1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
1TW3A 2HTSA 5C8WA 3ZP5A 2WV0A 4R52A 4XETA 1O7FA 5FB2A 1DGWA 2B0LA 3KP2A 1O5UA 3ELNA 2GC0A 3HOTA 3ACLA 1ZRRA 1SD5A 1FZPB 3GBFA 2RQPA 5CU1A 5E1ZB 2DK8A 3V8JA 4HDUA 1SD7A 4LB5A 1QPMA 2H6BA 5HDNA 4WWCA 2V9VA 5AONA 4LUMA 4YSFA 4KYWA 5L3EA 2VPVA 2ZKLA 3BCWA 3K1PA 1PM7A 1FP2A 3ZMTA 2HWVA 3LQQA 2Y0OA 3BB6A 2VC0A 2QLZA 3HRUA 2LKPA 1ZREA 1QXRA 2G7UA 4EVIA 4LLNA 3RJPA 4UVAA 2Q30A 4O5VA 4MGZE 3REOA 1T2KA 1VJ2A 4MEXF 4LFUA 5E1RA 3TOAA 2P17A 1DP7P 2STWA 3N4MA 2ET1A 5D1IA 4L0YB 3IWFA 1U5TB 1TBXA 3B73A 4ETSA 1MDMA 3MEXA 5HI0A 1SMTA 1IW7F 3HRSA 4QGNA 1YFYA 5CLSA 4XF0A 1S3JA 5FFXA 1V70A 1FX7A 4B8XA 2ZMEB 2LDUA 4JBAA 4MGRA 2D5FA 2O8XA 4MH0E 4YG2F 4IESA 4ON0A 4LLOA 1XMAA 4KN7X 3H8UA 2HYGD 5BPXA 3V4GA 4D7TA 4TV7A 1RUNA 2Z5UA 2Q0AA 2GC2A 4XFFA 4BAYA 1FYLA 2JZYA 1G6NA 2O03A 1GQHA 2OYZA 1Y3TA 2XAQA 2BGCA 4L9VA 4KNYA 3TO7A 3VOEA 2R3SA 3M9AA 4LEJA 2NNNA 2DW4A 2PAKA 2RKHA 5D8KB 4P5OA 4HF1A 4KT5C 5HOOA 1YG2A 4MZUA 3FXRA 4AIJA 4ZU7A 1P4XA 3CUOA 1BOAA 5LEJA 1X7NA 3IKTA 2IP2A 2DTRA 1O5LA 1SFEA 2D45A 3MDPA 1YFUA 3RKWA 4OIPF 4MTDA 3CDHA 3CLOA 4KU7A 4O9EA 3JTGA 1C0WA 5FPZA 1HQCA 2OAZA 2VE8A 4QX5A 1W5TA 1B9MA 3NRVA 1RIOH 5H6RA 3WU0A 2E7WA 4ESFA 4HBLA 1BBYA 2FMYA 4I01A 4E2GA 1B9NA 2A61A 3IC7A 4HV5A 4PGGA 1CX4A 2XLFA 3CUQB 3SHRA 2LF7A 1QZZA 3OCPA 1GXPA 4PIXA 3FM5A 1QGPA 3I58A 1FBSA 2OA4A 4KU8A 2GXBA 4AVPA 1VP6A 5JSRA 4GYIA 3T0YA 5TRDA 1FYKA 3R6SA 1PP7U 2XASA 2J5PA 5H6QA 5K5OA 1KYZA 2F5FA 2PA7A 1PP8F 1E17A 5JI6A 1G3WA 1ZG5A 2UXNA 2CAVA 4LLGF 1CAUB 4AXOA 4EQQA 4WX9A 4IHSA 3E97A 5L3FA 5T3NA 4RB0A 4LUKA 3QPTA 2W25A 3WU1B 2EV6A 4Q0PA 4OMZA 2K02A 4I3PA 5IT3A 3DKWA 4L0ZB 1V3FA 4XF1A 2UXXA 2ZMEA 2L54A 1J3RA 2D93A 1SQ4A 2ZBKA 1T39A 3GF2A 1R5GA 1YFXA 3ZMSA 1R00A 1ULYA 3G3ZA 5DUKA 4WXCA 2HZTA 3AAFA 1P6RA 4ORFA 3KETA 1Z1DA 2ZNZA 1O3TA 4RGSA 1JUHA 1B4AA 5D8LB 4PDKA 2K0GA 4B29A 3V8KA 2K27A 2YSRA 3ERED 2XAJA 3FM3A 4XFGA 1ZRDA 3OF1A 2GC3A 4HVQA 3EETA 1EP0A 1BIBA 3I54A 5D6EA 1ZZCA 2BNOA 1KA8A 5FD5A 2EFOA 3HSEA 3WE3A 1W5SA 3F3XA 2B9UA 2PFBA 1YTYA 4X6QB 4JTOA 4L5IA 3WW1A 5JAXA 3ZDSA 4IEZA 2IJLA 3HHGA 4HAMA 4XSXF 1IAWA 1XSXA 4EM2A 3SFZA 4LA2A 5JVTA 3RNSA 2QZ8A 5BOXA 2QQAA 2PHDA 4RGXA 1KU7A 1HW1A 2PTMA 5DDGA 2L02A 1ZH5A 3GLXA 1I27A 1XGOA 3C1DA 2GXGA 2MBFA 2ZO4A 4MX3A 5I0RA 3KP5A 5DYMA 1XGNA 1H1MA 3V7CA 5BXXA 1QY4A 3SXWA 2BNNA 3LA3A 3DF8A 1Z9CA 2M5WA 3FMQA 3L9FA 2ZJ2A 2Q0OA 4G94A 4P9UA 2OA2A 4WXDA 1P4AA 4L9NA 5CVUA 4L5JA 2G7HA 3F21A 5CVJA 4HX4A 4MTEA 3BWGA 1U5TC 3DEUA 3WE2A 1B59A 2STTA 1RTVA 1XD7A 1W4MA 5E1XA 3TDZC 5HS7A 3ETQA 2O3FA 4CHUA 4NQWA 1VR3A 1IRGA 4WZCA 1G3TA 2EV5A 2L01A 2Z69A 3BJAA 1CAVA 4U0YA 5FLXZ 4AVBA 4A6DA 1IF1A 3EYYA 1CAUA 2JPCA 2IA1A 2F5CA 4IEXA 3FXQA 4EMSA 3M7GA 4GO1A 4LB6B 3QAHA 4EJTA 1J3QA 2OZ6A 4I02A 2CG4A 1WGPA 1TQPA 5BPIA 1SFUA 4GULA 5KHIA 1MD0A 4G7HF 2B5HA 4BYYA 3FHIB 2IA0A 3RYRA 4DNCA 3ISPA 3RYPA 1OYWA 3J7AO 6PAXA 4HLYA 4E2SA 1R22A 4MGIE 2XL7A 1QBJA 2EVXA 3P9KA 1U2WA 5E20A 4M74A 4P9GA 4HW0A 3KP7A 5ICGA 5J6XA 2RC4A 3OD0A 5KHHA 2HEOA 1RZ4A 2A07F 4UXAA 4ZU5A 5KVRA 1I5ZA 3F6VA 2HYFA 4UUVA 4ZU4A 3CTAA 3LFKA 5CYVA 5K5RA 2Y48A 1IN6A 1WI9A 2DU9A 4X6RB 1ZZ6A 2B8MA 3F23A 1LDJA 2QWWA 5E16A 2VBWA 3HQXA 1WA4A 4CZZA 4IERA 3GX4X 1YWKA 1NXMA 5ICFA 4PCQA 2Z2SB 3E6CC 2PBIA 4Y15A 5D5WB 3LA2A 4BNCA 1O7LA 3J80K 3E5XA 5ILVA 3E6BA 1FBQA 2CYYA 3CUQC 4L9TA 4XFHA 2DPUA 2ATFA 2MLGA 1GHCA 5LGNA 1YIOA 2KIMA 1E2XA 4Q47A 4HQMA 1MJAA 2QUFA 2D40A 5DD8A 5HLIA 3JAMZ 4KA4A 1HKQA 3H9AA 3MAJA 2IT0A 1LKNA 5D4RA 3HSRA 1YUDA 3CF6E 3WG9A 1NYWA 1R1TA 1SD6A 3ML6A 3RPUA 1F4KA 1LDKB 3DFGA 2MA3A 4J1XA 1EH6A 4KICA 4LMYA 4IETA 3NEUA 3W6JB 3EDPA 3IRRA 3G7DA 5L3GA 4Z2YA 2VODA 1L3JA 1I6XA 5FGMA 4HF2A 4XRFA 2MH9A 1K79A 3O3KA 5FLIA 3H1YA 4UVBA 4Q29A 3V7SA 4M72A 1Q5OA 4EV0A 4NB5A 4EGYA 3GZ6A 4UV9A 2HQRA 2TDXA 3BALA 4KL1A 1QNTA 2C6YA 3I7DA 2P8TA 4MGKE 1Q1HA 3OOPA 2MPFA 5J8CA 1YLLA 3L2HA 5IT9Z 1MDMB 3C18A 4IPAA 5D5VB 1PDNC 4OU0A 4QMAA 1I1GA 2E1NA 2ISYA 3RI4A 3CO6C 4K8FA 1J2XA 2JT1A 1G3SA 1H9GA 2K7LA 3RIRA 2FEZA 4CDGA 3GXOA 1BN5A 3KMHA 2COMA 3FFQA 4RGUA 3H7JA 2A6HF 1DPRA 3MCZA 1USTA 1XCVA 3R0AA 1EY2A 1ZVFA 5DCMA 3TO9A 4QLCU 1SD4A 1TTYA 5FLXK 5HDKA 5AVPA 4ONUA 1S8NA 1H9TA 3COAC 4YNIA 3LAGA 3SHFA 2XRNA 1LVAA 2GWRA 2YX4A 5FFZA 1UHMA 3GFIA 2Z9OA 4BH9A 1OYYA 3T1BA 4HX8A 5J7MA 4LG0A 1LEBA 1BI3A 2WTEA 4MNUA 1RL3A 3ECHA 5HVQC 4XSZF 4BHBA 1YFHA 3DXJF 2IA2A 1H0MA 3EJKA 4QXKA 1X82A 4WVZA 3S2WA 2BV6A 3KEOA 5TJJA 1TNTA 3HIFA 3BOQA 3F8BA 2O1QA 1J0RA 3E5UA 4JVAA 3BJOA 3LAJA 3KGZA 3J81K 1ZZ7A 3QRFF 3CJNA 3JSOA 5LHIA 5FDBA 2VBYA 1XGMA 3IBMA 1QQIA 1CF7B 3WTSC 5E8GA 2DT5A 2RV8A 1Z91A 1YW8A 2GIVA 1YO5C 2V1DA 4EJOA 3F8FA 3I5UA 2V6CA 4IEUA 5LHHA 4YIFA 1S7OA 3RKYA 4ENKA 3ZN1A 4G6QA 2D1HA 3CL1A 2ZCWA 3FZVA 2M45A 3KP4A 5F6FA 1PUEE 1IXRC 5HS8A 1UW8A 3WW2A 3V7RA 3QPHA 2A3SA 3BDDA 2F5EA 5D5UB 2OD5A 2WFPA 3VB2A 3WTVC 3ZMVA 3VFZA 3JAMK 3C7JA 3KEQA 5FPXA 2P4WA 3SZPA 2YPRA 4U7DA 2BNMA 4KWLA 1ONVA 2RGVA 4L11A 2PN6A 4RD7A 4N0BA 2XVCA 