1LEDA

Structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
243
Chain Sequence
ENTVNFTYPDFWSYSLKNGTEITFLGDATRIPGALQLTKTDANGNPVRSSAGQASYSEPVFLWDSTGKAASFYTSFTFLLKNYGAPTADGLAFFLAPVDSSVKDYGGFLGLFRHETAADPSKNQVVAVEFDTWINKDWNDPPYPHIGIDVNSIVSVATTRWENDDAYGSSIATAHITYDARSKILTVLLSYEHGRDYILSHVVDLAKVLPQKVRIGFSAGVGYDEVTYILSWHFFSTLDGTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WEST-CENTRAL AFRICAN LEGUME LECTIN IV
publication title Structures of the lectin IV of Griffonia simplicifolia and its complex with the Lewis b human blood group determinant at 2.0 A resolution.
pubmed doi rcsb
source organism Griffonia simplicifolia
molecule tags Lectin
total genus 58
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ledA00
2ES3A 4XIKA 1CESA 1WLCA 4HL0A 4XYXA 5F5QA 5GALA 3O12A 1LOEA 1WLWA 4UW6A 2PHUA 4PCRA 4AGGA 5KXEA 3WDXA 2AH2A 5H9QA 5GM0A 1G86A 2YV8A 2A70A 1FV3A 2D3PA 2NN8A 2NYYA 4D69A 2JE7A 1KQRA 1LOGA 4AVVA 3AFKA 4JCKA 1UMZA 4Y22A 2CTVA 3AYCA 4FPHA 4M3CF 2JKBA 3ENRA 4LBJA 2BQPA 5H9RA 1GZWA 1H9PA 3VKOA 4ATEA 2ZGPA 4YW2A 2RHPA 1LECA 3SH5A 2GNTA 3WOGA 4YLZA 4M3CB 5GZGA 1HQWA 3QLQA 2DURA 1CIWA 3DUIA 4FOYA 1YRZA 4XBNA 3NWKA 3GNEA 2VUAA 3LCPA 3N36A 3POYA 1VALA 1UAIA 3R4UA 3IM0A 3BIWE 3JUUA 2EXIA 3PJQA 4U2AA 2R49A 2ZGQA 5T5LA 4AGVA 1MS0A 3AYDA 5CAZA 1A78A 1ULCA 1SCRA 2DVGA 4YM3A 1S0FA 3FBYA 3FUOA 3OJBA 4L8QA 2E51A 1DGLA 1AVBA 2EF6A 3A0KA 3D6EA 2V73A 4NOTA 1V6IA 3OY8A 4Y22B 4GXLA 1WD4A 1NXD1 4AVTA 2DUOA 2PHFA 3M2MA 1N1TA 3ILRA 2DWRA 1LULA 1UL9A 3M3CA 4GWMA 1GZWB 2D6LX 1LHVA 1HKDA 1QOSA 1GBGA 1V6OA 3FLRA 2P34A 1Q8OA 3TB0A 1JYCA 2YXSA 1F5FA 4YZ5A 2GMMA 4PQ9A 4UW3A 2C9AA 4LBLA 3T2TA 1DLLA 3AJYA 1X50A 3RRDA 2EXJA 2LTNA 1DQ6A 4YGBA 2DUQA 4FOQA 3NV4A 4XDQA 4BLJA 5DZGA 1CJPA 3POSA 4XJWA 1WW6A 2DU1A 5T5PA 3FLPA 4WVWA 4Q26A 1S0GA 3AYAA 3AK0A 3AP5A 4BOWA 1SLLA 1G9DA 4YZ4A 1WW5A 3ZYRA 3ZXLA 1LOFC 4P9YA 2PELA 3INAA 3OY8B 5FREA 3AP7A 3SNMA 3WG2A 3WG1A 1WBFA 1AF9A 1D0HA 2DYCA 1MR5A 3AXDA 3VUOA 3KQRA 1LOAA 2V5YA 2R16A 2ZABA 4FOWA 1ZM1A 3DGTA 3PVOA 2ZKNA 4AYUA 1UN1A 1FX5A 2AR6A 2ARXA 2SBAA 4RL7A 5GLTA 5GLWA 4XE9A 3APBA 1S0EA 1HLCA 1FNYA 1LGBA 1QNYA 2JD4A 1DBNA 2JECA 3WG3A 1U0AA 1GZCA 2CWMA 1WUVA 3N3HA 4ISQA 3ZSJA 4YG0A 1C1LA 4PF5A 2ZHKA 2P2KA 1ULEA 1DQ5A 3T1MA 3WCSA 4AWDA 2AUYA 2A3YA 2ENRA 3BTAA 1PZ8A 3O0WA 5IUQA 3RG0A 1FATA 1QDCA 1YO8A 1DFQA 3D4KA 3ILNA 3IKWA 1KJRA 3V0AA 2ZACA 4Y20A 5E89A 4XXPA 4FP2A 3B69A 1CONA 4XTPA 2A6YA 4GKXA 4PBPA 1IS5A 1YYNA 3RMXA 4FVVA 3V65A 2E7TA 3ZSLA 1DZQA 2PHXA 1LU1A 1V6MA 4ISRA 3FLTA 2DV9A 4UW4A 1ULGA 2B7YA 3LSEA 1MS3A 3AZVA 2UURA 4XJ8A 2DUPA 2I2SA 1QDOA 1LESA 1O4ZA 3IN9A 4FOVA 4Q1PA 5T55A 4Y24A 3T1LA 4DFSA 4YZ1A 4XJAA 3AZWA 1G9AA 5GZFA 2UWCA 1LHOA 2TEPA 2VU9A 3O5SA 4YGCA 4AGRA 1I1EA 4ASMB 1W6MA 3AYEA 2D43A 2LALA 4GA9A 5DZFA 1DQ2A 2W08A 2A7AA 1LHUA 3OYWA 5FRAA 3V0AB 1AXZA 4Y20B 3RS6A 3WVJA 1SLAA 1V6LA 4R9DA 5JOYA 1DYPA 3KM5A 4Q2FA 5CNAA 3NV2A 1SLBA 3WHUA 2ZGSA 4YM2A 2GDFA 3PMEA 1G9BA 5LK5A 1C1FA 4ZKTB 1SACA 4U36A 2P3IA 2ZMLA 2ARBA 3O0VA 5GLZA 5T5JA 1IKQA 3NV3A 3WLUA 5GLVA 5IK4A 1WW7A 2D3SA 1CPMA 1GICA 1ONAA 4RA0A 2A75A 1CR7A 2D44A 1O4YA 3BOPA 1JOJA 1AX1A 4M00A 5T54A 3IPVA 4FP3A 3M3EA 5EWSA 1W6MB 3N35A 1QMJA 1H30A 5DG1A 1FNZA 4JC1A 3MW2A 5CBLA 1QF3A 5IK5A 1GANA 2ZGMA 3OYWB 3ASIA 5DUVA 1A8DA 2HYKA 1GSLA 5DZEA 4CRQA 2YY1A 4ATFA 1GV9A 5E88A 5CB7A 1N3QA 3SH3A 2D6OX 4YW4A 3WZ1A 1AJKA 2C5DA 2ZZJA 3B01A 2NP0A 4XJZA 1UX6A 3HMYA 2D6MA 4UW5A 3WNXA 4DRRA 3V0BA 1FV2A 4XMIA 5HCFA 2VY0A 1S0JA 5EXOA 5KXBA 4MYEA 3R4SA 5SV8A 1MS8A 4FPJA 4M3CE 2R1DA 4P9XA 4XTMA 3AP4A 2ZGNA 1G7YA 3W59A 2NMOA 2OUJA 5DXDA 1DQ0A 2A6WA 3IMNA 1KDMA 3SITA 1ULFA 5T50A 1KJLA 1VAMA 2UU8A 4FPCA 4XOGA 5DG2A 3R05A 2ERFA 1DIWA 5HCBA 4GKYA 1PZ7A 1PZ9A 1JHNA 2YMZA 1B09A 3LSDA 1N47A 1CVNA 2A6XA 1RINA 1SCSA 2WNEA 1ENRA 1FAYA 1Q56A 1QGLA 1W6OA 3Q9OA 3RSJA 1G9CA 4WV8A 1N1YA 2A6ZA 2EXHA 4Y1ZA 1SLTA 4Q8KA 2EXKA 1S0IA 1GNHA 1LJ7A 3V0BB 2ZBJA 2CY6A 1IS4A 5CA6A 1A3KA 4XBLA 5IK7A 2VW2A 2XG3A 1Q8SA 2VW1A 2PHWA 1GYKA 3ZVXA 2WSUA 4YW5A 4Z8BA 1BZWA 3SH4A 1BXHA 3NV1A 2OW4A 1SFYA 1ULDA 2P3JA 2JDZA 4YGDA 4IQPA 2WT0A 1JUIA 2P3KA 1N1VA 3WDTA 3AZZA 1AXKA 3A4UA 4H55A 3WDYA 1LTEA 1Q8PA 1QKQA 2PHTA 1RITA 1W6OB 4GWNA 3MEPA 4FPYA 2AGSA 1W0PA 1ZA4A 1GNZA 2ZGUA 3WDUA 1BJQA 1W6NA 5GZEA 2ZHNA 2VH9A 3ILFA 2EALA 3PVNA 5T5OA 3WUCA 3AP9A 3ATGA 3I4IA 4F83A 4DS0A 2D6PA 3ZSKA 2GMEA 1LOFA 1N1SA 2CWSA 2GNBA 1MZ6A 1WCSA 2E7QA 4FPGA 1KDKA 4ITCA 1KITA 4W65A 5GJ6A 2DVBA 2GALA 1EPWA 1R1ZA 2DVFA 1TEIA 1MVQA 4K1YA 1G9FA 3MW3A 3V64A 2ZGKA 3M3OA 4LBOA 4YFZA 4DPNA 3OBTA 1LGCA 4WZFA 4FPKA 3AX4A 2GMPA 2GN3A 1WBLA 1IKPA 4I30A 1H9WA 4BM8A 4TZDA 1WD3A 2GN7A 3WDVA 4FPLA 1W6NB 1Q8QA 1LEMA 5GZCA 2JJ6A 1W0OA 1HQLA 2W39A 4K1ZA 5AVAA 2ZGTA 1AXYA 4TYSA 2VXRA 2W52A 4Q27A 3U4XA 4YW3A 1S0CA 1RIRA 5JLVA 4XJ9A 4YW1A 5H9PA 2W68A 3WDWA 3N7JA 4Q8LA 2ZGOA 4Y26A 3ZXFA 5GLUA 2AYHA 2D7FA 1LEDA 4M3CA 4YG3A 1ENSA 4YZ2A 1VAVA 2DTWA 2DVAA 4DQAA 1APNA 2YZ4A 1C57A 2WKKA 1OKQA 3WV6A 1G8WA 2EAKA 2ZMKA 2CNAA 4DRVA 1MS9A 5IT6A 1QOTA 3ZSMA 4Y1YA 2R0HA 3MPPG 1IS6A 2ZMNA 1QNWA 2FHRA 2FMDA 