1LEDA

Structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
243
Chain Sequence
ENTVNFTYPDFWSYSLKNGTEITFLGDATRIPGALQLTKTDANGNPVRSSAGQASYSEPVFLWDSTGKAASFYTSFTFLLKNYGAPTADGLAFFLAPVDSSVKDYGGFLGLFRHETAADPSKNQVVAVEFDTWINKDWNDPPYPHIGIDVNSIVSVATTRWENDDAYGSSIATAHITYDARSKILTVLLSYEHGRDYILSHVVDLAKVLPQKVRIGFSAGVGYDEVTYILSWHFFSTLDGTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the lectin IV of Griffonia simplicifolia and its complex with the Lewis b human blood group determinant at 2.0 A resolution.
pubmed doi rcsb
source organism Griffonia simplicifolia
molecule tags Lectin
molecule keywords WEST-CENTRAL AFRICAN LEGUME LECTIN IV
total genus 58
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ledA00
3USUA 5GZFA 5GALA 3WG2A 1QMJA 1UN1A 1JN2P 2ZKNA 1CIWA 2EXHA 5CB7A 2CWMA 4FPFA 4YW2A 3IPVB 4GALA 4RA0A 1YXWA 3U4XA 4XMAA 1DYKA 1CPMA 1W6PB 1CVNA 3AP9A 1QOTA 3L2YA 2OVUA 3WDXA 3D6EA 5FREA 1LU2A 5DUWA 4DS0A 3AX4A 4M3CF 4XOGA 4P9YA 4GXLA 2E51A 4BQ1A 1AXYA 1W6QB 2D44A 2EXIA 1G9DA 4Y1ZA 2ZHNA 1B09A 1N1SA 1Q8PA 1DBNA 4HANA 2ZGSA 1CPNA 3O0WA 1QDOA 1D0HA 1UL9A 2WSVA 5T55A 5KXBA 3IN9A 5E8AA 1HDKA 1LOEA 3ILRA 4YZ1A 5T52A 2A5ZA 3NWKA 4M3CA 3SH4A 1APNA 2YXSA 1DGLA 2ES3A 1TEIA 3R05A 2EAKA 4Y22A 4AYUA 4BLJA 2EF6A 3MPPG 2ZBJA 3PVEA 1KJLA 3SNMA 2ZACA 4UW4A 1KITA 1XQNA 4P9WA 4GKYA 2NMNA 1BYHA 3WDYA 1N1VA 1W6MA 2W52A 5F9TA 1N1YA 4YG0A 1LECA 4FPKA 2C5DA 4XMIA 3PVOA 1YI7A 2WQZC 4I30A 3V0BA 3MW2A 2VH9A 3C2UA 3DGTA 5BYNA 4FPGA 4AGVA 4AVVA 1F5FA 1WW6A 2EXKA 2RHPA 4PCRA 5GZDA 1G7YA 1I1EA 1LOFC 4K1ZA 2DURA 4XJ9A 5IT6A 1C1FA 3ZXKA 2CNAA 3VKFC 2R1DA 3AZVA 2ZGPA 3UJQA 2DU1A 2A75A 1VAVA 4AGRA 4H55A 3OJBA 1SLTA 2NMOA 2FHRA 2DTYA 1W6QA 1Z0HA 1DYPA 4LBLA 2DUPA 1GBGA 1LGBA 1GICA 2R16A 2ZA9A 1JHNA 4YZ2A 1ULDA 1WLWA 2WSUA 3B3QE 2VXRA 1W6NA 3AYAA 1NXD1 1U0AA 3ZXJA 4FOYA 1LHOA 2EIGA 3RQ0A 1IS3A 4YG6A 2FMDA 1G8WA 3AP7A 4M3CB 5GLZA 3B69A 4Q26A 1W0OA 4ISRA 2W39A 1X50A 4U36A 1LHVA 4GWMA 1QF3A 2UWAA 1V6OA 3IPVA 3NV2A 3GNEA 2AR6A 2LTNA 3FUOA 1LOFA 1SBDA 4Y1YA 2GNBA 1LGNA 4XJWA 3I4IA 1GLHA 1LOBA 4ASMB 1HKDA 2D43A 1JBCA 1SLIA 2ERFA 4FOVA 2GMMA 4SLIA 5IK8A 5HCBA 1W6NB 4CRQA 4XJZA 3POSA 1LEMA 3OBRA 3M3OA 3WDTA 1SCRA 1RIRA 3SISA 4YZ4A 3OPZA 2NM1A 3LSDA 5JOWA 4R9DA 2W68A 1Y7BA 3PJQA 2AUYA 5HCAA 2P2KA 3HMYA 1UKGA 3POWA 4XHXA 4JRAA 2WJSA 3N7KA 3WNXA 5GZEA 1MS9A 1BZWA 2ZABA 1WLCA 2NYYA 2AH2A 3OBTA 1UX6A 1SACA 2CY6A 1WUVA 2VW1A 3AJZA 1O4YA 2DUOA 2W08A 1CJPA 1GKBA 3ATGA 3ASIA 1NLSA 2GN3A 1UPSA 1SLCA 3B00A 4K20A 4XILA 3AFKA 5DZFA 3V64A 1YO8A 3WOGA 4BM8A 5EYYA 4R9AA 2ZGQA 4M01A 1AJKA 1QOSA 3H0OA 2SLIA 4Q1RA 3BOPA 2P3KA 4MYEA 4UW6A 1FV3A 4K21A 4FPOB 1LHUA 1Q8OA 2ZGTA 3RMYA 4AVTA 3UK9A 3N7MA 5KXEA 1W0PA 3V65A 5GLVA 4XBLA 1S0JA 5KXCA 4XIOA 1R1ZA 4XDQA 5JVVA 4WVWA 1AX2A 4XHBA 1ENQA 5EYXA 1IKQA 1MZ5A 2OW4A 3IM0A 3MW4A 1VALA 1AXZA 3WG1A 1ULGA 2PHTA 4L8QA 4YFZA 2BQPA 1S1AA 2D3SA 1YIFA 3T2TA 1Q8VA 4YGDA 2DVBA 2JJ6A 2YZ4A 3ENRA 4WZFA 4XE9A 2CWSA 4BOWA 4Y22B 1QNYA 5DUVA 4TZDA 3WG3A 1WBLA 1G9AA 2KM2A 4RL7A 4OZXA 1F31A 5GLTA 3M3CA 1DZQA 4FP2A 3WG4A 4YGBA 4DFSA 2E53A 1A8DA 1DQ4A 4HL0A 2PHWA 4LBQD 1VAMA 3UJOA 3V0BB 1BQPA 1ZA4A 4ISQA 3WUCA 5JOZA 2A3XA 1DIWA 2D6MA 2R0FA 4CTEA 4AGGA 5FRAA 3RS6A 4KBBA 1IS6A 1V6JA 1N47A 4YFWA 1Q8SA 1V6NA 1V6IA 1A3KA 1OFSA 3PMEA 1W6OA 2XG3A 4YW4A 1WBFA 1LCLA 1MS8A 4Y1UA 2ARBA 1S0CA 4ZKTB 5CAZA 2A6WA 2A3WA 3VUOA 2ZHKA 4FPEA 1UZZA 1N3QA 1DFQA 2YROA 4FP3A 1S0GA 2D6OX 1IKPA 1JOJA 2GMEA 1CR7A 3HN1A 5LK5A 4Q2FA 1LOGA 1N1TA 1UZYA 3O12A 4PBOA 2P37A 4XTMA 3AYEA 5JOXA 4FQ4A 2ZGUA 4F83A 2NP0A 2WNEA 1LHWA 2OUHA 1AF9A 4Q27A 5HCFA 1HQWA 5JOYA 1MS1A 1SCSA 2E7QA 2Q5TA 1PZ7A 2WKKA 3B01A 2UWCA 3LSEA 3OGGA 4LBJA 3RG0A 1KQRA 3RRDA 3AXDA 4JCKA 4Y1XA 1N3PA 2E6VA 1RINA 4Y20A 1DQ0A 1OQ1A 2V73A 5T5LA 3ZYPA 1AVBA 4XYXA 4Z8BA 1LOAA 3BODA 1MS0A 3KQRA 3POYA 1KRIA 1H9PA 1ENRA 4LBKA 2YMZA 1KJRA 3VKNA 3AXEA 1HLCA 5IK5A 2ZGRA 4YZ5A 4BMEA 1DLLA 1S0BA 1GZWA 1G9FA 2SBAA 3R4UA 4YG3A 3W59A 4C1WA 1FX5A 3WCSA 4FVVA 2CL2A 5DG2A 4Q8LA 5IUQA 1GNHA 2E7TA 1JUIA 1AX1A 4YM0A 2GNTA 4ZXKA 1DHKB 1DQ5A 1IOAA 3OYWA 5GZGA 1I3HA 2D3PA 1FV2A 1QGLA 2G4IA 4DRVA 2ZMKA 2D6NA 2VW2A 4FPHA 3FUQA 3QLQA 5T50A 3RMXA 1URXA 4YLZA 1CESA 1WD3A 3WUDA 4YGCA 1FNZA 2ZMNA 2A71A 1LOCA 1LJ7A 1N3OA 5CNAA 1H30A 4LBQB 1SLBA 1WCSA 2CTVA 4GA9A 1FYUA 2ZGNA 3N35A 5CBLA 2P34A 2AENA 3GALA 1JXNA 4YW3A 2EALA 2ZMLA 3SH5A 1VLNA 2HYKA 3SLIA 3KM5A 2VW0A 3WHUA 4P14A 1MVEA 3JU9A 1LULA 1D2SA 1FNYA 4M00A 1S0EA 3W58A 3WDWA 3ILNA 2DUQA 1A78A 3APBA 4DQAA 3AJYA 1VIWB 2ZHMA 4LBQA 4XTPA 4LBNA 1MS4A 5T54A 1SBFA 1AXKA 2ZZJA 1DQ6A 1MVQA 1GV9A 1EPWA 5AVAA 1S0IA 1WD4A 2VUAA 1W6MB 4JC1A 3ZXLA 1GZCA 2P3IA 3AZZA 3N36A 1BKZA 4PF5A 3WVJA 2JE7A 3IMNA 3TB0A 1AZDA 2JECA 3OY8B 4PQ9A 4ATFA 5JDBA 1GZ9A 2PHFA 2UU8A 1MZ6A 1UAIA 3B9CA 3FFZA 4W65A 5DUUA 5EWSA 3WLUA 3T1LA 1LTEA 3M2MA 1GSLA 4Y24A 3V0AB 1ENSA 2JE9A 2VY0A 1ZM1A 5GLUA 3FLPA 4GKXA 4FOWA 4XBQA 5IK4A 1RITA 2YY1A 3AP6A 4U2AA 4TYSA 1WW4A 2DVAA 2R0HA 1HQLA 5GM0A 1F9KA 3ZSMA 2ENRA 4Q8KA 3WHTA 1AJOA 3AZXA 3BTAA 3BIWE 1BJQA 3IKWA 3M1HA 3D4KA 3D5OA 1LENA 4LBMA 1BXHA 