4QPGC

Crystal structure of empty hepatitis a virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
246
structure length
246
Chain Sequence
MMRNETRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWTSIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDLVFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDIAGVQSTLRFRVPWISDTPYRVNRYTKEAHQKGEYTAIGKLIVYCYNRLTSPSNVAHHVRVNVYLSAINLECFAPLYHAMDVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Capsid protein VP1
publication title Hepatitis A virus and the origins of picornaviruses.
pubmed doi rcsb
total genus 46
structure length 246
sequence length 246
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qpgC00
1RUH1 1BBT2 2WS91 3VBSB 3VBSC 4Q4X3 1C8M1 4CDWA 1PVC2 4GMP1 2X5IC 2HWE3 2RMU1 1WCDJ 5GKAC 5CFDB 5CFDC 4NWWA 2R041 5K0UA 1AYN1 3VBUB 3VBUC 1H8TB 3CJIC 4N53B 1R1A2 4N53C 1NY71 1K5MA 5BNNC 3J8F1 2IZWA 1AR93 2HWC2 2RR12 1ZBA3 1RUJ3 4RS5A 1PO21 1VBE3 3JB8A 1ND2B 1ND2C 1FOD1 1FPN1 1VB2A 3VDDC 3VDDB 1RUI2 4WM8A 1NA1B 2RM22 1NA1C 4FSJA 5C9AB 5C9AC 1VRH3 1VBA2 4QPIB 4QPIC 2FZ2A 1QJX3 1RUG3 2RS51 1NCQB 1NCQC 1AL23 5C8CB 4NWVA 2WZR3 4N43B 4N43C 5DDJ1 4CDQC 4CDQB 4FTSA 1X36A 1PIV3 2HWF1 2HWD1 1CJDA 1QQP1 4YVSA 1MEC2 1RUF3 3ZFGB 1HXS1 3VBFA 4JGYC 1BMV1 1AR83 5ACA2 4FTEA 5BNOC 3ZFFC 3ZFEA 4Y4YA 4CDXB 4CDXC 5A32B 2HWB3 1NCRB 1NCRC 1VAKA 1COV2 2R072 4PDWA 4RR3A 1BBT3 5A33B 4YVWA 1PVC3 1ND3A 4Q4Y1 1EAH2 1RMU2 1CD3G 1POV1 1R1A3 1MQTB 1MQTC 5C4WA 4Q4W1 1TMF1 3JD72 2HWC3 2RR13 2RS11 1RVF1 1R091 1F8VA 3NAPA 1RUI3 1W39A 4Q4X1 1B35B 2PLV2 1B35C 1OPOA 2RM23 1VBD2 4WM7B 2HWE1 4WM7C 1VBB2 1PO12 1VBA3 1RUC2 2MEV2 3DPRA 4GH4A 1RHI2 1VBC3 5K0UB 1QJZA 1AR91 1ZBA1 1RUJ1 1RUE2 1VBE1 2R062 1MEC3 3VBRB 3VBRC 4RS5B 4RS5C 2BFUS 3M8LA 5ACA3 4GB32 4IV1A 5J98B 1VRH1 4WM8B 1QJX1 5CFCB 1RUG1 5CFCC 1AR62 1PGW1 4BCUA 1H8TC 1AL21 2ZTNA 1D4M2 1COV3 2R073 2WZR1 1F2NA 3JBG2 4QPGA 5L7OB 5L7OC 4RHV2 4RQPA 2DF7A 1PIV1 4RFT0 4IV3A 1EAH3 2XPJA 4CEWB 1RMU3 4CEWC 1RUF1 1FMD2 1ZBE2 1HRV2 5BNPB 1Z7S2 5FMOS 4AEDA 5BNPC 1AR81 5LK7B 5JZGB 5JZGC 3JD73 4Y5Z0 1RB8G 1PGL1 2HWB1 3TN92 3ZFEB 3ZFEC 3ZXAC 1BBT1 1VBC2 5C8CC 3VBSA 2PLV3 1RUD2 1PVC1 1VBD3 4PDWB 1VBB3 2X5IA 1PO13 1RUC3 4YVWB 5FOJB 5CFDA 1ND3B 1ND3C 1TME2 2MEV3 3ZFGC 1R1A1 2RS32 3CJIA 4N53A 1RHI3 1DDLA 5BNNA 2HWC1 2RR11 5AC92 4CEYB 4Q4V3 4CEYC 5C4WB 1RUE3 2R063 5ABJA 1ND2A 1QJU2 1RUI1 3VDDA 2RM21 4GMP0 1NA1A 4GB33 1V9U2 5C9AA 1VBA1 4Z92B 4QPIA 4CDUB 4CDUC 4JGZB 1AR63 4JGZC 1OOPB 1OOPC 1AR72 1D4M3 1NCQA 1VBC1 2TBVA 1EV12 4LLFA 2XBO2 1ASJ3 4N43A 3JBG3 4CDQA 3VBHB 3VBHC 4RHV3 1QJY3 1R082 1BEV2 5D8AA 1MEC1 1FMD3 1ZBE3 1HRV3 1HX6A 1Z7S3 4JGYA 1GFF2 2BBVA 1AYM2 5ACA1 1HRI2 5BNOA 3ZFFA 1RUH2 2WS92 1NOVA 4CDWB 4CDXA 4CDWC 5A32A 1C8M2 3TN93 1NCRA 1COV1 2R071 2RMU2 3JB4C 5K0UC 2Y26A 2R042 1RUD3 1AYN2 1X33A 4Q4V2 1K5MB 1K5MC 1EAH1 3J8F2 4QPGB 1RMU1 1TME3 3VBOA 2ZAHA 2RS33 1MQTA 1PO22 3JD71 5AC93 2BPA2 1FOD2 1FPN2 4WM8C 2VQ0A 3FBMA 2BFUL 1QJU3 2PLV1 1ASJ2 1B35A 1VBD1 2RS52 1VBB1 1QJY2 1V9U3 4WM7A 1PO11 1RUC1 5DDJ2 2MEV1 2X5IB 1POV0 1AR73 1RHI1 2HWF2 2HWD2 4YVSB 4YVSC 1AUYA 1QQP2 1EV13 2XBO3 3VBFB 3VBFC 3CJIB 1HXS2 4Q4V1 1BMV2 5BNNB 1RUE1 5FMOL 1R083 1BEV3 2R061 4FTBA 1C8NA 3VBRA 3S6PA 1AYM3 5ABJB 5ABJC 4GB31 1HRI3 2WFF3 4PDWC 2WLPA 4RR3B 4RR3C 1RUH3 2WS93 1OHFA 4YVWC 1C8M3 1AR61 5CFCA 4GMP3 1VB4A 1D4M1 3VBUA 1H8TA 4Q4Y2 2RMU3 2GH8A 1ASJ1 3JBG1 2R043 1AYN3 4RHV1 1QJY1 5L7OA 5C4WC 3J8F3 4Q4W2 1ZBE1 1FMD1 1TMF2 4CEWA 1HRV1 1Z7S1 2RS12 1RVF2 5BNPA 1R092 5D8AB 5D8AC 1PO23 2WWSA 5JZGA 3NAPB 4JGYB 3NAPC 1FOD3 1FPN3 4Q4X2 3TN91 5BNOB 3ZFFB 2HWE2 1IHMA 3DPRB 3DPRC 1RUD1 4GH4B 4GH4C 5C8CA 2RS53 5DDJ3 1TME1 1AR92 1ZBA2 1E57A 3ZFGA 2RS31 1HQNA 1RUJ2 2HWF3 2HWD3 1QQP3 1VBE2 3VBOB 3VBOC 2QQPA 5AC91 3LOBA 2WFF2 2BUKA 1HXS3 4CEYA 2FZ1A 4SBVA 4IV1B 4IV1C 1VRH2 1QJU1 3IDEA 1QJX2 1RUG2 5A33A 1PGW2 1M06G 1AL22 1SMVA 1V9U1 1NY72 5J96B 2WZR2 4QPGC 4RQPB 4RQPC 4CDUA 4JGZA 1AR71 1OOPA 1PIV2 4IV3B 4IV3C 4Q4Y3 1EV11 3HAGA 2XBO1 1NG0A 1RUF2 4AEDB 4AEDC 3VBHA 1POV3 1AR82 1A6CA 1R081 1AL0G 4Q4W3 1BEV1 2ZZQA 1TMF3 4EJRA 2RS13 2GSYA 1RVF3 1AYM1 1PGL2 1R093 2HWB2 1HRI1 2WFF1
chains in the Genus database with same CATH superfamily
1QMJA 3HBZA 4BPZA 3VBSC 3ZDSA 3BU0A 4XFGA 1US2A 3WNMA 1IKQA 4FPGA 3RPQA 4GKXA 1XNKA 4LKSA 2X5IC 2C0ZA 5CNAA 1FNYA 2RMU1 5SV8A 2D5FA 2VQAA 2W9XA 4H7MA 3K77A 1ENXA 4XTPA 3RJ2X 5KXCA 1OF3A 2WNUB 2WWJA 1AYN1 4QT6A 2Y64A 3PU3A 4K6BA 4Q8LA 2ARBA 4ITCA 3K48A 1DP0A 1K5MA 4GA9A 1DQ5A 1W0PA 2Y33A 3RZKA 5FO8B 3ILRA 1O3QA 1Q5OA 1LCLA 4IEWA 4CCJA 2P3IA 3I3EA 1LB2A 2FDGA 4BXSV 5FREA 2ZCWA 4YM2A 2QBXA 2V72A 5FYMA 1JW6A 1YQ2A 1ND2B 3CO2A 3IAPA 3RI8A 3WV6A 1X50A 4GXLA 2VD7A 3F95A 2W2IA 4UYBA 1FOD1 5F5IA 3VDDC 1MS8A 1UNBA 1I5PA 4DIQA 1NA1C 1DQ4A 4LBKA 4FSJA 5FZDA 5C9AC 2VNGA 4MGKE 4ZU7A 2B42B 4FPOB 3UGGA 4CUCA 3S7EA 1W2AX 1VBA2 3OEAA 4QPIC 1QDOA 1LKNA 2FZ2A 1NLRA 1QGLA 3FHAA 5F9TA 2RS51 2KR2A 3WNNA 3AYAA 4QQOA 1NCQC 1AL23 4W6WA 4QXHA 1W6QB 4LQRA 4NWVA 1UKGA 4N43C 3WNLA 2IXHA 4P5YA 2D3SA 2KXLA 1Q8SA 1E5RA 4LO6B 3QH7A 5BY5A 2HWF1 