4FT8A

E. coli catabolite activator protein with cobalt and sulfate ligands
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of catabolite activator protein with cobalt(II) and sulfate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ft8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ft8A01
3PVBB 4KIGA 5CVJA 1VR3A 1FC3A 3ULQB 1UIJA 2CV6A 3KEQA 3H7YA 5I8YA 1P2FA 3CUQB 4H0EA 3NRVA 4YFKF 4QGNA 3COAC 1K78A 3R0JA 3FM3A 4B09A 2PLYA 1V3FA 3NEUA 1LJ9A 2V1XA 4LEJA 4PIZA 2C0ZA 1QQIA 1GXPA 3M8FA 2ZMEB 4XFBA 2WTEA 4OIQF 5FQ0B 2L4AA 2PA7A 5F1RA 2E7WA 5ICCA 2M45A 3SHFA 3O6BB 4IHTA 4NVPA 4JVAA 1IF1A 5BS6A 3BB6A 4LUMA 2CQKA 4KIFA 4BHCA 1HBXG 1KU3A 3CLOA 2GC1A 1XSDA 3CTAA 3HRSA 2XAFA 1DZTA 2Y75A 2XASA 1HW1A 1BOAA 4QGLA 2XAJA 1F1ZA 5LHGA 4AD9A 1ODDA 1YTYA 4KUMA 1FBQA 1IN8A 1NZCA 4UBGA 2IXIA 1BC8C 3FWEA 3QPHA 2KJCA 4LA3A 2Z3YA 1BI0A 3OOPA 2NS0A 2L3DA 1Z7UA 1IXCA 3LAGA 4IEQA 1NE4A 2WWYA 4G6DA 1SFUA 4MTDA 2CAUA 2BE5F 2KIUA 2JZYA 5LBQA 1IPJA 3DL3A 1XDSA 2FOKA 1ZZCA 4BYYA 1BBYA 1YUDA 1GQGA 4IERA 3LOIA 1ZZBA 1U6GA 6PAXA 3DFGA 5H20A 3ZMDA 3LA3A 5D4RA 2MPFA 4Z07A 5I91A 4BHBA 5H6RA 3I7DA 2XROA 4KFCA 3GFMA 2EFQA 4EV0A 2NRAC 1YW9A 4BIFA 3TKYA 4KN7X 3V7CA 5DUIA 1EV7A 2WV0A 1XMAA 2XAHA 2XKOA 2D45A 3R60A 1R1VA 4OIRF 2ACJA 1B6AA 3CEWA 5HDGA 3TO6A 2V1UA 5DCMB 1ZAOA 2EAAA 1IAWA 3U0ZA 2YR2A 1MKMA 1OPCA 2ETHA 4H7LA 4Q0PA 3IBMA 3WGIA 1RIOH 3V7RA 2WC2A 3ROUA 2W85A 4R8HA 4A2UA 2QCSB 2B0LA 2E9QA 3AAFA 4IEWA 1MJ9A 1X7NA 5FPXA 3BDDA 1E17A 1KU2A 2BV6A 1K79A 2QJVA 2ATFA 1YFHA 4OU0A 4LULA 3MDPA 2XV4S 1TW2A 3DQVC 1FBUA 4DNCA 4XFCA 3V7SA 1R22A 2IXLA 1W7PB 4A5MA 3JZVA 3K9TA 1IRGA 1SQ4A 4XFAA 2RDPA 1J3RA 1MJBA 3F8MA 1S7OA 3ECHA 4P9UA 2O3FA 3RIRA 2RV8A 1YQAA 4PJYA 1JUHA 4YYOA 1FT9A 1KGSA 2QYOA 2L54A 2Q8KA 3BZ6A 1OI6A 4GGGA 3T0YA 4JK1X 1PUEE 2XAGA 1QXJA 2IRFG 3HTSB 4Q0UA 1ZYRF 2F2EA 1ZHFA 1LEAA 3H1YA 4D0PA 2FRHA 1IRFA 5E1ZB 2MC3A 2QZ8A 2DLLA 3H1MA 1KU9A 3RPUA 1DUXC 1TNSA 1SD5A 1CAUA 2HQNA 1LDKB 4HVRA 5HS9A 3QP5A 3VOEA 3IDCB 1CAWA 3TGNA 4AWXB 2NAZA 1FBSA 1XRUA 3HTUA 1VTNC 1UCXA 1YO5C 2P6TA 2ELHA 1RGSA 3BCWA 2GXBA 4XSZF 3BALA 3HRMA 4HLXA 4UXNA 2P4WA 1LB2A 2AS5F 1VJ2A 3TO9A 4EM0B 3WE2A 2JSCA 5BQTA 1P4XA 2FQPA 4QXKA 4HV5A 1QGPA 3GX4X 1Q1HA 4FX0A 5FDBA 1KA8A 1U78A 3ES1A 3U2RA 1WGPA 4Q5SF 4MX3A 5FLXZ 5E18F 1MZBA 2CGPA 3ES4A 4HBNA 4UVBA 3WTYC 1W5TA 4IEPA 1IXSB 5BUVA 1QZZA 2K86A 5LRSA 2FXAA 1G3SA 3GFLA 2PFBA 3C7JA 5HDNA 1O3SA 3PNAA 2QQAA 3DXJF 3EQEA 3WW3A 1QNTA 1QBJA 2VPVA 2MBFA 1WA4A 3ZMTA 4HQMA 5HVQC 4AVAA 5AIQA 5JVTA 3S0MA 4I02A 1R1TA 1WI9A 3HOTA 3J7AO 3V8LA 2B5HA 4I01A 4LA2A 3E5QA 4CO8A 5FB2A 3OD0A 4G7OF 3F21A 3NW4A 5D1IA 1HKSA 3F8NA 4UNOA 2BNMA 5JSRA 3D0JA 4AXOA 4TLFA 2L4MA 1FNNA 3BJOA 5D6FA 1OKRA 3UKTA 2LF8A 2A07F 3PFIA 4U7DA 4HF2A 4BH9A 4U88A 3M8EA 1OYIA 4JTNA 3GFJA 2PAMA 1PM7A 2UZKA 2AXLA 3SQNA 1WLTA 1T39A 1I1GA 4JV4A 4IRGA 4Y13A 3ZMZA 3WTTC 5ILUA 1XSVA 4YG2F 3HT1A 4HYEA 2HEOA 2YSRA 2HTJA 1TW3A 2CYYA 4GCVA 4HAMA 5D4SA 2ZBKA 3QAHA 3DPTA 4KMUX 5E1RA 3MAJA 2D5HA 3GUDA 4LUKA 4HN0A 3E5UA 4A0ZA 3F8FA 3SCGA 3GWZA 1ZX5A 3R4KA 2W84A 3SFZA 2GH2A 3U10A 4IEYA 4UV9A 1EYBA 3L7WA 2BBYA 3V8KA 2YX7A 4HF0A 5EEHA 2HWVA 2YX4A 4GO1A 5DD4A 1BN5A 3CO2A 3FF5A 4KA4A 3NSTA 2HGCA 3KP2A 3R0AA 2X0LA 4ZU7A 5BPIA 3FJSA 5FCCA 1GQHA 2Z69A 1WKMA 1Y3TA 5FD5A 1XGSA 1YIOA 4S04A 2HQRA 4Q0QA 3NJZA 5I0TA 5K5OA 1U12A 3KP5A 1FLIA 4X6RB 1HW2A 3GFIA 4CHUA 5E16A 4JTOA 1SFEA 2QBYA 4XEZA 1DPUA 4IEOA 5BMZA 3W6KB 5BY5A 2D5FA 2RKHA 2GAUA 2V9VA 3O2PE 1ZG5A 2IXCA 2IP2A 4Q48A 3ZN0A 2UWMA 1T2KA 2XLAA 2Y48A 3M7GA 1H9TA 3K1PA 1J0RA 3DPLC 1ZGJA 4J1XA 4ORFA 3BY6A 1J5YA 3J80K 1GXQA 1P6RA 2JRTA 2GC0A 2MHFA 2O1QA 1GHCA 3H1WA 2OZ6A 4WX9A 4UUVA 3H8UA 1H1IA 1E2XA 4P96A 4MUVA 2ZNZA 1ZREA 1Z1DA 2VE9A 2RQPA 3N4MA 1ZZ9A 3GO5A 4BXUA 3R61A 1G3TA 3CL1A 3P9CA 2K4BA 2FSWA 1MDMA 4RB3C 2ET1A 3CO7C 4ESBA 4LFUA 4WF2A 2OA2A 3KEOA 3HSEA 2EV5A 1I5ZA 4XF3A 1B59A 3KGLA 1FYKA 2GXGA 5LGUA 5DUKA 2K4JA 3CJXA 4HZFA 2Y0OA 4HSLA 2KIMA 4XF1A 1Y9QA 2Q0AA 2VC0A 4GYIA 3H92A 2Z99A 5J7MA 5FD6A 2UY9A 3HYIA 3WU0A 4I3PA 3GYDA 1HKTA 3ZMSA 4P55A 1TBXA 3WE3A 5I0UA 4I0AA 1QWRA 3GLXA 3FM5A 2IA2A 2HS5A 3LA7A 1D3YA 3JAMK 1S6LA 3TO7A 1CF7A 1WQ2A 2V09A 3KSCA 1KQ8A 1B9NA 1G6NA 3F6OA 3WGHA 4LG0A 1XDUA 3E6DA 1DZRA 3ZMVA 2OQGA 3TDUC 4O6JA 3CDHA 1OR7A 1R1UA 1GVJA 3IL2A 4CXFA 4RAZA 5BPDA 5DEQA 2HZTA 4Y17A 1YHFA 5FPZA 3I53A 3V4GA 1O4TA 3KP7A 1W5SA 3F6VA 1R5GA 1FXZA 5C8WA 2H6BA 5J6XA 3NL1A 4FT8A 4N0BA 1XN7A 4EMSA 4EJOA 3FZ3A 3T5XA 3I59B 4ETSA 2EA2A 2Z2SB 3ELNA 2E1NA 1J3PA 1X3UA 4RGXA 4MGKE 2EK5A 1LDDA 4GYGA 2O8QA 4E2SA 5HLIA 2VN2A 5LHIA 1ZNPA 4BNCA 4IXAA 1ONVA 2KRFA 3SCFA 2Y0MA 4QX5A 2A61A 4UBHA 4KIBA 1KQ0A 4BHPA 3OCPA 3KFWX 5LGNA 4CICA 1RNLA 4QM8A 2FU4A 4F7ZA 2E7XA 4PGGA 1UFMA 2RVCA 4LB6B 1Q5OA 3HUGA 4Z2YA 4FAHA 3KZYA 4LLNA 2JTVA 3MQ0A 3E97A 1I1SA 2FE3A 3HRTA 1TQPA 3RDIA 2P5KA 3KGZA 5FO5A 5CVUA 2J5OA 1CAXB 2ETEA 3T1BA 4YFXF 4EWEA 2FNAA 2PAEA 2DO7A 1YLFA 2BGCA 3IWZA 2XIGA 4MTEA 1YFWA 3HQXA 2ZNYA 4HF1A 2RNJA 3LQRA 5A2QZ 5I8SA 1ZRDA 1EH8A 5I93A 4KICA 