4P9JA

Crystal structure of rabbit ryanodine receptor 1 spry2 domain (1070-1246)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
180
Chain Sequence
SNADRVRIFRAEKSYTVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ryanodine receptor 1
publication title Crystal structures of wild type and disease mutant forms of the ryanodine receptor SPRY2 domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 35
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4p9jA00
4P9LA 4X8NA 4P9IA 4N7IA 4N7UA 4WVMA 2IWGB 5JI7A 5C33A 2FBEA 5JIUA 2YUEA 4P9JA 4KG0A 2E63A 4B8EA 4V1PA 5F6KA 5JI9A 4X8PA 2VOKA 5JIAA 3KB5A 3TOJA 3UV9A 4XW3A 4WVMB 3ZO0B 2WL1A 5F6LB 4QT6A 4B3NA 2LM3A 2YYOA
chains in the Genus database with same CATH superfamily
3JBG2 2E7AA 4KNCA 2GNBA 5DUWA 5A3MA 4ZU5A 5H9RA 4E4SA 2OUJA 4QXHA 1AYM3 4MADA 4XFGA 4XURA 5H9PA 4CCEA 2XQXA 1W6QA 1JUIA 1KJRA 3AP5A 3ELNA 2UYAA 4AFBA 1GP6A 4OUEA 2P6HA 1HRI3 1YIPA 1RTVA 5AC93 3QOPA 1RUF3 4OULA 3GZEA 1JYCA 3N9NA 2RHPA 3TN93 4WBBA 1QXPA 1JYIA 4C90A 2P17A 4LPLA 3VBFB 2A6YA 4UW4A 3ZKYA 4CEWA 4XVHA 5J1XA 2WT1A 1L3JA 1ULDA 1H2NA 1HN1A 3EHKA 1PO22 1QIQA 1JXNA 1QMJA 2HWF3 3GHMA 1SFNA 3OGSA 4XFHA 2ZGUA 4CE8A 1W2OA 2ADDA 1DLCA 3PTRB 4ET7A 5IATA 2FDJA 1FPN3 1BEV3 4CCNA 3N36A 4XCBA 3S57A 1GR3A 1K5MA 5KHHA 4LQRA 4X6QB 1W6NB 3D6EA 2Y6JA 4G3YC 1DBNA 4NIAA 3FX3A 3LPFA 1BHGA 1XNCA 5JPMB 3HEIA 3VZNA 5JOWA 4EN6B 2R071 4Y3OA 2P2KA 3WZ1A 1UQXA 2ZGPA 4LLOA 1A6CA 2D6LX 4OUSA 2XVKA 5E8AA 2BOJA 4JVAA 1SACA 5JZGC 5CG8A 1C8M1 1WCDJ 4IXLA 4L97A 1RVF1 1SLTA 4AEDC 5BNPA 3ZYGA 3CEWA 4YM2A 1ZRRA 3W5NA 2LRPA 3HNYM 2VZSA 5FZ1A 1W6OA 1QKQA 3MO4A 1O3QA 1MACA 1F15A 1ND3C 2Z69A 3DXUA 3LB9A 4LA2A 4S2HA 1ZREA 1LKNA 1S2KA 1OH3A 4KG0A 2HJIA 1PNFA 3CF6E 5F6KA 5BXXA 1W99A 4D3WA 4ZKTB 2WT2A 2CGNA 1Y43B 1IPJA 4XQ4A 1W90A 3I2DA 4NN0A 4XC9A 1VRH2 2DVFA 3DKQA 4Z07A 5EFUA 1W2NA 4A7YA 4Y1VA 1UX7A 2IC1A 1H30A 4P14A 4YRDA 1WLCA 4YG3A 1V9U3 3NAPA 4QU1A 3TEZA 4EN9B 3RZKA 3B02A 2XQRA 4JV4A 4QHOA 1I9RA 2C6SA 5T55A 4FAHA 2XL9A 1JYVA 3RGBA 5C8CB 4DRRA 4BXSV 3WW3A 2Q5TA 2ZX0A 3VLBB 3WG1A 3R05A 3LSDA 1MS9A 2OKXA 1XE8A 3Q8CA 3WF0A 1AR92 2VVFA 3RYKA 1GWKA 2JG9B 1N1VA 1V6LA 4KBZA 1L7RA 3NAPB 5D8AA 3L2YA 2GP5A 2FCVA 4LBQA 1ZBA2 2Q0AA 3UV9A 4LBKA 5AFEA 1S0BA 5HCHA 1FAYA 3AKSA 1MQTC 4CRQA 2FCTA 2QTWB 2ZHLA 2E51A 4E4DX 4INDA 3WF3A 2P4EA 1LECA 5IVFA 2RG4A 1XRUA 3PHMA 5IK7A 3HN1A 3WNXA 2PLV3 4RGGA 5IUQA 4CCOA 5LK7B 1V6KA 4UF0B 4LHSA 1YRZA 4BK5A 4D7TA 5D8AB 2IXLA 3IWZA 4CCDA 5IK5A 1I5PA 1NE6A 3LDKA 3PUHA 4HKOA 4DUXA 1H2LA 1TNRA 5A1LA 2WZEA 2JD4A 2OZJA 4Y26A 4JKKA 2RDQA 4QAWA 3ACLA 4D6QA 4QPWA 4FAGA 5FXWA 3UK9A 1RITA 3LZZA 4O7XA 3AZZA 3VHNA 5A3UA 3V0AA 4FOQA 2Q1MA 2QQJA 5C4WA 1ODNA 1ZM1A 3CMGA 2Q8OA 2RE9A 3KMHA 4BA6A 5CKMA 3RWNA 5F1RA 2VNOA 2YPDA 3PMSA 1GQPA 1E5SA 3IDAA 4YVSB 2VZUA 2YBPA 1W2UA 4D7SA 4XBNA 4IL7A 2ZGMA 2J42A 1WCSA 3VBRB 3V0AB 1NLRA 3AC0A 3VBSC 2JX9A 1VE0A 2VZQA 4NR1A 5F2SA 3H8OA 1W0OA 1K12A 3ETPA 1JI6A 3MIGA 4XW3A 5FPAA 5ACA2 1LULA 5FZHA 1C3HA 3AYEA 4XFBA 4XILA 2Y60A 3E5UA 3VDCA 4LO6B 3RSJA 5DZGA 1IHMA 1ZZBA 2DCTA 5CFDA 2Q8CA 5T52A 1EAH3 4WVMA 3WQ1A 5L9BA 5L7OA 3W5MA 2PYTA 3WVJA 1HN0A 2XHNA 1PVC2 3LAGA 4YW3A 2WAOA 3IAPA 2VCBA 2WWJA 1OA3A 2NYYA 2WYFA 2VO5A 3J8F3 4UFIA 3FLTA 3LQCA 5HCFA 3MW4A 1JZ3A 1DP0A 3L2HA 5FIXA 2W08A 5GZEA 1N3QA 3ZYFA 5IHRA 4I0AA 4LORA 2VVDA 3IKWA 1NA1A 2DVDA 2XBO1 2Y6LA 1WCUA 5FY7A 3O1VA 1BBT2 4A44A 3E6CC 5GKAC 1W05A 1W9SA 4TLGA 4EWDA 3S7IA 5CFDB 3OGJA 1H9PA 4RS5C 2AGSA 2VMGA 3O12A 4WVMB 1DGRN 4GH4B 4FPFA 2JB4A 1JZ5A 1AYM1 1D4M2 3RMYA 4QX5A 2ZX4A 1AVBA 2PHWA 2X5IC 5DUVA 5FP7A 3DPRA 4COYA 1TMF3 3POBA 1QJU2 3U14A 1Z78A 4BQ5A 1IS3A 2WO3A 1POV0 2ZKNA 4LEJA 4AI9A 3C7OA 4K3UA 4ZS2A 1HRI1 3NW4A 3VBOA 1IQAA 1OPMA 2Q30A 3RZMA 1C28A 4HSJA 5AC91 1RUF1 3FLRA 4CEYC 1VLNA 2V4VA 4CCLA 1W9TA 2PFWA 3TN91 5K8SA 4OHZA 5FWEA 4LKEA 2DF7A 1H2MA 1ST8A 3HVDA 2EIDA 1CD3G 2GZWA 3H3LA 3THCA 1POQA 3ALQA 4Q0PA 5I8SA 2HWF1 2VBPA 1JOBA 4FFGA 4LITA 5FZOA 4D0QA 2YROA 2ZXQA 1FI2A 1FPN1 1BEV1 3GZAA 1Q8PA 5CIRA 5CFCB 2XOMA 2K2SA 2AH2A 4K20A 1OA2A 5C5TA 2B9UA 3PNAA 4C1WA 1ZZ7A 1HXS3 1LENA 4LT5A 4AOCA 3KVBA 3A0KA 5A6ZA 3AKTA 2WS92 1AR73 4AR2A 1A34A 1SG3A 2ZEZA 3MV01 3PIGA 4LLFA 4LBLA 4E4HA 5CEHA 5LZ6A 4XUPA 2I2SA 3H1MA 2XJPA 2YXSA 5FZOB 3USUB 5BNNA 1RUE3 1XOYA 2AREA 2XGXA 3O1SA 1DQ6A 1S0DA 3IMMA 4FPGA 3WR0A 3HIFA 3BUCA 4QQOA 2H6CA 1MS4A 3AKRA 3WDUA 1WLTA 1RUI3 2BV4A 2W91A 5FYSA 1R1ZA 4YZ1A 3JQXA 2MEV3 4XIOA 1WCQA 3DXTA 3IM0A 4XE9A 2VGDA 4Y20A 2AENA 4XTMA 2F4PA 2LALA 3NKGA 2VMDA 4Z82A 3PJQA 1CAVA 1KRIA 3N9OA 3N7KA 4TYSA 4CPBD 5K0UC 3P3PA 1R1A3 2ILMA 4I30A 3DECA 5C71A 1HDKA 4YWAA 5LBCA 4YNIA 4NMIA 5T54A 3NJXA 1E5RA 4N53C 2QQMA 2R49A 2CY6A 3C8XA 4H3WA 4YARA 1UO9A 4NHKA 1ZZ6A 1IS5A 2H0VA 4PDWA 3S6PA 4BQ4A 5A80A 1DZQA 5DABA 1ENSA 1BZWA 1CAVB 2E33A 1V6IA 3AK0A 3IPVA 4JCKA 2FBEA 2Q1ZB 3VBUC 4Y1ZA 3T2OA 1JS9A 2ZX2A 5FKCA 2VMCA 3WG4A 5C9AA 2HWC2 2XJQA 3EQEA 4YVWB 3U0ZA 4IETA 5G05L 3P6BA 2OA2A 5H9QA 1XYOA 4XFFA 1OA4A 3GHNA 5C5UA 4M4RA 1ODMA 2WSUA 1N47A 1VBA3 5JPNB 3AP4A 1GV9A 2GC0A 