4A41A

Cpgh89cbm32-5, from clostridium perfringens, in complex with galactose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
SALPQGNMKATATSEHPDVGNEGLAKFAIDGKENTIWHTKYNPVEELPQSITLELGGSYEINKFTYLPRSGAKNGNITKYELHVSEDGNNFRKISEGNWDDSGSLKTLKFNSTKATHVKLVALEGVGGFASAAELNVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Carbohydrate Recognition by an Architecturally Complex Alpha-N-Acetylglucosaminidase from Clostridium Perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords ALPHA-N-ACETYLGLUCOSAMINIDASE FAMILY PROTEIN
total genus 34
structure length 139
sequence length 139
ec nomenclature ec 3.2.1.50: Alpha-N-acetylglucosaminidase.
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4a41A00
1GUIA 1UY3A 4UI9L 1KGYA 3I3BA 2W91A 1OF4A 5HPOA 3T0BA 3THDA 2VZSA 1I5PA 1J83A 3I2KA 4JKMA 1O59A 2WBKA 4D8MA 5LCWL 4MGQA 1K45A 3FHQA 4XUOA 2VCCA 2WO2A 4A45A 1LNSA 5J1XA 3SKJE 2EIDA 4CU7A 3C7EA 3PUHA 2YG0A 1K12A 2W9XA 1YQ2A 4JHZA 2WAAA 1JZ5A 2L9LA 4ET7A 5I0DA 3VDAA 4QDQA 2YC2A 1UYZA 4GWIA 3FN9A 2VMEA 2JE8A 4JKKA 1CX1A 2EICA 3K75B 3FHAA 3ETPA 1JZ2A 3DYMA 2PQSA 1JYNA 1GOFA 3WF3A 1UXZA 2VZUA 3I3EA 3LQCA 2HYXA 2C9KA 5CZKA 4ZXEA 4DXTA 3IAQA 2RV9A 4QX0A 2V5DA 3LPFA 4P08A 2QQMA 4TXWA 2J1RA 4OMDA 4E8DA 2BBAA 1JZ4A 3THCA 4BXSV 4DEQA 2BERA 1UZ0A 2VJXA 3I2GA 3MUZ1 5LA2A 5C70A 3HNBM 2J7MA 4XUQA 5CYYA 1H6YA 2YC4A 5EJ1B 1JYWA 2W1QA 3T08A 1CZSA 2W1WA 1JZ3A 3C7GA 4HG6B 1TVGA 3ABZA 4AAXA 3T0AA 2R7EB 4ZY9A 2W95A 1JHJA 3CDZB 4AG4A 1W0NA 2JKXA 3GDBA 3OB8A 5JR2A 1P8JA 2DCJA 2WDBA 1ULPA 1IQDC 4BDVB 2JD9A 1D7PM 1UY0A 5JXGA 2W1SA 1DYOA 2WABA 4JX0A 3JXSA 3NJVA 2VQUA 1JYXA 4GZ9A 2V4VA 2WZEA 4OMCA 4A3ZA 3WNLA 3GXUA 2VZRA 2W47A 1OH4A 3PUIA 5G05L 5B4XA 1NKGA 2ZEYA 3E1F1 1CIYA 4LHSA 4QB1A 4XVHA 4TTGA 1DP0A 4DUXA 3K46A 1NUKA 5LA0A 1PX4A 1WKYA 4MGSA 1O8PA 4QB6A 3EYPA 3VD7A 4GWJA 4UAPA 1UWWA 1DLCA 3C7FA 2ID4A 3ZM8A 2ZEZA 1UMIA 3HNYM 2JDAA 4YPJA 3EB7A 2WO1A 2QQOA 2W1UA 3HJRA 1GMMA 3A22A 4A44A 4PT6A 5JXIA 4BK4A 2HLEA 2VZQA 4RN5A 2VC9A 2RJ2A 1PX3A 4P02B 3MUY1 3T0DA 4QX2A 3LPGA 2X09A 2VMCA 1K42A 2VOTA 3T2PA 2C26A 2BGOA 1F4HA 4UOJA 2YFUA 5JXJA 5JUVA 2W92A 2VZVA 1XNAA 3VD5A 3CZUA 3K77A 3DECA 4L0PA 4DXRA 5EIYB 2DCKA 3I2JA 3WNOA 3W5NA 3A21A 1XPWA 1W99A 1GU3A 1GQPA 2KD7A 1XNTA 2ORXA 3ACHA 1WCQA 3K4AA 1XC6A 1JZ8A 3T2QA 1UY1A 2VR4A 3U37A 2RVAA 2XQXA 3VD9A 1UX7A 1W9WA 3MO4A 3WF0A 3NJXA 1TG7A 5DN2A 3A23A 5JMOA 2WN2A 2W5FA 3SEPA 1BHGA 2WUHA 2B4KA 4A4AA 4QDRA 3ACGA 3CZJA 2ZEWA 3C7OA 3HPNA 1UXXX 5EJZB 4DEVA 3WNKA 5C7GA 2VMFA 2VZTA 1UYYA 1W9TA 3AC0A 4Z2AA 1JU4A 3P1IA 1W8OA 3HEIA 3J7HA 2LW8A 5IFPA 1T2XA 3I2FA 2Y6GA 4CUAA 3CKHA 3WQBA 5DPNA 1EUTA 4LQRA 2W3JA 3IIIA 2Y8KA 4M4RA 4KWUA 2VCBA 4FI9A 2VMDA 2YFZA 1NX9A 4E8CA 4KI5M 2E32A 2QQKA 4CU6A 3I2IA 3CMGA 3DYPA 4LKSA 2X10A 1US2A 2Y6KA 3IDAA 3OBAA 2J1UA 4XUPA 4P5YA 3I97A 3T2OA 3LE0A 3VDBA 5F7UA 3C7HA 4D0QA 4CU9A 2WAOA 2QQLA 3BGAA 4CUCA 2CDOA 1ULOA 2YB7A 1JU3A 2XOMA 3WSOA 5C71A 2QQIA 4CUBA 1JI6A 3GGLA 4ZZ8A 5LA1A 2BGPA 4P00B 2J22A 3SEEA 3LEIA 2WQ8A 1J84A 3LEGA 3K4ZA 3WF2A 4IUGA 2WO3A 4ARYA 4W8JA 4A41A 3NNGA 3WF1A 2QBXA 3NQHA 3HN3A 5G04L 2J1TA 1SHWB 4CVUA 4RYDA 3IB3A 2W87A 4MO3M 3WNNA 4M4PA 3UETA 1CZVA 2BZDA 2VQTA 3LEKA 2J1SA 3WNPA 1JZ6A 1F4AA 1OT5A 5IYYA 3C8XA 3VD3A 3F2ZA 4LPLA 4ZZ5A 2ZEXA 3ECQA 3I3DA 4OYUA 1L7RA 1OD3A 2XHNA 3VDCA 3ACIA 2Y6HA 3IAPA 5IHRA 4QAWA 4QX1A 4PQQA 3OG2A 4QDSA 3WNMA 1US3A 2VCAA 1GOHA 1MPXA 3SKVA 3A7QA 3P6BA 4XURA 3VD4A 2J1EA 4W4ZA 3HOBA 4A6OA 4KMQA 5DMYA 2CDPA 2J1AA 3MBWA 3BN6A 2Y64A 4OUEA 4CU8A 3T09A 1UY2A 1SG3A 3HNMA 3K4DA 3MV11 5B4NA 2X05A 1NAEA 2LS6A 2VL4A 1JZ7A 4MADA 1O8SA 2DDUA 3D3AA 5IJRA 3NRUA 3OGRA 3WF4A 2EIBA 4QPWA 1PMJX 1GNYA 4MOAA 1HN1A 2WN3A 4XZUG 2J1VA 2Y6LA 1UYXA 3DYOA 3MV01 4QB2A 2ORZA 1CZTA 3UESA 1OF3A 1GOGA 2EIEA 3CQOA 4A42A 2B9VA 4OZOA 3W5MA 3CIHA 1KEXA 4BK5A 2E33A 3GM8A 4JKLA 2VM9A 2XONA 2VZ3A 4QX3A 4DUVA 5IFTA 2Y6JA 2VZ1A 1R64A 3I2HA 5HXMA 2WZ8A 2QQJA 2ZXQA 1L7QA 2QQNA 3OGSA 3FL7A 4DXSA 2VO5A 1EUUA 3OGVA 3OEBA 2OKXA 4BJ0A 4DUWA 2E26A 2C4XA 1PMHX 1W9SA 3UNPA 1SDDB 5DQ0A 2E31A 1JYVA 4PF1A 4XUNA 2V72A 2WYSA 1UMHA 2W94A 2VTFA 1RYYA 2W46A 3OEAA 4XUTA 3WEZA 5FUIA 1H6XA 2Z4FA 3ACFA 5JXHA 1W8NA 2VZPA 4W50A 1K3IA 1UY4A 4ARXA 5A1AA 2VZOA
chains in the Genus database with same CATH superfamily
1RUJ1 3RYPA 3C3VA 3DPRC 1QJU3 2LALA 3MIBA 4GULA 4CEYC 5FPAA 5EYXA 5FXWA 5IVBA 1O7FA 2D43A 3GYDA 4UT5A 2ZAAA 5IVJA 2NP0A 5DAPA 3TAYA 2R30A 4BH9A 2DVGA 1ZRFA 3POSA 4COZA 5A7WB 1AR61 1WZXA 3THDA 5L9VA 2VZSA 4KGQA 4CCLA 5GM0A 2Y26A 4HL0A 4HXCA 4JKMA 1RUF1 3CF6E 2XLFA 1ZRCA 4WM8A 1UZWA 2WBKA 1ZBE2 5D8AA 4JRAA 1DHKB 4LBNA 3TBDA 1K45A 3FFQA 3DCQA 3FHQA 3OY8A 1MEC3 1WWYA 3LSDA 5J1XA 3U1XA 2YGLA 5J36A 1ZZ6A 4Y5TA 1ULFA 4CU7A 2AGSA 2YG0A 1VBD3 1YQ2A 1W8FA 3KB5A 2PELA 2WAAA 1JZ5A 4ET7A 1G7YA 1PGW1 1XU1A 4ZXKA 4LBQB 2IC1A 1IG3A 3K51A 4Y5Z0 2VMEA 4M3CA 3NV1A 4JRLA 2BVBA 3PURA 3K75B 2KA3A 4SBVA 1JUHA 5F5IA 4YW1A 5C8CC 2ETEA 3KWVA 1RITA 1NY71 1OA3A 1HIXA 1ND3B 2PAEA 2QE3A 4QM9A 3U10A 3LQCA 1SEFA 4CXXA 2VU9A 4Q4X3 4UFMA 3QCWA 1IS3A 4HPKA 1VRBA 3IAQA 3N36A 5JSOA 1R092 2QQMA 1VRH3 5FY5A 1DYKA 3U0ZA 2A75A 3CJIC 5FYSA 3VHNA 1LHUA 4FP3A 5M0TA 2RE9A 3WHUA 2VVEA 3THCA 2R043 3Q8BA 4FXKB 4BXSV 1X9PA 3KHCA 4AEJA 4JQRA 1VMFA 2RDSA 4CZSA 1NCQB 1EP0A 1XNCA 1ND3C 2VJXA 1UZ0A 2GMMA 3V56A 3HMYA 4AI9A 2C1FA 1N1YA 2VY0A 1A8MA 1RUC1 4IL7A 2J7MA 5DDJ1 2VCMA 3HIFA 5EJ1B 3ZXAC 4N8MA 1UOFA 2W1QA 4XF1A 3MPPG 1WMFA 2LROA 3M3QA 1TVGA 3BOWA 2Q8DA 1D2SA 2LM3A 4AAXA 1MZFA 1H2MA 1U0AA 4UW6A 3T0AA 4GMP0 4DINB 2WSVA 1GP4A 1YNAA 2FCTA 4AQ6A 3CDZB 4GAZA 2ARAA 5ABJC 1NZIA 1W0NA 4QU2A 1BXHA 3GDBA 3H42B 1V9U3 2WKKA 3T4VA 2PHFA 4NRMA 2VVFA 1P8JA 2DCJA 2ZGTA 4AWDA 2VXRA 3TRSB 3AYAA 3POGA 1DQ0A 3KV6A 2FDFA 4UFHA 2XJSA 1DYOA 2C0ZA 1UOGA 2EAAA 1PMIA 2WNVA 3OSDA 2RS51 1YYNA 4FVVA 2XJPA 4NN0A 5JOYA 2WNUC 4R4ZA 4F7ZA 3H50A 2JG8C 4NPLA 4PI0A 2RS13 3TN91 3WZ1A 1MVQA 4CP1A 2XVLA 4LIUA 1I1EA 5FMBA 3WVJA 1ZZ7A 2R062 2PHWA 4A3ZA 3L2HA 3J8F1 5D2AA 1AR82 3WNLA 4C0BA 1LTEA 1YIPA 4AW7A 2VZRA 3PUIA 1TMF3 4K20A 5G05L 2Q0AA 2NQYA 2ZEYA 1CR7A 3KT1A 1HXS1 2ILMA 3VBSC 1AHSA 3B93A 2YBPA 2CL2A 1WW4A 2HYKA 5A6ZA 1BEV3 1WCKA 2C24A 4X8PA 1LGBA 1WCUA 2I2SA 2ZGMA 3WX5A 1W3XA 3MW4A 4R4XA 5C5UA 3ZN6A 3MIDA 3KT4A 2D6MA 1NUKA 4HONA 4K40A 3FBMA 1R081 4H3WA 4XFFA 3N4MA 1O8PA 1IPSA 1HRI3 1RHI2 3EYPA 2O14A 3ZR6A 1FYUA 2VMGA 2P37A 1OQDA 4AAPA 1DLCA 2CU5A 4Y1XA 2VECA 5FWEA 1K5MC 2A6XA 3C7FA 4Q27A 3S5QA 4BMEA 2ID4A 4D7TA 1RB8G 1MS8A 1QY4A 3OUIA 1O3RA 2HH9A 5IT6A 1JS9A 4ZS3A 5BNNA 1H1IA 4MGTA 1O3TA 2VULA 3LIGA 1S0IA 3HNYM 3KF5A 1AYM1 1Y9GA 4LXLA 3VL8A 3O1RA 1E5RA 1LOFA 2W52A 4XQ4A 1W6MB 2K2SA 2A73B 2VD7A 2YPDA 3HJRA 4LBMA 2VAUA 4OHWA 5F3IA 4A44A 2CGNA 2VOKA 4BK4A 5L7OC 2HLEA 1NLRA 4H7MA 1MQTB 2HWE1 4ES9A 4EE2A 4EYUA 4HKWA 4CDQB 2A5ZA 2DCTA 5BXXA 3ZX7A 1CONA 2UYBA 1VBE1 2VMCA 1YQ6A 1K42A 4R52A 2C26A 2PHXA 5FXVA 4IEXA 3ME2A 4UOJA 1ZBE1 2VMHA 4BCUA 1OLQA 5JXJA 2FZ2A 1ZZBA 1ULGA 2QDNA 5LY2A 3S5AA 2E51A 2ET7A 2XPJA 1H8TC 2EALA 2GMPA 4DXRA 5A80A 4IGPA 4NUBA 4RQPC 2JG9A 1WD4A 2DCKA 4GKXA 4P9YA 1MS5A 4FO9A 2D5FA 3WNOA 3AZWA 2ET1A 3N9OA 3PL0A 4FBFA 3A21A 5FZOB 1RUI3 5FOBB 2P4EA 5K0UB 1H1AA 2OUJA 5LRSA 4FPEA 2JDHA 4YW2A 3ZFFB 4BIOA 5K0UC 3ACHA 1WCQA 2ZX3A 3ZO0B 5JSPA 2SLIA 2UY9A 3H7JA 1JZ8A 1I3HA 1UY1A 3FLTA 4FXGB 4LLOA 3JBG3 3WHTA 2VR4A 3J7NA 4AVVA 5C6CA 1UZZA 1E5HA 4LO8A 2RVAA 1GQHA 4I02A 1ST8A 3VD9A 2HWE2 3MFCA 3VN4A 3AK0A 1I6XA 1PIV1 4SLIA 5LK5A 5J09A 1VBD1 3WDYA 4E2GA 4COUA 1Z78A 4IGQA 4YGEA 5LBFA 3MO4A 1VBC1 4HOOA 3EMRA 1J59A 1FV2A 4CA9A 3UJQA 2PHTA 1H0BA 4IXLA 4Q0VA 3DN7A 4B1MA 2DVBA 5EPAA 4LEJA 4FFIA 2JDZA 1DZQA 3NV4A 4XCAA 3ZDVA 2B4KA 3HT1A 1ND2B 1RIRA 1ZRDA 4QGNA 3VZMA 3AZZA 2ZMKA 2I07B 4RR3B 1UXXX 4GH4B 4AFCA 2QVSB 5CG8A 2VH9A 1AR92 2WRAA 2F4LA 3N9LA 4DEVA 1EV13 3N35A 4LHNA 4M3CF 4AEDC 2VZTA 4JC1A 3AYDA 1UYYA 4W6WA 3POJA 4JZRA 3RZHA 5I8TA 1X9TA 3ZOIA 4I0BA 3POWA 1WMXA 2Q1ZB 4WV8A 5C3QA 1VRH1 1VLNA 1HV1A 3PNAA 2HWF3 3VBUB 1W8HA 2D6LX 3POIA 4HVQA 5ACA1 3I3MA 3N9NA 1H2NA 1TQ5A 4XXPA 2BP6A 4OZXA 2O8QA 3PHMA 5DPNA 4LQRA 4P9GA 5JI7A 3IIIA 3NAPA 1VB2A 1Z0HA 5GLZA 1QNYA 3WW2A 3PUQA 1JOBA 1WUVA 1DQ4A 1CJPA 1WCSA 5F32A 3N3HA 1VBB1 4E8CA 1X8MA 4AHYA 4Y20B 4UBHA 1WMDA 4MGIE 4LKSA 4N53C 2X10A 1US2A 4YARA 3AXEA 5FZCA 2F17A 3IDAA 5JIUA 4CCEA 4P5YA 4CSWA 2PYTA 4ONUA 4NMIA 5J48A 5DAWA 5F7UA 1FOD1 3C7HA 2DTWA 3V0AB 4PDWA 4NWWA 5HV0A 2JG8B 1AYN2 1OLME 5J37A 4AGGA 1B35A 3DUIA 3WSOA 2ZABA 3D8CA 2QQIA 4XJ8A 3WCRA 1UU4A 1OPOA 2GDFA 4COVA 4AEDB 2BGPA 3M7AA 1QJU2 2ZBJA 5CEHA 3WG1A 4Q4W2 3H8UA 3AMPA 4LKDA 2BDRA 3VZOA 4XJWA 3T4HB 2NZ9A 1OMIA 2VUCA 4YFWA 3LEIA 1YIFA 1CAUB 2GSYA 3WP4A 1PO12 3B5LB 2JDUA 1GWMA 1UQXA 2GNDA 4IUGA 5GZCA 2XJUA 1Q8QA 4XJAA 4COWA 4W8JA 5FO8B 1VAKA 3PVEA 5KXBA 1LULA 1G86A 3NQHA 3ZXEA 1CX4A 2G1MA 4CVUA 1BEV1 1WW7A 4RYDA 1AR91 2W87A 2XKPA 2JE7A 3SMHA 1UMZA 1BCXA 4F83A 2VQTA 2BZDA 4NRQA 4AVAA 1NG0A 1POV0 1RUG1 4JGZC 1OH3A 5KXDA 2DURA 4MSVA 1YCIA 1F4AA 1SLTA 4UXAA 3C8XA 2R071 3KZ4C 4MYEA 3UV9A 5F3GA 5CIRA 1MZEA 2ZAHA 2XVGA 1YWKA 4LBOA 1DBNA 4OVEA 3I3DA 4UW3A 3U75A 3U14A 2KXLA 2XHNA 3VDCA 2OQ6A 4BQ5A 1LENA 2JECA 5CB7A 3IAPA 3ZYJB 3SC7X 3ZSKA 1URXA 4BQ4A 2ZPXA 2WWUA 3GJBA 4JGZB 4UFLA 4Y1ZA 3ZMOA 1EAH3 1GBGA 4CP2A 4AI1A 2DVAA 1MS4A 1DG6A 4CCCA 3APBA 4F3JA 3MF9A 4YVWB 2GAUA 1WBLA 3ST7A 4XURA 1SPPB 1OKQA 2VUJA 3FHIB 5KHKA 3RRDA 2J1EA 1CN1A 4XFIA 1QJY2 1WCDJ 4XPVA 3SCFA 2V73A 4QXHA 3HOBA 3ZXGA 1LESA 3AKSA 3WINE 3GCWA 4KMQA 1EPWA 5JZGA 2EXIA 2EXJA 4WM7C 3MBWA 4HZFA 3J7LA 3PJQA 1VBD2 2QZ3A 4OUEA 2WNUA 5FZEA 4CU8A 1WLTA 1SG3A 3MV11 5HXVA 3RWKX 1CAWA 4PIZA 2LS6A 4CDXC 4LKFA 2G19A 1JZ7A 3INAA 2JICA 3I54A 2RM21 5FZIA 1O8SA 3OUJA 2A1XA 5A7SA 3WF4A 2EIBA 4LORA 1PMJX 2AR6A 4Q1PA 5FCCA 4RHV3 4QKNA 5FP4A 3UGFA 4I30A 2VTXJ 4JHTA 4XZUG 3OPZA 1NCQC 4IGOA 5JLVA 4PBPA 3DYOA 3MV01 1M4WA 5FO7B 3WDUA 1A3KA 4QB2A 3ZXKA 4INDA 1DYPA 2BGCA 2ZACA 3ETQA 3CQOA 4BXFA 4A42A 5DUVA 2R6QA 5BNPC 3CIHA 4DY3A 3OCPA 4ZU4A 5A70A 3VBUA 3BU7A 2E33A 3KV5A 4IV1C 1J1TA 3SNMA 2RS12 2VM9A 4YZ4A 2WQ4A 3MIEA 1AYM3 3U07A 5C4WC 4DUVA 5IFTA 3O14A 3I2HA 2VOVA 1W0PA 3H8XA 4CDUA 3AP9A 4XBNA 3GZEA 1FMD1 4AFDA 1NT0A 1MVEA 4KBBA 4XFCA 3V0BB 4M00A 2YYOA 1EV11 3VDDC 1WBFA 3LF7A 5BV6A 2VO5A 3KD4A 4ATEA 3OEBA 4DUWA 2E26A 4GQ7A 3RYKA 3ES1A 4FPFA 4LUMA 4XE9A 1SDDB 5DQ0A 5KWRA 5ERLA 2E31A 1JW6A 3MIFA 4XUNA 2V72A 3VBHC 1WD3A 2CSGA 2VTFA 3H1YA 2X5IA 4QHBA 1OFNA 4XUTA 5FTTC 1SFYA 1ALYA 1C8M2 3FBYA 3WLUA 1DU3D 4HVRA 2H0VA 5FIXA 5ABJB 