4I0BA

Structure of the mutant catabolite gene activator protein h160l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0bA01
1G3YA 3JW4A 5HLGA 4I0BA 3M8EA 4EGZA 1FZPB 3M70A 3EJKA 1G6NA 5BY5A 1A04A 4LMYA 2VECA 1ZH5A 4LUMA 4N9HA 5E1ZB 3HSFA 1X8EA 1I27A 3KP6A 4CYDA 2KJBA 5D6FA 2XL7A 3SXYA 1XN7A 1FX7A 4ESBA 3C3WA 3CTAA 3ZMSA 2XKOA 2PHLA 2ESHA 5I91A 1T0FA 1JHFA 4M6XA 5FQ0B 2F5FA 2F5CA 3C7JA 1MZBA 3HT2A 1HKSA 5CVIA 2O61A 2PAMA 2OAZA 1R7JA 3S7EA 2IJLA 5DDGA 2FOKA 4E2QA 4YARA 1KGSA 1CAWB 3BJ6A 3D82A 4O3MA 4X6RB 2KIMA 3ELNA 1USTA 4LJZF 2ZFWA 3WTVC 1H1IA 4BH9A 1RZ4A 4EWDA 1JE8A 5EFUA 3RIRA 4KA4A 3M3IA 1ZN2A 1O3TA 4LLNA 5DD8A 2P5LC 5HDGA 4UVBA 1SFUA 1B59A 3MYXA 1E2XA 2K27A 3VODA 4AVCA 4R8HA 4KWKA 4EVIA 2CQKA 4HN1A 4BHBA 5CJ9A 1IPKA 3BJOA 4I09A 2P6TA 4YG2F 4N0BA 3EBRA 4XSXF 2RDPA 2IXHA 3G73A 2O8QA 2VT2A 1ZZ8A 1CAVA 1Z7UA 4DQ2A 5DCFA 2YX4A 2BNNA 1YLFA 1U3EM 4QGNA 4PIXA 2YX7A 3BWGA 3E6BA 5CVJA 1R58A 3V7CA 2VQAA 1IXSB 5FPZA 4IETA 3TDUC 2DFIA 1WQ2A 2JSCA 3S7IA 2ETHA 1UHMA 4AIJA 4BHPA 2XV4S 5ICEA 4ZYEA 4ZYGA 2HTJA 4UVCA 3L9FA 1FYKA 5FGMA 1QPMA 3K0LA 1C0WA 1ZNPA 2OD5A 4EJUA 3KP2A 2RV8A 5LGNA 1P4AA 1IZ1A 1JGSA 5L3BA 4JTOA 2FRHA 1OI6A 3I0TA 5D5UB 3REOA 4I2OA 2PG4A 3HSEA 5CVUA 5E17F 2VBYA 2XLGA 4AQ2A 5E8IA 3GWZA 2PAEA 1YHFA 1RL3A 5D8LB 2PA7A 4MTDA 1MDMA 4OIOF 3ABTA 2EFPA 5J6XA 3WTZA 5J3UA 1XDSA 4XFGA 4AVAA 2ZO4A 3WTUC 1TQ5A 5JSRA 1BC8C 5DUIA 3NL1A 3E5QA 4LLOA 4L9TA 2P8TA 2XROA 2HQRA 2YU3A 3NEUA 3GYHX 1PDNC 4XFFA 2K9ZA 4U0YA 2UZKA 1YYVA 3CLPA 4E70A 3V7SA 1ZZ6A 1U8RA 4PZJA 4I7HA 1G4DA 4HF2A 4JVAA 3BZ6A 1XRUA 1GQGA 4HVQA 2XAGA 1ZRCA 3CF6E 1HKQA 2VODA 1LR5A 3LZZA 2GC3A 4D7TA 3G3ZA 2O8XA 1H9GA 4AIHA 3UKTA 2MNGA 2OYZA 1S7AA 2DO7A 5J7MA 2R7FA 4WWCA 4GYGA 2UXXA 4TLFA 2GZWA 3HRUA 4RGRA 5D5XB 4PJYA 5AVPA 5K8SA 3VB2A 2XL9A 4QGMA 3M1EA 4D7SA 2ZJ2A 5E20A 1R1TA 5FLXZ 4CGZA 1YWKA 2HDCA 4IVNA 2PQ8A 3LAGA 4HSLA 3HHGA 1E17A 2PFWA 1OPCA 1SFXA 2EA4A 3ZN1A 4AWXB 1SFNA 1O4TA 4XEZA 3JTGA 1IN5A 2JZYA 2R7DA 1U2WA 1YG2A 1D8KA 3VFZA 4JQFA 3E6MA 4EV0A 1CAXA 1YW9A 1ZZ9A 1ZG1A 4YRDA 1GQHA 3FMQA 1W4MA 5CLSA 3CJXA 3QPHA 2CO5A 1H0MA 1VP6A 1Y9QA 4XF4A 3ES4A 2EFOA 2ATFA 5JI6A 3N97A 2ZMEB 1YS6A 2QZ8A 2M8EA 3BB6A 4EQQA 4O9EA 3I7DA 1L0OC 2RKHA 3NW4A 3EUHA 3H7YA 2CWEA 1IXCA 4J1XA 5CVVA 2G7HA 4EJVA 3JSPA 1WA4A 3HSRA 3V7RA 2JTVA 1QGPA 4QWQA 1J7KA 1BIBA 4ORFA 1W7PA 4HX8A 2Z5UA 3TOBA 1EPZA 2CG4A 3V8KA 4HF0A 5AONA 4P9UA 4IESA 3TNPB 4XFIA 4LD5A 5FLXK 2OZUA 5ILUA 4HF1A 2TDXA 4M9ZA 3H3UA 1G3TA 4MGKE 2VXZA 5IT9Z 1MDMB 3F8NA 4RS8A 4LFUA 1I6XA 3K9TA 4U7DA 2MPFA 5FD6A 4P5OA 5FCCA 3I64A 3QAHA 2DLLA 2V09A 4ZH4F 2X4HA 1VR3A 1UCXA 2EA2A 4L0ZB 5I0SA 3M9AA 1LJ9A 2EV6A 5JCTA 1BC7C 1SAXA 5L3FA 4G7ZF 2QBYA 3KP3A 2IVMA 1FI2A 2CYYA 2ZNYA 2VE9A 3E6CC 4KIGA 4L9VA 3GX4X 3P9IA 2IA1A 1HQCA 3H8UA 1J3QA 2H0VA 3LQQA 5HI0A 1SD6A 2GXBA 3RJPA 1PUEE 4JBAA 5BOXA 1JXSA 3KLOA 4PCQA 2QLZA 1IRFA 5D4SA 2D93A 2GC1A 2P7CB 4R1HA 4QGLA 3ZMDA 2IA0A 1PP8F 3TGNA 4FHTA 1DUXC 4XF9A 5LHGA 3LA2A 4XFHA 4WXCA 5KHIA 3H1YA 2MA3A 2CAVA 2FE3A 2VE8A 1YLLA 3H9AA 3SXWA 4BQAA 5LHHA 3LA7A 4QM8A 1ONVA 5HOOA 3HTSB 3LWFA 5C8WA 3F72A 5H20A 2H27A 2EK5A 5JVTA 4FAHA 1J9IA 4CZZA 1RC6A 1YIOA 2RQPA 3GF2A 5E18F 1OKRA 1XMKA 2CW0F 3MPBA 2M1BA 2B5HA 2L4AA 3FZVA 3KP7A 1J59A 4MEXF 5ICGA 3R0JA 2HTSA 1DPUA 2Y0MA 1REPC 3UKNA 5A2QZ 2HKXA 1XSXA 2DK8A 2QDRA 5FLHA 4MQVA 1J58A 4XLPF 1S8NA 4M9XA 4HLXA 1F4KA 2UYAA 1IPJA 4LUKA 2E7XA 1XMAA 1YUDA 4F7ZA 3C3VA 2Y0OA 1WGPA 3KE2A 2HJIA 3QOPA 3FXQA 4TV7A 4KIFA 1O5LA 3WW4A 1J5YA 2WWYA 4PIYA 4ZZLA 1V3FA 2QQBA 3CUQC 1LKNA 4B29A 2GWRA 1SD4A 4XSZF 1MKMA 4UXAA 1B6AA 3R6SA 3IDCB 1R1VA 1ZG3A 2P5KA 1BN5A 1AWCA 4IEOA 2ELHA 3KEQA 3COAC 1STZA 4OOIA 1BJAA 3MQ0A 1P92A 4LA3A 2ISYA 3ROUA 1WKMA 1O7LA 3W6KB 5H6QA 3WU1B 4G8XA 1S29A 2QBYB 5HS7A 3R61A 4GXOA 1WLTA 3RPQA 4GO1A 5A2QK 4Q5SF 3ERED 2ET1A 2F2EA 1NZCA 3K1MA 1D5VA 1QY4A 5F6FA 4HOBA 5LGTA 1VJ2A 2FMLA 4XFCA 3SZTA 2IPQX 4UUVA 2F5DA 1JUHA 1P4XA 2V79A 3T8TA 4G9YA 3J81K 3LOIA 1RUOA 4G6DA 4K8FA 1UB9A 2XLFA 2GQQA 1BBYA 3S2WA 5HLHA 3P7NA 2G7UA 4ENNA 5K5QA 3QU6A 2X0LA 2MH9A 3NKTA 3C1DA 1FBSA 2GC0A 3DL3A 3LWCA 2PI0A 3BU7A 4XF0A 1IF1A 4Q0VA 5J8FA 4GULA 3KFWX 1YFYA 4LK0F 2EJRA 1FPQA 2OPKA 2Q2EA 1UPIA 1Q5OA 4KDPA 2FU4A 1TW3A 5I8YA 5KK1A 4O9GA 3FJSA 2Q30A 4MV2A 2V1XA 5L3CA 3J80Z 5K5RA 4OIPF 4S04A 1IW7F 3HRTA 1TLHB 1FOKA 4ZU5A 1TQMA 2HOEA 4WF2A 1DGRA 2K02A 3CUQA 2R3SA 3SHFA 1T2KA 3KP5A 4P9FA 1LEBA 1X82A 2F5EA 2H94A 3F8BA 4MGRA 4NHJA 1IN7A 3L2HA 2LF7A 1FNNA 1FBUA 3F8CA 4I0AA 3Q5FA 3P9KA 2XLAA 4A12A 4IF4A 4HA8A 3IBMA 1ZZ7A 1DZRA 4IEQA 1U5TC 3EDPA 4NB5A 3HRMA 3ULQB 4MH0E 3I4PA 2Q0OA 4ETSA 1GVJA 4P55A 1GXPA 2PYTA 1SQ4A 4LLGF 4MEYF 3T1BA 1Y0UA 1DP7P 5E1XA 2D5HA 1NHAA 3GEZA 2P5VA 4I3PA 1SMTA 2V1DA 4GGGA 4A0ZA 3J7AO 2HKOA 4UHTA 2H6BA 2FEZA 1NE4A 4EJTA 1J0RA 1ZHFA 1I1GA 3H7JA 2UXNA 4G6QA 2VBZA 2HEOA 2OQGA 5H6RA 1ON2A 2HWVA 1O57A 3TOAA 4CXFA 1Z05A 4L9JA 2QUFA 3J80K 2A5YB 4R79A 1YFUA 3N4MA 3ST7A 2Z99A 3K2ZA 2QCSB 1D8JA 2BNMA 3BPVA 5BXXA 2HYGD 5BPIA 4PGGA 1IN6A 