4I0BA

Structure of the mutant catabolite gene activator protein h160l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Catabolite gene activator
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0bA01
3TO7A 4RB0A 2QENA 1T38A 4HF0A 5FD5A 2XHKA 2MA3A 5BS6A 5LHGA 2K0GA 4HZFA 3ABTA 1TQIA 5J8FA 4LG0A 2HYFA 4LA2A 3P9IA 5BOXA 1RNLA 2EA7A 5L3GA 2L4MA 2HR3A 3RDIA 3FMRA 2Y75A 2Q4SA 3IDCB 5K1YA 2QLZA 4MZUA 3SQNA 1T39A 2AXLA 1YW8A 2XRNA 5HLGA 2HS5A 3R6SA 3FF5A 4IRIA 4AWXB 3HRTA 1SFXA 3IRQA 1ZRCA 3JW4A 3O14A 1MJBA 5D5VB 2Y0OA 2ETHA 2H6BA 2P7VB 1FZPB 2O8QA 1IUYA 2RV8A 5IT9Z 3L9FA 2XROA 1TQ5A 4CGZA 4M6XA 3DQVC 5FB2A 2ZKZA 1DP7P 3CJXA 3WTVC 2YX4A 2PI0A 5DEQA 4I02A 3B02A 3E6BA 5DCFA 4Q0UA 3NVCA 1KYWA 4L2NA 4Y15A 3ZN0A 2KXLA 2CAVA 2Q1ZB 1I27A 1O5LA 4QMAA 2QM3A 2VE8A 5L3CA 1G3WA 4ENJA 2VECA 1MDMB 4HAMA 4UNOA 3WTZA 5I93A 5H20A 3RIRA 4O6JA 4P9FA 1FWZA 1QWRA 4G7ZF 4AXOA 4IEZA 3HUGA 3KEQA 3OF1A 3TO9A 4WF2A 3VOEA 2GQQA 4YNIA 1A04A 5CVJA 4LJZF 1DPRA 5LGTA 5DUIA 3MCZA 3J80Z 2QQBA 1ON2A 1P2FA 1J0RA 3QP5A 5D8KB 1DUXC 4Q29A 1XSXA 4CDGA 2VOPA 2I45A 4AQ2A 2JPBA 4Q0QA 2ZKLA 3FXQA 5TRDA 4WXHA 4OIQF 1B9NA 5JSOA 1Z7UA 2QVOA 4RGRA 1CAVB 2HWVA 2XAQA 4LGWA 5CYVA 1JE8A 5LEKA 3HHHA 2FF4A 2GH2A 3CJNA 3DEUA 2XLFA 4XF0A 3N97A 1I1GA 1MKMA 5AIQA 2PMHA 2BNMA 1KQ0A 5F64A 1J3PA 2HQNA 1IN8A 1U5TB 2M30A 4EM0B 1Z6TA 2EFQA 3RYRA 2QZ8A 1VJ2A 2QJVA 2DW4A 3BPZA 2GA2A 2PAMA 4IEPA 2KIFA 4OLLA 1XSDA 4IHSA 2XAGA 1KA8A 1DGWA 5DD4A 1ZH5A 2GWRA 3IWZA 2M8EA 5KHKA 1SD5A 3K2ZA 3WG9A 2K4JA 2VQAA 2AS5F 3RYPA 1YWKA 2F5FA 1ZGAA 5BPDA 2XKOA 1VR3A 4FAGA 3GFIA 4DNCA 5DV5A 3IDBB 1XGOA 1ZZ9A 5D5UB 2QWWA 4IEWA 3S7IA 2HQRA 5HDGA 2K9ZA 2IXIA 1SQ4A 4CZZA 2O1QA 3Q9SA 3BU7A 3L00A 5D5XB 1W5SA 4XF1A 4KNYA 1ZRRA 1O4TA 1G3SA 2K4BA 1CAXA 3HOTA 4UVCA 2VC1A 1P4XA 4HQMA 1IRFA 4BHBA 4M6YA 2STTA 1S8NA 1MZBA 2R7FA 2UYAA 4LUKA 1SMYF 3J81Z 4PIZA 3OCPA 4WXDA 1ZYRF 2PMUA 4QLCU 3F8FA 3H3UA 5T3NA 2KJCA 2A6EF 2QQ9A 2ZNZA 4EQQA 2QQAA 3VFZA 4O3MA 2PFWA 3I71A 5LHHA 4EV0A 4JVAA 1T6SA 4ESFA 1J58A 4IXAA 3T8RA 4IEQA 1ZARA 3LWCA 3BPXA 3V4GA 4ESJA 1K78B 4XFIA 5KK1A 2PHLA 1BC7C 4ZZDA 4LULA 3HQXA 5CU1A 3GZ6A 1T2KA 4HN1A 2O0YA 4L5JA 3IBMA 3EUHA 5CJ9A 3IRRA 1U5TC 2BNNA 3BALA 3EETA 3SCGA 5CVUA 2F5DA 1EV7A 1FLIA 3DN7A 4FBFA 1MJAA 1F9NA 4EMSA 1YHFA 1SD6A 4L0ZB 4ESBA 3I58A 3GO5A 1FP2A 1TLHB 3Q5FA 3NW4A 3FMSA 1UPIA 2L01A 3QU3A 3RKXA 1UIKA 2Z2SB 3GEZA 4RAYA 4XFAA 2XL7A 3GBFA 1R36A 3HSRA 4KWKA 5C8WA 4A12A 3CTAA 3BB6A 2A69F 2P4WA 3P9CA 2MPFA 4KU7A 4O5VA 4A2UA 5D8LB 3L2CA 1SEFA 1W4MA 3EQEA 1BJAA 4JTNA 3CF6E 2M87A 1I5ZA 4BHPA 2P17A 1KGSA 4KIGA 5JSRA 1U6GA 1R23A 4HVRA 1GQGA 4Q47A 2CW0F 4CXFA 3KP3A 4MX3A 4A5MA 3FFQA 4EROA 5JFRA 3QACA 2F4PA 5EZWA 2XV4S 4EWEA 4MGZE 2OA2A 1QPMA 3ULQB 2DI3A 4M72A 4N9HA 1YFUA 2VBZA 1ON1A 2VBWA 4AQ6A 2KIUA 2QCSB 1B59A 4Y13A 3IC7A 1R1UA 3E6CC 4BXUA 1XMKA 2FBIA 4HVOA 4YIIA 1PDNC 2HKXA 2PJPA 4O9EA 4MTEA 2J5OA 4IERA 5EEGA 2YSRA 2BYVE 3FXRA 4DINB 5JAXA 5D4SA 4K2EA 2FNAA 1FXZA 2E9QA 1RC6A 1TW3A 1Z1DA 2Z99A 2PTMA 2PQQA 4S05A 3ACLA 2ZCWA 3CUQA 3TDUC 1DPUA 5BPIA 1Y3TA 2GAUA 2V1XA 1FI2A 2HFHA 4ON0A 5K5RA 1BOAA 5ILUA 4ONUA 1YIOA 3T8TA 2P7CB 1WLTA 1CF7B 5BUVA 2O03A 2PHDA 4M71A 1UB9A 3TQNA 3JTGA 2RDPA 1HQCA 2ZFWA 3MFKA 4M9SA 5E1XA 3UKVA 1FNNA 1BI3A 2CFXA 2M45A 3KP5A 2EA4A 2Z3YA 3WTWC 2DK5A 2KIMA 1P4AA 4QGLA 5HDKA 2WWYA 4WBBA 4E2GA 2H27A 1NXMA 2IXJA 1ZG5A 3I59A 4A0ZA 5ICEA 2DLLA 3ZPLA 4XFGA 4MQ9F 2IW5A 2BBYA 5CLSA 4KUMA 3TDZC 4Q5SF 1YUDA 3WTTC 4TLFA 1IF1A 2UY8A 1R5GA 3COAC 2GC1A 4JQFA 4HV5A 2EA2A 3D0JA 5LLQA 1V70A 5FO5A 3K9TA 2RKHA 3SXWA 1IRGA 4HX7A 3SZPA 3F8NA 3NKTA 4LMYA 1QZZA 4CO8A 4L9NA 4NB5A 4G7HF 5BQTA 4LB5A 2DAOA 1YFHA 4HOBA 4BYYA 1ZN2A 3ZN1A 5J48A 3QPHA 3M7GA 2VBXA 4L11A 1H1MA 3F8CA 4ENMA 2XKPA 3FXUA 5DD8A 4B09A 1W5TA 4LFUA 2HYGD 4EWAA 2VONA 4WVZA 2Q2EA 3BCWA 3L2HA 3WTYC 4NVPA 4MGKE 2ZXJA 4N0BA 3LA3A 1WSUA 1OKRA 2BNOA 3ABUA 5ICFA 3ST7A 1LQ1A 1K7AA 5EEHA 3C18A 2RC4A 2DPUA 2YPRA 2FEZA 3FM5A 2ZNYA 1O7LA 2COMA 2CQKA 1ZREA 4IETA 2H09A 4MNUA 2YU3A 1ZZ8A 5FPXA 4OOIA 1VTNC 3RZZA 2P6TA 1JHFA 1OPCA 1KU2A 3U11A 3LA2A 4ZYEA 3RPQA 4L9VA 1L3JA 3RPUA 5J6XA 4JV4A 1G4DA 4D7TA 1UFMA 3S7EA 1FT9A 3KMHA 2MD5A 3LWFA 4AIJA 3KP4A 1I6XA 4NQWA 5FLXK 2B8MA 4F8AA 2E1NA 3DV8A 4A6DA 3HTUA 2LF7A 4L9JA 3ZMZA 1JXSA 4GO1A 4EJVA 2H6CA 3H1MA 2GU9A 3O2PE 2PAKA 4J1XA 1Y9QA 3BJ6A 4ASNA 5I0TA 1Y0UA 2F2EA 1D5VA 3GZ5A 3ERED 3HRMA 5E18F 1LB2A 1ZG1A 1G3TA 2JTVA 4WCGA 1E17A 4KICA 3GUDA 4EJTA 3J7AO 3HRUA 4X6RB 1F1ZA 1FY7A 1SFUA 1CAUB 2M5WA 4EJWA 3BROA 4KWLA 3KGLA 2FU4A 1K79A 3QU6A 1X8MA 3M8EA 4HLYA 2G7HA 3I64A 3GF2A 3EQLF 5FQ0B 1XCBA 3CUQC 3MAJA 2MLGA 2A6HF 1U3EM 4JTOA 1YTYA 3E6DA 2VT2A 4U0VA 1IXSB 5K5OA 1LDDA 1R1VA 1JUHA 3E6MA 3QPTA 1XMAA 2V9VA 1KU9A 3LQQA 2UWMA 1FBSA 3H7JA 2MC3A 1SD4A 4R1HA 3Q9VA 3WTXC 2VOOA 4GCVA 4LG0B 2PAEA 1LJ9A 3KP7A 5FD6A 3IKTA 5A2QK 2NYXA 2A5YB 4P9GA 4XFFA 1QQIA 2BEOA 2DBBA 3L09A 4A6EA 2ESNA 3U0ZA 3SHFA 4Q0SA 3IHUA 3BOQA 4H0EA 5DYMA 2OZJA 4HSLA 4ORFA 3ML6A 4R79A 2V79A 4ZZLA 4HF2A 2Y48A 1LDKB 5IT3A 