1JYTA

Solution structure of olfactory marker protein from rat
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
163
structure length
163
Chain Sequence
MAEDGPQKQQLDMPLVLDQDLTKQMRLRVESLKQRGEKKQDGEKLLRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Olfactory Marker Protein
total genus 17
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jytA00
1JODA 1F35A 1JOBA 1JYTA 1ZRIA
chains in the Genus database with same CATH superfamily
4EWEA 4XUQA 1QIQA 4N90A 5F5IA 3O7OA 4L99A 1CONA 4LULA 1EV13 4XBNA 1BJQA 1PHMA 3DYPA 4TXWA 4ZU4A 2BJSA 4JKLA 2A75A 3ZXLA 4AI3A 4B8EA 1U12A 4PIYA 4D6QA 4RGAA 1ZA7A 3POFA 4LK7A 2JDPA 4LXLA 1F4AA 3ASIA 3GM8A 3ECQA 4FPOB 2JE8A 4XUTA 3ZSKA 3NKGA 2WJSA 4IV3B 3U1XA 2HEWF 1VMFA 4WVMA 1UMHA 2HLEA 4JX0A 4CVUA 4DEVA 5JXHA 4CEWB 2YV8A 4MGTA 2AACA 1ZX5A 4FSJA 2W3JA 4I01A 4QQHA 5FCCA 5LCWL 3RRDA 1CWPA 2HWE2 5ACA1 2OZ6A 2DUQA 5AVAA 2EALA 1IKPA 2GH2A 2JKBA 1RC6A 1CAVA 2EXJA 1NAEA 3OD4A 1LOEA 5JZGC 4QPIB 3FHQA 1U0AA 2FDGA 1ENQA 3WW3A 1AZDA 1NLQA 3PUIA 4KG8A 4W4ZA 5A7SA 4QM8A 5D8AC 2RS51 3M3OA 1PX3A 1NYWA 4UFKA 2ETEA 3ZFEA 2HWB3 4F3JA 2PLV1 2ZHMA 1KQRA 4UW5A 4FP2A 4ES8A 1QJFA 4XFBA 4AE2A 5CAZA 4J1XA 1QF3A 2WZR1 4LR4A 4AQ2A 4RS5C 1C28A 5JZGA 3AKQA 3APBA 5T3NA 2NLRA 1V6LA 1Z7S1 1D2SA 3GHMA 3Q8CA 5A33B 3I2FA 1AR93 4R52A 4S2FA 3WDYA 1ZRDA 1I1EA 3DKQA 2R6QA 4C90A 3NNLA 5FZ8A 4WZCA 4Q2FA 1PGL1 4Y1ZA 2CGOA 5EJ3A 1AVBA 4O9GA 4QKNA 2R7EB 5LRSA 1ZRCA 2WNUB 1O3RA 1DZQA 1AR61 1YNAA 2HKXA 5CFDB 1LODA 1O4TA 4F8AA 3BI3A 1ULGA 1WLWA 1ZZ7A 1S55A 1IPJA 2RS13 3BYWA 3FBYA 2WYSA 3THTA 1K5JA 3TN92 3SH5A 1WLDA 5FZ4A 1SBEA 2RMU2 2BP6A 3CZJA 5GZGA 3T0DA 3AFGA 1LOAA 3B9IA 4WVWA 3GNEA 3DCQA 1GZ9A 4ZZ8A 4QKFA 4LTAA 4RR3A 3T2TA 2D93A 2E7QA 1MS5A 2ZOEB 5JWPA 3PL0A 2R1DA 1YHFA 1NE4A 1YQ8A 2Z5WA 1NLRA 3ME2A 3Q9OA 3SC7X 3WW4A 3WG4A 1OA2A 3R6SA 1W0OA 1MS9A 4FPCA 5CFDC 4EN8B 5A70A 4I2OA 3M4FA 1L7QA 1R64A 3IZOA 3JBG3 2BERA 1D4M2 2DUPA 2XL7A 1QJX3 1QQP2 2IUWA 3T2OA 1F2NA 3GALA 3O5SA 3DPRB 2VOVA 5GZDA 5CFCA 1RUF1 3FFZA 2BGCA 2GN7A 2H6BA 3H3LA 3J8F2 3NAPC 2R0HA 4XCAA 3Q8EA 2XLFA 3WSOA 1MS4A 5KXBA 1ZZ8A 4OUEA 5HXMA 4YW5A 3B3QE 4AHWA 3B9CA 5F5QA 1QJU3 3FWEA 5F3IA 2HWF1 4HN1A 5GKAC 2A5ZA 2QQMA 2HEVF 1C4RA 5HCHA 3LE0A 2B5HA 5CVRA 1C5IA 3M3EA 5C71A 1X36A 5L9BA 4LBNA 1MR5A 2XHNA 2W5FA 3DN7A 3NJZA 4Q0PA 1M06G 3I2IA 1LEMA 1UPSA 2QJVA 3WDTA 3LDBA 5CFCC 1Q5OA 3KF5A 2W91A 3NRUA 3MEPA 5EIYB 4WM8A 2X53S 1LU2A 5FBZA 3MW4A 3N9LA 4I02A 4BQ5A 4KWKA 4LOTA 1MS1A 1DQ1A 1UYXA 3N9OA 1C57A 4B7KA 4DRRA 1COV3 3INAA 3PUQA 3T2QA 3ZSEA 5FP7A 5A7NA 3B01A 1PZ9A 5ABJB 1ND2C 3CJXA 3T1LA 2GC0A 1WMFA 2GMEA 2W1WA 1PMJX 2J1EA 3ZFGA 4QB2A 2GNBA 4LA3A 4WM7A 1SPPA 1JBCA 3CL1A 5JMOA 2BPA2 3WINE 1J3PA 3MPBA 5BUVA 1N3OA 4LPLA 3EO6A 3ZM8A 1R1A3 2DU0A 4BH9A 2D3PA 3E97A 3QH6A 4ZS3A 3ZFEB 2DDUA 3HQXA 5C4WB 3UKNA 2DUOA 4Y4YA 3ZX7A 2WL1A 3LIGA 3D0SA 2H0BA 1HIXA 3LA7A 1Y9QA 1UNBA 1GWKA 4MZUA 2CY6A 1YC61 2XXZA 3NV3A 1VP6A 1GZWB 5L36A 4CCEA 2RHPA 1KGYA 3NJYA 3C7GA 1DU3D 4XFGA 5FPBA 4IV1A 4JQRA 5CB7A 3ZXAC 1VB4A 5A6YA 5CG9A 1JYCA 4MV2A 1BLZA 1RYYA 2WQ4A 3CJIB 2JX9A 1GWLA 1OQ1A 1HLCA 2CAUA 3IKWA 4XHBA 3H8XA 5CFDA 3WNXA 1YQ6A 4JTOA 4ET7A 5JCTA 4HLTA 2QTWB 5AC93 4OUSA 3U07A 4Q5OA 3GZAA 4SLIA 4L97A 4XILA 2UWBA 2VZPA 1SLLA 4KG0A 4MGKE 1PO21 5FYIA 4OUMA 4FTSA 3RG0A 1KFXL 1BK0A 4R4ZA 4TYSA 3M1HA 4W50A 5FMOS 4EN0A 4IE0A 2JDHA 2OPKA 3WNOA 1VBB1 2QNKA 4BCUA 3E6CC 2SLIA 4IE5A 4QWNA 4BM8A 4BISA 3MPPG 1STMA 4FPEA 3VLBB 4LO8A 1U5YA 4XIOA 3I3DA 5BY5A 4FAGA 5CZKA 1OOPC 1MEC2 2JG8B 1ULEA 4PHZA 5FP9A 2X05A 1RINA 2UY8A 1VALA 1WBFA 1EV11 3FZ3A 3ES1A 3DPRA 3T3YA 3KB5A 3OF1A 5FUNA 2Q8CA 4YRDA 4OZOA 4QGNA 4PJYA 2BV4A 3PDQA 2E26A 2OUJA 5J37A 2JG9C 3VBHB 1JOJA 5FZOA 4YM3A 5FMCA 4AWDA 3WF2A 1COV2 5IT6A 3J8F1 1A6CA 2PQQA 1JUIA 2V72A 1UX6A 5E6HA 4B4PA 5LK7B 3TEWA 3KF3A 3SHRA 1OLQA 1G9BA 5T50A 1RUJ1 3BALA 1URXA 2D40A 1W8TA 3FBMA 3T09A 1HXS1 3UGFA 3UL2A 3NMBA 3DYOA 2JG9A 4N43A 4P5YA 2VVEA 4YVWC 5HBAA 4QU1A 3O1UA 5I8SA 3K2OA 4CDQB 3LA3A 1W9YA 1CX4A 2QQJA 3WVJA 5ERLA 1H8TC 2JDKA 3OEBA 4QM9A 2RDQA 1OF3A 2FQPA 3PUAA 2YB7A 4JHZA 4PCRA 5IAVA 3ZMNA 1VR3A 1O8SA 1IGOA 5F3GA 1Q8QA 4S2HA 5FPLA 2C0ZA 4LUKA 5ABJA 4JRLA 4XTMA 2WFF3 3HJRA 1CAUB 2B45X 2ORXA 2VD7A 3G6JB 5ANQA 2VUAA 1G9AA 1SLTA 2DVGA 4NUBA 3ZFGB 3SITA 3AC0A 3VDCA 4ZKTB 1RJ7A 2K46A 4LLFA 1NXMA 4EQVA 2WO3A 2ZGQA 4RFRB 5DDJ2 1MACA 5JLVA 4YVWB 1TZOA 3RQ0A 3I2OA 1DFQA 2BFUS 3KV4A 4QKDA 4CUCA 5FTTC 3MDPA 1APNA 4XF3A 2VG9A 4CDUC 1WLCA 2ZGKA 4LHNA 2PHLA 2WYFA 1OVPA 1GLHA 3DXTA 4MX3A 5ACA3 2XWJB 4AFAA 2VE1A 4D0QA 4M4PA 2G1MA 3S7EA 1H9WA 3NV2A 3OGVA 2RS31 3LPGA 5IW0A 4AHZA 4NO4A 1H8VA 4FOQA 1OURA 5K8SA 2OPWA 2ZABA 1D0HA 1JYWA 3CIHA 3VD4A 1PZ7A 4PBPA 4IXLA 1XNDA 3IBMA 1Q3EA 2R49A 4D7SA 4E2GA 1TMF3 1VBD3 1US2A 3ETQA 5B2GB 1WCDJ 3THCA 2G19A 2C6SA 5EJ1B 4BWOA 3U4XA 4DXZA 4IV1C 4XETA 5LBCA 3OY8A 5KHHA 1KITA 2GU9A 3VBUB 1NZIA 1QH6A 3IAQA 2WAOA 2GZWA 2NQYA 3RZZA 5E88A 3VKOA 4A45A 3SCHA 1WW6A 3MIHA 1RHI1 1OFNA 2JIGA 1NCRB 4YG3A 3BN6A 1EPWA 1REEA 5L9VA 1BVP1 3GJBA 2FMDA 3BPSA 4RQPC 3THPA 2RR11 2DV9A 3W9AA 4XBLA 1DYOA 1ULCA 2BRTA 4PLNA 1JYXA 1WCSA 4YW1A 3EMRA 4BQ2A 5FZ6A 1BMV2 2XG3A 3LB9A 3N7LA 3N9MA 5CU1A 4Q4Y3 2IC1A 5CYYA 1OF4A 1FAYA 1AYM2 1S0BA 2FMYA 3D8CA 3MW3A 4M3CF 5FZMA 1Z0HA 3VZLA 5A3UA 5AFEA 3MZHA 4QXKA 1XC6A 4K8RB 1MEC1 5JVVA 3WF0A 1NX9A 4JAAA 4JGZB 3FFQA 5KR7A 4YZ1A 3ACIA 1CZVA 2XJUA 2ZACA 4CEWC 1QWRA 1U5XA 2FCVA 3I3QA 4XJAA 2RJKA 3UGHA 3VBHA 2HH9A 1SZBA 3BIWE 4P08A 5FUIA 4GJYA 3MIDA 4W65A 1ZRFA 4OHZA 3ILRA 3ZDVA 4CUBA 4XMIA 4P9YA 1R1ZA 4PLOA 3KQRA 2BDRA 3VL9A 1DF0A 1PGW2 2XKPA 4AEJA 4OMCA 2QVSB 2WFF2 5JIAA 1RTVA 2J1VA 5J48A 4JGZC 3D4KA 5FZ3A 3VZNA 5DG1A 3TOJA 3RZHA 3SKJE 4CU6A 4NIDA 1MS8A 1W0PA 2VZ3A 4CEWA 1K5MA 3POIA 4D7YA 3MF6A 1PX4A 5IFTA 1AR81 4M00A 2JDAA 1C1LA 4BHPA 4CDWC 2XLGA 1CAVB 3PVNA 3WP5A 2EA7A 3L2YA 2ZGTA 1E5HA 1CR7A 2LROA 3KSCA 1HB1A 2D6OX 1W8UA 4LBQA 1V9U2 1H8TA 2K0GA 2ZPXA 2YBSA 1DGRA 4QPIA 1O7FA 1OT5A 2DCZA 4Y1UA 5FREA 4I0WB 5C70A 3AJYA 1W2NA 1L7LA 4FOWA 4YZ5A 4EROA 1WMXA 1AXZA 1RUE3 2XONA 1T6BX 1F35A 4Y5TA 2XQRA 1SLCA 1WW5A 2X5IB 3KCXA 2CGPA 2BTVC 1RUG1 1NY71 2LUWA 2HJIA 1UXXX 1K5MC 1DQ5A 2YBPA 3C8XA 4JCKA 5FXZA 4B29A 4FPYA 1X33A 4XFFA 4EZ4A 3NL1A 3RI9A 1H1AA 1N3PA 2HYXA 1HQWA 3N9QA 2EF6A 4BPZA 3V65A 2Z2SB 3LIHA 3MFCA 3KV5A 1UIKA 1UZWA 1JU4A 4XFAA 3FJSA 4DY3A 1W2UA 1MEC3 5FLHA 3VBUC 4DIQA 2UWAA 4CTEA 1DIWA 1MVEA 1LHNA 2JENA 3KVBA 4Y22B 3BTZA 1UW8A 2JDUA 4MGQA 4PIXA 4ZONA 1NCRC 3KQ4B 4FI9A 2FDIA 2PMWB 4FO9A 4QU2A 3ILNA 2ZX4A 4XQDA 2RM21 3PUHA 5FRAA 4ARXA 4DUWA 2A6YA 3PTYA 4LA2A 5L7OB 1ZBE2 2RS11 2GNDA 2PXJA 4UFLA 4F83A 4Z1VA 2YXSA 1JHNA 4Q0VA 4R9BA 4KWUA 4Q4W2 1QJU2 1H9PA 4ES9A 3T0AA 1WCQA 2JECA 4D94A 2OYZA 2GNMA 5A1AA 3RVHA 1TG7A 4YYOA 1HJGA 4JKKA 4MLOA 1XE7A 4X8NA 3VKLA 4AFCA 3VHPA 2B4KA 3GJAA 3VZJA 4C1XA 3B7MA 3POJA 1F5FA 4AI0A 1QJU1 3CHXA 4Q8LA 2Y34A 2R042 4FOYA 4QKBA 2ZGNA 2P34A 3UJOA 1X9PA 3OUIA 2IXJA 5BNOC 2ARCA 5KHJA 2PHRA 2CAVA 2QKDA 1G86A 1HB2A 1S1AA 1VBE3 4FFIA 3VZOA 5LWBA 3JBG2 4IE6A 5CFCB 4Q27A 4Q0SA 2Y33A 3T08A 3MUZ1 1GP6A 1VMJA 3BTAA 3H1MA 2W47A 4IE4A 4JGZA 5FUPA 5FXXA 1RUI1 4C1WA 2QZ2A 1R081 3JD72 4XABA 1QXPA 4IEWA 3FMGA 1BYHA 1BBT3 3V64A 4A7YA 3AK0A 2WLPA 5FZ9A 5JPMB 3OYWB 2R1BA 3K3NA 3IT8A 4ONUA 3WG1A 3V0BA 4E8CA 2BOIA 4PF1A 4PBOA 1IHMA 5EXOA 5FP4A 5T54A 4YFWA 2IFRA 2F6BA 4UW6A 2PHXA 4XUNA 2TNFA 3IDBB 3AZVA 1CAWA 3PHMA 1AX1A 4YLZA 3HT2A 2VMHA 2D97A 2Q1ZB 2DCKA 3U78A 1W6PA 4JQTA 1UYPA 4CUGA 1HV0A 3LZZA 3V56A 1BMV1 4UFIA 4GH4A 2GMMA 2VULA 4M0NA 2DYCA 3USUB 2J1SA 5KBFA 4GD4A 4QPGC 4XF0A 2GH8A 5HCFA 2VCCA 3AKPA 1GZTA 3SMHA 5JMCA 1BCXA 1OVSA 4FPJA 2MEV1 4NHXA 4UAPA 2WFPA 1RMU2 3POGA 3U37A 1SBFA 2C4XA 4WZFA 5E16A 4URTA 3L2HA 1GQGA 3UK9A 2VZ1A 3H3ZA 3ZKUA 5IATA 2RR13 3SH4A 1YQ2A 2XJPA 2WZR2 1PVXA 3GDBA 1VBC2 1EUTA 1HN0A 5H9SA 1H30A 4DUVA 3EHKA 2ZBJA 4Q4Y1 5F9TA 4AEMA 5T5LA 5FZCA 4NIGA 1DYPA 3GZUC 4CUAA 2QZ3A 2JD9A 4XW3A 3KV9A 3AJZA 5JDBA 4IGQA 2ZCWA 4AR2A 2ARAA 3QLQA 4C8DA 4QPGA 4R9DA 3FHAA 1CJPA 3RJRA 3H8UA 4BQWA 3M3IA 4NN0A 4XMAA 1EAH3 5TSWA 4CXXA 1O3TA 1IPKA 4QHOA 1H2MA 3GYDA 3MYXA 3OBZA 1W2AX 1FI2A 1W90A 4S2GA 4ZU7A 1H2LA 4V2VA 2HWE3 4FT8A 5LATA 1ZNPA 4Z8BA 3VBOB 1UIJA 5C9AC 5T5JA 1JUHA 2VQUA 1VBA3 4AYUA 4H14A 1YWKA 5F8PA 3POSA 1XU1A 