4FT8A

E. coli catabolite activator protein with cobalt and sulfate ligands
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of catabolite activator protein with cobalt(II) and sulfate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription activator
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ft8A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ft8A01
3KETA 4MUVA 5J3UA 2V6CA 3OV8A 1FXZA 4LUMA 2QVOA 2BNMA 4WWCA 4FBFA 3KCCA 2JT1A 1D8JA 3F8FA 3VFZA 5E1XA 3QPHA 4LLGF 5JVTA 3HQXA 3O6BB 2BYVE 4L5JA 4LUKA 2H6CA 3P7NA 3K0LA 4OIRF 2IXHA 1TQ5A 1FPQA 2M5WA 4ENKA 4Q29A 5JR3A 4B8XA 4TV7A 4OFGA 1SMTA 1YYVA 3KZYA 1UPIA 2EA4A 5FO5A 4AVPA 4QXKA 5ED4A 2IVMA 3NL1A 4YSFA 3HHGA 1QXRA 3KZZA 4CDGA 3M9AA 4WXHA 3P9IA 4XFHA 2D1VA 1Z6TA 5KBFA 4A12A 3CUOA 2IXLA 4UNOA 4CGZA 3GYHX 4GGGA 1IN5A 3DEUA 3TDUC 1XSDA 1R7JA 4YG2F 2X0LA 3WTZA 2XAFA 1QZYA 3MZHA 2DPDA 1G3SA 5LRRA 1HW2A 3NQOA 3H3UA 2JSCA 5DD4A 4NHJA 3LWFA 4BHBA 3SZTA 3EBRA 3R0AA 4CXFA 3JAMZ 2QNKA 4L9TA 2EFNA 4LA3A 2FF4A 3JTGA 2H0VA 2ZKLA 5BS6A 1FC3A 2HTJA 3TQNA 4I09A 3FXQA 3L2HA 4MNUA 1O3SA 3MWMA 2K9ZA 3QPTA 3D5LA 4PIYA 3FM5A 4MGIE 2Q8KA 2K4BA 4ENNA 1TW2A 1EH7A 1VTNC 2DT5A 2CO5A 2M30A 1P4AA 3ZPLA 2ZJ2A 4Y15A 4A6DA 2K7LA 5KHKA 2XLGA 5DV5A 3WTVC 2VOPA 3ES4A 3LAJA 2B8MA 4L9NA 4KWLA 4EMSA 1O3TA 4ESBA 2Z5UA 2FOKA 1R5GA 3I0TA 5FFZA 1FSHA 3V7RA 1D8KA 2G7HA 4RGSA 1IXCA 4KICA 4YFNF 3ZMTA 4LEJA 1KQ9A 5I0UA 2NS0A 2DK8A 4R79A 5AVPA 1FI2A 4LK1F 1SQ4A 4HDVA 2IW5A 2QQ9A 2FXAA 1R23A 3DN7A 5H20A 3ZN0A 3S2WA 5K5QA 1ZGJA 2EFOA 3W6JB 3IL2A 4LFUA 2Y75A 2EK5A 3FHZA 1P6RA 3GFJA 2D2WA 4IRHA 3IKTA 1EP0A 2RC4A 5KHHA 1XE8A 5C6CA 3H50A 1KU3A 2ETEA 5FLXZ 5D5XB 3N97A 1WA4A 1X3UA 2X4HA 1TNSA 4OIOF 3WGGA 3U11A 2CSOA 5KVRA 1E17A 3EUHA 2Z3YA 1SEFA 5ICGA 2I45A 1LEAA 4KWKA 4IEPA 4EWDA 2P5KA 1XN7A 4R8HA 4ZYEA 1YTYA 3WG9A 1SFEA 2M87A 4WK8F 4Q0UA 2NYXA 1BC8C 4OMYA 4QLCU 1BJAA 3C18A 5D1IA 1UD1A 2VC1A 2ELHA 1FP1D 6PAXA 1H1MA 4L0ZB 2C0ZA 2FQ3A 1JXSA 1DPUA 2OD5A 3HTUA 4MX3A 1DGRA 5I8TA 5JFRA 3NKTA 4XLNF 3OTFA 5ILSA 1ZYRF 3GZ5A 5L3CA 2L01A 2Y48A 4YFXF 1HSJA 1SFNA 3MZYA 3R60A 4PDKA 1LJ9A 3FE5A 2XVCA 4XETA 1P4XA 2L54A 5BMZA 1NYWA 2VBYA 3U9GA 2Q0OA 2HZTA 3WODF 4HDUA 4BAYA 3R61A 1PDNC 1SD5A 5LRSA 3IIAA 4XF9A 5IT9K 3ST7A 1OYIA 1FYLA 4JBAA 1G4DA 4ONUA 1YFWA 1J7KA 4IRGA 1YG2A 4QM9A 1ZG1A 4XFIA 4R52A 2PHDA 1UFMA 2P17A 5ICCA 3I58A 2NNNA 1V70A 4AWXB 3HUGA 3UKTA 4QGLA 2MHFA 4ETSA 1XGMA 4L0YB 2YR2A 2CYYA 2K02A 2KIMA 5FFXA 2B0LA 2K27A 2Q2EA 3G3ZA 1DPRA 4HX4A 2A07F 3Q9SA 2G9WA 1HQCA 1MJBA 2MH9A 4LK0F 3EJKA 4UBGA 2CQKA 3CJNA 3PQKA 2IXKA 2O8QA 4XF4A 1PM7A 5D4SA 3MEXA 2XAJA 2PYTA 4MHGA 3LZZA 1Q1HA 1OMIA 3RYRA 1UB9A 1I27A 3RKXA 4I7HA 3BP8A 5I91A 3IRQA 5A2QZ 5E16A 1UW8A 3LOIA 3RDIA 5KHJA 2YSRA 2YX4A 2JPBA 1U3EM 4XFCA 2P8TA 2DLLA 4HQMA 2ZCWA 5JHUA 1P92A 3TO9A 1QGPA 4OMZA 3TGNA 1BI3A 5L3EA 5E1RA 1MJAA 2JTVA 2PQQA 1WLTA 4WCGA 3J81Z 5LHGA 2ZO4A 5FQ0B 4U7BA 1ODDA 3CO2A 5HDKA 4D7SA 1GQHA 1U8RA 3E6CC 3GEZA 5E1ZB 3MDPA 1YHFA 1AOYA 4GXOA 1GVJA 1IAWA 1HBXG 4Q5SF 5CVRA 3EQEA 5J48A 1ZG3A 2XL9A 2V1DA 3WTSC 2E9QA 1W5SA 2IRFG 1F9NA 1ON1A 1SMYF 4EWEA 1S6LA 2ZFWA 1CGPA 3ROUA 4HYEA 2PLYA 2L4AA 3FF5A 1U12A 4XFAA 2F5DA 1J59A 3ETQA 4HX7A 2MC3A 2DBBA 4IEYA 3HYIA 1TW3A 4IF4A 5AONA 3VODA 2DW4A 3IWFA 1ZAOA 3IKVA 2W57A 4I2OA 1ONVA 5K5RA 2V1XA 5BPIA 4YRDA 2LF7A 4PJYA 4RB0A 3QU6A 1C0WA 2XHKA 2VBXA 3Q5FA 4G7ZF 2JZYA 2PAMA 2GAUA 4EWAA 5FGMA 4MTEA 3LA2A 1JUHA 1DZRA 3F8CA 1XCVA 1QNTA 1LDJA 1J1LA 5LEKA 2H27A 4MGZE 1OYWA 2QVSB 5D5WB 5LLQA 4IEWA 4NQWA 4RD7A 1J3QA 2CV6A 3M8EA 1FYKA 2Q4SA 2XAGA 1MDMA 2F4PA 5D8LB 3LA3A 2OA2A 2Z69A 4LB5A 3F8MA 2GXBA 4AVCA 2ACJA 1S8NA 3VB2A 1ZLJA 2OBPA 2D45A 2LNBA 3T0YA 2HS5A 4AVBA 2HQNA 4K8FA 1L3JA 3ZP5A 4UVBA 3IC7A 2A5YB 1J2XA 2DU9A 3CO6C 4IEXA 4UXNA 3HSFA 3WU0A 4IHTA 1KQ0A 1FY7A 5I8SA 3GZ6A 2B5HA 2XIGA 1LR5A 3FXRA 3DL3A 2AS5F 4MEYF 1TBXA 5E17F 1UCRA 3ECHA 2OPKA 2EV0A 4MGYE 3SQNA 2IA0A 2EVXA 2QZ8A 4KL1A 4LA2A 2BV6A 3R0JA 2HR3A 4LGWA 4KMFA 3RI4A 1IRGA 2LF8A 2PMUA 4FHTA 1E2XA 1SFXA 4E2SA 3BALA 4KIFA 1EYBA 4LLNA 1PMIA 2ZBKA 2D5FA 3D0JA 3ZMZA 3E6MA 5T3NA 2GXGA 4PIXA 3UKVA 5JSRA 5IT3A 3GVAA 4PIZA 4HF1A 2OZUA 5D6EA 3H9AA 2IA1A 4F7ZA 4FAGA 1WQ2A 2MPFA 1RIOH 2FNAA 2WFPA 4U0YA 3GBFA 4P5OA 1YUDA 3C3WA 2R3SA 1RGSA 3HOSA 3KP4A 2XASA 3WE3A 1RUNA 1YFUA 4Q4ZF 1W5TA 2GA2A 4G8XA 1I6XA 2B9UA 4Q0PA 4Q48A 3CDHA 4P55A 1B9MA 2QQBA 1BI0A 2FSWA 2STTA 1DZTA 4HQEA 1CF7B 1ZARA 5FPZA 1XGSA 5FD6A 1LDKB 1YW8A 1CAVB 3N4MA 4BHCA 4HBLA 1ZZ9A 4IPAA 4RAYA 1Z7UA 2JPCA 2UY9A 2PQ8A 4L11A 3OF1A 3TNQA 2FRHA 4KT5C 1FWZA 1ZRCA 4XFFA 3ZMDA 1CX4A 3BZ6A 4OOIA 2FBKA 4PZJA 2V09A 5K8SA 4RGUA 2GIVA 2VECA 4M6YA 3WTTC 1STZA 2XAQA 1YS6A 3VHRA 4A0XA 3IDBB 4OINF 1QZZA 3GWZA 3E5UA 1H9GA 5L3DA 4Z2YA 1IN7A 1B59A 5KK1A 4WXCA 3KE2A 2KRFA 1BM9A 3F3XA 4ENMA 3UKNA 2BNNA 5ILUA 3R4KA 1J9IA 4PGHA 4HLYA 5I0TA 2HTSA 4UUVA 1YIOA 3FX3A 4HF2A 1MDMB 2H6BA 4O3MA 3EHKA 4IEVA 2IXCA 1QY4A 3B73A 4META 3SHFA 5FB2A 4BHPA 1YW9A 2ISYA 2FQPA 2VPVA 1USTA 1ZRDA 2E1NA 2ZKZA 4MGRA 3BROA 4BXUA 1ON2A 2EV6A 