1JYTA

Solution structure of olfactory marker protein from rat
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
163
structure length
163
Chain Sequence
b'MAEDGPQKQQLDMPLVLDQDLTKQMRLRVESLKQRGEKKQDGEKLLRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
publication title Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 17
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jytA00
1ZRIA 1F35A 1JODA 1JYTA 1JOBA
chains in the Genus database with same CATH superfamily
3MFCA 3WF4A 4Y26A 3B93A 4LPLA 2VCAA 1RVF3 1QOTA 5A3UA 4FPKA 1CAXB 1H4HA 4W50A 4AEKA 4D8MA 4A7ZA 1DYPA 1NAEA 2JDKA 3JU9A 4XBLA 1MS0A 1ZBA2 1C5HA 2CU5A 1OSGA 4G4FA 3ZN4A 1PVXA 2VZSA 3B9CA 3M3IA 4IE5A 3QH7A 3LAGA 1JTZX 3ZMOA 3ZPOA 4RA0A 1AYN3 5BUVA 5IYYA 5DG1A 2J1EA 1AR82 2E32A 5EQUA 4ZU4A 5BNPA 2VQ0A 3BYWA 3MPBA 4NIGA 4YM2A 1GZ9A 2RDSA 1H2NA 4UT5A 1HN0A 3WF2A 3OGVA 5DAQA 4NMIA 4XQWA 4D69A 4GH4C 2WQZC 4LUMA 4CCNA 4DMIA 2Y0IA 1KDMA 2XVLA 5LATA 3CDZB 3V64A 2GC1A 2Y6FA 1HRI1 3AVSA 2CWMA 5FTTC 5LB6A 4BWOA 4FQ4A 4L11A 3HN3A 4E9KA 2W08A 1Y3TA 5K0UA 1YEWA 2HH9A 2QQLA 5FMOS 1SQ4A 1ZNPA 5FYCA 4NPMA 4ATEA 1JZ4A 3POGA 1ENQA 3IAQA 5A7WA 3E5UA 5FXZA 2RDRA 5IK4A 1W0PA 3ZIWA 1UL9A 1DGWA 1DYOA 1W9TA 1YI9A 2BFUS 3DCQA 2DVDA 2ARCA 2WUHA 3ZXGA 1Y9QA 1MEC3 2P34A 1XPWA 4IEVA 5D8AA 4YW3A 2ZHLA 3BGAA 1EV11 1IHMA 4HMZA 2J1AA 2DYCA 2K9ZA 3RWKX 3NAPC 1Y7BA 5L73A 4BLJA 5GLUA 5A33B 4LMFA 5I0SA 5EP9A 3ROUA 1QQP3 2WNUB 2IVJA 5FYSA 5ABJC 2WWJA 1GP5A 1RUF3 1OLME 3ALQA 3LEGA 1POV3 1W04A 2K2SA 4ONUA 5DZGA 3PVNA 3U1XA 3W58A 3ILNA 5C9AC 1U5YA 1RUNA 2CL2A 4MOAA 1IPSA 1RHI3 4FQZA 2RS53 1SMVA 5FO9B 4W65A 2B39A 1IS3A 4XZUG 5T5LA 1JYTA 3OUJA 4MYEA 1KS4A 1LEMA 1D4M2 2PLV3 1MACA 1CWPA 1ODNA 3CJXA 3PIJA 3AMHA 4W4ZA 5CFCC 1QJY3 1NZIA 2D6LX 4GJZA 5CADA 5FO8B 1NUKA 4QT6A 1YNAA 2O1QA 1RJ7A 1RUH3 1ZX5A 3MIHA 4LBQA 5FYZA 3ZFGA 5JLVA 2P4EA 2JJ6A 2DU0A 1NZCA 2X53S 3Q8EA 4Q27A 2GH8A 2EIBA 3OPZA 3KWVA 4IE0A 3OUHA 3DPRB 4PDWA 3VZOA 4CDXA 3MHZA 2G9FA 4UW6A 4XF3A 2ZTNA 4AGVA 1NLQA 3S7EA 1DZRA 3ZYRA 3O12A 5KXBA 4CUBA 5FP7A 2JG8B 1ZYBA 1S2BA 1LENA 3DYOA 3L2HA 4XJAA 1SCRA 2XGXA 2ZGUA 2BZDA 4HN0A 4AYUA 3SEPA 1JMUB 4FO9A 4MGZE 3SCHA 3CJIA 5IAVA 4GXLA 2QDNA 4OQ9A 1UY2A 4LT5A 2GSYA 2ARBA 1Z78A 3OSDA 2O8QA 3B7MA 2FCUA 4WM8B 1W05A 3I7DA 4BB3A 3B69A 1CAVB 3K3NA 3RDIA 4UFHA 3VD9A 4I02A 4FI9A 2R7EB 3HWJA 4DOUA 2R041 4M3CE 3ME2A 1RINA 3UK9A 1UU5A 2ZEWA 1UOBA 4W6YA 4CPBA 3CZUA 4KWJA 1XXNA 4YVSA 2VZVA 4XTMA 1UWWA 1AR93 1LRHA 3KF3A 5FWEA 2JE8A 3ZR5A 5JPNB 2KR2A 2WC2A 4H3WA 3W9AA 4UF0A 5DAWA 2GN7A 5E8AA 2WNUC 5CG9A 2VZQA 5FZ1A 4KL1A 2YV8A 2ZGLA 1FX5A 4ATFA 1PM7A 1HRI2 4R8HA 3UJOA 2R1BA 1G9CA 1JXNA 4Q5OA 3RGBA 4CCDA 1LEDA 3ON7A 2Q5TA 2P3YA 3T2OA 3WUDA 5KXDA 4CVUA 4HT1T 5FYMA 1Q5OA 5A7SA 5F5QA 4QPIB 4M0HA 4H2AA 4EJRA 1AR83 1N1YA 5F1RA 3ZYGA 3ZXKA 4BK4A 5EJ3A 2R073 1AR71 1EV12 3BTZA 2PELA 2D5HA 2DTYA 2VXJA 4GZ9A 1R083 1IOAA 5GLTA 3UESA 1NLRA 3VBOB 3NWKA 5C4WB 4RHV3 3HQRA 3GBFA 2HKXA 2I74A 2JG9A 3JD73 1QJZA 2RMU1 3I59A 3TBDA 2FCTA 3KHCA 2AH2A 2P3JA 2AZ5A 5EIYB 3WR0A 4AOCA 1EP0A 1NA1B 1DLCA 3E5QA 2WNVB 1CVNA 3H3LA 4IEQA 5FLHA 5A70A 3OG2A 3NSTA 2WABA 1U12A 1BZWA 4Y5TA 2DUQA 1SBEA 2BERA 5ISLA 1MS1A 4QXHA 4R9CA 2WKKA 4PJYA 3H7JA 1SLLA 4QX5A 4LBMA 4IEWA 5B4XA 3GCXA 4M00A 2DVGA 1JZ3A 2IWGB 1S0BA 4AQTA 2KD7A 2PXJA 3ES4A 4DEVA 2D7FA 2P2KA 4JKMA 4KWKA 1YHFA 5EWSA 5KHIA 2GN3A 3ZXJA 2EVXA 4NIAA 1LECA 2DCTA 4Q4W1 5FY1A 1OD5A 2Q1FA 3C2UA 4DXTA 1QGLA 2E63A 4FOQA 4YW4A 1E5SA 1N1TA 5FZCA 5FDBA 2ET7A 4RN5A 4XBNA 2CDPA 3OCPA 5DAXA 3CQOA 1GQGA 4XFHA 1D4M3 4GH4A 4NHKA 3AJZA 2A6ZA 1UO9A 1XC6A 3BPZA 1G86A 3WSOA 1H9PA 5JIAA 4QD2A 4XJZA 5AC92 2VD7A 4RS5C 2VZTA 4E27A 3AKPA 1UW8A 1QJU1 3NV1A 2QBXA 2ZZJA 3ZR6A 1FV3A 3JZVA 3VDAA 5LZ6A 3E6BA 2TNFA 2ZX4A 3VBHC 1KXGA 4LIUA 2RJKA 1YFXA 2PHUA 1GNHA 2TUNA 2ZGRA 3T0AA 3H3ZA 3D0SA 1LOFC 1S0JA 1DGLA 3N7KA 2WRAA 3PIGA 2J1UA 1EY2A 2R042 5L9VA 1SPPA 5FP8A 3T2TA 2W1WA 2CAVA 4MG2A 1O91A 1IS6A 2LM3A 3I2OA 4DFSA 1N3PA 1EPZA 4O9EA 4DRRA 2D6MA 3C7EA 4WVMA 1ONAA 1YIFA 2V4AA 4IV3B 2AYHA 5IAXA 3MW4A 3PUHA 2I07B 1B35A 4TWTA 4KMQA 3VBUA 1IKQA 4LKDA 2WINB 2WNVC 4IV1C 1H1IA 5JR7B 3BTYA 4P9YA 4QPWA 2UYAA 4XUOA 1W9WA 5C9AA 1W8ZA 1ZZCA 2VNOA 4IQPA 4XHBA 1SHWB 2LTNA 2ZXQA 1J84A 3ZIXA 1OVPA 1ND3C 4C91A 2YFUA 3POIA 4FPOB 2J1SA 4I01A 3B5LB 1CAXA 3KB5A 5CFCA 4XFGA 2JD9A 2XBO1 4GD4A 3TAYA 1DZQA 1UZYA 5IWFA 2GC3A 1D0HA 1VBC1 2A71A 1X33A 1L7QA 4XURA 3VBSB 4OI2A 1WW6A 4Q4Y1 4EWAA 1OQEA 1AR72 1NT0A 4Y1XA 3JBG3 1OH4A 1W6PB 4JCKA 4LHLA 1MS5A 1HRI3 2IFRA 1NOVA 2WZR1 1UY4A 4YZ1A 4IDZA 3MIEA 1X9PA 2WT0A 2ILMA 2EXHA 3OY8B 2RMU2 1QEXA 3GXUA 4J1XA 5FK8A 2OKXA 3VHNA 3IIIA 2LS6A 4QQLA 3IDBB 2W46A 5FPVA 5AFBA 4BZ4A 3MUZ1 3WLUA 2P5BA 3T0DA 4Y20B 4HG6B 2VMDA 4ZS3A 3ECQA 5CFDB 2C0ZA 2DCZA 1WLDA 4LHNA 4WZCA 4CU8A 4QX7A 2R6QA 5DAPA 3SMHA 4IEZA 1DGRA 3MLLA 4AK3A 2ZAAA 1I3HA 4XAEA 1B09A 4RSUA 5CIRA 3T0BA 4Q4W2 4FTEA 4FVVA 2W91A 3TN93 3LCPA 5E1RA 3O0XA 4A6OA 5IK8A 1OPOA 2JICA 5A6QA 1JYNA 4AEDC 5A33A 4NUBA 3WQ0A 4O65A 3WINE 3WQ1A 2WNUA 3BN6A 5K4LA 1LGBA 4DXRA 4N53B 1WZXA 2OW4A 2WFF1 3I97A 3ZXAC 3RI9A 3EO6A 1PMJX 2WT2A 3V0AA 2JE9A 3N9LA 1E5HA 4XUTA 3VD7A 1QJU2 2IXJA 4BDVB 3DEMA 4S2HA 4XOGA 3SC7X 1AYM1 4FPEA 3H8XA 1HX6A 5BNNC 1KJRA 5DUUA 5HXVA 2DCKA 2XPJA 3LFMA 1XNAA 3N9MA 4DXSA 4QM9A 4HK8A 5FLJA 3GZEA 5FUNA 3NNGA 1KFUL 3PTYA 3WCSA 4KU8A 5APAA 2R32A 2YU1A 5B4NA 2WS93 5F5AA 2A73B 5LK5A 4YW1A 2HWD1 3DPRA 4EN9B 3WNOA 3N36A 3EMRA 3HNYM 2Z5WA 4M4PA 2R30A 1WD3A 3POYA 1DFQA 1LAJA 3UGGA 1W8OA 2JG8A 1WCQA 1EUTA 1L7LA 2A6XA 3OD0A 1H6XA 3C3VA 4J6GA 5JI7A 2ZJCA 4XAAA 1AXYA 1NLSA 4CEYB 5IT6A 2BOJA 2D3PA 4PF5A 1OH3A 3JQXA 3E6CC 1IS4A 3U0ZA 1O6UA 2XVGA 4TXWA 1PMHX 2VUAA 1AR63 4OMDA 3B94A 4AQ6A 3PNAA 4FOWA 3VHOA 3NJXA 3VZLA 4FTBA 1WBFA 3MIDA 1CAVA 3KQRA 2WNOA 4LHSA 3TB0A 4KG8A 4XCAA 4P14A 2VCCA 2W47A 1DQ5A 2XBO2 2VNGA 4Z07A 3WP6A 5JSPA 4PIZA 3ENRA 4PI0A 3W5NA 1VBC2 2BGOA 2EALA 3ZO0B 2XXZA 4Q4Y2 2PN5A 1HJGA 2D98A 2QQKA 2UWCA 3DV8A 4HSJA 5KHJA 1ULCA 2JDPA 1XNDA 5KHGA 2WZR2 4YW7A 1RUJ1 2GMEA 1GP6A 2UYBA 2VGDA 2ZX1A 3AKRA 3OBTA 3VZJA 4A4AA 4XQ4A 1ACCA 1O4TA 2J1TA 3W5MA 4BQ3A 2Y6GA 2VY0A 4MSVA 2DV9A 3PVBB 4F8AA 3WOGA 4XUNA 3UL2A 2ADEA 3ACLA 2VR4A 3ST7A 5IATA 4RS5A 1CIYA 1C8NA 2XKOA 1HB1A 3V0BB 2J1VA 2BJSA 1H1AA 3WNLA 2JXAA 4QPIA 3VBHA 4CDWC 4LBNA 1UMIA 4IGOA 3NV4A 1GZTA 4QDRA 1LOFA 5CKNA 4Q0VA 1VBB3 1RUC1 2FZ1A 1QXJA 1YJLA 3KV4A 4DY3A 1FNYA 3CNAA 5C4WA 2A3YA 1LOBA 1C4RA 3VBOA 2VUDA 3LEIA 1N1VA 2QUOA 4FPCA 1X8EA 4AEMA 3OBRA 3IIAA 4L92A 2B45X 3MEPA 3MLKA 4YZ5A 4PBPA 2HWB1 1PK6B 1Y9GA 4TYSA 3ACHA 2VOWA 4WBBA 3WNXA 4I3GA 4CEYC 1FMD3 2RM21 3RYRA 1LOCA 2WNVA 1H0BA 2IXKA 3FMGA 3WT3A 1CPNA 1MZEA 2WFF2 3H8UA 4N9IA 2XMLA 3H0OA 5F6LB 1JS9A 3LSDA 3DYPA 3D82A 1VRH1 1AYM2 3OUIA 5DG2A 1ULDA 3H9AA 5E89A 1AL21 4V2VA 4YM3A 3ACFA 3NJVA 3RMYA 4PLOA 1RTVA 3O1SA 5A6XA 1XOYA 1HB4A 3IDAA 4XDQA 4AHXA 5EJZB 3D6EA 4M01A 4Q26A 3D3AA 4YM0A 1UZVA 3UETA 2BYVE 3VKNA 2J42A 2HWD2 3ETQA 3M70A 4QKDA 1QXPA 1UY3A 2X8KA 3RWNA 3O1TA 1H8VA 4AEDB 3D0JA 5IVBA 1A8DA 3LWCA 3LZZA 5A1AA 1O3SA 4NPLA 1UPSA 5FZ7A 1JZ6A 1NCQC 2HWF3 3OEBA 4Q1PA 1JU4A 4ITCA 1W9YA 2D43A 1R1A3 1OA4A 3I3MA 3QLQA 5FZAA 2V4VA 1R1ZA 4WM7B 3WP5A 2VOXA 2LUWA 4W6XA 3WF0A 3ZSLA 2AREA 2BWCA 2JDUA 1W8NA 4CYDA 1OKOA 4FTSA 1WA4A 4U2AA 2OZ6A 2P3KA 5GZDA 1HJFA 2PHDA 1FNZA 3FL7A 4YRDA 4AW7A 1HXS1 1XRUA 3ETPA 4XACA 5FZOA 4R9AA 1HIXA 1ULEA 4PDWC 3R6SA 3USSA 4CDXC 1UX7A 3LDRA 2P37A 2W68A 3LD8A 3M4FA 4RL7A 1TZOA 3FUOA 4Y4RA 3RQ0A 2K46A 4M4RA 1OF4A 2IVIB 1OPMA 1OKQA 3DXUA 4LUKA 4LHKA 1V6LA 5FZ8A 3O0WA 1UN1A 3PVEA 4N90A 5KC5A 1UY1A 2AACA 5IUQA 4MO3M 3LPGA 1RUE1 1V6IA 4K21A 1ENSA 2QQVA 2WSVA 4XF0A 2UWBA 1G9AA 2PAEA 4QPGC 4JAAA 1RUJ2 2RJLA 4IV3A 4XFCA 1WLCA 4URTA 3CJIC 4Y5Z0 5GALA 5JSRA 3ZPYA 3FHIB 5HCFA 5JMOA 3H8RA 4PQ9A 2JIGA 4XFBA 4A3ZA 1ND2B 2VUCA 5FMDA 5FZBA 1MS9A 5JOYA 2XLFA 3AXDA 5GJ6A 2X10A 1VBC3 1TNRA 4CCLA 3UT0A 2JKXA 3VD3A 3ACGA 4Q4Y3 4QX0A 3ZDVA 4QKBA 4AI0A 5H9QA 2E53A 4BISA 1O4ZA 3FLTA 2Q4SA 5FKCA 2WWSA 3KV5A 3PJYA 4ZONA 4ZPIA 2Q8EA 4OHZA 3VDDC 4ORFA 2QQOA 4DZGA 3GHNA 3PLQA 2ZX2A 1NQDA 2OS2A 3VBSA 1BCXA 1KS5A 4IESA 5FJHA 3HQXA 4L99A 1YJKA 1RUC2 1N1SA 3DL3A 1XSQA 5A6ZA 4BMBA 3AP7A 4OI0A 1W6PA 4LBQD 4XEZA 5FZ3A 2RS31 1LHOA 3T3YA 3ZYJB 5FYYA 2R0FA 4O61A 1BQPA 