3CKHA

Crystal structure of eph a4 receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
170
Chain Sequence
b'NEVTLLDSRSVQGELGWIASPLEGGWEEVSIDEKNIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Crystal Structure and NMR Binding Reveal That Two Small Molecule Antagonists Target the High Affinity Ephrin-binding Channel of the EphA4 Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ckhA00
4CUCA 1CZTA 3P6BA 3CDZB 1SDDB 3FN9A 1I5PA 2VO5A 3I3DA 1F4HA 4MGSA 4QX1A 2E32A 4DUWA 1JZ8A 3HNMA 4MGQA 2YC4A 2WABA 4CU9A 1US2A 5EIYB 3OG2A 4OMCA 2Y6KA 3OB8A 2VJXA 5LA2A 5DMYA 4LPLA 4P02B 3I2GA 2ID4A 2YFZA 1UXXX 4JHZA 2DCKA 4XUNA 3HJRA 2WAOA 1SHWB 3VD4A 1OF4A 1OT5A 2VZVA 2Y8KA 4PQQA 3OGVA 3WEZA 4OMDA 1UYXA 3T2PA 1DP0A 4QAWA 4HG6B 3GXUA 2WUHA 3K75B 5JMOA 4E8DA 3VDAA 2CDOA 2J1UA 2EIEA 3WNPA 1JZ7A 2QQOA 4IUGA 4M4PA 3SKJE 4P00B 3IDAA 3WNMA 5G04L 3NRUA 4M4RA 2Y6HA 3OBAA 4A3ZA 4AG4A 1XC6A 1K42A 5JR2A 5JXHA 2W87A 3THCA 2J1AA 4KWUA 4CU6A 4QPWA 4LHSA 4CU8A 4BJ0A 3ACFA 3LPFA 2J1EA 2W46A 2J22A 2VCCA 4RN5A 2EICA 3MBWA 4ZY9A 4A41A 5I0DA 3SEPA 2VM9A 3VDBA 4XUOA 4ZZ5A 4CVUA 1TVGA 2VZOA 3T0AA 4XURA 3MO4A 3IIIA 1NAEA 1JYNA 2PQSA 1XNAA 3UETA 3PUHA 3T0BA 3EB7A 2YC2A 1UY4A 1ULOA 4JKLA 3HOBA 4OZOA 1JZ4A 2WN2A 1YQ2A 4Z2AA 2WBKA 3NQHA 1W0NA 1DYOA 2QQJA 4QB2A 2VQTA 3T2QA 1NX9A 1L7QA 1UY0A 3ETPA 2Y6GA 3LEIA 5HXMA 1JU3A 1RYYA 3WNNA 4TXWA 1KEXA 3WSOA 1JZ3A 1BHGA 4XZUG 2VMEA 4D8MA 3OGSA 2W5FA 1JU4A 3ABZA 1KGYA 2V4VA 1GOHA 3VD7A 4BK4A 4BK5A 2WAAA 4QDRA 2C9KA 4A42A 3EYPA 2R7EB 3C7HA 3NNGA 4GZ9A 5IYYA 3J7HA 5JXGA 3AC0A 3I2FA 3FL7A 3CIHA 2Y6LA 2LW8A 2W1WA 3IAQA 2VTFA 3C7FA 1CIYA 1NKGA 1WCQA 3ECQA 2L9LA 5LA0A 1UX7A 5C70A 2VZRA 3A21A 3MV01 3I2HA 1WKYA 3K46A 4ARYA 3WNOA 3T08A 1D7PM 2WQ8A 1GOFA 1CZSA 5C71A 3HNBM 1R64A 1JYVA 3OEBA 5JXJA 3K4ZA 2J1TA 3LEKA 3I3EA 1JYWA 2WZEA 2J1VA 2W91A 4DEVA 2EIDA 1UXZA 4JX0A 1GQPA 3FHQA 2B9VA 3LE0A 1UY3A 3CMGA 5IHRA 3GGLA 4QX0A 5LCWL 3VDCA 2YFUA 2EIBA 3C8XA 3W5MA 4QDQA 1IQDC 1L7RA 2E33A 1PX3A 2QQIA 3WF3A 3T09A 2JKXA 3C7OA 4BXSV 3FHAA 1UYYA 2Y6JA 4QX2A 5EJZB 4PF1A 4CUAA 4DEQA 3DYOA 1UY1A 3DECA 1F4AA 4MADA 4P5YA 2X09A 1SG3A 1US3A 1CX1A 4QX3A 1O8SA 4GWJA 3IAPA 4FI9A 4W4ZA 5IFTA 4ET7A 3NJVA 4QB1A 2VZ3A 2KD7A 2QBXA 1PMJX 2BERA 3E1F1 3C7GA 1HN1A 3WF0A 4MO3M 2BGPA 3VD9A 2VOTA 2VL4A 2XQXA 1OF3A 2XONA 5LA1A 3K4AA 4GWIA 1W8NA 2VZQA 2W95A 2ZEWA 2VQUA 2E31A 4YPJA 1PMHX 2OKXA 2WZ8A 1XNTA 3I97A 3MUZ1 2VMFA 2CDPA 1EUTA 3BN6A 3WQBA 5FUIA 2VR4A 3MUY1 3ACIA 2RJ2A 1ULPA 1JI6A 4XVHA 4E8CA 2WYSA 2DDUA 3A7QA 1GU3A 4DXRA 3HN3A 1UY2A 1JZ6A 2VZTA 3HPNA 2VCAA 4P08A 4TTGA 4JKKA 3LPGA 3HNYM 2HYXA 3A22A 2RVAA 2BGOA 2J7MA 3DYMA 2W1UA 1W9SA 2VZSA 3OEAA 2QQNA 2W94A 2VMDA 3ACHA 3I2KA 2ORXA 2VMCA 4LQRA 2VZUA 3BGAA 3K77A 2QQKA 2JE8A 2VC9A 4L0PA 4DUVA 4CU7A 4BDVB 2BZDA 4A44A 1DLCA 3HEIA 4DUXA 5CZKA 4ZXEA 3WF2A 2WO3A 4RYDA 5A1AA 3DYPA 1GMMA 2ORZA 2JD9A 3CZUA 4A45A 4D0QA 3LEGA 2W3JA 2X05A 2VZPA 4W50A 1JZ5A 1UYZA 1UWWA 3IB3A 2W92A 2ZEXA 4ZZ8A 3WF4A 3F2ZA 1EUUA 4QB6A 3D3AA 4UAPA 2ZEZA 1H6YA 3I2IA 2Y64A 2WO2A 2VCBA 4A4AA 1T2XA 3WF1A 1W9TA 2XHNA 5HPOA 4KI5M 1GUIA 2QQLA 2WO1A 4JKMA 3CKHA 1K3IA 2QQMA 2WDBA 5EJ1B 3K4DA 1W9WA 2E26A 2YG0A 1JYXA 4LKSA 3CQOA 5DN2A 4UOJA 2J1RA 3LQCA 1TG7A 5DQ0A 1J83A 4OYUA 2V5DA 3MV11 1MPXA 5B4XA 2X10A 3THDA 2ZXQA 5CYYA 3I2JA 2LS6A 4ARXA 3SKVA 5C7GA 3ACGA 5JUVA 4A6OA 1OH4A 4MOAA 5G05L 3WNLA 4W8JA 1W8OA 1K12A 3WNKA 3P1IA 2JDAA 5B4NA 3CZJA 2BBAA 4DXTA 5IFPA 1J84A 3U37A 1JHJA 3GDBA 2C4XA 3W5NA 2C26A 1W99A 2XOMA 1GNYA 3T0DA 1XPWA 2HLEA 3UESA 3VD3A 5DPNA 2J1SA 2RV9A 1GOGA 3ZM8A 3NJXA 4XUPA 1UMHA 2WN3A 1CZVA 3I3BA 4KMQA 1O59A 4XUTA 2W9XA 5J1XA 4XUQA 1K45A 3UNPA 4OUEA 4DXSA 1P8JA 1LNSA 1NUKA 2V72A 5JXIA 2ZEYA 1JZ2A 1UMIA 4UI9L 2W1SA 2W1QA 2YB7A 4PT6A 2W47A 3OGRA 2VZ1A 4CUBA 5IJRA 4QDSA 3SEEA 1PX4A 1UZ0A 3JXSA 2Z4FA 3C7EA 4AAXA 3T2OA 3A23A 5F7UA 1H6XA 3GM8A 2B4KA 2DCJA 3PUIA 1O8PA 1OD3A 3VD5A
chains in the Genus database with same CATH superfamily
3MW4A 2KM2A 3JD73 4XBQA 1YNAA 1REFA 3ROUA 2PFWA 3WW2A 1LOEA 1ZZ7A 4COVA 1JZ8A 3R4UA 2P4EA 2EA7A 5DZEA 3MLLA 5FZ4A 2HWC2 2Y0IA 1S4CA 2D3PA 3I2DA 4LBNA 3EQEA 4RQPB 1VAVA 3OJBA 4DQAA 1US2A 5EIYB 2KA3A 1FV2A 2QZ3A 3GCXA 2Y6KA 5C9AB 1F8VA 5B2GB 5L7OB 2WNOA 3RZHA 2VU9A 1NE6A 4LPLA 5JR7B 2NM1A 5FYYA 3GCWA 3I2GA 3KCCA 5A7NA 1H1AA 1RUH1 1DQ0A 3LA2A 1UXXX 1EPZA 1IG3A 1DYKA 1WMEA 4XUNA 1A78A 2GNMA 2FDFA 1WMXA 2E7AA 5C3OA 2R0FA 3PVBB 2RMU1 2E6VA 3DEMA 2GALA 4YRDA 3WEZA 1BEV1 1SDWA 1RUI2 3POJA 3RVHA 1DP0A 4AK3A 5LRRA 2A71A 5DDJ3 4ZU4A 4D94A 2DWRA 3VL9A 2QQUA 5GM0A 4CXWA 4E8DA 3CU7A 3VDAA 4FPHA 2MEV2 4UW4A 2CDOA 1LODA 4Q4X3 2J1UA 2R062 1FYUA 3J7LA 1EAH1 2VQ0A 3U0ZA 1Q8OA 4LITA 4BMBA 2A7AA 3WW4A 1GNZA 4AQTA 1OOPC 1VBD1 4L2NA 2P17A 1G8WA 3ZKUA 1XC6A 1W06A 5IVYA 1Y3TA 2RHPA 2NMNA 2RM22 3GBGA 2W87A 3BTAA 3THCA 2WZR2 4Q4Y2 5C8CA 3I54A 5JVVA 1SBEA 4LXLA 4KWUA 3RJ2X 3RYPA 1X9PA 3ES4A 4QHBA 3UJOA 3THPA 1XSRA 1O4YA 2YZ4A 4BJ0A 3HT2A 3P3PA 3ILFA 2YXSA 5FMDA 4M0HA 5I0DA 2J22A 1H1IA 5GZDA 3MBWA 3VBHA 2R071 5BNPC 1ND2A 1NCRB 4ZZ5A 4PQ9A 1TVGA 2P3IA 4LBQB 2ZKNA 2C24A 4QGMA 4V2WA 3A0KA 3MO4A 3DXUA 4UW5A 3RQ0A 4BYYA 1OLME 3POBA 1XNAA 4JGZA 4LTAA 2JX9A 1YIPA 1MS8A 4XHXA 2XBO2 1Q5OA 3VBOB 1J3RA 3ZFFC 4DMIA 1LU1A 4AQ2A 4AEDC 4BZ4A 1H9WA 2PLV1 4AF9A 1LEDA 1JZ4A 1WW6A 1YWKA 4FPKA 4OZOA 4Q4W2 3LIGA 4PF5A 4BXFA 5A1FA 1COV3 4LIUA 5H9SA 5LBCA 4JDMA 3AB0A 3UL2A 2P6HA 2QQWA 2ARAA 2D40A 1PZ7A 4I30A 4ASLA 5I0SA 4FQ4A 2Q0AA 4OUSA 3ZXFA 4Q0VA 1FMD1 2C9AA 1BCXA 1DQ6A 1NX9A 3UJQA 1XU1A 1UY0A 1GANA 5FBZA 2FD8A 4EWDA 4PJYA 4BLIA 4FPOB 1B35B 1PZ8A 5F39A 3L9JT 1JZ3A 1YLLA 4I3GA 4FP3A 2NMOA 3OGSA 5CU1A 2VE1A 1O3RA 4ONUA 2EALA 2GNDA 1WW5A 1X33A 1JU4A 2XB6C 3ABZA 3KHBA 4CCDA 4MYEA 1RL3A 1VBE2 4QHZA 3AP5A 5F2WA 2FZ1A 4QDRA 3TNQA 1NG0A 2RS32 1D4M2 3C7HA 5T5PA 1Q8VA 4J25A 4P9WA 2H0BA 1VMHA 3J7HA 4Z82A 4NIIA 5JXGA 2BVVA 3PVNA 1HJGA 3I2FA 3PDQA 4EE2A 5HBAA 4O65A 3O1OA 1ZZ6A 1Q8QA 2XKPA 3CIHA 4YG3A 5I93A 1DFQA 3WUDA 1LJ7A 4AVVA 2W1WA 3JQXA 4FOWA 3IKWA 4IEXA 1TE1B 2VTFA 1Z78A 4YGBA 3U4SA 5FP3A 3QOPA 3V56A 2E7QA 4A7YA 1CIYA 3VBRC 2BGCA 3ZVXA 3TEWA 1PO11 3PTRB 4KGQA 2DV9A 5FXWA 3URFA 2X29A 4IV1A 2L9LA 2BNNA 1OLQA 1VRH1 1ZBA1 3DPRA 3A21A 3MV01 5C3SA 1Z7S2 5J96B 1WKYA 3TEZA 3OBZA 4AQSA 1OMIA 4QPIC 2QFEA 2JDPA 1O5UA 2R0HA 3ALQA 3EJKA 1HRV1 3MF9A 3ORJA 2NP0A 5A3UA 1CVNA 4ISQA 3J7MA 1CZSA 4CDUB 2VG9A 1MZFA 1HB2A 2XL9A 3TN93 4DPNA 2WKKA 1QJY3 1R64A 5FLIA 3K4ZA 5JXJA 3MW2A 3HQUA 3A0NA 3ZSJA 3VKMA 1QDOA 2B7YA 3LEKA 3KGLA 3I7DA 1V6LA 5DAWA 5JLVA 4NIAA 2B9VA 4K1ZA 4UBHA 2GMEA 3TAYA 1QJU3 1YFXA 1ZBE3 1R081 4FXKB 4CCCA 4BQ4A 3VDCA 1AL0G 3CJIA 4UW6A 1NA1C 2EIBA 3VZOA 4GXLA 4LHLA 5CEHA 4HANA 1ASJ3 2HWE2 2ZGOA 4QDQA 3WT3A 2J42A 2E33A 2WL1A 2ZMKA 2RS51 4ZXKA 4GMP1 4QQOA 3AP4A 4B1MA 1WZXA 4YGEA 1W6MB 4IEQA 1D0GA 4KQ7A 5FZ0A 2IXKA 4HKWA 2JKXA 5CFCC 3RYRA 3C7OA 1EPWA 2PMWB 3BCWA 3FHAA 4X8PA 4CDQB 5LEKA 1XNBA 5LK5A 3A4UA 1RUG1 4PF1A 3PLQA 4PLNA 1TMF2 1OQEA 1UY1A 4O7XA 3MI8A 1AR73 2HWF2 1PGL1 1UO9A 1SPPB 4PHZA 1RVF2 2X09A 3OUHA 2DU1A 2QUOA 4XIKA 2ZGSA 2WO7A 4WV8A 4NRPA 1CX1A 4HLTA 4NPMA 4QQ2A 4FI9A 1HXS3 5FBJA 3BIWE 2Q4SA 4H14A 5FY1A 3WW1A 4Y20A 4OULA 2PA7A 4DY3A 4P9IA 3RZJA 4XAAA 3JU9A 3FBMA 5A32A 1YO8A 4ISRA 3VHRA 4MGZE 1NY72 2GP3A 5IATA 5LY1A 1E57A 2D6NA 1KXGA 3ZYJB 1JUIA 3HQRA 1PVXA 1QXPA 3PMEA 1O3SA 1CPMA 2GH8A 3SNMA 1OF3A 2XONA 1ZREA 4AW7A 3TYJA 2X5IB 1Q43A 2IUWA 3K4AA 3J8F3 4GWIA 1A34A 1YRZA 5FZGA 1CAUA 1HB1A 2BP6A 2W95A 1LESA 1HN0A 1V9U3 2GNTA 4QHOA 1GV9A 1PMHX 1RTVA 1QOSA 1FOD3 1W9FA 2ZX4A 2XJVA 3FX3A 4K40A 4OI4A 4CU6A 1JYIA 2CDPA 4YM1A 3BN6A 2HJIA 5IVJA 4NUBA 5A3WA 5FUIA 1PO21 3KT1A 2E53A 1YQ6A 4NROA 3CF6E 5L36A 2WYSA 5I0RA 4LR4A 1SZBA 4JCKA 4GH4B 4UF0B 4XAEA 1UY2A 1RUH2 4PLMA 2BRTA 1SMVA 3WG3A 4A7ZA 3HPNA 5IVFA 1PM4A 4P08A 2XL7A 3S5QA 1QQP1 3FLRA 3HNYM 4EN8B 1ND3C 3A22A 4IE5A 4M3CA 4BB3A 4YARA 1ONAA 3PUAA 4E2GA 2BGOA 3M3OA 1BEV2 4JVAA 2Q8OA 1WA6X 3ZPYA 4Z1VA 2G4IA 5LASA 3UKNA 4FAHA 4Y5Z0 1OOPA 1W9SA 1S0CA 4L99A 5FZ1A 5FKBA 5T55A 2W94A 4AGGA 1CONA 3I4IA 1LCLA 2AZ5A 2VXJA 1I6XA 1OFNA 3ASIA 4LQRA 1ULDA 4JGYB 1ZM1A 1EAH2 1YHFA 3MIDA 4W6WA 2CL2A 4I02A 2XG3A 1JOPA 1JH5A 2VC9A 4DUVA 2R30A 1VBD2 1NT0A 1WW4A 2ET1A 4N53C 4CU7A 1H30A 1MVEA 3J26N 1Y9QA 4JTNA 1IPSA 2PHFA 1W0PA 2EXKA 5CZKA 3WF2A 1ZZ9A 3KCYA 4XIOA 5BNPA 3ES1A 3OBTA 5E88A 1VJ2A 2A6XA 3FFZA 1VBA1 4WM8C 5A1AA 4QKNA 3DYPA 1URXA 4KU8A 3WUCA 4U2AA 2D44A 4YFZA 4MGYE 5LK7B 5C4WC 3LA3A 2NQYA 1F2NA 1QJX1 4MGKE 4AEDA 1CR7A 4V1PA 1QGLA 2Z69A 2W92A 3EHKA 4MV2A 2ZEXA 3FLPA 4AQ6A 5CAZA 1Q3EA 1ENSA 2RDQA 3OY8A 3F2ZA 3TWIA 1C8M1 3M3CA 4Q0PA 1J1LA 1PVC1 2HWD3 5C3RA 1ZZBA 3D3AA 4DINB 2ZEZA 4AI0A 1HLCA 4P9YA 5F3GA 3T4VA 1MS1A 2HH9A 1ODNA 2ZGTA 2Y64A 2WO2A 3SH3A 5FUNA 2YU1A 4BQ3A 1KQRA 2YGLA 3LDBA 1XSQA 1W6QA 3AZYA 2DVDA 3GBFA 4G3YC 4GB33 3VDDC 2PLV2 1DF0A 1FI2A 4S2FA 1GUIA 2QQLA 1K5MB 1JOBA 2ZHMA 4YM2A 2GMMA 1MS5A 1X8MA 4XF9A 2DTYA 3HT1A 5BNOC 1RUNA 4Q8KA 2WDBA 1W39A 4CP9A 1WWYA 4RHV3 2OVUA 1CPNA 5EJ1B 2B46X 3K4DA 2YG0A 4C0HA 4CCLA 1U5XA 1FX5A 4RGKA 1JOJA 3CQOA 3ZMOA 3BI3A 4LNVA 1KD7A 2J1RA 4W65A 1RUJ1 1J83A 3AYDA 2VBPA 4OYUA 1M4WA 4Y22A 5DQ0A 5T3NA 1FNZA 1A8MA 1UZVA 5FYBA 3THDA 4E4ZA 5JOWA 1RUD3 4OZXA 1YCIA 3KQRA 2R041 3O1SA 1VBC1 3OD4A 3K3OA 4RR3A 3OGGA 4X6QB 5C7GA 2FDHA 5JUVA 5L9RA 3N7JA 3ZSEA 3NJZA 1MS4A 2B39A 4BM8A 5FR3A 4A6OA 5AFBA 3LD8A 3D4KA 4ASMB 4QM9A 1C5IA 1F5FA 5G05L 1AYM3 1W28A 4XABA 5FFOC 5FDBA 2ZCWA 5F1RA 2HEWF 2VBDA 3JBG1 1ZA7A 4QWNA 3VKFC 2WFF3 3H1WA 4FPLA 3CZJA 4YW4A 5IFPA 4Y1UA 2DTWA 3U37A 2Y34A 3VBRA 3AL5A 3H8UA 1O3QA 5FO7B 5DUVA 1ENXA 1BYHA 2JD4A 3B9IA 3T0DA 5SV5A 1XPWA 3VD3A 3O0VA 1GP4A 5FQ0A 2Q1FA 1NQJA 2J1SA 2RV9A 1NE4A 3H1YA 2UWBA 5IW0A 1W05A 3ZM8A 5FZCA 1IKQA 4XF1A 1CZVA 1OUXA 3JD71 4QPIA 1O59A 3MF6A 2JIJA 2XLAA 4AGVA 1S1AA 1W03A 4DIQA 1LGCA 4H7LA 1VRH2 1C57A 3UK9A 1V00A 1LOFA 2PHLA 3ZXKA 2JJ6A 4XMAA 4OUEA 4DXSA 4R9BA 1P8JA 3RI9A 1PIV3 2ZA9A 1LNSA 4CEWC 3J9SA 3BALA 2V72A 4DFSA 2QDNA 2DUQA 5JXIA 4LBOA 1JZ2A 4NJ4A 5GLUA 3G6JB 2LTNA 1T6GC 1H8TB 3BTZA 2I45A 4GKXA 4Q2FA 4UI9L 1AXYA 4DNYA 2AEZA 1F9KA 2RR12 2W47A 3D82A 3OGRA 4Q4V3 1QOTA 1G9DA 3IIAA 5C5TA 5LRSA 1NA1A 4IV3C 5FP7A 4LLOA 3ATGA 4HETA 4E9KA 5EYYA 1FPN3 1IS4A 1RUF2 5DAPA 2VBBA 3AM2A 2BOIA 2P3YA 4QDSA 5FZOB 4XJZA 5DAVA 1TEIA 1V6MA 4AR2A 3H0OA 3NV4A 1R082 3JXSA 2Z4FA 5DDJ1 3JZVA 3H3ZA 4WZCA 3T2OA 5CFCA 5KHGA 5A3NA 5F7UA 5FK8A 3IPVB 1AR63 1XQNA 1TNRA 4FPCA 4Y24A 5LBEA 4BQWA 5ACA1 1HKDA 