4BNCA 1UW8A 1GVJA 1W7PA 1O7FA 3O6BB 1ULYA 3RNSA 5FFZA 2OZUA 3K1PA 1OYIA 3R0JA 4OIRF 3RYKA 3EDPA 3OGJA 2P6SA 2K7LA 2UXXA 2FBHA 2A68F 5FPZA 3BY6A 3DF8A 5AVPA 5BMZA 1OMIA 1HBXG 2QVSB 2VE9A 1LNWA 4KN7X 1XRUA 2EJRA 4ZU5A 1LEAA 1ZX5A 5IT9K 1XB4A 4GXOA 5F1RA 1TQMA 4QGNA 4G94A 3EBRA 1S7AA 1XGMA 3LAPA 2K86A 1XE7A 1GQHA 4E2SA 3MZYA 2VPVA 2MBFA 2RN7A 2GC2A 2Z9OA 3ELKA 2Y0MA 2P5KA 1QBJA 4KMUX 1G3YA 4MV2A 1AOYA 2CGPA 1K6OA 4EM1A 3KZYA 3MZHA 2UYBA 4KN4X 1EH6A 4BH9A 5FLHA 1TBXA 4M74A 3TNQA 4QGMA 2P5VA 3CUOA 1IW7F 3LAGA 5K5QA 1PMIA 3ELNA 1IZ1A 3ZMTA 3NSTA 3DPLC 2X4HA 1HSTA 3P7NA 5FCCA 3FHIB 5L3FA 4HDUA 2LF8A 5I0RA 4KFCA 5J7MA 2HTSA 3H8UA 1E2XA 4I09A 4BQAA 2GXGA 4HDVA 3ZQ7A 3DL3A 3WW1A 1R5HA 2DU9A 4HX4A 2MLKA 4ENNA 3I4PA 1U2WA 3ZDSA 1YO5C 4L0YB 4HYEA 4ETSA 2STWA 3H9AA 3SCFA 4XETA 2XL9A 3KEOA 4META 2ELHA 4KL1A 2OU2A 4I7HA 4RAZA 4XRFA 1MJ9A 3JSOA 2IP2A 5HVQC 2C0ZA 4U0YA 2EFPA 4OIOF 3GX4X 2BGCA 1EP0A 3JSPA 1EYBA 3HT2A 1T0FA 4HQEA 3ZMSA 4EWDA 1H9GA 3HHGA 1ZRFA 5E16A 3OD0A 1GXPA 1D8KA 2E7WA 2MNGA 1KU7A 1NYWA 4M9XA 5KVRA 2GC0A 1U8RA 1EH7A 1UCRA 3V8JA 3IKVA 3WGIA 1STZA 2IPQX 3FZ3A 4QM8A 3F72A 4R52A 1W7PD 2O6GE 2VBYA 5TJJA 1CAXB 1YS7A 1XGSA 1L0OC 4IEVA 1KQ8A 5E20A 2OQGA 1FBUA 1FYMA 2H94A 3ZMVA 2DFIA 4EM2A 1ZZ6A 3PQJA 4XLPF 2E7XA 3FHZA 2EK5A 5BXXA 2P8TA 4ZYGA 2ISYA 4FX0A 3W6JB 3FMQA 1BBYA 4M73A 4A5NA 1J9IA 2DQLA 4N9IA 1RL3A 4MUVA 5AIPA 3FZVA 5DCMA 4G6QA 4OMYA 4P5OA 3BZ6A 2Q0AA 2DQRA 3KLNA 2R3SA 3P9KA 3VHRA 5FLJA 4MGRA 1X7NA 1J3RA 1F5TA 3WODF 5HDNA 1WRJA 1TQPA 2G7UA 5BV6A 5JHUA 1RIOH 3J81K 2IXKA 4ZYHA 2DCTA 1QXJA 2B9UA 4E2QA 2A3SA 1HKSA 1L3LA 1SFNA 1J1LA 3GYHX 1Z9CA 3FJSA 5FFXA 3F6OA 1S29A 5L3DA 3TOAA 1ZLJA 1WA4A 4IJAA 3LSTA 2L3DA 1PM7A 5D5WB 4FAHA 5E8IA 3H92A 3KGZA 1MGTA 1O3TA 1UIJA 1YFWA 2M1BA 3ECHA 4FX4A 1O3SA 1XDUA 1O3RA 4AIHA 4S04A 3HIFA 1SFEA 5H6QA 1YQAA 3H1WA 4EVIA 3K1MA 3KETA 1USTA 5D6EA 3V7SA 3ZP5A 3U1DA 2YX7A 2XLAA 1IPJA 2QBYA 1HSJA 1XGNA 4YFXF 3L7WA 4GYGA 4LLOA 3VB2A 1REPC 1ZZBA 1LR5A 3JAMK 4A0YA 3ES4A 4WX9A 1O5UA 1GHCA 3SMHA 3WE3A 1IPKA 4IRHA 3OV8A 4EGYA 1S3JA 2D93A 3HSEA 3NRVA 3WU1B 2JPCA 5LGNA 1JHHA 2G9WA 1Q43A 2QNKA 4OFGA 5CVVA 3UKNA 3DFGA 1ONVA 4L5IA 5I8YA 1OI6A 1R7JA 3FM3A 4JK1X 4Q0PA 3HT1A 4NHJA 1QZYA 1UHMA 2K02A 1UHWA 3CEWA 3G7DA 4XEZA 3K1NA 4PZJA 3LOIA 1VP6A 5JCTA 2GA1A 2EAAA 5LHIA 1XN7A 1U78A 2WC2A 2ZMEA 1BI1A 2JRTA 2R7DA 1RZ4A 3JTHA 2IT0A 1GXQA 5L3EA 5E8GA 1FC3A 3B73A 1IXCA 3V7CA 1TNTA 3IL2A 1S6LA 1XCVA 1WWXA 3PLQA 4I3PA 2XLGA 2CV6A 2HJIA 2XUBA 3ROUA 1YW7A 1CAWA 3CUQB 4JBAA 3C3WA 1J7KA 3GVAA 5C6CA 3VEPA 2JZYA 1H1IA 3CLPA 2N7GA 4LEJA 1ZZ7A 1ZNPA 5I0UA 1QXRA 1PP8F 2ZBKA 3R0AA 5ILVA 2FE3A 3OTFA 4HBNA 2ETEA 1FOKA 2ET1A 4G8XA 1IN6A 3G73A 1I1SA 3MEXA 5HS8A 1DGRA 2NNYA 3E5UA 4EGZA 1EH8A 4MH0E 1TNSA 1J3QA 1Z6RA 1BN5A 4UV8A 1J2XA 3D5LA 2UY9A 3F6VA 2FQPA 3E5XA 4PIXA 1X3UA 3IWFA 4UXNA 3T0YA 4ENKA 3HOSA 3V8LA 3CDHA 2PLYA 3I59B 1HW5A 3H3ZA 4P96A 3AAFA 3T1BA 3EYIA 3EO6A 2L02A 2KRFA 4KMFA 5HS9A 2O61A 1OYYA 2NAZA 4HLTA 2TDXA 4KDPA 3S0MA 2OZ6A 4YFKF 5I8TA 2RVCA 2OAZA 3WE2A 3REOA 3EHKA 4MEXF 1FSEA 1Z91A 4RB3C 4RS8A 3SCHA 4WWCA 2DT5A 2IRFG 2FOKA 2W24A 2D45A 4UUVA 5KHGA 5LRSA 1MDMA 1NZCA 3SXYA 4I0BA 1X82A 3ETQA 1YLLA 1ZVFA 2ATFA 3RI4A 3MWMA 3KZZA 4RGUA 2ZO4A 1WI9A 4EJOA 3KSCA 3T5XA 4ZYDA 1O57A 4LLNA 2XIGA 1ZLKA 4UHTA 1ZGJA 4G9YA 2MH9A 5KHJA 5HLIA 1OYWA 3E97A 4I01A 1BI0A 2LSOA 3CL1A 3PFIA 2PBIA 4QX5A 4RB2C 2B5HA 3GXOA 3S2WA 2D40A 1R1TA 1SAXA 3K0LA 2CG4A 2ESHA 2ET7A 4A0XA 2HZTA 4ZU4A 3WGHA 2IJLA 4IESA 4G7OF 4XFBA 3FWEA 4P55A 3KE2A 2EFOA 2RQPA 5LGUA 3EJKA 4YYOA 5E17F 5KBFA 3I7DA 3KP2A 1CAVA 3DPTA 2Z69A 2D1HA 4MTDA 1TW2A 1Q3EA 3NJZA 5F6FA 3VODA 3OOPA 1D8JA 2NNNA 4UXAA 2LKPA 4XF4A 1IXRC 1T98A 1LVAA 3HSFA 2Q30A 1MD0A 2NRAC 4Z82A 4U88A 3F22A 2XGXA 1U5TA 2UZKA 4G6DA 3WU0A 4CYDA 2Q8KA 3E5QA 3WTSC 4LTAA 2DTRA 4AVBA 2MHFA 2P5LC 1ZZCA 3JZVA 2W57A 1WGPA 4QXKA 2OYZA 4D7SA 2EV6A 3UKTA 1Q1HA 1V4RA 2W85A 1IAWA 4L9TA 4B8XA 4IPAA 2WFPA 4MGYE 2NS0A 3SZTA 3RJPA 2W25A 5BY5A 3MDPA 3KP6A 4IVNA 4LK1F 4U7DA 4MQVA 1QNTA 3PNAA 1RI7A 5ERIA 4RB1A 5JR7B 5D6FA 2LDUA 3BPVA 2CO5A 4FT8A 1P4WA 2HTJA 2EFNA 3PVBB 4Q48A 4HX8A 3USSA 3KCCA 6PAXA 3H50A 2PQ8A 3R4KA 1C0WA 4XFHA 1P92A 4UV9A 2DPDA 3EYYA 2ADUA 4H7LA 1BM9A 4GGGA 4BHCA 1IN4A 2W84A 2WV0A 4HF1A 1IN5A 2D1VA 3GWZA 1Z05A 3TOBA 2FA5A 4P9UA 4IEYA 2DO7A 1PP7U 3QAHA 4QM9A 2H0VA 2HEOA 4UBGA 3RKWA 3BDDA 3H1YA 5H6RA 4IF4A 1BIAA 5E1WA 4DQ2A 1NE4A 4IRGA 2BE5F 4XBFA 3KFWX 3F23A 3WGGA 1LRHA 2KKOA 1W7PB 4PGHA 5E1ZB 4AD9A 3M1EA 4J1WA 1B6AA 3K69A 4UVBA 3DKWA 2HKOA 1FBQA 5FLIA 1K78A 2VN2A 2D5HA 3MYXA 3WW4A 4XF3A 4RGSA 4PIYA 3LAJA 2L4AA 3HTSB 5KHHA 4BIFA 3J80K 2XAHA 3CO7C 2V1UA 1D3YA 2HOEA 2LNBA 3U2RA 2FBKA 4AIKA 5JVTA 2XAJA 1KU3A 2JSCA 2YR2A 1UD1A 5D4RA 1YW9A 1SD7A 5ED4A 3LQRA 4KWJA 3SHRA 2Z5UA 4K8FA 1OFNA 2XAFA 4OMZA 4AVCA 4PGGA 1CX4A 4QWQA 1DZTA 4LLGF 2D5FA 3ECOA 4XSZF 4EJUA 1QGPA 1ZRDA 1XD7A 3QOPA 1QY4A 3W6KB 2F5EA 3M9AA 4KA4A 2X0LA 1YS6A 3ES1A 4OU0A 3M8FA 5E1RA 2V09A 2Q0OA 1OR7A 3CO6C 4HN0A 5J3UA 2IC1A 