1ZREA

4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
200
Chain Sequence
DPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*GP*GP*AP*T)-3'
publication title Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 66
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1zreA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zreA01
5AIQA 3H50A 3CEWA 3T1BA 1YS6A 1ZRRA 2O1QA 3KE2A 3MFKA 2V1XA 4KL1A 1J2XA 3V7CA 2QLZA 1KYZA 3H1YA 2MNGA 2MPFA 2E7WA 2MBFA 2ZKZA 2KIMA 3GF2A 3GW2A 4WXCA 1W7PD 4BH9A 2CAVA 3FMSA 4EMSA 5JSOA 1LQ1A 3JZVA 4YIFA 4JTNA 5FFXA 2L4MA 3DN7A 1SFUA 2EFOA 2ADUA 1LNWA 2W24A 2VE9A 4GYGA 4IEQA 1S29A 1QY4A 4HQEA 4OLLA 3TKYA 3SZPA 3HTUA 3E5XA 3H3UA 2PMUA 1ZN2A 3O6BB 1I6XA 2O8XA 2PJPA 5KHKA 5LRRA 2UXNA 2EFQA 2NRAC 1UIKA 3D5LA 4AIHA 5HS9A 4P9GA 2GH2A 4Z07A 3V8KA 5FLIA 2M8EA 2Z2SB 4N9HA 2H6BA 1H0MA 4LA2A 4LK1F 1CX4A 4L5IA 4WCGA 2EA7A 2IXLA 5HLGA 3G73A 1BIAA 3KP2A 1O3TA 1Z91A 5FQ0A 4HW0A 4IJAA 4RB0A 1HQCA 4JTOA 2MHFA 1LRHA 3NEUA 2ZJ2A 4NVPA 3QP5A 2Q2EA 4EQQA 1J3PA 4IERA 4A0XA 4QMAA 4B29A 4IXAA 3M3IA 3QU6A 4LG0A 4PZJA 3WE2A 4MEXF 2DU9A 5L3BA 1CAXB 5K1YA 2ZMEA 3T8RA 3WTTC 3LFKA 2ZNYA 1X8EA 3T0YA 4HDVA 5BPIA 1EV7A 3E5UA 5HS8A 1S7OA 1J1LA 4TLFA 4PGGA 3HSFA 4G7HF 3FM3A 4J1XA 3F6VA 3B02A 2IXCA 4HVRA 1FZPB 4ZZLA 2CSOA 3PQKA 4EJWA 5J7MA 1IN4A 4L9NA 2FNPA 2MLKA 5D8LB 3R61A 5EFUA 4NHJA 4CICA 4OIQF 3HRSA 2PYTA 3CUQC 1BI1A 3QP6A 1KU2A 3VOEA 1WKMA 2BBYA 4GYIA 1FYMA 4IEYA 1R36A 2IC1A 2GXBA 1GVJA 2O0YA 1EPZA 4YSFA 4QM8A 1EYBA 1QO0D 2YR2A 5D5VB 3R0JA 3RPQA 2COMA 1UPIA 1B1BA 5CVIA 1FC3A 1ODDA 1OKRA 1UCRA 4D7TA 4U0YA 3ST7A 4A0ZA 3ECHA 4ZU5A 4DNCA 4Z2YA 4ZZDA 3FHZA 3CLPA 2VBZA 3GVAA 1F5TA 3F8MA 3K1NA 2GWRA 2YU3A 1NXMA 4KIFA 3Q9VA 4O9EA 1G6NA 1FBSA 4HYEA 4HN0A 2OQRA 4LTAA 4AQ2A 2KIUA 4P55A 3MDPA 2H09A 4AD9A 2DPDA 1DZRA 3PFIA 4M9ZA 5ICGA 2PFWA 2F2EA 2BNNA 4MV2A 3EDPA 3I64A 3WTVC 