4A41A

Cpgh89cbm32-5, from clostridium perfringens, in complex with galactose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
SALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 34
structure length 139
sequence length 139
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a41A00
2BZDA 3LE0A 2XHNA 2W91A 3I3EA 4A6OA 4BK5A 3SKJE 3C7FA 4XURA 3LEIA 1H6YA 1UY0A 1CZSA 1GOFA 1UYXA 3OEAA 1JZ5A 2W1UA 2C26A 4A44A 1W99A 3HN3A 3K77A 5LA1A 1DYOA 4LKSA 3VD4A 2C4XA 4KI5M 4AG4A 2VQUA 1JZ4A 2DCJA 2W46A 2YC4A 3WNPA 4UI9L 3ECQA 3GXUA 2Z4FA 1KEXA 2X09A 4DUVA 4P5YA 1NUKA 4A45A 5EIYB 2CDPA 3OB8A 3VDBA 2HYXA 4JKLA 2EIBA 3IB3A 1K42A 1L7QA 5CYYA 4QB2A 1NKGA 1GU3A 2ZXQA 2OKXA 4ZZ5A 4ET7A 3OEBA 3I3BA 2WAAA 3P6BA 3IAPA 5G05L 4ZZ8A 2DCKA 1DP0A 3CZJA 4A4AA 1BHGA 1SHWB 2YG0A 2VZ1A 3EB7A 2QQJA 5J1XA 1CZTA 4A42A 2VCAA 5F7UA 3SEPA 3VDAA 1HN1A 1UMHA 2WN2A 5JUVA 3PUIA 5C71A 2VZVA 3WNOA 1RYYA 3F2ZA 2V72A 3CKHA 3CIHA 4XUOA 3T0AA 3THDA 3T2OA 2YC2A 4UAPA 4QDRA 4DEVA 4QAWA 1TVGA 3W5MA 4DEQA 2VZPA 4Z2AA 3NJXA 3I2FA 1PX4A 1OT5A 3I2JA 3T08A 4CU6A 3A23A 5JXGA 5B4NA 3T2QA 2QBXA 3A7QA 5EJZB 1NAEA 5C7GA 1O59A 1YQ2A 1UXZA 4RYDA 2X10A 3WNMA 5IYYA 1SDDB 4RN5A 4W8JA 4DXRA 1JYWA 4LPLA 1US3A 2WBKA 2VQTA 3ACHA 1JZ8A 5LCWL 3K75B 3A22A 2J1SA 1IQDC 3UESA 2E31A 2WABA 4ARXA 4GWIA 4BK4A 2JDAA 2QQMA 4CU8A 2V5DA 2E32A 4M4RA 2ID4A 4AAXA 2VMEA 3HPNA 1F4AA 3GGLA 3J7HA 3MO4A 5IFPA 3U37A 5IJRA 1GOHA 4XUPA 3BGAA 2E26A 1O8PA 4QB1A 2ORZA 3ETPA 1UXXX 3HNYM 3LQCA 4QX0A 4BJ0A 4HG6B 3PUHA 2ZEYA 3K46A 1JZ7A 2J7MA 3WF0A 3T0DA 2Y6LA 2RVAA 4CU7A 4CU9A 3UNPA 5DN2A 4QX2A 2W1SA 2W9XA 3ACIA 3HNBM 2WAOA 2HLEA 3E1F1 3UETA 5JXIA 2WO1A 4QX3A 3NQHA 3K4AA 3WF2A 3VD7A 4MGSA 2VZTA 5C70A 4BXSV 2WYSA 2EIDA 4XVHA 2VR4A 3WNLA 1UZ0A 3DYOA 1K3IA 4P00B 2VZUA 4XUQA 3MBWA 5JXHA 3A21A 2VZRA 4QB6A 1TG7A 3IIIA 1PX3A 3IAQA 3GM8A 5B4XA 2W92A 1JU4A 1JU3A 2VO5A 5A1AA 3CZUA 3NRUA 4XUNA 1W8NA 2QQIA 1WKYA 2BERA 1P8JA 3WF1A 2WQ8A 1JYXA 2B4KA 4IUGA 4YPJA 5IFTA 1GQPA 1KGYA 2Y6KA 1CIYA 3ZM8A 3I97A 1I5PA 4LHSA 5EJ1B 1PMJX 1OD3A 2E33A 3OGSA 4M4PA 2YFUA 2VZQA 3EYPA 2Y64A 2VCCA 1O8SA 3I3DA 1UMIA 4LQRA 1K12A 2DDUA 2W3JA 2BGOA 3SKVA 1ULOA 4CVUA 3ABZA 5LA0A 3MV11 2W1QA 1MPXA 2YFZA 4E8DA 4MGQA 1CZVA 3HEIA 1CX1A 2RV9A 3I2GA 1OF4A 3THCA 2VJXA 1JHJA 3MUZ1 2C9KA 3OBAA 4KWUA 1UY2A 2ZEXA 1WCQA 3FN9A 4E8CA 4ZY9A 3T09A 2J1RA 3WEZA 3LEKA 3I2HA 3JXSA 4XZUG 1W8OA 2WUHA 2ZEZA 3T0BA 1GOGA 1JZ3A 1DLCA 2CDOA 3FHAA 1EUUA 4JKKA 5JMOA 2VL4A 5CZKA 4DUXA 5HPOA 2R7EB 4D0QA 5DQ0A 3FHQA 3OGRA 2X05A 3FL7A 2W47A 1JZ2A 1SG3A 1J84A 4W50A 4GWJA 4BDVB 3DYMA 1XC6A 2W95A 4CUAA 3LPFA 2W94A 2VZSA 3IDAA 5G04L 1OH4A 3VD9A 2XONA 3BN6A 5I0DA 2W1WA 2VOTA 3C8XA 1T2XA 2J22A 4D8MA 3AC0A 1L7RA 3WF4A 1UY3A 2ORXA 2J1VA 2QQKA 4MOAA 4PF1A 2QQNA 3VDCA 2BBAA 4A41A 3D3AA 4XUTA 2WO3A 4MO3M 1UX7A 2WN3A 4ARYA 4JX0A 1NX9A 1PMHX 4W4ZA 1K45A 3I2IA 5LA2A 4P08A 4DXTA 4TTGA 4JKMA 2VZOA 1UY4A 3W5NA 3VD5A 3MUY1 1W9WA 3VD3A 4OMDA 4DUWA 2JD9A 3C7HA 4OUEA 5HXMA 1GMMA 3HJRA 2LW8A 2RJ2A 2VMDA 3P1IA 2W87A 3OG2A 1R64A 3MV01 2WDBA 2Y6GA 2J1TA 3NNGA 4ZXEA 1OF3A 2Y8KA 1UYZA 5DPNA 4QDSA 4QX1A 1UWWA 2Y6HA 2XOMA 3LEGA 3I2KA 3DYPA 1XNAA 1W9SA 2W5FA 3LPGA 3WSOA 3CDZB 2VM9A 3K4DA 5DMYA 1JZ6A 4QDQA 4GZ9A 2VMCA 1GNYA 2WZ8A 2EIEA 2KD7A 1LNSA 4P02B 3SEEA 2B9VA 1JYNA 5JR2A 1US2A 4PT6A 2YB7A 3HOBA 3HNMA 2J1EA 1W9TA 3T2PA 4A3ZA 5IHRA 2ZEWA 2J1AA 4JHZA 1JI6A 4DXSA 4UOJA 3OGVA 4OMCA 2J1UA 2LS6A 4L0PA 4MADA 3CMGA 4FI9A 3CQOA 4OZOA 1UY1A 2V4VA 2QQLA 2WZEA 3WQBA 2WO2A 3K4ZA 1J83A 1XPWA 2QQOA 4OYUA 4KMQA 1ULPA 2EICA 3ACFA 1UYYA 2BGPA 3NJVA 3C7OA 1H6XA 2VZ3A 3WF3A 1XNTA 3WNKA 2VC9A 4QPWA 1D7PM 2JKXA 3WNNA 4CUBA 1JYVA 1GUIA 5JXJA 2PQSA 4TXWA 2JE8A 1W0NA 3GDBA 3C7GA 4CUCA 3C7EA 2Y6JA 3DECA 2L9LA 2XQXA 2VTFA 1EUTA 3ACGA 4PQQA 1F4HA 2VCBA 5FUIA 2VMFA
chains in the Genus database with same CATH superfamily
3RDIA 3POWA 1D4M2 3N9LA 1WCUA 5ACA1 3NO8A 3VBHC 3E6BA 4BK5A 4YGBA 5HV4A 2PHDA 1LEMA 4I2OA 4LNVA 1D2SA 1CZSA 4AGRA 4FTBA 5DG1A 3OEAA 5CADA 2QFEA 2W1UA 4GMP3 4BWOA 2C26A 3SHRA 2LM3A 2FDFA 2BBVA 1KDMA 3MHZA 3N9NA 4I3GA 1POV1 4EV0A 1OKQA 3CU7A 4BM8A 1OVPA 1W05A 4BQ1A 2ZZQA 3GALA 4A44A 1XXNA 4JRLA 1IKQA 2XB6C 1DYOA 1REFA 1OVSA 4L8QA 3THTA 5JOYA 4QPGB 2DCJA 4AEKA 1WMXA 1T6BX 4CCKA 4BQXA 3KF3A 3GXUA 4XTMA 3I2DA 3N9MA 4LBOA 3WZ1A 3OYWA 4HANA 3BB6A 2BYVE 3J8F1 5D8AC 1ENQA 3HD8B 3NKTA 4DUVA 4P5YA 5C9AA 5K9YA 4CCOA 1TQ5A 3UYJA 3SCFA 5EIYB 1B35B 2CDPA 4Q4Y1 3BALA 2HYXA 4YVWC 1RUH1 2EIBA 2GP5A 1K42A 3FUOA 1OBNA 2XG3A 2EXHA 2QZ3A 3WDTA 3A4UA 2DFCA 4OHYA 4PIXA 1GU3A 1MR5A 5J09A 4MLOA 2OKXA 1H4GA 1DGWX 3K2OA 1WCDJ 1NZCA 3QCWA 4F8AA 3LGRA 4WM7A 1RUC1 2WAAA 2ZZJA 3AB0A 1REDA 2X5IB 2JDPA 2ZABA 5G05L 5FDBA 1AL23 1UMZA 3T4VA 1CJDA 1HQLA 5BY5A 3KT4A 4A4AA 1BHGA 1BEV3 3E5UA 5C33A 5HI0A 2VZ1A 4NHLA 2QQJA 4LJHA 4O61A 3URFA 5FYVA 3UGGA 1KFUL 5BNOC 4NVPA 5J1XA 3CF6E 4HLTA 1UD1A 1CAVA 3GBFA 5EXOA 1SFYA 1LODA 3ELNA 3RMXA 4AEDB 3HN1A 4AK3A 5FZHA 1PGSA 5KXBA 1WW4A 2FDGA 2P1BA 1QXPA 1RYYA 3W58A 3RJRA 5IVBA 4KQ7A 4HVQA 3THDA 4XTPA 1O5LA 3FLTA 3FX3A 3T2OA 1NE4A 3UKTA 2RM23 2OQ7A 2E53A 2KXLA 5E88A 1HN0A 2G4IA 5FPXA 5FYMA 3N36A 4YZ4A 4N53B 4COVA 3HBKA 4XJZA 5C3QA 2BVVA 3VL8A 4P9IA 2VZPA 4XETA 3TEXA 3JB8A 1MACA 1SFNA 1U5XA 2G9ZA 4ZU4A 1PIV1 3U75A 3WP5A 3ZIWA 4AR2A 1KFXL 5HBAA 5F3IA 1A34A 1UO9A 1PM7A 2K9ZA 2HWF2 4NWVA 3WP3A 2VMHA 3N35A 4IL7A 1E5IA 5H9RA 1LRHA 1CWPA 4NIGA 3THPA 3O12A 1XU1A 3AL6A 4QQ2A 2B8MA 4DFSA 3FBYA 3TAYA 2TNFA 1BJQA 5LW9A 4RYDA 5F32A 5K7PA 2Q1ZB 4LBKA 5EFUA 1C8M3 4XACA 2BRTA 1W6MB 1XBFA 1W9YA 4UFHA 1LKNA 2D3RA 4RN5A 2P4EA 5I8YA 4DXRA 4YGDA 5DG2A 3VBOA 1US3A 2WBKA 2ZX1A 3IMMA 4QD2A 4RS5A 1W8UA 2P3YA 1OPOA 3A0KA 5F37A 3P5BA 3GZTB 3A22A 4E27A 3POJA 5JR7B 2E31A 1NQJA 2YPJA 2WABA 3OGJA 3KVBA 3PJQA 4GWIA 3NV3A 2IVJA 2WINB 1HXS1 4PF5A 4W6YA 2QQMA 4CU8A 1OLME 3HPNA 1F4AA 1AXZA 3N9OA 2YBSA 4LHKA 4Y5SA 4XUPA 5K0UB 5ABJB 1S0IA 5FY4A 4UW5A 2VTXJ 1OOPC 4QB1A 2ORZA 2NQYA 4YVSB 1KS5A 2Q1MA 3HNYM 1MQTB 3LQCA 4FXKB 4MVTA 5I0TA 1BK1A 4HG6B 3RG0A 1LJ7A 3PUHA 4FXGB 4CDQA 3K46A 5CNAA 2WZR1 3AP4A 1JZ7A 4LO8A 4Q5OA 3R05A 3UJOA 4XJ8A 3DGTA 1WZXA 2DU1A 1YUDA 3AVSA 3CEWA 4CCEA 3KQ4B 1QJX2 4IV3C 3PUQA 5A3UA 4CDXC 3B69A 5IATA 2GNBA 1RUI1 3VDDA 2HEWF 3W20A 1ZNPA 2WAOA 1PGW2 5FXXA 3VBFB 4JRAA 4NRQA 4R52A 4PDWB 4QX3A 2AENA 1S2EA 3E97A 3SQOA 4BQ3A 1VMJA 3AK0A 3GBGA 4F83A 4MGZE 3FLRA 4YW3A 1CD3G 1TMF3 3VBHB 4C0BA 1SBFA 1LGBA 1DU3D 1SLAA 3ITQA 2FMYA 4IW3A 4BXSV 1O7FA 2P6HA 4HK8A 1JOPA 2VY0A 5LA9A 5IT6A 4V2VA 4FTEA 1ULFA 2O14A 3B9CA 2P34A 4XDOA 4ZU7A 1IZ3A 3SXWA 3WNLA 2H6BA 2RJLA 2WFF3 3B7MA 3BUCA 3NVCA 3VGIA 5IVJA 3KCXA 1V6KA 4QQPA 1QJFA 2PAEA 4QPIA 2I2SA 2ZAHA 2RDRA 1G9CA 4QGLA 4PI2A 2A6YA 2ET1A 2DBNA 4YM1A 4MXWB 3IIIA 1NA1A 5CU1A 2ZMLA 3O1TA 4CP0A 1OSGA 4FPOB 5FMOS 3AZWA 1OQ1A 1PO21 5L9RA 1H8TA 3VHPA 4QX8A 1B35A 4NHMA 4OHZA 3RYPA 3DKWA 3PVNA 1PO11 3R4UA 2CTVA 1W8NA 4EWAA 2P3JA 1WKYA 2GNTA 3RPQA 1DGWA 4E2SA 3O1VA 1JYXA 4IUGA 2Q8EA 1QJY1 1AR82 5FPUA 4PIYA 4FFGA 1UPIA 1V6IA 1DZQA 2HWE1 3I97A 1W28A 4CP2A 1AL22 2X5IA 4LHSA 4Q4V1 3QH7A 4YRDA 2GC1A 3ROUA 1Q56A 2E33A 4EROA 1AR73 3W59A 2YFUA 3BCWA 4PI0A 3QLQA 3WDVA 1G9DA 2PTMA 1ENXA 3I3DA 1W6NB 3ZYPA 3H8RA 1K12A 2WNUC 4XJWA 3V0AA 1LGCA 1UCXA 1H4HA 4CEWC 1MS0A 4ORFA 1DQ1A 2XH6A 3MFAA 3K48A 1RITA 1VRH1 5BNOB 3SKVA 1ULOA 3WW2A 5A3PA 4CVUA 1FMD3 3MIGA 4Y4RA 2RMU2 3Q8CA 4AEDA 4CEYB 4GKXA 4PHZA 3MV11 4JHTA 2YU1A 2YBPA 2ZAAA 3WLUA 3K51A 2GZWA 1NCRA 4AEMA 3HQRA 3HEIA 5A7NA 4MGKE 1CX1A 5F3GA 2ARCA 2VJXA 3H3UA 3M3IA 3WR0A 4YW4A 1COV1 2VMIA 1JYIA 3PMSA 3CHXA 2Y60A 1O91A 3O1RA 3KM5A 4Y22B 1X7NA 1YFXA 4KWUA 1DQ0A 1WCQA 3CLPA 1HJGA 4E8CA 3RZMA 2V4AA 2WNOA 5CIRA 5JMCA 3BIEA 2DTYA 3JBG3 1HIXA 1S0EA 2PLV1 3JXSA 1GV9A 4OCTA 4XZUG 1J3RA 4XBQA 1MS3A 1W8OA 5FR3A 5FZEA 1IS5A 3D82A 1DLCA 2ZKLA 1W6MA 1DQ4A 1R091 4XAAA 1SMVA 2YZ4A 3KT7A 1RUG2 4IV1C 1ONAA 3HQXA 5FZAA 5CZKA 2YV8A 1H2MA 4KG0A 2W52A 2HWB3 2XUMA 4QQOA 1H30A 1QXJA 2R7EB 1ZA7A 5DQ0A 4JTOA 1ZM1A 5FCCA 5CFDB 2WJSA 1W39A 3ZSEA 3NMBA 3WUCA 1AR63 1XYOA 2W47A 3FL7A 4LE4A 5IVCA 4UFKA 3CNAA 5A3OA 1WA6X 4IE7A 3HQUA 2VECA 2GMMA 3SITA 4BDVB 5GZGA 1F2NA 3VV1A 4ZS2A 3EJKA 2W94A 2VZSA 3IDAA 5C8CC 1F31A 3Q9OA 4JGZA 4AHZA 3PL0A 3DKQA 2P6CA 3M7AA 5APAA 4LHLA 2W1WA 2ZGUA 4B4RA 1QQP3 2HWC1 2VOTA 2YY1A 3Q8BA 4BQ4A 5A33A 2J22A 3AKTA 3E5QA 1OXCA 5HCFA 1HB1A 4WVWA 1SBDA 4XHBA 5IVYA 4AE2A 1OLRA 2PA7A 4LBNA 1UY3A 3VL9A 4XJUA 2J1VA 4FTSA 2QQKA 3PIJA 3O1MA 2ZHKA 3VDCA 3EHKA 1LHUA 4K3UA 4S2DA 1OI6A 4HT1T 2LROA 3D3AA 4FPHA 4XUTA 2WO3A 2QVSB 5F6LB 4GJZA 3NWKA 3BTAA 4Y20A 3M3EA 3ZFFC 3VBFA 3USUB 1CONA 4LK6A 3WP6A 4G9SB 4NIHA 4AVSA 2G9GA 2FQPA 4FOVA 1TMF2 1PGL2 4JKMA 1Q8VA 3O14A 5AVPA 1DLLA 1GP4A 3VD5A 1M06G 2FDJA 2MEV1 5DUUA 3ZN6B 1MVEA 3LWCA 3U4XA 3RZGA 5GALA 1OQDA 1RB8G 1HB4A 3NL1A 1RUJ2 4LOSA 1ZYBA 4LO6B 4F3JA 4DUWA 5D1IA 2VNVA 1QU0A 2ZX4A 3LAGA 3HJRA 1UOBA 1VBC1 4IEUA 1RHI1 4ATEA 2OUHA 1R64A 3OG2A 1OHFA 2WDBA 3POYA 2AR6A 3RJ2X 2CAUA 2ENRA 1NY71 1SPPB 1SDWA 4PLNA 1OF3A 4ZS3A 5FYUA 4AEJA 4ZKTB 2SBAA 5CEHA 4QX7A 4J1XA 1BKZA 1R1A2 4QX1A 1YFWA 5FMDA 4M3CB 3POFA 3RZHA 4FPFA 4MXWA 5FRAA 5FP3A 1E5RA 1ZZCA 1AR91 3AXEA 4BA6A 1WD3A 5D8AA 1RUE1 1LGNA 3IT8A 2VU9A 1CAWB 3CDZB 2B7YA 4LK7A 2YBKA 3K4DA 1QQP1 5DMYA 2VMCA 4HN1A 1IS3A 4Y24A 4YVWA 2EIEA 3UKNA 3VZNA 1LNSA 4HVRA 4P02B 2B9VA 1RVF1 3JD71 2ZACA 4PT6A 1AYN1 1G9FA 4B1LA 2O8QA 5FMBA 1Q8PA 3AMPA 3WNXA 5I8SA 4FFIA 3OGGA 4TLFA 3T2PA 4A3ZA 2WNVC 1EV13 1C1LA 4N43B 5JOWA 4L97A 2EXKA 4JHZA 4FBFA 1YFUA 1JI6A 3K3NA 4META 3WINE 1DDLA 2BJSA 3OUHA 4RHV1 2C6SA 2Q1FA 1UL9A 3EO6A 1JYTA 5BNPC 5FK8A 4NO4A 4AGVA 1GZWA 1Q5OA 3M3OA 2RS51 2RR13 2RS32 1QJU2 1WW7A 3NV2A 3CQOA 1ND2A 4XQ4A 3WOGA 4XFGA 2VUDA 3WCSA 1GBGA 4YGCA 2FBEA 3VKMA 1SZBA 3ZFEB 2WNUB 5BNOA 5CFCC 3I59A 3NJYA 5EP9A 2QJVA 4E4SA 5A3MA 4HL0A 3MPBA 4OYUA 4KMQA 5KC5A 1AVBA 1J3QA 1U0AA 2EXJA 4JCKA 1H1MA 5DZEA 1XNTA 3HBZA 3IWZA 3KLSA 1D7PM 4P9YA 3T1MA 5I8TA 2ZBJA 2JKXA 1LENA 2CYFA 2O1QA 1OFSA 1MZFA 1ENRA 2C0ZA 3PVBB 4RSUA 2XKOA 2VVEA 4KWKA 4CUBA 1JYVA 4LOTA 1GUIA 2BQPA 1JHNA 1S0CA 2ZGKA 2PHLA 4AQSA 2XBO1 2CY6A 1WW6A 1PMIA 3ES1A 1CPNA 4Y22A 1RMU3 4GQ7A 1G6NA 4QT6A 4CUCA 5FY9A 4NRPA 2VTXA 4D3WA 1S0DA 1J58A 5A7SA 2Y6JA 4FP2A 4QHOA 2VPVA 2WT0A 1C5IA 1FNYA 2L9LA 2VTFA 2XJVA 1IQAA 3ACGA 3ZFGB 2JG9B 3LOBA 5A7PA 1RUNA 1UZWA 1BLZA 2A3WA 4QPGC 5KBFA 5DDJ3 2BZDA 2BPA2 4B8EA 3IMNA 1YHFA 2W91A 3LFIA 2WRAA 4A6OA 4IEWA 5FBJA 2EXIA 3O1PA 2AREA 3C7FA 4AFDA 