3VLBB 5FOBB 2HWB2 1V6JA 1S1AA 4WM7C 4Q4V1 3WW3A 1VBE1 3H50A 5C8CB 2RM22 4QGLA 3B00A 2YC2A 1UOFA 3IDCB 4RQPB 4EWDA 3WF3A 1FOD1 5K8SA 2FDKA 5CZKA 2OX0A 2EIEA 2H0BA 5DN2A 4D3WA 5LW9A 2QDRA 3VHPA 1KQRA 4QQOA 4WZFA 1H6YA 4ISRA 4LBKA 3IDEA 1VRH2 1YQCA 1AL22 1CESA 2VVEA 2WDBA 2FQPA 4Y22B 4YGEA 4N43C 3WDXA 5FK7A 1R091 2AUYA 4IEUA 2OQ7A 1WLTA 5C5UA 3RZZA 2FZ2A 2QQUA 2JG9C 3I2DA 3POFA 1UKGA 1PMIA 3RG0A 4HXCA 3KMHA 4Q4X3 4NROA 1GANA 1BBT3 2NYYA 3GBWA 4XCBA 5G05L 4GWMA 2BNOA 2EA7A 4YG0A 2VTXA 1O8SA 2VU9A 1NCRB 1UF2C 2Y60A 1C57A 2VBBA 5CEHA 1LU2A 5A32B 2NP0A 2HWC1 3USUB 3BB6A 5F32A 4Q8KA 2JECA 3DGTA 4C1WA 4AXOA 4RYDA 4S2FA 1ZZ7A 4N53A 5JAXA 3L9JT 1QHDA 2DVFA 2DCYA 1WMEA 2O0OA 4YFZA 2VMFA 5L9BA 5SV5A 3SH4A 1ULPA 4YVWB 1PGL1 5FBZA 3R4DB 3O1MA 3V65A 1TMF3 4NN0A 2HWE1 3ZN6B 2QQMA 3WDVA 3O14A 4MX3A 3GZUC 1OOPB 1XQNA 1V6KA 2HWD3 4AI9A 1HXS2 3O1PA 3OPWA 2VBPA 4LBJA 4CDWA 2ZX0A 5BPXA 2UWAA 1W6NB 1COV3 2YMZA 3CU7A 4YYOA 3VBRB 4C1XA 3GF6A 4LLOA 5FPLA 1RB8G 3APBA 3WQBA 1OI6A 2IXLA 3CL1A 1HRV1 3ZSEA 4YW6A 1VIWB 1RUE2 5DPNA 4UW5A 4GB31 3PU8A 5LASA 4AGGA 3J9SA 4D7YA 3ATGA 3UNPA 2OUHA 4N9HA 1TVGA 2XUMA 3ILFA 4FP2A 5FZ6A 2YPDA 4CEYA 2Z42A 2WJSA 4L8QA 3RZGA 4P02B 4BOWA 5C3PA 2UY8A 3MBWA 3A23A 4CU7A 2JDNA 3AL5A 4GULA 1F8VA 1PVC3 1WCUA 1MPXA 1W8UA 3OYWB 5IJRA 5ANNA 1C8M1 2D6OX 4Y24A 3URFA 3VZMA 4K1YA 3K51A 1UY0A 2WQ8A 4MZUA 5D21A 4JDMA 1EYBA 3SISA 3H1WA 3WNKA 3KT4A 4Y1VA 5EPAA 4BK5A 4AEJA 1O59A 5FZDA 4IE7A 2QKDA 2WZEA 4UFMA 3FHQA 3C7OA 4DNYA 3TWIA 5H9RA 3OBAA 3FFZA 3AZYA 1G9FA 4QU2A 2QNKA 1WUVA 3CF6E 3VBUC 1B35C 1YRZA 3S6PA 4TSVA 4ASKA 2NMNA 4XXPA 4ZS2A 1V6NA 2OQ6A 5AVPA 1PGW1 2B7YA 1YFWA 1FV2A 2RS32 2CWSA 1NCQA 3RJ2X 3H1MA 2RJ2A 3WG3A 2QVSB 4LORA 3MDPA 4Q4V2 3CLPA 1VBE2 4GQ7A 4QPYA 4QXBA 4MGKE 4WVWA 4COUA 5M0TA 1PIV1 1HDKA 5FYIA 1EAH1 1FOD2 2CHHA 2NLRA 2ZAHA 5JDBA 3HBZA 2FBEA 3CIHA 3KZ4C 2Y33A 5H9PA 3SXWA 4UWDA 4EYUA 3V0BA 2ZCWA 5EJ1B 4QB2A 1FT9A 3KCCA 4QQPA 3J26N 1OC1A 5FXXA 5DMYA 4LOSA 1R092 5FZEA 1TNFA 2LROA 1Z7S1 3LEKA 4MHRA 5FY4A 5A3OA 2VM9A 4AFBA 5A3PA 4K8FA 3ZVXA 1J59A 1SDDB 2HWB3 3TNQA 2FDGA 3S30A 3KF5A 2QQWA 3JUUA 3HN1A 1YQ5A 2A6YA 5FP9A 4K20A 3EHKA 5GZFA 4QPGA 2ZBJA 2C4XA 2P6CA 3NO8A 5AC91 3SKVA 4XJUA 1C1LA 4IGPA 1PK6A 5KXEA 1MR5A 1NXD1 2HWC2 4AHWA 1JI6A 1L7RA 2ID4A 4JKKA 1GV9A 2XG3A 5FUIA 2D6PA 1ENRA 1DHKB 2EF6A 2LALA 1W6MB 5A7QA 2G19A 1LCLA 1PGL2 3KVBA 2HWE2 3B9IA 1Q43A 2GC2A 5F2SA 1VBD3 1UOJA 3NV3A 1VALA 4JQRA 5GLVA 4OHXA 5I91A 2ZGPA 2VOKA 4CXYA 2VZRA 5EHDA 3VDDA 4BCUA 3D8CA 1W03A 1BEV1 1JYWA 1LHUA 1D4VB 1FXZA 4HN1A 4QKNA 2B42B 1JN2P 2X5IB 4YZ4A 1QWRA 3Q9OA 1HRV2 4YNIA 3A4UA 3AYCA 4Z2AA 2O8OA 4B7EA 4ISQA 3J7NA 4AEDA 4GB32 1IG0A 5BNOB 3VB9A 1DYKA 4DO0A 3VKLA 2JWPA 2YGMA 3PTRB 1ZBA3 3KV6A 3ASIA 1XU1A 4Z82A 1PX3A 2WA3A 1W06A 1EUUA 3UYJA 4WM7A 1ZRCA 1HXS3 3VBFB 4DB5A 3VD4A 2BU9A 3AP4A 3T2QA 5FXWA 3FHAA 2K0GA 4CCOA 5G04L 4NRMA 2CYFA 3J7HA 1PO11 4AFCA 2Y6LA 1SBFA 1C8M2 4GIQA 5BV6A 3WX5A 5FR3A 3KT7A 2BTVC 3LIGA 3GBGA 1DQ4A 2BBVA 1HQWA 4AVTA 5JOXA 3SH5A 2MNGA 4LOTA 3DPRC 4N43A 4Q0QA 2IUWA 3AYDA 5CAZA 4P5HA 1I9RA 4ASMB 4B4PA 3N9OA 3ZM8A 3ELNA 1QMJA 2Y6KA 4P00B 3A22A 3LKJA 2JG8C 2R16A 3JB4C 1GP4A 3P5BA 3U11A 4LKSA 4CDQB 2QE3A 3LDKA 3KT1A 1ZZ8A 4G3YC 1CAWB 4IEYA 4KNCA 1LHWA 3WHUA 5DABA 5FY9A 4A3XA 1UIKA 1XE8A 2ET1A 1PGW2 4FPHA 1FATA 2JDAA 2VMCA 4LLFA 5FZFA 3WDYA 3J8F1 2AR6A 2EICA 3K4ZA 1ND2A 2Y6JA 4WM8C 5JUVA 2YU2A 2D5FA 3AFGA 1AXZA 1PIV2 2WA4A 4K9SA 1VB4A 4MV2A 4NWWA 1EAH2 5F37A 1ULOA 2ZHMA 1OT5A 3ZLIA 4AF9A 5FQ0B 2F6BA 3ABZA 1DZTA 3HPNA 2ZGOA 4X8NA 3NJZA 4NAOA 4AAPA 4LO6B 4CUAA 5TSWA 2PHTA 1SG3A 5FY5A 3RZLA 1C28A 1VBA1 4OUSA 3RPQA 3J7MA 1Z7S2 3EBRA 5EYYA 1GNYA 1X82A 3I3QA 3TEWA 1XNCA 3MLJA 4DEQA 1SBDA 1UYXA 4Q4V3 1UNBA 4WVZA 5I0RA 3N7MA 5I0TA 1FOD3 1UZ0A 2D3RA 4RR3B 3C7HA 3UKVA 1W8HA 4PIXA 5DUVA 5KR7A 1GR3A 4JQTA 1PZ9A 4H7LA 5C8CA 1K45A 3AKQA 5FZLA 2OXBA 1R093 4QPIC 1JU3A 4RQPA 3HD8B 1YC61 2XJSA 2WFPA 1F31A 4XE9A 2EAAA 2FDFA 1K42A 1RUD1 2G9ZA 3HVDA 2YXSA 4CEWB 5BYNA 4INDA 2GZWA 3N7LA 2Y34A 4Y22A 3EJKA 4IGQA 4LK7A 1HQNA 3IMNA 3BTXA 5C4WC 2JENA 3O0VA 1WMDA 2VQUA 4IEPA 2R061 2G4IA 3VBOC 1BEV2 1F15A 3IMMA 5HCHA 1KDKA 4A44A 5GZGA 2Z79A 5FPBA 1GWMA 1PNGA 5D2AA 5ACA1 2V5DA 1VAKA 2ZMLA 1GOHA 1NG0A 2ZEYA 4JGYB 1T2XA 2WAAA 1D0GA 4OLLA 1NA1C 1DQ6A 3I2GA 1CQ9A 3AC0A 3P6BA 1WD4A 1NCRA 2WZ8A 2HWE3 3NNJA 1UMZA 3ORJA 1SFYA 3BIWE 4LA3A 2F17A 3USUA 4CE8A 4XDOA 4DS0A 3I2IA 4V1PA 3J7LA 3POJA 4D6SA 4OMCA 4HVOA 1QOSA 4GKYA 5A32A 5DAVA 3M1HA 4I0WB 4JTNA 2VTXJ 1CZTA 1OMIA 3IAPA 4E2SA 1SLBA 2MHFA 1PO12 3NRUA 4MGYE 2CV6A 2UURA 3I2FA 1CZSA 4B7KA 1W6QB 3D4KA 3OGGA 4RGKA 2WWUA 4CP0A 1YO8A 1O5UA 1H2MA 4CDUB 5LA0A 1W6NA 1WW4A 3BTAA 1WWYA 2UY9A 5J1XA 2YC0A 2Y38A 2E7AA 3OPTA 4ZU5A 2I2SA 3A21A 5KC6A 1DP0A 3OOXA 1MQTB 3AL6A 2ARAA 4YG3A 2OVUA 5JZGB 1H8TB 1GZWB 4NHYA 3N9NA 5HCAA 1OHFA 2Y0OA 3SCFA 1IG3A 4W8JA 5FZ0A 5I8TA 1K5MB 1PM4A 2FDIA 4BQWA 2QTWB 2MEV1 3PMSA 3Q8BA 3PUSA 2OZJA 1KRIA 1ST8A 1XE7A 1YFUA 3J8F2 3PL0A 4MHUA 2D44A 5DDJ1 5L7OB 4TZDA 1J3PA 1QNYA 1QXRA 1EV13 3ZKUA 3UV9A 1RMU1 3KQ4B 2VMIA 4BM8A 4XJ8A 4TTGA 2ADDA 4Y4YA 4HBNA 3OYWA 1F35A 4EN6B 3ZSKA 3HNMA 3IKWA 3K4AA 4EQVA 2W39A 1A3KA 4GWIA 2BDRA 4QDSA 5HXMA 2IFWA 3KM5A 1DG6A 2P17A 2JDMA 1ZVFA 3HJRA 1KFXL 1VBA2 4UBHA 3SH3A 5FPUA 4Z92B 3VZNA 2A7AA 2CGNA 5EFUA 4IV3C 5A3MA 1IQDC 4FXKB 2W1QA 3S0MA 5LRRA 2BW8A 3ZN5A 5FZ4A 1SDWA 1G8WA 3P3PA 1ASJ1 3FLRA 4PT6A 3VD5A 4JGYC 2KXLA 2YUEA 3N35A 2GAUA 4NAMA 3THPA 1EAH3 4DY5A 1HV1A 1OD3A 2PHWA 4MADA 1S4CA 1K12A 4GA9A 2OUJA 2YZ4A 5A1LA 3I2KA 2V72A 2Q1ZB 3AMMA 2ZKLA 3LDBA 4AVVA 5CA6A 3AP9A 2GNBA 1ULGA 3GNEA 1Y9MA 3PUAA 4HPKB 4LE4A 1PO21 4OHWA 4B8EA 3M2MA 1V6OA 1RITA 1RGSA 1H4GA 1RUD2 2Z2SB 4LO7A 4O9GA 1GWKA 1MS8A 2OPWA 1PNFA 1JYVA 2C6SA 3VBSC 4ZKTB 3MV01 5IVVA 1JH5A 1Z0HA 3LOIA 4NJ4A 4Y5SA 4B1LA 1YUDA 2ZGTA 5J98B 4ZZ5A 4NIHA 3M3OA 1OFSA 2ZGKA 4KU7A 2W95A 4QQ2A 3HT1A 1W9SA 4MLOA 5L9RA 4CDUC 5C7GA 5HPOA 5AC93 5FZKA 3SKJE 2R062 4KWUA 3AJYA 4Y1ZA 1UD1A 1GQHA 1FPN1 3IZOA 4W6WA 1OFNA 4QMAA 4V2WA 5ACA2 2JDHA 4S2GA 1GFF2 2XHNA 1SLIA 1RVF1 1VR3A 2TEPA 4H7MA 3POEA 3U4SA 4N7UA 3CEWA 4CA9A 5IVFA 5JXGA 1PGSA 1OUXA 2F4PA 2CDOA 2ZX3A 1W3VA 2F4LA 4K40A 4K3UA 2ZGNA 2AGSA 1A78A 1E5RA 1X8MA 2VW2A 5BNPB 3B02A 3ZFEB 2R043 2XWBB 4CSWA 2Q8DA 5CFDC 4WM8A 2ARXA 4RGAA 4UBGA 5DUWA 4P9WA 5FPZA 4G9SB 3ZOIA 3E1F1 3EB7A 1AYN1 1BEV3 1G9DA 1H9WA 2A1XA 4QXCA 5FYBA 1MS4A 1WMFA 2YY1A 3G7DA 5FRAA 3W21A 2RVAA 2VCMA 1JOJA 5K0UB 4EV0A 1CGPA 3AZVA 3EYPA 5LWBA 1OXCA 2DFBA 4NIIA 2Q1MA 3LEMA 4JGZB 1BK0A 1WLWA 2NN8A 4QX8A 4JTOA 1HLCA 2JB4A 2X5IA 4XYXA 5JWPA 4I0AA 3MFAA 4ES9A 4D6RA 1HB3A 1T6GC 2ZHKA 1ALYA 5AFEA 5J37A 4N53C 5BNOA 3WG2A 4RFRB 1LODA 3FLPA 4PBOA 1QJEA 1W2OA 1PO13 1UYPA 2MEV2 3D5OA 4HKLA 1J3QA 2WO3A 4LO8A 4ZXEA 5J96B 5LRSA 5DDJ2 3RZHA 1RC6A 4GMP1 4YGBA 1S0GA 1MEC1 1AR73 2WO2A 3OGJA 1RMU2 3AVRA 3OEAA 3SEEA 5FIXA 4LKEA 2IXHA 5F3IA 3A7QA 3BKZA 4OVEA 2VQAA 4DXZA 5JIUA 2RMU3 3HR9A 5C3RA 3NKTA 3FC0A 2BVVA 1QQP1 1MZ5A 1XYPA 2JE7A 2D6KA 3AMQA 1P8JA 4Q0SA 5CNAA 1RUF1 2DTWA 1N3OA 2RS11 4JX0A 2VPVA 4FFGA 4H55A 1POV1 1J83A 3LF7A 4LBOA 5A7OA 1YQ8A 3DN7A 4CDQA 1GNZA 4NR1A 5FMCA 2B9VA 2VW1A 1ASJ2 3TEXA 1C5IA 2H6CA 2JEMA 1CAWA 4MGQA 4QX1A 1NA1A 1AX2A 1ENXA 2VULA 3HIFA 3IPVB 5EXOA 4MGTA 1QJY1 2ZKNA 1CR7A 1A34A 3RRDA 4FOYA 2XJRA 3FZ3A 5E6HA 5L19A 4AI2A 5C5TA 4Q4W3 5C33A 1RUH1 4FPFA 4BE3A 1V00A 1VMHA 2VH9A 1N3QA 1LGCA 1GBGA 3ZYBA 3A0KA 1GSLA 1PO22 1YQ2A 1T6BX 1VBA3 2R1DA 4XFFA 1UIJA 5FQ0A 4QU1A 2GC0A 1C1FA 3M7AA 4AAXA 1W0NA 3LGRA 4AHZA 3WQ7A 1DLLA 3WCRA 3WHTA 3LB9A 1DDLA 2W2IA 3SHRA 4FCAA 2BRTA 2W87A 2QQPA 4FSJA 4OYUA 4YM1A 1JOBA 2A6WA 2DWRA 3X29B 2HYXA 3TRSB 1YFYA 2DUPA 2DCJA 2BP6A 2WO1A 5FYTA 1QJU3 1FPN2 3WP4A 1V0AA 4NRPA 4HL0A 2R0HA 1SEFA 4QKFA 1NXMA 1RVF2 1F4AA 2WBKA 4OUEA 4BH9A 4YVSB 4FP3A 5BXXA 3MZHA 4XMAA 3FE5A 1WMXA 4AFDA 4QX2A 3OB8A 3NNFA 1S0DA 1GMMA 5C3OA 1QDOA 1U5IA 4UF0B 5LBEA 4KGQA 1JW6A 2W5FA 1JBCA 2CTVA 5F3CA 3ZMNA 2YB7A 3ZYFA 2PHLA 4AGRA 1AYN2 1AR91 1POQA 1UU4A 2VO5A 4JVAA 4CEWA 1YCIA 4E8CA 2XL9A 5T5OA 2D93A 2WYFA 2XQXA 3ZX7A 1ZRDA 4AWDA 5ACA3 1XNKA 2DU1A 4QHZA 4CCEA 4JDNA 5FUPA 3OBZA 4IEOA 1XB9A 1NY71 3PDQA 2B46X 4EWEA 1HQLA 4GMP0 4MXVA 1NE6A 3K75B 3HNBM 1PK6C 3O1UA 2VZ3A 4JGYA 3LFIA 5DQ0A 2Y6HA 4FBFA 2HEYF 1VAMA 1AHSA 