4P9JA

Crystal structure of rabbit ryanodine receptor 1 spry2 domain (1070-1246)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
180
Chain Sequence
b'SNADRVRIFRAEKSYTVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ryanodine receptor 1
publication title Crystal structures of wild type and disease mutant forms of the ryanodine receptor SPRY2 domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 35
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4p9jA00
4QT6A 4V1PA 3KB5A 4WVMB 4N7IA 5JIUA 3TOJA 4P9JA 2IWGB 3UV9A 2YYOA 4X8NA 2LM3A 4X8PA 4N7UA 5JI9A 4KG0A 3ZO0B 2E63A 4B8EA 2FBEA 4P9IA 5JIAA 2VOKA 2YUEA 5JI7A 4P9LA 4B3NA 4WVMA 4XW3A 5C33A 5F6KA 5F6LB 2WL1A
chains in the Genus database with same CATH superfamily
4ZS3A 3VBUA 5L9RA 3LA2A 4Y26A 1JYCA 3AYDA 2YHJA 3DKWA 4XPVA 4JDNA 3MUZ1 5T5OA 1W8NA 2AH2A 5LY1A 3BVCA 1FMD2 1FPN3 1LECA 4GWJA 4OYUA 2VVEA 3MHZA 4HBNA 2QBXA 2WA4A 4KMQA 4XXAA 5K0UA 4TYSA 1DYOA 1SLLA 2XBO3 4C0HA 1TG7A 2HWD3 2XUMA 1DQ5A 1L7QA 2XVLA 1IPJA 2ETEA 1UX7A 4YW2A 1ENXA 4IV3A 1HRI1 1P8JA 5FYYA 5LZ6A 1FAYA 1OKOA 3M1HA 1UYYA 1L7LA 4QPGA 4D6QA 2ZGTA 1V6OA 5FPAA 4MG2A 2W2IA 4HKOA 1S0EA 3JQWA 4RFRB 1ND3A 4AGRA 1J3QA 2BRTA 2YGLA 1POQA 3D82A 4K7JA 2VUDA 1VBA1 2VE1A 1W8FA 2X10A 4MGTA 1Q8VA 2W47A 1AYM2 4OFGA 4A2UA 1U5IA 1S2KA 5FPZA 5JDBA 3T0DA 3U78A 3IDBB 1GBGA 1OLRA 2AREA 5FBZA 3KGLA 3AZXA 2WUHA 5H9PA 1HB3A 3KLSA 3PMSA 4NR1A 4NPLA 1NYWA 2XVKA 3R05A 4DXTA 1RUH3 1VBD1 3ZSMA 1YO8A 1I5ZA 4Q0QA 3VKFC 1ZZ7A 1PGSA 2OUHA 1LHWA 2ZGSA 1QDOA 5EYXA 3N9MA 1SHWB 3AKSA 5A7WA 4QPWA 2FMDA 4XFAA 3WW3A 1AR91 1LTEA 1D4VB 2QTWB 2WWSA 4LBKA 1UOGA 4NWWA 2P1BA 4WM7B 5EPAA 5CA6A 2BFUS 4WVMB 4CUAA 4R9AA 1W2AX 5CAZA 4LLFA 2RJKA 2Y26A 4X8NA 1W04A 4K9SA 4AZZA 3OY8B 4F7ZA 1IG0A 1C1FA 3WDTA 1ULPA 1GOHA 2Y38A 3IIAA 5FMBA 1EUUA 1XNBA 1RUF3 1FPN2 5CKNA 4RS5A 5J7MA 4LBOA 4QX7A 5LBBA 1WD3A 4QXCA 5K4LA 2B5HA 2XBO2 3T2TA 1YFUA 2D93A 4CYDA 2HWD2 3QOPA 1RITA 2BVVA 1A34A 3M3EA 5FZCA 4AXOA 3PUQA 4LULA 2K0GA 4AAPA 4I0BA 1MEC1 2Q8CA 2PAEA 3A0NA 1QEXA 3LWCA 1FV2A 2ZTNA 4XBNA 1K12A 1R1A1 4AEDC 5L9VA 1VRH1 2XJPA 3IBMA 3OEAA 1GMMA 2TNFA 4RR3C 5FKBA 4FPFA 2VZQA 4J1WA 2FCTA 4QKFA 2YROA 3K3NA 1BBT1 2RS52 1BVVA 2C1FA 1UN1A 4FFFA 4DFSA 4YZ2A 2EALA 3WP3A 4IGPA 1LESA 3ZYIB 2WAAA 5C3QA 5CFDB 5JOYA 2B42B 5JMCA 3NNMA 1DLCA 2R072 3MIBA 1QXJA 1ZRCA 1KD7A 3HQRA 3J9SA 4FAGA 1O59A 3F2ZA 4R9BA 1RUH2 4P08A 1H8TB 4PDWC 2YU2A 1ZBE3 4EJRA 5FFOC 3S6PA 4W6YA 4CCMA 1CAXA 2Q0AA 3THTA 1NG0A 2WZEA 4P9WA 2VY0A 4FOVA 5FUNA 1UKRA 4A7KA 2ZPXA 3AYAA 1DQ0A 2RJLA 5LA1A 5C8CB 2XLGA 3B93A 3QACA 2R7EB 3W58A 5BYNA 5CB7A 1W39A 4IEUA 5IVJA 1Z7S3 1OLQA 5FZ1A 3VHRA 2JDUA 4Y1XA 4LBNA 2I74A 2YGMA 5BXXA 1A8DA 1PMJX 4IEXA 1Q8OA 3ACHA 4BQXA 2XB6C 3M3IA 3VD7A 1CVNA 1XNTA 4LBQA 3RZKA 3ZXAC 2CAVA 4DMIA 2HWB2 4XHBA 4BLIA 3KQ4B 3JZVA 1NZCA 5A7PA 4Z8BA 1HIXA 5FTTC 3CJXA 4Q4W1 3VBHA 1O4YA 5FO9B 5SV8A 2ZGUA 1GLHA 4ZU5A 2NP0A 1B35A 1YFYA 1O5LA 1UU6A 2RM21 1VBE1 4ZU7A 2WO3A 4FPYA 4FFIA 4N9IA 5FYZA 1PNFA 3OYWA 4Q1RA 2WYSA 4QX8A 5J48A 1JXNA 2RR13 4LHLA 3UKTA 2GZWA 1IS5A 2ARBA 1H1IA 2FBEA 4TN7A 4QPIC 1QJY1 3J7NA 2QQWA 3MGUA 5ANNA 5LRSA 3UK9A 3VD5A 1Y3TA 2VO5A 5FZFA 2HBTA 5DZEA 1W2OA 2RS31 4HKLA 3THDA 2FCVA 4P02B 1SLTA 1U5XA 1V0AA 1XNCA 2TEPA 1NCQC 3D3AA 4Q4V2 3K77A 3WY6A 3ZKYA 2J1VA 2VGDA 4AEDB 5D21A 4AEKA 4ONUA 1DFQA 3I2KA 4IEWA 4JDOA 1S0DA 4RR3B 3ZIWA 4FPHA 4AVAA 1KJRA 4NAMA 5EWSA 5IFTA 1DG6A 3LAGA 1ZBE2 4NOTA 5JAXA 5EYYA 4GULA 4UW4A 4M4PA 3UV9A 5FYUA 4CDWC 4IEQA 1X33A 2V72A 4XTPA 2HYKA 2EXJA 4FCAA 2CYFA 1NCRA 3QD6A 1W2NA 2VMHA 4QHZA 2A6YA 2Y8KA 4WVWA 2PHDA 1A8MA 4UW3A 5HCFA 3KF5A 1Z7S2 2AACA 1PK6C 2JXAA 1RUD1 4R8HA 1XBFA 3T08A 1DF0A 2JICA 3FJSA 3IIIA 4C8DA 2YC2A 3W59A 1ND2C 3H1MA 1T6GC 1C8M1 4QX5A 4XXPA 3B02A 3I3QA 3AKTA 5L36A 2QDNA 1RUI2 1ZZ6A 2BZDA 2ZBJA 1W8WA 4HONA 4YM3A 4UI9L 4QM9A 1NE4A 3ZPYA 3V0BA 2JG8A 4JQTA 1MS1A 3GJBA 3VZLA 5CNAA 5HCBA 2BEOA 1XQNA 1HB1A 4CDXA 5I0SA 3IPVB 5A32A 2X29A 3K48A 1X9PA 5ABJA 3ASIA 4Q29A 1AR61 2VVDA 4YVSC 2WC2A 3T2OA 3E6DA 1XNDA 3HQUA 4AFAA 3HEIA 1QJX3 2VZ3A 2WABA 1D0GA 1TEIA 1COV1 2RR12 4GB33 4OULA 1GR3A 3C8XA 4NUBA 5J37A 1K5MC 4B3NA 4E2QA 3WF0A 1RUC1 3WW2A 1OBNA 4BMEA 2RS11 1IZ3A 2JDPA 2K46A 4AHZA 2QQIA 1JBCA 2VZVA 3VDCA 3T30A 1CX4A 3OGRA 3Q8EA 3RFRA 1NZIA 5C6CA 1W03A 2JDAA 4XYXA 2YZ4A 3EXUA 3RZZA 2W94A 2XWJB 4ZKTB 4QGMA 5LK5A 2OIIA 3RI9A 5JMOA 1PO11 5F37A 4P9YA 1CAVA 4AK3A 3ZDVA 1ULDA 4B4PA 5FV3A 1WCQA 1W3XA 1UXXX 1NCQB 3ZFEC 2YFUA 3J7LA 2SLIA 2EIDA 1AL23 3V0AA 4BPZA 1AVBA 5BNPC 3W5NA 1CESA 2EIGA 1H8VA 1PGL1 3OD0A 4ISRA 4G4FA 4XFHA 4FPKA 2ADDA 3GXUA 1OPOA 5GALA 4OI0A 4CDWB 3D6EA 4CUBA 2BUKA 2D6LX 2ZCWA 1LU1A 4FFHA 4AWDA 2XMLA 3RJRA 4AVVA 2ZX0A 4K21A 4KI5M 4YW6A 4AVCA 3AFKA 1R092 3AP9A 4LITA 1RJ7A 4XMAA 3RWNA 5HV0A 1PMHX 5FYVA 2JD4A 3VBSB 4IE7A 1FATA 1S0JA 4N43C 3U14A 3GHMA 1BEV2 4UYBA 2E33A 1G86A 1ZA4A 4R9CA 2WWJA 3SKVA 4HVQA 1TMF2 2DCZA 5JIAA 4DS0A 4FSJA 1PMIA 3I2JA 2DCYA 4KNCA 3CNAA 1Q8SA 1N1TA 4P5HA 1E57A 2B7YA 4KU8A 3OJBA 1D2SA 4D7YA 1OOPC 1AR81 1RUG2 4HFSA 1JYVA 1DZQA 2UWCA 1GP4A 