4I0BA

Structure of the mutant catabolite gene activator protein h160l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
199
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTLPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Catabolite gene activator
total genus 58
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i0bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i0bA01
1UIKA 4BNCA 3LWCA 4HN0A 1IN6A 5BS6A 3J81K 1WI9A 3E6BA 4N0BA 3J80K 1YLLA 3GYDA 5FDBA 1EV7A 2VN2A 1LNWA 1B59A 1MJBA 2D45A 2VOPA 2CV6A 1LJ9A 2K86A 3WTVC 3KLNA 4S04A 4O3MA 1HSTA 1U5TA 1R1UA 2XROA 2UYBA 4YFKF 3GO5A 4IESA 2GH2A 4LA3A 2GXGA 1PMIA 2XGXA 1R58A 3O14A 5JVTA 1UD1A 5DUKA 3FM3A 4WZCA 5JCTA 3V7RA 2A07F 2O61A 1R5HA 2QCSB 2DPDA 2IPQX 4AXOA 3LFKA 4XLNF 1GQGA 2Q30A 3VB2A 1BM9A 3CO2A 4FHTA 4L9JA 4L5IA 1UCRA 1DPRA 3W6JB 2L02A 2DT5A 3UKTA 1FBSA 3KGLA 4GGGA 3JAMK 2DI3A 3RYRA 5JSRA 1ZAOA 5K5RA 4EJUA 5LLQA 3T5XA 4AQ2A 2PJPA 1IXSB 1UIJA 2KJCA 3IRQA 4PGGA 1TQPA 2K4BA 4WBBA 2XAGA 2PAKA 4YSFA 4ZYHA 1OMIA 1XE7A 4MGZE 1B9MA 4MGKE 1UFMA 4HX8A 3H3ZA 2PHDA 1G3YA 3SZPA 3R61A 4LULA 5DEQA 5FQ0B 3HOSA 4M72A 2DU9A 4HBNA 3SHRA 1J5YA 1XMAA 3AAFA 2FBKA 4A6EA 2ETHA 3CUOA 2XUBA 3KP7A 3GFJA 2A6EF 2IA0A 2M5WA 1LRHA 1YFWA 5EFUA 3C7JA 4MTDA 4L0YB 3U2RA 1PM7A 1STZA 1XSVA 3B02A 2W85A 5TRDA 3TOBA 1Y0UA 1TQIA 4YIFA 1YFUA 4LLLA 4WF2A 4YIIA 5IT9K 2BGCA 3MZYA 1WRJA 4RB0A 3D5LA 5FD6A 2HQRA 3CTAA 4Q0QA 1HKSA 2VE8A 3KEQA 1OYYA 2B9UA 1KA8A 2OA2A 4QGNA 5KHIA 5E1ZB 1QWRA 3NRVA 1U2WA 1HXDA 3LWFA 2DLLA 3MPBA 2BBYA 2XAQA 3U0ZA 1B9NA 4FX0A 1WGPA 2MC3A 2NAZA 1BN5A 2VC1A 2WTEA 4IRHA 5A2QK 2OZJA 3P9KA 1VJ2A 2FF4A 4G7OF 3T0YA 3HSRA 2QUFA 2RKHA 1R7JA 2V09A 3KP6A 2R3SA 1IZ1A 4I09A 4B29A 3QPHA 3F6OA 5E8IA 2OBPA 3CJNA 4Y13A 1ZRRA 1G3TA 4P9FA 2MH9A 3G3ZA 2F2EA 5LEJA 3H1MA 3ZDSA 2O8QA 1KYWA 3UKNA 4K8FA 3DPLC 4J1WA 3DP7A 4Q29A 5HDKA 1YFYA 1PP8F 4D7TA 2BE5F 4JTOA 5IT9Z 1BC8C 4LUMA 3V8JA 3KLOA 4MQ9F 2A6HF 1UCXA 4QGMA 3HTSB 5I8SA 2L3DA 4G94A 3JSPA 2E1CA 2Y0MA 5DDGA 3IBMA 4AIKA 4XSZF 3ES4A 1O3QA 3PQKA 4OINF 2O1QA 1R1VA 3E5XA 3KEOA 4AVBA 4WXCA 2L4MA 3FF5A 4RGRA 2K9ZA 3TDUC 2H94A 2B8MA 2F4PA 4UXNA 2XLFA 5D5UB 2VONA 2E9QA 3DEUA 3ECOA 3I54A 1D8JA 1C0WA 4A12A 3E3VA 4GYIA 1I1GA 5HLHA 4HDUA 2A5YB 4BQAA 2UXNA 5ILUA 2D5HA 1WWXA 1Q43A 1I5ZA 4B8XA 5IT3A 3TOAA 3ML6A 3GFMA 5JI6A 4JTNA 2GA2A 4XFGA 2IA2A 4GYGA 2EJRA 5CLSA 3WG9A 2AXLA 3NQOA 1EPZA 1LVAA 3KE2A 4QXKA 5D8LB 2H6BA 4KN7X 3V8LA 1SD6A 5LGUA 5J48A 2L01A 1SFEA 1ZHFA 4PCQA 1FY7A 1O7FA 4HF2A 1B6AA 4EJVA 2K4JA 5LRRA 3CLPA 3F8CA 2O6GE 3L7WA 3TNPB 1YIOA 3F8MA 2PAMA 1A04A 3KCCA 1J3QA 3LZZA 2PYTA 2PMHA 3CF6E 4KUMA 4AVCA 2M87A 3EBRA 2P5VA 1XB4A 4UUVA 2LNBA 1S29A 4XFHA 3QPTA 3ERED 2R7DA 1P6RA 3KP2A 1IRGA 3EO6A 2DQLA 2OYZA 2XHKA 2QDRA 1PDNC 2QQ9A 2PEXA 1RNLA 3F23A 2LDUA 4R52A 3FE5A 3BROA 2P17A 2L54A 1CAXB 2DTRA 3QRFF 5K5OA 1FBQA 5LEKA 2B0LA 1RUOA 2EV5A 1KQ8A 3GZ5A 1QXJA 3ECHA 4ENJA 3H50A 3U10A 4ESJA 4Q47A 1I6XA 2XASA 4HQMA 4N9HA 3L00A 4ESFA 5K1YA 4IJAA 5HVQC 2Q4SA 3GVAA 1QZZA 2IJLA 2BEOA 2ZBKA 1J9IA 1ON2A 2GZWA 1XCBA 1ZARA 1KGSA 4JQFA 3P7NA 1FSEA 3FXRA 2W84A 1K79A 3UKVA 5HDNA 1MDMB 1DZTA 1CX4A 1H1MA 2EWNA 3T8TA 2XRNA 2EA4A 3OOPA 3H1YA 1H9GA 1VR3A 5J8CA 1R23A 2GC1A 2UWMA 1U12A 4AQ6A 4L9NA 3KFWX 3F3XA 4XF4A 2O3FA 2A69F 4BHCA 4CDGA 5D4SA 4EWEA 4HVQA 2ZMEA 1S3JA 1W5SA 1Z6TA 3DFGA 5F1RA 3VODA 2BYVE 4Q0PA 3CO6C 1CAVA 3EHKA 5BOXA 5HS8A 3ZMDA 2FNAA 5L3FA 1BI3A 3BU7A 3F72A 5LGTA 4XETA 1IUYA 3MEXA 3E5QA 3QP5A 3MZHA 5HDGA 2QQBA 4R1HA 4EV0A 3FHZA 1DGWA 1FOKA 1IN4A 2V9VA 3K9TA 4JK1X 4EQQA 4MTEA 3D0JA 2IW5A 1BOAA 3JTHA 1CF7B 3FJSA 3HTUA 3J80Z 3S7IA 3L9FA 5E1WA 3HUGA 5JAXA 1LDKB 1CAVB 2Q0AA 5FLIA 5LRSA 5E17F 4X6QB 4FT8A 1FXZA 3K1NA 3U1DA 2M45A 1T98A 1CAWA 5LHGA 4CYDA 2P4WA 3WW3A 3R0JA 5FGMA 1Q5OA 2D1HA 2UY9A 3ZMZA 4HQEA 3HT1A 2QLZA 4R8HA 3WTTC 3BB6A 4XLPF 3FZ3A 1SD4A 5FD5A 3CLOA 1UPIA 4LB5A 3SMHA 5EZWA 2ZO4A 3EETA 1KU3A 3GEZA 1DZRA 3LA7A 1U5TB 2QQAA 4F7ZA 4HMZA 2ET1A 2JZYA 3PLQA 5FB2A 3IWFA 2QENA 3JZVA 4R79A 3EYYA 1W7PD 1LR5A 5DCMA 5I8YA 1T6SA 2HZTA 2F5DA 3O3KA 2XL9A 5D4RA 3G73A 3S0MA 1DDNA 1XDSA 2KIMA 1ZZ6A 4M71A 5ICCA 4YFNF 3K0LA 3SXYA 1ZNPA 1F9NA 1L3LA 3LSTA 4MEYF 4A5NA 2HOEA 5DD8A 3FHIB 4EWAA 3QACA 4WXDA 1XSDA 5HLIA 1LEBA 2VC0A 5FPZA 1HKTA 3K69A 2HKXA 4ON0A 3H7YA 1HKQA 3RTRA 2X0LA 1TW2A 3WTUC 2TDXA 1YS6A 3IWZA 2HTJA 2YSRA 2JPBA 2HDCA 1KU2A 4HX7A 1ZZ7A 1YW7A 3QAHA 1IXRC 5E8GA 3WTXC 4KNYA 5KHKA 1ZRDA 3GFLA 1ZZ8A 3TQNA 2ISZA 3MYXA 4FAGA 5KVRA 4RGXA 3KSCA 3IL2A 1JXSA 2PTMA 1T38A 4ZYGA 3DQVC 2F5CA 1NE4A 2PMUA 1IN7A 5KHJA 1TNSA 3RYKA 3I0TA 1V4RA 3GXOA 4UHTA 3IDBB 1SAXA 4OU0A 2MA3A 3JW4A 1SEFA 3WW4A 3EQLF 3Q9VA 5H6QA 2IXLA 4OIPF 1RIOH 4L2NA 1P2FA 4MGYE 5CVUA 3EJKA 3IC7A 4LJZF 1ONVA 4IVNA 5H6RA 4EWDA 4KMFA 1R5GA 1YS7A 4G9YA 4HF1A 2L4AA 2G7UA 4ONUA 1EH6A 1PUEE 2I45A 4XF1A 3LQQA 1U6GA 4IEPA 3NEUA 5E16A 4HV6A 4IPAA 4IEZA 3V7CA 5FLJA 5BPDA 1RGSA 4OOIA 5LBQA 4BYYA 4M6XA 3RPUA 4LTAA 1TW3A 2OZUA 4ASNA 4ESBA 4HSLA 2IXJA 2Y0OA 1BBYA 4BIFA 3RJPA 2J5PA 1K7AA 3I7DA 3FFQA 4ZU5A 