2NAZA 2MLGA 5DCMB 3EO6A 3RI4A 5BQTA 3LSTA 4MZUA 1HXDA 5HS8A 2WFPA 4DNCA 1KU3A 5KHJA 3PNAA 1CX4A 4IXAA 1ZYRF 2IRFG 5FFXA 5FO5A 4RB2C 1ZVFA 1QZYA 3I5UA 5LRSA 1QBJA 2PN6A 4IRHA 2ZMEA 3DFGA 4LA2A 2QYOA 1FWZA 2XRNA 4JTNA 1UCRA 1WWXA 2K86A 2V1UA 2XASA 1UW8A 4UXNA 3KLNA 4LGWA 4BAYA 4XF1A 4WXDA 4XETA 2STTA 1ULYA 3BOQA 1TW2A 2EAAA 2Q4SA 3KZZA 1YFHA 4L0YB 2FBKA 4HN0A 5JHUA 4KWLA 3KSCA 2DI3A 4LB6B 3I71A 2B8MA 3B02A 5I8TA 4PGHA 1SD5A 1YTYA 5CU1A 3CUQB 3SCGA 5LLQA 1J1LA 1LRHA 4KUMA 3R0AA 2IXJA 2EV5A 1X3UA 4BIFA 2VOPA 1W7PD 3MCZA 5BS6A 2PJPA 4HX7A 3ETQA 1R23A 1OMIA 4RAZA 2EFWA 3ECOA 1HW1A 2PTMA 5D5WB 4HBNA 2QVOA 1FBQA 1XCVA 1R00A 5HDKA 3WU0A 2XUBA 2IW5A 2PFBA 4MGYE 2YPRA 4WZCA 5JSOA 1RUNA 5DYMA 1OYYA 3HYIA 4Y15A 2VBXA 3RPUA 4HAMA 5KHGA 1Q1HA 4CO8A 3UKVA 4G94A 2P7VB 5HLIA 3FM5A 3VHRA 3I54A 4A6DA 5ED4A 2DCTA 4ZU4A 2L01A 1ZGJA 4FX0A 5LBQA 3CL1A 4HDVA 1J3RA 6PAXA 2ACJA 4Q0PA 1KA8A 1FYLA 1OD5A 2EFNA 3IKVA 3SQNA 2HFHA 4I98B 4HBLA 4M73A 1PP7U 4IERA 2MC3A 1XD7A 3HTUA 1NXMA 4MNUA 2KIFA 3L00A 2HYFA 3LA3A 3RYKA 4MGIE 1U78A 3E6DA 4EM0B 3GFJA 4YNIA 2STWA 1WSUA 2EA7A 4MGZE 4Q0SA 4Q0QA 5TJJA 2P6SA 2A68F 1OYWA 3JAMZ 1ZREA 2E1CA 3NSTA 1LDKB 3WTWC 4MHGA 1T38A 3ABUA 2ZNZA 1EV7A 4NQWA 4PDKA 4XLNF 4KMFA 1QNTA 2K7LA 2DQRA 2OZ6A 1Z91A 1R36A 2LDUA 4UV9A 2BGCA 2K4JA 3C18A 3OV8A 4ZU7A 4MX3A 1K6OA 4M71A 4ZZDA 3F22A 4IEVA 1OR7A 5CYVA 4IEPA 2FMYA 1EH6A 2COMA 2MBFA 4YFXF 3NVCA 4EGYA 2EV0A 5FFZA 2IXIA 4UVAA 3LFKA 5DD4A 3BDDA 3BJAA 3M7GA 4Z2YA 5D1IA 3FM3A 3H50A 3BY6A 1R5HA 2GA1A 1DGWA 4Y17A 4UBGA 1LVAA 3D0JA 1SMYF 3FMSA 3CO2A 2WTEA 2A3SA 4MQ9F 1Z6RA 4ENKA 4XF3A 3KEOA 1J3PA 4U7BA 1TQIA 3BROA 2AS5F 1ZLJA 1SFEA 5BPDA 2XIGA 2CGPA 5F1RA 2VPVA 3D0SA 5EEGA 1BI2A 1FYMA 3DPLC 2JT1A 3RKXA 5LGUA 2FXAA 3W6JB 1F5TA 1BOAA 4OU0A 4IPAA 2KXLA 1SD7A 2ISZA 2FQPA 3L2CA 3HOSA 4RAYA 1LDJA 2ESNA 5LEJA 5FB2A 1S6LA 1TQPA 3HHHA 3SZPA 1ON1A 4R52A 4MTEA 3IRRA 4YIIA 1X8MA 4LK1F 3ACLA 2KJCA 4B09A 3FHZA 2M30A 4Z82A 1FLIA 4ESFA 4BNCA 5IT9K 1BI0A 3FF5A 4IHSA 2GIVA 4EJOA 2JRTA 3CO7C 2GXGA 2NS0A 3HOTA 1Q43A 3CDHA 4HQEA 2IXLA 1K79A 1T98A 1EYBA 1YFWA 5ICFA 3NQOA 3WTTC 1TNTA 2DT5A 3FWEA 1XDUA 4QXKA 4FT8A 1K78B 4KU8A 2IT0A 2GU9A 4KWJA 4A6EA 3PFIA 3WTYC 2C0ZA 4AXOA 3M8FA 4Q48A 5BV6A 4EROA 2HZTA 1KQ9A 5EZWA 1MJAA 1ZZBA 4S05A 2IXKA 1ZZCA 1XSVA 1ZAOA 3K1PA 2Q1ZB 1ZRRA 3KGZA 5LRRA 4LB5A 3B73A 3FZ3A 4A0YA 2IXCA 2NRAC 5LEKA 4YFKF 4HVOA 4HVRA 3T8RA 4Z07A 1D3YA 2H09A 3H1WA 3RNSA 2QWWA 2KKOA 4META 3GFIA 3WE3A 3WTSC 1F9NA 3DXJF 3OGJA 4YFNF 3QP6A 2HS5A 4O6JA 1DPRA 4ON0A 4KN4X 1HW2A 4G7HF 2F4PA 1KQ8A 2Q0AA 5HVQC 5JR3A 1IN8A 1DZTA 2FA5A 2RNJA 4AQ6A 1QO0D 2XHKA 3I59A 4J1WA 3JSOA 3L09A 3MFKA 1O3SA 3RKWA 1OYIA 2RVCA 2PMUA 4AIKA 3P9CA 1FXZA 2O03A 3K69A 4LG0B 3BPXA 5K1YA 4RB1A 2VC1A 3TKYA 3CUOA 2Z9OA 4QMAA 2QENA 5DV5A 5DCMA 3E5UA 1XB4A 3LAJA 3WW2A 5JSPA 3QPTA 4D0PA 4IRGA 1ZARA 1HSJA 5I8SA 3GUDA 3RDIA 4K2EA 2B9UA 2D5FA 2W85A 3USSA 5CADA 5K5OA 2OQRA 3H92A 2KRFA 1MJ9A 3O14A 2UY8A 1IUYA 5EEHA 3ZMZA 2BBYA 1VTNC 2Z69A 4RGUA 5J8CA 2XGXA 1B9NA 2ET7A 3O2PE 2FQ3A 2E9QA 1U6GA 3E97A 3ZPLA 2K0GA 4OINF 3BALA 3HIFA 1O7FA 5ILSA 2IC1A 3MWMA 2M45A 2YSRA 3HUGA 2PQQA 2UWMA 4IEZA 2Q8KA 3WODF 3KGLA 1Z6TA 4M6YA 2QM3A 3O3KA 3QP5A 3D5LA 2A6EF 3WGGA 1RTVA 2DBBA 4BHCA 2VN2A 4BYYA 5D5VB 4QX5A 2YR2A 4FBFA 1ZLKA 3U1DA 3QU3A 1KQ0A 3T0YA 4L9NA 3HT1A 2A6HF 1P6RA 2DU9A 5KHHA 3Q9SA 3ZMUA 5C6CA 4LTAA 5JFRA 5FDBA 4WXHA 4RB3C 3PQJA 5ILVA 2OZJA 1YQAA 5E16A 1W5TA 1RI7A 3U0ZA 1PMIA 2E7WA 3RKYA 1O3QA 1J2XA 4OMZA 3EETA 4LLLA 4XFAA 1ZX5A 1YW7A 2V9VA 3WG9A 1R22A 3ZMVA 3EYIA 4L5JA 4EWEA 2LSOA 4M72A 5AIPA 1YW8A 5T3NA 2LF8A 1FSEA 4LULA 1YS7A 2HGCA 1UIJA 4QLCU 2FSWA 3NRVA 3I59B 1PM7A 3GVAA 2VBWA 4RGSA 5BUVA 2MD5A 4M74A 4WK8F 4RD7A 4YYOA 1IXRC 1S3JA 1HBXG 1XGMA 3OOPA 4I02A 4L2NA 2OU2A 1MD0A 2D1HA 3ZN0A 4HV6A 1XSDA 2OBPA 2CAUA 2XAQA 4X6QB 2K4BA 2A07F 3EQEA 4IEWA 2L02A 2QQAA 3IWZA 3V8JA 2ZXJA 2FBIA 3GBFA 1USSA 1FSHA 1BI1A 2BEOA 4KFCA 2QQ9A 4U0VA 2XAFA 3CLOA 3BCWA 4U0WA 3O6BB 4IEXA 1G3SA 4OLLA 4WX9A 3VOEA 1KYZA 2I45A 4B8XA 2H6CA 4OMYA 1NE6A 2QJVA 2PLYA 4H7LA 2UYBA 4A2UA 1LDDA 1U5TA 4H0EA 1EH7A 1BIAA 3WE2A 2Y75A 4LEJA 2Y48A 4CDGA 4CICA 4KMUX 2C6YA 2GAUA 3IL2A 3F8MA 2L4MA 1RNLA 1FT9A 4OIQF 1KU7A 1UHWA 5I0UA 3SFZA 1CF7A 3Q9VA 3TO6A 2CFXA 3TDZC 1DDNA 3RZZA 1T39A 1XE8A 5ICCA 5I0RA 1UFMA 3TO7A 3IRQA 4WBBA 1QZZA 2PAKA 4KU7A 2D40A 2VT3A 1B1BA 4U88A 5D6EA 3QRFF 4PIZA 2ETEA 4EWAA 2NNYA 2P4WA 5AIQA 5L3DA 1XE7A 1LB2A 1IRGA 2PBIA 2VC0A 3R4KA 2NNNA 4KN7X 4E2SA 2O1QA 3JZVA 3GYDA 3FHIB 4A5NA 4RGXA 2RN7A 3NJZA 2A69F 2E1NA 3SCHA 3DQVC 1QWRA 4E2GA 4XFBA 2D2WA 1CAUA 2G9WA 2XKPA 5L3EA 3TO9A 3ZP5A 2QVSB 5FLIA 5I0TA 4WVZA 2BYVE 2PMHA 3EYYA 3E5XA 3H3ZA 5ERIA 3GFMA 2W25A 4NVPA 1I5ZA 4WCGA 4I01A 2O3FA 1NYWA 1KYWA 2BV6A 3CEWA 5BMZA 1Y3TA 1QXJA 4IEYA 4FAGA 3PQKA 3OD0A 4P9GA 4N9IA 2M87A 2FNAA 2DK5A 3IHUA 5J48A 2JPCA 5L3GA 2MH2A 4HSJA 5KBFA 3IC7A 2PEXA 4ZYDA 4EM1A 1ZRFA 3V8LA 3ZQ7A 3HQXA 3ZDSA 2Z3YA 4ENJA 4BXUA 2RGVA 1K78A 2V6CA 2D45A 3F6OA 4Q4ZF 3U11A 1T6SA 