3CKHA

Crystal structure of eph a4 receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
170
Chain Sequence
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIDEKNIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ephrin type-A receptor 4
publication title Crystal Structure and NMR Binding Reveal That Two Small Molecule Antagonists Target the High Affinity Ephrin-binding Channel of the EphA4 Receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ckhA00
3WF4A 2E26A 1L7QA 4M4PA 2VZOA 3FHQA 1GMMA 3WF3A 2JKXA 3WF1A 1JHJA 1K3IA 1OT5A 1XNTA 3U37A 4FI9A 3HEIA 2R7EB 1LNSA 2WDBA 3BN6A 3T0AA 1WKYA 2W1SA 4OMCA 5JR2A 1UXXX 1UYZA 4YPJA 5LA1A 3MO4A 1L7RA 1P8JA 4QX1A 4QPWA 4XUPA 3A23A 3ACGA 1MPXA 5B4NA 3GGLA 1UWWA 4PT6A 4XURA 2WZEA 2VMFA 2W94A 4XUTA 2VOTA 5JXJA 3ECQA 3I2KA 4OMDA 2Y6LA 4CVUA 4A3ZA 1UYYA 3UNPA 1O8PA 2WO1A 4TXWA 4GWJA 4MGSA 2QQJA 2VC9A 1UMHA 2XOMA 3I2FA 1OF4A 3WNKA 3VD7A 1TG7A 4MGQA 2W47A 5B4XA 1W8NA 2QBXA 3HNMA 1JU3A 1CZVA 2WZ8A 3P6BA 3ACFA 4W4ZA 3NQHA 1J84A 4CU6A 4CUCA 2V72A 3T0DA 2DDUA 3HNYM 3T2PA 5LA0A 4E8CA 2LS6A 2XHNA 2VQTA 1TVGA 3FHAA 3ACIA 3VDCA 3FN9A 1J83A 4XUQA 2WQ8A 5EJ1B 3T2QA 2J7MA 3ACHA 1EUTA 1O8SA 4JKMA 4CUBA 5C71A 1UY2A 2ORXA 3I3BA 4QX2A 2VZQA 4BJ0A 3LPFA 2VZUA 2BZDA 2CDOA 2W5FA 4D8MA 3AC0A 3MV11 4CU7A 5C7GA 3OBAA 4CU8A 4QDRA 2XQXA 5IHRA 1NKGA 2WABA 2VMEA 3IDAA 3C7GA 5G05L 4ZZ8A 5DN2A 1PX4A 3GDBA 2ZXQA 3LQCA 2C26A 3WF0A 2EIBA 3LPGA 4DXTA 1JZ4A 4P02B 3C7FA 2VMDA 1JZ6A 4P00B 1DP0A 2VQUA 3BGAA 3WNOA 3WNMA 2CDPA 3GM8A 3CDZB 3LEIA 3UETA 5G04L 2VM9A 1JZ2A 2E33A 2VZRA 1GOHA 3NJXA 3W5MA 4BK5A 2YFUA 4BXSV 3NJVA 2VZSA 2BERA 4A45A 5HXMA 3LEKA 4QX0A 2Y6GA 1GUIA 3IIIA 2W3JA 1SHWB 2WAOA 1UXZA 2WN3A 1D7PM 1GNYA 2QQNA 3I2IA 3NNGA 3T09A 5C70A 1PMJX 1W9SA 1NX9A 2YFZA 3PUHA 3K4ZA 5F7UA 2VTFA 3HN3A 1IQDC 4GZ9A 1US2A 4TTGA 4MADA 4DXRA 2ZEZA 2J1SA 3OEAA 4KMQA 1US3A 2W46A 4LHSA 4BK4A 3F2ZA 2WO2A 3I97A 4JX0A 4XZUG 2J1EA 2WN2A 5A1AA 4HG6B 3VD5A 2QQKA 2VZVA 3C7OA 1K12A 4PF1A 1GQPA 5I0DA 4QB1A 3CQOA 4PQQA 4ZY9A 1OD3A 3K46A 1O59A 3J7HA 3VD3A 4XUOA 1JZ5A 3WF2A 2Y6JA 2W9XA 1PMHX 2J22A 1DLCA 1BHGA 4QAWA 3C7EA 5CZKA 3HOBA 1XNAA 2W92A 5DMYA 2J1AA 2E31A 3I3EA 3I2GA 3IAQA 4UOJA 1CZTA 2BBAA 2VL4A 3CMGA 3T2OA 3A7QA 2BGPA 2Y6HA 4DUWA 1F4HA 1EUUA 2B9VA 3HNBM 2HLEA 3WNPA 1UY4A 4A42A 3VDBA 4CU9A 3D3AA 1SDDB 2HYXA 3SKVA 4A41A 3SKJE 3GXUA 4W50A 1GOFA 1UY1A 1PX3A 3MBWA 1W99A 1KGYA 2E32A 3T0BA 3THCA 2J1TA 3ABZA 4P5YA 2QQIA 1ULPA 1DYOA 3WNLA 3UESA 3ZM8A 1W9TA 1JZ8A 3CKHA 2J1UA 4IUGA 5JMOA 2Y8KA 3IAPA 2V5DA 2WBKA 1W8OA 2VR4A 3FL7A 5JXGA 4E8DA 3I2HA 3MUY1 2Y64A 2ZEWA 3PUIA 1H6YA 2W91A 1JZ3A 1F4AA 3C7HA 4AG4A 2VZ1A 4JKKA 4QB2A 3T08A 4OYUA 1T2XA 1UY0A 3DYMA 1W0NA 4GWIA 4ARXA 4XVHA 3DECA 3E1F1 1UX7A 3HJRA 4XUNA 5LCWL 4CUAA 4LKSA 2WAAA 1SG3A 1W9WA 2WUHA 4UI9L 2BGOA 5IFTA 5DPNA 2W1QA 4QB6A 4MOAA 3EB7A 1JU4A 5EJZB 3EYPA 2VZTA 2RJ2A 2QQMA 4DUVA 4RYDA 3WNNA 2JD9A 3SEPA 2X05A 2ZEXA 3K77A 3VDAA 3VD9A 4W8JA 4P08A 2W87A 5JXIA 3SEEA 3OEBA 3JXSA 4M4RA 2VO5A 2V4VA 3MV01 3C8XA 3K4DA 4MO3M 2WYSA 2YC2A 1XC6A 4LPLA 4A4AA 1CX1A 2DCJA 4ZXEA 5IFPA 4UAPA 4ARYA 3I3DA 4OZOA 2YC4A 4LQRA 5HPOA 5JXHA 1R64A 1JZ7A 2WO3A 5JUVA 1WCQA 1NAEA 4JHZA 3K4AA 1GU3A 2RV9A 2VCCA 1CIYA 3K75B 1H6XA 4KWUA 4ZZ5A 4DUXA 2C4XA 4DEVA 2KD7A 2YG0A 2X10A 1K42A 3NRUA 1UMIA 2W1UA 2ZEYA 3P1IA 3IB3A 1UZ0A 4KI5M 2VCBA 3A21A 3WQBA 5J1XA 4ET7A 2J1RA 3WSOA 4A44A 1JYVA 4QDSA 4Z2AA 1UY3A 1JYXA 1OF3A 3OGVA 3W5NA 3LEGA 2L9LA 1JI6A 3CZJA 3OB8A 4OUEA 2QQLA 4QX3A 2EIEA 4DEQA 1KEXA 2W1WA 4DXSA 3THDA 4JKLA 2LW8A 4D0QA 2OKXA 3LE0A 2C9KA 2VZPA 2JE8A 5EIYB 2JDAA 2Z4FA 1ULOA 1I5PA 5IJRA 1CZSA 2B4KA 1JYNA 1RYYA 2ORZA 4BDVB 1JYWA 4A6OA 2QQOA 3CIHA 2VCAA 2XONA 3VD4A 1OH4A 2RVAA 2VJXA 4L0PA 1GOGA 2VZ3A 3I2JA 5FUIA 4RN5A 2DCKA 3OGSA 2EICA 3HPNA 1HN1A 5CYYA 5LA2A 2ID4A 1K45A 3WEZA 5IYYA 3ETPA 2J1VA 1XPWA 5DQ0A 2PQSA 2X09A 1UYXA 1NUKA 2W95A 2YB7A 3MUZ1 3DYPA 4QDQA 4AAXA 3DYOA 2VMCA 1YQ2A 3CZUA 3OGRA 3OG2A 2Y6KA 2EIDA 3A22A
chains in the Genus database with same CATH superfamily
3WF4A 3B5LB 1L7QA 2HWD1 2JXAA 4M4PA 3LOIA 1XQNA 5D8AC 3O1RA 1JOPA 3N9MA 2HEVF 3ZYGA 4YGDA 3WP5A 1QJX3 1X8MA 3FHQA 1GMMA 3WF3A 1NT0A 1AXYA 1WLCA 3RQ0A 3GZAA 2R062 4BXFA 3WF1A 3ZSMA 1K3IA 4IERA 3VDDC 1JYTA 2XWBB 1XNTA 4P9LA 4L9BA 4DOUA 4FI9A 4ITCA 4AGRA 1ZRRA 3LZZA 1OH3A 4IL7A 1OUXA 2E7TA 3SXWA 3T0AA 2ZGNA 3LA7A 4RR3C 3KB5A 5JR2A 3AP6A 4KG0A 3WVJA 5I0RA 2DCTA 3TYJA 4YPJA 5A1FA 4CDWC 2E63A 1L7RA 1MS9A 4A2UA 1CONA 1D4M3 1WMDA 3P5BA 4OUMA 5CFCB 3MF6A 5FYTA 5B4NA 1ND2C 3TN93 3NWKA 4M01A 1H9WA 1JS9A 5FZCA 2ARBA 4KQ7A 5LBEA 1NCQC 3IPVB 4I3GA 4XFAA 4CDQC 2BV4A 2I2SA 4PHZA 4QKBA 2JDYA 2XXZA 5JXJA 5FZGA 2TNFA 1A8MA 4CVUA 4FQ4A 1NQJA 3E6DA 4JGZC 4AR2A 4N9IA 1B35A 2PHRA 2MNGA 3WDXA 2WO1A 5FYUA 2R6QA 2YPJA 1W6MA 1QJU1 2UY9A 1C8M2 1FPN2 3FWEA 3R0RA 2PHFA 4YZ3A 2QQJA 4M3CE 4OUSA 4XTMA 1C5IA 2YC0A 2XOMA 3B94A 4ASKA 1VB4A 1DIWA 2DTWA 1W6QA 1QJEA 2C0ZA 2JIJA 1CQ9A 5B4XA 1GZCA 2RJKA 4Q29A 1W8NA 1POV1 3DV8A 5FZ9A 2XJTA 1BBT1 1EV12 1ZVFA 1AYN2 1YI7A 3I8TA 3O7OA 4W4ZA 4XILA 4ES8A 3BVCA 2WINB 1SEFA 4QT6A 2XMLA 4W65A 1JXNA 1Q43A 4UFKA 3RGBA 3WY6A 4CUCA 5CB7A 3HNYM 1JH5A 1ZBE2 1XNDA 3FX3A 2VNRA 2LS6A 3PTYA 4XQWA 4QD2A 5E16A 4CXXA 1ZA7A 5L9VA 1UZVA 3FBMA 3RRDA 3OBTA 3ACLA 1RGSA 1NA1B 4NROA 2XQRA 3FHAA 2CWMA 4PDWC 2K46A 4EZHA 2JDKA 5CVRA 4YW1A 3AK0A 1BK1A 1UX6A 1YIPA 2ZMLA 4QWNA 2WL1A 4OQ9A 3T2QA 1D0HA 3L2HA 4XBQA 3NAPB 1EUTA 1O8SA 4LHLA 2WWUA 2VCMA 2VOVA 2A3YA 3OGGA 5T5JA 4BQ4A 1U0AA 2VZUA 2ENRA 3RZHA 2P3KA 4NPMA 4GQ7A 2YDEA 3WINE 3FJSA 4Z1VA 3WX5A 4UXAA 1IOAA 1X50A 5C7GA 2NMNA 3NKGA 4CZSA 1BMV2 2WABA 2VMEA 3S30A 3VKMA 3B9IA 1VBB1 4ORFA 1PX4A 4N43B 4BQYA 1HB4A 4DMIA 3GJAA 1RUI2 1HN0A 3S7IA 1ZRFA 1MEC2 1R082 2EF6A 1DQ0A 3OBRA 4YNIA 5DZFA 2YBPA 1PIV1 4BOWA 4EN7B 4MXWB 4P02B 3UYJA 2WNUC 3VLBB 3THTA 4S2GA 4Y22A 2A6VA 5JOWA 4RS5B 1QQP2 5AFEA 1AXZA 1RUJ1 2DVFA 1XU2A 2Z79A 2WQZC 5A32A 2OZ6A 3RWNA 3I3QA 1U12A 3OJBA 1UZWA 2E33A 2DVDA 3MW4A 4IV3A 3HT1A 4XCAA 5F3EA 3ZSKA 3GHMA 3NJXA 5DZGA 3NNJA 3ILRA 4BK5A 3POFA 1ASJ2 4MGYE 4BXSV 1OFSA 2B8MA 2WFF1 5TSWA 1CVNA 4LBKA 1RB8G 4GMP3 5B2GB 4A45A 5BUVA 3ZPYA 4B7EA 4NAMA 5HXMA 4XETA 5ISLA 1TE1B 2LROA 3ME2A 4AQ2A 4QX0A 5JSRA 4YVWB 2Y0OA 4CCEA 1OLQA 3UL2A 5F6KA 1KS5A 1GUIA 1REFA 3MYXA 1SHWB 2HWF3 4QXHA 2WN3A 4EZ4A 1WW4A 4JV4A 1GNYA 4EN8B 4EN6B 3O1MA 3WHTA 5A7NA 1YFUA 5K9YA 3NNGA 4YVSB 2JICA 2R073 5L7OA 1GNHA 1NOVA 1PMJX 3CEWA 1MQTB 1W9SA 3HD8B 3TEYA 2PTMA 2QQPA 2D3RA 2V73A 4WVMA 3UKNA 1BEV3 2VTFA 1WLTA 3POEA 1US2A 4TTGA 2EIGA 2W52A 3NJYA 5A7WA 2DBIA 3HBKA 3LKJA 4JDNA 2VVDA 1NCRB 4FOWA 5C8CA 4KMQA 1ZBA1 3POYA 4JGYC 5K0UA 2ZAAA 4YW4A 3DL3A 1O4ZA 1OPMA 1S0IA 2BOJA 1NZCA 2J1EA 2WN2A 1ZYBA 4Y1VA 5E88A 3PU8A 5A1AA 1PO13 4HG6B 3VD5A 4R4ZA 1B35B 1PO22 2GP3A 2HJIA 3O1UA 2VZVA 2Z5WA 3C7OA 2PMWB 3LSEA 2RR13 5JOXA 1UKGA 3FZ3A 3UK9A 4AQSA 5JMCA 5T5OA 5EV7A 4JRAA 3NJZA 5A33A 2JDHA 2RHPA 2JJ6A 1DYPA 4CE8A 4CPBD 5LW9A 5FMOL 3VBSA 2ZX2A 4ZY9A 1W6QB 3PU3A 4QQ2A 5FPUA 4BQWA 2P17A 3M70A 3K46A 2HWC2 3J7HA 5C5TA 5GZDA 5KHJA 1XJAA 5DDJ2 4C90A 1JZ5A 1QH7A 1GFF2 3JBG1 4XEZA 5JZGC 3NNFA 4LA3A 1RL3A 3PMSA 3GHNA 4R9AA 2Y6JA 3FFZA 1AR63 1FMD1 1PMHX 1SBEA 2JDNA 2WS91 3AMHA 4JTNA 3WQ7A 4QAWA 3C7EA 4BZ4A 4GMP0 2HWD2 2EAAA 2HWB1 1HX6A 1VRBA 5EZWA 4F83A 1S0FA 2XL7A 2A70A 5KXBA 1HKDA 2ARAA 1XYOA 3MW2A 1SFYA 1R1A1 1RUH3 3WG3A 1H9PA 2QZ2A 3AZXA 1ZREA 2WZR1 3O0VA 1H30A 4ZHNA 5JOZA 5FZEA 4YW7A 1KXGA 5FPBA 2YGLA 5IK4A 1N1TA 4Y4YA 1V0AA 1J3RA 2UWBA 4AXOA 1OHFA 3A7QA 3ASIA 5T50A 3HBZA 1LESA 1OI6A 1CX4A 2ZX0A 4TLGA 3KVAA 1F4HA 2IUWA 4FCAA 4Q0VA 4CEWB 3KM5A 1QIQA 3WG4A 2XLGA 1UNBA 3HNBM 1S1AA 4FPOB 3ZR5A 1UY4A 3A0KA 5KC6A 3H3ZA 4E4HA 4XFCA 1YQCA 4F8AA 2E9QA 2AEYA 3K3OA 3D3AA 1SDDB 4A41A 5L19A 4W50A 1QOTA 3AMNA 2NZ9A 3AZZA 1UOJA 4Q4X2 5F5AA 5FCCA 4AVSA 4META 1CAUA 2PA7A 3MBWA 4XTPA 3S6PA 1W99A 3KMHA 3T0BA 4XYXA 3THCA 5J48A 1VP6A 2OX0A 3JD71 4R9BA 4MYEA 2XJVA 4COYA 1GV9A 3OTFA 2ZBJA 3OYWB 2K9ZA 1WCUA 1REEA 3PURA 4AZZA 2GU9A 3ZM8A 3HT2A 4KWLA 1QJU2 2HBTA 3MZHA 5A32B 2P6HA 3POSA 2JDMA 4QHOA 4YWAA 4SBVA 1GNZA 4KWJA 4NRPA 4IV3B 2I74A 2VR4A 3IIAA 3T4HB 1FOD3 3MUY1 2BFUL 2OUHA 1ENQA 2Y64A 1N47A 3D0JA 1RUC1 4NWWA 3CF6E 5EYYA 5FZ0A 3D4KA 1H6YA 1Y9QA 4FOQA 1JZ3A 4CXYA 5ABJB 3KGZA 3EO6A 2PHXA 2VZ1A 2XJPA 3FE5A 4LBNA 4RQPC 4XFFA 2R49A 3N9NA 2DU1A 3KHCA 4FSJA 1UY0A 1AYM2 3FHIB 4ZS2A 4A7ZA 1UOGA 2CY6A 1SLTA 1W0NA 3VB9A 1HRV1 4YW2A 3UV9A 3ZOIA 5ACA1 3RPQA 1SMVA 3MW3A 3E1F1 1NY71 1ZNPA 2IVIB 2WSUA 4AI3A 5EPAA 1REDA 4Y33A 5L7OB 4GAZA 1A8DA 4M3CA 2MEV3 3I3MA 3IDEA 4YZ4A 3O14A 3WR0A 1K5MA 2YYOA 1W9WA 2WUHA 4P9GA 1VRH3 2DVAA 3I59A 2HWE1 5A7OA 1YUDA 3ZFEB 1O6UA 5IFTA 1HXS1 4DRVA 3NV2A 5J36A 2RS53 3VBFA 4FTBA 1QY4A 2Q8EA 1MVEA 1FI2A 2FZ2A 4IEZA 1VBA2 1JU4A 3H42B 3N9PA 1KJRA 1ZRCA 1S0DA 1Y3TA 2PN5A 1W2TA 4H3WA 5A7WB 4WM8B 4J25A 5JIAA 2VECA 1LGNA 2KXLA 2OIIA 3LFMA 4LHKA 5C8CB 2JD9A 4LOTA 3VBUA 3BU7A 1CAVA 3H1MA 5JAXA 5K0UB 1W3XA 4AK3A 1OPOA 3VDAA 3VD9A 5M0TA 3H50A 1GZWA 2BNNA 4M0NA 4P08A 5FXXA 5C9AC 1GKBA 2VUAA 3NV4A 2WQ4A 1W9YA 3EQEA 5CNAA 3AMQA 1VBB2 4BHPA 4XF3A 1D2QA 1N3OA 1SBFA 5IVFA 2ADDA 4CSWA 2WKKA 3KHBA 1O5UA 2QDNA 1XNBA 3B00A 4GULA 3AJYA 3TRSB 3I2OA 2IXCA 2B46X 2VQ0A 1E57A 3UT0A 4Q4V1 2QDRA 1XC6A 1MS4A 5AVAA 4XACA 5FV3A 4CXWA 1C3HA 3VBSB 1UOFA 1UAIA 1VBE1 2JEMA 5IFPA 5F5CA 4UAPA 3RZKA 3VL9A 3KD4A 4XF0A 4BLIA 4J6GA 1VMJA 2ZZJA 1RUJ2 4A3XA 5KR7A 4UWDA 2W08A 2W2IA 3ZFGA 3OPWA 4FO9A 1QXRA 2P3YA 5C33A 3WNXA 5JUVA 1LHWA 1WCQA 4X6QB 3K4AA 4FXKB 4AF9A 1IGOA 1Q3EA 2RV9A 2WLQA 5JDBA 1CIYA 1CPNA 3K75B 5LB6A 2A6YA 1VBD2 2PHDA 4IV1B 1RXGA 2Q1MA 2YG0A 2IXIA 1LHUA 1QJZA 4B3NA 4I0AA 2WFF2 1AR71 1UMIA 3MGUA 3NL1A 2IXKA 3POIA 4RHV1 3WUDA 1BJQA 2ZEYA 1LJ7A 2Z2SB 5JCTA 3IB3A 3PVOA 1UZ0A 3Q8BA 4KI5M 3A21A 5HXVA 3WQBA 3NMBA 4N7UA 2RMU1 2G19A 2CL2A 2J1RA 5T5LA 2O0OA 3AMMA 4GALA 3U07A 4A44A 5BNNC 1OOPC 1ND3C 1JYVA 2BDRA 4YGBA 3B7MA 4QPGC 1LKNA 1N1YA 4OUEA 3GZUC 5FYYA 2Q1FA 4DY5A 1VLNA 1KEXA 3USSA 5I93A 1W8TA 5IWFA 3CU7A 2YMZA 4CCDA 2OPKA 1RUF1 3GYDA 4CP1A 1X8EA 2OKXA 2W68A 4AEDC 4OHXA 1CAUB 2NP0A 2JE8A 3CJIA 1ZRIA 2ZA9A 2D93A 3I54A 1EAH3 5BNOB 5JWPA 1I5PA 4LLOA 5FMCA 1CZSA 5A7SA 2XB6C 3B9CA 1ONAA 4AVAA 5IVJA 3R4UA 1XNKA 4C8DA 2GNDA 2DFBA 1D4VB 1AZDA 5KHHA 2JG8A 3TEZA 3RZGA 3CIHA 4AEKA 3H9AA 4Q4W3 4NIDA 4AAPA 1GP5A 5FZ1A 2GC1A 4CDUB 4WVVA 1NE6A 1NXMA 2RVAA 2VJXA 4IEWA 4L0PA 4MUVA 2GAUA 2VZ3A 3I2JA 2GSYA 2PAEA 4RN5A 1FNZA 1GQGA 1ULCA 1ZX5A 4Y20A 