1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
b'DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
2QWWA 1J58A 2PQQA 3E6BA 2EA2A 2FNPA 3CO2A 3G7DA 2EFPA 2K7LA 3LWCA 5D8LB 1XD7A 4Z07A 2VC1A 2HTJA 4HMZA 3CEWA 3WTUC 2C6YA 3JW4A 3SZTA 2KXLA 2EV5A 4ZZLA 4UVBA 5AONA 1WGPA 4LB5A 5ILSA 2NRAC 3RNSA 3S7EA 2O0YA 1B59A 3NQOA 1WSUA 4IEZA 1LDKB 1OI6A 1MDMA 2HEOA 3M8FA 2RV8A 4OIOF 1I1GA 3PQJA 3SZPA 1PMIA 3WTVC 3G3ZA 4MEYF 4UBGA 2V6CA 3DFGA 1CAVA 2H09A 3GFMA 4UXNA 3EBRA 3IDCB 3F8NA 3CUOA 4XF0A 4ENNA 3VFZA 1SFXA 2E7XA 2F2EA 3BOQA 4HSJA 2WC2A 4ZU5A 1S29A 5LRSA 1V4RA 2Y0OA 1TNTA 3UKVA 3ROUA 5J6XA 5K5QA 2W24A 1ZZ8A 2GQQA 1TLHB 3HSFA 4AQ2A 3R61A 3ZMVA 4M9XA 4IRGA 4KYWA 2DK8A 2L3DA 1U8RA 1LEAA 2ZFWA 3E3VA 3LAJA 3FE5A 2B0LA 3COAC 2XGXA 2EAAA 4M71A 2DTRA 2RGVA 2EJRA 2VBXA 4YIFA 1FI2A 2E7WA 4MNUA 1RTVA 1FBUA 3C18A 4RAYA 3RKWA 1XE7A 4LK1F 4ESFA 3K1PA 2W57A 2XL9A 4IJAA 3SFZA 1Y0UA 6PAXA 1RGSA 2LSOA 4IEQA 4Z2YA 4HDVA 1GVJA 1QGPA 4Q5SF 4EM1A 2O61A 3BY6A 5FLIA 3OF1A 1QXRA 1FX7A 1QNTA 3HOTA 1CX4A 2PMUA 2QLZA 4PJYA 2CGPA 4AVPA 2QENA 2FMLA 4KN4X 2DFIA 2ZJ2A 5HS7A 5CVUA 1J59A 1Y3TA 4BAYA 2IXLA 1WRJA 1IN8A 4U7DA 2FSWA 3FM5A 5FQ0A 2ZNYA 5ILUA 4EJUA 2ELHA 3GO5A 5LGTA 1ZZ9A 2R7DA 2Q0OA 1JUHA 2L02A 3F22A 3MDPA 1MDMB 1PM7A 1XGNA 2DK5A 2CFXA 4O3MA 2DBBA 1UPIA 1XDSA 4ON0A 3T8RA 1CAVB 4MX3A 2WTEA 4A12A 2PG4A 5JFRA 4XSZF 3K1NA 2V9VA 1RUNA 3J80Z 4ESBA 3L09A 4F8AA 4WXHA 5DUIA 3RDIA 4B29A 2DLLA 1PP8F 5IT3A 3HHHA 4U7BA 2VC0A 5D5WB 2K86A 4WXCA 1S7OA 4LFUA 1TQ5A 4A5NA 3R0JA 3WW3A 1JHHA 3U10A 1YFYA 2XLAA 2IA2A 1QXJA 1B9NA 1XSDA 4UV8A 1ZRDA 5DUKA 1RUOA 3ZMUA 4YFNF 2F5EA 4RS8A 2GIVA 3DKWA 1IN7A 5KHJA 1XGOA 4ESJA 2RC4A 2V1UA 2GC3A 5K5RA 2OYZA 4U88A 2I45A 1FNNA 2YX7A 3LA2A 3E6MA 3IRRA 4FX0A 3KP7A 4CYDA 2WV0A 2RN7A 4ZH4F 2FNAA 2F4PA 2KKOA 1ON2A 4N0BA 3E97A 3QRFF 2PFWA 4IRIA 1YFHA 2Q1ZB 4AIHA 1D3YA 1PP7U 4XEZA 1R7JA 2CW0F 3JSPA 2GC2A 3BPVA 1FPQA 3P7NA 5J7MA 4LUKA 2CSOA 3ZMDA 3S0MA 1JGSA 4HDUA 1NZCA 3QAHA 2IA1A 3WODF 3M7GA 1IPKA 2GA2A 1I1SA 2Y0MA 3EYYA 5FQ0B 1R5GA 1BN5A 1XRUA 3ZMZA 4KIBA 1YLLA 1IXSB 4OFGA 1W5TA 1FC3A 5HLHA 4HLYA 4O6JA 1YW9A 4IHSA 1EV7A 5FFZA 1UB9A 1CAXA 3ABTA 2PHLA 2OU2A 4RAZA 1O3RA 3IIAA 5L3BA 2PQ8A 1O57A 1FYMA 3FFQA 4EJOA 3GZ6A 3JAMZ 1OFNA 3E6CC 3ETQA 3U9GA 1DPRA 3DL3A 5FO5A 1F5TA 2VT2A 3KP2A 4A6EA 1WA4A 2FBIA 2G7HA 1XB4A 2CYYA 2XKOA 3BCWA 2FOKA 3C7JA 2HQNA 4G94A 3M70A 1K6OA 4D7TA 4Q0PA 2QM3A 5L3DA 3F6VA 2GWRA 3DP7A 4HVQA 1XGMA 1LQ1A 3L00A 1KU2A 1IRFA 2GZWA 4BXUA 3KP5A 3F23A 1LNWA 3M9AA 3KCCA 3R0AA 3I0TA 5AIPA 2EA7A 2UXNA 4KUMA 4Q0SA 1FWZA 4JV4A 2G9WA 3GF2A 5HDNA 1YW7A 2OA4A 4NHJA 3DV8A 1V70A 2CG4A 4HAMA 1YFXA 2TDXA 5HS8A 4LB6B 4HQMA 5BPIA 3I53A 2K9ZA 3JZVA 2PFBA 1BOAA 1ZREA 1GQGA 4ZU7A 1B4AA 3WU1B 1D8KA 4UXAA 4UNOA 1LRHA 1KQ0A 2DAOA 2JPCA 1FYKA 5FPXA 4ETSA 2PA7A 2A61A 4LLNA 4RB0A 4HLTA 1HW2A 4LLOA 1ZLJA 4YNIA 4I09A 4AVBA 1FOKA 3H1YA 4K8FA 5HLIA 1G3YA 4I01A 4U0YA 3TOBA 3F21A 2IW5A 3F72A 5CVJA 4RD7A 1ZRFA 2D5HA 1XN7A 1Z6TA 2A69F 3CO7C 1CAXB 2VONA 1Z91A 4RGUA 1P4WA 4MTDA 4YARA 3T0YA 1IUYA 5D1IA 3UKTA 4UVCA 3RKYA 2MPFA 5E1RA 3BB6A 1U5TA 5EEHA 1YO5C 3FF5A 1E17A 3CDHA 1XGSA 1F4KA 3GBFA 4Q0QA 1FYLA 3HHGA 4QGNA 2MH2A 4KIFA 2M5WA 3ZMTA 1J7KA 1R1UA 1YWKA 3RPQA 4RB3C 3FJSA 1QZZA 3H9AA 5F1RA 4KN7X 4FAHA 1RIOH 2XAHA 3BDDA 3S7IA 5JCTA 1R36A 2R3SA 4EWEA 2MA3A 2PBIA 2A6HF 4KNYA 4XF9A 2Q8KA 1FP2A 5HOOA 1B1BA 1JE8A 1J1LA 1GXPA 3WE2A 1OKRA 4MTEA 3WTWC 3I5UA 3PVBB 2FBKA 3HQXA 3CLPA 4BQAA 3LAGA 4KU8A 2UXXA 5FFXA 1VR3A 3GW2A 2BBYA 4WZCA 1KGSA 2EFNA 1LVAA 3REOA 3J81Z 4IEXA 3FZ3A 2MD5A 5H20A 1HKQA 4OIPF 2IXKA 4TLFA 1ZLKA 4L9VA 3CUQC 3T1BA 4ZYGA 1L0OC 4IETA 3ERED 4GYIA 3E5QA 2QNKA 1LB2A 3ES4A 5EEGA 3E5XA 1GHCA 3SQNA 3LZZA 3GFLA 5TRDA 5I8YA 1XSVA 2P5LC 4LG0A 2O03A 2HWVA 1TQPA 1Z6RA 1UHWA 3QOPA 2Z5UA 4NB5A 2RKHA 1U5TB 3U2RA 2XASA 1NE4A 1O3TA 4X6RB 1HQCA 4X6QB 4I2OA 3U11A 2MH9A 1MKMA 2V1DA 4HA8A 3TKYA 3CJXA 3V7CA 1BJAA 3ZN0A 5A2QK 4E2GA 4ZYDA 3LSTA 1ZHFA 5FB2A 2J5OA 5JR7B 4Q4ZF 3MZYA 5L3CA 2L54A 4KWKA 4QX5A 1IN5A 5D8KB 1T2KA 1SD7A 4UV9A 1X8MA 4IERA 2ESHA 1UIKA 4KL1A 1JHFA 2XV4S 5DCMA 4LA3A 5ICCA 1D5VA 1TW3A 1ULYA 1FBQA 2EA4A 4HSLA 4MEXF 4G7HF 3RTRA 2YPRA 3EQEA 1ZRRA 1B9MA 3USSA 4ZZDA 2LF8A 4P96A 4KWJA 4LLGF 1PUEE 1IW7F 3NJZA 1IPJA 3LQQA 5LBQA 3GYDA 4L9JA 1R5HA 4XFGA 3WE3A 3SMHA 3DN7A 1R23A 1LR5A 3I54A 4D7SA 1BI1A 1UCXA 2GAUA 4P9UA 3ZMSA 1S8NA 5BS6A 4ENKA 2HQRA 1U12A 3H1WA 3AAFA 3MPBA 1CAUA 1NXMA 3GWZA 4HLXA 1KQ8A 1AWCA 2YSRA 3IWFA 1BBYA 4KA4A 1BIBA 4BYYA 1YFWA 5L3EA 1DZTA 5HDKA 3RPUA 4LG0B 4J1XA 2UYAA 1LDDA 3ES1A 2PHDA 2P7VB 5ICFA 3JTGA 3B73A 3WGHA 4GULA 1W7PD 3QU6A 4BHBA 1OYIA 2KJCA 4L18B 3EYIA 3ZN1A 1SMYF 1PDNC 5JR3A 4AIKA 2Q0AA 3TNQA 3PFIA 3ULQB 2UWMA 2ZNZA 1TBXA 5DYMA 4IEOA 4XRFA 1H9TA 2G7UA 2D5FA 3I64A 2IP2A 4CGZA 1Z05A 2QVSB 2OAZA 4R52A 5ERIA 3ECHA 3MQ0A 1F1ZA 1YW8A 2A07F 4TV7A 2OA2A 3NKTA 1ZRCA 2YX4A 1QZYA 2P7CB 1IRGA 4IRHA 2MC3A 3GVAA 1C0WA 3HTUA 2FA5A 3R4KA 5DCMB 4D0PA 1ZN2A 1TQMA 4L11A 1W7PA 4M6XA 1Z1DA 3KP6A 