5ED4A 2XUBA 1WSUA 3WTXC 2OZJA 4QM8A 1EH7A 2ZNYA 3LSTA 5ILSA 4A6EA 3EBRA 5K1YA 4M9XA 1IN8A 5D6FA 3K1NA 4Y17A 1CGPA 3U10A 2FBIA 3ELKA 2CW0F 2ZFWA 2OQGA 1MGTA 1IZ1A 3CO7C 4M9SA 1X8MA 2P5VA 2VC1A 2QDRA 4IEPA 5I8TA 4M71A 3H92A 3ABTA 5HDGA 2EB7A 2XKPA 5A2QZ 4XF3A 1UCRA 4RS8A 4IEYA 2KJBA 3WTWC 2YX7A 4MQVA 3S7EA 2VE9A 4AIKA 1SFXA 2R7DA 4AD9A 1O4TA 1JHFA 4WCGA 5IT9K 3KSCA 5L3BA 3ZQ7A 1J75A 5J48A 1FBUA 2QBYB 5I0UA 2O0YA 3EQEA 3DQVC 2M87A 1OPCA 1KQ8A 2W84A 4XF4A 2LF8A 2CQKA 1OMIA 2GH2A 3QU3A 3R60A 1JHHA 2KRFA 1AWCA 3U1DA 5E8IA 1CF7A 4YFNF 2CWEA 4OIOF 1ZLJA 1JGSA 3C3VA 2PI0A 3UKNA 1OI6A 4OINF 4BIFA 2CAUA 2GZWA 1OYIA 3WTYC 1NZCA 1UB9A 1XSDA 1Y9QA 1BI0A 1VTNC 4IRHA 1CAVB 1XRUA 2ZKZA 3IL2A 2VN2A 4A2UA 1HBXG 4KUMA 4BHPA 3NVCA 4Q4ZF 3J80Z 1RGSA 3U2RA 4J1WA 4ENMA 3BPZA 1W7PA 2PMHA 2IXKA 3ZMDA 1T6SA 2ZXJA 2HKOA 3FZ3A 1NE6A 1EH8A 3OTFA 4IJAA 2Q8KA 2X4HA 4AQ2A 3M1EA 1Y0UA 1ZZ9A 5LRRA 2QVOA 2DK5A 2DQLA 1YYVA 4HQEA 2Q2EA 1XMKA 1BC8C 3BP8A 1CAWB 2MD5A 1GVJA 3TQNA 5EFUA 2ETHA 2FF4A 1KU2A 4GYGA 2GQQA 3G73A 3QU6A 2Y75A 3L00A 4YYOA 5FD6A 3WW4A 2HDCA 1UIKA 3I59A 1R58A 2ACJA 3R4KA 4RB3C 1R23A 2J5OA 1R36A 1OKRA 3FHZA 2CV6A 4CXFA 4UBHA 1SFNA 3EQLF 5BUVA 3R0JA 2UZKA 4ZYDA 2VONA 1D8JA 2I45A 3WTUC 4HLXA 4K2EA 3WW3A 4I0BA 3RYKA 1ON2A 1IRFA 3JTHA 2ESHA 1BC7C 2H94A 4XBFA 1L3LA 1W7PD 3VEPA 2QBYA 3KP3A 3UKTA 3UKVA 2XAHA 2QCSB 4NVPA 3L09A 5ERIA 2FBHA 4EJVA 3EHKA 2C0ZA 3O6BB 2GC1A 3P9IA 4XLPF 4HVRA 2KKOA 1UFMA 4L9JA 3DN7A 1XE8A 4D0PA 2P5LC 1OR7A 2PG4A 2EFQA 3QP6A 4TLFA 2QYOA 4KIBA 3SMHA 3RDIA 1JXSA 5F64A 3L2CA 1HKTA 1CAXA 1ZG1A 2OQRA 2ET7A 3SCHA 2CSOA 4IF4A 3USSA 2N7GA 4XFCA 3FJSA 3H1WA 1Z6RA 4UHTA 3FMRA 4MV2A 2EA7A 3KE2A 5A2QK 3CEWA 5LRSA 3T8TA 5DV5A 5CJ9A 2PQQA 4LGWA 3NSTA 4D7SA 4EJWA 2KXLA 1BJAA 2QNKA 2KJCA 1J3PA 4P55A 5J3UA 1R7JA 2ELHA 4M6YA 5AIPA 4XLNF 1FPQA 5JHUA 1ODDA 4LD5A 3Q5FA 1IUYA 1IN5A 1FT9A 1R1VA 5LBQA 1CAWA 3VHRA 4HLTA 3J81Z 2AXLA 1ZARA 3FMSA 4ENJA 3F72A 3WTTC 3K9TA 4M9ZA 4MHGA 4AQ6A 1U3EM 2IPQX 3HTUA 3WODF 1PMIA 5BV6A 2L4AA 4QGMA 5L3DA 3P7NA 1YW7A 2EA2A 3K69A 4HF0A 3ZMZA 4YFXF 3CLPA 1KU3A 1XE7A 3H1MA 2NYXA 1ZRCA 2D1VA 3OV8A 4HV6A 5DCMB 4F7ZA 3ST7A 2W57A 4FBFA 1XN7A 5D5XB 2PFWA 2DPDA 1DDNA 2FQPA 1QWRA 2VQAA 5LGTA 2VBXA 3ZN0A 3GW2A 2ADUA 4G9YA 5HLHA 1LB2A 2LSOA 4E2QA 3EYIA 4LG0B 1U78A 3PQJA 4WF2A 3TKYA 2VOOA 2MNGA 5EEGA 3O2PE 4OIRF 3ULQB 3WTZA 1O3SA 3GUDA 2VXZA 1A04A 2FRHA 4CO8A 4XFBA 4IXAA 2K86A 3PLQA 3KLOA 3KCCA 2K4JA 4I09A 1YS7A 1FWZA 2IVMA 4G8XA 5DCFA 4WXHA 1ZYRF 4IVNA 3N97A 1ZZBA 2H0VA 3NKTA 1DZTA 1P4WA 1F5TA 3W6KB 4AVCA 2HR3A 1WQ2A 3FWEA 1USSA 1FYMA 3BU7A 4O6JA 1ZAOA 2LNBA 2X0LA 1U6GA 4A12A 3NW4A 4P9FA 4IEVA 1LEAA 4BXUA 4QGLA 1D8KA 4A5MA 2KIUA 4KIGA 4A5NA 2XL9A 4BQAA 2ESNA 3PFIA 3HYIA 4UBGA 1KGSA 4HMZA 4FT8A 1TQMA 2R7FA 4I98B 5I91A 4PIYA 2PMUA 3IIAA 1TNSA 4MUVA 2H6CA 3GZ5A 4Q48A 2FXAA 4YRDA 1T38A 3KFWX 1TLHB 5KK1A 2W24A 4RB2C 5DEQA 4UXNA 4R79A 4QM9A 2PEXA 5K8SA 4KWKA 3IHUA 4LA3A 4ENNA 1L0OC 1U8RA 4L2NA 3KGLA 4KN4X 1REPC 4DINB 1SAXA 3BJ6A 3M8FA 4FAGA 4IEQA 2MH2A 1FSEA 4E70A 2VECA 1RI7A 1LNWA 4QWQA 5CVIA 3M8EA 3B02A 2DCTA 2DLLA 4ZYHA 1J1LA 1MZBA 2FOKA 4UNOA 1WWXA 3E6MA 3ABUA 1J59A 3NJZA 1S6LA 1QZYA 2Z33A 4Y13A 2OZUA 1UHWA 2OPKA 2Q1ZB 1X8EA 1EPZA 5D4SA 2JPBA 4U7BA 1LQ1A 2G9WA 4RAZA 3BY6A 4LK1F 1K78A 2IXJA 2QENA 1Q3EA 2HS5A 1T98A 3F8MA 5JSPA 4ZYGA 2FE3A 3BPXA 1XDUA 2DFIA 3Q9VA 3I53A 4XEZA 4CICA 2EFPA 3MYXA 1NHAA 4Q0VA 3GVAA 4MQ9F 5K5QA 3LA7A 4HBNA 3TNPB 3SQNA 1J9IA 5BS6A 2PHLA 2E7XA 1ZGAA 3BZ6A 3U9GA 1TQIA 1QO0D 4WK8F 1P92A 2BEOA 3F8NA 4YARA 1NE4A 2Z99A 4GCVA 5JCTA 4ZZLA 3I64A 1D3YA 1IPKA 5KHJA 4PGHA 4ZZDA 3F22A 3DP7A 3MQ0A 4JV4A 1FOKA 4KMUX 3S7IA 4EROA 4LLLA 1S29A 1YW9A 4KFCA 4ZH4F 4A0YA 1FSHA 1ZNPA 1ZLKA 1R1UA 4AVAA 3RZZA 4META 5LGUA 4O9GA 4F8AA 2M30A 5I0SA 2GA1A 2HTJA 4FAHA 1W7PB 4IEWA 2GAUA 3TOBA 4IRGA 3PQKA 2EWNA 3D5LA 4ZYEA 1TW2A 5JR3A 3QOPA 3E6DA 1DPUA 4HYEA 1EV7A 2FNPA 1RC6A 1TQ5A 4Q0UA 1X3UA 4LK0F 3BPVA 2GA2A 4FX0A 2IXHA 1GXQA 4FHTA 4ASNA 2PAMA 4ESBA 3ES4A 5LEKA 4EJUA 1SEFA 1XCBA 3DPLC 1DZRA 2P5KA 4H7LA 1UPIA 2D2WA 2XV4S 2DI3A 4OOIA 5E18F 3I59B 1ZRFA 2HOEA 3IDCB 2Z3YA 4OIQF 3PVBB 1KU9A 3GFMA 1BM9A 5H20A 3M70A 1OD5A 5CADA 2H09A 1EYBA 2A69F 3JW4A 2PAEA 2FA5A 2FBKA 4U88A 1XGSA 2IXLA 4HA8A 5DUIA 2E1CA 2K9ZA 1G4DA 1SMYF 4PZJA 2EV0A 1GQGA 1D5VA 2EK5A 5HS9A 3VODA 4KMFA 3HSFA 1K6OA 1RNLA 2EFNA 3HT2A 2O6GE 3C3WA 2KIFA 1F1ZA 3GEZA 3WGGA 4S04A 1F9NA 3F6OA 1ZZ8A 1YFWA 2V79A 2M8EA 5HLGA 5FCCA 2RN7A 3D0JA 2VT2A 5KHKA 3ECOA 3Q9SA 2BYVE 4Z82A 5I8SA 4A0ZA 3CJXA 4MEYF 3HUGA 3H3UA 2OBPA 3LQRA 3ES1A 3D0SA 2XROA 2L3DA 3H3ZA 3DL3A 2FU4A 1CAXB 5FO5A 2BBYA 5CVVA 1YHFA 1J58A 3L7WA 4NHJA 3T5XA 2QQ9A 4EWDA 2HKXA 4EGZA 1I1SA 2P6SA 2MC3A 1G3YA 4HN1A 2WWYA 1IN4A 2MLKA 1XSVA 4CYDA 5C6CA 3SXYA 1IXSB 1IPJA 3EUHA 1STZA 2H27A 4XFAA 5ICCA 1U5TA 4GXOA 2WC2A 1JE8A 3H7YA 3ROUA 2F5DA 3PNAA 2CFXA 3QACA 4KIFA 2PQ8A 2JSCA 1ZG3A 2IXCA 4PIZA 5BY5A 3BROA 2IRFG 3S0MA 2RDPA 1KQ0A 1T0FA 1MJ9A 4OFGA 1KQ9A 5JR7B 4A0XA 2QQBA 2O61A 