2HJIA 2QYOA 3PNAA 5CVJA 3T5XA 3RJPA 1ZLKA 4A5MA 3SHRA 4EJVA 2ET7A 2W24A 3H92A 2PTMA 2OQRA 2QBYA 2PFWA 3TO6A 1BC7C 2LSOA 5BV6A 3ZMVA 1GHCA 4RGRA 4IESA 2XGXA 2UZKA 3E5XA 1R58A 1F5TA 4G94A 5K5OA 2FMLA 3JAMK 3TDZC 2XRNA 1UIKA 3O14A 2D93A 1YQAA 4PCQA 2HOEA 5BQTA 2J5OA 1ZZBA 1MZBA 2V1UA 3BU7A 1WGPA 2A3SA 3TNPB 4O6JA 2P6SA 3WW2A 2QUFA 3M3IA 4E2QA 3S0MA 2GWRA 3IDCB 5JSPA 4G6DA 4L9JA 1ZZ8A 1FZPB 1R5HA 2CFXA 3RIRA 3K9TA 4DQ2A 5FQ0A 3V8JA 4NB5A 4ESFA 4EM0B 3KP5A 2OAZA 4E2GA 1SD4A 5CU1A 1KU9A 1Y3TA 4EM2A 5F6FA 1FBQA 3Q9VA 2PJPA 2F5FA 3K1MA 1FLIA 4ASNA 4KNYA 4HSJA 1J0RA 4AQ2A 1SD7A 2COMA 2LKPA 4JVAA 1UHWA 3CF6E 3BJAA 1BI1A 3GW2A 2P5VA 1LDDA 3M70A 2Z9OA 2GC3A 3I59A 3K69A 4EJUA 4GYGA 1K6OA 4BNCA 1FP2A 2DI3A 4D0PA 2NRAC 1R1VA 1XMKA 4KU8A 3NRVA 3EETA 1TTYA 3TO7A 1RUOA 4M74A 1REPC 3DQVC 1FBUA 3DXJF 3V8LA 1B1BA 5FD5A 3F22A 4HV5A 1O5UA 4KN4X 3CLPA 2P6TA 3RZZA 3ZDSA 4JTNA 5FLXK 3MPBA 1FNNA 5I0SA 4Q0VA 4Y13A 1O5LA 4MTDA 2G7UA 3EQLF 1LNWA 1G3YA 1QO0D 4I0AA 2O8XA 1F4KA 3MAJA 5BUVA 1ZRFA 1KQ8A 3REOA 3L09A 2QENA 5IT9Z 5CADA 1IZ1A 2J5PA 4XFGA 1IRFA 4XRFA 2FBHA 3OCPA 5DUKA 2GQQA 2Y0MA 3P9CA 3RTRA 3HRSA 3K2ZA 5HS7A 4HOBA 1YWKA 4EM1A 1ZHFA 2C6YA 3KP3A 2L4MA 1S7AA 4B09A 2EA7A 5D4RA 3KP2A 2GC1A 4LTAA 5F1RA 1J3PA 2YPRA 1MD0A 3MYXA 2A69F 2RV8A 2DCTA 4XF3A 5L3GA 4R1HA 4LG0B 2VE8A 2DQLA 2XUBA 3RKWA 1EH6A 1HW5A 4KWJA 2DAOA 4OLLA 1USSA 2UYBA 2W84A 2O0YA 1OYYA 3WGIA 4YARA 4ZYHA 5F64A 4KN7X 4I0BA 4DINB 3BPVA 3GO5A 1RTVA 4S05A 3USSA 4UV9A 3NEUA 1R36A 2QBYB 2WC2A 3M1EA 5FDBA 4YIIA 4IERA 5BY5A 2RGVA 3FZ3A 2KIFA 3HRTA 3M8FA 2BE5F 3SXWA 2ATFA 2A6HF 4EVIA 1YW7A 1ZVFA 2IP2A 2P5LC 5I0RA 3K1NA 2F5CA 2CW0F 1EPZA 3V7SA 1EY2A 1IW7F 4I98B 4JV4A 1XDSA 5L3BA 3SMHA 5D5VB 2ZMEA 1BOAA 4I02A 1WSUA 5LGNA 1NE6A 2CAVA 4AIKA 4EV0A 1X82A 4BQAA 4KYWA 3HT2A 4YYOA 3ACLA 1KYWA 4RS8A 1XGOA 1CF7A 2ET1A 2LDUA 2FMYA 1IF1A 1CAVA 5AIPA 3IWZA 4M72A 3J81K 3DF8A 3TOAA 4H0EA 4HX8A 1TLHB 3WW3A 3CUQB 3NW4A 4OIPF 4M6XA 3I59B 3HRMA 2P4WA 3V4GA 4JTOA 3GF2A 1HKQA 1MGTA 4OIQF 3HTSB 1YLLA 3HSRA 5HVQC 3L7WA 1Z6RA 2EB7A 5J6XA 2WWYA 3MCZA 3FMRA 4HVOA 3CJXA 1S29A 4P9GA 5HDGA 5HDNA 1DUXC 1H1IA 2PAEA 4RGXA 1QXJA 1GXQA 3CLOA 1V4RA 4CYDA 3DPTA 5LHHA 2M1BA 1RC6A 4LJZF 2FE3A 2BNOA 5BOXA 2E7XA 2EAAA 1LVAA 3OD0A 2O61A 4ENJA 5C8WA 1WI9A 1TQMA 1T39A 1ZRRA 2TDXA 3BY6A 5AIQA 1K79A 1R22A 3ECOA 2XAHA 4Q47A 4D7TA 3S7EA 3SXYA 5H6RA 1NZCA 1IXRC 2PFBA 2W85A 3E5QA 4L9VA 2QM3A 3WTUC 2PEXA 4HV6A 4AIHA 1T0FA 1TQIA 5JI6A 4A0ZA 2UWMA 1D3YA 3MFKA 1SD6A 1KGSA 2E1CA 4ZYDA 1J5YA 5FCCA 3J80Z 5HS9A 2HFHA 3D82A 3ISPA 2DPUA 2KXLA 4QM8A 1HXDA 2CGPA 1CAWB 2EWNA 5EZWA 3QRFF 3JSOA 3KMHA 3NSTA 3IHUA 1CAXA 4IEZA 2BBYA 4XBFA 2GU9A 4HVRA 3WGHA 1CAUA 4XFBA 5HI0A 4UVAA 2EV5A 2STWA 3ELKA 3VOEA 2IC1A 4MH0E 5JAXA 3GFMA 2JRTA 2QCSB 2L3DA 4LB6B 1U5TB 4AVAA 3JTHA 3JSPA 1S7OA 2PG4A 3W6KB 2YX7A 5FLJA 4A5NA 3RPUA 2VOOA 3SCFA 4IHSA 1U2WA 4NVPA 1XSXA 4UV8A 1U6GA 4KMUX 2VQAA 2HKOA 3R6SA 3HSEA 3VEPA 3EO6A 1A04A 3LFKA 1Q5OA 4WZCA 1HW1A 2E7WA 2R7DA 3CTAA 1TNTA 4RB3C 3BCWA 3U10A 2MH2A 2XV4S 3KGZA 3FJSA 2HGCA 2ZMEB 3H1WA 1UHMA 5HLGA 4CO8A 1QPMA 5EFUA 2XLFA 4AXOA 5HLIA 5DCMB 2ZNZA 4IVNA 4MQVA 4EGZA 1IN4A 4A0YA 4YNIA 3M7GA 4XSZF 4I01A 4KFCA 3LAGA 4JQFA 4HVQA 2F5EA 3V8KA 3CO7C 4WF2A 4ZH4F 3F8NA 3B02A 1NXMA 4HF0A 1IXSB 2N7GA 2XKPA 2RQPA 2H94A 4CZZA 1WRJA 4AQ6A 2DO7A 4WX9A 3LQQA 1XDUA 4KU7A 2MA3A 4FAHA 3H1MA 4J1XA 1W7PA 2CWEA 2O03A 5HS8A 1D5VA 4M9SA 1P4WA 2VE9A 3DKWA 1IN6A 1FBSA 1RZ4A 1ZN2A 4X6RB 1JE8A 2GZWA 3SZPA 3ZMUA 2UY8A 2ESNA 2ETHA 5D6FA 1WKMA 4PGGA 2PN6A 3CEWA 2NNYA 4N0BA 4G7OF 1J75A 1FT9A 1SFUA 3NJZA 3L9FA 3I54A 5CVUA 2Z2SB 1HKTA 1ULYA 1OPCA 2MNGA 4QX5A 4ZU4A 3COAC 5DYMA 3FM3A 4MGKE 2OYZA 3EYIA 4LG0A 3F6VA 4QMAA 1YFYA 4Z82A 4UHTA 4O9GA 2VC0A 1QQIA 2BEOA 1O57A 3KGLA 5ILVA 1ZH5A 3BJ6A 4UBHA 4GYIA 4XF1A 2PHLA 1YLFA 3BOQA 3RNSA 3E97A 3U1DA 1JHHA 4HMZA 3GXOA 1K7AA 3KP6A 4U7DA 3LA7A 4ZU7A 5ICEA 1VR3A 3LSTA 5HLHA 2VBZA 1I1SA 3U0ZA 1IUYA 3WW4A 4EJWA 3G7DA 1OD5A 1X8EA 2HQRA 2EFQA 4P96A 5CYVA 1YS7A 2QDRA 3F72A 1NHAA 4B29A 2D40A 1MJ9A 3H1YA 3KSCA 4EROA 5ICFA 1Q3EA 2RDPA 1NE4A 3AAFA 2M8EA 2XROA 2FU4A 1W4MA 1CAXB 4OU0A 1RL3A 2D1HA 1Z91A 4KDPA 5EEHA 1J58A 2EFWA 3LQRA 1CAUB 4N9HA 3E6BA 3U2RA 4X6QB 3I4PA 4ZZDA 5D8KB 3OOPA 4Y17A 3V7CA 1KA8A 3ABUA 2FNPA 4UVCA 2HYFA 1ZX5A 1IN8A 3F8BA 5JR7B 2UYAA 3HT1A 1DGWA 3C1DA 3I5UA 5D5UB 5KHIA 3BPXA 3I7DA 3QP6A 4UXAA 4GO1A 4FX0A 3WU1B 2PI0A 2L02A 4E70A 1GQGA 1RNLA 3J7AO 3CUQA 1HSTA 2W25A 3G73A 3CUQC 3FXUA 1KU2A 1BIBA 2HDCA 4TLFA 1XGNA 2M45A 4Z07A 3KEQA 2PMHA 3KLNA 3KLOA 3K1PA 4XSXF 1O4TA 1OR7A 2RN7A 3DFGA 1KU7A 3H3ZA 2IXIA 4XF0A 2VXZA 3L00A 4LD5A 3ZMSA 3RYKA 4IXAA 1X8MA 3SCGA 2OZ6A 3C3VA 2RKHA 4M9ZA 2MD5A 3F21A 4BIFA 4LMYA 1K78B 4KIGA 1YFHA 1OKRA 5CLSA 5E1WA 2OZJA 1HKSA 1PP8F 5TJJA 3BB6A 3TKYA 2ESHA 3I71A 4IEUA 5LGTA 4ORFA 2FA5A 4HN0A 1PUEE 1T38A 4O5VA 3RYPA 2XLAA 4ZZLA 4IEOA 2RVCA 4ON0A 3LAPA 3PLQA 2Q1ZB 3SCHA 2HEOA 2OA4A 2FEZA 3PFIA 2P7CB 1W7PB 4N9IA 1BBYA 3FMSA 5I8YA 3WE2A 4MQ9F 1O3QA 1XE7A 2IPQX 2V79A 1GXPA 5EEGA 5DCFA 1Z9CA 