1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
1O3SA 3BALA 5L3BA 3ZDSA 1FT9A 3IIAA 2EFQA 1H1IA 2DU9A 1X7NA 4ENKA 2V79A 1CAWB 3IL2A 1A04A 1LDJA 3NVCA 2DPDA 4X6RB 2K86A 4IRGA 3F6OA 3MQ0A 4ENJA 1S7OA 5HS9A 4BHCA 2O8QA 4META 4UVCA 2A3SA 3M9AA 3IDBB 1CAVB 5ICCA 4MHGA 3EBRA 1R5HA 3V8LA 1IUYA 4XFIA 1GHCA 1DPUA 1KQ0A 2Y48A 3SZPA 4AVBA 4XEZA 3IKVA 3SCGA 3O2PE 3HRSA 5IT3A 5D8LB 1LDKB 2L3DA 2OZUA 2GXBA 4D7SA 3PFIA 3WGIA 4L0YB 1SMYF 4WXHA 3ACLA 4LB6B 2F2EA 3QACA 5E17F 2WC2A 3KFWX 4ASNA 3W6KB 5D8KB 4RB1A 2QWWA 5F64A 2BNMA 5L3FA 2VXZA 5FGMA 1BI0A 4KMUX 2ZBKA 4MQ9F 3QU3A 1ONVA 5FD5A 4MUVA 5K1YA 1LKNA 2FA5A 4GULA 2W57A 4O3MA 2FE3A 2ZKZA 2PHDA 5FCCA 1OYYA 2Y0OA 1ODDA 2JRTA 4GO1A 1GXQA 1BM9A 1DGRA 5CJ9A 1ZRFA 1J1LA 1TQMA 5LLQA 1CAWA 3WTSC 4KIGA 1HSJA 1T6SA 3ZMSA 3C18A 1NZCA 1W7PD 3HTSB 5CVVA 4EVIA 2FMYA 3P9CA 4WK8F 1E2XA 3TDUC 4A2UA 4HA8A 2L01A 4GCVA 1CAVA 4EJWA 1UPIA 2TDXA 5EEGA 2EA7A 4DINB 1XCBA 5CVRA 2QM3A 1IAWA 4UV9A 1U5TC 5BXXA 2Z5UA 2WWYA 4IEYA 4R79A 1O3RA 3KMHA 3RYRA 3ES4A 5D5WB 1UCXA 1ZGAA 1GQHA 1NE6A 2FU4A 1EY2A 5E8IA 3DFGA 3BY6A 3RPUA 3CLPA 1XGMA 2BE5F 3J80K 2UY9A 3SXWA 3FX3A 4LUMA 3O3KA 2F4PA 2ZJ2A 5BS6A 3CL1A 3MZYA 1J2XA 4EV0A 5CU1A 4A0YA 4KICA 1B9NA 4KWKA 1XE8A 4GGGA 3DN7A 4P9FA 4HX4A 5K5RA 4U88A 3U11A 2RNJA 1G3YA 5F6FA 5D4SA 6PAXA 5I0TA 4O9GA 3C1DA 2ISYA 4IEVA 2M30A 4XF3A 5D5VB 4ETSA 2L02A 2B8MA 1OR7A 3V8KA 4YIIA 2P8TA 4A0ZA 4PGHA 1BIBA 4BYYA 2A5YB 3EJKA 5HI0A 3GYHX 1G4DA 3L9FA 1G3SA 2DFIA 2P7CB 1BI2A 4M9SA 4CDGA 5E1RA 5AONA 5FLXK 5I0UA 3H8UA 1VJ2A 3LAPA 3Q9VA 3FM3A 5L3GA 3P9KA 1XGSA 4ZU5A 2GC0A 3OCPA 5AIQA 2DI3A 3ML6A 3P7NA 3J80Z 2I45A 4AQ2A 4OMYA 3CLOA 4WBBA 1SFXA 1RNLA 4CGZA 4ENMA 2Z33A 2EB7A 1V4RA 4OINF 2P6TA 1BIAA 1DDNA 1TW2A 4XFGA 4M9XA 2O0YA 1RZ4A 3H9AA 1CAXB 4XFHA 4YFKF 4M73A 1FI2A 1TTYA 2UXNA 3I54A 3WTWC 2XL9A 2CSOA 2E7WA 1RUNA 4G7ZF 4G7OF 3FXQA 4QM8A 4RGRA 5A2QK 1R7JA 2EA2A 4KDPA 4JBAA 3HRTA 3ECOA 3JSPA 3SZTA 1OD5A 3Q5FA 3VEPA 3ELKA 3BDDA 4NQWA 5HVQC 2NNYA 1XRUA 3K0LA 1YW8A 3WGGA 5FLXZ 4FBFA 1TLHB 5I93A 2K4JA 5H6RA 5FPZA 5FLHA 1IPKA 3RYPA 1YFYA 1IW7F 3SHFA 2GWRA 3PQJA 1O57A 2FBIA 1YWKA 1RIOH 1KYWA 2DK5A 1YS6A 3R0JA 3GBFA 1LB2A 2F5DA 3K9TA 2Z69A 3HUGA 2ESNA 1HKSA 1O5UA 2K9ZA 1ZYRF 2D40A 1B1BA 2XHKA 4HF1A 5CVUA 3DP7A 3H1YA 3DKWA 3HQXA 1UW8A 4E2SA 4IETA 1HW5A 1WI9A 2QVOA 5ICGA 5BPDA 2HEOA 4HVRA 1UFMA 2MH9A 4HN1A 4FHTA 5FFXA 1R1UA 1GXPA 1ZN2A 1IZ1A 4U0WA 5JSOA 4L5IA 4IEUA 2A69F 3CO2A 5A2QZ 3MPBA 3KGZA 4IJAA 3IRRA 3T5XA 2ACJA 2CW0F 3F8NA 2CAVA 4MV2A 1I5ZA 1ZX5A 2YPRA 2NAZA 5JFRA 1O3TA 2ZNYA 1BBYA 4RB3C 2EA4A 1CAXA 4LFUA 1K79A 4KYWA 1UHWA 2HJIA 2QZ8A 4L9TA 4ZZDA 3J81Z 3ABUA 5D4RA 2FBHA 2RQPA 1G3TA 3EUHA 1V70A 2H94A 4ZYDA 3GYDA 2IA2A 4UBGA 1BC8C 3GFIA 1IPJA 1T0FA 5I0RA 1SD7A 2GAUA 1ON1A 2LDUA 2EV6A 2HYGD 2IXLA 1HBXG 3BU7A 3D0SA 4L11A 2P7VB 3PNAA 1EYBA 5CVIA 3N4MA 4M6YA 2E7XA 2A6EF 1XMKA 3QOPA 4HSJA 4J1WA 2ETEA 2RV8A 3U10A 3WW2A 2L4AA 4Q5SF 1ZRRA 3NEUA 2V1XA 5KHIA 2JPBA 4ZYHA 2EV0A 2XRNA 4OIOF 1JHFA 1J75A 3E5QA 1CX4A 1U3EM 4R8HA 4K2EA 5J8FA 3FJSA 3VODA 4OU0A 2GQQA 4RB0A 2QDRA 4FAGA 5ILUA 3V7CA 3OGJA 5FFZA 4PDKA 1NE4A 5ERIA 2XAQA 3GVAA 4BIFA 2Z99A 3L2CA 4Q29A 4M72A 5JVTA 4Q4ZF 1J0RA 4ORFA 1MJAA 3J7AO 3E5XA 3TNQA 3SFZA 5HLIA 1HXDA 4AWXB 4Q48A 4BHBA 1IN8A 3BROA 3S7EA 4XSXF 2Q30A 3TOBA 1J58A 4YG2F 4I2OA 1ZZBA 2ZCWA 2AXLA 4I7HA 4L18B 3B02A 3H7JA 2ZMEB 1HKQA 3BJOA 3JAMK 4EWDA 1QZYA 3OTFA 1MGTA 3KCCA 2PJPA 2YX7A 4EGYA 2IXJA 2HQNA 3LA3A 4LLLA 5BMZA 3KP6A 2OU2A 1QO0D 2MBFA 4LMYA 3F8BA 3TGNA 3GZ6A 2KIUA 3VHRA 2QQ9A 2FF4A 2FOKA 4B09A 3F8MA 3ERED 4G6QA 4MGRA 3ETQA 2MNGA 4KU8A 2OZJA 2KIMA 2ZO4A 4O9EA 2AS5F 2HOEA 3NL1A 1XD7A 1J3QA 3K1MA 2O8XA 4HF2A 4IRIA 4IERA 3VOEA 1DZRA 4Q0QA 2JZYA 5J6XA 3FHIB 2VBYA 2H27A 3VB2A 3REOA 1X3UA 1ZREA 5JSPA 4CHUA 2BGCA 4KIFA 5ED4A 2ET7A 1Z05A 4LLGF 4KT5C 4NB5A 1NHAA 2F5EA 3QAHA 1O5LA 4JTOA 1YLFA 1QY4A 3TQNA 5DCFA 4AD9A 2PAMA 3C3VA 3V7RA 1IXSB 1UB9A 4HX8A 2UZKA 4RGUA 1GVJA 1LR5A 1XGNA 1PP7U 2O6GE 1LRHA 1ULYA 4IHSA 4P9UA 3HT1A 2FNPA 2MA3A 5KHJA 1K7AA 1YIOA 2VC1A 3KETA 2LSOA 3DL3A 2VT3A 1U2WA 2YX4A 3LA7A 2COMA 1RC6A 4ESJA 4TV7A 1DZTA 4GYGA 1HSTA 4PGGA 4XFAA 2EWNA 1Z6RA 2ZMEA 4EJUA 1ZZ9A 3ULQB 2RN7A 4HYEA 1TQPA 2W85A 1HKTA 5E18F 5HOOA 3F23A 4AVAA 3GF2A 1FLIA 4OFGA 1QZZA 2X0LA 2YSRA 3ABTA 1XGOA 1JGSA 4NHJA 3I58A 1ZRCA 1IRGA 3GW2A 4A5MA 2HWVA 4ZZLA 5D5UB 2QBYB 1FWZA 3F8FA 4L2NA 4RD7A 4XF9A 1FC3A 5DEQA 3I4PA 4HN0A 4LG0B 1YO5C 4HMZA 1RGSA 5LGNA 1J3PA 5FQ0B 4Z2YA 3IKTA 5EFUA 1ZG3A 1JE8A 2DO7A 3H1WA 3H3ZA 1FYKA 2P5LC 3DPTA 5D6FA 4Q47A 2PFWA 3I5UA 1Y3TA 1D8KA 1YQAA 3ZMVA 3TNPB 2NRAC 3V8JA 2FNAA 1U12A 3BPXA 3KSCA 4Z07A 2Q4SA 1OMIA 3C3WA 1FBQA 3ES1A 1RTVA 1J3RA 5ICEA 2JSCA 3V7SA 3SMHA 1BOAA 2PI0A 2X4HA 2LF7A 1MJ9A 3I64A 1I27A 4EM1A 4HX7A 3WU1B 2VBZA 4BNCA 2B9UA 3WW3A 2HTJA 2V1DA 1U8RA 3FMQA 3BCWA 5HDGA 3FWEA 5I91A 4O5VA 4M71A 1TBXA 4UBHA 4E70A 2IXKA 2CV6A 5FDBA 5DCMA 3WTYC 2H0VA 5AVPA 3COAC 3R60A 1P4XA 4MTEA 3KP7A 3FZ3A 2XAHA 2R7DA 3HYIA 1YTYA 3PLQA 1KQ8A 