1QY4A 4Q4X1 2D3SA 4NHKA 4F7ZA 1O6UA 2MNGA 3WP4A 1LHOA 2RS52 3MFCA 5D2AA 4IGOA 1W6NB 1W2AX 3ZN6B 4DRRA 1YFYA 4MGSA 2IZWA 1F4HA 4BQ2A 3MLKA 4XTPA 2VOVA 4KWJA 1HRI3 4IE6A 1MQTB 2P6CA 2YC4A 2AEYA 4S2GA 1RUG2 3LCPA 5EHDA 2BFUL 2HBTA 4YGCA 3VKLA 1POV0 1DQ1A 4AI3A 5A6ZA 2XPJA 3ZYHA 3IWZA 1WMFA 4OMCA 2OUJA 3EMRA 4XHBA 1PGL2 1AVBA 2VJXA 1RUE2 3RWNA 1MZ6A 3PVOA 4QPGC 1ULCA 3M3QA 5A6XA 5DMYA 2PHUA 3NKGA 4WM7B 3ITQA 2D93A 1U5ZA 4H3WA 4K21A 3X29B 3JB8A 5IAXA 4JHZA 4BQ1A 4I0AA 3HJRA 4V2VA 2O1QA 4Q26A 3VD4A 2YC0A 3W59A 4L97A 3LDRA 2Y8KA 1YJKA 5FXZA 2ERFA 1UW8A 2BTVC 4OMDA 1PGSA 4QPYA 1UYXA 3IZOA 3T2PA 2DFBA 4I01A 1H2NA 4QAWA 2BWAA 5HCFA 4HG6B 1OD5A 1UN1A 1ZVFA 5CADA 1OHFA 2ZJCA 2ZMLA 4XXPA 4W6XA 1RUC3 5KHJA 5L7OC 2XJRA 1COV1 1W2NA 3BVCA 3R4SA 5F9TA 4IUGA 3MDPA 4M4PA 2B42B 4XZPA 2AH2A 3WNMA 5G04L 1JMUB 4KL1A 3DF0A 1OVSA 2Y6HA 4K9SA 2DCZA 1PO22 4I09A 4C0BA 1W2OA 5T52A 1DGRN 4QMAA 1ND3A 3VUOA 5JXHA 1DBNA 5T5LA 4CDWA 1KFXL 4SLIA 2WNVB 2JDMA 3SCFA 4BLJA 5BUVA 1UIKA 5IVCA 5L19A 5FWEA 1ULGA 3RG0A 4CU8A 1PK6C 3ZXAC 1WBLA 2Y26A 3LPFA 1QXJA 2J1EA 4M3CE 4CXXA 5AC93 3EBRA 4A41A 3RS6A 1QQP2 2WA4A 1UU5A 2VM9A 1YXWA 3LA7A 1POV3 3LF7A 4BHPA 3W58A 2VAUA 4AEKA 3K48A 1N1VA 3DCQA 4YW1A 3D6EA 2WA3A 5IK8A 3SQOA 4RGAA 1NAEA 2XQRA 1AR83 1JYNA 2PQSA 4N53A 3V0BA 3UETA 1GKBA 1WBFA 1QNYA 2ZOEB 3K51A 3OBRA 3PUHA 4LLFA 4MSVA 1AL23 4WVZA 1IOAA 1HV1A 2XJQA 1ZYBA 4YW6A 1GSLA 4KGGA 3WG2A 4N8MA 4YNIA 1JW6A 4HVQA 3EB7A 4FFHA 2RE9A 5FREA 3V65A 1VMFA 2I07B 4ES8A 3HVDA 1UY4A 4JKLA 2VMIA 3HOBA 4WM8A 4NN0A 5DG2A 5F37A 1W90A 2PTMA 5LWBA 2PHXA 1SCSA 4YVWB 3K3NA 2OW4A 1OC1A 1HIXA 4Z2AA 1S0EA 5C4WA 1NCRC 3NQHA 3VZKA 1AXZA 2QQJA 3PURA 4Y1ZA 4Q8LA 3C2UA 1AYN3 4MXVA 1UOGA 1X7NA 3H50A 3T2QA 1L7QA 3ETPA 2A73B 5FP4A 3VBOC 2LRPA 3LEIA 3EO6A 3WP6A 1NZIA 1QJX2 4H7MA 5IWFA 4EWEA 2DBIA 2V73A 3WNNA 4YSFA 3VDDA 3M3EA 2O8QA 3WSOA 2EF6A 4K6BA 1C5HA 4MHUA 2VMEA 4DZGA 4JDNA 1C8M2 4QQLA 1PVC2 2W5FA 4RSUA 3TN91 3ETQA 1FNYA 1QJY1 1WA4A 2V4VA 1R1ZA 3T2TA 5A3LA 5BNOA 3ZFGA 5FY7A 1DLLA 3EYPA 2A3XA 1F5JA 2R7EB 2ZBJA 4JGZB 4TWTA 5IYYA 3U10A 5FPLA 1IKPA 4AVBA 1VBB2 2QTWB 1QJU1 1ZBE1 1QU0A 1JUHA 3FL7A 1VMJA 2A70A 3RZGA 1GLHA 1B35C 4HPKB 1ASJ1 2BW8A 3NAPC 2WWSA 4QQHA 1RUI3 3WD5A 5BPXA 4FXGB 1ZZCA 3C7FA 5I8YA 2GC2A 5JZGC 2WQ4A 1H4HA 4NAMA 4F8AA 1G86A 1W3VA 4Y1YA 1NKGA 2MEV3 1RUJ2 3KF5A 3WDYA 1H1MA 3ECQA 1L7LA 5LA0A 1W8FA 4UWDA 5C70A 4P9JA 4N9HA 2VZRA 2YV8A 4KNCA 2R042 3NJYA 1XYPA 3NV1A 5APAA 4LOTA 4XE9A 3AP9A 5DUUA 1AR93 4D6SA 4YG6A 4XDOA 2BNMA 1F31A 4MVTA 3K46A 1AR71 3WG1A 1NQDA 2HYKA 5FYUA 5DAQA 2CGOA 1D7PM 4LT5A 4OHWA 4AGRA 1S2EA 1L3JA 5KC6A 5A7PA 1VB4A 1HXS1 5IAVA 5BNNB 1JYVA 4GWNA 1JS9A 2LROA 4FPGA 2R16A 2YBKA 3IMMA 1SBDA 2WZEA 5AFEA 2J1VA 3WHUA 4JX0A 2DUPA 1LR5A 3S5AA 3MYXA 1UOFA 2JENA 4HK8A 5D8AB 1C8NA 1DGRA 2OT7A 2V5YA 2Y33A 4LO7A 4CEWA 4YZ1A 3C8XA 1ZX5A 3ENRA 3J8F1 2BJSA 2ZX1A 1IQDC 4CDUC 4CRQA 1DZTA 4CUGA 3AFGA 1V9U1 4LULA 3DL3A 1FOD1 5FXVA 1UZWA 3WF3A 5JI9A 1EV12 5EYXA 3N9NA 4ATEA 4Q4W3 4LHKA 4IV3A 1TQ5A 4NMIA 5AVPA 4Y4YA 1JN2P 2CTVA 1DGWA 5JSPA 4XJ9A 2AENA 4CUAA 2JEMA 1GWKA 2VOKA 3GJBA 3BIEA 3HD8B 4P5YA 4M0NA 2BVBA 1UU4A 4AVTA 1O8SA 3N9LA 2LM3A 1MS9A 4ET7A 3KV4A 5IT6A 2A6ZA 2BPA2 2PAMA 3H3UA 1OQ1A 1APNA 3WLUA 2H6BA 3GYDA 5I0UA 3QH7A 5DDJ2 3WY6A 2BERA 4MGIE 4XOGA 3ZYPA 4LO6B 3C7GA 4CDQC 1HN1A 2WNEA 4AHWA 2AGSA 1WMDA 5ACA2 4N43B 3ZXJA 4KH9A 3P3NA 5K8SA 4RD7A 1VBE3 1R093 1S0BA 3OYWA 1OPMA 5FMOL 2RS33 4Y3OA 5LA1A 5E1RA 1U12A 1PNFA 4RL7A 1W8NA 5AVAA 2BU9A 2D97A 4QPGA 2VQUA 1XXNA 2JE7A 3D0JA 3VZNA 4P9LA 2ARBA 4XFAA 1YQ5A 3E6CC 3WVJA 5M0TA 3V0AA 5T54A 5A3TA 2OQ7A 1QNWA 4XEZA 4AVCA 3E97A 3VLBB 3MUY1 3ACIA 1ULPA 5JIAA 3E5QA 1XE7A 4XFIA 4E8CA 3ZFEC 2G1MA 2PN5A 5JOYA 1OUSA 5FJHA 2TUNA 3A7QA 3D5OA 3WQ7A 3HN3A 5HCHA 1AJOA 3E6BA 1GWMA 4HOOA 2DF7A 3R6SA 2VCAA 2X5IC 3ZOIA 3AVSA 1W8ZA 4TTGA 4JKKA 5HCAA 2HYXA 2ZGMA 5L7OA 5EXOA 4F83A 1LOAA 5FK7A 2D6OX 4PDWB 5ERLA 3E6DA 2D98A 2VW0A 3MPBA 3MIBA 4GB31 3UKTA 2VZSA 3OEAA 4NRQA 3N35A 4YWAA 2ILMA 1A6CA 2XJTA 3I2KA 3ACHA 4UFLA 2Q5TA 2ORXA 2F17A 1OFSA 3ACLA 4R4ZA 5H9QA 3H7YA 1COV2 1O91A 2G19A 4AI2A 1Z0HA 5BNQA 3ZMNA 2QQKA 2JE8A 1PK6A 2ZKLA 3L2HA 1H8VA 4RHV1 5FZ6A 4HT1T 3KB5A 3PTYA 4N7UA 4R4XA 2A6WA 5KXCA 3VGIA 1BBT2 3PNAA 3WQ0A 4BPZA 4DUXA 1S55A 2ZHKA 3ZYRA 2UYBA 2WO3A 4AI1A 1V0AA 2HWE3 1G9BA 5DXDA 1BJQA 1JYTA 3AP6A 1RUD1 5FZAA 2VNOA 2ORZA 4BWOA 2EXIA 4YVSB 4A45A 4EN6B 4JGYC 5IVEA 1Y7BA 1PGW1 2JXAA 2VZPA 5FV3A 5LB6A 1UYZA 3SH5A 4EZHA 5CG8A 3IB3A 2O8OA 1BZWA 1REEA 4YZ3A 4WVVA 3RWKX 1AYM1 2JKBA 4OQ9A 5LATA 4ZZ8A 1EUUA 1F15A 1MS3A 1TMF3 4IEZA 5FMBA 1VB2A 1N3OA 2WFF1 3PUSA 4UAPA 5J09A 1AUYA 5KBFA 5DUWA 1V6NA 1O7FA 5A7WB 1NOVA 3I8TA 3CJXA 1OLRA 3AZZA 2F4LA 4A4AA 5FPZA 3WF1A 1W9TA 2XHNA 1GBGA 3QBQA 5A3MA 1OA3A 3S7IA 4AFCA 1G9FA 2FMYA 2OZ6A 3UT0A 5CBLA 3IN9A 4PI2A 4DXZA 1ZRIA 2BWCA 4KG8A 4LO8A 3CKHA 4G4FA 2QQMA 4HN1A 5FZDA 3WG4A 4PBPA 2YBPA 1W9WA 1XYNA 2E26A 2EAKA 4PIZA 1WLTA 2E63A 3J7NA 4CTEA 2JDUA 4YW5A 2QCSB 2CY6A 3L2YA 5A3PA 4UFHA 1PIV1 4GULA 5B4XA 2ARCA 4KU7A 1G7YA 1Y43B 4OI0A 3WCSA 3I2JA 5FMOS 5DG1A 1ZNPA 4HFSA 1CAWA 3AMHA 4IEUA 4TN7A 1J3PA 4UXAA 3M70A 4ARXA 5F3IA 3WP3A 3USSA 4PIXA 1GZ9A 3LIHA 4Q4V1 1C4RA 1BK0A 4AEDB 2W2IA 5JWPA 3ZN4A 4MOAA 1AZDA 1XE8A 3ILNA 1B35A 1W8OA 3OY8B 5HCBA 3WNLA 2GZWA 3KCXA 2DUOA 3NAPA 1FPN1 1DQ4A 2ZTNA 1O4ZA 1LHUA 2ARXA 4FO9A 4LK6A 1UF2C 3OD0A 3RRDA 3IDEA 4DXTA 2Z79A 3AYAA 1J84A 4QU1A 1GQHA 5JZGA 4RS5C 2P5BA 3SHRA 1W6QB 4LE4A 1FV3A 4ZKTB 1BQPA 2HBUA 2C26A 3GZUC 1W99A 1SLTA 4I3PA 2JG9B 1UOJA 2XOMA 4AFDA 4LA2A 2HEVF 4CYDA 2ZMNA 1AR61 1R1A3 2HLEA 3VBSB 2E9QA 3KV5A 1VE0A 4BISA 5DPNA 5BXXA 1KJLA 4WVWA 1NXD1 4FBFA 4NAOA 4FT8A 1GZWB 1V6IA 5FO8B 4NHXA 1RIRA 4ZONA 3CEWA 5L73A 4KMQA 3MFAA 1N1SA 1SFNA 2NN8A 1OSGA 1HRI1 4XUQA 3RZZA 4LK7A 3FHIB 3O0WA 2HWB1 3AP7A 1JBCA 1NUKA 2ZZQA 4XJAA 1AR72 2EIGA 1N1TA 4RR3B 1UMIA 2W1SA 2QQVA 2RMU2 1TME3 2PAKA 4H55A 4OI1A 3LAGA 2XJUA 3O5SA 4OHXA 3MPPG 5EV7A 4C1XA 5IJRA 1WD4A 1PM7A 1JYCA 2ZX3A 2NLRA 3OOXA 4ZS3A 2OXBA 4B4QA 4CDUA 4CP2A 1NXMA 5JAXA 3WDXA 2CAUA 2VY0A 1BMV1 4E2QA 2XKOA 2IWGB 4KWKA 3THTA 4B4RA 2JDKA 3O14A 1VALA 3VN4A 2P3JA 2SLIA 5F5AA 1XJAA 3LB9A 4QGNA 2JDZA 5GLZA 1H6XA 2ADEA 2VTXJ 4NHYA 4XJUA 4WVMB 4QGLA 4Y5TA 1IQAA 2B4KA 1H8TC 3ZYIB 1RUC1 3AMQA 2DCJA 3J8F2 1XB9A 1O8PA 5GLVA 4AZZA 1J1TA 1V9U2 4TLGA 3RMYA 1OQDA 3P6BA 1HV0A 5C8WA 2XVKA 2CYFA 3MZHA 2PHRA 5H9RA 5HI0A 4QPIB 3VHNA 1PNGA 2VO5A 1YYNA 3I3DA 4QX1A 4ZPIA 1VPHA 3OPWA 5TSWA 3WDVA 5CFDB 4CP0A 1A8DA 2PQQA 3HNMA 2VD7A 4MGQA 5FZBA 2GU9A 2WABA 3ZPOA 1W6MA 1ACCA 3ZFFA 1OA4A 2R072 4LO5B 1HQNA 1W2UA 5FY9A 1STMA 2UWAA 1CAVB 1RJ7A 3JB4C 4U36A 4YG0A 4Y33A 4DB5A 4J6GA 5AC91 3NNJA 3SXWA 4QXBA 4K8RB 3BU7A 2WWJA 5LA2A 1JXNA 2ID4A 2WIIB 5FZMA 5FYMA 5K7PA 1POV1 2QQPA 4LMFA 4COZA 2JG8B 1SPPA 1W6OB 1E5SA 2VULA 2XVLA 2B45X 1SHWB 4NR1A 5K0UC 1OF4A 1XOYA 1AR81 5ABJC 2VZVA 4BU2A 3VV1A 4PQQA 3OGVA 2DURA 5A80A 3CNAA 3S0MA 4C91A 1AL21 2RDRA 1HB4A 2PHWA 5EJ3A 2N7GA 2FZ2A 3GXUA 2WUHA 2JICA 4UYBA 2OQ6A 3BYWA 1DGLA 5EWSA 2P34A 1CAXA 2EIEA 2Y6FA 4P14A 3WNPA 2QQOA 3ZFEA 3ZSKA 1JZ7A 1FMD2 4BOWA 4IESA 3SKJE 1CX4A 4ASKA 4EZ4A 3NRUA 5GZEA 2WINB 2VNGA 2FCTA 4M4RA 1HQLA 4A3ZA 2X5IA 1IPKA 3WCRA 1AYN1 2A5ZA 1K42A 1Q8SA 3USUA 4URAA 4YM0A 3TB0A 4AFMA 4QXHA 1NCQB 2YYOA 3B9CA 5FIXA 4W6YA 1YI7A 1VRH3 4TSVA 1JTZX 4HONA 3AJYA 5FY5A 2VCCA 4RN5A 4R9AA 4AVSA 4ZY9A 4OHZA 2G9ZA 3KT7A 4JAAA 4COWA 4B29A 1RHI1 4IE7A 2VVDA 3ZKYA 3H3LA 3T0AA 2GN7A 4XURA 4WBBA 5CB7A 4GB32 2XLFA 3BU0A 3AJZA 3AKSA 2RR13 5FY0A 3VBFB 4D7SA 3GNEA 1LHNA 2YROA 1IZ3A 3T0BA 1QHDA 2WNVC 4K7JA 1UU6A 2BQPA 1RUF3 2WSVA 3NWKA 4CPBA 2BUKA 1UKRA 3POEA 1ULOA 3Q8FA 1PO12 1U5IA 4OLLA 2WN2A 4MZUA 4URTA 2DCYA 1YQ2A 4CCJA 4XCAA 1ZBA2 4HXCA 4JGYA 1XYOA 1RMU3 3T4HB 1W0NA 1DYOA 1MEC3 4P9XA 3SCGA 2BYVE 2MEV1 3GJAA 4MHRA 1W6PB 4Q0SA 5IK7A 1RGSA 3GHMA 4CE8A 2RS13 3AK0A 1MACA 2TBVA 2VQTA 2WS93 4N90A 1HRV2 1RUD2 2IFWA 1ULFA 4CDWB 3ZYFA 3WDWA 3TNPB 3HBZA 2XUEA 1JHNA 1AR91 4L92A 4CEYB 1YFWA 5HXMA 1PGW2 2R49A 4CCMA 2VOWA 3NSTA 4TXWA 4FPFA 4YZ4A 1AYM2 1BHGA 4XZUG 1W0OA 4D8MA 4JTOA 3DN7A 4YVWC 2F4PA 3N9OA 2VPVA 3SMHA 5D1IA 4XCBA 3PU8A 3Q8BA 5HXVA 4AHXA 4MXWA 4BMEA 1RUE3 3Q9OA 1GOHA 3VD9A 4BK4A 3O7OA 2JDYA 1O4TA 4BK5A 3H8OA 2WAAA 4A42A 5BV6A 1DYPA 1X50A 3V0BB 3NNGA 3ZFFB 1S0FA 2WT0A 2D6LX 2EVXA 1TNFA 1XU2A 3I59B 4XF4A 1H4GA 5LA9A 1SEFA 4XXAA 4Q29A 4LBMA 4IGPA 4DO0A 4HSLA 2GSYA 2R6QA 2Y6LA 5GJ6A 1KFUL 4GJYA 2XDVA 5JI7A 4A6SA 1LULA 5CISA 2ZGLA 3VBUB 5C4WB 2GP5A 3POWA 2YGMA 2ZGNA 4NIHA 1RXGA 3GBWA 1S0GA 1U5YA 4Q4W1 2WSUA 3RNSA 1PIV2 1D4VB 2DFCA 2JB4A 3WINE 4JGZC 2XUMA 3U4XA 1LU2A 1M06G 3SH4A 3J4UH 3I2HA 3ST7A 3VHPA 3NVCA 5JSOA 3IDBB 3R05A 5FRAA 4RS5A 4Q4V2 3CL1A 5A7QA 4QQPA 4CDXB 5A33A 3G7DA 4CPBD 1HQWA 1LHWA 5FZIA 3T08A 3UGGA 3W20A 1OBNA 1ZA4A 4BIOA 4FFIA 5T5OA 1U0AA 2W08A 2E7TA 5C71A 1FPN2 3HNBM 4FOYA 4R8HA 1NLRA 4RQPC 4D3WA 1QJZA 3KQ4B 2J1TA 3ZFGB 3I3EA 4C90A 1JYWA 2EXHA 1MZ5A 3F95A 4FPYA 2JDHA 2W91A 4DEVA 5C9AC 2EIDA 1UXZA 4IDZA 2DVGA 3FHQA 4LKEA 3T1LA 2WNUB 3CMGA 3RMXA 3WHTA 4XACA 5IHRA 1AR62 4R9DA 3GGLA 2W68A 1VBE1 3S6PA 4GWMA 2P37A 1R091 1MS0A 4NRMA 3GALA 1C1FA 2FMDA 2O0OA 4N7IA 3U07A 5JIUA 1UL9A 3NL1A 4AFBA 1LHVA 3LZZA 4IW3A 1PX3A 3AFKA 3CBNA 4YZ5A 3TOJA 1HRI2 1E5IA 5BNNC 4Y26A 3FBYA 3T09A 4NHLA 4INDA 2WRAA 2HWB2 3IMNA 3B94A 3OUIA 2WLQA 1UYYA 2Y6JA 4QX2A 3QCWA 3AYCA 3OF1A 5J36A 4OCTA 1NZCA 5D8AC 3PUQA 2W0XA 3T3YA 1F4AA 5DZGA 4QX5A 2UWCA 3P5BA 4MADA 1ULEA 1SG3A 2VW2A 1US3A 4BQXA 1H8TA 3N9PA 3BPSA 4GWJA 3IAPA 4D7TA 3NW4A 4W4ZA 2O14A 1BMV2 1KITA 3KM5A 1IPJA 1WCKA 2BV4A 2Z5WA 1HW5A 1W2TA 4QB1A 1G9AA 4EN0A 1LGNA 5A70A 3R4DB 2VZ3A 2KD7A 5FY8A 2A1XA 2QBXA 1PMJX 2WFPA 4CA9A 4QKBA 3WF0A 4MO3M 2BGPA 4AXOA 1I3HA 2VOTA 3ZLIA 1RUC2 1N3QA 3HN1A 1Q8PA 1RXFA 2GC1A 2ZGRA 5ANNA 4CEWB 3KT4A 1X9TA 4HSJA 1VBB3 1VBA2 4DS0A 5KHIA 2E31A 2K9ZA 4YPJA 5FPXA 1J3QA 1ODMA 1XE0A 4GKYA 2WZ8A 1XNTA 3I97A 3ZXLA 4E2SA 5C8CB 2VMFA 2ZX0A 1W6NA 4IV3B 4CXYA 2HWE1 3M1HA 1C3HA 4HKOA 1NLQA 2RDSA 5K0UA 1V6JA 2VR4A 1HB3A 4LKFA 3AZWA 2HWC3 2RJ2A 1JI6A 5ABJA 5J37A 4XVHA 3VBHB 4EN9B 5AC92 4N43C 2DDUA 4D7YA 1ND2B 4P5HA 1OVPA 4XBLA 1GU3A 3IM0A 5CKNA 1VAKA 3POGA 3ZSLA 3O12A 3ZIWA 4LA3A 3RGBA 1N3PA 4E4SA 5FOBB 1C28A 1TMF1 2AYHA 3POFA 3O1TA 2RVAA 4XW3A 2IXIA 3O1MA 4OHYA 2CHHA 3K2OA 5FJKA 2Q1ZB 5FYTA 4QT6A 4QXKA 2IVJA 2QQNA 1LOGA 1E5RA 2XR4A 2DVBA 2VMDA 3SCHA 4CSWA 3ZXDA 4L11A 5FZFA 4YW2A 4OVEA 3IBMA 3OUJA 3PIGA 3SC7X 3MHZA 3U1XA 