4XLPF 4U7BA 1BI3A 4ESFA 3WTUC 4MV2A 4MGZE 3GYHX 5IT9Z 1Z91A 4ZYGA 1UPIA 3CUQA 4KN4X 2O03A 3J81Z 3F22A 3IRQA 2EVXA 5CVIA 1FZPB 1X8MA 2D1VA 4U0YA 2QVSB 3ZQ7A 4GXOA 5D8KB 1V70A 1I6XA 2G7HA 3E6MA 2ISZA 5EZWA 2ZMEA 4O5VA 2MH9A 1JGSA 1K6OA 4EM1A 4WVZA 5FQ0A 4LTAA 3RYPA 4EWAA 1CAVB 4LK0F 1BC7C 4MZUA 5JR3A 3OV8A 4IETA 3I0TA 1TNTA 1OD5A 2QLZA 5F6FA 2PFWA 1O3TA 1EP0A 1YS6A 2EWNA 4HA8A 4EGYA 3ML6A 4A6DA 5FLIA 1MJAA 4I2OA 1UCRA 1FP2A 2GC3A 5CJ9A 2OYZA 2DU9A 1O7LA 3WTXC 2L02A 2GIVA 5L3FA 1B4AA 3QP6A 4CZZA 2P6SA 2W57A 4PGHA 1YW8A 4HDUA 4HV6A 2Q30A 5KHKA 2G9WA 5ILSA 4Q0VA 4HVOA 1TLHB 5JI6A 1ZRFA 4S05A 3F8CA 1O7FA 3MEXA 1EPZA 3ZMUA 5E1WA 5HLHA 1UIKA 2QUFA 4ZU4A 2MA3A 2HJIA 1JE8A 2OD5A 2OQRA 1W4MA 3P9KA 1PMIA 1RZ4A 4QLCU 4G7HF 4QM9A 4ZZDA 4JBAA 3SHRA 3KP6A 1FYLA 4O3MA 2K0GA 3NVCA 4G94A 4L5JA 1LEBA 2DI3A 1X82A 4N9IA 5DYMA 4G7ZF 2FQ3A 1T0FA 2DCTA 1UB9A 4HLTA 5E17F 1LNWA 4IF4A 4EJVA 4L9NA 2XL7A 3ETQA 3MPBA 4FBFA 2GWRA 2HKOA 4MGIE 1ZRRA 3QRFF 3IRRA 1X8EA 4J1WA 2PN6A 5DD8A 2VECA 4OLLA 2GC2A 4LJZF 5FFXA 3EO6A 3HIFA 5DCMA 2STWA 4RB2C 2O6GE 4HSJA 1P4WA 1TQ5A 2IXJA 2WFPA 4KU8A 4CDGA 4HX8A 1U8RA 1SD4A 2EFWA 3ECOA 1NYWA 2EFOA 2Q2EA 3WTWC 5JR7B 5E1XA 3L00A 3NKTA 4UXAA 3P7NA 3LAJA 3FMQA 2F4PA 1W7PA 2H94A 2V1DA 2PHDA 1UD1A 5ICGA 2OBPA 1FSEA 2QM3A 4F8AA 3S2WA 1LDJA 4ZH4F 2LF7A 1AWCA 2GQQA 2K27A 1J9IA 1USSA 3DP7A 4CYDA 1HXDA 2M8EA 4D7TA 2TDXA 4P9GA 1WRJA 2OPKA 2IPQX 4HLYA 2V79A 1PDNC 2IW5A 2XGXA 2XKPA 2PJPA 3EDPA 5K8SA 5LLQA 4Q29A 1NHAA 4ENNA 3JTGA 4QGMA 1UW8A 3FE5A 2W24A 5ICEA 2HTSA 1IW7F 3IKTA 1ZZ7A 2MNGA 2VOOA 1ZG3A 1FI2A 1S7AA 5KHHA 4I7HA 4MNUA 2HFHA 3D5LA 5DDGA 2ET7A 1YLLA 4AVBA 3LFKA 1G3YA 4EJUA 3RNSA 4R52A 2IA0A 3K0LA 2EFPA 3R6SA 1H9GA 1J59A 1ON2A 1H1MA 2DT5A 1S3JA 1KU7A 3SZTA 2XHKA 5J48A 3REOA 1ZLKA 2XRNA 4L0YB 1ZGAA 4HX7A 1YYVA 4AIKA 2HYGD 3QACA 2PQ8A 2DFIA 2LKPA 3LAPA 5EFUA 5JHUA 2QDRA 3RKWA 3EYIA 4L9TA 4UVAA 1OYYA 2IXKA 4YIIA 4XF4A 4WXHA 4WBBA 3BWGA 1LKNA 4AVPA 2GU9A 1P92A 3SXWA 3GBFA 2OZUA 5D5UB 2P17A 2A6EF 3EETA 2YU3A 3H9AA 2DBBA 1S29A 4U0VA 5I0RA 4NB5A 3OGJA 3L9FA 2A5YB 3IC7A 3SZPA 2UXXA 5D8LB 2Z9OA 2Q1ZB 2ESHA 4LGWA 2O8XA 1MD0A 1VP6A 4MEXF 1V4RA 4HVQA 2D93A 2K7LA 4KYWA 3BOQA 1SMTA 1U5TB 5KHIA 4OFGA 5K5QA 4MGYE 1IZ1A 3KP3A 2CSOA 3FXQA 2PMHA 5BV6A 4NHJA 3P9IA 2PI0A 1XGOA 4TV7A 4PDKA 2LNBA 2G7UA 3HSFA 5DCFA 3WW1A 3ZPLA 2EB7A 2M1BA 4D7SA 2JPBA 3KZZA 1Y0UA 4LD5A 5D5XB 2HR3A 1XCVA 1U3EM 5FLJA 1R00A 2VE8A 3T8TA 1D5VA 2CFXA 1REPC 1SD7A 1Z9CA 3MFKA 2DQLA 2FBHA 4R79A 1JHHA 3F72A 1S8NA 3BJ6A 2MH2A 1FOKA 2KXLA 3EJKA 5AIPA 1IN7A 4KMFA 2R3SA 4B8XA 5JCTA 2NYXA 3MWMA 2FF4A 5CADA 2DQRA 1UHWA 2PHLA 1T6SA 1XGNA 3CUQC 4GULA 3JSPA 2ZO4A 1XMKA 1QXRA 5LGTA 3O14A 4ZYDA 3I5UA 5L3EA 2IC1A 1ZG1A 1DPRA 2VQAA 3Q9VA 3GZ5A 5C6CA 3OTFA 4XFFA 2BYVE 1XCBA 2IA1A 4HX4A 2NNYA 1ULYA 4WK8F 3IHUA 1K78B 3BPXA 4X6QB 3VEPA 2B9UA 2GA1A 4ZYHA 3L2CA 5AVPA 3KLOA 4G9YA 4UHTA 4AQ6A 3IDBB 3RYRA 1HQCA 3K1NA 3TOBA 4ZYEA 5FGMA 4QMAA 5E8IA 1ZZ8A 1Q43A 3D0SA 2PMUA 3B73A 3HOSA 3PQJA 2Z33A 5LEJA 4DINB 1D8KA 2VBWA 4HQEA 2M5WA 3BPZA 1R7JA 1JXSA 2QQBA 5L3CA 3I54A 3NQOA 2ZXJA 4LB5A 4G8XA 1O3QA 2RGVA 1ZH5A 3N97A 3I58A 3ZP5A 1CX4A 3RKYA 4PIYA 4NQWA 4R1HA 1EH6A 1OYWA 2J5PA 1FPQA 1HSJA 3EYYA 4FAGA 2NNNA 4L5IA 1F4KA 4EM2A 1RL3A 4XRFA 3KCCA 1LQ1A 4YFNF 1R36A 1YFYA 4EJWA 4IHSA 1QPMA 2FMYA 5BXXA 3BPVA 1O5LA 4ENKA 5JFRA 2CW0F 4XFGA 3F3XA 2DAOA 3FHIB 3GXOA 2K9ZA 5CU1A 4OINF 4KWKA 1I27A 3HHGA 2VBYA 1FP1D 3VFZA 3IIAA 1IN6A 4HN1A 2A6HF 2X4HA 4Z82A 1PP7U 3H50A 1BIBA 1STZA 1HSTA 1B1BA 4O9GA 3L09A 4CGZA 4KU7A 1OFNA 4I09A 3G3ZA 4AIHA 5KHJA 2Q0OA 4RGUA 2HOEA 1L0OC 3VHRA 4HDVA 2F5CA 2FNPA 1BM9A 4HMZA 3KE2A 3FZVA 1YFXA 3F23A 3DKWA 3ERED 2DK5A 2KJBA 5L3DA 2K02A 4MQ9F 4EROA 3JW4A 2EV0A 1XSXA 5DV5A 4U0WA 2A69F 4G6QA 5CYVA 2W25A 3J80Z 1IN5A 3MCZA 3GVAA 2M87A 2UYAA 2ZJ2A 2MLKA 4IVNA 4RB0A 5HDKA 4IEVA 3DN7A 2QENA 2R7DA 5TJJA 1J58A 4MEYF 1G3WA 5LHHA 2QWWA 4KL1A 4L2NA 3GW2A 2EV6A 4WCGA 2OAZA 5IT3A 3WTSC 2F5DA 2OU2A 5HOOA 4Q0SA 2FEZA 3DEUA 5I8TA 3M1EA 5FLXK 1O5UA 2UXNA 3I59A 2P5LC 1SFXA 4ENMA 4BQAA 1SD6A 1RUNA 5ICFA 1KQ9A 3H3ZA 1J75A 3I64A 1P4AA 3Q9SA 2B8MA 4AVCA 1Z6TA 5K1YA 3TQNA 3RPQA 1DGWA 3RZZA 3TOAA 3SMHA 3RTRA 1D8JA 4HBLA 5J8CA 2CWEA 2H0VA 1KYZA 4IEZA 4MQVA 1C0WA 2MLGA 3E6CC 3BU7A 1CAUB 5LEKA 4YIFA 3RKXA 3T8RA 4MGRA 5H6QA 5HS8A 1H0MA 1CAWB 3M3IA 5F64A 3JAMZ 2PQQA 1ZARA 1ZVFA 1TQIA 1QY4A 4JQFA 1IUYA 4Q4ZF 1CAXA 4YARA 2VT2A 1Z6RA 4HOBA 4UV8A 2FBKA 3FMRA 4P9FA 2ADUA 3RI4A 4IJAA 4IRHA 2DTRA 1IXRC 5TRDA 4IESA 3PQKA 1MGTA 4YSFA 4YRDA 2V6CA 1J2XA 3MZYA 2XUBA 2PBIA 2CO5A 3ABTA 3LZZA 1BJAA 4M73A 5KK1A 2QVOA 5AONA 3FMSA 3GF2A 4A5NA 4EGZA 5FLHA 2VBZA 3W6JB 4M71A 2VXZA 4OOIA 4FX4A 5JSOA 3K69A 3EQLF 1CAVA 1PP8F 3WW2A 4OIPF 2ZKLA 2CG4A 3MYXA 2P7VB 3L2HA 3U1DA 1TQMA 4Y15A 1USTA 1ZN2A 3ZN1A 5EEGA 2PTMA 3OF1A 2FA5A 2GA2A 5HS7A 3D82A 2ZKZA 2KKOA 5E8GA 2OZJA 2HDCA 5KBFA 5CVRA 4A0XA 1J7KA 1XE8A 3FFQA 3BROA 2VC1A 4PIXA 3LWFA 1R23A 4P5OA 1EH7A 3VB2A 4LLLA 1SAXA 3QU6A 3KLNA 4RGSA 3ACLA 3U11A 4I98B 3HT2A 4ZU5A 1UHMA 