2DO7A 4HSLA 1FC3A 5KBFA 2YU3A 2VOPA 3K2ZA 1Z05A 2UY9A 1LJ9A 4JTNA 2VT3A 3HRMA 3OGJA 3HT1A 1K7AA 5FLJA 1U12A 4IEOA 1O3RA 3M3IA 4HOBA 3LOIA 1J7KA 2UYBA 2A6EF 4IRIA 4IHTA 1O3QA 1ON1A 2HGCA 2UYAA 4YFKF 2AS5F 1LDDA 5ILUA 4U0WA 1UCXA 4LJZF 3I4PA 5E1WA 2JRTA 2XHKA 4HN0A 1HSJA 2V1UA 4FX4A 4EM1A 2HQNA 5FQ0B 2NNYA 2EJRA 2K4BA 2YR2A 3KP6A 4Q0QA 5JSOA 1J5YA 3P9CA 4S05A 2A68F 2EA4A 3GFLA 3LWCA 1B1BA 4UVCA 2DQRA 3CUQA 4B09A 3RTRA 3RKXA 1IN7A 2V09A 3E3VA 4XF9A 2F4PA 4N9HA 2UY8A 1BI1A 1FY7A 3FE5A 1P2FA 4RGRA 5FLHA 3GWZA 4PJYA 4H0EA 2E9QA 1WKMA 1MKMA 2MHFA 3GFJA 3GYHX 1WRJA 2OU2A 1KYWA 2VBZA 5JFRA 4LULA 4EWEA 1S7AA 2EAAA 5EEHA 2F2EA 3IWZA 4UV8A 1BI2A 4EM0B 2DAOA 1WLTA 1BIAA 1UIJA 5I8YA 4Q5SF 3HOSA 2NS0A 5I93A 1H1IA 2DBBA 3GO5A 4HDVA 2W85A 1LR5A 3HTSB 4AIHA 4LTAA 4KWJA 4I2OA 4I7HA 5AIQA 2P7VB 2PYTA 2QJVA 2IC1A 1R5HA 1ZGJA 2P7CB 3O14A 1Z6TA 5BQTA 4R1HA 1XDSA 1ZN2A 3I0TA 1FI2A 4HSJA 3LZZA 3WGIA 1OFNA 2JTVA 5L3CA 4JK1X 2XLGA 1ZX5A 4WBBA 5BMZA 1IXCA 1DGRA 4R8HA 3U0ZA 5J8FA 4G7OF 3IDBB 1K78B 1Z7UA 2FSWA 4RB1A 2QM3A 1LRHA 1Q43A 1YQAA 2XAFA 3FX3A 5EZWA 4M6XA 2BE5F 2FMLA 3TDUC 3IRQA 3TNQA 3FF5A 1DUXC 1V4RA 5FQ0A 3ZMUA 1MJBA 1HXDA 3SZTA 4HVOA 3HHHA 5ICEA 2XGXA 2XIGA 4KDPA 1XB4A 4DQ2A 2P6TA 1ZHFA 5F1RA 2UWMA 4AWXB 3QP5A 2QVSB 3NQOA 4RAYA 4MGYE 2XLAA 3FXUA 2M1BA 2RNJA 4HZFA 2EFWA 1FLIA 2NRAC 4O3MA 5LLQA 3JZVA 4Q0SA 4P96A 3TO6A 3CO2A 2Q4SA 4I0AA 2Y0MA 3JSPA 1QXJA 4OMYA 2IXIA 4N9IA 4Z07A 3F8CA 2HFHA 2O8QA 1YLFA 3MWMA 3SCFA 5CVRA 5BPDA 4HX7A 4M73A 3TGNA 4BHCA 2NAZA 4L18B 2PLYA 4U0VA 5E17F 4G7ZF 3LAPA 1HW5A 1UD1A 3V8LA 1RUOA 5I0TA 3HRTA 3MPBA 3NL1A 4ESJA 1FXZA 2A5YB 3LWFA 3WGHA 2FNAA 1YS6A 3IKVA 2D5HA 2CO5A 2CGPA 3MFKA 3K1MA 3I71A 4G6DA 2ETEA 2V1XA 1HW2A 5DD4A 2ISZA 3MZYA 3MZHA 4EWAA 2FQ3A 3SCGA 2XAGA 2L4MA 4YIIA 3E5QA 4XFIA 3KZYA 4CGZA 3KZZA 4JQFA 4OLLA 3ZPLA 5KHGA 2XKOA 3R61A 2HJIA 3DPTA 2RVCA 1O57A 1AOYA 3T8RA 3D82A 2IW5A 1FNNA 3GYDA 2GU9A 3EO6A 3H50A 3U11A 3RPQA 1HSTA 3KLNA 3K0LA 3DV8A 2PJPA 1HKSA 4GGGA 5LHGA 1B6AA 1FP1D
chains in the Genus database with same CATH superfamily
5JZGB 5IPAA 4R52A 5JWPA 2JE8A 1V55H 1DGWA 3ZXJA 1R1A1 1YIJI 4C91A 1W6PB 1IQDC 2VU9A 1E3PA 4RGAA 1SD5A 3ZXGA 1JZ3A 1TT5B 4B48A 4HNTA 5CU1A 4AUXA 4HEA2 2GMEA 1HB1A 5FMCA 3DCFA 4E7ZA 4CEYB 4ZPIA 4AVZA 3BN6A 2H6BA 2ZGNA 4NRMA 4LO5B 1XYNA 5JXIA 2ZKLA 3BCWA 1PM7A 3ZMTA 2EIGA 2HWVA 3I4IA 3LQQA 2FBEA 3AZVA 2I2SA 2VC0A 2QQWA 3ZSJA 3HRUA 2IS2A 1C57A 2VC9A 2ZGTA 5IHRA 3EPZA 4LLNA 1WBLA 4LOTA 2Q30A 4A3KJ 1VI0A 1VJ2A 4MEXF 1LEMA 2WFF2 1VQMI 3GCXA 2HPIA 3TOAA 1P7IA 1Y1VJ 2JRMA 1DP7P 4IKFA 3N4MA 1RUJ2 4S2DA 3H3LA 4Q4V3 3NV2A 4K20A 5D1IA 4J25A 2QDNA 3ZQLA 2W9XA 2CV2A 1SMTA 1C8NA 1VQNI 1S2KA 4Z6YA 4XF0A 3N9NA 4JBAA 2LKSA 1MR5A 5A1FA 4MH0E 4YG2F 4BQ5A 3RWKX 4Y1ZA 4BQ3A 4UFIA 3ZN6A 4KN7X 2XJRA 1JYCA 4C8DA 4OI2A 5BPXA 3V4GA 1AJKA 1Z7S3 4AG4A 4BJTA 4TV7A 2Z5UA 2ILMA 3J8F3 2A6VA 4BAYA 1Y0NA 1FYLA 3OPTA 3B9IA 3D5OA 2R063 2B4KA 1F35A 4BCUA 2GOMA 2XAQA 1YRNA 2QQIA 3PMSA 4L9VA 1SFPA 2WO2A 3VOEA 2XBO1 4FSJA 3A0KA 2NNNA 4WM7B 2DW4A 2PAKA 3NWSA 3BTLA 2WO1A 4Y26A 4MZUA 3FXRA 3T08A 1OT5A 4Y1YA 5LEJA 3IKTA 2LD5A 3G71I 2K46A 1OUSA 3P5JA 2FD5A 1W6PA 1O5LA 4A3EJ 3Q8BA 1SFEA 1MSFC 2A70A 3IUOA 2KHMA 4XXPA 4EJRA 2GXAA 2VMEA 4F93B 4Q4V2 4AGRA 3J7LA 2LRDA 1UWWA 2OAZA 4P08A 4BLJA 5TISC 2F17A 5LCWL 2PHTA 4XN0A 1W5TA 5H6RA 4ESFA 4G3YC 5L9BA 3MZ8A 3LMMA 4HV5A 1JUPA 1JODA 3CUQB 2ZA9A 1Z7S2 2LF7A 2XJUA 3AFGA 2OXBA 2JK3A 1GXPA 4AHZA 4CDXB 4DMIA 1M06G 4CCJA 3J8F2 4QQPA 1MS3A 1VP6A 4GYIA 3T0YA 1VQ6I 2HEYF 1FYKA 1LEDA 1WLDA 4XKVA 2ZMNA 4I76A 4AFMA 3K46A 1G3WA 5T5LA 1VQLI 2FZ1A 1JYIA 4UYBA 1C4RA 1IG3A 2ERFA 4LUKA 3QPTA 2W25A 3BPSA 4AVVA 3WU1B 1VQ7I 5KC5A 3OIPA 1ENXA 1OUXA 3WDYA 4L0ZB 5GAHJ 1J3RA 1VALA 2J1EA 2ZBKA 1T39A 1YFXA 1LJ7A 4XL9A 4FASD 3AAFA 2VJ5A 4UUSB 2ZNZA 1RUE1 4RGSA 1JUHA 3O1RA 2R7XA 5D8LB 4PDKA 1AKHB 3R4SA 5FZ7A 3ERED 1HB2A 4XFGA 2JD9A 3BODA 1KGYA 1BIBA 5J37A 5D6EA 3WP4A 2EIJH 4WM7A 5DMYA 1XQNA 3DWLE 3F3XA 2B9UA 2ORXA 2PFBA 1YTYA 2HDWA 4X6QB 4HOOA 3IIIA 3ZDSA 2Y2ZA 2IJLA 2ZJRF 1ZBA1 1BLZA 1XSXA 1H0BA 4LA2A 2HXIA 2PHWA 2JA2A 2RS33 5EZHA 2PHDA 2L02A 3VDAA 3C1DA 4IV3C 2MBFA 2NS7A 1QJZA 5DYMA 2DBIA 5BXXA 1U8BA 3MIBA 5F08A 5LK7B 3LA3A 2ADEA 2WBMA 4ZC3A 2AENA 2R7OA 2NVXJ 1D7PM 1ZBE3 3L9FA 2Q0OA 4G94A 4P9UA 3LDBA 1BYHA 2OA2A 3W58A 3RKQA 1G9DA 4L5JA 2VJXA 1H2LA 2EINH 3PTYA 4CDXA 1U5TC 4FE4A 3A4CA 4NNJA 2STTA 3ITQA 1XD7A 2O3FA 2O7OA 2ZSIB 1G3TA 2EV5A 2Z69A 3BJAA 1W2NA 3CJQB 1APNA 4AVBA 3I2IA 2ZMEC 2DUOA 1POV0 3EYYA 2QQJA 4A7YA 4KBBA 4URTA 3SLIA 4EMSA 5EP9A 5LBCA 5K9YA 4XJUA 4GH4C 2OZ6A 4I02A 2CG4A 1WGPA 2P4EA 2WZPP 1SFUA 5KHIA 2B5HA 4H7MA 1FOWA 2IA0A 1HN1A 2RS32 3JRFA 3RQ0A 4IE0A 3OMYA 1R22A 4UUSA 2BW3A 2KM2A 5E20A 1F43A 2XPVA 4V19K 1AKHA 4B7KA 4HW0A 1VQ8I 5F5QA 1GLHA 5A6XA 5KHHA 5HCAA 2HEOA 4PLNA 2VUCA 3CIHA 3WQ1A 1ZBE2 3DLLF 5JVVA 4ES9A 2YY1A 2LTPA 1XTAA 1VBE1 1CPMA 2HPMA 2B8MA 2EXIA 3V0AB 4NPLA 5AC93 5FZHA 3GX4X 1ACIA 2R7TA 1BJZA 3D5SC 4XZPA 1F15A 1LPQA 3VN4A 