2ISZA 2DLLA 4HQMA 3K1NA 4CICA 4BHPA 3L09A 1WGPA 4D0PA 1ZLKA 4RAYA 3CJXA 1SFNA 1I6XA 2FMLA 4XRFA 2QBYA 2EV5A 1L3LA 1LDDA 2KXLA 4LG0A 5E1XA 3QPTA 4L5JA 2DPUA 5FQ0A 5E1WA 3WE2A 4WWCA 1ZLJA 3E6BA 4LD5A 1YFHA 3I71A 1MKMA 5D1IA 5DD4A 4YIFA 4FX0A 5FO5A 1U6GA 4QX5A 2HDCA 3GFMA 3KP5A 3LWFA 3HSFA 1T98A 4L9VA 1F1ZA 5HLGA 2GZWA 1ZZ7A 2A6HF 2XV4S 5LEJA 2PAEA 4N0BA 3KLNA 2EVXA 1PDNC 2V09A 2HTSA 3KEQA 3KZZA 3SCFA 4RGSA 4QGNA 1XB4A 3MEXA 2XLAA 2RDPA 2XASA 4XLNF 4H7LA 1Q1HA 4UUVA 4UHTA 4UNOA 2V1UA 5CADA 3KP4A 2ZFWA 4KIBA 5LHHA 3K1PA 1EV7A 3EDPA 3H3UA 2F5CA 1P4WA 3ISPA 1TQIA 2HYFA 2QQBA 3CEWA 3KEOA 3UKNA 2E1NA 4IF4A 2GU9A 2VOOA 5JR3A 4WX9A 1YG2A 2PBIA 1ZVFA 2VOPA 1R22A 4U0VA 2KIFA 4MGIE 1FBSA 1WA4A 3JSOA 4ESFA 2VODA 4OIPF 5BY5A 4BXUA 1QWRA 1Y0UA 1KQ9A 2XKPA 3SCHA 3ZMUA 4XSZF 2IP2A 2PFBA 1WQ2A 1REPC 3BOQA 4RAZA 1G6NA 3JZVA 3O14A 3ZMTA 1IN7A 3EO6A 3R0AA 2MPFA 1DPRA 3QU6A 4QGLA 5BPXA 2PQ8A 4AIHA 1B9MA 3DEUA 1YW9A 5J8CA 4XBFA 1FOKA 3LAGA 2LF8A 1G3WA 1ZG5A 4XF4A 1Q43A 4U7DA 1FXZA 4HV6A 3NKTA 1LJ9A 2DTRA 5FB2A 1OKRA 2GA2A 4DNCA 3U2RA 3C7JA 1EP0A 4LA2A 3J81K 2F5FA 1J59A 2O61A 3RI4A 3HRUA 2D2WA 1BI1A 1IXRC 1FYMA 1MDMB 4NVPA 3K2ZA 3HSRA 1D8JA 2IW5A 3E5UA 1O7FA 2MLGA 4AQ6A 3R6SA 4HVOA 1FYLA 1VR3A 3ELNA 2ESHA 3LZZA 4JTNA 4M6XA 1JUHA 2PTMA 1MJBA 3NSTA 3RKWA 3I59B 1ZARA 1AWCA 1FP1D 3MDPA 4PIXA 3G7DA 4WXCA 4KFCA 1SD5A 1Z91A 4IEOA 3EYIA 3DPLC 4S05A 3USSA 3UKTA 4DQ2A 2OPKA 1CGPA 4EROA 2BEOA 3FFQA 3CJNA 5KBFA 3SXYA 3LQRA 2UYBA 2D5FA 4E2QA 2YR2A 2OD5A 3F3XA 3FXRA 1O3QA 1H9TA 5L3CA 2QJVA 4HW0A 1R00A 2J5OA 4PIZA 1UHMA 1FBUA 2KKOA 4B29A 2WFPA 2OZ6A 2ET1A 5DDGA 1J9IA 3LSTA 4GYIA 4BH9A 4IEZA 1JHHA 2XAJA 2L4MA 4IXAA 1HQCA 3ZN1A 2Y75A 2GC1A 3RNSA 5T3NA 1R5GA 4EJOA 1ZGJA 3HIFA 2XVCA 4Y15A 3I53A 1CF7B 2MH2A 3PVBB 4XF0A 1S6LA 4OIRF 1MDMA 1IRFA 4I09A 4HSLA 3GWZA 1SFEA 4P9GA 4JQFA 3CTAA 3WU0A 3F22A 1SD4A 4G94A 3JW4A 3HHGA 3RJPA 4PZJA 1Z7UA 3MFKA 1OYIA 2DQRA 3HRMA 3UKVA 4OIQF 4XFCA 2VT2A 1I1GA 4N9HA 3ZMZA 5I8SA 1PUEE 4KU7A 5E16A 1T39A 1YLLA 3RIRA 1YUDA 1STZA 3RYKA 1JXSA 3BB6A 2VPVA 2MHFA 4HVQA 2EFNA 3I59A 1KGSA 5LGTA 1ZZCA 3CF6E 4HLTA 3JTGA 1H9GA 3CUQB 2JTVA 3F8CA 3WGHA 1W5SA 4H0EA 4R1HA 3GZ5A 4FT8A 3H7YA 2QNKA 5BOXA 3LAJA 1FP2A 2OBPA 2VBWA 4KWLA 1BI3A 5IT9K 5BUVA 1LEBA 3KZYA 4KL1A 2VQAA 4LUKA 2PMHA 5E20A 3OV8A 4EGZA 1KA8A 5LRRA 5EZWA 3CUOA 4EM2A 3WE3A 3CO7C 4AXOA 4K8FA 4QGMA 2G9WA 2GC3A 2MLKA 1FNNA 2R3SA 1X8EA 1R1TA 1DUXC 2B5HA 1U78A 2MD5A 2OYZA 2K4BA 3E3VA 4FX4A 1J7KA 3HSEA 4IESA 2XGXA 4Y17A 2CAUA 4ZU7A 1YHFA 2DT5A 3IWZA 1XCVA 1ZAOA 2QYOA 3FMRA 3WW4A 3TO9A 3W6JB 2FRHA 3HT2A 4EWEA 1SMTA 4AVPA 1EH7A 1CF7A 2W84A 3CO6C 5JSRA 4ZH4F 1B6AA 2L54A 1XDSA 1F4KA 2A68F 2WTEA 4LA3A 4HAMA 5J48A 4RS8A 3DV8A 5ILVA 2HR3A 2QENA 3RPQA 4MQVA 2P4WA 2P17A 1B4AA 4GXOA 3WTUC 2Z2SB 3IRQA 3ROUA 4LTAA 1FZPB 4ESBA 2IRFG 1PMIA 4YNIA 4UVAA 1R36A 2C6YA 3NW4A 3K69A 3EQEA 2XAFA 4JK1X 5IT9Z 1KU2A 2IT0A 1FSEA 2DCTA 3GFJA 2PYTA 5JHUA 1RI7A 2G7UA 2A61A 4MH0E 1WWXA 4U7BA 2V6CA 4Y13A 2EFWA 5TJJA 3NRVA 3KGLA 3AAFA 4QLCU 1Q5OA 5DCMB 2OA4A 4XLPF 3F6VA 3HOSA 3CUQA 2VBXA 2GIVA 3GUDA 4AIJA 1W7PB 1WRJA 5KHHA 4MGYE 2K02A 1XSVA 3P9IA 2VC0A 2G7HA 4ZYEA 4WVZA 3T8TA 1P6RA 1UIJA 3FMSA 2FQPA 4LULA 1XDUA 1BN5A 4EWAA 2H6BA 2KJCA 4P55A 1D5VA 2P6SA 4KN4X 3FF5A 1Z1DA 4P96A 2IA1A 1SD6A 1YW7A 2XL7A 4KWJA 3I0TA 3Q9SA 1TNSA 4FAHA 3ECHA 4I3PA 4G9YA 3S2WA 3GFLA 4MX3A 1NXMA 4OMZA 2OA2A 4I98B 2ATFA 1WKMA 3LFKA 1AOYA 3M8EA 4L9NA 1F5TA 5FD6A 3WW1A 5KHGA 1TQ5A 1B59A 2VONA 4QXKA 4M9ZA 1U5TA 1ZZ8A 3GXOA 2P5VA 3MAJA 5L3DA 4JV4A 3EETA 1LNWA 4J1XA 4MEYF 1XSDA 1ZG1A 2HQRA 2D1VA 3GO5A 2PQQA 3IDCB 1OI6A 3GLXA 1SAXA 5K8SA 1PM7A 2LKPA 2NYXA 2RKHA 2XKOA 4HDUA 3EQLF 3QP5A 4YFXF 5C6CA 3NQOA 4A12A 5JCTA 2BV6A 1QXJA 2NS0A 3WTVC 3QP6A 1FPQA 4HZFA 2UXXA 4Z82A 5CVJA 1ZH5A 3TDZC 4YARA 3NJZA 1EH6A 2ZNZA 3R4KA 4KUMA 1IN6A 4MZUA 2PHLA 2CGPA 5H6QA 4IHTA 2E9QA 3EYYA 3TO7A 1P92A 4QM9A 2Q0AA 3WTXC 1K6OA 1W7PA 5LHIA 3CUQC 2XUBA 2GXGA 1WLTA 3N97A 1ZRDA 1X82A 4AVCA 3IBMA 2PMUA 3LQQA 3B73A 5HLHA 5HS7A 4LEJA 4YYOA 4XFBA 1MZBA 1R23A 5D5XB 2Z9OA 5E8GA 4YRDA 2FSWA 3L7WA 4LLNA 4CYDA 3GX4X 2CQKA 3LOIA 5LHGA 3U1DA 1UIKA 2MC3A 1IF1A 2RVCA 1LQ1A 3H1MA 3O6BB 5J7MA 2GH2A 1L3JA 2IA0A 4UV8A 4WXDA 2M5WA 2D1HA 3M1EA 4ON0A 3E6MA 3MZHA 2D93A 3MYXA 2VECA 2QLZA 1FX7A 3S0MA 4HBNA 4LLOA 3SQNA 3BJ6A 2K7LA 2CFXA 1C0WA 2HZTA 4KNYA 3IWFA 1ZNPA 4EQQA 4JVAA 2HKOA 2FBKA 2PLYA 1OYWA 4ZYGA 1T38A 5JR7B 3EHKA 5CLSA 2IXCA 1RL3A 3M70A 2C0ZA 5LBQA 3IC7A 1OPCA 1S8NA 5DYMA 1QXRA 5DD8A 5ICFA 1O7LA 3ST7A 1LEAA 2ADUA 3BP8A 2P5KA 3TKYA 3F21A 5TRDA 2ELHA 5I0SA 4XETA 1SQ4A 2RGVA 3TOAA 4MGZE 1NYWA 3OOPA 4IVNA 4L9JA 3E6CC 4WF2A 4HBLA 1Z9CA 2PEXA 4P5OA 2PG4A 4AIKA 1IN4A 3F72A 3LWCA 1Q3EA 1RUOA 2XROA 2M8EA 2IXIA 1HW2A 1L0OC 2N7GA 2HGCA 2W24A 5I8YA 1KU7A 1R58A 2QUFA 1KU9A 1YYVA 3T1BA 2D5HA 5FPXA 3KP2A 4HLXA 1XMAA 1QBJA 3DF8A 1CAUB 1OFNA 4XFFA 2PA7A 3I7DA 3DQVC 3HTUA 1QQIA 2ZXJA 3FZVA 4UVBA 5DUIA 4YSFA 3E97A 3E6DA 5LRSA 4E2GA 4I02A 1USTA 2DK8A 1ON2A 3LA2A 