4QPGC

Crystal structure of empty hepatitis a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
246
structure length
246
Chain Sequence
b'MMRNETRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDIAGVQSTLRFRVPWISDTPYRVNRYTKEAHQKGEYTAIGKLIVYCYNRLTSPSNVAHHVRVNVYLSAINLECFAPLYHAMDVTTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgC00
1AYN3 1NG0A 2X5IC 1GFF2 1X36A 2HWD3 1AYN1 1RVF2 1VB2A 3TN92 1NY71 1NCRC 1F2NA 2HWD1 1RB8G 4QPGB 1BBT2 1OOPC 3VDDA 3VBFA 1AR72 1K5MB 4FTEA 1FOD1 4RR3B 5ABJC 5ACA3 3CJIA 3ZFFC 5ACA1 4CDWB 1ASJ3 1R083 4N53C 1ASJ1 1R081 1NA1A 4Q4X2 1F8VA 1RUC3 2X5IB 2WS93 3VBSB 4BCUA 2GSYA 1RUC1 1NCRB 2R063 4Q4W2 2R061 1FMD3 1AR82 1RUE2 1OOPB 1QJY2 1FMD1 5BNNC 2RS33 1VBD3 4Q4V2 5ABJB 4QPIA 1V9U2 2RS31 1VBD1 1AYM1 2WFF3 3ZFFB 1TME3 3S6PA 2WFF1 1TME1 4N53B 2XBO3 2RS11 1HX6A 1R1A3 2XBO1 2ZAHA 4AEDC 4Q4Y3 4Z92B 1R1A1 4Q4Y1 1BEV2 1M06G 4CDUA 1VRH1 1HRI3 2RM22 1QQP3 4CDXA 1FPN3 4LLFA 5BNOC 1FPN1 3CJIC 2HWC2 5BNNB 1CJDA 2BPA2 1DDLA 4RS5A 4RHV3 1NCQA 1EAH2 1OHFA 3ZFEA 1NA1C 1C8M2 4IV3A 4RHV1 1VBB2 1ZBA2 4AEDB 4RQPA 4PDWA 1W39A 4CDQC 5FMOS 1SMVA 3VBFB 5FOJB 5BNOB 4QPIC 3CJIB 1COV2 4GB31 3JB8A 5AC92 1QJU3 1NA1B 5JZGC 1QJU1 5D8AA 1VBA2 4CDUC 2RS12 1H8TC 2HWE3 4FTBA 1ZBE2 4CDQB 4CDXC 2RR13 2HWE1 2RR11 3ZFGA 1PIV2 1ND3A 4QPIB 1R092 1RUH3 2RS52 1RUH1 1NCQC 4EJRA 5C9AA 4IV3C 1VBC3 1RUJ3 3VBOA 4YVSA 5JZGB 1HRV3 1PO22 3VBSC 1RUJ1 1ND2A 4RQPC 1HRV1 3JD72 3ZXAC 2R042 4CDUB 1H8TB 4CDXB 2WWSA 5A32A 2RMU3 3IDEA 2IZWA 2RMU1 4CEYA 1QJX2 1EV13 1NCQB 2WZR2 1PO13 4IV3B 1EV11 4GB32 1PO11 1Z7S3 5D8AC 4NWWA 1Z7S1 2HWB2 1RMU3 4RQPB 1RUG2 2WS91 1RMU1 1B35A 1D4M3 3J8F2 4RFT0 1D4M1 1PGL2 4GH4C 5C8CA 3ZFGC 1RHI3 4FSJA 2PLV3 4YVWA 1RHI1 3NAPA 4IV1A 2PLV1 1AR63 5L7OA 1PGW1 2DF7A 2MEV3 1AR61 1RUD3 3JBG3 3VBOC 2MEV1 1RUD1 3DPRA 3JBG1 1HXS3 1MEC3 4JGZA 1RUI2 5D8AB 5DDJ2 2WLPA 1HXS1 2HWF3 1TMF2 2HWF1 3VDDC 3VBFC 1AL23 3VBHA 1AYN2 1NY72 4GH4B 1AL21 1HRI1 1PVC3 2HWD2 3ZFGB 1BMV1 1QQP1 1PVC1 4CEYC 1AR93 1FOD2 1AR91 2R073 3VBOB 1VBE3 1RUF3 1MQTA 5ACA2 2R071 4Y5Z0 1VBE1 4SBVA 1RUF1 1ASJ2 1R082 1B35C 4WM7A 2BFUS 5C8CC 3VDDB 5J96B 1RUC2 2WS92 5BNPA 3NAPC 4IV1C 3TN93 1RVF3 5L7OC 2R062 3TN91 1RVF1 1BBT3 1FMD2 4CEYB 1AR73 3DPRC 2X5IA 2RS32 1VBD2 1AYM2 1AR71 4JGZC 3VBRA 4GMP0 4WM8A 2WFF2 1VB4A 1NCRA 1OPOA 1WCDJ 1TME2 1CD3G 5C4WA 1B35B 2XBO2 5C8CB 1R1A2 4Q4X3 4Q4Y2 4Q4X1 1VRH2 3NAPB 4IV1B 4N43A 1POV0 5L7OB 2FZ1A 4RS5C 4Q4W3 1HRI2 3ZFEC 1FPN2 1AR83 1RUE3 5FMOL 4Q4W1 5J98B 1QJY3 3DPRB 1AR81 1RUE1 3HAGA 1VBC1 1QJY1 4JGZB 4Q4V3 1V9U3 4PDWC 4Q4V1 4WM7C 4RHV2 2XPJA 1V9U1 4CEWA 1NOVA 4Y4YA 5BNPC 3FBMA 1TMF3 5CFCA 1BEV3 3VBUA 4RS5B 1A6CA 1BEV1 3ZFEB 2RM23 3VBRC 4AEDA 1MQTB 2RM21 4WM8C 2HWC3 2GH8A 5C4WC 2HWC1 4PDWB 4WM7B 1FOD3 1C8NA 1QJU2 1EAH3 5BNOA 1C8M3 1VBB3 1ZBA3 4GMP3 1EAH1 1C8M1 5BNPB 1VBB1 1ZBA1 4N43C 1ND3C 4GMP1 4JGYA 5CFDA 2BUKA 2HWE2 5C9AC 2RR12 2TBVA 2VQ0A 4YVSC 3VBRB 1RUH2 4WM8B 1ND2C 1POV3 5LK7B 1COV3 1E57A 1POV1 1MEC1 1COV1 5C4WB 4CEWC 4CDQA 2FZ2A 1VBC2 1RUJ2 5AC93 1HRV2 1AYM3 3LOBA 2ZTNA 5AC91 4N43B 1VBA3 1ND3B 5CFCC 5K0UA 3VBUC 1VBA1 2RS13 5A33A 5C9AB 1ZBE3 1QJZA 5JZGA 1ZBE1 4YVSB 2RMU2 4NWVA 1VRH3 1HQNA 1IHMA 1PIV3 1ND2B 1R093 2RS53 4QPGA 1PIV1 2QQPA 1H8TA 1R091 1EV12 2RS51 4CEWB 1PO12 1K5MA 1Z7S2 4RR3A 1PO23 5CFDC 4JGYC 4YVWC 1RMU2 5A32B 1PO21 3JD73 4CDWA 5CFCB 1D4M2 3JB4C 3JD71 3VBUB 2R043 2R041 1BBT1 1RHI2 2PLV2 3VBSA 1PGW2 1AR62 2MEV2 1RUD2 3JBG2 1QJX3 2WZR3 1OOPA 3VBHC 1QJX1 2WZR1 1HXS2 4GB33 1MEC2 5ABJA 2Y26A 5CFDB 4JGYB 4YVWB 2HWF2 3ZFFA 2HWB3 5K0UC 1RUG3 2HWB1 1RUG1 1AL0G 4N53A 1AL22 3J8F3 1BMV2 1QQP2 2BFUL 2ZZQA 3J8F1 1PVC2 1X33A 1MQTC 1VAKA 1PGL1 4QPGC 1AR92 1AUYA 1K5MC 2R072 4GH4A 4RR3C 1VBE2 1RUF2 3VBHB 5BNNA 1RUI3 4CDWC 5DDJ3 5GKAC 4FTSA 2BBVA 1RUI1 5K0UB 5DDJ1 3M8LA 5A33B 1TMF1
chains in the Genus database with same CATH superfamily
4ASKA 1JZ4A 3O1MA 1NG0A 5I8TA 3AYDA 1GZWA 3HNMA 2C9KA 3TN92 5EP9A 2XL9A 1NY71 3D3AA 3Q8FA 3LOIA 1F2NA 4D6RA 1WCQA 3CQOA 1WMDA 4UW6A 5F9TA 1VE0A 2XH6A 4ES9A 3WQ0A 3VZNA 1OOPC 1Q8SA 1K5MB 3ILRA 3DKQA 3AMPA 2K2SA 4JDMA 5CKNA 2E7TA 2JG8C 2BGPA 4K3UA 2B5HA 4MUVA 2XKOA 2RDQA 3RDIA 4IE7A 5KHJA 2EIDA 4AFCA 4OUSA 4LA2A 4IEOA 1OUSA 3KT4A 4JKMA 3QOPA 2VOWA 2D5HA 4PF1A 2D6OX 2G9ZA 1RTVA 2X5IB 4V2WA 3W59A 4NPRA 2GSYA 1FNZA 2IFWA 1KDMA 1PM4A 1NCRB 2ATFA 2WN3A 1XNDA 1OBNA 1WUVA 4YZ3A 1WMEA 2W47A 4B4QA 5H9PA 3NV4A 3RJRA 4B7EA 1QJY2 1RUNA 2VNVA 2VZSA 3MZHA 3WQ7A 5ABJB 4K8FA 1XYNA 3I3MA 4XZUG 1AYM1 1JZ7A 3HBKA 3PU3A 4ZU5A 3LIGA 4R9DA 1UL9A 1WMFA 4LORA 2C5DA 1DYPA 2RS11 2VMHA 4CXWA 2VM9A 4CPBA 1O4YA 3RGBA 5C8WA 3ILNA 4Q4Y3 1UIJA 5FKCA 2GC0A 4S2DA 4Q4Y1 1LOBA 4FPHA 2XVLA 4JDOA 4UOJA 2XJUA 3Q8EA 3RZMA 1MS5A 2BERA 4XQ4A 2G1MA 3UGGA 2J7MA 2RM22 2JG9C 5DAPA 3GCWA 1FPN3 2Q1MA 4A6SA 4CDXA 4A3XA 5ANNA 1FPN1 1GP4A 1MPXA 1JXNA 1QOSA 1DDLA 1EP0A 2VQAA 5A3MA 1WMXA 2VCAA 4IE0A 4XURA 3FE5A 1NCQA 2QJVA 1EAH2 2WLQA 5K4LA 1NA1C 1C8M2 4IV3A 2W91A 4JC1A 2AEZA 4YLZA 1NYWA 2ILMA 5LBEA 4AEDB 2ZHLA 2D6PA 1LJ7A 1IOAA 3OPTA 3ZN5A 2EF6A 5FMOS 