4QPGC

Crystal structure of empty hepatitis a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
246
structure length
246
Chain Sequence
MMRNETRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDIAGVQSTLRFRVPWISDTPYRVNRYTKEAHQKGEYTAIGKLIVYCYNRLTSPSNVAHHVRVNVYLSAINLECFAPLYHAMDVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgC00
2X5IA 1AR72 1MQTC 1QJU3 4AEDC 2WFF3 2X5IB 3DPRA 3JD73 3ZFEA 1ND3A 3DPRB 1E57A 4CDUA 3ZFEB 1RUD2 1RB8G 1D4M3 4AEDA 4CDUB 3VDDA 2RM23 2HWB2 4AEDB 1RMU2 3JB8A 2RR13 3J8F1 3VDDB 2BPA2 1QJY2 1HRI2 1PGL2 1VBB3 1V9U3 3ZFGA 5CFDC 3IDEA 5LK7B 3ZFGB 1AYN3 2HWD3 2TBVA 4JGZC 5AC92 1QJZA 1W39A 3FBMA 4CDXC 1BEV3 2WS91 4YVSA 1PO11 3NAPC 1Z7S3 4CDQC 4RS5A 4YVSB 1R1A1 4YVWA 1VBE3 4BCUA 1FPN3 3ZXAC 1R083 4Q4X1 5J98B 1RUC3 4RS5B 1RUH3 4YVWB 4CDXA 1B35A 1BBT2 1OOPC 4IV3C 2R063 1M06G 4CDQA 4FSJA 4CDXB 5DDJ3 5FMOS 1B35B 4CEWC 1EV11 1NOVA 1FOD3 2ZTNA 4RQPC 1X36A 2HWF1 4CDQB 1VRH1 4N53C 1C8M3 4IV1A 1AL21 4IV3A 1HXS1 4IV1B 1PVC3 4RHV3 4RQPA 4IV3B 1PGW1 2HWE3 4RQPB 3J8F2 3VBOC 1CJDA 1ZBE3 1ASJ1 1R091 4WM7C 1NA1A 1VBD2 4NWWA 3TN91 1POV0 4QPGA 1H8TC 1NA1B 2BBVA 4QPIA 2PLV3 2IZWA 1OHFA 4QPGB 1VBA3 2RS12 1RHI3 4QPIB 5K0UA 2MEV1 1AR63 4CDWC 5K0UB 1QJX1 1HRV1 2WS92 1PO12 1AR82 1TME3 1R1A2 5ACA2 4PDWC 1TMF1 2FZ1A 1NY71 5D8AC 2QQPA 1QJU1 1EV12 2HWB1 4WM8C 1BMV2 4PDWA 2HWF2 1VRH2 3LOBA 4RR3A 1AL22 1RVF1 3CJIA 5D8AA 1HRI1 1HXS2 5CFCC 1D4M1 1RUJ3 4RR3B 3CJIB 5D8AB 5BNOA 4SBVA 1PGW2 3ZFFC 2RR11 4Q4V3 4GH4C 5BNOB 1ASJ2 1RUI2 1A6CA 1POV1 1R092 5CFCA 5BNPC 3TN92 5CFCB 5AC91 2RS33 1VBC1 1QQP3 1PO21 2R073 4N43A 2MEV2 1AYN1 4N43B 1QJX2 1HRV2 1MEC1 2RS51 5C9AC 1Z7S1 1K5MA 1SMVA 1VBE1 1FPN1 1K5MB 1FMD3 1RUC1 1RUH1 1TMF2 5C9AA 1ND3B 1MQTA 2GSYA 1NY72 2R061 1QJU2 1AL0G 1AR73 1RUG3 2RMU3 1FOD1 5C9AB 1MQTB 1AUYA 3JD72 2HWC3 2GH8A 1AR93 2WZR1 1RUE1 2R043 1VBD1 1RVF2 1PIV1 1RUD3 1D4M2 1PVC1 4RHV1 2RM22 1IHMA 2RS11 2RR12 1ZBE1 5ABJC 3JBG3 1VBC2 5CFDA 5C4WC 1NCQC 1NCRC 1RHI1 4Z92B 1AR81 1PO22 5CFDB 4JGZA 1AYN2 2HWD2 5ACA1 1MEC2 4GMP3 4JGZB 5C4WA 2RS52 1ZBA3 3NAPA 5C4WB 1Z7S2 1BMV1 5J96B 1TME1 1VB2A 3NAPB 1VBE2 4CEYC 2BFUL 4Y5Z0 1FPN2 1OOPA 1RUC2 1RUH2 3VBHC 4LLFA 4CEWA 5JZGC 1OOPB 2R062 4Q4W1 1FOD2 4CEWB 4N53A 5FOJB 2WZR2 1RUI1 5A32A 1RUE2 4N53B 1PIV2 1AYM1 5A32B 1PVC2 4RHV2 1COV1 3VBOA 1VB4A 2HWE2 4WM7A 1ZBE2 3VBOB 1H8TA 4WM7B 3VBUC 1RUF3 4JGYC 1H8TB 1RHI2 4CDWA 4GB33 1ND2C 4CDWB 4FTBA 1HX6A 2ZAHA 1EAH3 1TME2 2WFF1 3JD71 1R1A3 4Q4X3 4PDWB 4WM8A 2RM21 4Q4W2 1EV13 4WM8B 1OPOA 2HWC1 2R041 1AL23 5L7OC 1VBB1 1AYM2 3ZFFA 1V9U1 1COV2 4GH4A 4Q4V2 3ZFFB 1CD3G 4GH4B 5BNPA 2XBO3 2HWD1 5BNNC 4Q4Y3 5BNPB 1F8VA 3TN93 4EJRA 1F2NA 2RS32 1QQP2 1BEV1 2R072 2MEV3 1R081 1HRV3 2BUKA 1HQNA 5DDJ1 2X5IC 2WFF2 2Y26A 3DPRC 1C8M1 3ZFEC 4CDUC 1RUG2 2RMU2 2HWB3 3VDDC 2HWE1 1RMU3 2HWC2 3JB4C 1AR92 2R042 1RVF3 1QJY3 1HRI3 1VBB2 1GFF2 2PLV1 1V9U2 2BFUS 1VBA1 5ABJA 3ZFGC 1AR61 1POV3 5A33A 1NG0A 5ABJB 1RUF1 5AC93 3M8LA 1NCQA 5A33B 1NCRA 3JBG2 1VBC3 1BEV2 1NCQB 1NCRB 1PO23 4YVSC 1WCDJ 4GB31 3VBRC 4RS5C 1R082 4YVWC 1MEC3 1BBT3 1ZBA2 2RS53 1B35C 5DDJ2 1EAH1 4CEYA 3VBRA 5GKAC 3VBHA 1C8M2 4CEYB 3VBRB 5JZGA 4IV1C 3VBHB 1RUJ1 5JZGB 2XPJA 3J8F3 4Q4V1 3VBFC 2WZR3 1RUE3 1VBD3 5C8CC 1PIV3 1DDLA 1NA1C 3VBSC 2RS31 3S6PA 2PLV2 4QPGC 4RFT0 3VBFA 1QQP1 4QPIC 1VBA2 2RS13 2VQ0A 2R071 5C8CA 3VBFB 5FMOL 1AR62 2XBO1 5K0UC 3VBUA 4JGYA 3VBSA 4Q4Y1 5C8CB 1RUF2 3VBUB 4JGYB 3VBSB 4FTEA 4Y4YA 4GMP0 2WS93 1PO13 1AR83 1ND2A 2DF7A 4GB32 4NWVA 1ND2B 5ACA3 1FMD1 2FZ2A 1AR71 1RUG1 2RMU1 1EAH2 2WWSA 2HWF3 3HAGA 1VRH3 1AR91 4Q4X2 1HXS3 4RR3C 1RUD1 1RUJ2 3CJIC 4Q4W3 5BNOC 1RMU1 1ASJ3 1RUI3 2WLPA 5L7OA 1R093 1QJY1 1PGL1 1AYM3 5L7OB 3JBG1 1COV3 2XBO2 5BNNA 4FTSA 4N43C 4Q4Y2 1QJX3 5BNNB 4GMP1 1ZBA1 1C8NA 1X33A 2ZZQA 1K5MC 1FMD2 1ND3C 1TMF3 1BBT1 1VAKA
chains in the Genus database with same CATH superfamily
3I2HA 2X5IA 4YLZA 2ZGUA 3DGTA 2PAKA 2X5IB 3DPRA 3H3LA 3ME2A 5E16A 1NZCA 2PA7A 2VUDA 4AR2A 4B8EA 3DPRB 3EHKA 3GZUC 3LIHA 4X6RB 4XJWA 1OH3A 3CU7A 4BA6A 4HONA 5I0UA 3BU0A 5HV4A 2W08A 2HWB2 4GWIA 2Y60A 4QGNA 3RVHA 3NJZA 2RR13 3J8F1 4LBQA 2Q0AA 4Q1RA 1O3QA 4ZXEA 3QD6A 2NZ9A 3C8XA 4IDZA 5I8YA 1LU1A 3L9JT 2VZUA 4LBQB 4MXWA 1DYOA 1HRI2 3T30A 2BPA2 1PGL2 1ULDA 4MXWB 5H9QA 5A3MA 5IVBA 1UL9A 3WUDA 2VTXA 1MZ5A 2DVDA 3FC0A 4AVBA 3IDEA 1UOGA 3W58A 5LK7B 5LK5A 4HSJA 2FDKA 3M3QA 1US2A 5FXXA 2R6QA 2TBVA 4HK9A 1YUDA 4JGZC 4QQLA 1RUOA 4N9HA 1UZZA 5FXVA 3GXUA 4J1XA 4UW3A 2HLEA 2LROA 2N7GA 3H1MA 2B45X 4XF4A 3E6BA 2E7QA 1PO11 2W3JA 2YUEA 4YRDA 4YM1A 2P6CA 5DZFA 1R1A1 1VBE3 2XOMA 1UYYA 1DU3D 4NPLA 4FOQA 2ZABA 4Q4X1 3WDUA 4HG6B 4CDXA 1OOPC 1UPIA 4LE4A 5IVEA 4IV3C 4CDQA 4CDXB 1DHKB 1LHVA 2VCBA 4NN0A 5FMOS 1LODA 5IW0A 5AFBA 4RQPC 3UNPA 2WWJA 4CDQB 2HWF1 1OLME 4AHZA 2BQPA 3D4KA 3WNXA 4XZPA 5FWEA 5GZCA 3S0MA 3C7FA 1A8MA 4RHV3 4XZUG 4YARA 4ZKTB 4G4FA 3K4ZA 1PGW1 2HWE3 1Z0HA 3HOBA 4XJZA 1D2SA 4IEPA 2W52A 2Q8CA 2J1TA 1GZCA 4WM7C 2X8KA 1KFXL 1W6NA 2OIIA 4Y1UA 2Y8KA 3PHMA 3PUSA 4NWWA 3TAYA 1WBLA 3LDBA 1ENSA 2IXKA 2C6SA 2A6YA 3D8CA 