3BGAA 1UD1A 2XH6A 4JQTA 3GF6A 4L8QA 5FUPA 3MIFA 1I5ZA 2R063 4L0PA 5KXBA 1BVVA 3JCIA 4MX3A 1CESA 1Y9GA 2BZDA 1AYN2 1DCSA 1DLCA 3AMPA 3DV8A 4A44A 3VKOA 4ZU7A 3HEIA 1VBC2 4PDWC 3WX5A 4ZXEA 5FP9A 2ZS6B 3V0AB 2OPKA 4WZFA 4RYDA 3WQ1A 3S57A 1KS5A 4PBOA 1ZRFA 4PIYA 2RM23 4FPJA 5SV8A 3FLTA 4NOTA 3RYKA 5KWRA 2WZR3 4Q4Y3 3O1UA 1EV13 3GZTB 2JD9A 3CZUA 3JBG2 2FCVA 1VP6A 2H0VA 2TEPA 3CO2A 3LEGA 3LSDA 2X05A 2WNVA 4NWWA 4W50A 4AHYA 3ZXGA 3ZDVA 1UWWA 2Q8CA 1MVQA 1RHI2 4CCEA 4BIFA 5FOJB 5GLWA 5FPVA 4JQRA 3WF4A 2A6YA 3ZIXA 3GZAA 4IEVA 4HVOA 2YBSA 4QB6A 1WLWA 1S0DA 5CIRA 3LEMA 3I2IA 3OCPA 3S30A 4B7KA 4OI2A 2ZAAA 1IHMA 2VCBA 3IT8A 4KWLA 1T2XA 3PMSA 1QWRA 5HPOA 4M01A 3JD72 5T50A 1R1A1 4M00A 1GFF2 2XBO3 1XNKA 4KI5M 3RZKA 4NIGA 5EFUA 2WO1A 3N7LA 4YVSC 4MGTA 5IVVA 2XJSA 3SISA 2ZPXA 2JDNA 3N9QA 3E5UA 1IS3A 1HJFA 1K3IA 1ZRDA 4XF3A 4I0WB 5E16A 1PK6B 3ZN5A 4HL0A 4IV1B 1AX0A 5ACA3 1JYXA 1QMJA 3DPRB 4O9GA 4LKSA 3I2OA 5KC5A 2XVGA 4YVWA 4S2HA 5DN2A 4GA9A 3LQCA 1LKNA 1TG7A 1YQ8A 2V5DA 3MV11 3KLSA 2WT1A 1AR92 1V6OA 4ITCA 3PVEA 4JRLA 2P2KA 1RB8G 1GNHA 4AI9A 3SKVA 1IS5A 4FTSA 3ACGA 4FPEA 3JQWA 4XQDA 1UZYA 1TME1 3DKWA 5FMCA 4OQ8A 2AR6A 4XBNA 5F2SA 3LOBA 5EPAA 4NVPA 1G9CA 5LZ6A 3ON7A 4IEOA 4SBVA 4W8JA 1CIWA 2DU0A 2ZGQA 4IE4A 2VW1A 5B4NA 1DU3D 1PHMA 2XWJB 4HK9A 4IL7A 3H42B 4Q4X2 3KMHA 3CJIB 4ZS2A 1JHJA 1K5JA 2UY8A 5CG9A 3W5NA 1D4M3 2I74A 4HVRA 1O3TA 2VQAA 3NNMA 4IEWA 2ENRA 2IFRA 1SLAA 3E5XA 2WYFA 1GOGA 2VGDA 5BY5A 3NJXA 3WNXA 5KHHA 3AKQA 1UMHA 5HV4A 2D6PA 2WN3A 2BEOA 1WGPA 4IE0A 2CGPA 3I3BA 5LBBA 3V64A 4XUTA 4HPKA 3OPTA 4MLOA 2VUCA 4BQYA 3H1MA 3AMNA 3TBDA 4RQPA 3FE5A 4Q0UA 5F3CA 1N47A 3HBKA 1EYBA 4UT5A 4D6QA 1QJFA 3O0XA 1CJDA 1GQGA 1WW7A 2JG9C 2ZEYA 3WXPA 1DDLA 4YLZA 1CAWB 5C9AA 3VBSC 4AYUA 1BBT3 1Z7S3 1BLZA 1JODA 2FHRA 2D43A 1LAJA 2HWD1 1Q56A 2DBNA 3HR9A 4XQ4A 1FXZA 1OH3A 2VZ1A 2AUYA 4Y20B 4YZ2A 2CWMA 1VR3A 3DUIA 1UAIA 5A32B 3VZMA 3RZLA 3NAPB 3B02A 1QF3A 4ES9A 1AHSA 4D6RA 5FZEA 4AEMA 4QU2A 3SEEA 3MW3A 4P9GA 5JZGB 2ETEA 3N9MA 4GH4C 5BNNA 1LECA 1QIQA 1UZ0A 4L9BA 3U11A 3C7EA 1R092 5IVBA 5FO9B 4RGGA 2PELA 4TLFA 4XDPA 1CAUB 4LKDA 1CD3G 4RR3C 3RSJA 3PUIA 5J7MA 1OD3A 4Y1XA 3PU3A 4CUCA 1CZTA 4K20A 3WR0A 4OUMA 3CDZB 4AAPA 5D8AA 1SDDB 3FN9A 3KS7A 1REDA 1J58A 1I5PA 2BDRA 3D8CA 2E32A 1W9YA 4DUWA 3JUUA 2PHTA 5ISLA 1UPIA 2ZGUA 3HQXA 3PHMA 4B7EA 4NPLA 2Z42A 4BQ5A 4Q27A 4B3NA 2GNBA 3UGFA 1MR5A 1PZ9A 1G6NA 4CCKA 4CU9A 4EV0A 2HEYF 3QLQA 4OHVA 3PJQA 1EP0A 2C5DA 3OG2A 3Q8EA 5FLHA 2FDIA 3OSDA 3LWCA 3OPZA 5DUXA 3OB8A 3W9AA 1FT9A 2GMPA 1LGBA 2ZHNA 3TRSB 5J48A 3TEXA 4M3CB 5FZ3A 2IVIB 3NNLA 4P02B 2HWF3 5HV0A 2D5HA 1RVF3 1GYKA 2YFZA 1NCRA 2DCKA 4QKDA 1QH6A 3I3QA 4Z8BA 4HKLA 3FFQA 1OOPB 2WAOA 4LBQA 3OGJA 5CFDC 4HBNA 2RJKA 4ZU5A 2P3KA 3N7MA 1OT5A 3VZLA 3BKZA 2RR11 1XNDA 1LOFC 2EAAA 1LEMA 3VBOA 3AVRA 4JC1A 1QH7A 2K0GA 5FPUA 4EYUA 2ZGKA 4QD2A 1RUF1 5JMOA 1BK1A 2IXLA 3K75B 3POYA 2CSGA 5IK4A 2FDGA 4HMZA 1POQA 4XFFA 1CQ9A 2GAUA 2CGNA 4JRAA 4N43A 3CHXA 4XFBA 3ZYBA 3HAGA 4M3CF 5BNPB 3N3HA 2QE3A 1UOBA 4P00B 5L9BA 2XJPA 1RMU1 1QJEA 3IDAA 2RDNA 1ENQA 2JG8C 1MEC1 1WCDJ 2AREA 4XQWA 3T1MA 3OBAA 3VHOA 4AG4A 2E51A 2K2SA 3PIJA 4LBLA 5FZHA 1GP5A 2RS11 3AKTA 2VXRA 2WS91 5J3UA 5JR2A 2D6KA 2JB8A 2QVSB 3FUOA 4GQ7A 3Q8CA 1K5MC 2J1AA 2TNFA 4UFJA 4LORA 5F8PA 5FZ7A 2D6MA 1QKQA 4QPWA 2Q8EA 3FJSA 4AFAA 3M2MA 3TN92 4E4DX 3O1VA 3B01A 1UX6A 1QJY2 1VLNA 2RG4A 4LHSA 1DZQA 2XLGA 4QM8A 4RFT0 4A2UA 4IEYA 2IXHA 4BE3A 3ACFA 5K9YA 1OA2A 1BKZA 4MH0E 2XMLA 2VUAA 5FP8A 2W46A 5I0TA 1OURA 2EICA 3KWVA 4UBGA 5J98B 5E89A 3SEPA 5C3PA 1RUH3 2OPWA 3VDBA 2D7FA 2VMGA 4XUOA 1QJU2 1ZBE2 2NYYA 5FYZA 4N9IA 4B4PA 3PJYA 4QXCA 1RUE1 2VZOA 5A7OA 3VKNA 4CVUA 2ZZJA 1QOOA 5FTTC 3BODA 1EY2A 2MPFA 1OI6A 3IIIA 2RMU3 4HN0A 4Y5SA 2Y38A 2FDJA 2X8KA 3ZX7A 1SLBA 2K46A 3O1RA 3ELNA 1ASJ2 1GWLA 1BEV3 2DVAA 4F3JA 5FLJA 4B1LA 4AWDA 4H2AA 1NCQC 4PDWA 2VCMA 4C1WA 2UU8A 3LFIA 1SFYA 5FYSA 3B93A 3BOPA 4KBZA 2YC2A 3IDCB 4BCUA 4CP9B 5JPMB 3EXUA 3BB6A 4XETA 5C5UA 4XPVA 1E5HA 1CAXB 2CNAA 3ZFEB 4UFKA 1EAH3 2VVEA 1VRBA 2VNVA 1X8EA 2AACA 4LUMA 2WBKA 4Y22B 4A3XA 1W8UA 1UMZA 2CV6A 4IERA 4GALA 4XF0A 4QB2A 1SFPA 1VBD3 4LBQD 4NIDA 2QKDA 2A75A 3HWJA 3MIEA 4FQZA 1SBFA 3USUB 3QD6A 3VBFC 4LBJA 4IETA 1BVP1 1OKQA 4IEPA 4MG2A 2ET7A 2ADDA 2RJLA 2Y6GA 4Z92B 2B9UA 1CJPA 5GZGA 4Y1VA 5DAXA 3B5LB 2FDKA 1D2SA 4UFIA 1HXS2 1JU3A 5A6QA 3INAA 1GR3A 1RYYA 3AX4A 1KEXA 4LEJA 5CNAA 2ZACA 2NPIA 3TEYA 2R073 3AZVA 1J59A 3S7EA 2B5HA 1I1EA 4YVSA 1LENA 1ZZ8A 3VBRB 3ZDSA 1KGYA 1X82A 3VD7A 4O61A 4FTBA 2C9KA 4GZ9A 1GP6A 4FVVA 5JDBA 4NO4A 5FQ0B 4CDWC 1R1A2 4PI0A 3FWEA 3I3MA 3AC0A 4LOSA 1Y9MA 4Q5OA 2OYZA 1WUVA 4CEYC 5I8SA 3AXEA 1FOD2 5A7WA 3ILRA 2PLV3 1IS6A 1S0IA 3LDKA 2ZAHA 4UW3A 4E4HA 1GZTA 1GICA 2LW8A 1ZRRA 1DG6A 3IAQA 1MZEA 4Q1PA 4YM3A 4A7KA 2NZ9A 3BPZA 2HKXA 1WCQA 4ORFA 2IXCA 1UX7A 2BNOA 5F6KA 3RFRA 1FMD3 3KVAA 5EP9A 2PAEA 2DVFA 3MIHA 4CDQA 5A1LA 3MICA 3OTFA 4XMIA 1SLIA 1IG0A 1IGOA 5A7SA 4R9CA 5FXXA 4AOCA 1TME2 2C6SA 1NA1B 4FOQA 4ARYA 2OX0A 1BXHA 1UKGA 3WNOA 3BTXA 2SBAA 4COUA 2EXJA 1C1LA 5LBFA 2WQ8A 3VB9A 1SCRA 1WLCA 1GOFA 4AE2A 2OS2A 1YJLA 2VOXA 1MQTC 1XRUA 4D0QA 3VBUC 5A6YA 4JV4A 2Z2SB 3U14A 3OEBA 5GKAC 5JPNB 4MXWB 5JOXA 4COYA 3AXDA 3M4FA 5CFCB 1KJRA 1NLSA 3KGZA 1GQPA 1YC61 3LE0A 1UY3A 4GMP0 2QDRA 4WM7C 3ZR5A 1YUDA 4QX0A 4XFGA 4DOUA 5LCWL 3FUQA 2YFUA 4LE3A 3D0SA 4IQPA 4CCOA 1UIJA 4CDXC 1O5LA 3LFMA 2JG9A 4EWAA 3W5MA 4NPRA 3BOWA 1VBB1 3VBSA 5F5QA 1L7RA 4XTMA 3QACA 3ZXEA 2QQIA 3RDIA 3O1PA 3BUCA 1AF9A 3MGUA 2VNRA 1NYWA 3UYJA 2A3WA 2JIGA 3N36A 4QKFA 1GZWA 1PO13 3ZFGC 4GJZA 1OKOA 1QDCA 2W39A 4BXSV 1DZRA 1ZBA3 1QXRA 2HWC1 2ZABA 3WZ1A 2WNUC 2X53S 2IXJA 2VUDA 5EJZB 3I49A 4DEQA 3DYOA 1AXKA 1I9RA 2H6CA 1AX2A 2HWD2 4PLOA 3DECA 4GH4A 4UF0A 4RS5B 4YFWA 2ZGPA 1PMIA 3MEPA 1ALYA 3M8LA 3W21A 2YPDA 4LBKA 3KVBA 5A33B 1ENRA 2A6VA 4GIQA 1HRV3 4OFGA 5DABA 5BYNA 1X36A 4NE9A 4QX3A 1RINA 3M3IA 3QH6A 2Q8DA 2D3RA 3WDTA 3MLJA 3T30A 1DQ2A 5IFTA 4XFCA 3B3QE 3NNFA 1KS4A 3KV6A 3NJVA 5KXDA 1AX1A 3VZJA 5F6LB 4EROA 2WT2A 3MIGA 1CWPA 2VTXA 1H9PA 1LTEA 2OIIA 3E1F1 5FZ8A 4EN7B 1CGPA 5FCCA 5KR7A 1YQCA 2Y60A 3FC0A 1N1YA 4CP1A 4RHV2 4YW3A 1R083 1KDMA 1RUI1 4TYSA 5GALA 3POIA 4FAGA 2VL4A 3KF3A 2WJSA 3WV6A 4AVAA 2XQXA 3RPQA 5FAXA 2FBEA 1W04A 1H2LA 3H8XA 4YW7A 4GD4A 1RC6A 1SLCA 2B8MA 1UNBA 1W8TA 1XNCA 1B09A 1RJ8A 2R061 4WVMA 2VZQA 1GZCA 1DHKB 2VVFA 2ZEWA 5IUQA 2RS53 1ND3B 4XC9A 4GMP3 4C8DA 2OKXA 3U75A 3MUZ1 3UV9A 1EUTA 2BOJA 2D5FA 3NV2A 3WQBA 2JWPA 2YUEA 2XWBB 4MUVA 5K4LA 5C33A 2YDEA 4X6RB 5CFDA 2RM21 3GHNA 1RUG3 2WZR1 1LRHA 1EV11 4Q4Y1 2WC2A 1CN1A 1F35A 5D21A 2PYTA 4K8FA 3ZR6A 4AI8A 3B7MA 3DGTA 4KG0A 5F3EA 2WFF2 3N4MA 4DXRA 1JZ6A 2VZTA 3APBA 1CAVA 2YPJA 4XYXA 3M7AA 2CAVA 5FKCA 5L9VA 4N53B 3LPGA 4NHMA 1W8WA 1UYPA 1H0BA 2VMHA 5C8CC 2J7MA 3DYMA 5FYVA 2C0ZA 2JG8A 2W1UA 2CU5A 1W6OA 2VH9A 4WM8B 4XJWA 5LW9A 5EQUA 1T6BX 3R0RA 4JHTA 2XHKA 2XBO1 4FFGA 2QJVA 3VBHC 1HDKA 2VMCA 4QX7A 4E27A 1OLMA 1WD3A 2OA2A 1K5MA 1ND2C 2QZ2A 4DY5A 1SLLA 2VZUA 4HZFA 4CCNA 4I0BA 4JZRA 1LOBA 3K77A 1RMU2 3NO8A 5FYHA 5IK5A 1Y4WA 2Y0OA 4JDOA 1MEC2 2XXZA 5CVRA 5LY2A 4BDVB 4B8EA 2RS12 3KV9A 2WS92 4FCAA 4AL9A 2F6BA 5FPBA 2Q1MA 5FPAA 3ZSMA 3RZMA 5EZWA 2MHFA 1D0HA 1DIWA 1PO23 3AZXA 5K0UB 5GZFA 3VDDB 3ZO0B 3KZ4C 4XFHA 4ATFA 5ABJB 3AL6A 1GMMA 4AEJA 2VUJA 3FMGA 3H8RA 2YMZA 3H9AA 1AJKA 2W3JA 2HWB3 1NCQA 4RA0A 2ES3A 5T5JA 2DCTA 1JZ5A 4FSJA 1FAYA 1W3XA 4YYOA 2GC0A 1QEXA 2ATFA 5BNOB 5FY4A 3KHCA 1QQP3 3DXTA 4Q1RA 2DYCA 1S2BA 2UY9A 1H6YA 1XBFA 1VIWB 3AKPA 4LO4B 3LOIA 4PCRA 5FZKA 5CKQA 3VL8A 5I8TA 2RS31 2W52A 1D4M1 4XJ8A 5FYIA 3WOGA 3U78A 3SLIA 5E6HA 2G9FA 2KR2A 2IC1A 1HX6A 4YGDA 3VBFA 4META 4JKMA 4KBBA 3WP5A 2Q30A 4I2OA 2BBVA 4O9EA 2ZHLA 3KD4A 3H7JA 4X8NA 5JCTA 2WLPA 2PHDA 2OUHA 3AMMA 3HIFA 2V4AA 1FATA 2WZPP 2I2SA 3WDUA 3KSCA 5F5IA 4FOVA 4LHNA 4QX8A 5CKMA 3ZYGA 2JE9A 5KHKA 2UYAA 3GZEA 2JECA 3LGRA 4IXLA 2GN3A 4UOJA 1YEWA 4BH9A 5ANQA 3SITA 3LKJA 4Z07A 2GC3A 1MPXA 1VBA3 2GDFA 2X10A 5CA6A 2ZXQA 1W6PA 4J1WA 2ZX2A 5CYYA 3B00A 3WW3A 1UPSA 2LS6A 5FWJA 3RJRA 1BBT1 4D69A 1YFUA 1Z7S1 2GH2A 4ZHNA 3NV3A 1UQXA 5JSRA 1YIFA 1S2KA 3NKTA 4XILA 4AHZA 2YU2A 1QJX3 4CEYA 1H2MA 3C3VA 5A3OA 1KDKA 2XGXA 4GAZA 1OH4A 5C6CA 2G9GA 2YY1A 3NMBA 4IV1C 1K12A 1C8M3 3WNKA 1PVC3 1UZZA 2WR9A 3DPRC 3P1IA 4K3UA 4LUKA 5C3QA 5LEJA 2JDAA 4Z2WA 2BBAA 5FZOA 1V6KA 4UFMA 2PXJA 2AC1A 4G9SB 2P1BA 3Q8AA 3GDBA 2C4XA 2VECA 2R1DA 3UKVA 2OZJA 5FZ9A 1WCSA 2C1FA 1DGWX 1GNYA 1ST8A 3HMYA 3IPVA 2QNKA 3UESA 4EJRA 5H9PA 5I91A 5KXEA 3RI8A 1LB2A 1LOCA 3I59A 4XUPA 3FZ3A 4Q0QA 3ZN6A 1SACA 4XDQA 2UURA 1VAMA 4FTEA 5F32A 2LALA 2W9XA 5J1XA 3POSA 1V70A 4R52A 4LIVA 1MQTA 5DZFA 2WWUA 1K45A 3VBUA 1RUJ3 3UNPA 3CJIC 4BA6A 5FYCA 1H2KA 1RITA 5F5CA 4EQVA 2WQZC 5GZCA 2R043 1ZRCA 1W8HA 1YI9A 1VBC3 4RFRB 1WLDA 3UGHA 5E8AA 1AR82 2W1QA 1OXCA 4FFFA 2YB7A 4PT6A 4S2DA 4WM7A 2HWF1 2YHJA 3CLPA 4Y4RA 3B69A 4CUBA 3N7KA 1RVF1 4NWVA 1AL22 3BTYA 4CDXA 1OPOA 2A3YA 2FCUA 1SQ4A 1KRIA 4LJHA 4CZSA 3JBG3 5GLTA 5JMCA 5FZLA 2KXLA 3LSEA 1PX4A 1RHI3 3OYWB 1UCXA 4TZDA 1RUOA 2BFUS 3AKRA 2R32A 1WCUA 3DKQA 4AAXA 1NY71 3A23A 2FQPA 4J1XA 5JOZA 1TZOA 4IGQA 1A3KA 2CWSA 3GM8A 2LUWA 3ME2A 4K1YA 2V09A 4QPGB 3AYEA 1S0JA 3PL0A 4DRVA 2WNUA 1D2QA 4FP2A 2R1BA 1DQ5A 3VD5A
chains in the Genus database with same CATH topology