2G9FA 3BU7A 1C5IA 3EQEA 4YVSB 5A1LA 5LBEA 1RJ8A 4ARXA 4GH4A 4C0BA 3MBWA 2I2SA 1O3RA 2GMPA 5T5JA 4HK8A 4ISQA 5BNNC 4MHRA 1K5MB 2R30A 3TYJA 1Q43A 3SNMA 4PF1A 5J1XA 5A3WA 2IFRA 5D8AA 1H6XA 2H0VA 4XJUA 2FQPA 4WM7A 5FOBB 5KR7A 4EWEA 1AL22 4WVMA 3GJAA 1H6YA 1SBFA 3H7JA 5B4XA 4QDSA 4UFKA 2A5ZA 4DRVA 1HW5A 1PHMA 2ZEYA 4K6BA 1AJOA 1ALYA 3K51A 2YFZA 1VBD3 1V6LA 3VLBB 2WNEA 3HJRA 4QWNA 3I2DA 1OA2A 5BNPB 5KWRA 2WIIB 1HRV3 2JB4A 4H7LA 3TBDA 4OZOA 2DUOA 4I3GA 4BJ0A 3ZR5A 1AXKA 1YHFA 4ET7A 4M3CF 2G19A 3DYMA 4XBLA 2C5DA 2R0FA 5ISLA 2J1RA 2VTFA 3JB8A 5L9BA 1Y4WA 1YNAA 2ARAA 2PHLA 5FMOL 2V5DA 2P3JA 5E88A 1VE0A 3X29B 1FPN1 3HIFA 2A75A 3APBA 4ASKA 2HWD1 5H9QA 4N43B 5FZAA 2DVFA 2XL9A 5A3PA 4UFLA 1ZYBA 5F7UA 2RJ2A 4XFCA 3D5OA 3ZSLA 5FP4A 2YMZA 2VQUA 1Q3EA 3HD8B 3CEWA 3HOBA 3T3YA 5JLVA 2CTVA 1WZXA 1MEC3 1Q5OA 3NWKA 4CCKA 4Z2AA 5CFCC 3KHBA 2VUCA 3UKNA 5GLUA 3PDQA 4UF0A 3ZYPA 1WLDA 3ZYBA 1QIQA 1JZ5A 1F5JA 1OOPB 2OW4A 1ZA7A 1QJU3 2RS51 3FHAA 5CBLA 3BB6A 4LIVA 2XDVA 5C33A 3POWA 4DB5A 4PIXA 1GQGA 1OVPA 2R071 4RA0A 1ST8A 3POSA 4Y3OA 1U12A 3ZSJA 5BNNB 5HCHA 4CU7A 1F4AA 4Q2FA 3MDPA 4Y22B 4YZ4A 1RUH1 3FFQA 5C3SA 3NJZA 3QCWA 4YW3A 4E9KA 1UIJA 2JG9C 4EZHA 1VBD2 5FREA 1F9KA 4FOYA 4KG0A 2ZAAA 3ZR6A 4XF9A 2C4XA 4PLNA 4S2GA 3OBZA 3RG0A 3WDVA 1HRV2 1S0GA 2PA7A 3J4UH 1T6BX 3GDBA 5DAXA 3WSOA 5EIYB 5I8YA 3SC7X 2CY6A 4XE9A 3S30A 3VGIA 3KV6A 2ZMNA 3ZYGA 1AHSA 5T55A 5KHHA 3RZGA 1Y43B 2X8KA 4WM8B 3I3MA 3H3LA 3CZJA 4IE6A 4AGGA 5A6ZA 4Y24A 3PL0A 1J59A 4CCLA 2HWB1 1G9FA 1S0FA 4EROA 1YQ5A 5FZ8A 1YWKA 2V73A 3GCXA 3P1IA 3WHTA 2ZGLA 3O14A 3ELNA 1DGWX 4RL7A 2DTYA 5A70A 1GZWB 2BJSA 5DDJ2 4C1XA 5C9AC 5EXOA 1SCRA 4BU2A 3EJKA 1NAEA 4NAOA 3MV11 4AEDA 5FP9A 2RM23 4RR3A 3SITA 4X6RB 1E5SA 2EXKA 4RQPC 5A6QA 4CEWC 3SEEA 1CZSA 3KMHA 3N7JA 1H2MA 1QJU2 3RVHA 5F9TA 1ZZ8A 5DG1A 1UMHA 4XJ9A 1CIYA 1QJY3 5CFCB 1VB2A 4DZGA 4Q4V1 4AI1A 1ODMA 4PDWA 3FMGA 2SBAA 3N3HA 2DFBA 5IT6A 3SCHA 1ZZCA 1D7PM 1MS9A 1S0CA 1WMFA 3CIHA 4PIYA 3ZM8A 4Y33A 1ZBE1 1UQXA 2PHTA 3WUDA 5A3UA 5C8WA 3CLPA 4RSUA 1PX4A 2F4PA 1REFA 5FQ0B 3KV4A 5J36A 2GC3A 1N3QA 1AUYA 1E5IA 2BNNA 2VQ0A 3EB7A 2UWBA 1SQ4A 1Z7S1 1UOJA 1YIFA 2JDKA 5FMOS 1LEMA 1UZZA 2EA7A 3VB9A 1H4GA 1KRIA 3GYDA 3BCWA 5FPXA 4QGLA 3IPVA 1RUD3 4YW5A 1X82A 1STMA 1XPWA 3C7HA 3H3UA 4XFIA 4A6SA 3WT3A 4Q8LA 3VBFC 5LWBA 4MYEA 1RUI1 4B4RA 2DVGA 3DPRB 2BP6A 1CAUB 4B1LA 1LEDA 5HBAA 3AP7A 3KQRA 1GP6A 2BVBA 1ACCA 2PHFA 3NV2A 3POFA 4QDRA 2WA3A 4XDQA 1RTVA 2GC0A 3N36A 2JIGA 3T1MA 1JMUB 1CD3G 3B01A 2RM22 2EIEA 2J1SA 3MZHA 1DP0A 2P3KA 1YEWA 4QPIA 3RDIA 4CCDA 4DEQA 3GZAA 5CISA 4NIGA 3H42B 1GQPA 1SLBA 3V64A 2RR11 2X5IC 5C9AB 1CPNA 4XABA 2BWAA 1NCQA 2D3PA 4EQVA 1MVQA 1N1SA 1LJ7A 1QKQA 2J22A 2Y6FA 4X8PA 2GMEA 4BLJA 1W6PB 4N7UA 4RQPB 4EV0A 4CEWB 2RS13 2Y6KA 3DN7A 4D7SA 4AL9A 1FI2A 2WO7A 3ZN5A 4N53C 4D0QA 3H9AA 3ZMNA 4KGQA 4CDWA 1WGPA 4KG8A 4SLIA 4AQ2A 4E4DX 1JTZX 1XB9A 3NO8A 2Y33A 5CU1A 1RIRA 4NHMA 4XW3A 4MVTA 1PK6A 3VN4A 5C71A 3JD71 4XQWA 1OSGA 4IE0A 1UXZA 5KHKA 3WV6A 1T2XA 3OBRA 2PAKA 3IB3A 1ND2A 1S0BA 3L2YA 5A6XA 2VL4A 2WJSA 3I3EA 3FE5A 2MPFA 4AG4A 3AB0A 3H0OA 4URAA 4DNYA 4KL1A 4ES9A 2RHPA 4X6QB 3OSDA 3A21A 5C3RA 4NMIA 2HEYF 1BK1A 1R091 1MZ5A 1W06A 4I02A 3NSTA 2Y64A 1GYKA 2W08A 5T5LA 5DAVA 1H9WA 2HEWF 4K8RB 3WHUA 2XUEA 4UT5A 1V70A 1BEV1 4A7ZA 4YVSA 4NIHA 2VULA 2A7AA 3ES1A 4QU2A 1WMEA 1CZVA 3UNPA 1TMF1 4FP2A 5AC91 4Y1ZA 2VCBA 5F39A 1K5MA 2IXLA 4XC9A 4FPOB 4LEJA 2XQXA 1RXGA 1MS5A 2JENA 4L9BA 4NO4A 1RUG1 3KT1A 2W95A 1WD4A 3ES4A 1AR83 1UY0A 2O0OA 4PT6A 2GH8A 2Q1MA 1TME2 4MXWB 3ZX7A 3Q8BA 4JX0A 3U75A 2C6SA 4JRLA 2XL7A 3I4IA 1IG3A 3ACGA 4CTEA 3WP5A 1ZZBA 2G9ZA 2WSVA 4GJZA 2WZR3 3ZFEA 1YLLA 4G3YC 4EE2A 2BOJA 2PELA 4IV1C 1O3SA 4H14A 1CONA 2JDZA 4B1MA 5BNPA 4AFDA 2NMOA 4QX0A 2PQSA 5AFEA 2ID4A 4OCTA 1G6NA 2XWBB 3F95A 4CP9B 5FRAA 3BOPA 3VZNA 4N53B 1EY2A 1IKQA 4XQ4A 2PMWB 1UL9A 2ZX2A 1IS6A 4F3JA 1RC6A 3TNQA 5L73A 2DYCA 4OLLA 2HBUA 3T4HB 2BYVE 5LB6A 2XHKA 5DAWA 1MZEA 3HT1A 5ACA3 1REEA 3LQCA 4CPBA 1V6JA 4XILA 3ZIXA 2ENRA 1Q56A 2VNVA 4N43A 1UCXA 1ZM1A 2DBNA 3VKNA 3VZKA 1W6MB 2OT7A 5FZ0A 4QQLA 4AEMA 4FP3A 1KGYA 3IM0A 1V6NA 1OURA 1RXFA 2XQRA 4CU6A 5FOJB 3KVBA 2J1UA 4V2VA 2BQPA 1WMXA 3FHIB 1WCKA 1OOPA 1BZWA 2YBSA 2GMMA 1SDWA 2ZGQA 5LY2A 3WDXA 5FY4A 3ABZA 2FCUA 2GN7A 5GLZA 3BIEA 3AKQA 3L2HA 1AR82 2PHWA 5A33B 5BNNA 4Y22A 3AFGA 3M8LA 2BGCA 4AEJA 2P34A 4LBLA 3NNJA 5IW0A 3VKMA 5CFDC 4QB2A 4XETA 5JXJA 2OXBA 4LKDA 2UWAA 2WZR2 2XH6A 3N7LA 4K8FA 2FD8A 3ACLA 2RS53 2Q8DA 1H8TC 3J26N 3LB9A 3OCPA 2XKOA 1LOAA 1JOBA 4CUGA 3RZHA 2HEVF 2QJVA 1LR5A 1VP6A 4P5YA 4XDOA 3R6SA 2QQPA 1PM4A 2R073 1BJQA 4QPYA 4S2DA 1HN0A 3G6JB 4DINB 5C8CC 4IV1B 5G05L 4XZUG 4CDQC 2Z69A 4UBHA 2WSUA 5IVEA 3E5UA 4PLOA 1TNRA 5ACA2 3WOGA 2DVBA 3BOWA 5GM0A 3CJIB 4YPJA 3WQBA 3CF6E 4YG6A 4ASLA 4IETA 2D44A 4F8AA 4YZ3A 4TTGA 1BYHA 1NLSA 1HRV1 3P5BA 3I7DA 5BPXA 2B46X 4HXCA 2E9QA 4U2AA 3WVJA 1QOOA 4JHTA 1XNKA 4QKDA 1KFUL 1CWPA 3ZMOA 1GANA 4AQSA 4CCEA 2VNRA 2WQZC 3H8RA 4M4RA 3ZYJB 2NQYA 4Y4RA 1GNHA 1JYWA 4CZSA 2BERA 4COVA 1ODNA 3AYEA 1OF3A 1IGOA 3LGRA 1WLTA 3R4DB 1LOBA 