4I0BA

Structure of the mutant catabolite gene activator protein h160l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 58
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0bA01
1SD5A 3FXQA 3J80Z 2ATFA 3MCZA 3ML6A 1ZRCA 3MWMA 1TQPA 4UHTA 1YTYA 3U0ZA 4MGYE 3H3ZA 3COAC 3FM3A 4KT5C 5E1XA 3KE2A 1EYBA 1FP2A 5HOOA 1D5VA 4BHBA 3S7EA 4P96A 4XFHA 5JFRA 1MJ9A 3U1DA 3QPHA 3ELKA 3M1EA 2YR2A 1W5TA 2B9UA 1G3YA 3SCHA 4Y17A 1FYKA 4EJUA 2CGPA 1VJ2A 2XV4S 2EB7A 4CO8A 2UXNA 1OKRA 3J80K 4HSLA 3IRQA 2RQPA 5FD5A 2F5CA 2XHKA 4OMZA 4GULA 4AVPA 1EH7A 1HW5A 4LG0B 5K5QA 4S05A 4ESBA 2V79A 5CADA 3HQXA 2VOOA 4XF9A 3D0SA 3HHHA 4HLXA 1NXMA 3R6SA 1UIKA 5D5XB 4GGGA 2Z2SB 3S0MA 1XGNA 2UYAA 2F5DA 3DFGA 1LEBA 4DQ2A 3NL1A 1R23A 4YNIA 2E7XA 1U78A 2Q4SA 3K69A 4AD9A 2LDUA 3F6VA 3NJZA 1QO0D 3LQRA 4KICA 3CUQA 4XSXF 3KP6A 1RGSA 2QWWA 2FNPA 5ICGA 4N9IA 1OD5A 2H94A 4KN7X 3ZMSA 2EFOA 5JCTA 3TDUC 2GXGA 1KU7A 3PVBB 3V8LA 2GC3A 4EWAA 3SXYA 1W5SA 4K2EA 3IL2A 3TO7A 3JTGA 2DK5A 5KBFA 4KIGA 4BHCA 1G4DA 4Q29A 1Q5OA 2DFIA 4LTAA 4A6EA 2HTJA 4ENKA 4UBGA 2VBYA 4E2QA 4L5IA 4P9UA 1O7FA 3M70A 4LD5A 1DZTA 1NHAA 3GVAA 3J81Z 2C0ZA 1X3UA 1BI2A 1P92A 3VFZA 1D8JA 2LF8A 4HDUA 1O3QA 3ZMDA 3U11A 1J59A 2EWNA 2UY8A 3EETA 3LA3A 4TV7A 3OOPA 1XDSA 4HF0A 5LLQA 1F4KA 1IN7A 4F8AA 4OU0A 2QBYA 2O8QA 4HN1A 4L11A 2QQAA 4MQ9F 3CUOA 3PLQA 1J9IA 1TQMA 1W7PD 3HIFA 4HZFA 4Q0UA 5F64A 3I58A 1J3PA 3HT1A 4CHUA 2J5OA 1L3LA 3KZZA 1TNTA 3J81K 4EVIA 1CAXA 3P9KA 1ODDA 2PTMA 5CJ9A 3H7JA 4MZUA 4AVAA 1S6LA 1CAUA 3GO5A 3LOIA 5FLHA 1DP7P 1B6AA 1YUDA 3NW4A 2VBXA 4IRGA 2RNJA 4PGHA 3CUQB 2VE8A 3ST7A 2VQAA 2HFHA 2BYVE 4FX4A 5JSOA 4ENMA 3ZMZA 1S7AA 1QPMA 2ET7A 2HKOA 3B73A 3CO7C 3TDZC 5I0RA 4EJWA 4KU7A 2K0GA 1ZYRF 3HSEA 2VT3A 3KZYA 5J8CA 4ORFA 2DW4A 2R7DA 3LAPA 2RGVA 4YIFA 1UPIA 5J7MA 1TW3A 2ZBKA 3PNAA 5AVPA 3M7GA 2PFWA 2ETHA 4EJTA 3JTHA 1WKMA 1XD7A 2IXCA 4R1HA 1XRUA 4LULA 1VP6A 4LLGF 4MEYF 3DPTA 4YARA 2EV5A 2IJLA 2OA4A 2QQ9A 4E2SA 1Z05A 3V7RA 1HW1A 3P7NA 2P6SA 4IF4A 2PEXA 2BE5F 2PI0A 2XKOA 4KL1A 2ZFWA 2XAHA 2RDPA 5DD4A 5KHHA 1CAWB 4Q0SA 2Y0MA 1R1UA 4L9TA 2CQKA 3KFWX 2QBYB 3DEUA 2RN7A 5E8GA 2PAEA 3RTRA 3V7CA 4WXDA 3V8KA 5F6FA 2OQRA 3BB6A 1T98A 1K6OA 5LHIA 4WK8F 5K1YA 2O0YA 3L9FA 4E70A 1MJAA 2OQGA 5BXXA 3KP7A 3GWZA 1FYLA 2VECA 4D7TA 1OPCA 1QBJA 4EJOA 5HDKA 4R52A 2GA2A 2IXJA 2HJIA 2L01A 2WTEA 1R1TA 1CAUB 4L9JA 1Y9QA 2HYGD 1R22A 4H0EA 2FQ3A 5K5OA 1LQ1A 4MUVA 4A5NA 4FAHA 1FBSA 1WGPA 2ADUA 1PP8F 1I1GA 1BJAA 4MX3A 2D5FA 2EA2A 4YIIA 2A68F 4KWJA 4EJVA 1GQHA 4QM8A 2F2EA 4KMUX 2W24A 4UVBA 3WTWC 1QNTA 2BGCA 2EFPA 4MHGA 3OD0A 5HS9A 3WU0A 2FBKA 1H9TA 4XFGA 1E2XA 4IEZA 1YLFA 3MZHA 3SMHA 1LKNA 5AIPA 1SFNA 3VODA 1XSVA 2FMYA 2MBFA 2Y75A 3NRVA 2PHDA 2Q1ZB 2WFPA 1TNSA 1ZARA 5DCMA 2BNOA 4XLNF 3CO6C 1ZZ6A 2R7FA 2V1DA 2Z99A 3REOA 1FYMA 1RI7A 4JBAA 2P17A 4U0YA 1FSEA 5ILVA 2ZJ2A 2G9WA 5D5UB 4AIKA 2JSCA 2VXZA 1ZHFA 4IJAA 3DKWA 3I53A 4JQFA 1WI9A 1S7OA 5KHJA 3TO6A 1FWZA 5LHHA 2PJPA 1MKMA 4DINB 3R61A 3HSRA 3DQVC 1RC6A 1BI1A 1ZAOA 2VT2A 3WE3A 1B1BA 1OYYA 4WXHA 1GQGA 1SQ4A 3KGZA 2Y0OA 5JAXA 3J7AO 4UXAA 2X0LA 4LMYA 1YS7A 2W57A 1WLTA 2Q8KA 2VODA 3C1DA 1G3TA 1LDJA 4RAZA 2STTA 1ONVA 4OFGA 5K5RA 1NE4A 5BV6A 4O9EA 3F8FA 4A5MA 3T8RA 2PG4A 3E3VA 1GXQA 1RTVA 3LQQA 1OMIA 2JT1A 2RVCA 5BMZA 3HRMA 3ECHA 4I09A 1X82A 3Q5FA 4NHJA 4G7HF 4HYEA 4F7ZA 2XLGA 3CO2A 2EV6A 4IEUA 2HQNA 4LK0F 2L3DA 4XEZA 3M8FA 4XFCA 2ETEA 4M9SA 3KEQA 3MQ0A 4UUVA 3U9GA 5CVUA 4MGKE 2CAUA 5J48A 5E8IA 1P6RA 1J1LA 1ZRDA 2E1NA 5DCMB 3TQNA 2AXLA 3IDCB 3CUQC 1U3EM 3WTVC 3AAFA 1IN4A 4HBLA 3H92A 4L5JA 4HLYA 3K9TA 1NZCA 3HT2A 2ET1A 4A0XA 1ZG3A 2LKPA 5A2QZ 2FRHA 2O03A 1R36A 2ELHA 2W25A 3ABTA 4L0ZB 4H7LA 4EQQA 2DI3A 5E16A 4KIBA 4RGRA 3QRFF 3RYPA 1R58A 1S3JA 2IXKA 4L9NA 4OOIA 5D6EA 4YFKF 2QVSB 1WRJA 4IVNA 1RZ4A 4WBBA 5E1WA 2A69F 1LJ9A 1Z6TA 3WTZA 4YFXF 1J58A 2RKHA 2OD5A 2D1VA 4ON0A 2GH2A 3GW2A 2OZUA 1I6XA 2M5WA 4E2GA 3WW3A 5DUKA 4LB6B 5A2QK 1JHHA 5E17F 3V7SA 2Z5UA 2L54A 3F8NA 1TQIA 2K27A 4LA3A 5J8FA 1FT9A 3ZDSA 5LGNA 2PA7A 1H0MA 2V1UA 3PQJA 1FP1D 2DLLA 5DEQA 2EA7A 2QVOA 4EV0A 3W6KB 1Z9CA 1IUYA 1BIBA 2L02A 2OAZA 1HQCA 2LSOA 3EBRA 4XFFA 3VHRA 3CLOA 1C0WA 4IERA 4RGUA 1KGSA 3RPUA 5FFZA 3CLPA 3IC7A 2N7GA 4CDGA 2MLKA 1BC8C 3LA2A 5D4RA 3HOTA 1Z6RA 4MQVA 5FPXA 3HRSA 1X8MA 1YFYA 4X6RB 4BQAA 1ZX5A 4EWDA 2H09A 2K02A 4KNYA 3FZ3A 1R1VA 2P5VA 4G94A 3FFQA 2K4BA 4IEQA 6PAXA 5AONA 3WE2A 1EH8A 1RUNA 3R4KA 2OU2A 3F8BA 1CAVA 3G73A 4HF2A 4PCQA 1XDUA 5ICEA 2WC2A 2H27A 3IWZA 4KMFA 3WW2A 2BEOA 3C18A 3O6BB 4LA2A 3OCPA 3RJPA 4UXNA 1LR5A 5I8SA 1U12A 1QGPA 3ELNA 3JW4A 2IXLA 4LB5A 3F8MA 1KQ9A 2EFWA 3ROUA 3H8UA 2M30A 2DQRA 2ZKZA 2G7UA 3BWGA 1BM9A 3L7WA 2P7CB 4BIFA 3EUHA 4S04A 1T39A 1P4AA 1P2FA 4D7SA 3RZZA 3R0AA 2L4AA 2M45A 2TDXA 3QACA 4ONUA 5DDGA 2F5FA 4HN0A 2I45A 1B59A 2XROA 4UBHA 4WX9A 2O61A 3MPBA 4FHTA 1TBXA 2P6TA 1F5TA 1LB2A 1YS6A 5KVRA 4EM1A 4U88A 1T2KA 2P7VB 2KRFA 4Z07A 1UW8A 5I91A 2K9ZA 1XN7A 3IHUA 4EMSA 2K86A 3WW4A 2PBIA 1LVAA 3QU3A 3C3VA 5HS7A 2QZ8A 2VBZA 3WU1B 2KIMA 2PFBA 5I0TA 3RYKA 