4FT8A

E. coli catabolite activator protein with cobalt and sulfate ligands
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords Catabolite gene activator
publication title Structure of catabolite activator protein with cobalt(II) and sulfate.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ft8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ft8A01
2XAQA 4BYYA 2HYGD 3K1MA 5FD5A 4M74A 1J9IA 2DK5A 4ON0A 5D6EA 4RAZA 1WQ2A 1IRFA 4BNCA 4MNUA 2VE9A 1NHAA 1XGOA 2ATFA 4A0XA 4QM9A 4F7ZA 3WGIA 1U5TC 5HS8A 1D8KA 4LB5A 1UCRA 3C3WA 3CL1A 1B1BA 3ABTA 3MYXA 3SZTA 1F9NA 5BPXA 1BIBA 2CO5A 4XFCA 4G9YA 2EB7A 4S04A 1LEAA 3NW4A 4CGZA 2NYXA 4PJYA 4D7TA 1KYWA 1SFUA 1YS7A 3SHFA 4UUVA 2PYTA 2UXNA 1Q43A 1X8EA 2XLFA 1YYVA 3B02A 4TLFA 3H92A 3TO9A 2GZWA 1YW9A 2DQLA 4DNCA 2LNBA 3KP4A 4CXFA 3KMHA 4WZCA 4P9FA 4XFAA 4HBLA 3CTAA 2BV6A 4YSFA 1R22A 5HI0A 5ICFA 1TW2A 5HDNA 1J2XA 1I5ZA 2OAZA 4ORFA 5F64A 2UWMA 3HRTA 3SCHA 3OD0A 2QJVA 2WFPA 3U2RA 1JHHA 1IPJA 3TNQA 1DGWA 2CQKA 1KQ9A 3IWFA 3IDBB 3G73A 3E97A 3G3ZA 1FZPB 2MH2A 3ABUA 2IVMA 5ILUA 2UYBA 3U0ZA 5IT9K 1ZRCA 4WCGA 1KQ8A 2CFXA 4EWAA 3R61A 4HF1A 2KJCA 1HSJA 1WGPA 3ZP5A 1KU3A 4CZZA 1LDKB 4UV8A 5H20A 1IN8A 3F8FA 4IXAA 3LAGA 3H3ZA 1QNTA 4DINB 1FWZA 4GCVA 1FT9A 2FA5A 3CO2A 3F8CA 4Q0UA 2VQAA 3TOAA 5LEJA 4U7BA 3BROA 1QXRA 3KP3A 1GHCA 2ZO4A 3WE2A 1TW3A 1DGRA 4BXUA 5I8SA 4L18B 2KIUA 1XMAA 1UCXA 2ISYA 3LA2A 2PHLA 4AVAA 2Y48A 4QWQA 2FSWA 2H6CA 4MX3A 5BXXA 4YARA 4OMZA 3TO6A 3NSTA 2GC1A 1JUHA 2HS5A 5LLQA 1IRGA 2PFBA 1RL3A 1LRHA 3E6BA 4EWDA 3KCCA 3WTXC 1GXPA 2EA7A 1Q3EA 5I0SA 3GX4X 1XGSA 3HUGA 2OA4A 1TQMA 2Z3YA 3JW4A 1KQ0A 1YQAA 5T3NA 4RAYA 5I0RA 1H1MA 3R0AA 2P7VB 4M6YA 4EWEA 4Z2YA 2FNAA 1XGMA 4I2OA 1SEFA 3BDDA 4ZYDA 3QU3A 2EAAA 4N9HA 2XL7A 1ZYRF 4MGIE 3R0JA 3BOQA 1ZZ8A 1HW2A 2VC0A 5L3FA 2IA1A 1SFNA 2K02A 2V9VA 2QCSB 4JQFA 3ELNA 2P6SA 5I91A 4HOBA 4Q48A 3R6SA 5ILVA 2HYFA 2VBXA 3Q5FA 1U6GA 5FPXA 5DUIA 4LLLA 2EFNA 4MQVA 1R58A 1AOYA 3CO6C 2DBBA 4L5IA 3F21A 1MD0A 1H1IA 2QUFA 4KWJA 3NQOA 4AXOA 3QU6A 4HX4A 1G4DA 2ETHA 3FZVA 3F72A 4K2EA 1X82A 3S7IA 2A6HF 4DQ2A 2A61A 1LKNA 2O8XA 3KP6A 3USSA 4KDPA 3V7SA 4JV4A 2LKPA 1KA8A 1YTYA 3EETA 4I3PA 5D5XB 1Z05A 3M8EA 3KP7A 4HQEA 3K1NA 4P55A 5JCTA 1G3TA 3QP5A 1KGSA 3WGHA 2P7CB 2CG4A 4G7HF 2DPDA 4G6DA 3EBRA 3IL2A 2VN2A 1YW7A 1HW5A 3P9IA 3F8BA 4N0BA 3VFZA 2QQAA 4IPAA 4Q0QA 1IXRC 1BI2A 3QRFF 4XFIA 5DDGA 1FY7A 4YIIA 2VECA 1VP6A 1J5YA 1T39A 4N9IA 1J59A 2LF8A 2P4WA 2VBZA 1T2KA 1K6OA 4HVQA 3CUQC 3HIFA 2O1QA 3EO6A 5FLJA 5D5VB 1G6NA 4LJZF 1BI3A 1V4RA 2F5EA 3HHHA 5LRRA 1VTNC 1PM7A 4KMUX 2UY9A 3BALA 3WE3A 3EJKA 2YX7A 3GZ5A 2VBYA 2GXBA 4YNIA 5H6RA 5D5UB 2X4HA 3DKWA 3DV8A 4O5VA 1Q1HA 2WWYA 4JK1X 2R3SA 3TO7A 1BIAA 2P6TA 1LR5A 4YRDA 1CAXA 3H50A 4U0YA 4KWKA 1ZZ9A 2XUBA 5EEGA 1ZG3A 4Q4ZF 3WU1B 2MD5A 1ZHFA 5BPIA 2IC1A 4HX7A 1C0WA 1ZG5A 3WTWC 2V1XA 2P5VA 2EFPA 1TQ5A 3ECOA 1PP7U 1CAXB 1DP7P 3DFGA 3PQJA 2C6YA 4LK1F 3ISPA 2X0LA 4KIGA 2Q4SA 4X6RB 5EFUA 2L01A 2FBIA 4HF0A 4MV2A 3GXOA 2K86A 4RGSA 2YPRA 5FQ0A 4ZH4F 3GZ6A 2XGXA 5BPDA 2VE8A 1XSDA 5BUVA 2QDRA 1KU9A 4Z82A 3WODF 3S0MA 3SHRA 4IRIA 2FRHA 5AONA 5FD6A 3RJPA 4UNOA 3I5UA 1RZ4A 2CSOA 2H6BA 3BPVA 4PDKA 5FQ0B 3HTUA 4H0EA 2KJBA 1Z7UA 3RPQA 2Z2SB 2FQ3A 4WBBA 1JGSA 5FLXZ 1YS6A 2RQPA 5KBFA 3IKVA 1MKMA 1ULYA 4LUMA 3ZQ7A 4AD9A 5E18F 4G7OF 2RNJA 3BJAA 5CADA 3MDPA 2D1VA 4XF9A 1W7PA 2HGCA 4IESA 2OZ6A 3OF1A 2A3SA 1J75A 2Y0OA 1LDJA 2FBHA 3F8NA 3GO5A 2RC4A 2RDPA 3JSPA 3ACLA 1FPQA 2MLGA 4MEYF 1W7PB 4KFCA 4PIYA 1SMTA 4PIZA 2DO7A 3NL1A 4IEUA 1XB4A 1SQ4A 4A0YA 2Q2EA 4KA4A 3BCWA 1ZNPA 4XF1A 4CHUA 4HN1A 2YSRA 4BAYA 2IXLA 4FAHA 3BPXA 3HRSA 5DYMA 1RUOA 4U88A 3MCZA 3VHRA 4MQ9F 2G9WA 1S29A 4ENNA 3EQLF 1MJBA 1QPMA 1ZZ6A 2YR2A 2HKXA 4XBFA 2HQNA 2PQ8A 4I09A 2B0LA 2BNNA 2QQBA 3TNPB 4IF4A 3SMHA 3GVAA 1BI1A 4OIPF 4KU8A 2RKHA 3M8FA 4P9GA 3NJZA 5KHGA 3V7RA 2EFQA 4FX0A 4MEXF 4HW0A 4NB5A 5TRDA 5CVIA 3J81Z 5I93A 5BV6A 2EK5A 4GXOA 5E1XA 4HBNA 2DK8A 1G3SA 1ZGAA 1D3YA 4OMYA 3K69A 5I0TA 4AQ6A 1IN4A 5CVVA 5FGMA 2IJLA 3ZMZA 1ZRRA 4PIXA 1QY4A 1ZGJA 1Y9QA 5HVQC 2M1BA 4KICA 4MTDA 1NE4A 3WW4A 3LQQA 4WF2A 5CLSA 5I8YA 3T8RA 2P17A 4R8HA 5F1RA 1REPC 1Z9CA 3QPHA 1FBQA 5JI6A 3WTTC 1RUNA 2E7WA 4Z07A 2MA3A 2ZFWA 1ZZBA 3L2HA 4RD7A 5FLIA 4IEOA 4A5NA 3T8TA 1G3YA 3WTVC 3C3VA 1IN5A 1NYWA 3MFKA 2PMUA 4ZZDA 2CV6A 3KGZA 4BH9A 2IW5A 1YFUA 4HA8A 3VOEA 4B8XA 2DFIA 1ON2A 4Q29A 3CJNA 3HQXA 1IW7F 4A6DA 1OI6A 3OCPA 2STWA 4IEXA 4ZYGA 4R79A 3CEWA 3D0SA 4HDUA 4LA3A 1CAVA 2KKOA 2MBFA 3ELKA 3I58A 4G7ZF 4WXHA 5JFRA 1YWKA 1RC6A 1VJ2A 1FP2A 3LAPA 1OKRA 4RB2C 3F23A 4R1HA 2VT2A 4MGRA 1WA4A 3ZN0A 2D5FA 4OINF 4OIRF 5FLHA 5HS7A 1CAVB 3OGJA 4QGMA 4XF3A 1RNLA 2O3FA 3C1DA 3FM5A 3SZPA 4YFNF 3LQRA 4E2GA 2V09A 3GFMA 4M9SA 1FSHA 2D93A 3F6OA 2HKOA 1G3WA 1NXMA 4ENJA 2OPKA 2W84A 4GYIA 4Q0VA 1O3TA 1X7NA 3WTUC 3JAMZ 2COMA 4YG2F 4ZYHA 1YFHA 1DZTA 5KK1A 5FDBA 2DLLA 5K5RA 5BOXA 1MDMA 2GH2A 3KEOA 3WG9A 2VOPA 4AIJA 2AXLA 3RKXA 2L4AA 3O3KA 4R52A 2EFWA 2XLGA 2MPFA 4IEWA 5FFXA 5HLHA 1O4TA 1J3RA 3RYKA 4XETA 4Y15A 4KUMA 1BC7C 1XCBA 