2Z69A 3TNPB 1W3XA 2XBO3 3U75A 3AX4A 4X8PA 4C0BA 4AI8A 2XJVA 3FUQA 4XABA 4XIKA 2X09A 3NMBA 4OZOA 2Q8OA 3I59B 5F8PA 1BKZA 1MEC2 2R071 1GYKA 4A42A 4COWA 2RR11 3NNMA 4DQAA 2C9KA 1POV0 3THCA 1JYIA 3ZXFA 1W90A 4MXWB 4ET7A 2WZR3 4P9JA 1R081 2RDNA 1F5FA 2ZOEB 2XLGA 4E4DX 1WGPA 3IN9A 1F2NA 1UMHA 4I0BA 4RHV1 1AZDA 4XJWA 4AR2A 5L36A 4HONA 3AK0A 3JD71 3PJQA 4LQRA 5FV3A 3WF1A 2XB6C 1W6QA 1W9FA 4Q1RA 4TN7A 4AZZA 1QQP2 1MS3A 2BNNA 3T1MA 4CDUA 4QQHA 1A6CA 1RUF2 2RS12 3A0NA 3GYDA 4KBZA 1UXXX 2MEV3 1AX0A 4MH0E 1X7NA 2YPJA 4P9IA 5DDJ3 3RMXA 3OY8A 4OI4A 1ZZ6A 3AYAA 4EN8B 3VUOA 1MQTA 1GLHA 1H8TA 1RMU3 3H7YA 4PCRA 1RIRA 2BGPA 4LNVA 3U37A 5HI0A 3PURA 4FT8A 2VZPA 1IQAA 1QJY2 2YC4A 4GAZA 3O1RA 3AKTA 3NV2A 2B4KA 3V56A 1V6MA 4Y20A 4E2QA 5L7OA 3BIEA 1GQPA 1LHVA 2JDZA 3E5XA 3U14A 3GZAA 1RUH2 5CFDA 1IZ3A 1TE1B 1AJKA 3GALA 4QXKA 1ZREA 5JXIA 1BHGA 4XIOA 4KQ7A 4AFMA 3JXSA 3OTFA 1DCSA 1NYWA 1VMJA 1BMV1 1JHNA 1U5XA 2GNTA 4XW3A 3LIHA 2A75A 2DFCA 3VL8A 4QGNA 1CAUB 2CGOA 2EXIA 2CY6A 1TEIA 3K46A 3N9PA 1JYCA 2WFF3 4KGGA 5KBFA 3IB3A 4C0HA 1JZ5A 2FDJA 1ZBE1 2AEYA 4Z8BA 5H9SA 1JZ7A 4LE3A 2NPIA 2EAKA 1AYM3 2BOIA 2V09A 3Q8AA 1SPPB 5FZMA 4AI3A 1ND2C 4YSFA 1YYNA 2W0XA 5C3QA 3I49A 4CRQA 2CSGA 3HAGA 1V9U1 4TLFA 2H6BA 2QCSB 1I6XA 2W1UA 2HBTA 3NAPB 5CKQA 3GZTB 3I3DA 4B4QA 4E4SA 2GU9A 1QJX1 4GWNA 4QHBA 4HPKA 5F5CA 4HVQA 5FY8A 5ABJB 5JXJA 2W52A 3WY6A 3ZYHA 3MW2A 5A3TA 1MZ6A 3WDWA 4ZHNA 1AR92 2OT7A 3AMNA 1D7PM 5C9AB 1STMA 4QAWA 4B29A 1DGWX 2XL7A 3WW1A 2GMPA 1O3TA 1WCKA 3PHMA 1I5ZA 1RUG1 2C9AA 1NY72 5CFCB 1W6OB 2PQSA 2J7MA 4BQYA 4D7TA 2IXCA 2VG9A 1PZ7A 1W2NA 1OA2A 2YDEA 3LA7A 5CISA 1W0OA 1URXA 4FPYA 4UFJA 1H1MA 5C8CC 1RXFA 1QF3A 4RQPC 4BA6A 4HVRA 2Q8CA 2KA3A 4XHXA 1RUI1 1W2TA 2AEZA 3ZFEA 1G6NA 1CJDA 1DQ1A 3IM0A 3KS7A 1C3HA 2C5DA 3QCWA 2R072 3NL1A 4IL7A 3POSA 5DUXA 2RR12 5J09A 4XFAA 3JBG1 3F2ZA 4QHOA 3U10A 4BQ2A 2ORXA 3AZZA 2JD4A 1RJ8A 1RUJ3 1R082 2VCBA 3WNNA 4RHV2 2XKPA 4Q8LA 2G9GA 3AFKA 3JD72 3MO4A 4KBBA 4FPJA 4QX3A 5A7PA 4D7SA 1MVQA 2C1FA 3KCYA 3MYXA 2P3IA 1DU3D 4I30A 4JGZA 5A7NA 3JCIA 4XBQA 3I3BA 4R4XA 1UQXA 1WW7A 5A3WA 1NCRC 1XNTA 4GMP3 1J1LA 4L9BA 3HOBA 2YBKA 1GUIA 1MZFA 5FYUA 3G6JB 4AFAA 4Y33A 1Q56A 4YVWC 2VC9A 4IUGA 5E16A 3BVCA 4UW4A 5LBCA 3LA2A 1CN1A 1VP6A 1RUC3 2JX9A 3NKGA 1OOPC 2WYSA 3GJAA 1G7YA 4LR4A 2RS13 3WZ1A 3TN91 1NX9A 1BYHA 1K5JA 1OF3A 4A6SA 3VBRC 4NVPA 2P6HA 1BMV2 1ZZ9A 1KGYA 1DQ2A 3V0AB 5FWJA 3BODA 1S0FA 2ZZQA 3Q8FA 4BPZA 2ENRA 2RM23 3SCGA 3R0RA 2WLQA 4YGDA 4LXLA 4UFIA 4NO4A 4YGCA 4CU9A 3MW3A 4NHLA 3BPSA 3ZXLA 5C6CA 4NHMA 1ZBE2 5CYYA 3MI8A 5C70A 5JI9A 3MIBA 3CKHA 3DXTA 2MPFA 1VRH3 3GGLA 5FP4A 1OA3A 4AE2A 1O5LA 4C90A 1AL23 3VV1A 4CP9B 4BMEA 4COVA 4C8DA 5EZWA 4PLNA 3MF6A 3IPVA 4X6RB 2OYZA 5GKAC 1V9U2 4DUVA 1MVEA 1O3QA 4YZ2A 2QZ3A 1RUOA 1DIWA 2GNDA 2J1RA 3BU0A 2ZACA 3TOJA 1UYZA 1QKQA 1OURA 2XJQA 2VZOA 4QDQA 4LEJA 3QBQA 3WDTA 1QJX2 5JCTA 2WS91 4M3CB 4PHZA 5E88A 1UXZA 5CVRA 2QQJA 4NE9A 4BXSV 3M3EA 5FBJA 3R05A 3K48A 4MGIE 3K3OA 4OFGA 4B1MA 1RL3A 2ETEA 2PAMA 2VMGA 3H42B 3Q8CA 3E97A 4LK6A 1XYNA 3JB8A 3S7IA 4PF1A 1RUG2 3WD5A 4ZXKA 3UJQA 3WXPA 3SNMA 3KSCA 1F9KA 1YXWA 3NJYA 2YBPA 4HLTA 2AC1A 4FFHA 1AR61 4J25A 3I8TA 4OI1A 3QACA 1CX4A 2E31A 2GALA 1HW5A 2BNMA 2D6NA 4BJ0A 4K8RB 3MUY1 1U0AA 3KLSA 1TME1 4KG0A 4E8DA 1M06G 1RUI2 1RXGA 5F3EA 1J1TA 1W8TA 4XZPA 3RJRA 4F7ZA 4Q0PA 4JDOA 4D94A 3VGIA 4A45A 1XSRA 2J22A 4H14A 3ZKYA 3AYEA 2Y64A 1RUE3 3HQUA 4CP1A 5IVEA 2YG0A 3JBG2 3RZJA 3DF0A 3UGFA 3CMGA 2Q30A 4IEXA 4RS5B 5F2WA 5A3NA 3AMPA 1GOFA 3QH6A 2V73A 1D2QA 4TLGA 3EXUA 5FY7A 3W59A 3WV6A 5GZCA 4JRAA 3WDUA 2IXIA 2ZGQA 3KD4A 4IXLA 3FWEA 4PIYA 4UFKA 5EYXA 2VMHA 4LITA 4FXGB 3VBHB 2GMMA 4DUXA 1SLAA 3F95A 1A8MA 4CCJA 2EXJA 3I3EA 2X05A 5FYVA 5T50A 2VZUA 2L9LA 5EV7A 3ILRA 2ZS6B 2VVDA 4URAA 5KXCA 3BOPA 4HK9A 1IKPA 5FZIA 2RR13 3CBNA 5HCBA 1DF0A 1GOGA 2W92A 2ZA9A 4U36A 4YARA 2WO7A 3EQEA 3LA3A 4YFWA 2EXKA 5A6YA 2ZGMA 5K7PA 1YI7A 5KHKA 2DVBA 4YW5A 3VKMA 2PYTA 1YQ6A 4R9BA 4Y1UA 1VBB1 5ERLA 3AB0A 3ZSJA 3PUIA 1XJAA 2PHFA 2ERFA 4YPJA 3OGSA 1YWKA 2DVAA 2XJUA 3FX3A 4MXWA 2QQIA 4IV1B 4UXAA 2WL1A 4MUVA 5KHHA 1W2AX 3TN92 3MICA 4CZSA 2RS33 3GCWA 4I3PA 2ZPXA 2EIGA 2IZWA 3KVAA 2XR4A 2X5IC 5IVYA 1QIQA 4L97A 1ND3B 3AXEA 4CXXA 4HANA 1VBE3 2JB8A 3RNSA 1FMD1 4JZRA 2W3JA 5BNOC 5F6KA 2XDVA 1FYUA 2A5ZA 5C8WA 3POWA 4A7KA 5CG8A 2E7QA 3H3UA 3M3CA 4GALA 3VBFC 1W39A 1JHJA 1BVVA 2B8MA 2BWAA 2ZABA 5JOZA 3OD4A 4HKWA 4QB6A 2PTMA 3M3QA 4MGSA 3TEZA 4COYA 1LULA 5I0DA 1W8FA 1WCSA 4NRQA 2LW8A 4JV4A 3ZXDA 1F5JA 4JHZA 3T09A 1XBFA 2WS92 3VHRA 2VE1A 3MGUA 1QOOA 1ZBE3 5FLIA 4ARXA 2HWF1 4CDQC 2HWC3 1UCXA 4LA2A 4ES8A 1TQ5A 3KCXA 1R1A1 2PA7A 3B01A 5KWRA 4D0QA 1CAUA 1Y4WA 1H2LA 4A7YA 3DUIA 1V9U3 2P1BA 5FZOB 4BQ1A 1UZZA 2PMWB 3T2PA 4DUWA 2XLAA 1OQ1A 2YBSA 3VKFC 4WV8A 1BK1A 3AM2A 3AP5A 1W28A 2VXRA 4IW3A 3PVOA 3L2YA 2ORZA 5CKMA 1QJX3 4KWLA 1VLNA 1AR62 1XU2A 2UU8A 2JDYA 5HV4A 5FPXA 4YVWA 1HV0A 3K2OA 4XETA 1TME2 3NAPA 5FPAA 1S0IA 1CIWA 3OJBA 3ZN6A 2GP3A 4DPNA 3S57A 4BQ4A 1HN1A 1HRV3 1OOPA 1UU6A 5ABJA 3N7JA 1YLLA 1ODMA 1BJQA 1RUG3 1L3JA 4P9LA 1FI2A 1U5ZA 2W9XA 1D2SA 4GB33 1LGNA 2ZGSA 5LY2A 4AQSA 5BY5A 3LSEA 3VBRA 5B2GB 3AKSA 2TBVA 1XE0A 3QOPA 5IK5A 2D97A 5LCWL 1JUIA 3N9QA 2BGCA 5JSOA 4QGMA 1DQ0A 2DUOA 1UX6A 4S2DA 5I93A 1X50A 5BNNB 3GM8A 3RZKA 3THDA 1W6OA 4RR3C 2XH6A 3T4HB 4XC9A 4M0NA 3HMYA 4QWNA 1RUI3 1C8M3 4YW2A 3LQCA 1F4HA 2BV4A 1QH7A 3RYKA 2EIDA 1J58A 3T08A 1IPKA 3FN9A 4WVVA 5FAXA 5IK7A 2A3WA 2HJIA 1WKYA 4XJ9A 3UGHA 3WNPA 3IWZA 3S5AA 4CXWA 2LRPA 4CEWC 1OQDA 1OUSA 4RD7A 4META 1VBB2 2VNRA 4CTEA 2XJPA 3MV11 5D1IA 2WR9A 1REDA 2VZ1A 3BCWA 1ZRFA 4XF1A 1Q8SA 2PFWA 4NOTA 1TG7A 1RYYA 4UFLA 4BIFA 1SLCA 4BIOA 5HBAA 4K6BA 4ZU7A 5DXDA 3QD6A 3RI8A 3ES1A 2VAUA 2D3SA 2FD8A 1N47A 4FFIA 3NNLA 1FMD2 1AL0G 3SITA 4AVCA 1PIV3 4X6QB 4CUCA 4XUPA 5A3LA 2WN3A 1OLMA 3KV9A 1O4YA 2YROA 4AG4A 1UAIA 1QJFA 2WIIB 4E4HA 3M8LA 4AHYA 1AF9A 2AENA 3RSJA 3I4IA 4FPGA 2WLPA 1US2A 5JPMB 1O7FA 4NPRA 3NVCA 1YIPA 3INAA 3MPPG 2YFZA 4I09A 3WEZA 3ZFFB 5LY1A 1M4WA 4XF4A 3MIGA 4JC1A 1Z7S3 4Z1VA 1JODA 4FFFA 4E4ZA 4XVHA 1S2EA 4UW3A 5JR2A 2A6VA 2V5YA 1CPMA 2DBIA 4LBLA 3WVJA 1SACA 4Q4X1 4SBVA 1DBNA 2CAUA 3CHXA 4BXFA 2XONA 1VAVA 3HEIA 4XDPA 4P5YA 1BBT1 4NWVA 1R64A 4LTAA 2ATFA 4OCTA 4OULA 3S5QA 1KD7A 2PAKA 3O7OA 4BU2A 4R9DA 2E7TA 3MIFA 4DIQA 2Q0AA 3FFQA 3KGZA 5BNQA 4IERA 3R4SA 5FP3A 2HWF2 1NKGA 1EPWA 3H8OA 1MQTC 1X36A 5F9TA 5FZHA 1R1A2 5JZGC 1H8TC 3THTA 5A80A 3I54A 1FAYA 3N3HA 2XOMA 3SQOA 4CDWB 1K5MC 2ZEZA 5T5PA 1TMF1 2BQPA 4K7JA 2BPA2 1K3IA 4XF9A 5K9YA 2GDFA 5L7OC 4CP2A 3VDBA 2FHRA 3BI3A 2NZ9A 4CP9A 4M3CF 1LTEA 3WW4A 2GP5A 5F5IA 5FREA 1W6MA 4P9XA 1AUYA 1Q8OA 1COV1 2E33A 3TYJA 5LA9A 4PI2A 5FMBA 1X9TA 2VJXA 4LO4B 4LO5B 2HEWF 3GDBA 2BEOA 4M3CA 4L2NA 5GZEA 1IGOA 5SV8A 1UKRA 4XILA 2W1SA 4YG6A 2VBDA 2E51A 2A70A 4R52A 4XQDA 5A7WB 4D6QA 4A2UA 3N4MA 3IT8A 4LJHA 1REFA 5T5JA 1G9BA 4EE2A 1S0CA 2Z4FA 4AVAA 1NE4A 1ZRRA 3PMEA 1E57A 5D8AB 1CD3G 5DZEA 4YWAA 4OHYA 3ITQA 3U4XA 5T54A 1LOGA 1QH6A 4ZZ8A 1TME3 1CONA 2CNAA 2NMOA 5FFOC 1US3A 4OUMA 4EZ4A 2GH2A 1PVC1 2OA2A 5JMCA 4UAPA 1UPIA 4BLIA 3VN4A 2HBUA 3C7GA 4KI5M 3H1YA 5IFTA 2XJTA 3VBFA 5LK7B 5FYHA 2HEVF 3ZSMA 3ACIA 1XYOA 3ZFFC 2FCVA 1S2KA 2VW0A 4HETA 1W8WA 1LOAA 4N8MA 4BQXA 2SBAA 1VRBA 1NCQB 4SLIA 4CUGA 4YZ3A 5IFPA 2XQRA 2YYOA 3C7FA 1GICA 2VQTA 5C3SA 4XUQA 1H2KA 2A3XA 2QJVA 3VZKA 2IC1A 2C24A 2VL4A 2ZMNA 3BOWA 1GKBA 2O14A 1Q8VA 4DINB 2PHRA 4LKFA 3R4UA 3J8F3 2I45A 2X29A 1RHI1 4GKXA 2RS51 4RGGA 3WG4A 4FAGA 4LBQB 1GWLA 3ZFGB 4EN7B 1Q3EA 4N7IA 3HT2A 5GLWA 4AL9A 2PLV1 4PDWB 5JXHA 1VPHA 4UOJA 2Y8KA 4CDXB 5LA1A 3GHMA 3C8XA 3HBKA 3E6DA 2ZHNA 5LBFA 5BNPC 4F83A 3LPFA 3ZFEC 4Z2WA 2QFEA 4NIDA 3MF9A 1QY4A 4F3JA 4QB1A 4BQ5A 1O3RA 1AX1A 2RDQA 4QPGB 1LJ7A 3DKQA 3FBYA 2OIIA 2ES3A 5C71A 1XNBA 5FXVA 3AZXA 3CJIB 4GJYA 4IE6A 3O1VA 1V70A 3FJSA 4IETA 4Q29A 3RYPA 5K0UC 4COZA 4Q4X2 2DF7A 4IV1A 4UYBA 1BBT2 5IVCA 1AVBA 2C26A 2RHPA 4JGZC 2WQ4A 4YLZA 2R49A 2VNVA 4B4RA 1IPJA 4Y3OA 4XXAA 1ZA7A 5IHRA 1ND3A 5IVJA 3BU7A 5D8AC 3JQWA 5FZGA 2DBNA 3AP6A 5F7UA 3ZYIB 2XVKA 4RR3A 5A1FA 2WAOA 1ULFA 3CZJA 3VDDB 2WZPP 2XWJB 1RUD3 2JKBA 2ZEXA 2N7GA 3TEYA 5DZFA 1J3RA 1TMF2 4LULA 4RFT0 1QDCA 3KHBA 5FO7B 1KITA 5I0UA 5T3NA 3O1OA 1VBD1 3O5SA 5J48A 3OGRA 3I2JA 2VECA 1WCDJ 5AVAA 5JVVA 2R063 2G1MA 4XMIA 