4RD7A 1ZZBA 2YGMA 4YGDA 1QJEA 4AOCA 3MBWA 4KQ7A 2NMNA 3J26N 4J6GA 1RUD1 5KXEA 1PVC2 2CHHA 4GAZA 4N53A 1I5ZA 3OOXA 2YU1A 1KJLA 2ZMLA 4LBKA 4B4RA 4K1ZA 1O4ZA 4HVOA 5HV4A 2XUEA 3RJ2X 4V1PA 3IWZA 1GU3A 4QDSA 1LNSA 4CP2A 4PF5A 1J3QA 1GOHA 1WA4A 4GXLA 4W8JA 1I3HA 4ASLA 2ZAAA 2SBAA 5FYSA 2J42A 5K9YA 5FY4A 1UCXA 3Q8AA 5KWRA 4DUXA 2GP3A 3GCWA 1WGPA 3RMYA 3T0BA 2D6KA 2JG8A 1O6UA 2BWCA 4LBLA 2D43A 4M01A 4HANA 4HN0A 4XCBA 3O1SA 5IHRA 4AEKA 4XJWA 5A7OA 4COVA 3MF9A 4KNCA 4UBHA 5J96B 2R041 5FYTA 1OD3A 3WP3A 4P02B 4EE2A 1PGSA 1C1FA 2Y6LA 4LORA 4Y4RA 4AFMA 4LNVA 1KS5A 1Q8PA 4Q0UA 1F4HA 2YUEA 5BNOA 4BMBA 3V0AB 1AYM3 3OYWA 4GWIA 3WP6A 2R073 3PJYA 2Y60A 4GZ9A 1FPN1 2DF7A 4IUGA 1X8EA 1G8WA 4QAWA 4LK6A 1CAXB 3ZO0B 2RS32 2RS12 4KI5M 4MG2A 2BOJA 5FIXA 5T5PA 1OC1A 4DFSA 2WWJA 4XBQA 1YJLA 3OJBA 5JXGA 1I6XA 2O1QA 4K9SA 1A78A 1N1TA 2QFEA 5GZFA 1RUJ3 3AYDA 5C5UA 3A23A 3HNBM 2OA2A 5HCBA 1RUOA 3HT1A 5K0UB 3BUCA 2OIIA 3NSTA 2GMPA 4HMZA 1PK6B 3S7IA 3RZKA 2QQIA 2W39A 4CDUB 1Y43B 3IDAA 3NAPA 1X7NA 1JYIA 2JB8A 1VBB2 5DDJ1 3GGLA 4L92A 4RS5A 3H8RA 1XYOA 1KD7A 1SFNA 4EN7B 4YGCA 5GZCA 1G9DA 3I3EA 4LHSA 2ES3A 4Y5Z0 2VVDA 2A3XA 5FZ7A 4E4SA 2R061 3J7MA 3RZLA 1CZTA 3FLRA 4TLFA 4N9HA 2JXAA 2BZDA 4JZRA 2LTNA 4KBZA 4M3CE 4WVVA 3S0MA 5C5TA 4BE3A 4IL7A 1QNWA 1GP4A 5F6KA 4A6OA 4Y33A 4QXHA 4NR1A 4XF4A 3SISA 1W6NA 1O5LA 2AR6A 1LECA 1W39A 1W8OA 2W9XA 5GM0A 3SQOA 3U11A 4LKEA 3N3HA 5C9AB 4Q4V1 5F6LB 2EAKA 1QJX1 5FP8A 1UZ0A 3GCXA 2BGOA 3OEAA 3WUCA 2BGPA 2XUMA 3PVEA 4CYDA 2DVAA 3AB0A 4IERA 3SCFA 4MHUA 4NIHA 1HN1A 1LESA 4YM0A 5CKQA 4GMP1 5EYXA 1UO9A 5FY0A 3W5NA 3OBAA 5IAXA 2VCMA 4XDOA 3ZFFA 1WMEA 4NRQA 5A3NA 2WBKA 5DAVA 2C1FA 5D21A 3KD4A 3HAGA 1OLME 1QOOA 1GQHA 4YGBA 4DRVA 4PDWC 1VRH2 1YQ5A 5C8CC 4FPFA 1W3VA 4WVZA 1PO13 4Z07A 3VBFC 4BOWA 5FYVA 1O3SA 4OVEA 1RGSA 2GAUA 3GBGA 3ZPOA 3QACA 3OY8B 2D44A 4AVVA 1PGW1 2ZHKA 3KVAA 1OOPA 4IEUA 2QQVA 1A8MA 4PI2A 4NRPA 2BNOA 1DCSA 1H4GA 3NNGA 2QQWA 4IQPA 3LEKA 4K20A 3ES4A 5C7GA 4HT1T 2AENA 3WNMA 2WZEA 5B4XA 3PIGA 4MGSA 5A6XA 1EY2A 2DBNA 1H0BA 1SLAA 2PAMA 1RUNA 2RDRA 1E5SA 2YROA 5GLWA 1QDOA 1OA3A 5JOYA 3POWA 4D6SA 3CBNA 5IWFA 5CA6A 5A7WA 4LBQD 1OH3A 2WO2A 1YFUA 3BB6A 2CNAA 3CLPA 3WX5A 1JXNA 3E5XA 3TN91 4UF0B 2F4PA 2VBDA 3ZYHA 3BTYA 1HX6A 1PVC1 1SG3A 4XVHA 1W99A 5KHKA 1VRH1 4CEYA 3AP6A 1O91A 3WXPA 2YPJA 3I59B 1EUUA 5BNOB 5ANNA 3FHIB 2PHDA 3AX4A 1BEV3 2WZR3 2IXKA 4Q4W1 1HRV2 2VH9A 1CAXA 5J1XA 3DPRC 3WQBA 4K1YA 3S5AA 2Q1MA 2VZUA 4EWAA 5IVJA 3CO2A 2DFBA 3A4UA 3MIGA 4XQWA 1FOD1 1OI6A 2VUDA 1CZSA 2ZA9A 3JU9A 1C8NA 3MLLA 3PU8A 2DCTA 4ZXKA 2W08A 4AI9A 4CCMA 1WLTA 4CDXA 3ACHA 1GOGA 2XVGA 3M3QA 5EP9A 2RS33 4CDUA 4ATFA 1K5MB 1RVF3 4K8FA 4L0PA 2MPFA 4J25A 2D6LX 3WDUA 3MO4A 3MUY1 4KBBA 4RS5B 2IXIA 5DQ0A 3UNPA 1MQTA 1EAH1 3C7FA 3MV01 1Q8VA 4FXKB 3BODA 2E32A 4OULA 2C26A 2G9GA 4LO6B 3C2UA 3T4HB 1JYTA 2Y6HA 4JGYA 5J09A 3KGLA 1AJKA 3PURA 5H9PA 3WCRA 4Q4X2 3I49A 2VY0A 2P6HA 3VDAA 5F7UA 2HWE1 5FYBA 5ACA2 2XWBB 5F39A 3MLKA 5BNQA 2AEYA 2JJ6A 2HWC1 1TEIA 3RPQA 3MIEA 3ZN6B 5FYHA 4QX3A 2R32A 1YFWA 1S0DA 3E5QA 4W6WA 5LRRA 3W21A 1KRIA 1P8JA 1ND2A 3H1YA 2ZJCA 3M3CA 5A32A 1CIWA 2X5IA 3QD6A 4R8HA 1OQDA 5FZBA 3PVBB 2D6MA 2WS91 4KWLA 1RHI3 2Y6FA 1AJOA 1YEWA 2JDZA 4LHKA 5H9RA 2YY1A 3PMSA 4MYEA 2WQ8A 4PDWB 2VNOA 2UYAA 4GQ7A 4Q4X1 1C3HA 3I2KA 3VD3A 1SMVA 3TEYA 3LPFA 3ZYBA 3ENRA 1ZZ9A 2QQLA 1MS0A 3JQXA 4IV1B 1RUG3 2ADDA 4QX2A 3ZSMA 4CCDA 2A6WA 2ARXA 2DCYA 1YJKA 1BQPA 3ZYIB 1RVF2 4COWA 3GHNA 3SEEA 2DWRA 2J22A 3CJIA 4QHBA 1N3QA 4QXBA 3TBDA 2JB4A 3WQ0A 2E7AA 2W95A 1FMD1 2Y26A 4QT6A 2MEV3 4AHYA 3U14A 4HK9A 1W2OA 2DTWA 4L9BA 3VL8A 3WV6A 1PM4A 2OKXA 3ZR6A 2WN2A 5BNNA 1UX7A 4CZSA 1NXD1 3OG2A 4QDQA 1QKQA 2VOWA 5HCAA 1S0EA 1G6NA 5L7OA 3O1OA 5FMDA 3I3MA 4G4FA 3WG2A 3ELNA 4AG4A 5F3EA 3T1MA 5IVEA 2WNVB 1COV1 2O8QA 1QU0A 2EIBA 1RL3A 1OMIA 4PQ9A 4YW2A 5FKBA 4NWVA 4QB1A 5A7PA 2YDEA 1PM7A 1TQ5A 3E1F1 4XFCA 4GMP3 2X8KA 4AW7A 2XBO1 1V6MA 1JI6A 5C3PA 1DQ2A 2JICA 1UOFA 1GFF2 1B09A 4BQ4A 4JRAA 2VCAA 2VGDA 3QBQA 3VBSA 5BNNC 2DU1A 4LMFA 5A3PA 3SXWA 2RM22 1XYNA 4UF0A 4DS0A 2VTXJ 1Y7BA 1XJAA 1SCRA 4QQOA 3VBRA 3LGRA 3OUHA 5LA2A 4OZXA 1NCQB 3P6BA 3WNLA 3WNKA 2K9ZA 1FOD3 1FV3A 2WSUA 1RMU3 1W8WA 2JDMA 2AYHA 4GWJA 3VBSC 1NQDA 3HBKA 1UQXA 2JIJA 1LHWA 4HKLA 4LQRA 4CDWA 1RUF3 1QGLA 1DGWX 5HV0A 4JGYC 3B00A 2O14A 5C6CA 3DGTA 1Y9MA 4BIOA 4Q4X3 4Y20A 1CX1A 1XNCA 3O14A 1K3IA 1ASJ1 5IVVA 3O0VA 2JG9B 4N43B 3VBHC 5FO9B 1NY72 2OZJA 1VRH3 1F31A 5LBEA 2YC4A 4HL0A 4JKMA 4Y3OA 4E2SA 2F4LA 1AXYA 2Q0AA 4E8DA 5CKMA 3TAYA 4AEDC 1DBNA 3KT4A 4K3UA 2C5DA 3EXUA 1TME2 3CNAA 3LSDA 4DXTA 2EXIA 2XQXA 3IPVA 3JB8A 4D7TA 1ULPA 4Y26A 1AYN1 4NWWA 2IXLA 3R4DB 4QQLA 3KV6A 1W8NA 2JWPA 4UW3A 1O3QA 3SEPA 4JGYB 4EWDA 3H0OA 3VBOC 3JD73 5GLUA 4UFHA 1NA1C 3R4SA 2TUNA 5EYYA 5FYUA 4BLIA 2ARBA 2VOKA 1LKNA 3ZYPA 2DURA 1F5JA 4NAMA 4XJZA 3ZN6A 1RUH1 4BLJA 5DUWA 4JHTA 3NNJA 3ETPA 4FPKA 3DYMA 4RHV3 2P3JA 4AGVA 2FZ2A 4LBOA 4AVSA 1GKBA 2W1SA 1DGRN 2Y38A 3ZXKA 4ZHNA 2NP0A 3VV1A 3IMNA 1AR83 1D4VB 2JD4A 2ZGPA 5A33A 1FX5A 2Z69A 4AI2A 1J83A 3HQUA 3HVDA 5LASA 2WS92 2W92A 1BXHA 4AFBA 5JAXA 3VD5A 2ZGUA 1T2XA 3EJKA 4YM1A 2XJTA 1NG0A 4YW3A 2WAAA 1JZ4A 4YW4A 1PMHX 2VCBA 2WR9A 5D8AA 3VUOA 1ZBA1 2Q4SA 2WDBA 1D2QA 1TE1B 2HWC2 1RUI2 3CF6E 4XXAA 2OW4A 1YCIA 1W9SA 4LKFA 4N53B 4YNIA 4EZHA 2D3SA 1GICA 4YZ2A 3ZXDA 2NMOA 2QUOA 4HZFA 2EICA 3JXSA 4FQZA 1RUD3 4XZPA 1LTEA 4OI4A 3VBUA 2DCJA 4A6SA 2W87A 2LM3A 1RUH3 3HPNA 3LEMA 1KFUL 3ORJA 3PTRB 4HXCA 5DXDA 5FPVA 2WO7A 2V4VA 3LDKA 5FOJB 4A3XA 1JODA 5I8TA 3ZYJB 2VZVA 3NNFA 4BQYA 2VZOA 1DP0A 2WT2A 3DEMA 2CDPA 1X8MA 1IZ3A 3AKTA 5JPNB 1JZ3A 5DAXA 1QHDA 4AK3A 5GLTA 2AGSA 2ZX3A 2ADEA 1ZM1A 5LA0A 1LHUA 4N9IA 4FTEA 1V6IA 1C8M3 3VBSB 4HK8A 2EXHA 4HONA 5FPUA 3GXUA 3J7LA 1JYNA 4N8MA 2NN8A 4K6BA 5GLZA 1B35C 2C9AA 3ZOIA 3D3AA 2BVVA 1PK6C 2C24A 3H3UA 3VN4A 2PHFA 3L9JT 3V0AA 3RI8A 4RR3C 5A3MA 4AQTA 1YRZA 3I2DA 1PZ8A 5EWSA 1V6KA 2HYKA 2YFUA 3TYJA 1ZA4A 4WM8C 1IS5A 1W6MA 2I2SA 3GBWA 4LO5B 1S0JA 4GMP0 1RXGA 4UI9L 5D1IA 4DXRA 4MADA 3F2ZA 2ILMA 5E89A 4OQ9A 5FYMA 1NA1A 1AR71 2ZEXA 1QDCA 4XPVA 2RS53 5GZEA 1AYM1 1ND3A 2L9LA 3AFKA 4NE9A 3WF3A 5JOXA 1XNAA 3DL3A 5F5CA 1DZRA 4NIIA 1RUD2 3P3NA 5A3LA 1AR62 2GC3A 1VBB3 2V09A 2Z42A 3NAPB 4GALA 5BNPB 1N1SA 1VBA2 4LE3A 1PGL2 1AR91 3PMEA 1Z7S3 2WZPP 5CBLA 4ORFA 2B7YA 4LKDA 2J1RA 4HBNA 4KMQA 5LY2A 3TNPB 4NHYA 3FLTA 3D0JA 2Z4FA 3RNSA 1XU2A 1L3JA 2XLAA 1UKGA 5FY8A 4W6XA 2A70A 4QGMA 3E6DA 4MXWB 1FV2A 5CADA 3ZVXA 3C7OA 2BUKA 5C9AA 1W6OA 2DVFA 3UT0A 3R05A 2YMZA 5CG8A 1K45A 3H7YA 1D7PM 1RUH2 1WW7A 3ZFFC 5DUUA 2WFF1 1W8ZA 1SHWB 4O7XA 4PQQA 5FZEA 4LO7A 3WOGA 1O8PA 4FFHA 2ZKNA 3M7AA 3BU0A 1JW6A 4DQAA 3FE5A 1FNZA 3IB3A 5BV6A 4PLMA 4XZUG 5E8AA 4MGZE 2ZXQA 4LKSA 4H55A 1SLBA 4YZ4A 3VB9A 3TB0A 3U4SA 3PJQA 1SQ4A 2VZRA 4IE7A 4AGRA 2VNGA 4CCLA 3ACFA 1EPZA 5C3OA 1W8FA 1YI7A 4QQ2A 3RYRA 3RZJA 1AR63 1VBD2 3O1MA 3GZEA 3A0NA 3K4DA 3N7KA 5FAXA 3RYPA 4CRQA 3LEGA 3TRSB 5JOWA 1OSGA 1GNHA 4AAPA 3ZYRA 3MLJA 1DZTA 2V5YA 5FYYA 4BIFA 1W03A 2V5DA 1MZ5A 4IEXA 4M3CB 1W9TA 1EP0A 3ZMOA 4BK5A 2AREA 1WD4A 3MICA 5FBJA 2Q8EA 4EN9B 1Q43A 2XOMA 5C3RA 4OFGA 2RV9A 1HDKA 4ITCA 1B35B 3UJQA 2ORZA 1GNZA 1LULA 3HWJA 1QXJA 4IEOA 4XFIA 5IK8A 2DVDA 4YW6A 4HVRA 2XJSA 2YU2A 5A7WB 3WD5A 3A22A 1BHGA 1XQNA 2AEZA 1XSQA 2WNVC 4HKOA 2VR4A 4IDZA 4P14A 2W0XA 3AKRA 5BYNA 1A34A 4M0HA 2ID4A 1TME3 2A6VA 2HBUA 2Q5TA 1QOSA 2XMLA 2BEOA 4R9CA 1CJDA 4RL7A 4DNYA 1SFYA 3KHCA 3V0BB 2G9FA 1M4WA 4AI1A 4BDVB 4CU8A 1RVF1 4Z92B 1F9KA 3AVRA 3KCCA 1W9FA 2B46X 3KWVA 4MO3M 2W1QA 4INDA 4Q26A 1JZ5A 3WQ1A 4O65A 3MW2A 3IMMA 5FYCA 1ZBA3 3FX3A 4B3NA 3LF7A 1NCQC 3GF6A 5F1RA 2XPJA 3CDZB 1HV1A 3M2MA 3SNMA 4CDQA 1RUI3 1PNFA 4XUPA 5JXJA 1XBFA 4SBVA 4WV8A 4CP9A 5LW9A 4WVMB 5FLJA 1ULDA 1SCSA 4AL9A 4GKXA 4RFT0 2RG4A 2HWD2 4RGGA 1SBDA 3TEXA 1E57A 4NIAA 4OMDA 4OI1A 3VGIA 3H1WA 3URFA 1S0GA 4ZXEA 5I0DA 4DO0A 2RMU1 3BCWA 1IS6A 5CNAA 3VKMA 4QPWA 3ZYGA 4L2NA 1RUG2 3ZXJA 2QCSB 3CKHA 3WDVA 1R1A1 3AP4A 4X6QB 5FZ1A 3MGUA 1RUE2 2W52A 1BVVA 3OCPA 2LS6A 1GYKA 5EQUA 4CCKA 4TZDA 5FZFA 1DQ0A 3WHUA 3ZKYA 1ZZCA 4KGGA 4AVBA 2MNGA 2QDNA 3H9AA 3MI8A 4ZS2A 1D4M3 1GOFA 1XNTA 4FPGA 2PHWA 1IPSA 4YG6A 1ODNA 2VQTA 4NPLA 4WM7C 2WA3A 4CP0A 3CMGA 1ZZ6A 4PDWA 5FYZA 1W8HA 2OVUA 1H6XA 1LGCA 4LLOA 3W5MA 2YYOA 5KXDA 2QQKA 3SLIA 2OS2A 1K42A 