1JYTA

Solution structure of olfactory marker protein from rat
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
163
structure length
163
Chain Sequence
MAEDGPQKQQLDMPLVLDQDLTKQMRLRVESLKQRGEKKQDGEKLLRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Olfactory Marker Protein
publication title Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 17
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jytA00
1JYTA 1ZRIA 1JODA 1JOBA 1F35A
chains in the Genus database with same CATH superfamily
2Y6LA 4NHXA 2OT7A 4LJHA 3RJ2X 1QJZA 1QH6A 4ARYA 4D6SA 2HH9A 2GNMA 4QB2A 1AX2A 2JXAA 4BK4A 5L36A 5A3TA 4LXLA 1TMF2 3S5QA 1ZRIA 1JS9A 5B4XA 4MZUA 1CJDA 5CFCB 1PM4A 2B45X 2XJSA 2BDRA 2OUJA 4CP9B 3FFQA 2JDAA 1GOFA 3JU9A 2V72A 5J1XA 4E8CA 1BK1A 5DMYA 5IT6A 5ACA2 2NN8A 4HVRA 3LQCA 4A2UA 4AXOA 3QOPA 3AKTA 4OYUA 3WY6A 1O6UA 5FP4A 1NAEA 2DUPA 3DUIA 5KHJA 4UW6A 1ND2C 1SLLA 4M01A 4H7MA 1ZZ7A 4K40A 5EV7A 1QIQA 4L9BA 1IPJA 1BQPA 4LBNA 4LO6B 5EHDA 4C90A 3JXSA 5CFDC 1OLMA 2PHWA 1US3A 5T5OA 4Z8BA 3GBGA 1DU3D 1Z7S3 3N36A 4DEQA 2VNOA 2W46A 3A7QA 3ES4A 5BNPA 1PVC1 1YFUA 1JU3A 2A71A 3NKTA 5AC92 1AR91 2JD9A 5JCTA 4CPBA 3VDDC 2VZPA 2JG9A 3KSCA 4NVPA 4PBOA 4KWUA 1JI6A 2BNMA 4LHLA 5FZCA 1R1A1 3BOWA 4L2NA 1GV9A 4DXZA 2VOTA 1LHVA 1WD3A 3THPA 2OYZA 4B4PA 2P34A 2Y0OA 4AEDC 1VBC3 2C6SA 3DXUA 1UZWA 1QQP3 2RS12 2A6VA 2ZAHA 1KITA 1S4CA 4MGKE 5F6LB 4XFCA 4GMP3 2CWMA 4AVSA 2Q1ZB 4GKYA 4JGZC 5I0TA 4AQSA 2XPJA 3GYDA 4N9HA 4GB31 4TXWA 1WZXA 3WV6A 4QXHA 3K51A 4QPIA 1LOBA 1YYNA 3VLBB 4FTBA 2ATFA 4FTSA 2LROA 1AX0A 3WW4A 3Q8AA 3HVDA 1RUG1 1M06G 5FZAA 3VD7A 5DDJ1 1CN1A 2ES3A 4CCOA 4WM7A 2QQIA 5JZGC 4DUVA 2Y0IA 4IEZA 2ARXA 4QMAA 2HBTA 2WZR2 3AP7A 3I3EA 4Z07A 3DF0A 2G4IA 4ATEA 2D98A 3PU3A 2GDFA 4MGQA 3VZJA 4META 3PTRB 4ES9A 1V70A 3PIJA 2WINB 2BW8A 3AJZA 4HN1A 5FLIA 1D4M2 4M3CB 2Y6FA 4UWDA 4DS0A 2FDFA 1CD3G 1FI2A 1NZIA 1H1IA 2H6CA 1JUHA 3JD73 1O4TA 4ZXEA 1LU2A 1OKOA 1O5LA 1ZBA2 4LEJA 4YM0A 2RR12 5FZFA 1H1AA 5L73A 5C4WC 4IGPA 1Q8SA 4XQWA 3MI8A 5T5PA 3SQOA 3HNMA 1QJY2 3ZXLA 1V6MA 2QZ3A 1AXKA 1RUJ3 1VBE1 2I74A 2GU9A 3CJIB 3O0WA 4LO8A 5T3NA 5HV4A 1O3QA 4EZHA 2RMU1 3B02A 2BFUS 2I07B 3VL9A 3ZFEA 1F5JA 4CCKA 4EN8B 5D8AC 4LE4A 4IV1B 4KBZA 4D7YA 2AH2A 4Y1ZA 3WUDA 4RL7A 4J1WA 5BNOA 5FZDA 3I3BA 2GN3A 2HWC3 2RM21 5A7WA 1PK6A 3E97A 1WUVA 4D94A 2A1XA 3AMHA 3BGAA 3KZ4C 2D43A 2VZSA 4A6SA 2D5HA 4YVSC 5BNNC 5GKAC 5JPNB 1NCQC 2VCBA 1W03A 3SKVA 3AKQA 3ME2A 2OKXA 5A3NA 5A3PA 1J3PA 3P5BA 4XZUG 2EIDA 1LENA 1VB4A 5HCFA 3THCA 4YZ2A 1A78A 1DBNA 1OVSA 2JG8A 1PO12 1FX5A 3ZN4A 3VBHC 1Q8QA 3IDEA 4ITCA 1S0JA 3M70A 4MO3M 5LA0A 2PA7A 2WWJA 4J6GA 4QPGC 4DXTA 2MPFA 2HWD2 2B9VA 1SCSA 3UT0A 1JZ7A 2P4EA 3B69A 3OTFA 3BKZA 1NE4A 2BWAA 5G05L 3J4UH 2FDGA 3T09A 5APAA 5IK7A 1W6NB 3PTYA 4B1LA 4K21A 5FY0A 1YIFA 4N8MA 3VBOB 1AYN2 2CYFA 1QJEA 3A4UA 1QY4A 3OPZA 5FMDA 1ZA4A 4Q26A 1QJU2 3K75B 1WW6A 5E89A 5F3CA 2JEMA 1QF3A 5FBJA 5A3UA 4YW3A 5FWJA 4NIAA 3KQRA 5J7MA 4CP2A 4P5YA 2IC1A 4Q2FA 3LDBA 2WFF1 4LITA 4XURA 3LA3A 4Y20A 1NLQA 1W6MB 2XJQA 4NHLA 1JYNA 2B7YA 2B5HA 2VR4A 4A4AA 2DWRA 3MBWA 3RFRA 4K6BA 1QDCA 2FMYA 3J26N 2F6BA 4QGMA 4GXLA 2VY0A 4O7XA 4ZU5A 4B3NA 2R043 1DGWX 1RUE1 1WMFA 2DUQA 4XJ9A 4ZU4A 3AKPA 3RZHA 1DGLA 1GNZA 4UW5A 5T55A 4X8NA 3RZZA 1XE0A 3WT3A 2CNAA 2XKPA 2PAKA 3PUIA 1AXZA 2JB8A 1RTVA 5FZ6A 2JE9A 4XHXA 5FY5A 1EV12 1E5IA 3I2JA 3K77A 3ATGA 1OH4A 4AR2A 2WS92 5JSRA 2CAVA 2WJSA 1L7QA 1MZEA 1OLRA 1UU4A 2HEVF 3I2HA 4NHKA 1LOCA 4JV4A 5T52A 1OXCA 3QACA 4IEQA 1QXJA 1W6OA 3NV2A 1NLRA 3BIEA 4IEYA 4OVEA 4YW4A 5FPLA 1R091 2VC9A 5LK5A 2BBVA 1MZ6A 5A32B 3MYXA 4JHTA 1R64A 2ZTNA 1Y9QA 2P6HA 2WSUA 3ACIA 4C1XA 3PDQA 4YVWB 1O3SA 4RHV2 4Q4V3 1UZZA 2TEPA 1XRUA 2BEOA 5DDJ3 3VBRA 1CX4A 2WWSA 1AX1A 1W8OA 5CADA 3RZKA 2ARCA 3IB3A 3WDYA 3J8F1 4CCEA 1RUI3 1QNWA 3N7KA 4HMZA 4PDWA 3BTYA 1H9WA 4LKDA 4E4ZA 4YM1A 1DGWA 1VBC2 1RL3A 2HWE2 5FLJA 3WP5A 1UZYA 1IOAA 1HRV2 1NT0A 2BUKA 4JDMA 1VBA3 4OLLA 1Y9MA 4PF5A 4UOJA 1RJ7A 4QM8A 4XPVA 4F8AA 1Q5OA 1FV3A 1Q8PA 2LUWA 3O1MA 3LD8A 1WD4A 3AVSA 5ABJC 4LK7A 3ZSEA 3IMMA 3NAPB 1QH7A 3KCCA 4OCTA 4WVWA 1LB2A 1TNRA 2RMU3 3VBUA 4CDUC 5LY1A 4ZXKA 4OQ9A 1LCLA 2VZQA 3AZZA 5A7SA 5J09A 1AL21 1AXYA 4V2WA 3ENRA 2QZ2A 2D7FA 3SC7X 2RS31 5FLHA 5FYMA 3KVAA 4OULA 1FOD3 4BPZA 5LK7B 2O14A 4LORA 2BGCA 3ZXKA 4CVUA 5ISLA 1IGOA 2BQPA 2VH9A 1MS8A 2P6CA 2VUJA 3AX4A 5BNPC 1NCRB 3P3NA 3JD72 3WP6A 3X29B 1VMHA 3I54A 2BTVC 2RHPA 3IKWA 1PO21 2RJ2A 2W95A 3J7HA 3TN91 3LF7A 2BVVA 1KS5A 3T3YA 2YC4A 5FQ0B 5FYIA 1HRI1 2PLV1 5FK7A 4GIQA 3ETQA 3IAPA 2VZOA 1HN1A 1UY1A 1V6IA 2YC2A 2XVLA 1S2EA 2ZX4A 3FE5A 4RQPC 3WG2A 3OGRA 2XWBB 1X9PA 3HIFA 3I3QA 1NXMA 1HB3A 2WT2A 4G4FA 4I30A 1UIJA 1KD7A 3WNMA 4WBBA 1XNCA 5C3SA 4ZONA 4UF0A 3SH3A 1W0OA 3AMPA 1IPKA 1NA1A 3FUQA 3VL8A 3MV11 5FYHA 5CIRA 3VBSB 4L97A 1CAWA 1LOAA 3JBG2 2E7QA 4JRLA 3B9IA 1CR7A 1YHFA 2MEV3 4Q5OA 2GNDA 4ZPIA 3S6PA 1OA4A 3LEIA 2YPJA 4IQPA 2Q1FA 4PLOA 4QXBA 2FQPA 3O1UA 2BPA2 1N1TA 1ODMA 2Q30A 1ND3A 3ZN6B 4XDOA 2J1SA 2UWAA 2GZWA 5FYUA 2RDSA 4NRMA 4IV3A 2ZS6B 4B8EA 3T2QA 1RUD2 1DQ4A 1OMIA 2QQNA 3R4UA 1NX9A 2WFF3 5E8AA 1I5PA 1S2KA 2OX0A 4Q8LA 1FAYA 2ZGKA 3GBFA 2HYKA 5F8PA 1S55A 1VRH1 5J96B 1FT9A 2WT1A 1EUTA 4UFJA 4H7LA 3B3QE 1TME3 3MW2A 2R0HA 2EIGA 1GQHA 4SLIA 5KBFA 3I97A 1UCXA 4JDNA 4JDOA 1N3OA 5FP8A 4QX7A 3TOJA 3WXPA 2CY6A 4HZFA 1UO9A 1ZVFA 2Z79A 4JGYA 5JR2A 3ZFEC 1MQTA 2QUOA 4DOUA 1IQAA 2WBKA 3LDRA 3F95A 4PBPA 1UXXX 2C26A 4Q0VA 1H4GA 2QCSB 3H1YA 3LDKA 3RSJA 1UY4A 4DUXA 2VECA 1S0DA 1C57A 4XF9A 3OB8A 5JIUA 1I3HA 1FPN3 2E7TA 5SV5A 1WKYA 5GJ6A 1GP4A 1W9FA 1WW5A 1QHDA 1RUF1 2BGOA 1R093 1O8PA 3GJBA 2BV4A 2QQJA 3I2IA 4DPNA 5IYYA 1BEV1 1TE1B 2A6WA 3JB8A 4KI5M 4XABA 1PVC2 2ZABA 2WAAA 4XQDA 1AR92 3DYPA 4Q1PA 4CDQB 4I3GA 1OQEA 3GBWA 1R1A2 4FT8A 4K7JA 1UYYA 2O8QA 5GLWA 3AYCA 4AFDA 4XCBA 2JDNA 4QX2A 5IAXA 4CEYB 5LRSA 3H8XA 5H9PA 4RYDA 2XJUA 3LIHA 4D6RA 1FNZA 1CAXA 3KF5A 4QAWA 3V0BA 1OOPC 4GH4B 5FYBA 3UGGA 1YXWA 1ND2A 4LBQD 4EN9B 5FV3A 5M0TA 3UJOA 3H1WA 4KG0A 1ULEA 2W87A 3DV8A 3CZJA 3H42B 1OSGA 4GB32 1W6QB 1PGW1 5CFDA 2YXSA 4DY3A 2D93A 5DG2A 3O1RA 3LEGA 1RUG2 4UXAA 1UOJA 1MZFA 1QJX1 4AG4A 5FKBA 1F2NA 3VDDA 4CUAA 4L92A 4NROA 5K9YA 3HN1A 3C7EA 1XNBA 2AACA 1K5MB 1REEA 3ETPA 1WLWA 2YU1A 2DV9A 4AEDA 4UAPA 1KDKA 1YQ2A 2PN5A 4A7KA 1N47A 1W90A 4BQ5A 1NOVA 1PNFA 2VAUA 3K46A 4MGIE 5L7OC 3WCRA 1Q3EA 2W3JA 3RS6A 3SLIA 1PO23 1MS9A 1ENRA 2XXZA 5F2WA 4E4SA 4AQTA 1SDWA 2ARAA 4JGZA 3B00A 4P9JA 3VKMA 1KRIA 1HRI3 2Z42A 4Y1VA 3AFKA 4WZFA 1VBE2 2A70A 1Q8VA 3WQ0A 4AW7A 2GC1A 1LGBA 2UYBA 3KV9A 1UPSA 1XYOA 3ECQA 4XJUA 5E1RA 2QQKA 1C8M1 4QQOA 1JBCA 3KGZA 5F7UA 4NIGA 1IKQA 1CAUA 3OYWB 4CA9A 2FHRA 1RXGA 2RM22 3LGRA 5JZGA 1V9U1 1MR5A 4Z2AA 4LOSA 3VKLA 1W9YA 2WNUB 2I45A 3T4HB 1QWRA 1YUDA 3WNXA 5LEKA 2ETEA 3S7IA 3WCSA 3U1XA 3JUUA 1U5YA 1HIXA 3DL3A 4RA0A 4AFMA 4YARA 4WM8B 4CEWA 2HBUA 1NE6A 4Y26A 1H4HA 2YMZA 2VOXA 4Y1XA 1N3PA 2IZWA 1G9CA 2VCCA 3C7OA 5C4WA 4XAAA 3VZKA 4B7KA 1YNAA 3N4MA 2ORXA 2ZHMA 3HEIA 4MOAA 1U5IA 4BK5A 5GLVA 4EZ4A 3T0BA 4CDWC 4H3WA 4IETA 5DAWA 5DXDA 2XVGA 2CL2A 4PDWC 1OBNA 5FMBA 2XQXA 1CIWA 4C91A 3S0MA 4XMAA 2UURA 3GNEA 4MGYE 1W6PB 2XUMA 1ZZ8A 1HJGA 2XR4A 3V56A 3VD9A 5A3OA 5EJ3A 2WLPA 3ZSKA 1QOSA 4BWOA 4BQ4A 2C0ZA 4NAOA 1JUIA 4RSUA 5HCBA 5J98B 3RQ0A 4EWAA 5FO7B 4D7SA 4DZGA 4M3CE 4TLFA 4GA9A 1LEMA 5BNNA 2EIBA 1ULCA 2NLRA 3LEMA 1UZ0A 5FP3A 2W91A 5EYXA 3PUAA 2X5IA 2A3WA 3UNPA 5JIAA 2YZ4A 3VBHA 1S0FA 2XDVA 3C8XA 1PIV3 1JYVA 2DBIA 1JHNA 3HBKA 4CP0A 3OD4A 5IVVA 3BVCA 3KT1A 1JZ5A 1S1AA 3A23A 4XDPA 2WT0A 2L9LA 4BB3A 4CU7A 2UWCA 3POSA 4IEXA 4QPGA 3SEEA 2WFF2 2FMDA 2LALA 3OY8B 4Q29A 5I8TA 3OSDA 1QQP1 3PVNA 3IIIA 2WO2A 4EYUA 4CCDA 2CGPA 4BLJA 2PELA 2VMDA 5SV8A 4Z82A 3PURA 2GAUA 4HKOA 4XIOA 2NZ9A 4GMP1 4HVOA 5A70A 2ZGSA 5FJKA 1RUE2 1S0BA 1CZVA 3ZKUA 2G9FA 3DKWA 3QH6A 1XC6A 4RD7A 5ANQA 1GOGA 2F4LA 2ILMA 1Z78A 2SBAA 3IWZA 4JRAA 4YG0A 3W20A 1VMJA 1FMD1 2CAUA 3POEA 2WFPA 1X7NA 2Y6HA 1OF4A 1XSQA 2WZ8A 3TRSB 1KQRA 1PMIA 4COYA 3NJVA 3SHRA 1G9BA 2D5FA 3AP9A 4BQ1A 1NA1C 1W8FA 1QDOA 2VZRA 3RDIA 1SACA 2GMMA 4QQPA 2RS53 3H7JA 5I8YA 1OFNA 4NIHA 2EVXA 2OXBA 1DQ5A 1R092 1JTZX 2WKKA 1IKPA 2YBPA 3VBFB 3DPRB 1PM7A 2NQYA 4QU1A 1OQ1A 1UPIA 2VQTA 3VHRA 3IAQA 1CAVB 1PX4A 4MXWA 2ZGUA 1KXGA 3ILNA 2WAOA 4IV3C 1E5RA 2H6BA 1MS1A 4QX3A 4QX0A 4UFMA 3KV5A 