5I8YA 1ZBA3 3GZAA 1W8NA 1A78A 2A6VA 4AVSA 3HT2A 4DS0A 4HFSA 4Y24A 1AL22 1PO11 1SCRA 1C4RA 1W2AX 3ZFFA 3CO2A 4XILA 1FOD2 2WWJA 4A7KA 4IV3C 4XIKA 2WJSA 1V70A 5DZEA 3ZSMA 3CEWA 3SHRA 4ATFA 2W91A 2P3YA 4AVCA 4QPGB 4WBBA 1WLCA 4PIYA 1OF4A 1NA1A 1GANA 2RS33 3MIGA 5FQ0B 5KHJA 1DGRA 4Y1YA 2AENA 3S30A 4JDMA 2WFF1 3HWJA 2ES3A 4O61A 1IZ3A 4Q4Y1 4Q4X2 2NMNA 1ULEA 1VBB2 1SPPA 1HW5A 5FP9A 3WOGA 4XAEA 2IXIA 1BK0A 2VPVA 1QXRA 5C9AC 1UN1A 5EJ3A 3WG2A 4DOUA 5FLJA 3VBFA 5A6YA 4XFBA 4E9KA 2RR11 5EWSA 2LUWA 5LK7B 4CCOA 5HCHA 1D0GA 2WS91 3HQRA 2AH2A 4KL1A 5BNPA 2Z79A 3JQWA 4IE0A 2HWD3 2YU2A 2H0BA 1PVC3 1C1LA 1OI6A 1RXFA 3LWCA 1RUE1 1Q5OA 3N9QA 5C3RA 4RQPB 1D2QA 3WUCA 1QGLA 1UZVA 2X5IC 2G9GA 3K3OA 2QZ2A 4AF9A 3ATGA 4LOTA 5AVPA 4QDQA 1UKGA 2YC2A 3M3CA 2XBO2 3B3QE 1Z7S3 1W9FA 5KR7A 3R0RA 2V4AA 3LFMA 4RA0A 4ZU5A 3CLPA 3ETPA 1JZ2A 3DYMA 4IEWA 2PQSA 1GOFA 1FPN2 1LODA 4AYUA 4H14A 2HYXA 4J6GA 1REFA 3LGRA 5CZKA 3GBWA 1S55A 3E97A 2YHJA 1O6UA 2RV9A 4QX0A 4TXWA 3LPFA 1VBB3 1L7LA 1BMV2 1LHOA 2Y60A 1VRH2 2J1RA 4L8QA 1NA1C 4OMDA 2EIGA 1W2UA 3M8LA 3ZFGC 5L19A 2ADDA 4GMP1 3NAPC 4PQ9A 4QMAA 4Y33A 2A6WA 2CAUA 3MLKA 3IT8A 4RD7A 5C3PA 2XUEA 4HKLA 4MZUA 3GBFA 4NOTA 2Q8CA 3I2GA 4YZ5A 4C91A 1RC6A 4M0NA 5F9TA 3HNBM 4S2FA 2GMEA 3ZPOA 4OI0A 4N7IA 1E5IA 1LOFC 3TEWA 1Q3EA 4XFGA 3H3UA 2VNOA 2YC4A 3D82A 2H6BA 3C2UA 1CPMA 2W1WA 2YGMA 2XBO3 3C7GA 4HG6B 4XDQA 4NIGA 4Y4RA 1RMU2 2DVFA 3ABZA 1KD7A 1QJY3 1SZBA 1OQ1A 1A6CA 2BTVC 2R7EB 1JHJA 3ZFGA 4YFZA 1LCLA 1E57A 4K1ZA 4AG4A 2HWD2 1UKRA 2JKXA 4E2SA 3BB6A 2B42B 2GZWA 3G6JB 3N7KA 3OB8A 3E6BA 3SQOA 5JR2A 5LW9A 3TB0A 5FXZA 1OVSA 2D97A 4GWMA 4BDVB 1DQ1A 2WFF3 1F9KA 2JD9A 2OQ7A 3IDBB 5JXGA 1ZA4A 2ARCA 4CEWA 4CCKA 2WABA 4LBJA 1YLLA 5AVAA 1HQWA 2PLV2 3SCGA 1IKQA 3JXSA 1VAVA 3ILFA 1F5FA 2VQUA 1F31A 1JYXA 3R4SA 4O65A 4CCDA 1JXNA 2RS32 4V2WA 3HN1A 1AYM2 5A7PA 1IPJA 1FPN3 2XL9A 4LE4A 4AZZA 3RZMA 4P5HA 3EBRA 5FPLA 3ROUA 3CL1A 3SISA 3UKNA 2AEYA 2W47A 1BVVA 4RGAA 1YFXA 5C5TA 1Q8VA 5DABA 3H9AA 5FXXA 2D6OX 2ZGUA 5H9SA 4LHSA 1CIYA 4UFJA 4QB1A 2UWCA 5FQ0A 3ILRA 3O1OA 4XVHA 4CEWC 4TTGA 5SV5A 3K46A 1U12A 5EYYA 2GH8A 3VZKA 3UT0A 1W04A 2JJ6A 2XJTA 1W8WA 2YBSA 3NMBA 4OCTA 2F4PA 4B4RA 3MEPA 5GZEA 4GWJA 4UAPA 1LB2A 1BZWA 2NLRA 4A6SA 4Z82A 3P3PA 1APNA 3RSJA 1S2KA 1YQ5A 4I0AA 3I8TA 3ZM8A 2WO7A 4RS5C 2ZEZA 1JTZX 1YUDA 3Q8EA 4QXKA 5LEKA 4JDOA 1W2NA 1WGPA 3I2OA 5A3WA 1UMIA 1RUI2 4CXYA 4YPJA 1CESA 1LGNA 2ZZQA 4FOQA 1B09A 1G8WA 3W58A 4EWEA 2WA3A 5CFDA 5LASA 3ILNA 1R082 1O3SA 5C9AB 3EQEA 3A22A 4K3UA 4OHYA 2DBIA 5DAVA 3JZVA 3IM0A 5A33B 1NE6A 2OPWA 4P9JA 4P9WA 1UD1A 2VZQA 3GZTB 1COV1 3JU9A 5C4WB 1FXZA 1YQCA 4IEZA 1JHNA 3ASIA 3MUY1 5LRRA 1KS4A 2AACA 1JUIA 4PLNA 5EQUA 5FZ3A 5A3UA 2P6CA 2RDNA 3JCIA 5CBLA 3WQ1A 2X09A 1O4TA 1MEC1 1SQ4A 3T2PA 2BGOA 1F4HA 5CU1A 1CAWB 3VKFC 1AR81 5DXDA 2YFUA 2JDYA 3K3NA 3KCYA 4KGGA 4Q4W1 3WDTA 2B5HA 4XACA 4HANA 1LOCA 3M2MA 4Q4X1 5CAZA 1VMHA 1XNAA 1PZ7A 3VD5A 5I93A 2UYAA 1PO22 1W6PA 5EIYB 1KXGA 5GZFA 1QMJA 1OD5A 1WW5A 2RJKA 3GHNA 4I09A 2BV4A 4LA3A 4DO0A 3W5NA 2BJSA 5EP9A 2XDVA 4I2OA 1G9FA 1OQEA 3EJKA 1XPWA 1VBA3 4QGMA 3VBRC 2JB8A 2F6BA 1E5SA 1GQPA 5DDJ2 4FTSA 1XNTA 4Y5SA 3JB4C 1MEC2 2DUOA 4J25A 2DF7A 2P3IA 3W21A 4XQDA 4LTAA 4N9HA 3O7OA 2TBVA 2YC0A 3OPWA 1W6OB 4YW3A 2A7AA 1PVC1 4GALA 1HRI1 1XSRA 4Q0PA 4TWTA 1W9WA 5I91A 1GP6A 2XGXA 3GNEA 1YHFA 1PVXA 3WF0A 4XBQA 3FJSA 5F5CA 1TG7A 2W39A 3A23A 4IEQA 5BNNB 5JMOA 2W5FA 1PK6B 4LOSA 4NVPA 5F8PA 3SEPA 1NE4A 4Q8LA 1BHGA 2WUHA 1YQ8A 3AMHA 4UF0A 5FZAA 4A4AA 4EV0A 3BTXA 3ACGA 3CZJA 4CEYB 2ZEWA 4N53B 3C7OA 5K7PA 2OW4A 5FAXA 1W8UA 2NYYA 1ACCA 5EJZB 3UK9A 2CTVA 3ZIWA 1W6OA 3O1VA 1EV12 2VMFA 1J58A 4CP9B 4Q2FA 1XYPA 4Y26A 5FY0A 4D7SA 5FY1A 1W9TA 1PGW2 4EROA 3AC0A 4EWDA 2ARXA 5JCTA 5A32B 1GR3A 5KHGA 4RGGA 2BFUL 5JR7B 1RUH3 3P1IA 1OFSA 3HEIA 3VD4A 4NR1A 4A3XA 1J3PA 3ENRA 2I74A 3DL3A 5EV7A 1CPNA 3I2FA 4XDOA 2Y6GA 4NO4A 4MHUA 4LNVA 5CFCB 1NY72 3R4DB 5L36A 1XYOA 4O9GA 1BBT3 2R1DA 3KGLA 2UU8A 4FSJA 1AR72 2W3JA 4FOVA 1IS5A 4OI1A 4XJ9A 4AI3A 1TMF1 4CDXB 4FFHA 4KWUA 3ZDSA 5E16A 2VCBA 3AL5A 5LZ6A 1ASJ1 1NX9A 2NM1A 4WM7B 1QQP1 1REDA 3QBQA 2QQKA 4CU6A 3I2IA 4Z92B 2BPA2 1EPZA 5F5QA 3DXUA 5FPVA 1QEXA 3O12A 3T1MA 1QOSA 4GKYA 2IFWA 3LA2A 4FPHA 2GP5A 4GWNA 5FZ8A 2PLV1 4PDWB 3ZSEA 3O0XA 2Y6KA 2RM22 5KXEA 3GF6A 1LU1A 2J1UA 4QKFA 3LOIA 4O9EA 5A33A 4OQ9A 1YFWA 1UYPA 3OYWB 5FZDA 5IAVA 5IATA 3LE0A 4JGYB 2HWB1 3JD71 1TME3 5CFCC 1CAUA 1GLHA 2IWGB 1S2EA 2WAOA 4P9IA 1H2KA 5IVEA 3OBZA 4BQ2A 1OUSA 4Z2WA 1AYN3 4IEOA 5I8SA 5IUQA 4OHZA 1JU3A 2FMDA 5C71A 3VZJA 5LB6A 1JI6A 4LK7A 2RHPA 4FPCA 4QWNA 4YZ1A 1D4VB 1FNZA 2WNOA 3RGBA 4MG2A 2LRPA 3THTA 5FLHA 3M70A 4MXWA 3DPRA 4NHMA 1GNZA 3LAGA 2VNVA 3VKNA 3QD6A 4HSJA 4AOCA 1GFF2 5DZGA 4P00B 4BPZA 2BYVE 2J22A 3RPQA 3JD72 4CPBD 4BQ1A 5FP3A 3V0AA 3I59A 3MI8A 1J84A 1RUJ2 4CDWA 2B8MA 3K4ZA 1AX2A 1MS9A 4NHLA 5E88A 1K5JA 3K48A 5FY9A 1TE1B 1F8VA 4UWDA 1QHDA 4XTMA 4NIHA 4ES8A 3IB3A 4LA2A 3L2YA 2XR4A 1J1LA 4KU8A 4MO3M 1NYWA 4KWJA 3UGGA 1RHI3 4M4PA 4XFHA 3WNNA 3ZFEC 2YZ4A 3ZIXA 2CAVA 1CZVA 3K2OA 1S0DA 1VB4A 4AHWA 2J1SA 5A3LA 1QJX1 5LA9A 5FZKA 4D7YA 4EN6B 1PNGA 1TMF2 1IS6A 3BUCA 4YG6A 3WNPA 3KHBA 3LDRA 4B8EA 1OT5A 1BJQA 3AP4A 3NAPB 3ZKUA 5F3EA 4XQWA 1BEV2 3Q8CA 3E5QA 1D4M3 4Y3OA 3ECQA 1GZCA 1QJFA 1O4ZA 2ZGLA 5FYUA 3ZYBA 2GC3A 2JXAA 2OZ6A 4YM3A 2XUMA 2Y6HA 4O7XA 4QAWA 4QX1A 3MHZA 1WW6A 1ZZ8A 1AXZA 2QTWB 5HBAA 2PFWA 2X53S 5CKMA 5FZ0A 4LT5A 3B01A 3WNMA 1US3A 2GNTA 2EXKA 2ZX4A 1FOD3 4MX3A 4EWAA 4AI0A 1GOHA 1MPXA 3IPVA 2ZCWA 3SKVA 3A7QA 4KQ7A 1C5IA 2P6HA 1W8TA 5FZOA 3RMYA 3BIEA 2IXLA 1L3JA 1RUD1 3DPRB 3AMQA 1MR5A 3J8F2 4ORFA 3E5XA 2DFBA 3WG4A 5DMYA 4Q4Y2 3ZYRA 2MHFA 4TSVA 4X6QB 1WA6X 4CE8A 2J1AA 1HB4A 3BN6A 1GV9A 3J7MA 4HVOA 4IE6A 2XJRA 3UJOA 3JD73 4GIQA 3AMMA 1JOJA 3KF3A 1UF2C 3ZMNA 4ASKA 5T55A 3WT3A 4HK9A 2ZGKA 3D3AA 5IJRA 5I0SA 2Z42A 1OLMA 3D0SA 3SLIA 3OGRA 2IUWA 2ZHKA 3WXPA 1RUNA 1I9RA 2XH6A 3LDKA 2G9FA 4MOAA 3BALA 2WIIB 5T3NA 1VMJA 1HN1A 1CJDA 1ZX5A 2A70A 4YZ3A 1ZREA 4YVSB 3RZJA 5AC91 2J1VA 2Y6LA 5D8AC 1XNKA 2Y34A 4Q4V1 1C57A 4CUGA 4AEMA 2DUPA 1CZTA 3MYXA 1GZ9A 5FYZA 1S0EA 1HRV3 2EIEA 2JDPA 1HRV2 4IESA 1QIQA 2BRTA 4OZOA 4YW7A 5EXOA 3RZLA 4JQTA 3AYCA 4NPMA 2QDRA 5GLTA 1SACA 1KEXA 5ACA3 1IPKA 4YGCA 5CA6A 5JOZA 5ACA2 2KR2A 2XONA 2VZ3A 5F3CA 1XSQA 5FZBA 1HQNA 3W20A 5CFCA 2AREA 1R64A 1GYKA 5FZ1A 2WZ8A 1F15A 2QQNA 2ZHMA 5J96B 3RWNA 5FYVA 1ENSA 4AK3A 4CDQA 3MDPA 1IHMA 2JKBA 2WNEA 1EUUA 2WZR2 4BJ0A 2A6YA 2D3RA 2C4XA 4WVMB 1FT9A 1W9SA 1SBEA 4AVBA 2OIIA 4WM7A 4PF1A 5DAXA 2XMLA 1VBA2 1UMHA 1TNRA 2W94A 2QFEA 2XKOA 1PM4A 3AFKA 3CU7A 2W46A 1S0JA 4G4FA 3VDDA 1HB1A 2OVUA 1BBT2 1UO9A 4QT6A 4RGKA 1QJZA 1SBDA 5AFBA 2ENRA 4N43A 1PK6A 2Z4FA 4TN7A 5E1RA 5JXHA 4PBOA 4W50A 1DIWA 1U5YA 4L9BA 2YUEA 5A1AA 1KJLA 1VIWB 1CIWA 4BMBA 1MACA 4PHZA 1H8TB 5GLUA 4UI9L 2I45A 3VZNA 5KHIA 1V6IA 3I4IA 4NHXA 2BOJA 2AEZA 4URAA 1KGYA 2ZMLA 1W28A 4N9IA 2Z2SB 4P14A 5HPOA 3ZR5A 1OLRA 2BQPA 4QGLA 2ZGRA 1I5PA 1S4CA 3FX3A 2DUQA 4W6XA 4XMAA 1J83A 3I2KA 2GC0A 4AEKA 4CYDA 1MQTC 4EJRA 1TEIA 1GWKA 2HBUA 4RHV2 2PHLA 1W3VA 1LKNA 4D8MA 1NA1B 3M3EA 3OGGA 4GB33 4XJZA 2A3WA 4AHZA 1VAMA 4PF5A 3A0KA 5C8CA 2TEPA 4QPGA 5H9QA 4XUOA 3RI9A 3TEZA 3QOPA 5A3MA 4GJZA 1STMA 3N7MA 2R041 2VCCA 2WO2A 4A45A 1LNSA 3VBRB 2EIDA 4XTPA 4BU2A 4L11A 1K12A 1FX5A 2W9XA 3PTYA 1HB2A 3ZXFA 1KQRA 3FWEA 4JHZA 1DQ2A 3HQUA 4XHBA 4YGBA 3VBOA 5IVYA 5DG1A 1JYCA 1NCQA 4R8HA 1RUJ3 5DDJ3 5FFOC 3VZLA 1XXNA 1UYZA 4UBGA 4GWIA 2NMOA 1UU6A 1RMU3 1KDMA 3FN9A 1ZRRA 2FCUA 3WCSA 2X5IB 2K46A 2JE8A 3MW3A 5CFDB 1G9CA 3R05A 1LEDA 3LIHA 1AVBA 1SLLA 2E6VA 2BU9A 3E5UA 3PTRB 3ZSJA 4K7JA 3U4XA 3AJYA 2WC2A 1UXZA 3I3EA 2IXHA 2JWPA 2XHKA 4Q4V2 3PUAA 1SLBA 1HB3A 2V5DA 1YFYA 4E4HA 4UYBA 1LECA 1W0OA 3TEXA 4E8DA 2BBAA 2WZR1 5FYCA 1PHMA 4YW5A 4C90A 3M1HA 1XNBA 5FMOS 1N1SA 2PLV3 2R49A 5F37A 1H9WA 3B02A 2ZOEB 1D4M1 3HD8B 4CCNA 1ENRA 5LWBA 2OZJA 1Y7BA 1W6QB 2A71A 3AKTA 5LA2A 3T30A 4K1YA 2UY8A 3AKRA 4QX7A 5C8CB 5JDBA 3BTYA 4QPGC 2FD8A 5CFDC 4V2VA 1V9U1 4ITCA 1MS0A 3MLLA 1GZWB 3FUQA 4NE9A 2PQQA 5CYYA 5T52A 4NIAA 1JYWA 3T08A 1CZSA 1N3PA 1QWRA 3RZZA 2DCZA 1N47A 1S0GA 1ND3A 3TN92 4B4PA 4JV4A 4MGKE 2TNFA 5C3SA 2RS53 4QPYA 4URTA 2RS52 4ZY9A 2W95A 1OA4A 3POBA 1FNYA 4XBLA 3GBGA 4FPOB 2ZGPA 4LMFA 1DZTA 3WDWA 4JGZA 1NCRB 2X29A 4AQSA 2DTYA 3S7IA 3G7DA 2WDBA 1ULPA 5K9YA 5FBZA 4AL9A 1GNHA 4P9XA 2DYCA 3VBHB 1AL21 1POV3 4JX0A 4MGYE 5IVVA 3NJVA 4HT1T 2YXSA 1NXD1 4IE7A 1TNFA 1QU0A 3MPBA 1REEA 2PXJA 4N43C 2AZ5A 4YVSC 2XVKA 3NSTA 3KS7A 4GZ9A 4UFIA 3VL9A 2GN7A 5L9BA 5LBEA 1AF9A 2WZEA 1HDKA 2O0OA 5J7MA 5FZ7A 4OMCA 5GLVA 2DBNA 1R083 2DU1A 3Q8AA 3H8OA 4AFAA 2Y33A 3GXUA 3PJYA 1OH4A 1PGL1 1XJAA 3O0WA 1NKGA 4AFBA 1JH5A 4IV1B 5T50A 2HWE3 1SLAA 2R1BA 2OPKA 2ZKLA 3RS6A 2OT7A 5A3NA 1D4M2 1V0AA 2EF6A 3TNPB 2BW8A 4NAMA 1X7NA 5J98B 4UFKA 1LOBA 2FDIA 1VBE3 2VOXA 2XLGA 1JODA 4LBQD 4S2DA 1IGOA 2W0XA 1S2BA 4FAGA 4EQVA 1WKYA 4MGSA 1Y43B 4NHYA 4QM8A 3RVHA 4FPKA 3I3QA 3WW4A 3DF0A 1Q43A 4IV1A 2XL7A 1UWWA 3FC0A 4Q4Y3 5JWPA 1PO13 3WG3A 3AMNA 4H7LA 2VQ0A 1AJKA 3ZN5A 5HV4A 1CAVA 1BK1A 3LCPA 1R1ZA 3N9PA 4HN1A 3IWZA 3AZYA 1X50A 4DXZA 3EB7A 1OKOA 4E2QA 4IW3A 3RYRA 2E7AA 2RS31 4UF0B 2WYFA 3ON7A 2QQOA 5A7NA 1OOPC 2W1UA 4CPBA 2A3YA 5FV3A 1GMMA 3H7YA 3JBG1 4DZGA 4EZ4A 2HWB2 2MEV3 1PIV2 3WP3A 1GKBA 2WLQA 1W6NB 5FUPA 1W06A 5F6LB 1FMD2 2WR9A 4GJYA 1Y9QA 4P02B 1ENXA 3CJXA 4QX2A 2QUOA 4LBKA 4XXAA 5D1IA 5FDBA 1Z7S1 3Q9OA 5FJKA 2P34A 4JAAA 4MLOA 4BQ3A 2XQRA 4YNIA 1DGLA 1BKZA 3AKPA 4NRPA 3CBNA 4HMZA 2B45X 4B4QA 1XQNA 2HWD1 1DF0A 2JDNA 5ANQA 2Q4SA 3ZYGA 5LEJA 1LRHA 1NXMA 3UYJA 2Z5WA 4MGZE 2W92A 3MIHA 2RMU1 1NLQA 2VZVA 4QD2A 4NPRA 2NPIA 4TYSA 4B29A 1RXGA 4BWOA 3K77A 3DECA 4L0PA 3MICA 3I2JA 2YPJA 2GC1A 3NKGA 1LR5A 1SDWA 5LBCA 1VBC3 4XMIA 5HCBA 2ZHNA 4ASMB 3PU3A 4OQ8A 3OBTA 1GU3A 4DMIA 4QQ2A 1XC6A 1VBE2 3D4KA 1H4HA 1KDKA 4IEVA 1W9YA 3L9JT 4K8FA 3T2QA 5ANNA 4UW5A 2WZPP 4AHXA 1AR73 1UX7A 1V6MA 3VKMA 4GH4A 1PZ9A 1HQLA 1UIKA 3KM5A 1YXWA 1PO23 2SBAA 5C33A 5CKQA 3V65A 4KU7A 4XETA 4DRVA 2CWMA 3NJXA 1CQ9A 4GMP3 3VBFB 2QQUA 4QKBA 2WN2A 5KC6A 1A34A 2ATFA 1NZCA 4ZPIA 1QJY1 1ZBE3 2OA2A 4J1WA 1JOPA 3OUHA 2XB6C 2MPFA 4PDWC 2IVJA 2QKDA 4CP0A 3WNKA 4PIXA 5C7GA 2DCYA 4GXLA 1WLWA 2XBO1 4LLFA 3VBOB 3VBFC 1ZNPA 2VBDA 3EHKA 4Z2AA 1AL0G 2D98A 5FMCA 3NKTA 1H8VA 3RMXA 1JU4A 3D5OA 4FPYA 5F2WA 2P2KA 4KWKA 2IVIB 1CAXA 3N7LA 2YBKA 3O1SA 4FCAA 2QCSB 4KG8A 5JPNB 5CADA 1K5MB 1PM7A 1OPMA 5E89A 1FPN1 4CUAA 3CKHA 4DY5A 1EUTA 4HN0A 3V64A 2DU0A 5JSRA 3QLQA 5A3PA 5E6HA 2Y8KA 1KS5A 