1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
3H9AA 2DBBA 1YFYA 2VT3A 4HF0A 4P9GA 1IRGA 1S29A 3WGIA 1FBSA 1YTYA 1DP7P 1FI2A 1REPC 2RC4A 4PCQA 1MD0A 1YS7A 5I0TA 4JQFA 2O3FA 3RIRA 2UYAA 4U0YA 3WTWC 5J8FA 3FXQA 3PNAA 4ENKA 2LSOA 3GEZA 1NE6A 3U1DA 5ILSA 3RKXA 1P4AA 2QBYB 4Y17A 3BB6A 2R3SA 5LHHA 4HQEA 3KGLA 5DCFA 2B8MA 2PBIA 4BQAA 1O7FA 2X4HA 4KDPA 4EV0A 6PAXA 5C6CA 2L4AA 1MJBA 3ZMTA 5L3CA 3QPHA 2FA5A 3BCWA 5H6RA 5I93A 3TDZC 4MNUA 4AQ6A 4S04A 1T0FA 3ROUA 3ULQB 4KMFA 1YQAA 2HS5A 4YFKF 3EHKA 4AVAA 3ZMZA 1Z6TA 5FLJA 1T39A 3KLNA 2NNYA 1ZYRF 2QUFA 5IT9Z 4AIJA 1ZG5A 2M45A 4XF1A 3DQVC 1W7PB 4GYIA 3NL1A 2E7XA 1HW5A 5AIQA 1FYKA 1O7LA 1JHFA 4HSJA 2GAUA 1B59A 2FSWA 1FWZA 4TLFA 5BXXA 2MH2A 2HYGD 1DGRA 4HQMA 2K86A 4IRGA 1J2XA 1XDUA 4HN0A 5BOXA 1QPMA 4U88A 3JW4A 1BI2A 2XKOA 4HX8A 4P55A 4RGRA 4IETA 2L3DA 1O5LA 1CAUA 1P4WA 2EAAA 2FE3A 3E6DA 1D5VA 3KP4A 5FLHA 4WXDA 3LA3A 3NKTA 1F1ZA 1LEBA 3TNPB 3CUQA 5DD4A 3K1MA 2KJBA 4Q48A 4O9GA 1WLTA 2CSOA 2GXBA 4HMZA 2YPRA 2PHDA 3LWCA 2MBFA 1Q43A 4P9FA 2K0GA 5K1YA 3F8BA 4XETA 3SCHA 3J80Z 2IXJA 3GUDA 1XE8A 3I0TA 1FPQA 4HLXA 3H7YA 2D1VA 2HJIA 4EM0B 3NRVA 3GZ6A 4IEQA 3G3ZA 5LGUA 1OYWA 2ZMEB 1L3LA 2Z9OA 2XAFA 4ZZLA 5AIPA 2NNNA 4A0ZA 3K69A 1O5UA 3I58A 3WTUC 4KU7A 3FZVA 2K27A 2XVCA 5H6QA 3U11A 1FOKA 1LEAA 4EJWA 4CXFA 3WTTC 4A0XA 4E2SA 1BJAA 1JHHA 3OD0A 1W7PA 1IUYA 3V4GA 4M9ZA 1BM9A 3MDPA 2UYBA 5BS6A 4CHUA 4ZYEA 3RPQA 1CGPA 4L9VA 3T5XA 2P7VB 1B9NA 1YLFA 4BIFA 1IRFA 2MC3A 3WG9A 1MDMB 5BY5A 3GFMA 1RUOA 3CUOA 3WTXC 4Q29A 4ENMA 4UNOA 2ZCWA 4PGGA 3Q9VA 2DQLA 1XCVA 4A12A 3C3WA 5I0SA 2ZKLA 1RNLA 3LQQA 4L9TA 2EJRA 4YIIA 2PJPA 1WSUA 3H8UA 3WU0A 3UKVA 1ZZ9A 3SXYA 3IC7A 1D8KA 5KHHA 4Z07A 4X6RB 2DCTA 4KA4A 2FRHA 1U3EM 1YFUA 5FB2A 2VOPA 1ZVFA 5LGTA 2GIVA 2LF7A 1J58A 1SMTA 2OQGA 1UW8A 4MQVA 1I5ZA 2O1QA 1DPUA 1ZG3A 2XGXA 3SMHA 3DP7A 4Q0SA 4UHTA 2FU4A 4PZJA 2IA1A 4ZU4A 3V8JA 3H92A 4EROA 1W5SA 4I0BA 1S7AA 1FT9A 1MGTA 3I54A 5LRSA 5BPIA 3HRTA 4I7HA 4WXCA 2O0YA 2ETHA 3HT1A 1T6SA 5CVJA 3REOA 3FMRA 5D4RA 4G6DA 2P5VA 4KIFA 5TJJA 3IRQA 3RKWA 4I01A 1HSTA 1LRHA 4HV5A 4QX5A 2ACJA 4AIHA 1O4TA 2BNOA 2CYYA 1SFNA 3HQXA 2Q0AA 2QVOA 2ZBKA 2BYVE 1R1VA 5HDKA 3ZP5A 1XN7A 3WW3A 2LF8A 1FSEA 2ET1A 2WV0A 2O03A 5E17F 3B73A 2EA7A 3M7GA 1KU3A 1UCRA 1CX4A 4A5MA 2L02A 1QXJA 1WGPA 2HEOA 1H0MA 2HKOA 4Q4ZF 4HVRA 3HHGA 2FNPA 2N7GA 1Z9CA 4YSFA 2VODA 1ZZ7A 4L2NA 2GQQA 2FEZA 2Y0MA 2C0ZA 1YG2A 1XSVA 3I7DA 3E6BA 2VE8A 1I1GA 1KGSA 4EWAA 4S05A 3SXWA 1ZRDA 2ISYA 5DEQA 4K2EA 4U0VA 1ZNPA 2M87A 2HWVA 4HVOA 5I91A 4RB2C 1J3PA 4NB5A 1LDDA 1ZARA 1L0OC 1PMIA 1IXRC 3ISPA 1WWXA 4QXKA 1FBQA 2FBKA 2VXZA 1S6LA 1RIOH 1ZZ8A 1HSJA 1KU7A 5E8IA 1QO0D 3E97A 2RN7A 2EFQA 3F6OA 2FBHA 3FMSA 3FFQA 3BDDA 3R6SA 4D7SA 3CEWA 4R8HA 2UXNA 4IEUA 2K7LA 4RB0A 5HLGA 5FCCA 3IHUA 1I6XA 2A3SA 1QBJA 2CFXA 5DDGA 2IXCA 3TGNA 1VJ2A 4IRHA 1R23A 1YS6A 1QQIA 3VB2A 5HLHA 2W57A 4LB5A 4ZU5A 3SZTA 3JSOA 4GXOA 3C3VA 2EV5A 2DPUA 3UKNA 3MFKA 2ZNZA 3AAFA 3JAMZ 1DDNA 5T3NA 1H9GA 4IVNA 2H6CA 4GULA 1SFUA 4RS8A 1H9TA 3G73A 3FJSA 2QQ9A 1TW2A 1OPCA 2EWNA 2VBWA 4A2UA 1QY4A 3H1WA 2CAUA 2D5FA 2X0LA 2FQPA 2HTJA 1J5YA 3MAJA 2P4WA 4BHCA 2OD5A 3CO2A 3FZ3A 5FGMA 1G6NA 2DI3A 2FMLA 3MZHA 4RAZA 5CU1A 1IN8A 4XF0A 3CF6E 2PFWA 4IEZA 5FQ0A 3ZPLA 3I53A 3RI4A 4N0BA 1XGMA 4G8XA 3WE3A 2QM3A 2P7CB 3M9AA 4Z82A 2HDCA 3OF1A 2V09A 2M8EA 4EGZA 2FBIA 3HTUA 3MQ0A 5HS8A 1UHWA 2KIUA 5L3FA 1TQIA 1W7PD 4A0YA 5KHGA 2M5WA 1EH8A 2PEXA 4XLNF 5FLXK 1R58A 5J6XA 5HDNA 3IDBB 2EV6A 4Z2YA 4ZH4F 2B5HA 2JT1A 2CAVA 2XLFA 3E3VA 1BI1A 3DPTA 5ICGA 1USTA 3CUQC 4ON0A 3F8NA 2EVXA 2P6SA 3DPLC 4KN4X 2HTSA 2ZJ2A 5J48A 1ZHFA 3RKYA 3ACLA 2F5EA 4E70A 2H94A 4QM8A 1QWRA 3H1MA 1Q5OA 5LHGA 4G7HF 1ZGJA 1S3JA 1BC8C 2QQBA 3GW2A 3BPXA 2OYZA 5KK1A 1XSDA 4WF2A 1OI6A 5JHUA 3G7DA 4ORFA 4BHPA 2RNJA 4OLLA 4FHTA 1KQ8A 2V1UA 4LLLA 3B02A 2H6BA 5KBFA 1KQ0A 3GF2A 4JVAA 1CAXB 2W84A 5JR3A 4N9HA 3RNSA 3V8LA 4X6QB 5ILVA 1R22A 3OCPA 3J80K 2H09A 3DKWA 4RAYA 1LVAA 1MJAA 3BJAA 1R5GA 2ZO4A 1YFWA 2Q4SA 4WWCA 3PLQA 4TV7A 3J81K 2E7WA 4ESFA 5BPDA 4UXAA 5K5RA 1TQMA 2K4BA 1HW2A 3SQNA 3TO7A 1OYIA 1X3UA 1XRUA 1YFXA 2OZUA 2HFHA 4R79A 2G7UA 2GA2A 2QJVA 3P9KA 2PAMA 4AD9A 1U12A 1J3QA 2YR2A 2A6EF 2B0LA 3KGZA 5BUVA 1QGPA 4WCGA 2XROA 5A2QZ 3QAHA 4R52A 4G7OF 4XFHA 5J3UA 3IL2A 4WX9A 1DUXC 3J81Z 5AONA 1B9MA 2EFNA 5CADA 4M6YA 4HZFA 2BGCA 3KEQA 4MEYF 3L09A 2IXHA 3KP7A 4O3MA 1BIBA 3TOAA 3U10A 1B6AA 2DFIA 3RTRA 2R7DA 3ELNA 5D8KB 1OFNA 5LEKA 5KHKA 1WQ2A 3BP8A 3T8TA 3K1PA 2NAZA 3KLOA 1PM7A 1J9IA 3D0SA 1CAXA 4L9JA 4FX0A 4YNIA 3LSTA 4AXOA 1J1LA 3JTGA 2JTVA 1RZ4A 5D5VB 3WW2A 1E17A 3GFLA 1FXZA 1RTVA 2J5PA 3ECOA 5K8SA 1X8EA 2RGVA 2Q30A 1Y3TA 4IERA 1HKTA 2ZFWA 3LAPA 3GZ5A 3CL1A 4CYDA 5CYVA 4LK0F 4KU8A 3WE2A 1P6RA 4LB6B 2CGPA 1IN6A 2IJLA 1IPKA 4YFXF 3H7JA 1XCBA 2Y0OA 3QU3A 1EH6A 4E2GA 1IAWA 3LWFA 2V6CA 5HS7A 3VFZA 3ML6A 1YO5C 2V1DA 4D7TA 2FF4A 5JCTA 4YYOA 3NSTA 5F6FA 4RB1A 5J8CA 1SQ4A 3LA7A 3GXOA 3V7CA 3KZZA 4HLTA 4LLOA 4I0AA 4XSZF 4LG0B 5HLIA 1G3SA 5LBQA 3CO7C 1RI7A 4PJYA 