3CKHA

Crystal structure of eph a4 receptor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
170
Chain Sequence
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIDEKNIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and NMR Binding Reveal That Two Small Molecule Antagonists Target the High Affinity Ephrin-binding Channel of the EphA4 Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 4
total genus 33
structure length 170
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3ckhA00
2ZEYA 3GM8A 3LEIA 5HXMA 1GQPA 2V5DA 2ID4A 4LQRA 4W4ZA 2W95A 2WBKA 2J1EA 4UI9L 2YB7A 3SKVA 4FI9A 4P08A 5JXJA 4XUNA 1PX3A 3ETPA 5C70A 1R64A 2WQ8A 3VDBA 4KWUA 1LNSA 4GZ9A 1WCQA 2ZEZA 1I5PA 1P8JA 1UYYA 1UXXX 2QQOA 2VL4A 3HNMA 3SKJE 4XURA 2RVAA 2VZOA 2VCBA 2QQNA 1WKYA 4OMCA 2J1RA 1GOHA 1UXZA 2RJ2A 3VD9A 4OUEA 3JXSA 1W9TA 2WO2A 3BGAA 3ABZA 5JR2A 2QQKA 3OGRA 2BBAA 3MBWA 3WNOA 4ZY9A 4ARXA 3HNBM 3IB3A 3I2GA 2WZEA 1JU3A 4ZXEA 3ACFA 1NKGA 4QX3A 3ACIA 5EJ1B 1O8PA 3D3AA 4JKLA 2VCCA 2EIBA 2VZPA 3I2IA 3OGSA 5A1AA 3W5NA 2VZVA 2ZEXA 2B9VA 3BN6A 2J1VA 5JXGA 1UYXA 2J1TA 3ZM8A 2PQSA 4QX2A 3I2HA 4A4AA 2W47A 5B4XA 3OBAA 3OEAA 3VDAA 4A6OA 3FN9A 2VTFA 3CQOA 2YFZA 3K4DA 4L0PA 2VQTA 4BXSV 4QDQA 5G05L 1K12A 3I3BA 1OF4A 2YG0A 5CZKA 2VMCA 4XUQA 5HPOA 4XUOA 1UZ0A 3K4AA 2Y6LA 1W9WA 2W46A 2OKXA 3VD3A 3NJVA 2VMDA 4A3ZA 4A42A 4DUXA 1JYNA 2JKXA 2QQMA 2VMEA 3K77A 4DUVA 1T2XA 1YQ2A 3HNYM 3WSOA 2W1WA 1GOFA 2W9XA 1US3A 2LW8A 4W50A 3NNGA 3SEEA 3T0DA 3PUIA 3PUHA 2C9KA 2XOMA 2VQUA 2W91A 2W92A 2VZRA 4DXRA 1TG7A 2E31A 2VZUA 3F2ZA 2JDAA 4PF1A 4CU6A 5DMYA 4A45A 2VJXA 3UESA 3ACGA 2Y6JA 2WAOA 2HYXA 2HLEA 4AAXA 1DLCA 1O59A 4A44A 2VZSA 2LS6A 2J7MA 4ET7A 3OEBA 3I2KA 4DEQA 2XHNA 1KGYA 2ZEWA 1TVGA 3DYOA 4OYUA 3WNKA 2W94A 2VZ3A 4QX1A 4LHSA 2WN2A 2VCAA 3A21A 3CZJA 2WABA 2XQXA 1XPWA 4JHZA 1GNYA 1DP0A 3DYPA 4XZUG 1UX7A 1OH4A 4D8MA 3UETA 1ULOA 2ORXA 4TTGA 3HEIA 1UY3A 2QQJA 4M4PA 5B4NA 3E1F1 1BHGA 1US2A 2Y6KA 4P02B 2VZQA 1JI6A 4CUAA 3AC0A 1JZ8A 4TXWA 3GDBA 4PQQA 2EIEA 3A7QA 3P6BA 3THDA 3GGLA 3OG2A 4MO3M 1UY1A 2DCKA 3I3DA 3WF1A 3T2OA 1NAEA 3VDCA 1CZVA 5C71A 2C26A 2WYSA 1KEXA 2QBXA 4OZOA 4HG6B 2X09A 3CZUA 1DYOA 5C7GA 2X10A 3MUZ1 5JXIA 4RYDA 1W0NA 5LCWL 1NUKA 1W99A 2WUHA 3IIIA 4MGQA 4W8JA 2W3JA 2BERA 2Z4FA 4A41A 5IFTA 3WNPA 3HPNA 3A22A 2J1SA 1IQDC 3C7EA 5JMOA 2VMFA 3ACHA 5DN2A 5LA2A 4BK5A 4P5YA 4M4RA 1XNTA 3U37A 3LEKA 4JX0A 5JXHA 4MOAA 2BZDA 4ZZ8A 4GWJA 1UYZA 5CYYA 5IFPA 1UWWA 2W1SA 3T09A 2J22A 1K42A 5FUIA 2CDPA 3T0AA 3WEZA 4E8DA 1W8NA 3CDZB 4E8CA 2Y6GA 1JZ7A 3K75B 3LEGA 1MPXA 2EIDA 2V72A 1JYVA 2VZ1A 3FHQA 4IUGA 4MGSA 3WF3A 2Y8KA 3A23A 1H6YA 3GXUA 5F7UA 1F4AA 3WNNA 3C7OA 1JYXA 1GMMA 3THCA 3DECA 3SEPA 1JHJA 1OF3A 1JZ2A 1RYYA 4LPLA 1J83A 5IJRA 1D7PM 3HN3A 3I2JA 4CU8A 2V4VA 3C7GA 1UY4A 3CIHA 3J7HA 3HJRA 1SHWB 2L9LA 3FL7A 3MV11 4QDSA 4YPJA 1W8OA 4QB2A 4BK4A 1EUTA 1J84A 5J1XA 4D0QA 4UAPA 2J1AA 4DXTA 1JZ4A 2WO3A 4XUTA 1OT5A 3MO4A 2E26A 3NQHA 1H6XA 2W1QA 2VO5A 2YFUA 3IAQA 1ULPA 5EJZB 3WF0A 4BDVB 2WDBA 3OB8A 3I97A 4QAWA 1UMIA 3W5MA 3WF4A 3NJXA 2W5FA 1F4HA 4CUCA 1O8SA 3LPFA 3WNLA 4BJ0A 4XVHA 3I3EA 2ORZA 1JU4A 4CUBA 2DDUA 2E33A 4ZZ5A 2RV9A 3T08A 3EYPA 4QB6A 2JE8A 3UNPA 3EB7A 2QQIA 1K45A 3T0BA 1UY2A 3C7FA 4JKKA 4AG4A 3FHAA 5LA0A 1JZ5A 1XNAA 3LE0A 2WN3A 2X05A 4CU9A 4P00B 1GOGA 4JKMA 5DQ0A 2Y64A 2DCJA 3WNMA 2VZTA 3CMGA 2B4KA 2KD7A 3WF2A 1EUUA 1SG3A 3T2QA 3K46A 1OD3A 3LPGA 4ARYA 5JUVA 3DYMA 1PX4A 3VD4A 2ZXQA 1W9SA 3K4ZA 5DPNA 3VD7A 3IAPA 1XC6A 1GUIA 2BGPA 2VM9A 1UY0A 4QDRA 3CKHA 4GWIA 3OGVA 3VD5A 1K3IA 1UMHA 3C8XA 4QPWA 4Z2AA 5IYYA 1NX9A 4CVUA 4RN5A 4LKSA 4XUPA 3C7HA 4PT6A 5G04L 2C4XA 1L7QA 3P1IA 1PMJX 4DXSA 5LA1A 1CX1A 4UOJA 1JZ3A 2BGOA 3IDAA 2XONA 5IHRA 1CZTA 2JD9A 2Y6HA 2J1UA 1GU3A 5EIYB 1JYWA 1CIYA 4MADA 2CDOA 4KMQA 4KI5M 2VOTA 2VR4A 1HN1A 2QQLA 3NRUA 2EICA 3WQBA 1CZSA 2YC4A 4QB1A 4OMDA 1PMHX 3ECQA 2W87A 3I2FA 1L7RA 2E32A 2WAAA 3T2PA 2R7EB 3MV01 5I0DA 2WO1A 3MUY1 4CU7A 1JZ6A 2YC2A 2VC9A 4DUWA 3HOBA 2W1UA 2WZ8A 4DEVA 1SDDB 3LQCA 4QX0A
chains in the Genus database with same CATH superfamily
2V4AA 4XIKA 5C8WA 1JUHA 5FO7B 1OLRA 2UYBA 1W2OA 3ZFEA 1SFPA 1NZIA 2A70A 3LEIA 4PLOA 1C8M2 1SPPB 5FY4A 1C5IA 3AYAA 4P9GA 5FZ0A 2ADEA 2RG4A 3ZSJA 1JYTA 4RR3C 4GH4C 1GQPA 4CEYC 4KG8A 4CTEA 4COVA 4XMAA 4CPBD 1WLCA 2ZGRA 2XJRA 1Q8SA 3MIFA 1A3KA 5FCCA 5FZAA 3ZKYA 2J1EA 4TLFA 1DYKA 1H2KA 2HWC2 3QBQA 2Q0AA 5FPVA 2O14A 3WT3A 1POQA 1VBE3 4LKFA 5DUWA 2ILMA 5H9QA 2ET7A 5A6ZA 4OUMA 2E6VA 4AR2A 4ZHNA 1LNSA 3E6CC 3U78A 4XF1A 2PLV3 1WCQA 3IT8A 4PBPA 4CSWA 4Q29A 4K6BA 5JMCA 1NG0A 1UU5A 1P8JA 2JENA 5L9VA 4NVPA 4CRQA 2HWB1 4XAAA 1PVC1 3HNMA 3PVNA 4JHTA 4XCBA 3SKJE 2A6VA 3FUOA 2Q8OA 5FOJB 4P9YA 4ATEA 5A3NA 2ZX0A 2QJVA 4JTOA 3LCPA 2SLIA 4HSLA 2WIIB 5CKQA 3M3CA 3R0RA 1S0FA 2D6MA 2HWC1 1E5SA 3MF6A 1RHI3 3AXEA 3VD9A 3B00A 4OUEA 2JXAA 1W9TA 5A33A 5LA9A 4GKXA 2ZZQA 4OI2A 3MPPG 4Q4X2 5J98B 3S5QA 2R041 2J42A 3MBWA 3POIA 4BQXA 5F5IA 1W0PA 2HKXA 4I09A 4YW3A 5KHJA 1WCSA 1JU3A 1BMV2 1Q43A 2WT1A 1KFXL 2I74A 2IXJA 4NPRA 3RYPA 1F2NA 1LOBA 3ACIA 4QX3A 1JHNA 4Y4YA 2CWSA 2G19A 3IMMA 3LDRA 4PDWB 4JKLA 1D4M3 2VCCA 4PJYA 1ZZ8A 4KGGA 3MW2A 1UPSA 4NHKA 3KD4A 2WYFA 3WW4A 2B9VA 4I0AA 3AMNA 3ZSKA 2AR6A 2PQSA 4YGBA 4YFWA 3UYJA 4MUVA 4ES8A 3AXDA 1WMFA 1VIWB 2ZABA 4A4AA 4QPYA 1C57A 1U0AA 2A3XA 1GNZA 4YVWC 2W47A 4YRDA 4Y20A 1C8M3 1QH6A 3OBAA 5FY1A 1YI9A 5IVCA 3BOWA 5CFCB 1W6NB 5A3WA 4CEYA 2XLGA 3BVCA 3M3QA 5KBFA 3DPRB 5J37A 4L0PA 2VQTA 4M3CB 3OSDA 1WMEA 1IKPA 2XHKA 3KWVA 4QDQA 1W3XA 4PQ9A 5DAVA 5FPBA 1QHDA 3BOPA 1OF4A 2GALA 5G05L 3TNPB 1ST8A 2YG0A 3D82A 2JECA 1XQNA 1UAIA 4FTBA 2VMCA 2P1BA 1HLCA 2Z79A 3RZJA 2GZWA 3W9AA 2W46A 4A7ZA 1ASJ2 2JIJA 4JGZB 3VZJA 4A42A 4F8AA 2O8OA 2ZGTA 1UD1A 1LR5A 1C3HA 3DPRC 3HBKA 4PLMA 5APAA 3NL1A 5FO8B 3K77A 1YQ2A 2ZGMA 4K20A 2ZX3A 4LBQA 4XMIA 5FUNA 4AK3A 3IWZA 2LRPA 2VNGA 4NROA 2W0XA 4JDOA 4XOGA 3VBFC 2WNVA 5FMOL 3VB9A 1VMJA 3J9SA 2F17A 3OUIA 1F35A 2A1XA 2CHHA 4CDWA 1S2EA 2W91A 3NV4A 5ACA2 3BCWA 2XKPA 3WCRA 1HB3A 2WNEA 1YO8A 4EQVA 5FZDA 1I3HA 3H8UA 3NNMA 2VMHA 1GKBA 2TEPA 5LY1A 4CU6A 1KDMA 1S0GA 3WCSA 1N47A 4CCOA 2VJXA 4O61A 4QXHA 2WAOA 3PDQA 2MHFA 4TWTA 1F8VA 1Q8VA 3NAPA 1VBC2 4AI3A 2VW2A 4AAXA 4AWDA 3CO2A 1B35A 1VB4A 3AP4A 4ET7A 1DGLA 4NOTA 2RE9A 2P6CA 3CL1A 4WBBA 5DAWA 2IVJA 3LDKA 4GB31 2WLQA 2ZX2A 4DEQA 3NKTA 4GKYA 2ZEWA 2IXCA 3HN1A 4PLNA 5L7OB 1NY71 2XGXA 2VCAA 3JCIA 1KXGA 4CCCA 2HEWF 5CA6A 3IN9A 4HBNA 1CWPA 3PLQA 2R043 4Q5OA 2JG9A 2OA2A 5FZOB 3S6PA 4JHZA 5BNNC 1GNYA 1DP0A 4XJZA 3RMXA 4OHXA 1HB1A 3VBSB 3KB5A 1OQDA 3Q8AA 2F6BA 5IK4A 3DCQA 5F2SA 1OH4A 2FCTA 5AFBA 4EWDA 1V6KA 2VW0A 3MI8A 2ORXA 4HLTA 4TTGA 5FFOC 4IL7A 3E1F1 4JAAA 2RMU2 4YG3A 4BZ4A 1US2A 1NCRC 1NLRA 4N8MA 3LWCA 2Q1ZB 5FP7A 4BA6A 3EMRA 2RMU3 1AXKA 2Y6FA 2EXIA 2UWAA 1ZRFA 1FV3A 1H8TC 2JG9C 3GNEA 5LATA 1JZ8A 2YZ4A 3RDIA 1CAVA 2ZPXA 4LO4B 2EIEA 3A7QA 5EZWA 5FYMA 1ENRA 4ASLA 2P3YA 4MO3M 2DCKA 1SFNA 4R9BA 3EO6A 1ULGA 5FO9B 4XDOA 1NAEA 5A7WA 3K3NA 5EPAA 2VVDA 3LSDA 1EPWA 3PTYA 4DXZA 3VDCA 2HWD2 3IZOA 2VG9A 5E6HA 3OBTA 1HRI2 4CP1A 2RDSA 2VOXA 1AR91 1ZZCA 1AYM1 1DZRA 2WYSA 4NWWA 4W6WA 3WQ1A 2R0HA 2QBXA 4HPKB 1F15A 4DNYA 1YHFA 5HBAA 2E7QA 1TNRA 4HG6B 4XQDA 2X09A 1QF3A 1CONA 1VBD1 2HBTA 2YYOA 4QPGA 1YIFA 1WW7A 4H55A 4XABA 3RQ0A 4AAPA 4PI0A 1W04A 1V9U3 3AP9A 1DYOA 4QM8A 4RQPC 1GBGA 4CDXC 3MUZ1 2EALA 3NAPC 3J8F3 1W0NA 1UYPA 1XNBA 2GH8A 3DGTA 1NUKA 2WUHA 2P17A 4W8JA 2D43A 2NLRA 5F32A 2GN7A 2VPVA 5D8AA 1DZQA 3AP5A 1EV11 2QFEA 2XH6A 2J1SA 4LT5A 4UW4A 1AR61 2YHJA 4OZXA 5FZ1A 3H0OA 4PBOA 2EXKA 1K5MC 3IM0A 4P5YA 3WOGA 4CEWC 1A8MA 1DF0A 3VDDA 3U37A 1H30A 1HXS1 1CAXA 1FNYA 5H9SA 1PVXA 3DN7A 5A6YA 4GWJA 3AZYA 4E4HA 3BTYA 5FK7A 4FSJA 4Q4W2 2Q8CA 4JGYA 1GWLA 5A7NA 4WV8A 1K42A 5FUIA 1FMD3 1BVVA 3ZXDA 3MFAA 1MS5A 4LHNA 4FOWA 1CVNA 2K0GA 4RL7A 5D8AC 1O3SA 3IDEA 3T2TA 1ND3A 2JKBA 4QWNA 4AQ2A 4NRQA 1L3JA 1MQTA 3BTAA 3N36A 2DCTA 2Y6GA 4BQ4A 1COV2 5JIUA 5JPMB 3KF5A 3LOIA 3LEGA 2ZGPA 3APBA 3AZXA 1LHUA 4MX3A 3B93A 3SHRA 4QPGC 4EN8B 2P37A 1W3VA 3NMBA 5HCHA 2VZ1A 4MGSA 1CN1A 1MEC2 3H42B 3ZYGA 3RFRA 1S0CA 3QH7A 4P9WA 1X7NA 1O6UA 3GXUA 4AE2A 3W20A 5FZCA 3ON7A 2OYZA 3J8F1 4MV2A 2VTXJ 1WCDJ 2GNBA 1RYYA 4Q4V1 4CEYB 4AFDA 4FPEA 3QCWA 3U10A 5JLVA 3VV1A 1C1FA 1VRH3 2PTMA 3KVAA 1H8VA 5KWRA 3P5BA 2WLPA 1F5FA 1W8HA 5CU1A 5C8CB 1JN2P 2V4VA 5DZEA 5K4LA 4D7TA 5A3TA 1SHWB 3AK0A 2I2SA 4Q26A 4J25A 3AFKA 4QDSA 4SBVA 3BKZA 3ZVXA 2GMMA 4YPJA 3R4UA 4XILA 2VVEA 4LXLA 2DBNA 1Y7BA 3O0XA 4GAZA 4BK4A 3O1MA 1ZA7A 1OPOA 4FAGA 2R30A 3ZYJB 1DQ6A 2ZX1A 2C5DA 1W03A 1FMD1 1RJ7A 2VUCA 3VBRC 4DXTA 5JZGC 1JZ4A 3KVBA 3MEPA 3P3PA 4E2GA 3KQRA 1FPN2 3VBHA 4C1XA 1MS9A 1W6PB 2OPKA 4UFIA 1JUIA 1MQTB 2IUWA 3Q8EA 3VBOC 4OQ8A 2Y0IA 3S5AA 4HN0A 1MS0A 1X82A 3J7NA 4GD4A 4YWAA 3ZXFA 3O7OA 3WY6A 1V00A 3J4UH 4Y33A 4Y1ZA 4EN9B 1R1A3 2W5FA 1F4HA 2BVBA 4YNIA 4I0BA 4N9IA 5J3UA 2MEV2 5FZGA 1ASJ3 2VY0A 1BK0A 4XAEA 3N9LA 2HWB2 4PIYA 4XVHA 1PHMA 5HXVA 1FMD2 3I3EA 1JU4A 4KU8A 2OT7A 4NRPA 4R4XA 4WM8B 2E33A 3AMMA 5AC92 4G3YC 4UXAA 4URAA 3SH5A 3T08A 2WZPP 4AI1A 3I49A 4LBQB 3UNPA 1PO11 2P6HA 5A3MA 2PXJA 2QQIA 4R9DA 1UY2A 1LOGA 1D4VB 3C7FA 1PGL1 4S2FA 3I2DA 1LEDA 2IFRA 2WSVA 3CJXA 3VKOA 1JZ5A 2XBO3 1AR71 1XNAA 3LE0A 4N53A 3MIDA 2WN3A 1MEC3 4A7YA 4WM8C 1HRV2 2D6OX 4JKMA 4OCTA 5BNNB 4J6GA 2VBDA 3AM2A 1NOVA 3POBA 4LHLA 1KJRA 2VZTA 2HWE1 5DZFA 2NMOA 3N7KA 1YXWA 1JOJA 1ND3B 3KGLA 4IV3B 1C8M1 2FDIA 1LGBA 2WJSA 3T2QA 1JYCA 1MZFA 1OLME 5KXCA 3LPGA 3WP3A 4ARYA 3TN93 1NQJA 1PX4A 5FV3A 2HWD3 4JGYB 1QJFA 1PK6A 3RPQA 2ZXQA 5FZMA 2JDUA 2AEZA 4XFHA 4DY5A 1W9SA 4JDMA 4AVCA 3GCWA 2Z5WA 3VD7A 5GZDA 1GUIA 4Z82A 5HCAA 2JDKA 2BGPA 3AP7A 5FYYA 1LTEA 1IS4A 1WWYA 3VBOB 1UY0A 1Z7S3 3IDCB 3CKHA 2K9ZA 1SLAA 1PO22 1ZRRA 1AL22 2D93A 1PM4A 1I6XA 5KXDA 3C8XA 1AYN2 5IYYA 1PK6C 4W65A 4CVUA 5BNPB 1R1ZA 3FFZA 1QDOA 2AEYA 2DUQA 4XUPA 3C7HA 5G04L 1W8UA 1L7QA 2AH2A 3HMYA 2YV8A 3A0KA 2B45X 2OUJA 4BIFA 5F5AA 2PHLA 5FZ4A 1K5MB 4CEWB 2D97A 5I91A 3V0BB 1BJQA 1FT9A 1H9WA 3EHKA 4LIVA 4XE9A 1C5HA 3LA3A 5IHRA 4AI2A 4UF0B 3KS7A 3MDPA 4IERA 3R05A 4UBHA 2EXJA 2JDYA 1VBE1 2K2SA 2R061 2Y6HA 4MSVA 4YVWA 3O1PA 1RUH3 3AKSA 2E9QA 2CAUA 1EYBA 4LTAA 1MZ6A 3GHMA 1CIYA 3O0VA 5F9TA 1GICA 4M3CE 4YW1A 1JYWA 3U0ZA 2CDOA 1RUH2 3QLQA 4LKDA 4KMQA 3DXTA 2PLV1 2VOTA 3O0WA 4LE4A 3VDDB 3CNAA 2WT2A 2QQLA 2EICA 3CHXA 4XTPA 3ZKUA 4OMDA 2ZX4A 5CFDC 3ECQA 4IEVA 4OI1A 4TN7A 1HQWA 1L7RA 2E32A 2FDJA 1IS5A 4B3NA 1RUJ1 3WG2A 2VVFA 4EJRA 3T2PA 3WDXA 1POV3 4CU7A 2YC2A 3BTXA 