3IAQA 3LDRA 4P9GA 2QVSB 4BISA 1JOBA 1OHFA 1AX0A 1W8WA 1RHI3 4A41A 5K0UA 5CG9A 1JUIA 1YFYA 1WLCA 3CZJA 3FHAA 4JQRA 2JG8C 5EIYB 1DQ2A 2DDUA 4LHSA 4Z8BA 5K0UB 1HRV1 2E7TA 3T2QA 3WXPA 2YGLA 3URFA 1YO8A 1ZA4A 1DF0A 2AC1A 3Q8FA 4XDQA 1UYPA 1S1AA 1HQWA 2WLQA 4ZPIA 2ZX1A 5FYHA 2JDZA 3MFCA 4HKLA 4BH9A 4XDPA 3THCA 1LAJA 2QQLA 4LOTA 5FZFA 5ACA2 4L2NA 1DYKA 2F4LA 3EJKA 4OMDA 1SBEA 1ZZ6A 4QX1A 1PK6A 3JQWA 2DCZA 4ASKA 2BJSA 2X09A 3B00A 3HQUA 4LE3A 3OGSA 1Q8VA 5EHDA 4A7ZA 4PI2A 1PK6B 5JOZA 4WM8C 5LA9A 1E5IA 1IS4A 2ZA9A 2PYTA 2GP5A 4TLFA 5LA2A 3WX5A 3LOBA 1F4AA 1AL22 2CYFA 5D8AA 1HXS2 2HBTA 4QXHA 4TSVA 1D4M1 1TEIA 5D8AB 2W39A 3POYA 5BNOA 1LHOA 5FYCA 5FKCA 2JDAA 4Q4V3 2ET7A 4GH4C 5BNOB 2VUJA 1WW7A 2DCTA 1ALYA 5CFCA 2BNNA 2QDNA 3AZWA 4J6GA 1Y43B 3TN92 4B3NA 4AEDB 5CFCB 5AC91 1DZRA 1X8MA 2XGXA 3DCQA 2XJSA 1VBC1 1XRUA 2A5ZA 2KR2A 5GM0A 3JCIA 1S0DA 1PO21 3OGJA 2R073 2VBDA 4N43A 4NHKA 5FY4A 5KHIA 3FX3A 2G9ZA 1AYN1 4N43B 4DUVA 4FPEA 4LHNA 4PCRA 4URTA 3R4SA 1OKQA 1W8OA 2RS51 1OVPA 1BCXA 2VUAA 1K5JA 2VZ1A 1Z7S1 4KL1A 3IAPA 2G9FA 2NPIA 2QQWA 1CAWA 1SMVA 5KXBA 5C70A 3BUCA 4O61A 2GU9A 4CU6A 3ZPOA 3BODA 1RUC1 1CAWB 2JKXA 3J4UH 2BRTA 3C7GA 5C9AA 1ND3B 3QLQA 2JDPA 4I0AA 3KV4A 1CN1A 1NY72 2VZSA 2D6NA 1AR73 2DU1A 3UKVA 2G19A 1FOD1 2AACA 1OD3A 5C9AB 2GH8A 2RHPA 3AYCA 1CPNA 4KG0A 2R30A 3P3NA 2WZR1 4QKFA 4DIQA 5I8TA 1WCSA 3I97A 4CP2A 3C2UA 3LA3A 4XJUA 1IPJA 4KMQA 4QQPA 1KS4A 4DS0A 1RUD3 4I3GA 5LW9A 2X53S 4IEZA 4YFZA 4UOJA 1IHMA 2EIBA 5BV6A 5JMOA 2RR12 1DGRA 1UF2C 2WKKA 3O12A 5ABJC 3KV5A 4PBPA 2XB6C 3WF0A 2VXRA 4ZY9A 3ZM8A 2ZGLA 5FP9A 5FMBA 1PGSA 3WP4A 4Y5SA 1QKQA 1GR3A 3QBQA 5C4WC 1NCQC 1D4VB 1NCRC 3CL1A 3W21A 4Z92B 1W6MA 4M0NA 3LGRA 4I09A 4FXKB 3RYKA 4BIFA 2DVGA 2CTVA 3LIGA 1W6MB 2CHHA 1Y3TA 2PHXA 3PUQA 4UFIA 2UY8A 3GDBA 4WZFA 4XJ9A 5FY8A 3NAPA 5FYVA 3BTAA 3OD0A 1HJFA 1LCLA 4XILA 3LPGA 3IM0A 1TME1 1VB2A 2Z69A 3NAPB 1VBE2 4IL7A 3MIGA 4CEYC 5I93A 2Q4SA 2NMNA 3RZKA 2JJ6A 2D93A 4MUVA 2HEWF 1H9WA 1XE7A 2PHTA 1CR7A 5KHHA 1QY4A 3ROUA 2WN3A 3V0AA 1UOFA 4XJ8A 1VAMA 3KSCA 5GLUA 2GC3A 4I0WB 1FNYA 3V0AB 1JMUB 1ULGA 1WLDA 1MS1A 2A6VA 1RUI1 2X05A 2OX0A 3GYDA 4YGBA 3U07A 1PIV2 4XQWA 1EP0A 3H0OA 3CBNA 4RHV2 5H9PA 3SKJE 1NLRA 4QB6A 1IS5A 3EBRA 1PM7A 2HWE2 2CGNA 2CWSA 1OA2A 4OUMA 4P14A 3CHXA 1KITA 2ZX4A 5K4LA 2RJLA 5EQUA 1W90A 1J1LA 3LAGA 1G9BA 5D2AA 4MG2A 3AK0A 1CX1A 3VBUC 3V56A 2FD8A 4Y5TA 4IGQA 5JIUA 5IWFA 3NMBA 1RHI2 1RGSA 1W28A 1QF3A 1XBFA 3ACIA 1CPMA 4IGPA 4IGOA 4CU7A 4QX7A 4CVUA 1F15A 2VOKA 4RN5A 1J3PA 1HX6A 3E6CC 2BWCA 4HOOA 1NQJA 4ZS2A 3RRDA 2W94A 3WY6A 2ZX0A 4YSFA 1L3JA 1H1IA 1ULPA 2HH9A 1W2NA 4AHYA 4LBMA 5F7UA 1H0BA 3BKZA 4FI9A 3THTA 2VMGA 1A8DA 4PDWB 3GALA 4QB1A 3HEIA 3WV6A 3TRSB 5IK4A 1LOEA 5F6LB 4MGZE 5EXOA 5A70A 2WFPA 3IB3A 4IE6A 4X8NA 3T3YA 4BB3A 3C7EA 1S0GA 2DV9A 1U5YA 1GOGA 3U11A 1Q5OA 5FZ3A 4YW1A 5JR7B 5FLIA 1UMHA 4Q27A 1T6BX 2R041 5LEKA 4XEZA 1Q8OA 1U5ZA 2QCSB 1DGWX 3I7DA 5FYSA 4CP0A 4DFSA 1HN0A 5L7OC 1AYM2 5EYXA 3RZMA 4QXKA 2QZ2A 2AGSA 2NM1A 5LA1A 1V9U1 3MF9A 4ORFA 5C6CA 4MHUA 4Y3OA 2JDMA 4Q4V2 2VNRA 2Q8EA 3WT3A 2VNOA 1SBFA 5BNPA 3LA7A 3HT2A 5EJ1B 4NOTA 4EROA 2HWD1 4LBKA 2V09A 1WW5A 5BNPB 5JSPA 1F8VA 1F2NA 4D7TA 2ADEA 2JE7A 3CJXA 2Y64A 4XMIA 1WWYA 4FPCA 5C5UA 2R072 3DYPA 2MEV3 1DIWA 4AQ2A 4ZZ8A 4BQ1A 3GJAA 3L2YA 3OF1A 5BUVA 2BUKA 3D6EA 2WNOA 4QGMA 2LS6A 5DDJ1 4JHTA 1OA3A 2X5IC 5E6HA 2WJSA 2VZ3A 1AX1A 2RDNA 1LU2A 1C8M1 2DVFA 3DPRC 4CCNA 2VL4A 3VGIA 4D7SA 1DYPA 2ILMA 2R32A 2CGOA 2VPVA 3LKJA 3KS7A 5FO9B 3A23A 1BQPA 2J1RA 1U0AA 4QX8A 5FR3A 1WGPA 3H8UA 1MR5A 4OHVA 4W4ZA 3TEYA 3PUAA 2Y6LA 4IQPA 4EN6B 4YW3A 3WLUA 1RVF3 4N7UA 3THDA 1VP6A 1VBB2 1GFF2 3B93A 2WT1A 1LGCA 4MGKE 4QPWA 2YBKA 3WNNA 4WZCA 1GNHA 2OS2A 5J3UA 4QWNA 2BFUS 1VBA1 1ZNPA 3NVCA 3VZJA 2WZPP 3F95A 3VLBB 4Y1XA 2VXJA 4BZ4A 2B5HA 2WNEA 2PELA 4NHMA 2PHUA 2VCAA 1NG0A 2XJVA 3I2DA 4QX0A 2OUJA 5FLHA 1J59A 1HB3A 2K2SA 1XYPA 3U37A 3ZSEA 1S0BA 1IS6A 2KXLA 3FZ3A 1WCQA 2WBKA 4P5HA 2EVXA 3OBRA 2BU9A 3VBRC 3ZOIA 1R082 4GD4A 3P1IA 4LK7A 4LNVA 1M4WA 2VH9A 4UW6A 4IE7A 4UW4A 1XNBA 1PZ9A 1RL3A 4BK4A 2VE1A 5KXDA 3MIEA 2BVVA 1DLCA 1V0AA 1WCUA 2XJTA 3MBWA 1J3RA 3SCGA 4CU9A 2H0VA 1V6IA 4QKBA 5E1RA 2YC2A 2HYKA 3LB9A 2XL9A 3AL6A 3PMSA 1RUJ1 2J7MA 1NUKA 3E5QA 3MV11 3RWKX 4A3ZA 2WT2A 2YDEA 2Y6FA 5LB6A 4AYUA 1BVVA 1AX2A 1OLQA 5JXHA 3VBFC 1JZ5A 3LEMA 3KGZA 4R9DA 1RUE3 1RUNA 1VBD3 1UCXA 5F39A 3MFAA 3Q8AA 1ZRDA 4M00A 1O3SA 5FJHA 2EAAA 3IIIA 3R4UA 4JRAA 4RFT0 3S7EA 3TWIA 2RS13 4V1PA 4BHPA 1OKOA 5JCTA 5FMOL 5K0UC 3Q9OA 4FXGB 1L7RA 3GCXA 3KVBA 1W8NA 2CY6A 2OZ6A 4XBQA 5F5AA 5FK8A 5I0DA 2D3PA 2WIIB 5F6KA 4C1WA 5IHRA 3LA2A 4Y4YA 5FRAA 4BU2A 2WS93 1LEDA 4R4ZA 2P17A 4PBOA 3RFRA 2V73A 1FV2A 1QDOA 5FYTA 3DYOA 1QOOA 2E7AA 2ATFA 2IVJA 2JDHA 4NWVA 3SQOA 2WO7A 2D44A 2ES3A 4IE4A 4TWTA 2PFWA 3PDQA 5LASA 1X7NA 2ZX3A 1Q3EA 3MLLA 3M4FA 2R49A 2PHWA 5FZMA 1PK6C 4XFHA 4K1ZA 2JENA 3MIBA 1OLRA 2D6OX 1CVNA 2VZOA 3I3MA 1VRH3 3U14A 1KXGA 4UFMA 3H7YA 1WUVA 4ZU5A 1QGLA 2VBBA 1L7QA 2EA7A 4AOCA 4O65A 1FYUA 3PIGA 3G7DA 3HQXA 4RGGA 1QXRA 3C7HA 4EN8B 