3GXOA 2W84A 2B0LA 5CVRA 4EM2A 1CAVB 5HDNA 5TRDA 2XVCA 1AOYA 4ENMA 3FFQA 4F8AA 1YO5C 3MDPA 3DP7A 3SCFA 2CV6A 2ZBKA 2ZCWA 2MHFA 1R1UA 1U5TB 2J5OA 5BPXA 1S7OA 3OF1A 4HW0A 4DINB 2EVXA 3ZMTA 5HS9A 3HRSA 1XCBA 1HKTA 3AAFA 1P2FA 1X7NA 1FP2A 5KVRA 1V70A 1Z9CA 4ZYHA 1ZG5A 1ODDA 2A61A 3V4GA 1CF7B 2DQLA 3U2RA 3WGIA 3MAJA 4HLTA 3BPZA 5E1RA 3RYPA 2LKPA 3IDBB 5FPXA 3L7WA 4QM9A 1WRJA 1TBXA 3TQNA 1ZGAA 3F3XA 4JK1X 2ZKZA 1IN4A 3KMHA 2DTRA 3RTRA 1EP0A 4Q47A 4AVBA 1GXQA 4UNOA 3MEXA 3ES1A 5D8KB 4GCVA 3JAMK 1K7AA 5F64A 2KIUA 2VONA 3GFLA 4YIFA 3WW3A 3GW2A 5D4RA 1IAWA 4Q0UA 5JR7B 1MGTA 1GHCA 1FY7A 1Z1DA 2EWNA 5DEQA 3DV8A 3GZ6A 4L11A 2ADUA 4LG0A 4P96A 1XGSA 3KETA 3FXRA 1CAUB 3IIAA 1V4RA 1Q3EA 3U10A 2AXLA 3DKWA 4AD9A 3KZYA 3E3VA 2W24A 2O6GE 2ZKLA 4Y13A 2P17A 5FD5A 2L3DA 5LHIA 1ZRDA 4KT5C 5IT3A 4EJWA 3DPTA 1HSTA 4ESJA 2MLKA 1L3LA 2JPBA 2EFQA 4MUVA 2XAHA 4ONUA 4O5VA 4GYIA 2GH2A 3OTFA 2BNOA 3PLQA 3DF8A 4CHUA 4KL1A 2GA2A 2FF4A 2J5PA 2W57A 3I58A 2N7GA 1EY2A 3F23A 3GLXA 1TNSA 1O3RA 3LQRA 1J75A 4KICA 3CJNA 4JV4A 1QXRA 4KYWA 4HLYA 2DAOA 2OA4A 3WW1A 1G3WA 4HQMA 4IRIA 4M9SA 3T5XA 3EQLF 4HX4A 4RB0A 3LAPA 1CAXB 4IJAA 1RGSA 1R5GA 1TTYA 1MJBA 4HDUA 3F8FA 1RIOH 3FXUA 4OIRF 3CO6C 1EH8A 2XAJA 3EHKA 4A5MA 4HZFA 4Q29A 5I93A 1U12A 1H1MA 1JHHA 1SEFA 3ML6A 3FE5A 1F1ZA 1KU2A 5DUKA 1YFXA 4AVPA 2DW4A 3I53A 1KU9A 2DPUA 2Z2SB 1LEAA 1WI9A 5FQ0A 3VEPA 4YSFA 2Z33A 2BE5F 2PHDA 4UV8A 2O0YA 3J81Z 1H9TA 3IWFA 1W7PB 4G7OF 5KHKA 3JTHA 4FX4A 1CAWA 4UBHA 5JAXA 3F21A 4EMSA 2M5WA 3ELKA 2LNBA 2D1VA 4XBFA 3WGHA 3IKTA 1CGPA 1I1SA 3FMRA 2UY9A 2DPDA 1FC3A 1L3JA 2FNPA 2QNKA 2IA2A 3ECHA 3ISPA 4L5IA 3PVBB 2L54A 1B9MA 4KNYA 3WTXC 3MZHA 3MZYA 3GZ5A 2WV0A 2FBHA 1LQ1A 3U9GA 3H1MA 1BI3A 4OFGA 3BP8A 3FX3A 3SHRA 2HQNA 4ASNA 1BM9A 4IHTA 4A0XA 3S0MA 3QACA 1UD1A 2VOOA 3TNQA 1XGNA 2IP2A 4L18B 3SMHA 1W5SA 4HMZA 2WC2A 4IEUA 1B4AA 5E1WA 3DEUA 1UIKA 2GC2A 3DN7A 3KP4A 3KCCA 1LNWA 4HYEA 1OFNA 2RC4A 1QQIA 5E8GA 4XRFA 1XGOA 3K1NA 2EB7A 5FLJA 3F6VA 1O5UA 2OA2A 3OCPA 2CSOA 4KIBA 1P4WA 3RYRA 2NYXA 1HW5A 4HV5A 2HR3A 3R60A 3GO5A 3G7DA 1FP1D
chains in the Genus database with same CATH superfamily
1VIWB 1G3YA 3M8EA 3K3OA 1I1EA 3OSGA 4Q2FA 3EJKA 3BKZA 2CDPA 3UT0A 4LMYA 2VECA 4JRLA 4N9HA 3TBDA 1P7IA 2ZZQA 4CUAA 2GP3A 1I27A 5IP6A 5D6FA 4FE4A 2CQXA 1XN7A 3N3HA 5K9YA 1TEIA 4DB5A 1ND2B 2WZR2 1D2SA 2WAEA 2XKOA 3I9V2 3IIIA 2DMUA 2BRTA 2ESHA 4V2FA 5EZHA 1JTXA 2E1OA 4K20A 1JU3A 1CJDA 1JHFA 4XQFA 3HOZJ 3GTKJ 5FQ0B 3C7JA 1JI6A 2ZGQA 2OAZA 2XBO2 5F0FA 1MR5A 5IYBJ 3QODA 5L7OB 4Z1VA 3HB9A 3L9JT 2KL4A 3WLUA 4KNCA 1KGSA 3BJ6A 3D82A 4ZDPA 4QHBA 2QF7A 1U0AA 4Q4V2 2UUZA 4YG0A 1REFA 3GZAA 1RUG1 1H1IA 4FVVA 1OC1A 1GFF2 1PVXA 3K51A 2VL8A 4BH9A 1F4HA 4EWDA 1MACA 1H2LA 3RIRA 4JX6A 5FYIA 1PGL1 4AVZA 1O3TA 1QJY2 4ZXEA 1S0EA 5HDGA 4UVBA 1W6OB 2WS93 4J01A 1B59A 5FY1A 2BFUS 2Y64A 3VODA 1Y43B 5C9AB 3VN4A 3OR2C 3I56I 1E3PA 3BJOA 4XSXF 2GNTA 2O8QA 2IS6A 4DQ2A 5DCFA 2L9RA 1U3EM 4QGNA 2YX7A 3BWGA 5DAXA 3V64A 1R58A 3V7CA 4UF0B 1RUI1 1HN1A 2VQAA 2NS7A 1UHMA 3LDRA 3VBUC 2ZAAA 3JRHA 2PHUA 1CR7A 4ZYGA 2A3YA 2VVEA 4NAMA 2HTJA 3CJRB 4UVCA 3THPA 4AR2A 2Y0SA 1QPMA 4CZCA 3K0LA 4Q4X1 3IPVA 5B66C 5E3MA 1UKRA 1C0WA 3AKTA 3A7QA 2QQOA 4AHZA 1QIQA 1DQ4A 1IZ1A 3I97A 2FRHA 1BLZA 2Q8OA 3ALQA 2KMUA 3DTEA 2RR12 3BR2A 3REOA 2PG4A 2RS51 3AG4H 4OQ9A 5E8IA 1QRYA 2PAEA 2FCUA 1RL3A 2PA7A 3BQYA 2DMQA 1FNYA 5LD2C 2EFPA 1R1ZA 5A33B 4F93B 1D1CA 1K12A 5JSRA 5DUIA 1LVKA 4L9TA 2YBKA 3RJ2X 2BGOA 2YU3A 3NEUA 1QMJA 5ERLA 3KT1A 3V7SA 1BMV1 4PZJA 4HF2A 2O8OA 5FPVA 3CF6E 1COV3 3AZWA 3G3ZA 2R6QA 2W48A 5DPNA 4OUMA 4AIHA 2MNGA 1TZLA 4BXFA 3POFA 2DO7A 3WQ7A 4J19A 4NPRA 3U07A 1DDLA 4TLFA 3TP3A 2KIQA 2V4VA 5AVPA 3OEAA 5K8SA 3VB2A 3RWNA 5CZKA 4BJ6C 3JR9A 3PVOA 2LBFB 4DGWB 1ND3B 2ZJ2A 1R1TA 2Z79A 5FLXZ 4A45A 2VMGA 1YWKA 1MSEC 1OPMA 2VNRA 3MKYB 4CPBD 4CRQA 2EA4A 3ZN1A 2V26A 3D1NI 3ZYHA 1U2WA 3M3CA 1D8KA 1ACIA 2SLIA 4EV0A 2JE7A 1HDPA 1YW9A 1GQHA 3FMQA 1ETQA 5ABJC 5JMCA 2FUG2 4IV3A 2CO5A 1PMHX 1LTEA 5HCHA 2EFOA 4FOQA 5BNPC 2KDOA 2ZMEB 5HCFA 3SITA 4PFOA 1QOTA 2M8EA 2WUHA 3OY8B 1ASJ1 3I7DA 4LIUA 1L0OC 1WW6A 2RKHA 3NW4A 3O1UA 3EUHA 1PO11 2CWEA 1IXCA 4E7ZA 3HSRA 1JGGA 2W08A 3TB0A 3WDYA 1QGPA 2DA6A 1OOPC 1W7PA 4HX8A 3ZR8X 1EPZA 3AK0A 1LULA 5AONA 4P9UA 5FROA 4IESA 1YIFA 2W1UA 3TNPB 4JC1A 3W3CA 4LJHA 5IVVA 1G3TA 2NN8A 3TN93 1MDMB 3IT8A 4R9DA 4LFUA 2W00A 1VBE1 2WADA 4IEJA 2RM22 3HWJA 1LESA 2MPFA 4P5OA 4SBVA 2LLKA 4WM7A 3BZKA 2X4HA 1AX1A 1VR3A 4W6XA 5GAHJ 2I10A 5IK7A 1LJ9A 2EV6A 2AYHA 1BC7C 2ZMNA 4BE2A 1HIXA 3U4XA 2QEXI 3A0NA 3KP3A 4KT6A 4JGZB 2ORZA 4Y1YA 3E6CC 1FAYA 4L9VA 3SISA 1HQCA 3I3BA 2O5RA 1QQP3 2AGSA 2KRCA 1EV12 1SZBA 2HPIA 3JCUC 2GC1A 4FFGA 4R1HA 2B63J 1E0EA 3WNKA 3TGNA 4FHTA 4XF9A 1DYPA 5CKNA 5ABJA 3LA2A 2NP0A 5KHIA 2Z1DA 3UJQA 1GVDA 1OCOH 1B72A 4AZZA 1W05A 2VE8A 2JECA 2OVUA 4BPZA 5LHHA 2B46X 4LK6A 3LA7A 4RM2A 1N1TA 5C8WA 2IGOA 5H20A 5JVTA 4FAHA 1J9IA 2DFCA 3PTYA 2RDNA 5C70A 1XMKA 1OOPA 3MPBA 1WMDA 3S3NA 2B5HA 1J59A 1F36A 2HTSA 4FP3A 3O1OA 4BQ5A 2Y0MA 