5IUQA 2VMFA 2VO5A 4FBFA 3VZKA 5IJRA 2MEV2 1A8DA 3I2JA 3AZXA 4XE9A 3O1RA 1LOFC 3O1PA 2BW8A 2GN3A 2HWB1 1W3XA 5D2AA 5AFBA 4OI2A 4LITA 4QX8A 2VM9A 5FFOC 3E5UA 1DGLA 4AF9A 2Y0OA 4BA6A 4P9IA 1VAVA 4I09A 4LIVA 3MIFA 3IIIA 4AQ6A 4Q8KA 3BKZA 1JU3A 1GANA 2WRAA 3LCPA 2XBO3 2ZZQA 3ZSJA 1AL23 3I4IA 5FZDA 5FO7B 2GC1A 2GDFA 4OHYA 4GB32 1OLRA 3H7JA 1JH5A 4HSJA 2EAAA 1CESA 1HRV1 1R092 4XF1A 1AX2A 4XOGA 5LBFA 3U10A 3KMHA 1VBA1 3CQOA 5SV5A 4Z2WA 1LOFA 5F3CA 4I0BA 1DDLA 5FV3A 3ST7A 4IGPA 2MHFA 1HRV3 3POBA 5FMBA 1Y3TA 2X09A 4XIKA 4QX7A 1BEV2 3H8OA 4DMIA 4N43C 3GBFA 3M70A 4TLGA 5EFUA 4URAA 5DAQA 1WWYA 2WC2A 4CU9A 3AYEA 3U0ZA 3B5LB 2BU9A 3LWCA 1Y9GA 4WBBA 5I8YA 4KU7A 1HB3A 4K40A 4Q4W3 1UOGA 3VBRB 3VHOA 1Q8OA 2JE7A 2ZAHA 1W28A 4C0BA 5C3SA 5KHIA 1UF2C 3LOIA 5ABJC 5FLIA 3S6PA 2YFZA 4P00B 4RA0A 1UAIA 3HNMA 3OD0A 5FZLA 1UYYA 2WO1A 2ZEZA 5APAA 1Z7S2 4ASMB 3DF0A 2VECA 3IDCB 4Y20B 1CN1A 3BIEA 4MGYE 4QB6A 1RIRA 1ZBA2 1FMD2 5I0RA 4EV0A 1G9FA 4CCOA 4FOVA 2FDFA 3NVCA 4WM8B 3I8TA 4BJ0A 4CP9B 3VD9A 1DLLA 2RS52 2ET1A 3U75A 3TEZA 2E31A 4BYYA 1ACCA 3AL6A 4YVSC 2ATFA 4NHKA 2TBVA 1QEXA 5LA1A 2ZEWA 4LHLA 2R062 4GWMA 4BXFA 2A6ZA 1C5HA 4U2AA 3HN3A 1UU4A 2PLV3 4IEZA 4COYA 2CV6A 1ULOA 1PO11 4WM7B 2FCUA 1Z78A 1DLCA 1GNYA 3OTFA 4YM2A 1HRI1 2I45A 3VKNA 1QJX2 1QQP3 1D0GA 2WINB 3WDXA 3NV4A 1AHSA 4A42A 1YUDA 4I0AA 5LA9A 3AM2A 2FBEA 2VW1A 3ALQA 5M0TA 4LT5A 3D5OA 2VMIA 2A3WA 1HRI2 4LOSA 1JOBA 4GJZA 1IKQA 1WCUA 1W2TA 5FK8A 4NAOA 5A6QA 2D3RA 5A3OA 4A4AA 1H2NA 1FXZA 1S2BA 2P17A 2VXJA 4JDMA 3ACGA 5FQ0B 2HWF2 1JYVA 4Z2AA 5JI9A 1FYUA 1ODMA 4QPIC 3WF1A 3ZFFB 4Y22A 2BBAA 1VBE1 4DEQA 5D8AB 1Q56A 3ZXFA 1FMD3 5JSRA 5DZEA 2A3YA 3EQEA 4CU7A 1ASJ2 1XE0A 4IETA 1F15A 2X5IC 4Q0QA 3W58A 5I0SA 1LENA 3J7HA 2AZ5A 5FZ0A 5IK4A 5FPAA 2VOXA 4L8QA 1T6GC 4CPBD 1W06A 3DV8A 1RUJ2 4FCAA 1V6JA 2IZWA 4YG0A 4RSUA 4FAHA 2CTVA 2ZGSA 1QMJA 5C8CB 4ZPIA 3SKVA 4AGGA 4MVTA 3N9PA 4FXGB 2PHUA 3S57A 1PIV1 1IG3A 1XPWA 1MS3A 2TEPA 3TWIA 4O9EA 1OPOA 2KD7A 2W94A 4XAEA 4V2WA 5DUXA 1UPIA 4D3WA 1VB2A 5FXVA 1WW4A 1ZBE1 2VC9A 4IEYA 1QJY2 3S5QA 3ZN4A 3O0XA 1JZ6A 1D4M1 4LBJA 4N7IA 1WMDA 1JZ7A 2KR2A 5K0UC 1MZEA 3WY6A 1CGPA 5I0UA 1H6YA 2W1UA 2B39A 1VBD1 5GLVA 4AEDA 5BNPC 1CQ9A 1ND3C 2H0VA 2KA3A 1R093 3JCIA 1XXNA 5FZOB 1OH4A 3HNYM 3ILFA 4YVSA 1UMZA 3S30A 3VDDC 1VLNA 1IQDC 1ONAA 1W6MB 3MV11 1IS3A 2PAEA 3AYCA 3RS6A 1CAWB 4FFGA 5FZIA 4KH9A 4CA9A 3OPTA 5HI0A 1XE8A 1RJ8A 3UGGA 1W6PB 3PLQA 2Y64A 2VTFA 3USUA 2AC1A 1V70A 2R072 1JMUB 1YXWA 2O8OA 3B69A 4XQ4A 4E4HA 5IVCA 2BQPA 5J7MA 1KJRA 2ZTNA 5FY1A 2ET7A 3AP7A 3HMYA 5BNPA 3T30A 1TNRA 4D8MA 5A6ZA 1V0AA 1HRI3 3WUDA 5E1RA 1VRBA 3LSEA 4NHMA 1W6QB 4UYBA 2ZHNA 4Q4V3 2FZ1A 1GZCA 3HOBA 3BVCA 2D5HA 4DPNA 3IAPA 2UY9A 4DZGA 3B02A 5T55A 3RZMA 3PVOA 2PLV2 3VDBA 1W6OB 5L73A 1LOBA 2RM23 1H1MA 2R063 3OPZA 4QPGB 4A41A 1AL21 1L7RA 1DYKA 1SLIA 1TVGA 5DZFA 2YPDA 1US3A 4LE4A 3WW2A 2Y8KA 5LBBA 3ZDSA 3ACLA 1JZ8A 2GC2A 2B42B 2I74A 1EYBA 2Y6GA 2Q8OA 1H4HA 2CU5A 2XGXA 3LDRA 4HKWA 5ISLA 4NPRA 4KL1A 2DVBA 3JB4C 1JN2P 5FWEA 2Q8DA 5T52A 5DPNA 1O59A 3HR9A 5FJKA 4MH0E 3OSDA 1N1VA 2VMCA 2VNRA 5L9RA 1SACA 1SEFA 2WNUA 2WWSA 3OPWA 2VZSA 4XJ9A 4E27A 2HWC3 2BYVE 1R082 1PNGA 3ZFEC 3KM5A 2YBKA 4XDQA 1YIFA 2VZQA 4Y24A 1V9U1 3E6BA 4UT5A 1WA6X 3NO8A 5LEJA 5FKCA 1CVNA 4NPMA 3AMMA 2LALA 5IVBA 1TNFA 4QDRA 3UKVA 2WNEA 3HBZA 1OBNA 2XBO2 1AR82 1NCRA 2FCTA 2VUJA 2XL9A 4Q1RA 5GALA 1B35A 4YPJA 2CWMA 4AAXA 4GKYA 1NE6A 4RHV2 4A44A 2CGNA 1OKQA 2WWUA 4P9WA 4FPHA 2ZGLA 4TSVA 2A71A 3A21A 1WZXA 2ZGRA 5CIRA 5JIUA 2EXKA 3WT3A 2VOTA 4ATEA 3AMHA 1UN1A 4RQPA 3H42B 3PIJA 4XJ8A 3ZPYA 2WT1A 2F17A 2R30A 3ZIWA 1VBE2 3K4ZA 5FZKA 1UU5A 1XYPA 2ENRA 3BU7A 2BNMA 1RB8G 3OB8A 2CYFA 4CDWB 1PO22 2QE3A 3MIBA 4QXCA 1BKZA 1S4CA 2YZ4A 3M8LA 3H50A 1NT0A 3FN9A 1ULFA 4P9JA 3POEA 2J1UA 2IVJA 2XHKA 4I3GA 4OQ8A 2FDJA 1F8VA 1FATA 3Q8BA 2P2KA 4FPLA 2I07B 1AL0G 1REFA 2NZ9A 1UZYA 4UFMA 5LY1A 3USSA 2V4AA 2VBPA 1PK6A 1SDDB 2WT0A 3NJXA 3NNMA 4W6YA 4OLLA 4IW3A 1UL9A 4EJRA 2UYBA 5LB6A 2YG0A 1R091 1S0IA 3VHRA 2KM2A 1QXRA 3AYAA 5CISA 3ON7A 4DXSA 5JOZA 2WNOA 4L11A 4HETA 2J1AA 2FDKA 3NWKA 4OHXA 3N9NA 3WNPA 1UWWA 5LZ6A 2V73A 3ITQA 1NZCA 1ZRIA 4AFDA 4LBQB 1OPMA 1EAH2 1SPPB 2D6PA 2VTXA 3J4UH 2HBTA 2P5BA 1JOPA 2ZHLA 4XYXA 3N7JA 3RWNA 2YC2A 4IEVA 4ASKA 4CXYA 3A7QA 3W59A 4BZ4A 2IFWA 4MOAA 4ZU5A 4BXSV 2OX0A 2VZTA 2QQNA 4UBGA 1RITA 2EVXA 1LHOA 3P3PA 1V00A 3IIAA 5SV8A 3WZ1A 4CCCA 4U36A 5G05L 1N1YA 2FD8A 2ZS6B 1VBC3 1ALYA 3C3VA 4MUVA 4OCTA 4BB3A 1YQCA 1J1LA 3AVSA 2BBVA 2PHTA 2VNVA 3LFIA 1BBT1 3J7NA 1R083 1H1IA 2P3IA 4QGLA 4C0HA 4COUA 4XAAA 1YIPA 3K51A 4MGIE 4XTPA 4Q4V2 3G7DA 1S0FA 4KWJA 3DKWA 4D69A 1VAKA 3K4AA 5JI7A 2LRPA 3MHZA 2R16A 3AXDA 2GALA 2WIIB 1WCKA 4IESA 4GWNA 5F5AA 4BU2A 5J98B 1W05A 2PTMA 5FMOL 3AZWA 4E2QA 1UOBA 4YSFA 2VMDA 1PO12 5J36A 4H7LA 1EV12 1H2KA 4XEZA 2YC0A 4OYUA 1O5UA 4D6RA 5CKNA 1OOPB 2JG8C 3N7MA 1BEV1 2E53A 1XRUA 2PQSA 1HJFA 2C9KA 2VPVA 2WNUC 1J84A 4QHZA 5G04L 1PO23 1X82A 5JSPA 3O0WA 1AR73 2HWD1 3VHNA 4GIQA 1XNKA 3I2HA 4N53C 2A1XA 1FNYA 3PU3A 4HPKB 2Y6KA 4H3WA 5A1FA 2JE9A 4NOTA 4AVTA 4P9LA 2IVIB 2BWAA 3MFAA 3K3OA 2OXBA 5FXWA 4A2UA 4DINB 1QQP1 1JS9A 5IYYA 3VBFB 3B93A 2FDHA 3DECA 1JTZX 3LQCA 2VW2A 1OFSA 4RHV1 5A80A 1LOCA 2X29A 3OGSA 2VL4A 2Z79A 1ZYBA 4LBMA 1FPN3 2XJVA 1RXFA 4N7UA 4MXVA 1REDA 1UKRA 5EZWA 2IWGB 3LOBA 1GSLA 2PELA 1BZWA 3JZVA 5EHDA 4BK4A 2VXRA 2HWB2 3KGZA 2CL2A 3W20A 4CDQC 3VKFC 4YARA 4G3YC 1GQPA 2XJQA 3NKTA 4I30A 5C8WA 1ST8A 2AUYA 1O4YA 1NA1B 3WR0A 2RJLA 3DXUA 1ZBE3 5DZGA 1LCLA 1HQNA 1HXS3 4PT6A 5FZHA 1ND3B 3UKTA 4AHXA 1OHFA 1QOTA 5F37A 1J59A 3PNAA 5C4WC 3K48A 5C33A 5FY5A 4QQPA 3P1IA 1NKGA 4IEPA 3OUJA 2PN5A 4XJUA 1GR3A 3ZFGC 3O1TA 4CDXB 2DFCA 3ZXGA 3NJVA 1NLSA 1YI9A 3WEZA 1ASJ3 4CCNA 3HIFA 1TMF2 3WG3A 2W46A 4BQ3A 2WZ8A 3B94A 3WQ7A 1VE0A 2GNTA 5F32A 1IS4A 2JDNA 1CAUA 3DUIA 4E4DX 3LFMA 1DQ4A 3ABZA 1S0CA 3TNQA 4AZZA 2R0FA 3IN9A 2HWF3 3OGJA 1TMF1 2QQPA 2BVBA 3WNNA 4YVWA 1CIYA 2K2SA 4Y1XA 3ZLIA 5A3TA 5EV7A 4LJHA 2G4IA 1J3RA 1ND2B 5H9QA 1IOAA 5A32B 1OLMA 1V6NA 2CSGA 2B9VA 1BK1A 1J58A 1U5ZA 4OHVA 4YFZA 1SDWA 2PA7A 5A1LA 1VAMA 3HN1A 5JXIA 4O61A 3OBTA 2E51A 1AXKA 5DDJ3 1ZREA 2P4EA 1RUC2 1XSRA 5FQ0A 3AL5A 1AYN2 2QDRA 1OA4A 2UU8A 2BNNA 2EIDA 2LW8A 4A7ZA 1YYNA 1KXGA 5KC5A 1IQAA 4AQSA 4COZA 2ZEYA 2VAUA 1OUSA 1PVC3 2ZX0A 2D5FA 3R4UA 4OHWA 3RSJA 4LEJA 3I97A 3UETA 2WUHA 4M3CA 2ZGOA 1I9RA 3OGGA 1CD3G 4XDPA 2A7AA 5GJ6A 5B4NA 1HQLA 2VQAA 4RR3B 3WP4A 3KLSA 5FY7A 1IG0A 5KXCA 4TTGA 4AVCA 1UZVA 4LIUA 3R0RA 1G7YA 3PUSA 1V6OA 2VMEA 3LAGA 3ATGA 1LJ7A 3FL7A 4XURA 4QD2A 2EIEA 1KDKA 4META 3K75B 4EN6B 4G9SB 3ZYFA 1QH7A 1SFPA 4YGEA 4HVQA 2WS93 3JQWA 2Q30A 3UV9A 3VDDA 3VBFA 2XKOA 4ZZ5A 4YW7A 1UY0A 5K7PA 1QJY3 1UZZA 3LKJA 1PIV3 2ZX1A 3Q8FA 2AH2A 5C8CA 2PAKA 3KHBA 2CDOA 1W04A 2O0OA 2ERFA 3AMQA 2KXLA 2RVAA 2XJRA 1HW5A 2VW0A 4P5HA 4PIZA 1UU6A 1WKYA 3AXEA 5FR3A 4XACA 5DMYA 1MVQA 3BOPA 2E6VA 3CU7A 1MZ6A 1LOGA 4JDNA 4DOUA 1POQA 1UYZA 2XR4A 4FTBA 3FLPA 2ZMKA 4IEQA 4GULA 1NUKA 1VPHA 4XFHA 4OI0A 1XNBA 2JEMA 3RDIA 1GUIA 3RGBA 3ZSLA 3RZGA 5DAWA 2QQOA 4MHRA 1AX0A 2VVFA 3OGRA 2RJ2A 5FJHA 3WDWA 1QY4A 5K0UA 3ZXEA 4M4RA 2P6CA 2ZX2A 3RYKA 3O12A 2W2IA 4H7MA 3IM0A 1WUVA 2OUHA 1NOVA 2YGLA 2YHJA 3IPVB 2OT7A 1E5IA 2D98A 4H2AA 3ROUA 4LO4B 1VBC1 2E33A 4YWAA 4Y1VA 5FWJA 3VZMA 3CZUA 4QX0A 1U5IA 1W6QA 1DG6A 1ZRRA 4HFSA 2E63A 4NRMA 4BQXA 3BOWA 4TWTA 5AC91 3ZIXA 5I0TA 5JUVA 1H8TB 2CWSA 5C3QA 5DAPA 3WLUA 2E9QA 5LK5A 2JKXA 5IVYA 3FUQA 3BPZA 2QBXA 4AVAA 4CXWA 4FQ4A 1ZVFA 1W6NB 2X10A 4Y5SA 4P9GA 5C4WA 3LD8A 3WCSA 1JHJA 3T4VA 1POV0 3HEIA 4NVPA 3NQHA 3SCGA 2WA4A 5K4LA 1KS4A 2UWCA 3POYA 4RN5A 3N4MA 5FP3A 2XDVA 2H6CA 4B7EA 1VIWB 5BXXA 1AR72 3P5BA 4XF9A 2XVKA 1GZWA 1UXZA 5AC92 5BPXA 1PMIA 4CE8A 1W0NA 5T5OA 2NPIA 3K46A 4CP1A 2XB6C 5L7OC 1W9WA 2RE9A 3C7EA 1MZFA 4NHLA 4Z82A 5EJZB 5IFPA 1C8M1 2N7GA 2R071 2ZGMA 2Q1FA 5A7QA 2IXHA 4NMIA 4BQ1A 5DUVA 3AZYA 2XH6A 1E5RA 1RUF2 2B9UA 1CPNA 3EYPA 3BTXA 1AUYA 2VQ0A 4Y1YA 1Y4WA 1FOD2 2WABA 5FZGA 1ENXA 3J9SA 4CEYC 1S2KA 4ARYA 5L19A 2BFUL 4IGOA 2VBBA 2ZKLA 2EIGA 2J7MA 3GZTB 4K21A 4A7KA 4QX5A 1X50A 5DN2A 4ZY9A 3I3BA 5EPAA 3KT7A 5HPOA 1HB4A 4KGQA 5I91A 1WD3A 4X8PA 3CJIC 3WF4A 5KC6A 3AMNA 4I3PA 4B1MA 4AI8A 1OQEA 3D6EA 4FP3A 4JDOA 4AXOA 1ENRA 3AP5A 4CPBA 1XOYA 4GA9A 1DQ6A 3VDDB 2E7TA 4FFFA 