1REEA 3JU9A 4YVSC 3H9AA 2BPA2 2DWRA 4YZ4A 1UIKA 5J48A 5JVVA 4LNVA 2ZMNA 3U4XA 4M0HA 1AR93 2ERFA 2HWC3 1HKDA 2W1UA 4DEVA 3DV8A 1RTVA 1J3PA 2R062 2WT0A 1H4HA 1SDDB 5C5UA 4BCUA 3PU3A 1Z7S2 5J96B 4QX0A 3SEEA 1GZWA 5T5LA 3GM8A 4HPKA 3RZGA 3J26N 1LU1A 4S2DA 1VP6A 2E7AA 4RR3B 4UBGA 1FOD2 2RM23 2VH9A 1HV1A 2X5IB 1VRH2 5HXMA 4AOCA 3R4DB 2V5DA 2OQ6A 4CDWB 2YC0A 4XW3A 1J58A 1QNYA 3RZZA 4XJWA 2FCVA 1APNA 3USSA 1RMU1 3POWA 4UI9L 2BP6A 4KG0A 3U14A 1R083 2JE9A 2ARAA 3E5XA 3M7AA 2DU0A 4UFKA 4JVAA 5JR7B 5C70A 4MVTA 4Q0QA 3M1HA 4KWLA 2WQ8A 3I59B 4KWUA 3ZYFA 2DF7A 4WVZA 1Y9MA 1BYHA 1G8WA 5EWSA 1U12A 2GNDA 5C33A 2A6WA 4E27A 5D21A 3D0SA 3OYWB 1UYYA 3A0NA 2PELA 4WVMA 1RIRA 1CPNA 2RR11 3UJQA 2QQOA 4P14A 5CNAA 3EJKA 3LKJA 2R49A 4FPOB 2RS11 1RUG3 2RVAA 2UWCA 4XURA 3I8TA 4GH4A 3VBFB 2VCBA 3FBMA 4RR3A 5KHKA 2FD8A 1KS4A 1WKYA 5IVBA 5I8SA 1OUSA 1EAH3 3MYXA 4IE7A 4LULA 5FZ7A 5LBEA 4E2SA 5IK5A 3AZWA 1W2UA 1IQAA 5FZOA 3VD4A 3ZFEC 1RMU2 2IFWA 4BQ1A 4BH9A 1JW6A 3JXSA 1ZREA 2OX0A 2SBAA 4MXVA 5DAXA 4IEXA 1G9BA 4YSFA 1OI6A 5JR2A 4Z92B 2P3JA 5E8AA 4QMAA 1UQXA 5BYNA 1RUF1 1QXRA 2UY8A 3HNBM 4URTA 5DUXA 5IK7A 2TBVA 3K2OA 5F3EA 2DVFA 1CX4A 4HK9A 3U07A 3VHOA 1S2KA 5A80A 2BNOA 4GMP3 1PVC2 3GJAA 5EJ1B 3V0AB 3S30A 1DGWA 3NNFA 2WINB 2PHDA 2FZ1A 1CESA 3GBGA 4DY3A 1GP4A 1GQHA 1HRI1 4KBBA 5BXXA 1AR92 3JUUA 1OOPA 4PIXA 2Z69A 3VDDC 4INDA 2J1VA 2W2IA 5F5CA 3ZM8A 3BUCA 5DXDA 5A7WB 3ZX7A 1DDLA 2ZKLA 2Y0OA 3I2HA 4RHV2 5CAZA 1MVQA 2QE3A 5KR7A 1NCQC 4MHRA 2FDGA 5B4XA 4JCKA 4QQHA 3CBNA 3ZYBA 3OEAA 4XJAA 4L92A 4FPHA 1UU4A 1KDKA 3IPVB 1NQDA 2XUMA 5F39A 1LHNA 1NA1C 4H3WA 3ITQA 4UW6A 2GNTA 4XFBA 4D69A 2XDVA 2ZGOA 3USUA 3VBUC 1QKQA 4YM3A 4ZXKA 4I01A 3I3BA 2CWMA 4Q4Y1 4XXAA 5EJ3A 1UOFA 1ZBA3 1NZCA 5CZKA 1MS8A 3N7LA 1GZ9A 4XUQA 2YGMA 3O1RA 3HBZA 3K4AA 3N9NA 1W9WA 3M4FA 3FLTA 2OKXA 2RDRA 1OPMA 5GALA 1X8EA 1Z78A 3CEWA 3NJVA 3ZSMA 1TMF3 4K8FA 5A6QA 3GZUC 3BU0A 1JYNA 1ND2C 1DU3D 1O3TA 3KV4A 2YROA 3WG3A 2YDEA 3TEYA 3HNYM 2GN3A 2ZGLA 5FYBA 2W1WA 1GOFA 4BLIA 4C1WA 3JD73 2IXHA 1VBA3 4XJ8A 3NNJA 2LW8A 1DQ5A 2RS31 3NNGA 3OD4A 3ZYHA 1H8TA 1LHWA 1PO13 4LHKA 4RS5B 2C9KA 5EYYA 1PVC3 5T55A 3POJA 4F83A 5L7OC 2RJLA 4N90A 4DXRA 1VBB2 4U2AA 1IPKA 2AZ5A 3RS6A 2JDAA 4CP9A 5JOZA 3WDUA 5IW0A 1QWRA 3H8RA 1H2NA 1AX0A 1BBT3 1W8ZA 4EV0A 1KQRA 5AC93 1JOBA 4MXWA 4OHWA 3TNQA 3G7DA 2JB8A 2VUDA 2WNOA 5T54A 4GQ7A 2OZ6A 4HOOA 1MVEA 2ZMLA 4L97A 1JYIA 1C1LA 3ZXJA 2J7MA 3DEMA 1RB8G 3PHMA 3ZFGB 3D8CA 3I2KA 2B46X 3CJIA 4Q0VA 1N1TA 1KGYA 1QOOA 4AGGA 4DFSA 5ABJA 4AVSA 4YW2A 5JIAA 5A6XA 3MICA 4R4ZA 4GWNA 2DTWA 5FYUA 3WNKA 4EN0A 2VZ3A 2ZA9A 4LHSA 3NV3A 4RFT0 2FCUA 2WN2A 4QQLA 5D2AA 1FPN1 1DG6A 5FZFA 4BB3A 3CZJA 1URXA 2WABA 3O1TA 3C2UA 2XQXA 5D8AB 2VNOA 2DURA 3ES1A 5HI0A 4AZZA 3ZN5A 1OQ1A 3DYPA 2BV4A 4LKEA 2VNVA 5FAXA 4B7EA 1AVBA 3ZN6B 4D8MA 4GMP1 4I3PA 5JSOA 4NR1A 3HEIA 4QPGB 3PURA 4M4PA 2PA7A 5FQ0B 1W6OA 2CGPA 1HRI3 5B4NA 1WLDA 4QHOA 2WFPA 4ZU7A 1BHGA 1N3PA 5FY0A 4LMFA 2AENA 3M70A 1OKOA 2A73B 2XLAA 2XQRA 1AR73 4JGZA 1RUD1 4C8DA 5JWPA 1MEC1 4CUAA 3D5OA 1WGPA 5JPNB 4UW3A 1CGPA 4BQ5A 3IMNA 1E5IA 2WNVC 3GDBA 4DPNA 4D6QA 2G9GA 4C0HA 4FQ4A 1X50A 4YG6A 4JRLA 2Y26A 1AHSA 1UY1A 1V70A 5GZEA 3T1MA 1SMVA 3WW1A 3WDTA 1GYKA 2P4EA 3ROUA 2QQPA 4A3XA 1RUOA 3DPRA 1PGL2 1RHI2 1C4RA 3E5QA 1GZWB 2ZGQA 5C71A 2C26A 4TLGA 5GZFA 1W6MA 5C9AC 1GWMA 2PHTA 1SEFA 1D0GA 3AYCA 5FP4A 4AQ6A 4DRRA 2UY9A 1YC61 4YW7A 3O1OA 1W90A 4KWJA 3SCGA 3JQWA 1TMF1 1ZRIA 2RM21 3H7YA 3JQXA 4AI8A 4AHZA 1TZOA 2HWF3 1LHVA 3VBRB 1MS4A 1RJ8A 1TME1 2BEOA 4XFAA 4RYDA 3VZKA 4EE2A 2WWSA 5LW9A 3NAPB 1W99A 3IIIA 3BIWE 3KGZA 1V6NA 2W52A 4LO6B 4WM8A 4YZ1A 1QQP1 5DDJ2 3NO8A 2ZMKA 4H14A 4YM0A 5EQUA 3WR0A 1UL9A 4ES9A 1ZRCA 3RZLA 3ELNA 4FFGA 4FQZA 5DN2A 1RUI1 1U5YA 5LA2A 4I2OA 5FMBA 2A6YA 1QY4A 1W6QB 2WFF1 5A7SA 3FLPA 5A7PA 1HV0A 5JXHA 5KC5A 1OLQA 3PNAA 4ZZ8A 5C9AA 3AP6A 1OSGA 5CYYA 4LLFA 3AB0A 3GBWA 4ORFA 2QZ2A 3SCFA 5IVJA 2W1SA 5IFPA 2WZR1 4IE6A 4K9SA 5E16A 5T3NA 5AC91 2CDPA 4S2HA 3ZXGA 3T0AA 4QU1A 4QD2A 4BQ3A 1ZBE1 3RMYA 4NIHA 1JZ7A 2BUKA 3K75B 4NUBA 1CIWA 3BODA 2XVKA 4GB33 1EAH2 1OQEA 4Q8LA 3TOJA 3WHUA 4HKOA 4HONA 2EIDA 2V72A 1PZ9A 1W6OB 1FX5A 3A4UA 1AR72 3E6BA 1QJU3 4IUGA 4YGEA 5FBJA 3VBOA 3WF3A 2Y8KA 4N43B 1SLIA 5IAVA 4UFHA 2PHFA 4N7IA 5L36A 4NPMA 5F7UA 3VZLA 3FZ3A 4HMZA 3W21A 3C7OA 1RINA 2IXKA 2RS52 5F37A 1S0EA 1V9U2 1OF3A 4IV1A 4NE9A 4B8EA 4AFCA 4R9CA 3GALA 5IJRA 3HN3A 2VECA 4LLOA 5ERLA 4CCMA 2ZACA 4IV1B 3J7LA 3GF6A 3KT4A 1UY4A 1XSRA 3CIHA 4MGIE 5FMDA 5K0UB 2FHRA 3RZMA 2DCZA 3MV11 5IT6A 1K5JA 4EN7B 2FZ2A 4RGGA 2IZWA 1ODNA 3QOPA 4AHXA 4BU2A 3MHZA 1EUTA 3VLBB 5FPLA 3AL6A 2Q5TA 4BHPA 5C4WC 1J84A 1R091 1GR3A 1SDWA 2PHWA 2AACA 4D0QA 4MZUA 4UAPA 3D0JA 3FX3A 2A6XA 2XG3A 4FPCA 5FP8A 2WWUA 5T52A 1QXPA 2W1QA 3P3NA 3EBRA 4B1LA 4XC9A 1Y43B 1W6NA 4JRAA 2G9ZA 1NLSA 1O4YA 2YFUA 3VN4A 4GXLA 5FJHA 4UYBA 3ZO0B 5ACA1 2DV9A 5FMCA 1RUG1 3POSA 3WG4A 5EJZB 5I93A 2JE7A 3B69A 4NAMA 3NVCA 1COV3 1UMIA 3ES4A 3H1MA 3NJXA 1VBD3 4IV3C 4IEWA 1UCXA 1G7YA 1XYNA 4Q1PA 4DMIA 1SQ4A 3VL9A 4AVTA 1V6JA 1QJU2 1GQGA 3WNLA 5BNOB 1VR3A 1J3QA 1H8TB 4M3CF 1PGSA 4CUBA 2DDUA 1LOAA 1QMJA 4K8RB 1J59A 4Q0PA 4AVBA 2XJVA 2WKKA 5SV5A 1WMDA 4IDZA 4FTSA 3AJYA 3TEZA 2FMDA 3BPZA 1ONAA 2BNMA 2JE8A 1VBA2 3N3HA 1XSQA 1G9FA 4L8QA 1Y3TA 4Y5SA 1HDKA 3EB7A 1GP6A 1VAMA 4M0NA 3T0BA 4QPIC 3I59A 5FIXA 4N7UA 5GZGA 4AG4A 2QKDA 4EZ4A 2QTWB 2E7TA 4QQ2A 3RGBA 4BIOA 1LCLA 1VBB3 4P00B 1GOGA 2Y64A 1WW4A 2R072 2WFF3 1IG3A 2DCJA 2WNUA 3CMGA 2KD7A 1UZVA 2B9UA 2E53A 1BKZA 3TEXA 3WD5A 4AEDA 3I3QA 2Q8EA 4RQPA 3T1LA 1WBLA 3OTFA 1IGOA 2WNUB 4I0WB 1W9YA 3WW3A 1BVP1 1FNZA 2GP5A 4QKDA 3KT1A 5JAXA 2IC1A 3K4ZA 1UMZA 5LK5A 3T30A 1XC6A 5C8CC 1W39A 3VZNA 4PHZA 4CCDA 2VM9A 5LASA 2A75A 2VULA 1O91A 4X8PA 4QKFA 4Y5TA 1RUC3 3B3QE 3VD5A 4YFZA 1NXMA 1WMXA 4UW5A 4Z2AA 2H0BA 4OULA 4RN5A 5FQ0A 2UU8A 5HCBA 1ODMA 3DKQA 2XB6C 5FZIA 5FREA 1I5ZA 4XDQA 2VQ0A 2IWGB 3C3VA 4NMIA 5DDJ3 1PMJX 1MR5A 5A7QA 4DXSA 5LA1A 3H3UA 2I45A 4LORA 5CFCA 5A33B 2BGOA 1REDA 1QJX2 2H6BA 5FYHA 1W6QA 3KCYA 5FKBA 4IQPA 1CZTA 3N7MA 1VPHA 3OOXA 4P5HA 5K9YA 4XXPA 5FTTC 5FDBA 1GU3A 1VBD2 3UV9A 4CXYA 1W6MB 2PFWA 4L9BA 3RG0A 4AEMA 4AQSA 1O7FA 3NWKA 2VTXA 5FP3A 1CQ9A 5FPAA 4UFMA 3V0BA 4AI9A 1DIWA 2R042 1WA6X 2R16A 4LITA 1ZA4A 4OHYA 1HJFA 3I2FA 1BBT1 2WAAA 1CAUA 2A3WA 2RS32 4RSUA 1V0AA 1BMV1 2R7EB 5K7PA 2WO1A 4WVMB 5FXWA 3GZTB 2BTVC 2FBEA 1C28A 4EN6B 2VUJA 4ATFA 2XWJB 3NJZA 3OPTA 1AR62 4CP0A 1YQ6A 4OHVA 3AZZA 1QJX1 3L2HA 5FZHA 3HOBA 5FY9A 5DG1A 1BZWA 4I02A 2XJTA 4FPYA 4LBMA 5TSWA 3RWNA 1X8MA 1YCIA 3ALQA 2VGDA 1LOEA 4GWMA 3SQOA 4BQWA 1U5IA 1NT0A 1B35C 4YG0A 5FZ3A 1F9KA 1MZ5A 2ZEYA 4RHV1 1Q8QA 2XVLA 4X6QB 5FJKA 1RUE1 1XNDA 4YGCA 5F3IA 1VBC1 3AJZA 4FAHA 2YBSA 2VXJA 3ZFEB 1KD7A 1ZZBA 2EXHA 1QXJA 4W4ZA 2W95A 3CF6E 3ZDVA 2XXZA 1GSLA 4HSJA 2VBPA 3JBG1 2WBKA 4NRMA 1E5HA 1O5LA 2YB7A 4FPJA 1J3RA 1XNCA 4CCJA 5JXJA 3SCHA 3ORJA 5CFDA 1PX3A 1ZZ6A 1HIXA 3H3LA 5E89A 1IZ3A 3ETPA 3FBYA 3ZFGA 4GZ9A 3N35A 1Z7S1 2R6QA 4LO8A 2Q4SA 1I5PA 4CDUA 1Q56A 1UX6A 4IW3A 3V0AA 1RUE2 2XKOA 5IK8A 4Q4V2 1EY2A 1UXXX 4Y1XA 1PIV3 5CG9A 5FMOS 1VRH1 2G4IA 2ZZJA 1DQ2A 3PVEA 4EYUA 2CYFA 5C5TA 2WA3A 3W59A 2QQNA 5GZCA 1GLHA 1GFF2 5FY7A 5ABJB 2CL2A 4CDQA 3AMHA 5LZ6A 2JG8C 1UO9A 2RDQA 2BGCA 3PJQA 1POV0 1XU1A 3LDBA 1O4TA 2GMEA 2RJ2A 4XTMA 4ZPIA 2CGOA 5FLJA 4BXFA 4CA9A 3S0MA 1OA4A 4CDQC 1VLNA 5JOXA 2XJSA 3ABZA 5HCFA 1C8NA 1WLWA 2WC2A 1VRBA 2QQKA 2XL7A 3LF7A 4NO4A 4AF9A 2BBAA 1GNHA 2VCMA 2OXBA 4LR4A 3PTRB 4ZY9A 5JI7A 4ARXA 1FYUA 4PDWA 1UF2C 3VBHC 4L99A 2VAUA 4LE3A 2OZJA 2HWF1 4XF0A 3ACFA 1NKGA 2X29A 5IVVA 2UWBA 1CAUB 1X9PA 2Y38A 4FFFA 2CV6A 2LM3A 4YVSB 2EIBA 3ZFGC 2HJIA 4Z8BA 1AYM2 5FLHA 4RA0A 2VQAA 2XJUA 1V6OA 2VZVA 2ZEXA 1G9CA 3RI8A 1RVF2 5IATA 2J1TA 2R073 4GIQA 1JXNA 4QX2A 2WA4A 5FXZA 5T5OA 4ASKA 4BQ2A 1NCQB 1TMF2 2BNNA 1XJAA 2WS93 5IVYA 5CIRA 2D40A 1OUXA 2YGLA 3ZPYA 5FPUA 2A71A 2YY1A 3FN9A 2VTFA 2YFZA 2VOVA 5L9BA 4QGNA 2X5IA 3LAGA 5A3OA 4D3WA 3RZHA 1YEWA 5FZ8A 3O12A 1A6CA 2BDRA 3WP4A 1X36A 5LRRA 4B1MA 5HPOA 3ZDSA 2D6PA 2Y6LA 3KMHA 2RHPA 3VD3A 1HRV1 2VMDA 2RMU1 4A3ZA 4CYDA 5C3OA 4PIZA 3CJIC 4CE8A 2DUOA 2GMPA 1NXD1 1R1A2 1FAYA 2VMEA 3BPSA 4DUVA 4FXGB 3VKMA 1T2XA 3WSOA 4G4FA 5FR3A 3SMHA 3AVRA 3D4KA 4XYXA 1JODA 2W9XA 3SISA 3WHTA 1US3A 5EYXA 2LTNA 2X53S 3VGIA 1LOFC 4W50A 1VJ2A 4Q4Y3 2BU9A 3PUIA 4YZ3A 3PUHA 1WBFA 2XOMA 3ZR5A 2VQUA 1CJDA 2X5IC 3TB0A 1LJ7A 1N3QA 3H1YA 4Q4Y2 1CD3G 3PMSA 3O5SA 2D5FA 4HK8A 4HXCA 3MFCA 4TSVA 4IEOA 5GKAC 3VBUB 1TG7A 4XDPA 2VZUA 5A1FA 4UFJA 1NE6A 2MEV3 1AYN1 4A45A 2WS91 5E1RA 3UESA 3ACGA 3UGHA 3W58A 2Y6JA 3Q8CA 1OD5A 1YUDA 2FDHA 5CEHA 1EP0A 1V9U1 2HYXA 3ZFFB 4LBLA 1IHMA 1SZBA 3HWJA 1YJKA 2V5YA 1BEV2 3OD0A 2P5BA 1O59A 3PUQA 1S0IA 4QPIB 1E57A 1YRZA 4A44A 5BNPC 1H1AA 3PIGA 5IVFA 1D4M1 2LS6A 1UOGA 3OYWA 1PIV1 3WX5A 1W05A 1W9FA 3OEBA 3TN92 4XFFA 3WP5A 1Q5OA 4K1ZA 2R063 2WSUA 4QX5A 4BM8A 5CB7A 4ZKTB 1WA4A 3KCCA 3OGGA 2IXLA 4F7ZA 1PM7A 4QM9A 2XHNA 1OLMA 1UOBA 1QIQA 2ZGKA 1SLCA 3DYOA 1RUC1 3PJYA 4OYUA 3K3OA 3ASIA 5D1IA 1HXS3 1PNGA 2DCYA 2Z42A 4I3GA 1W8WA 1WW6A 1QJEA 2KA3A 1DGWX 2LALA 2NN8A 2W94A 2XWBB 3QD6A 4ITCA 3TAYA 3RI9A 3WG1A 3H50A 1PK6B 3OBRA 3M8LA 1LGCA 1A34A 2WZR2 4XCAA 1OVSA 2CSGA 4XZUG 1NA1A 1VB2A 1MQTC 1RC6A 3T4VA 1BEV1 3JD72 4OUSA 4COWA 3N9MA 5JI9A 2Y60A 3LD8A 3UETA 4NHYA 4NHMA 5BNQA 3M3EA 1ULOA 1DYPA 1ULCA 2C0ZA 2VD7A 4DQAA 2VW1A 1UY3A 3B9CA 3NW4A 4V2VA 4XF3A 3E5UA 3OBZA 4JGYC 3WDWA 1DHKB 4CDUC 1YYNA 4XBQA 1ZBA1 4B4RA 2Y6KA 2MEV1 3U1XA 1OA2A 5F2WA 4P02B 1PO21 1AL21 2BQPA 2CTVA 4FFHA 1JI6A 4Q4X3 4JZRA 1OOPC 4C0BA 2XMLA 1Q8PA 1VAVA 3M3IA 4TXWA 1LOCA 1REFA 1H0BA 4HL0A 4WM7C 2ZHMA 3P6BA 5GM0A 3THDA 3KM5A 4AYUA 3GGLA 4H7MA 3V65A 4A6SA 1IKQA 3FFQA 3ZN6A 1J1LA 3I3DA 4RQPB 1HQLA 1LU2A 2DVBA 3PL0A 4K1YA 2VBBA 5H9RA 3T2OA 3VL8A 1SPPA 3JD71 2XBO1 3HIFA 2JX9A 4C91A 1ZZ9A 1R081 2DFCA 1SCSA 3OY8B 4Y22A 3MIBA 4KQ7A 1YFYA 4XJ9A 1H2MA 3L2YA 1XU2A 1XXNA 1EV13 4CDXA 3N9PA 5H9PA 1GWKA 2DUPA 2CGNA 1RUH1 1WW5A 2PLV2 5LK7B 3PVBB 1LECA 4FOQA 4FXKB 4K40A 4L2NA 1ZX5A 5JXIA 1ND2B 3O1VA 3KSCA 3E6DA 3RVHA 5LCWL 5A3PA 3PIJA 2W3JA 5M0TA 2Q1MA 2BERA 3SLIA 4A41A 3WUDA 2GP3A 3D6EA 1IS6A 4Q27A 3Q8BA 5I0UA 2ZHNA 4IGOA 5C4WA 3WNPA 3A22A 3AKPA 3VZOA 5K0UC 4Q0SA 4IEZA 1L7LA 4OFGA 3UKVA 3ZR6A 1KS5A 3VKLA 5F3CA 1G9DA 2V73A 2WQ4A 3ACHA 5LEJA 1XE7A 1XNTA 4JX0A 4CUGA 4Q4X1 1ASJ1 5F6LB 4LBJA 4UT5A 1D2SA 1DQ4A 4CCLA 2BRTA 1UYZA 2R32A 3KLSA 4R52A 2RM22 2XUEA 3LA2A 3T09A 3OCPA 1W2AX 3IIAA 1WUVA 3SXWA 5JSRA 1CPMA 