2IXIA 1P4XA 4ONUA 1W4MA 5JSOA 4MHGA 2O61A 3TO9A 5L3BA 3CLOA 1ZZ6A 4NHJA 3P7NA 1BI3A 2D5HA 1IZ1A 2XAGA 1RUNA 1AWCA 2ETEA 4FAHA 2IP2A 3ZN1A 2EB7A 1KU2A 4LMYA 3U2RA 3NVCA 2J5OA 5LGNA 1S7OA 3VOEA 2NS0A 4QWQA 4AWXB 2FXAA 1UFMA 1KU9A 3FMQA 2HR3A 1OMIA 2PYTA 3H50A 3DV8A 2G7HA 4WBBA 1LQ1A 5FD5A 4ENJA 4GYGA 1YWKA 2QYOA 1O57A 1T2KA 5ICEA 1ZLKA 3CTAA 1X8MA 3K0LA 3HSEA 1X82A 3RZZA 1CF7A 2KIMA 1USSA 1HXDA 1XB4A 3KP6A 5EFUA 3ECHA 5A2QK 1JXSA 3CUQB 1XE7A 3QRFF 5K5QA 3KEOA 3F3XA 1FP1D 5KVRA 1Y9QA 2JZYA 4NVPA 4I02A 2HQRA 2XHKA 2BE5F 3KZYA 4XRFA 4ETSA 1H1MA 4LG0A 1BBYA 1YIOA 1XD7A 2KJCA 3IKTA 3QACA 1UHMA 1SFXA 2WWYA 4QMAA 4QGLA 3M8FA 3O2PE 2P6TA 1GXPA 5ERIA 4HOBA 3JZVA 4IEPA 4XEZA 3L2CA 1FX7A 5KHJA 3C7JA 2MPFA 1FC3A 1MDMA 3WTVC 4A6EA 2D93A 4ENNA 2JPBA 4GCVA 2GC0A 3R4KA 5E16A 4OIQF 1JE8A 2OZJA 5H20A 1ZZCA 4HX7A 4XF9A 2BNNA 1EV7A 2QZ8A 4PIXA 3GLXA 3SHFA 2IC1A 3GX4X 4MH0E 1PDNC 5D5UB 5D1IA 5JSPA 3BWGA 1XGSA 1C0WA 3KP5A 2PFBA 2WC2A 2D45A 3NJZA 3QP6A 4OIRF 4RB3C 5JSRA 1XMAA 3O6BB 4Q0UA 1HKSA 4ZU7A 1U5TA 3OOPA 5LRRA 1F4KA 2K9ZA 4OIPF 5DV5A 1UD1A 4IJAA 3J7AO 1ZH5A 5HI0A 3GFJA 5E20A 1P2FA 4LD5A 5E1ZB 2DU9A 3HSFA 2XLGA 3S0MA 1U5TB 3LQRA 2IA0A 2PQQA 2WTEA 2Z99A 4J1XA 3EQEA 3MPBA 1SD5A 4EMSA 3EJKA 4HVQA 1ULYA 3KP3A 3IDCB 4EGYA 2RVCA 4MGKE 4F7ZA 2PHLA 3IWFA 1RC6A 2GXGA 2WFPA 4BHBA 2H0VA 3EYIA 2VE9A 3N4MA 2V1XA 4IF4A 3I59A 2EFOA 4LUMA 3ST7A 3GVAA 4L18B 4QLCU 1JUHA 4WVZA 1EYBA 1J0RA 2Q8KA 3E5UA 4KWKA 1ON1A 1XGNA 3BOQA 4PIZA 2Z69A 3CDHA 1L3JA 4O6JA 3Q5FA 1LR5A 2Q1ZB 3I64A 3HRMA 1X7NA 5FFXA 3CO6C 3H3UA 3GWZA 5CLSA 5E8GA 1ZREA 1EPZA 4H0EA 1G4DA 3F22A 1FYLA 2DK8A 4WK8F 2E9QA 1CF7B 3SCGA 1UPIA 1OR7A 3DL3A 1CAWA 1KQ9A 2PAKA 3C18A 2GA1A 1TNSA 2VC0A 1Y0UA 1G3TA 4MEXF 4KL1A 4XBFA 4U0WA 1NZCA 2NRAC 2VECA 4OINF 4CDGA 5FLXZ 1K7AA 2IA2A 2IPQX 1TNTA 3TO6A 4EM1A 4U7DA 4OIOF 4MX3A 4RGUA 3OTFA 2OA4A 3BJ6A 3NW4A 4MTEA 3PVBB 3DN7A 3V8KA 2HKXA 1BI0A 3COAC 1NYWA 1LNWA 2UY8A 1IN5A 2MD5A 2PMUA 1ONVA 2AXLA 4UVCA 3UKTA 3KETA 3U0ZA 2ZXJA 2EA4A 3DEUA 5FQ0B 1P92A 2ZNYA 3T8RA 1U2WA 3RYRA 4HDUA 4HLYA 2BEOA 2P5LC 4LK1F 4G94A 4YIFA 2PA7A 3QP5A 4EWDA 1G3WA 1QZZA 4EJTA 4AVPA 2DT5A 1GQHA 2D40A 4HA8A 3GYHX 1ZRRA 3K2ZA 2MNGA 4IEWA 1U5TC 4O5VA 3FM3A 3WGHA 2STTA 4UV8A 2AS5F 2MA3A 3R0AA 1Z1DA 2COMA 1SAXA 5FD6A 2A6HF 2LKPA 1O3QA 1SMYF 3QPTA 1ZG1A 2QLZA 2EV0A 4XFBA 3LZZA 5DCMA 3IWZA 3LAJA 3E5QA 1QNTA 3ERED 2A07F 5I8TA 5IT9K 1F9NA 3LA2A 5FPZA 4MUVA 1VTNC 4KYWA 5BMZA 2HOEA 4EJVA 2E1NA 5DYMA 4KNYA 3MEXA 2MHFA 3EBRA 3GYDA 5ILUA 1UIJA 3V7SA 2Z2SB 1J3RA 4HYEA 3P9IA 4XSXF 2QQAA 4JV4A 2IVMA 4DNCA 3KFWX 2DLLA 3ZMVA 5KHIA 4CZZA 1R7JA 4ESBA 2DPDA 4KIGA 4UVBA 3ZMSA 2A5YB 3HYIA 2GC2A 1YFHA 1ZRFA 2F5DA 2JPCA 2VQAA 3ZQ7A 4AVBA 3DXJF 1V4RA 1MKMA 2W25A 5AVPA 1OD5A 4LUKA 3O14A 4PIYA 1LDJA 4XFCA 2ISZA 5CVRA 4MGIE 2XASA 3D5LA 4AIKA 4JTNA 2I45A 3TNQA 5BPXA 3GO5A 4YFNF 4PGHA 3FXRA 2QNKA 2YU3A 4LULA 4CGZA 4JK1X 3W6JB 2P5KA 3BU7A 3T1BA 2VBXA 3BPVA 3R60A 1WRJA 1YW9A 1S8NA 4GGGA 1ZLJA 1TW3A 4MTDA 1FYMA 2L01A 1HQCA 1EY2A 3W6KB 2IXLA 2JRTA 4HAMA 1D8JA 3ZN0A 3RYPA 4M73A 2KIFA 4EQQA 1R5HA 3HSRA 3HHHA 4XFFA 5I8SA 4ZYHA 1QZYA 1PP8F 2IRFG 5JAXA 2R7FA 2H27A 2XAQA 2OU2A 2E1CA 1G3YA 4RGSA 4YRDA 4GO1A 3CJXA 2EA2A 2XLAA 2ELHA 3RDIA 2A69F 5D5WB 4OFGA 5IT3A 4BH9A 1XDSA 2LNBA 3E6MA 4O9EA 5ICFA 4LFUA 4LA2A 5ICCA 3WTYC 3M70A 4XFGA 2ATFA 4KUMA 4R1HA 1Z05A 5JVTA 2MH9A 2OZ6A 3KE2A 2D2WA 2XIGA 2XAJA 2KKOA 4L0ZB 1MZBA 2V9VA 4WXHA 1FBUA 3R0JA 4HW0A 4YG2F 1Z7UA 3BJOA 2ET7A 1ON2A 3S7IA 1R1TA 5DCMB 3GFIA 2V79A 3F6VA 1XSXA 4L11A 4Q0VA 2ESNA 1Z91A 4OMZA 2EK5A 2VN2A 2F5CA 2ZKZA 3L2HA 3ABTA 3HT2A 3O3KA 4OU0A 4JBAA 5LEJA 1FNNA 4EJUA 1K6OA 4RGXA 4DINB 2XRNA 4EVIA 4G7ZF 4IEOA 1EH7A 2OAZA 2QVSB 3MCZA 1IN4A 2Z33A 1RGSA 4D0PA 3EO6A 2HGCA 2Y48A 3I4PA 5FO5A 3IIAA 1LB2A 4UUVA 5FPXA 3FWEA 2UXXA 2DAOA 2OA2A 2F4PA 2PMHA 4G6QA 1YW7A 3ZDSA 2O8XA 1J7KA 3BALA 1ZRCA 4OMYA 4HBLA 5FDBA 3GBFA 3K1NA 4ASNA 3F8FA 1ZZBA 3USSA 3H3ZA 1K79A 1U78A 4IEYA 4NQWA 4HF2A 3EYYA 3CLPA 2KRFA 2PG4A 1LKNA 2HQNA 1V3FA 2Z3YA 2UY9A 1H1IA 1JGSA 4FAGA 1B1BA 1DZRA 3PQKA 2P17A 3KCCA 1U6GA 3HOTA 1SFEA 1D3YA 2TDXA 1WI9A 5E1WA 3SHRA 3KP2A 3PFIA 2XKPA 5HDGA 2PLYA 1IF1A 1WA4A 2K02A 2DK5A 2QBYA 2XL7A 1K78B 4B8XA 5I8YA 2GU9A 3ELKA 3HRUA 5BQTA 4IRIA 3MWMA 4N9IA 1BOAA 2C6YA 1ZN2A 3NQOA 4LTAA 2XV4S 1CAVB 4XLPF 1U8RA 1J59A 3MZYA 2Q2EA 4MQ9F 2QENA 3ES4A 2DTRA 4EM2A 3EQLF 3IRRA 2B9UA 3ES1A 4Q0PA 4PDKA 1E2XA 2VBYA 1NXMA 2LDUA 4ESJA 1DGWA 3M1EA 2STWA 4P5OA 4MV2A 4MGYE 3BZ6A 3SCFA 1VP6A 4K8FA 3WTZA 4RD7A 3T0YA 5DUIA 4IEVA 1PP7U 2F5FA 2GH2A 1IXCA 5L3GA 2L54A 2CG4A 5L3EA 4IHSA 1LDKB 2QWWA 3M3IA 4LLGF 5DD8A 2Q0OA 1HBXG 3C1DA 4Y13A 4HF1A 3FHIB 3WODF 4KWJA 1HKQA 4FX4A 5JR7B 2ESHA 2RV8A 1A04A 2YSRA 2PN6A 4HX4A 3D82A 2O8QA 4M74A 2Z5UA 4L0YB 4OOIA 1KYWA 3LOIA 4M9XA 3TOBA 4HN1A 2VPVA 1I1SA 2FQ3A 3QU6A 1O3SA 1FP2A 4LGWA 5D5XB 3R61A 2JSCA 3KMHA 4M71A 4MGZE 4J1WA 3CJNA 1PUEE 1CAVA 5D4SA 4YARA 3S7EA 2VC1A 4CICA 2IT0A 2FOKA 5TRDA 2PAEA 2PI0A 3JTHA 3F23A 4BXUA 3F21A 4KFCA 3IKVA 3N97A 4A5NA 1HW1A 4AVCA 4BYYA 2W85A 1GXQA 1YW8A 4LLNA 4MZUA 3VHRA 1TQPA 3KSCA 2A61A 4HDVA 2PQ8A 5F64A 3HRSA 1GVJA 4FT8A 3RYKA 4L5IA 5J7MA 4FBFA 3L00A 3RJPA 4AQ2A 2O6GE 5D8LB 5CVUA 1IW7F 3ZMUA 1UCXA 2CW0F 4L5JA 3OGJA 1YHFA 5I0RA 1GQGA 2PTMA 4XFAA 2NYXA 3E5XA 3WW4A 1Q1HA 4IEXA 5L3DA 4I3PA 1YUDA 4Q0QA 3FHZA 2OQRA 3D0JA 4P9UA 4UBHA 1SD7A 4H7LA 5DUKA 2GC3A 2RQPA 4L9NA 4Q47A 4Q5SF 4EWEA 2QDRA 3WU1B 2DQRA 3BROA 1DZTA 1ZX5A 1IN7A 3BY6A 5EEHA 2A68F 4IXAA 4QM9A 4ZYGA 5FFZA 4ZYDA 3MYXA 2CV6A 2VOOA 2XUBA 2KXLA 2YX4A 3SFZA 2CO5A 1GHCA 4P96A 2EFWA 3WGGA 2XAHA 2UWMA 4BAYA 1UIKA 1R00A 2MLGA 1Q3EA 4META 1UB9A 4XF4A 1XGOA 2DW4A 4XF3A 2GWRA 1YYVA 5E1RA 2Y75A 3DFGA 3SZPA 4KIBA 4KWLA 1KA8A 4UBGA 3TKYA 1NE4A 5K5OA 2VT2A 3I71A 1FSHA 2D1HA 1NHAA 1WKMA 4Y15A 4A6DA 3EUHA 1T38A 4KN7X 1YLLA 4KT5C 2XL9A 3ZMDA 3LFKA 3FX3A 3K9TA 1OKRA 4CO8A 2MLKA 3F8MA 1CAUB 3H1YA 4DQ2A 3F72A 2F2EA 3HOSA 5FLIA 3EETA 1MJ9A 4M6XA 3U9GA 3FF5A 5LHIA 3VODA 5EZWA 1BN5A 4UV9A 3JAMK 2EFPA 2RKHA 4F8AA 2BBYA 3WW1A 3FM5A 4ZZDA 4IPAA 3LAGA 3FE5A 1ZGAA 3Q9SA 5D6FA 5C8WA 4I2OA 1TLHB 5CJ9A 2VONA 3P9CA 2GC1A 4KMUX 2IXKA 2IW5A 1STZA 2YX7A 4QGMA 4EJOA 4G9YA 2DO7A 3QOPA 4M72A 1SEFA 3NEUA 4MGRA 3L7WA 1OYYA 3HIFA 4QGNA 2G9WA 4M9SA 5ED4A 1ODDA 4UXNA 3IBMA 1TTYA 5HVQC 4B29A 1AOYA 4B09A 1O3TA 1W5TA 4LEJA 5BV6A 2P8TA 4U7BA 1IPJA 1QXRA 2HZTA 1VR3A 2FNAA 3EDPA 3JSPA 5E18F 1B4AA 1RL3A 3OV8A 1SD6A 1TQ5A 2ADUA 2BNMA 4UVAA 1ZAOA 3ETQA 3VEPA 1LJ9A 3HUGA 3RPUA 3I5UA 1CAWB 2OPKA 2ZMEA 1F5TA 2VBZA 2OBPA 5LLQA 2RDPA 3HTSB 1R1UA 1FY7A 3BPZA 5I0UA 1EP0A 2K4JA 5HS9A 3DF8A 3PQJA 3E6CC 3V7RA 1XMKA 1DPRA 1KYZA 2GZWA 4I09A 3S2WA 4HSLA 4LA3A 5HOOA 5F1RA 1IXSB 1J75A 1K78A 3L9FA 2QCSB 3M8EA 5JI6A 2HYFA 3ABUA 1V70A 2W24A 5CVVA 5JFRA 4HBNA 4WZCA 1I27A 2CWEA 3F8CA 3TQNA 2UZKA 2L4MA 2CQKA 1FLIA 2M1BA 4IESA 3I59B 4E2QA 2FMYA 1BIAA 4XFIA 2M30A 2BV6A 4I98B 5CVIA 5EEGA 3FXUA 4BNCA 4HV6A 1TBXA 4JTOA 1Z6RA 1O3RA 1T98A 1SD4A 5E1XA 5D6EA 1FZPB 3TDUC 3WTSC 1R36A 4LJZF 1BC7C 4KICA 4IHTA
chains in the Genus database with same CATH superfamily
1WJBA 3H9AA 1WMXA 4BPZA 4IUGA 2IEKA 3CJIA 5GAGJ 4UUTA 1DP7P 1FI2A 3EXUA 1HV0A 1MD0A 5JLXA 2LK2A 4YZ3A 3WDWA 2KZVA 2LSOA 3ETPA 1NE6A 3U1DA 5JPNB 1UOJA 5ILSA 3RKXA 4IQ4A 4UW3A 1OCCH 4CXWA 2P3YA 3MV01 2KFDA 5LHHA 4HQEA 3KGLA 4RM3A 2W3JA 5HCAA 1VQLI 1O7FA 1PX3A 4EV0A 4UF0B 2DVFA 4F91B 3ZMTA 3QPHA 2VJXA 4COUA 2YYOA 1HDPA 1W9TA 4IV1C 1TEIA 2YFUA 4MNUA 5JR2A 1H8VA 3HBLA 4M3DA 3RI8A 3ULQB 4KMFA 2HS5A 3EHKA 4YFKF 1KQRA 1NK2P 3K75B 2NNYA 1ZYRF 2QUFA 2CU5A 3AP5A 3JRGA 3MUZ1 2VTXA 3WNOA 3SYTA 3RRDA 3NL1A 4U2AA 1FYKA 1O7LA 1JHFA 2GAUA 3AVRA 4A4AA 1FOD3 4CCMA 4QPIA 1W8TA 2RJKA 1WGXA 2OUHA 4PHZA 4K21A 2HYGD 4E7LA 2K86A 4IRGA 1PHMA 1J2XA 2KZGA 1QPMA 1VZ0A 2HQAA 3JW4A 4FPJA 1DQ2A 1JOBA 4R9AA 1O5LA 2BDRA 3OSDA 5F9TA 1JYVA 2Y9ZA 1D5VA 4HETA 5F6LB 3MI8A 2M7BA 5BYNA 2HVQA 4HNUA 3NKTA 2E7TA 4CDWB 1WCDJ 1STMA 2A6WA 3K1MA 3OGGA 2BUKA 1FATA 4DB5A 3BQZA 3VBRC 4CDXA 2FMDA 4HMZA 2AENA 4QDSA 3CC2I 2P5BA 3VV1A 5GTHC 1VBC2 3F8BA 4KGQA 3GUDA 4KWUA 5A3NA 3I0TA 5F0CA 3JRFA 1LOFC 5FZDA 4OYUA 1ULPA 2HU9A 1V00A 5IT6A 5LGUA 2LBFA 4IE6A 1XYNA 4ZZLA 5AIPA 2NNNA 1QJZA 4PLMA 5A3OA 1MBJA 3K69A 2DUPA 1Y9MA 4C9YA 2BGOA 4KU7A 3DKXA 2W08A 2PHRA 5A7QA 1SBEA 2TRTA 5A7NA 3IH3A 1K5JA 2OV7A 4LBQD 3W2VA 1MZEA 2GN7A 1JT0A 1BJAA 1JHHA 3OD0A 3GCWA 4U36A 3V4GA 5GLUA 1WH5A 1X1BA 5GAHJ 3F9KA 2QQWA 4LITA 2W92A 1CGPA 3RQ4A 5IVJA 1Y1VJ 4BIFA 1T6GC 1N1VA 3GFMA 1IG3A 3CUOA 3RWNA 4ENMA 3BC8A 4BY7J 4XKCA 5IYYA 2IS1A 4L9TA 1WSUA 3H8UA 1I3HA 5AC92 3UKVA 2WZPP 2BHZA 3MIHA 3IC7A 1LHNA 3WNNA 3ZCOA 1TZLA 3PUFA 1NCQA 2DCTA 2AEYA 1QH7A 2FRHA 1W8WA 2JDYA 2VMFA 5FB2A 1ZVFA 2GIVA 4YRVA 3NAPA 1E5IA 2KQRA 2LF7A 3ABLH 1J58A 3A01A 1I5ZA 2O1QA 2MG4A 3WQ1A 5DDJ3 3ZQGA 5IVFA 4QX1A 3RZKA 3INAA 5FYIA 4UHTA 4PZJA 3V8JA 5FIXA 3H92A 5CG9A 1WI3A 4Q27A 5FZ4A 2JG8A 2P0WA 1FT9A 3C7HA 4P08A 4WXCA 5C4XJ 4B4RA 1V6MA 1JHNA 1KXGA 3OYDA 2ETHA 3OUIA 3CMYA 5DM7F 1T56A 1T6SA 4EEFG 3FMRA 4KIFA 5TJJA 3IRQA 4QU1A 2NPIA 3H9GA 5IY5H 2ACJA 1P7IA 3NV4A 2CYYA 1SFNA 3HQXA 1RKTA 2QVOA 2BYVE 4H2AA 2EICA 4B7KA 1VMFA 1BW5A 3HXLA 2WZR3 5HDKA 4GKYA 1WZ2A 4QX2A 4CU7A 1UU5A 2V6EA 3S1NJ 2VBBA 1BJQA 1JW6A 2SBAA 3M7GA 2A70A 3RZMA 4A69C 1AR83 1QOTA 4HVRA 4CCEA 3H3VK 3HHGA 2J1UA 3VKNA 4YVSC 2FNPA 4DRVA 2VZQA 1WLCA 1WFXA 2V9KA 3SDGA 2GQQA 2FEZA 2Y0MA 3I7DA 1I1GA 2NZ9A 1KGSA 5F39A 1OCTC 4EWAA 1W6NA 4DYCA 1FTTA 1H2MA 5A1LA 4BA6A 1LENA 2ISYA 1ZBA2 4K2EA 1BR2A 1W6MB 4IW3A 3WNPA 2HWD2 3WQ0A 4N53C 3IZOA 2X10A 5B2GB 1O6UA 2E26A 3CP2A 1LDDA 1JUMA 1PMIA 4E7JA 4NIHA 2HWE1 1AXZA 1WWXA 4OWRB 1LUJB 2VXZA 1S6LA 1RIOH 5FKCA 2YU1A 3DBLB 1HSJA 4M00A 1KU7A 5E8IA 2GP3A 3H35A 4N43C 3E97A 3SDBA 3QBQA 3KYLA 3F6OA 2P4EA 5A6XA 3FFQA 3BDDA 1V9U2 1G7YA 3CEWA 4R8HA 3B9IA 2X1DA 3K4DA 5GADJ 3WHTA 1EJ9A 4UI9L 4IV3A 1GANA 5EQUA 5DDGA 2IXCA 4IV1A 3VBFA 3FL7A 3TGNA 5LY1A 4GB32 1JZ4A 2R0QC 1H0BA 1OVPA 4RS5C 1GBGA 1RITA 5HLHA 3EYPA 1XQNA 1HRV3 2R30A 2EAKA 2DFBA 1ACIA 3SZTA 3JRCA 