4P9JA

Crystal structure of rabbit ryanodine receptor 1 spry2 domain (1070-1246)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
180
Chain Sequence
SNADRVRIFRAEKSYTVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ryanodine receptor 1
publication title Crystal structures of wild type and disease mutant forms of the ryanodine receptor SPRY2 domain.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 35
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4p9jA00
4X8PA 5JIAA 5C33A 4XW3A 2LM3A 3UV9A 4QT6A 2IWGB 4P9IA 2FBEA 4P9LA 4KG0A 2YYOA 5JI9A 4N7UA 5F6KA 4WVMB 4V1PA 4B8EA 4B3NA 2VOKA 4WVMA 5JIUA 3ZO0B 2E63A 3TOJA 3KB5A 2YUEA 4P9JA 5F6LB 2WL1A 4N7IA 4X8NA 5JI7A
chains in the Genus database with same CATH superfamily
1JU4A 4K20A 2ZS6B 3J8F3 5EQUA 5FZDA 3FL7A 5FMOS 4IGQA 1PO13 3UETA 2VW2A 4YGEA 2R0FA 1AR93 3ELNA 3F95A 2TNFA 4AEJA 5BNNA 2VZPA 1W8TA 4COWA 4AQTA 1VP6A 4D8MA 2WNUC 4FPFA 3VKOA 5FZBA 1AXYA 3LPGA 5I0SA 1OLQA 4AI3A 4CU8A 3B00A 2EIEA 4TWTA 3IPVA 1WCKA 5FZ3A 4BMBA 5A6YA 4B29A 1QNYA 1I6XA 4AHZA 1W6MB 2HH9A 1O5UA 1RUC3 5A7WB 3VBRB 2HYXA 4CCEA 5ABJB 3TB0A 2BGOA 1MEC2 4BZ4A 5A32B 4W65A 5CKNA 2WAAA 1QDCA 2L9LA 5KC6A 5J37A 2OUJA 1CONA 5FMCA 5AC92 1APNA 3OCPA 2GZWA 2AREA 4IW3A 1OA2A 3PHMA 1VB4A 3D3AA 3NV2A 4JTNA 3C7EA 2ZACA 3I2DA 5E89A 2D3SA 4Q29A 4QXBA 5JSPA 3IDAA 4NHXA 3PDQA 2X05A 5A3TA 4PIYA 1BMV2 2XKOA 2WQZC 3K3NA 2ZMLA 4RHV1 3D8CA 2VMEA 5CFCC 2FDFA 2PELA 4Z2AA 4M3CB 4LORA 2PAMA 4N90A 4ARYA 5LA0A 2ZA9A 5A3NA 2VMDA 4CP9A 4LKFA 3BTXA 4XC9A 5D8AB 3TAYA 1E5SA 4GKYA 1W0OA 1KS5A 4NIIA 3OJBA 4XILA 1W0PA 3FUOA 2NP0A 3LDKA 2XPJA 3OBAA 2B9UA 3SNMA 1LJ7A 1S0FA 1CX4A 4CVUA 2WWJA 3A7QA 5J7MA 3WVJA 3ZXLA 1J59A 3WINE 2WQ4A 2QE3A 4MV2A 4PF1A 1O91A 3NAPB 3VBHB 3KVAA 4HLTA 1Z78A 2VMFA 3KF5A 1LGCA 4AFDA 3ALQA 1MR5A 4J25A 3U1XA 1O3SA 2YUEA 4E4DX 5EYYA 3FHIB 4LLFA 3WDXA 1V9U3 4IEQA 5A3OA 2QQWA 2NMNA 2HJIA 3ES1A 1Y3TA 2XBO1 2YBSA 3LGRA 3ZSMA 5B4NA 2VZVA 4LMFA 1QJU3 1JYCA 5FJKA 3IM0A 4A3XA 1W6QA 2QQOA 1C1LA 2EVXA 3A21A 2BBAA 5CB7A 4GWMA 4OYUA 1EUTA 3POYA 4BHPA 2ES3A 3WR0A 5LA1A 1KD7A 4BU2A 2XJQA 3CDZB 4S2FA 5GKAC 1SG3A 1GNHA 3IDBB 1HQLA 2O1QA 1MS1A 5CBLA 3IAPA 2XWJB 5FZFA 2WFF2 2JG9B 1J3PA 2E53A 2HYKA 1BCXA 1NZCA 3LA3A 1DZRA 3N7MA 4GZ9A 4YW3A 4DOUA 2AR6A 1PX4A 2J1SA 1NOVA 3WF0A 2OPWA 1US3A 4IERA 1GBGA 2IXIA 2JDPA 1BBT2 1J3RA 2P34A 1QJU1 5JR7B 2NN8A 5GZGA 3AL5A 1NLQA 3W5MA 1LHVA 2R49A 4DY5A 1KFUL 3SITA 4OI4A 3T08A 3ZFEC 4DEVA 1UYZA 2XVKA 2VM9A 4P9IA 2UYAA 1PGW1 5BNQA 3B02A 1MQTB 1OQEA 3BTYA 1R091 2RJLA 1JI6A 3VUOA 2OX0A 2MEV3 4LIVA 4MXWB 3WD5A 1FI2A 1WA6X 2VG9A 4I3PA 3B9CA 1DCSA 1UMIA 4B8EA 1CZTA 2D5FA 4QPGA 1HQNA 4FP2A 1FX5A 4NWWA 1LULA 4KI5M 3ZOIA 5FZHA 1FOD1 5EPAA 1QMJA 3T30A 5DZEA 2A6YA 4QKNA 5F8PA 3ZR6A 2VPVA 5JI7A 3NV1A 1YQ6A 3ON7A 4D7YA 3DCQA 2RS52 3BU7A 1UN1A 3K51A 4AQ6A 4PDWB 3VHRA 3FN9A 3ZIWA 1CAUB 1RUH3 3V0AB 5EJ3A 5FAXA 1B09A 4J1WA 2C9KA 2DVFA 3FHQA 2BVVA 3T2TA 2XL7A 2PQQA 5H9RA 3DPRC 4KWJA 4FXKB 5C71A 4IV3B 4E27A 1OUSA 2Q1ZB 1VBB2 3SHRA 5FKBA 1RINA 1Q56A 2BYVE 4E2SA 3AKQA 4FBFA 5DXDA 3ZFGC 5CG9A 4NIDA 3KT1A 4IV1B 3AKSA 3DKWA 2RMU1 2DVAA 4UF0B 2FZ2A 1W6MA 3VBRA 1UY0A 4HOOA 1OUXA 5A7WA 5ABJA 4NUBA 3SMHA 4CCMA 2K0GA 3NJZA 5L36A 1HXS1 2Z42A 3ZXJA 5A32A 1R64A 1RXFA 2PA7A 4I3GA 2Y60A 3H3UA 4MOAA 4INDA 5IVVA 3DKQA 1QJX2 2R6QA 1EUUA 3C7GA 4MHRA 2HWC2 3O1UA 3NL1A 4JX0A 3ZIXA 1ASJ3 3FFQA 3ZN5A 2J1VA 1X8EA 3J7HA 5FPLA 1CAWB 4DRRA 1TNRA 2VO5A 4GWIA 1AXZA 3K4ZA 4FQZA 2WO2A 4XHBA 4AYUA 3DXTA 4AVCA 1XYPA 2GN7A 1W9WA 4NR1A 1WD3A 1OD5A 4ZY9A 1XNTA 4GWNA 1LR5A 1ULOA 1RUNA 4M3CA 5KXCA 5J09A 1X9TA 1S0GA 4NHMA 1QJFA 1H8VA 1VBE3 2E7TA 5D8AA 3MO4A 1W8ZA 2VW1A 5A3WA 1C8NA 2R1DA 2XUEA 1BVVA 1MZEA 1RB8G 5IJRA 3WP5A 4HKOA 2C1FA 2B5HA 5T55A 4YVWB 4FPGA 1CWPA 2WO3A 5FPBA 2Z5WA 4KU7A 2OKXA 1PIV2 1E5RA 1G9BA 3C3VA 1CVNA 2ZX4A 4K40A 4A3ZA 4AK3A 1MZ6A 2JXAA 4XFFA 5FWEA 1JYNA 1MACA 2GP5A 1N47A 3NAPA 4PLMA 3ACFA 3MYXA 4JTOA 3VBHA 4NIGA 5JXHA 4URTA 3VZLA 3HNBM 1BXHA 1OKQA 4Q4V3 5FZ9A 3WP6A 1BVP1 1O8PA 2B42B 2CWSA 5A7NA 2ETEA 5ISLA 4WZCA 1HQWA 2IC1A 3O1OA 4LO4B 2A6ZA 2DDUA 1LODA 5FP3A 4XHXA 2HWB1 1HV1A 4AQ2A 1AYM2 1UU5A 1YI9A 2X5IC 4PF5A 2CHHA 1DQ1A 3B5LB 4L0PA 3AFKA 3ZN4A 2QZ3A 3T2QA 4FCAA 1QXPA 1XE0A 4LE3A 1YQ5A 4RR3C 4HONA 2XJPA 3KV4A 3O1TA 4XACA 4Q5OA 4CU7A 3PTYA 4IE0A 1H0BA 1W8UA 4BK4A 2WIIB 2KM2A 1LOFC 3RS6A 2VUJA 1H8TC 4R8HA 1B35B 3ZFFC 3KWVA 3R4DB 1VBA3 2RDQA 5K8SA 2XH6A 3D5OA 2MHFA 4WM8A 1GYKA 3WF3A 2IXCA 1TNFA 4QXHA 5A7PA 3MLJA 4KBBA 4CDUC 1CD3G 4UFLA 1FV3A 1M4WA 3ZXAC 2ZKNA 2JEMA 1VBD2 1FMD3 3RJRA 5FY0A 1HRI3 4CXXA 2QQIA 4FPLA 3W59A 1NT0A 1TMF1 2EA7A 2XQXA 3EXUA 3POBA 1XU2A 2BRTA 3PVOA 5CIRA 4O65A 4QU2A 5FY1A 4CU6A 5LK5A 5FPXA 1AR83 1MQTA 1PVC1 5GALA 2JE8A 1OLME 4KBZA 5FZLA 4UOJA 4YM0A 2R1BA 2ZZJA 1D4M3 4MXWA 4QHOA 4UW5A 3ETQA 5CG8A 5IVBA 1VBA1 2D44A 2IZWA 4YWAA 3JZVA 2VH9A 2HWE2 4QDRA 5HPOA 2VNGA 2WINB 5KHIA 2HWD3 4CTEA 4LR4A 2OIIA 3WG4A 1PO23 4H55A 4XJUA 4Q8KA 4YZ1A 2TEPA 3IMMA 1UYYA 3ZMOA 4CDXC 4Q1RA 1AL23 2VCMA 2PLV1 5CEHA 2IVJA 5F1RA 2PHUA 1UAIA 1ND3B 2WNOA 