1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
3HRSA 2ETHA 1DGWA 3DV8A 3DF8A 5IT9K 2Q8KA 2D93A 5K5QA 1RUOA 2HJIA 4R52A 3MFKA 1JGSA 5T3NA 2QBYB 2XV4S 4KL1A 1ZYRF 3I71A 2F5CA 2PYTA 3WTUC 5HS7A 2VONA 2HTSA 4MTDA 5BS6A 2Y48A 3HSRA 1P92A 1ZZ8A 1LDDA 1ZX5A 2D1VA 3S2WA 4XETA 1LVAA 2XUBA 3IIAA 3QP6A 5LHGA 2JTVA 2UWMA 1SD6A 1WLTA 4MHGA 1BBYA 3PLQA 3EDPA 5KBFA 3I4PA 3L9FA 4MEYF 4AVCA 4MGYE 4XFBA 1GQHA 5D4RA 2W57A 4DNCA 4D7SA 2D5FA 2IXIA 1CAVB 4XFHA 2FNAA 3CLOA 3FFQA 3RNSA 3C1DA 3LWFA 1XCVA 4E2GA 2PI0A 3V7CA 4L5IA 1UIKA 2M45A 3LA7A 5CJ9A 2QZ8A 1XN7A 4YNIA 1UCXA 4XFFA 5HDNA 5BXXA 5D4SA 4G8XA 1USTA 5ED4A 2YSRA 1PDNC 1FYKA 2W24A 4KA4A 2KXLA 2OZUA 2QQ9A 1SMYF 4LG0B 4UV8A 4FAGA 4L9VA 2HWVA 4L18B 2OD5A 4PIZA 3ERED 1FNNA 4XFCA 5K8SA 2G9WA 1SAXA 3HOSA 3DXJF 5LHIA 5LHHA 4HSLA 3T1BA 2V9VA 3MQ0A 1UPIA 1W7PB 2STTA 4WCGA 4QGLA 4MV2A 4O6JA 3SCGA 4G7OF 5DCFA 3L7WA 3HHHA 2CW0F 4HBLA 2G7HA 2MBFA 1WKMA 4XLPF 4PIYA 4MTEA 3IKVA 4UXNA 3HSEA 1D5VA 2L4MA 1R23A 4IF4A 1KYZA 4HMZA 5CVVA 5K1YA 2ZNYA 4XRFA 3UKTA 1YLFA 5DYMA 4ENJA 3RI4A 3CUQC 5CVUA 2QNKA 2RKHA 1WQ2A 2PG4A 5BY5A 1IN4A 4IRHA 3E6CC 3BPXA 4EJVA 2D5HA 1VTNC 5EFUA 2MH2A 4H0EA 1BI1A 5HLHA 4LB5A 2XAGA 3U0ZA 5CADA 2VQAA 5HDKA 3NW4A 4G6DA 2GH2A 2NNYA 1YO5C 3K69A 2ET1A 2PQ8A 4LLGF 5AONA 3ZMUA 2XROA 4EQQA 5HLIA 1V70A 4KIFA 4ETSA 2X0LA 2DU9A 4LTAA 2OPKA 4XF0A 5ILUA 3H7JA 3KSCA 3WW2A 2OYZA 4B8XA 2DAOA 4ZH4F 1HKSA 2PQQA 5J8CA 4JV4A 2Y0OA 4FX0A 4U7DA 1ODDA 2K0GA 4IEQA 4IEOA 2OQRA 3U10A 2XLFA 1TNTA 3ZMSA 4AQ2A 2BEOA 3PFIA 4E2QA 4EWEA 4HQMA 3G73A 2P5KA 4LA2A 2O1QA 2M87A 3F8MA 4IEXA 5ILVA 1TLHB 4U0VA 3M9AA 4O9EA 3GO5A 1J75A 3EJKA 3LAGA 3GW2A 4LLNA 3O6BB 2B5HA 4Z07A 3SMHA 3ABUA 4AIJA 1XB4A 2BYVE 2KIFA 3D5LA 1UHWA 2X4HA 3GX4X 1STZA 1T98A 2F5FA 1WGPA 4NVPA 3HTUA 4RS8A 2CWEA 3TO6A 1SD5A 3DFGA 3OCPA 4Q0PA 2MD5A 5LRRA 2PMHA 1HBXG 3KEQA 1XGOA 3HIFA 2MLGA 4UVCA 2VPVA 3MEXA 3LFKA 3HHGA 3EYIA 5FCCA 3WTYC 1OYWA 1NE6A 2HKOA 3L2HA 4ZU4A 1G3YA 2IA1A 2RDPA 3E5UA 1QPMA 3ZP5A 2B0LA 1S3JA 3B73A 3HOTA 2ZO4A 2Q0OA 4NQWA 1HKQA 1IXCA 4P9UA 4I09A 1UW8A 4LEJA 5I8YA 3HYIA 1R58A 3BPZA 2A69F 5JSRA 3UKVA 1I27A 3VHRA 3F72A 3QAHA 2IPQX 4PDKA 4KU8A 5CVIA 3GXOA 1R7JA 1ZH5A 2JT1A 3WTZA 2PFWA 4GCVA 2ZJ2A 5EEGA 1EV7A 2UY8A 2IA0A 1LEAA 1R1VA 3NVCA 1ZRFA 3QPHA 2IW5A 1U6GA 1FYLA 1ZG3A 3ZMZA 3GZ6A 1GXPA 6PAXA 1ZAOA 2FBHA 5F64A 3BZ6A 3O3KA 1O3SA 2XLGA 2GC2A 2LF7A 3E97A 2Z33A 5LRSA 5FDBA 5BPDA 2GQQA 4KWLA 3Q9VA 4IEPA 4A0XA 3SHFA 5EEHA 1YQAA 3VODA 1FP2A 4HF0A 4KUMA 3IDBB 1H9TA 3FHIB 2EAAA 2DTRA 2KJCA 3QACA 2CYYA 3T8RA 1I1SA 3CL1A 4G94A 4UVAA 4J1XA 4LJZF 4A0YA 1OD5A 5E1XA 2M8EA 3DEUA 3RDIA 4K8FA 4A5NA 4MZUA 1V4RA 4RGXA 4GGGA 4MNUA 4IEZA 1RGSA 4RD7A 3DPTA 2VBYA 2VXZA 4B09A 3L09A 4HSJA 3DKWA 4LFUA 4L9JA 3FM5A 4R8HA 4WK8F 2FRHA 2Z5UA 4Q29A 5FD5A 1QQIA 3QU6A 3JTGA 4BHPA 1ZREA 1IPJA 4QM8A 5D5WB 1CAUB 4JVAA 2ATFA 1W4MA 3IL2A 3JSPA 4OIPF 3E6MA 1NYWA 3M3IA 3WGIA 5BQTA 3WE3A 3FMRA 4BQAA 2UY9A 3RPQA 5FQ0B 2EB7A 2BNMA 5L3FA 4OU0A 2XL7A 3BP8A 2UXNA 3T0YA 3ZQ7A 2QDRA 5TJJA 3CTAA 5D8KB 2K4BA 2CGPA 1KU2A 2XLAA 5CVJA 4QMAA 1ZVFA 4OINF 1GVJA 3H3UA 3QP5A 1YWKA 2LSOA 1J5YA 4A0ZA 2VT2A 2A6HF 1T38A 1LRHA 4AVAA 1P6RA 4LGWA 4RGRA 3I59A 3H1MA 2O8XA 4QWQA 2PBIA 3D0JA 4L11A 4LMYA 1YLLA 1DUXC 2O03A 5BUVA 4UBHA 4META 5I0SA 2HS5A 1IAWA 3VEPA 5JCTA 4ZYHA 4Q4ZF 1KQ9A 3R0JA 4FX4A 1WWXA 2FBKA 4AIKA 4MX3A 5ICEA 1T6SA 5E17F 1IW7F 1FX7A 3V7SA 2WWYA 3TGNA 5I93A 5I91A 3ELNA 1B6AA 1ZN2A 4YSFA 3FM3A 1I1GA 4A6DA 3PVBB 2LDUA 2YR2A 5LEJA 1ZG5A 2K27A 4OIRF 1YFUA 2H27A 1ZZ7A 2GXGA 2PEXA 4EVIA 4HVRA 1ZNPA 4IETA 1IXRC 1ZZBA 3LWCA 4Q0QA 2E7WA 1KQ0A 3WTTC 1B9MA 3OGJA 3MAJA 5E1ZB 3H1YA 4I3PA 4XF1A 5FLJA 5JR3A 1QXJA 4IEWA 3BJ6A 2IA2A 3WW4A 2MPFA 3BROA 1ZRDA 1SD7A 2DPUA 3C18A 3V4GA 2IVMA 2EFOA 2F4PA 2CSOA 4N9HA 1ONVA 3MYXA 3DL3A 2Q2EA 4UHTA 5FFXA 5E8IA 1ZRCA 1QWRA 2ZBKA 4I01A 3OV8A 2NNNA 3MZHA 2ZXJA 2XGXA 3ROUA 1JUHA 4M72A 2M30A 5J8FA 1QBJA 2STWA 4ZYDA 1OYIA 4MGKE 5KHIA 3KLOA 2W84A 4M9XA 2DK5A 3M7GA 3LSTA 2IT0A 3R0AA 4GYIA 2OQGA 4M74A 2YX4A 3P9KA 2QM3A 1OPCA 2KRFA 5FLXK 4OIQF 2ELHA 1NZCA 3ML6A 2ZFWA 1NHAA 2Z3YA 3DQVC 3TQNA 4LULA 3CLPA 1KU7A 3Q5FA 4M6YA 2H09A 2BNOA 2M5WA 3SFZA 3FWEA 1E2XA 1PMIA 3WE2A 3CUQA 4L0YB 4JK1X 4CICA 2HTJA 2FE3A 1J59A 4GXOA 5HOOA 4EJTA 4KN7X 3H9AA 3OTFA 4ESBA 3E6DA 3M8FA 4L0ZB 2K9ZA 4PIXA 2QQBA 2JPBA 3KZZA 2EFQA 3H3ZA 3E5XA 1EH7A 2GWRA 3GZ5A 4IJAA 2UYAA 3RKYA 2FEZA 4H7LA 4O9GA 3K0LA 2P4WA 2YPRA 1J3RA 2A07F 1ZZ6A 2PAMA 4OFGA 1R1UA 2XRNA 3J80K 2ISZA 1XDSA 4QXKA 3RJPA 3CO2A 3HTSB 3GF2A 2GAUA 2O0YA 2XVCA 4GYGA 2CAUA 4MGRA 3GUDA 4RAYA 1YIOA 1Z05A 2ET7A 3I59B 2EFNA 4LD5A 3EQEA 4HX4A 4XF3A 3LQRA 2GA2A 2QVOA 2VODA 3VB2A 4UNOA 5DCMA 4CO8A 4M71A 1U3EM 2L01A 1LEBA 2P17A 2VBZA 4DQ2A 4WWCA 3J7AO 3KCCA 1IPKA 4ENMA 4LUMA 2B9UA 2AS5F 1H9GA 1R5HA 2KJBA 5J48A 1L0OC 2J5OA 2PFBA 3TKYA 1FSEA 5D5XB 5I8TA 3HT2A 4ZZDA 1Z6RA 1IRGA 1DDNA 1SFNA 3SCHA 3WGHA 4KN4X 3SHRA 3CJXA 4EMSA 1DZTA 2VOOA 1HSJA 1UCRA 2A3SA 1P4WA 3USSA 2F5EA 2TDXA 3FE5A 4LK1F 