4CUCA 1CZTA 3P6BA 3CDZB 1SDDB 3FN9A 1I5PA 2VO5A 3I3DA 1F4HA 4MGSA 4QX1A 2E32A 4DUWA 1JZ8A 3HNMA 4MGQA 2YC4A 2WABA 4CU9A 1US2A 5EIYB 3OG2A 4OMCA 2Y6KA 3OB8A 2VJXA 5LA2A 5DMYA 4LPLA 4P02B 3I2GA 2ID4A 2YFZA 1UXXX 4JHZA 2DCKA 4XUNA 3HJRA 2WAOA 1SHWB 3VD4A 1OF4A 1OT5A 2VZVA 2Y8KA 4PQQA 3OGVA 3WEZA 4OMDA 1UYXA 3T2PA 1DP0A 4QAWA 4HG6B 3GXUA 2WUHA 3K75B 5JMOA 4E8DA 3VDAA 2CDOA 2J1UA 2EIEA 3WNPA 1JZ7A 2QQOA 4IUGA 4M4PA 3SKJE 4P00B 3IDAA 3WNMA 5G04L 3NRUA 4M4RA 2Y6HA 3OBAA 4A3ZA 4AG4A 1XC6A 1K42A 5JR2A 5JXHA 2W87A 3THCA 2J1AA 4KWUA 4CU6A 4QPWA 4LHSA 4CU8A 4BJ0A 3ACFA 3LPFA 2J1EA 2W46A 2J22A 2VCCA 4RN5A 2EICA 3MBWA 4ZY9A 4A41A 5I0DA 3SEPA 2VM9A 3VDBA 4XUOA 4ZZ5A 4CVUA 1TVGA 2VZOA 3T0AA 4XURA 3MO4A 3IIIA 1NAEA 1JYNA 2PQSA 1XNAA 3UETA 3PUHA 3T0BA 3EB7A 2YC2A 1UY4A 1ULOA 4JKLA 3HOBA 4OZOA 1JZ4A 2WN2A 1YQ2A 4Z2AA 2WBKA 3NQHA 1W0NA 1DYOA 2QQJA 4QB2A 2VQTA 3T2QA 1NX9A 1L7QA 1UY0A 3ETPA 2Y6GA 3LEIA 5HXMA 1JU3A 1RYYA 3WNNA 4TXWA 1KEXA 3WSOA 1JZ3A 1BHGA 4XZUG 2VMEA 4D8MA 3OGSA 2W5FA 1JU4A 3ABZA 1KGYA 2V4VA 1GOHA 3VD7A 4BK4A 4BK5A 2WAAA 4QDRA 2C9KA 4A42A 3EYPA 2R7EB 3C7HA 3NNGA 4GZ9A 5IYYA 3J7HA 5JXGA 3AC0A 3I2FA 3FL7A 3CIHA 2Y6LA 2LW8A 2W1WA 3IAQA 2VTFA 3C7FA 1CIYA 1NKGA 1WCQA 3ECQA 2L9LA 5LA0A 1UX7A 5C70A 2VZRA 3A21A 3MV01 3I2HA 1WKYA 3K46A 4ARYA 3WNOA 3T08A 1D7PM 2WQ8A 1GOFA 1CZSA 5C71A 3HNBM 1R64A 1JYVA 3OEBA 5JXJA 3K4ZA 2J1TA 3LEKA 3I3EA 1JYWA 2WZEA 2J1VA 2W91A 4DEVA 2EIDA 1UXZA 4JX0A 1GQPA 3FHQA 2B9VA 3LE0A 1UY3A 3CMGA 5IHRA 3GGLA 4QX0A 5LCWL 3VDCA 2YFUA 2EIBA 3C8XA 3W5MA 4QDQA 1IQDC 1L7RA 2E33A 1PX3A 2QQIA 3WF3A 3T09A 2JKXA 3C7OA 4BXSV 3FHAA 1UYYA 2Y6JA 4QX2A 5EJZB 4PF1A 4CUAA 4DEQA 3DYOA 1UY1A 3DECA 1F4AA 4MADA 4P5YA 2X09A 1SG3A 1US3A 1CX1A 4QX3A 1O8SA 4GWJA 3IAPA 4FI9A 4W4ZA 5IFTA 4ET7A 3NJVA 4QB1A 2VZ3A 2KD7A 2QBXA 1PMJX 2BERA 3E1F1 3C7GA 1HN1A 3WF0A 4MO3M 2BGPA 3VD9A 2VOTA 2VL4A 2XQXA 1OF3A 2XONA 5LA1A 3K4AA 4GWIA 1W8NA 2VZQA 2W95A 2ZEWA 2VQUA 2E31A 4YPJA 1PMHX 2OKXA 2WZ8A 1XNTA 3I97A 3MUZ1 2VMFA 2CDPA 1EUTA 3BN6A 3WQBA 5FUIA 2VR4A 3MUY1 3ACIA 2RJ2A 1ULPA 1JI6A 4XVHA 4E8CA 2WYSA 2DDUA 3A7QA 1GU3A 4DXRA 3HN3A 1UY2A 1JZ6A 2VZTA 3HPNA 2VCAA 4P08A 4TTGA 4JKKA 3LPGA 3HNYM 2HYXA 3A22A 2RVAA 2BGOA 2J7MA 3DYMA 2W1UA 1W9SA 2VZSA 3OEAA 2QQNA 2W94A 2VMDA 3ACHA 3I2KA 2ORXA 2VMCA 4LQRA 2VZUA 3BGAA 3K77A 2QQKA 2JE8A 2VC9A 4L0PA 4DUVA 4CU7A 4BDVB 2BZDA 4A44A 1DLCA 3HEIA 4DUXA 5CZKA 4ZXEA 3WF2A 2WO3A 4RYDA 5A1AA 3DYPA 1GMMA 2ORZA 2JD9A 3CZUA 4A45A 4D0QA 3LEGA 2W3JA 2X05A 2VZPA 4W50A 1JZ5A 1UYZA 1UWWA 3IB3A 2W92A 2ZEXA 4ZZ8A 3WF4A 3F2ZA 1EUUA 4QB6A 3D3AA 4UAPA 2ZEZA 1H6YA 3I2IA 2Y64A 2WO2A 2VCBA 4A4AA 1T2XA 3WF1A 1W9TA 2XHNA 5HPOA 4KI5M 1GUIA 2QQLA 2WO1A 4JKMA 3CKHA 1K3IA 2QQMA 2WDBA 5EJ1B 3K4DA 1W9WA 2E26A 2YG0A 1JYXA 4LKSA 3CQOA 5DN2A 4UOJA 2J1RA 3LQCA 1TG7A 5DQ0A 1J83A 4OYUA 2V5DA 3MV11 1MPXA 5B4XA 2X10A 3THDA 2ZXQA 5CYYA 3I2JA 2LS6A 4ARXA 3SKVA 5C7GA 3ACGA 5JUVA 4A6OA 1OH4A 4MOAA 5G05L 3WNLA 4W8JA 1W8OA 1K12A 3WNKA 3P1IA 2JDAA 5B4NA 3CZJA 2BBAA 4DXTA 5IFPA 1J84A 3U37A 1JHJA 3GDBA 2C4XA 3W5NA 2C26A 1W99A 2XOMA 1GNYA 3T0DA 1XPWA 2HLEA 3UESA 3VD3A 5DPNA 2J1SA 2RV9A 1GOGA 3ZM8A 3NJXA 4XUPA 1UMHA 2WN3A 1CZVA 3I3BA 4KMQA 1O59A 4XUTA 2W9XA 5J1XA 4XUQA 1K45A 3UNPA 4OUEA 4DXSA 1P8JA 1LNSA 1NUKA 2V72A 5JXIA 2ZEYA 1JZ2A 1UMIA 4UI9L 2W1SA 2W1QA 2YB7A 4PT6A 2W47A 3OGRA 2VZ1A 4CUBA 5IJRA 4QDSA 3SEEA 1PX4A 1UZ0A 3JXSA 2Z4FA 3C7EA 4AAXA 3T2OA 3A23A 5F7UA 1H6XA 3GM8A 2B4KA 2DCJA 3PUIA 1O8PA 1OD3A 3VD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUC A;  1CZT A;  3P6B A;  3CDZ B;  1SDD B;  3FN9 A;  1I5P A;  2VO5 A;  3I3D A;  1F4H A;  4MGS A;  4QX1 A;  2E32 A;  4DUW A;  1JZ8 A;  3HNM A;  4MGQ A;  2YC4 A;  2WAB A;  4CU9 A;  1US2 A;  5EIY B;  3OG2 A;  4OMC A;  2Y6K A;  3OB8 A;  2VJX A;  5LA2 A;  5DMY A;  4LPL A;  4P02 B;  3I2G A;  2ID4 A;  2YFZ A;  1UXX X;  4JHZ A;  2DCK A;  4XUN A;  3HJR A;  2WAO A;  1SHW B;  3VD4 A;  1OF4 A;  1OT5 A;  2VZV A;  2Y8K A;  4PQQ A;  3OGV A;  3WEZ A;  4OMD A;  1UYX A;  3T2P A;  1DP0 A;  4QAW A;  4HG6 B;  3GXU A;  2WUH A;  3K75 B;  5JMO A;  4E8D A;  3VDA A;  2CDO A;  2J1U A;  2EIE A;  3WNP A;  1JZ7 A;  2QQO A;  4IUG A;  4M4P A;  3SKJ E;  4P00 B;  3IDA A;  3WNM A;  5G04 L;  3NRU A;  4M4R A;  2Y6H A;  3OBA A;  4A3Z A;  4AG4 A;  1XC6 A;  1K42 A;  5JR2 A;  5JXH A;  2W87 A;  3THC A;  2J1A A;  4KWU A;  4CU6 A;  4QPW A;  4LHS A;  4CU8 A;  4BJ0 A;  3ACF A;  3LPF A;  2J1E A;  2W46 A;  2J22 A;  2VCC A;  4RN5 A;  2EIC A;  3MBW A;  4ZY9 A;  4A41 A;  5I0D A;  3SEP A;  2VM9 A;  3VDB A;  4XUO A;  4ZZ5 A;  4CVU A;  1TVG A;  2VZO A;  3T0A A;  4XUR A;  3MO4 A;  3III A;  1NAE A;  1JYN A;  2PQS A;  1XNA A;  3UET A;  3PUH A;  3T0B A;  3EB7 A;  2YC2 A;  1UY4 A;  1ULO A;  4JKL A;  3HOB A;  4OZO A;  1JZ4 A;  2WN2 A;  1YQ2 A;  4Z2A A;  2WBK A;  3NQH A;  1W0N A;  1DYO A;  2QQJ A;  4QB2 A;  2VQT A;  3T2Q A;  1NX9 A;  1L7Q A;  1UY0 A;  3ETP A;  2Y6G A;  3LEI A;  5HXM A;  1JU3 A;  1RYY A;  3WNN A;  4TXW A;  1KEX A;  3WSO A;  1JZ3 A;  1BHG A;  4XZU G;  2VME A;  4D8M A;  3OGS A;  2W5F A;  1JU4 A;  3ABZ A;  1KGY A;  2V4V A;  1GOH A;  3VD7 A;  4BK4 A;  4BK5 A;  2WAA A;  4QDR A;  2C9K A;  4A42 A;  3EYP A;  2R7E B;  3C7H A;  3NNG A;  4GZ9 A;  5IYY A;  3J7H A;  5JXG A;  3AC0 A;  3I2F A;  3FL7 A;  3CIH A;  2Y6L A;  2LW8 A;  2W1W A;  3IAQ A;  2VTF A;  3C7F A;  1CIY A;  1NKG A;  1WCQ A;  3ECQ A;  2L9L A;  5LA0 A;  1UX7 A;  5C70 A;  2VZR A;  3A21 A;  3MV0 1;  3I2H A;  1WKY A;  3K46 A;  4ARY A;  3WNO A;  3T08 A;  1D7P M;  2WQ8 A;  1GOF A;  1CZS A;  5C71 A;  3HNB M;  1R64 A;  1JYV A;  3OEB A;  5JXJ A;  3K4Z A;  2J1T A;  3LEK A;  3I3E A;  1JYW A;  2WZE A;  2J1V A;  2W91 A;  4DEV A;  2EID A;  1UXZ A;  4JX0 A;  1GQP A;  3FHQ A;  2B9V A;  3LE0 A;  1UY3 A;  3CMG A;  5IHR A;  3GGL A;  4QX0 A;  5LCW L;  3VDC A;  2YFU A;  2EIB A;  3C8X A;  3W5M A;  4QDQ A;  1IQD C;  1L7R A;  2E33 A;  1PX3 A;  2QQI A;  3WF3 A;  3T09 A;  2JKX A;  3C7O A;  4BXS V;  3FHA A;  1UYY A;  2Y6J A;  4QX2 A;  5EJZ B;  4PF1 A;  4CUA A;  4DEQ A;  3DYO A;  1UY1 A;  3DEC A;  1F4A A;  4MAD A;  4P5Y A;  2X09 A;  1SG3 A;  1US3 A;  1CX1 A;  4QX3 A;  1O8S A;  4GWJ A;  3IAP A;  4FI9 A;  4W4Z A;  5IFT A;  4ET7 A;  3NJV A;  4QB1 A;  2VZ3 A;  2KD7 A;  2QBX A;  1PMJ X;  2BER A;  3E1F 1;  3C7G A;  1HN1 A;  3WF0 A;  4MO3 M;  2BGP A;  3VD9 A;  2VOT A;  2VL4 A;  2XQX A;  1OF3 A;  2XON A;  5LA1 A;  3K4A A;  4GWI A;  1W8N A;  2VZQ A;  2W95 A;  2ZEW A;  2VQU A;  2E31 A;  4YPJ A;  1PMH X;  2OKX A;  2WZ8 A;  1XNT A;  3I97 A;  3MUZ 1;  2VMF A;  2CDP A;  1EUT A;  3BN6 A;  3WQB A;  5FUI A;  2VR4 A;  3MUY 1;  3ACI A;  2RJ2 A;  1ULP A;  1JI6 A;  4XVH A;  4E8C A;  2WYS A;  2DDU A;  3A7Q A;  1GU3 A;  4DXR A;  3HN3 A;  1UY2 A;  1JZ6 A;  2VZT A;  3HPN A;  2VCA A;  4P08 A;  4TTG A;  4JKK A;  3LPG A;  3HNY M;  2HYX A;  3A22 A;  2RVA A;  2BGO A;  2J7M A;  3DYM A;  2W1U A;  1W9S A;  2VZS A;  3OEA A;  2QQN A;  2W94 A;  2VMD A;  3ACH A;  3I2K A;  2ORX A;  2VMC A;  4LQR A;  2VZU A;  3BGA A;  3K77 A;  2QQK A;  2JE8 A;  2VC9 A;  4L0P A;  4DUV A;  4CU7 A;  4BDV B;  2BZD A;  4A44 A;  1DLC A;  3HEI A;  4DUX A;  5CZK A;  4ZXE A;  3WF2 A;  2WO3 A;  4RYD A;  5A1A A;  3DYP A;  1GMM A;  2ORZ A;  2JD9 A;  3CZU A;  4A45 A;  4D0Q A;  3LEG A;  2W3J A;  2X05 A;  2VZP A;  4W50 A;  1JZ5 A;  1UYZ A;  1UWW A;  3IB3 A;  2W92 A;  2ZEX A;  4ZZ8 A;  3WF4 A;  3F2Z A;  1EUU A;  4QB6 A;  3D3A A;  4UAP A;  2ZEZ A;  1H6Y A;  3I2I A;  2Y64 A;  2WO2 A;  2VCB A;  4A4A A;  1T2X A;  3WF1 A;  1W9T A;  2XHN A;  5HPO A;  4KI5 M;  1GUI A;  2QQL A;  2WO1 A;  4JKM A;  3CKH A;  1K3I A;  2QQM A;  2WDB A;  5EJ1 B;  3K4D A;  1W9W A;  2E26 A;  2YG0 A;  1JYX A;  4LKS A;  3CQO A;  5DN2 A;  4UOJ A;  2J1R A;  3LQC A;  1TG7 A;  5DQ0 A;  1J83 A;  4OYU A;  2V5D A;  3MV1 1;  1MPX A;  5B4X A;  2X10 A;  3THD A;  2ZXQ A;  5CYY A;  3I2J A;  2LS6 A;  4ARX A;  3SKV A;  5C7G A;  3ACG A;  5JUV A;  4A6O A;  1OH4 A;  4MOA A;  5G05 L;  3WNL A;  4W8J A;  1W8O A;  1K12 A;  3WNK A;  3P1I A;  2JDA A;  5B4N A;  3CZJ A;  2BBA A;  4DXT A;  5IFP A;  1J84 A;  3U37 A;  1JHJ A;  3GDB A;  2C4X A;  3W5N A;  2C26 A;  1W99 A;  2XOM A;  1GNY A;  3T0D A;  1XPW A;  2HLE A;  3UES A;  3VD3 A;  5DPN A;  2J1S A;  2RV9 A;  1GOG A;  3ZM8 A;  3NJX A;  4XUP A;  1UMH A;  2WN3 A;  1CZV A;  3I3B A;  4KMQ A;  1O59 A;  4XUT A;  2W9X A;  5J1X A;  4XUQ A;  1K45 A;  3UNP A;  4OUE A;  4DXS A;  1P8J A;  1LNS A;  1NUK A;  2V72 A;  5JXI A;  2ZEY A;  1JZ2 A;  1UMI A;  4UI9 L;  2W1S A;  2W1Q A;  2YB7 A;  4PT6 A;  2W47 A;  3OGR A;  2VZ1 A;  4CUB A;  5IJR A;  4QDS A;  3SEE A;  1PX4 A;  1UZ0 A;  3JXS A;  2Z4F A;  3C7E A;  4AAX A;  3T2O A;  3A23 A;  5F7U A;  1H6X A;  3GM8 A;  2B4K A;  2DCJ A;  3PUI A;  1O8P A;  1OD3 A;  3VD5 A; 
#chains in the Genus database with same CATH topology
 3MW4 A;  2KM2 A;  3JD7 3;  4XBQ A;  1YNA A;  1REF A;  3ROU A;  2PFW A;  3WW2 A;  1LOE A;  1ZZ7 A;  4COV A;  1JZ8 A;  3R4U A;  2P4E A;  2EA7 A;  5DZE A;  3MLL A;  5FZ4 A;  2HWC 2;  2Y0I A;  1S4C A;  2D3P A;  3I2D A;  4LBN A;  3EQE A;  4RQP B;  1VAV A;  3OJB A;  4DQA A;  1US2 A;  5EIY B;  2KA3 A;  1FV2 A;  2QZ3 A;  3GCX A;  2Y6K A;  5C9A B;  1F8V A;  5B2G B;  5L7O B;  2WNO A;  3RZH A;  2VU9 A;  1NE6 A;  4LPL A;  5JR7 B;  2NM1 A;  5FYY A;  3GCW A;  3I2G A;  3KCC A;  5A7N A;  1H1A A;  1RUH 1;  1DQ0 A;  3LA2 A;  1UXX X;  1EPZ A;  1IG3 A;  1DYK A;  1WME A;  4XUN A;  1A78 A;  2GNM A;  2FDF A;  1WMX A;  2E7A A;  5C3O A;  2R0F A;  3PVB B;  2RMU 1;  2E6V A;  3DEM A;  2GAL A;  4YRD A;  3WEZ A;  1BEV 1;  1SDW A;  1RUI 2;  3POJ A;  3RVH A;  1DP0 A;  4AK3 A;  5LRR A;  2A71 A;  5DDJ 3;  4ZU4 A;  4D94 A;  2DWR A;  3VL9 A;  2QQU A;  5GM0 A;  4CXW A;  4E8D A;  3CU7 A;  3VDA A;  4FPH A;  2MEV 2;  4UW4 A;  2CDO A;  1LOD A;  4Q4X 3;  2J1U A;  2R06 2;  1FYU A;  3J7L A;  1EAH 1;  2VQ0 A;  3U0Z A;  1Q8O A;  4LIT A;  4BMB A;  2A7A A;  3WW4 A;  1GNZ A;  4AQT A;  1OOP C;  1VBD 1;  4L2N A;  2P17 A;  1G8W A;  3ZKU A;  1XC6 A;  1W06 A;  5IVY A;  1Y3T A;  2RHP A;  2NMN A;  2RM2 2;  3GBG A;  2W87 A;  3BTA A;  3THC A;  2WZR 2;  4Q4Y 2;  5C8C A;  3I54 A;  5JVV A;  1SBE A;  4LXL A;  4KWU A;  3RJ2 X;  3RYP A;  1X9P A;  3ES4 A;  4QHB A;  3UJO A;  3THP A;  1XSR A;  1O4Y A;  2YZ4 A;  4BJ0 A;  3HT2 A;  3P3P A;  3ILF A;  2YXS A;  5FMD A;  4M0H A;  5I0D A;  2J22 A;  1H1I A;  5GZD A;  3MBW A;  3VBH A;  2R07 1;  5BNP C;  1ND2 A;  1NCR B;  4ZZ5 A;  4PQ9 A;  1TVG A;  2P3I A;  4LBQ B;  2ZKN A;  2C24 A;  4QGM A;  4V2W A;  3A0K A;  3MO4 A;  3DXU A;  4UW5 A;  3RQ0 A;  4BYY A;  1OLM E;  3POB A;  1XNA A;  4JGZ A;  4LTA A;  2JX9 A;  1YIP A;  1MS8 A;  4XHX A;  2XBO 2;  1Q5O A;  3VBO B;  1J3R A;  3ZFF C;  4DMI A;  1LU1 A;  4AQ2 A;  4AED C;  4BZ4 A;  1H9W A;  2PLV 1;  4AF9 A;  1LED A;  1JZ4 A;  1WW6 A;  1YWK A;  4FPK A;  4OZO A;  4Q4W 2;  3LIG A;  4PF5 A;  4BXF A;  5A1F A;  1COV 3;  4LIU A;  5H9S A;  5LBC A;  4JDM A;  3AB0 A;  3UL2 A;  2P6H A;  2QQW A;  2ARA A;  2D40 A;  1PZ7 A;  4I30 A;  4ASL A;  5I0S A;  4FQ4 A;  2Q0A A;  4OUS A;  3ZXF A;  4Q0V A;  1FMD 1;  2C9A A;  1BCX A;  1DQ6 A;  1NX9 A;  3UJQ A;  1XU1 A;  1UY0 A;  1GAN A;  5FBZ A;  2FD8 A;  4EWD A;  4PJY A;  4BLI A;  4FPO B;  1B35 B;  1PZ8 A;  5F39 A;  3L9J T;  1JZ3 A;  1YLL A;  4I3G A;  4FP3 A;  2NMO A;  3OGS A;  5CU1 A;  2VE1 A;  1O3R A;  4ONU A;  2EAL A;  2GND A;  1WW5 A;  1X33 A;  1JU4 A;  2XB6 C;  3ABZ A;  3KHB A;  4CCD A;  4MYE A;  1RL3 A;  1VBE 2;  4QHZ A;  3AP5 A;  5F2W A;  2FZ1 A;  4QDR A;  3TNQ A;  1NG0 A;  2RS3 2;  1D4M 2;  3C7H A;  5T5P A;  1Q8V A;  4J25 A;  4P9W