2V26A 4GXOA 2R7WA 4Y5Z0 3C3VA 2EV5A 3ZQCA 3AAFA 1O8SA 2ZGPA 1H9GA 3FMGA 4GULA 5FP8A 3G73A 2HWE2 1TW2A 1OPCA 2EWNA 3MFAA 2X0LA 1MNMC 3M2MA 2P4WA 2A05A 5FPVA 1G6NA 3U1KA 5EDNA 1VBE2 4RAZA 2IAIA 3WUCA 5GJ6A 1IN8A 1GZWB 2J1EA 3CF6E 1JOJA 3H42B 4YVWC 3I53A 3RI4A 1V9U3 4N0BA 2OXBA 3NWSA 3H1CA 1OQEA 3OF1A 2WAEA 1V6IA 4A3KJ 3OPTA 2FBIA 3APBA 4DQAA 3VYSB 4KG8A 1S0DA 1R1A1 1D0ZA 2XOMA 2JD4A 2KIUA 3HNBM 5L3FA 3SZGA 3AZVA 4BQXA 4JHZA 3OYWB 4EN8B 3X29B 4PDWB 2PEXA 2A3WA 2NVYJ 4QHZA 1C8M3 4ZH4F 2JG9C 2CAVA 5ICGA 4Y52J 2VI6A 1LKXA 3F8NA 4FXGB 1RUF1 3UJQA 2FDIA 2DA6A 3SNMA 2X6WA 5EPAA 4KN4X 1OLRA 2E2IJ 2QSHX 3HBKA 3GJBA 4NIGA 3B6CA 4CZCA 4E70A 3S17J 5FMDA 4QM8A 3ZQLA 3H1MA 2XB0X 4AVVA 2E71A 3N3HA 3PIJA 1S4CA 3ITQA 2DMPA 1G8WA 4HG6B 3HGYA 3JD72 5M5WJ 3UJOA 4AR2A 5FYVA 4BHPA 2RNJA 4OLLA 4FHTA 4LLLA 2O14A 3GF2A 1CAXB 1EV11 1AR91 3HGGA 4UUSA 3RNSA 3OIOA 4CTEA 1KITA 3M1HA 3OCPA 5F5QA 5J47A 3K10A 4MIMA 4RAYA 1RUH2 2RV9A 4E6KG 5CEHA 1R5GA 2ZO4A 4TYSA 2Q4SA 2FCTA 2OW4A 1IPSA 5GKAC 3QPSA 1JZ7A 1ODNA 2YZ4A 1W03A 4K9SA 3FBIB 1A78A 3UGGA 1HCRA 5FXVA 1NA1B 3TO7A 1I5PA 4YW4A 1X3UA 3CMGA 4E4ZA 4TTGA 2VMEA 1FOXA 3IUOA 3Q3SA 5A33A 1WCSA 1Z0XA 3AFKA 3PJQA 3UETA 3P9KA 2PAMA 4AD9A 2PHTA 3KV9A 4TN7A 1E5HA 2ZHMA 1VQ5I 1EF4A 2UU8A 5CNAA 2HNHA 3JUUA 3ABKH 4COVA 2XSDC 2KL4A 3MN2A 2J1VA 3N7KA 2J7MA 3VDDA 4CDXB 4BZ4A 2DFHA 4XFHA 3VYTB 3WNKA 2GSYA 1WA6X 2BGCA 3VB9A 3KEQA 1QJY1 5IHRA 3N7LA 5GLZA 2DA1A 3U10A 5C5UA 3AG4H 3ZFFB 1D4M2 1OFNA 5LEKA 4JGYA 1QU0A 3BTJA 3K4MA 3T8TA 2NAZA 1UYZA 3WF1A 3D0SA 1E5SA 4YNIA 2VCCA 4GB31 1RIRA 1J1LA 1OISA 2JTVA 5FREA 4B4QA 3I2OA 5D5VB 1VBE1 5T5OA 3GFLA 1HQLA 1WCKA 2J5PA 4BXXJ 2RGVA 3I3MA 1U5IA 2BQPA 1HKTA 5J1XA 5E3LA 3LAPA 5J1RA 4BE3A 2M3AA 3OIQA 1D0YA 4LK0F 4XUTA 3BUCA 3ACIA 1W0PA 3GJAA 1IN6A 4A3XA 1GFF2 3PDQA 2JN6A 1QJY2 2A6YA 1DGRN 3VBOA 2V6CA 5HS7A 4JZRA 1YO5C 4CSWA 4BXFA 5F6FA 5LBFA 3FHAA 3LA7A 4AFAA 2PMZA 3V7CA 4HLTA 4LLOA 4XCBA 5ANNA 3ZXKA 5L7OA 2DU1A 3CO7C 2WA3A 4ONUA 4MHGA 2VZRA 3CLOA 3RSNA 1ZZ6A 5GM0A 4YLZA 1OCOH 5FYYA 2VZUA 1BI3A 3Q8AA 1OR7C 1AWCA 5A3LA 3WNXA 2IP2A 4NHYA 4LMYA 1OA3A 2DT6A 1S7OA 4L97A 2ZZQA 2RDNA 3R4DB 1Z3XA 2FXAA 4YG3A 2OCEA 3JQWA 3FMQA 3G1MA 2XWBB 1SANA 2G7HA 3A0KA 3RMXA 1W8FA 4XYXA 4GYGA 2QYOA 1GZCA 1X8MA 1TWCJ 1XPWA 1CF7A 3WLUA 2VUCA 1XB4A 2H8WA 4UWDA 5EFUA 2R0HA 2I5UA 1XE7A 3ZYIB 3PNVA 1I1EA 1X3WB 4NVPA 4PDWA 3VDBA 3VSKA 2Y60A 2XF7A 3PIGA 2BE5F 1GWKA 3PIPF 5F5AA 4AGGA 4ETSA 3FXLA 3O0VA 4NC8A 3A2KA 2E60A 3OYAA 4LQRA 3ZN5A 1UHMA 2K3FA 2EIGA 4LKSA 1FV2A 1AR62 1AR92 1OH4A 2DV9A 3GTLJ 3M8FA 2P6TA 4BIOA 4CA0A 3GZUC 2P1BA 1XX5A 1AR71 4CU6A 5ERIA 4HOBA 1ZA7A 4XEZA 3ZIWA 3WTVC 3FBYA 3W6VA 4IHVA 3HOYJ 5KR7A 4BXSV 4UW5A 2JPBA 1SVOA 2VBDA 1J84A 4GCVA 1IS5A 2RS52 1TMF2 5E16A 4OIQF 3GALA 5H20A 1ZZCA 4XJ8A 2AQEA 2V72A 1G9DA 2BNNA 3HB9A 4EN9B 3GLXA 3ZR8X 4MH0E 1PDNC 1R1A3 3QP6A 4OIRF 4RB3C 4AF9A 3H0DA 4Q0UA 1FPN3 3OOPA 3BGAA 5FZ8A 5DV5A 1UD1A 1UPSA 1TWAJ 5HI0A 2HWF3 5IYCJ 1AKHB 2XLGA 1DYPA 1U5TB 1LOCA 2Z99A 3MPBA 1JYCA 1SD5A 4EMSA 4HVQA 1FPN2 4JKMA 1NXD1 4HSRA 5FZMA 2GXGA 4XLHA 3CJIC 3EYIA 3N4MA 2XONA 4Q4X1 3NQHA 2L9SA 1HC8A 1PGW1 1VBA1 2ZX4A 1WJ5A 4LT5A 1XE0A 1W6QA 4W6YA 5H2FC 5FJ8J 1RUG1 1X4OA 2W5FA 2GMMA 4D6SA 3ST7A 4BUPA 2WUHA 5FMCA 4CDUC 3ZFGA 4LBOA 3JBG1 1ON1A 2VMIA 1PO21 3S14J 1W1WE 1QJX3 2Z69A 3LIHA 3S57A 4XLAA 3BPSA 4O6JA 3F95A 2Q1ZB 3PO2J 4C2TA 3S15J 3HRMA 3SKVA 2F6CA 4Q4X3 2VQLA 3WG3A 3CO6C 3H3UA 3GWZA 1ZK8A 5CLSA 1EV12 1LTEA 3Q0WA 5E8GA 1ZR4A 1EPZA 1G4DA 2MC4A 4QPQA 1CF7B 3AG2H 2OVUA 1KQ9A 2PAKA 4BLJA 2GA1A 4EYUA 2ES3A 4R9CA 1FPN1 2VBPA 1PYVA 4XBFA 1JTXA 3HOWJ 2NRAC 5H9PA 4OQ9A 4XRMA 3DTKA 1TNTA 4EM1A 4FPEA 3OJBA 3THDA 1HN1A 4OIOF 4LR4A 3HC7A 4CP9B 3HWJA 5F0HA 1HB2A 2OUJA 2HVSA 4KBZA 3N36A 2HKXA 3WNMA 4JGZB 1LNWA 4LBKA 1IN5A 2MD5A 2PMUA 4LHKA 2Y6FA 2AXLA 3TW6A 1SLAA 2ZNYA 3T8RA 2DMQA 3RYRA 5DZGA 2P5LC 1PM4A 4JQRA 3OEAA 1IQDC 4QX3A 4XRSG 1QZZA 3B6AA 1QIQA 5CBLA 3O8HA 2DT5A 1K42A 1AU7A 5HXVA 1ULEA 2WNOA 1ZRRA 1S0JA 2YC2A 1U5TC 4DXTA 1ENRA 2GALA 3FM3A 2STTA 1GOHA 2LRPA 1E0EA 1Z1DA 1W8UA 1SAXA 2XPWA 4Y22A 3CDZB 1SMYF 1ZG1A 1RINA 3PMEA 5DCMA 2WN2A 4Z2WA 4ZDLA 4NC6A 3LAJA 4Q4V2 2CWMA 4XACA 4AEJA 4XRSA 1C3HA 2A07F 2JJ6A 3D6EA 5LBCA 1DP0A 2MABA 1OCRH 3C7GA 1ETOA 3LA2A 5J3LA 1W05A 3IAS2 5FPZA 4MUVA 5BNOB 2V1NA 5FKOA 5BMZA 2E1NA 3AZXA 4FXKB 5C70A 3TP3A 1GOGA 3VGIA 3V7SA 1J3RA 2QQLA 4IDZA 3B3QE 3J7LA 2DXIA 4G12A 4BLIA 4XKWA 2ZHNA 3BTLA 4M4PA 2XB5A 4JGYB 3ZMSA 2QKMB 2X8KA 3JD73 5B1AH 2Y69H 1OD5A 1X19A 5DABA 3S2HJ 4XFCA 1W28A 2OC6A 2WQ4A 1ZBE3 4MGIE 1NY72 3ZYJB 2XASA 4JTNA 4NHLA 3TNQA 3A23A 4AFCA 2VR4A 4BMEA 4H55A 5HCFA 2D6LX 4CGZA 5HBAA 2K40A 3T1BA 2WADA 2W52A 3BPVA 1TWGJ 1WJAA 3AMNA 4OMDA 1ZLJA 4MTDA 2WY7Q 2L01A 1HQCA 1EY2A 1QQP1 3BR1A 5FZ9A 3CF5F 3ASOH 3BI3A 2AEZA 5DQ0A 3WHUA 3HSRA 2PLV3 4ZYHA 1J83A 1QZYA 1W2UA 3DBRB 2ARAA 2BW8A 3RZHA 1JKPC 2D6PA 1JUIA 4FE4A 1BA5A 2H27A 1ETQA 1AUYA 4NOTA 1VAVA 3TYJA 1ETVA 2TEPA 2ELHA 2A69F 2IVIB 2DJIA 2OCCH 3E6MA 3T4HB 3WTYC 