4CYDA 4HV5A 5D5VB 4HQEA 1FSHA 1X8EA 2GZWA 4IPAA 3RPUA 4XLNF 1LR5A 2LKPA 1ZZCA 2PN6A 2V09A 5I0UA 2KIUA 2EWNA 2EV6A 2H6BA 3BWGA 4NHJA 2H0VA 2K86A 1YW8A 1OKRA 3FMQA 3FXUA 4JQFA 4DINB 1KYWA 2LF8A 4LB6B 1TQMA 3ABTA 3OF1A 3GVAA 3MCZA 4AXOA 3WU0A 3N97A 2ZKZA 3F6OA 1O57A 3JAMK 5H20A 1CAUA 3KP7A 3GEZA 3TDZC 3LQQA 1J3PA 4CGZA 2EK5A 4WBBA 3SQNA 2XKPA 1HQCA 2FF4A 3J81K 3CDHA 2C0ZA 4S05A 1XDUA 4O3MA 3ISPA 4KMUX 1VR3A 4IHSA 2JRTA 4E2SA 1F9NA 4R79A 4JTNA 2D40A 4I7HA 2HR3A 2E7XA 1BI2A 2CV6A 2GXBA 3IWFA 4A5MA 5HLGA 1U2WA 3P7NA 4U0WA 4EJOA 1F1ZA 2EJRA 4BYYA 4P5OA 3NSTA 1TBXA 4X6QB 5D6EA 5FLIA 1O4TA 4Z82A 1HKTA 3U2RA 1YS6A 4HYEA 1AWCA 1CAWB 4IRGA 1CGPA 1ON1A 4FAHA 2WC2A 4P9FA 2XKOA 2IXLA 1EH8A 4KICA 2ZMEA 3ZMTA 5KK1A 5LEKA 1BOAA 1RIOH 4YIIA 4XEZA 3H8UA 2I45A 3IRRA 2HQRA 5DUKA 1FBQA 4HF2A 2CG4A 1FI2A 2XHKA 2HKXA 1D8JA 3G7DA 3KE2A 1NXMA 2Z69A 1XGNA 1V3FA 4Y17A 1O3TA 3D0SA 1ZLJA 3QPTA 4J1WA 5KHJA 1WI9A 1O3QA 4I2OA 4KWKA 2PHLA 2D1HA 3WTXC 4EV0A 2MC3A 3RTRA 1ZRRA 3FXRA 2DI3A 2G7UA 3OOPA 1Y9QA 3IRQA 4YG2F 2Z9OA 3GFMA 1L3JA 3JAMZ 3LOIA 3U11A 5JSOA 2FXAA 1TW2A 1X82A 1FBUA 1IN6A 2WFPA 5D1IA 3RYRA 4WXCA 2GC0A 4RB3C 4A6EA 5D8LB 3F8CA 5C8WA 2PMUA 4TV7A 1FWZA 4KDPA 1MJAA 2OBPA 4I0AA 2Q0AA 4PGGA 3K1NA 1U5TB 2DO7A 1DPUA 1RUNA 4ON0A 5D6FA 3W6JB 3IKTA 3V8KA 4UVBA 4I02A 4IVNA 1B59A 2CFXA 3CO6C 1DZRA 1O5LA 2O61A 5HI0A 2R7FA 3KGZA 1IN7A 2V6CA 3NRVA 2ZCWA 1BM9A 2IJLA 5HS8A 1YFYA 4KMFA 2F5DA 1CX4A 3ACLA 1G4DA 2IXCA 4Q0UA 1QZYA 3I5UA 4QGNA 4EJWA 5AIQA 4CZZA 2EA2A 3FZVA 5ERIA 4ESFA 5FLHA 4M73A 4XBFA 2HEOA 4M9ZA 4E70A 1HW5A 4A12A 4MQVA 1MGTA 5BPXA 3NEUA 1JXSA 1MKMA 4MQ9F 4HX7A 3EQLF 2A6EF 1YFHA 1FBSA 5HVQC 3K2ZA 1JE8A 4RB2C 2HYFA 1BI0A 4OMYA 5BMZA 3TDUC 3KMHA 1FYMA 3EYYA 1CAXB 1T0FA 5FGMA 3JW4A 3IWZA 3E6BA 3NKTA 3BJAA 4U88A 3WGGA 2NRAC 3U9GA 1K78A 4EM2A 1QZZA 2OU2A 1Q3EA 2Q30A 4FHTA 4HN0A 3ECOA 4OIOF 4N0BA 1R1TA 3KLNA 2A61A 2YU3A 2OZ6A 3F8FA 1B4AA 2P6TA 2UYBA 1WRJA 2XASA 1NE4A 1ZGAA 1IN5A 1Q5OA 4RGSA 1GXQA 3WTWC 2DK8A 3FZ3A 5CU1A 3KP3A 3W6KB 4PGHA 3BJOA 3I64A 4U7BA 1XMAA 2R7DA 4L9NA 2QUFA 3FJSA 4KWJA 3JSOA 1HXDA 4QM9A 1U5TA 1U78A 2XAQA 2HOEA 2GA1A 3IDCB 4AQ6A 4QX5A 1QNTA 5FLXZ 1TTYA 2P7CB 2FMLA 4PCQA 2Z2SB 3JZVA 4UV9A 5DD8A 4HLTA 3K1PA 4HA8A 1KU3A 4Q0VA 2PAKA 1K6OA 4EROA 2FNPA 2AXLA 2QYOA 1HSTA 5HS9A 1A04A 2IP2A 4F7ZA 3R4KA 2HYGD 1C0WA 4YRDA 2IXKA 5H6RA 4XFIA 4OLLA 3ELKA 5AVPA 5DUIA 2L02A 2FA5A 2JZYA 1T39A 2L4AA 5E1RA 2WTEA 4D0PA 5E8GA 4RGUA 4HV6A 2IXHA 4ASNA 2DQRA 2PTMA 4Z2YA 4ONUA 5LLQA 3FF5A 4K2EA 1G3TA 1TNSA 2HGCA 4YFNF 3IBMA 4HLXA 1Q43A 2VBWA 4IHTA 1EP0A 2FQPA 1ZARA 1LKNA 1PP7U 3LA3A 4IESA 2HQNA 1BC7C 1P2FA 4OMZA 5IT9Z 2IC1A 4EGZA 2GU9A 1BJAA 1Z6TA 4KIBA 3GBFA 2QCSB 1REPC 3FHZA 3J81Z 3I7DA 3M8EA 1VP6A 3BOQA 5L3EA 4HAMA 3EETA 3M1EA 4AWXB 3MPBA 5L3DA 1KGSA 4LUKA 3C3VA 4HDVA 1RTVA 2QJVA 1JHFA 2H6CA 1XSXA 3K1MA 1Z7UA 4HDUA 5FPXA 1YFXA 3RZZA 4AD9A 4XF9A 3QU3A 5J7MA 2EFPA 4KFCA 1SEFA 2CQKA 1T2KA 1L3LA 2P7VB 2EV5A 1MDMB 2DPDA 3FMSA 2P5LC 3D82A 3I53A 2W25A 2FSWA 4FT8A 1Y0UA 5JSPA 3F6VA 4LG0A 2EVXA 5FQ0A 4BXUA 3GYHX 3IHUA 5HDGA 3B02A 2XIGA 5JHUA 4MGZE 4R1HA 4KYWA 2MA3A 2PJPA 4ENKA 1PM7A 4ENNA 4EM1A 3BALA 1KU9A 1OR7A 2GC3A 1O7LA 1LJ9A 3HRMA 2XAFA 4CDGA 3MZYA 2EA4A 2ZKLA 3CO7C 4G6QA 5CVRA 3TNPB 1G3WA 1YFWA 2Z99A 2BNNA 2XL9A 1OFNA 1D8KA 2HFHA 4XFAA 1CF7A 2M1BA 1F5TA 3ECHA 2B8MA 4OOIA 4ZYGA 1RI7A 3WU1B 2XAJA 3F8BA 1EPZA 4IXAA 5J3UA 4HBNA 4UXAA 1BIAA 5I8SA 5ICCA 5DEQA 5F6FA 1TW3A 4KNYA 5ICGA 3ZN1A 2K02A 4WXHA 3RKXA 3KZYA 1J0RA 1O5UA 4FBFA 4BHBA 1IXSB 2P8TA 1R36A 3M70A 2OZJA 4IEVA 1E17A 2CO5A 1AOYA 5IT3A 3FXQA 2OAZA 5E1WA 1CAXA 1ZHFA 1S7AA 3NQOA 3S7IA 1KQ8A 1OI6A 2DFIA 2CAVA 4I98B 1XGSA 3HRTA 3ZPLA 2PA7A 4G9YA 4IEYA 2KIMA 4UBGA 1U8RA 3KGLA 1H1MA 1ZG1A 5TRDA 5KVRA 5L3GA 2PLYA 4ESJA 4HVOA 1RNLA 1YG2A 1O7FA 1RZ4A 4HZFA 2DT5A 2MH9A 1Z9CA 1W5TA 2HZTA 2RV8A 1ULYA 1I6XA 1BI3A 3P9IA 2V1XA 2FQ3A 2UZKA 3RKWA 2UXXA 3QRFF 3OD0A 1SMTA 5DCMB 1BIBA 2LNBA 5E16A 1XSDA 4WF2A 3O14A 4WVZA 3UKNA 1FOKA 3KETA 2O8QA 1D3YA 1CAWA 3GYDA 4HW0A 1XGMA 5DDGA 4MH0E 1FLIA 3HRUA 2QQAA 5DV5A 4YIFA 1SQ4A 5C6CA 1FP1D 5E20A 1IZ1A 5CLSA 4RAZA 4Q47A 1LQ1A 1YYVA 1ZGJA 3WODF 4YYOA 3E5QA 1UFMA 1XRUA 3HQXA 1H1IA 2VN2A 1J2XA 4L5JA 3GFJA 3N4MA 3SCFA 1USSA 1J58A 1LNWA 5AIPA 1UB9A 2NAZA 1W7PA 4O5VA 2GC1A 4F8AA 2Y0MA 4Q0SA 4D7TA 4LK0F 5JR7B 3H92A 3H1WA 4G7ZF 4WZCA 2FOKA 4MUVA 1YW9A 4JBAA 2P5VA 5BPIA 4HF1A 4RB0A 4HOBA 2A5YB 4UUVA 4EWDA 3VOEA 3V8LA 4EGYA 3DP7A 3RYPA 2QVSB 4B29A 5L3CA 4EJUA 3WW3A 1PP8F 3PQJA 3GLXA 3ETQA 2O3FA 5KHHA 3TO9A 5I0TA 5A2QK 4KU7A 4XFGA 3P9CA 4G7HF 3RYKA 4A2UA 3I58A 4Q48A 1FT9A 5DD4A 4LLLA 1FXZA 3ES1A 3SZTA 3TNQA 3PQKA 1J1LA 5LGTA 2D45A 4CHUA 2VT3A 3GWZA 2KKOA 3WW1A 2Y75A 2RC4A 2V79A 1Y3TA 1MZBA 2BBYA 1CF7B 3SZPA 1DGRA 4Y13A 2DLLA 3O2PE 2DW4A 1F4KA 2ESHA 3FX3A 3MDPA 1KA8A 1R00A 1WSUA 1K79A 4P55A 2RN7A 4GULA 3AAFA 1MD0A 3TOBA 1UIJA 4ZZLA 3CJNA 5FB2A 2ACJA 1X8MA 2VECA 3ST7A 2K4JA 3REOA 2NYXA 1XE7A 3NJZA 5I0RA 4WX9A 3F23A 3GFIA 3BCWA 3H50A 4KIGA 