3IDEA 3UKNA 2AENA 3JXSA 3WG1A 4RS5B 2DK8A 1QH6A 1HRV2 2Y0SN 5FLHA 3AYEA 4YG3A 1XXNA 1J58A 2XONA 3WCSA 3VWBA 1XPWA 4Y1VA 1FPN2 2E7XA 1XMAA 1W99A 1FOYA 1W0UA 3P5JA 4D6QA 3KE2A 2WNOA 3RI9A 1ETOA 3WD5A 3FXQA 1G59A 4TV7A 4KIFA 4AGVA 1POGA 4PIYA 4ZZLA 1EJ9A 3CMMA 4LR4A 2RVAA 1V3FA 3VSKA 4NAOA 2QQBA 3DKYA 3CUQC 3C2HA 1YJKA 3CCVI 1AR83 2ZABA 4FFIA 3DU5A 1R1VA 3GBGA 1GSLA 3HC7A 1ETXA 3A0KA 4AYUA 3KEQA 4NRPA 4LO7A 4AEDC 5A1LA 1STZA 1RUG3 1OD3A 3ROUA 1WKMA 1I9RA 1W6OA 3WU1B 3W6KB 3BVCA 2Y69H 4GXOA 2RS11 2KZGA 4GO1A 5A2QK 3ERED 1BHGA 2DBIA 2F2EA 1UJ8A 3CF2A 2RR11 1WH7A 1CQTA 1FOXA 1HOMA 4ES9A 1VJ2A 2FMLA 4C90A 2ZX0A 3A22A 1LOBA 2F5DA 1UOGA 4XJZA 3M4FA 3T8TA 2K46A 3J81K 1RUOA 5EV7A 4M3CA 3K2AA 5HLHA 3P7NA 3S57A 4RFRB 1R9TJ 2VUJA 1NY71 1RUE1 3QU6A 2MH9A 3C1DA 4QKFA 1FBSA 5CAZA 1D4VB 3DL3A 5GZCA 3ITQA 2PI0A 1IF1A 5J8FA 3BTZA 4LK0F 3VV1A 1FPQA 3M8LA 2VCMA 1UPIA 3KHBA 3DLLF 3CHXA 3ZGKA 3CDLA 1DQ1A 3S17J 2MD0A 1XSRA 5KK1A 4CU7A 3CCRI 4AQSA 3J80Z 1JTYA 4OIPF 2VMIA 4Q4Y3 1VQ6I 2QQWA 3QH7A 3WSOA 3CUQA 5A3TA 2BVBA 1PIV2 3SHFA 3GDBA 3PVNA 2F5EA 1BXHA 4AFBA 4I0AA 1FBUA 2JB8A 4IL7A 2VJJA 5A33A 4A12A 2XJQA 2KP6A 4HA8A 1OBNA 1ZZ7A 2RS53 1LHNA 1OJLA 2E7TA 3ECQA 4PQQA 2WFF3 2WNVB 2IZWA 5F37A 1Y1WJ 2Q0OA 4ETSA 2IS4A 2LR8A 4RGAA 2CNAA 3TAYA 1VRH3 4OI1A 2FD8A 4GB31 4LBJA 3WOGA 4XTMA 4AI0A 3LD8A 1H4GA 4V19K 4JGYC 4I3PA 3ZXDA 5C5UA 4P5HA 2H6BA 1IG7A 4EJTA 2L0KA 5DM6F 4PF1A 4W4ZA 2UXNA 3KZ4C 5LASA 5JLXA 1Z05A 3THDA 2WY8Q 4A3MJ 1EUUA 1OLTA 2A5YB 1FMWA 2WT1A 4FPEA 4L92A 3S1QJ 3RJRA 1YFUA 3HR9A 2HWE3 3HQRA 3BPVA 5FYVA 5BXXA 2HYGD 5BPIA 1DU3D 1LU1A 4X8NA 4GA9A 1A36A 3EO6A 5BQTA 1HXDA 1XE0A 4C2TA 4GXLA 2ZGLA 1CX4A 1ZYRF 3H8XA 5E89A 4RB2C 1OQDA 1ZVFA 3I5UA 1LGNA 3C7FA 2VUDA 2PN6A 2ZEYA 1W8WA 2ZMEA 5C4JJ 2WO2A 3DFGA 2DN0A 4LA2A 3OY8A 5B2GB 1FWZA 2XRNA 2K86A 3H42B 2XASA 2GM4A 1X1CA 1UW8A 1IS3A 4LGWA 4JDNA 2LD5A 2DTYA 1GWMA 1UU5A 3BOQA 2BFUL 2VQUA 4BISA 4UW3A 4L0YB 3KSCA 4LB6B 1XPXA 3I71A 1REDA 3B02A 5I8TA 4EN8B 4PGHA 3D6EA 3HJEA 1K6YA 4A3DJ 3JRIA 1APLC 2CTVA 4E4HA 1K5MC 3GTOJ 3CF5F 2PMZA 4XIOA 1ZR2A 3RQIA 1D0ZA 5BS6A 1W0PA 1SACA 1IV8A 2WYSA 2E7AA 3MBWA 4LE3A 1VBE3 1OR7C 5D5WB 4YZ1A 1R00A 2KFDA 4JX0A 5HDKA 1ODMA 2XB0X 4OUEA 2XUBA 1Z0HA 4JGZA 2D43A 1PNFA 2X09A 4LOCA 2JA7J 2XH6A 1A6IA 2VZQA 2ES3A 1WPKA 4AQTA 2K2SA 1HRV1 2QKMB 1LAJA 4IOAF 4YW5A 3I54A 2L01A 2O14A 5HPOA 1H88C 4CCEA 2P6HA 1FYLA 2EFNA 2EILH 1FPN1 3SQNA 2VU9A 2Z4FA 5LK7B 4M73A 2DCKA 3OL4A 2VZUA 4IERA 2MC3A 1GNZA 1XD7A 2KT0A 3HTUA 4AVSA 5DDJ2 5C5TA 3BLYA 3ZSKA 3L00A 1MS5A 4C1WA 3LA3A 3RYKA 4DYQA 1ZA7A 4A7ZA 2Y30A 2YFZA 2EA7A 5C4WC 4MGZE 4Q0SA 1A34A 1X9TA 4CEYB 2BVLA 3WY6A 5K7PA 2A68F 1V6MA 2WAOA 4E9KA 4W6YA 2CJJA 2E1CA 1RUF3 1N3QA 3BODA 4W97A 4RS5A 1T38A 3KEYA 2ZNZA 3I2OA 1TG7A 4PDKA 1R5ID 1A3KA 3ZQFA 3SLIA 2LMDA 2HWB2 2YU2A 1U5YA 1W2UA 2YDEA 2FDHA 4KG0A 3WZ1A 4UV9A 1IPSA 1WGXA 3ZQHA 2D7FA 3PUAA 2VGDA 1RMU1 3ENRA 4MX3A 3CD6I 1OR7A 4IEPA 2FMYA 3ZFGB 3S5AA 5DAWA 4IOCF 1GUUA 4RGGA 3JB4C 2COMA 1Z7S2 4A3JJ 5C71A 4EGYA 5F3IA 2P0WA 2IXIA 1JHNA 3M7GA 3IP4B 4Z2YA 4M3EA 4N8MA 1R5HA 1DGWA 4Y17A 3K4ZA 5K7HA 1LVAA 3D0JA 1SMYF 3FMSA 3CO2A 2WTEA 5HV0A 1AYM3 1W8NA 1VZ0A 2W47A 2ARAA 3MO4A 4HK8A 2WT0A 2ZJRF 1TMF2 4MO3M 1N1VA 1SFKA 5FMBA 1E57A 2D3SA 4KBZA 1WCDJ 1V5FA 4IHXA 4PDWB 3D0SA 2Y34A 1RC9A 2UU8A 1BI2A 1FYMA 2J7MA 2DTWA 3H5NA 1ENXA 2L9VA 2GSYA 3RKXA 5EP9A 2RS13 1BOAA 5C4WA 3ASNH 3B93A 4NNJA 2YPDA 4ITCA 4RAYA 1LDJA 2XJUA 4J25A 4G4FA 1ON1A 4WZFA 4DBQA 1XBFA 3BPSA 3E1F1 4BU2A 3WINE 3WNOA 3VBUB 5JPMB 4AIDA 5C3RA 1F5JA 4B09A 1UF2C 1UKGA 4GWNA 5IW0A 5IT9K 4BNCA 1KXGA 1WCSA 4EJOA 1G8XA 2CQQA 2NS0A 5L9BA 3CDHA 4HQEA 1K79A 4TWTA 1YFWA 1RUE3 2Y31A 3NQOA 1MS4A 3RSNA 3SJMA 4NJ4A 5FJ8J 1JODA 4CCKA 2VZRA 2GU9A 3I2IA 3ZSMA 4A6EA 4RAFA 1LHVA 2L7MP 3P3NA 3HBKA 3WTYC 1BKZA 4AXOA 5KAFC 4Q48A 2HQ5A 4Q26A 1X3WB 2QKDA 3PMEA 4YVSC 4EROA 4UOJA 2JMWA 5EZWA 2WL1A 2MSYA 1WJDA 4WVMA 1R082 2XVGA 3K1PA 2YZ4A 2Q1ZB 3PIOF 1NG7A 3DYPA 4N43C 2WNVA 2IXCA 4FOYA 5LEKA 2YXSA 4YFKF 1MBJA 4HVOA 3T8RA 3VBOC 2JKBA 3WP5A 3HNBM 1BR1A 3NNFA 3QYFA 1W36D 4L9BA 2KKOA 4AYBA 2VI6A 2JVGA 4BK4A 2PMZN 3WE3A 4YW3A 2RREA 1OCPA 5FV3A 4GB33 1VBD2 1KQ8A 3WXPA 3AZZA 5JOXA 5F3CA 5HVQC 1IN8A 4EN6B 5KR7A 4NHKA 2VD7A 1ZRIA 2RNJA 4AQ6A 3KVBA 2QE3A 2PLV2 4JHZA 3OYFA 4CA9A 3GCWA 2VH9A 1YIJI 4V2VA 2O03A 3K69A 4Y52J 3ZLIA 1EPWA 2DU0A 3BG7A 2R0QC 1E5SA 5K1YA 2R072 3W2VA 1W6QA 4QMAA 2L9NA 4M6VA 1RPWA 3O1TA 1FMVA 3MW2A 1NLSA 3LCPA 4IE7A 4B8EA 3Q8BA 2M0CA 3ILNA 5KC5A 1V9U1 1GZTA 1H2KA 5K5OA 2OQRA 2JDUA 4BK5A 3P6BA 5BNPB 3TRSB 3J4UH 3C2GA 4AI8A 3VHNA 4WM8C 1QHGA 2Z69A 2E5ZA 5CFCC 4HSTA 4XMIA 1JHJA 1B09A 3BG3A 3I3DA 5FKOA 1GZWB 3K4KA 1U6GA 2LROA 3ZPLA 3RWKX 1JYXA 1ZBE2 4NOTA 4XJ8A 4N43A 3PTRB 1EAH3 4XLAA 1K83J 2ZFUA 2Q8DA 1H8AC 2M45A 2VJ5A 2Q8KA 4E7IA 1W06A 2LY1A 4M6YA 3VBOA 2NYYA 3D5LA 1XQNA 5A7QA 3W59A 3WGGA 1OISA 4BHCA 2VN2A 3WQ1A 3A1YA 3PL0A 1SG3A 5D5VB 4B3AA 3LGRA 2DT6A 4QX5A 3VYUB 2YR2A 1UAAA 4FBFA 4OHYA 5IVFA 3QU3A 5FZLA 4L9NA 2DU9A 