1JYTA

Solution structure of olfactory marker protein from rat
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
163
structure length
163
Chain Sequence
MAEDGPQKQQLDMPLVLDQDLTKQMRLRVESLKQRGEKKQDGEKLLRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
publication title Olfactory marker protein (OMP) exhibits a beta-clam fold in solution: implications for target peptide interaction and olfactory signal transduction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 17
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jytA00
1ZRIA 1F35A 1JODA 1JOBA 1JYTA
chains in the Genus database with same CATH superfamily
3DL3A 1GQGA 4LK7A 4N53C 3X29B 4LO6B 3TRSB 4QQPA 1O7FA 1OPMA 1R1A3 1WZXA 2I2SA 5ANQA 1IS4A 2OKXA 5JZGC 3V0AA 5IFPA 1RINA 3VBRA 4DNYA 5L7OA 3N9LA 4A7YA 2WDBA 2BGOA 2TBVA 1AR93 1VAMA 5J7MA 3WNOA 3AC0A 4XJ8A 2E32A 1IKPA 4XF9A 5FK7A 3DGTA 2YUEA 2QQMA 4B8EA 1VRH3 1K42A 1W04A 4JDOA 4AEDA 4Z1VA 3MIBA 2PLV3 4YW2A 4EJRA 5C8CA 1CD3G 3CZJA 1C5IA 3H50A 4N7UA 2CAUA 1WCDJ 3IMMA 2Z69A 3N7KA 4CEYB 3IWZA 3GCWA 3SXWA 3ZLIA 2FDJA 4D0QA 5DAQA 4BQYA 5CKMA 1JOPA 2OXBA 5C9AC 4M3CF 2UURA 1KDKA 3ZDVA 3N7LA 5F9TA 4XF1A 4CA9A 4EYUA 2BGPA 3O12A 4DRVA 1ZX5A 3ALQA 3WNKA 2KD7A 2WNUB 2JDPA 2XWJB 3OBTA 3I7DA 5FZEA 1GP6A 2VMHA 4DEVA 4L97A 4E4ZA 4FPHA 3RS6A 1TMF3 2LRPA 3GHNA 1S2KA 4KNCA 4URTA 3UYJA 4FPJA 4NO4A 3LOBA 2UWCA 2G4IA 2JKBA 1N3PA 4KG8A 1DU3D 3HN1A 5KC6A 1FPN2 4EN9B 2R073 3B9IA 4BXSV 2EICA 3GYDA 2C5DA 2YBSA 2EVXA 5LASA 1N1SA 1NZIA 4S2FA 2ZGUA 3GCXA 4LA3A 4O61A 3VGIA 2WT0A 3BYWA 3POFA 4XAEA 2GC3A 5GLWA 1BEV2 3TYJA 1MACA 2JDYA 5FZ6A 1BBT3 5HXVA 5HCHA 5FUIA 2VMDA 5A3PA 3USUA 3NNLA 1FPN1 2PFWA 1JUIA 2VH9A 1CAVB 3KD4A 1VR3A 1WW4A 2A3WA 2QDRA 4UFHA 1W2NA 4LQRA 1Y7BA 4ASKA 4HLTA 3V0BA 3VHRA 4WBBA 4M3CB 2E7QA 1IQDC 3P3PA 4N9HA 1BEV1 1ZBE2 2IVIB 2OA2A 5CFDA 3OPZA 2RR13 1JUHA 5D8AC 5C3PA 2XJRA 5LA1A 4IEZA 2JEMA 3KQRA 3C8XA 4QGNA 3FUOA 3VBUC 5BYNA 3U11A 5FWJA 3PIGA 4X6RB 4L0PA 1PNGA 3ILRA 2DUOA 4QHZA 1PO12 2B7YA 2XWBB 1TME3 3QH7A 3WW4A 3E5QA 2P4EA 3M3EA 5FY8A 1LKNA 1ZBE1 4J1WA 4GB31 3KF5A 1SLIA 2OT7A 4EV0A 3D0SA 5F6KA 4Y1VA 1O5LA 2XVLA 4MOAA 1O91A 2X10A 1PO11 3KCCA 1NCRA 3OBAA 4JRLA 3WG3A 1POV3 2RE9A 3AYEA 4AFDA 2A7AA 2B5HA 2B4KA 3NL1A 2QQKA 3C2UA 2JDZA 2DTWA 1PZ8A 3GNEA 3LFMA 3NJYA 2JECA 3PNAA 2ZHKA 3LSDA 3AZWA 3WNLA 3WNMA 2BW8A 1S0EA 3ZN4A 3MO4A 4AVVA 4TXWA 2JICA 4MVTA 2Y0OA 1FOD2 1NUKA 2R49A 4Q4W3 5C3RA 1SLAA 3LE0A 3N9NA 4LLOA 4NHKA 4K21A 5C8CB 1TQ5A 1JI6A 1XB9A 1Q3EA 5C4WA 4QMAA 3ZSMA 4XFGA 4YM1A 4XPVA 1FPN3 4WM7A 1GQPA 1LCLA 4NRQA 5LEJA 2F17A 4Y33A 1M4WA 5GKAC 5EZWA 1ZBA3 1FOD1 3ATGA 3THTA 1U5IA 3N36A 4I3PA 1AF9A 1A3KA 5BNOC 3ITQA 1UOFA 2GDFA 5FYCA 4IV1C 4AGVA 2XPJA 2C24A 1ND3C 3ZYGA 3WQ1A 3NNJA 3CLPA 1JW6A 2VOVA 3T3YA 4LBQB 1KQRA 3JCIA 3CQOA 1JTZX 4UAPA 2BDRA 3RRDA 4WV8A 5JMOA 1Y3TA 1QJZA 5A7OA 2HYKA 3MUY1 3AYAA 3U37A 3N35A 3HAGA 1US2A 4GB33 2IFWA 1J3PA 4IV3A 5A7SA 3BPZA 3NRUA 3MI8A 4GJYA 4P02B 4ZKTB 1BLZA 1STMA 5B4XA 1VBB3 4QM9A 4AQTA 4A7KA 5FZ4A 1CAXB 2NPIA 3ZXEA 2HEYF 2RS13 3HJRA 4L2NA 3KV9A 1PO13 3PVNA 4E2QA 1A78A 1ST8A 1RUE2 3B5LB 4AI1A 5SV8A 3I49A 3NKGA 1V00A 3RVHA 2BUKA 4LKEA 1UKRA 4XVHA 3RZKA 2K2SA 3AZVA 3PL0A 3BODA 2NM1A 3NKTA 5J37A 1POV0 2VUAA 3K77A 1JZ6A 5L9VA 1UYZA 1W90A 5FYIA 1X9TA 4EN0A 2OZ6A 5AFBA 5C5UA 2W46A 2QZ3A 4B7EA 1OLMA 5FXWA 2B9UA 1NA1C 4MGQA 1W8ZA 1RUE1 3U14A 1F31A 5IFTA 4DOUA 4YNIA 2GP5A 4E8DA 5BPXA 2ADEA 2L9LA 1SQ4A 1RUOA 4META 3WQ7A 5JR7B 3Q8CA 2VW1A 4M01A 2WIIB 3VBSB 2CWSA 2VW2A 2FMYA 4LXLA 1XPWA 4AGGA 1C1LA 4Q5OA 5ABJA 4Y22A 1FOD3 1YI9A 3AKSA 1I1EA 1C4RA 1JU3A 4TLGA 3L9JT 5T54A 5DUUA 1G9FA 4PDWA 4QDSA 4Q1RA 2N7GA 2UWAA 1OI6A 1XYOA 2ZJCA 4LNVA 3ZSKA 1PVC3 1UKGA 4FPCA 4AVBA 3U1XA 1LTEA 5EXOA 3UKVA 4AR2A 5BNNB 2ZX0A 3VBHC 1SPPA 5T5OA 1MVQA 3M3CA 4IEXA 1VPHA 3MW3A 5FK8A 2D40A 1H1AA 1QQP2 4AFMA 1D4M3 5FBJA 2PN5A 2DUPA 5CKNA 1NCRB 3CJIC 3D0JA 1J58A 4BISA 3W9AA 2GALA 2Q1MA 1AR62 3AP9A 1GFF2 1I9RA 1PK6A 3DN7A 1OVPA 4A44A 3OEBA 3NNMA 4GQ7A 1R1ZA 2R32A 3EBRA 2C9AA 2JE7A 4QQLA 5KXCA 2GN7A 2VXJA 3N3HA 3ROUA 3MF6A 3WDVA 5FJKA 2VTXA 5LEKA 1QQP1 2X8KA 4LORA 2ZHLA 2DF7A 2XVKA 1H6XA 1HQLA 5FZ8A 4E8CA 3HQUA 2W9XA 3LPGA 2DVFA 1UY3A 2IZWA 1XC6A 1B35C 4HSJA 4XILA 3ZX7A 4ASLA 5AC93 2VQUA 4MGYE 2WS92 4QX0A 1QY4A 4WM7B 3MZHA 2W39A 2VCAA 1ND2C 5FPZA 3IDCB 1H2MA 1OUSA 2X09A 1W9TA 3SNMA 2DBIA 5LZ6A 3LCPA 5KHHA 1DGWX 4AVSA 1H2KA 3I54A 4IUGA 1JZ2A 3NJXA 5DXDA 2CGPA 1AUYA 4EE2A 1LOAA 3HT2A 1O4YA 1Z78A 1RUE3 1PNFA 1H0BA 5IAXA 4GKXA 2HWB2 3NAPC 3AL5A 5FO7B 3QLQA 5T50A 1OKQA 1VBD3 1GNZA 2J1RA 4FVVA 5A3UA 4DPNA 4R52A 3KGLA 2JB8A 3R4DB 4JX0A 4AFAA 2Y60A 3ZYBA 1F4AA 4XXAA 4WVWA 1GNYA 1UPIA 5FLJA 2VO5A 4K9SA 3ZXDA 4XDQA 2YV8A 5LB6A 2UWBA 2D6NA 4I01A 1SEFA 5IAVA 3SC7X 3IBMA 1CJDA 5EP9A 1VBA3 4FOYA 1QOOA 3O1TA 1OXCA 2HWB1 2DCKA 2VPVA 2XLFA 1QJU2 2E9QA 3CHXA 4N43A 3CNAA 3I8TA 4WM8C 3MIDA 4XBNA 5GZEA 1COV2 1JZ4A 2NMNA 3IAPA 4CXYA 3RYPA 4YZ2A 3JB8A 4B3NA 4PI0A 3LDRA 5EJZB 3I2FA 4S2DA 1OURA 2XVGA 4X6QB 5FYTA 3AP6A 4HXCA 1GKBA 2VOWA 5CBLA 2ZTNA 1NCQB 3E6DA 2XLAA 3PURA 5IATA 3WQ0A 4BK5A 4YZ5A 4PBPA 4YW4A 4XFBA 5LK7B 4RR3C 1KXGA 1COV1 3T08A 4DY3A 4JGYA 4YW5A 1KGYA 1ULOA 5F3IA 2VMEA 2ZGSA 3KLSA 3AYCA 4HT1T 4OI4A 4IEYA 4NPRA 3DPRC 4B29A 2CNAA 1OOPC 5FQ0B 1QGLA 1S0BA 1WMFA 1CN1A 3POSA 3WX5A 3ZOIA 4P9JA 3AVSA 4R8HA 3VBOA 1TEIA 4HVOA 3KT1A 5FZ3A 4XUQA 1ZA7A 3MW4A 1PO22 2I74A 3J26N 5JPNB 1AZDA 2H0BA 2CGOA 3KQ4B 1ZRCA 3AKTA 4PBOA 4XIKA 5GALA 4Y22B 2ARXA 4AI2A 5ABJB 1EY2A 2LUWA 5A6YA 3MBWA 4PDWB 4AVAA 3OCPA 3WINE 1UIJA 3H8OA 3J7MA 1ZZ8A 2Y38A 1H8TB 1DF0A 2ZHMA 3FBMA 1O4ZA 3ZXKA 1H4HA 4OQ8A 4XHBA 5EV7A 3VZMA 1SPPB 1V9U3 2DVBA 1DYOA 2B39A 3VDDC 1NYWA 3MPPG 4DXTA 5JLVA 1WD4A 2RDRA 1PO21 5KHGA 1V6JA 4HSLA 5I0SA 2B42B 2IVJA 2WNVA 4HPKA 4MLOA 1CZTA 4CUGA 5SV5A 3TEZA 2NN8A 2VCMA 4XJAA 1PK6B 1WCQA 3DYMA 2VBBA 4CCKA 2PMWB 1VMHA 2VZUA 4HETA 2BBVA 1NG0A 1ULFA 4XBLA 5DZEA 1J84A 2Y34A 5CAZA 3AZXA 4P00B 1REFA 2OS2A 3ACIA 5CVRA 4QHOA 5T5PA 3ZPOA 4ARYA 3UETA 3KGZA 4URAA 2G1MA 3E6BA 1LGNA 4MSVA 5C6CA 2XOMA 1AHSA 2WA4A 1GQHA 4YVWB 3I3MA 2HKXA 1BYHA 1G9BA 4P9YA 2BJSA 4BWOA 1W6PA 3ZYIB 1AXYA 5K4LA 1KJRA 2UY9A 1COV3 3ES4A 2BEOA 3MIGA 5J48A 4R9BA 1O3QA 4F83A 4P9LA 5FYSA 1NQJA 2PELA 2WFF3 4JDNA 5DDJ2 5APAA 5CG9A 2TNFA 4IE5A 4OI1A 4L11A 1MS1A 1UNBA 5JI9A 4QPYA 3NWKA 4CDXC 1RUJ2 1GWMA 1GZ9A 1VB4A 5FZDA 1YEWA 3H9AA 2F4LA 2QCSB 3I59A 1H2NA 2QZ2A 3PMEA 2X29A 2NYYA 1D0HA 3MIEA 2NZ9A 1XJAA 3C7FA 5CZKA 1UL9A 2EXJA 5FMCA 4CDUC 2D5FA 4I0WB 1W6MA 2XL7A 3WG1A 4UWDA 1HV1A 5IK4A 5FZCA 3UGFA 3I3DA 1ODMA 1T6BX 1HN1A 2OPWA 5DDJ1 1F8VA 1DGRN 2A6XA 4Q26A 2VUJA 3FLPA 4UI9L 1QJY3 1RUJ1 1WLWA 2HJIA 3TNQA 2WT1A 1NX9A 4YVSC 3ZYRA 3JD72 2JIGA 2CWMA 3RDIA 4QKDA 5HCBA 5F6LB 3FHIB 2Q5TA 4YW1A 2HWC2 4LUMA 1PO23 5CFCA 1YC61 1YQ5A 2VZTA 3J7NA 1ENQA 2IXKA 1IG3A 4LKFA 3W21A 2RDNA 1UOBA 5F8PA 2Q8OA 5C3OA 1IQAA 4X8PA 2XBO2 5FIXA 3WP3A 1MEC2 3ZSLA 3UL2A 1OF4A 4NHLA 4QXKA 2VOXA 2X53S 4QXBA 3L2YA 4MYEA 4FAGA 1QXRA 2UYBA 3JD71 3PJQA 5FTTC 5CADA 3DF0A 1XNBA 1HXS2 4QPGC 4C0HA 2GMEA 2XONA 3ACLA 4JGYB 4CDQA 4C91A 1V6NA 5FPBA 4LHNA 4Z8BA 1TNFA 3UNPA 3NV1A 2YPDA 1M06G 2Y0IA 3PTRB 3PUQA 4OHVA 4XABA 1S0CA 4BJ0A 1Q8PA 2XBO1 1MEC1 1OHFA 3AX4A 4AVTA 4UW5A 4CU7A 1UO9A 2AH2A 2WINB 4PLNA 4AI9A 1W99A 5CYYA 4EN7B 1IKQA 1V70A 1YLLA 2P37A 4JQRA 3VN4A 2PHXA 5B2GB 4Q0QA 5HI0A 1LB2A 1R082 1HXS1 1VALA 5D1IA 3K46A 1GZCA 1LULA 4ZU4A 3VHNA 5KHJA 2H6CA 5A32A 3FC0A 4BMBA 1URXA 2WO1A 4HK8A 4TWTA 3WG4A 1KITA 3BPSA 2R042 1ZREA 2WO3A 2R063 3ZSEA 4B7KA 1RUD2 1PMJX 2XB6C 2VL4A 5GLZA 5AFEA 2A6YA 1UCXA 3N4MA 1R64A 3DYOA 2WLQA 5E8AA 3HN3A 2GH8A 4UW4A 1G9AA 1R081 1F5FA 1HJFA 4K6BA 3HNMA 1AR72 4Z2AA 1ASJ2 2H0VA 5DDJ3 2P17A 1X8EA 4AEKA 5FZFA 1IOAA 3H3LA 5I91A 3MEPA 5GLVA 5FPXA 2JB4A 2ZEXA 1Q8OA 2R041 3TNPB 4FFFA 2YGMA 2WKKA 1RUD1 3C7HA 3WW3A 5DAXA 4C0BA 4I0BA 5FZAA 4C8DA 5A7WB 5A7PA 4RYDA 4BQWA 4MGKE 2ZGOA 3CZUA 5FY5A 3WDYA 1QHDA 1LHUA 2LS6A 3ZR6A 1R1A2 4TTGA 1AR71 2QJVA 3M3QA 1ASJ1 2VR4A 2WNUA 3AK0A 3PVOA 5FY7A 3UV9A 5BNPC 2GNDA 4IEUA 2QDNA 1U5XA 4KQ7A 4XETA 1N3QA 1S0GA 2FMDA 3BOWA 1DGWA 3HNYM 3ORJA 4XMAA 1LEMA 5LBBA 3ZYJB 4JGZC 1YQ8A 3SH4A 3TN92 4ATFA 1VRH2 2FCTA 4MHUA 2D43A 5H9PA 2PLV2 2A3YA 1PGSA 3UKNA 1DQ0A 3T1MA 3WV6A 2XR4A 1UF2C 3KB5A 3VDCA 1R1A1 4OVEA 2E53A 5I0RA 