1WMDA 2A6XA 4IV1B 4GD4A 1VMFA 2D7FA 1JW6A 4WBBA 1GWMA 1GOFA 2A7AA 4FCAA 2Y38A 2A5ZA 2GALA 3IDCB 5A6QA 3WG1A 4DY5A 3RS6A 2YGMA 4OUMA 1ZVFA 3KQRA 3HN3A 1XQNA 4OHVA 1FI2A 1NCQB 5A7OA 4BCUA 3VD4A 1PZ7A 4URAA 2C4XA 1JOJA 1FNZA 3NNJA 4QHZA 2W46A 2YC4A 4F7ZA 5IVFA 1ST8A 4PJYA 2Z4FA 4O7XA 1POQA 1OOPA 4XC9A 1KEXA 4QWNA 1GFF2 1NUKA 3V65A 4Q4W2 2ZMKA 2NZ9A 4AWDA 2QQWA 3VDBA 3J7NA 1UQXA 4JKLA 4GA9A 1PVC1 3IB3A 4EN9B 1V9U3 3E6DA 1XNCA 2B9UA 5CYYA 1NKGA 4IV3A 4AI8A 3AYDA 2VBBA 4CDXA 5I93A 3USUA 4LIUA 4M0HA 2YXSA 1AXYA 2ARBA 3AZZA 3FFZA 4ZZ5A 3B9IA 4O9EA 4OZXA 4EN8B 1OLQA 1RXGA 3KSCA 1V6LA 3H8UA 1F5FA 4GWNA 2JDHA 2ZGRA 2VD7A 2ZKNA 3LA7A 1AYM1 4UFIA 5AC92 1TNFA 2WS93 1CZTA 5FMOL 2OW4A 5FZ9A 4LO4B 3VDAA 2WN2A 3IKWA 4DXZA 1MEC1 2R49A 4UFMA 4Y4YA 1PM4A 1SEFA 5FYCA 2VZVA 4HOOA 3RNSA 3AFGA 4YW7A 5ACA3 3CKHA 3CIHA 1IPJA 4JAAA 5CKQA 1ZRRA 2CWSA 2H0BA 1G7YA 2E6VA 2OQ6A 2YC2A 2BGCA 3F95A 1HRV2 3WVJA 3ZX7A 3GHNA 2BNNA 4FPJA 4DEVA 1LESA 5C6CA 2GSYA 3U10A 4WVMB 5T54A 3ZR6A 1KXGA 1FT9A 1QY4A 5JLVA 2GMPA 1JXNA 1JTZX 4XIOA 3WQ0A 1AJKA 1POV3 1U5ZA 4HETA 4QHBA 2NM1A 3KCCA 4DOUA 2YROA 2QDNA 4RD7A 4Z2AA 3T3YA 3NJXA 5LZ6A 3I2FA 1PX4A 1ASJ1 3B02A 3T08A 2FCTA 4IGOA 4XPVA 4NN0A 5JXGA 1EV12 4AL9A 1QWRA 2WL1A 4QGNA 3IBMA 3L2HA 4XMIA 2FDKA 1JMUB 1C3HA 2R041 2R0HA 1NAEA 5C7GA 2F4LA 1BMV1 2OZJA 3POSA 2ZJCA 1X8MA 5FZ4A 1IPKA 1GQGA 2K0GA 2VW1A 2X10A 1W0PA 3J8F3 4H3WA 4X6RB 5T5OA 3WNMA 5K0UC 2IUWA 5ABJC 5IYYA 5KHKA 3BKZA 3WDYA 3O0XA 3ZSLA 2P37A 3ZXGA 5BNPB 4Q4Y3 4YM0A 4YVSC 3MFCA 2MNGA 1MQTC 5CISA 1RUH3 5FZDA 3H7JA 2VQTA 1MS1A 3FZ3A 5LCWL 1MZ5A 2W39A 3K75B 4CEWA 5M0TA 1EY2A 2J1SA 4MYEA 1NYWA 4ARXA 3CJIA 4KGGA 1V00A 1Z0HA 3WT3A 1ZBE2 3QACA 2Y33A 3HIFA 4EJRA 4HK9A 2DF7A 4KL1A 4YZ3A 4CA9A 4M4RA 1K5MA 1R081 1RUC3 1S2KA 1UIJA 2HEYF 5HCAA 1W04A 5IFPA 4AF9A 4PDWC 4UWDA 3NNMA 3NKGA 1O8PA 1BBT2 1UXXX 1OURA 1LOFC 2V09A 1VBD1 1ZZ7A 1EAH1 4XDQA 1UZZA 1O3SA 2XR4A 1F8VA 1W8TA 3KGLA 3U4SA 4A3XA 3GNEA 3WF0A 5L19A 2WWJA 3T0DA 2IXLA 2Y6LA 4H14A 4CU7A 4CU9A 3UNPA 4CYDA 2ET7A 2EVXA 4QX2A 4URTA 2W1SA 5DN2A 5A7WB 2GNMA 4WM8B 2W9XA 4TSVA 1QJZA 3KF5A 1IPSA 2Y0IA 5H9SA 3OY8B 4OUSA 2HLEA 3A0NA 1YXWA 5FP4A 1CAUB 1RC6A 2JDMA 2JDNA 5LBBA 2VW0A 4GB32 2R32A 5FKCA 3NQHA 3WF2A 4AOCA 4Q8KA 1C8NA 1LOGA 1F35A 4MGSA 4TN7A 4IV1A 3EBRA 5F3CA 4JQRA 2RDNA 5FPAA 1VAKA 1PIV3 3M3CA 5HCHA 4Y3OA 1JBCA 2ILMA 4XIKA 3OBRA 5CG8A 4PIZA 1FV2A 1K3IA 2PHRA 2HWD1 4YZ1A 3N7LA 1QH6A 5BV6A 5FZFA 1C5HA 4XUQA 5J36A 2R1DA 3WV6A 4OQ9A 4UF0A 3IM0A 5JXHA 1XSQA 5F6KA 3IN9A 3H1MA 5C8CA 4QB6A 3X29B 3FE5A 1LECA 3PURA 2R1BA 4I3PA 1QH7A 2NMOA 4CSWA 2DU0A 1JU3A 2WYFA 2VO5A 5JOZA 5A1AA 4LHNA 1YEWA 3LEMA 2QQPA 2BWCA 4XUNA 5IW0A 2QQIA 1HXS3 2GNDA 5JPNB 4IEVA 3OCPA 1MZEA 1OKOA 1RJ7A 2IXCA 2Y0OA 2ZS6B 4CEYC 1DGRA 1QGLA 4YPJA 5KHGA 1U5IA 1XJAA 1ACCA 1KGYA 1LTEA 3TNQA 2A75A 3ZFFA 4CCJA 1S4CA 4BYYA 4UYBA 2JD4A 3VBRB 3CBNA 4HPKA 5LK7B 2WSUA 1O3QA 1UOFA 2BNMA 4LUKA 4P9JA 3VB9A 1AL0G 1BCXA 2VZQA 1EPWA 4PBPA 5FO8B 2X53S 4Z07A 3V0BB 2WZR3 1UMIA 3NAPB 1FPN1 2E7QA 1Y9MA 2WS92 5FWJA 4P9LA 3IPVA 4Q4X2 1O4TA 3HVDA 5H9PA 2W3JA 4XEZA 1DQ2A 3ABZA 2NLRA 1RUI3 5KC6A 4K1ZA 5ACA2 5LA0A 2N7GA 4MGYE 5L36A 1MPXA 4LBJA 3ILNA 3WDWA 1EP0A 4KNCA 2ARXA 2X8KA 1MS9A 1KD7A 1QHDA 2MPFA 2XL7A 4IEZA 2ZPXA 4WVMA 2RV9A 3I2GA 3THCA 2XPJA 1WLWA 3QBQA 3U1XA 2ZTNA 1XRUA 4JGYC 5C5UA 4IDZA 3WUDA 1SLTA 3MUZ1 1YCIA 2WLPA 2C9KA 5TSWA 1G9BA 2ZEXA 1W8WA 4Z82A 2VUAA 2OIIA 5CFDC 4Q29A 3SH4A 2VXRA 1C28A 4OI2A 4P5HA 4X8NA 4Q27A 4YW6A 4QX5A 2DVDA 4Y1UA 2VNGA 4CXXA 1W2TA 1CR7A 1WWYA 5C3PA 1TEIA 5KHJA 4R4ZA 3ZXDA 3BODA 2BV4A 4NUBA 2WNVA 1SCSA 1JOBA 3TN92 4E4HA 2G1MA 2WUHA 3MEPA 2WKKA 1AX2A 2XLGA 2WC2A 1AR81 1GR3A 5FYHA 1LR5A 1X82A 4Q4Y2 1PO23 1W6OA 4KU8A 5BNPA 2ZHMA 2ZGLA 3K3OA 4GWMA 1TE1B 1RUH2 1YIPA 3SH3A 2FCUA 1GP5A 5LBCA 1IHMA 1PO13 1W2AX 5EWSA 3RVHA 5A1FA 1H2NA 3M3QA 4DUXA 4ES9A 1FOD2 1YI9A 1CIWA 3ACLA 4CDUC 3FHQA 5CFCA 1Y43B 5B2GB 1CESA 4NRMA 5FJHA 1QJY3 3FBMA 3BTXA 4N7IA 4EYUA 3MF9A 1J84A 3JB4C 4YM2A 2HWE3 2WWSA 1DG6A 4NAOA 5KHHA 1W9FA 5K4LA 1EYBA 1VRBA 2Q8DA 1QDOA 2RMU1 4Q4V3 3LZZA 4IQPA 4E4DX 3LPFA 5G04L 4PQ9A 3N7MA 1E5SA 3RI8A 4DPNA 3VD9A 2E9QA 3USSA 3BN6A 3LA2A 5I0DA 5DZGA 1OUXA 3AKPA 4OLLA 5IVVA 5KHIA 1T2XA 3PHMA 5LEKA 2VG9A 3RWKX 3H7YA 4XCBA 5J48A 1SLBA 4RGKA 2NMNA 1VRH3 4JDNA 4ASMB 3LSDA 4FPLA 5GM0A 5C8WA 3DUIA 1ND3B 1IKPA 1N3QA 4GALA 1LHNA 4NPRA 1CVNA 1X9PA 5EV7A 4XF4A 2EIGA 4Q0SA 1DQ6A 3OPTA 5I0SA 4YWAA 5FOJB 1W06A 4FP3A 5GZFA 3S7EA 1ZRIA 2XHKA 4RR3B 2XQRA 3ZXEA 4UW3A 1NXD1 2HJIA 5FZGA 1MS8A 5LK5A 1ZX5A 4RQPB 3O1OA 1NX9A 3ME2A 4BPZA 2A70A 4I0BA 4QPGA 1VP6A 3MIFA 5FWEA 4IGQA 2Z79A 3ZYIB 4K8FA 3ZYJB 1COV3 4ZPIA 2ZGMA 4BB3A 4MH0E 3W5NA 3D6EA 5J37A 1Y7BA 3MLLA 5T5PA 1W9WA 3UL2A 3VD3A 4IEPA 2XJPA 1DCSA 3T2TA 2DWRA 4OMDA 1LU1A 1RUG1 3FWEA 1LEDA 3U0ZA 3IZOA 3G7DA 2IXKA 4FQZA 3UV9A 3VBSC 2A73B 3LOIA 5DAQA 2XGXA 1RL3A 3SNMA 5HXMA 4NOTA 4BZ4A 2WQ4A 1XOYA 2PLV3 4L92A 4AYUA 1RXFA 2VMDA 4K7JA 1KJRA 2IXHA 2W87A 1HV1A 5E6HA 2JE7A 1K5JA 3RYRA 4D6SA 3O1SA 2X29A 1HQWA 1VAVA 1OA2A 2Y6GA 4XJAA 4N43C 4ZXEA 1R093 3OF1A 1Q8QA 4XXPA 2IXIA 5DPNA 2XKPA 2ZHLA 3I4IA 3PUSA 4LKDA 4JC1A 1V6NA 1X9TA 1RINA 2Y6HA 4Y1VA 4BIOA 5BYNA 5ANQA 3KWVA 5LRSA 3TWIA 5J3UA 1W3XA 2NYYA 4HKLA 4CP9B 3LPGA 1BEV2 2G9FA 2VM9A 2I07B 3B01A 2WFPA 5CG9A 3ZFEC 4FAHA 4GZ9A 3EMRA 2ZGOA 1GNYA 4P9GA 2WZ8A 1W8ZA 4ZU5A 1WBFA 2AYHA 4AI1A 3ZN5A 1US2A 4YG3A 3D4KA 4XF0A 5T50A 1FXZA 4LA2A 2ES3A 1XE7A 2J1EA 2TUNA 2PELA 3RYKA 1W9TA 4S2FA 1DFQA 2VQ0A 3AJZA 5T3NA 1UKRA 1O5UA 2XDVA 2DFBA 2ZEWA 2RM22 4LUMA 4LT5A 1N1SA 2HWC3 4DXSA 4FSJA 4GXLA 2KM2A 3T4HB 1LCLA 4L0PA 3IDBB 4AI9A 4GKYA 2EF6A 4BE3A 4J6GA 1PGL1 2K46A 3MF6A 4N53A 4V1PA 2A3YA 4FPGA 4OZOA 1FX5A 1VIWB 3W21A 2V4VA 3I8TA 1HKDA 4M01A 2R0FA 5JSPA 4X6QB 5CVRA 1RUI2 1XSRA 3K4ZA 1J83A 4A7ZA 3ZFGC 5L7OC 1UYYA 3S0MA 2JG9C 1RUJ1 2AZ5A 3C7OA 3LA3A 5F2WA 2D97A 2VZ3A 3AMNA 3H50A 5DUWA 3WNKA 4AQ2A 2VC9A 4EN6B 3P3NA 5F5CA 2PN5A 1ZRDA 2AC1A 4DRRA 1GSLA 1FYUA 1C8M2 1YJKA 2VOVA 3OBZA 3PVEA 4GH4B 3WNNA 4AQTA 2XJQA 4XZPA 1CGPA 3PLQA 3R6SA 2MEV3 3APBA 2D98A 1R1A1 2PQSA 1F15A 1ULDA 3WDXA 5JXJA 1GKBA 4JGYB 3GDBA 1HJFA 4OI4A 4G3YC 3SCGA 1B09A 3C7EA 1XE0A 2XVLA 4GJYA 1UOJA 1VBC3 2JWPA 2ZMNA 1RHI3 5GKAC 3VUOA 2ZX2A 1EPZA 1NCQC 4COUA 4XABA 4XHXA 4W6XA 3WQ7A 1C57A 2VCMA 3KV4A 3GZEA 1SFPA 2BVBA 2VMFA 3J9SA 1AR93 5F5AA 1UZYA 2EA7A 1I3HA 1RUE3 2R061 2XHNA 3CO2A 4IE0A 5EZWA 5FUNA 3I3EA 5K0UA 5ABJA 1W6PB 2J42A 2PMWB 1ZBA1 3HWJA 5EPAA 4IE6A 3SKJE 2D5HA 5JOXA 2AEZA 3LEIA 4YVSA 5IVEA 1UY0A 1MQTA 4YZ2A 2JE9A 3QOPA 1WMEA 3MPPG 1BXHA 2OYZA 1NLRA 3U78A 3H3ZA 4DY3A 2FZ2A 1RVF3 3JD73 1PK6B 4KBZA 1AYN3 1QJU1 4CDUB 1KS4A 2JENA 5A3LA 1RUF1 4Q0QA 3LDRA 2B46X 4E2GA 2QNKA 4KU7A 2DYCA 3N9PA 1LOEA 2LALA 4Q4V2 4KI5M 1MVQA 4LBQB 2QTWB 2VQUA 3JQWA 4RHV3 4ISRA 1G86A 4DQAA 4HN0A 1JZ4A 1OPMA 5FZ3A 4UI9L 2PHWA 4PDWA 1AJOA 5FK7A 5FLIA 2RS53 2XJUA 3VBHA 3WQ1A 5J98B 2X09A 3WW1A 2WZPP 5FY7A 2P5BA 1VRH2 5AFEA 3EXUA 2VGDA 3AM2A 1W03A 1UIKA 2CGNA 2Q5TA 3I54A 3S57A 3AJYA 5FPVA 3DPRB 3OB8A 4K6BA 1Z7S1 3LF7A 4FOYA 4CP1A 1L7QA 2E51A 2WFF2 1YWKA 3P3PA 3QD6A 1X8EA 4XFBA 5EQUA 3O5SA 2FHRA 1OD5A 3ALQA 1RJ8A 2ZXQA 3H3LA 2HBUA 1NLQA 4ET7A 3TYJA 4XBLA 3I3BA 2BTVC 3SMHA 5JZGB 1STMA 5FO9B 2XBO3 4ZZ8A 1DP0A 2HKXA 5GJ6A 3UGHA 1HX6A 5GLVA 2A6VA 4M00A 2G19A 1SHWB 3H9AA 1BZWA 5FZ8A 1GQHA 4MZUA 4XOGA 1VBA3 3DXUA 3GCWA 2BFUS 3AP5A 4A42A 4NHYA 3VBSB 1TZOA 4Z1VA 2VCAA 3WXPA 4IEQA 3SEPA 2GAUA 5FOBB 4C1XA 1HN1A 1UMHA 1HQNA 3PTYA 3MYXA 3I49A 4LLFA 2AACA 2XJTA 4TLGA 3ZSKA 2V72A 4D7TA 4FOWA 3T0AA 2PXJA 1FATA 2IWGB 1N1TA 1AX1A 3POIA 4LO5B 1AR72 4INDA 3ZOIA 4L99A 1IG3A 1PNFA 1WGPA 2CU5A 3FHIB 5C3SA 2CAVA 1R1ZA 1QIQA 1NQDA 1W6NA 3VBUC 4GULA 2NP0A 3PIGA 3MW4A 3W5MA 4DEQA 5FY8A 2OPWA 3BVCA 5C5TA 4Q4W1 3S6PA 1FMD2 4LKEA 2VUJA 4EN7B 3DL3A 5ISLA 4RFRB 4CU6A 5E8AA 4CEYA 4XF9A 4MHUA 2D6OX 4C0HA 4L9BA 5L9VA 1WLTA 5B4NA 3N4MA 2RS11 2QBXA 5EJZB 3AFKA 3GZAA 2D3PA 5IAVA 1ZREA 1YQ2A 2FDIA 2UY8A 5IWFA 3KB5A 5LBFA 4Y1YA 4IETA 4RGAA 4QKBA 4XQWA 2Q30A 2BWAA 4N8MA 3VZKA 4I01A 5GLTA 5FZLA 2P3IA 2WNEA 1RUD1 1PVC3 2JX9A 1JZ8A 2OT7A 5FUPA 5KR7A 5J7MA 1IQDC 2DTWA 1PZ9A 1M4WA 1VBB1 2HYKA 3JBG2 4LR4A 1VBE1 1QKQA 1O6UA 4BK4A 5AC91 5L7OB 2JDAA 1VBA1 2IZWA 2QQVA 4WM8C 1HRI1 2R071 3VDDC 2V5DA 4JTNA 2ID4A 2VMEA 4B3NA 3RQ0A 3GGLA 3GZUC 3MIHA 3MO4A 3RSJA 1X33A 5IJRA 1GOHA 2MEV2 3WCRA 4KWJA 3BGAA 2E26A 5EHDA 5FZ7A 4A2UA 4N9HA 5A3NA 5GZCA 1AXKA 5FP9A 3ZXKA 4HSJA 1AYM3 3M2MA 1XE8A 2UYBA 4OVEA 1HRV1 4JGYA 4Y33A 4BJ0A 3MLJA 2HWB2 1XYNA 1UF2C 1ENSA 2YGLA 1GANA 3KD4A 4TWTA 5CFDA 4QXKA 4Q26A 2D3SA 2ZOEB 5C3RA 3KV6A 4ITCA 1MEC3 1H0BA 1NY72 2RVAA 3IDEA 4IGPA 4QPYA 1AR62 1CPMA 1O4ZA 1UOGA 2D44A 2P17A 2VW2A 4LLOA 5EYYA 2YDEA 1REEA 4MX3A 1QXRA 4QPIC 2B45X 3ACIA 1AR92 1GNZA 4I0WB 4XE9A 4YFWA 2IFWA 1RUE2 4XW3A 5JI9A 5JXIA 1DYPA 4E4ZA 3Q8EA 4H7LA 1X50A 1KQRA 1BVVA 5CKNA 3E6CC 1QQP2 4BQWA 3OYWB 1UPSA 1S55A 4ISQA 2VZTA 5DAWA 4NIIA 3VD7A 3WHUA 5FKBA 1DYKA 2D6LX 2WYSA 3OUJA 4LEJA 3O7OA 3JD72 4AAPA 4BMBA 5C4WC 1ASJ3 1Y9QA 3SC7X 3ZXLA 2BEOA 4AFBA 2YYOA 3AZVA 1UZ0A 2OPKA 3ZPOA 2VMGA 4OI0A 2R043 2HBTA 1TME1 3MIDA 4AFAA 4D69A 4EE2A 4ZONA 4RHV2 3ZPYA 2DVBA 2XJRA 4LBQA 3RRDA 4NIDA 5A3TA 1ZBE1 3JZVA 4BLJA 1DZTA 4WM7B 1W2OA 2VZRA 3VBRC 3SLIA 1MS5A 5FFOC 5F1RA 3IAQA 1C4RA 3GM8A 4EWEA 1BK0A 3BYWA 1D4M1 2W92A 3LFMA 1JU4A 1T6GC 2JB4A 2R30A 1D0GA 1BBT1 1UU5A 3NAPC 4LKFA 3ZN6A 1UX6A 3ORJA 4WV8A 5JI7A 5T5LA 3JQXA 3VHNA 1NLSA 3N9QA 2DVFA 4E9KA 5IK7A 1UN1A 2C1FA 4FPEA 2BERA 1CAVB 1GICA 1GP6A 1R083 5F2SA 3SH5A 3TRSB 1SQ4A 4H55A 1GQPA 1JH5A 3C2UA 2WA4A 2PHTA 5AFBA 1SPPA 1CIYA 2Y6KA 1LOBA 3GJAA 1WLDA 3M70A 4LULA 1NCRC 3ZM8A 3ZYFA 1I1EA 4Z92B 3KZ4C 1F5JA 3WX5A 1OMIA 2A6WA 4M3CA 4FT8A 5LRRA 1GZCA 1VBD3 3RGBA 4WVVA 1EAH3 1OD3A 4P14A 3OGSA 4DZGA 2WIIB 3NJZA 3EYPA 4OI1A 4GB31 3UGFA 2VCCA 4JDMA 1O8SA 1CAWA 5A80A 3ILFA 5T52A 4DO0A 4LBLA 1YYNA 2DDUA 2BGOA 2OZ6A 3VBSA 3WG3A 3ZVXA 4LITA 4XFIA 2JECA 2DVGA 3HT2A 1CJPA 1GZ9A 2W1QA 1RTVA 3BU7A 4AHWA 4LBMA 5HCBA 1GWKA 1H2KA 3MIEA 3PTRB 4N43A 3V64A 2WT2A 3ZXFA 2UWAA 5JVVA 3BPZA 4MGQA 4AVTA 4AFCA 4M3CF 3PDQA 3O1UA 2KA3A 2RR12 3OD0A 1PHMA 4MGTA 3R4DB 4QM9A 4JVAA 3RMYA 3VBUB 1UY2A 3ZFEA 2E7AA 4CDWC 2WNUA 4EWDA 1DZRA 2JDYA 2HWD3 2YPDA 1IS4A 1Q8OA 3DV8A 1ODMA 4N90A 4R9CA 4ZY9A 4Y1ZA 3H8OA 3T09A 1WMFA 3RZJA 2J1RA 3ZXAC 1ALYA 1ZA4A 2D6NA 1XNDA 3BPSA 3LEKA 1E57A 2OS2A 4IERA 4J1WA 2UY9A 2JJ6A 4BH9A 1YNAA 3T0BA 4E2QA 3S5AA 1GOGA 