4GXOA 1TTYA 3KMHA 5JSPA 1FOKA 3TO9A 2B8MA 2BNMA 5K8SA 5AONA 1XGOA 3WW1A 4BXUA 3IDBB 5LLQA 3KP4A 5ICFA 1Z1DA 2DAOA 3EHKA 4JVAA 3CO2A 1SD5A 4PDKA 1DDNA 1CAXA 3WTWC 1QQIA 4OOIA 4H0EA 2XHKA 3M1EA 2DBBA 2X4HA 3FXRA 4L0YB 1IXCA 3KP5A 3WGHA 2R7DA 5LBQA 3KP3A 1U8RA 2UY9A 4IRHA 3ROUA 3LA7A 1BBYA 1RC6A 2A3SA 1YG2A 4KIGA 4XSXF 3WW2A 4S05A 3BB6A 4BIFA 2M87A 2VOPA 4EWAA 3CUOA 3IHUA 1D3YA 4Q48A 4ORFA 4IEZA 3C3VA 1F9NA 1PDNC 2VT3A 1F1ZA 2Z99A 3JW4A 5D8KB 1EY2A 4IF4A 3MPBA 2PMHA 3LWFA 3K2ZA 4LD5A 2VONA 3GFJA 4QXKA 3M8FA 3ES4A 2K9ZA 3HRUA 2EA2A 3O14A 2Z5UA 1YFYA 3HYIA 3ISPA 1H9TA 1FT9A 1J5YA 3VODA 2FA5A 3NL1A 1TQIA 3N4MA 2DK8A 1B4AA 1JGSA 1O57A 1TQPA 4YFXF 3J80K 2M5WA 2Y75A 1JHHA 2K4JA 3F23A 1T6SA 2UXXA 1WI9A 4CO8A 1T98A 3LAJA 3IBMA 4AWXB 3SCFA 2H6CA 5DCMB 2ZKLA 4XF0A 1I1GA 3FMQA 2STWA 4EJTA 1DGWA 4MZUA 3SXWA 3EYIA 2PQ8A 1U5TB 2KJBA 1FPQA 1XSXA 1TBXA 4L9TA 1ZVFA 2ATFA 2F5EA 1XDSA 1U6GA 1DP7P 2FE3A 2DT5A 1BJAA 1O4TA 5ICEA 4R1HA 4I3PA 3ZMTA 1LJ9A 5LGNA 3LQRA 3GYDA 4HSJA 5D5UB 3UKNA 3RIRA 3GXOA 3HRTA 1IZ1A 1YYVA 2PFBA 4HX8A 3MAJA 4KYWA 4I02A 3CDHA 4MTEA 4IETA 2Q1ZB 4Y13A 2OAZA 5CVVA 5IT3A 1Z7UA 5BPXA 2R3SA 1KQ0A 2IVMA 3BP8A 4U7BA 1VJ2A 3KEQA 2PHLA 4YG2F 4WVZA 4IEXA 3K9TA 2XKOA 4MX3A 2PEXA 4WZCA 5D1IA 1HW2A 3IIAA 2OPKA 2QDRA 4ENJA 1ZLKA 3BU7A 5HLHA 1QXRA 2GIVA 1CAUB 3COAC 1YS7A 1YTYA 2ELHA 2HWVA 1Q43A 2GC3A 3HT2A 2Y0MA 1XSDA 4L5JA 2Q0OA 4WWCA 5T3NA 4HLXA 4BNCA 3EQLF 4IEOA 2XROA 2CGPA 4XFIA 5C8WA 4PGHA 2PG4A 2QVOA 4I0AA 3TDZC 1NZCA 4UUVA 2MA3A 3VEPA 3MCZA 1ZZ6A 1FBQA 3C7JA 5CYVA 4AIJA 3KEOA 4EROA 2M1BA 5E1WA 5AVPA 1MKMA 4G6DA 3SHFA 1Y9QA 2VBYA 5J6XA 5D6EA 1RIOH 2VN2A 3ELNA 1MD0A 3ZN0A 1J7KA 2EJRA 2IXIA 2V9VA 4YARA 1R58A 2M45A 2AS5F 2X0LA 2CO5A 3ZMSA 3FMRA 1UD1A 4KN4X 1V4RA 3C18A 4LEJA 1L3JA 3ZDSA 4XFGA 4Y17A 2IW5A 3LZZA 3U1DA 3KSCA 3OCPA 2W57A 1AOYA 1PM7A 2IA2A 1R00A 3LAPA 3RJPA 3P9IA 5FQ0B 