2XL7A 3RKWA 3V8JA 1SFXA 2GQQA 4EGZA 3W6JB 1QWRA 2XIGA 4ENJA 3KLNA 2YX7A 3GFJA 3FE5A 1YIOA 4Y13A 4WZCA 3ZMTA 4UNOA 1YFWA 1GVJA 1ON2A 1CAVB 1OYIA 3EO6A 3CF6E 1J75A 5F1RA 3V4GA 1OR7A 3H3UA 4Q0QA 5L3DA 3LFKA 4QGNA 3FHZA 2COMA 5CVRA 1WA4A 3IKVA 4U7BA 3LZZA 2XKPA 1Z7UA 2V6CA 4O9GA 2EK5A 3ZN0A 4MTEA 2OZ6A 3F21A 1W4MA 4I98B 4XFBA 1X8EA 3BROA 5H6RA 1QXJA 1YG2A 5BY5A 4LK1F 1QY4A 2P5KA 5CU1A 4KU8A 2VONA 3DN7A 1RNLA 4PJYA 4XFAA 2IW5A 3EJKA 4L0YB 3T1BA 1ZZ8A 3QU6A 5BPIA 1YW9A 3USSA 2EAAA 2DAOA 1BBYA 1ZZ9A 3GYDA 2A5YB 1PMIA 2HQRA 4Q0VA 1TLHB 3DL3A 2ZMEA 4UVCA 1Q43A 2PLYA 3I54A 4GO1A 2C6YA 3I4PA 5FLXZ 5L3BA 4L9VA 4AQ6A 1LDDA 3C7JA 1VR3A 5JVTA 2D93A 2V09A 1FPQA 4ZU4A 3KCCA 4I2OA 3KMHA 3CDHA 1ZGAA 1YLLA 4I0BA 1LDKB 1UB9A 4GYIA 5HLHA 1LEAA 2UWMA 1ZZCA 1F9NA 4LJZF 2PHLA 4YRDA 5D1IA 3GEZA 2IC1A 2V1XA 2K4JA 1FZPB 2DK8A 1BC7C 4YG2F 4HQEA 2GC2A 4Q4ZF 5FLXK 5CLSA 4HAMA 1J2XA 1L3JA 4ZYGA 3E5XA 3F72A 1ZGJA 5HDNA 1DUXC 1XE7A 3PFIA 1O57A 4META 2FBHA 4XLPF 2UYBA 3I5UA 3SXWA 4AQ2A 1WQ2A 3ISPA 1UCXA 3MZYA 2DPDA 1YYVA 1XSDA 1RUOA 1Z1DA 3RYRA 2FEZA 4IEPA 2ZXJA 1ZG1A 3I64A 4NQWA 2GAUA 3ACLA 2IA1A 1T0FA 4KN4X 3IWFA 4JV4A 4MNUA 4AVBA 5ICFA 2XGXA 2B0LA 3UKTA 1Q1HA 3RKYA 5EEHA 4HA8A 4CGZA 3FZVA 3ES4A 2ZMEB 3EQLF 4HW0A 2FA5A 1CAXB 1QZZA 2D1HA 3FX3A 4MGZE 4A0YA 2DU9A 3FXRA 3K1MA 3HYIA 3TO9A 4M73A 2IVMA 5FQ0A 3T5XA 1I27A 2UY9A 3FJSA 3TOAA 3GZ6A 1A04A 3FF5A 4OLLA 3GX4X 2YPRA 2JTVA 5D5VB 5BPDA 3B02A 1DDNA 1XGSA 4JK1X 3LWFA 5K8SA 2H6BA 3RKXA 2XAFA 5T3NA 1R5GA 4Z2YA 1G6NA 4RB2C 3RI4A 3T0YA 5CYVA 4FAGA 1EP0A 3SFZA 4FX0A 1HSJA 3KGLA 5TRDA 4DNCA 4PZJA 1U8RA 3BP8A 4RD7A 4EROA 5JHUA 1FX7A 2CSOA 3O14A 4Q47A 2DQLA 1ZG5A 1XB4A 4XSZF 1X7NA 4PIYA 1IXCA 4BH9A 4M6YA 1FBQA 5EFUA 1I5ZA 1SFEA 4BXUA 2DO7A 5H6QA 4YFNF 1KU2A 5E20A 2BV6A 3T8TA 4AWXB 3ECOA 4HOBA 4KDPA 3SHRA 5I93A 3L09A 3GXOA 3SHFA 1WWXA 5CVJA 4M71A 4HV5A 3VB2A 2FE3A 5JR3A 1XE8A 1HSTA 4AXOA 4KIFA 4HF1A 3H1MA 2O6GE 2VC0A 5IT3A 4M72A 1O3TA 5BPXA 1GXPA 1H1IA 3ZMVA 3ZQ7A 5EZWA 3S7IA 4IEYA 1HKQA 3E6MA 2QNKA 2FXAA 5D5WB 4I01A 1B4AA 2QJVA 4XF0A 1XCBA 1D3YA 3KP4A 1IRFA 2F5EA 5HS8A 1QQIA 3NSTA 1FBUA 4HVQA 5FQ0B 1YQAA 2NAZA 2JPCA 3I59A 3QOPA 4R8HA 2CG4A 3OGJA 3K1PA 2EA4A 3WTUC 5ED4A 1PDNC 1T6SA 3CL1A 1ZN2A 4M6XA 5JI6A 3SCGA 4CXFA 2BNMA 4QGMA 5JSRA 4P9GA 3I0TA 1SMTA 2OZJA 2CW0F 5LRRA 4M9XA 1UFMA 2DT5A 3KP5A 1LRHA 4A12A 2H6CA 2UZKA 3I7DA 1V4RA 5FO5A 3E6DA 1JGSA 1CF7A 1SAXA 1HKTA 3ZMUA 4L18B 1J3QA 2MD5A 2HR3A 3MEXA 3SQNA 4WCGA 2D40A 3M9AA 4WWCA 2Q0AA 3NVCA 3GLXA 2GXBA 2XASA 1IN5A 2XRNA 5C6CA 3NEUA 3HRUA 2IRFG 4ZU7A 4IEXA 5DUIA 2QQBA 1XCVA 2IPQX 3KSCA 5JSPA 2NS0A 3K2ZA 3OF1A 1SD7A 3D5LA 1F1ZA 1JHFA 5DD8A 5FGMA 4IEOA 3U2RA 4YYOA 1FXZA 2M8EA 3M8EA 2MPFA 2PYTA 4HDVA 1OFNA 3QP6A 3R0JA 4JTNA 1IRGA 5DV5A 4IRHA 1Z91A 4K8FA 2EV0A 2FBIA 4ENNA 4GCVA 2CAVA 2EFNA 1J3RA 2GU9A 4HX7A 2Z3YA 1TW2A 1OI6A 1W7PA 4CYDA 1S29A 1GHCA 3WTXC 2QDRA 3Q9VA 3RDIA 1BOAA 4M9ZA 5LGTA 2CV6A 2OA2A 2MNGA 2NNYA 4EWEA 2CFXA 1J0RA 5LEJA 2M87A 4CICA 4O3MA 3DP7A 2JPBA 4BNCA 4M74A 2QUFA 1XGMA 3S2WA 2XVCA 3WW1A 3U10A 4LLNA 1OYWA 2MH9A 3DPLC 5CVIA 2IXIA 3EYIA 1JE8A 3BPZA 4OIQF 3WTSC 1O4TA 4G6DA 4A0ZA 5BS6A 4U7DA 3SZPA 5L3CA 4EM0B 2VOPA 1STZA 2PAKA 3O2PE 4AIHA 4KWLA 4XBFA 5TJJA 3H1YA 3NKTA 5E18F 4HMZA 2XAQA 1DPRA 5ICCA 3LWCA 3VOEA 1P4XA 5KHKA 4KA4A 3ERED 3QP5A 3DXJF 4I0AA 4LFUA 1IPJA 4G9YA 2KXLA 3BDDA 2KIUA 1ZRRA 2NYXA 1DGWA 2Q30A 4LEJA 2ZNZA 3GYHX 4I02A 2EJRA 1YHFA 3BALA 2BNNA 4QXKA 4HX8A 4IRIA 1MDMA 2ISYA 4Q0PA 2MC3A 5CVVA 3QPTA 1FLIA 1U2WA 3ULQB 4ZYDA 1W7PB 1SFUA 4MH0E 3SCFA 3H1WA 3IDBB 4MEXF 4JTOA 3GF2A 2VC1A 4BHPA 1FC3A 5JR7B 3ZN1A 1QZYA 5LHGA 5FCCA 2Z33A 2VE9A 2HOEA 5ILSA 1HXDA 2IP2A 3BJAA 3JZVA 4TLFA 4LGWA 3TOBA 1SD4A 3Q9SA 4PIXA 1IN6A 3M3IA 2JZYA 4XFIA 5LEKA 2ZNYA 5KK1A 2GIVA 3LA7A 4I7HA 1J5YA 3ZP5A 3E6BA 2UXXA 2HS5A 3O3KA 3P9CA 1IPKA 2A61A 5BQTA 4ZH4F 3FMQA 4IEVA 5EEGA 2GC0A 4LUMA 4OIOF 2A3SA 2AS5F 1Y0UA 3KLOA 3K0LA 2V9VA 2ZKLA 5FD6A 2O1QA 5ERIA 5I8YA 4KFCA 4RS8A 1BI0A 1XSXA 2MLGA 5KHIA 2GA1A 3D82A 1NE6A 4OIRF 2XL9A 2M1BA 1YWKA 3K1NA 5D8LB 4HSJA 1U5TC 3TKYA 3E5UA 1PM7A 3CJXA 4G6QA 1FOKA 1D8KA 5LGUA 3NQOA 2HYFA 2GWRA 3KETA 1MDMB 2Q0OA 1IW7F 1KQ0A 1B9NA 4XF3A 1PP7U 2BBYA 1H9GA 1EV7A 4ZYHA 5LRSA 3CJNA 2IT0A 2KJCA 1R5HA 3C3WA 3LAGA 3GUDA 3F23A 4J1WA 3E5QA 3GBFA 4RB0A 4MGRA 1NYWA 3KEOA 1V70A 2DCTA 5L3FA 2STWA 5D4SA 5KHGA 2FNAA 1UCRA 1AOYA 4QMAA 4ZZDA 2F4PA 1EY2A 3LAJA 2LF7A 1UD1A 1CAWA 3F8CA 1EPZA 4QWQA 4U0VA 3MFKA 4ZZLA 5J3UA 1MD0A 2PN6A 1BI3A 2WWYA 4ZYEA 3MDPA 4Q5SF 3GZ5A 2IA2A 2A6EF 4RGXA 5BUVA 4B29A 2VBWA 5L3GA 2DPUA 2YX4A 2H0VA 2HWVA 1B9MA 2FSWA 2ACJA 3FM5A 1TTYA 4I3PA 5BOXA 2A07F 2Q2EA 3OV8A 1I1SA 2FU4A 2QCSB 5HLGA 3N97A 1IAWA 3ABUA 4NVPA 4YSFA 2EFQA 3FMSA 3HRTA 4HVRA 2ZCWA 4PDKA 4RGSA 3FWEA 4IHTA 3TGNA 2MA3A 1DGRA 4ASNA 1LNWA 2NRAC 2XUBA 2HTSA 3WG9A 5HDGA 4HV6A 2GZWA 1IF1A 3BPVA 2L4MA 5I0SA 2D5HA 3UKNA 4ESJA 2HZTA 1G3WA 1IXRC 4B8XA 4Y15A 2D2WA 1ZRFA 1RL3A 4XETA 4D0PA 4EGYA 1ZZBA 1YFHA 1REPC 1MGTA 3G7DA 3BY6A 2OBPA 2FMLA 1IN8A 