5CB7A 4AVBA 5I8YA 1COV2 3P1IA 5J7MA 1LR5A 3I2HA 5GLZA 5FKBA 1DGRN 1W2UA 3DECA 5T52A 4J1WA 3NQHA 3U07A 1KEXA 4FAHA 5I8SA 1W99A 3AZWA 2VTFA 5FZ9A 1LHNA 1LKNA 3POBA 3WW2A 2VOTA 4HSLA 2HLEA 1ZBA1 4PQQA 4R4ZA 1UZWA 2Y26A 4B3NA 3VDCA 1I5PA 3ZFGC 5ANQA 2QZ2A 2BVBA 2VVFA 5LBBA 3PU3A 1IS5A 4EZHA 5LEJA 2DURA 1OBNA 2WSUA 4N43B 3K4DA 4ZY9A 4BHPA 2YHJA 1JYXA 1PVC2 1AR81 2QQNA 4CU6A 2SLIA 5FOJB 2NM1A 3IBMA 1WW5A 4AVSA 1HB2A 3LOBA 2JG9B 1VE0A 2W94A 3WNMA 3WG1A 1OLRA 4FPLA 1OLQA 3P3NA 1SCSA 1LESA 3KGLA 1REEA 1VMFA 1H30A 2VOVA 4L0PA 3T4VA 4CCKA 1Y43B 2PQQA 4KH9A 5F3GA 1SFPA 2D40A 2OPKA 3T30A 3B3QE 5FCCA 4AQ2A 2WNEA 1BVP1 1GU3A 1HKDA 1O8PA 3K77A 4Q0UA 4HKOA 2VMEA 2JIJA 3RFRA 4I2OA 3DKWA 1SZBA 2NQYA 4IE4A 4O7XA 3RZMA 1Q8QA 2DDUA 4OZXA 4DRVA 1LB2A 5LA2A 1JUHA 2RE9A 2B5HA 2B9UA 4JRLA 3PUQA 5J3UA 3T1LA 1RHI2 1LOEA 2RS52 1BXHA 1WA6X 4LIVA 1QNWA 3ZYPA 1GZWA 5BNNA 5JZGA 1LU1A 1PHMA 4ASLA 2PLV2 4YVSC 1K5MA 2BUKA 4XTPA 1AJOA 1Q8PA 4K1ZA 4Y1YA 4CCMA 1ZRIA 1ZZBA 4NHXA 3UKNA 1JOPA 4OHVA 3UKTA 1E5IA 3FBMA 3NW4A 2E26A 4AI1A 5LEKA 3ZDSA 1LNSA 3BALA 4EROA 1AXKA 1UYYA 2GNMA 4GH4B 3WUCA 2FDHA 5JOWA 2E6VA 5T55A 3LE0A 4CCCA 1VJ2A 2E9QA 4XFIA 4GWJA 4HFSA 5GM0A 5IW0A 2RV9A 3WP3A 3GJBA 2WN2A 1ZA4A 1PX4A 4JHTA 3BUCA 3DYMA 3ZXEA 1JZ2A 1ASJ3 4Q2FA 1GZCA 1D4M1 4HOOA 3RVHA 3W20A 4JKLA 5F39A 3RS6A 1KJLA 3OF1A 1SLTA 5FMOL 1QU0A 5CBLA 1ZM1A 1PZ8A 4UI9L 1SFNA 4EN0A 1CJPA 4QM8A 3VL9A 4FOVA 4XPVA 5J36A 1I1EA 1OVSA 4P08A 2BFUL 1PO23 1APNA 3VKOA 2PHXA 2HYKA 4ARYA 3SLIA 3J4UH 4HZFA 4PLMA 5HV0A 1JZ8A 2ZMKA 5CU1A 4P9GA 2XHKA 4WVMB 1S0EA 2XUEA 2H0VA 2BBAA 1BLZA 1VBD2 4A41A 3U78A 2FMYA 1B35B 3VBUB 4OQ8A 2FMDA 1CX1A 3ZFFA 1WBLA 4BYYA 1CZVA 1VB2A 5FJKA 4CPBD 2VUJA 2CGPA 4E2GA 5FY0A 4MVTA 1FPN3 1NQJA 2YGLA 2WT1A 2RG4A 1UOGA 1S55A 3CO2A 2KM2A
chains in the Genus database with same CATH topology
1ZRIA 1F35A 1JODA 1JYTA 1JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRI A;  1F35 A;  1JOD A;  1JYT A;  1JOB A; 
#chains in the Genus database with same CATH topology
 3MFC A;  3WF4 A;  4Y26 A;  3B93 A;  4LPL A;  2VCA A;  1RVF 3;  1QOT A;  5A3U A;  4FPK A;  1CAX B;  1H4H A;  4W50 A;  4AEK A;  4D8M A;  4A7Z A;  1DYP A;  1NAE A;  2JDK A;  3JU9 A;  4XBL A;  1MS0 A;  1ZBA 2;  1C5H A;  2CU5 A;  1OSG A;  4G4F A;  3ZN4 A;  1PVX A;  2VZS A;  3B9C A;  3M3I A;  4IE5 A;  3QH7 A;  3LAG A;  1JTZ X;  3ZMO A;  3ZPO A;  4RA0 A;  1AYN 3;  5BUV A;  5IYY A;  5DG1 A;  2J1E A;  1AR8 2;  2E32 A;  5EQU A;  4ZU4 A;  5BNP A;  2VQ0 A;  3BYW A;  3MPB A;  4NIG A;  4YM2 A;  1GZ9 A;  2RDS A;  1H2N A;  4UT5 A;  1HN0 A;  3WF2 A;  3OGV A;  5DAQ A;  4NMI A;  4XQW A;  4D69 A;  4GH4 C;  2WQZ C;  4LUM A;  4CCN A;  4DMI A;  2Y0I A;  1KDM A;  2XVL A;  5LAT A;  3CDZ B;  3V64 A;  2GC1 A;  2Y6F A;  1HRI 1;  3AVS A;  2CWM A;  5FTT C;  5LB6 A;  4BWO A;  4FQ4 A;  4L11 A;  3HN3 A;  4E9K A;  2W08 A;  1Y3T A;  5K0U A;  1YEW A;  2HH9 A;  2QQL A;  5FMO S;  1SQ4 A;  1ZNP A;  5FYC A;  4NPM A;  4ATE A;  1JZ4 A;  3POG A;  1ENQ A;  3IAQ A;  5A7W A;  3E5U A;  5FXZ A;  2RDR A;  5IK4 A;  1W0P A;  3ZIW A;  1UL9 A;  1DGW A;  1DYO A;  1W9T A;  1YI9 A;  2BFU S;  3DCQ A;  2DVD A;  2ARC A;  2WUH A;  3ZXG A;  1Y9Q A;  1MEC 3;  2P34 A;  1XPW A;  4IEV A;  5D8A A;  4YW3 A;  2ZHL A;  3BGA A;  1EV1 1;  1IHM A;  4HMZ A;  2J1A A;  2DYC A;  2K9Z A;  3RWK X;  3NAP C;  1Y7B A;  5L73 A;  4BLJ A;  5GLU A;  5A33 B;  4LMF A;  5I0S A;  5EP9 A;  3ROU A;  1QQP 3;  2WNU B;  2IVJ A;  5FYS A;  5ABJ C;  2WWJ A;  1GP5 A;  1RUF 3;  1OLM E;  3ALQ A;  3LEG A;  1POV 3;  1W04 A;  2K2S A;  4ONU A;  5DZG A;  3PVN A;  3U1X A;  3W58 A;  3ILN A;  5C9A C;  1U5Y A;  1RUN A;  2CL2 A;  4MOA A;  1IPS A;  1RHI 3;  4FQZ A;  2RS5 3;  1SMV A;  5FO9 B;  4W65 A;  2B39 A;  1IS3 A;  4XZU G;  5T5L A;  1JYT A;  3OUJ A;  4MYE A;  1KS4 A;  1LEM A;  1D4M 2;  2PLV 3;  1MAC A;  1CWP A;  1ODN A;  3CJX A;  3PIJ A;  3AMH A;  4W4Z A;  5CFC C;  1QJY 3;  1NZI A;  2D6L X;  4GJZ A;  5CAD A;  5FO8 B;  1NUK A;  4QT6 A;  1YNA A;  2O1Q A;  1RJ7 A;  1RUH 3;  1ZX5 A;  3MIH A;  4LBQ A;  5FYZ A;  3ZFG A;  5JLV A;  2P4E A;  2JJ6 A;  2DU0 A;  1NZC A;  2X53 S;  3Q8E A;  4Q27 A;  2GH8 A;  2EIB A;  3OPZ A;  3KWV A;  4IE0 A;  3OUH A;  3DPR B;  4PDW A;  3VZO A;  4CDX A;  3MHZ A;  2G9F A;  4UW6 A;  4XF3 A;  2ZTN A;  4AGV A;  1NLQ A;  3S7E A;  1DZR A;  3ZYR A;  3O12 A;  5KXB A;  4CUB A;  5FP7 A;  2JG8 B;  1ZYB A;  1S2B A;  1LEN A;  3DYO A;  3L2H A;  4XJA A;  1SCR A;  2XGX A;  2ZGU A;  2BZD A;  4HN0 A;  4AYU A;  3SEP A;  1JMU B;  4FO9 A;  4MGZ E;  3SCH A;  3CJI A;  5IAV A;  4GXL A;  2QDN A;  4OQ9 A;  1UY2 A;  4LT5 A;  2GSY A;  2ARB A;  1Z78 A;  3OSD A;  2O8Q A;  3B7M A;  2FCU A;  4WM8 B;  1W05 A;  3I7D A;  4BB3 A;  3B69 A;  1CAV B;  3K3N A;  3RDI A;  4UFH A;  3VD9 A;  4I02 A;  4FI9 A;  2R7E B;  3HWJ A;  4DOU A;  2R04 1;  4M3C E;  3ME2 A;  1RIN A;  3UK9 A;  1UU5 A;  2ZEW A;  1UOB A;  4W6Y A;  4CPB A;  3CZU A;  4KWJ A;  1XXN A;  4YVS A;  2VZV A;  4XTM A;  1UWW A;  1AR9 3;  1LRH A;  3KF3 A;  5FWE A;  2JE8 A;  3ZR5 A;  5JPN B;  2KR2 A;  2WC2 A;  4H3W A;  3W9A A;  4UF0 A;  5DAW A;  2GN7 A;  5E8A A;  2WNU C;  5CG9 A;  2VZQ A;  5FZ1 A;  4KL1 A;  2YV8 A;  2ZGL A;  1FX5 A;  4ATF A;  1PM7 A;  1HRI 2;  4R8H A;  3UJO A;  2R1B A;  1G9C A;  1JXN A;  4Q5O A;  3RGB A;  4CCD A;  1LED A;  3ON7 A;  2Q5T A;  2P3Y A;  3T2O A;  3WUD A;  5KXD A;  4CVU A;  4HT1 T;  5FYM A;  1Q5O A;  5A7S A;  5F5Q A;  4QPI B;  4M0H A;  4H2A A;  4EJR A;  1AR8 3;  1N1Y A;  5F1R A;  3ZYG A;  3ZXK A;  4BK4 A;  5EJ3 A;  2R07 3;  1AR7 1;  1EV1 2;  3BTZ A;  2PEL A;  2D5H A;  2DTY A;  2VXJ A;  4GZ9 A;  1R08 3;  1IOA A;  5GLT A;  3UES A;  1NLR A;  3VBO B;  3NWK A;  5C4W B;  4RHV 3;  3HQR A;  3GBF A;  2HKX A;  2I74 A;  2JG9 A;  3JD7 3;  1QJZ A;  2RMU 1;  3I59 A;  3TBD A;  2FCT A;  3KHC A;  2AH2 A;  2P3J A;  2AZ5 A;  5EIY B;  3WR0 A;  4AOC A;  1EP0 A;  1NA1 B;  1DLC A;  3E5Q A;  2WNV B;  1CVN A;  3H3L A;  4IEQ A;  5FLH A;  5A70 A;  3OG2 A;  3NST A;  2WAB A;  1U12 A;  1BZW A;  4Y5T A;  2DUQ A;  1SBE A;  2BER A;  5ISL A;  1MS1 A;  4QXH A;  4R9C A;  2WKK A;  4PJY A;  3H7J A;  1SLL A;  4QX5 A;  4LBM A;  4IEW A;  5B4X A;  3GCX A;  4M00 A;  2DVG A;  1JZ3 A;  2IWG B;  1S0B A;  4AQT A;  2KD7 A;  2PXJ A;  3ES4 A;  4DEV A;  2D7F A;  2P2K A;  4JKM A;  4KWK A;  1YHF A;  5EWS A;  5KHI A;  2GN3 A;  3ZXJ A;  2EVX A;  4NIA A;  1LEC A;  2DCT A;  4Q4W 1;  5FY1 A;  1OD5 A;  2Q1F A;  3C2U A;  4DXT A;  1QGL A;  2E63 A;  4FOQ A;  4YW4 A;  1E5S A;  1N1T A;  5FZC A;  5FDB A;  2ET7 A;  4RN5 A;  4XBN A;  2CDP A;  3OCP A;  5DAX A;  3CQO A;  1GQG A;  4XFH A;  1D4M 3;  4GH4 A;  4NHK A;  3AJZ A;  2A6Z A;  1UO9 A;  1XC6 A;  3BPZ A;  1G86 A;  3WSO A;  1H9P A;  5JIA A;  4QD2 A;  4XJZ A;  5AC9 2;  2VD7 A;  4RS5 C;  2VZT A;  4E27 A;  3AKP A;  1UW8 A;  1QJU 1;  3NV1 A;  2QBX A;  2ZZJ A;  3ZR6 A;  1FV3 A;  3JZV A;  3VDA A;  5LZ6 A;  3E6B A;  2TNF A;  2ZX4 A;  3VBH C;  1KXG A;  4LIU A;  2RJK A;  1YFX A;  2PHU A;  1GNH A;  2TUN A;  2ZGR A;  3T0A A;  3H3Z A;  3D0S A;  1LOF C;  1S0J A;  1DGL A;  3N7K A;  2WRA A;  3PIG A;  2J1U A;  1EY2 A;  2R04 2;  5L9V A;  1SPP A;  5FP8 A;  3T2T A;  2W1W A;  2CAV A;  4MG2 A;  1O91 A;  1IS6 A;  2LM3 A;  3I2O A;  4DFS A;  1N3P A;  1EPZ A;  4O9E A;  4DRR A;  2D6M A;  3C7E A;  4WVM A;  1ONA A;  1YIF A;  2V4A A;  4IV3 B;  2AYH A;  5IAX A;  3MW4 A;  3PUH A;  2I07 B;  1B35 A;  4TWT A;  4KMQ A;  3VBU A;  1IKQ A;  4LKD A;  2WIN B;  2WNV C;  4IV1 C;  1H1I A;  5JR7 B;  3BTY A;  4P9Y A;  4QPW A;  2UYA A;  4XUO A;  1W9W A;  5C9A A;  1W8Z A;  1ZZC A;  2VNO A;  4IQP A;  4XHB A;  1SHW B;  2LTN A;  2ZXQ A;  1J84 A;  3ZIX A;  1OVP A;  1ND3 C;  4C91 A;  2YFU A;  3POI A;  4FPO B;  2J1S A;  4I01 A;  3B5L B;  1CAX A;  3KB5 A;  5CFC A;  4XFG A;  2JD9 A;  2XBO 1;  4GD4 A;  3TAY A;  1DZQ A;  1UZY A;  5IWF A;  2GC3 A;  1D0H A;  1VBC 1;  2A71 A;  1X33 A;  1L7Q A;  4XUR A;  3VBS B;  4OI2 A;  1WW6 A;  4Q4Y 1;  4EWA A;  1OQE A;  1AR7 2;  1NT0 A;  4Y1X A;  3JBG 3;  1OH4 A;  1W6P B;  4JCK A;  4LHL A;  1MS5 A;  1HRI 3;  2IFR A;  1NOV A;  2WZR 1;  1UY4 A;  4YZ1 A;  4IDZ A;  3MIE A;  1X9P A;  2WT0 A;  2ILM A;  2EXH A;  3OY8 B;  2RMU 2;  1QEX A;  3GXU A;  4J1X A;  5FK8 A;  2OKX A;  3VHN A;  3III A;  2LS6 A;  