2L4AA 1D8JA 1EP0A 4R1HA 1Y9QA 3TDZC 2GXGA 1BC8C 2HYGD 1YIOA 2MLKA 3WW4A 4HX7A 2F5FA 4IEYA 2QUFA 2W85A 3FXQA 3IRQA 2VT3A 3Q5FA 4IEUA 1ZARA 4R79A 2VE9A 1UD1A 4BNCA 2VPVA 3TQNA 2PI0A 5BY5A 2DCTA 2XUBA 2UY9A 4CZZA 1CAUB 4QM9A 3IKVA 1SFUA 5FLJA 4I7HA 4MQVA 1KQ9A 3I59A 3EDPA 2Q4SA 4QXKA 4EGZA 3Q9VA 1T98A 3HUGA 5LHGA 2XIGA 5L3FA 3RJPA 2ZO4A 3BJ6A 2PAEA 3IKTA 2E1NA 3ELNA 1KYZA 4DINB 4L9TA 1ZZCA 2FEZA 4HW0A 2GC1A 4U0WA 1Q5OA 1U5TC 2ZBKA 4PGGA 5E8IA 1FZPB 5BQTA 4JBAA 1DP7P 1ZZ7A 5I0TA 4MGIE 2CO5A 3L7WA 2BNMA 1P2FA 4H7LA 1DUXC 3TO6A 3H3UA 2EV6A 5JAXA 2XRNA 2KRFA 4G7ZF 2DQLA 2NAZA 3GXOA 3F8BA 2JT1A 3FHIB 2OD5A 1BI2A 4E70A 3D5LA 1TNSA 4EM2A 2GXBA 1HKSA 1OPCA 4ZU4A 2PTMA 2XLFA 2AXLA 2H6CA 4F7ZA 2D1HA 3FWEA 3H92A 3ELKA 2XAQA 4IESA 4Q29A 4S05A 2MBFA 2KIUA 1H1MA 3W6JB 3MYXA 1MJBA 2IXIA 3NW4A 1W7PB 2QCSB 4HVRA 5D5UB 4LA2A 2JSCA 4MZUA 1I27A 5E1XA 5E1ZB 1CF7A 1HXDA 5IT9K 3LA3A 3WTXC 1K78A 2HKXA 2VE8A 4KWLA 5JSRA 1YQAA 1WQ2A 3RIRA 2Y48A 1VP6A 3O6BB 4GYGA 3V8KA 1U2WA 3M1EA 2V1XA 3BPXA 3BJAA 2BV6A 3QP5A 5D6EA 5JI6A 4QM8A 4UUVA 4YFKF 2M8EA 5DD8A 3ZP5A 4OMYA 4WF2A 5LEJA 2VOOA 5ED4A 3C1DA 4RB1A 4P5OA 3DPTA 2W84A 3BZ6A 4KICA 5CLSA 3K69A 5FD6A 3IWZA 5I91A 1P4XA 4CHUA 2D40A 4B8XA 4PIYA 1IZ1A 4CICA 1YLFA 3I4PA 3I59B 4WCGA 3GEZA 2EFQA 2D2WA 3V4GA 3L2HA 2F5CA 4M73A 2EFOA 4M6YA 4XF3A 5JHUA 3K1MA 5BXXA 2FRHA 1B6AA 3SHRA 2AS5F 1BC7C 4META 5D4RA 4MUVA 3HRUA 1OYWA 1XCBA 1IN4A 2HDCA 2BNOA 2O8QA 3KEQA 3VOEA 4G7OF 2O3FA 1EH6A 4OINF 4RGSA 1DPUA 2DW4A 3MEXA 1MD0A 2VOPA 3WW1A 1EH8A 1VTNC 1R22A 2HGCA 2HS5A 1BM9A 2V09A 4R8HA 2M87A 3KZZA 1V3FA 4EVIA 4Y17A 4B09A 5EZWA 3RI4A 1QBJA 4JK1X 3JTHA 3H3ZA 4I02A 1O7LA 2MNGA 2A6EF 3KE2A 5E16A 4IPAA 3HOSA 2ZXJA 2IRFG 3H7JA 2PAMA 1CF7B 2OQGA 4MV2A 1K78B 1ODDA 1WKMA 2STWA 1P4AA 5BPXA 2VXZA 2BNNA 2IA0A 2KIMA 1FSHA 2XHKA 4EJTA 3F6OA 1QY4A 2WWYA 3H7YA 3RKXA 2P6TA 3QPHA 2ZKLA 4OIQF 2YU3A 3GFIA 3WGIA 5FLXK 1CGPA 4QWQA 5K5OA 4BHPA 2F5DA 3DXJF 4L0YB 5HI0A 3ABUA 3F3XA 3WU0A 5E18F 4P9FA 4LLLA 4XF4A 4H0EA 3ISPA 1YTYA 4MQ9F 3J81K 4MH0E 3SCFA 2XVCA 4RB2C 3RYPA 4Q48A 4QGMA 2E9QA 1J0RA 4JTNA 3MCZA 5ICEA 3QU3A 3S2WA 4LEJA 4IEVA 1NHAA 1OD5A 1J5YA 1XDUA 2M30A 2E1CA 5E17F 5BOXA 5I8SA 4OLLA 4N9IA 4IEPA 3ZDSA 4HYEA 2M1BA 1L3LA 4P9GA 3GFJA 4ENJA 3TO9A 2ISYA 4A0XA 1KU7A 2HYFA 3CF6E 2OPKA 3OD0A 2XROA 5J48A 4HX4A 4ENMA 2H27A 4FAGA 5T3NA 4Q0VA 3ML6A 2W25A 3MFKA 1Q1HA 1KA8A 5DEQA 4XETA 4E2QA 5ICGA 4KU7A 2FBHA 4MGYE 3BU7A 1O7FA 3FMSA 2BE5F 1SAXA 4EWAA 5CVRA 2D93A 2DI3A 2EK5A 4AD9A 2IPQX 3IDBB 2LF7A 2XLGA 4JTOA 3T8TA 4XBFA 2GA1A 4L5JA 1SMTA 4E2SA 1W4MA 3LA7A 4XF1A 4LMYA 3PLQA 3HT2A 4OMZA 3VODA 5FD5A 5JSPA 4M72A 5AIQA 3I7DA 3WGGA 5DV5A 3WTSC 3CJNA 2J5PA 2EV0A 4OU0A 3LAPA 1IAWA 1EH7A 3D0SA 1K7AA 1BI0A 2VBWA 3EHKA 3WTTC 3RYKA 2OZUA 4LTAA 1P6RA 2VBYA 1WI9A 1ZGJA 5TJJA 3KMHA 2PAKA 4XSXF 4IF4A 3U0ZA 2BGCA 1G3TA 2N7GA 2Y75A 1WWXA 1EY2A 3JSOA 4EMSA 4CXFA 4WVZA 1LDJA 1O4TA 1T6SA 4PIZA 2FE3A 2QVOA 2CWEA 2RDPA 2YR2A 3O3KA 3QP6A 4XLNF 4J1WA 1QPMA 5LHIA 3FXRA 4YRDA 2Q2EA 1ZZBA 5HDGA 4WXDA 1X8EA 3F8MA 3DEUA 1QQIA 4ASNA 2XAJA 4RGRA 5F6FA 2STTA 5DCFA 4Y15A 1GXQA 1G4DA 5LLQA 1USSA 1EPZA 3KP4A 3NVCA 3B02A 3ZQ7A 2X0LA 1FY7A 1EYBA 5K8SA 1DDNA 3KETA 2VECA 4L2NA 4LD5A 3NRVA 3QPTA 2BYVE 3LOIA 2ATFA 4FHTA 1RI7A 2IC1A 4GCVA 4MGKE 1A04A 1J3QA 4LK0F 1BI3A 1XCVA 3DPLC 1ZNPA 4A5MA 1LEBA 2LKPA 2ZKZA 4AWXB 2UY8A 3EUHA 3GYHX 1R00A 3CLOA 2FQ3A 2Z33A 2OQRA 5BPDA 4HVOA 2H6BA 3BJOA 4JVAA 4G8XA 2CV6A 1QWRA 5BV6A 2VBZA 4OIRF 2H94A 3VHRA 3DF8A 3G73A 4I3PA 2XAGA 5A2QZ 5CYVA 4WX9A 2ZCWA 3EO6A 3SXWA 5FDBA 1J3RA 1O3QA 2BEOA 3V8JA 1ZH5A 2Z2SB 4HN0A 2HJIA 3FZVA 4KT5C 3LQRA 3I58A 4PGHA 5BUVA 2D45A 4HOBA 3MZHA 2K0GA 4N9HA 3K0LA 1BIAA 4FT8A 3WW2A 2CAVA 4O5VA 1OYYA 4XLPF 3C3WA 1S3JA 3N97A 3J80K 2ADUA 5JVTA 2IXHA 5C6CA 2PYTA 5KK1A 4LUMA 2XKPA 4UHTA 3O14A 2OZJA 2NS0A 2NNYA 1MGTA 4BH9A 1ZVFA 4PCQA 1O3SA 4L0ZB 4KFCA 3HYIA 1Z7UA 1G6NA 2PJPA 4XFFA 5HLGA 2OZ6A 2ESNA 1FBSA 3F8CA 4ONUA 4S04A 2P8TA 5I0SA 2Q30A 2FF4A 2XL7A 3SXYA 4WWCA 2DT5A 1WLTA 4HN1A 5J8CA 4KDPA 5CU1A 4HZFA 4EV0A 3FX3A 4WK8F 2ISZA 1J75A 4XFIA 1HSJA 5HVQC 5FCCA 5J3UA 3V7SA 4U0VA 3CUQA 2ETHA 1W5SA 1FSEA 1QO0D 4I98B 3T5XA 2X4HA 3J7AO 4MHGA 3GLXA 3HRTA 4Q47A 4EJWA 2FQPA 3DQVC 5KHHA 3PNAA 1ZAOA 2NYXA 2QQAA 5J8FA 3BPZA 3BWGA 3M8EA 4NVPA 4EWDA 5LRRA 1LKNA 2P17A 5KHIA 2XAFA 2ZMEA 3EETA 2WFPA 5KHKA 2IXJA 2VQAA 2GC0A 3ZPLA 3VB2A 2O1QA 4AVCA 1DGRA 4AVAA 4EJVA 3BROA 1RNLA 3L9FA 4EGYA 2NNNA 4CDGA 4QMAA 4XFAA 1YUDA 4BHCA 2B9UA 2HTSA 3ECOA 3ST7A 3Q9SA 3KLOA 2PEXA 3TO7A 1O5LA 1U3EM 2RVCA 4LJZF 4A0ZA 4PDKA 2K4BA 3OOPA 4EM0B 2LDUA 1ZYRF 5I93A 4K2EA 1SD6A 2MHFA 5ILVA 3CL1A 3W6KB 1UW8A 1HBXG 4HF0A 1NE6A 3KLNA 2HKOA 2DQRA 2B5HA 2IJLA 4YIIA 5AVPA 3GZ5A 2QJVA 5LGUA 3HSRA 3JAMK 4AIJA 2PN6A 2O8XA 3FXUA 3LWFA 4HBLA 1XSXA 1YG2A 2P6SA 1HKTA 4M9ZA 1TTYA 4DNCA 3KP3A 2KJBA 3K9TA 1MJAA 2P4WA 2PMHA 4Z82A 5LHHA 1R1VA 5E1WA 2K27A 4M9SA 3LFKA 1UCRA 2GH2A 2EFWA 4HF2A 4MGZE 3V7RA 3N4MA 3FHZA 4IVNA 1J2XA 3HRMA 4HX8A 3GX4X 4ZYHA 1L3JA 5CJ9A 