1GP6A 2JWPA 3E6DA 1CAUA 1OA3A 2C24A 3MBWA 3OY8B 5FZIA 3V0AA 1RMU2 5GM0A 3FE5A 4XBLA 1X33A 1CQ9A 4BISA 4LO6B 1Q8QA 4BQWA 1VMFA 1U5ZA 4IV3A 4DFSA 4LBQD 3AZWA 4UFMA 4QHBA 4QAWA 5F6LB 1ODMA 1RUI1 2EAAA 2EXKA 2E32A 3N36A 4UF0A 3RZLA 4XJWA 1EYBA 4AVTA 1WW5A 2HLEA 3PU3A 2H0VA 1J1TA 4M4PA 4L2NA 3H0OA 5DAQA 1RUF3 5FYBA 2DVDA 2QCSB 3OG2A 3DYMA 5FYHA 5FO8B 1SFPA 1QOSA 1LHNA 4K1YA 1HKDA 1H1AA 1Y43B 2K2SA 3LSDA 3M7AA 4S2GA 3GGLA 4Y1UA 5C4WC 2Z4FA 3B93A 3PNAA 3CJXA 4AI8A 1CAWA 4B7EA 2XBO2 4OFGA 4DXRA 2FZ1A 3Q8AA 2DBIA 4HSLA 3H9AA 1CPMA 1A6CA 1DYKA 1R081 2VMGA 2ZCWA 4MGYE 4X8NA 5B2GB 5BNNC 1S0BA 2Q8EA 2EXIA 3K75B 3THDA 2QKDA 4R4XA 4OHWA 3WNMA 1NCRB 2RV9A 2ZHKA 2GP3A 3POEA 3HBKA 3HN3A 5F3IA 2XL9A 3NO8A 1NLSA 3AMMA 2LALA 3PVNA 4YVWA 2AENA 2J1AA 4FAGA 3POSA 3ZSKA 4DY3A 2UWAA 1N1YA 4XDQA 4XQDA 1PZ9A 4XZPA 1WMEA 3EYPA 3MV11 4OMDA 4LO5B 4RS5B 4C91A 5JZGB 2VZQA 2Y6HA 1I3HA 3POFA 1WLDA 5C5TA 1LCLA 4YM3A 1YUDA 3ROUA 1YC61 5IWFA 4MH0E 4BIFA 2QDNA 5BV6A 3BODA 3KT7A 2PHWA 4JRLA 2VGDA 4MX3A 3OEAA 3N9LA 2RS13 1T2XA 3P1IA 2LS6A 3AYDA 2J22A 1Y9QA 1XBFA 1J83A 2WLPA 4LBJA 2J7MA 5C33A 1MEC3 1K5JA 5FXVA 5LY1A 5FMBA 1ZBA2 2WN2A 2Y38A 4FPEA 1BEV3 2R041 1MS3A 4YYOA 5G05L 1GFF2 4KL1A 5AC93 1F4HA 3I97A 1RYYA 4H2AA 1US2A 4QD2A 3K4DA 1GU3A 4AR2A 2D93A 2Q4SA 4JDNA 2BNNA 3CL1A 2JD9A 1B35A 3USSA 3PIGA 3BVCA 1UYXA 2YBPA 3KF3A 4JZRA 2RS11 3QH7A 1LOGA 1W9FA 2Y6LA 4ASMB 1HB2A 1WCSA 1ZZBA 4C8DA 5EZWA 1MS0A 2JIGA 4UBGA 4HPKB 4YG0A 4YW1A 2WT2A 5EJZB 2WZR1 1N1SA 1UMHA 2FDHA 2VNRA 1JYWA 4B1MA 2QTWB 3O0WA 3WCRA 1W3XA 1FYUA 2X8KA 2VULA 1RL3A 3AL6A 4HK8A 1RUG3 1T6GC 2R16A 1OXCA 4OI2A 1O4ZA 2YDEA 4OCTA 5K0UB 4GMP3 3VZOA 4EN6B 2FMDA 4QKFA 1UY4A 2LUWA 1UPIA 4Y33A 3VD4A 5FTTC 3ZMNA 3LOBA 4XJZA 5HV4A 2XLFA 2IXKA 4W8JA 2CU5A 5FYVA 1Z0HA 3NVCA 3U4SA 1GUIA 1UWWA 3WF2A 5GZCA 1TVGA 1S2BA 2CDPA 2BFUL 3JBG3 3KVBA 5DG2A 3BKZA 1TE1B 4CUCA 3WLUA 5IAXA 1AYN2 5LEKA 3LE0A 4YVSB 3PJQA 1NE6A 1U5XA 3QOPA 3ES4A 1DBNA 2GH2A 1WW4A 4JKKA 2VY0A 1ND3A 4PBPA 1RUG1 5A1AA 3OY8A 4PI0A 5FQ0B 5LBFA 2ZJCA 5LA9A 1JS9A 2ZXQA 5JI9A 1STMA 3MIDA 4JCKA 1W2AX 2D6LX 3CMGA 3RYRA 3UGFA 1MS8A 3MUZ1 5IVEA 3T1LA 2BVBA 4HFSA 3NKTA 1MZ5A 1EPZA 5FP7A 3KV6A 1HV0A 2Q1FA 5FYTA 5FBZA 4CCLA 2Z79A 2C5DA 3KB5A 3GZTB 4P9JA 2WWSA 3TYJA 1J1LA 5FREA 2WFF3 1G9AA 2VVDA 5A7OA 4Y20B 2WC2A 5GZDA 3IT8A 2X10A 4RL7A 4XXAA 2ZGTA 5I8YA 1PX3A 1NY71 2W5FA 4Q4X2 4V2WA 5BNOB 3ZYJB 4AFBA 3VD3A 3K2OA 4Z1VA 2ZEWA 4GXLA 4JDOA 3EQEA 2H6BA 5K4LA 4Q0SA 5BNPC 4GA9A 4QWNA 1GZ9A 1K12A 2XMLA 4JQTA 3WG2A 2ARXA 1O5LA 2E7AA 3ZDSA 4JC1A 1UIJA 4BDVB 3HQRA 4XAEA 1SLTA 1F5JA 4KU8A 5L19A 4K6BA 1IS4A 2VR4A 4XABA 2RM22 1VE0A 4QPIC 1YFUA 5A3MA 2VUAA 1PMHX 3U75A 1K42A 3FLPA 1EV11 2DTYA 2E51A 4QQOA 4LK7A 3I3BA 4QDSA 3RVHA 1NCRA 3MGUA 3A0NA 1JTZX 1Y9GA 3AVSA 3WNOA 4AAXA 2RVAA 4F83A 1RUD1 1WW7A 4Q4W1 4AEDB 4A4AA 5JWPA 1WLTA 2FQPA 4YG6A 3UKNA 4OLLA 3CKHA 2AYHA 3I3QA 4QX7A 2B39A 1W3VA 3VBRC 5HCHA 3RSJA 4RS5A 4XUTA 5HI0A 3IIAA 5JZGA 4B1LA 1VBB3 1LHUA 3OEBA 1CESA 5EIYB 1AR71 4XIOA 1TMF2 3WDYA 3BCWA 4YGBA 4TYSA 2W87A 3A22A 3HR9A 3M8LA 3VKMA 1GP4A 2VAUA 5DMYA 1PVC2 2WABA 1GZTA 4RGKA 2MPFA 2ADEA 3JCIA 3O1VA 4KG0A 1FNZA 2A71A 4I0AA 2XLAA 3CZJA 5FOBB 2EICA 3WDTA 4D7SA 4DUWA 2CTVA 4NO4A 4UI9L 3MFCA 4AXOA 4BB3A 3GHNA 4WVMB 1YFWA 2V4AA 2HEWF 4OI1A 2PHTA 2BP6A 2RJKA 4GQ7A 5IATA 1BZWA 1SDDB 2HWC3 4FO9A 1DQ0A 4YFWA 4ITCA 3OUIA 3WG1A 5CU1A 4F7ZA 2R0HA 5L7OB 4FPOB 3SH4A 3KMHA 1F2NA 4YW5A 3UT0A 5F7UA 3O0VA 1RUJ3 2WSVA 1O3TA 4C0BA 2ZBJA 1Q8OA 5LBBA 2VUDA 3OGJA 4P9YA 1WMFA 2E7QA 2JJ6A 4HPKA 4XJAA 3AP7A 3VZJA 5FYCA 5LWBA 3R05A 3B01A 5DUXA 4P9LA 4B7KA 2ZZQA 2DCYA 5E1RA 3USUB 1DGRA 2PN5A 2W47A 4R9DA 3GXUA 2R062 2Y26A 3KGZA 2ERFA 2ZHLA 1LGNA 5K0UA 1PIV3 2YU2A 3APBA 1EAH2 1ZBE3 3AB0A 3WHTA 1GV9A 3NJVA 3ZXKA 1ZRIA 1QKQA 4AVBA 4GALA 1BK0A 3BPSA 2JDMA 5FV3A 1RUJ1 3M3CA 2DU0A 1UMZA 2GSYA 2VTFA 3E6BA 4E2QA 2QQPA 2J1UA 3GCWA 4XBQA 4YVSA 2P17A 3U10A 1WZXA 1AYM3 4QPWA 5FOJB 2IFRA 1OF4A 3R0RA 2WO7A 2VMHA 2CGOA 2ZGMA 5F39A 1S2KA 3WEZA 5LA2A 1XC6A 2JG9C 3RDIA 1PNGA 4NVPA 5FQ0A 3VHPA 2WO1A 3CLPA 3MIEA 4QM8A 1ZBE1 1KJRA 3U0ZA 1QU0A 1BLZA 4HANA 5FXWA 3VDAA 5IK8A 4QX3A 1JHJA 1AR62 2XDVA 4HVOA 3VBUB 2VZTA 1QNWA 2JKXA 1YFYA 4Q2FA 5C3RA 1VAVA 2R073 3BI3A 1VIWB 4H7MA 3LF7A 4Y20A 1OI6A 2CSGA 1DLLA 1GNZA 2VJXA 1MQTC 2V72A 3N9QA 4OMCA 5H9SA 2JD4A 4GH4B 4D7TA 1AX2A 2XKPA 4LHLA 5FR3A 4AWDA 4CEYB 3THTA 4CDQB 2KXLA 1VBD3 5BNOA 1IPJA 3GDBA 3Q8FA 1NE4A 5I93A 4AI0A 3NWKA 2W2IA 4QKDA 2WYSA 2G9GA 2ATFA 2XHNA 3AFGA 3M3QA 4MHUA 3ZYFA 3C2UA 3OTFA 5A7SA 3H7JA 4MZUA 1NLRA 1IHMA 4RN5A 2YBKA 5DUUA 4DINB 3J7MA 3T09A 1XXNA 3MFAA 4CUGA 2X29A 4P5YA 2JG8B 3KCCA 5F5QA 3GJAA 2R071 5J48A 4PDWC 3ZSLA 1LEDA 2HWE3 2WA3A 2DCZA 4N53B 1KQRA 4A42A 3RZKA 3VBSB 1XQNA 1SPPB 3J8F1 2WZPP 4CXYA 1PO11 2F6BA 2ORZA 1W6PB 3VDDC 1AR91 4D69A 5HCFA 1JH5A 1MPXA 1JZ5A 1PK6C 1S0JA 2OZJA 4XE9A 1RVF2 4E9KA 2CWMA 4EWDA 2P3YA 4GKXA 1W06A 3D0JA 1VBC2 1LKNA 4AEDA 1HRV3 1H6XA 2FDJA 2W1SA 2ZKLA 1RMU3 1V00A 3QD6A 1X50A 4IV1C 4YZ2A 1OPMA 1DZQA 2RDRA 3E5UA 4ZU7A 3FLTA 5I0RA 1Z7S2 3VKNA 1RUC1 