A;  2H0B A;  1VMH A;  3J7H A;  4Z82 A;  4NII A;  5JXG A;  2BVV A;  3PVN A;  1HJG A;  3I2F A;  3PDQ A;  4EE2 A;  5HBA A;  4O65 A;  3O1O A;  1ZZ6 A;  1Q8Q A;  2XKP A;  3CIH A;  4YG3 A;  5I93 A;  1DFQ A;  3WUD A;  1LJ7 A;  4AVV A;  2W1W A;  3JQX A;  4FOW A;  3IKW A;  4IEX A;  1TE1 B;  2VTF A;  1Z78 A;  4YGB A;  3U4S A;  5FP3 A;  3QOP A;  3V56 A;  2E7Q A;  4A7Y A;  1CIY A;  3VBR C;  2BGC A;  3ZVX A;  3TEW A;  1PO1 1;  3PTR B;  4KGQ A;  2DV9 A;  5FXW A;  3URF A;  2X29 A;  4IV1 A;  2L9L A;  2BNN A;  1OLQ A;  1VRH 1;  1ZBA 1;  3DPR A;  3A21 A;  3MV0 1;  5C3S A;  1Z7S 2;  5J96 B;  1WKY A;  3TEZ A;  3OBZ A;  4AQS A;  1OMI A;  4QPI C;  2QFE A;  2JDP A;  1O5U A;  2R0H A;  3ALQ A;  3EJK A;  1HRV 1;  3MF9 A;  3ORJ A;  2NP0 A;  5A3U A;  1CVN A;  4ISQ A;  3J7M A;  1CZS A;  4CDU B;  2VG9 A;  1MZF A;  1HB2 A;  2XL9 A;  3TN9 3;  4DPN A;  2WKK A;  1QJY 3;  1R64 A;  5FLI A;  3K4Z A;  5JXJ A;  3MW2 A;  3HQU A;  3A0N A;  3ZSJ A;  3VKM A;  1QDO A;  2B7Y A;  3LEK A;  3KGL A;  3I7D A;  1V6L A;  5DAW A;  5JLV A;  4NIA A;  2B9V A;  4K1Z A;  4UBH A;  2GME A;  3TAY A;  1QJU 3;  1YFX A;  1ZBE 3;  1R08 1;  4FXK B;  4CCC A;  4BQ4 A;  3VDC A;  1AL0 G;  3CJI A;  4UW6 A;  1NA1 C;  2EIB A;  3VZO A;  4GXL A;  4LHL A;  5CEH A;  4HAN A;  1ASJ 3;  2HWE 2;  2ZGO A;  4QDQ A;  3WT3 A;  2J42 A;  2E33 A;  2WL1 A;  2ZMK A;  2RS5 1;  4ZXK A;  4GMP 1;  4QQO A;  3AP4 A;  4B1M A;  1WZX A;  4YGE A;  1W6M B;  4IEQ A;  1D0G A;  4KQ7 A;  5FZ0 A;  2IXK A;  4HKW A;  2JKX A;  5CFC C;  3RYR A;  3C7O A;  1EPW A;  2PMW B;  3BCW A;  3FHA A;  4X8P A;  4CDQ B;  5LEK A;  1XNB A;  5LK5 A;  3A4U A;  1RUG 1;  4PF1 A;  3PLQ A;  4PLN A;  1TMF 2;  1OQE A;  1UY1 A;  4O7X A;  3MI8 A;  1AR7 3;  2HWF 2;  1PGL 1;  1UO9 A;  1SPP B;  4PHZ A;  1RVF 2;  2X09 A;  3OUH A;  2DU1 A;  2QUO A;  4XIK A;  2ZGS A;  2WO7 A;  4WV8 A;  4NRP A;  1CX1 A;  4HLT A;  4NPM A;  4QQ2 A;  4FI9 A;  1HXS 3;  5FBJ A;  3BIW E;  2Q4S A;  4H14 A;  5FY1 A;  3WW1 A;  4Y20 A;  4OUL A;  2PA7 A;  4DY3 A;  4P9I A;  3RZJ A;  4XAA A;  3JU9 A;  3FBM A;  5A32 A;  1YO8 A;  4ISR A;  3VHR A;  4MGZ E;  1NY7 2;  2GP3 A;  5IAT A;  5LY1 A;  1E57 A;  2D6N A;  1KXG A;  3ZYJ B;  1JUI A;  3HQR A;  1PVX A;  1QXP A;  3PME A;  1O3S A;  1CPM A;  2GH8 A;  3SNM A;  1OF3 A;  2XON A;  1ZRE A;  4AW7 A;  3TYJ A;  2X5I B;  1Q43 A;  2IUW A;  3K4A A;  3J8F 3;  4GWI A;  1A34 A;  1YRZ A;  5FZG A;  1CAU A;  1HB1 A;  2BP6 A;  2W95 A;  1LES A;  1HN0 A;  1V9U 3;  2GNT A;  4QHO A;  1GV9 A;  1PMH X;  1RTV A;  1QOS A;  1FOD 3;  1W9F A;  2ZX4 A;  2XJV A;  3FX3 A;  4K40 A;  4OI4 A;  4CU6 A;  1JYI A;  2CDP A;  4YM1 A;  3BN6 A;  2HJI A;  5IVJ A;  4NUB A;  5A3W A;  5FUI A;  1PO2 1;  3KT1 A;  2E53 A;  1YQ6 A;  4NRO A;  3CF6 E;  5L36 A;  2WYS A;  5I0R A;  4LR4 A;  1SZB A;  4JCK A;  4GH4 B;  4UF0 B;  4XAE A;  1UY2 A;  1RUH 2;  4PLM A;  2BRT A;  1SMV A;  3WG3 A;  4A7Z A;  3HPN A;  5IVF A;  1PM4 A;  4P08 A;  2XL7 A;  3S5Q A;  1QQP 1;  3FLR A;  3HNY M;  4EN8 B;  1ND3 C;  3A22 A;  4IE5 A;  4M3C A;  4BB3 A;  4YAR A;  1ONA A;  3PUA A;  4E2G A;  2BGO A;  3M3O A;  1BEV 2;  4JVA A;  2Q8O A;  1WA6 X;  3ZPY A;  4Z1V A;  2G4I A;  5LAS A;  3UKN A;  4FAH A;  4Y5Z 0;  1OOP A;  1W9S A;  1S0C A;  4L99 A;  5FZ1 A;  5FKB A;  5T55 A;  2W94 A;  4AGG A;  1CON A;  3I4I A;  1LCL A;  2AZ5 A;  2VXJ A;  1I6X A;  1OFN A;  3ASI A;  4LQR A;  1ULD A;  4JGY B;  1ZM1 A;  1EAH 2;  1YHF A;  3MID A;  4W6W A;  2CL2 A;  4I02 A;  2XG3 A;  1JOP A;  1JH5 A;  2VC9 A;  4DUV A;  2R30 A;  1VBD 2;  1NT0 A;  1WW4 A;  2ET1 A;  4N53 C;  4CU7 A;  1H30 A;  1MVE A;  3J26 N;  1Y9Q A;  4JTN A;  1IPS A;  2PHF A;  1W0P A;  2EXK A;  5CZK A;  3WF2 A;  1ZZ9 A;  3KCY A;  4XIO A;  5BNP A;  3ES1 A;  3OBT A;  5E88 A;  1VJ2 A;  2A6X A;  3FFZ A;  1VBA 1;  4WM8 C;  5A1A A;  4QKN A;  3DYP A;  1URX A;  4KU8 A;  3WUC A;  4U2A A;  2D44 A;  4YFZ A;  4MGY E;  5LK7 B;  5C4W C;  3LA3 A;  2NQY A;  1F2N A;  1QJX 1;  4MGK E;  4AED A;  1CR7 A;  4V1P A;  1QGL A;  2Z69 A;  2W92 A;  3EHK A;  4MV2 A;  2ZEX A;  3FLP A;  4AQ6 A;  5CAZ A;  1Q3E A;  1ENS A;  2RDQ A;  3OY8 A;  3F2Z A;  3TWI A;  1C8M 1;  3M3C A;  4Q0P A;  1J1L A;  1PVC 1;  2HWD 3;  5C3R A;  1ZZB A;  3D3A A;  4DIN B;  2ZEZ A;  4AI0 A;  1HLC A;  4P9Y A;  5F3G A;  3T4V A;  1MS1 A;  2HH9 A;  1ODN A;  2ZGT A;  2Y64 A;  2WO2 A;  3SH3 A;  5FUN A;  2YU1 A;  4BQ3 A;  1KQR A;  2YGL A;  3LDB A;  1XSQ A;  1W6Q A;  3AZY A;  2DVD A;  3GBF A;  4G3Y C;  4GB3 3;  3VDD C;  2PLV 2;  1DF0 A;  1FI2 A;  4S2F A;  1GUI A;  2QQL A;  1K5M B;  1JOB A;  2ZHM A;  4YM2 A;  2GMM A;  1MS5 A;  1X8M A;  4XF9 A;  2DTY A;  3HT1 A;  5BNO C;  1RUN A;  4Q8K A;  2WDB A;  1W39 A;  4CP9 A;  1WWY A;  4RHV 3;  2OVU A;  1CPN A;  5EJ1 B;  2B46 X;  3K4D A;  2YG0 A;  4C0H A;  4CCL A;  1U5X A;  1FX5 A;  4RGK A;  1JOJ A;  3CQO A;  3ZMO A;  3BI3 A;  4LNV A;  1KD7 A;  2J1R A;  4W65 A;  1RUJ 1;  1J83 A;  3AYD A;  2VBP A;  4OYU A;  1M4W A;  4Y22 A;  5DQ0 A;  5T3N A;  1FNZ A;  1A8M A;  1UZV A;  5FYB A;  3THD A;  4E4Z A;  5JOW A;  1RUD 3;  4OZX A;  1YCI A;  3KQR A;  2R04 1;  3O1S A;  1VBC 1;  3OD4 A;  3K3O A;  4RR3 A;  3OGG A;  4X6Q B;  5C7G A;  2FDH A;  5JUV A;  5L9R A;  3N7J A;  3ZSE A;  3NJZ A;  1MS4 A;  2B39 A;  4BM8 A;  5FR3 A;  4A6O A;  5AFB A;  3LD8 A;  3D4K A;  4ASM B;  4QM9 A;  1C5I A;  1F5F A;  5G05 L;  1AYM 3;  1W28 A;  4XAB A;  5FFO C;  5FDB A;  2ZCW A;  5F1R A;  2HEW F;  2VBD A;  3JBG 1;  1ZA7 A;  4QWN A;  3VKF C;  2WFF 3;  3H1W A;  4FPL A;  3CZJ A;  4YW4 A;  5IFP A;  4Y1U A;  2DTW A;  3U37 A;  2Y34 A;  3VBR A;  3AL5 A;  3H8U A;  1O3Q A;  5FO7 B;  5DUV A;  1ENX A;  1BYH A;  2JD4 A;  3B9I A;  3T0D A;  5SV5 A;  1XPW A;  3VD3 A;  3O0V A;  1GP4 A;  5FQ0 A;  2Q1F A;  1NQJ A;  2J1S A;  2RV9 A;  1NE4 A;  3H1Y A;  2UWB A;  5IW0 A;  1W05 A;  3ZM8 A;  5FZC A;  1IKQ A;  4XF1 A;  1CZV A;  1OUX A;  3JD7 1;  4QPI A;  1O59 A;  3MF6 A;  2JIJ A;  2XLA A;  4AGV A;  1S1A A;  1W03 A;  4DIQ A;  1LGC A;  4H7L A;  1VRH 2;  1C57 A;  3UK9 A;  1V00 A;  1LOF A;  2PHL A;  3ZXK A;  2JJ6 A;  4XMA A;  4OUE A;  4DXS A;  4R9B A;  1P8J A;  3RI9 A;  1PIV 3;  2ZA9 A;  1LNS A;  4CEW C;  3J9S A;  3BAL A;  2V72 A;  4DFS A;  2QDN A;  2DUQ A;  5JXI A;  4LBO A;  1JZ2 A;  4NJ4 A;  5GLU A;  3G6J B;  2LTN A;  1T6G C;  1H8T B;  3BTZ A;  2I45 A;  4GKX A;  4Q2F A;  4UI9 L;  1AXY A;  4DNY A;  2AEZ A;  1F9K A;  2RR1 2;  2W47 A;  3D82 A;  3OGR A;  4Q4V 3;  1QOT A;  1G9D A;  3IIA A;  5C5T A;  5LRS A;  1NA1 A;  4IV3 C;  5FP7 A;  4LLO A;  3ATG A;  4HET A;  4E9K A;  5EYY A;  1FPN 3;  1IS4 A;  1RUF 2;  5DAP A;  2VBB A;  3AM2 A;  2BOI A;  2P3Y A;  4QDS A;  5FZO B;  4XJZ A;  5DAV A;  1TEI A;  1V6M A;  4AR2 A;  3H0O A;  3NV4 A;  1R08 2;  3JXS A;  2Z4F A;  5DDJ 1;  3JZV A;  3H3Z A;  4WZC A;  3T2O A;  5CFC A;  5KHG A;  5A3N A;  5F7U A;  5FK8 A;  3IPV B;  1AR6 3;  1XQN A;  1TNR A;  4FPC A;  4Y24 A;  5LBE A;  4BQW A;  5ACA 1;  1HKD A;  1QY4 A;  4Q4X 1;  2D3S A;  4NHK A;  4F7Z A;  1O6U A;  2MNG A;  3WP4 A;  1LHO A;  2RS5 2;  3MFC A;  5D2A A;  4IGO A;  1W6N B;  1W2A X;  3ZN6 B;  4DRR A;  1YFY A;  4MGS A;  2IZW A;  1F4H A;  4BQ2 A;  3MLK A;  4XTP A;  2VOV A;  4KWJ A;  1HRI 3;  4IE6 A;  1MQT B;  2P6C A;  2YC4 A;  2AEY A;  4S2G A;  1RUG 2;  3LCP A;  5EHD A;  2BFU L;  2HBT A;  4YGC A;  3VKL A;  1POV 0;  1DQ1 A;  4AI3 A;  5A6Z A;  2XPJ A;  3ZYH A;  3IWZ A;  1WMF A;  4OMC A;  2OUJ A;  3EMR A;  4XHB A;  1PGL 2;  1AVB A;  2VJX A;  1RUE 2;  3RWN A;  1MZ6 A;  3PVO A;  4QPG C;  1ULC A;  3M3Q A;  5A6X A;  5DMY A;  2PHU A;  3NKG A;  4WM7 B;  3ITQ A;  2D93 A;  1U5Z A;  4H3W A;  4K21 A;  3X29 B;  3JB8 A;  5IAX A;  4JHZ A;  4BQ1 A;  4I0A A;  3HJR A;  4V2V A;  2O1Q A;  4Q26 A;  3VD4 A;  2YC0 A;  3W59 A;  4L97 A;  3LDR A;  2Y8K A;  1YJK A;  5FXZ A;  2ERF A;  1UW8 A;  2BTV C;  4OMD A;  1PGS A;  4QPY A;  1UYX A;  3IZO A;  3T2P A;  2DFB A;  4I01 A;  1H2N A;  4QAW A;  2BWA A;  5HCF A;  4HG6 B;  1OD5 A;  1UN1 A;  1ZVF A;  5CAD A;  1OHF A;  2ZJC A;  2ZML A;  4XXP A;  4W6X A;  1RUC 3;  5KHJ A;  5L7O C;  2XJR A;  1COV 1;  1W2N A;  3BVC A;  3R4S A;  5F9T A;  4IUG A;  3MDP A;  4M4P A;  2B42 B;  4XZP A;  2AH2 A;  3WNM A;  5G04 L;  1JMU B;  4KL1 A;  3DF0 A;  1OVS A;  2Y6H A;  4K9S A;  2DCZ A;  1PO2 2;  4I09 A;  4C0B A;  1W2O A;  5T52 A;  1DGR N;  4QMA A;  1ND3 A;  3VUO A;  5JXH A;  1DBN A;  5T5L A;  4CDW A;  1KFX L;  4SLI A;  2WNV B;  2JDM A;  3SCF A;  4BLJ A;  5BUV A;  1UIK A;  5IVC A;  5L19 A;  5FWE A;  1ULG A;  3RG0 A;  4CU8 A;  1PK6 C;  3ZXA C;  1WBL A;  2Y26 A;  3LPF A;  1QXJ A;  2J1E A;  4M3C E;  4CXX A;  5AC9 3;  3EBR A;  4A41 A;  3RS6 A;  1QQP 2;  2WA4 A;  1UU5 A;  2VM9 A;  1YXW A;  3LA7 A;  1POV 3;  3LF7 A;  4BHP A;  3W58 A;  2VAU A;  4AEK A;  3K48 A;  1N1V A;  3DCQ A;  4YW1 A;  3D6E A;  2WA3 A;  5IK8 A;  3SQO A;  4RGA A;  1NAE A;  2XQR A;  1AR8 3;  1JYN A;  2PQS A;  4N53 A;  3V0B A;  3UET A;  1GKB A;  1WBF A;  1QNY A;  2ZOE B;  3K51 A;  3OBR A;  3PUH A;  4LLF A;  4MSV A;  1AL2 3;  4WVZ A;  1IOA A;  1HV1 A;  2XJQ A;  1ZYB A;  4YW6 A;  1GSL A;  4KGG A;  3WG2 A;  4N8M A;  4YNI A;  1JW6 A;  4HVQ A;  3EB7 A;  4FFH A;  2RE9 A;  5FRE A;  3V65 A;  1VMF A;  2I07 B;  4ES8 A;  3HVD A;  1UY4 A;  4JKL A;  2VMI A;  3HOB A;  4WM8 A;  4NN0 A;  5DG2 A;  5F37 A;  1W90 A;  2PTM A;  5LWB A;  2PHX A;  1SCS A;  4YVW B;  3K3N A;  2OW4 A;  1OC1 A;  1HIX A;  4Z2A A;  1S0E A;  5C4W A;  1NCR C;  3NQH A;  3VZK A;  1AXZ A;  2QQJ A;  3PUR A;  4Y1Z A;  4Q8L A;  3C2U A;  1AYN 3;  4MXV A;  1UOG A;  1X7N A;  3H50 A;  3T2Q A;  1L7Q A;  3ETP A;  2A73 B;  5FP4 A;  3VBO C;  2LRP A;  3LEI A;  3EO6 A;  3WP6 A;  1NZI A;  1QJX 2;  4H7M A;  5IWF A;  4EWE A;  2DBI A;  2V73 A;  3WNN A;  4YSF A;  3VDD A;  3M3E A;  2O8Q A;  3WSO A;  2EF6 A;  4K6B A;  1C5H A;  4MHU A;  2VME A;  4DZG A;  4JDN A;  1C8M 2;  4QQL A;  1PVC 2;  2W5F A;  4RSU A;  3TN9 1;  3ETQ A;  1FNY A;  1QJY 1;  1WA4 A;  2V4V A;  1R1Z A;  3T2T A;  5A3L A;  5BNO A;  3ZFG A;  5FY7 A;  1DLL A;  3EYP A;  2A3X A;  1F5J A;  2R7E B;  2ZBJ A;  4JGZ B;  4TWT A;  5IYY A;  3U10 A;  5FPL A;  1IKP A;  4AVB A;  1VBB 2;  2QTW B;  1QJU 1;  1ZBE 1;  1QU0 A;  1JUH A;  3FL7 A;  1VMJ A;  2A70 A;  3RZG A;  1GLH A;  1B35 C;  4HPK B;  1ASJ 1;  2BW8 A;  3NAP C;  2WWS A;  4QQH A;  1RUI 3;  3WD5 A;  5BPX A;  4FXG B;  1ZZC A;  3C7F A;  5I8Y A;  2GC2 A;  5JZG C;  2WQ4 A;  1H4H A;  4NAM A;  4F8A A;  1G86 A;  1W3V A;  4Y1Y A;  1NKG A;  2MEV 3;  