4QGLA 5KHGA 4G9YA 3GUDA 5KVRA 1I6XA 2EB7A 3CUQB 3WG9A 4AQ6A 4UVAA 3MWMA 2OBPA 2MLGA 1YS7A 3M3IA 1YS6A 2QQ9A 3CTAA 1O5UA 2UZKA 3MAJA 1UIJA 1ZG1A 1S6LA 2ET1A 1GQHA 5I0RA 3C3VA 2A3SA 1HW5A 3PQKA 4I0BA 5E20A 4P55A 3KGLA 3BALA 2ZMEB 4WBBA 1KYWA 1J9IA 5FPZA 1IXRC 3R6SA 2HZTA 3OGJA 4Y13A 1YHFA 3IC7A 4L9NA 2P5KA 2QYOA 3OV8A 3HSEA 4CO8A 1SD5A 3TNPB 4HV6A 3IL2A 1IN6A 2K4JA 2QDRA 3E6DA 5F64A 1T38A 4LULA 4GGGA 4QLCU 3TGNA 3NL1A 4A0YA 3E5UA 3WTZA 2Z3YA 2Z99A 5IT9Z 4XFBA 1STZA 5K1YA 4EQQA 3NSTA 4LGWA 1SQ4A 4OOIA 2H0VA 2Z69A 1SFEA 1YYVA 5I0UA 1E2XA 2KIFA 1KU3A 2FXAA 2EWNA 2LNBA 4UBHA 5LGNA 3CO6C 3KEOA 2A68F 4XFHA 3P9IA 1MZBA 4IHTA 2DPUA 1U6GA 1P92A 4RGXA 1Z9CA 3H50A 1G3SA 1XMKA 2L01A 1SFNA 2JRTA 5JSOA 3D0JA 3HT1A 4XFCA 5L3GA 3O2PE 2UYBA 4A6DA 4YFXF 4FX4A 1J3PA 3F8FA 2C0ZA 4MGRA 1CAWA 2DU9A 1ZG5A 3FM3A 3H1MA 5D4SA 1H1IA 1SEFA 2FU4A 2HOEA 1RL3A 3H8UA 3UKNA 1ZZ6A 3I71A 4IEWA 4Q0UA 5CVIA 1ONVA 1XMAA 2ETEA 3SCGA 5C8WA 4KMUX 2CAUA 1FT9A 4O9GA 5KBFA 4A2UA 3L2CA 3TOAA 1HW1A 1XE8A 3IHUA 3BP8A 3K2ZA 5H6QA 1X7NA 5BMZA 4I0AA 4KMFA 1LJ9A 1R1TA 2QBYA 4DQ2A 3NEUA 3VEPA 4M74A 1OR7A 5D5XB 2IT0A 1MJ9A 3OTFA 4HV5A 3KFWX 5E8GA 1VJ2A 3HTSB 1H9GA 1YFUA 4PIXA 3IBMA 1DZRA 2HFHA 4NQWA 1T39A 3P9CA 2ACJA 2VODA 3WTYC 4ZYEA 4KIGA 5DDGA 2CQKA 2HR3A 4HQEA 1JXSA 5H6RA 2PLYA 1FP1D 4PZJA 1ZG3A 4GO1A 3TDUC 3P9KA 1TW2A 3R60A 3KGZA 1OMIA 4L5IA 1K79A 4IXAA 2IVMA 1RZ4A 5D6FA 4ORFA 1RC6A 3V8LA 2RQPA 3HRSA 1G3WA 1HSTA 5LEKA 4JQFA 5CADA 3RYRA 2JZYA 3HIFA 5FLXZ 1IXCA 1FLIA 3FMQA 2K02A 2DPDA 2EVXA 2R7FA 2QZ8A 1U78A 3RZZA 2RNJA 1F9NA 3KSCA 1R58A 1ON1A 2B8MA 3OCPA 1AOYA 2V79A 4FBFA 1UHMA 2IXCA 1SD4A 2P5VA 4O9EA 5FLHA 1Q43A 3FMRA 2O6GE 1CAWB 2Z9OA 2GU9A 1T0FA 1IF1A 4HBNA 1UFMA 5I8TA 4YG2F 5CVVA 3QACA 1NYWA 3D82A 2L4MA 2ET7A 1ZGAA 1Q3EA 2M45A 2FMYA 1FXZA 5DD4A 5FGMA 4HF1A 1X82A 5EFUA 4GXOA 1REPC 4YSFA 3EQLF 3U1DA 2JPBA 1ZX5A 3ACLA 3SCHA 1I5ZA 4G6QA 1KU9A 1H0MA 1DGWA 3SHFA 4BIFA 3EJKA 4G6DA 2QBYB 2A5YB 2D1VA 2QQBA 4EROA 2COMA 5D5VB 4AXOA 1TQIA 1USTA 3KZYA 2VN2A 2DO7A 2JTVA 1S7AA 4YYOA 5HS9A 1X3UA
chains in the Genus database with same CATH superfamily
2QWWA 4NUBA 4NQWB 4XRSA 3K4NA 3AKPA 2NP0A 5DN2A 1Y8QB 2EFPA 3JD71 3H3LA 4XMAA 3EUKL 3SITA 1W9YA 1W6OB 3MPPG 2ZZQA 4AGGA 3PNTA 1JU3A 1HJFA 4ZZLA 4UVBA 1SLBA 2O8OA 3N7LA 2OS2A 3AC0A 1BK1A 3QPLA 3RNSA 3OYWB 2EXKA 3SKJE 3I97A 4BDYA 4ZXKA 3MUY1 3VBRC 4YZ4A 5K9YA 1OLTA 4B44A 2EICA 3ZQIA 1JZ8A 2K5CA 4P5HA 4EATA 2F4MB 3F8NA 2K9MA 5FY1A 2A3WA 3SLIA 4ENNA 1VQKI 1SFXA 2E7XA 1NG7A 1GZ9A 2WC2A 5JOYA 5LRSA 2Y0OA 1W6QB 2JB8A 1PHMA 3I2IA 3IUOA 2OT7A 5IT6A 3DGTA 1DGLA 2VMIA 1TLHB 3SQOA 2MFZA 5GP9A 3ZMVA 2D44A 2XG3A 4IRGA 2KPMA 1W39A 3FE5A 2B0LA 2R063 3ME2A 4RL7A 2VBXA 3MLKA 2BOLA 4RAYA 4I3GA 2V6EA 2O7OA 4QPOA 2JUGA 4Y4RA 5GZCA 5A6XA 1C8NA 1UKRA 2JDPA 3FHQA 4IJAA 6PAXA 2RNGA 1UPSA 4HDVA 2L9SA 2V72A 2N8GA 1FX7A 2R1BA 1QNTA 4QX1A 1HRI3 2FDHA 2QENA 1UY3A 1J1TA 2DFIA 1X9PA 5C4JJ 3UGGA 1J59A 1WRJA 1DQ0A 1IN8A 1B09A 3DLLF 2WQ4A 5GPCA 4BE2A 3G1LA 2CMPA 1P9QC 4H4KC 4J19A 2LLKA 3GO5A 3GGLA 3IPVA 1QH7A 4NRPA 3WR0A 1IGNA 2CFXA 4TTGA 2DBBA 2D97A 3T8RA 4PJMA 4PQQA 1CAVB 3GHMA 2WTEA 4IHYA 3ZM8A 3C7EA 1PVC1 1MBKA 3J7NA 1RUNA 5FWJA 5FZDA 3L09A 2DA6A 3CDZB 3ZR6A 4GWIA 1BLZA 2HWD2 3MLJA 2P34A 4Y22A 4AR2A 4XPVA 3T30A 1S7OA 3J7LA 3UV9A 3K7AJ 2ZFUA 3S15J 3OYEA 1ODMA 2RC4A 5K5RA 4NIAA 3E6MA 2VY0A 3KP7A 2JDNA 2DDUA 5EHDA 3WD5A 4DJAA 4LBLA 4CA9A 5IOZA 4UY8I 2FNAA 4JGZB 2F4PA 1ON2A 2HWF1 4YZ1A 5JIAA 1ERDA 3DXTA 5K0UB 1YFHA 3D5OA 4B47A 1PP7U 3QCWA 2VXDA 4V19K 2RG4A 4XEZA 2EIGA 3X29B 2CW0F 1I3HA 1MS3A 1CJDA 1OVPA 3JSPA 3DEWA 3W21A 5J7MA 2WNEA 5F32A 1UOGA 4LE4A 2BOIA 4I99C 4HDUA 4WVWA 4PSWA 4XBLA 1S2EA 3WNPA 1UYZA 3R0RA 3M7GA 1VMJA 3CMGA 1B35A 5FYBA 3K4CA 3EYYA 1R5GA 1UU5A 1BN5A 5F3CA 3J4UH 5CFDA 3HVDA 2RM23 1RHI1 1SZBA 4AEMA 4OFGA 2R073 1FC3A 5HLHA 3WF2A 5J4YA 4CDWC 1EV7A 5FFZA 3T0AA 4CEYB 3HQRA 4YPJA 3NNGA 4RAZA 4AM3A 2WB1A 5FZEA 5JZGA 1GZCA 1O3RA 3HPGA 4YIRX 3LCPA 1G59A 1FYMA 2Z1DA 1OFNA 1ZKGA 1DLLA 3E6CC 2IVJA 1JKQC 3BR6A 4QT6A 4P9LA 2FBIA 2G7HA 1XB4A 2CYYA 1UY0A 5L9VA 3L2WA 3C7JA 2HQNA 2G4IA 4NIGA 4Q0PA 1RXGA 4S0HB 1WI3A 1D1AA 4AI3A 1OUXA 4B7KA 1PGL1 2MSYA 5EJ3A 5EWSA 1TP4A 5KWRA 1LQ1A 4MGQA 2AGSA 2RHPA 1JMUB 3IT8A 3D8CA 3CCSI 2J42A 3I0TA 5F6KA 4KUMA 4Q0SA 1FWZA 3M3CA 2CW7A 3QODA 1KZHA 2OA4A 2RR12 4NHJA 3DV8A 3PM1A 3OUIA 3P5JA 2RDNA 1YFXA 1QOSA 2O8KA 1MMGA 4HQMA 1IUFA 3A01B 3I53A 4ZY9A 3B5LB 1BOAA 1H9WA 2W2IA 1WJFA 4ZU7A 4M4RA 1D8KA 4UXAA 3I3LA 4UNOA 3R4SA 4LORA 1RUC2 1POQA 2DAOA 2JPCA 2VJXA 4RS5B 5FPXA 4AFMA 2PA7A 4U36A 1R093 3J8F1 4LLNA 5E8AA 1WKYA 4L0PA 4MOAA 3J7MA 3VBUA 4DNYA 4I01A 3MN2A 3F21A 1OC1A 1NY71 5JR2A 2VZPA 2A75A 2D5HA 4XTPA 1VRH3 2A69F 2WSVA 4RM2A 4RGUA 3QYBA 4YARA 3T0YA 3J7AY 5D1IA 2YGMA 4PDWC 1NAEA 3RKYA 3NV3A 1IQAA 2C6SA 4JRLA 1AUYA 5IK4A 1ETWA 1U5TA 5FKCA 5FZCA 5EEHA 1E17A 1ST8A 1ZBE1 4Q0QA 3AMPA 3HHGA 4QGNA 2MH2A 3DKXA 2QE3A 1QJEA 4WM7B 1C1FA 1J7KA 2VXRA 1YWKA 2JE9A 2XWJB 4RB3C 1ZK8A 1QZZA 1PZ9A 4NIHA 