5I0SA

Thiosulfate bound cysteine dioxygenase at ph 6.2
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
185
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 53
structure length 185
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5i0sA00
4WVZA 5LRSA 4F8AA 2XGXA 2PHLA 4TLFA 3U10A 3H1WA 2PTMA 1H1IA 3DL3A 4QM8A 4XFGA 3GBFA 4IEVA 1YHFA 3WW1A 4LLOA 2ZKLA 4L11A 2OA2A 1CX4A 1NZCA 2VPVA 4UBHA 4IEOA 2XHKA 4CYDA 2XLGA 4LUKA 4AQ2A 3B02A 1PMIA 2EVXA 1LRHA 2BEOA 4KWJA 3DKWA 5BPXA 3E6CC 1O3QA 1X82A 1PM7A 3DN7A 1CAXB 5J3UA 3D0SA 1YUDA 3ETQA 2Z2SB 3BU7A 4P9GA 4EWEA 2IXLA 3BALA 2O8QA 1IPJA 3CF6E 1U12A 4LTAA 4QX5A 3FJSA 1O3TA 5JR7B 1OI6A 1J1LA 2OZ6A 2F4PA 4QGNA 4AVBA 2ATFA 4MX3A 4N9HA 3BPZA 5I0UA 1J58A 1RC6A 5I8SA 4XF1A 5JAXA 3QOPA 2N7GA 2PAMA 2Q0AA 5KHGA 4DINB 3OGJA 4UXAA 1QXJA 4R52A 2MHFA 1YFWA 3BB6A 2PFWA 3E6DA 4KL1A 4HSLA 1ZNPA 1EY2A 4FT8A 3OF1A 4IEYA 1YLLA 1ZZCA 3KSCA 4ORFA 2CV6A 3TNPB 1QXRA 1UW8A 4YNIA 3WW4A 5KHHA 3D0JA 4XFCA 4AQ6A 2UY8A 3H7YA 4LEJA 3I59B 2QNKA 5LEJA 3RNSA 4K8FA 4Z82A 1YFXA 2ZCWA 1DGRA 4HMZA 3WW3A 4IEPA 3ROUA 1CAVB 4QXKA 3NW4A 5FQ0B 3S7IA 3MPBA 3SCHA 1RL3A 1I5ZA 4YYOA 2H0VA 3KGLA 3PNAA 5E16A 5I0SA 4I01A 2BYVE 4MUVA 2XL9A 4I0BA 4YRDA 3KCCA 5BV6A 3IBMA 1ZRRA 1CAXA 1QY4A 5FCCA 4F7ZA 4Q0UA 3D82A 2XL7A 5K8SA 3ST7A 1V70A 4WBBA 2QCSB 3M3IA 1OD5A 2GC0A 5EFUA 3WW2A 4BHPA 3C3VA 4HVOA 2PHDA 4JV4A 5F1RA 1FXZA 4MGKE 1OMIA 2Z69A 2BNNA 4PIZA 1J59A 3BCWA 3OTFA 5D1IA 4PIXA 4EWDA 5I0TA 2EA7A 5FLIA 3LOIA 5BY5A 4HN1A 3UKNA 1UCXA 4XFIA 2GZWA 3CEWA 5HI0A 1IPKA 1J3RA 3PVBB 5KBFA 3KMHA 4Q0VA 4UBGA 1UIJA 1TQ5A 2HJIA 2WFPA 2D5FA 1DGWA 2Q4SA 2Q1ZB 2XKPA 2GC1A 2CGPA 4D7SA 1CAWB 2H6CA 5LEKA 4XFHA 2VECA 4I0AA 2PQQA 3I7DA 2UY9A 2V09A 1ZVFA 4J1XA 3M70A 3S7EA 4IERA 4HVRA 1Y3TA 3NJZA 1ZX5A 3OCPA 2Q30A 5FPXA 1YWKA 1NE6A 2CAVA 3MYXA 3I59A 4O9GA 5JSPA 5JSRA 3TNQA 3SCFA 4FAHA 1Q43A 3SMHA 3H7JA 4X6RB 1ZREA 4QM9A 3IDCB 1CAVA 5FQ0A 1LB2A 5J48A 3USSA 1X7NA 1SFNA 4Q0SA 4HLTA 3SHRA 2PAEA 2XLAA 3FWEA 3NSTA 1J3PA 3IIAA 1RTVA 3H8UA 1JUHA 1O5UA 1WGPA 3E5XA 4YSFA 3HT1A 5AVPA 2GAUA 4XFFA 4B29A 5BXXA 3MDPA 3ZDSA 3RYKA 5C6CA 1ZRCA 4E2GA 3KGZA 1Q3EA 1FI2A 2HKXA 1EPZA 1OFNA 4LA2A 4RD7A 4XF9A 4I2OA 4Q0PA 4IETA 3HT2A 4NVPA 1CAUB 3EQEA 2VQAA 4HBNA 4EROA 1FT9A 4ONUA 4OFGA 1Q5OA 2EAAA 2IXIA 4AXOA 3RDIA 3NKTA 1ZZBA 3UKVA 5BUVA 1YFUA 5I0RA 1ZRFA 3SCGA 3CJXA 4J1WA 3U0ZA 1CAWA 3FX3A 1SQ4A 3RYPA 5I8YA 1O5LA 2PYTA 3I54A 4QGMA 2GU9A 4JTOA 1UIKA 4E2QA 2ET7A 2IC1A 3ES4A 1YFYA 4HSJA 5FDBA 4KU8A 2BNMA 3H50A 5T3NA 4L2NA 4WZCA 3CO2A 1LKNA 4XF3A 4I09A 4KU7A 4X6QB 3UKTA 2B8MA 2BNOA 2IXCA 2B5HA 4OLLA 4XF4A 3E5UA 5JSOA 4R8HA 1WA4A 4BH9A 2ETEA 1NE4A 3LWCA 2OPKA 4ZU4A 5I91A 2DCTA 4A2UA 3EO6A 3NL1A 4EV0A 3LA3A 2UYBA 4XFAA 2QDRA 2QJVA 2IXJA 4META 4FAGA 4Z07A 5KHKA 2D40A 1QWRA 3O14A 4XEZA 1CGPA 3RPQA 5C8WA 2IXKA 3L2HA 3S0MA 3EBRA 4AVAA 4XETA 1GQHA 1XE7A 3JZVA 4IESA 4IEUA 4BYYA 4AVCA 1H1MA 1RUOA 4XFBA 1X8EA 4PIYA 5J7MA 1CAUA 2KXLA 4IEZA 5EZWA 2GC2A 3ES1A 4HN0A 4LA3A 3FE5A 5LRRA 2B9UA 1LR5A 5CU1A 2GC3A 2MNGA 1X8MA 5CADA 4JVAA 2PAKA 1ZRDA 4QMAA 4LUMA 3NVCA 2CAUA 3H1MA 4MV2A 4O9EA 3FFQA 1VJ2A 2MPFA 4HZFA 5CVRA 4MGYE 3RZZA 5KHJA 4JTNA 2IXHA 5FLHA 2BGCA 2I45A 1UPIA 4MGZE 3CL1A 5I93A 1GQGA 4HVQA 3OD0A 3DV8A 1O3SA 3EJKA 3PLQA 2QVSB 3H3UA 3IWZA 4FBFA 3GYDA 2OZJA 2E9QA 3VHRA 1I6XA 3EHKA 4IEXA 5FLJA 3IDBB 1DZRA 5KHIA 1J3QA 2WC2A 3HQXA 4EWAA 5JCTA 1WLTA 2D93A 2H6BA 1L3JA 1O4TA 1ZZ6A 1O7FA 1HW5A 4BIFA 4KWKA 4MH0E 2UYAA 4ZU7A 3HIFA 3H3ZA 2P17A 3H1YA 5E1RA 4IEQA 3MZHA 1UD1A 3ELNA 4Q29A 1Y9QA 1VR3A 4E2SA 2FMYA 3E5QA 3QACA 4MZUA 3U11A 2D5HA 2XLFA 4I02A 3RYRA 1RGSA 2K9ZA 3R6SA 1XE8A 2FQPA 1ZZ8A 4YARA 3ACLA 3H9AA 2C0ZA 1SEFA 4D7TA 4IEWA 3LAGA 4QGLA 4KWLA 4I3PA 4Q0QA 3N4MA 3E97A 1NYWA 3CLPA 4MGIE 1EP0A 2K0GA 2O1QA 5FPZA 3LZZA 1DZTA 3E6BA 1ZZ9A 4N9IA 3LA2A 4LULA 2Y0OA 2GH2A 1XRUA 1NXMA 3FHIB 2PA7A 4GULA 2ET1A 3SXWA 4XF0A 4H7LA 4PJYA 1O3RA 1G6NA 3G7DA 1VP6A 1ZZ7A 2OYZA 2XKOA 3LA7A 1EYBA 4ZU5A 3FZ3A 5I8TA 1RUNA
chains in the Genus database with same CATH superfamily
5LRSA 4FQZA 3VBUB 2P3IA 1CPMA 1O8SA 2XGXA 1DQ4A 3HEIA 3VDCA 3BOPA 3AVRA 1IS3A 5C3PA 3I2IA 1OVPA 1FMD2 1RUI2 3RVHA 3DL3A 1V6NA 4QM8A 4JHTA 2R30A 2YC2A 3ACFA 1RUE2 1TME2 3GBFA 4GKXA 4J25A 3WW1A 2ZGLA 4JC1A 4LLOA 4L11A 5L36A 1GP5A 2VMGA 2BV4A 4E4DX 1VBB2 2ZAHA 1PGL2 2XHKA 4IQPA 4W65A 4CYDA 4FOYA 4LUKA 1FOD3 1BVP1 4R9DA 2R0HA 3MLJA 1AR73 5JXIA 1A6CA 3LSDA 3V0AA 5J96B 1KEXA 3KF3A 3WNXA 4GZ9A 1Z0HA 4N53A 4B4PA 2JDNA 4CEWC 1U5XA 3ILNA 1YUDA 2Z2SB 2WFF3 3QLQA 2OUHA 1F5FA 4PI2A 3VHOA 3ZOIA 4NN0A 3SQOA 2Y26A 4AZZA 1OA2A 5AC91 3RRDA 3HPNA 2RS52 1VPHA 3AC0A 2PLV3 2YFZA 3INAA 4QQ2A 2J1EA 4A3XA 3PU3A 3NJVA 4KGGA 4XHBA 3ON7A 1UU6A 2E63A 3FJSA 3ZFGA 5EYYA 3VHNA 1CVNA 2D44A 1J1LA 1K5MA 1RUC2 4ZPIA 3T0BA 3LPGA 4KG8A 2R041 5FYHA 2R043 3DGTA 4NE9A 2BFUS 3RQ0A 4CCMA 5DUXA 3IPVA 2ZX4A 4A41A 3GBWA 2YBPA 3N35A 4GMP0 4Y33A 5CB7A 1ASJ1 2GN7A 3PTRB 2PAMA 2XB6C 1ASJ3 1NA1A 4IXLA 5KHGA 2V4AA 4UXAA 1H6YA 2VBPA 5C4WA 3ZXDA 5GKAC 3WNOA 1YQ6A 4XCBA 2CGOA 