4ZXKA 5GZDA 2ZGLA 5E8AA 4YM0A 4LBQA 1AJOA 1CQ9A 5IK8A 1BQPA 1LCLA 1AX2A 1Z78A 4KBBA 1WLDA 3HR9A 2R1BA 2E53A 1W6PA 4BMEA 2E6VA 2Q5TA 2GNDA 2WQZC 4XHXA 2SLIA 1WW4A 2VW0A 1SBFA 2CYFA 3ZYPA 4C1XA 2A5ZA 3PVEA 1F31A 1JBCA 1SBEA 1SBDA 1V6NA 2YROA 4NO4A 2EIGA 1C4RA 3N7MA 3USUA 5BYNA 4YG6A 1MACA 1IS3A 1FYUA 1QOOA 3ZXKA 2KM2A 3ZXJA 4BLIA 4XMAA 4P14A 2WSVA 1KRIA 1V6KA 1GKBA 1Z0HA 3D5OA 4JRAA 4M01A 4SLIA 5DUXA 1V00A 5DUWA 4Y1VA 5EYXA 1Q8VA 3IPVB 4FPEA 2NZ9A 2WT2A 2ZHLA 5DUUA 3RMYA 3WCRA 4LBQB 3TAYA 2R0FA 4XZPA 3B3QE 3JU9A 2A6VA 2P37A 5JMCA 1DYKA 3POWA 4BMBA 4LBMA 2DVDA 1AZDA 1W6PB 1LODA 2WJSA 3ZPYA 4Q1RA 1UZZA 3SISA 1LHWA 1V6JA 5KXCA 1AX0A 4XILA 3QCWA 3AZXA 1LOBA 1CPNA 4C1WA 1JXNA 2ZGRA 3USUB 1D2SA 4FQ4A 2XB6C 3HN1A 4AVSA 1DQ1A 3B9CA 4FQZA 2D6KA 1JW6A 1S0DA 4R9BA 3WHTA 2UWBA 1N3OA 3MW4A 3WUDA 4Y1UA 1BYHA 1JN2P 2WLQA 3AZYA 3UJOA 2GNMA 3I8TA 1MS4A 4WVVA 3UJQA 4LBKA 3C2UA 5HCAA 2DTYA 1J1TA 1CN1A 3AP6A 4R9AA 3W58A 1UPSA 2A71A 4K20A 1IOAA 1YXWA 3VKNA 2ZHMA 4XBQA 1MZ5A 4K21A 4LBNA 1QU0A 3WG4A 3M3QA 2JE9A 1YI7A 1XQNA 5EYYA 3AJZA 3OBRA 4HANA 3UL2A 2WT1A 1W6QA 3N7KA 5F9TA 5JDBA 1S1AA 3L2YA 2OUHA 2A3XA 4YFWA 5T52A 1DHKB 2DU0A 3A0NA 3B00A 4YZ3A 3VKLA 3M1HA 3RQ0A 4Y1XA 5KXDA 1UZYA 2AREA 1LGNA 4GALA 2NMNA 5H9SA 1S0BA 2D3RA 1GLHA 4XXAA 3N7LA 3VKMA 4BPZA 3BODA 3OGGA 1HDKA 4FPOB 1F9KA 4FPFA 4OZXA 1ENQA 4LBQD 4YM1A 1YIFA 3SLIA 1VLNA 1JYIA 1MS5A 2CL2A 5JOZA 3GALA 2G4IA 3FUQA 4P9WA 5L73A 1N3PA 4R9CA 1BKZA 1MS1A 2D6NA 3O0XA 2Z42A 2AENA 3ZXEA 4CTEA 4XHBA 1W6QB 1LENA 3FFZA 1OQ1A 4PBOA 5JOWA 2PHRA 4XJUA 1SLIA 1MVEA 1URXA 1VIWB 2ZAAA 4BQ1A 3AXEA 3CNAA 4CZSA 2A3WA 2OVUA 2H0BA 4YGEA 1I3HA 1OFSA 4XIOA 5JOXA 1NLSA 5JVVA 1DQ4A 1Y7BA 1SLCA 1LU2A 3UK9A 3H0OA 3VKFC 3OPZA 2NM1A 2ZA9A 3VV1A 1UKGA 1LHNA 1LOCA 1GZ9A 2UWAA
chains in the Genus database with same CATH superfamily
2ES3A 2WO7A 1WLCA 3WR0A 1ND2A 4XYXA 1LOEA 1WLWA 2PHUA 2BOIA 2Q8CA 2JDHA 3MFCA 4H3WA 3WDXA 4TXWA 5IWFA 1RMU3 1FV3A 1AL21 2D3PA 4D69A 2JE7A 2K0GA 4KQ7A 3TBDA 1QXPA 4D94A 3IDAA 4UBGA 3AYCA 4E9KA 3P3NA 4LBJA 2DDUA 2NQYA 4IV3B 4BH9A 4ATEA 1DP0A 2GNTA 1S2EA 4YLZA 5GZGA 4HVQA 3RYPA 2VZ3A 4KG8A 1G6NA 5IVCA 5J3UA 1I6XA 4I0WB 4UXAA 4XBNA 5ACA1 2VUAA 3RJRA 5CFCA 3KSCA 3U37A 4OCTA 4ZPIA 3IM0A 3BIWE 3JUUA 1VBD2 1PO11 2HWB2 1POV3 2ZOEB 3AYDA 5CAZA 4LE4A 1NQJA 3FUOA 4BZ4A 3OJBA 1GR3A 2J22A 2PLV2 5C9AC 1BCXA 4UOJA 3CO2A 3NNJA 3OY8A 4RGKA 4WVMB 4GJYA 3M70A 1NXD1 2DUOA 2ADDA 2PHFA 1N1TA 3J26N 3M3CA 1HKDA 1ENXA 3DPRA 5FZOB 2P34A 3TB0A 4NAMA 4BB3A 2WUHA 3UKVA 2CDOA 3KV5A 3ZDVA 4PQ9A 4KH9A 4QDSA 2RJ2A 5F1RA 2P5BA 1X50A 3FHAA 3I2JA 4BDVB 3S57A 2J42A 2LTNA 5FYYA 5FBJA 5TSWA 2RS51 3NV4A 3HVDA 3CZJA 4XDQA 5FR3A 1CJPA 4IGOA 1WW6A 3EMRA 3FLPA 4WVWA 4Q26A 1S0GA 4QQHA 3VDDB 2W1WA 2P3YA 1E5SA 1ZVFA 3AK0A 2OT7A 1RTVA 2Z2SB 4YZ4A 4BQ3A 2HWB3 2UY8A 4FTBA 2VL4A 3UGHA 1K5MB 3PUAA 5IATA 2KXLA 3RGBA 1GFF2 3OGSA 3SNMA 3WG2A 1EV13 1TQ5A 4WBBA 5FZ7A 2JG8C 2BFUS 2XQRA 3AMNA 1D0HA 2OYZA 3AXDA 2VBDA 3Q8AA 1OLQA 2Y33A 4JDOA 3LF7A 2W9XA 3WP5A 2VM9A 3J8F3 5IAXA 2ZABA 1H1MA 4WM7A 4XZUG 4FOWA 1VBB2 3FE5A 3DGTA 3PVOA 4XAEA 2RV9A 4RL7A 2J1TA 2WYSA 4CDUC 1FNYA 2WAAA 1VRH2 4UWDA 2VC9A 1PNGA 2HWC3 1GZCA 4QPGA 2PQSA 4AQTA 3N3HA 4CU6A 5BV6A 2CDPA 3ZSJA 5KHIA 5BUVA 2BNNA 4A44A 2VCBA 1DQ5A 1CJDA 5BY5A 4PQQA 4ONUA 4RHV1 3B5LB 2A3YA 3OBAA 4MGYE 3O0WA 5IUQA 4QMAA 5JAXA 1VMJA 1DFQA 3D4KA 4EN8B 1F4HA 1PGW1 3VHPA 3V0AA 2JXAA 3KV9A 1ASJ2 3MUZ1 2PTMA 3CJIB 4FP2A 5K0UA 2ID4A 1CONA 4XTPA 3K51A 3RZZA 1QXRA 4PBPA 1YYNA 4FXGB 3T2OA 4FVVA 3VBSB 1NCQB 3BOWA 1ZZCA 3H1WA 3KGZA 4CPBD 1YC61 2BW8A 3HQXA 2BWAA 2GP5A 4XJ8A 4TWTA 2DUPA 1KFXL 3JB8A 1O3TA 4OVEA 1FOD3 4I01A 2VCCA 2D97A 1NCRA 4ASKA 1IG3A 3T1LA 1XNDA 2BGOA 3AZWA 3FZ3A 4XJAA 5GZFA 5A3OA 1LHOA 1T6BX 3S0MA 5K7PA 1O6UA 3POIA 5F3GA 3AKRA 3D8CA 3SQOA 4IEXA 4GULA 1HQNA 5FAXA 4GA9A 2BWCA 3IDCB 5DZFA 4Z1VA 5KC5A 1UZ0A 1AYN1 4ES9A 1H8TB 3OYWA 5DDJ1 5FRAA 4Y20B 1HX6A 3IIAA 1NLQA 4JGYB 2VVFA 1DYPA 2LM3A 4CDQC 4H7LA 5C4WB 1UOFA 2JDKA 4YM2A 2QQWA 1ASJ3 2R043 4GH4C 3ZFEB 4XUNA 2QQIA 1C1FA 1HIXA 3E5XA 2P3IA 3S7IA 5T5JA 3O0VA 4NPMA 4A3ZA 3WSOA 4BQXA 5JPMB 1IKQA 3NV3A 5CISA 5C5UA 4IEUA 3WLUA 4D8MA 5LCWL 5IVJA 4AQSA 1CPMA 1ZRIA 2XVLA 3V56A 1O4YA 3BOPA 3CDZB 4QX8A 5LEKA 3T0BA 1VBE1 3C7OA 5FK7A 1Y43B 4FP3A 1PVC3 3VHRA 1W6MB 3CLPA 1QMJA 5JIUA 2WS92 5DG1A 4JGZC 4N7IA 5IK5A 2ZGMA 3N9LA 1O4TA 3THPA 3VBRA 4BIOA 3P3PA 1BBT1 3POFA 4L92A 5FCCA 1D4M2 1GSLA 2RDNA 3WF2A 1W8ZA 2Y60A 3KLSA 3HAGA 4W8JA 1AR61 3KQ4B 4HPKB 5E88A 4YW4A 2ZAHA 2VMDA 1HW5A 4QHBA 3DKWA 1Q43A 3ZYIB 1ODNA 3OB8A 3ZN6B 2V4AA 2VTFA 5CU1A 4EQVA 4UW5A 3H50A 1FV2A 3M4FA 4DOUA 1UXXX 4H14A 5KXBA 4YNIA 1UWWA 5SV8A 4V1PA 4M3CE 4P9XA 1UU4A 1O91A 4AE2A 2YBKA 2NMOA 1H8VA 1DQ0A 2A6WA 5FZDA 1AL22 4DMIA 3PIGA 1V9U1 4IE5A 3ZYGA 1NX9A 1YFUA 4FPCA 2E7AA 3R05A 3UKNA 2OS2A 2MNGA 4GKYA 4MHRA 4W6XA 1A34A 2PAMA 3S6PA 2RJKA 4IEPA 4RS5B 1ZZ6A 1CVNA 2WS93 1ZZ8A 3NKGA 3ST7A 2WNEA 2Q1MA 1W6OA 5FJHA 1ZBE3 3RSJA 4UI9L 1GOFA 4XUTA 1D4M3 4UAPA 5ACA2 1SLTA 3ES1A 5IHRA 2EXKA 3JD71 1M06G 1J84A 2VZRA 1S0IA 3EYPA 4EWEA 2CY6A 5CYYA 1PO12 1IS4A 1XE8A 