2RDPA 4LGWA 3DF8A 4AVCA 4E2QA 4Q4ZF 3HRMA 3L00A 3VB2A 1FYKA 2Y0OA 3KGZA 3W6JB 2UYBA 1UW8A 3RKWA 4L0ZB 1LEBA 1FI2A 2PAEA 3TOAA 2ZMEB 2K27A 5FFZA 3NVCA 2KJCA 4DQ2A 4G7OF 2IT0A 3BJOA 2N7GA 5J48A 3JAMZ 4RAYA 3F8FA 4NQWA 2V09A 2V1DA 4I09A 4OMYA 4LLOA 2BNOA 3RZZA 3DL3A 3RDIA 2Z3YA 2PLYA 4KU7A 4GO1A 2EVXA 3I7DA 4HAMA 4AVPA 1R7JA 4A6EA 2AXLA 1KQ8A 4EWDA 1JUHA 4I7HA 3J81K 3SHRA 4IEPA 4ZH4F 3WTZA 1KGSA 5I93A 1OYWA 2CAUA 3M7GA 1J59A 3PVBB 4EM0B 2M30A 3UKVA 2HKOA 4UVBA 3GEZA 3BDDA 1GQHA 4ZYDA 3FZVA 2JT1A 2ZFWA 3TOBA 3E3VA 2VOOA 2K86A 1ZG3A 5HDGA 3TQNA 2VECA 3IKVA 4XF1A 2J5OA 3CO7C 4BHPA 4LUKA 3BJAA 2LKPA 5BUVA 4MUVA 1YW9A 1LB2A 1UB9A 3H3ZA 4H7LA 2ZNZA 3CUQA 3HQXA 1O3SA 3J81Z 3BPXA 3G3ZA 3E6BA 3BWGA 4ENNA 3FFQA 2BYVE 1SFNA 1DUXC 3RKXA 4IEVA 2QYOA 2QZ8A 3DKWA 4FAGA 1GQGA 2EFWA 3W6KB 4WK8F 4JK1X 4IHSA 1NHAA 1CAVA 3D82A 4HVOA 2HYGD 4CDGA 5DV5A 1L0OC 4E2GA 5A2QK 2GA2A 1YFUA 1QZYA 1JE8A 3BY6A 1B6AA 4RGSA 5TJJA 1XCBA 5BQTA 4QGMA 1HW1A 2FMYA 4EJUA 1HKSA 1IW7F 3U2RA 2OZ6A 2ZCWA 1O3RA 2XL9A 1FX7A 3BPVA 1UIJA 2A68F 4R79A 4KICA 3WGGA 2XIGA 5EEHA 1RL3A 1YHFA 1K6OA 2BV6A 2O6GE 4X6RB 2NNNA 1J3RA 2RQPA 2QM3A 4IHTA 2GQQA 2PAMA 4UXAA 5E8IA 2OU2A 5A2QZ 1OYYA 2STTA 2QNKA 2NAZA 3ACLA 1USTA 2JTVA 5LHHA 3C3WA 4RAZA 4HZFA 4XFHA 2XRNA 4GGGA 4ON0A 1SFEA 1E17A 1LR5A 5D5WB 2HDCA 2PN6A 1LDJA 2QWWA 4FBFA 3KCCA 4ENKA 2G7HA 2HR3A 3QAHA 3TNQA 3P7NA 3H9AA 1BIBA 3NRVA 2F4PA 3ZPLA 2YX7A 2UYAA 3ZMDA 2D93A 1AWCA 2CFXA 2D1HA 1RUOA 5DDGA 1ZREA 4MGZE 3GZ6A 5JI6A 1OMIA 2HTJA 4F7ZA 6PAXA 2WC2A 4KUMA 2KXLA 3V7RA 3KGLA 1ON2A 2XAQA 3GFIA 5LEKA 3FXQA 4AQ6A 2P6TA 2XASA 4G9YA 2ACJA 2Z9OA 2P8TA 2O3FA 1FY7A 4XF9A 5H20A 2ET7A 1KYWA 4KFCA 1XB4A 3KP7A 4UBHA 4YYOA 5JCTA 1S6LA 5L3GA 2VPVA 3L7WA 3U0ZA 2ETHA 4EVIA 2P5VA 3GZ5A 1HW5A 5CLSA 1QPMA 3I59B 5JHUA 2JPBA 3TDUC 4CYDA 2B0LA 3EUHA 2EK5A 4EJOA 1FXZA 1BOAA 1ZNPA 4MH0E 1R5HA 4QGNA 3LSTA 