4QQL A;  3IDB B;  2W46 A;  5FPV A;  5AFB A;  4BZ4 A;  3MUZ 1;  3WLU A;  2P5B A;  3T0D A;  4Y20 B;  4HG6 B;  2VMD A;  4ZS3 A;  3ECQ A;  5CFD B;  2C0Z A;  2DCZ A;  1WLD A;  4LHN A;  4WZC A;  4CU8 A;  4QX7 A;  2R6Q A;  5DAP A;  3SMH A;  4IEZ A;  1DGR A;  3MLL A;  4AK3 A;  2ZAA A;  1I3H A;  4XAE A;  1B09 A;  4RSU A;  5CIR A;  3T0B A;  4Q4W 2;  4FTE A;  4FVV A;  2W91 A;  3TN9 3;  3LCP A;  5E1R A;  3O0X A;  4A6O A;  5IK8 A;  1OPO A;  2JIC A;  5A6Q A;  1JYN A;  4AED C;  5A33 A;  4NUB A;  3WQ0 A;  4O65 A;  3WIN E;  3WQ1 A;  2WNU A;  3BN6 A;  5K4L A;  1LGB A;  4DXR A;  4N53 B;  1WZX A;  2OW4 A;  2WFF 1;  3I97 A;  3ZXA C;  3RI9 A;  3EO6 A;  1PMJ X;  2WT2 A;  3V0A A;  2JE9 A;  3N9L A;  1E5H A;  4XUT A;  3VD7 A;  1QJU 2;  2IXJ A;  4BDV B;  3DEM A;  4S2H A;  4XOG A;  3SC7 X;  1AYM 1;  4FPE A;  3H8X A;  1HX6 A;  5BNN C;  1KJR A;  5DUU A;  5HXV A;  2DCK A;  2XPJ A;  3LFM A;  1XNA A;  3N9M A;  4DXS A;  4QM9 A;  4HK8 A;  5FLJ A;  3GZE A;  5FUN A;  3NNG A;  1KFU L;  3PTY A;  3WCS A;  4KU8 A;  5APA A;  2R32 A;  2YU1 A;  5B4N A;  2WS9 3;  5F5A A;  2A73 B;  5LK5 A;  4YW1 A;  2HWD 1;  3DPR A;  4EN9 B;  3WNO A;  3N36 A;  3EMR A;  3HNY M;  2Z5W A;  4M4P A;  2R30 A;  1WD3 A;  3POY A;  1DFQ A;  1LAJ A;  3UGG A;  1W8O A;  2JG8 A;  1WCQ A;  1EUT A;  1L7L A;  2A6X A;  3OD0 A;  1H6X A;  3C3V A;  4J6G A;  5JI7 A;  2ZJC A;  4XAA A;  1AXY A;  1NLS A;  4CEY B;  5IT6 A;  2BOJ A;  2D3P A;  4PF5 A;  1OH3 A;  3JQX A;  3E6C C;  1IS4 A;  3U0Z A;  1O6U A;  2XVG A;  4TXW A;  1PMH X;  2VUA A;  1AR6 3;  4OMD A;  3B94 A;  4AQ6 A;  3PNA A;  4FOW A;  3VHO A;  3NJX A;  3VZL A;  4FTB A;  1WBF A;  3MID A;  1CAV A;  3KQR A;  2WNO A;  4LHS A;  3TB0 A;  4KG8 A;  4XCA A;  4P14 A;  2VCC A;  2W47 A;  1DQ5 A;  2XBO 2;  2VNG A;  4Z07 A;  3WP6 A;  5JSP A;  4PIZ A;  3ENR A;  4PI0 A;  3W5N A;  1VBC 2;  2BGO A;  2EAL A;  3ZO0 B;  2XXZ A;  4Q4Y 2;  2PN5 A;  1HJG A;  2D98 A;  2QQK A;  2UWC A;  3DV8 A;  4HSJ A;  5KHJ A;  1ULC A;  2JDP A;  1XND A;  5KHG A;  2WZR 2;  4YW7 A;  1RUJ 1;  2GME A;  1GP6 A;  2UYB A;  2VGD A;  2ZX1 A;  3AKR A;  3OBT A;  3VZJ A;  4A4A A;  4XQ4 A;  1ACC A;  1O4T A;  2J1T A;  3W5M A;  4BQ3 A;  2Y6G A;  2VY0 A;  4MSV A;  2DV9 A;  3PVB B;  4F8A A;  3WOG A;  4XUN A;  3UL2 A;  2ADE A;  3ACL A;  2VR4 A;  3ST7 A;  5IAT A;  4RS5 A;  1CIY A;  1C8N A;  2XKO A;  1HB1 A;  3V0B B;  2J1V A;  2BJS A;  1H1A A;  3WNL A;  2JXA A;  4QPI A;  3VBH A;  4CDW C;  4LBN A;  1UMI A;  4IGO A;  3NV4 A;  1GZT A;  4QDR A;  1LOF A;  5CKN A;  4Q0V A;  1VBB 3;  1RUC 1;  2FZ1 A;  1QXJ A;  1YJL A;  3KV4 A;  4DY3 A;  1FNY A;  3CNA A;  5C4W A;  2A3Y A;  1LOB A;  1C4R A;  3VBO A;  2VUD A;  3LEI A;  1N1V A;  2QUO A;  4FPC A;  1X8E A;  4AEM A;  3OBR A;  3IIA A;  4L92 A;  2B45 X;  3MEP A;  3MLK A;  4YZ5 A;  4PBP A;  2HWB 1;  1PK6 B;  1Y9G A;  4TYS A;  3ACH A;  2VOW A;  4WBB A;  3WNX A;  4I3G A;  4CEY C;  1FMD 3;  2RM2 1;  3RYR A;  1LOC A;  2WNV A;  1H0B A;  2IXK A;  3FMG A;  3WT3 A;  1CPN A;  1MZE A;  2WFF 2;  3H8U A;  4N9I A;  2XML A;  3H0O A;  5F6L B;  1JS9 A;  3LSD A;  3DYP A;  3D82 A;  1VRH 1;  1AYM 2;  3OUI A;  5DG2 A;  1ULD A;  3H9A A;  5E89 A;  1AL2 1;  4V2V A;  4YM3 A;  3ACF A;  3NJV A;  3RMY A;  4PLO A;  1RTV A;  3O1S A;  5A6X A;  1XOY A;  1HB4 A;  3IDA A;  4XDQ A;  4AHX A;  5EJZ B;  3D6E A;  4M01 A;  4Q26 A;  3D3A A;  4YM0 A;  1UZV A;  3UET A;  2BYV E;  3VKN A;  2J42 A;  2HWD 2;  3ETQ A;  3M70 A;  4QKD A;  1QXP A;  1UY3 A;  2X8K A;  3RWN A;  3O1T A;  1H8V A;  4AED B;  3D0J A;  5IVB A;  1A8D A;  3LWC A;  3LZZ A;  5A1A A;  1O3S A;  4NPL A;  1UPS A;  5FZ7 A;  1JZ6 A;  1NCQ C;  2HWF 3;  3OEB A;  4Q1P A;  1JU4 A;  4ITC A;  1W9Y A;  2D43 A;  1R1A 3;  1OA4 A;  3I3M A;  3QLQ A;  5FZA A;  2V4V A;  1R1Z A;  4WM7 B;  3WP5 A;  2VOX A;  2LUW A;  4W6X A;  3WF0 A;  3ZSL A;  2ARE A;  2BWC A;  2JDU A;  1W8N A;  4CYD A;  1OKO A;  4FTS A;  1WA4 A;  4U2A A;  2OZ6 A;  2P3K A;  5GZD A;  1HJF A;  2PHD A;  1FNZ A;  3FL7 A;  4YRD A;  4AW7 A;  1HXS 1;  1XRU A;  3ETP A;  4XAC A;  5FZO A;  4R9A A;  1HIX A;  1ULE A;  4PDW C;  3R6S A;  3USS A;  4CDX C;  1UX7 A;  3LDR A;  2P37 A;  2W68 A;  3LD8 A;  3M4F A;  4RL7 A;  1TZO A;  3FUO A;  4Y4R A;  3RQ0 A;  2K46 A;  4M4R A;  1OF4 A;  2IVI B;  1OPM A;  1OKQ A;  3DXU A;  4LUK A;  4LHK A;  1V6L A;  5FZ8 A;  3O0W A;  1UN1 A;  3PVE A;  4N90 A;  5KC5 A;  1UY1 A;  2AAC A;  5IUQ A;  4MO3 M;  3LPG A;  1RUE 1;  1V6I A;  4K21 A;  1ENS A;  2QQV A;  2WSV A;  4XF0 A;  2UWB A;  1G9A A;  2PAE A;  4QPG C;  4JAA A;  1RUJ 2;  2RJL A;  4IV3 A;  4XFC A;  1WLC A;  4URT A;  3CJI C;  4Y5Z 0;  5GAL A;  5JSR A;  3ZPY A;  3FHI B;  5HCF A;  5JMO A;  3H8R A;  4PQ9 A;  2JIG A;  4XFB A;  4A3Z A;  1ND2 B;  2VUC A;  5FMD A;  5FZB A;  1MS9 A;  5JOY A;  2XLF A;  3AXD A;  5GJ6 A;  2X10 A;  1VBC 3;  1TNR A;  4CCL A;  3UT0 A;  2JKX A;  3VD3 A;  3ACG A;  4Q4Y 3;  4QX0 A;  3ZDV A;  4QKB A;  4AI0 A;  5H9Q A;  2E53 A;  4BIS A;  1O4Z A;  3FLT A;  2Q4S A;  5FKC A;  2WWS A;  3KV5 A;  3PJY A;  4ZON A;  4ZPI A;  2Q8E A;  4OHZ A;  3VDD C;  4ORF A;  2QQO A;  4DZG A;  3GHN A;  3PLQ A;  2ZX2 A;  1NQD A;  2OS2 A;  3VBS A;  1BCX A;  1KS5 A;  4IES A;  5FJH A;  3HQX A;  4L99 A;  1YJK A;  1RUC 2;  1N1S A;  3DL3 A;  1XSQ A;  5A6Z A;  4BMB A;  3AP7 A;  4OI0 A;  1W6P A;  4LBQ D;  4XEZ A;  5FZ3 A;  2RS3 1;  1LHO A;  3T3Y A;  3ZYJ B;  5FYY A;  2R0F A;  4O61 A;  1BQP A;  3VLB B;  5FOB B;  2HWB 2;  1V6J A;  1S1A A;  4WM7 C;  4Q4V 1;  3WW3 A;  1VBE 1;  3H50 A;  5C8C B;  2RM2 2;  4QGL A;  3B00 A;  2YC2 A;  1UOF A;  3IDC B;  4RQP B;  4EWD A;  3WF3 A;  1FOD 1;  5K8S A;  2FDK A;  5CZK A;  2OX0 A;  2EIE A;  2H0B A;  5DN2 A;  4D3W A;  5LW9 A;  2QDR A;  3VHP A;  1KQR A;  4QQO A;  4WZF A;  1H6Y A;  4ISR A;  4LBK A;  3IDE A;  1VRH 2;  1YQC A;  1AL2 2;  1CES A;  2VVE A;  2WDB A;  2FQP A;  4Y22 B;  4YGE A;  4N43 C;  3WDX A;  5FK7 A;  1R09 1;  2AUY A;  4IEU A;  2OQ7 A;  1WLT A;  5C5U A;  3RZZ A;  2FZ2 A;  2QQU A;  2JG9 C;  3I2D A;  3POF A;  1UKG A;  1PMI A;  3RG0 A;  4HXC A;  3KMH A;  4Q4X 3;  4NRO A;  1GAN A;  1BBT 3;  2NYY A;  3GBW A;  4XCB A;  5G05 L;  4GWM A;  2BNO A;  2EA7 A;  4YG0 A;  2VTX A;  1O8S A;  2VU9 A;  1NCR B;  1UF2 C;  2Y60 A;  1C57 A;  2VBB A;  5CEH A;  1LU2 A;  5A32 B;  2NP0 A;  2HWC 1;  3USU B;  3BB6 A;  5F32 A;  4Q8K A;  2JEC A;  3DGT A;  4C1W A;  4AXO A;  4RYD A;  4S2F A;  1ZZ7 A;  4N53 A;  5JAX A;  3L9J T;  1QHD A;  2DVF A;  2DCY A;  1WME A;  2O0O A;  4YFZ A;  2VMF A;  5L9B A;  5SV5 A;  3SH4 A;  1ULP A;  4YVW B;  1PGL 1;  5FBZ A;  3R4D B;  3O1M A;  3V65 A;  1TMF 3;  4NN0 A;  2HWE 1;  3ZN6 B;  2QQM A;  3WDV A;  3O14 A;  4MX3 A;  3GZU C;  1OOP B;  1XQN A;  1V6K A;  2HWD 3;  4AI9 A;  1HXS 2;  3O1P A;  3OPW A;  2VBP A;  4LBJ A;  4CDW A;  2ZX0 A;  5BPX A;  2UWA A;  1W6N B;  1COV 3;  2YMZ A;  3CU7 A;  4YYO A;  3VBR B;  4C1X A;  3GF6 A;  4LLO A;  5FPL A;  1RB8 G;  3APB A;  3WQB A;  1OI6 A;  2IXL A;  3CL1 A;  1HRV 1;  3ZSE A;  4YW6 A;  1VIW B;  1RUE 2;  5DPN A;  4UW5 A;  4GB3 1;  3PU8 A;  5LAS A;  4AGG A;  3J9S A;  4D7Y A;  3ATG A;  3UNP A;  2OUH A;  4N9H A;  1TVG A;  2XUM A;  3ILF A;  4FP2 A;  5FZ6 A;  2YPD A;  4CEY A;  2Z42 A;  2WJS A;  4L8Q A;  3RZG A;  4P02 B;  4BOW A;  5C3P A;  2UY8 A;  3MBW A;  3A23 A;  4CU7 A;  2JDN A;  3AL5 A;  4GUL A;  1F8V A;  1PVC 3;  1WCU A;  1MPX A;  1W8U A;  3OYW B;  5IJR A;  5ANN A;  1C8M 1;  2D6O X;  4Y24 A;  3URF A;  3VZM A;  4K1Y A;  3K51 A;  1UY0 A;  2WQ8 A;  4MZU A;  5D21 A;  4JDM A;  1EYB A;  3SIS A;  3H1W A;  3WNK A;  3KT4 A;  4Y1V A;  5EPA A;  4BK5 A;  4AEJ A;  1O59 A;  5FZD A;  4IE7 A;  2QKD A;  2WZE A;  4UFM A;  3FHQ A;  3C7O A;  4DNY A;  3TWI A;  5H9R A;  3OBA A;  3FFZ A;  3AZY A;  1G9F A;  4QU2 A;  2QNK A;  1WUV A;  3CF6 E;  3VBU C;  1B35 C;  1YRZ A;  3S6P A;  4TSV A;  4ASK A;  2NMN A;  4XXP A;  4ZS2 A;  1V6N A;  2OQ6 A;  5AVP A;  1PGW 1;  2B7Y A;  1YFW A;  1FV2 A;  2RS3 2;  2CWS A;  1NCQ A;  3RJ2 X;  3H1M A;  2RJ2 A;  3WG3 A;  2QVS B;  4LOR A;  3MDP A;  4Q4V 2;  3CLP A;  1VBE 2;  4GQ7 A;  4QPY A;  4QXB A;  4MGK E;  4WVW A;  4COU A;  5M0T A;  1PIV 1;  1HDK A;  5FYI A;  1EAH 1;  1FOD 2;  2CHH A;  2NLR A;  2ZAH A;  5JDB A;  3HBZ A;  2FBE A;  3CIH A;  3KZ4 C;  2Y33 A;  5H9P A;  3SXW A;  4UWD