2FDJA 3JZVA 2O1QA 1A3KA 1RUJ1 4XBLA 1OMIA 1OURA 4IEYA 4AW7A 2RDRA 4B7EA 3WW4A 3MIGA 4Q4W1 2WSUA 4Z8BA 1VE0A 2JDZA 3OBZA 4IQPA 1JUIA 2P3KA 3GZUC 4FI9A 5EPAA 3HJRA 5FY9A 3WDTA 2ZKLA 2B46X 4YW7A 1AL23 3A4UA 4H55A 5J98B 1A8MA 1BVVA 3MGUA 5KBFA 4LKSA 4XETA 5BNNA 4GWNA 3ZFFC 3VBOB 1HJFA 2ZGUA 4AI2A 3WQ7A 4YZ1A 5F39A 1S2BA 1WCQA 2EALA 3PVNA 4DY3A 3AP9A 4D7YA 2ZX1A 2RS52 5IAVA 4F83A 1QJU1 3NNLA 2Y38A 2JG9A 2Y64A 4PDWC 3GXUA 1WMXA 2CWSA 3VBFB 2E7QA 4QQOA 5CADA 2VZQA 3I49A 1AL0G 1MVQA 2QQVA 3IWZA 5L9VA 1YEWA 2A73B 5KHJA 3MW3A 5CFDC 2ZGKA 2RM21 3PU3A 4LBOA 4YFZA 3GZAA 3OBTA 2QZ2A 2B9VA 4MUVA 3VZNA 1C8M1 4CDUA 4OLLA 1WBLA 1IKPA 3VLBB 1H9WA 3NW4A 1WD3A 4P9GA 1C3HA 2QQPA 2WO1A 1CX4A 1W6NB 2KD7A 1LEMA 4QQLA 3A23A 1OVSA 2JJ6A 3RYRA 2BBAA 3BALA 4IV1C 4WM8B 1SG3A 5FY5A 2J1SA 1TZOA 3JXSA 4FTSA 2ZGTA 1AXYA 4ZZ5A 4TYSA 2VXRA 2W52A 3U4XA 5FK8A 1IPSA 4YW1A 5F37A 5JMOA 3N7JA 2ZXQA 2ZGOA 4Q0SA 3TEWA 1MEC1 5GLUA 3VD7A 4RHV2 2D7FA 3MF9A 4AFCA 4RR3C 3MICA 1ENSA 1E5IA 3W5NA 2DTWA 1G9CA 1APNA 3WP3A 1YHFA 2WKKA 1TMF3 4CVUA 1PGW2 2ZMKA 3WF4A 4XF0A 5JR7B 2X5IC 2XONA 4PIZA 1YJKA 2ZMNA 1QNWA 2Q8EA 2EIDA 4COUA 5KWRA 3NRUA 3HQRA 5E8AA 4SBVA 4YM0A 3EB7A 1UZWA 1PM7A 3KWVA 4XFBA 3E1F1 1GZTA 2E33A 1AJOA 1CQ9A 5IK8A 1BQPA 1LCLA 1AX2A 1Z78A 1U5IA 3TEZA 1WLDA 3UETA 3BN6A 1FPN2 1B35A 3D0JA 4PHZA 4W50A 4LO5B 4HVRA 3AMPA 2VW0A 1SBFA 3NNFA 5LK7B 2A5ZA 3BGAA 1R1A3 4BXSV 2CHHA 2VBBA 4NWWA 3AKQA 2HKXA 4NO4A 2EIGA 3JQWA 3WNOA 2YG0A 2Z5WA 1NXMA 1HRI2 1R092 3GBWA 3FFQA 1AYN2 3DKQA 3EJKA 5DDJ2 4XMAA 3CF6E 4HSJA 4RHV3 4CCJA 3ES4A 1V6KA 2F4LA 3DL3A 1KRIA 4OUEA 4UFLA 3TN93 5EYXA 1JZ5A 1RHI3 4HMZA 4OFGA 5JZGB 4QGLA 4AI1A 1Y9MA 2CAVA 2VNVA 2ZHLA 3SC7X 4LBQB 3P5BA 4XZPA 4S2HA 3B3QE 3K3NA 4MZUA 3JU9A 2A6VA 2VECA 4P9LA 4HK8A 2HLEA 4LNVA 5ANNA 5FXZA 4CDXC 5LZ6A 3N4MA 5C70A 4NHLA 1W6PB 4D7SA 4G9SB 4YRDA 4JGZA 4Y4RA 4Q1RA 1UZZA 5T3NA 3SISA 4CEYC 1ZZBA 3QCWA 5IVEA 4EN6B 1VBE2 1LOBA 1UOGA 3AZXA 1TME1 4JTNA 5LBCA 3VHOA 1JXNA 4B1LA 4DEVA 3USUB 4FQ4A 3WNMA 1DZRA 4CEWB 5HV4A 2XH6A 1KS5A 3WHTA 4HKOA 1EY2A 1BBT2 1N3OA 2A1XA 3B9IA 5BNPC 2IXCA 3AL5A 1BYHA 2PHDA 2WLQA 1UNBA 2Y0IA 3AZYA 1AYN3 3J7LA 3KB5A 3PTYA 4QGMA 2JX9A 4S2FA 5FMBA 3RJ2X 5HXMA 3HEIA 5FUPA 3QOPA 4PLMA 4DO0A 1I9RA 1J1TA 4UFKA 1TG7A 2QDNA 3NNMA 5L7OB 4R9AA 5DAWA 1CAWA 1IOAA 1YFYA 1YXWA 4JDMA 5FYTA 4N9HA 1EUTA 3QBQA 3H3LA 2VZUA 3WG4A 5C8WA 1DU3D 2YC4A 5EYYA 2PYTA 3OBRA 4HANA 1V9U2 4CU7A 1POV1 1S1AA 2OUHA 2A3XA 3I2FA 2YU2A 5FFOC 5T52A 1DHKB 3A0NA 3B00A 2D5FA 3M1HA 4CCOA 5ERLA 4XEZA 1JZ7A 4OZOA 1LGNA 2F4PA 2BBVA 5FY0A 4O9GA 3Q8EA 2NMNA 4YVSA 4D3WA 3IBMA 5A6QA 1W3XA 1BBT3 1JZ2A 2RJLA 3TOJA 3VKMA 1UYXA 3MYXA 1HDKA 4FPOB 5EIYB 4NE9A 4B3NA 3JD72 4FPFA 4RFRB 1AR63 1L7LA 4YM1A 2E31A 5ABJB 3SLIA 5JSOA 1JYIA 1MS5A 2CL2A 1RUJ2 3PLQA 4OQ9A 3RZMA 2PA7A 4Q4W2 1RUH3 1BKZA 1W90A 1OBNA 1S4CA 2R6QA 3PNAA 3PU8A 4OHWA 2IXKA 3THCA 1W6QB 2Y8KA 1YNAA 3O1VA 3LOIA 1MVEA 1PX4A 3ZFFA 1URXA 3F95A 2ZAAA 3I2KA 4OULA 3MPBA 4YVWC 4NAOA 1V9U3 5J7MA 3AL6A 3OD0A 4PIYA 3FL7A 3LIGA 5DN2A 1PIV2 4XIOA 4A3XA 1EV11 4PDWA 5LA2A 3MO4A 5A3NA 1TNFA 2VNRA 5C8CC 5AFEA 3OUJA 4CA9A 1QJU2 3J8F1 3ZYBA 2NM1A 1QQP2 1W9SA 1V6MA 1GZ9A 2Y34A 1XXNA 1CESA 2XUEA 3I97A 4QWNA 3DECA 1TVGA 5GALA 3JD73 3O12A 3H1YA 4MGQA 4UW6A 3HT2A 2WWJA 2XL9A 2HWC1 5H9QA 1G86A 2GP3A 3VZJA 2A70A 2RR13 4KBZA 2NN8A 3AVRA 4BQWA 5FP9A 1KQRA 1LOGA 3RZKA 4LLOA 4Y22A 3ZYHA 1XSQA 3H8XA 5JSPA 2CTVA 2RM22 3GZEA 3OOXA 5FY1A 3VDAA 1XPWA 1KGYA 5H9RA 1C8M2 4IV1A 1H9PA 4XURA 4JKLA 3VKOA 3H9AA 2LS6A 2YC2A 3WOGA 3RDIA 1ZBA1 2W1UA 2DURA 3DUIA 3NWKA 2K2SA 5D1IA 2WFF1 1LR5A 1XYNA 3POYA 4QB6A 1UAIA 3R4UA 4IETA 4RR3A 2XJSA 3EXUA 3PJQA 4MVTA 1ND2B 5FZHA 5LBBA 1MS0A 1QJU3 2X5IA 5FZGA 1H1AA 3Q8BA 1MEC2 1S0FA 1FOD1 1GOGA 5FP4A 4AF9A 4LITA 1ALYA 4L8QA 2E51A 5E16A 4B8EA 1AVBA 4N8MA 4Q0QA 3D6EA 4EYUA 3H8OA 4Z2WA 1REFA 4IEZA 4AFAA 3SCGA 4AVTA 5C33A 1X8EA 2WZ8A 2DWRA 2I74A 5FZ8A 2D6LX 1LHVA 1UU5A 4XUOA 4E4ZA 5E1RA 1V6OA 3FLRA 3NO8A 2RM23 1JYCA 1NYWA 1EUUA 4N7UA 3PURA 2OKXA 3T2TA 2BV4A 1DLLA 3UGGA 5CFCB 4N43A 2EXJA 1F35A 2AZ5A 3KS7A 2R041 3LFIA 4FOQA 3VZKA 2QQJA 3ZFGA 5DZGA 4B1MA 2P6HA 3POSA 2Q8DA 4BLJA 4RSUA 5A1LA 5HPOA 1I5ZA 4XABA 4Z92B 1UOBA 4CUGA 2YGLA 4JKMA 4BQ2A 1XSRA 4MV2A 4W6YA 3ZYRA 4YPJA 2BERA 1SQ4A 1KD7A 3INAA 3OY8B 1MEC3 1NAEA 2IC1A 4XF9A 4AFDA 3OEAA 1PVC1 4AOCA 1WBFA 2LRPA 4AEDC 3EHKA 3LGRA 5LA1A 5J37A 3VUOA 5SV5A 1GWKA 1LKNA 2QKDA 4Q4V2 1W8NA 5FOJB 2WNUC 3U0ZA 3M3IA 1CWPA 2ZKNA 4AYUA 1HV0A 1FX5A 5GLTA 2ARXA 1UZVA 1COV1 4BK5A 2VMIA 2JD4A 2RS31 1CAUA 3MIHA 2WO3A 3WG3A 1KFUL 1F15A 5FP7A 1ZNPA 1WUVA 4FAHA 4YG0A 2XOMA 2Y6KA 4LT5A 1C1LA 1TME2 2ZHKA 1ULEA 4J6GA 3T1MA 4XFGA 5BNQA 2FBEA 2JD9A 1CX1A 5A6ZA 3BTAA 3ZKUA 3QH7A 3I2OA 1RMU2 5KC6A 4XXPA 5F8PA 4KU7A 5LY2A 1O5LA 3WD5A 2P4EA 5F6KA 2VZTA 4QU2A 3RFRA 1DGRA 2QQUA 2ILMA 4H7MA 4MOAA 4AEJA 4A6SA 3RMXA 1U12A 3JBG1 3LEGA 1QJY1 3ZSLA 4WM7B 2PHXA 3VGIA 1LU1A 3FLTA 3Q8FA 2IXHA 2B7YA 4AL9A 2C24A 1MS3A 4IERA 5FPAA 5LWBA 3AZVA 4D6RA 1UMHA 4L97A 1ZBE1 4S2GA 1QDOA 2VNOA 5A1FA 3IN9A 4Q1PA 4QPGB 1G9AA 1F5JA 2UWCA 2VMEA 4K9SA 4KU8A 2TEPA 