NA 3ZM8A 4CCKA 1H4GA 4MGZE 4LOSA 2WZR3 3NMBA 1C8M2 1VRH1 1J1LA 1W8UA 1MEC2 2HWE2 3K75B 4JDOA 4NROA 3TAYA 3IAQA 3VBRB 5ABJA 2D7FA 2Y8KA 3HOBA 1W8WA 2DU0A 3T1MA 1XNTA 3I2FA 5HCAA 2B4KA 2WRAA 2QQIA 2RS31 2RS13 1BK1A 5F5CA 2EALA 5FTTC 1YFXA 2UYAA 2GN7A 2AACA 4EZ4A 3UGHA 4DNYA 5C4WC 2VZRA 4SBVA 1W8NA 4G4FA 3J7NA 2F4PA 1NQJA 2IVIB 3ACLA 5FAXA 2WZR2 3FWEA 3JD73 5A7WB 1NCQB 2D3RA 3K46A 3VDDC 4HPKA 1OI6A 5L7OB 2WWSA 3U78A 2VR4A 3MBWA 4Y24A 3VKFC 3SH4A 1OA3A 5LA9A 3DXUA 5BNNA 4X8PA 3ABZA 2RS12 3FE5A 1NA1A 3POGA 1UXZA 2N7GA 4LBKA 3ZFEB 5A3UA 4FFHA 3Q8FA 5KXEA 2PTMA 4FPKA 2XHNA 4ES9A 3JD72 2JDMA 2PHWA 3V65A 3VZMA 4DXRA 5CG9A 1PGSA 1Y7BA 3RG0A 2WDBA 3DCQA 1WCUA 4YW2A 4AFBA 5ERLA 4O61A 1LRHA 4L9BA 3D0JA 5EXOA 5L9RA 4GMP3 1OKQA 1APNA 3QLQA 3ZMOA 4YVSC 3BN6A 2ZXQA 1RXGA 1YJKA 2ERFA 4LBOA 4F83A 5E6HA 1AR73 1FXZA 2WNOA 1OH4A 2DDUA 2GNTA 2QDNA 2XBO3 4QXHA 2JB4A 4IETA 1RHI3 1NQDA 1AX0A 2Q8CA 3VBHA 2W1WA 3M2MA 4P9LA 4B1MA 1FI2A 3T0DA 1K5JA 2QQMA 2BOIA 2EVXA 4BCUA 2VOKA 3MIEA 5EJZB 3UGGA 1LODA 2ARAA 2Y38A 4H2AA 1FMD3 4LK7A 4QGNA 4XCBA 4IESA 4FTEA 5I0SA 4A7KA 4PT6A 1AR72 4GJZA 1BBT3 2XBO2 3GYDA 2Z4FA 1OPOA 1V6KA 4GWNA 4IEZA 1RHI2 3TN91 5KXCA 2VMHA 1DP0A 4YZ3A 1URXA 2RM21 2ZGRA 5FQ0B 1LHWA 1C28A 2R6QA 4AFAA 3MF9A 1OOPB 3O1TA 1KS4A 1ND2A 1SMVA 4RGAA 2ZKNA 2GH8A 3VD9A 1FMD2 4JGZB 2WYFA 5FYZA 3ZN6B 4FPJA 3N9LA 2HBTA 5AVAA 3HEIA 5BNOA 4LXLA 1DHKB 3WNOA 1BBT2 2C1FA 1SLIA 2WYSA 3B7MA 3RVHA 3EJKA 4CDUB 3EHKA 4CCJA 1FT9A 3SNMA 3E5XA 4LOTA 4DXTA 1RC6A 3WF2A 3KD4A 2EXJA 5LY1A 4E4HA 3BCWA 3UJQA 2ZGQA 4XF9A 2R7EB 1K5MC 2NYYA 3JB4C 3N9MA 4M00A 4PF1A 4CEWB 2WL1A 2PHTA 2YBKA 2IZWA 3RZJA 2D6OX 2RMU1 2D3PA 5IVCA 4WVMB 4K8FA 1G9FA 1R1A3 1GZTA 2C9AA 3KHBA 1I5ZA 4YARA 2VUDA 1BMV1 2YMZA 2VC9A 5FZDA 5JIAA 3OD4A 5C5UA 4OHVA 2XKPA 5F2WA 1DDLA 2JDYA 1XNAA 5FLJA 5L9BA 2VXJA 2WABA 1FPN3 1SFNA 1V70A 1DZTA 1PK6C 3AL5A 4MGSA 3K3OA 4DINB 3MF6A 1UIJA 2QJVA 4COWA 1RB8G 4DMIA 5C8CA 5KHIA 1SLAA 1UY1A 1CESA 4IGOA 4Q0UA 2VOWA 1R1A2 4L11A 3LSDA 3OPZA 3F95A 4IL7A 5GALA 3WG2A 1IHMA 5A1LA 2WINB 2WJSA 2YGLA 5C33A 1O8SA 2FHRA 4M0NA 5FO8B 1D0HA 5LA0A 1XE7A 3WNLA 1UYZA 2DBIA 3H8RA 3OGJA 1VBE3 4P5HA 3AYAA 1FPN2 5BYNA 1MS4A 5FP3A 1KD7A 1CAUB 3HMYA 3OCPA 2PMWB 5K4LA 3N7LA 3KB5A 1V6NA 1V9U3 3WHUA 5IVBA 3ZFEC 5DDJ3 3AP6A 4W6XA 3FHQA 4MGYE 3URFA 3TEYA 1LOFA 3LOIA 1BQPA 4K40A 1VBC1 1H9PA 4YZ4A 2G19A 3K48A 1IS5A 1P8JA 3OB8A 4FPEA 4QX0A 2YROA 5JI9A 3H8OA 2OPWA 5CKQA 5DG1A 4EQVA 4FAHA 3U75A 3AZXA 4Q1RA 3KWVA 4XFFA 1CZVA 1DU3D 3FX3A 4PIYA 3EO6A 4LHSA 3GHNA 5DDJ2 3WUCA 5EYXA 5EFUA 2A3XA 2YU1A 1A6CA 4RN5A 5FZEA 5CG8A 4CP1A 3H8XA 1ST8A 3B00A 4B7KA 4XILA 3K2OA 4KI5M 2LTNA 3POEA 5DXDA 4PF5A 3HT1A 3CZJA 4YG0A 1NUKA 3IBMA 4GH4A 4BLJA 5FKCA 4QQOA 4AZZA 1W0PA 1GV9A 1JUHA 2P3JA 2EAAA 3LAGA 3WQ1A 5KHGA 5I0RA 2ZHNA 2PQSA 1OF3A 1UYYA 3DYOA 2P5BA 4QM9A 4TSVA 2JD9A 1DQ5A 2WKKA 3NNLA 4UOJA 3TBDA 4X6QB 4CU9A 2VCAA 1PVXA 4KQ7A 4RA0A 3ST7A 2QQPA 2OPKA 3ZDVA 4D6RA 5FZ6A 1BJQA 4PDWA 5C3PA 5DUXA 1KGYA 5H9PA 1UY2A 1EUUA 4GB32 2Z42A 1UZ0A 1WUVA 4UW6A 3KV5A 3U10A 1OOPC 4Q8LA 3V0BA 4COYA 1ZVFA 1W6OB 2GC1A 4AYUA 4JGZC 1HV1A 2ZX2A 4PQ9A 5IK4A 3V0AA 3WNKA 1XYNA 1KS5A 2WQ8A 4QB6A 3U37A 2VNOA 2ZGLA 3DKWA 4KNCA 3N9QA 5C5TA 3JQWA 1XQNA 3ZIXA 4HFSA 2VCMA 5JUVA 3Q8AA 1OQEA 1UN1A 5FPBA 1ENSA 3DGTA 5A1AA 4AEMA 1REFA 4V2VA 3UNPA 1ULCA 2EXIA 1SZBA 4XC9A 3WDTA 4A3XA 2XB6C 3VBUC 1LJ7A 2DYCA 5JOXA 1WA6X 1LECA 3LFIA 1IG0A 2H6CA 5DAPA 2MPFA 5GKAC 4CEWC 4JDNA 5FOJB 1JYNA 2ZACA 3TEZA 3ZXAC 1CVNA 3CBNA 4BQ5A 4LHKA 1WLCA 2OA2A 4DEQA 2VZUA 2RR11 2V73A 4R8HA 4LIUA 5IAVA 4LO6B 2R043 3AP4A 1CAVB 2EIDA 5CADA 5FYCA 3T2OA 4DPNA 4DXZA 4FP3A 1REDA 1RMU1 2P2KA 5LEKA 1NAEA 5IHRA 5A3MA 2QQUA 4I09A 1BXHA 1D0GA 2J1RA 1OQ1A 1W2AX 1AR63 2QNKA 4XACA 4KH9A 3R4DB 3T3YA 1S2BA 4LKDA 2DVBA 1GP4A 3LPFA 4W6WA 2JIJA 3ZFGB 2R042 1QDCA 3LB9A 1RUF2 2X53S 4EN6B 2GSYA 4IGPA 4UBGA 1OA4A 1TZOA 1PO21 1QJU1 2IVJA 4FPYA 4H7MA 3PUAA 1GMMA 3MV11 2DCTA 3I3BA 1A3KA 2VUAA 4DS0A 5FZBA 2JDUA 1F15A 2PELA 3X29B 1H2KA 4A2UA 4Q29A 4EROA 3IPVB 1AR62 5L73A 1JZ6A 1YFYA 5DAWA 2GALA 2BWAA 1O3QA 1PM7A 4BM8A 4Y4YA 1QJZA 3MHZA 3THTA 1C3HA 4S2HA 3KT4A 3MIGA 2E31A 2G9ZA 4EN7B 4U2AA 1RUH3 1EYBA 5GLTA 3MZHA 3ZYGA 1DZQA 4C90A 3NL1A 4MXWA 3CL1A 4WM7B 3VBSB 3KGLA 2P17A 4BK5A 4UFLA 4Z82A 3LA7A 5IJRA 3VZJA 3HD8B 5DZGA 2WS93 3O1PA 1OA2A 2Y34A 4HBNA 3VHOA 2OIIA 1SACA 3AJYA 4QKDA 1W9WA 2BNOA 2HBUA 5BNPC 2B45X 2VUCA 3DXTA 4GXLA 4OHYA 4XIKA 1RUH2 2W87A 1HXS3 3I3QA 1C8M1 2HWE1 3C7FA 1MEC1 3LIGA 4JX0A 3ROUA 2YXSA 4XE9A 1OXCA 1X8EA 4OYUA 3W5NA 1GWLA 2J1AA 3IMNA 4Y1UA 3ZPYA 2J22A 2WS92 4RS5A 2VW1A 3CKHA 5A6ZA 3A21A 3BB6A 4XTPA 3SQOA 1HN0A 3O7OA 2GU9A 4LA2A 1JYCA 2BZDA 4XW3A 1WCKA 3BUCA 4IEWA 2HWF1 2WZR1 3TWIA 4AG4A 4P9YA 2EIGA 4IGQA 4WVZA 3WCRA 5JZGC 5JIUA 4QT6A 3P5BA 5CVRA 1YLLA 1FAYA 3LZZA 4UFMA 3WT3A 3ZSKA 4YM3A 3DPRB 3GF6A 3I59A 4GIQA 5D8AA 1LEDA 1C4RA 3N4MA 3M7AA 5CYYA 4B8EA 3KMHA 4KBZA 1UAIA 3POSA 1H4HA 4KWLA 2X29A 2GNMA 2W94A 4CCNA 1YEWA 2LUWA 3WNXA 1HRV1 4QKNA 4YPJA 3VBFB 1VMJA 4NPRA 5FY9A 4AGVA 2VECA 2UURA 5LB6A 5CIRA 4CDXC 2QQVA 3B9CA 2YV8A 1YQCA 3H50A 1DG6A 4LR4A 3KHCA 1W6PB 5C4WA 4NIHA 2ZZQA 4W50A 1GWMA 4XUNA 3ILFA 3CIHA 3F2ZA 5FZKA 2J1UA 1ODMA 2R0HA 2WNVB 3J9SA 1UZVA 4W4ZA 3VDDA 3POIA 1RVF1 1GFF2 2JDNA 3WDUA 2Y26A 3OJBA 4LULA 3S6PA 4LBQB 1S4CA 4A7YA 4GMP1 2VVFA 4AWDA 1UY0A 3TNPB 5LK7B 4QX3A 5I0TA 1LGNA 2BEOA 4UXAA 1XE8A 2W91A 3NKGA 5T5JA 1PNGA 1ND3B 4QX2A 3O1RA 3T2TA 1NXMA 4YZ5A 2NPIA 2XBO1 2VE1A 3AKPA 1ZZ9A 5GZGA 2JEMA 5JAXA 2JXAA 1L7LA 5CNAA 1RUJ2 3BTYA 2XJTA 5J96B 3ZR6A 4ZY9A 2AEZA 1W3VA 3ALQA 4L8QA 5FMDA 4Q2FA 1N1SA 3E97A 3MW2A 1WA4A 4K8RB 4L99A 4YVSA 3PVEA 1HB2A 5CB7A 3SCGA 5EJ1B 3ECQA 3P6BA 5CFDB 4LMFA 5JOWA 3L9JT 5AC91 3E5UA 2BU9A 3M3CA 4N43B 4NN0A 2GP5A 4OHWA 3MGUA 2ZA9A 3ASIA 2VBDA 1E5SA 1G7YA 1VBD3 4Y5Z0 4LO4B 4FBFA 5FRAA 4XUTA 3PUQA 3LEKA 4Q27A 5FO7B 1LAJA 5FBZA 4MHUA 2DBNA 4IE6A 2XGXA 3TOJA 4HZFA 3ZIWA 4CDWC 4DUXA 1Z7S3 4QDSA 4GWMA 2BGCA 5JXIA 3WEZA 1F31A 5DZEA 4I3PA 2XHKA 3VBOB 1OUXA 1ZZ8A 1SPPB 2ZGOA 1U0AA 2O8QA 2ZX1A 2YU2A 1CIWA 4A4AA 1DLLA 4I3GA 4XFGA 3VKNA 1X7NA 3CQOA 1J84A 1U5XA 3NNJA 3G6JB 3K4DA 1YFUA 2C24A 3CEWA 1VBD2 1PVC1 2PHUA 4XF3A 4XFCA 1IKPA 2W95A 4Y22B 3ZSMA 1AL21 1YRZA 2BPA2 4IERA 2D6LX 2A1XA 3I2HA 4MUVA 1MVEA 2IXKA 1Z7S2 1UD1A 4WVVA 4Q4X3 1IS4A 4I02A 3RSJA 2PLV1 2Q8DA 4RHV1 2DVGA 3I3EA 1YIPA 3R0RA 2RHPA 1AR91 1H2NA 5FPXA 2DFCA 5DZFA 5FZOA 5I8TA 2YC2A 4MZUA 5A3OA 3S5AA 5GZFA 1XYOA 4A6OA 5FZ7A 1JHNA 2B9VA 4LIVA 2ZGPA 5FREA 2PQQA 2CNAA 1K5MA 2DCJA 3MICA 2PYTA 2JG9B 1DGRN 4Q4X2 4Q0VA 3OD0A 4N9HA 5IYYA 2W3JA 3J7LA 3DPRC 4AHWA 3WNNA 3H3ZA 4BE3A 2EXHA 3HN3A 5A1FA 4XDPA 5KXDA 4AVSA 2HYXA 4BJ0A 3O1MA 1C57A 1V00A 3C2UA 1POV1 3FFQA 4HVOA 3SH3A 5J09A 4HOOA 4MGIE 3PIJA 4YW3A 1US3A 5ANNA 3WUDA 4E2SA 2FMDA 4GA9A 4Y20B 1O5UA 1PK6A 3UKVA 3VBFC 1NCRC 2Q8EA 5HXVA 2DURA 3HNMA 1TMF1 1QJY3 1M4WA 2XDVA 3LQCA 5LA2A 3UESA 2P34A 3ETPA 4CDQB 3EYPA 5FZ4A 1HLCA 4DY3A 4A3ZA 1SFPA 4A44A 4KL1A 1Y9GA 2VNVA 4Q26A 4JVAA 5C8WA 5J37A 5CBLA 2ARXA 3OGGA 5LRSA 1ULEA 2JG8B 1CJPA 2BNMA 4FXGB 4AFCA 2W1UA 3H1WA 5A7WA 2WLPA 4R9AA 3PURA 5C71A 3U11A 3ZYJB 3CNAA 2VCCA 1QJY2 2VBBA 3D0SA 4I0AA 5LATA 3OGVA 3AZYA 3RNSA 4RYDA 3GBWA 3I4IA 4ZU7A 2JIGA 4TXWA 1LNSA 2IXIA 3GZEA 4QGMA 4QPWA 4FOVA 1WMEA 1GZCA 4XOGA 5FZAA 3W9AA 3ZFEA 2ZBJA 4LUKA 3WLUA 4B4PA 3ILRA 2ZGTA 3HIFA 4RQPB 2X09A 5B4NA 1R092 1EV13 4NRQA 2YHJA 4YRDA 1UX7A 2QDRA 3GNEA 2ZTNA 3WW1A 5F9TA 4HK9A 2JENA 4OCTA 1EPWA 5A33B 1Q8VA 1UPIA 1PX4A 3IN9A 2E6VA 1DZRA 3E6DA 4GB31 3BI3A 4TWTA 2HEVF 5CISA 4Q4V3 3WDYA 5FXVA 4BU2A 1PIV1 1NXD1 2HWC1 3LEIA 3AKQA 2XJRA 4DY5A 4XDQA 5CFDC 1H8TB 4CUCA 1RUI2 1GNYA 1CN1A 3BOWA 1EV12 2HYKA 4QQHA 1WLDA 2W1QA 1H6XA 4ITCA 4N43C 4Y1XA 3I2OA 2NP0A 2YFZA 3VD3A 3VD4A 4OI2A 3WXPA 1W8HA 5FPUA 4Y3OA 2DCKA 1S0EA 4PIXA 4RR3C 1OD3A 1O91A 4Q4V2 2GC0A 3GALA 3RPQA 2NZ9A 4NHKA 4FOWA 2WQZC 3ZYPA 3ZXLA 5AFBA 2XJUA 1VALA 2J1SA 3VBOC 1H0BA 4ZPIA 4BPZA 1ZX5A 4N9IA 5JWPA 3ES4A 1IPKA 4YM1A 3UETA 4R9CA 5T5OA 2UWBA 4QMAA 1MZEA 3SEEA 5FMOL 5FQ0A 4P08A 3ZSEA 5C9AB 1MZFA 3T2QA 1OOPA 2WWJA 4OVEA 4V1PA 5KWRA 4Y26A 1HIXA 1DGWX 4JGZA 3WNPA 3ZN6A 1VAKA 2Y6FA 2HKXA 1Y9QA 1VE0A 4O9EA 1OSGA 5F5AA 4CRQA 2XWJB 5CFCB 2E9QA 1D2SA 5I8YA 3KQ4B 3LCPA 2IXCA 2WZEA 2XH6A 1PNFA 3U1XA 1SBFA 1RUF1 3O12A 2J1EA 1W8TA 4E8DA 1Q8OA 2HWD1 3A4UA 1GNHA 4LLOA 4DO0A 4QQPA 1TVGA 4INDA 3BPZA 5LBFA 1Q43A 3VBUA 1CPMA 4XUPA 4R4XA 3NNMA 1OF4A 4XCAA 1QMJA 4CCOA 4D7SA 2OZJA 4CEWA 2JG9C 4LKFA 1W90A 1I5PA 1E5RA 2D5FA 4P14A 4DB5A 1LHVA 2XJPA 1RUG1 4WVMA 2B9UA 4CVUA 2EIBA 3NAPB 4YGCA 2D40A 2DU1A 2A70A 1S0CA 1QQP1 2HWB1 3RWNA 4XMAA 1LCLA 4CUGA 4HVRA 2QZ3A 4JKLA 1QKQA 3UT0A 1OHFA 2BW8A 3TYJA 1KDMA 1SEFA 5LWBA 2Q1ZB 1YI7A 3OEBA 1Q8QA 5A7NA 2WQ4A 3JBG3 1JYVA 4CDQC 2C4XA 5K8SA 5F32A 1W0OA 2P1BA 1BK0A 1M06G 1GKBA 1DQ2A 5FY8A 3POFA 2PAMA 2ENRA 2ZGMA 3ORJA 3T0AA 5JI7A 3DUIA 1BVP1 2YFUA 5B2GB 2WFF1 3H42B 3O0XA 2R16A 3R05A 2JG8C 5CKMA 3NWKA 4HSJA 5F3EA 1GICA 3RYPA 2WN3A 3TB0A 1FV2A 1ZM1A 5IFPA 1W6MB 3W59A 4E9KA 1RUC3 1CAUA 3JBG2 4IV3B 5FR3A 4AI2A 4XURA 5FXWA 5DG2A 4Z07A 4O65A 2D3SA 4JRLA 3IIIA 1N1TA 1ASJ3 3PU3A 2ZZJA 1BLZA 1OLRA 4WM8B 5LBCA 2Y6GA 4BXFA 4RQPC 5LA1A 3H8UA 2D6KA 2QTWB 4XUOA 2ZGUA 3ACIA 3RZKA 2Y33A 4RL7A 5A6XA 2WO3A 4NRMA 2Y0IA 4XHXA 5FYYA 4IV1B 1PZ9A 2VZOA 3VZNA 3CMGA 1OMIA 2HEWF 3J4UH 2VOVA 5C3RA 3INAA 4JV4A 4ASKA 5BNPA 4DZGA 4RGGA 5A7PA 1UPSA 4DUVA 1JOBA 5A7SA 4B7EA 3E6CC 2XPJA 3SISA 3LEGA 1MS9A 1D4VB 1H8TC 3CJXA 2GMPA 3ZYBA 1GOHA 2BUKA 3O1VA 1NLSA 2E53A 1GU3A 1VAMA 4E4ZA 1LB2A 2IWGB 1SDDB 4NIDA 2KXLA 4QB1A 