1TQPA 1B9NA 5FLIA 1I5ZA 1O3RA 1F1ZA 2P7VB 3KP7A 3OGJA 4AIJA 1MKMA 2HKXA 1UIJA 1ZREA 1Q43A 2VBWA 5FLHA 4KUMA 2OQGA 4ESJA 1LRHA 1CAWA 4A2UA 3T1BA 1J3RA 3I64A 2DTRA 4IRIA 4HBNA 1QWRA 4HN1A 1FYMA 1EH8A 2O6GE 5BXXA 3WTXC 4A6EA 1BI2A 3O3KA 4U0VA 1LEBA 2H09A 4GCVA 4G7HF 1T2KA 2QJVA 1U5TA 2UXNA 4ZU5A 4LLOA 1U5TC 1LQ1A 3E3VA 3FMQA 4G9YA 3E6DA 5I93A 2MLGA 3GYDA 4DNCA 3BDDA 2A61A 5KHGA 1YO5C 4I3PA 1PP7U 1VJ2A 2A68F 4RB2C 2ZXJA 5DD8A 4U88A 1Y0UA 2VODA 2IXJA 4QGMA 4WBBA 1FSEA 2QWWA 1FX7A 1Y9QA 5ERIA 2Z33A 1G6NA 5E8GA 4M73A 4KA4A 1O7LA 2KJCA 2MBFA 1XB4A 2EJRA 1L0OC 1R1UA 5A2QK 5DUIA 1QBJA 2YU3A 3GFLA 5DEQA 5E20A 1XRUA 5DDGA 5E8IA 3EYYA 2Y0OA 3WTWC 2FBIA 4M71A 3D0SA 1DP7P 3HHHA 1T6SA 2EFPA 5DCMA 4CICA 1I1GA 5J8CA 3HIFA 2Q30A 1AWCA 1FOKA 3JZVA 3DPLC 3O2PE 3H7JA 3RPQA 1ZGAA 4QGNA 4M9XA 1OI6A 4EJOA 2RNJA 4AD9A 1H0MA 4L2NA 5BPXA 1BN5A 1IPJA 2KJBA 3HRUA 3T8TA 2V9VA 2HYGD 2WV0A 1RI7A 3PQJA 5HOOA 3ES1A 2KIUA 4Q0SA 2GH2A 2DFIA 5LGUA 2QQAA 5J8FA 4HW0A 1ZG5A 1ZZ7A 5L3FA 4EJTA 3KEOA 4BYYA 3ML6A 5TRDA 3GLXA 3BPZA 4YIFA 1YFXA 1XMAA 2IT0A 4P9FA 4HA8A 3ELNA 3FFQA 5CJ9A 1JGSA 1BIAA 1H9TA 4LLLA 1XD7A 1XCBA 3JW4A 1B6AA 2A6EF 2K4JA 2IJLA 2PAKA 1G3TA 4IJAA 3ZN1A 3I53A 2PBIA 2O3FA 4MZUA 4FT8A 1V3FA 4HAMA 2QLZA 5BPDA 2HWVA 3KFWX 3MQ0A 1IPKA 3GFIA 3FHIB 4CHUA 1T98A 2UXXA 3ERED 2ZNYA 1XSVA 3HOTA 1P2FA 3QP5A 1SAXA 4XLPF 3DV8A 1ZZ6A 1L3LA 2GC0A 2IA2A 3S7IA 1DDNA 4HLXA 4XEZA 1G3WA 5H6QA 5LEJA 2AXLA 4L5IA 3F23A 3QAHA 4WVZA 3BJOA 4FX4A 1Z1DA 2GC2A 3TOBA 4WXDA 2Z99A 2ISZA 3QOPA 2VN2A 4Q0QA 1KYZA 1U78A 2R7FA 3DP7A 3L2CA 4GULA 1R1TA 2PA7A 3QACA 4EQQA 4HSLA 1VP6A 4LULA 4K2EA 4S04A 2MLKA 1X7NA 3WTYC 5K1YA 5LBQA 2D5HA 3IBMA 5FPXA 1EV7A 4IEQA 5J7MA 4U0WA 1ZNPA 1S3JA 3ULQB 2ADUA 3J80K 3FZVA 1W7PD 5JSOA 4RAZA 4EGYA 1OFNA 3ZQ7A 2K86A 2K0GA 4YFKF 2GA1A 2NAZA 2VONA 1WWXA 4L18B 3ABTA 4P9UA 4HLTA 5JCTA 3F6OA 4MEXF 2VT2A 3T8RA 3CL1A 1LB2A 2BGCA 3IRRA 1B4AA 4F8AA 3H8UA 1LKNA 2O1QA 2XKOA 2XL7A 4H7LA 2WTEA 1R00A 1O7FA 4KIBA 1Z05A 4QWQA 2Q0AA 5CVIA 5CVVA 2CG4A 4G6QA 1ZZCA 3PVBB 3P9KA 2DQRA 3BWGA 3EDPA 3FWEA 2OU2A 4MV2A 3SFZA 5E18F 4IETA 4O9EA 5LHIA 4RB1A 3WW1A 2F2EA 3NVCA 4J1WA 3GUDA 2VT3A 3QU3A 1K78A 1JHFA 4ZYGA 3H7YA 2EA2A 3RKYA 3C7JA 3GX4X 4HZFA 4BH9A 1UCXA 2CAUA 2DK5A 3LWCA 4JK1X 2KKOA
chains in the Genus database with same CATH superfamily
1DQUA 2CWMA 2K9QA 2D6OX 2R1BA 4JX5A 3SEZA 1FXZA 4HOOA 3ABZA 5A3UA 1WCKA 4QKDA 2WBMA 4Q4X2 3UJQA 1WJBA 4RDUA 2C26A 5E3NA 2ENRA 5E1XA 4LLGF 5JVTA 3O6BB 1AYM3 1SDWA 1K5MC 3P7NA 2IUWA 1NQDA 1TMF2 3FK6A 4YELA 4NJ4A 3IP4B 1RUG3 4E7JA 1GOGA 2CUJA 4ENKA 1SPPA 4M3FA 5JR3A 1UYYA 2FDGA 4M0NA 1H4HA 4AHWA 4MFDA 3OGGA 4DO0A 2DA5A 4QXKA 4PDWC 2XJSA 3NL1A 4YSFA 1QXRA 3HOZJ 2QEXI 3M9AA 5FKKA 2JQ7A 5IUQA 1Z6TA 2R072 3CUOA 3WNMA 5CIRA 3KHCA 4GQ7A 1DF0A 4NNJA 3TDUC 1DYPA 1R7JA 3UGHA 2W39A 2ZMNA 2OXBA 3NQOA 1KXGA 5AFBA 3HC7A 3GCMA 2WNVA 4KGQA 4QPWA 1VAVA 3R0AA 3WG1A 3CDLA 3VBRC 3JAMZ 2QNKA 2WA4A 4LA3A 2WNUC 4Q2FA 2FF4A 4LKDA 2H0VA 2DYSH 1H6YA 1FC3A 4H2AA 4KG0A 3S3NA 3L2HA 4N53A 5IOYA 3MWMA 3Q9OA 3QPTA 2E63A 3PFYA 1C5HA 5FJ8J 4DXZA 1XSRA 3CMMA 3ACGA 4GMP0 4CDUC 1WLDA 1EH7A 1VBE1 2QQUA 1Y9GA 2DT5A 3T4VA 2QKMB 4D7YA 5HLTA 1QMJA 3PSFA 2VOPA 3ES4A 1TWHJ 1SLAA 2Z5UA 4A69C 2FOKA 4K7JA 5GZCA 5BNPC 1R5GA 3LIHA 1YITI 1NXD1 2ECBA 5FFZA 1D8KA 1UMIA 4R9AA 3JRBA 2A5WA 4PSWA 4E7HA 1XPWA 1MZ6A 2ZA9A 5FPAA 1N78A 2B7EA 5K0UA 4Q4W1 2ZB9A 2HXIA 2IW5A 3WDWA 3W6VA 3DN7A 5H20A 3HOBA 1ULOA 3W6JB 1AR91 2VLAA 2Y75A 1EF4A 2EK5A 1P6RA 3CESA 3GFJA 4JAAA 3HWJA 1K12A 5F1JA 5C6CA 3POWA 4BDYA 2ETEA 3ZQIA 5FLXZ 1WA4A 5FZCA 1VRBA 2ZGKA 4OIOF 3VSKA 4XUNA 1UZCA 1E17A 3EUHC 2I45A 4NC6A 1S0BA 1Q8PA 3CHXA 4IE5A 2P5KA 3DBHB 1XN7A 4FPLA 1OCTC 4DUWA 4RHV3 1WFXA 3ZYJB 4II2A 4QLCU 3C18A 1W05A 1IGNA 1H1MA 4PT6A 4L0ZB 2TEPA 4FTBA 1T8IA 2R7WA 3HTUA 4MX3A 1JJ8C 3NKTA 3OTFA 3O1RA 3R0RA 2L01A 3SITA 1SFNA 3R60A 3IM0A 2ZZJA 4CYCB 3ZM8A 2VJIA 4XETA 4JX4A 2Y0SN 3GTQJ 4XRSA 4QQHA 2Q0OA 1D1BA 3APBA 1XPXA 3VBFB 2PLV2 1VQ7I 3J26N 1OYIA 1Q8VA 4ONUA 5FZDA 4YZ1A 1R9TJ 3AXEA 1CD3G 2ZEZA 4IV3B 4XFIA 5FYMA 4XPVA 3TEXA 2VBDA 3S30A 2NVUB 5ICCA 2NPIA 1UYXA 4DYRA 4COYA 1XGMA 4NHXA 3LCPA 2CYYA 1Z0XA 1PJRA 2A3WA 2B0LA 2DMPA 4HX4A 4L9BA 2YHJA 3Q9SA 2XMLA 1W9SA 1W8WA 4A45A 1AF9A 1MJBA 3MIBA 2MH9A 4LK0F 5CQGA 3QD6A 1X4PA 4PFPA 2O8QA 1FMWA 1PM7A 5FPVA 5D4SA 1RUF3 3MEXA 3G6EI 2HWC1 3K4AA 2RS33 2YV8A 3ZXEA 3LZZA 3RYRA 4I7HA 5FZMA 3FXKA 2Y6JA 2IEKA 4W6WA 3Q8CA 3FXJA 1VQNI 1U3EM 5F3EA 3FISA 1P92A 1RUJ3 2RMU3 5JOXA 1ETQA 2JE9A 2JUCA 1RUI3 1MJAA 3LB9A 1WLTA 4DOZA 1K61A 4B4PA 1UZYA 5JXGA 4WCGA 3J81Z 4BE1A 2CJJA 5FQ0B 4BOWA 3TOJA 3C2BA 4D7SA 4EZHA 4A3CJ 1YHFA 3LSPA 1Y1VJ 1AKHB 4GXOA 1QNYA 3I4NJ 2D98A 1F9NA 1ON1A 3VLBB 2BVVA 2ZFWA 4HYEA 4B7EA 3GTLJ 2F5DA 1J59A 2E2JJ 3ZXAC 5FLVA 1ZR2A 3HYIA 1TW3A 2XJQA 1B8IA 2BV4A 2YFZA 3PU8A 4CP1A 2DW4A 4UT5A 4GALA 2VPLA 4Q4V1 1GP5A 4YRDA 5BPIA 5JZGC 2R92J 4PJYA 5JVVA 4G7ZF 1JTXA 2JZYA 3KF5A 3QOEA 1UOGA 1VE0A 4MTEA 3C7FA 2KT0A 1NCQB 5M0TA 1XCVA 1I39A 5TISC 5LEKA 2HOTA 2ZX2A 1FX5A 5LLQA 4Z2WA 