5FP8A 4COWA 1PMIA 4Y3OA 3ZYJB 4AGRA 3T4VA 3LPGA 2QQLA 2OX0A 2X29A 2LALA 3RVHA 3NAPC 3ZXDA 2W08A 4TSVA 1TME3 4EJRA 3V0AB 3RS6A 5K0UB 1SLAA 4D7TA 2OXBA 3CL1A 4JAAA 1JYWA 3KM5A 5CNAA 4F8AA 4G3YC 1MQTB 4ARYA 4MADA 2I45A 4Q4Y3 3PMEA 1Y9QA 1WZXA 1G9BA 2IUWA 5KHHA 3TNQA 2ZMLA 5GLZA 1IPKA 4META 1YLLA 2VZOA 1US3A 5FZLA 2Q30A 1JS9A 5GLVA 3GZTB 2VOXA 4LE3A 3T2PA 3B7MA 1U5XA 1NCRB 4E2GA 1ZA7A 3AFGA 4R4ZA 1ZX5A 4RA0A 4Q0VA 2D44A 4HBNA 3WEZA 3WX5A 5F5CA 3WNPA 3OUHA 1JOJA 4RYDA 4LORA 4ZXEA 1TNRA 2BGPA 2D98A 1K45A 4DXTA 1K5MC 4QPIA 1XB9A 2VQAA 4URAA 4OHZA 1NA1C 2BTVC 5CBLA 2XVGA 4K6BA 3CEWA 3OYWB 1GMMA 3G6JB 2XWJB 2XVKA 1UYPA 5FZ3A 4AHYA 2HYKA 5C8CA 2B8MA 2VNGA 3HOBA 2JDYA 5DPNA 1O8PA 4CRQA 1EV12 4ATFA 4LR4A 5CB7A 4LOTA 1N3QA 1W2NA 5LRRA 2WQ8A 2D6OX 5JXGA 4AI0A 1CZTA 3IIIA 5FZ6A 4PLNA 3B01A 2NP0A 3JQXA 3J8F2 4LUKA 3T2QA 3ZSEA 2D6MA 1YQ6A 3WNXA 3N9MA 5DAQA 3V0BA 3K4ZA 2VY0A 1J59A 2R32A 1LRHA 3MIFA 3O7OA 4O61A 5F3CA 1OF3A 3LEMA 2R1DA 3WF3A 1NOVA 2IFRA 4HN1A 4XTMA 1BK0A 4LKDA 3W59A 2QE3A 2HWC2 3AMHA 5FY4A 3IMNA 4UYBA 1ULFA 5T50A 1VAMA 3WQ1A 1PK6C 3PJYA 1OQDA 3LQCA 2NLRA 3GYDA 3MI8A 4KWKA 3C7GA 5F3EA 5I0TA 1DIWA 1L3JA 1XNBA 1NY71 1PZ7A 4QM8A 2Q0AA 2QUOA 5HCBA 4A41A 5EFUA 1XU2A 1RYYA 3C7HA 1N47A 3ECQA 2BOJA 3O1UA 1TMF1 1QGLA 2H6BA 1Q56A 2WN2A 2VMGA 3Q9OA 4A42A 1AR91 1ZBA2 2YPDA 1YQ2A 3IDEA 5B4NA 1SZBA 3ORJA 2A6ZA 4BU2A 4IL7A 1JYXA 4Y1ZA 2WFF2 1MZEA 5JI7A 4Q8KA 4QX3A 1F2NA 4KNCA 2WN3A 3DYOA 4DINB 1GNHA 3DV8A 5DAPA 2PN5A 3ZX7A 3G7DA 4E8DA 1OH3A 3WNKA 1ZREA 5EQUA 4LKFA 2J1RA 1Q8SA 2VW1A 1FOD2 4YW5A 2K46A 4JHTA 2ORXA 1H8TC 2J7MA 2P3JA 2WAOA 3OSDA 4Q4X1 1YWKA 4TLGA 1D0GA 1QWRA 2JDUA 1R1A1 2WT0A 4CCLA 1K42A 4JGYC 1HB2A 3D82A 4IE4A 3N9QA 3AZZA 4UFJA 3SMHA 1QHDA 4GWIA 2VZPA 4JX0A 4INDA 1Q8PA 2BGCA 3AVSA 1HB1A 4MSVA 1UQXA 2K9ZA 1LB2A 1W6OB 4HSLA 2QZ3A 4YYOA 2HWD1 4AAXA 3GBFA 1FMD3 3TYJA 2DCTA 3WDUA 2GSYA 2VH9A 3SKVA 3TN91 1OH4A 2BYVE 3E6BA 4GMP0 1RHI1 4C0BA 3KT1A 2R042 5FYZA 1OA2A 1ZBA3 3I4IA 1JU3A 2RG4A 1POQA 3FHIB 3MF6A 3WINE 4DS0A 2VULA 3DXTA 3M8LA 3OUIA 3CMGA 2WFF3 1N1SA 4Y33A 3U10A 3DF0A 1Z7S1 3IMMA 5GJ6A 4QX1A 4W65A 3BU7A 3WW3A 2DVBA 1EPWA 2DVFA 1RGSA 4AEDA 1AUYA 5APAA 1W2AX 4QX2A 5LB6A 1PVC2 5C6CA 3QH6A 3WY6A 2WQ4A 4DPNA 2W91A 4FPKA 1UY3A 4AFMA 4YARA 4QB1A 4AG4A 5BNNB 4AXOA 1A6CA 5FZFA 1UCXA 3M7AA 4TZDA 3TWIA 2YBSA 3WDVA 4FPLA 2VZ1A 4AHXA 2VMFA 4N53A 4OUMA 5A3TA 5GZCA 1W0OA 1COV2 5CG8A 4EZ4A 2RS32 3WQBA 2QQOA 4XQ4A 1KEXA 1CAXA 3LA7A 2JG9B 1OLRA 3I3BA 5AVPA 5H9PA 5J48A 3VBUC 2W68A 4Y5Z0 4Q8LA 1HRV1 4MX3A 2YFZA 2HJIA 2ZS6B 3I2IA 5FMCA 2J1VA 3VBHA 2EIEA 3B02A 2DVAA 1GU3A 1XNKA 2YZ4A 1RUOA 4RS5C 1OKQA 1NZIA 1G8WA 4DRVA 4OQ8A 1XBFA 1C8NA 2BNMA 5IT6A 5K9YA 3ZSMA 2VGDA 1GNYA 4CYDA 4ZXKA 4CDUB 1L7RA 3JBG2 1QJY2 3H1MA 2ZGLA 4LQRA 5EJ3A 1VB4A 1Y4WA 5J96B 5CEHA 4BHPA 4HG6B 3K48A 4XUQA 1ZBE2 3I7DA 4LMFA 2R1BA 3WF1A 2WQZC 4XHXA 3NAPA 3UKTA 4QXKA 1COV3 1VBA3 3U78A 3PVEA 1GP6A 4AEKA 2RS33 1Y9GA 1IHMA 4LA2A 1V6NA 4W4ZA 3N7MA 2MHFA 1REEA 1STMA 3OGVA 1MACA 5FYHA 2VTXA 1FYUA 1RUH1 2FZ2A 3T0DA 1QOOA 4XFAA 3IT8A 1HB3A 4BLIA 3O14A 3LOBA 4UBHA 1EYBA 2CGPA 2ZJCA 3LFMA 1DLCA 5DUXA 3ITQA 5FZ4A 1Q8VA 1X82A 3IPVB 3RMYA 1HXS1 4MXWA 4C8DA 1LAJA 2R0FA 2B42B 1OPOA 5CKNA 3CKHA 4UFHA 3GDBA 1DYKA 3JBG3 1QJY3 2H6CA 1XOYA 2VQ0A 1AZDA 1B35B 1NA1A 1LODA 2LUWA 2MEV1 2WJSA 3ZOIA 3VD4A 2WBKA 5KXCA 4COVA 3HNMA 1WLTA 2IXJA 5KHGA 1HB4A 2GC2A 4XDOA 2VQUA 5FOBB 4AVSA 4TLFA 1PO21 1JW6A 4QGNA 5E6HA 2UY9A 5C9AA 4CCKA 4O65A 1CAVA 2UWBA 1GQHA 3MW4A 2RR11 5FXWA 3ETPA 2ZEWA 3UJOA 4A2UA 2ZPXA 2IFWA 4WVVA 4EN0A 2WABA 3C2UA 4XF1A 2DCYA 1QJFA 5HCAA 2WLPA 1D4VB 2G9GA 1QY4A 1CN1A 3AP6A 4DXZA 5J1XA 1OXCA 3L9JT 4NUBA 1UPSA 2A71A 4K20A 4AZZA 4EV0A 1OT5A 1VR3A 1PK6A 1UIJA 5JXJA 1PX3A 2ADEA 1MZ5A 2CSGA 3KGLA 3PUSA 4LBNA 4Q5OA 1PNFA 3M3QA 5A32B 2G9ZA 4KG0A 4O7XA 3I3DA 3N7KA 5F9TA 2FDGA 1K12A 4IEQA 3CZUA 3SKJE 4YFWA 3BPZA 1W2TA 2DU0A 1NY72 5B2GB 3TRSB 1WMDA 4YZ3A 5FUIA 3FHQA 3RQ0A 3ZMOA 1W2UA 1TMF2 1YQ8A 5FZCA 4GALA 2JG8A 1AR92 3HPNA 3O1MA 3D3AA 1S0BA 2D3RA 4HFSA 5FKCA 2OZ6A 4EWAA 1RUF3 4LOSA 2R30A 4CXXA 5C3OA 1F9KA 4XCBA 2QQNA 2IWGB 3WQ0A 2YUEA 4LBQD 2ZX0A 4K8RB 1CAWB 2E9QA 4AEMA 1H8TA 3CIHA 3R6SA 2QVSB 2QFEA 5L73A 1VAKA 5D2AA 1H0BA 1P8JA 4ZU7A 1N3PA 5DABA 1MS1A 4HOOA 4CTEA 4Q4X2 1K5JA 1H1IA 3FFZA 1J83A 4RD7A 5JOWA 1R1A2 3CBNA 5FPXA 1FXZA 2E63A 2VBPA 1VIWB 1PGSA 2QDRA 4BQ1A 3AXEA 4CZSA 4XF4A 4CU9A 3RI9A 5KHKA 1OFSA 2HWD2 4YVSB 3GJBA 2GH8A 2O14A 1ND3C 2XBO3 2CGNA 1DQ4A 1EAH3 3TN92 1SFNA 3HIFA 1RHI2 1YI9A 3OPWA 4JZRA 5FPBA 1AR93 2QQMA 5DMYA 3OF1A 4Q0PA 4IESA 2XHKA 2UWAA 1JTZX 4AFBA 4HL0A 5F5QA 1Z7S2 5I0SA 2KA3A 4P00B 4HT1T 5KXEA 4OI2A 5FMOS 2AH2A 2WDBA 1YQ5A 4RFT0 4E4SA 4OUSA 4L99A 5A33B 4Q29A 4DZGA 5LA0A 5FTTC 3IAQA 2Y6JA 4AVVA 4D6QA 1UMZA 3NVCA 5FXXA 4PI0A 3J4UH 4ARXA 4LXLA 3DCQA 4M3CF 5C3RA 2JKBA 3GHNA 4Q4X3 2J1UA 2HBUA 4CPBA 4E27A 1GZWA 4COZA 4M4PA 4YW2A 1SPPA 4LHNA 3OCPA 4ZY9A 3SH5A 2XLGA 4M3CB 4CDQA 4PDWB 4FOYA 4CP0A 4AK3A 4ZHNA 4YWAA 3VBUA 3LCPA 3IAPA 3N36A 4GH4A 2HWD3 1VALA 3QD6A 2HEYF 4RN5A 5L36A 4L9BA 4U2AA 3EO6A 2X05A 2R49A 2XJTA 2ZGQA 