3LAPA 1KU7A 1FZPB 1G3SA 3LAJA 5I0UA 3I53A 1HBXG 1RZ4A 2NNNA 5HOOA 1Z9CA 4I3PA 5FLHA 4M73A 5FQ0A 2QJVA 2Z69A 1BI0A 3WGIA 2NNYA 2JT1A 2YR2A 2JSCA 2GA1A 1SFUA 4IEXA 3L09A 4QMAA 1EH7A 4ETSA 3CL1A 4O6JA 3GLXA 4AIHA 1YW8A 2FBIA 1SD7A 1VP6A 3P9CA 1FI2A 2DCTA 2GU9A 4HF0A 2GWRA 3HRUA 4IHTA 5J8FA 1OI6A 5DV5A 2D5FA 3SCFA 1W7PA 4LUKA 2DW4A 5E20A 1IRFA 3T8RA 5FCCA 2EFQA 3WW2A 5LHIA 2BNMA 4L5JA 1Z05A 4NVPA 2D1VA 4KU7A 5CVIA 1LDDA 1ZGJA 3I5UA 1FP2A 4Q5SF 2O0YA 1RTVA 3KP3A 1LDJA 4LEJA 2IXHA 1W4MA 2HGCA 1SMYF 4IF4A 4OIOF 4DINB 2STWA 1P4XA 2HEOA 3PFIA 3K1PA 4U7BA 4ZU7A 5T3NA 4KWLA 2ZFWA 4UV9A 5JR3A 1Y9QA 2FEZA 4KIGA 2MBFA 3KP5A 1GXPA 1YFXA 3BPZA 5CVVA 2RN7A 1YLFA 1ZG5A 2XLGA 2Y48A 3R0AA 3RKYA 3R60A 4EM2A 4WCGA 1T0FA 4IHSA 4CGZA 2ETEA 1XCVA 3O6BB 5LGNA 2EK5A 2PQQA 2IA1A 3COAC 4Z2YA 4D7SA 3CDHA 4X6RB 3OV8A 3QP6A 4N9IA 3IKVA 4KFCA 2OZ6A 4PIYA 2EFWA 2P6SA 1B4AA 3GWZA 1K6OA 2IXIA 1R1TA 3S7EA 2Z3YA 4P55A 4P9GA 2HYFA 1W5TA 1XGNA 1J0RA 5CVRA 5D5WB 1BC7C 1HQCA 3G7DA 4MUVA 1IPJA 2RDPA 3TGNA 2IRFG 1ULYA 3EDPA 3JTGA 4EMSA 5J6XA 2OQRA 3WODF 1J1LA 2PBIA 2QVSB 2P6TA 1CGPA 2VT3A 4LK1F 4S05A 4UVCA 2BNOA 2V79A 4HV5A 1G3WA 3LOIA 4KWKA 3ZMSA 4Z82A 2GAUA 4NHJA 5J7MA 2X4HA 4WX9A 3VHRA 5BMZA 1O3SA 2MH2A 2Z9OA 2XIGA 1O5UA 2O03A 4XFFA 1EP0A 2Y75A 5H20A 5KK1A 3DL3A 3ZQ7A 4LK0F 4L11A 3WW1A 5JSOA 3BPVA 1CAUB 5AVPA 5K8SA 3RDIA 3RKXA 4HAMA 4G7HF 4MQVA 4IEYA 3BJAA 1ZLJA 4JVAA 1UW8A 4L9TA 4A0YA 3GBFA 2AS5F 2VODA 2MD5A 1ZG1A 1D8KA 4MV2A 4ZYDA 4B09A 2Q2EA 5KHGA 4ENNA 3U9GA 1HW5A 4LGWA 4XF0A 1TBXA 5CVJA 2YPRA 5FLXZ 5FLXK 1Z91A 5DCFA 1ZRFA 1IN8A 4XFAA 1SFNA 3BP8A 3F6VA 2UYAA 5ED4A 4Q0VA 4IERA 3CUQB 4L0ZB 4I98B 4DQ2A 4YRDA 2RQPA 3LA3A 4XEZA 4RGSA 4UVAA 3OCPA 1H0MA 3DXJF 3HHHA 5BY5A 4MX3A 3QU3A 2EVXA 2MLGA 1R00A 3M1EA 1YO5C 1REPC 3SZTA 4KICA 1LKNA 4M9SA 4U88A 4KU8A 1X8MA 2D40A 2K02A 1I27A 3ELNA 4RD7A 4PGHA 2FRHA 5L3BA 2PQ8A 4LD5A 3WU0A 1CAWB 4Y17A 4HLXA 1V70A 5KBFA 5FFXA 3I59A 1GQHA 1P92A 3CEWA 5L3EA 3QU6A 5JHUA 2IVMA 4EJTA 1X8EA 2FMYA 1KQ0A 5ICEA 5I0SA 4K2EA 3ZP5A 2PFBA 1ZN2A 5HS7A 4RS8A 2XAFA 1KU9A 2DBBA 2H6CA 1HW2A 4KWJA 5JR7B 1B1BA 4TV7A 5JFRA 1X7NA 4KL1A 4LG0A 4HLYA 1MDMA 3SXWA 4XFBA 1I1SA 1WA4A 4IEQA 4XFIA 5F64A 1H1IA 1JHFA 4Q48A 4XRFA 1K78A 3RIRA 5BUVA 1TQMA 4HW0A 5EEHA 4A0ZA 2M30A 1YHFA 2XL7A 5D1IA 4PIZA 2MLKA 2BNNA 4ORFA 5JSPA 1O3TA 5AONA 2ACJA 4Q4ZF 2VBZA 4GULA 3TO7A 1KQ9A 2ZNZA 2YX7A 2GC3A 1MKMA 2PLYA 3BALA 1J3PA 1NYWA 2CYYA 3FMQA 4P9UA 1RL3A 1R36A 3GUDA 4PDKA 5A2QZ 3ACLA 3JSOA 4A2UA 4EM0B 4AD9A 3GF2A 1DGRA 4GO1A 3JAMZ 1LEAA 3DPTA 4ENMA 1ZYRF 2P7CB 2EFPA 2YX4A 2CQKA 3LAGA 4Q0UA 1BJAA 4E70A 4UBGA 2IP2A 5CYVA 1J2XA 3MWMA 3ZPLA 5D6FA 3TO9A 1DP7P 3FWEA 1V3FA 1XN7A 1CAUA 4OLLA 1IW7F 4WXHA 3RI4A 4ZZLA 1RUNA 3ST7A 3M7GA 5ERIA 3HSFA 2OA4A 3H7JA 5D6EA 3CJXA 5CJ9A 4KT5C 4RAZA 2HYGD 3V8KA 1IN5A 1QY4A 2ZJ2A 3E5UA 4KN4X 1CAXA 1XRUA 5E1RA 1EY2A 3F8NA 1OYIA 4RGUA 4MGIE 1GHCA 3KGZA 3BPXA 3WTYC 4YARA 4AVPA 1TLHB 1USTA 1OFNA 4E2QA 2A68F 2DFIA 4FAHA 1Z1DA 4HZFA 3BDDA 2QNKA 1YG2A 3RZZA 4MNUA 4H0EA 3M8FA 4XSXF 3HRTA 4F8AA 5HI0A 2E7XA 2G9WA 1U78A 2GC0A 3ZN0A 3IHUA 1O5LA 2KJBA 1JGSA 3NSTA 4CHUA 4UV8A 3C1DA 2W57A 4WWCA 2XVCA 4OFGA 2DPUA 1EYBA 2D93A 5BPXA 2KIFA 3SCGA 4A5MA 4U0VA 2M8EA 4KDPA 3I4PA 3T1BA 4GCVA 2CO5A 3RYPA 3F21A 2Q0OA 1QGPA 3E6DA 1XE8A 2HR3A 2C6YA 1J59A 1FLIA 2RGVA 3H8UA 2P7VB 3H92A 3I59B 4CXFA 3Q5FA 1SFXA 2FNPA 2IXKA 4IRGA 2ADUA 3K1MA 3N97A 4IEUA 2OD5A 2VBYA 4I02A 3IRRA 2P5KA 3M8EA 3NKTA 3NJZA 2XKPA 3PVBB 3ABUA 4EROA 3F8BA 1OYWA 5C8WA 1YWKA 2W24A 2PHLA 5I0RA 5D8KB 1FBUA 2QYOA 1XD7A 4BAYA 2GQQA 1TQ5A 1P4WA 5AIPA 1ZH5A 1PP7U 1FNNA 2O8XA 2RC4A 2FMLA 1S8NA 1FP1D 1S7AA 3ISPA 4UVBA 4EGYA 3HSEA 2HFHA 1E17A 4L9VA 3ULQB 1XGSA 2ZNYA 2HWVA 1S7OA 4AIJA 3OF1A 3FXQA 5I91A 3MFKA 2VOOA 2E1NA 3D0SA 1QPMA 3FXUA 5ILSA 2ISYA 4AVAA 4EVIA 4ZYEA 1LQ1A 1QQIA 1S6LA 1SQ4A 3M9AA 1USSA 1ZVFA 4WVZA 4PIXA 3I58A 1MD0A 2H27A 4M9XA 4CZZA 3NVCA 1JHHA 4RAYA 1OPCA 4RB1A 2OU2A 3GYHX 3HOTA 5DCMB 3MDPA 2CAUA 3HHGA 1HSJA 5HLGA 2EA2A 2DO7A 3KZZA 4I2OA 4KIBA 4PZJA 1TTYA 3VFZA 2QWWA 1TNTA 1XGMA 3I64A 3GW2A 1IAWA 4EM1A 1O7LA 4RB3C 2NYXA 1T2KA 1ZZ9A 5J3UA 1ZRCA 1ZG3A 1NHAA 5CADA 1T39A 2COMA 2ZKLA 4OMZA 1UB9A 2QM3A 3WE2A 3SCHA 2KXLA 1WLTA 2WFPA 2HJIA 3BY6A 3K2ZA 4QM8A 4LLNA 1YUDA 1NXMA 3C3WA 3NL1A 3E97A 1JE8A 5ILVA 4HX4A 5C6CA 3H3UA 1ON1A 2WWYA 1QXRA 4BHBA 3E6MA 3ROUA 1QZYA 1OR7A 1MGTA 1O3RA 3GFIA 4QGLA 1IXCA 2VXZA 4G7ZF 4HSJA 1YTYA 4BXUA 4NQWA 3IIAA 4ENKA 2E7WA 4YNIA 2CWEA 5DD4A 1WKMA 3U11A 1FYMA 3J7AO 1FC3A 5ICFA 4G8XA 4ZU4A 1MJAA 2WV0A 3LQRA 2H0VA 4U0YA 3D82A 3PQJA 1FYKA 4I01A 4A0XA 2CFXA 4LA2A 1BI1A 4QWQA 4L18B 1R22A 2HS5A 4M74A 5E1XA 4UBHA 2Z2SB 3H9AA 2B5HA 1Q3EA 3USSA 1GVJA 1JUHA 3ZMUA 2UY8A 2XKOA 4IEWA 1G4DA 2G7HA 1YW9A 2N7GA 1P4AA 3NW4A 1QBJA 4YFXF 3RKWA 2CW0F 2JRTA 4CO8A 3REOA 3R6SA 4UXAA 3V4GA 4O9EA 2XLAA 2MHFA 3N4MA 4DNCA 4LLGF 1L3JA 1F1ZA 4G6QA 2YU3A 1D5VA 3DF8A 3B73A 3QOPA 3RNSA 5I8TA 1Y3TA 1F4KA 4M9ZA 2HQNA 4J1XA 3R4KA 1Q1HA 2VBXA 1OKRA 3C18A 4XF3A 4I0AA 4HVRA 3F22A 2XAJA 4FBFA 3TKYA 3IDCB 5E18F 