4BPZA 2A3YA 1V6KA 3AYCA 1PZ9A 2TEPA 1PZ8A 1FATA 2D6PA 1LGCA 2VU9A 3OY8A 4XBNA 5GJ6A 4R9BA 4YM3A 3V0AA 4BMBA 5IK7A 1WW7A 1WW5A 3NV4A 5CA6A 5JLVA 1ULCA 4NOTA 3WDVA 4Q1PA 5DZEA 2DV9A 1C57A 2EXJA 2DVFA 4UW3A 4YW1A 2PHUA 2ZAAA 2ZGLA 5H9QA 4DPNA 1MS3A 1QU0A 4NO4A 1MS5A 1Q56A 5T5OA 4AVSA 2DTWA 4DRRA 3WCRA 3T1MA 2D6KA 2B7YA 1UMZA 3I8TA 2I2SA 3AYDA 3AZWA 3ILFA 3M3QA 4LBOA 4BLIA 1CN1A 5KXDA 5H9SA 3ZXEA 1G86A 2PHXA 5E89A 2A6VA 2A70A 1SBEA 5DXDA 2OUJA 4FOQA 1CQ9A 2D3RA 3VKMA 2ZGMA 1H9WA 1G9CA 1KDMA 4ATEA 5GZCA 4UW5A 5L73A 2WT2A 3FLRA 3PVNA 3ZSLA 1J1TA 3NV3A 1QDCA 4IQPA 1JYIA 1AX0A 2AGSA 3R4SA 3UL2A 1DQ2A 1JW6A 2D7FA 2YV8A 1QNWA 3OYWB 4FPLA 5F5QA 3ZSJA 3ZYRA 3ZXFA 1GANA 3O0VA 4XXPA 1IS5A 3DUIA 3O5SA 4WV8A 1S0FA 1YYNA 2V5YA 2JDZA 3INAA 1ULEA 3LCPA 3A4UA 3O0XA 4WVVA 3SH3A 1IS4A 2A7AA 3MW3A 2DU0A 4R9CA 4YGEA 1MR5A 2DVDA 2GALA 3FLTA 3A0NA 2ZGKA 4K1YA 3SITA 2H0BA 1ULFA 1LHNA 1LESA 2GNMA 4XJUA 2PELA 1KDKA 1LU1A 2Z42A 1OKQA 3WV6A 4YM1A 1LODA 2A6ZA 1Q8QA 2WT1A 4FQZA 2AREA 4FPYA 3WZ1A 4YM2A 2R49A 1GNZA 5DUXA 5H9PA 4FPJA 2CYFA 4Y26A 3N7JA 3Q9OA 2AYHA 3VV1A 3AP4A 4XZPA 3ZPYA 2NZ9A 1SFYA 4P9XA 2GMPA 4XIKA 1O4ZA 3WDUA 3AP5A 1CONA 3AZYA 1YRZA 3RSJA 2A6XA 4FPCA 4D69A 2LALA 2GDFA 3AK0A 4Y20B 1QKQA 5EXOA 3ZVXA 5GLWA 3M3EA 3FBYA 2P3JA 2A6YA 2R1BA 2DYCA 1Z78A 4XJAA 5H9RA 3ZSKA 1W6PA 2NN8A 3N7LA 2XB6C 2DWRA 5T5JA 4AWDA 2UWBA 5DZGA 3QCWA 3NV1A 5T5PA 3USUB 1V6MA 2GNDA 5DG1A 1DQ1A 2JD4A 2DVGA 4M3CE 2ARXA 2PHRA 3VKLA 2D6LX 1C1LA 4CZSA 2WLQA 4XXAA 1GYKA 1JYCA 4PBPA 1QOOA 2WT0A 1V6LA 1V00A 3MEPA 1LEDA 1S0DA 4GWNA 1SLAA 5E88A 2UURA 5SV8A 1C4RA 3N3HA 1W6OB 3JUUA 2GN7A 2JKBA 4C1XA 3VKOA 1SLLA 1FAYA 2ZHLA 3TAYA 3HR9A 1ONAA 1WLDA 1G9BA 2ZGOA 1MACA 4Y1VA 2C9AA 4YW5A 4ITCA 5JMCA 1GZWB 4YZ3A 3CNAA 3A0KA 4XJ8A
chains in the Genus database with same CATH superfamily
4IE4A 5GZFA 4N53B 4XCBA 2BVBA 3EQEA 1OA2A 2ZKNA 5FYSA 4A6SA 1UYXA 5FLIA 3ZYBA 4ZZ5A 1KD7A 4RN5A 3T0DA 2Z5WA 4Q5OA 1CPMA 1DF0A 1W6PB 1PM7A 2OVUA 2PLV1 4IETA 4N90A 2FCVA 4SBVA 5KWRA 1QH7A 1ZZ6A 3HT2A 3OGRA 4NIIA 4M3CF 1PK6C 4P9YA 4GH4A 2WNVB 4GXLA 4BQ1A 5BNPC 5I0SA 5FZ8A 1N1SA 1JYWA 5FBZA 1VBD3 2ZGSA 2VNVA 1I5PA 1WCQA 4LUKA 5FTTC 3CJIC 3USSA 4Z2AA 3NL1A 5KXBA 4MHRA 2UY8A 5BNOA 2LM3A 3IN9A 1BBT2 2JG8A 5LRRA 5E8AA 4AQ6A 1HDKA 5CFCB 1BEV1 1QJX3 5BV6A 4RS5A 1NOVA 3SH4A 1APNA 2YXSA 4EN7B 1WA4A 4EJRA 5D2AA 1R64A 3LKJA 4HFSA 4XDOA 1R082 2J1SA 3AMHA 5FMCA 4Y22A 4DMIA 3IDBB 5FZLA 4INDA 2ZBJA 2BBAA 1XNAA 3ZN6B 3WNKA 1ZYBA 4LA2A 2HWC3 2ID4A 3MYXA 3ZDSA 2Y6KA 1RB8G 1AR72 4A7ZA 2W1SA 3H3LA 2C5DA 4CVUA 1PIV1 4XMIA 2DCTA 4KU7A 2R043 1CAUA 1W8WA 1BBT1 2WQZC 3E5XA 4PDWA 4BZ4A 2VH9A 2Y0IA 3V0BA 1BMV1 3MHZA 4AGVA 1NE4A 2RHPA 4PCRA 4CA9A 1G7YA 1I1EA 4K1ZA 1W03A 4XJ9A 1QJU2 1COV1 3N9QA 3SEEA 5DQ0A 3K3OA 4BDVB 4A3ZA 4PIXA 1ND2B 2AEZA 2A75A 3WF1A 4EV0A 4QDSA 1VAVA 1SLTA 2DFCA 5A7NA 4CCKA 2FHRA 3LPGA 2HJIA 2DTYA 2VGDA 1H8TA 1Z0HA 2C24A 2X10A 2XQXA 3CU7A 4MGZE 1BBT3 2ZA9A 3PHMA 4WM7A 4QX1A 5LEJA 3AKRA 1ULDA 1NXD1 1U0AA 1QWRA 4UOJA 3VDDA 5IAXA 2QQVA 1OF4A 4KBZA 3ZLIA 5FOBB 4YG6A 2RM22 4M3CB 4CCLA 1QY4A 4AL9A 4OMDA 4ISRA 2P3YA 1X50A 4DXTA 4OQ8A 4U36A 1LHVA 4GWMA 2UWAA 4XFGA 3IPVA 2E63A 5A7QA 5F6LB 1L7QA 2OPWA 3X29B 1NCRB 2JDUA 2H0VA 3FUOA 2J1AA 2VQ0A 4HK9A 4F3JA 4D94A 1XE7A 4QQOA 2MEV3 1JYVA 1DGRN 5F2WA 1LGNA 4XJWA 3O14A 5ANQA 1VBD1 3I4IA 1GLHA 4ASMB 2XR4A 4XACA 4SLIA 4AXOA 1F2NA 4CRQA 2W5FA 2FDJA 3WW1A 3M3OA 3SISA 3PU3A 2OQ6A 5LEKA 2QQOA 1NKGA 1XE0A 3ZN4A 2WFF2 1CX4A 5C8CC 3OSDA 3RPQA 1RUD3 1EPZA 3PIGA 1UYYA 2JXAA 3GGLA 4P5YA 3PJQA 4XQWA 2XL9A 3BYWA 2P2KA 1UPIA 3ZO0B 4CDUC 4WM8B 1UKGA 3POWA 4XHXA 4XAAA 3VZJA 2EIEA 1LR5A 3WNXA 3ZFEB 1FMD3 1MS9A 5IVEA 2W87A 2A1XA 3KLSA 1JOPA 5I8TA 2YB7A 1SACA 1GQHA 2VW1A 1HB3A 1O4YA 5FLJA 3ATGA 3ASIA 3B00A 4OQ9A 3VZOA 1SZBA 3V64A 3KQ4B 4K7JA 1PHMA 2TUNA 5ACA1 1BVP1 4GAZA 2QTWB 2C6SA 1O6UA 4NHLA 1MZEA 1TME1 5LBCA 4EN0A 1Q43A 1AJKA 1STMA 3AMMA 5CNAA 3OB8A 1PVC3 2P3KA 4N9HA 1HN0A 3OUJA 5FZOA 1ZREA 3NNMA 1NCQA 1Q8OA 4AVTA 4FFHA 1BEV3 1QJX1 2MEV1 2MEV2 2Y6JA 3WP5A 4GZ9A 4N43A 4LIUA 4CU9A 4BWOA 5GLVA 4AFDA 1YQCA 2WQ8A 2IXKA 5JWPA 1PNFA 1SFPA 2PQSA 4W6WA 3SCHA 1R1ZA 3OPTA 5JVVA 3WD5A 4WVWA 4ZS3A 3ZXDA 3RI9A 2W1UA 4AFBA 1ENQA 2G9GA 5EYXA 2FDGA 1MEC3 2CDPA 1REDA 3MW4A 5LBFA 2R061 1ULGA 2ZAHA 5E6HA 1Q8VA 4YGDA 2JJ6A 5FYTA 2VVFA 1AR83 1BMV2 4WZFA 2RV9A 3FBMA 4BOWA 1QNYA 1AR71 1XNDA 3WG3A 4IE6A 4RL7A 1IHMA 1F31A 1FI2A 5DDJ3 4XF1A 1ND3A 1AR63 5FK7A 1LAJA 2WABA 3N9NA 4B7KA 1UW8A 1P8JA 4LBQD 1VAMA 3UJOA 5DAQA 4L11A 1BQPA 4AEKA 2D93A 1DGRA 3RZLA 1DIWA 4UFLA 5FMBA 4HK8A 1OKOA 4O65A 4AGGA 1VRH3 4LK6A 2XVKA 3RS6A 4QU2A 1NYWA 3URFA 1V6JA 1N47A 2XBO2 4W4ZA 4YWAA 3SKJE 1V6IA 3SKVA 3QH6A 3LA2A 1RC6A 1COV2 3BTZA 1WBFA 1YHFA 2J1TA 4YPJA 1S0CA 5CAZA 1W3VA 2OZJA 3M70A 4D0QA 4HKWA 4OHYA 1J58A 4TWTA 5K0UC 2VZVA 1OA3A 3VBHA 5FJKA 4FP3A 3B7MA 5FXXA 5GKAC 5A3WA 1O3RA 2D6OX 1G6NA 3NAPB 4Q4W3 3KHCA 3BTXA 3ST7A 4BIFA 2GMEA 3HN1A 2WQ4A 2XBO1 4XFBA 2FZ2A 4PBOA 4GD4A 3H7JA 4R4ZA 5IW0A 4XTMA 1X8EA 4HKOA 2W3JA 4RFT0 5JOXA 4JV4A 2WA4A 4OHWA 3T4VA 3LA3A 4F83A 4QWNA 2OUHA 2VMEA 