4BM8A 5ABJA 3OGVA 4Q0VA 3QCWA 2DBNA 2W5FA 1AYN3 3AXDA 3ZYIB 4AYUA 5KHGA 1CIWA 3LPGA 3UKNA 2J22A 1SPPA 1FMD3 1VBB2 2EAAA 2HWD3 5DQ0A 3ZLIA 1WLWA 5EV7A 5JR7B 3CJIB 2JICA 5C9AB 3ROUA 3VL9A 2GNTA 2VOXA 5JOXA 4QPIA 1IG3A 4JGYB 4NVPA 1CAUA 1DZTA 2ES3A 2PLV1 3K4ZA 1OQDA 4LIVA 3U10A 3OEBA 4BQ2A 2V5YA 4ZS3A 3O1MA 2Y8KA 1DF0A 2VZ1A 5I0RA 1F4AA 2QE3A 1X9TA 3B9IA 1NLQA 1R083 3MFCA 4AVBA 5KHIA 5ABJB 3HPNA 3MIBA 4Y24A 2A3WA 2RJ2A 3JXSA 1KITA 2IXJA 4UYBA 2CWSA 4R52A 1GNHA 3PURA 3ILRA 4CVUA 1PNGA 1SPPB 3QBQA 2RM22 2O8OA 4AVAA 2ORZA 3SKVA 1WZXA 4BH9A 4MGZE 4XTPA 1SEFA 4O9EA 4QD2A 4N43C 1AR63 2IXHA 3HR9A 3KT4A 4FPHA 5DUXA 4F8AA 2VTXA 2WZ8A 1AYM2 5EZWA 3ZPOA 3B01A 3PVBB 1RHI3 1TZOA 1GICA 3FJSA 3KT7A 3MF6A 3MGUA 2BYVE 3ES1A 1YI9A 4DS0A 1GNYA 3RJRA 4DXTA 1ULFA 3KHCA 2CDPA 1UZYA 1VBE2 3ZXFA 2PA7A 5A3PA 5F9TA 1ND2A 1VBC2 2HWE3 1W6MA 3MYXA 3WDYA 3BI3A 1TE1B 1MVEA 2D6PA 5B4XA 2ZHNA 3NL1A 5AC92 4HVQA 5IW0A 3VD7A 1ULGA 1UF2C 3AVRA 2JWPA 4PJYA 1W9YA 4B4PA 4RR3A 3NRUA 5IFPA 2HEVF 2ZA9A 2VOKA 1POV1 3ASIA 3TNQA 1APNA 1DQ1A 5T50A 2OQ7A 1O3TA 2DWRA 4NIHA 1WW4A 3S0MA 4BPZA 1BLZA 1L7QA 4QPGA 2ZPXA 1W6PB 3MLLA 1PK6A 3ZXDA 1FPN2 3EBRA 1ND2B 1SCRA 4OZOA 1CZSA 4CDUA 1DFQA 4EJRA 4LBMA 4OLLA 5C3SA 2ZEWA 4GWIA 5DAQA 3AL5A 4W4ZA 4CDQB 1UU6A 5CADA 2QUOA 4DY3A 1WWYA 2RS32 1BXHA 1LOAA 2W87A 3POWA 4IE6A 2JG8B 4N90A 1QF3A 4LK7A 4XMAA 5A1AA 2A71A 4XQWA 4QPGB 4YW4A 1KD7A 1KGYA 1PIV2 5F3EA 5K9YA 4J1XA 1XB9A 1P8JA 3ZXEA 2FQPA 5I93A 3ZN6A 5KXCA 1CAXB 2VD7A 3OBTA 2WFF3 5A7WA 1TMF1 4Y22B 4A3XA 2BPA2 2QVSB 5FYIA 4S2FA 3HQRA 1GQGA 3EMRA 5T5JA 4NAMA 4ASLA 4BIOA 3SISA 1IQDC 5JAXA 4AF9A 1VR3A 4AFMA 2YY1A 1LAJA 3B5LB 5FY1A 3IN9A 3ZFGB 1O5LA 5BNQA 2G19A 1OPOA 3GBGA 3UL2A 2YG0A 3WP5A 4AVVA 1X7NA 4DXRA 4FPYA 4MX3A 2A3XA 1UIKA 4Q29A 1V9U2 3W21A 4P02B 4PIZA 2J1SA 3AXEA 4Q0SA 2QBXA 2DUOA 2QDRA 5DDJ2 5EYXA 5F3GA 4CU6A 1JZ8A 2YGLA 2R1BA 3EYPA 4W6YA 4FSJA 3GALA 3GYDA 4WVZA 1XNKA 1HXS1 3I49A 1ULOA 1WW5A 1FATA 2XH6A 1RUG3 1SLBA 1Q3EA 4RHV3 2PHLA 1UY0A 1OURA 4HN1A 1AR71 4TXWA 5FPZA 4XDOA 5FYMA 4AQSA 3QD6A 4DXSA 5HV0A 4I02A 2EAKA 1MVQA 2WNUA 1JU3A 1URXA 4QGLA 4P9YA 2Z42A 4LR4A 2Z4FA 3RZLA 3OJBA 5A7SA 2B4KA 4JGZC 1ONAA 1S0CA 1RUE1 3RZHA 2B46X 1ZRIA 4PIXA 1PGL2 4ITCA 1GOGA 4GJZA 3I59B 4QDQA 1MEC2 3HAGA 5C3RA 1GBGA 4GULA 1FT9A 1PX3A 2QCSB 2R073 1V00A 3PUQA 1RUI1 4LMFA 5FMDA 3D0SA 4PLMA 1RGSA 3M3QA 2MEV1 3OTFA 1N1TA 4XXPA 1XSQA 3WNLA 4A41A 1KXGA 3UGGA 4H55A 3CQOA 4OHWA 4XF0A 1C57A 3Q8FA 4AI3A 2V72A 2GU9A 5GZFA 1EPZA 2CV6A 2SBAA 1C8NA 2W46A 5FCCA 4RGAA 4LHNA 4Q0UA 3M3EA 4AWDA 2ZACA 5H9SA 4YM1A 2R063 3ZIXA 2C24A 1LEDA 1KS4A 3FLPA 4Q4Y2 5I91A 1NX9A 3JCIA 3NJYA 3BPSA 4BQ1A 3HMYA 4OI0A 3BIEA 2BBVA 4QX7A 4UBGA 1RXFA 1Z7S2 2BZDA 2GH8A 5L73A 1M06G 4GIQA 3THTA 3O1OA 1U12A 1OFNA 1UIJA 2OXBA 2DU0A 3IZOA 3NNMA 4AHYA 3BGAA 2W95A 5FDBA 1OH4A 3M70A 4UFJA 1FNZA 2VECA 3NWKA 4OMDA 1OUXA 2XDVA 4LO7A 1VBA1 5GZCA 1RUC1 2E7QA 1UAIA 1W39A 3OYWA 4N8MA 4EQVA 3HN3A 1ULEA 1LHUA 4R4XA 1EV13 1W8FA 1JHNA 5IVCA 1AYN1 4AHXA 3H1WA 4F83A 3CBNA 1RUD3 1WMDA 5IWFA 1FMD1 2HWD1 4ES8A 1LTEA 1DYPA 1HB2A 5A7QA 1XNBA 1CZTA 2J1AA 4Y5TA 1WA6X 2WJSA 3UJQA 1I1EA 1S2BA 1EAH2 2Z79A 3ZN5A 2BEOA 4LO8A 4M3CF 5G04L 2W1SA 2HWB3 5FBJA 1DQ5A 1LGNA 3M3IA 2RS53 2G1MA 3OYWB 4BDVB 3J8F2 4LUMA 1EP0A 4NOTA 5FYYA 5JZGA 1HV0A 3B3QE 3PVOA 4HXCA 4I0BA 1BVVA 2DFBA 4AEDA 1UZWA 5DG1A 4Z1VA 1I5ZA 5SV8A 1XE7A 1J59A 5CZKA 1LNSA 1QEXA 2FMYA 1XXNA 1BJQA 1MZEA 4SLIA 4MUVA 5F8PA 1O4YA 4Q0QA 2XJSA 2NP0A 1X8MA 5CBLA 2DTWA 1ND3A 1XNTA 3OEAA 1ZZ8A 1XE0A 3LKJA 4Y5Z0 1UY1A 4JDMA 3K48A 3AP7A 4IE0A 5C70A 5FTTC 5CKQA 2Y0OA 4G4FA 3NVCA 3R6SA 2BFUS 5DAVA 4ISQA 1TMF2 1TG7A 1H4GA 2EXKA 3GBWA 1Q8QA 5GLZA 1B35C 1D0GA 4RFRB 4E8DA 4YW5A 3JZVA 1WMFA 4XEZA 3KVAA 3VKLA 1PGW1 4EYUA 5J98B 3LIHA 4QKNA 3P1IA 4PQQA 5F5CA 5ANNA 5K7PA 3MBWA 3WQ0A 4FP3A 4CXWA 1ND3B 4DIQA 1SBEA 2DCJA 2ORXA 4CU7A 3S7EA 4XFCA 1AR82 2LS6A 3V65A 3GJBA 4BCUA 2XUMA 2W68A 1Y9MA 3K77A 3KCCA 1SHWB 2JEMA 1FX5A 1TME1 2A6VA 1H8TC 4GKYA 4UWDA 1XYNA 4PLOA 4QXBA 2O1QA 3TNPB 2ZAAA 4XACA 2ZZQA 1SMVA 2A6WA 4EE2A 4WM8C 5E16A 1YXWA 4GB31 1VJ2A 2B8MA 3SH5A 1MQTA 4ORFA 1WLDA 2YDEA 3S5QA 2QZ2A 3WLUA 4B8EA 4LULA 5LRRA 2VTFA 4E27A 2JDMA 4Q4V3 3WF2A 2V5DA 1RUE2 5JXHA 2E31A 2HKXA 5DAWA 1ZBE2 3C7FA 4IV1C 4BYYA 5FYUA 1VBD2 5KWRA 4MXWA 3POFA 4Q1PA 4EN7B 1PZ8A 3LEIA 4JTOA 4COVA 1JODA 4H14A 4CYDA 1KJLA 2DBIA 5J48A 1DGWA 4BQXA 4RN5A 4XXAA 4M3CB 2JXAA 1YFXA 2BP6A 5ERLA 4GWJA 5EXOA 5F3CA 1CAWA 2Q8EA 4RGKA 1COV3 2VMFA 4CZSA 1QJY3 4O65A 1Q8VA 2FZ2A 1JYTA 2OUHA 2W47A 1R1A2 2VE1A 3UKVA 2XB6C 2JECA 5FZ4A 4GD4A 2VNVA 4LBQD 1AZDA 1MPXA 4E9KA 1ENRA 5A3WA 4MXWB 4LBNA 4A7KA 2E32A 1S0GA 3M2MA 4LKSA 1GZCA 4AQTA 1Y4WA 3BN6A 1ENQA 2PQQA 3INAA 3PU8A 5DZFA 1Q8OA 2J1VA 1W6QB 1MZFA 1J1LA 2DYCA 2VOTA 3KZ4C 1RUG1 4M3CE 1QH7A 4R9DA 4RHV1 3J7LA 5DPNA 3ABZA 3GJAA 2G9ZA 2WAAA 2QQPA 3VBSA 5KXDA 4FTEA 1H0BA 1SZBA 3PUAA 3RFRA 3ZYPA 4AAXA 1QJX2 5LASA 5FZBA 1WMXA 2XWBB 3RRDA 2WNEA 3KLSA 3A22A 1W9WA 2RMU3 4CCMA 3N35A 4NAOA 2EXIA 1FOD3 5A1FA 1HKDA 4AZZA 2QQKA 4CEWB 1W3VA 4DQAA 3I3QA 4LXLA 1IKPA 