3OGJA 3DKWA 4OMYA 2VQAA 3M3IA 4KA4A 2Q8KA 1X3UA 1H9TA 5LHHA 3M70A 2WC2A 3OD0A 2UZKA 2QVOA 4NB5A 3WTWC 1XMKA 1KYZA 1QNTA 3KMHA 4EJOA 2F5FA 2FSWA 2DQRA 4E2GA 3H1WA 4HA8A 4XBFA 1ZGAA 4P5OA 4ZH4F 3MCZA 4RB2C 1FX7A 1UHWA 2FU4A 4IETA 3RPQA 2ESNA 2VE9A 2MNGA 5ICGA 2QZ8A 2NS0A 4GXOA 1BI2A 1J75A 1FPQA 1WQ2A 3HYIA 3VEPA 4YG2F 2CSOA 2PN6A 2ESHA 3BJ6A 1G6NA 3SQNA 5BPIA 2V6CA 1CF7A 2ELHA 2EFNA 4PJYA 2D2WA 3KZYA 2CG4A 2PA7A 2K0GA 4E2SA 5BV6A 3DN7A 1O57A 1O4TA 1SD5A 2LF8A 4CICA 5FFZA 1K78B 3S2WA 3WGGA 1J3RA 2C0ZA 1BIAA 1YYVA 2PAEA 3L2HA 3WU1B 1E2XA 4A6DA 1RC6A 1QO0D 4LG0B 1ZZCA 1J7KA 4EJWA 2Z33A 1DUXC 2EA7A 6PAXA 2UXXA 3P9IA 2DK5A 5TJJA 4M6YA 3VOEA 1ZX5A 3ZMTA 4LLOA 2ATFA 4HLTA 4HOBA 3HT2A 3CO7C 3FMRA 4TLFA 3FM5A 2Z5UA 1ZREA 5DYMA 5L3DA 2RV8A 1LB2A 2HTSA 1FT9A 2FA5A 4U7DA 2HKOA 1NZCA 2NRAC 4QX5A 2R7FA 2GC2A 1YFHA 1OD5A 3TO6A 1ZLKA 1XGOA 3BJOA 4HVOA 2P8TA 3BCWA 1FWZA 4OIRF 2M1BA 3W6KB 3ABTA 2OQGA 2DAOA 3SHFA 2JTVA 2DK8A 2H09A 5D5XB 4QM9A 1IF1A 1FYLA 3KP4A 3J81Z 4XFCA 3WE3A 3HRSA 1F5TA 4O5VA 3PNAA 4MZUA 2ZXJA 3WTSC 1Z6RA 4QLCU 4HYEA 1IPKA 4O9GA 1X82A 5L3GA 4AWXB 2VECA 1J58A 4MEXF 2VT2A 3IKTA 1RI7A 3GX4X 4IXAA 4H7LA 3EQEA 5BQTA 5BXXA 2RNJA 4BH9A 4HDVA 4JV4A 1XDUA 2QBYA 2JPCA 2Z99A 3ELKA 2LF7A 2VPVA 4MH0E 2PFWA 2FQ3A 4BHPA 2VBWA 2IXCA 3ZN1A 4KYWA 1U8RA 4Z07A 1SMTA 2CAVA 3E6CC 3EYIA 2ZCWA 1HW1A 3WTZA 5I0TA 3GZ6A 1U5TC 2XV4S 2EV6A 4LB6B 4KMUX 3HQXA 1NE6A 4MGRA 4LFUA 2QBYB 3DV8A 2A3SA 2GXBA 1Z7UA 5FO5A 4META 2RVCA 5EEGA 1L0OC 1GXQA 3TNQA 2Q1ZB 3FMSA 2CGPA 4Y15A 1UHMA 2PG4A 5D5VB 2LKPA 5CU1A 5F6FA 3HIFA 2ZKZA 1W7PB 1MJ9A 4KIFA 1WSUA 1YQAA 1XSXA 1AWCA 3O2PE 3L2CA 4FX4A 4LMYA 2FE3A 4U0WA 4HN1A 2GIVA 3KETA 3OTFA 4IEVA 2EFOA 2F5EA 3HRMA 2W25A 2P5LC 2IT0A 3FZVA 2K27A 1ZZBA 5HS9A 2EB7A 3BZ6A 3I71A 2V1DA 5I93A 4HBLA 2ET7A 3LA2A 1MZBA 3Q9SA 2MPFA 2FBHA 2KRFA 2A61A 1DPUA 2ZMEB 2OAZA 2FOKA 4IRIA 4IEOA 5KHHA 4I7HA 1FSHA 3FX3A 1BIBA 4D0PA 5DUIA 2BV6A 3C3VA 2EAAA 5FPXA 5AIQA 4Q0SA 2J5OA 4JBAA 2K7LA 2FQPA 3WGHA 4P96A 2KKOA 3V7SA 4OIQF 3CUQA 1EH8A 3BWGA 3TDZC 3ZMVA 3EUHA 5K5QA 4WK8F 1AOYA 3MAJA 3CUQC 1ODDA 1U3EM 1VTNC 4ZZDA 3MQ0A 3ETQA 4EGZA 2V1XA 5L3CA 2KIUA 2EV0A 3SFZA 2IC1A 3F8FA 4MHGA 1D3YA 4YYOA 4UNOA 2XAHA 3BOQA 4I0BA 4G6DA 2FXAA 2PI0A 2V1UA 3ES1A 2OPKA 4XF9A 2LSOA 2STTA
chains in the Genus database with same CATH superfamily
1UIKA 4BNCA 1T33A 1TME1 1WI9A 1A6CA 1W6PA 1FIPA 3PNYA 4N0BA 1LOBA 3GYDA 3J9SA 1EV7A 3CJIA 1MJBA 2JUCA 1QU3A 1MZ5A 3DXTA 4YLZA 4IOCF 3RZJA 1TG7A 1QJZA 2OCEA 4O3MA 3DTIA 5IUQA 4YFKF 3IMNA 2GH2A 2JXAA 1PMIA 1QH7A 3O14A 3FM3A 3R4DB 4UYBA 1XU1A 2QCSB 4K20A 3LSKA 3M1HA 2CDPA 2XWBB 4L8QA 1D0XA 4FHTA 1ONAA 3HC7A 1DPRA 5C3EJ 4LE4A 2CMPA 2KD7A 3DEWA 3UKTA 1F5FA 4GGGA 1XNAA 3J4UH 1B09A 3RYRA 2FMDA 1ZAOA 2E71A 3NO8A 3PURA 5FJKA 2PN5A 3K3OA 3Q9OA 4IE0A 3T5XA 3DBHB 2ZHNA 3OYWB 3WHBA 5J09A 4ZYHA 3A23A 1B9MA 4UB8C 4MGKE 1UFMA 2R0HA 1G3YA 3SZPA 2JK3A 3JRGA 3NJYA 4ASMB 3S15J 1BKZA 4JP0A 4CUBA 3PDQA 3AAFA 4A6EA 3K4MA 1BEV1 5ABJC 5F2SA 2ENRA 3OOUA 1NLSA 2BP6A 4NPMA 1IRXA 3C7JA 3JRCA 2LKXA 4AHXA 4K40A 2CJJA 1CIYA 5DUUA 1NG7A 3BODA 2IAIA 4YIFA 1YFUA 3J8F1 5BNPB 4YIIA 4Y24A 4Q0QA 2JEMA 1BR2A 4HNVA 3S57A 1OYYA 4B4CA 4D9JA 2FUG2 1KA8A 2X1DA 1TWAJ 2QE3A 3ERMA 1CQ9A 5KHIA 2W92A 5E1ZB 3VBSB 1U2WA 3MPBA 3U0ZA 1B9NA 1BOBA 4XN0A 2MC3A 2NAZA 1BN5A 2VC1A 2ZAHA 2WTEA 1S1AA 3UETA 5A2QK 2JJ6A 1VJ2A 1A6IA 2VMGA 2QUFA 1IGOA 1RHI1 4C1XA 4QIWN 2NVXJ 1DGLA 2V09A 5C4XJ 4I09A 5H2FC 5F5QA 4J6GA 2W7NA 2HWC2 4NAOA 1G3TA 4MOAA 1JODA 2W4SA 1MS9A 1OH4A 5CEHA 3JRDA 4K8FA 1EUUA 4J1WA 1W8OA 3DP7A 1ZYBA 2BE5F 3ZVXA 2WB1A 5IT9Z 3V8JA 5TISC 3KLOA 3HWJA 5E79C 3NV2A 4DUVA 5E88A 4B7EA 3HTSB 5I8SA 2L3DA 2ZJRF 4OQ9A 3R0RA 3U07A 1UNBA 2BQPA 1LOGA 4QPWA 1ETXA 3A02A 5EZHA 4AIKA 4XSZF 3PQKA 2VZSA 1RYYA 1R1VA 4PF5A 1QPIA 3AP7A 2F4PA 4JDNA 3GZAA 2VONA 3I54A 3DXUA 1PM4A 4YZ4A 1C0WA 2BFUL 5AC93 5HLHA 1AKHA 1D2SA 2Y2ZA 2UXNA 5ILUA 2D5HA 1A6QA 1Q43A 3VZLA 4RQPA 3TOAA 4XCAA 2DTYA 4CDXA 1VZ0A 3C7OA 1WW4A 5CLSA 2NYYA 3WG9A 1LVAA 4QXKA 1Z21A 1PX4A 4KN7X 3ZLIA 3OS1A 5LGUA 5J48A 3FFZA 4G3YC 4BQNA 2KR2A 4JKMA 1XMXA 2ZSHB 3OIOA 1IRZA 3S14J 2RMU1 2JE9A 4EJVA 2BY3A 2K4JA 5LRRA 2WZPP 2JG8C 4L9BA 5KC5A 1RVF2 3KCCA 4CTEA 2PYTA 4AVCA 2M87A 3BTAA 1NUKA 1YI7A 3OYFA 3CCUI 1EV12 2LNBA 2WO7A 1S29A 3A0NA 4EYUA 2JA6J 2XHKA 1PDNC 1WJFA 1UG2A 1VQKI 1RNLA 2K85A 1GZ9A 1PVEA 4R52A 3AXEA 1MNEA 1PMJX 1WW5A 1COV1 5K5OA 1U8BA 4E7ZA 2D6LX 4Y52J 2DFCA 1PVC2 4ENJA 1IDZA 1PO21 2J1TA 3K4BA 1SFOJ 3U10A 3ME2A 1UMIA 4BDZA 2XASA 4HQMA 1JZ2A 2GDFA 2JG9B 1MVQA 2Q8OA 4ESFA 5T5JA 2VBPA 2VTXA 2IJLA 2LW8A 2W91A 3PIJA 1OCZH 2ZBKA 1SZBA 2CUEA 1MS8A 1CIWA 1K79A 1WBFA 3P5JA 3VBHB 4E9KA 1MMGA 5LATA 3PTYA 2EWNA 2BVLA 3TP0A 1R23A 1C5IA 3F3XA 2Q1FA 4XF4A 3V42A 5JVVA 2O3FA 2AR6A 2A69F 4LO6B 3S3MA 2WKKA 5D4SA 2ZPXA 4AEDA 2ZMEA 4II3A 1MBJA 1Z6TA 3K51A 1WKYA 1R4MB 4B44A 4P9IA 2BOJA 4RLQA 4Q0PA 3CO6C 4PBPA 2HI3A 4CYCA 4RHV3 3ZMDA 4JZRA 3ZRGA 1AR72 1MH4A 1XX5A 2WO1A 3MEXA 4RQPC 3E5QA 3MZHA 1NCQB 2AYHA 4RGAA 3R4UA 3K48A 2WV1A 1IN4A 5CISA 