4I0BA

Structure of the mutant catabolite gene activator protein h160l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0bA01
4WX9A 4XFAA 4EV0A 2IRFG 3Q5FA 3HRTA 4HBLA 2RNJA 3NRVA 2VQAA 3F6OA 5IT3A 4GXOA 3ZQ7A 1ZN2A 4U0WA 4JTOA 4A12A 1FBSA 3V7CA 4MQ9F 4LLGF 4L9VA 1W7PA 1B6AA 3FJSA 1BBYA 3E5QA 2A6HF 2D2WA 3SQNA 3FZVA 1R23A 4L0ZB 4P96A 5L3EA 2GA1A 2K27A 3KLOA 1IRGA 2DO7A 2GXGA 2RC4A 1U2WA 2XHKA 4MHGA 3GBFA 4X6QB 5CYVA 2Z5UA 3S0MA 3LAPA 4EQQA 2P7CB 2O6GE 3I59A 1LQ1A 5HLHA 1VJ2A 4LJZF 4HVRA 4NQWA 5J48A 3G3ZA 4LK0F 2GH2A 2IXKA 4BAYA 3H9AA 1GVJA 4E2QA 1HW1A 1WA4A 2EJRA 1J3PA 4YFNF 1FT9A 1IPJA 3BALA 3SZTA 3U0ZA 1RGSA 4IPAA 4HVQA 4G7OF 1YQAA 3CO2A 4HW0A 5BPIA 4KMFA 3MFKA 3CTAA 4LLOA 2J5OA 4JV4A 2ZFWA 2HS5A 5E20A 3RKYA 1WQ2A 1YLFA 3CF6E 3MZHA 2MH2A 1ZYRF 4KA4A 2MBFA 5L3GA 3BZ6A 5I0SA 1U5TC 5CVUA 4MQVA 3RDIA 3RYPA 3JAMK 4IEOA 2IA2A 3I5UA 3TQNA 4Q29A 1TNTA 3HHGA 5EZWA 4UUVA 4ZU5A 1BJAA 5D8LB 3BWGA 4KN4X 1YFWA 3KGZA 3LWFA 5I0RA 2IXJA 1W4MA 4XFBA 3NJZA 3I64A 3ST7A 5KBFA 5I8SA 2V1DA 5JSPA 2OA2A 1TW3A 1MKMA 1F9NA 1LDJA 5C8WA 4E2GA 3AAFA 2JSCA 4Q48A 5LEJA 2LKPA 1XSVA 2AXLA 1UCRA 1P2FA 5I0TA 1LKNA 4KDPA 4IXAA 1SFXA 5HOOA 1TQIA 5TRDA 2CV6A 2TDXA 1V4RA 1SAXA 2WWYA 1MDMB 2ISZA 4CDGA 2W57A 4MTEA 4RB1A 4G6DA 1Z05A 4ZU4A 3TOBA 3LAJA 3CUQC 3EHKA 2UYBA 3SMHA 3HTUA 3GWZA 1J2XA 3PQKA 2D93A 1I1SA 3J80K 3COAC 3JSPA 2FOKA 4J1XA 4RGUA 4EMSA 4F7ZA 2XAHA 3RZZA 2L4AA 2H94A 2P6SA 1UIKA 4M74A 1ON2A 1XCBA 4M9SA 5JFRA 3OF1A 3ELKA 2ET7A 2ZMEB 4UV8A 4A2UA 4A5NA 4KWJA 3FXUA 3LQRA 2BNOA 3ISPA 4L0YB 1I27A 2HZTA 3OCPA 4KMUX 1E17A 3IWFA 1HSJA 4LTAA 5I91A 3GEZA 3FHZA 3ECOA 1G4DA 1FSEA 1K6OA 5ILVA 5C6CA 1B1BA 2BV6A 2HFHA 4D7TA 2NNNA 2HYGD 2QQ9A 3F8MA 4CICA 1RZ4A 4O5VA 1QGPA 2LDUA 3EYYA 4XF4A 2UZKA 4ENKA 1RIOH 1IPKA 5IT9Z 3MAJA 2PQ8A 3H7JA 2M30A 2BGCA 2WV0A 2XKOA 3HIFA 2X0LA 4QXKA 4GULA 1XMAA 3HSEA 4BH9A 3RJPA 1IAWA 4KYWA 1XN7A 4J1WA 2H09A 4AVAA 3PLQA 1QXJA 3VHRA 3P9CA 4ON0A 1XCVA 2CG4A 5KVRA 4UNOA 2G9WA 1XRUA 1SFEA 1KU3A 4QX5A 3M7GA 3PVBB 2ZJ2A 4HN0A 3WODF 4G9YA 3H1WA 3NL1A 4I09A 4S04A 2EK5A 1FI2A 1K78A 3KSCA 3ZP5A 4IEWA 1XSXA 3GUDA 4P9FA 4CO8A 1ZZ6A 1USTA 4OMYA 1L3JA 1CAWB 1IXSB 4HQEA 3E3VA 2XIGA 1W5SA 1S3JA 2COMA 3D82A 3I53A 5D1IA 2ZNYA 1DDNA 5KHGA 2F4PA 1K7AA 3V7RA 3J7AO 4ZYDA 3GFMA 1STZA 3WW1A 1UPIA 2IP2A 2QZ8A 4HSLA 1FBQA 1Z9CA 3I54A 4A0XA 3DPTA 3QAHA 5DV5A 2DU9A 2PQQA 2PYTA 2MD5A 3C3WA 3GVAA 3FZ3A 3VFZA 1ZG1A 4XF9A 1DP7P 1L0OC 1A04A 2VODA 1QPMA 1CAVA 3F23A 2Z33A 3GZ5A 4PIYA 2BEOA 1JGSA 3DV8A 3RI4A 1IZ1A 4AVCA 1BI1A 4XRFA 2IXCA 1S7OA 4ESJA 3GFJA 4LULA 3NKTA 2BNNA 4M72A 1YFHA 2KKOA 3T8RA 4LGWA 3D0SA 3OTFA 2GC0A 2VE8A 1CAUB 2KRFA 4JTNA 4RGRA 2PHDA 4XETA 2E7XA 1KA8A 2JPCA 1LB2A 5JCTA 3HRMA 4AXOA 1P4XA 4OFGA 2QQBA 4FT8A 5CVRA 2WFPA 2EV6A 1ZRRA 2DT5A 3ZMDA 4YFKF 3N4MA 5DUKA 5ED4A 2Q2EA 4Y15A 2FBHA 1UW8A 2BYVE 1T2KA 4BHBA 4EGZA 4HF0A 3ZMTA 1KU2A 4M6XA 4E2SA 4AQ6A 3FHIB 2GC1A 3F21A 1FP2A 2W25A 4EM0B 5JSRA 1USSA 2FA5A 4QLCU 1OFNA 5FLJA 1BOAA 1ZZ7A 2HR3A 5L3FA 4ZU7A 1FWZA 1ZG3A 2DQRA 2DTRA 3JAMZ 5ILSA 4BQAA 1KQ8A 1D5VA 3FFQA 5J8FA 2HKOA 4OIQF 1D3YA 3DL3A 2P5LC 4K2EA 2E9QA 1GQGA 4ZZDA 4LMYA 1V3FA 4KNYA 3DPLC 1H9GA 4GO1A 1DGWA 4JK1X 4ETSA 1QQIA 2W84A 4Q0VA 2NAZA 2V09A 1LDKB 3WGIA 3U10A 2JT1A 4Y17A 5LBQA 3TO9A 3JZVA 2BBYA 2PFBA 3B73A 3PFIA 1IW7F 2M8EA 1IN6A 5FPZA 2UY9A 4HYEA 3O6BB 3EDPA 2ACJA 3HSRA 2CYYA 1XGOA 2RDPA 2DLLA 2O0YA 3HTSB 4WXDA 4K8FA 5FDBA 3N97A 1R5HA 1Q5OA 4WXCA 2EFNA 4KWLA 1CX4A 5JVTA 2Z69A 3WTYC 2M1BA 5LHGA 3DP7A 3BJ6A 4HSJA 2DK5A 3IWZA 3EYIA 4QMAA 2K02A 4LA2A 1ONVA 4LA3A 2QVOA 4Q47A 1T0FA 4WZCA 1XB4A 2ZMEA 3C7JA 5BV6A 2B5HA 3QOPA 2Y48A 5K5QA 2I45A 4U0YA 2UXXA 1GQHA 4L5JA 1YW7A 1S6LA 4YG2F 3QPHA 3R60A 1B4AA 5F6FA 4KWKA 2CW0F 5BPXA 3IIAA 4BHCA 3RNSA 1CAXB 1NXMA 4Q4ZF 4OLLA 3ACLA 1U78A 3GFIA 2QYOA 1WLTA 4FAGA 2C6YA 3TO6A 1HQCA 4PGGA 2HJIA 3DEUA 3HRSA 2ESHA 1SMTA 1J3RA 2Y0OA 4HOBA 5CVIA 4AD9A 3V8JA 2XUBA 4AIKA 3KP5A 1ZREA 1X82A 2IJLA 1F1ZA 2MHFA 1R58A 3LOIA 4UVBA 4EM2A 5I8YA 1CAVB 4AWXB 3FM5A 2FNAA 3L09A 3UKNA 2GU9A 3GF2A 3MYXA 1FC3A 1GHCA 5BS6A 4LLNA 3WTSC 3D0JA 2O61A 3ES1A 4I3PA 3TDZC 3KLNA 3I7DA 2HQRA 2OQRA 1GXQA 4JBAA 3O2PE 2G7HA 1PUEE 4Q0PA 1FSHA 2P4WA 2Q0AA 4IEZA 4XLPF 2GAUA 3VODA 1PDNC 5E8IA 4A6EA 1ZNPA 3GYHX 1H1MA 2QENA 1FYMA 3R0JA 1XE7A 4G7HF 4MGZE 5HLGA 4H0EA 2VBZA 1DZTA 1YW9A 2LNBA 3HHHA 4MEXF 3IDCB 4FX0A 5FGMA 4KT5C 2VBWA 2HYFA 4MTDA 4KIBA 3BCWA 4UXNA 2XVCA 3G7DA 1MJ9A 5L3DA 2LF8A 1Z6TA 2F2EA 3SCFA 4QGLA 2HTJA 3WTWC 1HKTA 5H20A 1J5YA 1P4WA 5LHHA 2DK8A 4HDUA 2EAAA 1TBXA 3F6VA 1FX7A 2PN6A 1LVAA 3ZN1A 1S8NA 2L4MA 2VT2A 4RB3C 3KZYA 3BPZA 4FX4A 1P92A 5CVJA 3HOTA 1ZRFA 4HAMA 3FMQA 1RC6A 4IJAA 4BHPA 1CAUA 2PG4A 1FYKA 1G3TA 4BXUA 4MGYE 3ZN0A 2PAEA 3J81Z 3FXRA 3GW2A 3CJNA 4A0ZA 1SFUA 1DPRA 1UHMA 2Y0MA 3ERED 1Z91A 1F4KA 5BXXA 3BB6A 2JZYA 2M45A 5ERIA 1EH6A 3P7NA 5BQTA 4Q0SA 4FAHA 2BE5F 3WW3A 1SEFA 5EEHA 2E1NA 3ULQB 5LRSA 2VOPA 2YX4A 1ZHFA 2OBPA 2YR2A 2YU3A 1EH8A 2ZNZA 2NS0A 1J58A 5LHIA 1O3RA 1L3LA 1OPCA 4XF1A 