4O61A 3WSOA 4A45A 1SMVA 4CDQC 4EZHA 3MLKA 1G8WA 1F5JA 4GWNA 2W3JA 4HVRA 1CAWB 3KGZA 4QGNA 4LNVA 1JHNA 3PVBB 1QWRA 1S0EA 1RC6A 4PIXA 5FP8A 2BVVA 4ITCA 5A33B 5HCHA 3FLPA 1O3TA 1SLTA 1DQ4A 4LJHA 1YUDA 4JKLA 2P1BA 1U5IA 3SC7X 2LTNA 2AUYA 3GZAA 5FP9A 1DU3D 3M3CA 4OZXA 5FY4A 5FZ8A 2P37A 4QDRA 1APNA 5CIRA 3NJVA 2VOTA 2ZGNA 4MGIE 5CISA 4Y5SA 3CLPA 1H2KA 4MHUA 3AX4A 1H2LA 2YC4A 4QQOA 1U5XA 3CJXA 4R9BA 2ZX2A 5FJHA 4CDUC 1D0HA 4V1PA 3E1F1 1RINA 3A21A 3NNLA 4IESA 4D7SA 1LHNA 4LK6A 4UXAA 5J3UA 1F35A 4QGLA 2VTXJ 1YFUA 5FZAA 3NV3A 1DQ2A 1LCLA 2FCTA 3L2HA 4J25A 3VZMA 4QPIB 5T5PA 1KD7A 3JXSA 2WYSA 1GP5A 2IVJA 4BK5A 5I0SA 1YQCA 2IXJA 3KMHA 5EYYA 4EJRA 3NSTA 1K12A 4XDPA 4JQTA 1ZA4A 4G4FA 3EHKA 3POWA 4HPKA 3VD7A 5LEJA 2VE1A 5A3LA 4AXOA 2UWAA 2WNUA 1GU3A 3VBSC 5JZGB 2ZOEB 2JDZA 1ND2A 4TYSA 3JD72 2JDYA 2EIEA 2CSGA 2BZDA 4QB2A 4MGZE 1CIWA 4DZGA 1NLRA 1B09A 2H0BA 4KMQA 3GBGA 4K20A 3BIWE 3U37A 4NHLA 4L92A 3S7EA 3RG0A 4LR4A 2R49A 2D6KA 4KH9A 1U0AA 2WWSA 1ULDA 2GNMA 2VO5A 4FQZA 2E53A 3T1MA 5KXCA 5KXDA 1XJAA 1QDCA 2B7YA 2RMU3 4S2GA 2WT2A 1Y9MA 4LA3A 2WNVC 2RMU1 5JVVA 1LNSA 3HIFA 3M3QA 1YJKA 2BU9A 3WNLA 3DN7A 4HFSA 3HVDA 3FN9A 1MS1A 4IEWA 2JB8A 4GB32 1Z7S3 4UBGA 1MZEA 2YDEA 3MIFA 4NWWA 1DFQA 3EB7A 3OY8A 1Z7S1 4XFAA 5FP7A 3C7GA 1QU0A 4G3YC 3E5QA 1RUG2 2ARXA 1DCSA 2PAKA 3ZN6A 5EIYB 2UYAA 1B35A 2PQSA 1OLQA 1DG6A 1TNFA 2AACA 3D0JA 3J8F2 3I3BA 4FPFA 4IW3A 5FKBA 3VD5A 4AQSA 1XB9A 3TEYA 1ZRFA 1PGL2 4GH4C 4IEYA 3ZFGC 5KBFA 3DKWA 4YW1A 3ZSLA 4KWKA 4NIAA 1JMUB 2CAUA 4IV1A 3GJBA 3C2UA 1JODA 1AR63 3O14A 5L7OA 3PJYA 2DTYA 2RHPA 4P9LA 1AR61 2XVKA 1LU1A 3HBZA 3ENRA 3BTXA 2EXIA 1JZ8A 2PELA 4FFGA 2JE7A 1G6NA 4FO9A 1LULA 4WV8A 1N3OA 3RMYA 2RVAA 1RUI2 4HSJA 1OA2A 5D8AB 5DQ0A 4YZ1A 3EO6A 1S4CA 4NPMA 2CGPA 3SH5A 3TOJA 2ZGSA 3WNKA 3O7OA 1W6NA 3DCQA 3IDCB 3FUOA 4KG0A 3SCHA 4BB3A 1VR3A 3JCIA 3T2OA 4BMEA 2KA3A 2RDRA 1HV0A 4LEJA 4YGDA 2YGLA 1RUOA 3K51A 4A42A 1OLMA 1A78A 2GC1A 1PVC3 5FZDA 3UJQA 4DUWA 5E1RA 2DVDA 4N7IA 1NXD1 1PVC1 1DLCA 2DVGA 4CEYC 1AR93 1KJRA 3BOPA 5T55A 2FD8A 3O1TA 3IBMA 3I7DA 1AR91 4XBNA 5DUXA 4CYDA 4QKDA 4AI1A 3E5XA 2IXIA 3ZYFA 2EIGA 4E8CA 2VPVA 1ASJ2 1R082 5FR3A 5ANQA 5AFBA 2VXJA 2W52A 3BB6A 2BFUS 1AHSA 4IGOA 2OQ6A 2GAUA 5KR7A 5FY7A 1GZCA 3IT8A 1BHGA 2WABA 2WS92 2P3YA 2YC0A 2YXSA 3LA7A 4K6BA 5DUVA 4AI0A 2V4AA 1W6PB 1GANA 1QXPA 5LWBA 1VMHA 1DGLA 2EA7A 1DGWX 1U5ZA 2VZVA 4ARYA 3MBWA 4HKOA 1ENXA 2P3IA 2Z4FA 1CIYA 4QGMA 1OQ1A 3DPRC 5FJKA 3VUOA 1NZIA 1HQLA 3H1MA 1Q56A 1UWWA 3R4SA 4GMP0 4M4PA 4WM8A 1YQ6A 5G05L 4C90A 4FBFA 4I0AA 2QE3A 1YJLA 2HEYF 1YFWA 2XB6C 5F1RA 1O3SA 3T0BA 5HV4A 1XNBA 2Q8CA 3AJZA 1G86A 5C8CB 1R1A2 2VZ1A 2JDKA 5LK5A 3VZKA 4CCMA 3GGLA 4BOWA 4N43A 2KM2A 2C1FA 4X8NA 1J1TA 4XMIA 1POV0 3ZYPA 3RZJA 4S2FA 5E16A 5DN2A 1T6GC 1JS9A 1HRI2 5AVPA 4LQRA 5T52A 4FP2A 5KWRA 1AR83 1RUE3 4JVAA 1NAEA 1PGSA 4AFAA 2HJIA 5JSRA 1AR81 1RUE1 3MW2A 4LO4B 2D7FA 3ZOIA 4TN7A 1GZ9A 1YFYA 3UK9A 2VW0A 5A6XA 1N1YA 2OIIA 2ARCA 2GH2A 1HN1A 1QJEA 4TLGA 3HNYM 4B29A 2ZAAA 2DVFA 1NOVA 4ISQA 5D2AA 2ET7A 1Q43A 4BZ4A 1GWKA 2XKPA 2EICA 3A0NA 2ZBJA 1G7YA 4ZZ5A 1XPWA 3C3VA 3ACGA 4M4RA 1TVGA 3WF3A 1MS3A 1W9WA 4UFLA 4Y3OA 4N9HA 1QOTA 2OPKA 1BEV3 1N3PA 3VBUA 4LBQB 4WVVA 4HXCA 1BEV1 2EAAA 4QB1A 4CVUA 2D6LX 2E63A 1ZRCA 1DZQA 2ARAA 4IEQA 1VJ2A 1ZRRA 2W39A 3OJBA 2P6HA 4BK4A 4CP9A 4XW3A 3J9SA 4Z2AA 3I2JA 3WHTA 4AVTA 2H6CA 3HT1A 1XE0A 1RJ7A 4Y5TA 2ZGRA 5FPUA 4HK9A 4ZHNA 2P2KA 5BNOA 4NJ4A 1CAVB 1ZBA3 2AH2A 2ZEYA 4CCCA 2PAEA 4URAA 2C26A 5BNPB 1ZBA1 5FZ0A 5FUNA 5CFDA 3HWJA 5T54A 4XBQA 4XFGA 1O8SA 2VVFA 3PVEA 2VUDA 3M3IA 4XJWA 1JOJA 1W90A 4KGQA 1Q3EA 4OMCA 3W9AA 1ULOA 1WCKA 2PYTA 5CVRA 2WNUC 3VBRB 4ZU4A 1ND2C 4E2GA 5LK7B 3KT1A 2O8QA 1LGNA 4JDNA 4Y22A 1MEC1 2D5FA 2PHDA 3DECA 5SV5A 5C4WB 4FAGA 3HOBA 2QFEA 1SLIA 5GZEA 1C57A 2A75A 4OUMA 4HLTA 4ASLA 5FPLA 5AC93 3KVBA 3WCSA 2PFWA 2PN5A 3I97A 5JOWA 5AC91 3VLBB 2D97A 3AB0A 3U75A 4AQTA 5ISLA 1ND3B 3F95A 5LASA 4A4AA 5CFCC 3LQCA 2GC3A 5FZLA 4MXWA 1AX0A 5C9AB 1O3RA 5F5IA 4B1MA 1JZ6A 2FDFA 3OBZA 5JZGA 1YI9A 5KHGA 3GALA 4NAOA 1JI6A 4GA9A 2X8KA 3MI8A 1SDWA 1OURA 3V64A 1HQNA 1R093 1TE1B 3WF1A 1H8TA 1R091 2VZQA 4DNYA 1PMJX 2XHKA 4CEWB 1FI2A 2W08A 5FZOA 5I91A 3BUCA 4I2OA 2WZ8A 5JSPA 1W2TA 4E4ZA 4RR3A 1PO23 1XC6A 3NQHA 4JGYC 3ZMOA 1PX3A 2WT0A 2QNKA 1RMU2 3UT0A 2W46A 1TG7A 1PO21 5GZFA 4D8MA 5FDBA 4CDWA 2BYVE 3AKRA 3I2KA 3ZKUA 1DBNA 4G9SB 1D4M2 2D93A 1V6JA 3JB4C 3ZXEA 3WEZA 1L7QA 5TSWA 1BBT1 2WO1A 3AXDA 1RHI2 4PLOA 1GR3A 5HI0A 4XFIA 3BPZA 1OA3A 2NMOA 3T4VA 3WD5A 5SV8A 4TLFA 5LCWL 1ZA7A 3BI3A 1PGW2 3PVOA 4PF5A 5I8YA 1CAUA 3NKTA 3PDQA 2PXJA 2C0ZA 2V5YA 2CNAA 1DYKA 5FZ3A 1YHFA 5DAQA 3SH3A 1OOPA 3KHBA 1VMFA 4HL0A 4CCJA 4I30A 2JB4A 4E2QA 3GBFA 3LE0A 3UV9A 2PAMA 4LE3A 3O5SA 3N9LA 4Y20A 2E6VA 4C8DA 4IDZA 3FFZA 4GXLA 4UW5A 1CZSA 3M3OA 4Q26A 1AL0G 2RDSA 2LW8A 2CDPA 4C0BA 1QQP2 3LSDA 4MGQA 3AYAA 4L8QA 2H0VA 1UOFA 5L9BA 4NE9A 5BNPA 1F4AA 5F5QA 1X33A 3SNMA 4MGTA 2CYFA 4RYDA 4OZOA 4QPGC 4RGGA 2BVBA 2GN3A 4QXHA 1JZ5A 2XJQA 5GZCA 1W3XA 2PHXA 4XETA 1IS5A 2IXKA 3D0SA 4GJYA 4BQ5A 