2V9VA 3GTPJ 1TEIA 2HVQA 2DMQA 3OD4A 2VKDA 4Y33A 1VNDA 4F91B 1X1CA 1RUF2 3HUGA 1LDKB 1CAVB 2Q0AA 5L7OB 5E17F 3BVCA 3K1NA 2RM23 3U1DA 1JUIA 2P4WA 2I5UA 4AK3A 3NJVA 3BR5A 3WW3A 3R0JA 5FGMA 2UY9A 5HCHA 5L19A 3PL8A 3WTTC 1LE8B 1OUXA 1X1DA 1NAEA 1D0ZA 3SMHA 1LAJA 5C9AA 2WQ4A 3V0BB 1UZ0A 3EETA 1VBB2 1C8M2 1W0NA 2WFF1 4HMZA 1MMDA 3OGVA 5FB2A 1WCUA 3AG1H 2QQNA 3GHMA 2QENA 3F0CA 2CU7A 1LR5A 1V00A 5I8YA 1T6SA 4CDUB 3OOXA 2YUEA 2BU9A 1VMJA 2XL9A 1GLNA 3G73A 3VD3A 4BZ4A 2NPIA 3HPGA 1XNDA 2KIMA 1VQ8I 1UOGA 1W99A 4M71A 5ICCA 3FMGA 3V64A 1POV0 2V72A 3C7EA 1ZNPA 2MGQA 4A93J 3OY9A 3DUIA 3OBZA 2YU1A 1W9YA 3FHIB 4L5EA 4GH4A 5CKTA 4FVVA 1XSDA 2ZGTA 4COZA 1QVTA 5FP4A 3QYEA 1US2A 4PF1A 3H7YA 2X0LA 3WTUC 3ZYJB 2ORXA 3CC4I 2KRHA 2R0QC 2YSRA 2JPBA 2BW3A 2HDCA 2I10A 3H9JA 5LW9A 3WTXC 3GTLJ 5A7WB 4C0HA 1VBE1 2ME6A 2LRPA 4HSTA 1S0GA 2DV9A 3WP3A 3ZFFC 1EF4A 4MFEA 3FN9A 3WDWA 2HU9A 3ZXLA 3W20A 2F5CA 4PJ0C 1NE4A 5HCBA 5F08A 1TNSA 5FKOA 2F6BA 3I3LA 4FCAA 3TWIA 3KYLA 4UHTA 3IDBB 1AUYA 4FPHA 3AVRA 4HT1T 2MA3A 1NG6A 1PUFB 4B3AA 5JPNB 5FREA 3EQLF 3Q9VA 5E6HA 3B94A 4MO3M 1W2AX 1JJ8C 1R9TJ 1RIOH 2C24A 2Z42A 2ME0A 2JVHA 5K7FA 3T09A 4IL7A 5B4XA 3KT4A 3VYTB 2HYJA 1CESA 4ONUA 1POV3 1PUEE 1HQLA 1WZ2A 4XF1A 2HQAA 4W97A 4Q8LA 1EV11 4IEPA 4HV6A 4IPAA 5FLJA 1RGSA 4OZXA 1I9RA 4M6XA 4QX1A 1X2NA 5D2AA 2OZUA 3P1IA 1O8SA 2ZKNA 5D8AA 3QQAA 1XYOA 4XQWA 3Q0VA 4QDSA 4BIFA 2Y31A 5M5WJ 1FZPB 2D7FA 4JCKA 1U5YA 2R92J 1G86A 1HBXG 2NNNA 3MGUA 1Z9CA 3MIDA 4I3PA 4RFT0 5FLHA 4CCNA 5FQ0A 2QJVA 2CU5A 2R5YB 2Z69A 1BI0A 3WGIA 3POSA 2JSCA 2GA1A 1ULGA 4ETSA 4L99A 5ANQA 1D1BA 4AIHA 1VP6A 3RZKA 5F3EA 1N47A 5A3WA 4W8JA 1FMD2 4HF0A 1OCCH 2GWRA 4IHTA 1OI6A 2HXOA 4UFIA 1BA5A 3UT0A 5EV7A 3AZVA 5FCCA 3KHCA 2DFFA 4XC9A 4A3ZA 4QQPA 2CWSA 2RQQA 4L5JA 1U0AA 2D1VA 3BQYA 1LDDA 1AJKA 1ZGJA 1VBD1 4N4OB 4BUPA 1WMEA 5EJZB 1H8TC 4KWUA 4UW4A 3N9LA 3ZMOA 2P0WA 1W4MA 1SMYF 4IF4A 4DINB 3VKMA 2STWA 3WDUA 3MKYB 2L9SA 1IHMA 4U7BA 3O1OA 4OHXA 5C4WB 4UV9A 3DWLE 5JR3A 1Y9QA 2FEZA 4KIGA 4QB2A 2ZGOA 1HOMA 1L7QA 1STMA 1W6QB 2RN7A 2VCBA 5H9SA 2XLGA 5GLTA 3R0AA 3D3AA 4MADA 3R60A 3BKZA 5A7SA 4WCGA 5CZKA 4CGZA 3O6BB 1VQ9I 2EK5A 2IA1A 4Z2YA 4D7SA 5JZGA 2HWD3 3BTZA 4X6RB 5C44J 4N9IA 1BW6A 4PLNA 3MW4A 4CH7A 2ZMNA 3RZHA 2UURA 3AYAA 1B4AA 3GWZA 2IXIA 1WJ5A 1JKOC 4AUXA 4P9GA 1XGNA 5CVRA 5D5WB 1Z0XA 2VOTA 2ZS6B 1IPJA 4AQSA 1OISA 3BG3A 2VG9A 1T6GC 4I30A 4KITB 3TEYA 2OQRA 3PIGA 3Q8BA 3CBNA 2GOMA 5J1YA 1F43A 4A3IJ 4RDUA 2BNOA 2VMCA 5CA6A 1G3WA 3LOIA 1OOPB 3ZMSA 2GAUA 1MEC3 2ZEXA 2ICWG 2DMUA 4PHZA 3NWTA 1O3SA 3B7MA 1IC8A 2QUOA 4QB1A 1RUI2 2X5IC 1TWFJ 1O5UA 3HPNA 3S2HJ 1H4GA 3WEZA 4IHXA 3T3YA 4DW6A 1URXA 1H88C 4YELA 2DA2A 3VGIA 5KK1A 2V7FA 1GUIA 5FROA 4AVZA 3DL3A 5BNNC 1H2NA 4CCOA 1FOD1 5A1LA 1SACA 4HAMA 3BJAA 4FOYA 3RS6A 3WV6A 2YS9A 2RDNA 1PO13 2RR12 4E7LA 3GBFA 2AS5F 1ZG1A 4DBQA 2Q2EA 5KHGA 1XNCA 4LGWA 5CVJA 2YPRA 1VQ7I 2E7QA 4M01A 3K75B 5DCFA 5IK5A 4M3DA 1DGRN 1YQ6A 4JYKA 3TN92 1JH5A 4A69C 1SFNA 1OD3A 3WQ7A 3F6VA 4GXLA 2O8OA 2Q2EB 4L0ZB 3N9NA 2D98A 4YRDA 2RQPA 3V0AA 4RGSA 4XAEA 3OCPA 4MX3A 5AFEA 3WF4A 1R00A 4LBJA 3U37A 3F2ZA 2CV1A 3KQ4B 4XIDA 3ZQQA 2X1CA 5F6KA 3RZLA 2W1OA 5LB6A 1OURA 3RWNA 5CFCA 2VNVA 4KJZA 2PQ8A 3WU0A 4X0GA 5L36A 1E5RA 1MIJA 1JGGA 1GNYA 5LBEA 4BQYA 3AG2H 5J3LA 5KBFA 2BY0A 3VBRC 3CEWA 5L3EA 2W46A 3B9CA 4Z1VA 4IGOA 2QKMB 2FMYA 3H42B 1DBNA 3ZR6A 4RR3A 1KQ0A 4BQQA 5ICEA 5I0SA 2XAFA 1DFQA 2ES3A 3KM5A 3OEAA 1IOAA 2DOAA 4LK7A 3CCEI 5EGOA 4DO0A 2WNUC 4NHYA 1I1SA 3KF3A 3ZXGA 2LY9A 4XFIA 5F64A 1EUTA 4BXSV 4HKOA 3RIRA 4XZUG 4IV1C 2WZR3 3DYOA 4RYDA 2M30A 1YHFA 3HGYA 1MS3A 2CNAA 5A7QA 1F8VA 2BNNA 4ORFA 5JSPA 1O3TA 5AONA 4KGQA 3CMMA 2Q8CA 4N7UA 2VBZA 5J98B 2O7OA 1O59A 4GULA 2HWE3 5CAZA 1MVEA 2VKVA 2PLYA 3F95A 4KG0A 1J3PA 4P9UA 1DQ1A 1XQNA 3ACLA 3ONQA 4PDKA 4BY7J 5A2QZ 3ZFEB 4EM0B 4AD9A 3GF2A 1DGRA 2CQNA 3GGLA 4ENMA 2EFPA 4LBQD 2YX4A 2CQKA 3GHNA 1HB3A 2JG9C 2IP2A 4QPOA 3TO9A 1D1AA 2DVBA 2W1QA 3ZFEA 1W8NA 1CAUA 1FOYA 1ZBA2 3RI4A 4M4PA 3M7GA 3NNJA 5ERIA 2ECBA 3J7AY 2OA4A 1QRYA 5FPAA 2RNGA 4HSRA 3CP2A 1IN5A 2ZJ2A 3E5UA 1AR92 5E1RA 2VQCA 4NJ4A 3F8NA 5FY5A 4Z2WA 3LEIA 5D8AB 2B4KA 2ERFA 4RHV1 5CFDA 3KZIC 1XU2A 3MBWA 1V9U2 1JYTA 2A68F 2VB6A 4FAHA 4V1PA 1AA7A 3DECA 2QNKA 1O8PA 4OHYA 1POQA 2KPMA 2VJJA 1UXXX 4F8AA 4XDQA 4IGQA 3I2DA 1C1LA 2BFUS 3FC0A 3HVDA 1PK6A 2A7AA 3AZXA 4R9DA 1Z0HA 2HWC3 1O5LA 1O4YA 2EF6A 2P81A 4BLIA 2KJBA 2VMIA 2HVSA 2VZ3A 2P34A 2GMPA 5FV3A 3MKLA 5HBAA 4YM1A 4YW4A 5FP8A 3AVSA 2BBAA 5HCAA 3PJRA 1UU5A 3VDDC 1HLCA 5FRNA 4YM0A 3PSFA 3I4PA 4GCVA 1Z78A 4AGVA 2VVDA 3RYPA 4GDFA 1XE8A 3LEKA 5LA1A 3I59B 3Q5FA 1SFXA 1W2OA 2YC0A 2ADUA 3P5BA 3OUHA 3CIHA 1VI0A 3BTCA 2OD5A 1UG0A 4S2GA 1A8DA 4TWTA 3NJZA 2XKPA 4LIVA 3F8BA 3TW6A 2YBKA 1OYWA 3J7LA 3ZFGC 2R7VA 2VL4A 5BNQA 2PHLA 5I0RA 1XD7A 4BAYA 4LOSA 4XCBA 5AIPA 4N43C 4BMEA 4Y5SA 1ZH5A 4DNYA 4COVA 5FPVA 2RC4A 4QT6A 2A3XA 1J09A 4F55A 4UFLA 1MMNA 4P9XA 4Y1VA 1XG1A 4EGYA 3TW7A 2W52A 2B45X 2VW0A 1IQDC 3OYNA 3EMRA 4AIJA 3AFKA 2W9XA 5B3SH 2FQ4A 1VQ4I 5FXZA 2JMWA 5AFBA 5DG1A 3VKFC 