1MACA 1QDOA 4HLTA 1MQTB 4NPLA 1YO8A 4XFBA 2R063 4HN1A 2WT0A 5DQ0A 3OBAA 2OX0A 2W68A 2GDFA 5DN2A 2KM2A 5IFTA 4QX8A 5FLIA 4AHYA 4ARYA 2PA7A 3N3HA 1N47A 4I0WB 2ZOEB 2BBAA 2ILMA 4YW6A 2HLEA 5JZGA 3AMNA 1GP5A 1I9RA 2CSGA 4OMDA 4AVAA 2XVKA 2P6CA 4XF1A 2CDOA 3RGBA 1Q5OA 3KV4A 1CD3G 1HJFA 3NQHA 5C9AC 1IG3A 3AM2A 3U4SA 1ULFA 2VU9A 2R062 1S2EA 1W6OA 4QHZA 4Z92B 2ZHLA 5A3TA 1W04A 1QWRA 2VGDA 2FDHA 2XOMA 4P9JA 4I0BA 1F2NA 1B09A 4FQ4A 1FATA 4YYOA 5FYSA 4YM0A 5HV4A 1UY3A 2MNGA 4R52A 5CFCC 1RUJ1 2AZ5A 1VR3A 2F17A 1COV3 3BPSA 3ZXDA 3I7DA 4QM8A 4ZKTB 4Q4Y3 1JXNA 4KU7A 5FJHA 1PZ8A 1LR5A 3MDPA 2V09A 5EZWA 3PJQA 4CDXA 1QXJA 3ACHA 2GMEA 4XFAA 5C3SA 1W39A 2B5HA 5FY7A 1RUE1 1ZRDA 5K0UB 5L9VA 1KJRA 4Q0SA 2J1TA 3BOPA 2GNDA 3LSEA 3OBTA 1ALYA 3Q9OA 4QD2A 3VB9A 2DUPA 2A73B 3ILNA 4AQ2A 1UW8A 2W2IA 1KFXL 4BQYA 1W8OA 5LBEA 1WGPA 2R073 2VCBA 2WWUA 1COV2 2JKBA 3NAPC 3LA2A 1VBB3 4IE0A 2PHLA 4Q4Y2 5GM0A 5IATA 3JU9A 2VH9A 1ZBA3 2WA4A 2XLGA 4NMIA 2Q1MA 1V6JA 4Q4W3 4XDOA 2VNRA 1S1AA 4D6SA 5CEHA 1JZ2A 2RG4A 3PUIA 1PO11 2QQKA 4B4QA 1AR83 2QQOA 4C8DA 2OQ7A 3I2IA 2K2SA 5A3NA 2WNUB 4YG6A 2R072 1VBD1 1C5IA 3OYWA 3PHMA 2FMYA 2ET1A 3QBQA 1GNZA 4CP0A 1PHMA 1UMHA 1Z78A 4YNIA 1QJX3 4ZXKA 1ZBA2 3VBRC 2BDRA 1XXNA 4HKWA 2A6VA 4Q4W2 4FAGA 3WQ0A 4NAOA 3WF0A 1S0BA 2NMNA 4XJUA 1VMHA 5JSOA 5D21A 1ZBE3 1QY4A 4XQWA 3M3OA 1AR82 3UL2A 2Z2SB 2FQPA 3FL7A 5KHJA 4IE7A 5FBJA 2XJQA 1UMIA 2CYFA 3D82A 5FYVA 3WV6A 1O5LA 1S0DA 3LF7A 4WM8C 1NCQC 1Y4WA 2ZPXA 2GC2A 1J3QA 4TLGA 2QQLA 3EQEA 1QJX2 5F39A 4CDWA 1ENRA 1RUD3 3NV2A 2VZ3A 4XJWA 4XBLA 5L7OC 1UYPA 5FZLA 5F5IA 4GZ9A 4NVPA 4AK3A 2I45A 2ORZA 3HPNA 4K1YA 2A7AA 4IW3A 4AVCA 3JB8A 4EN8B 1JYWA 2L9LA 4A45A 1G86A 5F5QA 2IFWA 4LBLA 1HJGA 2E26A 2VM9A 1HB1A 4BQ4A 4M01A 1DYPA 4PBOA 5E1RA 1VBE2 3BKZA 5FP7A 5ABJB 2Y60A 4MXVA 1RUD2 2HJIA 3RZLA 1IPJA 3RFRA 1W6QB 2ZAAA 5FZIA 3GHMA 1LULA 1V9U2 3D8CA 4CU7A 4NUBA 3OUJA 1UQXA 2Q0AA 3SEPA 5A32A 1WW7A 2CDPA 3T4VA 3HT2A 4R4ZA 4LKSA 4D7TA 1VMFA 3I97A 3RI9A 2B8MA 2ZCWA 2CAVA 1CAWB 5FYHA 3NSTA 1QXPA 3PUHA 1QJY1 4N53B 4YW7A 5ACA3 1V0AA 1UOFA 3U07A 1JYXA 5C6CA 3BTXA 5FPZA 3DEMA 4CP9B 1V6OA 3DPRA 3C7OA 5FY1A 3AVSA 3HN1A 1J59A 4BLIA 2BP6A 4AXOA 1X33A 4M3CB 4QKFA 1IQDC 2JE7A 5DAVA 1WD4A 4TLFA 2QKDA 4AEKA 1G9DA 4ATFA 3BU0A 1R091 1WLWA 2FDJA 3I54A 4OI4A 5JXJA 3OTFA 4ZHNA 1UOJA 3MIBA 3VBFA 1AYN3 1NCRA 3WP5A 4XF4A 1HRI3 1R083 2G9FA 3MLJA 1QXRA 4MGQA 4QXCA 4SLIA 4W6YA 5J7MA 4NIGA 3ZSLA 3PVNA 4FPCA 3DL3A 4Y1ZA 1QOSA 3U0ZA 1VJ2A 5H9QA 1NE6A 2UY8A 4AVVA 4HXCA 1W6PA 1ZZ6A 3KCYA 2PN5A 2EIEA 5K0UC 5A6QA 4RFRB 3IWZA 1MS3A 1RUI1 4OQ8A 1DQ6A 2NLRA 4CDUC 1H2LA 1DLCA 3OGRA 4XMIA 1BEV3 1AYN2 1U5ZA 3VBHB 2VBPA 1HRI2 1H6YA 1R082 2BV4A 1WKYA 2PHXA 4FSJA 4OHZA 2WN2A 2K9ZA 1OVPA 4ZZ8A 4O9GA 2UYBA 2C26A 4NR1A 3HBKA 5FZFA 3TNQA 3ZSJA 5C70A 3VD7A 2WT2A 4JQTA 1CWPA 2TBVA 4LITA 3DKQA 2MEV1 5B4XA 1DQ4A 5FUIA 5A3PA 3N36A 1XRUA 1BEV2 4OUSA 4PCRA 3RRDA 5T5PA 1JZ3A 1N1YA 1AYM1 4JKMA 1CZTA 3HWJA 1LU2A 1ND2B 4BMBA 4AW7A 4JKKA 5FXXA 2WNEA 1KXGA 2PHDA 2ZHMA 4EYUA 3N35A 5CFDA 1OLME 2DWRA 4FXKB 3WVJA 5BNOB 4AQ6A 5FZCA 2XWBB 4BHPA 4N43A 1BVVA 1ZREA 4N7IA 4C1WA 5I93A 2CY6A 1QGLA 1OH3A 2V5DA 5FFOC 1HQLA 3KT7A 1FOD1 2MHFA 2RS53 3ETQA 4RR3A 1GR3A 5DPNA 4GAZA 3BGAA 1MS0A 3GJBA 2CGPA 1UNBA 2QZ2A 2XJVA 4XZPA 1NZCA 2NQYA 1UKGA 3JQXA 4DOUA 1AXYA 4YW1A 3VBOA 3ZN5A 1SPPA 3OBRA 3WW2A 2P3YA 2K0GA 4AAXA 3K51A 2DV9A 4J1WA 1LTEA 3LD8A 5GLWA 2ZEXA 4J6GA 1ULPA 1JZ7A 1TNFA 2RS52 3NV1A 4Y22A 4BOWA 3NNGA 4M3CE 2B42B 4NRPA 2W08A 3J8F1 2WA3A 4FTBA 1ENQA 3ENRA 4GALA 4JQRA 5LBBA 3FUOA 4JC1A 4YFZA 4IEOA 5C8CB 1QHDA 2WSUA 2WC2A 1QH7A 4XUQA 4AFMA 3WR0A 3SMHA 1OFNA 2KA3A 2QUOA 2CU5A 2A75A 3BYWA 2DVDA 3GZTB 4QDQA 4ZZ5A 1CQ9A 4M0HA 4XF0A 1VRH3 4COUA 4EN0A 2OZ6A 1HQWA 1AF9A 3ZN4A 3ON7A 3T2PA 5BY5A 4I01A 4N53C 2JG9A 3SCHA 4B4RA 2CWSA 3ZFFB 1AL0G 2I2SA 2RS33 2XUMA 4CEYB 5FZ3A 1W6NB 1TQ5A 1LOEA 3T1LA 2VVEA 5CAZA 3USSA 3ZX7A 3SCFA 3EBRA 4CP2A 2LALA 1HXS2 1JH5A 1X9PA 4ZU5A 1K12A 1ZYBA 2RDSA 5EHDA 5JR2A 1UL9A 3CF6E 2GZWA 3LIHA 1QIQA 2D43A 4C0HA 1VRH2 4NIIA 5JCTA 2VQTA 1RJ8A 1L7RA 2BRTA 4M3CF 5CZKA 3VZLA 2I07B 3USUB 4KMQA 5FYBA 5FPAA 3VZKA 1F35A 2NMOA 2RS11 1K45A 3VZOA 4CDQA 5J1XA 2ID4A 2RS32 1YFWA 2P3IA 4BQ1A 2TNFA 3AXEA 2OKXA 4LTAA 1O6UA 5C3QA 2E33A 2AGSA 2XR4A 3DF0A 3JD71 2JJ6A 4LKEA 3M4FA 2JG8A 2VL4A 4MSVA 3LE0A 1ZA4A 1ODNA 1ZRCA 1LGBA 2ZEWA 1W9SA 3TEXA 4YVWB 1RUNA 4P9WA 2XLAA 4GH4B 4HKOA 3MW3A 3H1MA 3M3QA 4UT5A 3VD5A 5FPVA 2FD8A 1EPZA 4YW5A 3Q8EA 4L0PA 3OUHA 4QWNA 3FFZA 5H9RA 3W21A 5FIXA 4D94A 3TRSB 4MX3A 4AHXA 5IK5A 1T6BX 2FCTA 4RQPA 5EWSA 3ZKYA 3AB0A 5ANQA 1XB9A 4Y5TA 4P9XA 5A33A 4PBPA 2R1DA 2W0XA 4IE4A 1UXXX 4QDRA 4BQ2A 3N7MA 5KR7A 4AHZA 3BVCA 1QOOA 2DCYA 2QQWA 1QNWA 3V0BB 2R061 4XIOA 2YGMA 5JDBA 1X82A 1AR71 2V72A 1FNYA 1GQGA 2ATFA 4XAAA 3PUSA 3MIHA 3FBYA 1H8TA 4AEDB 3AYEA 1RHI1 4LNVA 4BA6A 1B35B 2X5IB 2DVFA 5FZ9A 3ZFGC 4AQTA 1OURA 1WW5A 4JZRA 3FHAA 4PHZA 4PI2A 4FFIA 3TN93 4XAEA 3AMMA 2RM23 3UV9A 1FMD1 1LESA 1O3RA 4N8MA 3H9AA 4HKLA 4LHLA 4XQ4A 2VUJA 1AXZA 3AMPA 4F8AA 4EE2A 2YBPA 2E7QA 1BBT1 1Y9MA 3OUIA 4GQ7A 2AH2A 2VMIA 2JX9A 1XSRA 4QHOA 2VJXA 2Z69A 1LOBA 4RFT0 1S0JA 4AGRA 2YBSA 4CUAA 3TN92 5FK8A 5F37A 5JMOA 3NVCA 4CYDA 2RM22 4WM7C 1YHFA 1VLNA 3VBSC 5C9AA 3VUOA 4F3JA 1JU3A 3IT8A 3NJVA 4UBHA 1YJLA 2Q5TA 3CO2A 4XJAA 4CXYA 3VLBB 2BGOA 4BYYA 4QXKA 2YYOA 2RMU3 2VZQA 2ZX0A 1QF3A 2TEPA 1SFYA 3KF3A 3VL8A 5CFCA 1JYIA 3FJSA 4XPVA 4CU8A 1POQA 3S7EA 1SQ4A 2ZMKA 4BISA 4BB3A 5CKNA 4BZ4A 3THDA 3FLPA 3OPWA 3B69A 2C5DA 3M1HA 5I0UA 1S0IA 4LO7A 5KHHA 4MADA 4IEUA 2WLQA 3Q8CA 5DABA 4PJYA 3APBA 1TEIA 4MH0E 5FY4A 3ZFFC 2AEYA 3DN7A 1R1A1 1OT5A 3UK9A 1IS3A 2RMU2 2VPVA 4ZXEA 4CEYC 5DUWA 3WG1A 4UI9L 4KBBA 2Y64A 1GBGA 4P9GA 4RSUA 4TN7A 4OZOA 1W2NA 3NAPA 3PLQA 2NN8A 2VMDA 4OHXA 1BMV2 2OS2A 4OZXA 2BJSA 4BIOA 4JTOA 4FT8A 1FPN1 2EA7A 1XYPA 2B39A 2VO5A 1SG3A 3C7GA 3HQUA 2YC4A 1DGRA 3NRUA 1JOJA 3SKJE 3AJZA 1J3RA 4XJ8A 1A78A 2JE8A 2XVLA 4CSWA 1Q56A 3M3EA 3NNFA 5FV3A 1N3QA 1NX9A 3WP3A 2TUNA 4J1XA 5DUVA 4WBBA 5FMCA 1Y3TA 4AAPA 3Q8BA 1VBE1 4UFHA 5AFEA 3VBRA 1VBC3 1DIWA 2A6ZA 3GBGA 4OUMA 1ZRIA 4XBNA 2IXJA 3FBMA 3KCXA 1FNZA 4O7XA 1O7FA 2XJSA 1W6MA 4YVWC 5IVEA 3S0MA 2JDAA 1HB3A 4C0BA 1PGW2 4ASLA 1V9U1 4ZS3A 1LOCA 5DDJ1 4AE2A 5F6LB 3RJ2X 1RIRA 4WM8A 1VRBA 2WNVC 4P5YA 1NCQA 2JDPA 2A6WA 2EF6A 3MI8A 2SLIA 4YGDA 3RMXA 1VBC2 4CPBA 2PAKA 5L7OA 3AFGA 3DV8A 2RDRA 2X10A 2BVVA 3LKJA 2VQ0A 5H9SA 4BDVB 4FFFA 1T6GC 1DBNA 1W8FA 2BVBA 1RTVA 1AJKA 2R49A 2XLFA 3I59B 4S2DA 5D8AB 1BHGA 3WF4A 4ET7A 1OUSA 1YUDA 1ND3C 3CZUA 5FZ0A 4LK6A 3WZ1A 2PFWA 1JYTA 3ZDSA 4DEVA 5LZ6A 2ZABA 3LWCA 4AEDC 5FCCA 3AVRA 4UWDA 1B35C 2X5IC 1HX6A 3IZOA 4LE4A 3VN4A 1XNKA 3A23A 2O0OA 3ELNA 1IPSA 1ZZBA 3IDEA 3U4XA 2BERA 4JDMA 4RGKA 5TSWA 1T2XA 1D4M3 3JZVA 4FPOB 1TG7A 2UU8A 1W2OA 4K20A 1F8VA 4XETA 5EYYA 1YQ6A 5LRRA 4LE3A 2WSVA 3B3QE 3WY6A 1ZZ7A 1VIWB 3RDIA 1LOAA 3AC0A 3FUQA 3V64A 4YWAA 2YZ4A 3BU7A 1SLBA 1D4M2 1W2TA 3AP7A 4FPHA 4LBQD 4LA3A 1WZXA 2IXHA 2YPJA 5F7UA 3C3VA 1O4YA 3RYRA 3ZO0B 1KQRA 3K4ZA 3QACA 3GZUC 3RJRA 1GWKA 2AREA 3AZZA 3PNAA 2XONA 4B29A 3DECA 4NPMA 2GMMA 4GULA 2RR13 2DUQA 5FPLA 4EWEA 4CE8A 1WBLA 2J42A 1J58A 3PVOA 3UKNA 3OSDA 3HBZA 4JHZA 3ZVXA 1GQHA 4KGGA 4E8CA 1RMU3 4CCDA 4YVSB 4AVBA 1TME3 2BFUS 1ZRFA 3I3DA 4GMP0 2XG3A 1S0GA 5K0UA 2WR9A 3A7QA 3MFAA 2ORXA 2D5HA 3ZKUA 4CDUA 4H55A 2R041 1WMXA 1WD3A 4NWWA 5L19A 2RR12 2FBEA 1GZWB 1W06A 4IXLA 2FDIA 1JTZX 2J1VA 4FOQA 5T3NA 5FO9B 1WCQA 2VULA 1ACCA 2GH2A 1ONAA 1GP6A 1PO23 1QJU3 4IEQA 4UW3A 1RMU2 3GXUA 3OY8B 1TME2 1ULDA 3JXSA 4EJRA 1AR61 2VZSA 5BPXA 1W05A 3WD5A 1QH6A 2F6BA 4JHTA 3B9IA 1CX4A 5IAXA 5T50A 3TEWA 2BQPA 3HNYM 4QPGB 4FPFA 2GNBA 3O0WA 3H0OA 2AC1A 4OMCA 5AVPA 4HL0A 4XFIA 5FUNA 2P6HA 4ORFA 1WBFA 5FXZA 1PO22 1QJU2 5GZCA 3EXUA 1F5FA 2WO1A 5IVYA 3P3NA 2JDZA 3PIGA 1OFSA 1AZDA 3OBZA 5GLZA 5A70A 4BQWA 2B7YA 2WT1A 1CGPA 3RI8A 1RUH1 4QGLA 5FLHA 3IIAA 1NLQA 3MLLA 4ISQA 1BYHA 4WZFA 5DAQA 1OQDA 3ATGA 5C7GA 5IK8A 1YCIA 1KRIA 5LEJA 1UF2C 1U5YA 4DRVA 1C8M3 2HWE3 3PU8A 4UFJA 4P02B 2R30A 4Z1VA 1K5MB 3BIWE 3VKMA 2WS91 1DGLA 2QFEA 2EAKA 3D6EA 3N7JA 5FP8A 1ULOA 4M4PA 4AI3A 3BIEA 2Y0OA 1SLLA 5JVVA 5IW0A 4CTEA 2LROA 1GZ9A 2YDEA 1CJDA 1S2KA 1KFUL 3H3UA 2SBAA 1GOGA 4YW4A 1DQ0A 5G05L 1JBCA 5JR7B 3IM0A 3ZPOA 5HCHA 1UZWA 1HXS1 3ZYHA 1MPXA 1NLRA 2P37A 4J25A 2HWF3 1W3XA 1RUOA 1OLMA 4K7JA 1SCRA 4AL9A 1NE4A 1PK6B 4BXSV 1RUC2 2C9KA 3LOBA 1YQ2A 5T5LA 1W6QA 2RJLA 4MV2A 2XKOA 1MS5A 3SKVA 3FLRA 1WCSA 1KJLA 1ASJ2 2LS6A 2Q1FA 3GBFA 4GKXA 1EAH3 3ZYIB 1CPNA 3VDCA 3NV4A 3N9PA 3WQBA 4LORA 1CONA 1LEMA 4IQPA 3O1OA 3I2KA 4X6RB 3CJIB 4EZHA 2JB8A 2HWF2 2V4AA 2ZEZA 3WW3A 1POV0 1XE0A 1HRV3 2E7TA 2FZ1A 4FQZA 4UW5A 1VBA3 5GZDA 1CAWA 4LPLA 1JU4A 2Q30A 4LHNA 4N53A 4DXSA 3UJOA 3AYDA 1JZ4A 1DCSA 2H6BA 4CP9A 5IUQA 2GP3A 1SBEA 4ES8A 1C1FA 1EAH2 3B94A 3S57A 3NJXA 1IZ3A 2XL7A 1SLCA 4M3CA 4DFSA 3D4KA 3R4SA 3PMEA 3SH5A 1DF0A 5FOBB 4CUBA 3I8TA 1HRV2 3ZMNA 3RWKX 1RVF3 1KITA 1VBA2 1UYXA 3FZ3A 4BMEA 3ACFA 3IDCB 4BWOA 4EV0A 3VDAA 5DUUA 4C91A 3KV9A 3MUY1 1HW5A 2GAUA 4AVTA 3LA3A 1ULGA 1JZ5A 4A41A 1XNBA 4IE5A 1YI9A 4WV8A 2P4EA 1O8PA 1FV3A 1L7QA 3KS7A 2CGOA 4AEJA 2XUEA 1WW4A 3O0VA 4BQ3A 3VHNA 1YWKA 1RVF2 5BV6A 4COZA 4NHXA 1W99A 3HAGA 3ZLIA 4YLZA 2VXRA 4Q8KA 2RDQA 3WP6A 4E4DX 1YNAA 1PZ7A 3IKWA 5E88A 3ACGA 5BNQA 1EUTA 4FP2A 2J7MA 1OPMA 2JE9A 5AC93 4LO5B 4QPGC 1CAVA 1AX1A 5FP9A 1NOVA 5E16A 1H30A 1GYKA 4D69A 4S2GA 5JOYA 4F7ZA 2VOTA 4ZU4A 2ETEA 3GM8A 4YFWA 2CGNA 3CLPA 2QE3A 4UF0B 2QVSB 2FCUA 5E8AA 4HT1T 3IB3A 1JS9A 4GD4A 5AC92 2VMGA 5EPAA 2OUHA 1MS8A 3FHIB 3ZFGA 3M8LA 4D3WA 2VG9A 4XXAA 3CU7A 