1JZ8A 2JRMA 2P1BA 5SV8A 3B6AA 1C1FA 2IBDA 2NZ9A 5C6CA 5FDBA 4YGDA 3UJOA 2HWF2 1N78A 2DCJA 1VALA 3PQJA 5A3LA 3E0JB 1JN2P 1WCQA 3OMYA 2JA8J 3VBSC 1PO21 3FUQA 1PMIA 4MGSA 3CDZB 4CDXC 1ULPA 2LYCA 3MEPA 1X1BA 3EETA 4UB6C 4LLLA 2WIIB 4XFAA 3K4NA 2HWC2 1YW7A 2GXAA 2LC2A 1OURA 4XIDA 2IUWA 3ZMVA 1QJU3 1YRZA 3TW7A 2YBSA 4M72A 4G6TB 2LF8A 1FSEA 3IB3A 4ITVA 5FXVA 5ANNA 5FZ1A 4A3FJ 1NCQC 3K4LA 2V6EA 4QLCU 2FSWA 1POQA 2CMPA 3NRVA 3JQWA 3I59B 2E26A 3GVAA 2VBWA 4JP0A 3RPUD 2XC7A 1S3JA 2QTWB 1JOPA 4L2NA 1QJX1 2FDFA 1Z7S1 3WCRA 4X6QB 3H35A 5EIYB 2DVBA 3KYDB 3IWZA 4ATEA 3H36A 2VQTA 3OBTA 4S0HB 2ZXJA 4YFWA 3GBFA 4CEYA 5C7GA 2JB4A 3AZVA 3OG2A 4KFCA 2XAFA 2G4IA 4YGEA 3WG2A 3V42A 4JYKA 2RDQA 1S2BA 3E7LA 4YPJA 4U0WA 5E3OA 1G3SA 3VOEA 1KYZA 1H8TC 1CZVA 2QJVA 1ZA4A 3NNGA 3MLKA 2PLYA 4H7LA 2UWBA 4YZ2A 4XZUG 1W6NB 2Y75A 4DO0A 2W82A 2LK2A 2Y48A 3OYLA 4N7UA 4AEJA 4NC6A 2C6YA 1HB2A 3ZQIA 3DEMA 2R16A 3AXDA 5KNLA 4CDQA 2ZX1A 1FT9A 1W3VA 3VBSA 5C3QA 5FBJA 4ASKA 1UHWA 4CDXA 1CF7A 1CQ9A 3Q9VA 1RMU3 3TDZC 1V6NA 3WUDA 3TO7A 3H0GJ 2PAKA 2XOMA 4UYBA 2ZX2A 4U88A 4AEDB 3JD72 2QQVA 2ETEA 3UGFA 1NCQA 5AIQA 2R7XA 2PBIA 3KHCA 2CW8A 2NNNA 4KN7X 3ASOH 5IPAA 1RINA 3JZVA 2H1KA 1S0BA 1UU4A 3HPNA 4RLQA 3H5AA 3FISA 4AYBN 1PVC2 4TTGA 4RGXA 4EYUA 3VD7A 3FDYA 1YI7A 3NJZA 3PDQA 3FIWA 5IAVA 1QWRA 1CAUA 2ZX3A 4PJLA 4BY7J 3J8F2 5I0TA 4WVZA 4TLGA 5M3FJ 4LKFA 3K3NA 2PMHA 1JXNA 4KISA 3H3ZA 1CD3G 1YJWI 1R081 5ERIA 3GFMA 2P5BA 2W25A 4WCGA 3OIPA 2O3FA 4I01A 3MUY1 5EG0A 1W8UA 4PJMA 2BV6A 1Y3TA 1H8TA 4IEYA 3CDIA 4QD2A 3QYEA 2M87A 3IHUA 3ZSLA 2R7RA 5L3GA 2VJ4A 3WP4A 2PEXA 3IAM2 3BOPA 4PCRA 3ZDSA 2B42B 5J96B 2Z3YA 4ENJA 2ZGTA 2RGVA 2JE9A 2E36A 2OCEA 2GOMA 4QX8A 1DZQA 1CAVB 3EMRA 3LSMA 1AOYA 4XUNA 3FFQA 5TISC 4CDWB 4F8AA 3MDPA 3DP7A 3SCFA 2V9KA 1VPHA 1F4AA 2MEV1 2P3JA 2P81A 3HL2A 1WLCA 1Y7BA 5F32A 2R071 1LOFC 3WUCA 2YG0A 3HRSA 4GMP1 5DMYA 3K4JA 1X7NA 1QHDA 3ZFEC 2OW4A 1OA2A 3VPRA 2JUGA 4KMQA 1QVUA 3C2BA 1ODDA 2DQLA 2XAUA 1A78A 3MAJA 3I49A 4HLTA 5LBBA 5FZ0A 2K3FA 3IDBB 4HXCA 4Q27A 1TBXA 2GP5A 1ZGAA 5DZEA 2HNHA 3BCAA 1FMD3 2KM2A 4UNOA 2IFRA 2ZMKA 4GCVA 2Y60A 5JI9A 1ZBE1 2VONA 3GFLA 3WW3A 4JX4A 3ZFFC 1BBT2 3T0BA 1VQKI 1YQ2A 4PBPA 1Z1DA 1T56A 5CKTA 5DEQA 1E3OC 3DV8A 4GWIA 4L11A 3MMYB 2HEYF 1V4RA 2WLPA 2Q8CA 4AD9A 2DDUA 2O6GE 5FD5A 3T4HB 3D5SC 1QF3A 4KT5C 5AFEA 5IT3A 3DPTA 2JPBA 5T50A 1W8FA 4CU9A 4B4CA 5EDNA 1T95A 4GYIA 3GTGJ 5CKMA 1YYNA 1BW6A 4CPBA 4RBOA 1VQ7I 3VKMA 2X6YA 1V9U3 4HKLA 5EYYA 2W57A 1QJZA 3A21A 3HQUA 1R1A1 1NQJA 1GZWA 5FKBA 1EY2A 3GLXA 3SDGA 1J75A 1LOFA 5DUWA 4JV4A 4QHZA 1EUTA 2OA4A 4QT6A 4C8DA 4HQMA 4IRIA 4M9SA 4DQAA 3S14J 3TW6A 5CPRB 4A3KJ 4IJAA 1X3ZB 1ETWA 1R5GA 4DBRA 1K5MB 1O91A 4DIQA 2ZS6B 4LQRA 1RXGA 3WU2C 3VD5A 4XKWA 2VNOA 1K61A 1U12A 1C8M1 1H1MA 1P9QC 3LOCA 2ZJQF 1FV3A 3BTYA 4HFSA 2RDRA 4I99C 3PFYA 4FQZA 3A02A 3I53A 3ZFFA 4CA0A 1VI0A 3CCSI 1VRBA 1UL9A 2VW1A 5IK4A 4UV8A 1AX0A 4QSHA 3J81Z 1H9TA 1W3XA 4G7OF 5F6KA 1F15A 1UHSA 1TC3C 1XYOA 2ZTNA 2Y6JA 1Z21A 2VVFA 4NO4A 4FX4A 1CAWA 1H2MA 1PO23 4UBHA 5DM7F 4FPFA 3I2DA 4D7YA 3TEZA 1CGPA 1I1SA 2CWMA 2DPDA 1FC3A 4AEKA 1L3JA 2GMPA 2HH9A 2JDYA 1QVTA 2IA2A 1JKPC 4L5IA 1SVLA 4W1UA 1B9MA 2YB7A 3MZHA 4A7YA 1MEC3 4BBRJ 3C7OA 1MMAA 1OA3A 1AL22 1LQ1A 4UFMA 2JVHA 3U9GA 5AFBA 5JZGB 1AYN2 2BBVA 2HQNA 1SLIA 2VZOA 3CCYA 4ASNA 1GANA 3JCIA 5B1BH 3TNQA 2VW0A 1QJX3 1Z78A 5F0CA 1UIKA 5CFDA 2GC2A 2GNMA 3KP4A 3FKJA 1NA1B 1LNWA 3OS1A 1FOD3 1OFNA 3P3PA 2RC4A 1RHI2 1XGOA 1XNAA 1O5UA 1LFBA 4YFZA 2VM9A 4RHV3 3OCPA 2CSOA 4KIBA 3RYRA 2NYXA 5A80A 1PVC1 4HV5A 1D4M2 3G7DA 1MH4A 1JKRC 5JXHA 4D69A 4G3YC 2KD7A 1HQLA 4Y1ZA 2A5WA 3WX5A 4AL9A 5D2AA 1SBDA 5BY5A 2YYOA 2WAFA 1ZH5A 1NG0A 2DA2A 1Z3XA 3RS6A 1X8EA 1LHWA 4IE5A 2XL7A 4QX0A 5DAQA 5A7SA 1VBC1 1Y8QB 1LHUA 3BTJA 3FK7A 4FQ4A 4CUCA 2CQNA 3FHQA 1KJLA 2R7QA 4WVWA 3SC7X 2EF6A 5J36A 2PAMA 3ABZA 4LBNA 3GZEA 1R7JA 2A1XA 3USUB 2CGNA 2BY1A 3R05A 1B8IB 3S7EA 4XABA 2RJKA 2A7AA 4E2QA 4ES8A 1QHHD 4YARA 3CCLI 4PBOA 3RGBA 2YGMA 1FIPA 2TBVA 1USTA 4YM0A 4UW6A 2NVYJ 1BEV2 1S0CA 5LA0A 4EATA 4LJZF 1GICA 2AH2A 2UWCA 3MV01 4E7JA 3ZN6A 4RM3A 1D7PM 1RZ4A 1Q8OA 5FREA 1UXZA 3M3IA 1ZN2A 3NARA 2Y2ZA 4LLNA 1VBA3 3WDXA 2P5LC 1JUMA 3K4MA 3UKGA 5FK8A 1EF4A 1SFUA 1WI3A 1C8NA 3MYXA 2DA5A 1E2XA 5GZFA 2K27A 4OI0A 1C57A 1OVPA 2ZGSA 2OUHA 3AP5A 4AAXA 3CC7I 1HV0A 2WINB 5FXXA 2CQKA 4HN1A 5FXZA 5CJ9A 1F8VA 1VMHA 4N0BA 2GMEA 1TWGJ 2V9PA 2IXHA 3T2TA 4A93J 3LQCA 1ZZ8A 1CAVA 1UELB 3BN6A 1UYPA 4Q1RA 2HLEA 2QUOA 1SDDB 2F4MB 4PIXA 3E6BA 5CVJA 1X1AA 1ULEA 3B00A 1IXSB 3AMQA 3O7OA 4XONA 1TME3 3S7IA 2ETHA 3BOWA 4AIJA 4BHPA 1S55A 2XB6C 4XOGA 1AR72 4XLHA 1BYHA 1NOVA 4AI9A 1ZNPA 1GV9A 4NDLA 4CCNA 2RV8A 4GMP3 2ZZJA 1P4AA 2L9SA 3BR1A 1JBCA 5L3BA 2IGMA 5SV5A 2OQ7A 5D5UB 3SEZA 2NMOA 3PUSA 2XLGA 3ZDVA 1U5IA 1RUC2 4RR3B 3LFUA 4KH9A 1TNFA 4XFGA 4DZPA 2E5NA 1SAUA 3V0AB 1BC8C 4QDSA 5FZKA 1LECA 1MZ5A 1DGWY 2OV7A 2XROA 4RQPC 4XYXA 2HQRA 4GH4B 5HLTA 4BMBA 2XVLA 2HU9A 2M4GA 1ZZ6A 2X10A 4YZ3A 1U8RA 1LE8B 2VBBA 1QXPA 1JZ5A 3NWKA 3MI8A 1UYXA 