1RUJ1 3I59B 3Q8FA 4HETA 2DCKA 2R063 3JB4C 3J8F2 4EWEA 3DXTA 3HNYM 1CX1A 1RVF1 2QE3A 2NMOA 5DQ0A 4FP2A 2HWC1 2DVAA 3MV01 3EBRA 4P9WA 3AMQA 1JYTA 5FZLA 2ZKNA 4AI2A 2PQSA 3RI8A 1ZREA 4YW6A 5EZWA 2VCMA 3H7YA 5FYYA 1ZM1A 2RJKA 2ZA9A 1GZWB 4UI9L 5K4LA 3PUQA 3BOPA 2WNVA 1UY3A 1BZWA 4S2HA 1ENSA 3HQXA 4BM8A 1CPMA 2VZ1A 4HKWA 2VNGA 1C8M3 3J7NA 4FPJA 1I9RA 4QWNA 1ZBE3 1BCXA 2VE1A 4P9GA 2Q8EA 1C5HA 3UJQA 2H0VA 1WCSA 1ST8A 4AZZA 4DUWA 1AL22 1RMU3 2GMEA 1G6NA 2YFZA 3ZSMA 1JYXA 2RS32 1UD1A 2WQ8A 1BXHA 1WBLA 2D97A 2ZGMA 1NZCA 2YHJA 3N9LA 2FCUA 3IIAA 3TEWA 4BHPA 3IMNA 3AZXA 4A41A 1W06A 4GH4C 3RNSA 4E2GA 3TN92 3EYPA 4HK9A 4JCKA 2ZX1A 1L3JA 4RS5B 4C0HA 1HRI2 2PLV2 4E27A 5ABJA 4AHYA 2V4VA 1NQJA 3DN7A 1W2AX 5C70A 3O1TA 5C9AC 2GP3A 2B8MA 4CDUA 1I1EA 3WSOA 3NV1A 3TBDA 2XJVA 1ASJ3 5FTTC 5JVVA 4PLNA 1J83A 4XC9A 2WWUA 1GWLA 2V73A 2WN3A 3H50A 4KU7A 5EWSA 4HFSA 1O4YA 4FTEA 1QMJA 2DDUA 4MGTA 3DYOA 1DYKA 2AENA 2ZGTA 4QPWA 5E6HA 4COUA 3V64A 1B35B 1WLDA 3C7HA 3E5QA 1G86A 3PVBB 3FFZA 2EA7A 2VVDA 4BQ2A 2WR9A 2TUNA 4A6OA 4KL1A 2JICA 3ZDSA 5JOZA 3UETA 5JR7B 3B5LB 1ZZBA 4F3JA 4IEUA 4YSFA 3TEZA 1JXNA 4LA2A 3WW1A 5C8CC 1TVGA 1GU3A 2J1TA 2O0OA 2R041 4W8JA 4AFAA 5CKMA 1YWKA 3TNQA 3U0ZA 5FK8A 1QGLA 2IVJA 4NPLA 2WN2A 4JKLA 1D0GA 4QHBA 4GZ9A 4MXVA 4NIDA 2W39A 4R9BA 3CJXA 2W0XA 2VPVA 3BIWE 3IDAA 4XQ4A 4RQPA 1STMA 1IQDC 3H0OA 4XEZA 5FXZA 4MSVA 5JMCA 4MGZE 3CL1A 1N3QA 1F8VA 5HCHA 4MHUA 5DUUA 1SBFA 3K4DA 1VRH2 3OF1A 4KGGA 3U37A 5I8SA 4EN6B 4AE2A 3MICA 3THTA 3SCFA 4Q8KA 2VW2A 4ONUA 4R8HA 4ZS2A 1MPXA 1ZZ6A 4IEPA 4O65A 3VZLA 5GLUA 2W47A 2XKOA 2ORZA 1GWMA 2WDBA 2DURA 2WABA 4EWDA 1K12A 3NQHA 3NWKA 1IG0A 4S2FA 2VZUA 4P14A 4AL9A 1ODNA 4XUQA 2C4XA 2X05A 2V4AA 1A3KA 1FMD3 4Q4V1 2G19A 1G9AA 1BK0A 3UV9A 5A3MA 1RC6A 5FUIA 5FBZA 1V6NA 2W2IA 1RUI1 5K7PA 2JG9B 2GN7A 3M3IA 4YZ4A 3BALA 4FP3A 2KD7A 2VUAA 4GD4A 5JOWA 1IPSA 3ZFFB 1RUF2 4CEWC 1OPMA 3UGHA 1VBA1 1J3RA 5FZ0A 5EIYB 3N7MA 4W50A 3ZLIA 1UZVA 1A8DA 1BEV2 2WNEA 3N9OA 3ZX7A 4FAGA 3FX3A 4A45A 2PYTA 4A7ZA 4XF0A 4TWTA 4AHZA 1XXNA 2BP6A 2FDKA 3D8CA 1JZ6A 4BCUA 4X8PA 2VCAA 3WDUA 2HWB3 2R16A 4GQ7A 5JOXA 2R7EB 2WUHA 1RIRA 3CHXA 1TNFA 4RN5A 4LLFA 3VZMA 3W58A 1C4RA 2FBEA 3AYDA 4QPIB 1RVF3 1WCUA 1GSLA 1BBT3 2BYVE 2J22A 3CDZB 3J7LA 3RWKX 2JDKA 2OIIA 4FPGA 3S57A 2OW4A 2OZ6A 3PU8A 1BVP1 3EB7A 5FYVA 4NRPA 3WNLA 4YZ1A 2XGXA 1W8HA 4TLGA 1RUC2 3MZHA 4FFHA 1FOD1 2X53S 4WM7B 4XFHA 2ZEXA 5HV0A 4QDRA 2Q1MA 2BFUL 1OUSA 5F9TA 2QDRA 2QNKA 1F35A 4LMFA 3W21A 4E8DA 2JDPA 2X5IC 4I01A 5JMOA 1PGW2 3NJYA 4UT5A 3AM2A 1VAVA 2ZEZA 3VZNA 4XBLA 4G3YC 3B9CA 3NNJA 2OPWA 2ADEA 2DCZA 4D7TA 3TB0A 1IS6A 2DVBA 4XJZA 1AR83 5FP9A 3AYAA 1DP0A 1QJX2 3WG4A 3ACLA 4GWJA 2Z5WA 1S0EA 2VG9A 2LM3A 1UU6A 3HPNA 3OGSA 4I0WB 4N9IA 3VBOA 2AUYA 3H8UA 4ASLA 4BE3A 5JPMB 3PL0A 1ULDA 3I2OA 4Y22B 1JOBA 2VTFA 4XFAA 1NKGA 4Y3OA 3OGJA 1J1TA 3K4AA 1W0NA 4H14A 3CO2A 3OPTA 2ZX0A 5FZOB 2D3PA 3KWVA 1OOPA 4JC1A 5BNOB 2GH8A 1C8NA 5CG9A 1FXZA 4UW3A 1IG3A 3KV6A 1RINA 5LB6A 1PK6B 4LHSA 1J3QA 4N43C 5A7WB 5FPXA 1DDLA 2QFEA 3CF6E 3N35A 2MEV1 4Q4W3 4CUBA 5FOBB 1G9FA 2ZPXA 2IXJA 1LULA 3UKNA 4AK3A 3E6BA 5IVJA 4YLZA 5FFOC 4QD2A 4BDVB 1IS5A 1UXZA 1H8TB 1HXS2 4ISRA 1C8M2 5GM0A 3ZPOA 4IW3A 4A3ZA 3M3CA 5FY9A 2JG8B 5GZCA 3H1MA 4RR3C 1V9U2 5K0UC 4FPEA 2DTWA 3WF3A 2D6PA 5E16A 1N1SA 3NMBA 1XU2A 2ZHNA 5JAXA 4DRRA 4KWLA 3VKFC 2QQOA 1H1MA 2DUOA 3CZUA 1TME1 4LPLA 1F31A 4UFIA 3WX5A 5L7OA 3O1PA 3DGTA 3EJKA 5JXIA 2I2SA 3AB0A 1Y3TA 3MLLA 2NPIA 3KCYA 3I3DA 1KJRA 5KHIA 2IXLA 2ZEYA 3VDBA 2YC0A 4Y5TA 5FXWA 1COV3 4Y1UA 5A32A 2D6NA 2EXKA 1AR73 4HVQA 3FLRA 3H9AA 3WNPA 1U0AA 4QKDA 3HQUA 2XL7A 1D2SA 2VOWA 4KWJA 4OMCA 2OVUA 1SPPA 1WCQA 1YCIA 3HD8B 4AEMA 2XJTA 2X8KA 1FPN1 1REDA 2ZOEB 2J1EA 2ZACA 1ULFA 4LUKA 5T5JA 3EMRA 2EXJA 4B4RA 1UL9A 3AC0A 1PZ7A 2GNTA 2WNVC 2FDJA 1UNBA 1QU0A 2E32A 5ERLA 1AR63 2VXRA 4O9GA 3AL5A 1DGRN 4XJWA 5A3LA 1OI6A 1JZ2A 4R52A 5JLVA 1R1ZA 1Z7S2 2C9AA 1G9DA 4LQRA 4OUEA 3PJQA 4KNCA 4IE6A 2VNVA 1UAIA 4LIUA 4LKFA 3T1MA 5CFCC 4Q4Y3 3AVRA 1GQGA 1HKDA 4CDWA 1C3HA 1GYKA 2BJSA 3ZYFA 4EE2A 2BGPA 3AMNA 1O7FA 4PQQA 1H0BA 1XQNA 1J59A 2DTYA 1S0IA 3HR9A 4XF4A 4FSJA 2P3KA 4LTAA 1QQP2 2PAMA 2VMGA 1PZ9A 5EXOA 2YDEA 4FFIA 1GZTA 3OUIA 4XFFA 1OLQA 1KGYA 2WLQA 3T4VA 3E6CC 1GMMA 3R4DB 5A6ZA 5C3RA 1W28A 2P3YA 2GP5A 3VKOA 2Y6JA 2E31A 2JDYA 1X50A 4LO5B 3K3NA 2ZX2A 4KGQA 2VMEA 4KMQA 1OA2A 5FO9B 4XACA 5EJ1B 1EPZA 3ALQA 3LFMA 3RZJA 2R6QA 4YYOA 1VAKA 5DAQA 3BI3A 2AR6A 3N3HA 4YW5A 5T50A 1NCRA 4NOTA 3OUJA 5LATA 3UKVA 2VMHA 5FYSA 3WP4A 3S7EA 2C1FA 5C3PA 1POV0 3VBRB 2PFWA 1UYXA 2XHNA 3ZSLA 1EAH3 2ADDA 2CGNA 2VM9A 4KBBA 1H30A 1EYBA 5DG1A 4XFGA 3RMXA 3WHTA 5BY5A 2CTVA 2EIEA 1YQ6A 2VQUA 3AZWA 4FPLA 4ET7A 5B4NA 3ZXJA 3O14A 2UWBA 5FZIA 2KA3A 4IE7A 4YWAA 1RUH3 1ULPA 2XLAA 3O0XA 3MDPA 3NJZA 2BRTA 2Y64A 2DVFA 4FOVA 5DABA 4BXSV 1X36A 1K3IA 1UY0A 2B9UA 1DHKB 1RUJ2 3MW3A 1O3TA 1E57A 4Y24A 1LHUA 4E9KA 3GALA 4X6RB 1ACCA 1XNAA 1RVF2 3MUY1 1ONAA 3BB6A 3MIBA 5IAVA 3GGLA 3ZFGB 3VBUB 2HWC2 3ZN6A 3AP4A 3TWIA 2WRAA 2UY8A 4DINB 3FL7A 2ZMLA 2ZGLA 3AL6A 3VHNA 1URXA 2XUEA 4GALA 3IPVB 1H8VA 3C3VA 3B94A 4KG8A 4J25A 5BYNA 2JDZA 1HQLA 2KXLA 2R073 1ZZ9A 4FBFA 1XNKA 4IE0A 5DUWA 3KHCA 1E5SA 4CUGA 4CDXB 2R1BA 3THDA 2IFRA 2B39A 4M3CF 5LW9A 3EO6A 1GLHA 3QLQA 3KQ4B 2GALA 5FAXA 1FATA 2G9ZA 1XE8A 2VTXA 3CJIC 4K1ZA 3D0SA 1PMJX 3KVBA 1LJ7A 2IVIB 4UYBA 1JZ4A 1PZ8A 1MEC1 1QXPA 5FZKA 5FCCA 4IV1C 5FRAA 1UWWA 4AI0A 1BLZA 3AMMA 3GF6A 3WF1A 3A21A 1NY71 3KF3A 5A7NA 2B42B 4BH9A 5HPOA 3LSEA 5BPXA 2XB6C 5JWPA 3MF9A 1BKZA 2A5ZA 2Y60A 2BZDA 1HQNA 1Z0HA 5GLZA 1JYWA 4FPHA 2XBO3 3QH7A 1D4VB 3WNOA 4KWKA 3VUOA 1WLTA 1OHFA 2J1AA 1OFSA 3BCWA 4BQWA 4ZHNA 1YFYA 4H2AA 3MW4A 2QBXA 1PIV1 1ZA7A 1SBEA 5IW0A 1X33A 3KCXA 2Y6GA 2JDHA 2EXIA 3OUHA 4LBOA 5KXDA 2R32A 4Y1YA 3NJXA 1POV1 4XXPA 1LNSA 3I7DA 4P02B 5DAPA 1UYZA 1YRZA 2W1UA 4OHVA 4TSVA 4CU6A 3ZKYA 4YGEA 3KV4A 4CEYA 4MG2A 3AKSA 2XLFA 4KQ7A 2PXJA 3MIFA 2HWF1 2IFWA 2ZKLA 1S2BA 2R042 4GH4A 5J48A 1IS4A 3HT1A 2XJRA 4TTGA 1CWPA 3VBOC 1N1YA 3QCWA 2VZVA 4PF1A 3OD0A 3LSDA 1W6QA 2QVSB 5A6YA 4JGYB 4IXLA 1VBD3 1QOTA 5C9AA 2KM2A 1MQTB 4IGQA 1HV0A 2JX9A 3C7GA 4K8RB 2YGLA 4HONA 1F9KA 1Y7BA 3GHNA 5C3OA 4DY5A 5A33B 4FO9A 4NN0A 3JCIA 2JIGA 2W1WA 5GLTA 3TAYA 3WG1A 1B09A 4B1MA 2WNOA 4ARXA 3VD4A 4AHWA 2RS51 1XYPA 2F17A 2JIJA 3VHOA 1AYM3 1AF9A 1JYCA 3ZM8A 1HW5A 4DQAA 2PHTA 2RV9A 4P9IA 4E2QA 4CRQA 5CVRA 2XHKA 4FOQA 5JI7A 3GHMA 2E9QA 3WNNA 5CYYA 5C6CA 2JE7A 5DAVA 4Q4V2 3OGGA 1XOYA 5C8CA 1VE0A 5DDJ2 2YU2A 1HX6A 4ASKA 5JXJA 2RDQA 3NV4A 4QM9A 4NIIA 2RVAA 3T2PA 5F39A 4Q4X3 3RYRA 4S2DA 4NWWA 2O8OA 2R061 3WVJA 1W3VA 3PMEA 1RUI2 3T0AA 4OQ8A 4IE4A 1DZTA 5IUQA 1T2XA 2R30A 3H3UA 4NPMA 1H2LA 1VBA2 5EYYA 2IWGB 3LPGA 3KHBA 1W8NA 4FOWA 5FREA 5FYTA 1NG0A 2QQMA 1F4AA 3T2TA 1RYYA 4LR4A 3O0VA 1RHI3 1ND2B 1T6BX 4WVVA 4EN7B 2B46X 1UMZA 2YGMA 3UK9A 2RMU2 1AUYA 2W1SA 3LAGA 4PLMA 2CHHA 2P3JA 4YVWC 1GUIA 3GZUC 2IXHA 5CFDB 4Z1VA 1ZBE1 3M1HA 4AF9A 3GM8A 1HB2A 4BLIA 2PHUA 3A0NA 2DU1A 3ZPYA 4BYYA 2W1QA 4UFKA 3ILFA 1RMU1 3DEMA 4JVAA 1M4WA 2FDIA 4LLOA 5KR7A 3VDDB 3TEXA 1FOD2 1ZYBA 3GZEA 4YGCA 4WVMA 1HDKA 3AXEA 3CEWA 1DYOA 4LULA 2D6KA 4CZSA 4CUCA 4HSLA 1OA3A 1ZRFA 1FV2A 2Y33A 4AEDB 4A7YA 5ACA3 2VW1A 1UX6A 2QDNA 4JKMA 5FMOL 1HJFA 1KEXA 2QQVA 3GXUA 4OUSA 2P3IA 4YFZA 1C1FA 2BBAA 2NP0A 4QX1A 4RFT0 3NAPC 3LIGA 1OLME 4JGZB 1R081 1J1LA 4BQXA 4EV0A 5DUXA 5FUNA 4AQ6A 3OG2A 5CISA 1MEC3 1BMV1 2WQZC 5GZEA 3ACFA 1ASJ1 3WEZA 4IEWA 1MVEA 2YBSA 3PMSA 3USUB 2IXKA 4CTEA 5EFUA 3WZ1A 3OBTA 4AFBA 5AC93 1Y43B 5KC6A 4RGKA 3FC0A 4XMIA 3VZOA 2Y26A 1DF0A 1YIPA 3I2DA 5BNQA 4YZ5A 3MHZA 5LA1A 1O3RA 5JZGB 1YI7A 4AI1A 1LAJA 1S0CA 5FZBA 1D0HA 3ZYRA 1QKQA 2D40A 2MEV2 5FMCA 2PHRA 1US2A 1NCRC 4HPKB 1GP6A 2WSVA 3POJA 3U4SA 4ATFA 5L9BA 1EV11 1SMVA 2RS13 1NQDA 2UU8A 4LHNA 3SITA 4BOWA 3H8OA 5FZ8A 4FXGB 3O7OA 2VVFA 2Y38A 3LWCA 4MGSA 3LCPA 3WF0A 5C4WB 3K4ZA 2Q4SA 1LRHA 4CXXA 3BTXA 1POV3 2EICA 4ORFA 4S2GA 4NJ4A 1Q56A 2VQ0A 2CSGA 3JZVA 1YJKA 5FJHA 2Z2SB 3D82A 4R9AA 4PIZA 1UW8A 2CU5A 4XBQA 5D8AB 2VOVA 1TME2 2Y6KA 5GZGA 2HWF3 4Z2WA 3KT7A 2BOJA 3RPQA 3CBNA 4OHWA 5K8SA 5GZDA 4AGGA 4W4ZA 4JAAA 4N43A 3VBSC 3PVOA 1H2NA 2WZR3 2ZMNA 3AKRA 3I2GA 1O4ZA 1W8UA 4XXAA 1REFA 4YVSB 1VALA 2PHXA 3VBFA 3CIHA 4YZ3A 5L19A 1NCQB 3F2ZA 4P00B 1D4M3 2HWE1 2VUDA 4CCCA 1DG6A 5FZ7A 5CZKA 