4CO8A 2Q0OA 3WTZA 4ENNA 1K78B 4EJTA 3BWGA 4ONUA 1Z6TA 1Y9QA 2A07F 3TO6A 3FHZA 4PCQA 3KP3A 2WV0A 2NNNA 1MD0A 2XAGA 1DP7P 4D7TA 2BNNA 4I01A 3IHUA 4HV5A 2DBBA 2VE9A 3KLOA 3MWMA 4G8XA 1W5TA 4A6DA 4EMSA 1SFUA 4MEXF 3D82A 3S7IA 3M8FA 1H0MA 5DV5A 1PP8F 3BPZA 4M74A 3HOTA 2RC4A 4IEWA 2UWMA 5JAXA 3GEZA 4RGXA 5CYVA 3FXUA 2BBYA 1P2FA 1QNTA 2EFPA 2E1CA 1F9NA 5K5QA 2DW4A 3KE2A 3FE5A 3OF1A 2OQRA 4KN7X 4LK0F 4ZU4A 3ZQ7A 5FLJA 2ZKLA 1FSHA 2IJLA 3ZMDA 2H09A 4HF0A 4IRHA 4LB5A 4LK1F 4Q0UA 3BJAA 1QGPA 3R61A 3U0ZA 4OLLA 1J5YA 3WTTC 3BZ6A 3U9GA 1I1SA 1GQGA 4MGKE 5BPIA 4X6QB 2Z3YA 2UY8A 1E17A 1CAUA 1TW3A 3RTRA 4G7HF 4I0BA 1O4TA 2YU3A 2HKXA 4RB2C 2O3FA 4Q0VA 2XIGA 1ZZ6A 2OAZA 3H50A 4WZCA 1USSA 5K5OA 3RZZA 3MCZA 1YFWA 3WODF 4MTDA 1XN7A 5KHKA 2GA1A 2IVMA 2FQ3A 2O03A 4A5NA 4PIYA 2LNBA 5KK1A 3M3IA 2B0LA 2CWEA 4R52A 3FM5A 4UXAA 1K78A 5HDNA 5F1RA 4QWQA 2V9VA 5FLIA 4OOIA 4CZZA 4HQEA 3DXJF 1XSXA 3PQKA 4IEQA 3H92A 1LVAA 3T8RA 4KMFA 4I0AA 5BV6A 5JI6A 2KRFA 5D6EA 3D0JA 2JT1A 2M87A 1V3FA 4Q0PA 1P4AA 4XF1A 3T0YA 2Q8KA 1VTNC 2IXHA 5HS8A 5E1ZB 5KVRA 2HS5A 5LGUA 2K27A 2EJRA 3V4GA 1YFUA 4HOBA 1YS7A 4S04A 2JPCA 2M45A 1VP6A 1YFXA 1KYZA 2BYVE 4IEPA 3RDIA 2BNOA 2GC2A 5DUKA 4IEXA 1EPZA 3L00A 3D5LA 3BPVA 4F8AA 3OD0A 2CYYA 2DAOA 2FXAA 2Q2EA 5HDKA 2Y0MA 2CO5A 2QVSB 2Q1ZB 4A0XA 4KA4A 5J3UA 2PN6A 2KJBA 3VFZA 4HLYA 3JTHA 4YFNF 3ZPLA 2XLFA 4Q0SA 4UXNA 2H6CA 1BJAA 4EM0B 5L3EA 1D3YA 4F7ZA 1FY7A 1KU3A 3QPHA 2FEZA 5BQTA 3G3ZA 2UYAA 2QCSB 3ZP5A 2K0GA 1XE7A 2VN2A 1X8MA 3HHHA 2D45A 4QMAA 2EAAA 2J5PA 5ILSA 5I8TA 1U5TB 2VE8A 1IN5A 5AIPA 1IXCA 2EFOA 2IPQX 5LEKA 4WCGA 2DQLA 2ETHA 4TLFA 3M7GA 1EH8A 2IC1A 1UCRA 1WSUA 3QRFF 4A6EA 2STTA 3WG9A 1QPMA 2STWA 1TNTA 2O1QA 1T2KA 2EK5A 4BQAA 2CG4A 3CDHA 3RKYA 2R7FA 4LJZF 1H1MA 1ZHFA 2HFHA 4U0YA 2PAKA 1W4MA 1S29A 2M1BA 4N9IA 5C8WA 3SHRA 4G6DA 2W25A 5EEHA 3L2HA 2XLGA 2OQGA 4L0ZB 3ZN0A 1DGWA 5H20A 4CXFA 1S3JA 1HW1A 4B8XA 4IPAA 2QQAA 1R1VA 4LGWA 1S7AA 4HDVA 4BAYA 4MNUA 3JAMZ 3RKXA 1BC7C 1SEFA 1UD1A 4PJYA 3G73A 4EJVA 4O6JA
chains in the Genus database with same CATH superfamily
4E7HA 2ZX3A 1BJZA 2EFQA 1RKTA 4IV1C 4P9LA 4LNVA 2JG8B 4ENKA 5K0UB 1CQTA 3V0AA 3O1RA 3IL2A 2JD4A 1LDJA 2IVIB 3NVCA 2EF6A 2DPDA 1AU7A 4IRGA 3IUOA 3MQ0A 4ENJA 4OWRB 1S7OA 5HS9A 4BHCA 1AL23 2Q8OA 4N7IA 3ZPOA 1WJDA 2BFUL 5IVEA 2VJIA 4MHGA 1R5HA 2W48A 1GHCA 3ILFA 5C5UA 3ZYPA 1Z7LA 2Y48A 2DBNA 4P9YA 4K40A 3T0DA 2HEVF 2GXBA 3P5BA 3WZ1A 3BTAA 4L0YB 1TME1 5GLTA 3ACLA 4LB6B 3BR1A 2OW4A 5HCHA 3CJIA 2FDGA 3L2QA 2XBO2 1W0TA 2WB1N 5F64A 1FPN2 2BNMA 5L3FA 2ZXIA 1QRYA 5F0HA 2DVDA 2RNGA 5K7ZA 5FD5A 2WNUC 1DQ2A 2AZ5A 5A3WA 3OPZA 4O3MA 5GLUA 3LEMA 2UWAA 2HWC1 2Y38A 2X48A 2PXJA 5LBFA 1UAIA 5FCCA 1QJY2 5GAGJ 1ZQ3P 2DUPA 2XBO3 4KBZA 3LPFA 1IC8A 2QQIA 3M7AA 3NNGA 5CKQA 3E0JB 4M3CA 1DGRA 3LCPA 3CJRB 3PJRA 3RJRA 3J7MA 1D4VB 5FYZA 1TQMA 4HG6B 3MIHA 1NCRB 2RDRA 4NHKA 2G9GA 2KZVA 1QIQA 1T6SA 4D5FA 3TN91 3C18A 1NZCA 3V56A 1W6NA 5CVVA 5E6HA 2FMYA 4FO9A 2JA7J 3VHOA 4A2UA 3CCVI 1QJY3 4GCVA 2NS8A 3WG4A 2D6LX 1NZIA 2LY1A 3IKWA 1R081 5EEGA 2BP6A 3ESWB 1WZXA 4XL9A 2L5QA 4Z8BA 3VBSB 1MNMC 3RYRA 5D5WB 1OPOA 2AC1A 1GQHA 4TSVA 3CLPA 5FAXA 5LATA 1HRV2 3ZYJB 1OUSA 4S2GA 3NWSA 1BK0A 2N8GA 2F4PA 2ZJ2A 3HXLA 4P14A 4E7LA 5CU1A 3HEFA 1XE8A 4GGGA 4P9FA 3U11A 2CYFA 1QQP1 1HN0A 1OKQA 1DP0A 3C1DA 5FKLA 4ETSA 1UKRA 2L02A 3OYJA 2B8MA 1OR7A 3V8KA 4EN9B 4YIIA 2OIIA 1HRV3 5C4JJ 3ZFGB 4A0ZA 4PGHA 1WW4A 1BIBA 4BYYA 5HI0A 3GYHX 4AEDB 1G3SA 2DFIA 3CU7A 3AG3H 3WDWA 1KONA 1CJPA 5G05L 2VGDA 5FP3A 4XIDA 3GF6A 5FLXK 3H8UA 4BQ2A 5FROA 1X58A 3N9PA 4UW6A 4QSHA 4XOGA 1QHGA 4ZU5A 3VDDC 3OCPA 2RREA 1PZ8A 4BK4A 3ACFA 1GOFA 2DI3A 2RQQA 3ML6A 4AQ2A 2VUJA 3DBHB 4OMYA 3CLOA 4WBBA 1W8TA 4XUTA 5H9RA 2Z33A 1NA1A 1V4RA 1W36D 2JUGA 4OMDA 2W1UA 1BIAA 4ISQA 2LROA 3OL4A 1RZ4A 1CAXB 4XR6A 2ID3A 2GBYA 1YRNA 1NAEA 3ITQA 2E7WA 2VE1A 1IG3A 4QM8A 4CUCA 5IAVA 2CMPA 4MYEA 3S17J 4QU1A 1OD5A 1PK6C 3PTYA 3VEPA 3BDDA 4NQWA 1XRUA 3K0LA 3HJRA 2VOXA 2DCYA 3C2HA 4FBFA 2W08A 1I9RA 3D5SC 2K4JA 5FPZA 5FLHA 1YFYA 3SHFA 2GWRA 1O57A 2FBIA 1RIOH 3ABLH 2DK5A 2JKXA 4YRVA 3PTRB 1YS6A 4PBPA 4NIDA 1DU6A 1ZYRF 1QJEA 3PUSA 1B1BA 4HF1A 5ABJB 2BXZA 1BR4A 3DP7A 1UW8A 4N53A 4IETA 3IN9A 4IKFA 1MVEA 5FK7A 2VNVA 2MH9A 4HN1A 3K4CA 4FHTA 3WEZA 3IPVA 4M0NA 1ZYBA 1D1BA 3EYPA 5JSOA 2A69F 1F4AA 5A2QZ 3O1SA 2ZA9A 3GXUA 2JMWA 3P5JA 4AGGA 2XPWA 4AFMA 3O8HA 2R4GA 2YY1A 1XMXA 4C0HA 3GDBA 1I5ZA 1AYN2 4AFCA 2OVUA 3PSFA 2YPRA 2NAZA 5JFRA 4RB3C 5TISC 2QSGX 3POWA 3SH3A 4FXGB 4XBQA 4KYWA 3J81Z 4D6RA 1K4TA 3EUKL 2FBHA 1T2XA 1GFF2 1ULGA 1G3TA 1ETVA 2J1UA 2H94A 1LJ7A 4NHLA 3ZXSA 1SZBA 1ERDA 3AJYA 2RV9A 2GAUA 2LDUA 3WXPA 2EV6A 5EZHA 3M8JA 5E3MA 1AYN3 1Z0XA 1C8M1 3ZFFA 3D0SA 1URXA 1W1WE 4LO6B 3PNAA 4C91A 1EYBA 1MPXA 4CEYC 1OQYA 3JBG2 1SVMA 1OCPA 2BUKA 2QQWA 2AGSA 3FL7A 3OEBA 4YM0A 3FBYA 5KXEA 2L7ZA 2L4AA 1V6MA 1MBHA 3BR2A 1MS0A 2DV9A 5FRAA 5KHIA 2DT7B 3QOEA 2XRNA 1G9DA 2M3AA 4OIOF 1JHFA 4RR3A 3PO3J 1OKOA 1LE8B 1RUI2 4FTHA 4XRMA 2KA3A 4ZS2A 3ZO0B 3EPZA 3VODA 