1KJLA 2ZHKA 2F4PA 2PYTA 1CAVB 1RXFA 3FHIB 4RS5A 3WEZA 1N1VA 1W8NA 4E8DA 1SLTA 3CDZB 3KV6A 2D6NA 4E8CA 1FI2A 5BPXA 2PHRA 2HYKA 5FK8A 4CZSA 5BNNA 2C6SA 1CAWB 1QOTA 1YJLA 2DBIA 4MGZE 3WZ1A 4OI4A 4D7SA 4EWEA 4LBKA 4WZCA 4BPZA 5FYZA 3AFGA 4DZGA 3UGGA 1RMU3 4NIAA 3EXUA 4NWVA 1I1EA 1LGNA 2QCSB 5GJ6A 2UURA 2NQYA 2ETEA 1RUJ3 3UGFA 4HETA 4ISQA 3A23A 3URFA 4AFMA 4HN1A 3THPA 2R1DA 1UPIA 3ZFFC 1BBT2 5T5JA 3WNNA 4AVAA 2C9AA 1JYXA 2NP0A 5C8CA 1JHJA 1JZ2A 4Y4RA 2HBUA 4HFSA 2XR4A 2ZJCA 4LPLA 5F5QA 1ULEA 1N1YA 1UKGA 3I2JA 4IEUA 5CISA 2RS12 4LOTA 2HWD1 2RR13 2O0OA 4CU8A 1DFQA 3C7GA 3CJIB 3J7HA 2OS2A 1AR83 2L9LA 3FL7A 4DO0A 2DVDA 1EAH1 1V6IA 1OKQA 3POYA 3AYDA 3FE5A 4QB2A 3DF0A 3VBHB 3RRDA 1DCSA 3JZVA 4XIOA 4ONUA 4IETA 2JDPA 2J1AA 2EIGA 3U4SA 2GC3A 1AXYA 3KCXA 2JDZA 4O9EA 1OT5A 4Q1RA 1N3OA 5A3LA 3MO4A 2E26A 4J1XA 4DOUA 1H6XA 2G1MA 2RS51 4D94A 4XQWA 3SH3A 3POFA 4MLOA 2FMYA 3IPVA 4LUKA 3DUIA 3OJBA 1DGRN 2VO5A 3IAQA 3PUAA 4LOSA 5A1LA 4FP3A 5C3RA 3ACLA 2EF6A 4XFCA 2C1FA 1UKRA 2JG8A 3OUHA 3OB8A 5FPXA 4QAWA 4ZU5A 1LKNA 5AVAA 1HXS2 4HVQA 1NLQA 3KHCA 3W5MA 4AFBA 2PAMA 4HVOA 4LBOA 1S0DA 3OY8A 1YFUA 4Y22B 2JJ6A 5CVRA 2GNMA 3GBFA 1H2LA 1O8SA 4CUCA 4OQ9A 4BJ0A 4DB5A 1TME3 3JB8A 1VMFA 2ORZA 3WP6A 2C24A 3ZPOA 1TNFA 1ENSA 5C4WB 1OFSA 4FPKA 2XL9A 5BNPA 2OUHA 1IPSA 2ARBA 3EYPA 4QB6A 4S2GA 4BLJA 3ZYPA 2BWCA 4CDUB 1V6MA 4P9JA 1SBFA 4MXWB 3DL3A 1K45A 4Z1VA 1AR81 4HT1T 4YZ5A 3FHAA 4KBZA 1N1SA 3ENRA 2D3PA 3UL2A 5CKMA 2ET1A 1GZTA 3TYJA 4CU9A 5FKCA 5DQ0A 4Y5Z0 3WNMA 3PMEA 3T3YA 2HEVF 2ADDA 4GA9A 2ZGNA 5FZEA 1OH3A 3VBSA 3VHRA 1EUUA 2QQWA 1PZ8A 2HWF2 1A8DA 4WVVA 1OD3A 4UFLA 5GLUA 2H6CA 3LOBA 1XRUA 2JDHA 2P2KA 3WV6A 4E2QA 3DYMA 5JUVA 3PU8A 1UZYA 3HQUA 1DZTA 4IV1C 3SNMA 1QJX3 4AI0A 1QGLA 2ES3A 2BVVA 2GAUA 2JDNA 4IESA 4ZS3A 5F3GA 3UK9A 1JMUB 5DAQA 4IGQA 1QDCA 3ZSLA 5JOWA 3HT1A 3DKWA 3OGVA 4GWIA 1K3IA 3I54A 1GP5A 5FZLA 4QPWA 2D5HA 1AX2A 1GANA 4YW5A 2X8KA 3OF1A 1SACA 1XE8A 2I07B 4O65A 4LKSA 3THTA 4PT6A 5L73A 2C4XA 4XHBA 2XJQA 4W6XA 2PMWB 3P1IA 2UYAA 3VBSC 3KT7A 3B02A 4PF5A 4QXBA 1ULFA 2PHUA 4UOJA 1RHI1 1CX1A 3ZXAC 4AEKA 2PN5A 2GC2A 2XONA 5FYVA 2VMIA 3WDYA 3OUJA 2JD9A 5EHDA 2GH2A 4MHUA 4CXWA 5FOBB 2J1UA 2JG8B 1YFWA 2Y33A 4DRVA 1AL23 5CFCC 1Q8OA 2AYHA 3N7JA 3X29B 3LSEA 1AL0G 4KI5M 1LAJA 2F4LA 3G6JB 4Y3OA 3WQBA 1CZSA 2YC4A 4EWAA 3N9QA 1JOPA 4NN0A 4G9SB 1QJZA 4XF9A 3MGUA 3NV1A 4META 1HJGA 3PUSA 4UF0A 4Y1YA 5K8SA 2NM1A 2VOKA 1KRIA 1AUYA 2DVGA 1QH7A 3MV01 5I0DA 1YLLA 4IEPA 4AHWA 3O1UA 1W06A 3LIGA 3OPWA 3HT2A 1W6PA 3R4SA 4KNCA 4MGKE 3NKGA 2GDFA 4PDWC 3ZYIB 4DUWA 1ND2A 2JIGA 5FYCA 4ISRA 1LULA 2ARCA 2CNAA 4UWDA 4KWKA 3MLJA 4FOVA 2D44A 4O9GA 1G86A 5LBFA 2O8QA 1FATA 5FXXA 4LUMA 4NIGA 1BLZA 5CBLA 4CCEA 5DUVA 2HWE2 1LRHA 2OVUA 2JICA 1ZYBA 4CDXB 4DS0A 3VBUA 4GJYA 5LBBA 4F3JA 1OBNA 2HWE3 5L19A 3H7JA 1BCXA 4KU7A 4M3CA 5I0TA 3OGJA 3NNLA 5A7OA 2ID4A 1D4M2 5L9RA 4LQRA 3Q9OA 1PIV2 3ZMNA 4XETA 1QJY1 2OIIA 1GV9A 3TN91 2CAVA 5GLZA 2OW4A 1TQ5A 5ANNA 1MZEA 5EXOA 1OHFA 4FI9A 3SKVA 4P08A 4XUNA 1XYOA 3RZKA 2JB4A 1OFNA 2XVGA 4AHYA 3V64A 1IOAA 2PHXA 3HQRA 4Q0UA 1R64A 4ZU4A 5DAPA 3VDBA 2H0VA 2JDMA 4JGZC 1SLBA 1YIPA 3ZN4A 4JDNA 1UNBA 2ZEZA 3ILRA 4N53B 1R1A1 3SH4A 1FOD3 3KHBA 2YXSA 1YI7A 2ZKNA 4YYOA 3ZXKA 3USUB 3ZYRA 5JCTA 1LODA 2VL4A 3CLPA 4M01A 5KC6A 1JTZX 2JEMA 2N7GA 1BQPA 3ZFFA 1KITA 2VZOA 4IV3A 2RS33 3BU7A 4IEYA 4XJUA 1SCRA 3MIEA 2J1RA 3JBG2 3POEA 4KH9A 1GOHA 4OMCA 3TWIA 2KM2A 3B7MA 2YBKA 1UXZA 1AR63 1O3RA 1W28A 1H9PA 3V56A 1WCUA 3BGAA 2WO2A 2Q8DA 2ZS6B 3POGA 2PAKA 1D2QA 3OGRA 1B35B 1OOPB 4TZDA 3UJOA 5LWBA 2WS92 3WNOA 2GU9A 3M3OA 3IB3A 4RS5C 3I2GA 1RXGA 1RUJ2 2PAEA 2WZEA 4CCKA 4YLZA 4ZXEA 5C3QA 1QJY3 1O8PA 1RL3A 2TUNA 3D3AA 4LIUA 5LRSA 3B9IA 3HQXA 4QGLA 1AJOA 1STMA 2VZPA 3OGSA 3I2IA 4WZFA 5AVPA 5A1AA 5CADA 3W5NA 1LB2A 5KXEA 3ZSEA 4D7YA 1RUNA 4OHZA 1FV2A 3BN6A 5JXGA 1UYXA 3O14A 2BYVE 3RYRA 4FTEA 1ENXA 5LBCA 4XQ4A 5K0UA 3LGRA 4HKWA 5DG2A 1O5UA 4YVWB 3ZLIA 1RUC2 5KHIA 1G9AA 3KZ4C 1HN0A 1LEMA 4LA2A 1IG0A 2RS53 5FZ9A 1Q3EA 3VDAA 2Z2SB 4LBQD 4A6OA 4QQPA 3CQOA 4GH4B 5A3UA 3K4DA 1WD3A 4Y24A 3PVOA 5FBZA 1SBEA 2A3YA 2BOIA 1I9RA 4BXSV 1UOJA 2WNVB 4NHXA 1K12A 3U11A 2XLFA 3B01A 5KHGA 1TE1B 1S0JA 4XUOA 1UZ0A 4BE3A 1WCKA 3AKRA 4AW7A 1OC1A 4FBFA 3UKNA 4LK7A 4BMBA 4DUXA 4HKLA 3LZZA 2JKXA 3QH6A 2QQMA 2QNKA 5DUUA 5JSPA 1ULDA 4E4ZA 5CFDB 4C90A 2QDNA 4M00A 1MS1A 2XPJA 3S7IA 1JH5A 3H1WA 4DIQA 5FY8A 1AJKA 2AUYA 1BEV3 3T0DA 4COZA 4BISA 1BXHA 3KV5A 2W92A 2HEYF 2XBO2 2WNUC 2YU1A 4GB32 4K3UA 4YW4A 4B4PA 3TBDA 4NHLA 5FYSA 2VZRA 3Q8FA 2E31A 5ACA3 3F2ZA 5AFEA 3I3MA 5FPZA 1V6LA 2YPJA 4PF1A 1NY72 4XBNA 2D6LX 1PO23 5DMYA 3H8OA 1CAWA 5FP9A 4P9IA 4PI2A 1F31A 1ENQA 4GALA 4QPIA 1ZM1A 3WUCA 2JD4A 2HLEA 2Q30A 5IVEA 3WXPA 2R0FA 1FOD1 1RITA 1DLCA 2WRAA 1LENA 4QKBA 3UKTA 2VZSA 3AZVA 5JOYA 1YNAA 4QXKA 4COYA 4QXCA 1T6GC 5I0RA 5C3PA 2BBVA 1LESA 2VUAA 5J1XA 4MGTA 3WNXA 2A7AA 4Q8KA 1CAXB 2P3IA 1PGW1 1NYWA 3K48A 1RUI2 1TVGA 1OVPA 1AYN3 2YU2A 3EQEA 3MIGA 4FPLA 2WFF2 1R092 1X9TA 4XHXA 4AXOA 3O1SA 4IEQA 4V2WA 4L11A 4QX1A 3R6SA 1IS3A 2R071 3A21A 1S55A 4AEJA 1S0BA 1VAKA 3SC7X 5A32A 1XPWA 4LK6A 2BFUS 4B29A 2FDKA 5BY5A 1HX6A 4AEDB 4YZ2A 3B94A 4JTNA 1JYVA 3M2MA 1FXZA 1UX7A 5EP9A 1Z0HA 1ZBE2 5BUVA 2OQ7A 4HANA 3KV9A 4N43A 4MG2A 5C6CA 2QQJA 5IAXA 5FWJA 1Y4WA 1AZDA 5HV4A 1H1MA 4MGYE 4E4DX 5CKNA 1PGW2 3ME2A 5FYTA 4CPBA 5CG8A 4NJ4A 5ISLA 1QJU1 2BW8A 3T4HB 4IE5A 2VZQA 1S2BA 2HWB3 4QX8A 3AC0A 2TNFA 1LOFA 5BNOC 5J7MA 4PQQA 4GMP0 4SLIA 3OG2A 5FWEA 1X33A 4LBNA 3I7DA 4AQTA 4D6RA 3JBG3 4QHZA 3AKQA 4I30A 2ENRA 2HH9A 4Y26A 3WF1A 1Y9GA 5ABJC 1G6NA 1PNFA 4PCRA 3AX4A 1CZVA 1BK1A 2ZCWA 3LEMA 3IKWA 4IXLA 5LY2A 1KEXA 2D6KA 1YFXA 1KFUL 2GC1A 4D6SA 1VBE2 1YWKA 3ATGA 5FRAA 4OZOA 4FOYA 3IBMA 1H1IA 3VKNA 1B09A 3CZUA 4WVWA 5T5PA 1F5JA 1E5RA 4P9XA 3TRSB 5C7GA 3MLKA 2X10A 4Y1VA 1LHOA 4Q2FA 5FZ6A 3RJRA 1DQ0A 3KF3A 3AVSA 4LO7A 4MGQA 4QGMA 1U5ZA 2Z4FA 2JG9B 1ZRDA 4LEJA 3VBRA 1XNKA 4BMEA 5IFTA 1VMHA 3AYEA 3HPNA 3RNSA 1IQDC 1HB4A 1OXCA 1VE0A 3C7EA 5L7OA 1YQ5A 4B7KA 5JMOA 5BNOA 2VMFA 4BK5A 3S57A 2AC1A 2CU5A 3GZAA 3LA7A 1UZWA 4JV4A 4M4RA 4CXXA 3WQ7A 3ILFA 2W68A 3LEKA 5EV7A 4AVVA 3RSJA 4MOAA 2LUWA 2BZDA 2NYYA 4EROA 1OMIA 2EAKA 1UIJA 2DVAA 5FLIA 4OI0A 1UWWA 3MPBA 3GCXA 4BYYA 4XBLA 2J22A 2BFUL 2RDNA 4MH0E 5F1RA 2EVXA 1O4ZA 1VALA 4N43C 3VUOA 2D7FA 4FFIA 4NIIA 3LFIA 4AGRA 1DLLA 2Q1FA 1RUE3 2RJKA 3AMPA 4BWOA 5A70A 2BJSA 3FMGA 1ACCA 4J1WA 4Q4V3 4FT8A 3BB6A 2ZHLA 1Y9QA 4RFRB 1EPZA 1VBA1 2QUOA 4JC1A 1QU0A 5E88A 3VHPA 4IE4A 3ZIWA 2QVSB 4Z07A 4LJHA 3F95A 1MPXA 5JZGB 1AR82 1WLTA 2ZBJA 1QOSA 2NPIA 5F6KA 1VBB1 3BALA 3FHQA 1RUD3 1NCRB 4HZFA 3MW4A 5FZBA 5IWFA 4Q4W3 1J1TA 1H6YA 1ND3C 4R9AA 1F4AA 4K21A 3AKTA 4AL9A 1MS3A 3WLUA 1GMMA 1QNWA 4IE0A 3DECA 5DABA 3QACA 3THCA 3RJ2X 3SEPA 4QT6A 2W39A 5JDBA 1HB2A 5J09A 1ALYA 2B5HA 4KL1A 2RR12 4V1PA 1J83A 4HVRA 2E51A 1D7PM 2IVIB 2A5ZA 3AMQA 5FYIA 3I2OA 2ATFA 1OA3A 4B4QA 2QQVA 1HW5A 4XEZA 3ZXLA 2ARXA 3HJRA 4E9KA 1M4WA 5FY5A 5T50A 4RHV3 4GULA 4Y20B 4RGAA 5FZKA 1W8OA 4TYSA 3MLLA 1IPJA 1UW8A 2R1BA 5FUPA 1OURA 5LB6A 3N4MA 4N53C 1W2TA 2WO3A 3N9OA 1W0OA 2VE1A 4XUTA 5ANQA 4CDQB 1RUF2 4E4SA 1D0HA 3FUQA 1NA1B 3NQHA 2XJPA 3BYWA 3I4IA 4XZPA 5IUQA 1QJY2 1AF9A 1DGRA 1FPN3 4XF4A 1QQP3 4RD7A 4K7JA 3NJYA 2QQUA 3BTZA 4QQOA 4YM1A 1ULPA 2G9FA 2KR2A 3JB4C 4BQYA 3WF0A 2OPWA 3ZXEA 1W2NA 4BDVB 2WDBA 1W8FA 1RVF3 1SFYA 3I97A 2YBPA 3LIHA 2E63A 4XACA 1R093 2BOJA 1XOYA 5EFUA 4A7KA 3HD8B 1PMIA 3WF4A 4X6RB 4YARA 1DBNA 3GHNA 4DINB 2ZAHA 4NIDA 1UU6A 3CU7A 2ZAAA 4XFGA 3WDVA 3ZOIA 2O1QA 2BWAA 1RUD2 2YMZA 2WZR3 3LPFA 5KHHA 1HQNA 3HAGA 4XFIA 3WINE 2FQPA 3LFMA 3J7MA 4R8HA 4FVVA 4IGPA 1AXZA 4QKNA 3S7EA 4H7LA 2WQZC 4OVEA 2CY6A 4WM7B 4ZZ5A 2RV9A 3NSTA 2P34A 1ZBE3 3ILNA 2DYCA 2GSYA 1JS9A 4FPGA 4FO9A 2LROA 1NE4A 1XB9A 4CP2A 1T6BX 4YM2A 1NCRA 2NMNA 2B42B 4JKKA 5C9AB 3GYDA 3LB9A 1A78A 5LA0A 1GZCA 3HR9A 2ZGUA 4AFAA 5JZGA 2X05A 3VKFC 2D3RA 3ETQA 2YPDA 1RGSA 3ST7A 4CCNA 2DFBA 2QDRA 4GJZA 1UN1A 3WW2A 3RYKA 1HRV3 2D3SA 1VBC3 2B4KA 5B2GB 3WF2A 1S1AA 1H4GA 4W6YA 4EZHA 2ZOEB 1SG3A 1PZ7A 4KGQA 1YQCA 2WWJA 3RWKX 1ZZ7A 3K51A 3K46A 4P9LA 3MIHA 5I8TA 4ZS2A 5A32B 1W8TA 2QZ3A 1O3QA 3E97A 2GC0A 2RS13 4OLLA 5HV0A 2VOWA 2B8MA 3U75A 1AYM3 5DPNA 1QQP2 3GJBA 1EV12 3IAPA 5DDJ1 3MZHA 1RVF1 3B5LB 1ZBA2 4NAOA 4QDRA 3UT0A 2Y34A 3KQ4B 5C3SA 1QEXA 2DU1A 3AL5A 4YVSA 4FCAA 4RGKA 3FLRA 2K46A 4QHBA 1UMHA 1UZZA 1RUI3 5SV8A 5I0SA 1TEIA 1YQ8A 2VNRA 1NX9A 4AGVA 4QX7A 1SBDA 4WM7A 4XPVA 1RUF3 5GLTA 3MW3A 4YW6A 2YUEA 2ZGSA 4ASMB 4Q4W1 3IDBB 1AX1A 4YGDA 4LA3A 3ZMOA 4A2UA 2D98A 3L9JT 4MYEA 2VMGA 4AEDC 4Y1UA 4FP2A 3TEWA 1POV1 1RUG2 2WR9A 4NPLA 1R082 1JZ3A 2PQQA 3IDAA 4QU2A 3GZEA 2KXLA 2FDFA 2ZTNA 2VU9A 2B7YA 4ZONA 1CR7A 4FPFA 2JWPA 3ZIXA 1COV1 1NCQA 1SLLA 3FJSA 3MF9A 1XE0A 4COUA 4CP9B 5BV6A 2EAAA 2NZ9A 5EIYB 3H8XA 4LO5B 3NV2A 4MADA 2IXIA 1S4CA 1M06G 5LEKA 4CDWC 2VR4A 3WQ0A 1HN1A 5FXVA 3FWEA 3NRUA 2AGSA 1TME2 2MNGA 2MPFA 2WL1A 4QB1A 1K5MA 4X8NA 4CEWA 3BIEA 1PMHX 2P3KA 2W87A 3VBFA 5I8YA 2WO7A 3VZMA 4JQTA 5F8PA 3J8F2 1CJPA 1DQ1A 2A6ZA 5J36A 1PO12 1U5XA 5GLVA 1WD4A 3SITA 3MUY1 4BOWA 2W08A 1JZ6A 1ZVFA 4H2AA 2AREA 1ZNPA 2VC9A 1XYPA 4Z2WA 1JBCA 4N9HA 3OPZA 2DTYA 3BI3A 5DZGA 3HVDA 3VHNA 2EA7A 2V09A 2WZ8A 4U36A 5GLWA 3DXUA 1XBFA 4O7XA 3WVJA 2B39A 3LQCA 4JQRA 3H3ZA 5KXBA 2VXRA 1MACA 3FC0A 3INAA 1WZXA
chains in the Genus database with same CATH topology
