1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
3H7YA 5L3EA 2A69F 4WX9A 4L18B 3UKNA 4HSJA 3FHZA 2L4MA 2P5LC 3OD0A 3GUDA 2FSWA 2B9UA 4S04A 1EH8A 4RS8A 1S29A 4MNUA 4XSXF 1U6GA 1JUHA 2DPUA 2DK8A 2VBZA 3HRUA 3N4MA 2M87A 2H6BA 1USSA 4YNIA 1QBJA 5CYVA 1OYWA 3D82A 4Q29A 1FBQA 1OI6A 3ULQB 4Y13A 1EP0A 3H3ZA 2PMUA 1AWCA 2DBBA 3FWEA 2CO5A 1K78B 2P4WA 4YIIA 2R7DA 4PIYA 3C7JA 1TLHB 3DFGA 1XB4A 4L0YB 4X6RB 1FNNA 3EDPA 1SFXA 2IW5A 5E1RA 2RV8A 3GVAA 1NZCA 3I54A 3WTTC 5LHHA 4FAGA 4IEVA 2QM3A 1MJ9A 3GWZA 3P9IA 4AVPA 4LEJA 1MZBA 3BJOA 2BNOA 4KIFA 4YFKF 5JI6A 2FOKA 1OKRA 4O3MA 2QBYA 3QPHA 1IW7F 3KE2A 4LJZF 3MWMA 4OFGA 4AIHA 4L2NA 1D3YA 5BPXA 2VE9A 1IN4A 1L3LA 2HQRA 1SEFA 3OGJA 3FMQA 1P4WA 4KICA 4QLCU 5EEHA 3F8BA 2VQAA 3P9KA 3V4GA 3ACLA 3ES4A 4MGRA 1U5TB 2YSRA 3HSRA 4UXAA 3CUQC 4IEWA 1F4KA 2XLGA 4AVBA 1Y0UA 1U5TA 2ESNA 1FBUA 3BJAA 1TNTA 1I1GA 2Y0MA 4JV4A 5LBQA 3DL3A 5LHIA 2KJBA 4ZYGA 2IXKA 4H7LA 4MH0E 3U0ZA 2XLFA 3TKYA 1G3WA 1BI0A 1YLFA 1YYVA 5I0UA 4IEXA 4B29A 1HQCA 3T0YA 5ILVA 4ENJA 3G73A 4J1XA 1H1MA 3M3IA 5L3DA 4HQMA 3I7DA 3E97A 3DXJF 3U9GA 2VPVA 2OYZA 3OCPA 2A5YB 1IRGA 3SZPA 3IL2A 4AIKA 1YFWA 2MHFA 3BB6A 1TQMA 1FI2A 4KWJA 2L01A 4P9GA 1ZG1A 2DLLA 4LULA 5I91A 4UV8A 2GH2A 2DI3A 4ONUA 3WGGA 3GFJA 1W4MA 2PAKA 1LR5A 3ABTA 3SZTA 2ELHA 1XGMA 5BXXA 1O3TA 3LAJA 1Z9CA 2NS0A 3KZZA 2EA4A 1YS7A 4LGWA 3F23A 4QX5A 2HKXA 1EV7A 4A0XA 2IVMA 3VOEA 1SFUA 1BI3A 2B8MA 3IBMA 3TO9A 1WSUA 4ZZDA 4HF2A 1YWKA 2CV6A 2DPDA 1TW3A 3I64A 3NL1A 2CSOA 4KN4X 4KWLA 2DW4A 1FXZA 4HVRA 4RB1A 4A0YA 4JK1X 2HJIA 1CAVA 2UYBA 1Y9QA 1CX4A 5D5VB 5CJ9A 5LLQA 5E1ZB 3V8KA 1PUEE 2EFOA 4HX7A 4EWDA 3BDDA 5LEKA 2W25A 4LK1F 3S0MA 4XF0A 4ZU5A 4XRFA 2XL9A 2D2WA 2W57A 3K2ZA 5K5QA 1REPC 2P6SA 1ZRDA 4RGSA 2ET1A 3RTRA 1R22A 4G6DA 3GBFA 2M45A 4UXNA 2EA2A 1DP7P 3RYPA 1XDSA 2D1VA 1ZZ7A 1YO5C 4D7SA 2O61A 3F8FA 3P9CA 3W6KB 4P9UA 3MDPA 4WCGA 3REOA 2V1DA 4LLGF 1XN7A 1RUNA 3CLOA 5L3CA 3R4KA 4IEPA 1JHHA 2F2EA 4WF2A 3F72A 4QM8A 3ML6A 2UXNA 1BJAA 1I5ZA 3U11A 3BCWA 3QP5A 4FHTA 4ZYHA 3HIFA 5C8WA 1YHFA 4L0ZB 1USTA 5I0RA 2HR3A 4YFXF 3V8LA 2UWMA 4YARA 1S7AA 3PQKA 1XD7A 4G8XA 2DAOA 2OQGA 3T1BA 3DV8A 5J8CA 4KA4A 2RNJA 4E2QA 4LB6B 1P92A 1LQ1A 3LQRA 4KN7X 4NQWA 5HS7A 2XAFA 5FPZA 1JXSA 3ES1A 4Y17A 2KXLA 3ZMDA 4IEQA 2EFQA 3F3XA 4RD7A 2PFBA 3TNPB 1BOAA 3C3VA 2VONA 2FE3A 3OV8A 4EM1A 2G7HA 4HQEA 2M30A 3L7WA 4PZJA 1QNTA 5K5OA 3LWFA 4GXOA 4BNCA 2E1NA 2L4AA 2CG4A 5LRSA 3DP7A 1XGSA 2GWRA 5TJJA 1LKNA 5KBFA 1R36A 2F5FA 3T8RA 1IZ1A 1QZYA 1E2XA 1OYIA 5BV6A 4XF3A 1AOYA 5DEQA 2XROA 1IUYA 1H9GA 4EV0A 4MZUA 2XASA 3RYRA 3EUHA 5JSPA 3F8MA 3EBRA 2G7UA 4Q0UA 2Y75A 2ZKZA 2PAMA 3V7SA 1XCVA 1FC3A 3L00A 5JHUA 2FF4A 2K4JA 2RC4A 1D5VA 2P7VB 3SCHA 2FBIA 3E5XA 2P6TA 2FU4A 2TDXA 1P4XA 3BWGA 3TGNA 1HKQA 3HRMA 4O6JA 1I1SA 3I58A 5FB2A 4KIGA 4KMFA 4IEZA 4M73A 3JAMZ 1E17A 2OZ6A 3K69A 4HN1A 5CVUA 2ESHA 1U3EM 2A07F 5FQ0A 1J5YA 1FY7A 4OINF 4IHTA 1MDMB 3G7DA 3LAPA 1FP2A 1U78A 1J9IA 3OTFA 1ZLKA 5CADA 4L11A 3D5LA 4ENMA 4DQ2A 4ESJA 1YIOA 2NAZA 4HOBA 1PP8F 4XF4A 5D6EA 3I59A 1CAXB 5D5WB 5IT9Z 1XE7A 1XCBA 2V1XA 4EMSA 3F8CA 3E6CC 1B59A 3CO6C 1SD7A 3JSPA 1IXCA 3TQNA 3PVBB 2K0GA 1YS6A 4CICA 3M70A 5IT9K 3HHGA 4OLLA 3WTWC 2IA0A 1WQ2A 1HW5A 3NKTA 2VE8A 4N0BA 1W7PD 4MGIE 1UPIA 4BHPA 4HLTA 5H6RA 1YFUA 4P96A 1NHAA 2WFPA 5BUVA 4YG2F 1R5HA 4J1WA 2LF8A 1S7OA 3C3WA 1OD5A 3FXRA 3UKVA 5BMZA 2EAAA 2L3DA 4IPAA 4DNCA 1VJ2A 3K9TA 3SHFA 1EY2A 4E70A 5HVQC 1T38A 3BALA 3KLOA 2Q30A 1ZZCA 3R0AA 2MH9A 2FRHA 2FA5A 2XV4S 3D0SA 2J5OA 1SMYF 4PGGA 2B5HA 2Z3YA 3BU7A 3ZMSA 5J8FA 1MJBA 5LGNA 1ZARA 4GO1A 2FBKA 4QGNA 3V7CA 4MHGA 3JAMK 1EPZA 3DPTA 3PQJA 1ZG3A 5LGUA 1K79A 1OYYA 1P6RA 1YFXA 1OFNA 4I2OA 5T3NA 3NQOA 1KQ8A 3NVCA 3S7EA 4OU0A 4A12A 2VODA 2CYYA 4OIRF 1U2WA 4DINB 2GQQA 3DEUA 3OF1A 1JGSA 3RDIA 2F5DA 4ZU7A 3Q5FA 1PM7A 5E1WA 2GU9A 1O7LA 3IWFA 5E1XA 2MPFA 3H7JA 2JT1A 3CJNA 3BROA 1X82A 5DCMA 3CUOA 3IDCB 4JTOA 3HT1A 5D6FA 1DPUA 2PTMA 2WC2A 2L02A 2OA2A 5J6XA 4EGYA 4ORFA 4XFFA 4IVNA 4M9SA 3KSCA 1FSEA 2ZKLA 4R79A 3HRTA 3JTGA 3KP3A 2MLGA 3WTXC 4ZZLA 4LTAA 4MGZE 4TLFA 2P17A 2CAUA 4R52A 4A5MA 3FM5A 2PYTA 4R8HA 4KL1A 5KHKA 5DD4A 1EH7A 2BYVE 4WWCA 1ZZ9A 3CTAA 3WTUC 5LEJA 2PHLA 3FZ3A 2PQQA 1XRUA 2JTVA 3NJZA 5J7MA 3HUGA 1KU7A 4LFUA 1LVAA 3CF6E 4WZCA 3KP5A 1FWZA 5I0TA 3RI4A 3GW2A 5D4SA 4XSZF 2GC3A 4FX0A 2OQRA 3O2PE 2HKOA 1W7PB 4LK0F 2HDCA 1FYMA 1F9NA 2MC3A 4D7TA 2EFPA 1I6XA 2QCSB 2V6CA 4IHSA 3WG9A 1BM9A 1BIAA 1UB9A 4UHTA 2EB7A 2D93A 2ZJ2A 1WLTA 1QWRA 3DN7A 2OZJA 4HBNA 5HOOA 2MLKA 3JSOA 4HA8A 4HYEA 5E8IA 3K1PA 1SAXA 2EFWA 1O3SA 1FBSA 3VFZA 5C6CA 1ON1A 3T8TA 2OZUA 2W84A 1MDMA 1KQ9A 2Z9OA 2B0LA 3HRSA 3QOPA 1QPMA 2F5EA 5FGMA 3E5UA 1QGPA 2QNKA 5D8KB 4MV2A 4FAHA 2VECA 1KYZA 1R7JA 1Z6RA 4XFHA 1J0RA 4F7ZA 3MYXA 4AVCA 3KFWX 1UHWA 1TBXA 2OA4A 1VP6A 3CJXA 3EJKA 2PAEA 4B8XA 3Q9VA 2EV5A 5KHGA 3ROUA 1S3JA 2E1CA 1T98A 3M1EA 5J3UA 4L9NA 1YQAA 2WTEA 3KCCA 3RYKA 5DCMB 4AD9A 4L5JA 1MGTA 3SCGA 4M74A 3BPVA 2O03A 4XFGA 5I8YA 1RC6A 3ETQA 2M1BA 3BP8A 4ZH4F 1OR7A 3KP6A 