1MQTC 1MNDA 5JVTA 5LW9A 5A7WB 2X85A 4Y1ZA 4WM8A 1FBUA 2BP6A 2E6VA 4YG2F 5H9RA 3BJOA 1CQ9A 1KDKA 3ESWB 2ET7A 3AFHA 3S7IA 1R1TA 3F6VA 2JIGA 1SLLA 1PZ7A 5DUWA 5F37A 2JB4A 1A8MA 4H3WA 2CHHA 2EK5A 2VN2A 4DY5A 2A1XA 4FETA 2I2SA 3HJRA 3O3KA 1OHFA 3WF2A 5LEJA 4E4HA 1K6OA 4EJUA 1BW6A 1TME3 2XF6A 3H5RA 1RYYA 1DLCA 1GMMA 2DCJA 1RGSA 4D0PA 1UX6A 1GT0C 3Q8CA 3KB5A 3ZIXA 1A5JA 3I4PA 4Q4W2 2RR13 2UXXA 3PURA 3ENRA 2F4PA 2VUJA 1YW7A 2O8XA 4YW2A 1AR72 5FZ7A 3AZWA 4Y5TA 1ZRCA 2H8RA 3K1NA 4ASNA 3F8FA 3RZOJ 1AJOA 2BWAA 3H3ZA 3ZSEA 1JZ8A 1K79A 2JXAA 1PJRA 1H89C 3ILNA 5D8AB 2HQNA 2E1MB 1B1BA 2P17A 2QCOA 5M0TA 1U6GA 4NUBA 1EUTA 4X0GA 1WI9A 1AZDA 2VZOA 4CUBA 3SHRA 5FZ1A 4RGKA 3PFIA 2K02A 3QODA 1SPPA 4OI1A 4MO7A 1K78B 1MH3A 4FQGA 5I0DA 2ZGNA 4IGPA 1QQP3 2VW1A 1CPNA 4HKWA 1KRIA 2E31A 2LR8A 2WZR1 2P3KA 1QPIA 2E5ZA 4IRIA 3AFGA 4N9IA 3E1SA 4LTAA 4XLPF 2NS7A 2GH8A 3KPHA 2QENA 1OCZH 3ES4A 3VZLA 2RR12 1V54H 1QF3A 5E3MA 3IRRA 2B9UA 3ES1A 2LFBA 2LW8A 1ENSA 2M2EA 3BYWA 1NXMA 5IOYA 3THCA 4ESJA 5LWBA 1DGWA 1E5RA 1SFYA 4ZONA 3I97A 4LHSA 4MGYE 2WBMA 2NYYA 4AFBA 4IEVA 4B1LA 4II3A 3OYJA 1IXCA 5L3GA 1ALYA 2L54A 3EPZA 4YW6A 4GZ9A 2JA8J 3BZCA 3DKYA 3C1DA 4JCKA 3VBOB 1K4SA 4HF1A 2R5ZB 4YW3A 4KWJA 1HKQA 1YRNA 1S0IA 4AEKA 1FEXA 1A04A 2PN6A 3CP8A 2DFCA 4CCNA 2O8QA 4M74A 5FOBB 3AX4A 4C0HA 4YVWA 4RFRB 2D6NA 1I1SA 3QU6A 5A32A 5CPRB 4BQ5A 3L2WA 2ARCA 5LA0A 2EZKA 1A6QA 4B48A 3FK7A 2XVLA 5K0UB 3V0AA 3K77A 4RAFA 3K70C 2IT0A 1UMZA 1W3VA 3F2ZA 5TRDA 2PAEA 3F23A 4DUVA 1PO23 3SEZA 4BXUA 2JG9B 2AQFA 1RHI1 2EIMH 1MVEA 4A5NA 4LIUA 2VOWA 3POYA 4AVCA 2PX9A 4LLNA 2ZGTA 2XJTA 2M4KA 1REDA 2CYFA 1GVJA 5JWPA 1CJPA 3RYKA 4W97A 1I6HJ 3MO4A 4FBFA 2P37A 4ISQA 1Z0HA 3KEYA 1JYTA 4XJWA 2XGCA 1T8IA 3BTIA 4AQ2A 5D8LB 5CVUA 1W9FA 1R71A 1DP3A 1RMU2 2CW0F 1GQGA 1LOAA 5C7GA 5C4WB 2PTMA 4XFAA 3E5XA 3WW4A 4C1XA 4IEXA 5L3DA 4I3PA 4PI2A 5A7WA 3W5NA 4HONA 2OPWA 3FHZA 4LBMA 3D0JA 4H7LA 3S1RJ 2RJ2A 2F4LA 2QQJA 2RQPA 4Q47A 1RUC3 4EWEA 1UO9A 3QYBA 3DEWA 4PBOA 3PTYA 1ETKA 2VXRA 4QM9A 1FMD3 4ZYGA 4DUWA 2CV6A 3L2YA 4QQPA 1PVC2 3TEYA 3SFZA 2LY9A 2CO5A 1YX5A 1GHCA 3K51A 2VJIA 4ZDPA 4DS0A 1MVQA 3I9V2 4XAEA 3VBSB 1Q3EA 3DKQA 3S1QJ 3ZYGA 4DY3A 1BBT1 3THPA 2YV8A 4XF3A 2ECBA 1YYVA 4OAZA 5C3SA 3R05A 4KIBA 1GP6A 2EINH 2BW3B 2NVXJ 4RS5B 5F3CA 5K5OA 1QJEA 4DZJA 1RUJ1 2D1HA 4X8NA 3EUHA 3K70D 4IE0A 1NCQB 4OHWA 3F72A 1PX4A 4BACA 2QE3A 2EZLA 2AH2A 3FF5A 4CDUA 4C2MJ 4IGQA 5EZWA 4ASKA 1BN5A 4UV9A 2EFPA 2XAUA 1EAH3 2RKHA 4A3EJ 3WW1A 1PO11 3FM5A 2A71A 4QD2A 4IPAA 3LAGA 1IS6A 5FY5A 4OUEA 1ZGAA 2JECA 4I2OA 1TLHB 2BRTA 2VQ0A 4ITVA 2HWC1 3P9CA 3ZKUA 1ULFA 3GBGA 2IW5A 4QGMA 2RS51 4M72A 5AC93 2G9WA 2D6OX 1ODDA 3M8JA 2PELA 2V5DA 3USUB 2VU9A 5HVQC 4YFZA 4CDQB 1UOGA 4G4FA 4JHTA 1O3TA 5IP7J 1W5TA 4CUAA 5DM6F 2P8TA 1QXRA 4Q5OA 2W48A 2KR2A 2FNAA 2IS4A 3ZR5A 3OV8A 1SD6A 1W2NA 1VQPI 1OUXA 4E8DA 3ZXSA 3HUGA 1CESA 1CAWB 5IATA 4YVSB 3AKRA 5FZKA 2WB1N 1F5TA 2GM4A 4DXSA 1UYXA 2RM22 1JJ6C 2F4OB 4YM2A 3BPZA 5I0UA 1YIPA 1EP0A 4MHUA 2K4JA 1XNKA 3PQJA 3Q8EA 3O1MA 4KQ7A 2GZWA 4QHOA 1ACCA 5HXMA 4P9JA 4RHV1 5JXGA 2J1SA 1VBD3 2LD5A 2GIZA 1K78A 2ZC2A 2BXYA 4CU8A 4Y20A 3M8EA 4ZY9A 3S1MJ 2DUOA 1V70A 5ACA1 3A4UA 4WZCA 1I27A 2Q8EA 1T6BX 2Z4FA 2HWC3 1CJDA 2MW8A 1FLIA 4AGRA 4PFPA 3RJ2X 1RVF3 5L7OC 1S0CA 2E19A 1GSLA 5CVIA 3FXUA 1W5CC 3ZXGA 3J7YJ 1T98A 4LO8A 1HRV2 1BCXA 5JHFA 5D2AA 4JP0A 3CCSI 4LJZF 4M01A 5IJRA 4D3WA 5CG8A 2ME6A 1YFYA 2YY1A 1QJFA 3A7QA 1S5LC 3C8XA 1IRGA 4Y22B 3VBUA 1YTYA 2VG9A 5GZGA 4PK4A 3RIRA 2XGEA 3J7ZI 4FASD 4U0YA 3WTWC 5J8FA 3RGBA 5CKQA 2KA3A 3ZSLA 3FXQA 4ENKA 4GJYA 2G19A 2KT0A 5DPNA 4J00A 1MSEC 1MBHA 4QXBA 5H9SA 5BNNB 2WZEA 2VPLA 3BVCA 4UF0A 2F48A 1H88C 3HBZA 4LLFA 3M3CA 4DO0A 3OOXA 4C3IJ 3WINE 4AI2A 2Y26A 2B8MA 3QWLA 4BQAA 4KDPA 6PAXA 4FPFA 2PN5A 4YW1A 2L4AA 4QPOA 3NO8A 5L3CA 2DFEA 5JMOA 2FA5A 2WQ8A 5H6RA 3TDZC 3GHNA 1ND3C 3HOBA 4XDOA 2L5QA 3ZN4A 4S04A 3FISA 4AFMA 4YZ5A 4LG3A 1MNEA 3ZMZA 2JQ7A 3B7MA 5JLWA 1T39A 2A5WA 5EV7A 2MSYA 2ID6A 5IT9Z 2ZFUA 2X53S 4AIJA 3JU9A 2M45A 4ASLA 4BL0B 1C8M2 4DRRA 5AIQA 1UELB 2FSWA 4FPHA 2JDNA 1H4GA 5FKNA 4M0NA 1SMVA 2COBA 1DGRA 4XMIA 2E51A 3GCXA 1XDUA 1DBNA 4CEYB 4DOUA 3FLTA 3VBHB 4XCAA 4U88A 2XKOA 4E8CA 4RGRA 1QJY3 4IETA 3SKJE 2HZDA 2VQTA 1GICA 4OCTA 2L3DA 2BWCA 1JMUB 1P4WA 3E6DA 1JODA 4UYBA 3X2QH 3KP4A 3IIIA 3KVAA 1NLRA 5F3EA 4LNVA 4BQYA 4XHBA 4WXDA 4AZZA 4A41A 3LA3A 4DNYA 2VOXA 2V9PA 2RMU2 2B45X 3CUQA 2KJBA 3IAM2 4O9GA 3UT0A 2RS13 3OYFA 4C8DA 5J09A 2CSOA 1NCRB 2PHDA 5KWRA 3ZYPA 1Q43A 4CCDA 2R043 2K0GA 4XETA 3SCHA 3G71I 2BVBA 1VNDA 5T5LA 3NRVA 1JS9A 1HV1A 4XICA 1OH3A 2DDUA 1L3LA 2ZMEB 2Z9OA 2XAFA 4FFGA 3ZQFA 2WFF3 5J37A 5FPUA 4A0ZA 1D7PM 4X1EA 1ZRIA 3WTUC 4A3DJ 3FZVA 5H6QA 3U11A 5DUXA 2XG3A 5FY8A 1S72I 4NQWB 1OQYA 2OF7A 2VO5A 3Q0UA 1BEV2 1IUYA 4M9ZA 4BQ2A 1BM9A 3DTIA 2UYBA 4CHUA 4ZYEA 5H9QA 3RPQA 2L7KA 5FRAA 1IRFA 2MC3A 2KDZA 3UR3C 4A7ZA 1HX6A 1QXPA 2VM9A 4B8EA 4D1QA 4W4ZA 3VD7A 3WV6A 3ZXLA 2A6ZA 1XCVA 1T0FC 2CV0A 3C3WA 2E32A 4PQQA 3LQQA 4QQHA 3RJRA 2ECCA 