2ZGTA 1OQEA 1OT5A 5KXEA 3BTYA 1OXCA 1W8NA 3EJKA 4WVMA 3UKTA 5J36A 4S2HA 4CUAA 4FTSA 3WVJA 4R9CA 3M8LA 3I3QA 4O9GA 4W6XA 1TMF1 3LA3A 3WF0A 1V70A 4OYUA 2DUPA 1YIFA 4LBLA 2GN7A 1SBDA 2VZ3A 4UFIA 2R16A 2HWD3 4C1XA 5FZKA 4XJ9A 1RVF2 4XE9A 3AC0A 1NE6A 5FZMA 3GHNA 2HWD1 4FI9A 5IATA 4TWTA 1RB8G 3I59A 3NJYA 1C1LA 3PVNA 4L0PA 2B9VA 2A6YA 3VDDA 4FFIA 3VBFA 4XUNA 3PURA 2JG9A 3AZWA 4A7ZA 2QCSB 1BK0A 2AC1A 3HQRA 2A3WA 4NHKA 3NJXA 1YWKA 2K9ZA 3WOGA 5ACA3 1J3PA 1WCUA 4HANA 5J48A 3ZFFC 3N9PA 1PNGA 2CL2A 3ZSJA 3MICA 4R4ZA 5ACA1 3VKMA 2Y38A 4N53C 4NIGA 3T3YA 3SCFA 3AP5A 1NA1A 4Q4X2 1DZTA 3OGGA 1RUC3 3VBSB 4X6QB 3NNGA 3SEEA 3B01A 2ID4A 4UFKA 1RUC1 5JR2A 1AX1A 1OLME 3N3HA 2ZMNA 3UYJA 2EXHA 4NMIA 4Q4W2 3IMMA 5F3IA 1S2EA 2XHNA 4QQHA 3ALQA 2NZ9A 3N9MA 4NRQA 5LRRA 1N47A 5FYTA 3BPSA 3WW4A 4R4XA 4I01A 2YV8A 3T0DA 2Q0AA 2JENA 1F15A 4FFFA 5HBAA 1V9U2 1OLRA 2WFF3 4IEXA 4FPGA 5F7UA 2WFF1 2GDFA 4W65A 5AVAA 4A41A 4QT6A 3N7JA 2JDAA 3P1IA 5HPOA 1DLLA 1HX6A 2VBBA 4LBJA 4Q0VA 1E5RA 3ZXKA 4ZXKA 3ZN4A 4Z92B 3W5MA 2UY9A 3SMHA 1GQPA 2HLEA 4CDUA 1VRH1 1LGCA 4YFZA 1JYNA 2GMMA 3H3UA 2P3JA 2JDHA 5FYHA 5FPVA 1QQP3 2Q5TA 3JQXA 4LLFA 5BNOC 2PTMA 4LBOA 3CJIC 5EQUA 1D4VB 2HWC2 5BNNB 1KEXA 1H1IA 3ROUA 3OB8A 1CJDA 2XLFA 3ZYRA 1Y4WA 1LODA 3JUUA 5IK7A 4H7LA 4RS5A 5CBLA 1ZVFA 1UZ0A 4RHV3 3UETA 5FO7B 1UOJA 1UYXA 3ZFEA 3BU0A 4NRPA 4RHV1 1IQDC 1W6OA 3I49A 1N3QA 3CHXA 1GZWB 1CESA 3POYA 2RJLA 2ERFA 4K1YA 2LM3A 2BRTA 4Q0UA 3I3EA 3NL1A 4HONA 4XHBA 5F32A 3OCPA 4MO3M 1O91A 2VVEA 3QH6A 4PT6A 1WA4A 2A5ZA 4Q8LA 3AL5A 1GQGA 1H4GA 3AMHA 3S5QA 4X6RB 2ZMLA 4M3CA 5FP4A 2WYFA 2VVDA 2HYXA 4M0HA 1AXZA 1MR5A 2J42A 1GSLA 1LAJA 3ATGA 1FNYA 4P5YA 4M01A 2D43A 1PM7A 3LIHA 3I2IA 4FPJA 3SEPA 5FYSA 5M0TA 5JZGC 3I2FA 4HVQA 3ZYBA 4LITA 4CP0A 1O5LA 1DGRA 1I5ZA 1GOHA 1MZFA 3UKNA 3MPPG 5D21A 3AP6A 3W5NA 3J4UH 2JKBA 2OW4A 2WQZC 2RS12 4H55A 1WW7A 1H8TC 2HWE3 3AMMA 1ZBE2 3NW4A 2QKDA 4LPLA 1UXZA 2HWE1 5FXVA 2YYOA 2XLGA 1H9PA 2QZ3A 2WL1A 4ZONA 3ZFGA 4A44A 3K4DA 1UD1A 1OMIA 4DUVA 1RUH3 4I3PA 4QWNA 4DINB 2RS52 4QQ2A 2ZKNA 1H9WA 4LKDA 4A3ZA 3OYWB 1RUH1 1H6XA 2OUHA 3M70A 5CKMA 3DUIA 5E6HA 4LIVA 3LF7A 4I0WB 3VKNA 1MS0A 4C1WA 1VBC3 2JE8A 4LO6B 1W06A 3O1OA 2KR2A 4YVSA 1IS3A 5FZEA 3ZLIA 1ULFA 4EE2A 4RQPC 2C4XA 3ZXAC 3E5UA 1QJFA 3LZZA 4HN1A 2VULA 4MX3A 5APAA 3GCXA 4XOGA 5FYVA 2R042 1VPHA 3ON7A 1N1TA 1R1ZA 1UW8A 2GZWA 3A23A 4P9WA 1FT9A 4BWOA 1IZ3A 4CDXB 5KC6A 1SBFA 3I2HA 4R9AA 3DV8A 2GU9A 1T2XA 3H3ZA 4CPBD 5A32A 1UU6A 5ERLA 5F6KA 3B94A 1K42A 4MSVA 3VZJA 2IZWA 2VC9A 4XILA 3KS7A 3NMBA 1YC61 4ATEA 4CEYA 5FY5A 5BYNA 1NCQB 5C71A 3FBYA 2CWSA 3OUIA 1AVBA 3N36A 4IV3B 4BIFA 4CXXA 5DZFA 1UKRA 2WT1A 3B3QE 4AHYA 4FT8A 4HG6B 2WSUA 3ZM8A 2CAVA 3E6CC 3DYOA 3DXUA 3WZ1A 5JIAA 4CSWA 4NPLA 3GDBA 3WW2A 3ELNA 4RFT0 4ZKTB 3LD8A 4UFMA 5GJ6A 1PVXA 1S0CA 1QGLA 2OZJA 3DF0A 3S7IA 2WR9A 4DY5A 3WW1A 4XCBA 3PIJA 3WNOA 4NR1A 1W2UA 2ORXA 2Q8EA 2XDVA 3JBG3 4A2UA 3VBOC 3DPRA 3JBG1 5FMCA 1HXS3 4CZSA 5A7WA 4OI1A 4Z1VA 5JIUA 3ZR6A 1ENSA 2VUCA 1HXS1 1S0GA 3FC0A 2XJPA 2HWF3 3FHQA 1JHJA 2Q30A 4N9IA 2XWJB 5LBCA 2Q8DA 1JU3A 1ULPA 3P3NA 3MFCA 4DEQA 5A1FA 1EY2A 1T6BX 2HWF1 3VHRA 3VDDC 3VBFC 5FBZA 2OXBA 2UWCA 5C5UA 1AYN2 2JDMA 5FUPA 2VZPA 1XQNA 3EMRA 4YG3A 3HR9A 1W6QA 3RI9A 3UJOA 4PI2A 5BUVA 1IPJA 4QX2A 2DDUA 2DCTA 4OHXA 3RPQA 3ES1A 1FOD2 1S2KA 3MLJA 3H1WA 1LOAA 5HXMA 1GBGA 1I5PA 2R073 4BQWA 4HPKB 3AZVA 1RUF3 3LFMA 4FP3A 2R071 1CONA 4Y5Z0 1YQ5A 5EPAA 4GJZA 1FXZA 1RUF1 5CADA 2CWMA 4U36A 2ZEZA 2EVXA 5JI7A 4MLOA 4XAEA 4Q27A 2Q1ZB 4LKFA 3VHPA 2DUOA 3QH7A 1A8DA 3N7LA 4SLIA 5J96B 1R64A 4OQ8A 4Y26A 3NAPC 3IB3A 5FZ6A 1J3QA 1UY3A 1IKPA 3BOWA 1H0BA 3TN93 2EAKA 2R062 2YB7A 1AX2A 3VZLA 4XXPA 3TN91 4QM9A 2DFBA 3H7JA 1FMD2 4QMAA 4L97A 2VMEA 5T3NA 3P5BA 5FO8B 2X5IA 2RS32 1NZCA 1VBD2 2WIIB 2XXZA 4JGZC 4NIIA 5FWJA 4KU7A 1NCRA 1LOGA 2J1AA 2HKXA 1WCDJ 1TME2 1CPMA 3N7MA 1JN2P 5LB6A 4AGVA 4JZRA 4XJUA 5A3NA 1B35B 2E32A 4UYBA 3MIDA 5IK4A 4XABA 1HB4A 1IG0A 1D2QA 2XBO2 3H8OA 4WVWA 4ES8A 3WG3A 1W28A 2BQPA 3KV6A 3KV5A 4UWDA 3ECQA 2YFZA 4V2VA 1KXGA 3B00A 3I8TA 5FXWA 2E7AA 4IV1B 1ZZBA 5L7OB 2EXJA 1Y3TA 3V65A 4RS5C 3ZIXA 3HEIA 5DAVA 4KNCA 3ZFEC 4HSLA 1I6XA 4YZ2A 5F6LB 2VCCA 5J98B 1QJY3 5CKQA 1UMIA 1EUTA 2GNBA 4JCKA 1QJY1 4QKBA 4CCOA 4ASMB 4WM7C 1YFXA 2D6NA 2Z79A 2Y60A 2VMFA 1CZVA 1JYXA 3MLLA 4P9XA 2TEPA 4UF0A 3GZTB 1ODNA 2X10A 3OD0A 4O9EA 1K3IA 1PZ7A 4QM8A 5B4XA 2Z5WA 3FBMA 5EZWA 5JXJA 1W8HA 3TNQA 3IPVA 3G7DA 2W1UA 5CFCA 1I3HA 2W1WA 4HT1T 1H1MA 2YG0A 1IPSA 2ES3A 4XDOA 2VMDA 2BP6A 3W20A 2RM23 1S0DA 1UZWA 4AEDA 5JUVA 2RM21 3AP4A 3EXUA 3O0XA 3LDRA 1OC1A 3LA2A 3APBA 1CX1A 4XACA 4K9SA 4PDWB 2WC2A 1VAMA 4OI2A 1FOD3 4K1ZA 1DZRA 4TZDA 4A7YA 4RN5A 1QJU2 1EAH3 4B3NA 1C8M3 2FCVA 1OUXA 2LUWA 3MF9A 4D0QA 1EAH1 1ZRIA 1V6IA 1C8M1 1DYOA 2QQUA 2D44A 4AGRA 4JGYA 3S57A 2R0HA 2CV6A 5D1IA 3A22A 5DUWA 1ST8A 4UW3A 2RR12 4CUGA 4QHBA 3IM0A 3C7EA 4DXRA 1MACA 5LA0A 1I1EA 5DABA 4XDQA 3R6SA 2VQ0A 5JSOA 1KQRA 2KXLA 3VL9A 4YVSC 5IVJA 2QBXA 5FFOC 2XLAA 3SISA 1UU4A 4WM8B 1HLCA 1V6KA 3HJRA 4HKLA 2I2SA 2O1QA 4HN0A 3IIIA 