1HB1A 3I8TA 1ZBA3 2RR13 5FY4A 1NXD1 2JD4A 1FPN2 3LZZA 2O1QA 3IDCB 3ZR6A 3I59A 4RR3A 4AI3A 4XFIA 1SDDB 1LOFC 5K0UA 3HBZA 1F5FA 2LS6A 2VULA 5FY1A 1QJY3 3K3OA 3UL2A 5A1LA 2DF7A 5C3QA 5IATA 1OVPA 4NHYA 4XETA 1QOOA 4QPGB 4R4XA 2GNBA 5C33A 3TYJA 2A3XA 1SBDA 3N9QA 3NRUA 5BXXA 4D69A 4QX5A 2YY1A 5FPAA 1OPOA 2Q8CA 3U11A 4LBQB 4XJAA 2HWB1 2XL9A 2AGSA 2V09A 2BOIA 2Y34A 5IK5A 1UF2C 2HJIA 1VJ2A 1F4HA 1GZWA 1KFUL 3PLQA 4JQTA 4OFGA 1DGRA 2CDOA 4BA6A 5I0UA 4N53B 1BBT1 2BNOA 3S5AA 1DLLA 3MPPG 3H3ZA 4NUBA 4DRVA 1JW6A 1H6XA 3L2HA 4PI0A 5H9QA 1PO13 5FZ3A 4YG6A 1TQ5A 1RGSA 2IUWA 4P9XA 4QQLA 3WDWA 4B29A 4QU2A 4G9SB 2A6ZA 2ZZQA 4YW1A 1VB2A 1MZ5A 2WQ4A 2WYFA 2ZGQA 5FDBA 5LRRA 4HT1T 3ZOIA 2HWD3 4AHXA 4COZA 1OC1A 3LA2A 2YUEA 4QT6A 3WLUA 1SLCA 3VB9A 4KH9A 3LPFA 1GQPA 4BMEA 4XFBA 3BUCA 4O9EA 1OH3A 1AR81 3AZYA 3QD6A 4LO7A 1NYWA 4YG3A 4CDQC 2K46A 3T2OA 1W8WA 4MXWB 4UW4A 5CFCA 2XONA 2Q0AA 4FPYA 3FHIB 3GJAA 4RS5A 3SKJE 3V65A 4CP9A 3KGLA 1VP6A 4ZZ8A 5T5LA 4CEYC 5BV6A 1SLIA 1W99A 4CE8A 5I91A 4IE5A 4LA3A 3V0AB 1CZSA 3POBA 3ZYPA 5FOJB 4L11A 1ZRCA 4NE9A 5D2AA 3ES1A 1PO22 1OURA 4PCRA 4LO4B 3FHQA 2XLGA 4JHZA 4MV2A 5EP9A 1VAMA 2JKBA 1B35A 4Q4W1 1MACA 5CU1A 1XE7A 3ZO0B 3POGA 3SNMA 5FR3A 1R083 1SQ4A 5FWEA 1BVVA 1JH5A 1WW4A 3VN4A 5CNAA 1X8EA 5JI9A 3E5XA 4MYEA 2D3RA 2GSYA 2ZHKA 2P2KA 4BU2A 1Y4WA 1L7LA 5DUVA 4BXFA 3BTZA 4A3XA 4NO4A 3ZMOA 4XAEA 4GWMA 1APNA 1TEIA 3IM0A 4XF3A 3HMYA 4LE3A 1GZCA 1K5MC 1O59A 2DCJA 4YPJA 1W39A 4AVCA 4J1XA 5CG8A 3MF6A 3G7DA 3UKTA 4CXYA 2HLEA 3SMHA 1FNYA 4ZKTB 1Y9GA 4DB5A 1X9TA 1EV13 2D44A 1UOBA 4YW2A 1W9WA 3POYA 5IK4A 2WS93 3L2YA 1H6YA 1UX7A 2ZGNA 3LE0A 1UOFA 4MX3A 1WGPA 4L99A 4TYSA 1COV1 2E6VA 4HXCA 1ULGA 1AR71 1HB4A 2J1UA 2SLIA 4Y5SA 2FZ2A 2BNNA 4QGLA 3FN9A 5ABJB 3SISA 1MEC2 5J37A 4N7UA 2XH6A 2YFUA 4XF1A 1VRBA 2JDUA 3W9AA 1LHNA 1WBFA 3D4KA 4CDUB 1W05A 4RHV3 1CIYA 1NY72 2WC2A 4JTOA 5TSWA 1LODA 3D3AA 3HOBA 3PIGA 2J1RA 4P9LA 4OHYA 2WNUC 3L9JT 4HANA 4XUOA 4OI0A 3IBMA 1AR61 4M3CA 3ZFFA 4WM8C 5FY8A 2ZBJA 4M4RA 2E26A 2FD8A 2EAKA 1LESA 3E5UA 3ZDVA 3D0JA 4I0BA 5DZFA 1S0GA 2HWE3 5BNPB 1HRV3 2IXCA 4Q4Y1 1GBGA 2A7AA 3E1F1 5A7QA 1HN0A 1L7RA 1PIV2 3LOIA 4AEKA 5IVFA 4I0AA 5LCWL 5FXVA 3POIA 4FPKA 3MFCA 3CJIA 3BPZA 3WP3A 3N9MA 5HI0A 1JU4A 3OJBA 5KXEA 1PMHX 4QDQA 2WYSA 1OD3A 1IZ3A 4RQPB 5F3IA 4IV1A 1RUOA 1WW7A 3IN9A 4Q27A 3VHPA 4OI4A 1QXRA 4FPOB 2OQ7A 5C5UA 4QX8A 2CWSA 4XJ8A 4Y4RA 2BWCA 4AOCA 2YROA 5I0DA 2Q8DA 2QQUA 2HWF2 2PHFA 3HT2A 4DFSA 1HLCA 4NWVA 5IFTA 2LW8A 4OHXA 4MADA 1CGPA 4XBNA 2EAAA 3P3PA 2ZGOA 2VL4A 3W5NA 2PMWB 1ZZCA 1UMHA 1PGL1 5KHGA 3OCPA 3O1OA 5J3UA 3M7AA 5DAXA 5C71A 2HEWF 4IERA 2WO1A 2FCVA 3FZ3A 3BYWA 4RGGA 1JZ3A 4COVA 1I6XA 1EAH1 4FI9A 2RS52 2X09A 1GR3A 1H2KA 4Q0SA 3WW3A 1UOGA 2N7GA 2HKXA 4QKBA 3JQWA 5AVPA 4CYDA 5FZ1A 1LKNA 4Y22A 3CNAA 4HBNA 4IDZA 2W68A 1V00A 4WVZA 1W8TA 2RJLA 2R49A 1RUH1 2VMFA 2VZ3A 1GKBA 3AZVA 1W6NA 4GJZA 4K20A 5FZOA 1UU5A 5JSOA 5JOYA 2VO5A 4CU8A 5LA2A 1YLLA 4QB1A 4D6QA 4M0HA 2GC2A 1HV1A 1W9TA 2R062 3MIHA 4XTMA 4SBVA 5I0SA 1D7PM 3HJRA 5F3EA 3JBG3 3CQOA 3ZFEB 3T30A 3UGFA 1POQA 3S30A 1H8TA 1YEWA 2AC1A 4KU8A 4BZ4A 1XJAA 2VTXJ 3NSTA 3WW2A 1LU1A 2ZAAA 4MLOA 5L9RA 5BUVA 2C24A 3BTAA 1RUD3 1W6MA 3M2MA 4N90A 3HNBM 3VBFC 2R071 3B01A 3WHUA 3DPRC 3VDAA 3CMGA 1YO8A 4AEJA 1RUNA 3NNMA 3N9NA 5AFBA 1PNGA 1MS0A 1LGCA 4Y4YA 1ZBE2 2AYHA 3M3OA 1BHGA 3GDBA 3GZTB 3OBRA 4YW7A 2D6MA 5A6QA 3QBQA 3SH5A 1RMU2 2PHLA 1V6OA 3D5OA 3ZIXA 2OPKA 4QHOA 1W04A 4LBMA 1KS4A 1C1LA 4XUTA 2DYCA 5CKNA 4N53C 1MS3A 5C5TA 1VMFA 3MLKA 5FP7A 4ZZ5A 5F37A 1PVXA 4JTNA 3WINE 5B2GB 1K45A 2JE8A 3MFAA 3RG0A 5D1IA 1IHMA 2E33A 2TNFA 1V0AA 2XBO1 4LIVA 5HXVA 2Y8KA 1OOPB 4GKXA 3ZYJB 4EJRA 1UY2A 1YI9A 2ZHLA 2OZJA 4FPCA 1GP5A 1KDMA 5A7PA 4BQYA 3SEPA 1R082 1SCRA 1DZRA 2QQWA 3P1IA 4MUVA 4YVWA 1BMV2 4AI9A 1WCDJ 1ASJ2 2TBVA 3WOGA 3WDVA 5IVEA 1W0PA 3HWJA 5LASA 4DXSA 1AJOA 1PVC3 3OEAA 2ZCWA 1AR93 3PVEA 4OI1A 3HAGA 3MEPA 2MNGA 4D3WA 2RDNA 3ZMNA 2V5DA 4Y20B 3VV1A 2YV8A 1R1A3 5KWRA 2C5DA 4K1YA 1HQWA 1RXFA 4XW3A 4INDA 2LTNA 3I2KA 1OD5A 2XJPA 4XHBA 3C7FA 1CQ9A 2PQQA 4IESA 5E88A 1J84A 4QXCA 4OI2A 2J42A 3LA7A 3Q8CA 3RMYA 2JKXA 4AVVA 5L7OB 1SFNA 1EPWA 2E53A 1CJPA 4RS5C 4AGVA 4F7ZA 4BISA 1XPWA 2Q5TA 4BJ0A 2VD7A 3TNPB 3NAPA 4LKSA 2JENA 5JUVA 2ENRA 1VBD1 4R9CA 1DFQA 2JDMA 2ZGRA 2EXHA 4GB33 4FQ4A 2A73B 1DQ0A 1Q43A 5C8WA 2QQPA 3FWEA 5IHRA 3AP5A 4XIKA 3GCWA 1WLCA 1YFWA 2R1DA 2ZXQA 5FXXA 3BN6A 3RZMA 2W94A 1SPPB 1RUG3 1AYM1 4K3UA 4XYXA 3Q9OA 4BIFA 1B35C 2WZPP 5KHKA 1JN2P 3KD4A 4I09A 4IGOA 4FQZA 1W6OB 4QXKA 4AYUA 1OKQA 2XWJB 3R05A 3WD5A 4K8FA 4HOOA 1YQCA 2ERFA 1FMD2 3IDBB 4DEVA 3RZGA 2VUCA 2DU0A 2XG3A 1KFXL 1SZBA 1AL0G 2K9ZA 2WA3A 4W6YA 5FIXA 3ZXFA 1OT5A 2D6LX 4A44A 5FZGA 4Q4X1 3JQXA 4OUMA 5KHHA 1NUKA 3OBZA 3NO8A 5FQ0A 5AFEA 3KS7A 5F2SA 1I5ZA 3M3EA 2WL1A 4CDWB 3PUSA 1VPHA 2HEYF 2ZJCA 2W5FA 1AVBA 3PUHA 5L9VA 1ZNPA 1VBE3 3LFIA 4PDWB 2FZ1A 4XOGA 4P08A 4AAXA 1LEDA 2OS2A 3ZFGA 3NKGA 2ET7A 5IVYA 3NV3A 4W6WA 3U75A 3FJSA 1LTEA 3IT8A 3ACGA 1DLCA 3ORJA 4PQ9A 1W2UA 1VBB1 3ROUA 3ON7A 1VLNA 1LGNA 2ID4A 3PNAA 5IWFA 5F1RA 2VW0A 1A8MA 1RHI1 2DBNA 2RM23 2VVEA 2P1BA 5LBBA 2HWB2 3VBSA 3IPVA 2VNRA 4AGRA 5AVAA 3G6JB 3O5SA 3K48A 4AWDA 2OUHA 5KXBA 2VU9A 4M0NA 5LZ6A 3I49A 1BBT2 4HLTA 4Y33A 3R6SA 2VOKA 1UMIA 3RRDA 3DECA 3EXUA 4GJYA 4CDXA 1MVQA 4LBJA 3SH4A 5LBCA 1W8ZA 5HXMA 5A3WA 2G1MA 1TMF1 3MIGA 4V1PA 3Q8BA 3ZXEA 4CCJA 5I0RA 1O5UA 2DCYA 1DZQA 2JG9C 3KMHA 3R0RA 1LOFA 4FPFA 3SCHA 1GOHA 3ZFFC 4LBKA 5JDBA 2XQRA 4DNYA 1G7YA 1W9SA 4AAPA 4DXRA 3WUCA 4YGBA 4UFLA 5CEHA 3MIEA 5ACA1 4OMDA 4OHZA 3WQ7A 4M00A 1AR82 3BPSA 3ZXDA 3ZXGA 2ZMKA 1OF3A 4X6QB 2D6OX 1DCSA 3RI9A 5F32A 2VQAA 2AEZA 3ZYIB 4RGAA 4AVAA 2FDHA 1XU1A 5DPNA 1A34A 1EUUA 2H0BA 4GULA 4QPIC 5FZMA 3MGUA 3WG3A 3I3MA 3NW4A 4ZU7A 5F5AA 1DQ2A 1JOPA 5A1AA 4URTA 1G8WA 5J36A 4M4PA 1U5ZA 5AC91 3WDTA 5I93A 2F4PA 4TZDA 2DVDA 2JECA 2WIIB 1U12A 1UN1A 1W2OA 2W08A 4PT6A 4WM7C 5FZ9A 1RJ8A 4UF0B 3FLTA 3FHAA 3Q8EA 3RJRA 1JYIA 5LWBA 1NA1B 4AFCA 4Q4W2 2NYYA 2PHDA 4ISQA 4PIXA 1JZ8A 3T0DA 2VBPA 1ULOA 4Q0PA 5A6XA 1H9PA 1V6KA 3AP6A 1CAWB 4PIYA 4D8MA 2RS11 1BJQA 3N9PA 5IJRA 2QKDA 1ZX5A 3O1VA 3ZR5A 1SG3A 4QKNA 5JXGA 2A6XA 3ASIA 4PI2A 1SFPA 1C5IA 1ND3B 2HYXA 4CDQA 3ZSJA 3ITQA 3RWNA 3GZAA 3VDCA 4R4ZA 2A6YA 2ZZJA 4IV3B 4Y5Z0 5A1FA 1RUE3 5GALA 3BODA 4YGDA 5GZFA 3OEBA 1AHSA 5EPAA 5DZGA 2C9KA 4GWNA 2OA2A 2GC0A 5T54A 5FZ4A 5A33A 2VGDA 3FLPA 4I02A 5BNOC 2AZ5A 2YB7A 1XYNA 1WMXA 2JWPA 5FUPA 1PK6C 4Q0QA 5HBAA 1WMDA 2GH2A 2K0GA 2WZR1 2DCTA 1SEFA 5G04L 4BIOA 4CU9A 1COV2 1MS4A 2AREA 3RYPA 3TEYA 1AR72 4WV8A 1D4M1 1DYPA 2ZEWA 4ES8A 1OUXA 1H8TC 1XSRA 2EF6A 2XOMA 3BU7A 2P5BA 4D0QA 5KC5A 3AJYA 3VD5A 1O8SA 1ZBA1 2RR11 4I3PA 2JG8C 1XB9A 4XDQA 4RFRB 1O91A 4JKKA 5FO8B 3MLJA 4YRDA 2AEYA 5FKCA 1PHMA 1DIWA 1QJY1 2W9XA 1XNTA 4AVTA 3W5MA 5IVCA 1K5MA 1W2TA 5CAZA 3ZN5A 1AR62 1YQ5A 2W52A 2PTMA 1ENQA 4LK6A 4EN0A 3J8F3 3M3QA 5C7GA 5F5QA 1JOJA 3FMGA 2UYAA 5EQUA 4XCAA 5FZEA 1SLTA 1P8JA 2J1VA 3DKQA 4W65A 1J58A 4JQRA 4Q4Y2 1AZDA 3AK0A 4NRQA 2NMNA 2X10A 1RUC1 3NL1A 4E4DX 5FPVA 3DCQA 3KLSA 3CLPA 1KJLA 3MO4A 2QQLA 4HN0A 4W6XA 4WZCA 5FYZA 4CXWA 5C9AB 4FFGA 4XTPA 1PO11 3NNFA 5CKQA 3OYWA 4HSJA 5F5IA 3A22A 3POWA 4FOYA 1CAXB 1CESA 2RDRA 4XVHA 3V0BB 2CGOA 1VBB3 2ARBA 3E6DA 3MPBA 3PJYA 4PHZA 4QDSA 4TN7A 5LBFA 2WNUA 1UKRA 1ZRRA 2KR2A 2PAEA 4LOTA 4YNIA 1AL23 3KB5A 2HWD1 4NAMA 4BMBA 1E5HA 3AYEA 2RS33 5H9SA 4WM8A 3CKHA 3AXDA 3FBMA 1GFF2 3ZXAC 1LOGA 1LR5A 1YFXA 3EQEA 4H55A 1PGL2 3INAA 4CSWA 1VIWB 4GMP0 4O61A 2NM1A 3USSA 4CCLA 2A3YA 4ZY9A 4HKLA 4DIQA 5C8CB 5HCAA 4U2AA 1W3XA 1TMF3 1FYUA 4AVBA 4L8QA 3RZLA 4MVTA 3TN93 1EAH2 1PGSA 1AJKA 1AYN1 3ELNA 1RITA 3OPWA 4CP1A 2PLV3 3T08A 1WA6X 2E51A 4HL0A 1W6PA 2YPDA 4CCNA 4NHMA 1QJU1 4QB6A 4R9DA 1WWYA 4LKEA 4HG6B 3USUA 1HXS1 1RUH2 1GNHA 1JHJA 4XUNA 3RGBA 1H2MA 5LEJA 3P6BA 1CPNA 4YFWA 5F5CA 2ZGPA 3WF4A 1LECA 4MH0E 5FMOS 1A6CA 1NLSA 2RG4A 4FXKB 4QQHA 4LUMA 3NVCA 5F3GA 1K5JA 3O1SA 3D6EA 4HPKA 4YM3A 2E63A 4OZXA 3U78A 4NPRA 2VJXA 5CB7A 1QEXA 3I4IA 4DO0A 3BU0A 3WNKA 2Z69A 3RVHA 5LBEA 3VBRC 1DQ6A 1CAUB 3WR0A 1LOEA 2V5YA 3LKJA 3MUZ1 3W59A 4B4QA 3OY8A 5FY7A 5LY2A 2ZX3A 4C8DA 1X82A 4QQ2A 2R072 2XMLA 4WVMB 5FPUA 3B7MA 1YC61 2OQ6A 1CVNA 4IEVA 5EJZB 2CV6A 3WQ1A 4CEWB 2VMCA 2VBDA 5D8AA 3UESA 2WS91 4AI8A 5IK8A 2G9GA 3ZVXA 2YG0A 