A;  4EYU A;  3V0B A;  2ZCW A;  5EJ1 B;  4QB2 A;  1FT9 A;  3KCC A;  4QQP A;  3J26 N;  1OC1 A;  5FXX A;  5DMY A;  4LOS A;  1R09 2;  5FZE A;  1TNF A;  2LRO A;  1Z7S 1;  3LEK A;  4MHR A;  5FY4 A;  5A3O A;  2VM9 A;  4AFB A;  5A3P A;  4K8F A;  3ZVX A;  1J59 A;  1SDD B;  2HWB 3;  3TNQ A;  2FDG A;  3S30 A;  3KF5 A;  2QQW A;  3JUU A;  3HN1 A;  1YQ5 A;  2A6Y A;  5FP9 A;  4K20 A;  3EHK A;  5GZF A;  4QPG A;  2ZBJ A;  2C4X A;  2P6C A;  3NO8 A;  5AC9 1;  3SKV A;  4XJU A;  1C1L A;  4IGP A;  1PK6 A;  5KXE A;  1MR5 A;  1NXD 1;  2HWC 2;  4AHW A;  1JI6 A;  1L7R A;  2ID4 A;  4JKK A;  1GV9 A;  2XG3 A;  5FUI A;  2D6P A;  1ENR A;  1DHK B;  2EF6 A;  2LAL A;  1W6M B;  5A7Q A;  2G19 A;  1LCL A;  1PGL 2;  3KVB A;  2HWE 2;  3B9I A;  1Q43 A;  2GC2 A;  5F2S A;  1VBD 3;  1UOJ A;  3NV3 A;  1VAL A;  4JQR A;  5GLV A;  4OHX A;  5I91 A;  2ZGP A;  2VOK A;  4CXY A;  2VZR A;  5EHD A;  3VDD A;  4BCU A;  3D8C A;  1W03 A;  1BEV 1;  1JYW A;  1LHU A;  1D4V B;  1FXZ A;  4HN1 A;  4QKN A;  2B42 B;  1JN2 P;  2X5I B;  4YZ4 A;  1QWR A;  3Q9O A;  1HRV 2;  4YNI A;  3A4U A;  3AYC A;  4Z2A A;  2O8O A;  4B7E A;  4ISQ A;  3J7N A;  4AED A;  4GB3 2;  1IG0 A;  5BNO B;  3VB9 A;  1DYK A;  4DO0 A;  3VKL A;  2JWP A;  2YGM A;  3PTR B;  1ZBA 3;  3KV6 A;  3ASI A;  1XU1 A;  4Z82 A;  1PX3 A;  2WA3 A;  1W06 A;  1EUU A;  3UYJ A;  4WM7 A;  1ZRC A;  1HXS 3;  3VBF B;  4DB5 A;  3VD4 A;  2BU9 A;  3AP4 A;  3T2Q A;  5FXW A;  3FHA A;  2K0G A;  4CCO A;  5G04 L;  4NRM A;  2CYF A;  3J7H A;  1PO1 1;  4AFC A;  2Y6L A;  1SBF A;  1C8M 2;  4GIQ A;  5BV6 A;  3WX5 A;  5FR3 A;  3KT7 A;  2BTV C;  3LIG A;  3GBG A;  1DQ4 A;  2BBV A;  1HQW A;  4AVT A;  5JOX A;  3SH5 A;  2MNG A;  4LOT A;  3DPR C;  4N43 A;  4Q0Q A;  2IUW A;  3AYD A;  5CAZ A;  4P5H A;  1I9R A;  4ASM B;  4B4P A;  3N9O A;  3ZM8 A;  3ELN A;  1QMJ A;  2Y6K A;  4P00 B;  3A22 A;  3LKJ A;  2JG8 C;  2R16 A;  3JB4 C;  1GP4 A;  3P5B A;  3U11 A;  4LKS A;  4CDQ B;  2QE3 A;  3LDK A;  3KT1 A;  1ZZ8 A;  4G3Y C;  1CAW B;  4IEY A;  4KNC A;  1LHW A;  3WHU A;  5DAB A;  5FY9 A;  4A3X A;  1UIK A;  1XE8 A;  2ET1 A;  1PGW 2;  4FPH A;  1FAT A;  2JDA A;  2VMC A;  4LLF A;  5FZF A;  3WDY A;  3J8F 1;  2AR6 A;  2EIC A;  3K4Z A;  1ND2 A;  2Y6J A;  4WM8 C;  5JUV A;  2YU2 A;  2D5F A;  3AFG A;  1AXZ A;  1PIV 2;  2WA4 A;  4K9S A;  1VB4 A;  4MV2 A;  4NWW A;  1EAH 2;  5F37 A;  1ULO A;  2ZHM A;  1OT5 A;  3ZLI A;  4AF9 A;  5FQ0 B;  2F6B A;  3ABZ A;  1DZT A;  3HPN A;  2ZGO A;  4X8N A;  3NJZ A;  4NAO A;  4AAP A;  4LO6 B;  4CUA A;  5TSW A;  2PHT A;  1SG3 A;  5FY5 A;  3RZL A;  1C28 A;  1VBA 1;  4OUS A;  3RPQ A;  3J7M A;  1Z7S 2;  3EBR A;  5EYY A;  1GNY A;  1X82 A;  3I3Q A;  3TEW A;  1XNC A;  3MLJ A;  4DEQ A;  1SBD A;  1UYX A;  4Q4V 3;  1UNB A;  4WVZ A;  5I0R A;  3N7M A;  5I0T A;  1FOD 3;  1UZ0 A;  2D3R A;  4RR3 B;  3C7H A;  3UKV A;  1W8H A;  4PIX A;  5DUV A;  5KR7 A;  1GR3 A;  4JQT A;  1PZ9 A;  4H7L A;  5C8C A;  1K45 A;  3AKQ A;  5FZL A;  2OXB A;  1R09 3;  4QPI C;  1JU3 A;  4RQP A;  3HD8 B;  1YC6 1;  2XJS A;  2WFP A;  1F31 A;  4XE9 A;  2EAA A;  2FDF A;  1K42 A;  1RUD 1;  2G9Z A;  3HVD A;  2YXS A;  4CEW B;  5BYN A;  4IND A;  2GZW A;  3N7L A;  2Y34 A;  4Y22 A;  3EJK A;  4IGQ A;  4LK7 A;  1HQN A;  3IMN A;  3BTX A;  5C4W C;  2JEN A;  3O0V A;  1WMD A;  2VQU A;  4IEP A;  2R06 1;  2G4I A;  3VBO C;  1BEV 2;  1F15 A;  3IMM A;  5HCH A;  1KDK A;  4A44 A;  5GZG A;  2Z79 A;  5FPB A;  1GWM A;  1PNG A;  5D2A A;  5ACA 1;  2V5D A;  1VAK A;  2ZML A;  1GOH A;  1NG0 A;  2ZEY A;  4JGY B;  1T2X A;  2WAA A;  1D0G A;  4OLL A;  1NA1 C;  1DQ6 A;  3I2G A;  1CQ9 A;  3AC0 A;  3P6B A;  1WD4 A;  1NCR A;  2WZ8 A;  2HWE 3;  3NNJ A;  1UMZ A;  3ORJ A;  1SFY A;  3BIW E;  4LA3 A;  2F17 A;  3USU A;  4CE8 A;  4XDO A;  4DS0 A;  3I2I A;  4V1P A;  3J7L A;  3POJ A;  4D6S A;  4OMC A;  4HVO A;  1QOS A;  4GKY A;  5A32 A;  5DAV A;  3M1H A;  4I0W B;  4JTN A;  2VTX J;  1CZT A;  1OMI A;  3IAP A;  4E2S A;  1SLB A;  2MHF A;  1PO1 2;  3NRU A;  4MGY E;  2CV6 A;  2UUR A;  3I2F A;  1CZS A;  4B7K A;  1W6Q B;  3D4K A;  3OGG A;  4RGK A;  2WWU A;  4CP0 A;  1YO8 A;  1O5U A;  1H2M A;  4CDU B;  5LA0 A;  1W6N A;  1WW4 A;  3BTA A;  1WWY A;  2UY9 A;  5J1X A;  2YC0 A;  2Y38 A;  2E7A A;  3OPT A;  4ZU5 A;  2I2S A;  3A21 A;  5KC6 A;  1DP0 A;  3OOX A;  1MQT B;  3AL6 A;  2ARA A;  4YG3 A;  2OVU A;  5JZG B;  1H8T B;  1GZW B;  4NHY A;  3N9N A;  5HCA A;  1OHF A;  2Y0O A;  3SCF A;  1IG3 A;  4W8J A;  5FZ0 A;  5I8T A;  1K5M B;  1PM4 A;  2FDI A;  4BQW A;  2QTW B;  2MEV 1;  3PMS A;  3Q8B A;  3PUS A;  2OZJ A;  1KRI A;  1ST8 A;  1XE7 A;  1YFU A;  3J8F 2;  3PL0 A;  4MHU A;  2D44 A;  5DDJ 1;  5L7O B;  4TZD A;  1J3P A;  1QNY A;  1QXR A;  1EV1 3;  3ZKU A;  3UV9 A;  1RMU 1;  3KQ4 B;  2VMI A;  4BM8 A;  4XJ8 A;  4TTG A;  2ADD A;  4Y4Y A;  4HBN A;  3OYW A;  1F35 A;  4EN6 B;  3ZSK A;  3HNM A;  3IKW A;  3K4A A;  4EQV A;  2W39 A;  1A3K A;  4GWI A;  2BDR A;  4QDS A;  5HXM A;  2IFW A;  3KM5 A;  1DG6 A;  2P17 A;  2JDM A;  1ZVF A;  3HJR A;  1KFX L;  1VBA 2;  4UBH A;  3SH3 A;  5FPU A;  4Z92 B;  3VZN A;  2A7A A;  2CGN A;  5EFU A;  4IV3 C;  5A3M A;  1IQD C;  4FXK B;  2W1Q A;  3S0M A;  5LRR A;  2BW8 A;  3ZN5 A;  5FZ4 A;  1SDW A;  1G8W A;  3P3P A;  1ASJ 1;  3FLR A;  4PT6 A;  3VD5 A;  4JGY C;  2KXL A;  2YUE A;  3N35 A;  2GAU A;  4NAM A;  3THP A;  1EAH 3;  4DY5 A;  1HV1 A;  1OD3 A;  2PHW A;  4MAD A;  1S4C A;  1K12 A;  4GA9 A;  2OUJ A;  2YZ4 A;  5A1L A;  3I2K A;  2V72 A;  2Q1Z B;  3AMM A;  2ZKL A;  3LDB A;  4AVV A;  5CA6 A;  3AP9 A;  2GNB A;  1ULG A;  3GNE A;  1Y9M A;  3PUA A;  4HPK B;  4LE4 A;  1PO2 1;  4OHW A;  4B8E A;  3M2M A;  1V6O A;  1RIT A;  1RGS A;  1H4G A;  1RUD 2;  2Z2S B;  4LO7 A;  4O9G A;  1GWK A;  1MS8 A;  2OPW A;  1PNF A;  1JYV A;  2C6S A;  3VBS C;  4ZKT B;  3MV0 1;  5IVV A;  1JH5 A;  1Z0H A;  3LOI A;  4NJ4 A;  4Y5S A;  4B1L A;  1YUD A;  2ZGT A;  5J98 B;  4ZZ5 A;  4NIH A;  3M3O A;  1OFS A;  2ZGK A;  4KU7 A;  2W95 A;  4QQ2 A;  3HT1 A;  1W9S A;  4MLO A;  5L9R A;  4CDU C;  5C7G A;  5HPO A;  5AC9 3;  5FZK A;  3SKJ E;  2R06 2;  4KWU A;  3AJY A;  4Y1Z A;  1UD1 A;  1GQH A;  1FPN 1;  3IZO A;  4W6W A;  1OFN A;  4QMA A;  4V2W A;  5ACA 2;  2JDH A;  4S2G A;  1GFF 2;  2XHN A;  1SLI A;  1RVF 1;  1VR3 A;  2TEP A;  4H7M A;  3POE A;  3U4S A;  4N7U A;  3CEW A;  4CA9 A;  5IVF A;  5JXG A;  1PGS A;  1OUX A;  2F4P A;  2CDO A;  2ZX3 A;  1W3V A;  2F4L A;  4K40 A;  4K3U A;  2ZGN A;  2AGS A;  1A78 A;  1E5R A;  1X8M A;  2VW2 A;  5BNP B;  3B02 A;  3ZFE B;  2R04 3;  2XWB B;  4CSW A;  2Q8D A;  5CFD C;  4WM8 A;  2ARX A;  4RGA A;  4UBG A;  5DUW A;  4P9W A;  5FPZ A;  4G9S B;  3ZOI A;  3E1F 1;  3EB7 A;  1AYN 1;  1BEV 3;  1G9D A;  1H9W A;  2A1X A;  4QXC A;  5FYB A;  1MS4 A;  1WMF A;  2YY1 A;  3G7D A;  5FRA A;  3W21 A;  2RVA A;  2VCM A;  1JOJ A;  5K0U B;  4EV0 A;  1CGP A;  3AZV A;  3EYP A;  5LWB A;  1OXC A;  2DFB A;  4NII A;  2Q1M A;  3LEM A;  4JGZ B;  1BK0 A;  1WLW A;  2NN8 A;  4QX8 A;  4JTO A;  1HLC A;  2JB4 A;  2X5I A;  4XYX A;  5JWP A;  4I0A A;  3MFA A;  4ES9 A;  4D6R A;  1HB3 A;  1T6G C;  2ZHK A;  1ALY A;  5AFE A;  5J37 A;  4N53 C;  5BNO A;  3WG2 A;  4RFR B;  1LOD A;  3FLP A;  4PBO A;  1QJE A;  1W2O A;  1PO1 3;  1UYP A;  2MEV 2;  3D5O A;  4HKL A;  1J3Q A;  2WO3 A;  4LO8 A;  4ZXE A;  5J96 B;  5LRS A;  5DDJ 2;  3RZH A;  1RC6 A;  4GMP 1;  4YGB A;  1S0G A;  1MEC 1;  1AR7 3;  2WO2 A;  3OGJ A;  1RMU 2;  3AVR A;  3OEA A;  3SEE A;  5FIX A;  4LKE A;  2IXH A;  5F3I A;  3A7Q A;  3BKZ A;  4OVE A;  2VQA A;  4DXZ A;  5JIU A;  2RMU 3;  3HR9 A;  5C3R A;  3NKT A;  3FC0 A;  2BVV A;  1QQP 1;  1MZ5 A;  1XYP A;  2JE7 A;  2D6K A;  3AMQ A;  1P8J A;  4Q0S A;  5CNA A;  1RUF 1;  2DTW A;  1N3O A;  2RS1 1;  4JX0 A;  2VPV A;  4FFG A;  4H55 A;  1POV 1;  1J83 A;  3LF7 A;  4LBO A;  5A7O A;  1YQ8 A;  3DN7 A;  4CDQ A;  1GNZ A;  4NR1 A;  5FMC A;  2B9V A;  2VW1 A;  1ASJ 2;  3TEX A;  1C5I A;  2H6C A;  2JEM A;  1CAW A;  4MGQ A;  4QX1 A;  1NA1 A;  1AX2 A;  1ENX A;  2VUL A;  3HIF A;  3IPV B;  5EXO A;  4MGT A;  1QJY 1;  2ZKN A;  1CR7 A;  1A34 A;  3RRD A;  4FOY A;  2XJR A;  3FZ3 A;  5E6H A;  5L19 A;  4AI2 A;  5C5T A;  4Q4W 3;  5C33 A;  1RUH 1;  4FPF A;  4BE3 A;  1V00 A;  1VMH A;  2VH9 A;  1N3Q A;  1LGC A;  1GBG A;  3ZYB A;  3A0K A;  1GSL