2GIVA 1JHHA 3PNAA 3WTVC 2VOPA 3BU7A 3J80Z 2MNGA 4XSZF 5H6QA 3TOAA 3L2CA 1SFEA 2COMA 4X6RB 5BV6A 4LLOA 5A2QZ 1TQIA 4BIFA 5E18F 4AIHA 4Q5SF 1YHFA 1FY7A 2RNJA 2JSCA 3CUQB 2DCTA 4Y15A 4AVPA 5LGNA 4PZJA 1J3QA 4ORFA 1O3RA 3EBRA 5JFRA 1RC6A 4IRIA 3C3WA 3JTHA 2BE5F 2MLKA 4YFXF 4U0YA 2P6SA 5FD6A 2R3SA 1XCBA 3CUOA 4TLFA 1I5ZA 2EV0A 1MJ9A 1EH6A 4YFKF 2ADUA 5LBQA 3I0TA 3EUHA 4IERA 4AVBA 4HVQA 2BGCA 2F2EA 1SFUA 3HUGA 2C6YA 2FBIA 3EHKA 1EYBA 4M9SA 3KP6A 3H7YA 1FZPB 1IRFA 1GQGA 4N9IA 1LB2A 2L3DA 5FPZA 2H94A 4HLYA 5LGUA 3BB6A 1XE8A 4HX8A 4EWAA 4S04A 3ZN0A 1R22A 1W5SA 1IUYA 4BH9A 1B9NA 2ETEA 4IEUA 3S0MA 2DBBA 3F8NA 2XAHA 3V7RA 3ES4A 3CF6E 3WTSC 2QLZA 2O6GE 1MJBA 5BOXA 1S8NA 3T8TA 1Z1DA 2E1NA 2IRFG 4P9GA 3U1DA 2BV6A 1YUDA 1HW1A 1TQPA 4WXDA 3VFZA 1U5TC 1Z91A 2FMYA 3LAJA 3ZMVA 5ICFA 1S7OA 1YTYA 3ZDSA 4BAYA 3WG9A 4LA3A 3CEWA 4MGIE 2Q4SA 3MWMA 1UHMA 3V8JA 3KP2A 4BHCA 2VE8A 2QWWA 1S6LA 5J6XA 2ISYA 2RQPA 1P4XA 2DQLA 3IC7A 5F1RA 3DN7A 1OYYA 3LA2A 1K78B 1J9IA 5FFZA 4P96A 3ZMDA 3SXWA 3F3XA 3COAC 2W85A 2VE9A 4ZYEA 1ZZ9A 4M6XA 3KP5A 1QGPA 1LDJA 2ZNZA 1PUEE 5D5UB 2J5PA 5KHGA 2QBYA 2V1UA 3BPVA 2K7LA 2ESNA 2EFWA 1DPRA 5JAXA 1XSVA 2A68F 5K5RA 1YW7A 4BNCA 2N7GA 2VBXA 3NL1A 3KP4A 1GHCA 3K9TA 1LDKB 4MEXF 2NS0A 5FO5A 3I54A 5K5OA 1K7AA 3LAPA 5L3BA 1XD7A 4HN1A 5JI6A 3S7EA 1YS7A 3HSFA 4NB5A 4EM0B 1B1BA 3G3ZA 2PAEA 3ULQB 4ZU5A 4PJYA 2QENA 3SXYA 1G3SA 3KEOA 3T5XA 1BN5A 2FU4A 2Q1ZB 2HDCA 4GO1A 1FC3A 1HW2A 1R5GA 1XMKA 3BY6A 1P4AA 5KHKA 1U12A 1W7PD 1BC8C 5JVTA 4ZU7A 5ILSA 3DPLC 2L54A 1CAVA 1ZLKA 3R6SA 4RB1A 3F22A 1SD4A 1H0MA 2E9QA 1SFXA 2RGVA 2YX7A 4CXFA 1X3UA 5CYVA 4XSXF 4I0BA 1IF1A 1OMIA 4JTOA 3GFLA 3L00A 3R61A 3KFWX 1G6NA 1S29A 1ON2A 1FPQA 1QO0D 3R60A 1IN8A 4YARA 4KT5C 2VC1A 3BDDA 1MDMA 1QXRA 2V1DA 1DP7P 3LZZA 2MHFA 2OA4A 2E1CA 3HT1A 1VJ2A 1TQ5A 4XF4A 2PHDA 2ZMEB 1QY4A 3C7JA 3EO6A 5EZWA 1Q1HA 3Q9SA 3RIRA 1X7NA 1EY2A 4QGMA 3TO7A 2EA7A 3QOPA 4L2NA 4QLCU 2RVCA 1J7KA 2OA2A 2JPCA 2VC0A 2WV0A 3F21A 3E3VA 4L9TA 2IXJA 1RL3A 2D2WA 1UD1A 1WA4A
chains in the Genus database with same CATH superfamily
1DGWA 3DV8A 5IT9K 2I74A 2VQHA 1W9TA 2HJIA 5LZ6A 4YW5A 3AMNA 2BERA 2QBYB 2XV4S 4KL1A 3WTUC 4NPRA 1YRNA 5HS7A 2Q1FA 2VJIA 3OYDA 5C4XJ 5ANQA 1BA5A 1EA3A 2JE7A 2ZAAA 3J9SA 1RUI1 1P92A 1W5CC 1LDDA 3G6JB 3VKFC 2F4IA 3ON7A 4GFBA 5AVAA 4DYRA 1D5YA 1WFXA 4YGBA 2LC2A 4Q4X1 2OKXA 1UMQA 3ERMA 2LK2A 2M7BA 3A4UA 2W5FA 3QP6A 5HV0A 4NHYA 3PJYA 4MHGA 4S0HB 5IHRA 1X2MA 1KS5A 2C26A 3I4PA 5J1XA 3S3MA 1TT0A 5D4RA 2FHRA 2W57A 3OEBA 4GMP1 4TLGA 4DNCA 2NMOA 3M07A 3C2BA 4XFHA 1FMD2 3CLOA 2WAAA 3FFQA 1K42A 4HNTA 3C1DA 1H9WA 1UKRA 4XL9A 1HXS3 1XCVA 4L5IA 2M0CA 5I0DA 3LA7A 2VMIA 1XN7A 5A7WB 3CJIA 5HDNA 4WVMA 5GLUA 5BXXA 2KFDA 5IJRA 1W05A 2R061 3ZN4A 2JG9A 2WO7A 5IUQA 2ZJPF 4OVEA 1BEV2 3ETPA 4W6XA 3Q8EA 3VL9A 4GKXA 4PJJA 1K5JA 3OPZA 4XJ9A 3I3MA 1D2SA 4LG0B 4FAGA 5DM7F 4L18B 1FNNA 4HPQA 1AZDA 3OYNA 2G9WA 1MSEC 1XMXA 1SAXA 1MBGA 2F4MB 2AZ5A 1TVGA 3T1BA 1U0JA 1I3AA 2STTA 3CMGA 4JGZC 2HWF2 3UNGC 1N3OA 2X5IC 2QQUA 4JZRA 4RQPC 3G71I 3JRAA 3ZQLA 1D4M3 2CW0F 4PUSA 1RUD3 4XPVA 5FK7A 4IF4A 4ZXEA 4HMZA 5CVVA 5K1YA 4ENJA 3D4KA 2QNKA 4AEDA 2PG4A 4YFWA 5BY5A 4OHVA 4YM2A 2D5HA 1VTNC 5EFUA 2JIJA 1BI1A 4XQ4A 3U0ZA 3EUHC 4G6DA 1GOHA 2GH2A 2DTWA 2FCVA 2XROA 4EQQA 4XBQA 5A3NA 3TWIA 1MQTC 3CCSI 2DA3A 5C8CC 4ETSA 4LTAA 1JOPA 4XLEA 1ZR2A 2NLRA 2E19A 3IKWA 1K5MA 4BLIA 1IRXA 2OYZA 1WCSA 4ZH4F 1HKSA 2WZR3 4QU2A 4FE7A 3LF7A 2PQQA 4ZTJA 5J8CA 4U7DA 1ODDA 5JZGC 4IEOA 2QQNA 5CFDB 4CP2A 2WABA 4DQAA 4D94A 4IKFA 3LD8A 2R6QA 4AQ2A 4M0NA 3PFIA 4HQMA 3G73A 1W6PB 2JG9B 1VQ4I 2JDKA 3M9AA 3KT1A 1OVSA 1H1AA 3EJKA 2RG4A 3LAGA 4IL6C 2J22A 4JKMA 3B9CA 3ZXJA 4XCBA 5F3EA 1SFOJ 3ABUA 4A41A 3O1PA 2KIFA 1UHWA 1UL9A 2WAFA 5A33A 2TUNA 1QU3A 4L97A 4L8QA 2LY2A 2F5FA 1V6MA 2DJIA 3BR3A 4ZS2A 4NVPA 3WDVA 3W59A 2VBBA 2V9PA 1T0FC 2H1KA 3OBRA 1SD5A 4Q26A 3DFGA 3I56I 1EV11 2NPIA 2MD5A 4G12A 1HBXG 3HZJA 3OYGA 3HIFA 5FXVA 2KIQA 4Q4V2 5DUVA 3CMAI 1RMU2 3IDAA 4AG4A 1OYWA 2HI3A 1NE6A 2V73A 5CKQA 3L2HA 3NQHA 2FD8A 3MGUA 3X29B 1MBEA 1HB4A 1TP4A 3WHTA 3HJRA 3H9GA 1S3JA 3B73A 3KCXA 3K2AA 3S1NJ 1R58A 3M1HA 5C5TA 5JSRA 1UOBA 2PLV2 3VHRA 3F72A 2A73B 2D7FA 4JC1A 5FXXA 3MO4A 1R7JA 5DG1A 4YVWB 3GBWA 3WTZA 4QHOA 3ZOIA 2VOKA 1OH4A 4LOSA 3T0AA 5D8AA 2I5UA 1KQRA 1EV7A 2IA0A 5LA1A 1ZRFA 3A7QA 2DVAA 4FOYA 1U6GA 3INAA 5C3RA 2BV4A 5F64A 3BZ6A 4QPIA 3O3KA 5K9YA 4YFZA 2Z33A 5FDBA 2DTZA 4W8JA 3FISA 4KWLA 4RS5B 3AJZA 2DWRA 3HL2A 2PJRA 4E7KA 1V9U3 4P5HA 2YYOA 4IHVA 3AP4A 4HKOA 1OF4A 1QOSA 4COWA 2KISA 2VQCA 4QDRA 4HNVA 4UVAA 3TOJA 4J1XA 4LJZF 4A0YA 3AP6A 3APBA 1PK6A 2M8EA 4B47A 3VYUB 3RZDJ 3RDIA 4K8FA 2NS7A 1KGYA 2YU2A 4HFSA 2ID6A 3JRBA 1DU6A 1TEIA 1OOPA 3DKWA 2HOSA 4L9JA 2YDEA 4WK8F 2FRHA 2D6NA 1W0PA 5CQGA 3QU6A 3JTGA 3V0AB 1IPJA 2XF6A 1W4MA 3IL2A 4XKBA 2HWB1 4NPLA 3FBMA 3M3IA 2A3WA 2ELJA 3I2DA 2JA8J 4XBNA 3BR0A 5J96B 1W2TA 5FQ0B 2CV1A 1B35A 2K3FA 3DF0A 4I76A 1RITA 4JRAA 1DQ1A 3AZZA 2PLV3 1RUG3 4Z1VA 3UJOA 4AHZA 4LHNA 5TJJA 4CDXC 5D8KB 