1FX7A 2ISZA 3RKYA 1EPZA 3NEUA 4IHTA 2EV5A 1R00A 2HDCA 1WQ2A 3QP6A 2FXAA 1FSHA 3M3IA 3FE5A 3ZMDA 1EY2A 4HMZA 1B4AA 2QDRA 3CO2A 3F3XA 4IEOA 4HV6A 3BJOA 5I91A 1B9MA 1JGSA 4KT5C 5HS7A 3SFZA 2L54A 1YG2A 4UBHA 2WTEA 2V1DA 1BIBA 4U7BA 2UXNA 2IXCA 3WW2A 2A61A 3BJAA 1USSA 2XVCA 2BV6A 2FRHA 1R58A 4R8HA 1KQ9A 3O3KA 3GLXA 3MQ0A 4OINF 4Z2YA 3C3VA 2EWNA 3HYIA 3F8BA 1XSVA 3JAMZ 2PA7A 1F4KA 5FDBA 1WKMA 1NE6A 1HXDA 3PQKA 2VC0A 4MHGA 2PN6A 4Y17A 3E3VA 4WXCA 4LB6B 5J8CA 3M70A 1PUEE 4UVAA 4IEUA 4XLNF 4XFCA 5I0SA 2CAUA 4MEYF 3GYDA 2IA1A 3HRSA 2KJBA 4YRDA 3GW2A 4HW0A 2GC3A 1J5YA 5CADA 2V6CA 4LUMA 5JSPA 1HKQA 3R60A 3TGNA 3TO6A 4WK8F 3BP8A 1BC8C 1J59A 5KHIA 1CF7A 4X6QB 4ZH4F 4KYWA 1RGSA 3U9GA 5DDGA 2J5PA 1TTYA 1ZHFA 3DXJF 4D0PA 1HW1A 4F7ZA 5FGMA 1RTVA 1LEBA 2F5CA 2VODA 1ZG3A 4YIFA 1O3QA 1X8EA 3GFLA 2MH2A 1B1BA 1YFXA 4CHUA 3MPBA 2IVMA 4XSXF 4HBLA 3H7YA 5HI0A 5ICGA 4B29A 4HVQA 1FPQA 1YLFA 5L3BA 4OIPF 2IA2A 1J75A 3I5UA 1LKNA 2VXZA 5BPXA 1SMTA 3ZMUA 2PEXA 5DCMB 4ZU7A 5CVIA 3TNPB 2IXHA 1QO0D 4PDKA 3C7JA 2EVXA 4LK0F 4XF9A 5JI6A 3KLOA 3NQOA 5K8SA 4GYIA 3I54A 5LEJA 3D0SA 1ZAOA 1P6RA 4O9GA 2VT3A 2QUFA 1H0MA 3LZZA 2EB7A 4Q4ZF 2CSOA 3I53A 5HLHA 4AVPA 1HW2A 3R61A 4M9ZA 4YFNF 2IXLA 3QRFF 3IIAA 3V8KA 4KIBA 2CWEA 2CYYA 4I98B 2FSWA 1RUOA 4AVAA 3LA7A 1NHAA 1G6NA 2Z33A 2GXBA 3RTRA 1IN7A 4KIFA 4L18B 2IA0A 3D82A 5FLXZ 5LRRA 1KYZA 2ACJA 2QYOA 1FP1D 4LA3A 1DDNA 5ICCA 5I8SA 2OQRA 4RD7A 1OD5A 1R22A 1YFYA 2PG4A 2FNPA 4I2OA 3C1DA 4YSFA 4RGXA 5HOOA 2E1CA 5CVRA 4U0WA 1BI2A 2GZWA 2QBYB 1FYLA 2O8XA 2EFWA 2FMYA 2A07F 3G3ZA 2K27A 4HLXA 1UCXA 3TKYA 1YYVA 5AONA 1RUNA 2O3FA 4LD5A 2XASA 2RGVA 5JR3A 4Z07A 3ISPA 4HSJA 3CLOA 1FYKA 1XDSA 3LFKA 5ILSA 3V7RA 3U10A 4CICA 4E70A 1ODDA 2ZJ2A 3NL1A 4YG2F 3F8MA 4MGIE 4LLLA 4WZCA 3GFJA 1AWCA 4I0AA 3I0TA 4FHTA 4HA8A 2OPKA 3WW3A 2RNJA 3N4MA 1HKTA 3GFMA 4PCQA 3F21A 4KU8A 1U12A 1CGPA 1LDJA 2EV0A 3DP7A 2PFBA 2C6YA 1XE8A 4BAYA 1V3FA 3BWGA 4GULA 2JT1A 2OD5A 1CAUA 2HGCA 1DZRA 1H9TA 4PJYA 2PYTA 2ZMEB 3FX3A 2D2WA 2B0LA 1Q5OA 4IEXA 4Q0VA 2FMLA 2GIVA 5LBQA 2DK8A 1S7OA 3WTUC 5FQ0A 5A2QZ 4YARA 5D1IA 2OBPA 2OA4A 1CAWB 5EFUA 5DUKA 2FQ3A 4TV7A
chains in the Genus database with same CATH superfamily
4OHYA 4RB0A 2QENA 1UZVA 1WCMJ 1QJU2 4FPEA 3AL0B 1YITI 5H9RA 2XHKA 5A3OA 2E1MC 4DYQA 4XOPA 4JX6A 2WNVC 1HB3A 3ABTA 4C2MJ 3OBRA 1OCCH 4TYSA 3POWA 4LA2A 5F8PA 2FOWA 1V9U3 4FTHA 2QUOA 3OY8B 2EA7A 2L4MA 1X58A 1DGRM 2HR3A 2YPJA 3PVEA 3IDCB 5FZAA 2W47A 3PL8A 3SKVA 2YBKA 3G1OA 1LOBA 3FF5A 2ZABA 1I50J 4IRIA 5DUXA 5FUNA 4CYCB 3DBHB 4KGQA 1ZRCA 3O14A 4P9YA 1U0AA 2GNBA 3H42B 1SACA 2PHUA 2Y0OA 2ETHA 2P7VB 1FZPB 2K9MA 1IUYA 1BVVA 1GV2A 1W99A 4UUSA 5IT9Z 1AR92 2XROA 3W2WA 2BERA 2ZX1A 4CGZA 3DQVC 3PNTA 1EUTA 4XKBA 1LNSA 1AYM1 1OXCA 2ZHKA 4AHWA 3BC8A 3BG3A 1MS5A 4YVSC 2W82A 3BG9A 5ACA2 3E6BA 2G19A 4NHYA 1WPKA 3AG3H 2CAVA 2NP0A 1O5LA 1UU4A 5IK4A 1G3WA 2VECA 4HAMA 2D6NA 3WTZA 5H20A 1JZ3A 3MLKA 5BNNA 1SLTA 4P9FA 3AFKA 4GZ9A 4HK9A 1HQNA 3I8TA 4LHLA 3KEQA 3ZX7A 4FISA 1TWCJ 5DAVA 3OJBA 4LIUA 4WF2A 3VOEA 4EE2A 1W8FA 4YVWA 4YNIA 3ZOBA 1A04A 1DBNA 3ZXGA 5IP9J 3GDBA 3S30A 2R5YB 1AXZA 4LHKA 2QQBA 1ON2A 4CDUB 1MS0A 1WLWA 3QP5A 3WQ0A 4ANJA 4M3EA 1DUXC 4GMP0 3C2BA 1XSXA 2RR11 4Q26A 1ND3B 2I45A 4AQ2A 4Q0QA 5TRDA 1OQDA 5G05L 4WXHA 2WBMA 4XLHA 1B9NA 4JHTA 1HN1A 2UWBA 2QVOA 3JD72 2EBIA 3N9MA 1G7YA 2XAQA 5CYVA 4A3ZA 3AL6A 3VUOA 2BY2A 1UZCA 5FRMA 3BTJA 2PMHA 4XACA 3ERMA 4A3XA 4CZSA 2HQNA 4GMP3 1D4M2 4GKXA 5E89A 2K9QA 3GBGA 4AI3A 5KNLA 5JXJA 3RYRA 2ZGLA 4M01A 1VJ2A 2DUQA 2R5ZA 3M1HA 5L19A 1KA8A 1ITYA 2UV1A 3E1SA 3K2ZA 4H7MA 4QPYA 3RZLA 1R092 1YWKA 3D6EA 1TZLA 1ZGAA 1LE8A 1GDTA 2RS13 4N8MA 3S3MA 3VBOA 5GAHJ 2PMZN 4Y52J 1WBLA 3IUOA 4XLCA 3PUQA 5EWSA 2B42B 3K4JA 1NLRA 4CCJA 2JIGA 4CCEA 1PVXA 3K3OA 1ND2C 1PK6B 4BDYA 2FZ1A 2NS8A 5GJ6A 5EF6A 1K5JA 1YXWA 4LIVA 2ZZQA 4DUVA 2UWCA 1JYWA 3FXLA 1J1TA 4H4KC 4AM3A 4AVSA 2FCUA 3VSKA 5FK7A 4XF1A 4SBVA 4Y4YA 5IPAA 2D6MA 1WMDA 2BY0A 2WNUA 5J4VA 2C26A 4M6YA 2IUWA 1YOVB 3AX4A 4CDQB 4MO7A 2X6XA 1SMYF 3GZNB 4WVMB 1NK2P 4WXDA 2XJPA 1IPSA 1LU2A 3VBFB 3BUCA 3HGGA 1DYKA 1JUPA 1E3HA 1WZ2A 2VJXA 2A6EF 1QJEA 1S9HA 2Y60A 1OFSA 5IWFA 4UFKA 4BCUA 3T4VA 3K6GA 5DAXA 2EQRA 1ZARA 3LWCA 4Z1VA 3ON7A 1GLNA 1BC7C 2W87A 4LULA 3HNBM 2L7ZA 2BGOA 5CPRB 1EAH2 4A93J 4B47A 3VD9A 3OYGA 3EUHA 1WI3A 1RB8G 5CVUA 2F5DA 3OGGA 2J42A 5FBJA 1LHUA 4FBFA 2DN0A 2LMDA 4G4FA 1F9NA 1MBFA 1QOTA 4LXLA 2J1SA 4L0ZB 5GZEA 1MEC2 3I58A 3OPTA 1V5EA 2IGOA 2O8OA 4TSVA 4BB3A 4LBMA 4QB6A 2H8WA 4LO6B 4B3NA 2ELKA 4BOWA 1CONA 5C7GA 5B2GB 1VBA1 1V6OA 4B7EA 3IT8A 2E51A 4PBPA 5FV3A 4P9JA 1S0FA 1Z67A 4XFAA 4DRVA 1RITA 2IVIB 1R36A 5DAWA 4XL9A 3AKSA 5M5YJ 4HPKB 4A12A 1G9FA 3BTXA 2N8GA 3VGIA 2AZ5A 2P4WA 1I9RA 3P9CA 3X29B 4KU7A 2ZGRA 3WG1A 2AH2A 4AK3A 4JKLA 4A2UA 1DLLA 5D8LB 5HV0A 3EQEA 1IC8A 1WGXA 3HR9A 4JYKA 1I5ZA 1HXS2 1OCTC 4E7JA 4HETA 1R23A 4Y22A 4CXFA 4A5MA 4EROA 2E33A 2F4PA 1MH4A 4XORA 3OS1A 4MGZE 2BY1A 1RHI3 4YELA 3ULQB 3VBHB 5SV5A 3IIIA 4N9HA 3K4BA 1YFUA 5LBEA 3ASOH 1KEXA 2LREA 1ETXA 2MEV1 