5IT3A 2GU9A 4G6QA 4YFKF 2MNGA 4LTAA 1MDMB 1ON1A 5FB2A 1P6RA 2UY8A 4J1WA 1J58A 4LLGF 2QM3A 3K2ZA 2VT3A 3RZZA 5JSOA 1EY2A 3MZYA 1USSA 3BZ6A 2P8TA 3DP7A 5BQTA 5L3CA 5AIQA 4BHBA 4YFXF 2XASA 4UBHA 4KT5C 1LDDA 3BPZA 3WTYC 1F4KA 2PN6A 2XRNA 4EVIA 5JR3A 1RGSA 2IA0A 3DN7A 4O3MA 5DUKA 3WGGA 4FX4A 3QPTA 3IBMA 2IP2A 5CU1A 3J80Z 4NVPA 1X3UA 1SAXA 3OV8A 3HRMA 3KSCA 3I59A 2M45A 4O9GA 2QBYA 3SCGA 3K9TA 2BYVE 2D45A 4LLOA 4ETSA 3WU0A 4EM2A 2HDCA 1EV7A 3WW1A 5LRSA 4RGUA 3RYRA 4KIFA 4PZJA 1QGPA 4XFGA 2L4MA 1B9MA 3N4MA 3IWZA 5HLGA 3R60A 2EJRA 3ZMDA 4P96A 2UZKA 2E7XA 2OQGA 2Z99A 1OPCA 1CAWA 2L3DA 2DU9A 1O7LA 4EM0B 4LLNA 5K5OA 2GAUA 3UKVA 5I8TA 5KHKA 2P5KA 3H7JA 2EWNA 4XFBA 4EJTA 2IXIA 3HT2A 5JSPA 2K4JA 4QGNA 3UKNA 2QQ9A 1ZREA 1CAWB 1O5UA 3F3XA 1QWRA 2UXXA 3SXWA 3GYHX 1J1LA 2DCTA 1KU2A 2D1HA 2UYAA 3FX3A 1DPRA 2H27A 3GF2A 1SFEA 5E17F 1R1TA 3BJ6A 3H1WA 4ASNA 2DPUA 2DW4A 1SD6A 4Q5SF 1TQIA 2VODA 1UD1A 4BIFA 5KHIA 5HOOA 2PI0A 4S05A 1T38A 3F22A 1R23A 1IN6A 4WWCA 4OFGA 1OMIA 2WV0A 2GA2A 1QZYA 4IETA 1YO5C 5AVPA 1R7JA 2STTA 2Z9OA 3KP2A 4WK8F 4ENKA 1DZRA 3H1MA 2M30A 3TKYA 2O0YA 3K0LA 2XROA 3FMRA 1S7OA 2OA2A 2NRAC 2PBIA 3TDZC 2K9ZA 1FYMA 3DQVC 4CICA 5E1RA 2O61A 5J8FA 1IN7A 1ZZ7A 2DQRA 1YUDA 5DD8A 4HLTA 4L2NA 2DAOA 5D6FA 4FHTA 3ZMSA 4MTEA 4Y13A 4LFUA 2QENA 3FFQA 4AIHA 1RI7A 2HZTA 4GO1A 4EM1A 2GC3A 3FMSA 1YLFA 1XDSA 1FYLA 2JZYA 5DD4A 5FPZA 3P7NA 1K78A 3WTZA 1F1ZA 1FBUA 1T6SA 4KN7X 2ZXJA 5A2QZ 3TOBA 1UB9A 4KIBA 4HQMA 1RTVA 1T0FA 1FNNA 4Q0PA 1LNWA 1B4AA 3SCFA 3F6VA 2F5CA 3UKTA 3HTSB 1O5LA 3E5QA 1YFWA 4CYDA 3NEUA 3QOPA 1K78B 2V6CA 3IHUA 3KFWX 3KLNA 5AIPA 4G8XA 1LVAA 1R5HA 3IRRA 2M87A 4NHJA 2GIVA 3B73A 2HOEA 3OTFA 3OOPA 4JTOA 4QM8A 2FBKA 3EYIA 3U10A 5DEQA 2IXKA 1TNTA 5C8WA 3KEQA 3I7DA 1W7PD 4EJVA 4Q0SA 4BHPA 1W5SA 3IIAA 1STZA 2VONA 1KYZA 1IPKA 3QP6A 2Z5UA 2B8MA 2ZKZA 3H3UA 2F4PA 2O6GE 5D4RA 1FOKA 2R7DA 2ZKLA 1ZARA 1CF7A 1EH6A 1TTYA 1MJ9A 2XV4S 1WI9A 4ZYEA 1Q5OA 4PCQA 2D5HA 5LHGA 3VEPA 4HV6A 5J48A 4CO8A 3CLOA 2KRFA 4HMZA 3GEZA 3T0YA 4HF2A 1HQCA 3ZPLA 1XRUA 3COAC 3ES1A 3SXYA 2ZJ2A 4HX8A 3LA3A 2M5WA 1T98A 3H1YA 3JSOA 2FEZA 3D0JA 1U8RA 4RS8A 3FWEA 3KETA 1YFYA 4L5JA 3ZN1A 4XSXF 1V3FA 4KYWA 2W24A 2CW0F 1GQGA 2XLAA 2K27A 2R7FA 1ZLKA 1FI2A 1L3LA 2QWWA 3L9FA 2GC2A 1VR3A 2PA7A 2PMHA 4IRGA 4FT8A 1QO0D 1YHFA 4ZZLA 2OU2A 4IJAA 2OZUA 4M71A 2HEOA 2FF4A 3FXRA 3V8JA 1Z6TA 2AS5F 4I0BA 2QVSB 1XE8A 3DF8A 4IEYA 3L2CA 1EH7A 3ZMVA 4OIOF 3TGNA 3T1BA 3HT1A 2HTSA 4L9JA 4QXKA 1D8JA 2JPCA 1NE6A 4ZU7A 2G7UA 4JBAA 1LEBA 5IT9Z 2MC3A 4XEZA 2NNYA 3GYDA 3HYIA 1ZLJA 1I27A 5ICGA 2K7LA 4QLCU 5TJJA 2EV5A 4MUVA 5D5WB 1O57A 3MZHA 4A12A 5FO5A 4HVRA 3K1PA 4QGLA 4I7HA 1E17A 4UHTA 1QQIA 2JTVA 5L3BA 2VBWA 3E5XA 3GW2A 1XN7A 3ROUA 1YFXA 4RGRA 3RTRA 5J3UA 3IRQA 2RN7A 3IKTA 2V1DA 3I71A 4L9VA 2IRFG 5D1IA 5LGTA 2EV6A 2P5LC 4GGGA 4UBGA 3RIRA 4QX5A 5J8CA 1GQHA 4O6JA 3EQEA 1O7FA 2JRTA 2NS0A 3FJSA 4LG0A 4B09A 4EQQA 4XF4A 3ULQB 3M9AA 4RB3C 1R00A 2ISZA 1J3QA 1UHWA 4M73A 5KHJA 3HRUA 2F5DA 4XFFA 2ZBKA 1GXQA 2F2EA 2FOKA 4U0VA 1IF1A 1BC8C 3JZVA 1JXSA 4AWXB 5K8SA 2PAEA 4A0ZA 4HSLA 1A04A 3E6DA 3ETQA 4LUKA 4WXCA 4U7DA 1B6AA 3ES4A 2YU3A 2B9UA 3U11A 2DT5A 1XE7A 1SD7A 2GXGA 1WLTA 2HTJA 2XIGA 1YW8A 2HWVA 2PLYA 3MAJA 4MGYE 2XAJA 3GBFA 4UXNA 4PGGA 3J7AO 3ZMTA 2MHFA 2XAGA 3FXQA 4XSZF 1J7KA 5E20A 1OD5A 1ZZCA 5JHUA 1ZG1A 4LEJA 1BBYA 3EHKA 3E6MA 2MLKA 2HJIA 3RNSA 1ONVA 2EVXA 2VOOA 2OBPA 4HSJA 1SMYF 5D8KB 5L3DA 3KZYA 2HFHA 3WTSC 3V7CA 4M9XA 2A5YB 3MWMA 4Q47A 1ZRDA 1WRJA 2PEXA 5CJ9A 3PFIA 1AWCA 5JSRA 3GWZA 2ZCWA 2NNNA 3CO7C 2M8EA 3QAHA 4KN4X 1S8NA 2GA1A 1CGPA 1DDNA 3WW2A 1HKSA 3LSTA 3CUOA 3FHIB 1KU7A 1OR7A 1ZVFA 2ZNZA 3H9AA 1EPZA 5FLXK 2MH9A 4HLYA 5H6QA 3HOSA 3ECHA 4BQAA 2PHDA 2CGPA 3FM3A 1YG2A 2KXLA 1Z1DA 3LWFA 1BI0A 3C7JA 3KE2A 2PG4A 3H7YA 1EH8A 2PAKA 3DPTA 4RGXA 4U0WA 4UV9A 1SD5A 3LAJA 3HSRA 4LA2A 2ELHA 4KNYA 2XKOA 6PAXA 3O14A 2Q30A 3FE5A 2LDUA 5D4SA 5HS9A 1GVJA 1K79A 2FE3A 2QLZA 4I0AA 4ESJA 3I64A 5CVUA 1NZCA 1SD4A 3REOA 1ODDA 4HDVA 1EYBA 3M7GA 1BM9A 4LD5A 2LF7A 3I0TA 4I02A 2IXCA 4BHCA 2PTMA 4NQWA 3PQKA 4L9TA 3BP8A 2LSOA 4L11A 4EMSA 2W57A 1HXDA 4WXDA 1OYIA 2RGVA 3GFIA 3JTHA 3MPBA 2K0GA 1QXJA 1R5GA 3CUQA 2I45A 4P5OA 1W5TA 4HYEA 3DEUA 3D82A 3E6CC 3JTGA 5E8IA 2V79A 2ET1A 4M6XA 1MZBA 1B9NA 4GULA 3LWCA 3LZZA 4XLNF 2EV0A 2ETEA 1OYWA 1XD7A 3LA7A 5DCFA 1JE8A 2J5PA 1X8MA 3CUQB 3I53A 1S6LA 3M1EA 2QYOA 1R1UA 2XAHA 3J81K 3NVCA 4OOIA 1J0RA 4LULA 2ADUA 3I4PA 4LK0F 2JPBA 2RV8A 3WW3A 4KMFA 4HVOA 3F8MA 2FMLA 4EV0A 1PUEE 1S7AA 2DI3A 1HW1A 4UVBA 1QZZA 2Q0OA 3RDIA 4XRFA 1SFXA 3I59B 5CVRA 2QBYB 3M70A 2H0VA 1TNSA 5JVTA 4HV5A 2PFWA 3L7WA 2BNMA 5ED4A 1LQ1A 4H7LA 3Q9SA 1XCVA 1FSEA 4B29A 3KGLA 3DXJF 2W85A 3HOTA 1BOAA 3ST7A 1P4XA 2CWEA 1H9GA 1CAUA 3RYPA 2H94A 1UFMA 5BY5A 5E1ZB 4KU7A 5L3GA 3QACA 4META 1BJAA 3TQNA 1BN5A 2JT1A 2O03A 5CYVA 1OFNA 4JTNA 3L00A 5L3EA 3GLXA 1XMKA 1IZ1A 3LOIA 3SQNA 2BBYA 1CAUB 3S2WA 4JVAA 2L54A 1LB2A 1HSTA 4M9ZA 1CX4A 1L3JA 4YYOA 3C18A 3IDCB 4HZFA 1ZX5A 5JR7B 4EGYA 5K1YA 5J7MA 2TDXA 2ESNA 3L09A 4ESFA 3HSEA 4YIFA 