4MUVA 3CO2A 1FT9A 3J81K 3KP7A 2ISYA 2RDPA 3KMHA 2PHDA 2GC0A 3L09A 2R7FA 4L9JA 2FQPA 3IWZA 3PNAA 1J3RA 3OOPA 4JTNA 4MGKE 4KUMA 2PN6A 3COAC 3J80Z 2Q0AA 4U0VA 1IN8A 1KQ0A 1H0MA 4L9TA 3GYHX 5DUIA 1HW2A 2Z5UA 5I8TA 1Q1HA 4ON0A 3TDUC 4N9IA 1OPCA 2XL7A 2Z69A 1TW2A 5FDBA 2BNNA 3FXQA 1XSVA 5BPIA 3QACA 1CF7A 5JSOA 2A68F 2PMHA 2BNMA 4EJWA 4YYOA 3FE5A 2F4PA 3V8JA 2KRFA 1LEAA 1EYBA 4OMYA 2O3FA 1X7NA 2FNAA 2EWNA 4AWXB 4S05A 3GX4X 4R1HA 4EWEA 2ZXJA 3N97A 4GGGA 1B1BA 2HQNA 4XFIA 5H6QA 2BEOA 4BIFA 3W6JB 5D5UB 1ULYA 4YFNF 3GFIA 4O9EA 1T2KA 4PIXA 1GQGA 3ST7A 1U5TC 3BOQA 2ETHA 4O5VA 5CLSA 1DDNA 4LLNA 2IRFG 1FP1D 2GA1A 1HXDA 3LFKA 2H27A 1YW9A 1Z1DA 2YPRA 3WW1A 2JRTA 3CDHA 3CLPA 3I59B 1CAXA 3WU1B 3GZ6A 1SFEA 3IKTA 3EHKA 1UCRA 2KJCA 2YU3A 3HOTA 4LUMA 4EJVA 2VC0A 2YX7A 3ZQ7A 4WXHA 3FF5A 3PFIA 4RGXA 1O7FA 4Z2YA 3U1DA 1IPJA 4ZU4A 2H6CA 2DQRA 3KLNA 3EETA 2V1UA 2XAJA 2EV6A 3M9AA 1XMKA 5CVIA 2IJLA 2XLAA 5HI0A 3F22A 5FD5A 3M8FA 2IC1A 3WTSC 1RTVA 2DK5A 1L0OC 3AAFA 4M71A 3F21A 3VODA 4ASNA 3IRRA 2ZMEB 2UY8A 1XDUA 2RN7A 3CEWA 4AIJA 5K5RA 1O5LA 2FQ3A 1Q5OA 1MD0A 2A3SA 3NSTA 4UBGA 4HV6A 3NEUA 2XIGA 4IJAA 4HLXA 3HSFA 1UHMA 1ZYRF 3BPXA 4XBFA 3ISPA 4EM0B 2PI0A 1H1IA 4RB0A 1YW7A 1UD1A 4NB5A 1RNLA 3QAHA 4EVIA 2D5HA 1U12A 1FYLA 3GEZA 2PQ8A 2G9WA 4BYYA 1ZH5A 5AONA 4M6XA 2VC1A 3L9FA 4LLLA 4I98B 4M9ZA 2QENA 2QQBA 1ZLJA 5BY5A 1R1UA 1U8RA 2P7CB 3MAJA 4EM2A 3KZYA 2O8XA 4I09A 3MFKA 4WXDA 3WW2A 2DFIA 2OBPA 2K4BA 3CL1A 4CYDA 1DGRA 5HDKA 1CAVB 1IXSB 2PLYA 2DQLA 4I7HA 1ZZ6A 1B9NA 3HQXA 5ICGA 4EJTA 2V09A 3ZPLA 4PJYA 4P5OA 2DT5A 3ELNA 2Z33A 4Q0QA 3RZZA 3DF8A 3V7RA 2DTRA 5D1IA 2IPQX 3H9AA 3WW3A 4CDGA 3H3UA 1RL3A 1NYWA 2EA7A 5BOXA 3FXUA 4U7BA 1MJAA 1R00A 2EVXA 1J3PA 1VR3A 2VT3A 4LLOA 5F6FA 2STWA 2WV0A 3ECOA 5FLXK 4IEOA 1ZAOA 4G6QA 1P4AA 1ZZBA 3H92A 1O4TA 2UYAA 3Q9SA 5AVPA 1WRJA 4I0AA 4IRGA 1SD4A 3RNSA 2IA2A 2XAQA 2O8QA 4EGZA 1IAWA 5JCTA 4IESA 4HZFA 1O3RA 4CGZA 1ZNPA 3LAGA 1XE8A 3WE2A 4XLNF 1YFYA 1STZA 4OOIA 4QXKA 2K27A 5DUKA 5DCFA 1CF7B 3H50A 3R60A 1T39A 1UIJA 2O1QA 4M6YA 4UVBA 2CGPA 4KDPA 1RUOA 4PIZA 1ZRCA 1CGPA 2IXHA 1YUDA 4P55A 1TQIA 3MZYA 4PCQA 4RAZA 1QXJA 1KU3A 1NE4A 5DDGA 5HDNA 3EYIA 4XF1A 2QBYB 4LD5A 2HZTA 3ZDSA 2JZYA 4OIQF 4FBFA 2LSOA 1UCXA 5L3GA 5D5XB 1BN5A 3IIAA 3KEOA 5D4RA 1S8NA 3KP4A 3RIRA 1IRFA 3GYDA 2LF7A 3MEXA 2YX4A 1YG2A 1LB2A 1ZG5A 3QU3A 2PA7A 3MQ0A 1BIBA 4LA3A 2GC2A 3EQEA 5H20A 1XGNA 2XGXA 3ZMUA 1YFHA 4K2EA 4MGYE 5FLXZ 4ETSA 4HX4A 1TQ5A 1O3QA 1JHFA 4JBAA 1HW1A 2R3SA 1IPKA 2JSCA 2I45A 4G7OF 3ELKA 1LEBA 1SFNA 5ED4A 4XLPF 1G3SA 2KIMA 4HAMA 2Q0OA 2CAVA 1G3YA 4ESBA 2NNYA 1GXPA 1GQHA 3DKWA 3S7IA 1L3JA 2FNPA 2W85A 1H9TA 4YIFA 2XAHA 3I71A 5ERIA 2L54A 1PDNC 1BC8C 2ZMEA 5J48A 3H1MA 4UVCA 3FJSA 2Z99A 4FT8A 3RPQA 3J81Z 4HLYA 2MD5A 5CVJA 5DV5A 4XFAA 1J59A 4KMUX 4HBLA 1ONVA 1LRHA 1S6LA 2IXLA 2PEXA 2EFNA 5FFXA 4AXOA 2VBWA 5F64A 1WGPA 2MH2A 4GCVA 4M72A 4HF1A 2ADUA 4KT5C 1RZ4A 2HYFA 2FBHA 3HTSB 1BI1A 4ENNA 2RQPA 3ZP5A 4MQ9F 3M8EA 3CO7C 3RJPA 3S2WA 2VN2A 3CUQA 5FLHA 4UNOA 2ZNZA 1J58A 4LB5A 1IXRC 1X3UA 3BPZA 2V9VA 4Y15A 1TNSA 1ZZ8A 4A6DA 5I8SA 2EV0A 2PBIA 1ZGJA 3TOBA 4RB2C 4RGUA 4Q0VA 2CFXA 3RPUA 2ISZA 2EK5A 4AQ2A 2A61A 2P8TA 3VEPA 1BC7C 2E9QA 1ODDA 4XFBA 2OD5A 4Z07A 3FHIB 4UUVA 5CVVA 2XKOA 1FX7A 1UFMA 4BQAA 3R6SA 3FMRA 2PFWA 3BZ6A 2BE5F 2IT0A 5E18F 1SMTA 3J80K 5BS6A 1UIKA 2NYXA 4RB3C 3QPTA 1QO0D 2FMYA 1PP7U 3EO6A 3TO6A 3HTUA 4I01A 3SCFA 3KGZA 3USSA 1HSTA 3QP6A 5JFRA 2PJPA 4U0WA 3EQLF 1K6OA 2AXLA 4KWKA 3GXOA 4PGHA 1FZPB 1G3TA 4WVZA 1IN5A 5JAXA 3K1MA 1SD5A 1R58A 2N7GA 1CAUA 4UBHA 3CUQB 3GFMA 2CQKA 1ZHFA 4EJUA 1XSDA 2MNGA 3HOSA 2QQAA 2ZNYA 1O57A 2VXZA 2D5FA 3HYIA 4OIPF 4QWQA 3K1NA 1IN6A 3ABUA 3G3ZA 4BXUA 3E6BA 2NNNA 3O3KA 3O14A 2MA3A 4QGLA 2EJRA 5KHIA 2MBFA 2OU2A 4MEXF 1I27A 1J3QA 5KVRA 4HN0A 1J75A 5E20A 5E16A 2QUFA 3IC7A 3MZHA 4G9YA 3GFLA 3HSEA 4IEUA 2UZKA 1Q3EA 4Z82A 1V70A 4HMZA 4F8AA 1QXRA 4N9HA 1Q43A 1XMAA 4Q5SF 1V4RA 4P9FA 3B73A 4OMZA 3KETA 2VBXA 5ILUA 3K0LA 2QDRA 4Q0PA 3ECHA 2P5KA 2HTJA 5HDGA 2LKPA 4L5IA 3IHUA 4NVPA 2VBYA 1G6NA 5K8SA 4GYIA 1PMIA 4FX4A 1ZRRA 2NRAC 1R5GA 2M5WA 3SFZA 4IF4A 3WE3A 4EROA 4HSLA 3F6VA 1FLIA 1C0WA 2O6GE 4XFCA 4JVAA 4G94A 1XSXA 4IXAA 4IETA 5FCCA 1GHCA 3H1WA 2GIVA 3VHRA 2YR2A 2IXIA 3LOIA 3WTZA 3WGIA 4AVAA 2PG4A 3ZMTA 2JPCA 3RKXA 4JQFA 3HT2A 2QYOA 3DQVC 2BV6A 1ZN2A 1J7KA 1Z6TA 4HF0A 1T6SA 2K7LA 2RGVA 2CW0F 1WI9A 2QJVA 1CAWA 5ICEA 5LRRA 4IEYA 4KYWA 1BBYA 2XVCA 3R0JA 3E5QA 5KK1A 1B6AA 1WWXA 3GF2A 4GYGA 4PDKA 3SHRA 1J2XA 4MEYF 3JW4A 3R61A 5LHGA 4KU7A 4E2SA 4M9XA 2Y48A 1LNWA 4BAYA 2BGCA 1B4AA 5BPDA 3BJ6A 4CZZA 1KU9A 3FZVA 4I0BA 2IXCA 4BHCA 4Q47A 2Z2SB 1NXMA 3D0JA 2E7XA 4WK8F 2M8EA 4ENKA 1X8EA 4KU8A 1LDDA 5LGTA 4YRDA 3KGLA 5JVTA 5L3BA 2RKHA 2RVCA 2QVOA 1KGSA 3C18A 4HVOA 2X4HA 2D40A 5AIQA 4LA2A 1K78A 3LA3A 2ATFA 3WTVC 3FFQA 3F8NA 2COMA 4QMAA 5HLGA 2DU9A 1GVJA 5F1RA 3IKVA 3KEQA 1RGSA 1MKMA 2KKOA 4WXCA 5HS8A 5EZWA 2UXXA 4HW0A 4IRHA 5CU1A 5AIPA 1TQPA 5JSRA 2HFHA 2OAZA 3VB2A 1FYKA 1T0FA 3H8UA 2DO7A 1OMIA 