3B01A 4BQ5A 4DUVA 1CJDA 4MGTA 4IETA 1QQP1 3CBNA 2FMYA 5L9BA 4MO3M 1BXHA 1K3IA 1RUF3 1VPHA 2B46X 2VZOA 4CU8A 5JVVA 3UL2A 1OQEA 2VUJA 3T1MA 4KWJA 3FN9A 1OA2A 1GQHA 3CEWA 4ZU5A 2WINB 4UFLA 4FTEA 4AGGA 1YIFA 5DAVA 1NUKA 4CDXC 1IS3A 4MLOA 4BISA 3LDKA 1MS3A 2VMEA 1GP5A 3V65A 2VCAA 1NCRC 3AVSA 3H50A 1A3KA 3IB3A 4DZGA 1TNRA 2QCSB 3M3CA 1JS9A 2VUDA 1OI6A 2P5BA 2ES3A 4COVA 1W9YA 4CPBA 3MUY1 4Y24A 5A33B 1ZYBA 3WG1A 1D7PM 2TNFA 4YVWA 3MUZ1 1BZWA 4WVZA 1QNWA 3E97A 2ZBJA 5C70A 2JG9C 4EV0A 1UKRA 3O14A 1A78A 5A70A 2VPVA 4X6RB 2WNVC 1VIWB 3ZYJB 3WF2A 1MQTB 2W1UA 4Q0PA 1YLLA 3T4VA 2P4EA 5HV4A 2XJTA 3MV01 3FC0A 2ET7A 4JKLA 4QX3A 2RR13 4JHTA 3VB9A 4I0WB 2RS11 1J1LA 2LALA 2EIGA 1W6OB 3E6DA 4HN0A 2GC1A 2VMHA 4BQ3A 2UYAA 4HPKB 4NJ4A 3ZSMA 1F8VA 1DQ0A 3IMMA 1XBFA 4J6GA 4Q4X1 2RM23 2Y6FA 1VBD2 1XE8A 2HWE1 2XUMA 1VBB2 2R0HA 2H6CA 1OQ1A 3A4UA 3AL5A 5EJ1B 3VGIA 2WLQA 2VOKA 5EZWA 1KDMA 3QLQA 4UFKA 1Y9QA 3DPRA 4OUSA 4CCCA 3AMPA 1GNZA 4IEXA 2BDRA 2YY1A 1EY2A 1UY3A 4QM9A 3W21A 5FMDA 5FZIA 3AL6A 4C1WA 5BYNA 3ASIA 3VHNA 3CNAA 3WNKA 3RGBA 2Y6GA 3FZ3A 2P3KA 5E16A 1RUE2 3BPZA 4JDOA 4QX7A 3RZHA 2XGXA 1VBE1 3AJZA 1GZTA 2D40A 1MEC3 1S1AA 2R062 2VOXA 3SNMA 2GC2A 4XDPA 5C5TA 4BB3A 2PHLA 2UWAA 1LRHA 1MVQA 1O8SA 4QB1A 3WUDA 5ACA3 1HJFA 2QNKA 2OUHA 4XQWA 1UY0A 4TTGA 2AEYA 4XFBA 1DHKB 2GNTA 4C91A 5CFCB 3H3ZA 2E31A 3M70A 1PGW1 4Y3OA 2J1TA 1H8TC 3IDAA 4I30A 5D1IA 3WP4A 2EXKA 2R073 4O61A 4Q2FA 1UYZA 3N35A 4S2DA 3KGLA 1D0HA 3K3OA 3WNOA 2K9ZA 5A3MA 2BWAA 2E7TA 1LHWA 3BTAA 4AGVA 2BU9A 4RFT0 4Q26A 3AZXA 5HV0A 4LNVA 4XIKA 5J09A 1ENRA 4QHZA 1CIWA 3ST7A 3WNXA 2JKBA 2HJIA 1HRV2 3D82A 1Z7S2 5BNPC 5A3TA 1PHMA 1F31A 3LSDA 3MGUA 3BALA 1J84A 3POYA 4BIOA 1YO8A 4CUBA 1XC6A 5JZGB 5FZ8A 2BYVE 1O4YA 4BMEA 1ENQA 2JDNA 4AHWA 4P9YA 4Y5Z0 4QB6A 1G9CA 1RB8G 3LA2A 3OPTA 1Q8OA 4BLIA 1B09A 2DUQA 3NRUA 1US3A 3HVDA 2VOWA 3WT3A 4CU9A 3V0AA 4AK3A 5LA9A 2NQYA 2XJPA 4YGCA 3H7YA 1WBLA 3VKNA 1OD3A 3KQ4B 5C8CC 4YPJA 1I3HA 1RUD2 3LFMA 1PVC1 3NV2A 4YW3A 1HIXA 1NLQA 3KZ4C 3E5XA 4AVSA 1H9PA 2EIEA 2QQUA 1FAYA 1QXJA 3PDQA 4MX3A 4YVWB 5CFDA 4DEVA 1TME2 1N3PA 5GJ6A 2QQKA 3RWKX 4COWA 1R1A1 2RS32 4XACA 5KR7A 1BVP1 4N53A 1RHI3 1UCXA 3NKTA 1LGCA 5GZEA 3ZMOA 1JYWA 1RYYA 2NMNA 4AHXA 1GQPA 5IVCA 2HWC1 1PMHX 4FXKB 4K1YA 4CEYB 5AC92 4AVAA 5JOWA 2WUHA 1H2NA 4JDMA 4O7XA 3KM5A 4YW2A 4LITA 1JMUB 1OLRA 5C3OA 3O1PA 4HBNA 1NXD1 5ABJA 3AYEA 3GJAA 4X8PA 3RRDA 4NE9A 1RUI1 3VHPA 1JHNA 4XHXA 4XF4A 4IEYA 4D6RA 4DFSA 5IVEA 4AQSA 3MPPG 1POQA 5FZ6A 4GWNA 1Y9GA 2GN7A 3ZSEA 4AI0A 1ZREA 4Z92B 3FFQA 4Y1UA 3BGAA 2HYXA 3VKMA 1MS1A 2DVDA 4PJYA 2QKDA 1OOPB 5DZEA 1AR72 4W65A 2YXSA 1W8UA 5GLUA 4AQTA 3DN7A 1N1YA 3I2KA 1SG3A 2JG8A 3JQWA 3OBRA 2OA2A 4UXAA 4V2WA 2ZAAA 5F3EA 5FYTA 3LE0A 3SLIA 4QX2A 4FVVA 4IQPA 2VZPA 4AXOA 4CDQA 4RHV3 4BA6A 4BLJA 4OMDA 1CIYA 1DLCA 3LZZA 4ET7A 1QDCA 3OYWA 3PUAA 2GALA 1ZBE3 4YGBA 3OBAA 4NIGA 2L9LA 3N7LA 1HX6A 4JQRA 3WW2A 1AJOA 1OLME 3EBRA 4JGYA 1G9BA 3T1LA 1Z78A 2D3PA 1MS9A 3M3EA 3Q9OA 5F5AA 4LHLA 2QQLA 2WNOA 3K4DA 1NE4A 2WYSA 1F4HA 4CDWC 2R32A 2YFUA 4IEUA 1PGSA 2WAAA 3FLPA 4M0NA 1GOFA 3ZSJA 5F37A 2A70A 2JE8A 1JZ6A 1COV1 2RMU2 4HT1T 4XJWA 1UD1A 1Z0HA 2Y26A 3NNJA 3I2JA 1RINA 1AYN2 1SDWA 3R05A 4O9GA 4JDNA 4QDQA 5IK4A 2CY6A 1T6GC 3ACFA 3ZR6A 4A4AA 1KFXL 3LB9A 4Y33A 4V1PA 1RMU1 3HD8B 1H4GA 4OMCA 5I0DA 5LB6A 3VBOA 2G4IA 3H3UA 1UQXA 5G05L 2DU1A 2XVKA 1V6OA 2J1VA 4YW5A 3OSDA 5A7PA 3CL1A 1HV1A 2YU1A 2YG0A 3BCWA 1FOD2 3C7EA 4WM8C 3UYJA 4EN0A 2D7FA 4JRAA 2WA3A 2BNMA 1SDDB 4IEQA 4AI9A 3ZLIA 3FBMA 2GDFA 3C7OA 1IKPA 4IUGA 4R52A 3HJRA 4QU2A 3OB8A 2B45X 4QQPA 1O4ZA 3V0AB 2PLV1 4XFIA 5FZBA 1ASJ2 3VL9A 4E2GA 2RS52 4KU7A 3AMMA 4HK8A 5BUVA 1GSLA 1V9U3 3C7HA 1QJFA 4WM7A 1A8DA 1PO11 4MZUA 5FY7A 1G9DA 2Y0OA 2XVLA 4BZ4A 2PFWA 2B8MA 1S0FA 3POSA 1UMIA 1CAXA 4MXWB 1POV0 2HWF2 3WLUA 1AUYA 1QQP2 1CZTA 1EV13 5FXXA 1KDKA 3LSEA 1LAJA 2E63A 4Q4V1 2Z42A 4B4QA 5LBBA 4ONUA 1WBFA 4M00A 2JE9A 5T3NA 3CHXA 3WR0A 1BEV3 1Y3TA 4HL0A 2X8KA 2DCTA 2GMEA 1XE0A 5FUPA 3TB0A 1RXGA 4IESA 3KT4A 3S6PA 3X29B 1UZZA 1W90A 2QQOA 2WNEA 5F6LB 5ABJB 4IEPA 4IDZA 4PDWC 3ENRA 4RR3B 5A3UA 5C6CA 1GYKA 4OYUA 1RUH3 2Y6LA 3INAA 1OHFA 3D6EA 5HCAA 2FDKA 4LBOA 1C8M3 1AR61 2JEMA 2VZSA 1ZRIA 2ZGTA 1Q56A 2VMFA 1D4M1 3THCA 4NN0A 4ZU4A 3OGVA 3S57A 4NIHA 2DTWA 2F4LA 3VV1A 3WP6A 2LTNA 1NZCA 4A7ZA 1ZX5A 3CF6E 4LEJA 1IGOA 1C5HA 1JUIA 5L7OA 1DG6A 5C4WC 1D4VB 2W87A 5A7OA 1ACCA 3LD8A 4PF5A 2Y60A 4CCOA 3J8F3 4GWIA 5FYIA 2VJXA 3SKJE 5KXBA 4EN8B 4P14A 3MPBA 4CEWA 1IG3A 5T50A 2RS12 1ZZ6A 2BNOA 5JXHA 1ZZ9A 1N47A 1DZQA 1OXCA 5FYCA 1DLLA 5DUUA 4YWAA 1YWKA 3NAPB 4JGYB 3HQXA 4XZUG 2W95A 2B4KA 3KT7A 2PELA 5JLVA 5DUWA 4Q4X2 2XUEA 5A7SA 2HWE2 1WLWA 1LULA 1CONA 2ZGSA 5A3OA 3UJOA 1YC61 2VZ1A 4ZS2A 2D6KA 1JTZX 1UAIA 2I74A 1TE1B 4GH4B 5CKMA 5DAXA 5DAPA 2GNDA 4XQ4A 3A23A 5FJKA 1UL9A 4DY3A 3WDVA 3LKJA 4ATFA 2PN5A 1UYXA 3IWZA 2BOJA 2VUAA 5DZFA 3ZN4A 5LK5A 4DS0A 5J1XA 2HWD3 3DYOA 4KWLA 5H9PA 5IATA 3EO6A 1VBE2 3VBOB 5FYZA 4QU1A 1UOGA 4TZDA 4B7KA 3LOBA 2W91A 4FXGB 4HVOA 1HXS3 1W6PA 2HBTA 5FRAA 1CR7A 4BXFA 2BRTA 4ARYA 1AHSA 3ZSKA 2NP0A 4Y1XA 4IV1C 5IUQA 3ES4A 