4FAGA 4JDOA 4Y7NJ 1QMJA 4TLGA 5FFZA 1YI9A 3DTIA 3I3QA 3PFYA 2XAQA 4BIFA 1R1A1 2KIQA 3POIA 1OFCX 3H1CA 3H0DA 2TCTA 2XHNA 1J0RA 4S2FA 1JZ4A 1Y8QB 5M3FJ 3J7AO 1RUI3 5HLIA 1GDTA 3B69A 4AWXB 2RG4A 4YVSA 1IN8A 4M01A 4XSXF 3TOBA 1WCUA 1DBNA 4A3KJ 4BIOA 3N9QA 1W8NA 2E33A 4L18B 2VTFA 3B02A 1LFBA 5IVFA 1CZTA 3ZQCA 2YX7A 1IDZA 2L7KA 4LLLA 4BKXA 3UR3C 4ZTJA 1A35A 3GZ6A 3W2VA 1MMNA 4QPIB 1A6QA 4A3ZA 2MW8A 4NHXA 2QQ9A 3ZSJA 3W6VA 3I2JA 5JDBA 3GZNB 2F4MB 2HWF1 3IAQA 2OZJA 2GSYA 1U9NA 2KIMA 2FBEA 3OYGA 4XQ4A 3LD8A 4QPQA 2GM4A 3BKZA 3K1MA 3GTGJ 2O8XA 4IRIA 4IERA 4S2DA 3VB2A 1X3UA 1ZREA 5DPNA 3CCYA 4FPYA 2BGCA 3SNMA 3RZOJ 3FUQA 4CDUB 1FV3A 4LLGF 4NB5A 1NT0A 5T5JA 2DODA 3QAHA 1O5LA 2VZRA 2NQYA 4HX8A 5BNOC 2L0KA 2GOMA 4UWDA 2P3IA 2A6VA 2MA3A 4D94A 5DUXA 5GLWA 5FJKA 4XJ9A 1I3AA 2VBPA 1VBB2 1EV12 1DU0A 4V2WA 4LBJA 2YC0A 4KGQA 1UX7A 1W6NB 5J1RA 2ZMEA 1ZZ9A 4HYEA 1TQPA 2JB4A 3OD4A 1XB9A 4XXAA 3F23A 4AVAA 3GF2A 2FDKA 4OFGA 2YSRA 2LRDA 1JGSA 1ZRCA 5LWBA 2A6XA 2HWVA 2V4JC 3H36A 2V73A 3T1MA 2NVYJ 4QQPA 1W06A 1PMHX 2GP3A 2W0XA 5LGNA 1J3PA 1EV13 2IUWA 2LR8A 1I6HJ 3H1WA 2WO7A 1W8FA 2VQUA 3CBNA 2ZB9A 4YGBA 1YQAA 1AVBA 3TNPB 2WV1A 1U12A 1X3ZB 1OQ1A 4NAOA 5C4WA 3QCWA 1OMIA 1K42A 3RSNA 4OUSA 2JSCA 3SMHA 1BOAA 5EF6A 3JCUC 3MW4A 4G9SB 2PI0A 1QH7A 4RA2A 1A78A 5LA2A 2VLAA 2YUSA 1I27A 4N8MA 3I55I 1Y7BA 3WOGA 5B1BH 4EM1A 1IUFA 4HX7A 2VBZA 3WU1B 4Q4X1 3W5NA 2CV1A 3WW3A 5FY8A 3FMQA 3BCWA 4Q8KA 2ADEA 5HDGA 4JP0A 2R7ZJ 4UBHA 2EIBA 1D5YA 1IS6A 4W65A 4Y1UA 5FDBA 5DCMA 4MTEA 1RKWA 3BTIA 1YIJI 1RINA 2QQ8A 1H9WA 5C8CB 4YZ1A 3SJMA 3I4NJ 4PFPA 3PLQA 2B9SA 1NUKA 2YPJA 4BEHB 2O7OA 4EN8B 3UL2A 2F5VA 2WL1A 1ZLKA 3CJXA 2FCUA 1SFNA 2PHXA 2V6EA 2WO2A 2FMLA 5F2SA 2MYSA 2XAUA 1X3WB 2E7QA 4CP1A 4FXKB 1WHUA 4NO4A 5FQ0A 1ZLJA 4WWCA 2OXBA 5JHFA 5DMYA 2K9QA 4FX0A 5FO5A 2WBMA 1U6GA 4NQWB 2HDCA 4XCBA 2CHHA 3LWFA 1CVNA 1IJWC 2GZWA 4UYBA 5M0TA 4GZ9A 5GZGA 1PDNC 2V09A 2WZR2 2ZEWA 2CGNA 2HTSA 3KEQA 1VBA1 4CVUA 1Z77A 2MEV3 3MEXA 5HLTA 3S93A 4JKMA 3C7EA 2XLAA 2WWUA 4XLNF 5A1AA 4H7LA 2VKHA 1WD3A 1C5IA 3AYDA 3HOZJ 2ZFWA 4KIBA 4NBQA 5LHHA 2X29A 4WM7A 3RG0A 1P4WA 4Q4Y2 3TRSB 2J1SA 3W20A 3OBRA 4B1RA 2WZR3 3RZGA 2PBIA 4RQPB 4JGYB 4U0VA 1ZM1A 4LHLA 3JRIA 4WVMA 1ETOA 2VODA 5BY5A 4BXUA 1H2NA 1QWRA 1R091 4XUNA 4IV3A 3DCFA 1XSQA 2JB8A 1GV2A 3AK0A 4Q4Y3 2CGOA 4K1YA 1HA8A 4CPBA 1JZ5A 4XAAA 2HWD2 1UG2A 1E5HA 4QXBA 2VCBA 3O14A 1IN7A 2P6CA 3EO6A 3R0AA 3N7JA 1D2SA 3FBIB 3QODA 3MKLA 2PQ8A 4TTGA 2DVFA 5L19A 3GTLJ 1B9MA 1IPSA 3DEUA 2EQRA 4YW3A 2WNOA 3CJQB 2LF8A 1JZ2A 2OQ7A 3E1SA 1G3WA 3OGVA 1YHQI 2G1MA 4V19K 1A31A 2BHYA 3HZJA 5JVGF 4DNCA 3J81K 2O61A 3HRUA 2YBKA 1X1BA 2W1OA 2V9PA 2A70A 4OYUA 2VQCA 3K2ZA 4RR3B 5JZGA 1H4HA 1O7FA 4AQ6A 1VMJA 3R6SA 1FYLA 2QSHX 1V5EA 1MSFC 5SV8A 5FY9A 1UOGA 5DXDA 3J7LA 1WH5A 1SBEA 2VVDA 3ZXDA 1T95A 5L7OA 5A7PA 3BTZA 2OX0A 1MJBA 4LIVA 2WQZC 4LBQA 3T2PA 4LOSA 3O1MA 2RM21 2DXIA 1WA6X 3GJAA 1ZBA2 4PIXA 4YVSB 4Y26A 3P3NA 4RLQA 4FCAA 1Q8VA 1YC61 3WNNA 2C1FA 4BQOA 3I2FA 4UW3A 2RS12 4DUXA 1ASJ2 4YZ4A 1CGPA 3SH5A 3WP4A 5KBFA 4GH4B 2WZPP 3LQRA 5EPAA 4E2QA 2DVAA 2OD5A 3ZR5A 3TWIA 3FXRA 1O3QA 1RUJ2 1ZBA3 1R00A 4NPRA 2J5OA 4PIZA 3LSDA 2OZ6A 5HNFA 5A7QA 1U0JA 4GYIA 4GWNA 1AL21 1BEV1 4RFT0 2XSDC 2XAJA 2L4MA 4YWAA 2W94A 2RS13 2VNRA 1HQCA 1SVOA 4LMFA 1ZGJA 4HANA 5FBZA 3LEIA 4CP2A 5CFDA 3URFA 3FKJA 3O1PA 3I53A 1CF7B 4P02B 1RUJ3 1UN1A 1NOVA 1IRFA 3GWZA 4P9GA 4NDLA 3KB5A 2P2KA 2HVQA 3BIEA 3CTAA 3F22A 3LEKA 5DZFA 4A3DJ 1LULA 1Z7UA 4SLIA 3VB9A 1A34A 4DW6A 3ATGA 3UKVA 5F3EA 5I8SA 4C3IJ 5T5PA 1OVSA 4C2UA 1HQLA 4M3FA 1DGRN 3K4ZA 3J7YJ 3H8XA 2ZMNA 3M3QA 4DPNA 4KGGA 1I39A 1XU2A 2LKXA 1ZZCA 3K70D 2YGMA 2EILH 4HLTA 5FPUA 3D5OA 1YJLA 2ZZJA 2MC4A 3ACHA 3HWJA 3BQZA 2JG9B 1NG0A 5LZ6A 2MGQA 1WJEA 1DGLA 1KJLA 4IV1A 5KR7A 4IE4A 2XBO1 2VJ4A 2DUOA 1FPN1 1AF9A 3FKIJ 3TEDA 1ND2C 1SAUA 2EXIA 3ALQA 3VYUB 3AFKA 1JOBA 2LMDA 5IT9K 5FK8A 2PMWB 4YFZA 2EIJH 5CZKA 1TC3C 2PMHA 1BVVA 2YU1A 1V6IA 1KA8A 1ST8A 1VAVA 5EZWA 3CO7C 3WE3A 2FCTA 4A3MJ 4QGMA 5IOZA 2GC3A 2MLKA 1FNNA 1QJY1 1R1TA 1TWHJ 1DUXC 2MD5A 2OYZA 3S6PA 2QKDA 4TXWA 1J7KA 1JZ8A 3LSJA 1FAYA 5J36A 2DT5A 3CDIA 1XCVA 2QYOA 4CDXB 3TBDA 3W6JB 1MZ5A 1KZHA 2W84A 1SBFA 1A5JA 5C4WB 4P9IA 2C5DA 2BW3A 1JOPA 2ID4A 1LOAA 3POGA 4QDSA 4QT6A 1I3HA 4RGGA 4MLOA 1F4KA 2A68F 2WTEA 4LA3A 4HAMA 3DV8A 4QIWN 4G6TB 3RPQA 2P17A 2YZ4A 2DYSH 3J7AY 2Y6FA 4AI8A 3ILNA 4LTAA 2OV7A 2IRFG 5FUNA 3NW4A 1J09A 1NLSA 5CFCC 3HN1A 3SITA 2IT0A 2AH2A 2WNUA 3GFJA 4L5EA 3DEWA 5FPBA 4AYUA 4I0WB 4Y13A 2VZVA 2GMEA 2NOJB 5DCMB 1O4XA 4DXRA 2OA4A 2CU7A 1HRV1 1IKPA 5KHHA 3MW2A 2YUEA 2FD5A 2ADDA 2K02A 3O1OA 1XSVA 1D0HA 2VC0A 1JOJA 1ZBE2 2OT7A 5FY5A 2VW2A 3IAM2 2ZHLA 3WT3A 3NAPB 4P96A 4E8DA 2BXYA 2XL7A 3H9GA 3GFLA 2VOVA 4MX3A 4OMZA 4L9BA 2W68A 1H0BA 1SFOJ 1F5TA 5KHGA 5FD6A 3AB0A 1TQ5A 1B59A 4MO7A 2VONA 4M9ZA 1UXXX 1ZBE3 3FK6A 1ZZ8A 3GXOA 3MAJA 5L3DA 4KQ7A 2M34A 2XPVA 1JT0A 1BZWA 4MEYF 5AC92 2LP0A 3GO5A 1R6RA 1W2OA 3IH4A 1SAXA 4D7MA 3S1RJ 4E7JA 1MBEA 2LKPA 2NYXA 2HXOA 1S0CA 