4QWQA 1YIOA 2XLFA 1P4WA 5H6RA 2HEOA 3AAFA 5HOOA 1IPKA 3DV8A 1DPUA 1HSTA 5CU1A 2FOKA 4HQMA 1FSHA 1IPJA 1XD7A 5FDBA 2H94A 2K02A 4U0VA 3D0JA 1YLFA 4HV5A 4BHBA 3P9KA 4A5MA 3I53A 3RYRA 1OFNA 5I91A 2P7CB 4Y15A 5FO5A 5I0SA 4P9FA 5JAXA 3C1DA 3HIFA 3R0AA 4RGXA 4Q29A 1IXSB 1FBUA 1H9GA 3S0MA 4KWKA 1UCXA 3ABUA 1J0RA 5K5OA 2P6SA 4HVQA 4AVAA 1CAWA 1KU9A 4KWJA 1TW3A 5I0RA 2V1UA 3REOA 2LNBA 5E8GA 4XF3A 4FAHA 5I8SA 2EFPA 3ZP5A 2XAJA 2D2WA 4MNUA 2MC3A 1R23A 3MQ0A 5CJ9A 3HUGA 4XEZA 4XRFA 4M72A 3FHIB 3QACA 3CL1A 1XMAA 3VFZA 2EA4A 2L54A 1ZAOA 5E1RA 2OZUA 4PCQA 1IRFA 2NYXA 2DFIA 3NJZA 1XGMA 3BJ6A 3UKTA 1ZHFA 4ETSA 1S8NA 2ESNA 1GXQA 4HX4A 2DTRA 1HBXG 2ISYA 4CHUA 5J3UA 1O7LA 3OF1A 4A5NA 1YWKA 2D5FA 3WGIA 1XDUA 4LMYA 2OBPA 2XAHA 2E9QA 2YSRA 1W5SA 4K2EA 4FX0A 5L3CA 2GC2A 2HQNA 5BOXA 2VC1A 3WG9A 1EP0A 3HOTA 4RS8A 2A07F 1R5GA 3I59A 1IF1A 1VR3A 5FGMA 4KWLA 1Z6RA 3ZN1A 1H1IA 3FXUA 3EJKA 1R1VA 1X8MA 3I5UA 3IRQA 3JTGA 1JXSA 4A12A 1LEAA 4E70A 2FRHA 3E5QA 3S7EA 1IRGA 1U3EM 1ZZ8A 4MQ9F 1X3UA 3J80Z 4ESBA 5BMZA 1K79A 3WTYC 2VC0A 3PLQA 2R7FA 2Y48A 3BOQA 4XETA 4IESA 1UFMA 2HTSA 4LFUA 2LDUA 4META 1FYLA 1Y3TA 2DQRA 3I4PA 3GX4X 5JFRA 2OYZA 3FZ3A 1PMIA 1S7AA 1ULYA 3H1MA 3WTUC 1G3SA 1BN5A 1TLHB 4U0WA 1T38A 3RYPA 1ZH5A 1TW2A 4Q0PA 4ESFA 3CLOA 4GCVA 2LF7A 4M74A 3HT1A 2L01A 4MGIE 2W85A 3QU3A 3I58A 4XF4A 2YPRA 4IEWA 1GXPA 4WXHA 1QZZA 1K78B 2K7LA 4EWEA 2MH2A 1K7AA 2Z33A 4YFKF 1O3QA 1Z9CA 2P17A 2IA0A 2L4AA 2EV5A 2XAFA 2XGXA 4XLNF 3BROA 3E6DA 2I45A 2Q30A 5L3DA 3LWCA 5CADA 2XV4S 2D40A 3E6CC 1P4AA 3ES1A 5KHGA 4LA3A 1L3LA 2DPUA 1YW8A 4OINF 2A6EF 5CVJA 2VQAA 1YUDA 1U2WA 4EGYA 1ZYRF 4YRDA 3ZQ7A 2VODA 1IN6A 3F8NA 2ETEA 4R8HA 2FXAA 2VT2A 2B5HA 2IXKA 1W7PA 3I0TA 4L9JA 2QUFA 3GYHX 4LLGF 3OGJA 3TNPB 2KRFA 5F1RA 3F21A 4TV7A 4IEUA 2XVCA 2JZYA 5DCFA 3Q9SA 2H27A 2Q0AA 5HI0A 2Z69A 4DINB 3L2HA 5K5QA 2GA1A 2P5KA 2FQPA 1G3WA 3WU1B 4UHTA 