2PJPA 5KCMA 1XNTA 2JKBA 4GDFA 3ZFFC 3ECQA 1RB8G 3FK6A 4X6RB 4MXVA 3RVHA 1VRH3 1CIYA 4LBJA 1ETYA 4AOCA 2VTXJ 2X48A 2BFUS 4XTMA 1UW8A 4MQVA 4RDUA 3OS1A 5FPBA 4Q4Y2 1AYN1 1ZG3A 4L99A 3EB7A 4LIVA 2XGXA 4QT6A 4MYEA 2R7TA 3SMHA 1YE9A 2ZGSA 1LECA 2FU4A 1R091 2IA1A 4ZU4A 5EIYB 1OKQA 3SQOA 2NP0A 1S7AA 3T2OA 5LRSA 1W9SA 1WJCA 3HRTA 1Q8SA 2QFEA 1YRZA 3CHXA 5M3MJ 3KVBA 4YG0A 4IQPA 3HT1A 2QF7A 4XPVA 3KYDB 4D0QA 2ILMA 4TSVA 4G6DA 1WH7A 1CR7A 4LOSA 3AM2A 3RKWA 1LEDA 3O1SA 4HV5A 4XUNA 5JOZA 2EILH 3J8F2 2XPUA 4CDWA 3N9NA 1MPXA 3RKQA 1GV5A 3MW3A 4XQDA 3LQCA 3K6GA 4JX5A 2OIIA 1CZSA 4P00B 2OT7A 3PFYA 1N47A 5L7OB 3ZP5A 4Q4W1 4A6OA 3W2WA 3W9AA 3I49A 2WV0A 2RM21 5FJKA 1G86A 5EG0A 3B73A 3BLYA 4M3BA 3VL8A 4OHYA 5IVEA 4A5MA 3WP5A 1WGPA 5FZEA 4J19A 2HWD1 4PQ9A 3MF9A 5K7PA 3WY6A 4RHV2 2CQXA 2JA6J 1HB3A 2VODA 2X1CA 3GZEA 3OYKA 3O1UA 3LGRA 1R64A 1E57A 5F6KA 5A3UA 1XSVA 2VMDA 1MMNA 4P5HA 1ZKGA 2VE8A 2HYXA 3I2HA 5C8CC 1BKZA 3I3LA 3LSHA 4C90A 3RFRA 4B3XA 4MO3M 3OYNA 2DMUA 4BEHA 4Q1RA 4P1WA 3NJXA 4ARXA 2R6QA 3CNAA 2M87A 2OTLI 4S2GA 1QNWA 3U14A 3RZLA 2VZSA 1H8AC 3O1RA 3MV11 1ZARA 4EATA 2ZJPF 1IXRC 3PSFA 4AG4A 3ISPA 2RG4A 4QXKA 3ON7A 3S93A 1FBQA 3QH6A 4XBQA 4IQJA 5F3IA 2FBKA 3CMMA 1I9RA 1HN0A 3J7AY 1DGRM 3FN9A 4BQQA 4AVTA 2V4VA 4KITB 2EFQA 2VQCA 4I0WB 1EKEA 1AL21 1Z21A 2UXNA 4IEUA 4CDUB 3S6PA 2WO3A 5FCCA 4YVWB 2VCBA 1LODA 2A3SA 2CFXA 1MS3A 4LMFA 4V1PA 1Q8VA 2RDQA 3B01A 3CJIB 3MBWA 2LM3A 1MEC3 3ZSKA 2BBVA 2Y9YA 5SV5A 5LZ6A 4AWDA 4LBQA 1YCIA 2B63J 2DPUA 1H2LA 4SBVA 3JAMZ 1SFUA 4RS8A 3NAPC 1YJNI 3FJSA 2ZHKA 3VL9A 4A2UA 1K83J 3GMEA 2CAUA 4XR6A 1VBB3 3CDLA 2D5FA 4C91A 2FQPA 5HODA 1Q1VA 2ZGOA 2YROA 3PHMA 2OD5A 5CFCA 4A3FJ 2GP5A 3G1LA 2HH9A 4FOVA 3OBAA 1FOWA 3BR5A 3WEZA 2PFWA 2EBIA 4IEZA 2WO2A 3CJQB 4EZHA 3CCEI 5FMBA 3WE3A 3ABZA 5F04A 2Q1FA 4JRLA 3CCVI 4XVHA 5EZHA 2VASA 3M9AA 2M8EA 4P02B 5EF6A 3B9CA 3OL4A 1L7RA 1W7PD 3LEMA 1YQ5A 3P1IA 5KHGA 1EH8A 3MKYB 3IDBB 2EV6A 1RRJA 3LOCA 2K85A 2LTPA 1USTA 4ON0A 5KAFC 3DPLC 4PJLA 3VKLA 4YGEA 4YVSA 2E5NA 2HTSA 5FBZA 5J48A 4I99C 1W6PA 1ZHFA 1Y56A 2BTVC 3GXUA 2HOSA 3HD8B 2PXJA 1KONA 3UKGA 1S3JA 5F08A 5K0UC 3GW2A 2NOGA 1RR8C 1XSDA 5T50A 2V73A 2AHQA 1B72B 2Z42A 4IEJA 4UFJA 4MG2A 5JHUA 2R5ZA 3G7DA 1W6OB 3IMMA 5CFDC 4NRMA 2PJRA 5FP9A 2W84A 2XHNA 3GTKJ 3MKLA 2R7VA 1VBB2 4X6QB 1T33A 5FKMA 3N9OA 3J80K 2OKXA 5GAEJ 2LOOA 2H09A 1QNYA 5C33A 1W8NA 4UW4A 1LVAA 1MJAA 2K9NA 2ZAHA 3CJRB 3MKWB 1F4HA 1RUH1 1JN2P 2WZ8A 4TV7A 1X58A 4D8MA 4M3EA 2E7WA 2NVUB 4H7MA 5C9AA 2BPA2 5BPDA 5K5RA 4URTA 1LULA 2Y8KA 2K4BA 2LY2A 1HW2A 4JGZA 4PI0A 3SQNA 4HT1T 1YFXA 1XRUA 2R16A 2OZUA 4M3CE 1S2BA 2G7UA 3RSJA 4ZKTB 4CP2A 2QJVA 1D5YA 1U12A 5KXDA 1MS8A 1J3QA 2B0LA 1AX0A 5BUVA 1WWYA 1QGPA 4BQ1A 2RNGA 2XROA 5A2QZ 4BWOA 3QAHA 3AJZA 2Y34A 5C3PA 3IL2A 2X51A 3J81Z 5CADA 1SPPB 2BY1A 3TN93 2IUWA 4HZFA 3ZR6A 2IXHA 2QZ2A 3KP7A 1B6AA 3RTRA 5JMCA 2R7DA 3AMMA 3GTOJ 3C2UA 1ASJ1 4XABA 4C0BA 5KHKA 5HNFA 1PIV3 2OQ7A 2DUQA 2W2IA 4XN3A 3POSA 4GXLA 3MIDA 2VH9A 4QB6A 3HZJA 3HOUJ 3I2DA 1CAXA 4L9JA 3LEKA 2DMTA 4FX0A 5C3EJ 2E1MC 1RUD2 3S5AA 3VYUB 3AP7A 1RZ4A 1IGOA 4FPLA 1E17A 2AXTC 4CDXC 1FXZA 5FV3A 3KWVA 1W6NB 3NNLA 1JYNA 5K8SA 3A02A 1Y3TA 3AKQA 2ZFWA 4XHXA 2WFF2 4N43A 3GZ5A 2A3XA 4YZ1A 3T4VA 4N4OB 3WE2A 2CGPA 3GZTB 3OYHA 3H7JA 1Z67A 2QSGX 2Y0OA 3QU3A 1GUIA 1T2XA 4IV3C 4QSHA 1UXXX 1EH6A 4E2GA 3SITA 1H2KA 5LATA 3ML6A 1W2OA 2CMPA 2JG9A 4D7TA 5JDBA 3VBFC 3WDXA 4ZHNA 4RB1A 1SQ4A 1MS5A 3GXOA 1GV2A 1LFUP 5CQEA 3LPFA 1XU2A 1BXHA 5LBQA 4PJYA 4FPKA 1ND2A 1GKBA 2O61A 3TB0A 3HVDA 3TO9A 4QDQA 4BISA 1O59A 3CF2A 1XNBA 2EXJA 3WCSA 3M3YJ 2J1TA 2XAGA 1RUNA 1K5MB 3AP9A 2NMNA 3OYLA 5CKMA 2ETEA 4FAHA 3ZN1A 2EB7A 3U2RA 2J5OA 5LGNA 3OR1C 1ZR2A 1KD7A 2NS0A 4QWQA 2IFWA 1UFMA 1JTZX 3H50A 2W1OA 3DV8A 2A3YA 1V55H 3LKJA 4MOAA 1HIXA 4ENJA 1GNHA 1YWKA 4K1YA 4L8QA 1T2KA 3VZJA 3CTAA 5FXWA 3HSEA 5J4VA 1FNZA 4XQFA 2P6CA 1HXDA 3MW2A 3AYEA 5A2QK 1BL0A 4Q4W3 1VAKA 5K5QA 3KEOA 1G9BA 1FP1D 5EZGA 3A22A 5GLVA 5A7OA 2JZYA 1UMHA 2KDOA 2K9MA 4R4XA 3KZYA 3K4KA 1RUC2 5CZKA 4LG0A 1UY1A 4AL9A 1YIOA 2QQKA 1AR61 1X1DA 3IKTA 1SFXA 3MLLA 1JZ2A 3CQZJ 2WWYA 3S3NA 4IHWA 4QMAA 1K6YA 4WM7B 2AGSA 1YYNA 5DTDA 4B1RA 1C57A 2VCAA 1GXPA 1R1ZA 1AYN3 2EXIA 2HWB3 3A03A 3NNGA 2HPIA 3L2CA 3C7JA 3BODA 1FC3A 3U21A 3CBNA 4A6EA 2AC1A 2D93A 2DYRH 2PLV1 2DMNA 4A3CJ 5LB6A 4HX7A 1VE0A 4K20A 4XF9A 4Q4V3 2IC1A 3GX4X 5D5UB 2JICA 4NWVA 3RWKX 2DYCA 2OJED 2E7QA 5JSRA 1TMF3 1XMAA 4XKBA 4ZU7A 2GDFA 1JKQC 1W39A 3WX5A 4HKOA 4Y7NJ 4IJAA 4E7ZA 4ZTJA 1VAMA 1MMDA 3ZXFA 3HSFA 1ITYA 1Z78A 4NPRA 2PQQA 5IK8A 4NPLA 3KP3A 1JUSA 5DN2A 4MGKE 1W04A 1RC6A 2RDSA 4Z8BA 2WFPA 3IM0A 1D1CA 4BHBA 4S2HA 3KCYA 4IF4A 3POWA 3WXPA 5T52A 4N53A 1W8ZA 4AI8A 1XPXA 4LUMA 2E2JJ 2P81A 3A01B 1F31A 2JB8A 1SVMA 1FMD2 3HKZA 1IC8A 4PIZA 3POJA 2RS53 1L3JA 4AEDC 3Q5FA 1LR5A 1OKOA 2WT2A 1LGCA 3PUAA 4CP9A 5FFXA 4BK4A 2VKDA 1FYLA 2DK8A 2A7AA 3LEGA 1OR7A 5GLWA 1CAWA 3CZ6A 4F92B 3KV4A 2VC0A 2XBO2 1Y0UA 3ZFEC 4BJTA 3GCMA 1W0NA 4KL1A 2EXHA 2IA2A 1B8IA 4U7DA 4NJ4A 