2A3WA 4JTNA 5APAA 1JUIA 1VBB2 4UAPA 2IFRA 3P3PA 4HONA 1MVQA 3A22A 1PVC3 5F3IA 2R32A 3UGFA 1AL23 4TYSA 1Z7S1 1LGCA 5FWEA 3VBUB 1F9KA 2VQAA 4RD7A 2WZPP 1XSQA 2WO7A 5FYIA 5FZGA 3IPVA 2I74A 1X9TA 3FMGA 3MPBA 4IV3C 4LBJA 3SHRA 1CX1A 2PLV3 3C7HA 4QPIB 4RHV3 3PTYA 1AR93 2OQ6A 3AL6A 1E5IA 4AQSA 4K21A 4QX7A 3NJZA 5FK7A 4CA9A 1O59A 3OEAA 4B3NA 1CAXB 4Y1YA 1PVC2 2VMFA 4WM7A 5A3WA 3VBSA 2E63A 1AL22 2QBXA 4IEXA 4QU1A 4CPBD 1H2MA 4AR2A 4Q4X1 2DTYA 1Q8PA 1ZZCA 4FI9A 1ZBE2 5A7QA 4IV1C 2QCSB 3NKTA 3OF1A 5D1IA 2PLV2 3KT1A 1AX2A 4RHV2 5GLUA 4Q0PA 1W2UA 1AR92 4JGYB 1KEXA 4MG2A 1NY72 3UKTA 1TE1B 1POV3 2CWMA 2VTXJ 4YZ2A 1MZ6A 4GWIA 3CJIC 2XQXA 3POYA 3ZXFA 5DMYA 2E32A 1TMF3 4FVVA 1MQTC 1W28A 2FDFA 2ES3A 3FN9A 3SXWA 3ZFFA 1PGW1 1ZA7A 3O1SA 4HG6B 2FZ2A 3ZOIA 4CEYA 1GLHA 5JSRA 2O1QA 1C1LA 3POBA 1N1VA 1W6NA 5HI0A 1JMUB 2RDNA 4YG3A 5JMCA 2E7AA 2DF7A 1REEA 3VL9A 1IQAA 5LW9A 2Z79A 2W92A 1UWWA 4HPKB 1UKRA 4KWJA 5GJ6A 3WNMA 5KBFA 1UU6A 1PGL2 2ZAHA 4NOTA 2AYHA 2C0ZA 1TMF2 1JOPA 3P1IA 4NWVA 4XHBA 3USUA 1UX6A 5BNNB 1NA1B 1MR5A 1AXKA 2OVUA 1LKNA 4C1XA 4L2NA 3MYXA 4P00B 4DUWA 5BNPB 1ZRRA 4U36A 3WG4A 3MIDA 4Y1VA 2FDKA 2A3YA 2Q4SA 5IVFA 3ZXEA 3LGRA 2BYVE 1FYUA 1QU0A 2WFPA 5A6YA 4LBNA 5ACA2 5K7PA 3I49A 1VPHA 2Z5WA 3BODA 4ISRA 1FX5A 4OLLA 5E89A 4YVWA 1AHSA 4GB33 4HSLA 1EP0A 1HN1A 1AUYA 4PIZA 1U5IA 4Z2WA 3AXDA 3ZXKA 1GSLA 2LM3A 1PIV3 2HWC3 4V2WA 4Y5SA 4CCEA 4AGGA 4ASMB 3J7MA 1EV11 2WNVA 1K42A 3PL0A 1NZIA 3K77A 3VGIA 5EJ3A 5JZGB 4H7LA 2H0VA 2ADDA 3W5MA 3N9OA 4FPLA 3THPA 1UMZA 4LBQA 5LK5A 2DFBA 2WAOA 2VZPA 3FC0A 1QEXA 2AENA 3AYCA 4Q4V1 4AI8A 4QX1A 1H1AA 1D4M1 2W47A 3RQ0A 3B5LB 5IK7A 1PIV2 2HWC2 1ND3A 2X8KA 3MUZ1 4UFIA 1N3PA 3D5OA 1W9FA 1WLTA 5FDBA 5GLVA 5FWJA 1Q3EA 4AEDA 5LCWL 3WF1A 2Y6KA 1B35A 2X5IA 5FYMA 2AR6A 2WUHA 1O4ZA 1X50A 2WNUC 2H0BA 4GWJA 4HETA 3WP4A 3ZYFA 4Z8BA 2RV9A 2ZGSA 1WW6A 3EMRA 2VAUA 4OFGA 3T08A 4ATEA 5KC5A 1XC6A 3KLSA 4CDXB 1X36A 4NHMA 3G7DA 4A7ZA 2O14A 1RJ7A 3WHTA 1SLTA 1IOAA 3QH7A 3VHPA 3KM5A 1F4HA 3W58A 2D44A 4AF9A 2CV6A 4YZ1A 4QPIC 1DYOA 4D6QA 1Q8SA 3POWA 1I1EA 5JPMB 1RXFA 3H3LA 3AP9A 5JXGA 2B46X 4TTGA 4IEVA 1G8WA 4XABA 2LRPA 1RUF3 2OT7A 1WWYA 3AZWA 2ZKLA 4W65A 3JCIA 4FFGA 2HWD3 4Y4RA 1O3TA 4Q1PA 1YXWA 1TME1 3PDQA 5D2AA 3D3AA 1HKDA 3BALA 1MS1A 2YY1A 3KSCA 1I3HA 3LFMA 1LHNA 2D93A 5J98B 5KC6A 4QHBA 1A8MA 1C8NA 1RUG3 3BTAA 3HQXA 3L2YA 3DYMA 4META 1JW6A 4JGYC 4R9BA 4XVHA 3ZYRA 5JSPA 3ZXGA 4MHRA 4XYXA 3OYWB 4KG0A 2HWD2 4QXBA 1A8DA 1QQP3 1PMIA 2E51A 2HWB3 5ABJC 5HPOA 3KZ4C 4CZSA 5HBAA 1E5HA 2BNNA 5EP9A 4KWKA 2CAUA 4Y33A 2XXZA 5LASA 4B1LA 1UZYA 2RJKA 3KCCA 4BIFA 5CA6A 3AZVA 3AK0A 3C8XA 1RUG2 2VZVA 2VTXA 1XU2A 2RE9A 2WBKA 3RYKA 2ARCA 3ITQA 1CIYA 4QKBA 3H7JA 3DYPA 4OUEA 3THCA 5BUVA 2WFF3 4KU8A 1JHJA 5JLVA 1QQP2 4XXPA 2HWB2 4OI0A 4CDWB 1UOGA 3OOXA 3KV6A 2CHHA 2WAAA 1G9AA 3JBG1 3VKOA 3SLIA 1V6MA 1LOGA 1QJEA 3L2HA 4L97A 3S5QA 5BNNC 2VY0A 1NA1C 1J1TA 3B01A 1CZSA 5G04L 5FZHA 5ISLA 1BKZA 2AUYA 4E2QA 2XMLA 3PTRB 3QH6A 4OI1A 2QQNA 3RS6A 3J26N 1W9TA 2WFF2 4Y20A 4AI1A 4KG8A 2ZMLA 2W1SA 4LO8A 2VOXA 3IDAA 1RUC1 2VVDA 4FO9A 3O1UA 4MGTA 5KXBA 4W8JA 3B02A 1HB4A 4NJ4A 3VHRA 2W39A 2VW0A 1ASJ1 3WF3A 4XFHA 2XL9A 1VP6A 5A32B 1XNCA 4HMZA 3WDXA 3KQRA 1YYNA 3NO8A 4MOAA 4XZUG 3RMYA 4Z2AA 3A0NA 5IVJA 3M3IA 1HDKA 2JECA 2JDHA 4ONUA 4UFKA 3VBHC 4QB2A 4BQXA 2VMCA 2YB7A 4NE9A 3VDBA 1SHWB 1A34A 3H7YA 1XNDA 4A42A 3RZHA 1EY2A 1QNYA 2D6NA 3H1YA 4NHLA 1J83A 3T09A 1EAH1 2A6YA 1WMDA 4NAMA 3GJAA 4HVQA 2EXKA 1DGWA 1QOTA 2DCZA 2V4VA 2OYZA 3ME2A 3WOGA 1MZ5A 1VBA1 4IEYA 1NCRB 2PHFA 2PHRA 4PDWB 5FY0A 3IMMA 3GZAA 4LUMA 3B93A 2W9XA 4BK4A 2GN3A 5HCBA 1ND2C 3PVBB 3KVAA 4WZCA 1RINA 4DIQA 1DFQA 3V0AB 1VAVA 1JN2P 4DRRA 5BNOC 3LDRA 3PMSA 3LEMA 3WQ7A 2EICA 2HH9A 1AVBA 2VMEA 1OC1A 4XQDA 5EQUA 2ZEYA 1LENA 3AFKA 4XTMA 4MO3M 2G4IA 4CCLA 1OKOA 2DTWA 1RUJ3 4QU2A 1RGSA 4TZDA 4DQAA 5GZEA 3T4HB 2YUEA 3JUUA 1LHOA 1UU5A 2R0FA 5F3CA 1IGOA 4ZONA 1S55A 3ZXJA 2OW4A 2VW2A 3FLTA 3LDBA 3ZR5A 1Y43B 1RUE3 3K4AA 2Y6LA 3MW4A
chains in the Genus database with same CATH topology
1JYNA 3ACHA 1UY4A 4JHZA 4KWUA 4E8CA 4DEQA 2VZUA 4IUGA 3GGLA 2J1TA 3MV01 2EIDA 3I3DA 2Y6JA 3T2OA 3OG2A 3A7QA 1W8OA 2ORXA 2VCBA 5JXHA 1NAEA 5IHRA 1GQPA 2J1RA 2X05A 2J1VA 3IAPA 3HNBM 1WCQA 1JZ2A 3PUIA 3EB7A 3GXUA 3LPFA 2QQKA 3HJRA 2QQOA 3JXSA 2VZSA 2W5FA 3I2IA 3HNYM 1GMMA 3MV11 3I3BA 2RJ2A 1UMHA 1NKGA 1JZ6A 4OMCA 3WF0A 2WO1A 2E31A 2VQUA 3T0BA 3FL7A 1JI6A 5I0DA 1UMIA 4BK5A 1GOFA 5IJRA 2W46A 2QQLA 5C7GA 2VZ3A 1W9WA 4P02B 2JKXA 4GZ9A 2ORZA 3HPNA 2W87A 1ULOA 4M4PA 1JYWA 2L9LA 3C7FA 4A45A 3I2GA 1R64A 2WZ8A 4JX0A 2E26A 3C7EA 2VM9A 1GOGA 5G05L 4OYUA 3W5NA 2J1AA 2J22A 3CKHA 1MPXA 3A21A 3CDZB 1RYYA 2BZDA 4BXSV 2C9KA 4CU7A 1YQ2A 4AG4A 3SEPA 2CDPA 3SKVA 2LS6A 4D8MA 4PQQA 4LKSA 2YG0A 3I97A 3VDCA 3WQBA 2WO2A 3I2KA 3PUHA 1JYXA 2ZEZA 5CYYA 4LPLA 1JU4A 3C7OA 4DXSA 1JZ4A 2W94A 4YPJA 1IQDC 2RVAA 2Y6HA 5JXJA 3NJXA 5HXMA 4MGQA 4CUBA 1UYXA 4W50A 3ACFA 4XUNA 1F4AA 3CIHA 3F2ZA 3VDAA 2J1UA 5EIYB 1JZ8A 3MUY1 2EIEA 4W4ZA 1JZ5A 2QQJA 4A41A 3MO4A 2VZ1A 1O8PA 1DLCA 1L7QA 3OGRA 1H6YA 1UY0A 1WKYA 2WN2A 4QX3A 4M4RA 4ZZ8A 2W91A 2C26A 4QX2A 2BGPA 1W99A 2VZTA 5C70A 3VD7A 5B4XA 1PMHX 5FUIA 4ZY9A 3ACGA 4D0QA 1EUTA 2J7MA 3OGSA 3I2JA 1JZ3A 5EJ1B 4JKMA 1CZTA 1PMJX 3ECQA 3P6BA 4LQRA 4JKKA 3GDBA 1D7PM 2VOTA 3GM8A 3IB3A 4XUTA 3LEKA 1XPWA 2LW8A 2V5DA 5JXIA 4DUXA 4QDSA 5DPNA 3WEZA 3BGAA 2VTFA 4UAPA 4ARXA 3A22A 4A4AA 3J7HA 1W0NA 3CQOA 1J84A 2KD7A 4AAXA 3K4DA 1CX1A 4QAWA 3C7HA 2W95A 1PX3A 2ZEXA 1ULPA 1GUIA 3I2HA 1JZ7A 3NNGA 1O59A 3I3EA 3OEAA 1K3IA 2VMFA 2QBXA 2YC2A 3WSOA 3E1F1 4XUQA 4FI9A 4A6OA 1US2A 2B9VA 3LPGA 4ZZ5A 2DCJA 4QDQA 4CU6A 1KEXA 5IYYA 2W3JA 3T2PA 4GWIA 3ZM8A 3WNNA 3HN3A 2XQXA 5DMYA 2HYXA 4BJ0A 2E32A 3K75B 3IAQA 3FN9A 2Y8KA 3HOBA 1US3A 1XNTA 3I2FA 4HG6B 2B4KA 1K12A 2QQIA 5JR2A 3HNMA 3LQCA 5LA2A 3UESA 3ETPA 2VQTA 1L7RA 3EYPA 5CZKA 2VZRA 4KMQA 1W8NA 2W92A 4A3ZA 1UWWA 4A44A 1K45A 5J1XA 3WNMA 2ID4A 3K46A 3P1IA 2OKXA 2W1UA 2E33A 2VR4A 3MBWA 5C71A 4DUWA 4P00B 2VL4A 2VCCA 3ABZA 3LE0A 3OGVA 1UXZA 4RYDA 2ZEWA 1W9SA 4TXWA 1LNSA 4QPWA 2XHNA 3VD5A 4DXRA 4L0PA 2WDBA 5B4NA 2X09A 1HN1A 1UX7A 1PX4A 3BN6A 2ZXQA 1K42A 3K77A 1UXXX 4QDRA 1OH4A 2DDUA 3LEIA 3W5MA 2WAOA 2VZPA 4CUCA 2W1WA 1GNYA 2V72A 4QX1A 3T0DA 2QQMA 2W1QA 1H6XA 2W47A 5EJZB 2YFZA 3VD3A 3VD4A 3MUZ1 2DCKA 3FHAA 5LCWL 3WF1A 1OD3A 4PT6A 2Y6KA 2WUHA 2Z4FA 4GWJA 2RV9A 3T08A 2J1SA 1XC6A 1DP0A 3UETA 2VJXA 3VD9A 3SEEA 1F4HA 4P08A 1DYOA 3T2QA 4CUAA 3HEIA 5JMOA 3WNPA 3WNOA 5JXGA 2WYSA 4TTGA 1JU3A 3NJVA 4DXTA 3WF2A 2WZEA 2BGOA 3D3AA 2VZQA 2J1EA 4E8DA 2R7EB 4PF1A 4CU8A 1TVGA 3K4AA 4XUPA 3THDA 1OF4A 3DYMA 4XVHA 1I5PA 4MADA 2VC9A 5HPOA 4CVUA 2EIBA 1XNAA 1OT5A 2WABA 4ZXEA 4UI9L 4MGSA 2Y64A 4OZOA 2VMDA 4JKLA 3C8XA 2VZVA 1UY1A 2WBKA 3OEBA 1JYVA 1CIYA 2VO5A 3DYPA 2C4XA 4OUEA 3THCA 1SG3A 1O8SA 1JHJA 5LA0A 3C7GA 2YC4A 3WNLA 1UYZA 3NRUA 2WAAA 3SKJE 3T0AA 2JE8A 2YFUA 1NX9A 1CZSA 5G04L 2WN3A 5IFPA 2QQNA 4XURA 1W9TA 3FHQA 2W1SA 3IIIA 2JDAA 3IDAA 4W8JA 2Y6GA 5LA1A 1P8JA 3OB8A 4QX0A 4XUOA 3ACIA 4P5YA 3WF3A 2WO3A 1CZVA 4LHSA 2VZOA 4MOAA 2X10A 4XZUG 3CMGA 4Z2AA 4RN5A 4BDVB 4QB2A 4DUVA 2VMCA 2YB7A 3VDBA 1SHWB 4ET7A 3LEGA 1BHGA 4KI5M 3WF4A 3CZUA 1GOHA 4A42A 1GU3A 3CZJA 1NUKA 4DEVA 1SDDB 1J83A 3T09A 4QB1A 3DYOA 2PQSA 1OF3A 1UYYA 3A23A 4UOJA 2V4VA 2JD9A 4CU9A 5DQ0A 2BERA 3OBAA 2VCAA 1T2XA 5DN2A 5IFTA 4ARYA 2W9XA 4BK4A 1KGYA 1TG7A 2BBAA 2HLEA 1UY2A 1EUUA 1UZ0A 4OMDA 2CDOA 2EICA 3NQHA 2VMEA 3WNKA 2ZEYA 2WQ8A 3AC0A 4QB6A 4MO3M 3U37A 2XOMA 5JUVA 5F7UA 1UY3A 5A1AA 3K4ZA 3UNPA 2XONA 3DECA 2Y6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYN A;  3ACH A;  1UY4 A;  4JHZ A;  4KWU A;  4E8C A;  4DEQ A;  2VZU A;  4IUG A;  3GGL A;  2J1T A;  3MV0 1;  2EID A;  3I3D A;  2Y6J A;  3T2O A;  3OG2 A;  3A7Q A;  1W8O A;  2ORX A;  2VCB A;  5JXH A;  1NAE A;  5IHR A;  1GQP A;  2J1R A;  2X05 A;  2J1V A;  3IAP A;  3HNB M;  1WCQ A;  1JZ2 A;  3PUI A;  3EB7 A;  3GXU A;  3LPF A;  2QQK A;  3HJR A;  2QQO A;  3JXS A;  2VZS A;  2W5F A;  3I2I A;  3HNY M;  1GMM A;  3MV1 1;  3I3B A;  2RJ2 A;  1UMH A;  1NKG A;  1JZ6 A;  4OMC A;  3WF0 A;  2WO1 A;  2E31 A;  2VQU A;  3T0B A;  3FL7 A;  1JI6 A;  5I0D A;  1UMI A;  4BK5 A;  1GOF A;  5IJR A;  2W46 A;  2QQL A;  5C7G A;  2VZ3 A;  1W9W A;  4P02 B;  2JKX A;  4GZ9 A;  2ORZ A;  3HPN A;  2W87 A;  1ULO A;  4M4P A;  1JYW A;  2L9L A;  3C7F A;  4A45 A;  3I2G A;  1R64 A;  2WZ8 A;  4JX0 A;  2E26 A;  3C7E A;  2VM9 A;  1GOG A;  5G05 L;  4OYU A;  3W5N A;  2J1A A;  2J22 A;  3CKH A;  1MPX A;  3A21 A;  3CDZ B;  1RYY A;  2BZD A;  4BXS V;  2C9K A;  4CU7 A;  1YQ2 A;  4AG4 A;  3SEP A;  2CDP A;  3SKV A;  2LS6 A;  4D8M A;  4PQQ A;  4LKS A;  2YG0 A;  3I97 A;  3VDC A;  3WQB A;  2WO2 A;  3I2K A;  3PUH A;  1JYX A;  2ZEZ A;  5CYY A;  4LPL A;  1JU4 A;  3C7O A;  4DXS A;  1JZ4 A;  2W94 A;  4YPJ A;  1IQD C;  2RVA A;  2Y6H A;  5JXJ A;  3NJX A;  5HXM A;  4MGQ A;  4CUB A;  1UYX A;  4W50 A;  3ACF A;  4XUN A;  1F4A A;  3CIH A;  3F2Z A;  3VDA A;  2J1U A;  5EIY B;  1JZ8 A;  3MUY 1;  2EIE A;  4W4Z A;  1JZ5 A;  2QQJ A;  4A41 A;  3MO4 A;  2VZ1 A;  1O8P A;  1DLC A;  1L7Q A;  3OGR A;  1H6Y A;  1UY0 A;  1WKY A;  2WN2 A;  4QX3 A;  4M4R A;  4ZZ8 A;  2W91 A;  2C26 A;  4QX2 A;  2BGP A;  1W99 A;  2VZT A;  5C70 A;  3VD7 A;  5B4X A;  1PMH X;  5FUI A;  4ZY9 A;  3ACG A;  4D0Q A;  1EUT A;  2J7M A;  3OGS A;  3I2J A;  1JZ3 A;  5EJ1 B;  4JKM A;  1CZT A;  1PMJ X;  3ECQ A;  3P6B A;  4LQR A;  4JKK A;  3GDB A;  1D7P M;  2VOT A;  3GM8 A;  3IB3 A;  4XUT A;  3LEK A;  1XPW A;  2LW8 A;  2V5D A;  5JXI A;  4DUX A;  4QDS A;  5DPN A;  3WEZ A;  3BGA A;  2VTF A;  4UAP A;  4ARX A;  3A22 A;  4A4A A;  3J7H A;  1W0N A;  3CQO A;  1J84 A;  2KD7 A;  4AAX A;  3K4D A;  1CX1 A;  4QAW A;  3C7H A;  2W95 A;  1PX3 A;  2ZEX A;  1ULP A;  1GUI A;  3I2H A;  1JZ7 A;  3NNG A;  1O59 A;  3I3E A;  3OEA A;  1K3I A;  2VMF A;  2QBX A;  2YC2 A;  3WSO A;  3E1F 1;  4XUQ A;  4FI9 A;  4A6O A;  1US2 A;  2B9V A;  3LPG A;  4ZZ5 A;  2DCJ A;  4QDQ A;  4CU6 A;  1KEX A;  5IYY A;  2W3J A;  3T2P A;  4GWI A;  3ZM8 A;  3WNN A;  3HN3 A;  2XQX A;  5DMY A;  2HYX A;  4BJ0 A;  2E32 A;  3K75 B;  3IAQ A;  3FN9 A;  2Y8K A;  3HOB A;  1US3 A;  1XNT A;  3I2F A;  4HG6 B;  2B4K A;  1K12 A;  2QQI A;  5JR2 A;  3HNM A;  3LQC A;  5LA2 A;  3UES A;  3ETP A;  2VQT A;  1L7R A;  3EYP A;  5CZK A;  2VZR A;  4KMQ A;  1W8N A;  2W92 A;  4A3Z A;  1UWW A;  4A44 A;  1K45 A;  5J1X A;  3WNM A;  2ID4 A;  3K46 A;  3P1I A;  2OKX A;  2W1U A;  2E33 A;  2VR4 A;  3MBW A;  5C71 A;  4DUW A;  4P00 B;  2VL4 A;  2VCC A;  3ABZ A;  3LE0 A;  3OGV A;  1UXZ A;  4RYD A;  2ZEW A;  1W9S A;  4TXW A;  1LNS A;  4QPW A;  2XHN A;  3VD5 A;  4DXR A;  4L0P A;  2WDB A;  5B4N A;  2X09 A;  1HN1 A;  1UX7 A;  1PX4 A;  3BN6 A;  2ZXQ A;  1K42 A;  3K77 A;  1UXX X;  4QDR A;  1OH4 A;  2DDU A;  3LEI A;  3W5M A;  2WAO A;  2VZP A;  4CUC A;  2W1W A;  1GNY A;  2V72 A;  4QX1 A;  3T0D A;  2QQM A;  2W1Q A;  1H6X A;  2W47 A;  5EJZ B;  2YFZ A;  3VD3 A;  3VD4 A;  3MUZ 1;  2DCK A;  3FHA A;  5LCW L;  3WF1 A;  1OD3 A;  4PT6 A;  2Y6K A;  2WUH A;  2Z4F A;  4GWJ A;  2RV9 A;  3T08 A;  2J1S A;  1XC6 A;  1DP0 A;  3UET A;  2VJX A;  3VD9 A;  3SEE A;  1F4H A;  4P08 A;  1DYO A;  3T2Q A;  4CUA A;  3HEI A;  5JMO A;  3WNP A;  3WNO A;  5JXG A;  2WYS A;  4TTG A;  1JU3 A;  3NJV A;  4DXT A;  3WF2 A;  2WZE A;  2BGO A;  3D3A A;  2VZQ A;  2J1E A;  4E8D A;  2R7E B;  4PF1 A;  4CU8 A;  1TVG A;  3K4A A;  4XUP A;  3THD A;  1OF4 A;  3DYM A;  4XVH A;  1I5P A;  4MAD A;  2VC9 A;  5HPO A;  4CVU A;  2EIB A;  1XNA A;  1OT5 A;  2WAB A;  4ZXE A;  4UI9 L;  4MGS A;  2Y64 A;  4OZO A;  2VMD A;  4JKL A;  3C8X A;  2VZV A;  1UY1 A;  2WBK A;  3OEB A;  1JYV A;  1CIY A;  2VO5 A;  3DYP A;  2C4X A;  4OUE A;  3THC A;  1SG3 A;  1O8S A;  1JHJ A;  5LA0 A;  3C7G A;  2YC4 A;  3WNL A;  1UYZ A;  3NRU A;  2WAA A;  3SKJ E;  3T0A A;  2JE8 A;  2YFU A;  1NX9 A;  1CZS A;  5G04 L;  2WN3 A;  5IFP A;  2QQN A;  4XUR A;  1W9T A;  3FHQ A;  2W1S A;  3III A;  2JDA A;  3IDA A;  4W8J A;  2Y6G A;  5LA1 A;  1P8J A;  3OB8 A;  4QX0 A;  4XUO A;  3ACI A;  4P5Y A;  3WF3 A;  2WO3 A;  1CZV A;  4LHS A;  2VZO A;  4MOA A;  2X10 A;  4XZU G;  3CMG A;  4Z2A A;  4RN5 A;  4BDV B;  4QB2 A;  4DUV A;  2VMC A;  2YB7 A;  3VDB A;  1SHW B;  4ET7 A;  3LEG A;  1BHG A;  4KI5 M;  3WF4 A;  3CZU A;  1GOH A;  4A42 A;  1GU3 A;  3CZJ A;  1NUK A;  4DEV A;  1SDD B;  1J83 A;  3T09 A;  4QB1 A;  3DYO A;  2PQS A;  1OF3 A;  1UYY A;  3A23 A;  4UOJ A;  2V4V A;  2JD9 A;  4CU9 A;  5DQ0 A;  2BER A;  3OBA A;  2VCA A;  1T2X A;  5DN2 A;  5IFT A;  4ARY A;  2W9X A;  4BK4 A;  1KGY A;  1TG7 A;  2BBA A;  2HLE A;  1UY2 A;  1EUU A;  1UZ0 A;  4OMD A;  2CDO A;  2EIC A;  3NQH A;  2VME A;  3WNK A;  2ZEY A;  2WQ8 A;  3AC0 A;  4QB6 A;  4MO3 M;  3U37 A;  2XOM A;  5JUV A;  5F7U A;  1UY3 A;  5A1A A;  3K4Z A;  3UNP A;  2XON A;  3DEC A;  2Y6L A; 
#chains in the Genus database with same CATH topology
 1NYW A;  4S2F A;  4YM2 A;  2DUO A;  4URT A;  4LBM A;  4XBQ A;  3SIT A;  1E57 A;  1YQ8 A;  5FYU A;  1COV 1;  1LHU A;  1UY4 A;  4KWU A;  1RIT A;  2OXB A;  4IUG A;  4Q4Y 1;  3GGL A;  2D97 A;  3MV0 1;  2Y6J A;  4EWA A;  1U12 A;  2P3K A;  3OG2 A;  5FKB A;  3UYJ A;  2ZGN A;  1DQ1 A;  4MGK E;  1WMF A;  2VNG A;  5JXH A;  1RUE 2;  3AP5 A;  5C8C C;  1PO1 3;  4LJH A;  2G9G A;  1GQP A;  1YQ5 A;  2X05 A;  2VD7 A;  2ZX3 A;  3IAP A;  4PLM A;  3HNB M;  2R07 1;  4E2G A;  3WG3 A;  4IDZ A;  1G9B A;  1GZW A;  1XOY A;  1SCS A;  1VBB 1;  3EB7 A;  4G9S B;  4QX5 A;  5F2S A;  5HV0 A;  3HJR A;  4FPG A;  2GC3 A;  1ZBA 1;  2W5F A;  4RR3 B;  4XEZ A;  4Q4W 1;  1DYK A;  3OY8 A;  1NG0 A;  3HVD A;  3WDV A;  3MIF A;  1UOB A;  1XJA A;  1YC6 1;  3POJ A;  1AR8 1;  3MPP G;  1PO1 2;  2D6M A;  2RJ2 A;  3KGZ A;  4NIA A;  4AOC A;  1NKG A;  2K46 A;  4QPG A;  4UYB A;  2IXL A;  4R9D A;  5CU1 A;  1CR7 A;  4K6B A;  4G3Y C;  5BXX A;  2ZX4 A;  1LOF C;  1V6L A;  4A6S A;  2VQU A;  1QJX 1;  4MVT A;  4MXW B;  4YGB A;  5A7O A;  3T0B A;  3VKL A;  5KHK A;  3I3M A;  4K1Z A;  3KF5 A;  1JI6 A;  1IS6 A;  2F4L A;  5I0D A;  4URA A;  3S30 A;  2ARB A;  1ZBE 1;  5FZM A;  1D2Q A;  1GOF A;  2W46 A;  5FY5 A;  1Z0H A;  3HQR A;  4QQL A;  2CTV A;  4UW4 A;  2Q8O A;  4X8N A;  2ZHK A;  4IEP A;  5F1R A;  1NY7 1;  2ZMN A;  3AKS A;  4PLN A;  3AKR A;  1KDK A;  2JKX A;  3AMH A;  1VB2 A;  3WCS A;  1RUD 1;  3N7K A;  4FCA A;  1VB4 A;  4CCC A;  2FDG A;  4E27 A;  2PXJ A;  3CHX A;  3I2G A;  1R64 A;  4RS5 B;  4IV3 A;  2WZ8 A;  1OD5 A;  4GH4 C;  3C7E A;  3RZM A;  5F6K A;  1H1I A;  4HAN A;  2JWP A;  3O5S A;  1HQN A;  3CDZ B;  4JRA A;  4P9I A;  1RYY A;  1JOD A;  4Q5O A;  5JOZ A;  4Q0Q A;  1AJO A;  2FCV A;  2YPD A;  1O4T A;  3GCX A;  3U14 A;  1W03 A;  3MFC A;  3R6S A;  5JPN B;  4PDW C;  1PGL 1;  5M0T A;  4KGQ A;  3RZZ A;  4IV1 A;  4D8M A;  4PQQ A;  1X8M A;  2YG0 A;  1LU1 A;  1GAN A;  3QCW A;  3M70 A;  2WO2 A;  5J48 A;  5FZ1 A;  2JDK A;  1H8V A;  3QD6 A;  1O3S A;  4QQ2 A;  3K3N A;  4I2O A;  5FMO S;  3BTZ A;  2IUW A;  5SV8 A;  3CJI A;  1NT0 A;  1R09 3;  2D98 A;  3AKT A;  4GKY A;  4FOY A;  4JCK A;  4N90 A;  5FMB A;  5ACA 1;  1G6N A;  1PM4 A;  5F8P A;  1MQT A;  1W9Y A;  4LLF A;  2RVA A;  2Y6H A;  1H1M A;  4K9S A;  5HXM A;  4I30 A;  3AMQ A;  3AX4 A;  5C4W B;  4EN9 B;  5FYT A;  5T54 A;  1I6X A;  5IT6 A;  1HV0 A;  1L3J A;  2PAE A;  4EWD A;  1C5H A;  1RUI 3;  3VDD B;  3I2D A;  4D7Y A;  1G9C A;  1F4A A;  1AYN 1;  3O14 A;  5T55 A;  3S7I A;  4YGE A;  1HRI 1;  1R08 1;  5T52 A;  5EIY B;  1JZ8 A;  1UZZ A;  5FJK A;  4L92 A;  2QQJ A;  3MEP A;  4XJZ A;  3VV1 A;  4QPY A;  2CL2 A;  3MO4 A;  2VZ1 A;  5K9Y A;  2D6P A;  2UWA A;  1BCX A;  4COV A;  1ENX A;  5J36 A;  1QJF A;  2NM1 A;  3A0K A;  3PJY A;  4M4R A;  4LEJ A;  2MEV 3;  3NW4 A;  4GJY A;  2BGP A;  2ZJC A;  1BEV 1;  3WIN E;  4MLO A;  2A6X A;  2JIC A;  4K3U A;  5FUP A;  2KR2 A;  2VZT A;  5A3L A;  2ADE A;  3E6B A;  1ZNP A;  4FTS A;  1PMH X;  1XBF A;  3NJY A;  1AYM 3;  4D0Q A;  1UU4 A;  3HR9 A;  3MLK A;  2WII B;  2V5Y A;  4E4S A;  1SBD A;  2A71 A;  1RL3 A;  3I2J A;  3OGS A;  2O8O A;  1PMJ X;  2ZGK A;  2MEV 2;  2UWC A;  4LQR A;  2DVA A;  1WCD J;  3GDB A;  1D7P M;  4LT5 A;  5FZ8 A;  4JAA A;  2IC1 A;  1SDW A;  4NHY A;  3V56 A;  3KVB A;  4MYE A;  1UIK A;  4NO4 A;  3WW4 A;  5IVV A;  1FOD 3;  5L36 A;  1AYM 2;  1OLQ A;  4CXX A;  5I91 A;  4AFD A;  1XPW A;  2W52 A;  2LW8 A;  4UF0 A;  1BZW A;  3LDK A;  5FP4 A;  1R1Z A;  2JD4 A;  1STM A;  4OQ9 A;  3SC7 X;  2BWC A;  4HN0 A;  5I8S A;  2C6S A;  1XU1 A;  5J3U A;  2HEY F;  2VTF A;  3IDB B;  4ARX A;  2WNU A;  3E5Q A;  4PLO A;  3J7H A;  2XQR A;  3T30 A;  1UO9 A;  2RS5 1;  4H14 A;  1W0N A;  2BTV C;  2ET7 A;  4N7U A;  4XJ9 A;  5LY2 A;  4AI9 A;  2KD7 A;  1F5J A;  1OBN A;  1FOD 2;  5HCF A;  3W20 A;  4QAW A;  1PX3 A;  3J8F 3;  4H3W A;  3NV3 A;  1GUI A;  4RS5 C;  4AI0 A;  1IKQ A;  5F3G A;  1UCX A;  4QPI A;  2OUJ A;  4OUL A;  5FZO B;  2UY9 A;  5IWF A;  3WDW A;  4ZS2 A;  5SV5 A;  1H9W A;  4CXW A;  4CCM A;  1K3I A;  3RZG A;  1V6I A;  4YSF A;  4WVW A;  5EV7 A;  3WX5 A;  3OPT A;  2BBV A;  1S0F A;  2A5Z A;  1OVS A;  3WSO A;  1MEC 3;  1CAX A;  3E1F 1;  1US2 A;  2G1M A;  2BOJ A;  1TNR A;  4HK8 A;  3J8F 2;  3LPG A;  3GCW A;  5A80 A;  3ES1 A;  1N3O A;  3QOP A;  4BH9 A;  4CU6 A;  2ZS6 B;  1W8Z A;  1YIF A;  5D8A C;  1J3P A;  2BFU L;  3R4U A;  5C3O A;  5DAX A;  4JGY A;  4PI0 A;  2R1B A;  2XVG A;  2YC0 A;  3N9N A;  3ZM8 A;  4CCK A;  1H4G A;  4MGZ E;  4LOS A;  2WZR 3;  3NMB A;  1C8M 2;  1VRH 1;  1J1L A;  1W8U A;  1MEC 2;  2HWE 2;  3K75 B;  4JDO A;  4NRO A;  3TAY A;  3IAQ A;  3VBR B;  5ABJ A;  2D7F A;  2Y8K A;  3HOB A;  1W8W A;  2DU0 A;  3T1M A;  1XNT A;  3I2F A;  5HCA A;  2B4K A;  2WRA A;  2QQI A;  2RS3 1;  2RS1 3;  1BK1 A;  5F5C A;  2EAL A;  5FTT C;  1YFX A;  2UYA A;  2GN7 A;  2AAC A;  4EZ4 A;  3UGH A;  4DNY A;  5C4W C;  2VZR A;  4SBV A;  1W8N A;  4G4F A;  3J7N A;  2F4P A;  1NQJ A;  2IVI B;  3ACL A;  5FAX A;  2WZR 2;  3FWE A;  3JD7 3;  5A7W B;  1NCQ B;  2D3R A;  3K46 A;  3VDD C;  4HPK A;  1OI6 A;  5L7O B;  2WWS A;  3U78 A;  2VR4 A;  3MBW A;  4Y24 A;  3VKF C;  3SH4 A;  1OA3 A;  5LA9 A;  3DXU A;  5BNN A;  4X8P A;  3ABZ A;  2RS1 2;  3FE5 A;  1NA1 A;  3POG A;  1UXZ A;  2N7G A;  4LBK A;  3ZFE B;  5A3U A;  4FFH A;  3Q8F A;  5KXE A;  2PTM A;  4FPK A;  2XHN A;  4ES9 A;  3JD7 2;  2JDM A;  2PHW A;  3V65 A;  3VZM A;  4DXR A;  5CG9 A;  1PGS A;  1Y7B A;  3RG0 A;  2WDB A;  3DCQ A;  1WCU A;  4YW2 A;  4AFB A;  5ERL A;  4O61 A;  1LRH A;  4L9B A;  3D0J A;  5EXO A;  5L9R A;  4GMP 3;  1OKQ A;  1APN A;  3QLQ A;  3ZMO A;  4YVS C;  3BN6 A;  2ZXQ A;  1RXG A;  1YJK A;  2ERF A;  4LBO A;  4F83 A;  5E6H A;  1AR7 3;  1FXZ A;  2WNO A;  1OH4 A;  2DDU A;  2GNT A;  2QDN A;  2XBO 3;  4QXH A;  2JB4 A;  4IET A;  1RHI 3;  1NQD A;  1AX0 A;  2Q8C A;  3VBH A;  2W1W A;  3M2M A;  4P9L A;  4B1M A;  1FI2 A;  3T0D A;  1K5J A;  2QQM A;  2BOI A;  2EVX A;  4BCU A;  2VOK A;  3MIE A;  5EJZ B;  3UGG A;  1LOD A;  2ARA A;  2Y38 A;  4H2A A;  1FMD 3;  4LK7 A;  4QGN A;  4XCB A;  4IES A;  4FTE A;  5I0S A;  4A7K A;  4PT6 A;  1AR7 2;  4GJZ A;  1BBT 3;  2XBO 2;  3GYD A;  2Z4F A;  1OPO A;  1V6K A;  4GWN A;  4IEZ A;  1RHI 2;  