2ZEYA 3GM8A 3LEIA 5HXMA 1GQPA 2V5DA 2ID4A 4LQRA 4W4ZA 2W95A 2WBKA 2J1EA 4UI9L 2YB7A 3SKVA 4FI9A 4P08A 5JXJA 4XUNA 1PX3A 3ETPA 5C70A 1R64A 2WQ8A 3VDBA 4KWUA 1LNSA 4GZ9A 1WCQA 2ZEZA 1I5PA 1P8JA 1UYYA 1UXXX 2QQOA 2VL4A 3HNMA 3SKJE 4XURA 2RVAA 2VZOA 2VCBA 2QQNA 1WKYA 4OMCA 2J1RA 1GOHA 1UXZA 2RJ2A 3VD9A 4OUEA 3JXSA 1W9TA 2WO2A 3BGAA 3ABZA 5JR2A 2QQKA 3OGRA 2BBAA 3MBWA 3WNOA 4ZY9A 4ARXA 3HNBM 3IB3A 3I2GA 2WZEA 1JU3A 4ZXEA 3ACFA 1NKGA 4QX3A 3ACIA 5EJ1B 1O8PA 3D3AA 4JKLA 2VCCA 2EIBA 2VZPA 3I2IA 3OGSA 5A1AA 3W5NA 2VZVA 2ZEXA 2B9VA 3BN6A 2J1VA 5JXGA 1UYXA 2J1TA 3ZM8A 2PQSA 4QX2A 3I2HA 4A4AA 2W47A 5B4XA 3OBAA 3OEAA 3VDAA 4A6OA 3FN9A 2VTFA 3CQOA 2YFZA 3K4DA 4L0PA 2VQTA 4BXSV 4QDQA 5G05L 1K12A 3I3BA 1OF4A 2YG0A 5CZKA 2VMCA 4XUQA 5HPOA 4XUOA 1UZ0A 3K4AA 2Y6LA 1W9WA 2W46A 2OKXA 3VD3A 3NJVA 2VMDA 4A3ZA 4A42A 4DUXA 1JYNA 2JKXA 2QQMA 2VMEA 3K77A 4DUVA 1T2XA 1YQ2A 3HNYM 3WSOA 2W1WA 1GOFA 2W9XA 1US3A 2LW8A 4W50A 3NNGA 3SEEA 3T0DA 3PUIA 3PUHA 2C9KA 2XOMA 2VQUA 2W91A 2W92A 2VZRA 4DXRA 1TG7A 2E31A 2VZUA 3F2ZA 2JDAA 4PF1A 4CU6A 5DMYA 4A45A 2VJXA 3UESA 3ACGA 2Y6JA 2WAOA 2HYXA 2HLEA 4AAXA 1DLCA 1O59A 4A44A 2VZSA 2LS6A 2J7MA 4ET7A 3OEBA 3I2KA 4DEQA 2XHNA 1KGYA 2ZEWA 1TVGA 3DYOA 4OYUA 3WNKA 2W94A 2VZ3A 4QX1A 4LHSA 2WN2A 2VCAA 3A21A 3CZJA 2WABA 2XQXA 1XPWA 4JHZA 1GNYA 1DP0A 3DYPA 4XZUG 1UX7A 1OH4A 4D8MA 3UETA 1ULOA 2ORXA 4TTGA 3HEIA 1UY3A 2QQJA 4M4PA 5B4NA 3E1F1 1BHGA 1US2A 2Y6KA 4P02B 2VZQA 1JI6A 4CUAA 3AC0A 1JZ8A 4TXWA 3GDBA 4PQQA 2EIEA 3A7QA 3P6BA 3THDA 3GGLA 3OG2A 4MO3M 1UY1A 2DCKA 3I3DA 3WF1A 3T2OA 1NAEA 3VDCA 1CZVA 5C71A 2C26A 2WYSA 1KEXA 2QBXA 4OZOA 4HG6B 2X09A 3CZUA 1DYOA 5C7GA 2X10A 3MUZ1 5JXIA 4RYDA 1W0NA 5LCWL 1NUKA 1W99A 2WUHA 3IIIA 4MGQA 4W8JA 2W3JA 2BERA 2Z4FA 4A41A 5IFTA 3WNPA 3HPNA 3A22A 2J1SA 1IQDC 3C7EA 5JMOA 2VMFA 3ACHA 5DN2A 5LA2A 4BK5A 4P5YA 4M4RA 1XNTA 3U37A 3LEKA 4JX0A 5JXHA 4MOAA 2BZDA 4ZZ8A 4GWJA 1UYZA 5CYYA 5IFPA 1UWWA 2W1SA 3T09A 2J22A 1K42A 5FUIA 2CDPA 3T0AA 3WEZA 4E8DA 1W8NA 3CDZB 4E8CA 2Y6GA 1JZ7A 3K75B 3LEGA 1MPXA 2EIDA 2V72A 1JYVA 2VZ1A 3FHQA 4IUGA 4MGSA 3WF3A 2Y8KA 3A23A 1H6YA 3GXUA 5F7UA 1F4AA 3WNNA 3C7OA 1JYXA 1GMMA 3THCA 3DECA 3SEPA 1JHJA 1OF3A 1JZ2A 1RYYA 4LPLA 1J83A 5IJRA 1D7PM 3HN3A 3I2JA 4CU8A 2V4VA 3C7GA 1UY4A 3CIHA 3J7HA 3HJRA 1SHWB 2L9LA 3FL7A 3MV11 4QDSA 4YPJA 1W8OA 4QB2A 4BK4A 1EUTA 1J84A 5J1XA 4D0QA 4UAPA 2J1AA 4DXTA 1JZ4A 2WO3A 4XUTA 1OT5A 3MO4A 2E26A 3NQHA 1H6XA 2W1QA 2VO5A 2YFUA 3IAQA 1ULPA 5EJZB 3WF0A 4BDVB 2WDBA 3OB8A 3I97A 4QAWA 1UMIA 3W5MA 3WF4A 3NJXA 2W5FA 1F4HA 4CUCA 1O8SA 3LPFA 3WNLA 4BJ0A 4XVHA 3I3EA 2ORZA 1JU4A 4CUBA 2DDUA 2E33A 4ZZ5A 2RV9A 3T08A 3EYPA 4QB6A 2JE8A 3UNPA 3EB7A 2QQIA 1K45A 3T0BA 1UY2A 3C7FA 4JKKA 4AG4A 3FHAA 5LA0A 1JZ5A 1XNAA 3LE0A 2WN3A 2X05A 4CU9A 4P00B 1GOGA 4JKMA 5DQ0A 2Y64A 2DCJA 3WNMA 2VZTA 3CMGA 2B4KA 2KD7A 3WF2A 1EUUA 1SG3A 3T2QA 3K46A 1OD3A 3LPGA 4ARYA 5JUVA 3DYMA 1PX4A 3VD4A 2ZXQA 1W9SA 3K4ZA 5DPNA 3VD7A 3IAPA 1XC6A 1GUIA 2BGPA 2VM9A 1UY0A 4QDRA 3CKHA 4GWIA 3OGVA 3VD5A 1K3IA 1UMHA 3C8XA 4QPWA 4Z2AA 5IYYA 1NX9A 4CVUA 4RN5A 4LKSA 4XUPA 3C7HA 4PT6A 5G04L 2C4XA 1L7QA 3P1IA 1PMJX 4DXSA 5LA1A 1CX1A 4UOJA 1JZ3A 2BGOA 3IDAA 2XONA 5IHRA 1CZTA 2JD9A 2Y6HA 2J1UA 1GU3A 5EIYB 1JYWA 1CIYA 4MADA 2CDOA 4KMQA 4KI5M 2VOTA 2VR4A 1HN1A 2QQLA 3NRUA 2EICA 3WQBA 1CZSA 2YC4A 4QB1A 4OMDA 1PMHX 3ECQA 2W87A 3I2FA 1L7RA 2E32A 2WAAA 3T2PA 2R7EB 3MV01 5I0DA 2WO1A 3MUY1 4CU7A 1JZ6A 2YC2A 2VC9A 4DUWA 3HOBA 2W1UA 2WZ8A 4DEVA 1SDDB 3LQCA 4QX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEY A;  3GM8 A;  3LEI A;  5HXM A;  1GQP A;  2V5D A;  2ID4 A;  4LQR A;  4W4Z A;  2W95 A;  2WBK A;  2J1E A;  4UI9 L;  2YB7 A;  3SKV A;  4FI9 A;  4P08 A;  5JXJ A;  4XUN A;  1PX3 A;  3ETP A;  5C70 A;  1R64 A;  2WQ8 A;  3VDB A;  4KWU A;  1LNS A;  4GZ9 A;  1WCQ A;  2ZEZ A;  1I5P A;  1P8J A;  1UYY A;  1UXX X;  2QQO A;  2VL4 A;  3HNM A;  3SKJ E;  4XUR A;  2RVA A;  2VZO A;  2VCB A;  2QQN A;  1WKY A;  4OMC A;  2J1R A;  1GOH A;  1UXZ A;  2RJ2 A;  3VD9 A;  4OUE A;  3JXS A;  1W9T A;  2WO2 A;  3BGA A;  3ABZ A;  5JR2 A;  2QQK A;  3OGR A;  2BBA A;  3MBW A;  3WNO A;  4ZY9 A;  4ARX A;  3HNB M;  3IB3 A;  3I2G A;  2WZE A;  1JU3 A;  4ZXE A;  3ACF A;  1NKG A;  4QX3 A;  3ACI A;  5EJ1 B;  1O8P A;  3D3A A;  4JKL A;  2VCC A;  2EIB A;  2VZP A;  3I2I A;  3OGS A;  5A1A A;  3W5N A;  2VZV A;  2ZEX A;  2B9V A;  3BN6 A;  2J1V A;  5JXG A;  1UYX A;  2J1T A;  3ZM8 A;  2PQS A;  4QX2 A;  3I2H A;  4A4A A;  2W47 A;  5B4X A;  3OBA A;  3OEA A;  3VDA A;  4A6O A;  3FN9 A;  2VTF A;  3CQO A;  2YFZ A;  3K4D A;  4L0P A;  2VQT A;  4BXS V;  4QDQ A;  5G05 L;  1K12 A;  3I3B A;  1OF4 A;  2YG0 A;  5CZK A;  2VMC A;  4XUQ A;  5HPO A;  4XUO A;  1UZ0 A;  3K4A A;  2Y6L A;  1W9W A;  2W46 A;  2OKX A;  3VD3 A;  3NJV A;  2VMD A;  4A3Z A;  4A42 A;  4DUX A;  1JYN A;  2JKX A;  2QQM A;  2VME A;  3K77 A;  4DUV A;  1T2X A;  1YQ2 A;  3HNY M;  3WSO A;  2W1W A;  1GOF A;  2W9X A;  1US3 A;  2LW8 A;  4W50 A;  3NNG A;  3SEE A;  3T0D A;  3PUI A;  3PUH A;  2C9K A;  2XOM A;  2VQU A;  2W91 A;  2W92 A;  2VZR A;  4DXR A;  1TG7 A;  2E31 A;  2VZU A;  3F2Z A;  2JDA A;  4PF1 A;  4CU6 A;  5DMY A;  4A45 A;  2VJX A;  3UES A;  3ACG A;  2Y6J A;  2WAO A;  2HYX A;  2HLE A;  4AAX A;  1DLC A;  1O59 A;  4A44 A;  2VZS A;  2LS6 A;  2J7M A;  4ET7 A;  3OEB A;  3I2K A;  4DEQ A;  2XHN A;  1KGY A;  2ZEW A;  1TVG A;  3DYO A;  4OYU A;  3WNK A;  2W94 A;  2VZ3 A;  4QX1 A;  4LHS A;  2WN2 A;  2VCA A;  3A21 A;  3CZJ A;  2WAB A;  2XQX A;  1XPW A;  4JHZ A;  1GNY A;  1DP0 A;  3DYP A;  4XZU G;  1UX7 A;  1OH4 A;  4D8M A;  3UET A;  1ULO A;  2ORX A;  4TTG A;  3HEI A;  1UY3 A;  2QQJ A;  4M4P A;  5B4N A;  3E1F 1;  1BHG A;  1US2 A;  2Y6K A;  4P02 B;  2VZQ A;  1JI6 A;  4CUA A;  3AC0 A;  1JZ8 A;  4TXW A;  3GDB A;  4PQQ A;  2EIE A;  3A7Q A;  3P6B A;  3THD A;  3GGL A;  3OG2 A;  4MO3 M;  1UY1 A;  2DCK A;  3I3D A;  3WF1 A;  3T2O A;  1NAE A;  3VDC A;  1CZV A;  5C71 A;  2C26 A;  2WYS A;  1KEX A;  2QBX A;  4OZO A;  4HG6 B;  2X09 A;  3CZU A;  1DYO A;  5C7G A;  2X10 A;  3MUZ 1;  5JXI A;  4RYD A;  1W0N A;  5LCW L;  1NUK A;  1W99 A;  2WUH A;  3III A;  4MGQ A;  4W8J A;  2W3J A;  2BER A;  2Z4F A;  4A41 A;  5IFT A;  3WNP A;  3HPN A;  3A22 A;  2J1S A;  1IQD C;  3C7E A;  5JMO A;  2VMF A;  3ACH A;  5DN2 A;  5LA2 A;  4BK5 A;  4P5Y A;  4M4R A;  1XNT A;  3U37 A;  3LEK A;  4JX0 A;  5JXH A;  4MOA A;  2BZD A;  4ZZ8 A;  4GWJ A;  1UYZ A;  5CYY A;  5IFP A;  1UWW A;  2W1S A;  3T09 A;  2J22 A;  1K42 A;  5FUI A;  2CDP A;  3T0A A;  3WEZ A;  4E8D A;  1W8N A;  3CDZ B;  4E8C A;  2Y6G A;  1JZ7 A;  3K75 B;  3LEG A;  1MPX A;  2EID A;  2V72 A;  1JYV A;  2VZ1 A;  3FHQ A;  4IUG A;  4MGS A;  3WF3 A;  2Y8K A;  3A23 A;  1H6Y A;  3GXU A;  5F7U A;  1F4A A;  3WNN A;  3C7O A;  1JYX A;  1GMM A;  3THC A;  3DEC A;  3SEP A;  1JHJ A;  1OF3 A;  1JZ2 A;  1RYY A;  4LPL A;  1J83 A;  5IJR A;  1D7P M;  3HN3 A;  3I2J A;  4CU8 A;  2V4V A;  3C7G A;  1UY4 A;  3CIH A;  3J7H A;  3HJR A;  1SHW B;  2L9L A;  3FL7 A;  3MV1 1;  4QDS A;  4YPJ A;  1W8O A;  4QB2 A;  4BK4 A;  1EUT A;  1J84 A;  5J1X A;  4D0Q A;  4UAP A;  2J1A A;  4DXT A;  1JZ4 A;  2WO3 A;  4XUT A;  1OT5 A;  3MO4 A;  2E26 A;  3NQH A;  1H6X A;  2W1Q A;  2VO5 A;  2YFU A;  3IAQ A;  1ULP A;  5EJZ B;  3WF0 A;  4BDV B;  2WDB A;  3OB8 A;  3I97 A;  4QAW A;  1UMI A;  3W5M A;  3WF4 A;  3NJX A;  2W5F A;  1F4H A;  4CUC A;  1O8S A;  3LPF A;  3WNL A;  4BJ0 A;  4XVH A;  3I3E A;  2ORZ A;  1JU4 A;  4CUB A;  2DDU A;  2E33 A;  4ZZ5 A;  2RV9 A;  3T08 A;  3EYP A;  4QB6 A;  2JE8 A;  3UNP A;  3EB7 A;  2QQI A;  1K45 A;  3T0B A;  1UY2 A;  3C7F A;  4JKK A;  4AG4 A;  3FHA A;  5LA0 A;  1JZ5 A;  1XNA A;  3LE0 A;  2WN3 A;  2X05 A;  4CU9 A;  4P00 B;  1GOG A;  4JKM A;  5DQ0 A;  2Y64 A;  2DCJ A;  3WNM A;  2VZT A;  3CMG A;  2B4K A;  2KD7 A;  3WF2 A;  1EUU A;  1SG3 A;  3T2Q A;  3K46 A;  1OD3 A;  3LPG A;  4ARY A;  5JUV A;  3DYM A;  1PX4 A;  3VD4 A;  2ZXQ A;  1W9S A;  3K4Z A;  5DPN A;  3VD7 A;  3IAP A;  1XC6 A;  1GUI A;  2BGP A;  2VM9 A;  1UY0 A;  4QDR A;  3CKH A;  4GWI A;  3OGV A;  3VD5 A;  1K3I A;  1UMH A;  3C8X A;  4QPW A;  4Z2A A;  5IYY A;  1NX9 A;  4CVU A;  4RN5 A;  4LKS A;  4XUP A;  3C7H A;  4PT6 A;  5G04 L;  2C4X A;  1L7Q A;  3P1I A;  1PMJ X;  4DXS A;  5LA1 A;  1CX1 A;  4UOJ A;  1JZ3 A;  2BGO A;  3IDA A;  2XON A;  5IHR A;  1CZT A;  2JD9 A;  2Y6H A;  2J1U A;  1GU3 A;  5EIY B;  1JYW A;  1CIY A;  4MAD A;  2CDO A;  4KMQ A;  4KI5 M;  2VOT A;  2VR4 A;  1HN1 A;  2QQL A;  3NRU A;  2EIC A;  3WQB A;  1CZS A;  2YC4 A;  4QB1 A;  4OMD A;  1PMH X;  3ECQ A;  2W87 A;  3I2F A;  1L7R A;  2E32 A;  2WAA A;  3T2P A;  2R7E B;  3MV0 1;  5I0D A;  2WO1 A;  3MUY 1;  4CU7 A;  1JZ6 A;  2YC2 A;  2VC9 A;  4DUW A;  3HOB A;  2W1U A;  2WZ8 A;  4DEV A;  1SDD B;  3LQC A;  4QX0 A; 
#chains in the Genus database with same CATH topology
 2V4A A;  4XIK A;  5C8W A;  1JUH A;  5FO7 B;  1OLR A;  2UYB A;  1W2O A;  3ZFE A;  1SFP A;  1NZI A;  2A70 A;  3LEI A;  4PLO A;  1C8M 2;  1SPP B;  5FY4 A;  1C5I A;  3AYA A;  4P9G A;  5FZ0 A;  2ADE A;  2RG4 A;  3ZSJ A;  1JYT A;  4RR3 C;  4GH4 C;  1GQP A;  4CEY C;  4KG8 A;  4CTE A;  4COV A;  4XMA A;  4CPB D;  1WLC A;  2ZGR A;  2XJR A;  1Q8S A;  3MIF A;  1A3K A;  5FCC A;  5FZA A;  3ZKY A;  2J1E A;  4TLF A;  1DYK A;  1H2K A;  2HWC 2;  3QBQ A;  2Q0A A;  5FPV A;  2O14 A;  3WT3 A;  1POQ A;  1VBE 3;  4LKF A;  5DUW A;  2ILM A;  5H9Q A;  2ET7 A;  5A6Z A;  4OUM A;  2E6V A;  4AR2 A;  4ZHN A;  1LNS A;  3E6C C;  3U78 A;  4XF1 A;  2PLV 3;  1WCQ A;  3IT8 A;  4PBP A;  4CSW A;  4Q29 A;  4K6B A;  5JMC A;  1NG0 A;  1UU5 A;  1P8J A;  2JEN A;  5L9V A;  4NVP A;  4CRQ A;  2HWB 1;  4XAA A;  1PVC 1;  3HNM A;  3PVN A;  4JHT A;  4XCB A;  3SKJ E;  2A6V A;  3FUO A;  2Q8O A;  5FOJ B;  4P9Y A;  4ATE A;  5A3N A;  2ZX0 A;  2QJV A;  4JTO A;  3LCP A;  2SLI A;  4HSL A;  2WII B;  5CKQ A;  3M3C A;  3R0R A;  1S0F A;  2D6M A;  2HWC 1;  1E5S A;  3MF6 A;  1RHI 3;  3AXE A;  3VD9 A;  3B00 A;  4OUE A;  2JXA A;  1W9T A;  5A33 A;  5LA9 A;  4GKX A;  2ZZQ A;  4OI2 A;  3MPP G;  4Q4X 2;  5J98 B;  3S5Q A;  2R04 1;  2J42 A;  3MBW A;  3POI A;  4BQX A;  5F5I A;  1W0P A;  2HKX A;  4I09 A;  4YW3 A;  5KHJ A;  1WCS A;  1JU3 A;  1BMV 2;  1Q43 A;  2WT1 A;  1KFX L;  2I74 A;  2IXJ A;  4NPR A;  3RYP A;  1F2N A;  1LOB A;  3ACI A;  4QX3 A;  1JHN A;  4Y4Y A;  2CWS A;  2G19 A;  3IMM A;  3LDR A;  4PDW B;  4JKL A;  1D4M 3;  2VCC A;  4PJY A;  1ZZ8 A;  4KGG A;  3MW2 A;  1UPS A;  4NHK A;  3KD4 A;  2WYF A;  3WW4 A;  2B9V A;  4I0A A;  3AMN A;  3ZSK A;  2AR6 A;  2PQS A;  4YGB A;  4YFW A;  3UYJ A;  4MUV A;  4ES8 A;  3AXD A;  1WMF A;  1VIW B;  2ZAB A;  4A4A A;  4QPY A;  1C57 A;  1U0A A;  2A3X A;  1GNZ A;  4YVW C;  2W47 A;  4YRD A;  4Y20 A;  1C8M 3;  1QH6 A;  3OBA A;  5FY1 A;  1YI9 A;  5IVC A;  3BOW A;  5CFC B;  1W6N B;  5A3W A;  4CEY A;  2XLG A;  3BVC A;  3M3Q A;  5KBF A;  3DPR B;  5J37 A;  4L0P A;  2VQT A;  4M3C B;  3OSD A;  1WME A;  1IKP A;  2XHK A;  3KWV A;  4QDQ A;  1W3X A;  4PQ9 A;  5DAV A;  5FPB A;  1QHD A;  3BOP A;  1OF4 A;  2GAL A;  5G05 L;  3TNP B;  1ST8 A;  2YG0 A;  3D82 A;  2JEC A;  1XQN A;  1UAI A;  4FTB A;  2VMC A;  2P1B A;  1HLC A;  2Z79 A;  3RZJ A;  2GZW A;  3W9A A;  2W46 A;  4A7Z A;  1ASJ 2;  2JIJ A;  4JGZ B;  3VZJ A;  4A42 A;  4F8A A;  2O8O A;  2ZGT A;  1UD1 A;  1LR5 A;  1C3H A;  3DPR C;  3HBK A;  4PLM A;  5APA A;  3NL1 A;  5FO8 B;  3K77 A;  1YQ2 A;  2ZGM A;  4K20 A;  2ZX3 A;  4LBQ A;  4XMI A;  5FUN A;  4AK3 A;  3IWZ A;  2LRP A;  2VNG A;  4NRO A;  2W0X A;  4JDO A;  4XOG A;  3VBF C;  2WNV A;  