3E6CC 3RJRA 2D6MA 1WA6X 2AC1A 4Y15A 4BNCA 3E5XA 5ILVA 5J09A 2WA3A 4L9TA 2CQQA 1POV1 5LGNA 2X85A 4Q47A 4AEDA 2D40A 5DD8A 1HKQA 5F37A 2WQ8A 3HPNA 3TEDA 2R5YB 2IT0A 1HXS1 4OMCA 5F3CA 1L7LA 4NAOA 4UW5A 3RPUA 1LTEA 1F4KA 3H8XA 1EH6A 4KICA 4LMYA 2CSGA 4NBQA 4XLEA 4TTGA 2VODA 2DA4A 3H1YA 3V7SA 4M72A 1IC8A 1Q5OA 3AG4H 4XN3A 3BALA 4KL1A 5DZEA 1QNTA 3JRAA 4D6SA 3CLQA 3I7DA 2QEXI 2QKLB 3MLLA 1WH5A 3Q8CA 1QXPA 1VBA3 5AC92 2AUYA 4MGKE 3N7JA 2MPFA 3THTA 1JZ6A 3H1CA 4YZ5A 3L2HA 5IT9Z 3C18A 2W92A 4IPAA 5D5VB 1ULPA 4HSTA 3LIHA 2ZSHB 4QMAA 1GICA 2NN8A 3CO6C 1WZ2A 3LEIA 5JI7A 4AI9A 1G3SA 2XPWA 1H9GA 3AP5A 4ZTJA 1BKZA 4LHKA 3KMHA 4RGUA 5C4XJ 4Y1VA 3ZFEC 1USTA 3GDBA 1UY2A 5DCMA 3OYHA 4XLAA 1TT0A 1WW4A 1JT0A 5CA6A 1Y9MA 4QLCU 3V0AA 2DUPA 2GNTA 1SD4A 1TTYA 2RJKA 5HDKA 3AG1H 3OGRA 1MZ5A 5FY8A 3LAGA 3SHFA 2XRNA 4QB6A 4P5HA 3SYTA 2EALA 2QQUA 1LU1A 1UOGA 2G4IA 4OQ9A 2R0FA 2ZEYA 1UX7A 5DZFA 5L36A 1RUF1 1RL3A 3DU5A 3ECHA 1C5HA 3MIHA 1YFHA 4JQRA 3EJKA 4FFGA 2R5YA 4A7ZA 2HXOA 2B45X 2FX0A 4UFMA 3BOQA 3F8BA 3E5UA 1NH3A 2PMZA 1WJCA 5DS9A 3LAJA 3JSOA 3OG2A 2IS4A 4AI0A 1B35A 1XGMA 1WW6A 2E26A 1G9FA 3POGA 1MVQA 3M8LA 2ZPXA 2PHUA 4YM1A 4YGCA 3KYCB 1WD3A 1ETVA 4YZ4A 2V6CA 3KCXA 4EN0A 1GKBA 1AF9A 4ENKA 2D1HA 2PXJA 3SKJE 1X3ZB 3FZVA 2WS91 1OOPB 1PUEE 2X5IA 1IXRC 5HS8A 3GALA 5IW0A 4IE4A 3FHAA 3CNAA 3UNPA 2IBDA 1MBKA 2WFPA 2P5BA 3VB2A 3RZDJ 2XHNA 3JAMK 3KEQA 3QODA 3MIFA 2P4WA 2YPRA 4U7DA 4KWLA 4C3IJ 2WNVC 3OD4A 2ZAAA 2XUBA 1MMSA 1AR91 4QKFA 4QM8A 4UB6C 4A6EA 1ZA7A 1PGW2 1PMHX 3OUIA 5A70A 3K6GA 5D6FA 1S0JA 2RM21 3FISA 3U10A 4IDZA 3FKIJ 1OHFA 1W0PA 2ZFWA 3OYNA 3QH7A 1IZ1A 3CO7C 3QPSA 3VSLA 3NWKA 5FZ0A 3I56I 3PU3A 4JCKA 2XB0X 5GZDA 5IOZA 2J1RA 3ABTA 4JHZA 3CZJA 5FXVA 1HRV3 3VD9A 5FP9A 1ETKA 1UCRA 3WTWC 5DUXA 5CG9A 1GDTA 4AD9A 1GMMA 1TWFJ 2PMZN 3HBLA 2AXTC 3KSCA 4CP9B 2RHPA 4QHBA 1QJY3 2WA0A 4OQ8A 3I97A 5I0UA 3EQEA 2R4GA 2M87A 2VR4A 1KQ8A 4KMQA 2BUKA 2W84A 4XF4A 2CQKA 4URAA 3O12A 2GH2A 5IK8A 3I3BA 2EQRA 2JJ7A 4DBQA 4Y5TA 3LSHA 4IQJA 4AFDA 4GXLA 4F55A 3A0BC 1JGSA 3HOYJ 2D6KA 4IE5A 4AM3A 4AI8A 2FCTA 4OINF 5A32A 2ZGKA 2R071 3HBZA 1VTNC 3FK6A 3H9JA 3RS6A 2VN2A 3IP4B 2DJNA 1OOPA 3AYEA 5K7ZA 1D0GA 1UZZA 2VKDA 3VL8A 4J1WA 4N53B 2ZGLA 4ENMA 1N75A 4NIIA 3ZSMA 1D1AA 1NE6A 3GHNA 3OTFA 4XAAA 1UHSA 2Q8KA 2D3SA 2VOWA 2NVYJ 4NPRA 4F83A 3H8RA 2TEPA 3HOVJ 4FP2A 4TXWA 1QJY2 3WHBA 4D1QA 1MMAA 4XM3A 3RSNA 2VW2A 4NHLA 1KU2A 4K8RB 3L00A 5JLXA 2HDCA 1UIKA 4BMBA 3I59A 5GZFA 3VZMA 4NMIA 1PVXA 1R23A 4KI5M 3MLKA 2BY3A 4LK7A 3SEQA 1CIYA 2A5ZA 4ZXEA 1LFBA 1SFNA 1AYM1 3U75A 1TME3 1ND3C 4ZYDA 4XONA 4RL7A 1X1AA 4I0BA 1ON2A 2H8RA 2QQPA 4CP9A 4UB8C 5J47A 1UZ0A 4XBFA 2UWAA 3UKTA 4EN8B 2QSGX 2ZOEB 1BEV3 2QCSB 2YBPA 1H8VA 1PK6A 2FBHA 4EJVA 3EHKA 3EXUA 3OSFA 1S9HA 4DNYA 3O6BB 2VKHA 3PUBA 2KKOA 4V2WA 5F0FA 2GALA 1RVF1 2XVLA 2KQRA 1V6NA 1YQCA 1OR7A 4BE3A 4F52A 2PG4A 1DYKA 2QYOA 3D6EA 4L9BA 3SMHA 1LOAA 4ZDPA 1JXSA 1N3OA 1O91A 1CAXA 3ACGA 2ET7A 5FYYA 4ZJZA 3TYJA 3RZKA 1K5MC 4MADA 2BY0A 3USSA 5DUVA 3FJSA 4DQAA 4N53A 1Z0HA 3K4LA 5A2QK 1IS3A 3CEWA 5B2GB 5C5TA 3T8TA 4ASKA 1TME2 2RE9A 5J40A 2QNKA 3UYJA 1PIV1 2ELHA 5AIPA 1WJDA 2BQPA 4D5FA 5F5IA 3DEMA 2YMZA 5FZEA 4FXKB 3Q5FA 1IN5A 1FT9A 3S3MA 3VHRA 3J81Z 3FMSA 3F72A 1BEV2 4R9CA 2VULA 2QGUA 4AQ6A 4EQVA 2EPFA 3WD5A 1GOHA 2M0MA 5L3DA 3LPFA 1AR63 3K69A 3S17J 5FWJA 3A03A 3ZMZA 4YFXF 1GFF2 1HDPA 1W2OA 5KHDA 2E71A 4JYKA 2IFRA 5D5XB 2PFWA 2VLAA 1D2QA 2DPDA 3E1SA 4QPYA 1VAMA 3OOUA 3B9CA 4CXYA 2I8DA 3RQIA 4CDWB 1LOFA 4INDA 3U14A 1AHDP 2LR8A 1BW6A 1COV1 2ADUA 3CMGA 4G9YA 2HWB3 2LSOA 4CA9A 5CZKA 1IGOA 3QBQA 4OIRF 2XB6C 3WTZA 4XK4A 3GUDA 1OURA 3ACFA 2GSYA 2RJLA 2RAEA 4CO8A 5BNPB 1RJ8A 3CF5F 3KLOA 4PLMA 2R7WA 1IS6A 2DBNA 3WNMA 2LC2A 4IVNA 2JDUA 3GTMJ 1DZTA 5A3UA 1YX5A 1YXWA 2ZTNA 4BOWA 4BK5A 5L73A 2LNBA 1AR62 3DBRB 1LEAA 4FTSA 5CQGA 3CDLA 4A6SA 3TOJA 4JDOA 5FZDA 1D5YA 4COYA 4IOAF 1QA6A 1FOD1 4HMZA 4FT8A 2R7FA 4I98B 2JA7J 2Y34A 5I91A 3ZKYA 1TNSA 4MUVA 3GZ5A 1HQLA 2X6XA 3PJQA 1OJLA 1MQTB 2FXAA 2XUEA 4YRDA 1VFCA 4CDQC 4RB2C 1GWLA 3T2TA 5L7OB 4R79A 4UW3A 5IVCA 2VMIA 1RR7A 4QM9A 3KWVA 2PEXA 1EAH1 2X10A 2VI6A 4L2NA 3KGLA 5IP9J 1SAXA 2ELKA 3M8FA 5C8CB 4IEQA 2FCVA 4E70A 1FSEA 1U5IA 1RI7A 2YBSA 3M8EA 3GTQJ 2DCTA 2HWE3 3M1CA 3E6MA 3ASOH 1S6LA 4CDWA 1JUIA 1OLRA 3BR6A 5CNAA 4Y13A 2ZACA 2HWC1 1UHWA 3VDDB 2Q1ZB 1X8EA 2P34A 4F92B 4XDOA 2YU1A 2JPBA 2R49A 1W99A 4MSVA 5GLTA 1Q8SA 3OS2A 1OQ1A 3IAS2 4LO7A 3RSJA 5TSWA 4MXWA 5JSPA 2HQAA 4ZYGA 1BZWA 1CJPA 2GMPA 3Q9VA 1HJFA 1X1BA 1JZ4A 4XEZA 3BG5A 1NHAA 3G6JB 3ZO0B 1LCLA 1V6OA 4HBNA 3SQNA 2DU0A 2E7XA 4W97A 4WK8F 3FMGA 2YU2A 2ZB9A 3WNXA 2B9VA 1QJEA 4GCVA 3THCA 3I64A 4P9IA 1IPKA 5KHJA 4PGHA 3DPUA 3WHTA 4PLOA 4LLLA 1YW9A 1YCIA 4ZH4F 3K70D 3WHCA 4FOYA 4JKKA 4Q4Y1 1BBT1 2FDFA 2AH2A 3MICA 3RZZA 3IPVB 2KA3A 5LGUA 4O9GA 1MS4A 2M30A 4RQPB 1CESA 4IEWA 1K12A 2E2IJ 5KXCA 3ZRGA 5L7OA 1F9KA 5C33A 2LS6A 3E6DA 3HL2A 3RRDA 1DPUA 1FV2A 1QZEA 1TQ5A 1UO9A 1X3UA 4XYXA 4LK0F 2GA2A 1KDKA 1WVRA 4ASNA 5B4NA 5C8CA 3S3OA 