5F1RA 4KN7X 4RGAA 1JGGA 4DXTA 4FAHA 1RIOH 2XAHA 3BTIA 1AYN3 2Z42A 5JCTA 1R36A 2ZJRF 1K4SA 1W8FA 1H8AC 5GAEJ 1CQ9A 2MA3A 4CTEA 2RS51 1IPSA 1YX5A 2A6HF 2VMCA 1YRZA 3UJQA 3TAYA 1GXPA 1URXA 2YPDA 3WTWC 4MTEA 3I5UA 2FBKA 4IV3B 1VQOI 5DG2A 2JDYA 4FE4A 1DBNA 4QB1A 2FCVA 3LAGA 1H1AA 3CDLA 1Y39A 1PNGA 1BEV3 3GW2A 1AYM1 1CESA 5A70A 4WZCA 5FZ6A 1ONAA 4PI0A 1LVAA 3VHOA 5CG9A 5F0CA 3FZ3A 2MD5A 5H20A 2B42B 5GKAC 3CCEI 4WM8C 1W6PA 1NCQB 3MEPA 4TLFA 5CA6A 2YFZA 3CUQC 2NN8A 4IETA 3ZMOA 4G6TB 1KEXA 4GYIA 2ZGMA 3VD5A 4S2DA 3IMNA 2QNKA 1LB2A 1W6NB 3GFLA 2PQSA 5I8YA 4UW4A 1T08B 1W2AX 5C9AA 4LG0A 1I9RA 4CU7A 3KZIC 3ZKUA 1SBEA 1LGNA 4Z8BA 3HJRA 3D5RC 1UHWA 4M0NA 3QOPA 4OI4A 1RUE3 2RKHA 1GICA 2XASA 4BZ4A 1HQCA 4GALA 4LHKA 4I2OA 1POV3 3AZZA 1Z21A 1GP5A 4YZ3A 5CG8A 3N35A 1MKMA 2RDSA 4HA8A 3V7CA 1YJKA 3ZN0A 3MW2A 3H5AA 5JR7B 3NWSA 2EIKH 2HBTA 3KT4A 4BPZA 2JVHA 4CPBA 2LY2A 3V0AA 4KWKA 4QX5A 5A3UA 2M0MA 2BWAA 4IERA 3KZ4C 1A6CA 3CNAA 1JJ6C 3TWIA 1TW3A 4OHWA 4HSLA 4G7HF 3DBRB 3USSA 4P96A 4LLGF 2ILMA 1QJY3 4BQ3A 1CPNA 2JVGA 1HRV1 1LOEA 1D1CA 2DYRH 1X1AA 4ES8A 4HPQA 1LR5A 2HWC1 3I54A 4P9UA 1S8NA 3ZYJB 5BS6A 4EN9B 2KA3A 1U12A 1GV2A 3LE0A 3ONQA 1UOJA 3BR2A 4D3WA 4HLXA 1JZ3A 3R4UA 1SFYA 3MW4A 3K48A 1W8WA 5IHRA 4BGDA 2L7MP 4C90A 2VW1A 1IJWC 1GYKA 4AGVA 1MVQA 4A3ZA 3RPUA 3N9PA 1AKHA 2X05A 2P7VB 5ICFA 3JTGA 3B73A 1W7PD 1G9FA 4C2MJ 2YY1A 5FYMA 3IIIA 3EYIA 1PDNC 3KV6A 2LTPA 2IBDA 2ZNZA 5A7SA 1F8VA 5EYRA 1H9TA 3MICA 2D5FA 3I64A 4CGZA 3ZFGA 2A71A 1U9OA 4R52A 5ERIA 3ECHA 2HPIA 1F1ZA 5BNPC 1ZRCA 2M34A 1C0WA 2JA8J 4CP1A 4XOTA 1UELB 3R4KA 3B6CA 2HWB1 4B4CA 1TQMA 4L11A 3UT0A 4JZRA 1IQDC 5T52A 4JHZA 1GZWB 1GLNA 1Y9QA 3TDZC 2HYGD 1HN0A 4ZKTB 4GH4A 2QUFA 3BQYA 3Q5FA 2XPVA 4YELA 4UOJA 1ZARA 1J83A 4W6XA 4BNCA 3HOUJ 5FZKA 5LBFA 3TRSB 4BQNA 4NHLA 5DUVA 1UY2A 2DCTA 1NXD1 4N7UA 3VDDA 5EYYA 3WLUA 3DU5A 1JUSA 2VQLA 1W3XA 1VBB1 3U75A 4I7HA 2ZGOA 1SCSA 1OCTC 2Q4SA 4QXKA 4ATEA 1H89C 3Q9VA 1OLME 3NJXA 3BJ6A 3VYRB 2DVFA 2CS3A 3ELNA 3NARA 1ZZCA 2WO3A 4DINB 2DWRA 2FEZA 4HW0A 1ZBA3 5E8IA 4V2VA 3WF3A 2WQZC 5A3OA 3O1MA 4Q4V3 4AYBA 1DP7P 5I0TA 4MYEA 5GAGJ 2CO5A 1DUXC 1LU1A 3TO6A 4BJTA 4D5CA 1JYWA 2XRNA 3WCRA 4A3JJ 4G7ZF 2R7TA 2I2SA 1WCMJ 2HQ5A 3GXOA 5K7HA 3BUCA 4ZXEA 3RKQA 1LNSA 1DCSA 2C24A 2LW8A 1MEC1 4M3EA 2OUJA 2GXBA 3MGUA 1QHDA 2WN2A 2YHJA 3M3YJ 5FP9A 2H6CA 4XKWA 3H92A 2XAQA 2ZHNA 3VBRA 4Q29A 2MBFA 4AF9A 2JG9C 3W6JB 5TSWA 1S55A 2D3PA 1HB2A 5D5UB 4QQOA 1I27A 3AFHA 5E1XA 2VXJA 5IUQA 5FZAA 1H30A 1GV5A 1BJQA 1TT0A 1M1EB 3CJRB 2OCEA 4E7IA 1VP6A 2R7VA 2W5FA 4OZXA 3VL8A 1X4PA 2D3SA 3W9AA 2LROA 3M1EA 3WG1A 2G0EA 5DAWA 3BJAA 2NVQJ 1DLCA 4NHMA 2M8EA 4OMYA 3MIFA 4XILA 5LEJA 4DXRA 2G9GA 1K45A 3MHZA 3N9MA 5I91A 4Z2AA 2E6VA 1V6JA 2CHHA 3L2HA 2W94A 1UXZA 2EFOA 1QDOA 1K3IA 2X9DA 3SHRA 1W8NA 1VZ0A 1IN4A 2HDCA 4ZC3A 1W04A 3H8RA 3S8PA 1FMWA 4NC6A 2R5YB 1PO13 1V6NA 3DKQA 4EN8B 4PLMA 1DPUA 1MD0A 1EH8A 3RZKA 2WT0A 3S1NJ 4BB3A 2JJ6A 1ETKA 2Y2ZA 5EDNA 1BM9A 2V09A 2Y6KA 2JRMA 5CBLA 1GP6A 3ZQGA 2M87A 1V3FA 4EVIA 2DCJA 4JX5A 3RI4A 4JK1X 4KBBA 4Y26A 2VCCA 1O7LA 1RUJ2 2A6EF 2OUMA 2E60A 1JYIA 4IGPA 1HA8A 1GR3A 4FQ4A 2OQGA 2X6WA 2XJTA 1ODDA 1WKMA 2FHRA 2VXZA 2BU9A 2Z5WA 5LZ6A 2DYCA 3B7MA 3KS7A 3AP9A 3DTKA 4C1XA 4XL9A 4YFZA 4GAZA 4HOOA 4NROA 1TWHJ 2JDMA 2P6TA 5FRMA 4XTMA 2NQYA 4Q5OA 4OIQF 3GFIA 3WHTA 1CGPA 5K5OA 3OYAA 2CQ7A 2F5DA 5A1FA 2W9XA 3DXJF 1VB4A 4LHNA 3WU0A 3PJQA 1UXXX 5EPAA 5FZFA 5FMBA 1OHFA 4LLLA 1U5ZA 4H0EA 2JN6A 1D4M2 2CNAA 4MQ9F 2WZR1 3HBKA 1BW6A 3OYCA 5A7WA 4LK6A 4LBMA 4Q48A 2IWGB 1J0RA 4JTNA 2DCEA 1DG6A 1OPMA 1OD5A 3I49A 1SVOA 1J5YA 2DFHA 5E17F 5BOXA 1VNDA 3ZDSA 3RZDJ 1L3LA 3QH7A 1RJ7A 1DHKB 4TYSA 2FDGA 2K40A 5KC6A 4YFWA 2QQVA 4BWOA 3VBOC 1HC8A 5CB7A 1XU2A 1OBNA 4FAGA 4YVSC 2HEVF 3WP6A 1MZFA 4XVHA 4YVWA 1Q1HA 1KA8A 3BODA 4XETA 5IK8A 2MEV1 2XF7A 2VNGA 3LDRA 3K70D 1O7FA 3OYBA 1SAXA 4LPLA 2D93A 2XJRA 1BQPA 2QSHX 2WAQN 4R9DA 4CDWA 3T8TA 2VC9A 2J1TA 5IVFA 4Y5Z0 3CQZJ 1K4TA 2KMUA 4E2SA 3OS2A 4FTBA 3LSEA 1MZ6A 3PLQA 4BOWA 3GALA 2IAIA 3KVAA 4ZTJA 3GCWA 4RQPA 4K40A 1N75A 4PK4A 5J1XA 4CDQC 3U1XA 4A6OA 2AEZA 3LAPA 1IAWA 1W9SA 2VVDA 3VZMA 4AYUA 4CDUC 2OUHA 1QQP2 5J36A 4U2AA 1IRZA 2OZUA 1AR73 4LTAA 4LK7A 2VBYA 5C71A 2PAKA 2ZTNA 3U0ZA 1NK3P 1WWXA 4WVZA 2DU0A 2FE3A 2QVOA 2WNOA 1HXS2 1AR91 1FPN3 3R05A 5LA1A 2RDPA 4XLNF 5FZ0A 3N9NA 5B2GB 1DQ5A 5HCAA 3FXRA 4B1RA 5F0HA 5HDGA 2WNVB 4LKDA 4UYBA 4ZS2A 2QQKA 1QVTA 4Y3OA 3DEUA 1YQ5A 2XAJA 1RUH3 4RGRA 2STTA 4AEDC 5E79C 1GXQA 2QKLB 1Q56A 4LNVA 3KP4A 3NVCA 3CCMI 3KETA 2VECA 4L2NA 1KDKA 3WG7H 2GOXB 2Y6JA 3LOIA 3PHMA 1RB8G 2JK3A 4GCVA 3OYFA 1J3QA 1BI3A 2ZEZA 2CV1A 4FSJA 1X19A 1AHDP 4AWXB 4F3QA 1OXCA 1R00A 3CLOA 4NRMA 2Z33A 3BJOA 1EAH1 1W0PA 5F39A 3F95A 1TZLA 3HDDA 3JRHA 3M4OJ 2CV6A 3O1OA 2VBZA 1GBGA 3RVHA 2H94A 3VHRA 3NV4A 4PDWA 3DF8A 1D4VB 2XAGA 5A2QZ 2VJJA 2GN7A 2KD7A 3T09A 3EO6A 5FDBA 3SXWA 2DMPA 1Y6IA 2CL2A 4ARYA 2Z2SB 3SEPA 2ORZA 2P3IA 3U1KA 4KT5C 4F92B 2X5IC 5HCHA 1DQUA 2LD5A 4AWDA 3CZ6A 2KT0A 2CWMA 4WVMB 3EUAA 1BIAA 3TW6A 