1GVJA 5GP9A 3QP5A 9ANTA 1G59A 1YWKA 3TEXA 1RJ8A 1T38A 2ZHLA 1HJGA 1MMAA 4LGWA 1HN1A 1PGW1 4QWQA 1D4M2 3D0JA 4Y5SA 4LMYA 4ASLA 3MUY1 3WEZA 1DUXC 5BUVA 2LROA 5I0SA 1IAWA 4ZYHA 1BW6A 5F8PA 3HOWJ 3C7EA 1WPKA 5FO8B 4GB31 2FBKA 5E17F 3V7SA 3R0RA 1GNHA 3HNMA 5I91A 5EGOB 3DBHB 4YZ2A 2D6KA 4BB3A 1ZN2A 4YSFA 3NNMA 4IV3C 1E5RA 2LDUA 2K27A 4KJZA 2GXGA 2PEXA 1OQ1A 1ZZBA 1JZ4A 1ENSA 1VQPI 2ZGUA 4PF1A 3QWLA 1KQ0A 4O65A 1B9MA 3GTPJ 1CIWA 1CPMA 2DMNA 4IEWA 4PFOA 3BJ6A 1TZLA 2IA2A 3WW4A 3BROA 1ZRDA 1CJDA 2AC1A 4MG2A 4HG2A 2C6SA 3ZXDA 1FMD1 1RUF2 1E0EA 4UFKA 1SANA 3JBG2 2XH6A 1RVF3 3N7JA 1ZQ3P 4FP3A 1W2AX 1ZRCA 4FQGA 5JDBA 4XQWA 1GFF2 2XGEA 4LLFA 3OV8A 1Y9MA 1WMFA 4YW1A 2ZXJA 4B4RA 1JUHA 2SBAA 3DBLB 2M30A 3B69A 3KVAA 1VB4A 2WBMA 5J8FA 1XNBA 5GLTA 1Q8QA 2OW4A 3V64A 3WR0A 4IE6A 2LBFA 2IGNA 1LVKA 2DFFA 4HNUA 1O59A 4NHXA 2DK5A 3M7GA 5A3TA 4FO9A 4V2WA 2OQGA 2YX4A 3HAGA 4AK3A 2BUKA 1ZGWA 1OPCA 2KRFA 2IS2A 5FLXK 1OQDA 1QEXA 3R4SA 2KDZA 1AYM2 1XYOA 5IK5A 3DQVC 4P9XA 3CLPA 5GADJ 2CGNA 2P6CA 1FV2A 3WE2A 2LY9A 1J59A 3JRIA 4GXOA 4EJTA 3H9AA 5FZ0A 2X6OA 3PHMA 4HK9A 4L0ZB 2BGPA 4U87A 4PIXA 3W9AA 3KZZA 1HRV3 2JJ7A 3E5XA 4LXLA 2CYFA 5F37A 2GWRA 4H7LA 4O9GA 3WLUA 2VMCA 4CUAA 2BW8A 2A07F 4OFGA 3RZHA 3OGVA 4BQOA 5EV7A 3ABLH 2Z4FA 2ZTNA 1XDSA 3RJPA 3GF2A 2GAUA 3HC7A 3POEA 1YOVB 3NAPA 1T8IA 4Y1XA 1RETA 4MGRA 1YIOA 2ET7A 3AG3H 3EQEA 2R32A 1XJAA 1UY1A 3POWA 5FZOA 2ZFUA 3IAM2 2CDOA 3C7FA 4LO5B 2BY0A 4E7HA 3CJRB 1V6JA 2ARCA 4M71A 1UAAA 4D5FA 1RUE1 4DQ2A 1IPKA 4ENMA 1RMU1 4FXKB 4BOWA 5IT6A 5FWEA 2BZDA 5JI9A 5CQEA 1H9GA 3WF2A 2VOWA 5SV5A 3VDDA 1W36D 3POFA 5D5XB 1IRGA 1DDNA 1SLLA 3SHRA 1W6QB 2WY8Q 3CJXA 2VOOA 2RR11 1RPWA 1UCRA 4BIOA 3DYMA 2A3SA 1ASJ2 2MW8A 4LBJA 2V6EA 1BCXA 1QU0A 1QA6A 2RS33 5D5VB 4HQEA 3OL3A 1QHGA 1HJFA 2EV6A 3VZKA 3ONQA 2ZJRF 2H6BA 4DNYA 4CCCA 1TQMA 5B1AH 2VVEA 4ASKA 2DA6A 4TN7A 3N97A 3K4NA 1X4OA 3KP7A 1DYPA 2XOMA 1DGWX 1QJY3 1QXPA 1NKGA 4B4PA 1QH6A 3SQNA 3PMEA 5F0HA 2XKPA 2FF4A 3J81K 1C1LA 4S05A 1XDUA 4BK4A 4OHWA 2G9FA 4BWOA 5FPLA 4PFPA 4L9BA 3WCSA 4XIOA 2CV6A 1OQYA 2ZJQF 2L9NA 5J47A 4S2DA 1FOD2 3ZSEA 2W46A 3NV1A 1RUG1 2A3XA 4BYYA 4P5OA 4BBSJ 4BU2A 1G86A 1TBXA 1LNSA 5D6EA 4N43B 1I3QJ 2R072 4E7SA 2VUMJ 4CDWA 4Z6YA 3W21A 1AYN3 5FXZA 4PHZA 3PM1A 1O4TA 4NHMA 5C4WC 3U2RA 1AWCA 1CGPA 1OHFA 4N7UA 2ZMEA 2QFEA 5KK1A 1AR83 4KBZA 1BOAA 2HQRA 3ZXFA 4N7IA 2CG4A 4XAAA 4RLQA 2COBA 1V3FA 4NDLA 2XGCA 1W6QA 2CQ7A 3I2JA 5C8CA 3MBWA 4LKFA 1LU2A 3O12A 3T0BA 4KWKA 3SDBA 2D1HA 2DA4A 4EV0A 2M34A 1LHWA 3JCUC 3OBTA 3FXRA 2DI3A 1AR63 2W9XA 1N78A 2DODA 2WB1N 2Z9OA 3K4DA 2DCEA 3OYCA 4KISA 1HRI2 1O4ZA 3LOIA 5BNQA 1OCRH 4QQOA 5IVCA 4A3CJ 1FOD1 1FTZA 4RB3C 3LSRA 5FUPA 3F8CA 3N7KA 3KHCA 4TV7A 1FWZA 4MGTA 1MBHA 3V65A 2LYCA 2RAEA 2XVGA 2GH8A 3BIWE 3K1NA 1VQ8I 1GZCA 4YELA 2K9QA 3QH7A 2QF7A 3QOEA 5D6FA 3IKTA 2YGLA 5FPVA 2WZPP 4M3FA 3JQXA 1B59A 3CP2A 1K61A 4A3EJ 3CBNA 4BQ4A 2DVBA 2IJLA 5HS8A 4Z8BA 3CNAA 4B1RA 3VDXA 3POSA 3CZJA 3GZEA 1LHVA 2J1EA 1RHI3 1G4DA 4AOCA 2IXCA 4Q0UA 4NRQA 4EN8B 1QZYA 3I5UA 1UOJA 4ZJZA 3K48A 4A4AA 1N77A 1ZR4A 2E6VA 2CV0A 4CDWB 3CJIC 1GNZA 1AL22 4DEVA 1MEC2 5FLHA 5DTDA 5ACA1 1KJRA 4E70A 3BN6A 1OH3A 1HW5A 1MGTA 4E8DA 1VQNI 3NEUA 1WCDJ 3SEEA 3BTJA 4HX7A 4XRSG 3B01A 1JYCA 2FZ2A 4QKNA 3PNYA 1UNBA 1VBC2 2CNAA 1CESA 4H55A 2F4LA 3LSIA 3EYYA 1CAXB 2FMDA 2X1DA 3E6BA 1UY2A 4M0HA 4YGCA 2RE9A 2I07B 1K78A 4EM2A 1QZZA 1Q3EA 2VMFA 2LALA 1HN0A 2ES3A 1G9AA 4DZGA 1AR92 4KT6A 2OZ6A 1VE0A 1LECA 5C3OA 3WUCA 1OOPB 2VNGA 1W9FA 3RZMA 3F8FA 2UYBA 1NE4A 3S2DJ 2BVLA 2AHQA 2AR6A 3VB9A 3I97A 2DK8A 1UZZA 3GJAA 5AFEA 3ZQGA 3I64A 1WVRA 5A6YA 1XMAA 2CMPA 2R7DA 4KWJA 1QVUA 4CYCA 2V72A 5BNPC 5IAXA 1HXDA 1U5TA 3SEQA 2HOEA 2DBIA 3GALA 4AQ6A 4CU6A 4QX5A 4YW4A 1OVPA 5JLXA 1OUSA 2Y0SN 3K1PA 1KU3A 4LO4B 5FJHA 1AU7A 1VQ6I 1IC8A 2WN2A 4EZHA 1GP5A 1S0GA 3M8LA 4KWUA 5FZFA 3TN91 3LPFA 2W1QA 2HWC2 3MF9A 4F7ZA 4LIVA 2WL1A 3A02A 2HYGD 4OAZA 3TB0A 4Q4Y2 4H3WA 5DUIA 4S2HA 1I9RA 2VTXA 1G9BA 2L02A 1SMVA 2JZYA 2XBO3 2WZR2 4JCKA 2WTEA 2B45X 2DCYA 2BBAA 4RGUA 4HV6A 2IXHA 3CJQB 1X50A 4Q5OA 2OT7A 4Q8LA 3IBMA 1QOOA 4P5YA 5FO7B 3EUAA 3L2QA 1LKNA 2ZXWH 2HQNA 3S5QA 1GOFA 1OBNA 5IT9Z 2IC1A 2Y2ZA 3LSEA 4EGZA 1N1TA 4KIBA 2QCSB 1REPC 3VD7A 1SBEA 5T5LA 3I7DA 4QSHA 3M8EA 1VP6A 1R083 4E7JA 1OKOA 2X05A 4RHV3 2O7OA 1ENQA 3WUDA 1E5IA 2RM21 2GBYA 1KS4A 5L7OC 2K46A 2YFZA 4LUKA 4Q4W1 3K1MA 4HDUA 2A70A 5FPXA 3OYMA 3HOXJ 2P34A 3PUQA 3W20A 1GQPA 1UZYA 2C1FA 4LOTA 1WHUA 3CP8A 2EV5A 3D82A 3FUOA 2WA0A 2W25A 1RB8G 4M3CF 1Y0UA 4IHXA 5FYSA 2KHMA 5BNOB 5JHUA 2E35A 3AP9A 4NC8A 2HLEA 4XICA 2MA3A 3UL2A 1LOFA 1OR7A 3D1NI 2BFUS 2M4GA 2EA4A 2ZKLA 3NARA 1VALA 3TNPB 3NNFA 4BM8A 2BNNA 1D8KA 2BY3A 4AEDC 3ECHA 2B8MA 4ZYGA 2XAJA 3VBUC 3RPUD 5F6LB 4IXAA 4HBNA 3K4JA 4A45A 2OCEA 1FNZA 1BIAA 2E51A 3TN93 5F5IA 4RSUA 2LMDA 4LBNA 5DEQA 3ZFFA 1JKRC 4NNJA 4PF5A 3ZN1A 3BTXA 2F5VA 1JI8A 3RKXA 3TEDA 2Y8KA 4QDSA 4YVWC 1IXSB 2P8TA 4Y20A 2OZJA 2Y0IA 1E17A 1AOYA 3B93A 5IT3A 3FXQA 2A1XA 4OZXA 2L9VA 5BNGA 2ZABA 1Y0NA 