5K5OA 1FLIA 2QNKA 3H92A 3I71A 3GFLA 4B09A 2IXLA 1RUOA 4HF1A 3WU1B 1HBXG 4GCVA 4IERA 1ZAOA 4EVIA 4EGYA 4IHTA 1IF1A 4XFIA 5BMZA 2PBIA 2YX7A 2CAVA 4ZZLA 2E7WA 3TKYA 3V4GA 3KCCA 2VC0A 4D7SA 1PP8F 1K79A 1B9MA 3GYDA 2EFWA 2MH9A 4KN7X 5D5WB 2XL7A 3WU0A 4L9JA 3KMHA 2E1CA 4IHSA 2QVSB 2D45A 2MLKA 2H27A 1KGSA 3ZDSA 3BJOA 4I98B 2P8TA 3KP3A 1HW2A 4ZYGA 2IT0A 1F5TA 4PIXA 3DFGA 2YSRA 4GYGA 2A68F 5J8CA 5LRRA 4D0PA 2QWWA 1AOYA 2VBYA 1ZGAA 1XDSA 1HKSA 3ZMSA 1KQ0A 1RTVA 4MH0E 2Z9OA 2R7DA 2EFPA 1SD7A 1HKQA 3I4PA 1R00A 4HZFA 2FMYA 1H9TA 2XLAA 1U6GA 3H50A 1W7PD 3KP2A 1Z1DA 3H1MA 4MUVA 2OA4A 4L2NA 1BI2A 1U12A 1XGSA 5EEGA 1FZPB 4PJYA 5ICFA 1XGMA 3WGHA 1Z6RA 4NHJA 5EFUA 2OYZA 2CQKA 4GGGA 3RTRA 2JPBA 1P6RA 2NYXA 3NVCA 4R1HA 5E8GA 3OD0A 2V1UA 4R79A 1V70A 4RS8A 4Q0UA 2CSOA 3IRQA 3TO7A 2XROA 2EA2A 4PZJA 3MEXA 2PFWA 2A3SA 2STWA 3EQEA 3JTGA 2JRTA 4UVAA 4RD7A 1P4AA 4QGMA 4KU7A 4G8XA 2O8QA 4A0YA 1YHFA 4XSXF 4LG0B 2PAMA 4EJUA 3LA2A 2PTMA 4ENJA 3D5LA 4PIZA 5HI0A 2D40A 1YUDA 2K4JA 5LGTA 3U1DA 1GXPA 3WGGA 2K9ZA 1LR5A 1DZRA 1WWXA 2PMUA 4AVBA 1Q3EA 2H6CA 4XF3A 3UKTA 2VC1A 3K69A 4DNCA 4QGNA 5DD8A 3K1NA 3DKWA 1UD1A 5I93A 4WXHA 1RNLA 3FXQA 4HX4A 1LEBA 2F5DA 3NEUA 3WTTC 5KHHA 3E6MA 4IRIA 4JQFA 3CL1A 1E2XA 4Q0QA 3E5XA 1ULYA 4I2OA 2XGXA 2A6EF 3GXOA 2L02A 1CAXA 4EJOA 2L54A 5HDGA 3MZYA 5DUIA 3K0LA 1ZVFA 4G6QA 2KXLA 3ETQA 3EBRA 1EY2A 3U11A 2OAZA 3ELNA 2UYAA 2IXHA 2VBXA 4GYIA 1CF7A 1VR3A 4JVAA 3FMRA 3CUOA 4IEXA 2EFOA 4LD5A 5J7MA 1YFUA 4META 2H6BA 5BOXA 1QNTA 4HV6A 2ZBKA 2HWVA 5E1WA 2QCSB 5E1RA 2UWMA 1HXDA 2Z3YA 5KHKA 2QLZA 5A2QK 4LFUA 4ENNA 1VP6A 3IRRA 3PNAA 3KFWX 3M9AA 1RL3A 2G7UA 4KL1A 2V6CA 2B0LA 2EB7A 4ZYHA 3RPUA 2F5FA 1BC8C 1FNNA 4BIFA 1CGPA 1T38A 1J0RA 3JSOA 2ZXJA 3VEPA 1J75A 2PJPA 2P17A 3VB2A 3K2ZA 2DFIA 1WRJA 4U7BA 1YTYA 4F8AA 1R36A 5FO5A 2W24A 3CLOA 4IETA 1OKRA 4EWEA 1EH7A 2L3DA 4LEJA 4R8HA 2IPQX 2FE3A 1J59A 1R1TA 3BOQA 1IN5A 4NB5A 1G3YA 1YWKA 2PI0A 1ZX5A 1XSDA 1TQPA 3KZZA 3WW2A 1ZZBA 2MPFA 2P5VA 2A5YB 1R1VA 5D6FA 3EQLF 4G7ZF 4XSZF 3SCGA 2ESNA 2ZKZA 3E6BA 2IXIA 3P9IA 1J7KA 3M3IA 3C3VA 5I0UA 2XLGA 3QP6A 1W7PB 1D8KA 2IA0A 2K86A 1RI7A 2O03A 2VN2A 2MA3A 4UV9A 4PDKA 2STTA 1X7NA 1YO5C 3KP6A 3RKWA 3NSTA 4ASNA 5FB2A 5FLHA 3FMSA 1X8MA 3WTZA 1S29A 4I7HA 2D5HA 2Z2SB 2A61A 3PQJA 2CGPA 5D4SA 1JHHA 4E70A 4HVOA 3F22A 4XFFA 4YFXF 3BP8A 3U9GA 2OZJA 1BIBA 1MJAA 3F8FA 4P9GA 4O6JA 3L00A 3IC7A 1DUXC 5FD5A 1Y3TA 3TDUC 4ESBA 1XD7A 4HLXA 2AS5F 1Z7UA 3E5UA 5FFZA 2GA2A 2ELHA 3OOPA 3HRUA 5LEKA 3H7YA 2FU4A 2JTVA 5LGUA 5FPXA 5LLQA 3LSTA 2Q8KA 2CFXA 4EM1A 3RYKA 1QXRA 2OPKA 5E17F 4L9NA 4UBHA 1LRHA 2D5FA 4IVNA 2HDCA 3DN7A 3L2HA 4KICA 1Q43A 4OINF 4M9ZA 5ICCA 2RVCA 2EV5A 2OD5A 5CU1A 3CDHA 1R7JA 3V8LA 3ABUA 1K78B 1AWCA 5DDGA 2Q1ZB 3CUQA 5HDKA 2ETHA 1NYWA 3SXWA 1PMIA 3KGLA 3K1PA 4ENMA 4Y13A 1BC7C 2A69F 2MNGA 1QZZA 1YG2A 1T39A 4U7DA 4OIPF 5DCMB 4RB2C 5J6XA 2QBYB 2UY8A 4TLFA 1ZZCA 4O9GA 1NE6A 5D5VB 5D5XB 3ZMUA 1TTYA 4CYDA 4XBFA 1IRFA 2ATFA 1G3SA 1LDDA 2CAUA 1FBUA 1D8JA 3F8CA 1BN5A 2FBKA 1LNWA 5H6RA 1I5ZA 4KU8A 1S7AA 2WTEA 4CHUA 2XAGA 5AVPA 1MJBA 1YIOA 3FWEA 1TW2A 2XAFA 2VPVA 3CLPA 4IF4A 5CADA 1NE4A 1BI3A 4M6YA 1ZLJA 2KIFA 1U5TA 3KP7A 3ECHA 4XF0A 4RAZA 2M5WA 4Z82A 4I0AA 3QPTA 1KU9A 4RB0A 3IL2A 2QM3A 4HA8A 2O8XA 4M71A 5FLXK 2IA1A 4BYYA 4AQ2A 4HN1A 3T1BA 5E1ZB 5KHIA 2CWEA 2Q4SA 4QM9A 2VOOA 1TLHB 1ODDA 2DQLA 4ONUA 3USSA 4P55A 3IKVA 2XRNA 3QP5A 2VE9A 5JSOA 2KJBA 4M9XA 1YS6A 3R4KA 3ES4A 1SD6A 2PLYA 2ZKLA 3L7WA 3MQ0A 3L9FA 4CGZA 1JXSA 4HV5A 4QWQA 1CF7B 3T5XA 1OYYA 3LZZA 4OIRF 3SXYA 2DPDA 1C0WA 3W6JB 1H1IA 4UHTA 4XFGA 4N9HA 4YNIA 2K0GA 2MLGA 3OGJA 3DXJF 4KFCA 5LGNA 4YYOA 3E6CC 2YPRA 1I1GA 4HQMA 4XFCA 2XKPA 5DYMA 4P9UA 4QM8A 1IUYA 2EA7A 2IC1A 4ESFA 3FM3A 2GWRA 4MV2A 3BY6A 3KEQA 2Y75A 3WW4A 2HEOA 1UB9A 3KP4A 3S7EA 5JR7B 3O3KA 1REPC 1ZRCA 2HGCA 2DCTA 1RUNA 3MDPA 1LEAA 2XAJA 2PEXA 4LUMA 3R61A 1QZYA 1OYIA 2CO5A 4I02A 3DQVC 4ORFA 3BPVA 5J3UA 4MGIE 2PMHA 3LA3A 5KHJA 5IT9K 5A2QZ 3V8KA 2RKHA 1HSTA 3F8NA 5HDNA 3SFZA 1KQ9A 2XAQA 4WCGA 5FLIA 4MZUA 1FP1D 1FPQA 3LFKA 4CZZA 3K9TA 2DW4A 1IN7A 1HW5A 5I8TA 3RKXA 4Q5SF 2M87A 1QWRA 2A07F 1ZG5A 4FBFA 4EWDA 5D4RA 3WE3A 1BM9A 3F3XA 4B29A 5JI6A 1UHWA 1J9IA 2QUFA 4RGXA 4YIIA 4LB5A 4B8XA 2RQPA 4HX8A 2FRHA 1IXCA 5CJ9A 5L3BA 5HS7A 3IHUA 1I6XA 2ADUA 4HLTA 5H6QA 5L3CA 3H3ZA 2L01A 1XDUA 1MZBA 4OU0A 1DGRA 1Y9QA 1G6NA 2X4HA 1OD5A 4AIHA 4LUKA 4A5MA 1WGPA 1O7LA 1YS7A 3MWMA 2PAKA 1B9NA 5ICGA 4M73A 4LB6B 2Q30A 2D1HA 3WE2A 5CLSA 1MD0A 4P5OA 1FXZA 4WVZA 1O5UA 1EPZA 3QU6A 4UXAA 4CXFA 3OV8A 2EWNA 4IRHA 2HQNA 3K1MA 3HUGA 3UKVA 2RGVA 2FF4A 3MPBA 1BI0A 3F8BA 5JR3A 3HOSA 2LF7A 3TGNA 4FHTA 5T3NA 3GX4X 4WBBA 3TNQA 5D8KB 3R0AA 3GLXA 1PM7A 1T98A 2D1VA 3SHRA 3IBMA 5ILUA 5FQ0A 1ON1A 4Z2YA 4N0BA 4U88A 1YYVA 2PA7A 1ZZ8A 2XLFA 1SMYF 1IXRC 3C18A 5FQ0B 2QQAA 4DQ2A 5E1XA 2P5KA 3F72A 3CJXA 1U8RA 2ZCWA 1QBJA 2R7FA 2BNMA 3E6DA 2WC2A 3JW4A 3GZ6A 5DEQA 2C0ZA 3Q9VA 4U0VA 1JUHA 2NRAC 5E16A 2Q0OA 3I59B 3IDBB 1MDMA 3M1EA 1TNSA 2K4BA 2RN7A 1U5TB 3TNPB 4S05A 3CO7C 5E18F 5CVVA 