4HDUA 2VXJA 4YFXF 2CSGA 4AI9A 3S5AA 3ZYHA 2EIEA 3NQOA 4A12A 1CN1A 3KZ4C 3AMNA 4W4ZA 5J4VA 1OJLA 2BVVA 1YX5A 5BNPC 2QQMA 1DGWY 4HZFA 5AC93 3VSLA 1N1TA 2ZX0A 4XYXA 1ZH5A 3N35A 5LBBA 4MZUA 2PHLA 3LIHA 5FXVA 4IHTA 3VGIA 3TO7A 4URAA 4QM9A 4I99C 2Q0AA 1W7PA 2ZACA 1GV5A 1FJLA 4A69C 3N97A 4JX6A 1LECA 4Q1RA 4HPKB 3VDDA 4R4XA 3WX5A 1WZ2A 3RWNA 2KQRA 1X4PA 5DM6F 3B93A 1MZBA 1GYKA 2J1RA 2JK3A 2Y6LA 2XF5A 2YROA 2W82A 4CCNA 2WYSA 3LOIA 4JQRA 5FJ8J 5CISA 1V6KA 3OY9A 1UIKA 4QDQA 1VRH2 3T3YA 3O6BB 2GH2A 1L3JA 2VNOA 4YGCA 3JREA 2M5WA 3GTJJ 2D1HA 2XGCA 4ON0A 3E6MA 5FZBA 3VBUC 2JN6A 1OA3A 4IGOA 2JDNA 3JUUA 4DXZA 1LOEA 2ENRA 4HBNA 3BJ6A 4FTSA 3POFA 3KWVA 4KNYA 1VRH3 3BZCA 4GMP0 3IWFA 3VBRC 3B3QE 4XKBA 4ZYGA 1AYN1 4BBRJ 3EHKA 3OOXA 2R7WA 2IXCA 5C3OA 1APLC 2R1DA 4CXXA 1OPCA 1S8NA 5DYMA 1O7LA 3ST7A 5K7HA 2WA0A 3TKYA 3F21A 3O1VA 2AENA 2RGVA 4MGZE 1VZ0A 3OOPA 4IVNA 1V6JA 2J22A 3WG3A 2Y9ZA 2H1KA 4E27A 2PG4A 1UYPA 4AIKA 3A0KA 3JBG1 3LQCA 5IHRA 2IXIA 1TWFJ 4QQHA 2NXNB 2P3YA 3HGYA 2N7GA 5I8YA 1R58A 5D2AA 2X09A 1YYVA 3ZFEB 4JGZB 5FPXA 2W1WA 2XXZA 3GJBA 1OFNA 2PA7A 4FPGA 3PSIA 2RS33 4BOWA 3MBWA 1OOPC 4YW1A 1YCIA 4I02A 2I8DA 3LA2A 1QJU2 4AFDA 4EJTA 3BWGA 1X1DA 3MIFA 2A07F 2YHJA 1JKPC 1DP7P 4QXHA 4D7TA 5FZ3A 5CFDB 2VE9A 3KLOA 2R0QC 2HYXA 3MWMA 3L2RA 4EMSA 1N3OA 2W46A 3M8FA 1H0MA 1SFYA 4RM2A 1DLCA 1QJU3 1W05A 4IEWA 2UWMA 5FO8B 1FOD2 1KJRA 1F9NA 3OYNA 3CMEI 1VB2A 2WT0A 2PELA 3OYFA 3OF1A 5FLJA 4AAPA 5GTHC 1FSHA 1BMV2 2DUQA 2H09A 4IRHA 1H9PA 3P6BA 2IFRA 4LB5A 4BZ4A 4AU7A 2HWB2 3BJAA 3WCSA 5JWPA 2RMU2 2GMMA 2COBA 2JDUA 3MUZ1 4M3DA 4COZA 4IV1B 1FOD3 5A7WB 4MGKE 3S1NJ 2Z3YA 3HNYM 1JT6A 1B72B 2R93J 3LDRA 4Y33A 1D1AA 3CCQI 4G7HF 2NVQJ 4RB2C 4QKDA 4AGRA 3TP3A 2K9NA 3I3BA 1N77A 3FBNB 1QA6A 2CWSA 2G9FA 1D4M2 2GA1A 2O03A 2ZEYA 5KK1A 2UWCA 3M3IA 3VN4A 3CCEI 2B0LA 4QPGC 3FM5A 4YVWC 4E9KA 3I3MA 3GGLA 4QWQA 2WS92 4YM3A 4DBQA 4JRLA 3ZLIA 3DXJF 5FREA 4EZHA 2F4IA 3T0AA 1LVAA 3OYHA 2ZGUA 4I0AA 5BV6A 1XG1A 2KRFA 1LEMA 4XF1A 2Q1MA 4MO3M 3T0YA 1VBB1 4Y52J 3AJZA 5C7GA 1ZKGA 3POJA 4FPCA 5LGUA 3VDCA 4WZFA 2JPCA 1PUFB 3P1IA 1YFXA 1KYZA 4IEPA 3RDIA 2WS93 4DRRA 5A6QA 3T0BA 3L00A 3BPVA 4F8AA 2CYYA 5HDKA 2HEYF 2WNUB 1WVRA 3AMHA 5GKAC 4A0XA 2VCMA 3I8TA 5E8AA 5F8PA 3WD5A 3VFZA 3JTHA 1VAKA 2XLFA 4B4QA 1J84A 3WF3A 3M07A 5FOJB 3CLQA 5EQUA 4MADA 4BU2A 4FFIA 2VL8A 4DOUA 2FEZA 2AQEA 4OHZA 2QCSB 2Y30A 4M3CF 1XE7A 1KQRA 1MR5A 2XVGA 3GM8A 1MACA 1E5RA 2V1NA 1G8XA 4EATA 4QMAA 4E4SA 5ILSA 1GKBA 5I8TA 4A7YA 2E32A 2AXTC 3M4FA 2EFOA 2IPQX 1QJFA 5LEKA 2V4VA 3RZDJ 2DQLA 1O4YA 4BISA 5EYXA 3M7GA 3WQ1A 1V00A 4KH9A 2IC1A 2B46X 1R49A 1UCRA 1WSUA 3ABZA 2STTA 3ZXAC 3PUIA 2Q8CA 3VBFA 2HQAA 2STWA 2ZKNA 2CG4A 1EPWA 3PJYA 4FPHA 1SDDB 4P9XA 2R7FA 3GBGA 5J3LA 1COV2 4EJRA 5FYYA 5JXIA 2WUHA 2CU5A 1APNA 1LFPA 2ZSIB 5EEHA 3H0OA 1OBNA 3ZN0A 4B8XA 3WSOA 3DPRC 5DAPA 1R1VA 4LGWA 2KPMA 1H8AC 3THCA 4HDVA 2OUMA 4MNUA 1K61A 3RKXA 4CSWA 4DO0A 2OF7A 2WT1A 4ATEA 3ZQHA 3LSKA 4O6JA 5A3OA 1H88C 1O3SA 1COV3 1H1IA 3S5QA 2R7XA 1H1AA 1V6LA 2V79A 5DUWA 2P81A 1CAWB 2WZR1 1AJKA 4QQ2A 1W8ZA 4X6RB 4PJLA 2GLOA 4META 3OSFA 4UVCA 2ZGPA 3T2OA 5C5TA 3M9AA 1CAVB 3CZ6A 5EXOA 2ZX4A 3LOCA 3OR2C 1IUYA 2NVXJ 2D3RA 2UV1A 3JRFA 4UOJA 4X6AJ 1CZVA 2FDJA 1W6MB 1PX3A 2OZUA 2WNEA 3POEA 3RQ0A 1PVC3 1GZTA 3PFIA 3WGIA 3VYTB 1QNWA 3N7KA 2WSUA 2BWCA 1B09A 1KFUL 1PK6B 3ZN6A 5C9AC 1XYPA 4Y1XA 3QACA 2WC2A 4C1WA 2HWD1 1G9AA 3NO8A 5BNQA 2KD7A 5E3LA 3LSPA 5FGMA 1BI0A 2FZ2A 2D5VA 2ZBKA 3UV9A 3O1TA 1AR72 1ONVA 1GANA 4E7KA 3PURA 1LKNA 1IQDC 2BOLA 2P3JA 4GULA 3AP9A 1UZ0A 2W57A 2FE3A 2PJRA 2D6MA 2PHDA 4F93B 2VU9A 3DUIA 4YPJA 1OYYA 1ODDA 2JRTA 4GO1A 5D21A 4XQDA 2ME0A 4C3JJ 3VD5A 3S3NA 5FZGA 4FPEA 1SVLA 1AR73 3S2HJ 5LY2A 4KIGA 5IPAA 5FY4A 1S55A 3VL8A 1MEC1 1WWYA 3KQRA 4ASMB 1JBCA 2W91A 3KT1A 4N43B 3B94A 2EPFA 1PMJX 4EJWA 2MD0A 2DA3A 3TL4X 2GNMA 1XCBA 5CVRA 2QM3A 1L7RA 1HB2A 1CQ9A 2WWYA 4IEYA 4R79A 5A7OA 5FZKA 3KMHA 2JWPA 3VD7A 1GWKA 1BW5A 4XN3A 2FU4A 2L2OA 1RMU2 5E8IA 3RPUA 1SEUA 4PLMA 3J80K 1NQJA 1PHMA 3SXWA 2IGNA 1POV3 2CY6A 4ASLA 4LUMA 3O3KA 3MZYA 2WAAA 3OEAA 3CJIC 3NMBA 4CEYB 1PGSA 1J2XA 4EV0A 3WQ7A 3ZYIB 4QKNA 1B9NA 2MABA 1JI8A 2W92A 4KNCA 3JRDA 1A8MA 3DN7A 5K5RA 2RS11 1XYNA 1G3YA 5F6FA 1ASJ1 1KITA 1X2NA 5D4SA 1AXYA 3D4KA 2ISYA 4IEVA 2OUJA 1RMU3 3HUGB 3J26N 3ZKUA 2DDAA 1RUJ1 2DA5A 4RGKA 4A7KA 3M3CA 3BOWA 3RMXA 2WJSA 5ANQA 1BI2A 4M9SA 2WINB 5M5YJ 5LA1A 4EN0A 5LBCA 4KISA 5I0UA 3K4NA 2WZ8A 1B8IA 4YM1A 2A6ZA 2VMIA 1PGL2 3MICA 4B4RA 5J1XA 3RZKA 1YOVB 2VJ5A 5FY7A 3VD9A 2I45A 2O9LA 3QYEA 3H8OA 1OLMA 1PGW2 3HQRA 3OGGA 2P6TA 2KZGA 1OCZH 2CV0A 1TW2A 4V1PA 2HH9A 3CNAA 4BJ5C 3H9AA 2D3PA 1MS5A 3NNFA 2NVUB 2VZOA 2CRGA 2VAUA 4CCOA 1YEWA 4G7OF 3A21A 2EA2A 4ANJA 4KDPA 4JBAA 3BZKA 4N90A 3HRTA 3JSPA 1W0PA 1S0BA 4ES8A 2WZEA 2D6NA 2J1EA 1W2UA 3ZM8A 2VUMJ 1ENQA 1TLHB 4HKOA 5KXBA 1T8IA 3RYPA 5A70A 4ES9A 2CNAA 3VBHB 1POQA 4CCMA 1W6PA 1LB2A 3IT8A 2WO1A 4NOTA 3TN92 1TG7A 3ZSKA 2D44A 3SH4A 4OI0A 1O5UA 5CKMA 2BGOA 5FZOA 4WM8A 2JDHA 2XHKA 2D98A 