5FMO L;  3VB9 A;  1VMJ A;  3J9S A;  2F17 A;  3OUI A;  1F35 A;  2A1X A;  2CHH A;  4CDW A;  1S2E A;  2W91 A;  3NV4 A;  5ACA 2;  3BCW A;  2XKP A;  3WCR A;  1HB3 A;  2WNE A;  1YO8 A;  4EQV A;  5FZD A;  1I3H A;  3H8U A;  3NNM A;  2VMH A;  1GKB A;  2TEP A;  5LY1 A;  4CU6 A;  1KDM A;  1S0G A;  3WCS A;  1N47 A;  4CCO A;  2VJX A;  4O61 A;  4QXH A;  2WAO A;  3PDQ A;  2MHF A;  4TWT A;  1F8V A;  1Q8V A;  3NAP A;  1VBC 2;  4AI3 A;  2VW2 A;  4AAX A;  4AWD A;  3CO2 A;  1B35 A;  1VB4 A;  3AP4 A;  4ET7 A;  1DGL A;  4NOT A;  2RE9 A;  2P6C A;  3CL1 A;  4WBB A;  5DAW A;  2IVJ A;  3LDK A;  4GB3 1;  2WLQ A;  2ZX2 A;  4DEQ A;  3NKT A;  4GKY A;  2ZEW A;  2IXC A;  3HN1 A;  4PLN A;  5L7O B;  1NY7 1;  2XGX A;  2VCA A;  3JCI A;  1KXG A;  4CCC A;  2HEW F;  5CA6 A;  3IN9 A;  4HBN A;  1CWP A;  3PLQ A;  2R04 3;  4Q5O A;  2JG9 A;  2OA2 A;  5FZO B;  3S6P A;  4JHZ A;  5BNN C;  1GNY A;  1DP0 A;  4XJZ A;  3RMX A;  4OHX A;  1HB1 A;  3VBS B;  3KB5 A;  1OQD A;  3Q8A A;  2F6B A;  5IK4 A;  3DCQ A;  5F2S A;  1OH4 A;  2FCT A;  5AFB A;  4EWD A;  1V6K A;  2VW0 A;  3MI8 A;  2ORX A;  4HLT A;  4TTG A;  5FFO C;  4IL7 A;  3E1F 1;  4JAA A;  2RMU 2;  4YG3 A;  4BZ4 A;  1US2 A;  1NCR C;  1NLR A;  4N8M A;  3LWC A;  2Q1Z B;  5FP7 A;  4BA6 A;  3EMR A;  2RMU 3;  1AXK A;  2Y6F A;  2EXI A;  2UWA A;  1ZRF A;  1FV3 A;  1H8T C;  2JG9 C;  3GNE A;  5LAT A;  1JZ8 A;  2YZ4 A;  3RDI A;  1CAV A;  2ZPX A;  4LO4 B;  2EIE A;  3A7Q A;  5EZW A;  5FYM A;  1ENR A;  4ASL A;  2P3Y A;  4MO3 M;  2DCK A;  1SFN A;  4R9B A;  3EO6 A;  1ULG A;  5FO9 B;  4XDO A;  1NAE A;  5A7W A;  3K3N A;  5EPA A;  2VVD A;  3LSD A;  1EPW A;  3PTY A;  4DXZ A;  3VDC A;  2HWD 2;  3IZO A;  2VG9 A;  5E6H A;  3OBT A;  1HRI 2;  4CP1 A;  2RDS A;  2VOX A;  1AR9 1;  1ZZC A;  1AYM 1;  1DZR A;  2WYS A;  4NWW A;  4W6W A;  3WQ1 A;  2R0H A;  2QBX A;  4HPK B;  1F15 A;  4DNY A;  1YHF A;  5HBA A;  2E7Q A;  1TNR A;  4HG6 B;  4XQD A;  2X09 A;  1QF3 A;  1CON A;  1VBD 1;  2HBT A;  2YYO A;  4QPG A;  1YIF A;  1WW7 A;  4H55 A;  4XAB A;  3RQ0 A;  4AAP A;  4PI0 A;  1W04 A;  1V9U 3;  3AP9 A;  1DYO A;  4QM8 A;  4RQP C;  1GBG A;  4CDX C;  3MUZ 1;  2EAL A;  3NAP C;  3J8F 3;  1W0N A;  1UYP A;  1XNB A;  2GH8 A;  3DGT A;  1NUK A;  2WUH A;  2P17 A;  4W8J A;  2D43 A;  2NLR A;  5F32 A;  2GN7 A;  2VPV A;  5D8A A;  1DZQ A;  3AP5 A;  1EV1 1;  2QFE A;  2XH6 A;  2J1S A;  4LT5 A;  4UW4 A;  1AR6 1;  2YHJ A;  4OZX A;  5FZ1 A;  3H0O A;  4PBO A;  2EXK A;  1K5M C;  3IM0 A;  4P5Y A;  3WOG A;  4CEW C;  1A8M A;  1DF0 A;  3VDD A;  3U37 A;  1H30 A;  1HXS 1;  1CAX A;  1FNY A;  5H9S A;  1PVX A;  3DN7 A;  5A6Y A;  4GWJ A;  3AZY A;  4E4H A;  3BTY A;  5FK7 A;  4FSJ A;  4Q4W 2;  2Q8C A;  4JGY A;  1GWL A;  5A7N A;  4WV8 A;  1K42 A;  5FUI A;  1FMD 3;  1BVV A;  3ZXD A;  3MFA A;  1MS5 A;  4LHN A;  4FOW A;  1CVN A;  2K0G A;  4RL7 A;  5D8A C;  1O3S A;  3IDE A;  3T2T A;  1ND3 A;  2JKB A;  4QWN A;  4AQ2 A;  4NRQ A;  1L3J A;  1MQT A;  3BTA A;  3N36 A;  2DCT A;  2Y6G A;  4BQ4 A;  1COV 2;  5JIU A;  5JPM B;  3KF5 A;  3LOI A;  3LEG A;  2ZGP A;  3APB A;  3AZX A;  1LHU A;  4MX3 A;  3B93 A;  3SHR A;  4QPG C;  4EN8 B;  2P37 A;  1W3V A;  3NMB A;  5HCH A;  2VZ1 A;  4MGS A;  1CN1 A;  1MEC 2;  3H42 B;  3ZYG A;  3RFR A;  1S0C A;  3QH7 A;  4P9W A;  1X7N A;  1O6U A;  3GXU A;  4AE2 A;  3W20 A;  5FZC A;  3ON7 A;  2OYZ A;  3J8F 1;  4MV2 A;  2VTX J;  1WCD J;  2GNB A;  1RYY A;  4Q4V 1;  4CEY B;  4AFD A;  4FPE A;  3QCW A;  3U10 A;  5JLV A;  3VV1 A;  1C1F A;  1VRH 3;  2PTM A;  3KVA A;  1H8V A;  5KWR A;  3P5B A;  2WLP A;  1F5F A;  1W8H A;  5CU1 A;  5C8C B;  1JN2 P;  2V4V A;  5DZE A;  5K4L A;  4D7T A;  5A3T A;  1SHW B;  3AK0 A;  2I2S A;  4Q26 A;  4J25 A;  3AFK A;  4QDS A;  4SBV A;  3BKZ A;  3ZVX A;  2GMM A;  4YPJ A;  3R4U A;  4XIL A;  2VVE A;  4LXL A;  2DBN A;  1Y7B A;  3O0X A;  4GAZ A;  4BK4 A;  3O1M A;  1ZA7 A;  1OPO A;  4FAG A;  2R30 A;  3ZYJ B;  1DQ6 A;  2ZX1 A;  2C5D A;  1W03 A;  1FMD 1;  1RJ7 A;  2VUC A;  3VBR C;  4DXT A;  5JZG C;  1JZ4 A;  3KVB A;  3MEP A;  3P3P A;  4E2G A;  3KQR A;  1FPN 2;  3VBH A;  4C1X A;  1MS9 A;  1W6P B;  2OPK A;  4UFI A;  1JUI A;  1MQT B;  2IUW A;  3Q8E A;  3VBO C;  4OQ8 A;  2Y0I A;  3S5A A;  4HN0 A;  1MS0 A;  1X82 A;  3J7N A;  4GD4 A;  4YWA A;  3ZXF A;  3O7O A;  3WY6 A;  1V00 A;  3J4U H;  4Y33 A;  4Y1Z A;  4EN9 B;  1R1A 3;  2W5F A;  1F4H A;  2BVB A;  4YNI A;  4I0B A;  4N9I A;  5J3U A;  2MEV 2;  5FZG A;  1ASJ 3;  2VY0 A;  1BK0 A;  4XAE A;  3N9L A;  2HWB 2;  4PIY A;  4XVH A;  1PHM A;  5HXV A;  1FMD 2;  3I3E A;  1JU4 A;  4KU8 A;  2OT7 A;  4NRP A;  4R4X A;  4WM8 B;  2E33 A;  3AMM A;  5AC9 2;  4G3Y C;  4UXA A;  4URA A;  3SH5 A;  3T08 A;  2WZP P;  4AI1 A;  3I49 A;  4LBQ B;  3UNP A;  1PO1 1;  2P6H A;  5A3M A;  2PXJ A;  2QQI A;  4R9D A;  1UY2 A;  1LOG A;  1D4V B;  3C7F A;  1PGL 1;  4S2F A;  3I2D A;  1LED A;  2IFR A;  2WSV A;  3CJX A;  3VKO A;  1JZ5 A;  2XBO 3;  1AR7 1;  1XNA A;  3LE0 A;  4N53 A;  3MID A;  2WN3 A;  1MEC 3;  4A7Y A;  4WM8 C;  1HRV 2;  2D6O X;  4JKM A;  4OCT A;  5BNN B;  4J6G A;  2VBD A;  3AM2 A;  1NOV A;  3POB A;  4LHL A;  1KJR A;  2VZT A;  2HWE 1;  5DZF A;  2NMO A;  3N7K A;  1YXW A;  1JOJ A;  1ND3 B;  3KGL A;  4IV3 B;  1C8M 1;  2FDI A;  1LGB A;  2WJS A;  3T2Q A;  1JYC A;  1MZF A;  1OLM E;  5KXC A;  3LPG A;  3WP3 A;  4ARY A;  3TN9 3;  1NQJ A;  1PX4 A;  5FV3 A;  2HWD 3;  4JGY B;  1QJF A;  1PK6 A;  3RPQ A;  2ZXQ A;  5FZM A;  2JDU A;  2AEZ A;  4XFH A;  4DY5 A;  1W9S A;  4JDM A;  4AVC A;  3GCW A;  2Z5W A;  3VD7 A;  5GZD A;  1GUI A;  4Z82 A;  5HCA A;  2JDK A;  2BGP A;  3AP7 A;  5FYY A;  1LTE A;  1IS4 A;  1WWY A;  3VBO B;  1UY0 A;  1Z7S 3;  3IDC B;  3CKH A;  2K9Z A;  1SLA A;  1PO2 2;  1ZRR A;  1AL2 2;  2D93 A;  1PM4 A;  1I6X A;  5KXD A;  3C8X A;  1AYN 2;  5IYY A;  1PK6 C;  4W65 A;  4CVU A;  5BNP B;  1R1Z A;  3FFZ A;  1QDO A;  2AEY A;  2DUQ A;  4XUP A;  3C7H A;  5G04 L;  1W8U A;  1L7Q A;  2AH2 A;  3HMY A;  2YV8 A;  3A0K A;  2B45 X;  2OUJ A;  4BIF A;  5F5A A;  2PHL A;  5FZ4 A;  1K5M B;  4CEW B;  2D97 A;  5I91 A;  3V0B B;  1BJQ A;  1FT9 A;  1H9W A;  3EHK A;  4LIV A;  4XE9 A;  1C5H A;  3LA3 A;  5IHR A;  4AI2 A;  4UF0 B;  3KS7 A;  3MDP A;  4IER A;  3R05 A;  4UBH A;  2EXJ A;  2JDY A;  1VBE 1;  2K2S A;  2R06 1;  2Y6H A;  4MSV A;  4YVW A;  3O1P A;  1RUH 3;  3AKS A;  2E9Q A;  2CAU A;  1EYB A;  4LTA A;  1MZ6 A;  3GHM A;  1CIY A;  3O0V A;  5F9T A;  1GIC A;  4M3C E;  4YW1 A;  1JYW A;  3U0Z A;  2CDO A;  1RUH 2;  3QLQ A;  4LKD A;  4KMQ A;  3DXT A;  2PLV 1;  2VOT A;  3O0W A;  4LE4 A;  3VDD B;  3CNA A;  2WT2 A;  2QQL A;  2EIC A;  3CHX A;  4XTP A;  3ZKU A;  4OMD A;  2ZX4 A;  5CFD C;  3ECQ A;  4IEV A;  4OI1 A;  4TN7 A;  1HQW A;  1L7R A;  2E32 A;  2FDJ A;  1IS5 A;  4B3N A;  1RUJ 1;  3WG2 A;  2VVF A;  4EJR A;  3T2P A;  3WDX A;  1POV 3;  4CU7 A;  2YC2 A;  3BTX A;  1REE A;  3JU9 A;  4YVS C;  3H9A A;  2BPA 2;  2DWR A;  4YZ4 A;  1UIK A;  5J48 A;  5JVV A;  4LNV A;  2ZMN A;  3U4X A;  4M0H A;  1AR9 3;  2ERF A;  2HWC 3;  1HKD A;  2W1U A;  4DEV A;  3DV8 A;  1RTV A;  1J3P A;  2R06 2;  2WT0 A;  1H4H A;  1SDD B;  5C5U A;  4BCU A;  3PU3 A;  1Z7S 2;  5J96 B;  4QX0 A;  3SEE A;  1GZW A;  5T5L A;  3GM8 A;  4HPK A;  3RZG A;  3J26 N;  1LU1 A;  4S2D A;  1VP6 A;  2E7A A;  4RR3 B;  4UBG A;  1FOD 2;  2RM2 3;  2VH9 A;  1HV1 A;  2X5I B;  1VRH 2;  5HXM A;  4AOC A;  3R4D B;  2V5D A;  2OQ6 A;  4CDW B;  2YC0 A;  4XW3 A;  1J58 A;  1QNY A;  3RZZ A;  4XJW A;  2FCV A;  1APN A;  3USS A;  1RMU 1;  3POW A;  4UI9 L;  2BP6 A;  4KG0 A;  3U14 A;  1R08 3;  2JE9 A;  2ARA A;  3E5X A;  3M7A A;  2DU0 A;  4UFK A;  4JVA A;  5JR7 B;  5C70 A;  4MVT A;  4Q0Q A;  3M1H A;  4KWL A;  2WQ8 A;  3I59 B;  4KWU A;  3ZYF A;  2DF7 A;  4WVZ A;  1Y9M A;  1BYH A;  1G8W A;  5EWS A;  1U12 A;  2GND A;  5C33 A;  2A6W A;  4E27 A;  5D21 A;  3D0S A;  3OYW B;  1UYY A;  3A0N A;  2PEL A;  4WVM A;  1RIR A;  1CPN A;  2RR1 1;  3UJQ A;  2QQO A;  4P14 A;  5CNA A;  3EJK A;  3LKJ A;  2R49 A;  4FPO B;  2RS1 1;  1RUG 3;  2RVA A;  2UWC A;  4XUR A;  3I8T A;  4GH4 A;  3VBF B;  2VCB A;  3FBM A;  4RR3 A;  5KHK A;  2FD8 A;  1KS4 A;  1WKY A;  5IVB A;  5I8S A;  1OUS A;  1EAH 3;  3MYX A;  4IE7 A;  4LUL A;  5FZ7 A;  5LBE A;  4E2S A;  5IK5 A;  3AZW A;  1W2U A;  1IQA A;  5FZO A;  3VD4 A;  3ZFE C;  1RMU 2;  2IFW A;  4BQ1 A;  4BH9 A;  1JW6 A;  3JXS A;  1ZRE A;  2OX0 A;  2SBA A;  4MXV A;  5DAX A;  4IEX A;  1G9B A;  4YSF A;  1OI6 A;  5JR2 A;  4Z92 B;  2P3J A;  5E8A A;  4QMA A;  1UQX A;  5BYN A;  1RUF 1;  1QXR A;  2UY8 A;  3HNB M;  4URT A;  5DUX A;  5IK7 A;  2TBV A;  3K2O A;  5F3E A;  2DVF A;  1CX4 A;  4HK9 A;  3U07 A;  3VHO A;  1S2K A;  5A80 A;  2BNO A;  4GMP 3;  1PVC 2;  3GJA A;  5EJ1 B;  3V0A B;  3S30 A;  1DGW A;  3NNF A;  2WIN B;  2PHD A;  2FZ1 A;  1CES A;  3GBG A;  4DY3 A;  1GP4 A;  1GQH A;  1HRI 1;  4KBB A;  5BXX A;  1AR9 2;  3JUU A;  1OOP A;  4PIX A;  2Z69 A;  3VDD C;  4IND A;  2J1V A;  2W2I A;  5F5C A;  3ZM8 A;  3BUC A;  5DXD A;  5A7W B;  3ZX7 A;  1DDL A;  2ZKL A;  2Y0O A;  3I2H A;  4RHV 2;  5CAZ A;  1MVQ A;  2QE3 A;  5KR7 A;  1NCQ C;  4MHR A;  2FDG A;  5B4X A;  4JCK A;  4QQH A;  3CBN A;  3ZYB A;  3OEA A;  4XJA A;  4L92 A;  4FPH A;  1UU4 A;  1KDK A;  3IPV B;  1NQD A;  2XUM A;  5F39 A;  1LHN A;  1NA1 C;  4H3W A;  3ITQ A;  4UW6 A;  2GNT A;  4XFB A;  4D69 A;  2XDV A;  2ZGO A;  3USU A;  3VBU C;  1QKQ A;  4YM3 A;  4ZXK A;  4I01 A;  3I3B A;  2CWM A;  4Q4Y 1;  4XXA A;  5EJ3 A;  1UOF A;  1ZBA 3;  1NZC A;  5CZK A;  1MS8 A;  3N7L A;  1GZ9 A;  4XUQ A;  2YGM A;  3O1R A;  3HBZ A;  3K4A A;  3N9N A;  1W9W A;  3M4F A;  3FLT A;  2OKX A;  2RDR A;  1OPM A;  5GAL A;  1X8E A;  1Z78 A;  3CEW A;  3NJV A;  3ZSM A;  1TMF 3;  4K8F A;  5A6Q A;  3GZU C;  3BU0 A;  1JYN A;  1ND2 C;  1DU3 D;  1O3T A;  3KV4 A;  2YRO A;  3WG3 A;  2YDE A;  3TEY A;  3HNY M;  2GN3 A;  2ZGL A;  5FYB A;  2W1W A;  1GOF A;  4BLI A;  4C1W A;  3JD7 3;  2IXH A;  1VBA 3;  4XJ8 A;  3NNJ A;  2LW8 A;  1DQ5 A;  2RS3 1;  3NNG A;  3OD4 A;  3ZYH A;  1H8T A;  1LHW A;  1PO1 3;  4LHK A;  4RS5 B;  2C9K A;  5EYY A;  1PVC 3;  5T55 A;  3POJ A;  4F83 A;  5L7O C;  2RJL A;  4N90 A;  4DXR A;  1VBB 2;  4U2A A;  1IPK A;  2AZ5 A;  3RS6 A;  2JDA A;  4CP9 A;  5JOZ A;  3WDU A;  5IW0 A;  1QWR A;  3H8R A;  1H2N A;  1AX0 A;  1BBT 3;  1W8Z A;  4EV0 A;  1KQR A;  5AC9 3;  1JOB A;  4MXW A;  4OHW A;  3TNQ A;  3G7D A;  2JB8 A;  2VUD A;  2WNO A;  5T54 A;  4GQ7 A;  2OZ6 A;  4HOO A;  1MVE A;  2ZML A;  4L97 