4RS5A 4QPOA 2W94A 3NQOA 3GM8A 2IS4A 5LBEA 2ERFA 4P14A 2KIMA 3WNXA 1OURA 3W58A 1U8RA 3KGLA 3GLLA 3ESWB 4M3EA 4AFMA 4HEA2 4MVTA 2VZSA 1XYPA 4UFJA 1YQ2A 4HVOA 1YG2A 2KZVA 1O7FA 4HZFA 2XJVA 3IV5A 1Z9CA 1I6XA 1H6XA 4UFMA 2HWC1 2V1XA 4GWJA 5HNFA 2L7ZA 1AF9A 5FWJA 2XUMA 1OA2A 4RFT0 2LNBA 1GWMA 2W48A 2DF7A 3BG9A 1LE8B 5CIRA 2XXZA 4HW0A 2O9LA 1FLIA 3AG2H 2QQAA 3RVHA 2FZ1A 2DU1A 4XVHA 5E20A 2EXKA 1Q8OA 4RAZA 1W8UA 2JICA 3VUOA 3E5QA 5JOYA 4HXCA 1JYVA 2VN2A 5FMCA 4A69C 3SCFA 1USSA 3T4VA 3IUOA 1J58A 2Y33A 1LNWA 3OYJA 2D3RA 2OPWA 4IOCF 1W7PA 4CCKA 4O5VA 5FZ1A 4F8AA 4ZTFA 4CUGA 5IPAA 3H92A 2JDYA 1E57A 3KF3A 3RCOA 1KFUL 5LW9A 4MUVA 4JBAA 1PVC2 5HCAA 1VBD1 2VZRA 5DAQA 1RUH3 3HEIA 1WMXA 2A5YB 3BR6A 5F0FA 4W6YA 3V8LA 1Y9GA 3CMYA 2KRCA 4AR2A 4YGDA 4K1ZA 5B5EC 4B29A 1HDKA 3PFYA 4D6SA 1ENRA 2OX0A 1NK3P 2M0MA 1S0IA 2E1OA 3TO9A 3UESA 1UMZA 5A2QK 4XFGA 2PX9A 2ADEA 4TTGA 4IL7A 1HOMA 2EBIA 1C57A 1S2BA 2JRMA 5DD4A 1FXZA 3OGRA 4XQFA 3WX5A 1J1LA 2VT3A 4WV8A 4P9JA 2HPMA 2MC4A 2YS9A 2JWTA 2OTJI 1CF7B 3SZPA 4AI9A 3MW2A 1VRH3 5A3UA 1XNKA 2DW4A 1YQ8A 5JLWA 1F4KA 4NIHA 1TWCJ 3POYA 2H1LA 3RJRA 1JUIA 3WOGA 1WSUA 2CW7A 1ALYA 1SCSA 4GULA 4JP0A 4F52A 2VVDA 3A0NA 1MD0A 4ZZLA 3ZFGA 4QPGB 4BE2A 3RQ4A 4ITVA 2WB1A 1A5JA 3REOA 2VZOA 2NYXA 1XE7A 2JX9A 3VYSB 1FTTA 3MW4A 4V19K 5FY7A 3F23A 3GFIA 4KIGA 3POJA 1JHHA 4JGZB 2G4IA 2MNGA 4XSZF 4I30A 1VBE3 2VR4A 1BJQA 2COMA 3MLKA 1XNAA 4OI0A 2QA4I 1PZ9A 5T5PA 2LRPA 5FP8A 1YJ9I 1I50J 2G0EA 4RQPB 3KV5A 3AFKA 1FY7A 1UQXA 2JSCA 3ITQA 4PZJA 4FPOB 3I3QA 1PGW2 4I99C 1O3RA 5JFRA 2E31A 1D2QA 3ZMNA 4IRIA 1VMHA 4U0YA 1BL0A 2WA3A 3QYFA 2R3SA 1XCBA 4TLFA 1I5ZA 2IVJA 4LIUA 3DGTA 3GTGJ 3POBA 5FUIA 1EH6A 2YUEA 4YFKF 2K40A 5LBQA 3EUHA 4IERA 4HVQA 2BGCA 4ET7A 1YJNI 1J09A 3KP6A 1WBLA 1IRFA 1GQGA 4E4HA 2L3DA 2P3KA 1NH3A 5FPZA 4HLYA 1XE8A 3FLPA 3ZN0A 2WYSA 1R22A 2VD7A 1W5SA 1IUYA 1I3HA 2PLV1 2Q8EA 4BH9A 1YXWA 4PI0A 1NY72 3S3OA 1HRV1 2VNVA 2DBBA 2XAHA 5EWSA 2JG8A 3WTSC 3J7LA 2QLZA 4UAPA 5CPRB 3B00A 4HANA 2BV6A 1F8VA 3VFZA 4B3XA 2ZC2A 2X6YA 1T33A 3IM0A 4BAYA 5LA2A 5A7PA 2Q4SA 4ARYA 3HQRA 5JLVA 2P2KA 1GV5A 5KXBA 5J6XA 1W36C 1TG7A 5FV3A 2UWBA 2ISYA 2RQPA 3JU9A 1P4XA 2DQLA 1K78B 1HDDC 5D21A 2QCOA 5FFZA 2VE9A 2VI6A 1ZZ9A 3T08A 3KP5A 4GIQA 1X3ZB 3DPRB 4PJNA 1YYNA 4IOAF 3AVRA 2MGQA 3FLRA 5GKAC 1MMNA 2J5PA 3ZXSA 2JWPA 2V1UA 2K7LA 1E5HA 3N3HA 1DPRA 4Z2WA 3SEZA 2VBXA 4PLOA 4A3KJ 2ID4A 3KV6A 3I2OA 2NVQJ 3PUAA 1R092 3OR2C 1JYWA 2RMU2 2WSUA 1W90A 4LO8A 3CZ6A 1LOFC 4BQ3A 2HWB2 5CAZA 1D0HA 3FBYA 4ZU5A 2QENA 1WI3A 1YJWI 3T5XA 2TEPA 2XRLA 2FU4A 1QJZA 2HDCA 3POGA 1HW2A 1OA3A 2AQFA 1R5GA 3IH3A 2NVXJ 4TXWA 2HVRA 3CU7A 3CQOA 3NAPB 5ILSA 4UUSB 3JXSA 4ASMB 3BGAA 1CZTA 2E53A 2EXJA 3WQ7A 1X3UA 3HNYM 1VLNA 4HPKB 1LENA 5J40A 5T5OA 4I0BA 1OMIA 4N43A 3GFLA 4WVMB 4BJ0A 3R61A 2QQKA 3QYEA 3GCXA 4XNFA 2OUHA 3KFWX 2LW8A 1G6NA 4XDOA 1QNWA 1ON2A 1D7PM 4AVVA 1OQEA 1KDKA 3BDDA 1QXRA 2W47A 2V1DA 3OL4A 3WDYA 3PUHA 4UY8I 2ZMEB 1QY4A 2WSVA 5LASA 4IGQA 5A6ZA 3RIRA 4QGMA 4CZCA 1RIRA 1NCRB 5J1RA 1FMD3 5AC92 2RVCA 2RJ2A 1J7KA 3E0JB 1TWFJ 5E79C 3A0HC 4MHUA 1I39A 2D2WA 3HRSA 1JHJA 3GMEA 3AB0A 3DF8A 4GDFA 1A34A 1VBB2 2D93A 1R091 4R52A 1OR7C 4PDWB 3JRGA 2WDBA 4IDZA 4GD4A 4BQYA 2WNVB 3VHNA 1NA1B 5FTTC 3ORJA 2VONA 2ZGPA 5BS6A 3HSRA 4LO7A 2A6TA 2BW3A 2XWBB 3AYCA 2Q2EB 2ZGQA 1ZZ8A 3HOZJ 1IPSA 1ENHA 2JA7J 5IYYA 3ZQQA 1LU1A 1BEV1 4BMBA 4XCAA 4LQRA 1R1ZA 2RQQA 5FREA 3S2WA 4XETA 1LVAA 3IIAA 1R1A1 4C2MJ 3DWLE 2ZGTA 2EINH 5LHGA 4BZ4A 3VPRA 1LOBA 3FUQA 2DDBA 4CDXB 5KBFA 1BYHA 4MEYF 3SYTA 1LGBA 2W92A 2HVSA 4CE8A 1W8HA 5J36A 2FNAA 3K75B 1JT6A 2MSYA 2CUEA 1H2LA 5JPMB 3PJQA 3BQZA 2J1SA 4DRRA 2M45A 5CJ9A 2QZ8A 5SV8A 1NCRC 4AGRA 4KG0A 1Y8QB 2IFWA 4XFFA 4BEHA 4W65A 1USTA 5ED4A 2YSRA 3GCMA 1PDNC 3R05A 3VSLA 1W06A 5GLWA 3J8F3 2QQ9A 4DZJA 5LBCA 4L9VA 4IHWA 3U1XA 2AO9A 3OYWA 5JVVA 1COV2 4FXGB 2WFF2 4FTSA 5FKOA 5LHHA 5FYIA 2R7TA 4XQDA 3KV4A 2GALA 1UPIA 1W7PB 1LESA 5FK8A 3U21A 1UYPA 2EZHA 1PK6B 4G7OF 1CVNA 3HHHA 2G7HA 3K4LA 4XLPF 1Y1VJ 4UXNA 4WM7C 1T6BX 4Q4V1 1KYZA 2NN8A 2ZNYA 2ZHKA 3D6EA 3RI4A 3CUQC 4CVUA 2RKHA 3G2BA 1IN4A 4IRHA 4JOMA 1X1PA 4EJVA 1LE8A 5E3OA 1ND2C 2YB7A 5HLHA 4LB5A 4NRPA 2XAGA 3N9LA 3B5LB 5HDKA 2ECCA 3NW4A 3K69A 2ET1A 2PQ8A 5HLIA 3ZRGA 1SCRA 4KIFA 5FKKA 1R4NB 2NVYJ 1HA8A 1UKGA 4M4RA 4XYXA 2G9ZA 3KSCA 2HBUA 4B8XA 3ACGA 1X1AA 2CL2A 3AFHA 1SG3A 4XKVA 4XJAA 4JV4A 2VMHA 1JOJA 4IEQA 2OQRA 3JBG1 1FV3A 1H2MA 4AQSA 1WW7A 1OLMA 1A78A 4DXRA 5K0UC 3ZMSA 5IYDJ 5A3LA 2Y31A 1MS3A 2BEOA 1CIYA 5FKMA 5B4XA 4AEKA 2JD4A 3RSNA 5M5WJ 2DFBA 2P5KA 4LA2A 2O1QA 1JZ3A 3PSFA 1T95A 3MN2A 3F8MA 1MMSA 4IEXA 5B2GB 1TLHB 3LFIA 3VDAA 5E6HA 1POV0 3KM5A 3VYTB 1VFCA 4CU9A 4R9AA 3K51A 4ES8A 3FBNB 2B5HA 5EEAA 2DXIA 5BNNC 3SMHA 2BYVE 3D5LA 1SFYA 1FOYA 1S0CA 3BKZA 4GZ9A 1LJ7A 3SH4A 3NJYA 2MABA 3F95A 1D1AA 2HYXA 4UUSA 4CDWC 3JD72 3QLQA 2KRHA 3HOVJ 1ZTRA 2PMHA 1JXNA 1UOGA 1MSFC 1RUE2 4Y1VA 1G8WA 2YBPA 4UVCA 3CJIB 2QUOA 2A6VA 4RBOA 4QQ2A 1UO9A 2HKOA 3WNPA 1D1BA 2RDPA 3ZP5A 2HOTA 4QX2A 2QBXA 