4YYOA 5JXJA 1O91A 2YC4A 3AZWA 2D93A 1QJU1 3IDEA 2ZGNA 4Y5SA 2W46A 3CQOA 5AFEA 2W1WA 1V6LA 2ERFA 1G6NA 1LOAA 1PGW2 3PUSA 4XURA 5IVBA 3MZHA 1SMVA 1QKQA 2ZGUA 3O1SA 3JCIA 4ZY9A 4MHRA 3B69A 3Q8CA 4QPGC 3AZZA 1CPMA 3THTA 3P3NA 3W59A 1YIPA 3WP5A 4CDUA 4E4ZA 1U5XA 4JGZA 4DEQA 5JWPA 2I2SA 4Q5OA 4IV3C 1ULEA 2P6HA 2JDKA 1WMEA 1PZ8A 3HAGA 3VDCA 5FYUA 1XXNA 1NG0A 5A80A 1QJEA 1I6XA 3BB6A 4AEDB 2AREA 2RDNA 4XPVA 2A3YA 2ZXQA 1OF4A 3N9NA 4QGMA 1QOOA 1LOEA 2WT2A 4Q4W3 4PIXA 3Q8FA 1P8JA 1SHWB 2VXJA 5I0TA 3CKHA 5KHJA 1U12A 4OHXA 3HPNA 1R093 3AMHA 1HRI1 1LU2A 1KS4A 2DUPA 3I2FA 3DXTA 4FPKA 2ZOEB 3PIGA 4XUPA 4ZZ8A 1PVC2 3J7MA 1WD4A 5A1FA 1BCXA 1GWLA 2XJRA 2Z5WA 3RMXA 3CU7A 2WIIB 2V5DA 1WCDJ 2EAKA 2IVIB 1N1TA 4E8CA 4IEOA 2R041 2WNUC 2XHNA 3RZMA 5FTTC 1GV9A 3J9SA 3FE5A 2CDOA 1R1A2 3IAQA 1NY71 4XETA 3QD6A 2ZKLA 2QUOA 2VGDA 3O12A 3JUUA 5BNNC 1XQNA 4ZXKA 4CVUA 4H3WA 5HI0A 2HWC2 1ZBA3 1YQCA 2EIBA 4CP2A 5GZFA 4XJZA 3PVNA 1RUJ3 1LTEA 1CAUA 4ASLA 5IVJA 4RS5A 2CYFA 4I0AA 4FPLA 3L2YA 3JB8A 1ND2C 3N7MA 3LEMA 4LUKA 4EE2A 1RUI2 3MW2A 4F83A 1F4AA 3VHRA 3D0SA 2VMCA 4N7IA 3NQHA 4CCDA 5L19A 1UZVA 4AEMA 2QDRA 1QXPA 4Q0UA 3I49A 1Q3EA 3MICA 4P00B 3U4SA 1VMHA 3PTRB 5KC6A 3TRSB 3WF4A 2W92A 4N90A 5CYYA 3WDWA 4QB2A 2WZR3 5DDJ1 3VZKA 5JAXA 2QE3A 2VTXA 1X36A 3OBTA 5GZCA 1RUNA 3ROUA 2DVAA 5I0RA 5FZLA 3O0WA 2JDYA 4YVSA 3DECA 3VBFA 4QMAA 1GKBA 2A3WA 1JU4A 2HEWF 2YFZA 5DAQA 5F3IA 1S2KA 4XOGA 2VXRA 4LXLA 5EIYB 2NZ9A 5F7UA 1LOFA 3VD7A 2C24A 3LDBA 3ZFFC 3ZFEA 5BNOC 2ID4A 3WSOA 4XFCA 1ZZ7A 4I02A 1ZRRA 2WFPA 1HN1A 1I1EA 1XYOA 2ZGQA 4XJ8A 1H4HA 3HWJA 2DCKA 4NMIA 3ES1A 1COV2 4DUWA 3IBMA 1BBT3 2ORZA 3E6CC 2BW8A 4BK4A 1E5SA 2OIIA 4TYSA 5KXDA 2JXAA 1XU1A 4YW6A 2EVXA 5CVRA 3THDA 2JKXA 3MI8A 3OCPA 4G9SB 3SISA 4QPYA 4Q4Y1 3MF9A 2ZEZA 3I59A 3AP5A 3H1MA 1D0GA 1RMU2 3NSTA 4CCLA 1CD3G 4QDSA 5CADA 5A6QA 1POV1 3HN3A 3O0VA 1MQTC 2A73B 3AXDA 5LA2A 4I2OA 2F6BA 2GP5A 5C3QA 3POEA 1YFWA 2FDJA 1VLNA 4KGGA 4YFZA 3HNBM 3AFGA 4XUTA 2BV4A 4M3CF 4AEJA 1VALA 4HOOA 1W39A 4XVHA 5FXWA 1B35B 2PLV2 3NWKA 3WW4A 1OPOA 5ERLA 2MNGA 3GGLA 3GHNA 5FZMA 4GZ9A 2DYCA 5LA0A 4ES9A 2W52A 1QNYA 2O8OA 3FWEA 1PO12 3T30A 4D6QA 2OS2A 1SFNA 1XPWA 2XJSA 3B7MA 5LW9A 4KG0A 1W0NA 1HB4A 2DVBA 2LM3A 4AHYA 1ULPA 4DPNA 1C4RA 2NN8A 1UN1A 2DU0A 4UOJA 5FZ4A 1IG0A 2VZQA 4LK6A 4FT8A 5T52A 3RWNA 2HLEA 2RV9A 4FAHA 2WN2A 4WV8A 4P9GA 1MZFA 5LWBA 3P1IA 4LMFA 2W39A 5FY1A 1OUXA 3AKPA 3OTFA 1ONAA 1XYPA 2QQMA 4N8MA 5DN2A 1W8WA 3EMRA 4MGSA 3LFIA 4AI1A 3H9AA 2DVGA 3VBRB 4RS5B 3T0DA 2HKXA 3TEZA 5JSRA 4YZ5A 2WJSA 2ATFA 1PK6A 4IEZA 4QXCA 2H6BA 3USSA 2ZGKA 5FZGA 4UWDA 4YNIA 1V6KA 5EYYA 5APAA 4OCTA 2WQZC 4MUVA 4HMZA 4RGAA 4Z1VA 2VECA 3H1WA 4BQXA 5CFCC 4E2QA 3W58A 1AR62 4ARXA 4BCUA 1AL21 1KXGA 4XFHA 1D4M2 5JR7B 4NPLA 3UGHA 3WZ1A 4F7ZA 3VL8A 2X29A 1K45A 2VZUA 5LRRA 4RQPA 3AXEA 3A0KA 1C5IA 4X6QB 2R0FA 1W2NA 4XJ9A 1YRZA 1EAH3 1MR5A 1RUF1 2V4AA 3ZIWA 2XHKA 4AFMA 2PAMA 2V4VA 2OYZA 5GLWA 3I97A 4HKOA 3EQEA 4DNYA 4UBGA 3WP3A 5JZGC 2ZX3A 4Y5TA 4E8DA 3JD73 4OI1A 5FYBA 3V0BB 2CWMA 1PGL1 2DBNA 3OBZA 3ZFEB 2B5HA 3DXUA 1UX6A 3I3DA 1SLCA 5DG1A 1RJ7A 3CMGA 3FL7A 5FUNA 3GZAA 5JOYA 1VBC2 3PL0A 4K8RB 3VBSA 4EWDA 4XJAA 1WZXA 5F5CA 4CCEA 3AM2A 3EB7A 2X5IA 4H55A 3LWCA 2JDHA 4NHLA 3E5QA 1RUC3 5KHHA 4DUXA 1W6NA 5FOJB 3VHOA 2MEV3 3UV9A 1O8PA 1EP0A 3NNLA 3ZFGC 3RVHA 3RSJA 4K21A 3I59B 3E1F1 1J1TA 3Q8AA 3WQ0A 1DDLA 1OC1A 3LOIA 2YDEA 4PI0A 5LRSA 1WW4A 3I2DA 2RR11 4B7EA 3E6BA 3U75A 4UFHA 3MLLA 4XFAA 1M4WA 1HDKA 3TBDA 4CEYC 2DFCA 2O1QA 1W8NA 2V5YA 4IE6A 4M4PA 4QAWA 4TLGA 1OLMA 3FJSA 4LULA 3TEXA 2AYHA 2QVSB 2ORXA 4DXRA 2JDZA 1VE0A 1QJU2 2VR4A 3VDDA 5LBFA 2RM21 5IFPA 1W2UA 1NA1A 3HQUA 4GB33 2Q5TA 4B1MA 5C9AA 1YXWA 1ENSA 4QPIA 4WVVA 4XEZA 4PIZA 3HR9A 1OOPC 2A5ZA 2P6CA 4AG4A 2JD4A 3ZX7A 5A1LA 1NCQA 2XH6A 1NQDA 5T5JA 2V09A 5T5PA 1QH6A 4G3YC 5JI7A 3ZYPA 4QQLA 1ASJ3 4N43A 1SBEA 3JBG3 2RDRA 4OVEA 4QX1A 3AFKA 3VBHB 4CU7A 4XDOA 5FMBA 5DABA 5FDBA 1DGRN 1WCSA 2YHJA 1WW6A 2O0OA 4B4PA 1MEC1 1FMD3 2JIGA 2X09A 4K9SA 2YPDA 1KFUL 3OD4A 1W0OA 5FAXA 2BBVA 3R4UA 5FZKA 5FZHA 4URAA 5ACA1 4K1ZA 3WQ7A 1HRI2 4J1XA 3C3VA 2YB7A 5JCTA 2C4XA 2G9ZA 3MIHA 1UY4A 3U10A 5FR3A 3ATGA 1NOVA 4CDXA 2PA7A 4MSVA 5EP9A 4EZ4A 3NVCA 3WXPA 1OLQA 5A32A 5KWRA 4R9DA 3TN93 2OW4A 5FZEA 1NCRA 4Y4RA 3SXWA 1RJ8A 2R071 3A22A 2XL7A 3PMSA 5E8AA 1DQ1A 3MIEA 3AB0A 3JB4C 4MGIE 1DBNA 3RG0A 5K0UC 3HNYM 5FYYA 2R042 3KSCA 1ZM1A 3I3BA 4UW4A 1K5MB 4BK5A 3ZYFA 2BTVC 3VN4A 3M3OA 5JPMB 4QWNA 1IS5A 4L9BA 3BN6A 2JG9A 4LHNA 5T54A 3SKVA 3SQOA 1N1VA 3F2ZA 4YG0A 3BKZA 2SBAA 3I54A 3O1OA 2LRPA 2ZAHA 5GLVA 5A3NA 3DV8A 2AACA 3Q8BA 4UF0A 3WF0A 1JYXA 2BBAA 3VD5A 5K8SA 3C2UA 1PX3A 2KM2A 4KWUA 4XMAA 5C7GA 1VR3A 3IM0A 4Q1RA 4DB5A 4OUEA 4WVMA 5D2AA 2VH9A 5IHRA 1S0IA 4BHPA 4RFRB 4A6SA 2ZMLA 2A6WA 4FP2A 2AZ5A 1CAWA 3LIGA 5A6YA 3PLQA 3ZPYA 1YI7A 5LBCA 1W3XA 1W9TA 1PZ9A 1QJY2 3D5OA 5FZCA 3SCGA 3B9IA 3SEPA 2ZX2A 2BVBA 2W0XA 2OQ6A 5DDJ2 1IZ3A 3MO4A 3GCXA 4A41A 2X5IB 4LKEA 2R16A 1W6MA 2VZ3A 3O1RA 2SLIA 3MFCA 1RHI1 2AH2A 3B93A 1W6NB 3POFA 1GP4A 1WLTA 3NL1A 4BJ0A 1WGPA 2D98A 2XBO3 5GALA 3HBKA 1RC6A 2OXBA 2P3JA 