2JENA 1NXMA 3I8TA 4CEWC 1AJOA 2VECA 3MEPA 3LB9A 5LB6A 2RG4A 2YC4A 2EIGA 3WNPA 4NRMA 3CBNA 4ZS3A 3I2GA 3U37A 2FBEA 1DP0A 2XWBB 1UZZA 4WVVA 4CA9A 1HRV1 1UQXA 3WW3A 2G9FA 2TUNA 3WQ0A 4YARA 4BE3A 3PJYA 3LKJA 1W99A 4OHXA 3ZYGA 3RZGA 3B7MA 3MV01 4WVMA 5LRRA 2JE9A 3AZXA 3HOBA 4Y1YA 1JZ7A 4ISRA 2VOXA 2D3RA 2E9QA 2IXJA 3Q8EA 4KGQA 5DG1A 5T5PA 2CL2A 1WCQA 1VMHA 4K21A 1OOPB 4YW7A 1YO8A 2OYZA 3VB9A 2VMIA 3PUQA 1GKBA 2Q30A 2XHKA 4Q4Y3 3DGTA 4QB6A 5IHRA 5KHKA 5FY7A 5L7OA 1UCXA 4K8FA 5F37A 2XXZA 2P2KA 2C4XA 2FHRA 1A8MA 1ULDA 2W68A 5BXXA 2VNVA 2QQJA 1YWKA 4XAAA 2VNOA 5JMCA 3OGVA 1YI7A 3MIFA 4LBMA 3O1SA 2WS92 3O5SA 5KXEA 1OQ1A 4RFRB 1L7QA 2E31A 2RS32 2WFPA 1L7LA 3MLKA 3USUA 3B69A 2JDYA 2W91A 3N7JA 2A3XA 5C9AB 4LTAA 2HBUA 5J96B 4BXFA 4WM8B 1GWMA 5LBCA 1BHGA 4Q4Y1 2JX9A 5AFEA 1V9U1 1QH7A 4XFAA 3UNPA 5FYSA 1OMIA 2D6NA 5CADA 1WW6A 2VQAA 1ZZ7A 5CYYA 4AI2A 1GQPA 2EF6A 2ZGQA 4AGVA 3VBFC 1GSLA 1LB2A 4XF0A 3UV9A 3GZUC 5C8CB 4NE9A 4NHLA 3AMNA 1DGRN 3VZKA 1ZREA 3O7OA 3H50A 3U14A 2DUPA 4PHZA 1NCQB 5A70A 2RR13 3M3IA 2UYBA 1ZBA3 4XMIA 1JBCA 2VZRA 5DDJ2 3KSCA 1PM7A 2UU8A 2IUWA 3LWCA 4GB32 4OUSA 2VQUA 4P9XA 1ZNPA 3SQOA 2ZEZA 5GLWA 4E8CA 1PGSA 3S5QA 1QQP2 1SLLA 3VBUA 1A3KA 1W8NA 2QQUA 3NMBA 1CIWA 4IGOA 3RWKX 1JZ4A 1K3IA 2IXLA 2ZGNA 1RUD2 4F3JA 3I2JA 1R1A3 1RJ7A 1ENRA 1RUE3 2ZGUA 4GH4A 4A44A 2LRPA 1VRH2 2RR11 4CDQA 2NLRA 4CEYA 2ILMA 2MEV1 4OZXA 3ST7A 5FLHA 4AI1A 4KMQA 4EN9B 5IYYA 2ZGSA 5A7QA 2A1XA 5LRSA 2AGSA 3V64A 1PMIA 3GM8A 3MF6A 4IEXA 1IZ3A 4LBNA 1TME2 3NNLA 2WNUB 1OPOA 3IKWA 4XUNA 1QIQA 1G7YA 3A23A 1ZX5A 5F5CA 5FXZA 3RPQA 3TN92 5HCAA 1VPHA 4N8MA 5FZ6A 4NJ4A 4BQXA 2JG8A 4SBVA 4CCDA 3J7LA 4AQSA 1GOFA 5BY5A 4N53A 2BV4A 2JECA 1R1A1 1I5PA 1J58A 3PTRB 1RUE1 1RUH1 4YZ4A 3VBSA 1SPPA 2B45X 3AZYA 2HWF2 4FTEA 2FD8A 3GYDA 1W6PA 4IEZA 3BOWA 1AYN3 2WKKA 4A2UA 4QQLA 4AL9A 4IQPA 1A8DA 1RXGA 3NJYA 5CNAA 1QJY2 3I59B 2RDSA 1DQ4A 1H2MA 5EFUA 1NAEA 1ULPA 1AX1A 1GQGA 4CCNA 1XNAA 5FY4A 4UAPA 2O8OA 3WDVA 5A3LA 4Y1VA 1F4AA 3MW2A 5CFCB 4HVRA 4URAA 4QHZA 3T0DA 3S0MA 2V5DA 3S6PA 5JSOA 2Y0IA 2B4KA 4FP3A 4Q1PA 3CIHA 4XCAA 1H2LA 4CP0A 2EAKA 1EP0A 3JD72 1S1AA 2YFZA 3VD5A 5KC5A 3DV8A 1ENSA 3HN1A 3UL2A 4FTBA 4Q4X3 1BYHA 5H9QA 5A6ZA 1VMJA 1FPN2 2WNVB 1ASJ1 1XNCA 3ZM8A 3E1F1 4BJ0A 4M3CF 4LHSA 1RHI2 4XUQA 4P00B 3RJ2X 3RFRA 3I3DA 4IE5A 3THPA 2I2SA 2Y64A 3S7EA 4Y1XA 1OC1A 2W08A 2O8QA 2ZX1A 3FHAA 3I2IA 1LTEA 5KHHA 1JZ6A 2D3PA 1OOPA 3JB4C 4ES9A 3ZVXA 3RZJA 2WDBA 4MGZE 3PL0A 1VBE1 2BOIA 4GULA 4YM1A 2YMZA 4YM2A 1GZCA 1F31A 3J7NA 3NNJA 1FATA 2RM23 1A78A 1H9WA 2R7EB 4PQ9A 4QB2A 4EWAA 3MZHA 1YCIA 4P9GA 4UYBA 3RGBA 1IG3A 1LOAA 4LHNA 3I49A 4I09A 3ZXFA 4BOWA 1WD4A 4MUVA 3K4AA 1JOJA 1C8M3 3DYPA 1N3PA 2BFUS 2D98A 4MLOA 1COV2 1NA1A 2Y6GA 4MG2A 1NUKA 5JIUA 4OUMA 3FMGA 3KD4A 1WLCA 2GC1A 3AP9A 4CPBA 4B4QA 4MXVA 2E33A 3IDCB 4Q4V1 3PVEA 4UXAA 5C9AA 2PTMA 3WNNA 2HKXA 3H1WA 4PI2A 1LOCA 1HJGA 3MW3A 3E6CC 1E57A 1VRBA 3EB7A 5L9VA 2ZGLA 2SLIA 1IKQA 1ULCA 5L9RA 3TEYA 1I5ZA 4FSJA 2Y8KA 2GN3A 4DRVA 1DGLA 5C8CA 1AXKA 3AMQA 4AFAA 1C8M1 1QDOA 2BNOA 1V0AA 2W3JA 4PLOA 2CDOA 3KHBA 5E88A 3VLBB 1NCQA 1GWKA 2VBPA 5SV5A 3WF1A 3VBOB 5CFDC 2DUOA 1XYOA 2PHLA 3J26N 4O9GA 3VGIA 2WNEA 1MS4A 4HBNA 3ACLA 4IEPA 3VHOA 2FCVA 4ES8A 1D2SA 4XUOA 5HV0A 1W9TA 4HK9A 2VOTA 2G1MA 3ZKYA 3RRDA 3SLIA 2SBAA 5DZGA 4AEKA 1FMD1 2BUKA 2KA3A 4UW4A 1HRI1 1UXXX 2W39A 3H8XA 2BZDA 1GQHA 1KDMA 3VDBA 5C3SA 3B9IA 3M2MA 1AR81 2XJRA 2D6MA 5I0UA 3T3YA 2XJTA 4EN0A 3RQ0A 5I91A 4NN0A 1O8SA 4N7UA 1SLIA 1D4M1 1ZZ6A 3O0XA 4RHV2 3FBMA 1ND2C 3KCXA 4LJHA 1KEXA 3OYWB 2R063 4XJ8A 1V6OA 3BYWA 2HWD1 4DB5A 2OUHA 2WNUA 1PO21 1OF3A 1R1ZA 4Q8LA 4Y4RA 1XPWA 3A4UA 4JQRA 4HZFA 3ZFGB 1UX7A 1W8FA 1F35A 5K9YA 2AEZA 4XUPA 1AL21 1NZIA 3VZNA 1F5FA 3MPBA 3FUQA 2P3IA 1CGPA 3PVBB 5DABA 1JMUB 2GH8A 1YEWA 1GICA 2XJSA 4RGGA 2Y6KA 4IEOA 4DPNA 4AGRA 1LENA 2GDFA 1FV2A 5FY9A 2DCKA 5ACA3 3BUCA 2YV8A 4QGMA 3AJZA 1O4YA 3LAGA 4B4RA 1QGLA 2VZ3A 3DF0A 4KQ7A 4XF3A 1S4CA 3I59A 1PZ7A 3OGSA 2VCAA 3V0BA 4RQPB 5JDBA 3ZYBA 1QXRA 3PMSA 4WM7B 2CV6A 4F8AA 5FO9B 4FPYA 4XURA 1GNYA 3FZ3A 3URFA 1AR63 3FWEA 4I0WB 5BNOC 1KJLA 5CFCA 2B7YA 3IWZA 3GALA 3QH6A 2DWRA 4H7LA 3D0SA 4ZPIA 3AJYA 1XB9A 1HJFA 1RUF1 3K77A 3VDCA 1SLAA 3E5XA 3MPPG 2XG3A 3KV5A 1DYOA 5ACA1 3TEWA 3FJSA 2QQVA 3LEKA 5GZFA 1HDKA 2Q5TA 5CA6A 3LEGA 2WNVA 4KWLA 4BQ1A 4BYYA 5IK4A 3KHCA 4YSFA 2D6KA 4IXLA 1SCSA 4Z2WA 4V2VA 2YG0A 1QY4A 3CNAA 4YZ5A 1D2QA 1DQ2A 1QJU2 2VUCA 5IK5A 3CJIB 4DZGA 4H3WA 4LUMA 5K7PA 3RZHA 3GJBA 1UY2A 2AH2A 3HBZA 3HQUA 5JOYA 4OHYA 1OA4A 2Q1MA 3ORJA 3FC0A 4LO7A 1PGW2 3SEEA 5JPMB 3R6SA 1W8HA 1R092 1ZRRA 4AHXA 4LOTA 2VVEA 2WRAA 4QDQA 2E6VA 3KV9A 1W8WA 3WG3A 3JUUA 2X5IB 5IAVA 4PIXA 1UY3A 4ISQA 1H4GA 1X7NA 2JDZA 3X29B 4CDWB 4QX2A 3WUCA 1SMVA 1BK1A 1RVF3 2UY8A 3WCSA 5L9BA 4I30A 1SBFA 1FOD2 2W94A 1VBC3 2YU1A 3EJKA 5D21A 2DCJA 5DUWA 4BQ5A 5T54A 1QH6A 1W6OB 2D97A 2Y6FA 4I01A 4LKSA 2WWUA 4WVZA 1O6UA 1UOFA 1UO9A 3P3PA 3RI9A 4AVAA 4AW7A 5JXJA 4GJZA 4DIQA 2A75A 3OF1A 1Z7S3 1H1MA 3K48A 4O7XA 2VU9A 1JUHA 3AMPA 4QQHA 5DQ0A 1I9RA 4HT1T 3HMYA 2GMMA 4MYEA 4W4ZA 1MEC1 3VHNA 