1QZYA 1R58A 4WWCA 5D5VB 2D2WA 4AIJA 4LLOA 4E70A 3EUHA 2QNKA 3TDZC 5T3NA 3RYKA 1WWXA 2BNNA 2XVCA 4RGRA 3USSA 1F5TA 2F5FA 4ON0A 3M70A 1RTVA 4K8FA 2PAKA 1KYWA 5I0SA 4IRIA 1J1LA 4M72A 3LQQA 4A6EA 2DPUA 4IEUA 5KVRA 4HW0A 1U5TC 4EWDA 3WGGA 2O0YA 5JSPA 1OMIA 2UYBA 2EJRA 2A68F 4M9XA 4RS8A 4ENJA 4KWJA 4M74A 3S7IA 4WZCA 5BPXA 3H3UA 2M30A 3QPTA 4MHGA 3JTHA 5HI0A 3M9AA 3F8BA 1YG2A 1FWZA 1W7PD 1WSUA 3K1MA 2ZCWA 4XSXF 1K7AA 4XETA 3B02A 1L3JA 4YNIA 3KETA 3CJNA 1B9MA 4LMYA 4E2GA 2QQ9A 5ERIA 1DDNA 3WTVC 1YFUA 4EJTA 3LSTA 3QU3A 3H7JA 1BI2A 1L3LA 5FFZA 4PCQA 4DQ2A 2A3SA 1FYMA 4XFHA 3IKVA 3UKVA 1QO0D 4XF0A 3ISPA 3U9GA 3ZDSA 4FHTA 2BNOA 5J3UA 2RN7A 2PEXA 3G7DA 2QBYB 2BEOA 4WXDA 4M6XA 3WU1B 4LLGF 3CUOA 3SXYA 2D1HA 2VT3A 2CAVA 4RAYA 2XL9A 1Q3EA 1FY7A 4L9VA 3FXRA 3E6BA 1ZZ6A 2DK8A 4M9ZA 2EA7A 3TNPB 3C18A 5JAXA 5CVVA 3BP8A 2HKXA 2XLFA 1BI1A 3KMHA 3VODA 1R5HA 3HSRA 3FX3A 2FMLA 1LVAA 5K5RA 3EBRA 2JT1A 1XE7A 3TNQA 3E5XA 3E3VA 2H27A 2N7GA 3C1DA 3DV8A 4BAYA 3ST7A 2STTA 5L3GA 4QWQA 4L11A 1Z05A 2XAQA 5ILVA 2IJLA 3FHZA 5BOXA 2UY8A 1G4DA 1EY2A 2R7FA 1MDMB 3HHHA 1FSHA 4L18B 3I71A 4XF9A 5L3BA 2RC4A 1HKQA 3WW4A 4L0ZB 3Q5FA 2IXHA 2VBXA 3UKNA 3EHKA 3G73A 4PZJA 2YPRA 1NE6A 3BJAA 2Z5UA 3DF8A 3O3KA 2ISYA 4KWLA 3S7EA 3V8JA 4RB1A 2VOPA 3CF6E 2PG4A 1YW7A 1AOYA 3ABUA 4ESJA 2GZWA 3SCHA 4XLNF 2COMA 3HRUA 5J8FA 2HYFA 2FBIA 4I0BA 2KIFA 4UVCA 2MD5A 1NXMA 2LDUA 4KNYA 4RD7A 4E2QA 5E20A 3KP4A 3PLQA 2VONA 4L9JA 4IPAA 4O9EA 1DP7P 1FX7A 1LRHA 1CF7B 1O57A 4Q47A 4ASNA 2XLGA 4LK1F 3JSOA 4LG0B 2F5EA 1ZLJA 1O3RA 5HLGA 4AQ2A 1HW5A 2DW4A 2OA4A 2IT0A 2L01A 1T98A 1XB4A 5CLSA 1SEFA 3I4PA 4ZZLA 5LRRA 1U2WA 5A2QK 3QOPA 1U5TA 3C3WA 1YWKA 3K2ZA 3WG9A 4OMZA 5IT9K 4OIOF 5D5WB 3J81K 4META 1F9NA 3MZHA 4KDPA 1SMYF 2H6CA 1JHFA 5ED4A 2I45A 2P8TA 4EVIA 2Q4SA 2E1CA 2VODA 3C3VA 1DGRA 5KHGA 1A04A 2IVMA 3LWCA 1XGMA 2P5VA 4M9SA 3CLPA 4ONUA 2O61A 3IWFA 2ZFWA 3WODF 4M6YA 3CO6C 1IN4A 1T38A 4XFIA 2ESNA 1LR5A 2PYTA 1RUOA 1RC6A 2DPDA 1CGPA 2EA4A 1IPKA 1YS7A 3WTZA 4WXCA 1J3QA 1TTYA 2C6YA 2LSOA 2EFNA 4OMYA 1BIAA 4K2EA 5D6EA 3GEZA 4MH0E 1XD7A 2JPCA 4XBFA 4B29A 2H09A 2P7CB 3FXUA 4EQQA 1ZRCA 1SFNA 3RJPA 3ELKA 1ON1A 4KT5C 1RI7A 4N9HA 4A0YA 3GZ6A 4IEXA 3LA2A 4A12A 2D40A
chains in the Genus database with same CATH superfamily
1VR3A 2DT7B 1FC3A 1K42A 2P4EA 5ISLA 1P2FA 3OYAA 1AX2A 2QE3A 4QGNA 2Y8KA 5FYIA 3NEUA 3BZKA 4PQQA 2V1XA 4RGGA 5ACA3 4AI0A 1F9KA 4W50A 2WT0A 4LE4A 2ZX1A 4F3JA 3WF3A 2QF7A 4AHZA 1N3OA 2PA7A 1UZZA 2VZ1A 5F1RA 1YE9A 3D8CA 1RKTA 3S93A 1C3HA 4IHTA 2JDYA 3VZNA 1W0PA 2WJSA 4JVAA 2AQFA 3BB6A 4TN7A 4CEYA 2VMGA 3OBTA 5CBLA 4KIFA 2ZEXA 3GNEA 4CU6A 5JWPA 2FDGA 3CLOA 3I2GA 3JBG3 1FTZA 1DGWY 2AQEA 2CS3A 3MUZ1 5FMDA 1Y39A 1HW1A 4ZZ5A 1F1ZA 3T2TA 3S15J 1EJ9A 4LE3A 4J25A 1ODDA 3LPGA 4KUMA 4X0GA 1MBGA 3SEQA 1Z7S2 4CZCA 1PO13 3DKYA 3QPHA 3C8XA 3U21A 5FY9A 3OYNA 1YNAA 2E36A 1KONA 5E89A 2XG3A 4G6DA 2BOLA 5A3PA 1JYTA 2XHNA 2BE5F 3B01A 2JZYA 3MLKA 2L7MP 5FKNA 5LBQA 1SACA 1YJNI 3DEMA 5FYHA 2KLOA 1WD3A 3I3MA 4BYYA 1BBYA 4YPJA 1X9PA 1RUF1 1YIPA 5GLZA 1PIV2 1XC6A 2MPFA 4COWA 4Z07A 4C1XA 4GXLA 3ZO0B 3CP8A 5H6RA 2XROA 3GTJJ 2EFQA 1Y43B 2NRAC 3JB4C 2E7AA 4BIFA 3TKYA 1O91A 5DUIA 3V7CA 5F08A 2CDPA 1K4TA 1N75A 2Y26A 2EIEA 1S7EA 5GTIC 4EN6B 3NAPA 2WV0A 2XKOA 2D45A 1X58A 2HVSA 3UYJA 1V00A 3PFYA 3H8OA 1CZVA 5EG0B 2KA3A 5DCMB 1PK6A 2QQPA 3U0ZA 4XCBA 2QZ2A 5FUNA 1PMHX 2ZGOA 1DP0A 1D1CA 2A05A 1RXGA 3J7NA 4R8HA 3A7QA 3A21A 4MXWA 5FPXA 1ETKA 2ZFUA 3BDDA 1E17A 4L99A 4Z6YA 1JHJA 1GDTA 3RCOA 2QJVA 2XJPA 1AR91 2JQ7A 4LULA 2Q2EB 2XV4S 3DQVC 1PHMA 1WPKA 1WKYA 5FJKA 3VD9A 4C3JJ 1OKOA 1RESA 2IXLA 5C9AB 2QQMA 3C7GA 4P9UA 2Y34A 1AKHB 2RV8A 5FRNA 1YQAA 4N7UA 1JUHA 3S1NJ 4PI0A 4YZ1A 1FT9A 1W8HA 1ZK8A 5JLVA 3X2QH 1RUE2 4GGGA 4FPOB 3CF2A 3ONQA 4IL6C 1ZYRF 4IE0A 3I55I 1ZHFA 4EN7B 5C3QA 2XBO3 1SG3A 2MC3A 2QZ8A 1VAVA 3H1MA 4IE6A 2IGKA 2HQNA 1F31A 1TG7A 2L7FP 4HVRA 2ZMKA 3QP5A 5C44J 2JDUA 3VOEA 3KYCB 1LE8A 3RI8A 5LA2A 4AWXB 2NAZA 4E7IA 4QPGA 5DM6F 1NG7A 2ELHA 2P6TA 3BCWA 3PL8A 3HRMA 1VJ2A 3VDDC 1GWLA 3KQRA 3TO9A 4EM0B 3H5RA 2PLV2 5F32A 3WE2A 2FHRA 1P4XA 1R6RA 1S0BA 4A93J 2FQPA 4HV5A 1QGPA 4Q1RA 5FZDA 1V54H 1YYNA 3P6BA 4FX0A 1ZKGA 3ZQCA 1KA8A 1JHNA 4IOCF 3ES1A 1REDA 4CYCB 3U2RA 4HPQA 4OQ8A 3G1LA 2DFFA 2LRDA 4BK5A 4HBNA 4DZJA 5BUVA 4LMFA 2K86A 2IAIA 2FXAA 2AR6A 1IZ3A 4XDPA 4XICA 2PFBA 5FFOC 3C7JA 2WLPA 4Y4RA 4JKLA 2HWF3 2QQAA 3WW3A 3ZMTA 5HVQC 3K4AA 1W36D 1P9QC 2VZVA 1KEXA 3W2VA 1U0JA 4I02A 4RGAA 4CUBA 4XKVA 3KV4A 1WI9A 3V8LA 3A4UA 2B5HA 3J7LA 3PJYA 1AF9A 4I01A 1HDKA 5GPCA 3VZMA 4HNTA 4QXCA 3CIHA 1N1TA 3Q0UA 3A2KA 5FMCA 3HPHA 3B5LB 4UUTA 2CUJA 1HKSA 5JSRA 2CFOA 4UNOA 4NHXA 3BJOA 5D6FA 4RS5B 4MO3M 4OI0A 2YPDA 3QYEA 2G19A 2LF8A 2R5ZA 4BH9A 3ME2A 1O4YA 1BKZA 2ZEWA 3ZYFA 2JUCA 3GFJA 1OQ1A 2ELJA 1RC9A 4JDOA 1I1GA 2JWTA 5B4NA 4IRGA 3HBKA 4JDMA 3HNMA 3RJ2X 5C4JJ 2Y60A 5FV3A 2HYJA 5ILUA 4HYEA 2DN0A 2YSRA 4CU8A 3CMGA 4GCVA 3QAHA 3H8XA 4EATA 2MW8A 4JGZA 4CA9A 4A41A 1W6NB 3MKYB 3POSA 3GWZA 5T5PA 4NC6A 2MFZA 5F3GA 5IW0A 3SFZA 3T09A 4UV9A 2YX7A 