4FFIA 2ZGKA 3VBRA 4QD2A 4DQAA 2EXIA 1OC1A 1YLLA 5T5OA 1C3HA 1MZ6A 4S2FA 4CEWB 2FCVA 2VCCA 2VNOA 4QHZA 2GSYA 1HX6A 3OBTA 3KS7A 1QHDA 1RIRA 4MHUA 4Q4X1 1JOBA 5KHHA 5IK8A 1W6QB 4YVWA 1Z7S3 4MGQA 3OBRA 5A1FA 1EAH2 3DUIA 4WM7C 4R9CA 1ND3C 1VIWB 4YW7A 3RNSA 1O4YA 4CPBD 4GJZA 2HEWF 3OPWA 3AKRA 1NKGA 1S2BA 1SBEA 3PU8A 1Q8SA 4WVMB 2RS32 2PELA 3UL2A 4BPZA 4CEYA 5L9VA 3NW4A 5FQ0B 3S7IA 5CEHA 2VQ0A 3J8F2 3ME2A 4QX8A 4A4AA 3KGLA 3PNAA 1SCRA 2WIIB 5E16A 2BYVE 4B1MA 4BQ5A 4MUVA 2YGMA 1AR92 3K75B 3KCCA 4XZPA 1PIV1 1ZRRA 5CFCC 1CAXA 2GMMA 1L7QA 1PIV3 2ILMA 4C0BA 1R081 1COV1 4Q0UA 5JR2A 1COV3 3U75A 3UGFA 4Z92B 4GB33 1JYWA 1V70A 2E53A 1ZBA2 5FXXA 1GP4A 3AP4A 1UKRA 1UYYA 3DXTA 4XABA 2VZPA 1CQ9A 5FBZA 1OD5A 3RZLA 2GC0A 5EFUA 5F1RA 4HVOA 2PHDA 4JV4A 3ZN4A 1FXZA 4MGKE 3WCSA 3O0VA 4XVHA 1HJGA 4UFHA 4OMCA 5IVBA 1W28A 1J59A 2RJ2A 2VJXA 1NCQC 5BNOA 4PIXA 1NLSA 2VUJA 3POFA 2P3JA 4QKNA 3H8OA 4FQ4A 2B9VA 3WQBA 3AZZA 4RN5A 1F5JA 4HN1A 4HK9A 4WM7B 5LK7B 1ND3B 1Q8OA 3BTYA 2JG8C 4KI5M 5A70A 5LA2A 3DKQA 3VBFC 5FO8B 2XUMA 3CEWA 5HI0A 1DQ2A 3UYJA 2R071 2AACA 2W1WA 5KXEA 5L9BA 2VW0A 2DWRA 3NV3A 1LNSA 2DTYA 3M1HA 5F5IA 1SPPA 1DGWA 2Q8DA 4CU7A 5C70A 4OHVA 2ZMKA 3O1MA 4GWJA 2JDHA 1CAWB 4D6SA 2DDUA 4XJ8A 4Z8BA 3VD9A 3RJRA 4I0AA 1W0OA 5BNNA 2PQQA 3I7DA 4GWIA 4HKWA 4ATEA 2UY9A 4H7MA 5FP7A 4LIVA 1PK6C 3BPSA 4J1XA 4BK5A 4JAAA 3M70A 3KWVA 2B46X 3S7EA 4HVRA 3VDBA 5DDJ3 2WS93 3PDQA 4YVSC 1DF0A 1W6MB 1RUF1 3OCPA 2GMPA 1RUF3 3I2JA 3ZIWA 1YWKA 1ND2C 4B1LA 3MYXA 1DFQA 3FLRA 3I59A 2Y6HA 4O9GA 5FPVA 3T2TA 3ZXFA 2CGNA 2JD4A 3BVCA 4FOVA 3WQ0A 4YW2A 5J37A 1APNA 1QNYA 3OJBA 3UGHA 4NIHA 1Q43A 3PUHA 4AR2A 3CQOA 3VD5A 1ZREA 4A3ZA 1CAVA 1CESA 4DNYA 1AR61 2DCKA 5IVYA 1QJY2 1AR63 5DG1A 3WUCA 4CDWA 1HB4A 2OVUA 3PIJA 1X7NA 1QJU3 1R1A2 1SFNA 4Q0SA 3LCPA 1OLMA 2QQVA 3MGUA 1VRH3 2ARCA 2HWD3 3KT7A 1POV3 4IE5A 3VBFB 1PGW2 5HV4A 3V65A 1V9U2 3N7MA 4OHXA 2XR4A 3IIAA 4HT1T 2TEPA 1GICA 1O5UA 3E5XA 2WWUA 4MXVA 4YW1A 3TYJA 4BM8A 1CWPA 3POJA 3IIIA 1SFYA 2WSVA 3K77A 4TN7A 2C9KA 1W3VA 2FHRA 4AEKA 3P6BA 3VBSC 2HWC2 1X36A 3R4DB 5C5TA 5GZFA 3NNFA 3KV6A 2RS13 4P02B 1HXS2 1BYHA 4W6WA 4E2GA 3KGZA 1Q3EA 1C57A 3SITA 1FI2A 5A7NA 4DPNA 3GHMA 2BUKA 4UF0A 5FXWA 4RD7A 4FPYA 1D4M2 2CWSA 5F3GA 3RJ2X 4I2OA 4GH4B 3DXUA 4YVSB 2WO3A 1OA4A 1CAUB 5K0UC 1AF9A 3EQEA 5CBLA 2VQAA 4FPLA 1LCLA 2C9AA 3GZTB 3I3QA 1QQP3 1AR81 3VZOA 1RUH2 3AMQA 5CA6A 1AR83 1FT9A 1NCRC 4ONUA 3S30A 5D8AA 4HXCA 4QX1A 3K4ZA 5LB6A 3UT0A 2R0FA 1FATA 1H9PA 3BI3A 1FV2A 4NPMA 1GU3A 2G9GA 4CCDA 2JICA 1LAJA 4Y24A 1VAVA 3IB3A 1XNDA 3MF6A 1JU4A 1W6PB 4B4RA 1FPN2 2XWJB 2Z79A 3B9CA 4N43A 4Y5Z0 4OHZA 2J1TA 3FX3A 3K4DA 3IKWA 4LO4B 3UESA 1O5LA 2PYTA 5I8YA 3M4FA 3AP9A 4QGMA 2GU9A 1UIKA 3A22A 4YG3A 2WUHA 1HLCA 1TZOA 2A71A 4E2QA 5CG9A 4HETA 1HN1A 4E9KA 2NYYA 2YHJA 2WYSA 1TG7A 2ZGUA 2JB8A 4M01A 5FDBA 3O1RA 1MVQA 1VMFA 2V5DA 4Q4W2 4M3CF 2Q8EA 4CEYC 2KD7A 4UI9L 4ZONA 4BQXA 5FYYA 1D4VB 3ZXGA 1V6KA 2MEV1 2W94A 2R6QA 3B69A 3O0WA 4AI1A 2P6HA 3VBOC 3E5UA 5JSOA 2E33A 5LA1A 1PVXA 1LHOA 2JG9C 1F8VA 3MW4A 3I2DA 5ABJA 1OOPB 2B42B 4XOGA 2WNUA 3GZAA 2C6SA 1UXZA 5KC6A 1B35C 1PO21 2D6OX 1W8ZA 1SDWA 4C0HA 2R1BA 2VC9A 3B00A 2VXRA 1NCRB 3VZNA 2QJVA 2IXJA 4META 4Z07A 3VGIA 2D40A 2D3RA 3LEIA 1QWRA 3SH5A 2QQLA 3RPQA 4TSVA 3KQ4B 1JHJA 2IXKA 4FXKB 3S0MA 1ST8A 1JUIA 5JXHA 3WD5A 3OEAA 1YO8A 4KNCA 1W99A 3N9QA 4W6YA 5FXVA 3M7AA 4XIKA 4J6GA 4XXAA 3TBDA 2JWPA 1FOD2 1PX4A 1X33A 2RMU1 1XE7A 3PUQA 2WQZC 3WINE 1AR72 3JZVA 4CRQA 4ZY9A 3MW2A 3NKGA 5HXMA 2IUWA 4IESA 3K51A 4INDA 4NUBA 2ZA9A 1JOPA 1UF2C 4A44A 1H1MA 4KBZA 5F3IA 4FP2A 4XFBA 3T4HB 1IG0A 1XE0A 1AYM3 3PIGA 1IOAA 1PMHX 1W6QA 2WFF2 4U36A 5FPBA 3POWA 4DY3A 4RHV1 5GZGA 4RHV3 3VKMA 1Q8QA 5JXJA 3JQXA 3FE5A 1FYUA 4NMIA 4PQQA 3VN4A 3VBOB 4URAA 2PLV2 3TN93 2RE9A 2JG9B 4FPHA 1Q56A 1QOSA 3MIEA 3QH6A 1EUTA 4XQWA 1H8VA 1N1YA 3C7OA 4QWNA 5CZKA 4A6OA 5CADA 4QPGC 3V0BA 4LUMA 3NVCA 2CAUA 2VNGA 4LKEA 4WV8A 5GLUA 5ISLA 3BUCA 1NZIA 5JIUA 1MZEA 1KJLA 2RM23 4O9EA 2MPFA 1MQTA 1XPWA 2HEVF 2WQ8A 2XJRA 3LEKA 5SV5A 4MGYE 1YXWA 3OPZA 4JTNA 3ORJA 1LU2A 2BGCA 1HB2A 1N3PA 3TEZA 1ODMA 1UL9A 4CDQC 1KQRA 3GHNA 1UPIA 1OQ1A 4XE9A 3S5QA 1GV9A 1LECA 1KITA 2X5IC 3AP5A 2X10A 3U1XA 4PLOA 4QQOA 1O3SA 3N7LA 2YUEA 1TNFA 1PZ8A 4FBFA 3IWZA 4XDQA 3Q8EA 4LK7A 4LMFA 4XPVA 5FJHA 2TUNA 1J84A 2AH2A 1I6XA 1W2OA 1BLZA 3OGGA 3KM5A 2XQXA 3EHKA 3OG2A 4IEXA 1LGBA 1VBA1 4TLGA 1XNKA 3HVDA 1VBA3 1KDKA 4MHRA 3WF2A 4CU9A 3HQXA 2LM3A 5E6HA 1S0FA 2A5ZA 3MUZ1 5C5UA 1IG3A 1DGLA 5JCTA 4FTBA 4UWDA 1LHWA 4EN9B 4YZ5A 1Z7S2 1DLCA 1UOJA 4IUGA 4LHSA 2ZEXA 3GCWA 4KWKA 4BIFA 4LHLA 3T1MA 4MH0E 3ACGA 4BIOA 5CG8A 3ACIA 3AVSA 5C71A 4W8JA 5JZGC 4EN6B 3V0AB 1DQ1A 4K8RB 2P17A 3O1PA 1AJOA 1CJPA 2XJPA 4Z2WA 5FIXA 1BEV1 4IEQA 1UD1A 1W8HA 1BEV3 4N53B 5FZIA 2DCJA 5FZ1A 3ACHA 2FMYA 3E5QA 2UWAA 3JQWA 1QOOA 3QACA 4MZUA 4OZOA 1K12A 4O65A 3U11A 2VAUA 1IKPA 2RDSA 3VKOA 4D0QA 2J1SA 4FO9A 4CUCA 4QB6A 4XHXA 3BKZA 3MBWA 5T54A 4IDZA 1HJFA 1IHMA 3NWKA 4YW6A 3HN1A 2DUQA 3VZLA 3W58A 4YARA 4UFKA 4QQHA 4GB32 4L0PA 3K3NA 3ZFGB 