1JYTA

Solution structure of olfactory marker protein from rat
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
163
structure length
163
Chain Sequence
MAEDGPQKQQLDMPLVLDQDLTKQMRLRVESLKQRGEKKQDGEKLLRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Olfactory Marker Protein
total genus 17
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jytA00
1JOBA 1JYTA 1JODA 1F35A 1ZRIA
chains in the Genus database with same CATH superfamily
1QY4A 3I4IA 4IV3C 1CVNA 5AFEA 2DURA 1ASJ3 4JRAA 4D94A 5FP3A 3ZSJA 2VCCA 3I54A 4Q4W3 5DUXA 4Q4W1 4Y1ZA 4ISRA 1R083 2VW0A 2ZBJA 4XF9A 3POFA 2W68A 1MQTA 4YW2A 5KC5A 1UOJA 2HWD2 2PN5A 1BK1A 1VALA 1V00A 4HSLA 1ZBE2 3ACFA 4Y20A 4ZU7A 3OBTA 1EV13 1WMDA 5C4WC 1GP6A 5FYSA 1O3TA 2P3IA 4N8MA 1AR71 5HXMA 2BBVA 5C3QA 1DQ2A 4CPBD 4L9BA 5FZCA 5HPOA 5FZOA 1QXPA 1RUC1 4NHXA 4RR3B 2PLV1 5G04L 3O1SA 2FCUA 3V56A 1TZOA 2E9QA 1PMIA 5CFDA 3CNAA 5FK7A 5D8AB 5FZLA 3NNJA 4LK6A 2WNUC 4P5YA 2XB6C 4Z8BA 2VZVA 2X5IC 3FE5A 4BU2A 2HEYF 1O3QA 4LKEA 2PMWB 5EJ1B 3VBSC 3HN3A 4CDQA 2W39A 2JDKA 4PDWA 3VLBB 2RS11 5FR3A 1LB2A 4XACA 2CL2A 4E4HA 1AR83 3DV8A 3H1WA 2DFCA 2XQXA 4QKNA 3N7KA 2XJVA 3AKTA 5J96B 4N53A 1COV2 1WMXA 2BWCA 4XQWA 3I97A 1UWWA 4RHV2 2Y0OA 4HVRA 3WV6A 3N9NA 1M06G 4V2VA 1UYYA 2MNGA 1C5HA 1OVPA 4R4ZA 1GWKA 4NO4A 1PX4A 2B5HA 2PXJA 5DAXA 3P6BA 1W2TA 2VMGA 3H1YA 3Q8AA 2GC2A 3TEYA 4BIFA 4DIQA 1K5MB 5GZFA 2JWPA 1YEWA 4XW3A 3IB3A 4AVBA 2EIEA 1V6IA 1RUF2 4FP2A 1US3A 3B3QE 3VBFA 1JOBA 1ODMA 2XONA 4QHZA 3U0ZA 4QT6A 3HT2A 1EYBA 1TME2 2Y34A 5FZMA 3LOBA 3WHTA 2PHDA 3S5QA 2XOMA 4QB6A 2D6KA 3LA2A 3LSDA 4XBNA 4AQ6A 3UT0A 2W0XA 3OGVA 2SLIA 5FXVA 5DQ0A 1IPKA 4P9LA 4D7TA 2ZGLA 4YZ2A 4AVCA 2UY9A 1X7NA 5F32A 3MW2A 3WUDA 3RNSA 2EIDA 4ET7A 4Q4V3 2W46A 3EB7A 1RUJ1 1ZRRA 4OI4A 1RUOA 4XF3A 5A7WA 2JKXA 1UL9A 4AAPA 3KT1A 1FATA 4LHNA 5I0DA 2Z4FA 1FAYA 3WNMA 3U4SA 4E2QA 1CAXA 1J1LA 1UU5A 3CBNA 1EAH1 5GZGA 1A8MA 2WS93 1BBT2 4RN5A 1CR7A 5GLVA 2LALA 1NYWA 3WOGA 2WFF2 4AXOA 2KM2A 4XJUA 4XC9A 3HAGA 3AZXA 2JXAA 4FCAA 1OLQA 4PDWC 1HXS2 4RR3A 1YQ5A 4YG6A 1S2KA 3V64A 2IZWA 4ATFA 5CZKA 1YRZA 4AFAA 1X8MA 1MS5A 3A0KA 5J7MA 1DBNA 3NAPC 5C33A 3NNFA 2JE9A 3WF3A 3ZFFC 4TZDA 2MPFA 4YPJA 4DMIA 5IVVA 1AL22 4QPGC 4V1PA 1QXRA 5FWEA 1W6PA 1Y3TA 1OPMA 4AQSA 2D98A 1ZREA 3PL0A 3ZXLA 3DYOA 2V5YA 2PLV2 4H55A 3VBRA 3WR0A 1C3HA 1CZSA 3RVHA 3ZMOA 4Z07A 1OOPB 1LHUA 2E6VA 2HWE1 4OHXA 2LUWA 3LOIA 1DG6A 1REFA 2QQKA 5GJ6A 4AQ2A 1AR91 1LOAA 4IEZA 3TRSB 3MZHA 2ZGSA 5FBJA 2PELA 4FOVA 3M1HA 4WVVA 2D40A 1AYM2 4BQXA 1V6KA 2HWD1 2LW8A 2WS91 4U2AA 3U14A 3ZN5A 2LM3A 1D0GA 5F3GA 3C7FA 4C90A 2ZX1A 5EZWA 2A75A 1JS9A 5GLZA 1CWPA 5FPZA 3QLQA 4Q8KA 4DY3A 1PGW2 4UFLA 3UGGA 4XZPA 1AXYA 1IQDC 3GGLA 2W3JA 5F8PA 4AI3A 2JG8C 4Q0QA 2YZ4A 4X6QB 5IVYA 1BMV1 4FXKB 4MV2A 1JOPA 2GMPA 3ZKYA 1OA3A 1VBA2 4HMZA 4I0WB 1JODA 4CVUA 2J7MA 4BZ4A 5LRRA 1X33A 1GP4A 5F2WA 4CYDA 3ELNA 3WF1A 2NMNA 4YM2A 4SBVA 4D6QA 2P3KA 1SFYA 4QPIB 4UFHA 1UX6A 2OYZA 2WC2A 4IE5A 4L92A 4LE3A 1RVF3 1YJLA 3LEGA 1CIWA 3WW1A 1Z0HA 4M4PA 2VZ3A 1ZRIA 1LGBA 2CDOA 4LLFA 1U5IA 3VBOA 4IE6A 2GSYA 4IEPA 3ME2A 1H8TA 1H8VA 4HKLA 1RIRA 4E8CA 2QQMA 4BMEA 1DFQA 3A21A 4QXBA 1R081 4KI5M 1VAVA 2A6YA 4RFT0 1PVC1 1VMFA 3VDBA 3WG2A 2A6XA 2DCKA 3T2TA 1DGRA 4OUMA 4JGZC 4M0HA 2WNVA 4YGCA 1VRH2 2P3JA 4OQ8A 3LZZA 1GWLA 4YM1A 2WT2A 1JYWA 3UNPA 2XBO1 4YGEA 2CGPA 2YDEA 4M3CF 3WDVA 2KR2A 3BTXA 4XFIA 5FKBA 2WO1A 1S0BA 3EJKA 4AFCA 2CWSA 5FJKA 4LTAA 2OPKA 3ZFGC 2RMU3 2ARAA 2G1MA 5JMCA 1RUE1 4CEYC 1RUNA 2XVKA 4AFBA 2ZGKA 1HQWA 1C1FA 3T0BA 2D6MA 1F31A 4JHZA 4NPLA 3UGFA 1CX1A 3FLTA 4ZS2A 2YBKA 3CQOA 2B7YA 1GZTA 4QB1A 3AC0A 2JIGA 2KXLA 2VU9A 1LOFA 4QU1A 1YFUA 4F8AA 3GNEA 2JKBA 1Z78A 2BYVE 3PHMA 1GYKA 1WLDA 1HV0A 3KLSA 3GJBA 1C5IA 1OF3A 3WCSA 2OKXA 3VKOA 1I3HA 2VBPA 3AXDA 4LBQA 4A6OA 3W59A 3H7YA 4BXSV 3LEIA 3RZJA 5JXGA 3CJIA 2IUWA 2XBO2 1CPMA 1SHWB 3MI8A 4GJYA 5L7OA 4DXRA 2VZRA 1ZZ7A 1WLTA 1GZWB 1ULEA 2DVBA 4N43A 5F3IA 4FTBA 1F5JA 3LA3A 1VRH1 1ENSA 1HQLA 4DXTA 5K0UA 1M4WA 4ZY9A 5CVRA 3SCGA 3H3LA 2Y64A 4A7ZA 4K8RB 3PURA 3RRDA 3ZFEB 4GB32 4LXLA 2BGPA 4OMCA 5DN2A 1W8ZA 3OCPA 2CGNA 4FPKA 5FZIA 2UWAA 4YFWA 1UYPA 1XSRA 3IDBB 3OG2A 3PUAA 4HLTA 3ZM8A 4DEVA 2DUPA 2IXLA 3K4DA 4FI9A 4XXPA 2BVBA 1WW5A 2PHXA 4MGKE 3LF7A 4XABA 3SISA 4E4DX 1IZ3A 3OY8B 5TSWA 3WQ1A 1P8JA 5FPVA 4CA9A 3FUOA 2WZ8A 5ACA1 1HRI2 2UY8A 4GWIA 4CDUB 5BNPA 1JOJA 2C4XA 1TNFA 5T5LA 4LO4B 2GC3A 3JB8A 3ZXGA 4QM9A 4K1ZA 1KS5A 1W05A 4AVSA 3B69A 2JDHA 4HXCA 4N7UA 1UY2A 2WQ8A 4HOOA 3KZ4C 3KCCA 2A3XA 4QGMA 2QDNA 4COYA 2E51A 2E7AA 4P9IA 5FY7A 2HYKA 3I7DA 2WN3A 1XNKA 4W8JA 1BLZA 2DVGA 5IAVA 3ES1A 2WSVA 1J83A 1RITA 2RG4A 1DYOA 3BB6A 5FV3A 3H8UA 3M7AA 5B4NA 2XGXA 5FMOS 1H1AA 2NZ9A 2TUNA 2XUEA 3CHXA 4AI1A 1PGW1 1KEXA 5FO9B 1O8SA 3KV4A 3VBRB 1Q8OA 2WUHA 4Q29A 3ZO0B 4F7ZA 1ULFA 3O1VA 4PIXA 5EP9A 4PDWB 5FPBA 2V4VA 4KL1A 1JZ2A 4Y1VA 1OA2A 1JUHA 1RHI3 4QKBA 5LA9A 1YI7A 5T54A 4GA9A 3VDDB 1XNCA 3ILFA 2VULA 3C3VA 4B29A 3D0SA 5HCAA 5JXJA 3CZJA 3LDBA 2R041 4LO7A 1WA6X 4QXCA 4ARYA 3K46A 5HV0A 4BK5A 1FOD2 2LTNA 3FJSA 2ZMNA 3EMRA 4QPWA 2HWF1 1ZBA2 3WHUA 1DLCA 1QJU2 1XYPA 3OUIA 4D69A 1RUG1 4EROA 3RPQA 3AYEA 4AGGA 2VTFA 1XE0A 3VDDA 3Q8BA 1XBFA 1S0DA 4K20A 3PVOA 4CCNA 4XFBA 1DQ5A 1VMHA 4HK8A 4Q4Y2 4CCJA 2GH8A 3BU0A 1QEXA 3OOXA 5D2AA 5FY9A 1JYXA 5IWFA 2W5FA 3AKPA 5H9QA 3UKNA 5J98B 2RS53 4IV3A 4P00B 3UYJA 4K3UA 3WCRA 5C9AA 4OHWA 4DRRA 4MADA 2YFZA 3SXWA 3WF0A 1OQEA 2O8QA 3GDBA 4GJZA 2V5DA 1NCQC 1O7FA 2I2SA 4XJWA 3BIWE 1SDDB 2ET1A 3L2HA 5FLHA 4RGKA 3LEMA 5GLUA 4PBOA 2BERA 4QXKA 2ZACA 1IPJA 1KFUL 5BNPC 2G4IA 1W6NA 4CCEA 3V0AB 4MGYE 5LEJA 1U12A 4PLNA 1WCDJ 4EN6B 1EV12 1F35A 3KSCA 2ZHKA 5JI9A 2DU1A 4A3XA 4AEMA 5F5CA 2BQPA 2RS13 5FZ6A 2LRPA 4R4XA 4UT5A 4XIKA 5A6ZA 4MHRA 1AXZA 3RGBA 1PO23 3VBOC 4TTGA 4IE0A 2VTXA 3C8XA 3K77A 1W03A 3ENRA 5GZDA 1DQ6A 2VY0A 5FQ0B 4FTEA 1LENA 1ENXA 1STMA 3SH5A 5IYYA 5IVCA 1WCKA 5E1RA 4CEYA 3AP6A 4AF9A 3NWKA 3GBGA 5FZ0A 4CE8A 5FZ7A 3DN7A 3I2IA 1DGWA 4QPGA 2CV6A 2G9FA 4B7KA 2RS33 3VBSA 1NT0A 3NNLA 2ZA9A 3IDEA 1L7LA 5B4XA 3RZHA 4QHBA 1ND2C 3VBRC 5F6KA 3ZN6A 4BOWA 3N3HA 4FPEA 4JGZB 3HBZA 1UZWA 2VMHA 3T2OA 1KJLA 3IDCB 2JEMA 1XE7A 1Y7BA 3HEIA 5FY0A 2DTWA 1IS6A 1A78A 5LASA 1C1LA 1FI2A 2IC1A 1GOHA 1KITA 1QJU3 1REDA 5FYHA 3VV1A 1K5MC 4HL0A 4LOSA 1COV1 1XU1A 3B5LB 3M8LA 3T2PA 2R49A 2D5FA 3VDDC 4JV4A 2D6NA 4D7SA 4AVAA 1OLRA 1V9U2 3UKVA 4XBQA 2PHFA 1GZCA 4YRDA 5FYUA 4R9BA 1ND3A 4XF0A 1LU1A 4WVZA 4PCRA 1IKPA 5LCWL 1SLLA 5IT6A 2ADDA 3AL5A 1JZ3A 3LE0A 2P5BA 1QU0A 1H0BA 2RR12 3W58A 3K48A 1VBE2 1U0AA 3W9AA 4QDRA 1GV9A 4JGYC 4JKKA 2QQUA 1RUD3 3VBUC 1H2LA 4WVMB 2VTXJ 4C1WA 3D8CA 4FO9A 4KNCA 3ZPOA 1JU3A 1RUI3 5L36A 2JDPA 3AVSA 1OFSA 4YVSB 3SHRA 4AE2A 2XLAA 2XLGA 3SKVA 2IVJA 1W99A 4CP2A 1ZBE1 2ERFA 3VZNA 3H3ZA 2XPJA 4QWNA 1OURA 2O0OA 2P2KA 4LA3A 2E31A 2VJXA 5G05L 5HI0A 1H1MA 4JC1A 5FZ3A 1YO8A 5FUPA 1UN1A 5J09A 4E4ZA 2YBPA 1WCUA 2B45X 3VKLA 2QFEA 3BALA 1BHGA 4NRQA 1Y9QA 4RGAA 1NCRA 1G8WA 3DL3A 1UU4A 3KWVA 4KMQA 5L9BA 4ZXEA 2LROA 1GOGA 1MACA 2ZKNA 3HNYM 2RM23 4XCBA 2RM21 1RINA 2WO7A 4IQPA 3SH4A 4LUMA 5KWRA 2YXSA 1EP0A 4CPBA 2HWE3 1QJZA 1WWYA 1QWRA 3GBWA 4NPRA 1JZ6A 1JW6A 1V9U1 3D6EA 4YARA 5I0RA 4IUGA 2FMDA 4O65A 1WCSA 1YQ8A 5I8TA 5JUVA 4S2GA 1OUSA 3JU9A 3POSA 4RGGA 1HW5A 3USSA 4H14A 1FV3A 5FYVA 2Q1ZB 1EAH2 3TN91 3GBFA 3WP3A 3HMYA 3QOPA 4EWAA 1ZBE3 4YFZA 5JPMB 5KXDA 4ORFA 3J7NA 5A7NA 2IXCA 3AKRA 2A6VA 3U11A 2B46X 2JJ6A 2BTVC 2PLV3 3AMHA 1J84A 2BRTA 3ETQA 3GALA 2V09A 3PU3A 4OULA 3WP5A 2XJSA 3NKTA 3THPA 4E9KA 3VUOA 1LOBA 1QOTA 1EUTA 2B9UA 2GMEA 2P37A 3GZEA 3OB8A 2D3PA 4Q5OA 1K5MA 5FMDA 2W1QA 3K51A 3WT3A 1PIV3 3WQBA 3R05A 5BXXA 5LY1A 1GR3A 2A6WA 2Y38A 2YG0A 2KD7A 1W3XA 1G9AA 1AYM3 1DU3D 2XQRA 5IK7A 5C8CC 1MS0A 2WNUA 1RUD2 1S2EA 2JIJA 1XNAA 5L73A 2JX9A 3LFIA 3VD4A 2OA2A 2BGOA 5DMYA 2W08A 3CIHA 1AR81 3NKGA 1NX9A 2JENA 1MEC1 5IK8A 1E5SA 4RYDA 2AUYA 4LBLA 4CDWB 1JXNA 5H9SA 5FAXA 1HB2A 2Y6LA 4E8DA 1F9KA 4QX5A 3W5MA 4JX0A 2FHRA 2A70A 2VXRA 3LCPA 3KM5A 4AAXA 1FX5A 1V6MA 1XJAA 2ZTNA 3PNAA 5K0UB 3M2MA 3N9OA 3OBRA 5CISA 4N43B 2C9AA 2XR4A 2IVIB 4CU9A 2BGCA 3LEKA 2FDGA 1RUC3 2CTVA 3MGUA 2HLEA 4YGDA 1ZA7A 4A7KA 4D7YA 5FYCA 1ZRDA 3WSOA 4AR2A 2B39A 3VBHA 4BHPA 1GKBA 2D5HA 3FFZA 2RS31 5A3UA 4KQ7A 1VBB2 4ZS3A 4Z2AA 5A3PA 2Y33A 1C8M1 3DEMA 1QJX1 1Z7S2 