4QPGC

Crystal structure of empty hepatitis a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
246
structure length
246
Chain Sequence
MMRNETRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDIAGVQSTLRFRVPWISDTPYRVNRYTKEAHQKGEYTAIGKLIVYCYNRLTSPSNVAHHVRVNVYLSAINLECFAPLYHAMDVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 46
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgC00
5BNNC 3TN93 1MEC3 1HXS1 1QQP2 3IDEA 2RR13 1ND2A 5J96B 1VAKA 5A32A 2RS51 1EAH3 1PGW2 4PDWA 1AR81 1R081 4CEYC 1CJDA 4FTSA 2RR12 1PO13 1QQP3 2RS33 1R093 1AYM2 1ZBE3 2RS12 4N53A 1FOD1 4CDQC 2R062 4NWWA 1EV12 3JB8A 1QQP1 1COV2 1QJY3 1C8M1 1VB4A 5BNPC 1FPN1 1NY72 2XPJA 1VBB1 1HRV3 1AYN2 5C8CC 1NA1C 3VBRB 3VDDA 4CDXC 4GB33 2RMU1 3ZFGA 4QPIC 1RUC1 4RS5C 4GMP3 1AR91 5J98B 1ND2B 5BNNA 3DPRC 1BEV1 1RUF2 1VBD2 1ZBA2 1RUI2 1BBT2 4N43C 3VBUC 2HWD2 4RS5B 3NAPC 4WM8A 1E57A 5C8CB 1CD3G 1AL0G 1NCRA 1VBE1 5AC92 2BBVA 4CEYA 1BEV3 2R073 4GH4C 2WWSA 3ZFGC 4CDWC 4QPIA 1VBC3 2HWF3 1BBT1 2X5IC 1VBC2 1PIV2 2HWF2 3VBSC 2GH8A 4WM8B 3DPRA 2R072 1ZBA1 1VBB3 3VBOA 5AC93 2WFF3 1R1A1 3VBFB 5C9AB 3FBMA 4WM7A 3ZFGB 2HWD3 4N53B 1BBT3 4IV3C 1OOPA 3VDDC 2XBO3 4CDXA 4QPGC 1R091 1POV3 3VDDB 1HRV2 4CEWA 3NAPA 5LK7B 2IZWA 1RUD3 3J8F1 2WZR2 1COV3 1RUE2 1AR93 1EV13 1NCQC 3CJIB 3ZFEC 5CFCA 4JGYA 1AYM3 2Y26A 2RS32 1VBA2 2BFUL 1F8VA 1RMU2 1HRI2 5L7OB 4IV1A 4Q4X1 5C9AC 4YVSC 4RHV2 1NA1B 3VBRC 5ACA1 1R1A2 1RB8G 4PDWB 1B35B 1EAH2 4JGZA 4QPGB 5BNOB 1RUJ1 1ASJ2 4Q4V3 3TN92 5DDJ2 4CEYB 1PO11 4GMP1 1FMD3 1RUG2 2VQ0A 1PGL2 2RMU3 4EJRA 4CDUC 1HX6A 1RMU1 4IV1C 1AUYA 1HXS3 1RUJ2 1AL22 1C8M3 2R041 3VBHB 1B35A 1NCQA 3ZFEA 1TMF3 1BMV1 1A6CA 1VRH2 5L7OA 5BNNB 3S6PA 2WLPA 4CDUB 3JBG3 2HWB1 4Q4W3 4IV3B 3VBRA 5C4WC 1QJX1 5K0UB 1RHI1 2RS53 1AR62 4FTBA 1VBB2 4JGZC 1PO23 2R042 3JD73 3TN91 1TME1 1B35C 1RUC3 1PVC2 5ABJB 1PVC3 1RUC2 2R061 4CEWB 1HRV1 5CFCB 1PO22 1VRH1 5BNPB 1AR71 2RS52 1X36A 4SBVA 2TBVA 2WZR1 4RQPB 1D4M2 1FOD3 1RUI3 1VBD3 1RVF3 1RUF3 4JGZB 1ND3A 3VBHC 4N53C 4GB32 1ND2C 1AYN3 4YVWC 2WS91 1V9U2 3ZXAC 1VBA1 4PDWC 1AR72 5FOJB 4Q4Y3 5BNPA 1RHI3 2HWE2 5JZGB 1QJY2 2ZZQA 1K5MA 1TME2 1DDLA 1FMD2 1RUG3 2RM23 1NCQB 1ASJ3 4Q4V2 3ZFFA 1TMF1 1Z7S3 1PO12 1VBD1 3JB4C 2PLV1 1RUH3 2ZTNA 4WM8C 4AEDA 4AEDB 1HRI3 5C8CA 5K0UA 1RMU3 1Z7S2 4GH4A 1VBA3 3ZFFB 1MEC2 4FSJA 1BMV2 1TME3 1PGW1 1AR92 1RUE3 1V9U1 1RUD2 1QJU1 4GH4B 1RHI2 1QJX3 2HWE3 1NCRC 2FZ2A 4IV1B 1K5MB 1MQTC 2BPA2 4JGYB 4QPGA 5A33A 3LOBA 2XBO2 1IHMA 1OPOA 1D4M3 1FPN2 4RHV1 3JD71 4RR3A 1COV1 2WFF2 4RQPC 3J8F3 3NAPB 1ND3B 4YVSB 5A33B 1OOPC 1POV0 5C4WB 2ZAHA 1AYN1 1NA1A 2HWB3 1PIV3 1C8NA 4JGYC 4RR3B 5D8AA 4CDQA 3JD72 1HQNA 4CDXB 5JZGC 5ABJC 1BEV2 1RUF1 1W39A 2XBO1 1AR63 4YVSA 3J8F2 1QJU3 4RR3C 5A32B 4Y5Z0 5ACA3 4RQPA 1H8TB 1VRH3 1TMF2 1MQTB 5CFDA 2X5IA 3VBSA 5D8AC 4CDUA 1FMD1 1EV11 4N43A 5ABJA 4CDWB 3VBUA 1PO21 4Q4V1 3VBUB 1HXS2 1RUJ3 1M06G 1OOPB 1VBE3 2HWC3 1Z7S1 5DDJ1 4QPIB 4IV3A 2RM21 4Q4X3 4CDWA 4N43B 1POV1 5DDJ3 1ZBE2 1R092 2FZ1A 1NCRB 2GSYA 5JZGA 2HWC1 4GB31 3VBOC 2HWD1 1NY71 4CEWC 1R1A3 4RHV3 1RUH2 4WM7C 1RUD1 2QQPA 1D4M1 1QJY1 2X5IB 3VBSB 2RM22 1RVF1 5CFDC 1VBC1 2HWF1 5CFCC 1RUI1 4Q4X2 4NWVA 3CJIC 3HAGA 1VB2A 2RS31 2WZR3 1AR82 2HWC2 4RFT0 1VBE2 5C4WA 1AR61 5BNOA 4Q4Y2 1AR73 1X33A 1V9U3 1ASJ1 1RUE1 2WFF1 1RUG1 1PGL1 1PIV1 1SMVA 2RR11 1MEC1 5FMOL 1F2NA 1RVF2 4YVWB 1FOD2 1HRI1 4Q4Y1 4YVWA 3CJIA 2BUKA 5C9AA 5ACA2 1H8TC 2WS93 3JBG1 1QJU2 4Q4W1 1RUH1 1R082 2PLV3 3ZFEB 1ND3C 2MEV2 4WM7B 3VBFA 3VBHA 1WCDJ 2MEV3 1GFF2 1ZBE1 1NOVA 2HWB2 3ZFFC 2R043 1QJZA 5L7OC 4GMP0 3DPRB 1R083 2HWE1 2PLV2 4AEDC 4Y4YA 5BNOC 5FMOS 2WS92 1OHFA 3JBG2 4Q4W2 5GKAC 1FPN3 1K5MC 4Z92B 1ZBA3 5AC91 4FTEA 3VBOB 2RS11 4BCUA 2MEV1 2DF7A 2BFUS 4LLFA 2R071 4CDQB 5D8AB 1AL23 1C8M2 1H8TA 1QJX2 1NG0A 1AR83 1AL21 5K0UC 5CFDB 1MQTA 1AYM1 2R063 1EAH1 2RMU2 3M8LA 1PVC1 4RS5A 3VBFC 2RS13
chains in the Genus database with same CATH superfamily
2PHRA 3GBWA 4E27A 1H2MA 4QT6A 1YUDA 2JG8A 1HXS1 5LZ6A 1QQP2 3IDEA 5JCTA 4KMQA 2XJUA 1EAH3 4QKBA 1XPWA 3M3QA 4PIXA 1LHOA 1J58A 3WDTA 3J4UH 2ZHKA 4AI8A 3I59B 4AVSA 2DVAA 2CV6A 5A80A 5T5JA 1OA2A 4CEYC 1IGOA 4FTSA 1H4GA 1SLAA 2RS33 2ZEXA 4HANA 2QTWB 1ULCA 1F9KA 4QQHA 3ES1A 3SMHA 3WD5A 2BRTA 2VNOA 4AEKA 2WNOA 1WW5A 3AZYA 1FOD1 1DU3D 5FP8A 3RZZA 4CDQC 5FR3A 4BQ5A 4KU7A 3ZYJB 4BMBA 1MS8A 2D98A 1P8JA 3B00A 1BCXA 1MZFA 2EAKA 3B9CA 1LHWA 4HG6B 4W6YA 4YZ4A 4C0BA 3ZKUA 1RXFA 2K9ZA 4B29A 5JLVA 2G4IA 3KT7A 3U0ZA 2D6NA 1L7QA 1VBB1 5FYMA 2D6LX 2A5ZA 3WVJA 4HPKB 1W90A 2JE9A 3CNAA 1XNTA 2WLQA 4IEXA 2R1DA 4XDPA 5C8CC 2RMU1 4M4RA 2E7TA 5LBCA 1RUC1 4RS5C 2QDNA 4DUWA 3H0OA 2DCYA 5BNNA 4YG0A 4BQ3A 3DXTA 1BEV1 1RUF2 2F4PA 3DPRC 1A3KA 1ZBA2 5AVAA 2ZZJA 1M4WA 1C4RA 2JB4A 2D5FA 2JDHA 1E57A 2VO5A 5C6CA 1OFSA 4OVEA 4V2VA 4YM0A 5C8WA 3ZDVA 5LY1A 1Y3TA 1AL0G 2J1AA 4W6XA 3SH5A 3H8OA 1X8MA 3HJRA 4GAZA 2YPJA 1BEV3 1XC6A 4GH4C 2FMDA 3DV8A 1XRUA 4FXGB 1VBC3 2HYKA 3DGTA 4IW3A 4MGIE 4OCTA 4FAGA 4DY5A 1GOFA 4UW5A 4O9GA 4WM8B 3TEWA 3B01A 3ATGA 4IEYA 3PUIA 3DPRA 2BNOA 2R072 4W8JA 1C1LA 1VBB3 