2GN3A 1CPNA 2WDBA 2XXZA 4QGLA 3UV9A 3KLSA 4GAZA 1K5MB 1GZTA 4NWWA 5FZ9A 1GWMA 4LO6B 4I3PA 1SBFA 4LHNA 3QD6A 2Z5WA 1I1EA 1IS5A 4YG0A 4DUXA 1C8M2 2VZUA 1AXZA 2P4EA 5DUWA 3FN9A 1VBC3 2JIJA 3IPVB 4C1WA 1RHI3 3MLLA 2WN3A 3E6BA 4KG0A 4PDWA 4QKFA 1NA1B 3HQRA 1AJKA 4QPWA 1G8WA 2AGSA 1CZSA 4LULA 5C4WB 1VLNA 5J36A 1NT0A 3KV4A 1UMZA 1UY1A 4JCKA 2PA7A 2A1XA 4GULA 5I91A 5ACA1 3ASIA 4JGZC 3VBRB 1Y7BA 3ZLIA 1FNYA 1QJX2 4IGOA 1F31A 5F32A 5C8CA 5FZLA 5F5QA 1ZZ7A 5FZDA 3ZPYA 2HWE3 4AI8A 5BNOC 5FZEA 1JYIA 1IS6A 4HPKA 4BB3A 4M4PA 1EYBA 2FDFA 2SLIA 3U10A 4BMBA 3OYWA 4QX3A 1VBE1 4WVZA 2XBO1 4LPLA 4YVWB 2HWF1 5C3RA 3KB5A 2XBO3 2HWF3 2ZZQA 2A6YA 5HCHA 1JZ5A 3WUDA 4BLIA 1H4GA 1LOEA 5FZMA 4Q4V3 1H1IA 2PMWB 2EXKA 4XFGA 4AFMA 1P8JA 4LBNA 3LGRA 1YHFA 3P3NA 1YRZA 1JW6A 3C7GA 5JIAA 5DDJ2 2WS92 5FAXA 1UMHA 2OA2A 4CEYB 4UBHA 5FPAA 4IEOA 1GZWA 2C26A 4PLMA 3DPRA 1RUF2 2E31A 4OI1A 3B02A 3A23A 1PMIA 1PVC1 2ZOEB 1KS4A 2R32A 2ZHLA 1PVC3 2JX9A 3N36A 5BPXA 3J4UH 1SDDB 4GD4A 3BGAA 3ZFFC 3E6CC 5LY2A 3VKNA 2RDRA 1G7YA 2VGDA 2VTXA 1CAXB 1HRI1 4JGYA 5J3UA 3D0SA 1HRI3 5BNNC 4GALA 3O1SA 2Y6LA 1C5HA 5TSWA 3BU7A 1YIFA 2CSGA 4N90A 2D98A 4YW3A 3U4SA 2PN5A 4OVEA 4QKDA 1QJU2 1KFXL 1OD3A 1X50A 3LQCA 5JMCA 2IXLA 1VRH2 2VZTA 2HWD2 3CF6E 1J1TA 1LOBA 1U12A 1UOFA 2W1QA 4COWA 2BBVA 4LTAA 1QJZA 5T52A 4QX5A 2Y6KA 5JR7B 5BNOB 1LJ7A 2OZ6A 4QGNA 3WNPA 4AVBA 4YZ2A 5FY7A 1RC6A 2YU1A 4KMQA 2X53S 2RS12 4XF1A 4XUQA 5LASA 3JD71 3LIGA 1NLQA 4CDXA 4MGSA 2VZQA 3HBKA 3WEZA 3QOPA 3SKVA 2ZEYA 1MR5A 2Q0AA 3AKQA 3OGRA 5A7WA 1QXJA 4R52A 3JBG1 1UZ0A 2XVLA 2ZGRA 3JBG3 1JYNA 1YFWA 3O5SA 3VKFC 1SPPB 2KR2A 3E6DA 4TTGA 1QQP2 4HSLA 4KL1A 1HB3A 3J7NA 2ZX0A 4M3CA 1AR82 2VTXJ 1MS1A 2XOMA 5FO9B 5KXCA 4HANA 2UWBA 2R062 2BVBA 4B7EA 1IQAA 2BOJA 3I3EA 4XMIA 4NIAA 4FPFA 4D7YA 1IKQA 1OA3A 5BNNB 4LOSA 2CV6A 4Y1UA 3RI9A 4XAAA 5IVFA 5FYCA 3URFA 2DU1A 5FZHA 4NAOA 4XFCA 4AQ6A 1RXGA 1PO13 4UW6A 3WG4A 4BDVB 4JKMA 5AFEA 3N9OA 1RMU3 5FZ4A 3I59B 5LEJA 2B7YA 4K8FA 1QGLA 1W2UA 3AYCA 4IW3A 5IAVA 2W52A 5D8AC 1YFXA 4YZ4A 1CAVB 2VUDA 1G9AA 1T6GC 4JKLA 3SCHA 4CDWB 3O1OA 4GWNA 1UMIA 4KBBA 1N3QA 4I01A 2GNTA 5I0SA 4YRDA 2E6VA 2DURA 3O1UA 4N43C 3S57A 3IBMA 4RA0A 2GP3A 1QY4A 2VOXA 2BZDA 4SLIA 5A6YA 1RVF1 3D82A 3VD3A 1RUD1 5FZGA 1SG3A 3MIDA 2BGPA 3ST7A 3RSJA 3HMYA 3FMGA 4K7JA 4BK4A 3WDUA 3M3IA 3ZN5A 2JE8A 5G05L 1RYYA 3V64A 1IGOA 1QH6A 1WLDA 2RVAA 4B3NA 4PIZA 4XZUG 1OQEA 1ULCA 2BGOA 3BCWA 5EJZB 4GJYA 4XTPA 4I3GA 4AI2A 1V6MA 4PT6A 3AL5A 4YM3A 3KT4A 1WMFA 4UF0B 3WR0A 2A3YA 1R091 2V72A 5GLWA 5AFBA 4DB5A 1XSRA 1LOAA 5F2WA 3NV2A 1K42A 3LOIA 5FRAA 2YV8A 4DS0A 2ARAA 1WCDJ 2WLPA 1NUKA 1W06A 3AFGA 3GZUC 1BBT1 2ZGTA 3I8TA 2IZWA 5FP3A 1NX9A 1BBT3 2G9ZA 4FSJA 2R1DA 4EN0A 3MLKA 4CU6A 4JX0A 1DBNA 1C1LA 1UZYA 3VD4A 1JBCA 5D8AB 4YWAA 2Y0IA 2CYFA 4CCCA 1AYM2 3IT8A 4Y20A 3KMHA 4Q0VA 4UBGA 5LW9A 1TQ5A 2HJIA 5CKNA 5IVJA 2D5FA 4RHV2 2JEMA 4D94A 1DZQA 1F4AA 4IE6A 3THPA 2XKPA 1YEWA 2DU0A 5JOXA 4MO3M 4N43B 3TN92 4CDUA 3H8XA 1HV0A 2H6CA 3LF7A 4Y22A 1GQPA 1V0AA 1E57A 1O8PA 2A70A 4A6SA 1H30A 1RITA 4K21A 4L97A 4D6QA 2W1SA 1ZBE1 1ZBE3 4AEDA 2P5BA 2RM22 4C90A 4A7KA 3FL7A 1O91A 2W2IA 3W9AA 5AC93 5CFDA 2V5YA 5EWSA 1TVGA 2CAVA 2EIGA 5E89A 4AI0A 4AGRA 1SFPA 4FXGB 3SH3A 2YC0A 1OLME 4FAHA 2CU5A 1C1FA 2ZX3A 3H7JA 5ABJB 5H9RA 2WNUB 1XNCA 2H0BA 4WM8A 2JE7A 4CU8A 2BBAA 4E4SA 4IE4A 4MLOA 1EV11 1S0GA 2VZSA 1EV13 1O6UA 4AGGA 4K40A 1H8TA 2X05A 3SHRA 5JPMB 5FMCA 1NY71 2W0XA 3GJBA 2ZGOA 5F9TA 5LWBA 2BQPA 2UWCA 2PXJA 2XJQA 1RTVA 1CN1A 3AKSA 1CIYA 2PHUA 1WBFA 2VOKA 4FFFA 1DCSA 4P5YA 5FMOL 5T55A 2I74A 1VRBA 4ZS2A 4OI4A 2WT1A 2RV9A 4XQ4A 3PMEA 4A45A 2Z4FA 1YC61 3MDPA 1QKQA 2DVGA 2VD7A 5BXXA 4B29A 5FZ6A 2FDIA 2HH9A 2GALA 5C6CA 3BODA 2YY1A 3ZKYA 4JKKA 1AX0A 4BQ1A 5HBAA 3W5MA 4C8DA 2VMHA 1EPZA 1AXYA 5DN2A 5IATA 4XBLA 1BEV2 3D8CA 1LENA 4Q4X3 1US3A 3HT2A 5A7OA 4BMEA 4DFSA 1C8NA 2WL1A 3HNMA 5B4NA 3ZKUA 4ZHNA 4LXLA 1MS4A 2XQRA 4L92A 1JH5A 4H3WA 4LBJA 4GXLA 4PCRA 5FYUA 4BJ0A 5AVAA 2HYXA 3RZHA 4CP1A 2BERA 1QNWA 2VE1A 1WW6A 5B2GB 1Q5OA 2HBUA 5LCWL 3NKTA 2L9LA 3UKVA 4CCNA 2EIEA 3V0BB 3B3QE 3POYA 5I0RA 4ISQA 2VZOA 4RQPA 1MEC1 5IWFA 3RZMA 2WABA 3P3PA 2P37A 3CJXA 1BZWA 1MQTB 2QUOA 3RYPA 3NNJA 3AMNA 3I54A 2A6XA 4PHZA 2WNVA 4P9JA 4QXHA 5DUVA 1LEMA 1VBC2 1R083 1OPOA 1QDOA 1RHI2 2ET7A 2IC1A 4ZZ8A 4CUBA 3M3OA 3MIBA 4AOCA 3RGBA 2A6WA 2BNMA 4K6BA 4KU8A 5IHRA 1W2AX 4L2NA 3B01A 4XF3A 5KXDA 3NAPA 2JJ6A 4COYA 1UAIA 4X6QB 3UKTA 5JUVA 2B8MA 2BNOA 2IXCA 4Y26A 3U37A 3O1VA 2W3JA 5FYMA 1CIWA 4OLLA 1K45A 4Y1VA 3KV9A 4XF4A 3WP6A 2OXBA 4COVA 1WA4A 3J7LA 3Q8BA 4ZZ5A 1SMVA 2ETEA 3ZXJA 4P9XA 2HWE2 4R9AA 4XUTA 4PDWC 4XW3A 3ZXEA 2J1RA 3NL1A 3LA3A 2WZ8A 2UYBA 2ZGPA 3FHAA 4XFAA 5FY4A 1MZ5A 2YBKA 4X8NA 2XBO2 5F6KA 4FAGA 2HWF2 5KHKA 1JYTA 4N7IA 1VE0A 4QHOA 4P9IA 2E7QA 3O14A 4Q4V2 4XEZA 4AHWA 5KWRA 1CGPA 1ULOA 1S55A 1Y43B 1X9PA 2R073 5L9RA 4DOUA 5JLVA 3L2HA 3T0AA 3EBRA 3WG3A 4DZGA 5EIYB 4RGGA 1WW4A 2YPDA 4NPRA 4XETA 5C8CC 5L7OA 3WNKA 2JB4A 4XURA 4OHWA 5FKCA 3F95A 2W08A 4CCEA 1PVC2 3NNGA 1TE1B 5HCBA 4QU1A 1H6XA 