2QCSB 1NA1A 1W8OA 4BXUA 3OD4A 4EN6B 1PDNC 4O9EA 2J5OA 2OC6A 1UX6A 3ZPOA 5JAXA 1RXFA 4BQWA 3U1KA 1RJ8A 1TW3A 5T54A 4W97A 2Z99A 1BJZA 2VU9A 4XLFA 1VBB2 2PQQA 3VBRA 2A6VA 5FZOA 4GH4B 1DPUA 3OYFA 1VBD3 4OHVA 3BR1A 1UHSA 1WJFA 2HFHA 4ON0A 5K5RA 4ONUA 1YIOA 3T8TA 3VZLA 3TN91 2VZRA 4FPGA 3UV9A 2PHDA 1B72B 1UB9A 3L2QA 4NNJA 2V7FA 2LBFB 5E1XA 1LGBA 1NXD1 3MLJA 5DZFA 3KP5A 3KCXA 1OR7C 2HWF1 3WU2C 3A0BC 2VOKA 3A4CA 3PUFA 3RFRA 4PHZA 5ICEA 4XFGA 2DLLA 4XE9A 3ME2A 5KXBA 2D6PA 1PO23 4QQLA 2IW5A 1RUG1 3TDZC 4BJ5C 4OI2A 3VZOA 3KWVA 5FZ1A 1OLMA 4TLFA 4B43A 4EATA 4IOAF 4JQFA 1OQ1A 4HV5A 5DABA 4YFWA 4C3HJ 3BLYA 2ICWG 4G9SB 5AC91 1V70A 2VB6A 3AMQA 3FISA 2CH0A 2R30A 2QTWB 1QZZA 2R1BA 4LNVA 4NB5A 3UETA 1CJPA 1QNYA 4G7HF 2DDUA 4FCYA 2DAOA 1AJKA 2RG4A 2FD8A 4S0HB 3QPHA 3WNOA 5HXVA 3WQ7A 3A4UA 4GB31 1VFCA 4OUMA 3J7MA 3F8CA 4M00A 4ENMA 3H35A 3D5RC 4B09A 1W5TA 4LFUA 4EWAA 2DXIA 3BCWA 2MSYA 1U5YA 1HQLA 4MGKE 2ZXJA 1Z7S2 2TCTA 1YJNI 1OKRA 3ST7A 2RS52 1KXGA 3O1TA 2QE3A 2DPUA 5E3LA 3OGSA 4GQ7A 2OPTA 2CQKA 1ZREA 1R083 2WIIB 5FPXA 1VTNC 3RZZA 5LASA 2PHRA 1OPCA 4XNFA 4PQQA 4E7KA 4HSRA 5DTDA 4JV4A 1RJ7A 2V4VA 5BNOB 2ZKNA 2ZJPF 1IRZA 1FT9A 1ULFA 1D5YA 3ALQA 3KMHA 3O0XA 3LWFA 4NIAA 1I6XA 5FLXK 3HWJA 4A6DA 3ZMZA 4B3AA 1X50A 3NWTA 1ZBE2 3BIWE 1FATA 3ZN4A 2JEMA 2PAKA 2RJ2A 1F36A 2Y26A 2VY0A 5I0DA 1FNZA 2XVLA 3ERED 3VZKA 1URXA 3BVCA 4WCGA 1E17A 4X6RB 4HK8A 3T2TA 1CAUB 3KB5A 3OYJA 2E2JJ 3UNGC 3BCAA 3T2QA 1AX1A 4A3LJ 2G7HA 2OTLI 4Q4X3 1V9U2 3EQLF 1XCBA 1VBC2 2MLGA 1VZ0A 4EJRA 1U3EM 2W00A 1XE0A 1JUSA 4JTOA 3CIHA 5K5OA 1SLBA 3SNMA 2ZHLA 2V9VA 3H7JA 2DFFA 1SD4A 1AR81 4NHLA 5FYIA 3Q9VA 4S2FA 1T95A 3V0BA 3NV1A 1HKDA 4XILA 4CE8A 4YLZA 5F6KA 3WF4A 5L7OC 5EGOA 2A5YB 1V5FA 1IDZA 5D2AA 2WWUA 1G59A 1EA3A 5L9BA 3OS2A 3AKQA 3WVJA 4YFZA 2AACA 2E26A 3W5NA 3WHUA 1D4VB 5B5EC 4BNCA 4UUSB 1A5JA 1C8NA 1UW8A 1GVJA 5IVVA 1VRH1 3O6BB 1ULYA 3K1PA 1OYIA 3R0JA 3OGJA 2KZGA 3I4MJ 3DECA 3HOVJ 2FBHA 4MADA 5FXXA 3MUZ1 4FO9A 1ZGWA 5BNNB 4M3CA 1LEAA 5F1RA 1FIPA 4QGNA 2BOLA 3DLAA 2BU9A 2E32A 1L7QA 3EBRA 1S7AA 1UYPA 2CUZA 4YVWB 3LAPA 4XDOA 2K9SA 5FJHA 4G12A 4JQTA 1DQ2A 1GQHA 3D4KA 4JHZA 2WAEA 2MBFA 3A21A 2VNOA 5J98B 5T5JA 5FZIA 4KMUX 2I2SA 1FMVA 1AX2A 1AOYA 4C8DA 2Q8CA 1X3WB 3CDLA 4EM1A 3KZYA 2UYBA 3GTQJ 3I2IA 4BH9A 1VBE1 1UF2C 5FLHA 3SC7X 3K10A 3CC4I 1V6MA 1IZ1A 1QJX3 3ZMTA 3NSTA 2X4HA 5DG1A 4ARXA 3AYDA 3P7NA 2IGNA 4Y1YA 3BIEA 2HTSA 2VNRA 2VUCA 1HCRA 3RG0A 4I09A 2HNHA 4W8JA 5C3SA 3ZQ7A 5LA2A 2DU9A 4HX4A 5FYBA 4JGZA 4TLGA 3J8F3 5BNQA 3I4PA 3GF6A 1PO13 4DQAA 2R5ZB 4OVEA 2TRTA 4HYEA 1R6RA 2STWA 3NNMA 2XVKA 5C8CC 2XL9A 3KEOA 1W8TA 1NQDA 1US3A 4RGKA 3WLUA 1LE8B 3VBOB 4FVVA 3JSOA 5HVQC 2C0ZA 4U0YA 1O4XA 2VTXA 1EP0A 2QKMB 1H8TC 2LLKA 3HT2A 4O65A 2OS2A 5H9SA 1LFUP 1ZRFA 3OD0A 4FFHA 2EZKA 2FUG2 1H8VA 1WMXA 1LHNA 2MNGA 2GC0A 1EH7A 1UCRA 3BYWA 3V8JA 4LJHA 1RR8C 3WGIA 2I07B 1PZ8A 4HL0A 5F32A 4QM8A 2YBPA 2O6GE 3HL2A 1DGLA 2WNUB 5A1FA 2XBO1 1LOGA 5E20A 5KR7A 1FYMA 1D2SA 4RHV2 1C8M1 2XJVA 1W0UA 1IGOA 3O1UA 3J7AY 2VZPA 3FHZA 3AG1H 5BXXA 2P8TA 3FLTA 2ISYA 5LFAA 3M4FA 2LALA 4M73A 1ULPA 1AYM3 1X1BA 1SVOA 5AIPA 3FZVA 5DCMA 4EN0A 2C9KA 4BIOA 3AKZA 2CWMA 2PLV1 3KZ4C 4P5OA 2WS92 2DQRA 3J4UH 3KV6A 3LFIA 3WODF 5HDNA 4W1UA 5BV6A 4Q8LA 3LEMA 1HQWA 3H1CA 3J81K 2UURA 1QXJA 3KIOA 4BISA 2M7AA 1J1LA 4YW4A 1Z9CA 2KA3A 4ASKA 4UAPA 5LBFA 1ASJ1 5FPAA 5A7QA 1SG3A 4IJAA 3MFAA 1PM7A 2WR9A 3SEZA 4CXXA 1PVEA 1YFWA 4D5FA 2M1BA 2WNVA 1RUF1 1IZ3A 2RR13 1O3RA 4AEDC 4AIHA 4FPJA 3T09A 1ENRA 1SFEA 1RINA 1RHI2 1YQAA 4BBSJ 2A3XA 1COV3 2VKVA 4EVIA 3QH7A 3ZXSA 3PO3J 1USTA 5D6EA 3CZUA 1S0IA 3ZP5A 5CIRA 4DIQA 3U1DA 2YX7A 5IOZA 4XQDA 3IV5A 1IPJA 2QBYA 3DKYA 2ZSIB 3HEFA 4YFXF 2J1EA 3EPZA 4GYGA 4LLOA 3AYCA 4D7NA 3OR1C 3R4SA 4Y22B 1LR5A 4EN9B 3KEYA 3ES4A 5FP7A 2XPWA 1SFPA 4GWJA 3OMYA 3WE3A 4IRHA 2K46A 3FXJA 1UZWA 3HSEA 5CFDC 2G9WA 4OFGA 1AL21 2NMNA 3UKNA 1YRNA 1KS5A 4MGSA 2RM21 3KV4A 2YUSA 1TMF1 4NHJA 1NA1B 4XMAA 4ZC3A 1V54H 1UHMA 3LCPA 3CEWA 3G7DA 5JVGF 4AYBA 4ITVA 4QHOA 1KD7A 1XN7A 4P08A 2WC2A 1F35A 1BI1A 2JRTA 4Q1PA 2X29A 4PJNA 2FDGA 1X36A 3B00A 5E8GA 1IXCA 1WWXA 2R0QC 4IZZA 4KG0A 1F5JA 4AL9A 2XLGA 1ULOA 2CV6A 2CUFA 2FJ1A 2XUBA 3VBRB 3ROUA 3MMYB 5F3IA 5FZOB 3UYJA 2DU1A 2ZB9A 3GVAA 3VEPA 5C6CA 1H1IA 1O59A 4LEJA 3A2KA 4P5HA 1QXRA 2Q8DA 2ZBKA 4XJ9A 1KQRA 2FE3A 4HBNA 3PDQA 2ETEA 1ZQ3P 3H3VK 2M2EA 3T0AA 4BE0A 3ONQA 2DBNA 4C2UA 2ME6A 4QWNA 3F6VA 2FQPA 1X3UA 2NOGA 1BR1A 3IWFA 3T0YA 2Q5TA 5FXWA 4DGWB 2WAOA 3HOSA 2ECBA 5C5UA 2Z79A 2ZMNA 3CDHA 3S1QJ 1KONA 3BR5A 1ZBA1 3EYIA 3AP7A 3EO6A 4JDMA 2L02A 2JUCA 4KMFA 1HF0A 5EZHA 4GA9A 2NAZA 3O0VA 4HLTA 3IB3A 3GTLJ 3CC7I 2JE7A 3JCUC 1TNRA 5I8TA 2ZBJA 5FPBA 2CGNA 4CCNA 3O8GA 4MEXF 1R082 4AI9A 2B63J 5EJ3A 2FHRA 4WWCA 4NJ4A 2MD0A 1VBA3 4AIDA 1YQ8A 1JZ2A 1QJY1 1NZCA 3SXYA 4QTRA 1X82A 3ETQA 3K4AA 4QX3A 1YLLA 1R71A 3WNKA 4JCKA 4QKNA 1RXGA 3BR6A 1SDWA 4P02B 1W5CC 3KSCA 3T5XA 2R16A 1VAVA 3ZYJB 3CBNA 2I74A 3NAPC 2NZ9A 1ZKGA 1VLNA 4PJLA 3HBZA 1MPXA 4UFLA 4RB2C 4OCTA 5FR3A 4FP3A 3GXOA 2L7FP 