3H9AA 4KUMA 4NB5A 2PQQA 3KP3A 4O6JA 1O7LA 4KWKA 1V3FA 5D6FA 2ZO4A 4PIZA 5FB2A 3OTFA 4OIPF 5I0UA 4MTDA 3VEPA 1AWCA 1SD6A 3IBMA 4BYYA 2QENA 1CX4A 1KQ8A 3F3XA 3CEWA 2Z9OA 2E9QA 3BU7A 3BJOA 3BJ6A 4RB1A 1ZNPA 4LLOA 1T38A 4B09A 2KJBA 5C8WA 4QM9A 4UV9A 3TNQA 1ZREA 4WVZA 2YSRA 1PUEE 2PQ8A 4OINF 1EH6A 1TQ5A 4P5OA 3IIAA 4IPAA 3BPXA 1E17A 1Y3TA 2Y48A 4UV8A 5D8KB 1K78A 1L0OC 5DYMA 4LUKA 1IZ1A 1H1MA 3FXUA 4IETA 5LBQA 1Q3EA 4HVOA 1XMAA 1U5TA 4IXAA 4CZZA 2P5LC 1ZLKA 1FNNA 5L3EA 2K7LA 3HOSA 3EDPA 2ISZA 3JAMZ 1HW2A 2QM3A 1R7JA 2IA0A 4MGIE 4PGGA 3D0JA 3LSTA 3I71A 2E7WA 3RIRA 3MYXA 2VPVA 3WTTC 4IEWA 1YO5C 2XLAA 4ESFA 3HSFA 4U0WA 3CTAA 3EYYA 5I8TA 2YU3A 4AIJA 2KIFA 1KYWA 5FDBA 4L2NA 2DTRA 1YFXA 4EM2A 2B8MA 1O3SA 3SZTA 3GFLA 1UHWA 3JAMK 3JSPA 5H20A 4J1XA 1KA8A 4WF2A 3WGGA 2PMHA 4UVAA 3E97A 2P8TA 2HGCA 2ESNA 3JSOA 2D45A 3FHIB 4N0BA 3EQEA 4GYGA 2ESHA 3E6CC 2RV8A 4ZU5A 3L2CA 5AIQA 4QGLA 1KYZA 2P4WA 1USTA 3MAJA 2EVXA 4G7ZF 3FMRA 2OYZA 3G3ZA 3HHGA 1O5UA 4R79A 2MH2A 1HKSA 1P4WA 1YFUA 4WXCA 1ZLJA 4HBNA 3RPQA 4HLTA 3QAHA 1K78B 2FOKA 5HVQC 1G3SA 1CGPA 5FLJA 3GFIA 4BAYA 4RB3C 1HBXG 4RAYA 4AVCA 4P55A 1U5TB 3L00A 5FPZA 2WV0A 4JVAA 2OPKA 2E1CA 1MZBA 2XLFA 4QLCU 4A6DA 2IXHA 1DZRA 1SMYF 3L2HA 1JUHA 2Z69A 2A6HF 3IRRA 2HEOA 3RNSA 5ILUA 5FFXA 2PMUA 3H7YA 2R3SA 1JXSA 3P9IA 4XRFA 2G7HA 2FQPA 2HKXA 4FBFA 2QLZA 4HX4A 3F6OA 3BOQA 4FT8A 3WTYC 1KU9A 3BCWA 2NNNA 3EHKA 2XAJA 5HI0A 1YW8A 4A2UA 4X6QB 3IKTA 4GXOA 2LNBA 3WODF 1ULYA 2CYYA 1K7AA 2DBBA 4IHSA 3WGIA 1UHMA 4ETSA 5DCFA 2PAMA 4P9FA 2FF4A 2W84A 5HLIA 3PQKA 1O5LA 2RC4A 1O3RA 5J6XA 4QX5A 3F22A 1ON1A 1U6GA 3UKVA 5FLIA 3ETQA 3HUGA 2CWEA 4G7OF 3I59B 2X4HA 1FSHA 1J7KA 3DV8A 4KYWA 1XMKA 4XF1A 2MHFA 1S8NA 1VTNC 2VN2A 4HQMA 1RIOH 3H50A 4LG0A 3HTUA 3N4MA 1FY7A 4OMYA 1YW7A 1BN5A 5IT9Z 4Z82A 2HDCA 5E1RA 1FI2A 1SEFA 2J5PA 3TNPB 2JRTA 2O8XA 1ZH5A 1MJBA 2XAGA 1ZZ7A 3BZ6A 4MV2A 1CF7B 1K79A 1QXRA 2W85A 4O5VA 1USSA 4G8XA 3R60A 4Q48A 4IESA 2KKOA 3ES1A 2B5HA 4N9HA 1ZVFA 5E1ZB 2GC1A 1R00A 1DPUA 4XF4A 4LLLA 3DF8A 3WGHA 1UIJA 3HTSB 2CO5A 1IXSB 2QYOA 3ZPLA 2O3FA 1WSUA 3GFMA 1XGOA 5IT9K 1KU3A 3KP2A 1BIAA
chains in the Genus database with same CATH superfamily
1SD5A 3FXQA 4X8NA 2CDOA 3MIBA 3MWMA 4PI0A 3GHNA 1TQPA 2B42B 1YTYA 1EV11 1RUJ1 3MIDA 4C2UA 1WW7A 1HIXA 1TT0A 4LO4B 1FP2A 3JR9A 4TTGA 3S7EA 2JQ7A 1N3OA 3S8PA 2JK3A 5JFRA 1DQUA 4ZY9A 4QPQA 4YVSA 4M0HA 3BODA 4FPGA 3SCHA 4Y17A 4EJUA 2VQHA 1F43A 4E7LA 1AR72 1ENXA 1QU3A 4CO8A 1K3IA 3FHQA 2VKDA 5C4WB 3ECQA 1VBE1 2IEKA 5BNOA 3AZYA 4AVPA 2NVTJ 1IKPA 1HW5A 4WVMA 4LG0B 5K5QA 3VV1A 3ZYGA 3U4SA 1CIYA 4O65A 4YVWC 1RB8G 3CBNA 3HHHA 4HLXA 1OOPB 5ISLA 2GN7A 3U78A 4DO0A 1O8PA 5HV0A 4CDWC 2HWB1 3CCYA 2VCMA 4QXBA 1U0JA 1XGNA 2VLAA 3UNGC 2UYAA 3J7NA 1W28A 2W2IA 4URTA 1R23A 3BTIA 4QX0A 1U78A 3RMXA 3K69A 3TW7A 2LDUA 3F6VA 2R073 3NJZA 3KP6A 1RGSA 3MW2A 1ZBA1 4NHMA 2H94A 2Y6HA 4UW4A 1HN0A 4OAYA 4GB32 3AFHA 4FPEA 2NXNB 5JXHA 3ZKYA 2GC3A 4EWAA 3SXYA 2VMGA 4X0GA 4ZHNA 2VTXA 3LEGA 1VLNA 4E4SA 4K2EA 2W82A 1RHI2 3NJXA 3JTGA 1WPKA 2BVVA 1VQ4I 5KBFA 2YC0A 2M3AA 4A6EA 5C3QA 2VCCA 1QJY1 2H8RA 4B4QA 2C0ZA 3UGHA 1BI2A 2X8KA 2EWNA 1G7YA 3PUIA 1A6CA 3FKJA 4HF0A 5J3LA 2BY3A 4F8AA 1H1AA 2QBYA 1LFBA 3LDRA 5EYRA 4HN1A 2GH8A 3PLQA 5FROA 4EZ4A 2ZC2A 1TQMA 1W7PD 3OGRA 2VQTA 4Q0UA 3AL6A 4CHUA 2J5OA 4BDYA 1RUD2 2Y6FA 4Y1YA 3K70D 4EVIA 5GTIC 1ZGWA 1TZLA 4AVAA 1S9HA 1S6LA 1CAUA 3GO5A 3A2KA 1UHSA 4A6OA 1B6AA 1YUDA 1W05A 4RAFA 4IRGA 1EPWA 2O0OA 2RNJA 4PGHA 3CUQB 2VE8A 2OIIA 3FLPA 1H88C 2VQAA 1UMZA 3BKZA 2BYVE 3K10A 5FZEA 5JSOA 1HQLA 2YXSA 5F3IA 3ZYBA 1WH7A 1UAIA 3ZFFB 5I0RA 4D6SA 4UOJA 1ZYRF 5J8CA 5JI9A 2KPMA 2DYSH 2R7DA 4ISRA 3LAPA 4ZDPA 4FSJA 3W5NA 1UPIA 1QJX3 1TW3A 3PNAA 3WD5A 1OVSA 2PFWA 1QNWA 3CQOA 4EJTA 1JXNA 2DOEA 3JTHA 4R1HA 1AX2A 4LULA 1VBA2 4HPKA 3LDKA 2YFUA 1J83A 4RGAA 2ZHNA 3DPTA 1OFSA 3U07A 4QPWA 2OA4A 1YEWA 1F5FA 5FK7A 2AC1A 4IF4A 4ZTFA 1KD7A 3LOBA 2EBIA 1PIV2 1WLDA 2ZJRF 3BQYA 4JCKA 5DD4A 3HDDA 2Y0MA 3W5MA 3PJQA 3RSNA 2CQKA 2D5VA 1MQTC 2RMU2 2RN7A 4DQAA 2PAEA 4GFBA 3RTRA 4QDSA 5M0TA 4AGRA 5LHIA 4WK8F 2WNVB 3J8F2 2VPRA 3L9FA 3JU9A 2ZZQA 4E70A 1EA3A 2OQGA 2QTWB 2VECA 1FYLA 1VB2A 4D7TA 1XNCA 1QBJA 3VSKA 2JDMA 2VW2A 4R52A 1GDTA 2L01A 2R30A 5FBZA 4JQTA 3PTRB 4JGZA 2HYGD 5FZ4A 1F8VA 1PGSA 2R7TA 4IE6A 5DAWA 2ADUA 3M1HA 1I1GA 4MX3A 2HDWA 1MS1A 2A71A 4RHV1 5FZGA 4CUGA 4EJVA 2E33A 2F2EA 4BKXA 4KMUX 2OPTA 3WTWC 1QNTA 3T0DA 2OVUA 5HS9A 4QIWN 1GV9A 4XFGA 4BS9A 3I49A 1SFNA 5AIPA 3VODA 3BTJA 4OUSA 1GZTA 4GJZA 1EKEA 4PJNA 1ZARA 5KHDA 2WO1A 3M3QA 1B35B 3FBIB 1UG0A 3CZUA 2R7FA 1XNTA 2P17A 2K9MA 3EXUA 1FSEA 3E0JB 2G9WA 2Q1MA 1ENRA 3CKHA 2A6ZA 2JSCA 1ZRIA 2VXZA 3DKWA 2PXJA 5HNFA 5KHJA 1JZ6A 3GTMJ 1MKMA 3J26N 3IDEA 3ZGKA 2CUFA 1DLLA 1ZAOA 2VT2A 1SC7A 4WXHA 5JAXA 4UFIA 2PLV2 2ZMLA 3AG4H 1RR7A 3NV1A 4UT5A 4XOGA 3C1DA 4RAZA 5FZOA 3JCIA 5E8AA 2R1DA 1S0CA 2V73A 1HRV3 5BNOC 3AL5A 2VQGA 2ZMKA 4RA2A 1CJPA 3ON7A 3T8RA 1VQNI 2PG4A 1D4M3 3N9MA 5TISC 1RTVA 2UUZA 1AXKA 4QD2A 4I76A 3OOXA 3HRMA 4D7YA 3H35A 5LW9A 