4EJUA 4D7NA 2NVQJ 1SEFA 1UXZA 2VUJA 4M4RA 2A3XA 5J4YA 4A93J 1SFKA 5BNNB 2R043 5FY7A 2XV4S 4OOIA 4P9LA 3M70A 1SLBA 5T54A 3VDDA 5EHDA 3OYWA 2H09A 5DM6F 4GWJA 2AREA 1YIFA 2ZZQA 5F6KA 1XGSA 3JD73 4HA8A 1WUVA 2W95A 2DTWA 3ABLH 2EV0A 2X8KA 1D5VA 1UMIA 2ZX3A 1TZOA 2ZHNA 4PCRA 3VODA 4KMFA 3H0OA 4Q4X3 2O6GE 4YW7A 2P3JA 2HYXA 2UU8A 1F8VA 2XH6A 4S04A 2HZDA 1F9NA 3F6OA 1BMV2 1RMU3 1UU4A 1YFWA 1XE0A 2VQCA 3RZOJ 2RN7A 3D0JA 3J7HA 2L5QA 1WLCA 4H2AA 3PSFA 5KHKA 3Q9SA 5EYXA 2VD7A 3CJXA 1MBHA 3VHPA 2OBPA 1S4CA 3RCOA 2L3DA 3H3ZA 3DL3A 1WMXA 3IDEA 4M4PA 1S0CA 2R042 4YVWB 3OY8B 4XOTA 3W6VA 4QHOA 3IPVA 4DRVA 3U07A 2QFEA 4IZZA 2VMGA 4C9YA 4UAPA 1MSEC 2ZMKA 4LG3A 2MLKA 2VB6A 1Z67A 2B7EA 1BXHA 1IPJA 3KS7A 1STZA 5ANQA 1HLVA 1U5TA 5FPLA 3UETA 2X05A 3IB3A 3H7YA 4X8PA 3ROUA 2CFXA 4Q4X2 1ZG3A 3K2OA 5A3NA 2XBO3 3C7GA 1BR1A 4QIWN 1BR2A 5JXHA 1ODMA 1Q8QA 1G9BA 3TBIA 3M3EA 1RMU2 4OFGA 1KQ9A 3VBHA 1Y6IA 1APLC 2XMLA 4P5YA 3BTZA 3C7FA 2L0KA 5FYVA 3UKGA 3ZFFC 2K9MA 2VOPA 4D6QA 1Z05A 2ID4A 2VT3A 4CEWA 4E7JA 2Y6JA 1K7AA 3BG7A 2KZGA 1FOXA 1KONA 1U12A 1MZFA 5HNFA 4HOBA 3RZJA 4FETA 3HPGA 2XQRA 1ON1A 2HGCA 3BGAA 2AS5F 1ND2C 1UPSA 3BG6A 1UCXA 3ZYPA 2D43A 3WV6A 3WU2C 1H1AA 5E1WA 1GT0C 3VZLA 2E1MB 2XHKA 1H8TB 3UR3C 1H4HA 2KDZA 4CPBD 2MEV3 3OYEA 4EM1A 4A45A 2R30A 4BQ1A 5FQ0B 2KRCA 3OJBA 2EJRA 5F39A 2UURA 2VM9A 1A6IA 2K4BA 1I3HA 1YQ2A 2YR2A 4XVHA 4QTRA 3P9CA 4S05A 4BS9A 2XBO2 3OBZA 1AR81 3CZ6A 3GFLA 1PZ7A 2D6LX 2M7AA 2BZTA 4UVCA 4C1XA 4YVWA 1NQDA 2WO7A 2ZHLA 3IKWA 2NM1A 2Y69H 3E3VA 4V2GA 3NNGA 1IQAA 1PO23 5EXOA 2L9VA 3HGGA 2E2JJ 4YVSB 1K61A 3ASIA 4DO0A 4RAGA 4QAWA 2MHFA 3GYHX 3K4NA 1WRJA 2OU2A 1U0JA 3BR2A 4ZKTB 2DFEA 2DMQA 1KYWA 5LATA 1GV2A 2KLOA 3BVCA 2WAFA 5EGOB 5EEHA 4XAEA 4W6XA 3RI9A 4AE2A 2OCCH 2DYRH 1OKOA 4EM0B 3KV6A 3WF2A 1PVC3 3M7AA 2BOLA 1LULA 3CMMA 2VKEA 5I8YA 4Q5SF 1US2A 2DBBA 1VRBA 2MEV2 1HRI3 4QPGC 3W3CA 4LTAA 4Y20A 4KWJA 4ASLA 1W9YA 3CJIB 5AIQA 2E31A 2PYTA 2QJVA 3AB0A 3Q3SA 2IC1A 5JDBA 1R5HA 1MZEA 1ZGJA 2QQVA 1OFCX 4BQXA 5BQTA 3CMEI 1Y4WA 3V0BA 5IFPA 4XTPA 1JYTA 3LZZA 4CDUB 3WINE 2Y26A 3O8HA 4XJ9A 4CE8A 1DQ5A 1ZX5A 4WBBA 5BMZA 4Y1UA 3U0ZA 2AGSA 1PO22 3VBFC 1K78B 1T56A 1DFQA 4RB1A 4HK9A 1LRHA 3ZFEA 1CJDA 1P7JA 3D5RC 4M6XA 5EZWA 3TNQA 1UELB 3FF5A 1V4RA 5FKNA 5BNOC 3HG9A 4QX2A 4NC7A 5FQ0A 3SKVA 4YFWA 2QUOA 3LD8A 4GRIA 4JGZB 1HXDA 4G4FA 4A44A 3AMNA 2FMDA 2WFF1 1W36C 1PVC2 5C3RA 2VY0A 1IG7A 2WZEA 1RUJ1 1DCSA 1MNEA 2UWMA 4ET7A 3NQOA 2OIIA 4RAYA 4QKDA 1V5FA 3FXUA 2M1BA 4I0WB 2RNJA 1HRI2 2XWJB 1ZBA2 4O3MA 5LLQA 1JZ7A 1UOFA 4XOPA 4XBNA 3E0JB 3CO2A 5DZGA 2HI3A 2QQMA 4L8QA 1PGL2 3H5AA 2WN2A 3KYLA 4OMYA 2IXIA 1QHHD 4N9IA 1MBJA 2HFHA 4AQSA 4XQ4A 1LOCA 1PHMA 1VBD3 2QQKA 2SBAA 1B72B 5FYMA 3MWMA 5CVRA 5EGOA 3PMEA 4A3IJ 3J7YJ 1DHKB 4M73A 1NQJA 4LOCA 2NAZA 4K1ZA 1HW5A 3V8LA 5FUNA 3A01B 4L99A 4LXLA 2ZFUA 3MEPA 3OYLA 3MPBA 3LWFA 1SFOJ 2V4VA 2FNAA 4XKCA 2CO5A 4N43C 4GALA 2CGPA 3MFKA 3I71A 3CJIA 1RITA 1ZA4A 3AFHA 4DW6A 3MZYA 2VG9A 2G9FA 4Q4V1 3K75B 2ZXHA 3SCGA 2LK2A 1N1YA 4YIIA 3KZYA 4CGZA 1K6YA 4XW3A 3ZPLA 3PJRA 1UMHA 2XKOA 3WF4A 4Q2FA 2HJIA 3DKYA 2CNAA 1C1FA 3T8RA 3D82A 2IW5A 3GBWA 1FATA 5ABJC 1CZSA 5I0DA 1H9PA 1HXS3 3RZLA 2I10A 1CZVA 2VVDA 1NUKA 3K0LA 3DV8A 2PJPA 1Z7S1 1SLCA 5IYBJ 2RVAA 1S0FA 2DFCA 3J8F1 1POQA 2MABA 3ZP5A 2WV0A 2M8GX 4FOVA 1VBD2 4XETA 3OS0A 2JDYA 5FB2A 5FPAA 1T6BX 2B0LA 2R061 4PJMA 4JGZA 1VQ5I 1FZPB 2DF7A 5A3PA 1LFUP 2RQPA 4Y33A 4AHYA 2COBA 2DK8A 1NCRC 3T4VA 1SD7A 4D94A 1QPMA 1O8SA 1MBFA 4NRPA 9ANTA 2XUMA 3CC4I 4LUMA 4FFFA 4IV1B 2VPVA 3BR5A 1FP2A 2EZLA 3CQOA 4V2FA 2Y0OA 3BB6A 5FP4A 5A33B 1JYWA 5IP7J 2A75A 1QXRA 2ADDA 4LJHA 2VH9A 5IT6A 5IVFA 3OGSA 1B72A 5FZCA 1FOYA 2WYFA 4JGYC 5KXEA 1NLQA 1GV9A 3Q0VA 2G0EA 4II2A 1HXS2 2WY7Q 1TBXA 3FBMA 4II3A 4ETSA 1K45A 1MS5A 5C3OA 5FP7A 4CCEA 1IW7F 3HRSA 4QGNA 1YFYA 4ZXKA 1ZTRA 5FFXA 1FX7A 4MGRA 4EN9B 4UFJA 2DOAA 2O8XA 1Z3YA 4IESA 2QKMB 4ON0A 4LLOA 3CKHA 3T2QA 2DCYA 2BV4A 1JN2P 5ERLA 4D7TA 1RUNA 2GC2A 5CFCB 2VCMA 3OYMA 2HBTA 1QKQA 2WL1A 2F4LA 2VBDA 3M3OA 1RUF3 2DXIA 2R1DA 1Y3TA 1GZ9A 2R3SA 2BOIA 3ECQA 5EZGA 2RKHA 2HWD3 2BY1A 4HF1A 3NKGA 4KT5C 3AL0C 5FUPA 2W1WA 1IRXA 4F3QA 3CUOA 3FBIB 3NNFA 2Q8EA 1X7NA 2IP2A 1RESA 2XF7A 3IH2A 3E7LA 3MDPA 5FLVA 3G2BA 4OIPF 4MTDA 1QDOA 1VQ4I 3CDHA 4O9EA 2AR6A 2ZS6B 5F2WA 3S1NJ 5FPZA 2P6CA 2ARBA 4DXTA 1YJWI 3NRVA 2DT6A 2E7WA 1ND3A 4CCMA 2FMYA 2XJTA 3MF6A 4GIQA 2DCEA 3ZDVA 2BWCA 4JKMA 5A3MA 1B9NA 3WDVA 4CCDA 3SHRA 2RS31 1QF3A 5A33A 1AXKA 1QZZA 3OCPA 3VKOA 3FM5A 4AVPA 5JSRA 1JI8A 1S1AA 3WQ0A 5TRDA 1OD3A 1RUF2 4TSVA 5IK5A 1W6QB 1W90A 1LE8B 2OF7A 5F3EA 5H6QA 5K5OA 5E3MA 2JG8B 2F5FA 2PA7A 1E17A 1RPWA 2UXNA 2HVSA 2XXZA 1GOGA 1ZBE1 4AXOA 2HWD2 1AXZA 4IHSA 4CPBA 4IL7A 3DKQA 5DG1A 1TNFA 5K0UB 3PIPF 3S2DJ 1A8MA 4I3PA 3AVSA 1RUD1 1V3FA 4XF1A 1R1ZA 2D93A 1SQ4A 3SITA 3M07A 5FYTA 2TRTA 4M00A 2XF5A 3HQRA 2XJSA 3N9QA 1GZWB 2HZTA 5A7PA 1P6RA 4ORFA 3VBOB 5CFCA 2HOSA 2XAJA 3FM3A 3MGUA 3OF1A 5K7HA 4Y5Z0 5JVGF 1ZM1A 5JI9A 3AM2A 3EETA 3AMQA 1X9PA 5JOXA 4JRLA 