3VKNA 3WF2A 4EROA 1VRH3 4IL7A 4GAZA 2WO7A 4E2SA 1UKGA 2W92A 4F83A 2VXJA 1W2NA 4QHZA 4Z92B 3ZYGA 1JMUB 3FBYA 2IXIA 4K9SA 1SLBA 1V6LA 5D21A 5JSPA 4YVSA 3U4XA 1DQ1A 1NCQA 3N7JA 3AFGA 3EHKA 4JZRA 4L0PA 2FCTA 4MHRA 3ST7A 3OOXA 4ZS3A 3CU7A 1Z7S1 1GNYA 4XZPA 3VBUC 3ZFGC 2VBBA 3U10A 4RHV1 3N7LA 3H3LA 4QKFA 2JJ6A 1MS5A 4URAA 3K2OA 3MIDA 1C28A 1ALYA 2XBO2 5A7OA 4LNVA 2XVKA 3ABZA 2WA4A 5BNNB 3KM5A 4P9YA 3DPRA 5IFPA 1VBC1 1TZOA 1RUF3 4UFHA 1HRV1 4EQVA 4CDXC 1CAVA 2X5IB 3J9SA 4IUGA 3ZYBA 1EP0A 5FPZA 1OQDA 3T1LA 5F6KA 1UIKA 3OGVA 5A80A 3SCGA 5FPBA 1BEV3 1UQXA 3DYMA 2R0FA 1N1VA 3UYJA 3VBHB 1ZRDA 1SFYA 4LBQA 3LB9A 1TG7A 2Z4FA 3ZYHA 1IS3A 4CPBD 5CA6A 3M8LA 2QJVA 5LA9A 3KT4A 1QNYA 4N53A 2DFBA 4IEOA 5FZHA 3NNGA 4QGNA 5IVBA 3VGIA 1VR3A 2JB4A 1CONA 1GWKA 2P37A 2X29A 3J7MA 2CDPA 3NNLA 4FFFA 4QPYA 2Q8OA 3SXWA 1EY2A 4PJYA 1SHWB 3POFA 4AQ2A 1SLAA 3LEKA 4CCMA 1RUC3 2WO3A 3M4FA 1JODA 5H9RA 3VD3A 1ENXA 4N43B 4COWA 5CBLA 4I2OA 1VBD2 5DZEA 1BYHA 3RYKA 1WA4A 3PHMA 4GWIA 3JD71 2ET1A 2WZEA 2GC3A 2K2SA 3OBAA 1ND3C 3H8RA 4N7IA 1GZ9A 1CZTA 4XUPA 4ASMB 4V2VA 2DFCA 4C1WA 1AYM2 1U5XA 2YBKA 3B93A 4LT5A 1QJX3 2EALA 5KXCA 4YM2A 3WDXA 4RR3B 1PX3A 5K0UB 3HQRA 1YJLA 2RE9A 4A42A 5FYCA 1GANA 3FUOA 3ZIWA 4E4HA 1WCKA 3V0AA 4XILA 2BVBA 4UBHA 1XBFA 2UY9A 5ANNA 4FCAA 4NR1A 4LBLA 3URFA 4U36A 1V6JA 3I2FA 5JXHA 1F15A 4Q4X2 5DN2A 1XNDA 4XE9A 4C0BA 4FAHA 2J7MA 2D3SA 1K42A 2MHFA 4JX0A 1AYN3 2B4KA 2GMPA 2P17A 2VMIA 3ILRA 3JBG1 4JGYC 3R4SA 2QTWB 1MQTC 4UBGA 3C2UA 3IZOA 4LHKA 4Q0UA 1X8MA 1UYPA 2VZTA 1QJU3 1GICA 3O12A 4HK8A 2E7AA 1QJFA 1LHWA 2DVGA 4Q1RA 3ACHA 1YQ8A 3U14A 1HXS3 4OZOA 2LRPA 1T6GC 2BU9A 3WQBA 2BERA 4NMIA 1VBB2 3A0KA 1RUD1 1Q8OA 1RB8G 1RHI2 1D2QA 1WMEA 1LHOA 1V9U3 2A75A 3GCXA 3APBA 3HN3A 4FVVA 4P5HA 3U07A 4DMIA 4BQ3A 2YYOA 3LOBA 2WNVB 4B7EA
chains in the Genus database with same CATH topology
1JYTA 1ZRIA 1JODA 1JOBA 1F35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYT A;  1ZRI A;  1JOD A;  1JOB A;  1F35 A; 
#chains in the Genus database with same CATH topology
 2Y6L A;  4NHX A;  2OT7 A;  4LJH A;  3RJ2 X;  1QJZ A;  1QH6 A;  4ARY A;  4D6S A;  2HH9 A;  2GNM A;  4QB2 A;  1AX2 A;  2JXA A;  4BK4 A;  5L36 A;  5A3T A;  4LXL A;  1TMF 2;  3S5Q A;  1ZRI A;  1JS9 A;  5B4X A;  4MZU A;  1CJD A;  5CFC B;  1PM4 A;  2B45 X;  2XJS A;  2BDR A;  2OUJ A;  4CP9 B;  3FFQ A;  2JDA A;  1GOF A;  3JU9 A;  2V72 A;  5J1X A;  4E8C A;  1BK1 A;  5DMY A;  5IT6 A;  5ACA 2;  2NN8 A;  4HVR A;  3LQC A;  4A2U A;  4AXO A;  3QOP A;  3AKT A;  4OYU A;  3WY6 A;  1O6U A;  5FP4 A;  1NAE A;  2DUP A;  3DUI A;  5KHJ A;  4UW6 A;  1ND2 C;  1SLL A;  4M01 A;  4H7M A;  1ZZ7 A;  4K40 A;  5EV7 A;  1QIQ A;  4L9B A;  1IPJ A;  1BQP A;  4LBN A;  4LO6 B;  5EHD A;  4C90 A;  3JXS A;  5CFD C;  1OLM A;  2PHW A;  1US3 A;  5T5O A;  4Z8B A;  3GBG A;  1DU3 D;  1Z7S 3;  3N36 A;  4DEQ A;  2VNO A;  2W46 A;  3A7Q A;  3ES4 A;  5BNP A;  1PVC 1;  1YFU A;  1JU3 A;  2A71 A;  3NKT A;  5AC9 2;  1AR9 1;  2JD9 A;  5JCT A;  4CPB A;  3VDD C;  2VZP A;  2JG9 A;  3KSC A;  4NVP A;  4PBO A;  4KWU A;  1JI6 A;  2BNM A;  4LHL A;  5FZC A;  1R1A 1;  3BOW A;  4L2N A;  1GV9 A;  4DXZ A;  2VOT A;  1LHV A;  1WD3 A;  3THP A;  2OYZ A;  4B4P A;  2P34 A;  2Y0O A;  4AED C;  1VBC 3;  2C6S A;  3DXU A;  1UZW A;  1QQP 3;  2RS1 2;  2A6V A;  2ZAH A;  1KIT A;  1S4C A;  4MGK E;  5F6L B;  4XFC A;  4GMP 3;  2CWM A;  4AVS A;  2Q1Z B;  4GKY A;  4JGZ C;  5I0T A;  4AQS A;  2XPJ A;  3GYD A;  4N9H A;  4GB3 1;  4TXW A;  1WZX A;  3WV6 A;  4QXH A;  3K51 A;  4QPI A;  1LOB A;  1YYN A;  3VLB B;  4FTB A;  2ATF A;  4FTS A;  2LRO A;  1AX0 A;  3WW4 A;  3Q8A A;  3HVD A;  1RUG 1;  1M06 G;  5FZA A;  3VD7 A;  5DDJ 1;  1CN1 A;  2ES3 A;  4CCO A;  4WM7 A;  2QQI A;  5JZG C;  4DUV A;  2Y0I A;  4IEZ A;  2ARX A;  4QMA A;  2HBT A;  2WZR 2;  3AP7 A;  3I3E A;  4Z07 A;  3DF0 A;  2G4I A;  4ATE A;  2D98 A;  3PU3 A;  2GDF A;  4MGQ A;  3VZJ A;  4MET A;  3PTR B;  4ES9 A;  1V70 A;  3PIJ A;  2WIN B;  2BW8 A;  3AJZ A;  4HN1 A;  5FLI A;  1D4M 2;  4M3C B;  2Y6F A;  4UWD A;  4DS0 A;  2FDF A;  1CD3 G;  1FI2 A;  1NZI A;  1H1I A;  2H6C A;  1JUH A;  3JD7 3;  1O4T A;  4ZXE A;  1LU2 A;  1OKO A;  1O5L A;  1ZBA 2;  4LEJ A;  4YM0 A;  2RR1 2;  5FZF A;  1H1A A;  5L73 A;  5C4W C;  4IGP A;  1Q8S A;  4XQW A;  3MI8 A;  5T5P A;  3SQO A;  3HNM A;  1QJY 2;  3ZXL A;  1V6M A;  2QZ3 A;  1AXK A;  1RUJ 3;  1VBE 1;  2I74 A;  2GU9 A;  3CJI B;  3O0W A;  4LO8 A;  5T3N A;  5HV4 A;  1O3Q A;  4EZH A;  2RMU 1;  3B02 A;  2BFU S;  2I07 B;  3VL9 A;  3ZFE A;  1F5J A;  4CCK A;  4EN8 B;  5D8A C;  4LE4 A;  4IV1 B;  4KBZ A;  4D7Y A;  2AH2 A;  4Y1Z A;  3WUD A;  4RL7 A;  4J1W A;  5BNO A;  5FZD A;  3I3B A;  2GN3 A;  2HWC 3;  2RM2 1;  5A7W A;  1PK6 A;  3E97 A;  1WUV A;  4D94 A;  2A1X A;  3AMH A;  3BGA A;  3KZ4 C;  2D43 A;  2VZS A;  4A6S A;  2D5H A;  4YVS C;  5BNN C;  5GKA C;  5JPN B;  1NCQ C;  2VCB A;  1W03 A;  3SKV A;  3AKQ A;  3ME2 A;  2OKX A;  5A3N A;  5A3P A;  1J3P A;  3P5B A;  4XZU G;  2EID A;  1LEN A;  1VB4 A;  5HCF A;  3THC A;  4YZ2 A;  1A78 A;  1DBN A;  1OVS A;  2JG8 A;  1PO1 2;  1FX5 A;  3ZN4 A;  3VBH C;  1Q8Q A;  3IDE A;  4ITC A;  1S0J A;  3M70 A;  4MO3 M;  5LA0 A;  2PA7 A;  2WWJ A;  4J6G A;  4QPG C;  4DXT A;  2MPF A;  2HWD 2;  2B9V A;  1SCS A;  3UT0 A;  1JZ7 A;  2P4E A;  3B69 A;  3OTF A;  3BKZ A;  1NE4 A;  2BWA A;  5G05 L;  3J4U H;  2FDG A;  3T09 A;  5APA A;  5IK7 A;  1W6N B;  3PTY A;  4B1L A;  4K21 A;  5FY0 A;  1YIF A;  4N8M A;  3VBO B;  1AYN 2;  2CYF A;  1QJE A;  3A4U A;  1QY4 A;  3OPZ A;  5FMD A;  1ZA4 A;  4Q26 A;  1QJU 2;  3K75 B;  1WW6 A;  5E89 A;  5F3C A;  2JEM A;  1QF3 A;  5FBJ A;  5A3U A;  4YW3 A;  5FWJ A;  4NIA A;  3KQR A;  5J7M A;  4CP2 A;  4P5Y A;  2IC1 A;  4Q2F A;  3LDB A;  2WFF 1;  4LIT A;  4XUR A;  3LA3 A;  4Y20 A;  1NLQ A;  1W6M B;  2XJQ A;  4NHL A;  1JYN A;  2B7Y A;  2B5H A;  2VR4 A;  4A4A A;  2DWR A;  3MBW A;  3RFR A;  4K6B A;  1QDC A;  2FMY A;  3J26 N;  2F6B A;  4QGM A;  4GXL A;  2VY0 A;  4O7X A;  4ZU5 A;  4B3N A;  2R04 3;  1DGW X;  1RUE 1;  1WMF A;  2DUQ A;  4XJ9 A;  4ZU4 A;  3AKP A;  3RZH A;  1DGL A;  1GNZ A;  4UW5 A;  5T55 A;  4X8N A;  3RZZ A;  1XE0 A;  3WT3 A;  2CNA A;  2XKP A;  2PAK A;  3PUI A;  1AXZ A;  2JB8 A;  1RTV A;  5FZ6 A;  2JE9 A;  4XHX A;  5FY5 A;  1EV1 2;  1E5I A;  3I2J A;  3K77 A;  3ATG A;  1OH4 A;  4AR2 A;  2WS9 2;  5JSR A;  2CAV A;  2WJS A;  1L7Q A;  1MZE A;  1OLR A;  1UU4 A;  2HEV F;  3I2H A;  4NHK A;  1LOC A;  4JV4 A;  5T52 A;  1OXC A;  3QAC A;  4IEQ A;  1QXJ A;  1W6O A;  3NV2 A;  1NLR A;  3BIE A;  4IEY A;  4OVE A;  4YW4 A;  5FPL A;  1R09 1;  2VC9 A;  5LK5 A;  2BBV A;  1MZ6 A;  5A32 B;  3MYX A;  4JHT A;  1R64 A;  2ZTN A;  1Y9Q A;  2P6H A;  2WSU A;  3ACI A;  4C1X A;  3PDQ A;  4YVW B;  1O3S A;  4RHV 2;  4Q4V 3;  1UZZ A;  2TEP A;  1XRU A;  2BEO A;  5DDJ 3;  3VBR A;  1CX4 A;  2WWS A;  1AX1 A;  1W8O A;  5CAD A;  3RZK A;  2ARC A;  3IB3 A;  3WDY A;  3J8F 1;  4CCE A;  1RUI 3;  1QNW A;  3N7K A;  4HMZ A;  4PDW A;  3BTY A;  1H9W A;  4LKD A;  4E4Z A;  4YM1 A;  1DGW A;  1VBC 2;  1RL3 A;  2HWE 2;  5FLJ A;  3WP5 A;  1UZY A;  1IOA A;  1HRV 2;  1NT0 A;  2BUK A;  4JDM A;  1VBA 3;  4OLL A;  1Y9M A;  4PF5 A;  4UOJ A;  1RJ7 A;  4QM8 A;  4XPV A;  4F8A A;  1Q5O A;  1FV3 A;  1Q8P A;  2LUW A;  3O1M A;  3LD8 A;  1WD4 A;  3AVS A;  5ABJ C;  4LK7 A;  3ZSE A;  3IMM A;  3NAP B;  1QH7 A;  3KCC A;  4OCT A;  4WVW A;  1LB2 A;  1TNR A;  2RMU 3;  3VBU A;  4CDU C;  5LY1 A;  4ZXK A;  4OQ9 A;  1LCL A;  2VZQ A;  3AZZ A;  5A7S A;  5J09 A;  1AL2 1;  1AXY A;  4V2W A;  3ENR A;  2QZ2 A;  2D7F A;  3SC7 X;  2RS3 1;  5FLH A;  5FYM A;  3KVA A;  4OUL A;  1FOD 3;  4BPZ A;  5LK7 B;  2O14 A;  4LOR A;  2BGC A;  3ZXK A;  4CVU A;  5ISL A;  1IGO A;  2BQP A;  2VH9 A;  1MS8 A;  2P6C A;  2VUJ A;  3AX4 A;  5BNP C;  1NCR B;  3P3N A;  3JD7 2;  3WP6 A;  3X29 B;  1VMH A;  3I54 A;  2BTV C;  2RHP A;  3IKW A;  1PO2 1;  2RJ2 A;  2W95 A;  3J7H A;  3TN9 1;  3LF7 A;  2BVV A;  1KS5 A;  3T3Y A;  2YC4 A;  5FQ0 B;  5FYI A;  1HRI 1;  2PLV 1;  5FK7 A;  4GIQ A;  3ETQ A;  3IAP A;  2VZO A;  1HN1 A;  1UY1 A;  1V6I A;  2YC2 A;  2XVL A;  1S2E A;  2ZX4 A;  3FE5 A;  4RQP C;  3WG2 A;  3OGR A;  2XWB B;  1X9P A;  3HIF A;  3I3Q A;  1NXM A;  1HB3 A;  2WT2 A;  4G4F A;  4I30 A;  1UIJ A;  1KD7 