1LEDA

Structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
243
structure length
243
Chain Sequence
ENTVNFTYPDFWSYSLKNGTEITFLGDATRIPGALQLTKTDANGNPVRSSAGQASYSEPVFLWDSTGKAASFYTSFTFLLKNYGAPTADGLAFFLAPVDSSVKDYGGFLGLFRHETAADPSKNQVVAVEFDTWINKDWNDPPYPHIGIDVNSIVSVATTRWENDDAYGSSIATAHITYDARSKILTVLLSYEHGRDYILSHVVDLAKVLPQKVRIGFSAGVGYDEVTYILSWHFFSTLDGTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords WEST-CENTRAL AFRICAN LEGUME LECTIN IV
publication title Structures of the lectin IV of Griffonia simplicifolia and its complex with the Lewis b human blood group determinant at 2.0 A resolution.
pubmed doi rcsb
source organism Griffonia simplicifolia
total genus 58
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ledA00
2A3WA 1FNYA 3SH5A 1UMZA 2LALA 3WDXA 3ZYPA 4R9BA 2JD4A 4FQZA 3PJQA 4XJWA 4YW1A 5CA6A 3WDVA 4D69A 2D44A 4XTPA 2DVBA 2EXHA 2ZGKA 3IPVB 5T55A 2D6KA 1UKGA 1KQRA 2P34A 2W39A 4M3CA 4R9CA 5EYXA 2OUJA 3FUQA 2GMPA 3OY8B 4AWDA 2DURA 4BQ1A 1JYCA 1V00A 4C1XA 3ILNA 3M3EA 1MVQA 3ZPYA 1F9KA 1LECA 4Q27A 3T1MA 1GSLA 3AZZA 1ENRA 3ZXJA 5GALA 1QDCA 2DVGA 2E7TA 4ATEA 3DUIA 2I2SA 2PHWA 2OW4A 3QCWA 1GZWB 4C1WA 3OBTA 4CZSA 1V6NA 2DUPA 3SH4A 3OY8A 3RMXA 3PMEA 3IM0A 2ZMNA 1DIWA 3AK0A 1V6IA 1VALA 2EALA 2D6PA 1MS5A 2JECA 4ISRA 3RSJA 1KJLA 1QF3A 5EYYA 1URXA 2D6LX 2DV9A 2LTNA 4LBMA 4AVVA 1H30A 2EAKA 4YZ1A 3N7LA 3RMYA 3WZ1A 3POYA 1GZWA 1W6QB 3B69A 3AP9A 2D6OX 1LCLA 4FPFA 1KDMA 5E88A 5DZGA 4WVVA 1MZ5A 4XIOA 2NYYA 5H9SA 3WG4A 1UX6A 4U2AA 4DRRA 4Y1XA 3SISA 3AP7A 3AZWA 1U0AA 1SLBA 2A7AA 2VU9A 5IUQA 1YI7A 2DU1A 5GZCA 2WNEA 1W6QA 4NO4A 5JLVA 2WSUA 4YZ5A 1LEMA 1GBGA 1S0CA 5DZEA 2NP0A 2GALA 1ZM1A 1AXKA 3D4KA 2XG3A 2ZHMA 4YZ3A 3W58A 4BMBA 3HN1A 4YM0A 1DQ0A 3IKWA 2R1BA 4PCRA 5E8AA 2JDZA 4K21A 2ZGPA 3V64A 5DZFA 4XE9A 1MS4A 1QDOA 2YXSA 2DYCA 5KXEA 1G7YA 3V65A 3AXDA 5GLTA 2E53A 1S0DA 5H9QA 2PELA 2YV8A 1A78A 1ONAA 2R16A 2XB6C 3MW2A 2ARBA 3TAYA 4FPYA 3W59A 4CRQA 5JOXA 3INAA 4Y22B 1J1TA 1DZQA 1RITA 4FOWA 1G9DA 1LEDA 3KM5A 1W0PA 4WV8A 2NMOA 2CWSA 4LBNA 1CONA 1Q8QA 4DS0A 4F83A 4YW2A 2JE7A 1BKZA 1UZYA 3D5OA 5DUUA 3VV1A 1CR7A 1LOEA 2OVUA 4FPEA 4OZXA 3AZXA 4CTEA 3USUB 1GV9A 2AYHA 1WD4A 1C4RA 2R0HA 1WW5A 5H9PA 2WT2A 4PF5A 4XBQA 4Y22A 5BYNA 1GNZA 1H9PA 2DU0A 2VXRA 3POWA 3ZVXA 4UW6A 1DQ2A 1WLDA 4LBKA 1QNWA 4PBPA 4L8QA 2ARXA 3GALA 4FPOB 2W08A 4P14A 4XMAA 3WUDA 1OFSA 3WV6A 3D6EA 3ENRA 1I1EA 3USUA 1MS9A 4XJ9A 1UN1A 2VH9A 1AVBA 1QMJA 1V6JA 2G4IA 2ZAAA 5EXOA 2R49A 2UWCA 3ZXEA 4YGBA 5JVVA 3OBRA 1A3KA 1EPWA 3WLUA 2ES3A 1SCSA 1JHNA 1W6OB 4GKYA 1PZ7A 1C1FA 3OYWA 1G9FA 1I3HA 4NOTA 2YZ4A 2DUQA 5T5OA 3M2MA 3H0OA 4YW4A 1AJKA 2CNAA 2EXIA 1Q56A 2YMZA 3A4UA 3AYAA 3VUOA 4RA0A 1ULCA 1Q8VA 1WLCA 1AZDA 3M1HA 4LBQB 1HKDA 3N7JA 4Y1VA 4AYUA 4P9YA 1W6NB 1W6OA 1O4YA 1QU0A 4XDQA 1DQ4A 2NZ9A 5IK4A 4GKXA 4JCKA 3T1LA 3OJBA 1IKPA 2NMNA 1LJ7A 3ILRA 1AX1A 4LBJA 3VKFC 2VW0A 4HANA 1FATA 4K1YA 3TB0A 1JUIA 3O0WA 4LBQA 4FP2A 4LBLA 2V5YA 1IS3A 2ZHLA 3ILFA 1DQ1A 3IPVA 5EWSA 1YRZA 2FMDA 4DQAA 4U36A 2WT0A 1C57A 1DFQA 2BQPA 1CIWA 1MS0A 3M3CA 1JYIA 2D3SA 1V6OA 4YG0A 1BXHA 4IQPA 1CN1A 2H0BA 3DGTA 1ULGA 2A71A 1D2SA 1C1LA 1LENA 1S1AA 4YW3A 1N3QA 3U4XA 3IN9A 4Y1YA 1GZCA 3M3OA 2A70A 1CESA 2ZGTA 3MW3A 4YGCA 5GLWA 3BOPA 1QNYA 2D6NA 5GZEA 4PBOA 4BM8A 1FYUA 4PQ9A 4WZFA 4YM3A 2AR6A 3IMNA 2DVDA 4Q1RA 2D43A 4XZPA 1LGBA 2DUOA 1SLIA 2DTWA 3A0NA 1MR5A 4M3CF 3WDUA 4DFSA 1LHOA 2EF6A 1ULEA 5IT6A 1CJPA 1MS8A 1SLTA 1PZ9A 1WBFA 2FHRA 4H55A 2P37A 2PHFA 1GNHA 1VAMA 5HCBA 4FOYA 3SH3A 1UAIA 2OUHA 1LODA 4Q8KA 3APBA 1W6PB 2CYFA 1ENSA 5T5PA 4R9AA 2E7QA 4BOWA 2GN3A 5T54A 4TZDA 3BTAA 4ASMB 5GJ6A 1DQ6A 2P3IA 3B00A 4LBQD 4BPZA 1X50A 4Z8BA 2PHTA 3V0AB 2GDFA 4AGGA 1N1YA 3BODA 1SBDA 2R1DA 2R0FA 1W6PA 5HCAA 4M3CE 3WG2A 3WDWA 1SLCA 3RRDA 1OQ1A 2GNDA 3UJOA 1WW7A 3FUOA 2DTYA 1DQ5A 2TEPA 1JW6A 1LOCA 4R9DA 2GNTA 3WCRA 4RL7A 5JDBA 1CQ9A 4TYSA 5DG1A 4YW5A 3FBYA 3ASIA 3V0AA 1YXWA 2UWBA 4GXLA 1DYPA 4XTMA 2P3KA 1LOFA 5IK5A 5T52A 5F9TA 2KM2A 2AENA 3JUUA 1FNZA 2EIGA 4XMIA 3AXEA 2YROA 1BQPA 3HMYA 3LCPA 5E89A 5F5QA 3SNMA 2ZGMA 1S0GA 1ZA4A 3PVOA 1MZ6A 1ULFA 2ZGQA 4K20A 2A6VA 4XYXA 3WDYA 1ENQA 2PHUA 2VW2A 3RS6A 1PZ8A 1HDKA 4SLIA 5IK7A 1VIWB 2CTVA 4I30A 1WBLA 1G9AA 4WVWA 3N7KA 4BLJA 1Q8PA 1SCRA 3WG3A 2A6WA 1H9WA 1S0IA 3POSA 5DUWA 3MW4A 1DBNA 4Q26A 1W0OA 2A75A 2NN8A 3SITA 3WG1A 5JOYA 2Q5TA 5CNAA 1FAYA 2GMEA 5GZFA 4Q8LA 1V6KA 1N1VA 1R1ZA 1N1TA 1LHUA 2D3RA 2W68A 3FLRA 3L2YA 4GALA 4YG3A 3VKLA 2GN7A 4FPGA 4FPKA 4FPHA 1SBFA 1Z0HA 3VKOA 3ZXFA 1LGCA 4XHXA 3AYDA 2A6ZA 2E6VA 1IS6A 3ZYRA 1FV2A 2ZGUA 3FLTA 3WVJA 3KQRA 1SACA 4XBNA 1BZWA 3UL2A 3WUCA 5DUVA 2CWMA 1N47A 2ZBJA 3Q9OA 1GICA 1KJRA 1YYNA 1Y7BA 2ZA9A 2ZHNA 3OGGA 1F31A 1O4ZA 2DVAA 2UWAA 4Y1ZA 5T5LA 4Y1UA 5KXCA 1Q8OA 1D0HA 1QKQA 1N3PA 4M3CB 2GNMA 1JN2P 4BLIA 1YO8A 4UW4A 3WCSA 4BMEA 1UZZA 2HYKA 4M01A 2DVFA 4UW3A 1YIFA 1W6NA 2SLIA 2UURA 2ZZJA 5CB7A 3FFZA 4XXPA 3ZSKA 1NXD1 3WHTA 1Z78A 1JXNA 3WDTA 1G86A 1QOTA 1LESA 1GYKA 5CAZA 2PHRA 2EXJA 1G8WA 2D3PA 3WOGA 4AVTA 5GZDA 2JKBA 1AF9A 3RQ0A 1GLHA 3VKNA 3B01A 4M00A 2D6MA 1IS5A 1QOOA 2ZGNA 2D7FA 4FP3A 1G9CA 