2A6XA 2PYTA 4NJ4A 2ZZJA 1POV3 4RQPB 4JC1A 4CEYB 2RR12 4QMAA 3I59A 5FY9A 4CSWA 2P1BA 2WKKA 4QPYA 1CPMA 1LR5A 1MQTC 4NROA 2IXCA 4E4ZA 4B4QA 5DG2A 3JD71 4R4XA 1UY1A 4GB33 4X6RB 1FT9A 1KEXA 3JBG1 1UOJA 3VBRC 5IVFA 1OKOA 3F95A 2VMGA 2VU9A 2WQZC 1XB9A 1AL22 3I54A 4UXAA 4Q1PA 4GH4B 2VJXA 4IV3A 2RMU3 3QOPA 1LAJA 3THDA 3LA2A 1K12A 3JUUA 3TN93 3J8F3 1JZ2A 1X9TA 1UMIA 3KT1A 5IK5A 1VMHA 3K77A 1AYN3 3A0KA 2P3YA 1RUC1 3SH3A 1GP5A 1RHI2 1MQTB 1GV9A 4YZ3A 5KHGA 3EB7A 2G9ZA 1OUXA 1YLLA 4JVAA 2QQUA 1G9CA 5IK7A 1BBT2 2GP5A 4J1WA 4A3ZA 1LU1A 1WBLA 3RWKX 1A3KA 1YFXA 3KS7A 4P9XA 4DY5A 5JSOA 1GMMA 4Q29A 3AMPA 3UYJA 5AVPA 4CDXC 1RMU1 1LGBA 3LEIA 2OQ7A 4MXWA 1ENSA 2NM1A 1AR92 1OXCA 3CEWA 3UESA 4GH4C 3RFRA 5I93A 4FVVA 2RDSA 3I2GA 4ISRA 2R043 1R1A2 4PI0A 5FPZA 3T2PA 5FOBB 2D7FA 3RMXA 1RUE1 4Q4Y2 1UD1A 4BMEA 3WHTA 1LRHA 2ZMNA 3O1VA 5JZGB 4UOJA 3AZZA 5F2SA 3HD8B 5LEKA 4B1LA 2JDYA 2UURA 4RGKA 5FPXA 4ISQA 2GSYA 1NQJA 1LHVA 3I7DA 1POV1 5JR7B 3VBOA 3BGAA 2RDNA 2WSVA 5FDBA 2J1TA 3VD7A 2HWD3 1GWMA 3NV1A 5JR2A 4JV4A 1S2EA 1N47A 1Q8SA 2HEYF 4HOOA 1DGWA 3X29B 1I5PA 4F7ZA 3C7HA 4HG6B 4K7JA 5BNNB 4UFJA 1HXS2 3WW1A 5FK7A 2A73B 2P3KA 1QJY1 5A3WA 1YO8A 3FC0A 3IDEA 4XUOA 3OBRA 1UY2A 4C91A 5FO8B 4RYDA 3N36A 2P37A 2DBIA 4KU8A 1LGNA 2WNVA 2B8MA 3AKSA 3KCYA 4QX1A 3ZR5A 3QH7A 2FHRA 3AP9A 4JTNA 3KZ4C 1TME1 1PIV2 4DB5A 2NYYA 2D6NA 4LUMA 4HPKA 1FPN2 4XC9A 2VUCA 1QNYA 2Y0IA 1LB2A 4E9KA 2W68A 1MPXA 1OD5A 4S2DA 5CEHA 3HQRA 1RUC3 2PFWA 1UY3A 2OQ6A 3NW4A 4XXPA 1HKDA 1LEDA 3N35A 1GBGA 1VJ2A 2WLQA 2XVLA 1V9U3 2WN3A 3EBRA 4R9AA 4IV3C 5HXVA 4CCJA 1DHKB 4TN7A 4AEDB 4MSVA 5DABA 1NCQA 4XHXA 1C8M2 4UW4A 4UWDA 5J3UA 3QCWA 5F2WA 1YFYA 2DTYA 3D82A 4YVSB 4HSLA 1QJZA 3FUOA 1J1TA 2Y6JA 5FZAA 3ZN5A 1UY4A 4GB31 4EYUA 1KDMA 1AF9A
chains in the Genus database with same CATH topology
1JODA 1F35A 1JOBA 1JYTA 1ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOD A;  1F35 A;  1JOB A;  1JYT A;  1ZRI A; 
#chains in the Genus database with same CATH topology
 4EWE A;  4XUQ A;  1QIQ A;  4N90 A;  5F5I A;  3O7O A;  4L99 A;  1CON A;  4LUL A;  1EV1 3;  4XBN A;  1BJQ A;  1PHM A;  3DYP A;  4TXW A;  4ZU4 A;  2BJS A;  4JKL A;  2A75 A;  3ZXL A;  4AI3 A;  4B8E A;  1U12 A;  4PIY A;  4D6Q A;  4RGA A;  1ZA7 A;  3POF A;  4LK7 A;  2JDP A;  4LXL A;  1F4A A;  3ASI A;  3GM8 A;  3ECQ A;  4FPO B;  2JE8 A;  4XUT A;  3ZSK A;  3NKG A;  2WJS A;  4IV3 B;  3U1X A;  2HEW F;  1VMF A;  4WVM A;  1UMH A;  2HLE A;  4JX0 A;  4CVU A;  4DEV A;  5JXH A;  4CEW B;  2YV8 A;  4MGT A;  2AAC A;  1ZX5 A;  4FSJ A;  2W3J A;  4I01 A;  4QQH A;  5FCC A;  5LCW L;  3RRD A;  1CWP A;  2HWE 2;  5ACA 1;  2OZ6 A;  2DUQ A;  5AVA A;  2EAL A;  1IKP A;  2GH2 A;  2JKB A;  1RC6 A;  1CAV A;  2EXJ A;  1NAE A;  3OD4 A;  1LOE A;  5JZG C;  4QPI B;  3FHQ A;  1U0A A;  2FDG A;  1ENQ A;  3WW3 A;  1AZD A;  1NLQ A;  3PUI A;  4KG8 A;  4W4Z A;  5A7S A;  4QM8 A;  5D8A C;  2RS5 1;  3M3O A;  1PX3 A;  1NYW A;  4UFK A;  2ETE A;  3ZFE A;  2HWB 3;  4F3J A;  2PLV 1;  2ZHM A;  1KQR A;  4UW5 A;  4FP2 A;  4ES8 A;  1QJF A;  4XFB A;  4AE2 A;  5CAZ A;  4J1X A;  1QF3 A;  2WZR 1;  4LR4 A;  4AQ2 A;  4RS5 C;  1C28 A;  5JZG A;  3AKQ A;  3APB A;  5T3N A;  2NLR A;  1V6L A;  1Z7S 1;  1D2S A;  3GHM A;  3Q8C A;  5A33 B;  3I2F A;  1AR9 3;  4R52 A;  4S2F A;  3WDY A;  1ZRD A;  1I1E A;  3DKQ A;  2R6Q A;  4C90 A;  3NNL A;  5FZ8 A;  4WZC A;  4Q2F A;  1PGL 1;  4Y1Z A;  2CGO A;  5EJ3 A;  1AVB A;  4O9G A;  4QKN A;  2R7E B;  5LRS A;  1ZRC A;  2WNU B;  1O3R A;  1DZQ A;  1AR6 1;  1YNA A;  2HKX A;  5CFD B;  1LOD A;  1O4T A;  4F8A A;  3BI3 A;  1ULG A;  1WLW A;  1ZZ7 A;  1S55 A;  1IPJ A;  2RS1 3;  3BYW A;  3FBY A;  2WYS A;  3THT A;  1K5J A;  3TN9 2;  3SH5 A;  1WLD A;  5FZ4 A;  1SBE A;  2RMU 2;  2BP6 A;  3CZJ A;  5GZG A;  3T0D A;  3AFG A;  1LOA A;  3B9I A;  4WVW A;  3GNE A;  3DCQ A;  1GZ9 A;  4ZZ8 A;  4QKF A;  4LTA A;  4RR3 A;  3T2T A;  2D93 A;  2E7Q A;  1MS5 A;  2ZOE B;  5JWP A;  3PL0 A;  2R1D A;  1YHF A;  1NE4 A;  1YQ8 A;  2Z5W A;  1NLR A;  3ME2 A;  3Q9O A;  3SC7 X;  3WW4 A;  3WG4 A;  1OA2 A;  3R6S A;  1W0O A;  1MS9 A;  4FPC A;  5CFD C;  4EN8 B;  5A70 A;  4I2O A;  3M4F A;  1L7Q A;  1R64 A;  3IZO A;  3JBG 3;  2BER A;  1D4M 2;  2DUP A;  2XL7 A;  1QJX 3;  1QQP 2;  2IUW A;  3T2O A;  1F2N A;  3GAL A;  3O5S A;  3DPR B;  2VOV A;  5GZD A;  5CFC A;  1RUF 1;  3FFZ A;  2BGC A;  2GN7 A;  2H6B A;  3H3L A;  3J8F 2;  3NAP C;  2R0H A;  4XCA A;  3Q8E A;  2XLF A;  3WSO A;  1MS4 A;  5KXB A;  1ZZ8 A;  4OUE A;  5HXM A;  4YW5 A;  3B3Q E;  4AHW A;  3B9C A;  5F5Q A;  1QJU 3;  3FWE A;  5F3I A;  2HWF 1;  4HN1 A;  5GKA C;  2A5Z A;  2QQM A;  2HEV F;  1C4R A;  5HCH A;  3LE0 A;  2B5H A;  5CVR A;  1C5I A;  3M3E A;  5C71 A;  1X36 A;  5L9B A;  4LBN A;  1MR5 A;  2XHN A;  2W5F A;  3DN7 A;  3NJZ A;  4Q0P A;  1M06 G;  3I2I A;  1LEM A;  1UPS A;  2QJV A;  3WDT A;  3LDB A;  5CFC C;  1Q5O A;  3KF5 A;  2W91 A;  3NRU A;  3MEP A;  5EIY B;  4WM8 A;  2X53 S;  1LU2 A;  5FBZ A;  3MW4 A;  3N9L A;  4I02 A;  4BQ5 A;  4KWK A;  4LOT A;  1MS1 A;  1DQ1 A;  1UYX A;  3N9O A;  1C57 A;  4B7K A;  4DRR A;  1COV 3;  3INA A;  3PUQ A;  3T2Q A;  3ZSE A;  5FP7 A;  5A7N A;  3B01 A;  1PZ9 A;  5ABJ B;  1ND2 C;  3CJX A;  3T1L A;  2GC0 A;  1WMF A;  2GME A;  2W1W A;  1PMJ X;  2J1E A;  3ZFG A;  4QB2 A;  2GNB A;  4LA3 A;  4WM7 A;  1SPP A;  1JBC A;  3CL1 A;  5JMO A;  2BPA 2;  3WIN E;  1J3P A;  3MPB A;  5BUV A;  1N3O A;  4LPL A;  3EO6 A;  3ZM8 A;  1R1A 3;  2DU0 A;  4BH9 A;  2D3P A;  3E97 A;  3QH6 A;  4ZS3 A;  3ZFE B;  2DDU A;  3HQX A;  5C4W B;  3UKN A;  2DUO A;  4Y4Y A;  3ZX7 A;  2WL1 A;  3LIG A;  3D0S A;  2H0B A;  1HIX A;  3LA7 A;  1Y9Q A;  1UNB A;  1GWK A;  4MZU A;  2CY6 A;  1YC6 1;  2XXZ A;  3NV3 A;  1VP6 A;  1GZW B;  5L36 A;  4CCE A;  2RHP A;  1KGY A;  3NJY A;  3C7G A;  1DU3 D;  4XFG A;  5FPB A;  4IV1 A;  4JQR A;  5CB7 A;  3ZXA C;  1VB4 A;  5A6Y A;  5CG9 A;  1JYC A;  4MV2 A;  1BLZ A;  1RYY A;  2WQ4 A;  3CJI B;  2JX9 A;  1GWL A;  1OQ1 A;  1HLC A;  2CAU A;  3IKW A;  4XHB A;  3H8X A;  5CFD A;  3WNX A;  1YQ6 A;  4JTO A;  4ET7 A;  5JCT A;  4HLT A;  2QTW B;  5AC9 3;  4OUS A;  3U07 A;  4Q5O A;  3GZA A;  4SLI A;  4L97 A;  4XIL A;  2UWB A;  2VZP A;  1SLL A;  4KG0 A;  4MGK E;  1PO2 1;  5FYI A;  4OUM A;  4FTS A;  3RG0 A;  1KFX L;  1BK0 A;  4R4Z A;  4TYS A;  3M1H A;  4W50 A;  5FMO S;  4EN0 A;  4IE0 A;  2JDH A;  2OPK A;  3WNO A;  1VBB 1;  2QNK A;  4BCU A;  3E6C C;  2SLI A;  4IE5 A;  4QWN A;  4BM8 A;  4BIS A;  3MPP G;  1STM A;  4FPE A;  3VLB B;  4LO8 A;  1U5Y A;  4XIO A;  3I3D A;  5BY5 A;  4FAG A;  5CZK A;  1OOP C;  1MEC 2;  2JG8 B;  1ULE A;  4PHZ A;  5FP9 A;  2X05 A;  1RIN A;  2UY8 A;  1VAL A;  1WBF A;  1EV1 1;  3FZ3 A;  3ES1 A;  3DPR A;  3T3Y A;  3KB5 A;  3OF1 A;  5FUN A;  2Q8C A;  4YRD A;  4OZO A;  4QGN A;  4PJY A;  2BV4 A;  3PDQ A;  2E26 A;  2OUJ A;  5J37 A;  2JG9 C;  3VBH B;  1JOJ A;  5FZO A;  4YM3 A;  5FMC A;  4AWD A;  3WF2 A;  1COV 2;  5IT6 A;  3J8F 1;  1A6C A;  2PQQ A;  1JUI A;  2V72 A;  1UX6 A;  5E6H A;  4B4P A;  5LK7 B;  3TEW A;  3KF3 A;  3SHR A;  1OLQ A;  1G9B A;  5T50 A;  1RUJ 1;  3BAL A;  1URX A;  2D40 A;  1W8T A;  3FBM A;  3T09 A;  1HXS 1;  3UGF A;  3UL2 A;  3NMB A;  3DYO A;  2JG9 A;  4N43 A;  4P5Y A;  2VVE A;  4YVW C;  5HBA A;  4QU1 A;  3O1U A;  5I8S A;  3K2O A;  4CDQ B;  3LA3 A;  1W9Y A;  1CX4 A;  2QQJ A;  3WVJ A;  5ERL A;  1H8T C;  2JDK A;  3OEB A;  4QM9 A;  2RDQ A;  1OF3 A;  2FQP A;  3PUA A;  2YB7 A;  4JHZ A;  4PCR A;  5IAV A;  3ZMN A;  1VR3 A;  1O8S A;  1IGO A;  5F3G A;  1Q8Q A;  4S2H A;  5FPL A;  2C0Z A;  4LUK A;  5ABJ A;  4JRL A;  4XTM A;  2WFF 3;  3HJR A;  1CAU B;  2B45 X;  2ORX A;  2VD7 A;  3G6J B;  5ANQ A;  2VUA A;  1G9A A;  1SLT A;  2DVG A;  4NUB A;  3ZFG B;  3SIT A;  3AC0 A;  3VDC A;  4ZKT B;  1RJ7 A;  2K46 A;  4LLF A;  1NXM A;  4EQV A;  2WO3 A;  2ZGQ A;  4RFR B;  5DDJ 2;  1MAC A;  5JLV A;  4YVW B;  1TZO A;  3RQ0 A;  3I2O A;  1DFQ A;  2BFU S;  3KV4 A;  4QKD A;  4CUC A;  5FTT C;  3MDP A;  1APN A;  4XF3 A;  2VG9 A;  4CDU C;  1WLC A;  2ZGK A;  4LHN A;  2PHL A;  2WYF A;  1OVP A;  1GLH A;  3DXT A;  4MX3 A;  5ACA 3;  2XWJ B;  4AFA A;  2VE1 A;  4D0Q A;  4M4P A;  2G1M A;  3S7E A;  1H9W A;  3NV2 A;  3OGV A;  2RS3 1;  3LPG A;  5IW0 A;  4AHZ A;  4NO4 A;  1H8V A;  