5ERIA 2BE5F 4LB6B 1UW8A 4ZU4A 4K8FA 1HKQA 3EUHA 1TQPA 2XL9A 5BMZA 5LGUA 3V8KA 1PDNC 2ESHA 3H8UA 4EGZA 3E3VA 3W6KB 5HDGA 3BJOA 1P4AA 4MGZE 3ERED 3EYYA 2EFOA 1I1SA 3JAMK 3CDHA 1IUYA 2VXZA 1Z6RA 2IT0A 3EDPA 3HHGA 4WX9A 3S7EA 3BU7A 1UHMA 1ZAOA 4IVNA 3BY6A 3VODA 3NRVA 2ACJA 3N97A 5KHHA 2C0ZA 4X6QB 2ET7A 4I01A 1P2FA 2Y0MA 2RVCA 3FMQA 5C6CA 2EA2A 4IEZA 4E2SA 4FBFA 4LGWA 4HLXA 2E9QA 4MHGA 1XDUA 4TV7A 4IERA 2V1UA 2GC0A 2Y75A 2IPQX 3E5UA 5EEHA 4MGKE 4L0ZB 1WWXA 3FF5A 5K5QA 3HSFA 1D5VA 3FHZA 1I1GA 1UIKA 2FNPA 1FC3A 3DPLC 1FX7A 1W4MA 3RKWA 3ZMUA 1FLIA 1R1VA 4ZU5A 5BS6A 4P9UA 1MJAA 1HBXG 1P92A 5FFZA 1RIOH 5LHHA 3GFLA 3J80K 4EJWA 2D2WA 1Z91A 3R4KA 2L02A 3W6JB 2E1CA 4AVBA 5ICEA 1WKMA 1DUXC 4ONUA 4J1XA 3PVBB 4AVCA 4XFHA 4EJUA 1E2XA 2XKPA 4UXAA 2G7HA 3V4GA 2K4BA 2BGCA 4E2QA 4IHSA 1U78A 3FZ3A 2HQRA 3AAFA 3GFJA 2WC2A 2VPVA 1CF7B 3LFKA 4F8AA 2H09A 2A68F 3I54A 4G94A 2GWRA 1K7AA 2FMYA 1J3PA 4ENMA 1UPIA 1ZH5A 2OYZA 4AVPA 4XF0A 5HDKA 4OIQF 3FXUA 3O2PE 5LHIA 4D0PA 1LJ9A 1V70A 1ZRFA 1IXSB 3MEXA 4L0YB 2J5OA 5LBQA 4EROA 1O3RA 2OD5A 2QVOA 1U5TA 3NKTA 4FAGA 1TBXA 4IEPA 2VC1A 3P9KA 4AIKA 5I0UA 4LMYA 4A6EA 2NAZA 5E1WA 1QBJA 2JSCA 2XAFA 3RPUA 3M3IA 1YLLA 4KWLA 1L0OC 2EA4A 4ESBA 1Y3TA 4GYGA 1U5TB 2IXHA 4MH0E 1U12A 3DL3A 3RKYA 2FXAA 2YX4A 1WSUA 2PQQA 2XHKA 1I6XA 3KP5A 3ML6A 4UVCA 2KIFA 2QNKA 1Y0UA 4HAMA 3CF6E 2Q0AA 4AQ2A 2N7GA 4L9NA 3SFZA 2BEOA 5KVRA 2IXJA 3Q9VA 1IXCA 2O8QA 2F5FA 1P4WA 3KZZA 4OU0A 4WVZA 1USTA 2Q8KA 4IRHA 1OYYA 3KLOA 4IEQA 1YIOA 1U2WA 1XGNA 1O3SA 4MZUA 5E16A 2Q1ZB 1H9TA 2OQRA 4QMAA 1B59A 5J6XA 2OZJA 4IEVA 4KL1A 2CYYA 1FYKA 3O6BB 2FU4A 1MGTA 5ICCA 2Z33A 3IC7A 1PMIA 2KIMA 2QZ8A 2HR3A 2ZNYA 4Y17A 3V8LA 1JHFA 3CLPA 3TDUC 5D8LB 1TLHB 5ILSA 2XVCA 3MQ0A 1EP0A 5DCMA 1O3QA 5LGNA 1XSVA 4A5MA 1U3EM 2A6EF 5DV5A 3PLQA 1XSXA 3ZDSA 1DPUA 1UIJA 3CJXA 4HN0A 2W25A 4RB0A 5FCCA 1IAWA 2B5HA 5A2QK 4CDGA 3BB6A 5LEKA 4D7SA 4E70A 1PP8F 1FP1D 1S3JA 2PJPA 5DCMB 2E1NA 1FXZA 3G7DA 3U9GA 5F6FA 2D40A 2Z69A 2WTEA 5CVJA 3D5LA 4LG0B 3VB2A 2IA2A 1HKTA 5E8GA 4O9EA 2A69F 3PNAA 1H0MA 3P9CA 4EJOA 4UVAA 4RB1A 1FBSA 3RI4A 2BNOA 2ZMEA 2FQPA 2DTRA 2GQQA 2CAVA 1F5TA 5JAXA 5HLIA 2PAMA 4OLLA 4M72A 4PGHA 2A07F 3T5XA 3GUDA 4XLPF 1R36A 5EZWA 3U1DA 3BWGA 2CAUA 2ZMEB 1ZN2A 4IHTA 4I98B 4A2UA
chains in the Genus database with same CATH superfamily
4BYYA 5KAFC 3ZFGB 5IP9J 4M74A 4DXZA 2DK5A 5GLVA 5JXIA 1WQ2A 1OCCH 2BOLA 5BNPC 2HVSA 5IVVA 5JZGB 1ETKA 2ATFA 4A0XA 3VBRC 2FUG2 2X10A 3CL1A 2X6OA 3PUFA 3ABTA 2LY2A 3AG4H 2WNUC 3K70D 2CO5A 3ZR8X 1RUJ1 2BDRA 4XFCA 2CY6A 5FWJA 2ZX3A 1Z7S2 2EB7A 4CGZA 2ZHMA 2NYXA 4L99A 1UKGA 4UUVA 1Q43A 3WDXA 2XLFA 1YYVA 1MR5A 3B02A 4FPKA 1WJFA 1GZCA 3TRSB 5FKKA 4YW6A 4UFHA 1K3IA 2GZWA 4C91A 3OB8A 3RFRA 2LNBA 4OUMA 2O7OA 4WZCA 1FATA 1YIPA 3MO4A 4XBQA 4FPEA 1DQ6A 3UJOA 5ICFA 5FXXA 5F3GA 1J2XA 4L0PA 2CU5A 3VHNA 3PUBA 3V0BA 4COYA 4HFSA 3SCHA 3KYDB 1D4M3 1QDOA 1IPJA 1MMSA 2QSHX 3GJAA 2RR11 1ZYBA 3IWFA 3G73A 1I3AA 3E97A 3G3ZA 1FZPB 3QBQA 4QXCA 1HIXA 5ILUA 4XMIA 1ZRCA 4WCGA 2CQNA 4D6SA 2KJCA 1HSJA 4CDXB 1LDKB 5H20A 1IN8A 3F8FA 4D7MA 3SH4A 2ZB9A 5A1LA 3H3ZA 1SDWA 2NP0A 4F55A 2KD7A 5C8CB 1FWZA 2UU8A 1FT9A 4M3EA 3CO2A 3F8CA 4Y5TA 3JRGA 3KZ4C 5K7FA 3KT7A 1U0AA 2NS8A 5A7WA 1GHCA 3ESWB 3RQ4A 1QJX3 3WE2A 4BQ2A 4YZ4A 4BXUA 2D43A 2ISYA 4AVAA 4ZS3A 1RETA 2Y48A 3RVHA 4EN0A 2GC1A 4MFEA 1MS8A 1A6QA 1NH3A 3V0AB 5FMOS 3LSEA 4S0HB 2EXIA 3ZFFA 4D3WA 4YGBA 1AR92 3I3BA 1GXPA 3T09A 3W58A 1TQMA 4FQ4A 3UV9A 4MG2A 5FYHA 4H4KC 2LMDA 2K46A 5J1XA 3HM5A 4MGQA 1TP4A 1WKYA 3R0AA 2F4LA 5FYTA 3PSIA 1R9TJ 3BDDA 2LY9A 1ZZ8A 2VZVA 1HW2A 5FZLA 3HUGB 4QB6A 4XHXA 2WZPP 2QCSB 5F2SA 1AHSA 4Q48A 1VQLI 5FK7A 2XWJB 3R6SA 2XG3A 4UAPA 4P14A 3PTYA 2VBXA 1YX3A 3SFIA 4MQVA 1R58A 1OR7C 2Y9YA 5IP7J 3MEPA 1DG6A 4L5IA 4AXOA 3AMQA 1MS3A 4HX4A 1G4DA 2RVAA 3WDWA 4IE7A 5EJCA 5J4VA 1XSQA 3NV4A 1LKNA 2GXAA 3KP6A 4KDPA 4CXWA 4XLFA 3K1NA 1CN1A 1KGSA 2P7CB 4XICA 1T8IA 2AREA 1ZELA 2IGOA 2AENA 2DPDA 4AIDA 1EUTA 3M8LA 2HBTA 3EBRA 1EAH3 3AFKA 5CQEA 3ZSEA 2VMGA 4B1LA 1PX3A 1BVP1 3P9IA 4N0BA 4UW3A 3CMMA 1UG2A 2W92A 1BI2A 4XFIA 5DDGA 1FY7A 2XQRA 4Q2FA 1DF0A 1J59A 2LF8A 1XYNA 2P4WA 2P3KA 4FFIA 5DUXA 1T2KA 1ZBE3 4OUEA 1PYVA 2JG9C 5CFDC 3CUQC 3HIFA 2XJVA 2O1QA 1TEIA 3TN93 4LJZF 5FPLA 1BI3A 4XJ9A 1RUC1 2D44A 3I3DA 2E34A 2F5EA 3FXKA 3HHHA 5LRRA 1PM7A 2DCZA 4KMUX 1PZ9A 3EJKA 2YX7A 2VBYA 5H6RA 1UY4A 4FP2A 1HCRA 5FZDA 1IG3A 4GJZA 2WLPA 1W6NA 1V9U3 1OLMA 2BVVA 2RS11 1Q1HA 3LNQA 4JK1X 4AEMA 1NOVA 4YRDA 1CAXA 2VNRA 5IHRA 4U0YA 3C7OA 3WCRA 4YG3A 1UZ0A 4DW6A 4UB8C 2XUBA 1QJY1 4M00A 1ZG3A 1KJLA 4I99C 1HB4A 4NN0A 3VZKA 1FMVA 1FTTA 2WUHA 3K7AJ 5LW9A 1LEDA 5CKTA 3PFYA 2X0LA 4KIGA 2VR4A 2VH9A 2L01A 5KWRA 2ID6A 5BNOC 4HF0A 1WI3A 3GXOA 1CJDA 4BLIA 1KDKA 2K86A 4RGSA 2E36A 2AQFA 3CZ6A 3ZXJA 3USUB 1RUC2 2MG4A 2C26A 5BPDA 1KU9A 1F4AA 2OW4A 5FYCA 1WJDA 3WODF 4BE1A 3K4KA 4IRIA 1JUSA 2Y6LA 3OOXA 2CNAA 4HNUA 5DAXA 1H9PA 2CSOA 4CP1A 3GTQJ 1E0EA 3BPVA 4JX6A 2UURA 2BW3B 1R082 1Z7UA 1PGSA 4WBBA 2F17A 3DCQA 1QJY2 4MXWB 1MKMA 1ENSA 5J98B 5H9PA 3ZQIA 3ZOBA 