5FUIA 1YWKA 3R4DB 1NQJA 3S7EA 3VBOA 1O3SA 3HPNA 3PMEA 3W9AA 2WFF3 1XYNA 4K40A 3RG0A 2Y64A 1Z78A 4WM7A 1W9TA 2HWD3 4D69A 1W04A 1BBT3 3ITQA 2QQIA 2WZ8A 4Q26A 2C4XA 4AGRA 3UNPA 4OFGA 4QPGC 4UFKA 5B2GB 4I30A 2Y60A 1O3RA 3DECA 4OZOA 1XB9A 2OPKA 1LEDA 5A7SA 4CVUA 3AL6A 2JJ6A 2XVLA 1W2UA 1J3PA 2VL4A 2QQWA 3IMNA 3GZUC 1IS3A 5L7OA 1SZBA 3ZSKA 1CPMA 4GA9A 4BZ4A 4TTGA 3T0DA 1REDA 1W6PA 2YFUA 1RUD3 3J8F1 3QBQA 2VXJA 4HT1T 4JQRA 3D3AA 3GBFA 2WZR2 3RGBA 1C5IA 3LKJA 4RN5A 3BPZA 3PVBB 2VZQA 2PHLA 3O1TA 2O0OA 3NQHA 1YQ2A 3SHRA 3SKJE 3PTRB 1KRIA 3PVEA 4XUQA 1ENRA 4EZ4A 2EIEA 3POBA 2QZ2A 4JX0A 3ZVXA 2GU9A 2DUOA 5KHKA 3KGZA 3RYKA 1RMU2 1E5IA 5L7OB 4HL0A 4IV1A 4Q4X1 1FNZA 3THDA 2VQUA 5EYXA 3BU0A 1YLLA 3WV6A 2J1SA 5LEKA 3FN9A 2UY9A 1RB8G 2EXJA 4PDWB 1B35B 5FPVA 5GLZA 3IBMA 4P5HA 2YBSA 4PF1A 1JOJA 3KQ4B 2P6HA 5BNOB 3GXUA 5DZGA 2D6PA 3LPFA 4QHOA 3TN92 2XUEA 5DDJ2 2JG9A 2WL1A 5FQ0A 1RUG2 4FPYA 4CCEA 4DRVA 5FXWA 1GUIA 1AX2A 4QGMA 1LOAA 2ZACA 5EPAA 4KBBA 4IV1C 4TYSA 4BIOA 2WSVA 4ES9A 4XFFA 2Q0AA 5FMCA 1RUJ2 1PK6C 2GZWA 1XJAA 4AOCA 2WINB 4YARA 2E31A 1E5RA 4BQ4A 1LU1A 3MLLA 2XKPA 3IB3A 4CCJA 1B35A 1FX5A 1IPJA 1JU4A 1MS5A 1S1AA 4LBQD 1UZYA 5F1RA 1TMF3 2NM1A 2I74A 1GR3A 3OPTA 3V64A 1WCQA 3VKOA 3VUOA 1WLDA 2DVBA 4NAOA 3N4MA 2GH2A 2Y0OA 4KU8A 4PI0A 5C3OA 3SCFA 4KWUA 3HQUA 1W9SA 2LALA 3T2OA 3VDCA 5CBLA 5LA2A 1GMMA 3U75A 3VBRA 4W50A 2W95A 3I7DA 4K8RB 2AACA 4BQXA 2RS53 1DLLA 4BK4A 1ZM1A 2C5DA 4QDQA 4UWDA 5A3OA 2VTXA 5FYZA 1GQGA 4UOJA 3I3MA 2XJRA 4R4ZA 1RUC3 5L36A 4G4FA 1D0GA 4N9HA 5T55A 3U10A 3OD0A 4HXCA 2R061 3I59A 5CFCB 5F5CA 4XUPA 5FY1A 4IESA 2UWCA 4P9LA 4CXXA 1G9DA 4P5YA 1X36A 4AZZA 4K21A 2BP6A 2W1QA 3GALA 4QQ2A 2TBVA 5FXZA 3AFKA 2PN5A 1SPPA 1XYPA 1FOD3 2CAVA 1RUI3 4WVZA 5IK8A 3NKGA 4AEMA 1UCXA 2BGCA 4JGZB 2R7EB 3OBTA 5JXGA 2DTWA 4NAMA 1JYWA 2J7MA 4AI2A 1EP0A 1WA6X 5LA1A 2AEYA 2VECA 1OA4A 2GMMA 4FPGA 3W5NA 5FP4A 4YVWC 1YC61 1V9U2 3D6EA 1J1LA 1VBA1 4ZXEA 5L9RA 4BMEA 3MUY1 2RE9A 1KJRA 4Q4Y3 5FBZA 5A1LA 1AX1A 1OLQA 4XF1A 4IDZA 3RWNA 2OKXA 3BKZA 4LR4A 5IVFA 4N9IA 3AP6A 2Z2SB 1BVVA 5CB7A 1F5FA 3KZ4C 2PELA 1NYWA 1DGLA 5KXBA 2VOVA 2OIIA 1UY4A 1NCQB 3AJYA 3ZFFA 1QGLA 1TMF1 4YW6A 1VBD1 2ZHMA 5JOZA 2D40A 3FJSA 2ZTNA 4WM8C 4NHYA 4X8PA 4AEDA 3NJVA 3O0VA 5FDBA 4AEDB 2JKXA 3LA2A 4XF0A 2Q4SA 3QCWA 2JD4A 5C8CA 5JPMB 2VMDA 4EN7B 4EV0A 4Y33A 1MEC2 5A1AA 4I0BA 2P3KA 1JUIA 3NJZA 4TLFA 1VE0A 1DBNA 5E89A 2HKXA 3U4SA 1W2NA 1CZVA 3A0KA 1UMIA 1H9PA 3LQCA 1PGW1 1CPNA 4HK8A 1RUE3 4ZHNA 1G7YA 2VVEA 2Y38A 2DU1A 1T2XA 1XSQA 1FV3A 4YPJA 4FT8A 5DAXA 1QJX3 4EQVA 2PTMA 5C3RA 3TB0A 4I3GA 3A7QA 1DYPA 1ALYA 3KF5A 4TSVA 3R05A 5IWFA 2Y8KA 2WDBA 2XLGA 4A6OA 2VMGA 4BA6A 4BQ1A 3BOWA 1C5HA 2ZA9A 2V5DA 4FFHA 3VHRA 5T52A 2W3JA 4JGYB 3SEPA 5J7MA 3PVOA 3IWZA 4QPGA 2A7AA 3WOGA 1ZREA 4AVCA 2VQAA 1UAIA 1WMXA 1XXNA 5E6HA 2XBO2 4OI1A 2WO2A 4S2DA 2Y6FA 4PIYA 1D4M3 4K9SA 3USUA 1SLIA 2R30A 2B46X 1DYKA 3ILNA 3K48A 4Y1YA 2VXRA 1O6UA 1BHGA 4RR3A 1CAVB 3MFCA 4RQPC 3J8F3 1ULFA 2RDRA 4CUCA 1S2KA 3AP5A 3B3QE 2ZX4A 5FTTC 3ZYIB 4FI9A 2VCMA 2C26A 2JKBA 4O65A 4ASLA 1URXA 4S2GA 4UW3A 3J7HA 4PJYA 4LMFA 2ZX2A 4K6BA 2LROA 4FXKB 1FXZA 1ZA7A 4C1WA 1GWLA 2QQJA 5APAA 4ZONA 3FLRA 1W39A 5KXCA 3H42B 4EWAA 5FK7A 5CG8A 1JZ5A 4J1XA 4XFHA 3ZSEA 4Y5Z0 2D7FA 4FFGA 5ACA3 4JQTA 4IL7A 2IXKA 1SBDA 1DQ1A 1PK6B 1I3HA 4FPHA 4C90A 2G9GA 1LJ7A 4Q8LA 1SFPA 4XYXA 4BLJA 1L3JA 4L0PA 4L97A 3MYXA 4DEQA 2WAAA 1SFNA 4WVMA 1V6IA 3RZKA 4KG8A 4MYEA 1IS4A 1FMD1 4H7MA 1EV11 1OD3A 3RNSA 4Z1VA 4IUGA 1JYVA 4CDWB 1KXGA 3CMGA 3VBUA 1Y43B 4Q4V1 3W58A 2WNUC 2JE7A 1NZIA 3EQEA 1LHUA 1XNKA 3FHAA 1OT5A 2CL2A 2BEOA 2HEVF 1UWWA 4A3ZA 3FL7A 1LNSA 1YNAA 3P5BA 4Q2FA 2O8QA 4CP0A 4XXAA 5F2SA 2VZ3A 2Q1ZB 1ENQA 2W9XA 4ZS3A 2RM21 4MADA 1W2AX 3PNAA 2FCTA 2XL7A 2BGPA 2IXLA 3KV4A 5GZEA 5IVCA 1R092 2FZ1A 2O1QA 3LD8A 4LKFA 1W8UA 2GSYA 5JZGA 1HQLA 4B4RA 5IW0A 5C33A 3DYOA 3FLTA 5FZOA 3OGGA 4B7EA 4CXWA 5F3GA 3B69A 5I91A 1JZ4A 1R1A3 2IXJA 3OOXA 1RUH2 3ELNA 3LDKA 2BOIA 5F8PA 3WY6A 4Z8BA 1D4M1 2ZPXA 3AP7A 4NIAA 3MIBA 4I01A 2W2IA 2VY0A 2ZGKA 2DUPA 5FPAA 3OCPA 1US2A 4HOOA 4K20A 5HCFA 1BK1A 5CFCC 1HB1A 4CUAA 1QJFA 4NWVA 1GSLA 3MGUA 3OEBA 3WNXA 2VMHA 3I97A 4PI2A 4I3PA 4MLOA 2RS31 5F37A 4QPYA 3BTAA 3RSJA 4RFT0 1W6PB 4IE6A 4C8DA 3AMQA 1K42A 5J37A 2G9FA 5BY5A 4UYBA 1ASJ1 5K8SA 3DYPA 3G7DA 4UFJA 2R1BA 1RUE1 3RFRA 4ONUA 4XBLA 4CRQA 3CIHA 2NQYA 1LKNA 4FPJA 1RIRA 4LO8A 2ATFA 2EIBA 3S7IA 1QNWA 3AX4A 3KCXA 5FMOL 1RVF2 2IFWA 4COWA 1JYTA 2A75A 3GGLA 4GIQA 1MPXA 4ITCA 2ET1A 5ACA2 1STMA 5E1RA 4Q4W1 1ODNA 3KCCA 5B4XA 2QCSB 3F2ZA 2VZPA 3JU9A 4M3CE 1OSGA 3WP6A 5FPZA 3VHOA 3Q9OA 4ZU5A 2JDPA 1W9WA 4CP9B 1WCDJ 2MEV3 1GFF2 2R49A 3ZFFC 4LBLA 2R043 5IJRA 3NWKA 4WV8A 5D21A 1W6OA 1ZNPA 3DPRB 5L19A 2P1BA 2XHNA 1R083 2HWE1 2VQTA 3AB0A 2P17A 2QQOA 3C7OA 2PYTA 5FZOB 3ETPA 3WF4A 2Z5WA 2DCTA 3PU8A 2WSUA 1PZ9A 2XH6A 3B5LB 4G9SB 1PM7A 4WVWA 3WF1A 2ADEA 3T0AA 4A7KA 1J84A 3WG1A 1LOBA 4ATFA 3MPPG 5FZ1A 2CY6A 5FYHA 2XXZA 4BQWA 4B1MA 4XJ9A 2JG8C 2ZXQA 4BXFA 2BFUS 2WC2A 1LTEA 4LLFA 2BYVE 3NV3A 3WNNA 3T0BA 4AWDA 5I0SA 1AL23 