1UHSA 1BKZA 1OYYA 1BBT2 5FKBA 3C3WA 3HQUA 5DZFA 1S3JA 2GNTA 2ADUA 4E7HA 2CUZA 3KYCB 4I0WB 5JVTA 1REEA 1OQDA 2PYTA 1WHUA 1GWLA 1UZYA 5KK1A 1GLHA 1AX0A 4LUMA 4BXSV 1RVF1 3PO2J 3JUUA 3HOWJ 2NS0A 5FZHA 3W5NA 1IHMA 4PCQA 5GM0A 4L0ZB 1YI2I 3WNMA 5DABA 4XFFA 2EALA 4LBJA 4GB32 1RC9A 2ESNA 3F8CA 5IK7A 4ONUA 4S04A 2P8TA 3TW7A 1Y9GA 2AENA 5F1JA 5IVBA 4MXVA 4PJNA 4XZUG 2XL7A 4WWCA 1C4RA 2DT5A 2WZPP 1W28A 4EV0A 2FD5A 4PSXA 9ANTA 2QQLA 2VW2A 1H8TC 2ISZA 4XFIA 1ND2C 1JTYA 5HVQC 5FCCA 4WM8A 2WZ8A 3V7SA 2DTWA 4U0VA 3P5BA 3CUQA 1W5SA 3T5XA 4B3XA 1IO2A 4IO9F 3HOZJ 3VZJA 1Y8RB 4QU2A 1C1LA 2HH9A 3HRTA 4Q47A 1IKPA 4MGTA 4F91B 3G6JB 1FOD3 4HONA 4EJWA 5D2AA 3WF4A 2X8KA 4MO7A 4IQJA 3DQVC 3LOBA 1ZAOA 3HG9A 3TN92 1OLMA 1ASJ2 3DF0A 3M8EA 4AZZA 1WJCA 5LRRA 4ET7A 5KHIA 2ZMEA 5KHKA 3WNXA 2GC0A 5A1LA 3K77A 1HIXA 1AA7A 1JW6A 4ZZ5A 3G2BA 4DW6A 1OOPC 2J1UA 5FUPA 3ZRGA 2EILH 4DEQA 2P1BA 1OISA 3THPA 1RUF3 2XJSA 3S1MJ 2KIQA 5FZ7A 5DS9A 3NKGA 2E1MC 1A35A 2BZTA 1NA1A 3W6KB 5FFOC 3CCVI 1R1A3 2JA2A 2VZTA 2R0FA 3RWKX 4YIIA 2QKDA 4DFSA 3WNLA 4MXWB 4HBLA 1YG2A 1HKTA 1DQ4A 3TEWA 4M9ZA 2ZHKA 4DNCA 2KJBA 3K9TA 2R93J 4X0GA 1MJAA 5LHHA 2IGKA 5FMDA 2JQ7A 1POV1 2KLOA 1AR63 4RM3A 4BEHA 5C8CC 3LFKA 4M0HA 1UCRA 3G1OA 4HF2A 1FAYA 3FHZA 4KI5M 5DM6F 1J2XA 3SKVA 3GX4X 2EXJA 5CJ9A 3GUDA 5KVRA 1I6XA 1JOBA 1SVLA 3AFGA 4JGYB 4XDOA 4UVAA 3MWMA 1YS7A 2NMNA 1RR7A 2RS32 4PBPA 2ME0A 2R7SA 3FLTA 2V1NA 2QTWB 3CJIA 1UIJA 5E3OA 2W48A 5IYBJ 3MMYB 5I0RA 2X6XA 5H9SA 3J26N 2OTJI 4ZS3A 4I0BA 5E20A 4CU6A 4P55A 3WCSA 1AL23 1IXRC 1W9WA 2HZTA 3CCRI 2QQ8A 4B1LA 5C4XJ 1OCOH 4NJ4A 4L9NA 4M3CB 4COZA 4GRIA 1A6IA 1E5RA 1ACCA 1WJAA 3TNPB 5F04A 1GNYA 1IN6A 2QDRA 4NAOA 4HL0A 3K70C 2WFF1 3ZX7A 3NL1A 3I3BA 5BNPA 1H2LA 3LSGA 2YGLA 5IT9Z 4XFBA 4AK3A 1SQ4A 3NAPC 4OOIA 1SAUA 4NIIA 4II3A 1I5PA 2XB5A 3W59A 5JOXA 1JZ5A 4AI2A 4XLFA 4CDXA 2FXAA 2W82A 2EWNA 4UBHA 2A3YA 4DB5A 3LIHA 2A68F 4XYXA 3IZOA 4P02B 3JB4C 4DUWA 4Q4X2 3FIWA 2DPUA 4DOZA 1C28A 1BK0A 3E1F1 3OOXA 1P92A 3WSOA 3ZMNA 2ZGTA 4IX7A 4Q8LA 1VQ7I 2HBUA 3MO4A 3ZLIA 2C0ZA 2RS13 1ZELA 3HMYA 3DEEA 3ESWB 2P5BA 2RJ2A 1F35A 2P81A 4A3CJ 3PJYA 5LASA 3OEAA 1OKOA 1SEFA 1TL8A 2HOEA 2ZACA 3H8UA 2L9LA 2BQPA 2E51A 1ZZ6A 1ULPA 5DQ0A 1E3HA 1PNFA 4IEWA 4MHUA 1ONVA 1PJRA 4PFPA 1V9U3 1Y1WJ 2JG8B 2V5YA 4HNVA 4YGCA 2CAUA 3ZFEC 2HU9A 3JBG2 1HW1A 1XE8A 3IHUA 3RZMA 1S4CA 2E5NA 2XWBB 1R1TA 2QBYA 1OR7A 5TGTA 4IQPA 2DBIA 1MJ9A 4Y20A 2P3YA 1SBFA 1IS3A 2C9KA 3KFWX 4W1UA 1VJ2A 1F4HA 1H9GA 3IBMA 1MVEA 1SLAA 1Y9MA 2JA6J 1PO22 4AOCA 2K9QA 1Y7BA 2PLYA 4BLJA 1FP1D 1ZG3A 5BYNA 4GO1A 1FEXA 3AL0C 2WS91 1OA3A 1OMIA 4L5IA 4IXAA 2V4VA 4UB6C 5A3NA 1G3WA 5DDJ3 2JG9A 4QQLA 1PIV2 3WF0A 2ZGPA 1S2BA 2JZYA 2QQMA 3HIFA 2VQUA 5FLXZ 4PCRA 1FLIA 4QPQA 2K02A 2DPDA 4D6QA 3HAGA 2R7FA 2QZ8A 3RZZA 2PHWA 3H9JA 3VBHB 2E2IJ 2Y0SN 1R58A 1VIWB 5D8AB 1GT0C 3URFA 4FBFA 5BNOC 2KP6A 4LBQA 4NPRA 4O9EA 3UK9A 5JMCA 2E63A 1IF1A 1UFMA 1XJAA 1BMV2 4IGOA 4ES9A 1OCRH 4KT6A 2L4MA 4LO4B 1TMF3 5EFUA 3M8JA 2C5DA 1I5ZA 1QU3A 1MACA 3VDXA 4EN7B 5T54A 5ACA2 2V73A 3DKYA 2Y8KA 2KISA 2D1VA 3Q0VA 4FFFA 5D5VB 1USTA 2TUNA 1Z7S1 1AF9A 2DO7A 1ULFA 5HS9A 2RMU1 4CCJA 4RHV2 3DYMA 2XAUA 3M1CA 2FNPA 1GANA 1X9TA 2J1VA 3G7DA 4WV8A 2K7LA 5D8LB 1U5YA 4Z07A 2VC1A 1TWCJ 4DYQA 4HMZA 1T6GC 3CEWA 3S16J 1IS4A 2KXLA 1V6KA 4P9IA 1RUD2 3RSJA 5FYVA 1WGPA 3H5NA 4LB5A 3WV6A 2NRAC 1W6MA 3NQOA 2CU5A 3FFZA 1PK6C 3GZAA 1NQJA 1JT6A 4JX4A 3M8FA 2HEOA 3VDAA 4N7IA 3POWA 2VGDA 1LESA 2XGDA 3WTVC 3BZCA 3C2HA 3T4VA 3DFGA 2H09A 3EBRA 3IDCB 5FYHA 3U78A 2HOTA 4IUGA 2F2EA 1XNCA 4ZU5A 4AEKA 4NPMA 3K4LA 2HWE2 1WD4A 3NNMA 5LA9A 2BGOA 4AI9A 1TNTA 1N1YA 3UKVA 2GM4A 2IGOA 5IFPA 5J6XA 3ACIA 4TN7A 1TME1 1VI0A 3VSKA 2G1MA 3DPRB 4AQ2A 3JCIA 4XZPA 1S0FA 5CFCC 3LEKA 3NMBA 4KYWA 4DXZA 1LEAA 3E3VA 5EGOB 2VBDA 4R4XA 3E7LA 3ZIWA 2E7WA 1ETVA 1RTVA 5FXWA 3C18A 1V54H 2P37A 4C2UA 2RJLA 1RGSA 2VULA 1MBHA 4Z2YA 5EYXA 3ZFFC 4Z1VA 4UUTA 2HEWF 1EPWA 1GVJA 1QGPA 3OBAA 3BY6A 3UNPA 1QXRA 2A6ZA 3ZPOA 5K7ZA 4YVSA 3D6EA 3HOTA 1X3ZB 4K20A 4PJYA 3GXUA 2EIJH 2FMLA 4QKDA 2ZJ2A 3V65A 2IXLA 4MLOA 1LOBA 2E71A 5FZLA 4U7DA 3L2YA 1D5YA 4AUXA 3FM5A 2A6XA 3AL5A 2ZNYA 5ILUA 1LOCA 5IYYA 2ELHA 3L2VA 5FYYA 1JUHA 3W2AA 2L02A 3MDPA 1MDMB 4RR3A 4XK4A 1PM7A 2DK5A 2ARAA 1UPIA 4ON0A 2VZUA 5GZDA 2M4GA 4MX3A 3WQBA 3G71I 4A12A 5JLVA 4QXCA 4XSZF 3K4JA 2ARXA 4CDQA 5JOWA 2V9VA 3LSIA 4KMQA 4WXHA 5DUIA 4Q4Y1 1KQRA 4QX2A 1Y43B 3AYCA 5IT3A 3HHHA 5D5WB 4CDUA 3K75B 4K6BA 4A5NA 3R0JA 1PGW2 1JHHA 2PHUA 1YFYA 2XLAA 2IA2A 2QQPA 1QXJA 4UV8A 1WH7A 4BBRJ 4YFNF 2JDUA 4RS8A 3DKWA 1IN7A 3CD6I 1XGOA 4H2AA 4BBSJ 1VBC1 3M4FA 1JTXA 1S2KA 2O5RA 1UOFA 3IRRA 2OPTA 2RN7A 3TP0A 4UW3A 2R1DA 2P6CA 2GIZA 3E97A 3QRFF 2PFWA 1CJPA 1WMDA 1K83J 1HQNA 4A69C 1N3QA 2Q1ZB 4AIHA 1Z3XA 1FTTA 2ELKA 4AEDA 2R062 4YM3A 4ISQA 4B4PA 1MIJA 5FZ3A 4CUAA 1PYVA 3HM5A 1FPQA 3P7NA 4LUKA 3NWKA 3ZMDA 3OWTA 3S0MA 3T2QA 1JGSA 2BVMA 1NZCA 3A02A 4BCUA 1QOOA 4Z2WA 1QJU3 4MSVA 1B72A 1IPKA 3S1RJ 2Y0MA 5FQ0B 4XUPA 5EJZB 2CYFA 1Q8VA 1YLLA 1IXSB 3RCOA 1XNKA 2I74A 