5FY1A 1TQ5A 5IK7A 1IPKA 2PAKA 3WXPA 2EALA 5A3MA 4LHNA 1K45A 2ZTNA 3ATGA 5IYYA 4PLMA 2A3WA 3DKWA 3ZFFA 2WS92 2BQPA 1HRI1 1W2AX 3S5QA 1TMF1 2Q5TA 2VD7A 1PGSA 1NUKA 1R1ZA 4Y26A 3KZ4C 2HWB2 1V6LA 4QU2A 4QDQA 4XAEA 3RWKX 2A73B 2EAKA 2VMCA 3DYOA 3I59B 4NHXA 1JOBA 1HV1A 2DVGA 3OGRA 4UFJA 3WOGA 1ZZBA 3VBFB 4BB3A 2IZWA 3A22A 3TOJA 3VBHA 4YLZA 2E26A 4BMBA 1NG0A 3HAGA 5IAXA 2Y38A 3X29B 1KQRA 1OLRA 4HBNA 4Y5Z0 4LBLA 1IKPA 2UYBA 1AL21 3LGRA 3URFA 4LBQD 1VALA 4PLNA 1CAVB 3VBUB 3RZMA 2JKXA 3HR9A 5F8PA 4LXLA 3D8CA 2HYKA 3VN4A 1AR93 1OT5A 4QPIC 1GZWB 1KD7A 4PBPA 3HEIA 3J7NA 4ES9A 2WDBA 2ZX1A 3BN6A 2A6WA 2R32A 2W1SA 4OMCA 1PZ9A 4DIQA 3ZXJA 5FYZA 1UYZA 1AR81 4COUA 3SCGA 1P8JA 4B4PA 5FYBA 1ENSA 2D5FA 3ACGA 4NIAA 3WCRA 1MPXA 1DGWA 1AX2A 4FFHA 1OA2A 3N36A 5CFCA 5JIUA 2R041 4I02A 5FLHA 5FMDA 3RYRA 1GICA 4E4DX 3ITQA 1PVXA 5DXDA 1SLBA 2WZEA 3PVBB 1VPHA 3IDCB 2W94A 4K8RB 2VOTA 1PGW1 2B45X 4W6YA 4B1MA 3MIHA 2Y60A 3J8F3 5FQ0B 1S0JA 2JG9C 1ZBE3 3TB0A 4A3ZA 1IS3A 1LOBA 1D2SA 3U0ZA 1UYYA 5F39A 2GN7A 1O8PA 4BQ3A 3UNPA 5FYCA 3BTAA 3DPRC 4TXWA 1RUC2 4MGSA 2Y34A 3BODA 4MGIE 2FZ1A 5FZIA 5FXZA 4NAOA 1UMHA 2WT2A 2QQWA 3MIFA 3ZXDA 1Z0HA 2X5IC 3OUIA 2DYCA 1TG7A 3AFKA 1HRV2 2GNBA 5I91A 3O1SA 2ZGSA 4P9IA 2RG4A 2D98A 3J4UH 1AJKA 1AUYA 4GH4C 1CZVA 5J96B 1V6OA 5FZFA 1YQ6A 3KQRA 1UPIA 4CU6A 2BTVC 4G4FA 3ZVXA 4XQ4A 1O3QA 2VGDA 4LKFA 3MIGA 2V72A 4S2DA 1HXS2 1SZBA 5LA0A 3WW2A 3R05A 4G9SB 4CEYC 2JKBA 4EYUA 4GJYA 2K0GA 4QU1A 2XHNA 3BOWA 4KGGA 3UGHA 1W6PB 2RS12 4RFT0 2OW4A 1WA6X 1RUI3 3N9OA 4IQPA 3FN9A 2VMHA 1J83A 3IMMA 3L2YA 2WQ8A 5EJ1B 1RUOA 3CJIB 3JCIA 4IESA 1H8TC 1V9U2 4QX8A 2BNOA 5J98B 3BTXA 1MS8A 1PK6C 5C3PA 4XJZA 4OLLA 1W28A 2FCVA 4CUBA 1UY2A 2HBUA 1IKQA 1BYHA 2ORXA 2VZQA 2WFPA 3KV4A 3NAPA 4TN7A 4BJ0A 2JE9A 2ATFA 3VHRA 3AM2A 5DAXA 3WP6A 4D8MA 3KLSA 1CN1A 1DZTA 5KC5A 1L7LA 1Z7S2 5C4WC 4LBJA 5CKNA 3OBAA 4CU8A 1G86A 1WD3A 3HIFA 3PHMA 4Q4V2 4V2WA 1V70A 1UU4A 4CDXC 4ZZ8A 3C7GA 2CSGA 4DQAA 3ES4A 2XBO3 5ANNA 3GDBA 3LQCA 4O65A 4Y20B 1ASJ3 2C26A 3WF0A 3JQWA 4N43A 5D8AB 5SV8A 1IPSA 4Y4RA 2QJVA 1BVVA 3RVHA 2PXJA 2C9AA 5BYNA 3H8RA 1COV3 2HEWF 5A1LA 1W8FA 1JZ4A 3VZNA 5HCFA 4NIHA 1LU1A 1JZ6A 4P00B 5L9RA 4MXWA 2ZHKA 1QJX1 4YG3A 3LEMA 1CPMA 3BGAA 3LIHA 3VDDB 4D6RA 1X33A 4E9KA 1ZZ9A 3ZXLA 2B9UA 3N7MA 3GM8A 1QEXA 3RDIA 4N53A 2B39A 5G04L 4OHZA 1AR72 3ROUA 3GF6A 4RHV2 4LULA 3VBHB 1Q8VA 5FY9A 4O9GA 3U10A 4CCOA 1HB2A 1LTEA 3W5MA 5HI0A 4QXCA 3A4UA 4MSVA 4ZU4A 2YFUA 5FRAA 2VUCA 4FP2A 3T1MA 1WBFA 4ZONA 4AI1A 5LK5A 1D4M1 4QKDA 4XPVA 4KG8A 5IVYA 1GP4A 2XJQA 3VKNA 4Y3OA 4CCMA 3TN91 2Y6GA 3IIIA 4JHTA 4LEJA 2W3JA 4YVWA 4GB32 2WAOA 2FDKA 1D7PM 2QQNA 3M3OA 5GZCA 1PVC2 2AC1A 2PHLA 3HQXA 3MFAA 2IFRA 1J1TA 1MZEA 1SACA 4YVSA 3ZXKA 1UU5A 4JGZB 4D3WA 1W9FA 5FPLA 1H2KA 3WG1A 5F6LB 3N3HA 1MQTA 2GH2A 3PUHA 1YJLA 3K4ZA 4UFLA 3H3LA 3SLIA 1GYKA 1LU2A 3BYWA 3ZN6A 1YEWA 2VPVA 1IQDC 5GZEA 5AC92 4YZ5A 4YZ2A 2G9FA 2VAUA 3BCWA 4YYOA 5DDJ3 4R9CA 5EHDA 2IXJA 1X36A 1TEIA 2XWJB 4JC1A 2J1SA 1NCRA 1US3A 2XH6A 1WUVA 4NVPA 4PI0A 3KWVA 4E2SA 4JX0A 3T30A 2H6CA 1UZYA 4H7MA 3O1OA 1PM7A 2Q8OA 2SLIA 2YU1A 1YO8A 1RINA 1QH6A 1UL9A 5F32A 4IE4A 3ZKYA 1JYIA 4FPCA 4NR1A 5CFDC 3RYPA 2PYTA 1LECA 1GQPA 4OQ8A 1Y9MA 3Q9OA 5JR7B 3ZYFA 1DZQA 2ZMKA 2QNKA 5I0DA 1FYUA 1QWRA 4NHKA 2BGCA 1QNYA 1OD3A 1HRI2 3T1LA 5GLVA 1TMF2 2A75A 1RMU2 2Q1ZB 2GC3A 3VD3A 4XUOA 5BNQA 3NKTA 5GM0A 3MI8A 1C4RA 4UFMA 1GBGA 1ZZ6A 1MR5A 3VUOA 4AHYA 2ZACA 1M4WA 5FY4A 3AVRA 3DN7A 1OFNA 5HCBA 4FFFA 1OLME 2ZCWA 2JD4A 5H9SA 2VOWA 2W39A 4V1PA 1LOFC 1IPJA 1GZ9A 3HOBA 1XNAA 4Q4X3 3B02A 4HETA 2CYFA 1CAXB 5F9TA 2W92A 5DMYA 2D6PA 1LAJA 4CA9A 4XFBA 4HK9A 1JTZX 3I2GA 3IAQA 3RJRA 2LTNA 2VL4A 2WNUB 3CMGA 4LO7A 4FAHA 2Y6HA 3FBYA 4NIIA 1SDWA 1Y43B 3ZXEA 3RFRA 1U5XA 5FPZA 3ZR6A 1VB2A 2AR6A 3KV9A 2AGSA 4E27A 1EUUA 1YFYA 1UD1A 4YM1A 1XE7A 2HH9A 4LUKA 2JB4A 1ULFA 3H1WA 4CEWA 5CA6A 2ZHMA 2Y0IA 4A42A 4I30A 5A3TA 1BZWA 4CU9A 4FPFA 2RE9A 3AJZA 2B7YA 3ETQA 3LA2A 3LIGA 1VBC2 3SH3A 3SKVA 2R042 1ZRDA 3SKJE 1CJDA 1ODNA 2RM23 4Q4Y3 2RJLA 1BKZA 1XSRA 1YJKA 1OKOA 3VBOC 1AYM3 1QXPA 4XFHA 2PAMA 1PGW2 5FBJA 4B1LA 2WA4A 2ZS6B 1WW6A 1ULPA 1FX5A 1QOSA 1WCDJ 1DYOA 3JUUA 2XR4A 4GMP1 4INDA 2ZGKA 3OYWA 3WV6A 1W9TA 3WNLA 1JZ8A 5T54A 3MIEA 2WO7A 4QQPA 4N53B 3AL5A 2Y8KA 1RUG3 3G7DA 2HWF1 3IAPA 1X82A 5JMOA 3OGJA 1NA1C 5LATA 1W8OA 2C1FA 1QXJA 4Q0PA 2D6NA 1GQHA 2JIGA 3VL8A 1IS5A 1VBA3 2OZJA 2R071 3I2HA 5FR3A 3Q8EA 4EROA 2DBNA 4I2OA 2UWCA 3K3NA 2W91A 3NAPC 1F4AA 1W2NA 3DGTA 3IKWA 1TZOA 2WNVA 4AG4A 1RUD3 4DFSA 4XDPA 5LBCA 4QB2A 3SMHA 1BEV1 1E5HA 1X7NA 1T2XA 3DYMA 4OYUA 4C0BA 5ABJA 2RS33 3ZLIA 1R093 4GWIA 4NOTA 4E2QA 4ARXA 5T3NA 5IVCA 4YZ1A 1BQPA 1QJY3 2VOKA 4NHMA 4XBNA 4XMIA 2FMDA 3ZX7A 4NPLA 5FPAA 2WAAA 3OPTA 2GNMA 3PJQA 3IWZA 1FATA 4YM2A 3R4DB 4RGGA 4FPYA 4UI9L 4URTA 2BGOA 4YW3A 3ZFEA 1PO11 4K1YA 3EJKA 2MPFA 3GCXA 4WV8A 3USUB 3ZN6B 4LTAA 2VBBA 3AP9A 3EYPA 2RR11 1HQNA 1GSLA 1HV0A 3AKRA 4H7LA 2G9GA 4RYDA 2CNAA 2QZ3A 3EBRA 4WM7C 4WM8A 5A3NA 3D0SA 1AF9A 2KR2A 3KT1A 3QACA 1WA4A 3AYEA 4RS5C 2RDQA 2DV9A 4W8JA 5JZGB 2SBAA 2V4AA 1DCSA 3WDWA 3RS6A 3JB8A 3BB6A 5FJHA 2BW8A 1VBD3 2VULA 3JXSA 2IVJA 1GLHA 5EJ3A 1AR61 3ST7A 2V4VA 1J1LA 4FTSA 1XU1A 4JCKA 4V2VA 4MO3M 4O9EA 1RC6A 2YC2A 4XIKA 4A6SA 3BTYA 1H2MA 1OXCA 5FMOS 1RHI2 4FOVA 5IAVA 1RUE3 5KXEA 3M8LA 1C5HA 1QJX2 3I3DA 1RUH1 1X9PA 2YC4A 1GR3A 5HPOA 1UYPA 2PQQA 3INAA 1JZ7A 3ENRA 4F3JA 3B69A 1SLAA 3ELNA 3PNAA 3ALQA 4JHZA 2F6BA 1XE8A 3BTZA 1GU3A 3E5QA 4ZPIA 2X53S 2GALA 4H14A 4AI0A 1QF3A 1FNYA 1F5FA 4IGOA 1H6XA 1XE0A 4ZZ5A 2KA3A 1DQ2A 3D6EA 3PJYA 5FDBA 1N3QA 2F17A 3CHXA 3H8UA 3ORJA 1WMFA 4IV1A 5FOJB 1K42A 1YHFA 4PCRA 3ZO0B 1SQ4A 1S0CA 4TSVA 3VKOA 4C1WA 3VBRA 2XVGA 3V64A 3ZDVA 3AL6A 4AWDA 5H9PA 4HMZA 1PNGA 2D3PA 5DAPA 3TN92 4AQ6A 4B8EA 3LFIA 2XL9A 4QGNA 1DGLA 3WSOA 4CP9A 1Q8SA 5IT6A 1YQ8A 1WD4A 4LITA 3MHZA 2V5YA 1UY3A 1B35C 4WZFA 3DUIA 1SCSA 3W5NA 1JBCA 1GZTA 1CGPA 1HQLA 4QM8A 1JI6A 1FV2A 3CZJA 5KXDA 4QX3A 4COZA 1W6OB 2EIEA 3P3PA 5JI7A 2CGNA 2EA7A 3WW1A 3BALA 4AYUA 4QQOA 4DXSA 4NIGA 3ILNA 2LW8A 4KU7A 2VUDA 4LNVA 4QQHA 2P6CA 3WCSA 1QDOA 2C24A 4I01A 4K40A 4R4XA 4XF4A 3THPA 4LMFA 2IFWA 1FOD1 3N9QA 3R6SA 2ET1A 5FO9B 5IATA 2YROA 3M4FA 3NV1A 4BWOA 2Z4FA 3CL1A 1QOOA 3ZXGA 1H4GA 5FBZA 3LDBA 2B4KA 5FZ8A 2ZGUA 2OYZA 5BNOA 5BPXA 2PLV3 1F8VA 3OPZA 4Z8BA 1JYWA 1JHNA 4A6OA 5T52A 2XONA 5DABA 1HJGA 1RXFA 3O5SA 3ON7A 4KBZA 2ERFA 4QXBA 4X8PA 5LA9A 1OH4A 2X8KA 2CGPA 2Q30A 2WWSA 3JB4C 2MEV1 2VXJA 2BFUS 4J1XA 3SCHA 4CDUA 5FUIA 1VRH1 2IXLA 2DCKA 4IEUA 4DO0A 3SISA 5CYYA 2RS51 1ZZCA 2D6KA 2WNVB 1BBT2 5FAXA 4LK7A 3WEZA 3APBA 1SLIA 3ZSJA 2RDSA 5CKQA 3TEXA 5DQ0A 3AXDA 1OD5A 2PQSA 1UYXA 1LHOA 3MUZ1 5C9AB 4Z82A 5I0SA 4XMAA 3WLUA 4P5HA 1YQ2A 4QHZA 5LY2A 3OG2A 4H2AA 5ANQA 2EIDA 2D44A 2A6ZA 4CTEA 2NN8A 3G6JB 4MGKE 1A3KA 5FTTC 1JMUB 1AX0A 4BMEA 5DAWA 4UW5A 4HXCA 5FJKA 5FLIA 1DZRA 4ZXKA 3RJ2X 5I8YA 4JDMA 2WJSA 1H8VA 1UMZA 1O4YA 5SV5A 1FV3A 4FOYA 3BPZA 5FZBA 3OSDA 5LRRA 2P5BA 1F31A 5A70A 1W90A 4GWMA 3U37A 4FTEA 3OCPA 2R7EB 1OLMA 1POQA 1W3VA 1RVF3 5ERLA 4IV3C 1HW5A 1B09A 1WKYA 5JPMB 4OHYA 5C5UA 1HB3A 2H0BA 4R8HA 4UFHA 1UXXX 2OA2A 4P14A 5CADA 3MO4A 2QCSB 1SFNA 2YHJA 1J3QA 4IETA 1W39A 4XUPA 4IGQA 1ACCA 1PIV2 1S2KA 4K7JA 4LBQB 4RSUA 2JDZA 1N1VA 1DQ5A 5C6CA 1UWWA 4OI0A 4YM0A 5FZ4A 3POGA 4FXGB 4XURA 3C3VA 1LOGA 4Y5SA 5BNNB 4XUTA 1OOPB 1ND3B 2HWF2 3ZDSA 3ECQA 3KS7A 5L7OC 5FYVA 4OMDA 3V0AA 1XXNA 2YUEA 5FQ0A 4E2GA 4JQRA 3MICA 2D6OX 1Q56A 2QVSB 2R072 4P9JA 5T55A 1MZ5A 3J26N 4GWJA 5KWRA 2RS13 1XBFA 2VC9A 5GJ6A 1U5YA 3IT8A 3IDBB 1U5ZA 1XOYA 1LODA 4B4RA 4D69A 2O14A 1MVQA 4XE9A 3WNKA 2QE3A 3UKVA 1BEV2 3VBRB 3H7JA 5LWBA 5C8CC 4AVVA 4DNYA 1YXWA 1V9U3 4MGQA 1G9AA 1E5SA 4FQZA 4AEDB 2W47A 5K0UC 3PUAA 1TME3 2QBXA 2A7AA 4CP9B 4BIOA 3HNMA 5C8WA 4Z2WA 1BCXA 5FYMA 1OQ1A 2WZ8A 3QH7A 5FPXA 3P6BA 3ACFA 3NQHA 4UW3A 4WVWA 1Z78A 3PDQA 2D40A 3ZYRA 3AZYA 4L11A 1EAH1 2VE1A 3WW4A 1Z7S3 1LGBA 4Q0QA 2DDUA 5A7QA 3T2PA 1CWPA 5CIRA 5HCAA 2A3XA 2DUOA 3W9AA 3AKQA 4HSJA 3NSTA 5E8AA 2RR12 1WCSA 2VQTA 4UT5A 3WZ1A 2P2KA 1TVGA 2Q8CA 2JE7A 1DLLA 3C2UA 4KGQA 4Q4W1 3VBSC 2XVKA 3WT3A 1TNRA 1W6PA 1H1MA 3VDCA 4LO4B 4AVTA 5FZLA 3ZYHA 2D97A 2GC0A 3GNEA 1ZBA2 2FBEA 2OQ6A 2PFWA 4LORA 5A6XA 4UYBA 1AL0G 5E89A 5C3SA 3I2DA 3K48A 3KCXA 1JYCA 1HJFA 3KGLA 4JKMA 4NWVA 5C71A 3I3BA 3LPFA 2BUKA 4BISA 4BLJA 3OY8B 3ZMNA 4LE3A 1AR62 5JSOA 2EXIA 1C1FA 4KH9A 4CU7A 2ZABA 3TEWA 2CV6A 2YU2A 2WR9A 4XOGA 3QOPA 2XQXA 3T3YA 5IHRA 5FZKA 1NKGA 1GANA 2UURA 1PNFA 5DUUA 2OVUA 5F2SA 2ZXQA 5BNPA 4S2HA 2GN3A 1IG0A 5FY8A 4AFDA 3N35A 3MPPG 1GWLA 4QGLA 2XJSA 2OS2A 4OI2A 5D8AA 2LUWA 4DXTA 3JBG2 3MLJA 1LB2A 3GBGA 2R063 2TBVA 3C7FA 3E5XA 3HQUA 1W04A 2VMDA 4FP3A 4GB33 1DP0A 1FMD2 4P9XA 1PZ7A 2BRTA 3AKPA 1PMIA 4MG2A 4QPIB 1PVC3 4RGAA 4WVZA 3VDDA 4Q8KA 3U1XA 4COWA 4Q8LA 1AR91 2Q4SA 5FYHA 2YBKA 2CDPA 2J42A 1S2EA 3POJA 2WSVA 2VM9A 4DZGA 1DQ6A 1JZ2A 3BIWE 3ZPOA 3RG0A 2VZRA 1R1A2 4RR3A 1GOHA 3FLTA 2AYHA 1H0BA 4HZFA 4Q26A 5FP8A 3O1TA 2WZR2 5GLWA 2JWPA 4CDWA 2GZWA 2Y33A 4H55A 3RSJA 5AC93 3NJVA 4QHBA 2DUPA 2VZSA 3MDPA 4OHVA 4YFWA 1CESA 4YW5A 3ZMOA 5FWJA 4K21A 4CCJA 4AEMA 1ND2A 4HK8A 3VKFC 4AI8A 1G8WA 1ULDA 4Y24A 1U5IA 2BP6A 1NCQA 1YQ5A 4CDQA 4ZU5A 1WCKA 4YG6A 3WD5A 2DURA 4TLFA 3T09A 1GWKA 2JG9B 4HANA 2C6SA 4UFIA 1YLLA 3AKTA 5C70A 1XSQA 1C8M3 1FPN3 3J8F1 4IEOA 1ZBE1 1F35A 3OOXA 4LBMA 4JGZA 2VBPA 3GBFA 3W21A 4BIFA 1FOD2 5F7UA 1Q5OA 3HN3A 2RDNA 3IMNA 4EJRA 4GZ9A 3AFGA 3JD72 4MADA 1NLQA 1RMU3 1STMA 4XHXA 1VAVA 1YFXA 2YV8A 3AP7A 2O1QA 2ZEZA 4TWTA 1EV13 3MEPA 3POBA 2NMOA 1AYN3 3PVNA 4N8MA 4BK4A 4HSLA 1Y9GA 2RDRA 2XJRA 3I97A 4GH4B 4BA6A 2HKXA 3M3EA 4YFZA 3V0AB 1K5MC 5CEHA 1N3PA 1EYBA 2PHTA 3DF0A 4OULA 1S0GA 4D7SA 4D7TA 1A34A 3J7MA 3VBFC 4HT1T 2NYYA 2QKDA 4K20A 1KJLA 2GMMA 1VRH2 2GMPA 2YZ4A 1KRIA 1DGRA 3VHPA 3VZKA 1K12A 4PF1A 3WQ0A 3I7DA 2BPA2 3KSCA 3RI8A 4EN9B 2UY8A 2PHWA 2CAVA 4HL0A 3OD4A 3ZSLA 5C3QA 2P37A 1UOBA 3VBUC 4PQQA 2QTWB 4K6BA 2VVFA 3AYAA 4PDWA 3W58A 5ACA2 2XUMA 1RUI1 1C8NA 4LUMA 2BNMA 1PK6B 2R1BA 1NY72 3OBZA 4PQ9A 2XKPA 3RYKA 5JLVA 2P34A 4HN1A 2IWGB 2YXSA 5LZ6A 2W9XA 4XIOA 2BJSA 1DLCA 2HWE2 5IVVA 5FZHA 1W8HA 2ZGTA 5JI9A 3KCCA 1D0GA 3U78A 1MZFA 3HQRA 4TZDA 2ARCA 2GMEA 2OT7A 1W8WA 3VZOA 1VBC3 4O61A 2QQUA 5CZKA 4CDXB 4HPKB 4M3CF 1H2NA 1MEC3 1R083 5FKCA 2XBO1 4K3UA 1CAXA 2J1AA 2ZGPA 3OF1A 3ZFGC 4PIZA 2BWCA 2IXHA 3VZMA 1GP6A 1WW5A 2ZHLA 5A7PA 1COV1 2XKOA 1QQP3 2WNUA 3NV3A 4IE5A 4YRDA 4DB5A 4DUWA 2AEZA 1UN1A 1XB9A 1NXD1 1DBNA 1AVBA 4Q1PA 4AGVA 