4FOYA 3VZLA 4JTOA 2WT0A 1W99A 1UXZA 5JIUA 3N9QA 1R083 2IFWA 4SLIA 1GP6A 4XIOA 4FTBA 2J1UA 4HKWA 4LIVA 4JTNA 4K7JA 4L11A 5EPAA 1H2LA 1X9PA 2H0BA 4NAOA 3T0AA 1AYM3 4MOAA 2D6PA 4A6OA 5C8WA 4LO8A 5HXVA 5ABJC 3VDAA 1HN0A 1NE6A 3POIA 2JX9A 4RR3C 4COYA 3HT1A 1XB9A 1IOAA 1J58A 2WS93 1Y4WA 3RZGA 3BTZA 1RTVA 2OX0A 4GMP3 1VB4A 3VBUA 1H8TA 3J4UH 4Q4Y2 1YQ8A 5FLHA 4XCAA 4COZA 3OUHA 3D0JA 3O1VA 4RHV1 2W3JA 4MVTA 4Y1YA 4CXXA 5KBFA 4XC9A 5CAZA 1UY2A 2AEZA 4CCNA 3M4FA 1OH3A 1AXYA 3NW4A 1UMHA 1ZBE1 2OPKA 3JQXA 3VKLA 4CP0A 1SLTA 2VCBA 1LECA 4LBNA 3GBWA 3AK0A 1VJ2A 2QQWA 5BNPA 2BQPA 4YGDA 4COUA 2E7AA 1PO23 4BH9A 5I8TA 2YU2A 4BE3A 4D69A 1W9SA 4D8MA 4EQVA 3NAPC 4NOTA 5I91A 1FPN3 1DYPA 1RUOA 5H9QA 4XAAA 5FZ3A 4DINB 2VUCA 4IE5A 1GMMA 4CSWA 1JBCA 3DPRB 4YM3A 5C8CA 4GH4C 4Z82A 5A6XA 1ZRCA 4E9KA 2ZGOA 1NQJA 2RE9A 2YBSA 2Z79A 1VRBA 3OEBA 4AI3A 3AKTA 4FQ4A 2XJUA 2CDPA 1K5JA 4XUOA 3SMHA 4UFJA 2K0GA 4W6XA 1REEA 2GP3A 4FFIA 5CKQA 1AXZA 4XZPA 4TLFA 5BPXA 3H8OA 1D2QA 4CP1A 5E88A 3VBOC 5CBLA 3S5AA 5LBEA 2ZPXA 4QQ2A 1ULFA 2WFF2 4W6YA 4XDQA 2WKKA 1WA4A 1H30A 2FZ1A 4YGEA 4MGZE 1NT0A 4GD4A 4NAMA 3MFAA 5LZ6A 2Y38A 4P9IA 3AP4A 1YFYA 4NHMA 1J59A 3ZXDA 1VMJA 5FXVA 2XLAA 4RD7A 4WVMB 3C7GA 1HB3A 1UY1A 4HZFA 2EAAA 1M06G 1V9U1 1AL22 3GF6A 5I0SA 1SLAA 1CAWB 4XMIA 4LHSA 5J96B 2MPFA 1LU1A 1QY4A 1U5IA 4O9EA 4DOUA 4HSJA 3I4IA 4NIDA 4QGLA 3AP7A 2DCZA 3PVBB 4A3ZA 2J22A 1WW5A 5IK7A 1EV11 3U0ZA 2BGPA 4OFGA 1X82A 4TSVA 1SBFA 1W6MB 1RUF2 5HXMA 4P08A 2YPJA 3WW1A 4AEDC 2BZDA 4V2VA 5FXZA 2R1BA 5IFTA 3O1MA 1A6CA 4QD2A 2A1XA 4NHYA 1BEV1 4LK7A 2ZZQA 2TEPA 3ON7A 1YHFA 1TEIA 1TMF3 2VMGA 1N3QA 4P9LA 2VBBA 4FFGA 3GZTB 3SC7X 1RVF3 4KWKA 2MHFA 1PGL2 1EUTA 1CGPA 1MVEA 1YJKA 4FQZA 4OHWA 2HH9A 2O8QA 1RUH1 3K4AA 1C8M1 2YROA 4CDWA 1EPWA 3OUJA 1PM7A 4IGPA 2DV9A 4XAEA 1OA4A 4Z2WA 1BQPA 4BQ4A 5JMOA 1F35A 5CFDB 2V73A 5C3SA 1JOPA 2ZEYA 4URTA 2PHDA 4NWWA 4D3WA 5IYYA 3VBUB 1H8TB 1URXA 1PZ7A 3CJIC 3GNEA 4N53B 3KV9A 4QDRA 4XUNA 5E1RA 1HB1A 2XOMA 3P5BA 1V6JA 5DUVA 4E2SA 3J8F1 3WW3A 1O3RA 1W06A 1AR93 1O6UA 2GZWA 2IZWA 1KEXA 2RR12 3WF1A 2NYYA 3G7DA 3MV11 2B9UA 2P1BA 1FI2A 4FPYA 1IPJA 3IIAA 3WG2A 4IE0A 3CLPA 1ZZCA 5JXGA 1VB2A 3J7LA 3PUQA 2HEYF 4WM8A 2UWBA 3N7JA 2RM22 3EXUA 3I3MA 1GQGA 1GNHA 4LKFA 2Q8EA 5DUXA 1JXNA 2Z69A 3THPA 5AFBA 1VRH3 5CZKA 3HN1A 4IL7A 3RYKA 3V56A 1QJX3 1RUG3 5JMCA 4YG3A 4A7KA 4XFFA 4YZ4A 1S0EA 2JG8B 3USUA 4OI0A 4FCAA 5C8CB 3T2QA 4CDQB 1STMA 4Q27A 2A71A 3QCWA 3J7NA 2C5DA 2ZX4A 4Q0SA 4HXCA 4B1LA 1PIV3 2G19A 4XTMA 2HWD1 3OYWB 2E7QA 4PT6A 1W9FA 3ZPOA 1TVGA 1S0GA 4RL7A 5FO9B 1G9AA 1MEC2 2Z4FA 1ULDA 1BYHA 1HXS1 2PHWA 2JD9A 1XE7A 2ZHMA 2X05A 2YV8A 3SCHA 1BMV1 4UT5A 3ZYHA 2JE7A 1AR83 2XKPA 3AYCA 4LHKA 1ULOA 4PIYA 1T6BX 4XF9A 3KMHA 4K20A 5ACA2 1T2XA 4XJUA 4L92A 3ACIA 5L73A 1XSRA 2DURA 2RG4A 4JV4A 4XQDA 2VM9A 3VLBB 2HYKA 4YZ1A 2W1SA 4M4RA 2F17A 1JYTA 3ACGA 4FOVA 2HWB3 3KF5A 3N7KA 3SCFA 5IVYA 3QOPA 1VAKA 1JOBA 3H0OA 1PMIA 2R072 2ZGPA 4PDWA 2JECA 4AVBA 2XR4A 3M3IA 1GOHA 4BOWA 3LEIA 3KHCA 1ND3A 1JYIA 2C1FA 4GQ7A 4P9XA 2QQVA 3TEYA 2PQSA 2ZHKA 5A3PA 3GZEA 4W50A 2XLFA 3KVBA 1JI6A 1WMXA 3BVCA 2DCYA 3A0NA 4R9BA 5A6ZA 5IVFA 4WVWA 5C4WA 5CKNA 4Q4W1 4MADA 4BQ1A 1ZVFA 2WO1A 3V64A 3AP9A 4MXVA 1YNAA 2E9QA 2WC2A 1R091 5I0UA 1BLZA 1O4TA 2B7YA 2RHPA 2W94A 4QQHA 5H9SA 4UW5A 2VW0A 1DFQA 4AW7A 1DGWX 1AF9A 4JHZA 2K2SA 1GLHA 5FPZA 1L7LA 1W9WA 2RDSA 1B35C 3TWIA 5DMYA 2EXIA 5DZGA 4WM7B 5H9RA 3MBWA 3HMYA 1YI9A 3M3QA 1TQ5A 3ZXJA 1VBA3 4AGRA 4AFAA 1WW7A 1H8VA 2ZMKA 2YMZA 1CAXB 3MLKA 3WCRA 3DKWA 2OZJA 3NJYA 3WVJA 4ZHNA 2E51A 3UETA 4ZPIA 1MZ5A 4FFFA 1RHI2 4QKNA 4S2FA 4D7TA 1VBC3 1UPIA 2VL4A 4BM8A 1QJZA 5HCHA 1ZBA1 2G9GA 4XF1A 2ZHLA 3H42B 1LODA 1RUJ1 1PX4A 4XABA 1WWYA 4R4ZA 4Y22A 1FT9A 2WN3A 4CUGA 2ARAA 4Q1PA 3GALA 4H2AA 4INDA 5FK8A 3VBRC 1Q8QA 4RS5C 5FZ7A 2BFUS 5CEHA 3I8TA 3IPVA 4IV1A 4XF3A 4H14A 4WM8B 2PXJA 2J42A 3POWA 1NLSA 1W28A 2WRAA 2H0VA 4M3CA 3FFZA 3ZIXA 2XWJB 2ZTNA 1JOJA 3GZUC 4MV2A 2FD8A 2DWRA 2PYTA 4AFCA 5EV7A 4L99A 5GLZA 3QACA 3RQ0A 2WZR1 3RJRA 3ZXEA 2IXKA 3UJQA 5IK5A 4UBHA 1CWPA 4QPGA 3VZMA 5L7OB 4KGQA 4RHV2 3UKTA 2XJQA 2CAUA 1LESA 2DF7A 3RZZA 3USUB 5J48A 4L0PA 3WEZA 4UW3A 4IV3A 1F15A 2XPJA 1UMZA 3T2PA 1HKDA 5T5OA 1ZBE2 4CEWB 1XOYA 3CJXA 3ITQA 1WMDA 2ARCA 1JYCA 4HLTA 4NR1A 1YUDA 3ZM8A 1PM4A 1C3HA 1WMFA 2QQJA 1CX1A 2GU9A 1SPPA 2BEOA 2JIJA 1BKZA 1R1ZA 2JWPA 5IAXA 5C3RA 3KCYA 3PU8A 4Y1ZA 3ZXKA 4MGQA 4W4ZA 3PHMA 4LORA 3ZFEC 3AJYA 1BJQA 3NMBA 5FKBA 3RZLA 4NHKA 3ZXAC 1PNGA 1BBT1 1CAVA 2UURA 4KU8A 5IWFA 4AR2A 3NNFA 3D3AA 3K46A 3N9LA 3WDUA 1OFNA 4HONA 1VBD3 4PDWB 4OULA 1VBB3 4G4FA 1J3RA 4LA2A 4JRLA 1X7NA 5EJZB 2JDAA 1ND3B 2QQNA 2QTWB 2WNUA 1J3QA 5GM0A 2YBKA 2WO3A 3GXUA 3MIDA 1OBNA 1HV0A 2VNVA 2WO7A 3POJA 5DXDA 3OGGA 3R6SA 3VD3A 2W47A 3ETQA 5BNNA 1W6PB 4DMIA 5C4WB 4BIFA 2CGPA 2D6LX 4JX0A 1RUE3 2BWCA 5I93A 1LJ7A 3S5QA 4Y1VA 3ZYBA 4NHXA 2R063 4AFBA 2VE1A 1ND2A 1CN1A 4QPWA 4S2HA 1LHVA 3T4HB 1EPZA 4JKKA 5HCBA 4LO5B 1HQWA 3A21A 1REFA 1X8EA 2DUOA 1ST8A 2R1DA 4GMP0 4A42A 4NUBA 1V9U2 4GJZA 4AAXA 3KB5A 1UO9A 2WQ4A 4AHZA 3HIFA 4I01A 1L7QA 2JENA 4OQ9A 4A44A 4CDUB 