1C4RA 2I07B 1R64A 1A78A 4JVAA 4PQ9A 3DECA 1F35A 1V6KA 3CBNA 4J1XA 5JOWA 2HWB3 4DXZA 4YM0A 4B7EA 1CJPA 2R061 3E5QA 3MF6A 4FOWA 3PU3A 5I91A 2GN3A 5D2AA 5DDJ1 4CCNA 5CFCA 3POYA 2ZHKA 3MF9A 2YU1A 3WF4A 4DQAA 1LOEA 2VCAA 3O5SA 2VW0A 1PIV2 3K4AA 4JCKA 3I2OA 2JWPA 2QQUA 4LA2A 3AC0A 4Z07A 1SFYA 1X36A 1S0IA 1VJ2A 1UIKA 4WVZA 1S4CA 1QJU1 4INDA 5FXXA 2VBBA 5DAPA 2HKXA 1IKPA 3SHRA 2TUNA 1W6NB 2ZA9A 4XF4A 5KHIA 2D97A 4AI3A 1JW6A 2PLV3 2WFF2 3VBRC 1WMDA 4CDUC 1ASJ2 4CP0A 4GKYA 5JWPA 4Q4V3 1QH6A 5G04L 2JG9A 3V56A 1OHFA 3WG1A 1SMVA 3VDDC 1I5PA 2R043 3WCRA 5CVRA 1QJFA 2WNVB 5DAQA 4QX3A 4HLTA 1I1EA 3NRUA 5LK7B 2NMNA 3KZ4C 4I30A 1XRUA 2W3JA 3HN3A 4HZFA 4AAXA 5J3UA 1CAUA 3MPPG 1OT5A 3NV1A 4MGIE 3B3QE 4Y20B 2BWCA 1J83A 1OQDA 4JKKA 2JE9A 5CYYA 3SKJE 4AI9A 1UY3A 4JAAA 4CDQB 1UZYA 1DHKB 1UPIA 4GWNA 3T2QA 5A3MA 4C91A 2OUJA 3OB8A 3I2GA 2GNBA 3E97A 3OF1A 3PTRB 1XU2A 1UPSA 4RGKA 1CJDA 3AP5A 2VZUA 4AFCA 4XAEA 5FR3A 1RUI3 5C9AA 2Z4FA 1E5RA 4UW5A 5KC5A 3H8XA 4LPLA 4BWOA 4XQDA 3SH5A 1NE6A 1POV1 4Q1PA 2LUWA 1W6PA 2GU9A 3AJYA 2VJXA 3IN9A 4RQPA 3WUCA 4BB3A 4FTSA 2JDYA 4AQTA 3C3VA 3TNPB 5EQUA 1QQP1 4IW3A 3RI8A 5JCTA 1RINA 1Z0HA 3VDDB 3AKPA 1JZ8A 4CU8A 1HQNA 1NQDA 1UY2A 3FBYA 5FZMA 5FZIA 3CU7A 2OA2A 3SISA 1W0NA 1O4TA 5DUXA 3UYJA 4KQ7A 1US2A 3IMMA 4OUEA 2QQMA 4PCRA 2E31A 2QUOA 3LF7A 4GKXA 1H2NA 2PLV2 3P3PA 1ENRA 4JGYC 4EN0A 2RMU3 5EFUA 3WG2A 1QJZA 4CEYC 5F6LB 3LEKA 2PFWA 2R042 4E2SA 1IHMA 3LPGA 2ATFA 3GBFA 3VBRB 1PZ9A 1YC61 2WR9A 5F3GA 3ZFGC 2VH9A 4CDUB 2D40A 3ZN6A 4PI2A 4ZPIA 2FDKA 2DUPA 3JD73 1O8SA 1QU0A 4QQ2A 3MO4A 1JZ7A 2Z5WA 3JUUA 1NA1C 1W9WA 4N8MA 3VZJA 3VBFA 3LFIA 4FAHA 3KVAA 2B8MA 4Q0UA 3ZPOA 5H9SA 4W8JA 4GIQA 2IC1A 3A0KA 2H6CA 1KJLA 2EXIA 1AYN3 3VBSC 3AXDA 3BI3A 3CHXA 5FY0A 3AKRA 4J25A 4QHBA 2WWUA 3T4VA 3HNMA 4I0AA 2WL1A 4MSVA 1DYPA 1R093 2JDMA 2ZXQA 2VMCA 5I0UA 3UGHA 1DGRA 4JGZC 4H7MA 1W28A 1OD5A 5GLWA 2A6ZA 2CHHA 2DCJA 4Y1UA 4A3XA 4EN7B 3B5LB 1BVP1 1F31A 1EYBA 1W8TA 4MXWA 1BEV3 2IFWA 4OHZA 1YCIA 3AZYA 4LORA 2X5IA 1CAWA 2Q5TA 1DIWA 5IVFA 1ZZ9A 2OYZA 1S2BA 2JJ6A 1LHNA 4NPRA 1YUDA 1TMF3 2BNOA 4JV4A 5AC93 3PIJA 4P14A 4L99A 1KXGA 2P3YA 3DXTA 4N90A 4NVPA 4E4HA 3UESA 1EAH3 2Q1ZB 2WAOA 2XJQA 4CP9A 4WBBA 3ORJA 1RUG3 4N53A 3WW1A 2VBPA 1W8ZA 1RUJ2 1TME1 4W50A 1J84A 2A71A 4E2GA 3JBG3 5IK4A 3O1UA 2RMU2 5FY8A 3U4SA 1GWMA 2UY8A 4A42A 4DIQA 5F5CA 3S7EA 5FK8A 3S7IA 5A3LA 5LEJA 5A80A 4Z92B 3GZUC 4O65A 2DURA 4H3WA 4GD4A 4IXLA 3VZMA 5FO8B 4AYUA 4JGYB 1BQPA 2J7MA 4JTOA 4CEYB 1UYPA 3AYCA 1MS8A 3JD72 4FXKB 4AVSA 1YRZA 3T0AA 3BALA 1BHGA 2WKKA 1JUHA 4FTBA 4LUKA 2VMIA 4XBQA 2C9KA 2N7GA 1H1MA 3DEMA 3ZFGB 5C7GA 1AYN2 1QGLA 2GC2A 3O1PA 1SLCA 1VR3A 3DF0A 2ZGOA 4LO8A 4A44A 1AX2A 2FMYA 2AGSA 3FWEA 3O1RA 1NA1B 1VBB2 1DLLA 5E8AA 3B7MA 1WA6X 1AX0A 2XR4A 3UETA 1MS0A 2E7QA 4B7KA 1MVEA 5DQ0A 5FY7A 1KEXA 5IAVA 4RGGA 5A7OA 1F15A 1WCSA 5F3CA 4NHLA 5IYYA 3GBGA 3H50A 4JC1A 3WNOA 3MV01 3LIGA 4L8QA 4META 2WZPP 1OLMA 2F4LA 2D3RA 1WW6A 2JX9A 1QY4A 3T09A 4GJYA 1QF3A 3WDYA 1XJAA 4JGZB 5AC92 2YPJA 4AHYA 2E7AA 3NV3A 1DGWA 4YNIA 2E6VA 4GQ7A 3H8OA 1EAH2 2YC4A 5E89A 5LBFA 1GOGA 4BA6A 4R9DA 1U0AA 2XLAA 3GHNA 2ZACA 5T50A 1LHOA 1LENA 4HK9A 3EHKA 3I59B 4YWAA 4PIZA 4WVVA 3O1TA 2LTNA 4IV1A 3JBG2 3UGFA 1ZREA 2BV4A 1ULCA 2W9XA 4FPEA 1QXPA 5K7PA 1OH4A 1UU5A 2WZR1 3RMXA 2BTVC 2ZKNA 4Z82A 4CCJA 1VALA 5IK8A 2EF6A 5E16A 3AMMA 2ZEWA 2V4AA 2VXRA 3C7EA 5CZKA 5DUVA 5A6YA 2CWSA 3V0AB 4YGDA 1N3OA 3W20A 2C9AA 1SPPB 4XF0A 5FZOB 2Y0OA 1UD1A 3LEMA 2YB7A 4E4ZA 3LE0A 4JTNA 3I2FA 1S2EA 3FBMA 3ZYHA 1UNBA 4Q0PA 5JXIA 3KT4A 1LHVA 2R16A 3OY8A 3QLQA 2P2KA 3U10A 1Q8PA 1UMZA 1S55A 1IOAA 3UT0A 5ACA1 2GNDA 5CKQA 1F5FA 3RQ0A 4D7TA 3WP6A 2UYBA 1YJKA 2ES3A 2W52A 3RYKA 4COZA 1QDCA 2OVUA 1UAIA 5HPOA 1N3PA 3BTZA 1R082 4WM8C 3MFCA 3Q8AA 3VKOA 1WBFA 2WZ8A 5FZEA 3LA3A 3JQXA 1D2QA 2AC1A 1IPKA 2A3XA 3KM5A 3WF3A 4KH9A 3PNAA 3J8F3 4XJ8A 3POJA 5IFPA 3E6BA 4IDZA 3AP6A 3U0ZA 2W5FA 1SFNA 4RHV1 2ZABA 1X9TA 2J1EA 4QB1A 4XEZA 4ZS2A 4BMBA 4EWAA 4FFGA 1V9U2 3MICA 2PHXA 4UFIA 5EZWA 3SH3A 3SMHA 3WINE 2WQ8A 2X09A 3IKWA 4QDQA 1LAJA 5JSPA 5FP8A 2HH9A 1MZFA 1C5HA 2WNUB 1JUIA 4TLFA 2QQKA 3NNGA 1PGW1 2R063 3JXSA 2XG3A 4XOGA 3ZXDA 3I3DA 2QNKA 2YYOA 5DDJ3 1VAMA 3AZVA 1KDKA 1OFSA 5CFDA 3O0WA 5FY9A 2GAUA 3VHOA 4D69A 1PIV1 5L7OA 5FLJA 4DUVA 2YDEA 5H9RA 1DYKA 1H8TA 2VZPA 2DBIA 4OHYA 3CL1A 2VMGA 3FHQA 1JYNA 4BM8A 3LCPA 4MXVA 2ZOEB 4AF9A 4I09A 4BK5A 1RUE3 4Y20A 5C8CA 5IHRA 4BH9A 2WFF1 4CDQA 3A4UA 1ASJ1 3ZLIA 3ROUA 2EAKA 5LEKA 1VBC3 3AMQA 4QT6A 3D4KA 1NY72 3I49A 2DVDA 3ZXJA 4LOTA 1ZRRA 1C28A 3VBUB 1PO23 2JIJA 1US3A 1QOSA 4GMP3 3LDBA 1UY4A 1UMIA 3DYOA 3LFMA 1BKZA 1UYZA 3PVEA 4XZPA 2IXHA 2JDNA 3RSJA 4EZ4A 4PLMA 1XXNA 2XJVA 1W99A 3CDZB 5KBFA 2E26A 4W6WA 2YXSA 1NXD1 1N1VA 4UW6A 3AX4A 3J8F2 4HPKB 3DPRC 2W1WA 3N9PA 1FNYA 2VZRA 1WW4A 4AI2A 4OI4A 3WF1A 5KC6A 1NX9A 2IUWA 3QH7A 4P9XA 2B45X 3RYPA 4QPGB 1JZ3A 2ZX4A 1Q8QA 1VPHA 4Q4Y3 4ORFA 3ZXKA 3LPFA 4M01A 2FDIA 4QXHA 1H4HA 3TRSB 2HWE2 1OQ1A 2R062 4XF1A 4OMCA 1POV3 5JPNB 1W90A 3ZN4A 3Q8FA 1AX1A 4NHYA 3MI8A 5FK7A 1TE1B 3K4ZA 2J1AA 4I0WB 4CXWA 1QQP3 4Q0SA 