1OFNA 2HEVF 4JGZC 2VULA 3FHAA 1W3VA 4HKOA 3ZYRA 3L9JT 4XXAA 4COZA 2DCTA 4JKKA 4ASKA 3M1HA 4NHXA 5BXXA 3NV4A 1AZDA 5JMOA 1RMU2 2VL4A 4I0AA 3J4UH 2Y26A 2RJKA 1RGSA 1VPHA 4GMP0 3B93A 2BDRA 5FP8A 3ZO0B 4D0QA 1ND3C 4YGEA 1S0FA 2A3XA 3OPZA 3ZXJA 5LEJA 4PBOA 2X05A 3TEZA 2XXZA 3ZFGA 5L7OA 5JPMB 3ENRA 2JG9A 4Q4X1 4RR3C 5E16A 3HMYA 2A6ZA 4BU2A 4IE5A 4GWJA 2D6PA 4RQPC 4Y26A 5ANNA 4KG8A 5DDJ2 3VDDB 4BLIA 2GDFA 4CCMA 3R4SA 2IXJA 5J96B 4DB5A 1XC6A 2W95A 3J26N 5LY1A 1DF0A 4CUAA 2HWF1 3N7JA 4RA0A 3TB0A 3CL1A 3OUIA 2D5FA 2GN7A 1OH4A 4KWLA 2RDQA 4Q8LA 5JIAA 1AYM2 2VVDA 1WBLA 2XONA 3Q8FA 5L73A 1N1VA 1FPN3 3C8XA 2JIJA 2YU2A 5JDBA 2R16A 2YMZA 4D8MA 1IGOA 4L2NA 1YQ8A 3D5OA 5JIUA 1MEC2 3WF4A 3FMGA 1A78A 3GCXA 4MOAA 5D21A 3AKQA 2QQNA 4HSLA 1BVP1 1NCQA 1JS9A 4MO3M 1LULA 4OULA 2AEYA 1PMHX 2DV9A 4NPLA 4QPIB 4YNIA 3PU8A 1LAJA 3BOWA 1QOSA 1YJLA 3S5QA 4DXTA 4TTGA 2CNAA 3ZIXA 1FV3A 1QEXA 5FO7B 1A6CA 3TN91 1NA1B 3LIGA 3OTFA 1NZIA 1O3TA 1NXMA 4YZ5A 1H8TB 2WSVA 1ASJ2 4B29A 5C4WB 5FQ0B 3KMHA 3RZKA 3AKRA 1L7LA 1VALA 4QU2A 1V9U2 3JU9A 5FV3A 2R042 4A7KA 4CTEA 5LB6A 1F9KA 4DINB 2JD9A 1BMV2 2CGPA 1LHOA 1FOD1 3P1IA 3ES4A 4QKDA 1MZ6A 1QOTA 2JDZA 2AUYA 4FPYA 2VVFA 3LB9A 2J1TA 3DCQA 2XVGA 3AKSA 1AR83 2ZHNA 2Y8KA 1GWLA 1UYZA 2PHXA 2WT1A 1QJX1 3AVRA 2VXJA 1OC1A 3MLKA 4AGGA 3HAGA 4YARA 5E89A 1PGW1 1DHKB 1YRZA 3T1LA 2BNOA 2D93A 1XNAA 1W9SA 1WA4A 2PAMA 1ND2C 2GC0A 3LIHA 1N47A 2JICA 3V0AB 1W6QB 2KD7A 1R082 4GMP1 1JYNA 3FUQA 4PCRA 3UJQA 3WY6A 3Q8AA 3VZJA 3TNPB 4BOWA 1CX4A 4CXWA 3HNMA 2QCSB 2RMU3 3MICA 3E5XA 3NNFA 4LXLA 3OD4A 5FYYA 4WZFA 4Q0VA 4KH9A 1W0OA 2BFUL 1A3KA 2J1AA 2ZGQA 1HDKA 1VBD2 1NCRB 1EAH2 4GH4C 1V70A 3BOPA 4UOJA 4XCAA 5ERLA 4OHXA 2DUPA 5LATA 3OGVA 4NJ4A 4K1YA 1PNGA 4OMCA 2CGOA 2J1UA 5A6XA 5LWBA 2FZ1A 1DIWA 3CMGA 3POEA 3VKNA 1LOAA 2LRPA 2FDHA 5T5JA 2Z42A 1PZ8A 2DURA 5BNNC 2WO2A 4JDOA 2QQOA 3BIWE 2W2IA 5FXWA 4B7EA 3L2YA 1D0HA 2WA3A 2Q8CA 2GC2A 5F39A 3WP4A 1OA3A 2I74A 1H6XA 2XWJB 3B94A 3B5LB 2ZGTA 1IOAA 3MIBA 3J8F2 2W68A 3NSTA 1GNHA 3ZR5A 1W90A 1QNWA 1J3PA 4AZZA 4MUVA 3T30A 4FVVA 1V6MA 1BQPA 4V2WA 1RUG3 4IE4A 5FZBA 4HKWA 5GLWA 4ASLA 1VB2A 1W0NA 2ERFA 3DXTA 5DUXA 4AI0A 1AL21 2XJSA 3C7GA 3MDPA 4O65A 3VBUA 2QQUA 2HWD2 3WG4A 4EZ4A 1OQEA 1PK6C 4CDWB 1BEV1 3DECA 3H1WA 2JG8C 3DF0A 4KBBA 1EUTA 5FY1A 5LASA 1RUC2 2VOXA 1OH3A 2VCBA 5FZOB 2BOIA 2C9AA 3KVAA 1S0JA 2H6CA 1UU4A 1I5ZA 1UZVA 3LE0A 3H8XA 1DQ5A 1QNYA 1V0AA 4IESA 2VH9A 4JGZB 2YC0A 4D6QA 2RM21 5FZKA 5FZCA 4XURA 3PNAA 5A33B 5FYBA 1H6YA 1TNRA 3UK9A 1UYXA 2WWUA 4YW5A 1JZ5A 4FOQA 4R8HA 3ZYBA 2A71A 4G4FA 1CN1A 2TBVA 3DPRC 4YW1A 5FPLA 2C5DA 2F17A 1W99A 3K77A 4QM8A 5FPBA 5LA1A 3B00A 4LKSA 5DAPA 2UU8A 4MV2A 4WM8A 5A7WA 3U14A 4BISA 4Y20B 4H2AA 4QKNA 4AG4A 4COYA 1A8MA 1H8VA 3OY8A 3WNPA 3RWNA 1CAUA 3ECQA 4R9DA 4NPMA 1WCKA 2WLQA 3RFRA 4OQ8A 1YC61 4FFHA 5JZGC 1FPN2 4YSFA 4Q2FA 4XFFA 1YO8A 2Q8OA 2F4PA 1C8M1 5IUQA 3RZLA 2BP6A 1H9WA 4A45A 3OJBA 1PIV2 1Q8SA 5IK4A 5JWPA 2VNRA 5EYXA 3ZDSA 3TEYA 4XFHA 3R0RA 1J1TA 1RUJ3 1VE0A 2IFRA 2NN8A 3U07A 4QB2A 4P9XA 3AYAA 5JSOA 4UXAA 4K40A 4D6RA 4EZHA 4CCNA 4KGQA 3OEBA 2WO7A 4BMEA 1R1A3 1XNBA 3P6BA 4CE8A 3IAPA 3FC0A 1ZZBA 4AXOA 1O4YA 1UU6A 2CL2A 2DCKA 4FPKA 5FZ0A 5FXZA 5D8AB 3H0OA 3CZJA 3TBDA 1VR3A 4Z8BA 5DAXA 3PU3A 4CPBA 4CZSA 3POBA 1JYCA 5C4WA 4Q0PA 5FQ0A 2V5YA 2YG0A 3BU0A 3C3VA 2O0OA 3EB7A 4UFJA 1LU2A 1HXS2 1QOOA 2Z2SB 3KT1A 4YVWB 5FBZA 5I0RA 4IXLA 4S2GA 1S2BA 5F7UA 2ZCWA 4AHYA 3ZKUA 2Z5WA 4B1MA 5JUVA 2XLAA 3PUIA 4XAEA 5C71A 2LTNA 4K21A 3WNOA 2R063 2D40A 3GBWA 3F2ZA 2GC3A 4L11A 4XMAA 2JXAA 4XUOA 2O8OA 2BUKA 5A1LA 1ZBA3 3VBRA 4LORA 4UAPA 4QDRA 4YM3A 4OHWA 2H0VA 2JIGA 5KXDA 3JUUA 4QAWA 1GYKA 2ZGSA 3AMMA 2ZGPA 3ATGA 1GZWB 2WZR2 1H2LA 1TMF1 3V0BA 1Q3EA 1TVGA 1ND2B 2RS33 1QJU3 3NAPA 4XDPA 1DGRN 4IEXA 4TYSA 1RUF3 1W6QA 1N3PA 2NPIA 4C90A 2VUCA 3I59B 5FZ6A 1MS4A 3CJIC 5F5QA 1G9AA 1OT5A 3I2JA 4Q0UA 1Y3TA 4NWWA 3A23A 2XWBB 3LDBA 4CUGA 5C3OA 5A6YA 1K5MC 4HFSA 3W9AA 2JDUA 3T2QA 3A7QA 2BW8A 2DUOA 2PFWA 1IS6A 2RDSA 1HB3A 2WFF1 3AYEA 1SBEA 1W8HA 1YQCA 3OBTA 1O59A 3AP6A 4WZCA 3O0WA 3WD5A 5KXEA 1VB4A 1UXZA 4HVOA 4GIQA 1RUOA 4LBQD 3D0SA 1SDDB 1JN2P 1SLLA 2Z69A 3MW2A 5FIXA 5K8SA 4SBVA 1XB9A 4W8JA 2VQAA 1JYWA 3VHOA 4LPLA 3CJXA 4BIFA 4QMAA 1Z7S3 4K9SA 1UKGA 2D43A 2C24A 3ACHA 1J59A 4JQTA 5FYSA 3UESA 3AZYA 4R9BA 5BNNB 5FTTC 4NAMA 2ATFA 3GF6A 4AHXA 2GU9A 4AAXA 2E32A 2QKDA 3N3HA 2P3KA 3J7HA 1UNBA 3U37A 4D7SA 2GH8A 3LSEA 5SV8A 1U5YA 1PO22 1CAXB 5L9BA 4JZRA 3INAA 1VAMA 2UURA 3ETPA 4XILA 4BQYA 5C9AC 1PO12 3BI3A 2VAUA 4QX0A 4ZHNA 1AR71 4QGMA 4NR1A 3VKLA 2ZEYA 1H9PA 2V73A 5BPXA 2Q4SA 4YG0A 4Y5TA 4CDWA 1WLCA 2J7MA 3AP9A 5F8PA 3ASIA 4QQHA 4JV4A 3VZLA 1QJY2 1S0BA 2CWMA 2RS31 5FY5A 4U2AA 2YUEA 4P9WA 4EN0A 4A6SA 3I3MA 2HWE2 2JG8B 1KJLA 2Y6FA 1I9RA 1YI7A 5FZOA 2PHFA 4Q1RA 3ZDVA 1FMD1 1UW8A 4XF1A 4YLZA 2D6MA 3HNBM 3E1F1 5A70A 3AMQA 4XJ9A 2WO1A 3UETA 5SV5A 1WD4A 4WM7C 4MSVA 4SLIA 1W8FA 4BHPA 4YG6A 3GYDA 3K4AA 2EAAA 3LCPA 2DBIA 2ETEA 1OOPB 3AMHA 3JCIA 4HZFA 4QXHA 4FPCA 4RFT0 3WG2A 3WW4A 5C70A 1ZZ8A 3RI9A 1LOFA 2WR9A 4Q4W3 4M3CE 2FD8A 2EIDA 5EJ3A 3AP7A 4XVHA 1ND3A 1OLMA 1HLCA 2LUWA 2VR4A 3AXDA 3SISA 2VBPA 4W6WA 4HMZA 3VN4A 2RS13 1N3OA 3DYOA 4P00B 2CHHA 2B42B 2D6KA 3KV5A 4IV3B 4RR3A 4TZDA 4CDXB 2VZUA 5D2AA 5F9TA 3JBG1 4RQPA 3SCHA 3UKVA 3MBWA 1KDKA 3M4FA 5FYIA 2PYTA 5I0UA 3A21A 1COV2 3KV9A 4DS0A 4R9AA 2ADDA 3ST7A 4B7KA 1TG7A 3MZHA 1PX3A 1RUD3 1WUVA 1ZZ6A 4YYOA 5B4XA 2DVAA 4LO7A 2JEMA 4ONUA 1A8DA 3CZUA 3NRUA 4DRVA 3LKJA 1H1IA 1VBB3 4O9GA 2R6QA 1W2NA 1VBE3 3NW4A 3DN7A 5AC93 1N1YA 4UW6A 5FYTA 2RE9A 4NMIA 3ZKYA 3IIAA 2HWB1 1HRI3 1P8JA 2PLV2 1Q43A 2R073 2JKBA 3V56A 1NG0A 3WF1A 2WQ8A 2Y34A 4CCDA 1YIFA 2B4KA 4AQ6A 1Y4WA 5IFTA 5HV0A 1QF3A 1AR61 1R092 2F6BA 3VZOA 3AL5A 3H42B 4CXYA 2PAKA 2VOWA 1JODA 1H1AA 4UT5A 3DEMA 3J7LA 1I5PA 3MGUA 5FXVA 1HRV3 5EJ1B 1PMJX 3KHBA 3FJSA 4M4PA 5DXDA 1J1LA 4AFMA 4B4QA 2GMEA 4LE3A 4CP9A 1S0GA 2WQZC 2Y64A 1YFYA 3VBOC 4RS5C 4N7UA 5GZEA 4XYXA 3H1YA 4LQRA 4AI3A 4S2HA 1VMHA 4ES8A 3ZN4A 4FO9A 4RL7A 5FLJA 1ZZ9A 4X8PA 5IK8A 2ARAA 3KGZA 2VE1A 2IC1A 2W08A 4QXCA 4XFCA 2R062 5FAXA 5JAXA 1ZBA2 2YFZA 4MHRA 2VOKA 5DABA 2ZGNA 2HWC2 4N9IA 1IG0A 1Z78A 1NT0A 1SLIA 4E8DA 2CSGA 1CZVA 3RZZA 1D4VB 1VJ2A 1OF4A 2XL9A 1QMJA 5A32B 4NE9A 4OFGA 1W2UA 3ZSMA 2EALA 4MG2A 1E5HA 5BUVA 1ZRFA 1JHJA 3VKOA 4CDQC 4DIQA 1RUF2 5BNQA 4W65A 3OBAA 1OUSA 4I30A 4CEWB 1TME3 3FN9A 1Y9GA 4C1WA 2BU9A 3QH6A 3CJIB 5FZ1A 4XBNA 3ZLIA 2OXBA 3HT1A 1ZBE3 3WEZA 3NV1A 3ZSJA 5F3EA 1K5MB 4COWA 3I2HA 5JSRA 1AHSA 3I2OA 1NE6A 1D2QA 4RGGA 2ZEZA 1JZ3A 4BQ5A 2CDOA 4GH4A 4UW4A 1LHVA 1ULGA 4Q1PA 5FJKA 1EUUA 1D4M3 2RHPA 2VBDA 1BBT3 1Z7S2 5I91A 4FFFA 2JB8A 5FREA 3ILRA 1NOVA 3KCYA 3HR9A 4QKFA 4U36A 3VKFC 4AI2A 4B4PA 4UBGA 5HPOA 2BOJA 1VBC2 5DAVA 5KXCA 1RHI2 2ADEA 5KWRA 2QUOA 2XUEA 4YW2A 5BNNA 3UT0A 3OGRA 1LB2A 5DZFA 1JZ2A 1SG3A 3OPWA 4Y5Z0 2ZX3A 4LIVA 1JUIA 5H9QA 4W50A 2E63A 1AF9A 1I6XA 2PHUA 5IK5A 2QE3A 3LDKA 4IEOA 3DYMA 4NROA 5F5IA 5FLHA 4GAZA 4AW7A 2FMDA 4D7YA 1U12A 1CAXA 1EV11 3VZMA 3ZMOA 5FPZA 4GB33 1W6PA 5LY2A 3WHTA 1NA1C 3GJBA 5CBLA 1ZRCA 3MI8A 5C9AB 3POGA 2I45A 1DBNA 3PJYA 1H8TC 2AH2A 1B35C 5FY0A 1V6JA 4Y1XA 1RVF2 2SLIA 3AC0A 5A6ZA 1L7RA 4NHKA 2RR11 4NIAA 1AYN2 1PK6A 2ORXA 1YLLA 4YFZA 4CDUA 4PF1A 2JG8A 3OOXA 4DMIA 2BBAA 4A41A 1ULCA 2GH2A 4CCCA 5HXVA 5FYZA 5FP7A 1UX7A 2WN3A 4ARYA 4JX0A 2CV6A 4W4ZA 1K45A 4QU1A 3WW3A 3I2IA 4UF0B 5LA2A 3PMEA 4P08A 1DGLA 4XQDA 5C8CB 1WCSA 3NNLA 2RS52 2X5IC 5A7QA 4AVCA 2VZOA 1UY4A 1KITA 2RG4A 3MUY1 2OVUA 2UWBA 3GHMA 1YQ6A 4PLOA 4PLMA 3VLBB 1XU2A 2MHFA 3B3QE 4AVVA 4HXCA 1BYHA 1APNA 2JDKA 3DPRA 3PVOA 4I09A 2UYAA 2GN3A 4I02A 1HB2A 1SLCA 3D8CA 4BQ2A 2RS12 4WVZA 1RMU1 5GZDA 1AUYA 1UAIA 1HV0A 3D0JA 3C7HA 4OUEA 1GMMA 4AEDC 1XYPA 2LW8A 2RJ2A 2DCYA 2OA2A 3MV01 3I7DA 3NNGA 2OUJA 3ZFFB 2XVKA 1AX0A 4K8RB 4BXFA 4QDSA 4C91A 1GLHA 2A1XA 3I3QA 4HPKB 1UWWA 1RUD2 2XBO2 3FLPA 5JZGA 1CQ9A 2XOMA 3MW3A 5DDJ1 4AVBA 1KRIA 3LEGA 2OX0A 3DYPA 3I2KA 1JUHA 3AYCA 2XMLA 2W5FA 4N53C 3S7IA 1VBB2 5DUVA 4H7MA 1POV0 1SACA 3G6JB 4M0NA 3WSOA 1VBE2 3WDUA 4R4XA 5GLUA 1JZ6A 4QDQA 1VBA2 3IPVB 1X36A 5FMCA 3FFQA 1HRI2 2R072 2B5HA 4Q4X3 2FCVA 1UYPA 3SEEA 4CRQA 5JR2A 4FAGA 2Q0AA 3OSDA 2YB7A 3HOBA 3U11A 4CCLA 1S1AA 4A7YA 1ODNA 5IAXA 5JCTA 4D94A 2HWF3 5IHRA 5CB7A 2B39A 4AVAA 3ZYGA 2PQQA 4HBNA 1VLNA 2KR2A 4ATFA 1PVXA 2YHJA 3M8LA 4J25A 2E7TA 2XLFA 5CAZA 1ULEA 4HONA 2IVIB 2LS6A 5E1RA 4MADA 1O3RA 1WW5A 2GP3A 3BTZA 1LOCA 2K2SA 4FI9A 3VBOB 2ZX0A 4RS5B 4UFLA 2TEPA 3BTYA 4MXVA 1C1FA 3N7KA 3PUAA 1UY1A 2QQLA 2WZEA 4XFAA 3WQBA 1LHWA 2DUQA 4Z2WA 5CKMA 4K20A 3LD8A 1XPWA 2EAKA 3O0VA 1ULPA 2EICA 3ACFA 5FZIA 2BGPA 1GZTA 3KHCA 2ZA9A 2VNOA 3NJVA 2QDRA 4LA3A 1SCRA 4EQVA 1V9U1 4QXBA 2HH9A 3WF3A 4ZXKA 2P2KA 5AVAA 2WNVB 3AZXA 4QPWA 5LBEA 1QJEA 4C8DA 3TN93 4LTAA 3ZYHA 1FAYA 1XNKA 4LMFA 5A32A 1W6OB 5A3WA 4UBHA 3KS7A 4QQLA 4FQ4A 2QZ2A 1L3JA 4TXWA 2JE8A 1PVC2 3J7MA 5T55A 3ZMNA 4CDQB 5GLZA 4IEYA 2W0XA 5FZMA 1TME2 3VHRA 4MGIE 1QDCA 1G8WA 3TOJA 2DCZA 1FOD3 1URXA 3ETQA 3S30A 4DNYA 5CFCB 4CPBD 1HW5A 1V6OA 1YQ5A 2XQXA 4XF3A 2AGSA 1OA4A 2UWCA 3ON7A 2WS91 3AX4A 4PQQA 1F4HA 1RIRA 1QJX3 3TEWA 3VBFC 5FUIA 5CA6A 3EQEA
chains in the Genus database with same CATH topology