2D40A 1W9YA 1HJFA 5FYCA 2HWB2 3WGHA 3VWBA 2A73B 2Y33A 4KWUA 1WW4A 3EJKA 2HPIA 4BWOA 3M3EA 3K4LA 3VBUA 1CAVA 3KYLA 4DZPA 2MEV3 4PSWA 3TBIA 3AB0A 4IL6C 1QJZA 5M3MJ 2X1EA 4MTDA 4F91B 2WRAA 5F6FA 3WP6A 5CBLA 1D8JA 2W1QA 4YPJA 3WD5A 1QVTA 1LVAA 3HSFA 5A6QA 4U88A 2E5ZA 4IGQA 2VPLA 1QKQA 2E2HJ 3WT3A 1J84A 2RMU1 4QDQA 3ZPYA 5EYXA 2DTRA 1ZZCA 1Q8SA 2QQUA 5FZGA 2W85A 4CZCA 3LEIA 4JX0A 3DCFA 2VOVA 1F15A 4OYUA 4MGYE 3SZTA 2W25A 4WM7C 5K4LA 5BY5A 4MFDA 2VZ1A 1PUFA 4MLOA 2NVQJ 3TN93 1YQ5A 4Y5TA 3O8HA 1RI7A 5ERIA 1M1EB 3RSJA 3AM2A 5H9PA 3M3YJ 2ZXWH 3AL0C 1UMZA 3FK7A 5KAFC 1FJLA 2BHZA 4V2WA 2PQ8A 2HWF3 3R4KA 2CDOA 4M0HA 1UY1A 4R9BA 3V0BB 3TEYA 1P92A 3I3BA 4UV9A 1ZTRA 1SFYA 2DPDA 2JSPA 4W6XA 1UOJA 3EYYA 2BBAA 1BM9A 4GGGA 1UAIA 5EGOB 4DBQA 2WV0A 4SLIA 3GWZA 2EIMH 4ISQA 2BDRA 2FA5A 5AC93 2H0VA 2GSYA 4CEWC 3H5RA 3RKWA 1Y9MA 3H1YA 4XUQA 1NAEA 2R7EB 5IOYA 2VUDA 4IRGA 3MKWB 5AVAA 2CWSA 3WGGA 3MFCA 1HOMA 4GB33 2XGCA 1AA7A 4J1WA 1Y6IA 2W1SA 3JRAA 1K78A 1JYNA 2JVHA 2VN2A 2V1NA 4FFFA 2BPA2 1LCLA 3MYXA 1FMWA 3WW4A 2JDNA 5F5CA 1BKZA 4BIFA 1PYVA 3ZR8X 4QB1A 2BVLA 3AZWA 5KXDA 4E7HA 1CQTA 2FBKA 1TE1B 2JSCA 1D0ZA 2JA8J 4M3CB 4J00A 3CQZJ 3SHRA 5T5LA 4NWVA 3C8XA 1UN1A 4NIHA 4QWQA 3RZHA 4A3FJ 4YW3A 5C71A 2VBPA 4BDZA 1XD7A 3QOPA 4LO8A 3OBZA 3ETPA 2Q0OA 1OR7A 4HN0A 2IC1A 1NY72 1EPZA 1WCQA 1EV12 1WD4A 4AEJA 3LSRA 1WQ2A 4IGOA 1BMV2 3HNMA 5FZ4A 4HSTA 3CKHA 3R4DB 3C2UA 1X4OA 3DLLF 4IEOA 4HV6A 2YC0A 4PBOA 3WXPA 1UQXA 2BOJA 1O6UA 1EPWA 3SFZA 2EIBA 2BP6A 2P6HA 3SISA 2YXSA 2WTEA 3HQRA 3RZGA 3CP8A 1DQ5A 3NJYA 3S57A 3T0DA 4FOQA 4U7BA 2IXCA 2KL4A 2X09A 1W9WA 3WW2A 4JGZB 2QZ3A 2YB7A 1IG3A 2FRHA 1R58A 4E7LA 3B7MA 3IDEA 4D1QA 3C3VA 2OQ7A 3OSDA 5FK8A 2Y34A 3HDDA 3CMAI 3PQKA 4UWDA 2FDHA 2OW4A 4AW7A 2VZVA 4MHGA 2W1OA 3E3VA 5KWRA 5J8CA 2AUYA 3IKWA 1AR83 5I0SA 4NPRA 1MVQA 3RMYA 1PGSA 4AWDA 3GW2A 4HW0A 5CADA 1RESA 1EF4A 5JSPA 4I30A 3R60A 3TO6A 5CA6A 2L5QA 1A36A 1J59A 3PHMA 4W65A 2ZOEB 4ZH4F 4KYWA 1H0BA 1UOFA 4D0PA 1ZHFA 4EN8B 4N7IA 1HW1A 4LKDA 3LEGA 1MMNA 2OKXA 4FPYA 5FO9B 2VODA 2LK2A 2GOXB 4LE3A 3HVDA 3GFLA 1JOJA 2MH2A 1YFXA 3ZFFA 4HKOA 4B29A 3ZN6A 5FP9A 1UY4A 3VD4A 2IFRA 3AZYA 1YLFA 5L3BA 1XC6A 1VRH3 3MIDA 4NPMA 2VXZA 4RN5A 2PN5A 3Q3SA 2OT7A 5DCMB 4BY7J 1W0NA 2JDAA 3USUA 2VG9A 1VQOI 4IXLA 4LK0F 3KLOA 2RS32 3TB0A 2RR12 4IE5A 4ATEA 1P6RA 2M7BA 4O9GA 2QUFA 3LZZA 2X85A 2L2OA 1KFUL 1WMEA 4Q4ZF 2HQAA 5HLHA 5FY1A 1JYXA 1HW2A 1D0HA 1QH7A 1COV2 4M9ZA 4Q4V2 1WA6X 3QRFF 5F9TA 2WV1A 1YIJI 4YGEA 3K77A 1NCQC 3LA7A 3UESA 4QHBA 1NQJA 3C7OA 1FOYA 3D3AA 1G6NA 1G8XA 1BR2A 4TZDA 2WNVB 2XJSA 3OL4A 5JMCA 5FLXZ 1WH5A 5JLVA 1FP1D 3AXEA 2DFBA 1T0FC 5L7OA 1FMD2 4XCBA 1XJAA 1VBE3 4Y33A 2K5CA 2M4GA 4D94A 1GNHA 4FE4A 4KNCA 4I2OA 1XXNA 1CJDA 1BI2A 2WL1A 3ESWB 2OUMA 2QBYB 3O1MA 1PJRA 2A07F 2QSFX 4HLXA 1SCSA 3DYMA 4LD5A 1Z77A 3KX2A 5APAA 1AXKA 3CCSI 2BJSA 3ISPA 1FYKA 1XDSA 1L7RA 5ILSA 3V7RA 1JUMA 4E70A 3JRCA 4IHWA 2ZJ2A 5F0HA 3GTGJ 1UKRA 3F8MA 4MGIE 3GFJA 2V4JC 3JRHA 4FHTA 5A7SA 1YRNB 3N4MA 1U12A 1CGPA 1LDJA 4QQ2A 3CMMA 1V3FA 2KLOA 2C9AA 4GULA 2P34A 4P5YA 5F37A 3ZKYA 4LO7A 1FPN1 2BFUS 5J37A 4Q0VA 2DK8A 3WTUC 4IHYA 2AQFA 2ZS6B 2XUMA 3LIHA 2DYRH 2VXDA 5EXOA 4F52A 5FZLA 5DUKA 1IS3A 2XBO3 4BQYA 2E34A 4Q4W1 4QQOA 2A05A 4HF0A 1OPMA 1C8M3 1HN0A 4CU8A 3B93A 3ZQCA 4OMCA 3CCJI 2K0GA 3HQUA 2CU7A 4LBOA 2F5VA 2VQGA 3IH2A 5L3GA 2VCCA 3ZCOA 2A3YA 3FMRA 3GTMJ 2Y75A 2E53A 2QLZA 2PLV3 4LO4B 1W9SA 1YW8A 1WBFA 2XRNA 5LK5A 5HLGA 1GMMA 1KZHA 4IGPA 3HRTA 1SFXA 1MJBA 4OHXA 5C5TA 2O8QA 2RV8A 3L9FA 5C8CA 1TQ5A 2ZKZA 5F2WA 1ASJ3 2YX4A 2PI0A 2F17A 1VNDA 5DEQA 3B02A 5J40A 1H8TA 1KYWA 4Y15A 2VNGA 3ZN0A 1RR7A 1MMDA 5M5XJ 1UXXX 5T5OA 1W05A 4LHNA 3RIRA 5HV4A 4O6JA 4A3DJ 2ZMEC 1QWRA 5A70A 4G7ZF 4AXOA 3RI9A 3IH3A 5GZDA 4BLJA 2ZEZA 2Y8KA 2CDPA 3JU9A 1VQ6I 3WZ1A 2GQQA 5A3MA 2A5WA 5CB7A 4ARYA 4LJZF 5LGTA 1HRI1 5DUIA 3MCZA 3J80Z 1J0RA 4FPLA 4INDA 1E3PA 1ZYBA 5D8KB 3UGFA 2KPMA 5BNOC 4XJZA 5F39A 2IS1A 4Z92B 4CDGA 4BQQA 2VOPA 2CTVA 2R7OA 1DU6A 4KBBA 3FXQA 4JX5A 5FYYA 5B66C 1OT5A 4CXWA 4OIQF 1O4ZA 5LY1A 3FLPA 1AL23 4JQRA 3H36A 1Z7UA 1O8PA 1OVSA 2RM23 3VBUB 1CAVB 1A6IA 1TMF3 4B48A 4XRMA 3S1NJ 4JP0A 2MC4A 1HRV2 3A03A 1W6PA 1I1GA 1PM4A 1MKMA 2NLRA 5AIQA 2OUHA 2HWD1 2BNMA 2AYHA 2D98A 3KVBA 1AHDP 3RPUD 1IN8A 2M30A 1ETQA 3BR3A 4EM0B 4HNVA 1PGW1 1A35A 1F9KA 1N77A 1PZ7A 2DW4A 2PAMA 1LVKA 2KIFA 1DGWA 2FBEA 2TUNA 5DD4A 5FO7B 1MNEA 4YZ4A 3A1YA 1SD5A 3WDYA 2WLQA 2AS5F 1QU3A 2HWC1 4XXAA 2XKOA 1WLDA 5DV5A 3M3QA 2XONA 4O7XA 2KQRA 2L0KA 1NH3A 5D5UB 1PUFB 2H8RA 1KJLA 4AEDA 3V0AA 3EXUA 1XOYA 4U87A 3S7IA 2VR4A 1WUVA 2V5DA 4N90A 1QQP2 4K1ZA 4OMDA 5FZDA 3WNMA 2IXIA 2NVXJ 1GZ9A 1FEXA 1TWHJ 3Q9SA 2VZTA 4IKFA 3N7LA 3MIHA 4AFDA 1IS4A 2XMLA 1G3SA 1DQ0A 3H3LA 3LSDA 1ZBA3 1P4XA 1IRFA 1R4MB 3M3CA 2GM4A 3PJYA 4BHBA 3CP2A 4OI4A 2R7RA 4ISRA 2BZTA 4LUKA 3AJYA 1JHJA 3J81Z 4PIZA 3OCPA 5CFDA 4B4CA 1SEUA 2E2IJ 3FC0A 1KITA 1YI9A 1ZYRF 2CL2A 3F8FA 5T3NA 2KJCA 1MQTC 4JKKA 1LHOA 2VZUA 4D3WA 2L9SA 2ZNZA 3RVHA 4IHVA 3VFZA 3LNQA 4BL0B 2PFWA 2XAUA 3DPRC 