1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
3E6DA 3HOSA 3WGGA 3RYRA 2EB7A 4K8FA 3F8CA 1ZZ6A 2HKXA 1JGSA 4M72A 3S7EA 1OMIA 3ZMZA 3FMSA 4XLPF 3JW4A 5LHHA 4WWCA 2RQPA 1F9NA 1Y9QA 5D5WB 3V8KA 1BIAA 2QUFA 4PIZA 2K4JA 1H9TA 2M45A 1HKSA 4D7TA 4LD5A 5KVRA 1WGPA 5CYVA 1LR5A 4OIPF 2VC1A 3MFKA 3RKXA 1ONVA 3ES4A 2ZNZA 4JK1X 1R1VA 2Y48A 2K02A 5JR7B 3ZQ7A 2DW4A 4HSJA 2P6TA 4LLOA 2FU4A 4CICA 3IRQA 5KHJA 3JTHA 1ZG1A 5LRSA 3VEPA 1KGSA 1L3LA 1ZLKA 3ZN0A 4M9ZA 3EJKA 1PUEE 4KICA 4HLYA 2VN2A 3HYIA 3KMHA 3PVBB 1X3UA 4XRFA 4M71A 1IN4A 5E20A 5JCTA 1DZTA 3RKYA 4OMZA 5JR3A 1CAVA 2GC0A 3KLNA 5L3FA 1OYYA 2QCSB 3OCPA 5ICFA 1K78B 2E9QA 1EY2A 3ZMUA 1XRUA 1Q1HA 2UY8A 3E6MA 2IXKA 1J3QA 4KIFA 2VQAA 4KN7X 2XL7A 5JI6A 5FLXZ 2ESHA 1SAXA 4ZYDA 4Q48A 4I3PA 4YRDA 2WWYA 1QPMA 3I71A 2FNPA 4L9VA 3KZYA 5BMZA 3SHRA 2P8TA 2D5HA 2YPRA 2EFWA 5J3UA 3ZMDA 5BPIA 4WXDA 1I1SA 4KFCA 4WXHA 2KIFA 3NEUA 3MWMA 4XF1A 2DFIA 3Q9VA 4ZU4A 3H9AA 1ZYRF 4KWLA 1S7AA 1G3SA 3ZN1A 1Z7UA 3IL2A 4QM8A 1YW8A 2QM3A 4I7HA 5ERIA 4HVQA 3EETA 1QO0D 4BYYA 2FOKA 1WKMA 5L3DA 1LEAA 2V1XA 2QDRA 4RGRA 1LQ1A 3Q9SA 3TGNA 5LBQA 4Y13A 2VT3A 4LFUA 5BUVA 5I93A 1QNTA 5FFZA 2HQNA 4YFKF 2Z9OA 1EPZA 3F8NA 1KQ9A 1XCVA 1YLLA 4JTNA 1T6SA 2ZCWA 4OIRF 2QZ8A 2XGXA 5E17F 2NS0A 2F5DA 4ZZDA 1IRFA 1F5TA 1ZREA 2KRFA 2UZKA 1YWKA 4QWQA 1KU2A 2KXLA 5L3BA 5I0UA 4HA8A 2QVSB 4IEVA 1EP0A 3K1PA 3FZVA 2D1VA 1W7PA 2EV6A 4LJZF 2OA4A 5HOOA 3JZVA 3EBRA 4BNCA 5FLIA 3LSTA 2B5HA 5A2QK 4LUMA 4PIXA 2V1UA 4MGRA 2M30A 5HS8A 2DK8A 4BHBA 2FSWA 4ZZLA 2XLFA 1R1TA 1D8KA 4PZJA 5EEHA 3KP3A 1W5SA 3R0JA 2OZJA 3TQNA 3QP6A 2Z33A 1FLIA 1YYVA 4LG0A 4RD7A 2ZKZA 3OD0A 1IPJA 1FP2A 2ZO4A 3BJ6A 2GU9A 3WTTC 2QQ9A 2VC0A 3MZHA 2O8XA 3H8UA 4N9HA 5DD4A 3RPUA 1BOAA 3VHRA 2YSRA 1XGMA 4ZH4F 1DPRA 3CUQB 1XSDA 3RJPA 2JSCA 1Z6RA 4N9IA 4LK1F 2B8MA 3F6VA 1FC3A 3KCCA 2EFQA 3ST7A 4YYOA 2LSOA 4XFHA 1R36A 5LHGA 2PFWA 5BS6A 3CLPA 1BI2A 3KP7A 4HF0A 4EROA 3W6KB 3PQKA 4L18B 1SMYF 1SD4A 1YS7A 1EH6A 3SMHA 5LEJA 3IKVA 1FBSA 3UKNA 2NRAC 2BNOA 1J7KA 1LVAA 3KLOA 2A3SA 3F6OA 3SXYA 2ISZA 1RZ4A 4MTDA 1WRJA 3RYKA 3IWFA 2VBXA 1HSTA 3J81Z 3MEXA 4HLTA 1O5UA 3FM5A 4FT8A 5CJ9A 3DPLC 2EK5A 1ODDA 3SCFA 1DGRA 2W84A 3WTVC 1P4XA 2Z99A 3F21A 4O9GA 2XAFA 3FXRA 1P4AA 4BIFA 2GH2A 3HQXA 2ET7A 3DFGA 1YFWA 3ZPLA 2L54A 1HXDA 1UD1A 3WU1B 4ENJA 4LA2A 4RGUA 3GBFA 3TNQA 3M9AA 4WZCA 4UVAA 3NQOA 4WX9A 4CGZA 2HFHA 1S3JA 2M87A 4HBLA 3WGIA 1ZZ9A 4HN1A 4YNIA 1J58A 2PAEA 3ZMTA 2PFBA 5ICCA 2D5FA 1FOKA 5BPXA 2K9ZA 2E7WA 2MC3A 4Q0SA 4YFNF 3B02A 2QNKA 1LNWA 3I54A 3GW2A 3WTYC 3KGLA 1EV7A 4EGZA 3I59B 2AXLA 3F22A 3L7WA 4GCVA 1VTNC 4IHSA 3KP4A 2IA0A 5D4SA 4P9GA 4IVNA 1FXZA 3GFJA 4MQ9F 3EHKA 4Q0QA 1HSJA 1FNNA 4QM9A 2UYAA 2GXGA 2QLZA 4R8HA 2WTEA 1AOYA 5I8TA 4XF0A 2KKOA 2RVCA 2A61A 4A0YA 3ABUA 1LRHA 2ZNYA 2CYYA 2V9VA 1XCBA 5KHHA 2IC1A 1S29A 4U0WA 1J59A 4EWEA 1XMKA 2PMHA 1OKRA 2H27A 2PHLA 1S8NA 2Q1ZB 2PJPA 4A12A 2FNAA 2L4MA 4HF2A 5CVVA 1UHWA 3TKYA 2DAOA 1KYZA 1IW7F 4AD9A 3C3VA 2MH9A 4P5OA 4ZYEA 4XF9A 3CF6E 2VE9A 4LK0F 2QVOA 3U9GA 4WK8F 5DD8A 1ZRCA 3HTSB 3ISPA 2EA7A 2MH2A 1HKQA 3BJAA 2Q2EA 5AONA 3I53A 4S05A 1IZ1A 1DZRA 4CDGA 3U11A 1YUDA 2YX7A 3M70A 4S04A 2FEZA 1QGPA 3VOEA 1T38A 2E1CA 1KQ8A 3R60A 1R00A 1Z1DA 1FSHA 3CJNA 4HV6A 1ZN2A 1R22A 1XD7A 3QACA 4TV7A 3QRFF 5HLHA 2FE3A 1XGNA 3T8RA 2G7HA 4M74A 3J7AO 2BE5F 2HGCA 2ELHA 3IRRA 5LLQA 4GGGA 5CVIA 3G7DA 1V3FA 3FXQA 1FBUA 4HQEA 3IKTA 3V7RA 3OGJA 3R0AA 5DDGA 3I58A 4CYDA 3RTRA 1O5LA 5FLJA 4AXOA 3K2ZA 3CO2A 2GXBA 2P7VB 3VFZA 4L9JA 2NAZA 1G3YA 3WW2A 4IEZA 2IA1A 1IPKA 3LA2A 2FA5A 4A2UA 4KIBA 3P7NA 5JSRA 5A2QZ 4LEJA 4Z2YA 2CAVA 3GF2A 3RNSA 4HLXA 2QQAA 3OV8A 3BROA 2DBBA 4EQQA 2PAMA 1FYMA 4QGLA 3MPBA 2UYBA 2PQQA 2CV6A 3EO6A 3PQJA 1U5TC 1FI2A 1WSUA 3C7JA 3ACLA 2GC1A 1B59A 2Y75A 1W7PB 4UUVA 5J8FA 4KU8A 1YFUA 3LWCA 1J1LA 1CAWB 2PTMA 4DINB 5ICGA 1O7LA 1XN7A 4IEWA 5HVQC 3WE3A 1GQGA 3I59A 1REPC 1B4AA 5D5XB 1ZRDA 4CO8A 5FO5A 1P2FA 2O61A 1JXSA 4NHJA 5D8LB 1ZH5A 2R7DA 4KL1A 4RB1A 4MGZE 1UB9A 5EFUA 4D7SA 1SEFA 5I91A 2EWNA 1X8MA 5CVJA 5DCMA 3GWZA 5FPZA 2B9UA 2RGVA 1K78A 1P4WA 1WWXA 1BBYA 4AQ2A 2L4AA 2HYFA 2H0VA 2DQRA 4FX4A 4EJWA 3HRTA 1TNTA 1XDUA 3QP5A 2OPKA 2ADUA 3QU6A 4QGNA 2XAHA 4BHCA 4ENMA 3O3KA 3O6BB 2L02A 4EVIA 3REOA 4MEYF 4MGIE 3RPQA 3FHIB 4X6QB 4U0YA 2XROA 5K5OA 5CLSA 2HDCA 5KK1A 5HDKA 2D1HA 2HKOA 3NRVA 3CUOA 4JBAA 4E2SA 2FXAA 4O5VA 2QYOA 3EYIA 3LA7A 3CL1A 3PLQA 3FX3A 1RUOA 4EM0B 3VB2A 2C6YA 4HMZA 5F64A 1WA4A 1RIOH 1XSVA 4YIIA 2C0ZA 4EM1A 4D0PA 5JSOA 1QZYA 4BAYA 4YG2F 3ELNA 1FP1D 3HRSA 2IJLA 2A5YB 1FZPB 1LDKB 2CFXA 4YARA 4FAHA 2XLGA 3CLOA 4WF2A 4MQVA 1J2XA 3RYPA 3V7CA 3E5UA 1WI9A 1Z9CA 4M6XA 1DGWA 5FPXA 1CF7A 5LGTA 3U2RA 2STTA 1LDJA 5KBFA 4FHTA 2EJRA 1SFUA 2BYVE 4G8XA 4IEUA 2XKOA 2A6EF 4UNOA 3KEOA 1R7JA 5C8WA 2PMUA 1O3QA 4IEPA 4IF4A 1YIOA 5I0SA 2F2EA 1XE7A 2UY9A 2O3FA 1VR3A 1Q5OA 4MUVA 3NW4A 2CGPA 1HQCA 2JT1A 5LHIA 4HSLA 5LRRA 4OMYA 1GVJA 2ZBKA 3DEUA 5F1RA 1X8EA 2ZFWA 3GVAA 4BXUA 1DP7P 1L0OC 1IN5A 1EH8A 2RC4A 3TDZC 4G7ZF 2YX4A 2LF8A 