3EYPA 3KF5A 4XDPA 3S5AA 5BNNC 2YUEA 4LULA 4JTOA 4A44A 1MEC3 3PUSA 2ZOEB 5C9AC 1UOBA 4Q4Y1 1B35A 2J1SA 3OUHA 4D6SA 4WM8C 3O1MA 1UPSA 1ULCA 2IXJA 3H50A 1R1A3 2BVVA 2WNVB 4A42A 5EV7A 1QJU1 3WF2A 3P3NA 5KXEA 2Q8DA 4YZ4A 4NN0A 5K4LA 3MLJA 4Y22A 1KJRA 1ZZBA 1WW7A 1ZZ8A 3GCXA 3LFMA 5GLTA 4CCKA 3ZLIA 1DQ0A 2W95A 4GAZA 4D8MA 1WKYA 2W91A 3O1UA 4NOTA 3OPWA 4AEDC 1UF2C 2D3SA 1AR72 1YC61 1ZZCA 1JYCA 4XJAA 3BVCA 4ITCA 5DUVA 1HJGA 1YIFA 3ES4A 1O5UA 1KD7A 3VKMA 2VQTA 3W21A 1G9BA 4XUQA 5ABJA 3KVAA 1H1IA 4AFDA 1ULOA 2X10A 1KRIA 3I3EA 2XXZA 5IK5A 3JBG2 3OYWA 2Y6HA 4FPYA 1OUXA 2EAKA 1W9WA 3VZJA 1CIYA 3ABZA 3H1MA 1FMD3 5I8SA 4QX8A 1GQHA 1E5HA 2MEV2 1WMEA 1ZVFA 4Q1RA 2FDKA 1OVSA 1UX7A 3EBRA 5A6XA 3X29B 2D97A 4XTPA 2W87A 1YUDA 5ACA3 4WV8A 3MUZ1 2VZ1A 1QHDA 1MS8A 1HDKA 3ZXEA 4GH4B 1AL0G 1A3KA 1SACA 3ATGA 2CYFA 2XWBB 4I0BA 2JB8A 4OZXA 3KV5A 1OMIA 1Q5OA 5BUVA 2VNVA 4IV1A 4S2DA 3ROUA 4KWKA 1LEDA 5CAZA 2VNGA 5AFBA 1WBFA 2ZEZA 2Z69A 4OUSA 4QHOA 1MR5A 2IFRA 4XJ8A 3PUQA 1SCRA 2YPJA 1W0PA 2CY6A 3WQ0A 1RUI1 2VUAA 3PLQA 5CKQA 5DZEA 4ZKTB 4BXFA 3KVBA 4FFHA 2R072 4YVWC 1PO12 3KV9A 4XDQA 3MF9A 2ZGUA 1ST8A 4JGYB 5JMOA 1MPXA 4QD2A 3ZSEA 2R062 5GALA 2BOIA 3N35A 4R9AA 3JD72 4LJHA 3WVJA 5FMOL 1UZZA 2RVAA 3M3CA 4HFSA 1VMJA 1OLME 5C3PA 1UO9A 3NNMA 3O0WA 3POIA 3Q9OA 4YVSC 3TAYA 5FPLA 3I49A 3AMNA 2FCTA 3MV01 1TQ5A 3MEPA 5FYBA 2VMDA 2UU8A 4GQ7A 3LSEA 2VZOA 2XVLA 1LJ7A 2ES3A 3ZYBA 2G9ZA 1KFXL 1WUVA 1RMU3 3AYCA 4Y22B 5D1IA 4OYUA 4K7JA 3RI9A 1W6OA 2XJTA 1SLBA 1BZWA 3TYJA 1QXJA 2JECA 1FMD2 1SLTA 1IKQA 5H9PA 4LBOA 3OY8A 4DINB 4LO6B 5CU1A 3F2ZA 1EY2A 1QJFA 4XQDA 1GBGA 1W6QA 3DCQA 3AMPA 3BPSA 5T55A 4UBHA 1NOVA 3AJYA 4QX7A 1RUE2 2WN2A 4LBQB 1O59A 4I30A 1UQXA 2JDNA 1S0EA 2DDUA 1O6UA 5FMBA 5FZ4A 4I02A 5FREA 2PHRA 3AM2A 4LBKA 4NAMA 2HJIA 5A33B 1UU6A 1NE4A 1NZIA 2P4EA 1QJX3 4FFIA 3VKNA 3D3AA 3OSDA 4BQ4A 1XB9A 2DCJA 1FOD3 2QQIA 5LZ6A 4R52A 1Y4WA 4FOYA 2VW2A 4XAEA 4OHYA 2F4PA 1CD3G 1GQPA 1V6LA 2WO3A 3A7QA 4NPMA 2R1BA 4I3PA 4N53C 3T30A 2R7EB 3CJIC 3T0AA 1GP5A 4RQPB 4EN9B 2EALA 2RMU2 4Y3OA 4AL9A 3OBAA 4QX0A 4XMAA 2QTWB 4XURA 3UJQA 4IV1C 1DYKA 5SV5A 1J1TA 4QQOA 1RJ7A 2ID4A 4XETA 1RJ8A 3BODA 2Z79A 2XH6A 1N1TA 4PI2A 5LWBA 1CGPA 1DGRN 3KCYA 1URXA 3AJZA 4CUAA 3O1RA 1ASJ2 2YV8A 5IVEA 5JXHA 3RZLA 3PTYA 4LIVA 1TEIA 1F15A 2BFUS 1OSGA 3E6BA 3PDQA 3BTZA 1H8TB 4XPVA 2WT0A 3UETA 2I45A 2PHLA 2R1DA 2P6HA 1SEFA 3T3YA 4GMP1 3ZX7A 1W8FA 1H4HA 2HEWF 5CKNA 5JOXA 4LNVA 5AC92 4HN0A 1C57A 1DYPA 1XPWA 4CDXC 4UFMA 1Y43B 2BNNA 1S1AA 3B94A 1GSLA 5EXOA 3IPVA 2X8KA 4GB33 3VKFC 3NV4A 4EZHA 4YW5A 5EYYA 1PO22 1PZ7A 3I2FA 4JKLA 5FUIA 5C3SA 2QQVA 5LBFA 5FOJB 4FPLA 4IW3A 2PAEA 2A7AA 5FZBA 4LKFA 5ABJC 3GHMA 3ZYRA 2WS92 1QOSA 3FFQA 4YZ5A 1E5RA 2EVXA 2B9VA 4LBQD 1JBCA 5JZGB 3N9MA 3MLKA 2WBKA 4N9HA 5FY8A 1ZA4A 2XJUA 5A32B 4UXAA 2YU1A 1UYZA 3CKHA 1MQTB 1AR61 4GZ9A 2V4AA 1RXFA 4N9IA 3C2UA 2JDMA 1UY1A 2ORXA 3ZR6A 1QNWA 4EZ4A 3WD5A 4ZZ8A 1PHMA 4MZUA 2WWUA 2GH2A 3ZSKA 3MIDA 1OT5A 3PUIA 3H42B 4FPHA 2X05A 1EAH3 4RHV3 2HWF3 1OFNA 1JU4A 3FHAA 3POYA 5FP9A 4IGOA 1GNYA 1V0AA 3M3EA 3IKWA 4A6SA 1CZTA 4YG3A 4Q4X3 5DAPA 4Z1VA 5A33A 1LTEA 1OD5A 3PVBB 2HWB3 5KC6A 3NVCA 5FPXA 4URTA 3THCA 2ATFA 1C8M2 1D4M2 2E7TA 4RS5A 4XHXA 2XL7A 4DUWA 1Q8SA 1F2NA 2QE3A 1S0JA 2VZQA 3GF6A 5JR2A 4AHWA 2RR13 2W47A 3JQWA 3TOJA 3NJYA 4LITA 4P08A 1NY72 3APBA 4HPKB 4EN0A 2R0HA 5CG9A 5AVPA 1PIV1 5HCHA 2IXHA 5C5TA 3OGJA 1AR93 2ZX0A 3PTRB 1LOCA 4FXGB 4LEJA 3RFRA 2DUQA 4NAOA 3ETPA 4W6YA 5EJZB 3ZFFB 2VUJA 4P14A 4CEWC 4QGLA 2GAUA 3NMBA 1HB1A 2EICA 2Y60A 3NV3A 4Q27A 4JRLA 4XBLA 3WF4A 1JZ8A 1DP0A 2H0VA 2IXIA 1ACCA 3OJBA 1WD3A 4MSVA 5FWJA 3LA7A 4OHZA 2W1WA 4Q4X1 3T0DA 1UMIA 3G7DA 4DXZA 1L7RA 5LA0A 4XF1A 5T3NA 2J1VA 4HZFA 2WINB 1RUF1 4ZPIA 5HCBA 2J1UA 3GXUA 3Q8FA 5A7OA 3S57A 3UL2A 4MGTA 1B35B 1RC6A 2A71A 1RUJ3 3HIFA 3WX5A 3AP4A 2WIIB 4R9CA 3AZYA 2W94A 3AZZA 1X9TA 3DPRA 3HT1A 2WDBA 3MW4A 3SITA 2VCBA 2OPWA 4Q0PA 2GC0A 3ZFEA 1HXS3 2OQ6A 5DABA 1CAWB 2D43A 4LQRA 4W6WA 1PM4A 3IN9A 4WM8A 4D6RA 1DHKB 3NAPA 4W6XA 1QJY2 1NY71 4MX3A 1MQTC 2E7QA 3D4KA 3ZXFA 3KQ4B 4MG2A 1LGNA 4TN7A 1ONAA 4CCOA 4ZZ5A 4S2FA 2PTMA 5IFPA 5D8AC 1Q3EA 4YW3A 1VB2A 4LPLA 3VBSB 1OH4A 1CPNA 5JOZA 4COWA 3MUY1 4I09A 1FNYA 4CEYB 5CFCC 1J58A 4FQ4A 2A3YA 2NLRA 1W39A 1D4M3 3PMEA 1E57A 4OCTA 3ZXAC 2QDRA 1G6NA 2ZX2A 3U1XA 4AHXA 4CXYA 1DQ4A 2NYYA 3EXUA 2R30A 1QMJA 1ENRA 1F5FA 4KU8A 1J59A 1CAUB 3AFGA 1YQCA 1OH3A 1RUG2 1VBC2 4L97A 3WNPA 4AWDA 2PYTA 4CP0A 3V0BA 1DF0A 1NA1B 2BU9A 3FL7A 4WBBA 4IEXA 4ZU4A 3RZGA 2NM1A 2X5IA 4RS5B 2ZX4A 4YW1A 4BWOA 5HCFA 4FAGA 4CDQC 5IVJA 4AVVA 5C70A 2EXJA 3VB9A 1TMF3 5B2GB 1LOFC 4LO8A 3NJZA 1DGLA 5A6QA 2RS51 1G9CA 1AR62 3AYDA 3M3OA 2Q0AA 2FDIA 1MZ5A 2D6OX 1OI6A 2JDYA 2SBAA 2P1BA 1UYXA 4XJZA 5C9AB 2WNUB 1OF4A 2VQAA 4AGRA 3I59A 5GLWA 4HT1T 3WEZA 5D21A 4J6GA 4WM7C 3UK9A 3DXUA 4CEWB 3AX4A 1PO21 1BEV3 4QKDA 3T4HB 2VOKA 3CZUA 3OPTA 5A3NA 1APNA 3R4DB 3POWA 4AHZA 4PQQA 2ZMKA 3N4MA 4MXVA 5F39A 3VBOB 3HD8B 3MBWA 2RDRA 2DCTA 2YC4A 3I2HA 4OMDA 4PHZA 5LBCA 4EV0A 3E5UA 1HV1A 1UY4A 1TMF1 1XYOA 1N47A 1PMHX 3B7MA 2XL9A 1RGSA 2HKXA 2W1SA 2TNFA 4IEOA 1QJY3 1XSQA 4AG4A 1TME3 2F6BA 1ASJ1 5E16A 1QH7A 1SPPA 2HWD3 3I2JA 1VJ2A 1Q43A 1MS1A 1OQ1A 1W2AX 1N3QA 3DKWA 3ILNA 2WO2A 3NRUA 4QDSA 4QB2A 5C4WA 5IK4A 1ND2A 1VBD2 4EWEA 2VMFA 3U4XA 4XEZA 2J1EA 2P6CA 2AEYA 2G9GA 4WM8B 3AMQA 2ZCWA 3WY6A 1S0CA 1B09A 2FZ1A 2ZZJA 4JVAA 3OPZA 3VDCA 4C0BA 4F83A 2OX0A 1NCRC 1XNBA 4Q1PA 3J8F1 4G4FA 5KXBA 5LATA 1W9FA 2VMIA 3UGHA 4AHYA 2P17A 4CU7A 2NMOA 4NJ4A 2NPIA 4EWDA 3D0JA 2RV9A 5JSOA 5F5IA 2R043 4LBNA 5C5UA 5FXZA 3EO6A 3OD4A 2QVSB 2F17A 1NA1C 5DDJ1 1U5ZA 4NIAA 2VH9A 3ACLA 3AXEA 2WZPP 1NG0A 1ODNA 1NQDA 2ORZA 3SEEA 1AUYA 1HLCA 4E4SA 4PI0A 1RHI2 2W2IA 2Y6JA 3SNMA 2HH9A 3MPPG 4NUBA 4UFKA 5C8WA 3I2KA 4B4QA 3H8XA 1AXKA 2DBIA 3ZIXA 3M4FA 3UJOA 4FPCA 4JTNA 4CDQB 4I2OA 1QDOA 1XYNA 3QBQA 3R0RA 2QQNA 2BV4A 5JIAA 5F3EA 3ZXJA 3ZN6B 2DFBA 2W52A 1DZRA 2YC2A 4L99A 2XLFA 1ZBA3 4JCKA 1VE0A 1O3RA 5F37A 1Q56A 2JG9C 5FY4A 3PJQA 4XVHA 1ZRCA 1RHI1 3AZVA 1IS3A 1UOFA 4PQ9A 3KS7A 4AI8A 3I59B 4IEVA 2DCZA 2WWJA 1AYN3 2K9ZA 3NO8A 4U36A 2DVDA 3BCWA 1LHNA 3ZXDA 4DPNA 5DDJ2 3RMYA 3ZN4A 2VVFA 1AJKA 2R0FA 1AVBA 4DNYA 1JHJA 3OGSA 4QMAA 1CQ9A 4Y20B 1PX3A 4DY5A 1PVXA 1PZ8A 1RYYA 3JD71 3OEBA 3VN4A 3J8F2 1R092 1A34A 3DECA 4COUA 3N7LA 1RUH2 2H0BA 4Q4V2 4GKXA 1J3PA 2AYHA 3BYWA 1R082 1W6NB 2EXIA 2VE1A 5JLVA 3V0AA 2ADEA 3B00A 3CF6E 4XIOA 4FPGA 3TEZA 2OUJA 2WNOA 3PVNA 1RTVA 2R6QA 3MF6A 1NKGA 4META 2WA4A 3IMMA 3WNOA 2IXKA 3J7MA 3BOPA 5BPXA 3ZSMA 2JD9A 3J7LA 2QQLA 3PJYA 4LO5B 2C9KA 3CEWA 3ILRA 1QIQA 1W04A 4C8DA 4COZA 1VBB3 5FO7B 2ZZQA 1US2A 2VOTA 2W9XA 3T2QA 2C1FA 4GWJA 1DCSA 5JVVA 1GMMA 2XHKA 4DOUA 4QX1A 4LA2A 4K1YA 5GZEA 1RUE3 5CB7A 5A1FA 5JOYA 1R1A2 4XUOA 1R1A1 1O4TA 5DZFA 5EYXA 3O0XA 1NCRB 1AL23 4HKWA 5ERLA 3RJRA 3WNKA 5C6CA 5D8AA 1H2NA 4IEYA 4O61A 3WNLA 1TNRA 4UI9L 3U10A 1W6MA 4OI2A 4INDA 2EF6A 2CDPA 4K9SA 1AR73 4FPOB 3JBG1 3FC0A 3K4AA 4JZRA 3VDAA 1HRI1 3R4UA 3AFKA 4UBGA 1WLWA 2ZHMA 1IS4A 2FDHA 4HVQA 2BEOA 1IG3A 1AX2A 3H0OA 5FFOC 5I93A 5DDJ3 4HANA 1W9YA 1PK6A 1WGPA 5CBLA 4KWLA 5FBZA 5A7WB 3RWNA 4W65A 1DLLA 1F4AA 1H2MA 4BM8A 4BQ5A 5EJ3A 2B8MA 4V2WA 1NE6A 3WDUA 1RUH1 1YI9A 1C8M3 2WKKA 2K2SA 2ZS6B 4GB31 4H3WA 4IEUA 1R091 3QH6A 3SLIA 1HX6A 4CCDA 4YW7A 5ANNA 1VBC1 3S30A 3BI3A 1FV2A 1OHFA 4OLLA 5FZDA 1BEV1 1H9WA 1X36A 1JN2P 2WSUA 3AKSA 4TLFA 1N1VA 4OHVA 3VBUA 3ZPYA 2DTYA 4E27A 1G86A 4HG6B 2YPDA 4X8PA 4P9GA 5J3UA 5JPNB 4CXXA 1NUKA 1RB8G 3KD4A 1HIXA 4GMP0 4WM7B 4OI1A 4MOAA 4CCMA 2AH2A 5A80A 2QZ2A 2QQPA 1FXZA 1CJPA 2VOWA 1DQ1A 3FLRA 1UXXX 2WAOA 1RVF2 1QDCA 4QDQA 4XXAA 1Q8QA 2ENRA 4OVEA 3FZ3A 4YZ1A 2RHPA 1QJY1 4QPYA 4RSUA 5JOWA 2C5DA 3ECQA 1BCXA 3O14A 4G9SB 1OD3A 3U07A 1YIPA 1YLLA 3NQHA 2JDUA 4IV3B 4AOCA 2DYCA 4MGSA 4XF4A 1QH6A 3FBMA 1ZRFA 3RMXA 1RUJ2 4ZU5A 2WFF3 2CHHA 3VBHB 2AENA 3RYKA 2XJQA 4ARXA 4RR3C 4BDVB 1H4GA 2I74A 1WCQA 1TG7A 3NAPB 4G3YC 4Y4RA 5KBFA 1AR82 3QCWA 1YFXA 5I91A 5M0TA 2ZHLA 4LORA 4GXLA 5C4WB 4BPZA 2AZ5A 4M3CE 2E63A 1VB4A 4IETA 5FKCA 3IMNA 2JD4A 2UYAA 4PIYA 3BPZA 5FYYA 3RDIA 2PQSA 4PJYA 2FZ2A 2FQPA 3TB0A 1GU3A 5C3OA 2C0ZA 2Q8EA 1PNFA 5BNOB 4YNIA 4FOWA 1V9U3 3RS6A 4WZCA 2O8OA 4GH4A 4OUEA 5A3LA 3L9JT 1K42A 1HN1A 5GZCA 3MFAA 5LK7B 2TEPA 2OZ6A 2Y0IA 1LEMA 4Z92B 4XYXA 