4IE4A 4D3WA 1B35C 3PIGA 4MV2A 1H30A 4EN7B 4CXWA 2VMDA 3HQXA 5F2SA 1CWPA 5DUUA 4RFT0 2EXHA 2HWF1 4GB31 4KI5M 4K21A 2E32A 3OTFA 3GZUC 2JEMA 5GKAC 3DYPA 4OI2A 5FREA 1ULDA 2ZMNA 1CGPA 4QKDA 3RI8A 2D44A 1RUE2 2YU1A 1PNFA 3HVDA 1BLZA 1MQTA 3T3YA 3AM2A 4E4SA 1G9DA 5IK7A 2FDKA 2GP3A 4Q26A 4XUPA 2WS92 3I97A 4XF0A 1W6MA 2Z69A 4QXBA 4MXWB 4QQLA 1TZOA 3OBRA 3T1LA 5T5OA 3VBRA 4CU9A 3VGIA 2QQLA 3BGAA 1XE0A 3J4UH 4PI2A 2AYHA 3B00A 4E4ZA 3TNQA 2ZHLA 4N43B 5E8AA 3IBMA 2IXKA 2XOMA 3MGUA 2HEWF 4L92A 1XU2A 3ZFGB 4LULA 4CUBA 4FT8A 3RZGA 5LA1A 1C8M1 5JMCA 1BQPA 2JIJA 2D6PA 3NO8A 2Q5TA 2QQWA 4JGYA 4BE3A 2WSUA 1O5LA 3NVCA 2CNAA 1BYHA 4TZDA 4YVWA 5FY7A 1V9U2 1R1A2 4CRQA 2JE9A 1AR63 3SEEA 4DQAA 2WQZC 1ND2C 3WDVA 3UKTA 3TEYA 3ES4A 3LEGA 3WF2A 1WMEA 2OX0A 2UURA 4ARYA 2VVDA 2QJVA 3JUUA 1UAIA 1RVF3 1S1AA 2HWC3 2QBXA 2W08A 3HN3A 1SFPA 3IKWA 2J1TA 3IZOA 4WZCA 4Y4YA 1OURA 3VB9A 3N7JA 4F8AA 1J3RA 2PHRA 1MZ6A 5FPXA 4W65A 3FLPA 1WA4A 2FDHA 5JI9A 1V6OA 4QPIC 5H9RA 3WQ0A 4YWAA 3OOXA 4K9SA 4J1XA 5BPXA 1QOOA 3VBSB 3S57A 5IYYA 3NW4A 3F2ZA 3WQ7A 4LPLA 1JBCA 1V6KA 3ZYIB 2ZEXA 4Q4W3 1AXKA 4W6YA 3U78A 3THPA 1L7RA 1IOAA 3BCWA 3PVBB 2GH2A 1SCSA 1YC61 2A3XA 5IHRA 1W8ZA 1O3QA 3D6EA 3WUDA 1NQDA 4HBNA 4ZU7A 1CVNA 4PQQA 5FRAA 5A3OA 3VKLA 4WVZA 3OG2A 4FAHA 1RUG3 4A2UA 2XJQA 3VBHA 4N53A 1AL23 5JPMB 2JX9A 2ERFA 2RDRA 3B94A 5FO9B 2VW0A 4YM0A 4JGYC 4HLTA 4XF9A 2LTNA 2BNMA 1IG0A 2RM23 5A6XA 4CDQC 4WVVA 2WL1A 1QOTA 4AGVA 2JD4A 2RMU2 3RNSA 4AGRA 3AL6A 1FAYA 3ACLA 4RHV1 4A6OA 4GD4A 3BTAA 3VLBB 5F1RA 3T2TA 1GSLA 2WNVB 2GC2A 4S2GA 5IK4A 1UW8A 2Y64A 4NIIA 3LD8A 3RQ0A 4B1LA 1ZVFA 2CY6A 2DWRA 4YVSA 1AR62 1UY2A 5IVFA 3K4DA 4BM8A 1OBNA 2PHUA 2IXJA 1HV0A 4M3CE 2R073 2VL4A 1RUH1 1DZRA 2X05A 2DDUA 3JQXA 2IFRA 5GLWA 1PGSA 3NRUA 2Y0OA 1W90A 4AVTA 4LJHA 4QPIA 5H9PA 1GNYA 2AC1A 4BOWA 2YMZA 4QHZA 5C8WA 4BB3A 2FZ1A 2PAMA 3BVCA 4HPKB 4MVTA 1DQ5A 1EAH1 1NCRA 1M06G 1QH7A 1OA2A 1Y4WA 5FBJA 2HJIA 4EN9B 1UYXA 2X8KA 3NNMA 5IWFA 1FMD3 3P5BA 1SFNA 2ORZA 2ZX1A 5HI0A 3M3OA 2RG4A 1AR71 1OF3A 2XLAA 4ZONA 4BISA 3KVAA 3GJAA 1JN2P 2B9VA 4ZHNA 4YW6A 3W5MA 2DV9A 2JIGA 2VUAA 3BU0A 3KV9A 4HK8A 3GM8A 2CWSA 2HWC1 4QX3A 5FZGA 3A0NA 2JDKA 2JDMA 3WP5A 1XBFA 2Y6JA 3BPSA 1GZWA 5F6KA 3WDXA 4WM8C 3IMNA 1Z7S2 2VZ1A 3ITQA 3LA3A 5BNQA 3LSEA 5CKNA 5HXMA 2P3JA 4N7UA 5EZWA 4DPNA 2HWB3 2MEV2 2QQJA 5BNNC 1L7QA 2D6NA 5T5JA 3OGSA 4XOGA 2HKXA 3I59B 5FPUA 1KJRA 2B46X 4I3GA 4DXSA 3R6SA 3FMGA 2R072 4RS5B 4H55A 2OKXA 2D3PA 4AQTA 4Y1VA 4XAAA 3IDEA 1PMHX 4PCRA 2E9QA 4D6QA 3UNPA 1XB9A 1BMV1 2ADEA 2ZGNA 4OI4A 4Q0SA 1HJGA 3O1UA 2XWJB 4Q5OA 3ZYHA 2E7QA 3BOPA 4MXVA 2WA4A 2YROA 2VNGA 5IVCA 3BI3A 1MS3A 3KSCA 1FV3A 1RYYA 3OEAA 1I5ZA 4M3CB 3VHOA 4AR2A 2A6ZA 3KGZA 4R9BA 5DAQA 5JIAA 5FUIA 3RJRA 2VQAA 2HEVF 2MNGA 1F2NA 1PVC2 2ZS6B 2VZPA 3USUB 2WNVC 5I0TA 4RFRB 4NWVA 1K3IA 3SH3A 4ARXA 4CEWB 2VZOA 1AYN1 3KMHA 4XFAA 3EO6A 2D40A 5FR3A 1J3QA 2P17A 4RR3C 1GUIA 1UY3A 3FLRA 2OYZA 4C0HA 1W2TA 1GP5A 1NLSA 2YV8A 1YO8A 3CJIA 1UL9A 3I3BA 2WS93 4FFGA 5GZDA 5D8AB 4LO7A 3T0BA 1PO21 3B9IA 4LHLA 3BTZA 1XRUA 1OUXA 1CD3G 3DEMA 3LZZA 4Q4V3 3PVOA 4DFSA 5A1FA 1X82A 4MH0E 3OPTA 4CDUC 1O59A 1O4YA 5LCWL 4FPGA 1LHNA 1LOGA 1RUD2 4Y22B 2WFF2 5LBBA 4MGQA 4BLIA 4BIFA 1OSGA 1RUC2 4L99A 4QHOA 3J26N 1ZYBA 1SLCA 5FYMA 3DXTA 3SKJE 3C7EA 3PUHA 1QJX3 4M0HA 2WINB 3M4FA 1NQJA 4LO6B 1COV2 4XYXA 2FQPA 3X29B 2YDEA 1YFUA 2GN3A 1UIJA 2O1QA 5BYNA 2L9LA 1VPHA 5TSWA 5I0DA 3VDAA 4EN0A 4META 1LJ7A 2HWC2 3UGHA 4LKEA 2RS11 3GHMA 3TN93 3VBSA 1RUI1 1UU5A 1FI2A 4L97A 2VGDA 2JG9C 2WWSA 4JKKA 2FCVA 4Y1UA 2EICA 5FZ9A 3DV8A 2KM2A 1O91A 3FHAA 4YYOA 4D94A 3ZYFA 4WZFA 2FDGA 4IETA 1QXJA 1UNBA 1JYNA 3WF3A 1Q56A 2VZUA 4CDXA 4JTNA 5BNOC 1RGSA 1RTVA 2P3KA 2C9KA 5CVRA 4YW4A 1VE0A 5EHDA 1HXS3 4ZXEA 5JVVA 4DXTA 3H8RA 3URFA 1PIV3 4P08A 1MS1A 2QQVA 3ORJA 3ZFEA 2VUDA 3M3IA 3S0MA 4AI2A 5CNAA 1JZ4A 4ISQA 5CG9A 1PZ8A 1Q8SA 1XE7A 3POEA 4AXOA 2BWAA 3RZKA 4DEQA 5A32A 1CX1A 2Q8OA 3ZN6B 5FY4A 1XYNA 5L7OA 2BERA 4GA9A 4CP9A 4EZHA 3MUZ1 4Z1VA 5FUNA 2GALA 5C70A 2BWCA 1H4GA 1IQAA 1R091 4EN8B 3DKWA 3ZFEB 4FTEA 4XUQA 4KBZA 2WT2A 2XJVA 1H6YA 4XW3A 2ARBA 1AX0A 1VALA 1X33A 1W6PB 2Q1FA 2W68A 5HCAA 4JDNA 1JZ3A 2D3SA 4IERA 3NL1A 5JOXA 1RUF2 2GU9A 1V6LA 2FHRA 4Y22A 5A7OA 1VBC2 5FZHA 2E53A 1F5JA 5T5PA 4FP2A 4BA6A 4YG3A 4MUVA 4AEDA 1K5MA 1GWLA 1LGCA 2IZWA 3WV6A 3ZYPA 1RVF2 3ZLIA 2Y6FA 5DG2A 4FQ4A 1V6NA 4RQPA 4QXCA 1B35B 5FP8A 4PLMA 2PAKA 5K4LA 4BQXA 3IPVB 5CISA 4AE2A 2HEYF 4LO5B 4DB5A 4Q29A 1HX6A 5BNPB 3KV4A 1U5ZA 1IQDC 1G6NA 2C9AA 3MF6A 2JENA 1D7PM 3HR9A 1UY0A 2W1SA 5GALA 1RUH2 4XDPA 3PUSA 2JB4A 3TYJA 1HLCA 1RVF1 4JCKA 1EY2A 1KFXL 2R042 3W9AA 3VHPA 5A6QA 2PA7A 1AUYA 1RMU1 2V4VA 4LUKA 2D6KA 3HAGA 2R063 2VBPA 4PJYA 1RUG2 3VBOC 2D7FA 3TWIA 4CDWC 1TME2 2R32A 1XOYA 2XWBB 4IQPA 4QQHA 3ZXDA 3JB8A 5DUWA 4D69A 2CGPA 1QDCA 1W03A 5B4XA 1EYBA 3QH7A 4A7ZA 3QACA 3E1F1 5FYBA 1CAXB 5APAA 4ASLA 1V00A 5BNOA 5L73A 3PMSA 4KWLA 4XC9A 5KXCA 1DP0A 2TUNA 2XG3A 4DUXA 3NNJA 4TLGA 4Q8KA 3JBG2 4KG0A 5LA0A 1PX4A 4Z8BA 2QNKA 1YRZA 1ZM1A 1FATA 4Q0QA 4I3PA 4QB6A 2K0GA 3BIWE 4HKOA 2R0HA 4LBLA 5T5LA 3VD7A 5F39A 4XF4A 1W39A 2UWBA 2Q8EA 2IXCA 1SLIA 4HETA 2PN5A 1OXCA 4NHKA 5FYTA 3USUA 4LO4B 2VBBA 3H0OA 3PDQA 4YSFA 1VBA1 2ZTNA 1DCSA 5IK8A 2JDAA 3ZN4A 4NIDA 4E4DX 1ND2A 2WO1A 4OFGA 2EVXA 3VUOA 5LATA 1S0FA 1AR83 1ULCA 1T6GC 4MHRA 3USSA 4B3NA 1AR93 1S0BA 1S0CA 3B7MA 2GNMA 4B7KA 2DFCA 1LOEA 1U5IA 3DGTA 4PT6A 3J9SA 4CDUB 2ZKNA 3GCXA 5BY5A 1R093 3O0VA 4RN5A 1N1TA 1AZDA 4RS5A 2VC9A 4V1PA 2RJ2A 1PX3A 1MZ5A 4FOWA 3LPGA 3ELNA 4KNCA 4QPIB 3MW2A 1POV1 2OUHA 1PGL2 2J42A 2VOTA 3O1TA 2RR12 1YI7A 3AVSA 1RL3A 2FDJA 1KITA 3IN9A 1N1VA 3LDBA 4D6SA 1YI9A 4IV3B 3OY8B 1C3HA 1G9BA 5JUVA 5IK5A 2BNOA 2NN8A 2BUKA 1YJKA 1IKPA 3SITA 1ONAA 5AFEA 3W59A 3CZUA 1Q8PA 4Q1RA 3AX4A 2BNNA 2FMYA 4FOYA 5FYIA 3WW3A 2VTXA 2BBVA 3HBKA 5B2GB 5BUVA 4LBQA 5A7WA 3EXUA 1ODNA 1W99A 3D0JA 2KD7A 3HBZA 3WNXA 2C6SA 2ORXA 4WVWA 3K4AA 1F35A 4G3YC 3KVBA 1RJ7A 4XABA 4OULA 1LU2A 3NV3A 5FZLA 3U37A 2VE1A 4AFMA 2XQXA 5A3TA 4XCBA 3OYWA 4YLZA 1COV3 4OLLA 1HJFA 2P5BA 2RDQA 1LOAA 1W05A 2FBEA 2N7GA 3VDDB 2WZR3 3AFGA 2V5YA 3OGJA 4NJ4A 4YVWC 2HWF2 5GZGA 2V09A 1ASJ3 3FE5A 3OD4A 5DN2A 3SH4A 4C1XA 4LK6A 3FFZA 4WM8B 2WT0A 1KFUL 4QDRA 2YY1A 1SBFA 5DZFA 2K9ZA 3HPNA 3WY6A 3NV2A 4QX5A 1HKDA 4AQ2A 5HCFA 4BK5A 3AVRA 3WR0A 1Y9MA 3NJZA 1DGWX 3LFIA 4P9LA 1W2OA 2WT1A 3AP5A 4Q0UA 2MEV1 2ZGOA 4A7YA 5FZ6A 5FWJA 1QNWA 1W8OA 2E63A 3J7HA 3OD0A 2XXZA 3KCCA 2ZA9A 1ENQA 1UOBA 1OOPA 2LW8A 3P3NA 4COYA 5IFPA 3KLSA 3H1WA 1T2XA 5FY8A 3WQBA 1LHWA 1QDOA 3O1PA 3U11A 3BODA 4FPLA 4ZS2A 4M4RA 1QJX2 4IV3A 4QU1A 1TME1 4IDZA 4CEYA 4FI9A 2YFZA 3I7DA 4Z07A 4N90A 3POFA 1WLDA 3AB0A 1UOJA 4ISRA 3VV1A 1W6QA 1YEWA 2CV6A 3POYA 5FLIA 3PLQA 4BLJA 3NWKA 5FPBA 4LIVA 3CMGA 4GH4C 5ISLA 4FPJA 1XNDA 2BOIA 3O5SA 3A4UA 4X6RB 3OBAA 3B9CA 4XZPA 4BQWA 3WW1A 4LR4A 3AP7A 5FYYA 2Q1MA 3T2OA 4Y20A 3U4SA 2VW1A 3VDBA 1H2LA 3F95A 1O5UA 1DFQA 3I2DA 5A7QA 4D0QA 5JZGC 1ZBA1 2EAKA 1QQP2 3WD5A 1C5HA 1DGWA 5T54A 5ABJA 1AJOA 1QQP3 2CGOA 5C4WA 4CUCA 1ASJ2 1LHVA 2CDOA 1H9PA 1ULOA 3AZXA 2YB7A 5I0RA 4X8NA 3RDIA 2VXJA 3MFAA 1U5XA 3GGLA 3NJYA 4IEPA 4ZZ8A 5K8SA 3RG0A 1BBT1 4C1WA 4RSUA 4DRRA 4M01A 4LE3A 1ZBA2 2Y0IA 5FZ4A 1ZRIA 2R0FA 4XIOA 3RJ2X 2Y38A 3ZVXA 2B7YA 4CCJA 3VKOA 3V0BA 1AX1A 2WQ8A 4XF3A 5I0UA 1H1MA 1VP6A 1PK6C 1QJEA 2WO3A 5J3UA 3AZVA 1Q8OA 3SH5A 4A41A 3NNGA 3WF1A 2G9ZA 5G04L 5JXIA 4S2HA 1SHWB 2WFPA 1T6BX 4C8DA 1UPIA 2ZX0A 1SMVA 1RUD3 1QKQA 2BEOA 2VMIA 4YG0A 4BHPA 4DNYA 5LY1A 2RMU3 3Q8FA 3UETA 3LKJA 3ZSLA 5C9AA 2VOWA 4R9DA 1POQA 3CNAA 3LEKA 4FQZA 4IEUA 4OUSA 1KRIA 1D0HA 2D5HA 5A1LA 4I01A 3BYWA 4XJUA 2CYFA 1LEMA 2E7TA 2EA7A 3PU8A 5FK8A 1JZ6A 2C5DA 2GNBA 4OUMA 4FTBA 1RUOA 3MZHA 3UKVA 3VD3A 3ZXJA 1GQGA 1RINA 3E6DA 4ZZ5A 5EFUA 4OYUA 4R9CA 3PIJA 4CDWB 4BZ4A 1OC1A 3H3LA 3H1MA 1RHI1 1OD3A 2HBTA 3FZ3A 4PLOA 4G9SB 2BVVA 5FJHA 3OJBA 4D6RA 4YRDA 3VHRA 3ACIA 5IW0A 4YGDA 5BNOB 2BFUS 5FZMA 1QH6A 3BKZA 4JTOA 5K0UA 1R1A1 3BPZA 1XE8A 4KH9A 4RR3A 2WLPA 4TLFA 3AKQA 4QDSA 2VCAA 2Q30A 1BVP1 1HN0A 1N3QA 2JG9B 4OHVA 4YZ2A 1HXS2 3LB9A 1DGRN 1HRV1 1QJU1 3ZPYA 3P6BA 3LEMA 3NNLA 3O1MA 3KCXA 1AXYA 1A8DA 2UWAA 3R4UA 4W4ZA 2OXBA 2PMWB 4XHXA 3WP6A 1LAJA 5C3OA 2R061 5AC92 3GALA 4H2AA 3N9MA 1RJ8A 4HSLA 4I0WB 1C8M3 4QX8A 2VNRA 1ZZ9A 2CDPA 4U2AA 4YM1A 1JYIA 2H6CA 4B7EA 3FUOA 2P1BA 5KBFA 4QQPA 1HRI2 3T09A 1RUF3 1ODMA 2DVDA 3HNMA 4BQYA 3H3ZA 5B4NA 1NAEA 5FK7A 5SV8A 2ZX2A 4MADA 4R9AA 5FMOL 5FMDA 3LA7A 5JOWA 4LITA 1VR3A 2G4IA 4K8RB 4UW4A 1H8TA 2D93A 4QPWA 5FPZA 1UPSA 1X8EA 3RFRA 4CCMA 1DQ6A 3DKQA 3IIAA 2R16A 2WN3A 3KQRA 4GB32 3J8F3 3PMEA 2B39A 3VBUC 2WNUB 5FKBA 1NOVA 2ZZJA 3SXWA 3LOBA 3TOJA 2PTMA 5JZGB 1QF3A 5F5AA 5FKCA 1GZTA 3UESA 1C1FA 1Y3TA 1QXPA 1GOGA 2VW2A 4RL7A 3S7EA 3T0DA 3IDCB 1N3OA 3AYEA 4OHXA 1JYTA 2W2IA 4CTEA 5JAXA 2RR13 3E6CC 4WVMA 3NNFA 1CAVB 3PVNA 5D21A 4JKLA 1NCRC 5KHHA 3ZKYA 3ZXLA 1OVPA 4YM2A 5L7OB 4E27A 1GICA 4JVAA 4NAOA 4ZKTB 1UX6A 1IS4A 3CHXA 1RUE3 4IEYA 1VJ2A 2B9UA 3AXDA 1OOPB 5L9RA 1G9AA 2O8OA 3I49A 1X36A 5DUXA 3AJZA 2ZXQA 1C28A 1UCXA 3MLJA 4XEZA 3FL7A 1DLLA 4IE5A 3AP6A 5FP7A 4DIQA 3OGVA 1W6NA 5FZFA 4NROA 1V6JA 2VG9A 2ZGQA 4U36A 5FOJB 4K6BA 1JYVA 3KT7A 2OS2A 1ZA7A 2WYSA 3S6PA 4QQOA 4LHKA 5KC5A 2QQPA 3SCHA 4FFFA 5AC93 2PHDA 3ZFFC 3WEZA 2CHHA 4L2NA 1RUC3 3ALQA 2ZJCA 3UL2A 2ZGSA 1H6XA 3IMMA 3KQ4B 1JMUB 3QH6A 2JG8A 3ACFA 4AI8A 2AUYA 5FYHA 5GJ6A 4BYYA 1R1A3 3OF1A 1UY4A 1OHFA 5IAXA 1UZYA 3CJIB 1EAH2 1YJLA 1DDLA 1ZZCA 3B69A 2RJLA 1C8NA
chains in the Genus database with same CATH topology