4IEWA 4XJ8A 2HZDA 1SFPA 3M8EA 2VUAA 1UY0A 3E0JB 2ARXA 3S1RJ 1ZELA 1VNDA 5D8LB 2DTYA 4HT1T 5L9RA 2ACJA 3ORJA 3IH3A 2GM4A 5CFCC 2Z4FA 1OC1A 2D45A 2LNBA 4B47A 1O91A 4H55A 3S5AA 3ZP5A 1GUIA 3IC7A 4V19K 2A5YB 3G1LA 1FMD1 3MLKA 4QU1A 3O1PA 2EZHA 4COUA 2XPVA 2AS5F 2ZABA 5KHDA 4HKWA 4FTSA 1TBXA 5ERLA 2HWE3 5E17F 2NN8A 1R4MB 3ECHA 3AKRA 5FZ6A 3QPSA 1AX0A 4MGYE 1NX9A 3D6EA 2Q8OA 2IA0A 4LK7A 1V5EA 1G8XA 2QZ8A 2ZHMA 3HBZA 3OYHA 2BV6A 1IC8A 2HR3A 1EAH1 4OMDA 4IUGA 1MMGA 1K4TA 4MHRA 3OR2C 1HN0A 1LOGA 1H6XA 1ZQ3P 1SFXA 2L0KA 3BALA 4YGDA 2ZBKA 2D5FA 1HA8A 2LH9A 3ZMZA 1T56A 5F6KA 1SDDB 2RR12 2VO5A 1A6CA 3H3VK 4XJUA 4HF1A 2HPMA 4YW4A 2OZUA 2B7YA 1ERDA 1WCMJ 4DPNA 2BTVC 3DLAA 3WG4A 3OUHA 4ARYA 5HNFA 1H2NA 5BNNB 1US2A 1CR7A 5EJ3A 2R3SA 3KP4A 2F4MB 4DZJA 3AMQA 3MHZA 3AYAA 3LEKA 4RN5A 2E53A 4PLMA 4Q4ZF 1O4YA 3AJYA 1DG6A 4JZRA 2RNGA 2VBPA 4QDSA 1A3KA 1BI0A 2FSWA 4X0GA 4HQEA 1WH7A 3AYDA 5CYYA 4E7ZA 1MNEA 5FPZA 5FD6A 5EZGA 3TEZA 1Z7UA 2KIQA 2UY9A 2HNHA 4C9YA 3IPVA 1YOVB 4CXXA 4E4ZA 4KT5C 1FWZA 1CVNA 2W2IA 3BZ6A 2R061 1FOD3 2JB4A 4RGUA 2GIVA 2DOAA 2K9MA 3UNPA 2XPWA 2Q1MA 3GWZA 3THTA 3E5UA 1H9GA 4AHZA 3DGTA 4MGSA 4B44A 4AEMA 3WNPA 4XQDA 4D69A 3KE2A 3SH5A 1BM9A 4ENMA 4CDWA 4Z1VA 2BNNA 1FPN1 1O4XA 2ZFUA 2R7ZJ 5L9VA 1RHI1 4PGHA 5C9AA 1GP4A 1ZBA1 5FZFA 2KFDA 1RUE3 1S2BA 4UFHA 3T1LA 4UUVA 3JB8A 1RUH1 4JKLA 5FZOB 3EHKA 2IXCA 3B73A 3VUOA 2WNVC 5FB2A 4META 3BTIA 1USTA 1MW7A 3BROA 1ON2A 3V56A 2RJKA 2L7FP 4JDNA 1Y0NA 5FY5A 2A70A 2VKDA 3RWNA 2OQRA 2PFWA 4XHBA 3TO6A 4L92A 3K10A 3N05A 4CU8A 1KZHA 5C8CC 2DFFA 4HXCA 3CF2A 1ST8A 3E5XA 2FMLA 3TDZC 4PCQA 5BQTA 3JCUC 1ZZBA 1GMMA 1MZBA 2V1UA 3AG4H 3VD4A 1WGPA 4NRMA 2E1MB 5F0CA 2QSHX 2QUFA 3FXOA 2HYKA 4E2QA 3FBMA 2RG4A 3S0MA 1TG7A 2JEMA 1DQ1A 1ZZ8A 4M00A 4DQ2A 4JRLA 3POEA 4OAZA 2VZUA 1NY72 5EGOA 3OYGA 4ZTFA 2WLPA 4KGGA 4Q4X1 5A1LA 5JIUA 3KP5A 2OAZA 3AG2H 2KQRA 5GLUA 3OSGA 2XJPA 1FBQA 1W6MB 3DEMA 1FLIA 4ASNA 4M3CF 2LKPA 1UHWA 5KNLA 5FO9B 1GKBA 3M70A 3ONQA 5J1YA 2WV1A 3S17J 3I59A 4OULA 1XMKA 4KU8A 2G4IA 1TTYA 3TO7A 1RUOA 4M74A 2L7KA 5EYRA 2BXZA 4BQQA 1REPC 4URAA 2R071 2XSJC 2CV0A 2G19A 3Q8EA 4MVTA 3ZSJA 3BR2A 1O5UA 4KN4X 2LR8A 4E27A 1AR73 3Q8FA 5D8AB 1UOBA 4CDXB 1RMU3 4OWRB 3MPBA 3WQ7A 3GTGJ 4MG2A 2HBUA 1LKXA 2GDFA 3M7AA 3DU6A 4ZZ5A 4MTDA 2G7UA 2WO1A 1IQDC 2A3YA 1NTCA 3K4LA 3ASNH 3V0BB 1AZDA 1G3YA 5M5XJ 2WJSA 5BUVA 3DWLE 2B42B 3LKJA 4OUEA 1KQ8A 3REOA 4Q4Y2 1PMJX 2QENA 2E2IJ 5IT9Z 3D5RC 1MPXA 2W1WA 2ZGOA 2J5PA 4XFGA 4CDQC 3LL7A 2FBHA 3A4UA 3SNMA 4YW3A 1I1EA 3ERMA 1Z7S3 5FMOS 3HRSA 3K2ZA 3ZX7A 3AZZA 5HS7A 1WLCA 1KGYA 3KP3A 4EEFG 2WYSA 3ZN5A 1S7AA 2EA7A 2WY7Q 3T08A 3WDTA 4LTAA 5F1RA 2RM22 3MIDA 2VZ1A 2VGDA 1W28A 4QIWN 1H8TC 2A69F 2CNAA 3VYUB 3ZXGA 4LG0B 3P3PA 2DQLA 3RKWA 4AM3A 2P3JA 1HW5A 4WVMA 5DM7F 3O8HA 3M4FA 3SC7X 2W84A 1LHWA 1OYYA 4YARA 3FDYA 3J4UH 5GZGA 1AL0G 2GOXB 5GLVA 3NWSA 3USSA 4UV9A 1W9WA 1WWYA 5FUNA 2VXJA 1R36A 4LOCA 4XBNA 2WC2A 2P3KA 4QPIB 4WM7A 3KV6A 4C8DA 3FBIB 3N7JA 3HRTA 3M8FA 1G7YA 2NS8A 3HR9A 4BEHA 1A6IA 1HC8A 4LJHA 4BQ2A 1YW7A 3AMMA 3JR9A 2R5YA 1ZVFA 2VXRA 4A42A 2WDBA 4DEQA 2CW0F 1EY2A 2XOMA 3AJZA 3HOWJ 5JDBA 1DYOA 2YC2A 3SMHA 3H8RA 3PIGA 1WSUA 1NE6A 4PI0A 4AIKA 2PHFA 4Q27A 2JE7A 1JTYA 5BNOA 4MADA 4QHZA 3DKXA 2IZWA 2W48A 4JHZA 1TP4A 2RAEA 1Q8SA 5FZHA 2W52A 4NAMA 2PLV1 2ICWG 4M3CB 1SCRA 3IKWA 4JGZA 5CB7A 5GM0A 5GZEA 3V4GA 1U9OA 4BMEA 3HMYA 3LOCA 3WINE 4BE2A 2FX0A 2ZAHA 1TVGA 1AUYA 1YLLA 3HSRA 2A6WA 5HVQC 2WWYA 3BTXA 1H89C 4HKLA 2IS2A 1R5ID 4C3JJ 5HDNA 1H1IA 4M3EA 1H0BA 1DHKB 3FUOA 4IQPA 1LU1A 1IGOA 3U1KA 3C2HA 1DGRM 3K4CA 2O61A 5C8WA 1TQMA 1T39A 2NS7A 2XAHA 2ZMLA 2FUG2 3H3LA 5H6RA 3FHNA 1E3PA 3MW3A 2W85A 1JZ2A 4Y3OA 3PNTA 2WL1A 5FPBA 1T0FA 2X09A 3H1CA 5A7NA 4GXLA 2M34A 5HNHA 1BJZA 2E1CA 2JX9A 1ZYBA 3HPHA 3HGGA 1WJAA 2ZZQA 4WZFA 2DPUA 1CAWB 2JDHA 2EWNA 5EZWA 4Y5SA 3IHUA 4LBMA 3GCWA 5AFEA 4XBFA 3LSMA 3WGHA 5IY5H 2JB8A 3ENRA 5CAZA 5HI0A 4UVAA 3RFRA 2KHMA 1MBHA 2IC1A 3JRHA 2ZJQF 2W5FA 3J8F2 2L3DA 4LB6B 1U5TB 2BW3B 4AVAA 4GH4A 3JTHA 3JSPA 1S7OA 4YM1A 1AXZA 2VQGA 2YX7A 5D2AA 4Y26A 1ND3C 3AL0B 1FOWA 2SLIA 4UV8A 1YNAA 1DYKA 1UG0A 2LOOA 1D0GA 1U6GA 2VQAA 2HKOA 3R6SA 1H8VA 3VEPA 3CC2I 1A04A 1Q5OA 3N9MA 4A44A 2FCVA 2QTWB 1HW1A 3JCIA 2R7DA 2WA0A 5KXEA 4RB3C 1W36D 4A3XA 1WBLA 2XV4S 3KGZA 4EN8B 2WABA 3LSJA 3B69A 2WZR2 2HGCA 4W65A 4A3IJ 2LG4A 4OHYA 2M4GA 4CO8A 5A33A 1QPMA 5HLIA 5DCMB 4BM8A 4FPKA 3TN93 4EGZA 4KBZA 3KVAA 2WO7A 1IHMA 4I01A 3JQWA 5FREA 3PJYA 5L19A 1TME3 2CL2A 3CO7C 3I3LA 5GLTA 2QBXA 3F8NA 1HRV2 3IMNA 3B02A 5FP8A 1NXMA 3O1SA 5FY1A 4K40A 3VPRA 1D0HA 2VCAA 4IGQA 2DT7B 3SZGA 1GP6A 3GZUC 3HJRA 4FOYA 3OIPA 3ZVXA 1VQ4I 2YU9J 3LQQA 1XDUA 2KZVA 4KU7A 4QAWA 2AZ5A 3KPHA 3PSIA 4XMYA 1MBKA 1VRH2 1IN6A 3UKGA 3GTMJ 1RZ4A 4X6RB 1JE8A 2GZWA 4XAAA 2UY8A 5GAGJ 4H3WA 4XONA 3CEWA 3O1TA 2WWUA 4LOTA 4P02B 2EIMH 1J75A 1SFUA 4OQ9A 3FK7A 4FCYA 1BA5A 1HKTA 1ULYA 1OPCA 2MNGA 5C9AC 5DYMA 2BUKA 3FM3A 4MGKE 3INAA 1W9FA 4XBLA 1R64A 1V6JA 3NV3A 1U5ZA 1VMFA 4Z82A 1VMHA 4O9GA 1GZWA 1ORKA 2VC0A 3I9V2 1D4M3 5FMDA 3KGLA 4P00B 