3TN9 1;  5KXC A;  2VMH A;  1DP0 A;  4YZ3 A;  1URX A;  2RM2 1;  2ZGR A;  5FQ0 B;  1LHW A;  1C28 A;  2R6Q A;  4AFA A;  3MF9 A;  1OOP B;  3O1T A;  1KS4 A;  1ND2 A;  1SMV A;  4RGA A;  2ZKN A;  2GH8 A;  3VD9 A;  1FMD 2;  4JGZ B;  2WYF A;  5FYZ A;  3ZN6 B;  4FPJ A;  3N9L A;  2HBT A;  5AVA A;  3HEI A;  5BNO A;  4LXL A;  1DHK B;  3WNO A;  1BBT 2;  2C1F A;  1SLI A;  2WYS A;  3B7M A;  3RVH A;  3EJK A;  4CDU B;  3EHK A;  4CCJ A;  1FT9 A;  3SNM A;  3E5X A;  4LOT A;  4DXT A;  1RC6 A;  3WF2 A;  3KD4 A;  2EXJ A;  5LY1 A;  4E4H A;  3BCW A;  3UJQ A;  2ZGQ A;  4XF9 A;  2R7E B;  1K5M C;  2NYY A;  3JB4 C;  3N9M A;  4M00 A;  4PF1 A;  4CEW B;  2WL1 A;  2PHT A;  2YBK A;  2IZW A;  3RZJ A;  2D6O X;  2RMU 1;  2D3P A;  5IVC A;  4WVM B;  4K8F A;  1G9F A;  1R1A 3;  1GZT A;  2C9A A;  3KHB A;  1I5Z A;  4YAR A;  2VUD A;  1BMV 1;  2YMZ A;  2VC9 A;  5FZD A;  5JIA A;  3OD4 A;  5C5U A;  4OHV A;  2XKP A;  5F2W A;  1DDL A;  2JDY A;  1XNA A;  5FLJ A;  5L9B A;  2VXJ A;  2WAB A;  1FPN 3;  1SFN A;  1V70 A;  1DZT A;  1PK6 C;  3AL5 A;  4MGS A;  3K3O A;  4DIN B;  3MF6 A;  1UIJ A;  2QJV A;  4COW A;  1RB8 G;  4DMI A;  5C8C A;  5KHI A;  1SLA A;  1UY1 A;  1CES A;  4IGO A;  4Q0U A;  2VOW A;  1R1A 2;  4L11 A;  3LSD A;  3OPZ A;  3F95 A;  4IL7 A;  5GAL A;  3WG2 A;  1IHM A;  5A1L A;  2WIN B;  2WJS A;  2YGL A;  5C33 A;  1O8S A;  2FHR A;  4M0N A;  5FO8 B;  1D0H A;  5LA0 A;  1XE7 A;  3WNL A;  1UYZ A;  2DBI A;  3H8R A;  3OGJ A;  1VBE 3;  4P5H A;  3AYA A;  1FPN 2;  5BYN A;  1MS4 A;  5FP3 A;  1KD7 A;  1CAU B;  3HMY A;  3OCP A;  2PMW B;  5K4L A;  3N7L A;  3KB5 A;  1V6N A;  1V9U 3;  3WHU A;  5IVB A;  3ZFE C;  5DDJ 3;  3AP6 A;  4W6X A;  3FHQ A;  4MGY E;  3URF A;  3TEY A;  1LOF A;  3LOI A;  1BQP A;  4K40 A;  1VBC 1;  1H9P A;  4YZ4 A;  2G19 A;  3K48 A;  1IS5 A;  1P8J A;  3OB8 A;  4FPE A;  4QX0 A;  2YRO A;  5JI9 A;  3H8O A;  2OPW A;  5CKQ A;  5DG1 A;  4EQV A;  4FAH A;  3U75 A;  3AZX A;  4Q1R A;  3KWV A;  4XFF A;  1CZV A;  1DU3 D;  3FX3 A;  4PIY A;  3EO6 A;  4LHS A;  3GHN A;  5DDJ 2;  3WUC A;  5EYX A;  5EFU A;  2A3X A;  2YU1 A;  1A6C A;  4RN5 A;  5FZE A;  5CG8 A;  4CP1 A;  3H8X A;  1ST8 A;  3B00 A;  4B7K A;  4XIL A;  3K2O A;  4KI5 M;  2LTN A;  3POE A;  5DXD A;  4PF5 A;  3HT1 A;  3CZJ A;  4YG0 A;  1NUK A;  3IBM A;  4GH4 A;  4BLJ A;  5FKC A;  4QQO A;  4AZZ A;  1W0P A;  1GV9 A;  1JUH A;  2P3J A;  2EAA A;  3LAG A;  3WQ1 A;  5KHG A;  5I0R A;  2ZHN A;  2PQS A;  1OF3 A;  1UYY A;  3DYO A;  2P5B A;  4QM9 A;  4TSV A;  2JD9 A;  1DQ5 A;  2WKK A;  3NNL A;  4UOJ A;  3TBD A;  4X6Q B;  4CU9 A;  2VCA A;  1PVX A;  4KQ7 A;  4RA0 A;  3ST7 A;  2QQP A;  2OPK A;  3ZDV A;  4D6R A;  5FZ6 A;  1BJQ A;  4PDW A;  5C3P A;  5DUX A;  1KGY A;  5H9P A;  1UY2 A;  1EUU A;  4GB3 2;  2Z42 A;  1UZ0 A;  1WUV A;  4UW6 A;  3KV5 A;  3U10 A;  1OOP C;  4Q8L A;  3V0B A;  4COY A;  1ZVF A;  1W6O B;  2GC1 A;  4AYU A;  4JGZ C;  1HV1 A;  2ZX2 A;  4PQ9 A;  5IK4 A;  3V0A A;  3WNK A;  1XYN A;  1KS5 A;  2WQ8 A;  4QB6 A;  3U37 A;  2VNO A;  2ZGL A;  3DKW A;  4KNC A;  3N9Q A;  5C5T A;  3JQW A;  1XQN A;  3ZIX A;  4HFS A;  2VCM A;  5JUV A;  3Q8A A;  1OQE A;  1UN1 A;  5FPB A;  1ENS A;  3DGT A;  5A1A A;  4AEM A;  1REF A;  4V2V A;  3UNP A;  1ULC A;  2EXI A;  1SZB A;  4XC9 A;  3WDT A;  4A3X A;  2XB6 C;  3VBU C;  1LJ7 A;  2DYC A;  5JOX A;  1WA6 X;  1LEC A;  3LFI A;  1IG0 A;  2H6C A;  5DAP A;  2MPF A;  5GKA C;  4CEW C;  4JDN A;  5FOJ B;  1JYN A;  2ZAC A;  3TEZ A;  3ZXA C;  1CVN A;  3CBN A;  4BQ5 A;  4LHK A;  1WLC A;  2OA2 A;  4DEQ A;  2VZU A;  2RR1 1;  2V73 A;  4R8H A;  4LIU A;  5IAV A;  4LO6 B;  2R04 3;  3AP4 A;  1CAV B;  2EID A;  5CAD A;  5FYC A;  3T2O A;  4DPN A;  4DXZ A;  4FP3 A;  1RED A;  1RMU 1;  2P2K A;  5LEK A;  1NAE A;  5IHR A;  5A3M A;  2QQU A;  4I09 A;  1BXH A;  1D0G A;  2J1R A;  1OQ1 A;  1W2A X;  1AR6 3;  2QNK A;  4XAC A;  4KH9 A;  3R4D B;  3T3Y A;  1S2B A;  4LKD A;  2DVB A;  1GP4 A;  3LPF A;  4W6W A;  2JIJ A;  3ZFG B;  2R04 2;  1QDC A;  3LB9 A;  1RUF 2;  2X53 S;  4EN6 B;  2GSY A;  4IGP A;  4UBG A;  1OA4 A;  1TZO A;  1PO2 1;  1QJU 1;  2IVJ A;  4FPY A;  4H7M A;  3PUA A;  1GMM A;  3MV1 1;  2DCT A;  3I3B A;  1A3K A;  2VUA A;  4DS0 A;  5FZB A;  2JDU A;  1F15 A;  2PEL A;  3X29 B;  1H2K A;  4A2U A;  4Q29 A;  4ERO A;  3IPV B;  1AR6 2;  5L73 A;  1JZ6 A;  1YFY A;  5DAW A;  2GAL A;  2BWA A;  1O3Q A;  1PM7 A;  4BM8 A;  4Y4Y A;  1QJZ A;  3MHZ A;  3THT A;  1C3H A;  4S2H A;  3KT4 A;  3MIG A;  2E31 A;  2G9Z A;  4EN7 B;  4U2A A;  1RUH 3;  1EYB A;  5GLT A;  3MZH A;  3ZYG A;  1DZQ A;  4C90 A;  3NL1 A;  4MXW A;  3CL1 A;  4WM7 B;  3VBS B;  3KGL A;  2P17 A;  4BK5 A;  4UFL A;  4Z82 A;  3LA7 A;  5IJR A;  3VZJ A;  3HD8 B;  5DZG A;  2WS9 3;  3O1P A;  1OA2 A;  2Y34 A;  4HBN A;  3VHO A;  2OII A;  1SAC A;  3AJY A;  4QKD A;  1W9W A;  2BNO A;  2HBU A;  5BNP C;  2B45 X;  2VUC A;  3DXT A;  4GXL A;  4OHY A;  4XIK A;  1RUH 2;  2W87 A;  1HXS 3;  3I3Q A;  1C8M 1;  2HWE 1;  3C7F A;  1MEC 1;  3LIG A;  4JX0 A;  3ROU A;  2YXS A;  4XE9 A;  1OXC A;  1X8E A;  4OYU A;  3W5N A;  1GWL A;  2J1A A;  3IMN A;  4Y1U A;  3ZPY A;  2J22 A;  2WS9 2;  4RS5 A;  2VW1 A;  3CKH A;  5A6Z A;  3A21 A;  3BB6 A;  4XTP A;  3SQO A;  1HN0 A;  3O7O A;  2GU9 A;  4LA2 A;  1JYC A;  2BZD A;  4XW3 A;  1WCK A;  3BUC A;  4IEW A;  2HWF 1;  2WZR 1;  3TWI A;  4AG4 A;  4P9Y A;  2EIG A;  4IGQ A;  4WVZ A;  3WCR A;  5JZG C;  5JIU A;  4QT6 A;  3P5B A;  5CVR A;  1YLL A;  1FAY A;  3LZZ A;  4UFM A;  3WT3 A;  3ZSK A;  4YM3 A;  3DPR B;  3GF6 A;  3I59 A;  4GIQ A;  5D8A A;  1LED A;  1C4R A;  3N4M A;  3M7A A;  5CYY A;  4B8E A;  3KMH A;  4KBZ A;  1UAI A;  3POS A;  1H4H A;  4KWL A;  2X29 A;  2GNM A;  2W94 A;  4CCN A;  1YEW A;  2LUW A;  3WNX A;  1HRV 1;  4QKN A;  4YPJ A;  3VBF B;  1VMJ A;  4NPR A;  5FY9 A;  4AGV A;  2VEC A;  2UUR A;  5LB6 A;  5CIR A;  4CDX C;  2QQV A;  3B9C A;  2YV8 A;  1YQC A;  3H50 A;  1DG6 A;  4LR4 A;  3KHC A;  1W6P B;  5C4W A;  4NIH A;  2ZZQ A;  4W50 A;  1GWM A;  4XUN A;  3ILF A;  3CIH A;  3F2Z A;  5FZK A;  2J1U A;  1ODM A;  2R0H A;  2WNV B;  3J9S A;  1UZV A;  4W4Z A;  3VDD A;  3POI A;  1RVF 1;  1GFF 2;  2JDN A;  3WDU A;  2Y26 A;  3OJB A;  4LUL A;  3S6P A;  4LBQ B;  1S4C A;  4A7Y A;  4GMP 1;  2VVF A;  4AWD A;  1UY0 A;  3TNP B;  5LK7 B;  4QX3 A;  5I0T A;  1LGN A;  2BEO A;  4UXA A;  1XE8 A;  2W91 A;  3NKG A;  5T5J A;  1PNG A;  1ND3 B;  4QX2 A;  3O1R A;  3T2T A;  1NXM A;  4YZ5 A;  2NPI A;  2XBO 1;  2VE1 A;  3AKP A;  1ZZ9 A;  5GZG A;  2JEM A;  5JAX A;  2JXA A;  1L7L A;  5CNA A;  1RUJ 2;  3BTY A;  2XJT A;  5J96 B;  3ZR6 A;  4ZY9 A;  2AEZ A;  1W3V A;  3ALQ A;  4L8Q A;  5FMD A;  4Q2F A;  1N1S A;  3E97 A;  3MW2 A;  1WA4 A;  4K8R B;  4L99 A;  4YVS A;  3PVE A;  1HB2 A;  5CB7 A;  3SCG A;  5EJ1 B;  3ECQ A;  3P6B A;  5CFD B;  4LMF A;  5JOW A;  3L9J T;  5AC9 1;  3E5U A;  2BU9 A;  3M3C A;  4N43 B;  4NN0 A;  2GP5 A;  4OHW A;  3MGU A;  2ZA9 A;  3ASI A;  2VBD A;  1E5S A;  1G7Y A;  1VBD 3;  4Y5Z 0;  4LO4 B;  4FBF A;  5FRA A;  4XUT A;  3PUQ A;  3LEK A;  4Q27 A;  5FO7 B;  1LAJ A;  5FBZ A;  4MHU A;  2DBN A;  4IE6 A;  2XGX A;  3TOJ A;  4HZF A;  3ZIW A;  4CDW C;  4DUX A;  1Z7S 3;  4QDS A;  4GWM A;  2BGC A;  5JXI A;  3WEZ A;  1F31 A;  5DZE A;  4I3P A;  2XHK A;  3VBO B;  1OUX A;  1ZZ8 A;  1SPP B;  2ZGO A;  1U0A A;  2O8Q A;  2ZX1 A;  2YU2 A;  1CIW A;  4A4A A;  1DLL A;  4I3G A;  4XFG A;  3VKN A;  1X7N A;  3CQO A;  1J84 A;  1U5X A;  3NNJ A;  3G6J B;  3K4D A;  1YFU A;  2C24 A;  3CEW A;  1VBD 2;  1PVC 1;  2PHU A;  4XF3 A;  4XFC A;  1IKP A;  2W95 A;  4Y22 B;  3ZSM A;  1AL2 1;  1YRZ A;  2BPA 2;  4IER A;  2D6L X;  2A1X A;  3I2H A;  4MUV A;  1MVE A;  2IXK A;  1Z7S 2;  1UD1 A;  4WVV A;  4Q4X 3;  1IS4 A;  4I02 A;  3RSJ A;  2PLV 1;  2Q8D A;  4RHV 1;  2DVG A;  3I3E A;  1YIP A;  3R0R A;  2RHP A;  1AR9 1;  1H2N A;  5FPX A;  2DFC A;  5DZF A;  5FZO A;  5I8T A;  2YC2 A;  4MZU A;  5A3O A;  3S5A A;  5GZF A;  1XYO A;  4A6O A;  5FZ7 A;  1JHN A;  2B9V A;  4LIV A;  2ZGP A;  5FRE A;  2PQQ A;  2CNA A;  1K5M A;  2DCJ A;  3MIC A;  2PYT A;  2JG9 B;  1DGR N;  4Q4X 2;  4Q0V A;  3OD0 A;  4N9H A;  5IYY A;  2W3J A;  3J7L A;  3DPR C;  4AHW A;  3WNN A;  3H3Z A;  4BE3 A;  2EXH A;  3HN3 A;  5A1F A;  4XDP A;  5KXD A;  4AVS A;  2HYX A;  4BJ0 A;  3O1M A;  1C57 A;  1V00 A;  3C2U A;  1POV 1;  3FFQ A;  4HVO A;  3SH3 A;  5J09 A;  4HOO A;  4MGI E;  3PIJ A;  4YW3 A;  1US3 A;  5ANN A;  3WUD A;  4E2S A;  2FMD A;  4GA9 A;  4Y20 B;  1O5U A;  1PK6 A;  3UKV A;  3VBF C;  1NCR C;  2Q8E A;  5HXV A;  2DUR A;  3HNM A;  1TMF 1;  1QJY 3;  1M4W A;  2XDV A;  3LQC A;  5LA2 A;  3UES A;  2P34 A;  3ETP A;  4CDQ B;  3EYP A;  5FZ4 A;  1HLC A;  4DY3 A;  4A3Z A;  1SFP A;  4A44 A;  4KL1 A;  1Y9G A;  2VNV A;  4Q26 A;  4JVA A;  5C8W A;  5J37 A;  5CBL A;  2ARX A;  3OGG A;  5LRS A;  1ULE A;  2JG8 B;  1CJP A;  2BNM A;  4FXG B;  4AFC A;  2W1U A;  3H1W A;  5A7W A;  2WLP A;  4R9A A;  3PUR A;  5C71 A;  3U11 A;  3ZYJ B;  3CNA A;  2VCC A;  1QJY 2;  2VBB A;  3D0S A;  4I0A A;  5LAT A;  3OGV A;  3AZY A;  3RNS A;  4RYD A;  3GBW A;  3I4I A;  4ZU7 A;  2JIG A;  4TXW A;  1LNS A;  2IXI A;  3GZE A;  4QGM A;  4QPW A;  4FOV A;  1WME A;  1GZC A;  4XOG A;  5FZA A;  3W9A A;  3ZFE A;  2ZBJ A;  4LUK A;  3WLU A;  4B4P A;  3ILR A;  2ZGT A;  3HIF A;  4RQP B;  2X09 A;  5B4N A;  1R09 2;  1EV1 3;  4NRQ A;  2YHJ A;  4YRD A;  1UX7 A;  2QDR A;  3GNE A;  2ZTN A;  3WW1 A;  5F9T A;  4HK9 A;  2JEN A;  4OCT A;  1EPW A;  5A33 B;  1Q8V A;  1UPI A;  1PX4 A;  3IN9 A;  2E6V A;  1DZR A;  3E6D A;  4GB3 1;  3BI3 A;  4TWT A;  2HEV F;  5CIS A;  4Q4V 3;  3WDY