1W8UA 3LF7A 4I3PA 5GKAC 4LE4A 1QGLA 4C1XA 4MVTA 2VMGA 3UJOA 4NRMA 5BNPB 1DYKA 1OUSA 2VNOA 5FYIA 4IDZA 1VBE2 1LOAA 3GXUA 3WHUA 3WG2A 4QKNA 2FDHA 3O1VA 1UY1A 1PX3A 1KS4A 1KGYA 4M00A 1OVPA 3LSDA 3U4XA 1OURA 2QQIA 5FZ6A 4ASLA 2E51A 5FOBB 4LT5A 4UW4A 3UESA 3IZOA 4LO8A 4QQLA 2DCZA 2Y26A 3R4SA 4UW6A 5FY5A 4LIVA 2J1UA 4O7XA 5DUWA 4LKEA 2WBKA 1XYNA 2O8OA 3FL7A 4RR3B 5FPVA 3IBMA 2XGXA 1CAWA 3SNMA 2GH8A 5A3OA 3CJIC 2EVXA 4CDWB 2BVVA 2VOXA 2RMU2 5DG2A 5GLZA 1Q8OA 3BU0A 3C7HA 4L8QA 5IUQA 3HN1A 4OFGA 3T08A 1ND2B 4Q0SA 1EAH2 2WLPA 1VE0A 4NO4A 3M3QA 5FP9A 3ZN4A 1NCQB 4CDQB 2JG8C 4XVHA 4RFRB 2ADEA 3DECA 3HVDA 1S0BA 1UX7A 3J9SA 5DDJ1 4CCKA 1G9DA 4JAAA 5LY1A 4JGYA 4XUNA 1G6NA 1VR3A 4CUAA 1PO23 1V00A 2ZKNA 4Q4W2 4OHWA 2JDUA 1DQ1A 1EPWA 3VGIA 3AZWA 3IN9A 4D7YA 1RUF2 5DPNA 4JZRA 4DS0A 2W1QA 2WYFA 3PL0A 5F3IA 4HN0A 4MOAA 1WW7A 5CFDB 1RHI3 5EJZB 2VNVA 5HBAA 2VZTA 3USUA 4YSFA 2P1BA 4DUVA 3V0BB 3D82A 3ZFFC 2HWC3 5FUPA 1J58A 3WNNA 3SEPA 4XC9A 4KBBA 1PZ8A 4Z07A 5I8SA 2X05A 1LEDA 3GZEA 4MV2A 4FPJA 5FREA 1O4TA 1YNAA 1I6XA 2ZGMA 1WLDA 2R1DA 5HV0A 5JXIA 3M2MA 5JZGA 5FZMA 3SEEA 3VBHC 3S0MA 1W8ZA 4KU8A 5A80A 2HWD3 2WC2A 3OEBA 4EQVA 1WMEA 5C3OA 4M4RA 5AVPA 3GBWA 3M1HA 2XUEA 3NVCA 4YW6A 3C8XA 5LRSA 2WYSA 2MHFA 2C5DA 3H7YA 1YWKA 2BEOA 2ZGQA 3WDYA 4PDWB 3LD8A 1V6MA 2DCJA 4ZXEA 2ILMA 1S55A 3AP5A 1DQ4A 3H8XA 4Q4X1 2DCYA 2VMIA 4URAA 4YG0A 1OBNA 1OC1A 5JXHA 3PLQA 5DUXA 4ZS3A 3S5AA 1AR92 2NM1A 2ARXA 2ZGLA 4PIYA 1NQDA 4MZUA 4D6QA 4OI4A 3QCWA 2EXHA 5A6YA 4NMIA 5I0UA 3ZYPA 1OKQA 2EXKA 4AFAA 2WRAA 4MLOA 2VNGA 3I49A 3T2TA 2C4XA 2JDPA 3KT4A 3V65A 5FKBA 4DPNA 2XLFA 2KD7A 3AZVA 5F1RA 2X10A 1DDLA 3U4SA 4U2AA 1W03A 1SLLA 5GZFA 3SHRA 2E53A 1HIXA 4IGPA 4XFIA 5CFCC 1AL22 1FXZA 3P1IA 4Z92B 4P9YA 5D21A 2VCBA 1UCXA 3K2OA 3VBOB 4XCBA 3LDRA 2RM21 2YGMA 3PUQA 3JQXA 4Q4Y1 5JSPA 2DF7A 1RUNA 4BCUA 5FZAA 3M3CA 1VMFA 1AYM1 1KFUL 2FQPA 5GALA 5A6QA 4XJ8A 2CHHA 3ZYIB 4LLFA 1QJU3 3FLRA 3J8F2 1IZ3A 3PUSA 2Q8DA 3OGVA 4LO5B 2DFCA 4AEJA 1AR82 3OB8A 4UBHA 4B4QA 4DEQA 5K8SA 1ENXA 2W1WA 2GNTA 1W6OA 1GWMA 1Q8PA 2DVBA 3B93A 1RUG1 4BU2A 2A6XA 4D0QA 4AFCA 1POV3 4EWAA 3LE0A 1BBT3 5FUNA 1M06G 1PGL1 1VBA1 1J59A 1OSGA 2JDAA 3QBQA 1O3RA 4RQPA 5IJRA 1CIWA 1JODA 1MS0A 1RUD1 4PIXA 2ORZA 4CCLA 2IC1A 2RS31 1R091 2QQOA 3VD4A 1QJY1 2VU9A 1WBLA 1CAWB 1EPZA 2UU8A 5LBFA 4ZKTB 1GOGA 4Q2FA 4AFMA 2AH2A 3KQ4B 4AVCA 1CJPA 4JTOA 4IEYA 5LA2A 4PLOA 5F5QA 4J1WA 4WM7B 1LHNA 3LOBA 2J1VA 2W0XA 5BY5A 5J37A 1JOJA 4IW3A 1SCRA 1ZA4A 4N9HA 3VHNA 2X09A 3WDUA 4JGYB 3TAYA 2W95A 4TYSA 5J09A 1X9TA 2YB7A 4AOCA 1TNFA 3DYPA 1VBB3 5FZ7A 1DGWX 4EWDA 5C9AA 3HMYA 2CGOA 4YGEA 2Y6KA 2A1XA 4N43C 4RGKA 3CBNA 3H8OA 1VBD1 1F2NA 1HDKA 2XBO2 2FD8A 1PIV3 2VZOA 4HFSA 3Q8CA 1CR7A 1LULA 2OUJA 4BQ1A 3ZIXA 2WNOA 2E6VA 5LEJA 5KXCA 2AACA 1COV2 2P3IA 4LR4A 2ZX4A 1RUJ3 3GJBA 1JHJA 1RUE1 5DAVA 1I3HA 1NYWA 4Q1RA 1RJ8A 3DXUA 2FCTA 2XJUA 4MXVA 5A3WA 3VHOA 1POV0 4N53C 2FDGA 1LNSA 1AHSA 3RZJA 2BBVA 4RL7A 4CP2A 2K2SA 3ILFA 4BM8A 5CG8A 1OQEA 5BXXA 3ZXAC 1UPSA 4NE9A 4CCCA 2R0HA 3SC7X 4ATFA 5LA1A 2WFF3 4RD7A 4QX1A 4QPWA 1ODMA 5DAQA 3A23A 2XG3A 3VKLA 3MF9A 4XXAA 3Q8FA 4LO6B 2I07B 4OZXA 2VBDA 3GGLA 4B7KA 2VH9A 4PT6A 4YM3A 4LBQA 2B42B 5E1RA 4YVWC 5FIXA 4FBFA 2CU5A 5FK8A 4E4ZA 2VMFA 1ZZ8A 2OXBA 4K9SA 5BNNA 2A5ZA 4YVSC 4YARA 3I2KA 4FFIA 2D5HA 1OOPA 1ND3A 2NPIA 2Y6LA 3O0XA 1C28A 5EXOA 1BXHA 1W6MB 4PBOA 1MQTC 2VW1A 4QPGA 4I09A 2D7FA 2DUQA 5CAZA 5EWSA 4ATEA 4CCNA 2VTXJ 3I2FA 1OF4A 3VD7A 1D4M2 1ZBA3 3LAGA 1NCRC 3E5UA 4PF5A 2BU9A 5APAA 4CRQA 4AEDA 3POWA 5LK7B 1JU3A 4MH0E 1L3JA 1G9CA 3PMEA 5FP3A 3WDTA 1SPPA 1ULGA 3SITA 1J84A 4Y1YA 4NPRA 2JENA 2FMYA 3T0DA 2ZKLA 5HCHA 4E8CA 2PLV1 3T4VA 3I4IA 5FY7A 2CTVA 3V56A 5EYXA 3ZYJB 1K5JA 3ACIA 4XDQA 5F3GA 4LOSA 4DY3A 3BIEA 4XUQA 2WIIB 3JBG3 4LK6A 2J7MA 1CD3G 4QX7A 3ACHA 5K4LA 2OQ7A 3S7EA 2XDVA 1FMD3 4RQPB 2WS93 1DU3D 2I45A 1ULEA 4QX2A 2BZDA 2CDOA 5CBLA 1BK0A 2OPWA 3M7AA 2HWB3 2P3JA 3J7LA 3MFCA 4AL9A 3OY8A 1UIKA 2W5FA 3AC0A 3MV11 3MLLA 1LRHA 1UKRA 3N9LA 2VVEA 1WZXA 3OUHA 4IEPA 4QDRA 1R1A3 4M0HA 4A7YA 2E7QA 1S0EA 3IDAA 5E6HA 2XVLA 5G05L 4FPHA 5DN2A 1W6NA 2WZR3 4LIUA 4AW7A 1HB1A 2CWSA 4U36A 2EIBA 3FMGA 4QXKA 2Z69A 3UJQA 2FDIA 1XNCA 5EQUA 1LOCA 4GXLA 3LPGA 4CP0A 5K7PA 4BH9A 4AHWA 1JN2P 2JB8A 1N1SA 4Y22B 4K1ZA 3N7JA 1C1LA 2G4IA 3NW4A 4LBOA 4XJWA 3P3NA 4EV0A 2VQUA 5IVBA 5BV6A 1UZZA 3KVBA 3WNOA 3O12A 4OI1A 4KWKA 1LR5A 1V6JA 1EY2A 5H9RA 4CEWC 4XW3A 4QPIA 2R16A 5HV4A 3AXEA 3RZZA 1VJ2A 3WNMA 4XF1A 3LEIA 3CDZB 3UETA 2VY0A 4UF0A 1RVF1 2WWJA 1DHKB 1T6BX 1E5IA 2YY1A 1DFQA 1KDKA 5IK8A 4PI2A 1LEMA 3FFQA 1MACA 4D6SA 3JD73 2RM22 4Q4Y2 1NZIA 3K51A 4HLTA 5FMBA 3TNQA 5J3UA 2BERA 4EN0A 3ZN5A 3N7LA 3TBDA 2R30A 3N4MA 3LEKA 5CG9A 1LOEA 2ZHNA 4AVBA 4Y5TA 1ST8A 4UBGA 5IK5A 1A6CA 1JUIA 4QM9A 5I0TA 3BOPA 5T5PA 3H1YA 1UXZA 1VAKA 1IHMA 1UF2C 3I2IA 2QQVA 4YGCA 4DXZA 2VUJA 2NLRA 4IE0A 4ISRA 1RUG2 4QPYA 1QHDA 2JG9A 5FY0A 1RUC3 4WVMB 3RI9A 4FPGA 1YRZA 3W59A 4JQTA 1NX9A 2YFZA 5FYSA 3B3QE 3KV5A 1PGL2 4BYYA 3DPRA 2WNVC 1OA4A 4Y1XA 2RS11 4XBLA 4AE2A 5ABJC 3L9JT 1HRV3 5ACA3 4DXRA 2X5IA 1RUD2 3WP4A 5L73A 3OEAA 5CISA 1V9U1 1WGPA 2HEYF 4XQDA 2W46A 4LHSA 2RS32 3F2ZA 2WO2A 1R092 4BQ5A 2WT1A 3M3IA 4XZUG 1TME1 3OD0A 1PHMA 1QJY2 2HWE3 4GA9A 4GH4A 4LJHA 3TWIA 1WLWA 2D6MA 1HXS3 3AVSA 4CYDA 1I1EA 2A71A 3ES1A 4HOOA 2ZGOA 3AP4A 3ZFEC 4QPGB 4MHUA 4AI9A 4Q27A 3UKTA 3VZJA 2QQKA 1Z7S1 4CEYA 2P4EA 5A33B 3ZXFA 3KCYA 1APNA 4HONA 1QKQA 4WM8C 4HVRA 4QB1A 3CQOA 4WBBA 1T6GC 4C0HA 2FHRA 1YFWA 1YI9A 3ZSEA 4DRRA 1O59A 1NE4A 3VV1A 5DZEA 4GIQA 1O3SA 1H8TA 1H1AA 1SPPB 3WUCA 1G9BA 1PK6A 4NJ4A 3WF2A 1H2LA 2J22A 4L2NA 1BLZA 1BHGA 2EXJA 3GZTB 1UU6A 1PO12 4FPLA 2TUNA 1W2OA 4Q4V3 3BUCA 4IEQA 3RMXA 2X29A 4ONUA 2XLAA 5C4WA 4GD4A 1W0OA 1VBE3 1KDMA 5FK7A 3PTRB 1Y7BA 2DTYA 1ALYA 3MIDA 4RA0A 5FO7B 3GALA 4CDXA 1WMXA 4HPKA 1RUE2 2JECA 2CAUA 3LA3A 4NRQA 2E7AA 2ZJCA 5KBFA 1PM4A 2PHUA 2ZMNA 3CJXA 2ZZQA 2Q0AA 2BVBA 2E31A 4GKXA 3I3EA 2WT0A 4HVOA 1CZTA 1SFPA 1V6IA 2BBAA 4UOJA 3T2OA 4AFBA 2Y6FA 2BGPA 2FCUA 3PIGA 4IE7A 4BQ2A 2R061 5FXWA 1HLCA 1O7FA 2WA3A 3E6CC 1W05A 2WZPP 2H0VA 3QLQA 1UQXA 1SLCA 1MS3A 4GB31 4A7KA 4IEVA 3CLPA 2B9VA 1AR73 4IV1C 3RNSA 1E5RA 1PVC1 5JVVA 4RHV3 3WNPA 2HLEA 4XAAA 1IS4A 4S2FA 3PIJA 1W6NB 3VDBA 3VBRC 3MLKA 2VQAA 1ENRA 5FZOA 3GCWA 3FUOA 4AI2A 2HYXA 4AQTA 5KHGA 4FPEA 2RMU3 1VMHA 5F2WA 5L9BA 5LASA 1RUH2 1GOFA 5J7MA 4IE6A 1YIFA 2V09A 3EHKA 2E32A 1AJOA 2XPJA 1H4HA 4LKDA 2J1TA 3ABZA 3DXTA 5AC91 1ZM1A 4P5YA 1IQAA 3RZLA 3NNLA 2QUOA 4I0WB 4COVA 1O3TA 4X8NA 4BQXA 3CKHA 1FT9A 4IUGA 1MS5A 3H0OA 1OA3A 1OVSA 4L97A 5AFBA 3HWJA 1RUF3 2V5DA 2KM2A 1NLSA 3AYCA 4UF0B 3KF3A 3UGFA 5JXGA 4HKLA 1JUHA 4XJAA 4E8DA 1ZZ7A 3KV6A 1AX1A 1DGRN 2QFEA 4SLIA 1H1IA 4W6XA 2ZEWA 4JVAA 1O5LA 3Q8AA 1C8M1 1FPN1 1RJ7A 3PUIA 3F95A 1W06A 3W20A 2VW0A 3JZVA 3A0NA 2AZ5A 3BPSA 4JKKA 2D6LX 5JOYA 5BNOC 4C91A 3BKZA 5F37A 3WP3A 3U14A 1RMU1 2D43A 3FLPA 2UYAA 1DF0A 1QU0A 2PLV2 4M3CB 3HJRA 1EV11 4XDOA 1AYN1 3MPBA 5LCWL 1K5MB 4P9WA 4LKSA 2XHKA 2N7GA 2ZX3A 1SG3A 4E4SA 4CDUC 3ZYBA 1I5ZA 1C57A 3NNMA 2YPDA 5A6ZA 2TEPA 3FUQA 4QGMA 4QB6A 3DPRB 4GWNA 3EB7A 3ZIWA 3SQOA 4ZU7A 4BE3A 4HKWA 4QKFA 5FZDA 5CFDA 2RJ2A 2QQMA 3FC0A 5IVEA 1HRI3 2X5IB 1TMF3 3LDKA 1OMIA 3QH6A 3V0BA 1YCIA 3CNAA 1IG3A 2BOIA 2O8QA 3LB9A 1YYNA 3AB0A 5JPNB 2ZEXA 3KF5A 2R0FA 3K77A 4XFGA 3MIBA 4FVVA 2BWAA 1IS6A 3OUJA 2VXRA 5FWEA 3WQ1A 2W87A 3AX4A 5A3PA 4L92A 2AENA 2MEV2 4OCTA 2VO5A 4R9DA 4CEYB 4AHZA 5H9QA 2VG9A 3MV01 5A3UA 3IM0A 1OQDA 3K4DA 3AYDA 2RS52 1AL23 2VTXA 4LPLA 4AHXA 1AXKA 4A4AA 3O1PA 1BMV1 4HVQA 1LOFA 1VBC1 4JRLA 4NN0A 2ZPXA 4FPKA 5CKMA 4DINB 1CX1A 4ARYA 4OZOA 2DWRA 1H8TB 2LALA 1MEC1 1R081 3IPVA 4LQRA 3ZFGB 1R64A 1G7YA 3LCPA 2NQYA 4XJUA 2GP5A 3QD6A 2WO3A 2AREA 1NAEA 3ZKUA 4L99A 1W2UA 3N7KA 1XYPA 1AR83 2VCCA 5LBBA 1QMJA 1I9RA 4FT8A 1RVF2 4G3YC 4GKYA 5DUVA 3RMYA 1QQP1 4JDOA 4NUBA 4KWUA 5FP4A 5FXVA 4DEVA 3DKQA 3LWCA 4DUXA 2H6BA 1HQWA 5C4WB 4N7IA 1NLRA 5FO8B 2GDFA 4Y1UA 1F15A 3NRUA 4MGZE 5FP7A 2R043 3DEMA 2W1UA 4XF9A 5GLUA 4Q0UA 3U11A 5D2AA 4QX5A 1XRUA 4CPBA 2F4PA 4FAGA 4OVEA 5FZ3A 4CUGA 4EE2A 5J1XA 1MZ6A 1ASJ1 4R52A 4ET7A 2AUYA 4GJZA 1V6KA 3VBOA 4NHYA 1WWYA 4QDSA 2PELA 4I0BA 2VW2A 4Z2AA 1J3PA 5GLTA 3S57A 4WZCA 4EWEA 1RTVA 2ET7A 1JYXA 5KHIA 1OF3A 3LEGA 3B01A 4MHRA 2JX9A 2L9LA 4XZPA 1A78A 5CU1A 2QQLA 2B5HA 1EP0A 2YBSA 5FFOC 3U75A 4MX3A 5EP9A 3WW3A 1UIJA 3SCFA 2Z42A 4PJYA 1V6NA 3THDA 3O0WA 4JKLA 5F5IA 5A3LA 5FZOB 4Y1ZA 1LGCA 1NA1A 2G9ZA 4F7ZA 4LA2A 1F9KA 4FFGA 2ES3A 3E97A 2UWAA 2C9KA 4W6WA 2VZPA 1W0PA 5D1IA 5IW0A 1KITA 1G9FA 1QDCA 1TME2 5EIYB 3AMPA 4HKOA 1ULOA 4XJ9A 1LHVA 1RIRA 2D3SA 1DG6A 5EFUA 1YC61 3EMRA 5DG1A 1JYNA 1QNWA 1RYYA 4BDVB 2FDFA 1LENA 2JG8B 4Q5OA 3NO8A 1SBDA 4XXPA 4QMAA 1FAYA 2VCAA 4XHBA 3UGGA 4IEXA 5KHKA 1BVP1 3CO2A 3SH4A 5C3RA 3BI3A 2LM3A 4N90A 1PO21 3D5OA 3SH5A 4MGTA 3AKSA 4BPZA 4K8FA 1Q8QA 3OGSA 2EICA 1UW8A 3HPNA 1HN1A 1KFXL 5F3CA 4IXLA 5L36A 4ASMB 2DU0A 3WDVA 5I8TA 3DCQA 4ISQA 3VZLA 2ID4A 2ZAHA 2ZOEB 4KNCA 3ZFFB 1RHI1 3ETPA 3PVEA 3KT7A 3JU9A 5LEKA 3EXUA 1O91A 1RITA 1XPWA 4WM7A 1F5JA 1VIWB 3H3UA 3TNPB 1VAMA 2HWC1 1UO9A 5GZGA 4AGGA 4NHLA 4B29A 2WNEA 4RS5A 4XABA 2GC2A 1QJFA 3E6BA 2LRPA 4X6RB 2FDJA 2ETEA 2G1MA 5FLJA 1JW6A 2ZGRA 4AAXA 1URXA 1Y4WA 4D94A 2BYVE 4KL1A 5BNPC 3CZUA 1LCLA 1S2BA 1S4CA 2F4LA 1MS1A
chains in the Genus database with same CATH topology