5FTTC 3NNMA 4WBBA 4P02B 4QQPA 3WR0A 1RUJ2 1RXFA 4YG6A 4EN9B 1HRV2 5FIXA 1DQ5A 4H14A 4I02A 3LOBA 2VNGA 2ZX4A 3AKSA 2BV4A 4E9KA 4N43B 3PHMA 1HB3A 1D7PM 4AHXA 3M4FA 4QDQA 1US2A 1CAXB 4CCKA 5FZFA 3MIBA 5F3EA 4AZZA 1RGSA 2OX0A 5KC5A 3PL0A 2BNNA 2OPWA 4L99A 2BNMA 4XF0A 2JIGA 4M3CE 4AYUA 1PK6B 4COZA 4XYXA 4QPGA 1LENA 2Y34A 4R52A 1EV12 5FZBA 1UCXA 4CE8A 4CCNA 1PO12 5A7QA 3WW3A 3HD8B 3FX3A 1O3QA 1QXJA 4AI9A 2UYBA 4OMDA 4YM1A 3C7OA 2JKXA 1YNAA 4XMAA 1K5JA 5A3UA 2ENRA 5BXXA 2E26A 3MIEA 4AR2A 2DCJA 4Y1YA 3JD73 3MIGA 4NHMA 4LT5A 2Z69A 4D69A 3ZVXA 1XNCA 3JD71 1REDA 3VBUB 1HJFA 1WA6X 2FCUA 4FAHA 3IDAA 5EXOA 4EQVA 2BTVC 3ETPA 1AXYA 2D98A 3WX5A 2PLV2 3NV2A 4W6YA 5FV3A 2TUNA 1WKYA 1FX5A 4P00B 4Y33A 2OVUA 3T4HB 4CP9B 5T50A 4MGKE 3KGLA 1W6MA 2VY0A 2VZTA 2MEV2 3MUY1 3RYKA 1RUD2 4HK8A 2ZHMA 4L9BA 1HN0A 4OI0A 3CNAA 2GALA 1PMIA 1EYBA 4GB33 1MEC2 3WDYA 3ASIA 4MXVA 2ZEWA 3NWKA 1UYYA 2Y26A 3JZVA 4QD2A 5CFDB 2W94A 4PJYA 4YVWB 4PIYA 1D0GA 3ZFFA 1XNTA 4CU6A 5K0UC 1JH5A 5IUQA 1H30A 1RUG3 4UBHA 4LHLA 1RUG1 4N53A 1AL22 3J8F3 5DUUA 4AE2A 1J1LA 4OLLA 2R1BA 2V09A 1BMV2 4JRAA 3AKPA 2ZZQA 3J8F1 2YGMA 2XUMA 2KD7A 5A1LA 4BA6A 4QXKA 1PGL1 2ZPXA 5IVEA 2VBDA 2TNFA 1VIWB 4UW4A 4MG2A 4BLIA 2XJTA 2ZJCA 2HH9A 3ZSEA 3KWVA 3NVCA 2E51A 4IE5A 2QQJA 1AUYA 1K5MC 2XJSA 3SKJE 3ACLA 3T2PA 2VQTA 4Q2FA 3NNFA 4AEKA 1ENRA 1VBE2 5F2WA 3VBHB 3OGVA 3KZ4C 3CZJA 5A7OA 4DXTA 4CXYA 3K77A 1EUUA 4LHSA 1GOGA 1CZTA 1RUI3 2VXRA 4IGQA 1Y9GA 1UYPA 1QMJA 2IWGB 1RUI1 4MXWB 5KHHA 2V72A 5J09A 4FPOB 5LA1A 4BU2A 2R6QA 1ULGA 3QCWA 1GLHA 1U5YA 2X5IC 4Q1PA 1UF2C 1UOGA 1DQ0A 1X36A 1QH6A 2MNGA 3IDBB 1VB2A 1NCRC 4LOTA 4IUGA 4HBNA 2IUWA 4M0NA 3H8RA 1BBT2 4UI9L 3VKLA 2VNOA 4IEUA 4M3CF 4DRRA 3UGFA 4COWA 3SH4A 5FQ0A 1RJ8A 1AR72 3RWKX 3V0AA 5FZOB 4FTEA 1QHDA 3PTRB 4BH9A 4RR3B 3VD3A 1Q8QA 2V5DA 5ABJC 4DFSA 3CJIA 4QX1A 4RGKA 1JZ3A 4QPWA 4QB6A 4KWLA 2W87A 4CDWB 4INDA 1ASJ3 1R083 1US3A 3CBNA 3POEA 1E5HA 1ASJ1 1R081 2W5FA 3SCGA 4CU9A 3IIAA 1F8VA 3FJSA 3MV01 2P5BA 5C6CA 1O4ZA 2A6VA 2WS93 4IEVA 4CU8A 2ZX3A 4BCUA 4K21A 1MS4A 4Y24A 3D5OA 5I93A 5GM0A 1WLTA 2A7AA 5GLWA 5IT6A 4HZFA 5HCBA 3WDXA 1CAUB 2AZ5A 1MS9A 3B7MA 1H1AA 4OQ9A 2J1UA 2QQNA 5FRAA 3ZYGA 1OOPB 2Y8KA 1PNFA 4NROA 3LPFA 4U2AA 3O1PA 4LXLA 4Q4V2 2IXLA 2W0XA 2ZHNA 1XBFA 4IERA 5FO9B 3PJQA 2JG8B 4GALA 4Y20B 5FZ1A 2JECA 2OKXA 2XQXA 3MO4A 3OSDA 4PBPA 5E89A 1G9DA 1XE7A 5EJ1B 2WN2A 4BYYA 3WQBA 1GICA 4QHOA 4YW3A 1V0AA 1R1A3 1SCSA 2E9QA 3A0KA 3FHAA 3THCA 4AEDC 5JDBA 1R1A1 2X05A 1WD4A 2K0GA 3LWCA 1E5SA 1V00A 4MZUA 4BE3A 1KRIA 1XSQA 1GP6A 1KJLA 1M06G 5CAZA 1NT0A 2JE9A 2B39A 1HRI3 1NLQA 3PLQA 4LUMA 1J84A 4Q0QA 1WLWA 4B1LA 3TB0A 4AAPA 4KG8A 4CRQA 4QX3A 3H7YA 3QBQA 5CU1A 4IXLA 5FY9A 1H2NA 3H8UA 3P3PA 2BPA2 1GNYA 2WJSA 2FMYA 4WVMB 4XUQA 1QIQA 5HXVA 5BNQA 4AQ6A 5A1AA 2A1XA 4LBQA 4NOTA 4AFDA 1CN1A 4ET7A 2JDNA 1VBB2 2NLRA 4J1WA 3U4XA 3E6BA 3POSA 3V56A 5G04L 4KBBA 4RQPA 1QNYA 2OA2A 4W50A 1WW5A 4GKYA 3I59B 2QQKA 5LBBA 1BVVA 4YGEA 3VL8A 3WDUA 4Q5OA 1DGRN 3VBFB 3KLSA 3OD4A 4XUOA 4AI3A 1ULCA 5L9VA 2JG9B 1J58A 5FOJB 3TWIA 1FAYA 4P9JA 4C0HA 2P6CA 4QPIC 1S0IA 1COV2 3WNXA 3AZZA 1H4HA 3JB8A 5I0TA 2WRAA 3G6JB 1Z78A 3BYWA 3MPBA 1P8JA 4BIOA 4KGGA 2VJXA 2QQVA 1D2SA 5LA9A 4DXZA 4ZZ8A 2PHUA 1NA1B 3WUCA 5FREA 4WVZA 1G9FA 3MYXA 1HIXA 5F3CA 1VBA2 3WV6A 3DXTA 5A70A 2CDOA 4TSVA 3AP9A 1S0FA 2GP3A 1W2NA 3PIGA 2UY8A 5L36A 2IFRA 3ZXDA 1SACA 3LEIA 4AW7A 4CDQB 5JPMB 4OULA 2WBKA 3GJAA 4AVVA 3Q9OA 1Q5OA 3PNAA 1PZ8A 1Y43B 5LY1A 2VMIA 4DS0A 2GP5A 1PIV2 1ND3A 1S1AA 2YBSA 4Q8KA 5F37A 5HCFA 1X9PA 5LZ6A 2JJ6A 3POGA 3A4UA 5C9AA 4FOWA 1Q8PA 3K48A 3VBOA 1YYNA 2P3KA 4XF4A 3IZOA 3H50A 4F7ZA 1SCRA 1QNWA 4M00A 3RNSA 1SQ4A 4NIDA 5F5CA 4CDUB 1N1VA 3I3DA 1IGOA 1GZTA 1W05A 1XNAA 2PHTA 3BODA 3OGJA 4GZ9A 2YHJA 3INAA 2WZPP 4OCTA 5A7PA 3T09A 2XQRA 1YI7A 4XTMA 3ES4A 1LHWA 1NQDA 4CCLA 3U78A 1W0NA 2YY1A 1JOBA 3IN9A 1QJX2 1OD5A 2WZR2 4XIKA 3EYPA 5FLJA 1GYKA 1W8ZA 3RFRA 3GNEA 3USUA 5HCAA 1W6OB 2E33A 1LTEA 2BW8A 1FYUA 3GF6A 5AFEA 2BEOA 1CVNA 2VCBA 5D8AC 4FPYA 4FFHA 4LKEA 3OOXA 4DMIA 5C3PA 3KCXA 3PTYA 1MZ5A 1RMU3 2HWB2 2JDPA 2Y33A 3AXEA 3LB9A 3N35A 3NKGA 4LBMA 1RMU1 2A71A 1C5IA 2ZS6B 5EJ3A 3TBDA 1D4M3 1VALA 1O6UA 3ZYJB 1D4M1 2PMWB 3LAGA 4M3CB 1LOCA 5JAXA 2JX9A 2OQ7A 1RHI3 3ZDVA 4DQAA 4IE4A 4R8HA 1OF3A 1E5IA 1RHI1 2LRPA 2SBAA 3NAPA 5DZEA 3WUDA 4AAXA 4DY3A 2WSVA 3O1VA 2DWRA 3CU7A 3KSCA 5EJZB 5IWFA 2UWBA 2WNVB 1PGW1 2DF7A 1DF0A 3NNJA 4A7KA 1KS4A 2GMEA 5IVCA 5H9QA 3WP4A 4UT5A 4YW2A 4JGZA 1WBLA 1REEA 4JAAA 5DDJ2 4AFMA 4P9IA 5FYUA 3R4DB 5FPZA 3LEGA 5JXGA 1QOOA 3AKTA 4JHZA 4PI0A 3MDPA 1LOFA 5IAVA 4EN6B 4PQ9A 1NY72 4GH4B 5FY0A 4COYA 3ZFGB 1IQAA 1CGPA 3WNPA 1QQP1 1YLLA 2FDIA 1KGYA 4XF1A 5FPXA 4AGGA 4GWIA 2CGNA 2EIBA 3I2OA 1GUIA 1LGBA 2OUJA 4Q0PA 2D40A 3O0VA 1EPZA 1OFSA 1HB1A 1LHOA 3AYCA 4L2NA 2NYYA 2YU2A 3KQRA 4N8MA 1X9TA 1MQTA 5FZ7A 4K8RB 2WNOA 5DZGA 1W9TA 3KB5A 4FOQA 3ABZA 4XEZA 3OPZA 1SLAA 3B02A 4P5HA 4WM7A 3FLRA 4ZS2A 1VRBA 2Z2SB 5FK8A 1QF3A 3BKZA 3POJA 2DBNA 5C8CC 5IVVA 4XXAA 2D3SA 5E8AA 3K4ZA 5LATA 2G4IA 2R32A 1XRUA 4OVEA 3OBAA 