4I98B 3QOPA 4XFBA 3CUQB 3O2PE 5ILUA 3QPTA 4KT5C 5EEGA 1J9IA 1REPC 1HKTA 4LJZF 1OPCA 4MEYF 3LQQA 1ZGJA 4I01A 1G4DA 3M70A 4M6XA 3DFGA 4FX4A 1Q5OA 1ZARA 5HVQC 5BS6A 4EM1A 2HOEA 3DXJF 3H7JA 1CAVB 3PNAA 3BCWA 3PQJA 4MQVA 5FLXK 1Y0UA 4PIXA 2GC1A 3I54A 1CF7A 1RI7A 1OYIA 4EM2A 5KBFA 1T2KA 2PHDA 3TGNA 2RVCA 3DPTA 1QBJA 3E6MA 4OIPF 5IT9K 1YFWA 5FPZA 2OQGA 5JVTA 2GXGA 2RKHA 1D5VA 3U10A 1BM9A 4YIIA 3M8EA 3O3KA 1MJ9A 1DGRA 1P6RA 4HX7A 5FLHA 3DPLC 4HLTA 2DCTA 1MJAA 3OOPA 1RTVA 4UNOA 2GAUA 1K78A 4UV9A 4MGYE 3OV8A 4XLPF 2DQLA 2Q8KA 3GLXA 2KIFA 3GWZA 2JRTA 3V7SA 5HDNA 1ON1A 1WSUA 4D7SA 3Q5FA 1HSJA 2ISZA 3NQOA 4ONUA 1IAWA 1CGPA 1OD5A 5BPDA 5E20A 5K5RA 3K0LA 1SD7A 1TQ5A 2O61A 5TRDA 2HKXA 1RZ4A 1FP2A 2GZWA 1EH6A 1PP7U 4Q0UA 4LLLA 5F64A 5KHIA 1KA8A 2UY8A 4U7DA 5ICCA 3DQVC 2MD5A 5HDKA 5LGUA 1FNNA 1KQ9A 4ZU4A 4BYYA 3IRRA 2IJLA 2P4WA 2IPQX 5FLJA 1O5LA 2CV6A 4A6DA 1YQAA 1SAXA 4A0YA 1RUNA 1WLTA 1U5TC 2HYFA 1XE8A 1KU7A 3KETA 4Q47A 2EV0A 4IRIA 3TO7A 3K1MA 3L09A 2A5YB 4RB1A 3WTXC 1XCVA 2QQ9A 1MDMB 1H1MA 2EFNA 2VBWA 4LLNA 4ZYHA 1R1TA 2IP2A 1Q3EA 3LAGA 2MLGA 1D8KA 3KZYA 4XFAA 4P9UA 2HJIA 2DO7A 4ENMA 1NE4A 1YLLA 2RN7A 4QX5A 2CWEA 2EWNA 5C6CA 1STZA 1HKQA 4HOBA 5LHGA 2V79A 4NB5A 3SQNA 1V3FA 4WF2A 4LB5A 1XN7A 1IN5A 2G9WA 1A04A 3KP6A 1LDDA 1B9NA 1WGPA 2XKPA 2QVSB 3CO6C 2CW0F 3HOSA 1U78A 3J7AO 5KHJA 4BAYA 4MHGA 3KLNA 1CAWB 4RB3C 3NSTA 4JV4A 1SD6A 1LVAA 1RNLA 2O03A 1QNTA 1J58A 4PJYA 4L9VA 4CXFA 4FT8A 2C0ZA 3D0SA 4L18B 2PBIA 3FWEA 2IXHA 3F8CA 4LULA 3WTSC 3HTSB 2FBKA 4HF1A 1Q1HA 4OU0A 1ZZ9A 3HHHA 3EBRA 3IWFA 2V6CA 1ZGAA 4B09A 1GHCA 2MH9A 2B9UA 4U88A 1FLIA 2EB7A 2FBIA 2FBHA 3RI4A 1VTNC 1BC7C 2IA1A 4ASNA 3WW4A 5DD4A 4X6QB 2XAGA 4OMZA 3K69A 5DEQA 1SMYF 1OI6A 4XFCA 5I8YA 3EO6A 4KN7X 1ZX5A 5DYMA 3SZTA 2F5DA 4HF2A 2QBYB 4G7ZF 4Q5SF 2ZBKA 2TDXA 3KFWX 3IKTA 2FEZA 5JR3A 1ZRCA 1XRUA 1MDMA 2BEOA 2O8QA 4RGRA 4CZZA 4J1WA 