3OGSA 4GAZA 5FPBA 2FZ2A 5EHDA 2OQ7A 1XYNA 3D0SA 4Q0VA 2OZ6A 5EJ3A 1W05A 4BQWA 2D6PA 3RZMA 5FYHA 3VBRA 4HSLA 4CDUA 3ZXGA 2CGNA 4BQYA 3PHMA 3KV9A 4HG6B 4PI0A 4RFT0 1GP5A 4XMIA 3WX5A 1J1TA 1RUE2 4V1PA 5FZDA 4CA9A 2PLV1 3VDDA 4K1YA 4AFMA 2YY1A 5A7WB 2WFPA 4GA9A 4LUMA 2VTXA 4FVVA 4UAPA 1VBC2 4YW1A 3OBTA 5DZGA 2VOTA 2Z2SB 3OPTA 4MGKE 3VZOA 3D0JA 4NIDA 5BV6A 1FNZA 3PMEA 1W6QB 2R041 3IMNA 3KHCA 1JZ6A 1AR72 1PO22 4IE4A 4KBBA 5JUVA 1DBNA 2DUQA 4QXKA 2ZHMA 4XUPA 4LJHA 5LATA 1MS3A 4C1WA 2UYAA 4DUXA 2WLPA 2P37A 5IJRA 3ZVXA 3SCFA 4AFBA 3EMRA 2IXCA 4QU1A 2X53S 5FZBA 4GWMA 1RUOA 3S57A 4LNVA 1W9TA 2VW2A 4AVBA 2CSGA 1EPZA 4DEVA 3UJQA 5DMYA 2EAAA 3NNLA 4AR2A 2DCKA 3CQOA 1I6XA 4OQ9A 3POGA 3MLJA 1JN2P 3OPWA 3ZDSA 4BIOA 2VU9A 4Q4Y2 1L3JA 4XTMA 2CWMA 2WT2A 4Q26A 3R0RA 1W6OB 4FXGB 2WS92 4ZONA 1R1ZA 4ATEA 4XUTA 2Y6JA 3IDAA 3AMHA 4QKBA 5FZ3A 2CGPA 3ZXLA 1RGSA 4D94A 4OHVA 1ENQA 3VL9A 3OUIA 4MH0E 3N7MA 2X05A 3HBKA 1QQP2 1XE7A 3FZ3A 3C7OA 1O8PA 3N9LA 4MX3A 4OHXA 1X8MA 3TEXA 3WZ1A 4ATFA 1XSRA 3K4DA 4YARA 5CEHA 3I8TA 3VDBA 3WNMA 1JU4A 2B39A 2BGOA 3AL6A 5AVPA 4AE2A 1AXYA 2AUYA 5GLVA 3OD4A 4JGYA 3VD9A 2KR2A 4CEYA 2IWGB 4EN6B 1WCDJ 2O14A 2UY9A 1RUJ1 2F17A 3PUSA 2CNAA 2VBDA 3ATGA 2RMU1 1TME3 5FWEA 4CU9A 3SH4A 1YQ8A 5A7QA 4RYDA 2VNOA 1LHUA 2WN2A 3ZFGA 1JODA 2GC1A 5A3OA 3ZXEA 4CCCA 1HXS3 4LMFA 2VOKA 4H2AA 2JG8C 1GZTA 5I0DA 4NE9A 3SEPA 1W8HA 4B29A 1NA1A 4Q8KA 4Z2WA 4ES8A 4XUQA 5IK5A 5HXMA 4DXSA 1UYXA 3WR0A 3WDWA 3SXWA 5DUWA 2K2SA 3VBSA 1C3HA 1D4M2 3LEGA 4FPJA 2VQAA 5T5PA 4M3CB 4A7YA 3BUCA 3N35A 4MO3M 4BQ3A 1AYN1 3TEYA 4YG0A 4HETA 1QJEA 2KXLA 1YQ6A 4R4XA 4JGZA 3RMYA 4BYYA 1APNA 1D0HA 1LCLA 1VBB1 2P5BA 3WW4A 1C57A 5F5AA 3OYWB 5FMDA 5LRRA 4KU7A 4HKWA 3FX3A 1ULFA 3KCCA 4QQPA 2GDFA 2NYYA 4LKFA 1HDKA 3ZSKA 2WNOA 4JDMA 5GZFA 1ZBA2 4H55A 2BBVA 3PUIA 4NRQA 3HPNA 5JVVA 2ET1A 3WQ1A 3SCGA 3RPQA 1G9CA 3EO6A 1PVXA 5FZKA 2AYHA 5L7OB 1W0PA 4PQQA 4HN1A 2BGPA 1HQWA 4QX2A 3WG4A 3ZOIA 2D98A 1JYIA 5GZEA 3LA7A 3TEWA 1GV9A 2DU1A 1EAH1 3NAPC 1C8NA 1XOYA 1NOVA 3BODA 3JB4C 1SPPA 4IEVA 4LA3A 1LGBA 2W92A 5FZOA 5M0TA 4IESA 2RVAA 3LOIA 3N9QA 5F8PA 3FC0A 1U5YA 2D6KA 5CG8A 1VMJA 2QQOA 5C4WC 3JBG1 1Z78A 1ULOA 3B69A 3HWJA 3RZJA 1W3VA 1W8UA 4UWDA 2ERFA 4EWDA 2E7TA 1SFPA 1ZX5A 2YBKA 1GZCA 1DZTA 2D5FA 4LXLA 2R0HA 4OZXA 1JOJA 2ARXA 4BDVB 1HXS2 3ENRA 1LGCA 4Q4X2 2Y0IA 3OOXA 4XFBA 1OXCA 1KS5A 1NLRA 4LK6A 3CJIC 2H0BA 4FPLA 3PUAA 5FYTA 3S0MA 4IEZA 4LBMA 4WZCA 3V0BB 2JG8B 3HAGA 1KQRA 4HSJA 1O3TA 4HVOA 5I93A 3WLUA 1GOFA 4Y5TA 3V65A 3OUHA 2VUJA 3WD5A 5FYCA 1R081 1GNYA 3M3QA 3NJXA 3EYPA 4COUA 1LU2A 4FPCA 1GWLA 3PURA 1W8OA 4QM8A 5DN2A 4A41A 3BTYA 2JDHA 1SBDA 1CN1A 3IWZA 3MYXA 4QQHA 4Y1VA 5FZHA 4BIFA 1VMHA 4YRDA 3FUQA 4IEOA 5FDBA 3ILRA 4OUSA 4Y1YA 2OKXA 4MADA 3UL2A 4YFWA 4RHV3 1V9U1 3AL5A 2HWC1 3C7GA 2LRPA 4ZXEA 3O1SA 3GGLA 1XNAA 4Q5OA 1LB2A 5DZFA 4DY5A 3ILNA 4DPNA 1SLIA 5HV4A 3USUB 3D8CA 3E6CC 4CP2A 2FHRA 2JEMA 2Q8OA 3FUOA 2XKPA 2Q1FA 3CMGA 4KWKA 3KS7A 4IE5A 4JRAA 3LKJA 1YXWA 1PIV3 1OVSA 4LHNA 4BXSV 5FPUA 4O7XA 2VXJA 2R32A 3NAPB 3MIGA 4FT8A 5CKMA 5I8TA 3T0BA 2LROA 2CGOA 1HLCA 2AR6A 3KWVA 3C2UA 4FI9A 5LA9A 5IVYA 3N9OA 2ZGMA 5JIUA 1SBEA 3T1LA 4LIUA 5C4WB 3HT2A 1LOFC 2ADEA 2RDSA 2WNVC 1DGRN 1XYPA 2D6MA 3P6BA 5J98B 4CUCA 2XONA 2WFF3 2BBAA 3IDEA 1MQTC 4IGOA 1ASJ3 2IZWA 5BNOC 1GU3A 3N4MA 1GWKA 1NY71 4HPKA 3WCSA 2ZGNA 2L9LA 1UOBA 2C26A 3AVSA 2VC9A 1A3KA 2D7FA 4EN9B 3R4UA 4TSVA 4WM8A 1HV0A 1GUIA 2ZEXA 1LGNA 1WLCA 4LBJA 2QE3A 4BISA 4EN8B 4UFJA 3VBOC 5DG2A 5A3NA 1GICA 3FN9A 1RL3A 5FZ4A 1BCXA 2QQJA 1RMU2 1WBLA 1RVF1 2O8OA 1LOGA 1XE0A 2A3WA 1MR5A 3O1OA 4KGGA 1GZWA 1LULA 2VW1A 1WCUA 3J8F1 5AFBA 2W1SA 1G9BA 1YI9A 5KHJA 3PUHA 3HMYA 3KT7A 3PVBB 4LO5B 3UGGA 1ULGA 3VHPA 1OQEA 3LOBA 4E27A 4RHV2 5EP9A 4LTAA 2VZ1A 2W91A 5GZGA 4Q27A 1UY1A 4GH4B 1Y9MA 3WQ0A 4M00A 3HN1A 5B2GB 5BNQA 3QBQA 2JB8A 3OGVA 2HWE1 2DU0A 3BKZA 1MACA 3WXPA 4XCBA 3OEBA 2A73B 5LBCA 3NJYA 1PGW2 4GZ9A 2A6VA 2VCMA 3FFZA 4AOCA 3C7FA 4NN0A 5D8AB 2WN3A 3ETPA 2FDJA 1NT0A 5IATA 1W6QA 3KGZA 3GM8A 4BCUA 2XJUA 1YQCA 1QXRA 1O6UA 2XGXA 2Q4SA 2R6QA 5I0RA 4YGEA 2XLFA 3UJOA 5FQ0A 3KCYA 1RUE1 1SZBA 3LSEA 2QKDA 5IVVA 2HJIA 3ZSEA 3MIHA 5FYMA 1UZVA 2CDOA 4XCAA 1BK0A 1OLME 3IDCB 1VBC1 2DVAA 1BLZA 3LZZA 2Y34A 3M3OA 3NQHA 3LDRA 1REDA 4LKEA 2HYXA 1AR71 2Y6HA 1PO21 2CDPA 1W0OA 2R1DA 3B94A 5IUQA 5C70A 4L0PA 4GMP1 3DYPA 4W6XA 3AK0A 2XVGA 2QFEA 1MQTB 4YSFA 5BNOB 5EV7A 2G9GA 1W6OA 1OUSA 3DPRA 5GLTA 2W0XA 1JI6A 3GF6A 3H1YA 3VD3A 2XJTA 3WNLA 5JOZA 2D5HA 5BUVA 5FY5A 4HL0A 1H2LA 2Y6LA 1FOD1 3WNNA 4IERA 5FYIA 3VBOB 3WP4A 2GNMA 4N9HA 2E63A 2D3SA 4AI8A 2OZJA 2GSYA 1HB2A 3LIHA 1RHI1 1OD3A 2A1XA 2G1MA 3BGAA 1K3IA 2V4VA 4Q4Y1 5T54A 3GALA 3P3NA 3LEIA 4K3UA 2ILMA 1PZ8A 4HN0A 2H6BA 3M4FA 2WS91 2E32A 1PVC3 4MHUA 4UF0B 5DPNA 3RZLA 4QXBA 1E5HA 4K40A 5TSWA 3RRDA 4CEWA 2V5YA 2W1QA 5FIXA 3RWKX 2KA3A 2E51A 2XJSA 3POIA 3MEPA 2HWF1 2GALA 2JKXA 4ZZ8A 1JYXA 5LA0A 4TWTA 4HT1T 1DQ1A 5FUPA 3SQOA 2XOMA 4JHZA 4FPGA 4ZY9A 5IVCA 1X50A 2XPJA 3GZEA 5FKCA 1RUF2 1DQ4A 1HB4A 4R52A 1OI6A 1V00A 5JXHA 1RUJ3 3PLQA 4XIOA 3UKVA 4M3CA 4LE4A 