4C2MJ 4IDZA 5CVUA 1U9OA 4XAEA 1HW5A 2QVOA 3FXMA 5ICGA 1UY4A 4M3BA 1XJAA 2D43A 2BPA2 5BNOB 1UPSA 3VKFC 1W6OA 4JAAA 2YPDA 1UFMA 4BQ3A 5IP9J 1JKQC 4ZYAA 1IZ1A 2XG3A 3QWLA 2HZDA 4L5IA 3TN93 3CO2A 2ZXQA 3MPBA 4GWMA 2ZMLA 5C3SA 3D1NI 3KLSA 3KGZA 5FXXA 3IRRA 4NC7A 2Y33A 2ACJA 2CDOA 1R083 3MF6A 3F8NA 3DYPA 2CAVA 5ACA2 1NA1C 1H4GA 3I2OA 2EIDA 2I74A 2Y64A 2A3WA 5DUVA 1OCRH 1BBYA 4Y5TA 3ZCOA 4DIQA 4AIDA 5KC5A 4A42A 3HMYA 4PT6A 4ZZDA 1NQDA 4FQGA 2RQPA 1VQ4I 2JXAA 3HBKA 4WVVA 2V5YA 5HV4A 1RUH2 1BR1A 2IA2A 1EF4A 1BC8C 4KBBA 4UBGA 5GTIC 5ACA3 1SMVA 3JR9A 1YQ5A 2WNVC 2IXLA 5GADJ 3BU7A 2PHWA 3TAYA 2Q8DA 4EQVA 2D6KA 2E1MC 4CUAA 4AF9A 4A41A 1QQP3 3RWKX 3PM1A 4KWUA 4Q2FA 4UFLA 2Y60A 1ZBE1 3WNMA 5GJ6A 2ETEA 5FMOL 2WABA 1ZRRA 2XVLA 4LBNA 2JPBA 1A36A 4ZYHA 1RUH3 2EV0A 1J75A 4ZXKA 1LCLA 1CX4A 4OU0A 3UYJA 1YQCA 1PX4A 3G4SI 2QDRA 3R0RA 4AYBA 2EBIA 4JX5A 4N53C 4PDKA 1NE4A 5ERIA 3MD2A 1SCSA 2Z99A 1RHI2 4UFJA 5CFCA 1K5JA 2X6OA 5IK5A 4MSVA 1KD7A 3VD4A 5JVTA 1RVF2 1PO22 3ZR8X 1YJWI 5AC91 1SCRA 3E5XA 1W3VA 1M1EB 1HXDA 3S7EA 3AG2H 4I2OA 1YO8A 2AXLA 1TT0A 1UAAA 1BK1A 3H7JA 3LPGA 4NRMA 1HKQA 4ZONA 2XPUA 1RHI3 2ORZA 3X29B 5HV0A 4ABZA 5FR3A 1MGTA 1RVF3 4EGYA 1ENRA 2HQNA 3LA3A 2R1BA 3HB9A 3K77A 3VDXA 3KP6A 3OYLA 4DRVA 4LMYA 3HG9A 5GAHJ 3VHRA 1H8VA 1AKHB 3ZFFC 3ZN6B 3PU8A 3F8MA 4QHOA 3CF2A 3ERED 1XXNA 2QA4I 4KU8A 2YFZA 1O91A 2ZO4A 2HOEA 3USUB 3PDQA 2CQNA 3NL1A 1J3QA 1V5GA 4HF2A 3VOEA 3TEXA 4B7EA 2JZYA 5J6XA 1MS8A 3BCBA 1ND3A 2H27A 2R7TA 3DKXA 3MGUA 2G4IA 5F6LB 4F55A 4CHUA 3W58A 4KIFA 2UWBA 4AE2A 3DLLF 1VRH1 4INDA 4KT5C 2DBIA 2QZ3A 3ZXKA 1NHAA 2DMPA 2VIXA 3TQNA 2PAMA 3C3VA 2YB7A 2DU1A 2UZKA 1GVJA 2BERA 3N9OA 5FV3A 1PP7U 4BPZA 1LHVA 1LRHA 1ULYA 2C4XA 2XB0X 1I1EA 1CONA 1GP5A 2VC1A 4CDWB 2X9DA 4E7ZA 3ABMH 2COMA 1RC6A 3GTPJ 4ESJA 3POYA 4A3EJ 3JRCA 3AZXA 3HKZA 2GNBA 2LFBA 4XFAA 1Z6RA 2CW8A 1JYTA 4EJUA 1WI3A 2RN7A 2W85A 1SPPA 5HOOA 1UU6A 4GMP1 2I10A 4NHJA 1XGOA 4JCKA 4CYCA 4UI9L 3HQUA 4F92B 5D5UB 2QBYB 1FWZA 2Y8KA 4XF9A 4M0HA 3I4PA 1RGSA 4FSJA 1W2AX 4Z2YA 3RQ4A 3IKTA 2A6YA 5EFUA 2JENA 2HNHA 4U36A 5IVBA 4W1UA 2BV4A 2LY2A 2P5LC 5D6FA 1MZEA 3VBUA 4XDOA 4IE6A 3ZMVA 5B4NA 3V8JA 1TWGJ 4OHWA 2GOXB 3C2BA 1BCXA 2JSPA 4Z07A 1QJX2 2WFF2 4FTBA 3T09A 3BPSA 3C3WA 3ES1A 1RTVA 4DB5A 5ICEA 5GAEJ 4FPKA 1V55H 3LSHA 3WY6A 3I64A 2KFDA 2C24A 3B01A 3NAUA 4BNCA 1DGWX 2V1DA 1U8RA 1QJU1 4MHRA 3PNYA 1OT5A 2KHMA 2JA2A 3FWEA 1QJX3 4O5VA 2IXKA 1B8IB 2FDHA 2CV6A 4DUWA 2R30A 4CH7A 2Y6KA 3WTYC 5AVPA 3COAC 4P9WA 3R60A 4BUPA 4OQ9A 2I07B 1YXWA 2F17A 3KP7A 3FZ3A 1SFKA 2V72A 3HYIA 3WNLA 4DQAA 2ZMEC 3K1NA 4CICA 1WGPA 4W6WA 4D0PA 1ALYA 1KXGA 1VIWB 4Y22A 1RUD2 3TEWA 1G59A 2WWJA 5EIYB 4K20A 1FOD1 1L3LA 1WCSA 4LG0A 1VAMA 2LVSA 1YE9A 1OH3A 1OA2A 3QYFA 2CS3A 3A03A 2HWF3 1SANA 3OYBA 3I71A 1C3HA 4XJ8A 1LODA 1BMV1 4YIFA 2HWB1 3HSFA 4L9VA 4COYA 1F1ZA 2WIIB 5HLGA 2VQGA 2A6HF 1RUD3 2RMU1 3APBA 3VHNA 3CMGA 1QU3A 4DZJA 4OHVA 1TP4A 3AG4H 3CKHA 4UW5A 1R64A 2DTYA 2EVXA 2R6QA 3MFCA 3OY8A 3A0HC 2QQKA 4PF1A 4XE9A 3SCFA 4RGSA 2M4KA 1XB4A 1BW6A 3S15J 4CA0A 1UMIA 2X5IA 1OFSA 3BLYA 2V1UA 3KP4A 4QAWA 1F5JA 2D6OX 2ID6A 1TQIA 2HYFA 1D4M1 3KEOA 1Y56A 1MNEA 4IF4A 1WJAA 2Y31A 1W6OB 3FHNA 2WS91 4WX9A 1SLTA 2KIFA 4MGIE 2JG8C 1SLBA 3O7OA 1BHGA 3AKQA 3JSOA 1U5XA 4ESFA 3KZIC 4B43A 2XWBB 5FKBA 4Z92B 1K6YA 2ZEZA 1MSEC 4XHBA 4XDPA 3THPA 3SDGA 4YIRX 2KR2A 3ZMUA 1B35A 1Y4WA 2IP2A 4V2FA 4NRPA 2YV8A 3A01B 1E5IA 4SBVA 1VI0A 1F35A 3SISA 3KT7A 2DDUA 3IDAA 5EJ3A 3CCRI 4HKLA 5A3LA 1G6NA 4KT6A 3F9KA 5LK5A 1ND2B 3JZVA 1MVQA 3ZMTA 4N4OB 4M00A 5CG9A 5EJZB 2CH0A 4QHBA 5BNNA 3RQIA 1UYXA 5BPXA 3T4VA 1HB4A 2Y6GA 4XBFA 2HI3A 4QPGA 1QPIA 4YVWA 2W47A 3I2GA 3HN3A 3E1F1 4Z2WA 5IK4A 4XF4A 1DQ5A 1Q43A 1JJ8C 4U7DA 1UMHA 1FXZA 2QKMB 2BTVC 5F1JA 3RZMA 2DTRA 3WHCA 5FB2A 4NMIA 3C7JA 3OYWB 3RI4A 2F4LA 1BI1A 5FWEA 1OISA 4XICA 1MQTC 2IW5A 3S8PA 4Q4X3 4BB3A 1UOBA 1UX6A 3JRHA 1VR3A 4WM7C 2DURA 1OH4A 2L7FP 3EB7A 3GBWA 2ESHA 3LZZA 1RUC2 1S1AA 2X10A 1H8TA 4Y20A 3JQXA 1JUHA 4IOAF 4B4PA 1NCRC 4GDFA 3NSTA 4QU2A 4NNJA 3I59B 3AKRA 1AWCA 3U14A 4IW3A 4YZ3A 1VE0A 2JE8A 3VDBA 3OBZA 2ZJCA 5FWJA 2FOWA 2LREA 1SD5A 3UGHA 2W1SA 1U5ZA 5FZEA 2LD5A 1YIPA 1Z3YA 1VQ9I 4S05A 3CD6I 1HLCA 1RUC3 4LOCA 2OPKA 1COV1 5HCAA 2BEOA 2VUCA 3CJNA 3RI8A 3SXYA 3D8CA 3P3PA 4MXWA 4A3FJ 2I2SA 2KISA 2D5FA 3VBSC 1D0ZA 1DCSA 2ZGNA 5L3CA 2LS6A 1UHMA 3CCUI 3HD8B 5DDGA 3FC0A 1SLAA 3AKPA 2YMZA 5M3MJ 1JHHA 3CDZB 4DUVA 2NP0A 1QDCA 3ZN1A 2GDFA 2GC1A 5T3NA 2AACA 2Z79A 4XACA 3BG6A 4J01A 3LDKA 4FFFA 4OAZA 3PVBB 4XF0A 1GZWB 4B3AA 4OIRF 4HPQA 1MDMA 3MIGA 4I09A 4HSLA 4PF5A 3WU0A 3S57A 5HXMA 5JZGC 2RHPA 2FD8A 3MFKA 1TNFA 2GP5A 5FZHA 4YGEA 3DXUA 1FNYA 2W9XA 1OURA 4CP9B 1JZ7A 1I1GA 1UJ8A 5BNPB 3ZMZA 1YLLA 3RIRA 4NWWA 3BQYA 1STZA 4MHUA 3ZOIA 1HDKA 1JXSA 2RVAA 3BB6A 1OD3A 2O0OA 2VPVA 5IJRA 5CAZA 2MHFA 1VFCA 4HVQA 2EFNA 4K21A 5TSWA 3CF6E 4CEWB 4M6VA 3D6EA 1W0UA 4UUSA 3CIHA 4CCEA 5FPAA 5EGOA 4D69A 3VD3A 2LLKA 2QNKA 5BOXA 1FP2A 1UY1A 4PLNA 3DGTA 4CYCB 3A02A 5BUVA 1LEBA 3KZYA 1AR71 