1IHMA 4I0AA 2XBO3 3E97A 1QH6A 5H9QA 5KXEA 4EROA 1K5MC 4IEPA 4Q29A 5FO9B 1N1YA 1FXZA 2EALA 3A21A 4GWIA 1P8JA 4NAMA 4Y24A 3LEGA 3TN91 5A6XA 1VRH1 1W6MB 3FFQA 1AXKA 1HXS3 1SDWA 2BVBA 2PLV1 5F5QA 1D7PM 1UYYA 3FN9A 3PU3A 4M00A 4MZUA 4E2GA 3A22A 4CP1A 5I8YA 2VVDA 2C4XA 2D6OX 2ERFA 4CXWA 4GH4C 5GLTA 1OPOA 4M0NA 1QJX2 2OUJA 5BV6A 1CPMA 1PMIA 3OSDA 4GALA 3O14A 3ZIXA 4NROA 3B7MA 4BA6A 3O5SA 3BTAA 1ZRIA 1N1TA 3EHKA 1MS0A 1CAWB 2WO2A 5FZ9A 3D5OA 1Y9GA 3FHAA 3IIIA 1XU2A 5CFCB 5K8SA 1UMIA 1R083 1AVBA 1H6YA 2XHKA 2R072 2RJKA 4JCKA 5BXXA 5A1FA 4AI0A 3K2OA 3K3OA 1AYM2 2FQPA 3IAQA 1BQPA 3U4XA 1GOHA 1QJX1 2JIJA 2R043 3WXPA 4BOWA 4NIDA 1RUD3 2P3IA 2RMU3 1OD5A 5GM0A 1QOTA 2W08A 3E5XA 3WDTA 2WT2A 4CDQB 2XUEA 3AKQA 4LE3A 5FZGA 2O14A 2P1BA 4YG0A 1BBT2 1LOFA 2PHUA 3ZFEC 4EWAA 1E5RA 1XNCA 2CYFA 1W9YA 3WDUA 4DZGA 5IK5A 3RZGA 4QKNA 1JYXA 3O1PA 2OW4A 2G9ZA 1AR73 1MQTC 1NT0A 1L7RA 3WP5A 5I0DA 4LLFA 5D2AA 1U5ZA 3RG0A 1AYM1 1MS9A 3PU8A 3JQWA 2ZGLA 4KU7A 2IXCA 3S0MA 2ZKLA 2YY1A 5J3UA 4O65A 1RUC3 1I5PA 4HZFA 1GLHA 4K7JA 1YCIA 2J1UA 4LHLA 2VJXA 3WEZA 1JOBA 3OGRA 2VVEA 2RR12 4XFCA 1OUXA 1BBT1 5EHDA 1GR3A 3KHBA 1ZZBA 5A32B 4QDQA 1AR83 1W2TA 2J1AA 4LTAA 1ZM1A 2HBUA 2ZZQA 3LPFA 4YM3A 2P6HA 2XKPA 1FX5A 4YZ1A 4AEMA 3FMGA 3LOIA 3WNXA 1E57A 5K0UB 4PJYA 2BYVE 3AMNA 2WLPA 4E4DX 2WFPA 3TN93 1TME2 3T2TA 2A71A 1Q43A 1W0NA 4N53B 1QDOA 4XJZA 2AR6A 4HVRA 4RN5A 1GMMA 2RR11 4JHZA 4FSJA 2EXIA 5JZGB 4LJHA 3ZSJA 1JYCA 2ZGNA 1G8WA 4DUWA 1DHKB 4OUMA 2GAUA 4R4XA 4XCBA 4NIGA 2CGNA 4UFJA 4XTPA 5G05L 4QXCA 4FPFA 2PQQA 1HKDA 3LEIA 4MGZE 4CEYC 3P1IA 3K4AA 1TME1 5F3CA 5F1RA 4AVCA 2Z5WA 3QACA 4FPOB 3RMXA 3IN9A 3ZFGC 3IPVA 2W95A 4AHXA 4AQ6A 4E2SA 1FV2A 1LGCA 3I97A 1RUI3 4UT5A 1AL0G 3H0OA 3KT7A 2NMOA 3KVBA 4RSUA 3LSEA 1QJX3 2P3KA 5C9AB 4Q4W2 4LBQA 3BI3A 2QQVA 1JYVA 2SLIA 3VHPA 3O1SA 1XNKA 4ZZ5A 4RA0A 2DCTA 4GZ9A 2Q8EA 3ZIWA 1POV1 4F8AA 2VZOA 5FZMA 2ZX1A 4GWMA 1REDA 1DG6A 1KJLA 3VD9A 3CKHA 2IXLA 1NLQA 5E89A 2FDIA 3LIHA 1RUH1 4A2UA 4ISRA 3W59A 3AB0A 2D93A 2VNRA 4B4RA 1AYM3 1R091 1ULEA 2VZSA 1C57A 2GN3A 4ORFA 2BERA 4JTOA 1ZBA2 1XNDA 1HB1A 3LA2A 3WDXA 1CAXA 2GSYA 4COZA 4Q4W1 1HN0A 1HW5A 4UXAA 4LA2A 5CKQA 1PMHX 4AHZA 5KBFA 4QPWA 2D44A 4R4ZA 4JAAA 1XOYA 4BQ4A 5FXZA 3I2IA 1XU1A 4DXSA 3IB3A 3WLUA 5FPUA 2P34A 5F2SA 4FPGA 2JXAA 4Y4YA 4AE2A 5A1LA 1MS5A 2A75A 4QKBA 2R1BA 4BLJA 1LODA 3LIGA 4LO4B 2ZHNA 5DUXA 4YZ3A 3JZVA 1ZBA1 2OZJA 2D6LX 4CE8A 2EXKA 2HEWF 3ECQA 3NVCA 2WNOA 3S30A 4CYDA 2VECA 4RHV3 4D94A 2BNMA 5FPAA 4IL7A 2BVVA 3LQCA 5FKCA 4XJUA 1FAYA 2TUNA 3MW2A 4PQQA 4GB32 4RQPA 1DBNA 3S57A 2D3PA 2IXJA 2O8QA 2AEZA 3NO8A 4CDWC 1UMHA 1VJ2A 4OMCA 2IXIA 4SLIA 1N3OA 2JG8A 3MIFA 5FZBA 1JN2P 1TG7A 1VBB2 3BCWA 4YM0A 2WABA 4LE4A 3VD5A 1BCXA 2WQ4A 3M4FA 5DAPA 2RS12 1MS3A 5CNAA 4R9CA 3VBSA 5IVJA 4AFCA 2GMPA 1C8NA 2CHHA 4YG3A 4Q4Y2 2D3RA 2QQNA 3VBFC 4Q4X2 2FDFA 2XLGA 2V5YA 2WZ8A 2ZGQA 4XZPA 5D8AB 5K9YA 4KI5M 3N7MA 3R6SA 4UW6A 3WD5A 4P5YA 4AGRA 4K40A 5BNNA 4QDRA 4CUCA 2UYAA 4CEWC 4I2OA 4KL1A 2XL9A 3THCA 1VBB1 3CF6E 3CIHA 3TAYA 3ZN6A 1ZRDA 1ZA4A 2JX9A 5DAWA 3FBYA 2RS11 4ZXKA 1UY0A 3HQXA 5F7UA 1E5SA 4XJWA 4Q4Y1 4Q27A 4Q4X1 4GJZA 4KWLA 3K4ZA 5IVFA 2DUQA 4YSFA 1H30A 1UU5A 2D7FA 1RUH3 2FZ1A 2C1FA 3AVRA 4DRRA 4NIAA 5JR2A 1R093 1A8MA 1MZ5A 4YW6A 1WBFA 1YWKA 2FD8A 3D8CA 3WT3A 3HIFA 1S0IA 4HOOA 2A6WA 3VBRC 5L7OC 4K20A 3SH3A 4E4SA 2R0HA 2WQZC 2RJ2A 4IW3A 3T4VA 3KZ4C 5A3TA 3WF3A 1C5HA 4PQ9A 1PVC2 2Y6GA 4AEDC 5C8CC 2Z4FA 3SCGA 1OMIA 2PYTA 5JSRA 1XBFA 1GV9A 2LTNA 1D4M2 3CO2A 3GZEA 3MGUA 4UFKA 1MZFA 3IDAA 3UJOA 4YGEA 4OCTA 1D0GA 2WZPP 3LDKA 1BK1A 1FNZA 2FZ2A 2VTXJ 3IPVB 1PVC1 2VC9A 4O7XA 3S7EA 1IPJA 1VLNA 2VMFA 1W9SA 4AW7A 1JXNA 5ACA2 1UW8A 3PUSA 4Q0SA 1SMVA 2FDHA 3WSOA 2CU5A 4UFLA 1D4M1 1C8M2 5DPNA 4FTBA 4CVUA 4OMDA 1POQA 4JHTA 4KWUA 4D6QA 4EZ4A 2WC2A 5BNOB 4FPLA 3POIA 2BWAA 4IEWA 3RGBA 2B46X 2E6VA 3A0NA 3Q8EA 4GAZA 4HKWA 5AC92 2VUCA 3A23A 1BKZA 1LOGA 3ILNA 1NE4A 4MHRA 4QM8A 5FXXA 1UXXX 4BZ4A 1DYPA 2WNEA 1UQXA 4D7TA 5C71A 3I2OA 2WSUA 3SEPA 5IK7A 5ACA1 1H1IA 3KT4A 4L92A 3K75B 1NXMA 4FPEA 2E26A 3ACHA 1C8M1 3VZJA 3AKPA 4ITCA 4Q4Y3 1SLCA 1LESA 5L9BA 3GXUA 4Q4X3 3ZMNA 3BIEA 2BNOA 4C1XA 1O4TA 1VBD2 5AC91 5LA2A 5C8WA 1RJ7A 1NCQA 3LD8A 3WUCA 4MO3M 4WM8A 3VKMA 4AI3A 3I4IA 4IERA 4XBQA 4PIYA 1TZOA 3H1MA 1T2XA 1APNA 1W06A 3ZO0B 5ISLA 2YU1A 1PZ9A 1YUDA 1KD7A 4L9BA 1XYNA 4LIVA 3Q9OA 1YI7A 1DDLA 3W5NA 1ULCA 3EQEA 4RQPB 5JVVA 4YGDA 1VBA2 4JQTA 1FI2A 2R7EB 5FQ0A 1N1VA 4K8FA 1VBD1 5FO8B 1CAUB 5FP8A 4JKMA 2JG8B 5HPOA 5CFDC 2EIDA 4Y4RA 5CG8A 4GIQA 2VOKA 4OZOA 2RDQA 4XF3A 2ORZA 3CDZB 3PUIA 2YFUA 3B00A 2WWSA 1H9WA 3T0DA 2KA3A 4OUSA 3DPRA 5KC5A 4NPMA 1XNTA 5A6ZA 4YFWA 1OA4A 1VBA1 1H8TA 4CPBD 1A6CA 3A4UA 1X36A 2C0ZA 2HBTA 2WL1A 2DCZA 2F6BA 4DIQA 4IESA 3Q8FA 3DV8A 3ZN6B 4Q2FA 1J59A 3O7OA 2HYXA 4O9EA 4PIXA 4HN1A 2WYFA 1RTVA 1O5UA 2ID4A 3L2HA 4DS0A 4UFMA 3IKWA 1IGOA 4XFFA 1NCRC 4FFGA 1OD3A 3T09A 1W8UA 2WZR2 4QKFA 2YMZA 2OQ6A 3VBHB 3KMHA 5EPAA 3VL8A 2RG4A 1H2LA 3DXTA 5ACA3 4QQ2A 4ARXA 2JDKA 3BALA 2QNKA 2VCCA 3CJIB 1HQNA 2JG9A 1C8M3 3FL7A 1ODNA 3PVEA 1CJPA 3HPNA 2ZEWA 4YVWA 3OF1A 4OULA 1RC6A 3RYKA 1VMFA 3GBFA 1V9U2 1OQDA 3ZXFA 4A3XA 2WZR1 5C4WC 1AX1A 2ES3A 3UK9A 1AX0A 1ACCA 3KV5A 3SH5A 3MPBA 4Y3OA 1O8PA 1DZRA 4W50A 4WM7C 2IXHA 2QKDA 4RL7A 4XAAA 1NZCA 3DCQA 3UKTA 3H3ZA 1WMXA 5F3GA 2YHJA 1OFNA 3TWIA 4I30A 2WYSA 1MVEA 1LECA 2Z2SB 1B35B 4QWNA 4FXGB 2P2KA 3RMYA 4EWEA 3KHCA 4B1LA 4OFGA 1V9U1 4OI2A 4OZXA 1GUIA 2ZAHA 3G6JB 2WWJA 3I3BA 1IS3A 1Y9QA 2V4VA 4DEQA 4MXVA 5IVCA 3R05A 2VBPA 4K1YA 5DG1A 3WUDA 4GXLA 3KSCA 1F2NA 3UESA 4GKYA 4DY5A 4OQ9A 1VE0A 3GF6A 3NAPB 5EQUA 3SKVA 4OI0A 1CZSA 2EIGA 1GOFA 4RGAA 3RZZA 2XQXA 2YC0A 4QGLA 1OA2A 1WWYA 3J8F3 1UZVA 3LAGA 3H8UA 4XOGA 4LO8A 5FZ1A 2WFF2 2O0OA 2Y6JA 4IV3C 4JZRA 2YG0A 1HX6A 1UYXA 5H9RA 3DKQA 5JOYA 1QKQA 4LOTA 3BTXA 4AL9A 4IE0A 3C7EA 1U5YA 2OX0A 2XJSA 4M0HA 3I3EA 4WM8B 2WWUA 1AYN3 2ZEZA 1PGW2 3A7QA 3AP7A 1FT9A 3ETPA 4LO5B 1F5JA 3PHMA 4NOTA 3RZJA 3P6BA 3TB0A 3N9PA 2W5FA 2WFF1 4YZ4A 3DYPA 4FQZA 2YXSA 4QPIA 3ETQA 1YXWA 1ZZCA 4LUKA 2QQIA 1QJY2 1X82A 4PCRA 1LU1A 5AVAA 3ZFFA 1CESA 3ZXAC 2WZR3 4RR3B 3WP4A 4FOQA 3PUHA 4RGGA 2RS32 1PGW1 4TSVA 4KU8A 2W47A 3MV11 2IWGB 5FXVA 2YBPA 4YRDA 4A4AA 3DPRB 3FWEA 4YWAA 1OOPB 2HH9A 2VTFA 5FYYA 5ABJC 1QJY1 2ET1A 1SBFA 1JHNA 5LBEA 1WBLA 2V09A 4PDWC 2ZAAA 4FP3A 2KM2A 5FCCA 3K48A 2ORXA 2ZGKA 4YW7A 1UY1A 3ZMOA 2RS31 2YROA 4QU2A 2DCYA 3VZLA 2AC1A 3AJYA 3EB7A 1UN1A 2R0FA 1J1TA 1UZYA 3AFKA 4P9GA 1LHWA 3IDBB 3SQOA 5J36A 1CGPA 1GZWA 2D6KA 2VZQA 1S4CA 3AP5A 4ZONA 3N9MA 2DDUA 3NNFA 1GYKA 5IWFA 3KCYA 4YFZA 3Q8BA 1K5JA 3IMNA 3R4UA 2XHNA 4ATEA 3VDDB 1YNAA 3TEYA 3GZUC 5FYHA 1PK6C 5A7WA 1W8FA 4G3YC 2FCUA 4R9DA 4ZZ8A 5JAXA 4XFAA 1UX7A 4NJ4A 2DVDA 1XE8A 4X8NA 2GNMA 3U07A 4AI8A 2JG9B 2ZCWA 1RGSA 3AFGA 5J98B 1WW5A 2E33A 3ZXLA 2PAMA 4XQ4A 5FUNA 2K0GA 1G6NA 2R062 3U0ZA 1C28A 1SFNA 4AF9A 3OGSA 4AEJA 2BOIA 4UBHA 3POWA 2I07B 4CCEA 4RFRB 1AXZA 4QD2A 1SHWB 1O8SA 1O3SA 1VAVA 4FFIA 1PHMA 1FV3A 5GZFA 3FUQA 4G9SB 4Q1PA 4XXPA 4XDOA 1ZVFA 4IE6A 3ASIA 3CEWA 5I0UA 3UGHA 1OH3A 3PLQA 4Q4V2 4Z07A 1UPSA 5IVEA 2X5IA 4QX5A 5FREA 2R061 1QF3A 3CL1A 1IG0A 3AMMA 5TSWA 4MX3A 1DZTA 2PHRA 5A3OA 5LRRA 3VD4A 1OC1A 4FCAA 5KXBA 5F5AA 1H1MA 4BQXA 3QH6A 1ENXA 2LALA 1FMD2 3KVAA 1U12A 3LEMA 3WHTA 3URFA 2QUOA 3POYA 3NQHA 1YO8A 4Q4V1 3RNSA 4AWDA 5EWSA 1GBGA 1W8HA 5IJRA 5JDBA 1I5ZA 3VDAA 3T30A 5HV4A 4MGTA 5IHRA 4MXWB 3T2QA 4XTMA 1MS4A 1IPSA 2VGDA 1WCUA 1CAWA 2RS33 3ACFA 2JE8A 4N43C 4LPLA 1QU0A 3GHMA 1FMD1 5A70A 3VKOA 2HEVF 2BU9A 1SG3A 1CWPA 4BPZA 2RM23 3BOPA 2VZPA 4CCMA 1W3VA 4YVSB 4B4QA 4N9IA 3TEWA 4QT6A 4BLIA 4W65A 4HKLA 1WCSA 1GSLA 1JBCA 5HCAA 4K1ZA 3EXUA 5T55A 3OB8A 1HRV3 1PX4A 3THPA 5FKBA 4QAWA 4QPIB 3S5QA 5C3SA 1O59A 1SZBA 2WAOA 2VXRA 4JGYC 1DIWA 4Y5TA 5LA9A 4A42A 4FT8A 4PF5A 4CU6A 4CCNA 1NY72 2DFCA 4P9WA 3ZFFB 4AXOA 3AMPA 3HNBM 4QPGB 4CCCA 3ZYPA 2DV9A 5I8SA 2JDHA 3OUIA 2J42A 3VBOC 1QMJA 4Y26A 1A8DA 4Y1YA 2MEV3 5L19A 5F5CA 1RITA 4QX1A 3IDEA 4FOVA 1YJLA 4YPJA 5L36A 3F2ZA 3HMYA 1I6XA 2BP6A 1LOCA 1RHI3 3FHQA 4CUBA 4KGGA 1UYPA 2RMU2 1PIV2 1W6OB 3KWVA 5IUQA 1NY71 2WA3A 3IM0A 5K0UA 1V6KA 4MH0E 3WF2A 3FFZA 2Y8KA 1CPNA 1UOGA 5FZOB 3PMSA 4HG6B 4CP2A 3O1VA 2OUHA 4AQSA 3ACGA 4N53A 3VB9A 4XC9A 5IVYA 1EPZA 2Q8CA 4ISQA 1FNYA 5FMBA 3JQXA 5EJ3A 3O1UA 4COWA 5JZGA 1GZWB 