4JKKA 4NRQA 4F7ZA 1WBLA 3GCWA 2J42A 3PIPF 2EXIA 4XMIA 4J25A 2X6XA 3T1MA 2HQNA 4WV8A 2ETEA 1SVOA 4UUVA 1OCPA 2JDKA 4MGKE 1W36C 3GLLA 4GQ7A 3S14J 5E8IA 2JG8A 4XBQA 1ZRDA 3HEIA 5DCMB 3VBOB 4LBQD 2AEYA 5FYBA 1PMJX 4HLYA 1NX9A 4AFCA 2EALA 3HT2A 3T3YA 1FPN3 2W1SA 1DG6A 5FIXA 1OR7C 4XOPA 2FRHA 4BIOA 3U37A 5LA1A 5J98B 4OI0A 1S3JA 2F4MB 4Y7NJ 5IOYA 2OW4A 4YFKF 2QVSB 5CFCC 5K9YA 2QQKA 3MGUA 3SLIA 4YFXF 2OD5A 3GF6A 5FXVA 1DP0A 2DA7A 1ZKGA 1N3QA 4FI9A 3IAS2 5CKTA 5DUKA 3GCMA 3DGTA 3PFYA 1V6IA 2Z5UA 1A31A 4UAPA 1RKTA 1UZ0A 3F8NA 1X4OA 2K27A 3LIGA 5J8FA 1FT9A 4LA3A 3ZDSA 3NQHA 2PA7A 2CV2A 2EA7A 3ACGA 1F31A 2RS13 1R4MB 3ALQA 3CC7I 5JMOA 2IFRA 4ASKA 3E1F1 5J1UA 1QKQA 2VVFA 3VHRA 1C8M1 2E71A 3CDZB 1C0WA 4RGUA 1KGSA 3NAPB 2Y6JA 4OWRB 2N7GA 4YZ5A 5F0HA 2MLKA 1BC8C 1SPPA 1WW4A 2HPMA 4QPGB 2B63J 3MKWB 5KWRA 1Z6RA 3UGFA 1YFYA 4UF0B 1POV0 2YGLA 3FZ3A 1ENQA 4ASLA 4MFDA 1WH5A 4AOCA 1Y8RB 1CAVA 4CPBA 1HN1A 3G73A 4KJZA 5CAZA 1M06G 2JWPA 5ICEA 4Q1RA 2EXJA 4KMFA 1QOOA 2BEOA 3O6BB 3OYKA 1W0NA 1CVNA 3PURA 4YM3A 1LR5A 4UXNA 5EG0B 5I8SA 4A44A 5IYYA 3BR1A 4LB5A 4AG4A 4IHWA 4LPLA 4XUNA 3MF9A 1MMGA 2JDPA 3BWGA 4Q4X3 4QX8A 4BK5A 1GUIA 1ULEA 3CJIA 2P7CB 4SLIA 3EUHA 3B6AA 4RR3A 1P2FA 4D7SA 3R0AA 3CHXA 2M45A 1HQWA 3TRSB 3FXJA 3OY9A 2F5FA 2DCZA 2I45A 4DS0A 1ND3C 4FHTA 1FIPA 1F5TA 1BR1A 3WHCA 2R7EB 1C4RA 4Z07A 3W21A 1UW8A 5CEHA 4KBBA 1V6LA 1S2EA 3IHUA 3WW4A 2PBIA 1NCRB 2A7AA 1CR7A 5HS7A 2QZ8A 2VBZA 3CNAA 3DYOA 1Y0NA 4YW7A 4CEYB 4LKFA 1AR81 2KIMA 3V8JA 4NO4A 2VM9A 4JRLA 2GQQA 4EGZA 4AQTA 4ENJA 5TSWA 4LKSA 1H8TC 4XTPA 4HG2A 4R4ZA 4LO7A 5C3RA 3GFJA 3H5NA 2VZOA 2ZAAA 1OF4A 3TEYA 4UNOA 4AGGA 2VOVA 1RJ7A 1ON2A 2WKKA 3I2IA 1J75A 4QPIA 2HWF2 3V4GA 2K9LA 2WNEA 3H3UA 2VB6A 4QGNA 1PVEA 1M1EB 2ENRA 3WP4A 3VZOA 5CVRA 1W0UA 2OZ6A 3F21A 3D5OA 4LHKA 4XFBA 3BROA 5H6RA 5IK5A 2R0HA 3WNMA 2NM1A 2ZOEB 3BYWA 1QY4A 2P5KA 3GZAA 3DN7A 4XFAA 1PX4A 4AWDA 3HXLA 1S5LC 5FZBA 4DYQA 4A3FJ 4ZZ5A 4UVCA 4QXCA 4PLOA 1Q43A 3FHAA 3IH4A 4UUSA 4GO1A 3UJQA 2FDHA 4Y1ZA 2C24A 2A6XA 2W87A 2QE3A 4L9VA 4XDQA 1VR3A 4SBVA 4GH4B 3CCUI 2EIBA 3KCCA 3KMHA 3HNYM 3CDHA 1UELB 1VAKA 1YLLA 1X50A 1Q56A 2QGUA 1AR73 3POEA 3B94A 2Y60A 2IC1A 2QKDA 3QYBA 3WQBA 2FCVA 3CU7A 1FZPB 1BC7C 1RYYA 1ETVA 1I5PA 1FATA 4DOUA 1AHSA 5CIRA 3A01A 1L3JA 2A6VA 3E5XA 2VOWA 2HWD1 2QQWA 3UESA 4MG2A 1PGW2 3A0HC 4META 1POGA 3TMOA 3B7MA 2UYBA 3MFAA 2R071 4UYBA 3NJYA 1AL22 1W8UA 3ISPA 2VUMJ 2VTXJ 1YYVA 1NKGA 5A7QA 1Z1DA 2FEZA 4IEPA 2ZXJA 5FOBB 2FDFA 3I64A 1UY4A 2GAUA 3ACLA 5FKCA 1R6RA 1AXZA 1N1VA 3HEFA 5JDBA 5ICFA 5A6ZA 3RKYA 3N9PA 5EEHA 4C0BA 4CGZA 2WDBA 3ES4A 4NRMA 3EQLF 2ZGPA 3WHUA 2LBFA 4GB33 4JHZA 4AI0A 2YUEA 2DU9A 4A0YA 1JZ3A 2NPIA 4AZZA 2MW8A 3O1RA 2X9DA 4H4KC 1IDZA 4QKNA 2XJPA 3T5XA 1I27A 1WLWA 4A93J 1SDWA 1FOD2 4RQPB 1VE0A 1A04A 5JLVA 1HF0A 2UWAA 1K5MC 2JE8A 4LMFA 1QA6A 3K4KA 1MBEA 2YPRA 1PO13 5D5VB 3B02A 1AJOA 3OY8A 2O9LA 5K8SA 1LGNA 4N43B 3WCRA 2XAFA 5T3NA 4Z2YA 3VBSB 1G6NA 4ZZ8A 2FOWA 2JECA 1APLC 2FHRA 3PVNA 1W36D 1YX3A 3ABLH 3O14A 4A41A 5IP9J 4GA9A 3BN6A 5B1AH 1W9SA 3HOYJ 1X7NA 1QEXA 4CCJA 1IXCA 4BH9A 4KQ7A 1RUD3 3UV9A 1SFEA 4BXUA 3HPGA 5CG8A 1RINA 3T8TA 2HYXA 3AZZA 2JKBA 4NQWB 2WS92 2BOLA 4Q4V3 3ZIWA 2WRAA 3GXOA 4N7UA 3FK7A 4P5YA 5CVJA 3W9AA 3OPWA 4K6BA 4HV5A 1QJX1 1S72I 4Q4Y3 1XE8A 4KIFA 1DYPA 3H1MA 2ZJCA 2VC0A 2VBPA 3BG9A 2DV9A 2RR11 1MVEA 5E3LA 1SDDB 3ZMVA 3ZQ7A 2BU9A 4FOQA 3S7IA 1BR2A 2C6SA 5IYCJ 3HN1A 3QPSA 3EUHC 5D5WB 4JC1A 4NHYA 5IHRA 4RR3C 3RFRA 1FMVA 1D3YA 3KP4A 1IRFA 2MEV2 4FP3A 5FQ0B 3BZCA 2NAZA 2VZUA 1VBA3 3QOPA 1SLCA 1OURA 3HQUA 5A1FA 2M0MA 1WLCA 2ARBA 3K1PA 1ACIA 3OGJA 3OYWA 3H5AA 1PDNC 1T6SA 4P9WA 3VKNA 5JI6A 3SCGA 4CXFA 5ABJA 1YC61 2J1RA 1I9RA 3ABMH 2RG4A 2OZJA 4ATFA 2D7FA 4XLAA 4CCEA 1GFF2 1UFMA 2RMU3 2H6CA 2HNHA 2NYYA 3OBZA 3J8F3 5FO5A 1BYHA 2FD8A 1OQYA 3PUQA 1GV5A 4K1ZA 4CA9A 3VD3A 1DGWX 3NNMA 4I30A 2MD5A 3HKZN 2HR3A 2D40A 5JMCA 3GDBA 4DBRA 3NVCA 2PHRA 2VOTA 4CDQC 2BW3B 5C6CA 3HRUA 3JRDA 2KQRA 2IGMA 2HQAA 2DBNA 4K20A 3KSCA 5JSPA 1C28A 3K7AJ 2D3RA 2VE1A 1SD7A 2R93J 1RETA 3D5LA 5T5JA 2M34A 3WF1A 3FXKA 5FGMA 3V65A 3GZTB 3U2RA 4YYOA 5GZFA 3ZSEA 4XDPA 1Q8SA 4JZRA 3WUCA 4PDWA 5DS9A 2PYTA 4NNJA 4Q27A 4HDVA 5A7PA 3R0JA 4JTNA 1BQPA 2HYJA 1Z77A 4IRHA 4K8FA 1ND2C 2FBIA 1E5IA 2EFNA 5L9BA 3WLUA 1J3RA 2GU9A 1MS3A 2Z3YA 1CZTA 1AR93 1QQP2 1S29A 2QDRA 3WTXC 3AYDA 3M3OA 3RDIA 4S2GA 1IKQA 4F83A 5BNNB 2J1TA 4HKLA 2OA2A 3HOVJ 2NNYA 1MH4A 1ONAA 4EWEA 3SKJE 2CFXA 3KZIC 1J0RA 4AHZA 2M87A 4O3MA 4BNCA 2HVQA 3S2WA 4IV1C 1HB2A 1HRV1 3KVAA 3WHTA 5DQ0A 4W1UA 3VZJA 3WW1A 2Z5WA 2XG3A 3U10A 4LLNA 5IK7A 1PUFB 2DVAA 3OIQA 4M3GA 3G1MA 3VBFC 2ZSIB 2XDVA 1VBC3 2CGNA 5DPNA 1BBT3 2CDPA 4W6XA 5A7NA 2PAKA 2HWE3 4XBFA 3GCXA 2XAQA 3LD8A 2DURA 2KDOA 2YV8A 2RS52 1P4XA 4KA4A 3QP5A 3DXJF 4LFUA 5HNHA 4G9YA 2KXLA 3BOPA 1PM4A 2NYXA 1NCQB 4H14A 4LEJA 3OEBA 2ZNZA 3LSEA 1DF0A 4LHLA 3WP6A 3IMNA 2Y31A 3BALA 2R7ZJ 2DOFA 3FXMA 4IRIA 1BMV2 2MC3A 2FDJA 5CVVA 2WWUA 1UPSA 1FPN1 3WG4A 4ES9A 1RUG2 3CDLA 1U2WA 3ULQB 1LVKA 1W7PB 1SLBA 1SFUA 