2BZDA 3LE0A 2XHNA 2W91A 3I3EA 4A6OA 4BK5A 3SKJE 3C7FA 4XURA 3LEIA 1H6YA 1UY0A 1CZSA 1GOFA 1UYXA 3OEAA 1JZ5A 2W1UA 2C26A 4A44A 1W99A 3HN3A 3K77A 5LA1A 1DYOA 4LKSA 3VD4A 2C4XA 4KI5M 4AG4A 2VQUA 1JZ4A 2DCJA 2W46A 2YC4A 3WNPA 4UI9L 3ECQA 3GXUA 2Z4FA 1KEXA 2X09A 4DUVA 4P5YA 1NUKA 4A45A 5EIYB 2CDPA 3OB8A 3VDBA 2HYXA 4JKLA 2EIBA 3IB3A 1K42A 1L7QA 5CYYA 4QB2A 1NKGA 1GU3A 2ZXQA 2OKXA 4ZZ5A 4ET7A 3OEBA 3I3BA 2WAAA 3P6BA 3IAPA 5G05L 4ZZ8A 2DCKA 1DP0A 3CZJA 4A4AA 1BHGA 1SHWB 2YG0A 2VZ1A 3EB7A 2QQJA 5J1XA 1CZTA 4A42A 2VCAA 5F7UA 3SEPA 3VDAA 1HN1A 1UMHA 2WN2A 5JUVA 3PUIA 5C71A 2VZVA 3WNOA 1RYYA 3F2ZA 2V72A 3CKHA 3CIHA 4XUOA 3T0AA 3THDA 3T2OA 2YC2A 4UAPA 4QDRA 4DEVA 4QAWA 1TVGA 3W5MA 4DEQA 2VZPA 4Z2AA 3NJXA 3I2FA 1PX4A 1OT5A 3I2JA 3T08A 4CU6A 3A23A 5JXGA 5B4NA 3T2QA 2QBXA 3A7QA 5EJZB 1NAEA 5C7GA 1O59A 1YQ2A 1UXZA 4RYDA 2X10A 3WNMA 5IYYA 1SDDB 4RN5A 4W8JA 4DXRA 1JYWA 4LPLA 1US3A 2WBKA 2VQTA 3ACHA 1JZ8A 5LCWL 3K75B 3A22A 2J1SA 1IQDC 3UESA 2E31A 2WABA 4ARXA 4GWIA 4BK4A 2JDAA 2QQMA 4CU8A 2V5DA 2E32A 4M4RA 2ID4A 4AAXA 2VMEA 3HPNA 1F4AA 3GGLA 3J7HA 3MO4A 5IFPA 3U37A 5IJRA 1GOHA 4XUPA 3BGAA 2E26A 1O8PA 4QB1A 2ORZA 3ETPA 1UXXX 3HNYM 3LQCA 4QX0A 4BJ0A 4HG6B 3PUHA 2ZEYA 3K46A 1JZ7A 2J7MA 3WF0A 3T0DA 2Y6LA 2RVAA 4CU7A 4CU9A 3UNPA 5DN2A 4QX2A 2W1SA 2W9XA 3ACIA 3HNBM 2WAOA 2HLEA 3E1F1 3UETA 5JXIA 2WO1A 4QX3A 3NQHA 3K4AA 3WF2A 3VD7A 4MGSA 2VZTA 5C70A 4BXSV 2WYSA 2EIDA 4XVHA 2VR4A 3WNLA 1UZ0A 3DYOA 1K3IA 4P00B 2VZUA 4XUQA 3MBWA 5JXHA 3A21A 2VZRA 4QB6A 1TG7A 3IIIA 1PX3A 3IAQA 3GM8A 5B4XA 2W92A 1JU4A 1JU3A 2VO5A 5A1AA 3CZUA 3NRUA 4XUNA 1W8NA 2QQIA 1WKYA 2BERA 1P8JA 3WF1A 2WQ8A 1JYXA 2B4KA 4IUGA 4YPJA 5IFTA 1GQPA 1KGYA 2Y6KA 1CIYA 3ZM8A 3I97A 1I5PA 4LHSA 5EJ1B 1PMJX 1OD3A 2E33A 3OGSA 4M4PA 2YFUA 2VZQA 3EYPA 2Y64A 2VCCA 1O8SA 3I3DA 1UMIA 4LQRA 1K12A 2DDUA 2W3JA 2BGOA 3SKVA 1ULOA 4CVUA 3ABZA 5LA0A 3MV11 2W1QA 1MPXA 2YFZA 4E8DA 4MGQA 1CZVA 3HEIA 1CX1A 2RV9A 3I2GA 1OF4A 3THCA 2VJXA 1JHJA 3MUZ1 2C9KA 3OBAA 4KWUA 1UY2A 2ZEXA 1WCQA 3FN9A 4E8CA 4ZY9A 3T09A 2J1RA 3WEZA 3LEKA 3I2HA 3JXSA 4XZUG 1W8OA 2WUHA 2ZEZA 3T0BA 1GOGA 1JZ3A 1DLCA 2CDOA 3FHAA 1EUUA 4JKKA 5JMOA 2VL4A 5CZKA 4DUXA 5HPOA 2R7EB 4D0QA 5DQ0A 3FHQA 3OGRA 2X05A 3FL7A 2W47A 1JZ2A 1SG3A 1J84A 4W50A 4GWJA 4BDVB 3DYMA 1XC6A 2W95A 4CUAA 3LPFA 2W94A 2VZSA 3IDAA 5G04L 1OH4A 3VD9A 2XONA 3BN6A 5I0DA 2W1WA 2VOTA 3C8XA 1T2XA 2J22A 4D8MA 3AC0A 1L7RA 3WF4A 1UY3A 2ORXA 2J1VA 2QQKA 4MOAA 4PF1A 2QQNA 3VDCA 2BBAA 4A41A 3D3AA 4XUTA 2WO3A 4MO3M 1UX7A 2WN3A 4ARYA 4JX0A 1NX9A 1PMHX 4W4ZA 1K45A 3I2IA 5LA2A 4P08A 4DXTA 4TTGA 4JKMA 2VZOA 1UY4A 3W5NA 3VD5A 3MUY1 1W9WA 3VD3A 4OMDA 4DUWA 2JD9A 3C7HA 4OUEA 5HXMA 1GMMA 3HJRA 2LW8A 2RJ2A 2VMDA 3P1IA 2W87A 3OG2A 1R64A 3MV01 2WDBA 2Y6GA 2J1TA 3NNGA 4ZXEA 1OF3A 2Y8KA 1UYZA 5DPNA 4QDSA 4QX1A 1UWWA 2Y6HA 2XOMA 3LEGA 3I2KA 3DYPA 1XNAA 1W9SA 2W5FA 3LPGA 3WSOA 3CDZB 2VM9A 3K4DA 5DMYA 1JZ6A 4QDQA 4GZ9A 2VMCA 1GNYA 2WZ8A 2EIEA 2KD7A 1LNSA 4P02B 3SEEA 2B9VA 1JYNA 5JR2A 1US2A 4PT6A 2YB7A 3HOBA 3HNMA 2J1EA 1W9TA 3T2PA 4A3ZA 5IHRA 2ZEWA 2J1AA 4JHZA 1JI6A 4DXSA 4UOJA 3OGVA 4OMCA 2J1UA 2LS6A 4L0PA 4MADA 3CMGA 4FI9A 3CQOA 4OZOA 1UY1A 2V4VA 2QQLA 2WZEA 3WQBA 2WO2A 3K4ZA 1J83A 1XPWA 2QQOA 4OYUA 4KMQA 1ULPA 2EICA 3ACFA 1UYYA 2BGPA 3NJVA 3C7OA 1H6XA 2VZ3A 3WF3A 1XNTA 3WNKA 2VC9A 4QPWA 1D7PM 2JKXA 3WNNA 4CUBA 1JYVA 1GUIA 5JXJA 2PQSA 4TXWA 2JE8A 1W0NA 3GDBA 3C7GA 4CUCA 3C7EA 2Y6JA 3DECA 2L9LA 2XQXA 2VTFA 1EUTA 3ACGA 4PQQA 1F4HA 2VCBA 5FUIA 2VMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZD A;  3LE0 A;  2XHN A;  2W91 A;  3I3E A;  4A6O A;  4BK5 A;  3SKJ E;  3C7F A;  4XUR A;  3LEI A;  1H6Y A;  1UY0 A;  1CZS A;  1GOF A;  1UYX A;  3OEA A;  1JZ5 A;  2W1U A;  2C26 A;  4A44 A;  1W99 A;  3HN3 A;  3K77 A;  5LA1 A;  1DYO A;  4LKS A;  3VD4 A;  2C4X A;  4KI5 M;  4AG4 A;  2VQU A;  1JZ4 A;  2DCJ A;  2W46 A;  2YC4 A;  3WNP A;  4UI9 L;  3ECQ A;  3GXU A;  2Z4F A;  1KEX A;  2X09 A;  4DUV A;  4P5Y A;  1NUK A;  4A45 A;  5EIY B;  2CDP A;  3OB8 A;  3VDB A;  2HYX A;  4JKL A;  2EIB A;  3IB3 A;  1K42 A;  1L7Q A;  5CYY A;  4QB2 A;  1NKG A;  1GU3 A;  2ZXQ A;  2OKX A;  4ZZ5 A;  4ET7 A;  3OEB A;  3I3B A;  2WAA A;  3P6B A;  3IAP A;  5G05 L;  4ZZ8 A;  2DCK A;  1DP0 A;  3CZJ A;  4A4A A;  1BHG A;  1SHW B;  2YG0 A;  2VZ1 A;  3EB7 A;  2QQJ A;  5J1X A;  1CZT A;  4A42 A;  2VCA A;  5F7U A;  3SEP A;  3VDA A;  1HN1 A;  1UMH A;  2WN2 A;  5JUV A;  3PUI A;  5C71 A;  2VZV A;  3WNO A;  1RYY A;  3F2Z A;  2V72 A;  3CKH A;  3CIH A;  4XUO A;  3T0A A;  3THD A;  3T2O A;  2YC2 A;  4UAP A;  4QDR A;  4DEV A;  4QAW A;  1TVG A;  3W5M A;  4DEQ A;  2VZP A;  4Z2A A;  3NJX A;  3I2F A;  1PX4 A;  1OT5 A;  3I2J A;  3T08 A;  4CU6 A;  3A23 A;  5JXG A;  5B4N A;  3T2Q A;  2QBX A;  3A7Q A;  5EJZ B;  1NAE A;  5C7G A;  1O59 A;  1YQ2 A;  1UXZ A;  4RYD A;  2X10 A;  3WNM A;  5IYY A;  1SDD B;  4RN5 A;  4W8J A;  4DXR A;  1JYW A;  4LPL A;  1US3 A;  2WBK A;  2VQT A;  3ACH A;  1JZ8 A;  5LCW L;  3K75 B;  3A22 A;  2J1S A;  1IQD C;  3UES A;  2E31 A;  2WAB A;  4ARX A;  4GWI A;  4BK4 A;  2JDA A;  2QQM A;  4CU8 A;  2V5D A;  2E32 A;  4M4R A;  2ID4 A;  4AAX A;  2VME A;  3HPN A;  1F4A A;  3GGL A;  3J7H A;  3MO4 A;  5IFP A;  3U37 A;  5IJR A;  1GOH A;  4XUP A;  3BGA A;  2E26 A;  1O8P A;  4QB1 A;  2ORZ A;  3ETP A;  1UXX X;  3HNY M;  3LQC A;  4QX0 A;  4BJ0 A;  4HG6 B;  3PUH A;  2ZEY A;  3K46 A;  1JZ7 A;  2J7M A;  3WF0 A;  3T0D A;  2Y6L A;  2RVA A;  4CU7 A;  4CU9 A;  3UNP A;  5DN2 A;  4QX2 A;  2W1S A;  2W9X A;  3ACI A;  3HNB M;  2WAO A;  2HLE A;  3E1F 1;  3UET A;  5JXI A;  2WO1 A;  4QX3 A;  3NQH A;  3K4A A;  3WF2 A;  3VD7 A;  4MGS A;  2VZT A;  5C70 A;  4BXS V;  2WYS A;  2EID A;  4XVH A;  2VR4 A;  3WNL A;  1UZ0 A;  3DYO A;  1K3I A;  4P00 B;  2VZU A;  4XUQ A;  3MBW A;  5JXH A;  3A21 A;  2VZR A;  4QB6 A;  1TG7 A;  3III A;  1PX3 A;  3IAQ A;  3GM8 A;  5B4X A;  2W92 A;  1JU4 A;  1JU3 A;  2VO5 A;  5A1A A;  3CZU A;  3NRU A;  4XUN A;  1W8N A;  2QQI A;  1WKY A;  2BER A;  1P8J A;  3WF1 A;  2WQ8 A;  1JYX A;  2B4K A;  4IUG A;  4YPJ A;  5IFT A;  1GQP A;  1KGY A;  2Y6K A;  1CIY A;  3ZM8 A;  3I97 A;  1I5P A;  4LHS A;  5EJ1 B;  1PMJ X;  1OD3 A;  2E33 A;  3OGS A;  4M4P A;  2YFU A;  2VZQ A;  3EYP A;  2Y64 A;  2VCC A;  1O8S A;  3I3D A;  1UMI A;  4LQR A;  1K12 A;  2DDU A;  2W3J A;  2BGO A;  3SKV A;  1ULO A;  4CVU A;  3ABZ A;  5LA0 A;  3MV1 1;  2W1Q A;  1MPX A;  2YFZ A;  4E8D A;  4MGQ A;  1CZV A;  3HEI A;  1CX1 A;  2RV9 A;  3I2G A;  1OF4 A;  3THC A;  2VJX A;  1JHJ A;  3MUZ 1;  2C9K A;  3OBA A;  4KWU A;  1UY2 A;  2ZEX A;  1WCQ A;  3FN9 A;  4E8C A;  4ZY9 A;  3T09 A;  2J1R A;  3WEZ A;  3LEK A;  3I2H A;  3JXS A;  4XZU G;  1W8O A;  2WUH A;  2ZEZ A;  3T0B A;  1GOG A;  1JZ3 A;  1DLC A;  2CDO A;  3FHA A;  1EUU A;  4JKK A;  5JMO A;  2VL4 A;  5CZK A;  4DUX A;  5HPO A;  2R7E B;  4D0Q A;  5DQ0 A;  3FHQ A;  3OGR A;  2X05 A;  3FL7 A;  2W47 A;  1JZ2 A;  1SG3 A;  1J84 A;  4W50 A;  4GWJ A;  4BDV B;  3DYM A;  1XC6 A;  2W95 A;  4CUA A;  3LPF A;  2W94 A;  2VZS A;  3IDA A;  5G04 L;  1OH4 A;  3VD9 A;  2XON A;  3BN6 A;  5I0D A;  2W1W A;  2VOT A;  3C8X A;  1T2X A;  2J22 A;  4D8M A;  3AC0 A;  1L7R A;  3WF4 A;  1UY3 A;  2ORX A;  2J1V A;  2QQK A;  4MOA A;  4PF1 A;  2QQN A;  3VDC A;  2BBA A;  4A41 A;  3D3A A;  4XUT A;  2WO3 A;  4MO3 M;  1UX7 A;  2WN3 A;  4ARY A;  4JX0 A;  1NX9 A;  1PMH X;  4W4Z A;  1K45 A;  3I2I A;  5LA2 A;  4P08 A;  4DXT A;  4TTG A;  4JKM A;  2VZO A;  1UY4 A;  3W5N A;  3VD5 A;  3MUY 1;  1W9W A;  3VD3 A;  4OMD A;  4DUW A;  2JD9 A;  3C7H A;  4OUE A;  5HXM A;  1GMM A;  3HJR A;  2LW8 A;  2RJ2 A;  2VMD A;  3P1I A;  2W87 A;  3OG2 A;  1R64 A;  3MV0 1;  2WDB A;  2Y6G A;  2J1T A;  3NNG A;  4ZXE A;  1OF3 A;  2Y8K A;  1UYZ A;  5DPN A;  4QDS A;  4QX1 A;  1UWW A;  2Y6H A;  2XOM A;  3LEG A;  3I2K A;  3DYP A;  1XNA A;  1W9S A;  2W5F A;  3LPG A;  3WSO A;  3CDZ B;  2VM9 A;  3K4D A;  5DMY A;  1JZ6 A;  4QDQ A;  4GZ9 A;  2VMC A;  1GNY A;  2WZ8 A;  2EIE A;  2KD7 A;  1LNS A;  4P02 B;  3SEE A;  2B9V A;  1JYN A;  5JR2 A;  1US2 A;  4PT6 A;  2YB7 A;  3HOB A;  3HNM A;  2J1E A;  1W9T A;  3T2P A;  4A3Z A;  5IHR A;  2ZEW A;  2J1A A;  4JHZ A;  1JI6 A;  4DXS A;  4UOJ A;  3OGV A;  4OMC A;  2J1U A;  2LS6 A;  4L0P A;  4MAD A;  3CMG A;  4FI9 A;  3CQO A;  4OZO A;  1UY1 A;  2V4V A;  2QQL A;  2WZE A;  3WQB A;  2WO2 A;  3K4Z A;  1J83 A;  1XPW A;  2QQO A;  4OYU A;  4KMQ A;  1ULP A;  2EIC A;  3ACF A;  1UYY A;  2BGP A;  3NJV A;  3C7O A;  1H6X A;  2VZ3 A;  3WF3 A;  1XNT A;  3WNK A;  2VC9 A;  4QPW A;  1D7P M;  2JKX A;  3WNN A;  4CUB A;  1JYV A;  1GUI A;  5JXJ A;  2PQS A;  4TXW A;  2JE8 A;  1W0N A;  3GDB A;  3C7G A;  4CUC A;  3C7E A;  2Y6J A;  3DEC A;  2L9L A;  2XQX A;  2VTF A;  1EUT A;  3ACG A;  4PQQ A;  1F4H A;  2VCB A;  5FUI A;  2VMF A; 
#chains in the Genus database with same CATH topology
 3RDI A;  3POW A;  1D4M 2;  3N9L A;  1WCU A;  5ACA 1;  3NO8 A;  3VBH C;  3E6B A;  4BK5 A;  4YGB A;  5HV4 A;  2PHD A;  1LEM A;  4I2O A;  4LNV A;  1D2S A;  1CZS A;  4AGR A;  4FTB A;  5DG1 A;  3OEA A;  5CAD A;  2QFE A;  2W1U A;  4GMP 3;  4BWO A;  2C26 A;  3SHR A;  2LM3 A;  2FDF A;  2BBV A;  1KDM A;  3MHZ A;  3N9N A;  4I3G A;  1POV 1;  4EV0 A;  1OKQ A;  3CU7 A;  4BM8 A;  1OVP A;  1W05 A;  4BQ1 A;  2ZZQ A;  3GAL A;  4A44 A;  1XXN A;  4JRL A;  1IKQ A;  2XB6 C;  1DYO A;  1REF A;  1OVS A;  4L8Q A;  3THT A;  5JOY A;  4QPG B;  2DCJ A;  4AEK A;  1WMX A;  1T6B X;  4CCK A;  4BQX A;  3KF3 A;  3GXU A;  4XTM A;  3I2D A;  3N9M A;  4LBO A;  3WZ1 A;  3OYW A;  4HAN A;  3BB6 A;  2BYV E;  3J8F 1;  5D8A C;  1ENQ A;  3HD8 B;  3NKT A;  4DUV A;  4P5Y A;  5C9A A;  5K9Y A;  4CCO A;  1TQ5 A;  3UYJ A;  3SCF A;  5EIY B;  1B35 B;  2CDP A;  4Q4Y 1;  3BAL A;  2HYX A;  4YVW C;  1RUH 1;  2EIB A;  2GP5 A;  1K42 A;  3FUO A;  1OBN A;  2XG3 A;  2EXH A;  2QZ3 A;  3WDT A;  3A4U A;  2DFC A;  4OHY A;  4PIX A;  1GU3 A;  1MR5 A;  5J09 A;  4MLO A;  2OKX A;  1H4G A;  1DGW X;  3K2O A;  1WCD J;  1NZC A;  3QCW A;  4F8A A;  3LGR A;  4WM7 A;  1RUC 1;  2WAA A;  2ZZJ A;  3AB0 A;  1RED A;  2X5I B;  2JDP A;  2ZAB A;  5G05 L;  5FDB A;  1AL2 3;  1UMZ A;  3T4V A;  1CJD A;  1HQL A;  5BY5 A;  3KT4 A;  4A4A A;  1BHG A;  1BEV 3;  3E5U A;  5C33 A;  5HI0 A;  2VZ1 A;  4NHL A;  2QQJ A;  4LJH A;  4O61 A;  3URF A;  5FYV A;  3UGG A;  1KFU L;  5BNO C;  4NVP A;  5J1X A;  3CF6 E;  4HLT A;  1UD1 A;  1CAV A;  3GBF A;  5EXO A;  1SFY A;  1LOD A;  3ELN A;  3RMX A;  4AED B;  3HN1 A;  4AK3 A;  5FZH A;  1PGS A;  5KXB A;  1WW4 A;  2FDG A;  2P1B A;  1QXP A;  1RYY A;  3W58 A;  3RJR A;  5IVB A;  4KQ7 A;  4HVQ A;  3THD A;  4XTP A;  1O5L A;  3FLT A;  3FX3 A;  3T2O A;  1NE4 A;  3UKT A;  2RM2 3;  2OQ7 A;  2E53 A;  2KXL A;  5E88 A;  1HN0 A;  2G4I A;  5FPX A;  5FYM A;  3N36 A;  4YZ4 A;  4N53 B;  4COV A;  3HBK A;  4XJZ A;  5C3Q A;  2BVV A;  3VL8 A;  4P9I A;  2VZP A;  4XET A;  3TEX A;  3JB8 A;  1MAC A;  1SFN A;  1U5X A;  2G9Z A;  4ZU4 A;  1PIV 1;  3U75 A;  3WP5 A;  3ZIW A;  4AR2 A;  1KFX L;  5HBA A;  5F3I A;  1A34 A;  1UO9 A;  1PM7 A;  2K9Z A;  2HWF 2;  4NWV A;  3WP3 A;  2VMH A;  3N35 A;  4IL7 A;  1E5I A;  5H9R A;  1LRH A;  1CWP A;  4NIG A;  3THP A;  3O12 A;  1XU1 A;  3AL6 A;  4QQ2 A;  2B8M A;  4DFS A;  3FBY A;  3TAY A;  2TNF A;  1BJQ A;  5LW9 A;  4RYD A;  5F32 A;  5K7P A;  2Q1Z B;  4LBK A;  5EFU A;  1C8M 3;  4XAC A;  2BRT A;  1W6M B;  1XBF A;  1W9Y A;  4UFH A;  1LKN A;  2D3R A;  4RN5 A;  2P4E A;  5I8Y A;  4DXR A;  4YGD A;  5DG2 A;  3VBO A;  1US3 A;  2WBK A;  2ZX1 A;  3IMM A;  4QD2 A;  4RS5 A;  1W8U A;  2P3Y A;  1OPO A;  3A0K A;  5F37 A;  3P5B A;  3GZT B;  3A22 A;  4E27 A;  3POJ A;  5JR7 B;  2E31 A;  1NQJ A;  2YPJ A;  2WAB