4IOCF 5DZGA 2YS9A 3UNGC 3MDPA 2ZJRF 2D1VA 2D98A 5A33A 1W7PA 5ABJC 3KZIC 2OZ6A 4NMIA 4UW6A 2AZ5A 2RJLA 2WS93 3AL6A 1HLVA 3K77A 1YI2I 3OGGA 2IGNA 3F8NA 3G4SI 1NCQC 1VQ4I 3HOVJ 2D6MA 3S6PA 4D9JA 4YZ3A 1IRXA 3JSPA 4CCNA 1WD3A 3W5MA 4PIYA 3I2DA 1UOFA 1A35A 4CDQB 3TP3A 3ZQGA 4UWDA 1SQ4A 1R71A 3THPA 1LOEA 5BNNC 3PIGA 1BJQA 2VI6A 4P5HA 4FAHA 4PCRA 5DYMA 3WP5A 4RAFA 4NBQA 2YV8A 4MQ9F 2G9WA 1S29A 3AVSA 4DXRA 1QPMA 2XJTA 4Q8LA 2HKXA 5FKLA 3WDVA 2B0LA 1WLCA 1VBB2 2IS2A 4KU8A 2RKHA 4P9GA 3ZYFA 3WOGA 1D1BA 3CC2I 2AH2A 4NB5A 3PU3A 3ASOH 3J81Z 5BV6A 3J7HA 4HBNA 1Z21A 4AM3A 1ZGWA 1W8HA 3OYHA 1T6GC 3BI3A 2D6KA 2Y34A 2IJLA 2CYFA 3C2BA 3U37A 1OF4A 3VBSB 1Y9QA 3UT0A 2M34A 1CX1A 1Q8OA 1LODA 2RR13 3FUQA 2A6TA 4KICA 2A5WA 4CEWC 3LQQA 2VQGA 2LOOA 2CL2A 2JJ6A 3ERMA 3OYGA 4R8HA 2WSVA 1Z9CA 2BW8A 4MSVA 4P9IA 2Q8EA 3L2HA 3H1CA 4DUVA 4XRMA 4FPYA 5C4WA 4E7JA 5FXZA 3C3VA 2PMUA 2CV6A 4LE3A 3KGZA 4KG8A 5EWSA 4BH9A 1RUD1 2WZR1 4HA8A 1K61A 4N8MA 2RNGA 3PHMA 3CJNA 2BRTA 3HQXA 4A6DA 1WZXA 3OCPA 3O1VA 2STWA 4IEXA 2LP0A 4QQHA 4QPGA 4R79A 4C1XA 1XQNA 2RM21 3D0SA 5D8AB 4UFMA 1CAVA 1JHNA 5F32A 5FP4A 2KKOA 1IQDC 5FYBA 4WXHA 1ODMA 2ZZQA 2WYFA 3WHUA 2DA5A 1MZFA 4ZXEA 2YU9J 4BBSJ 4MGRA 2J1UA 4TZDA 3KYCB 2A6ZA 1OSGA 4J19A 5A32B 3ZN0A 4Y22A 3VDCA 4QDQA 3Q8CA 1S2BA 4AFDA 5HS7A 3FFZA 2L9SA 3ZPYA 4A45A 2EINH 2L7ZA 3FM5A 2HXIA 4E2GA 2V09A 2ZGRA 3F6OA 2E1MB 2BVMA 2W84A 4GYIA 1R64A 1O3TA 1VNDA 4BPZA 1VBC1 4Q26A 3O1PA 4YG2F 4ZYHA 1DZTA 5FDBA 1AR61 1JHJA 2QKDA 1ZTRA 5J96B 3TOJA 2QKLB 1RUD2 3CD6I 2GH2A 3KEOA 2LBFB 1YI7A 5FYIA 2X48A 4XOTA 3RKXA 1NK3P 3AFHA 2UWCA 3O3KA 2XLGA 2MPFA 1O4TA 4UFJA 4LR4A 4Y15A 1BC7C 3CF5F 1XCBA 5IT3A 5FJ8J 2Y6FA 4YFKF 1MDMB 4ASMB 3OJBA 1K4TA 4KT6A 4FOYA 3DECA 1SACA 3T08A 5T55A 3IKWA 3BN6A 3B01A 3SKVA 2DOAA 3RZZA 1JZ7A 5JSOA 4RAGA 2XHNA 2ZAHA 3O0WA 4XJUA 3O1MA 3DP7A 2SLIA 3BR3A 2XASA 2XJPA 5A3PA 1ETQA 4CP9B 5F8PA 3NNJA 5IP6A 1N1VA 1F4KA 2PN6A 4ABZA 1VBC2 4PJLA 4EVIA 5JR3A 1RGSA 2MD0A 1AR62 4BOWA 2A3XA 3P5BA 4H3WA 3WGGA 4RQPA 5CU1A 3J80Z 3I3MA 4BL0B 4CYCA 4UFIA 2CDOA 1RUC3 2M45A 1GV2A 1IUFA 2BYVE 2ZMEC 3WU0A 4BLJA 5A7WB 4RGUA 3A7QA 3ZFGC 1QGPA 5FUNA 2Z16A 4Y1YA 4L92A 3I56I 1JGGA 2RS13 1S0IA 1AXKA 1R083 4HT1T 3WT3A 1QJY3 3HJEA 1AA7A 3CMAI 1CAWA 2L3DA 2DU9A 3ZFFB 4EM0B 4LLNA 2H8RA 2GAUA 2X85A 2BOIA 3H7JA 1W28A 5DM6F 5LBEA 4EJTA 2IXIA 2WDBA 3D4KA 2VJJA 4XONA 2R0QC 2QQ9A 4NJ4A 1O5UA 4QQOA 2L5QA 1MH3A 3WP6A 2ZX0A 1HJFA 5F39A 2UXXA 3WHCA 2A6WA 4Z2WA 5CG8A 5GAEJ 1J1LA 1AZDA 2PHFA 1KU2A 2D1HA 2RAEA 1VAKA 5M3FJ 2VMIA 1U9OA 4HL0A 4DY3A 1R1TA 2DPUA 2EXJA 2DW4A 1SD6A 2DVBA 4BIFA 2QQOA 3ONQA 5EHDA 5LCWL 1OLRA 4CUBA 3OSDA 2GA2A 5J47A 4ZTJA 1QZYA 1ZA7A 5AVPA 1VBB3 2STTA 2J42A 4BXSV 2F4OB 3K0LA 2DVGA 3GXUA 1CZSA 2WV1A 3BTIA 2VXRA 2OA2A 3FUOA 3VBUC 2PBIA 4CDXC 4C90A 1ACIA 1I5PA 4II2A 5J8FA 1ONAA 4PFPA 1NTCA 2WT1A 2XH6A 1WPKA 5JVVA 1ENHA 3H5AA 5BNGA 5D6FA 2YBKA 5C9AB 2H0BA 1AR71 5JI7A 4G6TB 1LOGA 4LFUA 4BQXA 2QENA 1WHUA 1RMU1 4AIHA 2HZTA 3HN1A 4GO1A 4EM1A 1R49A 1B8IB 1WWYA 5DD4A 3PURA 5JR2A 3SJMA 1LHUA 2A05A 2EXHA 2RDSA 3WTZA 2M9HA 4AHWA 1T6SA 2VJ5A 2B4KA 2HBUA 4KN7X 2ZXJA 2DDUA 1C5HA 2HZDA 3BTXA 1W36C 4KIBA 1RTVA 5B4XA 3TEZA 4XIDA 4AGRA 2HWC2 2X5IC 1W8OA 1WH5A 1YFWA 1F2NA 3NEUA 1K78B 4XRSG 2A75A 3OG2A 1COV1 1W6NB 5AIPA 3WNNA 4XLCA 2DTYA 5B1BH 4E4ZA 1R5HA 5B5EC 4D6RA 1WH7A 2M87A 5C70A 2VO5A 4JZRA 3OTFA 3OOPA 4QM8A 2FBKA 3U10A 2PHTA 3FK6A 3VN4A 3H0OA 2IXKA 2R7QA 1TNTA 2WB1N 5C8WA 1MBKA 3KEQA 4OMCA 3I7DA 4EJVA 4BHPA 1W5SA 1AR72 2VONA 5A7QA 3QD6A 1IPKA 3QP6A 2B8MA 1XNKA 3I55I 1AL0G 2F4PA 2O6GE 5D4RA 1FOKA 4PF1A 2R7DA 1CF7A 1EH6A 2YGMA 5FR3A 1VBE2 3A0NA 4CCDA 4ZYEA 1UAAA 2CGOA 2GN3A 1H8VA 1IHMA 5J48A 2KRFA 2NVXJ 5FBZA 1HOMA 3OYKA 1MZ6A 1EJ9A 2G9ZA 1RUE1 1Y56A 2EIBA 3VHPA 1XRUA 2BP6A 3DYOA 1JW6A 1N1SA 3ES1A 4AG4A 3AL5A 3AL0B 1VALA 1RUD3 1VQOI 3CCMI 1E5SA 2JIGA 3H1YA 4DZJA 1V6LA 3NKGA 4ZONA 3ABZA 5DMYA 3KETA 2V4VA 2RM23 4D7YA 2CW0F 1GQGA 1VQMI 2K27A 2R7FA 1M06G 3T1LA 1FI2A 1L3LA 3MLLA 1PK6B 1N1TA 2PA7A 2ZTNA 2FD5A 4IRGA 1PZ8A 3QQAA 4FT8A 4DUWA 1YHFA 4ZZLA 3PJRA 3S30A 5A33B 2GMMA 2TEPA 4M4RA 1YRNA 2YPJA 3RSNA 3HN3A 3J9SA 5F9TA 1YNAA 4FO9A 3L2CA 4UT5A 2VCMA 3AYCA 4OIOF 3T1BA 1YJNI 2DXIA 4L9JA 3GALA 1MNDA 4QXKA 1X50A 2DA6A 4PDWA 4ZU7A 1XMXA 4GKYA 2G7UA 1IDYA 5DAWA 1VBC3 3HNYM 4KQ7A 2B39A 2NNYA 4H55A 1ZLJA 4X0GA 1AR63 1VB2A 4QLCU 4WV8A 4BBRJ 1B72B 2V73A 1MNEA 4DGWB 3WQ7A 3W6VA 2E5NA 4PSWA 1O57A 3H35A 2YU1A 5FO5A 2K2SA 4QGLA 3FBYA 4QIWN 2QSFX 4RGRA 4ARYA 2IRFG 5D1IA 4GGGA 4INDA 5JXGA 5J8CA 3VZMA 3EQEA 1YX5A 2ZHLA 2JRTA 2NS7A 4EQQA 1XX5A 3ULQB 3M9AA 3CCQI 4GMP1 3AP7A 2ISZA 2ZMLA 3DU5A 3SDBA 2ZBKA 2ZJPF 4JKMA 4DYQA 1IF1A 1JXSA 2PAEA 2DMQA 1YC61 4A0ZA 1D1CA 4WXCA 3HDDA 5GLZA 3MFCA 2XIGA 3MF9A 5GJ6A 1YW8A 4UYBA 3GBFA 4C3IJ 3FXQA 1J7KA 4XMYA 5E20A 1OD5A 4U2AA 5FFOC 1ZZCA 1ZG1A 4LEJA 1LE8B 1BW5A 3RNSA 1ONVA 3ZYJB 2KR2A 2HOTA 4HSJA 3MV11 1K5MA 3KZYA 1MMDA 2YC2A 4CDQC 4CXYA 5AFEA 2PEXA 3HD8B 5CJ9A 1IV6A 1PGL1 3PFIA 2TNFA 1PUFA 2WNVB 5F3IA 5FZEA 5LY2A 4QPQA 1AWCA 5JSRA 3GWZA 