4Z07A 3MLLA 3D0JA 3P1IA 4IGPA 4QQHA 3KT7A 5FPVA 5CFCC 4CXWA 4LBJA 4RQPC 1PZ7A 2BP6A 2UWCA 1XNKA 3VLBB 2JX9A 4FTEA 4JCKA 5DN2A 3F95A 3J7HA 5CFDB 2RS32 2XWJB 1KS5A 1XRUA 3B9IA 2V73A 3OOXA 1Y43B 4OHXA 3I2JA 4XYXA 1HJGA 2W2IA 3KQRA 1RUE3 1H9PA 1ENRA 1VE0A 4IERA 2YMZA 4MVTA 4PJYA 1GWMA 4Y5TA 1YFWA 2IXIA 3BPZA 3VKNA 2D97A 3DYMA 4IEVA 3S30A 3K4DA 1H2LA 3CMGA 4W8JA 4Y4YA 4HVOA 4O7XA 4PF1A 1RUJ1 1PX3A 5CKQA 5E1RA 3WCSA 2XJVA 4FVVA 3IT8A 4Q8LA 1M4WA 3J7NA 1GNHA 1JUIA 3SXWA 5FFOC 4ZS2A 4FSJA 4OVEA 1TMF2 1OHFA 3UKTA 2GNTA 1IOAA 4I3PA 2QQJA 3IDCB 1CAWA 1F4HA 3J7MA 4DRVA 1AYM1 2ZMKA 5IVYA 4CP0A 2D6NA 4FPHA 4EYUA 5LA1A 2QQMA 3RMXA 1VBB1 3SMHA 1RUC1 2VTFA 4YLZA 2OKXA 1CESA 3RJ2X 1WD3A 4Q0QA 1FNZA 4K9SA 2CV6A 1V9U2 5JI9A 1GFF2 1GWLA 1N3OA 1H30A 2WNVA 2DCJA 1LKNA 3DPRC 4KGQA 4WM8C 4JGYA 1WCSA 4KL1A 5HV0A 2ZGNA 2W46A 5JXHA 3DKQA 3GALA 3IZOA 3LIGA 4EWDA 2RS51 2ZMLA 4MGIE 1W8HA 1AR91 2VW0A 5FPLA 4FAHA 4UFMA 2OZ6A 4XUOA 3GF6A 2FBEA 3JU9A 3FFQA 3TNPB 4XZUG 1YI9A 4HVQA 5B4XA 1VR3A 2ZX1A 1OOPA 1S0EA 1TME2 2ORXA 3ILNA 1A78A 1YQ2A 3I2HA 1UIJA 2VZTA 1VIWB 4DUWA 1WGPA 2JIGA 1NA1A 5C5UA 5I93A 1MS4A 1ZZ9A 1EAH3 1GV9A 5F3IA 1O7FA 4ONUA 2VMGA 1S0IA 1PX4A 5AVAA 5FMOS 5A7SA 5KHIA 3THPA 4JC1A 1OD3A 4E8CA 4AQTA 2WWUA 1NX9A 1GZCA 2VULA 4I02A 3HQXA 2YPDA 1O59A 2XVLA 4QAWA 4XABA 3WVJA 2JE7A 1AZDA 3FZ3A 4MH0E 3VZKA 5A7PA 1O8SA 2E9QA 4KH9A 2PHFA 4LKEA 4LO5B 1DCSA 1MZ6A 1UAIA 1U5IA 4BYYA 5FQ0B 4LHSA 3WLUA 1X9PA 1DYOA 4BQYA 2JICA 2X5IC 3ITQA 3HVDA 4LE3A 2RM23 1ENSA 2JG9A 2JE9A 1ZM1A 4XBQA 4FOWA 3LQCA 2HWB3 2YY1A 3AP6A 1HIXA 1Y3TA 1WW4A 2DVAA 2XL7A 4LOTA 4NMIA 5FY7A 5GM0A 5A3MA 4D6SA 1PVC1 4KNCA 3H8XA 4QM9A 1RUD2 2ET1A 3VL8A 1YEWA 5LY2A 1XSRA 3D5OA 1TME3 3PTYA 4CPBD 3KV9A 3FWEA 3E6BA 2V09A 5I0RA 3AYCA 4YRDA 4N7UA 4LXLA 1XOYA 4QPGC 1QJU1 1ZBA3 2OA2A 4R9BA 3R6SA 4E2QA 4YM3A 3S0MA 2DBNA 1WW5A 5D8AB 5CA6A 3NNLA 3WDVA 1VMHA 2Q1ZB 5JXIA 1EUTA 1XYPA 3TEXA 5BPXA 1GP6A 4UFJA 5F1RA 2VCCA 5FY0A 4CXYA 2VQAA 4YW1A 2J1VA 3IBMA 4EZ4A 5IVBA 1O4TA 2GP3A 2YC2A 4AAXA 1S2EA 5JZGA 5L36A 5JPNB 1UQXA 4DPNA 1QU0A 2WAOA 1VBA1 2I45A 2VZSA 5F5IA 2Q8OA 1CAVB 2J7MA 2K2SA 3UETA 1OPMA 1H2NA 5FYVA 5TSWA 2VZPA 4FFGA 2AC1A 1R083 1EV12 3ROUA 1QXPA 1ZZ8A 2ZEYA 3ILFA 2TNFA 3M3QA 2VR4A 4KG0A 4CCNA 3TEYA 1PK6B 2ET7A 3AFGA 4P9JA 1G86A 5E89A 2A6VA 4D7YA 2XKPA 5DXDA 4HVRA 3PMSA 1H6XA 2BGOA 2OUJA 1CQ9A 2QE3A 4JDOA 1O5UA 3UYJA 2DDUA 3V56A 4LLFA 2IWGB 3T30A 4IQPA 2LS6A 2GC1A 5I0UA 2B9UA 2BYVE 1OPOA 1PGL1 1C8M1 1L7RA 4IV3B 4Q4X2 3ZSJA 3DXUA 4NAMA 3LDRA 3AKPA 1AR62 1YYNA 4WVVA 2V5YA 2RS52 1OI6A 3LCPA 4JQRA 3A4UA 2A7AA 2J1RA 4I0AA 3TOJA 3I2OA 1W2NA 2HWD1 1BCXA 2PN5A 4NWWA 3VHRA 4B8EA 3KT1A 2VAUA 2H0BA 1T2XA 3S5AA 4XJUA 1KDKA 1LU1A 3ES4A 1J84A 5L9BA 3D8CA 2A6ZA 1Q8QA 5ERLA 3WY6A 4BJ0A 5FPBA 3JQXA 4PI0A 5I91A 5DUXA 1GNZA 1K42A 2JDAA 2XHKA 3GM8A 2R041 4PIYA 4Y26A 4N7IA 2AYHA 1PIV3 1NG0A 3Q8AA 5A1LA 4EN9B 2EA7A 2GMPA 1GMMA 2R7EB 1D4M3 1PM4A 3LPFA 3VBRB 5A3NA 1YRZA 5ABJB 4FPCA 5FZ6A 2BU9A 3I3BA 5EIYB 3IIAA 1H2KA 3M3EA 4GQ7A 4YVWB 1IGOA 4RFRB 2DYCA 1V9U1 1F4AA 1NLQA 2Y26A 4HOOA 5H9RA 3RYPA 3RZHA 1SFNA 1YFYA 4LEJA 3VL9A 1WMDA 3PTRB 2AACA 4GMP1 4A7YA 2XLAA 3NV1A 4W6YA 5T5PA 1EP0A 1YWKA 1DQ1A 2GNDA 2Q1MA 4QXKA 1OH4A 1OH3A 3AL5A 3LEMA 2ARXA 2PHRA 5L9VA 4YNIA 4CZSA 3RZKA 3KF5A 3LGRA 4PBPA 1HV1A 1LEDA 2YHJA 1SLAA 5E88A 2UURA 1UY4A 4QDRA 2VG9A 2ZX3A 3OUIA 2IVIB 3L9JT 5L7OC 3TAYA 3HR9A 1ZBE1 1ZBE2 3TBDA 5FZDA 5FKCA 4E4DX 1JH5A 1R092 3OD4A 1VAKA 3JXSA 4RS5B 3ZKYA 4JDNA 1RMU2 5JMCA 1RUOA 3A0KA 4G9SB 4XJ8A 1D2QA 5GALA 1FOD3 1CAXA 1JN2P 3OTFA 4OI2A 4YW2A 1BEV2 1J83A 3WR0A 3U4XA 1YXWA 4PLOA 3CL1A 3QD6A 1DYKA 4XMAA 5FXVA 1CVNA 3AP9A 1O3SA 3D6EA 3PUSA 4Y5SA 5FREA 1LU2A 3JCIA 5DUWA 4C0BA 2JD9A 4CEWA 4EN8B 4HONA 1W6QB 3MLKA 4CUAA 1HXS3 5J96B 1G9DA 4Y1ZA 4B3NA 4CP9A 3ZYGA 1ZX5A 1Q8PA 1DBNA 2KD7A 2JDKA 1CPNA 4AG4A 4C91A 2VCMA 3E97A 2VQUA 1AL22 3F2ZA 3HT1A 2G9FA 2RM21 5BXXA 1RXGA 3ILRA 4YZ1A 1UYPA 2A5ZA 3T4HB 1KS4A 4FCAA 2IVJA 4WZCA 4XFFA 5SV5A 1H2MA 2ZX0A 1DGLA 1O5LA 2C26A 2EF6A 1OF3A 5IWFA 4OFGA 4QHBA 5FP8A 1KJLA 4DUVA 4UW4A 3ALQA 1KITA 2VMHA 5D8AC 2W92A 4WM7B 2JIJA 3MLJA 3WDYA 3BGAA 1K45A 1N1YA 1YIPA 2WZ8A 3KT4A 2HWF3 5A3TA 1UY1A 2I74A 1DGWX 1YI7A 3MW2A 3C2UA 1CIYA 4FPGA 1H0BA 1RJ7A 4QX2A 2ZPXA 1QJY3 4RYDA 2DURA 5IT6A 2CNAA 2FCUA 2R1DA 2K46A 2JB4A 2X5IA 2ZGPA 3AZVA 4Q4Y2 4YW7A 2DU1A 5EJZB 2VMIA 4QXHA 4AGRA 1UMHA 4H55A 1IG3A 4M0NA 2VZRA 1US3A 1IPJA 2NMOA 1KXGA 2QFEA 2ZX2A 3I54A 5FZ0A 3S57A 4AW7A 3LWCA 2R16A 1H1AA 2WNUB 4LORA 4UXAA 5LATA 4YZ2A 1OSGA 2ZJCA 1JYXA 2CHHA 5D21A 3ZXJA 2VVEA 1MPXA 5G05L 1EAH2 2JG8B 4FTBA 2CAUA 1GQGA 2FMDA 4ES9A 3ORJA 3ON7A 3AP7A 1AUYA 1S55A 3B69A 4Q26A 3Q8FA 4JQTA 3GCXA 2RR12 1A8MA 3CZUA 1QF3A 2ORZA 2HWE2 3I2FA 3OD0A 1IG0A 3GNEA 3ETPA 2LRPA 1LOFA 2R062 4Y1YA 1RJ8A 3D82A 1VPHA 4AHZA 4DY3A 4AE2A 4LPLA 1C3HA 5EJ3A 5JZGB 4CP2A 2D43A 1JBCA 4CCDA 1ZVFA 5HCBA 1W6NB 2JB8A 4RGKA 1CAVA 5C71A 1VRH1 1GR3A 3KGZA 3MV01 3FL7A 3POSA 2WFPA 3OBRA 3J4UH 4QX8A 4JGYC 2Y60A 1OVPA 1QJX2 5FPZA 3K46A 3JBG3 2PHDA 2AUYA 5HCAA 1ZRIA 3DPRB 3HMYA 3HN3A 4JRAA 3NNJA 3N7KA 1S4CA 