3WF4A 2E26A 1L7QA 4M4PA 2VZOA 3FHQA 1GMMA 3WF3A 2JKXA 3WF1A 1JHJA 1K3IA 1OT5A 1XNTA 3U37A 4FI9A 3HEIA 2R7EB 1LNSA 2WDBA 3BN6A 3T0AA 1WKYA 2W1SA 4OMCA 5JR2A 1UXXX 1UYZA 4YPJA 5LA1A 3MO4A 1L7RA 1P8JA 4QX1A 4QPWA 4XUPA 3A23A 3ACGA 1MPXA 5B4NA 3GGLA 1UWWA 4PT6A 4XURA 2WZEA 2VMFA 2W94A 4XUTA 2VOTA 5JXJA 3ECQA 3I2KA 4OMDA 2Y6LA 4CVUA 4A3ZA 1UYYA 3UNPA 1O8PA 2WO1A 4TXWA 4GWJA 4MGSA 2QQJA 2VC9A 1UMHA 2XOMA 3I2FA 1OF4A 3WNKA 3VD7A 1TG7A 4MGQA 2W47A 5B4XA 1W8NA 2QBXA 3HNMA 1JU3A 1CZVA 2WZ8A 3P6BA 3ACFA 4W4ZA 3NQHA 1J84A 4CU6A 4CUCA 2V72A 3T0DA 2DDUA 3HNYM 3T2PA 5LA0A 4E8CA 2LS6A 2XHNA 2VQTA 1TVGA 3FHAA 3ACIA 3VDCA 3FN9A 1J83A 4XUQA 2WQ8A 5EJ1B 3T2QA 2J7MA 3ACHA 1EUTA 1O8SA 4JKMA 4CUBA 5C71A 1UY2A 2ORXA 3I3BA 4QX2A 2VZQA 4BJ0A 3LPFA 2VZUA 2BZDA 2CDOA 2W5FA 4D8MA 3AC0A 3MV11 4CU7A 5C7GA 3OBAA 4CU8A 4QDRA 2XQXA 5IHRA 1NKGA 2WABA 2VMEA 3IDAA 3C7GA 5G05L 4ZZ8A 5DN2A 1PX4A 3GDBA 2ZXQA 3LQCA 2C26A 3WF0A 2EIBA 3LPGA 4DXTA 1JZ4A 4P02B 3C7FA 2VMDA 1JZ6A 4P00B 1DP0A 2VQUA 3BGAA 3WNOA 3WNMA 2CDPA 3GM8A 3CDZB 3LEIA 3UETA 5G04L 2VM9A 1JZ2A 2E33A 2VZRA 1GOHA 3NJXA 3W5MA 4BK5A 2YFUA 4BXSV 3NJVA 2VZSA 2BERA 4A45A 5HXMA 3LEKA 4QX0A 2Y6GA 1GUIA 3IIIA 2W3JA 1SHWB 2WAOA 1UXZA 2WN3A 1D7PM 1GNYA 2QQNA 3I2IA 3NNGA 3T09A 5C70A 1PMJX 1W9SA 1NX9A 2YFZA 3PUHA 3K4ZA 5F7UA 2VTFA 3HN3A 1IQDC 4GZ9A 1US2A 4TTGA 4MADA 4DXRA 2ZEZA 2J1SA 3OEAA 4KMQA 1US3A 2W46A 4LHSA 4BK4A 3F2ZA 2WO2A 3I97A 4JX0A 4XZUG 2J1EA 2WN2A 5A1AA 4HG6B 3VD5A 2QQKA 2VZVA 3C7OA 1K12A 4PF1A 1GQPA 5I0DA 4QB1A 3CQOA 4PQQA 4ZY9A 1OD3A 3K46A 1O59A 3J7HA 3VD3A 4XUOA 1JZ5A 3WF2A 2Y6JA 2W9XA 1PMHX 2J22A 1DLCA 1BHGA 4QAWA 3C7EA 5CZKA 3HOBA 1XNAA 2W92A 5DMYA 2J1AA 2E31A 3I3EA 3I2GA 3IAQA 4UOJA 1CZTA 2BBAA 2VL4A 3CMGA 3T2OA 3A7QA 2BGPA 2Y6HA 4DUWA 1F4HA 1EUUA 2B9VA 3HNBM 2HLEA 3WNPA 1UY4A 4A42A 3VDBA 4CU9A 3D3AA 1SDDB 2HYXA 3SKVA 4A41A 3SKJE 3GXUA 4W50A 1GOFA 1UY1A 1PX3A 3MBWA 1W99A 1KGYA 2E32A 3T0BA 3THCA 2J1TA 3ABZA 4P5YA 2QQIA 1ULPA 1DYOA 3WNLA 3UESA 3ZM8A 1W9TA 1JZ8A 3CKHA 2J1UA 4IUGA 5JMOA 2Y8KA 3IAPA 2V5DA 2WBKA 1W8OA 2VR4A 3FL7A 5JXGA 4E8DA 3I2HA 3MUY1 2Y64A 2ZEWA 3PUIA 1H6YA 2W91A 1JZ3A 1F4AA 3C7HA 4AG4A 2VZ1A 4JKKA 4QB2A 3T08A 4OYUA 1T2XA 1UY0A 3DYMA 1W0NA 4GWIA 4ARXA 4XVHA 3DECA 3E1F1 1UX7A 3HJRA 4XUNA 5LCWL 4CUAA 4LKSA 2WAAA 1SG3A 1W9WA 2WUHA 4UI9L 2BGOA 5IFTA 5DPNA 2W1QA 4QB6A 4MOAA 3EB7A 1JU4A 5EJZB 3EYPA 2VZTA 2RJ2A 2QQMA 4DUVA 4RYDA 3WNNA 2JD9A 3SEPA 2X05A 2ZEXA 3K77A 3VDAA 3VD9A 4W8JA 4P08A 2W87A 5JXIA 3SEEA 3OEBA 3JXSA 4M4RA 2VO5A 2V4VA 3MV01 3C8XA 3K4DA 4MO3M 2WYSA 2YC2A 1XC6A 4LPLA 4A4AA 1CX1A 2DCJA 4ZXEA 5IFPA 4UAPA 4ARYA 3I3DA 4OZOA 2YC4A 4LQRA 5HPOA 5JXHA 1R64A 1JZ7A 2WO3A 5JUVA 1WCQA 1NAEA 4JHZA 3K4AA 1GU3A 2RV9A 2VCCA 1CIYA 3K75B 1H6XA 4KWUA 4ZZ5A 4DUXA 2C4XA 4DEVA 2KD7A 2YG0A 2X10A 1K42A 3NRUA 1UMIA 2W1UA 2ZEYA 3P1IA 3IB3A 1UZ0A 4KI5M 2VCBA 3A21A 3WQBA 5J1XA 4ET7A 2J1RA 3WSOA 4A44A 1JYVA 4QDSA 4Z2AA 1UY3A 1JYXA 1OF3A 3OGVA 3W5NA 3LEGA 2L9LA 1JI6A 3CZJA 3OB8A 4OUEA 2QQLA 4QX3A 2EIEA 4DEQA 1KEXA 2W1WA 4DXSA 3THDA 4JKLA 2LW8A 4D0QA 2OKXA 3LE0A 2C9KA 2VZPA 2JE8A 5EIYB 2JDAA 2Z4FA 1ULOA 1I5PA 5IJRA 1CZSA 2B4KA 1JYNA 1RYYA 2ORZA 4BDVB 1JYWA 4A6OA 2QQOA 3CIHA 2VCAA 2XONA 3VD4A 1OH4A 2RVAA 2VJXA 4L0PA 1GOGA 2VZ3A 3I2JA 5FUIA 4RN5A 2DCKA 3OGSA 2EICA 3HPNA 1HN1A 5CYYA 5LA2A 2ID4A 1K45A 3WEZA 5IYYA 3ETPA 2J1VA 1XPWA 5DQ0A 2PQSA 2X09A 1UYXA 1NUKA 2W95A 2YB7A 3MUZ1 3DYPA 4QDQA 4AAXA 3DYOA 2VMCA 1YQ2A 3CZUA 3OGRA 3OG2A 2Y6KA 2EIDA 3A22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WF4 A;  2E26 A;  1L7Q A;  4M4P A;  2VZO A;  3FHQ A;  1GMM A;  3WF3 A;  2JKX A;  3WF1 A;  1JHJ A;  1K3I A;  1OT5 A;  1XNT A;  3U37 A;  4FI9 A;  3HEI A;  2R7E B;  1LNS A;  2WDB A;  3BN6 A;  3T0A A;  1WKY A;  2W1S A;  4OMC A;  5JR2 A;  1UXX X;  1UYZ A;  4YPJ A;  5LA1 A;  3MO4 A;  1L7R A;  1P8J A;  4QX1 A;  4QPW A;  4XUP A;  3A23 A;  3ACG A;  1MPX A;  5B4N A;  3GGL A;  1UWW A;  4PT6 A;  4XUR A;  2WZE A;  2VMF A;  2W94 A;  4XUT A;  2VOT A;  5JXJ A;  3ECQ A;  3I2K A;  4OMD A;  2Y6L A;  4CVU A;  4A3Z A;  1UYY A;  3UNP A;  1O8P A;  2WO1 A;  4TXW A;  4GWJ A;  4MGS A;  2QQJ A;  2VC9 A;  1UMH A;  2XOM A;  3I2F A;  1OF4 A;  3WNK A;  3VD7 A;  1TG7 A;  4MGQ A;  2W47 A;  5B4X A;  1W8N A;  2QBX A;  3HNM A;  1JU3 A;  1CZV A;  2WZ8 A;  3P6B A;  3ACF A;  4W4Z A;  3NQH A;  1J84 A;  4CU6 A;  4CUC A;  2V72 A;  3T0D A;  2DDU A;  3HNY M;  3T2P A;  5LA0 A;  4E8C A;  2LS6 A;  2XHN A;  2VQT A;  1TVG A;  3FHA A;  3ACI A;  3VDC A;  3FN9 A;  1J83 A;  4XUQ A;  2WQ8 A;  5EJ1 B;  3T2Q A;  2J7M A;  3ACH A;  1EUT A;  1O8S A;  4JKM A;  4CUB A;  5C71 A;  1UY2 A;  2ORX A;  3I3B A;  4QX2 A;  2VZQ A;  4BJ0 A;  3LPF A;  2VZU A;  2BZD A;  2CDO A;  2W5F A;  4D8M A;  3AC0 A;  3MV1 1;  4CU7 A;  5C7G A;  3OBA A;  4CU8 A;  4QDR A;  2XQX A;  5IHR A;  1NKG A;  2WAB A;  2VME A;  3IDA A;  3C7G A;  5G05 L;  4ZZ8 A;  5DN2 A;  1PX4 A;  3GDB A;  2ZXQ A;  3LQC A;  2C26 A;  3WF0 A;  2EIB A;  3LPG A;  4DXT A;  1JZ4 A;  4P02 B;  3C7F A;  2VMD A;  1JZ6 A;  4P00 B;  1DP0 A;  2VQU A;  3BGA A;  3WNO A;  3WNM A;  2CDP A;  3GM8 A;  3CDZ B;  3LEI A;  3UET A;  5G04 L;  2VM9 A;  1JZ2 A;  2E33 A;  2VZR A;  1GOH A;  3NJX A;  3W5M A;  4BK5 A;  2YFU A;  4BXS V;  3NJV A;  2VZS A;  2BER A;  4A45 A;  5HXM A;  3LEK A;  4QX0 A;  2Y6G A;  1GUI A;  3III A;  2W3J A;  1SHW B;  2WAO A;  1UXZ A;  2WN3 A;  1D7P M;  1GNY A;  2QQN A;  3I2I A;  3NNG A;  3T09 A;  5C70 A;  1PMJ X;  1W9S A;  1NX9 A;  2YFZ A;  3PUH A;  3K4Z A;  5F7U A;  2VTF A;  3HN3 A;  1IQD C;  4GZ9 A;  1US2 A;  4TTG A;  4MAD A;  4DXR A;  2ZEZ A;  2J1S A;  3OEA A;  4KMQ A;  1US3 A;  2W46 A;  4LHS A;  4BK4 A;  3F2Z A;  2WO2 A;  3I97 A;  4JX0 A;  4XZU G;  2J1E A;  2WN2 A;  5A1A A;  4HG6 B;  3VD5 A;  2QQK A;  2VZV A;  3C7O A;  1K12 A;  4PF1 A;  1GQP A;  5I0D A;  4QB1 A;  3CQO A;  4PQQ A;  4ZY9 A;  1OD3 A;  3K46 A;  1O59 A;  3J7H A;  3VD3 A;  4XUO A;  1JZ5 A;  3WF2 A;  2Y6J A;  2W9X A;  1PMH X;  2J22 A;  1DLC A;  1BHG A;  4QAW A;  3C7E A;  5CZK A;  3HOB A;  1XNA A;  2W92 A;  5DMY A;  2J1A A;  2E31 A;  3I3E A;  3I2G A;  3IAQ A;  4UOJ A;  1CZT A;  2BBA A;  2VL4 A;  3CMG A;  3T2O A;  3A7Q A;  2BGP A;  2Y6H A;  4DUW A;  1F4H A;  1EUU A;  2B9V A;  3HNB M;  2HLE A;  3WNP A;  1UY4 A;  4A42 A;  3VDB A;  4CU9 A;  3D3A A;  1SDD B;  2HYX A;  3SKV A;  4A41 A;  3SKJ E;  3GXU A;  4W50 A;  1GOF A;  1UY1 A;  1PX3 A;  3MBW A;  1W99 A;  1KGY A;  2E32 A;  3T0B A;  3THC A;  2J1T A;  3ABZ A;  4P5Y A;  2QQI A;  1ULP A;  1DYO A;  3WNL A;  3UES A;  3ZM8 A;  1W9T A;  1JZ8 A;  3CKH A;  2J1U A;  4IUG A;  5JMO A;  2Y8K A;  3IAP A;  2V5D A;  2WBK A;  1W8O A;  2VR4 A;  3FL7 A;  5JXG A;  4E8D A;  3I2H A;  3MUY 1;  2Y64 A;  2ZEW A;  3PUI A;  1H6Y A;  2W91 A;  1JZ3 A;  1F4A A;  3C7H A;  4AG4 A;  2VZ1 A;  4JKK A;  4QB2 A;  3T08 A;  4OYU A;  1T2X A;  1UY0 A;  3DYM A;  1W0N A;  4GWI A;  4ARX A;  4XVH A;  3DEC A;  3E1F 1;  1UX7 A;  3HJR A;  4XUN A;  5LCW L;  4CUA A;  4LKS A;  2WAA A;  1SG3 A;  1W9W A;  2WUH A;  4UI9 L;  2BGO A;  5IFT A;  5DPN A;  2W1Q A;  4QB6 A;  4MOA A;  3EB7 A;  1JU4 A;  5EJZ B;  3EYP A;  2VZT A;  2RJ2 A;  2QQM A;  4DUV A;  4RYD A;  3WNN A;  2JD9 A;  3SEP A;  2X05 A;  2ZEX A;  3K77 A;  3VDA A;  3VD9 A;  4W8J A;  4P08 A;  2W87 A;  5JXI A;  3SEE A;  3OEB A;  3JXS A;  4M4R A;  2VO5 A;  2V4V A;  3MV0 1;  3C8X A;  3K4D A;  4MO3 M;  2WYS A;  2YC2 A;  1XC6 A;  4LPL A;  4A4A A;  1CX1 A;  2DCJ A;  4ZXE A;  5IFP A;  4UAP A;  4ARY A;  3I3D A;  4OZO A;  2YC4 A;  4LQR A;  5HPO A;  5JXH A;  1R64 A;  1JZ7 A;  2WO3 A;  5JUV A;  1WCQ A;  1NAE A;  4JHZ A;  3K4A A;  1GU3 A;  2RV9 A;  2VCC A;  1CIY A;  3K75 B;  1H6X A;  4KWU A;  4ZZ5 A;  4DUX A;  2C4X A;  4DEV A;  2KD7 A;  2YG0 A;  2X10 A;  1K42 A;  3NRU A;  1UMI A;  2W1U A;  2ZEY A;  3P1I A;  3IB3 A;  1UZ0 A;  4KI5 M;  2VCB A;  3A21 A;  3WQB A;  5J1X A;  4ET7 A;  2J1R A;  3WSO A;  4A44 A;  1JYV A;  4QDS A;  4Z2A A;  1UY3 A;  1JYX A;  1OF3 A;  3OGV A;  3W5N A;  3LEG A;  2L9L A;  1JI6 A;  3CZJ A;  3OB8 A;  4OUE A;  2QQL A;  4QX3 A;  2EIE A;  4DEQ A;  1KEX A;  2W1W A;  4DXS A;  3THD A;  4JKL A;  2LW8 A;  4D0Q A;  2OKX A;  3LE0 A;  2C9K A;  2VZP A;  2JE8 A;  5EIY B;  2JDA A;  2Z4F A;  1ULO A;  1I5P A;  5IJR A;  1CZS A;  2B4K A;  1JYN A;  1RYY A;  2ORZ A;  4BDV B;  1JYW A;  4A6O A;  2QQO A;  3CIH A;  2VCA A;  2XON A;  3VD4 A;  1OH4 A;  2RVA A;  2VJX A;  4L0P A;  1GOG A;  2VZ3 A;  3I2J A;  5FUI A;  4RN5 A;  2DCK A;  3OGS A;  2EIC A;  3HPN A;  1HN1 A;  5CYY A;  5LA2 A;  2ID4 A;  1K45 A;  3WEZ A;  5IYY A;  3ETP A;  2J1V A;  1XPW A;  5DQ0 A;  2PQS A;  2X09 A;  1UYX A;  1NUK A;  2W95 A;  2YB7 A;  3MUZ 1;  3DYP A;  4QDQ A;  4AAX A;  3DYO A;  2VMC A;  1YQ2 A;  3CZU A;  3OGR A;  3OG2 A;  2Y6K A;  2EID A;  3A22 A; 
#chains in the Genus database with same CATH topology
 3WF4 A;  3B5L B;  1L7Q A;  2HWD 1;  2JXA A;  4M4P A;  3LOI A;  1XQN A;  5D8A C;  3O1R A;  1JOP A;  3N9M A;  2HEV F;  3ZYG A;  4YGD A;  3WP5 A;  1QJX 3;  1X8M A;  3FHQ A;  1GMM A;  3WF3 A;  1NT0 A;  1AXY A;  1WLC A;  3RQ0 A;  3GZA A;  2R06 2;  4BXF A;  3WF1 A;  3ZSM A;  1K3I A;  4IER A;  3VDD C;  1JYT A;  2XWB B;  1XNT A;  4P9L A;  4L9B A;  4DOU A;  4FI9 A;  4ITC A;  4AGR A;  1ZRR A;  3LZZ A;  1OH3 A;  4IL7 A;  1OUX A;  2E7T A;  3SXW A;  3T0A A;  2ZGN A;  3LA7 A;  4RR3 C;  3KB5 A;  5JR2 A;  3AP6 A;  4KG0 A;  3WVJ A;  5I0R A;  2DCT A;  3TYJ A;  4YPJ A;  5A1F A;  4CDW C;  2E63 A;  1L7R A;  1MS9 A;  4A2U A;  1CON A;  1D4M 3;  1WMD A;  3P5B A;  4OUM A;  5CFC B;  3MF6 A;  5FYT A;  5B4N A;  1ND2 C;  3TN9 3;  3NWK A;  4M01 A;  1H9W A;  1JS9 A;  5FZC A;  2ARB A;  4KQ7 A;  5LBE A;  1NCQ C;  3IPV B;  4I3G A;  4XFA A;  4CDQ C;  2BV4 A;  2I2S A;  4PHZ A;  4QKB A;  2JDY A;  2XXZ A;  5JXJ A;  5FZG A;  2TNF A;  1A8M A;  4CVU A;  4FQ4 A;  1NQJ A;  3E6D A;  4JGZ C;  4AR2 A;  4N9I A;  1B35 A;  2PHR A;  2MNG A;  3WDX A;  2WO1 A;  5FYU A;  2R6Q A;  2YPJ A;  1W6M A;  1QJU 1;  2UY9 A;  1C8M 2;  1FPN 2;  3FWE A;  3R0R A;  2PHF A;  4YZ3 A;  2QQJ A;  4M3C E;  4OUS A;  4XTM A;  1C5I A;  2YC0 A;  2XOM A;  3B94 A;  4ASK A;  1VB4 A;  1DIW A;  2DTW A;  1W6Q A;  1QJE A;  2C0Z A;  2JIJ A;  1CQ9 A;  5B4X A;  1GZC A;  2RJK A;  4Q29 A;  1W8N A;  1POV 1;  3DV8 A;  5FZ9 A;  2XJT A;  1BBT 1;  1EV1 2;  1ZVF A;  1AYN 2;  1YI7 A;  3I8T A;  3O7O A;  4W4Z A;  4XIL A;  4ES8 A;  3BVC A;  2WIN B;  1SEF A;  4QT6 A;  2XML A;  4W65 A;  1JXN A;  1Q43 A;  4UFK A;  3RGB A;  3WY6 A;  4CUC A;  5CB7 A;  3HNY M;  1JH5 A;  1ZBE 2;  1XND A;  3FX3 A;  2VNR A;  2LS6 A;  3PTY A;  4XQW A;  4QD2 A;  5E16 A;  4CXX A;  1ZA7 A;  5L9V A;  1UZV A;  3FBM A;  3RRD A;  3OBT A;  3ACL A;  1RGS A;  1NA1 B;  4NRO A;  2XQR A;  3FHA A;  2CWM A;  4PDW C;  2K46 A;  4EZH A;  2JDK A;  5CVR A;  4YW1 A;  3AK0 A;  1BK1 A;  1UX6 A;  1YIP A;  2ZML A;  4QWN A;  2WL1 A;  4OQ9 A;  3T2Q A;  1D0H A;  3L2H A;  4XBQ A;  3NAP B;  1EUT A;  1O8S A;  4LHL A;  2WWU A;  2VCM A;  2VOV A;  2A3Y A;  3OGG A;  5T5J A;  4BQ4 A;  1U0A A;  2VZU A;  2ENR A;  3RZH A;  2P3K A;  4NPM A;  4GQ7 A;  2YDE A;  3WIN E;  3FJS A;  4Z1V A;  3WX5 A;  4UXA A;  1IOA A;  1X50 A;  5C7G A;  2NMN A;  3NKG A;  4CZS A;  1BMV 2;  2WAB A;  2VME A;  3S30 A;  3VKM A;  3B9I A;  1VBB 1;  4ORF A;  1PX4 A;  4N43 B;  4BQY A;  1HB4 A;  4DMI A;  3GJA A;  1RUI 2;  1HN0 A;  3S7I A;  1ZRF A;  1MEC 2;  1R08 2;  2EF6 A;  1DQ0 A;  3OBR A;  4YNI A;  5DZF A;  2YBP A;  1PIV 1;  4BOW A;  4EN7 B;  4MXW B;  4P02 B;  3UYJ A;  2WNU C;  3VLB B;  3THT A;  4S2G A;  4Y22 A;  2A6V A;  5JOW A;  4RS5 