2W1UA 1VP6A 1C8NA 2HWC2 3JXSA 3KT7A 1J3QA 1DZTA 3FWEA 3SMHA 3Q8EA 2OZJA 4RHV1 2RJKA 4UF0A 2QQJA 3SQOA 1RUF3 1BYHA 4BLIA 3TNPB 3B9CA 4Y1YA 3IM0A 3VBFC 4AEKA 5IAXA 2ARCA 3R6SA 4XTMA 4IEWA 1D4M1 5I0TA 1LHOA 5FP8A 1H2KA 2BJSA 3AL6A 5DPNA 4NHYA 3OBZA 1BMV2 3WP4A 5FYMA 4IL7A 4XFCA 1UCXA 5FZ9A 2VR4A 2QUOA 1BJQA 3VL9A 3MPBA 1LRHA 2A3WA 5K9YA 1A8DA 1ND3B 4K40A 1S0FA 1JYNA 1C4RA 3CO2A 4H7MA 3WNNA 4FQZA 4WM7A 4X8NA 1WMFA 3MHZA 3H8RA 2D6LX 2J22A 2JG9B 1PGL1 1NCQB 2D93A 5IFTA 4LBMA 1SQ4A 5BNPB 3POBA 2WLPA 1MVQA 1JZ4A 1D7PM 4UAPA 1VAKA 5IVFA 1W9TA 1YXWA 4PLMA 2RS52 1R64A 5JI7A 2HWE2 3VHRA 4ES9A 2UWBA 4COVA 2X29A 5J1XA 2EIGA 2CSGA 3JUUA 4I01A 1LODA 5BYNA 1SPPB 4XFGA 4Q4W2 1CX4A 1OBNA 5CKMA 3Q8CA 5KXCA 4Q26A 4XUPA 4XFAA 3FN9A 3WG1A 2IFWA 4ES8A 4QQLA 4FSJA 4DZGA 5A32A 5JIUA 1BVP1 2VXJA 2VMEA 3ZDVA 3ZIWA 4XE9A 4ATEA 5JZGA 4A45A 4DXSA 3OTFA 3VD9A 1AX1A 3EHKA 1IHMA 1I9RA 3I3BA 4ZONA 5EWSA 4AEDA 3CJIB 4KH9A 3VHOA 5CFCA 3SC7X 1MZFA 3SCHA 3T1MA 3DUIA 1N3OA 2JG8B 2WFF1 2Z2SB 4IDZA 1GUIA 1NA1A 4IV1B 1QNYA 4XUNA 5FYIA 3KHCA 4XUTA 2BBAA 1JYIA 1FYUA 1BBT1 5FJHA 2BP6A 2VD7A 1LHVA 1NXD1 5IUQA 5JSPA 3UKTA 4GH4C 3J7HA 3USUA 2JE8A 3DYMA 2FDFA 5FXXA 4E2GA 1UOGA 2HWC1 3B9IA 1UKGA 2P34A 2WNVC 4JQTA 4EN7B 2BWAA 3VZMA 4QPIC 5DAWA 1POV3 3HQRA 2BPA2 4Y4YA 2JG8A 4OZOA 4XMIA 5DG2A 3JB4C 3VZKA 2E26A 4L0PA 3KGZA 3V0BB 2ZJCA 3WNXA 1G9DA 3I2OA 4M00A 1YQ6A 1H6YA 1TME1 4FP3A 2XBO3 4FT8A 4NRMA 1MZ6A 3HVDA 5CG8A 4OFGA 2ARXA 5KHHA 3O12A 4CUBA 5L7OB 2V72A 1V70A 4Q4X2 1NAEA 4AEJA 4FPFA 1ND3C 4IERA 2WRAA 3URFA 1W8TA 5KR7A 4UW4A 1RXGA 3GZTB 1EV11 1XC6A 2Y6GA 4PBPA 4XILA 1POQA 2PHTA 1ALYA 3DKQA 2PHUA 4CDXB 3LKJA 5F5QA 5IHRA 2J1RA 5DAQA 4YVWA 1J3RA 4YVSA 2ZGRA 3W5NA 3K75B 4K8FA 2AACA 1WZXA 1HRI3 1DZQA 3LGRA 1CAVB 5KHIA 3BU7A 3L2YA 3TEWA 1RVF1 2B42B 1FPN2 3MW3A 1XU2A 4AI0A 3H8OA 2OUHA 4NWWA 4PLOA 1W9SA 5J37A 4L8QA 2WNEA 4P9XA 5DUWA 5EHDA 3RJ2X 5BV6A 2ZPXA 2RJLA 1XXNA 2WYFA 5FZOB 2RS12 2ZMLA 4QGNA 5IATA 1SZBA 3EQEA 4GALA 1HRV2 2VW1A 4WZFA 4UW5A 4HONA 4ASMB 1KS4A 3A23A 3W20A 2WZEA 5GM0A 1GWMA 3TN93 4CU6A 2VZTA 3FBYA 5J36A 3KQRA 4R8HA 3WLUA 1O4ZA 1BBT3 1K3IA 1IS5A 4GIQA 4LK7A 1ZBA1 1JZ7A 2QNKA 4YYOA 2GNBA 3M3IA 1BKZA 3MFCA 3CDZB 1KDMA 2AGSA 5IJRA 3GM8A 1W8OA 3ZKUA 1CONA 5CEHA 2BOJA 2R042 2ZABA 2MEV3 4NHLA 4QQHA 3P1IA 1OC1A 5ANQA 1F4HA 1LESA 2R071 2RDQA 3SCFA 1W2NA 2GMMA 2OIIA 1W8NA 3VZLA 4AI9A 1WW6A 3WG4A 4LHLA 4JDMA 4NR1A 5F6LB 4YLZA 4CDWC 4BQ1A 5F1RA 3OEAA 2JB4A 3BTAA 1OOPA 1OXCA 3HQXA 3T09A 3PU8A 4JQRA 4BQ3A 5FUNA 2ZGOA 3AB0A 3N36A 4HK9A 3M3QA 1QQP2 2YHJA 4TWTA 3NL1A 4BA6A 4UFIA 2DVFA 1MVEA 1VR3A 1UAIA 3MIGA 3MICA 1IPSA 5AC91 4MGIE 1GZWA 4A4AA 2GDFA 4B1LA 4PF1A 4PT6A 4YW6A 2R073 4UFJA 4QX2A 4QXHA 3DF0A 2MEV1 4RQPA 4HVOA 4A41A 3IWZA 1N1SA 1PGSA 3J26N 4LLOA 2CAVA 3DPRC 4EN8B 1F8VA 3KHBA 3MV11 5CIRA 1FPN3 2EXHA 3RWKX 4C91A 5I8YA 1X82A 2EAAA 1YQ2A 1R093 2C6SA 3GCWA 3LPGA 1RUH3 1UY3A 1A6CA 2E32A 2AEZA 1VBA3 1YFWA 1HRV3 3UESA 1ZZ9A 3IZOA 1TVGA 3NW4A 1GICA 1I5ZA 2H6BA 4CDXA 3MO4A 3POEA 1K5JA 5FZKA 2DBNA 2RMU1 1EPZA 4XQ4A 1I5PA 1X50A 4ASLA 5E8AA 4X6RB 1SMVA 1T6BX 4Q4V1 4B3NA 3ZOIA 3IPVB 2NP0A 1S0IA 1UIJA 1N3PA 4AQTA 4Y5SA 5LB6A 4ISQA 3RZMA 5GKAC 3WW2A 5LRSA 3C7OA 4CCCA 1XNTA 2YC0A 5A6YA 3WP6A 5E6HA 1SCSA 3FLPA 2QCSB 2BNMA 1DDLA 1N1YA 2VBDA 1C28A 1UZYA 4P02B 4LUKA 1AF9A 1UKRA 3WQ7A 5BNQA 5C8CA 1OA4A 3PIJA 2WZR2 4K6BA 4YG0A 3FHQA 4MH0E 3ZVXA 4Q0SA 2MHFA 1W6PB 2RS32 5FZ1A 3WDTA 3WDWA 3LD8A 4AGVA 5JSRA 5FK8A 3I3QA 5CADA 1VRH3 3AP5A 1FT9A 3H3UA 4Y33A 2YGMA 1QQP3 5APAA 2HBUA 2PA7A 5CFDB 2K0GA 1NQJA 2GALA 2GNDA 3ACIA 5DAVA 1BVVA 4KGGA 1I6XA 3O0VA 2WQZC 2CWMA 5FIXA 1SLAA 1OOPC 5FOBB 1W6QB 2ZHNA 3JBG3 1LOGA 3RYPA 3WDXA 2A5ZA 1W0NA 1ZX5A 1DIWA 3WW4A 3G6JB 1L7QA 4Y26A 1GFF2 5EQUA 1D0HA 5FY1A 1W8UA 2VQ0A 4YVWB 1BK0A 3VD3A 1Y9MA 3GZUC 2WA3A 2A1XA 2Z5WA 3THDA 4HKOA 1HB4A 3BTYA 2PAMA 2BDRA 2VZPA 4RD7A 3DPRB 2YGLA 5FO8B 4W50A 1UNBA 3SH3A 1GLHA 4DQAA 1UXZA 1W3VA 5A1AA 3JCIA 1JMUB 3B02A 5BY5A 4NIDA 3FUQA 4R9DA 3E5QA 4MGZE 4FOQA 5AC93 3BIEA 4N43C 1JI6A 4BLJA 1SFPA 1UY0A 3RYRA 1XE8A 3VBHC 5A1LA 4O7XA 1CN1A 5FMCA 1MS9A 2FMYA 2JG9A 5LY2A 4CZSA 2ZX3A 3LAGA 1CESA 2YY1A 4MO3M 3JZVA 1HN0A 1AYN2 4NHKA 1X9PA 3HPNA 2ZEWA 1VBA1 2ZGTA 1KXGA 3S7EA 4M3CB 5ISLA 3ITQA 1BQPA 4DRVA 2VO5A 4MVTA 4E2SA 2RM22 4QU2A 3F95A 4RL7A 5FZ8A 1JTZX 2ZGPA 3JD73 3IAPA 1OKOA 2CGOA 4FVVA 1ENQA 2VUCA 4QPGB 4CRQA 1QF3A 1YYNA 2R32A 3HBKA 4HETA 5LK5A 2Q8OA 4CCLA 3T4VA 1I1EA 2BZDA 1OLMA 1H30A 1W2UA 3ORJA 5FRAA 2VZUA 2P3YA 3IAQA 3PIGA 5E89A 4AEDB 4LIUA 5I0SA 4QX3A 4B1MA 2Y8KA 3RSJA 5J48A 3CMGA 3POJA 3KB5A 2ZKLA 4IXLA 3H7JA 4JGZA 4XDOA 5CFDC 3E6CC 1RMU2 1D2SA 2EA7A 2GC1A 3O1TA 5CNAA 5F3CA 2Q8CA 1FNZA 4NRPA 3HQUA 4F3JA 1QKQA 1UZ0A 2YU2A 4CP1A 5A3MA 1W2OA 3LWCA 4JKMA 3RQ0A 4RS5C 2GN7A 5A7PA 4B7EA 4B8EA 5FPUA 4AFMA 3QACA 4SLIA 4KG0A 2NN8A 3J9SA 1VBE3 1VBE1 5FP4A 3U37A 5HBAA 2ZGNA 3DXTA 1XRUA 2TBVA 2XG3A 1PK6C 4DO0A 1AZDA 3S0MA 3OF1A 1MS3A 5EFUA 2YBSA 5DXDA 1HRV1 3NJVA 5BNOC 4UYBA 5F9TA 5K8SA 2QKDA 3I3DA 4FAHA 1OKQA 1QJX2 1Z7S1 1W90A 5T50A 3VD5A 3TBDA 2YMZA 1LR5A 1KGYA 4QM8A 2GN3A 5A7SA 5KHKA 1T6GC 1L3JA 2HYXA 2W92A 3CL1A 4NIHA 4LR4A 5T5JA 3VBUB 1LGCA 4Y5TA 2BFUL 5H9RA 1IQAA 4GD4A 4KGQA 4HN1A 3VBFB 5JR7B 3K3OA 3P5BA 3WDYA 5C3RA 1PM7A 4NE9A 3TWIA 3NJXA 1TE1B 2DWRA 2QQOA 1POV0 1ULPA 5FZAA 2VNOA 2AC1A 1OQDA 3AKQA 5FXWA 2ETEA 1QGLA 1W0OA 4GKYA 2QJVA 1CAVA 2HWB1 1BXHA 1MEC2 5KHJA 1YNAA 2JICA 3KGLA 5T52A 2JDZA 1AX0A 3A4UA 2UURA 1CAXB 2VL4A 4BB3A 1SFNA 1GANA 1NXMA 4OQ9A 3LQCA 5KHGA 3VZOA 2E33A 4XCAA 4Y24A 3IT8A 3VD7A 3S6PA 3POGA 4IESA 4BCUA 3ST7A 1JYTA 4LBJA 5LEKA 3OGGA 3O1PA 2WWSA 4Y5Z0 3VGIA 3KCXA 5FYZA 1DGWX 3OUJA 1JYVA 3WZ1A 1WA4A 4GMP3 4MHUA 3P3PA 2Q1MA 4LMFA 1QOOA 4CSWA 2ZGMA 1PIV2 3H9AA 1H8TC 4XFFA 2WAAA 5FCCA 2L9LA 1NLQA 3TN92 2G19A 2VBBA 2GZWA 3ALQA 4XFHA 4UOJA 4AZZA 1RUG3 2UWCA 1VBC3 5T5PA 5CA6A 3ZR5A 2VC9A 2XWJB 1SLCA 1PVC3 4AW7A 5DG1A 2DU0A 3HJRA 4J1XA 2VCAA 3HNBM 1TMF2 3OYWB 2VQUA 4C1XA 2VPVA 1UD1A 4QAWA 2J1AA 2PHWA 2VVDA 5A7QA 2VOXA 1NZCA 2BUKA 2WL1A 4JDNA 2QQWA 4KBZA 1ZYBA 4N7IA 4XAAA 2OT7A 4JAAA 1HJFA 1O91A 4LOTA 4PIZA 1W6OB 4NHMA 2XMLA 4A2UA 4CP9A 1W8HA 1W06A 2HWF2 5L19A 3OD0A 4CXWA 3NV1A 5IVBA 2WLQA 4J1WA 4IE7A 1FOD1 1Q8PA 1WD4A 2WJSA 3B01A 2WYSA 1RUC2 4Q4Y3 1S2BA 4URAA 4MGQA 5LA1A 5L9VA 3MLLA 4GWMA 2Q5TA 5E88A 2X09A 4JHTA 1RMU1 3LB9A 4I3GA 3HN1A 5FZGA 3USUB 4DS0A 5LW9A 4A3ZA 1JH5A 4QQ2A 5A3WA 3I3MA 1IGOA 2VOVA 4WVWA 2F4LA 3GZAA 3NNGA 3QH7A 3AMMA 5DZGA 2YROA 1UW8A 4TSVA 2OVUA 4FBFA 2Z42A 1JZ5A 4LT5A 3NV2A 1HQNA 4ONUA 4Q0VA 2WABA 5I0UA 4BIOA 1PGL2 2GP3A 1R1ZA 4DB5A 2LS6A 3ZYHA 2XHNA 2OQ7A 4ASKA 2FBEA 1VLNA 4XHBA 5JWPA 4Z82A 2R063 3S7IA 4AK3A 5L7OC 2RR11 1MZEA 1E5IA 1HKDA 1X8EA 2YB7A 2D44A 3O5SA 1S4CA 3JQXA 4HSJA 4KG8A 4XOGA 2AREA 2V73A 4C0HA 2XVGA 1W28A 5FY5A 2VGDA 4FPJA 5C71A 4P9WA 3BUCA 4OI0A 5FLJA 2RJ2A 3BOWA 3I8TA 5F5AA 3T1LA 1AYN1 3C7GA 1U5XA 2VMCA 3T08A 1ULGA 2OS2A 1LU2A 1SBFA 1LKNA 5ABJB 4LKSA 3ZYFA 1UIKA 4NWVA 2RDSA 3THTA 1LNSA 1NLRA 3ZSLA 1ZZ6A 4M3CA 1AHSA 4CDUC 4LHSA 1AJOA 5FZEA 4DEQA 2WR9A 4KBBA 5FYTA 2RDNA 2ZAAA 4L11A 4MXWA 4RA0A 3AYAA 3RG0A 1O3SA 3A22A 1YFYA 3C7HA 1JUIA 4CDWA 2ZAHA 4BE3A 3I2DA 2ZEXA 2Y26A 3QD6A 3IIIA 3GYDA 2HWB2 2VM9A 4N53B 1REEA 5FPAA 3TNQA 3B93A 3N9PA 3ON7A 2WT1A 4Y1XA 3RZKA 2PQQA 2ZEYA 1OPOA 1UPIA 3O7OA 1O8PA 2CU5A 2NQYA 4XJ9A 2CAUA 3INAA 4ZXKA 2ZGQA 3ACGA 2OXBA 3ASIA 2FDJA 4A7YA 2Q4SA 4CUCA 2GU9A 4YW4A 3KF3A 4LHKA 1AR63 3AK0A 4QPIA 3J8F3 5FTTC 2H6CA 3DYPA 4BYYA 2AR6A 3J4UH 3CJXA 3CU7A 5F7UA 2WZR1 4JGYA 1PNGA 4I0AA 1GZ9A 4YGBA 3K4ZA 3RZZA 1XOYA 2HEVF 3MYXA 4UW6A 4Z2WA 2PFWA 2FCVA 5FQ0A 2C24A 2K46A 1S55A 1ULDA 1BEV2 3N9QA 5K7PA 3A0NA 2A6ZA 4O9EA 1KDKA 4L2NA 2C26A 3E97A 1PZ9A 3ZMNA 1CZVA 3D5OA 4YSFA 4DUXA 2R061 4WVMA 1XQNA 3IIAA 1LHWA 2VUDA 5C8CB 3LPFA 5FLIA 3VHNA 1XNDA 1PO11 1JHNA 1IOAA 3HWJA 4RFRB 2FD8A 3RI8A 4B4PA 1ND2B 1UZVA 1WBLA 4J25A 1YCIA 3ZYIB 5DUUA 2WZR3 5LBBA 1SDWA 1O5LA 2KA3A 3UV9A 2E53A 3CLPA 3TEXA 3AZWA 3FHIB 4H7LA 2PAKA 3VL8A 3HNMA 4M01A 2Q1FA 4MXWB 4P9JA 3D82A 5FZHA 1NLSA 3PUHA 4H2AA 1SBDA 3WXPA 3MIFA 3NSTA 2R16A 1YWKA 3N7MA 1Y9GA 1CAUA 4BQ2A 2JE7A 3ZFFA 4YM3A 3AP7A 2CNAA 2XUMA 4KU7A 5A3OA 4NIIA 4AVTA 3WG3A 2IWGB 3ZFGA 4BK4A 4FFFA 4W4ZA 4XZUG 4B4RA 4HPKA 3BGAA 4Q2FA 1H9PA 1CAWA 