1V5GA 1RPWA 3JRBA 1U5YA 4YW3A 1MS5A 3IDBB 4MEXF 4JTOA 1VBB2 2VC1A 1S0BA 3CDIA 4NUBA 2OUJA 4BHPA 3ACHA 3SEZA 1QZYA 5FCCA 3G6EI 2W5FA 5DM7F 3MUZ1 4LGWA 1SD4A 2XMLA 4PIXA 2D98A 3CZ6A 4XKWA 5KK1A 4I7HA 3P9CA 2NS8A 2JEMA 4BXSV 5IVCA 3NWTA 5DUUA 2WA0A 4ZH4F 3E7LA 2A6WA 5DMYA 1Y0UA 1KS5A 4COUA 2RS11 2JRMA 2O1QA 4NBQA 2GMPA 2R7WA 4RS8A 2E34A 1JKRC 5KHIA 1PK6A 3ZFGA 1QH7A 3N9QA 2M1BA 4A69C 2FCTA 1IS6A 2XUEA 2ELJA 1X9PA 3CJXA 4G6QA 1MBKA 3PJYA 5FP4A 5LGUA 4LIVA 2J22A 2EIJH 1SVMA 1B9NA 4XACA 3DEWA 2BBYA 1W9FA 2ID3A 2PMZA 3CJNA 2JDZA 2DA4A 2DFBA 1W6OB 3GUDA 1D0GA 4MGQA 2X1EA 5CFDC 5SV5A 4E7JA 4MGRA 3KEOA 1V70A 3LPFA 2ZXQA 5HODA 2YHJA 3WY6A 3ZKUA 1AOYA 2JKXA 3VBUA 2F4PA 3LAJA 2QQJA 1AYM3 2Z4FA 2CQNA 4D7NA 4Q8KA 2P5BA 4Q4X1 4NPMA 1Z3XA 3WNXA 4ZZLA 5J3UA 2VJ5A 4DRRA 2WWYA 3GZ5A 3PSFA 4F52A 2VVDA 4PFOA 1O8SA 3I55I 5LASA 5FBJA 2KZVA 2K2SA 4I3PA 5BOXA 4Z8BA 4RGKA 4XN0A 1J84A 4CH7A 2TRTA 3Q8EA 1IAWA 1RKWA 4A3JJ 3ABUA 2QQVA 4YSFA 2EFQA 4AVVA 4JGYC 2JE9A 3SISA 2XAUA 4F92B 3J7ZI 4XR6A 5C8CB 4AHYA 5FZ3A 1NT0A 3CCMI 1GU3A 4FTSA 2JXAA 3POSA 1DGRA 4QPYA 3SH3A 1JYIA 2HTSA 3VYUB 2OCEA 5HDGA 2GZWA 1IF1A 2G4IA 3KM5A 3UKNA 3LKJA 2Y38A 2WAFA 4CPBD 2R7VA 4XLFA 4D0PA 2KLOA 5LY1A 4AF9A 5C9AB 3PUHA 5M3MJ 1Z7S1 2CUJA 3O1UA 3BY6A 2WJSA 4NB5A 2PQQA 3KP3A 3JRHA 5FY9A 1RUE2 2ZKNA 3QBQA 3OTFA 4PDWC 5I0UA 2WZ8A 1LOFA 3VEPA 1MH3A 1Y1VJ 2UU8A 2GIZA 3AKPA 1KQ8A 3NWKA 3VBHB 2Z9OA 2E9QA 2VNRA 4LBOA 4LG3A 5JVGF 1AR63 2RDRA 1PNFA 2Y69H 3BJ6A 4LKDA 2M7AA 5FZIA 4LLOA 2FDKA 5I0DA 2DYCA 1T38A 2YY1A 5C4WC 4QM9A 2Q8OA 1UOFA 1GVDA 4A3CJ 3VDAA 5GLVA 4WVZA 2YSRA 3CJRB 1MEC2 5E79C 4QB1A 2CGOA 3FIWA 2E32A 4LBQB 5D8KB 2AXTC 1K78A 1WGXA 5DYMA 1GZWB 2R6QA 4V2GA 4LUKA 4H7MA 4UB8C 1IZ1A 1K83J 3TEDA 1OOPC 1JH5A 1VMJA 4HVOA 4XL9A 1V6NA 3O1MA 3AP9A 4CZZA 2P5LC 1R1A2 3NNLA 3VKFC 1WCQA 2ISZA 2ZX4A 1AR71 3ZXKA 2QM3A 2ZXIA 3TW6A 4CRQA 2P6HA 4IX7A 1MMSA 4MGIE 3LSTA 2E7WA 3MYXA 5JWPA 1YO5C 2R043 5E89A 1K42A 3UT0A 1AUYA 4C30A 3OSFA 3ERMA 5I8TA 2ID6A 2BQPA 2D6PA 4FPHA 2GALA 1YJ9I 2YU3A 2CWMA 2KIFA 3A1YA 2BOIA 2CWSA 4L2NA 3PHMA 2DWRA 1A35A 1O3SA 1UHWA 1W9YA 1W03A 1COV2 4GRIA 1KA8A 2F4IA 4HOOA 4YVWB 3EQEA 4GYGA 2ESHA 4BXXJ 2RV8A 3ASNH 4XW3A 4AYBN 1B72A 1VQLI 1LU1A 1AL23 4IQ4A 2YZ4A 4QQOA 5L9VA 2P4EA 3MAJA 3AYAA 3OYEA 3ZN6B 4G7ZF 5LBCA 3HOBA 1YFUA 1HKSA 1P4WA 4HBNA 2R92J 3RPQA 4GB31 1X58A 1D7PM 5DG1A 4B1RA 4AVCA 3H3VK 4P55A 1VIWB 3QWLA 3DCFA 3ZOIA 4CE8A 2MFZA 3ILFA 5B5EC 1MZBA 1VB4A 2XLFA 4QLCU 3BQZA 1OA4A 1XU1A 4KMQA 1JUHA 1VNDA 4XIOA 3RNSA 3O1OA 3OWTA 1JI6A 4JX5A 4MXWB 3NWSA 1JXSA 4QPGA 3Q8CA 3ZFGC 5KC6A 1POV3 3KV9A 4A7KA 4FT8A 1FOD3 2ME6A 3WX5A 1XSRA 1OKQA 4OMCA 2WT1A 3ZFFC 1XE0A 1E3HA 1WCMJ 3WODF 1YYNA 5F27A 2DBBA 4IHSA 5A7WB 1UHMA 4ETSA 1WMDA 1I1EA 1O5LA 1W8OA 1RUD1 1E5SA 2R1BA 1O3RA 4V2VA 2PHXA 4OI4A 1ON1A 4HRIA 2R7QA 5FLMJ 4BACA 1IRXA 4Q4V1 3OGSA 4QPOA 4G7OF 4Z2WA 3JD73 1J7KA 4CCOA 4IUGA 1IS3A 2MHFA 4Q4Y1 1VZ0A 2IGNA 1W9WA 3GNEA 2CHHA 5FZ6A 1BOBA 3GBGA 3HTUA 4XXPA 2DOAA 3N4MA 2FCUA 3IN9A 1FY7A 3OPTA 3FUOA 2R5ZB 2WNUB 2BBAA 4M4RA 4YRVA 3CCJI 5E1RA 2WNVC 1P8JA 1FI2A 2BDRA 2D97A 4CP1A 2CYFA 1ZZ7A 2LALA 2AQFA 1VBA1 4G8XA 1RXFA 5FR3A 1NCRA 4IESA 5JPNB 2B5HA 3W59A 1LOEA 2P0WA 3RI9A 3LSKA 3DF8A 3WGHA 4BUPA 3RI8A 2JA8J 3HTSB 2QYOA 1WMXA 4AEDA 3WUDA 2VASA 1WD4A 4AEJA 1LOGA 1YQ6A 2FJ1A 3VDDA 3J80Z 2VOKA 3MCZA 4JOMA 2RMU1 4UHTA 1ZTRA 4MGYE 3H3ZA 3MIEA 5A3LA 3BG7A 2QEXI 1F2NA 3GJBA 3J8F1 4KT5C 5E1XA 4AC0A 1D5VA 1L7QA 3IPVA 4XFHA 3NV4A 4WVVA 4GWNA 3ELKA 1R64A 2XJSA 4IL6C 1B35C 2X85A 1W5TA 1G3YA 3IB3A 1B8IB 4CXWA 1OJLA 5K0UB 1VJ2A 2YC4A 3CIHA 4PQ9A 5C7GA 2PJRB 2J1SA 4OQ9A 2EB7A 3LL7A 2UXNA 1V6KA 1YITI 2EIDA 2RQPA 3A02A 4WZFA 2XF6A 3TEWA 4AFBA 1EH7A 4N53A 5GP9A 5IYDJ 1HRI3 4A3MJ 1OKOA 5J4YA 4ANJA 4ESBA 2UWCA 2V79A 5CADA 3HQXA 1BCXA 1Y7BA 1KJLA 2VOOA 2B45X 4YWAA 5C4XJ 2ZB9A 1JUSA 4Q1PA 1E0EA 2JA7J 4GGGA 4ZC3A 4CSWA 2WL1A 1AR91 3JQWA 3A4CA 1K4TA 4AI9A 2ELKA 2I07B 2E7XA 5KAIC 2DMUA 2NOJB 3M7AA 2NS7A 3IAPA 3PO3J 5FKOA 1QO0D 3MKYB 2X6YA 1MS4A 2QWWA 3CP8A 3BCBA 4N9IA 4KN7X 1X1DA 4XJAA 3ZMSA 2XB6C 2VBBA 3VGIA 3AJZA 2EFOA 1DQ5A 2PLV1 5JCTA 2WFF3 4HT1T 2GXGA 1Y56A 4DRVA 2QDNA 3PVBB 3K46A 3V8LA 1JOPA 2VNGA 1VBC1 1BBT1 3AX4A 3IL2A 4OHYA 3I2KA 4YVSB 4EEFG 3VBOC 4QU1A 2HWE1 4XILA 4KIGA 3FKIJ 4Q29A 4AHWA 1UXZA 2HTJA 4BE2A 1TC3C 1ZK8A 4PUSA 2BWAA 3BR0A 2VBYA 1Y6IA 4UBGA 4L5IA 5LWBA 2QF7A 5BNPB 1NHAA 1FOYA 3J81Z 4XHXA 5FREA 4D9JA 4HDUA 1QJU3 4WVMB 3LF7A 2UY8A 4KITB 1F4KA 3S3MA 2RS53 1CX1A 2QQAA 3M1CA 3CUOA 3HIFA 1U5XA 2QBXA 1RIRA 5F64A 1DU0A 3I58A 3PUSA 3HT1A 1MSFC 1OUXA 1SZBA 1TNTA 2IS4A 1ODDA 2PTMA 2JVGA 3H7JA 3FBYA 3LOIA 4KT6A 5E3NA 2RAEA 2A5ZA 1V9U2 3NW4A 3VB9A 2BTVC 1GNZA 2VBXA 5FZLA 3THTA 5T52A 3GM8A 4FTBA 2K40A 3I9V2 4FX4A 1OSGA 4RQPA 4CDXB 5FPVA 4ENMA 4CYCB 4AEMA 3OBAA 1VBB3 2ET7A 2R7OA 1ERDA 4ET7A 4EJWA 4FPYA 4DUXA 4KU7A 2K0GA 3NAPC 3ZPOA 3KZYA 2V5YA 1A8DA 2KP6A 2AQEA 1VQ8I 5J7MA 5AVPA 3M7GA 2RNGA 2Y9YA 3UL2A 3PIOF 4QPGC 1YO8A 2BV4A 1XRUA 2DBIA 4LO6B 1VP6A 3K4AA 3K3NA 4MEYF 