3WODF 1K7AA 3LWCA 3IDBB 1R1TA 2VOPA 1HSJA 5JR3A 4A6EA 2AS5F 1IF1A 4QM9A 2Q2EA 2FXAA 2VT2A 1R1VA 2H94A 1JE8A 2XUBA 2C6YA 2GAUA 2H0VA 1FPQA 5FLJA 2ZCWA 3BY6A 4G7HF 3P7NA 5EFUA 3SXYA 1DZTA 4OIOF 4MQVA 2OPKA 3UKTA 3HHHA 3KP2A 2VOOA 1RI7A 4KNYA 1V3FA 1WKMA 4XEZA 2LDUA 1DPRA 1F1ZA 2K9ZA 4HDUA 4L9VA 5CVRA 3L2HA 4EJOA 3I5UA 1J1LA 4CHUA 4A5NA 3LA7A 4KIBA 4CXFA 2D1HA 4KFCA 3C1DA 2IP2A 1IN7A 2Q8KA 4TV7A 4QGMA 3SMHA 1SD6A 4LUKA 2GXGA 5IT3A 4XF9A 4K8FA 5K1YA 1FSHA 2HEOA 5EEGA 3RKYA 1Z91A 2K86A 2IXJA 2XAGA 4U7DA 1W5TA 5E17F 5FD6A 3J7AO 4MTEA 4HV5A 4B09A 3TO7A 2O0YA 4X6QB 3I0TA 3SXWA 5KHHA 2UY9A 1HKSA 2E7WA 2Q4SA 3QU6A 1ZGAA 4WBBA 3FM3A 4HDVA 4BH9A 4HX8A 2K02A 1Y3TA 1W5SA 1YW8A 1GXQA 1LJ9A 2GXBA 1ZVFA 2QVSB 2HTSA 2P5VA 1KYWA 2IA1A 5FFZA 3JTHA 3TNQA 3ZMVA 4LG0B 5E8GA 1D8KA 3B02A 4YSFA 1Z7UA 1Z05A 4U0YA 5DD8A 1O5UA 3JZVA 5FLIA 3WU0A 4EWAA 1VTNC 3WW4A 4A0ZA 1TTYA 2GA2A 3LZZA 2V79A 4G7ZF 2XKPA 2CWEA 4A2UA 4E2GA 3MCZA 2HWVA 4RAYA 2ACJA 3WTYC 5FQ0B 3H1YA 3U10A 1LDJA 3E6DA 3O6BB 4ESFA 2D45A 1B9MA 2XRNA 4Q0SA 4MX3A 2C0ZA 1CAWB 1R23A 2ZBKA 5JR7B 4NHJA 4IRIA 5TRDA 2BBYA 5ICFA 5HS9A 3E3VA 3DPLC 1KU2A 1QY4A 1YLLA 5BQTA 3PLQA 1YTYA 4MTDA 3WGHA 3U2RA 1F5TA 2GC1A 2W24A 4EQQA 4Q4ZF 4CO8A 3ZMZA 4LG0A 1CAUB 5KHJA 2WWYA 2A6HF 3SQNA 4I02A 1FOKA 3IRQA 1ON2A 1ZREA 2LNBA 2QZ8A 2FEZA 5ILSA 1HBXG 3MPBA 2QLZA 2XHKA 2ZFWA 1SQ4A 4UVAA 4UV9A 1ZRFA 2GZWA 2ETEA 2KIFA 5HLHA 3FX3A 3NRVA 1X8MA 5L3FA 2X0LA 3FMSA 4D0PA 2ZO4A 4ZYEA 1UW8A 4AQ6A 3EYYA 2Y0OA 1A04A 3QRFF 2HGCA 3TDZC 2F5CA 5FPXA 3LA2A 3RKWA 2ET7A 3TOAA 6PAXA 4XETA 3NW4A 3ERED 3T5XA 4META 1QZZA 2QWWA 3GZ5A 2J5PA 4HVQA 4IERA 4I3PA 1HKTA 5D8LB 2DCTA 1QQIA 4H0EA 4ZYDA 5A2QK 1DUXC 2KIUA 2JPBA 4RGRA 3LQQA 4O9GA 5DYMA 3L2CA 3E6MA 2A6EF 1ZX5A 4GULA 4U88A 3F6OA 4Q48A 1DGWA 2HYGD 2HS5A 3ZN0A 2HOEA 1W7PA 1KA8A 3I4PA 3I53A 3M7GA 1NE6A 4LMYA 2STTA 5I93A 5FO5A 2H09A 5A2QZ 2Q1ZB 3GO5A 1DZRA 1RIOH 1XGOA 1WA4A 2FMLA 3LSTA 1EH6A 5HLIA 5ICCA 1P2FA 2QQ9A 3GLXA 1BI2A 1LDKB 4BHBA 1D8JA 3ZN1A 5I0SA 1G4DA
chains in the Genus database with same CATH superfamily
2JSPA 2M7AA 2A69F 3G1MA 4L18B 1LPQA 4Y1YA 4HSJA 4RHV1 1AX2A 2H1LA 1GWMA 2X9DA 1N3PA 2R7ZJ 1V6IA 2N8GA 3T30A 2EICA 4A3EJ 2CW7A 4MNUA 2VBZA 3N4MA 4RM3A 5FZLA 1FNZA 4XLCA 1K45A 3BVCA 1RUI1 1WFXA 4A3KJ 2ZFUA 1VQ7I 2F6BA 5B5EC 2J1EA 4GMP1 3MD2A 1FBQA 4MOAA 3USUB 4AUXA 3SH4A 3NAPA 1OI6A 5A1FA 1FOD1 4XNFA 2RMU1 4YVSA 2JG8A 2B45X 1AWCA 1AF9A 5JUVA 2VASA 4OHZA 2W39A 3T0BA 3APBA 3O0XA 3O1SA 2BPA2 4AGVA 3G71I 3WCRA 2HWF3 1YQ6A 3DFGA 2V7FA 4BWOA 4YW5A 4L0YB 2ZX4A 2IS6A 1LNSA 2LLKA 3M4FA 4QPIC 4AWDA 2KDOA 3PFYA 5C4WA 5E1RA 1RUD2 3I54A 2AH2A 5M5XJ 5C9AA 3GTMJ 5JXHA 2QM3A 3WG7H 1YQ8A 1UMIA 4LEJA 4BZ4A 1Z7LA 1J83A 3BJOA 1JXNA 4KIFA 4YFKF 3ABKH 4A3CJ 2LH9A 1RUG1 2L0KA 2YC4A 2OPTA 2WAQN 4LJZF 5IK7A 4PJMA 2M0MA 1D3YA 2VZRA 2EBIA 5DDJ3 3VZLA 1L3LA 1SEFA 2ZGQA 3FBMA 3FMQA 1P4WA 3OYBA 4DYRA 3F8BA 2VPRA 1EAH3 2VQAA 3P9KA 3V4GA 3TL4X 3ES4A 4RYDA 4XN0A 2W1SA 3CUQC 1F4KA 2UWCA 4BE0A 1Y1VJ 1Y0UA 3AM2A 5IHRA 4YVWB 1FBUA 4XN3A 4XPVA 4L99A 1HIXA 3OSFA 3NAPC 3DL3A 2LG4A 2KQRA 3TBIA 1FATA 1G3WA 2WAAA 4IHXA 3SLIA 1X9TA 4IEXA 3WNLA 4ENJA 2JDUA 3CCJI 1H1MA 3E97A 1AL22 1WJEA 1W2NA 2BBAA 4GWMA 2OYZA 2DVBA 2A5YB 3I3MA 5ANQA 2MHFA 3GNEA 3CDZB 1TQMA 1WWYA 4LULA 5F3IA 3UT0A 3S6PA 2GH2A 1Z7S1 3JD71 1YO8A 3ITQA 2PAKA 5HPOA 2ZJCA 4RDUA 1H9PA 2XJPA 1FAYA 2CS3A 4A3BJ 4OI2A 1Z9CA 5LCWL 1DGWY 3I3EA 2FD5A 1QQP2 1K5JA 2WLPA 4LGWA 3F23A 3ABZA 1W90A 3VOEA 4XLEA 3MKYB 5CZKA 1XPXA 4P5YA 2XWBB 2CMPA 3WNKA 2CSOA 4MHUA 1HB1A 4KWLA 1A36A 4RB1A 3C7FA 5GTIC 2JA6J 3W5MA 2XGEA 1Y9QA 1CX4A 2LRPA 5CJ9A 5LLQA 4GFBA 1AL0G 4Y24A 4EWDA 2BXYA 1I1EA 4BE2A 1NY71 4LK1F 4PJ0C 4DB5A 4B4QA 4IE4A 2JE9A 4XF0A 4AEJA 4K1YA 4ZU5A 2XL9A 2W57A 3K2ZA 4E27A 5K5QA 4NAOA 4MFDA 4C0BA 2P6SA 2VJ4A 5JDBA 5M3FJ 5FKNA 4G6DA 5GZGA 2E34A 2EA2A 1DP7P 3SC7X 4W6YA 4KITB 2D1VA 3WDTA 1YO5C 3P9CA 1X1CA 3ERMA 3MDPA 1XN7A 1RUNA 4GJYA 1B35A 4RQPB 4AVVA 3Q3SA 4AGRA 1IGOA 4IEPA 5FRAA 3WF2A 3JRGA 3F72A 4QM8A 3ML6A 4FHTA 3HIFA 2WO1A 5C8WA 1MVEA 1USTA 1WCSA 1W9SA 5FRNA 1F15A 2XJRA 4CEWC 1JJ6C 5FMOS 2OQGA 2IXSA 2Y38A 4LB6B 5FZ1A 1AKHB 1LQ1A 3ZKYA 4NQWA 2JIGA 5IP7J 2XAFA 2KXLA 4BXFA 3MKWB 4LORA 3B5LB 2W68A 3C3VA 2J7MA 3G2BA 2AXTC 3MEPA 2XDVA 2EPFA 3L7WA 5K5OA 3LWFA 4BNCA 2A70A 1LUJB 4COUA 1YX3A 1C3HA 5FOBB 3S5QA 1XGSA 1JKOC 2OCEA 2KT0A 2E7TA 4ZKTB 2EILH 4XACA 4R4XA 1QZYA 3OD4A 1JZ5A 2F4MB 2DCZA 1A34A 3PL8A 4XF3A 2AQEA 3VHOA 4BUPA 3RYRA 1NG0A 3WY6A 3AZYA 1Y4WA 5J47A 4XUQA 1FC3A 2WA3A 5J36A 1D5VA 1MZ6A 1ULCA 4MADA 1ALYA 1TEIA 2GH8A 5TISC 2P6TA 4K8RB 3S1RJ 1P4XA 3GMEA 3TGNA 3HRMA 1GR3A 4G9SB 5FB2A 2W7NA 4XAAA 3D3AA 4IEZA 2ME0A 3ZXEA 2OZ6A 3BR1A 1W1WE 3K69A 5CVUA 2PHTA 4PDWA 3T3YA 5FYMA 4B1MA 4IE7A 2GN3A 2GALA 4DUWA 4ZDLA 3OTFA 1XBFA 2WAFA 2ZGNA 1TMF2 2X5IA 1V9U1 1GV2A 4XF4A 5IT9Z 1XE7A 1V6OA 4JDMA 2V1XA 1HKDA 3KIOA 1DYOA 3CO6C 2DMNA 1OISA 4CICA 2VJXA 3ZN5A 4XJ8A 1KS5A 1WQ2A 4LBKA 3HOVJ 2VE8A 1W7PD 5CFDC 1OQDA 2NVXJ 4HLTA 5H6RA 2JG9B 