3TEZA 2C6SA 4ATFA 4XMAA 1BEV1 4IE6A 5FUIA 5AC91 1H4HA 1ZZ8A 2ZGRA 4LBQB 3ZDVA 2XVLA 3HEIA 3ZFEA 2GC3A 5C3OA 4CCKA 4XFGA 2JDNA 5DAWA 1UY1A 1Y7BA 4Y5Z0 1MVEA 1ACCA 5IVJA 1OQDA 3M3EA 5FZ1A 3VBOA 3W21A 4M0HA 1KS4A 3I2OA 1LHWA 2RMU2 1KITA 3RZMA 4AFMA 1DZTA 1YIFA 1BMV1 3WZ1A 3D82A 3UESA 4QGLA 5F2SA 1HXS2 5C3QA 4PIZA 4FVVA 1DIWA 3N35A 1LGBA 5J98B 4NAOA 1DGWA 1D0GA 1V6IA 5D1IA 1OH3A 1C1FA 2W1QA 4PT6A 3H8UA 4CDXB 4NHKA 5FP4A 1S55A 2K9ZA 4IE4A 1QJZA 4UBHA 3HNMA 2VCCA 3C8XA 4XCBA 1IG0A 3WP3A 3OD0A 4M01A 4JKMA 1OH4A 4GMP1 2YYOA 1OVSA 2HEVF 1LOBA 1W39A 4IL7A 1C4RA 4K1ZA 1K45A 4GIQA 1TEIA 4S2DA 1OLMA 3DPRA 2RS33 1JZ3A 2VZOA 4JHZA 2GMPA 3HVDA 3MUY1 2W92A 4FOYA 3OYWA 3SH5A 4JGYB 5LY2A 1TQ5A 3UGHA 2A5ZA 3VKFC 1U5IA 3JBG1 4K3UA 2QQLA 1W28A 5FZOB 2VQTA 3ZFGA 2V09A 4AAPA 4Y3OA 4COVA 4LEJA 4Y5TA 3KCYA 2ET1A 4W50A 2PHDA 1NYWA 1BBT3 1XSQA 2RJ2A 2J1EA 3E5QA 4R52A 3VN4A 2WT0A 3NQHA 1ULFA 4JGZB 4QPGC 2G19A 2BGCA 1W2UA 1O4TA 5FYIA 1YLLA 5FUPA 1HB4A 2BDRA 4KWUA 3J4UH 2Z69A 5B4XA 2KD7A 3AX4A 3INAA 5DZFA 1ENXA 2P5BA 5FPAA 5GZEA 1UZWA 1WLWA 2A3WA 3LCPA 5C4WB 1L7RA 4XEZA 1D0HA 1V6NA 1VBE2 2WYFA 3JQXA 1UZYA 2WFF1 3EO6A 4GB33 2JIJA 2Q8DA 4GH4C 2HWB2 4RQPA 3ZLIA 4WM7A 5I8TA 3P3NA 2YFUA 3SISA 4CDQC 4QB1A 4YW4A 4Y4YA 2OZ6A 1G6NA 4FPJA 1QQP3 4NPRA 1XNBA 5ANQA 3T2OA 3O12A 4C1XA 2Z2SB 1BBT1 3LDBA 4IDZA 5F5IA 1JOBA 3WOGA 4CP2A 3HIFA 2EIBA 3FBYA 1DYPA 4PCRA 3HWJA 3U4XA 2CGPA 1JW6A 2RS53 4LQRA 4NHYA 3PURA 5EP9A 4COYA 1JODA 2WLQA 4BM8A 2Q0AA 3JQWA 3DYOA 4GAZA 1VRH3 2RE9A 3PIJA 1JOPA 4BMEA 4Q4V2 1U12A 1WUVA 2JG8C 4BWOA 4CCJA 4N53C 1IQDC 5ABJC 2ZHNA 3GZEA 3AZVA 3B3QE 2ZX0A 1TME3 1C28A 3ZN6B 1IQAA 3TNQA 3TN93 1JXNA 3WQBA 3CJIA 2XGXA 2ZGKA 5C3PA 2OA2A 4DNYA 2OS2A 4XF1A 3LEIA 1X36A 5JVVA 2W9XA 2GNBA 3CEWA 2VTXA 2RS51 3H3ZA 4EN8B 2EXJA 2D7FA 1OFNA 1SQ4A 2HBTA 4JAAA 3BU0A 2HWF3 2VCBA 2X5IA 1JN2P 1PGL1 1G86A 1GZWB 1ULEA 1VBA2 2JDKA 4CDWA 2WQ8A 2X53S 4CSWA 2DUQA 1QJX3 5F9TA 5FO7B 5FK8A 4LT5A 1NX9A 4QX8A 5C8WA 1UOJA 3T1MA 4C1WA 1VBB1 2BTVC 1QJY3 1UYPA 1XU1A 2F4PA 2ZMNA 4N43B 4P9WA 5D8AC 5FZMA 1FMD2 1LOFA 1POV3 1W6OA 4ATEA 4EYUA 2BPA2 5KWRA 1H9PA 2PLV2 3D4KA 4DS0A 1JYVA 2UWCA 2Y33A 4WVWA 1KFXL 4G3YC 4OQ8A 1LECA 5E16A 4OI0A 1ZRDA 2ZX3A 4HXCA 3WW2A 1VB2A 2WJSA 3QBQA 4BLJA 4B4PA 3FFZA 3K46A 3OD4A 4A7YA 1JYTA 2XUMA 1YQ8A 3Q8CA 5JCTA 3NAPC 3VBHC 4ZU5A 3JD73 4LBQA 3WT3A 4X6QB 4JDMA 1QJX1 4WV8A 2ZAAA 3MIBA 3VV1A 1OOPC 1PO22 1VAKA 5KHGA 2HWC1 3WDUA 1FPN3 1RUI2 3GF6A 4KNCA 4NOTA 4XDOA 3WQ7A 1POV1 3OGRA 1RHI3 2A6VA 4W6YA 1KDKA 3R4SA 1W9SA 4D6SA 1M06G 5FPUA 4HVQA 4XZUG 3ZSJA 3GBFA 4XPVA 5JUVA 3I54A 2D5HA 4EQVA 5C6CA 1Q8VA 1REEA 4YGCA 4D0QA 4CDXA 1UPSA 1WA4A 1LOEA 1Y4WA 2YZ4A 1GMMA 5E8AA 4DXSA 5EV7A 2VBBA 5C70A 4WM8C 3AYCA 4XQWA 3AZZA 1PIV1 5F3GA 4UW6A 4K9SA 1W90A 1MS5A 2JDHA 3SCHA 4L11A 1S0IA 2PAEA 3NJXA 1RIRA 1COV3 1R082 1RTVA 1DF0A 1ALYA 3SEPA 1LEMA 4JGYA 4RYDA 1UF2C 2RDNA 4OHZA 5A33A 4MGSA 5DAVA 1Y9MA 5C8CC 3S57A 3ZR5A 5I8SA 4RFT0 4UFIA 5FZOA 1J84A 5JIAA 1W05A 2VQ0A 4IEUA 4XIKA 2XB6C 2ZMKA 2JDAA 4Y26A 3U07A 1SBDA 1REFA 3ZXDA 4Y5SA 1AYM1 4LITA 4JGZA 2DVGA 4X6RB 5M0TA 2WA4A 3O1PA 4QX0A 3I2HA 1PZ8A 3T4VA 4LUKA 2WR9A 3ITQA 1URXA 2WUHA 3T0BA 5BNPB 3AVRA 2ARAA 4P14A 2A3YA 5SV8A 5C4WA 4IE7A 1IOAA 3IBMA 4NPLA 5GLZA 5JXIA 4TZDA 5BPXA 3RZZA 5HBAA 4XTPA 4QXCA 1W9YA 2W95A 3RYPA 3ACGA 4TLGA 3ZKUA 3ZYHA 2R042 4QPIB 1AX0A 3TEXA 3WW4A 5T5LA 2IWGB 4Y1ZA 4Y22A 1VBD1 1JZ2A 2ENRA 3DUIA 4CCCA 4WZFA 4XTMA 4IV3C 3N7KA 3JB8A 2V5YA 4ZONA 5FFOC 5FLIA 4FOWA 4Q0VA 2A7AA 1CZVA 3BB6A 4CZSA 3CZUA 3ACIA 1GANA 1ZA7A 1UX6A 4RHV3 4LXLA 2RS12 4M3CE 3JU9A 4Z82A 2HWE1 2WL1A 3AC0A 4EROA 1CX1A 4D6QA 1WCDJ 5HXMA 3ZN6A 3UJQA 2CYFA 2B46X 3E97A 3LIHA 4NRQA 1BEV2 2FMYA 2WZR2 3I2FA 3PLQA 2ZHMA 4FOQA 3ZX7A 4LBOA 2VW0A 4L8QA 3HAGA 4NAMA 1V70A 2G4IA 4A7ZA 1XNKA 1D4VB 1UXZA 4LKEA 5LATA 1JZ8A 4META 3C7FA 1C57A 1H2KA 1Q8PA 1RC6A 1RMU1 2VZUA 1JU3A 4EJRA 3BTZA 1GZWA 3TNPB 4FTSA 4FFIA 3HQXA 1SBEA 4IEYA 2ORXA 4Y24A 2B9VA 1C3HA 2AZ5A 4QPYA 2QUOA 4E2GA 2VC9A 1PHMA 2LW8A 3PUHA 4N43A 4N9IA 3NRUA 3DN7A 1CAVB 4BPZA 2XBO3 2XQRA 1O3RA 3LSEA 1TZOA 4LIUA 3UKVA 3WW1A 3U78A 1UIKA 1FNYA 2Y0OA 4YVWC 1RUG2 1LESA 1YHFA 5T5JA 4N9HA 2P6HA 3GBWA 2WNVC 3N7LA 3HD8B 4DEQA 5A6QA 4BQ4A 3AKTA 4ZXEA 1GR3A 3NSTA 3Q9OA 3POIA 4P08A 1VLNA 2N7GA 5A3PA 1CAXB 2PHXA 1NA1B 4MGKE 1O7FA 2PAKA 2ARBA 2VOKA 2VL4A 2DTWA 3GBGA 4FXGB 4BK5A 2ZPXA 2E63A 4HETA 2DU1A 1U0AA 2DCTA 3JBG2 3ILNA 2OPKA 3LPFA 3SXWA 3M3OA 2ZABA 4U36A 3CF6E 1HN0A 3VD7A 4EWEA 1NY72 2BWCA 2BW8A 5L73A 1REDA 3NV3A 5ERLA 2YY1A 3SH3A 1H6YA 5JXGA 3F2ZA 4BH9A 2V4VA 1HB1A 2J1TA 4GWJA 1NQJA 4XFBA 4ZHNA 1R093 3ENRA 2VZSA 3DECA 1HX6A 1ODNA 3R4UA 4ARXA 1B35C 1IS6A 4ZXKA 1N1TA 1HLCA 3HJRA 1X8MA 3BN6A 2DV9A 2WSUA 2CGNA 1H30A 4LKDA 1FOD3 2XVGA 5FYUA 2CY6A 3KQRA 1UD1A 3N9PA 4D6RA 2W0XA 5FY8A 5IW0A 1EV12 5FYZA 5LW9A 5I0TA 2DVBA 1K5MB 3H42B 2B8MA 2NPIA 4JKLA 1OBNA 4GD4A 3MDPA 4Q4W2 5FPZA 1A34A 3VBOC 3KZ4C 4EZHA 1AVBA 2QQNA 5KXDA 1W04A 1ZBA1 2A70A 1EY2A 4M0NA 2GC2A 4XFHA 5CKQA 4UT5A 1QOOA 1FAYA 3KGLA 4DXTA 4C90A 3HNYM 1BJQA 1XE7A 1AR72 1QF3A 1UNBA 