B;  1QQP 2;  5AFE A;  1AXZ A;  1RUJ 1;  2DVF A;  1XU2 A;  2Z79 A;  2WQZ C;  5A32 A;  2OZ6 A;  3RWN A;  3I3Q A;  1U12 A;  3OJB A;  1UZW A;  2E33 A;  2DVD A;  3MW4 A;  4IV3 A;  3HT1 A;  4XCA A;  5F3E A;  3ZSK A;  3GHM A;  3NJX A;  5DZG A;  3NNJ A;  3ILR A;  4BK5 A;  3POF A;  1ASJ 2;  4MGY E;  4BXS V;  1OFS A;  2B8M A;  2WFF 1;  5TSW A;  1CVN A;  4LBK A;  1RB8 G;  4GMP 3;  5B2G B;  4A45 A;  5BUV A;  3ZPY A;  4B7E A;  4NAM A;  5HXM A;  4XET A;  5ISL A;  1TE1 B;  2LRO A;  3ME2 A;  4AQ2 A;  4QX0 A;  5JSR A;  4YVW B;  2Y0O A;  4CCE A;  1OLQ A;  3UL2 A;  5F6K A;  1KS5 A;  1GUI A;  1REF A;  3MYX A;  1SHW B;  2HWF 3;  4QXH A;  2WN3 A;  4EZ4 A;  1WW4 A;  4JV4 A;  1GNY A;  4EN8 B;  4EN6 B;  3O1M A;  3WHT A;  5A7N A;  1YFU A;  5K9Y A;  3NNG A;  4YVS B;  2JIC A;  2R07 3;  5L7O A;  1GNH A;  1NOV A;  1PMJ X;  3CEW A;  1MQT B;  1W9S A;  3HD8 B;  3TEY A;  2PTM A;  2QQP A;  2D3R A;  2V73 A;  4WVM A;  3UKN A;  1BEV 3;  2VTF A;  1WLT A;  3POE A;  1US2 A;  4TTG A;  2EIG A;  2W52 A;  3NJY A;  5A7W A;  2DBI A;  3HBK A;  3LKJ A;  4JDN A;  2VVD A;  1NCR B;  4FOW A;  5C8C A;  4KMQ A;  1ZBA 1;  3POY A;  4JGY C;  5K0U A;  2ZAA A;  4YW4 A;  3DL3 A;  1O4Z A;  1OPM A;  1S0I A;  2BOJ A;  1NZC A;  2J1E A;  2WN2 A;  1ZYB A;  4Y1V A;  5E88 A;  3PU8 A;  5A1A A;  1PO1 3;  4HG6 B;  3VD5 A;  4R4Z A;  1B35 B;  1PO2 2;  2GP3 A;  2HJI A;  3O1U A;  2VZV A;  2Z5W A;  3C7O A;  2PMW B;  3LSE A;  2RR1 3;  5JOX A;  1UKG A;  3FZ3 A;  3UK9 A;  4AQS A;  5JMC A;  5T5O A;  5EV7 A;  4JRA A;  3NJZ A;  5A33 A;  2JDH A;  2RHP A;  2JJ6 A;  1DYP A;  4CE8 A;  4CPB D;  5LW9 A;  5FMO L;  3VBS A;  2ZX2 A;  4ZY9 A;  1W6Q B;  3PU3 A;  4QQ2 A;  5FPU A;  4BQW A;  2P17 A;  3M70 A;  3K46 A;  2HWC 2;  3J7H A;  5C5T A;  5GZD A;  5KHJ A;  1XJA A;  5DDJ 2;  4C90 A;  1JZ5 A;  1QH7 A;  1GFF 2;  3JBG 1;  4XEZ A;  5JZG C;  3NNF A;  4LA3 A;  1RL3 A;  3PMS A;  3GHN A;  4R9A A;  2Y6J A;  3FFZ A;  1AR6 3;  1FMD 1;  1PMH X;  1SBE A;  2JDN A;  2WS9 1;  3AMH A;  4JTN A;  3WQ7 A;  4QAW A;  3C7E A;  4BZ4 A;  4GMP 0;  2HWD 2;  2EAA A;  2HWB 1;  1HX6 A;  1VRB A;  5EZW A;  4F83 A;  1S0F A;  2XL7 A;  2A70 A;  5KXB A;  1HKD A;  2ARA A;  1XYO A;  3MW2 A;  1SFY A;  1R1A 1;  1RUH 3;  3WG3 A;  1H9P A;  2QZ2 A;  3AZX A;  1ZRE A;  2WZR 1;  3O0V A;  1H30 A;  4ZHN A;  5JOZ A;  5FZE A;  4YW7 A;  1KXG A;  5FPB A;  2YGL A;  5IK4 A;  1N1T A;  4Y4Y A;  1V0A A;  1J3R A;  2UWB A;  4AXO A;  1OHF A;  3A7Q A;  3ASI A;  5T50 A;  3HBZ A;  1LES A;  1OI6 A;  1CX4 A;  2ZX0 A;  4TLG A;  3KVA A;  1F4H A;  2IUW A;  4FCA A;  4Q0V A;  4CEW B;  3KM5 A;  1QIQ A;  3WG4 A;  2XLG A;  1UNB A;  3HNB M;  1S1A A;  4FPO B;  3ZR5 A;  1UY4 A;  3A0K A;  5KC6 A;  3H3Z A;  4E4H A;  4XFC A;  1YQC A;  4F8A A;  2E9Q A;  2AEY A;  3K3O A;  3D3A A;  1SDD B;  4A41 A;  5L19 A;  4W50 A;  1QOT A;  3AMN A;  2NZ9 A;  3AZZ A;  1UOJ A;  4Q4X 2;  5F5A A;  5FCC A;  4AVS A;  4MET A;  1CAU A;  2PA7 A;  3MBW A;  4XTP A;  3S6P A;  1W99 A;  3KMH A;  3T0B A;  4XYX A;  3THC A;  5J48 A;  1VP6 A;  2OX0 A;  3JD7 1;  4R9B A;  4MYE A;  2XJV A;  4COY A;  1GV9 A;  3OTF A;  2ZBJ A;  3OYW B;  2K9Z A;  1WCU A;  1REE A;  3PUR A;  4AZZ A;  2GU9 A;  3ZM8 A;  3HT2 A;  4KWL A;  1QJU 2;  2HBT A;  3MZH A;  5A32 B;  2P6H A;  3POS A;  2JDM A;  4QHO A;  4YWA A;  4SBV A;  1GNZ A;  4KWJ A;  4NRP A;  4IV3 B;  2I74 A;  2VR4 A;  3IIA A;  3T4H B;  1FOD 3;  3MUY 1;  2BFU L;  2OUH A;  1ENQ A;  2Y64 A;  1N47 A;  3D0J A;  1RUC 1;  4NWW A;  3CF6 E;  5EYY A;  5FZ0 A;  3D4K A;  1H6Y A;  1Y9Q A;  4FOQ A;  1JZ3 A;  4CXY A;  5ABJ B;  3KGZ A;  3EO6 A;  2PHX A;  2VZ1 A;  2XJP A;  3FE5 A;  4LBN A;  4RQP C;  4XFF A;  2R49 A;  3N9N A;  2DU1 A;  3KHC A;  4FSJ A;  1UY0 A;  1AYM 2;  3FHI B;  4ZS2 A;  4A7Z A;  1UOG A;  2CY6 A;  1SLT A;  1W0N A;  3VB9 A;  1HRV 1;  4YW2 A;  3UV9 A;  3ZOI A;  5ACA 1;  3RPQ A;  1SMV A;  3MW3 A;  3E1F 1;  1NY7 1;  1ZNP A;  2IVI B;  2WSU A;  4AI3 A;  5EPA A;  1RED A;  4Y33 A;  5L7O B;  4GAZ A;  1A8D A;  4M3C A;  2MEV 3;  3I3M A;  3IDE A;  4YZ4 A;  3O14 A;  3WR0 A;  1K5M A;  2YYO A;  1W9W A;  2WUH A;  4P9G A;  1VRH 3;  2DVA A;  3I59 A;  2HWE 1;  5A7O A;  1YUD A;  3ZFE B;  1O6U A;  5IFT A;  1HXS 1;  4DRV A;  3NV2 A;  5J36 A;  2RS5 3;  3VBF A;  4FTB A;  1QY4 A;  2Q8E A;  1MVE A;  1FI2 A;  2FZ2 A;  4IEZ A;  1VBA 2;  1JU4 A;  3H42 B;  3N9P A;  1KJR A;  1ZRC A;  1S0D A;  1Y3T A;  2PN5 A;  1W2T A;  4H3W A;  5A7W B;  4WM8 B;  4J25 A;  5JIA A;  2VEC A;  1LGN A;  2KXL A;  2OII A;  3LFM A;  4LHK A;  5C8C B;  2JD9 A;  4LOT A;  3VBU A;  3BU7 A;  1CAV A;  3H1M A;  5JAX A;  5K0U B;  1W3X A;  4AK3 A;  1OPO A;  3VDA A;  3VD9 A;  5M0T A;  3H50 A;  1GZW A;  2BNN A;  4M0N A;  4P08 A;  5FXX A;  5C9A C;  1GKB A;  2VUA A;  3NV4 A;  2WQ4 A;  1W9Y A;  3EQE A;  5CNA A;  3AMQ A;  1VBB 2;  4BHP A;  4XF3 A;  1D2Q A;  1N3O A;  1SBF A;  5IVF A;  2ADD A;  4CSW A;  2WKK A;  3KHB A;  1O5U A;  2QDN A;  1XNB A;  3B00 A;  4GUL A;  3AJY A;  3TRS B;  3I2O A;  2IXC A;  2B46 X;  2VQ0 A;  1E57 A;  3UT0 A;  4Q4V 1;  2QDR A;  1XC6 A;  1MS4 A;  5AVA A;  4XAC A;  5FV3 A;  4CXW A;  1C3H A;  3VBS B;  1UOF A;  1UAI A;  1VBE 1;  2JEM A;  5IFP A;  5F5C A;  4UAP A;  3RZK A;  3VL9 A;  3KD4 A;  4XF0 A;  4BLI A;  4J6G A;  1VMJ A;  2ZZJ A;  1RUJ 2;  4A3X A;  5KR7 A;  4UWD A;  2W08 A;  2W2I A;  3ZFG A;  3OPW A;  4FO9 A;  1QXR A;  2P3Y A;  5C33 A;  3WNX A;  5JUV A;  1LHW A;  1WCQ A;  4X6Q B;  3K4A A;  4FXK B;  4AF9 A;  1IGO A;  1Q3E A;  2RV9 A;  2WLQ A;  5JDB A;  1CIY A;  1CPN A;  3K75 B;  5LB6 A;  2A6Y A;  1VBD 2;  2PHD A;  4IV1 B;  1RXG A;  2Q1M A;  2YG0 A;  2IXI A;  1LHU A;  1QJZ A;  4B3N A;  4I0A A;  2WFF 2;  1AR7 1;  1UMI A;  3MGU A;  3NL1 A;  2IXK A;  3POI A;  4RHV 1;  3WUD A;  1BJQ A;  2ZEY A;  1LJ7 A;  2Z2S B;  5JCT A;  3IB3 A;  3PVO A;  1UZ0 A;  3Q8B A;  4KI5 M;  3A21 A;  5HXV A;  3WQB A;  3NMB A;  4N7U A;  2RMU 1;  2G19 A;  2CL2 A;  2J1R A;  5T5L A;  2O0O A;  3AMM A;  4GAL A;  3U07 A;  4A44 A;  5BNN C;  1OOP C;  1ND3 C;  1JYV A;  2BDR A;  4YGB A;  3B7M A;  4QPG C;  1LKN A;  1N1Y A;  4OUE A;  3GZU C;  5FYY A;  2Q1F A;  4DY5 A;  1VLN A;  1KEX A;  3USS A;  5I93 A;  1W8T A;  5IWF A;  3CU7 A;  2YMZ A;  4CCD A;  2OPK A;  1RUF 1;  3GYD A;  4CP1 A;  1X8E A;  2OKX A;  2W68 A;  4AED C;  4OHX A;  1CAU B;  2NP0 A;  2JE8 A;  3CJI A;  1ZRI A;  2ZA9 A;  2D93 A;  3I54 A;  1EAH 3;  5BNO B;  5JWP A;  1I5P A;  4LLO A;  5FMC A;  1CZS A;  5A7S A;  2XB6 C;  3B9C A;  1ONA A;  4AVA A;  5IVJ A;  3R4U A;  1XNK A;  4C8D A;  2GND A;  2DFB A;  1D4V B;  1AZD A;  5KHH A;  2JG8 A;  3TEZ A;  3RZG A;  3CIH A;  4AEK A;  3H9A A;  4Q4W 3;  4NID A;  4AAP A;  1GP5 A;  5FZ1 A;  2GC1 A;  4CDU B;  4WVV A;  1NE6 A;  1NXM A;  2RVA A;  2VJX A;  4IEW A;  4L0P A;  4MUV A;  2GAU A;  2VZ3 A;  3I2J A;  2GSY A;  2PAE A;  4RN5 A;  1FNZ A;  1GQG A;  1ULC A;  1ZX5 A;  4Y20 A;  5FY1 A;  1TQ5 A;  5IK7 A;  1IPK A;  2PAK A;  3WXP A;  2EAL A;  5A3M A;  4LHN A;  1K45 A;  2ZTN A;  3ATG A;  5IYY A;  4PLM A;  2A3W A;  3DKW A;  3ZFF A;  2WS9 2;  2BQP A;  1HRI 1;  1W2A X;  3S5Q A;  1TMF 1;  2Q5T A;  2VD7 A;  1PGS A;  1NUK A;  1R1Z A;  4Y26 A;  3KZ4 C;  2HWB 2;  1V6L A;  4QU2 A;  4QDQ A;  4XAE A;  3RWK X;  2A73 B;  2EAK A;  2VMC A;  3DYO A;  3I59 B;  4NHX A;  1JOB A;  1HV1 A;  2DVG A;  3OGR A;  4UFJ A;  3WOG A;  1ZZB A;  3VBF B;  4BB3 A;  2IZW A;  3A22 A;  3TOJ A;  3VBH A;  4YLZ A;  2E26 A;  4BMB A;  1NG0 A;  3HAG A;  5IAX A;  2Y38 A;  3X29 B;  1KQR A;  1OLR A;  4HBN A;  4Y5Z 0;  4LBL A;  1IKP A;  2UYB A;  1AL2 1;  3LGR A;  3URF A;  4LBQ D;  1VAL A;  4PLN A;  1CAV B;  3VBU B;  3RZM A;  2JKX A;  3HR9 A;  5F8P A;  4LXL A;  3D8C A;  2HYK A;  3VN4 A;  1AR9 3;  1OT5 A;  4QPI C;  1GZW B;  1KD7 A;  4PBP A;  3HEI A;  3J7N A;  4ES9 A;  2WDB A;  2ZX1 A;  3BN6 A;  2A6W A;  2R32 A;  2W1S A;  4OMC A;  1PZ9 A;  4DIQ A;  3ZXJ A;  5FYZ A;  1UYZ A;  1AR8 1;  4COU A;  3SCG A;  1P8J A;  4B4P A;  5FYB A;  1ENS A;  2D5F A;  3ACG A;  4NIA A;  3WCR A;  1MPX A;  1DGW A;  1AX2 A;  4FFH A;  1OA2 A;  3N36 A;  5CFC A;  5JIU A;  2R04 1;  4I02 A;  5FLH A;  5FMD A;  3RYR A;  1GIC A;  4E4D X;  3ITQ A;  1PVX A;  5DXD A;  1SLB A;  2WZE A;  3PVB B;  1VPH A;  3IDC B;  2W94 A;  4K8R B;  2VOT A;  1PGW 1;  2B45 X;  4W6Y A;  4B1M A;  3MIH A;  2Y60 A;  3J8F 3;  5FQ0 B;  1S0J A;  2JG9 C;  1ZBE 3;  3TB0 A;  4A3Z A;  1IS3 A;  1LOB A;  1D2S A;  3U0Z A;  1UYY A;  5F39 A;  2GN7 A;  1O8P A;  4BQ3 A;  3UNP A;  5FYC A;  3BTA A;  3DPR C;  4TXW A;  1RUC 2;  4MGS A;  2Y34 A;  3BOD A;  4MGI E;  2FZ1 A;  5FZI A;  5FXZ A;  4NAO A;  1UMH A;  2WT2 A;  2QQW A;  3MIF A;  3ZXD A;  1Z0H A;  2X5I C;  3OUI A;  2DYC A;  1TG7 A;  3AFK A;  1HRV 2;  2GNB A;  5I91 A;  3O1S A;  2ZGS A;  4P9I A;  2RG4 A;  2D98 A;  3J4U H;  1AJK A;  1AUY A;  4GH4 C;  1CZV A;  5J96 B;  1V6O A;  5FZF A;  1YQ6 A;  3KQR A;  1UPI A;  4CU6 A;  2BTV C;  4G4F A;  3ZVX A;  4XQ4 A;  1O3Q A;  2VGD A;  4LKF A;  3MIG A;  2V72 A;  4S2D A;  1HXS 2;  1SZB A;  5LA0 A;  3WW2 A;  3R05 A;  4G9S B;  4CEY C;  2JKB A;  4EYU A;  4GJY A;  2K0G A;  4QU1 A;  2XHN A;  3BOW A;  4KGG A;  3UGH A;  1W6P B;  2RS1 2;  4RFT 0;  2OW4 A;  1WA6 X;  1RUI 3;  3N9O A;  4IQP A;  3FN9 A;  2VMH A;  1J83 A;  3IMM A;  3L2Y A;  2WQ8 A;  5EJ1 B;  1RUO A;  3CJI B;  3JCI A;  4IES A;  1H8T C;  1V9U 2;  4QX8 A;  2BNO A;  5J98 B;  3BTX A;  1MS8 A;  1PK6 C;  5C3P A;  4XJZ A;  4OLL A;  1W28 A;  2FCV A;  4CUB A;  1UY2 A;  2HBU A;  1IKQ A;  1BYH A;  2ORX A;  2VZQ A;  2WFP A;  3KV4 A;  3NAP A;  4TN7 A;  4BJ0 A;  2JE9 A;  2ATF A;  3VHR A;  3AM2 A;  5DAX A;  3WP6 A;  4D8M A;  3KLS A;  1CN1 A;  1DZT A;  5KC5 A;  1L7L A;  1Z7S 2;  5C4W C;  4LBJ A;  5CKN A;  3OBA A;  4CU8 A;  1G86 A;  1WD3 A;  3HIF A;  3PHM A;  4Q4V 2;  4V2W A;  1V70 A;  1UU4 A;  4CDX C;  4ZZ8 A;  3C7G A;  2CSG A;  4DQA A;  3ES4 A;  2XBO 3;  5ANN A;  3GDB A;  3LQC A;  4O65 A;  4Y20 B;  1ASJ 3;  2C26 A;  3WF0 A;  3JQW A;  4N43 A;  5D8A B;  5SV8 A;  1IPS A;  4Y4R A;  2QJV A;  1BVV A;  3RVH A;  2PXJ A;  2C9A A;  5BYN A;  3H8R A;  1COV 3;  2HEW F;  5A1L A;  1W8F A;  1JZ4 A;  3VZN A;  5HCF A;  4NIH A;  1LU1 A;  1JZ6 A;  4P00 B;  5L9R A;  4MXW A;  2ZHK A;  1QJX 1;  4YG3 A;  3LEM A;  1CPM A;  3BGA A;  3LIH A;  3VDD B;  4D6R A;  1X33 A;  4E9K A;  1ZZ9 A;  3ZXL A;  2B9U A;  3N7M A;  3GM8 A;  1QEX A;  3RDI A;  4N53 A;  2B39 A;  5G04 L;  4OHZ A;  1AR7 2;  3ROU A;  3GF6 A;  4RHV 2;  4LUL A;  3VBH B;  1Q8V A;  5FY9 A;  