2F6BA 4FXGB 3RDIA 1UNBA 4UT5A 1WLCA 4YSFA 2BOIA 2YGLA 2AH2A 1DU3D 3MI8A 3I2DA 3OBTA 4BCUA 2XJQA 1WUVA 2R071 1CWPA 1E57A 1CJPA 1GKBA 3NJYA 1FPN3 2AEYA 4K20A 3WOGA 3GZTB 4KU8A 5A33A 1W8FA 1YO8A 5FP3A 4BM8A 1QXJA 2BNNA 4X6RB 3KF3A 4OUEA 2VXJA 2AZ5A 4DIQA 5LA9A 4E4HA 2XHNA 4Q1RA 3BOPA 4MYEA 4WM7C 4MG2A 1RUG2 1SEFA 1SQ4A 3IDEA 2RJLA 3RMYA 2ZGTA 4CU6A 5A3UA 2HBUA 1WKYA 2RVAA 2JG9B 3N7MA 4E4ZA 2VVDA 3J8F1 1W0PA 4GMP3 1MZFA 1D7PM 3LIHA 3SC7X 2ARAA 3KWVA 3P3PA 2JENA 3DECA 3RZGA 4NPRA 2WS91 4R52A 5KR7A 1AX2A 1XSQA 2HEYF 2VM9A 4XHBA 4QKNA 5FUPA 3ZXAC 1MZ5A 2OW4A 2QKDA 3GBWA 1VALA 1AXZA 1D4M1 4AQ2A 1S1AA 5ACA3 2Z69A 2RDNA 1YIFA 3T2TA 3RZMA 2CDOA 2DVBA 1HRV1 3ENRA 1GOHA 4BK4A 1XYOA 2CWSA 2LW8A 4RQPB 3ZYFA 4Q4X3 4OZXA 2BFUL 4JTOA 2EIBA 1DZQA 4FP2A 5AVPA 3A21A 4EQVA 1X7NA 3OCPA 5J3UA 1JS9A 3HBZA 4NVPA 4E2GA 5C4WB 3UKNA 1DQ4A 2Q8EA 5JOZA 2HWD3 3NAPC 4HN0A 1ZA7A 1SMVA 3S6PA 4CTEA 5C3SA 5L7OB 4CDWB 1ACCA 5FRAA 2V5DA 4QB1A 2HH9A 1V6NA 3G6JB 2PYTA 3TWIA 2XJUA 1A3KA 1C8M3 4QQPA 2R6QA 1W6OA 2XG3A 1LCLA 1MEC1 4ZXEA 4ZKTB 1XNCA 5FYMA 3W21A 1UZVA 5IATA 2A3WA 4EWAA 2GC0A 3OBZA 2E26A 2MHFA 1B35B 1WWYA 3M8LA 3MF6A 3I2IA 4BQ2A 2GSYA 5FLHA 4KWUA 3LOIA 3O1VA 4AFMA 1CR7A 4EWEA 5LK5A 3LFMA 1K5JA 1LOGA 1N1TA 1RGSA 1UZYA 3AMPA 4Q2FA 4BA6A 3AYEA 1HXS1 1SHWB 3N9OA 2NP0A 2WNEA 4WM8A 4AZZA 4Q27A 1AR92 1UD1A 4CDQA 5BNNB 1MS1A 5K9YA 1PMIA 2Q5TA 2WUHA 3RRDA 2VNRA 1KQRA 1CD3G 2X09A 3AXDA 2E6VA 4A41A 4Y20A 3VB9A 1FOD1 1FOD2 1DQ0A 1OQ1A 3JB8A 4NROA 4QGNA 4Z8BA 1LOAA 3BODA 1MS0A 1KRIA 2V4VA 1W90A 5A3OA 1KJRA 3BU7A 2WR9A 3GBFA 1ODNA 1CZTA 5DABA 1W9TA 1HLCA 1ZBE3 1HRV3 2WINB 2YG0A 1OLME 1OUXA 1S0BA 3ZOIA 2JDHA 4IL7A 4AF9A 1T6BX 3W59A 3POEA 1W99A 1OOPB 4DZGA 5FKBA 4FXKB 2CL2A 5DG2A 4WBBA 4IV1A 2IFWA 2WS93 4MGSA 4IV3C 3AMQA 3B93A 1J59A 3KZ4C 2B9VA 3NAPA 3QBQA 4ZXKA 5K0UB 1DQ5A 4L97A 1O91A 4XCAA 4NHXA 1I3HA 2NQYA 4H14A 2G4IA 3T08A 1LRHA 1TZOA 2YC4A 2OPKA 4LQRA 3QLQA 2BZDA 1WCDJ 5LY1A 4COWA 3I49A 3WUDA 1BLZA 4YGCA 2LUWA 2WAAA 1VBC2 1VBC1 4QPIC 1LJ7A 4UF0A 4XUTA 1VJ2A 3ACHA 1SLBA 2CTVA 1FYUA 5CBLA 1NY71 4MGYE 4XF4A 1BHGA 3U4SA 5A6YA 5IVCA 3SH5A 1VLNA 2HYKA 4UAPA 3SLIA 2HWF2 3JD71 3K51A 4P00B 1JHJA 4MV2A 5IVVA 4DEQA 4UI9L 2XLFA 2D5FA 3WNPA 3FX3A 3VBHC 3WP6A 3IAQA 1LULA 1D2SA 2WO3A 3LD8A 1K5MB 1PNGA 2JDYA 1J3QA 4K8RB 1EUUA 3BU0A 4R4XA 1HQNA 3WDWA 4LT5A 1QJU3 3ZN6A 1YCIA 5FQ0A 3P5BA 4JKLA 5K8SA 4A2UA 4LBNA 5T54A 1NCRC 2D98A 2XJRA 4J1XA 2X05A 1UMIA 1W9WA 1WD4A 1VBE2 4QMAA 5IYYA 4BQWA 3JB4C 3DXTA 3RYKA 5CFDA 3AZZA 3WW4A 5FBJA 2P1BA 4FFFA 4BK5A 4QQLA 3ECQA 3IMNA 4QGLA 4ARXA 1DP0A 1XE8A 3KCYA 2JECA 3KMHA 5JSRA 4ATFA 5F6KA 2PFWA 2UY9A 3B9CA 5CVRA 4JGZA 2H6BA 1LTEA 4CCEA 5DMYA 1GSLA 3K48A 1TE1B 4Y24A 4LE4A 2VY0A 5GLUA 2VZ3A 2W91A 1W9FA 2VCAA 4TYSA 2ATFA 3H7YA 4Q8KA 3AZXA 3NJZA 3PVOA 4TLGA 1BJQA 3C7OA 4JVAA 3D4KA 5J36A 1LENA 1BXHA 2OXBA 2WO1A 2W0XA 1V6KA 3H50A 1JMUB 4CUBA 4NIHA 2E31A 2XJTA 3AKSA 3TEWA 3ZXGA 4L2NA 3ZFEC 2RDSA 1RYYA 5GJ6A 4D6QA 1IQAA 4HLTA 1L3JA 2O14A 4JRLA 3V0AA 2WN2A 3HIFA 1WW7A 1QEXA 4L99A 4PLNA 5FO8B 1ULCA 4NOTA 5FY4A 5J7MA 3WINE 2DV9A 2WWJA 3VHPA 3THCA 3OG2A 1H4GA 5CG9A 3D0SA 2ZGLA 3LEIA 3D3AA 5CG8A 1MS3A 3H1MA 3NO8A 1Q56A 2XJPA 4IV1C 2DTWA 5T5OA 4S2GA 3SEPA 4XVHA 2WC2A 3MIEA 3NKTA 1FPN2 1YQ5A 1UMZA 3CJIB 4X8NA 5IFTA 3AYDA 4JKKA 3KGLA 3AZWA 5CEHA 5J98B 4I3GA 3SHRA 1H6YA 3BTYA 3AMNA 2A70A 3J8F3 3ZM8A 2W47A 5C8CA 3LFIA 3ACIA 1H9WA 1W2UA 1IPKA 1KDMA 1YQ8A 2KA3A 4I09A 2P6HA 4KG8A 3POBA 2OIIA 4LHKA 4N43B 3FLRA 4QX7A 4MXWB 4UW5A 4URAA 2ZCWA 3LEGA 3A23A 5HXMA 2AGSA 3R4SA 1DQ2A 2YV8A 1H8VA 2WNUC 1QNWA 3OYWB 5EQUA 4F8AA 1F5JA 4Z2WA 3DPRA 4IDZA 4KWLA 5F5QA 3ZYRA 5FZIA 1GANA 4XXPA 4H7MA 4LNVA 1NA1B 3SH3A 1ND2C 1IS4A 3VHNA 2DU0A 2RE9A 4AEJA 4YGEA 3VDBA 4AI0A 1RL3A 3A0NA 3AM2A 4ZY9A 4QT6A 4Z1VA 5HXVA 2RMU1 1ULFA 1LHNA 1LESA 2GNMA 3BIEA 4P5HA 2ZXQA 2R30A 4Q4V3 1OKQA 3MO4A 4YM1A 4HBNA 4D7SA 5C3RA 3VDCA 4CEYC 1F8VA 2WT1A 4IW3A 2AREA 4O61A 3WZ1A 4YM2A 1JYNA 3VD9A 3HPNA 2VQTA 2IXLA 5CFDC 5J1XA 4BQXA 2CYFA 3AKTA 3VV1A 2HWF1 3JD72 1MQTB 5LK7B 1IQDC 4P9XA 3U11A 1K5MC 3MICA 1UO9A 5FZ3A 4XIKA 1O4ZA 3PURA 2R063 4NHYA 3WNMA 1CONA 3AZYA 5LB6A 2A6XA 1CAXB 3EYPA 3MFAA 4J6GA 1XPWA 5EXOA 3RYRA 3P3NA 3T0AA 5GLWA 3ZVXA 4CCOA 4AI3A 2OX0A 2A6YA 1VMJA 1W0NA 2C1FA 3ZSKA 5I0TA 3MZHA 1W6PA 3N7LA 2VPVA 5T5JA 3WQ7A 1YNAA 4YYOA 1WCKA 3I2GA 1ULOA 5KHKA 1NY72 4KWKA 4AWDA 1W9SA 2FQPA 2GZWA 3PIJA 4IEYA 5DZGA 4AOCA 5BNPB 1E5IA 1V6MA 4QB6A 5DG1A 4AEDC 4FTSA 2GH8A 4QPIB 2DVGA 2QZ2A 4M3CE 1W05A 4QX0A 3VKLA 4IE0A 4MXVA 2WLQA 1GYKA 1HN1A 1JYCA 2CSGA 1W8ZA 2VUJA 4COUA 3MEPA 2EVXA 2QQKA 1AHSA 2KR2A 4GWNA 5FZ7A 5SV8A 1GZTA 5DPNA 1W6OB 3JUUA 3NJVA 1Y9MA 1YLLA 2GN7A 4Q4V2 3S5QA 2JKBA 4C1XA 3NJXA 4RS5C 1FAYA 1G9BA 4P9IA 1REFA 1WLDA 5T3NA 3CBNA 1OLRA 3H3ZA 4AI2A 2VTXJ 4DOUA 3WF3A 4CDWA 4ITCA 1GZWB 4YZ3A 3VN4A 4AR2A 3USUA 3IWZA 5CISA 5KC5A 2F4PA 3KHBA 1QMJA 1QH6A 4KGGA 3AL6A 4CEWB 4FPFA 5EV7A 5AFEA 4I2OA 3HQRA 3H42B 1RHI1 4HPKB 3KV6A 5IVFA 5FZAA 1QOTA 3RI8A 3WDXA 3CHXA 4RR3B 4ET7A 2WYSA 3J9SA 2CGPA 2ZS6B 2Z79A 3AX4A 3ZMNA 4CDXA 2XUEA 2E51A 3PL0A 1H8TB 4NWVA 