1GNHA 1SLIA 2ET7A 2WFPA 3WW3A 1G7YA 4NVPA 2BNOA 3K2OA 5JDBA 3AVRA 4D3WA 3ZYGA 1SBEA 2XJPA 1QQP1 1PMJX 4AI2A 2J1TA 4YM0A 5FP7A 5BNOA 2Y6KA 5T5OA 4BISA 4YWAA 2HWC3 2I07B 1LULA 1UMZA 4LKDA 3ZXKA 5JXIA 4MYEA 4P9YA 3HOBA 1T2XA 4BH9A 4UF0B 2A73B 4MLOA 3ZFGB 1AYM1 5ACA2 4M0NA 2XJRA 3MDPA 5FZFA 1H6XA 4BQWA 1ZNPA 2ILMA 4QQPA 2X53S 4IE4A 5CYYA 3V65A 3ZYPA 4RQPC 1AR92 4MUVA 3GHNA 3IDAA 4GULA 4UW3A 4BQYA 4S2HA 3AP9A 4EJRA 2VCMA 4Y1UA 3O1OA 1LAJA 5F2SA 4CP9B 5A3TA 2GP5A 4GWNA 4UWDA 5K0UC 1KQRA 4DUVA 2DVAA 3LIHA 2VNRA 1WLCA 3C7EA 3DGTA 1QJEA 4TXWA 1D4VB 4M4RA 1AL21 1Z7S3 1WW4A 3ZYJB 1V6NA 4TLGA 4ZHNA 5BNNA 3LIGA 5JAXA 4DFSA 5LA2A 2HBTA 1EPWA 4KWUA 1B35C 4IGPA 4Q0UA 4CTEA 3R4SA 1PO13 2BW8A 1NCQA 1CJDA 3MIEA 2J42A 3U78A 3VHPA 1HXS1 4O9GA 2N7GA 1LECA 1VBB1 3KT4A 2EIBA 2VAUA 1S0GA 3E1F1 3MIHA 1FPN1 3ZFEC 4CEWA 4P5HA 5JCTA 3FMGA 3ACHA 4CUGA 1VAMA 1RL3A 4CDUA 1Q8VA 2D7FA 1IG0A 1VBD3 1YJKA 1O4YA 1FMD1 5BNNB 3BKZA 2QBXA 2DV9A 4YZ3A 1K45A 1GQGA 5IW0A 2O14A 2O1QA 4KWJA 1D2QA 5HXVA 4EYUA 2Y6FA 3BN6A 4K21A 1K12A 3PMSA 3SKJE 1VRBA 4IGQA 4LE4A 1U5YA 3LDRA 4HBNA 5JZGC 4FTSA 1PK6B 2OW4A 5CFCB 2X5IB 2XKOA 2JDAA 2XKPA 2GNMA 4NROA 3M70A 3KV6A 3PVEA 4TYSA 2RE9A 5SV8A 3K3NA 4D0QA 3WUCA 5LBEA 4BJ0A 1YHFA 1RUD1 2WQ4A 5C7GA 3ZDSA 1GOFA 3E6DA 2UYBA 2B4KA 1W8WA 1V6OA 3U75A 4AYUA 1G9FA 3N9LA 2VECA 1W6MB 1PVC2 1SG3A 1LCLA 1V6JA 4JDOA 5EIYB 1EUUA 2D3RA 2EXKA 2Q30A 3MIBA 2DCYA 2DUOA 4EE2A 5L9RA 1ZM1A 1GNZA 1RUI2 3KMHA 1VIWB 1VBD1 4QKFA 4PF5A 2VVEA 2YFUA 3E5XA 4FFGA 2DF7A 3WINE 1MS4A 2YYOA 1LOEA 3IBMA 2ZXQA 1VPHA 3HR9A 3N7JA 4CU8A 1COV3 2D6PA 2VZSA 3LDKA 5A70A 1UMHA 3OGRA 5EPAA 5AVAA 3SEPA 1HB3A 2VG9A 4IEQA 5FDBA 4NIGA 4NMIA 2GNTA 3GJAA 4BMBA 5HV4A 4EQVA 2XDVA 4Q8LA 3FX3A 4N90A 3I2GA 2ARBA 2QZ3A 1POV1
chains in the Genus database with same CATH topology
1JOBA 1JYTA 1JODA 1F35A 1ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOB A;  1JYT A;  1JOD A;  1F35 A;  1ZRI A; 
#chains in the Genus database with same CATH topology
 1QY4 A;  3I4I A;  4IV3 C;  1CVN A;  5AFE A;  2DUR A;  1ASJ 3;  4JRA A;  4D94 A;  5FP3 A;  3ZSJ A;  2VCC A;  3I54 A;  4Q4W 3;  5DUX A;  4Q4W 1;  4Y1Z A;  4ISR A;  1R08 3;  2VW0 A;  2ZBJ A;  4XF9 A;  3POF A;  2W68 A;  1MQT A;  4YW2 A;  5KC5 A;  1UOJ A;  2HWD 2;  2PN5 A;  1BK1 A;  1VAL A;  1V00 A;  4HSL A;  1ZBE 2;  3ACF A;  4Y20 A;  4ZU7 A;  3OBT A;  1EV1 3;  1WMD A;  5C4W C;  1GP6 A;  5FYS A;  1O3T A;  2P3I A;  4N8M A;  1AR7 1;  5HXM A;  2BBV A;  5C3Q A;  1DQ2 A;  4CPB D;  4L9B A;  5FZC A;  5HPO A;  5FZO A;  1QXP A;  1RUC 1;  4NHX A;  4RR3 B;  2PLV 1;  5G04 L;  3O1S A;  2FCU A;  3V56 A;  1TZO A;  2E9Q A;  1PMI A;  5CFD A;  3CNA A;  5FK7 A;  5D8A B;  5FZL A;  3NNJ A;  4LK6 A;  2WNU C;  4P5Y A;  2XB6 C;  4Z8B A;  2VZV A;  2X5I C;  3FE5 A;  4BU2 A;  2HEY F;  1O3Q A;  4LKE A;  2PMW B;  5EJ1 B;  3VBS C;  3HN3 A;  4CDQ A;  2W39 A;  2JDK A;  4PDW A;  3VLB B;  2RS1 1;  5FR3 A;  1LB2 A;  4XAC A;  2CL2 A;  4E4H A;  1AR8 3;  3DV8 A;  3H1W A;  2DFC A;  2XQX A;  4QKN A;  3N7K A;  2XJV A;  3AKT A;  5J96 B;  4N53 A;  1COV 2;  1WMX A;  2BWC A;  4XQW A;  3I97 A;  1UWW A;  4RHV 2;  2Y0O A;  4HVR A;  3WV6 A;  3N9N A;  1M06 G;  4V2V A;  1UYY A;  2MNG A;  1C5H A;  1OVP A;  4R4Z A;  1GWK A;  4NO4 A;  1PX4 A;  2B5H A;  2PXJ A;  5DAX A;  3P6B A;  1W2T A;  2VMG A;  3H1Y A;  3Q8A A;  2GC2 A;  3TEY A;  4BIF A;  4DIQ A;  1K5M B;  5GZF A;  2JWP A;  1YEW A;  4XW3 A;  3IB3 A;  4AVB A;  2EIE A;  1V6I A;  1RUF 2;  4FP2 A;  1US3 A;  3B3Q E;  3VBF A;  1JOB A;  1ODM A;  2XON A;  4QHZ A;  3U0Z A;  4QT6 A;  3HT2 A;  1EYB A;  1TME 2;  2Y34 A;  5FZM A;  3LOB A;  3WHT A;  2PHD A;  3S5Q A;  2XOM A;  4QB6 A;  2D6K A;  3LA2 A;  3LSD A;  4XBN A;  4AQ6 A;  3UT0 A;  2W0X A;  3OGV A;  2SLI A;  5FXV A;  5DQ0 A;  1IPK A;  4P9L A;  4D7T A;  2ZGL A;  4YZ2 A;  4AVC A;  2UY9 A;  1X7N A;  5F32 A;  3MW2 A;  3WUD A;  3RNS A;  2EID A;  4ET7 A;  4Q4V 3;  2W46 A;  3EB7 A;  1RUJ 1;  1ZRR A;  4OI4 A;  1RUO A;  4XF3 A;  5A7W A;  2JKX A;  1UL9 A;  4AAP A;  3KT1 A;  1FAT A;  4LHN A;  5I0D A;  2Z4F A;  1FAY A;  3WNM A;  3U4S A;  4E2Q A;  1CAX A;  1J1L A;  1UU5 A;  3CBN A;  1EAH 1;  5GZG A;  1A8M A;  2WS9 3;  1BBT 2;  4RN5 A;  1CR7 A;  5GLV A;  2LAL A;  1NYW A;  3WOG A;  2WFF 2;  4AXO A;  2KM2 A;  4XJU A;  4XC9 A;  3HAG A;  3AZX A;  2JXA A;  4FCA A;  1OLQ A;  4PDW C;  1HXS 2;  4RR3 A;  1YQ5 A;  4YG6 A;  1S2K A;  3V64 A;  2IZW A;  4ATF A;  5CZK A;  1YRZ A;  4AFA A;  1X8M A;  1MS5 A;  3A0K A;  5J7M A;  1DBN A;  3NAP C;  5C33 A;  3NNF A;  2JE9 A;  3WF3 A;  3ZFF C;  4TZD A;  2MPF A;  4YPJ A;  4DMI A;  5IVV A;  1AL2 2;  4QPG C;  4V1P A;  1QXR A;  5FWE A;  1W6P A;  1Y3T A;  1OPM A;  4AQS A;  2D98 A;  1ZRE A;  3PL0 A;  3ZXL A;  3DYO A;  2V5Y A;  2PLV 2;  4H55 A;  3VBR A;  3WR0 A;  1C3H A;  1CZS A;  3RVH A;  3ZMO A;  4Z07 A;  1OOP B;  1LHU A;  2E6V A;  2HWE 1;  4OHX A;  2LUW A;  3LOI A;  1DG6 A;  1REF A;  2QQK A;  5GJ6 A;  4AQ2 A;  1AR9 1;  1LOA A;  4IEZ A;  3TRS B;  3MZH A;  2ZGS A;  5FBJ A;  2PEL A;  4FOV A;  3M1H A;  4WVV A;  2D40 A;  1AYM 2;  4BQX A;  1V6K A;  2HWD 1;  2LW8 A;  2WS9 1;  4U2A A;  3U14 A;  3ZN5 A;  2LM3 A;  1D0G A;  5F3G A;  3C7F A;  4C90 A;  2ZX1 A;  5EZW A;  2A75 A;  1JS9 A;  5GLZ A;  1CWP A;  5FPZ A;  3QLQ A;  4Q8K A;  4DY3 A;  1PGW 2;  4UFL A;  3UGG A;  4XZP A;  1AXY A;  1IQD C;  3GGL A;  2W3J A;  5F8P A;  4AI3 A;  2JG8 C;  4Q0Q A;  2YZ4 A;  4X6Q B;  5IVY A;  1BMV 1;  4FXK B;  4MV2 A;  1JOP A;  2GMP A;  3ZKY A;  1OA3 A;  1VBA 2;  4HMZ A;  4I0W B;  1JOD A;  4CVU A;  2J7M A;  4BZ4 A;  5LRR A;  1X33 A;  1GP4 A;  5F2W A;  4CYD A;  3ELN A;  3WF1 A;  2NMN A;  4YM2 A;  4SBV A;  4D6Q A;  2P3K A;  1SFY A;  4QPI B;  4UFH A;  1UX6 A;  2OYZ A;  2WC2 A;  4IE5 A;  4L92 A;  4LE3 A;  1RVF 3;  1YJL A;  3LEG A;  1CIW A;  3WW1 A;  1Z0H A;  4M4P A;  2VZ3 A;  1ZRI A;  1LGB A;  2CDO A;  4LLF A;  1U5I A;  3VBO A;  4IE6 A;  2GSY A;  4IEP A;  3ME2 A;  1H8T A;  1H8V A;  4HKL A;  1RIR A;  4E8C A;  2QQM A;  4BME A;  1DFQ A;  3A21 A;  4QXB A;  1R08 1;  4KI5 M;  1VAV A;  2A6Y A;  4RFT 0;  1PVC 1;  1VMF A;  3VDB A;  3WG2 A;  2A6X A;  2DCK A;  3T2T A;  1DGR A;  4OUM A;  4JGZ C;  4M0H A;  2WNV A;  4YGC A;  1VRH 2;  2P3J A;  4OQ8 A;  3LZZ A;  1GWL A;  4YM1 A;  2WT2 A;  1JYW A;  3UNP A;  2XBO 1;  4YGE A;  2CGP A;  2YDE A;  4M3C F;  3WDV A;  2KR2 A;  3BTX A;  4XFI A;  5FKB A;  2WO1 A;  1S0B A;  3EJK A;  4AFC A;  2CWS A;  5FJK A;  4LTA A;  2OPK A;  3ZFG C;  2RMU 3;  2ARA A;  2G1M A;  5JMC A;  1RUE 1;  4CEY C;  1RUN A;  2XVK A;  4AFB A;  2ZGK A;  1HQW A;  1C1F A;  3T0B A;  2D6M A;  1F31 A;  4JHZ A;  4NPL A;  3UGF A;  1CX1 A;  3FLT A;  4ZS2 A;  2YBK A;  3CQO A;  2B7Y A;  1GZT A;  4QB1 A;  3AC0 A;  2JIG A;  2KXL A;  2VU9 A;  1LOF A;  4QU1 A;  1YFU A;  4F8A A;  3GNE A;  2JKB A;  1Z78 A;  2BYV E;  3PHM A;  1GYK A;  1WLD A;  1HV0 A;  3KLS A;  3GJB A;  1C5I A;  1OF3 A;  3WCS A;  2OKX A;  3VKO A;  1I3H A;  2VBP A;  3AXD A;  4LBQ A;  4A6O A;  3W59 A;  3H7Y A;  4BXS V;  3LEI A;  3RZJ A;  5JXG A;  3CJI A;  2IUW A;  2XBO 2;  1CPM A;  1SHW B;  3MI8 A;  4GJY A;  5L7O A;  4DXR A;  2VZR A;  1ZZ7 A;  1WLT A;  1GZW B;  1ULE A;  2DVB A;  4N43 A;  5F3I A;  4FTB A;  1F5J A;  3LA3 A;  1VRH 1;  1ENS A;  1HQL A;  4DXT A;  5K0U A;  1M4W A;  4ZY9 A;  5CVR A;  3SCG A;  3H3L A;  2Y64 A;  4A7Z A;  4K8R B;  3PUR A;  3RRD A;  3ZFE B;  4GB3 2;  4LXL A;  2BGP A;  4OMC A;  5DN2 A;  1W8Z A;  3OCP A;  2CGN A;  4FPK A;  5FZI A;  2UWA A;  4YFW A;  1UYP A;  1XSR A;  3IDB B;  3OG2 A;  3PUA A;  4HLT A;  3ZM8 A;  4DEV A;  2DUP A;  2IXL A;  3K4D A;  4FI9 A;  4XXP A;  2BVB A;  1WW5 A;  2PHX A;  4MGK E;  3LF7 A;  4XAB A;  3SIS A;  4E4D X;  1IZ3 A;  3OY8 B;  5TSW A;  3WQ1 A;  1P8J A;  5FPV A;  4CA9 A;  3FUO A;  2WZ8 A;  5ACA 1;  1HRI 2;  2UY8 A;  4GWI A;  4CDU B;  5BNP A;  1JOJ A;  2C4X A;  1TNF A;  5T5L A;  4LO4 B;  2GC3 A;  3JB8 A;  3ZXG A;  4QM9 A;  4K1Z A;  1KS5 A;  1W05 A;  4AVS A;  3B69 A;  2JDH A;  4HXC A;  4N7U A;  1UY2 A;  2WQ8 A;  4HOO A;  3KZ4 C;  3KCC A;  2A3X A;  4QGM A;  2QDN A;  4COY A;  2E51 A;  2E7A A;  4P9I A;  5FY7 A;  2HYK A;  3I7D A;  2WN3 A;  1XNK A;  4W8J A;  1BLZ A;  2DVG A;  5IAV A;  3ES1 A;  2WSV A;  1J83 A;  1RIT A;  2RG4 A;  1DYO A;  