2X05A 4IEVA 4Q4V3 4CU8A 4AHYA 1XRUA 5A3LA 2ZACA 4QHBA 1G9CA 2WNVC 1RUC2 5GZDA 2RMU1 3HD8B 1PIV1 2PQSA 4ES9A 4ZU7A 4KMQA 1OFSA 2BFUL 3ILFA 3EJKA 3W20A 5C5TA 1HV0A 3H1WA 4NR1A 4UFIA 2YFZA 1UY4A 4J6GA 5FOBB 1CQ9A 3USSA 1AR82 1YQ6A 1LHNA 3S6PA 1W3XA 3THDA 1FMD3 2CV6A 3WW1A 1L7QA 4XUPA 2BFUS 3IZOA 2JD4A 3MFCA 1UOJA 2AGSA 1CVNA 2NQYA 1W03A 2XDVA 3BB6A 2I45A 4FTEA 5I8TA 4D7SA 5JPMB 2FBEA 5C9AA 1RUC1 5LK5A 5FZ0A 2BQPA 1KRIA 3N9QA 3T1LA 1O6UA 1ONAA 1N47A 4QB6A 5FY4A 2XH6A 5DG2A 5FMOL 4LIUA 3RI8A 3ZR5A 5KR7A 1AJKA 1AR81 2XJUA 5BNPB 4OYUA 4JC1A 3GZTB 5C33A 2X5IB 1S1AA 4J25A 4Y20B 4Y1UA 2ATFA 2A6ZA 5FMOS 3F95A 4AYUA 4JGZB 2P3YA 4HKOA 1O3TA 3AP4A 4MUVA 3CMGA 3J7LA 2W1SA 3H7YA 5FP9A 4D3WA 2HWE1 1XSRA 2W94A 1ZZ6A 1RUI2 3VZNA 4IXLA 1GWKA 1EP0A 1UZWA 5GZCA 4M4PA 3SISA 1K5MB 2GZWA 2HWF3 4NPLA 2UU8A 1HB4A 4ZHNA 3B02A 2VMIA 4BYYA 4QXHA 2RJLA 4XACA 1W39A 1W2UA 1UXZA 1EUTA 3ST7A 4EN6B 1W6NA 5EYXA 1UU4A 1RUG3 2Q1ZB 5A7NA 5JXGA 4LOSA 4GH4B 4RS5C 5CFCC 1RUI1 2ZZJA 3CU7A 3OD4A 4IDZA 1AX2A 4DXZA 2GNBA 1EYBA 1UZZA 5FAXA 5FP7A 1U0AA 3BVCA 4ZY9A 1PIV3 2WAAA 4HVQA 3EYPA 4ZXEA 3OEAA 1H8VA 3M3OA 2QQUA 2RS52 1LJ7A 1BJQA 1YFYA 4GWNA 5D8AA 1GWLA 2VQ0A 4OLLA 1GZTA 5DMYA 4CDQC 4WVZA 3K3NA 3VDBA 3VUOA 3RFRA 1X7NA 1GNHA 3VBUA 5EJ1B 1WA4A 2ETEA 5FZLA 1GOGA 3RZHA 3K4DA 1SACA 1Z7S2 3MHZA 1UD1A 2Y6KA 4RHV2 3DECA 1S0DA 4V2VA 3PUAA 1MZEA 1OLRA 3MIHA 4XIOA 3O1OA 1C1FA 2JWPA 2OQ7A 4GD4A 1ZRRA 2RS51 3WR0A 3MUZ1 4JKKA 1MQTB 2GC0A 1NAEA 3DKWA 1ZRFA 3OGJA 5ANNA 4COVA 4BDVB 3LF7A 3WCSA 4BB3A 4KGQA 3WW2A 1OH4A 1RMU3 3POBA 4M3CE 2W52A 4WVMB 4UOJA 3FZ3A 2ZGMA 4DFSA 4XYXA 1Z7S1 4RHV1 4BM8A 1XXNA 4A41A 1HIXA 5F32A 5FYZA 1UWWA 2HWE3 2C9KA 3C7OA 3ZM8A 5A33B 3Q8AA 3AL6A 3GGLA 5JSPA 1SBEA 2ILMA 4LBNA 2JE9A 4RD7A 4WVVA 2ARBA 3S7IA 2J1EA 4OHXA 1RVF2 4A45A 4BQ2A 2DVGA 5E16A 4XHXA 3B9CA 1MS8A 1QDCA 5JI7A 3WG2A 2B9VA 2XUMA 5LATA 3KV4A 5ERLA 5FZHA 3RWNA 4H2AA 1JZ5A 1RUH2 1SLBA 1X33A 4HONA 5JXJA 4ZU5A 1ZNPA 1R092 3V65A 1WD3A 1ZZ9A 4YM2A 3WF1A 2CSGA 3O1RA 3R4SA 1JH5A 3VKNA 1WUVA 4HL0A 2VNGA 2WNUC 2XXZA 1CZVA 2H6BA 3G7DA 1RVF1 3LA3A 4NIIA 4QQHA 5B4NA 1E5HA 5A3NA 5KHKA 2YU2A 5BNOA 4Z92B 4XURA 2VE1A 4IV1A 1JZ3A 1LR5A 3VZKA 1NE6A 3ZFGB 1ND3A 2JD9A 3OG2A 1W8WA 4NWWA 4QU1A 4HK9A 1RUF2 4U36A 5FZIA 1W2OA 4P9XA 4NRPA 2Q30A 3WOGA 2AENA 4P14A 4ET7A 3OYWA 2UY8A 2QE3A 1Z0HA 3RJ2X 3HT1A 4KBBA 4CP9B 4AZZA 3AM2A 4YYOA 5FYUA 3WP6A 3M1HA 2RS53 2GU9A 5DABA 3B3QE 2CDOA 2QQLA 1SFPA 4FQ4A 3MLJA 4K3UA 4GA9A 2NP0A 2PA7A 1RUF1 3T0AA 2VVFA 5LBFA 2PHFA 1WLDA 1KDMA 2JDMA 4JKLA 1W9WA 3KCXA 1NLRA 1Z7S3 1Y9MA 2O1QA 4QX8A 4AK3A 4DUXA 2DVAA 2WR9A 5FR3A 1W6NB 3WF0A 1WKYA 4J1XA 4LKDA 4COUA 4JRAA 3RWKX 2VAUA 1CAUA 4N7IA 1EPWA 4LEJA 1LNSA 4SBVA 5M0TA 1FATA 2D6MA 2DFBA 3B93A 2V73A 2V72A 2VBDA 4XF4A 5FBZA 2MPFA 3QOPA 2ZGTA 4HFSA 1J3QA 3E1F1 2EIEA 1IZ3A 2R16A 1ULGA 1NA1A 1WMDA 5L73A 1ZYBA 3PDQA 4Y1ZA 3SITA 4TYSA 5H9SA 4BIOA 4CDWB 4XF0A 2J1TA 1DCSA 1LOFC 2EIBA 3VBUB 2QQJA 1LOBA 3M7AA 3JXSA 4NHMA 4BH9A 4UYBA 3HQRA 3EMRA 4MG2A 3T4HB 1W8OA 2ZX2A 1RVF3 3R0RA 4DXRA 1L3JA 5FRAA 3VBFB 2HLEA 1GU3A 2VMGA 1UZ0A 2BTVC 3NV2A 4PLMA 1YRZA 5DUWA 1K45A 2E63A 3B01A 3LFIA 1MR5A 4K8RB 4XCAA 3VBHA 4CCLA 4CEWB 2WZEA 3LGRA 2ZOEB 2VOTA 2YBKA 2FHRA 3CJIA 1PZ7A 4CCOA 2YYOA 1BK0A 4CUAA 3BU0A 3CBNA 1DQ1A 2CAVA 5KHIA 1RYYA 1JYIA 2QBXA 2ZX3A 5A3MA 1LEDA 1XYPA 1QIQA 1S2EA 2XJPA 5BY5A 1RUF3 1Q5OA 3V0AB 4AAXA 3VBRB 5L7OB 1OSGA 4BCUA 2VULA 5LW9A 2AYHA 4DO0A 4QX7A 2PHWA 3H42B 2PXJA 2Y6LA 1NXD1 1JZ7A 1EV12 3ENRA 1LRHA 1H9PA 3UT0A 1B35A 3BTYA 5E1RA 4S2GA 4AEDB 4IEOA 5FZKA 3SCFA 2VQTA 3FJSA 1ND2A 1QJEA 3PIJA 4V2WA 2ZPXA 2ZX4A 3W5MA 2BZDA 1HRI2 1QWRA 1YIFA 2RDSA 3RZMA 2BBAA 5I93A 4E4HA 1Y4WA 2A70A 3J9SA 2XJVA 4IV1B 1BXHA 2JDNA 2QFEA 3O0VA 4KH9A 4LHKA 1ND3B 3RI9A 1EV11 2CY6A 3GALA 3NAPA 5C7GA 4LITA 5FJHA 4AOCA 1XNAA 3TEXA 1BEV3 2BPA2 4LKSA 2YPJA 4IEQA 4BK4A 3FLTA 2Y6HA 3OYWB 3PTYA 1HRI1 2ZA9A 3KV6A 2R1DA 1VBC2 3M3IA 4L99A 3ZPYA 1OQ1A 4XZUG 1SFYA 5F39A 3RJRA 5HXMA 3H1YA 3HBZA 2ET7A 3AZZA 1ENRA 2VZ1A 4LULA 2BRTA 2E51A 4PT6A 4UBGA 1UAIA 3J4UH 5LRSA 1ZBE3 2QQWA 3MLKA 3U75A 1W2AX 1IS5A 2RVAA 4IE7A 5FYMA 1CONA 3OUHA 4N8MA 1VBC1 5F37A 2ZBJA 3FX3A 4XFIA 1RXFA 2F4PA 3T0BA 5EIYB 3SMHA 2XJTA 1QJFA 4PLOA 1LHOA 5JMCA 2XJQA 3J8F2 4CRQA 2D98A 4OUEA 4RQPC 4RR3A 5GJ6A 3USUB 2SBAA 4KWKA 2DU1A 4AQ2A 4A6SA 2G19A 2JG8C 1Q8SA 1JHJA 3DEMA 1S0FA 2W1UA 5FY9A 3NJVA 2G9FA 3VLBB 1NA1B 5IT6A 1WMEA 3VBSC 4BHPA 3V0BB 3VL9A 1OOPA 5EFUA 1PM4A 2ZXQA 3GZAA 1QXJA 1AYN2 4FBFA 1VMJA 1WW6A 3OUJA 5CIRA 5CFDB 2Q0AA 4BIFA 4COYA 4DINB 4EQVA 3NW4A 3NV4A 3J8F1 4LBLA 1BHGA 4CP0A 5FLIA 4D6SA 3MLLA 3ZKYA 4H55A 5BNNC 3I3QA 4B4PA 4QB2A 1JOJA 5C3QA 4V1PA 2WN3A 3B94A 1J1LA 1F15A 1GICA 2Y64A 4YGCA 1EV13 1YIPA 1DP0A 1V6OA 2W0XA 4W6XA 1K3IA 5LY1A 1AYN1 2J22A 1QNYA 3VDDA 4HMZA 5GLUA 2GC1A 4GULA 2EAKA 5JOZA 1OLME 1XE0A 4XMIA 1B09A 3ES1A 2OPKA 4LK6A 2YGLA 3RQ0A 1WLTA 3NMBA 3FLRA 3JBG2 1HRI3 2B45X 5FOJB 1PGL2 4NUBA 2C26A 2R30A 2PAKA 5FFOC 4D6RA 1VBE2 4OHWA 1X8MA 4RGKA 1YFXA 2EXHA 2XMLA 4I3GA 3AJZA 1Y43B 2AEYA 3TOJA 2VZRA 3WDWA 3LKJA 5IW0A 2E7TA 4W6YA 3RSJA 1UMZA 4R9AA 2C6SA 4CXXA 3GJBA 1J3RA 1X9PA 1ENSA 3LB9A 1KEXA 3P3NA 1REEA 5AVPA 3U4SA 1S2BA 3BUCA 2FCVA 3I2KA 4CZSA 3JBG1 3SLIA 2GC2A 1PGL1 2RHPA 1VBC3 2E31A 5D21A 1W0PA 4EN8B 1VBE1 5DN2A 4YLZA 3APBA 1XQNA 1G9DA 3S5AA 5C4WB 1K12A 1AR61 1ND2B 1YFUA 2Y26A 1RL3A 4DMIA 2P5BA 4AFBA 2PTMA 3GJAA 1LOEA 1OLQA 1RIRA 3ME2A 4GMP1 1CR7A 2PAEA 3H8XA 3T2PA 3AMHA 1EUUA 1NKGA 5F3EA 4HBNA 5FUPA 1D4VB 3POGA 2J1VA 4KG0A 2BOJA 4CDXA 1CIWA 4CSWA 1OQEA 1DZQA 1WLCA 3JUUA 3O0WA 5JWPA 4MXWA 1V6IA 4XUTA 4CDUA 3IT8A 3JB4C 1D2SA 2W1WA 2JJ6A 5DAVA 2WS91 3FE5A 4Q8KA 3ON7A 4F7ZA 4RFT0 2ARAA 3I2HA 3SCHA 4UW3A 2WN2A 3ABZA 4IGQA 3WZ1A 4JV4A 2AUYA 2VZ3A 4LO7A 4A7ZA 4L8QA 4CPBA 2O8OA 2ZABA 5JSOA 4Y5Z0 4YVSA 3OBZA 3N9OA 3BTZA 1BVVA 5J09A 2J7MA 1T6GC 2AACA 2W2IA 2XKOA 3HEIA 2QQPA 2Y33A 5A6QA 1NCQC 3VD7A 4IV3B 1ALYA 4PIZA 2EA7A 4QX2A 3MV01 4CTEA 5JIUA 1QOSA 4C90A 1TE1B 1BZWA 5E6HA 3GDBA 2Q8DA 1Q8QA 3U78A 3V56A 3KS7A 3OY8A 2YC4A 4KBZA 4W4ZA 4QPGA 3I2DA 3I2JA 3ZKUA 5A3WA 2VQAA 3KM5A 4I02A 1QJU1 1QXPA 3NV3A 1US3A 1C3HA 3VKLA 2MNGA 3JBG3 3E6CC 2Y6FA 3CJXA 3WF4A 1JYWA 2RM22 2LW8A 1DLLA 4U2AA 1LU2A 1QQP3 1VBE3 2ZMKA 1W8TA 3VKFC 3WY6A 3HBKA 2P6CA 2BV4A 1WW7A 4TN7A 1W6OA 4JVAA 4ZS3A 1AR63 2PHDA 3O0XA 4NVPA 5T52A 1ULPA 5FZOA 5JXIA 1JYNA 3MDPA 1H8TC 3UJQA 1HRV2 1FYUA 4GMP3 1OT5A 4MGIE 4PI2A 5DZFA 5FYVA 3GM8A 5F2WA 2RM21 2VCBA 2YB7A 3BKZA 2VUDA 2EF6A 2IFRA 2BGCA 2Z79A 4TZDA 4XQWA 2ZGPA 2WUHA 3BN6A 2VG9A 5J96B 1OBNA 1JZ8A 2V4AA 1TVGA 1HRV1 2MEV2 1HB2A 2WS93 2ADDA 4NMIA 1A34A 3EO6A 3K51A 4QGMA 4KWJA 4XUNA 2GH2A 4XW3A 1AJOA 1RHI2 1GP5A 1OF3A 2JG9C 3C7GA 1DLCA 5LY2A 4DQAA 4W8JA 1NQDA 1YQ2A 4PHZA 5LBCA 2Q4SA 5LWBA 1WCKA 3A0KA 4YVWC 2A6VA 5DQ0A 1Q56A 1F4HA 2A1XA 5T5JA 1QEXA 1RXGA 3LZZA 5JOWA 2HWB3 2VNOA 2W87A 3WNPA 2WO7A 2AZ5A 3M70A 4BQ1A 2WSVA 2MEV1 3LA7A 1OVSA 2OVUA 3ZN5A 5BNPA 5HV0A 4LBJA 1ZZ7A 4FOWA 1RHI1 4Y20A 5FYBA 3POJA 1F9KA 3ZYFA 4JGZA 1V0AA 3I2GA 1BMV2 2PHTA 3PJYA 3SEEA 3OPTA 4FO9A 2CDPA 4BE3A 2D3SA 2CTVA 3OTFA 4LHSA 3ZDSA 5FZ7A 4F3JA 5HCFA 4OHZA 1KS4A 4Y5SA 1E5IA 2FDGA 4MGSA 2GP3A 1QJU3 3D82A 4CCJA 4H7MA 1DFQA 3ZYHA 3POEA 4JTNA 4UF0A 4NWVA 5JIAA 4CDXB 4DB5A 2VD7A 1K5MA 1X50A 1W6QA 1RB8G 1J83A 4I09A 3OD0A 1W0OA 4M4RA 1BMV1 4NRMA 4CDUB 2WRAA 2V5DA 2KR2A 4D8MA 4NN0A 2DTYA 3MICA 2VMCA 4XFHA 5A1AA 2R6QA 4Z82A 4B1MA 5BNQA 4FTSA 2HWD2 4JDMA 2VM9A 1DYKA 3UGGA 4GH4A 5FP4A 2DURA 2DU0A 3AXEA 3M2MA 1HDKA 4AG4A 4IE4A 2ZEYA 2ZMLA 4GMP0 1PVXA 2D97A 1MZ6A 3QD6A 5L9RA 4N43B 2W91A 1CX1A 3HR9A 5G04L 4LBKA 5JUVA 3BGAA 2XG3A 3OGVA 2NLRA 2A3XA 2WQ8A 3HWJA 5KWRA 1UU6A 2HWD1 4RS5A 5DZGA 5FLHA 2QVSB 2HWF2 3O1MA 4QPIC 2DWRA 3KF3A 3OY8B 2OYZA 1W05A 4C1WA 3VD3A 4QQOA 1OKOA 3LEKA 1LGBA 2J1SA 4YG6A 5LA0A 2KXLA 3ZFEA 3ZFFC 2BWCA 1RUG2 4H7LA 2ARCA 1MQTA 4LT5A 1YYNA 5EYYA 1HQWA 4ZPIA 3HVDA 2Z42A 1JODA 1LENA 2HWC1 3DUIA 5A7QA 4XEZA 3MF9A 1RUNA 1CIYA 2ENRA 4IGOA 4WZCA 4YW3A 4FPYA 2HWF1 4PF1A 2QTWB 4WVMA 5CB7A 3DXUA 2YDEA 4D69A 2ZS6B 3HOBA 4P5HA 4Q0PA 5FP3A 1EAH2 3VBOB 4BMEA 1JYTA 3WCRA 1XSQA 2XQRA 1Q8VA 3W58A 5KXDA 1JU4A 1OA3A 2TEPA 3OOXA 3V64A 1WGPA 4FPKA 1RUG1 3MFAA 5A33A 1YHFA 3JU9A 2VU9A 4INDA 3AKRA 3GBGA 5JXHA 4FXKB 1JMUB 3NNGA 4CU9A 2W1QA 5FV3A 4E9KA 3OBRA 