4JGZB 4OHYA 3OUIA 4Y20A 2LW8A 4KBBA 3WNPA 1DYOA 3U4XA 1SLIA 2TBVA 1EV12 1W6QA 2XJVA 1E5HA 1FXZA 4NRPA 5E6HA 1I9RA 3H8UA 5FFOC 3VBHC 3MLJA 2WO2A 4OZOA 5FY9A 1QJY3 4NVPA 1GANA 3ETPA 5JPNB 2IXJA 3S30A 4NROA 3ZYGA 2FDHA 1BEV2 4XHBA 5D8AA 1CQ9A 5FJHA 1X8MA 3IDCB 1HRV3 3WDTA 1Z7S3 3FX3A 2WYFA 1GFF2 5HCFA 5EJ3A 3I2IA 1OT5A 4BDVB 2WZ8A 3ECQA 2ARXA 2ZEXA 4AL9A 1DGRA 1ZA4A 2JDPA 3NJZA 3ZKYA 5FP9A 4NPRA 4FOWA 2I07B 5BNOA 3UNPA 5FKCA 3ZFFA 5F1RA 1RUH2 5AVPA 2A3XA 3S7IA 2FHRA 4EWAA 1SACA 5J36A 1C8M2 1OVSA 1UIJA 5L9VA 4IE4A 3FUQA 5A3LA 4QHOA 5B2GB 2J1EA 3VKOA 3ZMNA 4D7YA 4O65A 4C8DA 2E26A 3KQRA 1RUD3 3CZUA 2XL9A 4Q4V2 4RN5A 4B29A 5TSWA 1GZ9A 1K5MC 5EWSA 1EAH1 1X9TA 4EN9B 3IZOA 3J8F2 4QPGB 1WKYA 4PLNA 2PTMA 3IN9A 4LE3A 1TME3 4DRVA 1OKOA 5FZ0A 3PNAA 1CAUB 1Q43A 1CX4A 2DVFA 2RS33 2VVEA 4CE8A 4BMBA 4E4SA 5EXOA 1MQTA 1S0CA 3DF0A 2EXJA 1HQLA 3FMGA 3JD71 5F3CA 4BYYA 4QM8A 5AC93 2UWCA 3J26N 3AZVA 3BI3A 2VQ0A 2Y8KA 3WINE 2GNMA 1NKGA 3NO8A 1V6NA 5CG8A 1OUSA 2BFUL 1XJAA 1ALYA 5FP7A 3B3QE 1S4CA 1SCSA 4QX5A 1DF0A 1XYNA 5ANQA 3PURA 5FWJA 4OI2A 1FYUA 2PMWB 4HKLA 2GC0A 2ZEWA 4KBZA 4L2NA 5LASA 4D0QA 3U1XA 5IAVA 1WUVA 1RUC1 2IVJA 5ANNA 5FZ1A 3SH4A 2MEV1 3ZN6A 5FYVA 2GNBA 1CZVA 1AR73 1W8FA 2HWD2 4YVSB 4OLLA 3PVOA 1E5IA 3GBGA 3IT8A 4LE4A 4CP9A 4E4HA 4FPJA 1PMJX 4LOSA 3VBFB 5A3WA 5F3GA 1LEDA 1MZ6A 4NIAA 1HXS2 3WCSA 1UPSA 2ZGLA 1H2KA 1BMV2 5F6KA 1AVBA 1MZEA 1PVXA 3AC0A 4KNCA 3UESA 1L3JA 4B8EA 5BNNB 1XRUA 2XONA 4YSFA 1AX1A 1BVVA 3ACHA 2DTYA 4M3CE 1C8NA 4PI2A 2JJ6A 5I8SA 1ULGA 4XBLA 2VQTA 3K75B 4AWDA 2KA3A 2XDVA 3DUIA 2PHRA 4GB31 4XUQA 4QXBA 2WFF3 5JOZA 2WLPA 3T3YA 5IW0A 4YVWC 1UOFA 2Q8DA 2QDNA 4GIQA 1O3TA 3NV3A 5CFCA 3ACLA 2RJ2A 1SZBA 2OZ6A 2RMU3 5F39A 1W8OA 1CJPA 3BTXA 2WSVA 3LIHA 2GH8A 3IIIA 1ASJ1 3JBG1 3JXSA 3GCWA 1ZNPA 3HOBA 1AYN3 2C6SA 1UX7A 4Y20B 3WUCA 2BP6A 1XSQA 4YZ2A 2FMDA 4TN7A 5FY5A 1SBDA 4Q4W2 1GBGA 4OUMA 3SEEA 1FMD1 4LJHA 1W3VA 2YYOA 1CESA 1Q8PA 4LOTA 5A7WA 4Q8KA 2JB8A 4ISRA 5B4XA 3DGTA 3WQBA 2CHHA 5FBZA 2VC9A 1R092 3VDBA 2EA7A 1YYNA 3CZJA 1QIQA 1MS4A 2BNNA 2WWSA 3FHQA 5D8AB 3TOJA 5HBAA 5JZGA 4YW4A 1UZ0A 3U14A 2X10A 3H8XA 1GNYA 1O5UA 1FOD3 1FV3A 3UGFA 4AQ6A 4Z2AA 1SFPA 3KS7A 1JHJA 3POBA 3TN91 4U2AA 5BNOB 1LNSA 2QQIA 3ZFFB 4HVQA 4GAZA 1GUIA 1H9WA 5FIXA 3SH5A 2A75A 1IHMA 2JICA 2P34A 2R7EB 3D8CA 2CSGA 3LF7A 4M0HA 2IXLA 3H8RA 3DPRC 3QBQA 4R8HA 4TWTA 4AI2A 3ZOIA 2RS53 3U07A 1XNTA 2J1AA 2HEVF 4AAPA 5C5UA 2UYBA 1QOSA 2VMDA 4PF1A 2B39A 5J7MA 1AX2A 2DBIA 1RIRA 1ZBA2 1QU0A 1F9KA 2VOTA 3N9MA 1EYBA 1E57A 3ZFGA 2WR9A 1H1AA 2Q1FA 4EROA 1RUJ2 4JC1A 5FZOA 3ZVXA 2HWF3 2ZJCA 3RNSA 3W5NA 3GDBA 1QQP3 4R9CA 5L36A 4EZHA 3B94A 2VCMA 3N9OA 2BVVA 5JIAA 1BK0A 1AZDA 5LY2A 4XILA 4CEYA 1JZ5A 1PK6B 1JYVA 3HNMA 4SBVA 1UU5A 4ZS3A 2VZRA 5D21A 1YFUA 3RYRA 3UKVA 1Y9MA 1RL3A 2QFEA 5LEJA 3LGRA 4CRQA 5FQ0A 3OY8A 3BOWA 1DGWA 2A6XA 3LPGA 4LBQD 4NO4A 2Y6JA 1AXKA 1CZSA 3OD0A 2IWGB 3AKSA 1HB2A 5FP4A 2ZACA 3LDRA 5FLIA 3ZR5A 1NY72 2PHFA 1I5ZA 4FI9A 3PUHA 2IUWA 1HLCA 1GOGA 1L7RA 2WZR2 4CZSA 4RQPB 4F3JA 2ZX0A 2P3YA 2WSUA 4MGYE 1OOPA 4LIUA 2R49A 2XLGA 3J7HA 5F32A 5FLJA 4AQ2A 5K7PA 2WNVA 4JQTA 3ZN6B 2EALA 4EN7B 5CB7A 2XBO1 1KQRA 4Z8BA 5E89A 1AJKA 4K3UA 4OI4A 4CP9B 2JDMA 5I8YA 5J3UA 1R081 3TEWA 1AL0G 1CVNA 2HBUA 3FUOA 4P9JA 1S2BA 3FLRA 2X53S 1RITA 4CYDA 3LPFA 1OMIA 3ABZA 3KVAA 3SH3A 3KCCA 3ZSLA 4EJRA 2FCUA 2GSYA 2RS13 4PLOA 1AYM1 2UY8A 4HSLA 3ALQA 3BTYA 2ETEA 2Q8CA 2W08A 2RVAA 4XF0A 3FBYA 2VW1A 2EXHA 3LA3A 3TNQA 5KXEA 4LA3A 2ZABA 4C0HA 1BBT2 1WCQA 2WS91 1MACA 5L9RA 3VBSB 1EUUA 4ATEA 4Q4X3 2ENRA 4GMP1 3D4KA 4KI5M 5FY4A 2HWE3 1DYKA 1S55A 2JDUA 2YC2A 1IQAA 3R4SA 3N9PA 3LCPA 2D5HA 1VMFA 3AMQA 4OZXA 5GKAC 4AFDA 5CFDC 5JSOA 4P9WA 4DO0A 4LPLA 1VAMA 5K0UA 3ILNA 5A7QA 3VBUC 1YCIA 4N53C 2R6QA 5A1AA 2ILMA 3IKWA 1LGNA 1OURA 1CPNA 3KWVA 1LOGA 5FMCA 1YQ6A 3PTYA 1DIWA 1W2TA 1SEFA 2Q4SA 3MW3A 2ADDA 1OD5A 2O14A 2OT7A 1PO21 1UXXX 3E5UA 1VBE3 1XNDA 4RA0A 5CIRA 4YG6A 5A7WB 1LR5A 4KH9A 2XB6C 2ZS6B 1FPN1 3VDDB 1OVPA 1JZ3A 3K3NA 1Y7BA 5M0TA 1NA1B 4C0BA 1V0AA 5F2SA 5C9AB 5FOBB 3NNGA 3RS6A 3ZXFA 5K9YA 2LS6A 3U11A 4QPIB 4AI8A 1IS4A 4GWJA 3BU7A 1G8WA 5FV3A 4KQ7A 1JZ8A 5FUIA 4LT5A 3ORJA 4CXWA 1GZCA 3BODA 3KGZA 1NCQB 5FO7B 3AX4A 3VZNA 2IXIA 4ZKTB 2JG8C 4XE9A 2E32A 3DKQA 5C3PA 1UYYA 4QHBA 4N43B 2D43A 3UKNA 4CDQC 5KHIA 3N4MA 3MEPA 4FTSA 2GMMA 3GJBA 1S0BA 1JZ7A 1LHOA 1OPMA 4MH0E 3U37A 4DRRA 4MXWA 5FZ9A 1OFSA 2NLRA 5CISA 1C1LA 1ZRFA 2I45A 4UAPA 2UY9A 5FPLA 1H1MA 3ZFGB 1H0BA 2Q30A 2VZVA 2ZGRA 3R4DB 4JGYC 3AYDA 2G1MA 4YRDA 3GM8A 5FZOB 4DQAA 1OA3A 2W1QA 4FPCA 1QWRA 5IVVA 2J1RA 3H3LA 2ZKNA 3S0MA 3MYXA 4Y4YA 3ILFA 2VY0A 2G9FA 4CDXB 5A32B 3NKGA 4I3GA 1ODNA 3TAYA 5JOXA 1NCRB 3POGA 1GWKA 2CNAA 2Q1MA 3DEMA 3KV5A 4CU6A 5EYXA 4FAGA 1ZRDA 5FQ0B 3OY8B 3W5MA 3IMNA 4RR3A 1SLLA 4LLOA 2WQ8A 1S0JA 1UU6A 1TZOA 5KC5A 1PVC3 4B3NA 1W8HA 5B4NA 1EAH2 3WDYA 5JUVA 2JG9B 3G6JB 4A45A 2IC1A 3ZXLA 4IGQA 2FCVA 2IFRA 2VVFA 2BGOA 2RDQA 1W8TA 5FY0A 3R0RA 1R1A3 2WNVB 3MW4A 3GYDA 4UF0B 4GWMA 4UI9L 1TNFA 5LY1A 4XW3A 1TMF1 1W2OA 2EF6A 1V6IA 2HWC3 3JD72 4E4DX 3HT2A 1RVF1 2GN3A 1UIKA 3O0XA 4XXAA 