3KWVA 1W5TA 2VZOA 5IY5H 3BCAA 1BYHA 4HLYA 1HRI2 5LWBA 4IHSA 1R9TJ 5FZIA 3NJVA 1CAXA 1TT5B 3ABTA 3BQZA 2PHLA 1GV9A 1FATA 4QB2A 4QQHA 1MQTB 2X5IA 3WY6A 1O57A 4DO0A 1ORKA 3JAMZ 3C8XA 1W03A 1OQ1A 1RUG3 5L7OB 2XR4A 3DL3A 3LL7A 5FO5A 1F5TA 2VT2A 5TISC 1D7PM 1WA4A 2XKOA 2FOKA 3GTGJ 3M70A 1K6OA 3WNKA 3KB5A 3JD73 2QM3A 2GWRA 3DP7A 4F52A 4HNTA 4HVQA 1XGMA 1VQ9I 5FZ1A 1VQ5I 3M9AA 3J7HA 3CMEI 5HDNA 4RYDA 1Q8PA 2DV9A 3AP7A 4CEWB 2X1DA 4HAMA 2TDXA 2WYFA 3FBYA 5BPIA 1S72I 3PL0A 1COV1 1NH3A 1ND2A 5FWEA 1N1TA 1JUPA 2BW3A 4XLAA 4A45A 1DGRN 4C91A 1TWGJ 4AI1A 3WU1B 3AMMA 1M4WA 5HBAA 1KQ0A 2WLQA 1Z67A 4XJWA 2A61A 3ACGA 4OZOA 4RB0A 3MKYB 3HOXJ 4I09A 4AVBA 2B4KA 5HLIA 4LOTA 1K5JA 3EUHC 3POJA 2IW5A 4D1QA 4E4ZA 4RD7A 3CO7C 2KZVA 2AH2A 4X6AJ 2HXOA 5C44J 5ABJB 1IUYA 1OOPA 3DYPA 4A3LJ 2RM22 4IHWA 1HDDC 4F83A 1AXKA 4EYUA 2R072 1BJZA 5M5YJ 5IPAA 2LM3A 1BCXA 3ZXSA 1FYLA 4YW2A 4KIFA 2M5WA 4FXKB 2Y64A 3FJSA 5FPUA 4ZDLA 3SFIA 1O4ZA 1QJX1 5KAIC 3KHBA 5A33A 1HLCA 3KQ4B 3S7IA 3QWLA 1CZVA 3CCUI 4C30A 4W6YA 5AC91 4W4ZA 2WA3A 2R3SA 4FOQA 2PBIA 3IH2A 4XF9A 3VHPA 5E3LA 5LA0A 4NR1A 3GBWA 4RSUA 5C8CA 5HOOA 4UFHA 3AZXA 3WE2A 2ID6A 1OKRA 1F5JA 2ZX0A 5LCWL 3HKZA 3SEQA 1PVC3 2R7UA 3O12A 4AFCA 1GWKA 2OW4A 1VR3A 2R16A 4UFLA 1EV11 3PVNA 2MW8A 1WCDJ 4PJ0C 2EFNA 2GNMA 5KR7A 3V42A 2XSJC 3ENRA 1CIWA 1ZLKA 3T1BA 4GJYA 1O8SA 4V1PA 3AZYA 5J47A 3K10A 1UJ8A 1AR61 3ZXAC 1B8IB 2C9AA 2ERFA 4CPBD 1ZA4A 1UKGA 2J1EA 2LRDA 3SQNA 3LZZA 4AVTA 2VKDA 1EF4A 1WUVA 1XSVA 2FOWA 4XQDA 1LEMA 4J00A 4QX8A 1L7QA 2XBO1 4FP3A 1R092 3CESA 2YC4A 1HOMA 3HGGA 4XCAA 5B4NA 2EIDA 4L99A 4IE5A 2NS8A 2HWF3 1Z6RA 1LOFA 2BW8A 5A3LA 3WDYA 5G05L 3I2KA 2JA7J 3OPTA 4X6RB 1YJ9I 4X6QB 3K4DA 2VVFA 3CCYA 1Z3YA 1RMU1 1VRH2 1JOJA 3W58A 3SC7X 1W36C 1BJAA 3NAPA 5A2QK 5CZKA 4K7JA 3PNVA 1ZHFA 5FB2A 2L54A 4XOGA 5D8KB 1N47A 2R041 5A6QA 2Y34A 2YS9A 5DCMA 3VBSC 3PUBA 1EJ9A 1D5VA 1ULYA 1W2OA 2EA4A 1RHI3 4MEXF 1ZRRA 4S2HA 4Q27A 4ASKA 4ZZDA 3WP5A 4CU9A 4AG4A 5CAZA 4LJHA 3NJZA 1AYN2 3BCBA 2E5ZA 3KT7A 5A32B 1A6QA 1XPWA 3WQ1A 3M3EA 3WE3A 2JDAA 3SMHA 2OF7A 2LBFA 3ATGA 5BNNB 4D7SA 1BI1A 1UCXA 2X85A 5CFDC 1H88C 1NXMA 2E7TA 1A34A 3GWZA 1AWCA 2YSRA 1BEV2 4HFSA 5IJRA 3IWFA 4P14A 2LRPA 3AVSA 4GMP1 1BBYA 1BIBA 1O59A 1YFWA 2Y6LA 5L3EA 1DZTA 5HDKA 3L2UA 2RS11 5FYCA 3QU6A 4BHBA 2KJCA 1FNYA 1GZTA 5JR3A 4AIKA 3TNQA 2JB4A 1SLIA 2UWMA 4OHXA 1TBXA 5DYMA 1W8HA 2W1SA 1AR81 2VPRA 3TEDA 2W1UA 5G04L 3OGSA 3FKJA 2IP2A 4BL0B 2BBAA 4C3HJ 1PVEA 3MQ0A 1YW8A 4ZJZA 2A07F 3O0XA 4UFJA 1RUE2 1QZYA 1XBFA 5HPOA 1ZR2A 5JHFA 4DZGA 4XHXA 3GVAA 5D21A 3HTUA 2BOJA 3OYDA 3J8F3 1SBDA 3VKFC 1ZN2A 1LHWA 4NMIA 3LKJA 4M6XA 1Z1DA 1CIYA 5SV8A 4XJUA 4R1HA 4BIOA 5F08A 2BY0A 1MW7A 3WW4A 2RAEA 4HX7A 5BNOA 3LF7A 4V2WA 3JR9A 2QDNA 1FOWA 5IAVA 2W85A 3FXQA 4W50A 4B3NA 2VT3A 4IEUA 5JWPA 3CJTB 4YWAA 2VE9A 4JDMA 2AEYA 4A3XA 1W8TA 2Y33A 2KFDA 2PI0A 3OYGA 2YFUA 2VOKA 1QJY2 3KLSA 2F48A 2XUBA 1GOGA 1LTEA 2UY9A 1CAUB 1PZ8A 5FLJA 2RE9A 1XTAA 1RR8C 1TC3C 3EDPA 2RDQA 4EGZA 4QAWA 1T98A 2RR13 1LEDA 2DMNA 5LHGA 2UWBA 1Z0XA 1H8VA 1D0XA 2FMDA 3ASIA 4EJRA 2PAEA 3IKTA 2E1NA 1KYZA 2RS53 1K5MB 3BLYA 3PMSA 4U0WA 1TNFA 4HRIA 1U5TC 5BQTA 3AKZA 1TMF1 4R9BA 1P2FA 5C3PA 5F8PA 4IV1B 4CSWA 2K46A 5SV5A 2EV6A 4F55A 2VG9A 2KRFA 5F37A 3OYKA 1UX6A 1AYM3 3VBOB 3FHIB 3LFIA 2DVDA 4IL7A 2OD5A 3OBRA 5CQGA 2CQXA 3D5LA 1TNSA 4EM2A 3GCMA 4Q4W1 4ZU4A 1LE8A 4KNCA 3K51A 1IGOA 3CC7I 5L36A 3ELKA 1QOTA 5JPMB 1PK6A 4S05A 2Y26A 3BOPA 5B1BH 5EJ1B 2KIUA 1SMVA 3MYXA 2VOXA 1MJBA 1RUI1 3NW4A 1W7PB 3CP8A 1SHWB 3ZXGA 4HVRA 2FQ4A 4XJZA 2JSCA 4BXXJ 5IT9K 2PMWB 4A3FJ 1K78A 2VE8A 2YXSA 1YQAA 1XSRA 3RIRA 2ZZJA 1HDKA 4GYGA 2D43A 2Q8CA 1U2WA 2E31A 1AHSA 4XMYA 2V1XA 3H0DA 3AP5A 4CXXA 3PJRA 5GLWA 2DU1A 2BV6A 2OJED 3QP5A 1JUIA 3ZN6A 4UUVA 1GNHA 1D2QA 3ZP5A 3C1DA 1JZ6A 2XMLA 4TXWA 3MUZ1 2KRCA 2IVIB 4J6GA 4KH9A 2CH0A 1VBA1 1JH5A 5J1YA 3K69A 5CFCA 1P4XA 3QH6A 2D40A 3A1YA 5JLWA 4RGGA 1IZ1A 4CICA 3I4PA 3I59B 4BQXA 5C9AC 2EFQA 3HUGB 3NO8A 4V2FA 2BJSA 2ZEWA 3V4GA 2YUSA 2LYCA 4FQZA 5JHUA 3OUJA 2E7QA 3VKNA 2FRHA 4YG3A 2Q8OA 2AS5F 4RLQA 4META 4FPYA 5C4WB 4QQ2A 1JUMA 2JEMA 3ZFFA 2BNOA 4OAZA 1RITA 3ZGKA 1UMHA 5F3GA 3CCQI 1ZR4A 2DW4A 4QPGB 3MEXA 1HRV3 3MFAA 1OCCH 2DMTA 1ZBA2 2XGEA 2HGCA 3OYMA 2HWC3 2XDVA 5JXGA 4Q4V2 5F27A 3AYDA 4R8HA 3UGFA 3VSLA 2LY1A 1AL0G 1WLCA 1WLWA 3JTHA 1W05A 5L73A 5LBBA 1P8JA 4INDA 3KE2A 1OPOA 2XVKA 1IG3A 2C26A 1CR7A 1Y56A 3H7JA 2PAMA 1CF7B 3A22A 4NN0A 1UNBA 5BPXA 3RJRA 2YMZA 3JXSA 4C8DA 2VW0A 2IA0A 4RAGA 2KIMA 3LGRA 2EZLA 5T5PA 2CUFA 3F6OA 3H7YA 1R4MB 3RKXA 1NKGA 3IMMA 5FUNA 1H0BA 3CZJA 5FLXK 2LTNA 2DCKA 2DODA 5F3IA 2R7OA 4L0YB 3TOJA 3F3XA 1JHNA 2ZMNA 1ENHA 5JOZA 4XF4A 4OCTA 3HOBA 3J81K 4OVEA 2J22A 2VD7A 1LFPA 4DBQA 2NMOA 5ICEA 3QU3A 1Q8QA 2PELA 2NLRA 1NHAA 3OIPA 3I2HA 2HWB3 2M30A 3ZQCA 2E1CA 2WNUA 2EPFA 5EP9A 4OLLA 2VTXA 4YRVA 1FIAA 4O7XA 5K0UC 4ENJA 2IFRA 5FXZA 2L9NA 3ZIXA 4JHTA 1VQLI 2OVUA 2OPKA 2XROA 1HDPA 2WAOA 4XQWA 2O0OA 2WA4A 2IGMA 4YW3A 2H27A 3BR0A 5T3NA 4Q0VA 3ABMH 1H8TB 1JZ2A 2VR4A 