2E1NA 5ILSA 4EVIA 2JDMA 4ZYEA 4R9CA 5FYBA 1DGWX 3M9AA 1USSA 2TCTA 1QQP3 1T6BX 3I58A 1R49A 2H27A 4CZZA 3VZMA 1JHHA 4M3CE 2JIJA 2OU2A 3GYHX 3MDPA 3WDTA 1QJY2 3SKJE 4DYQA 1HSJA 4BL0B 4A3LJ 2DO7A 1XNBA 1SBFA 4YW5A 1K83J 3HMYA 3UJQA 3FLRA 3I2GA 3VBUA 3UESA 3MVPA 1CPMA 1IAWA 2E33A 2K2SA 5DG2A 1OUSA 1ZZ9A 2WJSA 3KZ4C 4XACA 3VBSC 4ISRA 5J3UA 1VRH3 1ZG3A 1NHAA 2XRLA 1WGXA 1JZ6A 4AL9A 5A32A 2ZKLA 3HJRA 3SCHA 1WLTA 3VZNA 1VBA3 1ZK8A 3BY6A 2B7YA 2CW7A 4CDXB 2W00A 3E97A 4HX4A 4Z2AA 5IVBA 3H3UA 1PHMA 2M4GA 3E6MA 1QZYA 4I99C 3OL3A 4G7ZF 4FPLA 1U5IA 5IP7J 3IIAA 4XLFA 3U11A 3J7AO 2HBUA 1MJAA 2WV0A 4P08A 5CFCC 2GALA 1FYKA 4BEHA 2YBPA 5M5YJ 1QJX2 3UV9A 1BI1A 3S32A 3EYPA 5F5AA 2BGOA 2JDHA 4JGZB 1W03A 3MMYB 5IATA 4UBHA 2BDRA 3USSA 4QX0A 2RM22 1WH7A 1JUHA 1NCQA 2M7BA 3ZMUA 5C3PA 1X2MA 5FBZA 2N7GA 1P4AA 4YFXF 1Y6IA 5GKAC 3WG7H 3B6CA 3I55I 4UXAA 3HB9A 4CYCB 4NC7A 1AYM3 1A8MA 2QQMA 5JWPA 4DNCA 1L3JA 2MW8A 3GF6A 1F9KA 2A6ZA 4G6QA 2MYSA 4FTHA 3DF8A 3B73A 3RNSA 1Y3TA 4DRRA 4IZZA 2MEV3 1XYPA 2ZX1A 3BYWA 1ASJ3 3R4KA 2GN7A 3ZXJA 3MF6A 3WF3A 1GKBA 1UKGA 4AI0A 3TKYA 3IDCB 5E18F 3WDXA 2JG8A 3PSIA 4AE2A 4OMYA 2E60A 3HOZJ 1X3UA 1H9TA 2RDSA 3OD0A 2UZKA 3H9QA 2VD7A 2QVOA 4NHMA 3Q8FA 1XMKA 1YJWI 2A71A 2DOEA 3KMHA 2WZ8A 4QAWA 2VBBA 1MBFA 4RHV2 1QF3A 2WIIB 2GP3A 1FX7A 2VJIA 2FU4A 4ZTFA 1PGW1 2ELJA 4XUTA 1UMZA 1FPQA 4MYEA 4FPCA 1VRBA 3HYIA 4XBLA 4YM3A 1HRI3 4YG2F 2HH9A 4IXLA 3RFRA 3ZSJA 2ESHA 1VBC3 1QGLA 1G6NA 4YVSA 4PI0A 2BTVC 4XIKA 2R32A 4PJYA 2NN8A 2CG4A 5JLVA 5BV6A 4DOUA 1SD5A 5DS9A 5L9BA 4CICA 2VZRA 3JQXA 2WNUA 1J3RA 2C0ZA 2PAEA 4P9WA 1ASJ1 3JRFA 2YPJA 4LG0B 1Z7S3 5IHRA 1J7KA 3D1NI 4EJWA 4BGDA 2Z33A 4GD4A 1RUC2 2EA7A 4JKKA 3ZYBA 2VUDA 2TNFA 5B66C 1ZX5A 3CDIA 2ATFA 4HLTA 3TRSB 2PHRA 3FMRA 2NVUB 4TLFA 3FM5A 3LL7A 3Q8EA 1ZREA 1WLDA 5G05L 2RV8A 4BQ1A 2FDKA 2HTSA 3KX2A 2R4GA 4U7DA 2FA5A 1A5JA 2Q8EA 2HWF3 1YFHA 2EXHA 2WN2A 1JHJA 1OD5A 4COYA 2XWJB 2KISA 2VOWA 3NAPB 2VKEA 5DMYA 2H1KA 1X58A 1P8JA 2CGNA 2XVKA 2DN0A 1FYLA 1ULDA 3J81Z 3VDDA 3HRSA 4MZUA 1C5HA 4GRIA 4CEYB 3OL4A 3DCFA 4HYEA 3OYAA 1XNTA 4QXHA 1K5MB 2Y6HA 5L3GA 3OB8A 4AWXB 4MEXF 1UZZA 3C2UA 3GX4X 4CCCA 3ZN5A 2BJSA 4A41A 5BXXA 1YRNB 4OHVA 3AL0C 4HDVA 1LGNA 1Q8VA 2P6CA 2VULA 2Z99A 3ELKA 2LF7A 3POWA 5DABA 2VGDA 3ORJA 1V0AA 2AENA 3ZN1A 1BLZA 4Y22B 3E6CC 2ZCWA 5I0TA 2XV4S 4BOWA 1X9TA 4MXWB 3CCRI 3HQXA 5EJ1B 4MGRA 2QBYB 1FOD3 3WQ1A 4V2WA 1GXQA 3ZYGA 2JDKA 2JWPA 2CGPA 1KXGA 2L0KA 3RMYA 4XYXA 5ISLA 2CHHA 5JXGA 4PJMA 4RS5C 3DPRB 1H1AA 2IGKA 4CPBD 3IDEA 4FX4A 2Q8DA 4LMYA 1NG0A 2E32A 3OTFA 1MR5A 2EFOA 2VL8A 5A3LA 2F5EA 4UAPA 2W25A 3FZVA 2EZLA 4BDVB 3DKQA 1Y7BA 1YQ2A 3WF2A 4JGYC 2V1DA 3LA2A 1C3HA 3CHXA 5FWJA 5GZCA 4UFKA 3A0BC 4GFBA 2FBHA 2KRFA 2WFF3 3POJA 1LFPA 1OCRH 5LBCA 4QPGC 2LTPA 2Y0SA 2PLV2 2QZ2A 1NKGA 3JRAA 4LE3A 4RSUA 3FX3A 2JE7A 3C3VA 2EAAA 3MLJA 4GAZA 3VDCA 5DM6F 1G8XA 2ID4A 1YIJI 3DEMA 1RUJ2 2J5OA 2WO2A 1HQWA 1IPSA 2WYSA 4XRMA 4LKEA 2KKOA 4RA2A 4OIQF 1EH8A 4DOZA 3EUHA 3MAJA 1SLIA 3CUQC 3PTRB 1ODDA 2YZ4A 3ETQA 4EN7B 2X8KA 4I76A 5FY4A 3KF5A 3F8FA 3HG9A 1KD7A 2A05A 2IUWA 4YYOA 1RUH3 4NIDA 1K12A 2V1UA 2ZFUA 2ARAA 4JHTA 1AHSA 2DVFA 2FD8A 4HN0A 5GAHJ 5IYYA 2ZGSA 5BS6A 1W5CC 4M3CA 5FDBA 2VN2A 3WU2C 3KCXA 5FP3A 3FBIB 1MS0A 1B59A 4C30A 1NCRA 4Q1RA 5DZEA 3S3OA 1OHFA 4JOMA 3WTVC 3KLNA 3KLSA 4YVWC 4ZKTB 3ACIA 4OI0A 5JUVA 1W8TA 1U5TA 1R1UA 2WA0A 2PLV3 1S72I 5A3UA 1ND2C 2XGXA 1UYXA 3ENRA 2WFF2 4OUMA 3V7RA 2A07F 2O61A 2ZGLA 1R5HA 4GKYA 2IPQX 5T5PA 1VBD2 3PFYA 2FCTA 3SLIA 1GQGA 2Q30A 4F52A 3HAGA 2PMZA 3PUAA 3N05A 4XN3A 1UCRA 1VAVA 2JDNA 4RA0A 5KCMA 3HBLA 2DI3A 4EJUA 5LLQA 4W6YA 4AU7A 5C5UA 4AQ2A 2O5RA 1IXSB 2DMNA 2L9RA 3IRQA 3CJRB 5IJRA 2DCEA 4WBBA 4YSFA 3LSMA 2KA3A 4YM2A 1YJ9I 1UZYA 4Y1ZA 4Q4X1 4G6TB 5IAVA 3R61A 3WCRA 2VQTA 4CDWA 3HOSA 1VALA 4PFOA 2ZGRA 1J5YA 3MUY1 5H9QA 3RZMA 2XUBA 2COBA 3KP7A 2A6EF 2IA0A 2M5WA 2HOAA 3POBA 4JX4A 1ND3A 5ABJA 4MTDA 4L0YB 5FZIA 3CZJA 1COV3 4QX8A 1S7EA 5TRDA 3TOBA 4HOOA 4XXPA 5JXHA 5KHDA 3GNEA 4LLLA 1BEV2 3IAM2 4QX3A 4YIRX 3OSDA 5A32B 2R042 1HB1A 1HKSA 2W87A 2FDIA 2OA2A 5GZEA 4QGNA 4WZFA 3NRVA 1IQAA 2DMPA 1TWGJ 5CIRA 2EIBA 3LWFA 2E7AA 2DLLA 2XAQA 1JHNA 2NQYA 1OVPA 1UU4A 4QDRA 1WCMJ 2OZJA 2ORZA 2UUZA 2FF4A 4BCUA 2MSYA 2R5ZB 2RKHA 3IAS2 3FIWA 5LD2C 1IZ1A 2VOKA 1AR73 3QPHA 3F6OA 3MZ8A 2OBPA 2FJ1A 4WM8C 4PSXA 1X50A 3POFA 5EEAA 4D7YA 3L1PA 1CVNA 1RB8G 2E34A 2O8QA 4PUSA 1NXD1 1FTTA 3A01A 4WM7C 5HDKA 1YFYA 1PP8F 2F4OB 4D7TA 4AM3A 1UCXA 4QGMA 1G9AA 1GNZA 3VHOA 2FDJA 5EZGA 1LEMA 4RN5A 3WOGA 2E1CA 3MUZ1 2Y0MA 3OYBA 2ZX4A 3GALA 3CCMI 3CDLA 3IBMA 4MSVA 5HV4A 1F4AA 3ES4A 1O3QA 2QSHX 4U36A 2LLKA 5C9AB 4C2TA 4RAGA 3KEOA 5TSWA 2L4MA 1MBEA 3POEA 2B8MA 2FOWA 2XLFA 1PZ8A 2E9QA 3WT3A 4DZPA 4AYUA 1CQTA 1H89C 2ZGPA 3DPUA 5E3LA 2NLRA 2WYFA 5HODA 4BQAA 4BQ3A 1VBC2 1GOHA 4B8XA 3R4SA 2JWTA 5FYYA 1BVP1 2EIJH 1MQTC 4JTNA 3JRBA 5M0TA 1B8IB 5A1AA 2FHRA 3WDYA 1C8M1 4YW1A 1EPZA 2CYFA 2QFEA 5ACA2 1SFKA 2H6BA 3NAUA 1ND3C 4M3EA 4D5CA 3D5RC 4XJ9A 2VVEA 4YZ3A 2AO9A 2HWC1 2GLOA 4PCQA 1K61A 5FMCA 2KQRA 2ZGNA 3HR9A 4PQQA 