A;  1PO2 2;  1YQ2 A;  1T6B X;  1VBA 3;  2R1D A;  4XFF A;  1UIJ A;  5FQ0 A;  4QU1 A;  2GC0 A;  1C1F A;  3M7A A;  4AAX A;  1W0N A;  3LGR A;  4AHZ A;  3WQ7 A;  1DLL A;  3WCR A;  3WHT A;  3LB9 A;  1DDL A;  2W2I A;  3SHR A;  4FCA A;  2BRT A;  2W87 A;  2QQP A;  4FSJ A;  4OYU A;  4YM1 A;  1JOB A;  2A6W A;  2DWR A;  3X29 B;  2HYX A;  3TRS B;  1YFY A;  2DUP A;  2DCJ A;  2BP6 A;  2WO1 A;  5FYT A;  1QJU 3;  1FPN 2;  3WP4 A;  1V0A A;  4NRP A;  4HL0 A;  2R0H A;  1SEF A;  4QKF A;  1NXM A;  1RVF 2;  1F4A A;  2WBK A;  4OUE A;  4BH9 A;  4YVS B;  4FP3 A;  5BXX A;  3MZH A;  4XMA A;  3FE5 A;  1WMX A;  4AFD A;  4QX2 A;  3OB8 A;  3NNF A;  1S0D A;  1GMM A;  5C3O A;  1QDO A;  1U5I A;  4UF0 B;  5LBE A;  4KGQ A;  1JW6 A;  2W5F A;  1JBC A;  2CTV A;  5F3C A;  3ZMN A;  2YB7 A;  3ZYF A;  2PHL A;  4AGR A;  1AYN 2;  1AR9 1;  1POQ A;  1UU4 A;  2VO5 A;  4JVA A;  4CEW A;  1YCI A;  4E8C A;  2XL9 A;  5T5O A;  2D93 A;  2WYF A;  2XQX A;  3ZX7 A;  1ZRD A;  4AWD A;  5ACA 3;  1XNK A;  2DU1 A;  4QHZ A;  4CCE A;  4JDN A;  5FUP A;  3OBZ A;  4IEO A;  1XB9 A;  1NY7 1;  3PDQ A;  2B46 X;  4EWE A;  1HQL A;  4GMP 0;  4MXV A;  1NE6 A;  3K75 B;  3HNB M;  1PK6 C;  3O1U A;  2VZ3 A;  4JGY A;  3LFI A;  5DQ0 A;  2Y6H A;  4FBF A;  2HEY F;  1VAM A;  1AHS A;  2Z69 A;  3TNP B;  1W3X A;  2XBO 3;  3U75 A;  3AX4 A;  4X8P A;  4C0B A;  4AI8 A;  2XJV A;  3FUQ A;  4XAB A;  4XIK A;  2X09 A;  3NMB A;  4OZO A;  2Q8O A;  3I59 B;  5F8P A;  1BKZ A;  1MEC 2;  2R07 1;  1GYK A;  4A42 A;  4COW A;  2RR1 1;  3NNM A;  4DQA A;  2C9K A;  1POV 0;  3THC A;  1JYI A;  3ZXF A;  1W90 A;  4MXW B;  4ET7 A;  2WZR 3;  4P9J A;  1R08 1;  2RDN A;  1F5F A;  2ZOE B;  2XLG A;  4E4D X;  1WGP A;  3IN9 A;  1F2N A;  1UMH A;  4I0B A;  4RHV 1;  1AZD A;  4XJW A;  4AR2 A;  5L36 A;  4HON A;  3AK0 A;  3JD7 1;  3PJQ A;  4LQR A;  5FV3 A;  3WF1 A;  2XB6 C;  1W6Q A;  1W9F A;  4Q1R A;  4TN7 A;  4AZZ A;  1QQP 2;  1MS3 A;  2BNN A;  3T1M A;  4CDU A;  4QQH A;  1A6C A;  1RUF 2;  2RS1 2;  3A0N A;  3GYD A;  4KBZ A;  1UXX X;  2MEV 3;  1AX0 A;  4MH0 E;  1X7N A;  2YPJ A;  4P9I A;  5DDJ 3;  3RMX A;  3OY8 A;  4OI4 A;  1ZZ6 A;  3AYA A;  4EN8 B;  3VUO A;  1MQT A;  1GLH A;  1H8T A;  1RMU 3;  3H7Y A;  4PCR A;  1RIR A;  2BGP A;  4LNV A;  3U37 A;  5HI0 A;  3PUR A;  4FT8 A;  2VZP A;  1IQA A;  1QJY 2;  2YC4 A;  4GAZ A;  3O1R A;  3AKT A;  3NV2 A;  2B4K A;  3V56 A;  1V6M A;  4Y20 A;  4E2Q A;  5L7O A;  3BIE A;  1GQP A;  1LHV A;  2JDZ A;  3E5X A;  3U14 A;  3GZA A;  1RUH 2;  5CFD A;  1IZ3 A;  1TE1 B;  1AJK A;  3GAL A;  4QXK A;  1ZRE A;  5JXI A;  1BHG A;  4XIO A;  4KQ7 A;  4AFM A;  3JXS A;  3OTF A;  1DCS A;  1NYW A;  1VMJ A;  1BMV 1;  1JHN A;  1U5X A;  2GNT A;  4XW3 A;  3LIH A;  2A75 A;  2DFC A;  3VL8 A;  4QGN A;  1CAU B;  2CGO A;  2EXI A;  2CY6 A;  1TEI A;  3K46 A;  3N9P A;  1JYC A;  2WFF 3;  4KGG A;  5KBF A;  3IB3 A;  4C0H A;  1JZ5 A;  2FDJ A;  1ZBE 1;  2AEY A;  4Z8B A;  5H9S A;  1JZ7 A;  4LE3 A;  2NPI A;  2EAK A;  1AYM 3;  2BOI A;  2V09 A;  3Q8A A;  1SPP B;  5FZM A;  4AI3 A;  1ND2 C;  4YSF A;  1YYN A;  2W0X A;  5C3Q A;  3I49 A;  4CRQ A;  2CSG A;  3HAG A;  1V9U 1;  4TLF A;  2H6B A;  2QCS B;  1I6X A;  2W1U A;  2HBT A;  3NAP B;  5CKQ A;  3GZT B;  3I3D A;  4B4Q A;  4E4S A;  2GU9 A;  1QJX 1;  4GWN A;  4QHB A;  4HPK A;  5F5C A;  4HVQ A;  5FY8 A;  5ABJ B;  5JXJ A;  2W52 A;  3WY6 A;  3ZYH A;  3MW2 A;  5A3T A;  1MZ6 A;  3WDW A;  4ZHN A;  1AR9 2;  2OT7 A;  3AMN A;  1D7P M;  5C9A B;  1STM A;  4QAW A;  4B29 A;  1DGW X;  2XL7 A;  3WW1 A;  2GMP A;  1O3T A;  1WCK A;  3PHM A;  1I5Z A;  1RUG 1;  2C9A A;  1NY7 2;  5CFC B;  1W6O B;  2PQS A;  2J7M A;  4BQY A;  4D7T A;  2IXC A;  2VG9 A;  1PZ7 A;  1W2N A;  1OA2 A;  2YDE A;  3LA7 A;  5CIS A;  1W0O A;  1URX A;  4FPY A;  4UFJ A;  1H1M A;  5C8C C;  1RXF A;  1QF3 A;  4RQP C;  4BA6 A;  4HVR A;  2Q8C A;  2KA3 A;  4XHX A;  1RUI 1;  1W2T A;  2AEZ A;  3ZFE A;  1G6N A;  1CJD A;  1DQ1 A;  3IM0 A;  3KS7 A;  1C3H A;  2C5D A;  3QCW A;  2R07 2;  3NL1 A;  4IL7 A;  3POS A;  5DUX A;  2RR1 2;  5J09 A;  4XFA A;  3JBG 1;  3F2Z A;  4QHO A;  3U10 A;  4BQ2 A;  2ORX A;  3AZZ A;  2JD4 A;  1RJ8 A;  1RUJ 3;  1R08 2;  2VCB A;  3WNN A;  4RHV 2;  2XKP A;  4Q8L A;  2G9G A;  3AFK A;  3JD7 2;  3MO4 A;  4KBB A;  4FPJ A;  4QX3 A;  5A7P A;  4D7S A;  1MVQ A;  2C1F A;  3KCY A;  3MYX A;  2P3I A;  1DU3 D;  4I30 A;  4JGZ A;  5A7N A;  3JCI A;  4XBQ A;  3I3B A;  4R4X A;  1UQX A;  1WW7 A;  5A3W A;  1NCR C;  1XNT A;  4GMP 3;  1J1L A;  4L9B A;  3HOB A;  2YBK A;  1GUI A;  1MZF A;  5FYU A;  3G6J B;  4AFA A;  4Y33 A;  1Q56 A;  4YVW C;  2VC9 A;  4IUG A;  5E16 A;  3BVC A;  4UW4 A;  5LBC A;  3LA2 A;  1CN1 A;  1VP6 A;  1RUC 3;  2JX9 A;  3NKG A;  1OOP C;  2WYS A;  3GJA A;  1G7Y A;  4LR4 A;  2RS1 3;  3WZ1 A;  3TN9 1;  1NX9 A;  1BYH A;  1K5J A;  1OF3 A;  4A6S A;  3VBR C;  4NVP A;  2P6H A;  1BMV 2;  1ZZ9 A;  1KGY A;  1DQ2 A;  3V0A B;  5FWJ A;  3BOD A;  1S0F A;  2ZZQ A;  3Q8F A;  4BPZ A;  2ENR A;  2RM2 3;  3SCG A;  3R0R A;  2WLQ A;  4YGD A;  4LXL A;  4UFI A;  4NO4 A;  4YGC A;  4CU9 A;  3MW3 A;  4NHL A;  3BPS A;  3ZXL A;  5C6C A;  4NHM A;  1ZBE 2;  5CYY A;  3MI8 A;  5C70 A;  5JI9 A;  3MIB A;  3CKH A;  3DXT A;  2MPF A;  1VRH 3;  3GGL A;  5FP4 A;  1OA3 A;  4AE2 A;  1O5L A;  4C90 A;  1AL2 3;  3VV1 A;  4CP9 B;  4BME A;  4COV A;  4C8D A;  5EZW A;  4PLN A;  3MF6 A;  3IPV A;  4X6R B;  2OYZ A;  5GKA C;  1V9U 2;  4DUV A;  1MVE A;  1O3Q A;  4YZ2 A;  2QZ3 A;  1RUO A;  1DIW A;  2GND A;  2J1R A;  3BU0 A;  2ZAC A;  3TOJ A;  1UYZ A;  1QKQ A;  1OUR A;  2XJQ A;  2VZO A;  4QDQ A;  4LEJ A;  3QBQ A;  3WDT A;  1QJX 2;  5JCT A;  2WS9 1;  4M3C B;  4PHZ A;  5E88 A;  1UXZ A;  5CVR A;  2QQJ A;  4NE9 A;  4BXS V;  3M3E A;  5FBJ A;  3R05 A;  3K48 A;  4MGI E;  3K3O A;  4OFG A;  4B1M A;  1RL3 A;  2ETE A;  2PAM A;  2VMG A;  3H42 B;  3Q8C A;  3E97 A;  4LK6 A;  1XYN A;  3JB8 A;  3S7I A;  4PF1 A;  1RUG 2;  3WD5 A;  4ZXK A;  3UJQ A;  3WXP A;  3SNM A;  3KSC A;  1F9K A;  1YXW A;  3NJY A;  2YBP A;  4HLT A;  2AC1 A;  4FFH A;  1AR6 1;  4J25 A;  3I8T A;  4OI1 A;  3QAC A;  1CX4 A;  2E31 A;  2GAL A;  1HW5 A;  2BNM A;  2D6N A;  4BJ0 A;  4K8R B;  3MUY 1;  1U0A A;  3KLS A;  1TME 1;  4KG0 A;  4E8D A;  1M06 G;  1RUI 2;  1RXG A;  5F3E A;  1J1T A;  1W8T A;  4XZP A;  3RJR A;  4F7Z A;  4Q0P A;  4JDO A;  4D94 A;  3VGI A;  4A45 A;  1XSR A;  2J22 A;  4H14 A;  3ZKY A;  3AYE A;  2Y64 A;  1RUE 3;  3HQU A;  4CP1 A;  5IVE A;  2YG0 A;  3JBG 2;  3RZJ A;  3DF0 A;  3UGF A;  3CMG A;  2Q30 A;  4IEX A;  4RS5 B;  5F2W A;  5A3N A;  3AMP A;  1GOF A;  3QH6 A;  2V73 A;  1D2Q A;  4TLG A;  3EXU A;  5FY7 A;  3W59 A;  3WV6 A;  5GZC A;  4JRA A;  3WDU A;  2IXI A;  2ZGQ A;  3KD4 A;  4IXL A;  3FWE A;  4PIY A;  4UFK A;  5EYX A;  2VMH A;  4LIT A;  4FXG B;  3VBH B;  2GMM A;  4DUX A;  1SLA A;  3F95 A;  1A8M A;  4CCJ A;  2EXJ A;  3I3E A;  2X05 A;  5FYV A;  5T50 A;  2VZU A;  2L9L A;  5EV7 A;  3ILR A;  2ZS6 B;  2VVD A;  4URA A;  5KXC A;  3BOP A;  4HK9 A;  1IKP A;  5FZI A;  2RR1 3;  3CBN A;  5HCB A;  1DF0 A;  1GOG A;  2W92 A;  2ZA9 A;  4U36 A;  4YAR A;  2WO7 A;  3EQE A;  3LA3 A;  4YFW A;  2EXK A;  5A6Y A;  2ZGM A;  5K7P A;  1YI7 A;  5KHK A;  2DVB A;  4YW5 A;  3VKM A;  2PYT A;  1YQ6 A;  4R9B A;  4Y1U A;  1VBB 1;  5ERL A;  3AB0 A;  3ZSJ A;  3PUI A;  1XJA A;  2PHF A;  2ERF A;  4YPJ A;  3OGS A;  1YWK A;  2DVA A;  2XJU A;  3FX3 A;  4MXW A;  2QQI A;  4IV1 B;  4UXA A;  2WL1 A;  4MUV A;  5KHH A;  1W2A X;  3TN9 2;  3MIC A;  4CZS A;  2RS3 3;  3GCW A;  4I3P A;  2ZPX A;  2EIG A;  2IZW A;  3KVA A;  2XR4 A;  2X5I C;  5IVY A;  1QIQ A;  4L97 A;  1ND3 B;  3AXE A;  4CXX A;  4HAN A;  1VBE 3;  2JB8 A;  3RNS A;  1FMD 1;  4JZR A;  2W3J A;  5BNO C;  5F6K A;  2XDV A;  1FYU A;  2A5Z A;  5C8W A;  3POW A;  4A7K A;  5CG8 A;  2E7Q A;  3H3U A;  3M3C A;  4GAL A;  3VBF C;  1W39 A;  1JHJ A;  1BVV A;  2B8M A;  2BWA A;  2ZAB A;  5JOZ A;  3OD4 A;  4HKW A;  4QB6 A;  2PTM A;  3M3Q A;  4MGS A;  3TEZ A;  4COY A;  1LUL A;  5I0D A;  1W8F A;  1WCS A;  4NRQ A;  2LW8 A;  4JV4 A;  3ZXD A;  1F5J A;  4JHZ A;  3T09 A;  1XBF A;  2WS9 2;  3VHR A;  2VE1 A;  3MGU A;  1QOO A;  1ZBE 3;  5FLI A;  4ARX A;  2HWF 1;  4CDQ C;  2HWC 3;  1UCX A;  4LA2 A;  4ES8 A;  1TQ5 A;  3KCX A;  1R1A 1;  2PA7 A;  3B01 A;  5KWR A;  4D0Q A;  