1YFUA 2E33A 2IS1A 3GHMA 3ZQHA 2LF8A 1ULGA 3C3WA 1MNEA 3FXRA 1PVC2 4B7KA 4COWA 3UKVA 4DNCA 1EY2A 2LOOA 2JA2A 1T38A 4D8MA 4N7IA 1UG0A 1BQPA 4KJZA 3OUJA 2MH9A 1X4OA 4LLFA 4J00A 5D21A 1OCOH 3NAUA 3K4JA 2J5OA 4RGGA 3RMYA 5GP9A 2VXJA 4GO1A 3KV9A 4QGNA 5F2SA 1EPZA 3DPTA 3WG1A 2WR9A 1F5JA 3ZFGA 4HSRA 1OYYA 3WHBA 3PU8A 3RCOA 4XCAA 2JG8B 2VCCA 3CNAA 4A12A 4PQ9A 3DKXA 2IGKA 3LEIA 1I50J 2CYYA 4JC1A 2KIQA 2IGMA 2G0EA 4F52A 4AK3A 1ETQA 1N1YA 3CMAI 5IYDJ 2R0FA 2X09A 5EP9A 3A0BC 5CEHA 3H7JA 4CRQA 2AYHA 1RMU1 3BROA 5DCMA 2O14A 2M8GX 2OXBA 3CP2A 5D6FA 3HT1A 2PTMA 4SBVA 4NHXA 4EGYA 1FPN2 3QCWA 4IVNA 4M9SA 1IS6A 3G6EI 1LGNA 2OC6A 4YGBA 1COV3 2VCMA 4OQ9A 4FP3A 1Z3YA 1FOXA 4RS5B 4TLFA 5IATA 5IVFA 1T95A 2BFUS 3A2KA 3OSDA 3HOXJ 4R8HA 2BYVE 5HODA 5LEJA 1VAVA 2PHLA 3LPFA 2PQQA 2WO7A 1H6XA 2XGDA 3HUGA 1CVNA 1RUG3 3KP5A 4WZCA 3VKOA 3RI4A 2GC3A 2RHPA 2OS2A 3O2PE 1AXYA 4QQHA 4BQ1A 1FIPA 1YJLA 4XQDA 3OGGA 5CFDA 4D7TA 5KC6A 3R4SA 2WNUC 1PX4A 3D5OA 3K10A 1X1PA 4IHSA 2Z42A 1UYPA 1H2LA 3WG9A 1X2MA 1MZFA 1M1EB 2R30A 5FJKA 4N53A 1K61A 5C3PA 1QWRA 2OZJA 1BW6A 5HOOA 2Y6GA 3MKZA 1GZ9A 5E8IA 3UK9A 4GWIA 3AYCA 2ZX1A 1SAXA 5CQEA 3IKWA 2Y33A 2W52A 3VBUA 4NRQA 5EF6A 1W03A 4PI2A 1ND3A 2RV9A 2Z9OA 1AJKA 3S15J 2Y60A 2YV8A 3ZX7A 3RGBA 2VECA 2CWMA 5FPLA 4F7ZA 1MS1A 4CU9A 4Q4Y1 5F04A 4I30A 3RJRA 3KFWX 1LE8B 2PJRA 3ZR8X 3ZO0B 2OA4A 3CJXA 3EJKA 2PAEA 2L9VA 5JOYA 4YW1A 5J3UA 2PHUA 3RYKA 3IPVA 4IX7A 4L5JA 3JQWA 3SCGA 3I2DA 1NZIA 4WM7B 4XFGA 4X8NA 2M1BA 3BP8A 5IAVA 3KP6A 4MUVA 5EYXA 4IEJA 1FT9A 3RFRA 1GT0C 5IK8A 3W9AA 3KVAA 3L09A 1V6NA 2K9SA 4L9JA 5IYBJ 5JI7A 5DS9A 1J3RA 4FOWA 3NKGA 2WDBA 4P02B 2PN6A 2I5UA 4LBQD 2WA0A 3J80Z 1V5EA 4F93B 3K48A 1GMMA 3GYHX 1WJBA 1HB4A 2Z69A 4BQOA 3HBZA 3WDXA 1MVQA 3FXQA 2V1NA 2J1SA 5FKBA 2A68F 2BNMA 4LOCA 4ZYAA 4YYOA 2R1DA 4JGZB 2KRFA 1EYBA 3OBAA 3V65A 4F55A 5C8CC 4S05A 1PNFA 2WL1A 4S2GA 2NMOA 3FXOA 1ZTRA 3AB0A 1WW5A 1OQEA 2FZ1A 1W2TA 1B1BA 2HQNA 3HOZJ 1JBCA 1RUC2 3UYJA 5H6QA 1BBT2 4BIFA 1VBB3 5D5UB 3WX5A 5ACA3 1GQGA 1RJ8A 4C1WA 5FYCA 1JZ7A 1IO2A 4PF5A 1FP1D 1GVDA 1DLLA 1SFKA 1QVUA 3MF6A 1JJ8C 2YPRA 2OUJA 4AYUA 1QDOA 3GZEA 2JRTA 3O8GA 3CLPA 4QXHA 3I59B 2O8KA 3WU1B 1SEUA 3W58A 2X85A 2YU3A 5FPBA 3HOTA 3T2QA 1JH5A 5GAEJ 2PHFA 3KHCA 3CD6I 1UAAA 1HXS3 1SLLA 4WXHA 2VNVA 3JRHA 1VMJA 1IPJA 3UJOA 2DQRA 3FHAA 3KLNA 4B3AA 3NRUA 1BHGA 1OH4A 2V1UA 5CVIA 3POBA 3WCSA 4AI2A 3L2UA 1VRH2 3M8FA 3CMGA 2VZOA 2IC1A 4E4SA 4YZ1A 5E89A 2WNVB 4PDWB 3AAFA 5FR3A 4BKXA 3S3NA 1VIWB 1EKEA 3FUQA 3OL4A 3ACFA 3CJIC 3CEWA 2B9VA 3JREA 1D1BA 2ZGLA 2A3SA 2WSUA 4HV6A 4IJAA 2ZJRF 3WOGA 2XHNA 2FHRA 2VNOA 4XBFA 3J7LA 4JYKA 2PI0A 2L9RA 2EXHA 3N36A 4ZONA 2Y9ZA 5EGOB 4C2MJ 3GEZA 2PQ8A 1ZH5A 4KNCA 3AMMA 4ES8A 3LSEA 3AMQA 1VRBA 3K4LA 4B47A 4I98B 3K70D 2QZ3A 2Y6LA 3N7MA 4COZA 4YLZA 3HBKA 5BY5A 1G9CA 5DN2A 2P7CB 2YMZA 4BM8A 3VD3A 1XU1A 3E1SA 4WM8A 3OYMA 3ZCOA 2K4BA 1RUF3 5IFTA 3TEYA 4NHLA 3DKYA 4LBLA 5HDKA 2WAQA 1CAVB 1IXSB 2PLYA 1IDYA 4GB32 4S2HA 1N1SA 1ZZ6A 2YC0A 5LA1A 1HRV3 1GP6A 4PJYA 3ZPLA 1MBJA 2O5RA 3NARA 2F5VA 2IPQX 3H9AA 1ZR2A 5BYNA 4XRMA 5C3QA 1UPSA 4E7HA 1OA2A 1CR7A 4LLOA 5EDNA 1Q8QA 2WV0A 1AYN2 5FLXK 1ZAOA 2WQ8A 2ZXQA 4AFCA 3BR6A 4FE4A 2DFEA 3H92A 1YC61 3HG9A 3WSOA 5AVPA 1WRJA 5T52A 5FYTA 3BTZA 1L7LA 2Y69H 4IRGA 2VQCA 2R5YB 2IA2A 4S0HB 2O8QA 1LFBA 3VD7A 2HWC3 3WE2A 2A1XA 1V6KA 4OOIA 3S2HJ 3I2KA 4QXKA 5DCFA 3H50A 1WBLA 2JRMA 1T39A 3LSIA 3DXTA 2YXSA 4M6YA 5LB6A 1OT5A 4KDPA 1S72I 1S0FA 4PI0A 1BEV2 5J1XA 4P55A 2XOMA 3VBSA 4RAZA 4WVMB 2PHXA 3HQUA 3JRFA 4D0QA 5G05L 1HLCA 5DABA 1QH7A 3FLPA 4B4RA 3IMNA 4YZ3A 4B3XA 4YIRX 1GOHA 5D5XB 4WM7C 3IIAA 3HPNA 5D4RA 4JKLA 2JWTA 3LSHA 4IV3A 1COV2 5E6HA 3KP4A 4Q4W1 4BGDA 4M6VA 2D3RA 2P3IA 1MBKA 1LB2A 3QU3A 2PA7A 3MLLA 3NAPB 4LA3A 2GC2A 1DIWA 1XGNA 2HOSA 1AA7A 2XGXA 4XOGA 1AHSA 4K2EA 2FBEA 2BV4A 4MGYE 2DA7A 3E7LA 1O3QA 3ZPYA 1F43A 4JBAA 1HW1A 2Y6JA 4W65A 1BBT3 3ASIA 4DJAA 3K70C 1QJFA 1MNMC 2Q0OA 1G3YA 1ASJ2 4KWUA 3BLYA 1GQHA 3MO4A 3WDWA 3IAS2 2VE1A 3S7IA 3ZXAC 1WLCA 3WP5A 2W85A 2WB1N 3I71A 2XG3A 5ERIA 1PDNC 4XXAA 1GICA 3MMYB 3QODA 2YG0A 4H4KC 3OOXA 5FZ0A 3ZXDA 5T5PA 1KS4A 5JOZA 4XK4A 1QZEA 3QH7A 4ZJZA 2DA3A 1AR81 2TEPA 2NVUB 4NC8A 2V9PA 1J59A 2V4JC 4DZJA 3GTQJ 2EQRA 1H2NA 2IXLA 5FFXA 4HPKB 4CDWB 1WGPA 5F64A 2HNHA 4DEQA 1RZ4A 2HYFA 4OUEA 4KBZA 1RUD3 1Z67A 2ZZJA 4AW7A 3J4UH 3S2WA 4N4OB 5FLHA 2HDDA 1J58A 2BBVA 4BQ2A 4YZ4A 4J25A 4CEYC 3MW3A 3J26N 1ZGJA 1OFCX 3BOPA 1IG7A 3EUAA 3RPUA 2ISZA 2EK5A 2Z16A 4LO6B 4AQ2A 1BC7C 2E9QA 4G3YC 1ODDA 3AFHA 4II2A 4ZTFA 1UY2A 3V0AA 2ZPXA 2FZ2A 4FETA 1UOJA 1AR91 3R6SA 4P9WA 3AZXA 3BZ6A 4QDRA 5HCBA 2IT0A 3N9LA 2ID3A 2E63A 5EJ1B 5C44J 1S0DA 3HNMA 1NOVA 3HPHA 5JXJA 1SLBA 4AHYA 4ASMB 3TO6A 2BGPA 4YWAA 1HSTA 3P5JA 3QP6A 4LBOA 2DA5A 4JGYB 1K6OA 4IGQA 2XH6A 4KWKA 5A3WA 1FZPB 4M3CF 4WVZA 2A3WA 3VBFA 3WQ7A 3K1MA 5K9YA 5LATA 1CAUA 2E19A 4UBHA 3GFMA 2NMNA 5FTTC 1FYUA 4E4HA 3OGVA 1N3OA 2KRHA 3HOSA 2JD4A 2ID6A 1O57A 4HG6B 1IUFA 4E7JA 4QWQA 4XLHA 4QPGB 3ZFEB 2OTJI 1YJWI 3ABUA 2DOEA 