5FYSA 3MFKA 1OJLA 3OL3A 5ICGA 1QHHD 4KU7A 1BVP1 1PO12 2ID4A 4MFDA 4HKWA 3ZYGA 2BE5F 4EWAA 5CVRA 2W0XA 2DURA 4GWMA 2QEXI 5FKNA 3IDBB 3RFRA 4JTOA 1VBB3 4XBFA 3BG6A 2GA1A 3MLLA 5DG1A 4XUNA 3S5QA 1VQ4I 4LO7A 4MFEA 3HT2A 5AFBA 5ISLA 3VODA 5FD5A 4CEYC 1VQ8I 1S5LC 3M2MA 2XH6A 3I7DA 2TNFA 3WTSC 3CJNA 4N53A 2EV0A 4OU0A 1EH7A 2JDHA 1YRNB 1UAIA 4CH7A 2EIBA 2QQUA 3A0NA 1P6RA 1TNRA 4LR4A 1WI9A 3QYEA 5TJJA 4XSXF 2ZX4A 2BGCA 1G3TA 1H4HA 2N7GA 4B4RA 1MEC3 3JSOA 4BS9A 4CXFA 3K3OA 5A1AA 3U37A 3CHXA 1FMD1 1O4TA 1T6SA 2R5ZA 4PIZA 5FZOA 1IS5A 1NG0A 1I1EA 1UG0A 4RA2A 1SFKA 3S93A 3A21A 2CWEA 2YDEA 1C8M1 2OXBA 4J1WA 1D0ZA 2BVLA 5LHIA 3S14J 3PIOF 3DU6A 1ZZBA 4YEJA 4WXDA 3O5SA 3I56I 4D0QA 1SPPA 4M01A 2OKXA 1LGBA 2YBKA 4X8NA 4M4PA 3PIJA 4Y15A 4RLFA 2RDRA 5FP4A 3MKWB 1ND3B 3B02A 1EYBA 2X0LA 1JXNA 1DDNA 3RZOJ 2P4EA 3HOVJ 4QX7A 5FMCA 1D0HA 4KG0A 5JMOA 2ATFA 4FHTA 4PF1A 2XF6A 1ODNA 1WJ5A 3O1VA 3I4NJ 4RS5C 2Y60A 4XJAA 2D6MA 2DA4A 1XCVA 2L9RA 1IV6A 4GWJA 2LKPA 3PUHA 2ZKZA 4XNFA 2UY8A 3EUHA 3GYHX 3L2RA 3UETA 1T95A 2OQRA 5BPDA 3OEBA 2H6BA 1R081 4G8XA 4JVAA 3S57A 5FOJB 2V5DA 1QWRA 1NLRA 5FXVA 2E19A 3W3CA 3G73A 1VBE1 4BISA 5CYVA 2D7FA 4KQ7A 2VCBA 1O3QA 1UU6A 2PLV1 2HJIA 5M3FJ 1Z0HA 3AZWA 3LQRA 5HCFA 3ZPYA 2JIJA 3I58A 4PGHA 5BUVA 3CCLI 3AG1H 3MZHA 2K0GA 1WPKA 3WQ0A 3K0LA 1G2HA 1H4GA 3LSKA 4HPKB 4FT8A 1BR2A 1VBD1 3P6BA 2W00A 3OGGA 1W2NA 3ZQFA 3SNMA 5FJKA 5DUXA 4TWTA 1N78A 2VJ4A 2FJ1A 4AFBA 4UHTA 3O14A 4LIUA 1POV0 2Q1MA 3LMMA 3FHAA 4E4HA 1GSLA 3A2KA 2PJPA 3OR1C 2VQCA 1AR72 2VMEA 2HVRA 2OZ6A 1N25A 2Q2EB 1JKPC 2E7AA 5GJ6A 1RRJA 3OGRA 5EZHA 2WT1A 5DAXA 1WLTA 4HN1A 1WZ2A 3CC4I 4IV3C 4KDPA 1FPN2 3R4DB 5A3PA 3FX3A 4Y1YA 1X2MA 3F2ZA 4WK8F 4R9CA 4NC8A 2EQRA 4JYKA 2HXIA 3V0BA 5J3UA 4QHZA 4MHGA 2XB0X 1NCQC 3IAPA 1RUH2 3BIWE 1WCUA 4CUGA 3WEZA 3ZYBA 3GTMJ 2FQPA 2WZR3 2DYSH 2QQAA 1O4XA 5J8FA 4FASD 5LD2C 3ZFEB 5CNAA 1LKNA 2WFPA 3ZPLA 2O1QA 1DYOA 2HEYF 4AVCA 4NOTA 4FFGA 4EJVA 2G9ZA 4CU8A 5HCBA 3BROA 3KHCA 2I5UA 2DUPA 4C3JJ 4XFAA 3FISA 2OIIA 1YUDA 3ECOA 2A6VA 5EZGA 3BYWA 1DF0A 1AVBA 3ZYIB 4DS0A 2RVCA 4A0ZA 4PDKA 4K1YA 4CP9A 4Y24A 5A3WA 4K2EA 2KRHA 4RAFA 2LS6A 5FY4A 4IGQA 1NE6A 2WAAA 2DFFA 2WA0A 1NTCA 3KLNA 1F4AA 3AZVA 3USUA 3PNYA 2HKOA 1W0TA 4U87A 3AL0B 5IWFA 1S0GA 2MEV3 3JAMK 4AIJA 2PN6A 2XSDC 3VBSA 4CXYA 2O8XA 1WW6A 1GOHA 3LWFA 2B39A 4QU1A 3M7AA 3Q8BA 1BA5A 2X29A 4Z82A 1JKRC 2CGOA 2PX9A 2QUOA 1X4OA 5FAXA 2BV4A 2WBKA 3VBFA 4E4SA 2ZMKA 1OF4A 1LODA 4N43B 2EFWA 3N7JA 1NZIA 2VZRA 1CZTA 1VAVA 3G4SI 4NE9A 3CP2A 2MYSA 4XIDA 4ZYHA 4UFMA 1M06G 4YVWC 4QQPA 5FPBA 1D4M3 2XONA 2EB7A 4FPEA 2AHQA 4BQ2A 5CISA 2OBPA 1H2KA 1WMEA 1OCPA 3K4MA 2VUAA 2BZDA 3PMEA 2UZKA 3PIPF 4CYCA 3SH3A 2K9LA 1S6LA 2HWD1 2ET1A 4IHVA 4BK5A 1GQHA 3CBNA 2XOMA 2UUZA 4RQPC 2CU7A 5FPZA 2LK2A 3OGJA 1AR93 5C3QA 4Y13A 5JPNB 2UV1A 4CUBA 2F4LA 1MSEC 1FOD2 4GXLA 4Q26A 2QYOA 1MPXA 1YNAA 3HSEA 1UWWA 4CO8A 3VD9A 5APAA 4IOAF 2PJRA 3B93A 4FOWA 2NVYJ 3H9QA 4GGGA 4AEJA 3WTZA 3AMHA 4UUSB 2Z3YA 3C7HA 1STZA 2E2JJ 3NSTA 4XUTA 1S0BA 2H0VA 3TEXA 1QNYA 5HNHA 4UF0B 1QMJA 1KU3A 1RUF2 2BFUS 2LNBA 4XXPA 5LGNA 1FNZA 2KL4A 4GDFA 1ULCA 4HK9A 3NWTA 1Y0NA 1R1A2 3PL8A 1HV0A 4IHTA 1E5SA 2F6CA 1EAH3 1GOFA 4XCBA 1IDZA 1Z9CA 5IP7J 1XMKA 2CJJA 5EG0B 2JRTA 4BJ0A 2QKMB 2WADA 2GN3A 4DYCA 1GNZA 5HV4A 2UYBA 1ETQA 2X6OA 4FX4A 3VN4A 1E3OC 3VPRA 4MGRA 2DU9A 1QJFA 1ALYA 2E53A 3FM3A 1LULA 3H1MA 5D4SA 4BDZA 2Z16A 4XHBA 3QYFA 1NX9A 2A1XA 1XMXA 1LCLA 5CVIA 2AR6A 2GLOA 1XMAA 1YIPA 3LOCA 1W1WE 3SCGA 3MV01 1FT9A 4XN0A 3O1SA 1OLRA 1MMAA 4G3YC 2F5VA 3BP8A 5H6QA 5HODA 3KF5A 1RVF3 4KMFA 4D7NA 5M3MJ 1E5HA 1SANA 4DQ2A 1QF3A 3VEPA 2VKVA 5D5XB 3VD7A 2W1WA 4XDPA 1AXYA 4I6ZA 1UU4A 2D5VA 3I3MA 2YZ4A 2HFHA 3WF1A 2W68A 4NQWA 5IP6A 1T39A 3D3AA 2WBMA 5KXBA 3DBHB 1PUFB 1AL22 2PMZN 4LBQD 1UF2C 4IEJA 5FO9B 5H6RA 3KT1A 2RR11 2ZKNA 1VMFA 3P9KA 3HEIA 1W6OA 3TB0A 3R60A 3KGZA 3KCYA 2ZMLA 4XUQA 5D6FA 2K2SA 4PJJA 3SEEA 2R7WA 3OYWA 4JQFA 3M3OA 3LSRA 2QA4I 2VOTA 4I30A 3OY8A 3GF6A 4CCCA 5E88A 1IXCA 4FPCA 1RUC1 1AJOA 2WL1A 3F0CA 2M4KA 2B8MA 1T56A 4C0HA 2V79A 3KF3A 2P5VA 3WUCA 5FLHA 1Q43A 4AI8A 1AZDA 1CAWB 2M3AA 3C7OA 5FZ9A 3Q0UA 4BE0A 1SFOJ 2VMDA 2V4JC 1W6QA 4ASMB 2M8GX 5FLVA 4AHZA 4YG2F 5CVVA 1IKQA 1H9PA 2VAUA 3OSGA 1ZGAA 1Q3EA 4BA6A 2W1OA 4HF1A 1P7IA 3H8OA 4GXOA 1REPC 4YSFA 3EQLF 3U1DA 1ZX5A 2ORXA 4XORA 1KU9A 1H0MA 2ZMEC 1DGWA 2SLIA 4QTRA 5FP3A 1DU3D 4YGEA 2ZX1A 4G6DA 2A5YB 2M2EA 2NZ9A 2QQBA 2ZEXA 3PURA 1V9U2 5JVGF 1R6RA 3IDAA 2JTVA 1S7AA 3FN9A 4YYOA 1X3UA 1J58A 2WR9A 1IV8A 3E6BA 1NA1C 1TG7A 3PUAA 2EA2A 3CO2A 3BR1A 2DOFA 2DOAA 3LWCA 4ANJA 3A0HC 2HTJA 1US2A 2C6YA 5FP7A 3SZTA 3CCJI 5AONA 3KM5A 2L7ZA 3JRDA 5ILSA 2BBVA 2O0YA 4P5YA 1B59A 3WDWA 4Z6YA 1VALA 4IEZA 1LDKB 2WY8Q 1OI6A 3OYJA 2FCTA 2RV8A 4OIOF 3PQJA 3SZPA 1RJ8A 4ARXA 5DM7F 4XKBA 3G3ZA 4UFIA 1CAVA 1NOVA 5JXJA 2OTLI 3I2FA 5B3SH 4XE9A 1UG2A 3CUOA 5DDJ2 1V0AA 2E34A 3BOQA 4HSJA 2NOGA 1V4RA 2TRTA 1QRYA 2NVXJ 3HEFA 2VH9A 5K5QA 4YLZA 2LMDA 4J25A 2OCCH 2W24A 1YQ8A 3CJIC 2QSFX 4BQQA 2WFF3 3MF9A 4BQWA 