A;  1JYI A;  1C1L A;  3ZXJ A;  2J7M A;  3DEM A;  1RB8 G;  3PHM A;  3ZFG B;  3D8C A;  3I2K A;  2B46 X;  3CJI A;  4Q0V A;  1N1T A;  1KGY A;  1QOO A;  4AGG A;  4DFS A;  5ABJ A;  4AVS A;  4YW2 A;  5JIA A;  5A6X A;  3MIC A;  4R4Z A;  4GWN A;  2DTW A;  5FYU A;  3WNK A;  4EN0 A;  2VZ3 A;  2ZA9 A;  4LHS A;  3NV3 A;  4RFT 0;  2FCU A;  2WN2 A;  4QQL A;  5D2A A;  1FPN 1;  1DG6 A;  5FZF A;  4BB3 A;  3CZJ A;  1URX A;  2WAB A;  3O1T A;  3C2U A;  2XQX A;  5D8A B;  2VNO A;  2DUR A;  3ES1 A;  5HI0 A;  4AZZ A;  3ZN5 A;  1OQ1 A;  3DYP A;  2BV4 A;  4LKE A;  2VNV A;  5FAX A;  4B7E A;  1AVB A;  3ZN6 B;  4D8M A;  4GMP 1;  4I3P A;  5JSO A;  4NR1 A;  3HEI A;  4QPG B;  3PUR A;  4M4P A;  2PA7 A;  5FQ0 B;  1W6O A;  2CGP A;  1HRI 3;  5B4N A;  1WLD A;  4QHO A;  2WFP A;  4ZU7 A;  1BHG A;  1N3P A;  5FY0 A;  4LMF A;  2AEN A;  3M70 A;  1OKO A;  2A73 B;  2XLA A;  2XQR A;  1AR7 3;  4JGZ A;  1RUD 1;  4C8D A;  5JWP A;  1MEC 1;  4CUA A;  3D5O A;  1WGP A;  5JPN B;  4UW3 A;  1CGP A;  4BQ5 A;  3IMN A;  1E5I A;  2WNV C;  3GDB A;  4DPN A;  4D6Q A;  2G9G A;  4C0H A;  4FQ4 A;  1X50 A;  4YG6 A;  4JRL A;  2Y26 A;  1AHS A;  1UY1 A;  1V70 A;  5GZE A;  3T1M A;  1SMV A;  3WW1 A;  3WDT A;  1GYK A;  2P4E A;  3ROU A;  2QQP A;  4A3X A;  1RUO A;  3DPR A;  1PGL 2;  1RHI 2;  1C4R A;  3E5Q A;  1GZW B;  2ZGQ A;  5C71 A;  2C26 A;  4TLG A;  5GZF A;  1W6M A;  5C9A C;  1GWM A;  2PHT A;  1SEF A;  1D0G A;  3AYC A;  5FP4 A;  4AQ6 A;  4DRR A;  2UY9 A;  1YC6 1;  4YW7 A;  3O1O A;  1W90 A;  4KWJ A;  3SCG A;  3JQW A;  1TMF 1;  1ZRI A;  2RM2 1;  3H7Y A;  3JQX A;  4AI8 A;  4AHZ A;  1TZO A;  2HWF 3;  1LHV A;  3VBR B;  1MS4 A;  1RJ8 A;  1TME 1;  2BEO A;  4XFA A;  4RYD A;  3VZK A;  4EE2 A;  2WWS A;  5LW9 A;  3NAP B;  1W99 A;  3III A;  3BIW E;  3KGZ A;  1V6N A;  2W52 A;  4LO6 B;  4WM8 A;  4YZ1 A;  1QQP 1;  5DDJ 2;  3NO8 A;  2ZMK A;  4H14 A;  4YM0 A;  5EQU A;  3WR0 A;  1UL9 A;  4ES9 A;  1ZRC A;  3RZL A;  3ELN A;  4FFG A;  4FQZ A;  5DN2 A;  1RUI 1;  1U5Y A;  5LA2 A;  4I2O A;  5FMB A;  2A6Y A;  1QY4 A;  1W6Q B;  2WFF 1;  5A7S A;  3FLP A;  5A7P A;  1HV0 A;  5JXH A;  5KC5 A;  1OLQ A;  3PNA A;  4ZZ8 A;  5C9A A;  3AP6 A;  1OSG A;  5CYY A;  4LLF A;  3AB0 A;  3GBW A;  4ORF A;  2QZ2 A;  3SCF A;  5IVJ A;  2W1S A;  5IFP A;  2WZR 1;  4IE6 A;  4K9S A;  5E16 A;  5T3N A;  5AC9 1;  2CDP A;  4S2H A;  3ZXG A;  3T0A A;  4QU1 A;  4QD2 A;  4BQ3 A;  1ZBE 1;  3RMY A;  4NIH A;  1JZ7 A;  2BUK A;  3K75 B;  4NUB A;  1CIW A;  3BOD A;  2XVK A;  4GB3 3;  1EAH 2;  1OQE A;  4Q8L A;  3TOJ A;  3WHU A;  4HKO A;  4HON A;  2EID A;  2V72 A;  1PZ9 A;  1W6O B;  1FX5 A;  3A4U A;  1AR7 2;  3E6B A;  1QJU 3;  4IUG A;  4YGE A;  5FBJ A;  3VBO A;  3WF3 A;  2Y8K A;  4N43 B;  1SLI A;  5IAV A;  4UFH A;  2PHF A;  4N7I A;  5L36 A;  4NPM A;  5F7U A;  3VZL A;  3FZ3 A;  4HMZ A;  3W21 A;  3C7O A;  1RIN A;  2IXK A;  2RS5 2;  5F37 A;  1S0E A;  1V9U 2;  1OF3 A;  4IV1 A;  4NE9 A;  4B8E A;  4AFC A;  4R9C A;  3GAL A;  5IJR A;  3HN3 A;  2VEC A;  4LLO A;  5ERL A;  4CCM A;  2ZAC A;  4IV1 B;  3J7L A;  3GF6 A;  3KT4 A;  1UY4 A;  1XSR A;  3CIH A;  4MGI E;  5FMD A;  5K0U B;  2FHR A;  3RZM A;  2DCZ A;  3MV1 1;  5IT6 A;  1K5J A;  4EN7 B;  2FZ2 A;  4RGG A;  2IZW A;  1ODN A;  3QOP A;  4AHX A;  4BU2 A;  3MHZ A;  1EUT A;  3VLB B;  5FPL A;  3AL6 A;  2Q5T A;  4BHP A;  5C4W C;  1J84 A;  1R09 1;  1GR3 A;  1SDW A;  2PHW A;  2AAC A;  4D0Q A;  4MZU A;  4UAP A;  3D0J A;  3FX3 A;  2A6X A;  2XG3 A;  4FPC A;  5FP8 A;  2WWU A;  5T52 A;  1QXP A;  2W1Q A;  3P3N A;  3EBR A;  4B1L A;  4XC9 A;  1Y43 B;  1W6N A;  4JRA A;  2G9Z A;  1NLS A;  1O4Y A;  2YFU A;  3VN4 A;  4GXL A;  5FJH A;  4UYB A;  3ZO0 B;  5ACA 1;  2DV9 A;  5FMC A;  1RUG 1;  3POS A;  3WG4 A;  5EJZ B;  5I93 A;  2JE7 A;  3B69 A;  4NAM A;  3NVC A;  1COV 3;  1UMI A;  3ES4 A;  3H1M A;  3NJX A;  1VBD 3;  4IV3 C;  4IEW A;  1UCX A;  1G7Y A;  1XYN A;  4Q1P A;  4DMI A;  1SQ4 A;  3VL9 A;  4AVT A;  1V6J A;  1QJU 2;  1GQG A;  3WNL A;  5BNO B;  1VR3 A;  1J3Q A;  1H8T B;  4M3C F;  1PGS A;  4CUB A;  2DDU A;  1LOA A;  1QMJ A;  4K8R B;  1J59 A;  4Q0P A;  4AVB A;  2XJV A;  2WKK A;  5SV5 A;  1WMD A;  4IDZ A;  4FTS A;  3AJY A;  3TEZ A;  2FMD A;  3BPZ A;  1ONA A;  2BNM A;  2JE8 A;  1VBA 2;  3N3H A;  1XSQ A;  1G9F A;  4L8Q A;  1Y3T A;  4Y5S A;  1HDK A;  3EB7 A;  1GP6 A;  1VAM A;  4M0N A;  3T0B A;  4QPI C;  3I59 A;  5FIX A;  4N7U A;  5GZG A;  4AG4 A;  2QKD A;  4EZ4 A;  2QTW B;  2E7T A;  4QQ2 A;  3RGB A;  4BIO A;  1LCL A;  1VBB 3;  4P00 B;  1GOG A;  2Y64 A;  1WW4 A;  2R07 2;  2WFF 3;  1IG3 A;  2DCJ A;  2WNU A;  3CMG A;  2KD7 A;  1UZV A;  2B9U A;  2E53 A;  1BKZ A;  3TEX A;  3WD5 A;  4AED A;  3I3Q A;  2Q8E A;  4RQP A;  3T1L A;  1WBL A;  3OTF A;  1IGO A;  2WNU B;  4I0W B;  1W9Y A;  3WW3 A;  1BVP 1;  1FNZ A;  2GP5 A;  4QKD A;  3KT1 A;  5JAX A;  2IC1 A;  3K4Z A;  1UMZ A;  5LK5 A;  3T30 A;  1XC6 A;  5C8C C;  1W39 A;  3VZN A;  4PHZ A;  4CCD A;  2VM9 A;  5LAS A;  2A75 A;  2VUL A;  1O91 A;  4X8P A;  4QKF A;  4Y5T A;  1RUC 3;  3B3Q E;  3VD5 A;  4YFZ A;  1NXM A;  1WMX A;  4UW5 A;  4Z2A A;  2H0B A;  4OUL A;  4RN5 A;  5FQ0 A;  2UU8 A;  5HCB A;  1ODM A;  3DKQ A;  2XB6 C;  5FZI A;  5FRE A;  1I5Z A;  4XDQ A;  2VQ0 A;  2IWG B;  3C3V A;  4NMI A;  5DDJ 3;  1PMJ X;  1MR5 A;  5A7Q A;  4DXS A;  5LA1 A;  3H3U A;  2I45 A;  4LOR A;  5CFC A;  5A33 B;  2BGO A;  1RED A;  1QJX 2;  2H6B A;  5FYH A;  1W6Q A;  3KCY A;  5FKB A;  4IQP A;  1CZT A;  3N7M A;  1VPH A;  3OOX A;  4P5H A;  5K9Y A;  4XXP A;  5FTT C;  5FDB A;  1GU3 A;  1VBD 2;  3UV9 A;  4CXY A;  1W6M B;  2PFW A;  4L9B A;  3RG0 A;  4AEM A;  4AQS A;  1O7F A;  3NWK A;  2VTX A;  5FP3 A;  1CQ9 A;  5FPA A;  4UFM A;  3V0B A;  4AI9 A;  1DIW A;  2R04 2;  1WA6 X;  2R16 A;  4LIT A;  1ZA4 A;  4OHY A;  1HJF A;  3I2F A;  1BBT 1;  2WAA A;  1CAU A;  2A3W A;  2RS3 2;  4RSU A;  1V0A A;  1BMV 1;  2R7E B;  5K7P A;  2WO1 A;  4WVM B;  5FXW A;  3GZT B;  2BTV C;  2FBE A;  1C28 A;  4EN6 B;  2VUJ A;  4ATF A;  2XWJ B;  3NJZ A;  3OPT A;  1AR6 2;  4CP0 A;  1YQ6 A;  4OHV A;  3AZZ A;  1QJX 1;  3L2H A;  5FZH A;  3HOB A;  5FY9 A;  5DG1 A;  1BZW A;  4I02 A;  2XJT A;  4FPY A;  4LBM A;  5TSW A;  3RWN A;  1X8M A;  1YCI A;  3ALQ A;  2VGD A;  1LOE A;  4GWM A;  3SQO A;  4BQW A;  1U5I A;  1NT0 A;  1B35 C;  4YG0 A;  5FZ3 A;  1F9K A;  1MZ5 A;  2ZEY A;  4RHV 1;  1Q8Q A;  2XVL A;  4X6Q B;  5FJK A;  1RUE 1;  1XND A;  4YGC A;  5F3I A;  1VBC 1;  3AJZ A;  4FAH A;  2YBS A;  2VXJ A;  3ZFE B;  1KD7 A;  1ZZB A;  2EXH A;  1QXJ A;  4W4Z A;  2W95 A;  3CF6 E;  3ZDV A;  2XXZ A;  1GSL A;  4HSJ A;  2VBP A;  3JBG 1;  2WBK A;  4NRM A;  1E5H A;  1O5L A;  2YB7 A;  4FPJ A;  1J3R A;  1XNC A;  4CCJ A;  5JXJ A;  3SCH A;  3ORJ A;  5CFD A;  1PX3 A;  1ZZ6 A;  1HIX A;  3H3L A;  5E89 A;  1IZ3 A;  3ETP A;  3FBY A;  3ZFG A;  4GZ9 A;  3N35 A;  1Z7S 1;  2R6Q A;  4LO8 A;  2Q4S A;  1I5P A;  4CDU A;  1Q56 A;  1UX6 A;  4IW3 A;  3V0A A;  1RUE 2;  2XKO A;  5IK8 A;  4Q4V 2;  1EY2 A;  1UXX X;  4Y1X A;  1PIV 3;  5CG9 A;  5FMO S;  1VRH 1;  2G4I A;  2ZZJ A;  1DQ2 A;  3PVE A;  4EYU A;  2CYF A;  5C5T A;  2WA3 A;  3W59 A;  2QQN A;  5GZC A;  1GLH A;  1GFF 2;  5FY7 A;  5ABJ B;  2CL2 A;  4CDQ A;  3AMH A;  5LZ6 A;  2JG8 C;  1UO9 A;  2RDQ A;  2BGC A;  3PJQ A;  1POV 0;  1XU1 A;  3LDB A;  1O4T A;  2GME A;  2RJ2 A;  4XTM A;  4ZPI A;  2CGO A;  5FLJ A;  4BXF A;  4CA9 A;  3S0M A;  1OA4 A;  4CDQ C;  1VLN A;  5JOX A;  2XJS A;  3ABZ A;  5HCF A;  1C8N A;  1WLW A;  2WC2 A;  1VRB A;  2QQK A;  2XL7 A;  3LF7 A;  4NO4 A;  4AF9 A;  2BBA A;  1GNH A;  2VCM A;  2OXB A;  4LR4 A;  3PTR B;  4ZY9 A;  5JI7 A;  4ARX A;  1FYU A;  4PDW A;  1UF2 C;  3VBH C;  4L99 A;  2VAU A;  4LE3 A;  2OZJ A;  2HWF 1;  4XF0 A;  3ACF A;  1NKG A;  2X29 A;  5IVV A;  2UWB A;  1CAU B;  1X9P A;  2Y38 A;  4FFF A;  2CV6 A;  2LM3 A;  4YVS B;  2EIB A;  3ZFG C;  2HJI A;  4Z8B A;  1AYM 2;  5FLH A;  4RA0 A;  2VQA A;  2XJU A;  1V6O A;  2VZV A;  2ZEX A;  1G9C A;  3RI8 A;  1RVF 2;  5IAT A;  2J1T A;  2R07 3;  4GIQ A;  1JXN A;  4QX2 A;  2WA4 A;  5FXZ A;  5T5O A;  4ASK A;  4BQ2 A;  1NCQ B;  1TMF 2;  2BNN A;  1XJA A;  2WS9 3;  5IVY A;  5CIR A;  2D40 A;  1OUX A;  2YGL A;  3ZPY A;  5FPU A;  2A71 A;  2YY1 A;  3FN9 A;  2VTF A;  2YFZ A;  2VOV A;  5L9B A;  4QGN A;  2X5I A;  3LAG A;  5A3O A;  4D3W A;  3RZH A;  1YEW A;  5FZ8 A;  3O12 A;  1A6C A;  2BDR A;  3WP4 A;  1X36 A;  5LRR A;  4B1M A;  5HPO A;  3ZDS A;  2D6P A;  2Y6L A;  3KMH A;  2RHP A;  3VD3 A;  1HRV 1;  2VMD A;  2RMU 1;  4A3Z A;  4CYD A;  5C3O A;  4PIZ A;  3CJI C;  4CE8 A;  2DUO A;  2GMP A;  1NXD 1;  1R1A 2;  1FAY A;  2VME A;  3BPS A;  4DUV A;  4FXG B;  3VKM A;  1T2X A;  3WSO A;  4G4F A;  5FR3 A;  3SMH A;  3AVR A;  3D4K A;  4XYX A;  1JOD A;  2W9X A;  3SIS A;  3WHT A;  1US3 A;  5EYX A;  2LTN A;  2X53 S;  3VGI A;  1LOF C;  4W50 A;  1VJ2 A;  4Q4Y 3;  2BU9 A;  3PUI A;  4YZ3 A;  3PUH A;  1WBF A;  2XOM A;  3ZR5 A;  2VQU A;  1CJD A;  2X5I C;  3TB0 A;  1LJ7 A;  1N3Q A;  3H1Y A;  4Q4Y 2;  1CD3 G;  3PMS A;  3O5S A;  2D5F A;  4HK8 A;  4HXC A;  3MFC A;  4TSV A;  4IEO A;  5GKA C;  3VBU B;  1TG7 A;  4XDP A;  2VZU A;  5A1F A;  4UFJ A;  1NE6 A;  2MEV 3;  1AYN 1;  4A45 A;  2WS9 1;  5E1R A;  3UES A;  3ACG A;  3UGH A;  3W58 A;  2Y6J A;  3Q8C A;  1OD5 A;  1YUD A;  2FDH A;  5CEH A;  1EP0 A;  1V9U 1;  2HYX A;  3ZFF B;  4LBL A;  1IHM A;  1SZB A;  3HWJ A;  1YJK A;  2V5Y A;  1BEV 2;  3OD0 A;  2P5B A;  1O59 A;  3PUQ A;  1S0I A;  4QPI B;  1E57 A;  1YRZ A;  4A44 A;  5BNP C;  1H1A A;  3PIG A;  5IVF A;  1D4M 1;  2LS6 A;  1UOG A;  3OYW A;  1PIV 1;  3WX5 A;  1W05 A;  1W9F A;  3OEB A;  3TN9 2;  4XFF A;  3WP5 A;  1Q5O A;  4K1Z A;  2R06 3;  2WSU A;  4QX5 A;  4BM8 A;  5CB7 A;  4ZKT B;  1WA4 A;  3KCC A;  3OGG A;  2IXL A;  4F7Z A;  1PM7 A;  4QM9 A;  2XHN A;  1OLM A;  1UOB A;  1QIQ A;  2ZGK A;  1SLC A;  3DYO A;  1RUC 1;  3PJY A;  4OYU A;  3K3O A;  3ASI A;  5D1I A;  1HXS 3;  1PNG A;  2DCY A;  2Z42 A;  4I3G A;  1W8W A;  1WW6 A;  1QJE A;  2KA3 A;  1DGW X;  2LAL A;  2NN8 A;  2W94 A;  2XWB B;  3QD6 A;  4ITC A;  3TAY A;  3RI9 A;  3WG1 A;  3H50 A;  1PK6 B;  3OBR A;  3M8L A;  1LGC A;  1A34 A;  2WZR 2;  4XCA A;  1OVS A;  2CSG A;  4XZU G;  1NA1 A;  1VB2 A;  1MQT C;  1RC6 A;  3T4V A;  1BEV 1;  3JD7 2;  4OUS A;  4COW A;  3N9M A;  5JI9 A;  2Y60 A;  3LD8 A;  3UET A;  4NHY A;  4NHM A;  5BNQ A;  3M3E A;  1ULO A;  1DYP A;  1ULC A;  2C0Z A;  2VD7 A;  4DQA A;  2VW1 A;  1UY3 A;  3B9C A;  3NW4 A;  4V2V A;  4XF3 A;  3E5U