1JBCA 1S0JA 3AYCA 4XXAA 3ZXKA 2PHXA 1SFYA 2ZABA 1F5FA 4FQ4A 2GNBA 5FREA 3T2TA 1AX0A 2ZGSA 4GA9A 1RIRA 3OPZA 3NV1A 2GMMA 1VLNA 4P9WA 3ZSMA 2AH2A 3GNEA 2RHPA 2ZGLA 3AJYA 3I8TA 1WW6A 3R4SA 4XJ8A 1ULDA 5GLVA 3WNXA 3M3QA 3V0BB 3R4UA 4XJUA 4HL0A 1JOJA 2JE9A 5T5JA 4AGVA 3I4IA 1IKQA 1LHWA 2ERFA 3PVEA 1QGLA 4XOGA 1XQNA 4XILA 1FV3A 1GKBA 3UK9A 3HR9A 1GANA 1V6LA 4AVSA 3A0KA 3AFKA 3AX4A 1KRIA 2C5DA 5SV8A 1AXZA 4YM2A 2WSVA 4FOQA 4YGEA 2A6YA 2C9AA 4ATFA 4Y24A 2A6XA 1LULA 1S0FA 3V0BA 1LHNA 4FPLA 3FLPA 1DGLA 1RINA 4P9XA 1A8DA 2Z42A 1B09A 3ATGA 2ZKNA 2EXKA 2V73A 2ZHKA 2W52A 4XIKA 1MS1A 2A5ZA 3NV3A 5IK8A 2B7YA 1APNA 1LGNA 3LSEA 3O5SA 1LOAA 4YFZA 5JOZA 1GZ9A 5KXBA 1WCSA 5LK5A 1SLLA 2WQZC 4YLZA 3QLQA 4JRAA 4UW5A 1FX5A 1MVEA 4YM1A 3UJQA 1N3OA 1BJQA 1CPNA 5L73A 5KXDA 3AJZA 3AZYA 3AYEA 5JOWA 1AX2A 4FVVA 4XBLA 1LOBA 1DHKB 2P2KA 4KBBA 1AXYA 2ZACA 4Q2FA 2SBAA 5DG2A 1LOGA 2VY0A 3N7MA 1WUVA 2WJSA 4XJZA 1HQWA 1NLSA 3MEPA 4Q1PA 1UPSA 3AP5A 2ENRA 2VW1A 5CBLA 2A3YA 4FPJA 1CPMA 4YZ2A 4LBOA 2AUYA 5FRAA 4ITCA 1CVNA 2E51A 2AREA 3NV2A 3B9CA 1KDKA 2JJ6A 1IOAA 2WT1A 3N36A 3WHUA 1LTEA 4YGDA 4GWMA 3N35A 3PVNA 5H9RA 3ZSJA 3ZXLA 4MYEA 1DYKA 3C2UA 4ZXKA 4FPCA 4XJAA 5GLZA 4YG6A 5AVAA 4Y26A 1SBEA 2ZGOA 1OKQA 4ISQA 3SLIA 4YFWA 3VKMA 3AP6A 1WW4A 1LU1A 2VUAA 3MPPG 5GLUA 1UL9A 1S0BA 4AGRA 1WLWA 2WLQA 1AJOA 1W6MB 1Q8SA 1LU2A 3NV4A 5DXDA 2CY6A 3AP4A 3O12A 2A3XA 2ZGRA 4FOVA 4Y20B 3JU9A 3OYWB 4GWNA 5DUXA 3RG0A 1BYHA 3O0XA 1QOSA 1V6MA 5JMCA 3R05A 2YY1A 3BIWE 1HQLA 1MACA 2UU8A 1HLCA 3ZSLA 3B3QE 1LOFC 4JC1A 1IS4A 1N1SA 1G9BA 1MS3A 5T50A 2CL2A 1W6MA 2ZMKA 1SLAA 2WKKA 5GZGA 1KITA 2NM1A 3CNAA 2AGSA 4K1ZA 4XHBA 4W65A 3NWKA 1S0EA 4Y20A 1TEIA 3O0VA 1DLLA 4YZ4A 2DWRA 1VAVA 4ZKTB 5HCFA 4DPNA 2ZMLA 1LHVA 3AZVA 5GM0A 1WD3A 3N3HA 2P3JA 3LSDA 4DRVA
chains in the Genus database with same CATH superfamily
2A3WA 1FNYA 4QGNA 5ABJB 2HWD3 1OLME 4BIOA 4E27A 3WDXA 2GAUA 1OH3A 4OVEA 3VBSA 1BEV2 5FYYA 4IL7A 4XTPA 1NCQC 2DVBA 2ZGKA 2R041 3ELNA 3RZGA 1GQPA 1ZA7A 1UXXX 2P34A 3H9AA 1SQ4A 2ATFA 1RUC2 4META 5FTTC 2GMPA 3QH6A 3GCWA 3IDEA 1OC1A 3O1SA 3WNOA 1JHJA 1NLRA 5ABJA 5CZKA 4ZHNA 2AEZA 1IG0A 1V00A 4AK3A 1QH7A 3ILNA 2B46X 1MVQA 3GBGA 3M3EA 1ND3B 4PDWB 1DGRN 3ZXJA 2E7TA 2JG9B 1TZOA 4ATEA 2OW4A 1YNAA 4NAOA 4CZSA 5BNNB 2QE3A 5C7GA 3ZYIB 1JZ5A 3U1XA 4WM7A 3AK0A 3CL1A 3BYWA 1VALA 1GR3A 1MS5A 1XU2A 4UFMA 1ND3A 2JECA 4ISRA 4AVVA 1URXA 1FMD1 4MXWB 2RJLA 2JG9A 3OD4A 3N7LA 2XBO1 3PLQA 2QJVA 1W6QB 5BNNA 4N53C 4QPGA 1GWMA 3AP9A 2F17A 4J25A 4Q4V2 1LCLA 4AEMA 3CJIB 3ZOIA 5DZGA 3HIFA 5E6HA 1MZ5A 1CAXB 5LA1A 1T6GC 2YPDA 2WBKA 1U0AA 1PO13 1SLBA 2VU9A 2D5HA 2VC9A 4HVQA 4TWTA 5FY1A 4Q29A 3RNSA 3ZYBA 3ZPOA 1W6QA 4K7JA 5GZCA 5JLVA 2FZ2A 5DZEA 4XF4A 4QXKA 5IVBA 2GALA 3I3QA 5BUVA 3BTZA 2QUOA 2J1RA 3D4KA 1W03A 2XG3A 2Y6HA 3GZAA 4MZUA 4V2WA 3T0BA 4YM0A 5A3WA 2FBEA 3IKWA 2ZX3A 5E8AA 3WF1A 4LA3A 2ZGPA 4FTEA 2E31A 2B9UA 3M7AA 1QJU3 2WWUA 3TOJA 2VZTA 4EZ4A 1EAH1 1QDOA 1VBB3 1ZZ9A 2YXSA 3ACGA 3DKQA 4QXHA 2QQOA 2X09A 4HN1A 3VN4A 1ZREA 2RS33 1V9U3 4RSUA 4ZU5A 5JXIA 2PELA 2XL7A 1A78A 1ONAA 3B02A 4X8PA 4FI9A 4FPYA 4QKNA 2HBUA 5JI9A 2IUWA 4GB31 1DZQA 3K77A 5F3GA 1W0PA 1WZXA 4JQTA 1WMDA 2NMOA 2XJSA 1K45A 2Y6JA 4DS0A 2VAUA 4GJYA 5JI7A 3VHPA 1HV0A 3N4MA 4UFHA 4FPEA 2UYBA 4CTEA 1VP6A 3JBG2 1GV9A 5ISLA 2AYHA 1BBT3 5EP9A 5H9PA 1PVC1 4WVZA 1QH6A 2H6CA 2VZOA 2WDBA 5JIUA 3ZVXA 1RJ8A 4UW6A 4IEYA 5E1RA 1DQ2A 4RS5B 4AF9A 5L7OB 2WN2A 2ARXA 1W9TA 1RUOA 5EJ3A 4B4PA 2WO2A 3O1PA 3KF5A 3WUDA 5EZWA 1PMHX 1OFSA 2ZS6B 1EUTA 2PHLA 1UX7A 2HWD2 2XJTA 4FO9A 4QHZA 3W5MA 2G4IA 5EXOA 4BIFA 3ST7A 1VMFA 5CG8A 4AHZA 3OBRA 1A3KA 1QJEA 2BWAA 4QGLA 4RS5A 3WLUA 4LTAA 2ES3A 1SCSA 1BVVA 5L7OA 4Y5SA 3LOBA 1G9FA 2EAAA 5F1RA 4LT5A 3POIA 1VRH3 1QEXA 5CYYA 4DIQA 2EXIA 2RS11 3A4UA 3AYAA 2VMFA 4RA0A 1DP0A 1OOPC 3D8CA 3U11A 4XUNA 5LY2A 4H7LA 3M1HA 1HKDA 3H1MA 1Q43A 1FOD1 4P9YA 5D1IA 5I91A 5J1XA 1W6NB 1O4YA 2Y6GA 3KWVA 4JKMA 3TWIA 4GMP0 2FDHA 5BNPA 2QQWA 3HQUA 4XURA 1RMU3 2XWBB 1PIV3 2XR4A 3AL5A 1ASJ1 1IKPA 1RUG1 1PK6C 3UKNA 2YC0A 3P3PA 4RHV3 3QOPA 4ES8A 1IGOA 2J1AA 3O0WA 1OF4A 4OHXA 4LBLA 2V5YA 3JD73 1W05A 5A3LA 1DQ1A 5EWSA 2P6CA 4KWUA 2WT0A 5IHRA 1XYPA 1CAVB 2V4AA 2YG0A 2CHHA 2F4PA 1OD5A 1K42A 1V6OA 4YG0A 1EYBA 4IQPA 1SHWB 1JZ8A 1UU5A 1UZ0A 3DGTA 1ZRDA 4CP0A 1PO12 3U4XA 4IV1B 4PF1A 2IC1A 5FP9A 1B35B 2ZGTA 3A7QA 3OGVA 4IEZA 2JDHA 1CAVA 2GP3A 4PQ9A 1RVF1 3IT8A 2OX0A 2QQKA 4QPIB 1VBD1 4I0AA 2PYTA 3DEMA 2WFPA 1TQ5A 1YFYA 2WUHA 4CU7A 4DFSA 4XCAA 1R1A3 4GWJA 3TNPB 4IV1A 2FHRA 1QJU2 4N9HA 4BH9A 5EIYB 1YI9A 1B35A 2MEV3 4FOYA 4Q8KA 1UAIA 2OUHA 3I2OA 2RS32 1V9U2 1W6PB 3APBA 5L9BA 3VHRA 5KHGA 3BKZA 3POGA 3VZKA 1OF3A 1XSQA 3PUIA 4L99A 2Q30A 5KR7A 2W92A 4TZDA 3PUSA 1J84A 4COWA 2P3IA 4BPZA 4HN0A 5CFCA 3H8OA 1ZBE1 1OXCA 1NY71 3VDAA 4A3ZA 1Y4WA 2J1VA 3E5XA 1JYXA 1BEV1 1W6PA 4M3CE 5A7WB 4NPRA 4O61A 2H0VA 3R6SA 1SLCA 2ID4A 1BBT2 3J7HA 3PVBB 5JPNB 5D8AC 4H2AA 1DQ5A 1RUC1 2DCKA 3H8UA 4R9DA 4B8EA 3ZMOA 1NQDA 3E5QA 3FX3A 4RL7A 3IBMA 4YW5A 5CEHA 3POFA 3VD3A 4MHUA 2CSGA 4AXOA 4BQ2A 1A34A 2VMGA 2FDKA 4DEVA 2XLFA 4FT8A 4P5HA 4Q0PA 5C9AB 2VNRA 