5T5LA 4K8FA 1HRV2 2YC0A 1SCRA 4UF0A 1OUSA 1W0NA 5JR2A 1DGLA 1UY2A 2EF6A 1Z7S3 2WNVC 4IEVA 1WA4A 2V73A 3HQUA 4NOTA 2VOWA 3ZXGA 1V6IA 3MLKA 4Y22B 2WRAA 4GXLA 2OPKA 1WD4A 4NIHA 1VPHA 3M2MA 4AVAA 1UL9A 3POBA 4GWMA 2XJQA 4CDWC 1O8SA 4XF3A 1OQEA 2IXIA 1BMV1 1F5FA 1H6XA 1VJ2A 3BPSA 2BZDA 4FT8A 4Q4Y1 3AJYA 3RRDA 1PMHX 3U11A 5HV0A 1SMVA 2O8OA 1DQ6A 3F2ZA 3I2GA 2DUQA 4IDZA 4YGBA 1RXFA 4E4HA 4RR3B 4A7KA 3BTXA 1OA4A 3ABZA 2X10A 2EA7A 4NHMA 4ET7A 4CCDA 5FYUA 1AR62 4ZZ8A 3KD4A 5IFPA 1RUD3 2X5IB 2C26A 3AP5A 3OD4A 4BOWA 4LO7A 1G9DA 5HXVA 2D40A 2DCKA 1OOPC 4D0QA 1RUH2 1WW5A 4HVOA 4P9YA 1HRV3 3MHZA 4I0AA 5FREA 3AP7A 3ME2A 3WG1A 1RUE3 1AF9A 3ELNA 2DYCA 1MR5A 4BMEA 4BWOA 3KQRA 3S30A 4GJZA 2V5YA 3LWCA 2R16A 1HXS2 1W9TA 2RDSA 3GM8A 4EROA 4I02A 4LK6A 1ZM1A 2WNOA 1UN1A 1U5ZA 2AR6A 2RMU1 4IE0A 3J9SA 4N43B 4XE9A 3APBA 5GLWA 1QNYA 1HLCA 2PMWB 3NKTA 2JECA 5I93A 1DBNA 2VCAA 3I2DA 1U0AA 4QDRA 3ZFGB 3ZLIA 2MEV2 4LULA 4RQPC 3BTYA 1W05A 5EJZB 1JZ8A 3ZIWA 1H2NA 1W8OA 4PF5A 2P2KA 3MIEA 1QIQA 2VUJA 3WCSA 3VD9A 3LZZA 3H3ZA 4P02B 4XC9A 4AWDA 1RUG3 2ENRA 2W95A 3ZKYA 1PZ8A 1PO22 3RG0A 4CCMA 2EAAA 3EBRA 1FATA 1YO8A 1JUHA 2WR9A 3ILNA 2ZACA 4PI2A 2RR12 5E89A 5BXXA 4DEQA 5JWPA 4P9JA 4JVAA 3HD8B 3KF3A 2A6YA 3GBGA 5A6YA 1J1LA 4JTOA 2AACA 4NN0A 2E7TA 1DZQA 2WFPA 4UW4A 4P5HA 3MBWA 2DV9A 2E26A 2VQTA 2MPFA 1ULGA 5LASA 1VBC1 1AR71 1QXJA 1HXS3 2I2SA 5D8AC 1ND2C 1CAUB 3AMMA 4KMQA 4FOVA 1H2LA 4DFSA 4Y24A 4AI9A 1XC6A 5CVRA 4CUAA 3O5SA 4YGCA 5A7WA 1ZZ9A 3RZHA 1O5UA 3LA2A 3VDCA 3J7HA 2MEV3 2CV6A 2W3JA 3AYEA 1AHSA 2D43A 3WP4A 4F3JA 4Y4YA 1DQ2A 5I0RA 5K4LA 3UGFA 4GD4A 3WVJA 4R9DA 3BKZA 4OHXA 5LRSA 3EQEA 5CFDA 1PO23 2F6BA 1DF0A 4QKNA 3NV2A 1SLBA 1ZRFA 3WHUA 2ZGSA 2BVVA 2FD8A 2GDFA 3J7MA 4YW6A 4HLTA 5CFCC 1F8VA 1WA6X 3WDWA 5LK5A 5I8TA 1SACA 4DNYA 1UW8A 2ARBA 4CE8A 2VTXJ 1FMD1 3WNNA 5IK4A 1WW7A 2X09A 2V4VA 4BQ5A 1GICA 3I59A 3NJVA 1ONAA 5A3LA 1CR7A 1ZRRA 2BNOA 3HWJA 3ZMNA 2P6CA 2W1QA 5F2WA 1AX1A 2Z69A 4M00A 2B5HA 3A7QA 2Y0OA 1OHFA 2YYOA 2HYXA 3N35A 3Q8CA 5F2SA 1H30A 2FDKA 5BNOC 1MPXA 1QF3A 3RWKX 1GANA 1ND3A 3H7JA 1WMFA 1DYOA 2HWE3 4JRLA 4NIIA 5DUVA 1A8DA 1NE4A 3USSA 5DZEA 2YY1A 3VD5A 5FPZA 2B45X 3NJZA 3CQOA 3OPTA 2JDMA 3WZ1A 2ZCWA 4JKKA 2ZZJA 5FYSA 4A4AA 4XJZA 1ULOA 4LEJA 3HMYA 4RGAA 4I2OA 4NROA 1AR83 1JHJA 1V0AA 2VOKA 3THTA 4COYA 4XMIA 5HCFA 1S0JA 4P5YA 5EXOA 5JUVA 1X36A 3R4SA 4I3GA 2FCTA 5EJ1B 3AP4A 2Y6LA 2ZGNA 2XWBB 1D2QA 4NR1A 4B4RA 3SITA 5L19A 1KJLA 4QPIB 4AQ6A 4MLOA 2G19A 1PM4A 4UT5A 4XOGA 5DG2A 2ERFA 2PQQA 5FIXA 2VPVA 5EP9A 5FPLA 4NPRA 1JHNA 2EICA 2YMZA 2X53S 1RXGA 4MXVA 2Q8OA 2A6XA 5C8CB 4WM7C 1FAYA 4I0BA 4L2NA 1OI6A 4WVZA 1R083 2Y6HA 3OGJA 3UNPA 2VAUA 1DDLA 4QPGC 1R64A 4O9EA 2XXZA 3E97A 3MIBA 2BVBA 1LJ7A 5LA9A 2ZBJA 3V0BB 2VMHA 2XLAA 3B94A 3PTRB 2WNVA 1HN1A 3DPRB 4CDXA 1E5HA 4R8HA 2OQ7A 2VW2A 1GOHA 3WT3A 3WW1A 1GYKA 3KV4A 4CXWA 1BZWA 4B4QA 3SH4A 4CEYA 4URTA 1ULDA 4YGDA 1VBA1 4CDWA 5A6XA 5K0UC 3D0SA 2BUKA 4EE2A 3K77A 4LPLA 1ODMA 3HBKA 4HONA 1MQTC 1ACCA 2JDPA 2LW8A 3RWNA 4BISA 4BA6A 2VVDA 3OTFA 4E2SA 3BTZA 1BEV1 5BNPA 3RZGA 1RITA 1OC1A 1J3QA 3MEPA 1BMV2 2AGSA 1DGRN 4PF1A 5T5OA 2ZHNA 4JDNA 3ILFA 4Q4Y2 4LK7A 2V5DA 5LEJA 4IV3C 4CCCA 3ATGA 3VL9A 3IB3A 2VR4A 3ZN5A 1Y3TA 1XYPA 2D6PA 2E32A 1GWMA 2FZ1A 4QHOA 1OOPA 5FPVA 5FZEA 1H4HA 3KCXA 3ON7A 1MZ6A 3LAGA 3GCWA 1WCSA 4FPGA 4QD2A 1KDKA 1KITA 1UD1A 1W9FA 1KS4A 2TUNA 4DUXA 2GALA 1R1ZA 2OPWA 4FBFA 5FUNA 1W2OA 2QNKA 4K1YA 3LDBA 1G9FA 1C5HA 3L2HA 3KHBA 3V64A 3AMQA 1LNSA 3O1RA 1W3VA 4LLFA 1LGCA 2VO5A 4WZFA 3GCXA 1M4WA 2C1FA 2GN3A 2HWF1 2JKXA 3BCWA 4I30A 5JIAA 4AI3A 3RNSA 4BM8A 2JENA 2WZR1 2AC1A 4XFCA 5FBZA 3S5AA 4QKBA 4RQPA 2RMU2 3LPFA 3FX3A 2DCZA 4MGSA 1VMHA 2PHLA 5FQ0A 4Q27A 5FYVA 2R071 3I3EA 1S0CA 1RIRA 1RVF3 4XJ9A 3T09A 4IEOA 4R52A 2PAEA 4QQ2A 2DCJA 2CGOA 2O0OA 2OQ6A 2WINB 2JDNA 3ACFA 2JDAA 3LEIA 4Y26A 3ZXFA 4AHZA 1LEDA 4AEDB 4M0HA 4YZ2A 2VG9A 1C57A 3VDDC 4FTEA 1GUIA 2CNAA 1MS9A 3POEA 4LO6B 1RUNA 1ZYBA 4YVWA 2FHRA 4K7JA 2FMDA 5GZDA 1OUXA 3PMSA 5D8AA 2XL7A 4ZS2A 2J1EA 4BK4A 1S55A 3UYJA 4QX7A 1VBC2 1AR72 4N53B 1W9WA 3URFA 1CZVA 3B93A 5C3SA 4I09A 1NZCA 4XFIA 4KBBA 2G1MA 3WW2A 5JSRA 2ETEA 1RUF1 2DBNA 2RMU3 1CAXB 2GNDA 1WCDJ 4X8PA 3W20A 5JCTA 1WW4A 1IPJA 2JB8A 2CYFA 2Y26A 2VE1A 4JV4A 3ZYPA 3NQHA 1F31A 1JBCA 1SBDA 5HBAA 2WA4A 2YROA 1C4RA 2HH9A 3VBHB 3PUQA 4YG6A 4LHKA 5FV3A 4E2QA 1H2KA 5C7GA 1IS3A 3QACA 3ZXKA 2KM2A 1NQDA 5FYBA 3E6CC 4P14A 3O1OA 2B4KA 4MO3M 3LDKA 1UU6A 1JMUB 1Z0HA 3D5OA 4JRAA 2JICA 2UYAA 1CIYA 4Y1VA 3RI8A 2CU5A 2CAUA 2WT2A 1RJ7A 3TNPB 3CJIC 1YIPA 2Q4SA 1HN0A 3N9NA 4LUMA 4BJ0A 4EWDA 5C71A 1NE6A 3E5UA 2BFUL 3POWA 1FMD2 3VBRB 4LBMA 2XBO1 4BCUA 4J1XA 5IFTA 3VBSC 3A22A 1EAH1 1NCQC 2LROA 3ZM8A 5I0UA 1QH7A 1VBC3 1AR73 3NAPB 3RPQA 3ROUA 4F7ZA 5BNOA 2V72A 4HN0A 4M4RA 4C1WA 2C6SA 5J36A 1DQ1A 4FQZA 3KCYA 4R9BA 1I5PA 4OMCA 5BNNC 3WUDA 4J1WA 5FYIA 1JN2P 5FWEA 4ES8A 5JXIA 1OVPA 5FMDA 4CUBA 3AKSA 2AEZA 1T2XA 1XJAA 4MXWB 5F3IA 5FLIA 1VBD3 1XRUA 2DTYA 4NHXA 1SHWB 3FWEA 2JG9C 5C4WC 3W58A 3ZFEC 3VKNA 3MUY1 2ZHMA 1NA1B 3DEMA 3NMBA 4XBQA 2WO2A 2PLV3 5IJRA 3ZPOA 1QJZA 1YI7A 2VXJA 1F4AA 