1CWPA 4FFIA 5FZBA 5IFPA 1CX1A 1H8TA 3CDZB 3SC7X 2EIGA 4QKNA 1QJX2 1RJ8A 3K77A 2DDUA 4PQ9A 3THTA 4BOWA 1NG0A 1IS5A 2E32A 1MR5A 1YI9A 2AGSA 5CFDB 1MQTA 3UGGA 4Y20A 5HCHA 3AKSA 1W6QB 4OYUA 2R063 4PHZA 4AVTA 2RMU2 5F9TA 4AHYA 2WO1A 3ZOIA 4Y22B 2YYOA 2CWSA 2RS13 2N7GA 3NRUA 3ZR6A 1MEC3 2ZX0A 3WUDA 3ZSJA 1KEXA 2TEPA 4IEZA 2RR13 5J96B 4R9BA 2FDKA 3OGVA 5A32A 1ZZ6A 1AHSA 2RS51 5FXXA 4WZCA 3DCQA 1PGW2 2P3JA 2YY1A 1UZZA 1XOYA 4IGPA 2PQQA 5F2WA 3BN6A 3QLQA 3WQ1A 4XHXA 4CUGA 3TEZA 3RJ2X 2WBKA 2HEYF 3I2JA 1W8HA 1JI6A 3ZMOA 2PHTA 3WHTA 2AR6A 3HBZA 1AYM2 3AP4A 3AZWA 5EJZB 3D5OA 3MW3A 3ZYGA 4JC1A 4N53A 3VV1A 4E8CA 3RYPA 5B4NA 4NWWA 3EBRA 4NHXA 3CEWA 1X82A 4ES8A 1COV2 4BLIA 1G8WA 1IQAA 4H7LA 4R52A 3VHPA 2OPWA 1W8WA 1W8FA 5SV8A 4W6WA 4INDA 5H9PA 1F15A 2WRAA 1NY72 1LR5A 3ZXDA 4UXAA 1UF2C 1NLSA 3D0SA 5FMDA 1HRV3 5IFTA 2I45A 2VZSA 2H0VA 4XQWA 4CDXC 1W99A 3VHNA 2JD9A 4QPIC 5EJ1B 1UKRA 3L2YA 5IK5A 3KWVA 1AR91 3MLJA 3O1UA 1C3HA 1ND2B 1W8TA 4HONA 4DQAA 4NR1A 1I5ZA 3BCWA 3E5QA 1RUI2 4N43C 1NX9A 2UY8A 1POQA 2B39A 1CAWB 2ZGSA 4QX1A 2V4AA 3POJA 1W0NA 1ULGA 3BGAA 4ZU4A 5C8CB 4QWNA 1NLRA 4R9DA 1CD3G 3RS6A 3LE0A 5IK4A 4Z2AA 1VBE1 2WNEA 5CIRA 4QM8A 5AC92 3KSCA 4CEYA 3E6CC 2VZUA 4LBQA 5FY9A 5CA6A 2WWSA 5BV6A 2HLEA 4QGLA 5F39A 3H1YA 1RYYA 4XJAA 2HWF3 4E4ZA 2HWF2 1PIV2 2E7AA 1MVEA 3MICA 5F3CA 5FZFA 5HXMA 4FPKA 1US3A 1IQDC 4XACA 3I54A 4RGAA 4LA3A 3ZM8A 3WSOA 5AC93 4LIUA 1YFXA 3CO2A 2XJQA 4CCDA 3FC0A 3IN9A 3VBFB 3T3YA 3FBMA 3ZFGB 1FYUA 3PJYA 3Q8AA 3AMPA 5EWSA 4CDXA 5A3LA 4XJWA 2P5BA 3FHIB 3SQOA 4TWTA 1AVBA 3I2FA 3T09A 3AM2A 1R091 1WCSA 3O0XA 5FZ4A 4A7YA 5H9QA 4NHMA 4YFWA 4QMAA 4TLGA 2XVGA 3TBDA 3AP9A 2K0GA 1CIWA 4GJZA 3RZMA 3WG4A 1XNBA 1VR3A 3VDDB 1X8EA 3LEGA 4AL9A 1V6JA 1HRV2 4CEWA 2CNAA 1NKGA 1OXCA 3FMGA 4CCOA 4QX3A 5CYYA 4EWEA 2ZBJA 5LK7B 1A78A 1SLLA 2BQPA 1GNZA 3WNOA 1CR7A 2WNUB 4CU8A 3MIDA 1HV1A 5JOYA 1COV3 1ZYBA 3INAA 3OG2A 2A6ZA 3DUIA 4L92A 5JXJA 5FO9B 4H14A 2YGMA 4AVVA 3Q8BA 3ZFEC 1X9PA 1AYM3 1V6MA 3H7YA 3LB9A 4LHNA 4XCAA 4A45A 3OB8A 4Y4RA 1UYZA 5EIYB 1HRI2 4BIFA 4OQ8A 1QDOA 4YVSC 2D6OX 4XIKA 4IEUA 5LA9A 2WUHA 2JDMA 4FP3A 3V0AB 1MVQA 3ZYFA 3KM5A 1GLHA 1UL9A 4Q0VA 4KWJA 5F5QA 1ASJ2 2Y0IA 3N35A 1YJLA 3LIHA 4Q4V3 1VAMA 4CEYB 1PO11 3R4UA 1NXD1 1OA3A 4J1WA 4D7TA 1AJOA 1FMD3 2C9KA 5E88A 4DPNA 3P6BA 2RMU3 4EJRA 1AXZA 4PBPA 3P3PA 3WCSA 3S0MA 1RJ7A 1CAXA 3LCPA 1VAVA 1DGWA 4EE2A 2DFBA 1H0BA 1R64A 1IPSA 1Q56A 2A3YA 2P34A 2WFPA 1RMU1 3ILFA 4META 1DZTA 2K46A 5J3UA 1AUYA 4CSWA 1WLTA 1Y7BA 2X05A 1AL22 5LRSA 1ULPA 1Y9MA 3THCA 2JDYA 2A6VA 1O59A 2JDZA 2WWJA 4DXRA 4YLZA 1VMJA 3V0AA 1NCQA 2ZAAA 1XU2A 4U2AA 4K1ZA 5AFEA 3TEXA 3WHUA 3A21A 1A34A 1BMV1 3BOPA 3AYCA 5F3IA 3T08A 2W94A 2ORZA 3SKVA 1Q43A 1JS9A 2P3IA 4XURA 1GOHA 2OUHA 3WG2A 1KDMA 5EZWA 5C4WC 3PHMA 5K0UB 2ET7A 1JZ2A 1AR62 1VBB2 4CCMA 4D6RA 2VGDA 2JG9B 1X9TA 2R042 2B8MA 2IVJA 4JHZA 5JXHA 1PVC2 4QXCA 2W39A 5ABJB 2VJXA 2KR2A 4OHVA 4PIZA 4FQZA 4DO0A 4CEWB 2B42B 1UW8A 1JUHA 1PO22 1YRZA 2LTNA 1VRH1 4XZUG 4HKOA 1D2SA 1AR71 1U5ZA 2D97A 4DUVA 1QOTA 4P14A 1W8ZA 2VUAA 4A3XA 1JZ6A 2WZR1 5GM0A 1F4HA 2CSGA 3AXDA 2VBPA 3ST7A 1CVNA 3I3QA 3LSEA 2VNGA 4MXWB 5T50A 2V72A 1UU5A 2P3YA 1RVF3 1RUF3 4LNVA 5ANQA 5KXDA 2CTVA 1ACCA 1EY2A 4ASKA 3H50A 3N9QA 3VBHC 4KWKA 2GC0A 4OULA 1F4AA 4HVRA 4LO6B 3WNMA 2CGNA 1ND2C 3B9IA 3EMRA 2YG0A 5FY4A 5E16A 2DVFA 5LY2A 4OI4A 5A1FA 3OYWB 3RZLA 1OUXA 4E2QA 2UURA 1CZTA 4NRMA 4Q29A 3PMSA 2L9LA 5FOJB 2X53S 2IXCA 3ZYPA 1RHI3 3H8RA 1TQ5A 3W20A 1LESA 3M2MA 3NNLA 4LBQB 4AGGA 3NVCA 1LAJA 3MF9A 1ULDA 5EHDA 2YZ4A 1OQ1A 1PX4A 3VD5A 1SCSA 4XFCA 3B93A 1T6GC 1TME2 1LGCA 1REEA 1YFYA 5DXDA 3KS7A 3URFA 3MW4A 5FZLA 1VP6A 5LBBA 5HCBA 2GNDA 5DMYA 2IWGB 5C3PA 1Z7S3 4GWMA 3WINE 4IEPA 3WT3A 2YXSA 1QY4A 1RUH3 1WWYA 4M01A 2YC4A 3WDXA 1PMIA 3M3EA 5C7GA 5K9YA 5FMBA 4XJUA 3M3OA 3PIJA 2A3XA 1W6NB 4PBOA 3SEEA 4LE3A 2XWJB 4A44A 5FO8B 1G9FA 1Z7S2 3CHXA 1OMIA 1VBA3 3PTYA 2ZGUA 4NIIA 1JZ3A 1CGPA 4MHRA 5T3NA 4MGTA 1UQXA 3TYJA 5KBFA 1YEWA 4XEZA 3I2HA 3FWEA 1V6LA 1TME3 2RG4A 4BYYA 2CGOA 1AR92 2PAKA 3MIGA 1Y4WA 2J1UA 4NRPA 4Q0SA 1IOAA 4XFGA 2OVUA 5C5TA 2IC1A 4XW3A 1WCUA 1QJU1 1RHI2 3T2TA 2YFZA 2VG9A 1GOGA 5FK8A 3TEYA 2ENRA 5T5OA 1RXGA 4AAXA 2FQPA 3ZIXA 1Y9GA 4IV1B 5IYYA 3J9SA 1K5MB 3KV5A 2MNGA 1G9AA 1ZRCA 1MQTC 4EYUA 3LOIA 2X10A 1YO8A 1F35A 1CESA 2HBUA 2G19A 5FLHA 2EVXA 4JV4A 1GU3A 2YHJA 3JXSA 3S30A 1JHJA 1SHWB 2BGOA 3U78A 1ZZCA 2FDHA 1DQ4A 1OPOA 4H55A 3VZLA 4UAPA 1FPN2 2ETEA 3KV9A 4RHV1 2C0ZA 1S0JA 2D3SA 4LKDA 3UKTA 2V73A 3VZMA 2PAEA 4LHKA 1UXZA 4JVAA 1KS5A 4JKLA 2UU8A 1JU3A 4Q0UA 1OOPC 1POV0 3SISA 2QBXA 2DCKA 1YIPA 1N1VA 4K7JA 4Z82A 2EICA 5BNQA 1C8NA 3W21A 4QHBA 5D8AA 4LUMA 1HQNA 2VTXJ 5JZGC 4MH0E 4RD7A 4A42A 3KVAA 1CQ9A 2XBO1 1AR63 2YPDA 3HMYA 4Y1VA 1E5HA 1RTVA 3I2GA 1JZ7A 3J8F2 1LHVA 1K45A 4GKXA 3X29B 3ZYRA 2WYFA 1WW6A 1DYOA 4YWAA 1NXMA 3K4AA 5FREA 3I2KA 4CXYA 3BIWE 1TNRA 1WBLA 3DEMA 3NV4A 4U36A 3IPVA 5A3MA 4K3UA 1IZ3A 2A6XA 2W47A 4N8MA 1Q8OA 5EYYA 2WJSA 4DNYA 4FPCA 2X5IA 3VBSA 4IEOA 5CU1A 4B4QA 3HNBM 5D8AC 2HBTA 4QQLA 3AZZA 3N3HA 3BPSA 1CX4A 