A;  3OGJ A;  3KVB A;  3PJQ A;  4GWI A;  3NV3 A;  2IVJ A;  2WIN B;  1HXS 1;  4PF5 A;  4W6Y A;  2QQM A;  4CU8 A;  1OLM E;  3HPN A;  1F4A A;  1AXZ A;  3N9O A;  2YBS A;  4LHK A;  4Y5S A;  4XUP A;  5K0U B;  5ABJ B;  1S0I A;  5FY4 A;  4UW5 A;  2VTX J;  1OOP C;  4QB1 A;  2ORZ A;  2NQY A;  4YVS B;  1KS5 A;  2Q1M A;  3HNY M;  1MQT B;  3LQC A;  4FXK B;  4MVT A;  5I0T A;  1BK1 A;  4HG6 B;  3RG0 A;  1LJ7 A;  3PUH A;  4FXG B;  4CDQ A;  3K46 A;  5CNA A;  2WZR 1;  3AP4 A;  1JZ7 A;  4LO8 A;  4Q5O A;  3R05 A;  3UJO A;  4XJ8 A;  3DGT A;  1WZX A;  2DU1 A;  1YUD A;  3AVS A;  3CEW A;  4CCE A;  3KQ4 B;  1QJX 2;  4IV3 C;  3PUQ A;  5A3U A;  4CDX C;  3B69 A;  5IAT A;  2GNB A;  1RUI 1;  3VDD A;  2HEW F;  3W20 A;  1ZNP A;  2WAO A;  1PGW 2;  5FXX A;  3VBF B;  4JRA A;  4NRQ A;  4R52 A;  4PDW B;  4QX3 A;  2AEN A;  1S2E A;  3E97 A;  3SQO A;  4BQ3 A;  1VMJ A;  3AK0 A;  3GBG A;  4F83 A;  4MGZ E;  3FLR A;  4YW3 A;  1CD3 G;  1TMF 3;  3VBH B;  4C0B A;  1SBF A;  1LGB A;  1DU3 D;  1SLA A;  3ITQ A;  2FMY A;  4IW3 A;  4BXS V;  1O7F A;  2P6H A;  4HK8 A;  1JOP A;  2VY0 A;  5LA9 A;  5IT6 A;  4V2V A;  4FTE A;  1ULF A;  2O14 A;  3B9C A;  2P34 A;  4XDO A;  4ZU7 A;  1IZ3 A;  3SXW A;  3WNL A;  2H6B A;  2RJL A;  2WFF 3;  3B7M A;  3BUC A;  3NVC A;  3VGI A;  5IVJ A;  3KCX A;  1V6K A;  4QQP A;  1QJF A;  2PAE A;  4QPI A;  2I2S A;  2ZAH A;  2RDR A;  1G9C A;  4QGL A;  4PI2 A;  2A6Y A;  2ET1 A;  2DBN A;  4YM1 A;  4MXW B;  3III A;  1NA1 A;  5CU1 A;  2ZML A;  3O1T A;  4CP0 A;  1OSG A;  4FPO B;  5FMO S;  3AZW A;  1OQ1 A;  1PO2 1;  5L9R A;  1H8T A;  3VHP A;  4QX8 A;  1B35 A;  4NHM A;  4OHZ A;  3RYP A;  3DKW A;  3PVN A;  1PO1 1;  3R4U A;  2CTV A;  1W8N A;  4EWA A;  2P3J A;  1WKY A;  2GNT A;  3RPQ A;  1DGW A;  4E2S A;  3O1V A;  1JYX A;  4IUG A;  2Q8E A;  1QJY 1;  1AR8 2;  5FPU A;  4PIY A;  4FFG A;  1UPI A;  1V6I A;  1DZQ A;  2HWE 1;  3I97 A;  1W28 A;  4CP2 A;  1AL2 2;  2X5I A;  4LHS A;  4Q4V 1;  3QH7 A;  4YRD A;  2GC1 A;  3ROU A;  1Q56 A;  2E33 A;  4ERO A;  1AR7 3;  3W59 A;  2YFU A;  3BCW A;  4PI0 A;  3QLQ A;  3WDV A;  1G9D A;  2PTM A;  1ENX A;  3I3D A;  1W6N B;  3ZYP A;  3H8R A;  1K12 A;  2WNU C;  4XJW A;  3V0A A;  1LGC A;  1UCX A;  1H4H A;  4CEW C;  1MS0 A;  4ORF A;  1DQ1 A;  2XH6 A;  3MFA A;  3K48 A;  1RIT A;  1VRH 1;  5BNO B;  3SKV A;  1ULO A;  3WW2 A;  5A3P A;  4CVU A;  1FMD 3;  3MIG A;  4Y4R A;  2RMU 2;  3Q8C A;  4AED A;  4CEY B;  4GKX A;  4PHZ A;  3MV1 1;  4JHT A;  2YU1 A;  2YBP A;  2ZAA A;  3WLU A;  3K51 A;  2GZW A;  1NCR A;  4AEM A;  3HQR A;  3HEI A;  5A7N A;  4MGK E;  1CX1 A;  5F3G A;  2ARC A;  2VJX A;  3H3U A;  3M3I A;  3WR0 A;  4YW4 A;  1COV 1;  2VMI A;  1JYI A;  3PMS A;  3CHX A;  2Y60 A;  1O91 A;  3O1R A;  3KM5 A;  4Y22 B;  1X7N A;  1YFX A;  4KWU A;  1DQ0 A;  1WCQ A;  3CLP A;  1HJG A;  4E8C A;  3RZM A;  2V4A A;  2WNO A;  5CIR A;  5JMC A;  3BIE A;  2DTY A;  3JBG 3;  1HIX A;  1S0E A;  2PLV 1;  3JXS A;  1GV9 A;  4OCT A;  4XZU G;  1J3R A;  4XBQ A;  1MS3 A;  1W8O A;  5FR3 A;  5FZE A;  1IS5 A;  3D82 A;  1DLC A;  2ZKL A;  1W6M A;  1DQ4 A;  1R09 1;  4XAA A;  1SMV A;  2YZ4 A;  3KT7 A;  1RUG 2;  4IV1 C;  1ONA A;  3HQX A;  5FZA A;  5CZK A;  2YV8 A;  1H2M A;  4KG0 A;  2W52 A;  2HWB 3;  2XUM A;  4QQO A;  1H30 A;  1QXJ A;  2R7E B;  1ZA7 A;  5DQ0 A;  4JTO A;  1ZM1 A;  5FCC A;  5CFD B;  2WJS A;  1W39 A;  3ZSE A;  3NMB A;  3WUC A;  1AR6 3;  1XYO A;  2W47 A;  3FL7 A;  4LE4 A;  5IVC A;  4UFK A;  3CNA A;  5A3O A;  1WA6 X;  4IE7 A;  3HQU A;  2VEC A;  2GMM A;  3SIT A;  4BDV B;  5GZG A;  1F2N A;  3VV1 A;  4ZS2 A;  3EJK A;  2W94 A;  2VZS A;  3IDA A;  5C8C C;  1F31 A;  3Q9O A;  4JGZ A;  4AHZ A;  3PL0 A;  3DKQ A;  2P6C A;  3M7A A;  5APA A;  4LHL A;  2W1W A;  2ZGU A;  4B4R A;  1QQP 3;  2HWC 1;  2VOT A;  2YY1 A;  3Q8B A;  4BQ4 A;  5A33 A;  2J22 A;  3AKT A;  3E5Q A;  1OXC A;  5HCF A;  1HB1 A;  4WVW A;  1SBD A;  4XHB A;  5IVY A;  4AE2 A;  1OLR A;  2PA7 A;  4LBN A;  1UY3 A;  3VL9 A;  4XJU A;  2J1V A;  4FTS A;  2QQK A;  3PIJ A;  3O1M A;  2ZHK A;  3VDC A;  3EHK A;  1LHU A;  4K3U A;  4S2D A;  1OI6 A;  4HT1 T;  2LRO A;  3D3A A;  4FPH A;  4XUT A;  2WO3 A;  2QVS B;  5F6L B;  4GJZ A;  3NWK A;  3BTA A;  4Y20 A;  3M3E A;  3ZFF C;  3VBF A;  3USU B;  1CON A;  4LK6 A;  3WP6 A;  4G9S B;  4NIH A;  4AVS A;  2G9G A;  2FQP A;  4FOV A;  1TMF 2;  1PGL 2;  4JKM A;  1Q8V A;  3O14 A;  5AVP A;  1DLL A;  1GP4 A;  3VD5 A;  1M06 G;  2FDJ A;  2MEV 1;  5DUU A;  3ZN6 B;  1MVE A;  3LWC A;  3U4X A;  3RZG A;  5GAL A;  1OQD A;  1RB8 G;  1HB4 A;  3NL1 A;  1RUJ 2;  4LOS A;  1ZYB A;  4LO6 B;  4F3J A;  4DUW A;  5D1I A;  2VNV A;  1QU0 A;  2ZX4 A;  3LAG A;  3HJR A;  1UOB A;  1VBC 1;  4IEU A;  1RHI 1;  4ATE A;  2OUH A;  1R64 A;  3OG2 A;  1OHF A;  2WDB A;  3POY A;  2AR6 A;  3RJ2 X;  2CAU A;  2ENR A;  1NY7 1;  1SPP B;  1SDW A;  4PLN A;  1OF3 A;  4ZS3 A;  5FYU A;  4AEJ A;  4ZKT B;  2SBA A;  5CEH A;  4QX7 A;  4J1X A;  1BKZ A;  1R1A 2;  4QX1 A;  1YFW A;  5FMD A;  4M3C B;  3POF A;  3RZH A;  4FPF A;  4MXW A;  5FRA A;  5FP3 A;  1E5R A;  1ZZC A;  1AR9 1;  3AXE A;  4BA6 A;  1WD3 A;  5D8A A;  1RUE 1;  1LGN A;  3IT8 A;  2VU9 A;  1CAW B;  3CDZ B;  2B7Y A;  4LK7 A;  2YBK A;  3K4D A;  1QQP 1;  5DMY A;  2VMC A;  4HN1 A;  1IS3 A;  4Y24 A;  4YVW A;  2EIE A;  3UKN A;  3VZN A;  1LNS A;  4HVR A;  4P02 B;  2B9V A;  1RVF 1;  3JD7 1;  2ZAC A;  4PT6 A;  1AYN 1;  1G9F A;  4B1L A;  2O8Q A;  5FMB A;  1Q8P A;  3AMP A;  3WNX A;  5I8S A;  4FFI A;  3OGG A;  4TLF A;  3T2P A;  4A3Z A;  2WNV C;  1EV1 3;  1C1L A;  4N43 B;  5JOW A;  4L97 A;  2EXK A;  4JHZ A;  4FBF A;  1YFU A;  1JI6 A;  3K3N A;  4MET A;  3WIN E;  1DDL A;  2BJS A;  3OUH A;  4RHV 1;  2C6S A;  2Q1F A;  1UL9 A;  3EO6 A;  1JYT A;  5BNP C;  5FK8 A;  4NO4 A;  4AGV A;  1GZW A;  1Q5O A;  3M3O A;  2RS5 1;  2RR1 3;  2RS3 2;  1QJU 2;  1WW7 A;  3NV2 A;  3CQO A;  1ND2 A;  4XQ4 A;  3WOG A;  4XFG A;  2VUD A;  3WCS A;  1GBG A;  4YGC A;  2FBE A;  3VKM A;  1SZB A;  3ZFE B;  2WNU B;  5BNO A;  5CFC C;  3I59 A;  3NJY A;  5EP9 A;  2QJV A;  4E4S A;  5A3M A;  4HL0 A;  3MPB A;  4OYU A;  4KMQ A;  5KC5 A;  1AVB A;  1J3Q A;  1U0A A;  2EXJ A;  4JCK A;  1H1M A;  5DZE A;  1XNT A;  3HBZ A;  3IWZ A;  3KLS A;  1D7P M;  4P9Y A;  3T1M A;  5I8T A;  2ZBJ A;  2JKX A;  1LEN A;  2CYF A;  2O1Q A;  1OFS A;  1MZF A;  1ENR A;  2C0Z A;  3PVB B;  4RSU A;  2XKO A;  2VVE A;  4KWK A;  4CUB A;  1JYV A;  4LOT A;  1GUI A;  2BQP A;  1JHN A;  1S0C A;  2ZGK A;  2PHL A;  4AQS A;  2XBO 1;  2CY6 A;  1WW6 A;  1PMI A;  3ES1 A;  1CPN A;  4Y22 A;  1RMU 3;  4GQ7 A;  1G6N A;  4QT6 A;  4CUC A;  5FY9 A;  4NRP A;  2VTX A;  4D3W A;  1S0D A;  1J58 A;  5A7S A;  2Y6J A;  4FP2 A;  4QHO A;  2VPV A;  2WT0 A;  1C5I A;  1FNY A;  2L9L A;  2VTF A;  2XJV A;  1IQA A;  3ACG A;  3ZFG B;  2JG9 B;  3LOB A;  5A7P A;  1RUN A;  1UZW A;  1BLZ A;  2A3W A;  4QPG C;  5KBF A;  5DDJ 3;  2BZD A;  2BPA 2;  4B8E A;  3IMN A;  1YHF A;  2W91 A;  3LFI A;  2WRA A;  4A6O A;  4IEW A;  5FBJ A;  2EXI A;  3O1P A;  2ARE A;  3C7F A;  4AFD A;  1WMD A;  2A6X A;  4IV1 B;  4GD4 A;  1VMF A;  2D7F A;  1JW6 A;  4WBB A;  1GWM A;  1GOF A;  2A7A A;  4FCA A;  2Y38 A;  2A5Z A;  2GAL A;  3IDC B;  5A6Q A;  3WG1 A;  4DY5 A;  3RS6 A;  2YGM A;  4OUM A;  1ZVF A;  3KQR A;  3HN3 A;  1XQN A;  4OHV A;  1FI2 A;  1NCQ B;  5A7O A;  4BCU A;  3VD4 A;  1PZ7 A;  4URA A;  2C4X A;  1JOJ A;  1FNZ A;  3NNJ A;  4QHZ A;  2W46 A;  2YC4 A;  4F7Z A;  5IVF A;  1ST8 A;  4PJY A;  2Z4F A;  4O7X A;  1POQ A;  1OOP A;  4XC9 A;  1KEX A;  4QWN A;  1GFF 2;  1NUK A;  3V65 A;  4Q4W 2;  2ZMK A;  2NZ9 A;  4AWD A;  2QQW A;  3VDB A;  3J7N A;  1UQX A;  4JKL A;  4GA9 A;  1PVC 1;  3IB3 A;  4EN9 B;  1V9U 3;  3E6D A;  1XNC A;  2B9U A;  5CYY A;  1NKG A;  4IV3 A;  4AI8 A;  3AYD A;  2VBB A;  4CDX A;  5I93 A;  3USU A;  4LIU A;  4M0H A;  2YXS A;  1AXY A;  2ARB A;  3AZZ A;  3FFZ A;  4ZZ5 A;  3B9I A;  4O9E A;  4OZX A;  4EN8 B;  1OLQ A;  1RXG A;  3KSC A;  1V6L A;  3H8U A;  1F5F A;  4GWN A;  2JDH A;  2ZGR A;  2VD7 A;  2ZKN A;  3LA7 A;  1AYM 1;  4UFI A;  5AC9 2;  1TNF A;  2WS9 3;  1CZT A;  5FMO L;  2OW4 A;  5FZ9 A;  4LO4 B;  3VDA A;  2WN2 A;  3IKW A;  4DXZ A;  1MEC 1;  2R49 A;  4UFM A;  4Y4Y A;  1PM4 A;  1SEF A;  5FYC A;  2VZV A;  4HOO A;  3RNS A;  3AFG A;  4YW7 A;  5ACA 3;  3CKH A;  3CIH A;  1IPJ A;  4JAA A;  5CKQ A;  1ZRR A;  2CWS A;  2H0B A;  1G7Y A;  2E6V A;  2OQ6 A;  2YC2 A;  2BGC A;  3F95 A;  1HRV 2;  3WVJ A;  3ZX7 A;  3GHN A;  2BNN A;  4FPJ A;  4DEV A;  1LES A;  5C6C A;  2GSY A;  3U10 A;  4WVM B;  5T54 A;  3ZR6 A;  1KXG A;  1FT9 A;  1QY4 A;  5JLV A;  2GMP A;  1JXN A;  1JTZ X;  4XIO A;  3WQ0 A;  1AJK A;  1POV 3;  1U5Z A;  4HET A;  4QHB A;  2NM1 A;  3KCC A;  4DOU A;  2YRO A;  2QDN A;  4RD7 A;  4Z2A A;  3T3Y A;  3NJX A;  5LZ6 A;  3I2F A;  1PX4 A;  1ASJ 1;  3B02 A;  3T08 A;  2FCT A;  4IGO A;  4XPV A;  4NN0 A;  5JXG A;  1EV1 2;  4AL9 A;  1QWR A;  2WL1 A;  4QGN A;  3IBM A;  3L2H A;  4XMI A;  2FDK A;  1JMU B;  1C3H A;  2R04 1;  2R0H A;  1NAE A;  5C7G A;  2F4L A;  1BMV 1;  2OZJ A;  3POS A;  2ZJC A;  1X8M A;  5FZ4 A;  1IPK A;  1GQG A;  2K0G A;  2VW1 A;  2X10 A;  1W0P A;  3J8F 3;  4H3W A;  4X6R B;  5T5O A;  3WNM A;  5K0U C;  2IUW A;  5ABJ C;  5IYY A;  5KHK A;  3BKZ A;  3WDY A;  3O0X A;  3ZSL A;  2P37 A;  3ZXG A;  5BNP B;  4Q4Y 3;  4YM0 A;  4YVS C;  3MFC A;  2MNG A;  1MQT C;  5CIS A;  1RUH 3;  5FZD A;  3H7J A;  2VQT A;  1MS1 A;  3FZ3 A;  5LCW L;  1MZ5 A;  2W39 A;  3K75 B;  4CEW A;  5M0T A;  1EY2 A;  2J1S A;  4MYE A;  1NYW A;  4ARX A;  3CJI A;  4KGG A;  1V00 A;  1Z0H A;  3WT3 A;  1ZBE 2;  3QAC A;  2Y33 A;  3HIF A;  4EJR A;  4HK9 A;  2DF7 A;  4KL1 A;  4YZ3 A;  4CA9 A;  4M4R A;  1K5M A;  1R08 1;  1RUC 3;  1S2K A;  1UIJ A;  2HEY F;  5HCA A;  1W04 A;  5IFP A;  4AF9 A;  4PDW C;  4UWD A;  3NNM A;  3NKG A;  1O8P A;  1BBT 2;  1UXX X;  1OUR A;  1LOF C;  2V09 A;  1VBD 1;  1ZZ7 A;  1EAH 1;  4XDQ A;  1UZZ A;  1O3S A;  2XR4 A;  1F8V A;  1W8T A;  3KGL A;  3U4S A;  4A3X A;  3GNE A;  3WF0 A;  5L19 A;  2WWJ A;  3T0D A;  2IXL A;  2Y6L A;  4H14 A;  4CU7 A;  4CU9 A;  3UNP A;  4CYD A;  2ET7 A;  2EVX A;  4QX2 A;  4URT A;  2W1S A;  5DN2 A;  5A7W B;  2GNM A;  4WM8 B;  2W9X A;  4TSV A;  1QJZ A;  3KF5 A;  1IPS A;  2Y0I A;  5H9S A;  3OY8 B;  4OUS A;  2HLE A;  3A0N A;  1YXW A;  5FP4 A;  1CAU B;  1RC6 A;  2JDM A;  2JDN A;  5LBB A;  2VW0 A;  4GB3 2;  2R32 A;  5FKC A;  3NQH A;  3WF2 A;  4AOC A;  4Q8K A;  1C8N A;  1LOG