1VQMI 2R32A 2DDUA 4BQ4A 2QQ9A 4E2SA 3RCOA 2M4KA 1HW1A 1HB4A 1NY72 2P6SA 3SKVA 4LBJA 2BE5F 4XXAA 2ZFWA 1ULCA 2RDPA 1W06A 1OUSA 4B3NA 1R1UA 3BLYA 2LRPA 2HPIA 2QBYB 3DEUA 2E6VA 3V7CA 3BB6A 5F6FA 2OQRA 1T98A 3T08A 1XJAA 2BBVA 2A1XA 5BXXA 3FUQA 1LJ7A 4P08A 2E26A 3I2GA 1YI7A 4EJOA 2OC6A 3CCLI 2WTEA 5FK8A 1R1TA 2CV1A 1CAUB 2CL2A 1R22A 2FQ3A 5K5OA 5F5AA 1LQ1A 4MUVA 4QDQA 4A5NA 1JOBA 1FBSA 1BJAA 1G2HA 4YIIA 2A68F 2W00A 4B48A 4XAEA 3POGA 2ECBA 4QM8A 4P9IA 3D8CA 3WG2A 4WM8A 3OD0A 2FBKA 1JOJA 4IEZA 4QT6A 1NCRC 1YLFA 3MZHA 4KISA 3SMHA 4CEYC 4IEJA 2Y75A 3NRVA 2PHDA 1UMHA 5FY5A 5FRNA 4XLNF 3HG9A 3HJEA 4QQ2A 2OS2A 1LHOA 1SFKA 1ZZ6A 3VDDC 1FYMA 1RI7A 4U0YA 2BP6A 2WLPA 1NK3P 2ZJ2A 1PZ9A 5D5UB 4FFFA 5IJRA 1ZHFA 3H9QA 3I53A 4JQFA 3RZLA 2FUG2 4QWNA 1OCOH 3K4NA 3TO6A 4PLMA 1FWZA 2IZWA 3HSRA 3OBRA 1RC6A 1BI1A 3FHNA 3WE3A 3WP5A 2X0LA 3T2OA 1VQKI 3VSLA 3VD5A 2W57A 1WLTA 4YZ3A 1FMD3 5A3TA 1G3TA 1LDJA 1AKHA 4OFGA 4A3LJ 4R9BA 3TAYA 1Y1WJ 1DGRM 1UU4A 2IVIB 4ARXA 3DEMA 1H2KA 4KNCA 5JIUA 4JGZB 4XIKA 1W0TA 3OIPA 3I2HA 4BA6A 3E3VA 2KZGA 5FAXA 2MC4A 2F48A 2VJ4A 2RVCA 4BB3A 1W6NA 2Y2ZA 3ECHA 4I09A 2X1DA 1X82A 1VI0A 3OYAA 3Q5FA 4NHJA 4NPRA 5E3MA 2VZQA 2HWF1 1CZSA 4FCAA 2R16A 3KV5A 1NA1A 4NAMA 2RDQA 1NG0A 2TEPA 3IDAA 3D6EA 5FMOL 1UU5A 5KCMA 3ILNA 4XFCA 4M9SA 3KEQA 1C1FA 3S1NJ 4XIDA 2VNVA 1MBHA 3U9GA 1VQ6I 5JXIA 5CQGA 2XHNA 2R7SA 2CAUA 1J1LA 5ERLA 4GH4C 2CU5A 3C7GA 1T33A 3TQNA 3IV5A 1PUFA 2SBAA 1KS4A 1FYUA 3MD2A 5GZCA 3C7EA 5L73A 2UWBA 4L5JA 3R4UA 3K9TA 4HPQA 5FKNA 1PMHX 4A0XA 1SCSA 3LSHA 2ZEWA 5A2QZ 1XS9A 2A3YA 2O03A 1MS9A 2W25A 3H9JA 5JVVA 1VQPI 2VR4A 4RGRA 2BVBA 3RYPA 4L9NA 4COZA 1SBDA 4OOIA 3WNOA 1OVPA 2R7RA 4QB2A 3RWKX 1OD3A 5J1YA 5FZOB 1NQJA 1ZBE2 3AP7A 1LJ9A 1Z6TA 3WTZA 5JOXA 2RKHA 3GHMA 3K48A 2WIIB 3OYFA 3J7HA 4KWUA 3ZO0B 2OZUA 1I6XA 3PNVA 4XMAA 3ZRGA 5E17F 4ES8A 3V7SA 2OV7A 1Y9GA 2W92A 2KA3A 1TQIA 5LGNA 2GNTA 3JRFA 4QQHA 4XDOA 2QVOA 3W6VA 1WJDA 2P3YA 3W6KB 2KR2A 2BXYA 2L02A 2OAZA 1HQCA 4ZKTB 4D1QA 3CLOA 5LCWL 1W2OA 4IERA 1S0DA 3P6BA 1PGW1 3CLPA 5FFZA 3IC7A 2VL4A 2ZFUA 1UZZA 1AL21 2JG8B 3AG1H 5J4VA 2PMWB 4CDGA 5A33A 3LA2A 2DJIA 2X6WA 3K4ZA 5D4RA 3J7LA 4MQVA 4RQPC 3HRSA 4B4CA 1LNSA 1TMF2 1SFYA 4EWDA 5T50A 2VGDA 5B4XA 1RVF2 2TNFA 4BJ0A 4XVHA 2OU2A 3F8BA 4F3JA 1GZCA 3G1LA 4HF2A 4PCQA 5JXJA 3S57A 2A3XA 3IWZA 2HVRA 2BGOA 3C7FA 1OQ1A 4LA2A 1OLRA 2L7MP 1S0GA 2BY1A 4XRSG 2OQ6A 2DMPA 2P1BA 3JW4A 1KEXA 3F8MA 2EFWA 4AIDA 3SFIA 1DGWY 4UY8I 3H8UA 2M30A 3S5QA 3VYRB 1HJGA 1YNAA 4KGGA 3FL7A 1FOD1 1BM9A 1PNGA 2QQLA 5DDJ3 4S04A 1T39A 3A22A 4RM2A 3OD4A 1T0FC 2L4AA 2DU0A 1R092 5FPUA 3N3HA 4IE5A 3KD4A 5DDGA 1QGLA 1GLNA 1TBXA 3JRCA 4Q4W2 2IS6A 1REFA 2J1EA 2WYSA 1UY1A 2A73B 1LB2A 1YS6A 1PO22 1Z78A 1YQCA 4D8MA 1ETOA 5A1LA 1T2KA 1ZYBA 5I91A 2JWTA 4EMSA 1K5JA 4FPLA 3OS0A 1WWYA 1SAUA 2JB8A 2I8DA 1R49A 2DCKA 1BKZA 3VZNA 1SFXA 1O4XA 4B8EA 1JGGA 3M2MA 4K21A 3KLNA 2WNOA 2YX7A 4Y13A 3ZMTA 3AP5A 3CCEI 1YI2I 3KB5A 1OFCX 1GVJA 1CAVB 1OYIA 4YZ1A 4PF1A 3QYFA 5L3DA 4ZPIA 1GP5A 3FHZA 2CFOA 2DDAA 3UJOA 5FYYA 1JUPA 5JZGA 1LHUA 2WABA 3IKVA 4U7BA 2XKPA 3ZR8X 3SJMA 5L36A 3O1PA 2VCAA 2EK5A 3ZN0A 2MEV1 4ITCA 4W8JA 2XF7A 2HZDA 4JP0A 3CJIB 5KNLA 4MHUA 2XONA 3O1SA 1OH3A 3PUAA 1ETXA 1IJWC 5BPIA 1YW9A 2XC7A 2NN8A 4FFIA 4ZXEA 1WJ5A 2DAOA 1BBYA 4I6ZA 4LT5A 2VJXA 5JUVA 1FV3A 1GR3A 2HQRA 2CUEA 3DL3A 2W1UA 2ZMEA 2A5WA 4MVTA 2PLYA 1WMEA 5IFPA 1JHJA 3MLKA 4M0NA 2C6YA 4BL0B 1LU2A 5IPAA 2X09A 5FLXZ 3HAGA 2LKXA 1UF2C 2D93A 1FPQA 5M3FJ 3POBA 4I0BA 3NNFA 1NA1C 1UB9A 2ARXA 3PMSA 5BNNC 4MXVA 2YC2A 2WY7Q 5F7UA 2UWMA 5CKMA 1ZZCA 2D6LX 1F9NA 4LJZF 5LA0A 4DY3A 2YU9J 2XUMA 3ESWB 4QPIB 5FFOC 3FBMA 4HQEA 2Z42A 1GZWA 5CLSA 3Q0VA 4HAMA 3FN9A 2L9VA 5FP7A 3BPSA 5J36A 4Y5SA 5HDNA 4XUPA 2ZEYA 1H2NA 4M3CA 2DTZA 3I5UA 3MZYA 1QQP1 1XSDA 1RUOA 1WZ2A 1W6PB 3ZDVA 1FNYA 2WFF1 2XQXA 1D0YA 3DTEA 2BW8A 5DUWA 4KN4X 1HXS3 3MMYB 2OUHA 1TP4A 2JENA 1W8NA 5FYZA 4XJWA 1Q1HA 3JBG3 2NVXJ 3K75B 5FV3A 1YIFA 3AKTA 1EAH3 1SANA 3FXLA 2IUWA 4K7JA 2FA5A 1MACA 4K8RB 5EJ1B 4LBMA 3FX3A 3N05A 1BEV2 2DVFA 1XC5A 2K9NA 3BG3A 3M4FA 3KEYA 3HYIA 1GMMA 1QJU1 3DUIA 2E60A 3R0RA 1VBE2 4PBOA 2IS1A 3K70C 2RS51 5JLWA 4OLLA 2C1FA 1DDNA 4JK1X 1D0ZA 3ZXGA 2H6BA 1D1BA 4CZCA 3T0YA 1DGLA 5D8AA 4DZPA 1GWLA 3SFZA 1A3KA 2QSGX 2VCBA 4FPJA 4PZJA 3H9GA 3P1IA 1H89C 3A01B 4GJYA 2AHQA 1FX7A 1BMV1 4Q47A 1MS8A 1XB4A 4EN9B 4HL0A 4PIYA 4II3A 4YG0A 5EFUA 4CEWA 1I5ZA 3H5RA 2DVBA 3DXTA 4FXKB 1VBB1 5EJ3A 2DO7A 4A3ZA 3PL0A 1TZOA 4XOTA 5BYNA 3SHRA 1ZBA2 2JN6A 3SHFA 3V0BB 2G9FA 4XICA 5EF6A 5FPAA 1NOVA 4M71A 2FE3A 4N7IA 4XC9A 4TWTA 5IT3A 2E7QA 3DPRA 1UMIA 5BPXA 1GXPA 2CQ7A 2LBFB 5A3UA 3E6MA 1TWHJ 4M3FA 2VXRA 4Y20A 2ZGKA 4XF0A 2Z1DA 4N90A 4BY7J 1WMFA 2XPJA 3OUJA 4R8HA 3WTUC 1QHDA 4XLHA 5ED4A 3WF3A 1ZN2A 1MW7A 2E63A 2XBO2 2R063 3ZSKA 3ZXEA 4HEA2 4QGMA 5EDNA 2HBTA 2W94A 3HKZA 2A70A 3I0TA 2RJLA 4IE4A 3FBNB 5FMDA 3USUA 4OI2A 3KP5A 3QOEA 5EYXA 1A6QA 2UZKA 2PHFA 5FZ1A 3R4DB 3LEMA 3SH5A 4RM3A 3CF5F 2WSUA 4DIQA 5E88A 1EUUA 2UURA 4V2FA 2ZGQA 1CD3G 3ZMUA 3HC7A 