1XSQA 3FE5A 4Q4W3 4KI5M 3OUJA 3KCCA 5BNOC 3UK9A 2XXZA 2O8QA 2JD9A 3ORJA 4HKOA 5F2WA 2Q1MA 4D8MA 3CF6E 2WNVA 3HT1A 3K2OA 3N9MA 2WL1A 4LORA 3ZX7A 1PGL1 2WNVB 4ISRA 2VQTA 3AZYA 4XFGA 3AJZA 1COV3 1CESA 1W6OA 1WD3A 2PMWB 3AFKA 3RMYA 3NSTA 1W6OB 4Q0QA 1DG6A 3KM5A 4IE5A 4N43C 1N1SA 4XXPA 1LR5A 4LLOA 1IPSA 2NMOA 2IUWA 1YFWA 3FFZA 4EV0A 4YM2A 3IBMA 1JYXA 3U4SA 1X33A 3RGBA 1SLCA 4QHOA 1XQNA 2W2IA 2XDVA 4LPLA 4LA3A 3TOJA 1JBCA 1REEA 3AXDA 1ND3C 1TMF3 4BE3A 5JI7A 4AZZA 4FO9A 1XNDA 3AL5A 5FP7A 2A3XA 2Q1ZB 4YFWA 5FCCA 3VHRA 3AFGA 4AEDC 5J7MA 2WFF3 2QQOA 1RC6A 4YW5A 5FY5A 4AVVA 2ZGPA 3NJVA 5B4NA 1E57A 1ZRIA 4CDUA 4FP3A 3B9IA 3AKSA 5F5IA 5GJ6A 1DQ1A 3RJ2X 5DUVA 4CDUB 2DBIA 2RM23 3D0JA 4NRMA 1UX6A 3GJBA 1UY3A 2WC2A 3O0VA 3ZXKA 3MGUA 3RNSA 4Y20A 4QU2A 1HLCA 4XE9A 4OI1A 4Y20B 1G9DA 4QX5A 1QHDA 3POJA 1V6OA 3ZXJA 4CU8A 4W50A 1W8TA 5E89A 3SKVA 4R8HA 2FCTA 3HNMA 3ZFGA 3RDIA 4TN7A 3ZFGB 3OBZA 4AAXA 1VLNA 3IZOA 2A75A 1ULFA 2VOXA 2AENA 2WQZC 4M0HA 1TQ5A 1JW6A 5AVPA 4E4DX 1QJZA 1W39A 1XNAA 2OT7A 2VMEA 2OZJA 4R9BA 3VKLA 5FPUA 4P02B 1BEV3 3QACA 1SLIA 2DWRA 1IKQA 4IEUA 1ZX5A 3NAPC 2LW8A 4XFAA 4AAPA 5A1FA 4PQ9A 5H9RA 3AVSA 1TZOA 4BCUA 1EUTA 5J98B 1RUH3 3HMYA 4URAA 2W68A 5G05L 4DINB 1S2KA 5CIRA 2VTXJ 4BXSV 1V6NA 2PAEA 2R063 2ZAAA 1IKPA 4LO4B 5L36A 4CCLA 4GA9A 1M06G 4FSJA 2ZGNA 3HIFA 5LRSA 2IVIB 4BQYA 3U4XA 1UWWA 1X36A 2JECA 5FUPA 3R6SA 3ZPYA 1AL21 5EPAA 1BK0A 3O7OA 5T3NA 1HXS1 1OLMA 5TSWA 4K40A 2DCKA 4AEKA 1PVC3 5C3PA 2FDJA 2Y6HA 3WNLA 4XHBA 3INAA 1GANA 4QMAA 1ZBE3 2P34A 2R0FA 4KH9A 1VBD2 2E33A 2XG3A 2K46A 4UFJA 5DAXA 3TN91 5F5CA 4HN1A 3HN3A 3LEGA 3ZSMA 2PLV3 1SHWB 2IZWA 1XE8A 4YW6A 4GIQA 3BOWA 2RS12 5HV0A 3VZNA 2VO5A 1AR63 2VUCA 2XLFA 5SV5A 3OBTA 4GJZA 4Q8LA 1OC1A 1I3HA 5I0RA 4AHWA 2XL7A 4BPZA 1OMIA 2XWBB 2WS92 3MV01 1RXGA 5FZOA 3LCPA 5A7QA 1US3A 4G3YC 3MHZA 5FZOB 3TYJA 3T2OA 3W59A 2Y38A 1OQDA 4PDWC 1ZZCA 3MO4A 3T0DA 3ZVXA 2BDRA 4FPJA 3VD9A 2WUHA 4QM8A 4UFHA 2FZ1A 1NY71 1JXNA 4XIKA 2QQPA 3L2HA 2AEYA 1EV12 2JWPA 4P9LA 4DRRA 4E27A 1AHSA 5FPVA 2UYBA 4UYBA 2GN7A 1VRH2 3AX4A 1W9FA 4KGQA 2XQXA 3MUY1 4W6XA 4RR3A 3IT8A 4K9SA 3AP9A 2GALA 4CCDA 4RR3B 5JVVA 2WYSA 4SBVA 1CX4A 1SDDB 3NNMA 4OZXA 4AL9A 2RR11 5IFTA 3J7LA 3ZR6A 4QDRA 5F37A 1POV1 4XF0A 1Y9QA 5D21A 5BNPC 3KMHA 5DAWA 1PX3A 1N1YA 1LHWA 3RPQA 2RDSA 3GNEA 1C1FA 4KWKA 2RE9A 3WINE 2OPKA 1QQP3 3QH6A 2BWAA 1UY4A 3UESA 5JXIA 1W99A 2Q1FA 5FP4A 2JICA 3N9PA 4H55A 2GDFA 2DURA 1AF9A 3FBYA 1XC6A 2WZEA 3PTYA 3LWCA 5IJRA 4CRQA 3T0AA 5KXCA 1IQAA 4CXWA 5IYYA 3ASIA 5A3WA 1UOJA 4COUA 2BGPA 2DFCA 1K5MA 1UAIA 3H8RA 4OULA 2OQ7A 3UKTA 1LECA 3W20A 1VBE1 2A3YA 4UT5A 1K5MB 1OF4A 2CU5A 2XLGA 3RYRA 1FMD3 4YGEA 5JSRA 1TMF2 3WD5A 5DUUA 1MQTA 4YZ1A 1W05A 2ZHLA 5C3RA 3U75A 1RUG3 3J7HA 1NLSA 1MQTB 1A34A 1D0GA 2HWC3 2WNUA 2BNMA 3ZYFA 5J48A 5JDBA 4RFRB 1YFUA 4XIOA 3TNPB 2UY9A 3K3NA 4FPLA 4CA9A 2WNUB 1PIV1 4Q29A 3AZXA 1LB2A 4RHV1 4CUBA 4M3CF 1WCKA 2RM22 3OEAA 5DZEA 4FPYA 2ZGOA 4L92A 4C0HA 2CSGA 3WW1A 4NIHA 3HWJA 3VL8A 4Y26A 2VR4A 4KG8A 4O9GA 3UGFA 1QJEA 4Q1PA 4Y4RA 4XDOA 3ZYPA 4H14A 5CFDA 3VDCA 1GQHA 2GNBA 1GICA 1RHI1 1YNAA 2V4VA 4JHZA 5JR2A 1AR81 3S5AA 1OPMA 4XABA 3POSA 5CFDB 3ITQA 3V65A 1DBNA 2ORZA 1GP6A 5FZLA 4K1YA 1MEC2 3WQ7A 4ET7A 2XR4A 4OHXA 1ZBA3 3S30A 1BMV1 3B7MA 4BQ2A 2QZ3A 2BFUL 4HXCA 4Y5Z0 2XUEA 3JUUA 5DUWA 3AP4A 2CAUA 4EE2A 5IAVA 1DGLA 1RUH2 3TEXA 4GWMA 2OQ6A 4LLFA 4CYDA 3UYJA 2R062 4OI2A 4EWEA 2HJIA 2WYFA 3GCWA 1J58A 1IQDC 1BHGA 1JU3A 5FPLA 5LY1A 3MPBA 2ARXA 5I0SA 2VMFA 4JKMA 5KWRA 3GBGA 5EV7A 2YG0A 3SEPA 1QNYA 1OH4A 2EXIA 2A71A 3B69A 1AYM1 1PVC2 1SCSA 2VOTA 3RZGA 1GWLA 2VZPA 1W6NB 3CZUA 4XF1A 5EYYA 5FOBB 3O1OA 1YYNA 1R1ZA 3QH7A 1PNGA 3EYPA 3C7OA 3KGLA 5E88A 1ZA7A 1ZBE2 1UNBA 1W3VA 2I07B 3B94A 5A7OA 2JXAA 1CJPA 1RUF3 2YXSA 2OPWA 3TEZA 2DCJA 2ZBJA 3LQCA 1EYBA 5IFPA 3RSJA 1YI9A 1J83A 3RZZA 1PVXA 4GWJA 1W8UA 1I9RA 1N47A 4FTBA 2D97A 3ZYBA 2ERFA 3MDPA 2ARCA 2ZAHA 4ZU7A 4Q0SA 3AMHA 1FV3A 2I74A 2XKPA 2YBSA 4JAAA 1MVEA 4JZRA 5A6YA 1G9FA 3JD71 1R1A3 4L97A 2UWCA 5FTTC 4K8RB 3ZR5A 1LESA 5FYMA 4Q4X3 5APAA 3RZJA 1C5IA 1JYIA 4DOUA 4LKEA 3I49A 4FT8A 3E6DA 1XNKA 1O5LA 4KWJA 1WMFA 1W04A 1XU1A 3AMPA 2BTVC 3BGAA 2WZ8A 3UL2A 1AVBA 1SPPA 3AKQA 5FMDA 1EUUA 3KT7A 1S0EA 3RS6A 4AF9A 1SPPB 1NAEA 2WR9A 2ZKLA 3Q8EA 4CTEA 2QDRA 2WNVC 1C28A 1VBB1 5ANNA 5K7PA 1JOJA 3I3BA 3EMRA 4BIOA 5LATA 3K3OA 4FVVA 4Y33A 3RZLA 2XBO3 4YG0A 3I2IA 3WF4A 2JDYA 4Y1VA 4F8AA 2LRPA 1H4HA 1MACA 1QEXA 2B9UA 3JZVA 4AFMA 4C91A 5HBAA 4AQTA 1ONAA 1QQP2 3FFQA 1V6MA 3PU3A 3OOXA 2PQQA 3AYEA 3ZYIB 4K21A 4YZ2A 1S55A 2WSUA 3R0RA 5FMCA 1C57A 1JOPA 1DFQA 2B42B 4O9EA 1R081 4FPKA 4TTGA 1HRV3 4FCAA 4DY5A 1HQNA 3VKMA 2C9KA 2W9XA 3EB7A 5LBCA 3ZDVA 1V6JA 5DPNA 4OI4A 5F5QA 2Y6GA 5FDBA 1W6PA 5F9TA 4BDVB 4X8PA 1MS0A 2QQKA 4RYDA 5FYUA 5FY9A 1O6UA 4DO0A 1W6PB 2DUPA 2FCVA 1X9PA 4CDUC 4CUAA 3LE0A 4DUXA 3AVRA 3HJRA 1RUG2 4XFCA 1C4RA 3MPPG 4S2FA 1T2XA 4PIZA 4QPYA 3RI9A 1V70A 2WABA 1OT5A 2HWC2 1K45A 3VD3A 1O3RA 3T1MA 2H6BA 2X10A 3MIFA 3POEA 4I2OA 2K0GA 3WF1A 2BERA 1TG7A 1QWRA 1QJY3 1FAYA 1H4GA 1TNRA 3OGRA 