5EEHA 2HWVA 5A3MA 4IE5A 4Q27A 1VBC2 2HGCA 2XJQA 3WVJA 3LEGA 4FOWA 4K1YA 5G04L 4MGTA 3BU0A 2GN7A 1AR83 1WKMA 5K7FA 3IMMA 5BNPA 4AI1A 1GZWA 4RHV2 1EPWA 1N78A 2Y6KA 1B09A 3A4CA 2VOKA 4NRQA 5L9VA 3NO8A 2DU0A 3AM2A 1OLTA 3GFIA 4CHUA 2ZGTA 2Y38A 5FP4A 1T6BX 5BMZA 3V42A 2GAUA 3H8RA 3SZGA 1F15A 4EE2A 2UWMA 2D5VA 4ZS2A 3WUDA 4D94A 1GKBA 2OXBA 2DVBA 1P6RA 5DMYA 2JRTA 2GC0A 1XU2A 2MHFA 1H2NA 1MW7A 5T5JA 1GU3A 2W2IA 1E2XA 5FKCA 2QA4I 2L2OA 4MUVA 1W1WE 1Z1DA 2HH9A 4MVTA 3GO5A 1WCMJ 4LG3A 2A6XA 1U8BA 4B3XA 1QGLA 3CL1A 1OHFA 1PVEA 5C3OA 1WLDA 3JCUC 2VM9A 4ESBA 4LFUA 1GP5A 4WF2A 2HWB1 5FWEA 2L0KA 5FUIA 3VUOA 1RMU2 3T2PA 3GJAA 2WNUC 5DUKA 2HPMA 3CJXA 4YZ3A 3GCMA 1I6HJ 3LFMA 1NX9A 4HSLA 5C3PA 4GYIA 2ZMLA 4H7MA 3D3AA 2HOSA 3WF4A 3T1LA 5FREA 4XZPA 3HYIA 1N25A 5GPAA 5EJCA 5LK7B 4BBSJ 3FM5A 4LK7A 2HS5A 3JAMK 3T0BA 2XSDC 1Z77A 1WQ2A 2V09A 1QDCA 3N9PA 1A31A 1OQDA 4BE2A 4P02B 1G6NA 5A6YA 1XDUA 2ZHLA 4O6JA 1IKQA 2DV9A 4IGPA 4P5HA 3CDHA 1UU6A 5DQ0A 1IS6A 2ZHMA 3BTIA 3IDAA 1OQYA 2HOAA 3O7OA 1R091 4IHVA 2HZTA 3I4MJ 2CNAA 5L36A 3V4GA 1W5SA 3RZGA 3OG2A 3TBIA 3JRBA 4W4ZA 3B6AA 1H2KA 4JHTA 4EMSA 2E2HJ 1REFA 1UZVA 5FROA 3QBQA 4MGKE 1QU3A 3IM0A 2XB0X 1JZ7A 3B6CA 4BQQA 3S16J 2JDAA 2O8QA 1QJU1 3BCAA 2E34A 5GZCA 2DFCA 4IXAA 4NJ4A 2KRFA 5FMBA 2XDVA 3GZAA 5A32B 4MADA 3DF0A 3AMPA 2Y0MA 2A61A 3L9JT 1KQ0A 4BHPA 2I07B 3SNMA 1K12A 4LBQA 2W1UA 2YROA 5FXVA 1DIWA 4F7ZA 2E7XA 2O5RA 4V2GA 3BTZA 2G4IA 1UFMA 3UNPA 3AVRA 3M2MA 1LUJB 3HRTA 1VRH3 1WZ2A 5FO5A 5CVUA 5M5YJ 3J7MA 3A0KA 4XJUA 3RZOJ 2BGCA 3BTLA 4PI2A 2ZNYA 3ZX7A 2RNJA 5FO7B 5I8SA 4CZSA 1P8JA 3Q3SA 4AU7A 4ESFA 2X48A 4U7BA 5FZ0A 2ZXHA 5IT9Z 2V7FA 4FOVA 4ZYGA 3W2WA 3J81Z 3D5OA 1SPPB 2EVXA 5CVIA 1FZPB 3RMXA 1X8MA 3WG3A 4BQOA 1AXZA 2E51A 1V70A 1DGWX 1VBB2 5CFDB 3AKSA 2ZMEA 4O5VA 4EM1A 2ME6A 4WVZA 4XOGA 4L5EA 1CAVB 4LK0F 4MZUA 3S2DJ 1QQP1 3OV8A 4QWNA 4IETA 2E1MB 3HB9A 3OBRA 1B35A 2YC4A 5IVEA 1S2BA 3KEYA 1EP0A 1YS6A 4AOCA 2EWNA 4FTBA 5FLIA 4RQPB 3ON7A 2BWCA 2DOEA 1ZR2A 2OYZA 2DU9A 4JP0A 2YU1A 1YI7A 2BOIA 3MGUA 1B4AA 1V6NA 3WCSA 2ORZA 2P6SA 1LAJA 3GMEA 1PGW2 4PGHA 5KHKA 1YITI 2G9WA 2CQNA 3OYLA 2OTLI 5JI6A 2UWAA 4K20A 3VBSA 5A3TA 3F8CA 3IN9A 3ZDVA 2MA3A 3ABMH 1BVVA 2OD5A 3H0GJ 2XAUA 3MEPA 3M3EA 1PMIA 4QLCU 1UY3A 5HNHA 4OUMA 4QM9A 5DS9A 1T6GC 1LHNA 1F8VA 1FYLA 1QJY2 1G59A 3HMYA 2C9KA 4E7JA 2X53S 1X1AA 4G94A 1LNSA 3VD4A 2NPIA 5DABA 4L5JA 4IEJA 1R5ID 5FPVA 4UB6C 4IV3B 4E4ZA 3CCMI 2G9GA 3ZLIA 2VO5A 1T0FA 4XLAA 4HLTA 2JG8A 4YW3A 4ANJA 4JX4A 3EYPA 3VBRB 1HRV2 2WNOA 4HG2A 5DN2A 1N3QA 5FFXA 2DBNA 1A6QA 1CIWA 4UI9L 4A3JJ 2P3YA 4RB2C 5DZFA 3S3OA 1UOJA 3I2FA 1NCQC 3I3LA 3P3NA 1OBNA 4W6WA 3VBUC 4KU8A 1BEV2 1NYWA 3VBHA 2IS4A 1RUG3 2JG9C 3H36A 5JR7B 2JDPA 1FMD1 4Q4V2 5F2WA 3L00A 5D8AB 4URAA 1UD1A 2Y69H 1Q8QA 3AYDA 2X05A 2HBUA 4ZH4F 2RG4A 4CEWC 3WV6A 1WFXA 1N47A 1HXDA 2FDIA 3ASNH 5JOXA 1WRJA 4G9SB 3H0OA 4HLYA 2V79A 3POBA 2VTXA 2B45X 2PJRA 2W68A 5K8SA 2LTNA 1FYUA 4DEQA 4NIDA 2HWE2 1FPN2 1UW8A 3FE5A 1W8FA 3I4NJ 4CPBD 4GJYA 2HTSA 4XMIA 2MNGA 2VOOA 1FI2A 4BDZA 1EV12 2HFHA 4D6SA 4EZ4A 2ET7A 1MVEA 4LNVA 1OXCA 1ZYBA 3POWA 3UGHA 3RNSA 2VJ5A 2IA0A 3K0LA 2QGUA 1J59A 1ENSA 3IPVB 1ON2A 1W2OA 2J1SA 1IV8A 1ZLKA 1UYYA 4L0YB 3WY6A 1C8M2 3QACA 1OR7C 3HNYM 1BR4A 2YBKA 2QDRA 1OUSA 5LBFA 1V9U1 2PHXA 1T95A 4WBBA 1DGRN 3BWGA 1K5MC 3CCVI 4QPYA 3SXWA 5ANNA 3LNQA 2R6QA 1OT5A 5FUPA 2AH2A 3VD3A 1S29A 4U0VA 3UJOA 5C3SA 1POV3 1RYYA 2Z9OA 1SFPA 4PJJA 4D8MA 3QPSA 5L7OB 1YQ2A 2WDBA 4KYWA 3GZUC 2X1DA 4D6QA 4LLFA 1DG6A 3MICA 3FXQA 1F36A 2QFEA 2PI0A 3NWSA 1FIAA 1QMJA 4YGBA 1VQLI 3MFAA 5FZ8A 4TV7A 5FPUA 2LNBA 5CEHA 4B4RA 5LATA 4NNJA 2EB7A 4D7SA 1AX1A 3H5AA 5A1FA 5J09A 1SCRA 1XCVA 1U3EM 2QKDA 1X1BA 4UUSA 3N9QA 4AM3A 1SD7A 4A7YA 2FBHA 4IKFA 3ACGA 4R79A 3F72A 1JN2P 5IFTA 2MH2A 3EJKA 1FV3A 1MIJA 1IN7A 3AX4A 4G6TB 4B8XA 3K48A 1T08B 2RM21 3A01B 1OPOA 2VQUA 2DQRA 3HOUJ 4LBKA 3ZXKA 3ZFFC 1XGNA 4XL9A 3DBRB 3CUQC 2B42B 1Y0NA 2ZJPF 1QXRA 5LGTA 4Q4Y1 2IGMA 3I5UA 2IC1A 1VBD1 4AG4A 3OR1C 3HOYJ 1XYOA 1ETXA 1X2NA 3Q9VA 3VB9A 2AHQA 3LSGA 2BZDA 4A3EJ 3DLLF 4PDWB 3BPSA 2AZ5A 4FASD 1XCBA 5FK8A 2PLV3 4NR1A 1ND3A 2NNYA 1JYIA 4WK8F 4E4HA 3CCQI 3VEPA 2GA1A 5E6HA 4G9YA 3G6JB 5FZFA 4UHTA 1ZBE3 3TOBA 5LB6A 1AUYA 3JRAA 5BNOB 4XN3A 4GDFA 4XLFA 3HOSA 3PQJA 2Z33A 4LT5A 4XONA 2ZOEB 3RG0A 2CW8A 2X5IB 1JXSA 1QJX3 2C5DA 2BP6A 5L3CA 3I54A 3NQOA 2A6WA 4CDWB 4HKLA 4AF9A 2TUNA 2BXZA 4ZYAA 4E4DX 3J4UH 4YM2A 3V0AA 1PJRA 1CX4A 3SISA 2GOXB 4NQWA 4PCRA 2KRHA 4FAGA 3EYYA 2G9FA 4M3CF 1Z7LA 3SEZA 4EM2A 1GR3A 4B4CA 2FBEA 1R36A 1VB2A 4XLCA 2P81A 5BXXA 1O5LA 4RSUA 4XFGA 2DAOA 3GXOA 3GTGJ 1JZ6A 1VQ7I 2K9ZA 1GQPA 2EXHA 5EGOB 1I27A 5FKLA 1Y7BA 2CUZA 3JUUA 1FIPA 1FP1D 2YUSA 4INDA 4HN1A 3GM8A 1FOD3 3AXEA 4LO8A 1STZA 1ENQA 2JB8A 4QT6A 1HLCA 1A6IA 1MACA 2A75A 1V5EA 4FFHA 1L0OC 3VHRA 4HDVA 3ZFGB 2F5CA 4QB6A 2FNPA 5ABJA 5J47A 2E31A 1D4M1 5EQUA 4DUVA 1BM9A 1YFXA 3F23A 5HXVA 1PZ8A 5GZEA 2CWSA 2RREA 5L3DA 1W6OA 3OIQA 2LRPA 1U9NA 1ULEA 1XSXA 1MEC2 1TMF3 3AKZA 3JU9A 4MYEA 3BTYA 3MCZA 3GVAA 2WS91 4RBOA 1Q56A 