1AXKA 4BACA 4OI2A 3CLPA 1RHI2 3I9V2 4XKWA 2H8RA 2VQUA 2QQIA 2GN3A 1MZ6A 1J3QA 1TL8A 3IT8A 2IGOA 3CF6E 4M6VA 1WHUA 1YJLA 2DXIA 2D3SA 4X1EA 2A3YA 2WNVC 2XR4A 4AF9A 4BJTA 3ERED 1P6RA 1PZ7A 2VXRA 2LFBA 2OYZA 2L9LA 2QDRA 3CJQB 3S6PA 1M1EB 3B5LB 1QKQA 2VUCA 2K3PA 4PQ9A 1C28A 1NOVA 3FE5A 2P17A 1CAXB 3QRFF 3T0DA 1IG3A 5LEKA 4ZONA 4AGRA 2ZXIA 5IWFA 3VYRB 4WVVA 1QXJA 4BB3A 2E7TA 4JX0A 3S2DJ 3H50A 5EF6A 4Q47A 3ZFFA 2HBTA 5IOZA 2CQQA 1TMF2 1H2MA 3L00A 1S0FA 5K1YA 2W39A 2WS93 2GZWA 1XCBA 2PHWA 4AI3A 2WZEA 1DQ4A 5IY5H 1FSEA 3DBLB 1LKXA 2HQ5A 3VBFA 1MDMB 4JGZA 5DAPA 1H1MA 2W68A 2PHUA 1VR3A 1AR62 1WCKA 2GC1A 2BWAA 1WJEA 3JD71 4H14A 3LNQA 2PELA 1PVC1 5F1RA 2O8KA 2FDHA 1WCDJ 2ZMEC 2BYVE 1K45A 5HS8A 1HRV1 1JZ5A 2FNAA 3BU7A 2OUMA 4XETA 1D4VB 1OBNA 4MVTA 5HDGA 4R1HA 4A3XA 1WI3A 5DDJ2 4EV0A 4ASKA 3FHZA 3KS7A 4GMP0 3CCQI 1FOKA 4JX6A 2KMUA 3P3NA 1HXS3 3V65A 1HB2A 1CF7B 3J80Z 3S7IA 5E1WA 2YFZA 4LQRA 1HA8A 3LSIA 1FXZA 5BNOB 5LHGA 4NDLA 5H9PA 3PUQA 3KQRA 2D1HA 1ZBA1 3BU0A 3WY6A 1RUG2 4RLFA 2I74A 5CPRB 4Q4W2 1ODNA 3BB6A 4S0HB 3FZ3A 4CDUA 5FD5A 2VTXJ 3CLOA 4C2UA 5EZWA 1WJDA 2WAFA 2WNVA 4CCJA 1KU3A 4XK4A 3GEZA 4F93B 1U5TB 5A7NA 1RXFA 1YEWA 2ET1A 3PLQA 1N1VA 4R79A 1KFXL 1UXZA 2GNMA 4FQ4A 2OTLI 4QX2A 4AFDA 1QJY1 1UN1A 5FBJA 5D21A 4BJ6C 1DYPA 1ZZ6A 4OCTA 4NIIA 4YFNF 2ZHMA 1SDDB 3AG3H 3CQZJ 4DYCA 3LSTA 3RKQA 2RS33 5EJ3A 1IJWC 5FZCA 5DD8A 1GZTA 2YROA 2JKXA 3U14A 1T0FC 2JA8J 1Z77A 2VC0A 5DPNA 3ABMH 3K69A 1CD3G 4A7YA 3DYMA 1SLAA 2HKXA 2AACA 1POGA 1TW2A 3WP5A 4FPOB 1K3IA 3IWZA 2HTJA 4B4QA 3QAHA 1GWKA 4S2DA 3H36A 4KNYA 3BUCA 1ZRDA 3T0AA 2WY8Q 3TQNA 3NV4A 4XQ4A 4FAGA 2WR9A 5FYVA 5FZOB 4FISA 2WS91 3LB9A 3B6AA 4RGXA 4UWDA 3PUHA 1X3WB 1W6PB 1UX7A 3T1MA 1V4RA 1T95A 1C57A 1W6MB 1DCSA 3JW4A 1SEFA 4LHNA 4NAMA 3GBWA 1JOPA 5DQ0A 2ZX3A 4FPKA 2LH9A 3IC7A 2DYCA 3DEEA 2X9DA 5H6RA 2A6XA 3U21A 1B72B 1Q8SA 4EWDA 1R5GA 1H4HA 3HOUJ 3FBMA 4HF1A 2L4AA 1JJ6C 5IK8A 2H8WA 2QQ8A 2I45A 2ARCA 4UI9L 5FXVA 3LFMA 1T56A 1W3XA 2G0EA 1NTCA 4IEZA 3Q0UA 5BPDA 3PVNA 1VB2A 2G4IA 2ZXHA 5IP6A 1MQTA 3MIEA 1JUMA 1TW3A 1V6NA 1LECA 1BL0A 4C0BA 3VHNA 4ASNA 4ESBA 3W58A 1D4M2 1J84A 3AKRA 3FFQA 3N9PA 4ZU5A 3WNKA 4D3WA 1KU7A 2OTJI 3GZUC 1L7LA 1RZ4A 3H5RA 2DCJA 3EUAA 2VY0A 3T2QA 2R073 2R49A 4WVMA 3RJRA 3C7HA 1AR91 4QX7A 4IEXA 1H0BA 3L09A 1EH7A 3RGBA 2IZWA 2W2IA 2FBIA 1JKQC 2DA4A 2R7RA 3SKVA 4AZZA 2CWMA 5HXMA 2GU9A 3HRUA 2D5FA 4GJYA 2AHQA 4OYUA 4AOCA 5E20A 3T8RA 3I2OA 3JXSA 2EFQA 1UKRA 3LD8A 2IS4A 3K4ZA 2XVLA 1HN0A 1RC9A 1DLCA 3I5UA 4Q27A 3WNOA 2RM21 3DU6A 2O0YA 2HWF2 3KHBA 1RTVA 1BZWA 2DU0A 4LEJA 4OIOF 2ZJQF 1EJ9A 1W9WA 3PIOF 4OWRB 3PMSA 1CJDA 1S9HA 2HEOA 3K1PA 3AP5A 1G9CA 2R1BA 5IK7A 3NWKA 4KWLA 5E3OA 1JN2P 2BY1A 4ZJZA 2QGUA 2BOLA 2VI6A 3A0KA 4M3FA 4IKFA 2K9SA 2Y9ZA 4HG6B 3OWTA 1DG6A 2EICA 5CVVA 1ZG5A 2EINH 2Y48A 4X8NA 5J4VA 5A3TA 4MGQA 5HPOA 4EM2A 5IVCA 1GZCA 1LE8A 1YX5A 4LBNA 1OA4A 2VU9A 1GU3A 1GNHA 1VBE3 3RQ0A 4RM3A 4LG3A 3CDHA 4J19A 3OV8A 2QTWB 4LBMA 2OZ6A 5FUPA 2QA4I 1BJQA 4UY8I 3KV9A 2IWGB 2ZXQA 3S7EA 1LHOA 5A70A 2HZDA 1W5TA 5FZMA 2KP6A 3G7DA 2LK2A 4MUVA 3OY8A 2PJRB 2QZ3A 3N9MA 2RDPA 3KWVA 2VUMJ 1ETVA 2V6EA 4DMIA 3ESWB 5JHFA 2QVSB 2P6TA 1UJ8A 5DAXA 2XAUA 4HNUA 2R30A 2NVQJ 3I2HA 4MGTA 2LBFA 5CQEA 4AIDA 4KWKA 5T5OA 5CFDB 3QOEA 1Y1WJ 4XNFA 2M0MA 1FV2A 3VHRA 1RJ7A 3HQRA 5BMZA 5KXBA 1OLMA 3LMMA 1SANA 4IV3B 4QPIB 2W1WA 2XJTA 3ZMNA 3TEZA 3VBOA 1FMWA 1KEXA 1RUI3 1KFUL 1E3HA 1ND2B 1EP0A 5H20A 2OPWA 3ZQ7A 3WW1A 5JSOA 3T0BA 1FPN1 5F0FA 1O4ZA 4Z92B 2BRTA 4MQVA 4IEYA 4D7NA 3PUFA 4JVAA 3BIEA 4M0NA 1R093 4A0YA 2Y6LA 2BV4A 4ZYDA 4IOAF 4FOVA 4ENNA 4XHBA 4DXTA 2GIZA 3OYGA 1HJGA 1ZRFA 5FYUA 2CW8A 1YRZA 3L2RA 3CUQB 1EAH3 1HRV2 2WT0A 1SAUA 4I98B 4DQ2A 3LA3A 4XEZA 1H0MA 4Q4W1 1K4SA 1BK1A 2LM3A 2EVXA 3KV5A 1NCRB 5IYCJ 3IKWA 1TE1B 3M1EA 3CCVI 1REPC 3SZTA 4D6QA 5DZFA 4U88A 4WVWA 4QPIA 1I27A 2RREA 3BCBA 4LD5A 3S5QA 1A3KA 4Y17A 1E0EA 5C4WA 4C3JJ 4N7IA 3ZN4A 5FFXA 5DXDA 3I59A 4QPGB 3J7NA 3ZPYA 4RR3C 4BA6A 5FYHA 1R092 4YGBA 4BQ4A 4CDQA 3ZFGA 3VBRA 5EGOB 5L73A 4OHZA 3RJ2X 4JDMA 4I0WB 2ZHKA 1ZN2A 4E4HA 5EG0B 3PNVA 1ENHA 4RS8A 2VR4A 1PVXA 3K4CA 4UF0A 1B1BA 1V9U1 4TV7A 5JFRA 1X7NA 2RS51 1TMF1 3H0OA 2DUOA 4HLYA 1MDMA 1JMUB 2PMZN 2QQVA 4XFBA 1RUI1 4IEQA 4XICA 1H1IA 3QYFA 1JU3A 1K78A 2GNDA 4QKBA 1CWPA 4HETA 1A35A 2JDYA 4R9AA 2W95A 4HW0A 3GMEA 5FYTA 1Q8QA 5EEHA 3PUIA 2XL7A 1XTAA 1D0GA 2JKBA 5C3QA 2IVJA 4HEA2 1V6LA 2X29A 1QDOA 5F3CA 4UUTA 4W1UA 4AWDA 3TO7A 2ZNZA 2YX7A 4OHWA 3AX4A 4XMYA 1AVBA 3O1PA 5J36A 4GB31 1NYWA 2CYYA 1RL3A 5JPMB 1U9NA 1OKOA 4ATFA 4GO1A 2BW3B 4W6XA 2EXJA 3JREA 5FZBA 2E19A 3JB8A 4Q0UA 2F4MB 1SCRA 4E70A 1F36A 4UBGA 1DQ0A 5CYVA 1DP7P 3FWEA 4LHKA 1DYKA 1HN1A 4OLLA 2R7XA 2A73B 2JG9A 2XHNA 1W1WE 4BQXA 4ZZLA 3K70D 1RUNA 1K5MC 2E2HJ 3HSFA 1ND2A 4B43A 3CJXA 2BPA2 2KLOA 2VQ0A 4A3EJ 2HYGD 2Y64A 3V8KA 5CBLA 1VBC1 3ILRA 4B48A 4XBQA 2XB6C 1BR1A 1OYIA 2OS2A 1MPXA 2PHTA 4CCMA 2E51A 4MGIE 1JUPA 3BPXA 4YARA 2XJSA 2NS8A 1TLHB 2XXZA 1OFNA 2KL4A 4Q26A 4CRQA 1TP4A 2ZJCA 3PU8A 4QPIC 1W2TA 1OLME 1YG2A 4MNUA 4H0EA 5FYIA 5FZFA 