A;  5FXV A;  4BU2 A;  1PIV 1;  1NXD 1;  2HWC 1;  3LEI A;  3AKQ A;  2XJR A;  4DY5 A;  4XDQ A;  5CFD C;  1H8T B;  4CUC A;  1RUI 2;  1GNY A;  1CN1 A;  3BOW A;  1EV1 2;  2HYK A;  4QQH A;  1WLD A;  2W1Q A;  1H6X A;  4ITC A;  4N43 C;  4Y1X A;  3I2O A;  2NP0 A;  2YFZ A;  3VD3 A;  3VD4 A;  4OI2 A;  3WXP A;  1W8H A;  5FPU A;  4Y3O A;  2DCK A;  1S0E A;  4PIX A;  4RR3 C;  1OD3 A;  1O91 A;  4Q4V 2;  2GC0 A;  3GAL A;  3RPQ A;  2NZ9 A;  4NHK A;  4FOW A;  2WQZ C;  3ZYP A;  3ZXL A;  5AFB A;  2XJU A;  1VAL A;  2J1S A;  3VBO C;  1H0B A;  4ZPI A;  4BPZ A;  1ZX5 A;  4N9I A;  5JWP A;  3ES4 A;  1IPK A;  4YM1 A;  3UET A;  4R9C A;  5T5O A;  2UWB A;  4QMA A;  1MZE A;  3SEE A;  5FMO L;  5FQ0 A;  4P08 A;  3ZSE A;  5C9A B;  1MZF A;  3T2Q A;  1OOP A;  2WWJ A;  4OVE A;  4V1P A;  5KWR A;  4Y26 A;  1HIX A;  1DGW X;  4JGZ A;  3WNP A;  3ZN6 A;  1VAK A;  2Y6F A;  2HKX A;  1Y9Q A;  1VE0 A;  4O9E A;  1OSG A;  5F5A A;  4CRQ A;  2XWJ B;  5CFC B;  2E9Q A;  1D2S A;  5I8Y A;  3KQ4 B;  3LCP A;  2IXC A;  2WZE A;  2XH6 A;  1PNF A;  3U1X A;  1SBF A;  1RUF 1;  3O12 A;  2J1E A;  1W8T A;  4E8D A;  1Q8O A;  2HWD 1;  3A4U A;  1GNH A;  4LLO A;  4DO0 A;  4QQP A;  1TVG A;  4IND A;  3BPZ A;  5LBF A;  1Q43 A;  3VBU A;  1CPM A;  4XUP A;  4R4X A;  3NNM A;  1OF4 A;  4XCA A;  1QMJ A;  4CCO A;  4D7S A;  2OZJ A;  4CEW A;  2JG9 C;  4LKF A;  1W90 A;  1I5P A;  1E5R A;  2D5F A;  4P14 A;  4DB5 A;  1LHV A;  2XJP A;  1RUG 1;  4WVM A;  2B9U A;  4CVU A;  2EIB A;  3NAP B;  4YGC A;  2D40 A;  2DU1 A;  2A70 A;  1S0C A;  1QQP 1;  2HWB 1;  3RWN A;  4XMA A;  1LCL A;  4CUG A;  4HVR A;  2QZ3 A;  4JKL A;  1QKQ A;  3UT0 A;  1OHF A;  2BW8 A;  3TYJ A;  1KDM A;  1SEF A;  5LWB A;  2Q1Z B;  1YI7 A;  3OEB A;  1Q8Q A;  5A7N A;  2WQ4 A;  3JBG 3;  1JYV A;  4CDQ C;  2C4X A;  5K8S A;  5F32 A;  1W0O A;  2P1B A;  1BK0 A;  1M06 G;  1GKB A;  1DQ2 A;  5FY8 A;  3POF A;  2PAM A;  2ENR A;  2ZGM A;  3ORJ A;  3T0A A;  5JI7 A;  3DUI A;  1BVP 1;  2YFU A;  5B2G B;  2WFF 1;  3H42 B;  3O0X A;  2R16 A;  3R05 A;  2JG8 C;  5CKM A;  3NWK A;  4HSJ A;  5F3E A;  1GIC A;  3RYP A;  2WN3 A;  3TB0 A;  1FV2 A;  1ZM1 A;  5IFP A;  1W6M B;  3W59 A;  4E9K A;  1RUC 3;  1CAU A;  3JBG 2;  4IV3 B;  5FR3 A;  4AI2 A;  4XUR A;  5FXW A;  5DG2 A;  4Z07 A;  4O65 A;  2D3S A;  4JRL A;  3III A;  1N1T A;  1ASJ 3;  3PU3 A;  2ZZJ A;  1BLZ A;  1OLR A;  4WM8 B;  5LBC A;  2Y6G A;  4BXF A;  4RQP C;  5LA1 A;  3H8U A;  2D6K A;  2QTW B;  4XUO A;  2ZGU A;  3ACI A;  3RZK A;  2Y33 A;  4RL7 A;  5A6X A;  2WO3 A;  4NRM A;  2Y0I A;  4XHX A;  5FYY A;  4IV1 B;  1PZ9 A;  2VZO A;  3VZN A;  3CMG A;  1OMI A;  2HEW F;  3J4U H;  2VOV A;  5C3R A;  3INA A;  4JV4 A;  4ASK A;  5BNP A;  4DZG A;  4RGG A;  5A7P A;  1UPS A;  4DUV A;  1JOB A;  5A7S A;  4B7E A;  3E6C C;  2XPJ A;  3SIS A;  3LEG A;  1MS9 A;  1D4V B;  1H8T C;  3CJX A;  2GMP A;  3ZYB A;  1GOH A;  2BUK A;  3O1V A;  1NLS A;  2E53 A;  1GU3 A;  1VAM A;  4E4Z A;  1LB2 A;  2IWG B;  1SDD B;  4NID A;  2KXL A;  4QB1 A;  1MAC A;  1QDO A;  4HLT A;  1MQT B;  4NPL A;  1YO8 A;  4XFB A;  2R06 3;  4HN1 A;  2WT0 A;  5DQ0 A;  3OBA A;  2OX0 A;  2W68 A;  2GDF A;  5DN2 A;  2KM2 A;  5IFT A;  4QX8 A;  5FLI A;  4AHY A;  4ARY A;  2PA7 A;  3N3H A;  1N47 A;  4I0W B;  2ZOE B;  2BBA A;  2ILM A;  4YW6 A;  2HLE A;  5JZG A;  3AMN A;  1GP5 A;  1I9R A;  2CSG A;  4OMD A;  4AVA A;  2XVK A;  2P6C A;  4XF1 A;  2CDO A;  3RGB A;  1Q5O A;  3KV4 A;  1CD3 G;  1HJF A;  3NQH A;  5C9A C;  1IG3 A;  3AM2 A;  3U4S A;  1ULF A;  2VU9 A;  2R06 2;  1S2E A;  1W6O A;  4QHZ A;  4Z92 B;  2ZHL A;  5A3T A;  1W04 A;  1QWR A;  2VGD A;  2FDH A;  2XOM A;  4P9J A;  4I0B A;  1F2N A;  1B09 A;  4FQ4 A;  1FAT A;  4YYO A;  5FYS A;  4YM0 A;  5HV4 A;  1UY3 A;  2MNG A;  4R52 A;  5CFC C;  1RUJ 1;  2AZ5 A;  1VR3 A;  2F17 A;  1COV 3;  3BPS A;  3ZXD A;  3I7D A;  4QM8 A;  4ZKT B;  4Q4Y 3;  1JXN A;  4KU7 A;  5FJH A;  1PZ8 A;  1LR5 A;  3MDP A;  2V09 A;  5EZW A;  3PJQ A;  4CDX A;  1QXJ A;  3ACH A;  2GME A;  4XFA A;  5C3S A;  1W39 A;  2B5H A;  5FY7 A;  1RUE 1;  1ZRD A;  5K0U B;  5L9V A;  1KJR A;  4Q0S A;  2J1T A;  3BOP A;  2GND A;  3LSE A;  3OBT A;  1ALY A;  3Q9O A;  4QD2 A;  3VB9 A;  2DUP A;  2A73 B;  3ILN A;  4AQ2 A;  1UW8 A;  2W2I A;  1KFX L;  4BQY A;  1W8O A;  5LBE A;  1WGP A;  2R07 3;  2VCB A;  2WWU A;  1COV 2;  2JKB A;  3NAP C;  3LA2 A;  1VBB 3;  4IE0 A;  2PHL A;  4Q4Y 2;  5GM0 A;  5IAT A;  3JU9 A;  2VH9 A;  1ZBA 3;  2WA4 A;  2XLG A;  4NMI A;  2Q1M A;  1V6J A;  4Q4W 3;  4XDO A;  2VNR A;  1S1A A;  4D6S A;  5CEH A;  1JZ2 A;  2RG4 A;  3PUI A;  1PO1 1;  2QQK A;  4B4Q A;  1AR8 3;  2QQO A;  4C8D A;  2OQ7 A;  3I2I A;  2K2S A;  5A3N A;  2WNU B;  4YG6 A;  2R07 2;  1VBD 1;  1C5I A;  3OYW A;  3PHM A;  2FMY A;  2ET1 A;  3QBQ A;  1GNZ A;  4CP0 A;  1PHM A;  1UMH A;  1Z78 A;  4YNI A;  1QJX 3;  4ZXK A;  1ZBA 2;  3VBR C;  2BDR A;  1XXN A;  4HKW A;  2A6V A;  4Q4W 2;  4FAG A;  3WQ0 A;  4NAO A;  3WF0 A;  1S0B A;  2NMN A;  4XJU A;  1VMH A;  5JSO A;  5D21 A;  1ZBE 3;  1QY4 A;  4XQW A;  3M3O A;  1AR8 2;  3UL2 A;  2Z2S B;  2FQP A;  3FL7 A;  5KHJ A;  4IE7 A;  5FBJ A;  2XJQ A;  1UMI A;  2CYF A;  3D82 A;  5FYV A;  3WV6 A;  1O5L A;  1S0D A;  3LF7 A;  4WM8 C;  1NCQ C;  1Y4W A;  2ZPX A;  2GC2 A;  1J3Q A;  4TLG A;  2QQL A;  3EQE A;  1QJX 2;  5F39 A;  4CDW A;  1ENR A;  1RUD 3;  3NV2 A;  2VZ3 A;  4XJW A;  4XBL A;  5L7O C;  1UYP A;  5FZL A;  5F5I A;  4GZ9 A;  4NVP A;  4AK3 A;  2I45 A;  2ORZ A;  3HPN A;  4K1Y A;  2A7A A;  4IW3 A;  4AVC A;  3JB8 A;  4EN8 B;  1JYW A;  2L9L A;  4A45 A;  1G86 A;  5F5Q A;  2IFW A;  4LBL A;  1HJG A;  2E26 A;  2VM9 A;  1HB1 A;  4BQ4 A;  4M01 A;  1DYP A;  4PBO A;  5E1R A;  1VBE 2;  3BKZ A;  5FP7 A;  5ABJ B;  2Y60 A;  4MXV A;  1RUD 2;  2HJI A;  3RZL A;  1IPJ A;  3RFR A;  1W6Q B;  2ZAA A;  5FZI A;  3GHM A;  1LUL A;  1V9U 2;  3D8C A;  4CU7 A;  4NUB A;  3OUJ A;  1UQX A;  2Q0A A;  3SEP A;  5A32 A;  1WW7 A;  2CDP A;  3T4V A;  3HT2 A;  4R4Z A;  4LKS A;  4D7T A;  1VMF A;  3I97 A;  3RI9 A;  2B8M A;  2ZCW A;  2CAV A;  1CAW B;  5FYH A;  3NST A;  1QXP A;  3PUH A;  1QJY 1;  4N53 B;  4YW7 A;  5ACA 3;  1V0A A;  1UOF A;  3U07 A;  1JYX A;  5C6C A;  3BTX A;  5FPZ A;  3DEM A;  4CP9 B;  1V6O A;  3DPR A;  3C7O A;  5FY1 A;  3AVS A;  3HN1 A;  1J59 A;  4BLI A;  2BP6 A;  4AXO A;  1X33 A;  4M3C B;  4QKF A;  1IQD C;  2JE7 A;  5DAV A;  1WD4 A;  4TLF A;  2QKD A;  4AEK A;  1G9D A;  4ATF A;  3BU0 A;  1R09 1;  1WLW A;  2FDJ A;  3I54 A;  4OI4 A;  5JXJ A;  3OTF A;  4ZHN A;  1UOJ A;  3MIB A;  3VBF A;  1AYN 3;  1NCR A;  3WP5 A;  4XF4 A;  1HRI 3;  1R08 3;  2G9F A;  3MLJ A;  1QXR A;  4MGQ A;  4QXC A;  4SLI A;  4W6Y A;  5J7M A;  4NIG A;  3ZSL A;  3PVN A;  4FPC A;  3DL3 A;  4Y1Z A;  1QOS A;  3U0Z A;  1VJ2 A;  5H9Q A;  1NE6 A;  2UY8 A;  4AVV A;  4HXC A;  1W6P A;  1ZZ6 A;  3KCY A;  2PN5 A;  2EIE A;  5K0U C;  5A6Q A;  4RFR B;  3IWZ A;  1MS3 A;  1RUI 1;  4OQ8 A;  1DQ6 A;  2NLR A;  4CDU C;  1H2L A;  1DLC A;  3OGR A;  4XMI A;  1BEV 3;  1AYN 2;  1U5Z A;  3VBH B;  2VBP A;  1HRI 2;  1H6Y A;  1R08 2;  2BV4 A;  1WKY A;  2PHX A;  4FSJ A;  4OHZ A;  2WN2 A;  2K9Z A;  1OVP A;  4ZZ8 A;  4O9G A;  2UYB A;  2C26 A;  4NR1 A;  3HBK A;  5FZF A;  3TNQ A;  3ZSJ A;  5C70 A;  3VD7 A;  2WT2 A;  4JQT A;  1CWP A;  2TBV A;  4LIT A;  3DKQ A;  2MEV 1;  5B4X A;  1DQ4 A;  5FUI A;  5A3P A;  3N36 A;  1XRU A;  1BEV 2;  4OUS A;  4PCR A;  3RRD A;  5T5P A;  1JZ3 A;  1N1Y A;  1AYM 1;  4JKM A;  1CZT A;  3HWJ A;  1LU2 A;  1ND2 B;  4BMB A;  4AW7 A;  4JKK A;  5FXX A;  2WNE A;  1KXG A;  2PHD A;  2ZHM A;  4EYU A;  3N35 A;  5CFD A;  1OLM E;  2DWR A;  4FXK B;  3WVJ A;  5BNO B;  4AQ6 A;  5FZC A;  2XWB B;  4BHP A;  4N43 A;  1BVV A;  1ZRE A;  4N7I A;  4C1W A;  5I93 A;  2CY6 A;  1QGL A;  1OH3 A;  2V5D A;  5FFO C;  1HQL A;  3KT7 A;  1FOD 1;  2MHF A;  2RS5 3;  3ETQ A;  4RR3 A;  1GR3 A;  5DPN A;  4GAZ A;  3BGA A;  1MS0 A;  3GJB A;  2CGP A;  1UNB A;  2QZ2 A;  2XJV A;  4XZP A;  1NZC A;  2NQY A;  1UKG A;  3JQX A;  4DOU A;  1AXY A;  4YW1 A;  3VBO A;  3ZN5 A;  1SPP A;  3OBR A;  3WW2 A;  2P3Y A;  2K0G A;  4AAX A;  3K51 A;  2DV9 A;  4J1W A;  1LTE A;  3LD8 A;  5GLW A;  2ZEX A;  4J6G A;  1ULP A;  1JZ7 A;  1TNF A;  2RS5 2;  3NV1 A;  4Y22 A;  4BOW A;  3NNG A;  4M3C E;  2B42 B;  4NRP A;  2W08 A;  3J8F 1;  2WA3 A;  4FTB A;  1ENQ A;  3ENR A;  4GAL A;  4JQR A;  5LBB A;  3FUO A;  4JC1 A;  4YFZ A;  4IEO A;  5C8C B;  1QHD A;  2WSU A;  2WC2 A;  1QH7 A;  4XUQ A;  4AFM A;  3WR0 A;  3SMH A;  1OFN A;  2KA3 A;  2QUO A;  2CU5 A;  2A75 A;  3BYW A;  2DVD A;  3GZT B;  4QDQ A;  4ZZ5 A;  1CQ9 A;  4M0H A;  4XF0 A;  1VRH 3;  4COU A;  4EN0 A;  2OZ6 A;  1HQW A;  1AF9 A;  3ZN4 A;  3ON7 A;  3T2P A;  5BY5 A;  4I01 A;  4N53 C;  2JG9 A;  3SCH A;  4B4R A;  2CWS A;  3ZFF B;  1AL0 G;  2I2S A;  2RS3 3;  2XUM A;  4CEY B;  5FZ3 A;  1W6N B;  1TQ5 A;  1LOE A;  3T1L A;  2VVE A;  5CAZ A;  3USS A;  3ZX7 A;  3SCF A;  3EBR A;  4CP2 A;  2LAL A;  1HXS 2;  1JH5 A;  1X9P A;  4ZU5 A;  1K12 A;  1ZYB A;  2RDS A;  5EHD A;  5JR2 A;  1UL9 A;  3CF6 E;  2GZW A;  3LIH A;  1QIQ A;  2D43 A;  4C0H A;  1VRH 2;  4NII A;  5JCT A;  2VQT A;  1RJ8 A;  1L7R A;  2BRT A;  4M3C F;  5CZK A;  3VZL A;  2I07 B;  3USU B;  4KMQ A;  5FYB A;  5FPA A;  3VZK A;  1F35 A;  2NMO A;  2RS1 1;  1K45 A;  3VZO A;  4CDQ A;  5J1X A;  2ID4 A;  2RS3 2;  1YFW A;  2P3I A;  4BQ1 A;  2TNF A;  3AXE A;  2OKX A;  4LTA A;  1O6U A;  5C3Q A;  2E33 A;  2AGS A;  2XR4 A;  3DF0 A;  3JD7 1;  2JJ6 A;  4LKE A;  3M4F A;  2JG8 A;  2VL4 A;  4MSV A;  3LE0 A;  1ZA4 A;  1ODN A;  1ZRC A;  1LGB A;  2ZEW A;  1W9S A;  3TEX