1S0DA 3WNXA 5BNPA 1S0EA 1YXWA 2DFBA 1SZBA 2OVUA 2PQSA 4TLFA 5DAXA 4OUEA 5APAA 4MGIE 2RMU3 4LHKA 3C7OA 4UFJA 1ND3C 2VMCA 4MVTA 3KM5A 4C0HA 3J9SA 3N9NA 1GLHA 4L9BA 2WZ8A 5T3NA 1HXS3 3K3OA 2Q8CA 1Q8SA 3AMHA 3WV6A 1PGL2 1E5HA 4QPIA 2DF7A 2I45A 3VDDB 2LROA 2W1UA 1KXGA 1G9FA 1X82A 3BPZA 3AP4A 3OBZA 1PK6B 4NIHA 4MGQA 3ASIA 5C5UA 3W20A 3S7IA 1WMDA 1MVQA 2P3JA 4BLIA 3N9OA 3SCGA 3V0BB 2VVFA 3GNEA 1VAMA 2FCTA 1CJPA 3FX3A 1I1EA 5BUVA 4E4SA 3WHUA 5IK7A 5A80A 5KHJA 3I2KA 1RJ8A 1WWYA 4QX5A 5F5AA 4A41A 4CEWB 3P5BA 1GP5A 3NNFA 5FZKA 3WQ1A 4PQQA 4AE2A 2XR4A 1AYN1 1MZFA 2K46A 3G7DA 3OOXA 5JOWA 1KRIA 3NV4A 5LEJA 1CJDA 1ULGA 3ILFA 4CCOA 4FT8A 5EWSA 5F2WA 2OXBA 3VL8A 3NNMA 4NMIA 3MLLA 4M00A 4RQPC 1RUOA 3PUSA 5FMOL 4WM7C 4D3WA 2H0BA 1W2NA 2YHJA 1LRHA 3CO2A 1VALA 2ZX2A 1OFSA 1RUJ2 4R9CA 4I02A 3T2PA 3AKPA 1W6NB 1HB3A 4UW3A 1YYNA 2QQKA 4CP1A 2YXSA 1NCRC 5FXXA 3P6BA 4QQ2A 1CAVA 4AF9A 4DUXA 5I0DA 1LHOA 5KBFA 2HWB3 5LBEA 3UYJA 2GMEA 1JUIA 5FZ0A 5A6XA 2OT7A 2WT1A 3ECQA 4QMAA 4FAHA 1SACA 1WKYA 5A3UA 5FZGA 1ST8A 4Q4X1 5ANNA 1WCUA 3G6JB 4RS5C 1WMXA 5JZGC 1ZBE2 4G9SB 1F8VA 1YJLA 3OSDA 2KR2A 4LOSA 2G9ZA 1CAXA 1LAJA 2JB4A 3CJIC 2C9AA 2VOWA 4NWVA 4GMP0 5EJ1B 3WXPA 5JSRA 2YPJA 1T6BX 3H7YA 3VKLA 3U11A 3BOPA 2ZEYA 2WN3A 1JYIA 2V73A 1JHNA 3H1MA 1DHKB 1OURA 3RYKA 5FCCA 4KH9A 4XF4A 2AEYA 1H1IA 2RM21 4AZZA 5CVRA 4E8DA 1V6LA 4OQ9A 4CDWC 4CXWA 4SLIA 1TMF3 5FIXA 1V6MA 2XLGA 2P3KA 3VBFB 5LCWL 1LNSA 1UW8A 5DUVA 4XXPA 2PHFA 1PVC3 2XJVA 3ZFEB 1QXJA 2XJUA 3M1HA 1OLRA 1GOGA 2OQ6A 1W03A 3OPWA 3SKVA 4CYDA 5LK7B 1TG7A 1G9DA 3PUAA 1S2EA 1QJEA 2CNAA 2GAUA 3RI8A 1PMJX 4JVAA 4J6GA 3ZO0B 2JG9A 2R072 3I3MA 1ZA4A 4Z07A 3TWIA 1VJ2A 1NKGA 1UKRA 1YQ2A 2QBXA 3J8F2 3L9JT 4ONUA 3M4FA 1PO12 1CIYA 4YGDA 1AR92 1XRUA 2A6XA 4YPJA 4BQ2A 4AEMA 3WUDA 1Q43A 3VD9A 2PLV3 1K5MA 4ZKTB 4XW3A 1UOBA 2F17A 4QT6A 1SDWA 4FI9A 4Q0UA 3VZMA 3H8RA 3OPTA 1ENQA 4Q0QA 5K0UC 5KR7A 2YROA 4QU1A 4AG4A 4CU9A 1OSGA 4S2HA 1IKPA 3B94A 5CISA 2CAVA 1ZZ9A 3LA7A 4IEWA 4B3NA 3DPRB 4NPMA 3OPZA 3WY6A 1RUC2 1UOGA 5LASA 1WBLA 1U5YA 1W0NA 3UJOA 1G9CA 2IFWA 3QACA 2ZAHA 4PBOA 2EIDA 1IPKA 1RUI3 5DPNA 1EAH3 2J42A 3M70A 4YVSC 4RGAA 1OD3A 3CU7A 5FY5A 4EE2A 1XJAA 4DUVA 5JLVA 4HKWA 4PDWA 2LM3A 3MICA 1HRV2 2ARCA 4J1XA 4LE4A 1N3QA 3UGGA 4AHWA 4UFKA 5HCBA 1OVPA 4CUAA 1XOYA 1SEFA 4XDPA 5AVPA 2PYTA 3I3EA 3VDDA 1SFYA 2W52A 2E26A 4UFHA 4JGYC 2ET7A 1PK6A 2P1BA 1DQ6A 2NM1A 2R061 4XQ4A 3ZYRA 5GLUA 3UK9A 3SKJE 1E5IA 1ZRCA 3VL9A 5JOZA 5FYYA 1DLCA 4ASLA 1XYNA 2JKBA 5FYMA 1DG6A 5IFTA 5J1XA 1EAH1 1XE8A 4IV1A 3BIWE 3T4HB 1CPNA 2QZ2A 1R083 3PU8A 3V56A 4LA3A 4JGZC 4D94A 3POGA 1H2NA 4CEWA 4Z8BA 4FQ4A 1RGSA 2J1RA 3SC7X 4P5HA 3L2HA 1OKOA 2CAUA 3O14A 4AI9A 2O0OA 4H14A 2QJVA 5JPNB 2YB7A 3KQ4B 3ZSEA 3AK0A 1ZZCA 4CE8A 5BYNA 3S5AA 3C7HA 5IUQA 3AP5A 4Q4Y2 2D6PA 3SCFA 4TSVA 1V9U2 2P4EA 2TBVA 3ME2A 4AOCA 3D6EA 2FCUA 4HL0A 3W9AA 2ZOEB 4ET7A 3POJA 1OT5A 3HT2A 4XFCA 3JXSA 4FFFA 1PNFA 1AF9A 5A1FA 1W6NA 1AR61 4LBKA 5GLVA 2EALA 3HPNA 1POV0 1XSRA 1SFNA 2WZEA 4COUA 2XONA 4K7JA 3BIEA 2DFCA 1BQPA 5T5OA 2Q8OA 3TBDA 4ASKA 4AEDC 5CAZA 1YFXA 5JMOA 4A7KA 4TXWA 2XOMA 2ADDA 4Q27A 1J3QA 2R043 4O9EA 4EN7B 3MIGA 2VD7A 5FBJA 2FDGA 4DXZA 3MW4A 4RR3B 3AM2A 1EPWA 2QQMA 5FZ4A 1AUYA 2QFEA 1ZM1A 3LQCA 3IIIA 2BQPA 3ETPA 1CN1A 2A73B 2UWBA 4LBLA 1S0CA 3WNKA 1CZSA 3EHKA 3H1YA 4U2AA 3PUIA 4I0BA 3POWA 1YIPA 5IVYA 1AL0G 1H8TB 3ZFFB 5FZ7A 2ZGOA 5IVCA 1MS9A 2ID4A 1YJKA 4XFIA 2DURA 3IN9A 1DGWX 1FXZA 2BU9A 2RR12 2LTNA 4CDUB 1AZDA 4R9BA 2MEV2 4FPHA 4TN7A 5DAPA 4ZU4A 3ZYIB 4IETA 4BCUA 1JYXA 2WZR3 2Y6JA 3WDWA 1XNDA 5GLTA 1UU4A 1AJKA 5EYXA 3VBFA 4AGGA 2PFWA 1RVF1 3RWNA 2QNKA 1D7PM 4HG6B 5F3CA 4N43C 1VBC1 1DU3D 2R32A 5CFDB 2ZEXA 3KT4A 2VE1A 4XOGA 2C26A 5H9PA 2VXJA 3T0AA 5L7OC 2I74A 1PVXA 1UKGA 3I7DA 1ZRFA 3Q8BA 5FRAA 3DEMA 2R30A 4AVVA 4DO0A 1CR7A 4GJYA 1R1A2 1Z7S1 3CQOA 4LA2A 1RUE2 1RUH2 4A6SA 2OW4A 1X9PA 3QLQA 5FK7A 3LDRA 5CZKA 4X8PA 5J3UA 1Q5OA 4XJ9A 3H8OA 1PM4A 1WBFA 1IS3A 1NG0A 4MADA 3S30A 2VTXJ 2QDRA 2D6OX 5FMDA 4CRQA 1SLBA 2JB8A 3BGAA 2WS93 4BIOA 5FJHA 4BA6A 1RITA 2BWAA 3ABZA 1ND2B 1IS5A 2JE7A 2VBDA 1IGOA 4LPLA 1SHWB 5HXVA 3EMRA 2ZGPA 5EHDA 5A33B 4W6WA 2YPDA 4O61A 2IXHA 3RG0A 2NMOA 2GU9A 1AHSA 5CKMA 4AVSA 1UZ0A 2YGMA 4BQYA 3GHMA 1ASJ2 3V65A 1UU6A 5AFBA 4RD7A 3IZOA 3NNGA 4QKBA 3GZAA 2WS91 3AYEA 4JRAA 4LNVA 1O3QA 4L92A 5FP8A 3CHXA 3WNLA 3RMYA 2RS31 3VBUC 4DMIA 3OB8A 5A1LA 4MGTA 2F4LA 4OULA 3UKTA 2GNDA 1HIXA 3LFMA 2NZ9A 4A45A 5DDJ3 4OHVA 4NRPA 4FPKA 1F9KA 4LLOA 3W58A 4TTGA 3MHZA 5KXBA 2RHPA 2NQYA 2WBKA 4CEYC 5C7GA 4ZZ8A 4FFGA 3W5NA 3ILRA 4IESA 1N3OA 1EV13 2VOVA 2GNTA 4XF9A 4Y22B 5BNNB 1DDLA 2BBVA 3AXEA 3OBRA 3NKGA 4IUGA 5FZCA 4XYXA 1YNAA 3A0KA 2UY9A 5IVFA 1RUD3 4Q4W3 2O14A 2FDIA 2OQ7A 5AVAA 4ZS2A 1QOTA 4XVHA 5FKCA 1DFQA 3IB3A 5GJ6A 3AYAA 3O1MA 3IPVB 3ZXEA 4QM9A 4Q0PA 4YNIA 4WBBA 1HW5A 1LU1A 4P02B 5DDJ1 1G8WA 3HT1A 1V6KA 4GB31 2EXHA 5F32A 3ACHA 4HMZA 2I07B 1AR73 1O59A 5FLJA 3VBSC 1QHDA 3DL3A 3LZZA 4QX1A 3AXDA 3I4IA 4OZOA 5T52A 1QQP1 3L2YA 3OBTA 2AACA 4LULA 4RA0A 4KGGA 2NYYA 3WP4A 4COZA 4ORFA 3LIGA 4PJYA 5FZEA 4HSJA 1F15A 