3BB6 A;  5FV3 A;  3H8U A;  3M7A A;  5B4N A;  2XGX A;  5FMO S;  1H1A A;  2NZ9 A;  2TUN A;  2XUE A;  3CHX A;  4AI1 A;  1PGW 1;  1KEX A;  5FO9 B;  1O8S A;  3KV4 A;  3VBR B;  1Q8O A;  2WUH A;  4Q29 A;  3ZO0 B;  4F7Z A;  1ULF A;  3O1V A;  4PIX A;  5EP9 A;  4PDW B;  5FPB A;  2V4V A;  4KL1 A;  1JZ2 A;  4Y1V A;  1OA2 A;  1JUH A;  1RHI 3;  4QKB A;  5LA9 A;  1YI7 A;  5T54 A;  4GA9 A;  3VDD B;  1XNC A;  3ILF A;  2VUL A;  3C3V A;  4B29 A;  3D0S A;  5HCA A;  5JXJ A;  3CZJ A;  3LDB A;  2R04 1;  4LO7 A;  1WA6 X;  4QXC A;  4ARY A;  3K46 A;  5HV0 A;  4BK5 A;  1FOD 2;  2LTN A;  3FJS A;  2ZMN A;  3EMR A;  4QPW A;  2HWF 1;  1ZBA 2;  3WHU A;  1DLC A;  1QJU 2;  1XYP A;  3OUI A;  4D69 A;  1RUG 1;  4ERO A;  3RPQ A;  3AYE A;  4AGG A;  2VTF A;  1XE0 A;  3VDD A;  3Q8B A;  1XBF A;  1S0D A;  4K20 A;  3PVO A;  4CCN A;  4XFB A;  1DQ5 A;  1VMH A;  4HK8 A;  4Q4Y 2;  4CCJ A;  2GH8 A;  3BU0 A;  1QEX A;  3OOX A;  5D2A A;  5FY9 A;  1JYX A;  5IWF A;  2W5F A;  3AKP A;  5H9Q A;  3UKN A;  5J98 B;  2RS5 3;  4IV3 A;  4P00 B;  3UYJ A;  4K3U A;  3WCR A;  5C9A A;  4OHW A;  4DRR A;  4MAD A;  2YFZ A;  3SXW A;  3WF0 A;  1OQE A;  2O8Q A;  3GDB A;  4GJZ A;  2V5D A;  1NCQ C;  1O7F A;  2I2S A;  4XJW A;  3BIW E;  1SDD B;  2ET1 A;  3L2H A;  5FLH A;  4RGK A;  3LEM A;  5GLU A;  4PBO A;  2BER A;  4QXK A;  2ZAC A;  1IPJ A;  1KFU L;  5BNP C;  2G4I A;  1W6N A;  4CCE A;  3V0A B;  4MGY E;  5LEJ A;  1U12 A;  4PLN A;  1WCD J;  4EN6 B;  1EV1 2;  1F35 A;  3KSC A;  2ZHK A;  5JI9 A;  2DU1 A;  4A3X A;  4AEM A;  5F5C A;  2BQP A;  2RS1 3;  5FZ6 A;  2LRP A;  4R4X A;  4UT5 A;  4XIK A;  5A6Z A;  4MHR A;  1AXZ A;  3RGB A;  1PO2 3;  3VBO C;  4TTG A;  4IE0 A;  2VTX A;  3C8X A;  3K77 A;  1W03 A;  3ENR A;  5GZD A;  1DQ6 A;  2VY0 A;  5FQ0 B;  4FTE A;  1LEN A;  1ENX A;  1STM A;  3SH5 A;  5IYY A;  5IVC A;  1WCK A;  5E1R A;  4CEY A;  3AP6 A;  4AF9 A;  3NWK A;  3GBG A;  5FZ0 A;  4CE8 A;  5FZ7 A;  3DN7 A;  3I2I A;  1DGW A;  4QPG A;  2CV6 A;  2G9F A;  4B7K A;  2RS3 3;  3VBS A;  1NT0 A;  3NNL A;  2ZA9 A;  3IDE A;  1L7L A;  5B4X A;  3RZH A;  4QHB A;  1ND2 C;  3VBR C;  5F6K A;  3ZN6 A;  4BOW A;  3N3H A;  4FPE A;  4JGZ B;  3HBZ A;  1UZW A;  2VMH A;  3T2O A;  1KJL A;  3IDC B;  2JEM A;  1XE7 A;  1Y7B A;  3HEI A;  5FY0 A;  2DTW A;  1IS6 A;  1A78 A;  5LAS A;  1C1L A;  1FI2 A;  2IC1 A;  1GOH A;  1KIT A;  1QJU 3;  1RED A;  5FYH A;  3VV1 A;  1K5M C;  4HL0 A;  4LOS A;  1COV 1;  1XU1 A;  3B5L B;  3M8L A;  3T2P A;  2R49 A;  2D5F A;  3VDD C;  4JV4 A;  2D6N A;  4D7S A;  4AVA A;  1OLR A;  1V9U 2;  3UKV A;  4XBQ A;  2PHF A;  1GZC A;  4YRD A;  5FYU A;  4R9B A;  1ND3 A;  4XF0 A;  1LU1 A;  4WVZ A;  4PCR A;  1IKP A;  5LCW L;  1SLL A;  5IT6 A;  2ADD A;  3AL5 A;  1JZ3 A;  3LE0 A;  2P5B A;  1QU0 A;  1H0B A;  2RR1 2;  3W58 A;  3K48 A;  1VBE 2;  1U0A A;  3W9A A;  4QDR A;  1GV9 A;  4JGY C;  4JKK A;  2QQU A;  1RUD 3;  3VBU C;  1H2L A;  4WVM B;  2VTX J;  4C1W A;  3D8C A;  4FO9 A;  4KNC A;  3ZPO A;  1JU3 A;  1RUI 3;  5L36 A;  2JDP A;  3AVS A;  1OFS A;  4YVS B;  3SHR A;  4AE2 A;  2XLA A;  2XLG A;  3SKV A;  2IVJ A;  1W99 A;  4CP2 A;  1ZBE 1;  2ERF A;  3VZN A;  3H3Z A;  2XPJ A;  4QWN A;  1OUR A;  2O0O A;  2P2K A;  4LA3 A;  2E31 A;  2VJX A;  5G05 L;  5HI0 A;  1H1M A;  4JC1 A;  5FZ3 A;  1YO8 A;  5FUP A;  1UN1 A;  5J09 A;  4E4Z A;  2YBP A;  1WCU A;  2B45 X;  3VKL A;  2QFE A;  3BAL A;  1BHG A;  4NRQ A;  1Y9Q A;  4RGA A;  1NCR A;  1G8W A;  3DL3 A;  1UU4 A;  3KWV A;  4KMQ A;  5L9B A;  4ZXE A;  2LRO A;  1GOG A;  1MAC A;  2ZKN A;  3HNY M;  2RM2 3;  4XCB A;  2RM2 1;  1RIN A;  2WO7 A;  4IQP A;  3SH4 A;  4LUM A;  5KWR A;  2YXS A;  1EP0 A;  4CPB A;  2HWE 3;  1QJZ A;  1WWY A;  1QWR A;  3GBW A;  4NPR A;  1JZ6 A;  1JW6 A;  1V9U 1;  3D6E A;  4YAR A;  5I0R A;  4IUG A;  2FMD A;  4O65 A;  1WCS A;  1YQ8 A;  5I8T A;  5JUV A;  4S2G A;  1OUS A;  3JU9 A;  3POS A;  4RGG A;  1HW5 A;  3USS A;  4H14 A;  1FV3 A;  5FYV A;  2Q1Z B;  1EAH 2;  3TN9 1;  3GBF A;  3WP3 A;  3HMY A;  3QOP A;  4EWA A;  1ZBE 3;  4YFZ A;  5JPM B;  5KXD A;  4ORF A;  3J7N A;  5A7N A;  2IXC A;  3AKR A;  2A6V A;  3U11 A;  2B46 X;  2JJ6 A;  2BTV C;  2PLV 3;  3AMH A;  1J84 A;  2BRT A;  3ETQ A;  3GAL A;  2V09 A;  3PU3 A;  4OUL A;  3WP5 A;  2XJS A;  3NKT A;  3THP A;  4E9K A;  3VUO A;  1LOB A;  1QOT A;  1EUT A;  2B9U A;  2GME A;  2P37 A;  3GZE A;  3OB8 A;  2D3P A;  4Q5O A;  1K5M A;  5FMD A;  2W1Q A;  3K51 A;  3WT3 A;  1PIV 3;  3WQB A;  3R05 A;  5BXX A;  5LY1 A;  1GR3 A;  2A6W A;  2Y38 A;  2YG0 A;  2KD7 A;  1W3X A;  1G9A A;  1AYM 3;  1DU3 D;  2XQR A;  5IK7 A;  5C8C C;  1MS0 A;  2WNU A;  1RUD 2;  1S2E A;  2JIJ A;  1XNA A;  5L73 A;  2JX9 A;  3LFI A;  3VD4 A;  2OA2 A;  2BGO A;  5DMY A;  2W08 A;  3CIH A;  1AR8 1;  3NKG A;  1NX9 A;  2JEN A;  1MEC 1;  5IK8 A;  1E5S A;  4RYD A;  2AUY A;  4LBL A;  4CDW B;  1JXN A;  5H9S A;  5FAX A;  1HB2 A;  2Y6L A;  4E8D A;  1F9K A;  4QX5 A;  3W5M A;  4JX0 A;  2FHR A;  2A70 A;  2VXR A;  3LCP A;  3KM5 A;  4AAX A;  1FX5 A;  1V6M A;  1XJA A;  2ZTN A;  3PNA A;  5K0U B;  3M2M A;  3N9O A;  3OBR A;  5CIS A;  4N43 B;  2C9A A;  2XR4 A;  2IVI B;  4CU9 A;  2BGC A;  3LEK A;  2FDG A;  1RUC 3;  2CTV A;  3MGU A;  2HLE A;  4YGD A;  1ZA7 A;  4A7K A;  4D7Y A;  5FYC A;  1ZRD A;  3WSO A;  4AR2 A;  2B39 A;  3VBH A;  4BHP A;  1GKB A;  2D5H A;  3FFZ A;  2RS3 1;  5A3U A;  4KQ7 A;  1VBB 2;  4ZS3 A;  4Z2A A;  5A3P A;  2Y33 A;  1C8M 1;  3DEM A;  1QJX 1;  1Z7S 2;  3EYP A;  3KF5 A;  4XDP A;  3S5A A;  5BNN C;  2YUE A;  4LUL A;  4JTO A;  4A44 A;  1MEC 3;  3PUS A;  2ZOE B;  5C9A C;  1UOB A;  4Q4Y 1;  1B35 A;  2J1S A;  3OUH A;  4D6S A;  4WM8 C;  3O1M A;  1UPS A;  1ULC A;  2IXJ A;  3H50 A;  1R1A 3;  2BVV A;  2WNV B;  4A42 A;  5EV7 A;  1QJU 1;  3WF2 A;  3P3N A;  5KXE A;  2Q8D A;  4YZ4 A;  4NN0 A;  5K4L A;  3MLJ A;  4Y22 A;  1KJR A;  1ZZB A;  1WW7 A;  1ZZ8 A;  3GCX A;  3LFM A;  5GLT A;  4CCK A;  3ZLI A;  1DQ0 A;  2W95 A;  4GAZ A;  4D8M A;  1WKY A;  2W91 A;  3O1U A;  4NOT A;  3OPW A;  4AED C;  1UF2 C;  2D3S A;  1AR7 2;  1YC6 1;  1ZZC A;  1JYC A;  4XJA A;  3BVC A;  4ITC A;  5DUV A;  1HJG A;  1YIF A;  3ES4 A;  1O5U A;  1KD7 A;  3VKM A;  2VQT A;  3W21 A;  1G9B A;  4XUQ A;  5ABJ A;  3KVA A;  1H1I A;  4AFD A;  1ULO A;  2X10 A;  1KRI A;  3I3E A;  2XXZ A;  5IK5 A;  3JBG 2;  3OYW A;  2Y6H A;  4FPY A;  1OUX A;  2EAK A;  1W9W A;  3VZJ A;  1CIY A;  3ABZ A;  3H1M A;  1FMD 3;  5I8S A;  4QX8 A;  1GQH A;  1E5H A;  2MEV 2;  1WME A;  1ZVF A;  4Q1R A;  2FDK A;  1OVS A;  1UX7 A;  3EBR A;  5A6X A;  3X29 B;  2D97 A;  4XTP A;  2W87 A;  1YUD A;  5ACA 3;  4WV8 A;  3MUZ 1;  2VZ1 A;  1QHD A;  1MS8 A;  1HDK A;  3ZXE A;  4GH4 B;  1AL0 G;  1A3K A;  1SAC A;  3ATG A;  2CYF A;  2XWB B;  4I0B A;  2JB8 A;  4OZX A;  3KV5 A;  1OMI A;  1Q5O A;  5BUV A;  2VNV A;  4IV1 A;  4S2D A;  3ROU A;  4KWK A;  1LED A;  5CAZ A;  2VNG A;  5AFB A;  1WBF A;  2ZEZ A;  2Z69 A;  4OUS A;  4QHO A;  1MR5 A;  2IFR A;  4XJ8 A;  3PUQ A;  1SCR A;  2YPJ A;  1W0P A;  2CY6 A;  3WQ0 A;  1RUI 1;  2VUA A;  3PLQ A;  5CKQ A;  5DZE A;  4ZKT B;  4BXF A;  3KVB A;  4FFH A;  2R07 2;  4YVW C;  1PO1 2;  3KV9 A;  4XDQ A;  3MF9 A;  2ZGU A;  1ST8 A;  4JGY B;  5JMO A;  1MPX A;  4QD2 A;  3ZSE A;  2R06 2;  5GAL A;  2BOI A;  3N35 A;  4R9A A;  3JD7 2;  4LJH A;  3WVJ A;  5FMO L;  1UZZ A;  2RVA A;  3M3C A;  4HFS A;  1VMJ A;  1OLM E;  5C3P A;  1UO9 A;  3NNM A;  3O0W A;  3POI A;  3Q9O A;  4YVS C;  3TAY A;  5FPL A;  3I49 A;  3AMN A;  2FCT A;  3MV0 1;  1TQ5 A;  3MEP A;  5FYB A;  2VMD A;  2UU8 A;  4GQ7 A;  3LSE A;  2VZO A;  2XVL A;  1LJ7 A;  2ES3 A;  3ZYB A;  2G9Z A;  1KFX L;  1WUV A;  1RMU 3;  3AYC A;  4Y22 B;  5D1I A;  4OYU A;  4K7J A;  3RI9 A;  1W6O A;  2XJT A;  1SLB A;  1BZW A;  3TYJ A;  1QXJ A;  2JEC A;  1FMD 2;  1SLT A;  1IKQ A;  5H9P A;  4LBO A;  3OY8 A;  4DIN B;  4LO6 B;  5CU1 A;  3F2Z A;  1EY2 A;  1QJF A;  4XQD A;  1GBG A;  1W6Q A;  3DCQ A;  3AMP A;  3BPS A;  5T55 A;  4UBH A;  1NOV A;  3AJY A;  4QX7 A;  1RUE 2;  2WN2 A;  4LBQ B;  1O59 A;  4I30 A;  1UQX A;  2JDN A;  1S0E A;  2DDU A;  1O6U A;  5FMB A;  5FZ4 A;  4I02 A;  5FRE A;  2PHR A;  3AM2 A;  4LBK A;  4NAM A;  2HJI A;  5A33 B;  1UU6 A;  1NE4 A;  1NZI A;  2P4E A;  1QJX 3;  4FFI A;  3VKN A;  3D3A A;  3OSD A;  4BQ4 A;  1XB9 A;  2DCJ A;  