1N3OA 1S0GA 2QFEA 3AYDA 5F6LB 2PHWA 5J48A 1UX6A 5FWEA 3GM8A 3VBUB 4QHZA 2EAAA 3N9LA 4PCRA 4CCKA 2JDAA 1SG3A 1XNCA 5FZ3A 1JZ8A 1XU1A 2HWC3 5A7PA 3HT2A 4OI2A 2RJKA 1W6QA 2ZGOA 3SLIA 5DDJ1 5IAVA 4ZKTB 3AVSA 3W5MA 1DGWX 5JI9A 4Q4X3 4YW2A 2VW0A 2JG9C 2CHHA 4LTAA 1BK0A 1N1YA 3KVBA 4ASMB 2NYYA 3CL1A 1POV1 1RITA 1QJEA 5C5UA 1ZBE2 2WR9A 4XJZA 5FY0A 1GQHA 1UO9A 2VU9A 2Y6HA 1NCRB 1ZRRA 4P00B 1UU6A 4GB31 3USSA 4BPZA 2LW8A 1D0HA 3AMNA 1JXNA 1NY71 4CEWC 1H2KA 4AHWA 4AVBA 4HKLA 1JBCA 3EXUA 4URTA 1PK6A 5FXVA 4D0QA 1UXXX 4WM7C 4CUBA 1RUD1 4LOTA 2QQPA 2B9VA 2ZGRA 5A7QA 2YBPA 4F7ZA 3NKTA 4XIOA 1N3PA 1UIJA 5IAXA 3E1F1 4FCAA 4ZZ8A 3QD6A 1W05A 5FP3A 5G04L 4P02B 1F31A 2P2KA 1YYNA 2K2SA 1W9YA 2Y6KA 3OTFA 5CFDC 3MZHA 4XUNA 1Q8SA 4Y1ZA 3AVRA 3CJIC 5IK7A 1SCRA 1VB2A 1PMJX 2WNUA 1K5JA 4L9BA 3N7KA 1VBE2 1W28A 3OUIA 4Q4Y2 1NE4A 3TNPB 3APBA 1ZRIA 1YQ5A 1V9U3 2ZGMA 3I3EA 4LLOA 1C57A 4KBZA 1GZWA 2WFF1 4YZ2A 4QD2A 1VJ2A 1PGL1 1KQRA 2OQ7A 1PIV1 4A41A 2RJLA 2BWCA 5GLUA 4FBFA 3N7MA 1JODA 4UBHA 3M1HA 4M0HA 1QH6A 4LO4B 1F2NA 2VW1A 1XE8A 4Y1XA 1V6NA 2W87A 4YW1A 2B45X 3WQ0A 5CKNA 1FOD2 2LRPA 3LPGA 3ZSLA 4FOQA 4FOYA 3CJIA 4R9AA 2DV9A 3AYEA 4CYDA 3KCYA 2RJ2A 3JBG1 2CYFA 4XABA 1OF3A 1QEXA 2NN8A 2VOTA 4PT6A 2WQ8A 4M3CB 2PLV3 4XF3A 3T4HB 2QQMA 3OBAA 2KXLA 3RMXA 4KQ7A 2AH2A 3UGHA 3ZIWA 2NP0A 2QNKA 2B7YA 3IM0A 4M3CF 1W6MA 3VBFA 1TNFA 4ARXA 4FPFA 4ZPIA 5FUPA 2C1FA 2RDNA 3V56A 1PNFA 1Q8PA 3RI9A 1ZBE1 1NOVA 2DBNA 2HWB2 4LUKA 4CU7A 5L7OC 2IUWA 4GMP0 3ZR5A 2WN2A 2PLV2 2UYBA 1HN0A 4BISA 5A3PA 4IGOA 1XYOA 5BNOC 1AX0A 5FMOS 4Y20B 3TWIA 2OS2A 3FUOA 4E4SA 3VB9A 5KHGA 5CAZA 3E5UA 4I0AA 4A6SA 5GKAC 1BQPA 1K5MC 4A2UA 4AQSA 5IVJA 1KJLA 5JVVA 3C7GA 4DUXA 4MGYE 4JZRA 1VIWB 1UNBA 4EN8B 5DZEA 2W52A 3DYMA 1OVSA 2KD7A 5JDBA 2QUOA 4BCUA 4KL1A 1UD1A 2GP5A 2WNVA 1QNYA 2VBBA 1SFYA 2BNNA 2EXHA 3C3VA 2VCBA 2Q30A 3LFIA 4CDQB 1S0IA 2XKOA 3DN7A 4XAEA 3JCIA 5FWJA 3SITA 4N7UA 2Q1FA 4Y5SA 1ONAA 1QMJA 4P9JA 3SCGA 4XXPA 3EHKA 4MO3M 5A7WA 1JYXA 4QPWA 1ST8A 4BXSV 1EAH1 2BTVC 2UWBA 4LKSA 3VBFC 1IPKA 4NUBA 5BNNC 3GCWA 1E5SA 1N1TA 3TN93 2Q8DA 3KQRA 1IS6A 4Y24A 1VAKA 3JQWA 4QB2A 4AGVA 2A1XA 2CDPA 3IMMA 1OVPA 3WZ1A 4ARYA 1RUOA 4I2OA 1S2BA 4PDWA 3BALA 3GJBA 4OUEA 4DS0A 4UFIA 1AR81 5L9VA 4XDQA 5A3NA 1TEIA 3HQXA 5FZ7A 2ZOEB 1CJDA 2PHFA 1UN1A 1PO13 2PHUA 2RR12 3BTYA 3RPQA 2W1UA 1ZBE3 2ILMA 2VOXA 2RS12 4QX5A 2ZJCA 3LFMA 5F3EA 5CEHA 4LQRA 4AFBA 4KH9A 3WXPA 4RSUA 2R062 2D6KA 4IE5A 3LEIA 4HN0A 4QX2A 5FRAA 1QQP1 3HIFA 3LDBA 1QJY3 5KHJA 4AEJA 1ZA4A 4XAAA 1LOFA 5BNPC 1FPN1 4MGKE 2XPJA 1AXKA 1GANA 3MIHA 3O1OA 1JOPA 2WKKA 4LK6A 1N1SA 1NA1C 3VBRB 2D3PA 2QQUA 2XJTA 3JZVA 5LBFA 2FDGA 2MPFA 1JYIA 3SH4A 1UOGA 2Q8EA 4GMP3 5J98B 5FCCA 3K4DA 3RJRA 1X50A 1OLMA 2YC0A 1CIYA 1VBD2 1CN1A 3ZLIA 1BBT2 5FJHA 3VZOA 5C71A 3HNMA 4QQOA 3LAGA 3VBUC 2HWD2 4RS5B 3NAPC 4WM8A 2VMCA 2GC3A 3O1VA 3K3NA 4UT5A 1EUTA 2GNTA 1KFUL 4KGGA 1YXWA 1O7FA 5BXXA 1O8SA 2V09A 5FYVA 1OLRA 4QX0A 4CTEA 1QDCA 2AREA 4AI1A 1Q5OA 3GZAA 5FZAA 4AI0A 2R073 3ZXFA 2ZGLA 4GQ7A 2J1EA 4Y3OA 1LHNA 4L8QA 5FZCA 2UWAA 3ZFGC 3LEKA 3WNPA 4JKKA 2G9ZA 4QPIA 4QKFA 4AQ6A 2X5IC 1VBC2 3VBSC 1PMHX 2PMWB 1UY1A 3PJQA 4MXVA 1ZBA1 3KMHA 3KD4A 4QU2A 5DUXA 2WO3A 3THPA 2JB8A 5A6YA 4KI5M 5BUVA 4LORA 2UYAA 2JX9A 3GF6A 5A3WA 3VLBB 4OUMA 5C9AB 3SH3A 1XSRA 5JIAA 4N53B 3O1PA 2XL9A 3CJXA 4LBJA 4XHBA 3FFQA 2I2SA 3UT0A 2E33A 2D6MA 5I8TA 1S0CA 4CCLA 3MBWA 2H6CA 1POV3 4NOTA 3VGIA 3OEAA 4M00A 5EFUA 3ROUA 1UYYA 3FBYA 2H0BA 5IVEA 2WT0A 3N9MA 4Z07A 4E4HA 3IIAA 1GZTA 1N47A 2Y6JA 4MXWA 3W59A 1W9FA 2IZWA 1LGBA 4TXWA 5IVVA 2JIJA 5SV5A 4Q8KA 2E6VA 3I4IA 2XB6C 3H9AA 4YNIA 3HBKA 4D7YA 2X29A 2AZ5A 3VL9A 4LBOA 1AR93 2VMIA 4O9EA 5DUWA 3CJIB 1U12A 5AVPA 2JXAA 2RS32 1VBA2 5FPBA 2HJIA 4D3WA 1F8VA 2VUJA 4RL7A 2XDVA 4XC9A 1DF0A 5C9AC 4YW5A 4Q1PA 1R1A2 4YM3A 4XFIA 1EAH2 2ARAA 2SBAA 2W1SA 3DKWA 2A3WA 4JGZA 5FLIA 1BYHA 1NAEA 3WQ7A 4QPGB 4IE7A 2CU5A 1YQCA 3VKFC 2WQ4A 2JG8B 3VZKA 4AK3A 3WP3A 1PGL2 4LE4A 3VZNA 2YB7A 4QXBA 3L9JT 2R6QA 3HVDA 4CDUC 1S4CA 2WO7A 3ACHA 3K51A 3LA3A 5FP7A 1HX6A 1PNGA 1OFNA 3EB7A 5LB6A 4YGCA 2VUDA 2VMFA 4DXZA 5GZGA 5FY5A 2VVDA 1C8M3 1SLTA 2XG3A 4G3YC 1ZZBA 3VBHB 4MGZE 1LGNA 3MF6A 4QXHA 5C3SA 2R0FA 4FPLA 3AMMA 3ZFEA 4NVPA 1OC1A 1CAUB 5LRRA 2ZEZA 4OZXA 2WT2A 2ZKNA 2BWAA 4MUVA 3T2PA 3S6PA 5BNNB 1N3QA 2GALA 5EQUA 1I9RA 4HMZA 2WLPA 3QH6A 4CDUB 5FZIA 3JBG3 2HWB1 3HWJA 3MV11 3VKLA 1G86A 4AI3A 5FYTA 1LULA 3K75B 4IV3B 2ERFA 2Q8CA 3OPZA 3RMYA 1JYNA 3DXUA 1HDKA 5F6KA 2OZ6A 3ZN4A 1S0DA 3HEIA 3AFGA 1GBGA 1LENA 1R1ZA 4FTBA 1UY2A 3ORJA 4JGZC 1VMHA 4XVHA 4HZFA 1VALA 2VD7A 4NO4A 1PO23 3H1WA 3MHZA 3ZPYA 3VDAA 5JWPA 1TME1 3GZEA 4XJ8A 3VD3A 3VD7A 1PVC3 1D2QA 4D6QA 2YMZA 4LOSA 1XBFA 1NZCA 3MI8A 1LOGA 4FFFA 5IATA 4CU9A 4CP2A 4OQ9A 1KITA 2B5HA 1HB2A 3J7NA 3AKPA 4E2SA 3WDWA 3T1MA 2O14A 2PA7A 1D4M2 4GJYA 3LDRA 2JE8A 1T6BX 5FYCA 2R32A 3ETQA 1ND3A 2A6WA 2X09A 5T5PA 4A4AA 3A22A 1MZ6A 3KLSA 3WDUA 1UU4A 4GWJA 1LCLA 1YCIA 4GB32 2WQZC 1LU2A 3S5QA 4AE2A 3WDVA 1AYN3 1EPZA 2WN3A 4PLMA 3ASIA 2ARBA 4NIHA 3NNFA 2Q8OA 1O4ZA 1KGYA 1LOEA 3PL0A 