3KT1A 5CA6A 4IGOA 3VUOA 4F8AA 2N7GA 4PCRA 4ZZ5A 3BOPA 2WAOA 2CL2A 3NAPA 4QGNA 1W8ZA 1RUI3 4AE2A 4BU2A 1DU3D 3EHKA 4JKMA 2FQPA 1UF2C 4J1WA 4WM7C 4UW6A 1U5ZA 1RUC2 2ET1A 1U5YA 3K51A 2CGNA 2MEV2 2ZHNA 2PHUA 3CIHA 4FPHA 4I3PA 4U36A 1F5FA 3AKRA 3URFA 4GH4A 4MG2A 2CGOA 3B00A 1REDA 2D6NA 1JODA 5K0UB 1C1FA 3N36A 4FP3A 1QXRA 1W05A 1AR91 3NV4A 3C8XA 3WQ1A 3Q8EA 4TXWA 1U0AA 2IXCA 4D7SA 1UZWA 1JU3A 5FPVA 1F5JA 2VU9A 3UT0A 1JZ2A 1ODMA 2K46A 1O7FA 3MIFA 4I09A 1H6XA 2WDBA 3TYJA 1DQ6A 3QH6A 4AF9A 4DXTA 3T2OA 5IT6A 1NZIA 4C90A 3M8LA 5DPNA 2AENA 4HG6B 4GB32 5J98B 3WG3A 1KS5A 1VRH1 1V6MA 3B9CA 1LENA 1QHDA 2OQ7A 4DXSA 1QJX1 3RFRA 1RUG1 4QX0A 4PBOA 1KITA 3M7AA 4H7LA 4LBJA 2OVUA 5FY8A 1COV3 2Q8OA 3DYPA 2VW2A 4YFWA 5FYSA 3ZKUA 1TG7A 1F2NA 2QZ3A 3KV6A 5FPUA 1IQDC 3BUCA 1YQ5A 3JBG2 3EYPA 5L7OC 4QX8A 3BPSA 1PIV1 3OGRA 3AZYA 1HJGA 4FPFA 3ZXGA 1LOBA 3RYPA 5ISLA 3JZVA 3P6BA 4IXLA 1GR3A 1RMU3 1W03A 2A6YA 1BK1A 1FMD2 4ES8A 4CEWC 2JB4A 4CA9A 2ZMNA 5BNPB 5FMOS 4AEDA 1AR81 3VD4A 2B9VA 1YEWA 2Q1ZB 5LK7B 4LO4B 2XWBB 3PMEA 3VZJA 1O5LA 2YZ4A 3LQCA 5F5QA 5BNQA 1JH5A 2C26A 4IE7A 1Q8VA 4LUMA 4AZZA 2HWB1 2ZX1A 3I2OA 3TN92 2VMIA 4AEKA 2Y34A 3PJQA 3U78A 1PNFA 3LAGA 4UFMA 5SV5A 3T09A 3MF6A 5C71A 3B5LB 2PLV3 4KG8A 2AC1A 3PIJA 4I0BA 4YW7A 1AX0A 1QEXA 2YUEA 4YW1A 3WHUA 1JZ4A 3VD9A 2VZTA 3ZYRA 4CTEA 4WZCA 1PO13 3VZOA 4IW3A 1QF3A 5FP8A 1ND3C 4IERA 5A7NA 1FNZA 1WD3A 4MYEA 5IK8A 4P5HA 1WCUA 1IPSA 3MIBA 3CJIA 4OHZA 2DDUA 4NRQA 4HN1A 1ZA7A 2XKOA 4HFSA 4QKBA 1VAVA 2VBDA 3P3PA 4FOQA 5K4LA 3FLTA 4DY5A 4GALA 1KJRA 4XYXA 2AR6A 3I7DA 3IDBB 2ADEA 4Q4V3 4L97A 1DQ2A 1NXMA 4JCKA 3WX5A 1QH7A 3NJXA 3UK9A 4LO7A 3MIGA 4L8QA 5C33A 4AVCA 3O1UA 3W20A 4EWEA 1A8MA 1N3OA 5FYHA 4LKDA 1RGSA 2QZ2A 4KMQA 4QXKA 2EICA 3WOGA 3O5SA 2TUNA 3OJBA 4CPBD 4EN6B 4N9IA 1VBA1 5T5LA 2ZGMA 5DG2A 2VCCA 2CTVA 2FCTA 1J3PA 1AR63 1UOBA 4J25A 4JGZC 4CDUC 1RXFA 3T2TA 2XVGA 4QKFA 1GZWA 4CCKA 1D4M3 1LGBA 1VBC1 5CG9A 3AKQA 2EIDA 4LLFA 3WD5A 3WHTA 2XBO2 3HQRA 4CCMA 1UU4A 1MPXA 4IEVA 5KHKA 2PQQA 5FPXA 1G86A 4QKDA 2KD7A 2PHXA 3LEGA 3N3HA 4PBPA 1DGLA 4PHZA 2C9KA 1R082 1JUHA 2FBEA 2XQRA 3AP6A 5GZDA 2NMOA 3M1HA 4PQQA 2A6ZA 2PHTA 3AVRA 2BJSA 1AYM2 1A34A 2D3RA 1R64A 2RJLA 4A2UA 3GHMA 3RDIA 1WCKA 1OKQA 2WS92 4CDWB 4ISQA 5J37A 1J83A 4MHUA 2YGLA 1UW8A 3PJYA 2DFBA 3BIWE 5BV6A 3PVEA 3M2MA 1WLCA 2NPIA 2CU5A 4LBQA 5EQUA 5DAWA 3APBA 3I3QA 5FPBA 3NV1A 4BQWA 4X8NA 4ORFA 5G04L 1X33A 3KF3A 4ASMB 4N7UA 5F8PA 1HW5A 1Y43B 2A6VA 3H7JA 3L9JT 3MHZA 1NAEA 1S2EA 4ZONA 3RI9A 2BOIA 4CXYA 5JXIA 5JR2A 2XG3A 3NJVA 4FO9A 1XNBA 2VOVA 4R4XA 5CU1A 4EYUA 1SLBA 2VTFA 4BQ2A 1PO22 1C28A 4LR4A 5T55A 3T08A 2LUWA 4E27A 1SCRA 4LBLA 1SFYA 2CV6A 3RZJA 2BPA2 1K12A 1FPN2 1V00A 1YFXA 4YM1A 4RGGA 1IS6A 2VNOA 1DZTA 1QOTA 4WZFA 1V70A 4M01A 4YLZA 2BGCA 1QJU3 1G9FA 2XXZA 3EJKA 3DYMA 1GWMA 1B35A 1VBD1 4RYDA 3SHRA 1VBB1 3WG4A 2YBPA 2Y6HA 5EHDA 5AVAA 1JN2P 2WA4A 3ELNA 4XBNA 3OOXA 4LTAA 4Y26A 4D6SA 3ZYIB 2R30A 4BQYA 1O59A 5JI9A 4NIIA 1O3SA 2VTXJ 1LHUA 3KHBA 2F4PA 4R9AA 4YVSC 1H6YA 4AVVA 2C9AA 2DCJA 2WABA 1KJLA 3OGSA 3AMNA 2OKXA 1K42A 1LOCA 3VBFC 1IPKA 4WBBA 3CJIB 2WT1A 2AUYA 2FDFA 3DCQA 1RUE1 4NRMA 4YZ3A 4OHVA 5FMOL 2LROA 1LOFC 2ZZJA 2R061 2WZPP 2J7MA 3O1TA 1S0DA 3VBRA 3K2OA 3KCXA 3KLSA 2VG9A 1XU2A 3DL3A 5FK7A 3LA7A 3WDXA 2GC3A 1HRI3 4AVTA 2CAVA 1MS0A 4N9HA 2P17A 3ZDVA 2PAKA 1W04A 2GAUA 1LEMA 1OQDA 4AOCA 3KD4A 2NM1A 3I2HA 4XBQA 2PAEA 2YGMA 1LHNA 1N1SA 4CUAA 2BERA 3L2HA 2Z2SB 1VP6A 3BIEA 4Q29A 1ZZ8A 2R043 2XMLA 3ZN5A 1GZWB 5FBJA 1QJY1 2WL1A 4UFIA 3A7QA 4FBFA 1DCSA 1OSGA 4GULA 5LATA 2RJKA 3BYWA 4XCBA 2E6VA 1TMF2 2D97A 2VVDA 2A7AA 1HRV1 2P37A 4AYUA 1Z7S1 4FPEA 4OQ8A 1RVF2 1UOJA 5FWEA 3W9AA 2Y6KA 4GKYA 4GJYA 2VULA 3O7OA 3VKFC 5D8AC 5FZFA 1H1IA 1UZYA 5FPAA 2CWSA 1G7YA 2D44A 2ZA9A 3HEIA 3OGJA 4HK9A 3V0BA 1FV2A 1WLDA 2Q0AA 4FFHA 3ZO0B 4HETA 2YC0A 5FZAA 1NX9A 2VBPA 4XXPA 2XQXA 1UYPA 2E53A 4RSUA 4RGKA 5FP3A 3TNPB 2WZEA 4Q0QA 1RUD1 5JSPA 1ULCA 5FCCA 4K40A 3OG2A 3C7FA 4YM0A 2OPWA 4LBQB 4HANA 3FHIB 2UU8A 1OH4A 5LEKA 4JZRA 5DDJ3 3CDZB 1TME1 1AR92 3WY6A 4S2GA 4Z07A 1YJLA 3NNMA 2RS31 4W8JA 1HQNA 2GMPA 1XNCA 4Y22B 5BXXA 4YARA 2E33A 2QQPA 4JVAA 4DXZA 1XNAA 2OUJA 5AC91 2BUKA 1GICA 1SQ4A 2VQUA 2Y0IA 1MS5A 1PK6C 2W68A 3IPVB 1D2SA 2VO5A 4IV1B 4META 5GLTA 1KRIA 2AGSA 4A7YA 3OF1A 3B02A 3PUIA 1VRH2 2P2KA 4M3CB 2VAUA 5LA1A 4KL1A 1FX5A 2VNRA 1QJX2 3JU9A 4B4RA 1RUG2 5JDBA 1H2MA 2GH2A 5A33A 2FDIA 1GU3A 1KGYA 3WF3A 1NYWA 1UWWA 3H1YA 1KD7A 4ZXEA 3LEKA 2D6OX 2D6MA 1DZRA 1FATA 5DQ0A 3OPWA 1BHGA 4RQPC 5EFUA 2J1SA 3SITA 5GZGA 5HPOA 3I2GA 1AR71 1PIV2 4IV3B 4Q4Y3 4BWOA 4NPMA 2WBKA 4ASKA 1C57A 5IJRA 3GBFA 3RMYA 5F2WA 1WA6X 4HVRA 1POV3 3VBHA 4LBMA 1AR82 3OPZA 1JYNA 4JAAA 1APNA 1W6OA 1SPPB 4P02B 1ZZBA 4A3XA 4C1XA 2QJVA 4PLMA 5LCWL 3K4ZA 5KHGA 3T0BA 4PQ9A 2W5FA 4HPKA 3KV4A 4Q0VA 3MDPA 2WWUA 2HWB2 3ME2A 4K8FA 2WFF1 4D94A 1CAVB
chains in the Genus database with same CATH topology