1FOD 3;  2QQI A;  5LZ6 A;  4R52 A;  1Y4W A;  4FOY A;  2VW2 A;  4XAE A;  4OHY A;  2F4P A;  1CD3 G;  1GQP A;  1V6L A;  2WO3 A;  3A7Q A;  4NPM A;  2R1B A;  4I3P A;  4N53 C;  3T30 A;  2R7E B;  3CJI C;  3T0A A;  1GP5 A;  4RQP B;  4EN9 B;  2EAL A;  2RMU 2;  4Y3O A;  4AL9 A;  3OBA A;  4QX0 A;  4XMA A;  2QTW B;  4XUR A;  3UJQ A;  4IV1 C;  1DYK A;  5SV5 A;  1J1T A;  4QQO A;  1RJ7 A;  2ID4 A;  4XET A;  1RJ8 A;  3BOD A;  2Z79 A;  2XH6 A;  1N1T A;  4PI2 A;  5LWB A;  1CGP A;  1DGR N;  3KCY A;  1URX A;  3AJZ A;  4CUA A;  3O1R A;  1ASJ 2;  2YV8 A;  5IVE A;  5JXH A;  3RZL A;  3PTY A;  4LIV A;  1TEI A;  1F15 A;  2BFU S;  1OSG A;  3E6B A;  3PDQ A;  3BTZ A;  1H8T B;  4XPV A;  2WT0 A;  3UET A;  2I45 A;  2PHL A;  2R1D A;  2P6H A;  1SEF A;  3T3Y A;  4GMP 1;  3ZX7 A;  1W8F A;  1H4H A;  2HEW F;  5CKN A;  5JOX A;  4LNV A;  5AC9 2;  4HN0 A;  1C57 A;  1DYP A;  1XPW A;  4CDX C;  4UFM A;  1Y43 B;  2BNN A;  1S1A A;  3B94 A;  1GSL A;  5EXO A;  3IPV A;  2X8K A;  4GB3 3;  3VKF C;  3NV4 A;  4EZH A;  4YW5 A;  5EYY A;  1PO2 2;  1PZ7 A;  3I2F A;  4JKL A;  5FUI A;  5C3S A;  2QQV A;  5LBF A;  5FOJ B;  4FPL A;  4IW3 A;  2PAE A;  2A7A A;  5FZB A;  4LKF A;  5ABJ C;  3GHM A;  3ZYR A;  2WS9 2;  1QOS A;  3FFQ A;  4YZ5 A;  1E5R A;  2EVX A;  2B9V A;  4LBQ D;  1JBC A;  5JZG B;  3N9M A;  3MLK A;  2WBK A;  4N9H A;  5FY8 A;  1ZA4 A;  2XJU A;  5A32 B;  4UXA A;  2YU1 A;  1UYZ A;  3CKH A;  1MQT B;  1AR6 1;  4GZ9 A;  2V4A A;  1RXF A;  4N9I A;  3C2U A;  2JDM A;  1UY1 A;  2ORX A;  3ZR6 A;  1QNW A;  4EZ4 A;  3WD5 A;  4ZZ8 A;  1PHM A;  4MZU A;  2WWU A;  2GH2 A;  3ZSK A;  3MID A;  1OT5 A;  3PUI A;  3H42 B;  4FPH A;  2X05 A;  1EAH 3;  4RHV 3;  2HWF 3;  1OFN A;  1JU4 A;  3FHA A;  3POY A;  5FP9 A;  4IGO A;  1GNY A;  1V0A A;  3M3E A;  3IKW A;  4A6S A;  1CZT A;  4YG3 A;  4Q4X 3;  5DAP A;  4Z1V A;  5A33 A;  1LTE A;  1OD5 A;  3PVB B;  2HWB 3;  5KC6 A;  3NVC A;  5FPX A;  4URT A;  3THC A;  2ATF A;  1C8M 2;  1D4M 2;  2E7T A;  4RS5 A;  4XHX A;  2XL7 A;  4DUW A;  1Q8S A;  1F2N A;  2QE3 A;  1S0J A;  2VZQ A;  3GF6 A;  5JR2 A;  4AHW A;  2RR1 3;  2W47 A;  3JQW A;  3TOJ A;  3NJY A;  4LIT A;  4P08 A;  1NY7 2;  3APB A;  4HPK B;  4EN0 A;  2R0H A;  5CG9 A;  5AVP A;  1PIV 1;  5HCH A;  2IXH A;  5C5T A;  3OGJ A;  1AR9 3;  2ZX0 A;  3PTR B;  1LOC A;  4FXG B;  4LEJ A;  3RFR A;  2DUQ A;  4NAO A;  3ETP A;  4W6Y A;  5EJZ B;  3ZFF B;  2VUJ A;  4P14 A;  4CEW C;  4QGL A;  2GAU A;  3NMB A;  1HB1 A;  2EIC A;  2Y60 A;  3NV3 A;  4Q27 A;  4JRL A;  4XBL A;  3WF4 A;  1JZ8 A;  1DP0 A;  2H0V A;  2IXI A;  1ACC A;  3OJB A;  1WD3 A;  4MSV A;  5FWJ A;  3LA7 A;  4OHZ A;  2W1W A;  4Q4X 1;  3T0D A;  1UMI A;  3G7D A;  4DXZ A;  1L7R A;  5LA0 A;  4XF1 A;  5T3N A;  2J1V A;  4HZF A;  2WIN B;  1RUF 1;  4ZPI A;  5HCB A;  2J1U A;  3GXU A;  3Q8F A;  5A7O A;  3S57 A;  3UL2 A;  4MGT A;  1B35 B;  1RC6 A;  2A71 A;  1RUJ 3;  3HIF A;  3WX5 A;  3AP4 A;  2WII B;  4R9C A;  3AZY A;  2W94 A;  3AZZ A;  1X9T A;  3DPR A;  3HT1 A;  2WDB A;  3MW4 A;  3SIT A;  2VCB A;  2OPW A;  4Q0P A;  2GC0 A;  3ZFE A;  1HXS 3;  2OQ6 A;  5DAB A;  1CAW B;  2D43 A;  4LQR A;  4W6W A;  1PM4 A;  3IN9 A;  4WM8 A;  4D6R A;  1DHK B;  3NAP A;  4W6X A;  1QJY 2;  1NY7 1;  4MX3 A;  1MQT C;  2E7Q A;  3D4K A;  3ZXF A;  3KQ4 B;  4MG2 A;  1LGN A;  4TN7 A;  1ONA A;  4CCO A;  4ZZ5 A;  4S2F A;  2PTM A;  5IFP A;  5D8A C;  1Q3E A;  4YW3 A;  1VB2 A;  4LPL A;  3VBS B;  1OH4 A;  1CPN A;  5JOZ A;  4COW A;  3MUY 1;  4I09 A;  1FNY A;  4CEY B;  5CFC C;  1J58 A;  4FQ4 A;  2A3Y A;  2NLR A;  1W39 A;  1D4M 3;  3PME A;  1E57 A;  4OCT A;  3ZXA C;  2QDR A;  1G6N A;  2ZX2 A;  3U1X A;  4AHX A;  4CXY A;  1DQ4 A;  2NYY A;  3EXU A;  2R30 A;  1QMJ A;  1ENR A;  1F5F A;  4KU8 A;  1J59 A;  1CAU B;  3AFG A;  1YQC A;  1OH3 A;  1RUG 2;  1VBC 2;  4L97 A;  3WNP A;  4AWD A;  2PYT A;  4CP0 A;  3V0B A;  1DF0 A;  1NA1 B;  2BU9 A;  3FL7 A;  4WBB A;  4IEX A;  4ZU4 A;  3RZG A;  2NM1 A;  2X5I A;  4RS5 B;  2ZX4 A;  4YW1 A;  4BWO A;  5HCF A;  4FAG A;  4CDQ C;  5IVJ A;  4AVV A;  5C70 A;  2EXJ A;  3VB9 A;  1TMF 3;  5B2G B;  1LOF C;  4LO8 A;  3NJZ A;  1DGL A;  5A6Q A;  2RS5 1;  1G9C A;  1AR6 2;  3AYD A;  3M3O A;  2Q0A A;  2FDI A;  1MZ5 A;  2D6O X;  1OI6 A;  2JDY A;  2SBA A;  2P1B A;  1UYX A;  4XJZ A;  5C9A B;  2WNU B;  1OF4 A;  2VQA A;  4AGR A;  3I59 A;  5GLW A;  4HT1 T;  3WEZ A;  5D21 A;  4J6G A;  4WM7 C;  3UK9 A;  3DXU A;  4CEW B;  3AX4 A;  1PO2 1;  1BEV 3;  4QKD A;  3T4H B;  2VOK A;  3CZU A;  3OPT A;  5A3N A;  1APN A;  3R4D B;  3POW A;  4AHZ A;  4PQQ A;  2ZMK A;  3N4M A;  4MXV A;  5F39 A;  3VBO B;  3HD8 B;  3MBW A;  2RDR A;  2DCT A;  2YC4 A;  3I2H A;  4OMD A;  4PHZ A;  5LBC A;  4EV0 A;  3E5U A;  1HV1 A;  1UY4 A;  1TMF 1;  1XYO A;  1N47 A;  1PMH X;  3B7M A;  2XL9 A;  1RGS A;  2HKX A;  2W1S A;  2TNF A;  4IEO A;  1QJY 3;  1XSQ A;  4AG4 A;  1TME 3;  2F6B A;  1ASJ 1;  5E16 A;  1QH7 A;  1SPP A;  2HWD 3;  3I2J A;  1VJ2 A;  1Q43 A;  1MS1 A;  1OQ1 A;  1W2A X;  1N3Q A;  3DKW A;  3ILN A;  2WO2 A;  3NRU A;  4QDS A;  4QB2 A;  5C4W A;  5IK4 A;  1ND2 A;  1VBD 2;  4EWE A;  2VMF A;  3U4X A;  4XEZ A;  2J1E A;  2P6C A;  2AEY A;  2G9G A;  4WM8 B;  3AMQ A;  2ZCW A;  3WY6 A;  1S0C A;  1B09 A;  2FZ1 A;  2ZZJ A;  4JVA A;  3OPZ A;  3VDC A;  4C0B A;  4F83 A;  2OX0 A;  1NCR C;  1XNB A;  4Q1P A;  3J8F 1;  4G4F A;  5KXB A;  5LAT A;  1W9F A;  2VMI A;  3UGH A;  4AHY A;  2P17 A;  4CU7 A;  2NMO A;  4NJ4 A;  2NPI A;  4EWD A;  3D0J A;  2RV9 A;  5JSO A;  5F5I A;  2R04 3;  4LBN A;  5C5U A;  5FXZ A;  3EO6 A;  3OD4 A;  2QVS B;  2F17 A;  1NA1 C;  5DDJ 1;  1U5Z A;  4NIA A;  2VH9 A;  3ACL A;  3AXE A;  2WZP P;  1NG0 A;  1ODN A;  1NQD A;  2ORZ A;  3SEE A;  1AUY A;  1HLC A;  4E4S A;  4PI0 A;  1RHI 2;  2W2I A;  2Y6J A;  3SNM A;  2HH9 A;  3MPP G;  4NUB A;  4UFK A;  5C8W A;  3I2K A;  4B4Q A;  3H8X A;  1AXK A;  2DBI A;  3ZIX A;  3M4F A;  3UJO A;  4FPC A;  4JTN A;  4CDQ B;  4I2O A;  1QDO A;  1XYN A;  3QBQ A;  3R0R A;  2QQN A;  2BV4 A;  5JIA A;  5F3E A;  3ZXJ A;  3ZN6 B;  2DFB A;  2W52 A;  1DZR A;  2YC2 A;  4L99 A;  2XLF A;  1ZBA 3;  4JCK A;  1VE0 A;  1O3R A;  5F37 A;  1Q56 A;  2JG9 C;  5FY4 A;  3PJQ A;  4XVH A;  1ZRC A;  1RHI 1;  3AZV A;  1IS3 A;  1UOF A;  4PQ9 A;  3KS7 A;  4AI8 A;  3I59 B;  4IEV A;  2DCZ A;  2WWJ A;  1AYN 3;  2K9Z A;  3NO8 A;  4U36 A;  2DVD A;  3BCW A;  1LHN A;  3ZXD A;  4DPN A;  5DDJ 2;  3RMY A;  3ZN4 A;  2VVF A;  1AJK A;  2R0F A;  1AVB A;  4DNY A;  1JHJ A;  3OGS A;  4QMA A;  1CQ9 A;  4Y20 B;  1PX3 A;  4DY5 A;  1PVX A;  1PZ8 A;  1RYY A;  3JD7 1;  3OEB A;  3VN4 A;  3J8F 2;  1R09 2;  1A34 A;  3DEC A;  4COU A;  3N7L A;  1RUH 2;  2H0B A;  4Q4V 2;  4GKX A;  1J3P A;  2AYH A;  3BYW A;  1R08 2;  1W6N B;  2EXI A;  2VE1 A;  5JLV A;  3V0A A;  2ADE A;  3B00 A;  3CF6 E;  4XIO A;  4FPG A;  3TEZ A;  2OUJ A;  2WNO A;  3PVN A;  1RTV A;  2R6Q A;  3MF6 A;  1NKG A;  4MET A;  2WA4 A;  3IMM A;  3WNO A;  2IXK A;  3J7M A;  3BOP A;  5BPX A;  3ZSM A;  2JD9 A;  3J7L A;  2QQL A;  3PJY A;  4LO5 B;  2C9K A;  3CEW A;  3ILR A;  1QIQ A;  1W04 A;  4C8D A;  4COZ A;  1VBB 3;  5FO7 B;  2ZZQ A;  1US2 A;  2VOT A;  2W9X A;  3T2Q A;  2C1F A;  4GWJ A;  1DCS A;  5JVV A;  1GMM A;  2XHK A;  4DOU A;  4QX1 A;  4LA2 A;  4K1Y A;  5GZE A;  1RUE 3;  5CB7 A;  5A1F A;  5JOY A;  1R1A 2;  4XUO A;  1R1A 1;  1O4T A;  5DZF A;  5EYX A;  3O0X A;  1NCR B;  1AL2 3;  4HKW A;  5ERL A;  3RJR A;  3WNK A;  5C6C A;  5D8A A;  1H2N A;  4IEY A;  4O61 A;  3WNL A;  1TNR A;  4UI9 L;  3U10 A;  1W6M A;  4OI2 A;  4IND A;  2EF6 A;  2CDP A;  4K9S A;  1AR7 3;  4FPO B;  3JBG 1;  3FC0 A;  3K4A A;  4JZR A;  3VDA A;  1HRI 1;  3R4U A;  3AFK A;  4UBG A;  1WLW A;  2ZHM A;  1IS4 A;  2FDH A;  4HVQ A;  2BEO A;  1IG3 A;  1AX2 A;  3H0O A;  5FFO C;  5I93 A;  5DDJ 3;  4HAN A;  1W9Y A;  1PK6 A;  1WGP A;  5CBL A;  4KWL A;  5FBZ A;  5A7W B;  3RWN A;  4W65 A;  1DLL A;  1F4A A;  1H2M A;  4BM8 A;  4BQ5 A;  5EJ3 A;  2B8M A;  4V2W A;  1NE6 A;  3WDU A;  1RUH 1;  1YI9 A;  1C8M 3;  2WKK A;  2K2S A;  2ZS6 B;  4GB3 1;  4H3W A;  4IEU A;  1R09 1;  3QH6 A;  3SLI A;  1HX6 A;  4CCD A;  4YW7 A;  5ANN A;  1VBC 1;  3S30 A;  3BI3 A;  1FV2 A;  1OHF A;  4OLL A;  5FZD A;  1BEV 1;  1H9W A;  1X36 A;  1JN2 P;  2WSU A;  3AKS A;  4TLF A;  1N1V A;  4OHV A;  3VBU