5GZEA 4BKXA 3WE3A 1BVVA 3LKJA 4L5IA 3M3YJ 3S6PA 4UW6A 1SBEA 1YEWA 3LGRA 1O59A 4XSXF 4A3MJ 4CEYC 3N36A 4U87A 4K40A 2LH9A 2XSDC 4M3FA 3CCSI 3RNSA 3VZKA 2QQAA 4RGXA 3M4FA 1HW1A 2PTMA 2HOTA 3VLBB 1AHSA 1XGOA 3POIA 3FLRA 2GXGA 4XHXA 1ZK8A 2RR13 3DPRB 5IVEA 4E8DA 3V7CA 3SXWA 2RM22 5LB6A 5AC91 2YHJA 1HLCA 3FMQA 2KISA 2ZJ2A 3TMOA 1P4AA 3SZGA 3F21A 4ITVA 1VRH1 4M3GA 4MTEA 5JLWA 1OVPA 3M3QA 2P2KA 1ZGWA 3WE2A 1W4MA 1YQ6A 3ETQA 5EEAA 5EPAA 5H9SA 3KYDB 4YGEA 2L01A 1LE8A 1CAVA 1OQEA 1JS9A 3VYSB 3CHXA 2JG8A 4A3DJ 1NLSA 3EUAA 4BM8A 3PM1A 2F5CA 4IEXA 3UGGA 1PMJX 1G2HA 3JB4C 2KD7A 1YI2I 4GO1A 1H6XA 4FCYA 3AL6A 4EJTA 5K0UA 1J3QA 2NP0A 2JKBA 2WR9A 4G7HF 3LDKA 3BTCA 2VVFA 5T55A 2K40A 4DNCA 4TYSA 3CMYA 3J7AO 1GZWA 4MGIE 4WM7C 4BZ4A 2RDRA 3VBOA 2R072 2EVXA 1W8NA 1U2WA 3A02A 4YGBA 4A3FJ 2ZJPF 5F6LB 3VBRB 2RC4A 1VBA1 3J7ZI 1I5ZA 5IY5H 3HVDA 3HXLA 2HYFA 4GJZA 3W5NA 3I2FA 4A41A 5DUUA 2WNUA 3LFKA 5CYVA 5K5RA 1LAJA 2ZHMA 5JHFA 1ZZ6A 4BJ6C 1XMXA 3O1TA 2LY2A 4U2AA 4CZZA 4GDFA 2DA5A 5FZLA 4RS5B 3GZAA 3VHNA 2PBIA 2F4OB 3DLAA 5D5WB 2TNFA 1O7LA 4NUBA 2D6PA 4LPLA 2CYYA 1FBQA 3CUQC 4XFHA 3W2WA 3DPRA 3NV1A 1YIOA 2KIMA 3TB0A 4CDXC 3RZHA 1E2XA 2FDGA 3ZGKA 2QUFA 3JAMZ 1AYN1 4LT5A 4NC6A 3CF6E 3LSIA 1XNTA 1NYWA 2VOTA 1SD6A 3ML6A 2JDAA 3KCYA 4B1LA 3ABMH 2WADA 4J1XA 1G86A 3NEUA 3EDPA 1VIWB 5EDNA 4XRMA 1BW5A 3G7DA 3JREA 1WMDA 2BW8A 4M3EA 4Z2YA 5A6QA 5FGMA 1B09A 4HF2A 4XRFA 5FLIA 1LHWA 4CRQA 2E19A 1SBDA 3ZSLA 1WW7A 3HR9A 4EGYA 2LMDA 3GZ6A 1F31A 1QEXA 2HQRA 2TDXA 2CQXA 5TGTA 1BOBA 4IX7A 2ORZA 5DAWA 2P8TA 1G9CA 1GV5A 1UQXA 3OOPA 2VOXA 1MDMB 3PSIA 2ZABA 1PDNC 4UT5A 1F36A 1YYNA 1HJGA 3AL5A 2E1NA 3WF3A 1YE9A 2XR4A 4COVA 3PNTA 1QRYA 2DTYA 3AMMA 1VQ9I 1J2XA 3WF1A 1TEIA 4AEMA 2QE3A 3GHMA 1GWMA 2W2IA 4AI1A 1DPRA 3R0AA 1EY2A 3O5SA 4P14A 3WUDA 2DVDA 5LK5A 2RS13 5FLXK 4RS5A 1H9TA 3COAC 4YNIA 5DDJ3 5FOBB 4XJWA 5T5OA 2YX4A 1WW5A 3GFIA 3FDYA 1OYYA 5J36A 1WZXA 2XGCA 5J7MA 3PFYA 3SH4A 2LY1A 5CFDB 4NIHA 5J1UA 5C71A 4PBOA 4DXRA 2VMHA 4AK3A 4JVAA 3BJOA 5B4XA 3J81K 3QRFF 2J7MA 1R6RA 3D3AA 1HRV1 4MGTA 2DFBA 5T52A 3IBMA 1CF7B 3WTSC 4E6KG 1OBNA 5FBZA 2RV8A 2JEMA 2XJVA 5IVBA 2V1DA 4EJOA 3F8FA 2F5VA 3I5UA 3QYEA 4YW6A 5A3OA 5LHHA 4OHVA 1JKQC 4YIFA 1EAH3 5FZ9A 1X4PA 2RS12 2ARAA 4FCAA 2VL8A 2M45A 3KP4A 2ZGPA 4F3JA 2W82A 1JXNA 3ON7A 4M3BA 3T2PA 4DY5A 3ZQGA 3WW2A 2KMUA 3V7RA 1ASJ3 2A3SA 2YGLA 3WVJA 5D5UB 1WCSA 2OD5A 3DBLB 3BOPA 2XAUA 1NLRA 1CR7A 2RGVA 4RD7A 1QH6A 2XVCA 5ED4A 5FYUA 3D4KA 2VCCA 2ZNYA 5DM7F 1G9AA 1D0XA 3K1NA 4MO3M 2W91A 1CZTA 1CGPA 2IXSA 4AAXA 1WWYA 1EV13 4M3CF 2CW0F 1RXFA 1SMVA 4M9SA 2BVBA 2P5VA 1JOPA 2VASA 4IEPA 3OGVA 1G8XA 5I8TA 5IK7A 4M71A 3H92A 3H5RA 5HDGA 2XKPA 5A2QZ 1QH7A 1YX3A 1EAH2 4IEYA 3ZIXA 2YX7A 4MQVA 2NQYA 1D1CA 2VE9A 5CFDA 1O4TA 1ALYA 1DU0A 1JHFA 4WCGA 1SHWB 3DTIA 3JRDA 3LSMA 2C26A 2KZVA 5J48A 1IKQA 1MS1A 4LBQD 4CH7A 2N8GA 1ASJ2 2O0YA 4NHXA 3MKYB 2GMMA 4JRAA 3R60A 1JHHA 1AWCA 3QH6A 3VKMA 1CF7A 4XLHA 3UV9A 2WO3A 2AHQA 4YFNF 1TME1 3MIGA 1TZLA 4OIOF 1DU6A 2WT2A 3ZYFA 2M4GA 2PI0A 2RS53 3UKNA 2QQNA 4AW7A 4BIFA 2CAUA 1JBCA 5IOYA 1ND2A 5LZ6A 3ZXEA 3N9LA 4KGQA 1UB9A 4BMEA 4FOQA 1XRUA 4IRHA 2FJ1A 4IGQA 1ZYBA 1NKGA 1BEV1 3WF0A 1EV12 4P00B 3GJAA 5ISLA 4PQQA 3IMNA 3N7MA 1RB8G 3TWIA 2RNGA 3U2RA 1QQP1 5HODA 1W7PA 2PMHA 3VBSA 3VZJA 2R32A 5F1JA 3THDA 1T6SA 4WM8B 1LENA 3FZ3A 1A34A 5FZ3A 4MGSA 2BVLA 4IJAA 1GU3A 3DYMA 2VZVA 3ZYJB 4AQ2A 3GTOJ 5LRRA 2HWF3 3JU9A 4NROA 2DQLA 4HQEA 5FZ8A 2Q2EA 1XMKA 1BC8C 2WZ8A 1G7YA 2MG4A 1N78A 3IV5A 2FF4A 4HKWA 5F5AA 3NV4A 1GUIA 1UF2C 5FD6A 4FPJA 3BZKA 5FRMA 3WW4A 2YS9A 3DECA 3MO4A 3AG2H 1R58A 2DJIA 4IE6A 2CWMA 2ACJA 3AVRA 1FNZA 5FBJA 3O1MA 4RB3C 2RS52 2J5OA 3DTKA 3LFIA 4UBHA 5FFOC 2JG9B 3R0JA 2JDNA 5JOZA 3V56A 2ARCA 2VZPA 4QPGA 3WTUC 2CUFA 1AR73 1S0IA 3WW3A 1T33A 1AR61 1VB4A 1BC7C 4Z2AA 2H94A 2DCKA 1HF0A 4QB1A 1XOYA 5ACA3 3UKVA 4RYDA 4QX3A 3ENRA 4NVPA 5F5CA 5CAZA 4GFBA 3N9MA 5L19A 1UYZA 5ERIA 1IUFA 4DYCA 2C0ZA 2X1DA 2GC1A 3P9IA 3PVEA 3LFUA 3G1OA 1OOPC 2YFZA 3ILNA 2HWF2 2PHXA 1XE8A 1XSQA 2HWB1 4TLFA 4JX4A 3SFIA 5F64A 2OQRA 2E60A 3SCHA 2RJ2A 1JU4A 1NG6A 2N7GA 1GR3A 1UX6A 3SNMA 4MV2A 2EA7A 1Z21A 5LRSA 1JZ8A 1CIWA 2DURA 2JD4A 4WM8A 1V9U3 2KXLA 1ULEA 1J3PA 3OPZA 2LOOA 1JUSA 3GZNB 4M6YA 3MFCA 2IGKA 1AR72 4B3XA 4LD5A 1IUYA 4KG0A 4AHXA 5FKKA 4HLTA 1JJ8C 3S2HJ 1J83A 5E6HA 4NHKA 3VDBA 1N3QA 4GWNA 1PMIA 5BV6A 2L4AA 2LBFB 2J1VA 2DUQA 2IEKA 3NO8A 3P7NA 4CCLA 1YW7A 4H55A 4HF0A 2YZ4A 3CLPA 1UY4A 1KU3A 5FZOB 1XE7A 1ZRCA 3OV8A 4F7ZA 1B8IB 3ST7A 3WNOA 3ZLIA 3BG3A 2IAIA 2W57A 4FBFA 1XN7A 2O8OA 4QX0A 1KEXA 5J4VA 2WNVB 4IQ4A 4L92A 1W0TA 3LSGA 2R92J 4QXCA 4XUTA 2LROA 2YPJA 2B9SA 2EH3A 3FXMA 4ZS2A 3ZN0A 1JOJA 3UGFA 1UYYA 4UFLA 1ENHA 3EYIA 4LG0B 3PQJA 4WF2A 2BRTA 2MNGA 3S5QA 5EEGA 5FROA 4W1UA 2Y33A 2R7UA 2CV0A 2HWE1 4B47A 2ZZJA 4D3WA 3JBG1 1V0AA 1V9U2 1SFYA 4RDUA 4L5EA 4IXAA 3C8XA 3PLQA 4I09A 2DFHA 2CRGA 1YS7A 5DCFA 3ACIA 1ZZBA 3DUIA 4N53C 1P4WA 4W8JA 3W6KB 2O5RA 2GP3A 4LLFA 4AVCA 1USSA 3BU7A 5FZKA 2X0LA 4A3CJ 3PVNA 3HKZA 