1DGWX 1CD3G 2I2SA 2Y60A 4IEUA 3SKJE 1JODA 3N3HA 5A6XA 2YZ4A 1RUOA 1HRI2 4RS5A 3PMSA 2BJSA 3IZOA 1SLBA 2XVGA 4PIYA 4AWDA 5J7MA 4GH4C 4BQYA 2Y8KA 4IEZA 5EJ3A 4LJHA 4CTEA 3W59A 5IT6A 1LEDA 3T2QA 5C3QA 5J09A 2B9UA 3HNBM 1KD7A 1OSGA 1VB4A 2VVDA 1CZVA 3SNMA 3IDEA 4JVAA 1BMV1 4DIQA 2DVAA 2JE9A 4PDWB 4JGYC 3L2YA 3TAYA 4BISA 1KS5A 1DHKB 3M3CA 1VJ2A 2VMCA 3B5LB 1WKYA 5H9SA 3I3MA 1JZ2A 3P1IA 2CWMA 3PJQA 4RR3A 3AZVA 3GJAA 4IE7A 4MGZE 5C8CB 5I93A 2ORXA 5BNPA 4BZ4A 1XBFA 4JHZA 3DV8A 1J83A 1UYZA 1KDMA 2XJVA 2A73B 3JBG2 4HPKB 1GOFA 3GYDA 4G4FA 3OYWB 2E9QA 1XXNA 4MSVA 4CCJA 5FYZA 4KGQA 4NPLA 3ZSKA 2W1UA 4P00B 1YNAA 1J3QA 2GNDA 4A42A 1OOPC 4EWAA 5CFCA 3GZEA 1AL21 4FPEA 1AL23 1W6OA 1WLTA 2D93A 4LHKA 4IV3A 1HRV1 1OKOA 5KC5A 2PHWA 1PO12 1GZWB 1DIWA 1ZZ6A 3DPRB 1O7FA 3ATGA 1HW5A 4CUGA 4ZKTB 1RMU2 1GZCA 4JDOA 4Y1YA 1L7RA 3KZ4C 4HL0A 5DZGA 5H9QA 4P5HA 4ZU7A 5FZFA 5CISA 3LEGA 4AI9A 5C9AA 4R4XA 3HIFA 1UO9A 3KQRA 2W46A 3H1YA 4JGYB 3KV5A 3A21A 1UOGA 4F83A 3GDBA 5SV8A 2ARBA 1ZA7A 5ANQA 3WG2A 4TZDA 5D2AA 1JN2P 3AP7A 4MXWA 2XLFA 3PUAA 4HFSA 3AZXA 2X09A 5DZFA 5FREA 2HLEA 1DQ6A 1XE8A 2C4XA 1XNBA 4YGEA 2XJSA 3R6SA 3WDYA 2DVDA 4BE3A 3TEYA 2FQPA 4JZRA 1ZZ8A 4HK8A 3ACLA 2C0ZA 5IVEA 3ZYPA 3MIGA 5EHDA 5F3EA 3H3LA 2ZX2A 2OIIA 1HIXA 3OUHA 4NIGA 1E5SA 4LIUA 2MEV3 4ES9A 3N4MA 3E97A 3R05A 3W20A 5F39A 4LQRA 1U5ZA 2BVVA 3I4IA 3DEMA 3WOGA 4CDXB 3AXDA 5FPZA 1JS9A 4MOAA 2RR11 3LZZA 5HPOA 2RR13 2NP0A 4NRPA 2XUEA 4D8MA 5IVCA 3U14A 3AM2A 1PO23 1H0BA 4AAXA 1POV0 2VZ1A 4LNVA 4HONA 5A7WB 1JZ3A 3LA2A 2ZACA 2P34A 4AAPA 1WCSA 3FHIB 3CJIA 4NO4A 4S2DA 3WCRA 2P1BA 2ZKNA 1REFA 4M3CB 5FK8A 1AVBA 1ZA4A 3SXWA 3T2PA 3ZVXA 4I30A 1DYKA 2VG9A 1V6IA 2YPJA 2J1AA 1W8NA 2A6VA 4NAMA 3G7DA 2ZHNA 4AFDA 2WA3A 4CZSA 5C3OA 2OYZA 2Y6FA 4DXSA 1RUG1 5H9PA 3B9IA 5FUNA 3EXUA 3LA7A 1GNZA 2HYKA 3WV6A 4E8CA 3FZ3A 3GM8A 2RMU3 5CKQA 1RUNA 2RDQA 4F8AA 1NLRA 2EIBA 4FCAA 4CXYA 1HQNA 2PHLA 3T1LA 3JXSA 3H1WA 1GR3A 2ZAAA 3U07A 1LHNA 2AC1A 3GBGA 2ZKLA 3AZWA 4YW4A 1AYN1 5GLZA 1W04A 4QHBA 2Y38A 2XLGA 5AC92 4AQ2A 3ZPOA 1QXPA 1S0CA 3HJRA 2EVXA 5FTTC 2J1VA 2BEOA 1MPXA 2WJSA 1WMEA 5J98B 5HCAA 1MVEA 1O3QA 2SBAA 1X82A 1PM7A 1UYPA 4YFZA 5FY0A 2HEYF 1JZ4A 1FMD1 4OUMA 1RUI1 4XAEA 1FMD3 4AI3A 3AYAA 1UQXA 2WZR1 1CX1A 1RUE1 1TME1 4N53C 2WZR3 1FAYA 2YC4A 1TME3 3ETQA 4EZHA 4EWEA 1VBB1 1YCIA 2QFEA 1PGL1 3GCXA 1LODA 2FDKA 1K3IA 2R042 5HXVA 4OHYA 2D6PA 3BALA 2CTVA 1EUUA 1XYNA 4LBQA 2NMNA 1MACA 3ZXAC 1S0EA 1YJKA 2JIGA 3BIEA 3NJXA 3ZDVA 1GZ9A 1CJDA 1ASJ2 1O3TA 4YM2A 1OI6A 1VAKA 3ZFGC 3RG0A 4XXPA 1XQNA 4HKOA 1QIQA 1SHWB 3OD4A 5FZOA 1K5MC 4UOJA 4WM8C 3MICA 4MX3A 2D3PA 4N9HA 1BK1A 3BPZA 1PNGA 3R4UA 3WQ1A 2EXJA 5I8SA 1ALYA 3I2OA 1AHSA 4BCUA 4B7KA 1H8TC 4GIQA 4G3YC 5JAXA 2VZRA 3OUIA 4M3CE 5A3WA 5IVVA 4YFWA 4AFAA 4GKYA 4OCTA 5FYSA 4BA6A 5A32A 2W47A 4L99A 3OGJA 4DINB 3W5NA 2G4IA 1NAEA 1NA1C 4Q4X2 3ETPA 2IWGB 4Y20B 1RUC1 1F9KA 3M3QA 4JQTA 1I5PA 2PFWA 5C4WC 1UY3A 4IV1A 1HN0A 1OPMA 4QX2A 1Y9MA 2Y6JA 2ZTNA 1ZNPA 4FT8A 3OF1A 4CDUB 3VBRC 1UZWA 4Q4Y1 3H0OA 4Y22B 1WD3A 4ORFA 4OUSA 4Q4Y3 4ASKA 3EB7A 3OUJA 2J7MA 3KVBA 3PURA 2YROA 3ENRA 4LBOA 3TNPB 1QXRA 1AUYA 1UW8A 5FYBA 4IL7A 5FYVA 3IMMA 4MVTA 2XWBB 1T2XA 4XTMA 3USUA 2V73A 4AEDB 1DDLA 4R4ZA 5A33A 3TRSB 4YVWC 2IVJA 3H7YA 5EYXA 5CFDB 2AENA 5IK4A 1G9BA 1OT5A 1PIV2 2QNKA 2Q1MA 1WLWA 2AREA 1LULA 1FV3A 1R082 1COV2 2OS2A 2ZCWA 5JWPA 3A0KA 1DGRA 4BWOA 2YFUA 3C8XA 4IEPA 4YG6A 3WW3A 1W05A 2QQJA 4K9SA 4KQ7A 1S1AA 2YU2A 4QB1A 4QXKA 4WM8B 4WZFA 1GNHA 3MPBA 4BLJA 3AP6A 3I3BA 2VW1A 2ZABA 4XJ9A 4YYOA 4ASLA 3ZSJA 1VB2A 2VU9A 2WINB 4Y4RA 1UNBA 2XL9A 4DXTA 1H8TB 3DYOA 1EAH1 1OKQA 2JXAA 4YGBA 1MS9A 4XJAA 4Q2FA 2P6CA 2WZEA 2VL4A 2WNVC 2OPWA 1XNTA 3NO8A 3ABZA 4COZA 2RS31 2WYFA 4GQ7A 5FOBB 4WBBA 5GZCA 3B7MA 2QCSB 4BOWA 4LKSA 2FZ1A 2NLRA 3H8RA 1ULFA 3J8F1 2C5DA 2GMEA 4ITCA 3FLTA 3NAPC 2ZX1A 1OUXA 2XDVA 2OW4A 2Z69A 3CDZB 1OLRA 3QBQA 4S2GA 1AR91 5ACA3 2QQNA 2WNOA 3OTFA 1NCQA 2R072 3ZIXA 1W8UA 3HOBA 3ZN6A 4EWDA 5FUPA 2EA7A 1ZBA1 1KJRA 4IE0A 5FLIA 4LT5A 3WDWA 2WRAA 3FLPA 1M06G 1VBE3 2JKXA 3LFMA 2JG8A 1UCXA 4XFIA 5JOWA 1HQWA 2VUCA 2GZWA 4OZXA 4QX0A 3ZO0B 2KM2A 2VTFA 3WDVA 1IPKA 2DYCA 5C33A 2FDGA 2QQUA 1W9SA 3PVBB 1QJEA 1NOVA 2WFPA 3VKLA 4RQPB 4AFBA 2Q1ZB 4LK6A 2CGPA 5FOJB 1GUIA 4EE2A 5LEKA 4F3JA 4AE2A 3CU7A 5FP8A 2EALA 2WNVB 2V09A 1PK6A 2DCZA 4E4HA 3I49A 1ZVFA 3ZR6A 3JB4C 3VZKA 1BMV2 4IERA 4R9BA 1AR62 3ZM8A 5T50A 1Y3TA 4YLZA 4D3WA 2HWB1 1ZX5A 1BK0A 4NHMA 1D2QA 2HWB3 1PNFA 1ND2A 3NAPB 3O12A 5F5CA 3LOBA 1NE6A 1GSLA 2Q1FA 4UW4A 1H4HA 2IVIB 3R0RA 4LE4A 1D2SA 5JSRA 3FHQA 3GF6A 4DUWA 3SCFA 4FFHA 1HV1A 3SMHA 4X6RB 1W6NA 1YYNA 3I2HA 3IDCB 1V6LA 4M4RA 4QM9A 2AEYA 2D3SA 4HKLA 4P9LA 1G86A 5ANNA 4CP9A 4PQ9A 2LALA 4CDWC 2A75A 3UJOA 2FD8A 4UAPA 1VMHA 4XJUA 3JD73 2PAEA 3FWEA 2XVKA 1W90A 4HG6B 1JUHA 3SH4A 2CNAA 3IMNA 2LTNA 5LBEA 1YI9A 4XUNA 5FBJA 2ZMLA 1BCXA 2A3WA 2DVFA 1IZ3A 3VBSA 3HT1A 3PVOA 2C24A 1QJY1 4XBQA 5BNPC 5DUUA 5L7OB 4XCAA 1R1A1 1RJ7A 1RINA 2VULA 2ZHKA 2WBKA 1R1A3 4XFFA 5DXDA 3ZDSA 4UT5A 4UFLA 4EZ4A 3C2UA 1G9CA 