4IVNA 4RB0A 2W00A 3KYDB 3TMOA 2HYKA 3NNJA 1HV0A 2R7DA 1UKRA 5LZ6A 4D7YA 4MEYF 3WHBA 3DUIA 3NNGA 2OAZA 2ZZJA 2DMTA 5HOOA 2CWMA 4Q0SA 5I8TA 1VI0A 3I3QA 1PO23 2UXNA 1D0HA 3I59A 2WAQN 1JOJA 2YHJA 1RUC1 3OBZA 1FOYA 3IMNA 3WDVA 1J75A 1YXWA 2B8MA 4AVCA 1Z6TA 5J37A 3I3DA 1DGWA 2YC0A 2NS8A 4RA2A 2A3YA 4DNYA 5J8CA 2BZTA 2XQRA 3LIHA 3E6CC 1CAUB 3M07A 1BHGA 1DCSA 4MGRA 4XJ8A 1R081 5HS8A 2CQ7A 5GZGA 1V6IA 4XPVA 1CQTA 2A7AA 2CY6A 1WCDJ 2WA4A 3V56A 1HXS1 3S57A 5DUVA 5FZOB 1BR2A 3EUAA 4BEHA 1GANA 4JQFA 1NK3P 3LSMA 1Z6RA 4AEKA 4M00A 3DPRC 3RI4A 1RMU3 4FTHA 2ECCA 5TRDA 4IESA 3OWTA 1NUKA 4LBNA 3TEXA 4YVWC 2V6CA 3BR2A 1J2XA 1V6LA 3QOEA 2BUKA 2PBIA 3GTPJ 3LZZA 4XIDA 2UU8A 3TWIA 5EHDA 1LOBA 5EYXA 4B48A 4EGZA 2VBZA 3ZOBA 1QZEA 3LGRA 1GP6A 5JSOA 4XBQA 3MIGA 3WW2A 1W6MA 2BPA2 4OIPF 1ETOA 4QXBA 3OSGA 2BW8A 3MYXA 1AJOA 4J00A 3WP4A 4QX0A 2FCTA 4GH4A 1XSQA 4QX2A 1ZN2A 2K46A 2F4MB 2L7KA 5EEGA 2FUG2 3M3QA 5HS7A 1AL22 2OZJA 2P5BA 4XBLA 1HC8A 3I2HA 5A1LA 2HDCA 5SV5A 1S5LC 4A0XA 2VKHA 1BQPA 2MSYA 1HDPA 3FFQA 4JX6A 5FTTC 1A6CA 3FHAA 5BNNC 4WVWA 1R23A 1RINA 4LLLA 1SAXA 3QD6A 4ZU5A 2P6HA 5GLVA 2ZAHA 3I2KA 4AIJA 4FE4A 3ZXGA 4E70A 3TDZC 1WWXA 1OOPA 1F5TA 2F5FA 3ZQLA 2ADEA 1X1CA 1NXD1 4AAPA 3BG6A 1OCTC 2C26A 2L9LA 2VCAA 2DPUA 5KVRA 4FQ4A 1RVF1 2O0YA 1TC3C 5JSPA 4QDQA 2A68F 1EUUA 4RS8A 3ZQIA 4ZY9A 4M74A 1W8UA 3HEIA 4PFOA 2GNDA 3OMYA 2QQLA 1B72B 3MIBA 4XZUG 3QPTA 3DKQA 4C1WA 1NCRB 3OD4A 4E7HA 4XLHA 4Q4X1 3VBOA 4XSXF 1K7AA 3AZXA 2VMCA 3POGA 4YNIA 2PHUA 5IT6A 4E2GA 1AYN2 4N4OB 4XUNA 2QQ9A 5ERIA 1DDNA 3WTVC 2JKBA 3LSTA 3H7JA 1BI2A 1L3LA 1WBFA 2A3SA 2VUJA 5GP9A 4HSTA 3UKVA 4Y22B 3ISPA 2D44A 4JGYC 3DYOA 1MBKA 3VD5A 2V4AA 5FBJA 3G7DA 3HQUA 4CP9B 3MVPA 3WU1B 4LLGF 3SXYA 1W8ZA 1Q3EA 1YX3A 2HVRA 5CFCB 4AI9A 2F5VA 1IPSA 5F7UA 3WNNA 5JAXA 5CVVA 2O7OA 4M3EA 1BI1A 1TEIA 3DXTA 3QLQA 3VODA 5F3CA 4GAZA 1OSGA 4XABA 3EBRA 2JT1A 1ONAA 5CNAA 5KXDA 5KCMA 3NV3A 4BAYA 3OSFA 2QBXA 5IAXA 2R7WA 4QWQA 1Z05A 2KHMA 2OUMA 5ILVA 3ZYRA 5K0UC 1POV0 4A7KA 5BOXA 2A3WA 1G4DA 2GN3A 3ZFEA 2VAUA 1I5PA 4XM3A 2ZX4A 2R7FA 3HNBM 4XF9A 1OUXA 1VALA 2RC4A 1V6OA 4L0ZB 3Q5FA 2DBIA 2R042 2GALA 3UKNA 2BVBA 3K7AJ 5FK7A 4C90A 3OUIA 1J83A 3AK0A 4GB31 3O3KA 3S7EA 3FUQA 1IS4A 4QPIB 2RS31 2E7TA 1UU5A 2LBFB 1K61A 1YW7A 4FXKB 2GZWA 4Y20B 3SCHA 4A44A 2O14A 3FLTA 1JOPA 1CZTA 1MS8A 4RD7A 3AG2H 1IGNA 1SFYA 2PHFA 3PLQA 4L9JA 4IPAA 1W6QB 2VCCA 5FZKA 2BU9A 2A70A 2VJXA 4ASNA 1RUJ3 4WVMB 3JSOA 4YVSA 1RUF2 4LG0B 2F5EA 3MKLA 3W58A 4BY7J 1HRV3 1HW5A 5IFPA 5A3OA 3IH4A 1T98A 1XB4A 3WQ7A 4ZZLA 1U2WA 1U5TA 5DXDA 5IT9K 3TN91 3J81K 4META 3VL8A 1ZGWA 1LEMA 3BZCA 1F9NA 4YEJA 4KDPA 2YU2A 4UW3A 1COV2 3DGTA 4Z8BA 2I45A 1YCIA 3KVBA 4EVIA 2NZ9A 1W28A 2VBDA 4BMEA 2M34A 2VODA 2VZRA 3AXDA 3MLJA 3LWCA 1XGMA 4M9SA 5JXGA 3CLPA 2W82A 4AEDA 1IV6A 1HB3A 3OPTA 1AR92 3NV2A 2D6LX 1CGPA 2W87A 3VBFC 1IPKA 2VGDA 4BJ5C 1YS7A 4CDQB 4XYXA 4GALA 3WTZA 4LBOA 1GOFA 2BGPA 1J3QA 3OYMA 2I2SA 5TISC 2D3SA 3RZKA 4NHYA 1OFCX 1BIAA 2HWE3 5BNQA 1URXA 4MH0E 1XD7A 3Q8EA 2NP0A 2DFEA 1AR62 1SFNA 2L9VA 3PUHA 1DLCA 3QYBA 3LA2A 4XXAA 5AC91 4A3MJ 3ZFFB 4IV1B 1UIJA 1SDWA 4CCEA 3CUQB 3DBLB 3NRVA 3COAC 1K78A 3R0JA 1W6PB 3WUCA 1V3FA 2RDSA 1UN1A 4LEJA 4PIZA 5HBAA 3W21A 1QQIA 3JBG1 4LO5B 2ADDA 4IX7A 5FQ0B 4C9YA 2DTWA 3GDBA 3FK7A 2VOXA 1DQ1A 3RI9A 5ICCA 1RUH2 2M45A 3SHFA 4HONA 1QNYA 2R0QC 3AC0A 4U36A 1IF1A 3AMMA 4BHCA 1GV5A 2GC1A 3K3NA 2F6CA 2QZ3A 4Q4W1 1WD4A 2JENA 3CTAA 2XAFA 1DZTA 2XASA 2XWBB 3Q8BA 2R7XA 1ZA7A 1BOAA 1D1AA 3SITA 4P9WA 1FBQA 4FP2A 1IN8A 1NZCA 3VHPA 4LA3A 1BI0A 1ODNA 5EDNA 1POQA 5LA1A 3AP4A 4PUSA 1H8TB 1NE4A 5FZEA 4DRVA 4JYKA 3KZIC 1MBEA 4KITB 4MTDA 2DCYA 1YO8A 3K2AA 4P08A 1XDSA 5JLWA 2XWJB 1GQGA 4IOAF 1ND2C 3LOIA 2Z4FA 2VVFA 1W2AX 5J1RA 6PAXA 5H20A 3ZMDA 3IH3A 4BU2A 5GALA 3MF6A 4BJTA 3E1F1 1UL9A 1J1TA 2VOWA 2KMUA 4M6VA 2G1MA 4LPLA 3ABLH 1XMAA 3ZPOA 3R60A 4OIRF 1OA2A 1XNTA 1B6AA 1U9OA 3LSJA 5FYVA 5HDGA 3TO6A 3RJRA 2V1UA 1L7LA 5FR3A 1ZAOA 2WB1A 1KJLA 1MKMA 1OPCA 2AO9A 2KDOA 1W8WA 2VXJA 3IBMA 3WGIA 3HBLA 1RIOH 5FP3A 1WJAA 4A2UA 2E9QA 4XW3A 1JZ4A 1S4CA 2EICA 3INAA 1KU2A 1N3PA 1YFHA 5J96B 4RYDA 2NVXJ 4DNCA 2X51A 2P37A 3V7SA 1R22A 1W7PB 4A5MA 3K9TA 3DKXA 2WAAA 3O1UA 1S7OA 3RIRA 4M3CA 4BA6A 2XOMA 1KGSA 3OS0A 4RR3C 2Q8KA 3BZ6A 3T0YA 4J19A 4LO6B 1PUEE 1G9AA 4D69A 4FPYA 4CU7A 2WT1A 3OGVA 2F2EA 4KH9A 2RMU2 3B9IA 5IK7A 2YDEA 5C8CA 5DM7F 1LEAA 2KRCA 1IRFA 4AUXA 1JU3A 3RPUA 1DUXC 3HQRA 3WG7H 1SD5A 1GT0C 4LJHA 1OURA 3THTA 5HS9A 2EQRA 3KT1A 3IB3A 2NVTJ 4COZA 1G8WA 4PBOA 4YW5A 3T0AA 4EZHA 1GUUA 3SYTA 1FBSA 2OC6A 2TRTA 1X50A 1XRUA 5GJ6A 3HTUA 1YO5C 3LE0A 1RGSA 2GXBA 3DCFA 4XSZF 1LB2A 5FKBA 3FDYA 1D5YA 2WN2A 2KL4A 4CDUC 2DXIA 4AGGA 1NKGA 1P7IA 1WCQA 3K4LA 2VL4A 4K8RB 3OJBA 3T08A 3L1PA 2EAKA 4Q5SF 4CDXB 4NWWA 4MX3A 4K9SA 5CYYA 3FXMA 3ZVXA 3QWLA 2WRAA 3WTYC 3AKRA 4P9XA 1UQXA 1QZZA 3VGIA 1G3SA 2QTWB 2DFHA 1RUD1 4A3XA 1R71A 2YB7A 4YVWB 3EQEA 2QQWA 1GMMA 1QBJA 3Q0VA 2MBFA 2F17A 1GNYA 4AVAA 2E6VA 4YFWA 5AIQA 1W03A 3GTKJ 2VUMJ 2JDHA 3NV1A 1ASJ2 3L2UA 4ZJZA 3JR9A 3ZYGA 