1RUJ 2;  3KF5 A;  3WDY A;  1H1M A;  3ECQ A;  1L7L A;  5LA0 A;  1W8F A;  4UWD A;  5C70 A;  4P9J A;  4N9H A;  2VZR A;  2YV8 A;  4KNC A;  2R04 2;  3NJY A;  1XYP A;  3NV1 A;  5APA A;  4LOT A;  4XE9 A;  3AP9 A;  5DUU A;  1AR9 3;  4D6S A;  4YG6 A;  4XDO A;  2BNM A;  1F31 A;  4MVT A;  3K46 A;  1AR7 1;  3WG1 A;  1NQD A;  2HYK A;  5FYU A;  5DAQ A;  2CGO A;  1D7P M;  4LT5 A;  4OHW A;  4AGR A;  1S2E A;  1L3J A;  5KC6 A;  5A7P A;  1VB4 A;  1HXS 1;  5IAV A;  5BNN B;  1JYV A;  4GWN A;  1JS9 A;  2LRO A;  4FPG A;  2R16 A;  2YBK A;  3IMM A;  1SBD A;  2WZE A;  5AFE A;  2J1V A;  3WHU A;  4JX0 A;  2DUP A;  1LR5 A;  3S5A A;  3MYX A;  1UOF A;  2JEN A;  4HK8 A;  5D8A B;  1C8N A;  1DGR A;  2OT7 A;  2V5Y A;  2Y33 A;  4LO7 A;  4CEW A;  4YZ1 A;  3C8X A;  1ZX5 A;  3ENR A;  3J8F 1;  2BJS A;  2ZX1 A;  1IQD C;  4CDU C;  4CRQ A;  1DZT A;  4CUG A;  3AFG A;  1V9U 1;  4LUL A;  3DL3 A;  1FOD 1;  5FXV A;  1UZW A;  3WF3 A;  5JI9 A;  1EV1 2;  5EYX A;  3N9N A;  4ATE A;  4Q4W 3;  4LHK A;  4IV3 A;  1TQ5 A;  4NMI A;  5AVP A;  4Y4Y A;  1JN2 P;  2CTV A;  1DGW A;  5JSP A;  4XJ9 A;  2AEN A;  4CUA A;  2JEM A;  1GWK A;  2VOK A;  3GJB A;  3BIE A;  3HD8 B;  4P5Y A;  4M0N A;  2BVB A;  1UU4 A;  4AVT A;  1O8S A;  3N9L A;  2LM3 A;  1MS9 A;  4ET7 A;  3KV4 A;  5IT6 A;  2A6Z A;  2BPA 2;  2PAM A;  3H3U A;  1OQ1 A;  1APN A;  3WLU A;  2H6B A;  3GYD A;  5I0U A;  3QH7 A;  5DDJ 2;  3WY6 A;  2BER A;  4MGI E;  4XOG A;  3ZYP A;  4LO6 B;  3C7G A;  4CDQ C;  1HN1 A;  2WNE A;  4AHW A;  2AGS A;  1WMD A;  5ACA 2;  4N43 B;  3ZXJ A;  4KH9 A;  3P3N A;  5K8S A;  4RD7 A;  1VBE 3;  1R09 3;  1S0B A;  3OYW A;  1OPM A;  5FMO L;  2RS3 3;  4Y3O A;  5LA1 A;  5E1R A;  1U12 A;  1PNF A;  4RL7 A;  1W8N A;  5AVA A;  2BU9 A;  2D97 A;  4QPG A;  2VQU A;  1XXN A;  2JE7 A;  3D0J A;  3VZN A;  4P9L A;  2ARB A;  4XFA A;  1YQ5 A;  3E6C C;  3WVJ A;  5M0T A;  3V0A A;  5T54 A;  5A3T A;  2OQ7 A;  1QNW A;  4XEZ A;  4AVC A;  3E97 A;  3VLB B;  3MUY 1;  3ACI A;  1ULP A;  5JIA A;  3E5Q A;  1XE7 A;  4XFI A;  4E8C A;  3ZFE C;  2G1M A;  2PN5 A;  5JOY A;  1OUS A;  5FJH A;  2TUN A;  3A7Q A;  3D5O A;  3WQ7 A;  3HN3 A;  5HCH A;  1AJO A;  3E6B A;  1GWM A;  4HOO A;  2DF7 A;  3R6S A;  2VCA A;  2X5I C;  3ZOI A;  3AVS A;  1W8Z A;  4TTG A;  4JKK A;  5HCA A;  2HYX A;  2ZGM A;  5L7O A;  5EXO A;  4F83 A;  1LOA A;  5FK7 A;  2D6O X;  4PDW B;  5ERL A;  3E6D A;  2D98 A;  2VW0 A;  3MPB A;  3MIB A;  4GB3 1;  3UKT A;  2VZS A;  3OEA A;  4NRQ A;  3N35 A;  4YWA A;  2ILM A;  1A6C A;  2XJT A;  3I2K A;  3ACH A;  4UFL A;  2Q5T A;  2ORX A;  2F17 A;  1OFS A;  3ACL A;  4R4Z A;  5H9Q A;  3H7Y A;  1COV 2;  1O91 A;  2G19 A;  4AI2 A;  1Z0H A;  5BNQ A;  3ZMN A;  2QQK A;  2JE8 A;  1PK6 A;  2ZKL A;  3L2H A;  1H8V A;  4RHV 1;  5FZ6 A;  4HT1 T;  3KB5 A;  3PTY A;  4N7U A;  4R4X A;  2A6W A;  5KXC A;  3VGI A;  1BBT 2;  3PNA A;  3WQ0 A;  4BPZ A;  4DUX A;  1S55 A;  2ZHK A;  3ZYR A;  2UYB A;  2WO3 A;  4AI1 A;  1V0A A;  2HWE 3;  1G9B A;  5DXD A;  1BJQ A;  1JYT A;  3AP6 A;  1RUD 1;  5FZA A;  2VNO A;  2ORZ A;  4BWO A;  2EXI A;  4YVS B;  4A45 A;  4EN6 B;  4JGY C;  5IVE A;  1Y7B A;  1PGW 1;  2JXA A;  2VZP A;  5FV3 A;  5LB6 A;  1UYZ A;  3SH5 A;  4EZH A;  5CG8 A;  3IB3 A;  2O8O A;  1BZW A;  1REE A;  4YZ3 A;  4WVV A;  3RWK X;  1AYM 1;  2JKB A;  4OQ9 A;  5LAT A;  4ZZ8 A;  1EUU A;  1F15 A;  1MS3 A;  1TMF 3;  4IEZ A;  5FMB A;  1VB2 A;  1N3O A;  2WFF 1;  3PUS A;  4UAP A;  5J09 A;  1AUY A;  5KBF A;  5DUW A;  1V6N A;  1O7F A;  5A7W B;  1NOV A;  3I8T A;  3CJX A;  1OLR A;  3AZZ A;  2F4L A;  4A4A A;  5FPZ A;  3WF1 A;  1W9T A;  2XHN A;  1GBG A;  3QBQ A;  5A3M A;  1OA3 A;  3S7I A;  4AFC A;  1G9F A;  2FMY A;  2OZ6 A;  3UT0 A;  5CBL A;  3IN9 A;  4PI2 A;  4DXZ A;  1ZRI A;  2BWC A;  4KG8 A;  4LO8 A;  3CKH A;  4G4F A;  2QQM A;  4HN1 A;  5FZD A;  3WG4 A;  4PBP A;  2YBP A;  1W9W A;  1XYN A;  2E26 A;  2EAK A;  4PIZ A;  1WLT A;  2E63 A;  3J7N A;  4CTE A;  2JDU A;  4YW5 A;  2QCS B;  2CY6 A;  3L2Y A;  5A3P A;  4UFH A;  1PIV 1;  4GUL A;  5B4X A;  2ARC A;  4KU7 A;  1G7Y A;  1Y43 B;  4OI0 A;  3WCS A;  3I2J A;  5FMO S;  5DG1 A;  1ZNP A;  4HFS A;  1CAW A;  3AMH A;  4IEU A;  4TN7 A;  1J3P A;  4UXA A;  3M70 A;  4ARX A;  5F3I A;  3WP3 A;  3USS A;  4PIX A;  1GZ9 A;  3LIH A;  4Q4V 1;  1C4R A;  1BK0 A;  4AED B;  2W2I A;  5JWP A;  3ZN4 A;  4MOA A;  1AZD A;  1XE8 A;  3ILN A;  1B35 A;  1W8O A;  3OY8 B;  5HCB A;  3WNL A;  2GZW A;  3KCX A;  2DUO A;  3NAP A;  1FPN 1;  1DQ4 A;  2ZTN A;  1O4Z A;  1LHU A;  2ARX A;  4FO9 A;  4LK6 A;  1UF2 C;  3OD0 A;  3RRD A;  3IDE A;  4DXT A;  2Z79 A;  3AYA A;  1J84 A;  4QU1 A;  1GQH A;  5JZG A;  4RS5 C;  2P5B A;  3SHR A;  1W6Q B;  4LE4 A;  1FV3 A;  4ZKT B;  1BQP A;  2HBU A;  2C26 A;  3GZU C;  1W99 A;  1SLT A;  4I3P A;  2JG9 B;  1UOJ A;  2XOM A;  4AFD A;  4LA2 A;  2HEV F;  4CYD A;  2ZMN A;  1AR6 1;  1R1A 3;  2HLE A;  3VBS B;  2E9Q A;  3KV5 A;  1VE0 A;  4BIS A;  5DPN A;  5BXX A;  1KJL A;  4WVW A;  1NXD 1;  4FBF A;  4NAO A;  4FT8 A;  1GZW B;  1V6I A;  5FO8 B;  4NHX A;  1RIR A;  4ZON A;  3CEW A;  5L73 A;  4KMQ A;  3MFA A;  1N1S A;  1SFN A;  2NN8 A;  1OSG A;  1HRI 1;  4XUQ A;  3RZZ A;  4LK7 A;  3FHI B;  3O0W A;  2HWB 1;  3AP7 A;  1JBC A;  1NUK A;  2ZZQ A;  4XJA A;  1AR7 2;  2EIG A;  1N1T A;  4RR3 B;  1UMI A;  2W1S A;  2QQV A;  2RMU 2;  1TME 3;  2PAK A;  4H55 A;  4OI1 A;  3LAG A;  2XJU A;  3O5S A;  4OHX A;  3MPP G;  5EV7 A;  4C1X A;  5IJR A;  1WD4 A;  1PM7 A;  1JYC A;  2ZX3 A;  2NLR A;  3OOX A;  4ZS3 A;  2OXB A;  4B4Q A;  4CDU A;  4CP2 A;  1NXM A;  5JAX A;  3WDX A;  2CAU A;  2VY0 A;  1BMV 1;  4E2Q A;  2XKO A;  2IWG B;  4KWK A;  3THT A;  4B4R A;  2JDK A;  3O14 A;  1VAL A;  3VN4 A;  2P3J A;  2SLI A;  5F5A A;  1XJA A;  3LB9 A;  4QGN A;  2JDZ A;  5GLZ A;  1H6X A;  2ADE A;  2VTX J;  4NHY A;  4XJU A;  4WVM B;  4QGL A;  4Y5T A;  1IQA A;  2B4K A;  1H8T C;  3ZYI B;  1RUC 1;  3AMQ A;  2DCJ A;  3J8F 2;  1XB9 A;  1O8P A;  5GLV A;  4AZZ A;  1J1T A;  1V9U 2;  4TLG A;  3RMY A;  1OQD A;  3P6B A;  1HV0 A;  5C8W A;  2XVK A;  2CYF A;  3MZH A;  2PHR A;  5H9R A;  5HI0 A;  4QPI B;  3VHN A;  1PNG A;  2VO5 A;  1YYN A;  3I3D A;  4QX1 A;  4ZPI A;  1VPH A;  3OPW A;  5TSW A;  3WDV A;  5CFD B;  4CP0 A;  1A8D A;  2PQQ A;  3HNM A;  2VD7 A;  4MGQ A;  5FZB A;  2GU9 A;  2WAB A;  3ZPO A;  1W6M A;  1ACC A;  3ZFF A;  1OA4 A;  2R07 2;  4LO5 B;  1HQN A;  1W2U A;  5FY9 A;  1STM A;  2UWA A;  1CAV B;  1RJ7 A;  3JB4 C;  4U36 A;  4YG0 A;  4Y33 A;  4DB5 A;  4J6G A;  5AC9 1;  3NNJ A;  3SXW A;  4QXB A;  4K8R B;  3BU7 A;  2WWJ A;  5LA2 A;  1JXN A;  2ID4 A;  2WII B;  5FZM A;  5FYM A;  5K7P A;  1POV 1;  2QQP A;  4LMF A;  4COZ A;  2JG8 B;  1SPP A;  1W6O B;  1E5S A;  2VUL A;  2XVL A;  2B45 X;  1SHW B;  4NR1 A;  5K0U C;  1OF4 A;  1XOY A;  1AR8 1;  5ABJ C;  2VZV A;  4BU2 A;  3VV1 A;  4PQQ A;  3OGV A;  2DUR A;  5A80 A;  3CNA A;  3S0M A;  4C91 A;  1AL2 1;  2RDR A;  1HB4 A;  2PHW A;  5EJ3 A;  2N7G A;  2FZ2 A;  3GXU A;  2WUH A;  2JIC A;  4UYB A;  2OQ6 A;  3BYW A;  1DGL A;  5EWS A;  2P34 A;  1CAX A;  2EIE A;  2Y6F A;  4P14 A;  3WNP A;  2QQO A;  3ZFE A;  3ZSK A;  1JZ7 A;  1FMD 2;  4BOW A;  4IES A;  3SKJ E;  1CX4 A;  4ASK A;  4EZ4 A;  3NRU A;  5GZE A;  2WIN B;  2VNG A;  2FCT A;  4M4R A;  1HQL A;  4A3Z A;  2X5I A;  1IPK A;  3WCR A;  1AYN 1;  2A5Z A;  1K42 A;  1Q8S A;  3USU A;  4URA A;  4YM0 A;  3TB0 A;  4AFM A;  4QXH A;  1NCQ B;  2YYO A;  3B9C A;  5FIX A;  4W6Y A;  1YI7 A;  1VRH 3;  4TSV A;  1JTZ X;  4HON A;  3AJY A;  5FY5 A;  2VCC A;  4RN5 A;  4R9A A;  4AVS A;  4ZY9 A;  4OHZ A;  2G9Z A;  3KT7 A;  4JAA A;  4COW A;  4B29 A;  1RHI 1;  4IE7 A;  2VVD A;  3ZKY A;  3H3L A;  3T0A A;  2GN7 A;  4XUR A;  4WBB A;  5CB7 A;  4GB3 2;  2XLF A;  3BU0 A;  3AJZ A;  3AKS A;  2RR1 3;  5FY0 A;  3VBF B;  4D7S A;  3GNE A;  1LHN A;  2YRO A;  1IZ3 A;  3T0B A;  1QHD A;  2WNV C;  4K7J A;  1UU6 A;  2BQP A;  1RUF 3;  2WSV A;  3NWK A;  4CPB A;  2BUK A;  1UKR A;  3POE A;  1ULO A;  3Q8F A;  1PO1 2;  1U5I A;  4OLL A;  2WN2 A;  4MZU A;  4URT A;  2DCY A;  1YQ2 A;  4CCJ A;  4XCA A;  1ZBA 2;  4HXC A;  4JGY A;  1XYO A;  1RMU 3;  3T4H B;  1W0N A;  1DYO A;  1MEC 3;  4P9X A;  3SCG A;  2BYV E;  2MEV 1;  3GJA A;  4MHR A;  1W6P B;  4Q0S A;  5IK7 A;  1RGS A;  3GHM A;  4CE8 A;  2RS1 3;  3AK0 A;  1MAC A;  2TBV A;  2VQT A;  2WS9 3;  4N90 A;  1HRV 2;  1RUD 2;  2IFW A;  1ULF A;  4CDW B;  3ZYF A;  3WDW A;  3TNP B;  3HBZ A;  2XUE A;  1JHN A;  1AR9 1;  4L92 A;  4CEY B;  1YFW A;  5HXM A;  1PGW 2;  2R49 A;  4CCM A;  2VOW A;  3NST A;  4TXW A;  4FPF A;  4YZ4 A;  1AYM 2;  1BHG A;  4XZU G;  1W0O A;  4D8M A;  4JTO A;  3DN7 A;  4YVW C;  2F4P A;  3N9O A;  2VPV A;  3SMH A;  5D1I A;  4XCB A;  3PU8 A;  3Q8B A;  5HXV A;  4AHX A;  4MXW A;  4BME A;  1RUE 3;  3Q9O A;  1GOH A;  3VD9 A;  4BK4 A;  3O7O A;  2JDY A;  1O4T A;  4BK5 A;  3H8O A;  2WAA A;  4A42 A;  5BV6 A;  1DYP A;  1X50 A;  3V0B B;  3NNG A;  3ZFF B;  1S0F A;  2WT0 A;  2D6L X;  2EVX A;  1TNF A;  1XU2 A;  3I59 B;  4XF4 A;  1H4G A;  5LA9 A;  1SEF A;  4XXA A;  4Q29 A;  4LBM A;  4IGP A;  4DO0 A;  4HSL A;  2GSY A;  2R6Q A;  2Y6L A;  5GJ6 A;  1KFU L;  4GJY A;  2XDV A;  5JI7 A;  4A6S A;  1LUL A;  5CIS A;  2ZGL A;  3VBU B;  5C4W B;  2GP5 A;  3POW A;  2YGM A;  2ZGN A;  4NIH A;  1RXG A;  3GBW A;  1S0G A;  1U5Y A;  4Q4W 1;  2WSU A;  3RNS A;  1PIV 2;  1D4V B;  2DFC A;  2JB4 A;  3WIN E;  4JGZ C;  2XUM A;  3U4X A;  1LU2 A;  1M06 G;  3SH4 A;  3J4U H;  3I2H A;  3ST7 A;  3VHP A;  3NVC A;  5JSO A;  3IDB B;  3R05 A;  5FRA A;  4RS5 A;  4Q4V 2;  3CL1 A;  5A7Q A;  4QQP A;  4CDX B;  5A33 A;  3G7D A;  4CPB D;  1HQW A;  1LHW A;  5FZI A;  3T08 A;  3UGG A;  3W20 A;  1OBN A;  1ZA4 A;  4BIO A;  4FFI A;  5T5O A;  1U0A A;  2W08 A;  2E7T A;  5C71 A;  1FPN 2;  3HNB M;  4FOY A;  4R8H A;  1NLR A;  4RQP C;  4D3W A;  1QJZ A;  3KQ4 B;  2J1T A;  3ZFG B;  3I3E A;  4C90 A;  1JYW A;  2EXH A;  1MZ5 A;  3F95 A;  4FPY A;  2JDH A;  2W91 A;  4DEV A;  5C9A C;  2EID A;  1UXZ A;  4IDZ A;  2DVG A;  3FHQ A;  4LKE A;  3T1L A;  2WNU B;  3CMG A;  3RMX A;  3WHT A;  4XAC A;  5IHR A;  1AR6 2;  4R9D A;  3GGL A;  2W68 A;  1VBE 1;  3S6P A;  4GWM A;  2P37 A;  1R09 1;  1MS0 A;  4NRM A;  3GAL A;  1C1F A;  2FMD A;  2O0O A;  4N7I A;  3U07 A;  5JIU A;  1UL9 A;  3NL1 A;  4AFB A;  1LHV A;  3LZZ A;  4IW3 A;  1PX3 A;  3AFK A;  3CBN A;  4YZ5 A;  3TOJ A;  1HRI 2;  1E5I A;  5BNN C;  4Y26 A;  3FBY A;  3T09 A;  4NHL A;  4IND A;  2WRA A;  2HWB 2;  