A;  3OBZ A;  4JGY C;  3WDW A;  1DHK B;  4CDU C;  1YYN A;  4XBQ A;  1ZBA 1;  4B4R A;  2Y6K A;  2MEV 1;  3U1X A;  1OA2 A;  5F2W A;  4P02 B;  1PO2 1;  1AL2 1;  2BQP A;  2CTV A;  4FFH A;  1JI6 A;  4Q4X 3;  4JZR A;  1OOP C;  4C0B A;  2XML A;  1Q8P A;  1VAV A;  3M3I A;  4TXW A;  1LOC A;  1REF A;  1H0B A;  4HL0 A;  4WM7 C;  2ZHM A;  3P6B A;  5GM0 A;  3THD A;  3KM5 A;  4AYU A;  3GGL A;  4H7M A;  3V65 A;  4A6S A;  1IKQ A;  3FFQ A;  3ZN6 A;  1J1L A;  3I3D A;  4RQP B;  1HQL A;  1LU2 A;  2DVB A;  3PL0 A;  4K1Y A;  2VBB A;  5H9R A;  3T2O A;  3VL8 A;  1SPP A;  3JD7 1;  2XBO 1;  3HIF A;  2JX9 A;  4C91 A;  1ZZ9 A;  1R08 1;  2DFC A;  1SCS A;  3OY8 B;  4Y22 A;  3MIB A;  4KQ7 A;  1YFY A;  4XJ9 A;  1H2M A;  3L2Y A;  1XU2 A;  1XXN A;  1EV1 3;  4CDX A;  3N9P A;  5H9P A;  1GWK A;  2DUP A;  2CGN A;  1RUH 1;  1WW5 A;  2PLV 2;  5LK7 B;  3PVB B;  1LEC A;  4FOQ A;  4FXK B;  4K40 A;  4L2N A;  1ZX5 A;  5JXI A;  1ND2 B;  3O1V A;  3KSC A;  3E6D A;  3RVH A;  5LCW L;  5A3P A;  3PIJ A;  2W3J A;  5M0T A;  2Q1M A;  2BER A;  3SLI A;  4A41 A;  3WUD A;  2GP3 A;  3D6E A;  1IS6 A;  4Q27 A;  3Q8B A;  5I0U A;  2ZHN A;  4IGO A;  5C4W A;  3WNP A;  3A22 A;  3AKP A;  3VZO A;  5K0U C;  4Q0S A;  4IEZ A;  1L7L A;  4OFG A;  3UKV A;  3ZR6 A;  1KS5 A;  3VKL A;  5F3C A;  1G9D A;  2V73 A;  2WQ4 A;  3ACH A;  5LEJ A;  1XE7 A;  1XNT A;  4JX0 A;  4CUG A;  4Q4X 1;  1ASJ 1;  5F6L B;  4LBJ A;  4UT5 A;  1D2S A;  1DQ4 A;  4CCL A;  2BRT A;  1UYZ A;  2R32 A;  3KLS A;  4R52 A;  2RM2 2;  2XUE A;  3LA2 A;  3T09 A;  3OCP A;  1W2A X;  3IIA A;  1WUV A;  3SXW A;  5JSR A;  1CPM A;  1KJL A;  2ZHK A;  2F4P A;  2PYT A;  1CAV B;  1RXF A;  3FHI B;  4RS5 A;  3WEZ A;  1N1V A;  1W8N A;  4E8D A;  1SLT A;  3CDZ B;  3KV6 A;  2D6N A;  4E8C A;  1FI2 A;  5BPX A;  2PHR A;  2HYK A;  5FK8 A;  4CZS A;  5BNN A;  2C6S A;  1CAW B;  1QOT A;  1YJL A;  2DBI A;  4MGZ E;  3WZ1 A;  4OI4 A;  4D7S A;  4EWE A;  4LBK A;  4WZC A;  4BPZ A;  5FYZ A;  3AFG A;  4DZG A;  3UGG A;  1RMU 3;  4NIA A;  3EXU A;  4NWV A;  1I1E A;  1LGN A;  2QCS B;  5GJ6 A;  2UUR A;  2NQY A;  2ETE A;  1RUJ 3;  3UGF A;  4HET A;  4ISQ A;  3A23 A;  3URF A;  4AFM A;  4HN1 A;  3THP A;  2R1D A;  1UPI A;  3ZFF C;  1BBT 2;  5T5J A;  3WNN A;  4AVA A;  2C9A A;  1JYX A;  2NP0 A;  5C8C A;  1JHJ A;  1JZ2 A;  4Y4R A;  2HBU A;  4HFS A;  2XR4 A;  2ZJC A;  4LPL A;  5F5Q A;  1ULE A;  1N1Y A;  1UKG A;  3I2J A;  4IEU A;  5CIS A;  2RS1 2;  4LOT A;  2HWD 1;  2RR1 3;  2O0O A;  4CU8 A;  1DFQ A;  3C7G A;  3CJI B;  3J7H A;  2OS2 A;  1AR8 3;  2L9L A;  3FL7 A;  4DO0 A;  2DVD A;  1EAH 1;  1V6I A;  1OKQ A;  3POY A;  3AYD A;  3FE5 A;  4QB2 A;  3DF0 A;  3VBH B;  3RRD A;  1DCS A;  3JZV A;  4XIO A;  4ONU A;  4IET A;  2JDP A;  2J1A A;  2EIG A;  3U4S A;  2GC3 A;  1AXY A;  3KCX A;  2JDZ A;  4O9E A;  1OT5 A;  4Q1R A;  1N3O A;  5A3L A;  3MO4 A;  2E26 A;  4J1X A;  4DOU A;  1H6X A;  2G1M A;  2RS5 1;  4D94 A;  4XQW A;  3SH3 A;  3POF A;  4MLO A;  2FMY A;  3IPV A;  4LUK A;  3DUI A;  3OJB A;  1DGR N;  2VO5 A;  3IAQ A;  3PUA A;  4LOS A;  5A1L A;  4FP3 A;  5C3R A;  3ACL A;  2EF6 A;  4XFC A;  2C1F A;  1UKR A;  2JG8 A;  3OUH A;  3OB8 A;  5FPX A;  4QAW A;  4ZU5 A;  1LKN A;  5AVA A;  1HXS 2;  4HVQ A;  1NLQ A;  3KHC A;  3W5M A;  4AFB A;  2PAM A;  4HVO A;  4LBO A;  1S0D A;  3OY8 A;  1YFU A;  4Y22 B;  2JJ6 A;  5CVR A;  2GNM A;  3GBF A;  1H2L A;  1O8S A;  4CUC A;  4OQ9 A;  4BJ0 A;  4DB5 A;  1TME 3;  3JB8 A;  1VMF A;  2ORZ A;  3WP6 A;  2C24 A;  3ZPO A;  1TNF A;  1ENS A;  5C4W B;  1OFS A;  4FPK A;  2XL9 A;  5BNP A;  2OUH A;  1IPS A;  2ARB A;  3EYP A;  4QB6 A;  4S2G A;  4BLJ A;  3ZYP A;  2BWC A;  4CDU B;  1V6M A;  4P9J A;  1SBF A;  4MXW B;  3DL3 A;  1K45 A;  4Z1V A;  1AR8 1;  4HT1 T;  4YZ5 A;  3FHA A;  4KBZ A;  1N1S A;  3ENR A;  2D3P A;  3UL2 A;  5CKM A;  2ET1 A;  1GZT A;  3TYJ A;  4CU9 A;  5FKC A;  5DQ0 A;  4Y5Z 0;  3WNM A;  3PME A;  3T3Y A;  2HEV F;  2ADD A;  4GA9 A;  2ZGN A;  5FZE A;  1OH3 A;  3VBS A;  3VHR A;  1EUU A;  2QQW A;  1PZ8 A;  2HWF 2;  1A8D A;  4WVV A;  1OD3 A;  4UFL A;  5GLU A;  2H6C A;  3LOB A;  1XRU A;  2JDH A;  2P2K A;  3WV6 A;  4E2Q A;  3DYM A;  5JUV A;  3PU8 A;  1UZY A;  3HQU A;  1DZT A;  4IV1 C;  3SNM A;  1QJX 3;  4AI0 A;  1QGL A;  2ES3 A;  2BVV A;  2GAU A;  2JDN A;  4IES A;  4ZS3 A;  5F3G A;  3UK9 A;  1JMU B;  5DAQ A;  4IGQ A;  1QDC A;  3ZSL A;  5JOW A;  3HT1 A;  3DKW A;  3OGV A;  4GWI A;  1K3I A;  3I54 A;  1GP5 A;  5FZL A;  4QPW A;  2D5H A;  1AX2 A;  1GAN A;  4YW5 A;  2X8K A;  3OF1 A;  1SAC A;  1XE8 A;  2I07 B;  4O65 A;  4LKS A;  3THT A;  4PT6 A;  5L73 A;  2C4X A;  4XHB A;  2XJQ A;  4W6X A;  2PMW B;  3P1I A;  2UYA A;  3VBS C;  3KT7 A;  3B02 A;  4PF5 A;  4QXB A;  1ULF A;  2PHU A;  4UOJ A;  1RHI 1;  1CX1 A;  3ZXA C;  4AEK A;  2PN5 A;  2GC2 A;  2XON A;  5FYV A;  2VMI A;  3WDY A;  3OUJ A;  2JD9 A;  5EHD A;  2GH2 A;  4MHU A;  4CXW A;  5FOB B;  2J1U A;  2JG8 B;  1YFW A;  2Y33 A;  4DRV A;  1AL2 3;  5CFC C;  1Q8O A;  2AYH A;  3N7J A;  3X29 B;  3LSE A;  1AL0 G;  4KI5 M;  1LAJ A;  2F4L A;  3G6J B;  4Y3O A;  3WQB A;  1CZS A;  2YC4 A;  4EWA A;  3N9Q A;  1JOP A;  4NN0 A;  4G9S B;  1QJZ A;  4XF9 A;  3MGU A;  3NV1 A;  4MET A;  1HJG A;  3PUS A;  4UF0 A;  4Y1Y A;  5K8S A;  2NM1 A;  2VOK A;  1KRI A;  1AUY A;  2DVG A;  1QH7 A;  3MV0 1;  5I0D A;  1YLL A;  4IEP A;  4AHW A;  3O1U A;  1W06 A;  3LIG A;  3OPW A;  3HT2 A;  1W6P A;  3R4S A;  4KNC A;  4MGK E;  3NKG A;  2GDF A;  4PDW C;  3ZYI B;  4DUW A;  1ND2 A;  2JIG A;  5FYC A;  4ISR A;  1LUL A;  2ARC A;  2CNA A;  4UWD A;  4KWK A;  3MLJ A;  4FOV A;  2D44 A;  4O9G A;  1G86 A;  5LBF A;  2O8Q A;  1FAT A;  5FXX A;  4LUM A;  4NIG A;  1BLZ A;  5CBL A;  4CCE A;  5DUV A;  2HWE 2;  1LRH A;  2OVU A;  2JIC A;  1ZYB A;  4CDX B;  4DS0 A;  3VBU A;  4GJY A;  5LBB A;  4F3J A;  1OBN A;  2HWE 3;  5L19 A;  3H7J A;  1BCX A;  4KU7 A;  4M3C A;  5I0T A;  3OGJ A;  3NNL A;  5A7O A;  2ID4 A;  1D4M 2;  5L9R A;  4LQR A;  3Q9O A;  1PIV 2;  3ZMN A;  4XET A;  1QJY 1;  2OII A;  1GV9 A;  3TN9 1;  2CAV A;  5GLZ A;  2OW4 A;  1TQ5 A;  5ANN A;  1MZE A;  5EXO A;  1OHF A;  4FI9 A;  3SKV A;  4P08 A;  4XUN A;  1XYO A;  3RZK A;  2JB4 A;  1OFN A;  2XVG A;  4AHY A;  3V64 A;  1IOA A;  2PHX A;  3HQR A;  4Q0U A;  1R64 A;  4ZU4 A;  5DAP A;  3VDB A;  2H0V A;  2JDM A;  4JGZ C;  1SLB A;  1YIP A;  3ZN4 A;  4JDN A;  1UNB A;  2ZEZ A;  3ILR A;  4N53 B;  1R1A 1;  3SH4 A;  1FOD 3;  3KHB A;  2YXS A;  1YI7 A;  2ZKN A;  4YYO A;  3ZXK A;  3USU B;  3ZYR A;  5JCT A;  1LOD A;  2VL4 A;  3CLP A;  4M01 A;  5KC6 A;  1JTZ X;  2JEM A;  2N7G A;  1BQP A;  3ZFF A;  1KIT A;  2VZO A;  4IV3 A;  2RS3 3;  3BU7 A;  4IEY A;  4XJU A;  1SCR A;  3MIE A;  2J1R A;  3JBG 2;  3POE A;  4KH9 A;  1GOH A;  4OMC A;  3TWI A;  2KM2 A;  3B7M A;  2YBK A;  1UXZ A;  1AR6 3;  1O3R A;  1W28 A;  1H9P A;  3V56 A;  1WCU A;  3BGA A;  2WO2 A;  2Q8D A;  2ZS6 B;  3POG A;  2PAK A;  1D2Q A;  3OGR A;  1B35 B;  1OOP B;  4TZD A;  3UJO A;  5LWB A;  2WS9 2;  3WNO A;  2GU9 A;  3M3O A;  3IB3 A;  4RS5 C;  3I2G A;  1RXG A;  1RUJ 2;  2PAE A;  2WZE A;  4CCK A;  4YLZ A;  4ZXE A;  5C3Q A;  1QJY 3;  1O8P A;  1RL3 A;  2TUN A;  3D3A A;  4LIU A;  5LRS A;  3B9I A;  3HQX A;  4QGL A;  1AJO A;  1STM A;  2VZP A;  3OGS A;  3I2I A;  4WZF A;  5AVP A;  5A1A A;  5CAD A;  3W5N A;  1LB2 A;  5KXE A;  3ZSE A;  4D7Y A;  1RUN A;  4OHZ A;  1FV2 A;  3BN6 A;  5JXG A;  1UYX A;  3O14 A;  2BYV E;  3RYR A;  4FTE A;  1ENX A;  5LBC A;  4XQ4 A;  5K0U A;  3LGR A;  4HKW A;  5DG2 A;  1O5U A;  4YVW B;  3ZLI A;  1RUC 2;  5KHI A;  1G9A A;  3KZ4 C;  1HN0 A;  1LEM A;  4LA2 A;  1IG0 A;  2RS5 3;  5FZ9 A;  1Q3E A;  3VDA A;  2Z2S B;  4LBQ D;  4A6O A;  4QQP A;  3CQO A;  4GH4 B;  5A3U A;  3K4D A;  1WD3 A;  4Y24 A;  3PVO A;  5FBZ A;  1SBE A;  2A3Y A;  2BOI A;  1I9R A;  4BXS V;  1UOJ A;  2WNV B;  4NHX A;  1K12 A;  3U11 A;  2XLF A;  3B01 A;  5KHG A;  1TE1 B;  1S0J A;  4XUO A;  1UZ0 A;  4BE3 A;  1WCK A;  3AKR A;  4AW7 A;  1OC1 A;  4FBF A;  3UKN A;  4LK7 A;  4BMB A;  4DUX A;  4HKL A;  3LZZ A;  2JKX A;  3QH6 A;  2QQM A;  2QNK A;  5DUU A;  5JSP A;  1ULD A;  4E4Z A;  5CFD B;  4C90 A;  2QDN A;  4M00 A;  1MS1 A;  2XPJ A;  3S7I A;  1JH5 A;  3H1W A;  4DIQ A;  5FY8 A;  1AJK A;  2AUY A;  1BEV 3;  3T0D A;  4COZ A;  4BIS A;  1BXH A;  3KV5 A;  2W92 A;  2HEY F;  2XBO 2;  2WNU C;  2YU1 A;  4GB3 2;  4K3U A;  4YW4 A;  4B4P A;  3TBD A;  4NHL A;  5FYS A;  2VZR A;  3Q8F A;  2E31 A;  5ACA 3;  3F2Z A;  5AFE A;  3I3M A;  5FPZ A;  1V6L A;  2YPJ A;  4PF1 A;  1NY7 2;  4XBN A;  2D6L X;  1PO2 3;  5DMY A;  3H8O A;  1CAW A;  5FP9 A;  4P9I A;  4PI2 A;  1F31 A;  1ENQ A;  4GAL A;  4QPI A;  1ZM1 A;  3WUC A;  2JD4 A;  2HLE A;  2Q30 A;  5IVE A;  3WXP A;  2R0F A;  1FOD 1;  1RIT A;  1DLC A;  2WRA A;  1LEN A;  4QKB A;  3UKT A;  2VZS A;  3AZV A;  5JOY A;  1YNA A;  4QXK A;  4COY A;  4QXC A;  1T6G C;  5I0R A;  5C3P A;  2BBV A;  1LES A;  2VUA A;  5J1X A;  4MGT A;  3WNX A;  2A7A A;  4Q8K A;  1CAX B;  2P3I A;  1PGW 1;  1NYW A;  3K48 A;  1RUI 2;  1TVG A;  1OVP A;  1AYN 3;  2YU2 A;  3EQE A;  3MIG A;  4FPL A;  2WFF 2;  1R09 2;  1X9T A;  4XHX A;  4AXO A;  3O1S A;  4IEQ A;  4V2W A;  4L11 A;  4QX1 A;  3R6S A;  1IS3 A;  2R07 1;  3A21 A;  1S55 A;  4AEJ A;  1S0B A;  1VAK A;  3SC7 X;  5A32 A;  1XPW A;  4LK6 A;  2BFU S;  4B29 A;  2FDK A;  5BY5 A;  1HX6 A;  4AED B;  4YZ2 A;  3B94 A;  4JTN A;  1JYV A;  3M2M A;  1FXZ A;  1UX7 A;  5EP9 A;  1Z0H A;  1ZBE 2;  5BUV A;  2OQ7 A;  4HAN A;  3KV9 A;  4N43 A;  4MG2 A;  5C6C A;  2QQJ A;  5IAX A;  5FWJ A;  1Y4W A;  1AZD A;  5HV4 A;  1H1M A;  4MGY E;  4E4D X;  5CKN A;  1PGW 2;  3ME2 A;  5FYT A;  4CPB A;  5CG8 A;  4NJ4 A;  5ISL A;  1QJU 1;  2BW8 A;  3T4H B;  4IE5 A;  2VZQ A;  1S2B A;  2HWB 3;  4QX8 A;  3AC0 A;  2TNF A;  1LOF A;  5BNO C;  5J7M A;  4PQQ A;  4GMP 0;  4SLI A;  3OG2 A;  5FWE A;  1X33 A;  4LBN A;  3I7D A;  4AQT A;  4D6R A;  3JBG 3;  4QHZ A;  3AKQ A;  4I30 A;  2ENR A;  2HH9 A;  4Y26 A;  3WF1 A;  1Y9G A;  5ABJ C;  1G6N A;  1PNF A;  4PCR A;  3AX4 A;  1CZV A;  1BK1 A;  2ZCW A;  3LEM A;  3IKW A;  4IXL A;  5LY2 A;  1KEX A;  2D6K A;  1YFX A;  1KFU L;  2GC1 A;  4D6S A;  1VBE 2;  1YWK A;  3ATG A;  5FRA A;  4OZO A;  4FOY A;  3IBM A;  1H1I A;  3VKN A;  1B09 A;  3CZU A;  4WVW A;  5T5P A;  1F5J A;  1E5R A;  4P9X A;  3TRS B;  5C7G A;  3MLK A;  2X10 A;  4Y1V A;  1LHO A;  4Q2F A;  5FZ6 A;  3RJR A;  1DQ0 A;  3KF3 A;  3AVS A;  4LO7 A;  4MGQ A;  4QGM A;  1U5Z A;  2Z4F A;  2JG9 B;  