3HOTA 4B7KA 1H2KA 2R0FA 5J1UA 4P9UA 2GSYA 4OHXA 5I8YA 1CX1A 3BPZA 4IE5A 2WO2A 3UKVA 5JVGF 4XMIA 3QAHA 3LEIA 5FLVA 1VBC1 4PDKA 4KU8A 2RS52 4F91B 2DJNA 2DFHA 5FZGA 2JUCA 3GXOA 3G4SI 1ZH5A 5F1JA 1GBGA 4GCVA 2LY1A 2ZJ2A 2JG9C 1TME2 4YIRX 5IK8A 4LMFA 1LEAA 4KGQA 1R1VA 5GALA 1LTEA 3QPHA 3DKYA 1AYN2 4A6SA 3ZMZA 2FBHA 2ZMEC 1O3SA 5E3NA 2GC2A 2LF7A 1F5JA 5LRSA 3IMMA 2WO1A 5GZCA 1U5XA 2GQQA 1Q56A 1E5SA 3NWSA 3MIGA 3M3QA 3Q9VA 5DMYA 4IEPA 3A4CA 5EEHA 2R7UA 2J1VA 4G6TB 1MBKA 1ASJ3 4HF0A 3IDBB 2B7YA 2DCJA 2JVGA 3BG7A 3JB4C 3MEPA 2KJCA 5EP9A 2AGSA 2CYYA 3KHBA 4G94A 3KYDB 1OD5A 3DEUA 1BR4A 2WAQA 2B42B 4GGGA 1A36A 4RD7A 4CDQA 2DOAA 4HG6B 4A3FJ 1DU3D 3FM5A 5FD5A 1CAUB 2XC7A 3JSPA 2YU1A 1NYWA 2CHHA 4BQAA 2UY9A 3RPQA 3MW3A 2EB7A 5LY1A 3ZX7A 2XL7A 2UXNA 1AR71 3ZQ7A 2QDRA 3A22A 5EDNA 2GN3A 2LG4A 3CTAA 1JGGA 2K4BA 3ZQCA 2CGPA 4R4XA 2FOWA 3FMGA 4QMAA 4OINF 3T4HB 3H3UA 3LSGA 2CJJA 2H0BA 1NQJA 2VT2A 3R4DB 2M7AA 1P6RA 1SFKA 2PBIA 4L11A 1RUJ1 1VAKA 4ZKTB 4ANJA 5DQ0A 1YLLA 1HRV2 4UBHA 5D8AB 2VJ4A 3X2QH 3VEPA 3AL5A 1KQ9A 3R0JA 5K0UB 5IY5H 1WWXA 2R071 4AIKA 3T30A 4BXXJ 2XQRA 2K85A 2WWYA 5I93A 5FYUA 3A0BC 3H0DA 1A3KA 1COV1 1SDWA 3FM3A 1G2HA 5LEJA 1WLCA 1ZG5A 1YFUA 4OIRF 2MEV1 4EVIA 1R6RA 1IXRC 5G04L 3LWCA 2VM9A 4Q0QA 1X9PA 2E7WA 2VKEA 3WTTC 1QQP3 3MAJA 4AAPA 4I3PA 5M5XJ 5FLJA 5JR3A 3CDLA 1UG0A 3K4KA 1SVLA 3WINE 3JRDA 3C7HA 2KMUA 4XKCA 3V4GA 2WNUB 2XUEA 4QQLA 4GALA 2F4PA 2WNUA 5EJ1B 1Z67A 2MYSA 2XVLA 4NBQA 1ONVA 4OZOA 1F4HA 1W8ZA 1J83A 4QU1A 3DL3A 1GUIA 2ZBKA 3MLLA 5FY4A 2JDPA 1WH5A 3ZN5A 1VPHA 4E4ZA 1FIAA 3LNQA 4B3AA 3MZHA 2YFUA 5FMOS 2XDVA 2R062 5A3PA 2DA7A 2XGXA 1X9TA 2B39A 1PNGA 1NLRA 2UWAA 3A03A 2FJ1A 4ZYDA 1OYIA 4MGKE 5KHIA 3ZYJB 3KLOA 4S2FA 5C8CB 1QNYA 4C1WA 3LSTA 2IT0A 2ZEYA 4GYIA 2R7VA 1W9YA 3RWKX 4X8NA 2G9GA 4Q4Y3 2QQMA 4ITCA 2EIJH 1A31A 3OS1A 3TQNA 1O91A 3GHNA 4M3BA 1QJX2 1FEXA 2BNOA 2H09A 2ZXHA 4YVWA 3USUB 4D3WA 2HTJA 3AKTA 4KN7X 3OTFA 5C9AC 4ESBA 3OYBA 4J00A 4COVA 2K9ZA 3T2OA 4N4NB 3I9V2 2JKXA 5T52A 3F9KA 2EFQA 4O7XA 1W2NA 3H3ZA 4QXHA 5DZGA 1R081 3GZ5A 2WWJA 3H3LA 1PUFA 5KHDA 2P4WA 3ZYPA 2PAMA 1OLQA 1R1UA 4UF0A 3L2RA 2X53S 2XRNA 1UJ8A 1QQP2 1U5YA 3BTYA 3ZDVA 4BBRJ 1RKWA 1H8AC 2X1CA 4QXKA 3CO2A 2B9VA 3SC7X 2JE8A 2O0YA 4GYGA 2RS13 5JHFA 2WNVC 5T50A 2R30A 1ZK8A 4AF9A 2X6WA 3IP4B 2CW8A 4HX4A 4AYUA 4XF3A 5M5YJ 2OUMA 3ATGA 4UNOA 4Q4W2 2AH2A 2P17A 2VBZA 3HDDA 1XC6A 1W9SA 2HVQA 4WWCA 4QPWA 5C4WA 5C4JJ 4GKYA 3CCYA 2B9UA 2LREA 2AS5F 1J84A 1PO23 3W2WA 1IO2A 2AYHA 5B1BH 3T09A 1Z0XA 4CP0A 5CA6A 3FK6A 1RUI3 2RDNA 1A6QA 1W1WE 1PO13 4PQ9A 5DS9A 1YQ6A 4KN4X 2HDWA 3ZSMA 1RUC2 1WW6A 3R4UA 4ZPIA 3GTQJ 5GJ6A 3AMQA 1JN2P 2QTWB 1P4WA 4G9SB 2CUJA 4RQPA 2Y9ZA 4CYDA 1X8EA 2CSGA 4AHWA 1DZQA 4UFIA 2GZWA 3FKIJ 1LR5A 2PN6A 2V09A 2RNGA 1CD3G 5I0UA 2EWNA 4YG0A 1T6GC 1JI6A 4NHJA 2H0VA 2K86A 1OKRA 3FXUA 5A3WA 4DINB 1V5FA 1FATA 2FDJA 2W3JA 3ZSKA 3F6OA 2J42A 1O57A 5H20A 3WNLA 3I2FA 4RHV1 4MADA 3PIPF 1QVTA 1HV0A 5E8AA 4FOQA 4MYEA 5FY8A 1TC3C 1XQNA 1VBB1 3UR3C 4Q4X2 1MVQA 3CLQA 1U5IA 4IGOA 5DAWA 2VKVA 3CDHA 4XORA 4JDNA 2DA2A 4Q1PA 2R5ZA 3K77A 4EN9B 3ISPA 4KMUX 1L7RA 4IHSA 4E2SA 5CISA 1F9NA 1GICA 3GHMA 3LSPA 3IWFA 2PHTA 1RUI2 4A5MA 5B66C 1VMFA 1Z3YA 5HLGA 3L2WA 5BNPA 4EJOA 2EJRA 4Y4YA 3OUIA 2IS1A 1CWPA 2R16A 5FLIA 3WZ1A 4HETA 1TMF2 4F3JA 1B09A 5IK4A 3IIIA 2HH9A 3PUIA 4Y1YA 2ARXA 3GTJJ 4BY7J 1F9KA 4IRGA 3GZTB 1UY0A 3BODA 2XKOA 2IXLA 1EH8A 4CYCB 1ULDA 2DURA 5IVVA 3H8UA 4M00A 1FBQA 2V5DA 1FI2A 5A32A 2Z69A 4QT6A 3OMYA 3L9JT 1LFUP 3HPHA 4F92B 3VBSA 4NIAA 4Y17A 3QPTA 4J1WA 5IAVA 4I2OA 3ZOBA 2PHLA 4XR6A 4PSXA 5EHDA 3OBAA 2MC3A 2QEXI 1JOBA 3ASIA 2G7UA 3OOPA 3IRQA 4YG2F 1XS9A 3GFMA 3OIOA 1QKQA 3N9QA 4P1WA 2VW2A 2VL8A 3JAMZ 3U11A 4EYUA 2JA5J 2LM3A 1T56A 3C2GA 4WXCA 3CDIA 2GC0A 4CP1A 4FP2A 4A6EA 4BJ5C 1W6MA 2Q0AA 2G1MA 1CPNA 4Q27A 1U5TB 3FLTA 2DO7A 4AEMA 4K20A 1IG0A 3BCBA 1DPUA 1RUNA 2LLKA 4YM0A 3V8KA 2R043 4IVNA 3CO6C 1DZRA 3I3LA 2E36A 1IN7A 2V6CA 3NRVA 1BM9A 3ZQHA 1OUXA 2OUJA 2EZLA 5T5JA 3LDKA 1S7EA 2DCKA 3AL0B 2XB5A 3ACLA 2ILMA 1XU2A 4FPJA 3AZVA 5JIUA 5AIQA 3GXUA 1NX9A 3FZVA 3CD6I 1JZ7A 4XZPA 1AYN1 2CH0A 5EZHA 4KH9A 3DTKA 4M73A 4XBFA 2HEOA 5FZLA 3HEFA 4P02B 4A12A 4DZPA 5BPXA 1DGRM 4UUTA 2X5IA 2L9SA 2A6EF 2ID3A 5FXWA 1YFHA 4QKFA 4BMEA 3MVPA 3AKQA 4DMIA 4Y20B 2HYFA 3O1RA 1BI0A 4OMYA 2V7FA 3VDDB 3OY8B 3JW4A 3NKTA 2HWF3 4U88A 1W0OA 3C2UA 4FISA 2NRAC 1AA7A 5A33B 3W5MA 4BPZA 2Q30A 5JI7A 3VL8A 1HQLA 4OIOF 1H6YA 1G7YA 2IAIA 5L19A 2A61A 2YU3A 3SJMA 5H9SA 2CU7A 4A93J 1KDMA 3ZXKA 1MZ6A 1VBE1 4Y22A 2F4OB 1QDOA 2P6TA 3DTEA 2WNVA 1WRJA 4G4FA 5LA9A 1ZGAA 3LQCA 4HKLA 1Q5OA 4YVSC 5CU1A 2YC4A 3KP3A 3W6KB 5F3IA 2A5WA 3ZYFA 2WA4A 4A3IJ 3U4XA 3G1MA 3N9OA 4AUXA 4L9NA 2QUFA 1HXS2 1FPN2 3CCUI 4QM9A 2L5QA 5ANNA 4W97A 2W87A 3HUGB 1QNTA 4KNCA 1TZOA 2P5BA 4RM2A 2O5RA 1QJU1 2D6OX 2KD7A 4Q0VA 3ZKYA 1S0BA 1K6OA 2A5ZA 4EROA 1WJDA 3O1UA 1W8WA 2K2SA 5IP6A 4WM8B 1ETKA 5HS9A 1A04A 3R4KA 1F4AA 2CUZA 4FPYA 3HN1A 2O14A 1AYM1 4XFIA 2KT0A 1B35C 5EYRA 2WS93 1XE0A 2QSFX 