3I2FA 1D4M1 4Q5OA 5A7WA 1UXZA 3WT3A 2VZSA 5IK5A 2CGPA 1I5PA 1W3XA 1FNZA 4AFAA 3VD9A 2RJKA 1LKNA 1WKYA 3LCPA 3GJBA 5E89A 4UFLA 2ZGMA 1S0GA 2BVVA 1MZ6A 2QQVA 2ZGQA 3WDYA 1ENQA 4IEVA 4BWOA 1DGRA 1EP0A 3RS6A 5C9AA 4MGYE 1AR83 3I54A 1VRH2 4I30A 2WABA 1D4VB 5A32B 4FTSA 3N7KA 1JODA 1WA6X 5FK8A 4Z1VA 1YWKA 2BVBA 3VBUB 1NG0A 1ENXA 4Q4V1 5C3RA 4QQHA 5AC93 2R6QA 4ZONA 2NQYA 3WG1A 5CNAA 1UY2A 1EV13 3JB8A 4WM8C 1AL23 2OKXA 3UGFA 4Q8LA 5FZMA 3PHMA 4YG3A 2D3RA 2W68A 1RMU2 2VO5A 3NKGA 2VZQA 4GALA 5HV0A 1PIV2 3FC0A 5A32A 1JU3A 2GN7A 4MOAA 1OA3A 1FXZA 1H8TB 3KVAA 2GH2A 4RHV2 5CVRA 4TSVA 4UT5A 3BU0A 3CU7A 4XHXA 3AYDA 3JD72 4RR3A 2A6ZA 2K46A 5SV5A 4HXCA 4W6YA 4CDUC 1FV2A 2F4LA 2ZGUA 3VZJA 3SQOA 3ZFFB 3FLTA 2VULA 3D0SA 4CUGA 2LRPA 5IVVA 2WNVB 4LKDA 5DUVA 2CWMA 2YGMA 3Q9OA 4YVSB 1KJRA 5FZGA 1O3QA 4OI0A 5FZ9A 2ZA9A 2UY9A 2IFWA 5KXCA 1O4ZA 2UWAA 2PTMA 4Y1ZA 1H8TA 1FMD3 1JTZX 2RDRA 4X8NA 1W2UA 1IPJA 1D0HA 4M3CB 1YO8A 4NROA 3JCIA 1XE7A 4IEQA 3ZFFA 1NA1B 2W47A 4CUBA 2WNVA 4GMP1 2ZZJA 4XXPA 2Y38A 1OI6A 2BWCA 4UI9L 4BA6A 4LK6A 2RJ2A 1GYKA 3ZFEB 4CDXC 2PHRA 2XGXA 5A6YA 5FZ6A 2JKBA 3RQ0A 1HN1A 4UBGA 5C4WC 5FPXA 4RQPA 4HFSA 1GLHA 3JBG1 1NA1A 2MEV2 3ZN4A 1QOOA 2EIEA 2ORZA 3CF6E 4FP3A 4F3JA 3NNJA 4ZY9A 1JYNA 1VR3A 2O0OA 4JTOA 3LA3A 3PU3A 1SZBA 1TE1B 1SFYA 2ZABA 1F5FA 2E9QA 2GNBA 2WFF3 3HJRA 3M3IA 3IB3A 4ZS3A 5FMOL 3T2TA 2HEWF 3AKRA 3OPZA 4P5YA 4JGZA 3NV1A 4LJHA 1VLNA 3X29B 2FZ1A 4IE5A 1XRUA 2RHPA 1EAH3 1U5YA 1H4GA 2XMLA 3AJYA 2HWD1 3WXPA 4E4SA 3MF6A 3T4VA 4I0BA 1YFWA 3PVEA 4BHPA 3NAPB 4HSLA 4Y4YA 2R062 3BI3A 2XVGA 1RB8G 4XILA 1FV3A 4R4ZA 4AVSA 2VCCA 4JGYB 4PT6A 4BU2A 1KRIA 5KC6A 2C9KA 2IXKA 4YM2A 4XFFA 5GKAC 3CZJA 4Y4RA 1QJX3 1RUH3 2BNOA 3H1YA 3ZLIA 2GSYA 4PQQA 2TNFA 2ZTNA 1VBC2 4EE2A 1GP6A 4YW7A 1MQTC 1DZTA 1JZ3A 3WP6A 4Q0SA 4JDOA 4OI2A 3BN6A 2W52A 4XIKA 5JXGA 2WNUC 4JGYA 5A3UA 2JG8B 5IW0A 3U14A 4QMAA 5HXMA 3O5SA 2YBKA 4AI8A 5JOZA 5D21A 4AHYA 3O1VA 4ASKA 2JIGA 3PUHA 1ST8A 5LK5A 1OMIA 2WQZC 3ACIA 3QLQA 1AR82 4UW5A 4YLZA 3WW1A 1FX5A 3ME2A 2DBNA 1BJQA 1E5IA 3DPRC 5L73A 1QJFA 4FAHA 3WQ1A 4AFMA 5J3UA 4GULA 3GZTB 1ODNA 4K40A 3DYPA 1LOBA 2G19A 2JG8A 2P2KA 4UWDA 2IXIA 3HVDA 3ZX7A 2ZEZA 4LUMA 2JDNA 3S6PA 5AC92 3N7MA 3VD5A 4A41A 2XHKA 4XPVA 4E8CA 2WAAA 5FZBA 1EV12 4JX0A 1AL22 3MEPA 3SHRA 2IZWA 5LB6A 3HQRA 4Q1PA 2ENRA 3KHBA 4FPJA 1CPMA 2ADDA 2RS13 1PO11 3PU8A 4AEKA 1JUHA 2AREA 2PLV3 1KDKA 2JJ6A 2WN3A 2WT1A 3MGUA 4Y5Z0 1LTEA 4YGDA 4ET7A 1NYWA 4IE7A 2VZRA 4MYEA 1O3TA 4FPCA 1H1IA 2VCMA 3WNNA 4AFDA 3WW2A 4AI1A 4QQLA 4NPMA 4IEOA 2QQJA 4B3NA 4QDRA 4AQ2A 1S0BA 3IIAA 3KCYA 5FAXA 5FQ0B 2YHJA 4AGRA 1AJOA 1QJU1 1VMJA 4NIAA 3UV9A 5IYYA 1ZZBA 4B29A 3E1F1 5DXDA 1YEWA 3AP4A 4TN7A 2RS31 1V9U1 2XKOA 4GWNA 4PI0A 1UU6A 3WX5A 4CXWA 1RTVA 1HQLA 2UU8A 1HLCA 1WA4A 3H3LA 2RR13 1MS3A 4YVWB 4CEYB 5FP3A 4B1LA 2C24A 1SLAA 2WKKA 2NM1A 3OB8A 1VJ2A 1K12A 3GGLA 4BXSV 2BW8A 3IIIA 1X33A 4E4DX 5AFEA 1S0EA 3U10A 2K9ZA 4IESA 1TEIA 1BBT1 2DWRA 4W4ZA 4ZKTB 4CP9B 4Z2AA 3AZVA 1UCXA 1WD3A 3N3HA 4D3WA 2P3JA 4YVWA 4CEYA 5IVYA 2BZDA 2WFF2 1ZZ7A 1POV0 2VZ1A 1UMZA 1AL0G 3C7HA 4IV3B 1KS5A 1RGSA 2FMYA 1JU4A 3PJQA 4FFIA 4YW1A 3J4UH 3T09A 2D44A 4UXAA 3FFQA 3KCCA 1QQP2 2WINB 1XNCA 1Y9GA 1VBE2 2KR2A 2W39A 2XJRA 3LE0A 2BUKA 2OUJA 4XFBA 3FUQA 4EROA 3OY8B 4ZXEA 4JQRA 1JZ2A 2DURA 4PI2A 4COVA 2PXJA 4DOUA 1ZZ8A 3I3BA 3SKJE 4IV3A 2JDMA 3ZPYA 1K5MB 3GZUC 1DDLA 4NHYA 1QJX2 1E5RA 1RUH2 4Q27A 1ENRA 1VRH1 2XONA 3LA7A 5FLIA 2DVGA 5GALA 5CKMA 4V1PA 3DUIA 5JZGA 4AI9A 4NIGA 2JXAA 3Q8BA 3QCWA 1CAWB 4C1WA 1V6NA 2OA2A 3SH4A 3OY8A 3RMXA 1GQHA 2TBVA 3IM0A 1WMFA 2OS2A 3HNYM 1R082 1DIWA 3HNBM 1NCRB 1V6IA 2VECA 4M4PA 2ETEA 4MH0E 4Z07A 5JIAA 4KBZA 5CFDA 2VMHA 4QX8A 5FYTA 3O7OA 1NQJA 3KGZA 1A8MA 1RMU1 1S2EA 2OXBA 3ACLA 1GP4A 1PIV1 3DYMA 4OUEA 4AEJA 5F3EA 1D4M3 3RMYA 5FWEA 4NHXA 1U5ZA 2C0ZA 4AHWA 3I2HA 3BTXA 1RUE3 3JD71 1KDMA 5K9YA 3JZVA 3C8XA 4MADA 1NCRA 5HPOA 4IGQA 3DXUA 4QXCA 3RJ2X 3VBFC 2R30A 1YUDA 2Y8KA 5T3NA 4DRRA 2JB4A 3Q8AA 3AZWA 2A7AA 2VNVA 5IUQA 1NZCA 1VMHA 3ZXDA 4P9IA 3A22A 4HK9A 4NO4A 3MUZ1 5FPLA 1LEMA 3GDBA 4UF0B 5LZ6A 3VBHC 2NP0A 2PLV2 1HRV1 1QWRA 4NHLA 1AXKA 4HBNA 2B39A 3LDBA 4YZ3A 5EPAA 4BMBA 4DY5A 5KC5A 2WO1A 1ND2B 5EJZB 5K0UC 4K9SA 4PCRA 1W8OA 3B94A 4ONUA 3ZXGA 4Y3OA 5DZFA 1XJAA 1UD1A 5F3IA 4XE9A 2N7GA 4QGMA 1G7YA 3V65A 5I8SA 2E53A 2Y60A 1S0DA 4GAZA 2P6HA 1CZSA 3MW2A 3TAYA 3LEKA 2WO3A 3WW4A 3LF7A 5DABA 1YQ5A 4CCKA 4MGTA 1IQAA 2MEV1 3E6CC 2VZVA 2VUDA 3EHKA 1ND2A 1H2NA 4FOWA 4MGSA 1LEDA 3OUIA 3T4HB 1H2LA 1HV1A 1XNDA 3WP5A 5FLHA 3IDBB 4LBNA 1X7NA 4XABA 4F83A 2W94A 3D3AA 3IDCB 4XCBA 2JE7A 1BKZA 3CQOA 2RR12 5DUUA 2NPIA 2X8KA 1GWKA 1LOEA 1UIJA 3I49A 2JDKA 4OZXA 1F4HA 4JDNA 3USUB 1W8TA 4Q4X3 1O3RA 3NJVA 4NPLA 5BYNA 4ARXA 2P3YA 1GNZA 1H9PA 1RUD3 4FFGA 3IWZA 2CAVA 2R061 2QVSB 2KA3A 4KL1A 4A6OA 1H1MA 5A7PA 1QNWA 1MPXA 4GMP3 4PBPA 4CCJA 2GC3A 4BQ4A 1COV3 5A6XA 3TEXA 4UOJA 3H7YA 4XF1A 3WV6A 3D6EA 3ZKYA 1VBC1 3USUA 1I5ZA 1REFA 3CZUA 4Y33A 1AVBA 1QMJA 2ZAAA 3WNLA 1XU1A 2QQLA 1AR63 1O4TA 3ZFGB 4LUKA 5JVVA 4QQPA 2LW8A 1E5HA 1UQXA 4GD4A 2ZEYA 3K4ZA 4BDVB 1JHNA 4GKYA 4S2GA 1PZ7A 