4FOQ A;  1OUR A;  5K8S A;  2OPW A;  2ZAB A;  1D0H A;  1JYW A;  3CIH A;  3VD4 A;  1PZ7 A;  4PBP A;  4IXL A;  1XND A;  3IBM A;  1Q3E A;  2R49 A;  4D7S A;  4E2G A;  1TMF 3;  1VBD 3;  1US2 A;  3ETQ A;  5B2G B;  1WCD J;  3THC A;  2G19 A;  2C6S A;  5EJ1 B;  4BWO A;  3U4X A;  4DXZ A;  4IV1 C;  4XET A;  5LBC A;  3OY8 A;  5KHH A;  1KIT A;  2GU9 A;  3VBU B;  1NZI A;  1QH6 A;  3IAQ A;  2WAO A;  2GZW A;  2NQY A;  3RZZ A;  5E88 A;  3VKO A;  4A45 A;  3SCH A;  1WW6 A;  3MIH A;  1RHI 1;  1OFN A;  2JIG A;  1NCR B;  4YG3 A;  3BN6 A;  1EPW A;  1REE A;  5L9V A;  1BVP 1;  3GJB A;  2FMD A;  3BPS A;  4RQP C;  3THP A;  2RR1 1;  2DV9 A;  3W9A A;  4XBL A;  1DYO A;  1ULC A;  2BRT A;  4PLN A;  1JYX A;  1WCS A;  4YW1 A;  3EMR A;  4BQ2 A;  5FZ6 A;  1BMV 2;  2XG3 A;  3LB9 A;  3N7L A;  3N9M A;  5CU1 A;  4Q4Y 3;  2IC1 A;  5CYY A;  1OF4 A;  1FAY A;  1AYM 2;  1S0B A;  2FMY A;  3D8C A;  3MW3 A;  4M3C F;  5FZM A;  1Z0H A;  3VZL A;  5A3U A;  5AFE A;  3MZH A;  4QXK A;  1XC6 A;  4K8R B;  1MEC 1;  5JVV A;  3WF0 A;  1NX9 A;  4JAA A;  4JGZ B;  3FFQ A;  5KR7 A;  4YZ1 A;  3ACI A;  1CZV A;  2XJU A;  2ZAC A;  4CEW C;  1QWR A;  1U5X A;  2FCV A;  3I3Q A;  4XJA A;  2RJK A;  3UGH A;  3VBH A;  2HH9 A;  1SZB A;  3BIW E;  4P08 A;  5FUI A;  4GJY A;  3MID A;  4W65 A;  1ZRF A;  4OHZ A;  3ILR A;  3ZDV A;  4CUB A;  4XMI A;  4P9Y A;  1R1Z A;  4PLO A;  3KQR A;  2BDR A;  3VL9 A;  1DF0 A;  1PGW 2;  2XKP A;  4AEJ A;  4OMC A;  2QVS B;  2WFF 2;  5JIA A;  1RTV A;  2J1V A;  5J48 A;  4JGZ C;  3D4K A;  5FZ3 A;  3VZN A;  5DG1 A;  3TOJ A;  3RZH A;  3SKJ E;  4CU6 A;  4NID A;  1MS8 A;  1W0P A;  2VZ3 A;  4CEW A;  1K5M A;  3POI A;  4D7Y A;  3MF6 A;  1PX4 A;  5IFT A;  1AR8 1;  4M00 A;  2JDA A;  1C1L A;  4BHP A;  4CDW C;  2XLG A;  1CAV B;  3PVN A;  3WP5 A;  2EA7 A;  3L2Y A;  2ZGT A;  1E5H A;  1CR7 A;  2LRO A;  3KSC A;  1HB1 A;  2D6O X;  1W8U A;  4LBQ A;  1V9U 2;  1H8T A;  2K0G A;  2ZPX A;  2YBS A;  1DGR A;  4QPI A;  1O7F A;  1OT5 A;  2DCZ A;  4Y1U A;  5FRE A;  4I0W B;  5C70 A;  3AJY A;  1W2N A;  1L7L A;  4FOW A;  4YZ5 A;  4ERO A;  1WMX A;  1AXZ A;  1RUE 3;  2XON A;  1T6B X;  1F35 A;  4Y5T A;  2XQR A;  1SLC A;  1WW5 A;  2X5I B;  3KCX A;  2CGP A;  2BTV C;  1RUG 1;  1NY7 1;  2LUW A;  2HJI A;  1UXX X;  1K5M C;  1DQ5 A;  2YBP A;  3C8X A;  4JCK A;  5FXZ A;  4B29 A;  4FPY A;  1X33 A;  4XFF A;  4EZ4 A;  3NL1 A;  3RI9 A;  1H1A A;  1N3P A;  2HYX A;  1HQW A;  3N9Q A;  2EF6 A;  4BPZ A;  3V65 A;  2Z2S B;  3LIH A;  3MFC A;  3KV5 A;  1UIK A;  1UZW A;  1JU4 A;  4XFA A;  3FJS A;  4DY3 A;  1W2U A;  1MEC 3;  5FLH A;  3VBU C;  4DIQ A;  2UWA A;  4CTE A;  1DIW A;  1MVE A;  1LHN A;  2JEN A;  3KVB A;  4Y22 B;  3BTZ A;  1UW8 A;  2JDU A;  4MGQ A;  4PIX A;  4ZON A;  1NCR C;  3KQ4 B;  4FI9 A;  2FDI A;  2PMW B;  4FO9 A;  4QU2 A;  3ILN A;  2ZX4 A;  4XQD A;  2RM2 1;  3PUH A;  5FRA A;  4ARX A;  4DUW A;  2A6Y A;  3PTY A;  4LA2 A;  5L7O B;  1ZBE 2;  2RS1 1;  2GND A;  2PXJ A;  4UFL A;  4F83 A;  4Z1V A;  2YXS A;  1JHN A;  4Q0V A;  4R9B A;  4KWU A;  4Q4W 2;  1QJU 2;  1H9P A;  4ES9 A;  3T0A A;  1WCQ A;  2JEC A;  4D94 A;  2OYZ A;  2GNM A;  5A1A A;  3RVH A;  1TG7 A;  4YYO A;  1HJG A;  4JKK A;  4MLO A;  1XE7 A;  4X8N A;  3VKL A;  4AFC A;  3VHP A;  2B4K A;  3GJA A;  3VZJ A;  4C1X A;  3B7M A;  3POJ A;  1F5F A;  4AI0 A;  1QJU 1;  3CHX A;  4Q8L A;  2Y34 A;  2R04 2;  4FOY A;  4QKB A;  2ZGN A;  2P34 A;  3UJO A;  1X9P A;  3OUI A;  2IXJ A;  5BNO C;  2ARC A;  5KHJ A;  2PHR A;  2CAV A;  2QKD A;  1G86 A;  1HB2 A;  1S1A A;  1VBE 3;  4FFI A;  3VZO A;  5LWB A;  3JBG 2;  4IE6 A;  5CFC B;  4Q27 A;  4Q0S A;  2Y33 A;  3T08 A;  3MUZ 1;  1GP6 A;  1VMJ A;  3BTA A;  3H1M A;  2W47 A;  4IE4 A;  4JGZ A;  5FUP A;  5FXX A;  1RUI 1;  4C1W A;  2QZ2 A;  1R08 1;  3JD7 2;  4XAB A;  1QXP A;  4IEW A;  3FMG A;  1BYH A;  1BBT 3;  3V64 A;  4A7Y A;  3AK0 A;  2WLP A;  5FZ9 A;  5JPM B;  3OYW B;  2R1B A;  3K3N A;  3IT8 A;  4ONU A;  3WG1 A;  3V0B A;  4E8C A;  2BOI A;  4PF1 A;  4PBO A;  1IHM A;  5EXO A;  5FP4 A;  5T54 A;  4YFW A;  2IFR A;  2F6B A;  4UW6 A;  2PHX A;  4XUN A;  2TNF A;  3IDB B;  3AZV A;  1CAW A;  3PHM A;  1AX1 A;  4YLZ A;  3HT2 A;  2VMH A;  2D97 A;  2Q1Z B;  2DCK A;  3U78 A;  1W6P A;  4JQT A;  1UYP A;  4CUG A;  1HV0 A;  3LZZ A;  3V56 A;  1BMV 1;  4UFI A;  4GH4 A;  2GMM A;  2VUL A;  4M0N A;  2DYC A;  3USU B;  2J1S A;  5KBF A;  4GD4 A;  4QPG C;  4XF0 A;  2GH8 A;  5HCF A;  2VCC A;  3AKP A;  1GZT A;  3SMH A;  5JMC A;  1BCX A;  1OVS A;  4FPJ A;  2MEV 1;  4NHX A;  4UAP A;  2WFP A;  1RMU 2;  3POG A;  3U37 A;  1SBF A;  2C4X A;  4WZF A;  5E16 A;  4URT A;  3L2H A;  1GQG A;  3UK9 A;  2VZ1 A;  3H3Z A;  3ZKU A;  5IAT A;  2RR1 3;  3SH4 A;  1YQ2 A;  2XJP A;  2WZR 2;  1PVX A;  3GDB A;  1VBC 2;  1EUT A;  1HN0 A;  5H9S A;  1H30 A;  4DUV A;  3EHK A;  2ZBJ A;  4Q4Y 1;  5F9T A;  4AEM A;  5T5L A;  5FZC A;  4NIG A;  1DYP A;  3GZU C;  4CUA A;  2QZ3 A;  2JD9 A;  4XW3 A;  3KV9 A;  3AJZ A;  5JDB A;  4IGQ A;  2ZCW A;  4AR2 A;  2ARA A;  3QLQ A;  4C8D A;  4QPG A;  4R9D A;  3FHA A;  1CJP A;  3RJR A;  3H8U A;  4BQW A;  3M3I A;  4NN0 A;  4XMA A;  1EAH 3;  5TSW A;  4CXX A;  1O3T A;  1IPK A;  4QHO A;  1H2M A;  3GYD A;  3MYX A;  3OBZ A;  1W2A X;  1FI2 A;  1W90 A;  4S2G A;  4ZU7 A;  1H2L A;  4V2V A;  2HWE 3;  4FT8 A;  5LAT A;  1ZNP A;  4Z8B A;  3VBO B;  1UIJ A;  5C9A C;  5T5J A;  1JUH A;  2VQU A;  1VBA 3;  4AYU A;  4H14 A;  1YWK A;  5F8P A;  3POS A;  1XU1 A;  4RD7 A;  1ZZB A;  2YGM A;  4YGD A;  1QJE A;  4AOC A;  3MBW A;  4KQ7 A;  2NMN A;  3J26 N;  4J6G A;  1RUD 1;  5KXE A;  1PVC 2;  2CHH A;  4GAZ A;  4N53 A;  1I5Z A;  3OOX A;  2YU1 A;  1KJL A;  2ZML A;  4LBK A;  4B4R A;  4K1Z A;  1O4Z A;  4HVO A;  5HV4 A;  2XUE A;  3RJ2 X;  4V1P A;  3IWZ A;  1GU3 A;  4QDS A;  1LNS A;  4CP2 A;  4PF5 A;  1J3Q A;  1GOH A;  1WA4 A;  4GXL A;  4W8J A;  1I3H A;  4ASL A;  2ZAA A;  2SBA A;  5FYS A;  2J42 A;  5K9Y A;  5FY4 A;  1UCX A;  3Q8A A;  5KWR A;  4DUX A;  2GP3 A;  3GCW A;  1WGP A;  3RMY A;  3T0B A;  2D6K A;  2JG8 A;  1O6U A;  2BWC A;  4LBL A;  2D43 A;  4M01 A;  4HAN A;  4HN0 A;  4XCB A;  3O1S A;  5IHR A;  4AEK A;  4XJW A;  5A7O A;  4COV A;  3MF9 A;  4KNC A;  4UBH A;  5J96 B;  2R04 1;  5FYT A;  1OD3 A;  3WP3 A;  4P02 B;  4EE2 A;  1PGS A;  1C1F A;  2Y6L A;  4LOR A;  4Y4R A;  4AFM A;  4LNV A;  1KS5 A;  1Q8P A;  4Q0U A;  1F4H A;  2YUE A;  5BNO A;  4BMB A;  3V0A B;  1AYM 3;  3OYW A;  4GWI A;  3WP6 A;  2R07 3;  3PJY A;  2Y60 A;  4GZ9 A;  1FPN 1;  2DF7 A;  4IUG A;  1X8E A;  1G8W A;  4QAW A;  4LK6 A;  1CAX B;  3ZO0 B;  2RS3 2;  2RS1 2;  4KI5 M;  4MG2 A;  2BOJ A;  5FIX A;  5T5P A;  1OC1 A;  4DFS A;  2WWJ A;  4XBQ A;  1YJL A;  3OJB A;  5JXG A;  1I6X A;  2O1Q A;  4K9S A;  1A78 A;  1N1T A;  2QFE A;  5GZF A;  1RUJ 3;  3AYD A;  5C5U A;  3A23 A;  3HNB M;  2OA2 A;  5HCB A;  1RUO A;  3HT1 A;  5K0U B;  3BUC A;  2OII A;  3NST A;  2GMP A;  4HMZ A;  1PK6 B;  3S7I A;  3RZK A;  2QQI A;  2W39 A;  4CDU B;  1Y43 B;  3IDA A;  3NAP A;  1X7N A;  1JYI A;  2JB8 A;  1VBB 2;  5DDJ 1;  3GGL A;  4L92 A;  4RS5 A;  3H8R A;  1XYO A;  1KD7 A;  1SFN A;  4EN7 B;  4YGC A;  5GZC A;  1G9D A;  3I3E A;  4LHS A;  2ES3 A;  4Y5Z 0;  2VVD A;  2A3X A;  5FZ7 A;  4E4S A;  2R06 1;  3J7M A;  3RZL A;  1CZT A;  3FLR A;  4TLF A;  4N9H A;  2JXA A;  2BZD A;  4JZR A;  2LTN A;  4KBZ A;  4M3C E;  4WVV A;  3S0M A;  5C5T A;  4BE3 A;  4IL7 A;  1QNW A;  1GP4 A;  5F6K A;  4A6O A;  4Y33 A;  4QXH A;  4NR1 A;  4XF4 A;  3SIS A;  1W6N A;  1O5L A;  2AR6 A;  1LEC A;  1W39 A;  1W8O A;  2W9X A;  5GM0 A;  3SQO A;  3U11 A;  4LKE A;  3N3H A;  5C9A B;  4Q4V 1;  5F6L B;  2EAK A;  1QJX 1;  5FP8 A;  1UZ0 A;  3GCX A;  2BGO A;  3OEA A;  3WUC A;  2BGP A;  2XUM A;  3PVE A;  4CYD A;  2DVA A;  3AB0 A;  4IER A;  3SCF A;  4MHU A;  4NIH A;  1HN1 A;  1LES A;  4YM0 A;  5CKQ A;  4GMP 1;  5EYX A;  1UO9 A;  5FY0 A;  3W5N A;  3OBA A;  5IAX A;  2VCM A;  4XDO A;  3ZFF A;  1WME A;  4NRQ A;  5A3N A;  2WBK A;  5DAV A;  2C1F A;  5D21 A;  3KD4 A;  3HAG A;  1OLM E;  1QOO A;  1GQH A;  4YGB A;  4DRV A;  4PDW C;  1VRH 2;  1YQ5 A;  5C8C C;  4FPF A;  1W3V A;  4WVZ A;  1PO1 3;  4Z07 A;  3VBF C;  4BOW A;  5FYV A;  1O3S A;  4OVE A;  1RGS A;  2GAU A;  3GBG A;  3ZPO A;  3QAC A;  3OY8 B;  2D44 A;  4AVV A;  1PGW 1;  2ZHK A;  