2PHUA 1AYN2 1LU2A 4SBVA 5CAZA 1Y9QA 1F31A 2E26A 3H7JA 2VJXA 3VBSB 1XJAA 3RZZA 1NUKA 2GNDA 4P9LA 2W0XA 3OD0A 3D3AA 1K5MB 3SH4A 1QOOA 3ACFA 1ULPA 4L99A 5KR7A 4XETA 4GJYA 4FTBA 1R082 4RS5A 1WBFA 2VZOA 3PDQA 3ACIA 1WCKA 2AEYA 3AFKA 5IYYA 2R061 2JIGA 2FZ1A 3BYWA 5FZEA 1GNZA 3H0OA 3DN7A 1YQ6A 5A7OA 2X5IA 4DB5A 4DUWA 3U75A 5BNOC 1GP4A 5FO9B 2VZTA 3DGTA 3N9LA 1QOSA 5LBFA 4KGGA 2Y6KA 1RJ7A 5BNPB 1AR62 5ISLA 1G9AA 4CEYA 4XBLA 3VZKA 1RHI2 2GMMA 4JC1A 3ZKUA 4IV3C 3F2ZA 1W6OB 2EVXA 4QM9A 4XF9A 4P5HA 1GWMA 3VBHC 3POSA 3WNPA 3KV5A 5EWSA 3AYDA 4XYXA 2YHJA 1ASJ3 2JE7A 4FOWA 2IVIB 2D3RA 2HWE2 2X5IB 4E2GA 2VQ0A 3AKQA 3ZIWA 5DN2A 1VAVA 2BRTA 1CONA 4HSLA 4KMQA 4BXFA 3NV1A 1AL22 3BALA 1EV11 3FL7A 3RG0A 4HK9A 5J09A 1ALYA 1R091 1S1AA 1RUD1 4XJZA 1VMFA 1QJFA 5F3IA 2DUPA 3KV6A 1IZ3A 2C1FA 3OG2A 1UKRA 2GNMA 3I3EA 3KB5A 3VN4A 2JE9A 2CWMA 3AM2A 3ZXJA 4YW6A 1DQ2A 4DMIA 4CDXC 3ZXLA 5F32A 1CPMA 3MIHA 1XNAA 2HWB1 4CUAA 1Y3TA 2RS51 1KFXL 3T1LA 1O3RA 4CUCA 3JD73 5L19A 3EJKA 1H8VA 1Y9GA 2OZ6A 4NPMA 2JE8A 2WO1A 1OC1A 2R043 4UFKA 2BGOA 2YC0A 4J25A 1RUH3 3B94A 4Q4X2 1LHVA 4LBQB 3ZFFC 2EA7A 4MYEA 5FOBB 1QQP2 1XBFA 4CCCA 1ZX5A 2EICA 1JU4A 4Q4W3 1O6UA 3RYPA 5FOJB 1HV1A 3UNPA 1C5HA 2BGCA 1VB4A 2GAUA 2WFF2 1N1SA 2WLQA 3GZTB 4HKLA 5K0UA 5L9VA 4CXYA 3BTXA 3BTAA 1G9DA 1U5XA 5FYBA 1XYPA 4MHUA 4JAAA 4L0PA 5FZ6A 3RDIA 3U11A 2X29A 2RVAA 4N53A 1EY2A 2ZEXA 1LU1A 2YFUA 3FBYA 1W28A 3OF1A 5GJ6A 1OXCA 3P5BA 1JBCA 1LHNA 1VAKA 2VZVA 4JDOA 1CPNA 4UAPA 3SC7X 3VBFC 4FO9A 3EXUA 4ZZ5A 3VBUA 2BDRA 3O14A 2BUKA 2RDSA 4COUA 3GXUA 3KV9A 4MVTA 5KXEA 2YBKA 3WHTA 2DVAA 4K21A 2GSYA 3LWCA 2C9KA 2JIJA 4LTAA 3SHRA 2GN7A 4QB6A 5C4WB 1RUOA 1POV3 2EALA 3ATGA 4N53B 5JMCA 3KF5A 3VD9A 4Q1RA 1AJKA 2RJKA 1RUG2 2WN3A 4ONUA 5F2WA 3VDDC 1IS6A 3C7GA 3M1HA 4GKXA 4UFLA 1RYYA 4DOUA 2QQWA 5HPOA 3RZGA 1MS5A 2L9LA 4FPOB 5FV3A 4LIUA 4FFHA 2Y6HA 4Q4V1 5FPVA 3KQRA 3K4DA 2PHTA 2AZ5A 4P08A 2OW4A 4UW5A 3KS7A 2CTVA 2XG3A 4ATEA 1C1FA 2ARXA 2JDNA 3HJRA 4LJHA 2R072 2CSGA 3A4UA 4XZUG 5L9RA 2W92A 3JB8A 5L7OB 4PIYA 3QH7A 4XAEA 5DXDA 5ANQA 5BUVA 1V6OA 5DMYA 3MICA 4S2GA 1C8M2 1RVF2 4I01A 3VDAA 5A32A 4MGYE 1COV1 1GSLA 1OLMA 1GANA 1GFF2 1QJY1 2JD9A 3PVEA 1JOPA 4YM0A 4YGEA 4AL9A 1OI6A 2QJVA 3GM8A 4LE4A 4YW7A 5FLJA 1H1MA 1OBNA 5FYTA 3UETA 4N43A 4XUOA 4DY5A 1NA1B 2QKDA 2R062 3N9PA 3CKHA 2W3JA 3QLQA 3KF3A 2A75A 3H9AA 4XDQA 3T30A 5JXJA 2WWSA 2H0BA 3J7HA 4AK3A 5FBZA 3ENRA 2VUJA 2FHRA 3VD4A 2ADEA 2VUAA 2FDKA 3DPRB 1U5YA 1NY71 2VQTA 2BERA 1RMU3 3ON7A 5C8CC 5F7UA 1WUVA 4TTGA 5GZDA 4COWA 1UYPA 1C1LA 4MGTA 1XU1A 1U5ZA 2R0FA 2D7FA 2VH9A 4QXKA 3IAQA 1UY2A 2B39A 3VBOB 4OI1A 2IVJA 3USSA 1YJLA 3MFAA 1GLHA 2JG9C 2RMU1 1NKGA 1SDDB 5IVJA 5FZMA 1FOD1 2G9FA 4FPEA 1JZ6A 1J84A 4META 4XJ8A 1KS5A 1PM4A 2BNOA 1EV12 2I07B 4MGKE 3AX4A 1JN2P 2P3JA 4OCTA 4LK6A 2RR13 4RL7A 3KSCA 4KU8A 1AX2A 3RJ2X 3T4HB 1Q43A 2D3SA 4BLJA 5LB6A 2JKBA 4FXGB 1GZWA 3FHAA 2P6CA 4HOOA 4A3ZA 4HL0A 3WSOA 1QHDA 4QT6A 4GAZA 4B29A 1SQ4A 2E9QA 3DUIA 4ZHNA 5JI7A 4IEYA 3J26N 1ZNPA 4Z2AA 1PM7A 1RL3A 1LOBA 2K9ZA 3A7QA 1E57A 3AZWA 3GDBA 1AXKA 2VUCA 4OFGA 5EPAA 3K2OA 2P1BA 5F37A 2ZOEB 2TUNA 1UOJA 5BNNB 3CZUA 1OT5A 4H7LA 1UL9A 4Q26A 1HB4A 3OUIA 4TSVA 3J7NA 2UY8A 5JCTA 3VZOA 2V73A 2O8QA 2GP3A 2EXJA 1AX0A 3I3DA 4HMZA 3JBG3 4Y20B 5D21A 5FMOL 1DDLA 1ASJ1 4K1YA 1EPWA 1JW6A 1TEIA 1MS8A 3OPTA 4A2UA 3AMQA 4YVSC 4URAA 5A6QA 3T0DA 1WW6A 5FZ3A 3TWIA 1HRV3 1RUJ1 3VBRC 4BMBA 1IPKA 4P9JA 1MS1A 1YJKA 3JU9A 1LJ7A 4XFAA 1RUC3 1NCRC 2DDUA 2VY0A 1NZCA 2VW2A 4NIDA 4HKWA 5C6CA 3FMGA 4GMP3 4PDWB 5BY5A 3HOBA 4Q2FA 1UMHA 1YQCA 4XUQA 1NQDA 4W50A 4XUNA 3SH3A 2VU9A 1UMIA 3AYCA 2WA3A 3IPVB 1C5IA 5J7MA 1K5JA 4JGZA 2CAVA 2Y6FA 1GYKA 2QQLA 3JD71 3OOXA 3Q8EA 4F3JA 2WIIB 1X50A 2UY9A 2D97A 1OOPC 2WA4A 2XKOA 2R041 1UPIA 1RUH1 1VB2A 1FYUA 4HBNA 2XPJA 2NN8A 2ZX1A 1OKQA 3BB6A 2VG9A 1WD4A 2ARBA 4GH4C 4Q4W1 1CWPA 1JZ7A 2XBO2 1LHWA 4FP2A 4G9SB 2Q4SA 3VD5A 3OPWA 2WN2A 5EQUA 1KFUL 2WQ4A 3LA3A 3WT3A 2VQAA 3CNAA 4QPIB 1CAUB 1GP5A 4YW1A 3AP6A 1T6BX 2LROA 4BQWA 2BTVC 3QH6A 1V6JA 5CKNA 1REEA 2DTYA 3DKWA 4GMP0 3L9JT 3X29B 2CNAA 2WZR1 5FY8A 5A7NA 4JZRA 1S0EA 5DUUA 3I2KA 2P5BA 2WQ8A 1YI7A 3LEGA 4N9HA 4AGRA 3RMXA 1HRI2 3LA2A 5GLTA 3TEWA 2NMNA 5FP4A 3EO6A 4BE3A 2D6MA 1RUF2 1W8WA 2WFPA 4AI2A 5IVVA 3BU0A 3N7MA 3TN92 1GZ9A 3RQ0A 2ET1A 3I54A 3RVHA 4ISRA 3SCHA 4BIFA 5CFCC 1V6MA 2W1WA 1JYXA 3A21A 3URFA 4XCAA 3E5QA 4KWKA 1WGPA 1NY72 2HWF2 3WW4A 5CA6A 3WG3A 4U2AA 2AC1A 2YU2A 4HFSA 3IBMA 1BEV2 3D5OA 2X10A 4CUBA 1W6MB 5KHKA 1TME3 5A7PA 4EZHA 4CP2A 3TRSB 3FN9A 3WW2A 3K4AA 2E7TA 5FO8B 1J3RA 1BK0A 1IG0A 4CUGA 3FUQA 4KWLA 5FZ8A 2XHKA 1CQ9A 5IT6A 1PO11 4XJWA 4AHZA 4RR3B 5HCAA 1O4ZA 2KA3A 3I7DA 4A45A 2B5HA 2ZBJA 3N9QA 4AFAA 4HZFA 1LESA 3FZ3A 4GB33 5LY1A 2Q8DA 4JHTA 3F95A 2DCZA 2W39A 3ORJA 4LNVA 2X8KA 1K42A 3POIA 1PK6B 1ZBA3 5F5AA 4NRMA 5M0TA 1DLLA 4NE9A 1AF9A 2R7EB 1W8HA 4CDUB 2YYOA 5FYVA 1NCQC 1UN1A 2VPVA 2ZMLA 3WUCA 5DG2A 2YZ4A 2JDZA 3B93A 3WQBA 1EYBA 2R1DA 1CJPA 3J9SA 4XJ9A 3ZYRA 2ZGQA 4IEZA 4NRPA 3U07A 3WINE 1H4HA 4D94A 4TZDA 5JXGA 1YFWA 1BVP1 4OUMA 5FREA 3MLJA 1QWRA 4RFT0 4XF3A 