4QKBA 1T39A 2L4AA 3NO8A 4Q2FA 3H35A 4D0PA 4BJ6C 1GP4A 2X6XA 2PTMA 3U1KA 2RR13 1ND2A 4NROA 3BTAA 2HGCA 4YFNF 1PHMA 5JPNB 4HLXA 4UB8C 4XKWA 5IP7J 4JX0A 1ZARA 3W6VA 3OY8A 4IESA 2DV9A 3HKZA 1C4RA 1YITI 3CDZB 5F08A 1HRI1 1Z6TA 3TBDA 2JA2A 5HV4A 1W6NB 1RC9A 2VOTA 3LFMA 1VBD3 3BOQA 4HAMA 1S0JA 2D3PA 2VZTA 4CEYC 3BOPA 3MPBA 4MIMA 4ZZ5A 5DAXA 1VI0A 5K0UA 1JHFA 4CXWA 1XSXA 3OS2A 2KA3A 1YFXA 3RZZA 5FZDA 1S0DA 5IVBA 3ZGKA 1W8OA 2EFPA 1SEFA 4GWNA 2ZHNA 2VBDA 5ACA3 1Y6IA 3FMSA 1NLSA 2P5LC 3JD73 1NZIA 4A6OA 1EPWA 1WD4A 2VIXA 2P81A 1WJFA 3F6VA 1VIWB 4BQWA 1XNDA 3HN3A 4MGZE 4LBMA 2D6MA 4XLAA 4FETA 1XB9A 4NC6A 4KYWA 1ZBA3 1H89C 4LHLA 4A7YA 3HRMA 3MZYA 4G6QA 4A3GJ 5CVRA 3AKZA 2HYKA 1OFNA 1IHMA 4XFAA 1CF7A 3AZWA 4PBOA 3UT0A 1Y39A 4HOOA 4A3JJ 3VLBB 3NAUA 3WU1B 1TMF1 1EPZA 1Y4WA 4OMDA 3BQYA 5J3UA 3A01B 1MS8A 4MFEA 5ICCA 4PI2A 3ASNH 5F6FA 1R71A 4KNYA 3AL6A 2MEV3 1GZTA 1PZ8A 1DGWY 2BZTA 1DLLA 1BHGA 2BRTA 2D6LX 2VW1A 2OAZA 2GNMA 4BQ1A 2HQAA 4FCAA 3RMYA 1FOWA 2HWE1 5FY9A 1KQ8A 4I98B 1XGSA 3ZPLA 4AU7A 2VCMA 4UBGA 4WVWA 3L2UA 3LDBA 4BCUA 3KWVA 2L9LA 3LSKA 3CZUA 4FFHA 3PDQA 5A3MA 3VBHB 1GANA 3OYLA 2YHJA 4QD2A 2HZTA 2HEVF 3THCA 1LGCA 3IAS2 5DDJ3 1RESA 3WG7H 1XXNA 3H9QA 3AC0A 2W00A 2O8KA 1PM4A 2IBDA 3H36A 3AM2A 5FZ9A 1R4MB 3O14A 5JXHA 4B4QA 3KETA 1D3YA 3GYDA 1XGMA 3HRUA 2ZMNA 3B6AA 2E1MC 5CLSA 3HOYJ 3VBHC 1YYVA 4AE2A 3GBGA 3GFJA 2E7TA 2QQPA 3NWKA 1SDDB 4II2A 1S5LC 3LEKA 5F2SA 4ATEA 2WFF3 2E33A 1S2KA 3PU8A 4D0QA 3H1WA 4G7ZF 2VU9A 2P5VA 1MQTA 2DVFA 1U5ZA 4ISQA 4HF1A 1DYOA 4HOBA 5M3FJ 3TP3A 4QIWN 4A3XA 4IQ4A 2R7EB 3P1IA 1RR7A 2WQZC 1UMHA 3VOEA 4DOZA 1HQWA 3RYPA 1A6CA 1DQ5A 3NJVA 1US2A 1UZ0A 1PP8F 4JGYB 1D0YA 5GTHC 5KHHA 4DOUA 3MFAA 5I0TA 4KU7A 5F3GA 3S1RJ 2DYSH 4E4SA 3NV3A 3ZM8A 4B3NA 2RV9A 2VQTA 4MHRA 3FKJA 5A6XA 1ZBA2 1WZ2A 3ES1A 3TNQA 2D45A 4CHUA 4AQTA 2AXTC 4XBLA 3A0KA 2Y75A 3P3NA 3Q3SA 2RC4A 1S0FA 1Y3TA 3AYEA 1MZBA 3RWNA 3I4NJ 1DGRA 1URXA 1ONAA 2RMU1 3A21A 1A35A 1AVBA 3MDPA 5GLZA 1OT5A 1UU6A 5C3SA 1R00A 5GPCA 1K79A 2YXSA 2LP0A 3ALQA 4ZS3A 1UIJA 5KXCA 3UGGA 2BFUL 4AYBA 3K70D 2ZS6B 4XLCA 2VECA 3ST7A 4NAOA 3DBRB 2VKHA 3NJZA 1LHNA 4AL9A 1FPN1 5BYNA 4CEWA 5EXOA 3PNAA 2G19A 3WTVC 2Q8CA 2VOPA 2UWCA 5T55A 2YC0A 4URTA 1K12A 5H6QA 1UYZA 1KFXL 4AVTA 1SFEA 4X6RB 1OLTA 2EICA 4QX0A 1XYNA 5IYBJ 1AJKA 4BIFA 1UOFA 5E18F 4XZUG 2WRAA 2RNJA 3CUQB 2DCTA 5LGNA 1X33A 3EBRA 1KXGA 4E7LA 2A3YA 1BLZA 4MO7A 1RC6A 2VE1A 3G1OA 4FQZA 4OI2A 3U4SA 5FKNA 2GM4A 4RAFA 2X10A 1W6MB 4JGYA 3IDEA 3RJ2X 4HSTA 2EIDA 2ADUA 3FHAA 3I0TA 4LE3A 2KLOA 1EV12 2FDKA 1UY3A 3HQUA 4RR3A 4RA2A 1FMVA 2C6YA 2FBIA 2HPIA 4JYKA 4K8RB 3H7YA 4B4CA 1FZPB 1LOAA 2BXZA 3CCMI 4K6BA 1MS0A 4EWAA 4S04A 2E1MB 3TP0A 4ZDPA 1ZKGA 4C0BA 1MS9A 5A7QA 2JB8A 1OCTC 3S0MA 3ES4A 1IQAA 1PX4A 2O6GE 1OSGA 1WUVA 1UZVA 4BDZA 3H5RA 4PJ0C 1Z1DA 3K4BA 2IRFG 4P9GA 4AFAA 4DUWA 4IV1A 2HZDA 2XPVA 2YMZA 3TEWA 2CRGA 1TQPA 3K46A 1RUJ3 4W6WA 2L7KA 2FMYA 1R1A3 5ABJC 4XOTA 3ZMVA 5FMDA 1YTYA 1S7OA 1W3XA 3ZDSA 3V0BA 2EIEA 2WN3A 3HPGA 3CEWA 4MGIE 3S32A 1JS9A 1WCQA 3WF1A 4UW3A 3U78A 3KP2A 1PZ7A 2BGOA 4BHCA 2VE8A 1B72A 4JRLA 1S6LA 1SBFA 3BCAA 2BWAA 1PMHX 2K3PA 1OYYA 3LA2A 4XN3A 1QDCA 4P96A 1F31A 1W6NA 4B1LA 1KZHA 1LFPA 1GZ9A 4M6XA 3VBUB 1M1EB 2ZNZA 2VXJA 1E3OC 3GNEA 5DXDA 3HVDA 3WNOA 1S9HA 1POGA 2ESNA 2EFWA 2X51A 1OPMA 5K5RA 2N7GA 3S93A 1NA1C 1OFSA 2LD5A 3URFA 1GHCA 2GNBA 2YBKA 1NK2P 2NS0A 5K5OA 5L73A 5L3BA 2WZR1 4HN1A 5JI6A 2EZKA 2O8OA 1QJX3 1YS7A 3HSFA 2BHZA 3FFZA 5EIYB 5IFTA 4BQNA 1G3SA 4A7KA 2FDFA 1AHDP 1LULA 3M4FA 3JRFA 1V6KA 1BN5A 4RR3B 2Q1ZB 4XTMA 2HYJA 3VZOA 4PCRA 3ZVXA 1ZRIA 1FOXA 1FC3A 1W0NA 2LFBA 1CR7A 1QJU2 2JDNA 2Y6LA 5KHKA 1R9TJ 5JVTA 4ZU7A 2WS92 3R6SA 3O0VA 1H0MA 1MIJA 1F35A 1SFPA 1DQ2A 1JU4A 5CYVA 1MMDA 4JHTA 3DYOA 3VDBA 4JTOA 2A7AA 1RUJ2 1LODA 1BR2A 4P9YA 4IUGA 1S29A 2NOGA 1DYKA 1T08B 2X09A 1QO0D 4KT5C 3K4CA 2DOFA 1DP7P 2MHFA 3JRHA 3ILNA 4LE4A 3GTMJ 2PHDA 3OUJA 3CCEI 1Q1VA 2K9NA 1X7NA 3TO7A 2EA7A 1C8M1 4QLCU 5FYTA 4OUSA 2OA2A 2VC0A 2WV0A 4M01A 4NPMA 3F21A 4NO4A 2VO5A 3E3VA 1HIXA 4L9TA 2YZ4A 3ZR5A 1AUYA 5DDJ2 5HBAA 3DTIA 1WW4A 3PO3J 2GXAA 1RJ7A 1MZFA 4XN0A 4FSJA 5K5QA 1RUOA 4M3CE 1JGSA 5T3NA 2OXBA 3PVEA 1J1TA 2E71A 4W1UA 1N3PA 4GH4B 2OCCH 3K10A 1BQPA 4MTDA 1EUUA 2E5ZA 4V1PA 1REFA 3IZOA 3VWBA 1ZX5A 1VQ5I 1ZYBA 3ZQIA 1UMIA 2DT7B 3E7LA 2HXIA 5FKLA 3OEAA 3DECA 2HWB3 2XUBA 1OISA 1POV1 2W4SA 1W8NA 2WO3A 2H8RA 2JTVA 3LOCA 1WLTA 3B3QE 1MEC3 1MVEA 1C28A 4RYDA 1AL23 2VZPA 4BLJA 2NXNB 4QXBA 4XFBA 4D1QA 2LH9A 1IQDC 3WF0A 1KITA 1WJBA 4CU7A 4E2GA 3S1QJ 4N90A 3I4MJ 1UIKA 1BKZA 2ZZJA 4CA9A 4R9DA 1UCXA 3ACHA 5DAVA 4BACA 5D4SA 1MH4A 5J4YA 4G8XA 2ZSHB 3WF4A 1FYKA 3WG4A 3AG4H 5J37A 4KA4A 4A7ZA 4XJWA 2XONA 4IV3B 4IV3A 1YX3A 1SMYF 2HWVA 4PIZA 4Y33A 3UYJA 4XFCA 4AI1A 1AXKA 4PLNA 1V55H 2W1WA 1QJU3 2V9VA 2EIGA 4NN0A 3MQ0A 2HQ5A 2LTNA 5GZFA 1KONA 1MMGA 3N05A 1YEWA 2XB0X 4LG3A 1WJEA 4O6JA 1X58A 1P7IA 5DCFA 2ICWG 3L7WA 4HBLA 2W7NA 4CCNA 1Z7LA 2VZVA 3HSEA 4JQTA 1H0BA 3KT4A 1D5VA 2L4MA 5C3EJ 4GMP0 2VBPA 4UB6C 