3KVA A;  1OOP A;  4IEU A;  2QQV A;  1A8M A;  4PI2 A;  4NRP A;  2BNO A;  1DCS A;  1H4G A;  3NNG A;  2QQW A;  4IQP A;  3LEK A;  4K20 A;  3ES4 A;  5C7G A;  4HT1 T;  2AEN A;  3WNM A;  2WZE A;  5B4X A;  3PIG A;  4MGS A;  5A6X A;  1EY2 A;  2DBN A;  1H0B A;  1SLA A;  2PAM A;  1RUN A;  2RDR A;  1E5S A;  2YRO A;  5GLW A;  1QDO A;  1OA3 A;  5JOY A;  3POW A;  4D6S A;  3CBN A;  5IWF A;  5CA6 A;  5A7W A;  4LBQ D;  1OH3 A;  2WO2 A;  1YFU A;  3BB6 A;  2CNA A;  3CLP A;  3WX5 A;  1JXN A;  3E5X A;  3TN9 1;  4UF0 B;  2F4P A;  2VBD A;  3ZYH A;  3BTY A;  1HX6 A;  1PVC 1;  1SG3 A;  4XVH A;  1W99 A;  5KHK A;  1VRH 1;  4CEY A;  3AP6 A;  1O91 A;  3WXP A;  2YPJ A;  3I59 B;  1EUU A;  5BNO B;  5ANN A;  3FHI B;  2PHD A;  3AX4 A;  1BEV 3;  2WZR 3;  2IXK A;  4Q4W 1;  1HRV 2;  2VH9 A;  1CAX A;  5J1X A;  3DPR C;  3WQB A;  4K1Y A;  3S5A A;  2Q1M A;  2VZU A;  4EWA A;  5IVJ A;  3CO2 A;  2DFB A;  3A4U A;  3MIG A;  4XQW A;  1FOD 1;  1OI6 A;  2VUD A;  1CZS A;  2ZA9 A;  3JU9 A;  1C8N A;  3MLL A;  3PU8 A;  2DCT A;  4ZXK A;  2W08 A;  4AI9 A;  4CCM A;  1WLT A;  4CDX A;  3ACH A;  1GOG A;  2XVG A;  3M3Q A;  5EP9 A;  2RS3 3;  4CDU A;  4ATF A;  1K5M B;  1RVF 3;  4K8F A;  4L0P A;  2MPF A;  4J25 A;  2D6L X;  3WDU A;  3MO4 A;  3MUY 1;  4KBB A;  4RS5 B;  2IXI A;  5DQ0 A;  3UNP A;  1MQT A;  1EAH 1;  3C7F A;  3MV0 1;  1Q8V A;  4FXK B;  3BOD A;  2E32 A;  4OUL A;  2C26 A;  2G9G A;  4LO6 B;  3C2U A;  3T4H B;  1JYT A;  2Y6H A;  4JGY A;  5J09 A;  3KGL A;  1AJK A;  3PUR A;  5H9P A;  3WCR A;  4Q4X 2;  3I49 A;  2VY0 A;  2P6H A;  3VDA A;  5F7U A;  2HWE 1;  5FYB A;  5ACA 2;  2XWB B;  5F39 A;  3MLK A;  5BNQ A;  2AEY A;  2JJ6 A;  2HWC 1;  1TEI A;  3RPQ A;  3MIE A;  3ZN6 B;  5FYH A;  4QX3 A;  2R32 A;  1YFW A;  1S0D A;  3E5Q A;  4W6W A;  5LRR A;  3W21 A;  1KRI A;  1P8J A;  1ND2 A;  3H1Y A;  2ZJC A;  3M3C A;  5A32 A;  1CIW A;  2X5I A;  3QD6 A;  4R8H A;  1OQD A;  5FZB A;  3PVB B;  2D6M A;  2WS9 1;  4KWL A;  1RHI 3;  2Y6F A;  1AJO A;  1YEW A;  2JDZ A;  4LHK A;  5H9R A;  2YY1 A;  3PMS A;  4MYE A;  2WQ8 A;  4PDW B;  2VNO A;  2UYA A;  4GQ7 A;  4Q4X 1;  1C3H A;  3I2K A;  3VD3 A;  1SMV A;  3TEY A;  3LPF A;  3ZYB A;  3ENR A;  1ZZ9 A;  2QQL A;  1MS0 A;  3JQX A;  4IV1 B;  1RUG 3;  2ADD A;  4QX2 A;  3ZSM A;  4CCD A;  2A6W A;  2ARX A;  2DCY A;  1YJK A;  1BQP A;  3ZYI B;  1RVF 2;  4COW A;  3GHN A;  3SEE A;  2DWR A;  2J22 A;  3CJI A;  4QHB A;  1N3Q A;  4QXB A;  3TBD A;  2JB4 A;  3WQ0 A;  2E7A A;  2W95 A;  1FMD 1;  2Y26 A;  4QT6 A;  2MEV 3;  4AHY A;  3U14 A;  4HK9 A;  1W2O A;  2DTW A;  4L9B A;  3VL8 A;  3WV6 A;  1PM4 A;  2OKX A;  3ZR6 A;  2WN2 A;  5BNN A;  1UX7 A;  4CZS A;  1NXD 1;  3OG2 A;  4QDQ A;  1QKQ A;  2VOW A;  5HCA A;  1S0E A;  1G6N A;  5L7O A;  3O1O A;  5FMD A;  3I3M A;  4G4F A;  3WG2 A;  3ELN A;  4AG4 A;  5F3E A;  3T1M A;  5IVE A;  2WNV B;  1COV 1;  2O8Q A;  1QU0 A;  2EIB A;  1RL3 A;  1OMI A;  4PQ9 A;  4YW2 A;  5FKB A;  4NWV A;  4QB1 A;  5A7P A;  2YDE A;  1PM7 A;  1TQ5 A;  3E1F 1;  4XFC A;  4GMP 3;  2X8K A;  4AW7 A;  2XBO 1;  1V6M A;  1JI6 A;  5C3P A;  1DQ2 A;  2JIC A;  1UOF A;  1GFF 2;  1B09 A;  4BQ4 A;  4JRA A;  2VCA A;  2VGD A;  3QBQ A;  3VBS A;  5BNN C;  2DU1 A;  4LMF A;  5A3P A;  3SXW A;  2RM2 2;  1XYN A;  4UF0 A;  4DS0 A;  2VTX J;  1Y7B A;  1XJA A;  1SCR A;  4QQO A;  3VBR A;  3LGR A;  3OUH A;  5LA2 A;  4OZX A;  1NCQ B;  3P6B A;  3WNL A;  3WNK A;  2K9Z A;  1FOD 3;  1FV3 A;  2WSU A;  1RMU 3;  1W8W A;  2JDM A;  2AYH A;  4GWJ A;  3VBS C;  1NQD A;  3HBK A;  1UQX A;  2JIJ A;  1LHW A;  4HKL A;  4LQR A;  4CDW A;  1RUF 3;  1QGL A;  1DGW X;  5HV0 A;  4JGY C;  3B00 A;  2O14 A;  5C6C A;  3DGT A;  1Y9M A;  4BIO A;  4Q4X 3;  4Y20 A;  1CX1 A;  1XNC A;  3O14 A;  1K3I A;  1ASJ 1;  5IVV A;  3O0V A;  2JG9 B;  4N43 B;  3VBH C;  5FO9 B;  1NY7 2;  2OZJ A;  1VRH 3;  1F31 A;  5LBE A;  2YC4 A;  4HL0 A;  4JKM A;  4Y3O A;  4E2S A;  2F4L A;  1AXY A;  2Q0A A;  4E8D A;  5CKM A;  3TAY A;  4AED C;  1DBN A;  3KT4 A;  4K3U A;  2C5D A;  3EXU A;  1TME 2;  3CNA A;  3LSD A;  4DXT A;  2EXI A;  2XQX A;  3IPV A;  3JB8 A;  4D7T A;  1ULP A;  4Y26 A;  1AYN 1;  4NWW A;  2IXL A;  3R4D B;  4QQL A;  3KV6 A;  1W8N A;  2JWP A;  4UW3 A;  1O3Q A;  3SEP A;  4JGY B;  4EWD A;  3H0O A;  3VBO C;  3JD7 3;  5GLU A;  4UFH A;  1NA1 C;  3R4S A;  2TUN A;  5EYY A;  5FYU A;  4BLI A;  2ARB A;  2VOK A;  1LKN A;  3ZYP A;  2DUR A;  1F5J A;  4NAM A;  4XJZ A;  3ZN6 A;  1RUH 1;  4BLJ A;  5DUW A;  4JHT A;  3NNJ A;  3ETP A;  4FPK A;  3DYM A;  4RHV 3;  2P3J A;  4AGV A;  2FZ2 A;  4LBO A;  4AVS A;  1GKB A;  2W1S A;  1DGR N;  2Y38 A;  3ZXK A;  4ZHN A;  2NP0 A;  3VV1 A;  3IMN A;  1AR8 3;  1D4V B;  2JD4 A;  2ZGP A;  5A33 A;  1FX5 A;  2Z69 A;  4AI2 A;  1J83 A;  3HQU A;  3HVD A;  5LAS A;  2WS9 2;  2W92 A;  1BXH A;  4AFB A;  5JAX A;  3VD5 A;  2ZGU A;  1T2X A;  3EJK A;  4YM1 A;  2XJT A;  1NG0 A;  4YW3 A;  2WAA A;  1JZ4 A;  4YW4 A;  1PMH X;  2VCB A;  2WR9 A;  5D8A A;  3VUO A;  1ZBA 1;  2Q4S A;  2WDB A;  1D2Q A;  1TE1 B;  2HWC 2;  1RUI 2;  3CF6 E;  4XXA A;  2OW4 A;  1YCI A;  1W9S A;  4LKF A;  4N53 B;  4YNI A;  4EZH A;  2D3S A;  1GIC A;  4YZ2 A;  3ZXD A;  2NMO A;  2QUO A;  4HZF A;  2EIC A;  3JXS A;  4FQZ A;  1RUD 3;  4XZP A;  1LTE A;  4OI4 A;  3VBU A;  2DCJ A;  4A6S A;  2W87 A;  2LM3 A;  1RUH 3;  3HPN A;  3LEM A;  1KFU L;  3ORJ A;  3PTR B;  4HXC A;  5DXD A;  5FPV A;  2WO7 A;  2V4V A;  3LDK A;  5FOJ B;  4A3X A;  1JOD A;  5I8T A;  3ZYJ B;  2VZV A;  3NNF A;  4BQY A;  2VZO A;  1DP0 A;  2WT2 A;  3DEM A;  2CDP A;  1X8M A;  1IZ3 A;  3AKT A;  5JPN B;  1JZ3 A;  5DAX A;  1QHD A;  4AK3 A;  5GLT A;  2AGS A;  2ZX3 A;  2ADE A;  1ZM1 A;  5LA0 A;  1LHU A;  4N9I A;  4FTE A;  1V6I A;  1C8M 3;  3VBS B;  4HK8 A;  2EXH A;  4HON A;  5FPU A;  3GXU A;  3J7L A;  1JYN A;  4N8M A;  2NN8 A;  4K6B A;  5GLZ A;  1B35 C;  2C9A A;  3ZOI A;  3D3A A;  2BVV A;  1PK6 C;  2C24 A;  3H3U A;  3VN4 A;  2PHF A;  3L9J T;  3V0A A;  3RI8 A;  4RR3 C;  5A3M A;  4AQT A;  1YRZ A;  3I2D A;  1PZ8 A;  5EWS A;  1V6K A;  2HYK A;  2YFU A;  3TYJ A;  1ZA4 A;  4WM8 C;  1IS5 A;  1W6M A;  2I2S A;  3GBW A;  4LO5 B;  1S0J A;  4GMP 0;  1RXG A;  4UI9 L;  5D1I A;  4DXR A;  4MAD A;  3F2Z A;  2ILM A;  5E89 A;  4OQ9 A;  5FYM A;  1NA1 A;  1AR7 1;  2ZEX A;  1QDC A;  4XPV A;  2RS5 3;  5GZE A;  1AYM 1;  1ND3 A;  2L9L A;  3AFK A;  4NE9 A;  3WF3 A;  5JOX A;  1XNA A;  3DL3 A;  5F5C A;  1DZR A;  4NII A;  1RUD 2;  3P3N A;  5A3L A;  1AR6 2;  2GC3 A;  1VBB 3;  2V09 A;  2Z42 A;  3NAP B;  4GAL A;  5BNP B;  1N1S A;  1VBA 2;  4LE3 A;  1PGL 2;  1AR9 1;  3PME A;  1Z7S 3;  2WZP P;  5CBL A;  4ORF A;  2B7Y A;  4LKD A;  2J1R A;  4HBN A;  4KMQ A;  5LY2 A;  3TNP B;  4NHY A;  3FLT A;  3D0J A;  2Z4F A;  3RNS A;  1XU2 A;  1L3J A;  2XLA A;  1UKG A;  5FY8 A;  4W6X A;  2A70 A;  4QGM A;  3E6D A;  4MXW B;  1FV2 A;  5CAD A;  3ZVX A;  3C7O A;  2BUK A;  5C9A A;  1W6O A;  2DVF A;  3UT0 A;  3R05 A;  2YMZ A;  5CG8 A;  1K45 A;  3H7Y A;  1D7P M;  1RUH 2;  1WW7 A;  3ZFF C;  5DUU A;  2WFF 1;  1W8Z A;  1SHW B;  4O7X A;  4PQQ A;  5FZE A;  4LO7 A;  3WOG A;  1O8P A;  4FFH A;  2ZKN A;  3M7A A;  3BU0 A;  1JW6 A;  4DQA A;  3FE5 A;  1FNZ A;  3IB3 A;  5BV6 A;  4PLM A;  4XZU G;  5E8A A;  4MGZ E;  2ZXQ A;  4LKS A;  4H55 A;  1SLB A;  4YZ4 A;  3VB9 A;  3TB0 A;  3U4S A;  3PJQ A;  1SQ4 A;  2VZR A;  4IE7 A;  4AGR A;  2VNG A;  4CCL A;  3ACF A;  1EPZ A;  5C3O A;  1W8F A;  1YI7 A;  4QQ2 A;  3RYR A;  3RZJ A;  1AR6 3;  1VBD 2;  3O1M A;  3GZE A;  3A0N A;  3K4D A;  3N7K A;  5FAX A;  3RYP A;  4CRQ A;  3LEG A;  3TRS B;  5JOW A;  1OSG A;  1GNH A;  4AAP A;  3ZYR A;  3MLJ A;  1DZT A;  2V5Y A;  5FYY A;  4BIF A;  1W03 A;  2V5D A;  1MZ5 A;  4IEX A;  4M3C B;  1W9T A;  1EP0 A;  3ZMO A;  4BK5 A;  2ARE A;  1WD4 A;  3MIC A;  5FBJ A;  2Q8E A;  4EN9 B;  1Q43 A;  2XOM A;  5C3R A;  4OFG A;  2RV9 A;  1HDK A;  4ITC A;  1B35 B;  3UJQ A;  2ORZ A;  1GNZ A;  1LUL A;  3HWJ A;  1QXJ A;  4IEO A;  4XFI A;  5IK8 A;  2DVD A;  4YW6 A;  4HVR A;  2XJS A;  2YU2 A;  5A7W B;  3WD5 A;  3A22 A;  1BHG A;  1XQN A;  2AEZ A;  1XSQ A;  2WNV C;  4HKO A;  2VR4 A;  4IDZ A;  4P14 A;  2W0X A;  3AKR A;  5BYN A;  1A34 A;  4M0H A;  2ID4 A;  1TME 3;  2A6V A;  2HBU A;  2Q5T A;  1QOS A;  2XML A;  2BEO A;  4R9C A;  1CJD A;  4RL7 A;  4DNY