3IMN A;  3B94 A;  3OUI A;  2WLQ A;  1UYY A;  2Y6J A;  4QX2 A;  3QCW A;  3AYC A;  3OF1 A;  5J36 A;  4OCT A;  1NZC A;  5D8A C;  3PUQ A;  2W0X A;  3T3Y A;  1F4A A;  5DZG A;  4QX5 A;  2UWC A;  3P5B A;  4MAD A;  1ULE A;  1SG3 A;  2VW2 A;  1US3 A;  4BQX A;  1H8T A;  3N9P A;  3BPS A;  4GWJ A;  3IAP A;  4D7T A;  3NW4 A;  4W4Z A;  2O14 A;  1BMV 2;  1KIT A;  3KM5 A;  1IPJ A;  1WCK A;  2BV4 A;  2Z5W A;  1HW5 A;  1W2T A;  4QB1 A;  1G9A A;  4EN0 A;  1LGN A;  5A70 A;  3R4D B;  2VZ3 A;  2KD7 A;  5FY8 A;  2A1X A;  2QBX A;  1PMJ X;  2WFP A;  4CA9 A;  4QKB A;  3WF0 A;  4MO3 M;  2BGP A;  4AXO A;  1I3H A;  2VOT A;  3ZLI A;  1RUC 2;  1N3Q A;  3HN1 A;  1Q8P A;  1RXF A;  2GC1 A;  2ZGR A;  5ANN A;  4CEW B;  3KT4 A;  1X9T A;  4HSJ A;  1VBB 3;  1VBA 2;  4DS0 A;  5KHI A;  2E31 A;  2K9Z A;  4YPJ A;  5FPX A;  1J3Q A;  1ODM A;  1XE0 A;  4GKY A;  2WZ8 A;  1XNT A;  3I97 A;  3ZXL A;  4E2S A;  5C8C B;  2VMF A;  2ZX0 A;  1W6N A;  4IV3 B;  4CXY A;  2HWE 1;  3M1H A;  1C3H A;  4HKO A;  1NLQ A;  2RDS A;  5K0U A;  1V6J A;  2VR4 A;  1HB3 A;  4LKF A;  3AZW A;  2HWC 3;  2RJ2 A;  1JI6 A;  5ABJ A;  5J37 A;  4XVH A;  3VBH B;  4EN9 B;  5AC9 2;  4N43 C;  2DDU A;  4D7Y A;  1ND2 B;  4P5H A;  1OVP A;  4XBL A;  1GU3 A;  3IM0 A;  5CKN A;  1VAK A;  3POG A;  3ZSL A;  3O12 A;  3ZIW A;  4LA3 A;  3RGB A;  1N3P A;  4E4S A;  5FOB B;  1C28 A;  1TMF 1;  2AYH A;  3POF A;  3O1T A;  2RVA A;  4XW3 A;  2IXI A;  3O1M A;  4OHY A;  2CHH A;  3K2O A;  5FJK A;  2Q1Z B;  5FYT A;  4QT6 A;  4QXK A;  2IVJ A;  2QQN A;  1LOG A;  1E5R A;  2XR4 A;  2DVB A;  2VMD A;  3SCH A;  4CSW A;  3ZXD A;  4L11 A;  5FZF A;  4YW2 A;  4OVE A;  3IBM A;  3OUJ A;  3PIG A;  3SC7 X;  3MHZ A;  3U1X A;  3BGA A;  1UD1 A;  2XH6 A;  4JQT A;  3GF6 A;  4L8Q A;  5FUP A;  3MIF A;  1I5Z A;  2R06 3;  4L0P A;  5KXB A;  1BVV A;  3JCI A;  4MX3 A;  1CES A;  1Y9G A;  2BZD A;  1AYN 2;  1DCS A;  1DLC A;  3AMP A;  3DV8 A;  4A44 A;  3VKO A;  4ZU7 A;  3HEI A;  1VBC 2;  4PDW C;  3WX5 A;  4ZXE A;  5FP9 A;  2ZS6 B;  3V0A B;  2OPK A;  4WZF A;  4RYD A;  3WQ1 A;  3S57 A;  1KS5 A;  4PBO A;  1ZRF A;  4PIY A;  2RM2 3;  4FPJ A;  5SV8 A;  3FLT A;  4NOT A;  3RYK A;  5KWR A;  2WZR 3;  4Q4Y 3;  3O1U A;  1EV1 3;  3GZT B;  2JD9 A;  3CZU A;  3JBG 2;  2FCV A;  1VP6 A;  2H0V A;  2TEP A;  3CO2 A;  3LEG A;  3LSD A;  2X05 A;  2WNV A;  4NWW A;  4W50 A;  4AHY A;  3ZXG A;  3ZDV A;  1UWW A;  2Q8C A;  1MVQ A;  1RHI 2;  4CCE A;  4BIF A;  5FOJ B;  5GLW A;  5FPV A;  4JQR A;  3WF4 A;  2A6Y A;  3ZIX A;  3GZA A;  4IEV A;  4HVO A;  2YBS A;  4QB6 A;  1WLW A;  1S0D A;  5CIR A;  3LEM A;  3I2I A;  3OCP A;  3S30 A;  4B7K A;  4OI2 A;  2ZAA A;  1IHM A;  2VCB A;  3IT8 A;  4KWL A;  1T2X A;  3PMS A;  1QWR A;  5HPO A;  4M01 A;  3JD7 2;  5T50 A;  1R1A 1;  4M00 A;  1GFF 2;  2XBO 3;  1XNK A;  4KI5 M;  3RZK A;  4NIG A;  5EFU A;  2WO1 A;  3N7L A;  4YVS C;  4MGT A;  5IVV A;  2XJS A;  3SIS A;  2ZPX A;  2JDN A;  3N9Q A;  3E5U A;  1IS3 A;  1HJF A;  1K3I A;  1ZRD A;  4XF3 A;  4I0W B;  5E16 A;  1PK6 B;  3ZN5 A;  4HL0 A;  4IV1 B;  1AX0 A;  5ACA 3;  1JYX A;  1QMJ A;  3DPR B;  4O9G A;  4LKS A;  3I2O A;  5KC5 A;  2XVG A;  4YVW A;  4S2H A;  5DN2 A;  4GA9 A;  3LQC A;  1LKN A;  1TG7 A;  1YQ8 A;  2V5D A;  3MV1 1;  3KLS A;  2WT1 A;  1AR9 2;  1V6O A;  4ITC A;  3PVE A;  4JRL A;  2P2K A;  1RB8 G;  1GNH A;  4AI9 A;  3SKV A;  1IS5 A;  4FTS A;  3ACG A;  4FPE A;  3JQW A;  4XQD A;  1UZY A;  1TME 1;  3DKW A;  5FMC A;  4OQ8 A;  2AR6 A;  4XBN A;  5F2S A;  3LOB A;  5EPA A;  4NVP A;  1G9C A;  5LZ6 A;  3ON7 A;  4IEO A;  4SBV A;  4W8J A;  1CIW A;  2DU0 A;  2ZGQ A;  4IE4 A;  2VW1 A;  5B4N A;  1DU3 D;  1PHM A;  2XWJ B;  4HK9 A;  4IL7 A;  3H42 B;  4Q4X 2;  3KMH A;  3CJI B;  4ZS2 A;  1JHJ A;  1K5J A;  2UY8 A;  5CG9 A;  3W5N A;  1D4M 3;  2I74 A;  4HVR A;  1O3T A;  2VQA A;  3NNM A;  4IEW A;  2ENR A;  2IFR A;  1SLA A;  3E5X A;  2WYF A;  1GOG A;  2VGD A;  5BY5 A;  3NJX A;  3WNX A;  5KHH A;  3AKQ A;  1UMH A;  5HV4 A;  2D6P A;  2WN3 A;  2BEO A;  1WGP A;  4IE0 A;  2CGP A;  3I3B A;  5LBB A;  3V64 A;  4XUT A;  4HPK A;  3OPT A;  4MLO A;  2VUC A;  4BQY A;  3H1M A;  3AMN A;  3TBD A;  4RQP A;  3FE5 A;  4Q0U A;  5F3C A;  1N47 A;  3HBK A;  1EYB A;  4UT5 A;  4D6Q A;  1QJF A;  3O0X A;  1CJD A;  1GQG A;  1WW7 A;  2JG9 C;  2ZEY A;  3WXP A;  1DDL A;  4YLZ A;  1CAW B;  5C9A A;  3VBS C;  4AYU A;  1BBT 3;  1Z7S 3;  1BLZ A;  1JOD A;  2FHR A;  2D43 A;  1LAJ A;  2HWD 1;  1Q56 A;  2DBN A;  3HR9 A;  4XQ4 A;  1FXZ A;  1OH3 A;  2VZ1 A;  2AUY A;  4Y20 B;  4YZ2 A;  2CWM A;  1VR3 A;  3DUI A;  1UAI A;  5A32 B;  3VZM A;  3RZL A;  3NAP B;  3B02 A;  1QF3 A;  4ES9 A;  1AHS A;  4D6R A;  5FZE A;  4AEM A;  4QU2 A;  3SEE A;  3MW3 A;  4P9G A;  5JZG B;  2ETE A;  3N9M A;  4GH4 C;  5BNN A;  1LEC A;  1QIQ A;  1UZ0 A;  4L9B A;  3U11 A;  3C7E A;  1R09 2;  5IVB A;  5FO9 B;  4RGG A;  2PEL A;  4TLF A;  4XDP A;  1CAU B;  4LKD A;  1CD3 G;  4RR3 C;  3RSJ A;  3PUI A;  5J7M A;  1OD3 A;  4Y1X A;  3PU3 A;  4CUC A;  1CZT A;  4K20 A;  3WR0 A;  4OUM A;  3CDZ B;  4AAP A;  5D8A A;  1SDD B;  3FN9 A;  3KS7 A;  1RED A;  1J58 A;  1I5P A;  2BDR A;  3D8C A;  2E32 A;  1W9Y A;  4DUW A;  3JUU A;  2PHT A;  5ISL A;  1UPI A;  2ZGU A;  3HQX A;  3PHM A;  4B7E A;  4NPL A;  2Z42 A;  4BQ5 A;  4Q27 A;  4B3N A;  2GNB A;  3UGF A;  1MR5 A;  1PZ9 A;  1G6N A;  4CCK A;  4CU9 A;  4EV0 A;  2HEY F;  3QLQ A;  4OHV A;  3PJQ A;  1EP0 A;  2C5D A;  3OG2 A;  3Q8E A;  5FLH A;  2FDI A;  3OSD A;  3LWC A;  3OPZ A;  5DUX A;  3OB8 A;  3W9A A;  1FT9 A;  2GMP A;  1LGB A;  2ZHN A;  3TRS B;  5J48 A;  3TEX A;  4M3C B;  5FZ3 A;  2IVI B;  3NNL A;  4P02 B;  2HWF 3;  5HV0 A;  2D5H A;  1RVF 3;  1GYK A;  2YFZ A;  1NCR A;  2DCK A;  4QKD A;  1QH6 A;  3I3Q A;  4Z8B A;  4HKL A;  3FFQ A;  1OOP B;  2WAO A;  4LBQ A;  3OGJ A;  5CFD C;  4HBN A;  2RJK A;  4ZU5 A;  2P3K A;  3N7M A;  1OT5 A;  3VZL A;  3BKZ A;  2RR1 1;  1XND A;  1LOF C;  2EAA A;  1LEM A;  3VBO A;  3AVR A;  4JC1 A;  1QH7 A;  2K0G A;  5FPU A;  4EYU A;  2ZGK A;  4QD2 A;  1RUF 1;  5JMO A;  1BK1 A;  2IXL A;  3K75 B;  3POY A;  2CSG A;  5IK4 A;  2FDG A;  4HMZ A;  1POQ A;  4XFF A;  1CQ9 A;  2GAU A;  2CGN A;  4JRA A;  4N43 A;  3CHX A;  4XFB A;  3ZYB A;  3HAG A;  4M3C F;  5BNP B;  3N3H A;  2QE3 A;  1UOB A;  4P00 B;  5L9B A;  2XJP A;  1RMU 1;  1QJE A;  3IDA A;  2RDN A;  1ENQ A;  2JG8 C;  1MEC 1;  1WCD J;  2ARE A;  4XQW A;  3T1M A;  3OBA A;  3VHO A;  4AG4 A;  2E51 A;  2K2S A;  3PIJ A;  4LBL A;  5FZH A;  1GP5 A;  2RS1 1;  3AKT A;  2VXR A;  2WS9 1;  5J3U A;  5JR2 A;  2D6K A;  2JB8 A;  2QVS B;  3FUO A;  4GQ7 A;  3Q8C A;  1K5M C;  2J1A A;  2TNF A;  4UFJ A;  4LOR A;  5F8P A;  5FZ7 A;  2D6M A;  1QKQ A;  4QPW A;  2Q8E A;  3FJS A;  4AFA A;  3M2M A;  3TN9 2;  4E4D X;  3O1V A;  3B01 A;  1UX6 A;  1QJY 2;  1VLN A;  2RG4 A;  4LHS A;  1DZQ A;  2XLG A;  4QM8 A;  4RFT 0;  4A2U A;  4IEY A;  2IXH A;  4BE3 A;  3ACF A;  5K9Y A;  1OA2 A;  1BKZ A;  4MH0 E;  2XML A;  2VUA A;  5FP8 A;  2W46 A;  5I0T A;  1OUR A;  2EIC A;  3KWV A;  4UBG A;  5J98 B;  5E89 A;  3SEP A;  5C3P A;  1RUH 3;  2OPW A;  3VDB A;  2D7F A;  2VMG A;  4XUO A;  1QJU 2;  1ZBE 2;  2NYY A;  5FYZ A;  4N9I A;  4B4P A;  3PJY A;  4QXC A;  1RUE 1;  2VZO A;  5A7O A;  3VKN A;  4CVU A;  2ZZJ A;  1QOO A;  5FTT C;  3BOD A;  1EY2 A;  2MPF A;  1OI6 A;  3III A;  2RMU 3;  4HN0 A;  4Y5S A;  2Y38 A;  2FDJ A;  2X8K A;  3ZX7 A;  1SLB A;  2K46 A;  3O1R A;  3ELN A;  1ASJ 2;  1GWL A;  1BEV 3;  2DVA A;  4F3J A;  5FLJ A;  4B1L A;  4AWD A;  4H2A A;  1NCQ C;  4PDW A;  2VCM A;  4C1W A;  2UU8 A;  3LFI A;  1SFY A;  5FYS A;  3B93 A;  3BOP A;  4KBZ A;  2YC2 A;  3IDC B;  4BCU A;  4CP9 B;  5JPM B;  3EXU A;  3BB6 A;  4XET A;  5C5U A;  4XPV A;  1E5H A;  1CAX B;  2CNA A;  3ZFE B;  4UFK A;  1EAH 3;  2VVE A;  1VRB A;  2VNV A;  1X8E A;  2AAC A;  4LUM A;  2WBK A;  4Y22 B;  4A3X A;  1W8U A;  1UMZ A;  2CV6 A;  4IER A;  4GAL A;  4XF0 A;  4QB2 A;  1SFP A;  1VBD 3;  4LBQ D;  4NID A;  2QKD A;  2A75 A;  3HWJ A;  3MIE A;  4FQZ A;  1SBF A;  3USU B;  3QD6 A;  3VBF C;  4LBJ A;  4IET A;  1BVP 1;  1OKQ A;  4IEP A;  4MG2 A;  2ET7 A;  2ADD A;  2RJL A;  2Y6G A;  4Z92 B;  2B9U A;  1CJP A;  5GZG A;  4Y1V A;  5DAX A;  3B5L B;  2FDK A;  1D2S A;  4UFI A;  1HXS 2;  1JU3 A;  5A6Q A;  3INA A;  1GR3 A;  1RYY A;  3AX4 A;  1KEX A;  4LEJ A;  5CNA A;  2ZAC A;  2NPI A;  3TEY A;  2R07 3;  3AZV A;  1J59 A;  3S7E A;  2B5H A;  1I1E A;  4YVS A;  1LEN A;  1ZZ8 A;  3VBR B;  3ZDS A;  1KGY A;  1X82 A;  3VD7 A;  4O61 A;  4FTB A;  2C9K A;  4GZ9 A;  1GP6 A;  4FVV A;  5JDB A;  4NO4 A;  5FQ0 B;  4CDW C;  1R1A 2;  4PI0 A;  3FWE A;  3I3M A;  3AC0 A;  4LOS A;  1Y9M A;  4Q5O A;  2OYZ A;  1WUV A;  4CEY C;  5I8S A;  3AXE A;  1FOD 2;  5A7W A;  3ILR A;  2PLV 3;  1IS6 A;  1S0I A;  3LDK A;  2ZAH A;  4UW3 A;  4E4H A;  1GZT A;  1GIC A;  2LW8 A;  1ZRR A;  1DG6 A;  3IAQ A;  1MZE A;  4Q1P A;  4YM3 A;  4A7K A;  2NZ9 A;  3BPZ A;  2HKX A;  1WCQ A;  4ORF A;  2IXC A;  1UX7 A;  2BNO A;  5F6K A;  3RFR A;  1FMD 3;  3KVA A;  5EP9 A;  2PAE A;  2DVF A;  3MIH A;  4CDQ A;  5A1L A;  3MIC A;  3OTF A;  4XMI A;  1SLI A;  1IG0 A;  1IGO A;  5A7S A;  4R9C A;  5FXX A;  4AOC A;  1TME 2;  2C6S A;  1NA1 B;  4FOQ A;  4ARY A;  2OX0 A;  1BXH A;  1UKG A;  3WNO A;  3BTX A;  2SBA A;  4COU A;  2EXJ A;  1C1L A;  5LBF A;  2WQ8 A;  3VB9 A;  1SCR A;  1WLC A;  1GOF A;  4AE2 A;  2OS2 A;  1YJL A;  2VOX A;  1MQT C;  1XRU A;  4D0Q A;  3VBU C;  5A6Y A;  4JV4 A;  2Z2S B;  3U14 A;  3OEB A;  5GKA C;  5JPN B;  4MXW B;  5JOX A;  4COY A;  3AXD A;  3M4F A;  5CFC B;  1KJR A;  1NLS A;  3KGZ A;  1GQP A;  1YC6 1;  3LE0 A;  1UY3 A;  4GMP 0;  2QDR A;  4WM7 C;  3ZR5 A;  1YUD A;  4QX0 A;  4XFG A;  4DOU A;  5LCW L;  3FUQ A;  2YFU A;  4LE3 A;  3D0S A;  4IQP A;  4CCO A;  1UIJ A;  4CDX C;  1O5L A;  3LFM A;  2JG9 A;  4EWA A;  3W5M A;  4NPR A;  3BOW A;  1VBB 1;  3VBS A;  5F5Q A;  1L7R A;  4XTM A;  3QAC A;  3ZXE A;  2QQI A;  3RDI A;  3O1P A;  3BUC A;  1AF9 A;  3MGU A;  2VNR A;  1NYW A;  3UYJ A;  2A3W A;  2JIG A;  3N36 A;  4QKF A;  1GZW A;  1PO1 3;  3ZFG C;  4GJZ A;  1OKO A;  1QDC A;  2W39 A;  4BXS V;  1DZR A;  1ZBA 3;  1QXR A;  2HWC 1;  2ZAB A;  3WZ1 A;  2WNU C;  2X53 S;  2IXJ A;  2VUD A;  5EJZ B;  3I49 A;  4DEQ A;  3DYO A;  1AXK A;  1I9R A;  2H6C A;  1AX2 A;  2HWD 2;  4PLO A;  3DEC A;  4GH4 A;  4UF0 A;  4RS5 B;  4YFW A;  2ZGP A;  1PMI A;  3MEP A;  1ALY A;  3M8L A;  3W21 A;  2YPD A;  4LBK A;  3KVB A;  5A33 B;  1ENR A;  2A6V