4H4KC 1YHQI 3ALQA 4MX3A 3LL7A 4RGUA 4RLQA 3NW4A 3BR0A 4PT6A 4AW7A 3V8KA 1MW7A 1BI0A 1EAH2 1NA1A 1NYWA 1DHKB 3AK0A 4HANA 3BIEA 2R1BA 1R092 4UVCA 4DFSA 3KETA 3U0ZA 3DEUA 5FQ0B 1P92A 5FYCA 1M1EB 2LROA 3DPUA 4HDUA 2DDBA 2SLIA 5M5XJ 3ZKYA 4LORA 4IX7A 3I55I 1K5MA 1U5XA 5CYYA 4XIOA 2PA7A 4Q4V1 2DODA 5DAPA 4P9XA 3H9QA 2CGNA 4EWDA 4LO6B 2E7AA 3DCFA 2DVDA 2D40A 1RUE2 4HA8A 3GYHX 4GMP3 3WT3A 4O5VA 2DCYA 3WGHA 4NAOA 3R0AA 2LKPA 2KPMA 3I4MJ 1PNGA 5FYHA 4XUPA 4LPLA 1QNTA 3ACFA 2M7AA 3ERED 5I8TA 5IAXA 2JE8A 3VDXA 2TUNA 5IVCA 1VTNC 2VUAA 1V6LA 1QJU2 3O1PA 2B9VA 2BOIA 2M0MA 2LKSA 3D5RC 2Y6LA 2JDMA 4KNYA 3GYDA 5ILUA 2VVFA 2QQVA 4XSXF 2QQAA 3PVEA 2CJJA 3CMAI 1R7JA 1Y39A 2R073 2HEWF 4KIGA 4UFMA 3N7JA 3W5MA 2QQIA 2CS3A 1YFHA 2JPCA 2RJLA 1V5EA 1V4RA 4CA9A 1ND2C 2CW8A 1MKMA 3WHBA 3O14A 1JYXA 2F4IA 1YRNB 1MBFA 2ISZA 2VZTA 1BZWA 2W82A 2XR4A 2WNVB 1N3QA 2YBKA 1D0HA 5IP9J 2ZSHB 1SEUA 3GO5A 1G9FA 1YJ9I 5IAVA 1B35B 4LULA 2P5KA 1N1SA 2VBXA 2G4IA 1HJGA 1AXYA 1WRJA 1YW9A 1TW3A 4XW3A 2FD8A 2IXLA 2JRTA 3RYPA 4BU2A 2R7RA 1S0BA 2KIFA 2ZGUA 1VI0A 1R5HA 1WCQA 3DLLF 1SHWB 2X05A 3JRDA 2RMU1 1YOVB 5GPCA 5HNHA 1G3YA 4HSTA 4FQ4A 1YC61 2JJ7A 2BOLA 4YRDA 4BDYA 2XLAA 5FK7A 5KHDA 4BH9A 4BBRJ 1XDSA 4XAAA 1RXFA 2W94A 4O9EA 5ICFA 4L9BA 2BHYA 2F4MB 1N78A 1GWMA 4XFGA 4CCLA 2W4SA 1Z05A 2MH9A 1L7QA 4A42A 2XIGA 2XAJA 3USUA 3CCQI 2B7EA 1ON2A 3WP3A 4XBLA 2IGKA 3AL0B 1XSXA 4L11A 3RPUD 4CDWC 1MBEA 1Z91A 4W6XA 3O12A 3VDAA 1OUSA 1X1CA 2ZKZA 1RUF3 1QOSA 2WNVA 2XRNA 4IEOA 1Z7LA 4UB8C 1EH7A 2OAZA 2TNFA 4RSUA 5GZDA 2O5RA 3I3EA 1QMJA 5FY1A 4PJNA 2Y38A 3ZO0B 1RUD1 4BQ4A 2L9NA 2VXJA 3LFUA 5FO5A 4IKFA 5C3QA 1PMHX 2IGNA 5FPXA 3FWEA 2I8DA 4RQPA 1Q8QA 2C5DA 2PMHA 1HKDA 2ZKNA 1AHSA 3ZDSA 2BW3A 1ULCA 2F5VA 2KRCA 1EAH1 4LXLA 5IVBA 2GNBA 2E33A 1S7EA 4YEJA 2RS12 4A7KA 3BTZA 1W3XA 4IOCF 4NQWA 2VVDA 3KF5A 3MMYB 5K7FA 3AG1H 4HF2A 5FZOA 1LKNA 1V3FA 2UY9A 1JGSA 4YW7A 3KCCA 3B69A 3SH4A 2TDXA 1PMJX 2DWRA 1RMU1 4IE7A 3ATGA 1HJFA 4E4DX 1V6OA 2D3RA 3KS7A 2BV4A 4QHBA 5I8YA 2GU9A 3HRUA 4AEDA 2WA0A 1SFOJ 4AEDB 5BQTA 5C3RA 4IOAF 1Z3YA 3PUHA 4BM8A 1K3IA 3OR2C 1FMD1 1FOYA 1U8RA 2DF7A 2QQNA 1J59A 4QQ2A 3MZYA 1QHGA 4MQ9F 3LF7A 1GZWA 1U5ZA 3ME2A 1ETXA 1LOGA 3BOPA 3EQLF 4Q0PA 4MLOA 5JXHA 3IH4A 1NQDA 4FP3A 3ZXJA 1Z7S2 3FKJA 1BR4A 2L2OA 1PZ9A 4GMP0 1YIJI 2C4XA 4MSVA 5DUIA 1PP7U 1NA1C 4HL0A 3IPVA 2F6BA 1WD4A 4BBSJ 5A6ZA 5L3EA 1MH4A 2HWF1 4QPIC 5DD8A 2WAOA 2Q0OA 2W7NA 3WF0A 2UV1A 1VRH1 2CL2A 4OZXA 2KLOA 2LYCA 3HPHA 3WODF 4AHYA 1PGL2 4FX4A 4ITCA 2BOJA 2ESHA 1GQPA 4OVEA 1HB4A 2GBYA 2WNUC 1PO12 3D82A 1Y1WJ 4L0YB 4OOIA 4HN1A 2OPTA 3AP6A 4CXYA 4LGWA 3HEFA 1IRXA 1SBFA 3KMHA 1Y8QB 3HG9A 4J1WA 3CJNA 1PUEE 1LOEA 3TEDA 4QPGA 1E3PA 5D4SA 3S7EA 2VC1A 2IFRA 2LREA 5SV8A 2PI0A 3JTHA 3KYCB 3IKVA 3N97A 2JEMA 4QPYA 2YU2A 1XNCA 3PNYA 4BYYA 2BY0A 3U1XA 3GTPJ 3MZ8A 2PQ8A 5F64A 1UZYA 1B8IB 4DZGA 4FT8A 3PVOA 5J7MA 3LDBA 1WW7A 3IAPA 2O6GE 4FFHA 2ZTNA 3BTCA 2EZIA 1UCXA 4L5JA 1QVUA 2DBIA 1YHFA 5I0RA 3NARA 5DZEA 2NYXA 1HDKA 2A6XA 5EP9A 1YUDA 4Q0QA 4UBHA 1S55A 2W0XA 1W0TA 4XXAA 3NV1A 3RS6A 2DQRA 2EH3A 1REFA 4AYBA 4AEMA 2WLPA 4UB6C 2A68F 4ZYDA 2RDRA 2MEV1 3MYXA 4OI0A 2XUBA 2YX4A 2RAEA 4LHNA 3IH2A 2PHXA 2WAFA 3DBHB 3ZPOA 5C3OA 4LK7A 4P96A 3N05A 1CX1A 3WGGA 1UIKA 4BAYA 5HV4A 1R00A 3IT8A 2HDWA 5DAQA 2FOWA 4META 1UB9A 3U4SA 3J9SA 4AM3A 4XF4A 4EE2A 1XGOA 4EN7B 1MACA 5E1RA 1QVTA 1UZZA 1UZ0A 4I30A 4KWLA 1KA8A 4D5FA 4QPIB 4KG0A 4UBGA 1NE4A 4PLOA 4XTPA 3CESA 2XGDA 5J98B 3UGFA 5HLTA 4KMQA 3J8F1 3K4LA 4KN7X 3CJTB 2FDGA 1OCPA 1YLLA 3VBFB 3ZMOA 3ZMDA 3LFKA 2W1SA 5JZGB 1OKRA 2MLKA 3H1YA 4DQ2A 4PJJA 3HOSA 2GNDA 4DGWB 2VZPA 4YGBA 4L92A 3ZMNA 3EETA 2HVRA 5A7PA 1MJ9A 3U9GA 2IXSA 2O9LA 4B3NA 1GVDA 1H8TC 3NJVA 2D97A 2M34A 4LHLA 4F8AA 1YJLA 3BCBA 4RR3C 2BBYA 4CYCB 4ZZDA 5IUQA 4DYQA 1WHUA 4MGQA 4ZS2A 5JXIA 4E7IA 1STZA 4B1MA 3CCMI 4G9YA 4NHXA 3NEUA 2VLAA 3FBMA 4M9SA 3IBMA 4WM8B 3CDIA 4B29A 3OPZA 3QD6A 3G2BA 2DVGA 2KISA 4N4NB 1AOYA 4B09A 2WNVC 3AYAA 4LEJA 5BV6A 1TME1 2JMWA 1VR3A 3JSPA 1TVGA 4A3MJ 2YC0A 1B4AA 1QQP2 1TQ5A 5FO9B 1GNZA 3DEMA 3HJEA 1OC1A 4C30A 4RL7A 5IYBJ 3OY8B 2OBPA 2AUYA 3NNMA 3BTYA 3HTSB 1UAAA 2ZXIA 1CWPA 3DF8A 3HNMA 4ZJZA 1DPRA 3C2HA 4I09A 3CZJA 4RMNA 4LA3A 1OPMA 3M8LA 1BEV3 2QCSB 2HEVF 1JOPA 2HYFA 1I50J 4Y1XA 3TRSB 3OSGA 2ZA9A 3VBUB 5JFRA 4M3GA 5IVYA 2CWEA 3F8CA 1ULOA 3TQNA 2DVBA 2UZKA 2L4MA 3BG3A 2M1BA 4HOOA 4E2QA 2CGOA 3QPLA 2FMYA 1BIAA 2M30A 5FKBA 4I98B 3D4KA 1TBXA 4JTOA 3DU5A 1U9NA 3QOEA 1Z6RA 1O3RA 2WNEA 4FVVA 1SD4A 3BQYA 3CMEI 3GZAA 1F15A 5HCHA 2FDHA 3N7MA 1GWLA 1BC7C 4KICA 2WABA 1XXNA 4NC7A 2DBBA 4HRIA 2JG8B 5J40A 2VT3A 1DYOA 4HF0A 4P9GA 2UURA 3ZX7A 3OBTA 2YC4A 1FBSA 2RC4A 5I0TA 2UYAA 4QTRA 1LJ7A 2FQ4A 1AR73 4YM1A 1WUVA 3GEZA 3D8CA 4XJ9A 5FYTA 1SVLA 2QBYB 1AYM3 4AVZA 3BB6A 2KIQA 1ASJ3 4XN0A 1VPHA 2JD9A 2R4GA 3EUHC 1QJU3 4N7UA 4NIIA 2ZEWA 5LA2A 3HM5A 3DYOA 4QWNA 2ID3A 2GXAA 1BJZA 5DDJ2 3QCWA 1MBGA 3ROUA 1YQAA 4AVAA 3KLNA 2WNUA 4WM8C 2LTNA 2HWF2 1X50A 1VQKI 4QPGB 3ZM8A 4XXPA 1HW5A 4Z1VA 1Q8OA 