3TOJA 1ULEA 4II3A 3CMAI 5E20A 3JQWA 4LORA 4EGZA 5LRRA 3EUHC 4C8DA 1XYOA 3I2DA 3BUCA 1I50J 1TEIA 2X05A 3CUOA 4FOWA 3LIGA 3BI3A 4K8FA 2ECBA 5F0CA 2R3SA 1X8EA 3E3VA 4P1WA 3I2HA 1RJ8A 3Q8EA 5F27A 2ZGRA 2ZZQA 1MZ6A 2R0FA 1LGNA 5DAWA 4HL0A 1YHFA 3ILRA 3FMRA 2R072 4XABA 2FRHA 4OUMA 3WHTA 4M4PA 2XONA 4HK9A 3CO6C 1F15A 4CU6A 1RPWA 5JSRA 1B6AA 2L54A 1XDSA 5F0FA 3PIPF 3VBRB 3O1UA 5J48A 1POV1 5ABJC 2QENA 2P4WA 1IKQA 2P6HA 2Z2SB 2ZC2A 3IRQA 1VBE2 2E2HJ 1J1TA 2RS51 1FZPB 3K70C 1PMIA 1LGCA 1R36A 2R073 2C6YA 1MBGA 3DKYA 4JRAA 4JK1X 1KU2A 4IOCF 2PYTA 1RI7A 2QQLA 2RM23 2EINH 4MH0E 2VH9A 3NRVA 3KGLA 1RMU1 4HK8A 2DA4A 1BEV2 2ZX1A 1H6YA 1MMDA 3HOSA 1IDYA 3U07A 3CUQA 1MW7A 2GIVA 3OYDA 3FHAA 1ZA4A 4MGYE 3CP2A 1VBE3 3VZNA 4LQRA 1Q8SA 4ZYEA 4WVZA 4A3BJ 1IHMA 1P6RA 4BJ0A 4F52A 5FYHA 1KFXL 3Q8AA 1D5VA 5FKCA 4GD4A 1C5HA 1YW7A 4KWJA 3Q9SA 3AL0C 3HNBM 1UYYA 1WW7A 1BEV3 4YW4A 1DGRM 1OLQA 3IIIA 4I98B 1ULPA 1WKMA 4RS5A 3RI9A 3LFKA 3M8EA 4L9NA 1OOPB 4LPLA 5IK7A 5A3NA 5GM0A 4A4AA 5CQEA 1LNWA 4KMQA 2RJKA 2AR6A 4M3CE 4RAFA 1ZG1A 4L0PA 1PGL1 3IDCB 1OI6A 3NWTA 4QXCA 5KWRA 1MNDA 1IZ3A 3C2GA 2C9KA 1O8PA 4DXSA 1FMD2 5LW9A 2YC2A 4HG2A 1PGW1 4B44A 5EYRA 4I6ZA 3Q8BA 5C6CA 4XW3A 1Y9GA 5FMDA 2JDPA 2BV6A 4HSRA 1QXJA 1VRBA 4XPVA 4NHYA 3WTVC 1FPQA 3TW7A 1M4WA 1HRI2 4GJZA 2LC2A 4DZPA 3RKQA 4YARA 3K2OA 2ZNZA 1IN6A 1FMD3 3CCSI 1UZZA 2M0CA 1K6OA 2GXGA 1WLTA 1FPN3 2CJJA 1IQAA 1ZRDA 3EMRA 1Q1VA 4H14A 3LQQA 4KG8A 3B73A 3FHQA 1JYIA 1VMFA 5HS7A 3Q9OA 2VZUA 4D8MA 1NCQB 4XFBA 5D5XB 3FLTA 4JQTA 3L7WA 4LLNA 3CCLI 2X6YA 4PJNA 3GX4X 2WAFA 1H30A 3U1DA 4QPOA 3EUAA 2MC3A 5FZAA 4A3GJ 3ZRGA 1Y0NA 1SHWB 1NTCA 3M8LA 1W5CC 2W52A 2IA0A 4LHKA 4P00B 4QPGB 1UMQA 4YG0A 2M9HA 4QHZA 2VZSA 2XJVA 1Y39A 3FDYA 5FZ8A 1FIAA 4LLOA 1XS9A 4IHYA 5IOYA 2K7LA 1PZ7A 1SFPA 2CFXA 1C0WA 2A6WA 1JU3A 4JVAA 3QPLA 1SC7A 3WQ0A 4JKLA 2FBKA 2HVRA 5ACA1 4LT5A 3N05A 4AC0A 3L2UA 5F5AA 4WVWA 5LBQA 4AYBN 4XM3A 1QHHD 5DD8A 3CQOA 3BP8A 2P5KA 3ENRA 2NMOA 4FP2A 5FZ9A 2ELHA 3ZVXA 5I0SA 1ETQA 1RUH1 3K4KA 2ARBA 1ULCA 4RN5A 2P4EA 4GKXA 4HONA 4Y1ZA 1IN4A 3F72A 2YFUA 1F8VA 2XROA 2J1TA 5FYVA 5J4YA 1VQ5I 1HW2A 3V64A 2HGCA 3BVCA 2W24A 4BLJA 1U0AA 4PSXA 3T1BA 1V6NA 2D5HA 4HLXA 3ZGKA 3UETA 1QBJA 3DF8A 1CAUB 3OGRA 1WJFA 3DQVC 2E2JJ 4XMIA 1QQIA 2ZXJA 3FZVA 4YSFA 4XOPA 1H89C 3HOVJ 1MZFA 1LKXA 1DHKB 2WY7Q 1DLLA 5CG8A 4E2GA 5EP9A 5FZ1A 1RHI1 3POSA 4NE9A 4O65A 4ONUA 4LIUA 1Z6TA 3CQZJ 1RVF1 4YG6A 1PO21 1IG7A 2Q5TA 3FHZA 3MEPA 1YI2I 1MD0A 3M4OJ 2XAGA 4XJAA 4I01A 2WNVA 3Q0VA 3IHUA 2DBBA 2EIGA 1Y1WJ 1RYYA 1QEXA 4PDWA 1XX5A 3HM5A 3I2KA 1IG0A 3PUBA 2IS6A 1GNYA 1QZEA 3IAPA 5JOZA 1BR2A 3Q0WA 2CUFA 3WDVA 4M74A 3HOTA 4R9DA 2B45X 3ZKYA 3PIGA 3BR5A 5GZEA 2DDBA 3WP6A 1BBT1 4D6QA 4BM8A 2JJ7A 3GEZA 3IV5A 4RGXA 1OCTC 5CYVA 1F2NA 4XIKA 3FXUA 5KAFC 1QNTA 2P1BA 1OLRA 3DPRB 3AP6A 2VUAA 2DW4A 4LK0F 3ZQ7A 2ZKLA 4XHXA 1T33A 1O8SA 5FUPA 3ZMDA 3H42B 2LBFA 3G6EI 5LCWL 3R61A 4UUSB 4OLLA 3HKZN 3ZQLA 2UURA 3WTTC 2ZJPF 2ZJRF 1I1SA 1DG6A 5EDNA 1FIPA 5DS9A 1K5MA 1E17A 2J1VA 4BQQA 2HLEA 3OYIA 1TW3A 3RTRA 4I0BA 1O4TA 2YU3A 4IQPA 3IH2A 4Q0VA 1ZZ6A 2DA1A 4BQ1A 1YFWA 4AVZA 1YX3A 4MTDA 2EZHA 4A5NA 5KHKA 2FQ3A 4C1XA 2LNBA 2CQ7A 2CWEA 4R52A 3VBOB 1K78A 5T5OA 2V9VA 1HOMA 1S0GA 4CZZA 4X0GA 4HQEA 1IO2A 4IEQA 3RGBA 4KMFA 1JYVA 5D6EA 4ARYA 2JT1A 5IATA 1RETA 5C9AB 2IXHA 5E1ZB 5KVRA 2FQ4A 3GMEA 3VPRA 3V65A 1YS7A 1KS4A 2BYVE 1P7JA 2BNOA 3HOUJ 3AP7A 2BBAA 5GPCA 5FTTC 2XF6A 1TWCJ 2Z5WA 3W9AA 4LE4A 4MIMA 4RM3A 3OD0A 3WDTA 2DAOA 2FXAA 2Q2EA 1HLVA 2Y0MA 3AMMA 3MIEA 4OZOA 4TZDA 4RQPC 2JA8J 4C90A 3H5AA 4KA4A 1WCKA 2PN6A 2VMCA 3JBG3 4UF0A 3NNLA 2ECCA 5L9RA 3ORJA 1W6QB 2H6CA 1BJAA 4EM0B 4XRSG 5JXJA 5FZ0A 3F2ZA 4F7ZA 1FY7A 1QJX1 2WFF1 4RBOA 3V0AB 1FYUA 1W0NA 3G3ZA 3N7MA 2IEKA 2HBUA 1GLNA 1OQDA 2VCCA 1JS9A 3HHHA 2HOTA 4JX4A 2LTPA 1JYXA 1VQNI 2J5PA 2CV2A 1VBC2 5JI9A 2VE8A 1OHFA 5AIPA 3F95A 1IXCA 5FXWA 5KNLA 1QOSA 3IH3A 2ETHA 4TLFA 1S5LC 4LHNA 1Y1VJ 3J7HA 5JVVA 3SEQA 1TNTA 2ZOEB 3S1MJ 4BQAA 3MZ8A 2BVBA 3CJIB 3BIWE 1HCRA 2A3XA 1VQLI 1LFUP 1N25A 1BOBA 2HFHA 2PAKA 1DYKA 4N9IA 3SHRA 3A7QA 1RUD1 1LTEA 3BTXA 1V0AA 2JDMA 4BAYA 1LHWA 2R5YA 1DIWA 2HEWF 2WQ4A 2E31A 2R042 2ZXWH 4XCAA 5LBEA 2OCEA 3UESA 3ZDSA 4M3CB 2WRAA 1FT9A 4W8JA 1WJCA 4BDVB 1X7NA 4DBRA 4LKSA 2WLQA 1UZWA 1WCDJ 1T6GC 4D7NA 3F6OA 1AYM2 3T2TA 1Q56A 2R043 1HN1A 4K1ZA 2R5ZA 2JDYA 1PO11 3EBRA 2BBVA 4A93J 1RITA 1DPUA 3SZPA 3PUQA 4XEZA 3IKVA 3SCGA 3A22A 3O2PE 3HRSA 5IT3A 2NOGA 2ELKA 1LDKB 2L3DA 3O0VA 4Q5OA 1VBB3 3RS6A 3FUOA 1BKZA 4EN6B 1HDPA 1ZTRA 5IYCJ 5DDJ2 2RDSA 4RL7A 1AYM3 1W9WA 3VBFC 4HSTA 1LNSA 4HNVA 2NZ9A 5E17F 5JXHA 1GOHA 4ASNA 5I0DA 3W6KB 5D8KB 3OSGA 3PHMA 2OTJI 2VXZA 1JU4A 1ULDA 3PU3A 2A1XA 4KMUX 3HVDA 4MQ9F 3QU3A 2V5DA 4MUVA 1ZK8A 5DDJ3 5K1YA 5FMBA 5F7UA 2X1EA 1BA5A 1W04A 2DVGA 2F48A 2DF7A 5EWSA 2Y0OA 1W9YA 5EZGA 1BM9A 2K9LA 2IS2A 1EKEA 3WVJA 3KX2A 4PQQA 1J1LA 3VUOA 2JG8A 3UKGA 4YM2A 1WMXA 3QLQA 3HOXJ 3WTSC 3KHBA 1HSJA 3ZMSA 3IDEA 4AFAA 1VBD2 3LE0A 4YEJA 4EVIA 2ZMKA 5FPVA 4WK8F 1I5PA 1E2XA 