A;  4GIQ A;  1HRV 3;  4OFG A;  5DAB A;  5BYN A;  1X36 A;  4NE9 A;  4QX3 A;  1RIN A;  3M3I A;  3QH6 A;  2Q8D A;  2D3R A;  3WDT A;  3MLJ A;  3T30 A;  1DQ2 A;  5IFT A;  4XFC A;  3B3Q E;  3NNF A;  1KS4 A;  3KV6 A;  3NJV A;  5KXD A;  1AX1 A;  3VZJ A;  5F6L B;  4ERO A;  2WT2 A;  3MIG A;  1CWP A;  2VTX A;  1H9P A;  1LTE A;  2OII A;  3E1F 1;  5FZ8 A;  4EN7 B;  1CGP A;  5FCC A;  5KR7 A;  1YQC A;  2Y60 A;  3FC0 A;  1N1Y A;  4CP1 A;  4RHV 2;  4YW3 A;  1R08 3;  1KDM A;  1RUI 1;  4TYS A;  5GAL A;  3POI A;  4FAG A;  2VL4 A;  3KF3 A;  2WJS A;  3WV6 A;  4AVA A;  2XQX A;  3RPQ A;  5FAX A;  2FBE A;  1W04 A;  1H2L A;  3H8X A;  4YW7 A;  4GD4 A;  1RC6 A;  1SLC A;  2B8M A;  1UNB A;  1W8T A;  1XNC A;  1B09 A;  1RJ8 A;  2R06 1;  4WVM A;  2VZQ A;  1GZC A;  1DHK B;  2VVF A;  2ZEW A;  5IUQ A;  2RS5 3;  1ND3 B;  4XC9 A;  4GMP 3;  4C8D A;  2OKX A;  3U75 A;  3MUZ 1;  3UV9 A;  1EUT A;  2BOJ A;  2D5F A;  3NV2 A;  3WQB A;  2JWP A;  2YUE A;  2XWB B;  4MUV A;  5K4L A;  5C33 A;  2YDE A;  4X6R B;  5CFD A;  2RM2 1;  3GHN A;  1RUG 3;  2WZR 1;  1LRH A;  1EV1 1;  4Q4Y 1;  2WC2 A;  1CN1 A;  1F35 A;  5D21 A;  2PYT A;  4K8F A;  3ZR6 A;  4AI8 A;  3B7M A;  3DGT A;  4KG0 A;  5F3E A;  2WFF 2;  3N4M A;  4DXR A;  1JZ6 A;  2VZT A;  3APB A;  1CAV A;  2YPJ A;  4XYX A;  3M7A A;  2CAV A;  5FKC A;  5L9V A;  4N53 B;  3LPG A;  4NHM A;  1W8W A;  1UYP A;  1H0B A;  2VMH A;  5C8C C;  2J7M A;  3DYM A;  5FYV A;  2C0Z A;  2JG8 A;  2W1U A;  2CU5 A;  1W6O A;  2VH9 A;  4WM8 B;  4XJW A;  5LW9 A;  5EQU A;  1T6B X;  3R0R A;  4JHT A;  2XHK A;  2XBO 1;  4FFG A;  2QJV A;  3VBH C;  1HDK A;  2VMC A;  4QX7 A;  4E27 A;  1OLM A;  1WD3 A;  2OA2 A;  1K5M A;  1ND2 C;  2QZ2 A;  4DY5 A;  1SLL A;  2VZU A;  4HZF A;  4CCN A;  4I0B A;  4JZR A;  1LOB A;  3K77 A;  1RMU 2;  3NO8 A;  5FYH A;  5IK5 A;  1Y4W A;  2Y0O A;  4JDO A;  1MEC 2;  2XXZ A;  5CVR A;  5LY2 A;  4BDV B;  4B8E A;  2RS1 2;  3KV9 A;  2WS9 2;  4FCA A;  4AL9 A;  2F6B A;  5FPB A;  2Q1M A;  5FPA A;  3ZSM A;  3RZM A;  5EZW A;  2MHF A;  1D0H A;  1DIW A;  1PO2 3;  3AZX A;  5K0U B;  5GZF A;  3VDD B;  3ZO0 B;  3KZ4 C;  4XFH A;  4ATF A;  5ABJ B;  3AL6 A;  1GMM A;  4AEJ A;  2VUJ A;  3FMG A;  3H8R A;  2YMZ A;  3H9A A;  1AJK A;  2W3J A;  2HWB 3;  1NCQ A;  4RA0 A;  2ES3 A;  5T5J A;  2DCT A;  1JZ5 A;  4FSJ A;  1FAY A;  1W3X A;  4YYO A;  2GC0 A;  1QEX A;  2ATF A;  5BNO B;  5FY4 A;  3KHC A;  1QQP 3;  3DXT A;  4Q1R A;  2DYC A;  1S2B A;  2UY9 A;  1H6Y A;  1XBF A;  1VIW B;  3AKP A;  4LO4 B;  3LOI A;  4PCR A;  5FZK A;  5CKQ A;  3VL8 A;  5I8T A;  2RS3 1;  2W52 A;  1D4M 1;  4XJ8 A;  5FYI A;  3WOG A;  3U78 A;  3SLI A;  5E6H A;  2G9F A;  2KR2 A;  2IC1 A;  1HX6 A;  4YGD A;  3VBF A;  4MET A;  4JKM A;  4KBB A;  3WP5 A;  2Q30 A;  4I2O A;  2BBV A;  4O9E A;  2ZHL A;  3KD4 A;  3H7J A;  4X8N A;  5JCT A;  2WLP A;  2PHD A;  2OUH A;  3AMM A;  3HIF A;  2V4A A;  1FAT A;  2WZP P;  2I2S A;  3WDU A;  3KSC A;  5F5I A;  4FOV A;  4LHN A;  4QX8 A;  5CKM A;  3ZYG A;  2JE9 A;  5KHK A;  2UYA A;  3GZE A;  2JEC A;  3LGR A;  4IXL A;  2GN3 A;  4UOJ A;  1YEW A;  4BH9 A;  5ANQ A;  3SIT A;  3LKJ A;  4Z07 A;  2GC3 A;  1MPX A;  1VBA 3;  2GDF A;  2X10 A;  5CA6 A;  2ZXQ A;  1W6P A;  4J1W A;  2ZX2 A;  5CYY A;  3B00 A;  3WW3 A;  1UPS A;  2LS6 A;  5FWJ A;  3RJR A;  1BBT 1;  4D69 A;  1YFU A;  1Z7S 1;  2GH2 A;  4ZHN A;  3NV3 A;  1UQX A;  5JSR A;  1YIF A;  1S2K A;  3NKT A;  4XIL A;  4AHZ A;  2YU2 A;  1QJX 3;  4CEY A;  1H2M A;  3C3V A;  5A3O A;  1KDK A;  2XGX A;  4GAZ A;  1OH4 A;  5C6C A;  2G9G A;  2YY1 A;  3NMB A;  4IV1 C;  1K12 A;  1C8M 3;  3WNK A;  1PVC 3;  1UZZ A;  2WR9 A;  3DPR C;  3P1I A;  4K3U A;  4LUK A;  5C3Q A;  5LEJ A;  2JDA A;  4Z2W A;  2BBA A;  5FZO A;  1V6K A;  4UFM A;  2PXJ A;  2AC1 A;  4G9S B;  2P1B A;  3Q8A A;  3GDB A;  2C4X A;  2VEC A;  2R1D A;  3UKV A;  2OZJ A;  5FZ9 A;  1WCS A;  2C1F A;  1DGW X;  1GNY A;  1ST8 A;  3HMY A;  3IPV A;  2QNK A;  3UES A;  4EJR A;  5H9P A;  5I91 A;  5KXE A;  3RI8 A;  1LB2 A;  1LOC A;  3I59 A;  4XUP A;  3FZ3 A;  4Q0Q A;  3ZN6 A;  1SAC A;  4XDQ A;  2UUR A;  1VAM A;  4FTE A;  5F32 A;  2LAL A;  2W9X A;  5J1X A;  3POS A;  1V70 A;  4R52 A;  4LIV A;  1MQT A;  5DZF A;  2WWU A;  1K45 A;  3VBU A;  1RUJ 3;  3UNP A;  3CJI C;  4BA6 A;  5FYC A;  1H2K A;  1RIT A;  5F5C A;  4EQV A;  2WQZ C;  5GZC A;  2R04 3;  1ZRC A;  1W8H A;  1YI9 A;  1VBC 3;  4RFR B;  1WLD A;  3UGH A;  5E8A A;  1AR8 2;  2W1Q A;  1OXC A;  4FFF A;  2YB7 A;  4PT6 A;  4S2D A;  4WM7 A;  2HWF 1;  2YHJ A;  3CLP A;  4Y4R A;  3B69 A;  4CUB A;  3N7K A;  1RVF 1;  4NWV A;  1AL2 2;  3BTY A;  4CDX A;  1OPO A;  2A3Y A;  2FCU A;  1SQ4 A;  1KRI A;  4LJH A;  4CZS A;  3JBG 3;  5GLT A;  5JMC A;  5FZL A;  2KXL A;  3LSE A;  1PX4 A;  1RHI 3;  3OYW B;  1UCX A;  4TZD A;  1RUO A;  2BFU S;  3AKR A;  2R32 A;  1WCU A;  3DKQ A;  4AAX A;  1NY7 1;  3A23 A;  2FQP A;  4J1X A;  5JOZ A;  1TZO A;  4IGQ A;  1A3K A;  2CWS A;  3GM8 A;  2LUW A;  3ME2 A;  4K1Y A;  2V09 A;  4QPG B;  3AYE A;  1S0J A;  3PL0 A;  4DRV A;  2WNU A;  1D2Q A;  4FP2 A;  2R1B A;  1DQ5 A;  3VD5 A; 
#chains in the Genus database with same CATH homology
 4CUC A;  1CZT A;  3P6B A;  3CDZ B;  1SDD B;  3FN9 A;  1I5P A;  2VO5 A;  3I3D A;  1F4H A;  4MGS A;  4QX1 A;  2E32 A;  4DUW A;  1JZ8 A;  3HNM A;  4MGQ A;  2YC4 A;  2WAB A;  4CU9 A;  1US2 A;  5EIY B;  3OG2 A;  4OMC A;  2Y6K A;  3OB8 A;  2VJX A;  5LA2 A;  5DMY A;  4LPL A;  4P02 B;  3I2G A;  2ID4 A;  2YFZ A;  1UXX X;  4JHZ A;  2DCK A;  4XUN A;  3HJR A;  2WAO A;  1SHW B;  3VD4 A;  1OF4 A;  1OT5 A;  2VZV A;  2Y8K A;  4PQQ A;  3OGV A;  3WEZ A;  4OMD A;  1UYX A;  3T2P A;  1DP0 A;  4QAW A;  4HG6 B;  3GXU A;  2WUH A;  3K75 B;  5JMO A;  4E8D A;  3VDA A;  2CDO A;  2J1U A;  2EIE A;  3WNP A;  1JZ7 A;  2QQO A;  4IUG A;  4M4P A;  3SKJ E;  4P00 B;  3IDA A;  3WNM A;  5G04 L;  3NRU A;  4M4R A;  2Y6H A;  3OBA A;  4A3Z A;  4AG4 A;  1XC6 A;  1K42 A;  5JR2 A;  5JXH A;  2W87 A;  3THC A;  2J1A A;  4KWU A;  4CU6 A;  4QPW A;  4LHS A;  4CU8 A;  4BJ0 A;  3ACF A;  3LPF A;  2J1E A;  2W46 A;  2J22 A;  2VCC A;  4RN5 A;  2EIC A;  3MBW A;  4ZY9 A;  4A41 A;  5I0D A;  3SEP A;  2VM9 A;  3VDB A;  4XUO A;  4ZZ5 A;  4CVU A;  1TVG A;  2VZO A;  3T0A A;  4XUR A;  3MO4 A;  3III A;  1NAE A;  1JYN A;  2PQS A;  1XNA A;  3UET A;  3PUH A;  3T0B A;  3EB7 A;  2YC2 A;  1UY4 A;  1ULO A;  4JKL A;  3HOB A;  4OZO A;  1JZ4 A;  2WN2 A;  1YQ2 A;  4Z2A A;  2WBK A;  3NQH A;  1W0N A;  1DYO A;  2QQJ A;  4QB2 A;  2VQT A;  3T2Q A;  1NX9 A;  1L7Q A;  1UY0 A;  3ETP A;  2Y6G A;  3LEI A;  5HXM A;  1JU3 A;  1RYY A;  3WNN A;  4TXW A;  1KEX A;  3WSO A;  1JZ3 A;  1BHG A;  4XZU G;  2VME A;  4D8M A;  3OGS A;  2W5F A;  1JU4 A;  3ABZ A;  1KGY A;  2V4V A;  1GOH A;  3VD7 A;  4BK4 A;  4BK5 A;  2WAA A;  4QDR A;  2C9K A;  4A42 A;  3EYP A;  2R7E B;  3C7H A;  3NNG A;  4GZ9 A;  5IYY A;  3J7H A;  5JXG A;  3AC0 A;  3I2F A;  3FL7 A;  3CIH A;  2Y6L A;  2LW8 A;  2W1W A;  3IAQ A;  2VTF A;  3C7F A;  1CIY A;  1NKG A;  1WCQ A;  3ECQ A;  2L9L A;  5LA0 A;  1UX7 A;  5C70 A;  2VZR A;  3A21 A;  3MV0 1;  3I2H A;  1WKY A;  3K46 A;  4ARY A;  3WNO A;  3T08 A;  1D7P M;  2WQ8 A;  1GOF A;  1CZS A;  5C71 A;  3HNB M;  1R64 A;  1JYV A;  3OEB A;  5JXJ A;  3K4Z A;  2J1T A;  3LEK A;  3I3E A;  1JYW A;  2WZE A;  2J1V A;  2W91 A;  4DEV A;  2EID A;  1UXZ A;  4JX0 A;  1GQP A;  3FHQ A;  2B9V A;  3LE0 A;  1UY3 A;  3CMG A;  5IHR A;  3GGL A;  4QX0 A;  5LCW L;  3VDC A;  2YFU A;  2EIB A;  3C8X A;  3W5M A;  4QDQ A;  1IQD C;  1L7R A;  2E33 A;  1PX3 A;  2QQI A;  3WF3 A;  3T09 A;  2JKX A;  3C7O A;  4BXS V;  3FHA A;  1UYY A;  2Y6J A;  4QX2 A;  5EJZ B;  4PF1 A;  4CUA A;  4DEQ A;  3DYO A;  1UY1 A;  3DEC A;  1F4A A;  4MAD A;  4P5Y A;  2X09 A;  1SG3 A;  1US3 A;  1CX1 A;  4QX3 A;  1O8S A;  4GWJ A;  3IAP A;  4FI9 A;  4W4Z A;  5IFT A;  4ET7 A;  3NJV A;  4QB1 A;  2VZ3 A;  2KD7 A;  2QBX A;  1PMJ X;  2BER A;  3E1F 1;  3C7G A;  1HN1 A;  3WF0 A;  4MO3 M;  2BGP A;  3VD9 A;  2VOT A;  2VL4 A;  2XQX A;  1OF3 A;  2XON A;  5LA1 A;  3K4A A;  4GWI A;  1W8N A;  2VZQ A;  2W95 A;  2ZEW A;  2VQU A;  2E31 A;  4YPJ A;  1PMH X;  2OKX A;  2WZ8 A;  1XNT A;  3I97 A;  3MUZ 1;  2VMF A;  2CDP A;  1EUT A;  3BN6 A;  3WQB A;  5FUI A;  2VR4 A;  3MUY 1;  3ACI A;  2RJ2 A;  1ULP A;  1JI6 A;  4XVH A;  4E8C A;  2WYS A;  2DDU A;  3A7Q A;  1GU3 A;  4DXR A;  3HN3 A;  1UY2 A;  1JZ6 A;  2VZT A;  3HPN A;  2VCA A;  4P08 A;  4TTG A;  4JKK A;  3LPG A;  3HNY M;  2HYX A;  3A22 A;  2RVA A;  2BGO A;  2J7M A;  3DYM A;  2W1U A;  1W9S A;  2VZS A;  3OEA A;  2QQN A;  2W94 A;  2VMD A;  3ACH A;  3I2K A;  2ORX A;  2VMC A;  4LQR A;  2VZU A;  3BGA A;  3K77 A;  2QQK A;  2JE8 A;  2VC9 A;  4L0P A;  4DUV A;  4CU7 A;  4BDV B;  2BZD A;  4A44 A;  1DLC A;  3HEI A;  4DUX A;  5CZK A;  4ZXE A;  3WF2 A;  2WO3 A;  4RYD A;  5A1A A;  3DYP A;  1GMM A;  2ORZ A;  2JD9 A;  3CZU A;  4A45 A;  4D0Q A;  3LEG A;  2W3J A;  2X05 A;  2VZP A;  4W50 A;  1JZ5 A;  1UYZ A;  1UWW A;  3IB3 A;  2W92 A;  2ZEX A;  4ZZ8 A;  3WF4 A;  3F2Z A;  1EUU A;  4QB6 A;  3D3A A;  4UAP A;  2ZEZ A;  1H6Y A;  3I2I A;  2Y64 A;  2WO2 A;  2VCB A;  4A4A A;  1T2X A;  3WF1 A;  1W9T A;  2XHN A;  5HPO A;  4KI5 M;  1GUI A;  2QQL A;  2WO1 A;  4JKM A;  3CKH A;  1K3I A;  2QQM A;  2WDB A;  5EJ1 B;  3K4D A;  1W9W A;  2E26 A;  2YG0 A;  1JYX A;  4LKS A;  3CQO A;  5DN2 A;  4UOJ A;  2J1R A;  3LQC A;  1TG7 A;  5DQ0 A;  1J83 A;  4OYU A;  2V5D A;  3MV1 1;  1MPX A;  5B4X A;  2X10 A;  3THD A;  2ZXQ A;  5CYY A;  3I2J A;  2LS6 A;  4ARX A;  3SKV A;  5C7G A;  3ACG A;  5JUV A;  4A6O A;  1OH4 A;  4MOA A;  5G05 L;  3WNL A;  4W8J A;  1W8O A;  1K12 A;  3WNK A;  3P1I A;  2JDA A;  5B4N A;  3CZJ A;  2BBA A;  4DXT A;  5IFP A;  1J84 A;  3U37 A;  1JHJ A;  3GDB A;  2C4X A;  3W5N A;  2C26 A;  1W99 A;  2XOM A;  1GNY A;  3T0D A;  1XPW A;  2HLE A;  3UES A;  3VD3 A;  5DPN A;  2J1S A;  2RV9 A;  1GOG A;  3ZM8 A;  3NJX A;  4XUP A;  1UMH A;  2WN3 A;  1CZV A;  3I3B A;  4KMQ A;  1O59 A;  4XUT A;  2W9X A;  5J1X A;  4XUQ A;  1K45 A;  3UNP A;  4OUE A;  4DXS A;  1P8J A;  1LNS A;  1NUK A;  2V72 A;  5JXI A;  2ZEY A;  1JZ2 A;  1UMI A;  4UI9 L;  2W1S A;  2W1Q A;  2YB7 A;  4PT6 A;  2W47 A;  3OGR A;  2VZ1 A;  4CUB A;  5IJR A;  4QDS A;  3SEE A;  1PX4 A;  1UZ0 A;  3JXS A;  2Z4F A;  3C7E A;  4AAX A;  3T2O A;  3A23 A;  5F7U A;  1H6X A;  3GM8 A;  2B4K A;  2DCJ A;  3PUI A;  1O8P A;  1OD3 A;  3VD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...