5FMDA 4BQ3A 3D4KA 2WBKA 3WVJA 3N7JA 2E7AA 3H7JA 4N90A 4HANA 3RPQA 3TBDA 3WNNA 1NLSA 4IGPA 1VIWB 1EAH1 2A73B 2VNVA 5I0TA 1YFWA 4GWJA 3RYRA 4AHWA 3AYDA 1GP4A 4QX3A 4TLFA 5GZGA 1DQ6A 1DQ5A 1HLCA 1DGLA 1NOVA 4EWDA 1W28A 1PM7A 2YZ4A 1RMU2 2WNVB 4HPKB 5C70A 4ONUA 1ULDA 1UY2A 3WHUA 5LCWL 5FY0A 4CEYA 1SBDA 3MYXA 4ASMB 5CA6A 5T3NA 1LHVA 1RUJ3 1SDDB 4FI9A 4P08A 4LBOA 1V6LA 4XUOA 1AL22 2HWE2 2VW0A 4CCDA 3D6EA 3QCWA 3ZXJA 4NHYA 1KFUL 1UIKA 3ZFGA 2RV9A 1W9FA 2VY0A 2HWD3 5IK8A 1JS9A 3INAA 5CEHA 4MV2A 4Y1XA 5CU1A 1RMU1 4IQPA 1XE7A 1W8NA 1IPKA 1S0JA 2GMMA 5IVVA 1AR92 2DBNA 2IUWA 2WJSA 2VZVA 3BIWE 4H3WA 2LM3A 2X5IC 1D2QA 5FPVA 5FDBA 1HJGA 3VV1A 4ES8A 5IYYA 3H3UA 3P5BA 1VAKA 4CP9A 4XE9A 1W6PB 1SCRA 3NJZA 5E88A 1AL21 2OIIA 4Q0VA 3JD73 4BXFA 3RZLA 3H8RA 1PX3A 3OGGA 4ZS2A 4UF0B 5BUVA 4G4FA 1KS5A 2HWC3 3B69A 2ZKNA 1W6QB 5DUVA 3AZYA 1G86A 2GNTA 1SCSA 1YJKA 3VZOA 4FP2A 1O3RA 2DCJA 4S2HA 2AREA 1AR91 1MEC3 2W3JA 4P9IA 3OPWA 1VRBA 3I59B 2BNNA 1RJ8A 1TNRA 1VB2A 4XQDA 3D3AA 2ZMNA 1YQCA 2B8MA 2MHFA 1G7YA 3AXDA 1SLLA 3LWCA 1V6MA 4QB1A 1KFXL 2D5HA 5JCTA 4D7YA 1QH7A 4NAOA 1H4GA 2Q1FA 3J7HA 5T5LA 5FWEA 4LBMA 2FDKA 1CAVA 4XDPA 2G9GA 3ZXGA 4YGBA 3VHOA 4BU2A 1TMF2 2EAAA 3C3VA 1VP6A 1EAH3 1HB3A 3M8LA 3OJBA 4IETA 2JKXA 5HBAA 1LAJA 1DQ4A 4LBQD 1L7LA 4BQ5A 2P3JA 1UX6A 2D6PA 3E5UA 4H14A 4LR4A 4M3CA 1WA6X 4RS5B 4A6OA 4CDWA 5J1XA 1IS6A 3AMQA 4FFHA 3QBQA 4NE9A 4W6WA 2PHLA 5IVBA 3T2OA 1CX4A 4NIHA 2YC2A 4OHYA 4Q8LA 1S55A 1QNWA 2A5ZA 3PVBB 4FAHA 2DYCA 2QQOA 3ZFEB 1DGRA 4LMFA 3VBFA 1TMF1 2XGXA 4HN0A 4Q0UA 2JENA 4EZHA 5K7PA 5FY1A 4YARA 1BVP1 1SLTA 5F5IA 5JOXA 1F35A 2JDUA 3GBWA 3LDBA 5A80A 3WQBA 2LROA 4E27A 3U10A 3SKJE 3ELNA 2W68A 3SHRA 4DUVA 4CEWA 2IC1A 4WZFA 2JDAA 2K9ZA 2R071 4NHXA 2ZGRA 1ASJ3 3NSTA 5CISA 4O9GA 3IIAA 1GANA 1I3HA 4MADA 4XJ9A 3BU7A 1MPXA 3ZVXA 2W92A 4A3ZA 1DQ2A 4AAPA 2CL2A 5FPLA 2K46A 5K0UC 4Z2WA 1AL23
chains in the Genus database with same CATH topology
1ZRIA 1F35A 1JODA 1JOBA 1JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRI A;  1F35 A;  1JOD A;  1JOB A;  1JYT A; 
#chains in the Genus database with same CATH topology
 3DL3 A;  1GQG A;  4LK7 A;  4N53 C;  3X29 B;  4LO6 B;  3TRS B;  4QQP A;  1O7F A;  1OPM A;  1R1A 3;  1WZX A;  2I2S A;  5ANQ A;  1IS4 A;  2OKX A;  5JZG C;  3V0A A;  5IFP A;  1RIN A;  3VBR A;  4DNY A;  5L7O A;  3N9L A;  4A7Y A;  2WDB A;  2BGO A;  2TBV A;  1AR9 3;  1VAM A;  5J7M A;  3WNO A;  3AC0 A;  4XJ8 A;  2E32 A;  1IKP A;  4XF9 A;  5FK7 A;  3DGT A;  2YUE A;  2QQM A;  4B8E A;  1VRH 3;  1K42 A;  1W04 A;  4JDO A;  4AED A;  4Z1V A;  3MIB A;  2PLV 3;  4YW2 A;  4EJR A;  5C8C A;  1CD3 G;  3CZJ A;  1C5I A;  3H50 A;  4N7U A;  2CAU A;  1WCD J;  3IMM A;  2Z69 A;  3N7K A;  4CEY B;  3IWZ A;  3GCW A;  3SXW A;  3ZLI A;  2FDJ A;  4D0Q A;  5DAQ A;  4BQY A;  5CKM A;  1JOP A;  2OXB A;  5C9A C;  4M3C F;  2UUR A;  1KDK A;  3ZDV A;  3N7L A;  5F9T A;  4XF1 A;  4CA9 A;  4EYU A;  2BGP A;  3O12 A;  4DRV A;  1ZX5 A;  3ALQ A;  3WNK A;  2KD7 A;  2WNU B;  2JDP A;  2XWJ B;  3OBT A;  3I7D A;  5FZE A;  1GP6 A;  2VMH A;  4DEV A;  4L97 A;  4E4Z A;  4FPH A;  3RS6 A;  1TMF 3;  2LRP A;  3GHN A;  1S2K A;  4KNC A;  4URT A;  3UYJ A;  4FPJ A;  4NO4 A;  3LOB A;  2UWC A;  2G4I A;  2JKB A;  1N3P A;  4KG8 A;  1DU3 D;  3HN1 A;  5KC6 A;  1FPN 2;  4EN9 B;  2R07 3;  3B9I A;  4BXS V;  2EIC A;  3GYD A;  2C5D A;  2YBS A;  2EVX A;  5LAS A;  1N1S A;  1NZI A;  4S2F A;  2ZGU A;  3GCX A;  4LA3 A;  4O61 A;  3VGI A;  2WT0 A;  3BYW A;  3POF A;  4XAE A;  2GC3 A;  5GLW A;  1BEV 2;  3TYJ A;  1MAC A;  2JDY A;  5FZ6 A;  1BBT 3;  5HXV A;  5HCH A;  5FUI A;  2VMD A;  5A3P A;  3USU A;  3NNL A;  1FPN 1;  2PFW A;  1JUI A;  2VH9 A;  1CAV B;  3KD4 A;  1VR3 A;  1WW4 A;  2A3W A;  2QDR A;  4UFH A;  1W2N A;  4LQR A;  1Y7B A;  4ASK A;  4HLT A;  3V0B A;  3VHR A;  4WBB A;  4M3C B;  2E7Q A;  1IQD C;  3P3P A;  4N9H A;  1BEV 1;  1ZBE 2;  2IVI B;  2OA2 A;  5CFD A;  3OPZ A;  2RR1 3;  1JUH A;  5D8A C;  5C3P A;  2XJR A;  5LA1 A;  4IEZ A;  2JEM A;  3KQR A;  3C8X A;  4QGN A;  3FUO A;  3VBU C;  5BYN A;  3U11 A;  5FWJ A;  3PIG A;  4X6R B;  4L0P A;  1PNG A;  3ILR A;  2DUO A;  4QHZ A;  1PO1 2;  2B7Y A;  2XWB B;  1TME 3;  3QH7 A;  3WW4 A;  3E5Q A;  2P4E A;  3M3E A;  5FY8 A;  1LKN A;  1ZBE 1;  4J1W A;  4GB3 1;  3KF5 A;  1SLI A;  2OT7 A;  4EV0 A;  3D0S A;  5F6K A;  4Y1V A;  1O5L A;  2XVL A;  4MOA A;  1O91 A;  2X10 A;  1PO1 1;  3KCC A;  1NCR A;  3OBA A;  4JRL A;  3WG3 A;  1POV 3;  2RE9 A;  3AYE A;  4AFD A;  2A7A A;  2B5H A;  2B4K A;  3NL1 A;  2QQK A;  3C2U A;  2JDZ A;  2DTW A;  1PZ8 A;  3GNE A;  3LFM A;  3NJY A;  2JEC A;  3PNA A;  2ZHK A;  3LSD A;  3AZW A;  3WNL A;  3WNM A;  2BW8 A;  1S0E A;  3ZN4 A;  3MO4 A;  4AVV A;  4TXW A;  2JIC A;  4MVT A;  2Y0O A;  1FOD 2;  1NUK A;  2R49 A;  4Q4W 3;  5C3R A;  1SLA A;  3LE0 A;  3N9N A;  4LLO A;  4NHK A;  4K21 A;  5C8C B;  1TQ5 A;  1JI6 A;  1XB9 A;  1Q3E A;  5C4W A;  4QMA A;  3ZSM A;  4XFG A;  4YM1 A;  4XPV A;  1FPN 3;  4WM7 A;  1GQP A;  1LCL A;  4NRQ A;  5LEJ A;  2F17 A;  4Y33 A;  1M4W A;  5GKA C;  5EZW A;  1ZBA 3;  1FOD 1;  3ATG A;  3THT A;  1U5I A;  3N36 A;  4I3P A;  1AF9 A;  1A3K A;  5BNO C;  3ITQ A;  1UOF A;  2GDF A;  5FYC A;  4IV1 C;  4AGV A;  2XPJ A;  2C24 A;  1ND3 C;  3ZYG A;  3WQ1 A;  3NNJ A;  3CLP A;  1JW6 A;  2VOV A;  3T3Y A;  4LBQ B;  1KQR A;  3JCI A;  3CQO A;  1JTZ X;  4UAP A;  2BDR A;  3RRD A;  4WV8 A;  5JMO A;  1Y3T A;  1QJZ A;  5A7O A;  2HYK A;  3MUY 1;  3AYA A;  3U37 A;  3N35 A;  3HAG A;  1US2 A;  4GB3 3;  2IFW A;  1J3P A;  4IV3 A;  5A7S A;  3BPZ A;  3NRU A;  3MI8 A;  4GJY A;  4P02 B;  4ZKT B;  1BLZ A;  1STM A;  5B4X A;  1VBB 3;  4QM9 A;  4AQT A;  4A7K A;  5FZ4 A;  1CAX B;  2NPI A;  3ZXE A;  2HEY F;  2RS1 3;  3HJR A;  4L2N A;  3KV9 A;  1PO1 3;  3PVN A;  4E2Q A;  1A78 A;  1ST8 A;  1RUE 2;  3B5L B;  4AI1 A;  5SV8 A;  3I49 A;  3NKG A;  1V00 A;  3RVH A;  2BUK A;  4LKE A;  1UKR A;  4XVH A;  3RZK A;  2K2S A;  3AZV A;  3PL0 A;  3BOD A;  2NM1 A;  3NKT A;  5J37 A;  1POV 0;  2VUA A;  3K77 A;  1JZ6 A;  5L9V A;  1UYZ A;  1W90 A;  5FYI A;  1X9T A;  4EN0 A;  2OZ6 A;  5AFB A;  5C5U A;  2W46 A;  2QZ3 A;  4B7E A;  1OLM A;  5FXW A;  2B9U A;  1NA1 C;  4MGQ A;  1W8Z A;  1RUE 1;  3U14 A;  1F31 A;  5IFT A;  4DOU A;  4YNI A;  2GP5 A;  4E8D A;  5BPX A;  2ADE A;  2L9L A;  1SQ4 A;  1RUO A;  4MET A;  3WQ7 A;  5JR7 B;  3Q8C A;  2VW1 A;  4M01 A;  2WII B;  3VBS B;  2CWS A;  2VW2 A;  2FMY A;  4LXL A;  1XPW A;  4AGG A;  1C1L A;  4Q5O A;  5ABJ A;  4Y22 A;  1FOD 3;  1YI9 A;  3AKS A;  1I1E A;  1C4R A;  1JU3 A;  4TLG A;  3L9J T;  5T54 A;  5DUU A;  1G9F A;  4PDW A;  4QDS A;  4Q1R A;  2N7G A;  2UWA A;  1OI6 A;  1XYO A;  2ZJC A;  4LNV A;  3ZSK A;  1PVC 3;  1UKG A;  4FPC A;  4AVB A;  3U1X A;  1LTE A;  5EXO A;  3UKV A;  4AR2 A;  5BNN B;  2ZX0 A;  3VBH C;  1SPP A;  5T5O A;  1MVQ A;  3M3C A;  4IEX A;  1VPH A;  3MW3 A;  5FK8 A;  2D40 A;  1H1A A;  1QQP 2;  4AFM A;  1D4M 3;  5FBJ A;  2PN5 A;  2DUP A;  5CKN A;  1NCR B;  3CJI C;  3D0J A;  1J58 A;  4BIS A;  3W9A A;  2GAL A;  2Q1M A;  1AR6 2;  3AP9 A;  1GFF 2;  1I9R A;  1PK6 A;  3DN7 A;  1OVP A;  4A44 A;  3OEB A;  3NNM A;  4GQ7 A;  1R1Z A;  2R32 A;  3EBR A;  2C9A A;  2JE7 A;  4QQL A;  5KXC A;  2GN7 A;  2VXJ A;  3N3H A;  3ROU A;  3MF6 A;  3WDV A;  5FJK A;  2VTX A;  5LEK A;  1QQP 1;  2X8K A;  4LOR A;  2ZHL A;  2DF7 A;  2XVK A;  1H6X A;  1HQL A;  5FZ8 A;  4E8C A;  3HQU A;  2W9X A;  3LPG A;  2DVF A;  1UY3 A;  2IZW A;  1XC6 A;  1B35 C;  4HSJ A;  4XIL A;  3ZX7 A;  4ASL A;  5AC9 3;  2VQU A;  4MGY E;  2WS9 2;  4QX0 A;  1QY4 A;  4WM7 B;  3MZH A;  2W39 A;  2VCA A;  1ND2 C;  5FPZ A;  3IDC B;  1H2M A;  1OUS A;  2X09 A;  1W9T A;  3SNM A;  2DBI A;  5LZ6 A;  3LCP A;  5KHH A;  1DGW X;  4AVS A;  1H2K A;  3I54 A;  4IUG A;  1JZ2 A;  3NJX A;  5DXD A;  2CGP A;  1AUY A;  4EE2 A;  1LOA A;  3HT2 A;  1O4Y A;  1Z78 A;  1RUE 3;  1PNF A;  1H0B A;  5IAX A;  4GKX A;  2HWB 2;  3NAP C;  3AL5 A;  5FO7 B;  3QLQ A;  5T50 A;  1OKQ A;  1VBD 3;  1GNZ A;  2J1R A;  4FVV A;  5A3U A;  4DPN A;  4R52 A;  3KGL A;  2JB8 A;  3R4D B;  4JX0 A;  4AFA A;  2Y60 A;  3ZYB A;  1F4A A;  4XXA A;  4WVW A;  1GNY A;  1UPI A;  5FLJ A;  2VO5 A;  4K9S A;  3ZXD A;  4XDQ A;  2YV8 A;  5LB6 A;  2UWB A;  2D6N A;  4I01 A;  1SEF A;  5IAV A;  3SC7 X;  