1QMJA 3HBZA 4BPZA 3VBSC 3ZDSA 4XFGA 1IKQA 4FPGA 3RPQA 4GKXA 1XNKA 2X5IC 2C0ZA 5CNAA 1FNYA 2RMU1 5SV8A 2D5FA 2VQAA 4H7MA 3RJ2X 5KXCA 1ENXA 4XTPA 2WNUB 1AYN1 4QT6A 4Q8LA 4K6BA 2ARBA 4ITCA 3K48A 1K5MA 4GA9A 1DQ5A 1W0PA 1O3QA 5FO8B 3ILRA 1LB2A 1Q5OA 1LCLA 4IEWA 2P3IA 5FREA 2ZCWA 4YM2A 1JW6A 3CO2A 1ND2B 3RI8A 3WV6A 1X50A 4GXLA 1FOD1 3VDDC 1MS8A 1NA1C 1DQ4A 4LBKA 4FSJA 5C9AC 2VNGA 4MGKE 4ZU7A 2B42B 4FPOB 3S7EA 1VBA2 4QPIC 1QDOA 1LKNA 2FZ2A 1NLRA 1QGLA 5F9TA 2RS51 3AYAA 4QQOA 1NCQC 1AL23 4W6WA 1W6QB 4NWVA 1UKGA 4N43C 2IXHA 2D3SA 2KXLA 1Q8SA 4LO6B 3QH7A 5BY5A 2HWF1 3B01A 1CJDA 4IETA 1QQP1 2FMYA 1BXHA 1RUF3 2B46X 5JVVA 3UL2A 1OQEA 2VUJA 3T1MA 4KWJA 1OA2A 1GQHA 3CEWA 4ZU5A 2WINB 4FTEA 4AGGA 1YIFA 4CDXC 1IS3A 4MLOA 1MS3A 3V65A 1NCRC 4DZGA 3H50A 1A3KA 1TNRA 2QCSB 3M3CA 1OI6A 2ES3A 4COVA 5A33B 4Y24A 1ZYBA 3WG1A 2TNFA 4YVWA 1BZWA 4WVZA 1QNWA 3E97A 2ZBJA 2JG9C 4EV0A 1UKRA 3O14A 1A78A 2VPVA 4X6RB 2WNVC 1VIWB 3ZYJB 1MQTB 4Q0PA 1YLLA 2XJTA 3FC0A 2ET7A 2RR13 4I0WB 2RS11 1J1LA 2LALA 2EIGA 1W6OB 3E6DA 4HN0A 2GC1A 2VMHA 2UYAA 4HPKB 3ZSMA 1F8VA 1DQ0A 4J6GA 4Q4X1 2RM23 1VBD2 1XE8A 2HWE1 2XUMA 1VBB2 2R0HA 2H6CA 1OQ1A 3A4UA 3VGIA 2WLQA 2VOKA 5EZWA 1KDMA 3QLQA 1Y9QA 3DPRA 4OUSA 3AMPA 1GNZA 4IEXA 2YY1A 1EY2A 4QM9A 4C1WA 5BYNA 3ASIA 3VHNA 3CNAA 3FZ3A 2P3KA 5E16A 1RUE2 3BPZA 4JDOA 2XGXA 1VBE1 3AJZA 2D40A 2R062 1MEC3 1S1AA 2VOXA 3SNMA 2GC2A 2PHLA 2UWAA 1LRHA 1MVQA 3WUDA 5ACA3 2QNKA 2OUHA 4XQWA 4XFBA 1DHKB 2GNTA 4C91A 5CFCB 3H3ZA 3M70A 1PGW1 5D1IA 1H8TC 4I30A 3WP4A 2EXKA 2R073 4Q2FA 3N35A 4S2DA 3KGLA 1D0HA 5A3MA 2K9ZA 2BWAA 2E7TA 1LHWA 3BTAA 4AGVA 4RFT0 4Q26A 3AZXA 5J09A 4LNVA 4XIKA 1ENRA 1CIWA 3ST7A 3WNXA 2JKBA 2HJIA 1HRV2 3D82A 1Z7S2 5BNPC 1PHMA 1F31A 3LSDA 3MGUA 3BALA 3POYA 4BIOA 1YO8A 5JZGB 2BYVE 1O4YA 4BMEA 1ENQA 4AHWA 4P9YA 4Y5Z0 1G9CA 1RB8G 3LA2A 1Q8OA 4BLIA 1B09A 2DUQA 2VOWA 3WT3A 3V0AA 4AK3A 2NQYA 2XJPA 4YGCA 3H7YA 1WBLA 3VKNA 5C8CC 1I3HA 1RUD2 3NV2A 1PVC1 4YW3A 1HIXA 3KZ4C 3E5XA 4AVSA 1H9PA 4YVWB 1FAYA 1QXJA 4MX3A 5CFDA 1TME2 1N3PA 5GJ6A 4COWA 1R1A1 2RS32 1BVP1 4N53A 1RHI3 1UCXA 3NKTA 1LGCA 5GZEA 3ZMOA 2NMNA 4AHXA 2HWC1 4K1YA 4FXKB 5AC92 4CEYB 5JOWA 4AVAA 1H2NA 4JDMA 3KM5A 4YW2A 1OLRA 4HBNA 1NXD1 5ABJA 3AYEA 4X8PA 3RRDA 1RUI1 3VHPA 1JHNA 4XHXA 4XF4A 4IEYA 4DFSA 4AQSA 3MPPG 4GWNA 2GN7A 3ZSEA 4AI0A 1ZREA 4Z92B 3FFQA 4Y1UA 3VKMA 1MS1A 2DVDA 4PJYA 2QKDA 1OOPB 5DZEA 1AR72 4W65A 2YXSA 5GLUA 4AQTA 3DN7A 1N1YA 2JG8A 3JQWA 3OBRA 2OA2A 4UXAA 3SLIA 2ZAAA 5I91A 4CDQA 4AXOA 4FVVA 4IQPA 4RHV3 4BA6A 4BLJA 3LZZA 1QDCA 3OYWA 2GALA 1ZBE3 4YGBA 3N7LA 1HX6A 4JQRA 3WW2A 1AJOA 3EBRA 4JGYA 1G9BA 3T1LA 1Z78A 2D3PA 1MS9A 3M3EA 3Q9OA 4LHLA 1NE4A 4CDWC 2R32A 4IEUA 1PGSA 3FLPA 3ZSJA 4M0NA 2A70A 1COV1 2RMU2 4HT1T 4XJWA 1UD1A 1Z0HA 2Y26A 1RINA 1AYN2 1SDWA 3R05A 4O9GA 4JDNA 5IK4A 2CY6A 1T6GC 1KFXL 3LB9A 4V1PA 1RMU1 3HD8B 1H4GA 3VBOA 2G4IA 3H3UA 2DU1A 2XVKA 1V6OA 4YW5A 3CL1A 1HV1A 3BCWA 1FOD2 4EN0A 4WM8C 2D7FA 4JRAA 2WA3A 2BNMA 4IEQA 3FBMA 2GDFA 4R52A 1IKPA 4QU2A 2B45X 4QQPA 1O4ZA 3V0AB 2PLV1 4XFIA 1ASJ2 3VL9A 4E2GA 2RS52 4KU7A 3AMMA 4HK8A 5BUVA 1GSLA 1V9U3 4WM7A 1G9DA 1A8DA 1PO11 4MZUA 2Y0OA 2XVLA 4BZ4A 2PFWA 2B8MA 1S0FA 3POSA 1CAXA 4MXWB 1POV0 2HWF2 3WLUA 1AUYA 1QQP2 1EV13 1KDKA 3LSEA 2E63A 4Q4V1 2Z42A 4B4QA 4ONUA 1WBFA 4M00A 2JE9A 5T3NA 3WR0A 1BEV3 1Y3TA 4HL0A 2X8KA 2DCTA 2GMEA 3TB0A 4IESA 3KT4A 3S6PA 3X29B 1UZZA 2WNEA 5ABJB 5F6LB 4IEPA 4PDWC 3ENRA 4RR3B 5C6CA 1GYKA 1RUH3 3INAA 1OHFA 3D6EA 5HCAA 4LBOA 1C8M3 1AR61 2JEMA 2ZGTA 1Q56A 1D4M1 4NN0A 4ZU4A 2DTWA 3VV1A 3WP6A 2LTNA 1NZCA 4A7ZA 1ZX5A 3CF6E 4LEJA 1IGOA 1C5HA 1JUIA 5L7OA 1DG6A 5C4WC 1D4VB 4PF5A 3J8F3 5KXBA 4EN8B 4P14A 3MPBA 4CEWA 5T50A 2RS12 1ZZ6A 2BNOA 1ZZ9A 1N47A 1DZQA 1DLLA 5DUUA 1YWKA 3NAPB 4JGYB 3HQXA 3KT7A 2PELA 5JLVA 5DUWA 4Q4X2 2HWE2 1WLWA 1LULA 1CONA 2ZGSA 3UJOA 2D6KA 1JTZX 1UAIA 2I74A 1TE1B 4GH4B 2GNDA 4XQ4A 1UL9A 4DY3A 3WDVA 3LKJA 4ATFA 2PN5A 3IWZA 2VUAA 5DZFA 3ZN4A 5LK5A 4DS0A 2HWD3 4KWLA 5H9PA 3EO6A 1VBE2 3VBOB 4TZDA 4B7KA 3LOBA 4FXGB 4HVOA 1HXS3 1W6PA 5FRAA 1CR7A 1AHSA 3ZSKA 2NP0A 4Y1XA 4IV1C 5IUQA 3ES4A 4YYOA 1O91A 3AZWA 2D93A 1QJU1 3IDEA 2ZGNA 5AFEA 1V6LA 2ERFA 1G6NA 1LOAA 1PGW2 3MZHA 1SMVA 1QKQA 2ZGUA 3JCIA 3B69A 4QPGC 3AZZA 1CPMA 3THTA 3P3NA 3W59A 1YIPA 3WP5A 4CDUA 4E4ZA 1U5XA 4JGZA 5JWPA 2I2SA 4IV3C 1ULEA 1WMEA 1PZ8A 3HAGA 1XXNA 1NG0A 3BB6A 1I6XA 4AEDB 2AREA 4XPVA 2A3YA 4QGMA 1QOOA 1LOEA 2WT2A 4Q4W3 4PIXA 5I0TA 5KHJA 1U12A 4OHXA 1R093 3AMHA 1HRI1 1LU2A 1KS4A 2DUPA 4FPKA 2ZOEB 1PVC2 1WD4A 1BCXA 2XJRA 2Z5WA 3RMXA 3CU7A 2WIIB 1WCDJ 2EAKA 1N1TA 4IEOA 2R041 2WNUC 5FTTC 1GV9A 3J9SA 3FE5A 1R1A2 1NY71 4XETA 3QD6A 2ZKLA 2QUOA 2VGDA 3O12A 3JUUA 5BNNC 1XQNA 4ZXKA 4H3WA 5HI0A 2HWC2 1ZBA3 4CP2A 5GZFA 4XJZA 3PVNA 1RUJ3 1LTEA 1CAUA 4ASLA 4RS5A 2CYFA 4I0AA 4FPLA 3L2YA 3JB8A 1ND2C 3N7MA 4LUKA 1RUI2 3MW2A 4F83A 3VHRA 3D0SA 4N7IA 5L19A 4AEMA 2QDRA 1QXPA 4Q0UA 1Q3EA 3MICA 5KC6A 3TRSB 4N90A 3WDWA 2WZR3 5DDJ1 3VZKA 5JAXA 2QE3A 1X36A 3OBTA 1RUNA 2DVAA 5I0RA 3O0WA 4YVSA 3VBFA 4QMAA 1GKBA 2A3WA 2HEWF 1S2KA 4XOGA 2VXRA 2NZ9A 1LOFA 5BNOC 3ZFFC 3ZFEA 4XFCA 1ZZ7A 4I02A 1ZRRA 2WFPA 1I1EA 1XYOA 2ZGQA 4XJ8A 1H4HA 3HWJA 2DCKA 3ES1A 1COV2 3IBMA 1BBT3 3E6CC 2BW8A 2OIIA 4TYSA 5KXDA 2JXAA 1XU1A 2EVXA 5CVRA 3MI8A 3OCPA 4G9SB 3SISA 4QPYA 4Q4Y1 