2WO2A 5JCTA 3WP6A 1RVF3 1H6YA 3CEWA 2W1SA 3PUHA 1RVF1 4RGAA 4CEYB 1OQDA 1ZX5A 2ZKLA 3KM5A 1DHKB 2DU0A 2O14A 2ZGPA 1JYCA 4EWEA 1SPPA 4NAMA 4B4RA 1Q8VA 1AYM2 3SLIA 4OHZA 5DAWA 3L2YA 1YEWA 3S0MA 1CD3G 1J83A 1NX9A 2NPIA 3A7QA 5EYXA 5A3TA 3BU7A 4YARA 5J37A 2XL7A 4YW6A 4EZ4A 1CWPA 2HBUA 4AI8A 5DMYA 4GQ7A 4Q4X3 3OUHA 4Q4Y2 2Y64A 4OFGA 1QXRA 4Q4X1 3ZXLA 1W9SA 1OFNA 4XFFA 1JBCA 1IS6A 4QX5A 3MW4A 2WAOA 2DYCA 4Q4W3 3VKFC 1AJKA 1C3HA 1FPN2 5FMOL 4Q4W1 2WWUA 1KFUL 3WG2A 3VKOA 1ULEA 3CKHA 3DPRB 2YBKA 3WP3A 3D4KA 3K3NA 5FMDA 1W8FA 3HT2A 4D94A 5A7WB 1VBC1 5L9RA 5I0RA 3IAPA 1V9U3 2RJ2A 2JICA 3T1LA 1W03A 2XPJA 1V9U1 1Q8OA 2VL4A 2XR4A 2VBPA 3I54A 3HQXA 4LO5B 4QX0A 4X8PA 4W8JA 5GALA 1SLCA 5CB7A 3ZR5A 4Y4YA 2WFPA 3PUSA 3CMGA 4XQDA 1CX4A 2GNDA 1WGPA 4P08A 1UQXA 2FMDA 2QQLA 5BNPC 5JOYA 1XE8A 2ARBA 3OBRA 3I4IA 1W6QB 3HNBM 4ISRA 3QD6A 4MHRA 5F2SA 1S2BA 3FFQA 1BZWA 3V0BA 4D6SA 3ZMNA 1JTZX 1LECA 2W68A 3I2DA 1A3KA 4FOVA 5C3SA 1OF4A 5EHDA 5FOBB 2XJRA 1ZZ8A 3DYPA 1RYYA 3VBRC 4BXFA 4MVTA 3X29B 2R1DA 1FV3A 2HWC3 2WO7A 4HVOA 2CGOA 2YC2A 3MGUA 1ZZ9A 2EALA 2DUQA 1UO9A 4KU8A 5C4WC 5FZ4A 2HWC1 2I45A 4NN0A 4Y1VA 4BQYA 5I0DA 4LLOA 1OPMA 2WWJA 4AHZA 1ACCA 2F17A 2XWBB 1DIWA 2JXAA 5IFPA 5J7MA 5CZKA 1W2OA 3KCCA 4UFHA 4Y1UA 4TTGA 1OH3A 2OZ6A 2W9XA 1SLBA 2Q1FA 1ND3C 3M2MA 3JU9A 2VECA 5FBJA 1UXXX 2DV9A 4XFBA 1W2AX 5C9AC 5CYYA 3NV1A 3U10A 1BVP1 2JDUA 4FPKA 4L11A 4AHWA 4TXWA 4AEJA 2J1VA 2O8OA 2J1TA 2QZ2A 2XG3A 3HPNA 2F4PA 2DVAA 3RZHA 3KV9A 2B42B 4QXCA 4OI4A 4Z82A 3THTA 4B4PA 1E57A 1GKBA 4NHYA 3LFIA 4J6GA 4GWMA 3WG4A 4CEWC 3MFAA 1SFNA 1UN1A 4XC9A 3VZOA 4Y1XA 3VV1A 1AYM3 2VOXA 4EV0A 2K46A 1OKQA 2FDGA 3OYWA 3WINE 3WCRA 5FMBA 1G9CA 1JU4A 5K0UA 2RS13 5J1XA 4PHZA 2X53S 5A33A 1LKNA 5IVBA 1ZBE3 4IE6A 4O7XA 3MUZ1 3LKJA 3UKVA 4BISA 5FUIA 1ZBE1 3AVRA 4DOUA 2D3PA 3TEZA 3U4SA 1YXWA 4YPJA 1S55A 1OH4A 2RMU2 2WNUB 1PZ9A 2WUHA 1IHMA 4NWVA 4XFCA 4HKWA 1ND2B 2YROA 4PLMA 5C3RA 1JYVA 2RS53 2G9GA 4QKFA 4ARXA 2H6BA 4YG0A 2NQYA 4NUBA 2QQPA 1AF9A 2RS51 2RDNA 3AYEA 3LCPA 2VZRA 1BKZA 3PMEA 2VAUA 4W6WA 4YM2A 1K5MA 4UF0B 1Z7S2 4KI5M 3SKVA 1UY2A 3D8CA 4PCRA 4COVA 3PUIA 5C5TA 3CIHA 4YW5A 3J7HA 5IJRA 1N1SA 5JMOA 5FYYA 2VTFA 3IPVB 5FYZA 5CFCB 1JUHA 1LEMA 2Q8OA 4I3GA 3ACFA 3GYDA 2R043 3H9AA 3OGRA 3NRUA 1C4RA 3KHCA 1MVEA 3WNNA 2R041 3S5AA 3BGAA 2XMLA 4AG4A 2R7EB 5A7SA 2YPJA 3OY8B 1AR62 1WLCA 3OBTA 1GWMA 5FY1A 3WP5A 2J1RA 3THPA 1VLNA 1QKQA 2LROA 3ZN6B 5K7PA 2UURA 3Q8AA 1LOFC 1HKDA 2V4VA 4XCAA 3WHUA 2D3RA 1RITA 2QQWA 3ZYHA 1J59A 5ABJA 5LEKA 4HMZA 4JGYB 5L19A 3W58A 2BBAA 3DGTA 4YWAA 3ZXGA 2VGDA 3H1YA 5FK7A 2B8MA 3VHNA 2BFUL 1BQPA 1PVC2 1BJQA 1MQTC 1SG3A 4OUEA 1WWYA 1BCXA 1VAKA 4B7KA 4EN8B 2DURA 1NUKA 1K45A 4MADA 5LBFA 2WO3A 2BWAA 1AR92 4OHVA 4FXGB 2LALA 3BN6A 3VDBA 1W6NB 3FUQA 3K46A 3MF6A 1JYIA 4C91A 5KXBA 1POQA 2ZGKA 3DYMA 4IQPA 5FWEA 4K40A 4DUXA 3RYRA 1GNHA 3Q8CA 5FY8A 3C7FA 2FQPA 1IG3A 3GZEA 4LO8A 2BBVA 2VQUA 4XBLA 2MPFA 1X50A 5JXIA 3H0OA 2WZEA 3K75B 2ORZA 3RZZA 1LB2A 1AYN3 3B9IA 1UAIA 1GFF2 4BDVB 3AMNA 4CUCA 1AYN1 4Y1ZA 2BNOA 3VD4A 4NRMA 3RZGA 4YW4A 3N4MA 4QPGB 1LR5A 2DU1A 3KQ4B 3N7KA 4EN7B 3U14A 3MV11 4JV4A 5IVFA 1FOD1 1CAWA 5CG8A 4QXBA 2DFCA 3ZKYA 3L9JT 1W8OA 4LBNA 2YZ4A 4QPYA 2Y6LA 3RZKA 2E7QA 2C24A 3B69A 4YM0A 5GLTA 4D7TA 5B4NA 2GMPA 4QU2A 3BVCA 1W8UA 3RJ2X 4DRVA 4YNIA 4B8EA 5FYCA 3T0AA 5FCCA 4O65A 1Y7BA 1SZBA 2R063 3WG1A 3WT3A 4P9GA 1W6MB 4QQLA 1U12A 2P4EA 5T5LA 3VHOA 2R061 1FMD3 1AR82 1RUE2 4OHYA 1UPIA 1FMD1 4AVCA 3AVSA 1F9KA 3VB9A 5BNNC 2RS33 1VBD3 3K4AA 4IL7A 1BK1A 2VR4A 4QPIA 4XJZA 1AJOA 2VOKA 2AREA 2RS31 1VBD1 5GLUA 4LHKA 3ZFFB 2J1EA 1XSRA 4JX0A 1TME3 3S6PA 4DO0A 1NE4A 3D6EA 4AFBA 4KL1A 1PMHX 1ENQA 1S0BA 1TME1 1XNKA 4N53B 4NVPA 2XBO3 5A6YA 5FZHA 1W8WA 1W99A 3KT7A 4LOSA 5GLVA 4BM8A 1JW6A 2XBO1 2ZAHA 3FZ3A 2WINB 2ZGUA 3AKQA 2VNRA 1H8VA 1VMJA 1W3VA 1XU2A 4RFRB 5JXHA 2V73A 5FPAA 1BEV2 3O1UA 1ZREA 3SQOA 3ORJA 1V6MA 5BY5A 4ORFA 3AL6A 5DXDA 2DTWA 3O1RA 3ME2A 4LE4A 5FZ9A 4JKKA 2WA3A 5IVYA 2C6SA 1RXGA 4GIQA 1VP6A 2BGCA 4E4DX 3ZSMA 4LMFA 3K2OA 2JD4A 4KWJA 4E27A 3C7HA 1OHFA 3U11A 3ZXFA 3THDA 2YU1A 1ZBA2 4FPLA 4NO4A 2YPDA 1A34A 2W95A 4AWDA 5A3OA 4CA9A 4IEZA 1ZZCA 2ZA9A 3OEBA 5CG9A 4H3WA 4PDWA 2DCZA 5L73A 5FXXA 1W39A 2YUEA 2AEYA 2CTVA 3I2GA 1PHMA 5FQ0B 4JRLA 3V0AB 5T5JA 1XYPA 1L7LA 4P14A 3URFA 5BNOB 3E6DA 2PHRA 3H42B 1G9AA 3CJIB 4BPZA 1C5HA 4XF9A 4GB31 4WZFA 1XXNA 1SLLA 3RMXA 2Y0IA 3J26N 4GULA 5C7GA 1UY1A 1OD3A 3TEXA 1UZZA 4YZ5A 3SITA 1W0PA 3RS6A 5AC92 2A6XA 1QJU3 3AZYA 3NJZA 1CJPA 1QJU1 2G19A 2P34A 3ITQA 5KHIA 5DG2A 4CCDA 5D8AA 2QDRA 1W0OA 5GLZA 2B46X 3ZX7A 4D6QA 5KHKA 3BTZA 1SFYA 4D3WA 4AK3A 5IFTA 4Y22B 1NKGA 3MHZA 3HQUA 1XOYA 4FTBA 4CDXC 2DVBA 1O8PA 2RR13 1YRZA 2WAAA 2VW1A 2OS2A 2RR11 5LRSA 3MW3A 1WBFA 3B5LB 1HW5A 2VUJA 5LA2A 1R092 2IVIB 4A6OA 3ACHA 1L7RA 2BGOA 4BQ4A 5IK5A 4YGBA 4KBZA 2JEMA 2XOMA 1NCQC 4AQ2A 1CAXA 3U0ZA 4IV3C 5BPXA 1WW6A 2X09A 4URTA 5FAXA 1RUJ3 1V6LA 2QVSB 4H7MA 4F3JA 1HRV3 1PO22 1X82A 1GV9A 2AYHA 3BTAA 1FATA 1PK6A 1RUJ1 1Y9QA 5DPNA 3KF3A 1HRV1 3T2TA 4GWJA 3ZPYA 2WKKA 4QAWA 2BOJA 