1C8M2 4E4HA 2W46A 3MI8A 1VR3A 5JR2A 2JDUA 5EXOA 2DBNA 1VRH1 5F6KA 4EV0A 4MSVA 4KWKA 5FZAA 2GC0A 2YGLA 1NXD1 4BQ3A 4I2OA 1W2OA 4G4FA 2C0ZA 4RR3A 4W6XA 4AFCA 1HN1A 1ONAA 1POQA 3H3LA 4HN0A 2BNMA 3TRSB 3N9MA 1TME1 4CP9B 5FZ8A 4PLNA 4YRDA 2BERA 3TN91 2AC1A 1HRI2 1LU2A 1P8JA 1H8TA 2D43A 3ZFFA 3AKRA 4YW2A 2FDKA 3QCWA 4K8RB 3WF4A 2P37A 2BJSA 2X09A 1AR82 2IVIB 1QWRA 2A6WA 4HN1A 3ZPOA 3LFIA 4CDUA 2DYCA 1C5HA 4NROA 3IDEA 5F3EA 2AUYA 4XETA 2PMWB 1D4M2 2HWF1 5T50A 4QQPA 4NIAA 4MO3M 3RMXA 1UL9A 3EBRA 4V1PA 5E6HA 4EZ4A 2HWD2 1BKZA 4FOVA 5DN2A 4OVEA 2GNMA 3N3HA 5G04L 4QGNA 1DQ5A 4Z92B 3PMEA 1QJY1 2BEOA 3AP6A 4Q26A 5CFDA 4RSUA 3MF9A 2PXJA 5FP9A 2VZ1A 4E4ZA 2JICA 4JHTA 1AL22 4KG8A 2MNGA 3BALA 4N7IA 4YLZA 3BTAA 2QVSB 2Y34A 5IFPA 4R4ZA 4IGPA 1W6QB 2UURA 3ATGA 1NQDA 4R9AA 1SCRA 1GOHA 3WX5A 3ZXGA 3ZYPA 1N1VA 2H6CA 1NA1C 1WGPA 3MIHA 5IT6A 5JOXA 3JD71 5TSWA 5C9AC 2W1WA 2ZTNA 2VXRA 4HKLA 1FPN1 2HEYF 1V6JA 5J36A 1IPSA 4YG3A 3TOJA 1RHI1 4DQAA 1QEXA 5D2AA 1ZVFA 3LOIA 3KLSA 1ND2A 4L97A 3ZPYA 5FDBA 4FPCA 4LK6A 1KGYA 1ZYBA 3RNSA 3THCA 2WAOA 1RUF2 4YFZA 4ZZ5A 2GALA 1YRZA 1FT9A 4IEVA 5FPVA 1C5IA 1NCQC 1SLCA 3O1RA 1OHFA 5ACA2 5JAXA 2P6CA 5FUNA 1L3JA 2D40A 3OUJA 3OUHA 3DXUA 4UWDA 3IMNA 4FFHA 3FLRA 2YC0A 4BXSV 3OGGA 4QPGB 4A6OA 3LD8A 1UZVA 3N4MA 4QXKA 4JV4A 4YZ3A 4M4RA 5FWJA 1COV1 2YC2A 1W2TA 3GCXA 1GWLA 3KS7A 4CUBA 3LA2A 4XBNA 1K5MC 3IAQA 4L99A 4CPBD 4AHYA 4YW6A 1W8OA 3NW4A 2PHRA 1Q3EA 5LZ6A 3WSOA 3LEMA 1YQCA 4LO8A 2BGPA 2BOJA
chains in the Genus database with same CATH topology
4K20A 2ZS6B 3J8F3 5FMOS 1PO13 2VW2A 4YGEA 2R0FA 1AR93 3ELNA 2TNFA 4AEJA 5BNNA 4COWA 4AQTA 1VP6A 2WNUC 4FPFA 3VKOA 1AXYA 5I0SA 1OLQA 4AI3A 3B00A 4TWTA 3IPVA 1WCKA 4BMBA 4B29A 1QNYA 1I6XA 4AHZA 1W6MB 3VBRB 1O5UA 1RUC3 5ABJB 3TB0A 1MEC2 4BZ4A 5A32B 4W65A 1QDCA 5KC6A 5J37A 2OUJA 1CONA 5AC92 1APNA 3OCPA 2GZWA 2AREA 1OA2A 3PHMA 1VB4A 4JTNA 3NV2A 2ZACA 3I2DA 5E89A 2D3SA 4Q29A 5JSPA 4PIYA 1BMV2 2XKOA 2WQZC 5CFCC 2ZMLA 4RHV1 3D8CA 2PELA 4M3CB 2PAMA 4N90A 2ZA9A 5D8AB 3TAYA 4GKYA 1W0OA 1KS5A 3OJBA 4XILA 1W0PA 3FUOA 2NP0A 2XPJA 2B9UA 3SNMA 1LJ7A 1S0FA 1CX4A 1J59A 5J7MA 3WVJA 3ZXLA 3WINE 2WQ4A 2QE3A 4MV2A 1O91A 3NAPB 3VBHB 4HLTA 1Z78A 1LGCA 4AFDA 3ALQA 1MR5A 1O3SA 2YUEA 4E4DX 5EYYA 3FHIB 4LLFA 3WDXA 1V9U3 4IEQA 2NMNA 2HJIA 3ES1A 1Y3TA 2XBO1 3LGRA 3ZSMA 1QJU3 1JYCA 4A3XA 3IM0A 1W6QA 1C1LA 2EVXA 5CB7A 4GWMA 3POYA 4BHPA 2ES3A 3WR0A 1KD7A 2XJQA 4S2FA 5GKAC 1GNHA 3IDBB 1HQLA 2O1QA 1MS1A 5CBLA 2XWJB 2WFF2 2JG9B 1J3PA 2E53A 2HYKA 1BCXA 1NZCA 3LA3A 1DZRA 3N7MA 4YW3A 4DOUA 2AR6A 1NOVA 4IERA 1GBGA 2IXIA 2P34A 1BBT2 1J3RA 1QJU1 5JR7B 2NN8A 5GZGA 1LHVA 2R49A 4DY5A 1KFUL 3SITA 4OI4A 3ZFEC 2XVKA 4P9IA 2UYAA 1PGW1 5BNQA 3B02A 1MQTB 1OQEA 1R091 2RJLA 3VUOA 2MEV3 4MXWB 3WD5A 1FI2A 2VG9A 4I3PA 3B9CA 4B8EA 2D5FA 4QPGA 1HQNA 4FP2A 1FX5A 4NWWA 1LULA 1FOD1 1QMJA 5DZEA 2A6YA 2VPVA 5JI7A 3NV1A 4D7YA 2RS52 3BU7A 1UN1A 3K51A 4AQ6A 4PDWB 3VHRA 3ZIWA 1CAUB 1RUH3 3V0AB 5EJ3A 5FAXA 1B09A 4J1WA 2DVFA 2BVVA 3T2TA 2XL7A 2PQQA 5H9RA 3DPRC 4KWJA 4FXKB 4IV3B 4E27A 2Q1ZB 1VBB2 3SHRA 1RINA 1Q56A 2BYVE 4E2SA 3AKQA 4FBFA 5DXDA 3ZFGC 5CG9A 3KT1A 4IV1B 3AKSA 3DKWA 2RMU1 2DVAA 2FZ2A 1W6MA 3VBRA 5ABJA 3SMHA 2K0GA 3NJZA 5L36A 1HXS1 2Z42A 3ZXJA 5A32A 4I3GA 2PA7A 3H3UA 4INDA 1QJX2 2R6QA 2HWC2 3NL1A 3ZIXA 1ASJ3 3FFQA 3ZN5A 1X8EA 5L19A 4DRRA 1CAWB 1TNRA 4XHBA 1AXZA 4FQZA 4AYUA 4AVCA 1XYPA 2GN7A 4NR1A 1WD3A 1OD5A 4GWNA 1RUNA 1LR5A 4M3CA 5KXCA 5J09A 1S0GA 4NHMA 1H8VA 1VBE3 2E7TA 5D8AA 2VW1A 1C8NA 2R1DA 1BVVA 1MZEA 1RB8G 3WP5A 4HKOA 2C1FA 2B5HA 5T55A 4YVWB 4FPGA 2Z5WA 4KU7A 1PIV2 1G9BA 3C3VA 1CVNA 2ZX4A 4K40A 4AK3A 1MZ6A 2JXAA 4XFFA 1MACA 1N47A 3NAPA 4PLMA 3MYXA 4JTOA 3VBHA 4URTA 3VZLA 1BXHA 1OKQA 4Q4V3 3WP6A 1BVP1 2B42B 2CWSA 2ETEA 4WZCA 1HQWA 2IC1A 4LO4B 2A6ZA 1LODA 4XHXA 2HWB1 1HV1A 4AQ2A 1AYM2 1UU5A 1YI9A 2X5IC 4PF5A 1DQ1A 3B5LB 3AFKA 3ZN4A 2QZ3A 4FCAA 1QXPA 4LE3A 4RR3C 2XJPA 3PTYA 1H0BA 2WIIB 2KM2A 1LOFC 3RS6A 2VUJA 1H8TC 4R8HA 1B35B 3ZFFC 3R4DB 1VBA3 5K8SA 2XH6A 3D5OA 2MHFA 4WM8A 1GYKA 2IXCA 1TNFA 3MLJA 4KBBA 4CDUC 1CD3G 1FV3A 1M4WA 3ZXAC 2ZKNA 2JEMA 1VBD2 1FMD3 3RJRA 1HRI3 4FPLA 3W59A 1TMF1 2EA7A 3EXUA 1XU2A 3PVOA 5CIRA 4QU2A 5LK5A 5FPXA 1AR83 1MQTA 1PVC1 5GALA 4YM0A 2R1BA 2ZZJA 1D4M3 4MXWA 4UW5A 3ETQA 5CG8A 1VBA1 2D44A 2IZWA 3JZVA 2VH9A 2HWE2 2VNGA 2WINB 5KHIA 2HWD3 4CTEA 4LR4A 2OIIA 3WG4A 1PO23 4H55A 4XJUA 4Q8KA 4YZ1A 2TEPA 3ZMOA 4CDXC 4Q1RA 1AL23 2PLV1 5F1RA 2PHUA 1UAIA 1ND3B 3E6DA 3OY8B 1CAUA 1OA3A 3V0AA 1RMU2 5GM0A 3FE5A 4XBLA 1X33A 1CQ9A 4LO6B 1Q8QA 1U5ZA 4IV3A 4DFSA 4LBQD 3AZWA 4QHBA 5F6LB 1RUI1 2EAAA 2EXKA 3N36A 4XJWA 1EYBA 4AVTA 1WW5A 2H0VA 1J1TA 4L2NA 3H0OA 1RUF3 2DVDA 2QCSB 5FO8B 4K1YA 1QOSA 1LHNA 1HKDA 1H1AA 1Y43B 2K2SA 3LSDA 3M7AA 4S2GA 4Y1UA 5C4WC 3B93A 3PNAA 3CJXA 4AI8A 1CAWA 4B7EA 2XBO2 4OFGA 2FZ1A 4HSLA 3H9AA 1CPMA 1A6CA 1DYKA 1R081 2VMGA 2ZCWA 4MGYE 4X8NA 5B2GB 5BNNC 1S0BA 2EXIA 2QKDA 4R4XA 4OHWA 1NCRB 2ZHKA 2XL9A 3NO8A 1NLSA 3AMMA 2LALA 3PVNA 4YVWA 2AENA 4FAGA 3POSA 3ZSKA 4DY3A 2UWAA 1N1YA 4XDQA 4XQDA 1PZ9A 4XZPA 1WMEA 4C91A 4LO5B 