4AW7A 2HJIA 1C5HA 4OI1A 5BNOA 4KGQA 5T5OA 4PHZA 1AJKA 1Z7S2 2CNAA 4G4FA 1NY72 2B5HA 2YMZA 3KSCA 4LO6B 5LATA 1AR81 2BDRA 1WLCA 2BNMA 4DY3A 3ZFGA 2PQSA 3N7JA 3DV8A 4N53B 4N43C 1CZVA 2NZ9A 4HK8A 3O1TA 4XQ4A 4A7KA 5C8CB 5IAVA 5AC91 5L9VA 3OJBA 5EQUA 1EV11 1XNAA 1HXS3 1AL21 1POV1 4LEJA 3FHIB 3NJZA 1AX1A 3ZR5A 3K75B 1RUI3 3LZZA 4PJYA 3H8XA 4FP2A 2WA3A 3NNLA 5CIRA 1D4M2 5J09A 3ACHA 1IS3A 2BU9A 4ORFA 1OKOA 1REEA 5FPBA 4DQAA 3B5LB 2BBAA 5C8CA 1RUE2 2RS53 1H1AA 3OD0A 4LA2A 4IDZA 2BQPA 1CIWA 1JYIA 4EJRA 2VOWA 1ULGA 1D2SA 3BPZA 1C1LA 1LENA 1S1AA 2XOMA 4G3YC 4N9IA 4QDSA 4V2VA 3RZJA 5HV4A 2X29A 1DGWA 1GWLA 4PDWA 1GZCA 1TMF2 3M3OA 1ODMA 1CESA 3C7EA 4QPWA 3MW3A 1UIKA 1OVPA 4YGCA 1OQEA 2ZX1A 3BOPA 4GWIA 5LBCA 4Q0VA 4DXTA 4YARA 2OQ7A 2PAKA 3LDRA 1O59A 2XPJA 4LK7A 4BM8A 2YDEA 2AR6A 4Q0QA 4D6RA 2DVDA 4QKFA 2QDNA 4XZPA 2VNOA 3VBSC 1LGBA 2DUOA 3A0NA 2DTWA 3BPSA 1MR5A 3WNMA 3CHXA 5IT6A 5FYHA 3ZDVA 1SLTA 1WBFA 4H55A 2BV4A 2K0GA 4HPKB 5JWPA 1W2AX 3LIHA 4MXWA 1GNHA 4W8JA 3P3NA 3O1UA 3SH3A 5ERLA 5I93A 2CYFA 4X6QB 2E7QA 3P5BA 1GOFA 2K2SA 3HN3A 4LITA 4H14A 4BOWA 5ABJC 3VBRB 2HLEA 3CJIA 5LRRA 3BTAA 5FZ1A 5T54A 4DNYA 3A21A 5LA2A 3AM2A 4LBQD 4LHKA 2JDAA 1CAXA 2KXLA 5DAWA 1NT0A 4Z8BA 2WFF1 2HBTA 4AGGA 1F35A 5FPVA 2R1DA 1S2KA 2VR4A 2XXZA 3FMGA 2XJQA 5I8TA 3E6DA 3U4SA 1VE0A 4WM7C 1QQP1 4Q4X2 3RRDA 3VBRA 3UJOA 1VBE1 3S7IA 2FCVA 1WW7A 1W2NA 2DTYA 1NE4A 1ND3C 1OLQA 1RUD2 3FUOA 3OGSA 2VG9A 5FOBB 3O1OA 3S0MA 2P17A 1DGWX 2JG9C 1YQ2A 5FZLA 2V09A 1COV2 2ADEA 5BNNC 1JYVA 1LOFA 1QJX1 1RUH1 4QPGC 2VTFA 5IVJA 4JVAA 2GP5A 3WNKA 1CD3G 1OLMA 5F9TA 5FYSA 1NXMA 5DAQA 1Q3EA 3JUUA 5FZHA 1GUIA 1BQPA 5JSOA 5F5QA 1AR62 2ZEXA 3CDZB 1MEC2 2HWB3 4XYXA 2A6VA 3QACA 3WQBA 1R081 3WF2A 3FJSA 3AFGA 4P08A 1OBNA 1BMV2 1BCXA 3AMNA 5IK7A 3GCXA 1PK6B 2YU2A 4LOSA 1LAJA 3ZIXA 4J6GA 2A6WA 3DXTA 1H9WA 2QDRA 2VUJA 5DUWA 2JDUA 2CGOA 3RZKA 4XDPA 5IVCA 4JAAA 2P5BA 2X5IB 4C0HA 2DCZA 1QY4A 4OUSA 4GH4B 3SITA 1UZVA 2Q5TA 5HCHA 4CDQB 1V6KA 2ORXA 2Q1FA 1LHUA 1X8EA 3UT0A 3L2YA 3VKLA 4XFAA 4B1MA 4FPGA 4FPKA 1HXS2 5JCTA 1AYM3 3UNPA 2YFZA 5F7UA 2MPFA 1RUI2 2DFBA 1LGCA 5FY8A 1C28A 1M4WA 2VPVA 2PLV1 5ANNA 2Y6FA 2X5IA 3ZYRA 4GH4A 3VBOB 5C5TA 4EYUA 2Q8CA 4CDQA 3IAPA 1JH5A 4URAA 5DAVA 2RS52 4MXVA 3WUCA 4CSWA 2ZBJA 4LHNA 3SCFA 3TYJA 4FFHA 1F5JA 4QKBA 2VTXJ 2OYZA 3AKTA 4R4XA 3RFRA 5T5LA 4X6RB 1QKQA 4A7ZA 1N3PA 4BMEA 1G6NA 1RC6A 1UYXA 2Y26A 4NAMA 2Y0OA 2G9GA 3ACFA 4QAWA 3ROUA 3VBOA 2V5DA 3K3NA 1YIFA 1W6NA 5EJ1B 2JKXA 4S2HA 3FFZA 2VXJA 3MHZA 4DB5A 1C3HA 2QBXA 3VDDB 1HN0A 4NVPA 4QX7A 3WHTA 4A4AA 4BK5A 4EZHA 1QOTA 3EJKA 4L92A 2FDFA 5C33A 4DO0A 1OPMA 2HWC3 2AACA 2MHFA 2RR11 2D3PA 4MGZE 4AVTA 3MPBA 3T2OA 4RS5C 4AI3A 3B01A 4M00A 3T0AA 5L7OC 5FR3A 2D7FA 2VVFA 3G7DA 2PN5A 3CO2A 1HRV3 3WR0A 4AQSA 5FIXA 4N8MA 1GOGA 4OFGA 2FDJA 5FPAA 3VDDA 3W21A 3WSOA 4XEZA 2FCUA 1AX0A 4GA9A 1X36A 3H1WA 3KCXA 5CADA 1X9PA 5J96B 4K3UA 2GMMA 4P9WA 4QT6A 3ZSMA 3GJAA 3R4SA 4XJ8A 1ULDA 3WW3A 5DAPA 3LAGA 1JOJA 1JZ4A 5JSRA 3I4IA 1IKQA 4CU8A 2O8QA 2ERFA 4NRMA 5BNPC 1J3RA 1Y43B 2VE1A 4IGOA 5F3CA 5FZOB 3HR9A 3K48A 4CCOA 3A0KA 3AFKA 1TME2 3RWKX 2C5DA 1O5LA 5SV8A 3PURA 5A7SA 4FOQA 4QPIA 2A6YA 2Y6KA 5A7OA 4Y24A 4ATFA 5J7MA 1LHNA 3OBAA 3FLPA 1CZTA 1Z7S1 3M8LA 1KXGA 4KQ7A 5CKQA 4C8DA 1OLRA 5FZAA 4HKWA 3P6BA 3ATGA 3GHNA 3O1RA 2V73A 4LE4A 1HX6A 4NJ4A 5FXXA 4CU6A 5FY5A 1JOPA 1BLZA 2R063 4W6XA 4AHXA 2B4KA 2HWB2 1XB9A 5EHDA 3ZXAC 3KV4A 1GQGA 1WCSA 2P4EA 3NNGA 5J36A 2L9LA 5FV3A 1VBC3 3GZEA 5F6LB 5F5CA 1CPNA 4FCAA 3RGBA 4QB2A 3CJXA 1DHKB 1Y9MA 4CDUB 3ZM8A 1A6CA 4R52A 1RUE1 3B93A 1IHMA 4MLOA 5FXWA 4IV1C 1BVP1 1XE0A 5KHJA 3WF3A 3K3OA 2ZX4A 1HQWA 4EV0A 5FP4A 5A3NA 4QHOA 1B35C 5FJHA 5CBLA 1HB3A 3VLBB 2A3YA 2VOVA 1FPN2 1EPZA 4OYUA 4LBOA 2PFWA 2E51A 1AYM2 1TMF1 3N36A 4QPIC 1US3A 1PGW2 4B4QA 5H9RA 4ZXKA 1DYKA 5CFCC 4YG6A 5AVAA 4KG0A 2DCYA 4MGIE 5FP8A 1OKQA 4BQXA 2VTXA 5C5UA 4IERA 4NN0A 3AP6A 5F6KA 2VUAA 3MPPG 1NZIA 5LEKA 1POV3 3MLJA 2VCBA 2WLQA 4I3PA 4NUBA 1Q8SA 1LU2A 3I2JA 1XNKA 1VPHA 1HJFA 2CY6A 3O12A 2ZGRA 2ILMA 2QTWB 4FOVA 4HLTA 4XETA 4LO7A 3KZ4C 4JTNA 3JU9A 3OYWB 5DUXA 3VBUA 2E63A 1BYHA 3BB6A 1QOSA 3O0XA 5JMCA 3TN93 3BIWE 3ZDSA 3ZKUA 3FHAA 4MX3A 4JC1A 1IS4A 5FZ0A 4DXZA 3D82A 5DN2A 5FZKA 3NMBA 3MIGA 2AGSA 2HWC2 1S4CA 3Q8FA 4TTGA 4XVHA 3NSTA 2W91A 4OCTA 3MIBA 1AHSA 4Q4Y2 1HIXA 4YZ4A 4Q4X1 5FYZA 3VZMA 1S2BA 1VAVA 1HRV2 5C9AC 4GZ9A 1RUD1 5LA0A 3O14A 5FYBA 1VBA3 1YFUA 5GM0A 3T2PA 4DRVA 3L9JT 2IXCA 1PGL2 4MGKE 3KVBA 1F4AA 4OHZA 4YVSA 2BOJA 2LALA 4UBHA 2RM23 1COV1 1YHFA 2JD4A 3MUY1 4FQZA 4XJWA 2WZ8A 4D69A 2JICA 2EXHA 3IPVB 4M4RA 3VL8A 1U12A 2E33A 3SEEA 2VGDA 2XJUA 4CCEA 2D6KA 1UKGA 1KQRA 1VRBA 2W87A 1UZWA 4M3CA 4BJ0A 1AR61 1GOHA 4N7UA 1J3QA 2WNUB 1MEC1 1UNBA 2QCSB 4JV4A 4BQ1A 4RD7A 1ZRRA 1BMV1 3LQCA 2D93A 2RE9A 4FSJA 4E4ZA 3T1MA 3PUQA 3AZZA 3ZFEA 3Q8EA 2J7MA 5LCWL 1QDCA 4RR3C 1KS4A 1L3JA 2I2SA 2YB7A 3CLPA 5FPUA 1GZWB 5FDBA 2CAUA 1UOBA 1QQP3 3EXUA 2J1TA 4O7XA 4A2UA 3PMEA 1OA2A 1VBE3 3MV01 4QPYA 3TEYA 2ZMNA 1J58A 2R32A 1NOVA 1PMJX 2WS93 2Y0IA 1H8TC 2D6PA 4EWEA 1KD7A 2RVAA 2W1SA 3JXSA 1QJY2 2VMIA 3WD5A 3RSJA 1QF3A 