A;  3WNM A;  4WBB A;  1XNC A;  5C3S A;  4ZON A;  4UF0 A;  3SH3 A;  1W0O A;  3AMP A;  1IPK A;  1NA1 A;  3FUQ A;  3VL8 A;  3MV1 1;  5FYH A;  5CIR A;  3VBS B;  4L97 A;  1CAW A;  1LOA A;  3JBG 2;  2E7Q A;  4JRL A;  3B9I A;  1CR7 A;  1YHF A;  2MEV 3;  4Q5O A;  2GND A;  4ZPI A;  3S6P A;  1OA4 A;  3LEI A;  2YPJ A;  4IQP A;  2Q1F A;  4PLO A;  4QXB A;  2FQP A;  3O1U A;  2BPA 2;  1N1T A;  1ODM A;  2Q30 A;  1ND3 A;  3ZN6 B;  4XDO A;  2J1S A;  2UWA A;  2GZW A;  5FYU A;  2RDS A;  4NRM A;  4IV3 A;  2ZS6 B;  4B8E A;  3T2Q A;  1RUD 2;  1DQ4 A;  1OMI A;  2QQN A;  3R4U A;  1NX9 A;  2WFF 3;  5E8A A;  1I5P A;  1S2K A;  2OX0 A;  4Q8L A;  1FAY A;  2ZGK A;  3GBF A;  2HYK A;  5F8P A;  1S55 A;  1VRH 1;  5J96 B;  1FT9 A;  2WT1 A;  1EUT A;  4UFJ A;  4H7L A;  3B3Q E;  1TME 3;  3MW2 A;  2R0H A;  2EIG A;  1GQH A;  4SLI A;  5KBF A;  3I97 A;  1UCX A;  4JDN A;  4JDO A;  1N3O A;  5FP8 A;  4QX7 A;  3TOJ A;  3WXP A;  2CY6 A;  4HZF A;  1UO9 A;  1ZVF A;  2Z79 A;  4JGY A;  5JR2 A;  3ZFE C;  1MQT A;  2QUO A;  4DOU A;  1IQA A;  2WBK A;  3LDR A;  3F95 A;  4PBP A;  1UXX X;  2C26 A;  4Q0V A;  1H4G A;  2QCS B;  3H1Y A;  3LDK A;  3RSJ A;  1UY4 A;  4DUX A;  2VEC A;  1S0D A;  1C57 A;  4XF9 A;  3OB8 A;  5JIU A;  1I3H A;  1FPN 3;  2E7T A;  5SV5 A;  1WKY A;  5GJ6 A;  1GP4 A;  1W9F A;  1WW5 A;  1QHD A;  1RUF 1;  2BGO A;  1R09 3;  1O8P A;  3GJB A;  2BV4 A;  2QQJ A;  3I2I A;  4DPN A;  5IYY A;  1BEV 1;  1TE1 B;  2A6W A;  3JB8 A;  4KI5 M;  4XAB A;  1PVC 2;  2ZAB A;  2WAA A;  4XQD A;  1AR9 2;  3DYP A;  4Q1P A;  4CDQ B;  4I3G A;  1OQE A;  3GBW A;  1R1A 2;  4FT8 A;  4K7J A;  1UYY A;  2O8Q A;  5GLW A;  3AYC A;  4AFD A;  4XCB A;  2JDN A;  4QX2 A;  5IAX A;  4CEY B;  5LRS A;  3H8X A;  5H9P A;  4RYD A;  2XJU A;  3LIH A;  4D6R A;  1FNZ A;  1CAX A;  3KF5 A;  4QAW A;  3V0B A;  1OOP C;  4GH4 B;  5FYB A;  3UGG A;  1YXW A;  1ND2 A;  4LBQ D;  4EN9 B;  5FV3 A;  5M0T A;  3UJO A;  3H1W A;  4KG0 A;  1ULE A;  2W87 A;  3DV8 A;  3CZJ A;  3H42 B;  1OSG A;  4GB3 2;  1W6Q B;  1PGW 1;  5CFD A;  2YXS A;  4DY3 A;  2D93 A;  5DG2 A;  3O1R A;  3LEG A;  1RUG 2;  4UXA A;  1UOJ A;  1MZF A;  1QJX 1;  4AG4 A;  5FKB A;  1F2N A;  3VDD A;  4CUA A;  4L92 A;  4NRO A;  5K9Y A;  3HN1 A;  3C7E A;  1XNB A;  2AAC A;  1K5M B;  1REE A;  3ETP A;  1WLW A;  2YU1 A;  2DV9 A;  4AED A;  4UAP A;  1KDK A;  1YQ2 A;  2PN5 A;  4A7K A;  1N47 A;  1W90 A;  4BQ5 A;  1NOV A;  1PNF A;  2VAU A;  3K46 A;  4MGI E;  5L7O C;  3WCR A;  1Q3E A;  2W3J A;  3RS6 A;  3SLI A;  1PO2 3;  1MS9 A;  1ENR A;  2XXZ A;  5F2W A;  4E4S A;  4AQT A;  1SDW A;  2ARA A;  4JGZ A;  3B00 A;  4P9J A;  3VKM A;  1KRI A;  1HRI 3;  2Z42 A;  4Y1V A;  3AFK A;  4WZF A;  1VBE 2;  2A70 A;  1Q8V A;  3WQ0 A;  4AW7 A;  2GC1 A;  1LGB A;  2UYB A;  3KV9 A;  1UPS A;  1XYO A;  3ECQ A;  4XJU A;  5E1R A;  2QQK A;  1C8M 1;  4QQO A;  1JBC A;  3KGZ A;  5F7U A;  4NIG A;  1IKQ A;  1CAU A;  3OYW B;  4CA9 A;  2FHR A;  1RXG A;  2RM2 2;  3LGR A;  5JZG A;  1V9U 1;  1MR5 A;  4Z2A A;  4LOS A;  3VKL A;  1W9Y A;  2WNU B;  2I45 A;  3T4H B;  1QWR A;  1YUD A;  3WNX A;  5LEK A;  2ETE A;  3S7I A;  3WCS A;  3U1X A;  3JUU A;  1U5Y A;  1HIX A;  3DL3 A;  4RA0 A;  4AFM A;  4YAR A;  4WM8 B;  4CEW A;  2HBU A;  1NE6 A;  4Y26 A;  1H4H A;  2YMZ A;  2VOX A;  4Y1X A;  1N3P A;  2IZW A;  1G9C A;  2VCC A;  3C7O A;  5C4W A;  4XAA A;  3VZK A;  4B7K A;  1YNA A;  3N4M A;  2ORX A;  2ZHM A;  3HEI A;  4MOA A;  1U5I A;  4BK5 A;  5GLV A;  4EZ4 A;  3T0B A;  4CDW C;  4H3W A;  4IET A;  5DAW A;  5DXD A;  2XVG A;  2CL2 A;  4PDW C;  1OBN A;  5FMB A;  2XQX A;  1CIW A;  4C91 A;  3S0M A;  4XMA A;  2UUR A;  3GNE A;  4MGY E;  1W6P B;  2XUM A;  1ZZ8 A;  1HJG A;  2XR4 A;  3V56 A;  3VD9 A;  5A3O A;  5EJ3 A;  2WLP A;  3ZSK A;  1QOS A;  4BWO A;  4BQ4 A;  2C0Z A;  4NAO A;  1JUI A;  4RSU A;  5HCB A;  5J98 B;  3RQ0 A;  4EWA A;  5FO7 B;  4D7S A;  4DZG A;  4M3C E;  4TLF A;  4GA9 A;  1LEM A;  5BNN A;  2EIB A;  1ULC A;  2NLR A;  3LEM A;  1UZ0 A;  5FP3 A;  2W91 A;  5EYX A;  3PUA A;  2X5I A;  2A3W A;  3UNP A;  5JIA A;  2YZ4 A;  3VBH A;  1S0F A;  2XDV A;  3C8X A;  1PIV 3;  1JYV A;  2DBI A;  1JHN A;  3HBK A;  4CP0 A;  3OD4 A;  5IVV A;  3BVC A;  3KT1 A;  1JZ5 A;  1S1A A;  3A23 A;  4XDP A;  2WT0 A;  2L9L A;  4BB3 A;  4CU7 A;  2UWC A;  3POS A;  4IEX A;  4QPG A;  3SEE A;  2WFF 2;  2FMD A;  2LAL A;  3OY8 B;  4Q29 A;  5I8T A;  3OSD A;  1QQP 1;  3PVN A;  3III A;  2WO2 A;  4EYU A;  4CCD A;  2CGP A;  4BLJ A;  2PEL A;  2VMD A;  5SV8 A;  4Z82 A;  3PUR A;  2GAU A;  4HKO A;  4XIO A;  2NZ9 A;  4GMP 1;  4HVO A;  5A70 A;  2ZGS A;  5FJK A;  1RUE 2;  1S0B A;  1CZV A;  3ZKU A;  2G9F A;  3DKW A;  3QH6 A;  1XC6 A;  4RD7 A;  5ANQ A;  1GOG A;  2F4L A;  2ILM A;  1Z78 A;  2SBA A;  3IWZ A;  4JRA A;  4YG0 A;  3W20 A;  1VMJ A;  1FMD 1;  2CAU A;  3POE A;  2WFP A;  1X7N A;  2Y6H A;  1OF4 A;  1XSQ A;  2WZ8 A;  3TRS B;  1KQR A;  1PMI A;  4COY A;  3NJV A;  3SHR A;  1G9B A;  2D5F A;  3AP9 A;  4BQ1 A;  1NA1 C;  1W8F A;  1QDO A;  2VZR A;  3RDI A;  1SAC A;  2GMM A;  4QQP A;  2RS5 3;  3H7J A;  5I8Y A;  1OFN A;  4NIH A;  2EVX A;  2OXB A;  1DQ5 A;  1R09 2;  1JTZ X;  2WKK A;  1IKP A;  2YBP A;  3VBF B;  3DPR B;  1PM7 A;  2NQY A;  4QU1 A;  1OQ1 A;  1UPI A;  2VQT A;  3VHR A;  3IAQ A;  1CAV B;  1PX4 A;  4MXW A;  2ZGU A;  1KXG A;  3ILN A;  2WAO A;  4IV3 C;  1E5R A;  2H6B A;  1MS1 A;  4QX3 A;  4QX0 A;  4UFM A;  3KV5 A;  1RUJ 1;  3I59 B;  3Q8F A;  4HET A;  2DCK A;  2R06 3;  3JB4 C;  3J8F 2;  4EWE A;  3DXT A;  3HNY M;  1CX1 A;  1RVF 1;  2QE3 A;  2NMO A;  5DQ0 A;  4FP2 A;  2HWC 1;  2DVA A;  3MV0 1;  3EBR A;  4P9W A;  3AMQ A;  1JYT A;  5FZL A;  2ZKN A;  4AI2 A;  2PQS A;  3RI8 A;  1ZRE A;  4YW6 A;  5EZW A;  2VCM A;  3H7Y A;  5FYY A;  1ZM1 A;  2RJK A;  2ZA9 A;  1GZW B;  4UI9 L;  5K4L A;  3PUQ A;  3BOP A;  2WNV A;  1UY3 A;  1BZW A;  4S2H A;  1ENS A;  3HQX A;  4BM8 A;  1CPM A;  2VZ1 A;  4HKW A;  2VNG A;  1C8M 3;  3J7N A;  4FPJ A;  1I9R A;  4QWN A;  1ZBE 3;  1BCX A;  2VE1 A;  4P9G A;  2Q8E A;  1C5H A;  3UJQ A;  2H0V A;  1WCS A;  1ST8 A;  4AZZ A;  4DUW A;  1AL2 2;  1RMU 3;  2GME A;  1G6N A;  2YFZ A;  3ZSM A;  1JYX A;  2RS3 2;  1UD1 A;  2WQ8 A;  1BXH A;  1WBL A;  2D97 A;  2ZGM A;  1NZC A;  2YHJ A;  3N9L A;  2FCU A;  3IIA A;  3TEW A;  4BHP A;  3IMN A;  3AZX A;  4A41 A;  1W06 A;  4GH4 C;  3RNS A;  4E2G A;  3TN9 2;  3EYP A;  4HK9 A;  4JCK A;  2ZX1 A;  1L3J A;  4RS5 B;  4C0H A;  1HRI 2;  2PLV 2;  4E27 A;  5ABJ A;  4AHY A;  2V4V A;  1NQJ A;  3DN7 A;  1W2A X;  5C70 A;  3O1T A;  5C9A C;  2GP3 A;  2B8M A;  4CDU A;  1I1E A;  3WSO A;  3NV1 A;  3TBD A;  2XJV A;  1ASJ 3;  5FTT C;  5JVV A;  4PLN A;  1J83 A;  4XC9 A;  2WWU A;  1GWL A;  2V73 A;  2WN3 A;  3H50 A;  4KU7 A;  5EWS A;  4HFS A;  1O4Y A;  4FTE A;  1QMJ A;  2DDU A;  4MGT A;  3DYO A;  1DYK A;  2AEN A;  2ZGT A;  4QPW A;  5E6H A;  4COU A;  3V64 A;  1B35 B;  1WLD A;  3C7H A;  3E5Q A;  1G86 A;  3PVB B;  3FFZ A;  2EA7 A;  2VVD A;  4BQ2 A;  2WR9 A;  2TUN A;  4A6O A;  4KL1 A;  2JIC A;  3ZDS A;  5JOZ A;  3UET A;  5JR7 B;  3B5L B;  1ZZB A;  4F3J A;  4IEU A;  4YSF A;  3TEZ A;  1JXN A;  4LA2 A;  3WW1 A;  5C8C C;  1TVG A;  1GU3 A;  2J1T A;  2O0O A;  2R04 1;  4W8J A;  4AFA A;  5CKM A;  1YWK A;  3TNQ A;  3U0Z A;  5FK8 A;  1QGL A;  2IVJ A;  4NPL A;  2WN2 A;  4JKL A;  1D0G A;  4QHB A;  4GZ9 A;  4MXV A;  4NID A;  2W39 A;  4R9B A;  3CJX A;  2W0X A;  2VPV A;  3BIW E;  3IDA A;  4XQ4 A;  4RQP A;  1STM A;  1IQD C;  3H0O A;  4XEZ A;  5FXZ A;  4MSV A;  5JMC A;  4MGZ E;  3CL1 A;  1N3Q A;  1F8V A;  5HCH A;  4MHU A;  5DUU A;  1SBF A;  3K4D A;  1VRH 2;  3OF1 A;  4KGG A;  3U37 A;  5I8S A;  4EN6 B;  4AE2 A;  3MIC A;  3THT A;  3SCF A;  4Q8K A;  2VW2 A;  4ONU A;  4R8H A;  4ZS2 A;  1MPX A;  1ZZ6 A;  4IEP A;  4O65 A;  3VZL A;  5GLU A;  2W47 A;  2XKO A;  2ORZ A;  1GWM A;  2WDB A;  2DUR A;  2WAB A;  4EWD A;  1K12 A;  3NQH A;  3NWK A;  1IG0 A;  4S2F A;  2VZU A;  4P14 A;  4AL9 A;  1ODN A;  4XUQ A;  2C4X A;  2X05 A;  2V4A A;  1A3K A;  1FMD 3;  4Q4V 1;  2G19 A;  1G9A A;  1BK0 A;  3UV9 A;  5A3M A;  1RC6 A;  5FUI A;  5FBZ A;  1V6N A;  2W2I A;  1RUI 1;  5K7P A;  2JG9 B;  2GN7 A;  3M3I A;  4YZ4 A;  3BAL A;  4FP3 A;  2KD7 A;  2VUA A;  4GD4 A;  5JOW A;  1IPS A;  3ZFF B;  1RUF 2;  4CEW C;  1OPM A;  3UGH A;  1VBA 