2A6HF 1XE7A 3ZMVA 3KZZA 2QQAA 4RGUA 1ZG5A 1LDKB 3FE5A 5D6FA 5D5XB 1R1UA 1Z6TA 3ERED 2P7VB 4RB2C 1ONVA 5H6QA 1X82A 2BGCA 1VP6A 4IRGA 4KU8A 2E7XA 4KIBA 4EGZA 1SEFA 4ZU7A 1EH8A 3IL2A 2OZJA 4L2NA 4QM9A 4BQAA 2IXJA 5FD5A 1MZBA 3K1PA 2J5PA 2G7UA 4OIRF 1SQ4A 1P4XA 3VHRA 3M9AA 2A69F 1OR7A 1C0WA 2QJVA 3H1WA 1V70A 3JSOA 5AIPA 4AXOA 4Q0VA 2FQ3A 3QPHA 5JR7B 4M6YA 5FB2A 5BXXA 2F5FA 2H0VA 2LF8A 2YX4A 3WW3A 2NNYA 4HBLA 5E17F 4AIKA 5HLIA 4D0PA 5ED4A 1KU3A 3H7YA 1ZRFA 1USSA 4YFNF 2PQQA 3BPZA 3R6SA 4HSLA 2FF4A 1PP8F 2KKOA 4Z82A 1P2FA 5LEJA 4E2SA 1XGSA 1J75A 2FMLA 1UHWA 1RGSA 1W7PB 2OA2A 4IVNA 4XSZF 5LHIA 4UBGA 5ILVA 2RGVA 5JSRA 4OFGA 3RYKA 3F72A 4P96A 4HDUA 3RTRA 5HS7A 3I71A 5L3EA 2PI0A 3SXYA 1P92A 4O3MA 5L3FA 3CF6E 1S3JA 4S04A 3MEXA 4HA8A 4M9SA 2WV0A 1IXRC 5BV6A 5CVUA 3USSA 1QGPA 1UHMA 1X7NA 2QBYA 3HHGA 2ESHA 3RPUA 3TO6A 5FPXA 4O6JA 4ESJA 3HSEA 3V4GA 1ZZ7A 2D5HA 3GFLA 3IDCB 2LSOA 1G3TA 3RKYA 3R4KA 2ZXJA 4O9GA 4HF0A 4UXNA 1J3QA 4LK0F 1ZLJA 5KHHA 2C6YA 2XUBA 5BY5A 2GU9A 3SFZA 2BE5F 2RNJA 3V8LA 4M9XA 4EJVA 1IN7A 1YFHA 1XSVA 3ETQA 1MGTA 3FM5A 1TNSA 3DP7A 1B9MA 1W4MA 2HQRA 3JSPA 5F6FA 3MZHA 2EAAA 2VXZA 4HBNA 1HXDA 4UVAA 3SCHA 3SMHA 1CF7B 2PTMA 4KMFA 3ABTA 2PA7A 2A61A 3HSRA 4G94A 4MGRA 2Q4SA 2NS0A 3CJNA 3F8BA 5DD8A 3GO5A 5EZWA 5LRSA 2RV8A 3LA2A 3ZMUA 2JSCA 4G6QA 3EETA 4ZYEA 2D45A 2GC0A 1B59A 2L02A 4A2UA 4KA4A 2DK5A 4OIOF 1SD4A 1SMTA 3WE3A 3EYYA 2QQBA 5E1XA 3ECOA 3NW4A 1PUEE 3FJSA 4BHCA 3JTHA 2P5LC 2FNAA 2HS5A 2FU4A 4WX9A 5DUKA 1E2XA 1ZG1A 2OA4A 4RD7A 5D4RA 2K0GA 5E1ZB 2XL7A 4WBBA 4Q0QA 3H8UA 2E1CA 4CGZA 4QLCU 1YW7A 1FP1D 5FCCA 2HZTA 4PIZA 5LGTA 3N97A 4I2OA 3OTFA 1FWZA 3S2WA 1JHFA 4HV6A 2EV6A 1NYWA 1ZZBA 5ERIA 5KVRA 2IRFG 1BI2A 5J8CA 1DZTA 3G7DA 4MGKE 2VBXA 3NKTA 3MWMA 1MJBA 2HFHA 4WXDA 1I27A 5J8FA 1LKNA 4EV0A 3U11A 1WQ2A 3R60A 1QWRA 4L11A 3E97A 3P9CA 1BI0A 2OD5A 2JPCA 2D1VA 2XLGA 3CJXA 3RNSA 