2G9FA 2ZCWA 4Y7NJ 3CO7C 2M8EA 3QAHA 2HOSA 2JG8A 3CQZJ 1D0GA 1ZVFA 2ZNZA 1EPZA 5FLXK 4HLYA 3ECHA 3OYJA 2PHDA 2G0EA 4TSVA 1TZOA 1YQ8A 2VZ1A 2EF6A 2DMPA 3HSRA 4OHVA 3OS1A 4LA2A 3T1MA 4J01A 3LSRA 1G8XA 3JRFA 2JA7J 5D4SA 3AK0A 1GP4A 1K6YA 1PIV1 4IHXA 3I64A 1NZCA 2HWC3 3OWTA 3REOA 1T95A 4HOOA 4XL9A 1BM9A 1X58A 4LD5A 1JJ6C 4W50A 1PGL2 5GP9A 1AJKA 1JYCA 1VQ9I 2GM4A 4WXDA 1OYIA 1MBJA 2IVIB 3MPBA 4N90A 1QXJA 2DYSH 3SLIA 5CZKA 1W5TA 2R7TA 3DEUA 1WCMJ 5DG2A 3D82A 1P7IA 3CCUI 3CCSI 5E8IA 5GADJ 2ET1A 3W20A 1MZBA 4NQWB 2ORZA 4NRPA 2NN8A 1AR73 3DLLF 3HGYA 1D2QA 2RE9A 5K7PA 2J5PA 1JKPC 4XAAA 3I53A 3M1EA 3HQUA 4AR2A 3M1CA 1R1UA 1VBE3 4LULA 4CPBD 4R9AA 4M3GA 2RV8A 3CNAA 4HVOA 4RGGA 4M0NA 1FPN1 1QQP1 1PUEE 2KRHA 2WNEA 3ZN6A 5IFTA 4YVWB 3FK7A 4XRFA 3RDIA 1PIV2 2R7RA 3HPHA 5CVRA 4EZ4A 5FKNA 3U21A 4P9XA 4QX1A 1RR8C 1BMV1 4BJTA 3IV5A 2Y0IA 1O4ZA 2DTWA 4AVSA 5IVCA 4H7LA 2DMUA 1FSEA 5A7NA 4B29A 3DXJF 2W85A 4IOAF 4AQSA 2E1MC 5IVFA 1P4XA 2DVFA 2H94A 2PLV2 3ZMNA 3Q0UA 3KD4A 4META 4K6BA 5IK5A 4FCYA 2WINB 5CYVA 1IS6A 4YGEA 3S3NA 1CWPA 1F35A 3AMPA 3ATGA 1C5IA 2YC0A 1IZ1A 3OY8A 2Y9ZA 4FOWA 1DU6A 2L54A 2JG8C 1CX4A 5B3SH 2W82A 4OAZA 4PF5A 5JR7B 4EGYA 1SVLA 5FKCA 4A3MJ 4WVMB 5J7MA 1FPN2 3HOZJ 3VD4A 2TDXA 2ESNA 3HSEA 3A21A 4YIFA 2VW0A 4M3CA 2BE5F 4A3JJ 2HDDA 3L2RA 3H5NA 1RUE3 3NWSA 5BMZA 1V5FA 1YJWI 2E6VA 2H1LA 1BMV2 3AXDA 4CCKA 5FJHA 3MW4A 2L2OA 5HDGA 3AVRA 3VBHB 1P4AA 4MGZE 3OYIA 4N53A 2JD4A 4B1MA 3INAA 2KDZA 1ENRA 4WX9A 2I10A 4KH9A 3MMYB 5DAVA 4Y52J 2WKKA 2LG4A 1JTZX 1U8BA 3T0DA 4X6QB 4C8DA 4NUBA 2ZZJA 2WR9A 2Y0MA 4PBPA 2VZ3A 4IEZA 4E2SA 4FBFA 4HLXA 1HF0A 3LFMA 3CHXA 2XVGA 4MHGA 4CCMA 2VMFA 3HL2A 5FBJA 2K9SA 2DUPA 2J1TA 4AEDA 2RV9A 1I3HA 4BQWA 2UWBA 5EEHA 1NG6A 4L0ZB 2M4GA 4PLNA 2FNPA 3DPLC 1HQWA 4JX0A 2VZSA 5E3OA 1LU2A 2M0MA 3ZMUA 5BS6A 2VQTA 1WVRA 5FZMA 3MGUA 4COZA 4EN9B 2FDGA 2J1VA 4GXLA 5LHHA 1QHHD 3R4UA 3OR2C 4NHLA 1QHGA 3W6JB 2E1CA 2L9VA 3BOPA 2YHJA 4FVVA 1WKMA 3J7YJ 1UY3A 1GR3A 3QH7A 2R92J 1W8WA 5LWBA 1X9TA 3IAQA 3UR3C 1LGNA 1VAMA 1WJBA 4AVCA 4XFHA 4UXAA 2G7HA 3LF7A 3KLSA 1BR2A 2BGCA 3K4LA 4GMP3 2IUWA 1KDMA 2HQRA 4Y5SA 3AAFA 1OQDA 2WC2A 2VPVA 4LO6B 1FV2A 1UZYA 1CF7B 3LFKA 2V9KA 4B4RA 4H2AA 1W6PA 1K7AA 2FMYA 2QQPA 2R071 3KCXA 1J3PA 2HPIA 5IAXA 1W0UA 4OIQF 3FXUA 5ANQA 1J83A 2VOTA 4D0PA 4NIAA 4ES8A 1ZRFA 4HG6B 4L0YB 5LBQA 5M3MJ 1IDZA 1O3RA 1DQUA 2QVOA 1U5TA 2JDKA 5EJ3A 4LIUA 2WY8Q 3BKZA 2GNMA 2VC1A 5I0UA 5C9AC 3C7GA 3WHTA 1QBJA 1OKOA 5EDNA 2DDBA 3ZXEA 3M3IA 5HXMA 1YLLA 3I2IA 2EA4A 1C4RA 4ESBA 1Y3TA 2M4KA 4GYGA 2IXHA 5GAHJ 1W8UA 3I3LA 1BBT1 3T30A 1WLWA 3RKYA 5H9SA 2YX4A 3KP5A 4UVCA 2KIFA 2QNKA 2OVUA 1S0BA 3IH2A 3MV01 4QB2A 3Q9VA 4ANJA 5C4JJ 4WVZA 1OYYA 3KLOA 5FYYA 2VMHA 3TYJA 4MO3M 3CCVI 5KC5A 1U2WA 4MZUA 2Q1ZB 2P3JA 5FXVA 3OGSA 5J6XA 2OZJA 4AEDC 5T5LA 1SLTA 1D2SA 5D8LB 3D5OA 5FY0A 1K4SA 1Y0NA 3MQ0A 1PIV3 2NYYA 3V42A 3DPUA 1S5LC 2GSYA 4BDZA 3VYUB 4DEQA 1VB4A 3VYRB 4QPYA 2BFUS 1UIJA 4HN0A 1IG0A 4HK8A 4RB0A 4JGYB 4B3NA 1IAWA 1BBT2 5A2QK 4CDGA 5FZ6A 3ZXFA 1LOBA 1D0YA 2GBYA 2E1NA 1FXZA 1AKHB 5IVBA 2WTEA 3AFGA 3ZGKA 1JZ5A 2KL4A 4XTPA 3T2PA 2JDUA 3P9CA 2IFWA 4UVAA 3B93A 3AL0C 2DFCA 2GQQA 2CRGA 1GV9A 1WW7A 2OUJA 5A70A 2QFEA 1H89C 4YIRX 5IVYA 1OPOA 1W3XA 4GB31 4OLLA 4B43A 4N4OB 4PGHA 2A07F 3T5XA 3PUQA 1R36A 3U1DA 3K2OA 3L2UA 2W91A 1FPN3 1QQP3 1BXHA 5FO9B 2TRTA 5IYBJ 2E32A 4I0WB 4R9DA 3RGBA 5GZGA 5FD5A 4FQGA 1IRFA 4MNUA 3PIPF 2Y26A 5LA0A 3F95A 4NOTA 4BEHA 4CUGA 1U5TC 5HS8A 4S2GA 2UV1A 3CCRI 1K5MB 3I4IA 3VDBA 1B1BA 1RJ7A 1BYHA 4A3KJ 3MYXA 3SZTA 1F9NA 5BPXA 4C2TA 3GCXA 4G9YA 2HWF1 1LEAA 2VTXA 3B9CA 3M07A 4PJYA 1W06A 1KYWA 1SFUA 3H9GA 3SHFA 2LROA 5FOBB 2OQ7A 4TLFA 2OPTA 2MFZA 5L36A 4BE2A 4LNVA 3MBWA 2DQLA 4DNCA 5FZOA 2WJSA 3WDYA 3W2AA 1CQTA 4H7MA 3KP4A 3ZO0B 3DTKA 3KMHA 2PELA 4GB32 3PM1A 2BV6A 2DN0A 5HI0A 3QYEA 5HDNA 1I5ZA 4TYSA 4ORFA 2W1QA 3ZSLA 3U14A 1UQXA 3HRTA 5LA2A 1WW4A 2YXSA 5FIXA 2WFPA 1JHHA 4LBMA 1IS3A 1DGWA 4W97A 4ZDPA 1NCRB 1UOJA 1WCUA 3OIOA 5C3OA 4RGKA 3NV1A 2MH2A 3U0ZA 1UJ8A 1IS5A 5IT9K 3PDQA 3R61A 2R0FA 2VZTA 2F4IA 1WGPA 3VBFB 3W2VA 3LAGA 2RDRA 4EEFG 1OOPA 2XGDA 1ND3B 4AI1A 4C0BA 1ULGA 2VQAA 1D7PM 5LEJA 3BROA 1QXRA 2VKEA 4XLEA 1O4YA 2HWE2 4YRVA 3KYLA 1JOBA 4QPOA 2G1MA 5I8SA 1R4MB 4L18B 5A6XA 3I3EA 2PJRB 4NRMA 4QWQA 5D2AA 4M3DA 4D1QA 3O7OA 2FSWA 4JGZA 4YARA 1T33A 2DYCA 3NSTA 4DYCA 4DB5A 3S1NJ 2HS5A 1IRGA 1OQEA 4GWNA 1UZWA 3UK9A 1RL3A 2XGCA 3KCCA 1D5YA 5I0SA 2OA4A 2Z3YA 3JW4A 1TL8A 1KQ0A 1QJZA 2VCBA 1SMVA 3BZCA 3DEMA 4M6YA 4Z2YA 2FNAA 3D8CA 1R4NB 3L2QA 3D3AA 1SEFA 3VWBA 3QU3A 4N9HA 2YY1A 3BOQA 2VC0A 2JSPA 2BVLA 5FMOL 3FL7A 2IA1A 3PL0A 1JYWA 4JQFA 3ELNA 3S3OA 5A3WA 4CPBA 2WADA 5FPXA 2JDNA 2EFNA 3WCSA 3OS0A 1AOYA 2ZGNA 4XZUG 4NRQA 1MBEA 2JDZA 3VDDB 3F21A 1DHKB 1MD0A 1H1IA 4KWJA 3NQOA 1V6IA 3QU6A 1QH6A 4XMAA 4FTSA 2MC4A 4X6AJ 3UETA 2XPJA 3FZVA 4K2EA 1X82A 1A36A 2VOXA 2A61A 3V7SA 4JV4A 2LKPA 4QPIA 3EETA 4P55A 3QP5A 5C44J 1QHDA 3ZIXA 2IS1A 3WVJA 3CCJI 4BK5A 3VPRA 5FZ1A 1FTZA 4G7HF 4TTGA 1OPMA 2X9DA 3OS2A 1W05A 1A31A 1K83J 4LBLA 4MGSA 2VN2A 4GFBA 4XKWA 3F8BA 2LFBA 2JA2A 4IPAA 4KG0A 4Q0QA 4NC8A 2TCTA 3ZQLA 3H5RA 2VECA 3LPFA 1T39A 3UESA 4IQ4A 5FMDA 4N9IA 2EZIA 3OSFA 2D6NA 3MVPA 2JA6J 3OYWB 3DXUA 2W4SA 1W2NA 3NAPB 2VXDA 3I97A 2CUZA 3EO6A 5FLJA 1N3PA 2FD8A 3WSOA 4NHMA 1BBT3 3WE3A 1RHI1 2GXBA 4YPJA 3GTOJ 1V00A 1D1AA 5D5UB 4E7LA 1QNWA 3AKTA 3Q0VA 3DKWA 3DV8A 1UKRA 4BQQA 2Q8DA 4O5VA 5FZBA 3SITA 2WWYA 3TO7A 1LR5A 2P6TA 1S72I 3OEBA 2OV7A 1PVXA 4CDUA 3H8RA 1REFA 1QKQA 1ZHFA 1VQ8I 2IC1A 2I5UA 1IS4A 4HX7A 3DBLB 1ZG5A 3WTWC 3U78A 5CB7A 2V1XA 4PJNA 3AMNA 2EFPA 4QKDA 4JQRA 3DFGA 4BJ5C 1XC5A 4IV1B 4NWWA 2Q4SA 4A7YA 2FBIA 3KEYA 5EP9A 3VB9A 1BHGA 1VI0A 1OLQA 3T3YA 4NNJA 5H9QA 1OURA 2BV4A 4ZH4F 2XGXA 2BTVC 2DCEA 3DGTA 2NVQJ 1RHI2 3S0MA 3SHRA 5AONA 1IGOA 2XVKA 4ZY9A 4UNOA 4NIDA 3IM0A 4CDWB 5T5OA 4PDKA 1Z78A 5JHFA 3D6EA 4URAA 3FKJA 2Y6KA 5FQ0B 3FXJA 2KJBA 1JGSA 4U36A 4PJJA 1O8PA 3MIDA 1ULYA 4HPKA 3N9MA 3CC7I 3ZQ7A 5E18F 2RNJA 5CADA 3QWLA 4XF9A 4IESA 1H2LA 4GB33 4LO7A 2ZHKA 1VLNA 1J75A 4AWDA 2W95A 2W46A 1JU4A 1XNAA 2Y0OA 4IUGA 1LDJA 2EIDA 3MW3A 4OWRB 5J40A 3OSGA 4K7JA 5CPRB 1OLME 2FBHA 4B3XA 2RDPA 2E51A 1ZBA1 1FPQA 1KFUL 3U4XA 2R5ZB 4PIZA 3THCA 3BT9A 1HQLA 4IEUA 1QIQA 1SCSA 4KA4A 3BCWA 4E4HA 2D5VA 3PUAA 4HN1A 1JBCA 1MQTA 2YSRA 1WCDJ 2J1RA 1EV11 1FV3A 3DPRC 1RUOA 2Y8KA 4U88A 2BGPA 3MCZA 4ENNA 1MJBA 3IAM2 1ZZ6A 1UZZA 2YR2A 3GCMA 1ASJ1 4EZHA 4AHYA 2LREA 4QQLA 2RS51 5FY7A 2Q2EB 2WFF1 3KV4A 3HPNA 5IFPA 4HANA 3SMHA 3GVAA 1BI1A 1U5ZA 2JRMA 4NC7A 1W90A 1JOJA 2GOXB 3NJZA 3K48A 4IL7A 1OCPA 4QDSA 4D5FA 3O0VA 1UX6A 3ORJA 5CVIA 4XCAA 4BMBA 4GXOA 5E1XA 2DK8A 1Y4WA 1D3YA 3N9NA 4PSXA 4LBQD 4XDPA 5FGMA 1ZBA2 2HDWA 1LESA 2QQVA 1QY4A 2VTXJ 1ZGJA 4YGCA 5BNQA 2DA7A 1SPPB 5CLSA 3T8RA 3W2WA 1QU3A 2ZXQA 3ETPA 3GTMJ 4GWIA 5F1RA 4PLOA 4IX7A 1HV0A 3WTTC 4KWUA 1UG0A 1EV12 1KFXL 4Z07A 2MA3A 1ZZBA 4RD7A 2DA4A 3HZJA 1TME1 3T8TA 2ZGUA 2JQ7A 4C3HJ 3WTVC 2W1OA 4FOQA 1HXS1 3LIHA 2KZVA 2K40A 5AC91 1Y39A 2W47A 2FX0A 2I2SA 3LQCA 2SBAA 2IW5A 1YFUA 2Y6HA 4B8XA 5M5WJ 4Q5OA 1H8TA 4RR3B 3OD4A 2GDFA 3B3QE 4LA3A 3OUIA 3ELKA 5JFRA 5GZCA 1FP2A 3R4SA 5IATA 4CCCA 3NO8A 3H36A 2JXAA 4BJ0A 4FPFA 5LZ6A 2Y0SA 1WA4A 3DUIA 4DJAA 3OGJA 4QGMA 4XF3A 1RNLA 2O3FA 3OR1C 3K10A 4YFNF 4IL6C 2VMEA 1SFKA 3GFMA 2L7KA 2D93A 2HKOA 2W1UA 4ENJA 2E19A 2D3SA 3H42B 3S93A 1X7NA 4A3GJ 1LULA 1W9FA 1YFHA 4Y5Z0 5IAVA 4XDQA 1WD4A 5KK1A 1HXS2 3M2MA 2DLLA 5AC92 1DYKA 2A3YA 3UGHA 3PIOF 1IC8A 2E60A 3AP5A 2XB5A 1AF9A 2MGQA 2P2KA 3MF6A 3WG9A 2R7OA 4IE0A 2Q8CA 2OUMA 2KQRA 2JECA 2P1BA 2IGKA 3ZDVA 4R52A 3KV5A 2LY1A 1OVPA 1SG3A 1J3RA 3RYKA 4XUQA 3C8XA 3ZYHA 5FZOB 3RS6A 4LTAA 4M3BA 1ON1A 1LU1A 4LE4A 3WNKA 5FP8A 3A22A 3RWKX 4J1WA 1J58A 2QM3A 5LK5A 4JGYC 1USSA 3NJXA 1FIPA 3O1SA 4WM7A 2P8TA 3K4CA 1SFPA 5CFCB 5L3CA 3K4NA 5AIQA 4BHBA 3AKPA 3M3YJ 3NARA 4KT5C 3HOXJ 4D7NA 4MHRA 2WA4A 2L9RA 4W1UA 3DN7A 3CJIA 3OYLA 4O3MA 3IBMA 2RQQA 4WM8B 4NVPA 1F36A 1PO21 3K2AA 3H0GJ 2Y2ZA 3Q0WA 1B35B 3WUCA 1X9PA 1HN0A 3SCGA 1RHI3 4LLOA 2HDCA 4II3A 1EV7A 1HX6A 3WW1A 3JR9A 3UJQA 2V26A 3D1NI 4XFGA 3W9AA 1W03A 4A41A 2W2IA 4OULA 4XACA 3A1YA 2EJRA 1N3OA 5FKOA 2JE7A 4CEYB 4P96A 1GNYA 4ZDOA 1RUG2 2E7XA 3AYAA 4JDNA 3AC0A 1UO9A 2Z99A 3DEWA 3LL7A 1S55A 1O7LA 3AZXA 5K5OA 1O6UA 3BG6A 5KHKA 2P5KA 1WMEA 3R05A 4XW3A 3HT2A 3HGGA 1FNZA 5FLVA 3VL9A 2DYRH 3UKGA 3ZYIB 4BQOA 4P9YA 5KXEA 5EGOB 1CZVA 2EZHA 1GZWB 2DCTA 1UU4A 3EPZA 1QRYA 1PO22 2B7EA 4A44A 1Q8VA 2H27A 3GF2A 1VF9A 4XBNA 1SFEA 3BTCA 2C9AA 5E17F 4JHTA 4IHYA 3OYFA 3KCYA 3H1WA 4ASNA 3IDAA 1GOFA 1IN6A 4YM3A 5IK4A 3VZNA 2ME0A 1NCRC 1H0BA 2XSJC 3BG3A 2XF6A 1R7JA 3GZEA 1D4M1 3KP2A 1HQNA 3H1MA 4AGVA 3BU0A 5L7OA 2O0YA 3PMEA 2E63A 1S7OA 4ITCA 3J8F1 3VBFC 5KXDA 1MS4A 4BE0A 3DKYA 3TDZC 1KQRA 2HEWF 1IN7A 1ND3C 3JRCA 2DQRA 1LTEA 1W6OB 1ZA4A 3BR1A 1I9RA 2KT0A 1TNRA 2DAOA 1WW6A 4MTEA 1QVTA 1DGRM 1ZBA3 2DT7B 2IS6A 2B42B 3IH4A 4UOJA 1PVC2 3FMSA 1V5GA 3DLAA 3MIGA 1QJX1 1UY0A 5FPZA 5A6ZA 4FFGA 2E53A 1FBUA 2LYCA 1EV13 2WLQA 2BQPA 3CJIC 1WUVA 3V65A 1T0FA 3FXMA 4AOCA 3KB5A 1B4AA 5LY1A 3JB8A 3F6VA 2RS53 2Y31A 3UKTA 3HTSB 3WQ1A 3QOPA 1W6QB 2F5VA 1WLDA 2V6CA 1HB1A 1QNYA 5JWPA 3IHUA 1EUUA 4G8XA 3HQRA 2E31A 1FOYA 4Y4RA 4KNCA 4FQZA 1YQCA 3IRRA 2XWBB 3J8F2 5TGTA 2GIVA 5CKQA 1US2A 3POBA 4JTOA 1E5RA 2FQ4A 3O5SA 3WDTA 4G3YC 3SISA 2ZA9A 3LSKA 3LDRA 3OPZA 1W7PD 3RJRA 4Q0SA 1KS5A 3WDUA 3IIAA 1STZA 3SEZA 3M3EA 3H3UA 2NPIA 2ZKLA 5GALA 1ZARA 3MIBA 2ADDA 1UOBA 3VDDC 4FPCA 3AMMA 3HBZA 3FC0A 4GKXA 5A7OA 1MJ9A 3O8HA 3LPGA 3DBRB 2C4XA 1WI9A 1Q5OA 4AHZA 3AXEA 4HV6A 4CO8A 2OQ6A 5A1FA 3C2UA 5FXWA 3PUIA 3U75A 4HF2A 5F3EA 1Z0XA 1GUIA 1HQCA 5A7SA 1HXS3 5AC93 2QTWB 3IAPA 3SXYA 2QA4I 4IV3A 3ABKH 3D5SC 1T56A 4CE8A 5HNHA 4OMDA 1VBD2 3P6BA 3RZJA 5FZ8A 4RS8A 3FWEA 3OEAA 2VZPA 4DIQA 2YYOA 4XLHA 4KYWA 2M7BA 2W24A 1ZR4A 5BNPA 2DA2A 1ZLKA 2QWWA 3VBRA 2X8KA 1JJ8C 4QKNA 2OU2A 4IJAA 3NAPC 2FF4A 1E5HA 1DLCA 1Q56A 3V8JA 4AUXA 2AS5F 2QVSB 4I6ZA 4IEYA 1LOFC 2OCCH 4CUCA 1NLRA 3LFIA 1EH7A 2HTSA 1S2KA 1O4XA 5HODA 1V5EA 2K9QA 1KS4A 5BYNA 3RZMA 1OA3A 4XJWA 2W3JA 2VCCA 4M3FA 2MABA 1IGNA 2ENRA 3OYEA 3BLYA 