3BJAA 4L18B 2VT3A 5BPDA 1H0MA 3HYIA 3S2WA 2W85A 3EUHA 2OZ6A 1UCXA 2DI3A 3EJKA 3T8TA 2F5EA 3EETA 2J5PA 2V1XA 4DINB 1KYWA 2XL9A 1EP0A 2OU2A 3M70A 3CO6C 3BU7A 1JE8A 2GC2A 4ZH4F 3C1DA 4WF2A 1ZGJA 1MGTA 4EJVA 4L11A 1XE8A 1O57A 1OR7A 4UBGA 4G94A 3KE2A 4KIGA 5JAXA 1XMKA 3JTHA 5BY5A 3QU3A 3HT1A 4IEQA 3FE5A 5DCFA 4EROA 5TJJA 3WTXC 4HF2A 5HLIA 1BIAA 2QDRA 2VONA 3J80Z 2EVXA 1EV7A 3ABTA 4IRGA 2EV0A 2P7VB 3H3UA 5KK1A 2B9UA 3I0TA 3M8EA 5K5RA 4MNUA 2ZO4A 1T6SA 2EA4A 1DPUA 2FSWA 1ZLKA 4YSFA 1NZCA 2GQQA 3MCZA 3LAGA 1ZRDA 5BUVA 1SQ4A 3T0YA 1R22A 1JHFA 3M8FA 4LLLA 3RPQA 4A6DA 2NNYA 4IEPA 2OZUA 1X3UA 2IVMA 3KETA 4IEYA 4LK1F 2HKXA 4TV7A 1Y0UA 3L2CA 1QO0D 1NHAA 2DAOA 1R1UA 5D5UB 3E97A 1TQ5A 4UVCA 1UFMA 3LWCA 1ZH5A 1EYBA 4IEVA 3TOAA 2PHLA 2QBYA 6PAXA 4R52A 5DCMA 1FYLA 5K8SA 4AIJA 2LSOA 2P6TA 3BPXA 4AVPA 3QACA 2HTSA 1R5GA 4IESA 2RV8A 1VTNC 1FY7A 3ZMZA 3FX3A 1G3WA 5K1YA 2EFQA 1WKMA 1UIJA 4EWAA 1LJ9A 4I01A 1YW8A 4HX7A 5HVQC 4KUMA 3Q9SA 4Z07A 2FQ3A 1SFNA 2XASA 3H1YA 4MGRA 3SZPA 4OOIA 3I58A 1KYZA 5FD6A 2HOEA 3V7SA 1B59A 1IN4A 3BROA 5FCCA 3P9KA 3ML6A 2H0VA 5FLXZ 4RAYA 1YFXA 3LA7A 2VECA 4YARA 2FNPA 5DD4A 2FEZA 1O3TA 1YFYA 4YIFA 4L5IA 4PCQA 4WK8F 2KJCA 1XGNA 1FOKA 1J3QA 2KIMA 2OQGA 2N7GA 2R3SA 3B02A 4XEZA 3R6SA 3U2RA 2MC3A 1O4TA 2XV4S 2K7LA 1WSUA 1Q1HA 1U3EM 1YLLA 1CAWA 3W6KB 3ZPLA 1J1LA 3CEWA 4EJWA 4X6RB 5ICEA 4HMZA 5F64A 3EO6A 4WWCA 4BNCA 3G73A 3DF8A 4O3MA 1O5LA 4IEUA 3HSFA 4HDVA 3WTVC 5AIQA 1QY4A 2B8MA 2VXZA 5D6EA 3SHFA 4H7LA 2UXNA 1OI6A 1TQMA 1X8EA 4L9TA 1O7FA 4EJTA 1OYWA 5FFXA 4YRDA 3NW4A 2F5CA 4OMZA 5AONA 2FMLA 3FF5A 1SD5A 3RYRA 3VOEA 2FQPA 4XLNF 1W5TA 1KU7A 2ET1A 3QRFF 3WTUC 2GC3A 2V79A 1ZARA 3BDDA 3RIRA 2QJVA 2O1QA 4HBNA 2DPUA 4MEYF 3LQQA 2GZWA 5HS9A 3O14A 3HT2A 5HS8A 3ZMVA 4OIOF 4I0BA 4MGKE 3S7IA 4N9IA 3CUQB 1OMIA 4O9EA 3ROUA 3IKTA 2GIVA 1O3QA 4RGSA 3WG9A 2IW5A 1IN8A 3KEOA 4HLYA 4ZYEA 1PP7U 1SD4A 5JHUA 5F1RA 3J81K 3H8UA 4NVPA 3GO5A 4KIFA 4PGHA 2O3FA 2V9VA 1O3SA 5AIPA 4XFHA 3REOA 3SCHA 4LG0A 2Z99A 1WI9A 1ZZ9A 2GXBA 2KIUA 2FBIA 2ISYA 2FXAA 2DBBA 4MX3A 3NQOA 3HQXA 2ETEA
chains in the Genus database with same CATH superfamily
1BR2A 4XOPA 3L2UA 2IRFG 4XLCA 2JDAA 4FFGA 2RNJA 3FLPA 3NRVA 1PGL1 1JZ3A 1S2EA 4QQ2A 1ZN2A 4P9JA 1CIYA 5CFDC 4LLGF 4IOAF 2ZAAA 2ZZJA 4FPKA 2DYRH 3SQNA 4JQTA 5ABJA 4CCOA 4A3FJ 2JSPA 3BZCA 1ND2A 5ANNA 3DBLB 3VN4A 3PU8A 1HB4A 2RC4A 2VQHA 3GBFA 4X6QB 1JHJA 4RFRB 1IOAA 5L19A 2HBUA 4CCLA 1BOBA 2P7CB 3GLLA 4CP9B 1LQ1A 5LBCA 2FCVA 2RMU2 1OLMA 5J48A 1WLWA 5C44J 4AFDA 2YS9A 3S16J 3H9AA 1O4ZA 1W6MB 2QQ8A 2CTVA 1F2NA 3DCQA 2KL4A 2XSDC 4QPIA 1FT9A 1QMJA 1AYM3 1WLCA 1OQYA 4CUCA 3VBFA 3U0ZA 1RUI2 1LKXA 1O8PA 4LXLA 4M00A 1X1PA 3CTAA 1DQ2A 2OQ7A 3RKYA 5E6HA 5KXBA 1XBFA 2HNHA 3WV6A 2QFEA 4M3EA 1ULCA 5GKAC 4KA4A 2IVIB 2EINH 1W04A 5L3GA 4Y1ZA 3A7QA 1MMNA 1WJBA 1J1TA 5DUVA 5BNPB 4MQVA 3JAMK 2NMOA 3I5UA 4N43A 4COWA 3CCYA 5FK7A 5DAXA 2BERA 1SLAA 3T09A 1YFWA 3KGZA 5IK8A 2LRPA 2RHPA 2VE1A 3SQOA 3I64A 3ST7A 2W47A 1N1SA 5FZ3A 1V54H 2OA2A 1LDJA 1PMHX 3AAFA 4Q48A 4A4AA 1XSVA 3AZZA 3VKNA 4XXAA 2XVLA 1MMGA 5I0TA 1LKNA 5FOJB 2DU0A 2XJVA 5HOOA 2HU9A 3GTJJ 2JDYA 2TDXA 1V4RA 1SAXA 1MDMB 5ABJB 4AE2A 4DXSA 5C3QA 2E2HJ 4RB1A 4SBVA 4Q1RA 2P34A 5JPNB 3FK6A 3FBNB 2W1OA 3J80K 3COAC 2BUKA 1L7QA 2H94A 4UAPA 1DLCA 5J40A 5AVAA 3ELKA 3QLQA 2Y60A 2ZMEB 4UV8A 2BP6A 4A5NA 1V6LA 1YQ8A 2Z5WA 4A3LJ 2WABA 3BR3A 2JXAA 3FXUA 4RHV3 1D0GA 3ZN6A 5BNQA 4K6BA 2HZTA 3I4IA 2K40A 2DBNA 4KMUX 3ENRA 1E17A 3APBA 3VDDC 4LTAA 4AEKA 2BXYA 3GCWA 1FSEA 2CV1A 5FUNA 5ILVA 1KD7A 3D6EA 3MIGA 3LFIA 2QQ9A 3F8MA 1RZ4A 4B4CA 1UY1A 2GP3A 4XACA 4FSJA 4CEYA 1IPKA 1T6GC 5JXHA 2PQ8A 1TL8A 3JU9A 4N4OB 2WV0A 2PJRB 2BVLA 4QD2A 3DWLE 3OSGA 1XNAA 1XMAA 5DABA 2DVAA 4KYWA 1SBFA 5FPBA 3VDDA 5LK5A 2H09A 4N43C 3VHRA 4AAPA 1UMZA 2CG4A 2VULA 3UETA 5BNNA 3CJQB 3DBRB 4AOCA 1FPN1 5D2AA 4QX5A 5GP9A 1F31A 3WODF 4G9YA 1VI0A 4I09A 5SV8A 5KWRA 1FI2A 3I3QA 4BXSV 3H8RA 2VMEA 4V1PA 2OTLI 1ZZ6A 2RJ2A 3MW3A 1L3JA 1CAWB 4HQEA 4OHXA 5C4JJ 1S3JA 3D82A 3VHPA 2VR4A 1DDNA 2HWE1 2W2IA 3K6GA 3K4AA 1ENRA 2DF7A 3KWVA 3WW1A 4BWOA 2ZGTA 1ETXA 5LD2C 2HYXA 1FBQA 2NZ9A 2AR6A 5GZFA 5C4WA 4XZUG 3LSKA 2PYTA 3ZYFA 3CJIB 3FZ3A 3NV2A 5J3LA 4XF9A 1DP7P 4BBSJ 4FP2A 1MQTA 4KJZA 5FYHA 4PIYA 3DV8A 1IZ1A 4AVCA 2IXCA 5CQEA 4ESJA 2HWD2 4LULA 2DYCA 3ZFGC 3ZR5A 2BW3B 4LGWA 1PIV1 3OTFA 2VE8A 1LHUA 1CAUB 2KRFA 4BXXJ 1RVF2 2EPFA 1QJY1 5FYVA 3OYNA 4CDWA 3NJVA 5C8CA 4AXOA 1JKOC 1ZRRA 2DT5A 3ZMDA 2UU8A 3N4MA 5LBFA 4CVUA 2R7VA 4CEWB 4ES8A 1B8IB 4ABZA 4DRVA 1IQDC 4AQ6A 3FHIB 4I6ZA 5IVBA 3PIGA 3F21A 1F5FA 1FP2A 4QWNA 1LECA 4XUQA 4G4FA 4BA6A 4WM8B 4QLCU 5FLJA 2ECCA 1BOAA 2YU1A 2V1NA 3IAM2 1ZZ7A 4DUVA 3CDZB 3NWSA 4NNJA 1FWZA 1ZG3A 4ZU7A 2CS3A 2VM9A 2DTRA 2Q1MA 1YI9A 5J8FA 4OIQF 4AGRA 1F15A 3DL3A 4K2EA 3GHNA 2E9QA 4X0GA 4LMYA 4KNYA 4E6KG 4KH9A 4OZOA 4QPIC 1UY3A 1H9GA 3BLYA 4JK1X 2XMLA 2VZUA 3S5AA 4P14A 4BQYA 4Y4YA 5DAVA 3U10A 3RZDJ 5LBQA 2F4IA 1JOBA 4GQ7A 2IS2A 2A71A 3HSRA 1Q1VA 1HB1A 2DDUA 1XGOA 5KCMA 5IYBJ 2DLLA 3HTSB 4WXDA 