1;  1J3R A;  5FZ0 A;  5EIY B;  3N7M A;  4W50 A;  3ZLI A;  1UZV A;  1A8D A;  1BEV 2;  2WNE A;  3N9O A;  3ZX7 A;  4FAG A;  3FX3 A;  4A45 A;  2PYT A;  4A7Z A;  4XF0 A;  4TWT A;  4AHZ A;  1XXN A;  2BP6 A;  2FDK A;  3D8C A;  1JZ6 A;  4BCU A;  4X8P A;  2VCA A;  3WDU A;  2HWB 3;  2R16 A;  4GQ7 A;  5JOX A;  2R7E B;  2WUH A;  1RIR A;  3CHX A;  1TNF A;  4RN5 A;  4LLF A;  3VZM A;  3W58 A;  1C4R A;  2FBE A;  3AYD A;  4QPI B;  1RVF 3;  1WCU A;  1GSL A;  1BBT 3;  2BYV E;  2J22 A;  3CDZ B;  3J7L A;  3RWK X;  2JDK A;  2OII A;  4FPG A;  3S57 A;  2OW4 A;  2OZ6 A;  3PU8 A;  1BVP 1;  3EB7 A;  5FYV A;  4NRP A;  3WNL A;  4YZ1 A;  2XGX A;  1W8H A;  4TLG A;  1RUC 2;  3MZH A;  4FFH A;  1FOD 1;  2X53 S;  4WM7 B;  4XFH A;  2ZEX A;  5HV0 A;  4QDR A;  2Q1M A;  2BFU L;  1OUS A;  5F9T A;  2QDR A;  2QNK A;  1F35 A;  4LMF A;  3W21 A;  4E8D A;  2JDP A;  2X5I C;  4I01 A;  5JMO A;  1PGW 2;  3NJY A;  4UT5 A;  3AM2 A;  1VAV A;  2ZEZ A;  3VZN A;  4XBL A;  4G3Y C;  3B9C A;  3NNJ A;  2OPW A;  2ADE A;  2DCZ A;  4D7T A;  3TB0 A;  1IS6 A;  2DVB A;  4XJZ A;  1AR8 3;  5FP9 A;  3AYA A;  1DP0 A;  1QJX 2;  3WG4 A;  3ACL A;  4GWJ A;  2Z5W A;  1S0E A;  2VG9 A;  2LM3 A;  1UU6 A;  3HPN A;  3OGS A;  4I0W B;  4N9I A;  3VBO A;  2AUY A;  3H8U A;  4ASL A;  4BE3 A;  5JPM B;  3PL0 A;  1ULD A;  3I2O A;  4Y22 B;  1JOB A;  2VTF A;  4XFA A;  1NKG A;  4Y3O A;  3OGJ A;  1J1T A;  3K4A A;  1W0N A;  4H14 A;  3CO2 A;  3OPT A;  2ZX0 A;  5FZO B;  2D3P A;  3KWV A;  1OOP A;  4JC1 A;  5BNO B;  2GH8 A;  1C8N A;  5CG9 A;  1FXZ A;  4UW3 A;  1IG3 A;  3KV6 A;  1RIN A;  5LB6 A;  1PK6 B;  4LHS A;  1J3Q A;  4N43 C;  5A7W B;  5FPX A;  1DDL A;  2QFE A;  3CF6 E;  3N35 A;  2MEV 1;  4Q4W 3;  4CUB A;  5FOB B;  1G9F A;  2ZPX A;  2IXJ A;  1LUL A;  3UKN A;  4AK3 A;  3E6B A;  5IVJ A;  4YLZ A;  5FFO C;  4QD2 A;  4BDV B;  1IS5 A;  1UXZ A;  1H8T B;  1HXS 2;  4ISR A;  1C8M 2;  5GM0 A;  3ZPO A;  4IW3 A;  4A3Z A;  3M3C A;  5FY9 A;  2JG8 B;  5GZC A;  3H1M A;  4RR3 C;  1V9U 2;  5K0U C;  4FPE A;  2DTW A;  3WF3 A;  2D6P A;  5E16 A;  1N1S A;  3NMB A;  1XU2 A;  2ZHN A;  5JAX A;  4DRR A;  4KWL A;  3VKF C;  2QQO A;  1H1M A;  2DUO A;  3CZU A;  1TME 1;  4LPL A;  1F31 A;  4UFI A;  3WX5 A;  5L7O A;  3O1P A;  3DGT A;  3EJK A;  5JXI A;  2I2S A;  3AB0 A;  1Y3T A;  3MLL A;  2NPI A;  3KCY A;  3I3D A;  1KJR A;  5KHI A;  2IXL A;  2ZEY A;  3VDB A;  2YC0 A;  4Y5T A;  5FXW A;  1COV 3;  4Y1U A;  5A32 A;  2D6N A;  2EXK A;  1AR7 3;  4HVQ A;  3FLR A;  3H9A A;  3WNP A;  1U0A A;  4QKD A;  3HQU A;  2XL7 A;  1D2S A;  2VOW A;  4KWJ A;  4OMC A;  2OVU A;  1SPP A;  1WCQ A;  1YCI A;  3HD8 B;  4AEM A;  2XJT A;  2X8K A;  1FPN 1;  1RED A;  2ZOE B;  2J1E A;  2ZAC A;  1ULF A;  4LUK A;  5T5J A;  3EMR A;  2EXJ A;  4B4R A;  1UL9 A;  3AC0 A;  1PZ7 A;  2GNT A;  2WNV C;  2FDJ A;  1UNB A;  1QU0 A;  2E32 A;  5ERL A;  1AR6 3;  2VXR A;  4O9G A;  3AL5 A;  1DGR N;  4XJW A;  5A3L A;  1OI6 A;  1JZ2 A;  4R52 A;  5JLV A;  1R1Z A;  1Z7S 2;  2C9A A;  1G9D A;  4LQR A;  4OUE A;  3PJQ A;  4KNC A;  4IE6 A;  2VNV A;  1UAI A;  4LIU A;  4LKF A;  3T1M A;  5CFC C;  4Q4Y 3;  3AVR A;  1GQG A;  1HKD A;  4CDW A;  1C3H A;  1GYK A;  2BJS A;  3ZYF A;  4EE2 A;  2BGP A;  3AMN A;  1O7F A;  4PQQ A;  1H0B A;  1XQN A;  1J59 A;  2DTY A;  1S0I A;  3HR9 A;  4XF4 A;  4FSJ A;  2P3K A;  4LTA A;  1QQP 2;  2PAM A;  2VMG A;  1PZ9 A;  5EXO A;  2YDE A;  4FFI A;  1GZT A;  3OUI A;  4XFF A;  1OLQ A;  1KGY A;  2WLQ A;  3T4V A;  3E6C C;  1GMM A;  3R4D B;  5A6Z A;  5C3R A;  1W28 A;  2P3Y A;  2GP5 A;  3VKO A;  2Y6J A;  2E31 A;  2JDY A;  1X50 A;  4LO5 B;  3K3N A;  2ZX2 A;  4KGQ A;  2VME A;  4KMQ A;  1OA2 A;  5FO9 B;  4XAC A;  5EJ1 B;  1EPZ A;  3ALQ A;  3LFM A;  3RZJ A;  2R6Q A;  4YYO A;  1VAK A;  5DAQ A;  3BI3 A;  2AR6 A;  3N3H A;  4YW5 A;  5T50 A;  1NCR A;  4NOT A;  3OUJ A;  5LAT A;  3UKV A;  2VMH A;  5FYS A;  3WP4 A;  3S7E A;  2C1F A;  5C3P A;  1POV 0;  3VBR B;  2PFW A;  1UYX A;  2XHN A;  3ZSL A;  1EAH 3;  2ADD A;  2CGN A;  2VM9 A;  4KBB A;  1H30 A;  1EYB A;  5DG1 A;  4XFG A;  3RMX A;  3WHT A;  5BY5 A;  2CTV A;  2EIE A;  1YQ6 A;  2VQU A;  3AZW A;  4FPL A;  4ET7 A;  5B4N A;  3ZXJ A;  3O14 A;  2UWB A;  5FZI A;  2KA3 A;  4IE7 A;  4YWA A;  1RUH 3;  1ULP A;  2XLA A;  3O0X A;  3MDP A;  3NJZ A;  2BRT A;  2Y64 A;  2DVF A;  4FOV A;  5DAB A;  4BXS V;  1X36 A;  1K3I A;  1UY0 A;  2B9U A;  1DHK B;  1RUJ 2;  3MW3 A;  1O3T A;  1E57 A;  4Y24 A;  1LHU A;  4E9K A;  3GAL A;  4X6R B;  1ACC A;  1XNA A;  1RVF 2;  3MUY 1;  1ONA A;  3BB6 A;  3MIB A;  5IAV A;  3GGL A;  3ZFG B;  3VBU B;  2HWC 2;  3ZN6 A;  3AP4 A;  3TWI A;  2WRA A;  2UY8 A;  4DIN B;  3FL7 A;  2ZML A;  2ZGL A;  3AL6 A;  3VHN A;  1URX A;  2XUE A;  4GAL A;  3IPV B;  1H8V A;  3C3V A;  3B94 A;  4KG8 A;  4J25 A;  5BYN A;  2JDZ A;  1HQL A;  2KXL A;  2R07 3;  1ZZ9 A;  4FBF A;  1XNK A;  4IE0 A;  5DUW A;  3KHC A;  1E5S A;  4CUG A;  4CDX B;  2R1B A;  3THD A;  2IFR A;  2B39 A;  4M3C F;  5LW9 A;  3EO6 A;  1GLH A;  3QLQ A;  3KQ4 B;  2GAL A;  5FAX A;  1FAT A;  2G9Z A;  1XE8 A;  2VTX A;  3CJI C;  4K1Z A;  3D0S A;  1PMJ X;  3KVB A;  1LJ7 A;  2IVI B;  4UYB A;  1JZ4 A;  1PZ8 A;  1MEC 1;  1QXP A;  5FZK A;  5FCC A;  4IV1 C;  5FRA A;  1UWW A;  4AI0 A;  1BLZ A;  3AMM A;  3GF6 A;  3WF1 A;  3A21 A;  1NY7 1;  3KF3 A;  5A7N A;  2B42 B;  4BH9 A;  5HPO A;  3LSE A;  5BPX A;  2XB6 C;  5JWP A;  3MF9 A;  1BKZ A;  2A5Z A;  2Y60 A;  2BZD A;  1HQN A;  1Z0H A;  5GLZ A;  1JYW A;  4FPH A;  2XBO 3;  3QH7 A;  1D4V B;  3WNO A;  4KWK A;  3VUO A;  1WLT A;  1OHF A;  2J1A A;  1OFS A;  3BCW A;  4BQW A;  4ZHN A;  1YFY A;  4H2A A;  3MW4 A;  2QBX A;  1PIV 1;  1ZA7 A;  1SBE A;  5IW0 A;  1X33 A;  3KCX A;  2Y6G A;  2JDH A;  2EXI A;  3OUH A;  4LBO A;  5KXD A;  2R32 A;  4Y1Y A;  3NJX A;  1POV 1;  4XXP A;  1LNS A;  3I7D A;  4P02 B;  5DAP A;  1UYZ A;  1YRZ A;  2W1U A;  4OHV A;  4TSV A;  4CU6 A;  3ZKY A;  4YGE A;  3KV4 A;  4CEY A;  4MG2 A;  3AKS A;  2XLF A;  4KQ7 A;  2PXJ A;  3MIF A;  2HWF 1;  2IFW A;  2ZKL A;  1S2B A;  2R04 2;  4GH4 A;  5J48 A;  1IS4 A;  3HT1 A;  2XJR A;  4TTG A;  1CWP A;  3VBO C;  1N1Y A;  3QCW A;  2VZV A;  4PF1 A;  3OD0 A;  3LSD A;  1W6Q A;  2QVS B;  5A6Y A;  4JGY B;  4IXL A;  1VBD 3;  1QOT A;  5C9A A;  2KM2 A;  1MQT B;  4IGQ A;  1HV0 A;  2JX9 A;  3C7G A;  4K8R B;  2YGL A;  4HON A;  1F9K A;  1Y7B A;  3GHN A;  5C3O A;  4DY5 A;  5A33 B;  4FO9 A;  4NN0 A;  3JCI A;  2JIG A;  2W1W A;  5GLT A;  3TAY A;  3WG1 A;  1B09 A;  4B1M A;  2WNO A;  4ARX A;  3VD4 A;  4AHW A;  2RS5 1;  1XYP A;  2F17 A;  2JIJ A;  3VHO A;  1AYM 3;  1AF9 A;  1JYC A;  3ZM8 A;  1HW5 A;  4DQA A;  2PHT A;  2RV9 A;  4P9I A;  4E2Q A;  4CRQ A;  5CVR A;  2XHK A;  4FOQ A;  5JI7 A;  3GHM A;  2E9Q A;  3WNN A;  5CYY A;  5C6C A;  2JE7 A;  5DAV A;  4Q4V 2;  3OGG A;  1XOY A;  5C8C A;  1VE0 A;  5DDJ 2;  2YU2 A;  1HX6 A;  4ASK A;  5JXJ A;  2RDQ A;  3NV4 A;  4QM9 A;  4NII A;  2RVA A;  3T2P A;  5F39 A;  4Q4X 3;  3RYR A;  4S2D A;  4NWW A;  2O8O A;  2R06 1;  3WVJ A;  1W3V A;  3PME A;  1RUI 2;  3T0A A;  4OQ8 A;  4IE4 A;  1DZT A;  5IUQ A;  1T2X A;  2R30 A;  3H3U A;  4NPM A;  1H2L A;  1VBA 2;  5EYY A;  2IWG B;  3LPG A;  3KHB A;  1W8N A;  4FOW A;  5FRE A;  5FYT A;  1NG0 A;  2QQM A;  1F4A A;  3T2T A;  1RYY A;  4LR4 A;  3O0V A;  1RHI 3;  1ND2 B;  1T6B X;  4WVV A;  4EN7 B;  2B46 X;  1UMZ A;  2YGM A;  3UK9 A;  2RMU 2;  1AUY A;  2W1S A;  3LAG A;  4PLM A;  2CHH A;  2P3J A;  4YVW C;  1GUI A;  3GZU C;  2IXH A;  5CFD B;  4Z1V A;  1ZBE 1;  3M1H A;  4AF9 A;  3GM8 A;  1HB2 A;  4BLI A;  2PHU A;  3A0N A;  2DU1 A;  3ZPY A;  4BYY A;  2W1Q A;  4UFK A;  3ILF A;  1RMU 1;  3DEM A;  4JVA A;  1M4W A;  2FDI A;  4LLO A;  5KR7 A;  3VDD B;  3TEX A;  1FOD 2;  1ZYB A;  3GZE A;  4YGC A;  4WVM A;  1HDK A;  3AXE A;  3CEW A;  1DYO A;  4LUL A;  2D6K A;  4CZS A;  4CUC A;  4HSL A;  1OA3 A;  1ZRF A;  1FV2 A;  2Y33 A;  4AED B;  4A7Y A;  5ACA 3;  2VW1 A;  1UX6 A;  2QDN A;  4JKM A;  5FMO L;  1HJF A;  1KEX A;  2QQV A;  3GXU A;  4OUS A;  2P3I A;  4YFZ A;  1C1F A;  2BBA A;  2NP0 A;  4QX1 A;  4RFT 0;  3NAP C;  3LIG A;  1OLM E;  4JGZ B;  1R08 1;  1J1L A;  4BQX A;  4EV0 A;  5DUX A;  5FUN A;  4AQ6 A;  3OG2 A;  5CIS A;  1MEC 3;  1BMV 1;  2WQZ C;  5GZE A;  3ACF A;  1ASJ 1;  3WEZ A;  4IEW A;  1MVE A;  2YBS A;  