4O9G A;  3U10 A;  4CCO A;  1HB2 A;  1LTE A;  3W5M A;  5HI0 A;  4QXC A;  3A4U A;  4MSV A;  4ZU4 A;  2YFU A;  5FRA A;  2VUC A;  4FP2 A;  3T1M A;  1WBF A;  4ZON A;  4AI1 A;  5LK5 A;  1D4M 1;  4QKD A;  4XPV A;  4KG8 A;  5IVY A;  1GP4 A;  2XJQ A;  3VKN A;  4Y3O A;  4CCM A;  3TN9 1;  2Y6G A;  3III A;  4JHT A;  4LEJ A;  2W3J A;  4YVW A;  4GB3 2;  2WAO A;  2FDK A;  1D7P M;  2QQN A;  3M3O A;  5GZC A;  1PVC 2;  2AC1 A;  2PHL A;  3HQX A;  3MFA A;  2IFR A;  1J1T A;  1MZE A;  1SAC A;  4YVS A;  3ZXK A;  1UU5 A;  4JGZ B;  4D3W A;  1W9F A;  5FPL A;  1H2K A;  3WG1 A;  5F6L B;  3N3H A;  1MQT A;  2GH2 A;  3PUH A;  1YJL A;  3K4Z A;  4UFL A;  3H3L A;  3SLI A;  1GYK A;  1LU2 A;  3BYW A;  3ZN6 A;  1YEW A;  2VPV A;  1IQD C;  5GZE A;  5AC9 2;  4YZ5 A;  4YZ2 A;  2G9F A;  2VAU A;  3BCW A;  4YYO A;  5DDJ 3;  4R9C A;  5EHD A;  2IXJ A;  1X36 A;  1TEI A;  2XWJ B;  4JC1 A;  2J1S A;  1NCR A;  1US3 A;  2XH6 A;  1WUV A;  4NVP A;  4PI0 A;  3KWV A;  4E2S A;  4JX0 A;  3T30 A;  2H6C A;  1UZY A;  4H7M A;  3O1O A;  1PM7 A;  2Q8O A;  2SLI A;  2YU1 A;  1YO8 A;  1RIN A;  1QH6 A;  1UL9 A;  5F32 A;  4IE4 A;  3ZKY A;  1JYI A;  4FPC A;  4NR1 A;  5CFD C;  3RYP A;  2PYT A;  1LEC A;  1GQP A;  4OQ8 A;  1Y9M A;  3Q9O A;  5JR7 B;  3ZYF A;  1DZQ A;  2ZMK A;  2QNK A;  5I0D A;  1FYU A;  1QWR A;  4NHK A;  2BGC A;  1QNY A;  1OD3 A;  1HRI 2;  3T1L A;  5GLV A;  1TMF 2;  2A75 A;  1RMU 2;  2Q1Z B;  2GC3 A;  3VD3 A;  4XUO A;  5BNQ A;  3NKT A;  5GM0 A;  3MI8 A;  1C4R A;  4UFM A;  1GBG A;  1ZZ6 A;  1MR5 A;  3VUO A;  4AHY A;  2ZAC A;  1M4W A;  5FY4 A;  3AVR A;  3DN7 A;  1OFN A;  5HCB A;  4FFF A;  1OLM E;  2ZCW A;  2JD4 A;  5H9S A;  2VOW A;  2W39 A;  4V1P A;  1LOF C;  1IPJ A;  1GZ9 A;  3HOB A;  1XNA A;  4Q4X 3;  3B02 A;  4HET A;  2CYF A;  1CAX B;  5F9T A;  2W92 A;  5DMY A;  2D6P A;  1LAJ A;  4CA9 A;  4XFB A;  4HK9 A;  1JTZ X;  3I2G A;  3IAQ A;  3RJR A;  2LTN A;  2VL4 A;  2WNU B;  3CMG A;  4LO7 A;  4FAH A;  2Y6H A;  3FBY A;  4NII A;  1SDW A;  1Y43 B;  3ZXE A;  3RFR A;  1U5X A;  5FPZ A;  3ZR6 A;  1VB2 A;  2AR6 A;  3KV9 A;  2AGS A;  4E27 A;  1EUU A;  1YFY A;  1UD1 A;  4YM1 A;  1XE7 A;  2HH9 A;  4LUK A;  2JB4 A;  1ULF A;  3H1W A;  4CEW A;  5CA6 A;  2ZHM A;  2Y0I A;  4A42 A;  4I30 A;  5A3T A;  1BZW A;  4CU9 A;  4FPF A;  2RE9 A;  3AJZ A;  2B7Y A;  3ETQ A;  3LA2 A;  3LIG A;  1VBC 2;  3SH3 A;  3SKV A;  2R04 2;  1ZRD A;  3SKJ E;  1CJD A;  1ODN A;  2RM2 3;  4Q4Y 3;  2RJL A;  1BKZ A;  1XSR A;  1YJK A;  1OKO A;  3VBO C;  1AYM 3;  1QXP A;  4XFH A;  2PAM A;  1PGW 2;  5FBJ A;  4B1L A;  2WA4 A;  2ZS6 B;  1WW6 A;  1ULP A;  1FX5 A;  1QOS A;  1WCD J;  1DYO A;  3JUU A;  2XR4 A;  4GMP 1;  4IND A;  2ZGK A;  3OYW A;  3WV6 A;  1W9T A;  3WNL A;  1JZ8 A;  5T54 A;  3MIE A;  2WO7 A;  4QQP A;  4N53 B;  3AL5 A;  2Y8K A;  1RUG 3;  3G7D A;  2HWF 1;  3IAP A;  1X82 A;  5JMO A;  3OGJ A;  1NA1 C;  5LAT A;  1W8O A;  2C1F A;  1QXJ A;  4Q0P A;  2D6N A;  1GQH A;  2JIG A;  3VL8 A;  1IS5 A;  1VBA 3;  2OZJ A;  2R07 1;  3I2H A;  5FR3 A;  3Q8E A;  4ERO A;  2DBN A;  4I2O A;  2UWC A;  3K3N A;  2W91 A;  3NAP C;  1F4A A;  1W2N A;  3DGT A;  3IKW A;  1TZO A;  2WNV A;  4AG4 A;  1RUD 3;  4DFS A;  4XDP A;  5LBC A;  4QB2 A;  3SMH A;  1BEV 1;  1E5H A;  1X7N A;  1T2X A;  3DYM A;  4OYU A;  4C0B A;  5ABJ A;  2RS3 3;  3ZLI A;  1R09 3;  4GWI A;  4NOT A;  4E2Q A;  4ARX A;  5T3N A;  5IVC A;  4YZ1 A;  1BQP A;  1QJY 3;  2VOK A;  4NHM A;  4XBN A;  4XMI A;  2FMD A;  3ZX7 A;  4NPL A;  5FPA A;  2WAA A;  3OPT A;  2GNM A;  3PJQ A;  3IWZ A;  1FAT A;  4YM2 A;  3R4D B;  4RGG A;  4FPY A;  4UI9 L;  4URT A;  2BGO A;  4YW3 A;  3ZFE A;  1PO1 1;  4K1Y A;  3EJK A;  2MPF A;  3GCX A;  4WV8 A;  3USU B;  3ZN6 B;  4LTA A;  2VBB A;  3AP9 A;  3EYP A;  2RR1 1;  1HQN A;  1GSL A;  1HV0 A;  3AKR A;  4H7L A;  2G9G A;  4RYD A;  2CNA A;  2QZ3 A;  3EBR A;  4WM7 C;  4WM8 A;  5A3N A;  3D0S A;  1AF9 A;  2KR2 A;  3KT1 A;  3QAC A;  1WA4 A;  3AYE A;  4RS5 C;  2RDQ A;  2DV9 A;  4W8J A;  5JZG B;  2SBA A;  2V4A A;  1DCS A;  3WDW A;  3RS6 A;  3JB8 A;  3BB6 A;  5FJH A;  2BW8 A;  1VBD 3;  2VUL A;  3JXS A;  2IVJ A;  1GLH A;  5EJ3 A;  1AR6 1;  3ST7 A;  2V4V A;  1J1L A;  4FTS A;  1XU1 A;  4JCK A;  4V2V A;  4MO3 M;  4O9E A;  1RC6 A;  2YC2 A;  4XIK A;  4A6S A;  3BTY A;  1H2M A;  1OXC A;  5FMO S;  1RHI 2;  4FOV A;  5IAV A;  1RUE 3;  5KXE A;  3M8L A;  1C5H A;  1QJX 2;  3I3D A;  1RUH 1;  1X9P A;  2YC4 A;  1GR3 A;  5HPO A;  1UYP A;  2PQQ A;  3INA A;  1JZ7 A;  3ENR A;  4F3J A;  3B69 A;  1SLA A;  3ELN A;  3PNA A;  3ALQ A;  4JHZ A;  2F6B A;  1XE8 A;  3BTZ A;  1GU3 A;  3E5Q A;  4ZPI A;  2X53 S;  2GAL A;  4H14 A;  4AI0 A;  1QF3 A;  1FNY A;  1F5F A;  4IGO A;  1H6X A;  1XE0 A;  4ZZ5 A;  2KA3 A;  1DQ2 A;  3D6E A;  3PJY A;  5FDB A;  1N3Q A;  2F17 A;  3CHX A;  3H8U A;  3ORJ A;  1WMF A;  4IV1 A;  5FOJ B;  1K42 A;  1YHF A;  4PCR A;  3ZO0 B;  1SQ4 A;  1S0C A;  4TSV A;  3VKO A;  4C1W A;  3VBR A;  2XVG A;  3V64 A;  3ZDV A;  3AL6 A;  4AWD A;  5H9P A;  4HMZ A;  1PNG A;  2D3P A;  5DAP A;  3TN9 2;  4AQ6 A;  4B8E A;  3LFI A;  2XL9 A;  4QGN A;  1DGL A;  3WSO A;  4CP9 A;  1Q8S A;  5IT6 A;  1YQ8 A;  1WD4 A;  4LIT A;  3MHZ A;  2V5Y A;  1UY3 A;  1B35 C;  4WZF A;  3DUI A;  1SCS A;  3W5N A;  1JBC A;  1GZT A;  1CGP A;  1HQL A;  4QM8 A;  1JI6 A;  1FV2 A;  3CZJ A;  5KXD A;  4QX3 A;  4COZ A;  1W6O B;  2EIE A;  3P3P A;  5JI7 A;  2CGN A;  2EA7 A;  3WW1 A;  3BAL A;  4AYU A;  4QQO A;  4DXS A;  4NIG A;  3ILN A;  2LW8 A;  4KU7 A;  2VUD A;  4LNV A;  4QQH A;  2P6C A;  3WCS A;  1QDO A;  2C24 A;  4I01 A;  4K40 A;  4R4X A;  4XF4 A;  3THP A;  4LMF A;  2IFW A;  1FOD 1;  3N9Q A;  3R6S A;  2ET1 A;  5FO9 B;  5IAT A;  2YRO A;  3M4F A;  3NV1 A;  4BWO A;  2Z4F A;  3CL1 A;  1QOO A;  3ZXG A;  1H4G A;  5FBZ A;  3LDB A;  2B4K A;  5FZ8 A;  2ZGU A;  2OYZ A;  5BNO A;  5BPX A;  2PLV 3;  1F8V A;  3OPZ A;  4Z8B A;  1JYW A;  1JHN A;  4A6O A;  5T52 A;  2XON A;  5DAB A;  1HJG A;  1RXF A;  3O5S A;  3ON7 A;  4KBZ A;  2ERF A;  4QXB A;  4X8P A;  5LA9 A;  1OH4 A;  2X8K A;  2CGP A;  2Q30 A;  2WWS A;  3JB4 C;  2MEV 1;  2VXJ A;  2BFU S;  4J1X A;  3SCH A;  4CDU A;  5FUI A;  1VRH 1;  2IXL A;  2DCK A;  4IEU A;  4DO0 A;  3SIS A;  5CYY A;  2RS5 1;  1ZZC A;  2D6K A;  2WNV B;  1BBT 2;  5FAX A;  4LK7 A;  3WEZ A;  3APB A;  1SLI A;  3ZSJ A;  2RDS A;  5CKQ A;  3TEX A;  5DQ0 A;  3AXD A;  1OD5 A;  2PQS A;  1UYX A;  1LHO A;  3MUZ 1;  5C9A B;  4Z82 A;  5I0S A;  4XMA A;  3WLU A;  4P5H A;  1YQ2 A;  4QHZ A;  5LY2 A;  3OG2 A;  4H2A A;  5ANQ A;  2EID A;  2D44 A;  2A6Z A;  4CTE A;  2NN8 A;  3G6J B;  4MGK E;  1A3K A;  5FTT C;  1JMU B;  1AX0 A;  4BME A;  5DAW A;  4UW5 A;  4HXC A;  5FJK A;  5FLI A;  1DZR A;  4ZXK A;  3RJ2 X;  5I8Y A;  4JDM A;  2WJS A;  1H8V A;  1UMZ A;  1O4Y A;  5SV5 A;  1FV3 A;  4FOY A;  3BPZ A;  5FZB A;  3OSD A;  5LRR A;  2P5B A;  1F31 A;  5A70 A;  1W90 A;  4GWM A;  3U37 A;  4FTE A;  3OCP A;  2R7E B;  1OLM A;  1POQ A;  1W3V A;  1RVF 3;  5ERL A;  4IV3 C;  1HW5 A;  1B09 A;  1WKY A;  5JPM B;  4OHY A;  5C5U A;  1HB3 A;  2H0B A;  4R8H A;  4UFH A;  1UXX X;  2OA2 A;  4P14 A;  5CAD A;  3MO4 A;  2QCS B;  1SFN A;  2YHJ A;  1J3Q A;  4IET A;  1W39 A;  4XUP A;  4IGQ A;  1ACC A;  1PIV 2;  1S2K A;  4K7J A;  4LBQ B;  4RSU A;  2JDZ A;  1N1V A;  1DQ5 A;  5C6C A;  1UWW A;  4OI0 A;  4YM0 A;  5FZ4 A;  3POG A;  4FXG B;  4XUR A;  3C3V A;  1LOG A;  4Y5S A;  5BNN B;  4XUT A;  1OOP B;  1ND3 B;  2HWF 2;  3ZDS A;  3ECQ A;  3KS7 A;  5L7O C;  5FYV A;  4OMD A;  3V0A A;  1XXN A;  2YUE A;  5FQ0 A;  4E2G A;  4JQR A;  3MIC A;  2D6O X;  1Q56 A;  2QVS B;  2R07 2;  4P9J A;  5T55 A;  1MZ5 A;  3J26 N;  4GWJ A;  5KWR A;  2RS1 3;  1XBF A;  2VC9 A;  5GJ6 A;  1U5Y A;  3IT8 A;  3IDB B;  1U5Z A;  1XOY A;  1LOD A;  4B4R A;  4D69 A;  2O14 A;  1MVQ A;  4XE9 A;  3WNK A;  2QE3 A;  3UKV A;  1BEV 2;  3VBR B;  3H7J A;  5LWB A;  5C8C C;  4AVV A;  4DNY A;  1YXW A;  1V9U 3;  4MGQ A;  1G9A A;  1E5S A;  4FQZ A;  4AED B;  2W47 A;  5K0U C;  3PUA A;  1TME 3;  2QBX A;  2A7A A;  4CP9 B;  4BIO A;  3HNM A;  5C8W A;  4Z2W A;  1BCX A;  5FYM A;  1OQ1 A;  2WZ8 A;  3QH7 A;  5FPX A;  3P6B A;  3ACF A;  3NQH A;  4UW3 A;  4WVW A;  1Z78 A;  3PDQ A;  2D40 A;  3ZYR A;  3AZY A;  4L11 A;  1EAH 1;  2VE1 A;  3WW4 A;  1Z7S 3;  1LGB A;  4Q0Q A;  2DDU A;  5A7Q A;  3T2P A;  1CWP A;  5CIR A;  5HCA A;  2A3X A;  2DUO A;  3W9A A;  3AKQ A;  4HSJ A;  3NST A;  5E8A A;  2RR1 2;  1WCS A;  2VQT A;  4UT5 A;  3WZ1 A;  2P2K A;  1TVG A;  2Q8C A;  2JE7 A;  1DLL A;  3C2U A;  4KGQ A;  4Q4W 1;  3VBS C;  2XVK A;  3WT3 A;  1TNR A;  1W6P A;  1H1M A;  3VDC A;  4LO4 B;  4AVT A;  5FZL A;  3ZYH A;  2D97 A;  2GC0 A;  3GNE A;  1ZBA 2;  2FBE A;  2OQ6 A;  2PFW A;  4LOR A;  5A6X A;  4UYB A;  1AL0 G;  5E89 A;  5C3S A;  3I2D A;  3K48 A;  3KCX A;  1JYC A;  1HJF A;  3KGL A;  4JKM A;  4NWV A;  5C71 A;  3I3B A;  3LPF A;  2BUK A;  4BIS A;  4BLJ A;  3OY8 B;  3ZMN A;  4LE3 A;  1AR6 2;  5JSO A;  2EXI A;  1C1F A;  4KH9 A;  4CU7 A;  2ZAB A;  3TEW A;  2CV6 A;  2YU2 A;  2WR9 A;  4XOG A;  3QOP A;  2XQX A;  3T3Y A;  5IHR A;  5FZK A;  1NKG A;  1GAN A;  2UUR A;  1PNF A;  5DUU A;  2OVU A;  5F2S A;  2ZXQ A;  5BNP A;  4S2H A;  2GN3 A;  1IG0 A;  5FY8 A;  4AFD A;  3N35 A;  3MPP G;  1GWL A;  4QGL A;  2XJS A;  2OS2 A;  4OI2 A;  5D8A A;  2LUW A;  4DXT A;  3JBG 2;  3MLJ A;  1LB2 A;  3GBG A;  2R06 3;  2TBV A;  3C7F A;  3E5X A;  3HQU A;  1W04 A;  2VMD A;  4FP3 A;  4GB3 3;  1DP0 A;  1FMD 2;  4P9X A;  1PZ7 A;  2BRT A;  3AKP A;  1PMI A;  4MG2 A;  4QPI B;  1PVC 3;  4RGA A;  4WVZ A;  3VDD A;  4Q8K A;  3U1X A;  4COW A;  4Q8L A;  1AR9 1;  2Q4S A;  5FYH A;  2YBK A;  2CDP A;  2J42 A;  1S2E A;  3POJ A;  2WSV A;  2VM9 A;  4DZG A;  1DQ6 A;  1JZ2 A;  3BIW E;  3ZPO A;  3RG0 A;  2VZR A;  1R1A 2;  4RR3 A;  1GOH A;  3FLT A;  2AYH A;  1H0B A;  4HZF A;  4Q26 A;  5FP8 A;  3O1T A;  2WZR 2;  5GLW A;  2JWP A;  4CDW A;  2GZW A;  2Y33 A;  4H55 A;  3RSJ A;  5AC9 3;  3NJV A;  4QHB A;  2DUP A;  2VZS A;  3MDP A;  4OHV A;  4YFW A;  1CES A;  4YW5 A;  3ZMO A;  5FWJ A;  4K21 A;  4CCJ A;  4AEM A;  1ND2 A;  4HK8 A;  3VKF C;  4AI8 A;  1G8W A;  1ULD A;  4Y24 A;  1U5I A;  2BP6 A;  1NCQ A;  1YQ5 A;  4CDQ A;  4ZU5 A;  1WCK A;  4YG6 A;  3WD5 A;  2DUR A;  4TLF A;  3T09 A;  1GWK A;  2JG9 B;  4HAN A;  2C6S A;  4UFI A;  1YLL A;  3AKT A;  5C70 A;  1XSQ A;  1C8M 3;  1FPN 3;  3J8F 1;  4IEO A;  1ZBE 1;  1F35 A;  3OOX A;  4LBM A;  4JGZ A;  2VBP A;  3GBF A;  3W21 A;  4BIF A;  1FOD 2;  