1AZDA 1UNBA 3K3OA 2A6ZA 4XPVA 4BMBA 1H8TB 5JLVA 2BOIA 2EXKA 2GC2A 4MOAA 5F8PA 2Q4SA 2IXCA 4RSUA 3AM2A 3PUAA 3WQ1A 2LS6A 2L9LA 5FLIA 3ZO0B 3VN4A 3WF2A 4LUKA 3VD9A 4FPCA 1H2MA 1W6PA 4IETA 2PHFA 3IDEA 5B2GB 3CF6E 4EWAA 1J3RA 2BWCA 4BXSV 1EV13 1ZZ7A 1YO8A 1PO13 1WZXA 1UX6A 5I0UA 1EV11 1UY0A 1X8MA 3J7LA 1PO11 1YQ8A 3CO2A 5JOZA 1BLZA 2JWPA 4JTOA 1LOEA 4QU1A 4D7YA 4DEVA 4QHZA 4RQPB 5CEHA 2WS91 2I07B 3IWZA 4Q29A 4IEPA 5FPBA 3HMYA 1YIPA 1F4HA 4LBQD 5FYBA 3WNMA 2W92A 3M3EA 5C8CA 4PQQA 4FSJA 2PLV3 4YVWA 5IK8A 2VG9A 4XTPA 1GQHA 4RD7A 3OUJA 1ODMA 2PLV1 4LULA 3PU8A 1HB2A 3VDCA 3UL2A 5FYIA 1W9FA 3CZUA 3KF5A 3PMSA 3VDAA 5DG1A 2MEV3 4KQ7A 1KS5A 1OSGA 1RUD3 4ZU7A 4XHXA 1KFXL 3B9CA 2MEV1 3UNPA 1RUD1 3N9QA 1V6OA 2Y6HA 2QTWB 4MH0E 3WF4A 2HEWF 5A3PA 1MEC3 1IKQA 2G9FA 3AZXA 3LPGA 1YCIA 3KCYA 4QKNA 1ZYBA 2A6WA 2VZOA 2WLPA 4IGPA 4XAAA 3GM8A 3F2ZA 2B9UA 1TMF2 3OEAA 5A7NA 2QQMA 3T2QA 3CL1A 2Z42A 3ZPOA 2RV9A 4CCEA 4CP1A 3FL7A 4LK7A 3FMGA 4XVHA 2ETEA 3OG2A 1AL23 3POFA 3VBHA 1XYOA 4NIHA 2VH9A 2QUOA 2R30A 2Y6GA 3Q8BA 2NM1A 1HRI1 1AL21 2HWD2 1UMZA 3WDTA 3RVHA 2J1SA 3SHRA 1BMV1 4XJAA 5LY2A 1DP0A 2FDHA 1X7NA 4FVVA 4AI2A 5JPNB 3N9NA 1O59A 3B93A 3ILFA 1GWLA 1UOBA 3N9OA 4Z2WA 2A3YA 3QACA 2RJKA 1UZYA 3O0WA 2P17A 3VBOB 1VBE3 1CPNA 5ACA2 1YQ2A 1RL3A 1VBE1 4SBVA 2W2IA 3OTFA 2NMNA 4YYOA 2I74A 1B35C 3RSJA 3LSEA 3CDZB 4ONUA 4DIQA 3WLUA 3AFKA 1DQ1A 1MZ6A 2VOVA 3KD4A 3GHMA 3RZLA 3VDDB 3SXWA 3TAYA 4CU7A 1CAVA 2OT7A 4MGYE 4FXKB 1RUC2 2WQ8A 3MEPA 2ZXQA 5JI9A 5FP3A 1WD3A 2HEVF 2X29A 3QLQA 4IV1C 5FYMA 1IS4A 3D82A 4EN0A 2ZZJA 4JQRA 4AF9A 5L7OC 2WA4A 4YW7A 2FDJA 4BHPA 2GNTA 1BBT3 1GNZA 2ZGQA 1A8MA 1LHUA 2ZACA 1AR73 1W9YA 3USUB 3ZSKA 2ZGOA 3U1XA 5I8SA 1AR71 3R05A 4UFJA 4XIOA 3VBRA 5CA6A 3ZDSA 1SDDB 2WFF2 1VB4A 3TNPB 1LESA 1OPOA 1WLDA 3JQWA 5C70A 2ADEA 2W1QA 2VW2A 2XONA 5C4WA 4F83A 1UY4A 4LKSA 2JIJA 2FBEA 5H9SA 2Y6FA 4Z07A 2R0FA 1LRHA 3HN3A 1VAVA 4XUPA 3WDVA 3ZIWA 2A3XA 3EQEA 4META 4XF3A 1LEDA 4BQ2A 2XGXA 4CP2A 2JG8A 1VRH2 3LGRA 3NAPB 1WW4A 4K7JA 3WDWA 2YBPA 4FPEA 4I0BA 1UKGA 3BCWA 2VUAA 2FZ1A 3C8XA 5A80A 3RI8A 4F8AA 4YZ4A 3R0RA 3J7NA 2UU8A 2HBTA 5IAXA 2Y0OA 1UU5A 2AENA 3HAGA 5C33A 1BXHA 1OKOA 1TQ5A 3GZUC 3KV4A 5JWPA 4H2AA 1MVQA 3ETQA 4JGZB 4Q4V3 1EPWA 3AFGA 4N7UA 4PDWC 4Q4V1 2B45X 3IKWA 3PUQA 3DEMA 4HOOA 5FLHA 1MS8A 2J22A 4RHV2 4CEWA 4LIUA 4NHXA 2PQQA 4COUA 3ZYIB 4FQ4A 4Q0SA 4AEMA 2F6BA 4Y4RA 4BLJA 5IYYA 3AK0A 2PHWA 4XQWA 1LHVA 4QX8A 2YFUA 4CUBA 2WNEA 1TMF3 3TEWA 2NN8A 5HV0A 2ZGMA 5A6QA 4RS5B 1ONAA 1A6CA 1I9RA 2PHLA 5GZDA 1SHWB 3ZFEB 4DXSA 1URXA 2DCYA 5T5OA 2IC1A 2Y6JA 4JTNA 1MQTB 4WM8C 3AP7A 2GH8A 4YFWA 1DQ6A 3UESA 1SFPA 2VTXA 4WM7B 1HDKA 2IXHA 1C8NA 1TNRA 3LDBA 2FHRA 2Y6KA 4MGSA 4XFHA 4BQ3A 1JYWA 1IPKA 3LEMA 1G9BA 1VBB3 5F3GA 2B4KA 4GMP3 3RWNA 1FV2A 4DB5A 2A70A 4PBOA 5FZCA 1VBB1 4N43C 4GMP1 3AJYA 5EWSA 1ZRDA 1RIRA 3EBRA 1UMHA 2BUKA 2ZX0A 2ZMKA 3ST7A 1JOPA 2HWE2 3GXUA 5LW9A 5H9RA 2NP0A 4XJ8A 4YM3A 2YMZA 2ZCWA 1L3JA 1SPPB 2TBVA 1BYHA 2XJVA 3OF1A 4LHNA 2VU9A 4WZCA 3BIEA 5E88A 1PK6C 2QQOA 1RUH2 1V6NA 1HJGA 1POV3 2HYKA 4BQXA 1COV3 2ET1A 3H8XA 3TYJA 4HETA 3O1SA 1POV1 2ZEXA 3ACIA 1COV1 3P6BA 4E4SA 4EWDA 4CDQA 3FHIB 3USSA 2BJSA 2FZ2A 1VBC2 5K8SA 1ZM1A 3KVAA 3RQ0A 3GBWA 5JOXA 1REFA 2DCKA 4XUTA 2F4LA 1WCSA 1NLSA 2CHHA 2ZTNA 3FWEA 4QX7A 4LTAA 4ZPIA 2ZGLA 4E8DA 5C3OA 1SEFA 1STMA 1VBA3 1CQ9A 1ZZ6A 4YSFA 3RRDA 3DL3A 3J7MA 1W04A 3VBUC 4KWUA 1VBA1 2C9AA 2CY6A 3FLTA 3BALA 3AMQA 1O5UA 4I09A 4EROA 4FCAA 3IAQA 1C1FA 4Q1RA 1QJZA 1GOFA 4Z8BA 1UPSA 2BDRA 3M1HA 2VMCA 1ALYA 1JZ2A 4YVSB 4AVSA 1VRH3 4OHWA 1PIV3 5EV7A 1OVSA 3R4UA 1HQWA 1PIV1 1SBEA 4LO7A 5C3QA 5K9YA 4AOCA 1PX4A 2E31A 5F39A 3UGHA 2N7GA 5F5AA 3H3LA 1UIKA 3POBA 3RYPA 1TZOA 5JR7B 1X8EA 2VZUA 5CFDC 4YVWC 1CR7A 1OI6A 5A32B 1W8TA 2WQ4A 3T30A 4PLNA 3WY6A 3TRSB 2OYZA 2SLIA 4YRDA 3V0BB 5CNAA 1NXMA 5FZIA 4AL9A 1JYTA 1XU1A 3NO8A 2XVGA 2ZX1A 1OA4A 4GKXA 4ATFA 3VBSA 4E2SA 4P9YA 4JHTA 2DBIA 4AVBA 2RG4A 2A73B 4PIZA 1GMMA 4QDSA 1UYZA 1O4TA 2O0OA 2VCMA 4GD4A 4E4HA 4YGCA 3JBG2 1QJX3 4UAPA 2WZR3 4ZY9A 1S0JA 4BQ1A 3VBHC 3POIA 1QJX1 2QDNA 1O7FA 2QQIA 1HXS2 2WZR1 4EYUA 2AR6A 2WDBA 1QEXA 1F5FA 4ZS3A 3T08A 3E97A 4J1XA 2HWF2 2VMGA 3VGIA 2HWB3 4RA0A 4RL7A 1UZVA 2WNVA 5FZGA 3ZXJA 1QDOA 5DAXA 4DPNA 1F31A 1OVPA 2HWB1 3W21A 3MIHA 4AVAA 4LBKA 1JUIA 1DGWA 1Z0HA 2RE9A 3S30A 4CTEA 1LU2A 3LEKA 1QY4A 4GAZA 1ZNPA 1UX7A 3U07A 1KITA 2FDKA 2JD9A 3M7AA 5FXZA 3OPWA 2MHFA 5A3WA 2D6MA 3HN1A 1M4WA 4XZPA 3IMNA 1NQJA 1HV1A 2R072 3LDKA 4BJ0A 4GH4A 4RR3C 4MYEA 5JMCA 1RUF2 1C28A 2AGSA 5BNNA 2XUEA 2ZABA 5IHRA 4ZXEA 5IW0A 1AXKA 5DDJ3 2ZHKA 5GKAC 4CDWC 5GZGA 5EFUA 2PA7A 2CU5A 3O12A 5K0UB 2ADDA 4N90A 4W4ZA 5DDJ1 5BV6A 3WXPA 5A6ZA 2VD7A 1QH7A 3OGSA 4FOYA 1TEIA 1KDKA 4MV2A
chains in the Genus database with same CATH topology