2PJRB 2JUCA 4HSJA 1B59A 1OSGA 2W87A 4YFWA 2ZGMA 3VZMA 4HQMA 3WD5A 2WWUA 4XLEA 2DA4A 3HKZN 1BI2A 2E53A 4QKFA 3AG3H 2E1OA 3J7MA 2NLRA 4Y1UA 2ORZA 2EAAA 2FE3A 5T5JA 5B5EC 1SBDA 5IW0A 1V0AA 5FLHA 1EPWA 3P6BA 2JENA 1LEBA 2HBUA 5DD4A 3WQBA 1F43A 3HL2A 2VJ4A 1APNA 4ARYA 2GXBA 5IVVA 2YPRA 1ZGWA 4P9FA 1BLZA 1U5YA 5K7ZA 3HOZJ 3AC0A 3VD4A 3J80Z 2IXJA 1XE8A 4HLXA 2PHWA 2D1VA 5FPLA 4I6ZA 4E27A 2HJIA 4HPQA 2YGLA 4EM0B 1S0FA 3GZ6A 4IEQA 3LSDA 1TMF1 1OYWA 1DGLA 1JYWA 2OUMA 3PU3A 3Q9OA 5KNLA 4FCAA 1WW4A 1YQ8A 1FMVA 3GTGJ 3ZFGB 2RM23 1X9TA 5A70A 1UY4A 1O5UA 2CQNA 3KT7A 2XVCA 4AI9A 1LEAA 1H30A 4OHVA 1PGW2 1VBA2 4ZS3A 4EJWA 4CXFA 4E4SA 4E2SA 4B3AA 2XUEA 3H5NA 3MDPA 1TWFJ 3C7EA 4L9VA 1B9NA 2D7FA 3AMPA 4D6QA 2E36A 5A6QA 5J36A 4LKDA 2XF5A 1RXGA 3JRAA 3BKZA 5BY5A 1VMJA 3PNTA 4UFLA 1UZCA 1UQXA 5A3TA 1RUOA 2GMPA 3ZFEA 2J1RA 4P9LA 3Q9VA 4QXHA 2NVTJ 2YUEA 1LHUA 1WJFA 4A12A 1X3ZB 1Z7S1 2EJRA 2BVLA 4G3YC 2WLQA 1GU3A 2YS9A 1X2MA 3WOGA 2JUGA 3WU0A 1RUE1 1W2AX 3SXYA 3MIGA 5KHHA 4Z07A 3P5BA 3ABMH 3OYCA 1N25A 1KFXL 2F17A 2D6KA 2VOPA 1XSRA 4HK9A 4LE3A 2VOTA 1H1AA 3ASNH 4Q4Y1 1SMTA 2OQGA 5F8PA 3WUDA 3WDVA 1DPUA 1MMSA 2R5YA 3M7AA 2X9DA 3AJYA 2ZGKA 3DP7A 3GTMJ 2WKKA 4Q0SA 2ZEXA 4CEWA 4CUGA 3OSFA 4EROA 4I0BA 1D4M3 1GZTA 1Y7BA 4YM0A 5BPIA 2NN8A 5LA1A 4JX4A 4BJ0A 4J6GA 2D98A 5CVJA 1LE8B 2WS91 2YDEA 3REOA 2Q8DA 4XQ4A 1CQTA 5D4RA 5IK5A 1POGA 2P5VA 4EN6B 4I01A 4P5YA 5FZBA 1LRHA 2NQYA 3J4UH 5FWJA 4XIKA 4AIHA 2JDKA 3WQ7A 2H1KA 2BNOA 1NZIA 2Q0AA 4NNJA 2ORXA 4XE9A 4MGTA 4COZA 1OOPB 2WWJA 3GZNB 3ZGKA 2LF8A 1VFCA 1PVXA 1FSEA 2VUDA 3MUY1 2KM2A 1QA6A 5E17F 5FZ6A 4AK3A 2WO1A 3DEEA 1UCRA 3AZYA 2L7FP 4AU7A 2L02A 1QXJA 3OGVA 2HEOA 1H0MA 2HKOA 3LB9A 3ZSJA 2N7GA 4IE4A 1Z9CA 4L2NA 3M1CA 2DA2A 1DGWY 5E88A 1K4TA 2XJVA 4WZFA 1JYIA 3DUIA 4F3QA 2LALA 3BG6A 1AR82 2EIBA 3E6BA 2ZX0A 4YIRX 1QGLA 3I4IA 1RJ8A 1AHDP 1AXKA 3V0BA 2L0KA 4CCCA 4HFSA 5A3MA 1IDYA 2WDBA 4WM7C 2XUMA 3K4BA 4U0VA 3PJRA 2HWVA 4QX0A 1ND3A 2X1EA 5I91A 4RB2C 4AGVA 1J3PA 4NB5A 4W65A 2YPDA 1BK0A 1L0OC 2JDUA 3PIOF 1X1AA 4X6AJ 4O65A 3ZOBA 2YBSA 2EIJH 2XJRA 1ZZ8A 2WWSA 1QO0D 3OYEA 3A0BC 3UNPA 2OX0A 2AO9A 1R9TJ 1DIWA 3FMSA 2C9AA 1W99A 4UFHA 4CPBA 4RB0A 5HLGA 1VQ6I 3T0BA 2FCVA 1IS3A 3IHUA 1I6XA 4GJZA 3K3NA 3T0DA 4RGGA 1QOOA 1BHGA 1VJ2A 1UMIA 3VB2A 3CC7I 2G1MA 3D3AA 2PQSA 3PL0A 4LB5A 1SLBA 4ZU5A 1OBNA 3QQAA 2P3JA 3ZFFA 4V2VA 4AAPA 5ABJC 1DDNA 2ZGLA 4GB33 2H6CA 1YJWI 3AL0C 1JZ6A 4MFEA 2QEXI 2QQ9A 3VYRB 4JOMA 1ZQ3P 2VBWA 1RVF1 3DPRB 5CFDB 3VDDB 4JX0A 3K4AA 2HTJA 1OQ1A 1J5YA 3L2RA 3MAJA 4BHCA 3NV3A 4JKLA 5FGMA 2DI3A 2FMLA 1K61A 1Y9GA 2QQOA 3MZHA 5JIUA 3KQRA 1S2EA 4PSWA 1COV3 5FO7B 2VOKA 4RR3A 3T1LA 1UKRA 2IGOA 1DQUA 1F5JA 5FQ0A 3ZPLA 1ZTRA 4PUSA 4HKLA 3ZSMA 4IV3B 3WVJA 1XGMA 4G8XA 3VBHA 1ZBE1 5FO8B 3URFA 1RUD3 4Z82A 2HDCA 1UU4A 4EGZA 2WS92 4WVMB 5F5CA 3MQ0A 2VIXA 1NLQA 5HS8A 3JRHA 1HDDC 4MXWB 1UHWA 4ZDOA 1TQIA 4CCOA 2ZACA 4A0YA 2M5WA 5FLXK 1R58A 5J6XA 3MVPA 3J8F3 3MEPA 2B5HA 2JT1A 4ES8A 4BE0A 1IHMA 1BI1A 4C1WA 3DPTA 1PK6A 3PMSA 2W1WA 2VE1A 2PMZN 3ACHA 4WV8A 1AYM2 4RBOA 1ND2B 1DQ4A 3ACLA 2F5EA 1Q5OA 1ZM1A 2ZMNA 2QQBA 3NMBA 2VKVA 5KK1A 3PSIA 2ADDA 4WF2A 4OI2A 1OI6A 2NM1A 2R1DA 4S0HB 2V1UA 3B02A 2H6BA 1QEXA 5JR3A 4N9HA 1QU3A 1DG6A 3O7OA 1HA8A 1OT5A 3C2GA 3V8LA 5ILVA 1R22A 2ZBJA 3DKWA 1W2TA 1NG6A 5A80A 1YFWA 4GH4C 4WWCA 1RUJ3 3PLQA 4QB2A 5G05L 3J81K 3S32A 1NCRA 4GKXA 1UL9A 1TQMA 3BIWE 2YBPA 4QX7A 1XMXA 4A93J 4DYRA 2HDDA 3ERMA 1OYIA 2HFHA 2ZSIB 4R79A 3TN91 2GA2A 2LRDA 2HOTA 3HDDA 4PLNA 1US2A 2YR2A 1COV1 1DLLA 3KGZA 4CEYA 4WCGA 4D94A 1BEV1 3ZXEA 1BBT2 4BGDA 3N35A 4R52A 1P9QC 4G7OF 3P5JA 5J3UA 4WX9A 1DUXC 3CCUI 1JBCA 5AONA 2K9QA 2R7EB 3VD3A 1LCLA 3T30A 2DA7A 3L09A 1IV6A 1OF3A 1BIBA 4HPKA 5F27A 3V56A 5FYBA 5DZFA 5D8KB 1RUC1 1WQ2A 3SISA 1W90A 3K1PA 3KLOA 2AREA 1PM7A 3JBG2 2O7OA 1CONA 1R4MB 5F7UA 3KHCA 3DPRA 3O0WA 3VKOA 4B47A 2ZB9A 3LSTA 1UN1A 2XWJB 2LG4A 3HQRA 4AXOA 2W9XA 4A3JJ 2HYKA 3IP4B 2QUOA 1SG3A 4XURA 2G9ZA 4QAWA 3WW2A 4LO4B 1WMFA 3NJYA 1JU3A 2JRMA 4Y24A 4COWA 4G9SB 1X8EA 2VL8A 5EJ3A 2Q30A 4MVTA 4IERA 1FYUA 2IZWA 3OG2A 3OWTA 4BCUA 1JT6A 3S2DJ 3CL1A 4XOGA 5CYVA 1XSQA 5B4XA 4HXCA 4ASMB 4KU8A 1P6RA 2RREA 3B00A 3GBWA 1XCBA 3JXSA 1ZBE2 4XORA 2LC2A 3S30A 2W46A 1WKYA 1IAWA 1X4PA 1CZTA 1B72A 4FPGA 5FUPA 1YNAA 5CKTA 5J8CA 3GGLA 2R7UA 5IOZA 5DG1A 1RMU3 5DXDA 4I0AA 4LG0B 4GMP1 2QTWB 3JB8A 2UWAA 2IXIA 1P4XA 4CRQA 1W4MA 3ACGA 3T1MA 3OOUA 3VD5A 5L3BA 1A31A 3H0OA 3SC7X 4NHJA 5J4YA 2D44A 3BG7A 2D5HA 1IZ1A 4FQZA 4FI9A 5HCBA 2MGQA 1V6NA 1H8TA 2JWPA 4XK4A 1KU9A 2KMUA 1OMIA 1R5ID 2ENRA 1IUFA 5FD5A 4AUXA 5ICEA 1ZLKA 1UZWA 4KJZA 3K0LA 1X82A 1YI7A 3NNFA 2DT7B 5C4WC 3AXEA 2KIMA 5C9AC 1USSA 3KP6A 3Q8BA 3ECHA 4D7NA 1JXSA 4Y26A 4AQTA 4XZUG 3CUQB 3QRFF 4IHYA 3MIBA 2WYFA 2XJPA 4ZYAA 3ORJA 1I39A 2HQRA 3OUHA 3WP6A 1CZVA 2ZJCA 1H9PA 4AIDA 3OPWA 4L5EA 1H1MA 4RS5A 2L9VA 1XD7A 2VPRA 2ZX3A 3QACA 5CAZA 5K4LA 1W8OA 5KXCA 1IRZA 1DQ5A 1RVF2 4CZSA 3O2PE 3Q0VA 1KS5A 5ERLA 4GA9A 5E8AA 3RZGA 1FX7A 3WG7H 2MPFA 1MDMA 1ERDA<