5F7U A;  1Q5O A;  3HN3 A;  2RDN A;  3IMN A;  4EJR A;  4GZ9 A;  3AFG A;  3JD7 2;  4MAD A;  1NLQ A;  1RMU 3;  1STM A;  4XHX A;  1VAV A;  1YFX A;  2YV8 A;  3AP7 A;  2O1Q A;  2ZEZ A;  4TWT A;  1EV1 3;  3MEP A;  3POB A;  2NMO A;  1AYN 3;  3PVN A;  4N8M A;  4BK4 A;  4HSL A;  1Y9G A;  2RDR A;  2XJR A;  3I97 A;  4GH4 B;  4BA6 A;  2HKX A;  3M3E A;  4YFZ A;  3V0A B;  1K5M C;  5CEH A;  1N3P A;  1EYB A;  2PHT A;  3DF0 A;  4OUL A;  1S0G A;  4D7S A;  4D7T A;  1A34 A;  3J7M A;  3VBF C;  4HT1 T;  2NYY A;  2QKD A;  4K20 A;  1KJL A;  2GMM A;  1VRH 2;  2GMP A;  2YZ4 A;  1KRI A;  1DGR A;  3VHP A;  3VZK A;  1K12 A;  4PF1 A;  3WQ0 A;  3I7D A;  2BPA 2;  3KSC A;  3RI8 A;  4EN9 B;  2UY8 A;  2PHW A;  2CAV A;  4HL0 A;  3OD4 A;  3ZSL A;  5C3Q A;  2P37 A;  1UOB A;  3VBU C;  4PQQ A;  2QTW B;  4K6B A;  2VVF A;  3AYA A;  4PDW A;  3W58 A;  5ACA 2;  2XUM A;  1RUI 1;  1C8N A;  4LUM A;  2BNM A;  1PK6 B;  2R1B A;  1NY7 2;  3OBZ A;  4PQ9 A;  2XKP A;  3RYK A;  5JLV A;  2P34 A;  4HN1 A;  2IWG B;  2YXS A;  5LZ6 A;  2W9X A;  4XIO A;  2BJS A;  1DLC A;  2HWE 2;  5IVV A;  5FZH A;  1W8H A;  2ZGT A;  5JI9 A;  3KCC A;  1D0G A;  3U78 A;  1MZF A;  3HQR A;  4TZD A;  2ARC A;  2GME A;  2OT7 A;  1W8W A;  3VZO A;  1VBC 3;  4O61 A;  2QQU A;  5CZK A;  4CDX B;  4HPK B;  4M3C F;  1H2N A;  1MEC 3;  1R08 3;  5FKC A;  2XBO 1;  4K3U A;  1CAX A;  2J1A A;  2ZGP A;  3OF1 A;  3ZFG C;  4PIZ A;  2BWC A;  2IXH A;  3VZM A;  1GP6 A;  1WW5 A;  2ZHL A;  5A7P A;  1COV 1;  2XKO A;  1QQP 3;  2WNU A;  3NV3 A;  4IE5 A;  4YRD A;  4DB5 A;  4DUW A;  2AEZ A;  1UN1 A;  1XB9 A;  1NXD 1;  1DBN A;  1AVB A;  4Q1P A;  4AGV A;  1W8U A;  3LF7 A;  4I3P A;  5GKA C;  4LE4 A;  1QGL A;  4C1X A;  4MVT A;  2VMG A;  3UJO A;  4NRM A;  5BNP B;  1DYK A;  1OUS A;  2VNO A;  5FYI A;  4IDZ A;  1VBE 2;  1LOA A;  3GXU A;  3WHU A;  3WG2 A;  4QKN A;  2FDH A;  3O1V A;  1UY1 A;  1PX3 A;  1KS4 A;  1KGY A;  4M00 A;  1OVP A;  3LSD A;  3U4X A;  1OUR A;  2QQI A;  5FZ6 A;  4ASL A;  2E51 A;  5FOB B;  4LT5 A;  4UW4 A;  3UES A;  3IZO A;  4LO8 A;  4QQL A;  2DCZ A;  2Y26 A;  3R4S A;  4UW6 A;  5FY5 A;  4LIV A;  2J1U A;  4O7X A;  5DUW A;  4LKE A;  2WBK A;  1XYN A;  2O8O A;  3FL7 A;  4RR3 B;  5FPV A;  3IBM A;  2XGX A;  1CAW A;  3SNM A;  2GH8 A;  5A3O A;  3CJI C;  2EVX A;  4CDW B;  2BVV A;  2VOX A;  2RMU 2;  5DG2 A;  5GLZ A;  1Q8O A;  3BU0 A;  3C7H A;  4L8Q A;  5IUQ A;  3HN1 A;  4OFG A;  3T08 A;  1ND2 B;  4Q0S A;  1EAH 2;  2WLP A;  1VE0 A;  4NO4 A;  3M3Q A;  5FP9 A;  3ZN4 A;  1NCQ B;  4CDQ B;  2JG8 C;  4XVH A;  4RFR B;  2ADE A;  3DEC A;  3HVD A;  1S0B A;  1UX7 A;  3J9S A;  5DDJ 1;  4CCK A;  1G9D A;  4JAA A;  5LY1 A;  4JGY A;  4XUN A;  1G6N A;  1VR3 A;  4CUA A;  1PO2 3;  1V00 A;  2ZKN A;  4Q4W 2;  4OHW A;  2JDU A;  1DQ1 A;  1EPW A;  3VGI A;  3AZW A;  3IN9 A;  4D7Y A;  1RUF 2;  5DPN A;  4JZR A;  4DS0 A;  2W1Q A;  2WYF A;  3PL0 A;  5F3I A;  4HN0 A;  4MOA A;  1WW7 A;  5CFD B;  1RHI 3;  5EJZ B;  2VNV A;  5HBA A;  2VZT A;  3USU A;  4YSF A;  2P1B A;  4DUV A;  3V0B B;  3D82 A;  3ZFF C;  2HWC 3;  5FUP A;  1J58 A;  3WNN A;  3SEP A;  4XC9 A;  4KBB A;  1PZ8 A;  4Z07 A;  5I8S A;  2X05 A;  1LED A;  3GZE A;  4MV2 A;  4FPJ A;  5FRE A;  1O4T A;  1YNA A;  1I6X A;  2ZGM A;  1WLD A;  2R1D A;  5HV0 A;  5JXI A;  3M2M A;  5JZG A;  5FZM A;  3SEE A;  3VBH C;  3S0M A;  1W8Z A;  4KU8 A;  5A80 A;  2HWD 3;  2WC2 A;  3OEB A;  4EQV A;  1WME A;  5C3O A;  4M4R A;  5AVP A;  3GBW A;  3M1H A;  2XUE A;  3NVC A;  4YW6 A;  3C8X A;  5LRS A;  2WYS A;  2MHF A;  2C5D A;  3H7Y A;  1YWK A;  2BEO A;  2ZGQ A;  3WDY A;  4PDW B;  3LD8 A;  1V6M A;  2DCJ A;  4ZXE A;  2ILM A;  1S55 A;  3AP5 A;  1DQ4 A;  3H8X A;  4Q4X 1;  2DCY A;  2VMI A;  4URA A;  4YG0 A;  1OBN A;  1OC1 A;  5JXH A;  3PLQ A;  5DUX A;  4ZS3 A;  3S5A A;  1AR9 2;  2NM1 A;  2ARX A;  2ZGL A;  4PIY A;  1NQD A;  4MZU A;  4D6Q A;  4OI4 A;  3QCW A;  2EXH A;  5A6Y A;  4NMI A;  5I0U A;  3ZYP A;  1OKQ A;  2EXK A;  4AFA A;  2WRA A;  4MLO A;  2VNG A;  3I49 A;  3T2T A;  2C4X A;  2JDP A;  3KT4 A;  3V65 A;  5FKB A;  4DPN A;  2XLF A;  2KD7 A;  3AZV A;  5F1R A;  2X10 A;  1DDL A;  3U4S A;  4U2A A;  1W03 A;  1SLL A;  5GZF A;  3SHR A;  2E53 A;  1HIX A;  4IGP A;  4XFI A;  5CFC C;  1AL2 2;  1FXZ A;  3P1I A;  4Z92 B;  4P9Y A;  5D21 A;  2VCB A;  1UCX A;  3K2O A;  3VBO B;  4XCB A;  3LDR A;  2RM2 1;  2YGM A;  3PUQ A;  3JQX A;  4Q4Y 1;  5JSP A;  2DF7 A;  1RUN A;  4BCU A;  5FZA A;  3M3C A;  1VMF A;  1AYM 1;  1KFU L;  2FQP A;  5GAL A;  5A6Q A;  4XJ8 A;  2CHH A;  3ZYI B;  4LLF A;  1QJU 3;  3FLR A;  3J8F 2;  1IZ3 A;  3PUS A;  2Q8D A;  3OGV A;  4LO5 B;  2DFC A;  4AEJ A;  1AR8 2;  3OB8 A;  4UBH A;  4B4Q A;  4DEQ A;  5K8S A;  1ENX A;  2W1W A;  2GNT A;  1W6O A;  1GWM A;  1Q8P A;  2DVB A;  3B93 A;  1RUG 1;  4BU2 A;  2A6X A;  4D0Q A;  4AFC A;  1POV 3;  4EWA A;  3LE0 A;  1BBT 3;  5FUN A;  1M06 G;  1PGL 1;  1VBA 1;  1J59 A;  1OSG A;  2JDA A;  3QBQ A;  1O3R A;  4RQP A;  5IJR A;  1CIW A;  1JOD A;  1MS0 A;  1RUD 1;  4PIX A;  2ORZ A;  4CCL A;  2IC1 A;  2RS3 1;  1R09 1;  2QQO A;  3VD4 A;  1QJY 1;  2VU9 A;  1WBL A;  1CAW B;  1EPZ A;  2UU8 A;  5LBF A;  4ZKT B;  1GOG A;  4Q2F A;  4AFM A;  2AH2 A;  3KQ4 B;  4AVC A;  1CJP A;  4JTO A;  4IEY A;  5LA2 A;  4PLO A;  5F5Q A;  4J1W A;  4WM7 B;  1LHN A;  3LOB A;  2J1V A;  2W0X A;  5BY5 A;  5J37 A;  1JOJ A;  4IW3 A;  1SCR A;  1ZA4 A;  4N9H A;  3VHN A;  2X09 A;  3WDU A;  4JGY B;  3TAY A;  2W95 A;  4TYS A;  5J09 A;  1X9T A;  2YB7 A;  4AOC A;  1TNF A;  3DYP A;  1VBB 3;  5FZ7 A;  1DGW X;  4EWD A;  5C9A A;  3HMY A;  2CGO A;  4YGE A;  2Y6K A;  2A1X A;  4N43 C;  4RGK A;  3CBN A;  3H8O A;  1VBD 1;  1F2N A;  1HDK A;  2XBO 2;  2FD8 A;  1PIV 3;  2VZO A;  4HFS A;  3Q8C A;  1CR7 A;  1LUL A;  2OUJ A;  4BQ1 A;  3ZIX A;  2WNO A;  2E6V A;  5LEJ A;  5KXC A;  2AAC A;  1COV 2;  2P3I A;  4LR4 A;  2ZX4 A;  1RUJ 3;  3GJB A;  1JHJ A;  1RUE 1;  5DAV A;  1I3H A;  1NYW A;  4Q1R A;  1RJ8 A;  3DXU A;  2FCT A;  2XJU A;  4MXV A;  5A3W A;  3VHO A;  1POV 0;  4N53 C;  2FDG A;  1LNS A;  1AHS A;  3RZJ A;  2BBV A;  4RL7 A;  4CP2 A;  2K2S A;  3ILF A;  4BM8 A;  5CG8 A;  1OQE A;  5BXX A;  3ZXA C;  1UPS A;  4NE9 A;  4CCC A;  2R0H A;  3SC7 X;  4ATF A;  5LA1 A;  2WFF 3;  4RD7 A;  4QX1 A;  4QPW A;  1ODM A;  5DAQ A;  3A23 A;  2XG3 A;  3VKL A;  3MF9 A;  4XXA A;  3Q8F A;  4LO6 B;  2I07 B;  4OZX A;  2VBD A;  3GGL A;  4B7K A;  2VH9 A;  4PT6 A;  4YM3 A;  4LBQ A;  2B42 B;  5E1R A;  4YVW C;  5FIX A;  4FBF A;  2CU5 A;  5FK8 A;  4E4Z A;  2VMF A;  1ZZ8 A;  2OXB A;  4K9S A;  5BNN A;  2A5Z A;  4YVS C;  4YAR A;  3I2K A;  4FFI A;  2D5H A;  1OOP A;  1ND3 A;  2NPI A;  2Y6L A;  3O0X A;  1C28 A;  5EXO A;  1BXH A;  1W6M B;  4PBO A;  1MQT C;  2VW1 A;  4QPG A;  4I09 A;  2D7F A;  2DUQ A;  5CAZ A;  5EWS A;  4ATE A;  4CCN A;  2VTX J;  3I2F A;  1OF4 A;  3VD7 A;  1D4M 2;  1ZBA 3;  3LAG A;  1NCR C;  3E5U A;  4PF5 A;  2BU9 A;  5APA A;  4CRQ A;  4AED A;  3POW A;  5LK7 B;  1JU3 A;  4MH0 E;  1L3J A;  1G9C A;  3PME A;  5FP3 A;  3WDT A;  1SPP A;  1ULG A;  3SIT A;  1J84 A;  4Y1Y A;  4NPR A;  2JEN A;  2FMY A;  3T0D A;  2ZKL A;  5HCH A;  4E8C A;  2PLV 1;  3T4V A;  3I4I A;  5FY7 A;  2CTV A;  3V56 A;  5EYX A;  3ZYJ B;  1K5J A;  3ACI A;  4XDQ A;  5F3G A;  4LOS A;  4DY3 A;  3BIE A;  4XUQ A;  2WII B;  3JBG 3;  4LK6 A;  2J7M A;  1CD3 G;  4QX7 A;  3ACH A;  5K4L A;  2OQ7 A;  3S7E A;  2XDV A;  1FMD 3;  4RQP B;  2WS9 3;  1DU3 D;  2I45 A;  1ULE A;  4QX2 A;  2BZD A;  2CDO A;  5CBL A;  1BK0 A;  2OPW A;  3M7A A;  2HWB 3;  2P3J A;  3J7L A;  3MFC A;  4AL9 A;  3OY8 A;  1UIK A;  2W5F A;  3AC0 A;  3MV1 1;  3MLL A;  1LRH A;  1UKR A;  3N9L A;  2VVE A;  1WZX A;  3OUH A;  4IEP A;  4QDR A;  1R1A 3;  4M0H A;  4A7Y A;  2E7Q A;  1S0E A;  3IDA A;  5E6H A;  2XVL A;  5G05 L;  4FPH A;  5DN2 A;  1W6N A;  2WZR 3;  4LIU A;  4AW7 A;  1HB1 A;  2CWS A;  4U36 A;  2EIB A;  3FMG A;  4QXK A;  2Z69 A;  3UJQ A;  2FDI A;  1XNC A;  5EQU A;  1LOC A;  4GXL A;  3LPG A;  4CP0 A;  5K7P A;  4BH9 A;  4AHW A;  1JN2 P;  2JB8 A;  1N1S A;  4Y22 B;  4K1Z A;  3N7J A;  1C1L A;  2G4I A;  3NW4 A;  4LBO A;  4XJW A;  3P3N A;  4EV0 A;  2VQU A;  5IVB A;  5BV6 A;  1UZZ A;  3KVB A;  3WNO A;  3O12 A;  4OI1 A;  4KWK A;  1LR5 A;  1V6J A;  1EY2 A;  5H9R A;  4CEW C;  4XW3 A;  4QPI A;  2R16 A;  5HV4 A;  3AXE A;  3RZZ A;  1VJ2 A;  3WNM A;  4XF1 A;  3LEI A;  3CDZ B;  3UET A;  2VY0 A;  4UF0 A;  1RVF 1;  2WWJ A;  1DHK B;  1T6B X;  1E5I A;  2YY1 A;  1DFQ A;  1KDK A;  5IK8 A;  4PI2 A;  1LEM A;  3FFQ A;  1MAC A;  4D6S A;  3JD7 3;  2RM2 2;  4Q4Y 2;  1NZI A;  3K51 A;  4HLT A;  5FMB A;  3TNQ A;  5J3U A;  2BER A;  4EN0 A;  3ZN5 A;  3N7L A;  3TBD A;  2R30 A;  3N4M A;  3LEK A;  5CG9 A;  1LOE A;  2ZHN A;  4AVB A;  4Y5T A;  1ST8 A;  4UBG A;  5IK5 A;  1A6C A;  1JUI A;  4QM9 A;  5I0T A;  3BOP A;  5T5P A;  3H1Y A;  1UXZ A;  1VAK A;  1IHM A;  1UF2 C;  3I2I A;  2QQV A;  4YGC A;  4DXZ A;  2VUJ A;  2NLR A;  4IE0 A;  4ISR A;  1RUG 2;  4QPY A;  1QHD A;  2JG9 A;  5FY0 A;  1RUC 3;  4WVM B;  3RI9 A;  4FPG A;  1YRZ A;  3W59 A;  4JQT A;  1NX9 A;  2YFZ A;  5FYS A;  3B3Q E;  3KV5 A;  1PGL 2;  4BYY A;  3DPR A;  2WNV C;  1OA4 A;  4Y1X A;  2RS1 1;  4XBL A;  4AE2 A;  5ABJ C;  3L9J T;  1HRV 3;  5ACA 3;  4DXR A;  2X5I A;  1RUD 2;  3WP4 A;  5L73 A;  3OEA A;  5CIS A;  1V9U 1;  1WGP A;  2HEY F;  4XQD A;  2W46 A;  4LHS A;  2RS3 2;  3F2Z A;  2WO2 A;  1R09 2;  4BQ5 A;  2WT1 A;  3M3I A;  4XZU G;  1TME 1;  3OD0 A;  1PHM A;  1QJY 2;  2HWE 3;  4GA9 A;  4GH4 A;  4LJH A;  3TWI A;  1WLW A;  2D6M A;  1HXS 3;  3AVS A;  4CYD A;  1I1E A;  2A71 A;  3ES1 A;  4HOO A;  2ZGO A;  3AP4 A;  3ZFE C;  4QPG B;  4MHU A;  4AI9 A;  4Q27 A;  3UKT A;  3VZJ A;  2QQK A;  1Z7S 1;  4CEY A;  2P4E A;  5A33 B;  3ZXF A;  3KCY A;  1APN A;  4HON A;  1QKQ A;  4WM8 C;  4HVR A;  4QB1 A;  3CQO A;  4WBB A;  1T6G C;  4C0H A;  2FHR A;  1YFW A;  1YI9 A;  3ZSE A;  4DRR A;  1O59 A;  1NE4 A;  3VV1 A;  5DZE A;  4GIQ A;  1O3S A;  1H8T A;  1H1A A;  1SPP B;  3WUC A;  1G9B A;  1PK6 A;  4NJ4 A;  3WF2 A;  1H2L A;  2J22 A;  4L2N A;  1BLZ A;  1BHG A;  2EXJ A;  3GZT B;  1UU6 A;  1PO1 2;  4FPL A;  2TUN A;  1W2O A;  4Q4V 3;  3BUC A;  4IEQ A;  3RMX A;  2X29 A;  4ONU A;  2XLA A;  5C4W A;  4GD4 A;  1W0O A;  1VBE 3;  1KDM A;  5FK7 A;  3PTR B;  1Y7B A;  2DTY A;  1ALY A;  3MID A;  4RA0 A;  5FO7 B;  3GAL A;  4CDX A;  1WMX A;  4HPK A;  1RUE 2;  2JEC A;  2CAU A;  3LA3 A;  4NRQ A;  2E7A A;  2ZJC A;  5KBF A;  1PM4 A;  2PHU