3FFZA 4AQ2A 4EZHA 5JZGB 2DVGA 5DAVA 1GWKA 3KV6A 3EYPA 2ZZQA 1W3XA 2GC1A 5F5AA 3BTXA 1O3QA 1LECA 1HN1A 3HN3A 2IFRA 1FMD2 3H3UA 1WCKA 3ON7A 4HN1A 4NN0A 1EYBA 4NRQA 1K3IA 3MPBA 4W65A 1I1EA 3AK0A 1ASJ3 3DKQA 4Q4V2 3UJQA 2BVVA 2WNVC 4B3NA 2ES3A 3JB4C 5L9BA 1XE0A 2CAUA 2GN7A 3PUAA 4C0HA 4COVA 2JICA 1HKDA 2FCUA 2P37A 4Y5TA 5LATA 4NHLA 5I0RA 1Z0HA 2VULA 3WUCA 2AENA 4YGDA 1VRBA 2AC1A 1ULEA 1DIWA 1HRI3 3OY8B 3HOBA 3D0JA 4GXLA 4HETA 1UZ0A 4P08A 3WCRA 3ZFFB 1V70A 3FZ3A 4FSJA 3FHQA 3Q8FA 3WLUA 5I0TA 1BMV2 5FPLA 4FQ4A 2C6SA 4COZA 1UPIA 2ZGTA 5JSPA 2XLAA 3K2OA 5GLTA 5KHIA 1W03A 1DLCA 5FYIA 4COUA 2WZPP 2WABA 3NO8A 5FY8A 5HPOA 4Q0QA 4NMIA 4GH4B 1NCRC 3H1MA 2FZ2A 2W68A 1ENXA 4UW6A 4HSLA 2EIDA 3GYDA 5FQ0B 5LEJA 2P6CA 5T54A 3AXEA 4V2WA 4AFDA 1REFA 1OBNA 4XF4A 2DU0A 4N7IA 3ZPOA 1MZ5A 1U5XA 4J6GA 2OA2A 1IHMA 2VZVA 2X8KA 3Q8CA 5CVRA 1GWMA 2VMEA 1I5PA 1MS0A 1WMFA 2PHDA 1H6XA 3JD71 3UK9A 2GMEA 3LWCA 3NAPB 1ND3B 4WVVA 5CADA 1XQNA 3WW4A 3AKRA 2E26A 5C4WB 3B7MA 2ZAHA 4A7ZA 1AYN1 2DVDA 4O7XA 2Q1MA 1PIV3 2V4VA 4JGYC 1DQ2A 3CLPA 2F4LA 4CDQA 2NPIA 1UX7A 4XZPA 4CDXB 2VNVA 3OUJA 4Y22A 4QB1A 5DUVA 5ABJC 3VD9A 1OLME 3JUUA 4RA0A 3J7MA 1KD7A 5KC5A 2PQSA 1QU0A 3POYA 4H2AA 3SNMA 1D7PM 3D8CA 2GMPA 4YVSA 5C3QA 3M70A 3WF2A 1O3TA 1QJU3 3CQOA 5A32B 4ZXKA 2ZGQA 3F95A 4AFAA 5IVBA 2LUWA 5M0TA 2JENA 4RQPA 5JUVA 2VW2A 3GBGA 3O7OA 4OHWA 3WNKA 1DFQA 1H8TB 4C1XA 2J1VA 5CG9A 3E6BA 3MDPA 4XQ4A 1S0EA 3POGA 3GZTB 4S2FA 4CPBA 1TMF2 2YC2A 4MHUA 4EROA 1MQTB 1LB2A 4DZGA 5CFDA 2BJSA 3C7FA 2DUQA 3GHNA 3N9OA 4CDUA 2QQVA 5JI7A 5ABJA 2Y6LA 3BUCA 1PO21 3V0BB 1LEMA 1RUJ3 2VBDA 1CAUA 1OQEA 1M06G 4OMCA 3VN4A 2VAUA 3O5SA 1QIQA 1Z7S1 2FHRA 4QPIB 4X8NA 4LO7A 1ODMA 1UOJA 4UI9L 4N43B 3CZJA 3LA7A 3LIGA 1OKOA 3C7HA 4LHLA 5DDJ3 3WR0A 3S57A 3ZDSA 1OD5A 4IE4A 2HWC1 2P4EA 3ZN6A 5LASA 1J3QA 3VBOC 3ZO0B 2XVKA 4FP2A 1LRHA 3OF1A 2Z4FA 3U11A 5IUQA 2EF6A 4AF9A 4E2GA 1HIXA 5JMCA 1W3VA 4BB3A 2NLRA 3EO6A 2ZHLA 3KT1A 3R4SA 5JPNB 1DQ0A 1WGPA 1QJY1 4V1PA 4DEVA 4M4PA 2RM22 3CKHA 1HB3A 2TNFA 3MIEA 1HJFA 1O91A 5G05L 1RVF1 2FDJA 2HWF1 3OSDA 5GZFA 1CAXB 3R6SA 3UKVA 5JSOA 1G9BA 3BYWA 4OUSA 2W91A 3HAGA 3MW2A 1QXRA 1UZVA 4XUOA 2WZR3 4HVQA 1UPSA 5LW9A 1W2OA 1WMDA 5JAXA 3OD4A 1UY0A 4BQYA 4JCKA 1AR61 2VZOA 3RWKX 1V00A 1IKPA 2JDKA 4LT5A 1FT9A 1AR73 2B4KA 2IXHA 2V5YA 1X33A 4JHTA 4HSJA 3PUQA 2BOJA 1GKBA 2ARXA 4Z2WA 1X7NA 2R0HA 4IQPA 5K7PA 3U4XA 1ZRDA 4E9KA 4M3CA 3LGRA 4F3JA 4IEWA 1UZWA 1HJGA 1PGSA 4JKMA 2Y6GA 1QOSA 1WW4A 5EV7A 3PVNA 3KHCA 5LA0A 1RGSA 3ECQA 3WQBA 4YVWB 4AYUA 1HRI1 3HR9A 4Q4Y1 3OBRA 4XBQA 2BUKA 1Q8VA 3ACIA 5FAXA 5A7NA 4AR2A 5C9AA 5FJKA 1BJQA 2YU1A 2YU2A 1QJU2 1WMEA 3NNGA 1R082 2EXIA 1V6KA 2GNBA 3ZFEB 1XNDA 5HV4A 1NQDA 5KC6A 3BODA 5CKMA 3GNEA 2MEV2 4WM7B 1GNYA 4AW7A 3IDAA 2A70A 3VBHA 1SQ4A 4NPMA 1LODA 3Q8EA 1O4YA 1W6NA 2XJPA 3RZHA 4NPRA 2XMLA 5GZCA 5DG2A 5D2AA 3B94A 3A0NA 3E6DA 4QDRA 4CA9A 1V6OA 3RVHA 1WBFA 4J25A 2PAMA 4FVVA 4EWDA 4DFSA 4LIVA 2W46A 1GICA 2VNRA 4AEDC 2LS6A 2DCZA 3N7LA 2J42A 3NNJA 4P9WA 4YM2A 1OHFA 4YG6A 5T5LA 4Q4W2 2ZX1A 4XMAA 5FO7B 5I8YA 4LPLA 4AI9A 1SEFA 1W8OA 1XE7A 1ZBA3 4R9CA 5FZMA 5FY7A 2ZCWA 3O1RA 2FDFA 4LK7A 3N7JA 4XCBA 4FPEA 2LM3A 2RS11 1JMUB 4EN6B 3WX5A 3VKNA 2RV9A 1HV0A 2XQRA 4GWIA 2ZKLA 2JECA 2R16A 1HLCA 2DF7A 3C2UA 2R071 1VMFA 5D8AB 2Z42A 3OYWA 3H8XA 3O12A 4UF0A 1ZZ8A 4ISRA 4P9YA 3ZXJA 3RRDA 4DB5A 5IVYA 4JTNA 5KHHA 1AL21 5K0UC 3WF0A 4N90A 1YI7A 3B02A 5I93A 1AYM1 2GP3A 1H2NA 3UV9A 4BDVB 2HH9A 3M8LA 1PVC1 4HFSA 1UOBA 3ZYBA 4BM8A 2ZGNA 1O8PA 4RYDA 4GD4A 3ZSMA 4UFHA 1MZEA 2QQNA 4BJ0A 3J26N 1ND2A 4MGSA 4WBBA 5GALA 2E7QA 4HK9A 1YHFA 1W6MB 3MO4A 1C1FA 3CBNA 5DN2A 3TOJA 1CJPA 4JAAA 5FYBA 2CGPA 5EXOA 3PDQA 4JTOA 1PVXA 5KWRA 1R081 2GN3A 1U5YA 1WZXA 3IPVB 4LKEA 4YG3A 1TG7A 4AHXA 1QQP3 4I09A 4X6QB 1RC6A 1L7RA 1R093 3OGRA 1O5UA 1ZRFA 1GZWB 4QB6A 1QXPA 4NPLA 1EV12 2DFCA 3CZUA 3PURA 4XMIA 4DRRA 3JB8A 1BZWA 3H3ZA 1SPPB 2A6YA 3RZGA 1C8M1 5AFBA 2OT7A 4YZ3A 2OXBA 4RGKA 1VB4A 3JQXA 4F83A 1YQ6A 4SLIA 3MFAA 4AHZA 1AYN2 1Q8QA 1O4TA 2ZEWA 2VZRA 3VDDA 4GB33 3ZFGA 4FOWA 4YSFA 1CZSA 1H1MA 2JEMA 1ZX5A 5ISLA 4HLTA 1SACA 2ZS6B 1G6NA 2D3RA 2OYZA 1RUNA 2JDUA 1WLWA 4JDOA 3WF3A 5J36A 2YUEA 1QH7A 5FUNA 4B4PA 1H30A 1GP4A 3QACA 1UIKA 3ACGA 5CZKA 2I07B 2XJVA 3OY8A 3NL1A 4H3WA 1LOFC 1NCRA 1SDDB 3QH7A 5EP9A 1D4VB 2BBVA 3PIGA 1LOCA 3WEZA 3O1MA 3BI3A 2DTYA 3BU7A 4LBNA 2VR4A 4CDWC 4HPKA 1BBT1 2XUMA 2D44A 2GH8A 1W2TA 4BK5A 2J22A 3HD8B 3AJZA 1MS9A 2OW4A 3AZVA 3IDBB 4ORFA 5DUUA 5GJ6A 5LK5A 4P9XA 3UJOA 3WG3A 4DXTA 4AFMA 3AC0A 2YBKA 4MGQA 2C24A 5FZ9A 3RZJA 1R1A1 5GLWA 5HBAA 3IZOA 4MV2A 5E8AA 1YJKA 4JRLA 4YFZA 4QXKA 2Y33A 3O14A 4CCNA 2BERA 4IV3C 1OOPA 3VDDC 2XBO3 3NMBA 2DURA 5FYUA 1H1AA 3NNMA 1IG3A 1WKYA 2JWPA 4Q27A 1OH3A 1PX3A 2XQXA 2VM9A 4YM1A 5FKBA 4L99A 2WA3A 3NAPA 2ZHNA 1OURA 4Q0PA 2ARCA 2BVBA 1IG0A 5LBEA 5JOXA 3ZN5A 4NIDA 2XR4A 3RYRA 1ZVFA 3H8UA 2BBAA 2DBIA 3USUB 1RUE2 1QHDA 4JRAA 4RGGA 1EV13 2J1TA 5FZ6A 4COYA 1NCQC 1WD4A 3RI8A 2Z69A 4QKDA 4YGEA 2VCCA 5CFCA 4JGYA 2D93A 5FIXA 2Y26A 2W1WA 1FI2A 3ACLA 3MLKA 4L11A 3ZXEA 5F7UA 