3MEXA 3ME2A 5GAGJ 4F91B 2HOSA 2XASA 3MO4A 5G05L 2IPQX 3DWLE 1WCKA 3OF1A 3POFA 5C8CC 2JD9A 2W68A 5DD8A 4IOAF 2VC9A 4BM8A 2F5VA 3KT4A 3M8EA 1AJKA 4DOZA 5FYCA 1UWWA 5F04A 1H4HA 2BRTA 2EXKA 4J01A 5LBEA 3CCSI 3AZXA 2QCOA 1P9QC 5FLVA 4ENNA 2CAVA 2KMUA 1CPNA 1TE1B 3PIJA 1JUIA 2PJRA 3SH4A 4O61A 4XAAA 5CB7A 2MNGA 2ZMEC 1RC9A 5ABJB 1FMD1 2HEYF 1S1AA 5CYYA 5FWJA 2DA3A 2FZ2A 1JBCA 5F5CA 1V00A 4M74A 4YGDA 2QUFA 2M9HA 1XGMA 5EP9A 2HU9A 4OHZA 2JUGA 3VBHC 2XVCA 1AL0G 2Q5TA 1OYWA 4OZOA 4EATA 3HZJA 3LEIA 2MH9A 4ZDOA 1WD3A 4IO9F 2VNOA 5CVIA 2JA2A 2IXIA 3MV11 1Q1VA 2F4OB 4OIQF 1X33A 5T5OA 4B3XA 2RM23 5IUQA 1P7JA 4EM0B 2X10A 2WYFA 4PK4A 3O0XA 3PNTA 2G0EA 5TJJA 1PX3A 3H1YA 3JB4C 3BTAA 1DPRA 5ICCA 1RUE1 3VOEA 3IP4B 5FYSA 2NLRA 2Y34A 3POYA 1ZRRA 1H4GA 2FMDA 1DGWA 2WN2A 2Q30A 5LK5A 1GZ9A 2WB1N 3TWIA 3IZOA 4WM7A 1PJRA 1C57A 4PDWB 3I3DA 2EIKH 3B6CA 1MDMA 4Q0PA 3I2JA 3DF0A 5IY5H 3TBDA 2WZR3 5A1AA 1MEC1 1B09A 1FIAA 4LKEA 3PO2J 3GF2A 1LE8A 3K51A 5BNPA 1TWGJ 1ETYA 1WZXA 4MO7A 3ZN1A 4CP0A 1YE9A 2Z33A 5ILSA 3JZVA 4Y22A 3FK6A 3HN3A 1W6QA 3TOBA 4R9DA 1IN6A 1FAYA 3CC2I 2ZGMA 3M3IA 2JZYA 3TN92 1J5YA 3B9CA 3QH6A 3UR3C 2UXXA 2HS5A 3HGGA 3ZYPA 1GOFA 2VBDA 5C71A 2VQUA 5BQTA 2B9SA 3OSDA 1XC6A 3HOZJ 5EEGA 4QTRA 4MO3M 1SACA 3K0LA 4QQLA 2V9VA 5FD6A 2HWD3 5ERIA 2MLGA 1H6XA 1RUI3 3OUIA 3OS1A 3GTOJ 4QAWA 2JD4A 1XPXA 4LO5B 3GBWA 4CDXA 1K45A 1R5ID 4CYCA 1YWKA 4FOWA 3KYCB 3E5UA 4H2AA 4B1MA 5HV4A 2WAQA 3HMYA 2DA5A 1PM7A 1OBNA 2ZGUA 1D8KA 2D44A 4Q8LA 5F08A 2X53S 4CCDA 2XB0X 1X19A 1YHQI 3URFA 1EV7A 3FXOA 1UAAA 5LRSA 2WAOA 4W4ZA 2KJCA 3C3WA 4BMBA 3F23A 2DODA 3GBFA 1XSQA 4XZPA 4XYXA 2KDZA 4RB0A 3CCVI 1TMF3 3JRIA 1S2BA 1NYWA 1R082 2JDUA 2VIXA 3ATGA 3AG2H 3GTLJ 5L3FA 1JZ4A 1RVF3 1GNYA 2FNAA 2YB7A 2LF7A 4AU7A 4BU2A 3F8CA 1UY3A 1S0FA 2ZBJA 3VYTB 1EPZA 2VY0A 3O0VA 2BWCA 3WNLA 3O5SA 4U0VA 1CONA 5DDJ1 1QMJA 3BUCA 1KFUL 4IGOA 1BI3A 4Q5SF 1VRH3 3TL4X 4B29A 2VBWA 2E36A 5L3GA 3MLLA 2H0VA 3ZFEA 2ZABA 2HWVA 4M3BA 5ACA3 3FM5A 3AFGA 1TTYA 1W3VA 1VAMA 3OV8A 4UW5A 2QCSB 1OISA 3N97A 1ZELA 1PK6B 4FETA 2WNUC 4NVPA 3ZFGB 1R093 4CP2A 3HRTA 4BE0A 4A3DJ 1HKDA 4PDKA 2DXIA 4RGSA 3FWEA 1NK2P 4IHTA 5JOZA 1PO23 1H9PA 5JOYA 4MYEA 4GWMA 3WG9A 3NV3A 3BPVA 3R05A 2GP5A 3AKZA 2HZTA 3DYMA 1LPQA 1IV6A 1C5HA 1H2LA 1JODA 4B7KA 4B8XA 2QZ2A 3O0WA 2X1CA 2RR13 4XETA 4AFDA 3SNMA 1LHNA 1FNZA 1YFHA 2VMFA 1X1PA 1REPC 5F5QA 2O7OA 1DFQA 1R1ZA 2FMLA 3H9AA 4XORA 4KUMA 2ECCA 4O6JA 4JQRA 1AYN2 5D6FA 1ENSA 1MNMC 3VBUB 1AWCA 4BYYA 2AZ5A 2D3SA 2W3JA 2QENA 1AA7A 3BU7A 4ZJZA 5K0UC 3APBA 3P5BA 1ZNPA 4B09A 3HM5A 1ZREA 4XCAA 3GZEA 5FP9A 2G1MA 2PQ8A 4OI1A 3CF2A 3HNBM 5HCHA 4FASD 4P5OA 3IIAA 4IPAA 2LTNA 1E17A 3PDQA 4YW6A 4FFGA 1L0OC 3QD6A 2LVSA 1V5EA 4EN8B 1H1MA 3FXUA 4IETA 5LBQA 4DBQA 5GZGA 5DZEA 1XMAA 3MIFA 3H8RA 1U5TA 4BBRJ 1ZLKA 1TG7A 5L3EA 2DCEA 2K7LA 1WKYA 1S0JA 3KF3A 4IE0A 3JAMZ 1TME2 5EV7A 1XOYA 3M8LA 3LDBA 3DCQA 2ZEXA 2H0BA 3RIRA 3ZMNA 3WTTC 4IEWA 3U75A 1XNBA 5IK4A 1IDYA 4UFJA 4U0WA 2LYCA 1GOHA 2DFFA 3EYYA 4AYBA 1AHDP 2IFWA 4AIJA 1REDA 2D6MA 1KYWA 3P5JA 1YJLA 2DTRA 2KM2A 4DNYA 3SZTA 2HXIA 2C9KA 4C3JJ 3I3EA 3ITQA 4J1XA 3WGGA 2DCYA 4YVSC 1W8TA 1AX0A 1LOAA 4D69A 2ESNA 4N0BA 2W48A 5EHDA 2WLQA 3Q8FA 3L2CA 1QIQA 5BNPC 1WCUA 2LH9A 2L2OA 1GP6A 1HXS1 5A6QA 1KYZA 2P4WA 3AP4A 2VZ1A 1YRNB 3W3CA 3JBG1 1BZWA 2OYZA 2XJRA 1EAH1 2MH2A 2DT7B 4HFSA 4XQFA 3L2VA 4HLTA 1K78B 2FOKA 4C0HA 3MVPA 5HVQC 2I2SA 3X29B 5A3MA 1CGPA 2O14A 5EQUA 4Z92B 3GFIA 4BAYA 1HBXG 5A6YA 1ZR2A 3B00A 2OPKA 2E1CA 2ZGTA 4BLIA 3EPZA 1LHVA 4A6DA 3HPHA 1DU6A 2HEOA 3H7YA 2LD5A 1BEV3 3NV2A 5F9TA 2FQPA 4CDXC 4IV3B 4YFWA 2E31A 3WTYC 1KU9A 2NNNA 2ICWG 3EHKA 4AFMA 4LBKA 4GXOA 3IAM2 4BISA 1ULYA 1SEUA 1K7AA 5DCFA 4C3IJ 2M8GX 2W84A 3AVSA 4NRPA 2RC4A 1BLZA 1V6MA 1UOJA 1KRIA 3THDA 5IYBJ 3UKVA 4RBOA 2LTPA 5FLIA 4LE3A 1JKPC 3HUGA 2CWEA 3I59B 1FSHA 3K77A 1EJ9A 3VHOA 3M07A 1B72B 4YW4A 2XVGA 4XF1A 1ASJ3 1SCRA 1VTNC 3B93A 2VN2A 4EZHA 1V5FA 2SLIA 1DYKA 4XUQA 4AM3A 4OMYA 2V72A 3WZ1A 5IP7J 5IT9Z 1W9TA 1JHNA 1ZA4A 1T6BX 1S0IA 2NMOA 2O8XA 5FYHA 1MJBA 3QODA 4DEVA 2OJED 3BZ6A 2HWC2 4MV2A 3L2YA 1CF7B 1K79A 4E8DA 3N9NA 3NNGA 3KZ4C 1RMU2 1IG7A 5FP8A 1FEXA 3R60A 4JX0A 4Q48A 1W1WE 2KKOA 2L7KA 5E1ZB 1UYXA 1DPUA 4XF4A 3BT9A 4A7YA 3GTJJ 2R061 1NY71 3L9JT 2VW0A 3I2FA 3ACFA 4B3AA 3ZPLA 2RS32 4C90A 3IIIA 2VTFA 1KU3A 2LR8A 1ULDA 2HH9A 2B4KA 3ML6A 5C70A 2KL4A 3COAC 3VDCA 2XBO3 3FM3A 4K40A 2XGCA 1HV0A 3KE2A 1APNA 1L7RA 3U1DA 1UX6A 3M1EA 1G9AA 3S2DJ 2LUWA 4NMIA 2YR2A 2B9UA 2B9VA 2CGPA 4QX7A 2E2JJ 5F3CA 2GN3A 5AVAA 3S17J 2MABA 4HG6B 1OKRA 4HSLA 2X48A 3D1NI 2F5CA 2XHKA 3ZQIA 5FKBA 4OMZA 4GULA 4BQ3A 3VLBB 3DPUA 3GZNB 1M4WA 2W4SA 2Y0SN 5H9SA 3HOXJ 1QJX2 3A4UA 5K4LA 2HOAA 1JZ5A 2WO2A 5LFAA 4UW3A 2JG9A 1X36A 4XF9A 2RJKA 3D0SA 1CZVA 1UIKA 5FZ8A 5D5XB 3GJAA 1IGOA 2Z2SB 3AMNA 3S0MA 4JGZC 1LEBA 4DQ2A 3NL1A 5IVBA 5JLXA 2H8WA 3IM0A 4Q5OA 2GNDA 3KF5A 1GWKA 4AD9A 3P3NA 3OYBA 1QH6A 4AEDB 3LQRA 3RJ2X 4XSXF 1WBFA 5B1BH 3VDDB 3DKYA 5IATA 3TDUC 3ENRA 2ORZA 3PVOA 5GKAC 1Z7S3 4L5EA 2RM21 3IPVB 5F0CA 