3AKQA 3R61A 3DPUA 3WDTA 4PLOA 2ARCA 1U8RA 5J1RA 4XACA 2ZFWA 3COAC 3AX4A 4DZPA 4XMIA 3IB3A 4QPIB 2RGVA 2M9HA 3IP4B 4YIFA 1FI2A 1Z77A 4MNUA 4JGZA 2HVSA 3RKWA 1XE7A 4ESFA 5K0UA 1LFBA 1HQWA 2BPA2 3CIHA 3SFZA 1Y0UA 1V6MA 1XG1A 4IEQA 2O61A 4EM1A 1MZ5A 4QPYA 3FBIB 1CX4A 2PMUA 4AVPA 5DUUA 5DUWA 3VYSB 4KN4X 2YG0A 5HS7A 5CVUA 1ZA7A 1BR1A 3A0BC 1FYUA 4CDXC 4IE6A 3HOYJ 4DEVA 4EJUA 4CE8A 5LGTA 3MBWA 2R7DA 1QVUA 2XPWA 5FR3A 3F22A 3BG5A 1HV1A 1ZYBA 2LREA 2FUG2 1YQ2A 1XDSA 2BVVA 2Y0IA 4CEYA 3BI3A 1LUJB 5JFRA 5T5OA 1XNTA 3K1NA 2A70A 1POGA 5EV7A 2KHMA 3J80Z 4ESBA 3RDIA 4B29A 2DLLA 1PP8F 4DY3A 2DDBA 3BT9A 3C2GA 2FCUA 3U10A 2P0WA 3UKGA 3OY9A 1XSDA 1DYKA 1ZRDA 3T3YA 3ZMUA 1DGWX 2F5EA 2GIVA 5KHJA 3RMYA 4Y1ZA 2WS93 1G9DA 2I45A 1FNNA 1ETYA 2YX7A 3LA2A 3ETPA 2WV0A 4LHSA 4ZH4F 4E8DA 3GTLJ 1OR7C 3SH5A 1F2NA 1AU7A 2EIEA 2L0KA 4DPNA 3MKLA 3T2PA 2WNVC 1T6BX 1KD7A 4FISA 4GIQA 2GC2A 3A01A 1YCIA 2Y6GA 4NHYA 2D3RA 4Y52J 4BQ1A 2DDAA 3QAHA 3N9OA 2IA1A 4E7ZA 3KD4A 5FRAA 4RS5A 4LIVA 4XJ8A 4OULA 2R6QA 4COYA 2WSUA 3FUOA 5FY7A 3ZMZA 4KIBA 3IPVB 3QPSA 4LKEA 1HB3A 2VBPA 5IAXA 2VQGA 1ULGA 4O6JA 1JS9A 2QCOA 4ZHNA 1YJNI 3U14A 2DCZA 2CV2A 2OU2A 5LW9A 3GCXA 3BKZA 2VNVA 5L3BA 4M3BA 3ZQQA 3GZ6A 4Y22B 2RREA 1Z7S3 3ETQA 1DFQA 3ABKH 2JJ7A 1DPRA 2RMU3 4EN0A 4D7YA 2WAQA 5EXOA 4WM7A 4OYUA 4TZDA 2CUJA 3ZXKA 4D7TA 5L3DA 5J09A 4KBZA 3L00A 2DVAA 2GZWA 4BXUA 4C1WA 3KCCA 3R0AA 5AIPA 4B8EA 2UXNA 3IV5A 4JV4A 2G9WA 1H2NA 1V70A 3MFCA 3BU0A 4XKVA 2DMQA 2XJUA 1LECA 4IV3A 3OSFA 1A36A 5FPVA 3HN3A 2RJKA 1ZREA 1GQGA 3VLBB 3V64A 2JXAA 1KJRA 5IOYA 4XICA 1LRHA 1FYKA 1NCQA 2NVUB 1YI9A 1YIFA 4P00B 1B35B 1TME3 2ZPXA 4HLTA 2J7MA 1HW2A 4A42A 1PX4A 3CLQA 5KCMA 5CFDB 4YNIA 2EIMH 1FOKA 2JDZA 1W6NA 1G3YA 4U0YA 3TOBA 3F72A 5CVJA 1QJU2 4PHZA 1MS4A 1ZRFA 1VMHA 2D6OX 2EZKA 2ZJPF 3T08A 1Z6TA 2VONA 3JRIA 1P4WA 1OA2A 3ACFA 1QIQA 3UKTA 4UVCA 5CKNA 5JZGB 2XVLA 5JVVA 2W3JA 2MPFA 4XC9A 1ENSA 3ITQA 3BB6A 3LPFA 1YO5C 1XNBA 3FF5A 3HL2A 3CDHA 1XGSA 3GBFA 1RYYA 3D1NI 3QD6A 4H7MA 1WA6X 3CC2I 4FPLA 3ILNA 3RPQA 4YG6A 3H9AA 4PF5A 2D6LX 4YGDA 1W8OA 1RUG2 4KGQA 2GH8A 4LQRA 2VLAA 5F2SA 3K2AA 3JRFA 3T0BA 5BNQA 1PM4A 1DU6A 4KNYA 3RZJA 1NG6A 2X48A 2UWAA 3ZSJA 1FP2A 1B1BA 3JD72 1WCQA 4CRQA 4XONA 5FKKA 2VM9A 1YJWI 3PVBB 3IH3A 4PLNA 2ZS6B 4BQAA 2DJIA 1BL0A 4TSVA 4KU8A 2UXXA 1RUJ1 2BBYA 4Q4Y3 3REOA 4IEXA 3GZEA 4RFRB 2IXKA 5FMOS 2A5ZA 4RDUA 3WU2C 4JGYC 3LFUA 3LSHA 5FZBA 2YC0A 3VBUB 4RR3C 3SJMA 3ES4A 5IVCA 5EEGA 1GHCA 3ZSEA 2LALA 3SISA 1VBC3 1YE9A 2X51A 2VTXJ 2P5LC 5GADJ 3SZGA 2PXJA 1DP3A 2ELJA 1D4M1 2W1QA 2ZBJA 4WZFA 1WZXA 2DA1A 4NB5A 4UI9L 1U5TB 1A3KA 4YM1A 3I3QA 3U11A 2MH9A 5J4VA 2AC1A 4B1MA 3TKYA 3CJXA 4QX3A 1W99A 1WD3A 4E2GA 4ZYDA 3LSTA 4QXBA 5JIUA 4DRRA 5H9PA 2WQ8A 4P9WA 1X8MA 1UIKA 2Q1FA 1W8ZA 4KL1A 4A3IJ 5JDBA 5ICCA 2VZQA 5KC5A 1X1DA 4JKLA 5FV3A 3RTRA 3PIGA 4NPLA 3INAA 3W20A 2YPRA 3EQEA 2D98A 2NVTJ 3OY8B 3MZ8A 4AL9A 1GZWA 5FYIA 2LF8A 4HKLA 5IVEA 4XLCA 4KWUA 1MS8A 1CN1A 2BY2A 5H9RA 5LBQA 3D4KA 4JOMA 3GYDA 4L9JA 3S17J 3B6AA 4A3DJ 2AACA 5FRNA 2IEKA 2MGQA 1UAAA 1R23A 5C3SA 2BGPA 1YQCA 2YV8A 3CDIA 2B46X 1W6PB 4HETA 2OX0A 3ZMSA 4BY7J 3OYHA 2HQRA 3H1WA 2I10A 1LOGA 3AAFA 1PVC2 3MPBA 4A93J 2JG8C 4KA4A 4L5EA 1BOBA 2HOSA 1GUUA 2XPUA 5C9AB 4LG0B 1QQP1 4J1XA 4UW6A 4ITCA 3ZSLA 3ES1A 2PHDA 4N90A 1GP4A 1OYIA 3J7ZI 1V5GA 1XB9A 2A5WA 2PHRA 2K3PA 1XYNA 4L18B 2HI3A 3PVOA 1SMYF 2V9PA 1WMFA 2OC6A 2QQNA 1ZRIA 5C33A 3PFIA 1KONA 3ULQB 1V55H 2ME6A 1HXS1 3OD4A 4IEOA 1JKOC 2G7UA 1TZOA 3ASOH 1QHGA 2OAZA 4CVUA 1R49A 1YJLA 1COV3 2IFWA 4OI0A 2HWF2 3UYJA 2ID3A 2X1EA 2YC2A 5LY1A 4TV7A 3NKTA 4L92A 3BTAA 4AU7A 3V0AB 3VD4A 4IRHA 2HOAA 2MC3A 3K2OA 2Z4FA 5F5QA 2FA5A 1ULEA 4QKNA 5B1AH 4D0PA 1OSGA 1W2UA 3K6GA 4P1WA 5F2WA 5HXVA 2CWSA 1OF3A 5A3MA 1EP0A 1D8JA 2Q8EA 2D6PA 4YZ5A 4YW6A 3T1MA 1OURA 2GXGA 1BC8C 4AHXA 2F5FA 3VBHC 4IEYA 2W46A 3IRQA 4C3IJ 5D8AC 4R79A 3OGVA 1RHI2 3OYLA 3THCA 4EEFG 2VPVA 1RPWA 3NV1A 2F4IA 3POBA 2COBA 4JQRA 2HYXA 3TBDA 1QNWA 2WDBA 3IKVA 2Y31A 1SFUA 1X50A 3VGIA 4XJ9A 2BFUL 1QJX3 4OMCA 2RV9A 3BG9A 3E0JB 4KJZA 3BG3A 2R49A 2XIGA 5CPRB 1LHNA 5L3FA 3RJPA 1C3HA 1AKHB 2ZO4A 1G9CA 5K7PA 4RGKA 2VMHA 4M3DA 5E6HA 5AC93 1OLQA 1BBT1 4C9YA 3FDYA 2GC1A 4LO8A 3H0OA 3VYUB 3EXUA 5LATA 2ZBKA 4PGGA 2JX9A 4BE3A 3KCXA 4JBAA 4M3CE 2R5YA 4AHWA 1PGL2 4GA9A 4H7LA 1X33A 5HLTA 4EZHA 1GWMA 3H3UA 1W0UA 3ZFGB 2DQLA 3DYOA 2LFBA 2R7QA 3RQ4A 4GB31 1EV13 4ZYAA 3F8BA 2JT1A 1BI2A 3MVPA 1A8MA 4AAXA 1H6XA 2JECA 1Q8OA 2AXLA 5FKLA 2P6HA 4F7ZA 3FWEA 1U0AA 2IXIA 2GBYA 2PHFA 4LA2A 1YO8A 3ZR8X 4MZUA 5ERLA 4TLGA 5C5TA 1V5EA 5E1ZB 1HXDA 3LA3A 2VNOA 3FXKA 1WW7A 1WQ2A 2XBO3 2HDWA 3J8F2 4JC1A 5LK7B 2DMUA 4GH4B 4LKSA 2ZJCA 4XABA 2EBIA 2IS6A 3TN91 3BPXA 1ASJ1 2JWPA 1EUUA 1MNMC 4YFKF 4JP0A 5DD8A 1NY72 1N1VA 2VOOA 1Y4WA 3H8XA 1RMU3 5ED4A 3VDDB 4P5OA 3ZO0B 3DPTA 2W84A 2XQXA 4KICA 5FD6A 2AYHA 3IWZA 2LVSA 2DBNA 4CHUA 2E26A 3DPRC 4B8XA 3AL6A 1AXZA 1YLFA 1FX5A 1XXNA 3U4XA 4WCGA 3GEZA 2Y0SA 2D2WA 4FTHA 2R043 4M73A 4XF3A 1ZBE2 2JKXA 2JE7A 4GJZA 1F9KA 1B6AA