4LQRA 3VUOA 2YPDA 4K3UA 5AVAA 1UY1A 1I5ZA 4OVEA 2W47A 4B1MA 3M7AA 4LIVA 1ST8A 3GHNA 5FZHA 3T4HB 2JEMA 1DGRN 3VKNA 3ZFGC 3ZO0B 2VJXA 4ZXKA 3HN1A 1J84A 1H6YA 2AR6A 5A33A 5F3CA 1Y9GA 5KHKA 3ON7A 1GMMA 1MS8A 1U5IA 3K4AA 2W5FA 2ZPXA 3FLPA 2QQNA 1XB9A 2O8OA 1VBC3 4NR1A 4ARYA 5A33B 2GC0A 1UMZA 3ENRA 2Z79A 1PO23 3D82A 3HD8B 3BIEA 1QH6A 4CSWA 1SZBA 2E26A 1UW8A 2GNMA 1Q8PA 4RA0A 2B7YA 1UZYA 1LOCA 3NKTA 1ZBA2 2RS53 2HEYF 1JHJA 1NE4A 3K48A 3UT0A 4S2GA 2G4IA 2C0ZA 1DGWA 1QH7A 4KBBA 4D6RA 3N7KA 4IEOA 2XQRA 5JZGA 4RD7A 3RWNA 4YYOA 4SLIA 5JZGB 3LOIA 4I3PA 5A7WA 3UGHA 2BW8A 1OD5A 3QOPA 4IEXA 2A3WA 1GP4A 1CIYA 1VIWB 1MS4A 2XJUA 4LITA 5A7WB 2WZR3 5T50A 3DF0A 4XW3A 4FAHA 3GHMA 4GAZA 1U12A 1MS5A 2RS31 2JIJA 4FPGA 3O1RA 3BVCA 1BK1A 1N1TA 5IVJA 2VQ0A 3BU7A 1HKDA 1R64A 4NIDA 1X82A 5C8CA 3J9SA 3WDYA 2VECA 4BK5A 3U0ZA 2XVGA 2WN2A 4JGYA 1NE6A 2ZCWA 4OFGA 3RYPA 3VBSA 5C8CB 4NIGA 1RUF2 3B3QE 1HJGA 4JGYB 3VBSB 4CCJA 4B4QA 1DQ4A 1H9PA 2OW4A 4XBNA 4H3WA 1ND2A 2DF7A 5FXWA 2ADDA 2RDRA 4LBOA 4AE2A 3H1YA 1ND2B 2OA2A 1SLBA 1SFNA 2QQMA 3LEIA 3OUHA 4LBJA 4V2VA 2DFBA 5EFUA 5IVVA 1LEMA 4XC9A 3VZKA 3NRUA 2B8MA 2UU8A 2F4PA 2FZ2A 3V64A 2RMU1 4WBBA 3HAGA 4PLNA 1AR91 1F35A 4MGQA 3VDBA 2ZX2A 4Q4X2 3H3UA 5GZDA 5J37A 2VVDA 1O59A 2JG9C 3R4DB 3AP6A 1HN1A 4RR3C 2D5FA 3SH3A 1A3KA 3AP7A 4GWNA 5HCFA 5GALA 1G8WA 4AG4A 3KF3A 4LO6B 3N7LA 4A3XA 2GMMA 3P5BA 4CCEA 1ASJ3 1RUI3 2WLPA 2EXJA 1R093 3ZIXA 1UD1A 4UBGA 1WMXA 3TB0A 4LA2A 2XMLA 5IK7A 4DEVA 4DY3A 4UAPA 1C3HA 3JBG1 3SLIA 4P08A 3UKNA 1KDKA 2B39A 1Q43A 2P5BA 1XOYA 4PF1A 4DXTA 2XBO2 5BNNA 4X6QB 4FTSA 3VHPA 1W9TA 4WVWA 1QJX3 3SH5A 1NLQA 5FPXA 5BNNB 4NJ4A 2BP6A 4GMP1 1GLHA 4AHXA 1F4HA 3KVAA 2HEVF 2QFEA 1JI6A 1ODNA 4QKDA 4EWAA 3P6BA 1GOHA 1ZM1A 2ZZQA 1K5MC 4FPFA 2JE9A 2R1DA 1XNTA 4ZONA 2QTWB 3A4UA 2ID4A 3BI3A 3PUHA 2Z42A 1W03A 1GWKA 2P1BA 2WDBA 4JDNA 3WDXA 2XHKA 1AR72 1MQTC 1QJU3 2A7AA 4KU8A 4AVCA 4EN9B 5DMYA 5K9YA 4XQDA 4E4ZA 3DXTA 1CAUA 4PLMA 2R1BA 3ZFEA 4MGTA 1MZ6A 2FDIA 2WNUC 4P9XA 1CAUB 3HBZA 3M3EA 1XJAA 3ZFEB 1HIXA 4NHYA 1RUD2 4M4PA 4XF3A 1WD4A 4CCOA 1GV9A 4A2UA 1NKGA 3VDAA 1QNWA 4E2QA 1S0JA 5CU1A 4Z2AA 2PHLA 1VMJA 1QJY2 5LBFA 2W87A 3IKWA 1V6KA 4MH0E 1V9U3 2VW1A 5KHGA 1YC61 2QE3A 5CFDC 1BZWA 4M01A 2C1FA 5DAPA 3U10A 4U2AA 5FYYA 5J36A 4DXZA 3S5QA 2HWD3 3LDKA 3WCSA 1NQDA 4LTAA 3WDVA 1UY0A 5AC92 4TLGA 3FBMA 3SISA 3BOPA 3BPSA 3WHUA 4CDXC 4HZFA 2WS91 4LO5B 3H8OA 2QQJA 1GKBA 4CDQC 4RS5A 3IPVA 3OCPA 4YVWA 4NPMA 1WLWA 1FPN3 3VB9A 1ZVFA 1PNFA 3IPVB 4RS5B 2ZGTA 4YVWB 3TBDA 1B35A 1UU5A 1QIQA 1EPWA 3RMXA 2WAAA 3ES4A 1GBGA 1LULA 3MEPA 5DDJ3 4ITCA 1B35B 2C4XA 1EV11 2VC9A 2EICA 2ARBA 1VRH1 2Y34A 5B2GB 4AWDA 1C8M3 2XKOA 5T5OA 1XXNA 1JU4A 1AJKA 4IV3A 4WV8A 4BWOA 3AKTA 4HLTA 3POGA 4IV3B 4RQPA 4Y22A 1H2LA 3A0KA 1W8HA 5J09A 4BQXA 4RQPB 4Y22B 4LR4A 4DB5A 1CJDA 2RVAA 3BTZA 2SBAA 1IG3A 1N1VA 4N8MA 3BN6A 2V5DA 5GZEA 1W2OA 3HVDA 5FQ0A 1P8JA 3ILRA 3AYDA 1S4CA 4QPIA 2VM9A 4WVZA 2E6VA 2VCCA 2BBVA 5FQ0B 2IXHA 1VBA3 1YQCA 2BYVE 4PIYA 3O5SA 4IXLA 2VU9A 4QPIB 3MI8A 1OXCA 5FJKA 3ZYJB 4EYUA 2E63A 5L9RA 4OQ9A 1KS5A 5JPMB 2D5HA 3CKHA 3D5OA 3FLTA 5FZDA 3WZ1A 3WSOA 1D0HA 2ZKNA 1CGPA 1GYKA 4MLOA 2YROA 2RG4A 3AZVA 1YIPA 3CLPA 5FZ4A 3UJQA 4FFGA 4HBNA 2JG8A 4F83A 1DZQA 3LPFA 4IERA 4LKSA 1S2EA 2JG8B 1YQ5A 5F32A 4JVAA 1TMF1 4XCBA 1JYVA 2A70A 4XTPA 5D8AC 4LKFA 4CZSA 2HWB1 4J1WA 3WW2A 2DU0A 3WG2A 4COYA 4D6SA 5GZGA 1CAXA 5FREA 1YFXA 1BLZA 3SHRA 1HRI1 2D6LX 4XJAA 2DTYA 3VZMA 5CFCC 4LO7A 1CAXB 1RUJ3 4DXRA 2TEPA 1F9KA 3T1LA 2YGMA 4S2DA 3WQBA 4HSLA 1RJ7A 4OZOA 4TZDA 3OEBA 3CIHA 2PN5A 3I2OA 1ENXA 5FK7A 3OPTA 1LHNA 4D69A 1ASJ2 1RUI2 4Y24A 2LUWA 1R092 3KT1A 5CNAA 3T0BA 4BQWA 4CPBD 3OD4A 4IW3A 1Q8SA 2VNVA 1GQGA 2DYCA 2ZMNA 3NV4A 1S0CA 1KQRA 2JB4A 2XJPA 3HPNA 1YJLA 4FOWA 4YGDA 5GLVA 1JZ8A 3MLKA 2MEV2 5FZ0A 3I2FA 4FP2A 3KD4A 1OFNA 1QJX2 2BEOA 1MEC1 2ZHNA 4OYUA 2IXJA 2W92A 5FZBA 5A3UA 3O0WA 4OI0A 2RV9A 3WCRA 5C9AC 5IK8A 3HQRA 1MPXA 3R05A 3PL0A 4LKDA 3WHTA 1NXMA 1W2AX 5BY5A 2EF6A 3SCFA 1W8ZA 5T55A 3KHCA 2FMYA 1XSRA 3CQOA 1RUH1 1WBFA 3N36A 4B7EA 2B46X 2IXIA 2GSYA 1UZ0A 2R061 2YPJA 1GQPA 1ZREA 5ANQA 1QJU2 4OUSA 3AB0A 3VD4A 2EXHA 4AGGA 4NROA 4PQQA 1PMJX 2VOVA 3H3ZA 4GQ7A 1YI7A 2R0HA 3NNJA 4QX3A 5D1IA 1RVF2 1V6LA 5CZKA 3NWKA 4OLLA 3KZ4C 2H6CA 5FY1A 4ONUA 2W1WA 1PVC1 2YC0A 4MHRA 1Y4WA 2XHNA 1RJ8A 4XUQA 1JZ6A 4AVSA 2A6XA 1CIWA 2DBNA 2RDQA 5BPXA 1ZBE1 3DV8A 1N3PA 2UURA 1REFA 5FZ7A 5C8WA 4CP9A 3WF2A 2GC1A 4FFIA 4HANA 2DVBA 4XUOA 3I2JA 2G9GA 4YG3A 1WA4A 5DAQA 5FZGA 2JB8A 5SV8A 5A3TA 4LBNA 3KQ4B 3DECA 5FUIA 5A7NA 5LRRA 1PZ8A 2ZGQA 1G86A 3GBFA 5A3LA 2WT0A 2EIGA 2HWD2 5ACA1 2NQYA 2XH6A 1D7PM 5C4WA 2CAVA 1KRIA 1VRBA 4MADA 5C4WB 1SLLA 2E51A 1PM4A 5KBFA 4NHLA 3SH4A 4D3WA 4EN7B 1JN2P 1FPN2 1W0PA 2J1EA 4NHXA 1XU2A 2AREA 3VKOA 2MHFA 4B4PA 1VMFA 1AXYA 1LTEA 5JXJA 2JDKA 1FATA 4ATEA 5CYYA 3SXWA 4CEWA 1W0OA 5JZGC 3T08A 1BKZA 3H42B 4Q5OA 5EP9A 4YM3A 3I59A 3MYXA 1G6NA 2VGDA 2ZEWA 4CEWB 4N53A 2IWGB 5T54A 2BGCA 5JMCA 2LM3A 2A6WA 3T2PA 1RUE2 4N53B 5A32A 3WEZA 4P9JA 1PMHX 3RG0A 5A32B 5LCWL 5C3OA 4D7YA 