5JR2A 4A7ZA 1NA1B 4HA8A 4PJMA 2ZX2A 2TDXA 2EA7A 4DINB 1YQ2A 2QEXI 4LXLA 4BMBA 1IAWA 4UV9A 1QOOA 1U5TC 5BXXA 1YRNB 1RUC1 1QDOA 5F6KA 3FBMA 3N9MA 2VY0A 1EY2A 1VBD3 3DFGA 5T5LA 1XGMA 2UY9A 4PSWA 2WNVB 4XZPA 1A3KA 2DT6A 3FX3A 5FUIA 4UW4A 3MKWB 5H2FC 4PHZA 3VZMA 2E1MB 1S2EA 3OMYA 2VOTA 4KICA 2RNJA 5BNGA 5J37A 3QH7A 3WUCA 6PAXA 3A2KA 4FASD 1DFQA 4XF3A 1MQTA 1NX9A 3KYDB 2ERFA 2P34A 2VKDA 1D0XA 2BDRA 1JHNA 2A5YB 3EJKA 1G4DA 4N53B 4CA9A 3L9FA 2K40A 2E2IJ 4CDGA 3LF7A 4A3IJ 2IS1A 2LBFB 1XBFA 4GKYA 4IHVA 3IPVB 3LAPA 3Q9VA 2DFFA 3FM3A 2DCEA 5L3GA 2XGEA 3P9KA 1NCRA 1XGSA 2ES3A 1C1FA 5AIQA 1AXZA 2QUOA 2VZTA 3AYAA 4W50A 1AUYA 4BACA 4XLFA 2EB7A 2QE3A 2R49A 1DDNA 4XFGA 4M9XA 4GQ7A 2O0YA 3MI8A 4XFHA 1ENXA 3LSMA 4L99A 3A4UA 1FI2A 2WAQA 5F3CA 2UXNA 3Q0UA 4U87A 3L2YA 3VBSA 3I97A 4LBMA 4G7ZF 1ZELA 2XQRA 3FXQA 4X1EA 5A2QK 3GCMA 1R4NB 4A3JJ 4B7KA 3ECOA 3SZTA 3BG7A 2WQ8A 3ELKA 3TEYA 2DTWA 2E1OA 2FJ1A 1ULFA 4BE2A 4K3UA 3KQ4B 5HVQC 3C7GA 4F83A 3ZFFB 2HWD3 1YW8A 4ZZ5A 5FLXZ 2RDNA 5FYSA 1FX5A 1QHDA 5J40A 1IPKA 2DMUA 5CPRB 5E3NA 3WF4A 3SDBA 2TBVA 2E35A 5CKTA 4BQNA 3GBFA 4IGQA 1O6UA 1MEC2 3K9TA 3J9SA 1HKSA 2D40A 4AR2A 2DFHA 3ZFGA 3V0BA 3DU5A 2AREA 3H1YA 3DKWA 3HQXA 5F32A 4E2SA 1WI9A 4A3LJ 2IWGB 1E5SA 5BPDA 4UF0B 2HEOA 4BMEA 2TNFA 2B63J 3K10A 4BLIA 4ZC3A 1SDWA 1R1UA 1GXPA 3RZLA 4U0WA 3CMMA 3NNMA 3SEPA 1OXCA 1MEC3 2R071 2L9RA 3DF0A 2YYOA 3MLLA 4IJAA 3T5XA 3DEMA 4MFDA 4GWIA 4MV2A 5H9QA 1K45A 2ZNYA 4AG4A 4A3CJ 2EA4A 1CAXA 1VBE1 1K79A 2HJIA 1GU3A 1CJDA 5D4RA 3DTKA 3ZQQA 4UB8C 1NXD1 3EUHA 2XJQA 3CCMI 4AEMA 4ZYDA 3GYDA 3GTMJ 4B48A 3KV6A 4BDYA 1DQUA 5E79C 3AKZA 4FP3A 2HYGD 1HBXG 5IP6A 2P7VB 3SKJE 4LO4B 3N4MA 4M6YA 1ASJ3 2E7XA 4MG2A 2A6EF 1XMKA 3QOPA 3I4MJ 3GZEA 4HSJA 1RUE2 4J1WA 3PNTA 2L7MP 2RV8A 3U10A 5BYNA 3WW2A 2VVEA 3AG1H 1GUIA 3NEUA 2V1XA 4AI2A 2ZHMA 1FNZA 3HPNA 2OQ6A 4BY7J 3E5QA 2W3JA 5JMCA 5IT6A 2R32A 4WM8C 5ABJA 4R8HA 2RJ2A 1KRIA 4K2EA 5J8FA 3ME2A 4RB0A 5ILUA 3OGJA 2R5YB 3HBLA 3GVAA 4IX7A 5B3SH 1PYVA 3T1LA 4ZDPA 2J42A 4Q29A 1JKOC 1CZSA 4CZCA 1XU1A 2JJ6A 4Q4ZF 2VOKA 2X1CA 3TNQA 2EZIA 1DZQA 2VL4A 4BHBA 3BROA 1ETYA 1FMD1 2XH6A 1J58A 3J4UH 4YG2F 2ZCWA 4I7HA 2ZMEB 4XLCA 3DECA 1WH7A 4GB32 5FYMA 3PO2J 3OTFA 3VV1A 2PJPA 2IGOA 2WBKA 1HRI1 1E0EA 4D7YA 2D3SA 3HDDA 2OU2A 2MBFA 2PLV2 3UK9A 5FZDA 4FISA 1S9HA 4LKEA 4K8RB 4AI0A 3BU0A 3BODA 2KIUA 2FF4A 3T2QA 3WDXA 2XVKA 1NG7A 1LU1A 4B09A 1C1LA 4YGDA 4GB33 2DU0A 3ETQA 4MGRA 1AR82 2MNGA 3M1HA 4O9EA 2AS5F 2BGPA 4I30A 1XD7A 2VQTA 4Y4YA 3I4IA 4D1QA 1KEXA 2PLV3 1DZRA 1XNTA 2W4SA 3LEGA 2VBYA 1LE8A 4ISRA 5JSPA 4AVTA 4Z1VA 3DYOA 2ET7A 5CB7A 1S2KA 4ASKA 2F5EA 4ZHNA 1AR83 2QTWB 4XTMA 1QY4A 4BQ4A 2Y34A 3BCAA 1IXSB 3W5MA 1S2BA 1LR5A 2P5BA 1EA3A 1W9SA 2VC9A 1XGNA 1DYPA 1UY2A 4IHSA 3K51A 4P9UA 3ZOBA 3HT1A 3DEEA 3VYRB 2K85A 3FIWA 1K7AA 4NPMA 2ARAA 2HBTA 1LEDA 3MVPA 4P08A 1U2WA 5F5QA 5CIRA 2NVTJ 3AKSA 1YYNA 1DZTA 1HSTA 3POBA 5F9TA 4AUXA 4EYUA 3ULQB 5CNAA 4H3WA 3OR1C 1HKTA 2XUEA 5E18F 1GICA 2A3YA 1MMGA 3U1KA 1D2QA 3ABTA 1QZZA 2X0LA 3G6JB 1IRGA 3GW2A 3SQOA 4A5MA 1JHJA 2VZPA 2QCOA 3WCRA 3F8FA 3IP4B 5DEQA 4II2A 1W2NA 4HN0A 4QPIA 1YO5C 3ZQIA 1JH5A 4H55A 5FQ0B 2LKSA 5HNHA 2X85A 4UT5A 4IQJA 1CIYA 5F3GA 4CCLA 3GCXA 1ZG3A 1JE8A 2DO7A 2DCZA 3H3ZA 1OCOH 3KV5A 3L9JT 2H8RA 3GTKJ 2ZAHA 2NRAC 2E63A 3U78A 2FNAA 5J1UA 5F04A 3U37A 3BPXA 3KSCA 4XZUG 3GTQJ 1POGA 2LTNA 2ARCA 3UNGC 1FBQA 5IYDJ 2PMZA 1J3RA 1ND3C 4WV8A 4RDUA 3LSRA 4CDUA 2JX9A 4DEQA 1MQTB 2ZGKA 2R92J 2ZPXA 3QYBA 5A3MA 4PBOA 2B39A 3K4DA 3VYSB 1MJ9A 1FEXA 1EJ9A 4WM7B 2LW8A 3AZYA 2ZS6B 2B9UA 2ORXA 2WO3A 3A0NA 2HTJA 3PIOF 5JI7A 2BWAA 2E51A 3G71I 3C7OA 2XOMA 5I91A 1TBXA 3N7LA 2OCCH 2H0VA 4WVMB 2CQQA 2LOOA 1P4XA 3OS2A 1OC1A 1S0IA 2DOEA 1UXZA 1VALA 1CPMA 2M0MA 4IV3B 2XAHA 2R7DA 1HV1A 1YTYA 2VUDA 1FTZA 3VWBA 2DLLA 1L7LA 3OYKA 4BHPA 1W8WA 4NAMA 2LYCA 4ZTFA 4RAYA 2ZEXA 2D6PA 4XRFA 1MS4A 2EV5A 2KXLA 3GALA 5E1XA 2DA6A 1RXFA 2PX9A 3E6BA 4LD5A 3THDA 3K7AJ 1MKMA 5D1IA 4COVA 2ZHNA 2XSJC 3S32A 3GFMA 5DABA 3KM5A 1T98A 2ICWG 1AXKA 2VD7A 2OTLI 5LEJA 3OUHA 3KLNA 1TE1B 1KGYA 5FJHA 1BQPA 5E3OA 4RYDA 1DU3D 3KZZA 4QGNA 1HB1A 5CEHA 3OIPA 4Y5Z0 2RDPA 3TB0A 3K46A 4XLEA 4IL7A 4FQZA 4UUVA 4UHTA 4UNOA 5CADA 5JZGB 2EZLA 3K1PA 3V0BB 4FQ4A 3EDPA 3ISPA 2HU9A 2J7MA 1C4RA 2JUCA 1GP6A 3UKNA 1TWAJ 2GU9A 4BXXJ 5APAA 3NKGA 1ZVFA 2VOPA 5L7OB 1R22A 1FBSA 1WA4A 1ETKA 1X4OA 3WDUA 4RMNA 4LBQB 5D8AC 5C8CA 3A4CA 4GMP3 4BEHA 5IP7J 2QGUA 2PFBA 1WQ2A 2R7RA 1REPC 2WADA 4NIIA 2BJSA 3F0CA 2AHQA 2VMDA 4JX0A 5GZFA 1E3OC 3PNVA 5DQ0A 1S0FA 1GZCA 1PVEA 4CU8A 1PJRA 3LFMA 2NYYA 1F43A 2R062 4M4RA 5A33A 2GH8A 4BXSV 1UKGA 1FOKA 1WUVA 3LAGA 3HOYJ 2CL2A 3R4UA 4HV6A 2YXSA 4QX7A 1LJ9A 2PHFA 2HDDA 1OKRA 4IQ4A 1NK2P 3AVSA 1HV0A 4QPYA 1EP0A 2F5FA 1J59A 5FZLA 1P8JA 2R063 2Y0SA 1N3PA 1IXRC 4ZXEA 3HSRA 2VQHA 4LK7A 1LOFA 1STMA 4YW6A 1T6BX 4MFEA 2X5IC 5LK7B 3E5UA 4XUQA 2MLGA 1W8UA 2E5NA 4JKKA 2X53S 2BY3A 2YBSA 5F2WA 2RDQA 3SYTA 3M3YJ 1VBC1 3WNXA 1LU2A 4DXTA 4RQPA 4JGYA 4XORA 4NHMA 2PTMA 5B2GB 3O5SA 2LH9A 4Q4V2