2Q5TA 5F8PA 1BJQA 3WHUA 1V9U1 1AL0G 1V9U3 1D0HA 4YM1A 3AFKA 4Y1XA 4LA2A 4RS5B 4P9YA 4XF9A 3A7QA 1XNAA 1MS3A 3CIHA 5DAQA 1U5IA 3IAPA 2F4LA 4IETA 5GLVA 4NVPA 5FV3A 1SZBA 4YZ3A 2ZGQA 3CZUA 4N7UA 4AYUA 3POEA 3T30A 2EICA 2GH8A 1R1ZA 2QTWB 2LW8A 3U4XA 2AEZA 1TMF1 1GANA 4LBLA 4TYSA 1UY0A 1TMF3 2VOTA 1HXS1 2XMLA 3N9LA 1HXS3 2DUOA 5C3SA 5DZEA 2EAAA 5I0DA 2QZ2A 2NZ9A 4O7XA 3RDIA 1QEXA 1FX5A 5FXZA 5BUVA 1D4M1 1A8MA 1E5RA 1YFUA 5A3NA 1D4M3 1BQPA 1W9FA 2WQ4A 3A4UA 3HQUA 4QAWA 5CKMA 3FFZA 1SLTA 1ZRFA 2WNEA 1WCQA 4TWTA 3U0ZA 2MEV2 1VMJA 1C5IA 1W39A 1YQ5A 4ARXA 1RUH1 1RUJ1 1RUJ3 2X8KA 4JTOA 2YBSA 3ZMOA 1RVF3 1RUD3 1CZTA 4RR3B 2RR12 1GYKA 1BHGA 2JDAA 1REEA 1S0BA 1YFYA 4AW7A 1PO22 1GLHA 3MFAA 1UU5A 4HSJA 4W6XA 1GP6A 3H50A 5T3NA 5BNPB 4WZCA 1QF3A 1LKNA 4I09A 4KU7A 5KXBA 2YXSA 3N7JA 2WR9A 1WMXA 5A7QA 1WCUA 5GM0A 5K4LA 4P9WA 4R8HA 3WZ1A 3AL6A 1RXFA 3HNYM 5IYYA 5FZKA 4BQ3A 4EYUA 2OQ6A 4BH9A 2ARXA 5ABJC 1R093 3LWCA 5CFCB 2RG4A 2OPKA 4NHKA 2WNUC 4FOQA 2DCTA 4LBQD 4Q26A 1AX1A 1W6OB 3EO6A 4K1ZA 4W50A 4GMP1 4IV3B 5CNAA 4Q4W1 4M00A 4GMP3 5GZDA 2RMU2 4Q4W3 1ENSA 1W9YA 5IK5A 2KA3A 2ENRA 3W21A 1UWWA 3D5OA 5DAPA 5DABA 4OQ9A 2BOIA 1S0JA 5C9AB 1OF3A 2W87A 5C8WA 3O1TA 1MS0A 5FZ8A 3AMPA 3ZYHA 5FY8A 4AVAA 4SBVA 1E5IA 3VB9A 4DO0A 3UETA 5FY1A 1GWLA 3BU0A 1F4HA 4D6RA 1GQHA 3APBA 3AMHA 4QDSA 2ZEZA 3T3YA 1PMJX 3H42B 2DBIA 3OOXA 1GWKA 1H9WA 4MXWB 4AHYA 1KGYA 3IDAA 2RDNA 4BYYA 3P5BA 3OPTA 1GKBA 2ZZJA 1YIPA 2LRPA 1X8EA 1N1SA 1F15A 2WZR2 2KXLA 5FYTA 2GC2A 1W9TA 3MHZA 4OUEA 1GOHA 4HN0A 5DPNA 1JYVA 5DG2A 1FOD1 2DVBA 1WWYA 2VMIA 5LRRA 3ZFEA 4E8DA 3VDDA 2QDNA 2YYOA 4FOWA 4C91A 1AR71 1QH7A 1GFF2 4RGKA 1LR5A 5CU1A 4FPCA 2GC3A 2WO1A 3ALQA 2MNGA 4LITA 1O59A 4QPGA 1GOGA 1ZRDA 2J1UA 5F7UA 2QQMA 3Q8FA 1PZ9A 2WFF1 3H1MA 4G9SB 1LTEA 2JECA 3WNLA 1DYPA 2YDEA 5JI9A 2QQIA 4NHLA 1OURA 4HZFA 1XU2A 5CVRA 3KCYA 1OF4A 1MQTC 3BOWA 5KHJA 3CJIB 2JD9A 3NNLA 2PLV1 1VBA2 1KFUL 2IXHA 5FLHA 5DAWA 2BFUL 4CDQA 1VAMA 1LOGA 2EF6A 2OT7A 2VVEA 2LS6A 2X5IA 3CL1A 4FPKA 2FMDA 1GQGA 3HR9A 3QH7A 3HBZA 3OD0A 3RFRA 3CKHA 1UN1A 1JU3A 2QVSB 3H3UA 4LKFA 1NQJA 1AX2A 1QOTA 2OZJA 1UU4A 4PLNA 4Y4YA 1U0AA 3VHRA 4YPJA 4YGDA 1S0IA 1DU3D 2TBVA 1SCSA 4DEVA 4XJWA 5FLJA 4ARYA 3PVNA 4Q4Y2 3IDBB 1UY4A 5KHIA 3QCWA 3CMGA 4K1YA 4V2WA 5FMOS 4OULA 1XYPA 1JXNA 4NIIA 5FZBA 3WSOA 3T0DA 3J7MA 1L3JA 4N8MA 2QE3A 4RFT0 4JRAA 3GXUA 4QPIA 2DFCA 5FR3A 2AZ5A 3Q9OA 4CCOA 4PF5A 4NRQA 4IV1C 5JZGA 2UYAA 2D7FA 1ULEA 4KWUA 3PUSA 4BXSV 3DYPA 2XPJA 3H3ZA 3T08A 5E1RA 3WT3A 3D6EA 3MV11 4Q29A 2E26A 5A3UA 2QQWA 1MEC3 1WW5A 4E2SA 3WY6A 1N1VA 1U5YA 1S2EA 1Z7S1 4WVVA 2JDZA 2D5HA 2JDKA 3ZYBA 3AYDA 4I02A 1O4ZA 2F17A 4LBKA 1TEIA 1W03A 3PJYA 1PM4A 3RYRA 2JKBA 4LBQB 3VL8A 1PZ7A 3O0XA 1MZFA 3FUQA 3MV01 4AFCA 5F37A 1HB1A 2D97A 4MADA 5KR7A 2UU8A 4B8EA 4IEWA 3ZSLA 3OGSA 3ZYJB 3D4KA 3IN9A 5FZOB 2CHHA 4Y5SA 2FDHA 3LSEA 4DEQA 4XC9A 4CP0A 3ZXKA 3B94A 2CDOA 1JZ8A 1NYWA 3CLPA 1Z78A 5ACA2 1JZ7A 1EP0A 4CXXA 2UURA 4Z1VA 2K0GA 5IFTA 4DRVA 3AKTA 3GNEA 3NV4A 1ZZ9A 1F2NA 1JMUB 4GB31 5F6LB 5A32B 2PQSA 2ZHMA 3MW3A 1VBD1 4XYXA 2Y0OA 2GH2A 2VQTA 5LBBA 1VBE2 1NXMA 1OH4A 1S2KA 1VBD3 3E1F1 5EQUA 1OBNA 2VNRA 3D3AA 4IV1B 5ERLA 3HAGA 2DBNA 5DMYA 4JGZA 3ROUA 2WA4A 3VV1A 1C8M1 3K2OA 3N9NA 4XF0A 1OH3A 5E8AA 1C8M3 4CCKA 1H1AA 4H7LA 1ACCA 2CDPA 3RZKA 2ZGNA 4A7YA 1G6NA 2AYHA 5LATA 1UX6A 1JOJA 1XYOA 2XKOA 5EPAA 4JDMA 4ZXEA 4CVUA 1UX7A 1PX3A 1DGRN 5F5AA 5I8TA 3USUB 3HWJA 2WLQA 3S5AA 5FPLA 1DLLA 5A33B 2R49A 2VBDA 1V6JA 1POQA 4TLFA 3T09A 4ET7A 1WMDA 2PTMA 4S2HA 3RZJA 5FZ7A 1QJX1 3DCQA 5FMDA 1QJX3 4IEVA 3TOJA 4CP2A 1E5HA 1OUSA 1LOFA 1CX4A 1NZCA 2VPVA 1UY2A 2VUAA 3MO4A 3ZSEA 4TXWA 3BTAA 4UFJA 2HWB2 4LORA 4E4ZA 1DYOA 2E7TA 3ZFFA 2FZ2A 3DPRC 4EN8B 2W68A 3CZJA 2XG3A 1LRHA 4KWJA 3DKWA 1XJAA 2NN8A 4CCLA 3LDKA 3DN7A 1X9TA 1KXGA 4JDNA 5F2SA 3LB9A 3OSDA 4IGQA 4K3UA 3BN6A 2VM9A 4HOOA 5C7GA 4RSUA 2BTVC 2WS91 5DDJ1 4P9GA 4Z2AA 1DG6A 3UK9A 3S6PA 3OY8A 3C7EA 4Q1RA 4EN7B 1TNRA 3I3DA 2R16A 1PHMA 3MIHA 5GJ6A 2O8QA 1IPJA 1C4RA 3JD72 1Q8PA 2W5FA 2JDPA 4FTEA 4RGAA 2GDFA 2FBEA 5FY5A 1NCQB 3OBAA 3ZN6B 3LKJA 1W3XA 3VBHA 5HCFA 2D6KA 3THCA 3LD8A 2F4PA 2ATFA 3PHMA 4ASMB 3I97A 3ILFA 1QJU1 5I0UA 1J58A 3WLUA 3VUOA 1DQ0A 2VY0A 2EIDA 3WNNA 1VRH1 2CL2A 4FPGA 2HWD1 2JG8B 1POV1 3VZMA 3J9SA 2BRTA 2HBTA 4V1PA 3Q8AA 3TEXA 5FKBA 5A1LA 3NMBA 4CDXC 4JQRA 1H2KA 1CONA 2N7GA 2WWJA 4LKDA 3SC7X 5A6QA 5LY1A 4BXFA 4LR4A 2ZBJA 1HRV3 4L8QA 2MHFA 4B4QA 4LO5B 5E88A 3OBZA 4FFGA 4H55A 3BB6A 2VOVA 4Y1ZA 2PHTA 1HQLA 2IFWA 4CSWA 2RS11 2YB7A 1TMF2 1EY2A 4L9BA 4RL7A 4XMAA 5FPUA 4IEYA 3I2GA 1ZZCA 3KSCA 5BNQA 1PK6B 2D6MA 3WP3A 3RWKX 4YNIA 1UPSA 2WKKA 5LBCA 2I07B 3WW4A 4AK3A 2NQYA 1ULDA 3J7HA 4XBNA 3D0JA 3K48A 2AR6A 4QT6A 3TB0A 4BU2A 3VBUA 1PGSA 3KD4A 1ND2B 1QQP1 2UY8A 3BYWA 5FZCA 4LEJA 1N47A 5FJKA 3WXPA 5EJ1B 1OLQA 1CR7A 1M4WA 1RUJ2 3N9MA 3MUY1 5A7SA 5EV7A 5IAXA 2R061 2BDRA 2VMDA 1RVF2 2R063 2K2SA 1RUD2 3NQHA 4Z82A 1ENQA 3C7HA 4HMZA 1W6NB 2ES3A 2NPIA 1NXD1 3OEBA 3VL9A 2YMZA 4YZ1A 3AB0A 5G04L 5A7PA 4CP9B 2W91A 2LROA 2ZEWA 1GBGA 1RL3A 