3GTGJ 4K8FA 1REFA 1Y6IA 1Q5OA 3I3EA 1CX4A 2R5YA 3UT0A 5JVTA 2QE3A 3Q0UA 3OS2A 2M1BA 3ZCOA 1X19A 2OQ6A 2CDOA 3DP7A 2HWD3 3IWZA 4LQRA 3BG9A 1ZR4A 3DGTA 2ZX0A 2K02A 5KXDA 3JR9A 1QJFA 1IV6A 2LKXA 1SDWA 2HXIA 3HC7A 2LBFA 5K5QA 5FY4A 2UXXA 1GQHA 1DQ1A 1B09A 2BOJA 3MVPA 1N1VA 4Q4ZF 4OLLA 3ACLA 5E79C 3OYWA 4LE4A 1WLTA 4XQ4A 2ESHA 1WI3A 1J3RA 3RG0A 3GHMA 4AIKA 1ZREA 1SVLA 1X82A 4BACA 4CDXA 1R58A 3LOIA 4BS9A 2XJRA 3I2JA 1CAVB 5KHDA 2FNAA 4K20A 3W59A 5F3IA 3KS7A 3I2OA 4BU2A 5HXVA 3TDZC 3CCVI 1LOBA 3KLNA 3WSOA 3K48A 4XJAA 2RS51 4UFHA 2YY1A 1AR91 1MS3A 2ZHMA 1AYN1 3PIJA 3HKZA 4IEZA 4M6VA 4UW3A 5EWSA 4YZ1A 4PJ0C 4A6EA 2DCKA 4MO3M 2WA3A 1FYMA 1OCOH 4MGZE 2VBZA 2OUJA 2DA5A 1YW9A 1SLCA 3HHHA 3EYPA 5A7NA 1JH5A 4YWAA 1POV3 2VASA 2HYFA 4MTDA 1R1A1 4W4ZA 1OUXA 5J09A 2E7AA 3G7DA 5L3DA 3JXSA 2LF8A 4B3NA 1Z6TA 1BW5A 4IE0A 3ON7A 3IDEA 1AF9A 5H20A 1IS4A 4YG3A 2DK8A 4A69C 4Y1UA 5DDJ1 4BDZA 4QHOA 1FX7A 3KT4A 2EIKH 2PN6A 1S8NA 5J1UA 3JBG2 3VV1A 2EF6A 4P9XA 2VTFA 5CVJA 1LGNA 4LHSA 4HAMA 4AG4A 2YB7A 1RITA 4IJAA 5FRAA 2XHNA 1RUH3 4XKCA 2YGLA 2FMDA 4RFT0 4L0PA 2ELJA 3ZN0A 1HQWA 4HPKA 3GW2A 2GMPA 3CJNA 5CAZA 1RUJ3 3TEDA 4D1QA 3GNEA 2VW0A 4B4RA 1HB2A 1S55A 5BXXA 2FX0A 1U5XA 1GFF2 5FP4A 1WBFA 3MUY1 2JZYA 5ERIA 2R7TA 2WRAA 3MIEA 1BBT2 2BE5F 3IDAA 1SEFA 5EEHA 3VBOB 4LT5A 5HV4A 2VOPA 2L9VA 2YX4A 4H14A 1OKQA 1R4MB 4Y33A 5LHIA 1O3RA 2E2JJ 4QX7A 4JDNA 4XF1A 5C5TA 3WUCA 2QNKA 4M3CA 3MPPG 3KYLA 3U4XA 1W28A 4ISQA 4ARXA 1P8JA 2NMNA 1WPKA 1Y4WA 3AKZA 2CDPA 3VBSA 2X5IA 2SBAA 4NBQA 3SEQA 4EVIA 4EJRA 3IUOA 1IF1A 5BMZA 4GMP1 4FTSA 1G9AA 2E7WA 3TKYA 2XWBB 5L73A 1DFQA 2L2OA 1MSFC 4D7SA 5BNOB 2KZVA 4AFAA 4AK3A 2A3XA 1XNTA 5ISLA 3FBYA 2MH9A 2GALA 4HOOA 5D5WB 2R32A 2HDDA 4FOWA 2D45A 3V56A 5BNPC 1KGSA 2V9PA 2XJTA 3DPRA 2P8TA 4LBQB 1H2NA 5A1AA 2XH6A 2IT0A 1L7RA 2P0WA 1H30A 3DFGA 1BLZA 1DDLA 4GYGA 5LRRA 5F0CA 1I3HA 3POBA 1VMFA 3WVJA 1DU0A 4GB31 1RTVA 4HK8A 4G9SB 3SH4A 2R7DA 1H8AC 2HBTA 1HKQA 4HZFA 2FMYA 1Z1DA 3AL0C 2QQIA 4MUVA 2OA4A 4DFSA 4L2NA 1BI2A 4NRPA 1U12A 3HOZJ 1PO12 4PJYA 2DVFA 2BDRA 1QA6A 4M0NA 3CC4I 4MVTA 2G9ZA 3H5RA 2Y8KA 1UL9A 3RTRA 2JPBA 1SFKA 2NYXA 3G4SI 3OD0A 1ENXA 1MW7A 4IEJA 4DNYA 4R79A 4RS8A 3J8F1 3PO3J 5J1XA 4N8MA 4GKXA 5GJ6A 3VBFB 2WAAA 1WW6A 2AEZA 4RAFA 4RD7A 2C9KA 1BK0A 4G8XA 5JZGB 1YHFA 4LG0B 4QPOA 9ANTA 4QTRA 3D5LA 2Y30A 2DURA 4BK4A 2HDWA 2O5RA 2XPVA 3K4DA 1STMA 3NNLA 3U1DA 3PTYA 5A33B 2K9ZA 5EJ1B 3JD73 4CZSA 2DA2A 5DAWA 2PMUA 3VKOA 4AVBA 1UU4A 2H6CA 2X48A 3K69A 3T4HB 2BHYA 4DNCA 3GZNB 2RE9A 4GALA 4CDUC 4JGYC 4AFMA 3EXUA 3NEUA 4IRIA 4ZZ8A 1WCSA 4AQSA 3GXOA 1BK1A 2XBO3 5DUIA 4G6QA 4MG2A 2KXLA 1A78A 3EBRA 1QJX2 1MMAA 1VR3A 4CDQC 4JVAA 3WNNA 3OEBA 3CCRI 4IEXA 2RDSA 2E34A 2M7AA 4BJ0A 3AM2A 3VBRC 1PIV3 1RJ8A 3K7AJ 4HV6A 1FMVA 4YZ2A 2O8KA 2QCSB 3DPUA 5E1RA 1HXDA 3VKMA 1YOVB 2WY8Q 3MUZ1 5KHKA 2WWJA 1QOOA 1VP6A 1G9CA 4ENNA 1MMSA 3AJYA 4JAAA 2XBO1 2RV9A 4FVVA 5E3NA 4KL1A 2V6CA 4ZYHA 5GZCA 4WM8A 1BC8C 5LBBA 2XUEA 1IDZA 1YRNA 4BIFA 5FBZA 4L92A 3LB9A 2ZXJA 1W0TA 1AHDP 3SDBA 3VB2A 2ME0A 3HB9A 1ODMA 1WA6X 4CCKA 1AR92 1WMDA 4YGDA 1VQ6I 2RDRA 1EH7A 3VD4A 3RZLA 4HXCA 5LY2A 3BOQA 4JYKA 4PJLA 3AVSA 3DTIA 1NT0A 4AUXA 5C8CB 3I4MJ 1ZX5A 3HQUA 1TQPA 4NQWB 1WUVA 3KZZA 1VBC2 1ZZBA 2J7MA 1JUPA 3TN93 1WJDA 4G7ZF 4BQ1A 3WEZA 3HN3A 2E1MC 4IL6C 4RS5B 2L9SA 1R092 4P1WA 3M3IA 3C3VA 4E7JA 4ITVA 3QP6A 4COYA 3QPSA 1X7NA 4PDKA 2STTA 1OQDA 2VKVA 1W8NA 4D94A 4ASNA 1GP5A 2CY6A 2M8GX 1JJ6C 1SVOA 5FYMA 3CD6I 5FKMA 1ND2C 1O8SA 1OFSA 3F22A 5T5LA 2OZJA 4JZRA 1OCRH 4M3CF 3VKFC 5CFCC 4MSVA 3N36A 4O6JA 4P9GA 3IC7A 2VNRA 1VQLI 1PZ7A 3T2OA 4B1MA 2ERFA 1X58A 1Y3TA 3TDUC 2K9NA 4HLXA 1REDA 1PNFA 3E5UA 2VBBA 3ASNH 4K3UA 2ELHA 3HRUA 4BDVB 4TXWA 5LGUA 1JZ6A 2YFUA 2Q8KA 2CFXA 3WG7H 4UWDA 4B7KA 2OPKA 3JRDA 2OX0A 2HVQA 3K4CA 4IVNA 2HDCA 4KICA 4C2MJ 1TME1 4OINF 4M9ZA 2AREA 1JTYA 1X3ZB 2ZHKA 5ICCA 2RVCA 1UWWA 3FLRA 3QYFA 3PUQA 3CDHA 1UOFA 2E1OA 5DDGA 3LQCA 3ZYGA 4BZ4A 5HDKA 5CFCA 2ETHA 1ACCA 2ICWG 3K1PA 2CH0A 3UGHA 4Y13A 3H3LA 2K85A 2VOTA 2MNGA 1AR71 4OMCA 4BM8A 1XYPA 1PO13 4AHWA 2ADEA 1T39A 2DFCA 2PLV1 2LY1A 4DBQA 2L9NA 4DMIA 1K5MB 4O9GA 3RJ2X 5D5VB 3PJRA 5D5XB 4BQNA 3VDBA 1TTYA 3C2GA 2VQUA 2HPMA 1IRFA 4IV3B 1H8VA 1Y8RB 1NCRB 4A3JJ 2W4SA 1I5ZA 2WTEA 4CHUA 4B3XA 3CLPA 4IF4A 2GNDA 1OF3A 1NE4A 4M6YA 1S4CA 1RC9A 2KIFA 4Z82A 3ABMH 5L9BA 4AM3A 4QX8A 4HA8A 5DUWA 4M71A 5FLXK 3SLIA 4BYYA 4RS5C 4BQ4A 3ZM8A 1ZBA1 5DAPA 4AQ2A 1S0BA 1RUH1 5F5AA 5BNNB 4QM9A 1S9HA 2VI6A 4IDZA 2DQLA 3IKVA 2YC0A 3T3YA 3QP5A 5F04A 2VE9A 3UGGA 3PFYA 2VVDA 1BA5A 4DUXA 4Q4W2 3VUOA 4C1WA 1RXGA 1EKEA 4LOCA 4DZGA 1LFBA 2XR4A 4BY7J 4PUSA 2DA6A 1H89C 5FZEA 3L9FA 4HV5A 1RUD1 2LW8A 1AKHA 1OURA 2A6XA 3I2GA 1OYYA 4H7MA 2CU5A 4DIQA 4NO4A 1PJRA 2VMFA 2HOSA 4OIRF 4C1XA 2HWB1 3W6JB 4XFGA 4N9HA 4YNIA 3LL7A 2K0GA 3DKXA 4KFCA 1IUFA 2YMZA 4XJ9A 5IOYA 3J7HA 5ANQA 3TWIA 1ULOA 3FIWA 3J7NA 3W3CA 2C4XA 2VCBA 2IC1A 4CYCB 5FZ7A 3KQRA 5BNOA 3HNYM 4EZ4A 2ZHLA 5M5WJ 2HEOA 2A3YA 2YUEA 3HNMA 3CP8A 4Q4V2 2ZGPA 4BEHA 3O3KA 2DCTA 