1GUIA 1UY3A 4UI9L 1KGYA 3I3BA 2W91A 1OF4A 5HPOA 3T0BA 3THDA 2VZSA 1I5PA 1J83A 3I2KA 4JKMA 1O59A 2WBKA 4D8MA 5LCWL 4MGQA 1K45A 3FHQA 4XUOA 2VCCA 2WO2A 4A45A 1LNSA 5J1XA 3SKJE 2EIDA 4CU7A 3C7EA 3PUHA 2YG0A 1K12A 2W9XA 1YQ2A 4JHZA 2WAAA 1JZ5A 2L9LA 4ET7A 5I0DA 3VDAA 4QDQA 2YC2A 1UYZA 4GWIA 3FN9A 2VMEA 2JE8A 4JKKA 1CX1A 2EICA 3K75B 3FHAA 3ETPA 1JZ2A 3DYMA 2PQSA 1JYNA 1GOFA 3WF3A 1UXZA 2VZUA 3I3EA 3LQCA 2HYXA 2C9KA 5CZKA 4ZXEA 4DXTA 3IAQA 2RV9A 4QX0A 2V5DA 3LPFA 4P08A 2QQMA 4TXWA 2J1RA 4OMDA 4E8DA 2BBAA 1JZ4A 3THCA 4BXSV 4DEQA 2BERA 1UZ0A 2VJXA 3I2GA 3MUZ1 5LA2A 5C70A 3HNBM 2J7MA 4XUQA 5CYYA 1H6YA 2YC4A 5EJ1B 1JYWA 2W1QA 3T08A 1CZSA 2W1WA 1JZ3A 3C7GA 4HG6B 1TVGA 3ABZA 4AAXA 3T0AA 2R7EB 4ZY9A 2W95A 1JHJA 3CDZB 4AG4A 1W0NA 2JKXA 3GDBA 3OB8A 5JR2A 1P8JA 2DCJA 2WDBA 1ULPA 1IQDC 4BDVB 2JD9A 1D7PM 1UY0A 5JXGA 2W1SA 1DYOA 2WABA 4JX0A 3JXSA 3NJVA 2VQUA 1JYXA 4GZ9A 2V4VA 2WZEA 4OMCA 4A3ZA 3WNLA 3GXUA 2VZRA 2W47A 1OH4A 3PUIA 5G05L 5B4XA 1NKGA 2ZEYA 3E1F1 1CIYA 4LHSA 4QB1A 4XVHA 4TTGA 1DP0A 4DUXA 3K46A 1NUKA 5LA0A 1PX4A 1WKYA 4MGSA 1O8PA 4QB6A 3EYPA 3VD7A 4GWJA 4UAPA 1UWWA 1DLCA 3C7FA 2ID4A 3ZM8A 2ZEZA 1UMIA 3HNYM 2JDAA 4YPJA 3EB7A 2WO1A 2QQOA 2W1UA 3HJRA 1GMMA 3A22A 4A44A 4PT6A 5JXIA 4BK4A 2HLEA 2VZQA 4RN5A 2VC9A 2RJ2A 1PX3A 4P02B 3MUY1 3T0DA 4QX2A 3LPGA 2X09A 2VMCA 1K42A 2VOTA 3T2PA 2C26A 2BGOA 1F4HA 4UOJA 2YFUA 5JXJA 5JUVA 2W92A 2VZVA 1XNAA 3VD5A 3CZUA 3K77A 3DECA 4L0PA 4DXRA 5EIYB 2DCKA 3I2JA 3WNOA 3W5NA 3A21A 1XPWA 1W99A 1GU3A 1GQPA 2KD7A 1XNTA 2ORXA 3ACHA 1WCQA 3K4AA 1XC6A 1JZ8A 3T2QA 1UY1A 2VR4A 3U37A 2RVAA 2XQXA 3VD9A 1UX7A 1W9WA 3MO4A 3WF0A 3NJXA 1TG7A 5DN2A 3A23A 5JMOA 2WN2A 2W5FA 3SEPA 1BHGA 2WUHA 2B4KA 4A4AA 4QDRA 3ACGA 3CZJA 2ZEWA 3C7OA 3HPNA 1UXXX 5EJZB 4DEVA 3WNKA 5C7GA 2VMFA 2VZTA 1UYYA 1W9TA 3AC0A 4Z2AA 1JU4A 3P1IA 1W8OA 3HEIA 3J7HA 2LW8A 5IFPA 1T2XA 3I2FA 2Y6GA 4CUAA 3CKHA 3WQBA 5DPNA 1EUTA 4LQRA 2W3JA 3IIIA 2Y8KA 4M4RA 4KWUA 2VCBA 4FI9A 2VMDA 2YFZA 1NX9A 4E8CA 4KI5M 2E32A 2QQKA 4CU6A 3I2IA 3CMGA 3DYPA 4LKSA 2X10A 1US2A 2Y6KA 3IDAA 3OBAA 2J1UA 4XUPA 4P5YA 3I97A 3T2OA 3LE0A 3VDBA 5F7UA 3C7HA 4D0QA 4CU9A 2WAOA 2QQLA 3BGAA 4CUCA 2CDOA 1ULOA 2YB7A 1JU3A 2XOMA 3WSOA 5C71A 2QQIA 4CUBA 1JI6A 3GGLA 4ZZ8A 5LA1A 2BGPA 4P00B 2J22A 3SEEA 3LEIA 2WQ8A 1J84A 3LEGA 3K4ZA 3WF2A 4IUGA 2WO3A 4ARYA 4W8JA 4A41A 3NNGA 3WF1A 2QBXA 3NQHA 3HN3A 5G04L 2J1TA 1SHWB 4CVUA 4RYDA 3IB3A 2W87A 4MO3M 3WNNA 4M4PA 3UETA 1CZVA 2BZDA 2VQTA 3LEKA 2J1SA 3WNPA 1JZ6A 1F4AA 1OT5A 5IYYA 3C8XA 3VD3A 3F2ZA 4LPLA 4ZZ5A 2ZEXA 3ECQA 3I3DA 4OYUA 1L7RA 1OD3A 2XHNA 3VDCA 3ACIA 2Y6HA 3IAPA 5IHRA 4QAWA 4QX1A 4PQQA 3OG2A 4QDSA 3WNMA 1US3A 2VCAA 1GOHA 1MPXA 3SKVA 3A7QA 3P6BA 4XURA 3VD4A 2J1EA 4W4ZA 3HOBA 4A6OA 4KMQA 5DMYA 2CDPA 2J1AA 3MBWA 3BN6A 2Y64A 4OUEA 4CU8A 3T09A 1UY2A 1SG3A 3HNMA 3K4DA 3MV11 5B4NA 2X05A 1NAEA 2LS6A 2VL4A 1JZ7A 4MADA 1O8SA 2DDUA 3D3AA 5IJRA 3NRUA 3OGRA 3WF4A 2EIBA 4QPWA 1PMJX 1GNYA 4MOAA 1HN1A 2WN3A 4XZUG 2J1VA 2Y6LA 1UYXA 3DYOA 3MV01 4QB2A 2ORZA 1CZTA 3UESA 1OF3A 1GOGA 2EIEA 3CQOA 4A42A 2B9VA 4OZOA 3W5MA 3CIHA 1KEXA 4BK5A 2E33A 3GM8A 4JKLA 2VM9A 2XONA 2VZ3A 4QX3A 4DUVA 5IFTA 2Y6JA 2VZ1A 1R64A 3I2HA 5HXMA 2WZ8A 2QQJA 2ZXQA 1L7QA 2QQNA 3OGSA 3FL7A 4DXSA 2VO5A 1EUUA 3OGVA 3OEBA 2OKXA 4BJ0A 4DUWA 2E26A 2C4XA 1PMHX 1W9SA 3UNPA 1SDDB 5DQ0A 2E31A 1JYVA 4PF1A 4XUNA 2V72A 2WYSA 1UMHA 2W94A 2VTFA 1RYYA 2W46A 3OEAA 4XUTA 3WEZA 5FUIA 1H6XA 2Z4FA 3ACFA 5JXHA 1W8NA 2VZPA 4W50A 1K3IA 1UY4A 4ARXA 5A1AA 2VZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUI A;  1UY3 A;  4UI9 L;  1KGY A;  3I3B A;  2W91 A;  1OF4 A;  5HPO A;  3T0B A;  3THD A;  2VZS A;  1I5P A;  1J83 A;  3I2K A;  4JKM A;  1O59 A;  2WBK A;  4D8M A;  5LCW L;  4MGQ A;  1K45 A;  3FHQ A;  4XUO A;  2VCC A;  2WO2 A;  4A45 A;  1LNS A;  5J1X A;  3SKJ E;  2EID A;  4CU7 A;  3C7E A;  3PUH A;  2YG0 A;  1K12 A;  2W9X A;  1YQ2 A;  4JHZ A;  2WAA A;  1JZ5 A;  2L9L A;  4ET7 A;  5I0D A;  3VDA A;  4QDQ A;  2YC2 A;  1UYZ A;  4GWI A;  3FN9 A;  2VME A;  2JE8 A;  4JKK A;  1CX1 A;  2EIC A;  3K75 B;  3FHA A;  3ETP A;  1JZ2 A;  3DYM A;  2PQS A;  1JYN A;  1GOF A;  3WF3 A;  1UXZ A;  2VZU A;  3I3E A;  3LQC A;  2HYX A;  2C9K A;  5CZK A;  4ZXE A;  4DXT A;  3IAQ A;  2RV9 A;  4QX0 A;  2V5D A;  3LPF A;  4P08 A;  2QQM A;  4TXW A;  2J1R A;  4OMD A;  4E8D A;  2BBA A;  1JZ4 A;  3THC A;  4BXS V;  4DEQ A;  2BER A;  1UZ0 A;  2VJX A;  3I2G A;  3MUZ 1;  5LA2 A;  5C70 A;  3HNB M;  2J7M A;  4XUQ A;  5CYY A;  1H6Y A;  2YC4 A;  5EJ1 B;  1JYW A;  2W1Q A;  3T08 A;  1CZS A;  2W1W A;  1JZ3 A;  3C7G A;  4HG6 B;  1TVG A;  3ABZ A;  4AAX A;  3T0A A;  2R7E B;  4ZY9 A;  2W95 A;  1JHJ A;  3CDZ B;  4AG4 A;  1W0N A;  2JKX A;  3GDB A;  3OB8 A;  5JR2 A;  1P8J A;  2DCJ A;  2WDB A;  1ULP A;  1IQD C;  4BDV B;  2JD9 A;  1D7P M;  1UY0 A;  5JXG A;  2W1S A;  1DYO A;  2WAB A;  4JX0 A;  3JXS A;  3NJV A;  2VQU A;  1JYX A;  4GZ9 A;  2V4V A;  2WZE A;  4OMC A;  4A3Z A;  3WNL A;  3GXU A;  2VZR A;  2W47 A;  1OH4 A;  3PUI A;  5G05 L;  5B4X A;  1NKG A;  2ZEY A;  3E1F 1;  1CIY A;  4LHS A;  4QB1 A;  4XVH A;  4TTG A;  1DP0 A;  4DUX A;  3K46 A;  1NUK A;  5LA0 A;  1PX4 A;  1WKY A;  4MGS A;  1O8P A;  4QB6 A;  3EYP A;  3VD7 A;  4GWJ A;  4UAP A;  1UWW A;  1DLC A;  3C7F A;  2ID4 A;  3ZM8 A;  2ZEZ A;  1UMI A;  3HNY M;  2JDA A;  4YPJ A;  3EB7 A;  2WO1 A;  2QQO A;  2W1U A;  3HJR A;  1GMM A;  3A22 A;  4A44 A;  4PT6 A;  5JXI A;  4BK4 A;  2HLE A;  2VZQ A;  4RN5 A;  2VC9 A;  2RJ2 A;  1PX3 A;  4P02 B;  3MUY 1;  3T0D A;  4QX2 A;  3LPG A;  2X09 A;  2VMC A;  1K42 A;  2VOT A;  3T2P A;  2C26 A;  2BGO A;  1F4H A;  4UOJ A;  2YFU A;  5JXJ A;  5JUV A;  2W92 A;  2VZV A;  1XNA A;  3VD5 A;  3CZU A;  3K77 A;  3DEC A;  4L0P A;  4DXR A;  5EIY B;  2DCK A;  3I2J A;  3WNO A;  3W5N A;  3A21 A;  1XPW A;  1W99 A;  1GU3 A;  1GQP A;  2KD7 A;  1XNT A;  2ORX A;  3ACH A;  1WCQ A;  3K4A A;  1XC6 A;  1JZ8 A;  3T2Q A;  1UY1 A;  2VR4 A;  3U37 A;  2RVA A;  2XQX A;  3VD9 A;  1UX7 A;  1W9W A;  3MO4 A;  3WF0 A;  3NJX A;  1TG7 A;  5DN2 A;  3A23 A;  5JMO A;  2WN2 A;  2W5F A;  3SEP A;  1BHG A;  2WUH A;  2B4K A;  4A4A A;  4QDR A;  3ACG A;  3CZJ A;  2ZEW A;  3C7O A;  3HPN A;  1UXX X;  5EJZ B;  4DEV A;  3WNK A;  5C7G A;  2VMF A;  2VZT A;  1UYY A;  1W9T A;  3AC0 A;  4Z2A A;  1JU4 A;  3P1I A;  1W8O A;  3HEI A;  3J7H A;  2LW8 A;  5IFP A;  1T2X A;  3I2F A;  2Y6G A;  4CUA A;  3CKH A;  3WQB A;  5DPN A;  1EUT A;  4LQR A;  2W3J A;  3III A;  2Y8K A;  4M4R A;  4KWU A;  2VCB A;  4FI9 A;  2VMD A;  2YFZ A;  1NX9 A;  4E8C A;  4KI5 M;  2E32 A;  2QQK A;  4CU6 A;  3I2I A;  3CMG A;  3DYP A;  4LKS A;  2X10 A;  1US2 A;  2Y6K A;  3IDA A;  3OBA A;  2J1U A;  4XUP A;  4P5Y A;  3I97 A;  3T2O A;  3LE0 A;  3VDB A;  5F7U A;  3C7H A;  4D0Q A;  4CU9 A;  2WAO A;  2QQL A;  3BGA A;  4CUC A;  2CDO A;  1ULO A;  2YB7 A;  1JU3 A;  2XOM A;  3WSO A;  5C71 A;  2QQI A;  4CUB A;  1JI6 A;  3GGL A;  4ZZ8 A;  5LA1 A;  2BGP A;  4P00 B;  2J22 A;  3SEE A;  3LEI A;  2WQ8 A;  1J84 A;  3LEG A;  3K4Z A;  3WF2 A;  4IUG A;  2WO3 A;  4ARY A;  4W8J A;  4A41 A;  3NNG A;  3WF1 A;  2QBX A;  3NQH A;  3HN3 A;  5G04 L;  2J1T A;  1SHW B;  4CVU A;  4RYD A;  3IB3 A;  2W87 A;  4MO3 M;  3WNN A;  4M4P A;  3UET A;  1CZV A;  2BZD A;  2VQT A;  3LEK A;  2J1S A;  3WNP A;  1JZ6 A;  1F4A A;  1OT5 A;  5IYY A;  3C8X A;  3VD3 A;  3F2Z A;  4LPL A;  4ZZ5 A;  2ZEX A;  3ECQ A;  3I3D A;  4OYU A;  1L7R A;  1OD3 A;  2XHN A;  3VDC A;  3ACI A;  2Y6H A;  3IAP A;  5IHR A;  4QAW A;  4QX1 A;  4PQQ A;  3OG2 A;  4QDS A;  3WNM A;  1US3 A;  2VCA A;  1GOH A;  1MPX A;  3SKV A;  3A7Q A;  3P6B A;  4XUR A;  3VD4 A;  2J1E A;  4W4Z A;  3HOB A;  4A6O A;  4KMQ A;  5DMY A;  2CDP A;  2J1A A;  3MBW A;  3BN6 A;  2Y64 A;  4OUE A;  4CU8 A;  3T09 A;  1UY2 A;  1SG3 A;  3HNM A;  3K4D A;  3MV1 1;  5B4N A;  2X05 A;  1NAE A;  2LS6 A;  2VL4 A;  1JZ7 A;  4MAD A;  1O8S A;  2DDU A;  3D3A A;  5IJR A;  3NRU A;  3OGR A;  3WF4 A;  2EIB A;  4QPW A;  1PMJ X;  1GNY A;  4MOA A;  1HN1 A;  2WN3 A;  4XZU G;  2J1V A;  2Y6L A;  1UYX A;  3DYO A;  3MV0 1;  4QB2 A;  2ORZ A;  1CZT A;  3UES A;  1OF3 A;  1GOG A;  2EIE A;  3CQO A;  4A42 A;  2B9V A;  4OZO A;  3W5M A;  3CIH A;  1KEX A;  4BK5 A;  2E33 A;  3GM8 A;  4JKL A;  2VM9 A;  2XON A;  2VZ3 A;  4QX3 A;  4DUV A;  5IFT A;  2Y6J A;  2VZ1 A;  1R64 A;  3I2H A;  5HXM A;  2WZ8 A;  2QQJ A;  2ZXQ A;  1L7Q A;  2QQN A;  3OGS A;  3FL7 A;  4DXS A;  2VO5 A;  1EUU A;  3OGV A;  3OEB A;  2OKX A;  4BJ0 A;  4DUW A;  2E26 A;  2C4X A;  1PMH X;  1W9S A;  3UNP A;  1SDD B;  5DQ0 A;  2E31 A;  1JYV A;  4PF1 A;  4XUN A;  2V72 A;  2WYS A;  1UMH A;  2W94 A;  2VTF A;  1RYY A;  2W46 A;  3OEA A;  4XUT A;  3WEZ A;  5FUI A;  1H6X A;  2Z4F A;  3ACF A;  5JXH A;  1W8N A;  2VZP A;  4W50 A;  1K3I A;  1UY4 A;  4ARX A;  5A1A A;  2VZO A; 
#chains in the Genus database with same CATH topology
 1RUJ 1;  3RYP A;  3C3V A;  3DPR C;  1QJU 3;  2LAL A;  3MIB A;  4GUL A;  4CEY C;  5FPA A;  5EYX A;  5FXW A;  5IVB A;  1O7F A;  2D43 A;  3GYD A;  4UT5 A;  2ZAA A;  5IVJ A;  2NP0 A;  5DAP A;  3TAY A;  2R30 A;  4BH9 A;  2DVG A;  1ZRF A;  3POS A;  4COZ A;  5A7W B;  1AR6 1;  1WZX A;  3THD A;  5L9V A;  2VZS A;  4KGQ A;  4CCL A;  5GM0 A;  2Y26 A;  4HL0 A;  4HXC A;  4JKM A;  1RUF 1;  3CF6 E;  2XLF A;  1ZRC A;  4WM8 A;  1UZW A;  2WBK A;  1ZBE 2;  5D8A A;  4JRA A;  1DHK B;  4LBN A;  3TBD A;  1K45 A;  3FFQ A;  3DCQ A;  3FHQ A;  3OY8 A;  1MEC 3;  1WWY A;  3LSD A;  5J1X A;  3U1X A;  2YGL A;  5J36 A;  1ZZ6 A;  4Y5T A;  1ULF A;  4CU7 A;  2AGS A;  2YG0 A;  1VBD 3;  1YQ2 A;  1W8F A;  3KB5 A;  2PEL A;  2WAA A;  1JZ5 A;  4ET7 A;  1G7Y A;  1PGW 1;  1XU1 A;  4ZXK A;  4LBQ B;  2IC1 A;  1IG3 A;  3K51 A;  4Y5Z 0;  2VME A;  4M3C A;  3NV1 A;  4JRL A;  2BVB A;  3PUR A;  3K75 B;  2KA3 A;  4SBV A;  1JUH A;  5F5I A;  4YW1 A;  5C8C C;  2ETE A;  3KWV A;  1RIT A;  1NY7 1;  1OA3 A;  1HIX A;  1ND3 B;  2PAE A;  2QE3 A;  4QM9 A;  3U10 A;  3LQC A;  1SEF A;  4CXX A;  2VU9 A;  4Q4X 3;  4UFM A;  3QCW A;  1IS3 A;  4HPK A;  1VRB A;  3IAQ A;  3N36 A;  5JSO A;  1R09 2;  2QQM A;  1VRH 3;  5FY5 A;  1DYK A;  3U0Z A;  2A75 A;  3CJI C;  5FYS A;  3VHN A;  1LHU A;  4FP3 A;  5M0T A;  2RE9 A;  3WHU A;  2VVE A;  3THC A;  2R04 3;  3Q8B A;  4FXK B;  4BXS V;  1X9P A;  3KHC A;  4AEJ A;  4JQR A;  1VMF A;  2RDS A;  4CZS A;  1NCQ B;  1EP0 A;  1XNC A;  1ND3 C;  2VJX A;  1UZ0 A;  2GMM A;  3V56 A;  3HMY A;  4AI9 A;  2C1F A;  1N1Y A;  2VY0 A;  1A8M A;  1RUC 1;  4IL7 A;  2J7M A;  5DDJ 1;  2VCM A;  3HIF A;  5EJ1 B;  3ZXA C;  4N8M A;  1UOF A;  2W1Q A;  4XF1 A;  3MPP G;  1WMF A;  2LRO A;  3M3Q A;  1TVG A;  3BOW A;  2Q8D A;  1D2S A;  2LM3 A;  4AAX A;  1MZF A;  1H2M A;  1U0A A;  4UW6 A;  3T0A A;  4GMP 0;  4DIN B;  2WSV A;  1GP4 A;  1YNA A;  2FCT A;  4AQ6 A;  3CDZ B;  4GAZ A;  2ARA A;  5ABJ C;  1NZI A;  1W0N A;  4QU2 A;  1BXH A;  3GDB A;  3H42 B;  1V9U 3;  2WKK A;  3T4V A;  2PHF A;  4NRM A;  2VVF A;  1P8J A;  2DCJ A;  2ZGT A;  4AWD A;  2VXR A;  3TRS B;  3AYA A;  3POG A;  1DQ0 A;  3KV6 A;  2FDF A;  4UFH A;  2XJS A;  1DYO A;  2C0Z A;  1UOG A;  2EAA A;  1PMI A;  2WNV A;  3OSD A;  2RS5 1;  1YYN A;  4FVV A;  2XJP A;  4NN0 A;  5JOY A;  2WNU C;  4R4Z A;  4F7Z A;  3H50 A;  2JG8 C;  4NPL A;  4PI0 A;  2RS1 3;  3TN9 1;  3WZ1 A;  1MVQ A;  4CP1 A;  2XVL A;  4LIU A;  1I1E A;  5FMB A;  3WVJ A;  1ZZ7 A;  2R06 2;  2PHW A;  4A3Z A;  3L2H A;  3J8F 1;  5D2A A;  1AR8 2;  3WNL A;  4C0B A;  1LTE A;  1YIP A;  4AW7 A;  2VZR