3SHFA 4B09A 3QOPA 2L3DA 5CVUA 4NVPA 3BALA 3QAHA 4RB3C 2LKPA 4G6DA 2G9WA 4LLLA 2CG4A 1SD7A 4G7HF 2VBZA 1OD5A 2F5CA 4ETSA 5TJJA 5IT3A 5E8GA 1U5TB 5E16A 3SXWA 2BBYA 1D8JA 2K4BA 2H94A 2HR3A 1JHFA 2COMA 3D0SA 1I5ZA 2MBFA 2K0GA 1B9NA 3HSFA 2HEOA 4LB6B 4KT5C 4UXNA 3FE5A 1SFEA 1PP7U 2IRFG 2CAUA 4GYGA 2OD5A 3TO7A 2Q4SA 5J6XA 3F8FA 5BY5A 2DPDA 2K7LA 3WW3A 4L0YB 3H7YA 3LA3A 3FWEA 1SD6A 3F23A 4IESA 2MA3A 2M8EA 1MJBA 1XGOA 4KUMA 3G73A 3GO5A 2OZUA 2DO7A 4Z07A 3M7GA 2XAJA 2GQQA 4I01A 5D5VB 4R79A 1IRGA 3FM3A 2HTJA 2XHKA 3LWFA 3WTXC 2LNBA 1H1IA 2DQLA 1OFNA 2O0YA 5C6CA 5KHIA 4IJAA 4HDUA 4UBGA 3C18A 1VP6A 2A07F 4IRIA 3KETA 1HKTA 2Q30A 2FF4A 1C0WA 2A6HF 3KGZA 3FZ3A 1Q3EA 1CAVB 2O03A 1UPIA 2P6SA 4MHGA 1SD5A 3K0LA 4O9EA 3H1WA 4META 1U5TA 5E1RA 4Q4ZF 3ULQB 4MGYE 4KMFA 1BI1A 2ZMEB 3I0TA 1U3EM 1WLTA 4MNUA 1E2XA 2Z2SB 4IPAA 2ETHA 2D93A 3SZPA 4KDPA 1J3PA 1IXCA 3L00A 4I98B 2XUBA 1YW7A 2X0LA 3S0MA 2MLGA 1QXRA 4PGGA 1O4TA 2MHFA 1NYWA 1ZLJA 1SFNA 1ZGAA 2PI0A 4A6DA 3ERED 5JSPA 1MKMA 4KN4X 1OYWA 4HOBA 2V09A 3IDCB 2CO5A 2PHDA 2G7UA 2NYXA 2CQKA 3RKWA 4AIJA 4FX0A 1UCXA 5E8IA 5CU1A 1TW2A 1MDMA 4P9UA 2IPQX 1YFXA 3T1BA 5LEKA 4OFGA 2RNJA 4F8AA 3F72A 1ZRRA 4YSFA 3IWZA 3MZYA 1UIKA 4LA3A 4LLGF 1LKNA 1ULYA 3R6SA 4N0BA 1ZNPA 4RB0A 2QJVA 5ILVA 1RC6A 5E1WA 1MJAA 3WU0A 5L3GA 4XFBA 5IT9K 2UXXA 5DCFA 1YTYA 4XLNF 2IT0A 3E6BA 4E2GA 2XVCA 4MTEA 2VE8A 3U10A 2P5LC 1RNLA 3NVCA 3FXUA 1KU3A 4U88A 5DV5A 3H7JA 2GC2A 1R5HA 2PA7A 3P9CA 4ESJA 3K69A 3EUHA 3JSPA 2HOEA 3N97A 3GXOA 1V4RA 4O3MA 1ZG3A 1KU7A 1H1MA 5DUKA 4AWXB 3RI4A 1TW3A 4UV8A 1PDNC 3VODA 5E18F 4LGWA 1KA8A 4KYWA 1UW8A 4HN0A 4OOIA 4EM2A 3HUGA 2RV8A 3HTUA 3DV8A 1O3SA 1K7AA 3CTAA 3TNPB 2R3SA 1Z6TA 4XETA 5KHKA 3LAPA 3W6JB 5CADA 1ZZ7A 2YU3A 4BH9A 4HAMA 4OIQF 4G9YA 1EH7A 2VBWA 4XFCA 1QXJA 2GC3A 2JRTA 5F6FA 2H6BA 4PDKA 4L0ZB 5I8SA 1H9GA 5FQ0A 3V8JA 1IAWA 3LAJA 1ON2A 3KP2A 3COAC 2OA2A 1TQMA 5K8SA 4MX3A 1XE8A 4GYIA 3DPTA 2EAAA 1UIJA 1ZAOA 2MD5A 2LF7A 2PLYA 5J48A 1F4KA 4GO1A 4I0AA 3V8LA 2ZKLA 5EEGA 2EV5A 3BPVA 2MNGA 4ONUA 4Q29A 3ZMSA 3RDIA 2Y0OA 4UHTA 3LOIA 2CW0F 4JV4A 3RIRA 1TLHB 3SCHA 2XV4S 4IHTA 1ZX5A 2VT2A 2IW5A 2E1NA 4L9TA 4A6EA 3R4KA 2W85A 1IXSB 1YFYA 5J7MA 4QGMA 3WW4A 5K5QA 4HX8A 3H1YA 4WCGA 5I8YA 4QX5A 1FWZA 2DPUA 2EV0A 3L2HA 2JTVA 1U6GA 2M5WA 4I09A 3DN7A 2UXNA 1MGTA 2OQGA 3ABTA 3FJSA 4ESFA 3R61A 4M9XA 4HW0A 1CAUA 5HS7A 3M8EA 5D6EA 2QENA 4HVOA 1JHHA 2BNNA 5AVPA 2W24A 5BQTA 4CXFA 1QWRA 1KU9A 2K86A 4I02A 2EFNA 5DUIA 3F3XA 1YHFA 4Y15A 2ET1A 4O6JA 3TOAA 3H3UA 2CWEA 2VXZA 3E5XA 2VONA 2XLAA 3SQNA 3ECOA 1FYKA 1SMTA 3K1MA 4BHPA 1U12A 2DI3A 3C1DA 1ON1A 4NQWA 4LULA 2OYZA 3FMRA 4ZU5A 4FBFA 3P9KA 3ZDSA 4JQFA 3BP8A 1JUHA 3ROUA 2L01A 3M8FA 4EWDA 3JTGA 4L9NA 3AAFA 3E3VA 4ENNA 1S6LA 3EDPA 1X7NA 1MDMB 4G94A 1CAWA 4Y17A 3ECHA 3ELKA 1O3RA 2BGCA 1BI3A 5KHGA 4RGSA 2P5KA 4ON0A 5BV6A 4YFXF 2Z5UA 3BOQA 4GULA 2EFPA 3BWGA 4UXAA 3HHHA 3HT2A 3U0ZA 2EA2A 4LB5A 5LGUA 1ZRFA 2A69F 4JVAA 4L11A 1LB2A 5L3CA 2IP2A 2O8QA 4UVBA 1NHAA 1J5YA 4KU7A 4ASNA 1F1ZA 2RDPA 1NE4A 5FQ0B 5FDBA 1W5TA 4DQ2A 1IUYA 3LFKA 4IRHA 2D40A 2HWVA 5HS9A 2F4PA 4UBHA 2Q0OA 2XAGA 1FYLA 1O7FA 4E2QA 3I5UA 2GA1A 1G3WA 2XAQA 4EJOA 1YW9A 1BN5A 1O57A 1YFHA 3EYYA 1LDDA 4KMUX 4MZUA 2HZTA 4RAYA 5FD5A 1ZZCA 4M9SA 4IXAA 1CF7B 2PAKA 2PEXA 4WBBA 4L2NA 3NKTA 1D3YA 1MD0A 5FCCA 2QWWA 1Y3TA 1Z91A 2M1BA 2RKHA 1UCRA 1UFMA 1CX4A 4XF4A 5FLXK 5E1XA 3USSA 1IN8A 4XF3A 5I0RA 3G3ZA 3HHGA 2PQ8A 4EJUA 4KIGA 2A68F 2DU9A 3WTWC 5AIPA 2V6CA 5H6QA 4ESBA 1YS6A 5HDGA 3S2WA 3DF8A 1RL3A 2P5VA 1LEBA 1L3JA 1TQIA 1QQIA 2VOPA 1ZARA 2IXIA 4FAGA 3PFIA 1GXPA 1BI0A 3ZP5A 1XDSA 5JVTA 2X4HA 4L5IA 3L2CA 5IT9Z 4CZZA 1FSEA 4CHUA 4Q0UA 1YG2A 2D2WA 5H6RA 3ML6A 5FD6A 1TBXA 2O6GE 3C3WA 3DQVC 3CUQA 4HDVA 4XSXF 3ES1A 3OOPA 5ICEA 4HF1A 4UVCA 2IXHA 3JAMZ 5JHUA 5FGMA 2DCTA 3O14A 4IEXA 4J1WA 2H6CA 5I0TA 4UV9A 1JE8A 5DEQA 5LGNA 4QMAA 4WVZA 3ETQA 1NE6A 4HBNA 3ZMVA 4ZU7A 1UHMA 1T39A 3FMQA 1U78A 2FBKA 2ZJ2A 3M3IA 4XFFA 4U7BA 3NL1A 4Q0PA 1RTVA 3D82A 1FX7A 2W57A 3DP7A 1CGPA 1GXQA 3CEWA 1W7PD 4IEQA 4AVBA 1R1UA 3DL3A 4P9FA 2IA2A 3GEZA 2P4WA 3BCWA 3GZ6A 4EV0A 4XFIA 3BY6A 4IRGA 3CO6C 3GYHX 1W4MA 2H09A 1WQ2A 3FHZA 1J9IA 4M6YA 5J8CA 1FT9A 1SFXA 3IBMA 1P92A 1DPUA 5D6FA 1HW1A 1AWCA 2FMLA 4OINF 5L3EA 1I1GA 3K9TA 4XFAA 1OPCA 1TQPA 1FBQA 2OBPA 4KWKA 1G3TA 4J1XA 4HX7A 2WC2A 4HX4A 2DLLA 2GWRA 1YLFA 1ZVFA 2FQPA 5H20A 1MJ9A 2QBYA 2V79A 3GX4X 1IF1A 1B9MA 3F8BA 3GUDA 4LUKA 2VOOA 2PG4A 2YR2A 4M73A 1STZA 5BPDA 1QY4A 2Z69A 2DTRA 2E7XA 3L09A 4I2OA 2J5OA 3BB6A 3E97A 2N7GA 3TOBA 4ORFA 2KIMA 2ZXJA 4QLCU 3H92A 4OLLA 3I4PA 3J80Z 2HYGD 3LQQA 3Q5FA 2KJBA 4ENKA 2FQ3A 1A04A 4LG0B 3CUQC 3V7SA 4F7ZA 4QXKA 1K6OA 3BZ6A 3BDDA 4XEZA 2R7FA 4H0EA 2DK5A 3K1NA 4P55A 4AVPA 3CJXA 1R23A 1K79A 2V1DA 3GLXA 2KIUA 1E17A 3EQLF 4LMYA 5HLGA 3NJZA 3KSCA 4EGYA 4Q5SF 2GA2A 1XMAA 1CAXB 1X82A 1B1BA 4RB2C 1PM7A 2MPFA 2Q8KA 1IN6A 2ATFA 5DYMA 3SCGA 1QZZA 2HS5A 3GFIA 5D4RA 2XRNA 2EA4A 2JZYA 2XIGA 3KP6A 2AS5F 4KNYA 2EFOA 3UKVA 1VJ2A 6PAXA 1CAXA 3HIFA 4R52A 