1X33A 1NA1A 1QU0A 1YIJI 2XAJA 3ZSKA 1VQNI 4OMDA 4ASLA 2R4GA 3OUHA 1MS4A 2JB4A 5F08A 4I02A 1RHI1 4NIGA 3K46A 1XTAA 4AEJA 2JQ7A 3LA3A 1GANA 2Y6KA 3ZXEA 3UNGC 3OY8A 1J09A 4D5FA 2MYSA 4PBOA 5JI7A 1LOFC 4CZZA 1LHWA 3K9TA 5LBEA 4W65A 3J9SA 2JKXA 3ESWB 3O1SA 5I8TA 1N1YA 4M3FA 1RUG1 1TVGA 5A3UA 4YM1A 2A07F 4JKMA 5D4RA 4A3DJ 4IQPA 1W6MA 1W0OA 2W94A 1SMVA 2VBDA 4XHXA 2CSGA 4RGXA 5B4NA 4H3WA 2VQTA 2RQPA 4XIKA 2FRHA 5C3SA 4ITCA 4NAOA 5J36A 2R041 5L3BA 3OPWA 3N9MA 3HGYA 2FQ4A 1I6XA 1SCRA 1UMHA 1W8WA 3H3ZA 2L01A 3I97A 1MZBA 4KISA 1ZK8A 2WNEA 1G6NA 3MKWB 4XJ8A 5ICGA 5JOXA 3A4UA 2VTXJ 4CUAA 4IV1C 1GVDA 2D1HA 4PCRA 5CLSA 1JMUB 3RJRA 1FXZA 2ZJCA 1EPZA 1NCQC 5KNLA 5AC92 4CXFA 1AU7A 5GTHC 2PQSA 1XNKA 5FZ4A 4AEMA 2C24A 5JR3A 2QQUA 1W2UA 3TGNA 4PI2A 5GLVA 1APNA 2QZ3A 1PM7A 1T98A 2D1VA 4QPGB 4PQQA 3SHRA 5JLXA 4YVSA 4TZDA 5ILUA 4N4NB 4QQLA 4Z2YA 4HSRA 4N0BA 2XLFA 2R6QA 2JA2A 3AG2H 3CQZJ 2QQAA 1NY71 1XNDA 3CJXA 1KDKA 2BNMA 2C1FA 3PTRB 5F5QA 1VQ9I 1NA1B 5FLMJ 1JUHA 3OYGA 3KF5A 2VOWA 1T2XA 1I3QJ 3IDBB 3I59B 1TNSA 1OBNA 3TNPB 4XABA 4S05A 3K70D 3K4MA 5E18F 5CVVA 2R49A 1XMXA 3AP4A 3HYIA 2W85A 1VFCA 3EUHA 1UCXA 5DG1A 4WM7C 4XPVA 1MH3A 3EJKA 3T8TA 4R4XA 3JRFA 1NG0A 2IEKA 2JG9A 1NZIA 2VZQA 3M70A 3NAPC 3BZKA 4FE4A 3C1DA 4QQHA 1VBD1 1MGTA 4QB6A 3NO8A 1ENQA 1CZTA 4EJVA 1H9PA 3G6JB 2TBVA 3T2QA 1OCCH 4A7ZA 1F43A 3RPUD 1JT6A 1R1ZA 3QU3A 4FFHA 1PIV2 1YX5A 2QKMB 4H2AA 4F3QA 1K12A 2QDRA 3AP6A 3PIOF 2VL8A 2F4LA 4CH7A 2BWAA 3ABTA 5M3FJ 4JX4A 2OF7A 3H3UA 5KK1A 2FCTA 1VE0A 5KAIC 1IRZA 2W95A 3M8EA 2OV7A 1ALYA 2ZO4A 2F17A 5IWFA 2HI3A 1ZLKA 4Y7NJ 2GQQA 3J26N 1ZRDA 2IGKA 3PJYA 3T0YA 5JOYA 3RPQA 2V5DA 4QIWN 2JE8A 1JI6A 2MW8A 4IEPA 4LLFA 2YU9J 4XCAA 4IEYA 5JR2A 3ZQGA 3CMAI 3GDBA 2HKXA 5FROA 1ZBE2 1NHAA 1YHQI 4XXPA 3E97A 5D5UB 4YGEA 4XJZA 2LD5A 3LWCA 2DJNA 1EYBA 1H2MA 1R083 2BW3A 1W2NA 4P9IA 4MYEA 4KITB 4AYBA 4R52A 3BTYA 3OIOA 1QOSA 4XC9A 2DN0A 1X4PA 3BPXA 3DTKA 4AVPA 3TBIA 2VBPA 1D0XA 4CCJA 2JDUA 3FUQA 3VLBB 4IESA 2RV8A 1FY7A 1W8UA 3FX3A 5K1YA 1XSQA 1WKMA 4EWAA 4Y5Z0 4PF1A 1I9RA 4XBNA 3ZYHA 4I01A 4HX7A 5FZIA 4XONA 3A01A 2FQ3A 5B1AH 1EAH2 2XASA 3H1YA 4OOIA 3I58A 5FLVA 3U78A 1KYZA 4CDXC 2LFBA 4NHYA 1G59A 1O6UA 4E8CA 2VECA 4QU1A 2X6WA 3THTA 4YARA 2FNPA 2ZS6B 2WJSA 2MD0A 4L5IA 4PCQA 4WK8F 2AO9A 1J3QA 2IGOA 3OS1A 2KIMA 2HYJA 2R3SA 3B02A 4XEZA 3U2RA 2WIIB 2WO7A 4L97A 4ASKA 1O4TA 2XV4S 1ULGA 1WSUA 3ZPLA 1J1LA 3CEWA 3CU7A 2KPMA 5A80A 4YZ3A 5ICEA 2QSHX 4HMZA 2C26A 2QA4I 4A3KJ 4BNCA 2JDMA 2ZX1A 3VHOA 2DDAA 1O5LA 1SLBA 3HSFA 1CX1A 5EJ3A 4HDVA 3OOXA 1QY4A 1P7JA 4QHBA 2UXNA 1TQMA 2A75A 4GH4C 1O7FA 2F6CA 2WBKA 3NW4A 3HPNA 5AONA 3G1MA 3DU5A 2FMLA 3WNPA 3POYA 1D0HA 4C90A 2WQZC 2OUMA 3VOEA 2FQPA 2ET1A 1WJFA 1ZARA 2WFF3 4EQVA 2DPUA 4MEYF 5HS9A 3O14A 2L9LA 2EH3A 1Z67A 2PHUA 3O0WA 3CUQB 3QWLA 1OMIA 4FQ4A 4O9EA 2FBEA 2VZ3A 3FXMA 2M0MA 4JGZB 3WG9A 1OXCA 3ZFEA 3KEOA 4PI0A 4XN3A 2NS8A 3O0XA 1PP7U 1QF3A 1UY2A 4CP0A 4PSXA 2F4MB 2D97A 2ZACA 4P00B 2NPIA 4XRSG 4KIFA 3MHZA 4H55A 1MEC1 3S30A 2NOJB 1B35C 2V9VA 1OVPA 4M3DA 3AMPA 3O5SA 3PUHA 4XQDA 2LY2A 1FNZA 3KVAA 3RZGA 5DDJ3 2A05A 1H88C 2Z99A 1ZR2A 3KQ4B 4E7KA 2Y26A 2KIUA 1XB9A 4W1UA 2BFUS 1X9PA 4JX0A 4MX3A 3NQOA 4Y1YA 2ETEA 1SLTA 4WX9A 2ZHNA 3NAUA 1TNRA 1AYM2 3Q5FA 3B69A 3C7FA 5FUPA 1W3VA 3W5MA 2HWE3 2EIJH 4U0WA 4JTOA 4JP0A 1FBSA 1RUG2 1WMEA 2ARBA 2JICA 1GV5A 1ETYA 3AL5A 5A7OA 1RUD2 2ECBA 3FJSA 5FP9A 2D2WA 5GZEA 4L0ZB 2TNFA 5L3EA 4KQ7A 4LBQD 5BNNC 2K27A 4Q4W3 3I56I 3MIBA 1LCLA 3JD71 2GXGA 3OGGA 2Y0IA 1U9NA 1DGWX 4ZTJA 2B45X 1Y56A 2XHKA 5CYVA 1A6CA 1JYIA 3DF0A 3S0MA 5C4XJ 3DU6A 1VJ2A 4MFEA 4HT1T 4EZHA 4E27A 1S5LC 2MEV1 1OLME 4KG0A 2NP0A 1M1EB 1AYM1 1CZSA 4JHTA 2RS11 1FOD2 3KV4A 3FN9A 1HW1A 1NCRC 2ZGSA 2QQVA 3ME2A 4NRQA 2EJRA 1JU3A 3P3PA 3AVRA 3ZFGB 1QIQA 4COZA 4IPAA 1W9FA 4HVQA 3CO2A 1YQ6A 2AEYA 3MFKA 3BR5A 4LLOA 2SLIA 4JV4A 2ZFWA 2DMTA 2X9DA 1Q8SA 2ZXWH 1YLFA 3V0BA 4JC1A 3HKZN 3CF6E 2MH2A 5C8CC 1ZYRF 1R081 3KV6A 4A6SA 4XAEA 1U5TC 4UFJA 4OQ9A 3RYPA 2WAEA 3TQNA 4Q29A 3HHGA 1GZCA 4UUVA 3BWGA 2WLPA 3A23A 4IXLA 2E60A 2IXJA 4DY3A 5KBFA 1G9BA 2RS33 5JSPA 2QQKA 4MO7A 5B5EC 4COVA 1MVEA 2Z16A 4E2GA 5G05L 5JDBA 4UOJA 4WVVA 4S2HA 1P2FA 2K9SA 2RJKA 5K0UA 3H36A 4IXAA 1SFXA 3PNVA 2CV6A 3OR2C 1OQEA 4GDFA 3AJZA 1JZ2A 5HV0A 4CDGA 5A33A 2W57A 2H8WA 4G6DA 2X1EA 4KBBA 3RQ0A 1Z05A 3AP5A 4W8JA 2FDIA 3CUQC 3EHKA 2UYBA 3GWZA 1QNWA 4O61A 1VZ0A 3AP7A 3JSPA 2FOKA 4RGUA 2TRTA 3O1VA 2XAHA 1N3OA 2P6SA 2J1RA 3VYTB 4M74A 1ODNA 1XCBA 4M9SA 1HRV2 3OF1A 3H35A 5B1BH 1W8ZA 3LDRA 3WCRA 2B7EA 4C3JJ 2J1SA 2BNOA 4U36A 4CCMA 3WHCA 2H0BA 3K3OA 2W68A 2R1DA 2I8DA 4L8QA 3CF5F 1ZBA3 1AR82 2JIGA 4D5CA 1VBB3 3LD8A 3ZSJA 5AFEA 4EYUA 4JKKA 3K2OA 1W36D 3FHZA 1SCSA 3ECOA 5T55A 1K6OA 4IE6A 2X1CA 1B1BA 2HFHA 2NNNA 3ZQCA 1SDDB 3RZHA 3S1NJ 1RMU3 3BOPA 3ZFEB 1BL0A 3EYYA 4XK4A 3MZ8A 1GZ9A 4LIUA 3NV4A 3VWBA 2UZKA 5F1JA 1IQAA 5A6ZA 2DODA 1LHNA 3ZLIA 4HSTA 1AX0A 2M30A 4FTHA 2BGCA 3K4NA 2XKOA 4GWIA 2OT7A 4TYSA 4QXKA 1JOJA 1RYYA 3HSEA 4BH9A 1S0JA 2HEVF 3AYCA 2WZR1 1WD3A 