5F5AA 2ZGPA 1F43A 3A02A 2RR11 3WNOA 2ZX4A 3LD8A 1HV1A 5F04A 3I49A 2KL4A 4GYIA 4XF1A 3SLIA 2J1VA 3VDDA 4HMZA 3C2GA 5FFOC 4WM8B 5F7UA 1K7AA 1LHOA 1SFOJ 4L99A 5ICEA 4YVWC 1PVC3 2VBZA 1IUYA 2OJED 4BBSJ 1RUF1 3WW4A 2RS31 1OD5A 3OL3A 2EFQA 2QDRA 4B29A 1AR83 2D40A 1QGLA 2JJ7A 1UZ0A 4RBOA 4RR3B 2F4LA 1Q3EA 2RDPA 2D6MA 3I3QA 3AAFA 2XROA 2FU4A 4CVUA 2M2EA 1CAXB 1RL3A 2E71A 4OU0A 2D1HA 3K2OA 2RV9A 1J84A 3G71I 3AKTA 1JU4A 4BQWA 2VC9A 3SISA 2VG9A 2RMU1 2WAFA 3VL8A 4YVSB 2Z1DA 1C8M2 4KI5M 4LNVA 3AYEA 5AC92 1BVP1 1U5IA 5JOZA 1X33A 3E1SA 1FEXA 5C3PA 4JC1A 1W8OA 3LFMA 1PO23 4HNVA 1NH3A 1XBFA 1V6MA 4EYUA 3N35A 4Y5TA 3QPLA 3CMEI 3FXUA 1BIBA 2HDCA 3ZFGB 3KEQA 2XVKA 2VR4A 4CSWA 1R49A 5L73A 2RN7A 1OR7C 4D1QA 1QOSA 2IXIA 3J7LA 3I8TA 3ZMSA 3I2HA 3D5SC 2GOMA 3RYKA 1OXCA 3ALQA 1HB2A 3SCGA 4GD4A 2I2SA 3F9KA 3BB6A 2XGCA 3ZMOA 2FA5A 4HN0A 1PUEE 2CQQA 1UKGA 3ZYGA 3PLQA 3RZOJ 4E4SA 4CEWA 4ZPIA 2W94A 2DVFA 3NAPC 4IZZA 1BMV2 2WSVA 1VI0A 1REDA 1IRZA 2IS4A 2IPQX 5KXCA 1JHJA 3TL4X 5FLIA 1O3RA 2LTNA 5KR7A 4AIJA 2IFWA 2HKXA 3FFZA 4CCDA 2EQRA 5FWEA 4E8DA 2M8GX 2WSUA 5FZIA 3AFHA 1Q43A 1OKOA 3E7LA 4KUMA 1LRHA 3HD8B 4A2UA 3I64A 4MLOA 2D97A 1NY71 4HBNA 1FYMA 1GV5A 4XN3A 1O59A 4A6EA 3LSHA 3O1MA 4A3ZA 3S3MA 2HWE1 5FP7A 4FTEA 2H09A 2DUPA 4GCVA 5T5OA 1YJWI 4D3WA 2QJVA 4J00A 2EZLA 4G9YA 3MUY1 2MLGA 1V9U3 3VBRB 3HXLA 2WNUB 1YQ5A 2FDHA 2A61A 3ZYRA 4I3PA 4BQ5A 2A68F 4RB2C 2VU9A 1Y0UA 4ZYAA 4WBBA 2Z16A 3RCOA 3GBGA 1FSEA 1FX7A 1K3IA 2XUEA 4XOGA 5EJZB 2CQNA 2A6XA 4G4FA 5E8GA 5LY2A 4W97A 3AZWA 1O7LA 2DJIA 2KJCA 1ALYA 3HJEA 4K1ZA 1HCRA 3GF6A 2YU3A 5DEQA 1XRUA 3VBHA 3IAQA 3EYYA 3WTWC 3BOPA 3CDZB 1RXGA 3RQ4A 1OF3A 2EFPA 3WQBA 3HIFA 2AQEA 5B4XA 3ZQCA 2BZDA 3DPLC 2B4KA 1ZGAA 4CEYC 2XDVA 9ANTA 2CHHA 1OI6A 4EJOA 2BXYA 4AD9A 4AI1A 2EXJA 4LBQD 3SEQA 3W5NA 1X1PA 3VBUC 3T8TA 1JI6A 3LPGA 4RS5C 2VMDA 4LBNA 4QX0A 4Q0SA 1ZRIA 2QQAA 3BZCA 1VBD2 2X5IA 4EJTA 2RM21 5TRDA 4IE4A 4CXYA 3BPZA 1YFXA 4EATA 3ACHA 3NAUA 1BIAA 1OLME 2PHWA 1AL22 1D4VB 4Y33A 3DKYA 5K7ZA 4WVVA 3U78A 1XCBA 2WO2A 3TEYA 2JA6J 4BIOA 3SJMA 2HDDA 1G3TA 4XM3A 3I53A 1MMNA 4FT8A 2OPWA 5BPDA 3KFWX 3KS7A 1IPKA 3GFIA 2HEWF 2PJRA 3P6BA 2ADEA 1ZBE2 1XSVA 2XPUA 2X1EA 3IIIA 1SAXA 1U0JA 4XLPF 2E19A 2HYXA 3BODA 4XXAA 1ZZ6A 1OVSA 1FNYA 1DQ5A 3S7IA 4D5FA 3PO3J 1JT0A 1TWAJ 2R4GA 1E5SA 3A2KA 1F35A 3QAHA 4KBBA 1Z1DA 2GC2A 4XUQA 3TOBA 2VCMA 3QOPA 4DGWB 4DJAA 3Q3SA 2XBO3 3M3OA 5A32B 1YIPA 1LESA 3DP7A 3TP0A 4HSLA 4NO4A 1D5YA 1VP6A 3RMXA 1JZ8A 4S04A 2MLKA 3WTYC 3WDUA 1Q1VA 4B1LA 3H8OA 3OUIA 3HUGB 4BY1J 1YRNA 2JKBA 4IEQA 1QIQA 2HWF2 1RR8C 4XCBA 1REFA 3J80K 3FZVA 1W7PD 4EGYA 4MO3M 5H9QA 2VQLA 1ACIA 5JR2A 1JYCA 1R083 5FXWA 4YFKF 5B2GB 5FYBA 4UW6A 2D3PA 2EZKA 3ABTA 3QYBA 3RKQA 3M1HA 2WUHA 3RRDA 4MEXF 5LZ6A 2VT2A 4P08A 3CJIA 2BGCA 1ODMA 2Y6HA 3H8UA 2A73B 2NZ9A 3ZSMA 1PO13 5M3FJ 3VZNA 2XKOA 2XL7A 1U8BA 1SLIA 1NCRB 2RS53 1O7FA 4Y4RA 1POV3 1L7QA 4CU7A 4W4ZA 5L7OB 1ZZCA 3CJRB 2DQRA 1GBGA 3QYFA 3FWEA 4XUOA 2WA3A 3SFZA 4O9EA 4RB1A 2F2EA 3NVCA 1S1AA 1IRXA 1K78A 1W3XA 5FZLA 3K4BA 4ZYGA 3H7YA 4FOVA 2EA2A 5ABJA 3VZKA 3LSEA 3S15J 2HWB2 1VQ6I 2DK5A 1ASJ3 4XURA 4YG6A 1AR71 4IGOA 3T2OA 1RMU1 3G1OA 2V6CA 3OV8A 3S2DJ 4M0HA 4NN0A 5G04L 4FFFA 1Y9MA 2WRAA 4FBFA 3KCCA 2BFUS 1D8JA 3F8FA 2AQFA 1IZ3A 2HBTA 4BS9A 2C5DA 3AMNA 4XXPA 3POFA 2H6CA 4GB32 1ND2A 3UV9A 3IV5A 4JOMA 1IG0A 1XYNA 5JZGB 2NVXJ 4PFOA 4TV7A 1PNGA 4OFGA 1Z7S1 5FKLA 2BY3A 5FO5A 1G9BA 1PZ9A 5ED4A 1JOBA 2IVMA 4IE0A 3I2JA 3KZZA 4DMIA 4CDGA 3J8F1 2BOIA 1SLBA 3RI8A 2C1FA 2IXLA 4RQPA 2WBKA 4XTPA 4UNOA 4Q8KA 4LO6B 1A78A 1D0YA 2X0LA 3WTZA 4WVWA 5A7OA 4BQ3A 2VXDA 2E33A 1HW2A 3RJRA 3H3UA 4GIQA 1JKRC 4IHXA 3VDDC 4NHJA 1COV3 2MEV2 3HNYM 3K75B 4L9TA 3O0XA 3B7MA 5FJKA 3OBTA 5A7PA 2HTJA 3TQNA 4I09A 5KAFC 3FXQA 1NG0A 1VLNA 1O3SA 4OCTA 3D5LA 1RJ7A 1W9YA 4R9BA 1AX1A 4XKWA 2WZR1 4C3IJ 4A7KA 3GJBA 2BPA2 3DU5A 1TW2A 4NMIA 2V6EA 1NG6A 3J7ZI 2M30A 4F52A 3A01B 3ZPLA 4A6DA 4HPQA 4QPGC 2XLGA 4CP9A 2LM3A 3WTVC 2Y30A 3LAJA 4KWLA 1X50A 4AE2A 1O3TA 1QJX3 4ATEA 4IHWA 4XRSG 1HRV1 5DN2A 1GSLA 2BOLA 3OYLA 4RGSA 3THDA 2G9FA 4XOTA 3ASIA 4LEJA 4NIIA 2NS0A 2DK8A 3MW2A 3DPRB 4UUTA 2O9LA 2VJJA 3KQ4B 3VDXA 2JIGA 3A4CA 1SQ4A 3I2DA 4JQRA 4HDVA 3POGA 2QQ9A 4B4RA 1VRH1 4C1XA 2DN0A 3ZSLA 3WZ1A 3S2WA 5K5QA 1S55A 3CU7A 2EFOA 3HNBM 3CDIA 3FHZA 3FHQA 2FD5A 3DYOA 1WKYA 3BR5A 4IRHA 3C2UA 3FIWA 4PQQA 3H50A 5ISLA 3ILRA 1KU3A 4I99C 1VBA2 1FATA 1PUFA 1X3UA 1W2AX 2EXKA 1CQTA 4CUCA 2W1SA 4A6OA 2DDBA 2VNVA 2Z3YA 4COWA 4ATFA 1LEAA 3OS0A 4KWKA 3WP6A 4EWDA 4R8HA 2GH8A 4ZYEA 4MXWB 3WG9A 2M87A 2BERA 2NYXA 3PVNA 1NCQC 2EF6A 1EV12 1C3HA 1UD1A 2VC1A 1FP1D 5EDNA 2VW2A 3Q0UA 2C0ZA 2WINB 5ACA2 2BP6A 2R93J 5I8TA 1Y8QB 5JFRA 5ILSA 1D7PM 1ZYRF 3GZ5A 4ITCA 4ASMB 1U9NA 1HSJA 3MZYA 4LIUA 3ZFFA 5KXDA 2XVCA 4QXHA 2L54A 4AZZA 1OJLA 4N7IA 1NYWA 2I5UA 1SPPB 5C5TA 1XMXA 3JD72 1JHNA 3R61A 4HPKA 4PJLA 2JMWA 3ECQA 1POGA 1UX7A 2K85A 1ULCA 1YE9A 1K83J 3CMAI 1YFWA 2VJ4A 5F39A 2G9GA 1MEC2 3ZQFA 2PHDA 5CFDC 1T08B 3L2UA 2P17A 4Y1ZA 4LBOA 1V70A 3KT4A 1BXHA 3K3NA 2QQPA 3UKTA 5C5UA 4ETSA 