1JTZX 2BFUL 3L2HA 4PF5A 4UBGA 4RHV2 5DQ0A 4YYOA 3U07A 3AMHA 1JHNA 1NA1B 2XLFA 5FLJA 4W4ZA 3N36A 3VBRC 3VZJA 5ACA1 4CP1A 1G9CA 3TNQA 5A70A 3CU7A 2VE1A 4AG4A 1C28A 2E63A 5J09A 1OQDA 5D1IA 2VC9A 1RUJ1 5FZDA 1KDKA 2NMNA 4QGNA 4GMP1 3BTZA 2F17A 1TVGA 2VQ0A 4DXSA 4ISQA 3T4VA 3H3LA 4D7SA 2GC2A 3LZZA 3IDCB 2FMYA 5A6XA 4R4XA 2G1MA 3KT4A 3M7AA 1RL3A 3UETA 5A6QA 4GKYA 1V0AA 3A4UA 3DL3A 1HXS3 4QX7A 4B1LA 1GP6A 1DHKB 3POFA 4ATEA 1DQ5A 4CU6A 2R041 4AQTA 4LO5B 1UY3A 5K4LA 4YW3A 3UL2A 1QXJA 4PLNA 3TAYA 3ME2A 3A23A 1W06A 1WUVA 4YRDA 1UOFA 5GZDA 5BPXA 2D5HA 1MS3A 5A3UA 2FD8A 1A6CA 1VRH2 1BVP1 2BU9A 2DYCA 2XOMA 3H7JA 4KG0A 2HYXA 4Q4W3 4Y1UA 1DGRN 3NJXA 4B8EA 1OF4A 4RFRB 4IXLA 4DMIA 2PFWA 1QJX1 2VZTA 1A8MA 4LEJA 4LHSA 1MS1A 1NT0A 3UGFA 1RHI1 4GZ9A 4Q1RA 5GLVA 3VDBA 4XE9A 2XGXA 4S2HA 1GNHA 2QJVA 4XUTA 3WW3A 4BE3A 3MV01 1H8VA 2W0XA 3JD73 3TN91 1GZCA 1B35C 2AYHA 4DINB 3BVCA 3WW2A 1UYXA 1WA4A 1RUC2 1HRV1 4QM9A 4NHKA 1H1IA 5CNAA 5LCWL 4YW4A 5FBJA 5FZGA 5LWBA 1BKZA 4XDOA 2H6BA 3WNLA 5BNPB 1H6YA 3UYJA 3VKMA 2RS52 3T1LA 4OHYA 3HQRA 4SBVA 2YDEA 3EJKA 2NMOA 2RVAA 2ID4A 4XPVA 3HT1A 4XETA 2VTFA 4RQPB 4F8AA 2ZMNA 5DAPA 2MHFA 1KS4A 1VBD3 2F6BA 2B9UA 3NSTA 4X6RB 4DIQA 3BIEA 2IXIA 3HN1A 2WZEA 3BB6A 4N53C 4UFMA 4C91A 4AVAA 1BLZA 2QVSB 3N9NA 5DAQA 4OLLA 5EJ3A 3O0WA 5FYYA 3OPWA 2WS91 5A6ZA 4IEVA 4TZDA 1HB4A 3ZXAC 1S55A 4PDWC 1AR72 1QOOA 2ZABA 3SXWA 2QZ3A 5BNPA 1GZ9A 1AF9A 2HWE2 1ULOA 2JDNA 3D82A 1J3RA 1JOBA 3KHBA 5FYSA 1WD3A 3I2DA 1MS4A 1QJY2 2BW8A 3WDYA 3PUHA 3ALQA 1K5MA 3ACFA 1F5JA 1RUG3 3FX3A 4QAWA 4CZSA 2RM23 3FUQA 2EALA 5FZEA 3FLPA 5ANNA 1PO12 1APNA 2QKDA 3I49A 2PLV1 2WIIB 4BQ2A 1JW6A 4AXOA 4CE8A 2FDIA 4JDMA 2BV4A 2QQLA 4QX8A 3ZXKA 3NV2A 1OPMA 3UESA 1H4HA 1HQWA 1YFWA 4NJ4A 5FZKA 3I3BA 5K0UA 3D4KA 1RMU3 5C70A 1DZQA 2ZMKA 3M4FA 4GH4A 3V65A 4ZY9A 3IKWA 4LA2A 4L2NA 3OUHA 5DZFA 2ORXA 4YGBA 4DY3A 4BWOA 1W0OA 3ZXLA 4MOAA 2AUYA 1SBEA 4XBNA 2VH9A 2WA4A 1PHMA 4UW4A 1V9U1 2VOWA 2FCVA 1RUD2 3I2IA 3LSDA 1DGRA 1NE6A 1YFUA 2HWE3 2XONA 2ZEYA 3S5AA 5HXVA 1K12A 3G6JB 1QF3A 1SLBA 2XWBB 3POEA 2EA7A 4NROA 2WAOA 5F32A 2BPA2 2ZX3A 5FZ8A 3KB5A 4MZUA 3P1IA 5DABA 1FNYA 5A33A 3T2QA 3LOBA 4KGQA 5JIUA 1J59A 3K3OA 1GP5A 2VCAA 5I8SA 1CAWA 2VPVA 3NJYA 2RHPA 3AKTA 1COV1 1YIFA 2WFF2 2VOKA 1Y9QA 3J7LA 3OJBA 5A7OA 4HBNA 1DZRA 4WZFA 3PLQA 4YVSB 5A33B 5TSWA 3U37A 2RDQA 4IETA 5IT6A 1WLCA 1NA1A 2HWB3 1FATA 1YQ8A 3RDIA 5JMOA 5FOBB 2SLIA 1U0AA 4RR3B 2Z79A 4I0WB 3JD72 5JR7B 3IAQA 1IKQA 2FBEA 4PLOA 4Q5OA 1H2LA 1BEV2 1RUF1 1OH4A 1QWRA 2ZMLA 4R8HA 4FPOB 3ZKYA 4K8FA 1CONA 1EPWA 4RR3C 1Q3EA 3ZN6B 2A71A 4EN9B 5H9RA 1RINA 1DDLA 4GULA 1UMZA 2BDRA 4GWNA 5I0DA 1FAYA 5I0UA 1B09A 4YW7A 5JR2A 5DAWA 1VRH3 1VPHA 3ILRA 2A73B 4YZ5A 3OGJA 3NV1A 1I6XA 2Q5TA 2XHKA 3POSA 3MIFA 2WNVB 4TN7A 5A7WB 1DCSA 1UYPA 2YGLA 4N43A 1UMHA 2TUNA 2YROA 3NW4A 4D94A 4I02A 4ET7A 3E97A 1HXS2 4BU2A 3T30A 4MVTA 4AFCA 4LXLA 1KFXL 1OOPB 1QKQA 1VBE3 4P9GA 2E53A 2EXKA 2O8OA 3TRSB 2RDSA 4D6SA 1XNAA 3CF6E 2C9AA 2IVIB 1SLCA 2W92A 4CCCA 4NIGA 3ENRA 2GNMA 4LBMA 1GYKA 4IV3A 3VL8A 4O61A 5JSRA 4OMDA 4CDWA 1FV2A 2JIGA 3C7EA 5F5IA 2OUJA 3OBZA 2HEWF 4E4DX 2AEZA 4K1YA 3AZXA 5FPUA 3IT8A 1SDWA 4XTMA 3GHMA 1O5LA 1OI6A 3POIA 5DG1A 3DF0A 2QE3A 3WP5A 4DOUA 2HWD1 3R0RA 2WWUA 1AJKA 5JOWA 4KNCA 3POWA 4XF9A 4RHV3 3K4ZA 2BNMA 3GJAA 1AZDA 1S0BA 3PU3A 4Y26A 3ZMNA 3ZX7A 2GAUA 4LJHA 2XJSA 4ZZ5A 1JN2P 4QU1A 2E51A 2Y34A 3AYAA 2BZDA 3MUZ1 2X5IB 1DP0A 3VBSB 2DWRA 3IAPA 4PQQA 4ZS2A 1GQPA 4IEQA 5KR7A 1VBC1 3UKNA 1RUI1 4Q4X2 1OKQA 2PXJA 1J1TA 1CAVA 3VD4A 4XOGA 5H9SA 4HVOA 5HI0A 1AR82 1DG6A 2HWC2 5DPNA 1W0PA 4XFAA 4NE9A 5FV3A 5C4WA 4MG2A 5BNOA 4FAHA 2OX0A 3HNYM 3M3CA 2OZJA 2D43A 1WW7A 2DCJA 4OHXA 1L7LA 4LULA 1RUG1 4JDNA 1JYCA 2W5FA 5HV0A 5CISA 1SMVA 2RR11 2VVFA 1MEC1 5A3TA 3GCXA 2VZ1A 5FZ0A 1PM4A 1W8NA 4ZU7A 4XILA 2WT1A 3C8XA 5FP9A 4AAPA 5J1XA 1GV9A 4YVWA 3QOPA 3PUSA 4GALA 5L73A 2ZGPA 3N9PA 1EUUA 1H8TC 1TZOA 2WS93 3WW1A 4MX3A 4QQPA 4IE0A 3SCHA 2VUCA 3IIIA 3AKQA 4FOVA 2CWMA 1RUH1 4BH9A 1OUSA 2CDOA 3M3IA 2W08A 4OI0A 4P9IA 3OGSA 3WP4A 1ND3C 4MSVA 2ADDA 3ZXGA 3U14A 1BXHA 3I3DA 4KWLA 3I8TA 3LF7A 3ES4A 3I2OA 1PZ8A 1S0FA 3K46A 3V0BA 1U5IA 2E9QA 4D8MA 4YZ1A 4M0NA 1J83A 4XQDA 1QJZA 4LITA 4UF0B 1NUKA 2J1RA 5FKCA 3ZYHA 1HW5A 4BHPA 1ENSA 1UKGA 2KA3A 4WVMB 3RQ0A 1JH5A 4Y4YA 3U1XA 3E5XA 3LEMA 3MEPA 2WS92 3KF3A 4LBKA 3O1SA 3JBG2 1PZ7A 4EN0A 5KXEA 1FPN3 3AL5A 3P3NA 4XFBA 2KM2A 5HCAA 5AC91 4Z92B 2WYSA 5IHRA 3GDBA 4FTEA 1VLNA 4HKWA 3VBOB 1S2EA 1NLQA 2OQ6A 2NZ9A 2MEV1 1SBFA 4IGQA 4URAA 1ZZ7A 4IERA 5FZHA 3KGLA 1A8DA 1C8M2 2QDRA 4UFLA 1ZZ9A 4B7KA 1AXYA 1W6OB 1H9WA 3FE5A 4XTPA 5CKQA 5BYNA 1DQ6A 4OHZA 1AR83 3ABZA 4E8DA 4QDSA 4CP9A 2GDFA 1TE1B 4RS5A 1MACA 2QQKA 4FO9A 2PHXA 5FFOC 4CPBD 5FPXA 5ERLA 2YV8A 5JXIA
chains in the Genus database with same CATH topology