5EYYA 2LTNA 2R7EB 4LBMA 2PAMA 4YW6A 2EAKA 1HXS1 2BEOA 4YZ1A 3WZ1A 3QH7A 5APAA 3ZFFC 5HI0A 1GZWA 1HRI3 2NLRA 1OPOA 3B69A 1RUI1 2WNVC 4LMFA 3OUHA 2D6OX 4D6SA 2V72A 1NUKA 1RYYA 3RZLA 3UETA 5E88A 3NAPA 4KWKA 3I2DA 4LE3A 4XIOA 2NYYA 3WG4A 2RS51 1R083 4U2AA 1DZRA 3SC7X 2D98A 3AP7A 3MYXA 1STMA 1H4HA 4RQPC 1YI7A 2DU1A 1NA1C 1UMHA 2WNEA 5K7PA 4YZ5A 3NJXA 1GBGA 4FXGB 5BXXA 4EN7B 5CG9A 5LK7B 4KGGA 4NIHA 4CP2A 4BQ5A 4A45A 3W58A 3HN1A 5J37A 3C7OA 4JGZC 1K5JA 2R1BA 3WP4A 1O6UA 5CU1A 2JE8A 1OA4A 3ETPA 2DYCA 3PL0A 1RUJ3 4XZUG 5FOJB 2Z5WA 3GXUA 5F8PA 5I0TA 5H9QA 4QDQA 4LHLA 1AYN3 2YV8A 1PO23 2RV9A 4L97A 3W59A 4CRQA 2ARBA 1J83A 2BPA2 1CX1A 3KB5A 5JOXA 3INAA 3LOIA 1J1TA 5FFOC 2HEVF 1G9DA 1RHI2 2D5FA 4KU8A 1W3VA 4WZCA 4AI0A 4WV8A 1ZZ6A 1O7FA 1YCIA 1WGPA 3TN92 1CONA 3KT7A 3AMPA 3LDKA 1UZYA 5FZ3A 3SCGA 1CR7A 5G04L 1T2XA 3WP3A 2DFCA 3ITQA 2F6BA 2WA4A 4BQYA 4CPBD 2R0HA 1WD4A 4JGYC 4CDWB 4F7ZA 2JD9A 3VDCA 4PF5A 4Z82A 4CCMA 2VMEA 1LR5A 2ZAHA 2DU0A 1J59A 3POWA 1KGYA 4HOOA 2BGCA 3B7MA 2JDPA 3MV11 4A3XA 4LBKA 2IVIB 4L8QA 3WEZA 3GALA 1TME1 1YJLA 3POBA 5FY4A 1VBA2 1ZX5A 4P14A 3VHNA 4BZ4A 5A3MA 3ENRA 2ZKLA 1W8UA 5KBFA 2JWPA 4QX0A 4YRDA 1I1EA 4CDWA 2BGPA 2RM22 4XJ9A 5FQ0A 1HQNA 2VH9A 5LW9A 2JG8C 3ZXEA 3J7NA 2R49A 2UWCA 4K8RB 3T3YA 3ZYFA 2VBPA 4COZA 3ZO0B 3HBKA 4AEDB 3NVCA 3ORJA 2LM3A 3KS7A 4ZPIA 3OEAA 2ZOEB 5LA9A 1I3HA 2HWB1 2YZ4A 2DUQA 3E97A 4I3GA 3R0RA 3M2MA 1MZFA 2XQRA 4H3WA 1Q56A 4RFT0 4HVOA 4D8MA 4UAPA 3H7JA 2ET1A 3FBMA 3AVSA 3N9PA 1SG3A 1AZDA 4LBQB 2EA7A 4AEDA 4AAPA 1JI6A 2QQIA 4JKLA 1OHFA 4B7KA 4OI4A 1W99A 1QU0A 1DQ4A 5IK4A 2WWJA 2VQAA 4CP9A 2YYOA 4NR1A 2WS92 2YGLA 3DN7A 3AB0A 5HBAA 1ULOA 3ILRA 4LBJA 4IETA 4HKOA 3VKFC 2VW0A 4HANA 5A33B 1FATA 1FPN1 2XHNA 1JUIA 1Z7S3 2GH8A 3ES4A 4KNCA 4LBQA 1F8VA 1PGSA 2BNNA 1R092 1JYTA 2KD7A 3FZ3A 1AYM1 3K51A 1HRI2 2V4VA 1PGW1 3CIHA 5LBBA 1YRZA 2FMDA 3TNQA 4S2DA 1ZRIA 1C57A 3U78A 3MFAA 2X05A 1DFQA 2O14A 3PIGA 1W06A 1UOJA 2B9VA 1MS0A 1ZRFA 1BXHA 2XLGA 1CN1A 5A33A 2H0BA 4YW3A 1K5MA 3AKSA 2WC2A 3IN9A 5FZIA 1U5IA 4N7IA 2A70A 2WR9A 5FZCA 5KXEA 4IUGA 5GLWA 1XBFA 3PNAA 1I9RA 1CAWA 1QNYA 2D6NA 2WAOA 4YVWC 4CEYC 5I0SA 2HH9A 1HJGA 4Q4W2 1DF0A 3IMNA 4P9JA 4CUAA 5L36A 4M0HA 5JXJA 3PMSA 4D6QA 2W3JA 1SDWA 4ZU4A 1DLCA 4CXYA 2EF6A 1MS8A 4MG2A 2O1QA 2WRAA 5IJRA 2P37A 3PDQA 1GFF2 4IW3A 3UGHA 2CDOA 1RUJ2 1VAMA 2HWC1 5HCBA 4ASLA 1XNBA 3RZZA 3U07A 2VOTA 4EWDA 1TMF3 2VQTA 1AYN2 3ECQA 1PO22 4UFIA 5FZDA 2JENA 4Q4Y1 2GN3A 1D0GA 2XKPA 2DDUA 4IV3C 3J8F3 3KQ4B 4QQOA 5E16A 5GJ6A 5BY5A 3B00A 3LA2A 5JXHA 4ARYA 3THCA 1X50A 4HMZA 1W90A 2PHTA 2VCAA 1PGL1 5F5IA 1DG6A 5JZGC 1JZ7A 2VQ0A 3LFMA 2IXHA 4NRPA 1SBDA 2E26A 2D40A 4QXBA 2R0FA 4A6SA 4OHYA 3HT1A 5HCAA 1H6XA 3THDA 4HETA 3MLKA 2DBIA 5FK7A 4UF0A 1OQ1A 2GNDA 3OUJA 2QNKA 3S57A 4FXKB 5CFDC 1JW6A 1YFXA 4CEWB 4HKLA 3MFCA 1PNGA 3LEIA 4MGQA 4TYSA 1NX9A 5DG1A 3SXWA 4MSVA 1Y3TA 2J1EA 1OUXA 1YXWA 2UWBA 2LROA 4GXLA 1QIQA 2X53S 3B9IA 1XOYA 1CJDA 1YLLA 1RUF3 4HT1T 3LPGA 3S5QA 2ZCWA 2AENA 1NCRC 1UMIA 2BYVE 2XVLA 1F2NA 3HMYA 4CEWA 5K4LA 4M0NA 1ZA4A 4YYOA 4N43B 1NCQB 3EYPA 4IEWA 4K20A 5F5AA 5FYIA 2Q8OA 3EQEA 3LPFA 4LKEA 3VB9A 2VW2A 1KFXL 2YFUA 1R64A 1PZ8A 1UOFA 3USSA 1X9TA 1HDKA 1QJY1 4SLIA 3RVHA 1UU4A 2CTVA 1DYOA 4S2FA 1WBLA 5A1FA 1JMUB 1BHGA 2YBPA 4BCUA 4WVWA 2FCTA 3ZYHA 4BLJA 2HWF3 1EY2A 2VBBA 4DZGA 4PLMA 4MHRA 1S0IA 5ANQA 1OURA 1D2QA 1AR72 1NCQA 1W0OA 3U0ZA 1OFNA 1WCQA 3NL1A 5FZEA 2Q8DA 3MBWA 1MEC3 5JMOA 1PX3A 5GZFA 1HB1A 3S5AA 1ZBA2 1N1VA 2CGNA 1N1TA 3GM8A 3FLRA 1PHMA 3OGJA 3SCHA 2QQPA 2WYFA 3NNFA 4LKFA 2PAEA 2H6BA 2ZX0A 4FPHA 1SBFA 1Z0HA 4E4HA 3VKOA 3ZXFA 1ND2C 5BV6A 1VB2A 3DYOA 3H3UA 2RDQA 4QX2A 3W20A 3WNPA 1Q5OA 3I3DA 1C8NA 5JR7B 1X82A 4BQ3A 1W8ZA 1SFPA 1NAEA 1SACA 1WCDJ 1BZWA 2VL4A 3CBNA 3J7LA 4XBNA 3UL2A 1SFNA 1N47A 2BOIA 3MIHA 3WINE 4W50A 4LORA 1W9SA 2ZHNA 3PTRB 1F31A 4HSJA 4Y1UA 5K8SA 4Z2WA 4LPLA 1Q8OA 5LY1A 4J1XA 1AR92 4AZZA 4RGGA 2Y6LA 4J1WA 4UFJA 3VZOA 2VZUA 2HYKA 2YU1A 4N53A 4M01A 2DVFA 4UW3A 3LFIA 4W6WA 2SLIA 2WNOA 4IEPA 5DDJ3 1RHI1 5CB7A 2OT7A 1NXD1 1JXNA 3OSDA 1UWWA 3TN91 2J42A 2EXJA 4D94A 2UYAA 1G8WA 1HW5A 5FCCA 5GZDA 3KT4A 1ZVFA 2A1XA 3BALA 3MF9A 5FBJA 2YC2A 5FUNA 1ZRCA 4P9LA 4N90A 2D6MA 2ZGNA 1G9CA 3NNMA 5EV7A 3ES1A 4WM7B 1L7LA 3OPWA 4PLNA 1JBCA 3RDIA 1S0JA 5KWRA 4XXAA 3ZXKA 5BNOC 3PIJA 1O91A 2PHXA 4WBBA 3BCWA 1YJKA 1OUSA 2ZGSA 2P1BA 3J8F2 4PIZA 5BNQA 1VBA1 1W8FA 4QD2A 2AH2A 3ZFGC 3ABZA 1WW6A 4BB3A 3V0BB 1UF2C 3R4UA 1REDA 2UY8A 4HL0A 2RM21 4QPGB 3H8RA 2JE9A 4CCLA 4KWJA 4NMIA 3HWJA 3E6BA 4B7EA 1WMXA 5FYCA 4CCCA 2ZEWA 4XFIA 1QGLA 4OMDA 4XOGA 1XQNA 1GKBA 2RMU3 1VAKA 3AX4A 2C1FA 2C4XA 3DCQA 1W28A 4R8HA 1AXZA 2WSVA 4LXLA 4YGEA 4E2GA 2W95A 3MIFA 3POJA 2GC2A 2A6XA 4XUQA 1LULA 1S0FA 3HEIA 4CA9A 3V0BA 1DU3D 1DGLA 1RINA 1RUF2 4HPKA 4P9XA 5DPNA 5C8CC 3G6JB 2HEYF 1B09A 3H50A 4KMQA 2EXKA 2W9XA 2GC0A 4L11A 5DAXA 1MS1A 2A5ZA 2W1QA 3FWEA 3J9SA 4XF3A 4CXXA 5IK8A 3N9OA 2B7YA 1APNA 1LGNA 1W8NA 3LSEA 2WLPA 4FTBA 2DCTA 1TME3 1LOAA 4YFZA 2E7AA 2WS91 4PDWC 3SKVA 3RZHA 3AKPA 3IZOA 2ET7A 4L2NA 1KEXA 4JRAA 4QWNA 3I2IA 4YM1A 3UJQA 1LB2A 2VUCA 1GZTA 5KXDA 5LBFA 1R091 3AZYA 2E32A 2HWF2 5C6CA 3AYEA 5JOWA 2IWGB 1HRI1 4OZOA 2A73B 2AZ5A 5FZFA 1S55A 4KBBA 1AXYA 1OOPB 4TXWA 4BE3A 1PM4A 2SBAA 1TG7A 1PX4A 2R073 2G9FA 2XUMA 5DG2A 4UFKA 5FO8B 2WJSA 1I6XA 5FMBA 4AE2A 2Q1ZB 1NLSA 3KMHA 2I07B 3AP5A 2VW1A 1YQ8A 1W0NA 1C8M3 4ITCA 3NV2A 1IOAA 2PQQA 3I2GA 4CUCA 5A3PA 1L7QA 3CJIC 5CKNA 3ZSJA 1H0BA 4GWMA 3ZXLA 1OOPA 1W9WA 4OHWA 1X8MA 5I0RA 4LLFA 4XJAA 5GLZA 2HKXA 3RYKA 2QZ3A 3AMMA 5AVPA 2ZGOA 3SLIA 3WQ7A 4Q4W1 4YFWA 1UPIA 2ZPXA 4XAAA 3VKMA 1WW4A 3MIDA 3ZYGA 4XW3A 3AC0A 3F95A 2RDSA 1WLWA 4DUVA 5C3PA 2FQPA 5FYVA 5CISA 3VBRC 1FPN3 1PK6A 4DUXA 4O65A 1IQDC 1RUJ1 2HWE3 3D0JA 5KHHA 4QX1A 3FE5A 5FP7A 2A3XA 4FFFA 3LEGA 1T6BX 5JAXA 1AYN1 4A44A 1PO21 4QU2A 4Y20B 3I3EA 1H6YA 3RG0A 3MICA 1V6MA 2YY1A 4NWVA 5DDJ2 4TLGA 4I01A 1LOFC 5C3SA 1N1SA 2XL9A 4AR2A 4DMIA 4XUTA 1HB2A 1UW8A 2CL2A 3GYDA 1IPKA 5GZGA 5A6ZA 1KITA 2EIDA 3CNAA 4XAEA 1QXJA 3NJYA 4L9BA 1WCKA 4XHBA 3NWKA 5FMCA 3CKHA 4Y20A 3WF0A 1JYWA 3O0VA 1DLLA 3AL6A 3FHQA 5BNPB 4DPNA 5FO7B 2WZR3 3BGAA 5B4XA 3ETQA 3LSDA 1UO9A 2TUNA 1CAUB 2LS6A 3HBZA 3NO8A 3SH5A 4AVCA 4DXSA 4Z92B 3LKJA 2IFRA 4R9BA 3ZYPA 5KHIA 5F32A 5CA6A 3WDVA 4EN9B 2WO7A 2CV6A 3N9LA 4SBVA 4FAGA 3KHCA 1RUNA 5T55A 3JB4C 4R9CA 5FLJA 5EYXA 3OEBA 4LULA 4Q4Y3 1XE8A 1UYPA 1SMVA 5FUIA 2FD8A 2VQUA 1CAUA 4AWDA 3K2OA 5F37A 1HB4A 3K4DA 1JYCA 2RMU2 5IATA 3CMGA 1O8PA 1Y9QA 3LEMA 3LIGA 4GIQA 4C1XA 5D8AB 1F9KA 1LECA 2BFUL 3AMHA 3KD4A 1GSLA 2OPWA 5KHKA 2DF7A 2X5IC 3I2KA 2PHWA 4GH4C 5FWJA 1V0AA 4YNIA 4CDQC 3OBTA 4EN6B 2DUPA 3T0DA 4EWAA 1MZEA 1AR71 4DEQA 2XLAA 3SEPA 3RZMA 1FT9A 2FDIA 1UY3A 1WMEA 2QQNA 4OMCA 3I97A 5DQ0A 2EALA 5D8AA 4QM9A 3JQXA 4OHVA 1XYNA 3AMQA 2LUWA 1ZBA1 2B42B 4HVRA 3FL7A 5AFBA 1KJLA 2PHDA 2D6LX 2DV9A 4XFCA 5C71A 3N9MA 4O9EA 4AFBA 1H30A 3MIEA 2EVXA 3U75A 3VBOC 3POYA 5G05L 2BRTA 3VZNA 1WCUA 1RXFA 2W2IA 3POEA 3THTA 3W5NA 3RJRA 4FPFA 1XSRA 5IWFA 3U37A 4CCDA 1XYOA 4WVVA 1V70A 4CPBA 5CFCB 5H9SA 4C90A 1LRHA 1UX6A 5FZOA 4Y1XA 2R072 3A23A 3SISA 1VBB2 3N9QA 2PA7A 5FUPA 1QJY3 2XJPA 2RG4A 3PTYA 4K8FA 1CX4A 3EBRA 5F2WA 3URFA 4AVAA 5A1LA 4WM8B 4G9SB 2WSUA 3RWNA 1M06G 1S0CA 5HXVA 1AR91 1C8M2 5C3QA 3VDDC 1ZM1A 4QM8A 3ZN5A 4YWAA 3VD7A 5ACA3 2YBSA 3H42B 1ZZCA 1YC61 2ARAA 2ZHMA 3UESA 3F2ZA 4BQWA 1DQ0A 2W0XA 2JDZA 4K21A 4CP1A 2BBVA 2OZJA 3V64A 3UYJA 3OGRA 1MS4A 4WM8A 3AXDA 4LOTA 5GLTA 2QQUA 3K46A 2R16A 2XB6C 3HOBA 3GBWA 2HWE2 3TEZA 3EB7A 5IVFA 4Y22B 3OPTA 3T30A 2HYXA 1RITA 1C5IA 4CCNA 2GC1A 5LEJA 3KM5A 1IPSA 4CDUA 2Q8EA 2CWSA 1Q8QA 2W1UA 3J8F1 5LASA 4C91A 4A42A 2OZ6A 2ZX2A 4YW2A 3D5OA 3VV1A 4NHKA 2OVUA 2BJSA 3AZXA 5FO9B 4JZRA 3ZSEA 4I09A 1RJ7A 1C4RA 1WW5A 4CDXB 2WT2A 4L0PA 4XBQA 4Y22A 4BYYA 2I45A 2VXRA 1QHDA 5C4WB 1CWPA 1WLDA 1GMMA 1BK0A 4JHTA 1RHI3 2WZR2 4FPOB 2W08A 4A7YA 4XMAA 1W2TA 2VOKA 3TEWA 2VZ3A 3E5UA 2R043 1MS9A 1W8WA 4CDXA 4OUMA 1UN1A 1RUF1 5FYMA 1V6JA 4RR3B 3ZN6B 5JSPA 1TVGA 4YGBA 5C4WA 4Y5TA 1EPWA 2G1MA 4HG6B 3T2QA 2JEMA 1W6OB 1C1FA 3H3ZA 2VNGA 3OYWA 4BK4A 2VZPA 4EQVA 4NOTA 2J1UA 2VJXA 5A3TA 3N9NA 5A7NA 3C3VA 4KG8A 3H0OA 4YW4A 1JOBA 2DCJA 1NLQA 3GBFA 4JRLA 3VUOA 3ZN6A 1ULCA 2BP6A 1Q8VA 4XACA 3I7DA 3V56A 5M0TA 4HZFA 4Y1VA 5FPZA 4AYUA 1MQTB 1UOGA 1US2A 2B8MA 1W6OA 2HWF1 2W1WA 2Z4FA 3BOWA 5A1AA 2BFUS 2XJVA 4RN5A 4XDQA 4IEUA 5TSWA 4GKXA 4JCKA 3T1LA 3WY6A 1AUYA 2WYSA 2EIBA 1JZ6A 4NE9A 4E2QA 2NMNA 2VM9A 2BGOA 1LJ7A 2XBO3 1PM7A 4I2OA 4CYDA 2J22A 3NRUA 4RQPB 4K1YA 2XDVA 1ALYA 2Z79A 5A80A 3TB0A 4CVUA 1BK1A 2Q1MA 5JR2A 3I3MA 2IXLA 5IVEA 1MQTA 3VBUC 2ZHLA 3ILFA 4PLOA 5L9RA 3IPVA 3BU7A 4U36A 4EN0A 4BXFA 3DPRB 4UYBA 2VMCA 1FI2A 1GNYA 2WNUA 4JGZB 3TBDA 3M3CA 1UY1A 4QX5A 2D3SA 1R1A2 4H7MA 1O5UA 3S30A 3NKTA 5FY9A 3ZMNA 2X10A 3HNMA 3MO4A 2A71A 2PMWB 1N3QA 3FN9A 2QKDA 4ZS2A 3LGRA 4Y1YA 1W9YA 4NHMA 4LO8A 4IXLA 1R093 4P00B 4OQ9A 3DPRA 3OF1A 5FZ8A 5GZEA 4PBOA 5J98B 4ZZ8A 2C6SA 1FYUA 4WZFA 4YM3A 5ACA2 1TNFA 4YVSC 4Q0UA 2WQ8A 1LNSA 2D43A 3MI8A 4Q1RA 4NWWA 5DDJ1 1SLIA 3CEWA 4M3CF 3WDUA 4CU9A 1GU3A 1LHOA 1ULEA 4EN8B 1CJPA 4AVBA 1PZ9A 2XUEA 2PHFA 4QU1A 4RFRB 4IGPA 4JHZA 3VD4A 1LODA 4AFCA 4I0WB 4GB33 4D0QA 1ENSA 1TNRA 2O8OA 4R9AA 5T5PA 4NIIA 3BIEA 2CDPA 4ASMB 1DQ6A 2JDYA 3P1IA 1YIPA 4E2SA 4Q4W3 3ZFEC 3BTYA 2WZPP 4IE6A 2AC1A 3UKTA 2XWJB 2J1SA 2GDFA 4DUWA 3V0AB 1N1YA 3BODA 1PVC3 4TLFA 3WG2A 4XUPA 4XC9A 3WDWA 4E9KA 4F8AA 3SMHA 2JX9A 4JKKA 4AL9A 1UY0A 5B4NA 4URTA 2WQ4A 4JDMA 2OQ6A 2TEPA 1LOCA 3PUAA 4B4RA 5JPMB 5IFPA 2GNTA 3HPNA 4IEXA 3S7EA 3WCRA 5FY7A 1SPPB 1CQ9A 4PIYA 4AQ6A 5JDBA 1QXRA 3FBYA 3LB9A 3ASIA 2RMU1 2VVEA 5FJKA 3V0AA 3GF6A 3IDAA 1DYPA 1YQCA 2VBDA 4XTMA 2P3KA 5JUVA 3OOXA 1RL3A 5T52A 2KM2A 2RDNA 3OBZA 5A6QA 2R042 2CU5A 4XMIA 2EIGA 3AXEA 2YROA 3NAPC 3LD8A 2WIIB 4QB6A 1H2KA 2QQMA 5FY0A 3SNMA 4QX3A 3PVOA 3QBQA 1ULFA 1SPPA 1KFUL 2PHUA 3MDPA 4IE0A 3BUCA 2VD7A 1D7PM 1OD3A 4MVTA 1QXPA 3K4AA 1GP5A 3EMRA 4XDOA 1VIWB 3WQ0A 2BTVC 2VOXA 5IAXA 1G9AA 3RYRA 1PVXA 1U5XA 1FOD3 1UYYA 1Q8PA 2Y34A 4P02B 1SCRA 3WG3A 3EO6A 4K6BA 1WWYA 2ARCA 3POSA 4WVMB 4YSFA 3MW4A 1DBNA 5C3OA 4Q26A 5C8WA 1OSGA 2A75A 1CGPA 2NN8A 4MUVA 2JB8A 2Y64A 1NKGA 5JOYA 1ASJ3 3IAQA 1FAYA 1RUG3 2GMEA 2MNGA 4D7TA 4RGKA 