2I74A 2TEPA 1B35A 4UI9L 3ZN6B 3PIJA 3MPBA 4LOSA 1UYZA 4LE3A 4NPRA 1RMU1 3K3NA 5A7WB 4YZ3A 3WCSA 2WNOA 5F6LB 1LEMA 4BZ4A 2HH9A 2ZGSA 4YVWC 2RJLA 3HNMA 3J4UH 2Y33A 5EJ3A 5JDBA 5FLHA 3TYJA 3KGLA 3WNOA 3V0BA 1XQNA 4MGSA 1YCIA 2VULA 2VC9A 2YGMA 4KGQA 4CDWC 1L7LA 1B35B 4XF1A 4I3GA 4DUVA 2RR11 4BJ0A 1H8TA 4N9IA 1WA4A 1W2AX 3SKJE 3AMPA 3CJIC 5IVYA 3IT8A 2LW8A 4WM8A 2HYKA 4IDZA 5I8YA 5ACA3 4NHMA 4JGYC 5A33A 1YWKA 3OGRA 3AMNA 4IGPA 3ZMOA 2DUQA 2YMZA 4Y33A 4K7JA 4P9GA 5FZGA 5DAXA 5JSRA 2HBTA 2WO7A 3WP6A 4QGNA 4I2OA 3PUIA 1PVC3 2VZPA 2PLV2 2WNUB 4FVVA 4IV1A 1H8TB 1VP6A 4XHBA 3LF7A 5FXZA 1UY4A 5GLVA 2QFEA 3ST7A 2IUWA 4GWMA 4EWEA 1RUH2 3U1XA 3WUDA 5C3OA 3SCGA 5E6HA 3HT2A 1ZA7A 4DINB 5C7GA 5LW9A 1CX1A 4GXLA 3NV2A 5FAXA 4Q8KA 1BBT3 1VMHA 1LODA 4QXCA 5FZLA 5FZKA 5FPBA 3WP4A 3IIIA 2PXJA 3ZFEC 3M8LA 3JBG1 3I3BA 4JQTA 3LEKA 3SLIA 4ATFA 4AFCA 3IDEA 4I09A 2W9XA 4IGOA 2RDRA 1UCXA 2JENA 2W2IA 1HRV1 1LGCA 4XBQA 1QJU3 5J36A 4PBPA 1YIFA 1O59A 3LE0A 2XJTA 4CCKA 4RQPC 1UOBA 2QNKA 3O1RA 4Y1UA 1O4TA 2E63A 4C8DA 4LOTA 3LFMA 4GMP1 4K6BA 3OPZA 2IFRA 1F8VA 1DZRA 3ITQA 4LHKA 3U4SA 1R093 3ILFA 4YLZA 4E2QA 5L36A 1UW8A 4CP9A 1R64A 5BYNA 3ZYHA 5CNAA 1UX6A 2OS2A 1LGBA 1PO21 1GQHA 1YHFA 2D43A 4QHZA 1LOFC 1O7FA 1HW5A 4FT8A 4WZFA 3NSTA 2XLGA 2XJVA 2GH2A 3C2UA 1HB1A 4CDQC 1QNYA 3N7JA 4Y1YA 1DU3D 1JH5A 1ZYBA 1JMUB 2ZZJA 5EJ1B 4QQLA 2LUWA 2JG8C 3CZJA 2Y26A 5HI0A 5FZ7A 1UD1A 4MH0E 1PMJX 1VMJA 3H50A 1NT0A 4BQYA 3AYAA 2D5FA 4BB3A 4AVTA 5JOYA 1AL0G 3T3YA 5A6YA 3WY6A 3MI8A 5A3OA 3NJZA 2ZAHA 4O9GA 3ACHA 1KQRA 4XOGA 1REFA 5FJKA 3KV4A 2VMEA 1YLLA 5FP3A 4D6RA 2ZGTA 2O0OA 5BNOA 5JZGB 4AEKA 3H7YA 1W8TA 4L8QA 4NJ4A 3VZJA 2NPIA 2F17A 4EN8B 4AEDB 4YFZA 1D7PM 1TVGA 3ZFGC 2EIBA 2BBAA 5HXVA 3U37A 5GLWA 5LWBA 5JR2A 1W04A 1F4HA 5FZ9A 4IV3A 5EYYA 4GA9A 1Z0HA 3VBHA 1NXD1 4XFIA 5FKBA 4AGGA 1O8PA 4PHZA 4CTEA 5EHDA 1TQ5A 1VRH1 2KXLA 3Q8BA 1G86A 2VZ3A 2Q1FA 3BOPA 4KQ7A 5FUNA 3TB0A 1IGOA 1JTZX 4ES9A 3K3OA 1EUUA 4BMEA 2C5DA 2VCAA 5FZFA 1REDA 3AMMA 2NM1A 3ZSLA 2OX0A 5AFBA 5LATA 1YQ8A 3ZXKA 1SLCA 1S55A 3NNJA 3VKNA 1YFUA 3BKZA 1FV3A 1HXS2 4IV3B 1OLQA 2OVUA 2HWC3 4DEQA 5J3UA 2JDPA 3U78A 2JJ6A 1AR72 4O61A 5I0TA 4CDXA 4JRAA 4V2VA 3CDZB 3E1F1 4HPKA 4OQ9A 5IVBA 2VBDA 1OF4A 1ACCA 4R8HA 4NHYA 2R6QA 4M4PA 2BVVA 3B9CA 2P3YA 1ZBA1 2XR4A 3B69A 5CISA 2MPFA 3RYRA 4QM8A 3W59A 4JHZA 3KQ4B 2WC2A 3VUOA 2CU5A 5A3TA 1DCSA 1SBFA 4C0BA 1C4RA 2I45A 3IB3A 1JHJA 3HQUA 1RUI2 1H1IA 2A5ZA 3HNBM 3KCYA 2ZEYA 1UWWA 3T0AA 3ZFFA 1F5JA 3M3OA 2MEV2 3FE5A 4CP0A 5C33A 4BK4A 1ZVFA 3LFIA 4TLFA 2BU9A 3ZDVA 2WR9A 1MQTB 1V0AA 3AZYA 4L92A 4H7MA 1CESA 2LTNA 5KC6A 1W2TA 3HBKA 1N1YA 4P9WA 3LGRA 3C7EA 2PQSA 4PI0A 5KC5A 2YC4A 2KR2A 4MLOA 1D4VB 4LKFA 1O5UA 5FLIA 3GBFA 5J96B 3K46A 2RM23 5FZIA 3BCWA 5JIAA 4DXZA 5C3QA 3HT1A 3ZFFB 2ZJCA 2VVEA 4FPLA 2FDGA 2B7YA 4OHXA 5LEJA 4ASKA 4HETA 2GC2A 3VBFA 4Z8BA 1CAWB 3O1UA 3SEEA 1U5IA 3WX5A 1RXGA 3ZMNA 5IVEA 3RWKX 1UZVA 2ATFA 3WNKA 1HRV2 5F39A 2C9AA 4IGQA 1HQLA 1OF3A 3TEXA 5B2GB 1VBE3 2XLAA 5JIUA 3NMBA 1VBC3 3MLKA 4KBBA 1VBA2 1SCSA 1RUC2 1W6NA 2PHDA 4M0HA 3RPQA 5HV4A 2RS13 3NV4A 2YC2A 3DYPA 1EUTA 3VDDA 3T2TA 1E5IA 1VIWB 2R0HA 1GMMA 4KWUA 3T4VA 5FYZA 5ACA1 4LKDA 4YGDA 4E2SA 2VBBA 1QDCA 3LOIA 1FMD2 1M4WA 2DCKA 2HWD2 3PUSA 4QWNA 4XZPA 4ZONA 3UYJA 3WNNA 5JUVA 4ZU4A 2AEZA 4HVOA 3W20A 5F5QA 4A6SA 4AEJA 4QQPA 1YUDA 4CP1A 4MHRA 3WEZA 1PVC1 2RV9A 2JDYA 3ZSMA 5IFTA 3WHUA 4B7KA 3AJYA 4YPJA 2UWBA 4HLTA 3VDDB 5LCWL 1H1AA 1VAMA 4YG0A 1XC6A 3MHZA 1CX4A 2VZRA 4NWVA 1QOTA 1DG6A 2RS33 2NQYA 2ZTNA 3ILNA 4DPNA 4FQ4A 1BBT1 3WV6A 4JX0A 5FRAA 3DF0A 2WNVC 3UT0A 1JZ2A 3S30A 2VQUA 3DCQA 3ZPYA 3SMHA 4W6WA 3DV8A 3FHQA 1PIV3 2WKKA 5FMBA 2D6KA 4JDNA 5T5OA 4NWWA 1YQ2A 2VMHA 4P5YA 4QMAA 4ZY9A 1D4M1 4Q5OA 1YQ5A 2X05A 2C26A 1UYXA 3NNFA 2BVBA 2UURA 4QX3A 3VZLA 1V6NA 1H6YA 4RS5B 1QJU1 3FC0A 2UU8A 1PZ7A 2IXCA 2IXKA 4B4QA 4QX0A 3D8CA 4DRVA 2ERFA 5FXVA 3HWJA 2ZABA 2PAKA 1W8NA 1FNYA 4QX2A 5IAXA 5C8CA 3PU3A 1PGW2 1DQ0A 1RUJ3 2ZMNA 2MNGA 4FOYA 1SLLA 3ZYJB 1F9KA 4Q27A 1OHFA 3AL6A 3HQXA 2WABA 3BVCA 3G7DA 1RIRA 1US2A 2V4AA 3PJYA 4CEYB 2PN5A 5FMOS 2JG9A 3CU7A 5I0UA 4HONA 4PQ9A 1XSRA 5BPXA 2YU1A 1X9PA 3WNMA 3T2PA 1YC61 1S2EA 2F4LA 5DDJ3 1YYNA 2ZHMA 4HG6B 3CJXA 3N9MA 1NZIA 3I4IA 1CGPA 1OLRA 5IJRA 2CGOA 1TME2 3ES4A 4NRQA 1DGRA 4Y4YA 3C7HA 3I2JA 2WS91 2J1UA 2YV8A 3LEMA 1LOCA 5FZAA 3AKPA 1K45A 1T2XA 3WQ7A 4FFIA 4WM7C 4GB32 4EN0A 4UF0A 1AX1A 2K46A 1XPWA 5LEKA 1N3PA 3ZDSA 2XMLA 5EJZB 5FPUA 3MF9A 1MEC3 4QPYA 1PX4A 4J6GA 2ZHKA 3MV11 4B3NA 2QDNA 3OGGA 4X8NA 1GZTA 2WQZC 4OHYA 3ZM8A 3DYOA 4M00A 4MGIE 4N7UA 2FDHA 3T08A 1MS0A 2D6OX 1S0JA 2BFUL 3OCPA 2B42B 4OHVA 5E89A 4ARYA 4FBFA 2QQOA 1HQWA 3H8XA 2FD8A 4NHLA 4IQPA 2WZR3 3I2OA 1QJEA 1O91A 1A3KA 2K0GA 4UT5A 1QU0A 1LHOA 2A1XA 5FFOC 3AB0A 4FCAA 2P37A 4QKDA 1ENXA 2UYBA 4YVSA 1J3QA 4MZUA 4I3PA 4Q4Y3 5K0UB 5IAVA 1XU2A 3POGA 4LO5B 3H3ZA 3PMEA 5FY4A 3VBRA 4CCJA 2D40A 1QXJA 1JYWA 3LD8A 4OQ8A 3KHBA 3KGZA 4WV8A 2WBKA 1Z7S3 1JZ4A 2VXRA 4FTSA 2VCMA 1OQEA 5KBFA 2A6XA 2BJSA 4X6RB 1NCRA 4EV0A 3IDCB 1W8ZA 3E5XA 5FZDA 4L9BA 4DNYA 1I6XA 2XL7A 1BMV1 