2PHRA 3GBWA 4E27A 1H2MA 4QT6A 1YUDA 2JG8A 1HXS1 1QQP2 3IDEA 5JCTA 2XJUA 1EAH3 3M3QA 4PIXA 1LHOA 1J58A 3WDTA 3J4UH 2ZHKA 4AI8A 3I59B 4AVSA 2DVAA 2CV6A 5T5JA 1OA2A 4CEYC 1IGOA 4FTSA 1H4GA 1SLAA 2RS33 4HANA 1ULCA 1F9KA 4QQHA 3ES1A 3SMHA 3WD5A 2VNOA 4AEKA 1WW5A 3AZYA 1FOD1 1DU3D 3RZZA 4CDQC 4KU7A 3ZYJB 4BMBA 1MS8A 2D98A 3B00A 1BCXA 1MZFA 2EAKA 3B9CA 1LHWA 4W6YA 4YZ4A 4C0BA 2K9ZA 4B29A 3U0ZA 5JLVA 2G4IA 3KT7A 2D6NA 1VBB1 2D6LX 2A5ZA 3WVJA 4HPKB 2JE9A 3CNAA 5C8CC 2WLQA 4IEXA 2R1DA 2RMU1 2E7TA 1RUC1 4RS5C 2QDNA 3H0OA 2DCYA 5BNNA 4YG0A 1BEV1 1RUF2 2F4PA 3DPRC 1A3KA 1ZBA2 5AVAA 2ZZJA 1M4WA 1C4RA 2D5FA 1E57A 5C6CA 1OFSA 4OVEA 4YM0A 5C8WA 1Y3TA 1AL0G 4W6XA 3SH5A 1X8MA 2YPJA 1BEV3 4GH4C 2FMDA 3DV8A 1XRUA 4FXGB 1VBC3 2HYKA 3DGTA 4MGIE 4FAGA 4DY5A 4UW5A 4O9GA 4WM8B 3B01A 3ATGA 4IEYA 3DPRA 2BNOA 2R072 1C1LA 1VBB3 3VBOA 1YWKA 3R4DB 1NQJA 3S7EA 1O3SA 3PMEA 3W9AA 2WFF3 1XYNA 4K40A 3RG0A 1Z78A 4WM7A 2HWD3 4D69A 1BBT3 4Q26A 4AGRA 4OFGA 4QPGC 5B2GB 4I30A 1O3RA 2OPKA 1LEDA 2JJ6A 2XVLA 1W2UA 1J3PA 3IMNA 3GZUC 1IS3A 3ZSKA 1CPMA 4GA9A 4BZ4A 1REDA 1W6PA 4HT1T 1RUD3 3J8F1 3QBQA 4B3NA 4JQRA 3GBFA 2WZR2 1C5IA 3LKJA 3BPZA 3PVBB 2PHLA 2O0OA 3SHRA 1KRIA 3PVEA 1ENRA 3ZVXA 2QZ2A 2GU9A 2DUOA 5KHKA 3KGZA 3RYKA 1RMU2 5L7OB 4HL0A 4IV1A 4Q4X1 1FNZA 5EYXA 1YLLA 3WV6A 5LEKA 2UY9A 1RB8G 2EXJA 4PDWB 1B35B 5GLZA 3IBMA 4P5HA 1JOJA 5BNOB 2D6PA 3TN92 5DDJ2 2JG9A 2WL1A 5FQ0A 1RUG2 4FPYA 1AX2A 4QGMA 1LOAA 2ZACA 4KBBA 4IV1C 4TYSA 4BIOA 2WSVA 4ES9A 4XFFA 2Q0AA 1RUJ2 1PK6C 2GZWA 2WINB 4YARA 1LU1A 3MLLA 2XKPA 1B35A 1FX5A 1IPJA 1MS5A 1S1AA 4LBQD 5F1RA 1UZYA 1TMF3 2NM1A 2I74A 1GR3A 3V64A 3VKOA 3VUOA 3N4MA 1WLDA 2DVBA 2GH2A 2Y0OA 4KU8A 3SCFA 2LALA 5CBLA 3VBRA 3I7DA 2RS53 1DLLA 1ZM1A 2C5DA 1GQGA 2XJRA 4R4ZA 1RUC3 5L36A 4G4FA 1D0GA 4N9HA 5T55A 3U10A 3OD0A 2R061 3I59A 5CFCB 4IESA 2UWCA 4P9LA 1G9DA 1X36A 4K21A 3GALA 4QQ2A 2TBVA 3AFKA 2PN5A 1XYPA 1FOD3 2CAVA 1RUI3 4WVZA 5IK8A 3NKGA 4AEMA 1UCXA 2BGCA 4JGZB 3OBTA 2DTWA 4AI2A 1EP0A 2VECA 1OA4A 2GMMA 4FPGA 4YVWC 1V9U2 3D6EA 1J1LA 1VBA1 4BMEA 2RE9A 1KJRA 4Q4Y3 5FBZA 1AX1A 1OLQA 4XF1A 3RWNA 4LR4A 4N9IA 3AP6A 2Z2SB 1BVVA 5CB7A 1F5FA 3KZ4C 1NYWA 2PELA 1DGLA 5KXBA 2VOVA 2OIIA 1NCQB 3AJYA 3ZFFA 1QGLA 1TMF1 1VBD1 2ZHMA 5JOZA 2D40A 3FJSA 2ZTNA 4WM8C 4X8PA 4AEDA 3O0VA 5FDBA 4AEDB 3LA2A 4XF0A 2Q4SA 3QCWA 2JD4A 5C8CA 5JPMB 4EN7B 4EV0A 1MEC2 4I0BA 2P3KA 1JUIA 3NJZA 4TLFA 1DBNA 5E89A 2HKXA 5DZGA 3A0KA 1H9PA 1PGW1 1CPNA 4HK8A 1RUE3 1G7YA 2VVEA 2Y38A 2DU1A 1FV3A 4FT8A 1QJX3 2PTMA 3TB0A 4I3GA 4TSVA 1DYPA 1ALYA 4BA6A 3R05A 2XLGA 4BQ1A 2VMGA 3BOWA 1C5HA 2ZA9A 3VHRA 5T52A 4JGYB 5J7MA 3PVOA 3IWZA 4QPGA 2A7AA 3WOGA 1ZREA 4AVCA 2VQAA 1UAIA 1XXNA 2XBO2 4OI1A 4S2DA 4PIYA 1D4M3 4K9SA 3USUA 1SLIA 2R30A 2B46X 1DYKA 3ILNA 3K48A 4Y1YA 2VXRA 4RR3A 1CAVB 3MFCA 4RQPC 3J8F3 1ULFA 1S2KA 3AP5A 3B3QE 2ZX4A 5FTTC 3ZYIB 2JKBA 4ASLA 1URXA 4S2GA 4UW3A 4PJYA 2ZX2A 4K6BA 4FXKB 1FXZA 4C1WA 3FLRA 1W39A 5KXCA 4EWAA 5CG8A 4J1XA 4XFHA 3ZSEA 4Y5Z0 2D7FA 5ACA3 4IL7A 2IXKA 1SBDA 1DQ1A 1PK6B 1I3HA 4FPHA 4C90A 2G9GA 1LJ7A 4Q8LA 4XYXA 4BLJA 1L3JA 4L97A 3MYXA 1SFNA 4WVMA 1V6IA 4KG8A 4MYEA 1IS4A 1FMD1 4H7MA 1EV11 3RNSA 4Z1VA 4CDWB 1KXGA 3VBUA 3W58A 1Y43B 4Q4V1 2WNUC 2JE7A 3EQEA 1LHUA 1XNKA 2BEOA 2CL2A 2HEVF 1YNAA 4Q2FA 2O8QA 4CP0A 4XXAA 2Q1ZB 1ENQA 2RM21 3PNAA 2XL7A 2IXLA 5GZEA 1R092 2FZ1A 2O1QA 2GSYA 5JZGA 1HQLA 4B4RA 5C33A 3FLTA 3OGGA 4B7EA 3B69A 5I91A 1R1A3 2IXJA 1RUH2 3ELNA 4Z8BA 3WY6A 1D4M1 2ZPXA 3AP7A 3MIBA 4I01A 2VY0A 2ZGKA 2DUPA 3OCPA 4K20A 5HCFA 1BK1A 5CFCC 4NWVA 1GSLA 3MGUA 3WNXA 2VMHA 4I3PA 4MLOA 2RS31 4QPYA 3BTAA 3RSJA 4RFT0 1W6PB 3AMQA 5J37A 2G9FA 5BY5A 1ASJ1 5K8SA 3G7DA 2R1BA 1RUE1 4ONUA 4XBLA 4CRQA 2NQYA 1LKNA 4FPJA 1RIRA 4LO8A 2ATFA 3S7IA 1QNWA 3AX4A 3KCXA 5FMOL 1RVF2 2IFWA 4COWA 2A75A 4GIQA 4ITCA 2ET1A 5ACA2 5E1RA 4Q4W1 3KCCA 2QCSB 3JU9A 4M3CE 1OSGA 3WP6A 5FPZA 3VHOA 3Q9OA 4ZU5A 1WCDJ 2MEV3 1GFF2 2R49A 3ZFFC 4LBLA 2R043 3NWKA 4WV8A 1W6OA 1ZNPA 3DPRB 5L19A 1R083 2HWE1 3AB0A 2P17A 2PYTA 2Z5WA 2DCTA 2WSUA 1PZ9A 2XH6A 3B5LB 4G9SB 1PM7A 4WVWA 4A7KA 3WG1A 1LOBA 4ATFA 3MPPG 2CY6A 4XJ9A 2JG8C 2BFUS 2WC2A 1LTEA 4LLFA 2BYVE 3NV3A 4AWDA 5I0SA 1AL23 1H8TA 2EIGA 1QJX2 1RJ8A 3THTA 4PQ9A 4BOWA 1NG0A 1IS5A 1MR5A 1YI9A 2AGSA 5CFDB 1MQTA 4Y20A 3AKSA 1W6QB 2R063 4AVTA 2RMU2 5F9TA 4AHYA 4Y22B 2YYOA 2CWSA 2RS13 2N7GA 1MEC3 2ZX0A 3WUDA 3ZSJA 2TEPA 4IEZA 2RR13 5J96B 4R9BA 5A32A 1ZZ6A 1AHSA 2RS51 4WZCA 1PGW2 2P3JA 2YY1A 1UZZA 2PQQA 3WQ1A 3QLQA 4XHXA 3RJ2X 2HEYF 3ZMOA 2PHTA 3WHTA 2AR6A 3HBZA 1AYM2 3AP4A 3AZWA 3D5OA 3MW3A 3ZYGA 4JC1A 4N53A 3VV1A 3RYPA 4NWWA 3EBRA 3CEWA 1X82A 4ES8A 1COV2 4BLIA 1G8WA 1IQAA 4H7LA 4R52A 3VHPA 5SV8A 4W6WA 4INDA 5H9PA 3ZXDA 1NY72 1LR5A 4UXAA 1UF2C 1NLSA 3D0SA 1HRV3 2I45A 2H0VA 4XQWA 4CDXC 3VHNA 4QPIC 1UKRA 3L2YA 5IK5A 1AR91 3MLJA 1C3HA 1ND2B 4DQAA 4NR1A 1I5ZA 3BCWA 3E5QA 1RUI2 4N43C 2UY8A 2B39A 2ZGSA 1CAWB 1ULGA 4ZU4A 5C8CB 1NLRA 4R9DA 1CD3G 3RS6A 5IK4A 1VBE1 2WNEA 5CIRA 4QM8A 5AC92 3KSCA 4CEYA 3E6CC 4LBQA 5CA6A 2WWSA 5BV6A 4QGLA 3H1YA 4XJAA 2HWF3 4E4ZA 2HWF2 1PIV2 2E7AA 1MVEA 3MICA 4FPKA 3I54A 4RGAA 4LA3A 5AC93 1YFXA 3CO2A 2XJQA 3FC0A 3IN9A 3VBFB 3FBMA 3ZFGB 1FYUA 3PJYA 3AMPA 5EWSA 4CDXA 5A3LA 4XJWA 3FHIB 4TWTA 1AVBA 3AM2A 1R091 1WCSA 3O0XA 4A7YA 5H9QA 4NHMA 4YFWA 4QMAA 3TBDA 2XVGA 3AP9A 2K0GA 1CIWA 3WG4A 