1W9YA 1XQNA 1HJGA 4DIQA 4E8CA 1NUKA 1XNCA 3UL2A 2WT1A 4R4XA 3VN4A 5JDBA 3L2YA 3OEBA 4CP9A 5FLJA 3AKPA 5C9AB 1OD5A 2JIJA 4NRMA 1CAVB 2RS11 3T3YA 1QEXA 1DGWA 2GZWA 1UZYA 3HT1A 1JH5A 4DB5A 5H9SA 4ASLA 1GLHA 4KWUA 4XXAA 4EN7B 4XCAA 4BPZA 3OGGA 3DN7A 4RGGA 2WNUA 2W1SA 3GJAA 4LO4B 5JI9A 5JOZA 1PK6B 3GALA 4ORFA 3X29B 1VRBA 3ALQA 4R9CA 4ZU4A 4BQ4A 1V70A 1QJX1 1MQTA 3KVBA 5FZAA 2Z42A 2AENA 2QTWB 1J58A 1VBA2 4NRQA 4XHBA 2DFBA 3LA3A 4FAGA 4PBOA 4AQ2A 2PHRA 4XJUA 1SLIA 4B4PA 5AC91 1RUD1 3KT4A 3E6DA 4FFIA 2D5HA 3SCFA 5LBEA 5IVVA 1TE1B 4OHVA 3CNAA 1XE7A 2H0BA 4IV3A 1FT9A 1BEV2 1VBB3 4YGEA 1FPN1 1I3HA 1OLMA 2VZSA 2JG8B 5FZBA 3I3MA 3H7YA 3LB9A 5JOXA 1RUE1 1U5YA 4KL1A 5JVVA 1VRH3 1J3PA 2Q1ZB 1O7FA 2ZX2A 3MLJA 2FDIA 4OI0A 1LU2A 1B35C 2YGMA 3VKFC 3AM2A 1HRI1 1R091 2W92A 3VL8A 1LHNA 3K75B 1A78A 4XIKA 1O3QA 3ZR5A 2VVEA 4AGGA 5F5AA 4PCRA 5F5IA 5A7NA 3H8RA 1J3RA 5GM0A 5JPNB 2YV8A 2NYYA 4A7ZA 2OIIA 3AFKA 1WCKA 4JCKA 2DBIA 3E5QA 4WVMA 5ISLA 3GGLA 4FPHA 1RUG1 4FFHA 3VB9A 3ENRA 2BQPA 4YSFA 3O1PA 5K8SA 2HWF2 2ZGPA 5FZOA 2RHPA 2YDEA 1LECA 2WZR2 1HQWA 3QLQA 1YQCA 4MGZE 1CIWA 4K3UA 1W04A 4I3PA 1YRZA 1BEV3 3GNEA 1ZRDA 1W99A 2C9KA 2OZJA 4CSWA 1JOPA 2BEOA 4HXCA 3MIDA 3VBOC 4PLOA 1VMFA 3U4SA 2R072 2EXIA 2GC1A 2FCVA 2XLFA 3HNBM 4AGVA 4HKWA 1IZ3A 4FFGA 3VDDA 4XVHA 3RZLA 4OHYA 2DVGA 1ULCA 3POGA 5IYYA 4YM3A 1UYYA 3FBYA 3OG2A 4FXKB 1GQPA 1W06A 1YFWA 4QKDA 4C91A 3A0KA 4Q0UA 1K5MA 1MZFA 2BU9A 4LIVA 3VBFC 5FZ9A 1PGL1 1FI2A 5FO8B 3MFAA 4QAWA 3ILRA 1LULA 5IVBA 2VUDA 1GZWB 3N9OA 1QJEA 1SPPB 1QOSA 1GBGA 2GC3A 3KT7A 1Q8OA 3KV6A 2XR4A 5A80A 4CDQB 2YXSA 2WWUA 4YZ5A 2GMMA 4UW3A 2D93A 2C9AA 4LBLA 3VBUB 2HWF3 3VZOA 4GH4B 1S2KA 2WZR3 2VZVA 4KWLA 5JXHA 4XW3A 1RUF2 5FZ0A 4XJWA 4QPWA 4QX0A 2DU1A 2X8KA 5T5PA 3R4DB 4WM8C 1RUI1 2BRTA 3AYAA 1RB8G 4L11A 5A1AA 2ATFA 3MLLA 4UF0B 2R073 1SLLA 3BU0A 2BPA2 4JQRA 1X8MA 4KWJA 2B39A 1WKYA 1KXGA 3ZXLA 1LOFC 4DXSA 2PELA 3TEYA 4BIFA 1IQAA 3J7NA 5IVFA 1W8WA 3VD3A 5FO9B 3CJIA 3IDBB 4JGZB 4YVSC 5FJKA 1BLZA 2FDHA 3ACLA 1RJ8A 2VOVA 4X6QB 2P17A 1W8UA 1LOAA 2GH2A 2Y6FA 3VBSA 1NCQA 2HWE1 2KR2A 5LY1A 2I07B 3UT0A 4GMP1 1JYTA 2GAUA 1JI6A 2P1BA 5HCHA 4XUPA 2SBAA 4QU1A 2GU9A 2XBO2 1W03A 2PFWA 1S0EA 3H42B 1LGBA 2ARCA 1EAH2 1O3RA 2JE8A 1UF2C 2WZEA 4MH0E 2CWMA 2JIGA 4ISQA 5CZKA 1YJLA 4OMDA 2Z4FA 5EHDA 1AR81 3PDQA 1XYOA 3WF0A 1PVXA 3AC0A 2AUYA 2YPJA 1PIV1 4NIDA 5KR7A 1DGWX 2W5FA 3C3VA 5A7QA 4XPVA 3MZHA 1QDCA 1POV0 1UPIA 3IKWA 2FDFA 1KJRA 4D6SA 4LJHA 4Y20A 2XQXA 3C8XA 3B69A 4MHUA 4JGYA 3KCCA 3BIEA 3I54A 1QQP1 5A70A 4Z82A 5ACA3 4GKXA 5C4WA 1IS5A 4HK9A 1GP5A 3V65A 2B9UA 1YCIA 3ZFEA 5FPUA 1UY1A 3T4HB 3K46A 4ISRA 5HI0A 3BVCA 4BXFA 2R061 1NKGA 1PO13 3I3QA 3LSEA 5F6LB 5B4XA 1BHGA 4AVBA 2UURA 2YFUA 2ZEZA 2VD7A 4Z07A 1C28A 5JZGC 1LESA 1R081 4LA3A 1O4ZA 2W0XA 4V2WA 3SHRA 3UV9A 1PHMA 1JYVA 5T55A 1W8TA 4W6WA 3KVAA 3UESA 5FMOL 4AI8A 4QB2A 2W87A 2VU9A 2YU1A 5FWJA 1I1EA 2Q1FA 1X9PA 4ASMB 5G05L 1W6MA 4MGIE 2L9LA 4CU8A 1O3SA 2TNFA 1NLRA 2A7AA 1LHUA 2RS12 1JOBA 1AXZA 1DZTA 3AB0A 4H2AA 3NJYA 1V6LA 4GQ7A 3PHMA 5JOYA 4Q2FA 5FZKA 1JU4A 4IE6A 3ZYFA 4CEWC 2ORZA 3OGRA 4JHZA 5EV7A 5LBFA 4HPKA 2FCUA 3N9PA 4BYYA 2RS53 2BDRA 3NNGA 4IGQA 4ZKTB 4U36A 5I8SA 3SEEA 3U07A 3ZFFB 3ZN6A 2IVIB 4QDQA 5FXVA 2D3SA 3POJA 1AYM1 4KGGA 4IE7A 1H6YA 2A75A 1QJX2 5L7OC 3U14A 4MGTA 5T54A 5A7WB 4OI1A 3U1XA 3IPVA 3M3EA 5EWSA 4AAPA 4QXCA 5AC92 1RUD2 1FNZA 1SDDB 3MW2A 4JC1A 4UFIA 3THDA 5AFBA 1JZ6A 4PIXA 3BI3A 2WL1A 1RC6A 5J09A 3SXWA 3R0RA 3ASIA 2ZEYA 4MGKE 4RS5A 5CFDB 3ACGA 3P6BA 2ZEXA 4PT6A 1CZSA 2RS13 2AEYA 1GV9A 1RUE2 2DFCA 1RUC1 2HEWF 3LDRA 1ST8A 2XMLA 4N43C 4ZS3A 5IVYA 1AJKA 3SH3A 3KF5A 4BQYA 2C5DA 3ZFGC 1OFNA 1UX6A 2VCMA 4JQTA 5IW0A 4K40A 5A3WA 2IXLA 3I2HA 4DRRA 4NVPA 4IV1B 5BPXA 3I59B 4MYEA 1MS8A 2ET1A 2EVXA 4FPJA 4GZ9A 1IQDC 1G7YA 1X33A 2VOTA 2OUJA 5DXDA 5ABJC 1KDMA 4NJ4A 4PJYA 1RVF1 1UY4A 4Q4V1 3SEPA 5A3PA 2UU8A 2RDQA 1QJX3 3K4DA 1GP4A 1ND3B 4WZCA 3DYPA 4DUWA 1RUG2 1PZ9A 3VDBA 3FN9A 3LSDA 1B09A 3IZOA 4FCAA 4GB31 4V2VA 5AC93 5C3QA 2N7GA 1GWLA 1RINA 1SCSA 1ENRA 2GC0A 3VBOA 4WV8A 4OYUA 5A32A 3CU7A 1N1YA 2EXHA 2XPJA 2V09A 4XDPA 1FPN3 4HZFA 1ZRCA 1X7NA 4ZONA 1JZ3A 2PXJA 5FO7B 5FYMA 2UYBA 4IGPA 3BB6A 3TEXA 5CA6A 1RMU1 2H0VA 1VP6A 5IK7A 3LKJA 3VBFA 1HRI3 1R093 2XG3A 3BYWA 4KI5M 1ULPA 2PHWA 2WC2A 3ZVXA 1WWYA 4CXYA 5DDJ3 2WWSA 1BXHA 3NV1A 2OW4A 1SFYA 4B29A 3RZJA 4QXBA 2XJVA 5FZIA 1N1VA 2Z79A 4CUCA 4QT6A 1PGL2 1ZZ7A 2XJUA 1AXKA 3BUCA 3WDYA 1LTEA 2WA3A 3NJXA 1QH6A 1QKQA 3ZIXA 2PHTA 2TBVA 3ZO0B 4HETA 5A7OA 3FJSA 4FPYA 4QX5A 1W0PA 1ZA4A 1GNZA 2C4XA 5M0TA 2QCSB 1BJQA 1W6NA 2VMCA 2PAKA 3A21A 5GZEA 3SCHA 3T30A 3WUCA 1NG0A 4WM8A 5A3MA 3MDPA 2J1AA 3O1TA 3ZSKA 1VBE3 5FYCA 1WGPA 2HBTA 2GMEA 2WNVB 1LOFA 4CDXB 2GNBA 4XQWA 3WP6A 1RUI2 2ZX4A 4ITCA 3LE0A 2ZX3A 2C0ZA 4CEYB 4XFFA 4ZU5A 2ET7A 1OSGA 1REDA 2XJRA 1TEIA 3KMHA 3ZXAC 4AVCA 4CDWB 2RVAA 4LKEA 3FMGA 1JZ4A 1US2A 1Q5OA 5DAVA 3M3OA 3ZDSA 1YUDA 4IEWA 1XE0A 1CD3G 3AX4A 4FFFA 5FY7A 5L9BA 2GMPA 5BNPB 3T0AA 2HWE2 2IVJA 1W8HA 3ACIA 2GN7A 2VUCA 1Q8QA 5D21A 4TTGA 3PIJA 5A33A 1HQLA 2XUMA 4EZHA 2WZPP 2W39A 4K1ZA 5AVAA 4DY5A 