1ZRD A;  4LEJ A;  3VBR A;  1XNK A;  4BME A;  5IFT A;  1VMH A;  3AYE A;  3HPN A;  3RNS A;  1IQD C;  1HB4 A;  1OXC A;  1VE0 A;  3C7E A;  5L7O A;  1YQ5 A;  4B7K A;  5JMO A;  5BNO A;  2VMF A;  4BK5 A;  3S57 A;  2AC1 A;  2CU5 A;  3GZA A;  3LA7 A;  1UZW A;  4JV4 A;  4M4R A;  4CXX A;  3WQ7 A;  3ILF A;  2W68 A;  3LEK A;  5EV7 A;  4AVV A;  3RSJ A;  4MOA A;  2LUW A;  2BZD A;  2NYY A;  4ERO A;  1OMI A;  2EAK A;  1UIJ A;  2DVA A;  5FLI A;  4OI0 A;  1UWW A;  3MPB A;  3GCX A;  4BYY A;  4XBL A;  2J22 A;  2BFU L;  2RDN A;  4MH0 E;  5F1R A;  2EVX A;  1O4Z A;  1VAL A;  4N43 C;  3VUO A;  2D7F A;  4FFI A;  4NII A;  3LFI A;  4AGR A;  1DLL A;  2Q1F A;  1RUE 3;  2RJK A;  3AMP A;  4BWO A;  5A70 A;  2BJS A;  3FMG A;  1ACC A;  4J1W A;  4Q4V 3;  4FT8 A;  3BB6 A;  2ZHL A;  1Y9Q A;  4RFR B;  1EPZ A;  1VBA 1;  2QUO A;  4JC1 A;  1QU0 A;  5E88 A;  3VHP A;  4IE4 A;  3ZIW A;  2QVS B;  4Z07 A;  4LJH A;  3F95 A;  1MPX A;  5JZG B;  1AR8 2;  1WLT A;  2ZBJ A;  1QOS A;  2NPI A;  5F6K A;  1VBB 1;  3BAL A;  3FHQ A;  1RUD 3;  1NCR B;  4HZF A;  3MW4 A;  5FZB A;  5IWF A;  4Q4W 3;  1J1T A;  1H6Y A;  1ND3 C;  4R9A A;  1F4A A;  4K21 A;  3AKT A;  4AL9 A;  1MS3 A;  3WLU A;  1GMM A;  1QNW A;  4IE0 A;  3DEC A;  5DAB A;  3QAC A;  3THC A;  3RJ2 X;  3SEP A;  4QT6 A;  2W39 A;  5JDB A;  1HB2 A;  5J09 A;  1ALY A;  2B5H A;  4KL1 A;  2RR1 2;  4V1P A;  1J83 A;  4HVR A;  2E51 A;  1D7P M;  2IVI B;  2A5Z A;  3AMQ A;  5FYI A;  3I2O A;  2ATF A;  1OA3 A;  4B4Q A;  2QQV A;  1HW5 A;  4XEZ A;  3ZXL A;  2ARX A;  3HJR A;  4E9K A;  1M4W A;  5FY5 A;  5T50 A;  4RHV 3;  4GUL A;  4Y20 B;  4RGA A;  5FZK A;  1W8O A;  4TYS A;  3MLL A;  1IPJ A;  1UW8 A;  2R1B A;  5FUP A;  1OUR A;  5LB6 A;  3N4M A;  4N53 C;  1W2T A;  2WO3 A;  3N9O A;  1W0O A;  2VE1 A;  4XUT A;  5ANQ A;  4CDQ B;  1RUF 2;  4E4S A;  1D0H A;  3FUQ A;  1NA1 B;  3NQH A;  2XJP A;  3BYW A;  3I4I A;  4XZP A;  5IUQ A;  1QJY 2;  1AF9 A;  1DGR A;  1FPN 3;  4XF4 A;  1QQP 3;  4RD7 A;  4K7J A;  3NJY A;  2QQU A;  3BTZ A;  4QQO A;  4YM1 A;  1ULP A;  2G9F A;  2KR2 A;  3JB4 C;  4BQY A;  3WF0 A;  2OPW A;  3ZXE A;  1W2N A;  4BDV B;  2WDB A;  1W8F A;  1RVF 3;  1SFY A;  3I97 A;  2YBP A;  3LIH A;  2E63 A;  4XAC A;  1R09 3;  2BOJ A;  1XOY A;  5EFU A;  4A7K A;  3HD8 B;  1PMI A;  3WF4 A;  4X6R B;  4YAR A;  1DBN A;  3GHN A;  4DIN B;  2ZAH A;  4NID A;  1UU6 A;  3CU7 A;  2ZAA A;  4XFG A;  3WDV A;  3ZOI A;  2O1Q A;  2BWA A;  1RUD 2;  2YMZ A;  2WZR 3;  3LPF A;  5KHH A;  1HQN A;  3HAG A;  4XFI A;  3WIN E;  2FQP A;  3LFM A;  3J7M A;  4R8H A;  4FVV A;  4IGP A;  1AXZ A;  4QKN A;  3S7E A;  4H7L A;  2WQZ C;  4OVE A;  2CY6 A;  4WM7 B;  4ZZ5 A;  2RV9 A;  3NST A;  2P34 A;  1ZBE 3;  3ILN A;  2DYC A;  2GSY A;  1JS9 A;  4FPG A;  4FO9 A;  2LRO A;  1NE4 A;  1XB9 A;  4CP2 A;  1T6B X;  4YM2 A;  1NCR A;  2NMN A;  2B42 B;  4JKK A;  5C9A B;  3GYD A;  3LB9 A;  1A78 A;  5LA0 A;  1GZC A;  3HR9 A;  2ZGU A;  4AFA A;  5JZG A;  2X05 A;  3VKF C;  2D3R A;  3ETQ A;  2YPD A;  1RGS A;  3ST7 A;  4CCN A;  2DFB A;  2QDR A;  4GJZ A;  1UN1 A;  3WW2 A;  3RYK A;  1HRV 3;  2D3S A;  1VBC 3;  2B4K A;  5B2G B;  3WF2 A;  1S1A A;  1H4G A;  4W6Y A;  4EZH A;  2ZOE B;  1SG3 A;  1PZ7 A;  4KGQ A;  1YQC A;  2WWJ A;  3RWK X;  1ZZ7 A;  3K51 A;  3K46 A;  4P9L A;  3MIH A;  5I8T A;  4ZS2 A;  5A32 B;  1W8T A;  2QZ3 A;  1O3Q A;  3E97 A;  2GC0 A;  2RS1 3;  4OLL A;  5HV0 A;  2VOW A;  2B8M A;  3U75 A;  1AYM 3;  5DPN A;  1QQP 2;  3GJB A;  1EV1 2;  3IAP A;  5DDJ 1;  3MZH A;  1RVF 1;  3B5L B;  1ZBA 2;  4NAO A;  4QDR A;  3UT0 A;  2Y34 A;  3KQ4 B;  5C3S A;  1QEX A;  2DU1 A;  3AL5 A;  4YVS A;  4FCA A;  4RGK A;  3FLR A;  2K46 A;  4QHB A;  1UMH A;  1UZZ A;  1RUI 3;  5SV8 A;  5I0S A;  1TEI A;  1YQ8 A;  2VNR A;  1NX9 A;  4AGV A;  4QX7 A;  1SBD A;  4WM7 A;  4XPV A;  1RUF 3;  5GLT A;  3MW3 A;  4YW6 A;  2YUE A;  2ZGS A;  4ASM B;  4Q4W 1;  3IDB B;  1AX1 A;  4YGD A;  4LA3 A;  3ZMO A;  4A2U A;  2D98 A;  3L9J T;  4MYE A;  2VMG A;  4AED C;  4Y1U A;  4FP2 A;  3TEW A;  1POV 1;  1RUG 2;  2WR9 A;  4NPL A;  1R08 2;  1JZ3 A;  2PQQ A;  3IDA A;  4QU2 A;  3GZE A;  2KXL A;  2FDF A;  2ZTN A;  2VU9 A;  2B7Y A;  4ZON A;  1CR7 A;  4FPF A;  2JWP A;  3ZIX A;  1COV 1;  1NCQ A;  1SLL A;  3FJS A;  3MF9 A;  1XE0 A;  4COU A;  4CP9 B;  5BV6 A;  2EAA A;  2NZ9 A;  5EIY B;  3H8X A;  4LO5 B;  3NV2 A;  4MAD A;  2IXI A;  1S4C A;  1M06 G;  5LEK A;  4CDW C;  2VR4 A;  3WQ0 A;  1HN1 A;  5FXV A;  3FWE A;  3NRU A;  2AGS A;  1TME 2;  2MNG A;  2MPF A;  2WL1 A;  4QB1 A;  1K5M A;  4X8N A;  4CEW A;  3BIE A;  1PMH X;  2P3K A;  2W87 A;  3VBF A;  5I8Y A;  2WO7 A;  3VZM A;  4JQT A;  5F8P A;  3J8F 2;  1CJP A;  1DQ1 A;  2A6Z A;  5J36 A;  1PO1 2;  1U5X A;  5GLV A;  1WD4 A;  3SIT A;  3MUY 1;  4BOW A;  2W08 A;  1JZ6 A;  1ZVF A;  4H2A A;  2ARE A;  1ZNP A;  2VC9 A;  1XYP A;  4Z2W A;  1JBC A;  4N9H A;  3OPZ A;  2DTY A;  3BI3 A;  5DZG A;  3HVD A;  3VHN A;  2EA7 A;  2V09 A;  2WZ8 A;  4U36 A;  5GLW A;  3DXU A;  1XBF A;  4O7X A;  3WVJ A;  2B39 A;  3LQC A;  4JQR A;  3H3Z A;  5KXB A;  2VXR A;  1MAC A;  3FC0 A;  3INA A;  1WZX A; 
#chains in the Genus database with same CATH homology
 2ZEY A;  3GM8 A;  3LEI A;  5HXM A;  1GQP A;  2V5D A;  2ID4 A;  4LQR A;  4W4Z A;  2W95 A;  2WBK A;  2J1E A;  4UI9 L;  2YB7 A;  3SKV A;  4FI9 A;  4P08 A;  5JXJ A;  4XUN A;  1PX3 A;  3ETP A;  5C70 A;  1R64 A;  2WQ8 A;  3VDB A;  4KWU A;  1LNS A;  4GZ9 A;  1WCQ A;  2ZEZ A;  1I5P A;  1P8J A;  1UYY A;  1UXX X;  2QQO A;  2VL4 A;  3HNM A;  3SKJ E;  4XUR A;  2RVA A;  2VZO A;  2VCB A;  2QQN A;  1WKY A;  4OMC A;  2J1R A;  1GOH A;  1UXZ A;  2RJ2 A;  3VD9 A;  4OUE A;  3JXS A;  1W9T A;  2WO2 A;  3BGA A;  3ABZ A;  5JR2 A;  2QQK A;  3OGR A;  2BBA A;  3MBW A;  3WNO A;  4ZY9 A;  4ARX A;  3HNB M;  3IB3 A;  3I2G A;  2WZE A;  1JU3 A;  4ZXE A;  3ACF A;  1NKG A;  4QX3 A;  3ACI A;  5EJ1 B;  1O8P A;  3D3A A;  4JKL A;  2VCC A;  2EIB A;  2VZP A;  3I2I A;  3OGS A;  5A1A A;  3W5N A;  2VZV A;  2ZEX A;  2B9V A;  3BN6 A;  2J1V A;  5JXG A;  1UYX A;  2J1T A;  3ZM8 A;  2PQS A;  4QX2 A;  3I2H A;  4A4A A;  2W47 A;  5B4X A;  3OBA A;  3OEA A;  3VDA A;  4A6O A;  3FN9 A;  2VTF A;  3CQO A;  2YFZ A;  3K4D A;  4L0P A;  2VQT A;  4BXS V;  4QDQ A;  5G05 L;  1K12 A;  3I3B A;  1OF4 A;  2YG0 A;  5CZK A;  2VMC A;  4XUQ A;  5HPO A;  4XUO A;  1UZ0 A;  3K4A A;  2Y6L A;  1W9W A;  2W46 A;  2OKX A;  3VD3 A;  3NJV A;  2VMD A;  4A3Z A;  4A42 A;  4DUX A;  1JYN A;  2JKX A;  2QQM A;  2VME A;  3K77 A;  4DUV A;  1T2X A;  1YQ2 A;  3HNY M;  3WSO A;  2W1W A;  1GOF A;  2W9X A;  1US3 A;  2LW8 A;  4W50 A;  3NNG A;  3SEE A;  3T0D A;  3PUI A;  3PUH A;  2C9K A;  2XOM A;  2VQU A;  2W91 A;  2W92 A;  2VZR A;  4DXR A;  1TG7 A;  2E31 A;  2VZU A;  3F2Z A;  2JDA A;  4PF1 A;  4CU6 A;  5DMY A;  4A45 A;  2VJX A;  3UES A;  3ACG A;  2Y6J A;  2WAO A;  2HYX A;  2HLE A;  4AAX A;  1DLC A;  1O59 A;  4A44 A;  2VZS A;  2LS6 A;  2J7M A;  4ET7 A;  3OEB A;  3I2K A;  4DEQ A;  2XHN A;  1KGY A;  2ZEW A;  1TVG A;  3DYO A;  4OYU A;  3WNK A;  2W94 A;  2VZ3 A;  4QX1 A;  4LHS A;  2WN2 A;  2VCA A;  3A21 A;  3CZJ A;  2WAB A;  2XQX A;  1XPW A;  4JHZ A;  1GNY A;  1DP0 A;  3DYP A;  4XZU G;  1UX7 A;  1OH4 A;  4D8M A;  3UET A;  1ULO A;  2ORX A;  4TTG A;  3HEI A;  1UY3 A;  2QQJ A;  4M4P A;  5B4N A;  3E1F 1;  1BHG A;  1US2 A;  2Y6K A;  4P02 B;  2VZQ A;  1JI6 A;  4CUA A;  3AC0 A;  1JZ8 A;  4TXW A;  3GDB A;  4PQQ A;  2EIE A;  3A7Q A;  3P6B A;  3THD A;  3GGL A;  3OG2 A;  4MO3 M;  1UY1 A;  2DCK A;  3I3D A;  3WF1 A;  3T2O A;  1NAE A;  3VDC A;  1CZV A;  5C71 A;  2C26 A;  2WYS A;  1KEX A;  2QBX A;  4OZO A;  4HG6 B;  2X09 A;  3CZU A;  1DYO A;  5C7G A;  2X10 A;  3MUZ 1;  5JXI A;  4RYD A;  1W0N A;  5LCW L;  1NUK A;  1W99 A;  2WUH A;  3III A;  4MGQ A;  4W8J A;  2W3J A;  2BER A;  2Z4F A;  4A41 A;  5IFT A;  3WNP A;  3HPN A;  3A22 A;  2J1S A;  1IQD C;  3C7E A;  5JMO A;  2VMF A;  3ACH A;  5DN2 A;  5LA2 A;  4BK5 A;  4P5Y A;  4M4R A;  1XNT A;  3U37 A;  3LEK A;  4JX0 A;  5JXH A;  4MOA A;  2BZD A;  4ZZ8 A;  4GWJ A;  1UYZ A;  5CYY A;  5IFP A;  1UWW A;  2W1S A;  3T09 A;  2J22 A;  1K42 A;  5FUI A;  2CDP A;  3T0A A;  3WEZ A;  4E8D A;  1W8N A;  3CDZ B;  4E8C A;  2Y6G A;  1JZ7 A;  3K75 B;  3LEG A;  1MPX A;  2EID A;  2V72 A;  1JYV A;  2VZ1 A;  3FHQ A;  4IUG A;  4MGS A;  3WF3 A;  2Y8K A;  3A23 A;  1H6Y A;  3GXU A;  5F7U A;  1F4A A;  3WNN A;  3C7O A;  1JYX A;  1GMM A;  3THC A;  3DEC A;  3SEP A;  1JHJ A;  1OF3 A;  1JZ2 A;  1RYY A;  4LPL A;  1J83 A;  5IJR A;  1D7P M;  3HN3 A;  3I2J A;  4CU8 A;  2V4V A;  3C7G A;  1UY4 A;  3CIH A;  3J7H A;  3HJR A;  1SHW B;  2L9L A;  3FL7 A;  3MV1 1;  4QDS A;  4YPJ A;  1W8O A;  4QB2 A;  4BK4 A;  1EUT A;  1J84 A;  5J1X A;  4D0Q A;  4UAP A;  2J1A A;  4DXT A;  1JZ4 A;  2WO3 A;  4XUT A;  1OT5 A;  3MO4 A;  2E26 A;  3NQH A;  1H6X A;  2W1Q A;  2VO5 A;  2YFU A;  3IAQ A;  1ULP A;  5EJZ B;  3WF0 A;  4BDV B;  2WDB A;  3OB8 A;  3I97 A;  4QAW A;  1UMI A;  3W5M A;  3WF4 A;  3NJX A;  2W5F A;  1F4H A;  4CUC A;  1O8S A;  3LPF A;  3WNL A;  4BJ0 A;  4XVH A;  3I3E A;  2ORZ A;  1JU4 A;  4CUB A;  2DDU A;  2E33 A;  4ZZ5 A;  2RV9 A;  3T08 A;  3EYP A;  4QB6 A;  2JE8 A;  3UNP A;  3EB7 A;  2QQI A;  1K45 A;  3T0B A;  1UY2 A;  3C7F A;  4JKK A;  4AG4 A;  3FHA A;  5LA0 A;  1JZ5 A;  1XNA A;  3LE0 A;  2WN3 A;  2X05 A;  4CU9 A;  4P00 B;  1GOG A;  4JKM A;  5DQ0 A;  2Y64 A;  2DCJ A;  3WNM A;  2VZT A;  3CMG A;  2B4K A;  2KD7 A;  3WF2 A;  1EUU A;  1SG3 A;  3T2Q A;  3K46 A;  1OD3 A;  3LPG A;  4ARY A;  5JUV A;  3DYM A;  1PX4 A;  3VD4 A;  2ZXQ A;  1W9S A;  3K4Z A;  5DPN A;  3VD7 A;  3IAP A;  1XC6 A;  1GUI A;  2BGP A;  2VM9 A;  1UY0 A;  4QDR A;  3CKH A;  4GWI A;  3OGV A;  3VD5 A;  1K3I A;  1UMH A;  3C8X A;  4QPW A;  4Z2A A;  5IYY A;  1NX9 A;  4CVU A;  4RN5 A;  4LKS A;  4XUP A;  3C7H A;  4PT6 A;  5G04 L;  2C4X A;  1L7Q A;  3P1I A;  1PMJ X;  4DXS A;  5LA1 A;  1CX1 A;  4UOJ A;  1JZ3 A;  2BGO A;  3IDA A;  2XON A;  5IHR A;  1CZT A;  2JD9 A;  2Y6H A;  2J1U A;  1GU3 A;  5EIY B;  1JYW A;  1CIY A;  4MAD A;  2CDO A;  4KMQ A;  4KI5 M;  2VOT A;  2VR4 A;  1HN1 A;  2QQL A;  3NRU A;  2EIC A;  3WQB A;  1CZS A;  2YC4 A;  4QB1 A;  4OMD A;  1PMH X;  3ECQ A;  2W87 A;  3I2F A;  1L7R A;  2E32 A;  2WAA A;  3T2P A;  2R7E B;  3MV0 1;  5I0D A;  2WO1 A;  3MUY 1;  4CU7 A;  1JZ6 A;  2YC2 A;  2VC9 A;  4DUW A;  3HOB A;  2W1U A;  2WZ8 A;  4DEV A;  1SDD B;  3LQC A;  4QX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...