3WG1A 4W97A 3BQYA 5HCHA 3PLQA 1QXJA 3H0GJ 3P9CA 4FTEA 3W5NA 1XCVA 4JX6A 2Y31A 4UNOA 2G9WA 1R1A3 1CONA 3ZR6A 1XRUA 1SFEA 1KU3A 1DZQA 4HPQA 2HQ5A 2VZPA 3M7GA 3L2RA 5DN2A 3ZYPA 5AFBA 3MV01 3KZ4C 3HG9A 2CJJA 3D1NI 3OYWB 4X1EA 2P81A 1K78A 3DKQA 3JCIA 3ZP5A 2I07B 1VBB1 4P9FA 4UFMA 2ZEXA 4AYBN 1W5SA 1G9FA 2XRLA 2R7ZJ 3C2UA 3I53A 5KHGA 2G9GA 1K7AA 5IYCJ 1S1AA 3VBUA 1YQ5A 3GFMA 3USUA 1VBC1 4LBOA 2BZTA 4HSLA 1OA4A 2VC9A 2ZGNA 4IE4A 3DPTA 1TWFJ 2AGSA 4XQWA 3T1LA 3W2AA 2PQQA 1N78A 5FKOA 4K7JA 1URXA 3C3WA 3GVAA 2HH9A 1T8IA 3KT1A 3N3HA 1V6OA 3T4VA 2VODA 5LFAA 2LREA 2LTPA 3EUAA 2Z33A 3GZ5A 4EN6B 1JGSA 1BI1A 1CWPA 3HOWJ 1S7OA 1DGWY 3OY9A 4QAWA 1XC6A 4M72A 2Q8EA 4IHXA 1WMFA 4E9KA 2GC0A 2P5BA 4WVMA 1FEXA 2LK2A 2LBFB 5F5CA 2JPCA 3PDQA 5JCTA 4WM7A 1RJ7A 5EIYB 4A3MJ 4Z2AA 1P4XA 1NK2P 1UU6A 4YFKF 5IVEA 1A6QA 4ATFA 2XPJA 5FWJA 3ASOH 1FAYA 4Y15A 1W03A 3LSGA 2BVVA 2BYVE 1PK6C 4YG0A 1O4XA 1NOVA 3NJYA 4E2SA 3BTAA 3BPSA 5GLTA 3NNGA 5H9PA 4CDUA 5JSRA 1W39A 1BCXA 2P3KA 1I6HJ 2HR3A 3LEKA 4BDYA 1IG3A 2D3PA 5L3FA 5FMOS 1YJNI 5M5YJ 2DQRA 1JN2P 4CDWC 1C4RA 5ILSA 4BQAA 1MBFA 3VBHA 3FFQA 1D3YA 2VNGA 3BTZA 4ZZDA 1KZHA 1SHWB 3KF3A 5FBJA 2ZGMA 2LYCA 4B48A 3POEA 4GO1A 1DGWA 3AMNA 4ETSA 2GIZA 2VJJA 1UXXX 1QQIA 2W84A 4Q0VA 1LDKB 4OVEA 4AEDC 4Y17A 3TO9A 5H2FC 3JZVA 4ZS3A 2PFBA 1WMXA 3B73A 3PFIA 4DJAA 5HCBA 4NMIA 1UU5A 2UY9A 3NKGA 5HODA 3J7ZI 1UAIA 4W6YA 1FOD3 3THPA 2RR11 5FY7A 3N97A 4WXCA 3ASIA 3R4DB 1PO23 2Z69A 1RUH2 1HV1A 4ATEA 2CV0A 3O12A 1GP4A 1UELB 5L7OB 1OOPC 1Z7S3 1KQRA 5DDJ2 1LOGA 3OYHA 2LUWA 4C91A 3BJ6A 4LHKA 4HSJA 4LK7A 2DK5A 4P5YA 5GLWA 1I1EA 4IKFA 4QMAA 3S1RJ 2ZABA 1VQKI 2WZ8A 1E5HA 1C1LA 4QB1A 4AVVA 3BCBA 2ZMEA 3Q0WA 4YVSB 2TUNA 3QOPA 1IG0A 3FUOA 1GWMA 2P3JA 3NRUA 4L5JA 1S6LA 4YG2F 5M5XJ 5A70A 4OZXA 5K7FA 1NH3A 5FXZA 4UFKA 2R5ZA 5BPXA 3ZIWA 4BHCA 2WT0A 1CAXB 3Q8CA 1J84A 2F48A 2QYOA 2Z4FA 1RKTA 4FAGA 1W9YA 1HQCA 2HJIA 3HRSA 2Y0OA 3HUGB 2GNTA 2WSUA 1YI2I 4EM2A 1DP3A 4AWXB 3FM5A 1HDDC 3L09A 3UKNA 1BQPA 1L7LA 5EXOA 3GF2A 1LE8A 1GHCA 5BS6A 4DUWA 1US3A 4LLNA 3D0JA 3HR9A 4LJHA 3SEZA 2OQRA 1GXQA 4UW5A 4XUNA 3K4KA 3WNLA 1MACA 3LSEA 4CXYA 3O2PE 2G7HA 1UYYA 1PUEE 5JZGA 4XLPF 2KDOA 5FMBA 3VODA 2IAIA 1PDNC 5GAGJ 3CZUA 3GYHX 5FP3A 4G7HF 2XGCA 4AGVA 3WQ7A 4YVWB 2WDBA 1DZTA 3LGRA 5JPMB 1ETVA 3IDCB 4M0HA 1YXWA 5FPUA 4KT5C 2M3AA 2CV2A 4QHZA 3PL0A 4A3IJ 3POIA 1MJ9A 2WYFA 3J7AY 1V5EA 3VD9A 4LBKA 2HTJA 3WTWC 1DGRM 3R4UA 3OBZA 2W0XA 5JVVA 2WQ4A 1WCDJ 2VT2A 3PUIA 4RB3C 3KZYA 1P92A 1ZRFA 5EGOA 2L7KA 5LA1A 3RI8A 5EYXA 4BHPA 1VALA 1WLDA 3J7MA 3BR6A 1X4OA 1Y8QB 2Q1FA 3T1MA 4FPGA 1W36C 2E5NA 4FOYA 5HNHA 1OKOA 4WM8C 4JCKA 4A0ZA 1WJAA 2ID4A 1UHMA 2Y0MA 3ERED 2R1BA 3LCPA 2Z79A 3BB6A 2M45A 3HOUJ 5J96B 1VQMI 1QJU3 4Q0SA 1MBHA 4ZPIA 2HWB3 4Q1PA 1E5IA 2Y34A 2E1NA 2ILMA 2KRHA 4ASMB 1C8M2 5D8AA 1ZHFA 2ZMNA 1EH8A 1J58A 1OPCA 5K5OA 3ZXFA 1FLIA 1UKRA 3H92A 3I71A 3MLJA 4D8MA 2LVSA 4B09A 2IXLA 1H8TB 1IS6A 2KD7A 2ZJPF 3TOJA 1MPXA 1HA8A 3IM0A 4GCVA 2G1MA 3ZFFB 4IHTA 3KYCB 2PBIA 5E3OA 4ZZLA 5FRNA 3WDUA 5IK5A 3ZQQA 1PP8F 2EFWA 4FPLA 4I30A 1OLQA 1POV1 3VZJA 1X9TA 3ZDVA 2QVSB 2EILH 3GJAA 4ES9A 4TSVA 4I98B 1ASJ1 5FY1A 3KP3A 3TP0A 2Q5TA 2Q8OA 5CG9A 2ZGRA 3Q8EA 4ZYGA 1KEXA 4C2UA 2A68F 3CCLI 4D0PA 1U5YA 1AOYA 3IPVA 2X6XA 5A6XA 4BE3A 3GCMA 1UZCA 2YBPA 3ZMSA 3CF2A 1QJX3 2DV9A 1KQ0A 3FLTA 2I2SA 3PNTA 2EFPA 4WZFA 3HEFA 1E0EA 1LTEA 4LBQA 5FZLA 4F55A 5KAFC 1ONAA 1R00A 1H9TA 3AKSA 3H50A 1RMU2 3NV1A 2K9QA 4OWRB 2WS91 4GMP0 1UX6A 4G3YC 3B93A 3JQWA 3U1XA 5ICFA 1HJFA 5DUUA 1XGMA 5DS9A 4RM2A 3P3NA 2DU1A 2A6WA 5EFUA 2OYZA 1SPPB 1TWHJ 2W00A 4BLIA 1V70A 4Q0UA 1D0YA 3TO7A 2XROA 1OHFA 2E1MB 4A3GJ 3PVNA 3MEXA 2A3SA 1RB8G 3X29B 3JTGA 3CBNA 2JRTA 4UVAA 4URAA 3WDVA 3EMRA 4QGMA 4RLFA 2BFUL 3WQ1A 4FPFA 5FZFA 1B8IA 2DCZA 3LDKA 5M0TA 2PAMA 3MGUA 3LA2A 2PTMA 1K5MA 3AFGA 1OT5A 4AIDA 5KXEA 1MIJA 3ZXKA 3L2VA 1WCUA 2D40A 5HI0A 2JECA 3RRDA 1GDTA 4BLJA 1GXPA 3MW4A 4LOSA 1DZRA 2BOLA 5FP8A 3IAQA 3WG3A 1FOYA 2P3YA 1E3PA 2BVBA 3TW6A 2ZPXA 1UOGA 4BMEA 5LA0A 4B7EA 3K1NA 3CDIA 3HBLA 4HX4A 1JZ5A 5KHHA 2W48A 1A35A 1W9SA 5HLTA 4DS0A 4OAYA 4GRIA 4EJOA 3S17J 4FE7A 1TEIA 1LUJB 3MZYA 3K0LA 3CJIA 1EY2A 4QQOA 3ELNA 3ZXLA 1CQ9A 2IXHA 4HEA2 2VBXA 4GYIA 3CUOA 4N53B 1OCTC 4R4ZA 1YFUA 4QKBA 3CP2A 4N90A 2ZBKA 3QYEA 1HC8A 2AZ5A 4BPZA 2UWMA 1GOHA 4XURA 5IVJA 1SAUA 5A2QK 2CYFA 4AHZA 4OAZA 3OS0A 2WO3A 1WGXA 3KFWX 1AYN2 1UYPA 5HXMA 1RUG3 3I2IA 2B0LA 2EB7A 3RPUA 4E7IA 2JJ6A 1T38A 1J0RA 1GQPA 2O8OA 3VEPA 1J75A 2R042 2WNUA 2DFIA 4J19A 5C9AB 1DLLA 4HG2A 3ZKUA 4IV3A 3ABLH 1YTYA 1R36A 4QXBA 2P6CA 4LKSA 2W24A 4IETA 1OPOA 4LEJA 2IPQX 2FE3A 2JUGA 1GICA 4XUTA 3T2PA 3VGIA 4NB5A 1G3YA 1YWKA 2CGNA 2J1EA 2PI0A 4CDWB 4L99A 3LIGA 4N53A 2Y2ZA 3RWKX 1ULDA 1R1VA 2JIJA 4XSZF 3SCGA 2ESNA 2ZKZA 2NVQJ 2WR9A 5B3SH 2JG8A 5E89A 3P9IA 1R6RA 1J7KA 1HLVA 5LWBA 2XLGA 1W7PB 5FZ6A 4BQOA 2O03A 2B9VA 3KIOA 4UV9A 3KP6A 3RKWA 1HDKA 1RUJ2 5FB2A 2R7XA 1TZOA 5FLHA 3GM8A 4OHZA 3OUIA 4I7HA 3GALA 4D6SA 2D5VA 4A44A 2A61A 3PQJA 3CCMI 4CUBA 1GV9A 4HVOA 2L0KA 