3GZUC 2XAGA 3TL4X 1HB4A 2QSFX 1MQTC 4LLFA 4PLOA 3ZX7A 3NJYA 5A1FA 1IQAA 1L7LA 2O8XA 3CJIB 4TYSA 1HQWA 2WZ8A 5CG9A 5ACA2 2YHJA 1BA5A 1S7AA 2GLOA 5J7MA 2Y6LA 4GYGA 2IS1A 2GZWA 3ZKUA 5F5QA 2EIBA 1WLDA 5D5XB 1PZ9A 5GZEA 1KEXA 2DODA 2XL9A 1OFCX 4HK9A 4QGMA 5DAPA 4D7SA 5F5IA 2Y33A 1OCRH 2VCBA 4CGZA 2XMLA 3Q9OA 4DMIA 2PQ8A 3LAGA 1P7JA 3HHGA 3OIOA 1YQCA 3ZCOA 3VFZA 2E1MC 1DQ2A 2VOKA 1NXD1 3IM0A 5GALA 4UUSB 1W4MA 1QJY3 1Y9QA 4XF4A 3ES4A 5JI6A 2QZ8A 4JDOA 3QQAA 1Q56A 4KG8A 5FZGA 2WO7A 3N9QA 2D98A 4J1XA 1C8M3 5CVVA 1AJOA 4EJVA 3JSPA 3O8GA 2QFEA 2ZA9A 4FTEA 2C4XA 2HVSA 3OYMA 4W6WA 2Z5UA 5TSWA 2ILMA 2CG4A 4HF0A 1MBEA 3DLAA 3POIA 3MW3A 4NRMA 4XFIA 4E4SA 5FLXK 3KWVA 4PLMA 3DXUA 2OZUA 3RSJA 4HF1A 4M3DA 1D4M1 4B43A 2VXZA 5IT9Z 3V65A 4ARYA 4RS8A 2DFHA 2E32A 3F0CA 2RS31 5FD6A 5FCCA 3I64A 3QAHA 4P9IA 2V09A 4ZH4F 2ZGNA 1UCXA 1YRNB 2EA2A 1ZQ3P 3M9AA 1NG6A 1SHWB 2QBYA 2QZ3A 1FI2A 4XQ4A 4YM1A 4IV1C 2FCVA 4AE2A 2PJRA 1G2HA 3GX4X 2ID6A 2FDKA 3S1NJ 4PT6A 2C26A 1SD6A 4JBAA 4M4RA 2EXKA 4PCQA 1NA1A 1IRFA 2D93A 2TEPA 4EEFG 2EXHA 3MGUA 5IFPA 2IA0A 4QPQA 1WKYA 4WXCA 2DTZA 1POV0 4IGPA 1RUH1 1YLLA 4BQAA 4N7IA 4XKBA 2BU9A 2VZTA 4CXYA 2ZKNA 4ZY9A 2CUZA 5BNOB 5FTTC 2VQCA 2VJIA 2RMU1 3HTSB 3LWFA 4CEWC 4TSVA 3MVPA 4AK3A 2H27A 2EK5A 2ELJA 1BEV1 1AKHB 1RC6A 4YRVA 3DECA 4BLIA 2RQPA 1OF3A 1POV1 3DTIA 5EEAA 5J4VA 4ASMB 3BTCA 1AR91 3FXJA 3KCYA 4URTA 3HPHA 1ZYBA 2XVKA 2LUWA 2Z42A 2OF7A 1S0JA 3RQ4A 3ZXSA 2WSVA 1VBC3 5GLTA 3KQ4B 3PNYA 4K1ZA 5DAVA 4XLPF 3ZXGA 4MXWB 1F4KA 3AL0B 3AFHA 1KITA 2PHWA 3USUA 1IPJA 1NK3P 3HBZA 3LEIA 3O1MA 3LFIA 4P1WA 2Y0OA 3CP2A 4NUBA 2EALA 5KC6A 1YITI 4RDUA 2X6WA 1GOGA 1O6UA 4IV1A 3A23A 2BY3A 5KXBA 1LKNA 2GWRA 1SD4A 3RCOA 3JB8A 1MKMA 4UXAA 1ZG3A 4OUSA 1G9BA 1BN5A 1AWCA 4Q4W2 5FWEA 5C8CC 5IVBA 1W90A 1XYPA 1AR71 3AL5A 3VBRA 1P92A 4LA3A 4COZA 5CNAA 1Q1VA 3PUFA 4O7XA 4QB1A 4BIOA 3QD6A 3NWSA 1S29A 5HS7A 1K4SA 2KR2A 1JU4A 4L97A 3K1MA 1LODA 5B3SH 1AXZA 3RRDA 2JE8A 1D5VA 4M3GA 1D5YA 5F6FA 4D5CA 5LGTA 2BVMA 3S3OA 3SZTA 2NVQJ 1IO2A 4OVEA 4UUVA 3SDBA 3J7AY 1AUYA 3LOIA 4ZDLA 1DQ6A 4G6DA 1GWKA 2JUCA 3ZMNA 5H9RA 4AAPA 4XXAA 1UB9A 3MUZ1 3A0HC 5D8AC 1BBYA 2G7UA 5K5QA 3URFA 1PZ7A 3U75A 3OYCA 1AR63 2GC0A 1TVGA 4CYCA 3ZFEB 2G1MA 1VAMA 5FMCA 1GMMA 2A70A 1OF4A 1UMQA 2HBTA 1OQEA 1Q5OA 1VF9A 4O9GA 3W2AA 2Q30A 4ASLA 2ZBJA 5FOJB 4C1XA 1UY2A 1YHQI 2B9VA 5G04L 1TLHB 1TQMA 1COV2 2EIDA 4CDUA 2K02A 3OWTA 2R3SA 2AXTC 4XN0A 1T2KA 1X2MA 1IN7A 2LALA 4LOTA 2LF7A 2WZPP 4CTEA 2JDZA 4YZ4A 3F8CA 3SH4A 2XLAA 3I3LA 1DZRA 1RUD1 1NCRB 2LH9A 5C8CA 3DPRC 4MH0E 4IQ4A 4JQRA 2V73A 1YQ8A 1GVJA 1V6KA 4DXSA 4MEYF 1U5ZA 1DP7P 3RFRA 1UZWA 1UOBA 1SMTA 4A0ZA 3J7AO 3J9SA 1QDOA 2JG9C 1NE4A 4AVVA 1CPMA 3ZSEA 5H6RA 1VBB3 2M4KA 1ON2A 3WNPA 3V0BA 5IOZA 1S0GA 4J6GA 4L9JA 3NAUA 5D8AA 4NPMA 3J80K 4R79A 4LHKA 3THTA 4LBOA 2R041 3JRAA 5FZ3A 3DUIA 4UAPA 5CIRA 3ST7A 3T2QA 2QCSB 3CC4I 1OPOA 5GZDA 2AQEA 3OYDA 2RV9A 1YJNI 1FYUA 3ZM8A 3JREA 4LPLA 5A3PA 4PGGA 4QKDA 1IN6A 2NAZA 4LBQD 5DCMB 3RZMA 5M5XJ 4YW4A 4DNCA 4UUSA 1M06G 3PNAA 4IHYA 4LKDA 2IRFG 4UUTA 1NKGA 1P8JA 4Y22A 4EZHA 4AHXA 5DTDA 3UGGA 1G7YA 1Y9GA 2R30A 4LNVA 1WWXA 1O8SA 3OY9A 4MXVA 1KZHA 5FYMA 4WXDA 3L1PA 2Q2EB 3DPRA 1XC5A 4XETA 2STTA 1ENHA 3WEZA 2GNDA 1LENA 2EAAA 2W91A 2TNFA 3KZZA 5LY2A 4HN0A 5JHUA 2DI3A 1B35C 2ID3A 2X5IB 1D0XA 1QQP2 1WWYA 4YZ5A 3ETPA 3LPGA 5FZFA 1LRHA 2WR9A 4FP2A 3K10A 2IXJA 2AREA 1V6IA 1LFPA 3AP7A 4XILA 3QWLA 2Z16A 3M4OJ 5FIXA 2CS3A 2JN6A 4XBNA 3L2UA 4QPWA 2PJPA 1R23A 5JPNB 2NOJB 1HW1A 2RS33 1DQ0A 2QVOA 4NPLA 1XCVA 4PHZA 1ZM1A 3WU0A 2VO5A 2PFBA 4MGYE 4M0HA 4D1QA 5DYMA 5DZFA 1OYYA 3HYIA 3RPUA 1JYCA 1N3PA 2GBYA 2BUKA 1Q1HA 4AF9A 4OZXA 5C3OA 2VUMJ 3UKVA 2P7VB 5HLIA 1OFSA 3HN1A 4P00B 1PJRA 4GZ9A 4HNVA 2DCTA 4ZU4A 1ZGJA 4FX0A 5LBQA 4HDVA 1J3RA 6PAXA 1ZBA3 1XJAA 2EINH 5J3LA 3X29B 2E63A 2WS91 4QU1A 1RJ7A 5CQEA 4C3IJ 4XE9A 1TT5B 4P5YA 2KIFA 3PO3J 2HYFA 4V1PA 1RUH3 4A42A 2STWA 4BACA 2RMU3 2VR4A 2CW7A 1XMXA 3NAPB 1PUFA 1OYWA 5F2WA 2X6OA 3LSHA 1X50A 4DXZA 4RN5A 5F5CA 3WTWC 4JAAA 3J26N 2CGOA 1Y8RB 3QH6A 3MV11 2F4IA 1MVQA 1POV3 1EV7A 1TWCJ 2AZ5A 4NQWA 1AR93 3THCA 1FTZA 4KMFA 1RUG2 2OZ6A 1Z91A 2LDUA 3BTIA 1MNMC 2BGCA 3OV8A 3TOJA 2J1EA 4QQHA 4ZZDA 3F22A 1V6JA 4IEVA 2E19A 1PGL2 3LSGA 3ZXJA 2NVXJ 1IGNA 4YFXF 4KI5M 4L0PA 2ZGMA 3DBLB 1HA8A 4UVAA 2VIXA 1V00A 3H50A 3BY6A 4HPKB 1GT0C 1REEA 5C33A 4QPIC 2B39A 2IWGB 3AL6A 4XF3A 1Z6RA 5BNQA 2DJIA 1J3PA 3R4DB 3FBNB 1W2NA 3SH5A 5T5LA 3BROA 1SFEA 4Y5Z0 5A70A 4DPNA 4ZC3A 1W2TA 2CGPA 4N4NB 2YV8A 4YVWC 3TP0A 4PI2A 3A01B 5LGUA 2FXAA 4QAWA 1F5TA 4OU0A 1UMZA 4ZZ8A 1DLLA 1SD7A 1TWFJ 4HONA 2BZDA 2EH3A 4E7HA 3L2CA 2BOIA 5LEJA 4Q4X2 2OKXA 2HYKA 5FB2A 1S6LA 1TQPA 4Q4Y2 4R52A 1JZ2A 3IRRA 1MMDA 1PK6B 5J47A 3FHZA 2JICA 3AKSA 2RS52 1R71A 3RKQA 2GIVA 3HBLA 3HOBA 1O4ZA 1Q43A 2IXLA 2WFF2 1T98A 4XJUA 1EYBA 4DZJA 5ICFA 5L36A 3WTTC 1TNTA 2DT5A 2NQYA 3JRCA 3OB8A 4XJAA 4NWVA 2IT0A 4D94A 3I8TA 3AFKA 4AGRA 2DVGA 2WSUA 1UY3A 2C0ZA 4A44A 5BV6A 4XK4A 4FCYA 1BMV2 1N3OA 2HZTA 5C3PA 2W1WA 4RL7A 1VFCA 