5LBEA 1R1ZA 2W46A 2R071 1FMD2 1VBB1 3KV5A 3KV9A 5I8YA 2BERA 2AEYA 3VDBA 2XBO2 3RPQA 3BVCA 4AOCA 4QB1A 4WVMA 5I0UA 3HQXA 2QZ2A 4LO4B 1C8M1 1IZ3A 1OVSA 2E6VA 1PNFA 1IS6A 5BPXA 5A3OA 1POQA 3WVJA 1AR73 3KQRA 4DINB 3QD6A 1WLTA 3VL9A 3PJYA 1GICA 2Z2SB 1YYNA 4MV2A 1Y7BA 3O1MA 4NIDA 3OGGA 3T08A 1ZBA3 2DVAA 1UKRA 5FMDA 3VBFB 5L19A 4O9GA 1E57A 2XVKA 5FKBA 5EFUA 2JIJA 4IE4A 4QQ2A 2GNMA 1JN2P 4BLIA 4UW4A 3WCSA 1F15A 1UZZA 2HWE1 5LWBA 1RVF3 2G9ZA 2IVJA 1VBD3 2GZWA 3GHMA 3ALQA 2UURA 4I02A 3VBHB 3ZSKA 4COYA 3VHOA 1Z78A 4YPJA 3WDTA 1G86A 4CDWC 1LESA 4LNVA 1EAH2 3VBFA 5CAZA 2OPKA 5FMOS 5K0UB 4XF9A 3WOGA 4XQDA 3DL3A 1AF9A 1XC6A 5JZGB 3VKNA 3OCPA 2YUEA 4DXRA 4OQ8A 1AR93 1IS5A 1W2OA 4GB32 4OULA 3VBHA 3AYCA 4HONA 1ZBE3 1W9FA 1XXNA 3ZR6A 5CFDB 1OH4A 4XF0A 4FQ4A 5F39A 5FREA 3RI8A 2B45X 2WZR1 1RIRA 5D2AA 5K0UA 1W8HA 3JQWA 1BEV3 4QKDA 4NRQA 3GNEA 3I8TA 2ZGLA 5GLVA 1DCSA 3WNXA 2WWSA 4AEDC 4ZZ5A 3M3QA 1E5SA 4XJUA 2ZZQA 5F2SA 1NE6A 3KV6A 1PVC2 5T5JA 2WL1A 3AVRA 4AGVA 1LHWA 2YPJA 3L2HA 3RI9A 1RUC3 1XPWA 3OTFA 1JS9A 1H8VA 2Y33A 5C70A 3KF3A 4FBFA 2XQXA 3UK9A 1GANA 1SDDB 1V6LA 4LIUA 3ZYJB 2Z69A 3TRSB 2C26A 2C9AA 4RHV1 1SEFA 1K3IA 4FPLA 4CE8A 1ZYBA 4E8DA 3R4DB 4KU7A 4LQRA 4D7SA 3J7MA 1A8DA 1PMIA 2Z42A 4ZU7A 3RYPA 4LLOA 2ZKNA 2ZHKA 4PIXA 1W39A 1W04A 2VMDA 1OT5A 3NV3A 5FKCA 4AG4A 1QJZA 2GU9A 2YC4A 3UGGA 3AKQA 4LHSA 1ACCA 3DKWA 1ULPA 1K5MC 2ZXQA 3NQHA 1GZ9A 3HAGA 3HT2A 4GQ7A 5KXBA 2RS12 1SLLA 2XH6A 1O8SA 5FYUA 1MVEA 1N3OA 1VB4A 1J3PA 1EUUA 1IG3A 2Q4SA 3KLSA 4KI5M 3AJZA 4Q4V3 1FOD2 4BISA 5I0DA 1L7RA 4MO3M 1AX2A 4FVVA 4XBLA 4P9GA 5A7QA 2ZACA 4Q2FA 4RYDA 1LOGA 1RXGA 2VY0A 3MLLA 1UY4A 3ZIWA 1OQDA 1ASJ2 1WUVA 4XJZA 1RUG2 3I59B 1R1A1 3C7FA 3W9AA 1O3SA 1UPSA 5DMYA 4YZ2A 4XUOA 3IMMA 2I74A 5FZ7A 2AUYA 5FRAA 4LKSA 1CVNA 3B9CA 3WHUA 4LIVA 5FZ4A 2VVDA 3N35A 3PVNA 3C2UA 3VZLA 4Y26A 1SBEA 3THPA 5ACA1 4D7YA 4ISQA 4N43A 1YQ6A 3I59A 1J1LA 1UYZA 1LU1A 5GLUA 2EICA 4XFGA 3DF0A 1UL9A 5FBZA 3KT1A 4GJZA 2W5FA 1W6MB 4OLLA 3NV4A 3M70A 2D97A 3HD8B 1ZNPA 4AI2A 2WZEA 4C0BA 3NW4A 5LRSA 5FXVA 5IFTA 3M4FA 1RVF2 4RGAA 3R05A 4LO5B 1VBD2 4LR4A 1MACA 3C7GA 4COUA 5BNOB 2FDGA 3ZSLA 1H2MA 3B3QE 3LWCA 3ON7A 4KH9A 2Q0AA 4QHBA 3WF4A 5T50A 1G9BA 3OG2A 5A70A 1CIYA 1P8JA 1W6MA 2ZMKA 3Q8CA 5FXZA 3J26N 3JBG3 5B2GB 4K1ZA 2IXJA 4AAXA 3VBSB 4XFHA 3VGIA 4CEWC 5J48A 4XQWA 2OIIA 4KWLA 2ZJCA 1XNTA 4W65A 3KGLA 4AQTA 4INDA 5HCFA 4ES9A 3UKVA 2ZMLA 1LHVA 3MZHA 2QFEA 3DECA 1ZBE2
chains in the Genus database with same CATH topology
2A3WA 1FNYA 4QGNA 5ABJB 2HWD3 4BIOA 4E27A 3WDXA 2GAUA 3VBSA 4OVEA 1BEV2 4IL7A 4XTPA 1NCQC 2DVBA 2ZGKA 2R041 3ELNA 2P34A 3H9AA 1SQ4A 2ATFA 1RUC2 4META 5FTTC 2GMPA 3QH6A 3IDEA 1NLRA 5ABJA 4AK3A 1V00A 1QH7A 3ILNA 2B46X 1MVQA 3GBGA 3M3EA 1ND3B 4PDWB 1DGRN 3ZXJA 2E7TA 2JG9B 4ATEA 2OW4A 1YNAA 4CZSA 5BNNB 2QE3A 3ZYIB 4WM7A 3AK0A 3CL1A 1VALA 1GR3A 1MS5A 1XU2A 1ND3A 2JECA 4ISRA 4AVVA 1URXA 1FMD1 4MXWB 2RJLA 2JG9A 3OD4A 3N7LA 2XBO1 3PLQA 2QJVA 1W6QB 5BNNA 4N53C 4QPGA 3AP9A 4AEMA 4Q4V2 1LCLA 3CJIB 5DZGA 3HIFA 1MZ5A 1CAXB 1T6GC 1U0AA 1PO13 1SLBA 2VU9A 2D5HA 4HVQA 4TWTA 3RNSA 4Q29A 5GZCA 1W6QA 4K7JA 2FZ2A 5JLVA 5DZEA 4XF4A 4QXKA 2GALA 5BUVA 2QUOA 3D4KA 2XG3A 3GZAA 4MZUA 4YM0A 2FBEA 3IKWA 2ZX3A 5E8AA 4LA3A 2ZGPA 4FTEA 3M7AA 2B9UA 1QJU3 3TOJA 1EAH1 1QDOA 1VBB3 1ZZ9A 2YXSA 5KC5A 5KXEA 1ZREA 3VN4A 4HN1A 2RS33 1V9U3 4RSUA 4ZU5A 2PELA 2XL7A 1A78A 1ONAA 3B02A 4X8PA 4FPYA 5JI9A 4GB31 1DZQA 1W0PA 2XJSA 1WMDA 2NMOA 4DS0A 5JI7A 3VHPA 1HV0A 3N4MA 4FPEA 2UYBA 4CTEA 1VP6A 3JBG2 1GV9A 2AYHA 1BBT3 5H9PA 1PVC1 4WVZA 1QH6A 2H6CA 5JIUA 3ZVXA 1RJ8A 4UW6A 4IEYA 5E1RA 1DQ2A 4RS5B 4AF9A 5L7OB 2ARXA 1RUOA 5EJ3A 4B4PA 3WUDA 5EZWA 1OFSA 2ZS6B 2PHLA 2HWD2 2XJTA 4FO9A 2G4IA 5EXOA 4BIFA 3ST7A 5CG8A 4AHZA 3OBRA 1A3KA 2BWAA 4QGLA 4RS5A 3WLUA 4LTAA 2ES3A 1SCSA 1BVVA 5L7OA 3LOBA 1G9FA 2EAAA 5F1RA 4LT5A 1VRH3 2EXIA 2RS11 3A4UA 3AYAA 4RA0A 1OOPC 3D8CA 3U11A 4H7LA 3M1HA 1HKDA 3H1MA 1Q43A 1FOD1 4P9YA 5D1IA 5I91A 1W6NB 1O4YA 3TWIA 4GMP0 5BNPA 1RMU3 2XWBB 1PIV3 1ASJ1 1IKPA 1RUG1 1PK6C 3UKNA 2YC0A 3P3PA 4RHV3 3QOPA 4ES8A 1IGOA 3O0WA 4OHXA 4LBLA 2V5YA 3JD73 5A3LA 1DQ1A 5EWSA 2WT0A 1XYPA 1CAVB 2F4PA 1OD5A 1V6OA 4YG0A 1EYBA 4IQPA 1UU5A 3DGTA 1ZRDA 4CP0A 1PO12 3U4XA 4IV1B 2IC1A 1B35B 2ZGTA 4IEZA 1CAVA 4PQ9A 1RVF1 3IT8A 4QPIB 1VBD1 4I0AA 2PYTA 2WFPA 1TQ5A 1YFYA 4DFSA 1R1A3 3TNPB 4IV1A 2FHRA 1QJU2 4N9HA 4BH9A 1YI9A 1B35A 2MEV3 4FOYA 4Q8KA 1UAIA 2OUHA 2RS32 1V9U2 1W6PB 3APBA 3VHRA 3VZKA 4L99A 2Q30A 4TZDA 4COWA 2P3IA 4BPZA 4HN0A 5CFCA 1ZBE1 1NY71 3E5XA 1BEV1 1W6PA 4M3CE 4NPRA 2H0VA 3R6SA 1SLCA 1BBT2 3PVBB 5JPNB 5D8AC 1DQ5A 1RUC1 2DCKA 3H8UA 4R9DA 4B8EA 3ZMOA 1NQDA 3E5QA 3FX3A 4RL7A 3IBMA 4YW5A 4AXOA 2VMGA 2XLFA 4FT8A 4P5HA 4Q0PA 5C9AB 2VNRA 1D4M1 3WT3A 5IK5A 2CGPA 4AFAA 1FNZA 2RJKA 1LKNA 3LCPA 5E89A 2ZGMA 1S0GA 2BVVA 1MZ6A 2ZGQA 3WDYA 1ENQA 4IEVA 4BWOA 1DGRA 1EP0A 3RS6A 5C9AA 4MGYE 1AR83 3I54A 1VRH2 4I30A 1D4VB 5A32B 4FTSA 3N7KA 4Z1VA 1YWKA 2BVBA 3VBUB 1NG0A 1ENXA 4Q4V1 4QQHA 5AC93 2R6QA 2NQYA 3WG1A 5CNAA 1EV13 3JB8A 4WM8C 1AL23 4Q8LA 3PHMA 4YG3A 2D3RA 2W68A 1RMU2 5KHGA 3NKGA 4GALA 