3ES1A 4E8DA 2AH2A 1KGYA 3VBOA 4AW7A 1VB4A 4Q26A 2VTFA 1K12A 2VY0A 3DEMA 5L73A 5C3SA 1ZZ7A 1FX5A 3AMNA 3VBOB 3S7IA 2IXLA 3O0XA 1DCSA 1H8TA 2QUOA 4N9IA 4YW4A 5T52A 3O1MA 2QKDA 3OJBA 2ZHMA 4JGYC 4LUMA 2Y33A 1CWPA 1H8TB 5KC5A 5LBBA 3WNKA 4NMIA 3B02A 2JIGA 5EWSA 4CDWA 4Z82A 3ELNA 1WW4A 5JIAA 3SEEA 4GB33 1ND2C 3AYAA 3A22A 4XQ4A 2P3KA 4CDWB 1G9CA 1UKRA 2FMDA 2J1VA 1OBNA 4ASMB 3AKRA 2IFRA 4P5YA 1SCRA 1W9WA 3LD8A 1MZFA 4CUCA 5A7PA 1PZ7A 2BVBA 4L11A 4NE9A 4Y1ZA 4A7YA 2YB7A 4XUPA 1EAH3 3M3IA 2WO2A 4DEQA 4A6SA 4C1XA 2DUOA 4C90A 3FUOA 3PU8A 3DN7A 4UXAA 5CKQA 2CV6A 4Q4W2 5F8PA 1AZDA 3FJSA 3I2KA 4I0BA 2HWC1 5FWJA 5CAZA 3DKQA 2VAUA 3OB8A 4AFDA 3IWZA 4LMFA 4AEMA 3WDWA 4BM8A 5FZEA 1NXD1 1SBDA 2X29A 4EWDA 1AL23 5CKNA 2WO3A 2YZ4A 4META 3MF6A 4XVHA 4XFBA 2ZEZA 2KM2A 1YXWA 3ZFFA 3WG4A 1COV2 4I30A 1UIJA 2ZACA 1GWMA 3ZFFB 2D43A 4MGSA 4QDSA 4GXLA 1SQ4A 2ZGSA 3EQEA 1JZ4A 5BNNC 2Q8OA 4Q4Y3 4LT5A 3TN93 4LULA 4EJRA 4WVVA 4CCKA 1Q8QA 2Z2SB 4MSVA 1STMA 2F6BA 4M3CE 5FV3A 2YV8A 3ZIWA 3SNMA 1AXKA 4D94A 4GKXA 2R7EB 2OYZA 2DUQA 4Q2FA 4BJ0A 1H30A 4BMBA 3POFA 2YY1A 5FY7A 3H50A 2BNOA 4EZHA 1K42A 4YW2A 1QOTA 1MS9A 2VVEA 5JUVA 1YRZA 1H2NA 5FO7B 4KGGA 3IIAA 3K75B 5JOYA 1REDA 1YQ8A 4FQ4A 2ZMLA 3AMMA 2WFF2 2Y26A 2YC4A 2ORXA 2FDGA 2P4EA 5GLTA 5FPZA 4XYXA 2XLAA 5HCHA 2XUMA 5LY2A 3ZFEC 3VD5A 4MZUA 4BLJA 5FAXA 3ZMNA 4U36A 5FYIA 3NKGA 4AXOA 4HK8A 1O91A 4COWA 4N90A 3VD7A 1UQXA 3MW3A 3NNLA 2HWE1 1RMU3 4ISQA 3GGLA 1YIFA 4UF0A 4Z2WA 1JZ2A 2CWMA 4A44A 1KFUL 4UF0B 3B5LB 4NPRA 4A42A 4AI8A 4ZHNA 1UZVA 2IXCA 1LGNA 2XVKA 4HKWA 1XYNA 5FZKA 1OA4A 2TNFA 1B09A 4E2GA 1Y7BA 1DP0A 1HB4A 2D6MA 4E8CA 4W8JA 4A6OA 3GZTB 1POV3 4OMCA 3WF3A 3ABZA 3DKWA 4LHLA 3BYWA 5BNQA 1JH5A 5JSOA 4HN0A 1RUF1 2GAUA 2K9ZA 1O7FA 4XXAA 5A3OA 3WVJA 1UYXA 1W0NA 3ZN5A 3ZXFA 4N7IA 1BEV2 4UW5A 4HVRA 1U5XA 1WCDJ 1UOBA 3VKFC 4NUBA 5IATA 3T4VA 3ZKYA 2HKXA 4RS5C 4IEVA 3MW4A 4YVWC 4A7KA 2QQVA 1OURA 1F31A 1UZWA 1BBT3 5CA6A 5A6XA 3MUZ1 1B35C 4NRPA 4MVTA 4Q0PA 4EZ4A 2D98A 1Q56A 5AFEA 3VBRA 1CZSA 3BTXA 4M4RA 3WP6A 3VBHA 3VBRB 4Z07A 4FQZA 1WKYA 3VBHB 1LGBA 1UN1A 1ZZ8A 2GNTA 2V72A 2VZTA 1LNSA 4KWUA 1RITA 3B01A 1NZIA 3J8F3 4Q4V1 4XURA 5EJ3A 4C0BA 2CNAA 5F2SA 3O1UA 1J1TA 3AMQA 3FLRA 5JOXA 1LRHA 1PIV3 1CQ9A 2D6KA 4FFFA 1VPHA 1SDWA 3GM8A 2PLV2 4HPKA 1S0IA 3I2GA 2BBAA 3VBFA 4QPIC 3SITA 2V4AA 4H7MA 2PTMA 1JUHA 4HPKB 2YFUA 2R071 3ZSLA 1GNZA 3VBFB 1UO9A 1AR62 2XBO1 2W1UA 3GZEA 2JX9A 4YW7A 1PMIA 2E9QA 4XTMA 4OCTA 5C5TA 1VR3A 4XPVA 3KB5A 4FTEA 4FAGA 5C7GA 1HB2A 1XPWA 2Z5WA 1PO13 2MNGA 4QQ2A 1AR83 1S2BA 2VCMA 2YU1A 4GB32 2FDFA 3ATGA 4W6YA 1WLTA 5T5LA 5DQ0A 3CO2A 4JV4A 4LBQD 3AKPA 5F3IA 4ZZ5A 4ES9A 2AYHA 4XAAA 1FXZA 1AR71 1LOGA 1ZZ9A 3ACLA 2EIDA 3LFIA 1EAH2 1YQ2A 3UGGA 4B29A 4BLIA 2HWF3 3WQ0A 1DQ5A 4JX0A 4P00B 4H7LA 4AI2A 2O1QA 5B4XA 1FI2A 5DN2A 2EAKA 5ERLA 1RUD1 5A6ZA 2VZQA 1VAVA 2LALA 1URXA 2GN3A 2WO1A 3ACGA 2P2KA 5JAXA 2SLIA 4OUEA 5FZ8A 4TXWA 3ZMOA 3HR9A 3IMMA 2GH2A 4YM0A 2WINB 1QJY1 1KJLA 2YU2A 1AYM3 4W65A 3BIWE 3PMEA 1H6XA 3WNMA 4L99A 3I3DA 3O1PA 5F3EA 4LOSA 4OQ8A 2F17A 2FCUA 1VALA 2BOJA 5IUQA 4E2SA 1RYYA 3G6JB 3KQRA 4Q4Y2 4HT1T 3K46A 5H9SA 3FL7A 1C8NA 4IETA 5T5JA 4O7XA 5E8AA 4ES8A 3WDTA 5G04L 2PHRA 3K77A 2W1QA 4YZ5A 3CMGA 3PUIA 1FMD2 3HNYM 5HXVA 4LJHA 4HVOA 4COZA 3IDBB 3VL9A 2O14A 3PVNA 1JYCA 4AFAA 5C33A 3KCXA 2QQIA 1POQA 3JD73 4ZU4A 1ND3A 3KF5A 3POBA 5FZIA 4B7KA 5DABA 5FP3A 1I5PA 1L7LA 1RB8G 1D4M3 4AEDA 4AK3A 5A6QA 5DZGA 3VDDA 2VMDA 2ARAA 3ZYGA 1W9SA 2FQPA 2OVUA 1IGOA 1RMU2 2A73B 3JB8A 3OGGA 1GZWA 3EXUA 4PLOA 1GOFA 3VDDB 1VJ2A 4XFIA 1GZWB 4AFBA 4BMEA 1BJQA 1VBB3 2ZGKA 4RGAA 4A45A 1H1AA 1AJOA 2ZJCA 1UXZA 3LSEA 1UY2A 3ZDSA 2A1XA 5FLJA 4Q8KA 3AXEA 2C26A 5HPOA 2JDNA 4KWLA 5GLZA 4XMAA 1KJRA 2G1MA 4DMIA 3LSDA 4JTOA 1AYN3 3W9AA 1HQLA 4PIXA 4FOVA 5FY0A 2TUNA 4K20A 4FFHA 4AGVA 3VHOA 1H2KA 3JQXA 3NW4A 4YVSA 2ZGRA 3ZSJA 1Z7S3 4AEJA 5JOWA 5I0TA 5JI9A 4YVSB 1IG0A 3OGVA 5FZ9A 4INDA 3ZXAC 1R083 2VMHA 1F5JA 4YZ4A 1RUC3 1LOFA 4KBZA 1BBT2 3IN9A 2V5YA 4ASLA 3KHBA 5A1AA 1Z78A 2VVFA 1OQEA 2UWBA 4CEWC 1NOVA 4LHKA 1FOD3 2P6HA 2ZTNA 4I01A 2VW2A 4PHZA 3PTRB 4W6WA 2UYAA 3GBWA 3M2MA 4N53C 4MGIE 2ZOEB 4IV1A 3PVOA 4NIIA 3U1XA 4CUGA 4XCAA 4IV1B 4QQHA 1UXXX 1RTVA 2FBEA 2PHDA 3VBOC 3J8F2 2LTNA 2FDHA 3AC0A 1ASJ1 4MGYE 5JXGA 1R091 2VD7A 1NA1A 4R9CA 3CEWA 1I6XA 2HYXA 1POV0 4QPGA 1H8TC 1NA1B 3JXSA 3OBAA 3WOGA 3PIJA 2ZHKA 4QXCA 1GP5A 4QPGB 3T09A 2J42A 4PJYA 4DRVA 2E31A 2RJKA 5FO8B 2MEV1 4Z1VA 4CDWC 4JKLA 5LZ6A 1QJX1 5I8SA 1JYTA 4QX2A 4AI1A 3MIHA 3AM2A 1BYHA 2GMEA 3X29B 5IT6A 1CONA 2VOWA 2ZEXA 1PO12 3KV6A 1WMDA 1AR82 4RSUA 1JYNA 1TNFA 1TME3 4DPNA 3C3VA 3USUA 1R1A2 4IUGA 4G9SB 3USUB 1NT0A 2ZGMA 4K6BA 4XACA 2W95A 3D0SA 4L8QA 3M1HA 1QJU1 3KLSA 2ENRA 1BMV2 3E97A 1QU0A 1ENQA 2HBUA 4FPOB 1S0FA 2HWF2 4PDWA 4Q0UA 1HV0A 3M3CA 3SMHA 1SLTA 3MLJA 2XJQA 1GNYA 4MXVA 5IVYA 4LO8A 2W0XA 1RVF1 3CJIA 2CGPA 4QGLA 3ST7A 5ISLA 4OHZA 5CADA 4XETA 4CCMA 5FPAA 3CJIB 3M3OA 2IC1A 3NNFA 4GALA 4IE0A 2VMIA 3DUIA 1PGW2 3ACFA 3GF6A 5DAVA 3ZFFC 2VG9A 4NRQA 1OVSA 1HW5A 1A6CA 5CISA 3RI8A 3M70A 