1QKQA 5M5WJ 1U5XA 3OYWA 2DMTA 4FE7A 2DTWA 2WNVB 2Q2EA 1DPRA 2A07F 1W2TA 2VOWA 2E7TA 4XL9A 2L2OA 1N47A 4LXLA 2JE8A 3BC8A 4OUMA 4NOTA 2M7BA 3CJNA 3PQKA 4XF4A 2ZMKA 1MS0A 4AFDA 1HXS3 2XAJA 5FBJA 2PYTA 4LHSA 5IP7J 4HRIA 1PGL2 4GJZA 3IRQA 5LB6A 1IV8A 3LOIA 3RDIA 4XKCA 1ULPA 2DMQA 3BT9A 2YX4A 1VBE3 2J42A 2QKLB 3VBSA 4XDPA 2GXAA 1YXWA 4HQMA 1W99A 4MO7A 4LHNA 1V00A 5F0HA 5DZFA 2V26A 3VZOA 2F4OB 5FZGA 2AREA 5L3EA 3PO2J 1W6OA 3WQ1A 1FIPA 5A80A 5LHGA 2WAQN 2DA2A 1Z0HA 3UR3C 2NP0A 1JGGA 4IXLA 3CO2A 5HDKA 1BLZA 3BVCA 4ZONA 2XWJB 3E6CC 3MDPA 1BMV1 1AOYA 5A7WA 1GVJA 2EH3A 2P5BA 1HBXG 4Q5SF 4MYEA 3EQEA 1ZG3A 2VMGA 5DG1A 3CZJA 3HL2A 2V1DA 1UAIA 1SBEA 3DLLF 2V72A 4AGGA 2Y31A 2VUJA 1SMYF 1W8TA 3I2OA 2PLYA 2L4AA 3FF5A 2VQCA 1U12A 3WLUA 5H9PA 5T50A 2DDUA 3WQ0A 2BW8A 2E7AA 4YGEA 1IOAA 3S93A 2FCTA 2XWBB 5A1FA 1AYN2 1ZAOA 3WF2A 2NLRA 4CCCA 4I2OA 3U21A 5K5RA 2R7RA 5CBLA 4OHXA 4RB0A 1C0WA 4Z2AA 1W0NA 4YZ5A 3UT0A 4JX0A 3DCQA 4QWNA 4EWAA 3B6CA 1DZRA 1TEIA 4QPYA 2Y6LA 1QNTA 5FYZA 4BXSV 5JLWA 2JKXA 3W21A 1VBC2 1J3QA 4RAFA 5A6ZA 5DS9A 2XAGA 1XNDA 4IL7A 1H8AC 2UU8A 3EMRA 3PMSA 2Z69A 4LB5A 1D4M1 3L2YA 4AVCA 2ELKA 3BPSA 3LSIA 3P3NA 1DIWA 5IHRA 4CDQB 4PSXA 3VB2A 2OBPA 3PTRB 1YEWA 2XGDA 2HS5A 1GNHA 2WR9A 4QX3A 4AVBA 1L3JA 2CWSA 3IH2A 4XORA 5E79C 4QX7A 4UXNA 4AFAA 2AACA 2PX9A 1BEV2 1DGLA 2VZQA 1GANA 2NVYJ 4QKFA 2B5HA 2XIGA 1RPWA 3N3HA 2CMPA 3PUSA 4MEYF 4K9SA 4G6TB 5DAPA 4B1RA 3BR0A 3AK0A 1X9TA 5E89A 2ZEYA 2D7FA 4KL1A 4LA2A 5I0DA 3R0JA 1QQP3 4KMFA 3RI4A 2M4KA 1LHUA 1V6NA 3H0DA 4E2SA 2WFF2 5FP3A 2R32A 2D44A 5A3NA 3D0JA 3M3QA 4YPJA 3POYA 2DVDA 4PIXA 4HANA 5JSRA 4Y7NJ 3GVAA 4XLFA 1RETA 1VBD1 4HKOA 1SVLA 1PO21 5A6XA 1OQDA 5D6EA 2W1UA 5EJCA 4BQXA 2IA1A 1YQCA 4FAGA 3TRSB 1A31A 4PLOA 1F15A 5IP9J 3D3AA 2WZ8A 2FNAA 4U0YA 2Q5TA 3TBDA 4P5OA 5HV0A 1WVRA 1AL21 3CCEI 1YUDA 3K4MA 3OYIA 1RGSA 5IYDJ 1S4CA 3A0NA 1YFUA 2K9SA 1ULGA 2CU7A 2R7TA 2O0OA 1PVXA 4G8XA 5BNGA 3ZQGA 3H9QA 4CUAA 5IK8A 4Q48A 2BWAA 4GZ9A 1SCSA 2WYFA 1CF7B 5F32A 5J3LA 2BOJA 1S0DA 1LDKB 5FUIA 4DRVA 3KV5A 4GWNA 2VZSA 5KWRA 2JDPA 3BI3A 2PQ8A 4L11A 3GM8A 3OF1A 4BK4A 2W7NA 4CYCA 1ZRCA 2JDKA 1UPSA 2VMHA 3BTZA 4DXSA 1VBB3 5E88A 3MPPG 4QQ2A 3K48A 4QX1A 4Q4V3 4A0XA 3WCSA 1D2QA 3VBFA 4YG0A 4XYXA 3HOVJ 4WXCA 2KRFA 3CJTB 2VZTA 4IV3A 3UKNA 4CXWA 2CQXA 2G0EA 2KDOA 3R4KA 1OFSA 4RQPC 1LOEA 2R6QA 5I0TA 4S2DA 4PF5A 4HF2A 2H6BA 3I97A 4O3MA 1OQEA 1YYNA 4BHPA 1YW9A 3I2GA 3KZ4C 5FO8B 1GNYA 1AHDP 4PCRA 5KCMA 4BXUA 2NM1A 4A5MA 2VJXA 3OBZA 2W24A 5T55A 2LKXA 4KJZA 1V9U1 2CUZA 2MABA 1FMD3 3USUB 2LSOA 3OWTA 1VMJA 3WP3A 3WF4A 1XYOA 4FQ4A 2BY2A 4IESA 1F5TA 4G94A 2QQWA 1DP0A 1UIKA 3O14A 5DM6F 3FL7A 4P1WA 3V65A 2K2SA 2HWB1 5LW9A 3WW2A 4KG8A 1GUUA 1EAH3 4L9JA 4LOSA 1YI9A 2CFXA 1PYVA 3K9TA 4IOAF 5FQ0A 4NUBA 4XN0A 1B35C 5JIAA 4NB5A 5FZ8A 3CZUA 4WV8A 3ACFA 1AKHA 1SD4A 1ND3B 5K9YA 4GB31 2CH0A 1JT6A 4RGAA 1Q8OA 4QX2A 4LBKA 4KNYA 5F6LB 4HSJA 3BTYA 3OB8A 3O12A 3BJAA 4PI2A 4QKNA 4DIQA 2P5VA 5HXMA 1LDDA 4OHZA 2DA1A 2DYCA 3S3OA 2DI3A 5IK5A 4AR2A 3NWTA 2V5YA 1CPNA 4BBRJ 1QVUA 1E5IA 1WJDA 1ENRA 5J1UA 1FBUA 2DCKA 4KMQA 3DXJF 1LNSA 1B1BA 5FD5A 3F22A 2P6TA 3ZDSA 4R4ZA 2LRPA 1LU2A 3H9JA 4D94A 2HWD2 5C4XJ 4Y13A 5JVGF 1GLNA 2MEV1 3B00A 3ZR8X 4LIVA 2ZGRA 2GLOA 4AEDC 1KJLA 3IPVB 2O8XA 4FI9A 1F4KA 2VKHA 1RUC2 5JHFA 2RS12 3HDDA 4ISRA 2VZ3A 2BVLA 2R063 5FYCA 3W9AA 1OFCX 1NA1A 1IRFA 4AGVA 3OCPA 1AXKA 1T6GC 5DUKA 2Y0MA 3RTRA 2HLEA 4HOBA 3A21A 1LUJB 2QZ2A 3KYCB 2L4MA 3GXUA 5JPNB 5GAEJ 3M8LA 1FPN3 2YBPA 2GC1A 3ZOIA 1J3PA 2ID6A 5C9AB 4FQZA 4FSJA 1RHI3 4NC7A 4V2FA 1NLSA 3MYXA 1RUD2 3ZSKA 2VQTA 2LYCA 2RV8A 1ZBA3 2DCTA 2DURA 5CISA 2H0BA 4R1HA 2VE8A 5IVEA 1PIV2 1RUH3 4K3UA 2OUMA 2EXHA 1PK6A 4IDZA 2XH6A 3I3DA 1S0IA 3OOUA 3WGIA 2R1DA 4S0HB 3WNKA 4I0WB 3LE0A 4I0BA 4KQ7A 3T30A 5EWSA 2CQ7A 3PVOA 2VQHA 4YVWB 5FDBA 5BY5A 2NOJB 1VBA1 3RSJA 3BTLA 5FR3A 3AL0C 2ZXWH 1IS5A 2NMOA 3N9QA 3B5LB 5EYYA 1MIJA 2ZX1A 3VBSC 4YW5A 4DRRA 1TZLA 1PO11 2IP2A 2P5LC 5BNNA 3K1NA 4W6XA 1EPZA 2VULA 4UB6C 3TAYA 4XKBA 1J1TA 2J1RA 3VKLA 1XDSA 4FPGA 2V1NA 1EV11 1PVEA 4FQGA 5D5VB 5EGOB 1LGCA 4I02A 4C2TA 2VB6A 1OCCH 3KCYA 4KYWA 1W6QA 4YYOA 3MI8A 1OOPA 2GN3A 4Q4X3 5C33A 2YPDA 5LA9A 2V7FA 3C8XA 5IOZA 1IF1A 5EJ1B 3HG9A 1PX4A 1TMF3 4XQ4A 1GOFA 4A3BJ 1RRJA 1GQPA 3DF8A 3JD71 2BWCA 3TOAA 2HPIA 5F2WA 4C3HJ 5FYVA 4KISA 3NW4A 5C3SA 4OIPF 4QXBA 3EYPA 3I59B 5FP9A 2P4WA 3ZIXA 5DAQA 4JTOA 3GF2A 1DU6A 1LVKA 1MEC1 4GKXA 4A7YA 4LO5B 1Z6RA 4HVOA 3KD4A 2ZGSA 5E8AA 2R073 3A23A 3HN3A 5HDGA 1QOTA 2LALA 1ZA4A 1DUXC 2L9LA 1QXJA 1DFQA 1GXQA 1V4RA 1DP3A 2VOXA 3FLRA 2FE3A 5BOXA 2E7XA 3SKVA 2WNEA 3OD0A 5A6QA 1BBT2 5M3MJ 3JBG2 4D0QA 1ZRRA 2TDXA 5FZOA 4M3GA 5AIQA 3DYMA 2YDEA 5HCAA 3NAPB 1IXRC 3O1UA 1BKZA 2PFBA 1LAJA 3I3MA 3E5QA 4ZJZA 4L9VA 2QM3A 4HV6A 3H9GA 1TQIA 2LY9A 2UWAA 3GJAA 5FYYA 5FYIA 1LPQA 5FWJA 4WM8C 2QQMA 1YQ8A 3I3BA 2QKDA 3KQRA 2XXZA 3CCQI 4NHKA 4L0PA 4ZYDA 4RA0A 1J5YA 3J80Z 1GNZA 4RGGA 2VNOA 1QJU2 3TB0A 4LBQA 1HXDA 3HOUJ 2NOGA 3OR1C 2DODA 2E60A 4IV1A 3QRFF 1TWCJ 5IAVA 3OGVA 4YW7A 4IEZA 3AZVA 1T2XA 4R9CA 