A;  3PUI A;  1TMF 3;  4K20 A;  5G05 L;  2Q0A A;  2NQY A;  2ZEY A;  1CR7 A;  3KT1 A;  1HXS 1;  2ILM A;  3VBS C;  1AHS A;  3B93 A;  2YBP A;  2CL2 A;  1WW4 A;  2HYK A;  5A6Z A;  1BEV 3;  1WCK A;  2C24 A;  4X8P A;  1LGB A;  1WCU A;  2I2S A;  2ZGM A;  3WX5 A;  1W3X A;  3MW4 A;  4R4X A;  5C5U A;  3ZN6 A;  3MID A;  3KT4 A;  2D6M A;  1NUK A;  4HON A;  4K40 A;  3FBM A;  1R08 1;  4H3W A;  4XFF A;  3N4M A;  1O8P A;  1IPS A;  1HRI 3;  1RHI 2;  3EYP A;  2O14 A;  3ZR6 A;  1FYU A;  2VMG A;  2P37 A;  1OQD A;  4AAP A;  1DLC A;  2CU5 A;  4Y1X A;  2VEC A;  5FWE A;  1K5M C;  2A6X A;  3C7F A;  4Q27 A;  3S5Q A;  4BME A;  2ID4 A;  4D7T A;  1RB8 G;  1MS8 A;  1QY4 A;  3OUI A;  1O3R A;  2HH9 A;  5IT6 A;  1JS9 A;  4ZS3 A;  5BNN A;  1H1I A;  4MGT A;  1O3T A;  2VUL A;  3LIG A;  1S0I A;  3HNY M;  3KF5 A;  1AYM 1;  1Y9G A;  4LXL A;  3VL8 A;  3O1R A;  1E5R A;  1LOF A;  2W52 A;  4XQ4 A;  1W6M B;  2K2S A;  2A73 B;  2VD7 A;  2YPD A;  3HJR A;  4LBM A;  2VAU A;  4OHW A;  5F3I A;  4A44 A;  2CGN A;  2VOK A;  4BK4 A;  5L7O C;  2HLE A;  1NLR A;  4H7M A;  1MQT B;  2HWE 1;  4ES9 A;  4EE2 A;  4EYU A;  4HKW A;  4CDQ B;  2A5Z A;  2DCT A;  5BXX A;  3ZX7 A;  1CON A;  2UYB A;  1VBE 1;  2VMC A;  1YQ6 A;  1K42 A;  4R52 A;  2C26 A;  2PHX A;  5FXV A;  4IEX A;  3ME2 A;  4UOJ A;  1ZBE 1;  2VMH A;  4BCU A;  1OLQ A;  5JXJ A;  2FZ2 A;  1ZZB A;  1ULG A;  2QDN A;  5LY2 A;  3S5A A;  2E51 A;  2ET7 A;  2XPJ A;  1H8T C;  2EAL A;  2GMP A;  4DXR A;  5A80 A;  4IGP A;  4NUB A;  4RQP C;  2JG9 A;  1WD4 A;  2DCK A;  4GKX A;  4P9Y A;  1MS5 A;  4FO9 A;  2D5F A;  3WNO A;  3AZW A;  2ET1 A;  3N9O A;  3PL0 A;  4FBF A;  3A21 A;  5FZO B;  1RUI 3;  5FOB B;  2P4E A;  5K0U B;  1H1A A;  2OUJ A;  5LRS A;  4FPE A;  2JDH A;  4YW2 A;  3ZFF B;  4BIO A;  5K0U C;  3ACH A;  1WCQ A;  2ZX3 A;  3ZO0 B;  5JSP A;  2SLI A;  2UY9 A;  3H7J A;  1JZ8 A;  1I3H A;  1UY1 A;  3FLT A;  4FXG B;  4LLO A;  3JBG 3;  3WHT A;  2VR4 A;  3J7N A;  4AVV A;  5C6C A;  1UZZ A;  1E5H A;  4LO8 A;  2RVA A;  1GQH A;  4I02 A;  1ST8 A;  3VD9 A;  2HWE 2;  3MFC A;  3VN4 A;  3AK0 A;  1I6X A;  1PIV 1;  4SLI A;  5LK5 A;  5J09 A;  1VBD 1;  3WDY A;  4E2G A;  4COU A;  1Z78 A;  4IGQ A;  4YGE A;  5LBF A;  3MO4 A;  1VBC 1;  4HOO A;  3EMR A;  1J59 A;  1FV2 A;  4CA9 A;  3UJQ A;  2PHT A;  1H0B A;  4IXL A;  4Q0V A;  3DN7 A;  4B1M A;  2DVB A;  5EPA A;  4LEJ A;  4FFI A;  2JDZ A;  1DZQ A;  3NV4 A;  4XCA A;  3ZDV A;  2B4K A;  3HT1 A;  1ND2 B;  1RIR A;  1ZRD A;  4QGN A;  3VZM A;  3AZZ A;  2ZMK A;  2I07 B;  4RR3 B;  1UXX X;  4GH4 B;  4AFC A;  2QVS B;  5CG8 A;  2VH9 A;  1AR9 2;  2WRA A;  2F4L A;  3N9L A;  4DEV A;  1EV1 3;  3N35 A;  4LHN A;  4M3C F;  4AED C;  2VZT A;  4JC1 A;  3AYD A;  1UYY A;  4W6W A;  3POJ A;  4JZR A;  3RZH A;  5I8T A;  1X9T A;  3ZOI A;  4I0B A;  3POW A;  1WMX A;  2Q1Z B;  4WV8 A;  5C3Q A;  1VRH 1;  1VLN A;  1HV1 A;  3PNA A;  2HWF 3;  3VBU B;  1W8H A;  2D6L X;  3POI A;  4HVQ A;  5ACA 1;  3I3M A;  3N9N A;  1H2N A;  1TQ5 A;  4XXP A;  2BP6 A;  4OZX A;  2O8Q A;  3PHM A;  5DPN A;  4LQR A;  4P9G A;  5JI7 A;  3III A;  3NAP A;  1VB2 A;  1Z0H A;  5GLZ A;  1QNY A;  3WW2 A;  3PUQ A;  1JOB A;  1WUV A;  1DQ4 A;  1CJP A;  1WCS A;  5F32 A;  3N3H A;  1VBB 1;  4E8C A;  1X8M A;  4AHY A;  4Y20 B;  4UBH A;  1WMD A;  4MGI E;  4LKS A;  4N53 C;  2X10 A;  1US2 A;  4YAR A;  3AXE A;  5FZC A;  2F17 A;  3IDA A;  5JIU A;  4CCE A;  4P5Y A;  4CSW A;  2PYT A;  4ONU A;  4NMI A;  5J48 A;  5DAW A;  5F7U A;  1FOD 1;  3C7H A;  2DTW A;  3V0A B;  4PDW A;  4NWW A;  5HV0 A;  2JG8 B;  1AYN 2;  1OLM E;  5J37 A;  4AGG A;  1B35 A;  3DUI A;  3WSO A;  2ZAB A;  3D8C A;  2QQI A;  4XJ8 A;  3WCR A;  1UU4 A;  1OPO A;  2GDF A;  4COV A;  4AED B;  2BGP A;  3M7A A;  1QJU 2;  2ZBJ A;  5CEH A;  3WG1 A;  4Q4W 2;  3H8U A;  3AMP A;  4LKD A;  2BDR A;  3VZO A;  4XJW A;  3T4H B;  2NZ9 A;  1OMI A;  2VUC A;  4YFW A;  3LEI A;  1YIF A;  1CAU B;  2GSY A;  3WP4 A;  1PO1 2;  3B5L B;  2JDU A;  1GWM A;  1UQX A;  2GND A;  4IUG A;  5GZC A;  2XJU A;  1Q8Q A;  4XJA A;  4COW A;  4W8J A;  5FO8 B;  1VAK A;  3PVE A;  5KXB A;  1LUL A;  1G86 A;  3NQH A;  3ZXE A;  1CX4 A;  2G1M A;  4CVU A;  1BEV 1;  1WW7 A;  4RYD A;  1AR9 1;  2W87 A;  2XKP A;  2JE7 A;  3SMH A;  1UMZ A;  1BCX A;  4F83 A;  2VQT A;  2BZD A;  4NRQ A;  4AVA A;  1NG0 A;  1POV 0;  1RUG 1;  4JGZ C;  1OH3 A;  5KXD A;  2DUR A;  4MSV A;  1YCI A;  1F4A A;  1SLT A;  4UXA A;  3C8X A;  2R07 1;  3KZ4 C;  4MYE A;  3UV9 A;  5F3G A;  5CIR A;  1MZE A;  2ZAH A;  2XVG A;  1YWK A;  4LBO A;  1DBN A;  4OVE A;  3I3D A;  4UW3 A;  3U75 A;  3U14 A;  2KXL A;  2XHN A;  3VDC A;  2OQ6 A;  4BQ5 A;  1LEN A;  2JEC A;  5CB7 A;  3IAP A;  3ZYJ B;  3SC7 X;  3ZSK A;  1URX A;  4BQ4 A;  2ZPX A;  2WWU A;  3GJB A;  4JGZ B;  4UFL A;  4Y1Z A;  3ZMO A;  1EAH 3;  1GBG A;  4CP2 A;  4AI1 A;  2DVA A;  1MS4 A;  1DG6 A;  4CCC A;  3APB A;  4F3J A;  3MF9 A;  4YVW B;  2GAU A;  1WBL A;  3ST7 A;  4XUR A;  1SPP B;  1OKQ A;  2VUJ A;  3FHI B;  5KHK A;  3RRD A;  2J1E A;  1CN1 A;  4XFI A;  1QJY 2;  1WCD J;  4XPV A;  3SCF A;  2V73 A;  4QXH A;  3HOB A;  3ZXG A;  1LES A;  3AKS A;  3WIN E;  3GCW A;  4KMQ A;  1EPW A;  5JZG A;  2EXI A;  2EXJ A;  4WM7 C;  3MBW A;  4HZF A;  3J7L A;  3PJQ A;  1VBD 2;  2QZ3 A;  4OUE A;  2WNU A;  5FZE A;  4CU8 A;  1WLT A;  1SG3 A;  3MV1 1;  5HXV A;  3RWK X;  1CAW A;  4PIZ A;  2LS6 A;  4CDX C;  4LKF A;  2G19 A;  1JZ7 A;  3INA A;  2JIC A;  3I54 A;  2RM2 1;  5FZI A;  1O8S A;  3OUJ A;  2A1X A;  5A7S A;  3WF4 A;  2EIB A;  4LOR A;  1PMJ X;  2AR6 A;  4Q1P A;  5FCC A;  4RHV 3;  4QKN A;  5FP4 A;  3UGF A;  4I30 A;  2VTX J;  4JHT A;  4XZU G;  3OPZ A;  1NCQ C;  4IGO A;  5JLV A;  4PBP A;  3DYO A;  3MV0 1;  1M4W A;  5FO7 B;  3WDU A;  1A3K A;  4QB2 A;  3ZXK A;  4IND A;  1DYP A;  2BGC A;  2ZAC A;  3ETQ A;  3CQO A;  4BXF A;  4A42 A;  5DUV A;  2R6Q A;  5BNP C;  3CIH A;  4DY3 A;  3OCP A;  4ZU4 A;  5A70 A;  3VBU A;  3BU7 A;  2E33 A;  3KV5 A;  4IV1 C;  1J1T A;  3SNM A;  2RS1 2;  2VM9 A;  4YZ4 A;  2WQ4 A;  3MIE A;  1AYM 3;  3U07 A;  5C4W C;  4DUV A;  5IFT A;  3O14 A;  3I2H A;  2VOV A;  1W0P A;  3H8X A;  4CDU A;  3AP9 A;  4XBN A;  3GZE A;  1FMD 1;  4AFD A;  1NT0 A;  1MVE A;  4KBB A;  4XFC A;  3V0B B;  4M00 A;  2YYO A;  1EV1 1;  3VDD C;  1WBF A;  3LF7 A;  5BV6 A;  2VO5 A;  3KD4 A;  4ATE A;  3OEB A;  4DUW A;  2E26 A;  4GQ7 A;  3RYK A;  3ES1 A;  4FPF A;  4LUM A;  4XE9 A;  1SDD B;  5DQ0 A;  5KWR A;  5ERL A;  2E31 A;  1JW6 A;  3MIF A;  4XUN A;  2V72 A;  3VBH C;  1WD3 A;  2CSG A;  2VTF A;  3H1Y A;  2X5I A;  4QHB A;  1OFN A;  4XUT A;  5FTT C;  1SFY A;  1ALY A;  1C8M 2;  3FBY A;  3WLU A;  1DU3 D;  4HVR A;  2H0V A;  5FIX A;  5ABJ B;  5I8Y A;  1ZBA 3;  3GZA A;  1W8N A;  1A78 A;  2A6V A;  4AVS A;  3HT2 A;  4DS0 A;  4HFS A;  4Y24 A;  1AL2 2;  1PO1 1;  1SCR A;  1C4R A;  1W2A X;  3ZFF A;  3CO2 A;  4XIL A;  1FOD 2;  2WWJ A;  4A7K A;  4IV3 C;  4XIK A;  2WJS A;  1V70 A;  5DZE A;  3ZSM A;  3CEW A;  3SHR A;  4ATF A;  2W91 A;  2P3Y A;  4AVC A;  4QPG B;  4WBB A;  1WLC A;  4PIY A;  1OF4 A;  1NA1 A;  1GAN A;  2RS3 3;  3MIG A;  5FQ0 B;  5KHJ A;  1DGR A;  4Y1Y A;  2AEN A;  3S30 A;  4JDM A;  2WFF 1;  3HWJ A;  2ES3 A;  4O61 A;  1IZ3 A;  4Q4Y 1;  4Q4X 2;  2NMN A;  1ULE A;  1VBB 2;  1SPP A;  1HW5 A;  5FP9 A;  3WOG A;  4XAE A;  2IXI A;  1BK0 A;  2VPV A;  1QXR A;  5C9A C;  1UN1 A;  5EJ3 A;  3WG2 A;  4DOU A;  5FLJ A;  3VBF A;  5A6Y A;  4XFB A;  4E9K A;  2RR1 1;  5EWS A;  2LUW A;  5LK7 B;  4CCO A;  5HCH A;  1D0G A;  2WS9 1;  3HQR A;  2AH2 A;  4KL1 A;  5BNP A;  2Z79 A;  3JQW A;  4IE0 A;  2HWD 3;  2YU2 A;  2H0B A;  1PVC 3;  1C1L A;  1OI6 A;  1RXF A;  3LWC A;  1RUE 1;  1Q5O A;  3N9Q A;  5C3R A;  4RQP B;  1D2Q A;  3WUC A;  1QGL A;  1UZV A;  2X5I C;  2G9G A;  3K3O A;  2QZ2 A;  4AF9 A;  3ATG A;  4LOT A;  5AVP A;  4QDQ A;  1UKG A;  2YC2 A;  3M3C A;  2XBO 2;  3B3Q E;  1Z7S 3;  1W9F A;  5KR7 A;  3R0R A;  2V4A A;  3LFM A;  4RA0 A;  4ZU5 A;  3CLP A;  3ETP A;  1JZ2 A;  3DYM A;  4IEW A;  2PQS A;  1GOF A;  1FPN 2;  1LOD A;  4AYU A;  4H14 A;  2HYX A;  4J6G A;  1REF A;  3LGR A;  5CZK A;  3GBW A;  1S55 A;  3E97 A;  2YHJ A;  1O6U A;  2RV9 A;  4QX0 A;  4TXW A;  3LPF A;  1VBB 3;  1L7L A;  1BMV 2;  1LHO A;  2Y60 A;  1VRH 2;  2J1R A;  4L8Q A;  1NA1 C;  4OMD A;  2EIG A;  1W2U A;  3M8L A;  3ZFG C;  5L19 A;  2ADD A;  4GMP 1;  3NAP C;  4PQ9 A;  4QMA A;  4Y33 A;  2A6W A;  2CAU A;  3MLK A;  3IT8 A;  4RD7 A;  5C3P A;  2XUE A;  4HKL A;  4MZU A;  3GBF A;  4NOT A;  2Q8C A;  3I2G A;  4YZ5 A;  4C91 A;  1RC6 A;  4M0N A;  5F9T A;  3HNB M;  4S2F A;  2GME A;  3ZPO A;  4OI0 A;  4N7I A;  1E5I A;  1LOF C;  3TEW A;  1Q3E A;  4XFG A;  3H3U A;  2VNO A;  2YC4 A;  3D82 A;  2H6B A;  3C2U A;  1CPM A;  2W1W A;  2YGM A;  2XBO 3;  3C7G A;  4HG6 B;  4XDQ A;  4NIG A;  4Y4R A;  1RMU 2;  2DVF A;  3ABZ A;  1KD7 A;  1QJY 3;  1SZB A;  1OQ1 A;  1A6C A;  2BTV C;  2R7E B;  1JHJ A;  3ZFG A;  4YFZ A;  1LCL A;  1E57 A;  4K1Z A;  4AG4 A;  2HWD 2;  1UKR A;  2JKX A;  4E2S A;  3BB6 A;  2B42 B;  2GZW A;  3G6J B;  3N7K A;  3OB8 A;  3E6B A;  3SQO A;  5JR2 A;  5LW9 A;  3TB0 A;  5FXZ A;  1OVS A;  2D97 A;  4GWM A;  4BDV B;  1DQ1 A;  2WFF 3;  1F9K A;  2JD9 A;  2OQ7 A;  3IDB B;  5JXG A;  1ZA4 A;  2ARC A;  4CEW A;  4CCK A;  2WAB A;  4LBJ A;  1YLL A;  5AVA A;  1HQW A;  2PLV 2;  3SCG A;  1IKQ A;  3JXS A;  1VAV A;  3ILF A;  1F5F A;  2VQU A;  1F31 A;  1JYX A;  3R4S A;  4O65 A;  4CCD A;  1JXN A;  2RS3 2;  4V2W A;  3HN1 A;  1AYM 2;  5A7P A;  1IPJ A;  1FPN 3;  2XL9 A;  4LE4 A;  4AZZ A;  3RZM A;  4P5H A;  3EBR A;  5FPL A;  3ROU A;  3CL1 A;  3SIS A;  3UKN A;  2AEY A;  2W47 A;  1BVV A;  4RGA A;  1YFX A;  5C5T A;  1Q8V A;  5DAB A;  3H9A A;  5FXX A;  2D6O X;  2ZGU A;  5H9S A;  4LHS A;  1CIY A;  4UFJ A;  4QB1 A;  2UWC A;  5FQ0 A;  3ILR A;  3O1O A;  4XVH A;  4CEW C;  4TTG A;  5SV5 A;  3K46 A;  1U12 A;  5EYY A;  2GH8 A;  3VZK A;  3UT0 A;  1W04 A;  2JJ6 A;  2XJT A;  1W8W A;  2YBS A;  3NMB A;  4OCT A;  2F4P A;  4B4R A;  3MEP A;  5GZE A;  4GWJ A;  4UAP A;  1LB2 A;  1BZW A;  2NLR A;  4A6S A;  4Z82 A;  3P3P A;  1APN A;  3RSJ A;  1S2K A;  1YQ5 A;  4I0A A;  3I8T A;  3ZM8 A;  2WO7 A;  4RS5 C;  2ZEZ A;  1JTZ X;  1YUD A;  3Q8E A;  4QXK A;  5LEK A;  4JDO A;  1W2N A;  1WGP A;  3I2O A;  5A3W A;  1UMI A;  1RUI 2;  4CXY A;  4YPJ A;  1CES A;  1LGN A;  2ZZQ A;  4FOQ A;  1B09 A;  1G8W A;  3W58 A;  4EWE A;  2WA3 A;  5CFD A;  5LAS A;  3ILN A;  1R08 2;  1O3S A;  5C9A B;  3EQE A;  3A22 A;  4K3U A;  4OHY A;  2DBI A;  