3HBLA 3S14J 5L73A 3VKLA 1ETWA 2DVBA 1QJFA 4XMIA 3ZYPA 3OPZA 1K78B 4XFIA 1QJY3 5KK1A 2PHLA 5A7PA 4XCAA 4ZZDA 3HQXA 5CU1A 1T2KA 4LBQA 4YW7A 4L5JA 3IBMA 3NV2A 4Q8KA 5CJ9A 3IRRA 1U5TC 2BNNA 3EETA 5BNNC 2ID6A 3S8PA 1EV7A 4FCAA 4A3BJ 3DN7A 1QA6A 1D2QA 1S0GA 1OD3A 2Y2ZA 4Q27A 4C1WA 3OYIA 3GZUC 2AHQA 2XPUA 2Y64A 1TLHB 1VQKI 3VL8A 4QDRA 4XYXA 1UPIA 2B7YA 9ANTA 3VSLA 3RKXA 1UIKA 2Z2SB 3N3HA 3WV6A 5KHDA 4YRVA 3HSRA 2CGOA 5C8WA 3T2OA 3BB6A 1IS6A 3U07A 1GP5A 1BJQA 1RUE2 2MPFA 3ZXFA 2VJIA 4V19K 2DA6A 2M87A 2DMQA 3W2VA 2R061 3VD7A 4BHPA 2ARBA 1HX6A 1XPXA 1N75A 5FY5A 1CD3G 1U6GA 4YM2A 3OYEA 3U75A 4XICA 2CW0F 3WUDA 4G3YC 4ZHNA 4PFPA 3FFQA 4TN7A 3BKZA 1H6XA 2WWSA 4Y5Z0 3U37A 4EWEA 3JRFA 4N4NB 1H2KA 1QPMA 1AR82 1OOPA 3H0GJ 4XAAA 5J09A 4M72A 3ZR6A 4YW2A 1VQ9I 3AZXA 2R7TA 1ON1A 2VBWA 4AQ6A 4KGGA 1WFXA 5EJ1B 2LY9A 1JTYA 1T08B 5IW0A 1T8IA 4MTEA 4IERA 1XQNA 2F4IA 2YSRA 2YFUA 1JJ8C 4IV3A 2YY1A 4K2EA 2HQ5A 3NAPA 1RC6A 1MNDA 1G2HA 1DF0A 2KISA 1XSQA 3CUQA 4NIIA 3WY6A 4QXCA 2V1XA 3LE0A 1FI2A 4LKSA 5T50A 3DU5A 1BOAA 5ILUA 1AX0A 2P7CB 1OCOH 3V64A 4XUPA 3POIA 2WNUC 3W6VA 5FKBA 5FMCA 4N53C 1F8VA 4JKMA 1HQCA 2EF6A 1BEV1 1QU0A 3VN4A 3UKVA 1BI3A 2CFXA 2Z3YA 3ZFFB 4XIKA 4BK5A 4LBQD 3UT0A 5FZ3A 1GWLA 3ZN6B 3CMYA 1BBT1 4Q5OA 4LHSA 1C57A 2FMDA 1ZG5A 2OX0A 2PMZA 1UAAA 5EJCA 5H2FC 1HV1A 4MQ9F 4GALA 4KUMA 4Q5SF 1E57A 1W8UA 1H4HA 3R4UA 4CU6A 1R1A1 1JOPA 1R5GA 2NPIA 3QD6A 2R042 3HPNA 4COWA 3USUB 3SXWA 3UK9A 3GHNA 4E9KA 1C3HA 3F8NA 2R1DA 2J7MA 4L9NA 5F0CA 3MPPG 5BNPA 2QEXI 1N25A 4IHXA 4HOBA 2MABA 4BYYA 1ZN2A 4BZ4A 3M8JA 1VBE2 3LDBA 4DJAA 2R4GA 2VBXA 2XF7A 1H1MA 2DA5A 2XKPA 1LUJB 4C3JJ 3CMEI 2VONA 4M3BA 2Q2EA 2OTJI 1MSEC 4NC6A 3LA3A 1WSUA 5FZKA 3SEPA 2A6ZA 1A8DA 4X8NA 1K7AA 4RQPC 2XDVA 1TT5B 3L2YA 4AR2A 3C18A 1KDKA 4YWAA 5KXCA 2YPRA 4IEJA 5L7OB 1O7LA 3AFGA 2COMA 3THPA 1ZZ8A 2YU3A 1S0JA 4RYDA 3AYEA 2ZGKA 2P6TA 3LL7A 3I9V2 5DUWA 1YI2I 4CEWA 2P2KA 2V9KA 4ZYEA 4L9VA 5J6XA 4E4HA 3Q8FA 2B39A 2WAFA 2GNTA 1W03A 4D7TA 3PFYA 4AIJA 3KP4A 1LEMA 3WP3A 3PMEA 2FCVA 4WVVA 2LF7A 2WAAA 4GO1A 3AMHA 4EJVA 2H6CA 2GU9A 4AI8A 1NA1C 1P8JA 3BJ6A 4ASNA 2VQ0A 3N35A 1CR7A 1D5VA 3GZ5A 5CAZA 1W6NA 1WZXA 1G3TA 2XBO2 1JZ6A 3J7AO 3HJRA 1SFUA 2WT2A 2M5WA 5JPNB 4ITCA 1C8M2 2A6YA 4KWLA 3KGLA 3QU6A 4AGRA 4S2HA 3R05A 3M8EA 3M07A 4HLYA 1LULA 4Y1XA 1VQ5I 5CQEA 3I64A 1REDA 2LUWA 1A31A 5LW9A 3MAJA 5CNAA 3LSKA 2A6HF 3OSGA 3HKZN 2VT2A 4BQ2A 1IXSB 4XOGA 2XG3A 3CLQA 1DLCA 1LDDA 1GZWA 2QDNA 2B9SA 1S2KA 1JUHA 3E6MA 3QPTA 1XMAA 1KU9A 1O8SA 1FBSA 1FOWA 5IAVA 1RRJA 2ZGNA 3WTXC 2VOOA 5E88A 5LD2C 4E27A 5A3TA 2CQ7A 5FD6A 3AKTA 2NYXA 3ZXAC 1I5PA 2VQUA 2Q1MA 4XFFA 1SVLA 2DBBA 4RL7A 3U0ZA 3PURA 1RUD1 4CDWC 3ZSKA 1CESA 2V4AA 2BRTA 1GQPA 1KRIA 4R79A 2X53S 4E4DX 2V79A 2W46A 3K51A 4ZZLA 4HF2A 4FPOB 2Y48A 1LDKB 5IT3A 3U14A 5C8CB 2VOTA 4U2AA 4AFBA 1LOAA 3GM8A 3EDPA 2K7LA 2VMGA 1FOD1 2UXXA 1SANA 3LDKA 1H8TB 4NOTA 5AVPA 1Z7LA 3NMBA 5L36A 2J1VA 1OMIA 2QVSB 2EJRA 2VKHA 4BQ4A 1VQ7I 1H30A 1VQPI 3PIJA 5J1YA 1ZX5A 5DG2A 1XB4A 4GXOA 5LBCA 3INAA 1IUFA 1R5ID 3V56A 5C3QA 2XJQA 4PF1A 1BK0A 4J25A 5FUPA 3DTIA 2JUGA 2EIKH 2K86A 1TMF2 2OV7A 3A01A 5FKMA 4NBQA 2BVBA 5C4XJ 3MZYA 1PNGA 2UUZA 4NIDA 2KDOA 1WLCA 3ZSJA 4HANA 2D3PA 3CD6I 3I4IA 2K85A 4BUPA 1U5XA 1T2XA 5A3WA 1S1AA 1EH6A 3TNQA 3P1IA 4OWRB 2VVFA 4DOZA 2WFF2 2VGDA 5FCCA 2LF8A 1W6PB 1KDMA 3OIOA 4YZ3A 4LBKA 1E2XA 2VUAA 4HDVA 1FPN3 1R5HA 2MLKA 4LORA 5A1LA 1YI7A 2LH9A 3H9GA 5KXEA 4CCKA 3H9AA 3ZVXA 3SCFA 2EZLA 2ELHA 2WWJA 3DCQA 1NCQA 3ABZA 4LPLA 2OU2A 1PGL1 2ZGOA 5FZBA 4Q4W3 3F0CA 4L97A 1ZBA2 3Q8AA 2EFPA 4YGCA 4NMIA 4OIOF 3GX4X 2QSGX 1ULEA 2W5FA 2Z5WA 4AEDB 3V0AB 3JSPA 1XNTA 4BACA 1T0FA 2EIDA 2WQZC 3A02A 1QJU1 3HHGA 4NN0A 2FDIA 3K48A 2PX9A 2ID4A 1KU7A 2DMTA 1NYWA 4BPZA 4AI2A 3B94A 1QDCA 2IPQX 4XJUA 4R52A 3F72A 2P3YA 4X6AJ 4BGDA 2E63A 4IEVA 1U8BA 1KQ8A 5CG8A 4HT1T 4CPBA 5EQUA 2OQGA 4AVTA 1QJY2 4OHZA 1ZZ6A 1VQMI 1VB2A 3OR2C 1X2MA 5CFDB 1N3OA 4FX0A 4A3MJ 1CN1A 5T55A 1GWMA 4A5NA 3MKLA 4FPHA 3A22A 2CSGA 4N9IA 5EEAA 2EXHA 2ZMKA 3G6JB 1LGCA 2WUHA 5ACA1 2OF7A 1RIRA 5IVEA 3SYTA 2E60A 1TQPA 2HOTA 2ZMLA 3DBRB 1P9QC 3T4HB 5JHUA 4LBQB 2R7SA 1RIOH 2WO2A 3WX5A 2GMEA 2YFZA 5CYYA 2A3SA 3FJSA 5TSWA 5FFXA 3F6OA 1S29A 2FDFA 1D1AA 1HRI3 2F6BA 1WA4A 3B5LB 3LSTA 4QPGA 2ZA9A 3G4SI 4FAHA 2EH3A 4L8QA 4II3A 1ZA7A 3DBLB 2BW3A 3M1CA 5IVJA 4FX4A 1UKGA 3JQWA 3BTYA 5IYDJ 5H9QA 1F5FA 1KS4A 1Q8VA 1Y8QB 3H1WA 3LKJA 2MGQA 5C3PA 2R071 5EJZB 1V6JA 4YM0A 5ANQA 5FZ7A 1SZBA 2R0FA 4LT5A 5EYRA 1XGNA 1TNFA 2SBAA 4N43C 4OZOA 2HWD3 2PHTA 4V2FA 2JA5J 4QXBA 1NLQA 4XLEA 2P81A 4FPCA 4QX0A 2P3JA 3ACHA 1O5UA 1D4M1 2JQ7A 1HB1A 2XB6C 1GHCA 2EINH 1SBFA 1LOCA 3PUIA 2QQWA 4EGYA 5JUVA 2D93A 4JGZC 3WU1B 1OOPB 1JHHA 1Q43A 5FYTA 3QYEA 5CVVA 2G9ZA 2CRGA 3DFGA 1LHVA 3I97A 4GJYA 1MBJA 2HWC3 4L5IA 4BM8A 5K7FA 2EALA 1R7JA 4HNTA 1IKQA 3HT1A 4QXHA 1QZYA 2K02A 1MBGA 4XEZA 3K1NA 3LOIA 5GZGA 3DXTA 3MIBA 5A7OA 2XSDC 2QKDA 1IJWC 2ZMEA 2A7AA 2O7OA 2R7DA 3VDXA 2ZX0A 1RZ4A 4IV3B 3JTHA 4B8EA 3FXKA 3NAPB 1IOAA 2QQIA 3B73A 1TNTA 2HWE1 4JDOA 