2CV6A 5IWFA 5F3EA 3TN91 3JCIA 4UBGA 3BU0A 2R49A 3AVRA 5A7NA 2G4IA 3ALQA 5KHGA 1BMV2 4D6SA 1HN1A 1K45A 2VUAA 1WLWA 2B4KA 5C3OA 1CIWA 2ZEZA 5EJZB 4P9JA 3OUJA 2BNMA 3H7YA 2JECA 3FLTA 2E53A 5E1RA 3SLIA 1X8EA 1D4M1 1OH3A 1EV13 5F3IA 4LE3A 4D6RA 4TXWA 2J42A 4L92A 2A6WA 4BOWA 3U37A 3TEZA 5F5IA 1VIWB 5FWJA 2BOIA 1UZWA 2WQ4A 4KWLA 1TVGA 2MNGA 3TB0A 4YGBA 3FLPA 4IGQA 1OMIA 1VBB3 4QKNA 4YM2A 1WWYA 1HQLA 1PVC2 2YG0A 2J1TA 4AI0A 4NJ4A 3OGGA 4YW4A 4PBOA 2VNGA 3MPBA 1ZBA1 2BDRA 3MW4A 3WG3A 1UO9A 2Z79A 4KWJA 3BTXA 1GSLA 1UWWA 2LM3A 1GFF2 4CPBD 5FZLA 2FZ1A 2MHFA 4QGNA 4BQ5A 5FJKA 1G8WA 1W9SA 1DQ6A 4PDWB 4A3ZA 3BPSA 2AEYA 2FDHA 4LOSA 2OS2A 3MUY1 5A3TA 1VAKA 1W9YA 2P3IA 5JZGC 4CRQA 3POBA 4BE3A 2XXZA 3RNSA 2ZGKA 5GZCA 1RYYA 1YFXA 3NKTA 3OGJA 4M0HA 3ON7A 2OPKA 1PX3A 3AP4A 4QD2A 3BYWA 4BHPA 3ETQA 3M2MA 3E1F1 1NKGA 4ZZ5A 1SACA 1LRHA 1W9FA 3ECQA 4GMP0 3I2IA 1HXS1 1N47A 4XF3A 4TLGA 4Q4X1 2UU8A 5FYSA 3OTFA 5FBJA 2ZX1A 4Z1VA 2PXJA 1XSQA 2VMEA 2ZHNA 3K75B 5BY5A 3ZO0B 5LA2A 1W6MA 2C24A 5FZ9A 3WNPA 4AW7A 2O8QA 4IQPA 1XYOA 5FJHA 2AENA 1EV12 5FUIA 4D3WA 4NIIA 4GWIA 5JI7A 2YPDA 5C5TA 4QHOA 3HNBM 3ZYRA 1H9PA 4OI2A 1B09A 1TQ5A 3GNEA 4YW7A 2IVIB 2JE8A 3FLRA 1PZ7A 2MEV3 2ZGRA 3DXUA 5C5UA 5JOXA 4RD7A 4QMAA 1R083 4XFGA 3USUA 1VAVA 4QPIB 4LR4A 4YZ1A 1PM7A 1TZOA 1H1AA 3DGTA 1POV0 3MW2A 2O1QA 3JU9A 1LKNA 3LDKA 2WNUC 5A33A 3ZFFC 2XHNA 3OPZA 4E8DA 5KXDA 4ARYA 4KWUA 3G7DA 4F83A 1V6IA 3K2OA 3MIEA 5A7SA 3E5XA 1DU3D 3NAPA 3USSA 4IEPA 1V9U3 4A6OA 4XAAA 2WT1A 2HWC3 5J96B 2NZ9A 3BIWE 4MGYE 4SBVA 1W2UA 2WYFA 3CZUA 1MPXA 2Y60A 5C4WA 4BK4A 3Q9OA 4XUOA 2UURA 3VUOA 5JSRA 5EJ1B 2DV9A 3M3CA 1HJGA 2VPVA 3KB5A 1PK6B 1PNGA 1K5JA 5FZ7A 2ZGPA 1YFWA 1NXMA 1IPSA 2DCTA 3PJQA 1JZ2A 5JI9A 1ND2B 5KXCA 3MFAA 4YVWC 3ZKUA 5JZGB 3TWIA 4MGZE 4J6GA 5DXDA 2PN5A 4BXFA 2DDUA 3CJIA 1N1YA 1ZRFA 1FMD1 3AZWA 3K3OA 3VBUC 3MIFA 3VDAA 2QCSB 4HOOA 1IS4A 5D1IA 1RUNA 3NW4A 1QJX2 2VOXA 3ZYFA 1ZVFA 4GB32 5HCAA 5F6KA 1W2TA 3A23A 4E8CA 4B4QA 2IXIA 3AJZA 4UOJA 1LOCA 2D6OX 3PJYA 1QHDA 5K0UC 3WEZA 1HRI3 3DV8A 2R1BA 1K42A 2PYTA 5I8SA 1WA4A 5FXZA 2K9ZA 4XACA 5DABA 4K20A 1QNWA 1RMU1 2MEV2 3I54A 4IV3C 4CSWA 3O7OA 1G7YA 3L9JT 1XU1A 4QPGC 4DXRA 3VV1A 1AYM1 1ONAA 2NN8A 1O7FA 1RVF3 1VBA3 1QOTA 3H3ZA 1OA4A 1ND3C 1UW8A 5E6HA 1J3PA 2QQNA 1G9DA 4LO7A 4DOUA 5FMCA 3IZOA 4LO4B 2D43A 2QVSB 4CXYA 3CO2A 1NUKA 4LHSA 3PVOA 4BQ2A 4LHKA 2PTMA 1URXA 2HWC2 3S5AA 1J58A 1KITA 1X7NA 5AVAA 4NIAA 1JHNA 3ACIA 3I2HA 4YM1A 3ZFEB 3ZFFB 3IT8A 4OI1A 3URFA 1FT9A 2EIBA 2YC0A 4TZDA 1W6NA 2A3YA 2HWE3 3DKQA 4MV2A 2B9VA 4DRRA 3AXEA 1S1AA 2FDFA 1YI7A 5KXBA 1UOFA 4JQRA 4K1ZA 1A6CA 1AR93 3N7KA 4LBQD 4NRMA 2W46A 4CE8A 4ZU4A 2RE9A 1XC6A 1FV3A 4L97A 3AM2A 3R4SA 4QX1A 4XHXA 1LOFA 5L19A 5JXGA 2WNVA 2Y6GA 2YUEA 3O12A 1MQTA 1SCSA 3THCA 5BNOA 5F32A 5KXEA 2JE7A 2RV9A 4FQZA 4XURA 1Y9GA 1IS3A 2IXKA 5HXVA 3O1VA 1M4WA 2XBO1 3J7MA 3WF2A 5FO7B 1F2NA 1AXZA 4YVWB 4FTEA 3HBZA 2VZTA 2VD7A 3OG2A 5FZGA 3ME2A 3Q8CA 3VBOA 1H0BA 4AHWA 4BZ4A 3GBWA 4RS5C 4LLOA 4YLZA 1CR7A 3K46A 1HRI2 1AR73 4NRPA 1UX6A 4AGVA 3DL3A 4Y4YA 5JPMB 2WRAA 3NJVA 1F8VA 2B9UA 2CAUA 3AMNA 2VMFA 5JR2A 1JH5A 4P9IA 1R1A3 1OF4A 1VRH3 4RGAA 5I0TA 1QNYA 1RVF2 1VBA2 1CQ9A 3S5QA 5K0UB 4P9LA 4DY3A 1BBT3 3H8UA 4XJAA 3HR9A 5K8SA 1JU3A 4W4ZA 1C1LA 1O5UA 1FOD3 5LASA 5FCCA 4IV3B 4BQ4A 1CZTA 4D8MA 1CX1A 1OKQA 2C0ZA 3DCQA 2ZMKA 2GP5A 2BU9A 3OBAA 4HVRA 1AF9A 1RHI3 2OPWA 2P6CA 2ZKLA 3IAQA 4YZ5A 1VLNA 3FL7A 1ND3B 3AMPA 4UXAA 5A1AA 1CGPA 1GNZA 2WS93 3A22A 4ASMB 5C3PA 1IQAA 2LALA 1J3RA 1XE8A 4AVTA 2ET7A 1HV1A 1UF2C 1EUTA 3O0VA 4CVUA 5A1FA 3RJ2X 4DUWA 1KS4A 2ZAHA 5FLHA 2BPA2 2WO2A 3RYRA 1G9AA 1AR92 1FYUA 5APAA 2EICA 2HWF3 5IK7A 4FBFA 5CADA 2GP3A 5JSOA 2JD9A 5FY1A 4PBPA 3VKLA 2RDNA 3I3BA 3LSDA 5K9YA 3RS6A 4C90A 4P00B 1H2KA 3POEA 5FPLA 1EP0A 4FO9A 5CG9A 3WDUA 3T2PA 1RUF1 3IAPA 3HVDA 3VHNA 1DZRA 1HKDA 1WW7A 4LT5A 2Q8EA 1MS4A 2ORXA 1SLAA 1VMFA 2Z42A 2EVXA 2W68A 3WQ7A 4Q4W3 1BMV1 2VR4A 3TN93 1ZNPA 3NL1A 5DUUA 5FXWA 3WNKA 4MUVA 4OMDA 4B8EA 1MEC2 5F5QA 1VBE3 4UFMA 2ZZJA 3DUIA 5SV5A 4JKMA 1O91A 3VBHC 2PHRA 4A45A 1QWRA 4S2FA 2RG4A 4AHXA 1B35C 1VRBA 1U5ZA 4LKSA 5FXVA 1DGLA 1JOPA 1R1A2 2OX0A 2VQTA 1VRH2 3HQXA 4IL7A 4A4AA 3KCXA 4RS5B 1D4M3 1OC1A 4NWVA 4QQOA 1BBT2 4GALA 2VTXJ 1SG3A 4LQRA 1FOD2 2RS33 3KV5A 3M7AA 4PJYA 4RN5A 3U1XA 2LW8A 4LO6B 5CIRA 3WNXA 1EPWA 1FX5A 4G9SB 4R4ZA 2AEZA 1NQJA 2QQLA 3ACFA 1JZ4A 1RHI2 2VOWA 3O1MA 1LNSA 3AZZA 1PVC1 2W1UA 2PQQA 5L7OC 2VVFA 4EYUA 1ZRDA 3KF3A 2CL2A 5T52A 3VL8A 3NVCA 1ZBA3 3BN6A 4O9GA 4M0NA 5FAXA 1DCSA 3MLLA 1HJFA 2KM2A 4XUNA 2JG9B 2VG9A 2PHUA 2HWF2 2VZOA 2KD7A 2VZSA 1UU4A 1MZ6A 1OUXA 3GZTB 1NCRC 3NKGA 1JS9A 4PHZA 4HANA 4N7IA 4IUGA 5IVBA 1O3QA 4WV8A 2VOVA 1C8M3 4MGQA 2BW8A 3H1WA 1AL0G 1J1LA 5F1RA 5FLIA 1CAXB 2V09A 3TAYA 1WUVA 2WINB 2HLEA 4QB6A 5FPVA 2WDBA 4O61A 4P9GA 2WLQA 3PIGA 1QH7A 4Q4W2 1OFNA 3ST7A 4I2OA 3TN92 4U36A 4CCOA 1YYNA 2W87A 3I97A 1CPMA 4HMZA 1VBE2 3B9IA 4Q4X3 4XFFA 3RGBA 3CKHA 1F4HA 4JZRA 1AR63 4L2NA 3LD8A 3ZXFA 2D6NA 3VD4A 3U4XA 4CDXC 1EV11 4I01A 4LBQB 5HI0A 5ABJC 2WBKA 4PF5A 1COV3 2ZMLA 2OQ6A 4I3PA 2QZ2A 