3HOTA 4DMIA 2Y33A 5FZ6A 4E7KA 2ZSHB 2ARBA 1WJ5A 3E5QA 1CN1A 5EYYA 2M0CA 3LOBA 2SLIA 3OD0A 4G7OF 3F21A 5FYSA 2GMMA 4QX3A 3F8NA 4QDSA 3J8F2 1BMV2 2L4MA 3Q8CA 1FNNA 4LKFA 2HYXA 3UKTA 5FXWA 2CUEA 2A07F 4U7DA 1TNRA 4U88A 2UWBA 5GLWA 3KZ4C 1FOXA 4JTNA 2OCCH 2R7RA 2UZKA 5DPNA 3VN4A 1WLTA 5ACA2 2IS2A 1HCRA 1JZ3A 1RHI3 3VHNA 3WTTC 1XYPA 1A5JA 3AFHA 3H0DA 3FN9A 3HXLA 2JA8J 1TW3A 2ERFA 5JI9A 4GIQA 5KXBA 4HAMA 3LSEA 5IK5A 2JRMA 3BKZA 1R4NB 4KMUX 4HFSA 4KGGA 5E1RA 3MAJA 4Y1ZA 4BUPA 3F8FA 1ZX5A 1PUFA 4BK4A 2W84A 3WP6A 2ZB9A 4IEYA 1X3ZB 2FCVA 2BBYA 2HWD2 5FP8A 2YX4A 4PSWA 3JREA 4NC8A 4FPCA 4CEYC 1PO12 3WZ1A 3CO2A 3FF5A 4KA4A 3NSTA 2DTZA 1ALYA 2X0LA 4ZU7A 1XB9A 1YHQI 5HNFA 2V1NA 3VD7A 2LH9A 4UFMA 1YIOA 2O9LA 5FBZA 4S04A 2YFZA 4D9JA 4ASLA 1U12A 4QD2A 3EUKL 4LHNA 2YS9A 3VPRA 1FLIA 4U87A 4JTOA 2QBYA 1YJKA 2MEV1 4X6AJ 3M7AA 1N1SA 3VDDA 3O2PE 1ZG5A 2IXCA 5DUXA 4Q48A 3ZN0A 2QDNA 2J1AA 1R1A3 3K1PA 1J0RA 2FX0A 3VYUB 1ENXA 2CV1A 2VKVA 1HRI2 2VQLA 1ZGJA 3LSKA 4J1XA 2Z1DA 2ZEYA 3OPWA 4WM7A 5DTDA 5F0HA 3AFKA 3SH3A 4DXZA 5LA0A 1GXQA 5CKQA 1UY2A 3C7EA 4UF0B 1UYXA 2O1QA 3G1MA 3AZZA 2HXIA 2OZ6A 4WX9A 5IHRA 1PGL1 1AL23 2GBYA 1O8SA 2XJVA 1TVGA 1JI8A 4OZXA 2JX9A 3B69A 2RQPA 3N4MA 1KD7A 4OQ9A 1HX6A 5F6KA 4BXUA 4BGDA 3AZWA 4DBRA 2ZHNA 2OQ7A 4LBMA 4OI2A 3CQOA 2E2JJ 2FSWA 1W9WA 1MDMA 5FZHA 4OHWA 4LKSA 4HT1T 4GKYA 4XACA 1VF9A 1VBA1 5LBCA 2ZTNA 5FXZA 2RS13 2GXGA 2LVSA 4XHBA 2K4JA 3FBIB 2DUQA 4ZC3A 1H6YA 2VR4A 1Y9QA 4F3QA 2VC0A 4WM8B 3MFCA 3SKJE 3U1XA 1XS9A 1ACCA 1HF0A 3VYSB 5IVJA 2ZHKA 4UY8I 2UY9A 5F39A 3WXPA 3NNFA 4NOTA 1RRJA 2HWC2 2WSVA 3WE3A 4FOYA 1QWRA 3ZYIB 2VTXJ 4MFEA 4CCOA 3PUQA 4IZZA 5E88A 3G4SI 2HVQA 3RGBA 5JZGB 1D0ZA 3B00A 1S6LA 4Q26A 4Y7NJ 3KSCA 1NAEA 3F9KA 2RR12 1B9NA 3E6DA 1DZRA 2XBO2 4HPKB 3CZUA 2AC1A 2OKXA 2XMLA 1UG0A 2DA7A 2J1UA 1JYCA 4CXFA 4Y1VA 2RS53 3HWJA 1YHFA 5FPZA 1W06A 4A42A 2VIXA 2N8GA 5C8WA 1RR7A 1W2UA 4SBVA 4BQWA 4FT8A 2IZWA 5FZ4A 1XN7A 1Y6IA 2JB4A 4XQ4A 2MD0A 5FZBA 2OCEA 1TWAJ 5F6LB 2RDNA 1LDDA 1WLWA 3O1MA 3AMQA 1W0OA 2EF6A 1F4HA 3V0BA 3ZN6A 4Q2FA 4UBHA 2ID6A 3OCPA 1OF4A 1YJLA 4CICA 1RNLA 1SVOA 2K9NA 3H3LA 1YI9A 3PMSA 2DA5A 2RVCA 4Z2YA 4FAHA 4RMNA 2C9AA 3MQ0A 3E97A 2HWF2 1I1SA 3J8F3 2OUJA 2W48A 4F52A 3KGZA 5C4WB 5C9AC 4MGSA 2ID3A 4OMCA 1ST8A 4EWEA 1NK2P 3VBFB 4MTEA 3HQXA 4HF1A 1UKGA 5M5WJ 4C2MJ 2CDOA 5IYDJ 1EH8A 4L97A 1HN0A 4XLPF 4TTGA 2R0FA 3M4FA 3WTUC 4MV2A 4MGZE 3GYHX 3U78A 2R071 3EXUA 5JUVA 3IRQA 3KCXA 2QSGX 2D1VA 5EIYB 1JYWA 3FK6A 3ZQ7A 1JKOC 1I6XA 2DDUA 3K4DA 2MH9A 1JGSA 3NWKA 3ACFA 4LTAA 3RYPA 1UOFA 1BC7C 4XQWA 2VPLA 2BWAA 4N43B 1MQTA 2XF7A 4OHVA 3AP5A 5F6FA 5TSWA 1RUF3 2E60A 2WNUA 4CRQA 4EGYA 3ML6A 3AG1H 1MJAA 4DFSA 1UCRA 2GC3A 3FXKA 4XAEA 5CJ9A 3N05A 2JD9A 3S17J 2CV0A 1QVTA 1H0BA 2BHZA 4CZZA 1G8XA 1OH3A 1ORKA 2Q30A 4M4RA 4CVUA 5T50A 1ZRFA 4F93B 2ZGPA 3FXOA 3G2BA 3V64A 2WKKA 4S05A 1WCUA 3I2DA 1UIKA 2A1XA 2DYRH 3AMNA 1JE8A 2YU9J 1OA3A 4Y1XA 2WAEA 1RZ4A 4P14A 4XUOA 4G7HF 3FLRA 4ZZDA 3SHRA 3KP6A 1AR93 1AR82 1PVC1 2K0GA 4AHXA 1B8IA 3ABZA 4M3BA 5EYRA 4S2HA 2WZR1 1HLVA 2YG0A 4NROA 2NMOA 4N9IA 4YGCA 3CC7I 2DWRA 3MI8A 3N9OA 4TWTA 3UNGC 1DQ0A 5JOWA 2DTYA 2H8WA 1TZOA 5DUWA 4LHSA 1UB9A 1LFPA 3WF2A 1SBEA 1W0UA 4L9NA 3HOXJ 3ZOIA 1QOTA 3GHNA 3QRFF 3BR6A 4Z2WA 1JYVA 1V55H 3BR0A 1X8EA 4J1WA 1ACIA 3GZTB 1HN1A 1XBFA 4G4FA 4OLLA 2GC2A 2E53A 1CJDA 1QJFA 4RS5C 4UFHA 3LL7A 2STWA 2WR9A 4AWDA 1P4WA 3GTMJ 1SD4A 2EFWA 3WNMA 1YJWI 3GTQJ 5LK5A 2LROA 5E1XA 3NKTA 3P7NA 3LAJA 3HPGA 3FMQA 5K9YA 3HN3A 5F37A 4MXVA 2V1DA 1H9WA 4P9LA 5ICGA 2OBPA 1FSEA 2QM3A 3POYA 4UW4A 1Z7S1 2K27A 3ETPA 3J7HA 4NN0A 3K4JA 1PX4A 4CYDA 4D7TA 3PVNA 2EXIA 3BCBA 3ZKUA 4ES8A 2AREA 1GV2A 2ZGRA 1VAMA 2IPQX 2IW5A 3AVSA 5FWJA 3OYWA 4IE7A 3ZMNA 4NC7A 3QH6A 2VZOA 3JTGA 3MLLA 2R7ZJ 5LY1A 4J01A 4XUTA 4RR3B 1NA1B 4F91B 3F2ZA 1ZZ7A 1S7AA 4QXHA 5KHHA 4I7HA 4GA9A 4XC9A 1PIV1 5DDGA 4XR6A 2XJTA 1KITA 3LSHA 1H6XA 2BY3A 2W94A 3CHXA 2R5YB 2EFPA 1H1MA 2OUHA 2XHKA 5IOZA 3IZOA 4XJAA 3HAGA 4HX7A 4XRSG 1ULOA 2JXAA 2DFIA 3THPA 1N77A 4ES9A 2IXKA 1XNDA 4UT5A 2VNVA 3APBA 1F4AA 4E7SA 2GU9A 1P92A 2XSJC 2HXOA 1DYKA 5T5LA 4QU1A 2VZSA 2R1BA 3I8TA 4PHZA 3T2QA 2A6EF 2YU3A 5LWBA 3W20A 4NB5A 3OGJA 3L9FA 1IRXA 2CMPA 3BGAA 3VWBA 3IC7A 2ZXIA 1F43A 3SZPA 2UXXA 1BJZA 5D8LB 2Q1ZB 4CE8A 1CESA 3DU5A 1WW6A 1SHWB 1X4OA 3SJMA 1D4M2 4HVQA 2K7LA 3BOQA 1SMTA 5KHIA 3USUB 4OFGA 4W8JA 4A3CJ 2PHRA 4OHYA 2DVFA 1ZRIA 1RUE1 3ZSMA 1XGOA 4PBPA 4PDKA 2R4GA 1IDZA 3POFA 3HSFA 5DCFA 3ZPLA 3CJIB 1EUTA 3MIFA 1LTEA 2K9QA 3BI3A 2HR3A 5FLJA 2VZPA 2VXRA 4OWRB 2EZHA 5BYNA 1D5VA 4B4QA 1Z9CA 2DQLA 3NJYA 1JHHA 1S8NA 3FHNA 3BJ6A 1FOKA 1NCQA 1WCSA 5AIPA 4LOCA 3VBUA 5JCTA 2NYXA 4OMDA 2RMU3 2M8GX 1IHMA 4K3UA 4XJZA 3DEWA 2LS6A 5EZHA 4XRMA 2JG9A 5FMOL 3BOWA 2PLV1 2ZO4A 1VQMI 1E5RA 2D43A 5HCFA 4QB1A 4ZYDA 5L3EA 4DGWB 1OISA 4BOWA 3MPPG 4FTEA 4CEWA 3OTFA 1SVLA 1OCPA 2BYVE 5A70A 2IA1A 2DJIA 3BIEA 3HJRA 5IVVA 3KPHA 3CMYA 1R082 2OW4A 1B35C 5CA6A 3HKZN 1MNDA 2DJNA 5F5QA 5AVPA 2YBPA 4AQ6A 3IDBB 5DG1A 2V6EA 1Q43A 1G86A 5GZFA 2WFF1 4MSVA 2HWB3 