1Z7LA 4GWJA 3L00A 3TBDA 3WQ0A 5FKNA 3CMEI 5FD5A 4IHYA 3DBHB 4M3CE 1Y39A 4JKLA 1BEV1 3OG2A 1W0PA 3EB7A 2DUQA 3NQHA 4IHVA 2FU4A 3VB9A 5FPXA 2D6OX 2W1WA 3LSTA 4FQZA 4EM1A 4WM7B 1QXRA 5DAQA 1IRXA 3M3EA 5IOZA 3L2HA 2EALA 1R5ID 2PMWB 2VUCA 2LMDA 3N7KA 4AQTA 2OD5A 3SKJE 2H8RA 5A6QA 1HF0A 2ZX3A 3ABUA 1AWCA 2Q1ZB 2VZRA 1COV3 3WD5A 3CUQA 1GOFA 1NYWA 3SXWA 1X1AA 2WYSA 3KGLA 2Y0SA 4ENMA 4OYUA 4FOVA 4YELA 4E4ZA 4FTBA 1J83A 5FJKA 2KIQA 2JA7J 1X2NA 2CUEA 2ZGLA 4CDQA 5DCMB 2YBKA 2ZMKA 2QBYB 1JYCA 1ETQA 2V7FA 4BKXA 4XBFA 3F95A 1QJEA 2DUOA 1LDDA 2VXDA 2CAUA 1D8JA 3F8CA 1A3KA 1LNWA 1S7AA 2ZGUA 4NE9A 1PO11 5AVPA 1YIOA 4GXLA 2VPVA 5FYBA 2Y64A 2A5WA 3BI3A 2DCJA 1WCQA 2LKSA 2XC7A 5JUVA 3V0AA 3FXOA 2QQPA 1VAMA 2AH2A 1DP0A 4RAZA 4XF0A 1KU9A 3BU0A 3ZOBA 1NXD1 3VZKA 3D5SC 1LGCA 5E1ZB 3EUHC 2CWEA 2Q4SA 2VOOA 3ZFGA 5AC91 3DXUA 4GZ9A 1ODDA 1R4NB 4F91B 4OUMA 3ACIA 4P55A 1QKQA 2XRNA 1GNZA 2EBIA 1KJLA 3KHCA 1ORKA 1KONA 2R073 3OGRA 5A7WA 3VBSB 1YS6A 3R4KA 2R7WA 3PO2J 4XOGA 5FZKA 4CGZA 2LS6A 1PUFB 2WT1A 2PJRA 4HFSA 2VJ4A 1VBC3 3LSIA 1Q8PA 1MS5A 3SXYA 2XXZA 1HN0A 4K40A 1GUUA 5LZ6A 2MLGA 3OGJA 4YYOA 2DMNA 3E6CC 2YPRA 1I1GA 2VPRA 1KS4A 3K70C 1TME2 2XKPA 4QM8A 3E7LA 4NJ4A 1JW6A 2HQAA 4DGWB 3T08A 5EV7A 3BN6A 3JREA 1LOFA 3JCUC 2VZ1A 4XW3A 3S7EA 5JR7B 1REPC 3SH3A 4HANA 2Y0SN 3H0OA 3NJXA 5JMOA 1LEAA 4E8DA 3IKWA 3GCXA 5H9QA 1AR62 1FOWA 3N05A 2IS6A 3DXTA 1CZVA 3N7LA 1X1CA 2CO5A 3DQVC 2FD8A 3FXKA 2D7FA 3LF7A 4ZY9A 5J1RA 1NLRA 5KHJA 5IT9K 5BNPA 1CIWA 3H8OA 3A0NA 5HDNA 3T0AA 3SFZA 1AR72 1AL21 5FMCA 1FP1D 3LFKA 1NKGA 2B9SA 2VW1A 4Q4X1 4XDPA 1PGL2 4BXFA 1LPQA 1RETA 2NQYA 1HW5A 2RM21 3MI8A 4Q5SF 3WG2A 1UG2A 3V0AB 2M87A 3ZXSA 1QWRA 4AHXA 1ZG5A 4FXGB 1N77A 4IGOA 4XLFA 1LGBA 3VBSC 5JI6A 1HRI2 1XNBA 2TEPA 4RR3B 4AFBA 1J9IA 2NYYA 5L9VA 1IXCA 1BYHA 3N9QA 3GJBA 1D4M3 1CD3G 4E4HA 4CEYB 2KZGA 1XDUA 3F9KA 1AR63 1K83J 1QU3A 2VQCA 1OD5A 5JWPA 4AIHA 1WGPA 1YS7A 5JXIA 3IPVB 1XSRA 1ACIA 1B9NA 2DA7A 4LG3A 3U07A 2JDPA 2K2SA 4F83A 2R93J 1A8MA 2X8KA 3IN9A 1ZELA 5FZDA 1MD0A 5FAXA 1T08B 4WVZA 3SITA 3QU6A 2QQNA 4TLGA 1RPWA 4NPLA 1EV11 2OKXA 5JHFA 2EWNA 5CKTA 2HQNA 3K1MA 3UKVA 3ZSLA 1GZWB 1PZ9A 3O1OA 3MPBA 1BI0A 1I39A 4FHTA 3TNQA 4WBBA 3R0AA 1AUYA 2JE7A 3M3OA 1JT0A 2ZOEB 1W0NA 4JGYA 1RVF3 2PA7A 2JA5J 2ZEZA 4YW4A 5B2GB 3KEYA 3WR0A 1VBB2 2AUYA 3U1KA 3D8CA 1Q56A 5DTDA 4DQ2A 1EAH1 5E1XA 1UYXA 1YJ9I 2RR12 2WC2A 3VPRA 1DF0A 2C0ZA 4FPCA 4U0VA 1OA3A 1HCRA 5E16A 1PNGA 5H9SA 2Q0OA 1UZYA 4CP9A 2M34A 3M1EA 1WW7A 3W2WA 2RN7A 2R0QC 3E1F1 2AHQA 3A01B 1PZ8A 2X09A 2VUDA 5BPDA 3I2KA 2ZMLA 1H0MA 2CHHA 4QX2A 3S2WA 3DEEA 3A0BC 2JWPA 2OVUA 3CDLA 5GAEJ 2VZOA 3EETA 2J5PA 1VPHA 3CMMA 3B9IA 5GALA 1JE8A 2UV1A 2XGDA 2XJUA 2GC2A 4ZH4F 4WF2A 4L11A 1Z0HA 3K4JA 3OJBA 4GFBA 4G94A 1OUSA 1W1WE 2GLOA 4KIGA 1XMKA 1PK6B 4D0QA 3SC7X 2LP0A 1SFYA 5BY5A 1SBDA 4EROA 5TJJA 4QQPA 3WTXC 1NTCA 1AVBA 1Q8QA 3KV5A 2VONA 3B00A 3J80Z 1B72A 1K4TA 2EVXA 1QQP3 1LOCA 1W2TA 1YJWI 4EN9B 2IGNA 1OC1A 1NX9A 3POSA 3S6PA 3VD7A 1HDPA 2FUG2 3L9JT 2ID3A 1UYZA 4NOTA 2DT7B 4Y5TA 2EA4A 5FK8A 3B01A 3I8TA 1Z77A 4XRMA 1NZCA 3OPTA 5BUVA 5F3EA 1SQ4A 2QKLB 1JHFA 4LLLA 4A6DA 1VQ7I 4YVWA 2NVXJ 3RCOA 2D6KA 2CQQA 1X3UA 3KETA 4OHWA 2VJ5A 4LK1F 4N7UA 3M3CA 4TV7A 1Y0UA 4CA9A 2FD5A 1BEV3 2NS7A 1BBT1 1QJY2 3WUDA 2WO2A 1R1UA 1FATA 4IEVA 2MEV3 1F35A 5IPAA 2J42A 2QBYA 1TP4A 6PAXA 2YPDA 4GIQA 4R9AA 3J7LA 4OULA 4AIJA 2LSOA 3LFUA 5CPRB 1ITYA 2QSFX 4JRAA 4KBZA 3UJQA 1QHGA 2HTSA 2JDHA 4OQ8A 5B4XA 4F93B 1AA7A 5C3RA 2VMGA 3ZMZA 2FJ1A 2ES3A 2R92J 1QVUA 2EIEA 5JIUA 1A5JA 1LJ9A 2KM2A 1YW8A 5JMCA 5K7HA 1POGA 4MIMA 1VLNA 1UHSA 4MGRA 1VAKA 1UQXA 3A21A 2HOEA 2V9KA 1KFXL 2X6YA 4OCTA 3V7SA 3S57A 1IN4A 5LB6A 1IS3A 3BG7A 5FCCA 1AYN3 3URFA 3LA7A 5EZGA 4X6AJ 2XQRA 1YFYA 4IQJA 2KJCA 4JGYB 1ASJ3 5L7OA 1FPN2 2PHRA 2N7GA 1AHSA 1YIPA 5EEAA 1VF9A 1YQ2A 2MC3A 2K7LA 1YLLA 1CAWA 3OL4A 3S32A 4YW1A 2JENA 4QDRA 3H5AA 5F64A 5FYCA 3EO6A 4A7YA 4QKFA 3WG4A 4BK5A 3VDDB 1WH7A 3S3NA 3SHFA 5F32A 4YZ4A 1XXNA 3AB0A 4DBRA 2CRGA 1JYWA 4H7LA 4F92B 4CZCA 3Q0VA 3J4UH 3VBFC 4L9TA 4CUGA 4EJTA 2BGPA 4YRDA 3WHTA 4QPQA 4OMZA 5A3OA 1YITI 3RQ4A 1PO22 2EQRA 2XWJB 1W5TA 2JE9A 1KU7A 3WTUC 2GC3A 5HPOA 2V79A 3BDDA 3RIRA 4HBNA 5FP7A 1ZGWA 3K4LA 2GZWA 5HS8A 5FJ8J 3GZUC 4M01A 1UY4A 1VBA3 3ROUA 1SLLA 4N53C 3JRAA 2J1AA 1O3QA 4RGSA 4P9WA 3KCYA 1SD4A 4XKBA 1V5FA 1C5HA 5IAVA 4XJWA 3ZRGA 5F1RA 1IZ3A 2KLOA 1XPXA 5JXGA 3H8UA 4NVPA 3GO5A 1YE9A 3MIHA 1VNDA 4PGHA 2O3FA 4UUSA 4RGGA 1LHOA 1O3SA 3S5QA 1T33A 1JU4A 4MHRA 4Y26A 3OYKA 4LG0A 2RS13 2JD4A 3VZMA 3WF2A 3IAS2 1RUC3 3TN91 2HWC1 4S0HB 2FBIA 4XTPA 2DBBA 1E57A 4WVWA 2OIIA 1RVF1 1ZRIA 2DFBA 1IKQA 4EV0A 3ZN4A 4HBLA 2VQAA 4UT5A 3F6OA 3MW2A 3VYSB 4GXOA 3ZQ7A 4MXVA 3AG3H 2VMHA 4L9VA 3R05A 4WVMB 4NHMA 2H1LA 5BNOC 3GTQJ 1B35A 1BBYA 3E5QA 2QBXA 2WB1A 3FBMA 4MFDA 1R23A 1VQ5I 4P96A 2GA1A 4LO6B 3VHNA 3KLOA 1IRGA 2DO7A 3RQIA 1H4HA 4MHGA 1PYVA 4AHYA 4CA0A 2Z5UA 3B3QE 3TN92 4LJZF 4UY8I 1FOXA 2IWGB 4OHVA 1WJEA 4HVRA 3HWJA 4PQ9A 1HRV3 1UX7A 4LK0F 2GH2A 1D4M1 1QRYA 