4GIQA 3W5MA 4YW3A 4N90A 1OOPB 1VBD1 3K2OA 4FO9A 4A7YA 5JLVA 3W21A 3CHXA 2QJVA 2HWB1 1AR82 4QPIC 2F17A 2AYHA 4Z2AA 4M3CA 4YG3A 2JWPA 4CCNA 5LW9A 4NWVA 2PLV1 1VAVA 4DQAA 1RUI3 1T6GC 1OF4A 3WV6A 2EAKA 4DXRA 3FBMA 5FDBA 1QOTA 4Y1YA 2R0HA 3MPPG 1IS6A 2W47A 3S7EA 1WCUA 3PVBB 4X6RB 5GKAC 5JZGA 4CCEA 1EP0A 2YHJA 3PUHA 5I0DA 5I91A 3RYKA 1OKOA 2JB4A 1UO9A 4LBQA 2R062 4RQPB 4DUVA 2JEMA 1EPZA 5DQ0A 4B7KA 5CIRA 1RUJ3 5CKQA 3CJXA 5FZMA 5FQ0B 3DPRC 1R082 1UXZA 3P1IA 4Q4W3 3HR9A 4GMP3 2E53A 2BJSA 1C5IA 1DG6A 1W6PA 1E5RA 2E6VA 2G9FA 2Q5TA 2W2IA 2SLIA 3DXUA 3GF6A 4LIUA 5L9RA 2HEVF 4C1XA 4MG2A 5EZWA 2XDVA 1SBEA 1UYZA 1K3IA 5BYNA 2ARAA 2XJPA 3USUA 2XGXA 5FP3A 4CEWA 2FMYA 4NIAA 2FQPA 3ZXJA 1SFPA 2NPIA 1OLME 1PIV3 2WSVA 1GKBA 4M01A 4QXHA 3VZMA 1XNAA 4SLIA 4YVWB 5FY8A 1V00A 4P9IA 5DUWA 5D8AB 4GWJA 4FPEA 2WYFA 2NZ9A 5A3UA 3WCRA 5DUUA 3PL0A 3TAYA 5F32A 1QQP3 1VBB1 2EIBA 4LHSA 3ZN4A 2P37A 5JMCA 5L7OA 4S2DA 4BMBA 2WIIB 2DVDA 3HBZA 1VRH1 1AYM2 2R063 3NL1A 4LTAA 3K3OA 3U75A 4XFHA 3KZ4C 3ZPYA 1XU1A 1LHWA 1V6JA 5F7UA 1AX0A 2YBPA 4XILA 4AHWA 4GAZA 4OI4A 1CPNA 1W39A 3ZR6A 3ACHA 2ZGRA 1GQGA 1D2SA 1H4GA 2XB6C 3HN1A 4G4FA 4A45A 3B9CA 1UIKA 1C8M3 2D6KA 1OA3A 1S0DA 1UOJA 4M0NA 1XNTA 4E4DX 3PUIA 4BE3A 3LD8A 1ASJ1 4HKLA 4Y1UA 4XAAA 4XQDA 2GNMA 1RL3A 4AR2A 1UY0A 1IG0A 3I8TA 1MS4A 4NHKA 1RUC2 4QKFA 1E57A 3AKTA 3K4AA 3UJQA 4LBKA 4Y5SA 5C3PA 4TN7A 2VJXA 5CG9A 5ABJA 3LEKA 3H3UA 3JB4C 2YB7A 3C7EA 4K21A 5BNOB 1QU0A 5ANQA 3WXPA 4N9IA 2JE9A 4QM9A 2XKOA 4X8NA 4NHYA 1PMJX 3AJZA 1WMEA 3DYMA 4J25A 1AYM3 1UMIA 1RVF2 1W6QA 1UX7A 3H8UA 1OD3A 3HNYM 1NCRC 4NMIA 2ZZQA 4CP1A 1VB2A 4QQPA 2O8QA 2QQKA 3HN3A 3MV01 3VKLA 3MV11 5CKMA 4GB32 5G04L 4A6OA 3NSTA 4Y1XA 5KXDA 1W8FA 2AREA 4LHLA 2IZWA 5I8YA 4NPLA 5FKBA 4CP2A 3ETQA 4IW3A 4EN9B 2QBXA 4N53C 4NRPA 3WNLA 3N7LA 1D7PM 3BODA 4KGQA 1H2MA 4UFMA 4OZXA 1ENQA 4QPYA 1RUC3 2Y6GA 3C7FA 1JYNA 1YIFA 3LIHA 1VLNA 2XKPA 2RE9A 3S5QA 5C5TA 2G4IA 2DF7A 3FUQA 4P9WA 3O1SA 1IGOA 1X9TA 3JCIA 4C0HA 1CGPA 4P08A 1L7QA 2D6NA 3O0XA 3VBHC 5A7PA 3ZXEA 2ZTNA 1LENA 1OQ1A 2W46A 1HV1A 3GHMA 4IXLA 1UKRA 4CP9B 2WS91 5FZ1A 4Y5TA 4L0PA 3FC0A 4Q4V3 1BK1A 1W28A 2A3WA 2OA2A 2OVUA 2W94A 1BVP1 5FLHA 4IUGA 2XHNA 1D4M1 4FSJA 3KHCA 5DAXA 3VZLA 1SEFA 1JODA 1NLSA 1DCSA 2BP6A 4GB33 3T08A 3VBRC 4C90A 5LATA 1Y7BA 4NIGA 4QHZA 1YFXA 4XACA 1SLCA 3UK9A 1NT0A 2WNUB 1OPMA 3H0OA 5A7SA 2R7EB 1Q3EA 1SDWA 3W9AA 3OPZA 4LO8A 1O59A 2ZA9A 3VHNA 1UKGA 3VV1A 1LOCA
chains in the Genus database with same CATH topology
2ES3A 3WR0A 1WLCA 1ND2A 4XYXA 1LOEA 1WLWA 2PHUA 3MFCA 4H3WA 3WDXA 1RMU3 1FV3A 1AL21 2D3PA 4D69A 2JE7A 2K0GA 4KQ7A 3TBDA 1QXPA 4D94A 4UBGA 3AYCA 4E9KA 3P3NA 4LBJA 2NQYA 4IV3B 4BH9A 4ATEA 2GNTA 4YLZA 5GZGA 4HVQA 3RYPA 4KG8A 5J3UA 1G6NA 1I6XA 4I0WB 4UXAA 4XBNA 5ACA1 2VUAA 3RJRA 5CFCA 3KSCA 3IM0A 3BIWE 3JUUA 1VBD2 1PO11 2HWB2 1POV3 2ZOEB 3AYDA 5CAZA 4LE4A 1NQJA 3FUOA 4BZ4A 3OJBA 1GR3A 2PLV2 5C9AC 1BCXA 3CO2A 3OY8A 4WVMB 3M70A 1NXD1 2DUOA 2PHFA 3J26N 1N1TA 3M3CA 1HKDA 1ENXA 3DPRA 2P34A 3TB0A 3UKVA 4PQ9A 4KH9A 5F1RA 1X50A 2LTNA 5TSWA 2RS51 3NV4A 4XDQA 1CJPA 1WW6A 3FLPA 4WVWA 4Q26A 1S0GA 4QQHA 3VDDB 1ZVFA 3AK0A 1RTVA 2Z2SB 4YZ4A 2HWB3 2UY8A 4FTBA 1K5MB 2KXLA 1GFF2 3SNMA 3WG2A 1EV13 1TQ5A 4WBBA 2JG8C 2BFUS 3AMNA 1D0HA 2OYZA 3AXDA 1OLQA 4JDOA 3WP5A 3J8F3 2ZABA 1H1MA 4WM7A 4FOWA 1VBB2 3FE5A 3DGTA 3PVOA 4RL7A 4CDUC 1FNYA 1VRH2 1PNGA 2HWC3 1GZCA 4QPGA 4AQTA 3N3HA 5BV6A 5KHIA 3ZSJA 5BUVA 2BNNA 1DQ5A 1CJDA 5BY5A 4ONUA 4RHV1 3B5LB 2A3YA 4MGYE 3O0WA 5IUQA 4QMAA 5JAXA 3D4KA 1DFQA 4EN8B 3VHPA 1PGW1 3V0AA 2JXAA 1ASJ2 5K0UA 2PTMA 3CJIB 4FP2A 1CONA 4XTPA 3K51A 3RZZA 1QXRA 4PBPA 1YYNA 4FXGB 3VBSB 4FVVA 1NCQB 3BOWA 1ZZCA 3H1WA 3KGZA 2BW8A 3HQXA 2BWAA 4XJ8A 4TWTA 2DUPA 1KFXL 3JB8A 1O3TA 4OVEA 1FOD3 4I01A 2D97A 1NCRA 3T1LA 1XNDA 4XJAA 3AZWA 3FZ3A 5GZFA 1LHOA 3S0MA 5K7PA 3AKRA 3D8CA 4IEXA 4GULA 1HQNA 5FAXA 4GA9A 2BWCA 3IDCB 5DZFA 4Z1VA 5KC5A 1AYN1 4ES9A 1H8TB 3OYWA 5DDJ1 5FRAA 4Y20B 1HX6A 3IIAA 4JGYB 2VVFA 1DYPA 2LM3A 4CDQC 4H7LA 5C4WB 4YM2A 2R043 1ASJ3 4GH4C 3ZFEB 1C1FA 1HIXA 3E5XA 2P3IA 3S7IA 5T5JA 3O0VA 5JPMB 1IKQA 3NV3A 4IEUA 3WLUA 4AQSA 1CPMA 2XVLA 3V56A 1O4YA 3BOPA 5LEKA 1VBE1 1Y43B 4FP3A 1PVC3 3VHRA 1W6MB 3CLPA 1QMJA 5JIUA 2WS92 5DG1A 4JGZC 4N7IA 5IK5A 2ZGMA 1O4TA 3THPA 3VBRA 4BIOA 3P3PA 1BBT1 4L92A 5FCCA 1D4M2 1GSLA 3KLSA 3HAGA 5E88A 1AR61 4HPKB 4YW4A 2ZAHA 1HW5A 4QHBA 3DKWA 1Q43A 3ZYIB 3ZN6B 5CU1A 4UW5A 3H50A 1FV2A 3M4FA 4DOUA 4H14A 5KXBA 4YNIA 5SV8A 4V1PA 4M3CE 4P9XA 1UU4A 1O91A 4AE2A 2NMOA 1H8VA 1DQ0A 2A6WA 1AL22 4DMIA 1V9U1 3ZYGA 1YFUA 4FPCA 2E7AA 3R05A 3UKNA 2MNGA 4GKYA 4W6XA 2PAMA 3S6PA 2RJKA 4IEPA 4RS5B 1ZZ6A 1CVNA 2WS93 1ZZ8A 3NKGA 3ST7A 2WNEA 2Q1MA 1W6OA 1ZBE3 3RSJA 1D4M3 5ACA2 1SLTA 3ES1A 2EXKA 3JD71 1M06G 1S0IA 4EWEA 2CY6A 1PO12 1IS4A 1XE8A 3JZVA 2O1QA 1A3KA 1RUJ1 4XBLA 1OMIA 4IEYA 4B7EA 4AW7A 3WW4A 3MIGA 4Q4W1 2WSUA 4Z8BA 2JDZA 4IQPA 1JUIA 2P3KA 3GZUC 3WDTA 2ZKLA 2B46X 1AL23 3A4UA 4H55A 5J98B 1A8MA 1BVVA 3MGUA 5KBFA 4XETA 5BNNA 4GWNA 3ZFFC 3VBOB 2ZGUA 4AI2A 3WQ7A 4YZ1A 1S2BA 2EALA 3PVNA 4DY3A 3AP9A 4D7YA 2ZX1A 2RS52 4F83A 1QJU1 