3MF9A 3I59A 3AP5A 3H1MA 1D0GA 1RMU2 3NSTA 1CD3G 5CADA 1POV1 3O0VA 1MQTC 2A73B 3AXDA 4I2OA 2F6BA 1YFWA 1VLNA 4KGGA 4YFZA 3AFGA 4M3CF 4AEJA 1VALA 1W39A 1B35B 2PLV2 3NWKA 3WW4A 1OPOA 2MNGA 3GHNA 2DYCA 4ES9A 2W52A 1QNYA 2O8OA 3FWEA 1PO12 1SFNA 2XJSA 3B7MA 4KG0A 2DVBA 2LM3A 4AHYA 4DPNA 1C4RA 2NN8A 1UN1A 2DU0A 4FT8A 5T52A 3RWNA 4FAHA 4WV8A 4P9GA 1MZFA 2W39A 3AKPA 3OTFA 1ONAA 1XYPA 4AI1A 3H9AA 2DVGA 3VBRB 4RS5B 2HKXA 5JSRA 4YZ5A 2WJSA 2ATFA 1PK6A 4IEZA 3USSA 2H6BA 2ZGKA 4YNIA 1V6KA 5EYYA 4RGAA 2WQZC 4MUVA 4HMZA 4Z1VA 2VECA 3H1WA 5CFCC 1AR62 4E2QA 3W58A 4BCUA 1AL21 1KXGA 4XFHA 1D4M2 5JR7B 3WZ1A 4F7ZA 3VL8A 2X29A 5LRRA 4RQPA 3AXEA 3A0KA 1C5IA 4X6QB 2R0FA 4XJ9A 1YRZA 1EAH3 1MR5A 1RUF1 3ZIWA 2XHKA 4AFMA 2PAMA 2OYZA 5GLWA 4HKOA 3EQEA 4DNYA 4UBGA 3WP3A 5JZGC 2ZX3A 3JD73 4OI1A 3V0BB 2CWMA 1PGL1 3ZFEB 2B5HA 1UX6A 1SLCA 5DG1A 1RJ7A 3GZAA 5JOYA 1VBC2 3VBSA 4EWDA 4XJAA 3AM2A 2X5IA 4H55A 3LWCA 4NHLA 3E5QA 1RUC3 5KHHA 5FOJB 1W6NA 3VHOA 2MEV3 3UV9A 1EP0A 3ZFGC 3RSJA 4K21A 3I59B 1J1TA 3WQ0A 1DDLA 3LOIA 2YDEA 5LRSA 1WW4A 3I2DA 2RR11 4B7EA 3E6BA 3MLLA 4XFAA 1M4WA 1HDKA 3TBDA 4CEYC 2DFCA 2O1QA 2V5YA 4LULA 3FJSA 2AYHA 2QVSB 2JDZA 1QJU2 3VDDA 2RM21 1W2UA 1NA1A 4GB33 2Q5TA 5C9AA 1YXWA 1ENSA 4QPIA 4WVVA 4XEZA 4PIZA 3HR9A 1OOPC 2A5ZA 4AG4A 2JD4A 3ZX7A 1NCQA 2XH6A 1NQDA 5T5JA 2V09A 5T5PA 1QH6A 4G3YC 5JI7A 3ZYPA 4QQLA 1ASJ3 4N43A 1SBEA 3JBG3 4OVEA 3VBHB 3AFKA 5FDBA 1DGRN 1WCSA 2YHJA 1WW6A 2O0OA 4B4PA 1MEC1 1FMD3 4K9SA 1KFUL 3OD4A 1W0OA 5FAXA 2BBVA 3R4UA 5ACA1 4K1ZA 3WQ7A 1HRI2 4J1XA 3C3VA 5JCTA 3U10A 3MIHA 3ATGA 1NOVA 4CDXA 2PA7A 4MSVA 5A32A 3NVCA 3WXPA 1OLQA 5KWRA 4R9DA 3TN93 2OW4A 1NCRA 3SXWA 1RJ8A 2R071 3PMSA 2XL7A 5E8AA 1DQ1A 3MIEA 3AB0A 3JB4C 4MGIE 1DBNA 3RG0A 5K0UC 2R042 3KSCA 1ZM1A 4UW4A 1K5MB 2BTVC 3VN4A 3M3OA 5JPMB 1IS5A 4L9BA 4LHNA 2JG9A 5T54A 1N1VA 4YG0A 2SBAA 3I54A 2ZAHA 5GLVA 3DV8A 5K8SA 3C2UA 2KM2A 4XMAA 1VR3A 3IM0A 4Q1RA 4DB5A 4WVMA 2VH9A 1S0IA 4BHPA 2ZMLA 2A6WA 4FP2A 2AZ5A 1CAWA 3PLQA 3ZPYA 1YI7A 1PZ9A 1QJY2 3D5OA 3SCGA 3B9IA 2ZX2A 2BVBA 2W0XA 5DDJ2 1IZ3A 2X5IB 2R16A 1W6MA 2SLIA 3MFCA 1RHI1 2AH2A 3B93A 1W6NB 1WLTA 3NL1A 1WGPA 2D98A 2XBO3 5GALA 1RC6A 2P3JA 4FOYA 3VZLA 4JTOA 2WT0A 5JIUA 1R083 2IFWA 4SLIA 4XIOA 4FTBA 4HKWA 4JTNA 4K7JA 4L11A 1H2LA 2H0BA 1AYM3 2D6PA 5C8WA 4LO8A 5HXVA 5ABJC 1NE6A 2JX9A 4RR3C 4COYA 3HT1A 1IOAA 1J58A 2WS93 1RTVA 4GMP3 1VB4A 3VBUA 1H8TA 3J4UH 4Q4Y2 5FLHA 4COZA 3D0JA 4RHV1 4MVTA 4Y1YA 5KBFA 5CAZA 3M4FA 1AXYA 3NW4A 1ZBE1 2OPKA 3JQXA 3VKLA 4CP0A 1SLTA 1LECA 4LBNA 3GBWA 3AK0A 1VJ2A 5BNPA 2BQPA 4YGDA 4COUA 2E7AA 1PO23 4BH9A 5I8TA 4BE3A 4D69A 3NAPC 4NOTA 1FPN3 1DYPA 1RUOA 5H9QA 4DINB 1JBCA 3DPRB 4YM3A 5C8CA 4GH4C 4Z82A 1ZRCA 4E9KA 2ZGOA 1NQJA 2RE9A 4AI3A 2Z79A 3AKTA 4FQ4A 2XJUA 3SMHA 2K0GA 4W6XA 1REEA 1AXZA 4XZPA 4TLFA 5BPXA 1D2QA 4CP1A 5E88A 3VBOC 5CBLA 2ZPXA 4QQ2A 1ULFA 2WFF2 4W6YA 4XDQA 2WKKA 1WA4A 1H30A 2FZ1A 4YGEA 4MGZE 3MFAA 2Y38A 4P9IA 3AP4A 1YFYA 4NHMA 1J59A 3ZXDA 2XLAA 4RD7A 4WVMB 4HZFA 2EAAA 1M06G 1AL22 1V9U1 3GF6A 5I0SA 1SLAA 1CAWB 4XMIA 5J96B 2MPFA 1LU1A 1QY4A 1U5IA 4O9EA 4DOUA 4HSJA 3I4IA 4QGLA 3AP7A 2DCZA 3PVBB 5IK7A 1WW5A 1EV11 3U0ZA 4OFGA 1X82A 4TSVA 1SBFA 1W6MB 1RUF2 2YPJA 3WW1A 4AEDC 2R1BA 1A6CA 4QD2A 1BEV1 2ZZQA 2TEPA 1YHFA 1TEIA 1TMF3 2VMGA 1N3QA 4P9LA 3GZTB 1RVF3 4KWKA 2MHFA 1PGL2 1CGPA 1MVEA 1YJKA 4FQZA 4OHWA 2O8QA 1RUH1 1C8M1 2YROA 4CDWA 1EPWA 1PM7A 2DV9A 1OA4A 4Z2WA 1BQPA 5CFDB 2V73A 4URTA 2PHDA 4NWWA 4D3WA 3VBUB 1H8TB 1URXA 1PZ7A 3CJIC 3GNEA 4N53B 5E1RA 1V6JA 5DUVA 4E2SA 3J8F1 3WW3A 1O3RA 2IZWA 1AR93 2GZWA 2RR12 2NYYA 3G7DA 2B9UA 1FI2A 4FPYA 1IPJA 3IIAA 3WG2A 3CLPA 1ZZCA 1VB2A 4WM8A 2HEYF 2UWBA 3N7JA 2RM22 3EXUA 1GQGA 1GNHA 5DUXA 1JXNA 2Z69A 3THPA 5AFBA 1VRH3 3HN1A 4IL7A 3RYKA 3V56A 1QJX3 1RUG3 5JMCA 4YG3A 4A7KA 4XFFA 4YZ4A 1S0EA 2JG8B 3USUA 4OI0A 4FCAA 5C8CB 4CDQB 4Q27A 2A71A 3QCWA 2C5DA 2ZX4A 4Q0SA 1PIV3 4XTMA 2HWD1 3OYWB 2E7QA 1S0GA 4RL7A 5FO9B 1G9AA 1MEC2 1ULDA 1BYHA 1HXS1 2PHWA 2ZHMA 1XE7A 3SCHA 3WY6A 2YV8A 1BMV1 2JE7A 1AR83 2XKPA 3AYCA 4LHKA 4PIYA 4XF9A 3KMHA 4K20A 5ACA2 4XJUA 4L92A 5L73A 2DURA 4JV4A 4XQDA 3VLBB 2HYKA 4YZ1A 4FOVA 2HWB3 3N7KA 3SCFA 3QOPA 1VAKA 3H0OA 1PMIA 2R072 2ZGPA 4PDWA 2JECA 4AVBA 3M3IA 4BOWA 1ND3A 1JYIA 2C1FA 4GQ7A 4P9XA 2ZHKA 2XLFA 4R9BA 2DCYA 3A0NA 4WVWA 5C4WA 4Q4W1 4BQ1A 1ZVFA 3V64A 3AP9A 4MXVA 1YNAA 2E9QA 2WC2A 1R091 5I0UA 1O4TA 2RHPA 2B7YA 4QQHA 5H9SA 4UW5A 2VW0A 1DFQA 4AW7A 1DGWX 1AF9A 2K2SA 1GLHA 5FPZA 1B35C 3TWIA 2EXIA 5DZGA 4WM7B 5H9RA 3HMYA 1YI9A 3M3QA 1TQ5A 3ZXJA 1VBA3 4AGRA 4AFAA 1WW7A 1H8VA 2ZMKA 2YMZA 1CAXB 3MLKA 3WCRA 3DKWA 2OZJA 3WVJA 2E51A 1MZ5A 1RHI2 4S2FA 4D7TA 1VBC3 1UPIA 4BM8A 1QJZA 1ZBA1 2G9GA 4XF1A 2ZHLA 1LODA 1RUJ1 4R4ZA 4Y22A 1FT9A 4Q1PA 3GALA 4INDA 3VBRC 1Q8QA 4RS5C 2BFUS 3I8TA 3IPVA 4IV1A 4XF3A 4H14A 4WM8B 3POWA 1NLSA 2H0VA 4M3CA 3FFZA 3ZIXA 2XWJB 2ZTNA 1JOJA 3GZUC 4MV2A 2DWRA 2PYTA 4AFCA 5EV7A 4L99A 5GLZA 3QACA 3RQ0A 2WZR1 3RJRA 3ZXEA 2IXKA 3UJQA 5IK5A 4UBHA 4QPGA 3VZMA 5L7OB 4KGQA 4RHV2 3UKTA 2XJQA 2CAUA 1LESA 2DF7A 3RZZA 3USUB 5J48A 4UW3A 4IV3A 2XPJA 1UMZA 4CEWB 1HKDA