4RS5B 5JZGB 1I3HA 1WLDA 1LCLA 4YM3A 1YUDA 3ROUA 4MH0E 4BIFA 2QDNA 5BV6A 3BODA 3KT7A 2PHWA 4JRLA 2VGDA 4MX3A 2RS13 3AYDA 1Y9QA 2WLPA 4LBJA 5C33A 1MEC3 1ZBA2 2Y38A 4FPEA 1BEV3 2R041 1MS3A 4YYOA 1GFF2 4KL1A 5AC93 4QD2A 2D93A 2Q4SA 4JDNA 2BNNA 3CL1A 1B35A 3USSA 2RS11 3QH7A 1LOGA 4ASMB 1ZZBA 1WCSA 5EZWA 1MS0A 4UBGA 4HPKB 4YG0A 4YW1A 2WT2A 2WZR1 1N1SA 2VNRA 3O0WA 3WCRA 1FYUA 2X8KA 2VULA 1RL3A 4HK8A 5J98B 1RUG3 1T6GC 2R16A 4OI2A 1O4ZA 2YDEA 5K0UB 4GMP3 3VZOA 4EN6B 2FMDA 2LUWA 1UPIA 5FTTC 3ZMNA 3LOBA 4XJZA 2XLFA 2IXKA 1Z0HA 3NVCA 5GZCA 1S2BA 3JBG3 2BFUL 5DG2A 1TE1B 3WLUA 5LEKA 1AYN2 4YVSB 3PJQA 1NE6A 1U5XA 3QOPA 3ES4A 1DBNA 2GH2A 1WW4A 4PBPA 2VY0A 1ND3A 1RUG1 3OY8A 5FQ0B 2ZJCA 5JI9A 3MIDA 4JCKA 2D6LX 3RYRA 1MS8A 3T1LA 2BVBA 4HFSA 3NKTA 1MZ5A 1EPZA 1HV0A 5FBZA 2Z79A 2C5DA 3KB5A 3GZTB 4P9JA 2WWSA 3TYJA 1J1LA 5FREA 2WFF3 1G9AA 2VVDA 4Y20B 2WC2A 5GZDA 3IT8A 4RL7A 4XXAA 2ZGTA 5I8YA 1NY71 4Q4X2 5BNOB 3ZYJB 4AFBA 4Z1VA 4GXLA 4JDOA 3EQEA 2H6BA 4Q0SA 5BNPC 4GA9A 1GZ9A 3WG2A 2ARXA 1O5LA 2E7AA 3ZDSA 4JC1A 1UIJA 1SLTA 1F5JA 4KU8A 4K6BA 1IS4A 2RM22 4QPIC 5A3MA 1YFUA 2VUAA 3FLPA 1EV11 2DTYA 2E51A 4QQOA 1NCRA 3MGUA 3A0NA 1JTZX 4F83A 1RUD1 1WW7A 4Q4W1 4AEDB 5JWPA 1WLTA 2FQPA 4YG6A 3UKNA 4OLLA 2AYHA 2B39A 3VBRC 3RSJA 4RS5A 5HI0A 5JZGA 3IIAA 1VBB3 1LHUA 1CESA 1AR71 4XIOA 1TMF2 3WDYA 3BCWA 4YGBA 4TYSA 3HR9A 3VKMA 3M8LA 1PVC2 2MPFA 3JCIA 4KG0A 1FNZA 2A71A 4I0AA 2XLAA 5FOBB 3WDTA 4D7SA 2CTVA 4NO4A 4AXOA 3MFCA 3GHNA 4WVMB 1YFWA 4OI1A 2HEWF 2PHTA 2RJKA 4GQ7A 1BZWA 2HWC3 4FO9A 1DQ0A 4YFWA 4ITCA 3WG1A 5CU1A 4F7ZA 2R0HA 5L7OB 4FPOB 3SH4A 3KMHA 1F2NA 4YW5A 3O0VA 1RUJ3 2WSVA 1O3TA 4C0BA 2ZBJA 1Q8OA 3OGJA 4P9YA 1WMFA 2E7QA 2JJ6A 4HPKA 4XJAA 3AP7A 3VZJA 3R05A 3B01A 5DUXA 4P9LA 4B7KA 2ZZQA 2DCYA 5E1RA 3USUB 1DGRA 2PN5A 4R9DA 2R062 2Y26A 3KGZA 2ERFA 2ZHLA 1LGNA 5K0UA 1PIV3 3APBA 1EAH2 1ZBE3 3AB0A 3WHTA 1GV9A 3ZXKA 1QKQA 4AVBA 4GALA 1RUJ1 3M3CA 2DU0A 1UMZA 2GSYA 3E6BA 4E2QA 2QQPA 4XBQA 4YVSA 2P17A 3U10A 1AYM3 5FOJB 2IFRA 3R0RA 2VMHA 2CGOA 2ZGMA 1S2KA 2JG9C 3RDIA 1PNGA 4NVPA 5FQ0A 3VHPA 3CLPA 3MIEA 4QM8A 1ZBE1 1KJRA 3U0ZA 1QU0A 4HANA 5IK8A 1AR62 4HVOA 3VBUB 1QNWA 1YFYA 4Q2FA 1VAVA 2R073 1VIWB 4H7MA 4Y20A 1OI6A 1DLLA 1GNZA 1MQTC 5H9SA 2JD4A 4GH4B 4D7TA 1AX2A 2XKPA 4LHLA 4AWDA 4CEYB 3THTA 4CDQB 2KXLA 1VBD3 5BNOA 1IPJA 1NE4A 5I93A 4AI0A 3NWKA 2G9GA 2ATFA 3AFGA 3M3QA 3C2UA 3OTFA 3H7JA 4MZUA 1NLRA 1IHMA 5DUUA 4DINB 1XXNA 3MFAA 2X29A 2JG8B 3KCCA 5F5QA 5J48A 2R071 4PDWC 3ZSLA 1LEDA 2HWE3 2WA3A 2DCZA 4N53B 1KQRA 3VBSB 1XQNA 3J8F1 2WZPP 1PO11 2F6BA 1W6PB 3VDDC 1AR91 4D69A 5HCFA 1JH5A 1PK6C 1S0JA 2OZJA 4XE9A 1RVF2 4E9KA 2CWMA 4EWDA 4GKXA 3D0JA 1VBC2 1LKNA 4AEDA 1HRV3 2ZKLA 1RMU3 1V00A 3QD6A 1X50A 4IV1C 4YZ2A 1OPMA 1DZQA 3E5UA 4ZU7A 3FLTA 5I0RA 1Z7S2 3VKNA 1RUC1 2JENA 1NXMA 3I8TA 4CEWC 1AJOA 2VECA 3MEPA 3LB9A 2EIGA 2FBEA 2XWBB 1UZZA 4WVVA 1HRV1 3WW3A 2G9FA 2TUNA 3WQ0A 4YARA 4BE3A 3PJYA 3LKJA 3ZYGA 4OHXA 3B7MA 4WVMA 5LRRA 2JE9A 3AZXA 4Y1YA 4ISRA 2VOXA 2D3RA 2E9QA 2IXJA 4KGQA 5DG1A 5T5PA 2CL2A 4K21A 1OOPB 1YO8A 2OYZA 2VMIA 4Q4Y3 1GKBA 2Q30A 2XHKA 3DGTA 5KHKA 5L7OA 1UCXA 4K8FA 2P2KA 2FHRA 1A8MA 1ULDA 2W68A 5BXXA 5JMCA 1YWKA 2VNOA 1YI7A 3MIFA 4LBMA 2WS92 3O5SA 5KXEA 1OQ1A 2RS32 2WFPA 3USUA 3MLKA 3B69A 3N7JA 2A3XA 5C9AB 4LTAA 5J96B 4WM8B 4Q4Y1 2JX9A 5AFEA 1V9U1 1QH7A 4XFAA 1OMIA 2D6NA 5CADA 1WW6A 2VQAA 1ZZ7A 4AI2A 2EF6A 2ZGQA 4AGVA 3VBFC 1GSLA 1LB2A 4XF0A 3UV9A 3GZUC 5C8CB 4NHLA 3AMNA 1DGRN 3VZKA 1ZREA 3O7OA 3H50A 2DUPA 1NCQB 2RR13 3M3IA 2UYBA 1ZBA3 4XMIA 1JBCA 5DDJ2 3KSCA 1PM7A 2UU8A 3LWCA 4GB32 4OUSA 4P9XA 1ZNPA 5GLWA 1PGSA 1QQP2 1SLLA 3VBUA 1A3KA 1CIWA 2IXLA 2ZGNA 1RUD2 4F3JA 1R1A3 1RJ7A 1ENRA 1RUE3 2ZGUA 4GH4A 1VRH2 2RR11 4CDQA 2NLRA 4CEYA 2ILMA 2MEV1 4OZXA 3ST7A 5FLHA 4AI1A 4EN9B 2ZGSA 5LRSA 2AGSA 3V64A 1PMIA 3MF6A 4IEXA 4LBNA 1IZ3A 1TME2 2WNUB 1OPOA 3IKWA 1G7YA 3TN92 1ZX5A 5HCAA 3RPQA 2JG8A 4SBVA 4AQSA 5BY5A 4N53A 2JECA 1R1A1 1J58A 1RUE1 1RUH1 4YZ4A 3VBSA 2B45X 3AZYA 2HWF2 4FTEA 3GYDA 1W6PA 4IEZA 3BOWA 1AYN3 2WKKA 4A2UA 4QQLA 4IQPA 1A8DA 5CNAA 1QJY2 3I59B 1DQ4A 1H2MA 5EFUA 1AX1A 1GQGA 2O8OA 3WDVA 5A3LA 4Y1VA 3MW2A 5CFCB 4HVRA 3S0MA 3S6PA 5JSOA 2Y0IA 4FP3A 4Q1PA 1H2LA 4CP0A 2EAKA 1EP0A 3JD72 1S1AA 5KC5A 3DV8A 1ENSA 3HN1A 3UL2A 4FTBA 4Q4X3 1BYHA 5H9QA 1FPN2 2WNVB 1ASJ1 1XNCA 4M3CF 1RHI2 3RJ2X 3THPA 2I2SA 3S7EA 4Y1XA 2W08A 2O8QA 2ZX1A 5KHHA 1LTEA 2D3PA 1OOPA 3JB4C 4ES9A 3ZVXA 4MGZE 1VBE1 4GULA 4YM1A 2YMZA 4YM2A 1GZCA 1F31A 1FATA 2RM23 1A78A 1H9WA 4PQ9A 4EWAA 3MZHA 1YCIA 4P9GA 1LOAA 4LHNA 4I09A 3ZXFA 4BOWA 1WD4A 4MUVA 1JOJA 1C8M3 1N3PA 2BFUS 2D98A 4MLOA 1COV2 1NA1A 5JIUA 4OUMA 3FMGA 3KD4A 1WLCA 2GC1A 3AP9A 4B4QA 4MXVA 3IDCB 4Q4V1 5C9AA 3PVEA 4UXAA 2PTMA 2HKXA 3H1WA 1LOCA 3MW3A 3E6CC 1E57A 2ZGLA 2SLIA 1IKQA 1ULCA 1I5ZA 4FSJA 2GN3A 4DRVA 1DGLA 5C8CA 1AXKA 3AMQA 4AFAA 1C8M1 1QDOA 2BNOA 4PLOA 3VLBB 5E88A 1NCQA 5SV5A 5CFDC 3VBOB 2DUOA 1XYOA 2PHLA 3J26N 4O9GA 3VGIA 2WNEA 1MS4A 4HBNA 3ACLA 4IEPA 3VHOA 4ES8A 1D2SA 4HK9A 3RRDA 3SLIA 2SBAA 5DZGA 4AEKA 1FMD1 2BUKA 2KA3A 4UW4A 1HRI1 2W39A 1GQHA 1KDMA 3B9IA 