2Y38A 2JG9A 4PDWC 2CWSA 3VBFB 2E7QA 4QQOA 5CADA 1AL0G 1MVQA 3IWZA 2A73B 5KHJA 3MW3A 5CFDC 2ZGKA 2RM21 4LBOA 4YFZA 3GZAA 3OBTA 2QZ2A 4MUVA 3VZNA 1C8M1 4CDUA 4OLLA 1WBLA 1IKPA 3VLBB 1H9WA 3NW4A 1WD3A 4P9GA 1C3HA 2QQPA 1CX4A 1W6NB 3RYRA 1LEMA 4QQLA 2JJ6A 3BALA 4IV1C 4WM8B 4FTSA 2ZGTA 1AXYA 4TYSA 2VXRA 2W52A 3U4XA 4YW1A 3N7JA 2ZGOA 4Q0SA 1MEC1 5GLUA 4RHV2 2D7FA 3MF9A 4AFCA 4RR3C 3MICA 1ENSA 2DTWA 1G9CA 1APNA 3WP3A 2WKKA 1YHFA 1TMF3 1PGW2 2ZMKA 4XF0A 5JR7B 2X5IC 1YJKA 2ZMNA 1QNWA 4COUA 5KWRA 5E8AA 4SBVA 4YM0A 1PM7A 4XFBA 1AJOA 1CQ9A 5IK8A 1BQPA 1LCLA 1AX2A 1Z78A 1U5IA 1WLDA 1B35A 1FPN2 3D0JA 4LO5B 4HVRA 3AMPA 2VW0A 1SBFA 5LK7B 2A5ZA 1R1A3 4NWWA 3AKQA 2HKXA 4NO4A 2EIGA 3JQWA 2Z5WA 1NXMA 1HRI2 1R092 3GBWA 3FFQA 1AYN2 3EJKA 5DDJ2 4XMAA 3CF6E 4HSJA 4RHV3 3ES4A 1V6KA 3DL3A 1KRIA 3TN93 5EYXA 1RHI3 4HMZA 4OFGA 5JZGB 4QGLA 4AI1A 2CAVA 2ZHLA 4LBQB 4XZPA 4S2HA 3B3QE 4MZUA 3JU9A 2A6VA 2VECA 4P9LA 4HK8A 4LNVA 3N4MA 4CDXC 4NHLA 1W6PB 4D7SA 4G9SB 4YRDA 4JGZA 4Q1RA 1UZZA 5T3NA 3SISA 4CEYC 1ZZBA 3QCWA 4EN6B 1VBE2 1LOBA 3AZXA 4JTNA 1TME1 3VHOA 1JXNA 3USUB 4FQ4A 1DZRA 4CEWB 2XH6A 1KS5A 3WHTA 4HKOA 1EY2A 1BBT2 1N3OA 3B9IA 5BNPC 2IXCA 1BYHA 2PHDA 2WLQA 2Y0IA 3AZYA 3KB5A 1AYN3 3PTYA 4QGMA 4S2FA 2JX9A 3RJ2X 3QOPA 4PLMA 1I9RA 1J1TA 2QDNA 5L7OB 4R9AA 1CAWA 1IOAA 1YFYA 1YXWA 4JDMA 4N9HA 3QBQA 3WG4A 5C8WA 1DU3D 5EYYA 2PYTA 3OBRA 4HANA 1V9U2 1POV1 1S1AA 2OUHA 2A3XA 5FFOC 5T52A 1DHKB 3A0NA 3B00A 2D5FA 3M1HA 4XEZA 1LGNA 2F4PA 2BBVA 4O9GA 4YVSA 2NMNA 4D3WA 3IBMA 1BBT3 2RJLA 3TOJA 3VKMA 3MYXA 1HDKA 4FPOB 4B3NA 3JD72 4FPFA 1AR63 4YM1A 5ABJB 3SLIA 5JSOA 1JYIA 1MS5A 2CL2A 1RUJ2 3PLQA 2PA7A 4Q4W2 1RUH3 1BKZA 2R6QA 3PNAA 4OHWA 2IXKA 1W6QB 1YNAA 3LOIA 1MVEA 3ZFFA 1URXA 2ZAAA 4OULA 4YVWC 3MPBA 1V9U3 5J7MA 3OD0A 4PIYA 1PIV2 4XIOA 4A3XA 1EV11 4PDWA 1TNFA 2VNRA 5C8CC 5AFEA 1QJU2 3J8F1 2NM1A 1QQP2 1V6MA 1GZ9A 1XXNA 1CESA 5GALA 3JD73 3O12A 3H1YA 4UW6A 3HT2A 2XL9A 2HWC1 5H9QA 1G86A 3VZJA 2A70A 2RR13 2NN8A 1KQRA 1LOGA 4LLOA 4Y22A 5JSPA 2CTVA 2RM22 5H9RA 1C8M2 4IV1A 1H9PA 3VKOA 3H9AA 3WOGA 3RDIA 1ZBA1 2DURA 3DUIA 3NWKA 2K2SA 5D1IA 2WFF1 1LR5A 1XYNA 3POYA 1UAIA 3R4UA 4IETA 4RR3A 2XJSA 3EXUA 3PJQA 4MVTA 1ND2B 1MS0A 1QJU3 2X5IA 1H1AA 1MEC2 1S0FA 1FOD1 4AF9A 1ALYA 4L8QA 2E51A 4B8EA 1AVBA 4Q0QA 3D6EA 4Z2WA 1REFA 4IEZA 4AFAA 3SCGA 4AVTA 5C33A 1X8EA 2DWRA 2I74A 2D6LX 1LHVA 1UU5A 4E4ZA 5E1RA 1V6OA 3FLRA 3NO8A 2RM23 1JYCA 1NYWA 4N7UA 3T2TA 1DLLA 5CFCB 4N43A 2EXJA 2AZ5A 3KS7A 2R041 4FOQA 3VZKA 3ZFGA 5DZGA 4BLJA 3POSA 4RSUA 1I5ZA 4Z92B 2YGLA 4MV2A 4W6YA 3ZYRA 1SQ4A 1KD7A 3INAA 3OY8B 1MEC3 2IC1A 4XF9A 4AFDA 1PVC1 1WBFA 4AEDC 3EHKA 3LGRA 5J37A 3VUOA 5SV5A 1LKNA 2QKDA 4Q4V2 5FOJB 2WNUC 3U0ZA 3M3IA 2ZKNA 4AYUA 1HV0A 1FX5A 5GLTA 2ARXA 1COV1 2VMIA 2JD4A 2RS31 1CAUA 3MIHA 3WG3A 1KFUL 1ZNPA 1WUVA 4FAHA 4YG0A 4LT5A 1C1LA 1TME2 2ZHKA 1ULEA 4J6GA 3T1MA 4XFGA 5BNQA 2FBEA 3BTAA 3QH7A 1RMU2 5KC6A 4XXPA 4KU7A 3WD5A 1O5LA 5F6KA 4QU2A 1DGRA 2ILMA 4H7MA 4AEJA 3RMXA 1U12A 3JBG1 1QJY1 3ZSLA 4WM7B 2PHXA 3VGIA 1LU1A 3FLTA 2IXHA 2B7YA 1MS3A 4IERA 3AZVA 4L97A 1ZBE1 4S2GA 1QDOA 2VNOA 3IN9A 4Q1PA 4QPGB 1G9AA 1F5JA 2UWCA 4K9SA 4KU8A 2TEPA 4COWA 1PMIA 3ZYJB 4AGRA 2X29A 2LALA 3NAPC 3ZXDA 2W08A 4TSVA 1TME3 4EJRA 3V0AB 3RS6A 5K0UB 1SLAA 4D7TA 3CL1A 4JAAA 3KM5A 5CNAA 4F8AA 4G3YC 1MQTB 2I45A 4Q4Y3 3PMEA 1Y9QA 1G9BA 5KHHA 3TNQA 2ZMLA 5GLZA 1IPKA 4META 1YLLA 2Q30A 5GLVA 3GZTB 2VOXA 4LE3A 3B7MA 1U5XA 1NCRB 4E2GA 3AFGA 4R4ZA 1ZX5A 4RA0A 4Q0VA 2D44A 4HBNA 3WX5A 1JOJA 1TNRA 2D98A 1K5MC 4QPIA 2VQAA 4OHZA 1NA1C 2BTVC 5CBLA 2XVGA 4K6BA 3CEWA 3OYWB 3G6JB 2XWJB 2XVKA 4AHYA 2HYKA 5C8CA 2B8MA 2VNGA 4CRQA 1EV12 4ATFA 4LR4A 5CB7A 1N3QA 5LRRA 2D6OX 4AI0A 4PLNA 3B01A 2NP0A 3JQXA 3J8F2 4LUKA 3ZSEA 2D6MA 3WNXA 3V0BA 2VY0A 1J59A 2R32A 1LRHA 3MIFA 3O7OA 2R1DA 1NOVA 2IFRA 4HN1A 4XTMA 3W59A 2QE3A 2HWC2 3AMHA 3IMNA 1ULFA 5T50A 1VAMA 3WQ1A 1PK6C 3PJYA 1OQDA 2NLRA 3GYDA 3MI8A 4KWKA 5I0TA 1DIWA 1L3JA 1XNBA 1NY71 1PZ7A 4QM8A 2Q0AA 2QUOA 5HCBA 5EFUA 1XU2A 3ECQA 1N47A 1TMF1 1QGLA 2H6BA 1Q56A 2VMGA 3Q9OA 1AR91 1ZBA2 3IDEA 2A6ZA 4IL7A 4Y1ZA 2WFF2 1MZEA 5JI7A 4Q8KA 1F2NA 4KNCA 4DINB 1GNHA 3DV8A 2PN5A 3ZX7A 3G7DA 1ZREA 1Q8SA 2VW1A 1FOD2 4YW5A 1H8TC 2P3JA 4Q4X1 1YWKA 1D0GA 1QWRA 2WT0A 1R1A1 4JGYC 3D82A 3AZZA 3SMHA 1QHDA 4INDA 1Q8PA 2BGCA 4MSVA 2K9ZA 1LB2A 1W6OB 4HSLA 2QZ3A 4YYOA 2HWD1 3GBFA 1FMD3 3TYJA 2DCTA 3WDUA 2GSYA 2VH9A 3TN91 2BYVE 3E6BA 4GMP0 1RHI1 4C0BA 3KT1A 2R042 1OA2A 1ZBA3 3I4IA 3FHIB 3MF6A 3WINE 4DS0A 2VULA 3M8LA 2WFF3 1N1SA 3U10A 3DF0A 1Z7S1 5GJ6A 4W65A 3BU7A 3WW3A 2DVBA 1EPWA 2DVFA 1RGSA 4AEDA 1AUYA 1PVC2 5C6CA 3QH6A 3WY6A 2WQ4A 4DPNA 4FPKA 4AFMA 4YARA 4AG4A 5BNNB 4AXOA 1A6CA 4TZDA 1UCXA 3M7AA 3TWIA 3WDVA 4FPLA 4AHXA 4OUMA 4N53A 5GZCA 1W0OA 1COV2 5CG8A 2RS32 4XQ4A 1CAXA 3LA7A 2JG9B 1OLRA 5AVPA 5H9PA 5J48A 3VBUC 2W68A 4Y5Z0 4Q8LA 1HRV1 4MX3A 2HJIA 2ZS6B 3VBHA 3B02A 2DVAA 1RUOA 1XNKA 2YZ4A 4RS5C 1OKQA 1G8WA 4DRVA 5IT6A 1C8NA 2BNMA 5K9YA 3ZSMA 2VGDA 4CYDA 4ZXKA 4CDUB 3JBG2 1QJY2 3H1MA 2ZGLA 5EJ3A 1VB4A 5J96B 4BHPA 3K48A 1ZBE2 3I7DA 2R1BA 2WQZC 4XHXA 3NAPA 3UKTA 4QXKA 1COV3