A;  2ZMN A;  3CJX A;  2ZZQ A;  2Q0A A;  2BVB A;  2E31 A;  4GKX A;  3I3E A;  2WT0 A;  4HVO A;  1CZT A;  1SFP A;  1V6I A;  2BBA A;  4UOJ A;  3T2O A;  4AFB A;  2Y6F A;  2BGP A;  2FCU A;  3PIG A;  4IE7 A;  4BQ2 A;  2R06 1;  5FXW A;  1HLC A;  1O7F A;  2WA3 A;  3E6C C;  1W05 A;  2WZP P;  2H0V A;  3QLQ A;  1UQX A;  1SLC A;  1MS3 A;  4GB3 1;  4A7K A;  4IEV A;  3CLP A;  2B9V A;  1AR7 3;  4IV1 C;  3RNS A;  1E5R A;  1PVC 1;  5JVV A;  4RHV 3;  3WNP A;  2HLE A;  4XAA A;  1IS4 A;  4S2F A;  3PIJ A;  1W6N B;  3VDB A;  3VBR C;  3MLK A;  2VQA A;  1ENR A;  5FZO A;  3GCW A;  3FUO A;  4AI2 A;  2HYX A;  4AQT A;  5KHG A;  4FPE A;  2RMU 3;  1VMH A;  5F2W A;  5L9B A;  5LAS A;  1RUH 2;  1GOF A;  5J7M A;  4IE6 A;  1YIF A;  2V09 A;  3EHK A;  2E32 A;  1AJO A;  2XPJ A;  1H4H A;  4LKD A;  2J1T A;  3ABZ A;  3DXT A;  5AC9 1;  1ZM1 A;  4P5Y A;  1IQA A;  3RZL A;  3NNL A;  2QUO A;  4I0W B;  4COV A;  1O3T A;  4X8N A;  4BQX A;  3CKH A;  1FT9 A;  4IUG A;  1MS5 A;  3H0O A;  1OA3 A;  1OVS A;  4L97 A;  5AFB A;  3HWJ A;  1RUF 3;  2V5D A;  2KM2 A;  1NLS A;  3AYC A;  4UF0 B;  3KF3 A;  3UGF A;  5JXG A;  4HKL A;  1JUH A;  4XJA A;  4E8D A;  1ZZ7 A;  3KV6 A;  1AX1 A;  1DGR N;  2QFE A;  4SLI A;  1H1I A;  4W6X A;  2ZEW A;  4JVA A;  1O5L A;  3Q8A A;  1C8M 1;  1FPN 1;  1RJ7 A;  3PUI A;  3F95 A;  1W06 A;  3W20 A;  2VW0 A;  3JZV A;  3A0N A;  2AZ5 A;  3BPS A;  4JKK A;  2D6L X;  5JOY A;  5BNO C;  4C91 A;  3BKZ A;  5F37 A;  3WP3 A;  3U14 A;  1RMU 1;  2D43 A;  3FLP A;  2UYA A;  1DF0 A;  1QU0 A;  2PLV 2;  4M3C B;  3HJR A;  1EV1 1;  4XDO A;  1AYN 1;  3MPB A;  5LCW L;  1K5M B;  4P9W A;  4LKS A;  2XHK A;  2N7G A;  2ZX3 A;  1SG3 A;  4E4S A;  4CDU C;  3ZYB A;  1I5Z A;  1C57 A;  3NNM A;  2YPD A;  5A6Z A;  2TEP A;  3FUQ A;  4QGM A;  4QB6 A;  3DPR B;  4GWN A;  3EB7 A;  3ZIW A;  3SQO A;  4ZU7 A;  4BE3 A;  4HKW A;  4QKF A;  5FZD A;  5CFD A;  2RJ2 A;  2QQM A;  3FC0 A;  5IVE A;  1HRI 3;  2X5I B;  1TMF 3;  3LDK A;  1OMI A;  3QH6 A;  3V0B A;  1YCI A;  3CNA A;  1IG3 A;  2BOI A;  2O8Q A;  3LB9 A;  1YYN A;  3AB0 A;  5JPN B;  2ZEX A;  3KF5 A;  2R0F A;  3K77 A;  4XFG A;  3MIB A;  4FVV A;  2BWA A;  1IS6 A;  3OUJ A;  2VXR A;  5FWE A;  3WQ1 A;  2W87 A;  3AX4 A;  5A3P A;  4L92 A;  2AEN A;  2MEV 2;  4OCT A;  2VO5 A;  4R9D A;  4CEY B;  4AHZ A;  5H9Q A;  2VG9 A;  3MV0 1;  5A3U A;  3IM0 A;  1OQD A;  3K4D A;  3AYD A;  2RS5 2;  1AL2 3;  2VTX A;  4LPL A;  4AHX A;  1AXK A;  4A4A A;  3O1P A;  1BMV 1;  4HVQ A;  1LOF A;  1VBC 1;  4JRL A;  4NN0 A;  2ZPX A;  4FPK A;  5CKM A;  4DIN B;  1CX1 A;  4ARY A;  4OZO A;  2DWR A;  1H8T B;  2LAL A;  1MEC 1;  1R08 1;  3IPV A;  4LQR A;  3ZFG B;  1R64 A;  1G7Y A;  3LCP A;  2NQY A;  4XJU A;  2GP5 A;  3QD6 A;  2WO3 A;  2ARE A;  1NAE A;  3ZKU A;  4L99 A;  1W2U A;  3N7K A;  1XYP A;  1AR8 3;  2VCC A;  5LBB A;  1QMJ A;  1I9R A;  4FT8 A;  1RVF 2;  4G3Y C;  4GKY A;  5DUV A;  3RMY A;  1QQP 1;  4JDO A;  4NUB A;  4KWU A;  5FP4 A;  5FXV A;  4DEV A;  3DKQ A;  3LWC A;  4DUX A;  2H6B A;  1HQW A;  5C4W B;  4N7I A;  1NLR A;  5FO8 B;  2GDF A;  4Y1U A;  1F15 A;  3NRU A;  4MGZ E;  5FP7 A;  2R04 3;  3DEM A;  2W1U A;  4XF9 A;  5GLU A;  4Q0U A;  3U11 A;  5D2A A;  4QX5 A;  1XRU A;  4CPB A;  2F4P A;  4FAG A;  4OVE A;  5FZ3 A;  4CUG A;  4EE2 A;  5J1X A;  1MZ6 A;  1ASJ 1;  4R52 A;  4ET7 A;  2AUY A;  4GJZ A;  1V6K A;  3VBO A;  4NHY A;  1WWY A;  4QDS A;  2PEL A;  4I0B A;  2VW2 A;  4Z2A A;  1J3P A;  5GLT A;  3S57 A;  4WZC A;  4EWE A;  1RTV A;  2ET7 A;  1JYX A;  5KHI A;  1OF3 A;  3LEG A;  3B01 A;  4MHR A;  2JX9 A;  2L9L A;  4XZP A;  1A78 A;  5CU1 A;  2QQL A;  2B5H A;  1EP0 A;  2YBS A;  5FFO C;  3U75 A;  4MX3 A;  5EP9 A;  3WW3 A;  1UIJ A;  3SCF A;  2Z42 A;  4PJY A;  1V6N A;  3THD A;  3O0W A;  4JKL A;  5F5I A;  5A3L A;  5FZO B;  4Y1Z A;  1LGC A;  1NA1 A;  2G9Z A;  4F7Z A;  4LA2 A;  1F9K A;  4FFG A;  2ES3 A;  3E97 A;  2UWA A;  2C9K A;  4W6W A;  2VZP A;  1W0P A;  5D1I A;  5IW0 A;  1KIT A;  1G9F A;  1QDC A;  1TME 2;  5EIY B;  3AMP A;  4HKO A;  1ULO A;  4XJ9 A;  1LHV A;  1RIR A;  2D3S A;  1DG6 A;  5EFU A;  1YC6 1;  3EMR A;  5DG1 A;  1JYN A;  1QNW A;  1RYY A;  4BDV B;  2FDF A;  1LEN A;  2JG8 B;  4Q5O A;  3NO8 A;  1SBD A;  4XXP A;  4QMA A;  1FAY A;  2VCA A;  4XHB A;  3UGG A;  4IEX A;  5KHK A;  1BVP 1;  3CO2 A;  3SH4 A;  5C3R A;  3BI3 A;  2LM3 A;  4N90 A;  1PO2 1;  3D5O A;  3SH5 A;  4MGT A;  3AKS A;  4BPZ A;  4K8F A;  1Q8Q A;  3OGS A;  2EIC A;  1UW8 A;  3HPN A;  1HN1 A;  1KFX L;  5F3C A;  4IXL A;  5L36 A;  4ASM B;  2DU0 A;  3WDV A;  5I8T A;  3DCQ A;  4ISQ A;  3VZL A;  2ID4 A;  2ZAH A;  2ZOE B;  4KNC A;  3ZFF B;  1RHI 1;  3ETP A;  3PVE A;  3KT7 A;  3JU9 A;  5LEK A;  3EXU A;  1O91 A;  1RIT A;  1XPW A;  4WM7 A;  1F5J A;  1VIW B;  3H3U A;  3TNP B;  1VAM A;  2HWC 1;  1UO9 A;  5GZG A;  4AGG A;  4NHL A;  4B29 A;  2WNE A;  4RS5 A;  4XAB A;  2GC2 A;  1QJF A;  3E6B A;  2LRP A;  4X6R B;  2FDJ A;  2ETE A;  2G1M A;  5FLJ A;  1JW6 A;  2ZGR A;  4AAX A;  1URX A;  1Y4W A;  4D94 A;  2BYV E;  4KL1 A;  5BNP C;  3CZU A;  1LCL A;  1S2B A;  1S4C A;  2F4L A;  1MS1 A; 
#chains in the Genus database with same CATH homology
 3WF4 A;  2E26 A;  1L7Q A;  4M4P A;  2VZO A;  3FHQ A;  1GMM A;  3WF3 A;  2JKX A;  3WF1 A;  1JHJ A;  1K3I A;  1OT5 A;  1XNT A;  3U37 A;  4FI9 A;  3HEI A;  2R7E B;  1LNS A;  2WDB A;  3BN6 A;  3T0A A;  1WKY A;  2W1S A;  4OMC A;  5JR2 A;  1UXX X;  1UYZ A;  4YPJ A;  5LA1 A;  3MO4 A;  1L7R A;  1P8J A;  4QX1 A;  4QPW A;  4XUP A;  3A23 A;  3ACG A;  1MPX A;  5B4N A;  3GGL A;  1UWW A;  4PT6 A;  4XUR A;  2WZE A;  2VMF A;  2W94 A;  4XUT A;  2VOT A;  5JXJ A;  3ECQ A;  3I2K A;  4OMD A;  2Y6L A;  4CVU A;  4A3Z A;  1UYY A;  3UNP A;  1O8P A;  2WO1 A;  4TXW A;  4GWJ A;  4MGS A;  2QQJ A;  2VC9 A;  1UMH A;  2XOM A;  3I2F A;  1OF4 A;  3WNK A;  3VD7 A;  1TG7 A;  4MGQ A;  2W47 A;  5B4X A;  1W8N A;  2QBX A;  3HNM A;  1JU3 A;  1CZV A;  2WZ8 A;  3P6B A;  3ACF A;  4W4Z A;  3NQH A;  1J84 A;  4CU6 A;  4CUC A;  2V72 A;  3T0D A;  2DDU A;  3HNY M;  3T2P A;  5LA0 A;  4E8C A;  2LS6 A;  2XHN A;  2VQT A;  1TVG A;  3FHA A;  3ACI A;  3VDC A;  3FN9 A;  1J83 A;  4XUQ A;  2WQ8 A;  5EJ1 B;  3T2Q A;  2J7M A;  3ACH A;  1EUT A;  1O8S A;  4JKM A;  4CUB A;  5C71 A;  1UY2 A;  2ORX A;  3I3B A;  4QX2 A;  2VZQ A;  4BJ0 A;  3LPF A;  2VZU A;  2BZD A;  2CDO A;  2W5F A;  4D8M A;  3AC0 A;  3MV1 1;  4CU7 A;  5C7G A;  3OBA A;  4CU8 A;  4QDR A;  2XQX A;  5IHR A;  1NKG A;  2WAB A;  2VME A;  3IDA A;  3C7G A;  5G05 L;  4ZZ8 A;  5DN2 A;  1PX4 A;  3GDB A;  2ZXQ A;  3LQC A;  2C26 A;  3WF0 A;  2EIB A;  3LPG A;  4DXT A;  1JZ4 A;  4P02 B;  3C7F A;  2VMD A;  1JZ6 A;  4P00 B;  1DP0 A;  2VQU A;  3BGA A;  3WNO A;  3WNM A;  2CDP A;  3GM8 A;  3CDZ B;  3LEI A;  3UET A;  5G04 L;  2VM9 A;  1JZ2 A;  2E33 A;  2VZR A;  1GOH A;  3NJX A;  3W5M A;  4BK5 A;  2YFU A;  4BXS V;  3NJV A;  2VZS A;  2BER A;  4A45 A;  5HXM A;  3LEK A;  4QX0 A;  2Y6G A;  1GUI A;  3III A;  2W3J A;  1SHW B;  2WAO A;  1UXZ A;  2WN3 A;  1D7P M;  1GNY A;  2QQN A;  3I2I A;  3NNG A;  3T09 A;  5C70 A;  1PMJ X;  1W9S A;  1NX9 A;  2YFZ A;  3PUH A;  3K4Z A;  5F7U A;  2VTF A;  3HN3 A;  1IQD C;  4GZ9 A;  1US2 A;  4TTG A;  4MAD A;  4DXR A;  2ZEZ A;  2J1S A;  3OEA A;  4KMQ A;  1US3 A;  2W46 A;  4LHS A;  4BK4 A;  3F2Z A;  2WO2 A;  3I97 A;  4JX0 A;  4XZU G;  2J1E A;  2WN2 A;  5A1A A;  4HG6 B;  3VD5 A;  2QQK A;  2VZV A;  3C7O A;  1K12 A;  4PF1 A;  1GQP A;  5I0D A;  4QB1 A;  3CQO A;  4PQQ A;  4ZY9 A;  1OD3 A;  3K46 A;  1O59 A;  3J7H A;  3VD3 A;  4XUO A;  1JZ5 A;  3WF2 A;  2Y6J A;  2W9X A;  1PMH X;  2J22 A;  1DLC A;  1BHG A;  4QAW A;  3C7E A;  5CZK A;  3HOB A;  1XNA A;  2W92 A;  5DMY A;  2J1A A;  2E31 A;  3I3E A;  3I2G A;  3IAQ A;  4UOJ A;  1CZT A;  2BBA A;  2VL4 A;  3CMG A;  3T2O A;  3A7Q A;  2BGP A;  2Y6H A;  4DUW A;  1F4H A;  1EUU A;  2B9V A;  3HNB M;  2HLE A;  3WNP A;  1UY4 A;  4A42 A;  3VDB A;  4CU9 A;  3D3A A;  1SDD B;  2HYX A;  3SKV A;  4A41 A;  3SKJ E;  3GXU A;  4W50 A;  1GOF A;  1UY1 A;  1PX3 A;  3MBW A;  1W99 A;  1KGY A;  2E32 A;  3T0B A;  3THC A;  2J1T A;  3ABZ A;  4P5Y A;  2QQI A;  1ULP A;  1DYO A;  3WNL A;  3UES A;  3ZM8 A;  1W9T A;  1JZ8 A;  3CKH A;  2J1U A;  4IUG A;  5JMO A;  2Y8K A;  3IAP A;  2V5D A;  2WBK A;  1W8O A;  2VR4 A;  3FL7 A;  5JXG A;  4E8D A;  3I2H A;  3MUY 1;  2Y64 A;  2ZEW A;  3PUI A;  1H6Y A;  2W91 A;  1JZ3 A;  1F4A A;  3C7H A;  4AG4 A;  2VZ1 A;  4JKK A;  4QB2 A;  3T08 A;  4OYU A;  1T2X A;  1UY0 A;  3DYM A;  1W0N A;  4GWI A;  4ARX A;  4XVH A;  3DEC A;  3E1F 1;  1UX7 A;  3HJR A;  4XUN A;  5LCW L;  4CUA A;  4LKS A;  2WAA A;  1SG3 A;  1W9W A;  2WUH A;  4UI9 L;  2BGO A;  5IFT A;  5DPN A;  2W1Q A;  4QB6 A;  4MOA A;  3EB7 A;  1JU4 A;  5EJZ B;  3EYP A;  2VZT A;  2RJ2 A;  2QQM A;  4DUV A;  4RYD A;  3WNN A;  2JD9 A;  3SEP A;  2X05 A;  2ZEX A;  3K77 A;  3VDA A;  3VD9 A;  4W8J A;  4P08 A;  2W87 A;  5JXI A;  3SEE A;  3OEB A;  3JXS A;  4M4R A;  2VO5 A;  2V4V A;  3MV0 1;  3C8X A;  3K4D A;  4MO3 M;  2WYS A;  2YC2 A;  1XC6 A;  4LPL A;  4A4A A;  1CX1 A;  2DCJ A;  4ZXE A;  5IFP A;  4UAP A;  4ARY A;  3I3D A;  4OZO A;  2YC4 A;  4LQR A;  5HPO A;  5JXH A;  1R64 A;  1JZ7 A;  2WO3 A;  5JUV A;  1WCQ A;  1NAE A;  4JHZ A;  3K4A A;  1GU3 A;  2RV9 A;  2VCC A;  1CIY A;  3K75 B;  1H6X A;  4KWU A;  4ZZ5 A;  4DUX A;  2C4X A;  4DEV A;  2KD7 A;  2YG0 A;  2X10 A;  1K42 A;  3NRU A;  1UMI A;  2W1U A;  2ZEY A;  3P1I A;  3IB3 A;  1UZ0 A;  4KI5 M;  2VCB A;  3A21 A;  3WQB A;  5J1X A;  4ET7 A;  2J1R A;  3WSO A;  4A44 A;  1JYV A;  4QDS A;  4Z2A A;  1UY3 A;  1JYX A;  1OF3 A;  3OGV A;  3W5N A;  3LEG A;  2L9L A;  1JI6 A;  3CZJ A;  3OB8 A;  4OUE A;  2QQL A;  4QX3 A;  2EIE A;  4DEQ A;  1KEX A;  2W1W A;  4DXS A;  3THD A;  4JKL A;  2LW8 A;  4D0Q A;  2OKX A;  3LE0 A;  2C9K A;  2VZP A;  2JE8 A;  5EIY B;  2JDA A;  2Z4F A;  1ULO A;  1I5P A;  5IJR A;  1CZS A;  2B4K A;  1JYN A;  1RYY A;  2ORZ A;  4BDV B;  1JYW A;  4A6O A;  2QQO A;  3CIH A;  2VCA A;  2XON A;  3VD4 A;  1OH4 A;  2RVA A;  2VJX A;  4L0P A;  1GOG A;  2VZ3 A;  3I2J A;  5FUI A;  4RN5 A;  2DCK A;  3OGS A;  2EIC A;  3HPN A;  1HN1 A;  5CYY A;  5LA2 A;  2ID4 A;  1K45 A;  3WEZ A;  5IYY A;  3ETP A;  2J1V A;  1XPW A;  5DQ0 A;  2PQS A;  2X09 A;  1UYX A;  1NUK A;  2W95 A;  2YB7 A;  3MUZ 1;  3DYP A;  4QDQ A;  4AAX A;  3DYO A;  2VMC A;  1YQ2 A;  3CZU A;  3OGR A;  3OG2 A;  2Y6K A;  2EID A;  3A22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...