A;  1SFY A;  3KHC A;  3V0B B;  2G9F A;  1M4W A;  4AI1 A;  4BDV B;  4CU8 A;  1RVF 1;  4Z92 B;  1F9K A;  3AVR A;  3KCC A;  1W9F A;  2B46 X;  3KWV A;  4MO3 M;  2W1Q A;  4IND A;  4Q26 A;  1JZ5 A;  3WQ1 A;  4O65 A;  3MW2 A;  3IMM A;  5FYC A;  1ZBA 3;  3FX3 A;  4B3N A;  3LF7 A;  1NCQ C;  3GF6 A;  5F1R A;  2XPJ A;  3CDZ B;  1HV1 A;  3M2M A;  3SNM A;  4CDQ A;  1RUI 3;  1PNF A;  4XUP A;  5JXJ A;  1XBF A;  4SBV A;  4WV8 A;  4CP9 A;  5LW9 A;  4WVM B;  5FLJ A;  1ULD A;  1SCS A;  4AL9 A;  4GKX A;  4RFT 0;  2RG4 A;  2HWD 2;  4RGG A;  1SBD A;  3TEX A;  1E57 A;  4NIA A;  4OMD A;  4OI1 A;  3VGI A;  3H1W A;  3URF A;  1S0G A;  4ZXE A;  5I0D A;  4DO0 A;  2RMU 1;  3BCW A;  1IS6 A;  5CNA A;  3VKM A;  4QPW A;  3ZYG A;  4L2N A;  1RUG 2;  3ZXJ A;  2QCS B;  3CKH A;  3WDV A;  1R1A 1;  3AP4 A;  4X6Q B;  5FZ1 A;  3MGU A;  1RUE 2;  2W52 A;  1BVV A;  3OCP A;  2LS6 A;  1GYK A;  5EQU A;  4CCK A;  4TZD A;  5FZF A;  1DQ0 A;  3WHU A;  3ZKY A;  1ZZC A;  4KGG A;  4AVB A;  2MNG A;  2QDN A;  3H9A A;  3MI8 A;  4ZS2 A;  1D4M 3;  1GOF A;  1XNT A;  4FPG A;  2PHW A;  1IPS A;  4YG6 A;  1ODN A;  2VQT A;  4NPL A;  4WM7 C;  2WA3 A;  4CP0 A;  3CMG A;  1ZZ6 A;  4PDW A;  5FYZ A;  1W8H A;  2OVU A;  1H6X A;  1LGC A;  4LLO A;  3W5M A;  2YYO A;  5KXD A;  2QQK A;  3SLI A;  2OS2 A;  1K42 A;  5IUQ A;  2VMF A;  2VO5 A;  4FBF A;  3VZK A;  5IJR A;  2MEV 2;  1A8D A;  3I2J A;  3AZX A;  4XE9 A;  3O1R A;  1LOF C;  3O1P A;  2BW8 A;  2GN3 A;  2HWB 1;  1W3X A;  5D2A A;  5AFB A;  4OI2 A;  4LIT A;  4QX8 A;  2VM9 A;  5FFO C;  3E5U A;  1DGL A;  4AF9 A;  2Y0O A;  4BA6 A;  4P9I A;  1VAV A;  4I09 A;  4LIV A;  3MIF A;  3III A;  4AQ6 A;  4Q8K A;  3BKZ A;  1JU3 A;  1GAN A;  2WRA A;  3LCP A;  2XBO 3;  2ZZQ A;  3ZSJ A;  1AL2 3;  3I4I A;  5FZD A;  5FO7 B;  2GC1 A;  2GDF A;  4OHY A;  4GB3 2;  1OLR A;  3H7J A;  1JH5 A;  4HSJ A;  2EAA A;  1CES A;  1HRV 1;  1R09 2;  4XF1 A;  1AX2 A;  4XOG A;  5LBF A;  3U10 A;  3KMH A;  1VBA 1;  3CQO A;  5SV5 A;  4Z2W A;  1LOF A;  5F3C A;  4I0B A;  1DDL A;  5FV3 A;  3ST7 A;  4IGP A;  2MHF A;  1HRV 3;  3POB A;  5FMB A;  1Y3T A;  2X09 A;  4XIK A;  4QX7 A;  1BEV 2;  3H8O A;  4DMI A;  4N43 C;  3GBF A;  3M70 A;  4TLG A;  5EFU A;  4URA A;  5DAQ A;  1WWY A;  2WC2 A;  4CU9 A;  3AYE A;  3U0Z A;  3B5L B;  2BU9 A;  3LWC A;  1Y9G A;  4WBB A;  5I8Y A;  4KU7 A;  1HB3 A;  4K40 A;  4Q4W 3;  1UOG A;  3VBR B;  3VHO A;  1Q8O A;  2JE7 A;  2ZAH A;  1W28 A;  4C0B A;  5C3S A;  5KHI A;  1UF2 C;  3LOI A;  5ABJ C;  5FLI A;  3S6P A;  2YFZ A;  4P00 B;  4RA0 A;  1UAI A;  3HNM A;  3OD0 A;  5FZL A;  1UYY A;  2WO1 A;  2ZEZ A;  5APA A;  1Z7S 2;  4ASM B;  3DF0 A;  2VEC A;  3IDC B;  4Y20 B;  1CN1 A;  3BIE A;  4MGY E;  4QB6 A;  1RIR A;  1ZBA 2;  1FMD 2;  5I0R A;  4EV0 A;  1G9F A;  4CCO A;  4FOV A;  2FDF A;  3NVC A;  4WM8 B;  3I8T A;  4BJ0 A;  4CP9 B;  3VD9 A;  1DLL A;  2RS5 2;  2ET1 A;  3U75 A;  3TEZ A;  2E31 A;  4BYY A;  1ACC A;  3AL6 A;  4YVS C;  2ATF A;  4NHK A;  2TBV A;  1QEX A;  5LA1 A;  2ZEW A;  4LHL A;  2R06 2;  4GWM A;  4BXF A;  2A6Z A;  1C5H A;  4U2A A;  3HN3 A;  1UU4 A;  2PLV 3;  4IEZ A;  4COY A;  2CV6 A;  1ULO A;  1PO1 1;  4WM7 B;  2FCU A;  1Z78 A;  1DLC A;  1GNY A;  3OTF A;  4YM2 A;  1HRI 1;  2I45 A;  3VKN A;  1QJX 2;  1QQP 3;  1D0G A;  2WIN B;  3WDX A;  3NV4 A;  1AHS A;  4A42 A;  1YUD A;  4I0A A;  5LA9 A;  3AM2 A;  2FBE A;  2VW1 A;  3ALQ A;  5M0T A;  4LT5 A;  3D5O A;  2VMI A;  2A3W A;  1HRI 2;  4LOS A;  1JOB A;  4GJZ A;  1IKQ A;  1WCU A;  1W2T A;  5FK8 A;  4NAO A;  5A6Q A;  2D3R A;  5A3O A;  4A4A A;  1H2N A;  1FXZ A;  1S2B A;  2P17 A;  2VXJ A;  4JDM A;  3ACG A;  5FQ0 B;  2HWF 2;  1JYV A;  4Z2A A;  5JI9 A;  1FYU A;  1ODM A;  4QPI C;  3WF1 A;  3ZFF B;  4Y22 A;  2BBA A;  1VBE 1;  4DEQ A;  5D8A B;  1Q56 A;  3ZXF A;  1FMD 3;  5JSR A;  5DZE A;  2A3Y A;  3EQE A;  4CU7 A;  1ASJ 2;  1XE0 A;  4IET A;  1F15 A;  2X5I C;  4Q0Q A;  3W58 A;  5I0S A;  1LEN A;  3J7H A;  2AZ5 A;  5FZ0 A;  5IK4 A;  5FPA A;  2VOX A;  4L8Q A;  1T6G C;  4CPB D;  1W06 A;  3DV8 A;  1RUJ 2;  4FCA A;  1V6J A;  2IZW A;  4YG0 A;  4RSU A;  4FAH A;  2CTV A;  2ZGS A;  1QMJ A;  5C8C B;  4ZPI A;  3SKV A;  4AGG A;  4MVT A;  3N9P A;  4FXG B;  2PHU A;  3S57 A;  1PIV 1;  1IG3 A;  1XPW A;  1MS3 A;  2TEP A;  3TWI A;  4O9E A;  1OPO A;  2KD7 A;  2W94 A;  4XAE A;  4V2W A;  5DUX A;  1UPI A;  4D3W A;  1VB2 A;  5FXV A;  1WW4 A;  1ZBE 1;  2VC9 A;  4IEY A;  1QJY 2;  3S5Q A;  3ZN4 A;  3O0X A;  1JZ6 A;  1D4M 1;  4LBJ A;  4N7I A;  1WMD A;  1JZ7 A;  2KR2 A;  5K0U C;  1MZE A;  3WY6 A;  1CGP A;  5I0U A;  1H6Y A;  2W1U A;  2B39 A;  1VBD 1;  5GLV A;  4AED A;  5BNP C;  1CQ9 A;  1ND3 C;  2H0V A;  2KA3 A;  1R09 3;  3JCI A;  1XXN A;  5FZO B;  1OH4 A;  3HNY M;  3ILF A;  4YVS A;  1UMZ A;  3S30 A;  3VDD C;  1VLN A;  1IQD C;  1ONA A;  1W6M B;  3MV1 1;  1IS3 A;  2PAE A;  3AYC A;  3RS6 A;  1CAW B;  4FFG A;  5FZI A;  4KH9 A;  4CA9 A;  3OPT A;  5HI0 A;  1XE8 A;  1RJ8 A;  3UGG A;  1W6P B;  3PLQ A;  2Y64 A;  2VTF A;  3USU A;  2AC1 A;  1V70 A;  2R07 2;  1JMU B;  1YXW A;  2O8O A;  3B69 A;  4XQ4 A;  4E4H A;  5IVC A;  2BQP A;  5J7M A;  1KJR A;  2ZTN A;  5FY1 A;  2ET7 A;  3AP7 A;  3HMY A;  5BNP A;  3T30 A;  1TNR A;  4D8M A;  5A6Z A;  1V0A A;  1HRI 3;  3WUD A;  5E1R A;  1VRB A;  3LSE A;  4NHM A;  1W6Q B;  4UYB A;  2ZHN A;  4Q4V 3;  2FZ1 A;  1GZC A;  3HOB A;  3BVC A;  2D5H A;  4DPN A;  3IAP A;  2UY9 A;  4DZG A;  3B02 A;  5T55 A;  3RZM A;  3PVO A;  2PLV 2;  3VDB A;  1W6O B;  5L73 A;  1LOB A;  2RM2 3;  1H1M A;  2R06 3;  3OPZ A;  4QPG B;  4A41 A;  1AL2 1;  1L7R A;  1DYK A;  1SLI A;  1TVG A;  5DZF A;  2YPD A;  1US3 A;  4LE4 A;  3WW2 A;  2Y8K A;  5LBB A;  3ZDS A;  3ACL A;  1JZ8 A;  2GC2 A;  2B42 B;  2I74 A;  1EYB A;  2Y6G A;  2Q8O A;  1H4H A;  2CU5 A;  2XGX A;  3LDR A;  4HKW A;  5ISL A;  4NPR A;  4KL1 A;  2DVB A;  3JB4 C;  1JN2 P;  5FWE A;  2Q8D A;  5T52 A;  5DPN A;  1O59 A;  3HR9 A;  5FJK A;  4MH0 E;  3OSD A;  1N1V A;  2VMC A;  2VNR A;  5L9R A;  1SAC A;  1SEF A;  2WNU A;  2WWS A;  3OPW A;  2VZS A;  4XJ9 A;  4E27 A;  2HWC 3;  2BYV E;  1R08 2;  1PNG A;  3ZFE C;  3KM5 A;  2YBK A;  4XDQ A;  1YIF A;  2VZQ A;  4Y24 A;  1V9U 1;  3E6B A;  4UT5 A;  1WA6 X;  3NO8 A;  5LEJ A;  5FKC A;  1CVN A;  4NPM A;  3AMM A;  2LAL A;  5IVB A;  1TNF A;  4QDR A;  3UKV A;  2WNE A;  3HBZ A;  1OBN A;  2XBO 2;  1AR8 2;  1NCR A;  2FCT A;  2VUJ A;  2XL9 A;  4Q1R A;  5GAL A;  1B35 A;  4YPJ A;  2CWM A;  4AAX A;  4GKY A;  1NE6 A;  4RHV 2;  4A44 A;  2CGN A;  1OKQ A;  2WWU A;  4P9W A;  4FPH A;  2ZGL A;  4TSV A;  2A71 A;  3A21 A;  1WZX A;  2ZGR A;  5CIR A;  5JIU A;  2EXK A;  3WT3 A;  2VOT A;  4ATE A;  3AMH A;  1UN1 A;  4RQP A;  3H42 B;  3PIJ A;  4XJ8 A;  3ZPY A;  2WT1 A;  2F17 A;  2R30 A;  3ZIW A;  1VBE 2;  3K4Z A;  5FZK A;  1UU5 A;  1XYP A;  2ENR A;  3BU7 A;  2BNM A;  1RB8 G;  3OB8 A;  2CYF A;  4CDW B;  1PO2 2;  2QE3 A;  3MIB A;  4QXC A;  1BKZ A;  1S4C A;  2YZ4 A;  3M8L A;  3H50 A;  1NT0 A;  3FN9 A;  1ULF A;  4P9J A;  3POE A;  2J1U A;  2IVJ A;  2XHK A;  4I3G A;  4OQ8 A;  2FDJ A;  1F8V A;  1FAT A;  3Q8B A;  2P2K A;  4FPL A;  2I07 B;  1AL0 G;  1REF A;  2NZ9 A;  1UZY A;  4UFM A;  5LY1 A;  3USS A;  2V4A A;  2VBP A;  1PK6 A;  1SDD B;  2WT0 A;  3NJX A;  3NNM A;  4W6Y A;  4OLL A;  4IW3 A;  1UL9 A;  4EJR A;  2UYB A;  5LB6 A;  2YG0 A;  1R09 1;  1S0I A;  3VHR A;  2KM2 A;  1QXR A;  3AYA A;  5CIS A;  3ON7 A;  4DXS A;  5JOZ A;  2WNO A;  4L11 A;  4HET A;  2J1A A;  2FDK A;  3NWK A;  4OHX A;  3N9N A;  3WNP A;  1UWW A;  5LZ6 A;  2V73 A;  3ITQ A;  1NZC A;  1ZRI A;  4AFD A;  4LBQ B;  1OPM A;  1EAH 2;  1SPP B;  2D6P A;  2VTX A;  3J4U H;  2HBT A;  2P5B A;  1JOP A;  2ZHL A;  4XYX A;  3N7J A;  3RWN A;  2YC2 A;  4IEV A;  4ASK A;  4CXY A;  3A7Q A;  3W59 A;  4BZ4 A;  2IFW A;  4MOA A;  4ZU5 A;  4BXS V;  2OX0 A;  2VZT A;  2QQN A;  4UBG A;  1RIT A;  2EVX A;  1LHO A;  3P3P A;  1V00 A;  3IIA A;  5SV8 A;  3WZ1 A;  4CCC A;  4U36 A;  5G05 L;  1N1Y A;  2FD8 A;  2ZS6 B;  1VBC 3;  1ALY A;  3C3V A;  4MUV A;  4OCT A;  4BB3 A;  1YQC A;  1J1L A;  3AVS A;  2BBV A;  2PHT A;  2VNV A;  3LFI A;  1BBT 1;  3J7N A;  1R08 3;  1H1I A;  2P3I A;  4QGL A;  4C0H A;  4COU A;  4XAA A;  1YIP A;  3K51 A;  4MGI E;  4XTP A;  4Q4V 2;  3G7D A;  1S0F A;  4KWJ A;  3DKW A;  4D69 