4K2EA 2VBYA 3IC7A 3QU3A 5ILSA 1OYIA 3WTUC 4H7LA 1YO5C 2PYTA 3I64A 2OAZA 2HTSA 4B29A 3QPHA 3TO6A 4IEYA 3IIAA 2WV0A 1O3TA 4KA4A 3SFZA 1NXMA 1BC7C 3HSEA 4ZYHA 3T0YA 1J0RA 1XSXA 3BPXA 2ESNA 2BV6A 5FB2A 2FMYA 5JAXA 3M1EA 3U1DA 4X6RB 2OZ6A 3QPTA 5ED4A 1P6RA 4AVAA 2JPCA 1S7OA 4IETA 3KE2A 4Q47A 4L5JA 1G6NA 3TDUC 3HT1A 4MGKE 3KFWX 4XFGA 5FFXA 1OI6A 3B73A 3V4GA 3OF1A 2ETEA 4HVRA 2IXCA 1FY7A 1XGSA 4XBFA 4A5MA 3HRMA 4YIFA 2WFPA 1V70A 2NNYA 5HDNA 4GXOA 1BJAA 5T3NA 2OQRA 3KP5A 4EMSA 4G6QA 3MYXA 4LTAA 1XB4A 1R5GA 2JPBA 3WG9A 3HOTA 3BJOA 1D5VA 2MLKA 5HI0A 2VPVA 4HZFA 3GFLA 5D8KB 3GZ5A 3MQ0A 4PCQA 3WTSC 3JSOA 4RGXA 1KYWA 1U8RA 1R58A 1IN7A 3DKWA 4E70A 2IXJA 2Z3YA 4JTOA 2STWA 1ZHFA 4EWAA 2ACJA 2ZMEA 2W25A 5DCMB 1TNSA 3SZTA 1T98A 3J80K 2IXLA 4P96A 4A0XA 2HQRA 1BM9A 2CSOA 1Q43A 1HW5A 1KQ0A 4AQ6A 4AVCA 2P17A 1YQAA 4PGHA 1PMIA 4HYEA 4PJYA 4I0BA 2XASA 1J3RA 1RGSA 1BC8C 5BXXA 3WODF 1QBJA 5AIQA 3T5XA 4OU0A 1ZG5A 1ZGJA 2Y0MA 2XKPA 1HW2A 4LLNA 3E6CC 3KEQA 5D1IA 4U7DA 1B6AA 2B0LA 4KWJA 1EYBA 3HRUA 3EQEA 3E5QA 3NSTA 5HLIA 3PNAA 3UKTA 2P7CB 2J5PA 5K1YA 3LAGA 3HSRA 3LZZA 4Q0VA 5ILUA 2VODA 3CDHA 4MH0E 3TO9A 2RN7A 3JAMK 2ISYA 4G7OF 1USTA 1DUXC 1U2WA 1Y0UA 2FBIA 2QBYB 2HJIA 4IEOA 5FLHA 5TRDA 1ZZBA 4A0ZA 4ZYGA 1CAUB 1PP8F 2VECA 2IVMA 3FF5A 1TQ5A 3DXJF 4RS8A 5BOXA 3BU7A 4EJTA 2I45A 5CVRA 3IDBB 3IHUA 3O2PE 2BEOA 4PIYA 2KJCA 4U0VA 1GQHA 4WXCA 1IXRC 2OU2A 1G4DA 2EVXA 1GHCA 2F5FA 3RZZA 4NB5A 1NZCA 3H1MA 3H50A 4AIKA 3GFMA 2O1QA 1BIBA 3OTFA 3CO7C 2TDXA 5EZWA 2NNNA 2QQBA 4XSZF 4B8XA 1LJ9A 3MCZA 2F5EA 3LQRA 4DNCA 5K5RA 4Z82A 2DT5A 4HQMA 4IERA 1H0MA 4TLFA 5JFRA 3BPZA 1I6XA 1SQ4A 4A5NA 4R1HA 3H3ZA 2FRHA 2FBHA 3GYDA 3WW1A 3WGHA 3FFQA 3F8MA 2PN6A 2PBIA 1RI7A 1MZBA 3J81K 4AIHA 1RUNA 4EJVA 1USSA 4HV5A 5D5UB 2BNMA 1OR7A 3KZZA 3D0JA 3WE2A 4BQAA 3WTZA 4OIOF 2XL9A 1ZZ8A 3P9IA 1TTYA 4RAZA 3D5LA 2Q0AA 3T8TA 1FPQA 2GIVA 3N4MA 1Z05A 2LDUA 3MAJA 1HBXG 1J75A 2UWMA 1DDNA 3L9FA 3I7DA 4MEXF 1I27A 3MDPA 3S7IA 5E1ZB 1T0FA 2GZWA 2D45A 2GAUA 1T2KA 2K27A 4MV2A
chains in the Genus database with same CATH superfamily
1JYCA 5JLVA 3HKZA 4AYBN 3WGGA 2RS13 3RYRA 2C24A 2BXYA 3BTZA 3CMMA 4W6YA 5F1JA 1JGSA 1WGXA 1JTZX 5C4WA 4Y4YA 3FMSA 1WCDJ 3PUIA 4WWCA 2RQPA 1S0CA 1V6IA 1POQA 1OCOH 2RV9A 4D7YA 1LHNA 1CESA 3V8KA 5J37A 1K83J 3QYEA 2QA4I 4B7EA 3OY9A 2K4JA 4U36A 1BXHA 4LD5A 3I2IA 1QVUA 2AQEA 5CYVA 3JD71 1QOOA 2CV1A 3RKXA 5KC5A 3ZQ7A 2CYFA 2YMZA 4E7SA 3AFGA 5EZHA 4HSJA 2DA7A 4D7MA 4LLOA 5KHJA 1PZ8A 1ZG1A 3VEPA 2WS92 1KGSA 2A6WA 3ZN0A 2FJ1A 4OQ9A 1HA8A 3EJKA 1PUEE 4KICA 4NO4A 1PIV2 1U5XA 4XRFA 1DZTA 3RKYA 3WY6A 3ZMOA 1CAVA 5CG9A 5L3FA 3DF0A 2XDVA 1Q1HA 3URFA 3CF2A 4OI2A 2GN7A 2VQAA 1UQXA 2KISA 2CQXA 4RLFA 5GKAC 5SV8A 3JRDA 4I3PA 5DUVA 2DVBA 1LPQA 1QPMA 2OCEA 4QDQA 4YW1A 2FNPA 5BMZA 4FO9A 5FY5A 2P8TA 2D5HA 3ZDVA 4KGQA 3DPRC 5EV7A 5BPIA 4JHTA 3N9NA 5FK7A 4IE5A 4KFCA 4TXWA 2BBAA 2Y6FA 1OHFA 2VMCA 3ZSMA 3WZ1A 1IS4A 3Q9VA 3OB8A 2GM4A 1S7AA 2OS2A 1XTAA 1G3SA 3ZN1A 1W90A 2OVUA 1OA2A 1RUF2 5CFDB 4AI3A 4BYYA 3SEZA 3QQAA 2D6MA 5L3DA 5CKMA 2A3YA 4RGRA 4DOZA 2E51A 3KF5A 3MUZ1 3HPNA 1UYXA 3ZQGA 2R7QA 2CWMA 2VC9A 4Y13A 2VT3A 5C3QA 3JD72 1AR63 5FFZA 3N35A 4RM2A 3T3YA 3GCMA 4NN0A 2R043 4YW4A 1W8NA 4Y26A 4XJ8A 1FMD3 3AXDA 4ZZDA 5FMOS 1W28A 4FISA 1SLCA 1S72I 4QWQA 2KXLA 1FYUA 5F3GA 1BVP1 2CV2A 2Y33A 5C3SA 4IEVA 3K1PA 5FO8B 3BPSA 1W7PA 2QBXA 1PO21 3DBLB 2OA4A 4A7KA 2LROA 4LO7A 3AKZA 1WW6A 1JKOC 5A2QK 2GNDA 5HS8A 4BHBA 3VBSB 1D8KA 4JHZA 1BA5A 2JG8A 4N43A 5FKOA 2OZJA 5D21A 5FFOC 3QP6A 4CE8A 2E2IJ 3HG9A 2ZKZA 1A6QA 2K9QA 4COZA 3J7HA 3HEFA 1IPJA 2BZDA 3HGGA 2BJSA 4E4ZA 3WTTC 4YVSB 2VC0A 4K8RB 1ZBA3 3RPUA 3CC2I 3A0HC 1UF2C 2WWUA 3HNYM 5FKCA 3FXLA 3LSJA 1HB4A 1W99A 2ARAA 5FY7A 3OYHA 1Z6RA 2IVIB 4LK1F 1W9YA 3K3OA 1FC3A 1WH5A 3ST7A 2A70A 3VKMA 1GOGA 2WZ8A 2LSOA 2PHFA 4RA0A 5LHGA 5C5UA 1BI2A 4HF0A 2RMU2 3W6KB 4EN7B 4YGEA 1P7JA 3PUHA 3SMHA 5LEJA 3IKVA 1FBSA 2BV4A 2HWD1 3DBRB 4XOPA 4FPKA 4PQ9A 1OKOA 3LFUA 1PGSA 1YCIA 2VCCA 5ABJC 2JWPA 4C3JJ 2RVAA 1D0GA 3IWFA 3RYKA 4K21A 3BR5A 4GB33 3BG7A 1KEXA 1SEUA 1IHMA 1N78A 1LHOA 4ASKA 1P4XA 4XKBA 2EICA 3L2YA 3LOBA 4OHVA 2LUWA 3B6AA 2XAFA 1ZBA2 3FXRA 2JIGA 3RZMA 1GU3A 5FXWA 2ET7A 2L9RA 1DFQA 3VD4A 4A6OA 2L5QA 1FV3A 5TGTA 3TNQA 1MSFC 2MGQA 3M9AA 2RS32 2PXJA 1G9AA 5BYNA 1HRV3 1OUXA 2R0FA 1JYTA 3MBWA 5E88A 2IXSA 5IK5A 2M87A 2WV1A 3AP4A 3S15J 3Q0WA 4YNIA 1XSRA 3BG3A 4ITVA 4ISQA 4XQDA 3ZMTA 2WR9A 3AZYA 2NN8A 2Y6LA 4MADA 1B35B 1GNZA 1SPPA 1NA1B 4YVWB 3I54A 4EGZA 4NHKA 1WWYA 3I59B 2AXLA 2IS4A 4GCVA 3K4NA 5IVVA 5EG0A 3O0WA 4F3QA 3JREA 1FXZA 4BQWA 1R64A 4Q0QA 4DGWB 5F32A 4QM9A 3J7NA 2JUGA 2GXGA 1UYPA 1DQ6A 4PUSA 4GKYA 4R8HA 2WTEA 1C5HA 2KKOA 1QOTA 2RVCA 2RM23 2A61A 5H9SA 1VBD2 3ZFGA 4HG2A 1MS4A 2VOWA 4AEDC 3FN9A 3IUOA 5KHHA 3BTYA 3QPSA 1YHQI 2IC1A 1S29A 3B93A 3KQRA 2JD4A 4CYCA 5IYCJ 4MSVA 2EIJH 4U0WA 2VXRA 2PMHA 3K4ZA 3WEZA 4E7JA 2W9XA 2Q1ZB 2FNAA 2VW0A 3TBIA 4AEMA 5JIAA 1IW7F 4AD9A 2MFZA 3A1YA 4NC8A 4A3MJ 2A05A 4PJLA 3H42B 2ZHNA 3CCUI 3O5SA 1Z3XA 