1OOPB 2D43A 3G3ZA 4BXUA 4QPWA 3OMYA 2R6QA 2EIKH 4B43A 4OMCA 2MA3A 2PMWB 2R4GA 3JD73 1XB9A 2G19A 2EJRA 4RL7A 4CDQA 5FY9A 2EZHA 2OU2A 4A69C 4XJWA 4ITVA 4MEXF 3KB5A 1J3QA 3DGTA 4HN0A 2YUEA 1IKPA 3JUUA 1AX0A 4IEUA 2VJIA 1SCRA 2VUAA 2IUWA 2RAEA 1Q43A 4Q5SF 3GDBA 1V4RA 2HI3A 4OMZA 4RHV2 5ILUA 4Q0PA 2JIJA 4BMBA 1RITA 4L5IA 2HPIA 4NVPA 3FHNA 2VXRA 1ENHA 2XPWA 1G4DA 4GYIA 1QF3A 2M5WA 3IUOA 1JUSA 4D69A 4EROA 2EIEA 3CF5F 3MUZ1 2DTWA 4XFCA 1BR2A 5DMYA 1XNDA 4V1PA 3BTIA 1PO23 3MI8A 4I0WB 4AVSA 2GIVA 3LQCA 1ZK8A 2CQQA 2I8DA 5KXDA 5K7ZA 3KLSA 3ZMTA 2JPCA 2MG4A 2FDIA 2JDMA 1J7KA 1VMHA 4CE8A 2RGVA 2CW0F 2J1UA 1CAWA 5LRRA 4DOUA 2VUJA 1ZA4A 5KK1A 2ZHMA 4GYGA 4PDKA 3FLRA 4QDQA 1W6PA 2VZ3A 4URTA 3PJYA 5FROA 2ZA9A 4CZZA 1QKQA 2VBDA 5IOZA 3D0JA 2Z2SB 1US3A 2E7XA 2M8EA 4M3CE 5LGTA 5M5WJ 4IE5A 1NA1B 4RFRB 1R1A3 4QPYA 4Q8KA 1E3PA 2RKHA 2RVCA 5GLUA 1R1A1 4Y5SA 3S5AA 2KMUA 4RS5C 5HV0A 2D40A 4ATEA 1OCPA 1UY4A 3ZR5A 1X33A 5LASA 3WT3A 1MKMA 2KKOA 1SPPB 4HW0A 3GCMA 4Y7NJ 1KFXL 4AEKA 4HK8A 1QMJA 3K4ZA 5A7NA 2VZQA 2HFHA 1FYKA 1K4SA 1T0FA 2HWD2 2QCOA 4W6WA 3WODF 1R1TA 3HEIA 1HSJA 5J37A 4A6EA 4DO0A 2FOWA 1IF1A 1R1VA 1JE8A 2B63J 2H0VA 5J4VA 3BY6A 3ONQA 4XKVA 1KXGA 1MMSA 4OIOF 1F8VA 5GPAA 3ZYRA 2OPKA 2YZ4A 4LJHA 3UKTA 2CQNA 1XG1A 3ETPA 3KP2A 3GM8A 5AC93 3I2FA 1RI7A 2LK2A 4NIGA 2XJSA 1DPRA 2AEZA 3BIEA 5FBJA 4HDUA 2M0CA 3RZHA 4ZDOA 2E71A 4D7YA 2X8KA 3B3QE 1H4HA 4WM8B 3CCUI 4KIBA 2CWSA 2D1HA 5H9QA 3T2OA 1W04A 3VN4A 4NPRA 4JGYC 4CCCA 2XBO2 5SV5A 2CUFA 4QGMA 1YX5A 3GHNA 4LUKA 2RS32 1UYZA 1E57A 5DUXA 2LMDA 3IMMA 4K8FA 3HN1A 1XYOA 3RKYA 2K86A 4EN9B 1QNYA 4U7DA 2HWE3 4MTEA 1OOPC 2HWE1 4B09A 1QA6A 3I4MJ 3ZOIA 5EJCA 3CJRB 3EPZA 3EUKL 5CQGA 1NCRC 1H2KA 3CCEI 5KHHA 2JWPA 2VIXA 4AIDA 2ZABA 4QXCA 1ERDA 2E7WA 1S0JA 4DQAA 3QU6A 2D5VA 1ZGAA 5GAHJ 1AJOA 2VGDA 4HDVA 3AYEA 5F5IA 4A41A 3VZNA 3HC7A 2JDPA 4CYCB 1W5SA 4P9YA 1HA8A 1AVBA 4CDXA 1LJ9A 3N05A 4KMQA 4CDXB 2JB4A 4QX1A 3LDBA 2CSGA 3HN3A 2ZMEC 2QSFX 1KONA 2XVLA 2D97A 2ZEYA 3K2AA 4U0YA 1B8IB 4NRPA 5J1UA 4WVMA 2BTVC 3MPPG 2VZPA 3LZZA 3BKZA 2XKPA 1CZTA 4SLIA 1WCKA 3CESA 4E2GA 4IV1C 2HWVA 4XRSG 1F9KA 5FQ0B 3OUIA 3LDRA 1LDJA 1R1ZA 3B69A 3DCQA 3O6BB 2EIJH 3MLJA 1B9MA 4ATFA 2GN7A 3VBOB 5IVYA 4F92B 4E4DX 1LU2A 4ANJA 2DFCA 4OUMA 1JUMA 1QDCA 1D0XA 2BBYA 5HS9A 1G59A 1AYM2 2RMU3 3K3NA 4GMP3 3DPLC 3PIOF 3KQRA 3B9IA 1CPMA 4LR4A 1VNDA 3TEDA 4CO8A 1P7IA 1S0GA 1RUE3 3OOUA 1JHNA 4MXVA 4BB3A 2DJIA 1AR63 2LNBA 2QZ8A 4BQXA 1OKOA 3VDDC 1OLRA 3WG3A 2R042 2XONA 1RUH1 5EPAA 2KPMA 4UV9A 1LHVA 3AP7A 3BQZA 2ETEA 2WIIB 1T6GC 4CCMA 3FISA 2X0LA 2Y6KA 1K5MC 2Y0OA 1T56A 4DOZA 2BU9A 2X53S 1PIV1 3LA2A 3RKWA 1ODNA 3VDDA 2E26A 6PAXA 3NW4A 2ZHLA 3ERED 5C4XJ 3T5XA 4BQNA 1XNBA 3GTOJ 2J5PA 3IH3A 4UW3A 4IUGA 3RZOJ 2DCTA 4CA0A 4RQPC 2KIUA 2QUOA 4V19K 1ST8A 2JPBA 1R093 3GF6A 4LKSA 3DU6A 1NLSA 2GM4A 3F6OA 1OLMA 1DGWA 4J19A 2K9NA 2HS5A 3USUA 4RR3C 2A05A 4L8QA 2HOEA 3I4PA 1X9PA 5FREA 3I53A 3M7GA 4CCOA 1NCQA 4LMYA 2STTA 3OYKA 1CIYA 2H09A 4D7MA 4FPEA 1DZRA 1XGOA 1WA4A 2FMLA 1D4M2 1EH6A 5ICCA 2DOAA 3GLXA 1P2FA 3LFIA 5C70A 1LDKB 1FOYA 3ZN1A 2NVYJ 1EV12 5FZOB 4OQ8A 4A3FJ 1IRZA 5L3EA 4DRRA 5CFDB 5C4JJ 4C30A 1CPNA 3TEXA 1DCSA 1OC1A 3JU9A 3FHZA 1A6CA 1GUIA 1W6MB 4JKMA 4MHRA 4HFSA 2VTXJ 1ND2A 3HZJA 1JUHA 3U1KA 3VYTB 2QQKA 2VBPA 2DPUA 2DK8A 1CZSA 1JTYA 1USSA 1APNA 1X1BA 1OYWA 2EH3A 1W9TA 2VQUA 2HOTA 2EAKA 2WUHA 3ULQB 5F9TA 3KT4A 4DXTA 1DGRN 2DBBA 2D6KA 1EF4A 5JZGC 1UELB 2LYCA 1K78B 4NC7A 4YIIA 2R7DA 4PIYA 4E8CA 3WHTA 1AHDP 3ZSLA 5KAFC 2CJJA 3TBDA 4LE3A 2DMPA 3MIDA 1ND3C 3BG3A 5LFAA 3WTTC 5KC5A 2BWCA 4IEVA 4HKLA 3LF7A 5LA0A 5HV4A 3WNXA 5J1YA 2FOKA 2R7EB 1W3XA 1OKRA 3S8PA 4AOCA 1IW7F 3PTYA 1ND2B 1SDDB 3VB9A 2A5WA 4L2NA 4QSHA 4HOOA 3GBWA 2HQRA 4QLCU 3TAYA 4DZPA 4P08A 5FMCA 4JQRA 2XF7A 4MGRA 2YSRA 3HSRA 1WH5A 4XMIA 4EYUA 1S1AA 4UXAA 4IEWA 4AVBA 2YDEA 1REDA 2VKDA 2R043 4AFBA 1TNTA 1I1GA 2Y0MA 1A8MA 3BGAA 4QAWA 4Y33A 1ULPA 5LBQA 3BIWE 4ZZ8A 5LHIA 3U0ZA 4K21A 5J1RA 2W4SA 1BI0A 1YYVA 2R32A 5FY0A 3T0YA 5ILVA 4MGSA 5GJ6A 3M3IA 1BXHA 1YJ9I 5IYCJ 3U9GA 1RR8C 3TEZA 2BY0A 1IRGA 4HNVA 4AIKA 3Q0UA 1VMFA 1S0IA 1PHMA 5EV7A 5D8AA 1FI2A 4PHZA 2VM9A 1F35A 1AYM3 2DFFA 3PSIA 4Q26A 5I91A 4ZPIA 2E53A 1OPMA 4ZXEA 1CWPA 2RS12 3WP4A 3WGGA 1OH3A 5CNAA 5FZ9A 1VBA1 1XNAA 1XGMA 3BPSA 3PVNA 4YEJA 1BK0A 5HLTA 1MNDA 1O3TA 2SBAA 3LAJA 2OPWA 5JHFA 2EA4A 2OQ7A 4ZS3A 1YS7A 5H9PA 4A0XA 5FP8A 3CDIA 4MG2A 3IB3A 1BI3A 4HF2A 1YWKA 5K7FA 1R5ID 5FY7A 3I64A 5CFCA 3IN9A 2LD5A 3U37A 5FZAA 4U2AA 1FXZA 4B48A 1ETYA 1N1VA 3DPUA 1U5YA 4M0HA 2CRGA 3VBRC 4XBNA 3IP4B 1FIAA 5E1ZB 4M3CB 4YM0A 1YQ2A 1C8M3 3NWTA 5FKKA 5LEKA 4M3CA 1SFOJ 4LBJA 4XRFA 1MH3A 2D2WA 2CYFA 2IAIA 2ET1A 4ISQA 1UYYA 3GBFA 2M45A 2WBKA 4GMP0 4XORA 4D7SA 3F8FA 2GOXB 2W94A 1NAEA 3RKQA 3CLOA 4XIDA 5L3CA 2VUDA 3NV4A 5IFPA 1JHHA 4D94A 4Q1RA 2F2EA 4WF2A 1JZ2A 1BJAA 3ZYBA 3U11A 2FDKA 3QP5A 3CZUA 2V73A 3ZMNA 2HR3A 3JBG2 4H3WA 4YFXF 2K40A 2VVFA 2W47A 2DAOA 1ULOA 3T1BA 2MC4A 3DV8A 2NP0A 4E2QA 4XOTA 1P92A 4QPIA 5AFEA 4Q4V1 