3B00A 4L11A 1UKGA 5B4NA 1QJY2 1RUC3 2DF7A 3VBHB 5ERLA 4UFHA 2QDRA 3NV4A 1OPMA 3PVNA 2RS32 3BPZA 1H30A 3HNYM 1B35B 2A70A 1UZ0A 4IEYA 2PAMA 1QMJA 1YIPA 1L7RA 4S2HA 2RDRA 4GXLA 1KFXL 2ZX3A 1VB4A 2W39A 5T3NA 2JKBA 5LW9A 2F6BA 1O4ZA 2RDQA 1PO13 5F2WA 2P17A 5GKAC 1FXZA 3PU8A 4FQ4A 3I59A 2DFCA 2I45A 1YQ2A 2ZJCA 5JZGA 4MLOA 3KSCA 2CU5A 3NNFA 1M06G 5J09A 1I3HA 4NHXA 2IVJA 2WT0A 3INAA 2EXHA 3ITQA 1RUD2 2QQVA 2ZZQA 1IQDC 1DQ2A 4OVEA 4DO0A 1C8M2 4MZUA 4URTA 4OUMA 3J7HA 3N9NA 1ULEA 4XJWA 1I9RA 4YG3A 5FYBA 3MIDA 3KD4A 3ZN6B 3PTYA 5IAXA 4AQ6A 4E4SA 1GZ9A 4ZHNA 3EBRA 1NCRB 5GJ6A 1WKYA 5FZ6A 1GQHA 3VBFB 5ANQA 2LS6A 3GCWA 4W65A 4XIKA 2VMDA 2BFUL 4COWA 3U07A 3QH6A 1AJKA 1Y7BA 1FMD3 2TBVA 2YBPA 5GZDA 4YYOA 1AR62 3M70A 1TNFA 1QJX1 4XDPA 4CXXA 4ITCA 4GB31 4MOAA 2VAUA 3B9CA 1ENSA 1ZRIA 1RB8G 1COV2 1YJLA 2DWRA 4OHWA 4LK7A 4YGCA 4JKLA 3MW3A 1NLQA 1SEFA 2Q30A 1RUC2 1SDDB 2IXJA 2RS12 3U11A 4MGSA 1V6MA 2GNTA 1GKBA 3BTAA 2VECA 3O0XA 5FP3A 4CP1A 2X5IB 1CAWB 3MLKA 2MEV1 4NHKA 2NLRA 4CDXB 2FDGA 2ZS6B 4OQ8A 5A32B 5ABJB 3W9AA 2WNUA 1WW5A 2YV8A 1RMU3 1JHJA 5JR7B 3ZFFA 4M3CE 2A6XA 2XJRA 5FP7A 1LODA 2DTWA 2ZHLA 3THPA 4XJZA 1AYM3 1PO12 2NM1A 2ORZA 3A7QA 4GH4C 4O9EA 4KBZA 4QAWA 1AL21 5F2SA 3TOJA 4COYA 1BXHA 4ZXKA 1HX6A 1KDMA 3ILFA 5LCWL 5D8AC 1PGL2 3NMBA 4XVHA 1OA3A 4WM7C 2NPIA 1DDLA 2GH2A 2VCCA 4NPMA 2ARCA 3W21A 2AZ5A 4Y5Z0 1Y9QA 4NROA 4V2WA 4Y5SA 2VM9A 1CAVB 4YFZA 4BQ1A 4YVWA 2QZ3A 1JYTA 2P4EA 2WO1A 2P6HA 4FOQA 4WZFA 3W5MA 1AZDA
chains in the Genus database with same CATH topology
3VBUA 3LA2A 4Y26A 1JYCA 3AYDA 2YHJA 3DKWA 4XPVA 4JDNA 5T5OA 2AH2A 1FMD2 1FPN3 1LECA 2VVEA 4HBNA 4XXAA 2WA4A 5K0UA 4TYSA 1SLLA 2XBO3 4C0HA 2XUMA 2HWD3 1DQ5A 2XVLA 1IPJA 2ETEA 4YW2A 1ENXA 4IV3A 1HRI1 1FAYA 3M1HA 4QPGA 2ZGTA 1V6OA 4HKOA 1S0EA 3JQWA 1ND3A 4AGRA 1J3QA 2YGLA 3D82A 4K7JA 1VBA1 1Q8VA 1AYM2 4OFGA 4A2UA 1U5IA 1S2KA 5FPZA 5JDBA 3IDBB 1GBGA 1OLRA 2AREA 5FBZA 3KGLA 3AZXA 5H9PA 3KLSA 3PMSA 4NR1A 1NYWA 2XVKA 3R05A 1RUH3 1VBD1 3ZSMA 1YO8A 1I5ZA 4Q0QA 3VKFC 1ZZ7A 1PGSA 2OUHA 1LHWA 2ZGSA 1QDOA 5EYXA 3AKSA 2FMDA 4XFAA 3WW3A 1AR91 1LTEA 1D4VB 2WWSA 4NWWA 4LBKA 4WM7B 5CA6A 2BFUS 4WVMB 4R9AA 5CAZA 4LLFA 2RJKA 2Y26A 4X8NA 4K9SA 3OY8B 4F7ZA 1C1FA 3WDTA 2Y38A 3IIAA 1XNBA 1RUF3 1FPN2 4RS5A 5J7MA 4LBOA 1WD3A 2B5HA 2XBO2 3T2TA 1YFUA 2D93A 4CYDA 2HWD2 3QOPA 1RITA 2BVVA 3M3EA 4AXOA 4LULA 2K0GA 4I0BA 1MEC1 2PAEA 3A0NA 3LWCA 1FV2A 2ZTNA 4XBNA 1R1A1 4AEDC 1VRH1 2XJPA 3IBMA 2TNFA 4RR3C 4FPFA 4J1WA 2YROA 1BBT1 2RS52 1BVVA 2C1FA 1UN1A 4DFSA 4YZ2A 2EALA 3WP3A 3ZYIB 1LESA 5JOYA 5CFDB 2B42B 5JMCA 2R072 3MIBA 1QXJA 1ZRCA 1KD7A 3J9SA 4FAGA 4R9BA 1RUH2 1H8TB 4PDWC 1ZBE3 4EJRA 5FFOC 3S6PA 4W6YA 1CAXA 2Q0AA 3THTA 1NG0A 4P9WA 2VY0A 4FOVA 4A7KA 1UKRA 2ZPXA 3AYAA 1DQ0A 2RJLA 5C8CB 2XLGA 3B93A 3QACA 5BYNA 3W58A 5CB7A 1W39A 4IEUA 1Z7S3 1OLQA 3VHRA 4Y1XA 4LBNA 2I74A 2YGMA 5BXXA 1A8DA 4IEXA 1Q8OA 2XB6C 3M3IA 1CVNA 4LBQA 3ZXAC 2CAVA 4DMIA 2HWB2 4XHBA 4BLIA 3JZVA 1NZCA 4Z8BA 1HIXA 5FTTC 3CJXA 4Q4W1 3VBHA 1O4YA 5FO9B 5SV8A 2ZGUA 1GLHA 4ZU5A 2NP0A 1B35A 1YFYA 1O5LA 1UU6A 2RM21 1VBE1 4ZU7A 4FPYA 4N9IA 1PNFA 3OYWA 4Q1RA 5J48A 1JXNA 2RR13 4LHLA 3UKTA 2GZWA 1IS5A 2ARBA 1H1IA 2FBEA 4QPIC 1QJY1 3MGUA 5LRSA 3UK9A 5BY5A 1Y3TA 5DZEA 4HKLA 2RS31 1SLTA 1U5XA 1XNCA 2TEPA 4Q4V2 1NCQC 3WY6A 4COVA 5L7OA 4AEDB 5LEJA 2VGDA 4AEKA 4ONUA 1DFQA 4IEWA 4JDOA 4RR3B 1S0DA 3ZIWA 4AVAA 4FPHA 1KJRA 5EWSA 1DG6A 3LAGA 1ZBE2 4NOTA 5JAXA 5EYYA 4GULA 4UW4A 3UV9A 4CDWC 4IEQA 1X33A 4XTPA 2HYKA 2EXJA 4FCAA 1NCRA 2CYFA 3QD6A 2VMHA 4WVWA 5HCFA 2A6YA 3VDDB 2PHDA 1A8MA 4UW3A 1Z7S2 1PK6C 2JXAA 1RUD1 4R8HA 1DF0A 2JICA 3FJSA 3W59A 1ND2C 3H1MA 1T6GC 1C8M1 4QX5A 4XXPA 3B02A 3AKTA 5L36A 2QDNA 1RUI2 1ZZ6A 2ZBJA 4YM3A 4QM9A 1NE4A 3ZPYA 3V0BA 2JG8A 1MS1A 3VZLA 5CNAA 5HCBA 2BEOA 1XQNA 4CDXA 5I0SA 3IPVB 5A32A 2X29A 3K48A 5ABJA 3ASIA 4Q29A 1AR61 2VVDA 4YVSC 2WC2A 3E6DA 1XNDA 4AFAA 1QJX3 1D0GA 1TEIA 1COV1 2RR12 4GB33 4OULA 1GR3A 5J37A 1K5MC 4B3NA 4E2QA 1RUC1 3WW2A 4BMEA 2RS11 1IZ3A 4AHZA 1JBCA 1CX4A 5C6CA 4XYXA 2YZ4A 3EXUA 3RZZA 2XWJB 4ZKTB 4QGMA 5LK5A 2OIIA 3RI9A 1PO11 4P9YA 1CAVA 4AK3A 1ULDA 4B4PA 3ZFEC 1NCQB 2SLIA 1AL23 3V0AA 4BPZA 1AVBA 5BNPC 1CESA 2EIGA 1H8VA 1PGL1 3OD0A 4ISRA 4G4FA 4XFHA 4FPKA 1OPOA 5GALA 4OI0A 4CDWB 3D6EA 2BUKA 2D6LX 2ZCWA 1LU1A 4AWDA 3RJRA 4AVVA 2ZX0A 4K21A 4AVCA 3AFKA 1R092 3AP9A 1RJ7A 4XMAA 3RWNA 2JD4A 3VBSB 1FATA 1S0JA 4N43C 3GHMA 1BEV2 1G86A 1ZA4A 4R9CA 4HVQA 1TMF2 2DCZA 5JIAA 4DS0A 4FSJA 1PMIA 4KNCA 2DCYA 3CNAA 1Q8SA 1N1TA 4P5HA 1E57A 2B7YA 4KU8A 3OJBA 1D2SA 4D7YA 1OOPC 1AR81 1RUG2 4HFSA 1DZQA 2UWCA 2G9FA 3BU7A 1C5IA 3EQEA 4YVSB 1RJ8A 4C0BA 4GH4A 2I2SA 1O3RA 2GMPA 5T5JA 4HK8A 4ISQA 5BNNC 1K5MB 2R30A 3TYJA 1Q43A 3SNMA 2IFRA 5D8AA 2H0VA 4XJUA 2FQPA 4WM7A 5FOBB 4EWEA 1AL22 4WVMA 1SBFA 3H7JA 2A5ZA 4DRVA 1HW5A 1PHMA 4K6BA 1AJOA 1ALYA 3K51A 1VBD3 1V6LA 3VLBB 2WNEA 3I2DA 1OA2A 5BNPB 5KWRA 2WIIB 1HRV3 4H7LA 3TBDA 2DUOA 4I3GA 1AXKA 1YHFA 4M3CF 4XBLA 2C5DA 2R0FA 3JB8A 1YNAA 2PHLA 5FMOL 2P3JA 5E88A 3X29B 1FPN1 3HIFA 2A75A 3APBA 2HWD1 5H9QA 4N43B 2DVFA 2XL9A 1ZYBA 4XFCA 