1I5ZA 4FVVA 2H0VA 4H14A 2O14A 3T4VA 4FPOB 2TNFA 2VO5A 4I0BA 4XJZA 4X8PA 2BWCA 2RJLA 2QQKA 4PF1A 5BV6A 1UXXX 4OI2A 4QQPA 5FCCA 4F7ZA 5LA9A 3ZSMA 2XL7A 2VBBA 3I2KA 2QZ3A 1R092 2E32A 4Y5TA 2DFBA 3LDRA 3N9PA 3SISA 3VBSB 3UJQA 3WP5A 4YW5A 1BBT2 1MS5A 4COUA 3WW2A 4BHPA 3C3VA 2A7AA 2K46A 1OMIA 4NRMA 1XSQA 1ENRA 2BNNA 2B45X 1WA6X 3DECA 4QX7A 3ZYFA 3AYEA 2F6BA 1W0PA 2QBXA 3GALA 5D1IA 3WNMA 3AJYA 1DP0A 5FYIA 1RUG3 2V4VA 5I0TA 1S0DA 2QQOA 2VH9A 5K0UB 3K46A 1ZRIA 3G6JB 5BY5A 3UKNA 4CE8A 1ULGA 4QXCA 5DAXA 1AZDA 1SLCA 3KT1A 5A3LA 3OB8A 4LE3A 5LA0A 3NRUA 4RFRB 5JMOA 5GZEA 3FUOA 2B39A 2DCYA 1J3RA 3AK0A 2ERFA 2WN2A 4Q1PA 2BPA2 2GP5A 1LU1A 1ZBE2 5FY9A 5KBFA 1AYN3 1UIJA 4ZXKA 2BP6A 2DTWA 1US2A 4CXWA 4DMIA 3R4SA 1N3OA 1QU0A 4UW5A 4ISRA 1FNZA 4NHYA 2Q4SA 1JHNA 3VD7A 3LEMA 2VZVA 1XC6A 2GC1A 3PVEA 3MF9A 4D7SA 2ZGSA 4CDUC 4XFHA 3MPPG 2VECA 3ZXLA 1W8WA 5K7PA 3CBNA 2YG0A 4CEWA 1RUI3 2Z42A 5A3TA 3O7OA 1AYM1 1RUE3 4H2AA 2ID4A 3LE0A 5T5LA 4BQ4A 4NJ4A 4OQ8A 4Q8LA 3NJZA 1EV12 1VBB3 1W0NA 2GNMA 5JI7A 4AEDC 1W2NA 2Q30A 5FPXA 1N1TA 2VXJA 1WD4A 4UYBA 3WDXA 5CFDC 1NY72 2VMEA 5L19A 4OI0A 3ZFEC 3TN91 4LBMA 3AXEA 3VDDC 3ZYRA 5JSPA 3TNQA 1WCKA 3HD8B 4AEMA 4WVMA 2D43A 2ZMNA 3JUUA 4LOTA 3RZGA 3AMMA 3DYMA 1B35B 3FBMA 3M3EA 3WF1A 5FQ0A 1LB2A 2DF7A 3KHCA 5J48A 3THTA 1SACA 1UKGA 1K5JA 2RM21 3USSA 2O8OA 3M2MA 1ZYBA 1DQ5A 2RS51 1VALA 4HLTA 2RS53 1QMJA 4DY5A 2P3YA 1Y4WA 2XLAA 3WG1A 3NSTA 1J3PA 5JPNB 2XONA 3VLBB 2ZGMA 2WSUA 3H8UA 1WGPA 5M0TA 4LO8A 4PBPA 5FZ0A 4MG2A 4YSFA 5IW0A 1QDCA 5A80A 1LESA 2AUYA 5JOYA 1RUC3 1W8OA 4Q5OA 3RMXA 5AVPA 2W92A 4O61A 2GAUA 5HV0A 5FP4A 3JCIA 5DQ0A 2RHPA 3RYKA 4K20A 4AHZA 2WAOA 4XILA 1S4CA 1WZXA 1ZRCA 1W8FA 2PHFA 4NR1A 2VZ3A 5L73A 1T6BX 3B93A 1WUVA 4M0NA 2HKXA 1OFNA 5K9YA 3PTYA 1BVVA 1ODNA 2JDYA 3N7KA 3KF5A 5T5PA 1NQDA 4Q0PA 1YJLA 1MEC2 1OXCA 4AF9A 4HBNA 5CYYA 1UYXA 4WM7A 3ZYIB 2CY6A 3ZFEB 1ND3A 3SLIA 4XACA 4NHXA 4EROA 1F35A 2J22A 3VDDB 3L9JT 3SEPA 3DF0A 1Q8VA 3KHBA 4QPIC 3NJYA 2NM1A 1ULPA 4OFGA 3OGVA 3NV1A 2IXIA 4AXOA 4QPGB 2FCTA 3M8LA 1ZZBA 3AX4A 5FK7A 2VW2A 2EAKA 4Y3OA 1JZ6A 3SCGA 4RQPC 4OMDA 5DAVA 2VNVA 1XU1A 4J1WA 2E51A 1CAWA 2VCAA 4AL9A 5FO7B 1SQ4A 5LK5A 1EAH3 5D21A 4FI9A 5A3MA 2EXHA 1KRIA 1OQDA 4CDQB 3IAQA 1ZM1A 2RS33 3ES4A 1WBLA 4NIDA 2WO2A 4YM0A 1H2LA 4E27A 2FDJA 2X5IB 3FC0A 1JYXA 4CUAA 4XQDA 1W2TA 1W6MA 4DXZA 2XJUA 3CO2A 3J8F3 5JOZA 1VBD2 1RB8G 2B5HA 1V6OA 5FWJA 1YQCA 4P14A 1AR93 4AVVA 5FFOC 2BWAA 4Q8KA 2GNBA 5B4XA 1VBC1 5FMBA 2OUJA 2WT0A 1RHI1 3C7FA 5FZ3A 1NE4A 5T5JA 4I0WB 3F2ZA 4W4ZA 4ZU4A 1ZBA3 4QU2A 4A2UA 2DUPA 2P2KA 1A3KA 2G19A 4NWVA 4LO7A 3ZX7A 5JVVA 2FCUA 3JU9A 2B4KA 1JTZX 1XOYA 3AZYA 4EV0A 5K8SA 1H2NA 2ZPXA 4AQSA 2YGLA 2QDRA 4CA9A 5CAZA 3JB8A 1I3HA 4QDQA 4QPIB 4UFIA 3VBFA 2XH6A 4AVSA 3GGLA 4EQVA 5JZGB 4MGTA 5JXGA 4MYEA 2C1FA 1SLLA 3VHPA 1BXHA 2G1MA 1YQ2A 2W9XA 4CPBA 4DRRA 2HWE1 4XDPA 3WVJA 1H2MA 3LIHA 2R7EB 5CIRA 2NMOA 3FBYA 5GLTA 4DUVA 4P08A 5L7OC 1OVSA 3J26N 3EMRA 4PBOA 2IFRA 2ORZA 3BIWE 2VOWA 3MIFA 3LPFA 3KVAA 3K3OA 2D6LX 4PI0A 1W9WA 4XDOA 2WWSA 4M0HA 1STMA 4Q4V1 1LGNA 4AVCA 4RS5C 4GH4A 4Q27A 4YVSA 1CAUA 3PUIA 4D69A 5EZWA 3POBA 1G9DA 1B09A 3ES1A 4URTA 1LOFC 4XIOA 2Y33A 4AGVA 4LA3A 4V2VA 3WP4A 3WQ7A 3UNPA 1IQDC 2G9FA 3I2FA 2ADDA 1X8MA 5IJRA 4BQWA 5A6ZA 4BQ2A 2PAKA 4NROA 4QB2A 4QMAA 1EPWA 1L7LA 3POSA 1LHVA 2X29A 4MV2A 2O0OA 1W6PA 2QKDA 3PL0A 3FFQA 4UFMA 5J1XA 1LOCA 5JDBA 2ZS6B 1D0GA 1SBDA 2W39A 3RZZA 4IGPA 3AJZA 4C1XA 3RWNA 4JGZB 5IFPA 1A8DA 3RS6A 1XB9A 5FUIA 2BU9A 2I45A 1JYCA 2J42A 3EYPA 2WZPP 4RR3C 1AL22 4YGCA 1IPSA 4AQTA 3RMYA 2A6ZA 1BKZA 1JI6A 2Y6GA 3X29B 1HRV2 4HVQA 5IK7A 4QDRA 3UGGA 3EJKA 1QJY3 1RJ8A 3PLQA 3VBHC 4U2AA 2W95A 3CNAA 1IS4A 2E7AA 2VQUA 3BTZA 2JDMA 4AHXA 4DXRA 3TEWA 1PGW1 4UW3A 2WO7A 3WX5A 4QPYA 4ZS3A 1DZRA 2LUWA 1OOPA 2WC2A 4KH9A 4ES8A 3CHXA 4AVTA 2VMFA 5K0UA 4QXBA 4FPJA 3IM0A 3MFCA 2Y64A 5FP9A 2H6BA 3KCXA 1MS8A 1O4TA 2HWC1 4IV3C 3THDA 2JDUA 2HWC3 2XJTA 5FWEA 1NCRA 1REDA 1Y9GA 2VCBA 2PHXA 4GA9A 3ZYGA 3ZFFB 2RJKA 4QQLA 3BTXA 5FZAA 1C28A 1ONAA 3V56A 1LHUA 1WW7A 1YI7A 4NOTA 1V00A 2ZJCA 5C9AC 3ZMNA 3ZR5A 2DV9A 2XHNA 3Q8CA 5A1AA 3MZHA 3ELNA 2OKXA 4EJRA 3NNMA 1GMMA 3RI8A 1QJFA 1Y9QA 1VR3A 1GNYA 4LLFA 3LFIA 2Q8OA 3OY8B 2JENA 1PO11 4JRLA 4ATFA 1RUH3 1RGSA 2K9ZA 3K4AA 1RMU1 2VR4A 3MEPA 3U78A 3VBUC 3POIA 1UZZA 2ZXQA 3MI8A 1D7PM 1UOBA 2WAAA 1R64A 2ADEA 3WF3A 3H9AA 2BW8A 4OYUA 1SEFA 4GWMA 1HDKA 1A34A 2Y34A 1NG0A 4D7TA 4A7ZA 3POGA 3LAGA 3WHTA 1AXKA 3VBHB 3VZJA 5GALA 1HKDA 4QKBA 4KWLA 1FPN1 1G9FA 3VBOA 1FPN3 4Q0QA 5A3PA 2PHRA 2Q8CA 1ENXA 2JG9A 1LGCA 4MGIE 5EP9A 5LBFA 3ECQA 1SLIA 1OFSA 1YQ8A 2VVFA 4FP3A 2O1QA 5LZ6A 4FTSA 5F3CA 1DZTA 1B35A 4AEJA 3LDBA 2A3XA 3TWIA 4N9IA 1RUG2 3HN3A 4XUOA 4WVWA 5EXOA 1WLCA 2OQ7A 1SLAA 1UZVA 1W8TA 3SEEA 5APAA 1OHFA 1XRUA 2QQPA 3WF0A 1I9RA 3CJIC 3WF4A 2ET1A 3ILRA 4AG4A 1URXA 5BYNA 4PJYA 1O3RA 3WDTA 3ITQA 1VP6A 2OX0A 4RYDA 2P3KA 2WT2A 3AKPA 5IUQA 1AYN2 2VCMA 2D6NA 1A78A 3A0NA 3T2OA 4ZU5A 4XUPA 5A3OA 3VDAA
chains in the Genus database with same CATH topology