1NG0A 5I8TA 3AYDA 1GZWA 3TN92 2XL9A 1NY71 3LOIA 1F2NA 1WMDA 4UW6A 5F9TA 2XH6A 4ES9A 3WQ0A 3VZNA 1OOPC 1Q8SA 1K5MB 3ILRA 3AMPA 2K2SA 4JDMA 2E7TA 2JG8C 4K3UA 2B5HA 4MUVA 2XKOA 3RDIA 5KHJA 4AFCA 4OUSA 4LA2A 4IEOA 3KT4A 3QOPA 2VOWA 2D5HA 2D6OX 2X5IB 1RTVA 3W59A 4NPRA 2GSYA 1FNZA 2IFWA 1KDMA 1NCRB 2ATFA 1XNDA 1WUVA 4YZ3A 1WMEA 4B4QA 5H9PA 3NV4A 3RJRA 4B7EA 1QJY2 1RUNA 3MZHA 3WQ7A 5ABJB 4K8FA 1XYNA 1AYM1 4ZU5A 4R9DA 1UL9A 1WMFA 2C5DA 1DYPA 2RS11 2VMHA 5C8WA 1O4YA 3ILNA 4Q4Y3 1UIJA 2GC0A 4S2DA 4Q4Y1 1LOBA 4FPHA 2XVLA 4JDOA 2XJUA 1MS5A 4XQ4A 2RM22 2JG9C 4CDXA 1FPN3 2Q1MA 4A3XA 1FPN1 1JXNA 1QOSA 1DDLA 1EP0A 2VQAA 5A3MA 3FE5A 1NCQA 2QJVA 1EAH2 2WLQA 1NA1C 1C8M2 4IV3A 4JC1A 4YLZA 1NYWA 2ILMA 4AEDB 2ZHLA 2D6PA 1LJ7A 1IOAA 3ZN5A 2EF6A 5FMOS 4CDQC 1SMVA 3MLKA 1G8WA 1F5JA 4GWNA 4QGNA 4HVRA 1CAWB 3KGZA 4LNVA 3E6CC 1JHNA 3PVBB 1QWRA 1S0EA 1RC6A 4PIXA 5A33B 2BVVA 4ITCA 1O3TA 3FLPA 1SLTA 1DQ4A 1YUDA 1U5IA 2LTNA 2AUYA 3GZAA 1DU3D 3M3CA 4OZXA 2P37A 1APNA 5CIRA 4MGIE 2ZGNA 3CLPA 1H2KA 3AX4A 1H2LA 4QQOA 1U5XA 3CJXA 4R9BA 2ZX2A 4CDUC 1D0HA 4V1PA 1RINA 4D7SA 4IESA 1LHNA 4UXAA 5J3UA 4QGLA 1YFUA 3NV3A 1DQ2A 1LCLA 3L2HA 3VZMA 4QPIB 5T5PA 1KD7A 5I0SA 2IXJA 3KMHA 5EYYA 4EJRA 3NSTA 1ZA4A 4G4FA 3EHKA 3POWA 4HPKA 5LEJA 5A3LA 4AXOA 2UWAA 2WNUA 3VBSC 5JZGB 2ZOEB 2JDZA 1ND2A 4TYSA 3JD72 4MGZE 1CIWA 4DZGA 1NLRA 1B09A 2H0BA 3GBGA 4K20A 3BIWE 4NHLA 4L92A 3S7EA 3RG0A 4LR4A 2R49A 2D6KA 4KH9A 1U0AA 2WWSA 1ULDA 2GNMA 4FQZA 2E53A 3T1MA 5KXCA 5KXDA 1QDCA 2B7YA 2RMU3 4S2GA 2WT2A 4LA3A 2WNVC 2RMU1 5JVVA 3HIFA 3M3QA 1YJKA 3DN7A 4HFSA 1MS1A 4IEWA 4GB32 1Z7S3 4UBGA 1MZEA 2YDEA 3MIFA 4NWWA 1DFQA 4XFAA 3OY8A 1Z7S1 1QU0A 4G3YC 3E5QA 1RUG2 2ARXA 2PAKA 3ZN6A 2UYAA 1B35A 1OLQA 1DG6A 1TNFA 3D0JA 4FPFA 3J8F2 4AQSA 1ZRFA 1PGL2 4GH4C 4IEYA 3ZFGC 5KBFA 3DKWA 4YW1A 3ZSLA 4KWKA 2CAUA 4IV1A 3C2UA 1AR63 3O14A 5L7OA 3PJYA 2DTYA 2RHPA 4P9LA 1AR61 2XVKA 1LU1A 3HBZA 3ENRA 2EXIA 2PELA 2JE7A 1G6NA 4FO9A 1LULA 4WV8A 1N3OA 3RMYA 4YZ1A 1RUI2 4HSJA 1OA2A 5D8AB 3EO6A 2CGPA 3SH5A 3TOJA 2ZGSA 3O7OA 1W6NA 3IDCB 4KG0A 3FUOA 3SCHA 1VR3A 3JCIA 4BMEA 2KA3A 1HV0A 4LEJA 4YGDA 2YGLA 1RUOA 3K51A 1A78A 2GC1A 1PVC3 3UJQA 5E1RA 2DVDA 4N7IA 1NXD1 1PVC1 2DVGA 4CEYC 1AR93 1KJRA 3BOPA 5T55A 3IBMA 3I7DA 1AR91 4XBNA 5DUXA 4CYDA 4AI1A 3E5XA 2IXIA 2EIGA 2VPVA 1ASJ2 1R082 5AFBA 2W52A 3BB6A 2BFUS 1AHSA 2GAUA 1GZCA 3IT8A 2YXSA 2YC0A 2WS92 3LA7A 4K6BA 4AI0A 5DUVA 1W6PB 1GANA 1QXPA 1DGLA 2EA7A 1DGWX 1U5ZA 4HKOA 1ENXA 2P3IA 4QGMA 1OQ1A 3DPRC 3VUOA 1HQLA 3H1MA 1Q56A 3R4SA 4GMP0 4C90A 4WM8A 4FBFA 4I0AA 2QE3A 1YJLA 2HEYF 1YFWA 2XB6C 5F1RA 1O3SA 1XNBA 3AJZA 1G86A 5C8CB 1R1A2 5LK5A 3VZKA 4BOWA 4N43A 2KM2A 2C1FA 4X8NA 1J1TA 4XMIA 1POV0 3ZYPA 4S2FA 5E16A 1T6GC 1HRI2 5AVPA 5T52A 5KWRA 4FP2A 1AR83 1RUE3 4JVAA 1PGSA 4AFAA 2HJIA 5JSRA 1AR81 1RUE1 3MW2A 4LO4B 2D7FA 1GZ9A 1YFYA 3UK9A 2VW0A 1N1YA 2OIIA 2GH2A 4B29A 2ZAAA 2DVFA 1NOVA 4ISQA 2ET7A 1Q43A 4BZ4A 2XKPA 3A0NA 2ZBJA 1G7YA 3C3VA 1MS3A 4N9HA 1QOTA 2OPKA 1BEV3 1N3PA 3VBUA 4LBQB 4WVVA 1BEV1 2EAAA 2D6LX 2E63A 1ZRCA 1DZQA 4IEQA 1VJ2A 1ZRRA 2W39A 3OJBA 4XW3A 3J9SA 3WHTA 4AVTA 2H6CA 3HT1A 1RJ7A 2ZGRA 4HK9A 2P2KA 5BNOA 1CAVB 1ZBA3 2AH2A 2PAEA 5BNPB 1ZBA1 5CFDA 3HWJA 5T54A 4XBQA 4XFGA 2VVFA 3PVEA 3M3IA 4XJWA 1JOJA 4KGQA 1Q3EA 3W9AA 1WCKA 2PYTA 5CVRA 2WNUC 3VBRB 4ZU4A 1ND2C 4E2GA 5LK7B 3KT1A 2O8QA 1LGNA 4JDNA 4Y22A 1MEC1 2D5FA 2PHDA 5SV5A 5C4WB 4FAGA 2QFEA 1SLIA 5GZEA 1C57A 2A75A 4OUMA 4HLTA 4ASLA 5AC93 3WCSA 2PFWA 2PN5A 5JOWA 5AC91 3VLBB 2D97A 3AB0A 4AQTA 1ND3B 5CFCC 2GC3A 4MXWA 1AX0A 5C9AB 1O3RA 5JZGA 5KHGA 1YI9A 3GALA 4GA9A 2X8KA 3MI8A 1SDWA 3V64A 1HQNA 1R093 1TE1B 1H8TA 1R091 4DNYA 2XHKA 4CEWB 1FI2A 2W08A 5I91A 4I2OA 5JSPA 4E4ZA 4RR3A 1PO23 3ZMOA 4JGYC 2WT0A 2QNKA 1RMU2 5GZFA 1PO21 5FDBA 4CDWA 2BYVE 3AKRA 1DBNA 4G9SB 1D4M2 2D93A 1V6JA 3JB4C 3ZXEA 5TSWA 1BBT1 3AXDA 1RHI2 4PLOA 1GR3A 5HI0A 4XFIA 3BPZA 1OA3A 2NMOA 3WD5A 5SV8A 4TLFA 1PGW2 3PVOA 4PF5A 5I8YA 1CAUA 3NKTA 2C0ZA 2V5YA 2CNAA 1DYKA 1YHFA 3SH3A 1OOPA 4HL0A 4I30A 4E2QA 3GBFA 3UV9A 2PAMA 4LE3A 3O5SA 4Y20A 2E6VA 3FFZA 4GXLA 4UW5A 3M3OA 4Q26A 1AL0G 4C0BA 1QQP2 3LSDA 3AYAA 4L8QA 2H0VA 5F5QA 3SNMA 1X33A 2CYFA 4QPGC 4RGGA 2BVBA 2GN3A 2XJQA 5GZCA 2PHXA 4XETA 1IS5A 2IXKA 3D0SA 2ZGTA 1OQEA 5KXEA 3EJKA 4WVMA 3UKTA 5J36A 4S2HA 4FTSA 3WVJA 4R9CA 3M8LA 4O9GA 4W6XA 1TMF1 3LA3A 1V70A 2DUPA 1YIFA 4LBLA 2GN7A 1SBDA 2R16A 2HWD3 4C1XA 4XJ9A 1RVF2 4XE9A 1NE6A 3GHNA 2HWD1 4TWTA 1RB8G 3I59A 3PVNA 1C1LA 2A6YA 3VDDA 3VBFA 2JG9A 3AZWA 4A7ZA 2QCSB 2A3WA 4NHKA 1YWKA 2K9ZA 3WOGA 5ACA3 1J3PA 4HANA 5J48A 3ZFFC 1PNGA 2CL2A 3ZSJA 3MICA 4R4ZA 5ACA1 3VKMA 2Y38A 4N53C 3SCFA 3AP5A 1NA1A 4Q4X2 1DZTA 3OGGA 1RUC3 3VBSB 4X6QB 3B01A 1RUC1 1AX1A 3N3HA 2ZMNA 2EXHA 4Q4W2 4QQHA 3ALQA 2NZ9A 5LRRA 1N47A 3WW4A 4R4XA 4I01A 2YV8A 2Q0AA 2JENA 5HBAA 1V9U2 1OLRA 2WFF3 4IEXA 4FPGA 2WFF1 2GDFA 4W65A 5AVAA 4QT6A 3N7JA 1DLLA 1HX6A 4LBJA 4Q0VA 3ZXKA 4ZXKA 3ZN4A 4Z92B 2UY9A 3SMHA 4CDUA 1VRH1 1LGCA 4YFZA 2GMMA 3H3UA 2P3JA 1QQP3 2Q5TA 3JQXA 4LLFA 5BNOC 2PTMA 4LBOA 3CJIC 1D4VB 2HWC2 5BNNB 3ROUA 1H1IA 1CJDA 2XLFA 3ZYRA 3JUUA 1LODA 5IK7A 4H7LA 4RS5A 5CBLA 1ZVFA 4RHV3 5FO7B 3ZFEA 4RHV1 1W6OA 1N3QA 1GZWB 1CESA 3POYA 2RJLA 2ERFA 4K1YA 2LM3A 4Q0UA 3NL1A 3OCPA 1O91A 2VVEA 3QH6A 1WA4A 2A5ZA 4Q8LA 1GQGA 1H4GA 3AMHA 4X6RB 2ZMLA 4M3CA 2VVDA 4M0HA 1AXZA 