4V2VA 4BXUA 1D8KA 4A5MA 2KL4A 2V5DA 2WSUA 4KIGA 3N9OA 3NAUA 2ESNA 4JHTA 1HOMA 1AZDA 1C5IA 3SH3A 4PIYA 2ELJA 2PMUA 3IIAA 1LOBA 4Q48A 5D8AB 1E5HA 4IHXA 5ANNA 2L9LA 1T38A 2BBVA 5KK1A 4RM2A 2W24A 5DEQA 5LBBA 1EUUA 2DU1A 3ZMOA 4DFSA 2Y9YA 2PLV3 3MUZ1 1K4TA 2KRHA 1XB9A 1NK2P 5LA9A 3T1MA 2FOWA 1ZR4A 2DMTA 1LOFC 2EBIA 1XG1A 4Q4W3 3VKNA 2MH2A 2W39A 5FZOA 2DOEA 4RBOA 3VUOA 1LNWA 1NXD1 5J1YA 3WHUA 3B02A 2VZOA 1J1LA 3MF9A 1MZBA 1TMF3 1YJKA 4UNOA 1WWXA 3NJZA 2H8WA 3MPPG 2YROA 1QDCA 4N4NB 2OPKA 4PFOA 2NYYA 5D4SA 2YXSA 1XXNA 4BK4A 2G9WA 3MVPA 3OBTA 1HDDC 4OI4A 2QTWB 2IXJA 2HS5A 2R041 5F32A 4XJAA 3BPXA 3PL0A 3I53A 2G9GA 4CICA 3MYXA 2D97A 3HKZN 4Q0VA 3GVAA 4EZHA 4MQ9F 3JD71 5K5QA 3LA7A 2PLV2 4JX6A 2FDJA 2W00A 5A7NA 5DAXA 5BS6A 3ZX7A 1RKTA 1ZGAA 1REEA 5F9TA 3WCRA 4Q4W2 4Q4X1 2Z99A 4AC0A 1IG0A 2Z42A 3MQ0A 4JV4A 4EROA 1TMF2 2R16A 1ZQ3P 2JDZA 4X6AJ 3VPRA 1RMU1 1ZNPA 3P3PA 1IS4A 1ZLKA 4YG6A 1R1UA 3JXSA 3LSEA 5HV4A 2LYCA 1WPKA 1RYYA 3S32A 1MBEA 5D8AA 1LHVA 4F8AA 5I0SA 2GA1A 2HTJA 2GAUA 4BIOA 5FZIA 4ZDLA 2FHRA 2VXJA 3D5LA 2VTXA 5JR3A 3GM8A 4IQPA 1DQ2A 1RC6A 4Q0UA 4IGPA 5FRNA 2X1EA 4CDWC 2IXHA 4JP0A 1GXQA 4FHTA 3HBKA 4OHXA 2VJ4A 3AFKA 2CQNA 1PO13 5FY1A 4QQHA 4A3GJ 3KM5A 4JKLA 1UPIA 5EV7A 5FKBA 5E88A 1VF9A 1XC5A 1ZRFA 5F04A 3OYBA 3IDCB 3PVBB 1BM9A 5C3QA 2W7NA 1LVKA 5CADA 3OIOA 5BNPC 4I6ZA 3AZWA 3JW4A 1JKPC 4LBOA 1NCQA 2VZTA 2FA5A 1A5JA 2QQ8A 4HONA 4A7KA 3CD6I 5FJKA 4OUEA 1SMYF 3T4HB 5HS9A 3HSFA 2CU5A 1K6OA 3QQAA 3HT2A 3OIQA 5JZGA 3SEZA 4AI2A 3ZKUA 2O0OA 1JTXA 3OUJA 3GEZA 3WGGA 3AG3H 1ZZ8A 4MVTA 5J1XA 1H6YA 4DBRA 2OUHA 5HLGA 5DTDA 1TP4A 4Z82A 2VXDA 2GOXB 4CEYA 3NNJA 1MQTC 1HDKA 3LSPA 3I2GA 2L7ZA 3O0WA 3LQRA 2CY6A 4DXZA 1PO12 2XROA 5L7OC 1Z7LA 4LIVA 4FPOB 1WJEA 5CVVA 5KXBA 1W3XA 4BXXJ 2MEV1 5CKNA 1K42A 2V1NA 3O7OA 2QQ9A 4EWDA 4MYEA 2HKXA 2E5NA 2R062 1DQ1A 2DTZA 2DCJA 5C8CC 1G3YA 3J7NA 4HN1A 2WWYA 3WSOA 1C8M3 5C6CA 3FUQA 3EUHA 4KBZA 5HV0A 1PX4A 1QVTA 2ID3A 4GXOA 2YC0A 1JE8A 1X1PA 4GQ7A 2F5DA 3G4SI 4NPMA 1DYOA 3LEMA 1QU3A 4BL0B 1WMFA 4PIZA 2OPTA 3VDDC 3OYAA 1Q1VA 3G1LA 2IGMA 1T0FA 1RUG3 2WT0A 2VIXA 1JMUB 4YFZA 1PO21 3PUIA 2OPWA 2Y9ZA 1LESA 3MKZA 3CJTB 5JR7B 3CESA 4CDQB 2AO9A 2DO7A 2XG3A 2P3IA 1UJ8A 2WV1A 4HL0A 5KBFA 2YU3A 5E89A 2NZ9A 3POYA 3K2ZA 3WG1A 1AX1A 3ZQQA 4UY8I 1FIPA 3HT1A 1PVC1 3OSGA 2A6XA 5KNLA 4Y3OA 4OHYA 5FLJA 5C3SA 1EKEA 1SLLA 5FZAA 1O3RA 1JH5A 3AKRA 2ZHKA 2AZ5A 1J7KA 2UYBA 2A6EF 4IRIA 4IHTA 1HRI1 3H9GA 3CCQI 4X1EA 1OQYA 2R1BA 2LUWA 1QJFA 4YFKF 1LDDA 3GTJJ 4CUAA 4HK8A 4XR6A 3O0XA 1W2AX 4LJZF 5SV5A 1C8M2 2WAAA 4Y1XA 5G05L 3I4PA 1ULOA 1PGL1 1RUC3 3CMAI 2FDIA 4Y24A 5B1AH 3ZXAC 1WJAA 1HSJA 2V1UA 4FX4A 3CJRB 2HQNA 1KRIA 2HNHA 3SQOA 2DOFA 4XQWA 3WP5A 4D6RA 3L2VA 4Q0QA 3AMHA 1MS0A 4GJYA 5EYRA 2AEZA 1W5CC 2WA4A 3IN9A 3TBDA 1RUG2 3WG7H 2E33A 2JQ7A 2NXNB 3VDXA 5J1RA 3CUQA 2RV9A 3S3NA 3CCVI 1GOFA 5BYNA 1CQTA 1X3WB 3RTRA 1RUD3 1IN7A 2V09A 5A3WA 2F4PA 3PU8A 1FY7A 3V42A 1P2FA 4RGRA 2VMFA 3W21A 4XLFA 2VPLA 3FKJA 4HXCA 5DXDA 4C2TA 1PZ9A 4BISA 1D1BA 4E7KA 5BNNC 1SPPB 3POJA 2VBZA 5JFRA 3PIJA 4A3ZA 3VBHC 4LULA 2EAAA 2XQXA 4W6WA 2F2EA 3IWZA 4UV8A 2R93J 3HDDA 1UOBA 2M7BA 3ZFGB 1TWCJ 4MOAA 1QOSA 4CEWC 5I93A 3LB9A 1H1IA 4IUGA 3RJ2X 5EYYA 3S1QJ 4HDVA 1RUH3 2W85A 1HC8A 3A21A 4P9JA 1DYPA 3PTRB 3L1PA 1AUYA 4I2OA 1VBB3 1VBD1 2CMPA 2P7VB 2AYHA 1LU2A 2LM3A 4QX1A 2HH9A 2XWBB 3UESA 3ILFA 4O7XA 2JA5J 3TEXA 2M4KA 4QPWA 1FI2A 1ZELA 4HSJA 3WGIA 1OFNA 2JTVA 3FHQA 5L3CA 3K4AA 3T2OA 4JK1X 2XLGA 5FYBA 3K3NA 4PQ9A 3U78A 1W36D 1RUD2 4FTEA 1LUJB 1CD3G 2VNVA 4MFDA 1H2MA 1W3VA 4XLCA 2DVGA 4MG2A 2WLPA 5EJ3A 4G7OF 3IDBB 1VRH3 2FSWA 2KP6A 4CP2A 1Q43A 1YQAA 4B1MA 3PUFA 1E3HA 3PO3J 2FMLA 1DQ6A 1LGNA 1RUI1 3JQXA 1DUXC 4YVWC 1R64A 5A1LA 3ZMUA 1MJBA 4HVOA 3HHHA 4BWOA 2P6TA 3OS1A 2WZR3 2QVSB 3K4DA 3IMMA 4M0NA 2XSJC 3ETPA 4AIDA 2XLAA 2EFWA 1FLIA 1VBB2 2HOAA 1KS4A 4QPIB 4P96A 3GXUA 2WLQA 1X1CA 3QPLA 4NHYA 4I0AA 3NNLA 4DRRA 1Z3XA 4YRVA 4KITB 5AFBA 2LALA 1JZ5A 3F8CA 4TZDA 2JVGA 3T0DA 1UYPA 1F5FA 4CUGA 4HX7A 4UFHA 3TGNA 4RA0A 1V6LA 2F4IA 2YFUA 4BHCA 1MMDA 3OL4A 4GD4A 3O1PA 2EF6A 4L18B 2PLYA 5E17F 4G7ZF 3ZFGA 2NMOA 3LAPA 1UD1A 1RUOA 1VRH2 5I0TA 2WABA 5LA0A 4ESJA 1FXZA 4CVUA 5A1AA 4YM0A 2PN5A 4MGQA 4G6DA 2ZGSA 2ETEA 2V1XA 2ISZA 2JIGA 3MZHA 2AQFA 4EWAA 3KV4A 3MMYB 4FQ4A 2WIIB 3Q9OA 1H8TC 3KZZA 5KHGA 1CONA 3R61A 4FPYA 3RZMA 1LHOA 2BXZA 2L7MP 1AYN3 5C3EJ 4LKSA 3GYDA 3EO6A 3R4UA 5JUVA 1R083 3Q8EA 3ZPOA 3KLNA 5C4WB 1HKSA 4YEJA 4GGGA 3KT4A 1YO8A 5A7SA 1TW3A 2HTSA 5C8WA 2R7RA 1H2KA 2Y6FA 4V1PA 2Q8OA 4ZZ8A 3KP2A 3WDTA 5FZ6A 2E53A 1FPN3 3ELNA 2WWSA 1VBA2 3GBFA 1JHJA 1K83J 1CX1A 4YVSC 4E4HA 2HWD1 4QWNA 4XHBA 2L9SA 3V8JA 1IKPA 2JENA 4HDUA 1S0EA 4C30A 3PDQA 5HDNA 1U5ZA 3ZM8A 4L97A 2V9VA 1HKDA 2IVIB 4KYWA 3R4DB 3K1PA 4A6OA 3WR0A 5GLWA 5FMDA 4D5CA 4A3LJ 4RGKA 2F48A 2ZXQA 1ZREA 2YC4A 4JDNA 2G7UA 5M3FJ 3RJPA 2BHYA 2EIBA 5FYSA 4O5VA 4MGZE 2CV1A 3F2ZA 4I3GA 4LFUA 1AYN2 2P17A 1X2MA 3CJIC 4QT6A 2STWA 2JDMA 2ET1A 2WNOA 1R082 1UZVA 5HI0A 2ZC2A 3K70C 1UXXX 3MW2A 