4Q1PA 4XLFA 1X1DA 3HDDA 1ZZBA 3AMPA 3PIJA 2XQXA 4QPIA 3U1KA 3NRUA 1ZAOA 2VQGA 1ZRRA 3KGZA 3GF6A 4RQPB 3B73A 2IGNA 4DFSA 4Y20A 1RUJ3 4B4PA 5FAXA 2FDGA 3H1WA 4I76A 1XU1A 1MQTB 4LG3A 1W9SA 3WTSC 1F9NA 2GMMA 3TN91 1LKXA 2HS5A 2VNGA 1YCIA 1CVNA 4KN4X 4V2GA 2HWB3 4G7HF 3GLLA 4P9JA 4FASD 4BJTA 5JR3A 4BL0B 2FMDA 1WW4A 4YGCA 2X85A 2J1TA 3PM1A 3Q0VA 2X48A 1VB4A 3GJAA 3CMEI 3JSOA 2WKKA 5BNNC 1OUXA 3S93A 1W04A 2RVCA 5FZ7A 4Y24A 2K40A 4LOSA 5FYBA 3BPXA 2EXJA 2ZACA 4P14A 1QQP1 2Y6HA 2VQLA 3TKYA 4LXLA 5DV5A 4BDVB 3ZXAC 1ASJ2 5DCMA 3E5UA 2CL2A 2VNVA 1XB4A 1Y39A 1NK2P 1XNCA 3QPTA 4D0PA 1GOFA 5TGTA 1ZARA 5I8SA 1A31A 2B9UA 2D5FA 3CP8A 2ZGOA 3LDBA 3HOUJ 3ZO0B 4FPGA 3VD9A 5GP9A 3VLBB 1MJ9A 3HEIA 3O14A 2UY8A 3OPTA 2BBYA 4BQ2A 2F4OB 5GAEJ 2XGXA 1B9NA 4AC0A 4BEHB 3U14A 2FQ3A 1OQYA 2E9QA 3E97A 3HNMA 4OINF 1VBE2 3RQ0A 4LHSA 3HIFA 2ZAHA 5EJ3A 2IC1A 2R93J 4COYA 1GDTA 2P37A 5IK8A 2UWMA 1N1YA 2QM3A 3C7EA 3O3KA 5A32B 4OWRB 3QP5A 1RJ8A 2JWPA 2X5IA 2XWJB 2A6EF 1MH3A 4DYRA 2JDMA 2Z5WA 3VBFB 3VDDC 4CXXA 2ZXIA 1KQ0A 3T0YA 1MPXA 2JG8B 3ABKH 1P6RA 1UYYA 1KD7A 3ZMUA 1MS8A 1NQDA 4TXWA 2J1UA 5FZHA 5F1JA 5IY5H 1NTCA 4W50A 3ZKYA 2DA7A 2LY2A 3HOYJ 2ADDA 3WF2A 1RI7A 2X1EA 5BNNA 3ME2A 4CE8A 1NZIA 3O12A 5E79C 1O3QA 3R4UA 2V9VA 2R7OA 4KITB 3WG9A 1R22A 2X05A 4COWA 3G1OA 3OSFA 3H8RA 3MICA 1WFXA 4IO9F 1AR81 4EWEA 4OZOA 2LSOA 1W2OA 2VKVA 2D3PA 4PI0A 1T8IA 5T3NA 1RUF2 1YS7A 2Y0IA 4XNFA 3OYAA 2D44A 1PM7A 5DQ0A 2VVDA 4RGSA 4D9JA 3Q8CA 4YYOA 1IXRC 2GH8A 1BJZA 1XGMA 1BK1A 3OOPA 4XUTA 3T1LA 4Y26A 2MG4A 3ZN0A 4DNYA 5FZDA 4PLNA 1DGLA 2XAQA 2K4BA 4ZDOA 2L02A 2QQAA 1YI9A 4JKLA 2DFBA 4OQ8A 1N25A 2M7AA 4U0VA 4ZJZA 1WJ5A 2QQNA 3BCWA 2ME0A 2WBKA 4IEXA 5LWBA 2JQ7A 4XDPA 4OLLA 5CYYA 1W0TA 4I3GA 3NKGA 3VDDA 5EWSA 3A2KA 3JBG1 4OMYA 4AM3A 1NE6A 3ON7A 4S2HA 1L7QA 3L2WA 2BJSA 1DF0A 1U5TA 4H0EA 1BIAA 2XJSA 1UZVA 4CICA 3HUGB 2GAUA 3L2RA 2LY9A 5K0UC 3SZGA 2WO3A 1UN1A 5I0UA 4Q4Y1 2VMFA 3TO6A 3RZZA 2RS12 2VTXJ 2PXJA 2G9ZA 1UFMA 3IRQA 3DEWA 1TT0A 2D40A 5IYDJ 1OKOA 3J7MA 4IV3C 5HNFA 4HT1T 2XJPA 1QDCA 2VQHA 3B5LB 1RKTA 1JKOC 2XF6A 2P4WA 5L3DA 1XE7A 4MFDA 2WFF1 2VC0A 1MBFA 1WZXA 3TBIA 5FYYA 3VKNA 2O1QA 3UR3C 3GYDA 3EUHC 1VRH1 4N53B 1QJFA 1V0AA 4UFLA 1SEUA 2KLOA 5FY5A 3DQVC 1NY72 1RUE2 3G4SI 4MADA 4Y1XA 2D2WA 2G9WA 2XKPA 4E7LA 3ZP5A 2QVSB 4K40A 4CP9A 2BYVE 3NQHA 2EXIA 5F9TA 1YQ6A 3VL9A 1W0NA 3RZOJ 2HWF3 1JOJA 2DDBA 2DCEA 4BZ4A 4QWNA 1PK6A 4O65A 4WM7C 2QKLB 2HWE1 5F5AA 4P9GA 2XJTA 2GN3A 1GZCA 2MH2A 4FPKA 3LFMA 2Q8EA 2G9FA 9ANTA 2O0OA 2XR4A 2R5ZB 4K8RB 4BXUA 1S4CA 2QDNA 2WY7Q 3POGA 3U11A 1T6SA 2EIGA 4LT5A 5K0UA 5CVRA 2VAUA 5T54A 5TRDA 2XVCA 1J84A 5GLZA 1MNDA 4Y1UA 1UZCA 1S0DA 1BK0A 3PUIA 4GB32 2ZBKA 3VZKA 3VUOA 5FKMA 3V56A 4CSWA 1S7OA 2WBMA 4HW0A 4IGQA 2EVXA 2NXNB 1G9FA 4JZRA 5HS9A 4GQ7A 1XCBA 1C1LA 1CJPA 3AVRA 1V70A 3VBHB 1J09A 3NNMA 1Z9CA 3GZNB 1OT5A 1VE0A 3WGIA 5F2SA 2VPLA 2JG9B 2HOTA 3L7WA 4A3EJ 4QM9A 2GN7A 5CQGA 4IE6A 4JK1X 4CCLA 4A69C 2RQQA 2DTRA 3ZPOA 4QPGB 4NIAA 2LOOA 3VL8A 1W0OA 2IAIA 3ES1A 3JAMK 4E27A 4UFJA 1APNA 5F64A 2JA2A 2HVQA 2CV2A 2D5VA 5D4RA 1IAWA 5JR7B 2COBA 1O59A 1FY7A 4OI2A 3GZ6A 2DVDA 4UFHA 1TZOA 4A3XA 1XGSA 3FXRA 5L7OC 5F27A 3LSPA 3IIAA 2AXLA 3DKWA 2Q1FA 3KZYA 1EAH2 3E3VA 2W24A 4Y13A 2P17A 2L3DA 3ZIWA 4HEA2 3UETA 1L3LA 1YQ5A 4FPHA 2EFQA 5J40A 3AG2H 4MUVA 2XAHA 4ONUA 2C6SA 2GH2A 2BNOA 1GZ9A 3M3QA 4XR6A 4GWJA 4LBQB 2FF4A 1SLLA 3BC8A 4BQOA 4NE9A 3HZJA 3I58A 1ULFA 4BEHA 5GAGJ 4UT5A 3WDTA 1BVP1 4BQWA 1TNSA 2LTPA 4HL0A 3LQRA 1XNTA 2VOVA 3FLTA 3NJVA 3K70C 5J1UA 4M00A 4XN3A 1B35B 2DAOA 5E6HA 1IDZA 3EQLF 5GTIC 1RUF1 2RG4A 2DJNA 5A32A 2WNUB 1CAXB 2V1NA 3HVDA 2WABA 1GBGA 1TTYA 1MJBA 3BYWA 2FQ4A 1KONA 1RIOH 2BZTA 3CO6C 4OIRF 5GPCA 1S9HA 4Y3OA 4A5MA 1I39A 4DY5A 4HZFA 2OS2A 2JG8A 2BGPA 1ND2A 2GNBA 3I55I 1SEFA 3ML6A 1YOVB 4AVPA 1D0HA 2E51A 2H0BA 4NHMA 3KYCB 5EYXA 2Z2SB 1WI9A 5HODA 1WJBA 5FQ0A 3SKVA 3VEPA 4P08A 1VNDA 4XZPA 2ZSIB 3AKPA 3GBWA 4NC7A 4H7MA 5KHKA 5L7OA 2JJ7A 4DXTA 3N7LA 5J1XA 1L7RA 3AB0A 5JUVA 5FP9A 2AEYA 2YROA 3JTHA 4D0QA 2JD4A 5LCWL 2M5WA 3ELKA 4XJ9A 4GFBA 2E71A 1AYM1 1ZK8A 2WQ4A 5FZIA 5IHRA 2FNPA 1F35A 2L54A 3TEYA 3J7NA 4NBQA 1A35A 3S3MA 4KNYA 3F9KA 4QQOA 1O4YA 2WV0A 4JRAA 3N36A 3AYAA 4OFGA 3FX3A 2BDRA 5B5EC 3WNNA 2P34A 3PURA 4R4XA 4L18B 5C9AA 1W39A 3DEUA 1RMU2 4HYEA 2OTLI 4XRFA 4XUQA 3WG3A 5FLJA 3F6VA 3ACHA 2W0XA 2J1RA 1HXS1 4YEJA 3KT4A 2OUMA 1R64A 1G9AA 5GKAC 3GO5A 1FP1D 4UF0A 3ZIXA 1JZ6A 5HLGA 2IVJA 3ZXLA 1ND3C 1MS0A 2OCCH 2QQUA 3JBG3 3DEEA 1HV1A 1FZPB 3M70A 3PMSA 2EIMH 2DBNA 1A04A 3OYHA 3GCMA 3LIGA 4LUMA 5E1ZB 2XJRA 2J1AA 3ZYRA 1LCLA 5F8PA 2OC6A 3KX2A 5FRAA 3KP6A 2CU7A 5A6YA 3MKLA 3SXYA 4BY1J 3VGIA 4ESBA 3UV9A 1ENSA 2V72A 3VZJA 3VZNA 3CTAA 4MIMA 4G9SB 2ZMEC 3VDCA 1T0FA 2LFBA 4M6XA 1TWHJ 4BA6A 2F5CA 3OBZA 2YS9A 3HT2A 1HKSA 1BW5A 4JOMA 2VOTA 4XOTA 5DDGA 3C7GA 1ORKA 4INDA 2JA6J 2CUFA 3O8HA 2KIMA 4TN7A 3SH3A 3AXEA 5KCMA 4A4AA 1UZ0A 2AR6A 3ABMH 2ZFWA 3I2KA 3MKZA 4MGTA 1XX5A 5DG1A 2VXJA 4RGKA 1JE8A 4NIDA 5EFUA 4KA4A 5IT6A 1W6PB 2OT7A 