A;  3ZPY A;  2DTY A;  4E27 A;  1G86 A;  4HG6 B;  2YPD A;  4X8P A;  4P9G A;  5J3U A;  5JPN B;  4CXX A;  1NUK A;  1RB8 G;  3KD4 A;  1HIX A;  4GMP 0;  4WM7 B;  4OI1 A;  4MOA A;  4CCM A;  2AH2 A;  5A80 A;  2QZ2 A;  2QQP A;  1FXZ A;  1CJP A;  2VOW A;  1DQ1 A;  3FLR A;  1UXX X;  2WAO A;  1RVF 2;  1QDC A;  4QDQ A;  4XXA A;  1Q8Q A;  2ENR A;  4OVE A;  3FZ3 A;  4YZ1 A;  2RHP A;  1QJY 1;  4QPY A;  4RSU A;  5JOW A;  2C5D A;  3ECQ A;  1BCX A;  3O14 A;  4G9S B;  1OD3 A;  3U07 A;  1YIP A;  1YLL A;  3NQH A;  2JDU A;  4IV3 B;  4AOC A;  2DYC A;  4MGS A;  4XF4 A;  1QH6 A;  3FBM A;  1ZRF A;  3RMX A;  1RUJ 2;  4ZU5 A;  2WFF 3;  2CHH A;  3VBH B;  2AEN A;  3RYK A;  2XJQ A;  4ARX A;  4RR3 C;  4BDV B;  1H4G A;  2I74 A;  1WCQ A;  1TG7 A;  3NAP B;  4G3Y C;  4Y4R A;  5KBF A;  1AR8 2;  3QCW A;  1YFX A;  5I91 A;  5M0T A;  2ZHL A;  4LOR A;  4GXL A;  5C4W B;  4BPZ A;  2AZ5 A;  4M3C E;  2E63 A;  1VB4 A;  4IET A;  5FKC A;  3IMN A;  2JD4 A;  2UYA A;  4PIY A;  3BPZ A;  5FYY A;  3RDI A;  2PQS A;  4PJY A;  2FZ2 A;  2FQP A;  3TB0 A;  1GU3 A;  5C3O A;  2C0Z A;  2Q8E A;  1PNF A;  5BNO B;  4YNI A;  4FOW A;  1V9U 3;  3RS6 A;  4WZC A;  2O8O A;  4GH4 A;  4OUE A;  5A3L A;  3L9J T;  1K42 A;  1HN1 A;  5GZC A;  3MFA A;  5LK7 B;  2TEP A;  2OZ6 A;  2Y0I A;  1LEM A;  4Z92 B;  4XYX A;  2W1U A;  1VP6 A;  1C8N A;  2HWC 2;  3JXS A;  3KT7 A;  1J3Q A;  1DZT A;  3FWE A;  3SMH A;  3Q8E A;  2OZJ A;  4RHV 1;  2RJK A;  4UF0 A;  2QQJ A;  3SQO A;  1RUF 3;  1BYH A;  4BLI A;  3TNP B;  3B9C A;  4Y1Y A;  3IM0 A;  3VBF C;  4AEK A;  5IAX A;  2ARC A;  3R6S A;  4XTM A;  4IEW A;  1D4M 1;  5I0T A;  1LHO A;  5FP8 A;  1H2K A;  2BJS A;  3AL6 A;  5DPN A;  4NHY A;  3OBZ A;  1BMV 2;  3WP4 A;  5FYM A;  4IL7 A;  4XFC A;  1UCX A;  5FZ9 A;  2VR4 A;  2QUO A;  1BJQ A;  3VL9 A;  3MPB A;  1LRH A;  2A3W A;  5K9Y A;  1A8D A;  1ND3 B;  4K40 A;  1S0F A;  1JYN A;  1C4R A;  3CO2 A;  4H7M A;  3WNN A;  4FQZ A;  4WM7 A;  4X8N A;  1WMF A;  3MHZ A;  3H8R A;  2D6L X;  2J22 A;  2JG9 B;  1PGL 1;  1NCQ B;  2D93 A;  5IFT A;  4LBM A;  1SQ4 A;  5BNP B;  3POB A;  2WLP A;  1MVQ A;  1JZ4 A;  1D7P M;  4UAP A;  1VAK A;  5IVF A;  1W9T A;  1YXW A;  4PLM A;  2RS5 2;  1R64 A;  5JI7 A;  2HWE 2;  3VHR A;  4ES9 A;  2UWB A;  4COV A;  2X29 A;  5J1X A;  2EIG A;  2CSG A;  3JUU A;  4I01 A;  1LOD A;  5BYN A;  1SPP B;  4XFG A;  4Q4W 2;  1CX4 A;  1OBN A;  5CKM A;  3Q8C A;  5KXC A;  4Q26 A;  4XUP A;  4XFA A;  3FN9 A;  3WG1 A;  2IFW A;  4ES8 A;  4QQL A;  4FSJ A;  4DZG A;  5A32 A;  5JIU A;  1BVP 1;  2VXJ A;  2VME A;  3ZDV A;  3ZIW A;  4XE9 A;  4ATE A;  5JZG A;  4A45 A;  4DXS A;  3OTF A;  3VD9 A;  1AX1 A;  3EHK A;  1IHM A;  1I9R A;  3I3B A;  4ZON A;  5EWS A;  4AED A;  3CJI B;  4KH9 A;  3VHO A;  5CFC A;  3SC7 X;  1MZF A;  3SCH A;  3T1M A;  3DUI A;  1N3O A;  2JG8 B;  2WFF 1;  2Z2S B;  4IDZ A;  1GUI A;  1NA1 A;  4IV1 B;  1QNY A;  4XUN A;  5FYI A;  3KHC A;  4XUT A;  2BBA A;  1JYI A;  1FYU A;  1BBT 1;  5FJH A;  2BP6 A;  2VD7 A;  1LHV A;  1NXD 1;  5IUQ A;  5JSP A;  3UKT A;  4GH4 C;  3J7H A;  3USU A;  2JE8 A;  3DYM A;  2FDF A;  5FXX A;  4E2G A;  1UOG A;  2HWC 1;  3B9I A;  1UKG A;  2P34 A;  2WNV C;  4JQT A;  4EN7 B;  2BWA A;  3VZM A;  4QPI C;  5DAW A;  1POV 3;  3HQR A;  2BPA 2;  4Y4Y A;  2JG8 A;  4OZO A;  4XMI A;  5DG2 A;  3JB4 C;  3VZK A;  2E26 A;  4L0P A;  3KGZ A;  3V0B B;  2ZJC A;  3WNX A;  1G9D A;  3I2O A;  4M00 A;  1YQ6 A;  1H6Y A;  1TME 1;  4FP3 A;  2XBO 3;  4FT8 A;  4NRM A;  1MZ6 A;  3HVD A;  5CG8 A;  4OFG A;  2ARX A;  5KHH A;  3O12 A;  4CUB A;  5L7O B;  2V72 A;  1V70 A;  4Q4X 2;  1NAE A;  4AEJ A;  4FPF A;  1ND3 C;  4IER A;  2WRA A;  3URF A;  1W8T A;  5KR7 A;  4UW4 A;  1RXG A;  3GZT B;  1EV1 1;  1XC6 A;  2Y6G A;  4PBP A;  4XIL A;  1POQ A;  2PHT A;  1ALY A;  3DKQ A;  2PHU A;  4CDX B;  3LKJ A;  5F5Q A;  5IHR A;  2J1R A;  5DAQ A;  4YVW A;  1J3R A;  4YVS A;  2ZGR A;  3W5N A;  3K75 B;  4K8F A;  2AAC A;  1WZX A;  1HRI 3;  1DZQ A;  3LGR A;  1CAV B;  5KHI A;  3BU7 A;  3L2Y A;  3TEW A;  1RVF 1;  2B42 B;  1FPN 2;  3MW3 A;  1XU2 A;  4AI0 A;  3H8O A;  2OUH A;  4NWW A;  4PLO A;  1W9S A;  5J37 A;  4L8Q A;  2WNE A;  4P9X A;  5DUW A;  5EHD A;  3RJ2 X;  5BV6 A;  2ZPX A;  2RJL A;  1XXN A;  2WYF A;  5FZO B;  2RS1 2;  2ZML A;  4QGN A;  5IAT A;  1SZB A;  3EQE A;  4GAL A;  1HRV 2;  2VW1 A;  4WZF A;  4UW5 A;  4HON A;  4ASM B;  1KS4 A;  3A23 A;  3W20 A;  2WZE A;  5GM0 A;  1GWM A;  3TN9 3;  4CU6 A;  2VZT A;  3FBY A;  5J36 A;  3KQR A;  4R8H A;  3WLU A;  1O4Z A;  1BBT 3;  1K3I A;  1IS5 A;  4GIQ A;  4LK7 A;  1ZBA 1;  1JZ7 A;  2QNK A;  4YYO A;  2GNB A;  3M3I A;  1BKZ A;  3MFC A;  3CDZ B;  1KDM A;  2AGS A;  5IJR A;  3GM8 A;  1W8O A;  3ZKU A;  1CON A;  5CEH A;  2BOJ A;  2R04 2;  2ZAB A;  2MEV 3;  4NHL A;  4QQH A;  3P1I A;  1OC1 A;  5ANQ A;  1F4H A;  1LES A;  2R07 1;  2RDQ A;  3SCF A;  1W2N A;  2GMM A;  2OII A;  1W8N A;  3VZL A;  4AI9 A;  1WW6 A;  3WG4 A;  4LHL A;  4JDM A;  4NR1 A;  5F6L B;  4YLZ A;  4CDW C;  4BQ1 A;  5F1R A;  3OEA A;  2JB4 A;  3BTA A;  1OOP A;  1OXC A;  3HQX A;  3T09 A;  3PU8 A;  4JQR A;  4BQ3 A;  5FUN A;  2ZGO A;  3AB0 A;  3N36 A;  4HK9 A;  3M3Q A;  1QQP 2;  2YHJ A;  4TWT A;  3NL1 A;  4BA6 A;  4UFI A;  2DVF A;  1MVE A;  1VR3 A;  1UAI A;  3MIG A;  3MIC A;  1IPS A;  5AC9 1;  4MGI E;  1GZW A;  4A4A A;  2GDF A;  4B1L A;  4PF1 A;  4PT6 A;  4YW6 A;  2R07 3;  4UFJ A;  4QX2 A;  4QXH A;  3DF0 A;  2MEV 1;  4RQP A;  4HVO A;  4A41 A;  3IWZ A;  1N1S A;  1PGS A;  3J26 N;  4LLO A;  2CAV A;  3DPR C;  4EN8 B;  1F8V A;  3KHB A;  3MV1 1;  5CIR A;  1FPN 3;  2EXH A;  3RWK X;  4C91 A;  5I8Y A;  1X82 A;  2EAA A;  1YQ2 A;  1R09 3;  2C6S A;  3GCW A;  3LPG A;  1RUH 3;  1UY3 A;  1A6C A;  2E32 A;  2AEZ A;  1VBA 3;  1YFW A;  1HRV 3;  3UES A;  1ZZ9 A;  3IZO A;  1TVG A;  3NW4 A;  1GIC A;  1I5Z A;  2H6B A;  4CDX A;  3MO4 A;  3POE A;  1K5J A;  5FZK A;  2DBN A;  2RMU 1;  1EPZ A;  4XQ4 A;  1I5P A;  1X50 A;  4ASL A;  5E8A A;  4X6R B;  1SMV A;  1T6B X;  4Q4V 1;  4B3N A;  3ZOI A;  3IPV B;  2NP0 A;  1S0I A;  1UIJ A;  1N3P A;  4AQT A;  4Y5S A;  5LB6 A;  4ISQ A;  3RZM A;  5GKA C;  3WW2 A;  5LRS A;  3C7O A;  4CCC A;  1XNT A;  2YC0 A;  5A6Y A;  3WP6 A;  5E6H A;  1SCS A;  3FLP A;  2QCS B;  2BNM A;  1DDL A;  1N1Y A;  2VBD A;  1C28 A;  1UZY A;  4P02 B;  4LUK A;  1AF9 A;  1UKR A;  3WQ7 A;  5BNQ A;  5C8C A;  1OA4 A;  3PIJ A;  2WZR 2;  4K6B A;  4YG0 A;  3FHQ A;  4MH0 E;  3ZVX A;  4Q0S A;  2MHF A;  1W6P B;  2RS3 2;  5FZ1 A;  3WDT A;  3WDW A;  3LD8 A;  4AGV A;  5JSR A;  5FK8 A;  3I3Q A;  5CAD A;  1VRH 3;  3AP5 A;  1FT9 A;  3H3U A;  4Y33 A;  2YGM A;  1QQP 3;  5APA A;  2HBU A;  2PA7 A;  5CFD B;  2K0G A;  1NQJ A;  2GAL A;  2GND A;  3ACI A;  5DAV A;  1BVV A;  4KGG A;  1I6X A;  3O0V A;  2WQZ C;  2CWM A;  5FIX A;  1SLA A;  1OOP C;  5FOB B;  1W6Q B;  2ZHN A;  3JBG 3;  1LOG A;  3RYP A;  3WDX A;  2A5Z A;  1W0N A;  1ZX5 A;  1DIW A;  3WW4 A;  3G6J B;  1L7Q A;  4Y26 A;  1GFF 2;  5EQU A;  1D0H A;  5FY1 A;  1W8U A;  2VQ0 A;  4YVW B;  1BK0 A;  3VD3 A;  1Y9M A;  3GZU C;  2WA3 A;  2A1X A;  2Z5W A;  3THD A;  4HKO A;  1HB4 A;  3BTY A;  2PAM A;  2BDR A;  2VZP A;  4RD7 A;  3DPR B;  2YGL A;  5FO8 B;  4W50 A;  1UNB A;  3SH3 A;  1GLH A;  4DQA A;  1UXZ A;  1W3V A;  5A1A A;  3JCI A;  1JMU B;  3B02 A;  5BY5 A;  4NID A;  3FUQ A;  4R9D A;  3E5Q A;  4MGZ E;  4FOQ A;  5AC9 3;  3BIE A;  4N43 C;  1JI6 A;  4BLJ A;  1SFP A;  1UY0 A;  3RYR A;  1XE8 A;  3VBH C;  5A1L A;  4O7X A;  1CN1 A;  5FMC A;  1MS9 A;  2FMY A;  2JG9 A;  5LY2 A;  4CZS A;  2ZX3 A;  3LAG A;  1CES A;  2YY1 A;  4MO3 M;  3JZV A;  1HN0 A;  1AYN 2;  4NHK A;  1X9P A;  3HPN A;  2ZEW A;  1VBA 1;  2ZGT A;  1KXG A;  3S7E A;  4M3C B;  5ISL A;  3ITQ A;  1BQP A;  4DRV A;  2VO5 A;  4MVT A;  4E2S A;  2RM2 2;  4QU2 A;  3F95 A;  4RL7 A;  5FZ8 A;  1JTZ X;  2ZGP A;  3JD7 3;  3IAP A;  1OKO A;  2CGO A;  4FVV A;  1ENQ A;  2VUC A;  4QPG B;  4CRQ A;  1QF3 A;  1YYN A;  2R32 A;  3HBK A;  4HET A;  5LK5 A;  2Q8O A;  4CCL A;  3T4V A;  1I1E A;  2BZD A;  1OLM A;  1H30 A;  1W2U A;  3ORJ A;  5FRA A;  2VZU A;  2P3Y A;  3IAQ A;  3PIG A;  5E89 A;  4AED B;  4LIU A;  5I0S A;  4QX3 A;  4B1M A;  2Y8K A;  3RSJ A;  5J48 A;  3CMG A;  3POJ A;  3KB5 A;  2ZKL A;  4IXL A;  3H7J A;  4JGZ A;  4XDO A;  5CFD C;  3E6C