A;  4YVW B;  1RUN A;  4P9W A;  2XLA A;  4GH4 B;  4HKO A;  3MW3 A;  3H1M A;  3M3Q A;  4UT5 A;  3VD5 A;  5FPV A;  2FD8 A;  1EPZ A;  4YW5 A;  3Q8E A;  4L0P A;  3OUH A;  4QWN A;  3FFZ A;  5H9R A;  3W21 A;  5FIX A;  4D94 A;  3TRS B;  4MX3 A;  4AHX A;  5IK5 A;  1T6B X;  2FCT A;  4RQP A;  5EWS A;  3ZKY A;  3AB0 A;  5ANQ A;  1XB9 A;  4Y5T A;  4P9X A;  5A33 A;  4PBP A;  2R1D A;  2W0X A;  4IE4 A;  1UXX X;  4QDR A;  4BQ2 A;  3N7M A;  5KR7 A;  4AHZ A;  3BVC A;  1QOO A;  2DCY A;  2QQW A;  1QNW A;  3V0B B;  2R06 1;  4XIO A;  2YGM A;  5JDB A;  1X82 A;  1AR7 1;  2V72 A;  1FNY A;  1GQG A;  2ATF A;  4XAA A;  3PUS A;  3MIH A;  3FBY A;  1H8T A;  4AED B;  3AYE A;  1RHI 1;  4LNV A;  4BA6 A;  1B35 B;  2X5I B;  2DVF A;  5FZ9 A;  3ZFG C;  4AQT A;  1OUR A;  1WW5 A;  4JZR A;  3FHA A;  4PHZ A;  4PI2 A;  4FFI A;  3TN9 3;  4XAE A;  3AMM A;  2RM2 3;  3UV9 A;  1FMD 1;  1LES A;  1O3R A;  4N8M A;  3H9A A;  4HKL A;  4LHL A;  4XQ4 A;  2VUJ A;  1AXZ A;  3AMP A;  4F8A A;  4EE2 A;  2YBP A;  2E7Q A;  1BBT 1;  1Y9M A;  3OUI A;  4GQ7 A;  2AH2 A;  2VMI A;  2JX9 A;  1XSR A;  4QHO A;  2VJX A;  2Z69 A;  1LOB A;  4RFT 0;  1S0J A;  4AGR A;  2YBS A;  4CUA A;  3TN9 2;  5FK8 A;  5F37 A;  5JMO A;  3NVC A;  4CYD A;  2RM2 2;  4WM7 C;  1YHF A;  1VLN A;  3VBS C;  5C9A A;  3VUO A;  4F3J A;  1JU3 A;  3IT8 A;  3NJV A;  4UBH A;  1YJL A;  2Q5T A;  3CO2 A;  4XJA A;  4CXY A;  3VLB B;  2BGO A;  4BYY A;  4QXK A;  2YYO A;  2RMU 3;  2VZQ A;  2ZX0 A;  1QF3 A;  2TEP A;  1SFY A;  3KF3 A;  3VL8 A;  5CFC A;  1JYI A;  3FJS A;  4XPV A;  4CU8 A;  1POQ A;  3S7E A;  1SQ4 A;  2ZMK A;  4BIS A;  4BB3 A;  5CKN A;  4BZ4 A;  3THD A;  3FLP A;  3OPW A;  3B69 A;  2C5D A;  3M1H A;  5I0U A;  1S0I A;  4LO7 A;  5KHH A;  4MAD A;  4IEU A;  2WLQ A;  3Q8C A;  5DAB A;  4PJY A;  3APB A;  1TEI A;  4MH0 E;  5FY4 A;  3ZFF C;  2AEY A;  3DN7 A;  1R1A 1;  1OT5 A;  3UK9 A;  1IS3 A;  2RMU 2;  2VPV A;  4ZXE A;  4CEY C;  5DUW A;  3WG1 A;  4UI9 L;  4KBB A;  2Y64 A;  1GBG A;  4P9G A;  4RSU A;  4TN7 A;  4OZO A;  1W2N A;  3NAP A;  3PLQ A;  2NN8 A;  2VMD A;  4OHX A;  1BMV 2;  2OS2 A;  4OZX A;  2BJS A;  4BIO A;  4JTO A;  4FT8 A;  1FPN 1;  2EA7 A;  1XYP A;  2B39 A;  2VO5 A;  1SG3 A;  3C7G A;  3HQU A;  2YC4 A;  1DGR A;  3NRU A;  1JOJ A;  3SKJ E;  3AJZ A;  1J3R A;  4XJ8 A;  1A78 A;  2JE8 A;  2XVL A;  4CSW A;  1Q56 A;  3M3E A;  3NNF A;  5FV3 A;  1N3Q A;  1NX9 A;  3WP3 A;  2TUN A;  4J1X A;  5DUV A;  4WBB A;  5FMC A;  1Y3T A;  4AAP A;  3Q8B A;  1VBE 1;  4UFH A;  5AFE A;  3VBR A;  1VBC 3;  1DIW A;  2A6Z A;  3GBG A;  4OUM A;  1ZRI A;  4XBN A;  2IXJ A;  3FBM A;  3KCX A;  1FNZ A;  4O7X A;  1O7F A;  2XJS A;  1W6M A;  4YVW C;  5IVE A;  3S0M A;  2JDA A;  1HB3 A;  4C0B A;  1PGW 2;  4ASL A;  1V9U 1;  4ZS3 A;  1LOC A;  5DDJ 1;  4AE2 A;  5F6L B;  3RJ2 X;  1RIR A;  4WM8 A;  1VRB A;  2WNV C;  4P5Y A;  1NCQ A;  2JDP A;  2A6W A;  2EF6 A;  3MI8 A;  2SLI A;  4YGD A;  3RMX A;  1VBC 2;  4CPB A;  2PAK A;  5L7O A;  3AFG A;  3DV8 A;  2RDR A;  2X10 A;  2BVV A;  3LKJ A;  2VQ0 A;  5H9S A;  4BDV B;  4FFF A;  1T6G C;  1DBN A;  1W8F A;  2BVB A;  1RTV A;  1AJK A;  2R49 A;  2XLF A;  3I59 B;  4S2D A;  5D8A B;  1BHG A;  3WF4 A;  4ET7 A;  1OUS A;  1YUD A;  1ND3 C;  3CZU A;  5FZ0 A;  4LK6 A;  3WZ1 A;  2PFW A;  1JYT A;  3ZDS A;  4DEV A;  5LZ6 A;  2ZAB A;  3LWC A;  4AED C;  5FCC A;  3AVR A;  4UWD A;  1B35 C;  2X5I C;  1HX6 A;  3IZO A;  4LE4 A;  3VN4 A;  1XNK A;  3A23 A;  2O0O A;  3ELN A;  1IPS A;  1ZZB A;  3IDE A;  3U4X A;  2BER A;  4JDM A;  4RGK A;  5TSW A;  1T2X A;  1D4M 3;  3JZV A;  4FPO B;  1TG7 A;  2UU8 A;  1W2O A;  4K20 A;  1F8V A;  4XET A;  5EYY A;  1YQ6 A;  5LRR A;  4LE3 A;  2WSV A;  3B3Q E;  3WY6 A;  1ZZ7 A;  1VIW B;  3RDI A;  1LOA A;  3AC0 A;  3FUQ A;  3V64 A;  4YWA A;  2YZ4 A;  3BU7 A;  1SLB A;  1D4M 2;  1W2T A;  3AP7 A;  4FPH A;  4LBQ D;  4LA3 A;  1WZX A;  2IXH A;  2YPJ A;  5F7U A;  3C3V A;  1O4Y A;  3RYR A;  3ZO0 B;  1KQR A;  3K4Z A;  3QAC A;  3GZU C;  3RJR A;  1GWK A;  2ARE A;  3AZZ A;  3PNA A;  2XON A;  4B29 A;  3DEC A;  4NPM A;  2GMM A;  4GUL A;  2RR1 3;  2DUQ A;  5FPL A;  4EWE A;  4CE8 A;  1WBL A;  2J42 A;  1J58 A;  3PVO A;  3UKN A;  3OSD A;  3HBZ A;  4JHZ A;  3ZVX A;  1GQH A;  4KGG A;  4E8C A;  1RMU 3;  4CCD A;  4YVS B;  4AVB A;  1TME 3;  2BFU S;  1ZRF A;  3I3D A;  4GMP 0;  2XG3 A;  1S0G A;  5K0U A;  2WR9 A;  3A7Q A;  3MFA A;  2ORX A;  2D5H A;  3ZKU A;  4CDU A;  4H55 A;  2R04 1;  1WMX A;  1WD3 A;  4NWW A;  5L19 A;  2RR1 2;  2FBE A;  1GZW B;  1W06 A;  4IXL A;  2FDI A;  1JTZ X;  2J1V A;  4FOQ A;  5T3N A;  5FO9 B;  1WCQ A;  2VUL A;  1ACC A;  2GH2 A;  1ONA A;  1GP6 A;  1PO2 3;  1QJU 3;  4IEQ A;  4UW3 A;  1RMU 2;  3GXU A;  3OY8 B;  1TME 2;  1ULD A;  3JXS A;  4EJR A;  1AR6 1;  2VZS A;  5BPX A;  1W05 A;  3WD5 A;  1QH6 A;  2F6B A;  4JHT A;  3B9I A;  1CX4 A;  5IAX A;  5T50 A;  3TEW A;  2BQP A;  3HNY M;  4QPG B;  4FPF A;  2GNB A;  3O0W A;  3H0O A;  2AC1 A;  4OMC A;  5AVP A;  4HL0 A;  4XFI A;  5FUN A;  2P6H A;  4ORF A;  1WBF A;  5FXZ A;  1PO2 2;  1QJU 2;  5GZC A;  3EXU A;  1F5F A;  2WO1 A;  5IVY A;  3P3N A;  2JDZ A;  3PIG A;  1OFS A;  1AZD A;  3OBZ A;  5GLZ A;  5A70 A;  4BQW A;  2B7Y A;  2WT1 A;  1CGP A;  3RI8 A;  1RUH 1;  4QGL A;  5FLH A;  3IIA A;  1NLQ A;  3MLL A;  4ISQ A;  1BYH A;  4WZF A;  5DAQ A;  1OQD A;  3ATG A;  5C7G A;  5IK8 A;  1YCI A;  1KRI A;  5LEJ A;  1UF2 C;  1U5Y A;  4DRV A;  1C8M 3;  2HWE 3;  3PU8 A;  4UFJ A;  4P02 B;  2R30 A;  4Z1V A;  1K5M B;  3BIW E;  3VKM A;  2WS9 1;  1DGL A;  2QFE A;  2EAK A;  3D6E A;  3N7J A;  5FP8 A;  1ULO A;  4M4P A;  4AI3 A;  3BIE A;  2Y0O A;  1SLL A;  5JVV A;  5IW0 A;  4CTE A;  2LRO A;  1GZ9 A;  2YDE A;  1CJD A;  1S2K A;  1KFU L;  3H3U A;  2SBA A;  1GOG A;  4YW4 A;  1DQ0 A;  5G05 L;  1JBC A;  5JR7 B;  3IM0 A;  3ZPO A;  5HCH A;  1UZW A;  1HXS 1;  3ZYH A;  1MPX A;  1NLR A;  2P37 A;  4J25 A;  2HWF 3;  1W3X A;  1RUO A;  1OLM A;  4K7J A;  1SCR A;  4AL9 A;  1NE4 A;  1PK6 B;  4BXS V;  1RUC 2;  2C9K A;  3LOB A;  1YQ2 A;  5T5L A;  1W6Q A;  2RJL A;  4MV2 A;  2XKO A;  1MS5 A;  3SKV A;  3FLR A;  1WCS A;  1KJL A;  1ASJ 2;  2LS6 A;  2Q1F A;  3GBF A;  4GKX A;  1EAH 3;  3ZYI B;  1CPN A;  3VDC A;  3NV4 A;  3N9P A;  3WQB A;  4LOR A;  1CON A;  1LEM A;  4IQP A;  3O1O A;  3I2K A;  4X6R B;  3CJI B;  4EZH A;  2JB8 A;  2HWF 2;  2V4A A;  2ZEZ A;  3WW3 A;  1POV 0;  1XE0 A;  1HRV 3;  2E7T A;  2FZ1 A;  4FQZ A;  4UW5 A;  1VBA 3;  5GZD A;  1CAW A;  4LPL A;  1JU4 A;  2Q30 A;  4LHN A;  4N53 A;  4DXS A;  3UJO A;  3AYD A;  1JZ4 A;  1DCS A;  2H6B A;  4CP9 A;  5IUQ A;  2GP3 A;  1SBE A;  4ES8 A;  1C1F A;  1EAH 2;  3B94 A;  3S57 A;  3NJX A;  1IZ3 A;  2XL7 A;  1SLC A;  4M3C A;  4DFS A;  3D4K A;  3R4S A;  3PME A;  3SH5 A;  1DF0 A;  5FOB B;  4CUB A;  3I8T A;  1HRV 2;  3ZMN A;  3RWK X;  1RVF 3;  1KIT A;  1VBA 2;  1UYX A;  3FZ3 A;  4BME A;  3ACF A;  3IDC B;  4BWO A;  4EV0 A;  3VDA A;  5DUU A;  4C91 A;  3KV9 A;  3MUY 1;  1HW5 A;  2GAU A;  4AVT A;  3LA3 A;  1ULG A;  1JZ5 A;  4A41 A;  1XNB A;  4IE5 A;  1YI9 A;  4WV8 A;  2P4E A;  1O8P A;  1FV3 A;  1L7Q A;  3KS7 A;  2CGO A;  4AEJ A;  2XUE A;  1WW4 A;  3O0V A;  4BQ3 A;  3VHN A;  1YWK A;  1RVF 2;  5BV6 A;  4COZ A;  4NHX A;  1W99 A;  3HAG A;  3ZLI A;  4YLZ A;  2VXR A;  4Q8K A;  2RDQ A;  3WP6 A;  4E4D X;  1YNA A;  1PZ7 A;  3IKW A;  5E88 A;  3ACG A;  5BNQ A;  1EUT A;  4FP2 A;  2J7M A;  1OPM A;  2JE9 A;  5AC9 3;  4LO5 B;  4QPG C;  1CAV A;  1AX1 A;  5FP9 A;  1NOV A;  5E16 A;  1H30 A;  1GYK A;  4D69 A;  4S2G A;  5JOY A;  4F7Z A;  2VOT A;  4ZU4 A;  2ETE A;  3GM8 A;  4YFW A;  2CGN A;  3CLP A;  2QE3 A;  4UF0 B;  2QVS B;  2FCU A;  5E8A A;  4HT1 T;  3IB3 A;  1JS9 A;  4GD4 A;  5AC9 2;  2VMG A;  5EPA A;  2OUH A;  1MS8 A;  3FHI B;  3ZFG A;  3M8L A;  4D3W A;  2VG9 A;  4XXA A;  3CU7 A;  2A3W A;  4JTN A;  5APA A;  1JUI A;  1VBB 2;  4UAP A;  2IFR A;  3P3P A;  4HON A;  1MVQ A;  3A22 A;  1PVC 3;  5F3I A;  2R32 A;  3UGF A;  1AL2 3;  4TYS A;  1Z7S 1;  1LGC A;  5FWE A;  3VBU B;  1F9K A;  2VQA A;  4RD7 A;  2WZP P;  1XSQ A;  2WO7 A;  5FYI A;  5FZG A;  3IPV A;  2I74 A;  1X9T A;  3FMG A;  3MPB A;  4IV3 C;  4LBJ A;  3SHR A;  1CX1 A;  2PLV 3;  3C7H A;  4QPI B;  4RHV 3;  3PTY A;  1AR9 3;  2OQ6 A;  3AL6 A;  1E5I A;  4AQS A;  4K21 A;  4QX7 A;  3NJZ A;  5FK7 A;  4CA9 A;  1O59 A;  3OEA A;  4B3N A;  1CAX B;  4Y1Y A;  1PVC 2;  2VMF A;  4WM7 A;  5A3W A;  3VBS A;  2E63 A;  1AL2 2;  2QBX A;  4IEX A;  4QU1 A;  4CPB D;  1H2M A;  4AR2 A;  4Q4X 1;  2DTY A;  1Q8P A;  1ZZC A;  4FI9 A;  1ZBE 2;  5A7Q A;  4IV1 C;  2QCS B;  3NKT A;  3OF1 A;  5D1I A;  2PLV 2;  3KT1 A;  1AX2 A;  4RHV 2;  5GLU A;  4Q0P A;  1W2U A;  1AR9 2;  4JGY B;  1KEX A;  4MG2 A;  1NY7 2;  3UKT A;  1TE1 B;  1POV 3;  2CWM A;  2VTX J;  4YZ2 A;  1MZ6 A;  4GWI A;  3CJI C;  2XQX A;  3POY A;  3ZXF A;  5DMY A;  2E32 A;  1TMF 3;  4FVV A;  1MQT C;  1W28 A;  2FDF A;  2ES3 A;  3FN9 A;  3SXW A;  3ZFF A;  1PGW 1;  1ZA7 A;  3O1S A;  4HG6 B;  2FZ2 A;  3ZOI A;  4CEY A;  1GLH A;  5JSR A;  2O1Q A;  1C1L A;  3POB A;  1N1V A;  1W6N A;  5HI0 A;  1JMU B;  2RDN A;  4YG3 A;  5JMC A;  2E7A A;  2DF7 A;  1REE A;  3VL9 A;  1IQA A;  5LW9 A;  2Z79 A;  2W92 A;  1UWW A;  4HPK B;  1UKR A;  4KWJ A;  5GJ6 A;  3WNM A;  5KBF A;  1UU6 A;  1PGL 2;  2ZAH A;  4NOT A;  2AYH A;  2C0Z A;  1TMF 2;  1JOP A;  3P1I A;  4NWV A;  4XHB A;  3USU A;  1UX6 A;  5BNN B;  1NA1 B;  1MR5 A;  1AXK A;  2OVU A;  1LKN A;  4C1X A;  4L2N A;  3MYX A;  4P00 B;  4DUW A;  5BNP B;  1ZRR A;  4U36 A;  3WG4 A;  3MID A;  4Y1V A;  2FDK A;  2A3Y A;  2Q4S A;  5IVF A;  3ZXE A;  