5K7PA 1PK6C 3I2KA 2E7XA 1OOPA 4LOTA 1U78A 4U2AA 2C5DA 1EPWA 3ZN0A 1HV0A 4UFMA 5BNPA 3N9QA 3WNLA 2WQ8A 1JZ7A 4G9SB 3QPSA 3C1DA 3O1UA 2XJRA 1WZXA 3C2HA 5GPAA 1YCIA 2DPUA 2D93A 3HXLA 4AG4A 2KIFA 3SCGA 3TBIA 5F27A 3OYKA 2VZTA 4A5MA 4L0PA 2RAEA 1AR93 4XKVA 2M8EA 2J1EA 5FLVA 2DVDA 2CO5A 3BI3A 3F21A 4D6RA 2Q0OA 3E6DA 2RGVA 4LBQA 4LMFA 4CXFA 2VW2A 3AMPA 2IXKA 4NHXA 2G9ZA 5DUVA 4IEUA 3A01B 1EKEA 1G8WA 2F17A 1CZTA 2XUMA 3NKTA 4CP2A 4IW3A 4CZSA 2MABA 2E1MC 2XF7A 4CDWC 5C8WA 2LS6A 4QHBA 4G12A 2W24A 1COV2 5T54A 2JN6A 1TQ5A 1P4WA 3A1YA 4YG6A 1PP7U 1ZELA 5B4NA 3HQUA 2R7OA 5M3MJ 2FMLA 2I07B 1FP1D 4QTRA 4UVBA 2HFHA 1SVMA 2V26A 4E7SA 2LP0A 1GP5A 1O6UA 4K6BA 5A33A 1PO23 2JIGA 2HWVA 1K6YA 3M7AA 3OF1A 5I91A 3MFKA 5A1FA 2VOOA 1QPMA 2ISYA 2XJVA 2HYXA 1LQ1A 1QQIA 1S6LA 1SQ4A 5IW0A 3A4CA 3T1LA 1FMVA 3QYBA 1UO9A 3NNLA 2ZA9A 2VQHA 1F35A 3HUGB 4FI9A 2CFOA 4I2OA 4PZJA 2P4EA 1TTYA 2QSFX 2QWWA 4BXFA 3WG3A 1RUH1 1AYN2 2EXIA 4ZS3A 3GW2A 4OUEA 1O7LA 4RB3C 4P02B 4QKFA 1MSFC 1FOXA 3M3CA 2R5YA 5LWBA 3WHUA 2R93J 3H8RA 5CADA 1T39A 2QM3A 5JZGB 3Q8AA 2L7KA 2KXLA 4DS0A 2WFPA 5K9YA 1YUDA 1NXMA 3C3WA 5CFCB 3TMOA 5ILVA 1W6QA 2D3RA 5IYDJ 2M3AA 1QXRA 2C9KA 4BHBA 4TTGA 3ROUA 3ACFA 3JD73 1IXCA 4HSJA 4Y26A 1RUF1 4EN0A 1NY71 3ZN6B 4BXUA 2ZZQA 4YNIA 1FYMA 4G8XA 5FIXA 2H0VA 4U0YA 1DQ5A 1I1EA 3D82A 4I01A 1JI8A 2HPMA 2LMDA 4M74A 4KBZA 3H0DA 3N7KA 1B72A 4IX7A 5FLMJ 2XKOA 5FOBB 2G7HA 3NW4A 1DGRM 1Y56A 3RKWA 2B46X 3E7LA 2Y33A 4DY5A 5GJ6A 3V4GA 4O9EA 2XLAA 1JKRC 2MHFA 3BTYA 3BC8A 4ASLA 1RUG3 5EXOA 3WNPA 4AC0A 2YU3A 1ENQA 1W0UA 3C2GA 3ASNH 4OMDA 1OKRA 3C18A 3BG9A 4HVRA 4UW5A 1ETOA 2XAJA 3HJEA 1RUD3 3HD8B 4Y5Z0 5JR2A 3M3IA 1I3AA 1ZA4A 5LHHA 3M70A 2ZEWA 3USUB 3NARA 3LQCA 3DF0A 1YHQI 4Q8KA 2OPTA 3BR6A 4EJOA 3J8F2 2F5FA 2FSWA 1AR63 4NRQA 4E2GA 3H1WA 4NMIA 3AYEA 3LOCA 1E57A 4OMCA 4P5OA 4ZH4F 2Z1DA 1QIQA 4IETA 1RMU1 4IGPA 2MNGA 5ICGA 4B1LA 4GXOA 2GNTA 2IS2A 2OQ7A 2PXJA 3ZFGB 2XPUA 2CSOA 5EPAA 4YVSC 2LD5A 3AM2A 3G4SI 3SQNA 4CEWC 4AI8A 1AKHB 5EYYA 5HXVA 2OX0A 1LEDA 1L7RA 2K0GA 2VMDA 4E2SA 1Y9GA 4BJ5C 2LF8A 3GZTB 5F0HA 2UU8A 5FFZA 1K78B 2HXIA 1SDWA 1FPN3 1BIAA 4LPLA 4XR6A 1RC6A 1W05A 5FUIA 3UGFA 4CCDA 2VKHA 1QO0D 2QKLB 1ZZCA 4KMQA 3ZYFA 1MBGA 3VBFB 1DUXC 2UXXA 1GDTA 2R7ZJ 2WWUA 4M6YA 3G1MA 3HT2A 3RSNA 4DQAA 4JX5A 1UELB 2W5FA 3RCOA 1GOFA 1WCQA 3OYEA 1QQP2 2HDDA 5DYMA 5J1UA 3LGRA 3O1MA 5L3DA 3I49A 1FT9A 5F9TA 1QJX1 2GC2A 5SV5A 5IOYA 1KONA 3TO6A 5J47A 1XGOA 1AHDP 4FFIA 3BJOA 4HVOA 2P8TA 4OIRF 1ERDA 3SHFA 1YX3A 3VZOA 5D5XB 4ABZA 1GZWB 2R7WA 5FK8A 3MIFA 3K4AA 4YWAA 5D8AC 3KP4A 4L97A 5JVGF 2L9NA 3WE3A 2WA3A 4XOTA 5FMBA 2IS6A 2VQGA 2VAUA 2RMU2 2UWBA 1S0IA 4B3NA 2X5IA 1Z6RA 4UUSA 3O1SA 5C5TA 1FV3A 3QPLA 4GQ7A 2KDOA 4O9GA 4MGSA 3CCJI 1AU7A 3SZGA 4IXAA 4GWIA 2RNJA 5L9RA 1W6OA 3IB3A 4J01A 1UY3A 1ENRA 5A80A 2ZC2A 1R1A3 3M3OA 4JV4A 3RSJA 2YFUA 1XDUA 2QBYA 2JPCA 2JDPA 1E3OC 2IXCA 3KT7A 2DJNA 1SMTA 2VZUA 3EYIA 3VZJA 1S5LC 4LK6A 3GZ6A 3ACGA 1BMV1 4EEFG 4KMUX 2QQUA 5E8AA 1NE6A 5J1RA 3PHMA 1OT5A 2A3SA 4Q4V3 2L7ZA 2XB5A 5FO5A 3ZCOA 2F4IA 4PDWC 5FKNA 4FASD 2J1RA 3QLQA 2RVCA 5EEGA 1DQ6A 1YC61 4A7ZA 4W50A 4QPYA 3DTKA 1H30A 1QZEA 4CEWA 1KGYA 2LKPA 2E36A 5CU1A 3OEBA 2WQZC 3HIFA 2ZKZA 4Q4X3 4CU9A 5F3IA 5FXXA 3HNYM 4KIFA 4Y20B 1XSXA 1AWCA 3N35A 4P9JA 2IGNA 2VOVA 5C71A 2FE3A 3OYHA 3I56I 3HRMA 1PGW2 4GWJA 1U9OA 1ZZBA 3CZ6A 5HS9A 1NA1B 3BZ6A 1RKWA 1HCRA 1GR3A 2B39A 1MZBA 2D6KA 2BVMA 2OUHA 2OW4A 4N53B 4Q4Y3 1ASJ2 2MPFA 4DJAA 1PX3A 2YU9J 3R05A 1F31A 1SVOA 4IEOA 3JRIA 4Y3OA 4B4PA 2W3JA 5FPXA 2WWJA 3RWKX 1RETA 1XBFA 2VM9A 2W82A 4Q0SA 4JBAA 2K7LA 2FQPA 1KITA 2EQRA 1LHUA 3WGHA 4P96A 3BR3A 3V7SA 4FQZA 3CUQA 1TNRA 4MO7A 4BKXA 2YC2A 1AOYA 3LDKA 3PJQA 3EUHC 5J37A 4ZZDA 1DU3D 5FZDA 3SEQA 5L3CA 2KIUA 2EV0A 3M3YJ 3JR9A 3KPHA 1D3YA 1O4XA 1HLVA 2XAHA 4G6DA 2PI0A 5M3FJ 2LSOA 2DA7A 5BNNA 2HVRA 3K4JA 1N1YA 3I4NJ 3UKGA 2MEV1 1IN6A 1DLLA 3J81K 1XJAA 4BPZA 2E26A 3J80K 1YLLA 4AAXA 3K10A 2BGPA 2YY1A 2EZHA 1QMJA 1REDA 3WF0A 3H3VK 2K86A 5C8CA 4WM7B 1JUSA 1WBLA 1HSTA 2Z79A 4UF0B 5BNNB 3GO5A 4XZPA 4AFBA 4LA3A 3VDBA 4GMP1 5FO9B 3V0BA 1R58A 1VQOI 3X2QH 1UD1A 5JCTA 5JMOA 3BOWA 3LDBA 3LFKA 3I3EA 4AGGA 4IQ4A 3VB2A 2X6XA 3CO2A 4L9JA 4QDQA 1ENSA 2K9MA 2JECA 2WB1N 2X05A 1FBSA 1VBD3 2KRCA 2VBDA 3KGLA 4XUPA 1WPKA 3JAMK 2RS32 5K5RA 2RDQA 2JDAA 1PGSA 1H8VA 1PJRA 2VNGA 1TQPA 4HNTA 2A1XA 2K4BA 3VN4A 1RXGA 4IUGA 1TZOA 2Y6GA 1OMIA 1XE7A 5K7ZA 3TB0A 3H3ZA 2D6PA 1AXZA 2PHDA 2X53S 4LULA 3LDRA 5DEQA 5CKQA 4B3XA 1Z3YA 2DU9A 4V2VA 3SHRA 1AR82 2VUAA 3MLLA 3MFCA 2FBKA 2ETHA 3GFJA 1V6JA 2Y69H 1YFWA 1XB9A 2RS53 5EFUA 3V0AB 1SVLA 3U2RA 2ZBJA 3MPPG 1STZA 1XSVA 3B02A 3GCXA 1TQIA 3AFGA 4FXGB 4BQOA 4WF2A 3MN2A 2XH6A 2MG4A 1OLRA 1YQCA 5FYZA 4OAYA 1WRJA 3SQOA 4W6WA 3D5LA 3U4XA 5FKLA 2VE8A 2VASA 3KEQA 2WAEA 1EV13 2DFEA 1QWRA 1H6YA 3SDBA 2VCAA 3I2JA 4FCYA 1FATA 1ULEA 2WT2A 1DQUA 2B63J 4EN9B 5FZ8A 5M5XJ 3UGGA 4G7OF 3L2WA 3OBTA 1G7YA 1MEC2 1BCXA 3U1KA 4A3CJ 2XF6A 4LBKA 4WM8A 2VPLA 4XONA 4H2AA 1ZRRA 3VBSA 4P9FA 1W8WA 3G3ZA 1VE0A 3K2AA 2V9PA 5LEJA 1CZVA 3D6EA 3ZDSA 