5FUIA 2HWC1 4RHV2 2TNFA 3IDBB 1Q8SA 5J37A 1W0NA 4B4RA 2XUEA 3ZOIA 4CEWC 1BYHA 4JTNA 2YBSA 4IEUA 4XABA 1W9FA 5AVPA 5CB7A 3VBUB 4PCRA 4ZZ8A 3RZJA 5FXXA 2XWJB 2WZPP 1PO13 5FUPA 2G4IA 2GC1A 4QHBA 4MG2A 1OMIA 3Q9OA 3H42B 2GMEA 2D93A 1OOPA 4D7YA 1VBB1 2HLEA 1K5MC 1NCRB 4P00B 1G8WA 1MZ6A 4KU7A 1MZ5A 4MSVA 5FYHA 5HCBA 3LIGA 4BQ3A 4AAPA 1UXXX 3A23A 4LA3A 5GALA 3JUUA 1KDMA 1HJGA 4GH4A 1W06A 3APBA 3OBAA 2OYZA 3ZR5A 3B00A 4R9AA 2A3YA 5FYCA 1ZRFA 1W0PA 1JUHA 1ZRDA 2EF6A 1US3A 1DYKA 5I8TA 5FR3A 4A6OA 2ZGOA 4WVWA 4LBOA 1YO8A 4YW2A 4K1ZA 1LR5A 1X36A 1NLSA 3AVSA 1FXZA 1OOPB 2WUHA 5BNPC 5FZ0A 1HQNA 2B9VA 2RM21 1HX6A 3I2HA 4HT1T 4XMIA 1LRHA 1Y7BA 1W03A 3RNSA 4RSUA 1LB2A 3TOJA 4D6SA 4A4AA 5FK7A 1J58A 3MPPG 4FPJA 4Z92B 3QACA 2Y38A 5A32B 4YZ4A 2P34A 2WRAA 4N7IA 3VHRA 4YZ5A 4QKFA 5T3NA 1OUSA 3JQWA 4N43B 1VBE1 3I2FA 3WG2A 3SQOA 4CU8A 2AYHA 1K3IA 2Z2SB 5CFCA 1VBC1 2DV9A 5D2AA 2P3KA 5JVVA 3NQHA 1VRBA 2RS11 3LSEA 2OPWA 4U36A 4CU9A 2ZMKA 3NAPC 3P3NA 5K4LA 5LBBA 1NG0A 5T5LA 3VGIA 2D44A 2D3PA 1X8EA 2OIIA 1R092 2YPJA 1AHSA 2BGPA 2HEYF 2W1UA 1RUD2 2FDIA 2F6BA 1AR83 4LUKA 4NIIA 1DGLA 3MEPA 1AXYA 1OLME 2P3IA 5SV5A 3USUA 2NLRA 2CGPA 2ETEA 4NROA 2W52A 2ZGLA 3VDBA 3A0NA 3AJZA 3MUY1 4OI4A 1J83A 2HWB2 5IK4A 1PVXA 3R4UA 4IW3A 4LO4B 2RS52 4HK8A 3H8UA 5D8AC 5FQ0A 4PT6A 1DQ4A 1FV2A 3OBZA 3WW1A 2RS31 1NCQA 1CZVA 4YSFA 2H6BA 4P9XA 2TBVA 3WDTA 2X09A 3WF4A 2V09A 2O14A 3E6BA 2BOIA 4ARXA 1PIV1 1GZWB 1TNFA 3FUOA 1BQPA 3CO2A 4COZA 1UXZA 1QJZA 1ZBE3 1HIXA 4I0WB 4K8RB 4AVSA 5LBEA 1VBD3 2JB8A 3VHOA 2D98A 5C3PA 1SLIA 2ARAA 2KD7A 4MOAA 1UZZA 2DURA 5FQ0B 1OSGA 5GLUA 1UOGA 4XJAA 2IWGB 3T2QA 3UGHA 3ECQA 4FXKB 1PGSA 3NJVA 1NYWA 1NCQB 3Q8AA 2WINB 3ACGA 4BOWA 2XXZA 4M01A 3EB7A 5FY5A 3PVNA 2AR6A 4LHLA 3O0XA 1SFPA 3MIFA 4YVWA 3I97A 3M7AA 1OQ1A 4Y4RA 2PHFA 1NXMA 4GWNA 3VHPA 5JI9A 4IE5A 1PHMA 5C4WC 2J1TA 1ZZCA 4V2WA 1D0HA 1V9U1 2WYSA 2GDFA 4QX1A 4CDWA 3MZHA 5DDJ1 3ZSJA 3V56A 4QKBA 5KHJA 2B45X 1N3OA 2CL2A 2LM3A 1PMHX 3AZXA 4R4ZA 4UFHA 4UOJA 4UW6A 1ULCA 4XPVA 1PO23 5E1RA 1Q5OA 1RB8G 2Z5WA 3FFQA 3CJIA 4IEOA 1BMV2 4ASMB 2E6VA 1AXZA 2Y6GA 3KWVA 4FPKA 4LBJA 4YFWA 3UJOA 4AQ6A 1QJX3 4JGYA 1GUIA 1AJOA 5LA1A 2HEWF 1W8OA 4B1LA 2A6ZA 4CDWB 1PMIA 5CFDC 1DGWX 1PGL1 4Q4V2 1UPSA 2ET7A 3M4FA 5L7OC 5JOZA 3THDA 1MEC1 4WVVA 5CG9A 1NE4A 3VKMA 4IEWA 2JKXA 4XIKA 1X33A 3B7MA 2JDAA 1VALA 3OB8A 4JGZB 1GU3A 3DYMA 2XONA 3IMNA 1IPSA 4C91A 4KI5M 1S4CA 2VM9A 2ARCA 1NA1C 4BWOA 4KL1A 1OVPA 2YB7A 1W8UA 1COV2 1QJY2 4W65A 3ZFEA 2VR4A 2A7AA 3U4XA 5TSWA 3WDVA 3S5AA 1S0FA 3GNEA 2Y34A 2QQUA 1DIWA 5APAA 4ZXKA 2AUYA 5FPLA 2ZKLA 4JKMA 4Q4Y1 1BK1A 3CIHA 4QB1A 3DPRC 3T1MA 3NV3A 4K40A 1UY3A 2PELA 1LOGA 1WW7A 2PHRA 3W9AA 1Z7S1 3BODA 4BISA 1VRH3 4RQPA 4RD7A 2VOWA 3OY8A 3VBOC 5EIYB 2X53S 3N4MA 1HB3A 4JKLA 4NUBA 4IEQA 3UESA 3ZFEB 3OBRA 4A7ZA 1W6PA 1MS3A 1IOAA 1UYYA 4MGQA 4B7EA 5KXBA 5FY9A 3WXPA 5DAPA 4EROA 2KM2A 4IE7A 4C0HA 3TAYA 1LOFA 2EIGA 3DEMA 3V64A 2RS12 1UU5A 2RMU2 3CHXA 1AL23 2JDKA 4EWAA 1FOD2 3KD4A 4CDQA 1AR93 5CYYA 1STMA 4RQPB 4CPBA 3OY8B 4PF1A 3I8TA 4QQHA 3BIWE 3LCPA 2JG8A 5LA9A 5B4NA 1D2SA 2R16A 4JRLA 1PZ9A 3E97A 5T5PA 4AFDA 1GWLA 3ZO0B 2J1RA 4AEMA 1A8MA 3UKTA 1EAH1 4YZ2A 3R0RA 4ZPIA 4JQRA 4NPLA 5A3LA 2FDFA 2GALA 4P9IA 3ZXAC 4YGCA 3N3HA 1ZRCA 1LOEA 2UWCA 1CAXA 1F2NA 3O7OA 4AI8A 3J8F1 4MO3M 3VKOA 5GZGA 1OFSA 3AP9A 4KH9A 5DZEA 3NNLA 3HBZA 4Y22A 2VUDA 1G9FA 5BNNC 1RJ8A 4AW7A 3T0BA 1CVNA 2QZ3A 4E8CA 2RDNA 5JSOA 4AGVA 2YUEA 5LRSA 3HD8B 1CN1A 3DL3A 1KDKA 1UZ0A 2N7GA 1OD5A 4Q4X3 3GZUC 4QDRA 1OKOA 2VXJA 1QQP3 3SCFA 3M3CA 5FPXA 2D5HA 2NZ9A 1QH6A 4PBOA 4TWTA 3ZFGA 2EIEA 3ZVXA 2A73B 1JYNA 2ZX3A 1YEWA 2ZGNA 1JOJA 4QDSA 1DHKB 3G6JB 2BWAA 3ETQA 5CU1A 5A6XA 2CYFA 2ZCWA 3POYA 4DFSA 3RS6A 1H9WA 3K75B 1YFYA 3WDWA 1ASJ2 5JMOA 2XVLA 5A70A 1GOHA 2GMPA 1A8DA 2BWCA 4OVEA 3I2GA 5LY2A 3ZSEA 2W1QA 1CR7A 2DVBA 4C1XA 5CVRA 2VW0A 3RI9A 2VW1A 1RUJ2 1H6XA 4PDWC 3WF1A 4GQ7A 5IK8A 2W94A 3BU7A 1AR81 2OPKA 2VCCA 1ZZ9A 2BNMA 2ZS6B 2CDOA 3BPZA 5FY0A 3FFZA 5C9AC 4RYDA 1D2QA 3I2IA 1O3SA 4IEXA 4Y5SA 3I59A 3LDRA 2J7MA 4GALA 2DCYA 2BNNA 3BOWA 5JXIA 3V0BB 5GM0A 3VL8A 3NO8A 1G6NA 3ZSKA 5C8WA 2J1EA 4UFMA 4A42A 3D82A 5ABJC 2A70A 1V70A 1T6GC 3O1PA 3SITA 3JD72 4FPCA 3WCRA 4Q8LA 4MXVA 1CIYA 4XF4A 3OSDA 4EZ4A 2GN3A 2R042 1BCXA 1X82A 1VPHA 4NHXA 1W3XA 1WKYA 4HVRA 1IS4A 4DO0A 1RC6A 2R32A 3IIAA 2WO2A 1NOVA 4WM8B 1I3HA 1QY4A 2WWUA 2HYXA 1ZBE1 2QQIA 4M0NA 4OYUA 4Q4W2 4QPIC 5FP8A 5A33B 1VBD1 5JSPA 2QQVA 2Y64A 4L11A 4W8JA 3VZMA 3O1TA 5JWPA 2PAEA 1Q56A 1NQJA 3MUZ1 2HBUA 2XVGA 3VV1A 4IESA 1D4M3 4IV1B 1GOFA 1C8M3 3FHIB 1KEXA 1RVF3 2VTXJ 3OD4A 4TN7A 1UOFA 1MR5A 3NKTA 4AI0A 1XNDA 2IZWA 3TEYA 1R1A1 2WZR2 4BLIA 1UKGA 2VOVA 1QDOA 2MHFA 2PMWB 3GF6A 5LK5A 3VB9A 1AUYA 2DFCA 3MW2A 1F5FA 2ZGRA 2ENRA 4WZCA 1OD3A 3ZN4A 1E5HA 4NO4A 1H2KA 2ZGKA 5I0DA 1UMZA 3LA7A 5EP9A 3WD5A 3W58A 3WDXA 1UNBA 4AE2A 1S0IA 2WSVA 5FZCA 3R4DB 1B09A 3POEA 3MW3A 4FOVA 2C4XA 4Y1XA 1ND2C 5FWJA 2G9GA 4Z2WA 2D6NA 4ZU7A 4HANA 3OUJA 4E4ZA 5FO7B 1DYOA 1IKQA 3JB4C 3J7MA 4UBHA 2EXHA 2XKPA 4CA9A 3O0VA 4RR3C 4YGBA 1QJX1 4B1MA 1SLAA 2IXIA 2AACA 