3IBM A;  1CJD A;  5EP9 A;  1VBA 3;  4FOY A;  1QOO A;  3O1T A;  1OXC A;  2HWB 1;  2DCK A;  2VPV A;  2XLF A;  1QJU 2;  2E9Q A;  3CHX A;  4N43 A;  3CNA A;  3I8T A;  4WM8 C;  3MID A;  4XBN A;  5GZE A;  1COV 2;  1JZ4 A;  2NMN A;  3IAP A;  4CXY A;  3RYP A;  4YZ2 A;  3JB8 A;  4B3N A;  4PI0 A;  3LDR A;  5EJZ B;  3I2F A;  4S2D A;  1OUR A;  2XVG A;  4X6Q B;  5FYT A;  3AP6 A;  4HXC A;  1GKB A;  2VOW A;  5CBL A;  2ZTN A;  1NCQ B;  3E6D A;  2XLA A;  3PUR A;  5IAT A;  3WQ0 A;  4BK5 A;  4YZ5 A;  4PBP A;  4YW4 A;  4XFB A;  5LK7 B;  4RR3 C;  1KXG A;  1COV 1;  3T08 A;  4DY3 A;  4JGY A;  4YW5 A;  1KGY A;  1ULO A;  5F3I A;  2VME A;  2ZGS A;  3KLS A;  3AYC A;  4HT1 T;  4OI4 A;  4IEY A;  4NPR A;  3DPR C;  4B29 A;  2CNA A;  1OOP C;  5FQ0 B;  1QGL A;  1S0B A;  1WMF A;  1CN1 A;  3POS A;  3WX5 A;  3ZOI A;  4P9J A;  3AVS A;  4R8H A;  3VBO A;  1TEI A;  4HVO A;  3KT1 A;  5FZ3 A;  4XUQ A;  1ZA7 A;  3MW4 A;  1PO2 2;  2I74 A;  3J26 N;  5JPN B;  1AZD A;  2H0B A;  2CGO A;  3KQ4 B;  1ZRC A;  3AKT A;  4PBO A;  4XIK A;  5GAL A;  4Y22 B;  2ARX A;  4AI2 A;  5ABJ B;  1EY2 A;  2LUW A;  5A6Y A;  3MBW A;  4PDW B;  4AVA A;  3OCP A;  3WIN E;  1UIJ A;  3H8O A;  3J7M A;  1ZZ8 A;  2Y38 A;  1H8T B;  1DF0 A;  2ZHM A;  3FBM A;  1O4Z A;  3ZXK A;  1H4H A;  4OQ8 A;  4XHB A;  5EV7 A;  3VZM A;  1SPP B;  1V9U 3;  2DVB A;  1DYO A;  2B39 A;  3VDD C;  1NYW A;  3MPP G;  4DXT A;  5JLV A;  1WD4 A;  2RDR A;  1PO2 1;  5KHG A;  1V6J A;  4HSL A;  5I0S A;  2B42 B;  2IVJ A;  2WNV A;  4HPK A;  4MLO A;  1CZT A;  4CUG A;  5SV5 A;  3TEZ A;  2NN8 A;  2VCM A;  4XJA A;  1PK6 B;  1WCQ A;  3DYM A;  2VBB A;  4CCK A;  2PMW B;  1VMH A;  2VZU A;  4HET A;  2BBV A;  1NG0 A;  1ULF A;  4XBL A;  5DZE A;  1J84 A;  2Y34 A;  5CAZ A;  3AZX A;  4P00 B;  1REF A;  2OS2 A;  3ACI A;  5CVR A;  4QHO A;  5T5P A;  3ZPO A;  4ARY A;  3UET A;  3KGZ A;  4URA A;  2G1M A;  3E6B A;  1LGN A;  4MSV A;  5C6C A;  2XOM A;  1AHS A;  2WA4 A;  1GQH A;  4YVW B;  3I3M A;  2HKX A;  1BYH A;  1G9B A;  4P9Y A;  2BJS A;  4BWO A;  1W6P A;  3ZYI B;  1AXY A;  5K4L A;  1KJR A;  2UY9 A;  1COV 3;  3ES4 A;  2BEO A;  3MIG A;  5J48 A;  4R9B A;  1O3Q A;  4F83 A;  4P9L A;  5FYS A;  1NQJ A;  2PEL A;  2WFF 3;  4JDN A;  5DDJ 2;  5APA A;  5CG9 A;  2TNF A;  4IE5 A;  4OI1 A;  4L11 A;  1MS1 A;  1UNB A;  5JI9 A;  4QPY A;  3NWK A;  4CDX C;  1RUJ 2;  1GWM A;  1GZ9 A;  1VB4 A;  5FZD A;  1YEW A;  3H9A A;  2F4L A;  2QCS B;  3I59 A;  1H2N A;  2QZ2 A;  3PME A;  2X29 A;  2NYY A;  1D0H A;  3MIE A;  2NZ9 A;  1XJA A;  3C7F A;  5CZK A;  1UL9 A;  2EXJ A;  5FMC A;  4CDU C;  2D5F A;  4I0W B;  1W6M A;  2XL7 A;  3WG1 A;  4UWD A;  1HV1 A;  5IK4 A;  5FZC A;  3UGF A;  3I3D A;  1ODM A;  1T6B X;  1HN1 A;  2OPW A;  5DDJ 1;  1F8V A;  1DGR N;  2A6X A;  4Q26 A;  2VUJ A;  3FLP A;  4UI9 L;  1QJY 3;  1RUJ 1;  1WLW A;  2HJI A;  3TNQ A;  2WT1 A;  1NX9 A;  4YVS C;  3ZYR A;  3JD7 2;  2JIG A;  2CWM A;  3RDI A;  4QKD A;  5HCB A;  5F6L B;  3FHI B;  2Q5T A;  4YW1 A;  2HWC 2;  4LUM A;  1PO2 3;  5CFC A;  1YC6 1;  1YQ5 A;  2VZT A;  3J7N A;  1ENQ A;  2IXK A;  1IG3 A;  4LKF A;  3W21 A;  2RDN A;  1UOB A;  5F8P A;  2Q8O A;  5C3O A;  1IQA A;  4X8P A;  2XBO 2;  5FIX A;  3WP3 A;  1MEC 2;  3ZSL A;  3UL2 A;  1OF4 A;  4NHL A;  4QXK A;  2VOX A;  2X53 S;  4QXB A;  3L2Y A;  4MYE A;  4FAG A;  1QXR A;  2UYB A;  3JD7 1;  3PJQ A;  5FTT C;  5CAD A;  3DF0 A;  1XNB A;  1HXS 2;  4QPG C;  4C0H A;  2GME A;  2XON A;  3ACL A;  4JGY B;  4CDQ A;  4C91 A;  1V6N A;  5FPB A;  4LHN A;  4Z8B A;  1TNF A;  3UNP A;  3NV1 A;  2YPD A;  1M06 G;  2Y0I A;  3PTR B;  3PUQ A;  4OHV A;  4XAB A;  1S0C A;  4BJ0 A;  1Q8P A;  2XBO 1;  1MEC 1;  1OHF A;  3AX4 A;  4AVT A;  4UW5 A;  4CU7 A;  1UO9 A;  2AH2 A;  2WIN B;  4PLN A;  4AI9 A;  1W99 A;  5CYY A;  4EN7 B;  1IKQ A;  1V70 A;  1YLL A;  2P37 A;  4JQR A;  3VN4 A;  2PHX A;  5B2G B;  4Q0Q A;  5HI0 A;  1LB2 A;  1R08 2;  1HXS 1;  1VAL A;  5D1I A;  3K46 A;  1GZC A;  1LUL A;  4ZU4 A;  3VHN A;  5KHJ A;  2H6C A;  5A32 A;  3FC0 A;  4BMB A;  1URX A;  2WO1 A;  4HK8 A;  4TWT A;  3WG4 A;  1KIT A;  3BPS A;  2R04 2;  1ZRE A;  2WO3 A;  2R06 3;  3ZSE A;  4B7K A;  1RUD 2;  1PMJ X;  2XB6 C;  2VL4 A;  5GLZ A;  5AFE A;  2A6Y A;  1UCX A;  3N4M A;  1R64 A;  3DYO A;  2WLQ A;  5E8A A;  3HN3 A;  2GH8 A;  4UW4 A;  1G9A A;  1R08 1;  1F5F A;  1HJF A;  4K6B A;  3HNM A;  1AR7 2;  4Z2A A;  1ASJ 2;  2H0V A;  5DDJ 3;  2P17 A;  1X8E A;  4AEK A;  5FZF A;  1IOA A;  3H3L A;  5I91 A;  3MEP A;  5GLV A;  5FPX A;  2JB4 A;  2ZEX A;  1Q8O A;  2R04 1;  3TNP B;  4FFF A;  2YGM A;  2WKK A;  1RUD 1;  3C7H A;  3WW3 A;  5DAX A;  4C0B A;  4I0B A;  5FZA A;  4C8D A;  5A7W B;  5A7P A;  4RYD A;  4BQW A;  4MGK E;  2ZGO A;  3CZU A;  5FY5 A;  3WDY A;  1QHD A;  1LHU A;  2LS6 A;  3ZR6 A;  1R1A 2;  4TTG A;  1AR7 1;  2QJV A;  3M3Q A;  1ASJ 1;  2VR4 A;  2WNU A;  3AK0 A;  3PVO A;  5FY7 A;  3UV9 A;  5BNP C;  2GND A;  4IEU A;  2QDN A;  1U5X A;  4KQ7 A;  4XET A;  1N3Q A;  1S0G A;  2FMD A;  3BOW A;  1DGW A;  3HNY M;  3ORJ A;  4XMA A;  1LEM A;  5LBB A;  3ZYJ B;  4JGZ C;  1YQ8 A;  3SH4 A;  3TN9 2;  4ATF A;  1VRH 2;  2FCT A;  4MHU A;  2D43 A;  5H9P A;  2PLV 2;  2A3Y A;  1PGS A;  3UKN A;  1DQ0 A;  3T1M A;  3WV6 A;  2XR4 A;  1UF2 C;  3KB5 A;  3VDC A;  1R1A 1;  4OVE A;  2E53 A;  5I0R A;  1IHM A;  4I0A A;  2XBO 3;  3E97 A;  1QH6 A;  5H9Q A;  5KXE A;  4ERO A;  1K5M C;  4IEP A;  4Q29 A;  5FO9 B;  1N1Y A;  1FXZ A;  2EAL A;  3A21 A;  4GWI A;  1P8J A;  4NAM A;  4Y24 A;  3LEG A;  3TN9 1;  5A6X A;  1VRH 1;  1W6M B;  3FFQ A;  1AXK A;  1HXS 3;  1SDW A;  2BVB A;  2PLV 1;  5F5Q A;  1D7P M;  1UYY A;  3FN9 A;  3PU3 A;  4M00 A;  4MZU A;  4E2G A;  3A22 A;  4CP1 A;  5I8Y A;  2VVD A;  2C4X A;  2D6O X;  2ERF A;  4CXW A;  4GH4 C;  5GLT A;  1OPO A;  4M0N A;  1QJX 2;  2OUJ A;  5BV6 A;  1CPM A;  1PMI A;  3OSD A;  4GAL A;  3O14 A;  3ZIX A;  4NRO A;  3B7M A;  4BA6 A;  3O5S A;  3BTA A;  1ZRI A;  1N1T A;  3EHK A;  1MS0 A;  1CAW B;  2WO2 A;  5FZ9 A;  3D5O A;  1Y9G A;  3FHA A;  3III A;  1XU2 A;  5CFC B;  5K8S A;  1UMI A;  1R08 3;  1AVB A;  1H6Y A;  2XHK A;  2R07 2;  2RJK A;  4JCK A;  5BXX A;  5A1F A;  4AI0 A;  3K2O A;  3K3O A;  1AYM 2;  2FQP A;  3IAQ A;  1BQP A;  3U4X A;  1GOH A;  1QJX 1;  2JIJ A;  2R04 3;  3WXP A;  4BOW A;  4NID A;  1RUD 3;  2P3I A;  2RMU 3;  1OD5 A;  5GM0 A;  1QOT A;  2W08 A;  3E5X A;  3WDT A;  2WT2 A;  4CDQ B;  2XUE A;  3AKQ A;  4LE3 A;  5FZG A;  2O14 A;  2P1B A;  4YG0 A;  1BBT 2;  1LOF A;  2PHU A;  3ZFE C;  4EWA A;  1E5R A;  1XNC A;  2CYF A;  1W9Y A;  3WDU A;  4DZG A;  5IK5 A;  3RZG A;  4QKN A;  1JYX A;  3O1P A;  2OW4 A;  2G9Z A;  1AR7 3;  1MQT C;  1NT0 A;  1L7R A;  3WP5 A;  5I0D A;  4LLF A;  5D2A A;  1U5Z A;  3RG0 A;  1AYM 1;  1MS9 A;  3PU8 A;  3JQW A;  2ZGL A;  4KU7 A;  2IXC A;  3S0M A;  2ZKL A;  2YY1 A;  5J3U A;  4O65 A;  1RUC 3;  1I5P A;  4HZF A;  1GLH A;  4K7J A;  1YCI A;  2J1U A;  4LHL A;  2VJX A;  3WEZ A;  1JOB A;  3OGR A;  2VVE A;  2RR1 2;  4XFC A;  1OUX A;  1BBT 1;  5EHD A;  1GR3 A;  3KHB A;  1ZZB A;  5A32 B;  4QDQ A;  1AR8 3;  1W2T A;  2J1A A;  4LTA A;  1ZM1 A;  2HBU A;  2ZZQ A;  3LPF A;  4YM3 A;  2P6H A;  2XKP A;  1FX5 A;  4YZ1 A;  4AEM A;  3FMG A;  3LOI A;  3WNX A;  1E57 A;  5K0U B;  4PJY A;  2BYV E;  3AMN A;  2WLP A;  4E4D X;  2WFP A;  3TN9 3;  1TME 2;  3T2T A;  2A71 A;  1Q43 A;  1W0N A;  4N53 B;  1QDO A;  4XJZ A;  2AR6 A;  4HVR A;  4RN5 A;  1GMM A;  2RR1 1;  4JHZ A;  4FSJ A;  2EXI A;  5JZG B;  4LJH A;  3ZSJ A;  1JYC A;  2ZGN A;  1G8W A;  4DUW A;  1DHK B;  4OUM A;  2GAU A;  4R4X A;  4XCB A;  4NIG A;  2CGN A;  4UFJ A;  4XTP A;  5G05 L;  4QXC A;  4FPF A;  2PQQ A;  1HKD A;  3LEI A;  4MGZ E;  4CEY C;  3P1I A;  3K4A A;  1TME 1;  5F3C A;  5F1R A;  4AVC A;  2Z5W A;  3QAC A;  4FPO B;  3RMX A;  3IN9 A;  3ZFG C;  3IPV A;  2W95 A;  4AHX A;  4AQ6 A;  4E2S A;  1FV2 A;  1LGC A;  3I97 A;  1RUI 3;  4UT5 A;  1AL0 G;  3H0O A;  3KT7 A;  2NMO A;  3KVB A;  4RSU A;  3LSE A;  1QJX 3;  2P3K A;  5C9A B;  4Q4W 2;  4LBQ A;  3BI3 A;  2QQV A;  1JYV A;  2SLI A;  3VHP A;  3O1S A;  1XNK A;  4ZZ5 A;  4RA0 A;  2DCT A;  4GZ9 A;  2Q8E A;  3ZIW A;  1POV 1;  4F8A A;  2VZO A;  5FZM A;  2ZX1 A;  4GWM A;  1RED A;  1DG6 A;  1KJL A;  3VD9 A;  3CKH A;  2IXL A;  1NLQ A;  5E89 A;  2FDI A;  3LIH A;  1RUH 1;  4A2U A;  4ISR