4XMAA 2TUNA 5FIXA 1A8DA 1QJX1 4MH0E 4Y1VA 5FZEA 2QCSB 5IVCA 2JRMA 5F3IA 1VZ0A 4LR4A 2VW0A 1UNBA 1H30A 3KM5A 2PG4A 3W6KB 2VNGA 1REEA 4A5NA 2ZGNA 1W6MA 4FTHA 1U2WA 3B01A 4BEHB 1AYN1 3LFUA 2RREA 3WHCA 3EO6A 2R5YB 4RFRB 2RJ2A 2C9AA 2GMEA 2R0HA 4G9SB 2Y0IA 1ZGWA 1OF4A 3OIOA 3FLTA 4BXFA 2V4AA 1FIAA 3BCWA 1STMA 2LKSA 4ARXA 1UXXX 3ZFGC 1KEXA 4B4CA 2HH9A 1G9AA 2XJTA 5CA6A 1VBC1 5EFUA 4AXOA 1W2NA 5BNOB 4IVNA 4MQVA 1IN4A 4JP0A 1G86A 4YNIA 5D8AA 3JRDA 2JSPA 2ID3A 4XMIA 2GMPA 4KFCA 4CEYB 5J1XA 1WZXA 4HVQA 1F4AA 5A1AA 4ASLA 1DDLA 1D0ZA 2ZTNA 4BKXA 4HF0A 1IXSB 3PMEA 2N7GA 3POIA 4XIOA 3VBUB 1T33A 1Q8QA 2H94A 4CZZA 4QHBA 3BCAA 2PLV3 3SH4A 2DO7A 4GDFA 4RS5B 1W6NA 5T54A 4FAHA 1HIXA 3H1MA 4J1XA 1W7PA 2CWEA 2O03A 1HQLA 3ZPYA 1BEV1 1PX3A 3WVJA 2ECCA 4JCKA 2WAQA 2R7SA 4QDRA 5CKTA 3ZPOA 2VMCA 3ZMUA 2ETHA 1WKMA 2A3XA 3WDXA 3I4IA 2VBBA 1XB9A 4BGDA 3NJZA 3BTCA 1ZKGA 4NIAA 1OD3A 3WT3A 4QX5A 5DDJ2 2ELJA 1KRIA 2W92A 3EYIA 4DBQA 4FCAA 4LG0A 3F6VA 2WFF1 1YFYA 1FV2A 1WJEA 1FV3A 4UHTA 1QQIA 3NNFA 3POSA 1W04A 1ENHA 4UBHA 1XC6A 2XVLA 3F2ZA 5EP9A 4HSRA 1QHDA 4C2MJ 3P5JA 3U1DA 1K6YA 5J4VA 1H4GA 4AU7A 1ODNA 4QPIA 3KP6A 3LIGA 4U7DA 3LA7A 2KA3A 5HLHA 1I1SA 2RQQA 3PUHA 1HXS1 4EJWA 3G7DA 2HQRA 5CYVA 4YLZA 4AC0A 4OUSA 4BLJA 1NHAA 4ISQA 4NHYA 4EROA 3ESWB 3ZMNA 5ICFA 5GP9A 3U07A 1OT5A 1FJLA 1W4MA 3VD9A 1J58A 1ULDA 2CS3A 2LVSA 1IKPA 2DT6A 2OT7A 4L8QA 4FPHA 3U2RA 2W08A 4ZZDA 4CPBD 3D4KA 2HYFA 3OY8B 1IN8A 4B3AA 1QXPA 4Q26A 5JR7B 3K51A 3HT1A 1DGWA 3C1DA 3I5UA 5D5UB 5KHIA 3I7DA 2XB6C 2OS2A 4UXAA 4IHVA 4FX0A 1RKTA 1S0FA 2L02A 1GQGA 4ZXEA 4TYSA 4BQOA 2XAUA 4NIDA 4BXXJ 1HSTA 4M3CA 2KZGA 3CUQC 5DZGA 1KU2A 2DA7A 1LHVA 3G1MA 1XGNA 2M45A 4Z07A 1MS3A 3KLNA 4XSXF 1C1LA 4LKFA 2XJVA 3CCMI 5SV5A 1KU7A 4QB1A 4F83A 3L00A 2WO3A 5A33B 3PU3A 4IXAA 4HG2A 3AVSA 3S6PA 4XHXA 1Z21A 1MQTC 1X8MA 4F92B 4S2FA 1JOJA 2OZ6A 2L5QA 3C3VA 4M9ZA 4PJ0C 5LCWL 1OKRA 5CLSA 5E1WA 2OZJA 1KJRA 1WJ5A 3N36A 1LENA 2PHXA 4BA6A 4B48A 1E3HA 1AVBA 3MKLA 1XG1A 1T38A 5FZ1A 4ZZLA 3O7OA 1X9PA 4CUGA 4ON0A 3LAPA 3BKZA 5CG9A 2XG3A 4H14A 2HEOA 2WAOA 3ZCOA 4N9IA 4BWOA 1NA1C 3FMSA 5DABA 3VHNA 5I8YA 3AXDA 4YRVA 4NRPA 3B93A 1H2LA 2GMMA 1MZEA 5DCFA 4BACA 3GHNA 2VZOA 3BIEA 1MKMA 5T5PA 1W8HA 1OLTA 1TT0A 1WMEA 4JKKA 1XXNA 2K46A 3SYTA 4J19A 1HB3A 5FKNA 4DEVA 5IVJA 4FOWA 2JA5J 2DFCA 1CAWA 3T1BA 2HOSA 3BQZA 2DTRA 4IRIA 1QWRA 3FXMA 3BUCA 2O6GE 5EV7A 5BXXA 3WTXC 1PK6C 3O3KA 1LEBA 5LA1A 3JXSA 1Y4WA 3GCXA 1BL0A 2OKXA 2RR13 2X8KA 4JGYC 1IG7A 2WB1N 1ETOA 1T2KA 3AX4A 1U5TA 3VDDB 4ZU5A 4FPFA 1LQ1A 3AKQA 1UG2A 1QQP1 1W8ZA 2WWJA 3E6DA 4PLNA 3GYDA 1XX5A 3K3OA 1R092 4PHZA 3BDDA 2D6LX 1OLRA 2UUZA 4U87A 4IKFA 4LG3A 1VJ2A 5DD8A 2VL4A 2VODA 4QGMA 5C4WC 1Y9QA 5ERIA 2Z33A 4KA4A 2LC2A 2MBFA 4FFHA 1L0OC 1R1UA 4QPGB 1NCRC 2PHRA 4PJMA 2LUWA 5FMBA 1QBJA 4E9KA 4BQYA 3GFLA 3JQXA 1RR7A 5L7OC 2W1OA 3ZXJA 2J22A 4GFBA 1YIFA 1X4OA 2Z79A 1T6SA 1YO8A 5DCMA 4M4PA 5J8CA 1OOPC 1AWCA 3QH7A 4AWDA 1FOKA 2ZSHB 2DYRH 3ME2A 3H7JA 3RPQA 2RS11 2QGUA 1JH5A 4R4XA 2YC0A 4AVZA 4MGQA 4Y5Z0 4XAEA 3C7OA 2DTZA 2KDZA 1ACCA 2VUMJ 2MC4A 3J7MA 1FNZA 5K7PA 4FPEA 1BN5A 2R7QA 2WV0A 2C9KA 4JYKA 3FN9A 3ES1A 2KIUA 3ZYPA 1A34A 5FK8A 1ZG5A 1ZZ7A 2ZXQA 3KEOA 1VBB1 3GLXA 1XS9A 1RUD1 2E32A 4NIHA 4P9FA 3ZR5A 1JZ3A 4ZS3A 3KB5A 3FFQA 2Y69H 1JGSA 1IS4A 1PIV1 5KXBA 3R4DB 5FJHA 3UGGA 1N25A 4EN0A 1H9TA 4LLLA 3LEGA 1BR4A 2MSYA 3CCSI 3R4UA 1B6AA 2D6PA 2ARCA 2IJLA 2OCEA 4IJAA 4SBVA 3ZN1A 1HOMA 2PBIA 5FAXA 1I3AA 3DBRB 4XNFA 4CEWB 3S5QA 1WCUA 4CHUA 5F8PA 2ZNYA 2QSGX 1T95A 3HOTA 1ZTRA 4Z6YA 3QBQA 2IA2A 4HEA2 4HLXA 1G3WA 5H6QA 2AXLA 3LMMA 1R1A2 3F23A 3BJOA 4UOJA 1SC7A 4K1YA 3S14J 3MFAA 3LEIA 1OA3A 2Z99A 4Q0QA 3WNXA 1KYZA 4RR3A 3AG1H 4GULA 1R1TA 3QACA 4EQQA 4K2EA 5CFDB 5BYNA 1X7NA 5K1YA 4UAPA 1ETXA 4QQPA 3KHBA 4RFT0 3IBMA 5FPXA 3RVHA 1UZZA 4XZUG 4BQNA 2BDRA 2MFZA 1S3JA 4QTRA 5LASA 4RAZA 5JSOA 3HEIA 4YVSA 1BCXA 1CZSA 3GTPJ 1RC9A 2GA1A 4D6RA 1CESA 1EUTA 2NAZA 1WWXA 1VQLI 4AYUA 1W03A 5JI7A 3WF1A 3F6OA 5LWBA 1V54H 1JW6A 1Y7BA 1LB2A 3THPA 2E31A 4HFSA 3DPRC 4KITB 1POV0 3JRGA 1QJY2 5FK7A 3HPGA 1S7EA 3OS2A 4NPLA 5L9BA 2A6ZA 2FZ2A 2Y33A 2WTEA 3A0KA 4KIBA 3MIHA 5DZEA 3AG3H 1V6IA 2X1CA 1VALA 2HXOA 1XOYA 4G6QA 3VBHB 5IVFA 5HCFA 2JXAA 2W68A 2KMUA 2PHTA 1BK1A 1XQNA 4NAOA 4IETA 4U36A 3VBOA 1A36A 1BBT1 4QDQA 4J1WA 3P1IA 3GUDA 3OGRA 4Y22B 2VT3A 3QU3A 5F5CA 1JYVA 3RKYA 3T2PA 3GX4X 5FZBA 2ZC2A 1UOFA 3LWCA 4Q4Y3 2KKOA 4YW6A 5JI9A 2W87A 1IV6A 1CIYA 2Q8CA 3U75A 2D3RA 5J3UA 4LO8A 3FBYA 2DCZA 3PJQA 4AHXA 4YGBA 1HKDA 4Q4W2 1G9CA 1JN2P 1UELB 4C30A 3VHOA 3QPHA 1YHQI 3ETPA 2BYVE 5CQEA 4L5JA 1K5MA 4LUKA 4EN9B 2X5IB 1YX5A 1JMUB 4FXGB 4CRQA 1QJU1 4F3QA 1UN1A 4OIRF 2XPJA 2VD7A 3F0CA 4Y52J 1AR92 2IXHA 2RM23 2JG8A 1FPQA 2M5WA 4B8XA 3K4ZA 1SMTA 3KZYA 3ZQQA 4PDWA 3MIGA 4XJZA 1K42A 1F36A 5JMOA 5HV4A 3HHGA 2KP6A 4WXHA 3P9IA 4XFHA 4TN7A 5KBFA 2PJRB 2ZPXA 3HB9A 4CGZA 3NNGA 1IN5A 3BGAA 1MS4A 4W50A 1QDCA 5CNAA 4AGRA 4DS0A 4D5CA 3MZHA 4AYBA 2DPDA 5LRRA 1HLCA 2P34A 5DD4A 3MV01 5A3LA 2KRCA 3SZTA 3EBRA 1UU6A 4TTGA 1RVF2 5F5IA 2WNUA 2EFNA 2HYJA 