A;  1F35 A;  4MGS A;  4TN7 A;  4IV1 A;  3EBR A;  5F3C A;  4JQR A;  2RDN A;  5FPA A;  1VAK A;  1PIV 3;  3M3C A;  5HCH A;  4Y3O A;  1JBC A;  2ILM A;  4XIK A;  3OBR A;  5CG8 A;  4PIZ A;  1FV2 A;  1K3I A;  2PHR A;  2HWD 1;  4YZ1 A;  3N7L A;  1QH6 A;  5BV6 A;  5FZF A;  1C5H A;  4XUQ A;  5J36 A;  2R1D A;  3WV6 A;  4OQ9 A;  4UF0 A;  3IM0 A;  5JXH A;  1XSQ A;  5F6K A;  3IN9 A;  3H1M A;  5C8C A;  4QB6 A;  3X29 B;  3FE5 A;  1LEC A;  3PUR A;  2R1B A;  4I3P A;  1QH7 A;  2NMO A;  4CSW A;  2DU0 A;  1JU3 A;  2WYF A;  2VO5 A;  5JOZ A;  5A1A A;  4LHN A;  1YEW A;  3LEM A;  2QQP A;  2BWC A;  4XUN A;  5IW0 A;  2QQI A;  1HXS 3;  2GND A;  5JPN B;  4IEV A;  3OCP A;  1MZE A;  1OKO A;  1RJ7 A;  2IXC A;  2Y0O A;  2ZS6 B;  4CEY C;  1DGR A;  1QGL A;  4YPJ A;  5KHG A;  1U5I A;  1XJA A;  1ACC A;  1KGY A;  1LTE A;  3TNQ A;  2A75 A;  3ZFF A;  4CCJ A;  1S4C A;  4BYY A;  4UYB A;  2JD4 A;  3VBR B;  3CBN A;  4HPK A;  5LK7 B;  2WSU A;  1O3Q A;  1UOF A;  2BNM A;  4LUK A;  4P9J A;  3VB9 A;  1AL0 G;  1BCX A;  2VZQ A;  1EPW A;  4PBP A;  5FO8 B;  2X53 S;  4Z07 A;  3V0B B;  2WZR 3;  1UMI A;  3NAP B;  1FPN 1;  2E7Q A;  1Y9M A;  2WS9 2;  5FWJ A;  4P9L A;  3IPV A;  4Q4X 2;  1O4T A;  3HVD A;  5H9P A;  2W3J A;  4XEZ A;  1DQ2 A;  3ABZ A;  2NLR A;  1RUI 3;  5KC6 A;  4K1Z A;  5ACA 2;  5LA0 A;  2N7G A;  4MGY E;  5L36 A;  1MPX A;  4LBJ A;  3ILN A;  3WDW A;  1EP0 A;  4KNC A;  2ARX A;  2X8K A;  1MS9 A;  1KD7 A;  1QHD A;  2MPF A;  2XL7 A;  4IEZ A;  2ZPX A;  4WVM A;  2RV9 A;  3I2G A;  3THC A;  2XPJ A;  1WLW A;  3QBQ A;  3U1X A;  2ZTN A;  1XRU A;  4JGY C;  5C5U A;  4IDZ A;  3WUD A;  1SLT A;  3MUZ 1;  1YCI A;  2WLP A;  2C9K A;  5TSW A;  1G9B A;  2ZEX A;  1W8W A;  4Z82 A;  2VUA A;  2OII A;  5CFD C;  4Q29 A;  3SH4 A;  2VXR A;  1C28 A;  4OI2 A;  4P5H A;  4X8N A;  4Q27 A;  4YW6 A;  4QX5 A;  2DVD A;  4Y1U A;  2VNG A;  4CXX A;  1W2T A;  1CR7 A;  1WWY A;  5C3P A;  1TEI A;  5KHJ A;  4R4Z A;  3ZXD A;  3BOD A;  2BV4 A;  4NUB A;  2WNV A;  1SCS A;  1JOB A;  3TN9 2;  4E4H A;  2G1M A;  2WUH A;  3MEP A;  2WKK A;  1AX2 A;  2XLG A;  2WC2 A;  1AR8 1;  1GR3 A;  5FYH A;  1LR5 A;  1X82 A;  4Q4Y 2;  1PO2 3;  1W6O A;  4KU8 A;  5BNP A;  2ZHM A;  2ZGL A;  3K3O A;  4GWM A;  1TE1 B;  1RUH 2;  1YIP A;  3SH3 A;  2FCU A;  1GP5 A;  5LBC A;  1IHM A;  1PO1 3;  1W2A X;  5EWS A;  3RVH A;  5A1F A;  1H2N A;  3M3Q A;  4DUX A;  4ES9 A;  1FOD 2;  1YI9 A;  1CIW A;  3ACL A;  4CDU C;  3FHQ A;  5CFC A;  1Y43 B;  5B2G B;  1CES A;  4NRM A;  5FJH A;  1QJY 3;  3FBM A;  3BTX A;  4N7I A;  4EYU A;  3MF9 A;  1J84 A;  3JB4 C;  4YM2 A;  2HWE 3;  2WWS A;  1DG6 A;  4NAO A;  5KHH A;  1W9F A;  5K4L A;  1EYB A;  1VRB A;  2Q8D A;  1QDO A;  2RMU 1;  4Q4V 3;  3LZZ A;  4IQP A;  4E4D X;  3LPF A;  5G04 L;  4PQ9 A;  3N7M A;  1E5S A;  3RI8 A;  4DPN A;  3VD9 A;  2E9Q A;  3USS A;  3BN6 A;  3LA2 A;  5I0D A;  5DZG A;  1OUX A;  3AKP A;  4OLL A;  5IVV A;  5KHI A;  1T2X A;  3PHM A;  5LEK A;  2VG9 A;  3RWK X;  3H7Y A;  4XCB A;  5J48 A;  1SLB A;  4RGK A;  2NMN A;  1VRH 3;  4JDN A;  4ASM B;  3LSD A;  4FPL A;  5GM0 A;  5C8W A;  3DUI A;  1ND3 B;  1IKP A;  1N3Q A;  4GAL A;  1LHN A;  4NPR A;  1CVN A;  1X9P A;  5EV7 A;  4XF4 A;  2EIG A;  4Q0S A;  1DQ6 A;  3OPT A;  5I0S A;  4YWA A;  5FOJ B;  1W06 A;  4FP3 A;  5GZF A;  3S7E A;  1ZRI A;  2XHK A;  4RR3 B;  2XQR A;  3ZXE A;  4UW3 A;  1NXD 1;  2HJI A;  5FZG A;  1MS8 A;  5LK5 A;  1ZX5 A;  4RQP B;  3O1O A;  1NX9 A;  3ME2 A;  4BPZ A;  2A70 A;  4I0B A;  4QPG A;  1VP6 A;  3MIF A;  5FWE A;  4IGQ A;  2Z79 A;  3ZYI B;  4K8F A;  3ZYJ B;  1COV 3;  4ZPI A;  2ZGM A;  4BB3 A;  4MH0 E;  3W5N A;  3D6E A;  5J37 A;  1Y7B A;  3MLL A;  5T5P A;  1W9W A;  3UL2 A;  3VD3 A;  4IEP A;  2XJP A;  1DCS A;  3T2T A;  2DWR A;  4OMD A;  1LU1 A;  1RUG 1;  3FWE A;  1LED A;  3U0Z A;  3IZO A;  3G7D A;  2IXK A;  4FQZ A;  3UV9 A;  3VBS C;  2A73 B;  3LOI A;  5DAQ A;  2XGX A;  1RL3 A;  3SNM A;  5HXM A;  4NOT A;  4BZ4 A;  2WQ4 A;  1XOY A;  2PLV 3;  4L92 A;  4AYU A;  1RXF A;  2VMD A;  4K7J A;  1KJR A;  2IXH A;  2W87 A;  1HV1 A;  5E6H A;  2JE7 A;  1K5J A;  3RYR A;  4D6S A;  3O1S A;  2X29 A;  1HQW A;  1VAV A;  1OA2 A;  2Y6G A;  4XJA A;  4N43 C;  4ZXE A;  1R09 3;  3OF1 A;  1Q8Q A;  4XXP A;  2IXI A;  5DPN A;  2XKP A;  2ZHL A;  3I4I A;  3PUS A;  4LKD A;  4JC1 A;  1V6N A;  1X9T A;  1RIN A;  2Y6H A;  4Y1V A;  4BIO A;  5BYN A;  5ANQ A;  3KWV A;  5LRS A;  3TWI A;  5J3U A;  1W3X A;  2NYY A;  4HKL A;  4CP9 B;  3LPG A;  1BEV 2;  2G9F A;  2VM9 A;  2I07 B;  3B01 A;  2WFP A;  5CG9 A;  3ZFE C;  4FAH A;  4GZ9 A;  3EMR A;  2ZGO A;  1GNY A;  4P9G A;  2WZ8 A;  1W8Z A;  4ZU5 A;  1WBF A;  2AYH A;  4AI1 A;  3ZN5 A;  1US2 A;  4YG3 A;  3D4K A;  4XF0 A;  5T50 A;  1FXZ A;  4LA2 A;  2ES3 A;  1XE7 A;  2J1E A;  2TUN A;  2PEL A;  3RYK A;  1W9T A;  4S2F A;  1DFQ A;  2VQ0 A;  3AJZ A;  5T3N A;  1UKR A;  1O5U A;  2XDV A;  2DFB A;  2ZEW A;  2RM2 2;  4LUM A;  4LT5 A;  1N1S A;  2HWC 3;  4DXS A;  4FSJ A;  4GXL A;  2KM2 A;  3T4H B;  1LCL A;  4L0P A;  3IDB B;  4AI9 A;  4GKY A;  2EF6 A;  4BE3 A;  4J6G A;  1PGL 1;  2K46 A;  3MF6 A;  4N53 A;  4V1P A;  2A3Y A;  4FPG A;  4OZO A;  1FX5 A;  1VIW B;  3W21 A;  2V4V A;  3I8T A;  1HKD A;  4M01 A;  2R0F A;  5JSP A;  4X6Q B;  5CVR A;  1RUI 2;  1XSR A;  3K4Z A;  1J83 A;  4A7Z A;  3ZFG C;  5L7O C;  1UYY A;  3S0M A;  2JG9 C;  1RUJ 1;  2AZ5 A;  3C7O A;  3LA3 A;  5F2W A;  2D97 A;  2VZ3 A;  3AMN A;  3H50 A;  5DUW A;  3WNK A;  4AQ2 A;  2VC9 A;  4EN6 B;  3P3N A;  5F5C A;  2PN5 A;  1ZRD A;  2AC1 A;  4DRR A;  1GSL A;  1FYU A;  1C8M 2;  1YJK A;  2VOV A;  3OBZ A;  3PVE A;  4GH4 B;  3WNN A;  4AQT A;  2XJQ A;  4XZP A;  1CGP A;  3PLQ A;  3R6S A;  2MEV 3;  3APB A;  2D98 A;  1R1A 1;  2PQS A;  1F15 A;  1ULD A;  3WDX A;  5JXJ A;  1GKB A;  4JGY B;  3GDB A;  1HJF A;  4OI4 A;  4G3Y C;  3SCG A;  1B09 A;  3C7E A;  1XE0 A;  2XVL A;  4GJY A;  1UOJ A;  1VBC 3;  2JWP A;  2ZMN A;  1RHI 3;  5GKA C;  3VUO A;  2ZX2 A;  1EPZ A;  1NCQ C;  4COU A;  4XAB A;  4XHX A;  4W6X A;  3WQ7 A;  1C57 A;  2VCM A;  3KV4 A;  3GZE A;  1SFP A;  2BVB A;  2VMF A;  3J9S A;  1AR9 3;  5F5A A;  1UZY A;  2EA7 A;  1I3H A;  1RUE 3;  2R06 1;  2XHN A;  3CO2 A;  4IE0 A;  5EZW A;  5FUN A;  3I3E A;  5K0U A;  5ABJ A;  1W6P B;  2J42 A;  2PMW B;  1ZBA 1;  3HWJ A;  5EPA A;  4IE6 A;  3SKJ E;  2D5H A;  5JOX A;  2AEZ A;  3LEI A;  4YVS A;  5IVE A;  1UY0 A;  1MQT A;  4YZ2 A;  2JE9 A;  3QOP A;  1WME A;  3MPP G;  1BXH A;  2OYZ A;  1NLR A;  3U78 A;  3H3Z A;  4DY3 A;  2FZ2 A;  1RVF 3;  3JD7 3;  1PK6 B;  4KBZ A;  1AYN 3;  1QJU 1;  4CDU B;  1KS4 A;  2JEN A;  5A3L A;  1RUF 1;  4Q0Q A;  3LDR A;  2B46 X;  4E2G A;  2QNK A;  4KU7 A;  2DYC A;  3N9P A;  1LOE A;  2LAL A;  4Q4V 2;  4KI5 M;  1MVQ A;  4LBQ B;  2QTW B;  2VQU A;  3JQW A;  4RHV 3;  4ISR A;  1G86 A;  4DQA A;  4HN0 A;  1JZ4 A;  1OPM A;  5FZ3 A;  4UI9 L;  2PHW A;  4PDW A;  1AJO A;  5FK7 A;  5FLI A;  2RS5 3;  2XJU A;  3VBH A;  3WQ1 A;  5J98 B;  2X09 A;  3WW1 A;  2WZP P;  5FY7 A;  2P5B A;  1VRH 2;  5AFE A;  3EXU A;  2VGD A;  3AM2 A;  1W03 A;  1UIK A;  2CGN A;  2Q5T A;  3I54 A;  3S57 A;  3AJY A;  5FPV A;  3DPR B;  3OB8 A;  4K6B A;  1Z7S 1;  3LF7 A;  4FOY A;  4CP1 A;  1L7Q A;  2E51 A;  2WFF 2;  1YWK A;  3P3P A;  3QD6 A;  1X8E A;  4XFB A;  5EQU A;  3O5S A;  2FHR A;  1OD5 A;  3ALQ A;  1RJ8 A;  2ZXQ A;  3H3L A;  2HBU A;  1NLQ A;  4ET7 A;  3TYJ A;  4XBL A;  3I3B A;  2BTV C;  3SMH A;  5JZG B;  1STM A;  5FO9 B;  2XBO 3;  4ZZ8 A;  1DP0 A;  2HKX A;  5GJ6 A;  3UGH A;  1HX6 A;  5GLV A;  2A6V A;  4M00 A;  2G19 A;  1SHW B;  3H9A A;  1BZW A;  5FZ8 A;  1GQH A;  4MZU A;  4XOG A;  1VBA 3;  3DXU A;  3GCW A;  2BFU S;  3AP5 A;  4A42 A;  4NHY A;  3VBS B;  1TZO A;  4Z1V A;  2VCA A;  3WXP A;  4IEQ A;  3SEP A;  2GAU A;  5FOB B;  4C1X A;  1HN1 A;  1UMH A;  1HQN A;  3PTY A;  3MYX A;  3I49 A;  4LLF A;  2AAC A;  2XJT A;  4TLG A;  3ZSK A;  2V72 A;  4D7T A;  4FOW A;  3T0A A;  2PXJ A;  1FAT A;  2IWG B;  1N1T A;  1AX1 A;  3POI A;  4LO5 B;  1AR7 2;  4IND A;  3ZOI A;  4L99 A;  1IG3 A;  1PNF A;  1WGP A;  2CU5 A;  3FHI B;  5C3S A;  2CAV A;  1R1Z A;  1QIQ A;  1NQD A;  1W6N A;  3VBU C;  4GUL A;  2NP0 A;  3PIG A;  3MW4 A;  3W5M A;  4DEQ A;  5FY8 A;  2OPW A;  3BVC A;  5C5T A;  4Q4W 1;  3S6P A;  1FMD 2;  4LKE A;  2VUJ A;  4EN7 B;  3DL3 A;  5ISL A;  4RFR B;  4CU6 A;  5E8A A;  4CEY A;  4XF9 A;  4MHU A;  2D6O X;  4C0H A;  4L9B A;  5L9V A;  1WLT A;  5B4N A;  3N4M A;  2RS1 1;  2QBX A;  5EJZ B;  3AFK A;  3GZA A;  2D3P A;  5IAV A;  1ZRE A;  1YQ2 A;  2FDI A;  2UY8 A;  5IWF A;  3KB5 A;  5LBF A;  4Y1Y A;  4IET A;  4RGA A;  4QKB A;  4XQW A;  2Q30 A;  2BWA A;  4N8M A;  3VZK A;  4I01 A;  5GLT A;  5FZL A;  2P3I A;  2WNE A;  1RUD 1;  1PVC 3;  2JX9 A;  1JZ8 A;  2OT7 A;  5FUP A;  5KR7 A;  5J7M A;  1IQD C;  2DTW A;  1PZ9 A;  1M4W A;  1VBB 1;  2HYK A;  3JBG 2;  4LR4 A;  1VBE 1;  1QKQ A;  1O6U A;  4BK4 A;  5AC9 1;  5L7O B;  2JDA A;  1VBA 1;  2IZW A;  2QQV A;  4WM8 C;  1HRI 1;  2R07 1;  3VDD C;  2V5D A;  4JTN A;  2ID4 A;  2VME A;  4B3N A;  3RQ0 A;  3GGL A;  3GZU C;  3MIH A;  3MO4 A;  3RSJ A;  1X33 A;  5IJR A;  1GOH A;  2MEV 2;  3WCR A;  4KWJ A;  3BGA A;  2E26 A;  5EHD A;  5FZ7 A;  4A2U A;  4N9H A;  5A3N A;  5GZC A;  1AXK A;  5FP9 A;  3ZXK A;  4HSJ A;  1AYM 3;  3M2M A;  1XE8 A;  2UYB A;  4OVE A;  1HRV 1;  4JGY A;  4Y33 A;  4BJ0 A;  3MLJ A;  2HWB 2;  1XYN A;  1UF2 C;  1ENS A;  2YGL A;  1GAN A;  3KD4 A;  4TWT A;  5CFD A;  4QXK A;  4Q26 A;  2D3S A;  2ZOE B;  5C3R A;  3KV6 A;  4ITC A;  1MEC 3;  1H0B A;  1NY7 2;  2RVA A;  3IDE A;  4IGP A;  4QPY A;  1AR6 2;  1CPM A;  1O4Z A;  1UOG A;  2D44 A;  2P17 A;  2VW2 A;  4LLO A;  5EYY A;  2YDE A;  1REE A;  4MX3 A;  1QXR A;  4QPI C;  2B45 X;  3ACI A;  1AR9 2;  1GNZ A;  4I0W B;  4XE9 A;  4YFW A;  2IFW A;  1RUE 2;  4XW3 A;  5JI9 A;  5JXI A;  1DYP A;  4E4Z A;  3Q8E A;  4H7L A;  1X50 A;  1KQR A;  1BVV A;  5CKN A;  3E6C C;  1QQP 2;  4BQW A;  3OYW B;  1UPS A;  1S55 A;  4ISQ A;  2VZT A;  5DAW A;  4NII A;  3VD7 A;  3WHU A;  5FKB A;  1DYK A;  2D6L X;  2WYS A;  3OUJ A;  4LEJ A;  3O7O A;  3JD7 2;  4AAP A;  4BMB A;  5C4W C;  1ASJ 3;  1Y9Q A;  3SC7 X;  3ZXL A;  2BEO A;  4AFB A;  2YYO A;  3AZV A;  1UZ0 A;  2OPK A;  3ZPO A;  2VMG A;  4OI0 A;  2R04 3;  2HBT A;  1TME 1;  3MID A;  4AFA A;  4D69 A;  4EE2 A;  4ZON A;  4RHV 2;  3ZPY A;  2DVB A;  2XJR A;  4LBQ A;  3RRD A;  4NID A;  5A3T A;  1ZBE 1;  3JZV A;  4BLJ A;  1DZT A;  4WM7 B;  