2MC3A 3RQIA 4NDLA 3G2BA 1W0OA 5J1UA 1RUF2 3ZFEA 1MBHA 1D0HA 5KR7A 3IPVB 1OA2A 4Q4X1 4Y1VA 4HNVA 4IQJA 5FAXA 5D5WB 3WXPA 2WO1A 1ULOA 4O65A 2YC4A 4I7HA 4UHTA 2YFUA 2V5YA 2VBWA 1J84A 3GW2A 3K46A 1T08B 4W6XA 4QKBA 3A01B 4N43B 4IV1C 2RREA 1NKGA 2XJUA 5IPAA 2Q5TA 4O6JA 1RUG3 4LJHA 5HCAA 1FMD1 2NS0A 4C30A 5B4NA 1R00A 4ZPIA 5IVJA 3BR5A 1VQ7I 4FPHA 2WWJA 3LOCA 4QB1A 2BXZA 3HRUA 3PTRB 3S5AA 4U0VA 2F2EA 3CF2A 4RS5A 4UF0A 4CDWC 5FO8B 1BC8C 2AGSA 5EYXA 2XBO1 4AWXB 5K8SA 3AKRA 3TP0A 1Z7S1 4HSRA 4U7DA 4BUPA 2MYSA 3ES4A 1AJOA 1SD7A 4Q4X2 1GSLA 3WUDA 4A3FJ 4LKSA 2HWVA 2PLYA 2XAJA 1PO23 2RMU1 3N9QA 1OVSA 2J7MA 3J7AO 2ZSHB 5A3LA 4UUSB 4AI3A 4FISA 4LBQA 2PN5A 1OUXA 2FDHA 3EHKA 4AFCA 2K9LA 3A0HC 4KGQA 2VOOA 1RUI1 1ST8A 1SMYF 5D8KB 5HNFA 2HFHA 3WTSC 2A5YB 3MWMA 4Q47A 1I39A 1RXFA 1WRJA 2LD5A 2R5YA 1FMD2 1UF2C 2QDNA 2P0WA 2ZXIA 4ZDLA 2JE9A 2GA1A 5FWEA 1KRIA 4YG0A 3CUOA 2JDYA 1KU7A 1OR7A 4EN7B 2XBO2 4AL9A 3SYTA 5H6QA 3HOSA 2XR4A 3B00A 3NV3A 2EILH 2JDMA 1Z1DA 3LWFA 1OBNA 3KE2A 3ZQHA 1CPNA 2W1SA 2PG4A 1DIWA 2OPWA 2VMDA 2PAKA 2RMU2 4RGXA 4U0WA 4XQDA 2E5ZA 4RA0A 4JOMA 3PU8A 1FIAA 2EICA 1W36D 4KNYA 6PAXA 5KCMA 2QE3A 4XQFA 3GHNA 3O14A 4YWAA 2Q30A 2LDUA 3ZFEC 2FDIA 2FE3A 4ARXA 1RUI2 2PHRA 4I0AA 2VBBA 3N36A 4NHXA 3QPLA 2K9MA 5TISC 2ERFA 4JX4A 1EYBA 1AR81 1OQ1A 1AR91 3BTYA 2LF7A 1GUUA 4I02A 2PTMA 4WVWA 1KGYA 3BP8A 2LSOA 2W57A 4V2FA 1ZK8A 2JG9A 5CFDA 3J8F3 3CUQA 2I45A 3O12A 3RWNA 4E4SA 4V2VA 3CDLA 3BTLA 3JTGA 5HBAA 4WM7B 2O0OA 2FCUA 4GULA 2JIJA 3LWCA 3LZZA 4B8EA 1STMA 2ZBJA 3VBOB 2ETEA 3MKWB 3J26N 1XD7A 1YQ6A 4RSUA 1RIRA 4RR3C 1JE8A 2JA5J 1QJFA 2CUFA 4L97A 4RS5C 3I8TA 4COWA 4LK0F 4WVVA 2JPBA 2JEMA 4YW4A 1ALYA 5FROA 3F8MA 1W9SA 4EV0A 4UVBA 1HW1A 4E7IA 4ZJZA 2VNOA 2WO2A 3GZAA 2ZACA 4CZSA 5HLTA 2EZLA 1AR82 3POWA 2CQXA 4QX8A 2BNMA 4CCEA 2BZDA 5ED4A 1LQ1A 1VBD3 1GWMA 3N7KA 4XIOA 2I8DA 5BNOA 1BOAA 3A02A 4GH4B 4YZ2A 3ST7A 1OCRH 1XPXA 1CAUA 1W39A 5L9RA 2AO9A 4QSHA 3WZ1A 3QACA 4K8RB 9ANTA 2AYHA 1BN5A 2JT1A 5EPAA 1GOHA 1A6IA 2ID3A 1OFNA 2X51A 1GDTA 3L00A 1ND2A 3CKHA 3O1UA 2ILMA 3OBZA 4C2UA 3ZSKA 3JRAA 2BBYA 2XB6C 1L3JA 3BR0A 4NR1A 3C18A 2K5CA 4MO7A 1TVGA 5K1YA 2ECCA 2GIZA 3OIQA 3TEXA 4J6GA 4S2HA 4ESFA 1RVF1 2F6BA 1JYTA 2WT0A 5T5JA 5ABJA 1SHWB 4ZU4A 4K8FA 1HKQA 4IZZA 1TQPA 1RUF3 4Y1XA 3MHZA 3V8KA 1FAYA 5K0UC 2ESHA 2W39A 1LKXA 3E3VA 4A3BJ 3W6KB 3BJOA 5JOWA 1JTXA 3GTKJ 5CFCC 5JI9A 3ERED 2V7FA 1NCQA 4YVSC 2EFOA 3VZOA 3JAMK 2O8KA 1IUYA 3ECQA 1FEXA 2PMWB 4K1ZA 5HPOA 1DZQA 3FHAA 3EDPA 1NLSA 2XRLA 3S7EA 3BU7A 1UHMA 4P02B 2VKVA 1IG7A 5BNNA 2ACJA 3N97A 4XE9A 2R7ZJ 2CSGA 1OFSA 4BQ5A 4LOSA 4WM8C 2WAEA 4FFFA 1P2FA 3O0XA 4OAYA 4XBLA 5IYYA 1HC8A 5C6CA 2J22A 4RLFA 2EIGA 1GMMA 4BJ6C 4IO9F 2A70A 2WN2A 1B35C 4D5CA 2R6QA 1XDUA 1RR7A 3DTIA 4AFAA 1F5FA 1RVF2 5FZAA 2CQQA 1QGLA 5GZDA 3LDKA 1IJWC 1GP5A 2VQHA 4CEYC 3S57A 2DMNA 5B66C 4AI9A 3FF5A 4Q4X3 1D5VA 4C2MJ 3ABLH 1UIKA 4XUTA 4YW3A 4AHXA 1SVOA 1R081 4QX3A 3GGLA 1FX7A 3RKWA 3TW6A 1FLIA 1R1VA 5K7ZA 3FXLA 3Q8EA 2N8GA 2KISA 3JD71 4PK4A 1K45A 2ZHNA 4GWJA 3VGIA 1A8MA 4B47A 1P92A 5HCBA 2DTZA 2CV1A 4CEWA 4M3CE 4IKFA 3R4KA 3L2WA 3HR9A 2QGUA 1I1EA 4SBVA 3BQZA 3T0AA 1WFXA 4LITA 4BDVB 1RITA 5JPMB 2LVSA 1GZTA 4F3JA 4ATEA 1FMD3 3ZSMA 4MGTA 2BWAA 1U78A 3FZ3A 1G8WA 3ZYPA 5FPBA 5F5CA 4EN8B 3I54A 2XBO3 5DPNA 1NA1A 4Y20A 1ND2C 1H6XA 2WBKA 1Z7S3 5FRMA 1BL0A 2WQ8A 3OIPA 1TMF1 4XF0A 1W5CC 3FKIJ 2QQ8A 3Q3SA 5LHIA 1VBB1 1LJ9A 4HEA2 5FO7B 2PX9A 2RMU3 3VDAA 3MEXA 2J5OA 3RZOJ 2Y64A 3JD72 4LLFA 2OD5A 1SLAA 3RSJA 1TBXA 2UUZA 3P9KA 3MUZ1 1HLCA 1JXNA 1SC7A 1RUI3 4A6EA 5DUVA 2JSCA 2D97A 2CW7A 5FZFA 3ZLIA 2EBIA 4FXKB 4XVHA 1JYXA 2M8GX 3TEYA 4AGGA 1UN1A 3WNLA 3KVAA 1U12A 3AG1H 1ORKA 1ACCA 1WSUA 2WNUB 1YE9A 5J09A 2XUEA 5FZHA 2DVAA 4LHNA 1WZ2A 3RZLA 1Y0UA 1U0JA 4CZCA 3S3MA 4HAMA 5FP7A 3KX2A 1UAIA 4JDMA 2VPRA 5DUUA 3LSGA 2EAKA 2F5FA 1P4WA 3KZZA 4OU0A 3GTPJ 5L9VA 2Q8KA 4IRHA 1VZ0A 1TMF2 3CCLI 2AXTC 2MEV1 4IEQA 1CJPA 2AC1A 2OQRA 2AHQA 1R091 4QMAA 2DDAA 5A7PA 5FPAA 1Y7BA 1T6BX 3O6BB 1W6MB 3IC7A 4Y17A 4E7SA 3TDUC 1ULDA 1TLHB 4V2WA 5DCMA 2E26A 4A7ZA 1S0JA 1F4HA 3I2HA 3WEZA 1JI6A 5IYCJ 4Q1RA 1U3EM 4JQTA 1AR83 4JRLA 3ZDSA 1AR93 4BDYA 1G7YA 2A73B 1POV1 3ZN4A 5E3NA 3VDXA 2V72A 3BUCA 2B5HA 1H8AC 2VZRA 2VUMJ 1BK1A 3BCAA 1R1A1 1FP1D 2PJPA 1SLCA 1HRI1 4BISA 5FY5A 2D40A 2P6HA 2Z69A 5CVJA 3D5LA 1HKTA 5E8GA 3WR0A 4O9EA 1H0MA 4RFT0 4AFMA 4XTMA 4EJOA 2KIQA 2ZMEA 2PQSA 3KHBA 4BZ4A 2MEV2 2OC6A 1QJEA 3ZFGA 2WNOA 1Q8SA 3GM8A 3ZQFA 3H9QA 1R092 3B6CA 4Z6YA 3GJBA 1NA1C 1MS9A 5EZWA 1LGBA 1ZKGA 4CTEA 3C7FA 2A7AA 1XNDA 1ZN2A 4IHTA 1PM4A 4I98B 4IGPA 2HYGD 4AQTA 2CW8A 4ON0A 2QQIA 5D6EA 4RAZA 3B69A 2VE9A 5CBLA 2YBPA 1NHAA 3G6JB 4XK4A 2HWB1 4QM9A 2DUQA 2VKHA 3C3WA 3BOWA 3WF2A 1R1A2 5JLXA 1HRI2 1WCQA 3LEKA 4S04A 1UOGA 3U4SA 1YIFA 1S0EA 2CQ7A 5F37A 1YS7A 2HVRA 3E7LA 1PO11 3VKOA 1F8VA 2UXNA 4BS9A 4CP0A 2QEXI 1K42A 2F48A 4F92B 1QDCA 1SLBA 5C3RA 1LOAA 2OIIA 3WG2A 4FASD 5EIYB 3CIHA 1R22A 3DF0A 1N47A 1TW2A 3M8JA 4N43C 4W8JA 3HJRA 1V6OA 2OTLI 1RVF3 1KEXA 3VBUA 1N1YA 3VD9A 3OD0A 4CDXA 3HWJA 