4KN7X 4RLQA 1HXS2 4AEDC 3J7HA 2BY3A 3N7LA 5FPZA 2Q2EB 3ES1A 4Y17A 1TNRA 4IE6A 1X3ZB 4OCTA 1RUJ3 1XXNA 3F3XA 2JQ7A 4RD7A 2X6YA 1YE9A 2PFBA 4HNTA 2WS93 3L1PA 4F3QA 2IS2A 4DBQA 2G7HA 2HLEA 4PZJA 2YU1A 4GXOA 1JKPC 2CG4A 3FKJA 3DP7A 5FAXA 5TJJA 5FPVA 1KRIA 1HX6A 3SEEA 3ZFGB 3FXLA 1VBB2 1E2XA 3K75B 1GV9A 3EXUA 1OYIA 2X6WA 3BTCA 5BV6A 5FXXA 1AOYA 2G1MA 1SLIA 3CMMA 4H7MA 2BERA 5KXBA 5DEQA 4CP9B 4MZUA 1H9GA 2XASA 1X1AA 4ASLA 3OBTA 2G7UA 5FK8A 2Y75A 4A42A 3L00A 2FF4A 5A3LA 3OYJA 1RUI3 3H3LA 2RC4A 1OA4A 2FBIA 1FMD3 5FBZA 2FU4A 1Y8RB 4EATA 3W21A 2FD8A 1GZCA 4O6JA 3I58A 4KIGA 4GKXA 3I97A 4HN1A 1IV8A 1Y1WJ 1JT0A 5FQ0A 3AMPA 1J5YA 1H8TC 1RUC3 3MIFA 1BBT1 1JI8A 3ZXGA 1WJDA 5CADA 4L11A 3POJA 2NAZA 4I76A 5D6EA 3LD8A 4MO7A 2NOJB 1SMVA 4IW3A 1PGSA 2X1DA 4EMSA 4EJRA 3UGHA 3J7YJ 1UU5A 1U0JA 2VQHA 4P9XA 1IXCA 1MW7A 3PVBB 1G86A 1YS6A 1NCQB 1VQ9I 3HHGA 3W2VA 1HW5A 3NKTA 2VMGA 4N0BA 1JUIA 4A3GJ 1D0ZA 5FZOA 4YG2F 4IHWA 1R5HA 1UKRA 4LMFA 1OD5A 3B7MA 3DPRA 5FK7A 1K5MA 5BMZA 1OKQA 2EAAA 2L3DA 1PO22 3K9TA 3SHFA 3AL0C 4QQ2A 2RG4A 3BALA 2Q30A 3TN92 1R091 1NA1C 3HXLA 3R0AA 1A5JA 4AAXA 2VCAA 3Q8CA 5DM6F 1U0AA 2D3SA 2FA5A 1KD7A 5C5TA 2ZEZA 2O8OA 3K4KA 1SMYF 4M4PA 4OVEA 5JOXA 3KPHA 3ZMSA 4BBSJ 1ZARA 1ND3B 3V7CA 3MW2A 4CUGA 4XQWA 4Y1VA 3PQJA 4XDOA 1K79A 1W8WA 2XUEA 1VBA2 1H8VA 3Q0WA 1OXCA 3WG2A 1JS9A 1P6RA 1R6RA 1OQ1A 1QHGA 2ZX3A 1KQ8A 3NVCA 4AYBA 4BL0B 5JXGA 3S7EA 2XR4A 2RS11 4FPFA 5C3OA 3W2WA 4X0GA 1WGXA 1ACCA 2VJ5A 1NXD1 2YU9J 3HUGB 4DINB 3OF1A 2Q5TA 1JGSA 3RDIA 5DUUA 4ARXA 2HWB1 3VL9A 4PJLA 5E1XA 3IWFA 4GWNA 4BS9A 4TSVA 3N9QA 4Y22A 2JENA 1SLCA 4FPHA 3IDCB 4JTOA 2HVRA 1U5XA 1DPUA 3FK6A 4FI9A 3OJBA 3DBRB 5J6XA 4PFOA 4PLMA 2RJKA 5KXCA 2OJED 2ZKLA 4R79A 2HQ5A 3HRTA 2P5BA 3KP3A 4GD4A 4ZZLA 4LTAA 4ZS2A 5JZGB 1EUUA 2DURA 2CAUA 4A5MA 2PYTA 4KL1A 5KHKA 5DD4A 4CDXC 5IJRA 1ZZ9A 3M1HA 1S7EA 4YM2A 3WTUC 3U1XA 4JGZC 5B1BH 3H9JA 2JTVA 2W48A 1NLRA 2QQLA 3NJZA 3S1QJ 1LVAA 2UUZA 3VHPA 1MEC1 4DYQA 3IIIA 3OYEA 5M3MJ 4UW6A 5D4SA 1MEC3 2XVKA 1HB2A 1W7PB 1YQ5A 1VBB1 3POSA 4BDVB 2HDCA 2HWF2 4K40A 3MW4A 2EFPA 3ZFEA 3F9KA 1BM9A 1UB9A 1RB8G 2NXNB 3DBHB 2KR2A 2ZJ2A 1WLTA 2MLKA 1NQDA 5DM7F 3K1PA 3OB8A 3POYA 4XABA 1H8TA 2EFWA 1O3SA 5DQ0A 1R9TJ 3ALQA 5CKQA 5IPAA 2VQTA 3AJZA 5C6CA 2ZX2A 3LDKA 1ON1A 4UFLA 1Q8SA 2X6OA 2VLAA 2F4OB 4PLNA 2E7AA 4N43C 2F5EA 3E5UA 1XSRA 3ZIWA 4CDQC 2W3JA 4MV2A 1KYZA 1V5FA 1Z6RA 1J0RA 1HB3A 4DXZA 1UHWA 1TBXA 4UFIA 2HXIA 3T09A 3POFA 3RQ4A 1A6IA 3A23A 3Q9VA 5GZCA 5KHGA 1C4RA 3ROUA 3AVRA 2E1CA 1VBA3 3ZXLA 4L9NA 4LKDA 3KCCA 5A6QA 1EJ9A 5GZEA 2VUMJ 4XC9A 5BNGA 2JN6A 1MGTA 1YRNA 3BPVA 5I8YA 2C1FA 1K12A 3ETQA 4BDZA 2AEYA 4PF1A 3BR3A 1SZBA 2ISYA 5EYYA 1H89C 1Y0NA 1S2KA 2WT2A 2R7FA 2CV0A 4JTNA 2LW8A 1LHUA 2V5YA 2L2OA 4U0VA 3BR0A 3LE0A 1IN8A 3ZXKA 4L9TA 2DDAA 2VKHA 5JVGF 1KJLA 4N9IA 1OPCA 4NBQA 1CIWA 3KF3A 1MEC2 2WFF1 4B4PA 5BPIA 1K4TA 3THTA 3LNQA 3LIHA 3RWKX 5JSOA 4B1RA 2CW8A 3FE5A 3V8JA 3S57A 2O3FA 3CIHA 4Y20A 2EF6A 4CU6A 1GFF2 2EWNA 4AWXB 3AC0A 1NA1A 1ULEA 4IV1B 4R1HA 3OYAA 4F91B 2ZXJA 3N97A 5CA6A 5FZKA 4A45A 4XFIA 2JDHA 1ORKA 2YGLA 1ULYA 3ENRA 1N78A 5FKOA 1KJRA 5LA9A 3BOQA 2ETHA 1HRI3 2H8WA 1DDNA 3GGLA 2DCJA 2GA1A 1HXDA 1UKGA 3LFKA 3KQ4B 2EXIA 2CY6A 2HWB2 5JI9A 3IH4A 3IKTA 4EJVA 1HDPA 4JRAA 2QQOA 1O7FA 1RUI2 4Z2YA 3UR3C 4DNYA 1MMAA 2QQMA 1VF9A 3H5AA 1DHKB 3OY8A 4Q1PA 2XAJA 4HNUA 2I10A 2ZS6B 2CDOA 4Y1UA 4A3IJ 3M9AA 4N4NB 2ICWG 2P3YA 3PUQA 3TMOA 1BW5A 1R081 4M3DA 2RS52 3HR9A 3VPRA 2W5FA 1IS4A 2X10A 3WTSC 1RTVA 2DK5A 4HANA 2W1QA 3WU2C 4M71A 1D2SA 1AZDA 4FTSA 3FXKA 3VODA 4UFMA 3BQYA 2HH9A 1XDUA 4ZTJA 2RN7A 3NSTA 4YZ2A 3NEUA 3MN2A 4AF9A 3GJBA 4HLXA 3TN91 1PYVA 2WQZC 3RZKA 1YW7A 1O4ZA 1WW4A 4CP0A 4NB5A 3VBOA 4XRSA 2D5HA 4I99C 2WINB 1OURA 1FYLA 1N25A 4BYYA 4M6XA 1W8HA 4LLLA 4M9ZA 3AZWA 3VBRA 3ZPOA 1ZLJA 4XBLA 3ZLIA 1OBNA 1U8RA 2D6MA 2WY8Q 3QWLA 1YHQI 1GU3A 3KZYA 4RHV3 2K3FA 4I09A 4XXPA 2NZ9A 1SDWA 2DFIA 4QPOA 1IHMA 1GNYA 3KV4A 2ZJPF 4A3ZA 5CKNA 5FJ8J 3SYTA 4CYDA 1W8UA 4JCKA 4I7HA 3I9V2 2JG9A 1E5RA 4RR3A 1IJWC 5ICGA 2DTYA 2V09A 4GH4B 3ELNA 4R9BA 3PHMA 3V7RA 3BZCA 4XURA 5AVAA 2PLV1 2EA7A 3MFCA 3FXUA 4U7BA 3RSJA 1ZA7A 4DIQA 4A3DJ 3D4KA 3MGUA 1XQNA 2XPUA 5F6FA 2STWA 2GOMA 4D7NA 3M8JA 4HKOA 1ZZBA 5L7OB 1RUE1 1PUFA 2VB6A 4BMEA 1LJ7A 4XIOA 1X1DA 3B9CA 3RG0A 2Z79A 1VPHA 1XC5A 1PMHX 4CDUC 2WZR1 3RNSA 3H8RA 2XSJC 5JCTA 1SLAA 4YVWA 3K4CA 1ZNPA 1WLWA 2A3XA 1MMGA 1XE8A 1WCUA 1REEA 2E6VA 4XLNF 3HOBA 5IP6A 1Z78A 1ETXA 4DXRA 1V54H 3MF9A 4CEWB 3SDGA 3VD9A 3AMNA 2VOVA 2BWAA 4UVBA 4FQ4A 2BQPA 3LEKA 4QHBA 1F4HA 1TQIA 1D0HA 3MZYA 1WJCA 3W6VA 1QXJA 1KU3A 5DDGA 3D1NI 1GZWA 4LD5A 2HZTA 3MIEA 2LKSA 3VYSB 1QJY1 3ZDSA 1C5HA 2AHQA 5A1LA 4Z92B 3BOWA 2ZOEB 4FBFA 4UFHA 1US2A 1GZWB 1UCXA 1JZ6A 3WHCA 5CYYA 2A6VA 2R7WA 3WR0A 1S8NA 5LD2C 4YPJA 3BG6A 2LF7A 3NWKA 3LCPA 1LULA 3MQ0A 4K9SA 3JR9A 3F95A 5H20A 2TBVA 3VWBA 3C8XA 4BQ3A 5FYYA 2XUMA 4D3WA 5FLXZ 2IGOA 4ETSA 4NROA 2DUQA 1AU7A 4RGKA 5DZGA 2R16A 3RJ2X 1JHFA 2R3SA 3TWIA 2JSCA 4G7OF 1BMV1 4UF0A 4XLPF 