5A80A 1OQ1A 3MW2A 2P3YA 3T2TA 1W9YA 1MZEA 2PHFA 2RS33 2EALA 4R9AA 4V2WA 1QXPA 4CE8A 3POWA 3AJYA 3B9CA 1JZ7A 2Y6KA 4MYEA 5T5PA 3NQHA 4MOAA 3VN4A 4QU1A 5C3QA 3NL1A 1T6GC 2CDPA 1HRV2 1LJ7A 1SFPA 2GNDA 3OPWA 3WP5A 4LUKA 3BTYA 2JKBA 2J22A 2VQAA 1SG3A 3NJXA 2Q30A 2PQSA 3N3HA 2ETEA 4UWDA 2VULA 3OY8A 4MX3A 1UU6A 4YGCA 2FHRA 4L9BA 1JS9A 3WG1A 2VQUA 5FXZA 1FPN1 3OY8B 2W91A 2W1SA 1GU3A 2P3JA 3PVBB 4AGRA 4JRLA 4H2AA 1AL0G 1TVGA 2B9VA 2RMU3 3BB6A 2ZMKA 3ZSKA 1WZXA 1AUYA 3JD72 3N9OA 3ZLIA 4DXSA 2ZEYA 4WVMA 4I02A 3RQ0A 1AR93 1FNZA 1RUE1 5A3PA 2R043 3LZZA 1VBD1 3N7JA 1NX9A 1D2QA 2YYOA 4WVMB 2KA3A 1LENA 1XE0A 1QOSA 1D4M2 3DL3A 4IEWA 2PAMA 3CDZB 3LEKA 4QM9A 3V0BA 3I4IA 3PJYA 1IZ3A 3ZN4A 2RS11 3H8XA 1HB1A 1O8SA 3A21A 1WA6X 3KT4A 5KHJA 2WQ4A 3WP3A 3WNPA 3V0BB 4HMZA 5IK5A 3N7MA 2UWAA 4BXFA 3N9LA 3APBA 4UFLA 4QHZA 2XONA 3JBG3 1VBC2 4HFSA 2XJRA 4LEJA 2D3RA 4YNIA 1RXFA 5DXDA 5DUXA 1PO22 3D3AA 2Y0OA 4B4RA 1WMEA 4JGZA 1NYWA 5CEHA 1AYN2 1O4ZA 4BQ3A 5JPNB 5L19A 1GZTA 1FT9A 2J1SA 1CZTA 1KD7A 3N9QA 4GMP3 4JGZB 4LK6A 4XFFA 4CPBA 5K8SA 5LA0A 1O4YA 2RS52 3SC7X 5C71A 1JHNA 5FFOC 4COVA 1YHFA 3BPZA 1MS3A 1Z7S2 4JC1A 4JQTA 2ZZJA 3E5XA 5J96B 1RIRA 3FMGA 4GKYA 1E5RA 5FPBA 5FZCA 1OOPA 1CZVA 1RUC2 1SACA 1ZZBA 2WSVA 2IFWA 3OPZA 2VBPA 3DYMA 3VBHC 3WW4A 3ZN6A 3O1SA 1OOPB 4CP1A 4XUTA 3ZN6B 1UX7A 4S2HA 4Q4W1 1FOD2 4QB2A 1G7YA 1W2UA 3NV1A 3ZXEA 1J3QA 5FOJB 2Z4FA 3POIA 1H8VA 2VZVA 2WZR2 4HETA 4QDQA 5HI0A 2VZRA 5L9BA 3KWVA 3PJQA 1F5FA 3CNAA 5CVRA 1YLLA 3I3EA 3MIDA 1COV1 1PHMA 3BALA 5FKBA 1KEXA 4D0QA 2CDOA 4D6QA 2WAOA 3FWEA 2H0BA 4WM7A 1XNCA 4MO3M 5A1LA 1WW6A 5CKMA 1UKGA 1H2MA 4J25A 3AP5A 4WM7B 3TNQA 1QDCA 2CL2A 4Y1YA 4AI3A 3K4DA 3ZXLA 4K7JA 3NV2A 4UFKA 1ULOA 5FYBA 1HDKA 3HBKA 2XVLA 4IEQA 3S57A 1Y9MA 3UV9A 3I3QA 3K51A 5BXXA 3MICA 4XBLA 1AXZA 5LEJA 3UJOA 2YHJA 5A3NA 4RGKA 4JTNA 2P37A 2WFF1 1TME2 1DQ0A 2I45A 1VMHA 4ARXA 1BVP1 3NNGA 1ULCA 3BCWA 2P3IA 3H9AA 2JE8A 2E53A 3VZOA 3OG2A 2J1AA 4CXXA 3LF7A 1GUIA 3ECQA 4WM8A 2RM21 4F7ZA 3VZLA 1EV13 1RINA 4HVQA 1OI6A 5HCBA 4KQ7A 1O5UA 2GP3A 4WM8B 1OPOA 1UYZA 4CXYA 3JU9A 3Q8CA 2NLRA 2EIEA 3OTFA 4BOWA 1LHUA 2YMZA 1UU4A 1KDMA 1UIKA 4E9KA 1YWKA 1C5HA 1QMJA 2JDUA 3W5NA 5FBJA 4GH4A 3ETPA 2L9LA 4QHBA 3WW3A 3ETQA 3ZYHA 4LBLA 1CD3G 4GH4B 3FHQA 3A0NA 3HNBM 1OFSA 1VE0A 2WRAA 3ZYRA 1JYWA 3IMNA 3H7JA 4QXBA 2RS32 5FUNA 1IS3A 1G9AA 2QQUA 3WUCA 1BEV1 4IESA 1V00A 4M3CA 4MV2A 3ZXGA 1SEFA 2BOIA 4M3CB 4P9IA 2OXBA 3MZHA 2BV4A 4E4HA 4XF9A 5LWBA 2AUYA 1QXJA 2C5DA 2GMPA 2DVAA 4BQ5A 4PT6A 4YPJA 4UBHA 4QT6A 5FZ6A 2NYYA 3P3PA 5FIXA 3ILFA 5GZFA 1OUXA 3GZAA 1OSGA 4OHYA 5J1XA 1C1LA 2O0OA 3QCWA 2RMU2 3IDAA 2HWB3 2J1UA 3VDDC 2YFZA 3JB4C 5FP8A 1XYOA 5HCAA 1AR92 4QD2A 2Y0IA 2R042 3Q8BA 4K8FA 1HRI3 1W2TA 1E5SA 3F2ZA 1ZRCA 4XHXA 2KD7A 2PLV1 1UMIA 4KNCA 4CP9B 1V9U2 2DTWA 4NVPA 5DG1A 2Y6JA 3IDCB 1JODA 4GULA 3UETA 5ABJA 1YCIA 2DCYA 1ZRRA 1AR61 2EXKA 2VNGA 3ALQA 3EO6A 4GJYA 3PLQA 5ABJB 3ZXDA 5I91A 1DQ6A 1X8EA 2WWUA 2C24A 1EPZA 2ET1A 3NJYA 4R52A 5JWPA 2OKXA 4YZ3A 3M8LA 1NCQA 1PX4A 5EZWA 3WG3A 1NCRA 3JBG2 4PF5A 4TYSA 4AI0A 4YG6A 1GZ9A 4FPHA 2I2SA 2ZXQA 2C9AA 3ILNA 4L0PA 1IOAA 1NCQB 4PI0A 4ATFA 3RZHA 1NCRB 3U78A 3FHIB 3I54A 4YVSC 4IEYA 3NO8A 4GB31 1YJKA 3J26N 5AC93 3KCYA 5KXEA 1MEC3 4DZGA 3KV9A 3O1VA 3J7NA 4RL7A 3N4MA 2NP0A 1LOFC 3VHNA 4BQ4A 3VV1A 1X9TA 2R16A 4NAMA 5DDJ2 5FZ1A 4AVTA 2QBXA 1EAH1 4CEYA 3E1F1 2AEZA 5GKAC 3I59B 1OUSA 1C8M2 3WQ1A 4AQSA 4CEYB 4DQAA 3OSDA 3W5MA 1GSLA 2VW0A 1LOAA 4OHWA 4IV1C 1ODMA 4A4AA 4DUWA 2D40A 4AFCA 5HXMA 2QNKA 1ACCA 1MVQA 2RJ2A 4R4XA 2XPJA 1H1MA 4JCKA 3FUQA 1LOBA 3AZZA 5C8CC 5FZAA 4C8DA 1X50A 1DDLA 1NA1C 1N3QA 1O8PA 3DXUA 2AZ5A 3VBSC 1CAVA 5F3GA 5A7SA 4FBFA 3S6PA 1YEWA 5KC6A 4QPGC 3NV3A 1QQP1 4XUNA 1VBA2 1E5HA 2MPFA 1CAVB 4LXLA 1HV1A 4UI9L 2NN8A 5DG2A 1I1EA 3PNAA 3OYWA 4EN0A 4NO4A 3VBUA 1LKNA 3FN9A 1QJFA 4Q4Y1 3OYWB 4NAOA 3VBUB 5JLVA 5L9VA 3E5UA 1N3OA 2A6ZA 4DNYA 1ULEA 5CBLA 3J7MA 4GMP0 4AI9A 5CB7A 1UPSA 1O4TA 5F1RA 4Q0VA 4JDMA 3N35A 4YWAA 5GLWA 1W06A 4P9WA 5ACA3 1SFYA 3ACHA 2B4KA 1FMD1 4EQVA 5BYNA 2D7FA 3H1WA 4JDOA 1ENRA 1SLAA 2PXJA 3N9NA 2Q8DA 1RUG1 3THPA 1K3IA 1W3XA 1JTZX 3I8TA 2WWSA 5LBEA 1ZYBA 3WR0A 5FBZA 5IAXA 1APNA 2OUHA 2D6PA 1W6QA 2ZS6B 2JD4A 1ZRFA 1W8FA 1BXHA 1HXS3 4AVAA 1RUJ2 2XWJB 3CJIC 1W6QB 2GC2A 2WA4A 5EJZB 3ZKUA 3A7QA 5IVCA 1OF3A 4QQOA 1RMU1 4GZ9A 3PURA 4B1LA 1DZTA 4HL0A 3RJRA 2JG9A 5L7OA 3O14A 3SCHA 2QJVA 2YBPA 2JG9B 5L7OB 4XAEA 1IPKA 2VMCA 4AQ6A 4CCCA 2BGOA 2WQ8A 5KR7A 1DLLA 1O3TA 1TE1B 1EY2A 3WNOA 4ZS3A 1YQ6A 4E4SA 1JZ3A 2BZDA 2E32A 2GZWA 3USSA 3O1TA 4FOYA 4JKKA 4QKNA 5FYZA 3OUIA 4KU7A 1A78A 2Q5TA 4LIUA 3LFMA 4NIAA 1ZBA1 5M0TA 2D3SA 4P9YA 2WA3A 3TEWA 3PVEA 5CG8A 4F3JA 4QAWA 2W46A 4BYYA 5IVFA 4XOGA 1BBT1 1VAKA
chains in the Genus database with same CATH topology