5DD8A 3BR3A 4FFFA 1MVEA 3AP6A 4RMNA 4XIKA 1YX5A 1UMHA 2LBFA 1ND3A 3AKZA 2JA5J 4YGBA 4JGZC 4R8HA 4EVIA 3ERMA 3C8XA 2P6TA 4YG2F 1E5RA 4B7KA 3OUJA 3T4VA 1UOFA 5M3MJ 4Y5SA 1ZELA 1S2EA 2A6VA 2BNNA 5DABA 4LIVA 4FCAA 1VAKA 4XAAA 4A3GJ 1R6RA 1U9NA 1HRI1 4IETA 1ENRA 1WQ2A 2JSCA 3K4CA 5ANQA 2XV4S 1HB1A 1EAH1 5ICEA 2VG9A 2HYJA 3OUHA 5H9PA 2W68A 1FYKA 1R093 1JW6A 1OA4A 2J42A 5FGMA 5IP9J 2DFFA 2OD5A 1LEMA 3ZYPA 4CP1A 4EJUA 4PSWA 3KP2A 1JGSA 4MLOA 1BZWA 5LBEA 4JTOA 2WWUA 4XKCA 3U78A 1OI6A 3I0TA 2CFOA 4GKXA 4I2OA 1F31A 2XPJA 4XPVA 4ZTFA 5E17F 4QPGA 3GWZA 4RS5C 3DGTA 3DWLE 1RXFA 1WCUA 1MDMA 4HKOA 4OIOF 3ABTA 1YNAA 3BGAA 5J6XA 5A7NA 3WTZA 1XDSA 3B6CA 2ZO4A 5FZOB 1V9U2 4BDYA 4QQ2A 2ZEWA 2HDDA 5T52A 3E5QA 5APAA 2P8TA 4DRVA 5FYZA 4XFFA 1Y1VJ 2W3JA 3RZGA 1BJQA 1YYVA 3CLPA 3RMXA 5LA1A 3FFZA 1UO9A 1QJU1 2W46A 1G4DA 2R5YB 1GQGA 1QU0A 1E5HA 3CZ6A 4HVQA 1UU6A 1ZRCA 4C0HA 1HKQA 2VODA 1LR5A 4D7TA 1Z7LA 1WD4A 4HSRA 3UKTA 2OYZA 4AGGA 4FE7A 4WWCA 2UXXA 2XQRA 5FP3A 4DXRA 3FK6A 2VMHA 5C3SA 3M1EA 2E2IJ 2VZ3A 4BXXJ 2EIEA 4E6KG 3GGLA 1QOSA 2YGLA 3OJBA 2DYSH 4BKXA 3PSFA 2HDCA 2EIKH 2I8DA 4IVNA 5JVGF 5FZAA 2ERFA 1SBEA 2R061 3AJZA 3WG7H 5FZEA 5A3MA 1VQ8I 1OPCA 3G6EI 2LRPA 1W2AX 3OPZA 4AWXB 3BT9A 1O4TA 5CKQA 3JTGA 1IN5A 3OBRA 2R7DA 3SEEA 2RJLA 2L2OA 3GTPJ 5KHDA 1CAXA 3E6MA 3M7AA 1ZG1A 2DA4A 2CV1A 4YRDA 2JD9A 3CJXA 1PO22 5IATA 3HEFA 1WMEA 3N97A 1ULCA 1YS6A 1JYNA 1AXYA 4S2DA 3VKLA 2F6CA 4EQQA 1NLRA 4O9EA 5IUQA 4U36A 3H7YA 1HJFA 1OLME 2B7YA 3IPVB 1RB8G 2G7HA 1WA4A 5IVCA 3V7RA 2JTVA 4QWQA 2CUEA 1BIBA 3S6PA 4ORFA 2D6NA 3VHOA 2VBDA 3V8KA 1XS9A 3H0DA 4QKNA 3N9OA 2A05A 3J7LA 1QJX2 1M1EB 4LD5A 2ZB9A 4PJJA 1IG0A 5ILUA 1FOWA 4MGKE 3F8NA 1I6XA 1IOAA 2M7BA 1XYNA 4U7DA 3POBA 4QHOA 4RHV2 1V5GA 2EZLA 4FXKB 4A3CJ 2DDAA 3MIHA 2BW8A 3JRDA 3ZOIA 4L0ZB 2WNVC 3M8JA 5I0SA 5JOWA 1SAXA 1IRZA 5A7PA 5L3FA 3PNTA 5A7WB 2IVMA 3N35A 1VB2A 2ZNYA 2VE9A 1SBFA 4KIGA 5JIAA 1W28A 2IA1A 1J3QA 5IVYA 2H0VA 3LQQA 3MFAA 4BLJA 2GXBA 3RJPA 2XPVA 5BOXA 3KLOA 3QCWA 5J1YA 3OYGA 3BUCA 5D4SA 2QCOA 2P7CB 1RITA 3ZN4A 3ZMDA 3AMHA 4QIWN 1DUXC 4C30A 5LHGA 1QNYA 2X53S 2MA3A 4FPYA 2CAVA 4XRSG 3DYOA 2D6MA 4K6BA 3AKRA 2M34A 1HDKA 4NROA 4QM8A 1SFOJ 1XB9A 1ONVA 5HOOA 4LO6B 1HXS3 2PHRA 1ODNA 3D3AA 3F72A 1XU2A 3M3OA 1XNBA 2C9KA 2PN5A 4URAA 1IKQA 4CZZA 3QBQA 3FUOA 5FR3A 5E18F 3W20A 1OKRA 5FRMA 4HRIA 2M1BA 2L4AA 3OBAA 5IYCJ 2V5DA 3FBIB 5ICGA 3R0JA 4L99A 2ZEZA 2ID4A 2ZXHA 5FRNA 1Y6IA 2XB5A 1XSXA 3HGYA 2R0HA 2QDRA 3NV2A 4F3JA 4OYUA 4MQVA 2VJXA 3I2JA 4HNTA 1S8NA 4M9XA 1W6MB 1VBA2 1X1PA 4W8JA 4D8MA 1C28A 5GLUA 3BCBA 4F91B 2HJIA 3QOPA 3ZQLA 4K1YA 2YY1A 1RKWA 4F3QA 3WW4A 3P5BA 1YIPA 4R9BA 4NHYA 4MOAA 5FLVA 1FMD1 4S2GA 4QPOA 1G9CA 4B29A 4AFDA 4OHWA 1QGLA 1ERDA 3GTLJ 3B94A 4A6SA 3OOXA 1B6AA 2ZHKA 3COAC 1W6PA 3RZHA 3AYDA 3I3MA 4AHYA 2WYFA 1W1WE 5H6QA 4JCKA 4G8XA 3GTQJ 1JUIA 1OHFA 1WLTA 4Q5SF 1XSQA 4Q8KA 1VQPI 1NZCA 3ESWB 3S16J 1T6GC 2MEV2 4BDZA 2QQKA 1QY4A 1LPQA 1C5HA 3HJRA 5LBCA 2FZ2A 4HOBA 3ORJA 2OTJI 1GV2A 4NHLA 4GIQA 4IE0A 3GHNA 2V79A 1SMVA 5ABJB 4G9YA 3WNXA 3MLLA 1RRJA 4K8FA 2GQQA 2BW3B 1AVBA 1BVVA 1SANA 3D5OA 2JDHA 4XCAA 4ISQA 5FUIA 3HPGA 3LWCA 4XF0A 1HRI3 4Q0VA 4GULA 2ZC2A 3KFWX 2DVFA 2EJRA 1GUIA 2OPKA 1OOPB 5FMDA 4KDPA 5I8YA 4CEYC 4ZHNA 3I3QA 3FJSA 4MV2A 2V1XA 1MW7A 3W58A 3MZ8A 2ECCA 1FOKA 1JUPA 1GWLA 4ZU5A 2MYSA 2OIIA 5FZCA 4XKVA 3KP5A 4P9FA 1X82A 3NMBA 3F8BA 4MGRA 4NHJA 2XGDA 2LW8A 1DG6A 3AP9A 1LU2A 1FNNA 4XDQA 3WF0A 5AC91 3IBMA 1RVF1 4IEQA 3VKOA 5FZOA 4NB5A 3EDPA 4B47A 3HRMA 3RVHA 4E4ZA 1W8HA 3I4PA 2D6OX 3M07A 4P55A 2PYTA 1YEWA 1SQ4A 4LLGF 3RMYA 5LZ6A 3T1BA 3ZFGC 1Y0UA 1N1SA 4CDQC 4BB3A 2DU1A 1XOYA 2D5HA 2R5YA 1R1A2 2ICWG 3GEZA 3HM5A 2V1DA 4GJZA 5D21A 2CU5A 2MFZA 4UHTA 4M3BA 2OPTA 2VKDA 2FEZA 4PQ9A 3IH2A 5GADJ 2K85A 4G6QA 3L2QA 2ZHMA 1X4PA 2OQGA 5FPAA 2HWVA 1O57A 5A6ZA 3TOAA 3J7ZI 1MEC1 2Y8KA 1U8BA 2QUFA 3TEXA 5JOYA 2D6KA 1STMA 4XQDA 2M3AA 4LORA 3SQOA 2XGEA 3KYLA 2B4KA 1HJGA 3GZTB 4FOWA 1GNYA 3IH4A 4XMYA 4F92B 3N4MA 4XDOA 2BNMA 4PDWC 1GNHA 1C8M2 4AFAA 1CWPA 1NX9A 4UB8C 2MLGA 4BBSJ 1FOD1 3O1VA 4D7MA 3LSTA 2DMTA 4PK4A 4MZUA 3SNMA 4QB6A 2WFPA 2R063 2CH0A 4Q4W3 1EA3A 5FFXA 4RHV1 2BVVA 4M3CB 5EJZB 2QQPA 5LRSA 4BQ3A 1QU3A 4FPLA 2WO1A 1WMFA 2QYOA 5C3EJ 1UCRA 4Y33A 5K7ZA 1MBGA 2D6PA 3O1SA 3KLNA 1NUKA 4R4ZA 5EGOB 3LSKA 4XF1A 1ULYA 2Q4SA 1YFHA 4BJ5C 4KWLA 3MIFA 3ZFGA 2B8MA 3WDUA 3OYBA 1DLCA 1YTYA 2YUSA 3CUQB 3SCGA 5LLQA 1J1LA 3DBHB 4KUMA 2AEZA 2E2JJ 1QPIA 3MF9A 1VQ5I 4UY8I 3R4SA 4B4RA 3OYWB 3W5MA 4HX7A 3LPFA 1K5JA 3UESA 4RAZA 2HZDA 3ECOA 3OYEA 3K48A 1DYKA 1PGW1 4HBNA 2KISA 2DCZA 5A7WA 2IW5A 2ADEA 1LOAA 1RUNA 4PDWA 4DRRA 4Y15A 2VW2A 4HAMA 5KHGA 1CPNA 1WCMJ 4CO8A 3DPUA 5G05L 2DURA 2EZHA 3KV5A 5ED4A 3CL1A 1D2QA 2C24A 1VBA1 2A6ZA 4AUXA 4Q0PA 1W8ZA 4F83A 1OD5A 1UY0A 2ZJPF 3IKVA 2HFHA 3I4MJ 2ORXA 1VBC2 1PP7U 3VBUA 5IWFA 4O61A 1NXMA 4MNUA 3NJXA 1VQLI 2KA3A 5IVJA 4MGIE 1SPPB 3H9JA 1IG3A 4EM0B 4LKSA 3GFJA 1CONA 4XCBA 1DQUA 1D0YA 4A3LJ 2K9LA 4Q0QA 2P6SA 3MIEA 4C2MJ 3JAMZ 1ZREA 3VYSB 1LOGA 3NSTA