5DAV A;  3JZV A;  3IM0 A;  5A33 B;  1NE6 A;  2OPW A;  4P9J A;  4P9W A;  1UD1 A;  2VZQ A;  3GZT B;  1COV 1;  3JU9 A;  5C4W B;  1FXZ A;  1YQC A;  4IEZ A;  1JHN A;  3ASI A;  3MUY 1;  5LRR A;  1KS4 A;  2AAC A;  1JUI A;  4PLN A;  5EQU A;  5FZ3 A;  5A3U A;  2P6C A;  2RDN A;  3JCI A;  5CBL A;  3WQ1 A;  2X09 A;  1O4T A;  1MEC 1;  1SQ4 A;  3T2P A;  2BGO A;  1F4H A;  5CU1 A;  1CAW B;  3VKF C;  1AR8 1;  5DXD A;  2YFU A;  2JDY A;  3K3N A;  3KCY A;  4KGG A;  4Q4W 1;  3WDT A;  2B5H A;  4XAC A;  4HAN A;  1LOC A;  3M2M A;  4Q4X 1;  5CAZ A;  1VMH A;  1XNA A;  1PZ7 A;  3VD5 A;  5I93 A;  2UYA A;  1PO2 2;  1W6P A;  5EIY B;  1KXG A;  5GZF A;  1QMJ A;  1OD5 A;  1WW5 A;  2RJK A;  3GHN A;  4I09 A;  2BV4 A;  4LA3 A;  4DO0 A;  3W5N A;  2BJS A;  5EP9 A;  2XDV A;  4I2O A;  1G9F A;  1OQE A;  3EJK A;  1XPW A;  1VBA 3;  4QGM A;  3VBR C;  2JB8 A;  2F6B A;  1E5S A;  1GQP A;  5DDJ 2;  4FTS A;  1XNT A;  4Y5S A;  3JB4 C;  1MEC 2;  2DUO A;  4J25 A;  2DF7 A;  2P3I A;  3W21 A;  4XQD A;  4LTA A;  4N9H A;  3O7O A;  2TBV A;  2YC0 A;  3OPW A;  1W6O B;  4YW3 A;  2A7A A;  1PVC 1;  4GAL A;  1HRI 1;  1XSR A;  4Q0P A;  4TWT A;  1W9W A;  5I91 A;  1GP6 A;  2XGX A;  3GNE A;  1YHF A;  1PVX A;  3WF0 A;  4XBQ A;  3FJS A;  5F5C A;  1TG7 A;  2W39 A;  3A23 A;  4IEQ A;  5BNN B;  5JMO A;  2W5F A;  1PK6 B;  4LOS A;  4NVP A;  5F8P A;  3SEP A;  1NE4 A;  4Q8L A;  1BHG A;  2WUH A;  1YQ8 A;  3AMH A;  4UF0 A;  5FZA A;  4A4A A;  4EV0 A;  3BTX A;  3ACG A;  3CZJ A;  4CEY B;  2ZEW A;  4N53 B;  3C7O A;  5K7P A;  2OW4 A;  5FAX A;  1W8U A;  2NYY A;  1ACC A;  5EJZ B;  3UK9 A;  2CTV A;  3ZIW A;  1W6O A;  3O1V A;  1EV1 2;  2VMF A;  1J58 A;  4CP9 B;  4Q2F A;  1XYP A;  4Y26 A;  5FY0 A;  4D7S A;  5FY1 A;  1W9T A;  1PGW 2;  4ERO A;  3AC0 A;  4EWD A;  2ARX A;  5JCT A;  5A32 B;  1GR3 A;  5KHG A;  4RGG A;  2BFU L;  5JR7 B;  1RUH 3;  3P1I A;  1OFS A;  3HEI A;  3VD4 A;  4NR1 A;  4A3X A;  1J3P A;  3ENR A;  2I74 A;  3DL3 A;  5EV7 A;  1CPN A;  3I2F A;  4XDO A;  2Y6G A;  4NO4 A;  4MHU A;  4LNV A;  5CFC B;  1NY7 2;  3R4D B;  5L36 A;  1XYO A;  4O9G A;  1BBT 3;  2R1D A;  3KGL A;  2UU8 A;  4FSJ A;  1AR7 2;  2W3J A;  4FOV A;  1IS5 A;  4OI1 A;  4XJ9 A;  4AI3 A;  1TMF 1;  4CDX B;  4FFH A;  4KWU A;  3ZDS A;  5E16 A;  2VCB A;  3AL5 A;  5LZ6 A;  1ASJ 1;  1NX9 A;  2NM1 A;  4WM7 B;  1QQP 1;  1RED A;  3QBQ A;  2QQK A;  4CU6 A;  3I2I A;  4Z92 B;  2BPA 2;  1EPZ A;  5F5Q A;  3DXU A;  5FPV A;  1QEX A;  3O12 A;  3T1M A;  1QOS A;  4GKY A;  2IFW A;  3LA2 A;  4FPH A;  2GP5 A;  4GWN A;  5FZ8 A;  2PLV 1;  4PDW B;  3ZSE A;  3O0X A;  2Y6K A;  2RM2 2;  5KXE A;  3GF6 A;  1LU1 A;  2J1U A;  4QKF A;  3LOI A;  4O9E A;  5A33 A;  4OQ9 A;  1YFW A;  1UYP A;  3OYW B;  5FZD A;  5IAV A;  5IAT A;  3LE0 A;  4JGY B;  2HWB 1;  3JD7 1;  1TME 3;  5CFC C;  1CAU A;  1GLH A;  2IWG B;  1S2E A;  2WAO A;  4P9I A;  1H2K A;  5IVE A;  3OBZ A;  4BQ2 A;  1OUS A;  4Z2W A;  1AYN 3;  4IEO A;  5I8S A;  5IUQ A;  4OHZ A;  1JU3 A;  2FMD A;  5C71 A;  3VZJ A;  5LB6 A;  1JI6 A;  4LK7 A;  2RHP A;  4FPC A;  4QWN A;  4YZ1 A;  1D4V B;  1FNZ A;  2WNO A;  3RGB A;  4MG2 A;  2LRP A;  3THT A;  5FLH A;  3M70 A;  4MXW A;  3DPR A;  4NHM A;  1GNZ A;  3LAG A;  2VNV A;  3VKN A;  3QD6 A;  4HSJ A;  4AOC A;  1GFF 2;  5DZG A;  4P00 B;  4BPZ A;  2BYV E;  2J22 A;  3RPQ A;  3JD7 2;  4CPB D;  4BQ1 A;  5FP3 A;  3V0A A;  3I59 A;  3MI8 A;  1J84 A;  1RUJ 2;  4CDW A;  2B8M A;  3K4Z A;  1AX2 A;  1MS9 A;  4NHL A;  5E88 A;  1K5J A;  3K48 A;  5FY9 A;  1TE1 B;  1F8V A;  4UWD A;  1QHD A;  4XTM A;  4NIH A;  4ES8 A;  3IB3 A;  4LA2 A;  3L2Y A;  2XR4 A;  1J1L A;  4KU8 A;  4MO3 M;  1NYW A;  4KWJ A;  3UGG A;  1RHI 3;  4M4P A;  4XFH A;  3WNN A;  3ZFE C;  2YZ4 A;  3ZIX A;  2CAV A;  1CZV A;  3K2O A;  1S0D A;  1VB4 A;  4AHW A;  2J1S A;  5A3L A;  1QJX 1;  5LA9 A;  5FZK A;  4D7Y A;  4EN6 B;  1PNG A;  1TMF 2;  1IS6 A;  3BUC A;  4YG6 A;  3WNP A;  3KHB A;  3LDR A;  4B8E A;  1OT5 A;  1BJQ A;  3AP4 A;  3NAP B;  3ZKU A;  5F3E A;  4XQW A;  1BEV 2;  3Q8C A;  3E5Q A;  1D4M 3;  4Y3O A;  3ECQ A;  1GZC A;  1QJF A;  1O4Z A;  2ZGL A;  5FYU A;  3ZYB A;  2GC3 A;  2JXA A;  2OZ6 A;  4YM3 A;  2XUM A;  2Y6H A;  4O7X A;  4QAW A;  4QX1 A;  3MHZ A;  1WW6 A;  1ZZ8 A;  1AXZ A;  2QTW B;  5HBA A;  2PFW A;  2X53 S;  5CKM A;  5FZ0 A;  4LT5 A;  3B01 A;  3WNM A;  1US3 A;  2GNT A;  2EXK A;  2ZX4 A;  1FOD 3;  4MX3 A;  4EWA A;  4AI0 A;  1GOH A;  1MPX A;  3IPV A;  2ZCW A;  3SKV A;  3A7Q A;  4KQ7 A;  1C5I A;  2P6H A;  1W8T A;  5FZO A;  3RMY A;  3BIE A;  2IXL A;  1L3J A;  1RUD 1;  3DPR B;  3AMQ A;  1MR5 A;  3J8F 2;  4ORF A;  3E5X A;  2DFB A;  3WG4 A;  5DMY A;  4Q4Y 2;  3ZYR A;  2MHF A;  4TSV A;  4X6Q B;  1WA6 X;  4CE8 A;  2J1A A;  1HB4 A;  3BN6 A;  1GV9 A;  3J7M A;  4HVO A;  4IE6 A;  2XJR A;  3UJO A;  3JD7 3;  4GIQ A;  3AMM A;  1JOJ A;  3KF3 A;  1UF2 C;  3ZMN A;  4ASK A;  5T55 A;  3WT3 A;  4HK9 A;  2ZGK A;  3D3A A;  5IJR A;  5I0S A;  2Z42 A;  1OLM A;  3D0S A;  3SLI A;  3OGR A;  2IUW A;  2ZHK A;  3WXP A;  1RUN A;  1I9R A;  2XH6 A;  3LDK A;  2G9F A;  4MOA A;  3BAL A;  2WII B;  5T3N A;  1VMJ A;  1HN1 A;  1CJD A;  1ZX5 A;  2A70 A;  4YZ3 A;  1ZRE A;  4YVS B;  3RZJ A;  5AC9 1;  2J1V A;  2Y6L A;  5D8A C;  1XNK A;  2Y34 A;  4Q4V 1;  1C57 A;  4CUG A;  4AEM A;  2DUP A;  1CZT A;  3MYX A;  1GZ9 A;  5FYZ A;  1S0E A;  1HRV 3;  2EIE A;  2JDP A;  1HRV 2;  4IES A;  1QIQ A;  2BRT A;  4OZO A;  4YW7 A;  5EXO A;  3RZL A;  4JQT A;  3AYC A;  4NPM A;  2QDR A;  5GLT A;  1SAC A;  1KEX A;  5ACA 3;  1IPK A;  4YGC A;  5CA6 A;  5JOZ A;  5ACA 2;  2KR2 A;  2XON A;  2VZ3 A;  5F3C A;  1XSQ A;  5FZB A;  1HQN A;  3W20 A;  5CFC A;  2ARE A;  1R64 A;  1GYK A;  5FZ1 A;  2WZ8 A;  1F15 A;  2QQN A;  2ZHM A;  5J96 B;  3RWN A;  5FYV A;  1ENS A;  4AK3 A;  4CDQ A;  3MDP A;  1IHM A;  2JKB A;  2WNE A;  1EUU A;  2WZR 2;  4BJ0 A;  2A6Y A;  2D3R A;  2C4X A;  4WVM B;  1FT9 A;  1W9S A;  1SBE A;  4AVB A;  2OII A;  4WM7 A;  4PF1 A;  5DAX A;  2XML A;  1VBA 2;  1UMH A;  1TNR A;  2W94 A;  2QFE A;  2XKO A;  1PM4 A;  3AFK A;  3CU7 A;  2W46 A;  1S0J A;  4G4F A;  3VDD A;  1HB1 A;  2OVU A;  1BBT 2;  1UO9 A;  4QT6 A;  4RGK A;  1QJZ A;  1SBD A;  5AFB A;  2ENR A;  4N43 A;  1PK6 A;  2Z4F A;  4TN7 A;  5E1R A;  5JXH A;  4PBO A;  4W50 A;  1DIW A;  1U5Y A;  4L9B A;  2YUE A;  5A1A A;  1KJL A;  1VIW B;  1CIW A;  4BMB A;  1MAC A;  4PHZ A;  1H8T B;  5GLU A;  4UI9 L;  2I45 A;  3VZN A;  5KHI A;  1V6I A;  3I4I A;  4NHX A;  2BOJ A;  2AEZ A;  4URA A;  1KGY A;  2ZML A;  1W28 A;  4N9I A;  2Z2S B;  4P14 A;  5HPO A;  3ZR5 A;  1OLR A;  2BQP A;  4QGL A;  2ZGR A;  1I5P A;  1S4C A;  3FX3 A;  2DUQ A;  4W6X A;  4XMA A;  1J83 A;  3I2K A;  2GC0 A;  4AEK A;  4CYD A;  1MQT C;  4EJR A;  1TEI A;  1GWK A;  2HBU A;  4RHV 2;  2PHL A;  1W3V A;  1LKN A;  4D8M A;  1NA1 B;  3M3E A;  3OGG A;  4GB3 3;  4XJZ A;  2A3W A;  4AHZ A;  1VAM A;  4PF5 A;  3A0K A;  5C8C A;  2TEP A;  4QPG A;  5H9Q A;  4XUO A;  3RI9 A;  3TEZ A;  3QOP A;  5A3M A;  4GJZ A;  1STM A;  3N7M A;  2R04 1;  2VCC A;  2WO2 A;  4A45 A;  1LNS A;  3VBR B;  2EID A;  4XTP A;  4BU2 A;  4L11 A;  1K12 A;  1FX5 A;  2W9X A;  3PTY A;  1HB2 A;  3ZXF A;  1KQR A;  3FWE A;  4JHZ A;  1DQ2 A;  3HQU A;  4XHB A;  4YGB A;  3VBO A;  5IVY A;  5DG1 A;  1JYC A;  1NCQ A;  4R8H A;  1RUJ 3;  5DDJ 3;  5FFO C;  3VZL A;  1XXN A;  1UYZ A;  4UBG A;  4GWI A;  2NMO A;  1UU6 A;  1RMU 3;  1KDM A;  3FN9 A;  1ZRR A;  2FCU A;  3WCS A;  2X5I B;  2K46 A;  2JE8 A;  3MW3 A;  5CFD B;  1G9C A;  3R05 A;  1LED A;  3LIH A;  1AVB A;  1SLL A;  2E6V A;  2BU9 A;  3E5U A;  3PTR B;  3ZSJ A;  4K7J A;  3U4X A;  3AJY A;  2WC2 A;  1UXZ A;  3I3E A;  2IXH A;  2JWP A;  2XHK A;  4Q4V 2;  3PUA A;  1SLB A;  1HB3 A;  2V5D A;  1YFY A;  4E4H A;  4UYB A;  1LEC A;  1W0O A;  3TEX A;  4E8D A;  2BBA A;  2WZR 1;  5FYC A;  1PHM A;  4YW5 A;  4C90 A;  3M1H A;  1XNB A;  5FMO S;  1N1S A;  2PLV 3;  2R49 A;  5F37 A;  1H9W A;  3B02 A;  2ZOE B;  1D4M 1;  3HD8 B;  4CCN A;  1ENR A;  5LWB A;  2OZJ A;  1Y7B A;  1W6Q B;  2A71 A;  3AKT A;  5LA2 A;  3T30 A;  4K1Y A;  2UY8 A;  3AKR A;  4QX7 A;  5C8C B;  5JDB A;  3BTY A;  4QPG C;  2FD8 A;  5CFD C;  4V2V A;  1V9U 1;  4ITC A;  1MS0 A;  3MLL A;  1GZW B;  3FUQ A;  4NE9 A;  2PQQ A;  5CYY A;  5T52 A;  4NIA A;  1JYW A;  3T08 A;  1CZS A;  1N3P A;  1QWR A;  3RZZ A;  2DCZ A;  1N47 A;  1S0G A;  1ND3 A;  3TN9 2;  4B4P A;  4JV4 A;  4MGK E;  2TNF A;  5C3S A;  2RS5 3;  4QPY A;  4URT A;  2RS5 2;  4ZY9 A;  2W95 A;  1OA4 A;  3POB A;  1FNY A;  4XBL A;  3GBG A;  4FPO B;  2ZGP A;  4LMF A;  1DZT A;  3WDW A;  4JGZ A;  1NCR B;  2X29 A;  4AQS A;  2DTY A;  3S7I A;  3G7D A;  2WDB A;  1ULP A;  5K9Y A;  5FBZ A;  4AL9 A;  1GNH A;  4P9X A;  2DYC A;  3VBH B;  1AL2 1;  1POV 3;  4JX0 A;  4MGY E;  5IVV A;  3NJV A;  4HT1 T;  2YXS A;  1NXD 1;  4IE7 A;  1TNF A;  1QU0 A;  3MPB A;  1REE A;  2PXJ A;  4N43 C;  2AZ5 A;  4YVS C;  2XVK A;  3NST A;  3KS7 A;  4GZ9 A;  4UFI A;  3VL9 A;  2GN7 A;  5L9B A;  5LBE A;  1AF9 A;  2WZE A;  1HDK A;  2O0O A;  5J7M A;  5FZ7 A;  4OMC A;  5GLV A;  2DBN A;  1R08 3;  2DU1 A;  3Q8A A;  3H8O A;  4AFA A;  2Y33 A;  3GXU A;  3PJY A;  1OH4 A;  1PGL 1;  1XJA A;  3O0W A;  1NKG A;  4AFB A;  1JH5 A;  4IV1 B;  5T50 A;  2HWE 3;  1SLA A;  2R1B A;  2OPK A;  2ZKL A;  3RS6 A;  2OT7 A;  5A3N A;  1D4M 2;  1V0A A;  2EF6 A;  3TNP B;  2BW8 A;  4NAM A;  1X7N A;  5J98 B;  4UFK A;  1LOB A;  2FDI A;  1VBE 3;  2VOX A;  2XLG A;  1JOD A;  4LBQ D;  4S2D A;  1IGO A;  2W0X A;  1S2B A;  4FAG A;  4EQV A;  1WKY A;  4MGS A;  1Y43 B;  4NHY A;  4QM8 A;  3RVH A;  4FPK A;  3I3Q A;  3WW4 A;  3DF0 A;  1Q43 A;  4IV1 A;  2XL7 A;  1UWW A;  3FC0 A;  4Q4Y 3;  5JWP A;  1PO1 3;  3WG3 A;  3AMN A;  4H7L A;  2VQ0 A;  1AJK A;  3ZN5 A;  5HV4 A;  1CAV A;  1BK1 A;  3LCP A;  1R1Z A;  3N9P A;  4HN1 A;  3IWZ A;  3AZY A;  1X50 A;  4DXZ A;  3EB7 A;  1OKO A;  4E2Q A;  4IW3 A;  3RYR A;  2E7A A;  2RS3 1;  4UF0 B;  2WYF A;  3ON7 A;  2QQO A;  5A7N A;  1OOP C;  2W1U A;  4CPB A;  2A3Y A;  5FV3 A;  1GMM A;  3H7Y A;  3JBG 1;  4DZG A;  4EZ4 A;  2HWB 2;  2MEV 3;  1PIV 2;  3WP3 A;  1GKB A;  2WLQ A;  1W6N B;  5FUP A;  1W06 A;  5F6L B;  1FMD 2;  2WR9 A;  4GJY A;  1Y9Q A;  4P02 B;  1ENX A;  3CJX A;  4QX2 A;  2QUO A;  4LBK A;  4XXA A;  5D1I A;  5FDB A;  1Z7S 1;  3Q9O A;  5FJK A;  2P34 A;  4JAA A;  4MLO A;  4BQ3 A;  2XQR A;  4YNI A;  1DGL A;  1BKZ A;  3AKP A;  4NRP A;  3CBN A;  4HMZ A;  2B45 X;  4B4Q A;  1XQN A;  2HWD 1;  1DF0 A;  2JDN A;  5ANQ A;  2Q4S A;  3ZYG A;  5LEJ A;  1LRH A;  1NXM A;  3UYJ A;  2Z5W A;  4MGZ E;  2W92 A;  3MIH A;  2RMU 1;  1NLQ A;  2VZV A;  4QD2 A;  4NPR A;  2NPI A;  4TYS A;  4B29 A;  1RXG A;  4BWO A;  3K77 A;  3DEC A;  4L0P A;  3MIC A;  3I2J A;  2YPJ A;  2GC1 A;  3NKG A;  1LR5 A;  1SDW A;  5LBC A;  1VBC 3;  4XMI A;  5HCB A;  2ZHN A;  4ASM B;  3PU3 A;  4OQ8 A;  3OBT A;  1GU3 A;  4DMI A;  4QQ2 A;  1XC6 A;  1VBE 2;  3D4K A;  1H4H A;  1KDK A;  4IEV A;  1W9Y A;  3L9J T;  4K8F A;  3T2Q A;  5ANN A;  4UW5 A;  2WZP P;  4AHX A;  1AR7 3;  1UX7 A;  1V6M A;  3VKM A;  4GH4 A;  1PZ9 A;  1HQL A;  1UIK A;  3KM5 A;  1YXW A;  1PO2 3;  2SBA A;  5C33 A;  5CKQ A;  3V65 A;  4KU7 A;  4XET A;  4DRV A;  2CWM A;  3NJX A;  1CQ9 A;  4GMP 3;  3VBF B;  2QQU A;  4QKB A;  2WN2 A;  5KC6 A;  1A34 A;  2ATF A;  1NZC A;  4ZPI A;  1QJY 1;  1ZBE 3;  2OA2 A;  4J1W A;  1JOP A;  3OUH A;  2XB6 C;  2MPF A;  4PDW C;  2IVJ A;  2QKD A;  4CP0 A;  3WNK A;  4PIX A;  5C7G A;  2DCY A;  4GXL A;  1WLW A;  2XBO 1;  4LLF A;  3VBO B;  3VBF C;  1ZNP A;  2VBD A;  3EHK A;  4Z2A A;  1AL0 G;  2D98 A;  5FMC A;  3NKT A;  1H8V A;  3RMX A;  1JU4 A;  3D5O A;  4FPY A;  5F2W A;  2P2K A;  4KWK A;  2IVI B;  1CAX A;  3N7L A;  2YBK A;  3O1S A;  4FCA A;  2QCS B;  4KG8 A;  5JPN B;  5CAD A;  1K5M B;  1PM7 A;  1OPM A;  5E89 A;  1FPN 1;  4CUA A;  3CKH A;  4DY5 A;  1EUT A;  4HN0 A;  3V64 A;  2DU0 A;  5JSR A;  3QLQ A;  5A3P A;  5E6H A;  2Y8K A;  1KS5 A;  4IE4 A;  4D3W A;  1B35 C;  3PIG A;  4MV2 A;  1H30 A;  4EN7 B;  4CXW A;  2VMD A;  3HQX A;  5F2S A;  1CWP A;  5DUU A;  4RFT 0;  2EXH A;  2HWF 1;  4GB3 1;  4KI5 M;  4K21 A;  2E32 A;  3OTF A;  3GZU C;  2JEM A;  5GKA C;  3DYP A;  4OI2 A;  5FRE A;  1ULD A;  2ZMN A;  1CGP A;  4QKD A;  3RI8 A;  2D44 A;  1RUE 2;  2YU1 A;  1PNF A;  3HVD A;  1BLZ A;  1MQT A;  3T3Y A;  3AM2 A;  4E4S A;  1G9D A;  5IK7 A;  2FDK A;  2GP3 A;  4Q26 A;  4XUP A;  2WS9 2;  3I97 A;  4XF0 A;  1W6M A;  2Z69 A;  4QXB A;  4MXW B;  4QQL A;  1TZO A;  3OBR A;  3T1L A;  5T5O A;  3VBR A;  4CU9 A;  3VGI A;  2QQL A;  3BGA A;  1XE0 A;  3J4U H;  4PI2 A;  2AYH A;  3B00 A;  4E4Z A;  3TNQ A;  2ZHL A;  4N43 B;  5E8A A;  3IBM A;  2IXK A;  2XOM A;  3MGU A;  2HEW F;  4L92 A;  1XU2 A;  3ZFG B;  4LUL A;  4CUB A;  4FT8 A;  3RZG A;  5LA1 A;  1C8M 1;  5JMC A;  1BQP A;  2JIJ A;  2D6P A;  3NO8 A;  2Q5T A;  2QQW A;  4JGY A;  4BE3 A;  2WSU A;  1O5L A;  3NVC A;  2CNA A;  1BYH A;  4TZD A;  4YVW A;  5FY7 A;  1V9U 2;  1R1A 2;  4CRQ A;  2JE9 A;  1AR6 3;  3SEE A;  4DQA A;  2WQZ C;  1ND2 C;  3WDV A;  3UKT A;  3TEY A;  3ES4 A;  3LEG A;  3WF2 A;  1WME A;  2OX0 A;  2UUR A;  4ARY A;  2VVD A;  2QJV A;  3JUU A;  1UAI A;  1RVF 3;  1S1A A;  2HWC 3;  2QBX A;  2W08 A;  3HN3 A;  1SFP A;  3IKW A;  2J1T A;  3IZO A;  4WZC A;  4Y4Y A;  1OUR A;  3VB9 A;  3N7J A;  4F8A A;  1J3R A;  2PHR A;  1MZ6 A;  5FPX A;  4W65 A;  3FLP A;  1WA4 A;  2FDH A;  5JI9 A;  1V6O A;  4QPI C;  5H9R A;  3WQ0 A;  4YWA A;  3OOX A;  4K9S A;  4J1X A;  5BPX A;  1QOO A;  3VBS B;  3S57 A;  5IYY A;  3NW4 A;  3F2Z A;  3WQ7 A;  4LPL A;  1JBC A;  1V6K A;  3ZYI B;  2ZEX A;  4Q4W 3;  1AXK A;  4W6Y A;  3U78 A;  3THP A;  1L7R A;  1IOA A;  3BCW A;  3PVB B;  2GH2 A;  1SCS A;  1YC6 1;  2A3X A;  5IHR A;  1W8Z A;  1O3Q A;  3D6E A;  3WUD A;  1NQD A;  4HBN A;  4ZU7 A;  1CVN A;  4PQQ A;  5FRA A;  5A3O A;  3VKL A;  4WVZ A;  3OG2 A;  4FAH A;  1RUG 3;  4A2U A;  2XJQ A;  3VBH A;  4N53 A;  1AL2 3;  5JPM B;  2JX9 A;  2ERF A;  2RDR A;  3B94 A;  5FO9 B;  2VW0 A;  4YM0 A;  4JGY C;  4HLT A;  4XF9 A;  2LTN A;  2BNM A;  1IG0 A;  2RM2 3;  5A6X A;  4CDQ C;  4WVV A;  2WL1 A;  1QOT A;  4AGV A;  2JD4 A;  2RMU 2;  3RNS A;  4AGR A;  3AL6 A;  1FAY A;  3ACL A;  4RHV 1;  4A6O A;  4GD4 A;  3BTA A;  3VLB B;  5F1R A;  3T2T A;  1GSL A;  2WNV B;  2GC2 A;  4S2G A;  5IK4 A;  1UW8 A;  2Y64 A;  4NII A;  3LD8 A;  3RQ0 A;  4B1L A;  1ZVF A;  2CY6 A;  2DWR A;  4YVS A;  1AR6 2;  1UY2 A;  5IVF A;  3K4D A;  4BM8 A;  1OBN A;  2PHU A;  2IXJ A;  1HV0 A;  4M3C E;  2R07 3;  2VL4 A;  1RUH 1;  1DZR A;  2X05 A;  2DDU A;  3JQX A;  2IFR A;  5GLW A;  1PGS A;  3NRU A;  2Y0O A;  1W90 A;  4AVT A;  4LJH A;  4QPI A;  5H9P A;  1GNY A;  2AC1 A;  4BOW A;  2YMZ A;  4QHZ A;  5C8W A;  4BB3 A;  2FZ1 A;  2PAM A;  3BVC A;  4HPK B;  4MVT A;  1DQ5 A;  1EAH 1;  1NCR A;  1M06 G;  1QH7 A;  1OA2 A;  1Y4W A;  5FBJ A;  2HJI A;  4EN9 B;  1UYX A;  2X8K A;  3NNM A;  5IWF A;  1FMD 3;  3P5B A;  1SFN A;  2ORZ A;  2ZX1 A;  5HI0 A;  3M3O A;  2RG4 A;  1AR7 1;  1OF3 A;  2XLA A;  4ZON A;  4BIS A;  3KVA A;  3GJA A;  1JN2 P;  2B9V A;  4ZHN A;  4YW6 A;  3W5M A;  2DV9 A;  2JIG A;  2VUA A;  3BU0 A;  3KV9 A;  4HK8 A;  3GM8 A;  2CWS A;  2HWC 1;  4QX3 A;  5FZG A;  3A0N A;  2JDK A;  2JDM A;  3WP5 A;  1XBF A;  2Y6J A;  3BPS A;  1GZW A;  5F6K A;  3WDX A;  4WM8 C;  3IMN A;  1Z7S 2;  2VZ1 A;  3ITQ A;  3LA3 A;  5BNQ A;  3LSE A;  5CKN A;  5HXM A;  2P3J A;  4N7U A;  5EZW A;  4DPN A;  2HWB 3;  2MEV 2;  2QQJ A;  5BNN C;  1L7Q A;  2D6N A;  5T5J A;  3OGS A;  4XOG A;  2HKX A;  3I59 B;  5FPU A;  1KJR A;  2B46 X;  4I3G A;  4DXS A;  3R6S A;  3FMG A;  2R07 2;  4RS5 B;  4H55 A;  2OKX A;  2D3P A;  4AQT A;  4Y1V A;  4XAA A;  3IDE A;  1PMH X;  4PCR A;  2E9Q A;  4D6Q A;  3UNP A;  1XB9 A;  1BMV 1;  2ADE A;  2ZGN A;  4OI4 A;  4Q0S A;  1HJG A;  3O1U A;  2XWJ B;  4Q5O A;  3ZYH A;  2E7Q A;  3BOP A;  4MXV A;  2WA4 A;  2YRO A;  2VNG A;  5IVC A;  3BI3 A;  1MS3 A;  3KSC A;  1FV3 A;  1RYY A;  3OEA A;  1I5Z A;  4M3C B;  3VHO A;  4AR2 A;  2A6Z A;  3KGZ A;  4R9B A;  5DAQ A;  5JIA A;  5FUI A;  3RJR A;  2VQA A;  2HEV F;  2MNG A;  1F2N A;  1PVC 2;  2ZS6 B;  2VZP A;  3USU B;  2WNV C;  5I0T A;  4RFR B;  4NWV A;  1K3I A;  3SH3 A;  4ARX A;  4CEW B;  2VZO A;  1AYN 1;  3KMH A;  4XFA A;  3EO6 A;  2D40 A;  5FR3 A;  1J3Q A;  2P17 A;  4RR3 C;  1GUI A;  1UY3 A;  3FLR A;  2OYZ A;  4C0H A;  1W2T A;  1GP5 A;  1NLS A;  2YV8 A;  1YO8 A;  3CJI A;  1UL9 A;  3I3B A;  2WS9 3;  4FFG A;  5GZD A;  5D8A B;  4LO7 A;  3T0B A;  1PO2 1;  3B9I A;  4LHL A;  3BTZ A;  1XRU A;  1OUX A;  1CD3 G;  3DEM A;  3LZZ A;  4Q4V 3;  3PVO A;  4DFS A;  5A1F A;  1X82 A;  4MH0 E;  3OPT A;  4CDU C;  1O59 A;  1O4Y A;  5LCW L;  4FPG A;  1LHN A;  1LOG A;  1RUD 2;  4Y22 B;  2WFF 2;  5LBB A;  4MGQ A;  4BLI A;  4BIF A;  1OSG A;  1RUC 2;  4L99 A;  4QHO A;  3J26 N;  1ZYB A;  1SLC A;  5FYM A;  3DXT A;  3SKJ E;  3C7E A;  3PUH A;  1QJX 3;  4M0H A;  2WIN B;  3M4F A;  1NQJ A;  4LO6 B;  1COV 2;  4XYX A;  2FQP A;  3X29 B;  2YDE A;  1YFU A;  2GN3 A;  1UIJ A;  2O1Q A;  5BYN A;  2L9L A;  1VPH A;  5TSW A;  5I0D A;  3VDA A;  4EN0 A;  4MET A;  1LJ7 A;  2HWC 2;  3UGH A;  4LKE A;  2RS1 1;  3GHM A;  3TN9 3;  3VBS A;  1RUI 1;  1UU5 A;  1FI2 A;  4L97 A;  2VGD A;  2JG9 C;  2WWS A;  4JKK A;  2FCV A;  4Y1U A;  2EIC A;  5FZ9 A;  3DV8 A;  2KM2 A;  1O91 A;  3FHA A;  4YYO A;  4D94 A;  3ZYF A;  4WZF A;  2FDG A;  4IET A;  1QXJ A;  1UNB A;  1JYN A;  3WF3 A;  1Q56 A;  2VZU A;  4CDX A;  4JTN A;  5BNO C;  1RGS A;  1RTV A;  2P3K A;  2C9K A;  5CVR A;  4YW4 A;  1VE0 A;  5EHD A;  1HXS 3;  4ZXE A;  5JVV A;  4DXT A;  3H8R A;  3URF A;  1PIV 3;  4P08 A;  1MS1 A;  2QQV A;  3ORJ A;  3ZFE A;  2VUD A;  3M3I A;  3S0M A;  4AI2 A;  5CNA A;  1JZ4 A;  4ISQ A;  5CG9 A;  1PZ8 A;  1Q8S A;  1XE7 A;  3POE A;  4AXO A;  2BWA A;  3RZK A;  4DEQ A;  5A32 A;  1CX1 A;  2Q8O A;  3ZN6 B;  5FY4 A;  1XYN A;  5L7O A;  2BER A;  4GA9 A;  4CP9 A;  4EZH A;  3MUZ 1;  4Z1V A;  5FUN A;  2GAL A;  5C70 A;  2BWC A;  1H4G A;  1IQA A;  1R09 1;  4EN8 B;  3DKW A;  3ZFE B;  4FTE A;  4XUQ A;  4KBZ A;  2WT2 A;  2XJV A;  1H6Y A;  4XW3 A;  2ARB A;  1AX0 A;  1VAL A;  1X33 A;  1W6P B;  2Q1F A;  2W68 A;  5HCA A;  4JDN A;  1JZ3 A;  2D3S A;  4IER A;  3NL1 A;  5JOX A;  1RUF 2;  2GU9 A;  1V6L A;  2FHR A;  4Y22 A;  5A7O A;  1VBC 2;  5FZH A;  2E53 A;  1F5J A;  5T5P A;  4FP2 A;  4BA6 A;  4YG3 A;  4MUV A;  4AED A;  1K5M A;  1GWL A;  1LGC A;  2IZW A;  3WV6 A;  3ZYP A;  1RVF 2;  3ZLI A;  2Y6F A;  5DG2 A;  4FQ4 A;  1V6N A;  4RQP A;  4QXC A;  1B35 B;  5FP8 A;  4PLM A;  2PAK A;  5K4L A;  4BQX A;  3IPV B;  5CIS A;  4AE2 A;  2HEY F;  4LO5 B;  4DB5 A;  4Q29 A;  1HX6 A;  5BNP B;  3KV4 A;  1U5Z A;  1IQD C;  1G6N A;  2C9A A;  3MF6 A;  2JEN A;  1D7P M;  3HR9 A;  1UY0 A;  2W1S A;  5GAL A;  1RUH 2;  4XDP A;  3PUS A;  2JB4 A;  3TYJ A;  1HLC A;  1RVF 1;  4JCK A;  1EY2 A;  1KFX L;  2R04 2;  3W9A A;  3VHP A;  5A6Q A;  2PA7 A;  1AUY A;  1RMU 1;  2V4V A;  4LUK A;  2D6K A;  3HAG A;  2R06 3;  2VBP A;  4PJY A;  1RUG 2;  3VBO C;  2D7F A;  3TWI A;  4CDW C;  1TME 2;  2R32 A;  1XOY A;  2XWB B;  4IQP A;  4QQH A;  3ZXD A;  3JB8 A;  5DUW A;  4D69 A;  2CGP A;  1QDC A;  1W03 A;  5B4X A;  1EYB A;  3QH7 A;  4A7Z A;  3QAC A;  3E1F 1;  5FYB A;  1CAX B;  5APA A;  4ASL A;  1V00 A;  5BNO A;  5L73 A;  3PMS A;  4KWL A;  4XC9 A;  5KXC A;  1DP0 A;  2TUN A;  2XG3 A;  4DUX A;  3NNJ A;  4TLG A;  4Q8K A;  3JBG 2;  4KG0 A;  5LA0 A;  1PX4 A;  4Z8B A;  2QNK A;  1YRZ A;  1ZM1 A;  1FAT A;  4Q0Q A;  4I3P A;  4QB6 A;  2K0G A;  3BIW E;  4HKO A;  2R0H A;  4LBL A;  5T5L A;  3VD7 A;  5F39 A;  4XF4 A;  1W39 A;  2UWB A;  2Q8E A;  2IXC A;  1SLI A;  4HET A;  2PN5 A;  1OXC A;  4NHK A;  5FYT A;  3USU A;  4LO4 B;  2VBB A;  3H0O A;  3PDQ A;  4YSF A;  1VBA 1;  2ZTN A;  1DCS A;  5IK8 A;  2JDA A;  3ZN4 A;  4NID A;  4E4D X;  1ND2 A;  2WO1 A;  4OFG A;  2EVX A;  3VUO A;  5LAT A;  1S0F A;  1AR8 3;  1ULC A;  1T6G C;  4MHR A;  3USS A;  4B3N A;  1AR9 3;  1S0B A;  1S0C A;  3B7M A;  2GNM A;  4B7K A;  2DFC A;  1LOE A;  1U5I A;  3DGT A;  4PT6 A;  3J9S A;  4CDU B;  2ZKN A;  3GCX A;  5BY5 A;  1R09 3;  3O0V A;  4RN5 A;  1N1T A;  1AZD A;  4RS5 A;  2VC9 A;  4V1P A;  2RJ2 A;  1PX3 A;  1MZ5 A;  4FOW A;  3LPG A;  3ELN A;  4KNC A;  4QPI B;  3MW2 A;  1POV 1;  2OUH A;  1PGL 2;  2J42 A;  2VOT A;  3O1T A;  2RR1 2;  1YI7 A;  3AVS A;  1RL3 A;  2FDJ A;  1KIT A;  3IN9 A;  1N1V A;  3LDB A;  4D6S A;  1YI9 A;  4IV3 B;  3OY8 B;  1C3H A;  1G9B A;  5JUV A;  5IK5 A;  2BNO A;  2NN8 A;  2BUK A;  1YJK A;  1IKP A;  3SIT A;  1ONA A;  5AFE A;  3W59 A;  3CZU A;  1Q8P A;  4Q1R A;  3AX4 A;  2BNN A;  2FMY A;  4FOY A;  5FYI A;  3WW3 A;  2VTX A;  2BBV A;  3HBK A;  5B2G B;  5BUV A;  4LBQ A;  5A7W A;  3EXU A;  1ODN A;  1W99 A;  3D0J A;  2KD7 A;  3HBZ A;  3WNX A;  2C6S A;  2ORX A;  4WVW A;  3K4A A;  1F35 A;  4G3Y C;  3KVB A;  1RJ7 A;  4XAB A;  4OUL A;  1LU2 A;  3NV3 A;  5FZL A;  3U37 A;  2VE1 A;  4AFM A;  2XQX A;  5A3T A;  4XCB A;  3OYW A;  4YLZ A;  1COV 3;  4OLL A;  