2X5IA 4YLZA 2ZGUA 3DGTA 2PAKA 2X5IB 3DPRA 3ME2A 5E16A 1NZCA 2PA7A 4B8EA 3DPRB 3EHKA 3GZUC 4XJWA 4X6RB 3CU7A 4BA6A 5I0UA 2W08A 2HWB2 4QGNA 3NJZA 2RR13 3J8F1 4LBQA 2Q0AA 4Q1RA 1O3QA 3QD6A 2NZ9A 5I8YA 1LU1A 3L9JT 4LBQB 4MXWA 2BPA2 1HRI2 1PGL2 1ULDA 4MXWB 5H9QA 5A3MA 1UL9A 3WUDA 1MZ5A 2DVDA 3FC0A 4AVBA 3IDEA 3W58A 5LK7B 5LK5A 4HSJA 3M3QA 2R6QA 2TBVA 4HK9A 1YUDA 4JGZC 4QQLA 1RUOA 4N9HA 1UZZA 4J1XA 4UW3A 2N7GA 3H1MA 2B45X 4XF4A 3E6BA 2E7QA 1PO11 4YRDA 2YUEA 4YM1A 5DZFA 1R1A1 1VBE3 1DU3D 4FOQA 2ZABA 4Q4X1 3WDUA 4CDXA 1OOPC 1UPIA 4LE4A 4IV3C 4CDQA 4CDXB 1DHKB 1LHVA 5FMOS 4NN0A 5AFBA 1LODA 4RQPC 4CDQB 2HWF1 4AHZA 2BQPA 3D4KA 3WNXA 4XZPA 5GZCA 3S0MA 1A8MA 4RHV3 4YARA 4ZKTB 4G4FA 1PGW1 2HWE3 1Z0HA 4XJZA 1D2SA 4IEPA 2W52A 1GZCA 4WM7C 2X8KA 1KFXL 1W6NA 2OIIA 4Y1UA 3PHMA 4NWWA 3TAYA 1WBLA 1ENSA 2IXKA 3D8CA 2A6YA 4P9GA 2QVSB 1OHFA 1AX0A 1RHI3 5K0UA 5CG9A 1JUIA 1YFYA 1WLCA 4JQRA 2JG8C 1DQ2A 4Z8BA 5K0UB 1HRV1 2E7TA 3WXPA 2YGLA 3URFA 1YO8A 1ZA4A 1DF0A 4XDQA 1S1AA 1HQWA 2WLQA 2ZX1A 2JDZA 3MFCA 4HKLA 4BH9A 5ACA2 4L2NA 1DYKA 3EJKA 1SBEA 1ZZ6A 1PK6A 3JQWA 2DCZA 3B00A 4A7ZA 4LE3A 1Q8VA 1PK6B 5JOZA 4WM8C 1IS4A 2ZA9A 2PYTA 4TLFA 3WX5A 3LOBA 1AL22 2CYFA 5D8AA 1HXS2 4TSVA 1D4M1 1TEIA 5D8AB 2W39A 3POYA 5BNOA 1LHOA 4Q4V3 2ET7A 4GH4C 5BNOB 2VUJA 1WW7A 2DCTA 1ALYA 5CFCA 2BNNA 2QDNA 3AZWA 4J6GA 1Y43B 3TN92 4B3NA 4AEDB 5CFCB 5AC91 1DZRA 1X8MA 2XGXA 2XJSA 1VBC1 1XRUA 2A5ZA 5GM0A 3JCIA 1S0DA 1PO21 3OGJA 2R073 4N43A 4NHKA 5KHIA 3FX3A 1AYN1 4N43B 4FPEA 4LHNA 4PCRA 4URTA 3R4SA 1OKQA 2RS51 1BCXA 2VUAA 1Z7S1 4KL1A 2NPIA 2G9FA 1CAWA 1SMVA 5KXBA 2GU9A 3BODA 1RUC1 1CAWB 3J4UH 5C9AA 1ND3B 3QLQA 4I0AA 1CN1A 1NY72 2D6NA 1AR73 2DU1A 3UKVA 1FOD1 5C9AB 2GH8A 2RHPA 3AYCA 1CPNA 4KG0A 2R30A 3P3NA 2WZR1 5I8TA 1WCSA 4CP2A 3C2UA 3LA3A 4XJUA 1IPJA 4QQPA 1KS4A 4DS0A 1RUD3 4I3GA 2X53S 4IEZA 4YFZA 1IHMA 5BV6A 2RR12 1DGRA 1UF2C 2WKKA 3O12A 5ABJC 4PBPA 2XB6C 2VXRA 2ZGLA 1PGSA 3WP4A 1QKQA 1GR3A 3QBQA 5C4WC 1NCQC 1D4VB 1NCRC 3CL1A 4Z92B 1W6MA 4M0NA 3LGRA 4I09A 4FXKB 3RYKA 4BIFA 2DVGA 2CTVA 1W6MB 1Y3TA 2PHXA 2UY8A 4WZFA 4XJ9A 3NAPA 3BTAA 3OD0A 1LCLA 4XILA 3IM0A 1TME1 1VB2A 2Z69A 3NAPB 1VBE2 4IL7A 3MIGA 4CEYC 5I93A 2Q4SA 2NMNA 2JJ6A 2D93A 4MUVA 2HEWF 1H9WA 1XE7A 2PHTA 1CR7A 5KHHA 1QY4A 3ROUA 3V0AA 4XJ8A 1VAMA 3KSCA 5GLUA 2GC3A 4I0WB 1FNYA 3V0AB 1ULGA 1WLDA 1MS1A 2A6VA 1RUI1 3GYDA 4YGBA 3U07A 1PIV2 4XQWA 1EP0A 3H0OA 4RHV2 5H9PA 1NLRA 1IS5A 3EBRA 1PM7A 2CWSA 2CGNA 2HWE2 1OA2A 4OUMA 4P14A 1KITA 2ZX4A 2RJLA 1G9BA 1J1LA 3LAGA 3AK0A 3VBUC 3V56A 5JIUA 1RHI2 1RGSA 1QF3A 1CPMA 2VOKA 1J3PA 1HX6A 3E6CC 2BWCA 1NQJA 3RRDA 3WY6A 2ZX0A 4YSFA 1L3JA 1H1IA 4AHYA 4LBMA 1H0BA 3THTA 2VMGA 1A8DA 4PDWB 3GALA 3WV6A 5IK4A 3TRSB 1LOEA 5F6LB 4MGZE 5EXOA 2WFPA 4X8NA 1S0GA 2DV9A 1U5YA 3U11A 1Q5OA 4YW1A 5JR7B 5FLIA 4Q27A 2R041 5LEKA 4XEZA 1Q8OA 1U5ZA 2QCSB 1DGWX 3I7DA 4DFSA 4CP0A 5L7OC 1AYM2 5EYXA 4QXKA 2QZ2A 2AGSA 2NM1A 1V9U1 3MF9A 4ORFA 5C6CA 4Q4V2 2VNRA 3WT3A 2VNOA 1SBFA 5BNPA 3LA7A 3HT2A 4NOTA 4EROA 2HWD1 4LBKA 2V09A 1WW5A 5BNPB 5JSPA 1F8VA 1F2NA 4D7TA 2JE7A 3CJXA 4XMIA 4FPCA 2R072 2MEV3 1DIWA 4AQ2A 4BQ1A 3L2YA 3OF1A 5BUVA 2BUKA 3D6EA 4QGMA 5DDJ1 1OA3A 2X5IC 2WJSA 1AX1A 3DPRC 1LU2A 1C8M1 2DVFA 3VGIA 4D7SA 1DYPA 2ILMA 2R32A 2CGOA 2VPVA 3LKJA 3KS7A 5FO9B 1BQPA 1U0AA 1WGPA 3H8UA 1MR5A 4OHVA 4IQPA 4EN6B 4YW3A 3WLUA 1RVF3 4N7UA 1VP6A 1VBB2 1GFF2 3B93A 2WT1A 1LGCA 4MGKE 4F8AA 4WZCA 1GNHA 5J3UA 2BFUS 1VBA1 1ZNPA 3NVCA 3VZJA 2WZPP 3VLBB 4Y1XA 4BZ4A 2B5HA 2WNEA 2PELA 4NHMA 2PHUA 3I2DA 1NG0A 2XJVA 2OUJA 5FLHA 1J59A 2K2SA 1XYPA 3ZSEA 1S0BA 1IS6A 2KXLA 3FZ3A 4P5HA 2EVXA 3OBRA 3VBRC 1R082 4UW6A 4LNVA 1M4WA 2VH9A 4UW4A 1XNBA 1PZ9A 1RL3A 5KXDA 3MIEA 2BVVA 2XJTA 3SCGA 1J3RA 2H0VA 1V6IA 5E1RA 2HYKA 3LB9A 2XL9A 3PMSA 1RUJ1 3E5QA 2WT2A 2YDEA 4AYUA 1BVVA 1AX2A 1OLQA 3VBFC 3KGZA 4R9DA 1RUE3 1RUNA 1VBD3 1UCXA 3MFAA 1ZRDA 4M00A 1O3SA 3S7EA 2EAAA 4JRAA 3R4UA 3TWIA 4RFT0 2RS13 4V1PA 4BHPA 5JCTA 5FMOL 5K0UC 3Q9OA 4FXGB 4XBQA 2OZ6A 2CY6A 2D3PA 2WIIB 5F6KA 4C1WA 3LA2A 4Y4YA 5FRAA 2WS93 1LEDA 4R4ZA 2P17A 4PBOA 2V73A 1FV2A 1QDOA 1QOOA 2E7AA 2ATFA 4NWVA 2D44A 2ES3A 4TWTA 2PFWA 1X7NA 2ZX3A 1Q3EA 3MLLA 3M4FA 2R49A 2PHWA 1PK6C 4XFHA 4K1ZA 2JENA 3MIBA 1OLRA 2D6OX 1CVNA 1VRH3 1KXGA 3H7YA 1WUVA 4ZU5A 1QGLA 2EA7A 1FYUA 3G7DA 3HQXA 4RGGA 1QXRA 4EN8B 3FE5A 4Q4W3 3KCCA 5BNOC 3UK9A 2O8QA 4HKOA 2Q1MA 3CF6E 2WNVA 3HT1A 2WL1A 3ZX7A 1PGL1 2WNVB 4ISRA 3AZYA 4XFGA 3AJZA 1COV3 1CESA 1W6OA 1WD3A 3AFKA 3RMYA 3NSTA 1W6OB 4Q0QA 1DG6A 3KM5A 4N43C 1N1SA 4XXPA 1LR5A 4LLOA 2NMOA 1YFWA 3FFZA 4EV0A 4YM2A 3IBMA 1X33A 1SLCA 1XQNA 3TOJA 4LA3A 1JBCA 1REEA 3AXDA 1ND3C 1TMF3 4BE3A 5JI7A 4FO9A 1XNDA 2A3XA 2Q1ZB 4YFWA 5FCCA 3VHRA 3AFGA 4AEDC 5J7MA 2WFF3 1RC6A 4YW5A 4AVVA 2ZGPA 1E57A 4CDUA 4FP3A 3B9IA 3AKSA 5GJ6A 3RJ2X 1DQ1A 5DUVA 4CDUB 2RM23 3D0JA 1UX6A 3O0VA 2WC2A 3ZXKA 3MGUA 3RNSA 4Y20A 4QU2A 1HLCA 4XE9A 4OI1A 4Y20B 1G9DA 4QX5A 1QHDA 1V6OA 3ZXJA 5E89A 4R8HA 3ZFGA 3RDIA 3ZFGB 1VLNA 2A75A 1ULFA 2VOXA 2AENA 2WQZC 4M0HA 1TQ5A 1JW6A 5AVPA 4E4DX 1QJZA 1W39A 4R9BA 3VKLA 2OZJA 1BEV3 3QACA 1SLIA 2DWRA 1IKQA 4IEUA 1ZX5A 3NAPC 4XFAA 4PQ9A 5H9RA 4BCUA 5J98B 1RUH3 3HMYA 2W68A 4DINB 1S2KA 5CIRA 1V6NA 2PAEA 2R063 2ZAAA 1IKPA 4LO4B 5L36A 1M06G 4GA9A 4FSJA 2ZGNA 3HIFA 5LRSA 3U4XA 1X36A 2JECA 3R6SA 3ZPYA 1AL21 5T3NA 3O7OA 1HXS1 5TSWA 4K40A 