1MR5A 1GSLA 3ATGA 1FNYA 4M01A 2D43A 1PM7A 4FPJA 5JZGC 4HVQA 4CP0A 1O5LA 1DGRA 1I5ZA 1MZFA 3UKNA 3MPPG 3AP6A 3J4UH 2JKBA 2OW4A 2WQZC 2RS12 4H55A 1WW7A 1H8TC 2HWE3 3AMMA 1ZBE2 3NW4A 2QKDA 2HWE1 2YYOA 2XLGA 1H9PA 2QZ3A 2WL1A 3ZFGA 1UD1A 1OMIA 1RUH3 4I3PA 4DINB 2RS52 4QQ2A 2ZKNA 1H9WA 3OYWB 1RUH1 2OUHA 3M70A 3DUIA 4I0WB 3VKNA 1MS0A 4C1WA 1VBC3 4LO6B 4YVSA 1IS3A 1ULFA 4RQPC 3ZXAC 3E5UA 3LZZA 4HN1A 2VULA 4MX3A 4XOGA 2R042 1N1TA 1R1ZA 1UW8A 2GZWA 4P9WA 4BWOA 1FT9A 1IZ3A 4CDXB 5KC6A 1SBFA 4R9AA 3DV8A 2GU9A 5A32A 3H3ZA 1UU6A 5F6KA 3B94A 4MSVA 3VZJA 2IZWA 4XILA 3KS7A 4ATEA 4CEYA 5BYNA 1NCQB 3FBYA 2CWSA 1AVBA 3N36A 4IV3B 4BIFA 5DZFA 1UKRA 2WT1A 3B3QE 4AHYA 4FT8A 2WSUA 2CAVA 3WZ1A 5JIAA 3WW2A 3ELNA 4RFT0 4ZKTB 5GJ6A 1PVXA 1S0CA 1QGLA 2OZJA 3DF0A 3S7IA 4DY5A 3WW1A 4NR1A 1W2UA 3JBG3 4A2UA 3VBOC 3DPRA 3JBG1 1HXS3 4CZSA 4OI1A 4Z1VA 5JIUA 1ENSA 1HXS1 1S0GA 3FC0A 2XJPA 2HWF3 4N9IA 2Q30A 2XWJB 3P3NA 3MFCA 1EY2A 2HWF1 3VHRA 3VDDC 3VBFC 5FBZA 2UWCA 1AYN2 1XQNA 4YG3A 3HR9A 1W6QA 3RI9A 3UJOA 1IPJA 2DCTA 4OHXA 3RPQA 3ES1A 1FOD2 1S2KA 3MLJA 3H1WA 1LOAA 1GBGA 2R073 4HPKB 3AZVA 1RUF3 4FP3A 2R071 1CONA 4Y5Z0 1FXZA 1RUF1 5CADA 2CWMA 4U36A 2EVXA 5JI7A 4MLOA 4Q27A 2Q1ZB 3VHPA 2DUOA 3QH7A 1A8DA 3N7LA 4SLIA 5J96B 4Y26A 3NAPC 1J3QA 1IKPA 3BOWA 1H0BA 3TN93 2EAKA 2R062 1AX2A 3VZLA 4XXPA 3TN91 4QM9A 2DFBA 3H7JA 1FMD2 4QMAA 4L97A 5T3NA 5FO8B 2X5IA 2RS32 1NZCA 1VBD2 2WIIB 4JGZC 4KU7A 1NCRA 1LOGA 2HKXA 1WCDJ 1TME2 1CPMA 3N7MA 1JN2P 4AGVA 4XJUA 1B35B 3MIDA 5IK4A 2XBO2 1D2QA 4WVWA 4ES8A 3WG3A 2BQPA 3ECQA 1KXGA 3B00A 3I8TA 2E7AA 4IV1B 1ZZBA 5L7OB 2EXJA 1Y3TA 3V65A 4RS5C 3ZIXA 4KNCA 3ZFEC 4HSLA 1I6XA 4YZ2A 5F6LB 5J98B 1QJY3 2GNBA 4JCKA 1QJY1 4ASMB 4WM7C 1YFXA 2D6NA 2Z79A 3MLLA 4P9XA 2TEPA 3GZTB 3OD0A 4O9EA 1PZ7A 4QM8A 2Z5WA 3FBMA 5EZWA 3TNQA 3IPVA 3G7DA 5CFCA 1I3HA 4HT1T 1H1MA 2ES3A 2RM23 1S0DA 4AEDA 2RM21 3AP4A 3EXUA 3O0XA 3LA2A 3APBA 4K9SA 4PDWB 2WC2A 1VAMA 4OI2A 1FOD3 4K1ZA 1DZRA 4TZDA 4A7YA 1QJU2 1EAH3 4B3NA 1C8M3 2LUWA 3MF9A 1EAH1 1V6IA 1C8M1 2D44A 4AGRA 4JGYA 2R0HA 2CV6A 5D1IA 5DUWA 4UW3A 2RR12 4QHBA 3IM0A 1MACA 1I1EA 3R6SA 4XDQA 5JSOA 2VQ0A 1KQRA 2KXLA 3VL9A 4YVSC 5FFOC 2XLAA 3SISA 1UU4A 4WM8B 1HLCA 1V6KA 4HKLA 2I2SA 2O1QA 4HN0A 5FTTC 4WBBA 4QQPA 3WR0A 1RUJ2 4YG6A 4EN9B 1HRV2 1DQ5A 4H14A 4I02A 3LOBA 2VNGA 2ZX4A 3AKSA 4E9KA 4N43B 3PHMA 4AHXA 3M4FA 1CAXB 3MIBA 1RGSA 5KC5A 2BNNA 4L99A 2BNMA 4XF0A 4M3CE 4AYUA 1PK6B 4COZA 4XYXA 4QPGA 1LENA 4R52A 1EV12 1UCXA 1PO12 3WW3A 3HD8B 3FX3A 1O3QA 1QXJA 2UYBA 4YM1A 4XMAA 1YNAA 2ENRA 5BXXA 3MIEA 2DCJA 4Y1YA 3JD73 3MIGA 4NHMA 4LT5A 2Z69A 4D69A 3ZVXA 1XNCA 3JD71 1REDA 3VBUB 4FAHA 5EXOA 2BTVC 1AXYA 2D98A 3WX5A 2PLV2 3NV2A 4W6YA 2TUNA 1FX5A 2OVUA 5T50A 4MGKE 3KGLA 1W6MA 2VY0A 2MEV2 3RYKA 1RUD2 4HK8A 2ZHMA 4L9BA 4OI0A 3CNAA 2GALA 1PMIA 1EYBA 4GB33 1MEC2 3WDYA 3ASIA 4MXVA 3NWKA 2Y26A 3JZVA 4QD2A 5CFDB 4PJYA 4YVWB 4PIYA 1D0GA 3ZFFA 5K0UC 1JH5A 5IUQA 1H30A 1RUG3 4UBHA 4LHLA 1RUG1 4N53A 1AL22 3J8F3 5DUUA 4AE2A 1J1LA 4OLLA 2R1BA 2V09A 1BMV2 4JRAA 3AKPA 2ZZQA 3J8F1 2YGMA 2XUMA 4BA6A 4QXKA 1PGL1 2ZPXA 2TNFA 1VIWB 4UW4A 4BLIA 2XJTA 2ZJCA 3ZSEA 3NVCA 2E51A 2XJSA 1AUYA 1K5MC 3ACLA 4Q2FA 4AEKA 1ENRA 1VBE2 3VBHB 3KZ4C 1RUI3 2VXRA 1QMJA 2IWGB 1RUI1 4MXWB 5KHHA 5J09A 4FPOB 2R6QA 1ULGA 3QCWA 1GLHA 1U5YA 2X5IC 4Q1PA 1UF2C 1DQ0A 1X36A 1QH6A 2MNGA 3IDBB 1VB2A 1NCRC 4HBNA 4M0NA 1BBT2 3VKLA 2VNOA 4IEUA 4M3CF 4DRRA 4COWA 3SH4A 5FQ0A 1RJ8A 1AR72 3V0AA 4FTEA 1QHDA 4BH9A 4RR3B 1Q8QA 5ABJC 4DFSA 3CJIA 4KWLA 4CDWB 4INDA 1ASJ3 1R083 1ASJ1 1R081 3SCGA 3IIAA 1F8VA 3FJSA 5C6CA 1O4ZA 2A6VA 2WS93 4IEVA 2ZX3A 4BCUA 4K21A 1MS4A 4Y24A 3D5OA 5I93A 5GM0A 1WLTA 2A7AA 5GLWA 5IT6A 4HZFA 5HCBA 3WDXA 1CAUB 2AZ5A 1MS9A 3B7MA 1H1AA 5FRAA 3ZYGA 1OOPB 1PNFA 4U2AA 4Q4V2 2IXLA 2W0XA 2ZHNA 4IERA 5FO9B 3PJQA 2JG8B 4GALA 4Y20B 2JECA 4PBPA 5E89A 1G9DA 1XE7A 4BYYA 1GICA 4YW3A 1R1A3 1SCSA 2E9QA 3A0KA 4AEDC 5JDBA 1R1A1 1WD4A 2K0GA 3LWCA 1V00A 4MZUA 1KRIA 4BE3A 1KJLA 1M06G 5CAZA 2JE9A 2B39A 1HRI3 3PLQA 4LUMA 4Q0QA 1WLWA 3TB0A 4KG8A 4CRQA 3H7YA 3QBQA 5CU1A 4IXLA 1H2NA 3H8UA 3P3PA 2BPA2 2WJSA 2FMYA 4WVMB 5HXVA 5BNQA 4AQ6A 4LBQA 4NOTA 4AFDA 1CN1A 1VBB2 2NLRA 4J1WA 3U4XA 3E6BA 3POSA 3V56A 4KBBA 4RQPA 1QNYA 2OA2A 1WW5A 4GKYA 3I59B 1BVVA 4YGEA 3VL8A 3WDUA 1DGRN 3VBFB 3KLSA 3OD4A 4AI3A 1ULCA 2JG9B 1J58A 5FOJB 3TWIA 1FAYA 4P9JA 4C0HA 4QPIC 1S0IA 1COV2 3WNXA 3AZZA 1H4HA 3JB8A 5I0TA 3G6JB 1Z78A 3MPBA 4BIOA 4KGGA 1D2SA 4DXZA 2PHUA 1NA1B 3WUCA 5FREA 4WVZA 1G9FA 3MYXA 1HIXA 1VBA2 3WV6A 4TSVA 3AP9A 1S0FA 2UY8A 5L36A 2IFRA 3ZXDA 1SACA 4AW7A 4CDQB 5JPMB 4OULA 4AVVA 3Q9OA 1Q5OA 3PNAA 1PZ8A 1Y43B 2VMIA 4DS0A 1PIV2 1ND3A 1S1AA 4Q8KA 5HCFA 2JJ6A 3A4UA 5C9AA 4FOWA 1Q8PA 3K48A 3VBOA 1YYNA 2P3KA 4XF4A 3H50A 4F7ZA 1SCRA 1QNWA 4M00A 3RNSA 1SQ4A 4CDUB 1N1VA 1IGOA 2PHTA 3BODA 3OGJA 2YHJA 3INAA 2WZPP 1YI7A 4XTMA 3ES4A 1LHWA 1NQDA 2YY1A 3IN9A 1QJX2 1OD5A 2WZR2 4XIKA 5FLJA 1GYKA 3GNEA 3USUA 5HCAA 1W6OB 1LTEA 2BW8A 1FYUA 3GF6A 2BEOA 1CVNA 5D8AC 4DMIA 4FPYA 3KCXA 3PTYA 1MZ5A 1RMU3 2HWB2 3LB9A 3N35A 3AXEA