3JTGA 2ZKLA 3I2KA 5GJ6A 5K7HA 2HOAA 2J1EA 2JVHA 4N53C 2EXIA 4LO7A 3FM5A 4AEJA 1EUUA 4MGIE 4CDUA 3K7AJ 2K4BA 2E1OA 1VTNC 1VQOI 2XUMA 2VMFA 3GHMA 3MIFA 2K7LA 5DV5A 2B8MA 4EMSA 3ACIA 4ZDOA 5BNPA 2XONA 2I10A 3I0TA 1FSHA 3KZIC 1O4ZA 3V7RA 2D43A 1MBFA 3O0VA 3QH6A 2WQZC 2LBFA 5DG2A 1IXCA 4KICA 2VKVA 4AFCA 4YIRX 1KQ9A 4JDMA 4R79A 5K0UC 1MMDA 3OG2A 3HEFA 4INDA 5AVPA 4LORA 1BVVA 2OPTA 1LFBA 2UWBA 4LK1F 2FXAA 1R23A 1HRI2 1TMF1 2HWC2 4LMFA 1P7JA 4JHTA 4J01A 5C3QA 2AEZA 4UF0A 3IKTA 4MHUA 3HM5A 1HDPA 2ZX0A 5IVBA 2EILH 2ZJRF 5IK7A 2D6NA 3N9OA 3DKQA 5A7QA 2ES3A 2X4HA 1UF2C 1W5CC 1W8UA 1JI8A 4BUPA 3K4DA 5IAXA 5D21A 3U11A 4U2AA 1D1CA 3EUHA 1X3WB 5J4YA 1SEFA 3T2TA 2Y6GA 4IEPA 1GV2A 1YTYA 1YC61 1SFEA 4WK8F 4Q0UA 4KH9A 1MZFA 1W2UA 1GVDA 2FQ3A 1JXSA 1XNCA 3VKMA 1AR62 1DGRA 2QQIA 2CTVA 4XLNF 2VI6A 3OYDA 5L3CA 3UYJA 2Y48A 4YFXF 4PDKA 3MVPA 1ND2B 1UQXA 2A1XA 1MS1A 3NNJA 2I8DA 1P4XA 1GV9A 4ET7A 1GLHA 3U9GA 1YX3A 4HDUA 5JXIA 4BAYA 2AXTC 4N8MA 1N75A 3CP8A 1PDNC 1SD5A 4QPQA 2DMNA 4M01A 5IT9K 3ST7A 4C0HA 4XILA 4JBAA 3GGLA 4IRGA 1YG2A 4MGTA 1EKEA 1W0OA 2VUDA 3WUDA 4EQVA 1SLCA 4R52A 4BCUA 1UFMA 3BG6A 3ABMH 3J8F3 4XTMA 4RQPB 3PIOF 3HUGA 2VQ0A 1OUSA 2A75A 4QGLA 2BHZA 2K40A 1YJ9I 4L0YB 2YR2A 4NR1A 2AO9A 1ENXA 4RLFA 2K27A 3G3ZA 3RI9A 1M4WA 4HG6B 1HQCA 2JK3A 5DAVA 3EJKA 5A6YA 2X6WA 5FMCA 2P6HA 4OHWA 2X85A 2IXKA 4PQ9A 4MHGA 1OMIA 1UB9A 5FZ9A 5A2QZ 3EUKL 1C28A 2WZR3 5E16A 3WNNA 4DOUA 1UW8A 5KHJA 2WS92 4LHKA 2DOFA 4ZZ8A 2Y6FA 2LY1A 2JPBA 4CP9B 2DLLA 2K9LA 1LOBA 3TO9A 4PBOA 1X1CA 3TGNA 1NUKA 3BR6A 2O5RA 2JTVA 4RA2A 2PQQA 1HRV3 1LE8B 1KFUL 1SVOA 2ZO4A 4F91B 2ORXA 1N77A 2WT2A 3IH4A 4U7BA 1B35B 3IAS2 1TNRA 1ODDA 1AX2A 1GQHA 3HZJA 5E1ZB 4DBRA 4II3A 1IAWA 1ONAA 5J48A 2QQ8A 4B4QA 2XL9A 1SACA 1WJCA 3WTSC 3NRUA 1W5SA 4Z92B 2IRFG 1VRH3 4BQ1A 1S6LA 2E2HJ 1CGPA 1JBCA 3ROUA 3ZFEA 5EG0B 3ZYIB 1ENSA 2DBBA 4IEYA 1PGSA 4IF4A 3N7KA 3VODA 4EN7B 1PUFB 4FPYA 2P3IA 2W57A 3WX5A 2V1XA 4AF9A 2E51A 2JG9A 3QU6A 5FY4A 4P9LA 3S8PA 4IE7A 3Q5FA 2HDWA 1F2NA 3OYKA 4CUBA 2DU1A 2TNFA 1W0TA 1ZA7A 2VTFA 2W00A 2H27A 4FETA 4URTA 2WT1A 4IX7A 1OYWA 2QVSB 5D5WB 1UU5A 4NQWA 4RD7A 4CU9A 2CV6A 1R091 1WW7A 5DQ0A 4AEDB 1MDMA 4NHMA 4X8PA 1V5FA 3LA3A 4CP2A 4UFMA 4XZPA 3F8MA 2GXBA 1S8NA 1OCOH 2A5ZA 3RMYA 4CCLA 5CFCA 1UMHA 2R042 5FRNA 1SLTA 4HPKB 1ZLJA 4ZKTB 4CCNA 2P4EA 4K8FA 5LATA 1LFPA 3U37A 1J2XA 2R7OA 4YZ3A 4IEXA 1ULEA 4RYDA 2L7ZA 2B45X 1FY7A 3QLQA 3WUCA 5I8SA 1ETVA 2DA6A 3S57A 3FXRA 1QH6A 4V2GA 1C8M3 2R30A 4AI9A 3WSOA 5AC93 3DXTA 1D2SA 1OQ1A 1QU3A 2RDQA 4G3YC 5ANNA 1UCRA 1YI7A 3AVRA 2EV0A 3WG3A 1AU7A 3OYWB 3CJQB 3SQNA 2Q2EB 2KM2A 2EVXA 2ADDA 2XQXA 1MMAA 2RVAA 1IRGA 5APAA 2PMUA 5A3TA 2Y0SA 3KYDB 4ZHNA 4I3GA 4KIFA 2NMNA 1PMIA 4IL6C 5T3NA 4AI0A 4B43A 2GXGA 2ZEXA 4PIZA 3OS1A 3K70C 4DXTA 5C44J 3H9AA 2QCOA 5A70A 2CYFA 3VBSB 4A3DJ 2L9RA 2WFPA 3GBFA 2R5ZA 3HOSA 2XASA 2WB1A 3VBOC 3WE3A 1RUNA 3WDVA 3LDRA 1W5TA 2GA2A 1NAEA 5J1RA 3KIOA 2X53S 3BG7A 3TEDA 1UX6A 1I6XA 5DAWA 2B9UA 1SHWB 4Q0PA 3OMYA 3CDHA 3O5SA 4LLFA 2LTPA 1B9MA 2STTA 4ZDLA 1DZTA 1NT0A 5FROA 2VUCA 3H0GJ 2WNOA 2ZEWA 4A3FJ 1YW8A 1CAVB 4BHCA 3T0AA 1ZZ9A 1R1A1 2JPCA 2YXSA 2BGPA 2W4SA 2Y38A 3OPWA 4XFFA 4OOIA 1WUVA 3NO8A 2FBKA 2E36A 2V09A 4UY8I 5K8SA 2JG8C 4AI8A 1STZA 4EZ4A 2XAQA 1SMVA 1YS6A 4I6ZA 4AUXA 3AP9A 3HGYA 4N43A 2WT0A 2LD5A 1YIJI 5L3DA 1IN7A 5KK1A 2ARBA 1U0AA 1E5RA 4V2VA 5ILUA 3OPZA 4CDWC 3LF7A 1VQPI 2BZTA 4A7ZA 3SEEA 4PBPA 4QPOA 1UY2A 2GIZA 3PNYA 1OPMA 1QY4A 4B7KA 1DGWY 3SHFA 2MG4A 2X10A 3G2BA 1QJY1 2FQPA 2VPVA 3SKJE 2E1NA 3J7HA 2WAAA 4P5YA 4DZGA 1Y8RB 2HJIA 4UUSA 4FE4A 2VIXA 3T5XA 3RJPA 1ZLKA 3VZMA 3SHRA 4EJVA 2ET7A 4IQ4A 2PTMA 2QBYA 2OQ7A 4XUPA 3HOXJ 1I9RA 4MOAA 3LNQA 5C8CA 3LSDA 5BV6A 4TLGA 2WIIB 5DXDA 3HBKA 3KX2A 4D9JA 2Y2ZA 2HOEA 3H5RA 3M3YJ 3SEPA 3BU7A 2A3SA 3M3CA 4O6JA 3TNPB 3LFIA 2DF7A 4FO9A 2H1LA 5JSPA 1FTZA 4G6DA 3BZKA 3RIRA 1L7RA 3V8JA 1QDOA 4ESFA 4J25A 2DBIA 1MZ5A 1W1WE 3WCRA 4W8JA 1KU9A 1Y3TA 1MBGA 5F6FA 1H9WA 5IVVA 2F5FA 3K1MA 3CCUI 1VBD3 2XJRA 1J0RA 2H8RA 1LHNA 2COMA 4JVAA 4JDOA 3CF6E 3U4XA 1Z67A 1JUMA 4S2HA 1LCLA 1AL23 2Z9OA 5IVYA 2F6BA 1K6OA 4EJUA 2PMZN 4BNCA 3HNMA 5FZ7A 2OVUA 4D0PA 4AFMA 2NRAC 2FJ1A 2R16A 3EETA 4IE6A 1WD3A 3ZN6A 3A7QA 1S9HA 2ZS6B 2CUFA 5FRMA 3DQVC 4O7XA 3LPFA 2AH2A 1NK2P 4HV5A 5LBEA 3RZDJ 3CLPA 4Y20A 1ZBE3 3RZZA 2FDKA 4JTNA 2QFEA 2JD9A 3RZJA 5FP4A 5I0SA 2AHQA 5A3WA 3VB9A 5IT6A 4Q0VA 4AIDA 4DZPA 1O5LA 2D3SA 3CC4I 1RVF1 5JLXA 5FOBB 1UYZA 5FKBA 2VOTA 2BGOA 4EE2A 2QQVA 4I0AA 4XABA 1M1EB 1ZRFA 3L09A 3JB4C 2IGMA 5CADA 4OYUA 4CDQA 3A22A 2MD0A 4CPBA 2YB7A 5EPAA 4AK3A 4FOQA 4ABZA 5CPRB 2ARAA 2I07B 4CTEA 3IMMA 2KD7A 4X1EA 2JJ6A 1ZHFA 2HVQA 2HWF3 5EYXA 1BOBA 1AYM2 1OH4A 1YJLA 4B09A 3QQAA 5D4RA 3QYEA 2JWPA 3KP2A 1FYUA 1RUG2 4XLHA 3A0HC 2YPRA 3L2RA 1A8MA 1GT0C 1PNFA 1H8TA 3FMGA 1XJAA 4MXVA 3LSGA 3LOBA 5JXJA 2JIJA 3KT7A 4BDVB 1EH6A 3FC0A 4COVA 1S5LC 2DAOA 3DTKA 1X3ZB 1WMDA 2DCYA 2NXNB 2UYBA 3BN6A 4XJ9A 2B9SA 2FDIA 4ZYHA 1HRI1 5DAXA 4DINB 3GO5A 1RTVA 4S05A 4BJ5C 3NEUA 3GZTB 2WLQA 2NVTJ 2YBSA 2CGNA 4S2GA 4WM7C 2BE5F