2DCKA 4AEKA 1PVC3 4XHBA 3INAA 1GANA 4QMAA 1ZBE3 2P34A 2R0FA 4KH9A 1VBD2 2XG3A 3TN91 4HN1A 3ZSMA 2PLV3 2IZWA 1XE8A 4GIQA 3BOWA 2RS12 3VZNA 1AR63 5SV5A 2XLFA 3OBTA 4Q8LA 1I3HA 5I0RA 4AHWA 2XL7A 4BPZA 1OMIA 2XWBB 2WS92 3LCPA 4G3YC 3TYJA 3W59A 2Y38A 1OQDA 4PDWC 1ZZCA 3ZVXA 4FPJA 4QM8A 2FZ1A 1NY71 1JXNA 4XIKA 2QQPA 3L2HA 4P9LA 1EV12 4DRRA 4E27A 1AHSA 2UYBA 2GN7A 1VRH2 3AX4A 4KGQA 4W6XA 4RR3A 3IT8A 4K9SA 3AP9A 2GALA 4RR3B 5JVVA 4SBVA 1CX4A 4OZXA 2RR11 1POV1 4XF0A 1Y9QA 5BNPC 3KMHA 1N1YA 1LHWA 3RPQA 3GNEA 1C1FA 4KWKA 2RE9A 3WINE 2OPKA 1QQP3 3QH6A 2BWAA 2JICA 4H55A 2GDFA 2DURA 1AF9A 3FBYA 3PTYA 3LWCA 4CRQA 5KXCA 1IQAA 3ASIA 4COUA 2DFCA 1K5MA 1UAIA 4OULA 3UKTA 1LECA 1VBE1 2A3YA 1K5MB 5JSRA 2XLGA 3RYRA 1FMD3 4YGEA 1TMF2 3WD5A 5DUUA 1MQTA 4YZ1A 2ZHLA 1RUG3 1NLSA 1MQTB 1D0GA 2HWC3 2WNUA 2BNMA 5J48A 5JDBA 1YFUA 4XIOA 3TNPB 2UY9A 4FPLA 2WNUB 1PIV1 4Q29A 3AZXA 1LB2A 4RHV1 4M3CF 1WCKA 2RM22 5DZEA 4FPYA 2ZGOA 4L92A 4C0HA 3WW1A 3HWJA 3VL8A 4Y26A 4KG8A 4O9GA 4Q1PA 3ZYPA 4H14A 5CFDA 1GQHA 2GNBA 1GICA 1RHI1 1YNAA 1AR81 1OPMA 5CFDB 3POSA 3V65A 1DBNA 4K1YA 1MEC2 3WQ7A 4OHXA 1ZBA3 3S30A 1BMV1 3B7MA 2QZ3A 2BFUL 4Y5Z0 3JUUA 5DUWA 3AP4A 2CAUA 1DGLA 1RUH2 4GWMA 4LLFA 4CYDA 2R062 4OI2A 4EWEA 2HJIA 1J58A 3MPBA 2ARXA 5I0SA 5KWRA 3GBGA 5EV7A 1QNYA 2EXIA 2A71A 3B69A 1AYM1 1PVC2 1SCSA 1W6NB 5EYYA 4XF1A 5FOBB 1YYNA 1R1ZA 3QH7A 1PNGA 3KGLA 5E88A 1ZBE2 2I07B 3B94A 2JXAA 1CJPA 1RUF3 2YXSA 2DCJA 2ZBJA 1EYBA 3RSJA 1YI9A 3RZZA 1PVXA 1I9RA 1N47A 4FTBA 2D97A 2ERFA 3MDPA 4ZU7A 2ZAHA 4Q0SA 3AMHA 1FV3A 2I74A 2XKPA 4JAAA 1MVEA 1G9FA 3JD71 1R1A3 4L97A 2UWCA 5FTTC 1JYIA 1LESA 4Q4X3 1C5IA 4DOUA 4FT8A 3E6DA 1XNKA 1O5LA 4KWJA 1WMFA 1XU1A 3AMPA 2BTVC 3UL2A 1AVBA 3AKQA 3KT7A 1S0EA 3RS6A 4AF9A 4CTEA 2ZKLA 2QDRA 2WNVC 1C28A 1VBB1 5K7PA 1JOJA 4BIOA 4FVVA 2XBO3 4YG0A 4Y1VA 1H4HA 1MACA 2B9UA 3JZVA 4AFMA 4C91A 5HBAA 4AQTA 1ONAA 1QQP2 3FFQA 1V6MA 2PQQA 3AYEA 3ZYIB 4K21A 4YZ2A 1S55A 2WSUA 3R0RA 1C57A 2B42B 1DFQA 4O9EA 1R081 4FPKA 1HRV3 4FCAA 4DY5A 1HQNA 3VKMA 1V6JA 4OI4A 5F5QA 5FDBA 1W6PA 5F9TA 4X8PA 1MS0A 1W6PB 2DUPA 4CDUC 1RUG2 4XFCA 1C4RA 3MPPG 4S2FA 4PIZA 4QPYA 3RI9A 1V70A 2HWC2 1O3RA 3T1MA 2H6BA 3MIFA 4I2OA 2K0GA 1QWRA 1QJY3 1FAYA 1H4GA 1TNRA 3VUOA 4K3UA 5AVAA 1I5ZA 4OVEA 3M7AA 3GHNA 3ZFGC 3VKNA 2JEMA 1DGRN 3ZO0B 4ZXKA 3HN1A 2AR6A 5A33A 5KHKA 1MS8A 1U5IA 5AC93 2ZPXA 3FLPA 5A33B 2O8OA 4NR1A 1VBC3 2GC0A 1UMZA 3ENRA 2Z79A 1PO23 3D82A 3HD8B 1QH6A 1UW8A 2GNMA 1Q8PA 4RA0A 2B7YA 1UZYA 1LOCA 3NKTA 1ZBA2 2RS53 2HEYF 1NE4A 3K48A 4S2GA 2G4IA 2C0ZA 1DGWA 1QH7A 4KBBA 3N7KA 4IEOA 5JZGA 4RD7A 3RWNA 4YYOA 4SLIA 5JZGB 3LOIA 4I3PA 2BW8A 1OD5A 3QOPA 4IEXA 2A3WA 1VIWB 5T50A 1MS4A 2XJUA 2WZR3 3DF0A 4XW3A 4FAHA 3GHMA 1U12A 1MS5A 2RS31 4FPGA 1BK1A 1N1TA 2VQ0A 3BU7A 1HKDA 1X82A 5C8CA 3J9SA 3WDYA 2VECA 3U0ZA 2XVGA 4JGYA 3VBSA 1NE6A 2ZCWA 4OFGA 3RYPA 5C8CB 1RUF2 3B3QE 4JGYB 3VBSB 4B4QA 1DQ4A 2OW4A 1H9PA 4XBNA 4H3WA 1ND2A 2DF7A 4LBOA 4AE2A 3H1YA 1ND2B 2OA2A 1SLBA 1SFNA 4LBJA 2DFBA 5EFUA 1LEMA 3VZKA 2B8MA 2UU8A 2F4PA 2FZ2A 3V64A 2RMU1 3HAGA 4PLNA 1AR91 2ZX2A 4Q4X2 3H3UA 5GZDA 5J37A 2VVDA 3R4DB 2JG9C 3AP6A 4RR3C 2D5FA 3SH3A 1A3KA 3AP7A 4GWNA 5HCFA 5GALA 1G8WA 4AG4A 4LO6B 4A3XA 3N7LA 2GMMA 1ASJ3 1RUI3 2WLPA 2EXJA 1R093 3ZIXA 1UD1A 4UBGA 3TB0A 4LA2A 5IK7A 4DY3A 1C3HA 3JBG1 3SLIA 3UKNA 1KDKA 2B39A 1Q43A 2XBO2 5BNNA 4X6QB 4FTSA 3VHPA 4WVWA 1QJX3 3SH5A 5FPXA 5BNNB 4GMP1 1GLHA 4AHXA 2HEVF 2QFEA 4EWAA 1ZM1A 2ZZQA 1K5MC 4FPFA 2JE9A 2R1DA 3A4UA 2Z42A 4JDNA 3WDXA 2XHKA 1AR72 1MQTC 1QJU3 2A7AA 4KU8A 4AVCA 4EN9B 5K9YA 4XQDA 4E4ZA 1CAUA 4PLMA 2R1BA 3ZFEA 1MZ6A 2WNUC 4P9XA 1CAUB 3HBZA 3M3EA 3ZFEB 1HIXA 1RUD2 4XF3A 1WD4A 1GV9A 4A2UA 1QNWA 4E2QA 1S0JA 5CU1A 2PHLA 1QJY2 3IKWA 1V6KA 4MH0E 1V9U3 2VW1A 5KHGA 2QE3A 5CFDC 1BZWA 4M01A 2C1FA 3U10A 5J36A 4U2AA 4DXZA 2HWD3 3WCSA 1NQDA 4LTAA 3WDVA 5AC92 3FBMA 3SISA 3BOPA 3WHUA 4CDXC 4HZFA 2WS91 4LO5B 4CDQC 1GKBA 4RS5A 3IPVA 3OCPA 4YVWA 1WLWA 1FPN3 1ZVFA 1PNFA 3IPVB 4RS5B 2ZGTA 4YVWB 3TBDA 1B35A 1UU5A 3RMXA 1EPWA 3ES4A 1GBGA 1LULA 3MEPA 5DDJ3 4ITCA 1B35B 1EV11 2ARBA 1VRH1 5B2GB 4AWDA 1C8M3 2XKOA 5T5OA 1XXNA 4IV3A 1AJKA 4WV8A 4BWOA 3AKTA 4HLTA 4IV3B 4RQPA 4Y22A 1H2LA 3A0KA 5J09A 4RQPB 4Y22B 4LR4A 4DB5A 1CJDA 2SBAA 1N1VA 5GZEA 5FQ0A 3ILRA 3AYDA 2BBVA 4QPIA 4WVZA 2E6VA 5FQ0B 2IXHA 1VBA3 2BYVE 4PIYA 3O5SA 4IXLA 2VU9A 4QPIB 3MI8A 3ZYJB 2E63A 1KS5A 5JPMB 2D5HA 3FLTA 3D5OA 3WZ1A 1D0HA 2ZKNA 1CGPA 1GYKA 4MLOA 2YROA 3CLPA 3AZVA 1YIPA 3UJQA 4HBNA 2JG8A 4F83A 1DZQA 4IERA 2JG8B 4JVAA 1TMF1 2A70A 4XTPA 5D8AC 4CZSA 2HWB1 4J1WA 3WW2A 2DU0A 3WG2A 4COYA 5GZGA 1CAXA 5FREA 1YFXA 3SHRA 1HRI1 2D6LX 4XJAA 2DTYA 3VZMA 5CFCC 4LO7A 1CAXB 1RUJ3 2TEPA 1F9KA 3T1LA 2YGMA 4S2DA 4HSLA 1RJ7A 4TZDA 2PN5A 1ENXA 1LHNA 4D69A 1ASJ2 1RUI2 4Y24A 2LUWA 1R092 3KT1A 5CNAA 3OD4A 1Q8SA 1GQGA 2DYCA 2ZMNA 3NV4A 1S0CA 1KQRA 4FOWA 2XJPA 4WBBA 1YJLA 4YGDA 5GLVA 3MLKA 2MEV2 4FP2A 3KD4A 1OFNA 1QJX2 2BEOA 1MEC1 2ZHNA 2IXJA 3O0WA 4OI0A 5IK8A 3WCRA 5C9AC 3R05A 3WHTA 1NXMA 5BY5A 2EF6A 3SCFA 5T55A 2FMYA 1RUH1 1WBFA 3N36A 4B7EA