4L5EA 3HTSB 5A7OA 3RMXA 1NCRC 4C1XA 1GNHA 5E89A 4IQPA 2MH2A 1AX2A 2WZPP 1IZ1A 4CDGA 1VLNA 5E6HA 2M0MA 4Y3OA 2VPLA 3SNMA 3WNPA 1YUDA 2YX7A 3M70A 2FEZA 5LBFA 1FPN2 3B9IA 5DAPA 2JDHA 4YZ1A 1GNYA 4XXAA 5FY9A 1R00A 1NCQB 1A31A 1FSHA 2PJRA 1ZN2A 4DZPA 1R22A 5FP9A 4RBOA 4C0BA 2D6OX 1G7YA 1LJ7A 4Q4X1 2BE5F 3ZO0B 2HGCA 2ELHA 3IRRA 3ALQA 4GGGA 5CVIA 4LJHA 1RUI2 2P3YA 3ZQHA 1VMFA 4AOCA 4UY8I 1E3PA 1VB4A 5JOWA 1T56A 3O1PA 3I58A 4Z2WA 5J1XA 3CO2A 3PTRB 2GXBA 3WW2A 4L9JA 2C26A 1RMU3 3LA2A 4A2UA 4KIBA 1BOBA 2DMUA 3Q0UA 3UYJA 2LW8A 2LG4A 2CAVA 3RNSA 3VGIA 4GFBA 2QQAA 2DBBA 3OGSA 5FZ1A 2IGOA 1MMNA 1TMF2 1B59A 2Y75A 3M3QA 3GDBA 4KU8A 1SVLA 1AHDP 1VMJA 2P34A 2D97A 1UYYA 3ILNA 5FLMJ 3VBOA 2PTMA 3BUCA 1XN7A 1DQ0A 3I59A 3CCYA 3BLYA 1LOFC 3BTAA 2O61A 2RDNA 4XORA 5JOZA 5D8LB 1W8HA 1R092 2BQPA 2VZOA 1N1YA 5KWRA 4D7SA 4XMIA 1X8MA 2IAIA 4E8CA 1WW4A 5FP3A 1AYM2 1S0EA 1ERDA 3ZKYA 5IVYA 3JB4C 3AFHA 4FX4A 3HD8B 1OFCX 2PHWA 4V2FA 3JR9A 1OPMA 4CRQA 1VAKA 3J7ZI 2ADUA 3QU6A 2L9SA 1MEC2 4FP3A 1O4ZA 1YI7A 4GA9A 4A42A 5HPOA 4KBZA 2ORXA 3O6BB 1QEXA 3BTIA 2YHJA 3BZKA 5JMOA 3DBHB 5FZCA 4MEYF 3PSFA 1UY4A 4U0YA 1WMXA 2WY8Q 5K5OA 2HDCA 5C4JJ 3NRVA 3BYWA 5C3OA 3D5OA 4NUBA 1KDKA 5IVJA 3S2DJ 1RUOA 2C6SA 4F3JA 2C6YA 3LDKA 3OIQA 4B4RA 1HN0A 3T0BA 2LVSA 2WINB 4EM1A 4D0PA 4FOVA 4LPLA 2KIQA 1V6OA 3AMQA 1JH5A 1QZYA 2RNGA 4BAYA 1FP1D 4PLOA 4FPJA 1OF3A 4CDXB 4M4PA 2LTNA 2DODA 3IAQA 3RYPA 4EN9B 3I2HA 1NCQC 2FOWA 2RJKA 4IQJA 4FFIA 4M6XA 2RE9A 1O8SA 2ZSIB 4FHTA 1LE8B 3MV01 4YFZA 2JXAA 1GWMA 4BS9A 3OMYA 4FPFA 2OV7A 1WJAA 4NIGA 2PMUA 1O3QA 4R4XA 4RN5A 1AVBA 1RR7A 2A6ZA 4QIWN 3A4CA 2F2EA 3JRHA 2Z79A 3M3OA 1VR3A 5EJCA 4MUVA 1RRJA 3NW4A 4FE7A 4QPYA 3WLUA 2CGPA 4IOAF 1KS4A 4RR3C 3NWSA 3L9JT 1GSLA 4HSLA 2ZBKA 2P6HA 2K9MA 3WHTA 1AR62 1DP7P 2VQHA 3K77A 1EH8A 3M07A 3HOBA 3OPZA 2RC4A 2UWAA 1HJFA 3SHFA 4B09A 3QOPA 1S0BA 4JGZB 5EEAA 3QAHA 2ID4A 3HNMA 2ZGLA 2Z1DA 5J36A 1X36A 2WB1A 3VD5A 4P02B 3W5NA 2TRTA 3HVDA 3RZOJ 2F5CA 4Y1UA 2Z42A 3IH4A 2LALA 3ZYHA 5E3NA 4NPLA 5L36A 2QF7A 5E8GA 1U5TB 5C3RA 2XRLA 3D0SA 1I5ZA 1K4TA 2K0GA 1B9NA 2DUPA 4GWNA 4BQ4A 2HEOA 4NOTA 2Y38A 4UXNA 2UWBA 3FE5A 2JKXA 3WDXA 2RMU1 1PP7U 2CAUA 4JQRA 1XOYA 3F8FA 4L0YB 3ACGA 1SD6A 3F23A 4IESA 1V5FA 3UGHA 4L97A 2M34A 3GO5A 4MHRA 2OZUA 4Z07A 2R071 1YNAA 3M7GA 2XAJA 4C30A 4LKDA 3OY8B 4GWJA 2BZTA 5D5VB 2QQNA 4A44A 4R79A 2LR8A 1IRGA 3VBUC 5FMCA 1MS5A 5C6CA 4QPWA 2KM2A 4IJAA 3VZNA 1VAVA 1VP6A 3HWJA 4IRIA 4CUAA 1Q8PA 2EAKA 3OPWA 3S1QJ 3ZFEB 2FF4A 1C0WA 3ATGA 1Q3EA 3S93A 2O03A 4N53C 3VZMA 4MHGA 1SD5A 4O9EA 4G9SB 1APLC 3MIEA 3AB0A 3N36A 3WP5A 2DU0A 2HWE2 3ULQB 2G4IA 5K0UC 1U3EM 1WLTA 4OAYA 4P14A 5C4WC 4KDPA 2DTYA 4XDPA 1J3PA 3OGVA 1IXCA 1R6RA 3L00A 1UN1A 2BU9A 2QQLA 2WZR3 2AACA 5F7UA 1OOPB 1T95A 1YW7A 4DXSA 5FZGA 2MLGA 2QDNA 1JTYA 3AZVA 2WFF1 1O4TA 3BCAA 4RS5A 1NYWA 5LCWL 1SFNA 4NHMA 4P9IA 2XJUA 3DYMA 2PI0A 2V5DA 1NZIA 5KCMA 2LP0A 3TAYA 1D7PM 2HWF3 4GWIA 4HOBA 1KRIA 2P3JA 2V09A 2CO5A 1WCUA 1V5GA 2NYXA 2PHDA 2RS33 3CLQA 1BEV3 3RKWA 4MG2A 4Z92B 1MDMA 2DF7A 1YFXA 3T1BA 3F72A 1ZRRA 2WO2A 5FP4A 4LA3A 3GHMA 1MS3A 1P9QC 5IFTA 1LKNA 1ULYA 2ORZA 3R6SA 4XOTA 1CD3G 2QQPA 4ANJA 5KNLA 4Q8KA 5ILVA 1MJAA 3VUOA 3WU0A 3MVPA 5L3GA 5A3NA 5IT9K 1YTYA 3MD2A 2IT0A 2BDRA 3DECA 4MTEA 3ZN6A 4DIQA 2FD8A 4X1EA 5GZGA 1DF0A 4G6TB 3MLKA 3CP8A 4B1LA 4ESJA 4ZPIA 2OX0A 5HCAA 3N97A 3GXOA 4JRAA 5L7OC 3PUFA 3KYDB 1TW3A 4UV8A 1OCCH 1S0IA 4OHZA 4M3CE 3ZXSA 1KA8A 4UAPA 1HRI1 3HTUA 2TNFA 1B35C 3P1IA 5CIRA 1O3SA 1K7AA 3GCXA 1JYWA 1Z6TA 3AZWA 4IHWA 4CCJA 3O1TA 1ZZ7A 4BH9A 4OIQF 5FYHA 1EH7A 5JI9A 5FUPA 1QXJA 1OLME 2WSUA 1FIAA 5A6QA 3N9LA 1TL8A 4H55A 4A93J 4FSJA 3V8JA 1IAWA 4BBRJ 3DYOA 5E3OA 2VTXA 2AEYA 4B4CA 2D43A 1IV6A 1POV3 4BK5A 5DN2A 3C2BA 4TWTA 4GYIA 3ZYPA 1X4PA 2XVGA 3SEPA 5C9AA 3CMYA 2A6XA 4D6SA 3ZFEC 1SFPA 3V8LA 2DFCA 5EEGA 1RC9A 3BPVA 2NS7A 1SLAA 4K20A 2Y0OA 4UHTA 3HDDA 1H88C 2XF7A 4CPBA 2YFZA 1UG0A 4QXBA 1ZX5A 5FWEA 3UESA 2E1NA 3T0AA 2W85A 5FZHA 2V5YA 1TT0A 1YFYA 2VNGA 3I3EA 2QQOA 3MIGA 4QGMA 3WW4A 5J7MA 4PI2A 1WJEA 4MGTA 2L7KA 3TN92 2XJSA 1FWZA 2EV0A 3KYCB 2JTVA 3JBG2 2A3WA 2UXNA 5HBAA 2OQGA 1V6LA 3R61A 3SKVA 4M9XA 3VL9A 1O8PA 4HVOA 4QPIC 3ABMH 1TVGA 4CXFA 1QWRA 1OCZH 4QPIA 4I02A 1YHFA 1FX5A 2Y64A 2ET1A 3NAUA 4C8DA 2R5YA 1G8WA 3J8F2 2RS53 2VXZA 2YUEA 2DVAA 3E5XA 3ECOA 1FYKA 1LCLA 1YX3A 1S7EA 2DI3A 2E1MB 3LF7A 3C1DA 2X6YA 2J1TA 4DBRA 2WJSA 5T5JA 1DYPA 3FMRA 4E4DX 2GLOA 3P9KA 1UKRA 1W0NA 4ATFA 3ZDSA 3SEEA 3HR9A 2C1FA 4EWDA 3VBUA 1X7NA 5HV0A 1EAH3 1CAWA 2ZACA 4Y17A 4JDMA 2VCBA 4OMCA 1O3RA 5FMOL 1RUE3 4CP0A 2P5KA 4AQSA 2XVKA 2Z5UA 4GULA 5LWBA 3POFA 2EA2A 4LB5A 5LGUA 5IPAA 2YV8A 2GH8A 4L11A 1LB2A 3IDAA 4II2A 3FKJA 2JA5J 3DTEA 2IP2A 1Z67A 4UVBA 4ASNA 4UI9L 1NE4A 5FQ0B 1O59A 2ZSHB 4IRHA 3IB3A 1IV8A 4GZ9A 1VQ9I 1FYLA 3WXPA 3I5UA 4W6WA 2O7OA 1G3WA 4CDUB 1BN5A 2ID3A 4BWOA 4AHYA 1DQ2A 4P00B 4XILA 4RAYA 5D8AB 2W94A 5FD5A 3Q8FA 4QHZA 2PMWB 4IXAA 3S57A 2PAKA 2IS6A 4WBBA 4L2NA 4NPMA 4BXXJ 1IZ3A 1Y3TA 3ACHA 1FV2A 4FFHA 2WRAA 