3D5OA 3ZSLA 2YMZA 1Q3EA 3HD8B 3CEWA 5JLVA 2CTVA 1MEC3 1Q5OA 3NWKA 5CFCC 3UKNA 5GLUA 3ZYPA 1WLDA 1F5JA 1OOPB 2OW4A 1QJU3 2RS51 5CBLA 3BB6A 5C33A 3POWA 4DB5A 4PIXA 1GQGA 4RA0A 2R071 3POSA 3ZSJA 1U12A 5BNNB 4Q2FA 3MDPA 4Y22B 4YZ4A 1RUH1 3FFQA 3NJZA 3QCWA 4YW3A 4E9KA 1UIJA 2JG9C 1VBD2 5FREA 1F9KA 4FOYA 4KG0A 2ZAAA 4XF9A 4PLNA 4S2GA 3RG0A 3WDVA 1HRV2 1S0GA 2PA7A 3J4UH 5I8YA 2CY6A 4XE9A 3S30A 3VGIA 2ZMNA 3ZYGA 1AHSA 5T55A 5KHHA 1Y43B 2X8KA 4WM8B 4AGGA 4Y24A 1J59A 1G9FA 1S0FA 2HWB1 4EROA 1YWKA 2V73A 3WHTA 2ZGLA 3O14A 3ELNA 1DGWX 4RL7A 2DTYA 1GZWB 5DDJ2 5C9AC 4C1XA 5EXOA 1SCRA 3EJKA 4AEDA 2RM23 4RR3A 3SITA 4X6RB 2EXKA 4RQPC 4CEWC 3KMHA 3N7JA 1H2MA 1QJU2 5F9TA 1ZZ8A 5DG1A 4XJ9A 1QJY3 5CFCB 1VB2A 4DZGA 4Q4V1 4AI1A 4PDWA 3FMGA 2SBAA 3N3HA 2DFBA 5IT6A 3SCHA 1ZZCA 1WMFA 1MS9A 1S0CA 4PIYA 1ZBE1 2PHTA 3WUDA 5C8WA 3CLPA 4RSUA 2F4PA 1REFA 5FQ0B 5J36A 1N3QA 1AUYA 2GC3A 2BNNA 2VQ0A 2UWBA 1SQ4A 1Z7S1 1YIFA 5FMOS 1LEMA 1UZZA 2EA7A 1H4GA 1KRIA 3GYDA 3BCWA 5FPXA 4QGLA 3IPVA 1RUD3 4YW5A 1X82A 3H3UA 4XFIA 3WT3A 4Q8LA 3VBFC 4MYEA 1RUI1 4B4RA 2DVGA 3DPRB 1CAUB 1LEDA 5HBAA 3AP7A 3KQRA 2BVBA 2PHFA 3NV2A 2WA3A 4XDQA 1RTVA 2GC0A 3N36A 3T1MA 1CD3G 3B01A 2RM22 3MZHA 2P3KA 4QPIA 3RDIA 3GZAA 1SLBA 3V64A 2RR11 2X5IC 5C9AB 1CPNA 2BWAA 1NCQA 2D3PA 1MVQA 1N1SA 1LJ7A 1QKQA 4BLJA 4X8PA 2GMEA 1W6PB 4N7UA 4RQPB 4EV0A 4CEWB 2RS13 3DN7A 4D7SA 1FI2A 3ZN5A 4N53C 3H9AA 3ZMNA 4KGQA 4CDWA 1WGPA 4KG8A 4SLIA 4AQ2A 4E4DX 1JTZX 3NO8A 5CU1A 1RIRA 4NHMA 4XW3A 4MVTA 1PK6A 3VN4A 3JD71 4XQWA 1OSGA 5KHKA 3WV6A 3OBRA 2PAKA 1ND2A 1S0BA 3L2YA 2WJSA 3FE5A 2MPFA 4AG4A 3AB0A 3H0OA 4DNYA 4KL1A 4ES9A 2RHPA 4X6QB 2HEYF 1BK1A 1R091 1MZ5A 4I02A 3NSTA 1GYKA 2W08A 5T5LA 1H9WA 2HEWF 3WHUA 1V70A 1BEV1 4A7ZA 4YVSA 2VULA 2A7AA 3ES1A 4QU2A 1WMEA 1TMF1 4FP2A 5AC91 4Y1ZA 1K5MA 2IXLA 4FPOB 4LEJA 1MS5A 2JENA 4L9BA 4NO4A 1RUG1 3KT1A 1WD4A 3ES4A 1AR83 2O0OA 2GH8A 2Q1MA 1TME2 4MXWB 3ZX7A 4JRLA 2XL7A 3I4IA 4CTEA 3WP5A 1ZZBA 2WSVA 2WZR3 3ZFEA 1YLLA 4G3YC 2PELA 4IV1C 1O3SA 4H14A 1CONA 2JDZA 5BNPA 4AFDA 2NMOA 5AFEA 1G6NA 2XWBB 5FRAA 3BOPA 3VZNA 4N53B 1EY2A 1IKQA 4XQ4A 1UL9A 2ZX2A 1IS6A 4F3JA 1RC6A 3TNQA 5L73A 2DYCA 4OLLA 2BYVE 2XHKA 1MZEA 3HT1A 5ACA3 1REEA 1V6JA 4XILA 3ZIXA 2ENRA 1Q56A 4N43A 1UCXA 1ZM1A 3VKNA 3VZKA 1W6MB 4QQLA 4AEMA 4FP3A 3IM0A 1V6NA 5FOJB 2BQPA 3FHIB 1WCKA 1OOPA 1BZWA 2GMMA 1SDWA 2ZGQA 3WDXA 2GN7A 5GLZA 3AKQA 3L2HA 1AR82 2PHWA 5A33B 5BNNA 4Y22A 3AFGA 3M8LA 2BGCA 4AEJA 2P34A 4LBLA 3VKMA 5CFDC 4XETA 2UWAA 2WZR2 2XH6A 3N7LA 4K8FA 3ACLA 2RS53 1H8TC 3J26N 3LB9A 3OCPA 2XKOA 1LOAA 2HEVF 2QJVA 1LR5A 1VP6A 3R6SA 2QQPA 2R073 1BJQA 4QPYA 4S2DA 3G6JB 4DINB 5C8CC 4IV1B 4CDQC 2Z69A 4UBHA 2WSUA 3E5UA 4PLOA 1TNRA 5ACA2 3WOGA 2DVBA 3BOWA 5GM0A 3CJIB 3CF6E 4YG6A 4ASLA 4IETA 2D44A 4F8AA 4YZ3A 1BYHA 1NLSA 1HRV1 3I7DA 5BPXA 2B46X 2E9QA 4U2AA 3WVJA 1QOOA 1XNKA 1KFUL 3ZMOA 1GANA 4AQSA 2VNRA 2WQZC 3ZYJB 2NQYA 1GNHA 4CZSA 3AYEA 3LGRA 1IGOA 3R4DB 1WLTA 4JVAA 1LOBA 1C4RA 2I07B 4QD2A 1A78A 4PQ9A 1V6KA 4J1XA 5JOWA 2HWB3 4DXZA 4YM0A 4B7EA 2R061 1CJPA 3E5QA 3MF6A 4FOWA 5I91A 2GN3A 5CFCA 5DDJ1 3POYA 2ZHKA 3MF9A 4DQAA 1LOEA 3O5SA 2VW0A 1PIV2 4JCKA 4LA2A 4Z07A 1SFYA 1X36A 1S0IA 1VJ2A 1UIKA 4WVZA 1QJU1 4INDA 2HKXA 1IKPA 3SHRA 2TUNA 1W6NB 2ZA9A 4XF4A 5KHIA 2D97A 4AI3A 1JW6A 2PLV3 2WFF2 3VBRC 1WMDA 4CDUC 1ASJ2 4CP0A 4GKYA 5JWPA 4Q4V3 1QH6A 2JG9A 3V56A 1OHFA 3WG1A 1SMVA 3VDDC 2R043 3WCRA 5CVRA 2WNVB 4HLTA 1I1EA 5LK7B 2NMNA 3KZ4C 4I30A 1XRUA 4HZFA 5J3UA 1CAUA 3MPPG 3NV1A 4MGIE 4Y20B 3B3QE 2BWCA 1OQDA 4CDQB 2JE9A 4JAAA 1UZYA 1DHKB 1UPIA 4GWNA 5A3MA 4C91A 2OUJA 2GNBA 3E97A 3OF1A 1XU2A 1UPSA 1CJDA 3AP5A 4AFCA 1RUI3 5C9AA 4UW5A 4BWOA 4XQDA 3SH5A 1NE6A 1POV1 4Q1PA 2LUWA 1W6PA 2GU9A 3AJYA 3IN9A 4RQPA 3WUCA 4FTSA 4AQTA 3C3VA 3TNPB 1QQP1 3RI8A 5JCTA 1RINA 1Z0HA 3AKPA 1HQNA 1NQDA 3FBYA 3CU7A 2OA2A 3SISA 1O4TA 5DUXA 4KQ7A 4PCRA 2QUOA 4GKXA 1H2NA 2PLV2 3P3PA 1ENRA 4JGYC 4EN0A 2RMU3 5EFUA 3WG2A 1QJZA 4CEYC 5F6LB 2PFWA 2R042 4E2SA 1IHMA 2ATFA 3GBFA 3VBRB 1PZ9A 4CDUB 3ZFGC 2VH9A 2D40A 3ZN6A 2DUPA 3JD73 1QU0A 4QQ2A 2Z5WA 3JUUA 1NA1C 3VZJA 3VBFA 4FAHA 2B8MA 4Q0UA 5H9SA 4GIQA 2IC1A 3A0KA 2H6CA 1KJLA 2EXIA 1AYN3 3VBSC 3AXDA 3AKRA 4QHBA 4I0AA 2WL1A 4MSVA 1DYPA 1R093 5I0UA 1DGRA 4JGZC 4H7MA 1OD5A 5GLWA 2A6ZA 2DCJA 4Y1UA 4A3XA 4EN7B 3B5LB 1BVP1 1F31A 1EYBA 4MXWA 1BEV3 2IFWA 4OHZA 1YCIA 3AZYA 2X5IA 2Q5TA 1CAWA 1DIWA 1ZZ9A 2OYZA 1S2BA 2JJ6A 1LHNA 4NPRA 1YUDA 1TMF3 2BNOA 4JV4A 5AC93 4P14A 4L99A 1KXGA 4N90A 4NVPA 1EAH3 2Q1ZB 2XJQA 4WBBA 1RUG3 4N53A 3WW1A 1RUJ2 1TME1 2A71A 4E2GA 3JBG3 5IK4A 2RMU2 2UY8A 3S7EA 3S7IA 5A3LA 4Z92B 3GZUC 2DURA 4H3WA 4IXLA 3VZMA 5FO8B 4AYUA 4JGYB 1BQPA 4JTOA 4CEYB 3AYCA 1MS8A 3JD72 4FXKB 4AVSA 1YRZA 3BALA 2WKKA 1JUHA 4FTBA 4LUKA 2VMIA 4XBQA 2N7GA 1H1MA 3ZFGB 1AYN2 1QGLA 2GC2A 1SLCA 1VR3A 3DF0A 2ZGOA 4LO8A 1AX2A 2FMYA 2AGSA 3FWEA 1NA1B 1VBB2 1DLLA 5E8AA 3B7MA 1AX0A 1MS0A 2E7QA 4B7KA 1MVEA 4RGGA 1WCSA 4NHLA 3GBGA 3H50A 4JC1A 4L8QA 4META 2WZPP 2D3RA 2JX9A 1WW6A 1QY4A 3WDYA 1QF3A 5AC92 4JGZB 2YPJA 4AHYA 2E7AA 3NV3A 1DGWA 4YNIA 2E6VA 4GQ7A 1EAH2 