3J8F1 1W6NB 2KIMA 2VW1A 3P6BA 4OHVA 1C57A 1C1LA 3DKWA 3NQHA 2VQGA 4HSTA 1JYNA 2FNPA 4Q5OA 3WDUA 1H9TA 4YIFA 2XAHA 2DDUA 4XDPA 2ZMEA 3K4MA 1TWHJ 1YI9A 5J48A 4DYCA 1ZKGA 1K3IA 2IBDA 2WAOA 3FJSA 3AKQA 1GYKA 2VH9A 3HM5A 1OFSA 3RPQA 3J81Z 4HLYA 2MD5A 3MUY1 1W0NA 4G4FA 5CVJA 1S5LC 1LOFC 5C9AB 4GDFA 1ONVA 1LRHA 1ASJ3 1W6PB 2PEXA 4IQJA 5C3SA 3PIGA 2Q8OA 2ZSIB 2ZAHA 1Y56A 3OY9A 4GCVA 4M72A 4HF1A 4AI1A 1H2MA 4KT5C 5A7WA 2FBHA 1BI1A 4ENNA 1RHI2 4MQ9F 2NLRA 3M8EA 1TT5B 3RJPA 2BW8A 2ERFA 4UNOA 3SEZA 4YW7A 4HETA 1IXRC 1YI2I 3BPZA 1AXKA 4YG3A 5EJ3A 1T2XA 3LSDA 1LTEA 5FKCA 3TOBA 2W82A 4RA0A 3QYFA 1WD3A 5DUVA 1WMEA 5ABJB 1NH3A 2NVTJ 3M2MA 2CFXA 1MS0A 2XJTA 4FTBA 2A61A 2P8TA 3VEPA 2OD5A 1CD3G 1TWFJ 4D5FA 1G7YA 4UUVA 2Y30A 3Q8BA 4FPKA 3O5SA 3S3OA 2XKOA 3CQOA 1FX7A 1UFMA 5F39A 3N35A 3ZXFA 4DBRA 5FPAA 2EZLA 5E18F 3VDAA 3J80K 5FLVA 2NYXA 2JVGA 1WBFA 5C3RA 3QPTA 3BCBA 5GPCA 1N3QA 5GZDA 1OUXA 1Y6IA 3SCFA 3USSA 3Q9OA 3CC4I 4Y5TA 3EQLF 1DQ2A 1BR4A 1S0CA 3H5NA 3JB8A 1FPN1 1MSEC 5GM0A 5BNOB 4PGHA 1IN5A 5JXIA 1FPN3 4HKWA 2N7GA 1R58A 3R0RA 3A4CA 2GIZA 1XSDA 2MNGA 4B3NA 2ZNYA 5F0HA 2VXZA 3HYIA 4OIPF 3K1NA 2BVLA 1IN6A 5BNPB 4OAZA 1GUUA 2NNNA 1O4XA 3O3KA 2E2HJ 2LY1A 1OF3A 4K20A 5A7SA 1H30A 4JQTA 2MBFA 3WZ1A 1P8JA 1I27A 3U4SA 3WV6A 1NCQC 5E20A 1RUF1 5E16A 2QUFA 4BLJA 3VBUC 1H4GA 3MZHA 2V5DA 3VYUB 3HSEA 2UZKA 2KL4A 2VXDA 2EIGA 2X5IB 3H0GJ 1RUF2 3T1LA 2VJJA 1HRV1 1K42A 1QXRA 2A6YA 5JPNB 3ZQLA 2Y64A 4GWJA 3KETA 4OHWA 2WS92 5KWRA 4GIQA 1UWWA 2LKPA 4N8MA 3C7EA 1RUE2 2WWUA 3IZOA 3ON7A 1PMIA 2GDFA 2BW3B 4FX4A 3S30A 4AI0A 4IF4A 4CXWA 3PUIA 2VO5A 3F6VA 4OZXA 3AP5A 2RJ2A 1R1A2 5KHDA 4CEYA 5A6YA 4G94A 1XSXA 1MS3A 4IXAA 3KV6A 5FCCA 1MBFA 1QOTA 3U21A 1WA6X 2OTLI 2CV1A 1W3VA 4BQYA 3JCUC 1JMUB 3FUOA 1I39A 2YR2A 3PMEA 2IXIA 3WTZA 1JOJA 2WNVA 2JJ7A 2E32A 2PG4A 4W8JA 1JODA 2JVHA 1GNZA 3RRDA 1ZELA 2QYOA 3ZN6B 2BV6A 4UB6C 3A01A 1Z6TA 2UU8A 2K7LA 3KT1A 1WI9A 4A3MJ 1D4M1 2XVCA 1NCRA 2LFBA 1RIRA 1UU6A 3QYBA 2C24A 1XNCA 1WMDA 1H0BA 3M8LA 3GF2A 2XBO3 3SHRA 1WD4A 1J2XA 4MEYF 5LHGA 4KU7A 3WUCA 4E2SA 2A6TA 1LNWA 3R4DB 2Q1FA 1APLC 4BEHB 2IXCA 3M3QA 3TN93 4Q47A 2J1RA 1NXMA 4WK8F 4CYCA 4ENKA 1X8EA 1LDDA 3GCXA 2VZSA 4NC6A 5L3BA 2QVOA 1ZBA1 2W87A 3C18A 2YGMA 3PL0A 2X4HA 1ZR4A 4ZC3A 4BJ5C 3LA3A 2ATFA 5JWPA 3FFQA 2X51A 3NV1A 3F8NA 3URFA 4BQ4A 3IKVA 3OBZA 1RGSA 1X2NA 5A80A 5HS8A 2UXXA 4BJ6C 4IRHA 2A71A 2QQWA 5AIPA 1TQPA 5JSRA 3VB2A 2RR13 4GZ9A 5FRMA 3GZAA 4A3JJ 3PSFA 2QTWB 4PQQA 1LOBA 4MYEA 1LEMA 2KA3A 1RKWA 1MBEA 2QQJA 4KG8A 2Q2EA 2FXAA 3M4OJ 3H5RA 2H94A 4FSJA 2C6YA 2GAUA 1FPQA 5FLJA 4NRMA 2NVQJ 3LKJA 4G7HF 1T33A 3HWJA 1ENRA 1T0FC 1YRZA 3SXYA 1DZTA 3O12A 4MQVA 2DMTA 2E51A 3RZGA 1XC6A 3M07A 4BK5A 5BNPC 1WKMA 4XEZA 4CDWC 2KD7A 1ITYA 2XQXA 5CVRA 5JIAA 4EJOA 3I5UA 4WV8A 1LVKA 4Y26A 3I2IA 4P9LA 3BUCA 1LOGA 4CXFA 4U87A 3QLQA 4FOYA 4R4ZA 2IP2A 2QSHX 2Q8KA 3PMSA 3SMHA 5DAWA 3FLTA 4N53B 2QSGX 2ZB9A 3AP4A 3BC8A 1R4MB 1FSHA 3QPLA 3GXUA 2PQSA 1PO12 1W5TA 2JKXA 1WVRA 5D2AA 3V56A 3I0TA 5F1JA 3AL5A 1S4CA 1IDZA 4A4AA 5EWSA 3GZTB 1AR93 5FP7A 3ZYFA 5JLXA 2Q4SA 2KM2A 1GDTA 5A3UA 4OZOA 1ODMA 2DU1A 1IV6A 3WQ1A 1NY72 1C8NA 3H9QA 1YW8A 4MGQA 1YI7A 1SVMA 2DMQA 5J40A 4W6XA 2HTSA 2P5VA 1OCTC 1KYWA 4FXGB 2IA1A 2OVUA 3JTHA 2HEWF 3TNQA 1SBEA 2DYCA 2JMWA 5SV8A 1XS9A 3HL2A 3THCA 2ORXA 3LIGA 4OHXA 5DD8A 3WHUA 5CFCC 4HK9A 5FLIA 2VL4A 2V79A 1W0TA 3CP8A 3ZSKA 3MCZA 3NMBA 1C1FA 3OYNA 3GTGJ 1ETKA 1MPXA 3U10A 3HGGA 4QX7A 4N7UA 2ARBA 1QOOA 4BU2A 4RN5A 3ZVXA 4O7XA 4Q0SA 4IXLA 1KITA 5JR7B 2P4EA 3VLBB 3E3VA 2CUJA 5L19A 2VKVA 1LE8A 2PJRB 1AXZA 3DCFA 1YLLA 2HDWA 3PUFA 2R1BA 1OOPA 1HRI2 2DUPA 3AX4A 4PJJA 1F5TA 2W24A 2R93J 4PBPA 1ZGWA 4URAA 3POGA 3X29B 2I07B 3ZMZA 4Q4V2 2LTNA 2WWYA 3WP6A 1JW6A 4I02A 1FOKA 4LK6A 1ON2A 4IHYA 2D98A 2AO9A 1KZHA 2ZFWA 1SQ4A 4PUSA 1KDKA 2ARXA 1W9WA 1DQ5A 3CKHA 3FMSA 4YFZA 3FXJA 2DFHA 2HXOA 3EYYA 1VQPI 3CCLI 1A04A 2A6ZA 2WA4A 4PBOA 3VZJA 2MGQA 2F5CA 3DPRC 4YW6A 1GOGA 5FPXA 1WI3A 3OG2A 4XETA 1CZVA 1H1AA 4META 1QZZA 3RI9A 5C8CA 3GZ5A 3MICA 4QQLA 5DG1A 1HKTA 2D6NA 1QQIA 2W9XA 5DAVA 5FO9B 4H0EA 4ZYDA 5A2QK 2R041 2ARAA 1CX1A 1W05A 1CQ9A 3LQQA 4O9GA 3E6MA 4U88A 5HNHA 3OYFA 3ZN0A 3DLAA 1W7PA 2K2SA 1NE6A 1MS8A 3NNFA 2YPDA 5BNNA 5FO5A 3GO5A 3M3OA 5L36A 3T4VA 1D8JA 1WZ2A 4UT5A 3H7YA 4CCDA 4QKBA 5JMCA 4WX9A 4NHMA 1AYM1 3UKNA 3M3EA 2GP3A 2RS51 2P5LC 3S1NJ 1PVEA 2FSWA 2B9UA 1SC7A 2M2EA 4S04A 1EH8A 4RS8A 1UU4A 2NS7A 2MEV2 3LEMA 4CUCA 1U6GA 4EN8B 3RZMA 1DGWX 1LAJA 3HRUA 3SISA 5LY2A 2M87A 2OW4A 3KYCB 4Q29A 3CCSI 2FCUA 4KBBA 3I4NJ 1UY3A 1UXZA 3VBHC 1ONAA 4Y13A 1EP0A 4NPMA 2PMUA 2X6XA 4CEYB 3VBFC 5F27A 1TMF3 2BZTA 2JA8J 2CO5A 2P4WA 5EEAA 3H0DA 3C7JA 1TLHB 3DTIA 1IOAA 1XB4A 4XMAA 1FNNA 3WNMA 1SFXA 2IW5A 4XHBA 1W9FA 4AFMA 2RV8A 3CCQI 1NKGA 5FXWA 3ZYHA 4GALA 1T6BX 5LHHA 4XJUA 4FAGA 1O8PA 1SPPA 2WFF3 3A01B 1MJ9A 5FLMJ 1U5ZA 5T54A 1JYTA 3GWZA 3M3CA 2PHWA 5BNNC 3CZ6A 4HL0A 4EN6B 4AVPA 4N53C 3H8XA 3QD6A 1HF0A 2JDNA 2BUKA 2IVIB 1MBGA 2MSYA 3DWLE 2BHZA 1GQPA 3I3DA 4O3MA 2QBYA 