2HI3A 1XYOA 3PLQA 3BR0A 1SBDA 2ADEA 2HJIA 2IS4A 5IT6A 2A75A 3VDDA 1YW7A 3SZGA 3CUQB 1UMQA 3K4MA 4E8DA 4URTA 4COVA 4JBAA 5A3UA 4D69A 1J7KA 2JZYA 3CLPA 2YPDA 2X6YA 1PP8F 2WAQN 3WQ1A 3R0AA 2WDBA 5ILVA 4HOOA 3OG2A 2PMWB 3DEWA 3WDWA 2DFCA 1VQ8I 3E5UA 1EH8A 1J3QA 1S0BA 4Z6YA 1Z6RA 3DYPA 3D5LA 1SLLA 5GTHC 1N47A 4PIXA 2XH6A 4UXNA 4ZYAA 1RMU2 3B01A 3RRDA 1FOXA 5F5IA 3FKJA 2M3AA 2I5UA 2BVMA 5LA1A 3IAS2 3H3ZA 4P96A 3AAFA 2QQJA 3T1BA 1BXHA 2BWCA 1HV0A 2BW8A 1OVPA 5CKMA 2O61A 1OYYA 2BZDA 3UL2A 2JECA 1EAH1 2TDXA 4IQPA 3PMSA 2XSJC 4YFKF 5BNPB 2RVCA 3REOA 1YHQI 4AVZA 3BTLA 4F83A 2R49A 4XJ8A 1MEC1 1YRZA 3WG3A 5GKAC 4RB3C 4RS8A 2DT5A 1REEA 5KHGA 4UUVA 3SKJE 2FDKA 1MDMA 5JPMB 4I0BA 2ZHNA 2Q2EB 2R92J 1SC7A 1VRBA 3K4CA 4YEJA 4RGUA 5FYUA 1ODMA 4EJOA 5IHRA 2XIGA 3BR2A 2VCAA 4UHTA 1SMVA 1ZGJA 4G9YA 5KHJA 4XW3A 5FZCA 3E97A 3KT1A 3OYKA 3CL1A 3PFIA 2R063 1ZK8A 4QX5A 2B5HA 3PJQA 4AAXA 1HXS1 3AP9A 1TP4A 1SAXA 3ZSMA 2HEVF 4CEWB 4IE0A 4FOWA 4ZU4A 3SFIA 3BQZA 1PNFA 1RVF1 3LPGA 3LF7A 3NQHA 4I99C 1VMFA 1JKOC 1MQTA 3FWEA 5FY9A 3MW4A 3KE2A 2EFOA 2H1LA 2RQPA 5LGUA 2DDAA 5E17F 4W50A 1XC5A 5KBFA 1PMHX 2GN7A 2RE9A 3DPRA 4IOCF 5F27A 1TW2A 4PF5A 3FL7A 2RREA 2HVRA 4BQNA 1N3QA 4UXAA 2LKPA 1IXRC 5F1JA 3QWLA 3TW7A 5EPAA 2Q30A 3OPWA 1MD0A 2NRAC 4DNYA 2KM2A 1W6NB 1U5TA 4V2GA 4UOJA 3E5QA 2FD5A 3WTSC 1QHDA 3H5NA 1MACA 1XNDA 4AVBA 2MHFA 3JZVA 1WGPA 4QXKA 4TXWA 4D7SA 1VBB1 1RETA 2EV6A 3ZFEA 3SLIA 3I55I 4L9TA 4IPAA 1NKGA 2WFPA 4AE2A 3RJPA 3LSEA 3OYCA 3MDPA 2DFHA 3KP6A 4LK1F 2ADDA 4MQVA 4AUXA 1QNTA 2L9VA 3MD2A 3JBG2 4B44A 5HCFA 3OGRA 2H0BA 1GZWB 4JRAA 2K9LA 3PVBB 1UZ0A 3MIGA 2IWGB 2LKSA 3KPHA 3S2DJ 3H50A 3FHQA 1C0WA 4OULA 3GLLA 2WZR1 4ZZ5A 3VPRA 3HXLA 3ZQIA 2JJ6A 5LY2A 2DO7A 4QM9A 2HEOA 5GAGJ 1WCKA 3BDDA 1TWFJ 1MNMC 3RZJA 1RKWA 3F9KA 5L9RA 1WD3A 1NE4A 4FQ4A 1Q1VA 3KFWX 3AMMA 2EXJA 1LRHA 2R7QA 2KKOA 4PGHA 5E1ZB 3M1EA 2HKOA 1FBQA 3FBYA 4B1LA 3KM5A 1Y0NA 2VMEA 4H14A 1O91A 4URAA 5AFBA 5K7PA 4PIYA 5FLMJ 2L4AA 2CV1A 2DV9A 2PHWA 1REFA 2V1UA 3B9IA 1Z7S1 1GP4A 2RS51 2Q1FA 4AIKA 4YW6A 4D5CA 3CMGA 2YR2A 5FWEA 2JDKA 4PFOA 3FMGA 4OAYA 1YCIA 1OFNA 2XAFA 2R7XA 4PGGA 3POFA 4CA9A 1CZSA 4KBZA 3OB8A 4G6TB 1HDKA 4LLGF 5FPLA 2JDMA 4N53A 3ECOA 4XSZF 3A01B 5IVYA 2Z1DA 3FIWA 2X0LA 1QMJA 4BLIA 3GHMA 5LWBA 4DXZA 3WNPA 2ISZA 3RKYA 4XUTA 4BE3A 4IHTA 2EV5A 3GTJJ 1QVUA 3VBUC 3QP6A 2BGPA 2B45X 2EXKA 1ZBE1 2YHJA 2WB1N 3D5SC 4GAZA 3CO2A 1B9MA 4KT5C 4Q4W2 4XMYA 4OI0A 1W06A 1VAKA 3OIPA 1QH6A 2GP5A 1BIBA 3HC7A 4ABZA 1S2BA 1J09A 2A61A 1D1CA 1DQ1A 4L5EA 2JIJA 1VI0A 2QGUA 3O3KA 4DPNA 1K4TA 1V9U1 4COUA 1VBC1 4QX8A 2EWNA 3F8BA 1XSVA 2DCEA 3JAMZ 3EUKL 1NCQB 2E7TA 1XX5A 2PA7A 1F4KA 2O0OA 5FDBA 2EZIA 1HXDA 4MHRA 4RQPA 4BQ1A 2PN6A 4Y17A 1Q8OA 2V9PA 4UVAA 2XJRA 2DA7A 1IKPA 2DTYA 4DEVA 3HRSA 5ERLA 2KJBA 3BTAA 2LP0A 1AR72 2LR8A 3RKQA 2GC3A 2V6CA 2W1WA 2Z42A 1OCRH 3TP3A 3M8LA 1CF7A 4X6QB 1RGSA 3DXUA 2J5PA 1RUD3 3IPVA 4XUOA 3MO4A 4EZ4A 2DCYA 1OLQA 5FGMA 3GXUA 4YGDA 5D21A 3WDVA 2F5CA 1ZG3A 1O3QA 2ZFUA 1X8EA 4HG2A 2M4KA 1B1BA 1W36C 2WJSA 4XSXF 4LOCA 3J7LA 3BG7A 4HVQA 3OEBA 1G86A 3I5UA 2AEZA 2PEXA 1BR4A 2X6OA 2JMWA 3I4NJ 1DU3D 2R7UA 3TNPB 1SBEA 2JXAA 3ZXKA 3KT7A 2IXHA 3C7JA 3FDYA 4XF9A 3I3DA 2GMMA 2JD4A 3M7AA 3L1PA 1X2NA 3TW6A 2VT3A 2JDYA 2EB7A 3IZOA 2ENRA 3U1XA 3AJZA 4AHXA 3DUIA 1ST8A 3R61A 2A3WA 2WSVA 4GIQA 3JCIA 2CWEA 2CYYA 1OQYA 4Y20A 5FP3A 4QPGB 1TEIA 1JHNA 5E79C 2HWD2 4AYUA 1NHAA 2XJTA 3SH3A 4AZZA 2BW3B 4KIFA 4L18B 3D82A 3LB9A 2ACJA 5FPVA 1JYVA 3FN9A 1DDNA 2Y30A 1X1CA 1OD5A 1R22A 1W2TA 4CA0A 2CV0A 3A0HC 2JKBA 2QQOA 3U4XA 5HOOA 1Y1WJ 1AUYA 2HWC2 4CDWA 1ULGA 4NIGA 3TWIA 5DUUA 3ZXJA 2JG9C 4CCLA 3PTYA 4LMFA 2EXIA 4LOTA 2EFWA 1W2OA 4CU9A 2L9RA 3DKQA 1ORKA 5HCBA 3G3ZA 2IFWA 3J7NA 2K27A 2XQRA 2KIQA 3FXMA 1YYVA 5AONA 2O3FA 4FTEA 4HSJA 3LFKA 3U10A 5DS9A 1WJDA 3NL1A 2CU5A 4ZZ8A 4LLLA 3HOZJ 3P5JA 4F3JA 2Y9ZA 4ZJZA 4PCQA 3DP7A 3HZJA 2PFBA 3M3OA 1MZFA 3AG2H 2NQYA 4QU1A 5JOXA 3FK6A 2DYSH 5JOZA 1MS3A 2JT1A 3GTPJ 1OUSA 1H9TA 1QJU3 4PJYA 2PYTA 2ZMEB 1JTXA 3FX3A 4QD2A 3HB9A 4FXKB 3VDDB 3ZFGC 2PJRA 1IQDC 2W94A 2VXJA 3OWTA 4UFJA 1UL9A 3TO7A 2VLAA 4LR4A 4AGGA 2X9DA 4GFBA 1MMGA 4RHV1 1XMXA 2QQLA 3UGHA 4QKDA 4M3DA 2MA3A 5LHGA 1TME3 4HZFA 3ZFFC 4EQVA 4LG0A 4QDSA 5BOXA 1D7PM 2KMUA 2Q4SA 1E5SA 4MZUA 3SQNA 3OYLA 2GOMA 2DA3A 5ACA3 2Y0IA 2AREA 2AXLA 4ZONA 2HS5A 1IQAA 2WS91 1MZ5A 4AWXB 2JA2A 4KT6A 3PL0A 3MEPA 3IRQA 1OLME 4B1MA 5D5VB 3H9JA 5GPCA 3L2VA 1MBHA 2XWJB 1GYKA 3KF5A 3VHOA 3K46A 4AHYA 2VW0A 4P1WA 3WTVC 2GP3A 4DXTA 1JGGA 1W9FA 3RZOJ 3NVCA 4UB6C 2O9LA 3BOPA 3W59A 3ZXDA 2X10A 1I27A 4DZJA 4QMAA 2QM3A 2VE8A 3DTKA 5L3CA 4K8RB 4ENJA 1MDMB 2CHHA 4UNOA 2MYSA 1FWZA 3NWSA 3ZSLA 3HAGA 4IEZA 3HUGA 2R073 3CCQI 3TO9A 5CKTA 2O8KA 4Y1UA 1EJ9A 5CVJA 1LHWA 1DPRA 1OA2A 3KV9A 4BMBA 5E3NA 3WDUA 4E7ZA 4Q29A 2VD7A 1D4M3 4ATFA 1G9CA 2KRHA 5M3FJ 4R4ZA 3RZDJ 2ZKLA 1MQTB 4K6BA 5JSOA 3DPRB 3GMEA 1P7IA 1GT0C 2HWVA 4LGWA 4COZA 1UZZA 3OOUA 5LATA 1W8NA 2FF4A 4UB8C 2GH2A 5FREA 2XLFA 3IMMA 2BVVA 1KQ0A 5F64A 1J3PA 4COYA 1U5TB 1Z6TA 2EFQA 