4BAYA 3K10A 3HBZA 4A3ZA 3VZOA 5T50A 1RUF1 5K7PA 1P7IA 1W6NB 1WA4A 1ND3C 4YFNF 1YC61 5JIAA 1N3PA 2VMIA 4PJMA 3BALA 3IV5A 3TB0A 3M1CA 2CQNA 1RGSA 4GWMA 1R49A 1S2KA 2WAOA 2RR13 2ORXA 3OY8B 4CEYC 4PFPA 2ELKA 3A03A 1ETKA 2J5OA 3D3AA 2HWF1 4A3BJ 1KJRA 5JI9A 3ONQA 2O7OA 5E20A 1W8TA 2A5ZA 1WQ2A 1VBE3 5ERLA 5CA6A 4EEFG 1MBEA 2Y6HA 4LK6A 2WSVA 5FRMA 4QXCA 2CFOA 2MBFA 3BZ6A 2HPIA 3RDIA 2IA2A 1U0AA 4M3CB 5EZWA 1W99A 2VCMA 2WZR2 4PLNA 2D3RA 4ZU5A 1BJAA 2VKEA 5D8LB 5FPLA 4KN4X 2Z42A 3LWFA 3BG6A 1JTZX 2DT6A 3C7OA 4XFBA 3R4SA 5I8SA 5FYTA 1UO9A 1TW3A 1MKMA 1F9NA 3PHMA 3S8PA 4Y20A 5C8WA 2JSCA 5LEJA 1UN1A 1GZTA 4RR3A 4FCYA 2AXLA 1UCRA 4DYRA 2XONA 5ACA3 3BGAA 1BVVA 4YGCA 2X29A 2D6MA 4KDPA 4I99C 5K4LA 4DYQA 2X05A 5TRDA 4EN8B 1QQP1 4RDUA 2WWYA 1ND2B 4HKLA 2IZWA 3PMEA 1O4YA 3SMHA 3HTUA 3OSFA 1J2XA 5EPAA 2BRTA 3GZEA 3PQKA 2D93A 5LCWL 3CJTB 1I1SA 2ID6A 4J1XA 4CCDA 2HEYF 2OXBA 2E53A 2Y6LA 1UIKA 1MNEA 4PBPA 3LSJA 4IE7A 5A1LA 2OPWA 5CZKA 2ET7A 2CWMA 4KWJA 3IP4B 4E7SA 3CCSI 3LQRA 4CCNA 3ISPA 3R0RA 4YM3A 4M3GA 1GWLA 2EXIA 1I27A 1US2A 1W5CC 5CKNA 5IAXA 5I91A 1D2QA 4BJTA 2BQPA 4DB5A 2Y69H 3S1MJ 3LEMA 1PVXA 1LFUP 3WDTA 3K4BA 2P2KA 4D7TA 4O5VA 4AU7A 2ZA9A 2BWCA 5A6YA 1JXNA 4XF4A 1DQ5A 4ENKA 2R0HA 4E4SA 3MAJA 2EIBA 4NROA 2LALA 3FFZA 3AKRA 3HIFA 2E19A 2PHXA 4D9JA 3ZXAC 2NLRA 4J1WA 3VBRB 4DQAA 5T54A 4IL7A 4CDXB 3V0BB 1EA3A 4DEQA 4CDQB 2DYSH 4ON0A 1XU2A 1X36A 3HVDA 3IH4A 4NHXA 2ZJ2A 4D7NA 1SVMA 3NL1A 3S93A 2ZC2A 5IFTA 2EK5A 4AZZA 2CUJA 2QTWB 5F27A 4IEWA 4ZC3A 4CO8A 2YC2A 1USTA 4OMYA 1IXSB 2HVSA 4ZJZA 2EZKA 2X5IB 2ZNYA 2F4PA 3V7RA 2QSGX 2H1KA 4ZYDA 2UWAA 1UPIA 1NCRA 2IP2A 3ECQA 3MF9A 1DYKA 3PUSA 1JYXA 4BEHB 3I54A 4A0XA 3FXJA 5DPNA 5C3PA 3HL2A 4PJJA 1V9U1 3OYLA 1Y0NA 2DCYA 2MD5A 1AXZA 4QKDA 3VFZA 1ZG1A 2OUHA 4XDOA 3C7HA 3H9QA 5K0UC 3TW7A 2XQXA 2VZSA 2ZB9A 2RJLA 2L7FP 4YEJA 1UNBA 1CAVA 1OLTA 4QDSA 3F23A 4BJ5C 4YFWA 3Q8AA 4Q26A 3WNXA 1PVC1 3ZYJB 2RM23 1YX3A 3AP9A 3GTOJ 3NKTA 4Q4V1 1TT0A 3PUAA 3HD8B 3WOGA 1RUF3 1R71A 4NC7A 2PX9A 3ZXDA 1LVKA 4JTNA 3LSDA 4RGRA 2HOTA 3DCFA 2Q8CA 3HRMA 3AG4H 4PDWA 2M4KA 4FI9A 2EV6A 4OUSA 4LHNA 1XE0A 5ED4A 4NR1A 1W6OB 1QJY3 4DZJA 1T2KA 3K75B 4LIVA 4EGZA 4HF0A 3PUBA 3ZMTA 1KU2A 3MFCA 3JRHA 2DMUA 5FXXA 1RR8C 2DOAA 3BTCA 5SV5A 1USSA 3L1PA 2DVGA 4RGKA 1UOJA 5FWEA 5F3GA 4DW6A 4XBLA 1JUIA 3UKGA 1KQ8A 2GN3A 1D5VA 3ZSEA 2HKOA 2P5LC 3IH2A 1GQGA 1V3FA 3CC2I 4NIDA 3A2KA 3IMMA 1ASJ2 2BBAA 4AR2A 3LOBA 1OF4A 1WKYA 4AI1A 2COBA 3WINE 1X2MA 2XVGA 3WGIA 1R082 2HLEA 2GSYA 4A3EJ 5F9TA 2W1QA 1T0FC 1OCPA 1IN6A 2W5FA 2XB0X 4Q4X2 1HXS2 4XBQA 2JVHA 1ZYBA 1K3IA 3BG5A 5D21A 2HWD1 3HJEA 3M3QA 1RIRA 4NUBA 1S0DA 2WLQA 2EFNA 2C6SA 5J4VA 2DBIA 1Q8VA 1MSEC 4XN0A 5ACA2 4A3XA 4AWDA 3ABZA 5FZCA 2WA4A 2M7BA 1D4VB 3IB3A 1ZBE3 2CW7A 2B46X 4IUGA 3UK9A 4LA2A 1ONVA 4LA3A 2QVOA 1C28A 1T0FA 2AQEA 1XB4A 1AJKA 4WZCA 4BQQA 4FPJA 5BV6A 3U75A 1S0EA 2Y48A 2W46A 3OD4A 1PM4A 3WDYA 4U0YA 2DFEA 3QPHA 1B4AA 5F6FA 3T2TA 4OUEA 4FO9A 2CW0F 3CZ6A 4DXRA 4YIRX 3IIAA 1KITA 4HETA 3RNSA 1U78A 3GFIA 2YZ4A 1H2KA 2C6YA 1Y1VJ 2NOGA 3TO6A 3POFA 5DZGA 5CVIA 4BQ5A 1T56A 1ERDA 1Y9MA 2XG3A 2B63J 1F1ZA 1PGW1 4AI9A 1UPSA 2XBO2 4Z8BA 2CQXA 5F6KA 2ZMEC 4I3GA 3ZGKA 2ZJRF 2GU9A 3ILRA 3MYXA 1FC3A 1XX5A 4XOTA 5A3LA 1TMF2 3S1QJ 1ZA7A 5A3MA 2O61A 3ES1A 5LK7B 4FPEA 4P9LA 3I7DA 3MBWA 3OYIA 1RUE3 3D5OA 3U37A 5C3EJ 3PUFA 4Q0PA 1MEC3 3L2YA 1E5SA 3OGSA 4PK4A 1HV0A 2R30A 2WBMA 2GAUA 3HNBM 1X50A 4LKEA 3O1PA 5E8IA 1VQ4I 4XICA 1WCKA 1ZNPA 1W2OA 1H1MA 2FZ1A 3WQBA 3R0JA 4A42A 4BIOA 5HLGA 1A34A 2JN6A 1JKRC 3LPGA 5APAA 1VMJA 2VBWA 3A4CA 1U5ZA 1B72B 4KIBA 3BCWA 5DZEA 2DDBA 3OPZA 4V2WA 2PELA 1NLQA 2F2EA 5FZ0A 4BE1A 1ZKGA 1HKTA 3ZXGA 2FDHA 1P4WA 4HDUA 4GA9A 4O65A 1LVAA 2HWB2 1UOBA 3WLUA 3BPZA 4FX4A 2OC6A 2BV4A 3GBWA 1CAUA 1CR7A 3DEWA 2LM3A 1FYKA 2UUZA 4QPWA 1G3TA 4BXUA 4MGYE 4D6RA 4B44A 1WFXA 3UR3C 3WNMA 3MIDA 1MS8A 1Z7S1 1Z91A 3RFRA 3CLQA 3RWNA 3P7NA 4A7KA 3JRGA 4FAHA 3I3DA 3WW3A 2RS12 1CJDA 5LRSA 2YU3A 2OBPA 2YR2A 1L3LA 4ZYAA 5GZGA 4UB6C 3ZN6B 4D7MA 3HGGA 4QDQA 5FYSA 4IV3C 3GFLA 4RHV2 1RUOA 2EIDA 4II3A 4QPGA 2PLV2 1HBXG 1LJ7A 2MABA 4EGYA 1IC8A 1PVC2 3ZMOA 4XFIA 4K21A 2CAVA 5HBAA 3DEMA 2HEWF 5A7PA 3BIEA 5GADJ 2VC0A 2E32A 3VD3A 1B9MA 3VZLA 2B4KA 2W9XA 5CKQA 1FV2A 4KN7X 3RVHA 2XL7A 3WU0A 4L9JA 5T52A 5FOBB 1H2LA 4IHSA 3I55I 4P5HA 4OI2A 1ULFA 3BJOA 1Y9GA 3WT3A 4C0HA 3AC0A 2EZIA 1N25A 2ZGOA 2VJIA 3HPHA 5DZFA 1HW2A 2VIXA 1UY0A 2Y9ZA 4S2DA 1F5TA 4PIXA 5HCFA 3C2HA 5J8CA 3PSFA 3CIHA 1QJU2 1MS0A 3AYAA 1TMF3 5EHDA 2VBYA 5FIXA 4DPNA 1XDSA 2ENRA 3AMMA 1H0BA 4AVZA 1WVRA 4RBOA 5CFCB 4MGSA 4CEWC 2BTVC 2XPWA 2VMCA 1U6GA 1N1TA 2WNVC 3KP2A 4NN0A 2L7MP 3H1MA 1BMV1 1XGSA 4Q4Y2 2DA4A 2AYHA 1G86A 3WGHA 3HOXJ 4NHJA 1MQTC 2CQKA 4GGGA 3RSJA 1HJGA 5GZDA 2QF7A 2V1UA 4A41A 3O1TA 4GKYA 1SFOJ 2V5YA 3IRQA 4QKNA 2XF5A 4YM0A 4PZJA 4DOZA 4URTA 2PFWA 1ZM1A 5DXDA 2STWA 4ANJA 3EQEA 4GH4B 4KGQA 1ZQ3P 2A1XA 3FC0A 2PHTA 1N75A 4AYUA 1P4AA 1VBD2 3U21A 2O8QA 2KT0A 1EPWA 4EJUA 1MBGA 1K42A 4ENJA 4LORA 5IP6A 4ZS2A 4TTGA 1QJX1 4QU2A