1UFMA 2ECCA 3HHGA 2VKEA 4KIGA 2DU9A 1V9U3 4N7UA 1SMVA 1TNRA 2CGNA 1WMFA 2XHNA 1ETOA 3WTWC 4Y1ZA 1PIV1 2V6CA 5HDGA 3S2WA 1L3JA 3N9OA 2NZ9A 3M8LA 2VOPA 4NWVA 3MICA 2IXIA 4A7ZA 2DUQA 3N7LA 3ZP5A 4BUPA 2KT0A 4S0HB 5C44J 2BFUS 3L2CA 5FMDA 4CZZA 1MMDA 1FSEA 2D2WA 1OQYA 5H6RA 5FD6A 2F6BA 3C3WA 3VZJA 1C1LA 3I3DA 4ZXKA 2HDDA 3WINE 4JGZA 4UVCA 4K1YA 5FPLA 2QCOA 3WUCA 3JAMZ 5JHUA 1VBA2 2EZLA 5C7GA 4UV9A 1JE8A 5LGNA 4ZU7A 3WG1A 1U9NA 2BW8A 3AVRA 5F8PA 3JUUA 3M3IA 2ZJ2A 3IMMA 5FYSA 3NL1A 3OBRA 1RTVA 4LK7A 1FX7A 5JZGC 3CEWA 3ZKUA 4IEQA 2WNVC 2Y0SA 3ABZA 3RZHA 1VALA 2AHQA 4Y24A 2R072 3GZ6A 4FP2A 1ACIA 4WM7B 1RUF1 3GYHX 2WN2A 1J9IA 1RUJ3 1IG0A 2WNUC 2VNOA 3IBMA 2VCMA 2E33A 4OINF 2JDZA 4XRMA 1TQPA 4J19A 1UO9A 2AQFA 4RAGA 4J1XA 2WC2A 1XC6A 5A33A 2DLLA 1YQ2A 2RHPA 1PJRA 1MS8A 1YLFA 1KFXL 2FQPA 3HKZN 3CDZB 1SCSA 4Q1PA 4YEJA 2LMDA 2O14A 2IWGB 4XCBA 2VOOA 5FRAA 1RUG3 1F31A 3I2GA 5BPDA 1QY4A 2Z69A 1FOD3 2E7XA 5B4XA 1DQUA 3LKJA 5LY2A 2ZXJA 5EF6A 5L73A 3H92A 3RPUD 5M3FJ 4H4KC 1H4HA 5FPVA 1WA6X 3J80Z 3J26N 3KM5A 2KJBA 4ENKA 3CUQC 2Q5TA 2VGDA 1MQTA 4F7ZA 1PO22 2VZPA 4LHKA 3VBHC 4QXKA 5A3OA 1K6OA 3BGAA 3IPVA 3K70D 3PO3J 2XJVA 1JYIA 3K1NA 1IKPA 4AVPA 1JU4A 2EBIA 1PUFB 1T8IA 2V1DA 3GLXA 1VQKI 2KIUA 5FXVA 4RGGA 1HRI3 4LMYA 1TME3 3KSCA 4QPOA 4ES9A 4WVMB 2WT1A 1ND3C 2GA2A 5HCBA 3BTLA 1XMAA 1CAXB 4IV3A 3AFKA 1VBA1 1W1WE 2WABA 2ZZQA 1QZZA 1UELB 1G9FA 1VQMI 5FAXA 2XIGA 3AG2H 4KNYA 2DURA 3HIFA 1OF4A 4CTEA 4R52A 5K4LA 2VBYA 5ILSA 4DNYA 2K46A 5FV3A 2JE7A 2GXAA 4CCEA 1GLNA 5G04L 4J25A 1SBEA 4HFSA 4BLIA 4MGSA 4IW3A 5JLWA 1YEWA 2R062 1XBFA 5B66C 2ZEZA 1GUUA 5LA9A 5FKNA 4IZZA 3I64A 3H8RA 4XNFA 1V6NA 3LQCA 4IDZA 1X4OA 1NXMA 4ZYHA 4CDQC 3MFAA 4RFRB 3VBFB 4ZHNA 3M1EA 1TWFJ 2GP3A 2OZ6A 2NVYJ 3O1SA 3PU3A 5EJZB 4CUGA 2ID6A 4XLEA 2BP6A 3TMOA 4YFWA 1NLSA 3BR2A 2I5UA 1JZ2A 4KBBA 4AGGA 3V4GA 3SC7X 4WM8A 4XIDA 3M8JA 1XGSA 4A5MA 4GDFA 2P6CA 4X8NA 1AZDA 2VPRA 1SBFA 3KB5A 4EMSA 1IUFA 4UW4A 2IFRA 1XB4A 5AC91 1R5GA 2YC4A 2JG9A 3HOTA 3KCXA 3BJOA 1F4HA 4HSRA 2CV0A 3V0BB 3ZFGC 4HZFA 2BFUL 2EXIA 5IK7A 3ZYRA 1GV5A 1U8RA 2Z3YA 2ARCA 4ZC3A 3ORJA 1Z3YA 4EWAA 2ACJA 2ZMEA 3C7FA 5LATA 1QU3A 3J4UH 3PNVA 3MLLA 1TNSA 1WZ2A 3J80K 2IXLA 3FL7A 4Q4W2 3ASNH 2ZHKA 4A0XA 4XZPA 2ZJPF 2CSOA 3CCLI 3HPHA 1Q43A 1SDWA 4E4SA 4HKOA 4AVCA 2P17A 1VRH2 1HN1A 3CKHA 2EXKA 1OQEA 4LKFA 1RGSA 2J1RA 4L0PA 1YQ5A 3B5LB 2Z5WA 5L7OB 1ZG5A 1MSEC 2XKPA 3S6PA 4P1WA 5D1IA 4AFMA 3OYLA 5K7FA 4U7DA 4XW3A 2B0LA 1VPHA 4JKMA 5IK8A 3EQEA 3E5QA 2OJED 5HLIA 1JW6A 4GMP1 2P7CB 2J5PA 3LAGA 1OURA 4Q0VA 4NIDA 4TN7A 4RAFA 1MZ6A 1EV11 3JAMK 2YBKA 4RHV1 1UL9A 5H9RA 2QBYB 3OYIA 4CDWA 1RKWA 1H0BA 1Y8QB 4BQOA 1TQ5A 3N9QA 1A5JA 1X1PA 1G86A 3VBHA 1Y1WJ 5A3WA 4RS8A 3VDCA 3CP2A 3M4FA 3KV9A 3O2PE 1W8TA 2BEOA 1E5SA 3GM8A 4WXCA 1IXRC 2EVXA 1COV3 3RZZA 2QQMA 4M3EA 3VSLA 2O1QA 2CTVA 2VUDA 2W00A 4UW6A 1C1FA 3CO7C 1LKXA 4XSZF 4B8XA 1LJ9A 2F5EA 4D9JA 2MEV1 2DT5A 3ZN6B 4MXWB 1PK6C 2RAEA 2M2EA 4R1HA 3H3ZA 2FRHA 1NUKA 3KVBA 4RR3B 1GANA 2VW1A 4Q1RA 5IVBA 1RUH3 1CWPA 2PBIA 3O7OA 2OQ7A 4EJVA 1USSA 2Y34A 4LMFA 1C28A 1TTYA 3D5LA 1OKQA 1DDNA 4HANA 4COYA 1I3QJ 4M0NA 1PIV3 3MDPA 1I27A 4CPBD 2D45A 5IFPA 3K51A 3OYMA 3B00A 5ACA1 3F8CA 2HWC3 1PGW1 1OXCA 2Y0IA 3FBYA 3PIPF 1OMIA 2D44A 3MIHA 5GALA 3VN4A 1VF9A 4QX7A 2XJQA 3IDEA 1GV2A 2BBVA 5LHHA 1QHGA 5D8AA 2HWB2 1N3OA 1FNZA 2ZHMA 4W8JA 4BQ1A 5GLWA 3T4HB 1F5FA 2DMPA 3BTXA 1H9TA 4D7TA 3BU0A 2I10A 1LR5A 4OIPF 3IPVB 3MFKA 3ES4A 3V0AB 1ZQ3P 4OI1A 5K7HA 1HB1A 3OYFA 2BHYA 1QPIA 2VQCA 2DDUA 1LTEA 3IRQA 4CICA 1N3QA 2EXJA 3JTHA 1W9FA 5LRSA 3CC4I 5CKQA 2XB6C 2CDOA 3HQRA 5FYBA 1UY3A 1ZLKA 2ZHLA 3H5AA 3BCBA 1SG3A 2DMQA 4UB6C 3PVBB 5KHDA 2E7TA 2ZS6B 4M71A 5E20A 3CIHA 5JCTA 3S3MA 2MEV2 4DS0A 3NAPA 5JR3A 3KLNA 1OPOA 2ZMKA 1ND3A 3ERMA 5ICFA 2ZMLA 2P37A 3ZMUA 1XRUA 1NH3A 3CCVI 3E6MA 2IXKA 4KIFA 1LFUP 4XBNA 2KD7A 5GTHC 3NAPB 2ADDA 3KWVA 5FZOA 1DYKA 1S0GA 5J1UA 3NQHA 2HWF2 4Q48A 2IVJA 2ZXWH 2WWYA 1PX4A 2EILH 3KZYA 2HI3A 1O91A 3SHRA 1X50A 2YS9A 3OEAA 5IUQA 1ITYA 4XMYA 3DTKA 4OYUA 4WXDA 3N9MA 4WXHA 4FTSA 1RINA 2JDYA 2H1LA 1M06G 5ACA2 4WVVA 3LB9A 1ZYRF 1QJEA 1YW8A 3VBSA 1AR82 2QM3A 4I7HA 3EETA 2ERFA 1BBT1 2YGLA 4A3DJ 2FZ2A 3S8PA 2V1XA 1XYNA 3V65A 3BR1A 3Q9SA 4DRVA 4IGPA 2IFWA 4UUSA 4M0HA 1JT0A 3AP7A 2X5IC 2ZBJA 4LFUA 5BUVA 1A3KA 5ERLA 4LOSA 2HLEA 1H6XA 2RJLA 2VOKA 1KQ9A 1YLLA 1T6SA 4GIQA 2ZCWA 4OIRF 3AKSA 5E17F 2NS0A 2F5DA 4CUCA 1Z7S2 3AYAA 1N47A 1IRFA 1ZREA 1D0HA 2GALA 3K4KA 5GAGJ 4DUXA 3EPZA 2QVSB 5JLXA 1JXNA 3H9JA 4JKLA 5HOOA 1PHMA 5M5YJ 3EBRA 2FD5A 1S2EA 3ZX7A 3NMBA 3LEGA 1GFF2 5FLIA 3TEZA 2B45X 1AR83 2MSYA 4PIXA 5CNAA 2CL2A 2WO3A 4CCDA 3RZKA 5CFDA 3QOEA 1R1TA 2XLFA 5EEHA 3KP3A 2BWAA 2R49A 1R1A2 2Z33A 2DJNA 4ARXA 5CBLA 5FJKA 3AL5A 4ABZA 1YI9A 2W92A 3BJ6A 2W46A 2DMNA 2J1VA 1I50J 2QQ9A 2J1EA 1OR7C 3N05A 3MZHA 4HETA 3H8UA 4N9HA 1QVTA 5DD4A 5F37A 3VHRA 2YSRA 3HJRA 4IKFA 2ZOEB 3HBLA 1HOMA 1XSDA 2VJ4A 2WAEA 1V00A 2J1UA 4MVTA 5FTTC 2VXDA 3KCCA 4XTPA 2EFQA 1H8TA 2L7MP 4XFHA 1K4SA 1I6HJ 1QGLA 