1W2O A;  2VZR A;  3VBR C;  3SLI A;  1MS5 A;  5FFO C;  5F1R A;  3IAQ A;  1C4R A;  3GM8 A;  4EWE A;  1BK0 A;  3BYW A;  1D4M 1;  2W92 A;  3LFM A;  1JU4 A;  1T6G C;  2JB4 A;  2R30 A;  1D0G A;  1BBT 1;  1UU5 A;  3NAP C;  4LKF A;  3ZN6 A;  1UX6 A;  3ORJ A;  4WV8 A;  5JI7 A;  5T5L A;  3JQX A;  3VHN A;  1NLS A;  3N9Q A;  2DVF A;  4E9K A;  5IK7 A;  1UN1 A;  2C1F A;  4FPE A;  2BER A;  1CAV B;  1GIC A;  1GP6 A;  1R08 3;  5F2S A;  3SH5 A;  3TRS B;  1SQ4 A;  4H55 A;  1GQP A;  1JH5 A;  3C2U A;  2WA4 A;  2PHT A;  5AFB A;  1SPP A;  1CIY A;  2Y6K A;  1LOB A;  3GJA A;  1WLD A;  3M70 A;  4LUL A;  1NCR C;  3ZM8 A;  3ZYF A;  1I1E A;  4Z92 B;  3KZ4 C;  1F5J A;  3WX5 A;  1OMI A;  2A6W A;  4M3C A;  4FT8 A;  5LRR A;  1GZC A;  1VBD 3;  3RGB A;  4WVV A;  1EAH 3;  1OD3 A;  4P14 A;  3OGS A;  4DZG A;  2WII B;  3NJZ A;  3EYP A;  4OI1 A;  4GB3 1;  3UGF A;  2VCC A;  4JDM A;  1O8S A;  1CAW A;  5A80 A;  3ILF A;  5T52 A;  4DO0 A;  4LBL A;  1YYN A;  2DDU A;  2BGO A;  2OZ6 A;  3VBS A;  3WG3 A;  3ZVX A;  4LIT A;  4XFI A;  2JEC A;  2DVG A;  3HT2 A;  1CJP A;  1GZ9 A;  2W1Q A;  1RTV A;  3BU7 A;  4AHW A;  4LBM A;  5HCB A;  1GWK A;  1H2K A;  3MIE A;  3PTR B;  4N43 A;  3V64 A;  2WT2 A;  3ZXF A;  2UWA A;  5JVV A;  3BPZ A;  4MGQ A;  4AVT A;  4AFC A;  4M3C F;  3PDQ A;  3O1U A;  2KA3 A;  2RR1 2;  3OD0 A;  1PHM A;  4MGT A;  3R4D B;  4QM9 A;  4JVA A;  3RMY A;  3VBU B;  1UY2 A;  3ZFE A;  2E7A A;  4CDW C;  2WNU A;  4EWD A;  1DZR A;  2JDY A;  2HWD 3;  2YPD A;  1IS4 A;  1Q8O A;  3DV8 A;  1ODM A;  4N90 A;  4R9C A;  4ZY9 A;  4Y1Z A;  3H8O A;  3T09 A;  1WMF A;  3RZJ A;  2J1R A;  3ZXA C;  1ALY A;  1ZA4 A;  2D6N A;  1XND A;  3BPS A;  3LEK A;  1E57 A;  2OS2 A;  4IER A;  4J1W A;  2UY9 A;  2JJ6 A;  4BH9 A;  1YNA A;  3T0B A;  4E2Q A;  3S5A A;  1GOG A;  1OFN A;  2HEV F;  4JGZ C;  2VUL A;  3FHA A;  1W3V A;  4HKO A;  3ZYR A;  3L9J T;  4XXA A;  4COZ A;  2DCT A;  4JKK A;  4ASK A;  3M1H A;  4NHX A;  5BXX A;  3NV4 A;  1AZD A;  5JMO A;  1RMU 2;  2VL4 A;  4I0A A;  3J4U H;  2Y26 A;  2RJK A;  1RGS A;  1VPH A;  4GMP 0;  3B93 A;  2BDR A;  5FP8 A;  3ZO0 B;  4D0Q A;  1ND3 C;  4YGE A;  1S0F A;  2A3X A;  3OPZ A;  3ZXJ A;  5LEJ A;  4PBO A;  2X05 A;  3TEZ A;  2XXZ A;  3ZFG A;  5L7O A;  5JPM B;  3ENR A;  2JG9 A;  4Q4X 1;  4RR3 C;  5E16 A;  3HMY A;  2A6Z A;  4BU2 A;  4IE5 A;  4GWJ A;  2D6P A;  4RQP C;  4Y26 A;  5ANN A;  4KG8 A;  5DDJ 2;  3VDD B;  4BLI A;  2GDF A;  4CCM A;  3R4S A;  2IXJ A;  5J96 B;  4DB5 A;  1XC6 A;  2W95 A;  3J26 N;  5LY1 A;  1DF0 A;  4CUA A;  2HWF 1;  3N7J A;  4RA0 A;  3TB0 A;  3CL1 A;  3OUI A;  2D5F A;  2GN7 A;  1OH4 A;  4KWL A;  2RDQ A;  4Q8L A;  5JIA A;  1AYM 2;  2VVD A;  1WBL A;  2XON A;  3Q8F A;  5L73 A;  1N1V A;  1FPN 3;  3C8X A;  2JIJ A;  2YU2 A;  5JDB A;  2R16 A;  2YMZ A;  4D8M A;  1IGO A;  4L2N A;  1YQ8 A;  3D5O A;  5JIU A;  1MEC 2;  3WF4 A;  3FMG A;  1A78 A;  3GCX A;  4MOA A;  5D21 A;  3AKQ A;  2QQN A;  4HSL A;  1BVP 1;  1NCQ A;  1JS9 A;  4MO3 M;  1LUL A;  4OUL A;  2AEY A;  1PMH X;  2DV9 A;  4NPL A;  4QPI B;  4YNI A;  3PU8 A;  1LAJ A;  3BOW A;  1QOS A;  1YJL A;  3S5Q A;  4DXT A;  4TTG A;  2CNA A;  3ZIX A;  1FV3 A;  1QEX A;  5FO7 B;  1A6C A;  3TN9 1;  1NA1 B;  3LIG A;  3OTF A;  1NZI A;  1O3T A;  1NXM A;  4YZ5 A;  1H8T B;  2WSV A;  1ASJ 2;  4B29 A;  5C4W B;  5FQ0 B;  3KMH A;  3RZK A;  3AKR A;  1L7L A;  1VAL A;  4QU2 A;  1V9U 2;  3JU9 A;  5FV3 A;  2R04 2;  4A7K A;  4CTE A;  5LB6 A;  1F9K A;  4DIN B;  2JD9 A;  1BMV 2;  2CGP A;  1LHO A;  1FOD 1;  3P1I A;  3ES4 A;  4QKD A;  1MZ6 A;  1QOT A;  2JDZ A;  2AUY A;  4FPY A;  2VVF A;  3LB9 A;  2J1T A;  3DCQ A;  2XVG A;  3AKS A;  1AR8 3;  2ZHN A;  2Y8K A;  1GWL A;  1UYZ A;  2PHX A;  2WT1 A;  1QJX 1;  3AVR A;  2VXJ A;  1OC1 A;  3MLK A;  4AGG A;  3HAG A;  4YAR A;  5E89 A;  1PGW 1;  1DHK B;  1YRZ A;  3T1L A;  2BNO A;  2D93 A;  1XNA A;  1W9S A;  1WA4 A;  2PAM A;  1ND2 C;  2GC0 A;  3LIH A;  1N47 A;  2JIC A;  3V0A B;  1W6Q B;  2KD7 A;  1R08 2;  4GMP 1;  1JYN A;  3FUQ A;  4PCR A;  3UJQ A;  3WY6 A;  3Q8A A;  3VZJ A;  3TNP B;  4BOW A;  1CX4 A;  4CXW A;  3HNM A;  2QCS B;  2RMU 3;  3MIC A;  3E5X A;  3NNF A;  4LXL A;  3OD4 A;  5FYY A;  4WZF A;  4Q0V A;  4KH9 A;  1W0O A;  2BFU L;  1A3K A;  2J1A A;  2ZGQ A;  1HDK A;  1VBD 2;  1NCR B;  1EAH 2;  4GH4 C;  1V70 A;  3BOP A;  4UOJ A;  4XCA A;  5ERL A;  4OHX A;  2DUP A;  5LAT A;  3OGV A;  4NJ4 A;  4K1Y A;  1PNG A;  4OMC A;  2CGO A;  2J1U A;  5A6X A;  5LWB A;  2FZ1 A;  1DIW A;  3CMG A;  3POE A;  3VKN A;  1LOA A;  2LRP A;  2FDH A;  5T5J A;  2Z42 A;  1PZ8 A;  2DUR A;  5BNN C;  2WO2 A;  4JDO A;  2QQO A;  3BIW E;  2W2I A;  5FXW A;  4B7E A;  3L2Y A;  1D0H A;  2WA3 A;  2Q8C A;  2GC2 A;  5F39 A;  3WP4 A;  1OA3 A;  2I74 A;  1H6X A;  2XWJ B;  3B94 A;  3B5L B;  2ZGT A;  1IOA A;  3MIB A;  3J8F 2;  2W68 A;  3NST A;  1GNH A;  3ZR5 A;  1W90 A;  1QNW A;  1J3P A;  4AZZ A;  4MUV A;  3T30 A;  4FVV A;  1V6M A;  1BQP A;  4V2W A;  1RUG 3;  4IE4 A;  5FZB A;  4HKW A;  5GLW A;  4ASL A;  1VB2 A;  1W0N A;  2ERF A;  3DXT A;  5DUX A;  4AI0 A;  1AL2 1;  2XJS A;  3C7G A;  3MDP A;  4O65 A;  3VBU A;  2QQU A;  2HWD 2;  3WG4 A;  4EZ4 A;  1OQE A;  1PK6 C;  4CDW B;  1BEV 1;  3DEC A;  3H1W A;  2JG8 C;  3DF0 A;  4KBB A;  1EUT A;  5FY1 A;  5LAS A;  1RUC 2;  2VOX A;  1OH3 A;  2VCB A;  5FZO B;  2BOI A;  2C9A A;  3KVA A;  1S0J A;  2H6C A;  1UU4 A;  1I5Z A;  1UZV A;  3LE0 A;  3H8X A;  1DQ5 A;  1QNY A;  1V0A A;  4IES A;  2VH9 A;  4JGZ B;  2YC0 A;  4D6Q A;  2RM2 1;  5FZK A;  5FZC A;  4XUR A;  3PNA A;  5A33 B;  5FYB A;  1H6Y A;  1TNR A;  3UK9 A;  1UYX A;  2WWU A;  4YW5 A;  1JZ5 A;  4FOQ A;  4R8H A;  3ZYB A;  2A71 A;  4G4F A;  1CN1 A;  2TBV A;  3DPR C;  4YW1 A;  5FPL A;  2C5D A;  2F17 A;  1W99 A;  3K77 A;  4QM8 A;  5FPB A;  5LA1 A;  3B00 A;  4LKS A;  5DAP A;  2UU8 A;  4MV2 A;  4WM8 A;  5A7W A;  3U14 A;  4BIS A;  4Y20 B;  4H2A A;  4QKN A;  4AG4 A;  4COY A;  1A8M A;  1H8V A;  3OY8 A;  3WNP A;  3RWN A;  1CAU A;  3ECQ A;  4R9D A;  4NPM A;  1WCK A;  2WLQ A;  3RFR A;  4OQ8 A;  1YC6 1;  4FFH A;  5JZG C;  1FPN 2;  4YSF A;  4Q2F A;  4XFF A;  1YO8 A;  2Q8O A;  2F4P A;  1C8M 1;  5IUQ A;  3RZL A;  2BP6 A;  1H9W A;  4A45 A;  3OJB A;  1PIV 2;  1Q8S A;  5IK4 A;  5JWP A;  2VNR A;  5EYX A;  3ZDS A;  3TEY A;  4XFH A;  3R0R A;  1J1T A;  1RUJ 3;  1VE0 A;  2IFR A;  2NN8 A;  3U07 A;  4QB2 A;  4P9X A;  3AYA A;  5JSO A;  4UXA A;  4K40 A;  4D6R A;  4EZH A;  4CCN A;  4KGQ A;  3OEB A;  2WO7 A;  4BME A;  1R1A 3;  1XNB A;  3P6B A;  4CE8 A;  3IAP A;  3FC0 A;  1ZZB A;  4AXO A;  1O4Y A;  1UU6 A;  2CL2 A;  2DCK A;  4FPK A;  5FZ0 A;  5FXZ A;  5D8A B;  3H0O A;  3CZJ A;  3TBD A;  1VR3 A;  4Z8B A;  5DAX A;  3PU3 A;  4CPB A;  4CZS A;  3POB A;  1JYC A;  5C4W A;  4Q0P A;  5FQ0 A;  2V5Y A;  2YG0 A;  3BU0 A;  3C3V A;  2O0O A;  3EB7 A;  4UFJ A;  1LU2 A;  1HXS 2;  1QOO A;  2Z2S B;  3KT1 A;  4YVW B;  5FBZ A;  5I0R A;  4IXL A;  4S2G A;  1S2B A;  5F7U A;  2ZCW A;  4AHY A;  3ZKU A;  2Z5W A;  4B1M A;  5JUV A;  2XLA A;  3PUI A;  4XAE A;  5C71 A;  2LTN A;  4K21 A;  3WNO A;  2R06 3;  2D40 A;  3GBW A;  3F2Z A;  2GC3 A;  4L11 A;  4XMA A;  2JXA A;  4XUO A;  2O8O A;  2BUK A;  5A1L A;  1ZBA 3;  3VBR A;  4LOR A;  4UAP A;  4QDR A;  4YM3 A;  4OHW A;  2H0V A;  2JIG A;  5KXD A;  3JUU A;  4QAW A;  1GYK A;  2ZGS A;  3AMM A;  2ZGP A;  3ATG A;  1GZW B;  2WZR 2;  1H2L A;  1TMF 1;  3V0B A;  1Q3E A;  1TVG A;  1ND2 B;  2RS3 3;  1QJU 3;  3NAP A;  4XDP A;  1DGR N;  4IEX A;  4TYS A;  1RUF 3;  1W6Q A;  1N3P A;  2NPI A;  4C90 A;  2VUC A;  3I59 B;  5FZ6 A;  1MS4 A;  3CJI C;  5F5Q A;  1G9A A;  1OT5 A;  3I2J A;  4Q0U A;  1Y3T A;  4NWW A;  3A23 A;  2XWB B;  3LDB A;  4CUG A;  5C3O A;  5A6Y A;  1K5M C;  4HFS A;  3W9A A;  2JDU A;  3T2Q A;  3A7Q A;  2BW8 A;  2DUO A;  2PFW A;  1IS6 A;  2RDS A;  1HB3 A;  2WFF 1;  3AYE A;  1SBE A;  1W8H A;  1YQC A;  3OBT A;  1O59 A;  3AP6 A;  4WZC A;  3O0W A;  3WD5 A;  5KXE A;  1VB4 A;  1UXZ A;  4HVO A;  4GIQ A;  1RUO A;  4LBQ D;  3D0S A;  1SDD B;  1JN2 P;  1SLL A;  2Z69 A;  3MW2 A;  5FIX A;  5K8S A;  4SBV A;  1XB9 A;  4W8J A;  2VQA A;  1JYW A;  3VHO A;  4LPL A;  3CJX A;  4BIF A;  4QMA A;  1Z7S 3;  4K9S A;  1UKG A;  2D43 A;  2C24 A;  3ACH A;  1J59 A;  4JQT A;  5FYS A;  3UES A;  3AZY A;  4R9B A;  5BNN B;  5FTT C;  4NAM A;  2ATF A;  3GF6 A;  4AHX A;  2GU9 A;  4AAX A;  2E32 A;  2QKD A;  3N3H A;  2P3K A;  3J7H A;  1UNB A;  3U37 A;  4D7S A;  2GH8 A;  3LSE A;  5SV8 A;  1U5Y A;  1PO2 2;  1CAX B;  5L9B A;  4JZR A;  3INA A;  1VAM A;  2UUR A;  3ETP A;  4XIL A;  4BQY A;  5C9A C;  1PO1 2;  3BI3 A;  2VAU A;  4QX0 A;  4ZHN A;  1AR7 1;  4QGM A;  4NR1 A;  3VKL A;  2ZEY A;  1H9P A;  2V73 A;  5BPX A;  2Q4S A;  4YG0 A;  4Y5T A;  4CDW A;  1WLC A;  2J7M A;  3AP9 A;  5F8P A;  3ASI A;  4QQH A;  4JV4 A;  3VZL A;  1QJY 2;  1S0B A;  2CWM A;  2RS3 1;  5FY5 A;  4U2A A;  2YUE A;  4P9W A;  4EN0 A;  4A6S A;  3I3M A;  2HWE 2;  2JG8 B;  1KJL A;  2Y6F A;  1I9R A;  1YI7 A;  5FZO A;  2PHF A;  4Q1R A;  3ZDV A;  1FMD 1;  1UW8 A;  4XF1 A;  4YLZ A;  2D6M A;  3HNB M;  3E1F 1;  5A70 A;  3AMQ A;  4XJ9 A;  2WO1 A;  3UET A;  5SV5 A;  1WD4 A;  4WM7 C;  4MSV A;  4SLI A;  1W8F A;  4BHP A;  4YG6 A;  3GYD A;  3K4A A;  2EAA A;  3LCP A;  2DBI A;  2ETE A;  1OOP B;  3AMH A;  3JCI A;  4HZF A;  4QXH A;  4FPC A;  4RFT 0;  3WG2 A;  3WW4 A;  5C70 A;  1ZZ8 A;  3RI9 A;  1LOF A;  2WR9 A;  4Q4W 3;  4M3C E;  2FD8 A;  2EID A;  5EJ3 A;  3AP7 A;  4XVH A;  1ND3 A;  1OLM A;  1HLC A;  2LUW A;  2VR4 A;  3AXD A;  3SIS A;  2VBP A;  4W6W A;  4HMZ A;  3VN4 A;  2RS1 3;  1N3O A;  3DYO A;  4P00 B;  2CHH A;  2B42 B;  2D6K A;  3KV5 A;  4IV3 B;  4RR3 A;  4TZD A;  4CDX B;  2VZU A;  5D2A A;  5F9T A;  3JBG 1;  4RQP A;  3SCH A;  3UKV A;  3MBW A;  1KDK A;  3M4F A;  5FYI A;  2PYT A;  5I0U A;  3A21 A;  1COV 2;  3KV9 A;  4DS0 A;  4R9A A;  2ADD A;  3ST7 A;  4B7K A;  1TG7 A;  3MZH A;  1PX3 A;  1RUD 3;  1WUV A;  1ZZ6 A;  4YYO A;  5B4X A;  2DVA A;  4LO7 A;  2JEM A;  4ONU A;  1A8D A;  3CZU A;  3NRU A;  4DRV A;  3LKJ A;  1H1I A;  1VBB 3;  4O9G A;  2R6Q A;  1W2N A;  1VBE 3;  3NW4 A;  3DN7 A;  5AC9 3;  1N1Y A;  4UW6 A;  5FYT A;  2RE9 A;  4NMI A;  3ZKY A;  3IIA A;  2HWB 1;  1HRI 3;  1P8J A;  2PLV 2;  1Q43 A;  2R07 3;  2JKB A;  3V56 A;  1NG0 A;  3WF1 A;  2WQ8 A;  2Y34 A;  4CCD A;  1YIF A;  2B4K A;  4AQ6 A;  1Y4W A;  5IFT A;  5HV0 A;  1QF3 A;  1AR6 1;  1R09 2;  2F6B A;  3VZO A;  3AL5 A;  3H42 B;  4CXY A;  