3VBRB 3O8GA 3TO7A 2R5YA 4FQGA 5AFBA 4PBPA 2LY2A 1G4DA 2OXBA 2DFIA 4Y1XA 4OULA 3CMEI 4E2QA 1O7FA 3GVAA 1N1TA 2L9SA 3Q0UA 4A42A 2CV0A 4KGQA 1X3UA 4N8MA 2LREA 1MBGA 1PGL2 1D8JA 3VFZA 2DMNA 1W6PA 4N53B 1O3QA 3ZMDA 3U11A 1J59A 1XQNA 4JX4A 4TV7A 5J37A 1XDSA 4B4RA 4AW7A 1IN7A 1W6MB 4OU0A 3OYDA 2PMZN 4YEJA 2O8QA 4MQ9F 4DUWA 2WZR1 2WAEA 1JTYA 3PUFA 2M4GA 3L2UA 5FZDA 2DVGA 2EZKA 4MZUA 5TGTA 3V42A 1TWCJ 2VW1A 2WT0A 4NWVA 1RESA 2QQIA 3DLLF 4P00B 2Y9ZA 3ST7A 4M00A 3RMYA 2HFHA 1SBFA 1RRJA 1S7AA 2FD5A 3ZN5A 4CU7A 1QPMA 4LHNA 3B73A 3CO7C 4IHYA 1REEA 4RLFA 4OMDA 3HSEA 2VT3A 5J96B 3A0BC 1D2SA 2JG8C 2RGVA 4JDOA 1MZ6A 2ZBKA 1D4M2 5LATA 2VQ0A 2ETHA 4QXHA 1HDKA 1WKMA 3DXUA 5F2WA 1WJAA 4XJ9A 3TN93 4XLEA 3RJRA 2EIGA 4LLGF 2TUNA 4XPVA 1RUI1 2EV5A 2X5IA 2IJLA 2AGSA 1LEDA 1GOGA 1WJEA 3EYPA 4NOTA 4IGPA 3DU5A 2XKOA 4KL1A 2XAHA 3VD4A 1JYWA 5KHHA 1CAWB 2CUZA 3V0BA 3KFWX 5IOZA 1MBFA 5E8GA 3HWJA 4WXDA 3V8KA 4BGDA 2O0YA 3BC8A 2W1QA 2JICA 3DLAA 3UYJA 3D5SC 2NQYA 2GA2A 1FPN2 2HJIA 1TMF1 4P1WA 4AHXA 3RZHA 4H0EA 1RHI3 3KHBA 1MMAA 2Q2EB 1TL8A 1DQ4A 4XKCA 4LJHA 1RVF1 4FAHA 1WGPA 3ZXJA 4XKVA 1PP8F 3OUHA 5LZ6A 1HQNA 2EA2A 2VUJA 3PU8A 3I4NJ 2GNBA 3J7YJ 1GQHA 1LGCA 1ULFA 2AO9A 1VPHA 2W24A 1R083 4UVBA 3C2GA 3SDBA 3ZXLA 1X1CA 4EE2A 1VRH1 1D5YA 3RRDA 1E2XA 3S1QJ 1UXXX 5A32A 2FMYA 5ACA1 2Q1ZB 2WFPA 1JT6A 5T54A 2VKHA 3CO6C 2ZJQF 3WF0A 3LIHA 3S1RJ 2XWBB 3AXDA 2Z99A 3REOA 4JBAA 3HOWJ 1R091 4B44A 4M3EA 3M4OJ 1ZA7A 4AIKA 2EQRA 2QUOA 4IJAA 4PI2A 4C91A 2W1OA 1WI9A 1S7OA 1SG3A 4RYDA 3VKOA 5KXCA 1PO21 2E7AA 1H0BA 4BEHA 1B1BA 1GQGA 1K61A 3KGZA 1UYYA 2Y0OA 4UXAA 1HJFA 2VJIA 1YS7A 4QSHA 3AM2A 3RQ4A 2WQZC 3CZJA 2WWSA 4G3YC 5IFTA 1OA2A 5HXVA 3EUAA 2ZX1A 5FOJB 4BPZA 5BV6A 3CJIC 2R7XA 1RUH2 4O9EA 3F8FA 1CQTA 3OYHA 4A5MA 5H2FC 1JKQC 1GWMA 2XF5A 3BR6A 1OLTA 3LQQA 1OMIA 4BLJA 2VZSA 3K4CA 4NE9A 1CQ9A 2DU1A 4G7HF 1ETWA 4QDRA 3K4DA 4COVA 4AVTA 3G1OA 4Y5Z0 2LS6A 4RAGA 2EV6A 1AXYA 4LK0F 4WM8B 2L3DA 1AYN3 3M8FA 1PIV3 3O12A 4IDZA 5JPMB 1C5IA 5CVUA 5FZ7A 5EXOA 3H36A 5J48A 4AI3A 1P6RA 4XLCA 2BERA 2VQCA 1DQ6A 5GZEA 1G9FA 3IDCB 1U3EM 5T55A 1XYNA 1IN4A 4HBLA 3H92A 3S2HJ 3OL3A 4Y5TA 3VL8A 1N25A 2LC2A 5CNAA 3GTQJ 5F3GA 3J4UH 4QPIC 3PM1A 2O8OA 3ZQQA 5KXBA 5GTHC 4GZ9A 1R36A 3UKGA 3ABTA 2DI3A 5E16A 5FY8A 1A8MA 4BQNA 2IXKA 1SLTA 4IQJA 1MQTA 4MGSA 5F3EA 1AKHB 1RZ4A 4WBBA 5E1WA 5L9RA 3N7KA 2XPUA 4NHKA 2D1VA 2OQ7A 5A3OA 4ON0A 2GH2A 3GW2A 1TWAJ 3B9IA 2M5WA 3I4MJ 4XM3A 3WU2C 1TME3 3CC4I 2ZZJA 4A3IJ 4LB6B 5K7HA 3ZYJB 2GSYA 1V6OA 1JJ6C 1W6NB 4YM1A 2L54A 1BXHA 1H0MA 3K4MA 3PQJA 2DLLA 1NA1B 2QQ8A 1JKOC 2DUQA 1Z9CA 1IUYA 3BTZA 1BIBA 2ZACA 2LSOA 1W90A 2ID4A 2P3IA 2P6CA 4L9BA 2HXOA 3K4JA 4H55A 4OHXA 4V2WA 1HOMA 4L0PA 4I0WB 3BOWA 2X05A 2PLV3 3SC7X 2PX9A 1O4ZA 1SLIA 3M3CA 1R71A 5FPXA 1IRZA 2VKEA 1X8MA 4X6RB 4BQAA 4A4AA 5HCFA 4L97A 4KNYA 4AR2A 3ZXAC 1R1VA 2V26A 5AC92 5K7FA 6PAXA 5AONA 3WE2A 5FO7B 1EH8A 2LROA 5A80A 4OAZA 1K4SA 1FOXA 3Q0WA 2CSGA 3JCUC 2H27A 1UYZA 3C18A 3RZMA 1QNYA 2WSVA 4C2MJ 1BEV1 1QGPA 3BU0A 2X5IC 5HCAA 1KQ9A 3TOJA 3WQ0A 3ROUA 3DTIA 2J1VA 5GPAA 1O59A 2BHYA 2DQRA 2ZKZA 4GMP3 1Y9MA 5KR7A 1SFPA 4UFKA 4Y1UA 2ZHKA 3JREA 2VO5A 3RVHA 4RFT0 1P4AA 2G9GA 3RZZA 3A03A 3ASIA 4W97A 5DAPA 2Y0IA 4HN0A 2JDNA 4GDFA 1B59A 2XROA 4UBHA 4WX9A 4CZSA 3MPBA 2DTYA 3U4XA 2D6NA 4AAPA 3JB8A 2P6TA 1WHUA 2GMMA 4EM1A 3KV6A 1C1LA 3LFIA 2PHWA 2CTVA 2V5DA 1DU3D 4K1YA 2NMNA 1XN7A 1TVGA 3LFMA 4BXFA 3AP6A 2K86A 4ASMB 4QHBA 1Y8QB 4DXSA 1ASJ1 3WU1B 5A33B 2C4XA 2XL7A 3RKWA 4S2HA 2WADA 2Y26A 1MMNA 1QWRA 3W6JB 4M3CF 3H0GJ 1DQ1A 3RKQA 4TSVA 3VZKA 1Q8VA 3CMAI 1YIOA 1YFWA 4P02B 1D1CA 2ILMA 4PSXA 1JS9A 4X6AJ 4YG3A 5F6KA 1OR7A 3LFKA 1VBD2 5IWFA 2L9LA 3GALA 3IH2A 1Z67A 5BNGA 2JE7A 2GOMA 5IVYA 2WQ4A 2JUCA 1WA4A 2JVHA 1MR5A 4O9GA 5CFCA 2BFUS 4GALA 4NJ4A 2HWC3 3WV6A 1W4MA 1PO12 1YG2A 1RMU3 4LK1F 1EUTA 1P7IA 1WW5A 4GXLA 4YGCA 4M01A 4YPJA 2YBSA 2DMQA 1DBNA 4KU8A 3NNJA 2VONA 1VAVA 1RNLA 2XBO1 2EF6A 3O8HA 1MIJA 4OHVA 4NAOA 3SEPA 2RS33 3TEZA 2EAAA 4XJUA 3S16J 2Y8KA 4LIUA 1ZZ9A 3GYDA 5EJZB 1PMIA 3MHZA 4KG0A 4C8DA 1ULPA 4IOCF 3I54A 1W8WA 3I4PA 2WO7A 5A7OA 1YJWI 1LDDA 2CY6A 4IGQA 4AQ6A 5FYIA 3C7JA 4Q4V2 3AMMA 4OUEA 3FISA 4ZU4A 1NG6A 1NZIA 1KXGA 3TBIA 1XNAA 1RXGA 2CW7A 1LDKB 4Q4Y2 3BR3A 1D0XA 1XPWA 5ABJC 4YGEA 2KRCA 1GICA 4YRDA 2V1XA 4HKWA 1UY2A 2K4JA 1F4AA 1TEIA 2WZEA 4YG2F 3RZOJ 4RS5A 5FZCA 2LLKA 3UETA 2Y6GA 4CDUB 4Q4ZF 5JZGB 4ZYGA 4G12A 3F72A 2EINH 2ADDA 4Y3OA 1DUXC 3N9LA 2LFBA 1HDPA 4ARYA 3ZN4A 4LNVA 3PMEA 2FBHA 2NP0A 4XLPF 5F8PA 4AQ2A 2JA6J 4FPFA 4Z6YA 5DAVA 4CUAA 5A3PA 2IVJA 2A6YA 2LMDA 2FX0A 4COYA 3RYRA 1JU3A 5CKQA 2JDYA 2IA1A 3IWFA 3CESA 2AH2A 5F5IA 5GLTA 1BJQA 2VUAA 2XGXA 2B0LA 1ND3A 3UKTA 4D5CA 2BOJA 5L19A 3FZVA 3PU3A 3S15J 2ZMEB 5FRMA 4HW0A 2D43A 3OIOA 1IPSA 4DYCA 1YX5A 2ADEA 1CAXB 2DF7A 2HWF3 2ZX0A 4KI5M 3LSDA 4D94A 3FXRA 2VU9A 2NVYJ 3K1MA 2L5QA 3ZQGA 4M73A 2IVMA 4NDLA 5BNQA 1MVQA 1W04A 2UY9A 3LSRA 1UZCA 9ANTA 5CBLA 5FTTC 4F93B 1H8TA 3FF5A 4NIDA 3GX4X 3MBWA 2JTVA 1XGSA 1YRNA 1YQ5A 3LWFA 4U87A 3RKXA 1R5GA 4RB2C