5D8AC 5C9AB 3GF6A 5EXOA 4AEDB 2VZUA 4EROA 3PQKA 1RMU2 1YRNB 2BNOA 1J7KA 4IL7A 1LVAA 2YXSA 3OYNA 3KLOA 5DUUA 2VNVA 2EPFA 1YYNA 3AKTA 4RR3A 1RKTA 3SXYA 2ISZA 2LLKA 4MTDA 2K9NA 1AL21 2JICA 1AYN3 4XDOA 4DYQA 3ZOIA 1GZWA 3MEXA 2M3AA 1STMA 4HLTA 1O5UA 4FT8A 5CJ9A 3DPLC 3ZYBA 2EK5A 3FK7A 2XPWA 4BK4A 5F27A 2W84A 3H5RA 3F21A 5G05L 1KJLA 4ZKTB 1BJZA 1PZ7A 1G9CA 1H89C 3HQXA 4YLZA 2DA3A 2L54A 4OWRB 2KZGA 3KT7A 1EV13 3E1SA 3UV9A 4WZCA 3U14A 4OHXA 1AL0G 2Q8DA 3NQOA 3WHUA 3LD8A 2EZIA 2X51A 3HB9A 4NMIA 4CGZA 3WNLA 1XNCA 4PDWC 5BNPC 4JCKA 3WGIA 1X3ZB 2PAEA 2D5FA 3PNTA 2A1XA 2P2KA 3TEDA 2MC3A 2KRHA 3MUY1 2QNKA 2CUFA 1WH7A 1EV7A 3JRIA 1VTNC 4XACA 4IHSA 3PTYA 3KP4A 3R4DB 3R05A 5E79C 5D4SA 2FMDA 4IVNA 1AR91 2IGMA 2DU1A 2H8WA 3GTMJ 1IS5A 5L9RA 4QQHA 2QLZA 2ELJA 3BODA 2L0KA 1AOYA 4XF0A 3T4VA 1D0YA 4B7KA 2CYYA 4XQFA 4KJZA 3FXJA 3MI8A 1J59A 2VNRA 3ACFA 3MPPG 4CA9A 1H8VA 2E19A 1VAMA 2PHLA 4WV8A 5DDJ2 5A7WB 2BWCA 2O5RA 5IP6A 4A12A 2N8GA 4WVMA 2IGNA 3TKYA 1KYZA 3HXLA 5FO7B 3V42A 1LGBA 2ADEA 2E2HJ 4EQVA 4P5OA 4E6KG 1V6KA 4ZYEA 5IAVA 3NV2A 4M00A 3U9GA 1UAAA 4WK8F 1W2TA 3ISPA 2PHTA 3H8OA 4D69A 2JDNA 5FYUA 1MIJA 4CDUC 2JIJA 1MNDA 1NQJA 3N3HA 5AONA 4S05A 3OUHA 1DZRA 4AZZA 3ON7A 5IK4A 2LY1A 4S04A 3VOEA 4XRSA 1T38A 3ZFFA 1O4YA 1KQ8A 3R60A 1LEDA 1OT5A 3Q8CA 3CJNA 3CJIC 2KDZA 1PVEA 3QYFA 2VM9A 2BOLA 3QRFF 2JJ7A 3IKWA 1YQCA 1ULEA 1BVVA 2BHZA 5HLHA 1X1AA 3HZJA 2G7HA 1AXZA 4M74A 4HG6B 1MZFA 3R4SA 3W2WA 3ZXGA 1COV2 3G7DA 5B1AH 2W39A 3U1KA 4QX2A 3FXQA 1FBUA 4HQEA 2XF6A 3IKTA 1L7LA 5LY1A 5AVAA 4CCCA 2ZGQA 5FP8A 3EB7A 4IGOA 1S4CA 1O5LA 5FLJA 3VBOC 3GZTB 1G3YA 1F43A 2D3SA 1C57A 2K3PA 1RVF1 3GF2A 4K7JA 1IQDC 1EKEA 4IL6C 4DBQA 1JGGA 2OT7A 1ENXA 1ASJ1 4EQQA 4QGLA 3MPBA 1H30A 2UYBA 2PQQA 5EWSA 2CV6A 3EO6A 1WCKA 2ZGTA 4YW2A 3TOJA 4F92B 1YXWA 5F5CA 4QXCA 4MFDA 2F4LA 2CFOA 4DOUA 4PDWB 4DINB 3T0DA 3DKXA 4IEWA 5HVQC 1GQGA 5A7QA 1B4AA 5FO5A 3APBA 1P2FA 4L99A 5DG1A 5JXJA 4KL1A 3WOGA 4MGZE 1MS0A 5LFAA 1SEFA 5I91A 4XIOA 5F0CA 3GWZA 3FFZA 5FZAA 5L9VA 1PGL2 4E8DA 3VD7A 2LKXA 1TG7A 2OUMA 4N90A 3JRGA 1K78A 1P4WA 1WWXA 2HWB3 1BBYA 3LDBA 4UF0B 2WAOA 1MMAA 2WZR1 3VBRB 3ZM8A 2W08A 4EJWA 1XS9A 3QP5A 1F5JA 1ULFA 5F2WA 3C2UA 3HN3A 2ES3A 1RUC3 4BHCA 3LSMA 4ENMA 1K5MC 5KXEA 4YW6A 4AEDA 3OYWB 4FFGA 3S32A 4EVIA 1OBNA 4A6SA 4MGIE 5J96B 4F55A 4YZ2A 5A3TA 3M3EA 5HDKA 1Y7BA 3OYWA 4E2SA 4NRPA 2KA3A 3FX3A 3OSFA 4EM0B 2VULA 4XAAA 4NRQA 3WUDA 2A6TA 2GOMA 1HDPA 4QDSA 1WA4A 1BLZA 1AR81 1RIOH 2KL4A 1HRV2 4YIIA 3P5JA 5JSOA 5GLVA 3C7EA 4QPQA 1FNYA 3HRSA 1VBE2 2BY1A 2VUCA 2CFXA 4UFIA 4FAHA 2UUZA 2XLGA 2YU1A 3CLOA 2JB4A 3U07A 4MQVA 2VZVA 4PJMA 5APAA 3TW7A 4IV1C 4YPJA 5CB7A 1EUTA 4NC7A 2OF7A 1KJRA 4XE9A 3JRAA 3EXUA 3INAA 1RXGA 2QQUA 5T54A 2A6VA 1HX6A 2WAQN 1SFUA 4M3DA 4R9CA 2HU9A 3ZXEA 5TSWA 4IEUA 2XKOA 5FY0A 5JI7A 1R7JA 1PK6A 2VQLA 2ZX4A 1YX5A 4IF4A 3SYTA 1ZM1A 2UY9A 4M3BA 1Q5OA 4CP9A 5DQ0A 5A70A 2YYOA 1Y56A 3C2GA 3S3OA 5DZEA 3CDLA 3NV3A 1WW5A 3BKZA 2JT1A 3NNJA 1PMHX 4XTMA 1DGLA 4C1WA 1GVJA 5F1RA 1SAUA 4BQYA 2G9GA 4BXUA 3HOXJ 3VHOA 3ZN4A 1L0OC 4BXSV 2KDOA 4DQAA 2YG0A 3TDZC 4G7ZF 2D5VA 2LF8A 1IS3A 4OZOA 4JRLA 1D1BA 1AXYA 1W6PB 1ETKA 2ZGSA 1Z7S3 4CDWC 1ZR4A 4D8MA 1CZVA 2EALA 1OOPC 1RIRA 1UZYA 2WFF2 2JWTA 4G7HF 1KGYA 2NXNB 3KEYA 3WDVA 3ZXKA 4Q4X3 4FCAA 5IT3A 2BBYA 3S2HJ 2E7AA 2HR3A 1JHFA 2COMA 2MBFA 4YZ3A 3I3MA 3HSFA 4DYRA 3NWKA 2Y8KA 1LAJA 4KT5C 2WNVA 2VG9A 3PURA 4E7ZA 1R081 3TO7A 5LK7B 2HWD2 2Q4SA 5J6XA 4WM8C 4YVWC 4FPCA 2GMPA 3FWEA 2MA3A 4S2FA 3H3VK 1MJBA 2P0WA 3ILRA 4HL0A 1UMZA 2DO7A 4BL0B 4YWAA 1AL22 4URTA 4LKSA 2W48A 4PBPA 2GQQA 2ENRA 4I01A 1MMSA 2ME6A 2WZEA 3CMGA 3F0CA 3LWFA 2VMFA 5KHIA 4HDUA 3GTPJ 3I3BA 3THCA 3PUBA 4C3HJ 4XYXA 2XBO2 3N7MA 1HKTA 2AC1A 2V73A 3T2OA 2QZ2A 4QX0A 3AMNA 1QIQA 2RS51 1SACA 1CAVB 4ISRA 5DZFA 4XZUG 2P6SA 3WVJA 3OJBA 3RCOA 3ZR6A 3DXTA 4M6VA 3I4NJ 5KAFC 5DM6F 3NNLA 3S5AA 4M3GA 5JHFA 2E32A 2ZMEB 3I0TA 3GBGA 1U0JA 4I99C 1Z0HA 2ETHA 4CXXA 1QJU1 4I98B 1JOPA 4MO7A 1WCSA 4MXVA 3WV6A 1EJ9A 2RQQA 5GZCA 4BEHB 3S0MA 3SH4A 3UT0A 4M3CF 1PNGA 4Q5OA 2FDHA 4PGGA 1GKBA 2MHFA 4BE0A 1DG6A 4BQ3A 1DQ5A 4YM1A 5DPNA 1MMGA 1ZGAA 2G9FA 4LBOA 4A6DA 4BEHA 1MKMA 1OYWA 2E35A 1R71A 2V9PA 2VKVA 2BW3A 4N53A 2IEKA 4FX0A 3KV5A 5E8IA 5CU1A 1VBD1 4CU6A 5LEKA 4OFGA 4CCLA 4B1RA 5J1YA 2RNJA 5A1AA 2DYRH 4YSFA 3OS1A 3IWZA 2FZ1A 3OR1C 2E1MC 1UIKA 4QKFA 5HNFA 1W06A 4EEFG 4PT6A 5BNOB 2BXZA 3KT4A 1X1CA 1DP3A 1W6PA 2OC6A 3IT8A 2FHRA 1WJ5A 5GP9A 4N4OB 1TEIA 4XFBA 2Z4FA 4E2GA 2CW7A 3VBSC 3FXUA 1JUMA 1AKHA 2GC2A 1R5HA 4YGBA 3P9CA 2DBNA 4K40A 3K69A 5A3PA 3JSPA 3C7OA 3I56I 4O3MA 1RVF3 1ZG3A 3MN2A 5DUKA 4LBKA 2CU7A 4A3XA 5E18F 4KYWA 1EF4A 2RV8A 4OUEA 3S1NJ 1DGRN 3CTAA 3TNPB 1UJ8A 2XXZA 5KHKA 3LAPA 1IG3A 4HAMA 3B7MA 1CX1A 4G9YA 2YPDA 3TWIA 2QKLB 1Y4WA 4CU7A 4PDKA 1A6IA 4L0ZB 4AGVA 4QTRA 3FDYA 5AC92 4J6GA 4GMP0 1IRZA 4JX6A 3LAJA 2K5CA 3KP2A 4XKWA 5TISC 1TQMA 2MG4A 2RREA 5K8SA 2NMNA 3OUIA 4MX3A 3BR0A 4X0GA 1OLTA 5IVCA 1PO13 4FQZA 3ONQA 2EAAA 5FBZA 1ZAOA 4QX3A 4BJ0A 1QKQA 1K5MB 