2PAK A;  2VOW A;  1JOD A;  1H1A A;  4UT5 A;  3DEM A;  3J7L A;  1I5P A;  3MGU A;  5FXV A;  1HRV 3;  5EJ1 B;  1PMJ X;  3KHB A;  3FJS A;  4M4P A;  5DXD A;  1J1L A;  4AFM A;  4B4Q A;  2GME A;  4LE3 A;  4CP9 A;  1S0G A;  2WQZ C;  2Y64 A;  1YFY A;  3VBO C;  4RS5 C;  4N7U A;  5GZE A;  4XYX A;  3H1Y A;  4LQR A;  4AI3 A;  4S2H A;  1VMH A;  4ES8 A;  3ZN4 A;  4FO9 A;  4RL7 A;  5FLJ A;  1ZZ9 A;  4X8P A;  5IK8 A;  2ARA A;  3KGZ A;  2VE1 A;  2IC1 A;  2W08 A;  4QXC A;  4XFC A;  2R06 2;  5FAX A;  5JAX A;  1ZBA 2;  2YFZ A;  4MHR A;  2VOK A;  5DAB A;  2ZGN A;  2HWC 2;  4N9I A;  1IG0 A;  1Z78 A;  1NT0 A;  1SLI A;  4E8D A;  2CSG A;  1CZV A;  3RZZ A;  1D4V B;  1VJ2 A;  1OF4 A;  2XL9 A;  1QMJ A;  5A32 B;  4NE9 A;  4OFG A;  1W2U A;  3ZSM A;  2EAL A;  4MG2 A;  1E5H A;  5BUV A;  1ZRF A;  1JHJ A;  3VKO A;  4CDQ C;  4DIQ A;  1RUF 2;  5BNQ A;  4W65 A;  3OBA A;  1OUS A;  4I30 A;  4CEW B;  1TME 3;  3FN9 A;  1Y9G A;  4C1W A;  2BU9 A;  3QH6 A;  3CJI B;  5FZ1 A;  4XBN A;  3ZLI A;  2OXB A;  3HT1 A;  1ZBE 3;  3WEZ A;  3NV1 A;  3ZSJ A;  5F3E A;  1K5M B;  4COW A;  3I2H A;  5JSR A;  1AHS A;  3I2O A;  1NE6 A;  1D2Q A;  4RGG A;  2ZEZ A;  1JZ3 A;  4BQ5 A;  2CDO A;  4GH4 A;  4UW4 A;  1LHV A;  1ULG A;  4Q1P A;  5FJK A;  1EUU A;  1D4M 3;  2RHP A;  2VBD A;  1BBT 3;  1Z7S 2;  5I91 A;  4FFF A;  2JB8 A;  5FRE A;  3ILR A;  1NOV A;  3KCY A;  3HR9 A;  4QKF A;  4U36 A;  3VKF C;  4AI2 A;  4B4P A;  4UBG A;  5HPO A;  2BOJ A;  1VBC 2;  5DAV A;  5KXC A;  1RHI 2;  2ADE A;  5KWR A;  2QUO A;  2XUE A;  4YW2 A;  5BNN A;  3UT0 A;  3OGR A;  1LB2 A;  5DZF A;  1JZ2 A;  1SG3 A;  3OPW A;  4Y5Z 0;  2ZX3 A;  4LIV A;  1JUI A;  5H9Q A;  4W50 A;  2E63 A;  1AF9 A;  1I6X A;  2PHU A;  5IK5 A;  2QE3 A;  3LDK A;  4IEO A;  3DYM A;  4NRO A;  5F5I A;  5FLH A;  4GAZ A;  4AW7 A;  2FMD A;  4D7Y A;  1U12 A;  1CAX A;  1EV1 1;  3VZM A;  3ZMO A;  5FPZ A;  4GB3 3;  1W6P A;  5LY2 A;  3WHT A;  1NA1 C;  3GJB A;  5CBL A;  1ZRC A;  3MI8 A;  5C9A B;  3POG A;  2I45 A;  1DBN A;  3PJY A;  1H8T C;  2AH2 A;  1B35 C;  5FY0 A;  1V6J A;  4Y1X A;  1RVF 2;  2SLI A;  3AC0 A;  5A6Z A;  1L7R A;  4NHK A;  2RR1 1;  4NIA A;  1AYN 2;  1PK6 A;  2ORX A;  1YLL A;  4YFZ A;  4CDU A;  4PF1 A;  2JG8 A;  3OOX A;  4DMI A;  2BBA A;  4A41 A;  1ULC A;  2GH2 A;  4CCC A;  5HXV A;  5FYZ A;  5FP7 A;  1UX7 A;  2WN3 A;  4ARY A;  4JX0 A;  2CV6 A;  4W4Z A;  1K45 A;  4QU1 A;  3WW3 A;  3I2I A;  4UF0 B;  5LA2 A;  3PME A;  4P08 A;  1DGL A;  4XQD A;  5C8C B;  1WCS A;  3NNL A;  2RS5 2;  2X5I C;  5A7Q A;  4AVC A;  2VZO A;  1UY4 A;  1KIT A;  2RG4 A;  3MUY 1;  2OVU A;  2UWB A;  3GHM A;  1YQ6 A;  4PLO A;  4PLM A;  3VLB B;  1XU2 A;  2MHF A;  3B3Q E;  4AVV A;  4HXC A;  1BYH A;  1APN A;  2JDK A;  3DPR A;  3PVO A;  4I09 A;  2UYA A;  2GN3 A;  4I02 A;  1HB2 A;  1SLC A;  3D8C A;  4BQ2 A;  2RS1 2;  4WVZ A;  1RMU 1;  5GZD A;  1AUY A;  1UAI A;  1HV0 A;  3D0J A;  3C7H A;  4OUE A;  1GMM A;  4AED C;  1XYP A;  2LW8 A;  2RJ2 A;  2DCY A;  2OA2 A;  3MV0 1;  3I7D A;  3NNG A;  2OUJ A;  3ZFF B;  2XVK A;  1AX0 A;  4K8R B;  4BXF A;  4QDS A;  4C91 A;  1GLH A;  2A1X A;  3I3Q A;  4HPK B;  1UWW A;  1RUD 2;  2XBO 2;  3FLP A;  5JZG A;  1CQ9 A;  2XOM A;  3MW3 A;  5DDJ 1;  4AVB A;  1KRI A;  3LEG A;  2OX0 A;  3DYP A;  3I2K A;  1JUH A;  3AYC A;  2XML A;  2W5F A;  4N53 C;  3S7I A;  1VBB 2;  5DUV A;  4H7M A;  1POV 0;  1SAC A;  3G6J B;  4M0N A;  3WSO A;  1VBE 2;  3WDU A;  4R4X A;  5GLU A;  1JZ6 A;  4QDQ A;  1VBA 2;  3IPV B;  1X36 A;  5FMC A;  3FFQ A;  1HRI 2;  2R07 2;  2B5H A;  4Q4X 3;  2FCV A;  1UYP A;  3SEE A;  4CRQ A;  5JR2 A;  4FAG A;  2Q0A A;  3OSD A;  2YB7 A;  3HOB A;  3U11 A;  4CCL A;  1S1A A;  4A7Y A;  1ODN A;  5IAX A;  5JCT A;  4D94 A;  2HWF 3;  5IHR A;  5CB7 A;  2B39 A;  4AVA A;  3ZYG A;  2PQQ A;  4HBN A;  1VLN A;  2KR2 A;  4ATF A;  1PVX A;  2YHJ A;  3M8L A;  4J25 A;  2E7T A;  2XLF A;  5CAZ A;  1ULE A;  4HON A;  2IVI B;  2LS6 A;  5E1R A;  4MAD A;  1O3R A;  1WW5 A;  2GP3 A;  3BTZ A;  1LOC A;  2K2S A;  4FI9 A;  3VBO B;  2ZX0 A;  4RS5 B;  4UFL A;  2TEP A;  3BTY A;  4MXV A;  1C1F A;  3N7K A;  3PUA A;  1UY1 A;  2QQL A;  2WZE A;  4XFA A;  3WQB A;  1LHW A;  2DUQ A;  4Z2W A;  5CKM A;  4K20 A;  3LD8 A;  1XPW A;  2EAK A;  3O0V A;  1ULP A;  2EIC A;  3ACF A;  5FZI A;  2BGP A;  1GZT A;  3KHC A;  2ZA9 A;  2VNO A;  3NJV A;  2QDR A;  4LA3 A;  1SCR A;  4EQV A;  1V9U 1;  4QXB A;  2HH9 A;  3WF3 A;  4ZXK A;  2P2K A;  5AVA A;  2WNV B;  3AZX A;  4QPW A;  5LBE A;  1QJE A;  4C8D A;  3TN9 3;  4LTA A;  3ZYH A;  1FAY A;  1XNK A;  4LMF A;  5A32 A;  1W6O B;  5A3W A;  4UBH A;  3KS7 A;  4QQL A;  4FQ4 A;  2QZ2 A;  1L3J A;  4TXW A;  2JE8 A;  1PVC 2;  3J7M A;  5T55 A;  3ZMN A;  4CDQ B;  5GLZ A;  4IEY A;  2W0X A;  5FZM A;  1TME 2;  3VHR A;  4MGI E;  1QDC A;  1G8W A;  3TOJ A;  2DCZ A;  1FOD 3;  1URX A;  3ETQ A;  3S30 A;  4DNY A;  5CFC B;  4CPB D;  1HW5 A;  1V6O A;  1YQ5 A;  2XQX A;  4XF3 A;  2AGS A;  1OA4 A;  2UWC A;  3ON7 A;  2WS9 1;  3AX4 A;  4PQQ A;  1F4H A;  1RIR A;  1QJX 3;  3TEW A;  3VBF C;  5FUI A;  5CA6 A;  3EQE A; 
#chains in the Genus database with same CATH homology
 2BZD A;  3LE0 A;  2XHN A;  2W91 A;  3I3E A;  4A6O A;  4BK5 A;  3SKJ E;  3C7F A;  4XUR A;  3LEI A;  1H6Y A;  1UY0 A;  1CZS A;  1GOF A;  1UYX A;  3OEA A;  1JZ5 A;  2W1U A;  2C26 A;  4A44 A;  1W99 A;  3HN3 A;  3K77 A;  5LA1 A;  1DYO A;  4LKS A;  3VD4 A;  2C4X A;  4KI5 M;  4AG4 A;  2VQU A;  1JZ4 A;  2DCJ A;  2W46 A;  2YC4 A;  3WNP A;  4UI9 L;  3ECQ A;  3GXU A;  2Z4F A;  1KEX A;  2X09 A;  4DUV A;  4P5Y A;  1NUK A;  4A45 A;  5EIY B;  2CDP A;  3OB8 A;  3VDB A;  2HYX A;  4JKL A;  2EIB A;  3IB3 A;  1K42 A;  1L7Q A;  5CYY A;  4QB2 A;  1NKG A;  1GU3 A;  2ZXQ A;  2OKX A;  4ZZ5 A;  4ET7 A;  3OEB A;  3I3B A;  2WAA A;  3P6B A;  3IAP A;  5G05 L;  4ZZ8 A;  2DCK A;  1DP0 A;  3CZJ A;  4A4A A;  1BHG A;  1SHW B;  2YG0 A;  2VZ1 A;  3EB7 A;  2QQJ A;  5J1X A;  1CZT A;  4A42 A;  2VCA A;  5F7U A;  3SEP A;  3VDA A;  1HN1 A;  1UMH A;  2WN2 A;  5JUV A;  3PUI A;  5C71 A;  2VZV A;  3WNO A;  1RYY A;  3F2Z A;  2V72 A;  3CKH A;  3CIH A;  4XUO A;  3T0A A;  3THD A;  3T2O A;  2YC2 A;  4UAP A;  4QDR A;  4DEV A;  4QAW A;  1TVG A;  3W5M A;  4DEQ A;  2VZP A;  4Z2A A;  3NJX A;  3I2F A;  1PX4 A;  1OT5 A;  3I2J A;  3T08 A;  4CU6 A;  3A23 A;  5JXG A;  5B4N A;  3T2Q A;  2QBX A;  3A7Q A;  5EJZ B;  1NAE A;  5C7G A;  1O59 A;  1YQ2 A;  1UXZ A;  4RYD A;  2X10 A;  3WNM A;  5IYY A;  1SDD B;  4RN5 A;  4W8J A;  4DXR A;  1JYW A;  4LPL A;  1US3 A;  2WBK A;  2VQT A;  3ACH A;  1JZ8 A;  5LCW L;  3K75 B;  3A22 A;  2J1S A;  1IQD C;  3UES A;  2E31 A;  2WAB A;  4ARX A;  4GWI A;  4BK4 A;  2JDA A;  2QQM A;  4CU8 A;  2V5D A;  2E32 A;  4M4R A;  2ID4 A;  4AAX A;  2VME A;  3HPN A;  1F4A A;  3GGL A;  3J7H A;  3MO4 A;  5IFP A;  3U37 A;  5IJR A;  1GOH A;  4XUP A;  3BGA A;  2E26 A;  1O8P A;  4QB1 A;  2ORZ A;  3ETP A;  1UXX X;  3HNY M;  3LQC A;  4QX0 A;  4BJ0 A;  4HG6 B;  3PUH A;  2ZEY A;  3K46 A;  1JZ7 A;  2J7M A;  3WF0 A;  3T0D A;  2Y6L A;  2RVA A;  4CU7 A;  4CU9 A;  3UNP A;  5DN2 A;  4QX2 A;  2W1S A;  2W9X A;  3ACI A;  3HNB M;  2WAO A;  2HLE A;  3E1F 1;  3UET A;  5JXI A;  2WO1 A;  4QX3 A;  3NQH A;  3K4A A;  3WF2 A;  3VD7 A;  4MGS A;  2VZT A;  5C70 A;  4BXS V;  2WYS A;  2EID A;  4XVH A;  2VR4 A;  3WNL A;  1UZ0 A;  3DYO A;  1K3I A;  4P00 B;  2VZU A;  4XUQ A;  3MBW A;  5JXH A;  3A21 A;  2VZR A;  4QB6 A;  1TG7 A;  3III A;  1PX3 A;  3IAQ A;  3GM8 A;  5B4X A;  2W92 A;  1JU4 A;  1JU3 A;  2VO5 A;  5A1A A;  3CZU A;  3NRU A;  4XUN A;  1W8N A;  2QQI A;  1WKY A;  2BER A;  1P8J A;  3WF1 A;  2WQ8 A;  1JYX A;  2B4K A;  4IUG A;  4YPJ A;  5IFT A;  1GQP A;  1KGY A;  2Y6K A;  1CIY A;  3ZM8 A;  3I97 A;  1I5P A;  4LHS A;  5EJ1 B;  1PMJ X;  1OD3 A;  2E33 A;  3OGS A;  4M4P A;  2YFU A;  2VZQ A;  3EYP A;  2Y64 A;  2VCC A;  1O8S A;  3I3D A;  1UMI A;  4LQR A;  1K12 A;  2DDU A;  2W3J A;  2BGO A;  3SKV A;  1ULO A;  4CVU A;  3ABZ A;  5LA0 A;  3MV1 1;  2W1Q A;  1MPX A;  2YFZ A;  4E8D A;  4MGQ A;  1CZV A;  3HEI A;  1CX1 A;  2RV9 A;  3I2G A;  1OF4 A;  3THC A;  2VJX A;  1JHJ A;  3MUZ 1;  2C9K A;  3OBA A;  4KWU A;  1UY2 A;  2ZEX A;  1WCQ A;  3FN9 A;  4E8C A;  4ZY9 A;  3T09 A;  2J1R A;  3WEZ A;  3LEK A;  3I2H A;  3JXS A;  4XZU G;  1W8O A;  2WUH A;  2ZEZ A;  3T0B A;  1GOG A;  1JZ3 A;  1DLC A;  2CDO A;  3FHA A;  1EUU A;  4JKK A;  5JMO A;  2VL4 A;  5CZK A;  4DUX A;  5HPO A;  2R7E B;  4D0Q A;  5DQ0 A;  3FHQ A;  3OGR A;  2X05 A;  3FL7 A;  2W47 A;  1JZ2 A;  1SG3 A;  1J84 A;  4W50 A;  4GWJ A;  4BDV B;  3DYM A;  1XC6 A;  2W95 A;  4CUA A;  3LPF A;  2W94 A;  2VZS A;  3IDA A;  5G04 L;  1OH4 A;  3VD9 A;  2XON A;  3BN6 A;  5I0D A;  2W1W A;  2VOT A;  3C8X A;  1T2X A;  2J22 A;  4D8M A;  3AC0 A;  1L7R A;  3WF4 A;  1UY3 A;  2ORX A;  2J1V A;  2QQK A;  4MOA A;  4PF1 A;  2QQN A;  3VDC A;  2BBA A;  4A41 A;  3D3A A;  4XUT A;  2WO3 A;  4MO3 M;  1UX7 A;  2WN3 A;  4ARY A;  4JX0 A;  1NX9 A;  1PMH X;  4W4Z A;  1K45 A;  3I2I A;  5LA2 A;  4P08 A;  4DXT A;  4TTG A;  4JKM A;  2VZO A;  1UY4 A;  3W5N A;  3VD5 A;  3MUY 1;  1W9W A;  3VD3 A;  4OMD A;  4DUW A;  2JD9 A;  3C7H A;  4OUE A;  5HXM A;  1GMM A;  3HJR A;  2LW8 A;  2RJ2 A;  2VMD A;  3P1I A;  2W87 A;  3OG2 A;  1R64 A;  3MV0 1;  2WDB A;  2Y6G A;  2J1T A;  3NNG A;  4ZXE A;  1OF3 A;  2Y8K A;  1UYZ A;  5DPN A;  4QDS A;  4QX1 A;  1UWW A;  2Y6H A;  2XOM A;  3LEG A;  3I2K A;  3DYP A;  1XNA A;  1W9S A;  2W5F A;  3LPG A;  3WSO A;  3CDZ B;  2VM9 A;  3K4D A;  5DMY A;  1JZ6 A;  4QDQ A;  4GZ9 A;  2VMC A;  1GNY A;  2WZ8 A;  2EIE A;  2KD7 A;  1LNS A;  4P02 B;  3SEE A;  2B9V A;  1JYN A;  5JR2 A;  1US2 A;  4PT6 A;  2YB7 A;  3HOB A;  3HNM A;  2J1E A;  1W9T A;  3T2P A;  4A3Z A;  5IHR A;  2ZEW A;  2J1A A;  4JHZ A;  1JI6 A;  4DXS A;  4UOJ A;  3OGV A;  4OMC A;  2J1U A;  2LS6 A;  4L0P A;  4MAD A;  3CMG A;  4FI9 A;  3CQO A;  4OZO A;  1UY1 A;  2V4V A;  2QQL A;  2WZE A;  3WQB A;  2WO2 A;  3K4Z A;  1J83 A;  1XPW A;  2QQO A;  4OYU A;  4KMQ A;  1ULP A;  2EIC A;  3ACF A;  1UYY A;  2BGP A;  3NJV A;  3C7O A;  1H6X A;  2VZ3 A;  3WF3 A;  1XNT A;  3WNK A;  2VC9 A;  4QPW A;  1D7P M;  2JKX A;  3WNN A;  4CUB A;  1JYV A;  1GUI A;  5JXJ A;  2PQS A;  4TXW A;  2JE8 A;  1W0N A;  3GDB A;  3C7G A;  4CUC A;  3C7E A;  2Y6J A;  3DEC A;  2L9L A;  2XQX A;  2VTF A;  1EUT A;  3ACG A;  4PQQ A;  1F4H A;  2VCB A;  5FUI A;  2VMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...