5L9RA 3I56I 4HQEA 4QKNA 3VDAA 2QQBA 2KZVA 1XMXA 5JPMB 4CEYB 3VBSC 2CV2A 4G8XA 1W3XA 1SDDB 1ZM1A 2RGVA 2WNVA 3I58A 3PU8A 1BOBA 5C4XJ 1EH6A 1OYWA 2J5PA 4QX1A 5E3NA 4E27A 3S3NA 3VKFC 1ERDA 1GZCA 5LFAA 1VQ8I 3BTAA 1LQ1A 2VW0A 5LASA 1YFYA 1JMUB 2PHWA 1HB4A 3BPVA 1OA4A 2CW0F 4ZS3A 1K5MA 3F3XA 1JZ2A 1BK0A 5CFDC 5CU1A 4OINF 1SLLA 3MUY1 1HIXA 3CMMA 2A6HF 2WB1N 2X4HA 4Z82A 1C28A 2AEYA 2E1MC 1HSTA 1B1BA 1R093 5JI7A 1BW6A 5J4YA 1V0AA 4CGZA 3TP3A 1RUG2 4ZHNA 2GM4A 3MD2A 1OFNA 1O6UA 4RQPC 4RGUA 2HOEA 3ACHA 1HJFA 1VQOI 4A4AA 3WDTA 3HOZJ 1XQNA 2P3KA 1CIYA 3K2OA 2LOOA 4HMZA 3FZVA 3M3OA 3ERED 2DK5A 3NAPB 1VBC1 4MQ9F 4EROA 1DQ2A 4IQPA 2W39A 2UUZA 3CDIA 4G6QA 5CYVA 1QJU3 4FVVA 3NJVA 1ULFA 1PK6B 4QPQA 4RHV1 4B3NA 1MMNA 1BJQA 3EUHC 3PNVA 4QX8A 4MXWB 2HWD3 2UURA 4NHLA 2ZSIB 3PIJA 2DA2A 1G3WA 5FZGA 3E1SA 5K7PA 2NVUB 2IXSA 2MYSA 4L2NA 3VHOA 1FJLA 1JT6A 4IV3C 3I9V2 2F48A 2F5DA 3BG3A 3DEUA 1W8NA 2D7FA 3T4VA 1AXKA 5G05L 4NDLA 3Q9OA 3ILNA 4HKOA 3OY8A 2P5LC 5HCBA 5FY4A 1HV1A 4AZZA 5LA9A 4GMP0 1P4AA 3VBRC 2FJ1A 3RPQA 1JUSA 1Q8OA 3TOAA 3H9JA 1HRI3 2R7OA 2WA0A 1D8JA 1QA6A 2CYFA 4HBLA 4GKXA 2XH6A 5CKMA 2H0VA 4A3ZA 1C0WA 2EINH 1UZ0A 3BU7A 5A7QA 5LEKA 4YIFA 1RMU1 1GOGA 4MO7A 4LR4A 4XTPA 2R062 1LE8B 3M3IA 5F64A 2XONA 1QQP3 2PQQA 1OVSA 4FFFA 1W2NA 5D8AC 4QPGB 3S5QA 3VYRB 4CCDA 1CAXA 2VT2A 1GYKA 4UV8A 2FBKA 4S0HB 3TOJA 4P9FA 4BWOA 1YIJI 4IRHA 5EXOA 1IXRC 2M0MA 3ZYHA 3ZM8A 2W08A 2JICA 2IFRA 3ALQA 3WDWA 4M3GA 1S2KA 3ABTA 4M73A 3DU6A 1A78A 5AONA 3O8HA 2CW7A 1DQ4A 1QHGA 3W6JB 2HWC3 3K4KA 4A7ZA 3S8PA 4OOIA 3AMHA 1QHHD 3LEMA 3RRDA 4CXXA 4QQ2A 3EQLF 1ITYA 2CG4A 1N1VA 4XNFA 3O1OA 2RR13 3U1DA 2R7VA 2BOJA 3ZN1A 2ZC2A 4PLNA 2VMDA 3DBHB 2FA5A 2GA2A 5E8GA 2YZ4A 2GH8A 4AYUA 3IT8A 3AKTA 4YW2A 2Y0SN 4NE9A 3BROA 2VC1A 2P3JA 2WAQA 3QU6A 2WL1A 3KLNA 4RGSA 3ERMA 2FMDA 5F5IA 2LY1A 2VY0A 3AG3H 4DXSA 2HZDA 4FISA 2R5ZB 1WA6X 3ZSLA 4CPBA 1TME2 2C1FA 2QNKA 5T3NA 3RYKA 2BNNA 3VV1A 2AXTC 2GNBA 3USSA 1ZBE2 4ON0A 1KYWA 4IRIA 4M72A 5L7OC 4HW0A 3A23A 4BISA 3M3CA 4EWDA 1OMIA 4Y33A 3ASOH 1QJX2 4JGZB 1ENRA 2J1TA 3S7IA 3UESA 1R4MB 4E8DA 4HG6B 5BPXA 5A6ZA 2W1WA 4XJWA 4IHXA 4MGQA 1QOOA 1UZWA 2OPTA 3K4MA 3JTHA 3E0JB 2H0BA 1VBB1 1FWZA 1LFBA 1WSUA 3K1MA 1VPHA 5DAXA 1UJ8A 2J1VA 2W1OA 4ATEA 4QKDA 5JXHA 5BNPB 4A69C 1CONA 2R92J 4DQ2A 1FYMA 1GZWB 2EIMH 5CG8A 3BODA 4ZXEA 1U5YA 3BTXA 2R7TA 3PUBA 2QQ8A 3PUFA 1FOD2 2V5YA 3PIPF 2AACA 1W39A 2QKMB 2VT3A 3IH2A 2DMPA 2CAVA 3LCPA 5FY5A 3RVHA 4D7MA 3DPRA 1I9RA 4L9VA 2EXJA 1ZZ6A 3E6BA 3CDZB 3TNPB 1PGW1 3JD71 4PDWC 1LU2A 1X4PA 3BP8A 4WV8A 4V2WA 3KMHA 4EN0A 3OB8A 3JQXA 4AW7A 2JJ7A 3HSRA 5K5RA 1UMQA 3O0WA 1XE7A 4XMYA 5HCAA 2DYSH 4BKXA 4XUQA 3ST7A 2STTA 4JQTA 5L3GA 2GMEA 2E19A 3LSIA 1HB2A 1TMF2 1QJY1 2UY8A 4FPFA 3THDA 5BNOC 1EY2A 3QYFA 1LODA 3CCLI 2ZAAA 1G9DA 2QQVA 3OBAA 2EALA 5FYZA 1AVBA 4DZGA 4ARYA 4L18B 5L3BA 2EILH 2X5IC 3WW4A 1EAH2 4CDWC 3A03A 3EHKA 3O1TA 3G73A 2YPRA 1DGRM 3X29B 4ATFA 3TYJA 2VOPA 3CF6E 1AOYA 2COMA 3AL0B 1PO22 3HRUA 1WHUA 5J8FA 5A3NA 2HYFA 3DLAA 2FBIA 2WO1A 4HKWA 2KIFA 4UVCA 5BNNA 1QRYA 3NARA 1BEV1 3FXJA 2XLGA 1DYOA 4QSHA 3MO4A 1WW5A 1FEXA 2V4VA 5IWFA 4AQ2A 4HOOA 2OIIA 4Q4V1 2RM23 5A7OA 2IT0A 4LHKA 4L92A 2VKEA 2DURA 3R4SA 3I4PA 3PTYA 5KNLA 4D7NA 4BQ5A 3QOPA 3C3WA 3IAPA 4OMZA 4Q4Y3 1BCXA 3FBMA 4OIOF 5D5WB 1VBD3 4XUPA 4OYUA 3ZFGC 1E0EA 2E5NA 2H6CA 1JHFA 2CQQA 2P8TA 2Q4SA 1AYM1 3C3VA 5KHGA 3N9MA 1IG0A 3UJQA 2IVMA 3WP3A 3WHUA 4UOJA 4ONUA 3OGSA 3IWFA 4M6YA 3CO6C 1FPN1 4PSXA 5FZ9A 3BTCA 2Y2ZA 2PYTA 1RUOA 2WV1A 4NRPA 2DPDA 2W4SA 2Y64A 1EV11 4BQYA 2R16A 2VL8A 4S2FA 4LBQB 2WQ8A 4WXCA 1RUI2 3N9NA 2M3AA 3GZEA 3K51A 2X85A 4W6XA 4DIQA 3HOWJ 1LHWA 2EFNA 4JGYA 4XCAA 5DAVA 2FZ2A 1BL0A 4K2EA 3GEZA 4DEVA 2Q8DA 4XBFA 4R4ZA 3S32A 5DUUA 2EIJH 2H09A 1BVP1 1NQJA 1WMDA 3W5MA 4C8DA 2P7CB 3FXUA 1ZRCA 3KHCA 1C8M1 3RJPA 1OF3A 1RI7A 2J1RA 1A34A 5KAFC 1HQLA 4JX0A 3WR0A 5I0DA 3WINE 3WHTA 4IEXA 2VZTA 3Q8AA 1APLC 2D40A 3PVBB 5FO9B 4KIGA 2Y31A 2DDBA 5I8YA 4H0EA 1GICA 4YFKF 4M01A 5DG2A 4B09A 2PLYA 5F27A 2B9VA 1NT0A 1IOAA 1GLNA 4V2FA 3TRSB 2C0ZA 4K6BA 2L5QA 5FOJB 5K0UA 1GXPA 2ZMEB 4XFBA 3MW2A 2WTEA 4OIQF 2L4AA 1E5IA 2DUOA 1NY72 3T4HB 4ITCA 4FE7A 3DYMA 2XPWA 1S0JA 4AVTA 2EZLA 2LMDA 2A6TA 1V6MA 1MS1A 1B35B 3ACIA 4LUMA 3PO3J 2A6ZA 2CQKA 5F5CA 1HBXG 2RJLA 1XSDA 2NQYA 3HRSA 2R49A 1X9TA 2Y75A 3ZR6A 4QGLA 5BNGA 3N35A 5LHGA 1RXFA 1D4M3 2JK3A 1YTYA 3AJYA 2X9DA 4B3AA 1OOPC 1BC8C 4YRVA 1KXGA 4D6RA 5LW9A 1LOFA 5H9RA 3VBSB 2DVDA 2L3DA 1Z7UA 3LAGA 4IEQA 4XILA 4QIWN 1SFUA 2NVQJ 2XF6A 2CAUA 1ODMA 3HDDA 5FY0A 1HB1A 1IPJA 1XNKA 4XKWA 2E1OA 2FOKA 4YW1A 1ZZCA 3M1HA 1ZELA 1YUDA 2J42A 3LSRA 4IERA 1ZZBA 1U6GA 1ETQA 3LA3A 5D4RA 2FDKA 1IDYA 4CA0A 1MSFC 1ETYA 4KFCA 2VMFA 5FLMJ 1C1FA 3HGYA 4EV0A 2JG8B 2Y9YA 4KN7X 2JWPA 2R30A 2OJED 2GDFA 2XAHA 1R1VA 4JC1A 2ACJA 3VSLA 2VI6A 5E79C 2EAAA 1SZBA 1IAWA 2YR2A 1GWKA 1OCRH 1FATA 2VXDA 1WH5A 3V7RA 3ENRA 3ROUA 2W85A 3SLIA 4DPNA 2B0LA 3AAFA 1QF3A 1R083 4BQ2A 5JXJA 1GWMA 1UZYA 1K79A 2ATFA 3VBHB 4OU0A 3ZSJA 1W3VA 1TL8A 4PJ0C 3MDPA 5B3SH 4QHOA 1FBUA 5D2AA 