4A6OA 2D44A 5HV4A 1JZ7A 3VBSB 4M4RA 1B09A 2RR11 3M7AA 3GZEA 4HANA 3O1SA 1QDOA 1D0HA 1UL9A 2WSVA 5T55A 3VD3A 2VD7A 1ND3C 4Q0SA 1AYN2 1WA6X 4FT8A 5T52A 2YYOA 5BNNC 4BHPA 3PUIA 4Q0PA 1H1IA 3EXUA 4NHMA 2OQ7A 3EO6A 2EAKA 3S7EA 4BLJA 2BFUS 3OUHA 4Q4Y1 3MPPG 4RHV1 1WLTA 3PVEA 4CDQC 4P9WA 4FAGA 4GKYA 2WNUA 2NMNA 2K0GA 1BYHA 1OA4A 5A6XA 1B35C 3HNBM 3GHMA 2XDVA 4I30A 5C3OA 2BGCA 4AVVA 3PDQA 2EXKA 1YJLA 5GZDA 3IIIA 1V0AA 5C33A 1LOFC 4Q0VA 4CYDA 4R8HA 5I8SA 1C1FA 3ZXKA 2BOJA 1VMFA 3VKFC 3ZX7A 5FWEA 3AC0A 3UJQA 1KFUL 1AR61 1WZXA 4UF0B 5F39A 4CDUB 5F7UA 4I0BA 3VBRA 3OJBA 5C8CB 3LDKA 4LBLA 1DYPA 2DUPA 2GC2A 1GBGA 1LGBA 3ZYIB 4B4QA 4XF0A 4S2DA 3B3QE 1TMF3 2VXRA 1W6NA 2B39A 3OGJA 4JGYB 4XQ4A 3ELNA 4Q29A 4WVMB 3MUY1 4P08A 3UESA 5I8YA 1XC6A 2EIGA 4YVSB 5JR2A 1IS3A 1R093 4M4PA 5EZWA 1JYTA 2J1UA 5LA2A 4DO0A 5GLZA 5K4LA 3FJSA 5JZGC 2OS2A 3UV9A 2F4LA 1UY3A 2BVVA 3PUAA 3I3QA 1RUH3 4QD2A 1RVF3 4CDUA 2YGMA 3PJYA 3WQ0A 1V9U3 5IJRA 1V6OA 4MSVA 1GNYA 3NV2A 1JZ2A 2LTNA 1AYN3 1SBDA 1NZCA 3WNOA 2GNBA 1RMU1 2W1WA 3H1YA 2PTMA 3ZFGB 2N7GA 1LOBA 1HKDA 3HBKA 2ERFA 3I59B 4W50A 4FOVA 4A44A 2GMMA 5IK8A 2WBKA 2Y34A 2GAUA 3E5UA 1UY2A 1QXRA 3MDPA 1LEMA 1POV0 2HEVF 2PLV3 4GMP0 4OUSA 3WDTA 1SCRA 1RIRA 4CCMA 3ZIWA 1HB1A 2NM1A 2D5HA 2PQQA 4R9DA 2RJ2A 4P02B 4QXCA 2W68A 1JTZX 5JOWA 2VUCA 3R4DB 2QUOA 5CU1A 5LW9A 1COV3 4JGZC 4B29A 3WQBA 2G19A 4RR3A 3C8XA 2WJSA 3A7QA 5LWBA 5A33B 1BZWA 2ZABA 4WVZA 2X53S 2RS53 3VBSA 1RUD1 1UX6A 1Z7S2 3AJZA 2OT7A 2JDMA 2DUOA 4XC9A 1VB2A 3VGIA 1SLCA 1K12A 2WA3A 2QZ3A 2WWSA 1NQJA 1ZRRA 1ZRDA 3KSCA 2RG4A 3CDZB 5EYYA 4AK3A 2XOMA 4R9AA 2ZGQA 5A32B 4RHV3 4URTA 2TBVA 1QOSA 1YUDA 5G04L 2JEMA 3H0OA 4JGZB 3WT3A 1LHUA 1UCXA 1VBB3 4MO3M 3UK9A 3U10A 2GH2A 2O8OA 3TN93 1R1A2 5FR3A 1S0JA 4ZONA 5KXCA 2RS11 2QBXA 2YPJA 1RVF1 2RR13 5FPXA 2WLPA 3MGUA 1WMXA 4NHKA 2Z2SB 1HW5A 2QNKA 3I7DA 3L2HA 4MGKE 2QQLA 1RUJ3 1XB9A 2ADEA 1OBNA 3IM0A 3WG1A 1W2TA 4QXBA 2PHTA 4L8QA 3FHQA 4YFZA 2BQPA 2CAVA 2D3SA 3CQOA 5M0TA 3M4FA 4QPIA 4RSUA 2YZ4A 1XXNA 2JDPA 4Y22B 5FYUA 4NR1A 1UU5A 3A22A 4FI9A 4NE9A 1WBLA 3R0RA 2KM2A 2HWD2 4P9GA 5JXJA 3ZYHA 5HPOA 1G9AA 4A7KA 1HXS2 2JG8C 3UGFA 1OC1A 1TNRA 3MIDA 4LKSA 3NRUA 2JE8A 3CJIA 4HMZA 4RHV2 4YGBA 3SCGA 3THTA 4COYA 4DFSA 4HL0A 2PHWA 2HWC2 2QDNA 3H3UA 4IV3A 2OYZA 3V0BB 3WUCA 4Q0UA 4Q4X1 2A3XA 3ZIXA 1UIKA 2D6MA 2R0FA 4E27A 4BXFA 2Q1FA 1R1A3 2BRTA 2X8KA 1Y9GA 2WYFA 2YFUA 4YFWA 4IGQA 1RUC2 1HRI3 3VD4A 4I01A 3FE5A 5CZKA 3UKVA 3Q8EA 4MX3A 2JKXA 4Q4W1 2ARBA 5C9AB 4XF3A 3VUOA 2DFBA 4COZA 4CDXB 5BUVA 4XUNA 5LASA 5A80A 5FMDA 1N3QA 4D3WA 2YROA 3O1UA 1GQPA 2IUWA 2B5HA 2WO7A 3O1MA 1ASJ2 1VB4A 3T2PA 3ZSEA 1IKPA 1FT9A 1JOJA 5FZ4A 4DXZA 5F2SA 5B2GB 4XUQA 3O12A 1HRI1 3EJKA 3VBUC 3PNAA 4UFIA 4XEZA 4ES8A 4NIGA 5D8AA 1OMIA 2I07B 2RS33 2P4EA 3HQUA 4LKFA 5HCFA 1HQWA 2E7QA 2C9KA 3LSEA 3OGGA 1QHDA 4CU8A 3MV11 4OI1A 3T0BA 2C0ZA 2ZKLA 1PO22 4BH9A 1YJKA 1AVBA 5KHGA 5DAWA 1HRV2 1AR73 4LBKA 3ZR6A 1PIV2 3OPWA 1JU4A 1OQDA 1W28A 1RUG3 2YBSA 2W9XA 2PXJA 5FYYA 5IK5A 2Y6FA 4CEWC 4QKDA 2ZGRA 2XMLA 1US2A 4BMEA 3T3YA 1QQP3 5F32A 2SBAA 3BCWA 3WEZA 4BXSV 2ARCA 2VMDA 1W8NA 1FX5A 1PO13 5FMOL 1S2KA 4META 3LOBA 5J37A 2FCTA 2NPIA 5IUQA 5L9RA 5HBAA 5IHRA 2E7TA 3RZJA 1AX1A 1RUC3 4JTNA 4XFCA 4YM0A 2G9ZA 4CU7A 4GB33 2YFZA 4J1WA 4LMFA 1I6XA 1XYNA 2RDQA 5GZGA 2D3PA 1FV2A 1QGLA 4GB32 4MADA 3T09A 1ZBA2 2VW2A 3OGSA 4G4FA 1UY0A 5T50A 5L7OA 5HCHA 1ZRFA 1URXA 4D7TA 2XQRA 1O3QA 4S2HA 1DZTA 5A3PA 1ZZBA 4G3YC 4S2FA 1UX7A 4TTGA 2BBVA 1NXMA 5J48A 4K40A 1VBE1 2A71A 2P5BA 3N9MA 2E32A 3C7HA 4LLOA 4AQSA 1C8NA 4LBQB 2W1QA 2XUMA 4CSWA 2X29A 3N35A 3KCXA 3MFCA 4QHZA 2AENA 3MIBA 3H8OA 1JXNA 1R1A1 5JSPA 3LZZA 1DDLA 4AFCA 3WHUA 5B4NA 4QQ2A 2PA7A 2J42A 3NQHA 4Q4V1 1X8MA 4M00A 3VDAA 4X8PA 2DBIA 2WFF3 4W6XA 3VD7A 4LBQA 1SBFA 3ACLA 3S7IA 1AXKA 3E6CC 3UNPA 2ZZJA 1MVQA 1Y4WA 1EPWA 4IEWA 4TXWA 5A6ZA 2VUAA 5F5AA 2RS31 1AR81 1UOJA 5GZCA 1GP4A 4XURA 3ZDVA 2JDNA 5F37A 4GIQA 2P3IA 4NRQA 2IZWA 4PF5A 4V2VA 5BNQA 1AYM2 4E8DA 2VECA 4IEXA 2EIDA 3CEWA 4YVSC 3NKGA 4DY5A 1I5ZA 1PGL2 2UU8A 1UZWA 1NA1C 4GWJA 4W65A 5EWSA 1C5HA 2RS13 5FV3A 2B42B 3T1LA 2BDRA 2BGPA 1JUHA 1OFNA 4EROA 4OI0A 3V0AB 3FLPA 4GKXA 4DNYA 1M06G 5E16A 3ZKUA 5LZ6A 2BERA 5CKNA 3RWNA 3EBRA 3KVAA 4HG6B 4OMCA 3HJRA 4BISA 1XBFA 5ACA2 3TEZA 1F9KA 5KHHA 3ZSMA 4COVA 3WHTA 5AFBA 3IKWA 3M1HA 1RUE2 4AHWA 4Z92B 1ZZ7A 4BPZA 2A3YA 3ZPOA 2ZEWA 3T2OA 5CIRA 5FDBA 2IXHA 4LO6B 3O1TA 4ASKA 4EN6B 3PU8A 4XBNA 2QQWA 3FHIB 4XPVA 5IK7A 5JLVA 3NV4A 3CO2A 4BQ4A 4Q1PA 4NRMA 4NUBA 5DZEA 4CCCA 1C57A 2EXJA 2XXZA 4GWIA 2PHUA 4MHUA 4ZU4A 4IV1B 4E2SA 5AC91 2UYAA 4LKDA 4IEQA 5FZHA 4YVSA 1UWWA 4OI4A 4DRRA 3WCRA 1CAUB 3T1MA 1ODMA 2HWC1 2P6CA 2B7YA 1PMHX 3CJXA 4V2WA 3I8TA 2O8QA 1H8TC 4LBOA 5L19A 1RMU3 2WZR2 5H9SA 4QPGB 3ZXEA 2PHXA 3ZR5A 4ORFA 2XVGA 1SBEA 5KBFA 3TN91 4Y3OA 3I2KA 1NT0A 1CJDA 4FOQA 3IAPA 4JAAA 4MOAA 5FXWA 3RNSA 1NLRA 3VKMA 4BU2A 5HI0A 1G9CA 3RVHA 3FN9A 5EJ1B 3W20A 4ATEA 4X6QB 2WT2A 5L73A 3ZSLA 1JYIA 1J1TA 3NV3A 1QDCA 4H2AA 4OULA 4PDWC 1R091 1JW6A 4NN0A 3J26N 4NPMA 5CFCA 3LDBA 1VBA3 2X5IB 3O5SA 1ST8A 1S0FA 4BIOA 2JDZA 3INAA 