5LRSA 4FQZA 3VBUB 2P3IA 1CPMA 2XGXA 1DQ4A 3BOPA 1IS3A 1FMD2 1RUI2 3DL3A 1V6NA 4QM8A 2R30A 4GKXA 1RUE2 1TME2 3GBFA 3WW1A 2ZGLA 4JC1A 4LLOA 4L11A 5L36A 4E4DX 2VMGA 1VBB2 2ZAHA 1PGL2 2XHKA 4IQPA 4W65A 4CYDA 4FOYA 4LUKA 1FOD3 1BVP1 4R9DA 2R0HA 3MLJA 1AR73 1A6CA 3LSDA 3V0AA 5J96B 3WNXA 4B4PA 1Z0HA 4N53A 4CEWC 1U5XA 3ILNA 1YUDA 2Z2SB 2WFF3 3QLQA 2OUHA 1F5FA 3VHOA 4NN0A 2Y26A 5AC91 1OA2A 3RRDA 2RS52 4QQ2A 4A3XA 2PLV3 3INAA 4KGGA 4XHBA 1UU6A 2E63A 3FJSA 3ZFGA 5EYYA 3VHNA 1CVNA 2D44A 1J1LA 1K5MA 1RUC2 4KG8A 2R041 2R043 3DGTA 2BFUS 3RQ0A 5DUXA 3IPVA 2ZX4A 3GBWA 3N35A 4GMP0 5CB7A 1ASJ1 2GN7A 2PAMA 2XB6C 1ASJ3 1NA1A 4IXLA 5KHGA 4UXAA 3ZXDA 5C4WA 5GKAC 2CGOA 2ZGKA 3VBRA 4QD2A 4DQAA 2EXIA 1YLLA 5T5OA 1C3HA 1MZ6A 4S2FA 4CEWB 2VNOA 2GSYA 1HX6A 3OBTA 3KS7A 1QHDA 1RIRA 4Q4X1 5KHHA 5IK8A 1W6QB 4YVWA 1Z7S3 3OBRA 1EAH2 3DUIA 4WM7C 4R9CA 1ND3C 1VIWB 3RNSA 1O4YA 2HEWF 3AKRA 1S2BA 1SBEA 4WVMB 1Q8SA 2RS32 2PELA 3UL2A 4BPZA 4CEYA 3NW4A 5FQ0B 3S7IA 2VQ0A 3J8F2 3ME2A 3KGLA 3PNAA 1SCRA 2WIIB 5E16A 2BYVE 4MUVA 2YGMA 1AR92 4XZPA 3KCCA 1PIV1 1ZRRA 1CAXA 2GMMA 2ILMA 1PIV3 4C0BA 1R081 1COV1 4Q0UA 1COV3 4Z92B 4GB33 1V70A 2E53A 1ZBA2 3AP4A 1UKRA 5FBZA 1CQ9A 1OD5A 2GC0A 5EFUA 5F1RA 4HVOA 2PHDA 4JV4A 3ZN4A 1FXZA 4MGKE 3WCSA 3O0VA 1J59A 1NCQC 5BNOA 4PIXA 1NLSA 2VUJA 2P3JA 4FQ4A 3AZZA 1F5JA 4HN1A 4HK9A 4WM7B 5LK7B 1ND3B 1Q8OA 2JG8C 3VBFC 5FO8B 2XUMA 3CEWA 5HI0A 1DQ2A 2R071 5KXEA 2VW0A 2DWRA 3NV3A 2DTYA 3M1HA 1DGWA 4OHVA 2ZMKA 1CAWB 4Z8BA 4XJ8A 3RJRA 4I0AA 1W0OA 5BNNA 2PQQA 3I7DA 4HKWA 4ATEA 2UY9A 4H7MA 1PK6C 4J1XA 4JAAA 3M70A 2B46X 3S7EA 4HVRA 5DDJ3 2WS93 4YVSC 1DF0A 1W6MB 1RUF1 3OCPA 2GMPA 1RUF3 3ZIWA 1YWKA 1ND2C 3MYXA 1DFQA 3FLRA 3I59A 4O9GA 3T2TA 3ZXFA 2CGNA 2JD4A 4FOVA 3WQ0A 4YW2A 5J37A 1APNA 1QNYA 3OJBA 1Q43A 1ZREA 1CAVA 1CESA 4DNYA 1AR61 2DCKA 1QJY2 1AR63 5DG1A 3WUCA 4CDWA 2OVUA 1X7NA 1QJU3 1R1A2 1SFNA 4Q0SA 3LCPA 3MGUA 1VRH3 2HWD3 3KT7A 1POV3 3VBFB 1PGW2 3V65A 1V9U2 3N7MA 4OHXA 3IIAA 4HT1T 2TEPA 1GICA 1O5UA 3E5XA 4MXVA 4YW1A 3TYJA 4BM8A 1SFYA 2WSVA 2FHRA 4AEKA 3VBSC 2HWC2 1X36A 3R4DB 5GZFA 2RS13 1HXS2 1BYHA 4W6WA 4E2GA 3KGZA 1Q3EA 1C57A 3SITA 1FI2A 4DPNA 3GHMA 2BUKA 4RD7A 4FPYA 1D4M2 2CWSA 3RJ2X 4I2OA 4GH4B 4YVSB 1OA4A 1CAUB 5K0UC 1AF9A 3EQEA 5CBLA 2VQAA 4FPLA 1LCLA 2C9AA 3GZTB 1QQP3 1AR81 3VZOA 1RUH2 3AMQA 5CA6A 1AR83 1FT9A 1NCRC 4ONUA 3S30A 5D8AA 2R0FA 1FATA 1H9PA 1FV2A 2G9GA 2JICA 4Y24A 1VAVA 1XNDA 3MF6A 1W6PB 4B4RA 1FPN2 2XWJB 2Z79A 3B9CA 4N43A 4Y5Z0 4OHZA 3FX3A 4LO4B 3IKWA 5I8YA 1O5LA 2PYTA 3M4FA 3AP9A 4QGMA 2GU9A 1UIKA 4YG3A 1HLCA 2A71A 4E2QA 5CG9A 4HETA 4E9KA 2NYYA 2YHJA 4M01A 2ZGUA 5FDBA 1MVQA 4Q4W2 4M3CF 1D4VB 3ZXGA 1V6KA 2MEV1 3B69A 2R6QA 3O0WA 4AI1A 3VBOC 3E5UA 5JSOA 1PVXA 1LHOA 2JG9C 1F8VA 3MW4A 3I2DA 5ABJA 1OOPB 2B42B 4XOGA 2WNUA 3GZAA 1B35C 1PO21 2D6OX 1SDWA 4C0HA 2R1BA 3B00A 2VXRA 1NCRB 3VZNA 2QJVA 2IXJA 4META 4Z07A 3VGIA 2D40A 2D3RA 1QWRA 3SH5A 3RPQA 4TSVA 2IXKA 4FXKB 3S0MA 1JUIA 3WD5A 1YO8A 4KNCA 4W6YA 3M7AA 4XIKA 4J6GA 4XXAA 3TBDA 1FOD2 1X33A 2RMU1 1XE7A 2WQZC 3WINE 1AR72 3JZVA 4CRQA 3MW2A 3NKGA 4IESA 3K51A 4INDA 2ZA9A 1UF2C 1H1MA 4FP2A 4XFBA 1AYM3 1IOAA 1W6QA 2WFF2 4U36A 3POWA 4DY3A 4RHV1 4RHV3 3VKMA 1Q8QA 3JQXA 3FE5A 1FYUA 3VN4A 3VBOB 2PLV2 3TN93 2RE9A 2JG9B 4FPHA 1Q56A 1QOSA 3MIEA 3QH6A 4XQWA 1H8VA 1N1YA 5CADA 4QPGC 3V0BA 4LUMA 3NVCA 2CAUA 2VNGA 5GLUA 4WV8A 5JIUA 1MZEA 1KJLA 2RM23 4O9EA 2MPFA 1MQTA 2HEVF 2XJRA 5SV5A 4MGYE 1YXWA 3OPZA 4JTNA 1LU2A 2BGCA 1N3PA 1UL9A 4CDQC 1KQRA 3GHNA 1UPIA 1OQ1A 4XE9A 1GV9A 1LECA 1KITA 2X5IC 3AP5A 4PLOA 4QQOA 1O3SA 3N7LA 2YUEA 1TNFA 1PZ8A 4FBFA 3IWZA 4XDQA 4XPVA 2TUNA 2AH2A 1I6XA 3OGGA 3KM5A 3EHKA 4IEXA 1LGBA 1VBA1 1XNKA 1VBA3 1KDKA 3HQXA 2LM3A 1S0FA 2A5ZA 1DGLA 5JCTA 4FTBA 4EN9B 1LHWA 4YZ5A 1Z7S2 4BIFA 4KWKA 5CG8A 4LHLA 3T1MA 4MH0E 4BIOA 5JZGC 4EN6B 3V0AB 1DQ1A 2P17A 1AJOA 1CJPA 2XJPA 4Z2WA 1BEV1 4IEQA 1UD1A 4N53B 1BEV3 2DCJA 2FMYA 3E5QA 2UWAA 3JQWA 1QOOA 3QACA 4MZUA 3U11A 4BZ4A 1IKPA 3VKOA 4FO9A 4XHXA 5T54A 1IHMA 3NWKA 3HN1A 2DUQA 3VZLA 3W58A 4YARA 4QQHA 4GB32 3ZFGB 2GN3A 1CPNA 4QGLA 3UV9A 3KLSA 1K5MB 4NWWA 4LO6B 4I3PA 1SBFA 4LHNA 3QD6A 2Z5WA 1I1EA 1IS5A 4YG0A 1C8M2 1AXZA 5DUWA 1VBC3 3IPVB 4C1WA 1RHI3 3MLLA 3E6BA 4KG0A 4PDWA 1NA1B 1AJKA 1G8WA 2AGSA 4LULA 5C4WB 1VLNA 5J36A 1UMZA 4JCKA 2PA7A 4GULA 5I91A 5ACA1 3ASIA 4JGZC 3VBRB 1Y7BA 1FNYA 1QJX2 1F31A 5C8CA 5F5QA 1ZZ7A 3ZPYA 2HWE3 4AI8A 5BNOC 1JYIA 1IS6A 4HPKA 1EYBA 2SLIA 3U10A 4BMBA 3OYWA 4WVZA 1VBE1 4YVWB 2XBO1 2HWF1 3KB5A 2XBO3 2HWF3 2ZZQA 2A6YA 3WUDA 4BLIA 1H4GA 1LOEA 4Q4V3 1H1IA 2EXKA 4XFGA 4AFMA 4LBNA 3LGRA 1YHFA 3P3NA 1YRZA 1JW6A 5JIAA 5DDJ2 2WS92 5FAXA 2OA2A 4CEYB 4UBHA 4IEOA 1GZWA 4PLMA 3DPRA 1RUF2 4OI1A 3B02A 1PMIA 1PVC1 2ZOEB 1KS4A 2R32A 2ZHLA 1PVC3 2JX9A 3N36A 5BPXA 3J4UH 3ZFFC 3E6CC 3VKNA 1G7YA 2VGDA 1CAXB 1HRI1 4JGYA 5J3UA 3D0SA 1HRI3 5BNNC 4GALA 1C5HA 5TSWA 3BU7A 1YIFA 4N90A 2D98A 4YW3A 2PN5A 4OVEA 1QJU2 1KFXL 1X50A 5JMCA 2IXLA 1VRH2 2HWD2 3CF6E 1J1TA 1LOBA 1U12A 4COWA 2BBVA 4LTAA 1QJZA 5T52A 4QX5A 5JR7B 5BNOB 1LJ7A 2OZ6A 4QGNA 