2HWE3 4IEPA 4OLLA 4KI5M 4EN7B 1VALA 4UYBA 2GWRA 1GOGA 2M8EA 3WG9A 1PX4A 3I2DA 1RUJ1 2K4JA 3ZFEB 3RYPA 3ZGKA 2VASA 4FAGA 4IX7A 3THTA 1E0EA 3GFIA 4DNCA 2A6XA 2WNEA 1XGOA 3IDBB 1ZZ9A 2X1DA 2QWWA 5GALA 5EDNA 3S15J 1JKPC 4RS5C 2HQRA 3QPSA 3O12A 1QZEA 1B09A 2K9ZA 1ZELA 1YX5A 4CZZA 5GLTA 4A3JJ 1BW5A 2DWRA 2W95A 4UY8I 2F4OB 1ZR4A 2F4MB 5FRNA 3GNEA 5BNGA 4PT6A 1BL0A 2O1QA 3ABLH 1SLAA 1W5SA 4N43A 4KNYA 5FUIA 3S1MJ 1O4TA 4MXWA 2RS12 1K42A 1CAXA 1AR63 3CF5F 4HQMA 4BQ5A 4CCCA 1MZBA 2WN2A 1QNWA 4X1EA 4K7JA 4MO3M 1YC61 4C30A 1EAH3 2DBIA 2NVYJ 3N36A 2B9VA 2PMUA 3ZYGA 3POSA 4QLCU 3EB7A 5FY0A 2R6QA 4J6GA 2QQ9A 4K3UA 4XOTA 5DXDA 1OKQA 4D6SA 4O3MA 1MEC3 4Z2AA 1H6YA 5LHHA 4EV0A 4JVAA 1T6SA 4ESFA 4OUSA 2AEYA 1J58A 4UFHA 3T8RA 5IYCJ 4IEQA 2W2IA 3BPXA 3V4GA 1LAJA 1UU5A 2HEWF 1FV2A 1MH3A 2LYCA 1ENHA 3GZ6A 4XZUG 2JN6A 4HN1A 1UXZA 2O0YA 4Y4RA 1DCSA 1XNKA 3SCGA 3BALA 2DUOA 4CEYC 1W3XA 3HGYA 2E36A 5FYVA 3C2GA 3OBAA 4M3CE 4ESBA 3GO5A 2PQSA 4FFIA 2ZAHA 2CW7A 2RDSA 1H4GA 1JI8A 3NW4A 2QQNA 3OYDA 4N53B 1WVRA 3QU3A 3GEZA 4RAYA 4BY1J 2XL7A 3GBFA 1RVF3 2HWB1 1XNBA 5FMOL 3QYFA 1V6NA 3S93A 2VL8A 4KWKA 4DYCA 2A69F 2P3KA 2ZSHB 5IVBA 4O5VA 1WJBA 4BBRJ 1OPOA 1W4MA 2FDJA 5ISLA 1A6CA 4BA6A 3MICA 4NHKA 2HU9A 3KQ4B 2DVFA 2CMPA 1KGSA 4KIGA 5JSRA 2DODA 4AFMA 1GQGA 2D6LX 2E7AA 4MX3A 2VJ5A 5HNFA 4JRLA 2EPFA 5HPOA 2EIGA 3TEWA 3K2OA 3JQXA 2DI3A 2ORZA 1AHSA 5FYSA 3MKZA 2W91A 4XK4A 2WZ8A 1VB4A 2L7MP 4OQ8A 3IC7A 1R1UA 3E6CC 2FBIA 5C44J 2HYKA 3VZMA 3JB4C 5EEGA 1M4WA 2XVGA 2OXBA 1LPQA 1W9TA 3HOUJ 1RUD2 5F3CA 4RQPB 4DINB 1S7EA 1HC8A 1ODNA 1JT6A 1V0AA 2WYFA 1Z1DA 5A32A 4UFMA 1R49A 2PTMA 3ACLA 4RDUA 2NOJB 1VMJA 2ZCWA 1DIWA 3L2RA 1Y3TA 4ZS3A 4D6RA 5B4NA 2WZR3 4AI1A 1CF7B 1GV5A 5KC6A 4CXYA 3IPVB 5BUVA 2O03A 4Y26A 2C1FA 2HXOA 2F48A 4XABA 4M71A 4A41A 3TQNA 3JTGA 1Y8RB 2ZFWA 3MFKA 4M9SA 1K4SA 3AMPA 4QHZA 2L9NA 2EA4A 4MVTA 3WTWC 3BN6A 3LGRA 3ZO0B 4ZKTB 5JZGC 1QDOA 1W2UA 3J26N 2RJKA 4TTGA 1P4AA 4QGLA 5HDKA 4WBBA 1VBD2 3J7HA 3LSMA 2WQ4A 3CJIC 4QX2A 4A0ZA 1OSGA 5CLSA 2EICA 4XLAA 3W9AA 4CRQA 1IF1A 1ZA4A 2UY8A 4P9LA 2GC1A 4V1PA 2E35A 3PNYA 3D0JA 5LLQA 1Z7S3 2ZACA 5DZGA 2RS53 2VQHA 3OY9A 2VVDA 3VYSB 4CO8A 3CCLI 3ZR5A 1J83A 3UKGA 2JICA 5JR2A 3ZN1A 4L11A 1LOEA 4ASMB 1PO22 3QQAA 3MZ8A 1PZ9A 3FXUA 5DD8A 5JDBA 5BYNA 2HOAA 3NO8A 5HCHA 4Y20B 2VTXJ 4WVZA 3L2HA 4HONA 4NVPA 4N0BA 2VM9A 3W2AA 1FV3A 1YQ2A 5EEHA 5FKCA 1Z3XA 1RPWA 1TWGJ 4Y3OA 1IHMA 3FM5A 2ZNYA 5FKOA 1EV11 2BV4A 2ERFA 5GADJ 4IETA 4MNUA 1ZBE3 1BMV1 1XTAA 5CFCC 2X8KA 1I39A 2RAEA 1FX5A 4CDWB 4FOVA 3U11A 3LA2A 3KVAA 2Y6JA 1G4DA 4NE9A 2X6WA 2M9HA 2MD5A 2VJJA 5A6ZA 3OYWA 3K7AJ 5M0TA 3PVNA 3TL4X 4AOCA 2QZ2A 3ACGA 4PI2A 3POYA 1OOPC 4DRRA 3DV8A 2X5IC 5J1XA 1JXSA 4ZXKA 1UOBA 1VBC3 3O2PE 2WABA 4B1RA 1XNCA 4J1XA 1Y9QA 4Y5SA 5I0TA 5HLTA 2ARCA 4R9AA 5LA9A 1Y0UA 2YYOA 2F2EA 1TWAJ 4JC1A 5E18F 1LB2A 1HDPA 3HEIA 2JTVA 2JE8A 4U36A 4BXXJ 4EJTA 3HRUA 1F1ZA 4IV3C 4AGVA 4EJWA 3BROA 2FU4A 4WV8A 3V65A 1C5IA 1K12A 5E3MA 2VIXA 1TME2 1ETKA 1POGA 4RA0A 2XHNA 3CUQC 4XBQA 3CCRI 1YTYA 3E6DA 2WNOA 2PJRB 3O1PA 4U0VA 2DTWA 5FRAA 2NXNB 1R1VA 2DJIA 4B4PA 3QH6A 5F7UA 2VULA 4XDPA 4NO4A 1JMUB 2UWMA 5FP4A 4GWIA 3KV5A 4R1HA 3PNVA 1FYUA 2QA4I 2M0CA 3AYAA 3FHAA 4LG0B 1NX9A 4OHWA 4Q4X2 4QSHA 1B35C 1W0TA 3IKTA 1PIV1 5A2QK 4P9GA 2QCOA 2BEOA 2JX9A 3L09A 4CDXC 4A6EA 2ESNA 1DQUA 2WINB 3I2JA 1YX3A 4Q0SA 5J3LA 3TRSB 2Z16A 4D8MA 2ZHMA 3BOQA 4XQFA 5DYMA 3N9NA 2SLIA 2NMOA 4ORFA 3MV11 1R64A 4QX7A 2RS31 2DOAA 1V6LA 3RJRA 4DY3A 2V5YA 3I49A 3ABKH 3MN2A 1N1VA 2Y38A 5BNPC 1O7FA 1W8WA 2R072 3BODA 2OQ6A 2OZUA 4OIRF 3F95A 1COV1 4Q4V1 4D0QA 4CCMA 3HOWJ 5GZFA 2A68F 5FPZA 3BY6A 1G9AA 1UJ8A 5FROA 3TOJA 2VMFA 4NROA 1UYXA 3NAUA 2VE9A 2WZEA 1LNWA 5LA0A 1Z78A 4NRPA 4QQPA 4C9YA 2YS9A 4R4XA 1FMD1 1TQMA 2R7ZJ 5FZ0A 4A7KA 3HUGB 1RUG3 4ZDLA 4RM3A 1PHMA 3U21A 3K4KA 1PX3A 4KG8A 3MVPA 3LEKA 4E2SA 2GMPA 1QIQA 4IE6A 3V42A 1Y7BA 5C3OA 3FBMA 2Z9OA 3ELKA 2P5KA 4LE4A 1G3YA 4FTSA 2CGPA 2FQ4A 1YJWI 3BQYA 1BQPA 5LZ6A 4FETA 3OUJA 2HWE2 1Y1VJ 4M74A 1OQEA 2VZSA 4QGMA 4WM8C 3S6PA 5K5QA 1PMIA 3ELNA 2MFZA 3BZCA 5IK8A 2G1MA 4AFAA 2ZPXA 2VNVA 1JZ5A 2YGLA 1HSTA 1CZVA 5L3FA 4HDUA 3MF6A 5I0RA 5J96B 2JWTA 3P3PA 3VKOA 4II2A 4BQAA 2YROA 4QPWA 3HOYJ 5L9VA 3ZDSA 1DGRN 1MW7A 4H2AA 4JAAA 1YO5C 3IP4B 4L0YB 3FUOA 2HXIA 4ETSA 1D0XA 2VW2A 3QLQA 2EIJH 3JRIA 2ZTNA 3POJA 3H8OA 4I7HA 1QJX2 2DCZA 4RAZA 4XRFA 3PIOF 1MJ9A 2JDPA 4C2TA 1AR62 2IP2A 1VAMA 1EYBA 2P3IA 2HBTA 4RHV3 2JDHA 4HQEA 4EWDA 1W6OA 1H9GA 5E16A 3J8F2 3WR0A 1E5HA 1PO12 3T1MA 1JZ7A 2BTVC 4M9XA 5KVRA 2VMDA 3WF1A 1SHWB 2JG9A 1U8RA 3E7LA 4N43B 4MXWB 5A3NA 3AK0A 2OJED 1HLCA 2WS93 1E5IA 1CAXB 2ZEYA 5FAXA 3TAYA 2HYXA 1FBUA 2H94A 3ZMVA 2DFIA 4W4ZA 3PQJA 5KCMA 3W20A 1AJOA 4XLPF 2E7XA 2JK3A 4TWTA 2EK5A 2VE1A 3H8RA 4YZ2A 1OF4A 2FZ2A 1WCUA 3J7ZI 1J9IA 4Y1ZA 1IV6A 3HKZA 1IDYA 4OMYA 2R7VA 3KLNA 2R3SA 4M6VA 3VHRA 3C2HA 1G8WA 2CUEA 1J3RA 1WRJA 1DP0A 1TL8A 2G7UA 1H89C 5TISC 2GDFA 2NS7A 1RVF2 4ZYHA 3QCWA 1W36D 2DCTA 2B9UA 3CHXA 3L2UA 1F31A 2W48A 3ZFGA 1L3LA 1AYM2 2BY3A <