4XFCA 4F55A 3OYDA 5KXCA 4AVSA 3A0BC 3JZVA 1PX3A 1IRGA 1SQ4A 2RDPA 1J3RA 1Z21A 1MJBA 3F8MA 4YG3A 3ECHA 2O3FA 5GAEJ 2PQSA 4DW6A 1ZBA1 5F3EA 3ZXAC 2L54A 1OI6A 2ICWG 2W3JA 4XQDA 3UL2A 3Q8FA 3SDBA 1NCRC 2IRFG 4BS9A 2EXKA 1TWCJ 3FHQA 4Q0UA 5F0CA 2WO3A 3H1YA 1JBCA 4JX5A 4L0PA 3DWLE 5E1ZB 2PJRB 2UWCA 5CKNA 5C5TA 2E63A 2PELA 3PNYA 4QQOA 2P0WA 1RUJ2 2Z42A 3IDCB 1CAWA 4JQRA 3TGNA 3ZXJA 4G12A 3TW6A 1W2TA 5A7WA 3MKWB 1VTNC 1UCXA 3BALA 3ZQQA 4HLXA 4UXNA 2P4WA 1LOAA 4N8MA 2MG4A 5CFCC 3KF3A 4NIIA 1S0DA 1K6YA 1FMVA 4QXKA 4XOPA 3GX4X 1MPXA 1X36A 5F9TA 1U78A 1MEC1 2X6YA 1D7PM 3O0VA 3VZLA 1WGPA 3WOGA 2Q8EA 5T52A 3OOUA 3JCIA 3ZSKA 1C1LA 3KV5A 5E18F 2XPVA 3NAUA 3KQ4B 1MZBA 5A1AA 3DECA 3OYEA 4UVBA 3CZJA 1W5TA 4IEPA 1IXSB 5DZEA 3TL4X 1UY1A 2VKDA 3GFLA 3ZRGA 4FOQA 2GMPA 3T0DA 1DP3A 5JMCA 5HDNA 1O3SA 3FIWA 1YQCA 3POJA 4D1QA 2JIJA 4GWNA 2VPVA 2VTFA 4UFKA 2V9PA 1WA4A 2ARAA 3M1CA 1ND2A 5JVTA 1CQ9A 3ZKYA 2QUOA 3ZPYA 4MLOA 1R1TA 2XGDA 4QPIC 4OHXA 3J7AO 2IWGB 5CQEA 1S0CA 4LA2A 2VNOA 1AHDP 2GSYA 2K85A 4YZ5A 4CU9A 5FP9A 3FC0A 5FPAA 1V6KA 3NW4A 3KV9A 2BNMA 3VKNA 2XVKA 3D0JA 4CCLA 4C91A 4UUSB 4AXOA 2IS1A 4Y3OA 4Q4X3 4IUGA 2Y6LA 1OKRA 1LU1A 1DQ5A 2NYYA 4H2AA 4Z92B 5FZ1A 5JVVA 1H89C 4YELA 2HQAA 2AXLA 3SQNA 1UU4A 1T39A 4JV4A 5IY5H 3RMYA 1YRNA 2A71A 1DGLA 4Y13A 1DU0A 2DOFA 2XR4A 4YG2F 3HT1A 2BW3A 4UW6A 2CYYA 2BXYA 5AFEA 1JKRC 2R063 5D4SA 1X3WB 3ZYJB 1EF4A 3OY9A 1AR72 2D5HA 4LUKA 2E5ZA 3LB9A 3R4KA 4Y52J 4BE3A 5FP7A 1HOMA 3L7WA 1ND3B 2LK2A 2SBAA 4HF0A 3PJRA 4PFPA 4GO1A 5DD4A 1BN5A 3R0AA 4OZOA 4CDQC 2XPJA 2WN3A 3F0CA 3I4IA 1KFUL 5FD5A 4AL9A 4YLZA 3BIWE 5I0TA 4LHLA 5K5OA 2VUCA 2YFUA 2BDRA 1LENA 4AI8A 3K4CA 4N53A 1X2MA 1AX0A 5E16A 1VAKA 1SFEA 4IEOA 3W6KB 1YQ6A 2V9VA 2IP2A 4GB33 1T2KA 1VBE2 2XLAA 3M7GA 3V0AB 4ZDPA 2JA5J 4PF1A 2RS33 3DPLC 4CDUA 4NQWB 4ORFA 3IAS2 2PN5A 3AP7A 3ATGA 2DCJA 4IV1C 4B43A 3H1WA 5A3UA 4UUVA 1H1IA 4AYBN 2ZNZA 5A7PA 3M8JA 4ISRA 1BBT2 2W95A 2XPUA 5C3EJ 3AJZA 2JEMA 3RQ4A 4URTA 1P7JA 2ZJQF 4Y24A 2I74A 4B4PA 3TB0A 2CJJA 2ET1A 4E4SA 1UY4A 3DCQA 2OA2A 2LREA 3KEOA 2VMHA 3HSEA 3HR9A 4UFLA 2FZ1A 3TEDA 2WQ4A 4RFRB 5A33A 5B4XA 1M4WA 1I5ZA 3URFA 3HL2A 1TME3 3V65A 5EZGA 2K3FA 1LGBA 4GWMA 2JMWA 3TN93 4XF1A 2Q0AA 3HVDA 2ZPXA 3H92A 2Z99A 5J7MA 5FD6A 5ABJB 3N7MA 1TNFA 4EEFG 3WU0A 1LHOA 1HKTA 4OAYA 4QQLA 4AIDA 5LY2A 4P55A 1W6OB 1TBXA 5I0UA 4I0AA 3GCWA 4U2AA 3I3BA 3H42B 3LKJA 1AYN1 3C2GA 3WCRA 3J7AY 2P34A 4DUXA 4CCKA 1BR1A 3S6PA 4CUGA 5GAGJ 3TO7A 3ZXSA 1CF7A 4YGDA 1H8TC 3K10A 4CUAA 3WGHA 2CU7A 2R0HA 3P1IA 4A3FJ 4KJZA 1IG7A 4FPJA 1VQ4I 4RL7A 4V1PA 3IL2A 1ZQ3P 1DBNA 4Y5Z0 2JA6J 5BPDA 5HCHA 1UAAA 2ZA9A 1O4TA 2E7QA 1FXZA 1UPSA 5C8CC 1JS9A 3NQHA 4LO7A 3NL1A 4N0BA 2VLAA 3A0HC 1ULDA 3FZ3A 1I1EA 4EJOA 3T5XA 5F8PA 3I59B 4ETSA 3BC8A 2EA2A 2Z2SB 3ELNA 1J3PA 1X3UA 5DDJ2 5FYYA 5AC93 5DAWA 1QVUA 3PURA 4UAPA 4F92B 1UMIA 4E2SA 3CCYA 2BV4A 3FXLA 4TYSA 1ONVA 4BQXA 4DYQA 5GKAC 4QX5A 2OTJI 4KIBA 3L2YA 1KS4A 4R9AA 3R05A 4BZ4A 1Q5OA 2DVAA 2R041 1MZFA 3HUGA 3KZYA 4BY1J 4LLNA 2YC2A 2RHPA 4NBQA 4Y1YA 1TQPA 3RDIA 1BYHA 3ZSEA 2P5KA 4QX7A 4BEHB 2AUYA 2J22A 4GMP1 4Q4W3 2PAEA 1Y9GA 3UR3C 3NRUA 2XIGA 3LQRA 4W1UA 3JRGA 4C3IJ 1ZRDA 3IDEA 1EAH3 1W9SA 4KICA 1I3HA 3BG5A 5I93A 1BI3A 4FFGA 1UPIA 2Y30A 1SAUA 1OPMA 3F22A 1VMFA 5IK4A 4ZPIA 2XVLA 4U0YA 5KR7A 2QVSB 4AVZA 3KLSA 1W5CC 3CF5F 2VNGA 2G7HA 1REEA 1UWWA 2ISZA 1W9FA 2HU9A 2TBVA 1K6OA 4M0HA 3C2BA 2XB5A 2VZUA 4EWAA 1YJ9I 1W6MB 5JR3A 5A6QA 2BTVC 5IUQA 1WBLA 2QLZA 2A6YA 2PFWA 1X33A 4GH4B 4KBBA 1S0FA 1NLRA 1RHI2 3VKLA 1JZ5A 1COV1 4XMAA 1W99A 3LD8A 4I2OA 2ZGQA 3LSPA 4K1ZA 1JTXA 4XRSA 3I49A 3GXUA 4JRLA 4B44A 2GIVA 5L3FA 5FKKA 5D21A 3VKMA 4UWDA 2W57A 4CDXC 3H9QA 1YW8A 5IP6A 4HDUA 4HV6A 5ILSA 1VMHA 1EPZA 1YC61 2YBSA 2HJIA 2OQRA 1W4MA 3GZNB 1OCCH 1OJLA 3LFUA 1DHKB 1OOPB 4A6SA 2QQNA 1CPNA 2WABA 4ARXA 2ZGMA 4O3MA 2W92A 3LDBA 2X8KA 3NVCA 1AR61 1MBJA 3GTLJ 1W8TA 1YIFA 1MBHA 1X82A 4G7ZF 2DCEA 4A3IJ 1RUI3 3PUAA 1T56A 4GWIA 2DCTA 4BQNA 1JODA 2DOAA 4DXRA 5E17F 3UK9A 2VJJA 1MR5A 1LNWA 4EJVA 4SLIA 5IP9J 4FBFA 3ETQA 1TWHJ 3MPBA 3VSKA 4MGIE 1ZRRA 4H14A 1R1A2 2LC2A 3H35A 2XUMA 2PN6A 4B1RA 2V4JC 4LKEA 5H9PA 2VECA 2RJKA 4LJZF 3C2UA 1U5ZA 2H1LA 2LKXA 5EG0A 3EO6A 1Z0HA 3HIFA 4PK4A 5DCMA 3OSDA 4B8EA 3VBOB 1OLRA 2IFWA 3LFIA 1W0TA 2IXJA 2ZGSA 1QJZA 4HX8A 1RUH1 3OYFA 4L9BA 3C2HA 2E32A 4WM7C 1CWPA 2EFOA 3TBDA 4NRMA 2Q2EA 5IYCJ 1Q8PA 5GADJ 2WNEA 1G2HA 4O65A 3K75B 4P00B 1UG2A 2F4PA 5C9AA 2WY7Q 2QKLB 3BG9A 2RS12 1AKHA 1QXPA 1LDJA 2YPJA 1AWCA 1FNYA 2CU5A 2KR2A 1J9IA 3BLYA 3UV9A 4RDUA 2A73B 4YM3A 2TDXA 4P9GA 2BJSA 2ENRA 5EF6A 2OPKA 3ZQFA 2WFF2 2XKPA 3FKJA 2PJPA 3WD5A 1MBFA 2XJUA 3R4UA 4BJ6C 4Q29A 1XC5A 3EB7A 2QQKA 5ICEA 3ZFEB 1IW7F 2ARXA 1RUD3 4XBNA 2OV7A 2RE9A 4R9BA 5J36A 4XKCA 5HV4A 4FFIA 4AVBA 3J7YJ 3EPZA 5EV7A 5A3LA 4PJMA 1S0GA 2RS52 1APNA 1EA3A 1C8NA 2VQHA 3VLBB 4QTRA 2DT5A 2Q1FA 1KU7A 3SZTA 5J48A 2BFUL 3REOA 2XRNA 2V5DA 1ZGAA 5J1UA 4EYUA 4CYCA 2HYGD 2PQ8A 2LKPA 3LAPA 2MABA 5EFUA 5JHUA 1FMWA 4L9TA 4XF4A 4WXHA 2LLKA 2R32A 4BLJA 2VW2A 2JSPA 4HXCA 4AVPA