1ULEA 2VBPA 2DCKA 4R9CA 4OUMA 1REEA 5FP4A 3CKHA 2DVDA 2GALA 4LK7A 1XNBA 4GH4B 2FZ1A 3H9AA 3SITA 2WNOA 3LA7A 4KI5M 4NPLA 1PGW2 1PGW1 4AEDB 4FBFA 3WF0A 3N4MA 5FY5A 4CXXA 5H9PA 4FPJA 4AAPA 1JZ4A 5C4WA 2J1EA 3J8F2 5A7WB 3Q9OA 3ZPYA 2WZPP 3AP4A 5A3LA 3E1F1 2NZ9A 1SFYA 4Y4RA 2GP5A 2E33A 4OHVA 3SCFA 3WDUA 3AP5A 5JIAA 1AYN1 2LALA 2GDFA 3AK0A 3QOPA 5C3QA 4Q4Y3 2QQPA 3FBYA 2P3JA 1J3PA 4XJAA 3WW3A 1U5XA 5FO9B 1W3XA 2DWRA 3O7OA 5A1FA 4CPBA 3WX5A 2UWBA 2YUEA 3QCWA 4CEYB 4HXCA 2ZTNA 3PUHA 3KS7A 3T2QA 1RHI2 2XONA 1TMF1 3G7DA 3SQOA 2WIIB 1EV13 1RUF1 3MIHA 3K77A 2CGOA 1MEC2 1QOOA 2WT0A 3DYPA 3K4ZA 1V00A 5F8PA 2NLRA 1S0DA 5FPUA 3FHAA 1EAH1 4N53C 1C4RA 2ZOEB 3N3HA 4NIDA 4GJYA 3VBUA 1FPN1 5FZFA 1JZ3A 4B1LA 5FZGA 4UBHA 3VKOA 1SLLA 2ZHLA 4A42A 3GBGA 4AHYA 2BEOA 3RWKX 5FO7B 4NRPA 2FDIA 2QQIA 3WNLA 1LB2A 2C9AA 2XWBB 1H1MA 2BUKA 4MGQA 4QB2A 2QJVA 2XGXA 3CNAA 3ZXFA 4AEMA 2Q8DA 4N43C 4BE3A 3WG2A 4ZPIA 1UN1A 4MUVA 5CB7A 1CIWA 2EXHA 4L92A 2CWMA 2Y64A 3IPVB 3ACFA 2HEWF 4GALA 4RA0A 3CIHA 2YDEA 3L2YA 4LO4B 5KC6A 4IEUA 4YVWA 1UU6A 4J25A 4DS0A 1GWKA 4XOGA 2Q0AA 1X33A 1AXYA 3VZNA 2EXIA 5C3PA 2ZHNA 4AI1A 3H1WA 3O0WA 1GOFA 1CX1A 1RUI2 3I3EA 3OBAA 1LOEA 3KB5A 3NMBA 3K3NA 4OHZA 3BPSA 2B46X 3NWKA 1LNSA 4M3CA 4N8MA 2WL1A 3VBOA 4A3XA 2ES3A 3CLPA 5A7WA 1ZZCA 2Q4SA 2BNOA 1NAEA 1TEIA 3R05A 4RQPA 4N53A 4HSJA 4AYUA 4BQ5A 3UGHA 5CADA 1IZ3A 3SNMA 2ZACA 1XQNA 4DB5A 4IXLA 5F3CA 4LA3A 5F9TA 1N1VA 1RHI3 1W6MA 2W52A 3WNNA 1OUSA 1LECA 4YG0A 4FPKA 2B8MA 1VP6A 3TN92 3WQ1A 4CP9B 3AVSA 4XFAA 2KXLA 4IGOA 2WDBA 5EFUA 3DGTA 4HN1A 5BYNA 3HOBA 1F5FA 1RUE1 1WW6A 2VBDA 2WZEA 4Z82A 3VBOB 3U37A 1PVC2 5JXGA 4OLLA 4KMQA 1OURA 1Z7S1 5K7PA 3E6DA 3GYDA 1O8PA 3DN7A 2YU1A 2FDKA 4UBGA 5FOJB 4MZUA 5FY1A 4BQ3A 3LEKA 1OQEA 1QJY2 4OCTA 3POIA 1W6QA 2BV4A 1GICA 1JHNA 3VDDC 1RUI3 1TNFA 1WLWA 2WSUA 3POFA 3AYAA 3GDBA 4A4AA 5C4WC 4FOYA 1OVSA 2PMWB 3I59A 1LHOA 2FDHA 4B1MA 5FYBA 3RQ0A 1DGWA 3LE0A 3WW2A 4EE2A 4DUXA 3WF4A 5J09A 1G8WA 3ES1A 4LR4A 4XDPA 5FAXA 5JSOA 1W0OA 2W39A 2WO2A 1PGSA 1FXZA 2BNMA 4M0HA 4QX3A 5EHDA 1ALYA 2O1QA 1SDWA 2V72A 4JHTA 2AR6A 4QPGA 3ETQA 5DDJ2 4P9LA 2VTXA 4GB31 4D6RA 4XETA 2EICA 2RJKA 5C8WA 1VBA2 2L9LA 1OXCA 2JWPA 5FYIA 1SLIA 1SPPB 1POV3 1V70A 4GULA 2Y6HA 3VBHB 2XJSA 4XJZA 2Y6GA 4EZHA 2QDRA 4XAEA 2FD8A 1PMJX 2XKOA 1QQP1 1QQP2 5FZBA 1W39A 3OPZA 4YZ4A 1RUJ2 2Y0OA 2JG9C 3LSDA 2WRAA 3KD4A 3EHKA 1Y7BA 5C9AC 1Z7S3 1W2OA 4QGMA 1C8M2 4ZU5A 3O1PA 5ISLA 1RXFA 2W94A 3LAGA 2IC1A 5FPAA 1VBD2 3GHNA 5GZEA 1E5RA 5JPMB 2C4XA 2NYYA 1J3RA 3JBG1 1AR82 2VZ1A 3B02A 1W8TA 2CY6A 3P6BA 3O1RA 4RD7A 2W08A 1A6CA 1NLSA 1PVXA 1UPSA 1QJEA 2GN3A 4L9BA 4XILA 3AFKA 5DZFA 5BNPA 4IEZA 1SPPA 3DKWA 3NNFA 4UWDA 4M01A 1VBC3 4AHXA 1UF2C 1EV11 1RUF3 2SLIA 4UW6A 1FV3A 4K21A 4FPOB 5A6QA 2BTVC 2XPJA 5FYCA 5KXEA 1OOPC 3AKQA 2IXJA 2VOVA 3KV5A 4CUGA 5ANNA 2EAAA 3HD8B 2R042 3U0ZA 4OYUA 3V65A 4IESA 3K2OA 2YU2A 4XBLA 1T6GC 4CP1A 1KGYA 4XIOA 3WSOA 2VZQA 2VL4A 2VJXA 4XDQA 4UFHA 5FK8A 4D8MA 3W5MA 1IKQA 2Z4FA 3KV4A 3POJA 2DCZA 3UGGA 4LULA 4MGTA 1GP5A 3AB0A 4XFIA 2WNVC 1YFUA 3K75B 1CZVA 5C5TA 3ZFFA 1DZRA 4XE9A 1NCQB 3IB3A 2ZX4A 2ZEXA 5DUVA 1E5SA 5FUIA 4TZDA 1W8UA 1ZRCA 4PT6A 1RTVA 1U5YA 1RUNA 5GLTA 3M3CA 4JZRA 4C90A 3NSTA 4JX0A 3HNMA 3WG4A 2E53A 2J22A 1A8DA 1W8OA 4DEVA 4LHLA 2VOWA 3WP3A 1ZA4A 4ISQA 1JU3A 1H4HA 4H3WA 1GOGA 1POQA 3ZFFB 2VO5A 1JI6A 5ABJA 1XJAA 3JZVA 4KBBA 1IS6A 2WN3A 4CDXC 1D0GA 2B4KA 3DYOA 1Q8SA 1VRBA 1IPSA 4ASLA 2A73B 1OFSA 5JR7B 2RMU2 3PMEA 4GJZA 4JHZA 4YW4A 5FCCA 1ASJ3 1MS8A 2MNGA 4Y1UA 5FZCA 1PO21 2PAEA 2XLGA 4H7LA 2A6WA 2VE1A 3DF0A 4UYBA 2ZHKA 3NNGA 5FZMA 5A70A 2BPA2 3GJAA 3FMGA 2HLEA 4FPEA 1U12A 1UZZA 5D1IA 2CGNA 1DFQA 4CDWC 2QCSB 5DAVA 2VMCA 1U5ZA 1S0GA 4FFIA 1Y9QA 3JQWA 2Q30A 1J1LA 3VZLA 2GC3A 2P37A 2QVSB 4YARA 3H8RA 1E5HA 4UFKA 1R081 4HZFA 2ADDA 1JZ8A 4FQ4A 1NUKA 1XU1A 2ZGUA 4OZOA 1LHWA 1AF9A 5LCWL 1ENXA 4ARYA 1S2BA 1SCSA 2WKKA 1QJFA 5JOYA 3B01A 3C7EA 2D40A 4QDQA 4QKFA 3RG0A 3AVRA 4E4SA 4IEPA 5FZKA 1UOGA 4Y1XA 1N3PA 5JCTA 3MF9A 2YBPA 1RINA 2WZR1 3RZZA 5C6CA 3KCCA 5T5LA 3ZYPA 3GXUA 1FMD1 4PIZA 5K0UA 4B4PA 2K9ZA 3POYA 3BI3A 4HPKA 3JD73 3AXEA 1WCUA 5FY9A 2HYXA 3VD5A 2VNGA 2WZR3 3QH7A 1BK0A 1PK6A 1ZBA1 4GH4C 3WP4A 4YZ5A 3FC0A 5IAVA 1DLLA 1X82A 2Y6LA 2VMFA 1GZWA 1G9FA 5FIXA 1HX6A 3HNYM 1CZSA 3HEIA 3R4UA 5LA0A 4YG3A 4C1WA 4XUPA 3ACGA 2Y8KA 2R32A 5EPAA 4BB3A 1NQDA 4HKLA 4HETA 3OEAA 4PDWB 3K4AA 3CZJA 5IVJA 2FDFA 3IMMA 3TYJA 2BWCA 1DHKB 4ZU7A 3OYWA 5F3EA 3C7FA 4TSVA 4C0HA 5FP7A 1TQ5A 1TG7A 3U78A 3FUQA 1L7LA 1C28A 1RUH1 1OD5A 1AL0G 1K3IA 1RUF2 4RGAA 3U1XA 5LBBA 3I3DA 4NIAA 1PO23 2ZMNA 5CYYA 3UT0A 1LOCA 1ND2A 3C3VA 2IFRA 2UYBA 3HAGA 4LO8A 2PAMA 3ZFFC 4GA9A 4DXSA 4NAOA 5F3GA 5FP9A 3W9AA 2P34A 4L0PA 5APAA 1KEXA 2R073 2P17A 1WMEA 4YW3A 2EALA 5AC93 1W2AX 3BUCA 2QQNA 2H6CA 3HWJA 3KM5A 4XQDA 5A1AA 1CGPA 3ZMOA 4QPWA 3C7GA 4P14A 1F35A 3GZAA 1MVEA 3I97A 3U75A 2WFF1 5C70A 5A7OA 1FNYA 1MQTA 1CAWB 4PQQA 1Q5OA 3W58A 3ZFGC 5FZEA 2DUQA 1XU2A 1NCQC 3APBA 1NZIA 1UXZA 3AJYA 4DQAA 2ZHMA 5LRSA 4XTPA 3CF6E 5CKMA 3VBFC 1AR93 1DQ6A 2HWE1 2BWAA 3J7LA 2VCBA 1X36A 1HV0A 1W6MB 3JBG2 4LIVA 