C;  1RMU 2;  1D2S A;  2EA7 A;  2GC1 A;  3O1T A;  5CNA A;  5F3C A;  2Q8C A;  1FNZ A;  4NRP A;  3HQU A;  4F3J A;  1QKQ A;  1UZ0 A;  2YU2 A;  4CP1 A;  5A3M A;  1W2O A;  3LWC A;  4JKM A;  3RQ0 A;  4RS5 C;  2GN7 A;  5A7P A;  4B7E A;  4B8E A;  5FPU A;  4AFM A;  3QAC A;  4SLI A;  4KG0 A;  2NN8 A;  3J9S A;  1VBE 3;  1VBE 1;  5FP4 A;  3U37 A;  5HBA A;  2ZGN A;  3DXT A;  1XRU A;  2TBV A;  2XG3 A;  1PK6 C;  4DO0 A;  1AZD A;  3S0M A;  3OF1 A;  1MS3 A;  5EFU A;  2YBS A;  5DXD A;  1HRV 1;  3NJV A;  5BNO C;  4UYB A;  5F9T A;  5K8S A;  2QKD A;  3I3D A;  4FAH A;  1OKQ A;  1QJX 2;  1Z7S 1;  1W90 A;  5T50 A;  3VD5 A;  3TBD A;  2YMZ A;  1LR5 A;  1KGY A;  4QM8 A;  2GN3 A;  5A7S A;  5KHK A;  1T6G C;  1L3J A;  2HYX A;  2W92 A;  3CL1 A;  4NIH A;  4LR4 A;  5T5J A;  3VBU B;  1LGC A;  4Y5T A;  2BFU L;  5H9R A;  1IQA A;  4GD4 A;  4KGQ A;  4HN1 A;  3VBF B;  5JR7 B;  3K3O A;  3P5B A;  3WDY A;  5C3R A;  1PM7 A;  4NE9 A;  3TWI A;  3NJX A;  1TE1 B;  2DWR A;  2QQO A;  1POV 0;  1ULP A;  5FZA A;  2VNO A;  2AC1 A;  1OQD A;  3AKQ A;  5FXW A;  2ETE A;  1QGL A;  1W0O A;  4GKY A;  2QJV A;  1CAV A;  2HWB 1;  1BXH A;  1MEC 2;  5KHJ A;  1YNA A;  2JIC A;  3KGL A;  5T52 A;  2JDZ A;  1AX0 A;  3A4U A;  2UUR A;  1CAX B;  2VL4 A;  4BB3 A;  1SFN A;  1GAN A;  1NXM A;  4OQ9 A;  3LQC A;  5KHG A;  3VZO A;  2E33 A;  4XCA A;  4Y24 A;  3IT8 A;  3VD7 A;  3S6P A;  3POG A;  4IES A;  4BCU A;  3ST7 A;  1JYT A;  4LBJ A;  5LEK A;  3OGG A;  3O1P A;  2WWS A;  4Y5Z 0;  3VGI A;  3KCX A;  5FYZ A;  1DGW X;  3OUJ A;  1JYV A;  3WZ1 A;  1WA4 A;  4GMP 3;  4MHU A;  3P3P A;  2Q1M A;  4LMF A;  1QOO A;  4CSW A;  2ZGM A;  1PIV 2;  3H9A A;  1H8T C;  4XFF A;  2WAA A;  5FCC A;  2L9L A;  1NLQ A;  3TN9 2;  2G19 A;  2VBB A;  2GZW A;  3ALQ A;  4XFH A;  4UOJ A;  4AZZ A;  1RUG 3;  2UWC A;  1VBC 3;  5T5P A;  5CA6 A;  3ZR5 A;  2VC9 A;  2XWJ B;  1SLC A;  1PVC 3;  4AW7 A;  5DG1 A;  2DU0 A;  3HJR A;  4J1X A;  2VCA A;  3HNB M;  1TMF 2;  3OYW B;  2VQU A;  4C1X A;  2VPV A;  1UD1 A;  4QAW A;  2J1A A;  2PHW A;  2VVD A;  5A7Q A;  2VOX A;  1NZC A;  2BUK A;  2WL1 A;  4JDN A;  2QQW A;  4KBZ A;  1ZYB A;  4N7I A;  4XAA A;  2OT7 A;  4JAA A;  1HJF A;  1O91 A;  4LOT A;  4PIZ A;  1W6O B;  4NHM A;  2XML A;  4A2U A;  4CP9 A;  1W8H A;  1W06 A;  2HWF 2;  5L19 A;  3OD0 A;  4CXW A;  3NV1 A;  5IVB A;  2WLQ A;  4J1W A;  4IE7 A;  1FOD 1;  1Q8P A;  1WD4 A;  2WJS A;  3B01 A;  2WYS A;  1RUC 2;  4Q4Y 3;  1S2B A;  4URA A;  4MGQ A;  5LA1 A;  5L9V A;  3MLL A;  4GWM A;  2Q5T A;  5E88 A;  2X09 A;  4JHT A;  1RMU 1;  3LB9 A;  4I3G A;  3HN1 A;  5FZG A;  3USU B;  4DS0 A;  5LW9 A;  4A3Z A;  1JH5 A;  4QQ2 A;  5A3W A;  3I3M A;  1IGO A;  2VOV A;  4WVW A;  2F4L A;  3GZA A;  3NNG A;  3QH7 A;  3AMM A;  5DZG A;  2YRO A;  1UW8 A;  4TSV A;  2OVU A;  4FBF A;  2Z42 A;  1JZ5 A;  4LT5 A;  3NV2 A;  1HQN A;  4ONU A;  4Q0V A;  2WAB A;  5I0U A;  4BIO A;  1PGL 2;  2GP3 A;  1R1Z A;  4DB5 A;  2LS6 A;  3ZYH A;  2XHN A;  2OQ7 A;  4ASK A;  2FBE A;  1VLN A;  4XHB A;  5JWP A;  4Z82 A;  2R06 3;  3S7I A;  4AK3 A;  5L7O C;  2RR1 1;  1MZE A;  1E5I A;  1HKD A;  1X8E A;  2YB7 A;  2D44 A;  3O5S A;  1S4C A;  3JQX A;  4HSJ A;  4KG8 A;  4XOG A;  2ARE A;  2V73 A;  4C0H A;  2XVG A;  1W28 A;  5FY5 A;  2VGD A;  4FPJ A;  5C71 A;  4P9W A;  3BUC A;  4OI0 A;  5FLJ A;  2RJ2 A;  3BOW A;  3I8T A;  5F5A A;  3T1L A;  1AYN 1;  3C7G A;  1U5X A;  2VMC A;  3T08 A;  1ULG A;  2OS2 A;  1LU2 A;  1SBF A;  1LKN A;  5ABJ B;  4LKS A;  3ZYF A;  1UIK A;  4NWV A;  2RDS A;  3THT A;  1LNS A;  1NLR A;  3ZSL A;  1ZZ6 A;  4M3C A;  1AHS A;  4CDU C;  4LHS A;  1AJO A;  5FZE A;  4DEQ A;  2WR9 A;  4KBB A;  5FYT A;  2RDN A;  2ZAA A;  4L11 A;  4MXW A;  4RA0 A;  3AYA A;  3RG0 A;  1O3S A;  3A22 A;  1YFY A;  3C7H A;  1JUI A;  4CDW A;  2ZAH A;  4BE3 A;  3I2D A;  2ZEX A;  2Y26 A;  3QD6 A;  3III A;  3GYD A;  2HWB 2;  2VM9 A;  4N53 B;  1REE A;  5FPA A;  3TNQ A;  3B93 A;  3N9P A;  3ON7 A;  2WT1 A;  4Y1X A;  3RZK A;  2PQQ A;  2ZEY A;  1OPO A;  1UPI A;  3O7O A;  1O8P A;  2CU5 A;  2NQY A;  4XJ9 A;  2CAU A;  3INA A;  4ZXK A;  2ZGQ A;  3ACG A;  2OXB A;  3ASI A;  2FDJ A;  4A7Y A;  2Q4S A;  4CUC A;  2GU9 A;  4YW4 A;  3KF3 A;  4LHK A;  1AR6 3;  3AK0 A;  4QPI A;  3J8F 3;  5FTT C;  2H6C A;  3DYP A;  4BYY A;  2AR6 A;  3J4U H;  3CJX A;  3CU7 A;  5F7U A;  2WZR 1;  4JGY A;  1PNG A;  4I0A A;  1GZ9 A;  4YGB A;  3K4Z A;  3RZZ A;  1XOY A;  2HEV F;  3MYX A;  4UW6 A;  4Z2W A;  2PFW A;  2FCV A;  5FQ0 A;  2C24 A;  2K46 A;  1S55 A;  1ULD A;  1BEV 2;  3N9Q A;  5K7P A;  3A0N A;  2A6Z A;  4O9E A;  1KDK A;  4L2N A;  2C26 A;  3E97 A;  1PZ9 A;  3ZMN A;  1CZV A;  3D5O A;  4YSF A;  4DUX A;  2R06 1;  4WVM A;  1XQN A;  3IIA A;  1LHW A;  2VUD A;  5C8C B;  3LPF A;  5FLI A;  3VHN A;  1XND A;  1PO1 1;  1JHN A;  1IOA A;  3HWJ A;  4RFR B;  2FD8 A;  3RI8 A;  4B4P A;  1ND2 B;  1UZV A;  1WBL A;  4J25 A;  1YCI A;  3ZYI B;  5DUU A;  2WZR 3;  5LBB A;  1SDW A;  1O5L A;  2KA3 A;  3UV9 A;  2E53 A;  3CLP A;  3TEX A;  3AZW A;  3FHI B;  4H7L A;  2PAK A;  3VL8 A;  3HNM A;  4M01 A;  2Q1F A;  4MXW B;  4P9J A;  3D82 A;  5FZH A;  1NLS A;  3PUH A;  4H2A A;  1SBD A;  3WXP A;  3MIF A;  3NST A;  2R16 A;  1YWK A;  3N7M A;  1Y9G A;  1CAU A;  4BQ2 A;  2JE7 A;  3ZFF A;  4YM3 A;  3AP7 A;  2CNA A;  2XUM A;  4KU7 A;  5A3O A;  4NII A;  4AVT A;  3WG3 A;  2IWG B;  3ZFG A;  4BK4 A;  4FFF A;  4W4Z A;  4XZU G;  4B4R A;  4HPK A;  3BGA A;  4Q2F A;  1H9P A;  1CAW A;  1GNH A;  1SLI A;  2ET7 A;  2WFP A;  3WW3 A;  1G7Y A;  4NVP A;  2BNO A;  3K2O A;  5JDB A;  3AVR A;  4D3W A;  3ZYG A;  1SBE A;  2XJP A;  1QQP 1;  1PMJ X;  4AI2 A;  2J1T A;  4YM0 A;  5FP7 A;  5BNO A;  2Y6K A;  5T5O A;  4BIS A;  4YWA A;  2HWC 3;  2I07 B;  1LUL A;  1UMZ A;  4LKD A;  3ZXK A;  5JXI A;  4MYE A;  4P9Y A;  3HOB A;  1T2X A;  4BH9 A;  4UF0 B;  2A73 B;  4MLO A;  3ZFG B;  1AYM 1;  5ACA 2;  4M0N A;  2XJR A;  3MDP A;  5FZF A;  1H6X A;  4BQW A;  1ZNP A;  2ILM A;  4QQP A;  2X53 S;  4IE4 A;  5CYY A;  3V65 A;  3ZYP A;  4RQP C;  1AR9 2;  4MUV A;  3GHN A;  3IDA A;  4GUL A;  4UW3 A;  4BQY A;  4S2H A;  3AP9 A;  4EJR A;  2VCM A;  4Y1U A;  3O1O A;  1LAJ A;  5F2S A;  4CP9 B;  5A3T A;  2GP5 A;  4GWN A;  4UWD A;  5K0U C;  1KQR A;  4DUV A;  2DVA A;  3LIH A;  2VNR A;  1WLC A;  3C7E A;  3DGT A;  1QJE A;  4TXW A;  1D4V B;  4M4R A;  1AL2 1;  1Z7S 3;  1WW4 A;  3ZYJ B;  1V6N A;  4TLG A;  4ZHN A;  5BNN A;  3LIG A;  5JAX A;  4DFS A;  5LA2 A;  2HBT A;  1EPW A;  4KWU A;  1B35 C;  4IGP A;  4Q0U A;  4CTE A;  3R4S A;  1PO1 3;  2BW8 A;  1NCQ A;  1CJD A;  3MIE A;  2J42 A;  3U78 A;  3VHP A;  1HXS 1;  4O9G A;  2N7G A;  1LEC A;  1VBB 1;  3KT4 A;  2EIB A;  2VAU A;  1S0G A;  3E1F 1;  3MIH A;  1FPN 1;  3ZFE C;  4CEW A;  4P5H A;  5JCT A;  3FMG A;  3ACH A;  4CUG A;  1VAM A;  1RL3 A;  4CDU A;  1Q8V A;  2D7F A;  1IG0 A;  1VBD 3;  1YJK A;  1O4Y A;  1FMD 1;  5BNN B;  3BKZ A;  2QBX A;  2DV9 A;  4YZ3 A;  1K45 A;  1GQG A;  5IW0 A;  2O14 A;  2O1Q A;  4KWJ A;  1D2Q A;  5HXV A;  4EYU A;  2Y6F A;  3BN6 A;  4K21 A;  1K12 A;  3PMS A;  3SKJ E;  1VRB A;  4IGQ A;  4LE4 A;  1U5Y A;  3LDR A;  4HBN A;  5JZG C;  4FTS A;  1PK6 B;  2OW4 A;  5CFC B;  2X5I B;  2XKO A;  2JDA A;  2XKP A;  2GNM A;  4NRO A;  3M70 A;  3KV6 A;  3PVE A;  4TYS A;  2RE9 A;  5SV8 A;  3K3N A;  4D0Q A;  3WUC A;  5LBE A;  4BJ0 A;  1YHF A;  1RUD 1;  2WQ4 A;  5C7G A;  3ZDS A;  1GOF A;  3E6D A;  2UYB A;  2B4K A;  1W8W A;  1V6O A;  3U75 A;  4AYU A;  1G9F A;  3N9L A;  2VEC A;  1W6M B;  1PVC 2;  1SG3 A;  1LCL A;  1V6J A;  4JDO A;  5EIY B;  1EUU A;  2D3R A;  2EXK A;  2Q30 A;  3MIB A;  2DCY A;  2DUO A;  4EE2 A;  5L9R A;  1ZM1 A;  1GNZ A;  1RUI 2;  3KMH A;  1VIW B;  1VBD 1;  4QKF A;  4PF5 A;  2VVE A;  2YFU A;  3E5X A;  4FFG A;  2DF7 A;  3WIN E;  1MS4 A;  2YYO A;  1LOE A;  3IBM A;  2ZXQ A;  1VPH A;  3HR9 A;  3N7J A;  4CU8 A;  1COV 3;  2D6P A;  2VZS A;  3LDK A;  5A70 A;  1UMH A;  3OGR A;  5EPA A;  5AVA A;  3SEP A;  1HB3 A;  2VG9 A;  4IEQ A;  5FDB A;  4NIG A;  4NMI A;  2GNT A;  3GJA A;  4BMB A;  5HV4 A;  4EQV A;  2XDV A;  4Q8L A;  3FX3 A;  4N90 A;  3I2G A;  2ARB A;  2QZ3 A;  1POV 1; 
#chains in the Genus database with same CATH homology
 1JOB A;  1JYT A;  1JOD A;  1F35 A;  1ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...