5J48A 3CCSI 1F4KA 2Y2ZA 5JXHA 1Q8SA 2ZKLA 5A1FA 4XJZA 3AMPA 2YB7A 2E1OA 3RDIA 4IUGA 4S2HA 3SCHA 3UK9A 2XV4S 4IHTA 3OPTA 2VT2A 2O9LA 2ZMEC 1QJY3 4JDNA 2IW5A 4L9TA 4A6EA 3R4KA 1BW6A 3MW4A 2PJRB 3PHMA 1SLBA 5KXCA 4FPGA 2WNOA 1KZHA 3OL4A 5K5QA 3FXOA 1UZCA 4QX5A 4UF0A 2DPUA 2WBKA 2V9KA 4LO4B 3Q3SA 1YQ6A 3ABTA 3WP4A 3AMHA 3NJYA 2WAFA 2QSGX 5HS7A 1LHWA 2QENA 3FIWA 5BQTA 1BMV1 4AE2A 5IW0A 5DUIA 3F3XA 3LPGA 3ESWB 3H3UA 2CWEA 3WG2A 4QB1A 3DWLE 2WWJA 2UWCA 2VVDA 1SMTA 4MGQA 2VU9A 5JUVA 1B35A 4B4QA 3WQ1A 4NQWA 4PFOA 5DAVA 1TME1 2WT2A 4LG3A 3DLLF 1TZLA 3OWTA 1DDLA 5CQEA 3D1NI 4QU2A 3OS2A 2F48A 1CN1A 1S6LA 3EDPA 2HH9A 3U21A 3Q8EA 2JDPA 5GZFA 4DZGA 3ELKA 4GH4C 1BI3A 4DRRA 5KHGA 1XU2A 3HAGA 5BV6A 2DCEA 3I2DA 2EFPA 2ZB9A 3BC8A 3U0ZA 1NCRB 2GMEA 4Y22A 2XGDA 2A69F 1RUJ2 2QEXI 2HDWA 4UB8C 1AJKA 3PUAA 4K9SA 3UGFA 1BEV1 1J5YA 5BNQA 5FDBA 1W5TA 4DQ2A 1IUYA 3LFKA 5FYIA 5HS9A 3POBA 4COVA 3LOCA 1NG0A 3O1VA 4UBHA 3PVEA 1PK6B 4CA0A 5FPAA 1OUSA 2VI6A 1O57A 4INDA 2J22A 1LDDA 4KMUX 1X9PA 1XNBA 1POGA 3KD4A 1US2A 3PIJA 5FZ6A 4ITCA 2KPMA 4XRSG 4QB2A 1D3YA 4BDZA 1MD0A 5FCCA 4EZHA 2EIBA 2RKHA 2JE9A 2W5FA 3P6BA 1B09A 1UCRA 2M7BA 4XF4A 4HNVA 3USSA 1IN8A 4KG0A 4XF3A 3W9AA 2PQ8A 5FZ0A 4EJUA 3PMEA 2WLQA 1GYKA 3IP4B 3LEMA 4H7MA 5H6QA 1S0JA 3DXUA 1FTZA 3D5RC 1TME2 3POWA 3KV4A 2AEZA 1K42A 3ZCOA 1GXPA 1BI0A 2E6VA 4C9YA 4TZDA 4A3LJ 1XDSA 5JVTA 2QE3A 4FPOB 1FJLA 4B44A 3SITA 4Y1YA 5J1RA 1CPMA 2QQWA 2ZMNA 4Q0UA 3ML6A 4PF1A 4BY1J 1YJ9I 5EPAA 2P4EA 3DQVC 3QCWA 2XB5A 4P5HA 1E5RA 2IXHA 3VPRA 4JX4A 2YBPA 2LY9A 2PHUA 5GLUA 2E31A 3FUOA 3O14A 4IEXA 2H6CA 1QHDA 2BY2A 4QMAA 1W36C 3ZMVA 1VQPI 2I07B 4AEKA 1POV1 4U7BA 4RGAA 3D82A 3DP7A 1GXQA 1VQ8I 5IYYA 1YIPA 4Y20A 2JDKA 2VL4A 3RSNA 4XHXA 4ZDLA 4P9FA 2I8DA 1D4M1 3GEZA 3AP5A 2P4WA 4IRGA 2B9SA 3DGTA 5BNGA 3ZVXA 2R061 2R5ZB 3FHZA 1WQ2A 4NIIA 4M6YA 3NRUA 4YVWA 1FT9A 1SFXA 1P92A 1DPUA 3D8CA 4Z2AA 2VE1A 2XJTA 3SJMA 4CCNA 1I1GA 1OPCA 2B42B 2Y6GA 2Q1FA 1FBQA 5B5EC 4KWKA 5DAQA 1G3TA 3A0NA 4FVVA 4UWDA 1DGWY 1W9WA 1E3OC 2EIGA 1MEC3 1ZVFA 3K75B 5B2GB 4QQOA 3MIBA 5FYCA 2CQ7A 4UT5A 2QBYA 1IF1A 4CDWB 3ZQFA 2JD9A 3WHBA 4LUKA 2PG4A 2K9LA 4M73A 2EZHA 4FTHA 1FPN3 3BB6A 4I2OA 2J5OA 2WQ4A 3U4SA 4XLAA 5EG0B 3TOBA 4OUMA 5A6ZA 1OCPA 4YVSC 4QLCU 1VBB1 2A7AA 3RZGA 2W95A 2L9LA 4QPIB 1W05A 1A04A 3GTGJ 1JUPA 4LG0B 1X58A 1B8IB 1WLCA 1HXS2 3I2OA 5JIUA 4GJYA 4Z1VA 3OG2A 2ICWG 2CGOA 1HLVA 4Y33A 3AYDA 3AYEA 2D3PA 1E17A 5EYRA 5HLGA 2R7TA 4DXRA 4LITA 4Q5SF 3CF5F 1MBHA 3I2JA 5I0DA 1YJLA 4EZ4A 3IH3A 3RVHA 2VMEA 4RB2C 3CC7I 1PM7A 2MPFA 1D2QA 4RYDA 4I76A 4UFKA 3GFIA 2WLPA 2XRNA 4RQPA 1LGNA 2EFOA 2XPVA 1RUD1 4OULA 3WD5A 1VJ2A 3NJVA 2ZEYA 3IC7A 3QU3A 2W87A 3K4MA 1FMD1 1OYIA 3WTUC 1NK2P 4H7LA 4RQPB 2MABA 1IPSA 4QQ2A 1YO5C 4XL9A 1BK1A 3LE0A 2HTSA 1XG1A 1NG7A 3QPHA 5EJ1B 1MW7A 2WV0A 1O3TA 4KA4A 1MR5A 4QSHA 1J0RA 2K85A 1LFBA 5FB2A 3QPTA 3CJIA 3HUGB 4X8PA 1T6GC 1S7OA 3NJXA 4Q47A 4U2AA 3HT1A 3KFWX 1R4MB 1SDDB 3PL8A 3B73A 2ZX1A 1HV0A 4Y5Z0 3WHCA 2XGCA 2IXCA 3GZUC 4P9YA 1FY7A 2V7FA 2B39A 3FC0A 3I3LA 3JBG3 1V6MA 3L2WA 1V70A 2DFFA 4QQPA 1GOHA 3PSIA 3LSKA 1ZBA1 2OQRA 3VZOA 3ILFA 3MYXA 5F0HA 1QU0A 3MKLA 3MLJA 3T1LA 2JPBA 3WG9A 1ENRA 1D5VA 2W82A 5IAXA 5HI0A 2VPVA 1WBFA 3MQ0A 3GZ5A 2CUEA 4RGXA 1KYWA 1R58A 3VYUB 1XB9A 4E70A 1V9U1 3OSDA 5DAWA 1CVNA 4JTOA 4OVEA 3KZIC 1ZHFA 4QB6A 1J83A 2DA4A 1REFA 1Q56A 2W25A 3G6EI 1OH3A 5DCMB 2MC4A 3PIGA 3SZTA 1W6NA 2HQRA 1B72B 5CKTA 1VNDA 2H0BA 3OUJA 2XGEA 4LE4A 1HW5A 3WU2C 4AQ6A 3S14J 4DB5A 2Q2EB 1N77A 5H9QA 4V2VA 1PMIA 4YW7A 3SISA 1C4RA 3PU8A 3VYTB 2ZEWA 4NNJA 1F2NA 1QBJA 2J1SA 3T5XA 1V6JA 1FMD2 5K9YA 1JU3A 1VFCA 3OYKA 4LLNA 3O1MA 2HEWF 4LIUA 4GH4A 3AJZA 2HYXA 3PNAA 3UKTA 4XLHA 4AK3A 5K1YA 2DVDA 3LZZA 4O61A 5ILUA 2VODA 3CDHA 5FKLA 1LOEA 1OVSA 3TO9A 4NPRA 1DUXC 2FBIA 3AJYA 1ZZBA 5EQUA 4ZYGA 2HYJA 3FF5A 4P9LA 1QZEA 1SC7A 3BU7A 5FZLA 4EJTA 2I45A 4R4ZA 2OUJA 1G9BA 3IDBB 2FX0A 2QZ3A 5JWPA 2KJCA 1GQHA 4TYSA 1Q1VA 2WS91 1GHCA 3B6CA 1NZCA 3H1MA 4DW6A 1GOFA 1NY72 5EZWA 2NNNA 2QQBA 1PYVA 2VQTA 5A6YA 4Z82A 5FZFA 4F83A 4HEA2 1LE8A 5GLTA 3OOUA 4IHXA 2OPWA 1W04A 2RM21 3QBQA 4BE3A 2FBHA 1A35A 3ETPA 3GYDA 3TEYA 3WW1A 2DCJA 3WGHA 5DMYA 1MZ5A 3KHBA 5FZ9A 3FFQA 5F04A 2X6OA 1WBLA 1WMDA 2VMDA 1D2SA 1MZBA 3J81K 1RUNA 1HKDA 3TBDA 4IE4A 2E26A 3NWTA 4YIRX 4OIOF 2XL9A 4EATA 4IV3C 2LBFA 3P9IA 3ZXJA 4RAZA 1HJGA 5F39A 2DA1A 3BTJA 2AZ5A 3AYCA 1Z05A 4XR6A 2JA6J 2LDUA 4AHWA 3MAJA 2UWMA 5FP7A 3OS0A 3L9FA 3WDTA 1YIFA 3VBRA 2JB8A 2GAUA 1GDTA 1WHUA 2VIXA 3HOSA 1I9RA 2EB7A 4RMNA 4K8FA 1ZZ6A 3MIFA 1XE0A 3VKLA 3A4UA 5IP9J 4QKNA 3ZMZA 3OIPA 2J42A 3A0KA 2M4KA 3JW4A 4Z6YA 5KXDA 1AL23 1AYN1 2ZFUA 4OHYA 5D5WB 3BQZA 4DY5A 1BIAA 2QUFA 1W6NB 4EYUA 5JXIA 4PIZA 3RKQA 2M45A 4R9AA 3QH7A 5FY1A 1X9TA 4HT1T 4QDRA 2VC1A 4JK1X 2I2SA 2XBO3 1R1VA 2Y48A 5JR7B 3CJQB 4QHOA 2DW4A 2P6TA 2PELA 2HXOA 2FU4A 2L7FP 4GRIA 2AGSA 2IS1A 2W1SA 4M9ZA 4B8EA 1LGCA 5HLTA 1LFPA 4CSWA 2VN2A 5FO9B 3HYIA 3KMHA 5KAIC 4XURA 1IN4A 3IAM2 4OMZA 1PX3A 1TWAJ 2Y0SN 3AG1H 3T1MA 5BNOA 