1CAU A;  1Y4W A;  1H2L A;  4A7Y A;  3DUI A;  1V9U 3;  2P1B A;  5FZO B;  4BQ1 A;  1UZZ A;  2PMW B;  3T2P A;  4DUW A;  2XLA A;  1OQ1 A;  2YBS A;  3VKF C;  4WV8 A;  1BK1 A;  3AM2 A;  3AP5 A;  1W28 A;  2VXR A;  4IW3 A;  3PVO A;  3L2Y A;  2ORZ A;  5CKM A;  1QJX 3;  4KWL A;  1VLN A;  1AR6 2;  1XU2 A;  2UU8 A;  2JDY A;  5HV4 A;  5FPX A;  4YVW A;  1HV0 A;  3K2O A;  4XET A;  1TME 2;  3NAP A;  5FPA A;  1S0I A;  1CIW A;  3OJB A;  3ZN6 A;  2GP3 A;  4DPN A;  3S57 A;  4BQ4 A;  1HN1 A;  1HRV 3;  1OOP A;  1UU6 A;  5ABJ A;  3N7J A;  1YLL A;  1ODM A;  1BJQ A;  1RUG 3;  1L3J A;  4P9L A;  1FI2 A;  1U5Z A;  2W9X A;  1D2S A;  4GB3 3;  1LGN A;  2ZGS A;  5LY2 A;  4AQS A;  5BY5 A;  3LSE A;  3VBR A;  5B2G B;  3AKS A;  2TBV A;  1XE0 A;  3QOP A;  5IK5 A;  2D97 A;  5LCW L;  1JUI A;  3N9Q A;  2BGC A;  5JSO A;  4QGM A;  1DQ0 A;  2DUO A;  1UX6 A;  4S2D A;  5I93 A;  1X50 A;  5BNN B;  3GM8 A;  3RZK A;  3THD A;  1W6O A;  4RR3 C;  2XH6 A;  3T4H B;  4XC9 A;  4M0N A;  3HMY A;  4QWN A;  1RUI 3;  1C8M 3;  4YW2 A;  3LQC A;  1F4H A;  2BV4 A;  1QH7 A;  3RYK A;  2EID A;  1J58 A;  3T08 A;  1IPK A;  3FN9 A;  4WVV A;  5FAX A;  5IK7 A;  2A3W A;  2HJI A;  1WKY A;  4XJ9 A;  3UGH A;  3WNP A;  3IWZ A;  3S5A A;  4CXW A;  2LRP A;  4CEW C;  1OQD A;  1OUS A;  4RD7 A;  4MET A;  1VBB 2;  2VNR A;  4CTE A;  2XJP A;  3MV1 1;  5D1I A;  2WR9 A;  1RED A;  2VZ1 A;  3BCW A;  1ZRF A;  4XF1 A;  1Q8S A;  2PFW A;  4NOT A;  1TG7 A;  1RYY A;  4UFL A;  4BIF A;  1SLC A;  4BIO A;  5HBA A;  4K6B A;  4ZU7 A;  5DXD A;  3QD6 A;  3RI8 A;  3ES1 A;  2VAU A;  2D3S A;  2FD8 A;  1N47 A;  4FFI A;  3NNL A;  1FMD 2;  1AL0 G;  3SIT A;  4AVC A;  1PIV 3;  4X6Q B;  4CUC A;  4XUP A;  5A3L A;  2WN3 A;  1OLM A;  3KV9 A;  1O4Y A;  2YRO A;  4AG4 A;  1UAI A;  1QJF A;  2WII B;  4E4H A;  3M8L A;  4AHY A;  1AF9 A;  2AEN A;  3RSJ A;  3I4I A;  4FPG A;  2WLP A;  1US2 A;  5JPM B;  1O7F A;  4NPR A;  3NVC A;  1YIP A;  3INA A;  3MPP G;  2YFZ A;  4I09 A;  3WEZ A;  3ZFF B;  5LY1 A;  1M4W A;  4XF4 A;  3MIG A;  4JC1 A;  1Z7S 3;  4Z1V A;  1JOD A;  4FFF A;  4E4Z A;  4XVH A;  1S2E A;  4UW3 A;  5JR2 A;  2A6V A;  2V5Y A;  1CPM A;  2DBI A;  4LBL A;  3WVJ A;  1SAC A;  4Q4X 1;  4SBV A;  1DBN A;  2CAU A;  3CHX A;  4BXF A;  2XON A;  1VAV A;  3HEI A;  4XDP A;  4P5Y A;  1BBT 1;  4NWV A;  1R64 A;  4LTA A;  2ATF A;  4OCT A;  4OUL A;  3S5Q A;  1KD7 A;  2PAK A;  3O7O A;  4BU2 A;  4R9D A;  2E7T A;  3MIF A;  4DIQ A;  2Q0A A;  3FFQ A;  3KGZ A;  5BNQ A;  4IER A;  3R4S A;  5FP3 A;  2HWF 2;  1NKG A;  1EPW A;  3H8O A;  1MQT C;  1X36 A;  5F9T A;  5FZH A;  1R1A 2;  5JZG C;  1H8T C;  3THT A;  5A80 A;  3I54 A;  1FAY A;  3N3H A;  2XOM A;  3SQO A;  4CDW B;  1K5M C;  2ZEZ A;  5T5P A;  1TMF 1;  2BQP A;  4K7J A;  2BPA 2;  1K3I A;  4XF9 A;  5K9Y A;  2GDF A;  5L7O C;  4CP2 A;  3VDB A;  2FHR A;  3BI3 A;  2NZ9 A;  4CP9 A;  4M3C F;  1LTE A;  3WW4 A;  2GP5 A;  5F5I A;  5FRE A;  1W6M A;  4P9X A;  1AUY A;  1Q8O A;  1COV 1;  2E33 A;  3TYJ A;  5LA9 A;  4PI2 A;  5FMB A;  1X9T A;  2VJX A;  4LO4 B;  4LO5 B;  2HEW F;  3GDB A;  2BEO A;  4M3C A;  4L2N A;  5GZE A;  1IGO A;  5SV8 A;  1UKR A;  4XIL A;  2W1S A;  4YG6 A;  2VBD A;  2E51 A;  2A70 A;  4R52 A;  4XQD A;  5A7W B;  4D6Q A;  4A2U A;  3N4M A;  3IT8 A;  4LJH A;  1REF A;  5T5J A;  1G9B A;  4EE2 A;  1S0C A;  2Z4F A;  4AVA A;  1NE4 A;  1ZRR A;  3PME A;  1E57 A;  5D8A B;  1CD3 G;  5DZE A;  4YWA A;  4OHY A;  3ITQ A;  3U4X A;  5T54 A;  1LOG A;  1QH6 A;  4ZZ8 A;  1TME 3;  1CON A;  2CNA A;  2NMO A;  5FFO C;  1US3 A;  4OUM A;  4EZ4 A;  2GH2 A;  1PVC 1;  2OA2 A;  5JMC A;  4UAP A;  1UPI A;  4BLI A;  3VN4 A;  2HBU A;  3C7G A;  4KI5 M;  3H1Y A;  5IFT A;  2XJT A;  3VBF A;  5LK7 B;  5FYH A;  2HEV F;  3ZSM A;  3ACI A;  1XYO A;  3ZFF C;  2FCV A;  1S2K A;  2VW0 A;  4HET A;  1W8W A;  1LOA A;  4N8M A;  4BQX A;  2SBA A;  1VRB A;  1NCQ B;  4SLI A;  4CUG A;  4YZ3 A;  5IFP A;  2XQR A;  2YYO A;  3C7F A;  1GIC A;  2VQT A;  5C3S A;  4XUQ A;  1H2K A;  2A3X A;  2QJV A;  3VZK A;  2IC1 A;  2C24 A;  2VL4 A;  2ZMN A;  3BOW A;  1GKB A;  2O14 A;  1Q8V A;  4DIN B;  2PHR A;  4LKF A;  3R4U A;  3J8F 3;  2I45 A;  2X29 A;  1RHI 1;  4GKX A;  2RS5 1;  4RGG A;  3WG4 A;  4FAG A;  4LBQ B;  1GWL A;  3ZFG B;  4EN7 B;  1Q3E A;  4N7I A;  3HT2 A;  5GLW A;  4AL9 A;  2PLV 1;  4PDW B;  5JXH A;  1VPH A;  4UOJ A;  2Y8K A;  4CDX B;  5LA1 A;  3GHM A;  3C8X A;  3HBK A;  3E6D A;  2ZHN A;  5LBF A;  5BNP C;  4F83 A;  3LPF A;  3ZFE C;  4Z2W A;  2QFE A;  4NID A;  3MF9 A;  1QY4 A;  4F3J A;  4QB1 A;  4BQ5 A;  1O3R A;  1AX1 A;  2RDQ A;  4QPG B;  1LJ7 A;  3DKQ A;  3FBY A;  2OII A;  2ES3 A;  5C71 A;  1XNB A;  5FXV A;  3AZX A;  3CJI B;  4GJY A;  4IE6 A;  3O1V A;  1V70 A;  3FJS A;  4IET A;  4Q29 A;  3RYP A;  5K0U C;  4COZ A;  4Q4X 2;  2DF7 A;  4IV1 A;  4UYB A;  1BBT 2;  5IVC A;  1AVB A;  2C26 A;  2RHP A;  4JGZ C;  2WQ4 A;  4YLZ A;  2R49 A;  2VNV A;  4B4R A;  1IPJ A;  4Y3O A;  4XXA A;  1ZA7 A;  5IHR A;  1ND3 A;  5IVJ A;  3BU7 A;  5D8A C;  3JQW A;  5FZG A;  2DBN A;  3AP6 A;  5F7U A;  3ZYI B;  2XVK A;  4RR3 A;  5A1F A;  2WAO A;  1ULF A;  3CZJ A;  3VDD B;  2WZP P;  2XWJ B;  1RUD 3;  2JKB A;  2ZEX A;  2N7G A;  3TEY A;  5DZF A;  1J3R A;  1TMF 2;  4LUL A;  4RFT 0;  1QDC A;  3KHB A;  5FO7 B;  1KIT A;  5I0U A;  5T3N A;  3O1O A;  1VBD 1;  3O5S A;  5J48 A;  3OGR A;  3I2J A;  2VEC A;  1WCD J;  5AVA A;  5JVV A;  2R06 3;  2G1M A;  4XMI A;  5CB7 A;  4AVB A;  5I8Y A;  1COV 2;  3P1I A;  5J7M A;  1LR5 A;  3I2H A;  5GLZ A;  5FKB A;  1DGR N;  1W2U A;  3DEC A;  5T52 A;  4J1W A;  3NQH A;  3U07 A;  1KEX A;  4FAH A;  5I8S A;  1W99 A;  3AZW A;  2VTF A;  5FZ9 A;  1LHN A;  1LKN A;  3POB A;  3WW2 A;  2VOT A;  4HSL A;  2HLE A;  1ZBA 1;  4PQQ A;  4R4Z A;  1UZW A;  2Y26 A;  4B3N A;  3VDC A;  1I5P A;  3ZFG C;  5ANQ A;  2QZ2 A;  2BVB A;  2VVF A;  5LBB A;  3PU3 A;  1IS5 A;  4EZH A;  5LEJ A;  2DUR A;  1OBN A;  2WSU A;  4N43 B;  3K4D A;  4ZY9 A;  4BHP A;  2YHJ A;  1JYX A;  1PVC 2;  1AR8 1;  2QQN A;  4CU6 A;  2SLI A;  5FOJ B;  2NM1 A;  3IBM A;  1WW5 A;  4AVS A;  1HB2 A;  3LOB A;  2JG9 B;  1VE0 A;  2W94 A;  3WNM A;  3WG1 A;  1OLR A;  4FPL A;  1OLQ A;  3P3N A;  1SCS A;  1LES A;  3KGL A;  1REE A;  1VMF A;  1H30 A;  2VOV A;  4L0P A;  3T4V A;  4CCK A;  1Y43 B;  2PQQ A;  4KH9 A;  5F3G A;  1SFP A;  2D40 A;  2OPK A;  3T30 A;  3B3Q E;  5FCC A;  4AQ2 A;  2WNE A;  1BVP 1;  1GU3 A;  1HKD A;  1O8P A;  3K77 A;  4Q0U A;  4HKO A;  2VME A;  2JIJ A;  3RFR A;  4I2O A;  3DKW A;  1SZB A;  2NQY A;  4IE4 A;  4O7X A;  3RZM A;  1Q8Q A;  2DDU A;  4OZX A;  4DRV A;  1LB2 A;  5LA2 A;  1JUH A;  2RE9 A;  2B5H A;  2B9U A;  4JRL A;  3PUQ A;  5J3U A;  3T1L A;  1RHI 2;  1LOE A;  2RS5 2;  1BXH A;  1WA6 X;  4LIV A;  1QNW A;  3ZYP A;  1GZW A;  5BNN A;  5JZG A;  1LU1 A;  1PHM A;  4ASL A;  2PLV 2;  4YVS C;  1K5M A;  2BUK A;  4XTP A;  1AJO A;  1Q8P A;  4K1Z A;  4Y1Y A;  4CCM A;  1ZRI A;  1ZZB A;  4NHX A;  3UKN A;  1JOP A;  4OHV A;  3UKT A;  1E5I A;  3FBM A;  3NW4 A;  2E26 A;  4AI1 A;  5LEK A;  3ZDS A;  1LNS A;  3BAL A;  4ERO A;  1AXK A;  1UYY A;  2GNM A;  4GH4 B;  3WUC A;  2FDH A;  5JOW A;  2E6V A;  5T55 A;  3LE0 A;  4CCC A;  1VJ2 A;  2E9Q A;  4XFI A;  4GWJ A;  4HFS A;  5GM0 A;  5IW0 A;  2RV9 A;  3WP3 A;  3GJB A;  2WN2 A;  1ZA4 A;  1PX4 A;  4JHT A;  3BUC A;  3DYM A;  3ZXE A;  1JZ2 A;  1ASJ 3;  4Q2F A;  1GZC A;  1D4M 1;  4HOO A;  3RVH A;  3W20 A;  4JKL A;  5F39 A;  3RS6 A;  1KJL A;  3OF1 A;  1SLT A;  5FMO L;  1QU0 A;  5CBL A;  1ZM1 A;  1PZ8 A;  4UI9 L;  1SFN A;  4EN0 A;  1CJP A;  4QM8 A;  3VL9 A;  4FOV A;  4XPV A;  5J36 A;  1I1E A;  1OVS A;  4P08 A;  2BFU L;  1PO2 3;  1APN A;  3VKO A;  2PHX A;  2HYK A;  4ARY A;  3SLI A;  3J4U H;  4HZF A;  4PLM A;  5HV0 A;  1JZ8 A;  2ZMK A;  5CU1 A;  4P9G A;  2XHK A;  4WVM B;  1S0E A;  2XUE A;  2H0V A;  2BBA A;  1BLZ A;  1VBD 2;  4A41 A;  3U78 A;  2FMY A;  1B35 B;  3VBU B;  4OQ8 A;  2FMD A;  1CX1 A;  3ZFF A;  1WBL A;  4BYY A;  1CZV A;  1VB2 A;  5FJK A;  4CPB D;  2VUJ A;  2CGP A;  4E2G A;  5FY0 A;  4MVT A;  1FPN 3;  1NQJ A;  2YGL A;  2WT1 A;  2RG4 A;  1UOG A;  1S55 A;  3CO2 A;  2KM2 A; 
#chains in the Genus database with same CATH homology
 1ZRI A;  1F35 A;  1JOD A;  1JYT A;  1JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...