3PMS A;  3USU B;  2IXK A;  4CTE A;  5EFU A;  3WZ1 A;  3OBT A;  4AFB A;  5AC9 3;  1Y43 B;  5KC6 A;  4RGK A;  3FC0 A;  4XMI A;  3VZO A;  2Y26 A;  1DF0 A;  1YIP A;  3I2D A;  5BNQ A;  4YZ5 A;  3MHZ A;  5LA1 A;  1O3R A;  5JZG B;  1YI7 A;  4AI1 A;  1LAJ A;  1S0C A;  5FZB A;  1D0H A;  3ZYR A;  1QKQ A;  2D40 A;  2MEV 2;  5FMC A;  2PHR A;  1US2 A;  1NCR C;  4HPK B;  1GP6 A;  2WSV A;  3POJ A;  3U4S A;  4ATF A;  5L9B A;  1EV1 1;  1SMV A;  2RS1 3;  1NQD A;  2UU8 A;  4LHN A;  3SIT A;  4BOW A;  3H8O A;  5FZ8 A;  4FXG B;  3O7O A;  2VVF A;  2Y38 A;  3LWC A;  4MGS A;  3LCP A;  3WF0 A;  5C4W B;  3K4Z A;  2Q4S A;  1LRH A;  4CXX A;  3BTX A;  1POV 3;  2EIC A;  4ORF A;  4S2G A;  4NJ4 A;  1Q56 A;  2VQ0 A;  2CSG A;  3JZV A;  1YJK A;  5FJH A;  2Z2S B;  3D82 A;  4R9A A;  4PIZ A;  1UW8 A;  2CU5 A;  4XBQ A;  5D8A B;  2VOV A;  1TME 2;  2Y6K A;  5GZG A;  2HWF 3;  4Z2W A;  3KT7 A;  2BOJ A;  3RPQ A;  3CBN A;  4OHW A;  5K8S A;  5GZD A;  4AGG A;  4W4Z A;  4JAA A;  4N43 A;  3VBS C;  3PVO A;  1H2N A;  2WZR 3;  2ZMN A;  3AKR A;  3I2G A;  1O4Z A;  1W8U A;  4XXA A;  1REF A;  4YVS B;  1VAL A;  2PHX A;  3VBF A;  3CIH A;  4YZ3 A;  5L19 A;  1NCQ B;  3F2Z A;  4P00 B;  1D4M 3;  2HWE 1;  2VUD A;  4CCC A;  1DG6 A;  5FZ7 A;  5CZK A;  1HB1 A;  3I8T A;  1ZBA 3;  2RR1 3;  5FY4 A;  1NXD 1;  2JD4 A;  1FPN 2;  3LZZ A;  2O1Q A;  3IDC B;  3ZR6 A;  3I59 A;  4RR3 A;  4AI3 A;  4XFI A;  1SDD B;  1LOF C;  5K0U A;  3HBZ A;  1F5F A;  2LS6 A;  2VUL A;  5FY1 A;  1QJY 3;  3K3O A;  3UL2 A;  5A1L A;  2DF7 A;  5C3Q A;  5IAT A;  1OVP A;  4NHY A;  4XET A;  1QOO A;  4QPG B;  4R4X A;  2GNB A;  5C33 A;  3TYJ A;  2A3X A;  1SBD A;  3N9Q A;  3NRU A;  5BXX A;  4D69 A;  4QX5 A;  2YY1 A;  5FPA A;  1OPO A;  2Q8C A;  3U11 A;  4LBQ B;  4XJA A;  2HWB 1;  2XL9 A;  2AGS A;  2V09 A;  2BOI A;  2Y34 A;  5IK5 A;  1UF2 C;  2HJI A;  1VJ2 A;  1F4H A;  1GZW A;  1KFU L;  3PLQ A;  4JQT A;  4OFG A;  1DGR A;  2CDO A;  4BA6 A;  5I0U A;  4N53 B;  1BBT 1;  2BNO A;  3S5A A;  1DLL A;  3MPP G;  3H3Z A;  4NUB A;  4DRV A;  1JW6 A;  1H6X A;  3L2H A;  4PI0 A;  5H9Q A;  1PO1 3;  5FZ3 A;  4YG6 A;  1TQ5 A;  1RGS A;  2IUW A;  4P9X A;  4QQL A;  3WDW A;  4B29 A;  4QU2 A;  4G9S B;  2A6Z A;  2ZZQ A;  4YW1 A;  1VB2 A;  1MZ5 A;  2WQ4 A;  2WYF A;  2ZGQ A;  5FDB A;  5LRR A;  4HT1 T;  3ZOI A;  2HWD 3;  4AHX A;  4COZ A;  1OC1 A;  3LA2 A;  2YUE A;  4QT6 A;  3WLU A;  1SLC A;  3VB9 A;  4KH9 A;  3LPF A;  1GQP A;  4BME A;  4XFB A;  3BUC A;  4O9E A;  1OH3 A;  1AR8 1;  3AZY A;  3QD6 A;  4LO7 A;  1NYW A;  4YG3 A;  4CDQ C;  2K46 A;  3T2O A;  1W8W A;  4MXW B;  4UW4 A;  5CFC A;  2XON A;  2Q0A A;  4FPY A;  3FHI B;  3GJA A;  4RS5 A;  3SKJ E;  3V65 A;  4CP9 A;  3KGL A;  1VP6 A;  4ZZ8 A;  5T5L A;  4CEY C;  5BV6 A;  1SLI A;  1W99 A;  4CE8 A;  5I91 A;  4IE5 A;  4LA3 A;  3V0A B;  1CZS A;  3POB A;  3ZYP A;  5FOJ B;  4L11 A;  1ZRC A;  4NE9 A;  5D2A A;  3ES1 A;  1PO2 2;  1OUR A;  4PCR A;  4LO4 B;  3FHQ A;  2XLG A;  4JHZ A;  4MV2 A;  5EP9 A;  1VAM A;  2JKB A;  1B35 A;  4Q4W 1;  1MAC A;  5CU1 A;  1XE7 A;  3ZO0 B;  3POG A;  3SNM A;  5FR3 A;  1R08 3;  1SQ4 A;  5FWE A;  1BVV A;  1JH5 A;  1WW4 A;  3VN4 A;  5CNA A;  1X8E A;  5JI9 A;  3E5X A;  4MYE A;  2D3R A;  2GSY A;  2ZHK A;  2P2K A;  4BU2 A;  1Y4W A;  1L7L A;  5DUV A;  4BXF A;  3BTZ A;  4A3X A;  4NO4 A;  3ZMO A;  4XAE A;  4GWM A;  1APN A;  1TEI A;  3IM0 A;  4XF3 A;  3HMY A;  4LE3 A;  1GZC A;  1K5M C;  1O59 A;  2DCJ A;  4YPJ A;  1W39 A;  4AVC A;  4J1X A;  5CG8 A;  3MF6 A;  3G7D A;  3UKT A;  4CXY A;  2HLE A;  3SMH A;  1FNY A;  4ZKT B;  1Y9G A;  4DB5 A;  1X9T A;  1EV1 3;  2D44 A;  1UOB A;  4YW2 A;  1W9W A;  3POY A;  5IK4 A;  2WS9 3;  3L2Y A;  1H6Y A;  1UX7 A;  2ZGN A;  3LE0 A;  1UOF A;  4MX3 A;  1WGP A;  4L99 A;  4TYS A;  1COV 1;  2E6V A;  4HXC A;  1ULG A;  1AR7 1;  1HB4 A;  2J1U A;  2SLI A;  4Y5S A;  2FZ2 A;  2BNN A;  4QGL A;  3FN9 A;  5ABJ B;  3SIS A;  1MEC 2;  5J37 A;  4N7U A;  2XH6 A;  2YFU A;  4XF1 A;  1VRB A;  2JDU A;  3W9A A;  1LHN A;  1WBF A;  3D4K A;  4CDU B;  1W05 A;  4RHV 3;  1CIY A;  1NY7 2;  2WC2 A;  4JTO A;  5TSW A;  1LOD A;  3D3A A;  3HOB A;  3PIG A;  2J1R A;  4P9L A;  4OHY A;  2WNU C;  3L9J T;  4HAN A;  4XUO A;  4OI0 A;  3IBM A;  1AR6 1;  4M3C A;  3ZFF A;  4WM8 C;  5FY8 A;  2ZBJ A;  4M4R A;  2E26 A;  2FD8 A;  2EAK A;  1LES A;  3E5U A;  3ZDV A;  3D0J A;  4I0B A;  5DZF A;  1S0G A;  2HWE 3;  5BNP B;  1HRV 3;  2IXC A;  4Q4Y 1;  1GBG A;  2A7A A;  3E1F 1;  5A7Q A;  1HN0 A;  1L7R A;  1PIV 2;  3LOI A;  4AEK A;  5IVF A;  4I0A A;  5LCW L;  5FXV A;  3POI A;  4FPK A;  3MFC A;  3CJI A;  3BPZ A;  3WP3 A;  3N9M A;  5HI0 A;  1JU4 A;  3OJB A;  5KXE A;  1PMH X;  4QDQ A;  2WYS A;  1OD3 A;  1IZ3 A;  4RQP B;  5F3I A;  4IV1 A;  1RUO A;  1WW7 A;  3IN9 A;  4Q27 A;  3VHP A;  4OI4 A;  1QXR A;  4FPO B;  2OQ7 A;  5C5U A;  4QX8 A;  2CWS A;  4XJ8 A;  4Y4R A;  2BWC A;  4AOC A;  2YRO A;  5I0D A;  2Q8D A;  2QQU A;  2HWF 2;  2PHF A;  3HT2 A;  4DFS A;  1HLC A;  4NWV A;  5IFT A;  2LW8 A;  4OHX A;  4MAD A;  1CGP A;  4XBN A;  2EAA A;  3P3P A;  2ZGO A;  2VL4 A;  3W5N A;  2PMW B;  1ZZC A;  1UMH A;  1PGL 1;  5KHG A;  3OCP A;  3O1O A;  5J3U A;  3M7A A;  5DAX A;  5C71 A;  2HEW F;  4IER A;  2WO1 A;  2FCV A;  3FZ3 A;  3BYW A;  4RGG A;  1JZ3 A;  4COV A;  1I6X A;  1EAH 1;  4FI9 A;  2RS5 2;  2X09 A;  1GR3 A;  1H2K A;  4Q0S A;  3WW3 A;  1UOG A;  2N7G A;  2HKX A;  4QKB A;  3JQW A;  5AVP A;  4CYD A;  5FZ1 A;  1LKN A;  4Y22 A;  3CNA A;  4HBN A;  4IDZ A;  2W68 A;  1V00 A;  4WVZ A;  1W8T A;  2RJL A;  2R49 A;  1RUH 1;  2VMF A;  2VZ3 A;  1GKB A;  3AZV A;  1W6N A;  4GJZ A;  4K20 A;  5FZO A;  1UU5 A;  5JSO A;  5JOY A;  2VO5 A;  4CU8 A;  5LA2 A;  1YLL A;  4QB1 A;  4D6Q A;  4M0H A;  2GC2 A;  1HV1 A;  1W9T A;  2R06 2;  3MIH A;  4XTM A;  4SBV A;  5I0S A;  1D7P M;  3HJR A;  5F3E A;  3JBG 3;  3CQO A;  3ZFE B;  3T30 A;  3UGF A;  1POQ A;  3S30 A;  1H8T A;  1YEW A;  2AC1 A;  4KU8 A;  4BZ4 A;  1XJA A;  2VTX J;  3NST A;  3WW2 A;  1LU1 A;  2ZAA A;  4MLO A;  5L9R A;  5BUV A;  2C24 A;  3BTA A;  1RUD 3;  1W6M A;  3M2M A;  4N90 A;  3HNB M;  3VBF C;  2R07 1;  3B01 A;  3WHU A;  3DPR C;  3VDA A;  3CMG A;  1YO8 A;  4AEJ A;  1RUN A;  3NNM A;  3N9N A;  5AFB A;  1PNG A;  1MS0 A;  1LGC A;  4Y4Y A;  1ZBE 2;  2AYH A;  3M3O A;  1BHG A;  3GDB A;  3GZT B;  3OBR A;  4YW7 A;  2D6M A;  5A6Q A;  3QBQ A;  3SH5 A;  1RMU 2;  2PHL A;  1V6O A;  3D5O A;  3ZIX A;  2OPK A;  4QHO A;  1W04 A;  4LBM A;  1KS4 A;  1C1L A;  4XUT A;  2DYC A;  5CKN A;  4N53 C;  1MS3 A;  5C5T A;  1VMF A;  3MLK A;  5FP7 A;  4ZZ5 A;  5F37 A;  1PVX A;  4JTN A;  3WIN E;  5B2G B;  1K45 A;  2JE8 A;  3MFA A;  3RG0 A;  5D1I A;  1IHM A;  2E33 A;  2TNF A;  1V0A A;  2XBO 1;  4LIV A;  5HXV A;  2Y8K A;  1OOP B;  4GKX A;  3ZYJ B;  4EJR A;  1UY2 A;  1YI9 A;  2ZHL A;  2OZJ A;  4FPC A;  1GP5 A;  1KDM A;  5A7P A;  4BQY A;  3SEP A;  1R08 2;  1SCR A;  1DZR A;  2QQW A;  3P1I A;  4MUV A;  4YVW A;  1BMV 2;  4AI9 A;  1WCD J;  1ASJ 2;  2TBV A;  3WOG A;  3WDV A;  5IVE A;  1W0P A;  3HWJ A;  5LAS A;  4DXS A;  1AJO A;  1PVC 3;  3OEA A;  2ZCW A;  1AR9 3;  3PVE A;  4OI1 A;  3HAG A;  3MEP A;  2MNG A;  4D3W A;  2RDN A;  3ZMN A;  2V5D A;  4Y20 B;  3VV1 A;  2YV8 A;  1R1A 3;  5KWR A;  2C5D A;  4K1Y A;  1HQW A;  1RXF A;  4XW3 A;  4IND A;  2LTN A;  3I2K A;  1OD5 A;  2XJP A;  4XHB A;  3C7F A;  1CQ9 A;  2PQQ A;  4IES A;  5E88 A;  1J84 A;  4QXC A;  4OI2 A;  2J42 A;  3LA7 A;  3Q8C A;  3RMY A;  2JKX A;  4AVV A;  5L7O B;  1SFN A;  1EPW A;  2E53 A;  1CJP A;  4RS5 C;  4AGV A;  4F7Z A;  4BIS A;  1XPW A;  2Q5T A;  4BJ0 A;  2VD7 A;  3TNP B;  3NAP A;  4LKS A;  2JEN A;  5JUV A;  2ENR A;  1VBD 1;  4R9C A;  1DFQ A;  2JDM A;  2ZGR A;  2EXH A;  4GB3 3;  4FQ4 A;  2A73 B;  1DQ0 A;  1Q43 A;  5C8W A;  2QQP A;  3FWE A;  5IHR A;  3AP5 A;  4XIK A;  3GCW A;  1WLC A;  1YFW A;  2R1D A;  2ZXQ A;  5FXX A;  3BN6 A;  3RZM A;  2W94 A;  1SPP B;  1RUG 3;  1AYM 1;  4K3U A;  4XYX A;  3Q9O A;  4BIF A;  1B35 C;  2WZP P;  5KHK A;  1JN2 P;  3KD4 A;  4I09 A;  4IGO A;  4FQZ A;  1W6O B;  4QXK A;  4AYU A;  1OKQ A;  2XWJ B;  3R05 A;  3WD5 A;  4K8F A;  4HOO A;  1YQC A;  2ERF A;  1FMD 2;  3IDB B;  4DEV A;  3RZG A;  2VUC A;  2DU0 A;  2XG3 A;  1KFX L;  1SZB A;  1AL0 G;  2K9Z A;  2WA3 A;  4W6Y A;  5FIX A;  