3M2MA 1AR81 2XJRA 2D6MA 5I0UA 2XJTA 4EN0A 3RQ0A 5I91A 4NN0A 4N7UA 1SLIA 1D4M1 1ZZ6A 3O0XA 4RHV2 3FBMA 1ND2C 3KCXA 3OYWB 2R063 4XJ8A 1V6OA 2HWD1 4DB5A 2OUHA 2WNUA 1PO21 1R1ZA 4Q8LA 3A4UA 4JQRA 4HZFA 3ZFGB 5K9YA 1AL21 3VZNA 1F5FA 3MPBA 3FUQA 2P3IA 1CGPA 3PVBB 2GH8A 1GICA 2XJSA 4RGGA 4IEOA 4DPNA 4AGRA 1LENA 2GDFA 1FV2A 2DCKA 5ACA3 2YV8A 4QGMA 3AJZA 1O4YA 3LAGA 4B4RA 1QGLA 3DF0A 4KQ7A 4XF3A 3I59A 1PZ7A 3V0BA 4RQPB 5JDBA 1QXRA 3PMSA 4WM7B 2CV6A 4F8AA 5FO9B 4FPYA 3URFA 5CFCA 3FZ3A 1AR63 3FWEA 4I0WB 5BNOC 1KJLA 2B7YA 3IWZA 3GALA 3QH6A 2DWRA 4H7LA 3D0SA 3AJYA 1RUF1 1SLAA 3E5XA 3MPPG 2XG3A 5ACA1 3FJSA 5GZFA 1HDKA 2Q5TA 5CA6A 4BYYA 2WNVA 4KWLA 4BQ1A 5IK4A 4YSFA 2D6KA 4IXLA 1SCSA 4Z2WA 1QY4A 3CNAA 4YZ5A 1D2QA 1DQ2A 1QJU2 5IK5A 3CJIB 4DZGA 4H3WA 4LUMA 5K7PA 2AH2A 3HBZA 5JOYA 4OHYA 1OA4A 2Q1MA 4LO7A 3FC0A 1PGW2 5JPMB 3R6SA 1R092 1ZRRA 4AHXA 2VVEA 2E6VA 3WG3A 3JUUA 2X5IB 4PIXA 4ISQA 1H4GA 1X7NA 2JDZA 3X29B 4CDWB 3WUCA 1SMVA 1BK1A 1RVF3 2UY8A 3WCSA 4I30A 1SBFA 1FOD2 3EJKA 1VBC3 2DCJA 5DUWA 5T54A 1QH6A 1W6OB 2D97A 4I01A 4WVZA 3P3PA 3RI9A 4AVAA 4AW7A 2A75A 3OF1A 1Z7S3 1H1MA 3K48A 2VU9A 1JUHA 3AMPA 4QQHA 1I9RA 4HT1T 3HMYA 2GMMA 4MYEA 1MEC1 3VHNA 4ATFA 4XMAA 1BEV1 5AC91 1H4HA 1ZZ8A 2ZGRA 4LBQB 2XVLA 3ZFEA 2GC3A 4XFGA 1Y7BA 4Y5Z0 1MVEA 1OQDA 3M3EA 3VBOA 4M0HA 1KS4A 1LHWA 2RMU2 1KITA 4AFMA 1DZTA 1YIFA 1BMV1 3WZ1A 3D82A 4QGLA 1HXS2 4PIZA 4FVVA 1DIWA 3N35A 1LGBA 1DGWA 1D0GA 1V6IA 5D1IA 1C1FA 4CDXB 3H8UA 4NHKA 1S55A 2K9ZA 1QJZA 4UBHA 3WP3A 3OD0A 4M01A 4GMP1 2YYOA 2HEVF 1LOBA 1W39A 4IL7A 1C4RA 4K1ZA 4GIQA 4S2DA 1TEIA 3DPRA 2RS33 2GMPA 4FOYA 3OYWA 3SH5A 4JGYB 1TQ5A 2A5ZA 3VKFC 1U5IA 3JBG1 4K3UA 3ZFGA 2V09A 4COVA 4LEJA 3KCYA 2ET1A 2PHDA 1NYWA 1BBT3 4R52A 3VN4A 3E5QA 2WT0A 4JGZB 1ULFA 4QPGC 2BGCA 1W2UA 1O4TA 1YLLA 3J4UH 2Z69A 3AX4A 3INAA 5DZFA 1ENXA 5GZEA 1WLWA 2A3WA 3LCPA 5C4WB 4XEZA 1D0HA 1V6NA 1VBE2 3JQXA 1UZYA 2WFF1 3EO6A 4GB33 4GH4C 2HWB2 4RQPA 4WM7A 5I8TA 3P3NA 4CDQC 3SISA 4YW4A 4Y4YA 2OZ6A 1G6NA 4FPJA 1QQP3 4NPRA 1XNBA 3O12A 4C1XA 2Z2SB 1BBT1 3WOGA 4CP2A 3HIFA 3FBYA 4PCRA 1DYPA 3HWJA 3U4XA 2CGPA 1JW6A 2RS53 4COYA 4BM8A 2WLQA 2Q0AA 3JQWA 1VRH3 2RE9A 4BMEA 4Q4V2 1U12A 1WUVA 2JG8C 4BWOA 4N53C 5ABJC 2ZHNA 3AZVA 3B3QE 2ZX0A 1TME3 1C28A 3ZN6B 1IQAA 3TNQA 3TN93 1JXNA 3CJIA 2XGXA 2ZGKA 2OA2A 4DNYA 4XF1A 1X36A 5JVVA 2GNBA 3CEWA 2RS51 3H3ZA 4EN8B 2EXJA 2D7FA 1OFNA 1SQ4A 4JAAA 2HWF3 2X5IA 1JN2P 1PGL1 1G86A 1GZWB 1ULEA 1VBA2 4CDWA 2X53S 2DUQA 1QJX3 5F9TA 5FO7B 4LT5A 5C8WA 4C1WA 3T1MA 1VBB1 2BTVC 1QJY3 1XU1A 2F4PA 2ZMNA 4P9WA 4N43B 5D8AC 4ATEA 1FMD2 1LOFA 1POV3 1W6OA 2BPA2 5KWRA 1H9PA 2PLV2 3D4KA 4DS0A 2UWCA 4WVWA 1KFXL 4G3YC 1LECA 5E16A 4OI0A 1ZRDA 2ZX3A 3WW2A 1VB2A 2WJSA 3QBQA 4BLJA 4B4PA 3FFZA 3OD4A 4A7YA 2XUMA 5JCTA 3NAPC 3VBHC 4ZU5A 3JD73 4LBQA 3WT3A 4X6QB 4JDMA 1QJX1 4WV8A 2ZAAA 3MIBA 3VV1A 1OOPC 1PO22 1VAKA 5KHGA 2HWC1 3WDUA 1FPN3 1RUI2 3GF6A 4KNCA 4NOTA 3WQ7A 1POV1 1RHI3 2A6VA 4W6YA 1KDKA 3R4SA 1M06G 4HVQA 3ZSJA 3GBFA 4XPVA 3I54A 2D5HA 5C6CA 1Q8VA 1REEA 4YGCA 4CDXA 1UPSA 1WA4A 1LOEA 2YZ4A 5E8AA 5EV7A 4WM8C 3AYCA 4XQWA 3AZZA 1PIV1 4UW6A 4K9SA 1MS5A 3SCHA 4L11A 2PAEA 1S0IA 1RIRA 1COV3 1R082 1RTVA 1DF0A 1ALYA 1LEMA 4JGYA 1UF2C 4OHZA 5A33A 5C8CC 5I8SA 4RFT0 5JIAA 2VQ0A 4IEUA 4XIKA 4Y26A 2XB6C 2ZMKA 3U07A 1SBDA 1REFA 3ZXDA 1AYM1 4JGZA 2DVGA 4X6RB 2WA4A 1PZ8A 4LUKA 1URXA 5BNPB 4P14A 2A3YA 5SV8A 5C4WA 1IOAA 3IBMA 5GLZA 4TZDA 5BPXA 3RZZA 5HBAA 4XTPA 3RYPA 2R042 4QPIB 1AX0A 3WW4A 5T5LA 2IWGB 4Y1ZA 4Y22A 1VBD1 2ENRA 3DUIA 4WZFA 4XTMA 4IV3C 3N7KA 3JB8A 2V5YA 5FFOC 5FLIA 4FOWA 4Q0VA 2A7AA 3BB6A 4CZSA 1GANA 1UX6A 4RHV3 4M3CE 2RS12 3JU9A 4Z82A 2HWE1 2WL1A 4EROA 1WCDJ 3ZN6A 3UJQA 2CYFA 2B46X 3E97A 1BEV2 2FMYA 2WZR2 3PLQA 4FOQA 2ZHMA 3ZX7A 4LBOA 2VW0A 4L8QA 3HAGA 1V70A 2G4IA 4A7ZA 1XNKA 1D4VB 4META 1C57A 1H2KA 1Q8PA 1RC6A 1RMU1 4EJRA 1GZWA 3TNPB 4FTSA 3HQXA 1SBEA 4IEYA 4Y24A 1C3HA 2AZ5A 4QPYA 2QUOA 4E2GA 1PHMA 4N43A 4N9IA 3DN7A 1CAVB 4BPZA 2XBO3 1O3RA 3LSEA 3UKVA 1UIKA 1FNYA 2Y0OA 4YVWC 1RUG2 1LESA 1YHFA 5T5JA 4N9HA 3GBWA 2WNVC 3N7LA 3HD8B 3AKTA 1GR3A 3NSTA 3Q9OA 1VLNA 2N7GA 1CAXB 2PHXA 1NA1B 4MGKE 1O7FA 2PAKA 2ARBA 2VOKA 2DTWA 3GBGA 4FXGB 2ZPXA 2E63A 4HETA 2DU1A 1U0AA 2DCTA 3JBG2 3ILNA 2OPKA 3SXWA 3M3OA 2ZABA 4U36A 3CF6E 4EWEA 1NY72 2BWCA 2BW8A 5L73A 1REDA 3NV3A 2YY1A 3SH3A 4BH9A 1NQJA 4XFBA 1R093 3ENRA 1HX6A 3R4UA 1B35C 1IS6A 4ZXKA 1N1TA 1HLCA 1X8MA 3WW1A 2DV9A 2WSUA 2CGNA 1H30A 1FOD3 2XVGA 2CY6A 3KQRA 1UD1A 2W0XA 1EV12 5I0TA 2DVBA 1K5MB 2B8MA 2NPIA 3MDPA 4Q4W2 5FPZA 3VBOC 3KZ4C 1AVBA 5KXDA 1ZBA1 4M0NA 2A70A 1EY2A 2GC2A 4XFHA 1QOOA 1FAYA 3KGLA 4C90A 1BJQA 1XE7A 1AR72 1QF3A 1S0DA 3WNXA 5BNPA 1S0EA 1YXWA 2DFBA 2OVUA 4TLFA 4MGIE 2RMU3 4LHKA 1ND3C 4MVTA 3KM5A 4C0HA 3J9SA 1GLHA 4L9BA 5T3NA 3WV6A 1HXS3 1Q8SA 3AMHA 1PGL2 4QPIA 2DF7A 2I45A 3VDDB 1KXGA 1G9FA 1X82A 3BPZA 3AP4A 1PK6B 3ASIA 3S7IA 1WMDA 1MVQA 2P3JA 4BLIA 3SCGA 3V0BB 2VVFA 3GNEA 1VAMA 1CJPA 3FX3A 1I1EA 5BUVA 4E4SA 3WHUA 5IK7A 5KHJA 1RJ8A 4QX5A 4CEWB 3WQ1A 4AE2A 1AYN1 1MZFA 3G7DA 5JOWA 1KRIA 3NV4A 5LEJA 1CJDA 1ULGA 3ILFA <