3ZYJB 3DL3A 3GJBA 5I0DA 3ZXLA 2V4AA 2MPFA 5F5CA 3N36A 5BNOB 1VBB2 3H8UA 1BKZA 4B4RA 4LO7A 2PAKA 5KHJA 2HKXA 3TB0A 1VBE3 1PO12 3OY8B 4PQ9A 3PLQA 4KWJA 4QU1A 1GZ9A 4QPYA 5JDBA 3DV8A 5EP9A 3TNQA 4WVMA 3FFZA 3KVBA 2BW8A 5DUUA 5FY8A 5FYZA 1DLCA 4CUCA 3MUZ1 3WXPA 2VZOA 3M2MA 4IEOA 4B7EA 4XFHA 1A34A 2G1MA 3I3MA 1TVGA 2GU9A 1ASJ1 4AVCA 5AC92 5JMOA 5C9AA 5IK4A 1RITA 5FZOB 5DAXA 1W9YA 4U2AA 3ZFEA 2R0HA 2DF7A 1JOBA 1HQLA 4AVAA 1RUI1 4DXRA 2ENRA 3THDA 1AJOA 3BTAA 1PO11 3BIWE 5C7GA 4LBMA 4V1PA 2B45X 4PHZA 4K8FA 4FO9A 1PZ9A 4F7ZA 2TEPA 1PZ8A 2E7AA 1FATA 2D6PA 1LGCA 2PLV2 2VU9A 3OY8A 3VBFB 5JAXA 1KFXL 3PUQA 4BMBA 4QM8A 4CCJA 1D4M2 2BJSA 2XH6A 2RMU3 3POGA 5IFPA 3BOWA 2W95A 3EMRA 4CDQB 5BNNA 1D4VB 1O3TA 2DVFA 4UW3A 5LBEA 2WS92 5DAPA 4LJHA 2ZAAA 3ABZA 2VBBA 1JZ5A 3GZUC 3B5LB 1YQ6A 2FMYA 3OGVA 4I0WB 5H9QA 1GUIA 4NO4A 1MS5A 4AVSA 1UU4A 3WF2A 1AL21 4HT1T 2D6KA 5FJHA 5JUVA 3RGBA 4IUGA 1POV1 2I2SA 4CE8A 1YC61 2VUDA 3U14A 3VBSC 4LOSA 3VHOA 3GCWA 4K6BA 4KQ7A 1CN1A 2YC0A 4BLIA 4AI8A 5KXDA 4TN7A 4PLMA 1NCRA 1NE6A 2XBO3 2HWB1 2HWB2 4LHNA 1AYM3 3BALA 4RR3C 4K3UA 1C5IA 3MIGA 3MIFA 3BB6A 3BVCA 3DEMA 3N9LA 4HSLA 4IE5A 1OT5A 1XNTA 1HB4A 5FZ9A 2D3RA 1UOBA 2RS12 2ZGMA 5FXZA 4DINB 4AI9A 5FWJA 2ETEA 4XW3A 3PVNA 2PHLA 2Y38A 4AFAA 3Q8CA 1AX0A 5FUNA 3UL2A 3VDDB 2D7FA 3TRSB 4FPLA 3QACA 1AL23 3NW4A 3N9PA 3O0VA 3ME2A 1IS5A 3DUIA 1X9TA 2IXCA 3BN6A 3O0XA 4WV8A 4E9KA 3MW3A 3LF7A 1EY2A 3E5QA 1MR5A 5FYHA 1WMFA 1F15A 2QQUA 3FLTA 3VZMA 4AEDA 2ZGKA 2LROA 3Q8BA 4K1YA 3RFRA 4AVBA 3VBOC 5BNOC 1UKRA 2PELA 5A32A 3ZN5A 2Z42A 1GU3A 4QHOA 3B94A 2O0OA 4YW6A 1LODA 5DDJ1 3WV6A 1RVF2 4LTAA 1QIQA 4FQZA 1ZNPA 2RDRA 4FPYA 4MXWA 2ZZQA 2R49A 1FMD2 2Y33A 4O9EA 2ILMA 2CU5A 4ZHNA 3O1OA 3OEBA 3N7JA 2DCYA 4XZPA 1K5MA 1SG3A 2ZEZA 3MPBA 3OF1A 4YVWC 1W06A 4PI2A 3VBFA 1UZ0A 3DCQA 3EB7A 5ABJC 1I9RA 3RSJA 3VBRC 1VRH2 4IE7A 4D69A 3VBUB 4Y20B 1QKQA 4LUMA 2VOXA 3ZFGA 4ZZ8A 4C8DA 1HB2A 3RJRA 4XF9A 3LB9A 1MQTC 2HBTA 1Z78A 1ND3B 1UYZA 2R1BA 2NN8A 2F17A 4RGGA 1SDDB 2XB6C 3PVBB 4JDMA 4O9GA 4Y33A 4NJ4A 4JKMA 4Y5Z0 3U07A 1BVVA 3USUB 1W04A 2VNOA 1QJZA 2JD4A 4MLOA 1B35A 4QX5A 2D6LX 1C1LA 1EYBA 4XXAA 3W5NA 5BY5A 1BK1A 1RUH2 2R072 5FZ1A 4Q4W2 2VOTA 1DG6A 1V6LA 4LITA 2HWE3 4A45A 4QKBA 4TLFA 1Q3EA 1OLMA 1YFXA 2Q8CA 5JIUA 1ULPA 3IDAA 1OLQA 1HJFA 2VC9A 1ONAA 4CEYA 1JZ6A 3M3IA 4N9IA 1RUG1 2ZGOA 1MACA 3MBWA 1JODA 1QJY1 1UOFA 2VZUA 4Y1VA 2YBKA 1HRI2 4YW5A 5JI7A 2VOKA 1UXXX 3NVCA 3BKZA
chains in the Genus database with same CATH topology
5GZFA 4N53B 2BVBA 3EQEA 1OA2A 2ZKNA 5FLIA 1KD7A 2Z5WA 1CPMA 1DF0A 1W6PB 1PM7A 2OVUA 2PLV1 4IETA 4N90A 4SBVA 5KWRA 1QH7A 1ZZ6A 3HT2A 4M3CF 1PK6C 4P9YA 4GH4A 2WNVB 4GXLA 4BQ1A 5BNPC 5I0SA 1N1SA 5FBZA 1VBD3 2ZGSA 5FTTC 3USSA 4LUKA 3CJIC 3NL1A 5KXBA 2UY8A 5BNOA 2LM3A 3IN9A 1BBT2 2JG8A 5LRRA 5E8AA 4AQ6A 1HDKA 5CFCB 1BEV1 1QJX3 5BV6A 4RS5A 1NOVA 3SH4A 1APNA 2YXSA 4EN7B 1WA4A 4EJRA 3LKJA 4HFSA 1R082 3AMHA 4DMIA 4Y22A 3IDBB 4INDA 2ZBJA 3ZN6B 1ZYBA 4LA2A 2HWC3 3ZDSA 3MYXA 1RB8G 1AR72 4A7ZA 2C5DA 1PIV1 4XMIA 2DCTA 4KU7A 2R043 1CAUA 1BBT1 2WQZC 3E5XA 4PDWA 4BZ4A 2VH9A 2Y0IA 3V0BA 1BMV1 4AGVA 1NE4A 2RHPA 4PCRA 1G7YA 1I1EA 4K1ZA 4XJ9A 1QJU2 1COV1 4PIXA 1ND2B 2A75A 4EV0A 1VAVA 1SLTA 2DFCA 5C9AB 2FHRA 4OHZA 2HJIA 2DTYA 2VGDA 1H8TA 1Z0HA 3CU7A 4MGZE 5KBFA 1BBT3 2ZA9A 3PHMA 4WM7A 5LEJA 3AKRA 1ULDA 1NXD1 1U0AA 1QWRA 3VDDA 5FOBB 4YG6A 2RM22 4M3CB 1QY4A 4ISRA 1X50A 4U36A 1LHVA 4GWMA 2UWAA 4XFGA 3IPVA 2E63A 3X29B 5F6LB 1NCRB 2H0VA 3FUOA 4HK9A 2VQ0A 4F3JA 4D94A 1XE7A 4QQOA 2MEV3 1DGRN 1LGNA 4XJWA 3O14A 1VBD1 3I4IA 1GLHA 4ASMB 4SLIA 4AXOA 1F2NA 4CRQA 3WW1A 3M3OA 3SISA 5LEKA 3ZN4A 2WFF2 1CX4A 5C8CC 3RPQA 1RUD3 1EPZA 2JXAA 4XQWA 3PJQA 2XL9A 2P2KA 1UPIA 3ZO0B 4CDUC 4WM8B 1UKGA 3POWA 4XHXA 3VZJA 3WNXA 1LR5A 3ZFEB 1FMD3 1MS9A 3KLSA 5I8TA 1SACA 1GQHA 2VW1A 1O4YA 5FLJA 3ASIA 3B00A 3ATGA 3VZOA 3V64A 4K7JA 1PHMA 2TUNA 5ACA1 1BVP1 4NHLA 1MZEA 1TME1 4EN0A 1Q43A 1AJKA 3AMMA 1PVC3 2P3KA 4N9HA 1ZREA 1NCQA 1Q8OA 4AVTA 1BEV3 1QJX1 2MEV1 2MEV2 3WP5A 4N43A 4BWOA 5GLVA 4AFDA 2IXKA 5JWPA 1PNFA 4W6WA 3SCHA 1R1ZA 3WD5A 5JVVA 3ZXDA 4WVWA 3RI9A 4AFBA 1ENQA 2G9GA 5EYXA 1MEC3 1REDA 3MW4A 2R061 1ULGA 2ZAHA 1Q8VA 4YGDA 2JJ6A 1BMV2 2VVFA 1AR83 4WZFA 3FBMA 4BOWA 1QNYA 1AR71 1XNDA 3WG3A 4RL7A 1IHMA 1F31A 1FI2A 5DDJ3 4XF1A 1ND3A 1AR63 4B7KA 1UW8A 4LBQD 1VAMA 3UJOA 4L11A 1BQPA 4AEKA 2D93A 1DGRA 1DIWA 4HK8A 4AGGA 1VRH3 2XVKA 3RS6A 4QU2A 1NYWA 3URFA 1V6JA 1N47A 2XBO2 1V6IA 3QH6A 3LA2A 1RC6A 1COV2 1WBFA 1YHFA 1S0CA 5CAZA 2OZJA 3M70A 4OHYA 4HKWA 1J58A 4TWTA 5K0UC 1OA3A 3VBHA 4FP3A 3B7MA 5GKAC 1O3RA 2D6OX 1G6NA 3NAPB 4Q4W3 3ST7A 4BIFA 2GMEA 3HN1A 2WQ4A 2XBO1 4XFBA 2FZ2A 4PBOA 4R4ZA 3H7JA 4XTMA 1X8EA 4HKOA 4RFT0 5JOXA 4JV4A 2WA4A 4OHWA 4F83A 3LA3A 2OUHA 4Z07A 3MLLA 3D0JA 4QQHA 3KT7A 5CFCC 4LBJA 4RQPC 1PZ7A 2UWCA 1XNKA 3VLBB 2JX9A 4FTEA 4JCKA 5CFDB 2RS32 2XWJB 1KS5A 1XRUA 3B9IA 2V73A 1Y43B 4OHXA 4XYXA 3KQRA 1RUE3 1H9PA 1ENRA 4IERA 4PJYA 2YMZA 4MVTA 3VKNA 1YFWA 2IXIA 3BPZA 2D97A 4IEVA 3S30A 1H2LA 4Y4YA 4HVOA 1RUJ1 5E1RA 3WCSA 2XJVA 4FVVA 3IT8A 4Q8LA 1M4WA 1GNHA 1JUIA 3SXWA 5FFOC 4FSJA 