1T2XA 1KYWA 1X33A 3UKNA 3M8JA 1OQYA 3TN91 3CF2A 4YVWB 5A33B 2LUWA 3AJYA 4TLGA 4YW3A 3PJYA 1N3OA 2WNEA 4CUGA 4JTOA 1BC8C 2ZGMA 2E31A 4ZXEA 2JD9A 3JCUC 3OGSA 4XRSA 1RMU2 2ZABA 1V5FA 2LR8A 4G94A 3ZQFA 3JSPA 1YE9A 2F6CA 3M07A 4JRAA 1N3QA 4OINF 4B1MA 2XQRA 3WUCA 2O1QA 2VXJA 3ITQA 3TDUC 3GCWA 1FOD2 3G71I 3CMGA 5D5UB 3W5NA 3DEUA 3ECOA 4KT6A 3FISA 1TMF3 3K6GA 2R0FA 4AEDC 4EZHA 3HEFA 2LALA 1D8JA 2GBYA 3QWLA 4A12A 3E3VA 2Y6KA 3B93A 1I1GA 3FHAA 2E63A 2A5YB 1V54H 5H9RA 1WWXA 4CA9A 2DODA 3MHZA 3LSGA 3F9KA 3ML6A 3GFMA 2R6QA 2GA2A 4XFGA 1AR61 2HOSA 4KBBA 2H1LA 2DCKA 4FPJA 1ZRIA 4XTPA 2EJRA 4A3MJ 3FHQA 2XDVA 2AXLA 3NQOA 3KE2A 3VWBA 1G9DA 3LPGA 2E5NA 1YIPA 4NIAA 4Y5TA 1SD6A 4IL6C 3K2OA 1RMU3 2L01A 1SFEA 1H2LA 3AMNA 2R7EB 1FY7A 1O7FA 1JS9A 5CQGA 3NQHA 1B6AA 5A6QA 4JGYB 4NR1A 3B01A 2O6GE 4CU7A 1QJFA 5EDNA 3F8MA 2PAMA 1A04A 5C8CB 1LHWA 3PO2J 2JENA 2PMHA 3OYMA 2XGCA 5FZOA 3EBRA 1H8AC 1A36A 3HEIA 2F5VA 4UFJA 3I3MA 5AC91 1HX6A 4UUVA 1OC1A 1BHGA 1N78A 1OFSA 3VKNA 4XFHA 4BS9A 1WW6A 3DGTA 2R7DA 1IRGA 4LO4B 2QQ9A 2PEXA 3F23A 4YGDA 5CG8A 3CC7I 3B00A 4BK5A 3BROA 2L54A 1VQNI 2DTRA 4NWVA 5FZLA 2DYRH 1GP6A 1RUOA 2EV5A 1KQ8A 3GZ5A 1YOVB 3ECHA 5KR7A 5IVYA 4XHXA 3X29B 4LORA 1I6XA 1OFCX 3MV11 3AL6A 5HVQC 2Q4SA 1FYUA 1QZZA 3G6EI 1J9IA 4GH4C 2CY6A 1IGNA 3HN1A 5FO8B 4PBOA 3P7NA 2D44A 1I3HA 4IV3A 2W84A 3GXUA 4NQWB 3BR2A 1JTXA 1DZTA 3T8TA 2XRNA 2EA4A 3H1YA 1SFPA 1H9GA 4XIOA 2VTFA 3K7AJ 4MFDA 3TN93 1U12A 3KT1A 4L9NA 3KFWX 4CEYC 1G2HA 1JYNA 2E2JJ 4JDOA 4HVQA 3WVJA 1S3JA 1W5SA 2MFZA 1SLCA 2R7SA 3DFGA 2EIGA 3VODA 2NZ9A 3EHKA 4P9LA 3NRUA 5L3FA 1BI3A 3IPVA 4FP3A 2WO3A 4N53C 4HK9A 1IUYA 3NAPC 5JLWA 2QQBA 2A6YA 2AGSA 2WWSA 3C7GA 1DGWA 1UZWA 1WJAA 2KIQA 4JK1X 4EQQA 1OR7C 4MTEA 3MW2A 3G1LA 2DTWA 2A3WA 1BOAA 3K4NA 3JTHA 1GQPA 3FJSA 3HTUA 3W3CA 1NX9A 3VHPA 3L9FA 1MSEC 5JAXA 2GXAA 4AQTA 4FT8A 5SV8A 2HNHA 1CAWA 4CYDA 1OCTC 5FYMA 2R043 5DAQA 3ZMZA 1LODA 1QJX3 4H4KC 4Y1UA 2QLZA 3SH4A 4V19K 1KJLA 3OUJA 3OPZA 4PDWB 4XLPF 1SD4A 3ZYIB 2CTVA 3GDBA 4LB5A 3Q3SA 2DU1A 4QU2A 3LA7A 1LJ7A 3MO4A 1UOBA 2JZYA 3MIGA 1W0OA 4QPQA 3IWFA 1ULPA 4XRSG 3BG5A 2HPIA 3M4OJ 1B8IA 4DRVA 3JZVA 1W7PD 3RPUD 5DCMA 1ACCA 2F5DA 3BN6A 3MICA 1XNKA 3O3KA 2IGMA 3CJTB 1W90A 4PI2A 2RR11 2J1AA 5D4RA 3AP9A 4IO9F 2HLEA 1DDNA 2CL2A 3AZZA 1XDSA 4UW3A 4KISA 1F2NA 3K0LA 4O7XA 1V6OA 1L3LA 5FKMA 4MEYF 1IUFA 4A5NA 3ZQCA 3QACA 3H8OA 4WXDA 3CJIB 3ZXKA 1LEBA 1TWHJ 3OYCA 3N3HA 5C70A 2IFWA 1YS6A 2EZIA 1TME3 5T50A 1KU2A 4HX7A 1OLQA 1W04A 2OCCH 1UF2C 4Q4Y2 4JRLA 2ID6A 5KHKA 1BW5A 2R062 1JTYA 2ISZA 3MYXA 3E1SA 4Q4X2 1SC7A 3SISA 3LFIA 1LGBA 3IL2A 5J40A 2JG8B 2PTMA 4QHOA 3KYCB 1T38A 1IS5A 1ZGWA 3DQVC 1E5HA 4RS5A 2WAQA 2PMUA 1IN7A 4EZ4A 5DM7F 2ZGQA 2FBEA 4ITCA 3ZN6A 1XXNA 3DU5A 2YMZA 3I3QA 2EAKA 3WW4A 3VBFC 5H6QA 4JGZC 5KC6A 1LOFA 2IXLA 4JGYA 4L2NA 3EJKA 2LREA 1V6MA 4AVSA 3FLTA 2F48A 3GTMJ 1AL22 5HV0A 1ONVA 3BG6A 1KQRA 4AEMA 4PJJA 1UZVA 4XL9A 4G9YA 1I50J 1EH6A 3ZSLA 2JA5J 4LBLA 5HCFA 3LQQA 1U6GA 1VMFA 4IE5A 4V2GA 4OOIA 3ZYPA 5LBQA 3M8LA 3Q8CA 4BYYA 4IHYA 3RPUA 4LTAA 3H0GJ 3JCIA 4C1WA 2WINB 4CDXC 3MIHA 5DUXA 2RMU3 3ZYRA 3VL9A 1BBYA 2IXSA 4OULA 3LSJA 4YVWA 2J5PA 1MZFA 3I7DA 3UK9A 3MV01 3LAPA 4FPFA 1D1CA 1G3SA 3LAJA 1G9FA 5I0UA 3I53A 3AYDA 2R16A 4RAFA 4N8MA 3FBYA 1RUE1 1VAKA 4GZ9A 2OT7A 5FKKA 2JT1A 2YR2A 4YPJA 3IH3A 1JZ4A 5F5IA 3K77A 4QMAA 4P1WA 2K9QA 3ZIWA 3CL1A 1MS1A 4O6JA 5GLUA 4CZCA 1YW8A 1SD7A 3O0XA 4COWA 5FMDA 3SCFA 5DV5A 2W08A 4LUKA 2RJKA 2DW4A 1IRFA 2VMEA 4K3UA 3WW2A 4H55A 4URAA 4GKXA 4EN6B 2BNMA 3VKOA 3WHTA 4WVMB 5CVIA 1FP2A 2IVIB 1SBEA 4E4ZA 4UB6C 4NPLA 1V5GA 3WG1A 3ZR8X 4HONA 2DVGA 5JIUA 4ZPIA 5F04A 1LDJA 2HGCA 5DN2A 2XONA 3PFIA 5C3RA 5C7GA 1I6HJ 2ZFWA 1HDKA 4BBRJ 5LCWL 4EE2A 1REFA 3KP5A 1GXPA 9ANTA 2DVAA 1YLFA 1GZWA 2OXBA 3K4LA 1T0FA 4FPEA 4IHSA 2ETEA 5LGNA 1ZBA3 2PQQA 3COAC 1S2EA 1UX6A 3I3DA 2PQSA 2DUQA 2DT7B 4PIYA 2VZOA 3LSPA 1SMVA 1K6OA 3HGGA 4B7KA 1IV6A 1P7JA 1DP3A 2Z3YA 3I2FA 3AMHA 2P5BA 1HQCA 4XLCA 3VDDB 4F3QA 3EDPA 3KCYA 4N43A 4EMSA 1R082 3WODF 1C8M3 5LA2A 2HWE2 3T2TA 4FPYA 1JTZX 4UVCA 3J8F3 2V79A 4HV5A 3H3LA 5J7MA 2X4HA 5G04L 2VNRA 4II2A 2M9HA 3D5SC 4AVTA 1VBB1 3NWSA 2Z9OA 1QH6A 1IKPA 4D6SA 5FZ0A 2XGDA 4FQGA 1E3PA 1RUF3 1Y8QB 3ABKH 1ACIA 2Y75A 5B1BH 2ARXA 4LK0F 4BQ2A 3I4IA 2EILH 1CAUB 4FSJA 3RDIA 3RKXA 2L2OA 2OKXA 5ERLA 3CJIC 3MW3A 1DQ2A 2EBIA 1RITA 2QBXA 3V56A 3VB9A 1WD4A 1AX1A 2X6OA 4CP0A 4KNCA 1ZM1A 1NQDA 3WD5A 4PK4A 3HBZA 4B09A 2V1NA 4XF0A 1WJCA 1AR83 3IIIA 5TGTA 4K7JA 5FLXK 3OYLA 1Z91A 4LO7A 4BISA 3O1TA 5DUWA 4KGGA 2LOOA 4XFAA 3U75A 2M34A 5JOZA 1AR71 2UYAA 4XLHA 4Q0VA 4INDA 2VZPA 5GLZA 4UVAA 2E35A 2Y0IA 3LPFA 4K21A 3HHHA 3E0JB 3LE0A 4FOQA 4R4ZA 2MLGA 2B7EA 1YO5C 1ITYA 4A6SA 4KICA 2GM4A 1X8MA 2DJIA 2D40A 1ORKA 2TUNA 4RD7A 4FO9A 4YW7A 3AFHA 4IE7A 2FRHA 5L3BA 5BNOA 1LVKA 4XPVA 4IV1B 5EYXA 1VQ5I 1P92A 4ZS2A 4MHRA 2C1FA 4XTMA 2E5ZA 4OVEA 4EJTA 3GTQJ 1X8EA 2VO5A 4PDWA 3OG2A 2E53A 1SCSA 4K2EA 1B35B 2MEV2 3ZP5A 5HS7A 1KS5A 2WNUB 3QH7A 2DBBA 2L5QA 1UY2A 2H6CA 3AC0A 4KWJA 4GALA 1C1FA 4RBOA 4KL1A 1PK6B 1VAMA