3ZX7A 3AFGA 4QQ2A 5E88A 1F35A 3KT1A 4J1WA 2WS93 4QPGC 3D4KA 4V1PA 4IUGA 1PO12 1PK6C 1G9BA 5FK8A 4CP9B 4UXAA 1UU4A 3SXWA 4KG8A 5I0SA 5FMCA 2BW8A 4CDUC 1G7YA 4YM3A 3R4SA 4HN0A 4QGMA 5LA0A 3PL0A 3I3MA 3LDBA 4R9BA 1QGLA 2WL1A 3MIDA 4YG6A 1RUNA 3T09A 3N7LA 1WBLA 2GC3A 1YNAA 4D69A 1CJDA 2FCUA 3E6DA 3GGLA 3POJA 4OMCA 5HBAA 5HXMA 4D8MA 2WNVA 2PAMA 4URTA 4XHXA 5JLVA 3AZVA 2WT0A 1R081 3TBDA 4H2AA 5FJHA 4IEPA 1WD3A 4YYOA 1QNWA 3MIEA 2VNRA 1O8SA 3FBMA 3LOBA 1HJFA 2R30A 4XUTA 3MDPA 2XJUA 3H8RA 2FMDA 1U0AA 3GCXA 4AG4A 4XQDA 2PTMA 2IFWA 3C3VA 1AR61 5AVAA 4RA0A 3FWEA 1NAEA 2WNVB 1OVSA 1HLCA 3K51A 1RHI1 4QU2A 3VD3A 2Y0IA 1RMU2 1SDWA 4QX8A 4AXOA 5BNOB 4K9SA 2NMOA 4FI9A 4K8FA 3WOGA 1WMEA 3ZR6A 4XJUA 1RINA 3ME2A 4DEVA 4BHPA 4OZXA 2HWE1 2WDBA 3KM5A 2YFZA 4IE4A 1J3PA 2XLFA 3GCWA 4L2NA 2WLPA 2CHHA 5A3NA 2OT7A 2VMIA 5LA2A 2QQNA 1AL21 1SFYA 3VBHB 1SBDA 1AR91 2DU1A 3AMHA 4ZXEA 1A78A 2C0ZA 1ZA4A 3BTZA 3NNGA 4IEVA 2RR12 3O0WA 4KWJA 4PF5A 4AVCA 4X8PA 4R9CA 4PLNA 3BTYA 3PTYA 4W6XA 3SNMA 3WP3A 4DZGA 3PLQA 4IERA 3UGFA 3ZYBA 3VKFC 4WM7A 3H3UA 1VBB3 2WNUC 3CL1A 2SLIA 3ZXGA 4FFFA 2DVGA 2VNGA 1GKBA 4MV2A 2XJRA 4CXXA 4F7ZA 4QB2A 2VL4A 4AHWA 4CDXB 4GZ9A 3OUHA 4NIGA 5FP9A 3THPA 2ID4A 1QXRA 4PI2A 4HPKB 3O5SA 4S2DA 1BKZA 2JDUA 3KCXA 2JDHA 2OQ6A 4M3CA 3SEPA 2PHXA 4Q4X1 4CSWA 5BV6A 2CAUA 2E53A 1J1TA 1QQP1 2VAUA 4XAAA 3H1YA 4AQ2A 3D0JA 4WM7B 2XBO3 4BU2A 4OI2A 4FQZA 3CLPA 4AI1A 2BQPA 2WFF1 2UWAA 5D1IA 5F5IA 4XDPA 1LCLA 3RI8A 1G9CA 4UW3A
chains in the Genus database with same CATH topology
3JBG2 2E7AA 4KNCA 2GNBA 5DUWA 5A3MA 4ZU5A 5H9RA 4E4SA 2OUJA 1AYM3 4XFGA 5H9PA 1W6QA 1JUIA 1KJRA 3AP5A 3ELNA 2UYAA 4AFBA 1HRI3 1YIPA 1RTVA 5AC93 3QOPA 1RUF3 4OULA 1JYCA 2RHPA 3TN93 4WBBA 1QXPA 1JYIA 4C90A 2P17A 3VBFB 2A6YA 4UW4A 4CEWA 2WT1A 1L3JA 1ULDA 1H2NA 3EHKA 1PO22 1JXNA 1QMJA 2HWF3 3GHMA 1SFNA 4XFHA 2ZGUA 1FPN3 1BEV3 3N36A 1GR3A 1K5MA 5KHHA 4X6QB 1W6NB 3D6EA 4G3YC 1DBNA 3FX3A 5JPMB 1XNCA 3VZNA 5JOWA 4EN6B 2R071 2P2KA 3WZ1A 2ZGPA 4LLOA 1A6CA 2D6LX 4OUSA 2XVKA 5E8AA 5JZGC 4JVAA 1SACA 5CG8A 1C8M1 1WCDJ 4IXLA 4L97A 1RVF1 1SLTA 4AEDC 5BNPA 3ZYGA 3CEWA 4YM2A 1ZRRA 1W6OA 1QKQA 1O3QA 1MACA 1ND3C 2Z69A 3LB9A 4LA2A 4S2HA 1ZREA 1LKNA 1S2KA 4KG0A 2HJIA 1PNFA 3CF6E 5F6KA 5BXXA 4D3WA 4ZKTB 2WT2A 2CGNA 1Y43B 1IPJA 4XQ4A 3I2DA 4Z07A 4NN0A 1VRH2 2DVFA 5EFUA 4A7YA 4Y1VA 2IC1A 4YRDA 1H30A 4P14A 1WLCA 4YG3A 1V9U3 3NAPA 4EN9B 3B02A 4JV4A 1I9RA 5T55A 4FAHA 2XL9A 5C8CB 4DRRA 3WW3A 2Q5TA 2ZX0A 3VLBB 3WG1A 3R05A 3LSDA 1MS9A 1XE8A 1AR92 2VVFA 3RYKA 2JG9B 1N1VA 1V6LA 3NAPB 5D8AA 3L2YA 4LBQA 1ZBA2 2Q0AA 3UV9A 4LBKA 5AFEA 1S0BA 1FAYA 3AKSA 1MQTC 4CRQA 4E4DX 2ZHLA 2E51A 4INDA 1LECA 1XRUA 3PHMA 5IK7A 3HN1A 3WNXA 2PLV3 4RGGA 5IUQA 5LK7B 1V6KA 1YRZA 4D7TA 5D8AB 2IXLA 3IWZA 5IK5A 1NE6A 4HKOA 1H2LA 1TNRA 2JD4A 2OZJA 4Y26A 3ACLA 4FAGA 3UK9A 3VHNA 1RITA 3LZZA 3V0AA 3AZZA 4FOQA 2Q1MA 5C4WA 1ZM1A 2Q8OA 2RE9A 3KMHA 4BA6A 3RWNA 5F1RA 2VNOA 3PMSA 4YVSB 1W2UA 4D7SA 4XBNA 4IL7A 2ZGMA 3VBRB 1WCSA 3V0AB 1NLRA 3VBSC 2JX9A 4NR1A 1W0OA 4XW3A 5ACA2 3MIGA 1LULA 1C3HA 3AYEA 4XFBA 4XILA 3E5UA 4LO6B 3RSJA 5DZGA 1IHMA 1ZZBA 2DCTA 5CFDA 3WQ1A 5T52A 1EAH3 4WVMA 5L7OA 2PYTA 3WVJA 1PVC2 3LAGA 4YW3A 1OA3A 2NYYA 3J8F3 3FLTA 5HCFA 3MW4A 3L2HA 5GZEA 2W08A 1N3QA 4I0AA 2VVDA 3IKWA 1NA1A 2DVDA 2XBO1 1BBT2 3E6CC 5GKAC 4EWDA 3S7IA 5CFDB 3OGJA 1H9PA 4RS5C 2AGSA 2VMGA 3O12A 4WVMB 1DGRN 4GH4B 4FPFA 1AYM1 1D4M2 3RMYA 4QX5A 2ZX4A 1AVBA 2PHWA 2X5IC 5DUVA 3DPRA 4COYA 1TMF3 1QJU2 1Z78A 1IS3A 4LEJA 1POV0 2ZKNA 4K3UA 1HRI1 3NW4A 3VBOA 1IQAA 1OPMA 2Q30A 1C28A 4HSJA 5AC91 1RUF1 3FLRA 4CEYC 1VLNA 3TN91 2PFWA 5K8SA 4OHZA 2DF7A 1H2MA 2GZWA 1CD3G 3ALQA 4Q0PA 5I8SA 2HWF1 2YROA 1FI2A 1FPN1 1BEV1 3GZAA 1Q8PA 5CIRA 5CFCB 2K2SA 2AH2A 4K20A 1OA2A 2B9UA 3PNAA 4C1WA 1ZZ7A 1HXS3 1LENA 4LT5A 3A0KA 3AKTA 2WS92 1AR73 4LLFA 4LBLA 2I2SA 3H1MA 2XJPA 2YXSA 3USUB 5BNNA 1RUE3 2AREA 2XGXA 1DQ6A 1S0DA 4FPGA 3WR0A 3HIFA 4QQOA 2H6CA 1MS4A 3AKRA 3WDUA 1WLTA 1RUI3 1R1ZA 4YZ1A 3JQXA 2MEV3 4XIOA 4XE9A 3IM0A 2VGDA 4Y20A 2AENA 4XTMA 2F4PA 2LALA 3NKGA 4Z82A 3PJQA 1CAVA 1KRIA 3N7KA 4TYSA 5K0UC 3P3PA 1R1A3 2ILMA 4I30A 1HDKA 4YNIA 5T54A 4N53C 2R49A 2CY6A 4H3WA 4YARA 4NHKA 1ZZ6A 1IS5A 2H0VA 4PDWA 3S6PA 1DZQA 1ENSA 1BZWA 1CAVB 3AK0A 1V6IA 3IPVA 4JCKA 3VBUC 2FBEA 2Q1ZB 4Y1ZA 2ZX2A 3WG4A 5C9AA 2HWC2 2XJQA 3EQEA 4YVWB 3U0ZA 4IETA 2OA2A 5H9QA 1XYOA 4XFFA 1OA4A 3GHNA 2WSUA 1N47A 1VBA3 5JPNB 3AP4A 1GV9A 2GC0A 4BM8A 5ABJA 4Q0VA 3QCWA 3ZYIB 1AYN3 3AXDA 4AYUA 5KHGA 1CIWA 3UKNA 1VBB2 1FMD3 2EAAA 2HWD3 1WLWA 5EV7A 5JR7B 3CJIB 2JICA 5C9AB 3ROUA 3VL9A 2GNTA 2VOXA 5JOXA 4QPIA 4JGYB 4NVPA 1CAUA 1DZTA 2ES3A 2PLV1 3ZSMA 1OQDA 3U10A 2V5YA 1DF0A 5I0RA 2QE3A 3B9IA 3MFCA 1R083 4AVBA 5KHIA 5ABJB 3MIBA 4Y24A 2A3WA 1KITA 2IXJA 2CWSA 4R52A 1GNHA 3ILRA 1PNGA 3QBQA 2RM22 2O8OA 4AVAA 4BH9A 4MGZE 4XTPA 1SEFA 4O9EA 4QD2A 4N43C 1AR63 2IXHA 3HR9A 3KT4A 4FPHA 5DUXA 4F8AA 5EZWA 1AYM2 3B01A 3PVBB 1RHI3 3FJSA 1GICA 3KT7A 3MF6A 3MGUA 2BYVE 3ES1A 1YI9A 4DS0A 3RJRA 1ULFA 1UZYA 1VBE2 3ZXFA 2PA7A 5F9TA 1ND2A 1VBC2 2HWE3 1W6MA 3MYXA 3WDYA 1TE1B 