A;  1VAK A;  3K4A A;  5JI7 A;  2LRP A;  3MHZ A;  2R16 A;  3AXD A;  2GAL A;  2WII B;  1WCK A;  4IES A;  4GWN A;  5F5A A;  4BU2 A;  5J98 B;  1W05 A;  2PTM A;  5FMO L;  3AZW A;  4E2Q A;  1UOB A;  4YSF A;  2VMD A;  1PO1 2;  5J36 A;  4H7L A;  1EV1 2;  1H2K A;  4XEZ A;  2YC0 A;  4OYU A;  1O5U A;  4D6R A;  5CKN A;  1OOP B;  2JG8 C;  3N7M A;  1BEV 1;  2E53 A;  1XRU A;  2PQS A;  1HJF A;  2C9K A;  2VPV A;  2WNU C;  1J84 A;  4QHZ A;  5G04 L;  1PO2 3;  1X82 A;  5JSP A;  3O0W A;  1AR7 3;  2HWD 1;  3VHN A;  4GIQ A;  1XNK A;  3I2H A;  4N53 C;  2A1X A;  1FNY A;  3PU3 A;  4HPK B;  2Y6K A;  4H3W A;  5A1F A;  2JE9 A;  4NOT A;  4AVT A;  4P9L A;  2IVI B;  2BWA A;  3MFA A;  3K3O A;  2OXB A;  5FXW A;  4A2U A;  4DIN B;  1QQP 1;  1JS9 A;  5IYY A;  3VBF B;  3B93 A;  2FDH A;  3DEC A;  1JTZ X;  3LQC A;  2VW2 A;  1OFS A;  4RHV 1;  5A80 A;  1LOC A;  2X29 A;  3OGS A;  2VL4 A;  2Z79 A;  1ZYB A;  4LBM A;  1FPN 3;  2XJV A;  1RXF A;  4N7U A;  4MXV A;  1RED A;  1UKR A;  5EZW A;  2IWG B;  3LOB A;  1GSL A;  2PEL A;  1BZW A;  3JZV A;  5EHD A;  4BK4 A;  2VXR A;  2HWB 2;  3KGZ A;  2CL2 A;  3W20 A;  4CDQ C;  3VKF C;  4YAR A;  4G3Y C;  1GQP A;  2XJQ A;  3NKT A;  4I30 A;  5C8W A;  1ST8 A;  2AUY A;  1O4Y A;  1NA1 B;  3WR0 A;  2RJL A;  3DXU A;  1ZBE 3;  5DZG A;  1LCL A;  1HQN A;  1HXS 3;  4PT6 A;  5FZH A;  1ND3 B;  3UKT A;  4AHX A;  1OHF A;  1QOT A;  5F37 A;  1J59 A;  3PNA A;  5C4W C;  3K48 A;  5C33 A;  5FY5 A;  4QQP A;  3P1I A;  1NKG A;  4IEP A;  3OUJ A;  2PN5 A;  4XJU A;  1GR3 A;  3ZFG C;  3O1T A;  4CDX B;  2DFC A;  3ZXG A;  3NJV A;  1NLS A;  1YI9 A;  3WEZ A;  1ASJ 3;  4CCN A;  3HIF A;  1TMF 2;  3WG3 A;  2W46 A;  4BQ3 A;  2WZ8 A;  3B94 A;  3WQ7 A;  1VE0 A;  2GNT A;  5F32 A;  1IS4 A;  2JDN A;  1CAU A;  3DUI A;  4E4D X;  3LFM A;  1DQ4 A;  3ABZ A;  1S0C A;  3TNQ A;  4AZZ A;  2R0F A;  3IN9 A;  2HWF 3;  3OGJ A;  1TMF 1;  2QQP A;  2BVB A;  3WNN A;  4YVW A;  1CIY A;  2K2S A;  4Y1X A;  3ZLI A;  5A3T A;  5EV7 A;  4LJH A;  2G4I A;  1J3R A;  1ND2 B;  5H9Q A;  1IOA A;  5A32 B;  1OLM A;  1V6N A;  2CSG A;  2B9V A;  1BK1 A;  1J58 A;  1U5Z A;  4OHV A;  4YFZ A;  1SDW A;  2PA7 A;  5A1L A;  1VAM A;  3HN1 A;  5JXI A;  4O61 A;  3OBT A;  2E51 A;  1AXK A;  5DDJ 3;  1ZRE A;  2P4E A;  1RUC 2;  1XSR A;  5FQ0 A;  3AL5 A;  1AYN 2;  2QDR A;  1OA4 A;  2UU8 A;  2BNN A;  2EID A;  2LW8 A;  4A7Z A;  1YYN A;  1KXG A;  5KC5 A;  1IQA A;  4AQS A;  4COZ A;  2ZEY A;  2VAU A;  1OUS A;  1PVC 3;  2ZX0 A;  2D5F A;  3R4U A;  4OHW A;  3RSJ A;  4LEJ A;  3I97 A;  3UET A;  2WUH A;  4M3C A;  2ZGO A;  1I9R A;  3OGG A;  1CD3 G;  4XDP A;  2A7A A;  5GJ6 A;  5B4N A;  1HQL A;  2VQA A;  4RR3 B;  3WP4 A;  3KLS A;  5FY7 A;  1IG0 A;  5KXC A;  4TTG A;  4AVC A;  1UZV A;  4LIU A;  3R0R A;  1G7Y A;  3PUS A;  1V6O A;  2VME A;  3LAG A;  3ATG A;  1LJ7 A;  3FL7 A;  4XUR A;  4QD2 A;  2EIE A;  1KDK A;  4MET A;  3K75 B;  4EN6 B;  4G9S B;  3ZYF A;  1QH7 A;  1SFP A;  4YGE A;  4HVQ A;  2WS9 3;  3JQW A;  2Q30 A;  3UV9 A;  3VDD A;  3VBF A;  2XKO A;  4ZZ5 A;  4YW7 A;  1UY0 A;  5K7P A;  1QJY 3;  1UZZ A;  3LKJ A;  1PIV 3;  2ZX1 A;  3Q8F A;  2AH2 A;  5C8C A;  2PAK A;  3KHB A;  2CDO A;  1W04 A;  2O0O A;  2ERF A;  3AMQ A;  2KXL A;  2RVA A;  2XJR A;  1HW5 A;  2VW0 A;  4P5H A;  4PIZ A;  1UU6 A;  1WKY A;  3AXE A;  5FR3 A;  4XAC A;  5DMY A;  1MVQ A;  3BOP A;  2E6V A;  3CU7 A;  1MZ6 A;  1LOG A;  4JDN A;  4DOU A;  1POQ A;  1UYZ A;  2XR4 A;  4FTB A;  3FLP A;  2ZMK A;  4IEQ A;  4GUL A;  1NUK A;  1VPH A;  4XFH A;  4OI0 A;  1XNB A;  2JEM A;  3RDI A;  1GUI A;  3RGB A;  3ZSL A;  3RZG A;  5DAW A;  2QQO A;  4MHR A;  1AX0 A;  2VVF A;  3OGR A;  2RJ2 A;  5FJH A;  3WDW A;  1QY4 A;  5K0U A;  3ZXE A;  4M4R A;  2P6C A;  2ZX2 A;  3RYK A;  3O12 A;  2W2I A;  4H7M A;  3IM0 A;  1WUV A;  2OUH A;  1NOV A;  2YGL A;  2YHJ A;  3IPV B;  2OT7 A;  1E5I A;  2D98 A;  4H2A A;  3ROU A;  4LO4 B;  1VBC 1;  2E33 A;  4YWA A;  4Y1V A;  5FWJ A;  3VZM A;  3CZU A;  4QX0 A;  1U5I A;  1W6Q A;  1DG6 A;  1ZRR A;  4HFS A;  2E63 A;  4NRM A;  4BQX A;  3BOW A;  4TWT A;  5AC9 1;  3ZIX A;  5I0T A;  5JUV A;  1H8T B;  2CWS A;  5C3Q A;  5DAP A;  3WLU A;  2E9Q A;  5LK5 A;  2JKX A;  5IVY A;  3FUQ A;  3BPZ A;  2QBX A;  4AVA A;  4CXW A;  4FQ4 A;  1ZVF A;  1W6N B;  2X10 A;  4Y5S A;  4P9G A;  5C4W A;  3LD8 A;  3WCS A;  1JHJ A;  3T4V A;  1POV 0;  3HEI A;  4NVP A;  3NQH A;  3SCG A;  2WA4 A;  5K4L A;  1KS4 A;  2UWC A;  3POY A;  4RN5 A;  3N4M A;  5FP3 A;  2XDV A;  2H6C A;  4B7E A;  1VIW B;  5BXX A;  1AR7 2;  3P5B A;  4XF9 A;  2XVK A;  1GZW A;  1UXZ A;  5AC9 2;  5BPX A;  1PMI A;  4CE8 A;  1W0N A;  5T5O A;  2NPI A;  3K46 A;  4CP1 A;  2XB6 C;  5L7O C;  1W9W A;  2RE9 A;  3C7E A;  1MZF A;  4NHL A;  4Z82 A;  5EJZ B;  5IFP A;  1C8M 1;  2N7G A;  2R07 1;  2ZGM A;  2Q1F A;  5A7Q A;  2IXH A;  4NMI A;  4BQ1 A;  5DUV A;  3AZY A;  2XH6 A;  1E5R A;  1RUF 2;  2B9U A;  1CPN A;  3EYP A;  3BTX A;  1AUY A;  2VQ0 A;  4Y1Y A;  1Y4W A;  1FOD 2;  2WAB A;  5FZG A;  1ENX A;  3J9S A;  4CEY C;  1S2K A;  4ARY A;  5L19 A;  2BFU L;  4IGO A;  2VBB A;  2ZKL A;  2EIG A;  2J7M A;  3GZT B;  4K21 A;  4A7K A;  4QX5 A;  1X50 A;  5DN2 A;  4ZY9 A;  3I3B A;  5EPA A;  3KT7 A;  5HPO A;  1HB4 A;  4KGQ A;  5I91 A;  1WD3 A;  4X8P A;  3CJI C;  3WF4 A;  5KC6 A;  3AMN A;  4I3P A;  4B1M A;  4AI8 A;  1OQE A;  3D6E A;  4FP3 A;  4JDO A;  4AXO A;  1ENR A;  3AP5 A;  4CPB A;  1XOY A;  4GA9 A;  1DQ6 A;  3VDD B;  2E7T A;  4FFF A;  2A6X A;  2PYT A;  4NJ4 A;  2ZZJ A;  1POV 3;  4RQP B;  4JC1 A;  4CEY B;  2RR1 2;  4QMA A;  3I59 A;  5FY9 A;  4CSW A;  2P1B A;  2WKK A;  4QPY A;  1CPM A;  1LR5 A;  1MQT C;  4NRO A;  2IXC A;  4E4Z A;  4B4Q A;  5DG2 A;  3JD7 1;  4R4X A;  1UY1 A;  4GB3 3;  4X6R B;  1FT9 A;  1KEX A;  3JBG 1;  1UOJ A;  3VBR C;  5IVF A;  1OKO A;  3F95 A;  2VMG A;  2VU9 A;  2WQZ C;  1XB9 A;  1AL2 2;  3I54 A;  4UXA A;  4Q1P A;  4GH4 B;  2VJX A;  4IV3 A;  2RMU 3;  3QOP A;  1LAJ A;  3THD A;  3LA2 A;  1K12 A;  3JUU A;  3TN9 3;  3J8F 3;  1JZ2 A;  1X9T A;  1UMI A;  3KT1 A;  5IK5 A;  1VMH A;  3K77 A;  1AYN 3;  3A0K A;  2P3Y A;  1RUC 1;  3SH3 A;  1GP5 A;  1RHI 2;  1MQT B;  1GV9 A;  4YZ3 A;  5KHG A;  3EB7 A;  2G9Z A;  1OUX A;  1YLL A;  4JVA A;  2QQU A;  1G9C A;  5IK7 A;  1BBT 2;  2GP5 A;  4J1W A;  4A3Z A;  1LU1 A;  1WBL A;  3RWK X;  1A3K A;  1YFX A;  3KS7 A;  4P9X A;  4DY5 A;  5JSO A;  1GMM A;  4Q29 A;  3AMP A;  3UYJ A;  5AVP A;  4CDX C;  1RMU 1;  1LGB A;  3LEI A;  2OQ7 A;  4MXW A;  1ENS A;  2NM1 A;  1AR9 2;  1OXC A;  3CEW A;  3UES A;  4GH4 C;  3RFR A;  5I93 A;  4FVV A;  2RDS A;  3I2G A;  4ISR A;  2R04 3;  1R1A 2;  4PI0 A;  5FPZ A;  3T2P A;  5FOB B;  2D7F A;  3RMX A;  1RUE 1;  4Q4Y 2;  1UD1 A;  4BME A;  3WHT A;  1LRH A;  2ZMN A;  3O1V A;  5JZG B;  4UOJ A;  3AZZ A;  5F2S A;  3HD8 B;  5LEK A;  4B1L A;  2JDY A;  2UUR A;  4RGK A;  5FPX A;  4ISQ A;  2GSY A;  1NQJ A;  1LHV A;  3I7D A;  1POV 1;  5JR7 B;  3VBO A;  3BGA A;  2RDN A;  2WSV A;  5FDB A;  2J1T A;  3VD7 A;  2HWD 3;  1GWM A;  3NV1 A;  5JR2 A;  4JV4 A;  1S2E A;  1N47 A;  1Q8S A;  2HEY F;  4HOO A;  1DGW A;  3X29 B;  1I5P A;  4F7Z A;  3C7H A;  4HG6 B;  4K7J A;  5BNN B;  4UFJ A;  1HXS 2;  3WW1 A;  5FK7 A;  2A73 B;  2P3K A;  1QJY 1;  5A3W A;  1YO8 A;  3FC0 A;  3IDE A;  4XUO A;  3OBR A;  1UY2 A;  4C91 A;  5FO8 B;  4RYD A;  3N36 A;  2P37 A;  2DBI A;  4KU8 A;  1LGN A;  2WNV A;  2B8M A;  3AKS A;  3KCY A;  4QX1 A;  3ZR5 A;  3QH7 A;  2FHR A;  3AP9 A;  4JTN A;  3KZ4 C;  1TME 1;  1PIV 2;  4DB5 A;  2NYY A;  2D6N A;  4LUM A;  4HPK A;  1FPN 2;  4XC9 A;  2VUC A;  1QNY A;  2Y0I A;  1LB2 A;  4E9K A;  2W68 A;  1MPX A;  1OD5 A;  4S2D A;  5CEH A;  3HQR A;  1RUC 3;  2PFW A;  1UY3 A;  2OQ6 A;  3NW4 A;  4XXP A;  1HKD A;  1LED A;  3N35 A;  1GBG A;  1VJ2 A;  2WLQ A;  2XVL A;  1V9U 3;  2WN3 A;  3EBR A;  4R9A A;  4IV3 C;  5HXV A;  4CCJ A;  1DHK B;  4TN7 A;  4AED B;  4MSV A;  5DAB A;  1NCQ A;  4XHX A;  1C8M 2;  4UW4 A;  4UWD A;  5J3U A;  3QCW A;  5F2W A;  1YFY A;  2DTY A;  3D82 A;  4YVS B;  4HSL A;  1QJZ A;  3FUO A;  1J1T A;  2Y6J A;  5FZA A;  3ZN5 A;  1UY4 A;  4GB3 1;  4EYU A;  1KDM A;  1AF9 A; 
#chains in the Genus database with same CATH homology
 1JOD A;  1F35 A;  1JOB A;  1JYT A;  1ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...