5E89A 4BA6A 4R9DA 1U0AA 2XLAA 3GHNA 2ZACA 5T50A 1LHOA 1LENA 4HK9A 3EHKA 3I59B 4PIZA 4WVVA 2LTNA 4IV1A 3JBG2 1ZREA 1ULCA 4FPEA 1QXPA 5K7PA 1UU5A 2WZR1 3RMXA 2BTVC 2ZKNA 4Z82A 1VALA 5IK8A 2EF6A 5E16A 3AMMA 2VXRA 5DUVA 2CWSA 3V0AB 4YGDA 1N3OA 2C9AA 4XF0A 2Y0OA 1UD1A 4E4ZA 4JTNA 3FBMA 4Q0PA 3KT4A 1LHVA 2R16A 3OY8A 3QLQA 2P2KA 3U10A 1Q8PA 1UMZA 1S55A 1IOAA 5ACA1 2GNDA 3RQ0A 1F5FA 4D7TA 3WP6A 2UYBA 1YJKA 2ES3A 2W52A 3RYKA 4COZA 1QDCA 2OVUA 1UAIA 1N3PA 1R082 4WM8C 3MFCA 3VKOA 1WBFA 3LA3A 3JQXA 1D2QA 1IPKA 2A3XA 3KM5A 4KH9A 3PNAA 3J8F3 4XJ8A 3E6BA 3AP6A 3U0ZA 1SFNA 4RHV1 2ZABA 4XEZA 4BMBA 4EWAA 1V9U2 3MICA 2PHXA 5EZWA 3SH3A 3WINE 3SMHA 3IKWA 5JSPA 1MZFA 1C5HA 2WNUB 1JUIA 4TLFA 1PGW1 2R063 4XOGA 2XG3A 3ZXDA 2QNKA 2YYOA 5DDJ3 1VAMA 3AZVA 1KDKA 1OFSA 5CFDA 3O0WA 2GAUA 3VHOA 4D69A 1PIV1 5FLJA 2YDEA 5H9RA 1DYKA 1H8TA 4OHYA 3CL1A 2VMGA 4BM8A 3LCPA 4MXVA 2ZOEB 4AF9A 4I09A 1RUE3 4Y20A 5C8CA 4BH9A 2WFF1 4CDQA 3A4UA 1ASJ1 3ROUA 2EAKA 5LEKA 1VBC3 3AMQA 4QT6A 3D4KA 1NY72 2DVDA 3ZXJA 1ZRRA 1C28A 3VBUB 1PO23 1QOSA 4GMP3 1BKZA 3PVEA 4XZPA 2IXHA 3RSJA 4PLMA 1XXNA 2XJVA 5KBFA 4W6WA 2YXSA 1NXD1 1N1VA 4UW6A 3AX4A 3J8F2 4HPKB 3DPRC 1FNYA 1WW4A 4AI2A 4OI4A 5KC6A 4P9XA 3QH7A 3RYPA 2B45X 4QPGB 2ZX4A 1Q8QA 4Q4Y3 4ORFA 3ZXKA 4M01A 1H4HA 3TRSB 2HWE2 1OQ1A 2R062 4XF1A 5JPNB 1POV3 3ZN4A 1AX1A 3MI8A 1TE1B 4I0WB 1QQP3 4Q0SA 2FZ2A 1XYNA 3D0SA 4Q0VA 2OZ6A 5EJ3A 2D6PA 3VBRA 4HSLA 4CDUA 3ZXGA 2CGNA 3PHMA 4RFT0 4XMIA 3WX5A 1J1TA 1RUE2 4V1PA 2PLV1 3VDDA 4K1YA 4AFMA 2YY1A 2WFPA 4GA9A 4LUMA 4FVVA 1VBC2 4YW1A 3OBTA 5DZGA 2Z2SB 4MGKE 3VZOA 3D0JA 5BV6A 1FNZA 3PMEA 1W6QB 2R041 3IMNA 1AR72 1PO22 4KBBA 1DBNA 2DUQA 4QXKA 2ZHMA 1MS3A 4C1WA 2UYAA 2WLPA 2P37A 3ZVXA 3SCFA 4AFBA 1RUOA 2IXCA 2X53S 4GWMA 4LNVA 2VW2A 4AVBA 1EPZA 3UJQA 2EAAA 2DCKA 1I6XA 3MLJA 1JN2P 3ZDSA 4BIOA 2VU9A 4Q4Y2 1L3JA 4XTMA 2CWMA 2WT2A 4Q26A 3R0RA 1W6OB 4FXGB 2WS92 1R1ZA 4ATEA 3AMHA 2CGPA 3ZXLA 1RGSA 4D94A 4OHVA 1ENQA 3VL9A 4MH0E 3N7MA 1QQP2 1XE7A 3FZ3A 4OHXA 3WZ1A 4MX3A 4ATFA 1X8MA 4YARA 3I8TA 2B39A 5AVPA 4AE2A 1AXYA 2AUYA 5GLVA 3OD4A 4JGYA 4CEYA 2IWGB 4EN6B 1WCDJ 2UY9A 1RUJ1 2CNAA 3ATGA 2RMU1 1TME3 3SH4A 2VNOA 1LHUA 3ZFGA 2GC1A 3ZXEA 1HXS3 2VOKA 2JG8C 4B29A 1NA1A 4Q8KA 4Z2WA 4ES8A 5IK5A 3WR0A 3WDWA 3SXWA 5DUWA 2K2SA 3VBSA 1C3HA 1D4M2 4FPJA 2VQAA 5T5PA 4M3CB 4A7YA 3N35A 1AYN1 4YG0A 4HETA 2KXLA 4R4XA 3RMYA 4BYYA 4JGZA 1APNA 1D0HA 1LCLA 1VBB1 3WW4A 1C57A 3OYWB 5LRRA 4KU7A 4HKWA 3FX3A 1ULFA 3KCCA 4QQPA 2GDFA 2NYYA 1HDKA 3ZSKA 4JDMA 5GZFA 1ZBA2 4H55A 2BBVA 5JVVA 2ET1A 3WQ1A 3SCGA 3RPQA 1G9CA 3EO6A 1PVXA 2AYHA 5L7OB 1W0PA 4HN1A 1HQWA 3WG4A 2D98A 1JYIA 5GZEA 3LA7A 1GV9A 2DU1A 1EAH1 3NAPC 1C8NA 1NOVA 3BODA 3JB4C 4IEVA 4LA3A 1LGBA 4IESA 3LOIA 3FC0A 1U5YA 2D6KA 5CG8A 5C4WC 3JBG1 1Z78A 3B69A 3HWJA 2ERFA 4EWDA 2E7TA 1ZX5A 1GZCA 1DZTA 2D5FA 2R0HA 4OZXA 1JOJA 2ARXA 1HXS2 3ENRA 1LGCA 4Q4X2 2Y0IA 4XFBA 1KS5A 1NLRA 3CJIC 2H0BA 4FPLA 3S0MA 4IEZA 4LBMA 4WZCA 3V0BB 2JG8B 3HAGA 1KQRA 4HSJA 1O3TA 4HVOA 5I93A 3WLUA 3V65A 2VUJA 3WD5A 1R081 3M3QA 4COUA 1LU2A 4FPCA 4QM8A 3IWZA 1SBDA 1CN1A 3MYXA 4QQHA 4Y1VA 4BIFA 4YRDA 3FUQA 4IEOA 5FDBA 3ILRA 4OUSA 4Y1YA 3UL2A 4YFWA 4RHV3 1V9U1 2HWC1 1LB2A 5DZFA 4DY5A 3ILNA 4DPNA 1SLIA 3USUB 3D8CA 3E6CC 4CP2A 2FHRA 2JEMA 2Q8OA 3FUOA 2XKPA 4KWKA 3KS7A 4JRAA 3LKJA 1YXWA 1PIV3 4LHNA 2R32A 3NAPB 3MIGA 4FT8A 5I8TA 2CGOA 1HLCA 2AR6A 3C2UA 2ZGMA 5JIUA 1SBEA 3T1LA 5C4WB 3HT2A 1LOFC 2WNVC 1DGRN 1XYPA 2D6MA 5J98B 2WFF3 3N4MA 3IDEA 1MQTC 1ASJ3 2IZWA 5BNOC 1NY71 4HPKA 3WCSA 2ZGNA 1A3KA 2D7FA 4EN9B 3R4UA 4TSVA 4WM8A 1HV0A 1LGNA 1WLCA 4LBJA 2QE3A 4EN8B 3VBOC 5DG2A 1GICA 1RL3A 1BCXA 1RMU2 1WBLA 1RVF1 2O8OA 1LOGA 2A3WA 1MR5A 4KGGA 1GZWA 1LULA 2VW1A 3J8F1 5AFBA 1G9BA 1YI9A 5KHJA 3HMYA 3KT7A 3PVBB 4LO5B 3VHPA 1ULGA 1OQEA 3LOBA 4E27A 4RHV2 4LTAA 5GZGA 4Q27A 4GH4B 3WQ0A 4M00A 3HN1A 5B2GB 5BNQA 3QBQA 2HWE1 2DU0A 1MACA 3WXPA 2A73B 1PGW2 2A6VA 3FFZA 4NN0A 5D8AB 1W6QA 3KGZA 4BCUA 2XJUA 1QXRA 2XGXA 2Q4SA 2R6QA 5I0RA 4YGEA 2XLFA 3UJOA 5FQ0A 3KCYA 1RUE1 3LSEA 2QKDA 2HJIA 3ZSEA 3MIHA 3IDCB 1VBC1 2DVAA 3LZZA 3M3OA 1REDA 3B94A 1AR71 5IUQA 1PO21 1W0OA 2R1DA 4GMP1 4W6XA 3AK0A 2XVGA 2QFEA 1MQTB 4YSFA 5BNOB 5EV7A 2G9GA 1W6OA 5GLTA 3DPRA 2W0XA 3GF6A 3H1YA 5JOZA 2XJTA 2D5HA 5BUVA 4HL0A 1H2LA 1FOD1 4IERA 3WP4A 3VBOB 2GNMA 4N9HA 2E63A 2D3SA 4AI8A 2OZJA 2GSYA 1RHI1 4Q4Y1 5T54A 3GALA 3P3NA 4K3UA 2ILMA 1PZ8A 4HN0A 2H6BA 3M4FA 2WS91 1PVC3 4K40A 5TSWA 3RRDA 4CEWA 2V5YA 2KA3A 2E51A 2XJSA 3MEPA 2HWF1 2GALA 4TWTA 4HT1T 1DQ1A 4FPGA 1X50A 2XPJA 1RUF2 1DQ4A 4R52A 1OI6A 1V00A 1RUJ3 3PLQA 4XIOA 3UKVA 4M3CA 4LE4A 2CV6A 3TN91 3JCIA 4UBGA 2R49A 1BMV2 2G4IA 3ALQA 5KHGA 2VUAA 1WLWA 1CIWA 4P9JA 2BNMA 3H7YA 2JECA 3FLTA 2E53A 5E1RA 3SLIA 1X8EA 1D4M1 1EV13 4LE3A 4L92A 2A6WA 4BOWA 1VIWB 2WQ4A 4KWLA 2MNGA 3TB0A 4YGBA 3FLPA 1OMIA 1VBB3 4YM2A 1HQLA 1PVC2 4AI0A 3OGGA 4YW4A 4PBOA 2VNGA 3MPBA 1ZBA1 3MW4A 3WG3A 4KWJA 2Z79A 1GSLA 2LM3A 1GFF2 2FZ1A 2MHFA 4QGNA 1G8WA 4PDWB 1DQ6A 1VAKA 2P3IA 5JZGC 4CRQA 4BE3A 3RNSA 2ZGKA 5GZCA 1YFXA 3NKTA 3OGJA 4M0HA 2OPKA 3AP4A 4BHPA 3ETQA 3M2MA</