1MVEA 2D6PA 2ZHNA 3NL1A 5AC92 4HVQA 1ULGA 1UF2C 4PJYA 4B4PA 4RR3A 2HEVF 2ZA9A 2VOKA 1POV1 3ASIA 3TNQA 1APNA 1DQ1A 5T50A 1O3TA 2DWRA 1WW4A 3S0MA 4BPZA 4QPGA 2ZPXA 1W6PB 3MLLA 1PK6A 3ZXDA 1FPN2 3EBRA 1ND2B 1SCRA 4CDUA 1DFQA 4EJRA 4LBMA 4OLLA 5CADA 4CDQB 1UU6A 2QUOA 4DY3A 2RS32 1BXHA 1LOAA 3POWA 2JG8B 4N90A 1QF3A 4XMAA 2A71A 4XQWA 4QPGB 4YW4A 1KD7A 1PIV2 5K9YA 4J1XA 3ZXEA 2FQPA 5I93A 3ZN6A 5KXCA 1CAXB 3OBTA 2WFF3 1TMF1 4Y22B 4A3XA 2BPA2 2QVSB 4S2FA 1GQGA 5T5JA 4ASLA 4BIOA 3SISA 5JAXA 4AF9A 1VR3A 4AFMA 2YY1A 3B5LB 3IN9A 3ZFGB 1O5LA 5BNQA 1OPOA 3GBGA 3UL2A 3WP5A 4AVVA 1X7NA 4FPYA 4MX3A 2A3XA 1UIKA 4Q29A 1V9U2 4Q0SA 4PIZA 3AXEA 2DUOA 2QDRA 5DDJ2 5EYXA 4FSJA 2YGLA 2R1BA 4W6YA 3GALA 3GYDA 4WVZA 1XNKA 1HXS1 2XH6A 1WW5A 1FATA 1RUG3 1SLBA 1Q3EA 4RHV3 2PHLA 4HN1A 1AR71 5FPZA 4AQSA 3QD6A 4I02A 2EAKA 1MVQA 2WNUA 1URXA 4QGLA 4P9YA 2Z42A 4LR4A 3OJBA 4JGZC 1ONAA 1S0CA 1RUE1 2B46X 4PIXA 1PGL2 4ITCA 3I59B 1MEC2 3HAGA 1GBGA 4GULA 1FT9A 2QCSB 2R073 1V00A 1RUI1 3D0SA 4PLMA 1RGSA 3M3QA 2MEV1 3OTFA 1N1TA 4XXPA 1KXGA 4H55A 4OHWA 4XF0A 1C57A 4AI3A 5GZFA 2GU9A 1EPZA 2CV6A 2SBAA 1C8NA 5FCCA 4RGAA 4LHNA 4Q0UA 3M3EA 4AWDA 2ZACA 5H9SA 4YM1A 2R063 3ZIXA 1LEDA 1KS4A 3FLPA 4Q4Y2 5I91A 2BBVA 3JCIA 4OI0A 4BQ1A 3HMYA 4UBGA 1Z7S2 2GH8A 5L73A 1M06G 4GIQA 3THTA 1U12A 1OFNA 1UIJA 2DU0A 4AHYA 5FDBA 3M70A 1FNZA 2VECA 3NWKA 4LO7A 1VBA1 5GZCA 1RUC1 2E7QA 1UAIA 1W39A 3OYWA 1ULEA 1LHUA 4R4XA 1EV13 1JHNA 1AYN1 4AHXA 3H1WA 4F83A 1RUD3 1WMDA 4ES8A 1FMD1 2HWD1 1LTEA 1DYPA 1XNBA 2WJSA 3UJQA 1I1EA 1S2BA 1EAH2 2Z79A 3ZN5A 2BEOA 4LO8A 4M3CF 2HWB3 1DQ5A 1LGNA 3M3IA 2RS53 3OYWB 3J8F2 4LUMA 1EP0A 4NOTA 5JZGA 1HV0A 3B3QE 3PVOA 4I0BA 1BVVA 2DFBA 4AEDA 5DG1A 4Z1VA 1I5ZA 5SV8A 1XE7A 1J59A 2FMYA 1XXNA 1BJQA 1MZEA 4SLIA 4MUVA 1O4YA 4Q0QA 2XJSA 2NP0A 1X8MA 5CBLA 2DTWA 1ND3A 1ZZ8A 3LKJA 4Y5Z0 4JDMA 3K48A 3AP7A 5FTTC 2Y0OA 4G4FA 3NVCA 3R6SA 2BFUS 4ISQA 1TMF2 3GBWA 1H4GA 2EXKA 1Q8QA 5GLZA 1B35C 1D0GA 4YW5A 3JZVA 1WMFA 4XEZA 3VKLA 1PGW1 5J98B 5K7PA 3WQ0A 4FP3A 1ND3B 1SBEA 2DCJA 3S7EA 4XFCA 1AR82 3V65A 4BCUA 2XUMA 2W68A 3KCCA 2JEMA 1FX5A 1TME1 2A6VA 1H8TC 4GKYA 1XYNA 4PLOA 3TNPB 2O1QA 2ZAAA 2ZZQA 1SMVA 2A6WA 4WM8C 5E16A 1YXWA 4GB31 1VJ2A 2B8MA 3SH5A 1MQTA 4ORFA 1WLDA 2YDEA 4B8EA 2QZ2A 3WLUA 4LULA 5LRRA 4E27A 4Q4V3 1RUE2 2HKXA 1ZBE2 4IV1C 4BYYA 1VBD2 5KWRA 4MXWA 4EN7B 4Q1PA 1PZ8A 4JTOA 4COVA 4H14A 4CYDA 1KJLA 5J48A 1DGWA 4XXAA 4M3CB 2JXAA 1YFXA 5EXOA 1CAWA 1COV3 4CZSA 2FZ2A 1QJY3 1Q8VA 2OUHA 1R1A2 3UKVA 2XB6C 2JECA 4LBQD 1AZDA 4E9KA 1ENRA 4MXWB 4LBNA 4A7KA 1S0GA 3M2MA 4AQTA 1GZCA 1ENQA 2PQQA 3INAA 5DZFA 1Q8OA 1W6QB 1MZFA 1J1LA 2DYCA 3KZ4C 1RUG1 4M3CE 1QH7A 4R9DA 4RHV1 2QQPA 3VBSA 5KXDA 4FTEA 1H0BA 3ZYPA 1QJX2 2XWBB 3RRDA 2WNEA 3KLSA 2RMU3 3N35A 2EXIA 1FOD3 1HKDA 4CEWB 4DQAA 1IKPA 2PHUA 1AYN2 1LU2A 4SBVA 5CAZA 1Y9QA 1F31A 3H7JA 3VBSB 3RZZA 2GNDA 4P9LA 2W0XA 3OD0A 3SH4A 1K5MB 1QOOA 4L99A 4XETA 4FTBA 1R082 4RS5A 1WBFA 1WCKA 3AFKA 2R061 2FZ1A 1GNZA 3H0OA 3DN7A 2X5IA 4DB5A 5BNOC 5FO9B 3DGTA 5BNPB 1QOSA 1AR62 4KGGA 1RJ7A 1G9AA 4CEYA 4XBLA 3VZKA 1RHI2 2GMMA 4JC1A 4IV3C 4QM9A 1W6OB 2EVXA 4XF9A 3VBHC 4P5HA 3POSA 5EWSA 3AYDA 4XYXA 2YHJA 1ASJ3 2JE7A 4FOWA 2D3RA 2HWE2 2X5IB 4E2GA 2VQ0A 3AKQA 3ZIWA 1VAVA 1CONA 4HSLA 3NV1A 1AL22 3BALA 1EV11 3RG0A 4HK9A 5J09A 1ALYA 1R091 1S1AA 1RUD1 4XJZA 2DUPA 1IZ3A 2C1FA 1UKRA 2GNMA 3VN4A 3KB5A 2JE9A 2CWMA 3AM2A 3ZXJA 1DQ2A 4DMIA 4CDXC 3ZXLA 1CPMA 3MIHA 2HWB1 1Y3TA 2RS51 1KFXL 3T1LA 1O3RA 3JD73 5L19A 3EJKA 1H8VA 2OZ6A 2R043 2YC0A 1RUH3 3B94A 4Q4X2 1LHVA 4LBQB 3ZFFC 2EA7A 4MYEA 5FOBB 1QQP2 1ZX5A 4Q4W3 3RYPA 5FOJB 1HV1A 1C5HA 2BGCA 1VB4A 2GAUA 2WFF2 1N1SA 2WLQA 3GZTB 4HKLA 5K0UA 3BTAA 1G9DA 1U5XA 1XYPA 4JAAA 3RDIA 3U11A 2X29A 4N53A 1EY2A 1LU1A 3FBYA 3OF1A 5GJ6A 1JBCA 1LHNA 1VAKA 4JDOA 1CPNA 3VBFC 4FO9A 3EXUA 3VBUA 3O14A 2BUKA 4COUA 4MVTA 5KXEA 3WHTA 2DVAA 4K21A 2GSYA 3LWCA 3SHRA 4LTAA 2GN7A 5C4WB 1RUOA 1POV3 2EALA 3ATGA 4N53B 5JMCA 4Q1RA 1AJKA 2RJKA 1RUG2 4ONUA 3VDDC 1IS6A 3M1HA 4GKXA 4DOUA 1MS5A 4FPOB 4Q4V1 3KQRA 2PHTA 2AZ5A 2OW4A 4UW5A 3KS7A 2CTVA 2XG3A 4ATEA 1C1FA 2ARXA 2R072 3A4UA 3JB8A 5L7OB 4PIYA 3QH7A 5BUVA 5DXDA 1V6OA 3MICA 4S2GA 1C8M2 1RVF2 4I01A 5A32A 4MGYE 1COV1 1GSLA 1QJY1 1GANA 1GFF2 3PVEA 4YM0A 4YGEA 5FO8B 1OI6A 2QJVA 5FLJA 4LE4A 1H1MA 4N43A 4DY5A 1NA1B 2QKDA 2R062 3QLQA 2A75A 3H9AA 4XDQA 2WWSA 2H0BA 4AK3A 5FBZA 3ENRA 2VUJA 2FHRA 2VUAA 3DPRB 1U5YA 1NY71 5C8CC 1RMU3 1WUVA 5GZDA 4COWA 1C1LA 1XU1A 1U5ZA 2R0FA 2D7FA 2VH9A 4QXKA 2B39A 3VBOB 4OI1A 3USSA 1YJLA 3MFAA 1GLHA 2JG9C 2RMU1 1FOD1 2G9FA 4FPEA 4XJ8A 4META 1KS5A 2BNOA 1EV12 2I07B 4MGKE 3AX4A 1JN2P 2P3JA 4RL7A 2RR13 3KSCA 4KU8A 1AX2A 3RJ2X 1Q43A 2D3SA 4BLJA 2JKBA 4FXGB 1GZWA 4HL0A 1QHDA 4QT6A 4B29A 1SQ4A 2E9QA 3DUIA 5JI7A 4IEYA 3J26N 1ZNPA 1PM7A 1RL3A 1LOBA 2K9ZA 1E57A 3AZWA 1AXKA 4OFGA 2ZOEB 2TUNA 5BNNB 4H7LA 1UL9A 4Q26A 4TSVA 2UY8A 5JCTA 3VZOA 2V73A 2O8QA 2EXJA 1AX0A 4HMZA 5FMOL 3JBG3 4Y20B 1DDLA 1ASJ1 4K1YA 1EPWA 1JW6A 1TEIA 1MS8A 4A2UA 3AMQA 4YVSC 1WW6A 3TWIA 1HRV3 1RUJ1 3VBRC 4BMBA 1IPKA 4P9JA 1MS1A 1YJKA 3JU9A 1LJ7A 4XFAA 