3V64A 5CLSA 4B8XA 1X1DA 3GZUC 3K48A 3HGYA 2GNBA 2D5FA 3I4MJ 5M3MJ 1FPN2 5FYIA 4BEHB 4C0BA 1XMAA 3B93A 2HYGD 4DYQA 3C2HA 1WCMJ 1SANA 3A2KA 2NOJB 2WINB 3CZUA 2D3RA 4W6YA 4ZDOA 2A7AA 1GQHA 3DBHB 1ZRIA 3AKSA 4KNYA 4JGZC 2H1KA 1V5EA 5D8KB 4P5OA 1YG2A 1V6KA 2JKXA 3RQ4A 5C4WA 2BHZA 4AIJA 1A31A 1IDZA 5FY4A 4ZU7A 1OF3A 2IGNA 1P4XA 2M34A 2EXHA 2EAKA 5KR7A 2DTRA 1SC7A 1NG0A 5E3NA 4IW3A 4FPGA 4ANJA 4B44A 3NMBA 3CLOA 4KU7A 4BE0A 1R4MB 4ASMB 3JTGA 3U4XA 2QQLA 3DGTA 3I4NJ 3B69A 3FBNB 4D9JA 1B9MA 1RIOH 4ZYAA 1BBYA 1GP4A 2JX9A 5FO8B 4FXGB 3AP7A 3PJYA 1GP5A 4E2GA 2A61A 1UZCA 3FC0A 3IC7A 2XLFA 1GUUA 1UMQA 1UU5A 2PHRA 1GWKA 2A6TA 4XUOA 4PIXA 3QOEA 1OH4A 1QGPA 4KU8A 2OA4A 2GXBA 1VQPI 1S7EA 5B5EC 2RR11 3ESWB 3P5BA 1PP7U 2J5PA 3O8GA 1J09A 3UK9A 1KYZA 2Q5TA 1PP8F 5FO7B 1OLME 4LBMA 3ME2A 5IVYA 4LLGF 1CAUB 1ETWA 2ZAHA 4WX9A 3LFMA 5L3FA 3W5MA 5FLMJ 3Q8AA 3N9PA 2K02A 5IT3A 1HRV2 5A6YA 3DKWA 4NR1A 2UXXA 2L54A 1QIQA 2M0CA 3G3ZA 4WXCA 4BEHA 2JMWA 1Z1DA 3RVHA 3WP3A 4AEJA 4AL9A 1WJFA 2NS8A 1B4AA 3BCBA 2K27A 2YSRA 1ZRDA 1G8WA 3BIWE 2GC3A 2X51A 1GZCA 3PUHA 1EP0A 3I54A 2WRAA 3GNEA 1ZZCA 2WY8Q 4PK4A 5FD5A 2YV8A 2EFOA 4HETA 3BG9A 4YPJA 1N25A 4QU1A 3CCLI 3B6AA 3N7LA 2VBPA 4J6GA 1XBFA 2NMNA 2E36A 4EM2A 1SZBA 1SBFA 3AKQA 3BLYA 1PYVA 5BOXA 1R9TJ 1KQRA 4IV1C 5C70A 4OHWA 5DDGA 1OCCH 5GZCA 1FJLA 4BBRJ 1YRZA 5I0RA 1ETYA 5ABJB 2Y8KA 3VD4A 1H1MA 4BUPA 1QY4A 2BNNA 1S2EA 1QJU3 4ITCA 1GANA 3DF8A 1Z9CA 1YNAA 1S0GA 4ARXA 3NWTA 3POFA 3FXOA 1NG7A 2G7HA 5CVJA 1QQP3 4BQOA 5EWSA 4HX4A 3BWGA 2QZ3A 1K4SA 3WXPA 4Q1PA 3V65A 4ZY9A 1RTVA 4Q8LA 4CHUA 4AOCA 4WZCA 3L2WA 2ZBJA 4U0YA 5FLXZ 1S2BA 4A6DA 2WAQA 4P02B 3KT7A 1CAUA 2QQOA 3JQWA 4PI0A 4GB33 3FXQA 1KJRA 3O1VA 3CP8A 4YZ3A 4LB6B 3QAHA 4DGWB 1VLNA 1HA8A 5CFCC 2DDBA 1TQPA 2X48A 2YDEA 4BYYA 1HB3A 3FHIB 4M6VA 3ZQFA 3RYRA 3ISPA 5CYYA 3RYPA 1OYWA 3U21A 5C9AB 4HG2A 2W68A 1BQPA 2ZXIA 4XRSA 1OKQA 3LNQA 4FO9A 1QBJA 3POWA 1H8AC 4TWTA 3KP7A 5ICGA 1A78A 4MHRA 3S1RJ 3ZYBA 1Y43B 3OD0A 4E7IA 1W8FA 2FQ4A 3ZVXA 5EJZB 2A07F 4UXAA 1TWHJ 3HOXJ 5KVRA 2J42A 3F6VA 1SVLA 1VMFA 5M5YJ 2E1OA 2DYCA 4UUVA 4ZU4A 4KG8A 1QQP2 1T2XA 4KWUA 5FXXA 1WI9A 2DU9A 4X6RB 2IS1A 1TL8A 2VL4A 2QWWA 5E16A 1ETQA 3VSKA 3TW6A 1X58A 5EJ1B 2XB5A 5JXJA 3GCWA 3SC7X 1H30A 4QKBA 5ICFA 2Z2SB 4PCQA 3A23A 3ABZA 3GF6A 5CKTA 2EIKH 1KITA 3POSA 4GB32 4CU9A 1O4ZA 3NAPB 2EZIA 2ENRA 4N90A 2DPUA 2ATFA 4M0HA 4ZHNA 1GHCA 1H9WA 2YG0A 5FY9A 2VQUA 2W0XA 5F7UA 2F6CA 2HQ5A 4HQMA 1MJAA 3K4CA 1TWAJ 5HLIA 4KA4A 1N1VA 2AQEA 3H9AA 2RS11 2A1XA 3MN2A 5E79C 5D4RA 3I2DA 2JG8C 1YUDA 3E1F1 1LHUA 4YM2A 2CH0A 1R1TA 5DDJ1 3JRCA 4G6TB 1LDKB 4LMFA 2WAQN 5DQ0A 1Z78A 4XQFA 3VGIA 2ECCA 3W6JB 2ZEWA 2C9AA 2A05A 3IRRA 5K0UC 1OVSA 5L3GA 4RMNA 1UOJA 2ZX4A 5FZ1A 1L3JA 1K5JA 3QCWA 2MH9A 3NARA 2W1SA 4UVBA 1NK3P 5GTHC 4EV0A 1JW6A 4NB5A 5EJCA 4PDWB 1KS5A 3ZYRA 2ICWG 2I74A 4UV9A 3B6CA 3WT3A 3ZYHA 1IV8A 3VBOC 4XACA 1JU3A 4B4QA 4ATFA 4Z2WA 5J8CA 3ZN4A 1IS5A 1YLLA 5C9AA 4AVTA 4HKLA 3H8OA 1Q56A 4OU0A 5GLVA 2HWB2 1RHI3 2WNUC 2Z16A 2ISYA 5CB7A 2JT1A 2EILH 4RSUA 4OCTA 1NA1B 3RPUD 2FEZA 3LEKA 3GXOA 2COMA 3H7JA 2A6HF 4BGDA 2WSVA 1ASJ1 1ZVFA 2V4AA 1UMZA 1YRNB 4DEQA 2TCTA 3DPRC 4BDZA 3JBG3 4HRIA 3B7MA 2CQ7A 4BPZA 3BT9A 2A6YA 1LVAA 3H3VK 5GAGJ 1UHMA 3T1BA 3NAPA 1QOTA 4XKBA 5GZGA 1DGWY 5HVQC 4LBKA 4E8CA 2QBXA 4XSZF 4BHBA 4DEVA 3DXJF 4CP1A 2IA2A 1H0MA 4G12A 3FUOA 4QXKA 1X82A 2ZEZA 1EV11 4QDQA 4W4ZA 4WVZA 3S2WA 5BNPA 1LODA 1WKYA 5TJJA 1W0NA 1TNTA 4PJLA 4LE4A 5FY0A 2JN6A 2O1QA 4A4AA 3WDXA 2D6NA 2E7AA 1MBGA 1VQKI 3KGZA 2DA7A 1REDA 1RHI2 5LHIA 2JUCA 1OLMA 2P37A 4BQ2A 1JKOC 2DT5A 1O4XA 1Z91A 4CTEA 4XUNA 1ST8A 4XPVA 1YW8A 2VNGA 1YO5C 4PDWA 3VYUB 3WLUA 2L9RA 4IEUA 4IHYA 3SEEA 1AU7A 4D8MA 3WG3A 1E0EA 1AXYA 1T6GC 2HWE2 4YM3A 3IAM2 4G6QA 2YYOA 3JBG2 2ZCWA 2QSFX 4XUQA 3VBRC 3VZOA 2JSPA 1C28A 1MQTA 3QPHA 1PM4A 2RS51 2F5EA 1JGGA 2XJPA 2BXYA 2VJIA 1H89C 2WQZC 5AVAA 2LVSA 5FREA 2ZGUA 3LE0A 1PNFA 2R0HA 2BNMA 1ONVA 4L11A 2XPUA 1IV6A 4COZA 4N0BA 4K9SA 4Y22B 4RS5C 2E63A 3AKTA 3HPHA 3WTXC 2VO5A 1NA1A 3LSTA 2K3PA 5FOJB 5K1YA 5HCBA 3A22A 4AR2A 3JB8A 1IN8A 3WNLA 4QKNA 1Y9GA 1WCKA 2AEYA 2VOVA 1VBC3 3UNGC 2HWF1 3C7HA 3O1UA 3D1NI 2OUJA 1ZR2A 3BKZA 1KXGA 4F91B 4RS8A 1PX3A 4JQTA 2KJBA 2AACA 3S7EA 1XNBA 4AIKA 1SFXA 2R7DA 4K7JA 2W1OA 1QJX3 2CGOA 5L3BA 3ZQ7A 1J75A 4AI3A 1FBUA 2QBYB 1UYXA 5FZBA 3VDCA 2LF8A 3ZMNA 3LCPA 1JTYA 3VV1A 5C3PA 4LIUA 2CWEA 1OPOA 1ZLJA 3ZXKA 4E4SA 2KPMA 1KZHA 5KWRA 1EPWA 2J1SA 5IAVA 1OI6A 4QX8A 1AR71 4RR3B 4AU7A 1XSDA 4AYUA 1BI0A 3TP0A 5FY5A 3MFAA 5ACA1 2ZKZA 3IL2A 4Q8KA 2W3JA 1HBXG 4KUMA 2WAOA 3J80Z 1RGSA 4RGGA 1DLCA 1VBC2 3C2BA 3T0AA 5HCFA 4RQPA 1BVP1 3ZQCA 4KT6A 4PHZA 4GKYA 3B3QE 1U5YA 3JD72 4GMP3 1ONAA 4BQNA 1EH8A 1RINA 3CF2A 1QJX2 2JDKA 2X4HA 4Y22A 1Y0UA 1W39A 2BW3B 2QVOA 4O61A 3BP8A 1CAWB 2MD5A 3K7AJ 3TQNA 4K6BA 2E51A 1XS9A 2ETHA 5FAXA 2GQQA 3G73A 3QU6A 1ETOA 2Y75A 2JA8J 2RQQA 1VE0A 5A3TA 5BNNA 3OWTA 4QHZA 2M2EA 2XOMA 1EJ9A 1V9U1 2JWPA 5CFDC 3R4KA 3F9KA 1DIWA 1JYVA 2XPJA 5CIRA 1JKRC 1OKRA 2CV6A