1W39A 4FPLA 3I49A 3KE2A 1FNYA 4KT6A 4YGEA 3MWMA 5FIXA 3FC0A 4OFGA 5A32A 4L0PA 2VE9A 3N9PA 1IN4A 1AR92 3OGJA 1BMV2 2JG9C 5A7QA 1VRH3 2XB0X 4EEFG 2B9SA 1VRH1 4XJ9A 3OY8B 1D4M3 1U5TB 2LALA 3CMYA 4QX3A 2XLGA 3O1MA 4XOPA 2XMLA 1K83J 1UZVA 1U5TA 2HVQA 2XBO1 1UYXA 1E0EA 3BJAA 1VBD2 5EYRA 2VUCA 3P3NA 4H7LA 3TKYA 1OSGA 2WQ4A 5I0UA 1HQNA 1Y39A 2AR6A 4B29A 1HQCA 4J1XA 3NWSA 3O8HA 1OPOA 3WLUA 5L3DA 4HQMA 3H8OA 5FMDA 1VB4A 2JEMA 2VQLA 2VI6A 3IL2A 1XMXA 1YFWA 4QKDA 1DZQA 3VZKA 4L5EA 2WS91 2DLLA 1UHSA 1G9DA 4C0HA 4UUSB 2DI3A 4ONUA 2R063 3DUIA 1LR5A 1WCMJ 4H2AA 1N1TA 5C9AC 2KRCA 1DQ4A 3OGRA 5C71A 4COYA 2E31A 2NS0A 3DKQA 4B8EA 3KZZA 1BA5A 4QX5A 2HKXA 5FZIA 1S2EA 2PMZN 3D8CA 2IVMA 2CGNA 1HV1A 2B8MA 3IBMA 3R4UA 5ERLA 3BG7A 1WSUA 4ZZDA 5HBAA 2B46X 2CV6A 1TW3A 4CPBD 4WM8C 1DGLA 2ZXHA 3ESWB 1JN2P 4A0YA 2B7YA 1CAVA 1XPWA 1CQTA 4BQWA 4J01A 1GKBA 1AYN3 4D5CA 2NOGA 3ATGA 1G8XA 2GMPA 5FJHA 4NAMA 1PUEE 4HX7A 3U78A 3J7MA 3S0MA 1PUFB 3P1IA 3OUHA 3FFZA 2IFWA 3SEQA 4E8DA 3ME2A 1REPC 1BVVA 4RGSA 4A7KA 1RUH3 1VBE2 4CTEA 4UXNA 1TT0A 3VHNA 2Z4FA 1ZZ7A 1T08B 2DCKA 4P9UA 4S2DA 1ZQ3P 4WCGA 4LLGF 2A73B 2BRTA 1JU4A 2RE9A 3R4KA 1JKRC 2VU9A 1JYIA 2UXNA 4JDOA 1OHFA 1I5ZA 1JKQC 2CL2A 4GXLA 2FJ1A 4G6TB 3BCWA 3VBRB 2L7FP 4ZYHA 1VBE3 3ILRA 2YY1A 1YHFA 4L0ZB 5IYYA 2K9QA 2JICA 2HYKA 2JJ6A 2UWMA 1S7AA 1RUD1 1HN0A 1TME3 2KDZA 3FIWA 1BK1A 2QDNA 3BODA 2R072 2NM1A 3LQRA 2DWRA 2F48A 3INAA 2C26A 1URXA 2VKEA 4W97A 5FWJA 3CC7I 4MSVA 3S32A 1O59A 2EFQA 2LKXA 2DCYA 4QX8A 3TNPB 1BOAA 1QJU2 1BEV1 2YBPA 4EM1A 2TCTA 1BEV3 4LHNA 1VI0A 1QNTA 1W2AX 1Y8QB 2E1NA 2L4AA 2C6SA 2R5ZB 3WQBA 1UO9A 1JYCA 1UZ0A 1LKNA 3WQ0A 2VOWA 1R36A 2RS13 2F5FA 3T8RA 2ZGUA 1NUKA 4CZCA 2YB7A 2DVDA 1J09A 4QX0A 2RS33 1LOEA 2RQQA 2XROA 1IUYA 4EV0A 3F0CA 4B44A 3F8MA 2O0OA 2CUZA 2PAMA 2DOFA 5JHUA 4FPCA 3VD4A 2R7VA 4J6GA 2HWB3 2QEXI 2P7VB 3SCHA 4XTPA 1AR73 3E5XA 4OWRB 4BISA 2TDXA 2NN8A 5C4WB 3CF2A 1JYVA 4RMNA 4M73A 2R073 1E17A 3RQ0A 5FZBA 3V64A 1Y9MA 2ESHA 2IEKA 3C2HA 1U3EM 2YFUA 2A07F 4KISA 4OINF 3AG4H 1MBHA 3LAPA 5FYZA 5IW0A 3DF0A 1U78A 2DJNA 1MS5A 3HJRA 2OKXA 3D5LA 4GB31 4DQ2A 4HOBA 4JDNA 5ACA2 1CAXB 3ZFFB 1PZ9A 2DVFA 2ORZA 3F8CA 2HWD3 3G4SI 5FUNA 1B59A 5J4YA 1PJRA 3FL7A 1SD7A 3H9GA 3JSPA 3VUOA 3TQNA 4LHKA 1EA3A 5IT9K 4GA9A 4OLLA 3WTWC 2P1BA 4XUTA 3Q0VA 3KX2A 5EZGA 3L2RA 1UPIA 4ISRA 4BHPA 4P96A 2QKMB 5BUVA 3U14A 3CCMI 1S7OA 4DY3A 1B72B 1TZLA 4OHYA 4IPAA 3T2TA 4E70A 2VOKA 1RMU2 3KLOA 1ZYBA 3KVBA 5KCMA 3FBYA 2Y0SA 5FV3A 4YGCA 2FRHA 4WZFA 3VGIA 4IL7A 4O65A 2MABA 2WZ8A 3GZNB 5H9RA 1HXS1 2X05A 3BU7A 1RETA 5J8FA 1MJBA 4NDLA 5LGNA 1JZ3A 2C9AA 2FBKA 4H55A 4MHGA 1UMHA 4XZUG 1HQLA 2SLIA 1LODA 1VQKI 3N9NA 1OFNA 4I2OA 5T3NA 3NQOA 3JD72 3HMYA 1N47A 2DCEA 2VODA 1DYKA 3DYPA 4LNVA 4XTMA 2DBIA 4QB2A 2OUMA 2XPJA 5FZ8A 4FCYA 2F5DA 4ZU7A 1QH6A 4EZ4A 4UW4A 2LR8A 1BL0A 3K6GA 1WZXA 2XSDC 2A75A 3WNNA 2MPFA 4FE7A 2P3KA 2H8RA 1X82A 3AZZA 2BXZA 4M3FA 2PLV2 1LGCA 1VBD1 1DFQA 2L02A 2QBXA 4XFFA 2WJSA 1QHDA 3KSCA 1JYWA 2YHJA 2FQ4A 3JTGA 1WW6A 1MMDA 2MLGA 3CBNA 3WTXC 4XUNA 3KYDB 2P17A 2FDFA 1POGA 1BYHA 3HDDA 2QF7A 3FM5A 1EH7A 3CTAA 3KV5A 3OPTA 1XRUA 4XKWA 5J7MA 1Z77A 1KU7A 3CF6E 1FWZA 1BKZA 4PK4A 1V9U2 3W2AA 5I0TA 3VBSB 3GW2A 4XSZF 3OIOA 2OQRA 2HKOA 4RBOA 4QPIB 5FZEA 1HOMA 3VDCA 1FYMA 1F9NA 2MC3A 2V6CA 3C7HA 1SAUA 4XJAA 1A6QA 2E1MC 4ZDPA 5AC91 1QHHD 4MXWA 2EB7A 5DZFA 3DN7A 2RDSA 4HBNA 2CH0A 4HA8A 3FXMA 3C2GA 4HYEA 1ACIA 1OF4A 4XVHA 3LPGA 3DEMA 1FBSA 4A3XA 5A3NA 4Q4V3 3JCIA 3VKLA 3T8TA 3PM1A 1MDMA 4LKEA 2PHRA 4QU1A 1DQ6A 4C90A 3HRSA 3CLQA 4PSXA 3QOPA 2PXJA 5FGMA 5D8KB 2ZEWA 2HQAA 1R7JA 4XFHA 3M3YJ 2GNMA 2B42B 4AGGA 5T5LA 3NV2A 4TYSA 3MYXA 2JG8C 4AHZA 4RGAA 2DT6A 1RXGA 1VP6A 2YYOA 3A4UA 3AXDA 3I4IA 2EV5A 3EUHC 4YGDA 1S3JA 4MLOA 1WMXA 3QYEA 1T98A 2M9HA 3BN6A 1GWKA 1YQAA 3MIHA 2WTEA 2C5DA 5DCMB 4AD9A 3BTYA 4CU8A 4Y3OA 4M74A 1RKTA 2O03A 4R9DA 3ZMOA 3EB7A 3K77A 4PJNA 2D44A 3I8TA 5E3NA 4CCNA 2PHDA 1FMD1 2BOJA 2FQPA 1RPWA 3IWZA 3PNAA 3OOPA 4MGKE 4KUMA 3DBLB 4XCBA 3COAC 4INDA 5CAZA 2Z5UA 1HW2A 5I8TA 1Q1HA 4ON0A 2IFRA 2ILMA 3GTKJ 1X4PA 5I0DA 1TL8A 2XL7A 4P00B 1TW2A 5FDBA 3O0VA 3V42A 2BNNA 1GOFA 4QHOA 3QACA 4M3GA 2L7MP 4BXSV 3V0BB 4Z8BA 2XJUA 2Q8EA 1KEXA 1R71A 4EJWA 2HZDA 4OMYA 2HWE2 5LK5A 5LBBA 1YEWA 3HOWJ 4FFHA 4OYUA 2FNAA 1A8DA 4CU7A 2V6EA 3ZIXA 1Q1VA 4GGGA 4NWWA 2M34A 3S93A 2BEOA 3K4BA 3W6JB 4Y4YA 4YFNF 3FN9A 3HNYM 3HJEA 4O9EA 2HYJA 2WNUB 4P9IA 3ZSEA 1T2KA 4AEMA 1YCIA 4PIXA 3ST7A 4Q4X2 1U5TC 1Z7S2 5CLSA 4LLNA 3A0NA 2PLV3 1W6QB 3DU5A 4NOTA 2WB1A 1YW9A 1Z1DA 3HBLA 1W6QA 2DTZA 1UOFA 4CDWA 3CDHA 1GSLA 3GZ6A 3VV1A 4YW2A 4AVZA 1SFEA 2VBBA 3EHKA 3K51A 1RUJ2 2KJCA 2B39A 3WF3A 1UZCA 5L73A 4LUMA 4P1WA 4IV3B 2YX7A 3ZQFA 4RGXA 3SH5A 4IL6C 3WNPA 3ZSJA 4ZU4A 2WYSA 1HRV2 2BY2A 4RSUA 3EETA 4AQTA 5GTHC 1SANA 2K9MA 1IG0A 4EE2A 3TEWA 4B7EA 1TWCJ 4AG4A 3JRIA 1SHWB 2CQXA 4BEHA 5F6KA 2XLAA 3ZOBA 2F17A 3AJYA 5DDJ2 2KZGA 3F21A 4ASNA 3PJQA 2UY8A 2VL8A 1P9QC 2A3YA 1K5MB 2LC2A 2FQ3A 1Q5OA 1MD0A 5JOWA 1IS3A 2XIGA 1YIPA 1W6MA<