1OYYA 2JJ6A 2QCSB 3OCPA 3CESA 2NVUB 2E9QA 2CHHA 3K4AA 2SLIA 4XJAA 4YW5A 4XXPA 1J3QA 1JZ4A 1MEC1 2XL7A 5C71A 3FISA 4LBNA 2LM3A 1ND2B 1I3AA 3K48A 4ZYDA 2EIKH 4LT5A 1QRYA 4GKXA 2PLV3 4L9VA 3UR3C 4UFJA 4YG3A 5HXVA 2YPRA 2I74A 1VBB3 5A3MA 3CBNA 1DZQA 1MNMC 5GLZA 5C8CA 4XF1A 2RDQA 2DFIA 4OMDA 2DFBA 1WD4A 4ZU4A 3H9AA 4NAOA 4KWLA 4P9WA 4W50A 1Z7UA 3IL2A 4M01A 3H0GJ 1GICA 1AX0A 2PX9A 2TEPA 3LSPA 3ACIA 5T55A 1QO0D 3VKOA 1WKMA 1UMIA 2F4OB 2ZGMA 5IJRA 1YJKA 4GALA 5LBQA 3HM5A 5I93A 4PHZA 1QNTA 2DUOA 3ME2A 3ZXLA 1YRZA 1AF9A 4GMP3 5LBEA 4YFKF 1PVC2 1EPZA 3KT1A 2NLRA 2TUNA 4JTNA 2PMZN 4L9BA 3RQ0A 4RHV3 3WG4A 3OL3A 3WCSA 4BQXA 2ZJCA 4CDQB 1F5TA 1DQ4A 3F95A 2UZKA 1YWKA 1KU2A 3DCFA 4IHVA 1M4WA 2WY7Q 2YZ4A 4LHNA 1MNEA 3AMMA 5I0UA 2V4JC 2LY2A 2XONA 3RQ4A 4H3WA 4QX8A 1LU1A 2YUSA 2EV6A 4LJZF 3OYAA 3FHAA 3CJRB 4BNCA 3DLAA 3LSTA 3WCRA 2NVTJ 4LUMA 2V1UA 4MGRA 2DK8A 1W8FA 4GH4B 2ZABA 2FSWA 4Y5TA 4PZJA 1H8TC 1W5SA 1DYOA 1H2LA 1DU6A 3O1UA 3TQNA 3GJBA 1YYVA 4LG0A 3HEIA 1WLWA 4RD7A 4S2DA 4QHBA 4MLOA 4JGYB 1FOD2 5K7ZA 3OD0A 1FP2A 1PVC3 2ZO4A 3K4CA 1RUH1 3CNAA 2KP6A 3KIOA 5FRNA 2JX9A 2JDAA 2OPTA 1BL0A 1BOAA 3UNGC 3POSA 5F08A 4QXHA 1XGMA 2VKHA 3IH2A 1DPRA 1FMWA 3CUQB 3RJPA 2JSCA 2JG9B 4LHSA 1T08B 2DA6A 3CMAI 3FUQA 4P5YA 3CJTB 2X5IA 4CU9A 2PFWA 5BNPB 4LNVA 3WNKA 3KP7A 4L18B 1SMYF 1SD4A 1JZ7A 4OHWA 2VLAA 5F0FA 3UKNA 2NRAC 2VUJA 3KZ4C 3GTKJ 2SBAA 2FCTA 3ZFEA 3PFYA 3RZLA 2C5DA 3GNEA 2QKMB 1CJDA 2W91A 1WRJA 3J81Z 1HSTA 3LFMA 3FM5A 4BQ2A 4P9JA 1OLQA 1DGRA 3WTVC 1XPXA 2Z99A 3UJQA 4O9GA 2NOGA 4Y4RA 4A3ZA 5FWJA 3OD4A 1SFYA 4BIFA 1WI3A 2E36A 1RUC1 5B1BH 2TBVA 2RJ2A 1YFWA 2CW8A 3ZPLA 4NHXA 1HXDA 1UD1A 4ENJA 3ZSLA 3VBFC 2VBDA 3AKPA 2PN5A 4A45A 1Y6IA 2R7ZJ 4UVAA 4WX9A 2WNVB 1H8TB 2RR13 2HFHA 1ZZ9A 1J58A 5FUIA 1R1A1 2PFBA 1FOKA 1EAH2 4PSWA 1ND3B 2E7WA 2PQSA 4Q0SA 4LIVA 1CIYA 2XPUA 3B02A 1JI6A 2WS93 1LNWA 3WTYC 3KGLA 5C3PA 4JZRA 2R073 3QD6A 1RHI3 1LECA 1GZ9A 2IA0A 4AR2A 3Q9OA 3P3NA 4MQ9F 1ND2C 3M3CA 1HSJA 2ILMA 3EMRA 2NS8A 4CYCB 2H1KA 3QPLA 4KNCA 1FMVA 2D3RA 3FK6A 3R4UA 2DJIA 3ABUA 4A0YA 2CUZA 1UAIA 1LRHA 2J1AA 3OGRA 4CXYA 2ZNYA 2V9VA 1UU4A 3AX4A 1POV0 1ONAA 4EWEA 1XMKA 1OKRA 1UXZA 2H27A 4CEYC 3VYRB 1VZ0A 4RFT0 2PJPA 2L4MA 5CVVA 1UHWA 4J00A 2DAOA 2VR4A 3C3VA 3L2QA 2QSFX 2VE9A 4KQ7A 4LK0F 3CCQI 5DD8A 1ZRCA 5H2FC 2EA7A 1ACCA 4Q4Y1 1X2MA 4BJ6C 1PGL1 3I53A 1MQTB 4JX5A 4D94A 5F3EA 5KR7A 1EUUA 1QGPA 5EHDA 5GAHJ 2RDSA 2RS31 1JODA 1NTCA 1Z1DA 1NG6A 4RS5B 4HV6A 4IEJA 1XC5A 2JECA 2ZAAA 1S0DA 5CFCC 3QACA 4QAWA 4TV7A 5K0UA 4PI0A 2OTLI 1ENHA 2D6KA 4QPGB 3VHNA 2WWSA 1XGNA 5F5AA 2FQ4A 2IGKA 4KI5M 1REEA 2WADA 2YPJA 3IZOA 5LLQA 2XC7A 3LSGA 1ZBE2 1JYXA 2GDFA 2A75A 4LOTA 3W2AA 5LBBA 3G1OA 1T33A 2CUJA 3OGJA 3R0AA 4BBSJ 3EYPA 4CYDA 3K2ZA 2X9DA 4HNUA 4IEZA 4XHBA 2IA1A 1IPKA 5FPBA 1BQPA 1W0TA 1AX1A 5A2QZ 1QNWA 4Z2YA 3KHCA 2VBPA 2LC2A 3OV8A 3PJRA 1YIJI 2PAMA 3PQJA 1IO2A 1WSUA 3WDYA 3ACLA 2GC1A 4ZS2A 5FYMA 3AK0A 1VBE1 1IGNA 1W7PB 4ZTFA 5FZOB 3KF3A 2X1DA 1JOBA 3MF6A 1J84A 1ETQA 3L2UA 5T5OA 5ICGA 1O7LA 5BNNC 3WE3A 2BTVC 4NHJA 5A1LA 1AUYA 3K46A 5EIYB 4Q4V2 5GZDA 1NXD1 4LBMA 1UB9A 4N4NB 1V5EA 1S9HA 1Y0NA 2EWNA 2HWC2 5CVJA 2E7QA 3KYLA 4BA6A 5DCMA 1VI0A 3PJQA 2WYFA 2EIEA 2VTFA 4HXCA 5H9PA 5FPZA 2B9UA 5CAZA 1B72A 1GP4A 2RGVA 1VQLI 2E71A 4DZJA 1UOFA 1QJZA 2HYFA 2YGMA 4KWUA 1K6YA 1EPWA 5E3MA 3U75A 4KT6A 3HRTA 3SKJE 5LBCA 1TNTA 1XDUA 3TYJA 3CZ6A 1AR61 4QGNA 2XAHA 2YBSA 4FQGA 3O3KA 2NP0A 1MBJA 4XJ9A 1W2UA 1U5YA 4Q4X2 1W03A 4GB32 3REOA 5C5TA 3RPQA 1XXNA 1ZBE1 4X6QB 3L1PA 3OBAA 1C8M2 3RRDA 2XROA 5CLSA 1HC8A 2B7YA 3VD3A 5KK1A 3F2ZA 1Z78A 1KQRA 4K1ZA 3WQBA 4JBAA 2FXAA 4O5VA 4AWDA 1TT5B 5FK8A 1MS9A 5FYZA 3LA7A 2R92J 3CL1A 3PLQA 1W6QB 4FPYA 4UYBA 3VB2A 4AVVA 4PK4A 4HMZA 1ETVA 3OBZA 1N1TA 4ZXEA 5F64A 3TEXA 2ZAHA 2C0ZA 2K40A 3FXKA 4D1QA 4YG2F 4FTBA 3ELNA 4D0QA 2DDBA 2IJLA 1FZPB 4YARA 2HEYF 1Y9MA 2NVXJ 1ULCA 1BEV2 4WF2A 4O65A 3V7CA 3JRCA 3ITQA 2B7EA 1WI9A 2VZQA 5FPXA 3A7QA 1PVC1 4YG6A 3A22A 1RESA 2STTA 4PBOA 5KBFA 4KISA 4Q27A 3ZR8X 2A6EF 2VQGA 5C8WA 3BG5A 3VDDC 1A78A 4IEPA 5I0SA 3W3CA 3F9KA 1XE7A 3WF1A 3V64A 3CJIB 3BQYA 1HDDC 5DUWA 4FOYA 4PLMA 3BN6A 2R7XA 3ZYGA 3AKQA 1F35A 5LRRA 5E3LA 3DEUA 1RUI3 2ZFWA 3GVAA 4BE2A 1QOSA 3ZYIB 5AFEA 5FOBB 1IN5A 4E4HA 1NK3P 1HCRA 3GHNA 2YX4A 1WFXA 1H2MA 4AGRA 4GB31 1FIPA 1UMQA 2L3DA 4NVPA 3BALA 3ENRA 2A5ZA 3VLBB 3S1MJ 2RS12 1LNSA 3VBHB 2LKPA 1NQDA 2ZGNA 2G9WA 1OD3A 1W36D 1ZK8A 1N3PA 5LB6A 4ZY9A 2CG4A 1SD7A 5JOXA 2VBZA 1WCMJ 1Z77A 4ETSA 5TJJA 4UFHA 3NV4A 4HSTA 1IKQA 5E16A 2DXIA 4LLFA 1P7IA 2K4BA 2H94A 3THDA 2QSHX 3OYJA 1R9TJ 1HRV1 3HC7A 4QD2A 1ULDA 1QJY1 2NM1A 2CMPA 4AI8A 2OD5A 3RQIA 5BY5A 2WNUA 2DPDA 2K7LA 4XC9A 3WW3A 3AVSA 3H7YA 2Y60A 2M8EA 1QJX2 1UY2A 1ZKGA 3ZN5A 3MFCA 4KUMA 1G8XA 3HGYA 3W20A 2IZWA 5A32A 4FXKB 4GWMA 1RHI1 1HF0A 5FZMA 4NJ4A 4PQQA 4A3BJ 2GN3A 2XHKA 5FZ8A 1OFNA 4UBGA 5CA6A 2F5VA 4FFFA 3KETA 2BVBA 2Q30A 2F6CA 4G4FA 4IO9F 3KGZA 2Q8EA 4L92A 4CCOA 2GNTA 1UPIA 5FRMA 3K0LA 3H1WA 4META 4PCRA 1W6OB 1Y8RB 1FOWA 3AP6A<