1XNBA 1VR3A 3VDDB 1X8EA 1V6JA 1HRV2 4CEWA 2CNAA 5LK7B 3FMGA 4EWEA 2ZBJA 1A78A 1SLLA 2BQPA 1GNZA 1CR7A 2WNUB 3MIDA 1HV1A 5JOYA 1COV3 1ZYBA 3INAA 2A6ZA 3DUIA 4L92A 5FO9B 4H14A 2YGMA 4AVVA 3ZFEC 1AYM3 1V6MA 3H7YA 3LB9A 4LHNA 1HRI2 4BIFA 1QDOA 4YVSC 2D6OX 4XIKA 4IEUA 4FP3A 3V0AB 1MVQA 3KM5A 1GLHA 1UL9A 4Q0VA 4KWJA 5F5QA 1ASJ2 2Y0IA 3N35A 1YJLA 4Q4V3 1VAMA 4CEYB 1PO11 3R4UA 1NXD1 1OA3A 4J1WA 4D7TA 1AJOA 1FMD3 5E88A 4DPNA 2RMU3 4EJRA 1AXZA 4PBPA 3P3PA 3WCSA 3S0MA 1RJ7A 1CAXA 3LCPA 1VAVA 1DGWA 2DFBA 1H0BA 2A3YA 1Q56A 2P34A 3ILFA 2WFPA 1RMU1 4META 1DZTA 5J3UA 1AUYA 1WLTA 1Y7BA 1AL22 5LRSA 2A6VA 2JDZA 4YLZA 3V0AA 1NCQA 2ZAAA 1XU2A 4U2AA 4K1ZA 5AFEA 3WHUA 1BMV1 3BOPA 3AYCA 1Q43A 2P3IA 2OUHA 3WG2A 1KDMA 5EZWA 5C4WC 3PHMA 5K0UB 2ET7A 1AR62 1VBB2 2VGDA 2JG9B 2R042 2B8MA 1PVC2 2W39A 5ABJB 4OHVA 4PIZA 4FQZA 4CEWB 2B42B 1UW8A 1JUHA 1PO22 1YRZA 2LTNA 1VRH1 4HKOA 1D2SA 1AR71 1U5ZA 2D97A 1QOTA 4P14A 2VUAA 4A3XA 2WZR1 5GM0A 3AXDA 3ST7A 1CVNA 3LSEA 2VNGA 4MXWB 5T50A 4LNVA 1UU5A 1RVF3 1RUF3 5KXDA 2CTVA 1EY2A 3H50A 3VBHC 4KWKA 2GC0A 4OULA 4HVRA 4LO6B 2CGNA 1ND2C 3B9IA 5E16A 2DVFA 4OI4A 3OYWB 4E2QA 2UURA 4Q29A 3PMSA 5FOJB 2X53S 2IXCA 3ZYPA 1RHI3 1TQ5A 1LESA 3M2MA 4AGGA 4LBQB 3NVCA 3MF9A 1ULDA 2YZ4A 1OQ1A 1SCSA 4XFCA 3B93A 1T6GC 1TME2 1LGCA 1REEA 1YFYA 5DXDA 3KS7A 3URFA 3MW4A 1VP6A 5HCBA 2GNDA 2IWGB 1Z7S3 4GWMA 3WINE 4IEPA 3WT3A 2YXSA 1QY4A 1RUH3 3WDXA 4M01A 5K9YA 1PMIA 3M3EA 4XJUA 3M3OA 2A3XA 1W6NB 4PBOA 4LE3A 2XWJB 5FO8B 1G9FA 1Z7S2 1CGPA 1OMIA 1VBA3 3PTYA 2ZGUA 5T3NA 3TYJA 5KBFA 4XEZA 3FWEA 1V6LA 1TME3 4BYYA 2CGOA 1AR92 2PAKA 3MIGA 4Q0SA 1IOAA 4XFGA 2OVUA 2IC1A 4XW3A 1QJU1 1RHI2 3T2TA 2VG9A 2ENRA 5T5OA 2FQPA 3ZIXA 4IV1B 3J9SA 1K5MB 2MNGA 1G9AA 1ZRCA 1MQTC 3LOIA 1YO8A 5FLHA 1CESA 2EVXA 4JV4A 2YHJA 3S30A 1ZZCA 1DQ4A 1OPOA 4H55A 3VZLA 1FPN2 2ETEA 4RHV1 2C0ZA 1S0JA 2D3SA 3UKTA 2V73A 3VZMA 2PAEA 4LHKA 4JVAA 1KS5A 2UU8A 4Q0UA 1OOPC 1POV0 3SISA 2DCKA 1YIPA 1N1VA 4K7JA 4Z82A 5BNQA 1C8NA 4QHBA 5D8AA 4LUMA 1HQNA 5JZGC 4MH0E 4RD7A 1CQ9A 2XBO1 1AR63 3HMYA 4Y1VA 1RTVA 3J8F2 1LHVA 4GKXA 3X29B 3ZYRA 1WW6A 1NXMA 5FREA 3BIWE 1TNRA 1WBLA 3NV4A 4U36A 5A3MA 3IPVA 4K3UA 1IZ3A 2A6XA 1Q8OA 5EYYA 2WJSA 4DNYA 4FPCA 2X5IA 3VBSA 4IEOA 5CU1A 4B4QA 5D8AC 4QQLA 3AZZA 3N3HA 1CX4A 1N3OA 1S0GA 3AYDA 2QFEA 5F6LB 2PHWA 5J48A 1UX6A 3VBUB 2EAAA 4PCRA 1XNCA 1XU1A 2HWC3 3HT2A 4OI2A 2RJKA 1W6QA 2ZGOA 3SLIA 5DDJ1 4ZKTB 1DGWX 5JI9A 4Q4X3 4YW2A 2VW0A 2JG9C 4LTAA 4ASMB 1N1YA 2NYYA 3CL1A 1POV1 1RITA 1ZBE2 4XJZA 1GQHA 2VU9A 1NCRB 1ZRRA 1UU6A 4GB31 3USSA 4BPZA 3AMNA 1D0HA 1JXNA 1NY71 4CEWC 1H2KA 4AHWA 4AVBA 4HKLA 1JBCA 3EXUA 4URTA 1PK6A 4WM7C 1RUD1 2QQPA 2ZGRA 4F7ZA 3NKTA 4XIOA 1N3PA 1UIJA 4FCAA 3QD6A 1F31A 2P2KA 1YYNA 2K2SA 3OTFA 5CFDC 3MZHA 1Q8SA 4Y1ZA 3CJIC 5IK7A 1SCRA 1VB2A 2WNUA 4L9BA 3N7KA 1VBE2 4Q4Y2 1NE4A 3TNPB 3APBA 1V9U3 2ZGMA 4LLOA 1C57A 1GZWA 2WFF1 4YZ2A 4QD2A 1VJ2A 1PGL1 1KQRA 1PIV1 2RJLA 2BWCA 5GLUA 4FBFA 3N7MA 4UBHA 3M1HA 4M0HA 1QH6A 4LO4B 1F2NA 2VW1A 1XE8A 4Y1XA 1V6NA 4YW1A 3WQ0A 2B45X 1FOD2 3ZSLA 4FOQA 4FOYA 3CJIA 4R9AA 2DV9A 3AYEA 4CYDA 3KCYA 3JBG1 2CYFA 2NN8A 4XF3A 4M3CB 2PLV3 2KXLA 3RMXA 4KQ7A 2AH2A 3ZIWA 2NP0A 2QNKA 2B7YA 3IM0A 4M3CF 1W6MA 3VBFA 1TNFA 4FPFA 2C1FA 3V56A 1PNFA 1Q8PA 3RI9A 1ZBE1 1NOVA 2HWB2 4LUKA 5L7OC 4GMP0 2PLV2 2UYBA 1XYOA 5BNOC 1AX0A 5FMOS 4Y20B 3TWIA 3FUOA 4E4SA 5KHGA 5CAZA 3E5UA 4I0AA 5GKAC 1BQPA 1K5MC 4A2UA 4AQSA 1KJLA 5JVVA 4MGYE 1VIWB 4EN8B 5DZEA 2W52A 5JDBA 2QUOA 4BCUA 4KL1A 1UD1A 2WNVA 1QNYA 1SFYA 2BNNA 2EXHA 3C3VA 2Q30A 4CDQB 1S0IA 2XKOA 3DN7A 3JCIA 3SITA 4N7UA 1ONAA 1QMJA 4P9JA 3SCGA 4XXPA 3EHKA 1EAH1 2BTVC 2UWBA 3VBFC 1IPKA 5BNNC 3TN93 1N1TA 3KQRA 1IS6A 4Y24A 1VAKA 3JQWA 4AGVA 4I2OA 3WZ1A 1RUOA 1S2BA 4PDWA 3BALA 4DS0A 1AR81 4XDQA 1TEIA 3HQXA 2ZOEB 1CJDA 2PHFA 1UN1A 1PO13 2PHUA 2RR12 3RPQA 4QX5A 1ZBE3 2ILMA 2VOXA 2RS12 2ZJCA 4AFBA 4KH9A 3WXPA 4RSUA 2R062 2D6KA 4HN0A 5FRAA 1QQP1 3HIFA 5KHJA 1QJY3 4AEJA 1ZA4A 1LOFA 5BNPC 1FPN1 4MGKE 2XPJA 1AXKA 1GANA 3MIHA 2WKKA 1N1SA 1NA1C 3VBRB 2D3PA 2XJTA 3JZVA 2MPFA 1JYIA 3SH4A 4GMP3 5J98B 5FCCA 3RJRA 1X50A 2YC0A 1VBD2 1CN1A 1BBT2 3VZOA 3VBUC 4QQOA 3LAGA 2HWD2 4RS5B 3NAPC 4WM8A 2GC3A 4KGGA 2GNTA 1KFUL 1YXWA 1O7FA 5BXXA 2V09A 1OLRA 4CTEA 1QDCA 2AREA 4AI1A 1Q5OA 3GZAA 4AI0A 2R073 3ZXFA 2ZGLA 4GQ7A 1LHNA 4L8QA 2UWAA 3ZFGC 4QPIA 4AQ6A 2X5IC 1VBC2 3VBSC 3PJQA 4MXVA 1ZBA1 3KMHA 3KD4A 4QU2A 5DUXA 3THPA 5BUVA 2UYAA 2JX9A 3GF6A 3VLBB 4OUMA 5C9AB 3SH3A 5JIAA 4N53B 2XL9A 3CJXA 4LBJA 4XHBA 3FFQA 2I2SA 2D6MA 5I8TA 1S0CA 2H6CA 1POV3 4NOTA 3VGIA 4M00A 5EFUA 3ROUA 3FBYA 2H0BA 2WT0A 4Z07A 3IIAA 1N47A 4MXWA 3W59A 2IZWA 1LGBA 5SV5A 4Q8KA 2E6VA 3I4IA 2XB6C 3H9AA 4YNIA 4D7YA 2X29A 2AZ5A 3VL9A 4LBOA 1AR93 2VMIA 4O9EA 5DUWA 3CJIB 1U12A 5AVPA 2JXAA 2RS32 1VBA2 2HJIA 4D3WA 1F8VA 2VUJA 4RL7A 1DF0A 5C9AC 4YW5A 4Q1PA 1R1A2 4YM3A 4XFIA 1EAH2 2SBAA 3DKWA 2A3WA 4JGZA 5FLIA 1BYHA 3WQ7A 4QPGB 3VKFC 2WQ4A 2JG8B 3VZKA 4AK3A 3WP3A 1PGL2 4LE4A 3VZNA 3L9JT 2R6QA 4CDUC 3K51A 3LA3A 1HX6A 1PNGA 1OFNA 4YGCA 4DXZA 5GZGA 2VVDA 1C8M3 1SLTA 2XG3A 4G3YC