A;  3W59 A;  3AB0 A;  2D93 A;  2VNR A;  4B4R A;  1AYM 3;  1R09 1;  1ULE A;  2VZS A;  1C57 A;  2GN3 A;  4ORF A;  2BER A;  4JTO A;  1ZBA 2;  1XND A;  1HB1 A;  3LA2 A;  3WDX A;  1CAX A;  2GSY A;  4COZ A;  4Q4W 1;  1HN0 A;  1HW5 A;  4UXA A;  4LA2 A;  5CKQ A;  1PMH X;  4AHZ A;  5KBF A;  4QPW A;  2D44 A;  4R4Z A;  4JAA A;  1XOY A;  4BQ4 A;  5FXZ A;  3I2I A;  1XU1 A;  4DXS A;  3IB3 A;  3WLU A;  5FPU A;  2P34 A;  5F2S A;  4FPG A;  2JXA A;  4Y4Y A;  4AE2 A;  5A1L A;  1MS5 A;  2A75 A;  4QKB A;  2R1B A;  4BLJ A;  1LOD A;  3LIG A;  4LO4 B;  2ZHN A;  5DUX A;  4YZ3 A;  3JZV A;  1ZBA 1;  2OZJ A;  2D6L X;  4CE8 A;  2EXK A;  2HEW F;  3ECQ A;  3NVC A;  2WNO A;  3S30 A;  4CYD A;  2VEC A;  4RHV 3;  4D94 A;  2BNM A;  5FPA A;  4IL7 A;  2BVV A;  3LQC A;  5FKC A;  4XJU A;  1FAY A;  2TUN A;  3MW2 A;  4PQQ A;  4GB3 2;  4RQP A;  1DBN A;  3S57 A;  2D3P A;  2IXJ A;  2O8Q A;  2AEZ A;  3NO8 A;  4CDW C;  1UMH A;  1VJ2 A;  4OMC A;  2IXI A;  4SLI A;  1N3O A;  2JG8 A;  3MIF A;  5FZB A;  1JN2 P;  1TG7 A;  1VBB 2;  3BCW A;  4YM0 A;  2WAB A;  4LE4 A;  3VD5 A;  1BCX A;  2WQ4 A;  3M4F A;  5DAP A;  2RS1 2;  1MS3 A;  5CNA A;  4R9C A;  3VBS A;  5IVJ A;  4AFC A;  2GMP A;  1C8N A;  2CHH A;  4YG3 A;  4Q4Y 2;  2D3R A;  2QQN A;  3VBF C;  4Q4X 2;  2FDF A;  2XLG A;  2V5Y A;  2WZ8 A;  2ZGQ A;  4XZP A;  5D8A B;  5K9Y A;  4KI5 M;  3N7M A;  3R6S A;  4UW6 A;  3WD5 A;  4P5Y A;  4AGR A;  4K40 A;  5BNN A;  4QDR A;  4CUC A;  2UYA A;  4CEW C;  4I2O A;  4KL1 A;  2XL9 A;  3THC A;  1VBB 1;  3CF6 E;  3CIH A;  3TAY A;  3ZN6 A;  1ZRD A;  1ZA4 A;  2JX9 A;  5DAW A;  3FBY A;  2RS1 1;  4ZXK A;  1UY0 A;  3HQX A;  5F7U A;  1E5S A;  4XJW A;  4Q4Y 1;  4Q27 A;  4Q4X 1;  4GJZ A;  4KWL A;  3K4Z A;  5IVF A;  2DUQ A;  4YSF A;  1H30 A;  1UU5 A;  2D7F A;  1RUH 3;  2FZ1 A;  2C1F A;  3AVR A;  4DRR A;  4NIA A;  5JR2 A;  1R09 3;  1A8M A;  1MZ5 A;  4YW6 A;  1WBF A;  1YWK A;  2FD8 A;  3D8C A;  3WT3 A;  3HIF A;  1S0I A;  4HOO A;  2A6W A;  3VBR C;  5L7O C;  4K20 A;  3SH3 A;  4E4S A;  2R0H A;  2WQZ C;  2RJ2 A;  4IW3 A;  3T4V A;  3KZ4 C;  5A3T A;  3WF3 A;  1C5H A;  4PQ9 A;  1PVC 2;  2Y6G A;  4AED C;  5C8C C;  2Z4F A;  3SCG A;  1OMI A;  2PYT A;  5JSR A;  1XBF A;  1GV9 A;  2LTN A;  1D4M 2;  3CO2 A;  3GZE A;  3MGU A;  4UFK A;  1MZF A;  3IDA A;  3UJO A;  4YGE A;  4OCT A;  1D0G A;  2WZP P;  3LDK A;  1BK1 A;  1FNZ A;  2FZ2 A;  2VTX J;  3IPV B;  1PVC 1;  2VC9 A;  4O7X A;  3S7E A;  1IPJ A;  1VLN A;  2VMF A;  1W9S A;  4AW7 A;  1JXN A;  5ACA 2;  1UW8 A;  3PUS A;  4Q0S A;  1SMV A;  2FDH A;  3WSO A;  2CU5 A;  4UFL A;  1D4M 1;  1C8M 2;  5DPN A;  4FTB A;  4CVU A;  4OMD A;  1POQ A;  4JHT A;  4KWU A;  4D6Q A;  4EZ4 A;  2WC2 A;  5BNO B;  4FPL A;  3POI A;  2BWA A;  4IEW A;  3RGB A;  2B46 X;  2E6V A;  3A0N A;  3Q8E A;  4GAZ A;  4HKW A;  5AC9 2;  2VUC A;  3A23 A;  1BKZ A;  1LOG A;  3ILN A;  1NE4 A;  4MHR A;  4QM8 A;  5FXX A;  1UXX X;  4BZ4 A;  1DYP A;  2WNE A;  1UQX A;  4D7T A;  5C71 A;  3I2O A;  2WSU A;  3SEP A;  5IK7 A;  5ACA 1;  1H1I A;  3KT4 A;  4L92 A;  3K75 B;  1NXM A;  4FPE A;  2E26 A;  3ACH A;  1C8M 1;  3VZJ A;  3AKP A;  4ITC A;  4Q4Y 3;  1SLC A;  1LES A;  5L9B A;  3GXU A;  4Q4X 3;  3ZMN A;  3BIE A;  2BNO A;  4C1X A;  1O4T A;  1VBD 2;  5AC9 1;  5LA2 A;  5C8W A;  1RJ7 A;  1NCQ A;  3LD8 A;  3WUC A;  4MO3 M;  4WM8 A;  3VKM A;  4AI3 A;  3I4I A;  4IER A;  4XBQ A;  4PIY A;  1TZO A;  3H1M A;  1T2X A;  1APN A;  1W06 A;  3ZO0 B;  5ISL A;  2YU1 A;  1PZ9 A;  1YUD A;  1KD7 A;  4L9B A;  1XYN A;  4LIV A;  3Q9O A;  1YI7 A;  1DDL A;  3W5N A;  1ULC A;  3EQE A;  4RQP B;  5JVV A;  4YGD A;  1VBA 2;  4JQT A;  1FI2 A;  2R7E B;  5FQ0 A;  1N1V A;  4K8F A;  1VBD 1;  5FO8 B;  1CAU B;  5FP8 A;  4JKM A;  2JG8 B;  5HPO A;  5CFD C;  2EID A;  4Y4R A;  5CG8 A;  4GIQ A;  2VOK A;  4OZO A;  2RDQ A;  4XF3 A;  2ORZ A;  3CDZ B;  3PUI A;  2YFU A;  3B00 A;  2WWS A;  1H9W A;  3T0D A;  2KA3 A;  4OUS A;  3DPR A;  5KC5 A;  4NPM A;  1XNT A;  5A6Z A;  4YFW A;  1OA4 A;  1VBA 1;  1H8T A;  4CPB D;  1A6C A;  3A4U A;  1X36 A;  2C0Z A;  2HBT A;  2WL1 A;  2DCZ A;  2F6B A;  4DIQ A;  4IES A;  3Q8F A;  3DV8 A;  3ZN6 B;  4Q2F A;  1J59 A;  3O7O A;  2HYX A;  4O9E A;  4PIX A;  4HN1 A;  2WYF A;  1RTV A;  1O5U A;  2ID4 A;  3L2H A;  4DS0 A;  4UFM A;  3IKW A;  1IGO A;  4XFF A;  1NCR C;  4FFG A;  1OD3 A;  3T09 A;  1W8U A;  2WZR 2;  4QKF A;  2YMZ A;  2OQ6 A;  3VBH B;  3KMH A;  5EPA A;  3VL8 A;  2RG4 A;  1H2L A;  3DXT A;  5ACA 3;  4QQ2 A;  4ARX A;  2JDK A;  3BAL A;  2QNK A;  2VCC A;  3CJI B;  1HQN A;  2JG9 A;  1C8M 3;  3FL7 A;  1ODN A;  3PVE A;  1CJP A;  3HPN A;  2ZEW A;  4YVW A;  3OF1 A;  4OUL A;  1RC6 A;  3RYK A;  1VMF A;  3GBF A;  1V9U 2;  1OQD A;  3ZXF A;  4A3X A;  2WZR 1;  5C4W C;  1AX1 A;  2ES3 A;  3UK9 A;  1AX0 A;  1ACC A;  3KV5 A;  3SH5 A;  3MPB A;  4Y3O A;  1O8P A;  1DZR A;  4W50 A;  4WM7 C;  2IXH A;  2QKD A;  4RL7 A;  4XAA A;  1NZC A;  3DCQ A;  3UKT A;  3H3Z A;  1WMX A;  5F3G A;  2YHJ A;  1OFN A;  3TWI A;  4I30 A;  2WYS A;  1MVE A;  1LEC A;  2Z2S B;  1B35 B;  4QWN A;  4FXG B;  2P2K A;  3RMY A;  4EWE A;  3KHC A;  4B1L A;  4OFG A;  1V9U 1;  4OI2 A;  4OZX A;  1GUI A;  2ZAH A;  3G6J B;  2WWJ A;  3I3B A;  1IS3 A;  1Y9Q A;  2V4V A;  4DEQ A;  4MXV A;  5IVC A;  3R05 A;  2VBP A;  4K1Y A;  5DG1 A;  3WUD A;  4GXL A;  3KSC A;  1F2N A;  3UES A;  4GKY A;  4DY5 A;  4OQ9 A;  1VE0 A;  3GF6 A;  3NAP B;  5EQU A;  3SKV A;  4OI0 A;  1CZS A;  2EIG A;  1GOF A;  4RGA A;  3RZZ A;  2XQX A;  2YC0 A;  4QGL A;  1OA2 A;  1WWY A;  3J8F 3;  1UZV A;  3LAG A;  3H8U A;  4XOG A;  4LO8 A;  5FZ1 A;  2WFF 2;  2O0O A;  2Y6J A;  4IV3 C;  4JZR A;  2YG0 A;  1HX6 A;  1UYX A;  5H9R A;  3DKQ A;  5JOY A;  1QKQ A;  4LOT A;  3BTX A;  4AL9 A;  4IE0 A;  3C7E A;  1U5Y A;  2OX0 A;  2XJS A;  4M0H A;  3I3E A;  4WM8 B;  2WWU A;  1AYN 3;  2ZEZ A;  1PGW 2;  3A7Q A;  3AP7 A;  1FT9 A;  3ETP A;  4LO5 B;  1F5J A;  3PHM A;  4NOT A;  3RZJ A;  3P6B A;  3TB0 A;  3N9P A;  2W5F A;  2WFF 1;  4YZ4 A;  3DYP A;  4FQZ A;  2YXS A;  4QPI A;  3ETQ A;  1YXW A;  1ZZC A;  4LUK A;  2QQI A;  1QJY 2;  1X82 A;  4PCR A;  1LU1 A;  5AVA A;  3ZFF A;  1CES A;  3ZXA C;  2WZR 3;  4RR3 B;  3WP4 A;  4FOQ A;  3PUH A;  4RGG A;  2RS3 2;  1PGW 1;  4TSV A;  4KU8 A;  2W47 A;  3MV1 1;  2IWG B;  5FXV A;  2YBP A;  4YRD A;  4A4A A;  3DPR B;  3FWE A;  4YWA A;  1OOP B;  2HH9 A;  2VTF A;  5FYY A;  5ABJ C;  1QJY 1;  2ET1 A;  1SBF A;  1JHN A;  5LBE A;  1WBL A;  2V09 A;  4PDW C;  2ZAA A;  4FP3 A;  2KM2 A;  5FCC A;  3K48 A;  2ORX A;  2ZGK A;  4YW7 A;  1UY1 A;  3ZMO A;  2RS3 1;  2YRO A;  4QU2 A;  2DCY A;  3VZL A;  2AC1 A;  3AJY A;  3EB7 A;  1UN1 A;  2R0F A;  1J1T A;  1UZY A;  3AFK A;  4P9G A;  1LHW A;  3IDB B;  3SQO A;  5J36 A;  1CGP A;  1GZW A;  2D6K A;  2VZQ A;  1S4C A;  3AP5 A;  4ZON A;  3N9M A;  2DDU A;  3NNF A;  1GYK A;  5IWF A;  3KCY A;  4YFZ A;  3Q8B A;  1K5J A;  3IMN A;  3R4U A;  2XHN A;  4ATE A;  3VDD B;  1YNA A;  3TEY A;  3GZU C;  5FYH A;  1PK6 C;  5A7W A;  1W8F A;  4G3Y C;  2FCU A;  4R9D A;  4ZZ8 A;  5JAX A;  4XFA A;  1UX7 A;  4NJ4 A;  2DVD A;  1XE8 A;  4X8N A;  2GNM A;  3U07 A;  4AI8 A;  2JG9 B;  2ZCW A;  1RGS A;  3AFG A;  5J98 B;  1WW5 A;  2E33 A;  3ZXL A;  2PAM A;  4XQ4 A;  5FUN A;  2K0G A;  1G6N A;  2R06 2;  3U0Z A;  1C28 A;  1SFN A;  4AF9 A;  3OGS A;  4AEJ A;  2BOI A;  4UBH A;  3POW A;  2I07 B;  4CCE A;  4RFR B;  1AXZ A;  4QD2 A;  1SHW B;  1O8S A;  1O3S A;  1VAV A;  4FFI A;  1PHM A;  1FV3 A;  5GZF A;  3FUQ A;  4G9S B;  4Q1P A;  4XXP A;  4XDO A;  1ZVF A;  4IE6 A;  3ASI A;  3CEW A;  5I0U A;  3UGH A;  1OH3 A;  3PLQ A;  4Q4V 2;  4Z07 A;  1UPS A;  5IVE A;  2X5I A;  4QX5 A;  5FRE A;  2R06 1;  1QF3 A;  3CL1 A;  1IG0 A;  3AMM A;  5TSW A;  4MX3 A;  1DZT A;  2PHR A;  5A3O A;  5LRR A;  3VD4 A;  1OC1 A;  4FCA A;  5KXB A;  5F5A A;  1H1M A;  4BQX A;  3QH6 A;  1ENX A;  2LAL A;  1FMD 2;  3KVA A;  1U12 A;  3LEM A;  3WHT A;  3URF A;  2QUO A;  3POY A;  3NQH A;  1YO8 A;  4Q4V 1;  3RNS A;  4AWD A;  5EWS A;  1GBG A;  1W8H A;  5IJR A;  5JDB A;  1I5Z A;  3VDA A;  3T30 A;  5HV4 A;  4MGT A;  5IHR A;  4MXW B;  3T2Q A;  4XTM A;  1MS4 A;  1IPS A;  2VGD A;  1WCU A;  1CAW A;  2RS3 3;  3ACF A;  2JE8 A;  4N43 C;  4LPL A;  1QU0 A;  3GHM A;  1FMD 1;  5A70 A;  3VKO A;  2HEV F;  2BU9 A;  1SG3 A;  1CWP A;  4BPZ A;  2RM2 3;  3BOP A;  2VZP A;  4CCM A;  1W3V A;  4YVS B;  4B4Q A;  4N9I A;  3TEW A;  4QT6 A;  4BLI A;  4W65 A;  4HKL A;  1WCS A;  1GSL A;  1JBC A;  5HCA A;  4K1Z A;  3EXU A;  5T55 A;  3OB8 A;  1HRV 3;  1PX4 A;  3THP A;  5FKB A;  4QAW A;  4QPI B;  3S5Q A;  5C3S A;  1O59 A;  1SZB A;  2WAO A;  2VXR A;  4JGY C;  1DIW A;  4Y5T A;  5LA9 A;  4A42 A;  4FT8 A;  4PF5 A;  4CU6 A;  4CCN A;  1NY7 2;  2DFC A;  4P9W A;  3ZFF B;  4AXO A;  3AMP A;  3HNB M;  4QPG B;  4CCC A;  3ZYP A;  2DV9 A;  5I8S A;  2JDH A;  3OUI A;  2J42 A;  3VBO C;  1QMJ A;  4Y26 A;  1A8D A;  4Y1Y A;  2MEV 3;  5L19 A;  5F5C A;  1RIT A;  4QX1 A;  3IDE A;  4FOV A;  1YJL A;  4YPJ A;  5L36 A;  3F2Z A;  3HMY A;  1I6X A;  2BP6 A;  1LOC A;  1RHI 3;  3FHQ A;  4CUB A;  4KGG A;  1UYP A;  2RMU 2;  1PIV 2;  1W6O B;  3KWV A;  5IUQ A;  1NY7 1;  2WA3 A;  3IM0 A;  5K0U A;  1V6K A;  4MH0 E;  3WF2 A;  3FFZ A;  2Y8K A;  1CPN A;  1UOG A;  5FZO B;  3PMS A;  4HG6 B;  4CP2 A;  3O1V A;  2OUH A;  4AQS A;  3ACG A;  4N53 A;  3VB9 A;  4XC9 A;  5IVY A;  1EPZ A;  2Q8C A;  4ISQ A;  1FNY A;  5FMB A;  3JQX A;  5EJ3 A;  3O1U A;  4COW A;  5JZG A;  1GZW B;  2X05 A;  4IEV A;  4Q4V 3;  4CU8 A;  4AHY A;  1XRU A;  5A3L A;  2ZAC A;  4QHB A;  1G9C A;  2WNV C;  1RUC 2;  5GZD A;  2RMU 1;  3HD8 B;  1PIV 1;  2PQS A;  4ES9 A;  4ZU7 A;  4KMQ A;  1OFS A;  2BFU L;  3ILF A;  3EJK A;  3W20 A;  5C5T A;  1HV0 A;  3H1W A;  4NR1 A;  4UFI A;  2YFZ A;  1UY4 A;  4J6G A;  5FOB B;  1CQ9 A;  3USS A;  1AR8 2;  1YQ6 A;  1LHN A;  3S6P A;  1W3X A;  3THD A;  1FMD 3;  2CV6 A;  3WW1 A;  1L7Q A;  4XUP A;  2BFU S;  3IZO A;  2JD4 A;  3MFC A;  1UOJ A;  2AGS A;  1CVN A;  2NQY A;  1W03 A;  2XDV A;  3BB6 A;  2I45 A;  4FTE A;  5I8T A;  4D7S A;  5JPM B;  2FBE A;  5C9A A;  1RUC 1;  5LK5 A;  5FZ0 A;  2BQP A;  1KRI A;  3N9Q A;  3T1L A;  1O6U A;  1ONA A;  1N47 A;  4QB6 A;  5FY4 A;  2XH6 A;  5DG2 A;  5FMO L;  4LIU A;  3RI8 A;  3ZR5 A;  5KR7 A;  1AJK A;  1AR8 1;  2XJU A;  5BNP B;  4OYU A;  4JC1 A;  3GZT B;  5C33 A;  2X5I B;  1S1A A;  4J25 A;  4Y20 B;  4Y1U A;  2ATF A;  2A6Z A;  5FMO S;  3F95 A;  4AYU A;  4JGZ B;  2P3Y A;  4HKO A;  1O3T A;  3AP4 A;  4MUV A;  3CMG A;  3J7L A;  2W1S A;  3H7Y A;  5FP9 A;  4D3W A;  2HWE 1;  1XSR A;  2W94 A;  1ZZ6 A;  1RUI 2;  3VZN A;  4IXL A;  1GWK A;  1EP0 A;  1UZW A;  5GZC A;  4M4P A;  3SIS A;  1K5M B;  2GZW A;  2HWF 3;  4NPL A;  2UU8 A;  1HB4 A;  4ZHN A;  3B02 A;  2VMI A;  4BYY A;  4QXH A;  2RJL A;  4XAC A;  1W39 A;  1W2U A;  1UXZ A;  1EUT A;  3ST7 A;  4EN6 B;  1W6N A;  5EYX A;  1UU4 A;  1RUG 3;  2Q1Z B;  5A7N A;  5JXG A;  4LOS A;  4GH4 B;  4RS5 C;  5CFC C;  1RUI 1;  2ZZJ A;  3CU7 A;  3OD4 A;  4IDZ A;  1AX2 A;  4DXZ A;  2GNB A;  1EYB A;  1UZZ A;  5FAX A;  5FP7 A;  1U0A A;  3BVC A;  4ZY9 A;  1PIV 3;  2WAA A;  4HVQ A;  3EYP A;  4ZXE A;  3OEA A;  1H8V A;  3M3O A;  2QQU A;  2RS5 2;  1LJ7 A;  1BJQ A;  1YFY A;  4GWN A;  5D8A A;  1GWL A;  2VQ0 A;  4OLL A;  1GZT A;  5DMY A;  4CDQ C;  4WVZ A;  3K3N A;  3VDB A;  3VUO A;  3RFR A;  1X7N A;  1GNH A;  3VBU A;  5EJ1 B;  1WA4 A;  2ETE A;  5FZL A;  1GOG A;  3RZH A;  3K4D A;  1SAC A;  1Z7S 2;  3MHZ A;  1UD1 A;  2Y6K A;  4RHV 2;  3DEC A;  1S0D A;  4V2V A;  3PUA A;  1MZE A;  1OLR A;  3MIH A;  4XIO A;  3O1O A;  1C1F A;  2JWP A;  2OQ7 A;  4GD4 A;  1ZRR A;  2RS5 1;  3WR0 A;  3MUZ 1;  4JKK A;  1MQT B;  2GC0 A;  1NAE A;  3DKW A;  1ZRF A;  3OGJ A;  5ANN A;  4COV A;  4BDV B;  3LF7 A;  3WCS A;  4BB3 A;  4KGQ A;  3WW2 A;  1OH4 A;  1RMU 3;  3POB A;  4M3C E;  2W52 A;  4WVM B;  4UOJ A;  3FZ3 A;  2ZGM A;  4DFS A;  4XYX A;  1Z7S 1;  4RHV 1;  4BM8 A;  1XXN A;  4A41 A;  1HIX A;  5F32 A;  5FYZ A;  1UWW A;  2HWE 3;  2C9K A;  3C7O A;  3ZM8 A;  5A33 B;  3Q8A A;  3AL6 A;  3GGL A;  5JSP A;  1SBE A;  2ILM A;  4LBN A;  2JE9 A;  4RD7 A;  4WVV A;  2ARB A;  3S7I A;  2J1E A;  4OHX A;  1RVF 2;  4A45 A;  4BQ2 A;  2DVG A;  5E16 A;  4XHX A;  3B9C A;  1MS8 A;  1QDC A;  5JI7 A;  3WG2 A;  2B9V A;  2XUM A;  5LAT A;  3KV4 A;  5ERL A;  5FZH A;  3RWN A;  4H2A A;  1JZ5 A;  1RUH 2;  1SLB A;  1X33 A;  4HON A;  5JXJ A;  4ZU5 A;  1ZNP A;  1R09 2;  3V65 A;  1WD3 A;  1ZZ9 A;  4YM2 A;  3WF1 A;  2CSG A;  3O1R A;  3R4S A;  1JH5 A;  3VKN A;  1WUV A;  4HL0 A;  2VNG A;  2WNU C;  2XXZ A;  1CZV A;  2H6B A;  3G7D A;  1RVF 1;  3LA3 A;  4NII A;  4QQH A;  5B4N A;  1E5H A;  5A3N A;  5KHK A;  2YU2 A;  5BNO A;  4Z92 B;  4XUR A;  2VE1 A;  4IV1 A;  1JZ3 A;  1LR5 A;  3VZK A;  1NE6 A;  3ZFG B;  1ND3 A;  2JD9 A;  3OG2 A;  1W8W A;  4NWW A;  4QU1 A;  4HK9 A;  1RUF 2;  4U36 A;  5FZI A;  1W2O A;  4P9X A;  4NRP A;  2Q30 A;  3WOG A;  2AEN A;  4P14 A;  4ET7 A;  3OYW A;  2UY8 A;  2QE3 A;  1Z0H A;  3RJ2 X;  3HT1 A;  4KBB A;  4CP9 B;  4AZZ A;  3AM2 A;  4YYO A;  5FYU A;  3WP6 A;  3M1H A;  2RS5 3;  2GU9 A;  5DAB A;  3B3Q E;  2CDO A;  2QQL A;  1SFP A;  4FQ4 A;  3MLJ A;  4K3U A;  4GA9 A;  2NP0 A;  2PA7 A;  1RUF 1;  3T0A A;  2VVF A;  5LBF A;  2PHF A;  1WLD A;  1KDM A;  2JDM A;  4JKL A;  1W9W A;  3KCX A;  1NLR A;  1Z7S 3;  1Y9M A;  2O1Q A;  4QX8 A;  4AK3 A;  4DUX A;  2DVA A;  2WR9 A;  5FR3 A;  1W6N B;  3WF0 A;  1WKY A;  4J1X A;  4LKD A;  4COU A;  4JRA A;  3RWK X;  2VAU A;  1CAU A;  4N7I A;  1EPW A;  4LEJ A;  1LNS A;  4SBV A;  5M0T A;  1FAT A;  2D6M A;  2DFB A;  3B93 A;  2V73 A;  2V72 A;  2VBD A;  4XF4 A;  5FBZ A;  2MPF A;  3QOP A;  2ZGT A;  4HFS A;  1J3Q A;  3E1F 1;  2EIE A;  1IZ3 A;  2R16 A;  1ULG A;  1NA1 A;  1WMD A;  5L73 A;  1ZYB A;  3PDQ A;  4Y1Z A;  3SIT A;  4TYS A;  5H9S A;  4BIO A;  4CDW B;  4XF0 A;  2J1T A;  1DCS A;  1LOF C;  2EIB A;  3VBU B;  2QQJ A;  1LOB A;  3M7A A;  3JXS A;  4NHM A;  4BH9 A;  4UYB A;  3HQR A;  3EMR A;  4MG2 A;  3T4H B;  1W8O A;  2ZX2 A;  1RVF 3;  3R0R A;  4DXR A;  1L3J A;  5FRA A;  3VBF B;  2HLE A;  1GU3 A;  2VMG A;  1UZ0 A;  2BTV C;  3NV2 A;  4PLM A;  1YRZ A;  5DUW A;  1K45 A;  2E63 A;  3B01 A;  3LFI A;  1MR5 A;  4K8R B;  4XCA A;  3VBH A;  4CCL A;  4CEW B;  2WZE A;  3LGR A;  2ZOE B;  2VOT A;  2YBK A;  2FHR A;  3CJI A;  1PZ7 A;  4CCO A;  2YYO A;  1BK0 A;  4CUA A;  3BU0 A;  3CBN A;  1DQ1 A;  2CAV A;  5KHI A;  1RYY A;  1JYI A;  2QBX A;  2ZX3 A;  5A3M A;  1LED A;  1XYP A;  1QIQ A;  1S2E A;  2XJP A;  5BY5 A;  1RUF 3;  1Q5O A;  3V0A B;  4AAX A;  3VBR B;  5L7O B;  1OSG A;  4BCU A;  2VUL A;  5LW9 A;  2AYH A;  4DO0 A;  4QX7 A;  2PHW A;  3H42 B;  2PXJ A;  2Y6L A;  1NXD 1;  1JZ7 A;  1EV1 2;  3ENR A;  1LRH A;  1H9P A;  3UT0 A;  1B35 A;  3BTY A;  5E1R A;  4S2G A;  4AED B;  4IEO A;  5FZK A;  3SCF A;  2VQT A;  3FJS A;  1ND2 A;  1QJE A;  3PIJ A;  4V2W A;  2ZPX A;  2ZX4 A;  3W5M A;  2BZD A;  1HRI 2;  1QWR A;  1YIF A;  2RDS A;  3RZM A;  2BBA A;  5I93 A;  4E4H A;  1Y4W A;  2A70 A;  3J9S A;  2XJV A;  4IV1 B;  1BXH A;  2JDN A;  2QFE A;  3O0V A;  4KH9 A;  4LHK A;  1ND3 B;  3RI9 A;  1EV1 1;  2CY6 A;  3GAL A;  3NAP A;  5C7G A;  4LIT A;  5FJH A;  4AOC A;  1XNA A;  3TEX A;  1BEV 3;  2BPA 2;  4LKS A;  2YPJ A;  4IEQ A;  4BK4 A;  3FLT A;  2Y6H A;  3OYW B;  3PTY A;  1HRI 1;  2ZA9 A;  3KV6 A;  2R1D A;  1VBC 2;  3M3I A;  4L99 A;  3ZPY A;  1OQ1 A;  4XZU G;  1SFY A;  5F39 A;  3RJR A;  5HXM A;  3H1Y A;  3HBZ A;  2ET7 A;  3AZZ A;  1ENR A;  2VZ1 A;  4LUL A;  2BRT A;  2E51 A;  4PT6 A;  4UBG A;  1UAI A;  3J4U H;  5LRS A;  1ZBE 3;  2QQW A;  3MLK A;  3U75 A;  1W2A X;  1IS5 A;  2RVA A;  4IE7 A;  5FYM A;  1CON A;  3OUH A;  4N8M A;  1VBC 1;  5F37 A;  2ZBJ A;  3FX3 A;  4XFI A;  1RXF A;  2F4P A;  3T0B A;  5EIY B;  3SMH A;  2XJT A;  1QJF A;  4PLO A;  1LHO A;  5JMC A;  2XJQ A;  3J8F 2;  4CRQ A;  2D98 A;  4OUE A;  4RQP C;  4RR3 A;  5GJ6 A;  3USU B;  2SBA A;  4KWK A;  2DU1 A;  4AQ2 A;  4A6S A;  2G19 A;  2JG8 C;  1Q8S A;  1JHJ A;  3DEM A;  1S0F A;  2W1U A;  5FY9 A;  3NJV A;  2G9F A;  3VLB B;  1NA1 B;  5IT6 A;  1WME A;  3VBS C;  4BHP A;  3V0B B;  3VL9 A;  1OOP A;  5EFU A;  1PM4 A;  2ZXQ A;  3GZA A;  1QXJ A;  1AYN 2;  4FBF A;  1VMJ A;  1WW6 A;  3OUJ A;  5CIR A;  5CFD B;  2Q0A A;  4BIF A;  4COY A;  4DIN B;  4EQV A;  3NW4 A;  3NV4 A;  3J8F 1;  4LBL A;  1BHG A;  4CP0 A;  5FLI A;  4D6S A;  3MLL A;  3ZKY A;  4H55 A;  5BNN C;  3I3Q A;  4B4P A;  4QB2 A;  1JOJ A;  5C3Q A;  4V1P A;  2WN3 A;  3B94 A;  1J1L A;  1F15 A;  1GIC A;  2Y64 A;  4YGC A;  1EV1 3;  1YIP A;  1DP0 A;  1V6O A;  2W0X A;  4W6X A;  1K3I A;  