1HJF A;  2P5B A;  2RDQ A;  1LOA A;  1W05 A;  2FBE A;  2N7G A;  3VDD B;  2WZR 3;  3AFG A;  2V5Y A;  3OGJ A;  4NJ4 A;  4YVW C;  2HWF 2;  5GZG A;  2V09 A;  1ASJ 3;  3FE5 A;  3OD4 A;  5DN2 A;  3SH4 A;  4C1X A;  4LK6 A;  3FFZ A;  4WM8 B;  2WT0 A;  1KFU L;  4QDR A;  2YY1 A;  1SBF A;  5DZF A;  2K9Z A;  3HPN A;  3WY6 A;  3NV2 A;  4QX5 A;  1HKD A;  4AQ2 A;  5HCF A;  4BK5 A;  3AVR A;  3WR0 A;  1Y9M A;  3NJZ A;  1DGW X;  3LFI A;  4P9L A;  1W2O A;  2WT1 A;  3AP5 A;  4Q0U A;  2MEV 1;  2ZGO A;  4A7Y A;  5FZ6 A;  5FWJ A;  1QNW A;  1W8O A;  2E63 A;  3J7H A;  3OD0 A;  2XXZ A;  3KCC A;  2ZA9 A;  1ENQ A;  1UOB A;  1OOP A;  2LW8 A;  3P3N A;  4COY A;  5IFP A;  3KLS A;  3H1W A;  1T2X A;  5FY8 A;  3WQB A;  1LHW A;  1QDO A;  3O1P A;  3U11 A;  3BOD A;  4FPL A;  4ZS2 A;  4M4R A;  1QJX 2;  4IV3 A;  4QU1 A;  1TME 1;  4IDZ A;  4CEY A;  4FI9 A;  2YFZ A;  3I7D A;  4Z07 A;  4N90 A;  3POF A;  1WLD A;  3AB0 A;  1UOJ A;  4ISR A;  3VV1 A;  1W6Q A;  1YEW A;  2CV6 A;  3POY A;  5FLI A;  3PLQ A;  4BLJ A;  3NWK A;  5FPB A;  4LIV A;  3CMG A;  4GH4 C;  5ISL A;  4FPJ A;  1XND A;  2BOI A;  3O5S A;  3A4U A;  4X6R B;  3OBA A;  3B9C A;  4XZP A;  4BQW A;  3WW1 A;  4LR4 A;  3AP7 A;  5FYY A;  2Q1M A;  3T2O A;  4Y20 A;  3U4S A;  2VW1 A;  3VDB A;  1H2L A;  3F95 A;  1O5U A;  1DFQ A;  3I2D A;  5A7Q A;  4D0Q A;  5JZG C;  1ZBA 1;  2EAK A;  1QQP 2;  3WD5 A;  1C5H A;  1DGW A;  5T54 A;  5ABJ A;  1AJO A;  1QQP 3;  2CGO A;  5C4W A;  4CUC A;  1ASJ 2;  1LHV A;  2CDO A;  1H9P A;  1ULO A;  3AZX A;  2YB7 A;  5I0R A;  4X8N A;  3RDI A;  2VXJ A;  3MFA A;  1U5X A;  3GGL A;  3NJY A;  4IEP A;  4ZZ8 A;  5K8S A;  3RG0 A;  1BBT 1;  4C1W A;  4RSU A;  4DRR A;  4M01 A;  4LE3 A;  1ZBA 2;  2Y0I A;  5FZ4 A;  1ZRI A;  2R0F A;  4XIO A;  3RJ2 X;  2Y38 A;  3ZVX A;  2B7Y A;  4CCJ A;  3VKO A;  3V0B A;  1AX1 A;  2WQ8 A;  4XF3 A;  5I0U A;  1H1M A;  1VP6 A;  1PK6 C;  1QJE A;  2WO3 A;  5J3U A;  3AZV A;  1Q8O A;  3SH5 A;  4A41 A;  3NNG A;  3WF1 A;  2G9Z A;  5G04 L;  5JXI A;  4S2H A;  1SHW B;  2WFP A;  1T6B X;  4C8D A;  1UPI A;  2ZX0 A;  1SMV A;  1RUD 3;  1QKQ A;  2BEO A;  2VMI A;  4YG0 A;  4BHP A;  4DNY A;  5LY1 A;  2RMU 3;  3Q8F A;  3UET A;  3LKJ A;  3ZSL A;  5C9A A;  2VOW A;  4R9D A;  1POQ A;  3CNA A;  3LEK A;  4FQZ A;  4IEU A;  4OUS A;  1KRI A;  1D0H A;  2D5H A;  5A1L A;  4I01 A;  3BYW A;  4XJU A;  2CYF A;  1LEM A;  2E7T A;  2EA7 A;  3PU8 A;  5FK8 A;  1JZ6 A;  2C5D A;  2GNB A;  4OUM A;  4FTB A;  1RUO A;  3MZH A;  3UKV A;  3VD3 A;  3ZXJ A;  1GQG A;  1RIN A;  3E6D A;  4ZZ5 A;  5EFU A;  4OYU A;  4R9C A;  3PIJ A;  4CDW B;  4BZ4 A;  1OC1 A;  3H3L A;  3H1M A;  1RHI 1;  1OD3 A;  2HBT A;  3FZ3 A;  4PLO A;  4G9S B;  2BVV A;  5FJH A;  3OJB A;  4D6R A;  4YRD A;  3VHR A;  3ACI A;  5IW0 A;  4YGD A;  5BNO B;  2BFU S;  5FZM A;  1QH6 A;  3BKZ A;  4JTO A;  5K0U A;  1R1A 1;  3BPZ A;  1XE8 A;  4KH9 A;  4RR3 A;  2WLP A;  4TLF A;  3AKQ A;  4QDS A;  2VCA A;  2Q30 A;  1BVP 1;  1HN0 A;  1N3Q A;  2JG9 B;  4OHV A;  4YZ2 A;  1HXS 2;  3LB9 A;  1DGR N;  1HRV 1;  1QJU 1;  3ZPY A;  3P6B A;  3LEM A;  3NNL A;  3O1M A;  3KCX A;  1AXY A;  1A8D A;  2UWA A;  3R4U A;  4W4Z A;  2OXB A;  2PMW B;  4XHX A;  3WP6 A;  1LAJ A;  5C3O A;  2R06 1;  5AC9 2;  3GAL A;  4H2A A;  3N9M A;  1RJ8 A;  4HSL A;  4I0W B;  1C8M 3;  4QX8 A;  2VNR A;  1ZZ9 A;  2CDP A;  4U2A A;  4YM1 A;  1JYI A;  2H6C A;  4B7E A;  3FUO A;  2P1B A;  5KBF A;  4QQP A;  1HRI 2;  3T09 A;  1RUF 3;  1ODM A;  2DVD A;  3HNM A;  4BQY A;  3H3Z A;  5B4N A;  1NAE A;  5FK7 A;  5SV8 A;  2ZX2 A;  4MAD A;  4R9A A;  5FMO L;  5FMD A;  3LA7 A;  5JOW A;  4LIT A;  1VR3 A;  2G4I A;  4K8R B;  4UW4 A;  1H8T A;  2D93 A;  4QPW A;  5FPZ A;  1UPS A;  1X8E A;  3RFR A;  4CCM A;  1DQ6 A;  3DKQ A;  3IIA A;  2R16 A;  2WN3 A;  3KQR A;  4GB3 2;  3J8F 3;  3PME A;  2B39 A;  3VBU C;  2WNU B;  5FKB A;  1NOV A;  2ZZJ A;  3SXW A;  3LOB A;  3TOJ A;  2PTM A;  5JZG B;  1QF3 A;  5F5A A;  5FKC A;  1GZT A;  3UES A;  1C1F A;  1Y3T A;  1QXP A;  1GOG A;  2VW2 A;  4RL7 A;  3S7E A;  3T0D A;  3IDC B;  1N3O A;  3AYE A;  4OHX A;  1JYT A;  2W2I A;  4CTE A;  5JAX A;  2RR1 3;  3E6C C;  4WVM A;  3NNF A;  1CAV B;  3PVN A;  5D21 A;  4JKL A;  1NCR C;  5KHH A;  3ZKY A;  3ZXL A;  1OVP A;  4YM2 A;  5L7O B;  4E27 A;  1GIC A;  4JVA A;  4NAO A;  4ZKT B;  1UX6 A;  1IS4 A;  3CHX A;  1RUE 3;  4IEY A;  1VJ2 A;  2B9U A;  3AXD A;  1OOP B;  5L9R A;  1G9A A;  2O8O A;  3I49 A;  1X36 A;  5DUX A;  3AJZ A;  2ZXQ A;  1C28 A;  1UCX A;  3MLJ A;  4XEZ A;  3FL7 A;  1DLL A;  4IE5 A;  3AP6 A;  5FP7 A;  4DIQ A;  3OGV A;  1W6N A;  5FZF A;  4NRO A;  1V6J A;  2VG9 A;  2ZGQ A;  4U36 A;  5FOJ B;  4K6B A;  1JYV A;  3KT7 A;  2OS2 A;  1ZA7 A;  2WYS A;  3S6P A;  4QQO A;  4LHK A;  5KC5 A;  2QQP A;  3SCH A;  4FFF A;  5AC9 3;  2PHD A;  3ZFF C;  3WEZ A;  2CHH A;  4L2N A;  1RUC 3;  3ALQ A;  2ZJC A;  3UL2 A;  2ZGS A;  1H6X A;  3IMM A;  3KQ4 B;  1JMU B;  3QH6 A;  2JG8 A;  3ACF A;  4AI8 A;  2AUY A;  5FYH A;  5GJ6 A;  4BYY A;  1R1A 3;  3OF1 A;  1UY4 A;  1OHF A;  5IAX A;  1UZY A;  3CJI B;  1EAH 2;  1YJL A;  1DDL A;  1ZZC A;  3B69 A;  2RJL A;  1C8N A; 
#chains in the Genus database with same CATH homology
 1GUI A;  1UY3 A;  4UI9 L;  1KGY A;  3I3B A;  2W91 A;  1OF4 A;  5HPO A;  3T0B A;  3THD A;  2VZS A;  1I5P A;  1J83 A;  3I2K A;  4JKM A;  1O59 A;  2WBK A;  4D8M A;  5LCW L;  4MGQ A;  1K45 A;  3FHQ A;  4XUO A;  2VCC A;  2WO2 A;  4A45 A;  1LNS A;  5J1X A;  3SKJ E;  2EID A;  4CU7 A;  3C7E A;  3PUH A;  2YG0 A;  1K12 A;  2W9X A;  1YQ2 A;  4JHZ A;  2WAA A;  1JZ5 A;  2L9L A;  4ET7 A;  5I0D A;  3VDA A;  4QDQ A;  2YC2 A;  1UYZ A;  4GWI A;  3FN9 A;  2VME A;  2JE8 A;  4JKK A;  1CX1 A;  2EIC A;  3K75 B;  3FHA A;  3ETP A;  1JZ2 A;  3DYM A;  2PQS A;  1JYN A;  1GOF A;  3WF3 A;  1UXZ A;  2VZU A;  3I3E A;  3LQC A;  2HYX A;  2C9K A;  5CZK A;  4ZXE A;  4DXT A;  3IAQ A;  2RV9 A;  4QX0 A;  2V5D A;  3LPF A;  4P08 A;  2QQM A;  4TXW A;  2J1R A;  4OMD A;  4E8D A;  2BBA A;  1JZ4 A;  3THC A;  4BXS V;  4DEQ A;  2BER A;  1UZ0 A;  2VJX A;  3I2G A;  3MUZ 1;  5LA2 A;  5C70 A;  3HNB M;  2J7M A;  4XUQ A;  5CYY A;  1H6Y A;  2YC4 A;  5EJ1 B;  1JYW A;  2W1Q A;  3T08 A;  1CZS A;  2W1W A;  1JZ3 A;  3C7G A;  4HG6 B;  1TVG A;  3ABZ A;  4AAX A;  3T0A A;  2R7E B;  4ZY9 A;  2W95 A;  1JHJ A;  3CDZ B;  4AG4 A;  1W0N A;  2JKX A;  3GDB A;  3OB8 A;  5JR2 A;  1P8J A;  2DCJ A;  2WDB A;  1ULP A;  1IQD C;  4BDV B;  2JD9 A;  1D7P M;  1UY0 A;  5JXG A;  2W1S A;  1DYO A;  2WAB A;  4JX0 A;  3JXS A;  3NJV A;  2VQU A;  1JYX A;  4GZ9 A;  2V4V A;  2WZE A;  4OMC A;  4A3Z A;  3WNL A;  3GXU A;  2VZR A;  2W47 A;  1OH4 A;  3PUI A;  5G05 L;  5B4X A;  1NKG A;  2ZEY A;  3E1F 1;  1CIY A;  4LHS A;  4QB1 A;  4XVH A;  4TTG A;  1DP0 A;  4DUX A;  3K46 A;  1NUK A;  5LA0 A;  1PX4 A;  1WKY A;  4MGS A;  1O8P A;  4QB6 A;  3EYP A;  3VD7 A;  4GWJ A;  4UAP A;  1UWW A;  1DLC A;  3C7F A;  2ID4 A;  3ZM8 A;  2ZEZ A;  1UMI A;  3HNY M;  2JDA A;  4YPJ A;  3EB7 A;  2WO1 A;  2QQO A;  2W1U A;  3HJR A;  1GMM A;  3A22 A;  4A44 A;  4PT6 A;  5JXI A;  4BK4 A;  2HLE A;  2VZQ A;  4RN5 A;  2VC9 A;  2RJ2 A;  1PX3 A;  4P02 B;  3MUY 1;  3T0D A;  4QX2 A;  3LPG A;  2X09 A;  2VMC A;  1K42 A;  2VOT A;  3T2P A;  2C26 A;  2BGO A;  1F4H A;  4UOJ A;  2YFU A;  5JXJ A;  5JUV A;  2W92 A;  2VZV A;  1XNA A;  3VD5 A;  3CZU A;  3K77 A;  3DEC A;  4L0P A;  4DXR A;  5EIY B;  2DCK A;  3I2J A;  3WNO A;  3W5N A;  3A21 A;  1XPW A;  1W99 A;  1GU3 A;  1GQP A;  2KD7 A;  1XNT A;  2ORX A;  3ACH A;  1WCQ A;  3K4A A;  1XC6 A;  1JZ8 A;  3T2Q A;  1UY1 A;  2VR4 A;  3U37 A;  2RVA A;  2XQX A;  3VD9 A;  1UX7 A;  1W9W A;  3MO4 A;  3WF0 A;  3NJX A;  1TG7 A;  5DN2 A;  3A23 A;  5JMO A;  2WN2 A;  2W5F A;  3SEP A;  1BHG A;  2WUH A;  2B4K A;  4A4A A;  4QDR A;  3ACG A;  3CZJ A;  2ZEW A;  3C7O A;  3HPN A;  1UXX X;  5EJZ B;  4DEV A;  3WNK A;  5C7G A;  2VMF A;  2VZT A;  1UYY A;  1W9T A;  3AC0 A;  4Z2A A;  1JU4 A;  3P1I A;  1W8O A;  3HEI A;  3J7H A;  2LW8 A;  5IFP A;  1T2X A;  3I2F A;  2Y6G A;  4CUA A;  3CKH A;  3WQB A;  5DPN A;  1EUT A;  4LQR A;  2W3J A;  3III A;  2Y8K A;  4M4R A;  4KWU A;  2VCB A;  4FI9 A;  2VMD A;  2YFZ A;  1NX9 A;  4E8C A;  4KI5 M;  2E32 A;  2QQK A;  4CU6 A;  3I2I A;  3CMG A;  3DYP A;  4LKS A;  2X10 A;  1US2 A;  2Y6K A;  3IDA A;  3OBA A;  2J1U A;  4XUP A;  4P5Y A;  3I97 A;  3T2O A;  3LE0 A;  3VDB A;  5F7U A;  3C7H A;  4D0Q A;  4CU9 A;  2WAO A;  2QQL A;  3BGA A;  4CUC A;  2CDO A;  1ULO A;  2YB7 A;  1JU3 A;  2XOM A;  3WSO A;  5C71 A;  2QQI A;  4CUB A;  1JI6 A;  3GGL A;  4ZZ8 A;  5LA1 A;  2BGP A;  4P00 B;  2J22 A;  3SEE A;  3LEI A;  2WQ8 A;  1J84 A;  3LEG A;  3K4Z A;  3WF2 A;  4IUG A;  2WO3 A;  4ARY A;  4W8J A;  4A41 A;  3NNG A;  3WF1 A;  2QBX A;  3NQH A;  3HN3 A;  5G04 L;  2J1T A;  1SHW B;  4CVU A;  4RYD A;  3IB3 A;  2W87 A;  4MO3 M;  3WNN A;  4M4P A;  3UET A;  1CZV A;  2BZD A;  2VQT A;  3LEK A;  2J1S A;  3WNP A;  1JZ6 A;  1F4A A;  1OT5 A;  5IYY A;  3C8X A;  3VD3 A;  3F2Z A;  4LPL A;  4ZZ5 A;  2ZEX A;  3ECQ A;  3I3D A;  4OYU A;  1L7R A;  1OD3 A;  2XHN A;  3VDC A;  3ACI A;  2Y6H A;  3IAP A;  5IHR A;  4QAW A;  4QX1 A;  4PQQ A;  3OG2 A;  4QDS A;  3WNM A;  1US3 A;  2VCA A;  1GOH A;  1MPX A;  3SKV A;  3A7Q A;  3P6B A;  4XUR A;  3VD4 A;  2J1E A;  4W4Z A;  3HOB A;  4A6O A;  4KMQ A;  5DMY A;  2CDP A;  2J1A A;  3MBW A;  3BN6 A;  2Y64 A;  4OUE A;  4CU8 A;  3T09 A;  1UY2 A;  1SG3 A;  3HNM A;  3K4D A;  3MV1 1;  5B4N A;  2X05 A;  1NAE A;  2LS6 A;  2VL4 A;  1JZ7 A;  4MAD A;  1O8S A;  2DDU A;  3D3A A;  5IJR A;  3NRU A;  3OGR A;  3WF4 A;  2EIB A;  4QPW A;  1PMJ X;  1GNY A;  4MOA A;  1HN1 A;  2WN3 A;  4XZU G;  2J1V A;  2Y6L A;  1UYX A;  3DYO A;  3MV0 1;  4QB2 A;  2ORZ A;  1CZT A;  3UES A;  1OF3 A;  1GOG A;  2EIE A;  3CQO A;  4A42 A;  2B9V A;  4OZO A;  3W5M A;  3CIH A;  1KEX A;  4BK5 A;  2E33 A;  3GM8 A;  4JKL A;  2VM9 A;  2XON A;  2VZ3 A;  4QX3 A;  4DUV A;  5IFT A;  2Y6J A;  2VZ1 A;  1R64 A;  3I2H A;  5HXM A;  2WZ8 A;  2QQJ A;  2ZXQ A;  1L7Q A;  2QQN A;  3OGS A;  3FL7 A;  4DXS A;  2VO5 A;  1EUU A;  3OGV A;  3OEB A;  2OKX A;  4BJ0 A;  4DUW A;  2E26 A;  2C4X A;  1PMH X;  1W9S A;  3UNP A;  1SDD B;  5DQ0 A;  2E31 A;  1JYV A;  4PF1 A;  4XUN A;  2V72 A;  2WYS A;  1UMH A;  2W94 A;  2VTF A;  1RYY A;  2W46 A;  3OEA A;  4XUT A;  3WEZ A;  5FUI A;  1H6X A;  2Z4F A;  3ACF A;  5JXH A;  1W8N A;  2VZP A;  4W50 A;  1K3I A;  1UY4 A;  4ARX A;  5A1A A;  2VZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...