1RUC3 1NCRC 2VY0A 2VW2A 1NZCA 4HKWA 5C6CA 3FMGA 4GMP3 4PDWB 5BY5A 4Q2FA 1NQDA 3SH3A 2VU9A 3AYCA 2WA3A 3IPVB 1C5IA 5J7MA 4JGZA 2CAVA 1GYKA 4F3JA 3JD71 2WIIB 1X50A 2UY9A 2D97A 1OOPC 2WA4A 2XKOA 2R041 1UPIA 1RUH1 1VB2A 1FYUA 4HBNA 2XPJA 2NN8A 2ZX1A 1OKQA 3BB6A 2VG9A 1WD4A 2ARBA 4GH4C 4Q4W1 2XBO2 1LHWA 4FP2A 4G9SB 2Q4SA 1KFUL 2WQ4A 3LA3A 3WT3A 2VQAA 3CNAA 4QPIB 1CAUB 4YW1A 3AP6A 2BTVC 3QH6A 1V6JA 1REEA 2DTYA 3DKWA 4GMP0 3L9JT 3X29B 2CNAA 2WZR1 1S0EA 5DUUA 1YI7A 4AGRA 4N9HA 3RMXA 1HRI2 3LA2A 5GLTA 2NMNA 4BE3A 3EO6A 2D6MA 1RUF2 2WFPA 4AI2A 3N7MA 3TN92 1GZ9A 3RQ0A 2ET1A 3I54A 3SCHA 4ISRA 4BIFA 5CFCC 1V6MA 3URFA 3E5QA 4KWKA 1WGPA 1NY72 2HWF2 3WW4A 5CA6A 3WG3A 4U2AA 4HFSA 3IBMA 1BEV2 3D5OA 1W6MB 5KHKA 1TME3 4CP2A 3TRSB 3WW2A 2E7TA 1J3RA 3FUQA 4KWLA 2XHKA 1CQ9A 5IT6A 1PO11 4XJWA 4AHZA 4RR3B 5HCAA 1O4ZA 2KA3A 3I7DA 2B5HA 2ZBJA 4AFAA 4HZFA 1LESA 3FZ3A 4GB33 2DCZA 2W39A 4LNVA 2X8KA 1PK6B 1ZBA3 1DLLA 1AF9A 4CDUB 2YYOA 1NCQC 1UN1A 2VPVA 2ZMLA 3WUCA 5DG2A 2YZ4A 2JDZA 3B93A 1EYBA 2R1DA 1CJPA 3J9SA 4XJ9A 3ZYRA 2ZGQA 4IEZA 3U07A 3WINE 1H4HA 4D94A 4TZDA 1YFWA 1BVP1 4OUMA 5FREA 3MLJA 1QWRA 4RFT0 4XF3A 2I74A 2TEPA 1B35A 3ZN6B 3MPBA 4LE3A 4NPRA 1RMU1 4YZ3A 3WCSA 5F6LB 1LEMA 4BZ4A 2ZGSA 4YVWC 2RJLA 3J4UH 5EJ3A 5JDBA 5FLHA 3TYJA 3KGLA 3V0BA 1XQNA 1YCIA 2VULA 2YGMA 4CDWC 4KGQA 1B35B 4XF1A 4I3GA 2RR11 1H8TA 4N9IA 1WA4A 3AMPA 3CJIC 3IT8A 4WM8A 2HYKA 5I8YA 5ACA3 4NHMA 4JGYC 5A33A 1YWKA 3AMNA 3ZMOA 2DUQA 2YMZA 4K7JA 4P9GA 5JSRA 3WP6A 4QGNA 4I2OA 1PVC3 2WNUB 2PLV2 4FVVA 4IV1A 5GLVA 1H8TB 1VP6A 4XHBA 2QFEA 3ST7A 4GWMA 4EWEA 1RUH2 3WUDA 3SCGA 3HT2A 4DINB 4GXLA 3NV2A 5FAXA 4Q8KA 1BBT3 1LODA 3WP4A 3ZFEC 3M8LA 3JBG1 3SLIA 4ATFA 4AFCA 3IDEA 4I09A 1UCXA 2JENA 1HRV1 1LGCA 4XBQA 1QJU3 5J36A 4PBPA 1YIFA 2XJTA 4RQPC 2QNKA 4Y1UA 1O4TA 2E63A 4GMP1 4K6BA 3OPZA 2IFRA 1F8VA 1DZRA 4LHKA 1R093 3ILFA 4YLZA 4E2QA 5L36A 1UW8A 5BYNA 5CNAA 1UX6A 1LGBA 1PO21 1GQHA 1YHFA 2D43A 4WZFA 1LOFC 1O7FA 1HW5A 4FT8A 3NSTA 2XLGA 2XJVA 2GH2A 3C2UA 4CDQC 1QNYA 3N7JA 4Y1YA 1DU3D 1JH5A 1ZYBA 2ZZJA 4QQLA 2LUWA 2JG8C 2Y26A 5HI0A 1UD1A 4MH0E 3H50A 3AYAA 2D5FA 4AVTA 5JOYA 1AL0G 3WY6A 3MI8A 3NJZA 2ZAHA 4O9GA 1KQRA 4XOGA 1REFA 5BNOA 1YLLA 2ZGTA 2O0OA 5JZGB 4AEKA 3H7YA 4L8QA 3VZJA 2NPIA 4EN8B 4YFZA 4AEDB 3ZFGC 5HXVA 5GLWA 4IV3A 5EYYA 4GA9A 1Z0HA 3VBHA 1NXD1 4XFIA 4AGGA 4CTEA 1TQ5A 1VRH1 2KXLA 1G86A 4KQ7A 3BOPA 3TB0A 1IGOA 1JTZX 4ES9A 4BMEA 2C5DA 1REDA 3AMMA 2NM1A 3ZSLA 5AFBA 3ZXKA 1SLCA 1S55A 3VKNA 1YFUA 1FV3A 1HXS2 4IV3B 1OLQA 2OVUA 2HWC3 5J3UA 2JJ6A 1AR72 5I0TA 4CDXA 4JRAA 4HPKA 4R8HA 2R6QA 2BVVA 3B9CA 1ZBA1 3B69A 2MPFA 3RYRA 4QM8A 3W59A 3VUOA 2WC2A 1SBFA 4C0BA 1C4RA 2I45A 1RUI2 1H1IA 2A5ZA 3KCYA 3ZFFA 1F5JA 3M3OA 2MEV2 3FE5A 4CP0A 5C33A 1ZVFA 4TLFA 1MQTB 3AZYA 4L92A 4H7MA 1CESA 2LTNA 5KC6A 1N1YA 4P9WA 3LGRA 5KC5A 4MLOA 1D4VB 1O5UA 5FLIA 3GBFA 5J96B 2RM23 3BCWA 5JIAA 4DXZA 3HT1A 3ZFFB 2ZJCA 2VVEA 4FPLA 2B7YA 4OHXA 5LEJA 4HETA 2GC2A 3VBFA 4Z8BA 1CAWB 1U5IA 3WX5A 3ZMNA 2ATFA 1HRV2 2C9AA 1HQLA 5JIUA 5B2GB 1VBE3 2XLAA 1VBC3 3MLKA 4KBBA 1VBA2 1SCSA 1RUC2 1W6NA 2PHDA 4M0HA 3RPQA 2RS13 3NV4A 3VDDA 3T2TA 1VIWB 2R0HA 5ACA1 4YGDA 4E2SA 4XZPA 1QDCA 3LOIA 1FMD2 1M4WA 2DCKA 2HWD2 3ZDSA 4YM3A 4ZU4A 4HVOA 5F5QA 4AEJA 4QQPA 1YUDA 4CP1A 1PVC1 3WHUA 4B7KA 3AJYA 2UWBA 4HLTA 3VDDB 1H1AA 1VAMA 4YG0A 4NWVA 1CX4A 1QOTA 1DG6A 2RS33 2NQYA 2ZTNA 3ILNA 4DPNA 4FQ4A 1BBT1 3WV6A 5FRAA 3DF0A 2WNVC 3S30A 3ZPYA 3SMHA 4W6WA 3DV8A 1PIV3 2WKKA 2D6KA 4JDNA 5T5OA 4NWWA 2VMHA 4QMAA 1D4M1 2BVBA 2UURA 3VZLA 1V6NA 4RS5B 1QJU1 3FC0A 2UU8A 1PZ7A 2IXCA 2IXKA 4B4QA 3D8CA 4DRVA 2ERFA 3HWJA 2ZABA 2PAKA 1FNYA 5C8CA 1PGW2 1DQ0A 1RUJ3 2ZMNA 2MNGA 4FOYA 1SLLA 3ZYJB 1F9KA 4Q27A 1OHFA 3HQXA 3PJYA 4CEYB 3G7DA 1RIRA 2PN5A 5FMOS 2JG9A 3CU7A 5I0UA 5BPXA 4PQ9A 5DDJ3 1YYNA 2ZHMA 3CJXA 3I4IA 1CGPA 1OLRA 2CGOA 1TME2 3ES4A 1DGRA 4Y4YA 2WS91 2YV8A 1LOCA 3AKPA 3WQ7A 4WM7C 4GB32 4EN0A 1AX1A 5LEKA 1N3PA 3MF9A 1MEC3 4QPYA 4J6GA 2ZHKA 4B3NA 2QDNA 3OGGA 4X8NA 2WQZC 4OHYA 4M00A 4MGIE 4N7UA 1MS0A 2D6OX 1S0JA 2BFUL 3OCPA 2B42B 4OHVA 5E89A 4FBFA 1HQWA 4NHLA 4IQPA 2WZR3 1O91A 1A3KA 2K0GA 1QU0A 1LHOA 5FFOC 3AB0A 4FCAA 2P37A 1ENXA 2UYBA 4YVSA 1J3QA 4MZUA 4I3PA 4Q4Y3 5K0UB 1XU2A 4LO5B 3H3ZA 3PMEA 3VBRA 2D40A 1QXJA 3KGZA 4WV8A 4FTSA 1Z7S3 2VXRA 1OQEA 5KBFA 2A6XA 4X6RB 1NCRA 4EV0A 3IDCB 3E5XA 4L9BA 4DNYA 1I6XA 2XL7A 1BMV1 2HWC1 4RHV2 2TNFA 3IDBB 1Q8SA 5J37A 4B4RA 4CEWC 1BYHA 4JTNA 4IEUA 3VBUB 5AVPA 5CB7A 4PCRA 2XWJB 2WZPP 1PO13 2G4IA 2GC1A 4QHBA 1OMIA 3Q9OA 2GMEA 2D93A 1OOPA 4D7YA 1VBB1 1K5MC 1NCRB 1G8WA 1MZ6A 4KU7A 1MZ5A 4MSVA 5HCBA 4LA3A 5GALA 3JUUA 1KDMA 4GH4A 3APBA 2OYZA 3B00A 4R9AA 2A3YA 1ZRFA 1W0PA 1JUHA 1ZRDA 2EF6A 1DYKA 5I8TA 2ZGOA 4WVWA 4LBOA 1YO8A 4YW2A 4K1ZA 1LR5A 1X36A 1NLSA 1FXZA 1OOPB 5BNPC 1HQNA 2RM21 1HX6A 4HT1T 4XMIA 1LRHA 1Y7BA 3RNSA 4RSUA 1LB2A 3TOJA 1J58A 3MPPG 4FPJA 4Z92B 3QACA 2Y38A 5A32B 4YZ4A 2P34A 4N7IA 3VHRA 4YZ5A 5T3NA 3JQWA 4N43B 1VBE1 3WG2A 2AYHA 2Z2SB 5CFCA 1VBC1 2DV9A 2P3KA 5JVVA 2RS11 4U36A 3LSEA 2ZMKA 3NAPC 3P3NA 1NG0A 5T5LA 3VGIA 2D44A 2YPJA 2D3PA 1X8EA