5LY1 A;  1AYN 1;  2J22 A;  1QNY A;  3VDD A;  4HMZ A;  5GLU A;  2GC1 A;  4GUL A;  2EAK A;  5JOZ A;  1OLM E;  1XE0 A;  4XMI A;  1B09 A;  3ES1 A;  2OPK A;  4LK6 A;  2YGL A;  3RQ0 A;  1WLT A;  3NMB A;  3FLR A;  3JBG 2;  1HRI 3;  2B45 X;  5FOJ B;  1PGL 2;  4NUB A;  2C26 A;  2R30 A;  2PAK A;  5FFO C;  4D6R A;  1VBE 2;  4OHW A;  1X8M A;  4RGK A;  1YFX A;  2EXH A;  2XML A;  4I3G A;  3AJZ A;  1Y43 B;  2AEY A;  3TOJ A;  2VZR A;  3WDW A;  3LKJ A;  5IW0 A;  2E7T A;  4W6Y A;  3RSJ A;  1UMZ A;  4R9A A;  2C6S A;  4CXX A;  3GJB A;  1J3R A;  1X9P A;  1ENS A;  3LB9 A;  1KEX A;  3P3N A;  1REE A;  5AVP A;  3U4S A;  1S2B A;  3BUC A;  2FCV A;  3I2K A;  4CZS A;  3JBG 1;  3SLI A;  2GC2 A;  1PGL 1;  2RHP A;  1VBC 3;  2E31 A;  5D21 A;  1W0P A;  4EN8 B;  1VBE 1;  5DN2 A;  4YLZ A;  3APB A;  1XQN A;  1G9D A;  3S5A A;  5C4W B;  1K12 A;  1AR6 1;  1ND2 B;  1YFU A;  2Y26 A;  1RL3 A;  4DMI A;  2P5B A;  4AFB A;  2PTM A;  3GJA A;  1LOE A;  1OLQ A;  1RIR A;  3ME2 A;  4GMP 1;  1CR7 A;  2PAE A;  3H8X A;  3T2P A;  3AMH A;  1EUU A;  1NKG A;  5F3E A;  4HBN A;  5FUP A;  1D4V B;  3POG A;  2J1V A;  4KG0 A;  2BOJ A;  4CDX A;  1CIW A;  4CSW A;  1OQE A;  1DZQ A;  1WLC A;  3JUU A;  3O0W A;  5JWP A;  4MXW A;  1V6I A;  4XUT A;  4CDU A;  3IT8 A;  3JB4 C;  1D2S A;  2W1W A;  2JJ6 A;  5DAV A;  2WS9 1;  3FE5 A;  4Q8K A;  3ON7 A;  4F7Z A;  4RFT 0;  2ARA A;  3I2H A;  3SCH A;  4UW3 A;  2WN2 A;  3ABZ A;  4IGQ A;  3WZ1 A;  4JV4 A;  2AUY A;  2VZ3 A;  4LO7 A;  4A7Z A;  4L8Q A;  4CPB A;  2O8O A;  2ZAB A;  5JSO A;  4Y5Z 0;  4YVS A;  3OBZ A;  3N9O A;  3BTZ A;  1BVV A;  5J09 A;  2J7M A;  1T6G C;  2AAC A;  2W2I A;  2XKO A;  3HEI A;  2QQP A;  2Y33 A;  5A6Q A;  1NCQ C;  3VD7 A;  4IV3 B;  1ALY A;  4PIZ A;  2EA7 A;  4QX2 A;  3MV0 1;  4CTE A;  5JIU A;  1QOS A;  4C90 A;  1TE1 B;  1BZW A;  5E6H A;  3GDB A;  2Q8D A;  1Q8Q A;  3U78 A;  3V56 A;  3KS7 A;  3OY8 A;  2YC4 A;  4KBZ A;  4W4Z A;  4QPG A;  3I2D A;  3I2J A;  3ZKU A;  5A3W A;  2VQA A;  3KM5 A;  4I02 A;  1QJU 1;  1QXP A;  3NV3 A;  1US3 A;  1C3H A;  3VKL A;  2MNG A;  3JBG 3;  3E6C C;  2Y6F A;  3CJX A;  3WF4 A;  1JYW A;  2RM2 2;  2LW8 A;  1DLL A;  4U2A A;  1LU2 A;  1QQP 3;  1VBE 3;  2ZMK A;  1W8T A;  3VKF C;  3WY6 A;  3HBK A;  2P6C A;  2BV4 A;  1WW7 A;  4TN7 A;  1W6O A;  4JVA A;  4ZS3 A;  1AR6 3;  2PHD A;  3O0X A;  4NVP A;  5T52 A;  1ULP A;  5FZO A;  5JXI A;  1JYN A;  3MDP A;  1H8T C;  3UJQ A;  1HRV 2;  1FYU A;  4GMP 3;  1OT5 A;  4MGI E;  4PI2 A;  5DZF A;  5FYV A;  3GM8 A;  5F2W A;  2RM2 1;  2VCB A;  2YB7 A;  3BKZ A;  2VUD A;  2EF6 A;  2IFR A;  2BGC A;  2Z79 A;  4TZD A;  4XQW A;  2ZGP A;  2WUH A;  3BN6 A;  2VG9 A;  5J96 B;  1OBN A;  1JZ8 A;  2V4A A;  1TVG A;  1HRV 1;  2MEV 2;  1HB2 A;  2WS9 3;  2ADD A;  4NMI A;  1A34 A;  3EO6 A;  3K51 A;  4QGM A;  4KWJ A;  4XUN A;  2GH2 A;  4XW3 A;  1AJO A;  1RHI 2;  1GP5 A;  1OF3 A;  2JG9 C;  3C7G A;  1DLC A;  5LY2 A;  4DQA A;  4W8J A;  1NQD A;  1YQ2 A;  4PHZ A;  5LBC A;  2Q4S A;  5LWB A;  1WCK A;  3A0K A;  4YVW C;  2A6V A;  5DQ0 A;  1Q56 A;  1F4H A;  2A1X A;  5T5J A;  1QEX A;  1RXG A;  3LZZ A;  5JOW A;  2HWB 3;  2VNO A;  2W87 A;  3WNP A;  2WO7 A;  2AZ5 A;  3M70 A;  4BQ1 A;  2WSV A;  2MEV 1;  3LA7 A;  1OVS A;  2OVU A;  3ZN5 A;  5BNP A;  5HV0 A;  4LBJ A;  1ZZ7 A;  4FOW A;  1RHI 1;  4Y20 A;  5FYB A;  3POJ A;  1F9K A;  3ZYF A;  4JGZ A;  1V0A A;  3I2G A;  1BMV 2;  2PHT A;  3PJY A;  3SEE A;  3OPT A;  4FO9 A;  2CDP A;  4BE3 A;  2D3S A;  2CTV A;  3OTF A;  4LHS A;  3ZDS A;  5FZ7 A;  4F3J A;  5HCF A;  4OHZ A;  1KS4 A;  4Y5S A;  1E5I A;  2FDG A;  4MGS A;  2GP3 A;  1QJU 3;  3D82 A;  4CCJ A;  4H7M A;  1DFQ A;  3ZYH A;  3POE A;  4JTN A;  4UF0 A;  4NWV A;  5JIA A;  4CDX B;  4DB5 A;  2VD7 A;  1K5M A;  1X50 A;  1W6Q A;  1RB8 G;  1J83 A;  4I09 A;  3OD0 A;  1W0O A;  4M4R A;  1BMV 1;  4NRM A;  4CDU B;  2WRA A;  2V5D A;  2KR2 A;  4D8M A;  4NN0 A;  2DTY A;  3MIC A;  2VMC A;  4XFH A;  5A1A A;  2R6Q A;  4Z82 A;  4B1M A;  5BNQ A;  4FTS A;  2HWD 2;  4JDM A;  2VM9 A;  1DYK A;  3UGG A;  4GH4 A;  5FP4 A;  2DUR A;  2DU0 A;  3AXE A;  3M2M A;  1HDK A;  4AG4 A;  4IE4 A;  2ZEY A;  2ZML A;  4GMP 0;  1PVX A;  2D97 A;  1MZ6 A;  3QD6 A;  5L9R A;  4N43 B;  2W91 A;  1CX1 A;  3HR9 A;  5G04 L;  4LBK A;  5JUV A;  3BGA A;  2XG3 A;  3OGV A;  2NLR A;  2A3X A;  2WQ8 A;  3HWJ A;  5KWR A;  1UU6 A;  2HWD 1;  4RS5 A;  5DZG A;  5FLH A;  2QVS B;  2HWF 2;  3O1M A;  4QPI C;  2DWR A;  3KF3 A;  3OY8 B;  2OYZ A;  1W05 A;  4C1W A;  3VD3 A;  4QQO A;  1OKO A;  3LEK A;  1LGB A;  2J1S A;  4YG6 A;  5LA0 A;  2KXL A;  3ZFE A;  3ZFF C;  2BWC A;  1RUG 2;  4H7L A;  2ARC A;  1MQT A;  4LT5 A;  1YYN A;  5EYY A;  1HQW A;  4ZPI A;  3HVD A;  2Z42 A;  1JOD A;  1LEN A;  2HWC 1;  3DUI A;  5A7Q A;  4XEZ A;  3MF9 A;  1RUN A;  1CIY A;  2ENR A;  4IGO A;  4WZC A;  4YW3 A;  4FPY A;  2HWF 1;  4PF1 A;  2QTW B;  4WVM A;  5CB7 A;  3DXU A;  2YDE A;  4D69 A;  2ZS6 B;  3HOB A;  4P5H A;  4Q0P A;  5FP3 A;  1EAH 2;  3VBO B;  4BME A;  1JYT A;  3WCR A;  1XSQ A;  2XQR A;  1Q8V A;  3W58 A;  5KXD A;  1JU4 A;  1OA3 A;  2TEP A;  3OOX A;  3V64 A;  1WGP A;  4FPK A;  1RUG 1;  3MFA A;  5A33 A;  1YHF A;  3JU9 A;  2VU9 A;  4IND A;  3AKR A;  3GBG A;  5JXH A;  4FXK B;  1JMU B;  3NNG A;  4CU9 A;  2W1Q A;  5FV3 A;  4E9K A;  3OBR A;  5FMD A;  4BQ3 A;  3D4K A;  2WBK A;  3WVJ A;  3N7J A;  2E7A A;  3H7J A;  4N90 A;  4HAN A;  3RPQ A;  3TBD A;  3WNN A;  1NLS A;  4IGP A;  1VIW B;  1EAH 1;  2A73 B;  2VNV A;  5I0T A;  1YFW A;  4GWJ A;  3RYR A;  4AHW A;  3AYD A;  1GP4 A;  4QX3 A;  4TLF A;  5GZG A;  1DQ6 A;  1DQ5 A;  1HLC A;  1DGL A;  1NOV A;  4EWD A;  1W28 A;  1PM7 A;  2YZ4 A;  1RMU 2;  2WNV B;  4HPK B;  5C70 A;  4ONU A;  1ULD A;  1UY2 A;  3WHU A;  5LCW L;  5FY0 A;  4CEY A;  1SBD A;  3MYX A;  4ASM B;  5CA6 A;  5T3N A;  1LHV A;  1RUJ 3;  1SDD B;  4FI9 A;  4P08 A;  4LBO A;  1V6L A;  4XUO A;  1AL2 2;  2HWE 2;  2VW0 A;  4CCD A;  3D6E A;  3QCW A;  3ZXJ A;  4NHY A;  1KFU L;  1UIK A;  3ZFG A;  2RV9 A;  1W9F A;  2VY0 A;  2HWD 3;  5IK8 A;  1JS9 A;  3INA A;  5CEH A;  4MV2 A;  4Y1X A;  5CU1 A;  1RMU 1;  4IQP A;  1XE7 A;  1W8N A;  1IPK A;  1S0J A;  2GMM A;  5IVV A;  1AR9 2;  2DBN A;  2IUW A;  2WJS A;  2VZV A;  3BIW E;  4H3W A;  2LM3 A;  2X5I C;  1D2Q A;  5FPV A;  5FDB A;  1HJG A;  3VV1 A;  4ES8 A;  5IYY A;  3H3U A;  3P5B A;  1VAK A;  4CP9 A;  4XE9 A;  1W6P B;  1SCR A;  3NJZ A;  5E88 A;  1AL2 1;  2OII A;  4Q0V A;  3JD7 3;  4BXF A;  3RZL A;  3H8R A;  1PX3 A;  3OGG A;  4ZS2 A;  4UF0 B;  5BUV A;  4G4F A;  1KS5 A;  2HWC 3;  3B69 A;  2ZKN A;  1W6Q B;  5DUV A;  3AZY A;  1G86 A;  2GNT A;  1SCS A;  1YJK A;  3VZO A;  4FP2 A;  1O3R A;  2DCJ A;  4S2H A;  2ARE A;  1AR9 1;  1MEC 3;  2W3J A;  4P9I A;  3OPW A;  1VRB A;  3I59 B;  2BNN A;  1RJ8 A;  1TNR A;  1VB2 A;  4XQD A;  3D3A A;  2ZMN A;  1YQC A;  2B8M A;  2MHF A;  1G7Y A;  3AXD A;  1SLL A;  3LWC A;  1V6M A;  4QB1 A;  1KFX L;  2D5H A;  5JCT A;  4D7Y A;  1QH7 A;  4NAO A;  1H4G A;  2Q1F A;  3J7H A;  5T5L A;  5FWE A;  4LBM A;  2FDK A;  1CAV A;  4XDP A;  2G9G A;  3ZXG A;  4YGB A;  3VHO A;  4BU2 A;  1TMF 2;  2EAA A;  3C3V A;  1VP6 A;  1EAH 3;  1HB3 A;  3M8L A;  3OJB A;  4IET A;  2JKX A;  5HBA A;  1LAJ A;  1DQ4 A;  4LBQ D;  1L7L A;  4BQ5 A;  2P3J A;  1UX6 A;  2D6P A;  3E5U A;  4H14 A;  4LR4 A;  4M3C A;  1WA6 X;  4RS5 B;  4A6O A;  4CDW A;  5J1X A;  1IS6 A;  3AMQ A;  4FFH A;  3QBQ A;  4NE9 A;  4W6W A;  2PHL A;  5IVB A;  3T2O A;  1CX4 A;  4NIH A;  2YC2 A;  4OHY A;  4Q8L A;  1S55 A;  1QNW A;  2A5Z A;  3PVB B;  4FAH A;  2DYC A;  2QQO A;  3ZFE B;  1DGR A;  4LMF A;  3VBF A;  1TMF 1;  2XGX A;  4HN0 A;  4Q0U A;  2JEN A;  4EZH A;  5K7P A;  5FY1 A;  4YAR A;  1BVP 1;  1SLT A;  5F5I A;  5JOX A;  1F35 A;  2JDU A;  3GBW A;  3LDB A;  5A80 A;  3WQB A;  2LRO A;  4E27 A;  3U10 A;  3SKJ E;  3ELN A;  2W68 A;  3SHR A;  4DUV A;  4CEW A;  2IC1 A;  4WZF A;  2JDA A;  2K9Z A;  2R07 1;  4NHX A;  2ZGR A;  1ASJ 3;  3NST A;  5CIS A;  4O9G A;  3IIA A;  1GAN A;  1I3H A;  4MAD A;  4XJ9 A;  3BU7 A;  1MPX A;  3ZVX A;  2W92 A;  4A3Z A;  1DQ2 A;  4AAP A;  2CL2 A;  5FPL A;  2K46 A;  5K0U C;  4Z2W A;  1AL2 3; 
#chains in the Genus database with same CATH homology
 1ZRI A;  1F35 A;  1JOD A;  1JOB A;  1JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...