3LGR A;  2BYV E;  1FYU A;  1QU0 A;  2WFP A;  5A6Y A;  4LBN A;  5ACA 2;  5K7P A;  3I49 A;  1VPH A;  2Z5W A;  3BOD A;  4ISR A;  1FX5 A;  4OLL A;  5E89 A;  4YVW A;  1AHS A;  4GB3 3;  4HSL A;  1EP0 A;  1HN1 A;  1AUY A;  4PIZ A;  1U5I A;  4Z2W A;  3AXD A;  3ZXK A;  1GSL A;  2LM3 A;  1PIV 3;  2HWC 3;  4V2W A;  4Y5S A;  4CCE A;  4AGG A;  4ASM B;  3J7M A;  1EV1 1;  2WNV A;  1K42 A;  3PL0 A;  1NZI A;  3K77 A;  3VGI A;  5EJ3 A;  5JZG B;  4H7L A;  2H0V A;  2ADD A;  3W5M A;  3N9O A;  4FPL A;  3THP A;  1UMZ A;  4LBQ A;  5LK5 A;  2DFB A;  2WAO A;  2VZP A;  3FC0 A;  1QEX A;  2AEN A;  3AYC A;  4Q4V 1;  4AI8 A;  4QX1 A;  1H1A A;  1D4M 1;  2W47 A;  3RQ0 A;  3B5L B;  5IK7 A;  1PIV 2;  2HWC 2;  1ND3 A;  2X8K A;  3MUZ 1;  4UFI A;  1N3P A;  3D5O A;  1W9F A;  1WLT A;  5FDB A;  5GLV A;  5FWJ A;  1Q3E A;  4AED A;  5LCW L;  3WF1 A;  2Y6K A;  1B35 A;  2X5I A;  5FYM A;  2AR6 A;  2WUH A;  1O4Z A;  1X50 A;  2WNU C;  2H0B A;  4GWJ A;  4HET A;  3WP4 A;  3ZYF A;  4Z8B A;  2RV9 A;  2ZGS A;  1WW6 A;  3EMR A;  2VAU A;  4OFG A;  3T08 A;  4ATE A;  5KC5 A;  1XC6 A;  3KLS A;  4CDX B;  1X36 A;  4NHM A;  3G7D A;  4A7Z A;  2O14 A;  1RJ7 A;  3WHT A;  1SLT A;  1IOA A;  3QH7 A;  3VHP A;  3KM5 A;  1F4H A;  3W58 A;  2D44 A;  4AF9 A;  2CV6 A;  4YZ1 A;  4QPI C;  1DYO A;  4D6Q A;  1Q8S A;  3POW A;  1I1E A;  5JPM B;  1RXF A;  3H3L A;  3AP9 A;  5JXG A;  2B46 X;  4TTG A;  4IEV A;  1G8W A;  4XAB A;  2LRP A;  1RUF 3;  2OT7 A;  1WWY A;  3AZW A;  2ZKL A;  4W65 A;  3JCI A;  4FFG A;  2HWD 3;  4Y4R A;  1O3T A;  4Q1P A;  1YXW A;  1TME 1;  3PDQ A;  5D2A A;  3D3A A;  1HKD A;  3BAL A;  1MS1 A;  2YY1 A;  3KSC A;  1I3H A;  3LFM A;  1LHN A;  2D93 A;  5J98 B;  5KC6 A;  4QHB A;  1A8M A;  1C8N A;  1RUG 3;  3BTA A;  3HQX A;  3L2Y A;  3DYM A;  4MET A;  1JW6 A;  4JGY C;  4R9B A;  4XVH A;  3ZYR A;  5JSP A;  3ZXG A;  4MHR A;  4XYX A;  3OYW B;  4KG0 A;  2HWD 2;  4QXB A;  1A8D A;  1QQP 3;  1PMI A;  2E51 A;  2HWB 3;  5ABJ C;  5HPO A;  3KZ4 C;  4CZS A;  5HBA A;  1E5H A;  2BNN A;  5EP9 A;  4KWK A;  2CAU A;  4Y33 A;  2XXZ A;  5LAS A;  4B1L A;  1UZY A;  2RJK A;  3KCC A;  4BIF A;  5CA6 A;  3AZV A;  3AK0 A;  3C8X A;  1RUG 2;  2VZV A;  2VTX A;  1XU2 A;  2RE9 A;  2WBK A;  3RYK A;  2ARC A;  3ITQ A;  1CIY A;  4QKB A;  3H7J A;  3DYP A;  4OUE A;  3THC A;  5BUV A;  2WFF 3;  4KU8 A;  1JHJ A;  5JLV A;  1QQP 2;  4XXP A;  2HWB 2;  4OI0 A;  4CDW B;  1UOG A;  3OOX A;  3KV6 A;  2CHH A;  2WAA A;  1G9A A;  3JBG 1;  3VKO A;  3SLI A;  1V6M A;  1LOG A;  1QJE A;  3L2H A;  4L97 A;  3S5Q A;  5BNN C;  2VY0 A;  1NA1 C;  1J1T A;  3B01 A;  1CZS A;  5G04 L;  5FZH A;  5ISL A;  1BKZ A;  2AUY A;  4E2Q A;  2XML A;  3PTR B;  3QH6 A;  4OI1 A;  2QQN A;  3RS6 A;  3J26 N;  1W9T A;  2WFF 2;  4Y20 A;  4AI1 A;  4KG8 A;  2ZML A;  2W1S A;  4LO8 A;  2VOX A;  3IDA A;  1RUC 1;  2VVD A;  4FO9 A;  3O1U A;  4MGT A;  5KXB A;  4W8J A;  3B02 A;  1HB4 A;  4NJ4 A;  3VHR A;  2W39 A;  2VW0 A;  1ASJ 1;  3WF3 A;  4XFH A;  2XL9 A;  1VP6 A;  5A32 B;  1XNC A;  4HMZ A;  3WDX A;  3KQR A;  1YYN A;  3NO8 A;  4MOA A;  4XZU G;  3RMY A;  4Z2A A;  3A0N A;  5IVJ A;  3M3I A;  1HDK A;  2JEC A;  2JDH A;  4ONU A;  4UFK A;  3VBH C;  4QB2 A;  4BQX A;  2VMC A;  2YB7 A;  4NE9 A;  3VDB A;  1SHW B;  1A34 A;  3H7Y A;  1XND A;  4A42 A;  3RZH A;  1EY2 A;  1QNY A;  2D6N A;  3H1Y A;  4NHL A;  1J83 A;  3T09 A;  1EAH 1;  2A6Y A;  1WMD A;  4NAM A;  3GJA A;  4HVQ A;  2EXK A;  1DGW A;  1QOT A;  2DCZ A;  2V4V A;  2OYZ A;  3ME2 A;  3WOG A;  1MZ5 A;  1VBA 1;  4IEY A;  1NCR B;  2PHF A;  2PHR A;  4PDW B;  5FY0 A;  3IMM A;  3GZA A;  4LUM A;  3B93 A;  2W9X A;  4BK4 A;  2GN3 A;  5HCB A;  1ND2 C;  3PVB B;  3KVA A;  4WZC A;  1RIN A;  4DIQ A;  1DFQ A;  3V0A B;  1VAV A;  1JN2 P;  4DRR A;  5BNO C;  3LDR A;  3PMS A;  3LEM A;  3WQ7 A;  2EIC A;  2HH9 A;  1AVB A;  2VME A;  1OC1 A;  4XQD A;  5EQU A;  2ZEY A;  1LEN A;  3AFK A;  4XTM A;  4MO3 M;  2G4I A;  4CCL A;  1OKO A;  2DTW A;  1RUJ 3;  4QU2 A;  1RGS A;  4TZD A;  4DQA A;  5GZE A;  3T4H B;  2YUE A;  3JUU A;  1LHO A;  1UU5 A;  2R0F A;  5F3C A;  1IGO A;  4ZON A;  1S55 A;  3ZXJ A;  2OW4 A;  2VW2 A;  3FLT A;  3LDB A;  3ZR5 A;  1Y43 B;  1RUE 3;  3K4A A;  2Y6L A;  3MW4 A; 
#chains in the Genus database with same CATH homology
 1JYN A;  3ACH A;  1UY4 A;  4JHZ A;  4KWU A;  4E8C A;  4DEQ A;  2VZU A;  4IUG A;  3GGL A;  2J1T A;  3MV0 1;  2EID A;  3I3D A;  2Y6J A;  3T2O A;  3OG2 A;  3A7Q A;  1W8O A;  2ORX A;  2VCB A;  5JXH A;  1NAE A;  5IHR A;  1GQP A;  2J1R A;  2X05 A;  2J1V A;  3IAP A;  3HNB M;  1WCQ A;  1JZ2 A;  3PUI A;  3EB7 A;  3GXU A;  3LPF A;  2QQK A;  3HJR A;  2QQO A;  3JXS A;  2VZS A;  2W5F A;  3I2I A;  3HNY M;  1GMM A;  3MV1 1;  3I3B A;  2RJ2 A;  1UMH A;  1NKG A;  1JZ6 A;  4OMC A;  3WF0 A;  2WO1 A;  2E31 A;  2VQU A;  3T0B A;  3FL7 A;  1JI6 A;  5I0D A;  1UMI A;  4BK5 A;  1GOF A;  5IJR A;  2W46 A;  2QQL A;  5C7G A;  2VZ3 A;  1W9W A;  4P02 B;  2JKX A;  4GZ9 A;  2ORZ A;  3HPN A;  2W87 A;  1ULO A;  4M4P A;  1JYW A;  2L9L A;  3C7F A;  4A45 A;  3I2G A;  1R64 A;  2WZ8 A;  4JX0 A;  2E26 A;  3C7E A;  2VM9 A;  1GOG A;  5G05 L;  4OYU A;  3W5N A;  2J1A A;  2J22 A;  3CKH A;  1MPX A;  3A21 A;  3CDZ B;  1RYY A;  2BZD A;  4BXS V;  2C9K A;  4CU7 A;  1YQ2 A;  4AG4 A;  3SEP A;  2CDP A;  3SKV A;  2LS6 A;  4D8M A;  4PQQ A;  4LKS A;  2YG0 A;  3I97 A;  3VDC A;  3WQB A;  2WO2 A;  3I2K A;  3PUH A;  1JYX A;  2ZEZ A;  5CYY A;  4LPL A;  1JU4 A;  3C7O A;  4DXS A;  1JZ4 A;  2W94 A;  4YPJ A;  1IQD C;  2RVA A;  2Y6H A;  5JXJ A;  3NJX A;  5HXM A;  4MGQ A;  4CUB A;  1UYX A;  4W50 A;  3ACF A;  4XUN A;  1F4A A;  3CIH A;  3F2Z A;  3VDA A;  2J1U A;  5EIY B;  1JZ8 A;  3MUY 1;  2EIE A;  4W4Z A;  1JZ5 A;  2QQJ A;  4A41 A;  3MO4 A;  2VZ1 A;  1O8P A;  1DLC A;  1L7Q A;  3OGR A;  1H6Y A;  1UY0 A;  1WKY A;  2WN2 A;  4QX3 A;  4M4R A;  4ZZ8 A;  2W91 A;  2C26 A;  4QX2 A;  2BGP A;  1W99 A;  2VZT A;  5C70 A;  3VD7 A;  5B4X A;  1PMH X;  5FUI A;  4ZY9 A;  3ACG A;  4D0Q A;  1EUT A;  2J7M A;  3OGS A;  3I2J A;  1JZ3 A;  5EJ1 B;  4JKM A;  1CZT A;  1PMJ X;  3ECQ A;  3P6B A;  4LQR A;  4JKK A;  3GDB A;  1D7P M;  2VOT A;  3GM8 A;  3IB3 A;  4XUT A;  3LEK A;  1XPW A;  2LW8 A;  2V5D A;  5JXI A;  4DUX A;  4QDS A;  5DPN A;  3WEZ A;  3BGA A;  2VTF A;  4UAP A;  4ARX A;  3A22 A;  4A4A A;  3J7H A;  1W0N A;  3CQO A;  1J84 A;  2KD7 A;  4AAX A;  3K4D A;  1CX1 A;  4QAW A;  3C7H A;  2W95 A;  1PX3 A;  2ZEX A;  1ULP A;  1GUI A;  3I2H A;  1JZ7 A;  3NNG A;  1O59 A;  3I3E A;  3OEA A;  1K3I A;  2VMF A;  2QBX A;  2YC2 A;  3WSO A;  3E1F 1;  4XUQ A;  4FI9 A;  4A6O A;  1US2 A;  2B9V A;  3LPG A;  4ZZ5 A;  2DCJ A;  4QDQ A;  4CU6 A;  1KEX A;  5IYY A;  2W3J A;  3T2P A;  4GWI A;  3ZM8 A;  3WNN A;  3HN3 A;  2XQX A;  5DMY A;  2HYX A;  4BJ0 A;  2E32 A;  3K75 B;  3IAQ A;  3FN9 A;  2Y8K A;  3HOB A;  1US3 A;  1XNT A;  3I2F A;  4HG6 B;  2B4K A;  1K12 A;  2QQI A;  5JR2 A;  3HNM A;  3LQC A;  5LA2 A;  3UES A;  3ETP A;  2VQT A;  1L7R A;  3EYP A;  5CZK A;  2VZR A;  4KMQ A;  1W8N A;  2W92 A;  4A3Z A;  1UWW A;  4A44 A;  1K45 A;  5J1X A;  3WNM A;  2ID4 A;  3K46 A;  3P1I A;  2OKX A;  2W1U A;  2E33 A;  2VR4 A;  3MBW A;  5C71 A;  4DUW A;  4P00 B;  2VL4 A;  2VCC A;  3ABZ A;  3LE0 A;  3OGV A;  1UXZ A;  4RYD A;  2ZEW A;  1W9S A;  4TXW A;  1LNS A;  4QPW A;  2XHN A;  3VD5 A;  4DXR A;  4L0P A;  2WDB A;  5B4N A;  2X09 A;  1HN1 A;  1UX7 A;  1PX4 A;  3BN6 A;  2ZXQ A;  1K42 A;  3K77 A;  1UXX X;  4QDR A;  1OH4 A;  2DDU A;  3LEI A;  3W5M A;  2WAO A;  2VZP A;  4CUC A;  2W1W A;  1GNY A;  2V72 A;  4QX1 A;  3T0D A;  2QQM A;  2W1Q A;  1H6X A;  2W47 A;  5EJZ B;  2YFZ A;  3VD3 A;  3VD4 A;  3MUZ 1;  2DCK A;  3FHA A;  5LCW L;  3WF1 A;  1OD3 A;  4PT6 A;  2Y6K A;  2WUH A;  2Z4F A;  4GWJ A;  2RV9 A;  3T08 A;  2J1S A;  1XC6 A;  1DP0 A;  3UET A;  2VJX A;  3VD9 A;  3SEE A;  1F4H A;  4P08 A;  1DYO A;  3T2Q A;  4CUA A;  3HEI A;  5JMO A;  3WNP A;  3WNO A;  5JXG A;  2WYS A;  4TTG A;  1JU3 A;  3NJV A;  4DXT A;  3WF2 A;  2WZE A;  2BGO A;  3D3A A;  2VZQ A;  2J1E A;  4E8D A;  2R7E B;  4PF1 A;  4CU8 A;  1TVG A;  3K4A A;  4XUP A;  3THD A;  1OF4 A;  3DYM A;  4XVH A;  1I5P A;  4MAD A;  2VC9 A;  5HPO A;  4CVU A;  2EIB A;  1XNA A;  1OT5 A;  2WAB A;  4ZXE A;  4UI9 L;  4MGS A;  2Y64 A;  4OZO A;  2VMD A;  4JKL A;  3C8X A;  2VZV A;  1UY1 A;  2WBK A;  3OEB A;  1JYV A;  1CIY A;  2VO5 A;  3DYP A;  2C4X A;  4OUE A;  3THC A;  1SG3 A;  1O8S A;  1JHJ A;  5LA0 A;  3C7G A;  2YC4 A;  3WNL A;  1UYZ A;  3NRU A;  2WAA A;  3SKJ E;  3T0A A;  2JE8 A;  2YFU A;  1NX9 A;  1CZS A;  5G04 L;  2WN3 A;  5IFP A;  2QQN A;  4XUR A;  1W9T A;  3FHQ A;  2W1S A;  3III A;  2JDA A;  3IDA A;  4W8J A;  2Y6G A;  5LA1 A;  1P8J A;  3OB8 A;  4QX0 A;  4XUO A;  3ACI A;  4P5Y A;  3WF3 A;  2WO3 A;  1CZV A;  4LHS A;  2VZO A;  4MOA A;  2X10 A;  4XZU G;  3CMG A;  4Z2A A;  4RN5 A;  4BDV B;  4QB2 A;  4DUV A;  2VMC A;  2YB7 A;  3VDB A;  1SHW B;  4ET7 A;  3LEG A;  1BHG A;  4KI5 M;  3WF4 A;  3CZU A;  1GOH A;  4A42 A;  1GU3 A;  3CZJ A;  1NUK A;  4DEV A;  1SDD B;  1J83 A;  3T09 A;  4QB1 A;  3DYO A;  2PQS A;  1OF3 A;  1UYY A;  3A23 A;  4UOJ A;  2V4V A;  2JD9 A;  4CU9 A;  5DQ0 A;  2BER A;  3OBA A;  2VCA A;  1T2X A;  5DN2 A;  5IFT A;  4ARY A;  2W9X A;  4BK4 A;  1KGY A;  1TG7 A;  2BBA A;  2HLE A;  1UY2 A;  1EUU A;  1UZ0 A;  4OMD A;  2CDO A;  2EIC A;  3NQH A;  2VME A;  3WNK A;  2ZEY A;  2WQ8 A;  3AC0 A;  4QB6 A;  4MO3 M;  3U37 A;  2XOM A;  5JUV A;  5F7U A;  1UY3 A;  5A1A A;  3K4Z A;  3UNP A;  2XON A;  3DEC A;  2Y6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...