4OVEA 1TMF2 1OHFA 3UKTA 2GNTA 1IOAA 4I3PA 3IDCB 1CAWA 4DRVA 1AYM1 2ZMKA 4CP0A 2D6NA 4FPHA 3RMXA 1VBB1 3SMHA 1RUC1 4YLZA 1CESA 3RJ2X 1WD3A 4Q0QA 1FNZA 4K9SA 2CV6A 1V9U2 5JI9A 1GFF2 1N3OA 2WNVA 1H30A 3DPRC 2DCJA 1LKNA 4KGQA 4WM8C 5CNAA 4JGYA 1WCSA 4KL1A 2ZGNA 3GALA 4EWDA 2RS51 2ZMLA 4MGIE 1AR91 2VW0A 4FAHA 2OZ6A 3GF6A 2FBEA 3JU9A 3FFQA 3TNPB 4HVQA 1YI9A 1VR3A 2ZX1A 1OOPA 1S0EA 1TME2 3ILNA 1A78A 1UIJA 1VIWB 1WGPA 1NA1A 5I93A 1MS4A 1ZZ9A 1EAH3 1GV9A 1O7FA 4ONUA 2VMGA 1S0IA 5AVAA 5FMOS 5KHIA 3THPA 4JC1A 4AQTA 1GZCA 2VULA 4I02A 3HQXA 2XVLA 3WVJA 2JE7A 1AZDA 3FZ3A 4MH0E 3VZKA 2E9QA 4KH9A 2PHFA 4LO5B 4BYYA 1MZ6A 1UAIA 1U5IA 5FQ0B 3WLUA 2JICA 2X5IC 4LE3A 2RM23 1ENSA 2JG9A 2JE9A 1ZM1A 4XBQA 4FOWA 2HWB3 2YY1A 3AP6A 1HIXA 1Y3TA 1WW4A 2DVAA 2XL7A 5GM0A 5A3MA 1PVC1 4KNCA 4QM9A 1RUD2 2ET1A 3VL8A 3D5OA 1TME3 3PTYA 3FWEA 3E6BA 2V09A 5I0RA 3AYCA 4YRDA 4N7UA 4QPGC 1QJU1 1ZBA3 2OA2A 4R9BA 3R6SA 4E2QA 4YM3A 3S0MA 1WW5A 5D8AB 5CA6A 3WDVA 2Q1ZB 1XYPA 5BPXA 5F1RA 2VQAA 4YW1A 3IBMA 1O4TA 5JZGA 5L36A 5JPNB 4DPNA 1QU0A 1VBA1 2I45A 2Q8OA 1CAVB 2K2SA 1OPMA 1H2NA 5TSWA 1R083 1EV12 3ROUA 1QXPA 1ZZ8A 3ILFA 2TNFA 3M3QA 4KG0A 1PK6B 2ET7A 3AFGA 4P9JA 1G86A 5E89A 2A6VA 4D7YA 2XKPA 5DXDA 4HVRA 3PMSA 2OUJA 1CQ9A 2QE3A 4JDOA 1O5UA 3V56A 4LLFA 2IWGB 4IQPA 2GC1A 5I0UA 2B9UA 2BYVE 1OPOA 1PGL1 1C8M1 4IV3B 4Q4X2 3ZSJA 3AKPA 1AR62 1YYNA 4WVVA 2V5YA 2RS52 1OI6A 3LCPA 4JQRA 3A4UA 2A7AA 4I0AA 3TOJA 2HWD1 2PN5A 1BCXA 3VHRA 4NWWA 4B8EA 3KT1A 2H0BA 4XJUA 1KDKA 1LU1A 3ES4A 3D8CA 2A6ZA 1Q8QA 3WY6A 3JQXA 5I91A 5DUXA 1GNZA 2XHKA 4PIYA 2R041 4Y26A 4N7IA 2AYHA 1PIV3 1NG0A 4EN9B 2EA7A 2GMPA 1D4M3 3VBRB 1YRZA 5ABJB 4FPCA 3IIAA 1H2KA 3M3EA 4GQ7A 4YVWB 1IGOA 2DYCA 2Y26A 1V9U1 5H9RA 3RYPA 1SFNA 1YFYA 4LEJA 3VL9A 1WMDA 4A7YA 4GMP1 2XLAA 3NV1A 4W6YA 5T5PA 1EP0A 1YWKA 1DQ1A 2GNDA 2Q1MA 4QXKA 2ARXA 2PHRA 4YNIA 4CZSA 4PBPA 3LGRA 1HV1A 1LEDA 2YHJA 1SLAA 5E88A 2UURA 2VG9A 2ZX3A 3L9JT 5L7OC 3TAYA 3HR9A 1ZBE1 1ZBE2 3TBDA 4E4DX 1JH5A 1R092 3OD4A 1VAKA 4RS5B 4JDNA 1RMU2 5JMCA 1RUOA 3A0KA 4G9SB 4XJ8A 1D2QA 5GALA 1FOD3 1CAXA 1JN2P 3OTFA 4OI2A 4YW2A 1BEV2 3WR0A 3U4XA 1YXWA 4PLOA 3CL1A 3QD6A 1DYKA 4XMAA 1CVNA 3AP9A 1O3SA 3D6EA 5FREA 1LU2A 3JCIA 5DUWA 4C0BA 4CEWA 4EN8B 5J96B 1W6QB 3MLKA 1HXS3 1G9DA 4Y1ZA 4B3NA 3ZYGA 1ZX5A 1Q8PA 1DBNA 4AG4A 1CPNA 4C91A 3E97A 3HT1A 1AL22 2G9FA 2RM21 5BXXA 3ILRA 4YZ1A 2A5ZA 1KS4A 4FCAA 4WZCA 4XFFA 5SV5A 1H2MA 2ZX0A 1DGLA 1O5LA 2EF6A 4OFGA 4QHBA 1KJLA 4UW4A 3ALQA 1KITA 2VMHA 5D8AC 4WM7B 3MLJA 3WDYA 1N1YA 1YIPA 3KT4A 2HWF3 2I74A 1DGWX 1YI7A 3MW2A 3C2UA 4FPGA 1H0BA 1RJ7A 2ZPXA 1QJY3 2DURA 5IT6A 2CNAA 2R1DA 2X5IA 3AZVA 2ZGPA 4Q4Y2 2DU1A 2VMIA 4AGRA 4H55A 4M0NA 2NMOA 1IPJA 2QFEA 1KXGA 2ZX2A 3I54A 4AW7A 3LWCA 2R16A 1H1AA 2WNUB 4UXAA 4YZ2A 1OSGA 2ZJCA 3ZXJA 2VVEA 1EAH2 2JG8B 4FTBA 2CAUA 1GQGA 2FMDA 4ES9A 3AP7A 1AUYA 1S55A 3B69A 4Q26A 2RR12 1A8MA 1QF3A 2HWE2 3OD0A 3GNEA 1LOFA 2R062 4Y1YA 1RJ8A 3D82A 4DY3A 4AHZA 4AE2A 1C3HA 5EJ3A 5JZGB 4CP2A 2D43A 1JBCA 1ZVFA 5HCBA 1W6NB 1CAVA 1VRH1 1GR3A 3KGZA 3POSA 2WFPA 3OBRA 3J4UH 4JGYC 1QJX2 5FPZA 3JBG3 2PHDA 2AUYA 5HCAA 3DPRB 3HMYA 4JRAA 3N7KA 2F6BA 4FXGB 3RDIA 1WLCA 4YSFA 3MI8A 2YGLA 2AH2A 1DU3D 4BCUA 3I2DA 3OBTA 2XJQA 1WUVA 2R071 1E57A 1CJPA 1GKBA 1FPN3 4K20A 3WOGA 3GZTB 4KU8A 5A33A 1YO8A 4BM8A 1QXJA 2BNNA 4X6RB 2AZ5A 4Q1RA 3BOPA 4MYEA 4WM7C 1RUG2 1SEFA 1SQ4A 3IDEA 2RJLA 3RMYA 2ZGTA 3N7MA 2JG9B 4E4ZA 2VVDA 3J8F1 1W0PA 4GMP3 1MZFA 3P3PA 2JENA 4NPRA 2WS91 4R52A 1AX2A 2HEYF 4XHBA 3ZXAC 1MZ5A 2OW4A 2QKDA 3GBWA 1VALA 1AXZA 1D4M1 4AQ2A 1S1AA 5ACA3 2Z69A 1YIFA 3T2TA 2DVBA 1HRV1 3ENRA 1XYOA 2CWSA 4RQPB 4Q4X3 4OZXA 2BFUL 4JTOA 1DZQA 4FP2A 5AVPA 5J3UA 1X7NA 3OCPA 3HBZA 4NVPA 4E2GA 5C4WB 3UKNA 1DQ4A 5JOZA 2HWD3 3NAPC 4HN0A 1SMVA 3S6PA 4CTEA 5L7OB 4CDWB 5FRAA 1V6NA 3G6JB 2PYTA 3TWIA 2XJUA 1A3KA 1C8M3 4QQPA 2R6QA 1W6OA 2XG3A 1LCLA 1MEC1 4ZKTB 1XNCA 2A3WA 4EWAA 2GC0A 2MHFA 3M8LA 1B35B 3MF6A 2GSYA 5FLHA 3LOIA 4AFMA 1CR7A 4EWEA 5LK5A 4Q2FA 1LOGA 1N1TA 1RGSA 1UZYA 3AMPA 4BA6A 3AYEA 1HXS1 2NP0A 2WNEA 4WM8A 4Q27A 1AR92 1UD1A 4CDQA 5BNNB 1MS1A 5K9YA 1PMIA 2Q5TA 3RRDA 2VNRA 1KQRA 1CD3G 3AXDA 2E6VA 4Y20A 1FOD1 1FOD2 1DQ0A 1OQ1A 3JB8A 4QGNA 4Z8BA 1LOAA 3BODA 1MS0A 1KRIA 1KJRA 3BU7A 3GBFA 1HLCA 1ZBE3 1HRV3 2WINB 1S0BA 4AF9A 4IL7A 3W59A 4DZGA 1OOPB 4FXKB 2CL2A 5DG2A 4WBBA 4IV1A 2IFWA 2WS93 4IV3C 3AMQA 3B93A 1J59A 3KZ4C 3NAPA 3QBQA 4ZXKA 5K0UB 1DQ5A 4L97A 1O91A 1I3HA 2NQYA 4H14A 2G4IA 1LRHA 2OPKA 3QLQA 1WCDJ 4COWA 3WUDA 4YGCA 2LUWA 4QPIC 1VBC2 1VBC1 1LJ7A 1VJ2A 1SLBA 2CTVA 1FYUA 5CBLA 1NY71 4MGYE 4XF4A 3SH5A 1VLNA 2HYKA 3SLIA 2HWF2 3JD71 3K51A 4MV2A 2XLFA 2D5FA 3FX3A 3VBHC 3WP6A 1LULA 1D2SA 1K5MB 1PNGA 1J3QA 4R4XA 1HQNA 3WDWA 4LT5A 1QJU3 3ZN6A 1YCIA 5FQ0A 5K8SA 4A2UA 4LBNA 5T54A 1NCRC 2D98A 2XJRA 4J1XA 1WD4A 1VBE2 4QMAA 3JB4C 3RYKA 5CFDA 3AZZA 3WW4A 4QQLA 3ECQA 3IMNA 4QGLA 5JSRA 3KMHA 1XE8A 3KCYA 2JECA 4ATFA 5F6KA 2PFWA 2UY9A 3B9CA 5CVRA 4JGZA 2H6BA 1LTEA 1GSLA 3K48A 1TE1B 4Y24A 4LE4A 2VY0A 5GLUA 4TYSA 2ATFA 3H7YA 4Q8KA 3AZXA 3NJZA 3PVOA 5J36A 1BJQA 4JVAA 3D4KA 1LENA 1BXHA 3H50A 2W0XA 1V6KA 2XJTA