4XRFA 3UKTA 3KQ4B 2EXIA 5DYMA 2IGKA 4Y22B 3DXTA 3VBOC 2L2OA 5CVUA 2JKBA 4DXZA 4Q4W3 2W52A 2LRDA 5K7ZA 3E1F1 3SQOA 5CADA 4ISRA 2VQAA 1RUH2 3CMMA 3N9NA 5E88A 1YO5C 4LLGF 4X0GA 1V70A 1EUTA 2RS12 4PQQA 1OKQA 3Q0WA 2DU9A 5BNOA 1ETWA 2FCTA 2OPKA 2P6HA 4XF0A 4DXSA 5ILUA 3H7JA 3U14A 2DUPA 5J3LA 2DAOA 1MEC1 3MKZA 2JA6J 3EUKL 1VRH1 1HKDA 4LK6A 2Y0OA 4FX0A 2EZIA 1AR81 2K0GA 1AL0G 1OD3A 3PL8A 5F5QA 3U10A 3MIHA 1VBB3 2XLFA 1ETVA 3WQ1A 3UGFA 4E2QA 4EWEA 2BOIA 1QHDA 3ZO0B 3AJYA 1JBCA 1Y8RB 1H8VA 4XUTA 2QKDA 3D5OA 1YCIA 2PHXA 2ZGLA 1OCPA 4B48A 4O9EA 3GO5A 3GDBA 3O6BB 4CSWA 2DBNA 3PTYA 4YZ5A 3KX2A 3RQ0A 1PX3A 1GUUA 4P9IA 4AIJA 2NZ9A 3K3OA 1WMEA 3FXKA 2Q8OA 5KC6A 3RG0A 4E9KA 2DUOA 5D8AC 1RUH1 2X4HA 3GX4X 3WHBA 2UU8A 1STZA 3ZN6B 1JUPA 1T98A 1WGPA 5DABA 1P7JA 3LSMA 3UNPA 3MIDA 1Q8VA 1PVXA 1GDTA 2X48A 3DEEA 1SLCA 1M4WA 3HBLA 4D7NA 2MLGA 2BVMA 2E60A 2WT0A 4PSWA 3LFKA 2LOOA 3HHGA 3EYIA 5FCCA 1HRI3 2Y9YA 1GLNA 2ARAA 3GF6A 4ZU4A 1G3YA 2OQ6A 4QPGA 4FOWA 5CB7A 2IA1A 1QPMA 3WDXA 3QH6A 1JZ2A 2R92J 1CZSA 2ZO4A 1F15A 4NQWA 4AZZA 1UW8A 3HYIA 4BDVB 2ADDA 3MKYB 3OYIA 2IPQX 4RS5C 3TEZA 3BR1A 1N3QA 1I6HJ 1ND3C 2TNFA 2PFWA 4AHYA 3CQZJ 4FPLA 4RLFA 5EEGA 4K9SA 5ACA2 4QDQA 1QJFA 5HCFA 3NVCA 2F6CA 5LATA 2VMDA 5M0TA 2IW5A 3S16J 3H5NA 2C24A 2W1UA 1JHNA 4CUCA 6PAXA 1ZAOA 4FASD 2V26A 2XLGA 3EYPA 1IS4A 1BK1A 4U36A 5DZFA 3OWTA 3HB9A 1W39A 5CKMA 3SHFA 3LEMA 2FX0A 2N8GA 1OA4A 1YQAA 3VODA 3WSOA 1FP2A 1HB2A 1BOBA 4Q4Y1 3RFRA 3FHIB 4BQ2A 2R5ZB 3QACA 1I1SA 3CL1A 5C5UA 4BL0B 4DRVA 2WY7Q 1OJLA 1V00A 3BPSA 1JYTA 3O8HA 1V4RA 4RGXA 4MNUA 1W8FA 4IEZA 1RGSA 3N7LA 1H4GA 2VBYA 4AGGA 2VXZA 4B09A 3L09A 1IJWC 4R8HA 2ZX3A 2RR12 1P9QC 2Z5UA 3ZYBA 4BXFA 4Q29A 3U37A 2RREA 5LWBA 3J7YJ 4JVAA 1C3HA 2ATFA 5C4WB 3KPHA 3WE3A 2IUWA 5A70A 3OUHA 2WKKA 1AR93 1RUF1 2BNMA 5L3FA 3T0YA 3ABZA 4OAYA 1MNDA 1IUFA 1UELB 1YIPA 5FIXA 3BR5A 1WZXA 1C5HA 5CVJA 4AI8A 1RVF2 1ZVFA 3PUSA 2R7RA 4NHKA 1O8PA 2GNDA 1AR91 1RUF3 5TSWA 2LSOA 2ZGRA 2ECBA 2CQXA 5GTIC 2KZGA 3I59A 5FYCA 1SLIA 1OPOA 4E6KG 2BHYA 2O03A 2JENA 4META 4JDOA 3PVOA 4QX1A 3DU6A 3TL4X 2HS5A 5JCTA 3ABMH 3WDWA 1BK0A 4CH7A 2R0QC 3PU3A 1X36A 5ICEA 1T6SA 1N1YA 1IW7F 2Y6GA 5DUWA 4MGSA 4YG3A 3ELNA 1B6AA 1POV3 1K4TA 4OI1A 4A6DA 3PVBB 5JZGA 2YR2A 2VUCA 3VKLA 1ZZ7A 3B9IA 4AW7A 4XTPA 4M4PA 3OSFA 4P08A 3OGJA 2VMEA 3JR9A 1K5MB 2HEYF 4KITB 1JYIA 1OF3A 2D98A 2MD0A 1QXJA 3NNLA 3B7MA 3VBHA 4IZZA 1BBT3 1Z7S3 2RM22 3MLJA 2VTXJ 5CZKA 2JXAA 5J98B 2DPUA 3C18A 1VBC3 5FZ6A 4RHV2 1ACCA 1REEA 4GB33 4NMIA 2CSOA 3ZYRA 2A71A 2ME0A 3MYXA 4KG8A 5FFXA 2E7QA 1QWRA 2YUSA 3IPVB 3GJBA 1RUC3 1WWYA 3BT9A 4I01A 1B8IA 3ZFFB 2NNNA 3VBFB 1YHQI 4IX7A 1JJ6C 4HK8A 3GTLJ 2UURA 5C9AA 3S30A 5C9AB 2VZ1A 1R64A 2W68A 3AMHA 5FZ4A 1SACA 4M74A 1CQTA 3P9KA 3ZMOA 5LB6A 2VQLA 2ELHA 4CEYB 1NZCA 4Q8KA 2K9SA 3BLYA 3ML6A 2ZFWA 4MOAA 4K7JA 1NHAA 3BTLA 4JAAA 3FBIB 1O4YA 3Q5FA 2DVGA 4M6YA 5FZCA 1SVMA 1E2XA 1PMIA 3CUQA 5FPBA 4JK1X 4CICA 2FE3A 3VD5A 3AMMA 3IAPA 1OOPC 4DYCA 3E6DA 1PO21 4N53A 2DMTA 1Y7BA 3SLIA 3Q8BA 2Q8DA 4BJTA 1BVP1 4QHZA 3SNMA 2JN6A 2UYAA 3RKYA 2FBEA 1YIJI 3K0LA 1J3RA 3OPTA 1BJZA 4IHYA 1NCQB 4TSVA 1W6OB 2IS6A 1DFQA 2DDAA 2I2SA 5KNLA 1VBA1 3HTSB 1HXS1 3CF5F 2DFEA 1DG6A 2CAUA 5FP3A 5FYVA 4WM8C 1YNAA 2EFNA 4LD5A 1LUJB 1N25A 1NG7A 3LQRA 3GTOJ 2GA2A 4COZA 1NXD1 3O8GA 4D5CA 1U3EM 2VASA 3I4IA 3KV9A 3KCCA 4NOTA 2XJUA 5JMCA 4EN6B 1N47A 4LUMA 3ME2A 1QJX1 1YX5A 5HNHA 2E5NA 2KJBA 5J48A 4FTBA 4QPYA 1SEUA 4CCOA 1FOD3 3TKYA 3S8PA 5I8TA 3HT2A 4ZZDA 2BJSA 1Z6RA 1JTYA 1SFNA 5EJCA 2PJRB 3SCHA 2Y0SA 1RMU3 4NJ4A 4QB6A 4EMSA 3USSA 3LSHA 1YO8A 2NYYA 2WINB 3ZN6A 4PDWA 4HV5A 4J25A 1MQTB 4MSVA 4XDPA 4D6QA 2LKPA 2HXOA 1ZZCA 2ZMKA 4L92A 2KIUA 3C2HA 3BWGA 2ME6A 4GAZA 4JQRA 1YW8A 3FMQA 4JQFA 4QPQA 2LF8A 1FJLA 1XOYA 3OF1A 3ECQA 3GVAA 3LSJA 3MCZA 1S72I 2ZKZA 3RSJA 4YM3A 1ETQA 2F48A 4E4DX 3CKHA 3LQQA 1J3PA 3VBRC 4WBBA 3AX4A 3MKLA 5IVYA 3BVCA 1R1A2 1HQCA 2LKXA 3ZKUA 2BOJA 1NY71 2C0ZA 3M2MA 2DOEA 3THPA 2DTYA 4D69A 2VQUA 2EXHA 4JTNA 2D40A 4I7HA 2KDOA 2HR3A 2E7XA 1BI2A 2GXBA 4XW3A 4CZSA 3GCWA 3VHOA 1JZ5A 1U2WA 2HOAA 2WZEA 4YW7A 4U0WA 3AXEA 2Y6KA 1ODMA 2XJSA 2D6PA 4Z92B 3NSTA 2RJLA 1QQP1 2JD9A 4ES9A 4RR3C 1QHHD 4Z82A 3I3BA 5IVEA 2OPTA 2XF7A 1HKTA 4HYEA 1CAWB 1HB3A 1ON1A 4QQPA 4P9FA 3H0GJ 1XBFA 4R4ZA 2Q1MA 1ND2B 4Y3OA 4ZHNA 3PIGA 4C91A 4C30A 3ZFEC 4LKEA 4A44A 1UG2A 2I45A 5DUKA 5H9QA 1AL21 4PDWC 4HF2A 4K1YA 2E7AA 2HKXA 1D8JA 1AX1A 3KE2A 1NXMA 2Y38A 3RQIA 4CPBD 5LBBA 1O3QA 1YQ5A 3PIOF 1VQLI 1ZRRA 2VCCA 3VDDC 2RS31 1D0XA 2XJTA 2RMU3 5FZMA 5B3SH 2JG8B 2C9AA 2FXAA 3O1SA 1X82A 4F55A 1FBUA 1IGOA 3U07A 1MNEA 1IN6A 2WFPA 4A3BJ 4CP9A 3ZQFA 2UV1A 5C44J 2PMUA 3O0WA 5FFOC 3ZXGA 2YGMA 1HDPA 1CN1A 1ND3B 4GJYA 4PGGA 5L9VA 4YG6A 1QJY2 1BZWA 3W6JB 4MGQA 2JSPA 4LPLA 4UVBA 4I02A 3ASOH 1O5LA 2O61A 5HI0A 2R7FA 3HXLA 4YW6A 2ZCWA 1YE9A 1DGLA 4C3IJ 3VDCA 3GTKJ 4KMFA 2F5DA 4LR4A 1CX4A 3OPWA 4A3ZA 4AGVA 4QGNA 3AZXA 1S55A 4CZZA 2NQYA 2KM2A 2EA2A 2PMWB 1R093 3MPPG 3IH2A 2ZGNA 3HPNA 1EAH2 1JODA 4EJRA 4M9ZA 1AJOA<