4S2FA 2XPWA 2P3YA 1KQ9A 4LBKA 4AAPA 1X33A 2HWB2 2IVMA 3IDEA 1RB8G 5T52A 3V0BB 1KQ8A 1IKQA 1XYOA 2CFXA 4CU6A 4CZZA 1C1FA 2A71A 1S0GA 4IXAA 4CCLA 2CWSA 1U9NA 4GCVA 4FP3A 4DPNA 1CD3G 4Q0UA 1PO12 2JG9B 5CFDB 3CBNA 1VQ6I 5JMOA 3OOUA 2NVTJ 4NPRA 1TW3A 1VFCA 1DGRA 1QMJA 2D3RA 2KIUA 2X5IA 2XC7A 1UCXA 5FJKA 3LA2A 1QVUA 1UMZA 2PHLA 3HBKA 3ZOIA 2R7UA 4PQQA 5IY5H 4XOGA 2Y38A 4P1WA 4NC6A 1IV8A 2H6CA 4OMZA 1H2NA 3TO6A 2ZEWA 1X1DA 3S32A 1V6NA 3MLKA 5LLQA 3IN9A 1YIJI 2BVBA 1XG1A 3E6BA 1LRHA 4CU7A 5IK8A 3SEQA 3WTXC 2EA7A 1Q3EA 2HYJA 1XGSA 4DZPA 3HUGA 3G1MA 2VJ4A 1YQAA 5JZGC 3T4VA 1RINA 5T3NA 2P7VB 3LSMA 5JLVA 1XGMA 5F6LB 3JD73 1MBGA 1DFQA 2Y0SN 3BIEA 1ZYRF 2EXKA 5K4LA 5L3FA 2R062 4F91B 4HKOA 5BNOB 4KI5M 3ZQCA 5DQ0A 2H8WA 2YMZA 2HYFA 1WBLA 4A42A 1U6GA 1LEMA 1XNBA 1TWFJ 3ZVXA 2NMNA 2ZKNA 3GZUC 2DBBA 3SQOA 3SH3A 3UGGA 2QUFA 4D6QA 1LCLA 3FIWA 1W2AX 3F72A 4QTRA 4QQPA 4GRIA 4TXWA 3S7IA 2JKXA 2A6HF 3LEIA 2YROA 4E9KA 1GNHA 2X1DA 2JUGA 3USSA 1KA8A 1YTYA 4I3PA 5D5XB 1MMGA 2ZXHA 4UW4A 1X1CA 4ZXKA 1JTYA 2HWC1 1TMF3 3O1RA 4G6DA 3LSDA 2VQCA 3AZZA 3I2GA 3IL2A 1GYKA 1YW7A 2FBEA 1GVDA 4IE6A 1S9HA 1IXRC 4K21A 2A6YA 1TT0A 1OKQA 2LS6A 3CLQA 1VP6A 5FOJB 3JCUC 3KVBA 5C8CC 5FV3A 3VBOC 4DS0A 2VBZA 3ILNA 3HKZA 1WA6X 4FPOB 2XGEA 1JUIA 4LBJA 1UHSA 4HVQA 2BXYA 2WN3A 5D5VB 2LM3A 2UY9A 2BU9A 1VBE1 2C6SA 2E7TA 3QYBA 1C28A 4ES9A 2BBAA 3JCIA 2DT6A 2R3SA 2VUAA 1BIAA 2RDQA 2VKDA 3H50A 4KWKA 4LK7A 5EEGA 2MEV3 3WU1B 2MD5A 2BY2A 5BPIA 4O61A 3IUOA 5A6QA 3TBDA 4GH4C 1R093 1C0WA 4BB3A 4NWVA 5IOYA 2P5VA 4JYKA 4BY1J 1LECA 3USUA 3ECOA 4XNFA 1PP7U 1CAXB 2VM9A 2X6WA 2XDVA 3PQJA 2C6YA 1Q8QA 4LK1F 3AKZA 1JYNA 3AYEA 4X6RB 4QPWA 4HKLA 2AUYA 2YUEA 1O91A 3WU2C 4MV2A 5EG0A 4GA9A 5FZGA 2BGOA 2EIJH 3A4CA 3FHNA 1POV3 2YPRA 2BW3A 3SH5A 2JVGA 1XSDA 2QDRA 3OBTA 4Z82A 4DBQA 2LUWA 4MXWA 3PJYA 1R1A3 2VOKA 1HRI3 3RJPA 2ZGTA 1RZ4A 2H6BA 4PBOA 2QF7A 2FJ1A 1GICA 2DMTA 3HTUA 3RPQA 5FLXZ 1ETWA 3IKVA 4BACA 4G7OF 3BJAA 1VRBA 2NMOA 4CDQA 3OF1A 1H30A 2VJIA 5LD2C 4PJ0C 4ZC3A 2A3SA 4B44A 3RZGA 3C2GA 5FP9A 1NXD1 4R9BA 2I07B 3F2ZA 4MEYF 4KFCA 1W7PB 3JBG1 4JDOA 1UWWA 4A0YA 3LEMA 3T0BA 1X3WB 2HWB3 3NNFA 2DV9A 1LHNA 1SAUA 1ZNPA 1I3QJ 4QXBA 4XF1A 3ILRA 2QQMA 4BAYA 2IXLA 2XVLA 1W8ZA 2W5FA 3BPXA 3HRSA 1OQYA 1N78A 4XKVA 2I74A 2GN7A 1UL9A 1RRJA 3CP2A 3VHRA 1A78A 3EQLF 1VRH2 2M0CA 2OKXA 1E57A 4XBFA 2PQ8A 3G1LA 4I09A 1PO13 2BNNA 2XF5A 4LKFA 1EAH2 3M8FA 1J09A 2LALA 3NWKA 5I0DA 2IVJA 2HH9A 4AU7A 3VBSA 2EFQA 1TWAJ 4FX0A 4MEXF 4HW0A 3J7NA 1LFBA 5I93A 1W9WA 2R041 1YJ9I 2E2HJ 4BQ4A 1G3SA 1ZBE2 3ZXSA 4OMYA 4QX0A 3WNPA 3K69A 4FE4A 4AQ6A 2OS2A 1X19A 1REEA 5FY1A 3ZMZA 1ZRRA 4PIXA 1V6MA 5JXHA 1G9CA 5HVQC 4JP0A 2M1BA 1QXPA 3JBG2 4MTDA 3IMNA 4WF2A 4OYUA 5C33A 4BGDA 3AZYA 3BTJA 1FBQA 5JI6A 2EALA 3B9IA 1W2OA 2ZFWA 2B7YA 2ZGKA 1XSRA 5FLIA 4IEOA 4A5NA 3NQHA 4LBOA 1G3YA 5CKMA 3MFKA 3OYBA 2R30A 2Y60A 1F15A 4Y3OA 3VOEA 1C57A 4QKFA 1XC6A 1IW7F 1OI6A 3THTA 1GZ9A 4LK6A 4W4ZA 5DDJ1 5A32A 4ZYGA 1XOYA 5C4WB 4HDUA 4NPMA 5JXJA 4XC9A 4OHYA 4YW1A 3WHBA 3I58A 1RC6A 2R042 2JA8J 1VJ2A 1C8NA 4KGGA 1W9YA 1DP3A 1T2XA 4FCAA 1JZ3A 4RB2C 3G6EI 3F23A 5DZEA 5A6YA 4R1HA 3VSKA 1JZ8A 4QPGB 4Q27A 3QODA 4OINF 5FZ3A 5FLHA 2OUHA 1CAVB 1AX0A 3SZPA 1DYOA 3LSJA 4CU8A 4BK4A 2R7WA 1FSHA 1B09A 1G3WA 2OPKA 2LBFA 4Q0VA 2VVEA 5E3LA 3WTUC 2XSDC 1UELB 4Y22B 2COMA 2QQUA 4A93J 2NVYJ 3VLBB 1QOSA 1WMDA 3LB9A 4LOCA 2KP6A 4ASLA 3BYWA 5EXOA 1MDMA 3PO2J 2P4EA 2WWUA 2VOPA 4AIJA 2AXLA 5DDJ2 5GLWA 2L4AA 2WS92 5HLHA 3Q8AA 4CUAA 2CDPA 2WSUA 4AI2A 2MNGA 5F0FA 4BM8A 4CP9A 2Y69H 3QLQA 3R4DB 1KONA 1G9AA 3I9V2 2R16A 2LH9A 3VBSC 3MZYA 2C9KA 2RG4A 2FCVA 1ZR2A 3BZ6A 2R7EB 3VBUB 3EUKL 3AM2A 1OISA 5ACA1 1WJCA 5BQTA 1RUJ2 4QXHA 1YEWA 1PNGA 5JOXA 4OHWA 4UBHA 3BPZA 3WTYC 2WAQA 2KMUA 4HG2A 3VYSB 2VMCA 1Y1WJ 2PLV1 3LSPA 5H9RA 5DUKA 4FX4A 4P5YA 2NOGA 3AJZA 4LO4B 1DGLA 4ISRA 1N75A 1SAXA 3OV8A 3HRMA 1DP0A 3OPWA 2CWMA 1VMHA 4O9GA 1SLLA 4NIGA 4FTHA 2QBYA 4M4PA 4XCBA 2D45A 5D8AC 4ETSA 4EM2A 1PHMA 5LRSA 4HPQA 3AJYA 4RQPB 5GPAA 2L4MA 1S2EA 1B9MA 1OCZH 3N4MA 2DFFA 2X5IB 1US3A 5HLGA 4S2DA 1AU7A 3H8OA 4CYCB 3R60A 5G05L 2RR12 4DUXA 3L1PA 3ZMDA 3T4HB 5EZGA 3KQ4B 2LR8A 2OQGA 2LKSA 1OPCA 2DOEA 5ACA2 3UKVA 4Q1PA 3DKQA 5I8TA 2EWNA 5FKMA 5IYDJ 1MS5A 1QA6A 1S0CA 5JSPA 3BC8A 2K4JA 1S1AA 3I2OA 3AZWA 1M4WA 2OJED 4IHVA 2DOFA 3UKNA 3MUY1 1SLIA 3C7EA 4COUA 1CAWB 3NJVA 2ECBA 1QWRA 3SXWA 1AHDP 3GYHX 1DQ5A 1SFYA 3RI8A 3WF0A 3DXTA 2UYAA 1DPRA 3AB0A 4OI0A 1CZTA 1SVMA 3FXOA 2R0HA 1TQIA 3UGFA 5KHIA 1IPSA 5HOOA 2PI0A 1VRH3 4LPLA 3VSLA 2WO3A 1H1AA 1R23A 1U5IA 3WY6A 2A5ZA 4DY5A 4WWCA 2WYSA 2DWRA 4AW7A 2WV0A 4MOAA 2Z9OA 4WK8F 5C9AA 4ENKA 5FMCA 3VKFC 4DQAA 4E6KG 3TKYA 3KV6A 3FMRA 2XF7A 2NOJB 3N9LA 4EQVA 2IFRA 1EKEA 3U07A 1N77A 2K9ZA 2E7AA 1B8IA 2QKMB 1ZZ7A 3IAS2 1W0TA 2R7SA 2VGDA 3RZHA 5DD8A 4HLTA 4L2NA 4FHTA 3ZMSA 3RZKA 4N7UA 4B3AA 1JKQC 4Y13A 1UXZA 3FFQA 1RI7A 5H2FC 2GC3A 4X8NA 4V1PA 2HQAA 1XDSA 1YLFA 1NZIA 3JBG3 3LCPA 4BE3A 2J1AA 1LENA 5JLWA 2X05A 3P7NA 1K78A 5A2QZ 2PMZA 5LATA 1PVEA 3TOBA 3LD8A 4AVVA 4HQMA 2A3WA 1FNNA 3OL3A