1PIV2 3FC0A 5A32A 2GN7A 1OA3A 1FXZA 1H8TB 4RHV2 2GH2A 5CVRA 4TSVA 3CU7A 4XHXA 3AYDA 3JD72 4RR3A 2A6ZA 4CDUC 5SV5A 4W6YA 1FV2A 2ZGUA 3VZJA 3ZFFB 3FLTA 2VULA 3D0SA 2WNVB 5DUVA 2CWMA 2YGMA 3Q9OA 4YVSB 1KJRA 1O3QA 4OI0A 2ZA9A 2UY9A 2IFWA 5KXCA 1O4ZA 2UWAA 2PTMA 4Y1ZA 1H8TA 1FMD3 1JTZX 4X8NA 1W2UA 1IPJA 1D0HA 4M3CB 1YO8A 3JCIA 1XE7A 4IEQA 3ZFFA 1NA1B 2WNVA 4GMP1 2ZZJA 4XXPA 2Y38A 1OI6A 2BWCA 4BA6A 1GYKA 3ZFEB 4CDXC 2PHRA 2XGXA 2JKBA 3RQ0A 4UBGA 5FPXA 5C4WC 4RQPA 4HFSA 1GLHA 3JBG1 1NA1A 2MEV2 3ZN4A 1QOOA 4F3JA 3CF6E 4FP3A 1VR3A 2O0OA 4JTOA 3LA3A 1TE1B 1SFYA 2ZABA 1F5FA 2E9QA 2GNBA 2WFF3 3M3IA 5FMOL 3T2TA 2HEWF 3AKRA 3OPZA 4JGZA 3NV1A 1VLNA 3X29B 2FZ1A 1XRUA 2RHPA 1EAH3 1U5YA 1H4GA 3AJYA 3WXPA 2HWD1 4E4SA 3MF6A 4I0BA 1YFWA 3PVEA 4BHPA 3NAPB 4HSLA 4Y4YA 2R062 2XVGA 1RB8G 4XILA 1FV3A 4R4ZA 4AVSA 4JGYB 1KRIA 5KC6A 2IXKA 4YM2A 4XFFA 5GKAC 1QJX3 1RUH3 2BNOA 3H1YA 2GSYA 2TNFA 2ZTNA 1VBC2 1MQTC 1DZTA 3WP6A 4Q0SA 4JDOA 4OI2A 2W52A 4XIKA 2WNUC 4JGYA 2JG8B 4QMAA 3O5SA 4AI8A 5JOZA 4AHYA 5LK5A 1OMIA 2WQZC 3QLQA 4YLZA 1AR82 4UW5A 3WW1A 1FX5A 3ME2A 1BJQA 3DPRC 5L73A 4FAHA 3WQ1A 4AFMA 5J3UA 4GULA 3GZTB 4K40A 1LOBA 2JG8A 2P2KA 2IXIA 3ZX7A 4LUMA 3S6PA 5AC92 3N7MA 2XHKA 4XPVA 1EV12 1AL22 3MEPA 3SHRA 2IZWA 4Q1PA 2ENRA 4FPJA 1CPMA 2RS13 4AEKA 1PO11 1JUHA 2AREA 2PLV3 1KDKA 2JJ6A 2WT1A 3MGUA 4Y5Z0 1LTEA 4YGDA 1NYWA 1O3TA 4MYEA 4FPCA 1H1IA 4AFDA 3WW2A 4AI1A 4QQLA 4IEOA 4B3NA 4AQ2A 1S0BA 3IIAA 3KCYA 5FAXA 5FQ0B 2YHJA 4AGRA 1AJOA 1QJU1 3UV9A 1ZZBA 4B29A 5DXDA 3AP4A 2RS31 1V9U1 2XKOA 4GWNA 3WX5A 1UU6A 1RTVA 1HQLA 2UU8A 1HLCA 1WA4A 2RR13 1MS3A 4YVWB 4CEYB 1SLAA 2WKKA 2NM1A 1VJ2A 2BW8A 1X33A 4E4DX 5AFEA 1S0EA 3U10A 2K9ZA 4IESA 1TEIA 1BBT1 2DWRA 4ZKTB 3AZVA 1UCXA 1WD3A 3N3HA 4D3WA 2P3JA 4YVWA 4CEYA 2WFF2 1ZZ7A 1POV0 1UMZA 1AL0G 4IV3B 1KS5A 1RGSA 2FMYA 3PJQA 4YW1A 3J4UH 2D44A 4UXAA 3FFQA 3KCCA 1QQP2 2WINB 1XNCA 1VBE2 2W39A 2XJRA 2BUKA 2OUJA 4XFBA 3FUQA 4EROA 3OY8B 4JQRA 2DURA 4COVA 4DOUA 1ZZ8A 4IV3A 3ZPYA 1K5MB 3GZUC 1DDLA 1QJX2 1RUH2 4Q27A 1ENRA 1VRH1 3LA7A 5FLIA 5GALA 2DVGA 4V1PA 3DUIA 5JZGA 2JXAA 3QCWA 1CAWB 4C1WA 1V6NA 2OA2A 3SH4A 3OY8A 3RMXA 1GQHA 2TBVA 3IM0A 1WMFA 1R082 1DIWA 1NCRB 1V6IA 2VECA 4MH0E 2ETEA 4Z07A 5JIAA 5CFDA 2VMHA 3O7OA 1NQJA 3KGZA 1A8MA 1RMU1 3ACLA 4AEJA 1PIV1 1D4M3 3RMYA 1U5ZA 2C0ZA 4AHWA 1RUE3 3JD71 1KDMA 5K9YA 3JZVA 1NCRA 3RJ2X 3VBFC 2R30A 1YUDA 4DRRA 5T3NA 3AZWA 2A7AA 5IUQA 1NZCA 3ZXDA 4P9IA 4HK9A 4NO4A 1LEMA 3VBHC 2NP0A 2PLV2 1HRV1 1QWRA 4NHLA 1AXKA 4HBNA 2B39A 4YZ3A 4BMBA 4DY5A 1ND2B 5K0UC 4K9SA 4PCRA 3B94A 4ONUA 3ZXGA 5DZFA 1UD1A 4XE9A 2N7GA 4QGMA 1G7YA 3V65A 5I8SA 2E53A 1S0DA 3MW2A 3TAYA 3WW4A 1IQAA 2MEV1 3E6CC 3EHKA 1ND2A 1H2NA 4FOWA 1LEDA 3WP5A 1H2LA 1HV1A 1XNDA 5FLHA 3IDBB 4LBNA 1X7NA 4F83A 3IDCB 2JE7A 1BKZA 5DUUA 2RR12 2NPIA 2X8KA 1LOEA 1UIJA 4OZXA 4JDNA 3USUB 4Q4X3 1O3RA 5BYNA 1GNZA 1H9PA 1RUD3 3IWZA 2CAVA 2R061 2QVSB 2KA3A 4KL1A 1H1MA 1QNWA 4PBPA 4GMP3 2GC3A 1COV3 3H7YA 4XF1A 3WV6A 3D6EA 1VBC1 3USUA 1I5ZA 1REFA 1AVBA 1QMJA 2ZAAA 1XU1A 1AR63 1O4TA 3ZFGB 4LUKA 5JVVA 4QQPA 1JHNA 4GKYA 4S2GA 1PZ7A 4AW7A 2HJIA 1C5HA 4OI1A 5BNOA 4KGQA 5T5OA 1AJKA 1Z7S2 2CNAA 4G4FA 1NY72 2B5HA 2YMZA 3KSCA 4LO6B 1AR81 1WLCA 2BNMA 4DY3A 3ZFGA 3N7JA 3DV8A 4N53B 4N43C 2NZ9A 4HK8A 4XQ4A 4A7KA 5C8CB 5AC91 3OJBA 1EV11 1HXS3 1AL21 1POV1 4LEJA 3FHIB 3NJZA 1AX1A 3LZZA 1RUI3 4PJYA 4FP2A 2WA3A 5CIRA 1D4M2 5J09A 1IS3A 4ORFA 1REEA 4DQAA 3B5LB 5C8CA 1RUE2 2RS53 1H1AA 3OD0A 4LA2A 2BQPA 1CIWA 1JYIA 4EJRA 2VOWA 1ULGA 1D2SA 3BPZA 1C1LA 1LENA 1S1AA 4G3YC 4N9IA 2X29A 1DGWA 4PDWA 1GZCA 1TMF2 3M3OA 1CESA 3MW3A 1UIKA 4YGCA 1OQEA 2ZX1A 3BOPA 4Q0VA 4YARA 2PAKA 2XPJA 4BM8A 2YDEA 2AR6A 4Q0QA 2DVDA 2QDNA 4XZPA 2VNOA 3VBSC 1LGBA 2DUOA 3A0NA 2DTWA 1MR5A 5IT6A 1SLTA 1WBFA 4H55A 2K0GA 4HPKB 5JWPA 4MXWA 1GNHA 3P3NA 3SH3A 5I93A 2CYFA 4X6QB 2E7QA 4BOWA 2K2SA 4H14A 5ABJC 3VBRB 5T54A 3CJIA 5LRRA 3BTAA 4DNYA 3AM2A 4LBQD 4LHKA 1CAXA 2KXLA 4Z8BA 2WFF1 4AGGA 2R1DA 1S2KA 3FMGA 2XJQA 5I8TA 3E6DA 4WM7C 3RRDA 1QQP1 4Q4X2 3VBRA 3UJOA 1VBE1 3S7IA 1WW7A 3FUOA 2DTYA 1NE4A 1ND3C 1OLQA 1RUD2 5FOBB 2VG9A 3S0MA 2P17A 1DGWX 2JG9C 2V09A 1COV2 5BNNC 1LOFA 1QJX1 1RUH1 4QPGC 4JVAA 5F9TA 1CD3G 1NXMA 1Q3EA 3JUUA 1BQPA 5JSOA 5F5QA 1AR62 1MEC2 2HWB3 4XYXA 2A6VA 3QACA 1R081 3FJSA 3AFGA 1BMV2 1BCXA 3AMNA 5IK7A 1PK6B 3ZIXA 4J6GA 2A6WA 1H9WA 2QDRA 2VUJA 5DUWA 2CGOA 4JAAA 2X5IB 4C0HA 2DCZA 1QY4A 4OUSA 4GH4B 3SITA 2Q5TA 4CDQB 1V6KA 1LHUA 1X8EA 3L2YA 3VKLA 4XFAA 4FPGA 4FPKA 1HXS2 5JCTA 1AYM3 2MPFA 1RUI2 2DFBA 1LGCA 1C28A 1M4WA 2VPVA 2PLV1 2X5IA 3ZYRA 4GH4A 3VBOB 4CDQA 1JH5A 2RS52 4MXVA 3WUCA 2ZBJA 4LHNA 3SCFA 3TYJA 1F5JA 2OYZA 3AKTA 4R4XA 5T5LA 4X6RB 1QKQA 4A7ZA 1N3PA 4BMEA 1G6NA 1RC6A 2Y26A 3VBOA 2Y0OA 2G9GA 3ROUA 1YIFA 1W6NA 4S2HA 3FFZA 4DB5A 1C3HA 3VDDB 3WHTA 4NVPA 1QOTA 3EJKA 4L92A 5C33A 1OPMA 2HWC3 2MHFA 2RR11 2D3PA 4MGZE 4AVTA 3MPBA 4RS5C 4AI3A 3B01A 4M00A 5L7OC 2D7FA 2VVFA 3G7DA 2PN5A 3CO2A 1HRV3 3WR0A 4AQSA 4OFGA 3VDDA 4XEZA 1AX0A 4GA9A 1X36A 3H1WA 3KCXA 5CADA 5J96B 4K3UA 2GMMA 4P9WA 4QT6A 3ZSMA 3R4SA 4XJ8A 1ULDA 3WW3A 3LAGA 1JOJA 5JSRA 3I4IA <