4AVBA 4YZ2A 1RC6A 2X53S 2RS12 4XF1A 3JD71 4CDXA 3QOPA 1MR5A 2Q0AA 3AKQA 1QXJA 4R52A 3JBG1 2XVLA 2ZGRA 3JBG3 1YFWA 3O5SA 3VKFC 3E6DA 1QQP2 4HSLA 4KL1A 4M3CA 2ZX0A 1AR82 1MS1A 5FO9B 5KXCA 4HANA 2UWBA 2R062 2BVBA 4B7EA 1IQAA 5BNNB 4XMIA 4FPFA 4D7YA 1IKQA 1OA3A 2CV6A 4Y1UA 3RI9A 3URFA 2DU1A 4XFCA 4AQ6A 4UW6A 1PO13 3WG4A 5AFEA 1RMU3 3I59B 5LEJA 2B7YA 4K8FA 1QGLA 1W2UA 3AYCA 2W52A 5D8AC 1YFXA 4YZ4A 1CAVB 1G9AA 1T6GC 3SCHA 4CDWB 4GWNA 4KBBA 1N3QA 4I01A 2GNTA 5I0SA 4YRDA 2E6VA 2DURA 4N43C 3IBMA 4RA0A 1QY4A 2VOXA 4SLIA 1RVF1 3D82A 1RUD1 3MIDA 3ST7A 3RSJA 3HMYA 3FMGA 4K7JA 3WDUA 3M3IA 3ZN5A 3V64A 1IGOA 1QH6A 1WLDA 4B3NA 5JPNB 4PIZA 1OQEA 1ULCA 3BCWA 4XTPA 4I3GA 4AI2A 1V6MA 4YM3A 3KT4A 1WMFA 3WR0A 2A3YA 1R091 5GLWA 5AFBA 4DB5A 1LOAA 3NV2A 3LOIA 5FRAA 2YV8A 4DS0A 1WCDJ 2WLPA 3AFGA 3GZUC 1BBT1 2ZGTA 3I8TA 2IZWA 1BBT3 4FSJA 2R1DA 4EN0A 3MLKA 1DBNA 1C1LA 1UZYA 1JBCA 5D8AB 2Y0IA 2CYFA 1AYM2 3IT8A 4Y20A 3KMHA 4Q0VA 4UBGA 1TQ5A 2HJIA 2D5FA 4RHV2 2JEMA 4D94A 1DZQA 3THPA 2XKPA 2DU0A 5JOXA 4N43B 3TN92 4CDUA 1HV0A 2H6CA 4Y22A 1E57A 2A70A 1H30A 1RITA 4K21A 4L97A 1ZBE1 1ZBE3 4AEDA 2RM22 4C90A 4A7KA 1O91A 3W9AA 5AC93 5CFDA 2V5YA 5EWSA 5E89A 2CAVA 2EIGA 4AI0A 4AGRA 4FXGB 3SH3A 2YC0A 4FAHA 1C1FA 2ZX3A 3H7JA 5ABJB 5H9RA 2WNUB 1XNCA 2H0BA 4WM8A 2JE7A 4E4SA 4MLOA 1EV11 1S0GA 1EV13 4AGGA 4K40A 1H8TA 5JPMB 3SHRA 1NY71 2W0XA 5F9TA 2ZGOA 2BQPA 2UWCA 2XJQA 1RTVA 1CN1A 3AKSA 2PHUA 1WBFA 2VOKA 5T55A 5FMOL 2I74A 4OI4A 2WT1A 4XQ4A 3PMEA 4B29A 5BXXA 3MDPA 1QKQA 2DVGA 5C6CA 2GALA 3BODA 2YY1A 1AX0A 4BQ1A 5HBAA 2VMHA 1EPZA 1AXYA 4XBLA 1BEV2 3D8CA 1LENA 4Q4X3 4DFSA 3HT2A 4BMEA 1C8NA 2WL1A 1MS4A 4L92A 1JH5A 4H3WA 4LBJA 4GXLA 4PCRA 5AVAA 4CP1A 1QNWA 1WW6A 5B2GB 1Q5OA 3NKTA 3UKVA 3V0BB 3B3QE 3POYA 5I0RA 4ISQA 4RQPA 1MEC1 3P3PA 2P37A 3CJXA 1BZWA 1MQTB 2QUOA 3RYPA 3AMNA 3I54A 2A6XA 2WNVA 4P9JA 5DUVA 1LEMA 1VBC2 1R083 1OPOA 1QDOA 1RHI2 2ET7A 2IC1A 3M3OA 3MIBA 2A6WA 2BNMA 4K6BA 4KU8A 4L2NA 3B01A 4XF3A 5KXDA 3NAPA 2JJ6A 4COYA 1UAIA 4X6QB 3UKTA 2B8MA 2BNOA 2IXCA 4Y26A 1CIWA 4OLLA 4Y1VA 4XF4A 3WP6A 4COVA 1WA4A 1SMVA 2ETEA 3ZXJA 4P9XA 2HWE2 4R9AA 4PDWC 4XW3A 3ZXEA 3NL1A 3LA3A 2UYBA 2ZGPA 4XFAA 1MZ5A 4X8NA 2XBO2 5F6KA 4FAGA 2HWF2 5KHKA 4N7IA 4P9IA 2E7QA 3O14A 4Q4V2 4XEZA 4AHWA 5KWRA 1CGPA 1S55A 1Y43B 2R073 4DOUA 5JLVA 3L2HA 3EBRA 3WG3A 4DZGA 4RGGA 1WW4A 4XETA 4NPRA 5C8CC 5L7OA 4OHWA 2W08A 1PVC2 1TE1B 5HCBA 1DGWX 1CD3G 2I2SA 4IEUA 3N3HA 2YZ4A 1RUOA 1HRI2 4RS5A 3PMSA 1SLBA 2XVGA 4PIYA 4AWDA 5J7MA 4GH4C 4IEZA 5EJ3A 4CTEA 3W59A 5IT6A 1LEDA 5J09A 2B9UA 1KD7A 1OSGA 1VB4A 2VVDA 3SNMA 3IDEA 4JVAA 1BMV1 2DVAA 2JE9A 4PDWB 4JGYC 3L2YA 3TAYA 1KS5A 1DHKB 3M3CA 1VJ2A 3B5LB 5H9SA 2CWMA 3PJQA 4RR3A 3AZVA 4MGZE 5C8CB 5I93A 5BNPA 3DV8A 1KDMA 2XJVA 2A73B 3JBG2 4HPKB 3GYDA 4G4FA 3OYWB 2E9QA 1XXNA 4MSVA 4KGQA 3ZSKA 1YNAA 1J3QA 2GNDA 1OOPC 4EWAA 5CFCA 1AL21 4FPEA 1AL23 1W6OA 1WLTA 2D93A 4LHKA 4IV3A 1HRV1 5KC5A 2PHWA 1PO12 1GZWB 1DIWA 1ZZ6A 3DPRB 1O7FA 3ATGA 1HW5A 4ZKTB 1RMU2 1GZCA 4JDOA 4Y1YA 3KZ4C 4HL0A 5DZGA 5H9QA 4P5HA 4ZU7A 5C9AA 4R4XA 3HIFA 3KQRA 3H1YA 4JGYB 4F83A 5SV8A 2ARBA 3WG2A 4TZDA 1JN2P 3AP7A 4MXWA 2XLFA 4HFSA 3AZXA 5FREA 5DZFA 3R6SA 4YGEA 1DQ6A 1XE8A 3WDYA 1XNBA 2XJSA 4BE3A 2DVDA 2FQPA 1ZZ8A 4HK8A 3ACLA 2C0ZA 3ZYPA 3MIGA 2ZX2A 2OIIA 1HIXA 2MEV3 4ES9A 3N4MA 3E97A 3R05A 1U5ZA 2BVVA 3I4IA 3WOGA 4CDXB 3AXDA 5FPZA 2RR11 3LZZA 2RR13 2NP0A 3AM2A 1PO23 1H0BA 1POV0 4LNVA 3LA2A 2ZACA 2P34A 1WCSA 3FHIB 3CJIA 4NO4A 4S2DA 3WCRA 2ZKNA 1REFA 4M3CB 3SXWA 1AVBA 1ZA4A 3ZVXA 4I30A 1DYKA 2VG9A 1V6IA 2YPJA 2A6VA 4AFDA 3G7DA 2ZHNA 4CZSA 2WA3A 2OYZA 1RUG1 5H9PA 3B9IA 3EXUA 3LA7A 1GNZA 2HYKA 3WV6A 3FZ3A 2RMU3 1RUNA 4F8AA 1NLRA 4FCAA 1HQNA 2PHLA 3T1LA 3H1WA 1GR3A 2ZAAA 3U07A 1LHNA 3GBGA 2ZKLA 3AZWA 4YW4A 1AYN1 5GLZA 4QHBA 2Y38A 2XLGA 5AC92 4AQ2A 1QXPA 1S0CA 2EVXA 5FTTC 2BEOA 5J98B 2WJSA 1WMEA 5HCAA 1MVEA 1O3QA 2SBAA 1X82A 1PM7A 4YFZA 2HEYF 1FMD1 4OUMA 1RUI1 1FMD3 4AI3A 3AYAA 2WZR1 1RUE1 1TME1 4N53C 2WZR3 1FAYA 3ETQA 1TME3 4EWEA 1VBB1 1YCIA 2QFEA 1PGL1 1LODA 5HXVA 2R042 4OHYA 2D6PA 3BALA 2CTVA 1XYNA 4LBQA 2NMNA 1MACA 3ZXAC 1S0EA 1YJKA 1GZ9A 1CJDA 1ASJ2 1O3TA 4YM2A 1OI6A 1VAKA 3ZFGC 3RG0A 4XXPA 1XQNA 4HKOA 3OD4A 1K5MC 4WM8C 3MICA 4MX3A 2D3PA 4N9HA 1BK1A 3BPZA 1PNGA 3R4UA 3WQ1A 2EXJA 5I8SA 1ALYA 1AHSA 4BCUA 4B7KA 1H8TC 4GIQA 4G3YC 5JAXA 4M3CE 4YFWA 4AFAA 4GKYA 5A32A 4BA6A 4L99A 4DINB 3OGJA 2G4IA 1NA1C 4Q4X2 4Y20B 2IWGB 1RUC1 1F9KA 3M3QA 5C4WC 2PFWA 4IV1A 1OPMA 2ZTNA 1ZNPA 4FT8A 3OF1A 4CDUB 3VBRC 4Q4Y1 3H0OA 4Y22B 1WD3A 4ORFA 4OUSA 4Q4Y3 2YROA 3ENRA 4LBOA 3TNPB 1QXRA 1AUYA 1UW8A 4IL7A 4MVTA 4XTMA 2XWBB 1DDLA 3USUA 2V73A 4AEDB 4R4ZA 5A33A 3TRSB 4YVWC 3H7YA 5EYXA 5CFDB 2AENA 5IK4A 1G9BA 1PIV2 2QNKA 2Q1MA 1WLWA 2AREA 1LULA 1FV3A 1R082 1COV2 2ZCWA 5JWPA 3A0KA 1DGRA 4BWOA 3WW3A 4IEPA 4YG6A 4KQ7A 4K9SA 4QXKA 4WM8B 1S1AA 3ROUA 4BLJA 4CEYC 4WZFA 1GNHA 3MPBA 3AP6A 2VW1A 2ZABA 4XJ9A 4YYOA 4ASLA 3ZSJA 1VB2A 2VU9A 2WINB 2XL9A 1H8TB 1EAH1 1OKQA 2JXAA 4YGBA 1MS9A 4XJAA 4Q2FA 2WNVC 5K8SA 5GZCA 3NO8A 4COZA