3ZXF A;  1OT5 A;  2D6L X;  4A44 A;  5FZG A;  4Q4X 1;  3JQX A;  4OUM A;  5KHH A;  1NUK A;  3OBZ A;  3NO8 A;  5FQ0 A;  5AFE A;  3KS7 A;  5F2S A;  1I5Z A;  3M3E A;  2WL1 A;  4CDW B;  3PUS A;  1VPH A;  2HEY F;  2ZJC A;  2W5F A;  1AVB A;  3PUH A;  5L9V A;  1ZNP A;  1VBE 3;  3LFI A;  4PDW B;  2FZ1 A;  4XOG A;  4P08 A;  4AAX A;  1LED A;  2OS2 A;  3ZFG A;  3NKG A;  2ET7 A;  5IVY A;  3NV3 A;  4W6W A;  3U75 A;  3FJS A;  1LTE A;  3IT8 A;  3ACG A;  1DLC A;  3ORJ A;  4PQ9 A;  1W2U A;  1VBB 1;  3ROU A;  3ON7 A;  1VLN A;  1LGN A;  2ID4 A;  3PNA A;  5IWF A;  5F1R A;  2VW0 A;  1A8M A;  1RHI 1;  2DBN A;  2RM2 3;  2VVE A;  2P1B A;  5LBB A;  2HWB 2;  3VBS A;  3IPV A;  2VNR A;  4AGR A;  5AVA A;  3G6J B;  3O5S A;  3K48 A;  4AWD A;  2OUH A;  5KXB A;  2VU9 A;  4M0N A;  5LZ6 A;  3I49 A;  1BBT 2;  4HLT A;  4Y33 A;  3R6S A;  2VOK A;  1UMI A;  3RRD A;  3DEC A;  3EXU A;  4GJY A;  4CDX A;  1MVQ A;  4LBJ A;  3SH4 A;  5LBC A;  1W8Z A;  5HXM A;  5A3W A;  2G1M A;  1TMF 1;  3MIG A;  4V1P A;  3Q8B A;  3ZXE A;  4CCJ A;  5I0R A;  1O5U A;  2DCY A;  1DZQ A;  2JG9 C;  3KMH A;  3R0R A;  1LOF A;  4FPF A;  3SCH A;  1GOH A;  3ZFF C;  4LBK A;  5JDB A;  2XQR A;  4DNY A;  1G7Y A;  1W9S A;  4AAP A;  4DXR A;  3WUC A;  4YGB A;  4UFL A;  5CEH A;  3MIE A;  5ACA 1;  4OMD A;  4OHZ A;  3WQ7 A;  4M00 A;  1AR8 2;  3BPS A;  3ZXD A;  3ZXG A;  2ZMK A;  1OF3 A;  4X6Q B;  2D6O X;  1DCS A;  3RI9 A;  5F32 A;  2VQA A;  2AEZ A;  3ZYI B;  4RGA A;  4AVA A;  2FDH A;  1XU1 A;  5DPN A;  1A34 A;  1EUU A;  2H0B A;  4GUL A;  4QPI C;  5FZM A;  3MGU A;  3WG3 A;  3I3M A;  3NW4 A;  4ZU7 A;  5F5A A;  1DQ2 A;  1JOP A;  5A1A A;  4URT A;  1G8W A;  5J36 A;  4M4P A;  1U5Z A;  5AC9 1;  3WDT A;  5I93 A;  2F4P A;  4TZD A;  2DVD A;  2JEC A;  2WII B;  1U12 A;  1UN1 A;  1W2O A;  2W08 A;  4PT6 A;  4WM7 C;  5FZ9 A;  1RJ8 A;  4UF0 B;  3FLT A;  3FHA A;  3Q8E A;  3RJR A;  1JYI A;  5LWB A;  1NA1 B;  4AFC A;  4Q4W 2;  2NYY A;  2PHD A;  4ISQ A;  4PIX A;  1JZ8 A;  3T0D A;  2VBP A;  1ULO A;  4Q0P A;  5A6X A;  1H9P A;  1V6K A;  3AP6 A;  1CAW B;  4PIY A;  4D8M A;  2RS1 1;  1BJQ A;  3N9P A;  5IJR A;  2QKD A;  1ZX5 A;  3O1V A;  3ZR5 A;  1SG3 A;  4QKN A;  5JXG A;  2A6X A;  3ASI A;  4PI2 A;  1SFP A;  1C5I A;  1ND3 B;  2HYX A;  4CDQ A;  3ZSJ A;  3ITQ A;  3RWN A;  3GZA A;  3VDC A;  4R4Z A;  2A6Y A;  2ZZJ A;  4IV3 B;  4Y5Z 0;  5A1F A;  1RUE 3;  5GAL A;  3BOD A;  4YGD A;  5GZF A;  3OEB A;  1AHS A;  5EPA A;  5DZG A;  2C9K A;  4GWN A;  2OA2 A;  2GC0 A;  5T54 A;  5FZ4 A;  5A33 A;  2VGD A;  3FLP A;  4I02 A;  5BNO C;  2AZ5 A;  2YB7 A;  1XYN A;  1WMX A;  2JWP A;  5FUP A;  1PK6 C;  4Q0Q A;  5HBA A;  1WMD A;  2GH2 A;  2K0G A;  2WZR 1;  2DCT A;  1SEF A;  5G04 L;  4BIO A;  4CU9 A;  1COV 2;  1MS4 A;  2ARE A;  3RYP A;  3TEY A;  1AR7 2;  4WV8 A;  1D4M 1;  1DYP A;  2ZEW A;  4ES8 A;  1OUX A;  1H8T C;  1XSR A;  2EF6 A;  2XOM A;  3BU7 A;  2P5B A;  4D0Q A;  5KC5 A;  3AJY A;  3VD5 A;  1O8S A;  1ZBA 1;  2RR1 1;  4I3P A;  2JG8 C;  1XB9 A;  4XDQ A;  4RFR B;  1O91 A;  4JKK A;  5FO8 B;  3MLJ A;  4YRD A;  2AEY A;  5FKC A;  1PHM A;  1DIW A;  1QJY 1;  2W9X A;  1XNT A;  4AVT A;  3W5M A;  5IVC A;  1K5M A;  1W2T A;  5CAZ A;  3ZN5 A;  1AR6 2;  1YQ5 A;  2W52 A;  2PTM A;  1ENQ A;  4LK6 A;  4EN0 A;  3J8F 3;  3M3Q A;  5C7G A;  5F5Q A;  1JOJ A;  3FMG A;  2UYA A;  5EQU A;  4XCA A;  5FZE A;  1SLT A;  1P8J A;  2J1V A;  3DKQ A;  4W65 A;  1J58 A;  4JQR A;  4Q4Y 2;  1AZD A;  3AK0 A;  4NRQ A;  2NMN A;  2X10 A;  1RUC 1;  3NL1 A;  4E4D X;  5FPV A;  3DCQ A;  3KLS A;  3CLP A;  1KJL A;  3MO4 A;  2QQL A;  4HN0 A;  4W6X A;  4WZC A;  5FYZ A;  4CXW A;  5C9A B;  4FFG A;  4XTP A;  1PO1 1;  3NNF A;  5CKQ A;  3OYW A;  4HSJ A;  5F5I A;  3A22 A;  3POW A;  4FOY A;  1CAX B;  1CES A;  2RDR A;  4XVH A;  3V0B B;  2CGO A;  1VBB 3;  2ARB A;  3E6D A;  3MPB A;  3PJY A;  4PHZ A;  4QDS A;  4TN7 A;  5LBF A;  2WNU A;  1UKR A;  1ZRR A;  2KR2 A;  2PAE A;  4LOT A;  4YNI A;  1AL2 3;  3KB5 A;  2HWD 1;  4NAM A;  4BMB A;  1E5H A;  3AYE A;  2RS3 3;  5H9S A;  4WM8 A;  3CKH A;  3AXD A;  3FBM A;  1GFF 2;  3ZXA C;  1LOG A;  1LR5 A;  1YFX A;  3EQE A;  4H55 A;  1PGL 2;  3INA A;  4CSW A;  1VIW B;  4GMP 0;  4O61 A;  2NM1 A;  3USS A;  4CCL A;  2A3Y A;  4ZY9 A;  4HKL A;  4DIQ A;  5C8C B;  5HCA A;  4U2A A;  1W3X A;  1TMF 3;  1FYU A;  4AVB A;  4L8Q A;  3RZL A;  4MVT A;  3TN9 3;  1EAH 2;  1PGS A;  1AJK A;  1AYN 1;  3ELN A;  1RIT A;  3OPW A;  4CP1 A;  2PLV 3;  3T08 A;  1WA6 X;  2E51 A;  4HL0 A;  1W6P A;  2YPD A;  4CCN A;  4NHM A;  1QJU 1;  4QB6 A;  4R9D A;  1WWY A;  4LKE A;  4HG6 B;  3USU A;  1HXS 1;  1RUH 2;  1GNH A;  1JHJ A;  4XUN A;  3RGB A;  1H2M A;  5LEJ A;  3P6B A;  1CPN A;  4YFW A;  5F5C A;  2ZGP A;  3WF4 A;  1LEC A;  4MH0 E;  5FMO S;  1A6C A;  1NLS A;  2RG4 A;  4FXK B;  4QQH A;  4LUM A;  3NVC A;  5F3G A;  1K5J A;  3O1S A;  3D6E A;  4HPK A;  4YM3 A;  2E63 A;  4OZX A;  3U78 A;  4NPR A;  2VJX A;  5CB7 A;  1QEX A;  3I4I A;  4DO0 A;  3BU0 A;  3WNK A;  2Z69 A;  3RVH A;  5LBE A;  3VBR C;  1DQ6 A;  1CAU B;  3WR0 A;  1LOE A;  2V5Y A;  3LKJ A;  3MUZ 1;  3W59 A;  4B4Q A;  3OY8 A;  5FY7 A;  5LY2 A;  2ZX3 A;  4C8D A;  1X82 A;  4QQ2 A;  2R07 2;  2XML A;  4WVM B;  5FPU A;  3B7M A;  1YC6 1;  2OQ6 A;  1CVN A;  4IEV A;  5EJZ B;  2CV6 A;  3WQ1 A;  4CEW B;  2VMC A;  2VBD A;  5D8A A;  3UES A;  2WS9 1;  4AI8 A;  5IK8 A;  2G9G A;  3ZVX A;  2YG0 A;  3VKN A;  3WF2 A;  4ERO A;  1VRH 3;  4IL7 A;  4GAZ A;  2WO7 A;  4E2S A;  1UKG A;  2W92 A;  4F83 A;  2VXJ A;  1W2N A;  4QHZ A;  4Z92 B;  3ZYG A;  1JMU B;  3FBY A;  2IXI A;  4K9S A;  1SLB A;  1V6L A;  5D21 A;  5JSP A;  4YVS A;  3U4X A;  1DQ1 A;  1NCQ A;  3N7J A;  3AFG A;  3EHK A;  4JZR A;  4L0P A;  2FCT A;  4MHR A;  3ST7 A;  3OOX A;  4ZS3 A;  3CU7 A;  1Z7S 1;  1GNY A;  4XZP A;  3VBU C;  3ZFG C;  2VBB A;  3U10 A;  4RHV 1;  3N7L A;  3H3L A;  4QKF A;  2JJ6 A;  1MS5 A;  4URA A;  3K2O A;  3MID A;  1C28 A;  1ALY A;  2XBO 2;  5A7O A;  4LNV A;  2XVK A;  3ABZ A;  2WA4 A;  5BNN B;  3KM5 A;  4P9Y A;  3DPR A;  5IFP A;  1VBC 1;  1TZO A;  1RUF 3;  4UFH A;  1HRV 1;  4EQV A;  4CDX C;  1CAV A;  2X5I B;  3J9S A;  4IUG A;  3ZYB A;  1EP0 A;  5FPZ A;  1OQD A;  3T1L A;  5F6K A;  1UIK A;  3OGV A;  5A80 A;  3SCG A;  5FPB A;  1BEV 3;  1UQX A;  3DYM A;  2R0F A;  1N1V A;  3UYJ A;  3VBH B;  1ZRD A;  1SFY A;  4LBQ A;  3LB9 A;  1TG7 A;  2Z4F A;  3ZYH A;  1IS3 A;  4CPB D;  5CA6 A;  3M8L A;  2QJV A;  5LA9 A;  3KT4 A;  1QNY A;  4N53 A;  2DFB A;  4IEO A;  5FZH A;  3NNG A;  4QGN A;  5IVB A;  3VGI A;  1VR3 A;  2JB4 A;  1CON A;  1GWK A;  2P37 A;  2X29 A;  3J7M A;  2CDP A;  3NNL A;  4FFF A;  4QPY A;  2Q8O A;  3SXW A;  1EY2 A;  4PJY A;  1SHW B;  3POF A;  4AQ2 A;  1SLA A;  3LEK A;  4CCM A;  1RUC 3;  2WO3 A;  3M4F A;  1JOD A;  5H9R A;  3VD3 A;  1ENX A;  4N43 B;  4COW A;  5CBL A;  4I2O A;  1VBD 2;  5DZE A;  1BYH A;  3RYK A;  1WA4 A;  3PHM A;  4GWI A;  3JD7 1;  2ET1 A;  2WZE A;  2GC3 A;  2K2S A;  3OBA A;  1ND3 C;  3H8R A;  4N7I A;  1GZ9 A;  1CZT A;  4XUP A;  4ASM B;  4V2V A;  2DFC A;  4C1W A;  1AYM 2;  1U5X A;  2YBK A;  3B93 A;  4LT5 A;  1QJX 3;  2EAL A;  5KXC A;  4YM2 A;  3WDX A;  4RR3 B;  1PX3 A;  5K0U B;  3HQR A;  1YJL A;  2RE9 A;  4A42 A;  5FYC A;  1GAN A;  3FUO A;  3ZIW A;  4E4H A;  1WCK A;  3V0A A;  4XIL A;  2BVB A;  4UBH A;  1XBF A;  2UY9 A;  5ANN A;  4FCA A;  4NR1 A;  4LBL A;  3URF A;  4U36 A;  1V6J A;  3I2F A;  5JXH A;  1F15 A;  4Q4X 2;  5DN2 A;  1XND A;  4XE9 A;  4C0B A;  4FAH A;  2J7M A;  2D3S A;  1K42 A;  2MHF A;  4JX0 A;  1AYN 3;  2B4K A;  2GMP A;  2P17 A;  2VMI A;  3ILR A;  3JBG 1;  4JGY C;  3R4S A;  2QTW B;  1MQT C;  4UBG A;  3C2U A;  3IZO A;  4LHK A;  4Q0U A;  1X8M A;  1UYP A;  2VZT A;  1QJU 3;  1GIC A;  3O12 A;  4HK8 A;  2E7A A;  1QJF A;  1LHW A;  2DVG A;  4Q1R A;  3ACH A;  1YQ8 A;  3U14 A;  1HXS 3;  4OZO A;  2LRP A;  1T6G C;  2BU9 A;  3WQB A;  2BER A;  4NMI A;  1VBB 2;  3A0K A;  1RUD 1;  1Q8O A;  1RB8 G;  1RHI 2;  1D2Q A;  1WME A;  1LHO A;  1V9U 3;  2A75 A;  3GCX A;  3APB A;  3HN3 A;  4FVV A;  4P5H A;  3U07 A;  4DMI A;  4BQ3 A;  2YYO A;  3LOB A;  2WNV B;  4B7E A; 
#chains in the Genus database with same CATH homology
 1JYT A;  1ZRI A;  1JOD A;  1JOB A;  1F35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...