4N9IA 4YNIA 1D8JA 2L3DA 2FSWA 4LB6B 1O5UA 1SFXA 3F6OA 4JQFA 5E18F 1EH7A 2DLLA 3QRFF 2WWYA 4JBAA 1TNTA 3MZYA 3ULQB 2WTEA 1WRJA 1G3YA 4UVCA 2UWMA 4LUMA 5E16A 5DCMA 1WWXA 3WODF 3F3XA 2PAKA 3FX3A 4M73A 4N0BA 3U9GA 4IPAA 3GFMA 3L2CA 1WA4A 1R22A 1F4KA 3BZ6A 5FD6A 1U5TA 2HGCA 5DUIA 1I5ZA 3ML6A 3T8TA 3DEUA 4HLYA 3SCGA 3GUDA 3L9FA 1Z05A 3LA3A 1T39A 4XBFA 1ZZCA 3JAMK 3V8JA 1YO5C 3IWZA 5CVRA 1FSEA 3S7IA 4AVBA 1XGNA 2CYYA 3WU0A 1NE6A 4HMZA 4I0BA 2CG4A 5KK1A 1TQMA 1U12A 4Q0SA 1DPRA 2UZKA 2DW4A 5I8TA 3LOIA 2VE8A 2ET1A 4KNYA 3GBFA 1T0FA 3CTAA 1XMKA 4F8AA 4KMUX 1W5TA 3H92A 4KDPA 4LG0B 4MTDA 3KLOA 5FLXZ 2QENA 5I0UA 1O7FA 1QXJA 4K8FA 2E1NA 1IUYA 3ELKA 1ZRDA 4HN1A 1YFXA 4XFFA 2CQKA 4PIYA 1BI3A 4O5VA 2XLAA 4GULA 5IT9Z 3IC7A 5D4SA 2W25A 3BALA 4FHTA 2WFPA 4QGLA 2W84A 4UV8A 3T5XA 2ZO4A 1I1SA 3MYXA 3ZMZA 1IN8A 3F22A 2QCSB 1CAUA 2RC4A 4M71A 2F5CA 3EQEA 4R52A 3FF5A 3B73A 4P5OA 4B8XA 3OD0A 5ILSA 5I0TA 2DI3A 2K4BA 1BC8C 4ZYGA 4G8XA
chains in the Genus database with same CATH superfamily
1UKRA 3CEWA 3T1BA 3VBFA 4HKLA 3WT3A 2O1QA 3QQAA 4HPKA 2GH8A 3POGA 4M3CB 1KYZA 1UYYA 3JCIA 2E7WA 2LP0A 2MBFA 1MZ5A 3GW2A 4C0HA 3AKPA 4B47A 1PK6B 4NAOA 1DIWA 3K4KA 5FYUA 1LQ1A 1V6LA 4TLGA 2WNOA 2DXIA 1M1EB 2DA4A 1WPKA 3PHMA 4OLLA 3H3UA 5F3CA 1I6XA 3FK6A 1UZYA 4CDQC 3VD7A 4HK8A 5LRRA 2UXNA 5GALA 4CPBA 3D5LA 2OXBA 1OQEA 2H6BA 3H9GA 2XOMA 1H0MA 4AFMA 2QQOA 1GANA 4GD4A 5F9TA 4L5IA 2EA7A 2IXLA 3OYWA 2X1EA 3LSRA 2ZKNA 4A7YA 2WLQA 2ME0A 1C28A 4IJAA 3KEYA 3HPGA 4JTOA 4XONA 1BEV1 1LRHA 3NEUA 1L7RA 4RL7A 2WFF1 3ABZA 4AIDA 1JI8A 1UWWA 2EQRA 4B29A 3JBG3 4PZJA 2DU0A 5J98B 5K1YA 3GXUA 3O1PA 3T8RA 4QPOA 4WVMA 2QF7A 4PLNA 2IEKA 2R5ZB 1F5JA 1X8EA 4HDVA 2V5DA 1BJZA 1IG3A 1J1LA 5FZKA 2OW4A 4PGGA 3FM3A 3I3LA 3BOPA 4A3DJ 3K4CA 4ZZLA 5FXXA 3MEPA 4Q1RA 2HH9A 4SBVA 3PQKA 2Y60A 4U2AA 5J7MA 2MLKA 1OA3A 3R61A 1WMXA 4CCJA 2FDJA 3UNPA 4NHJA 4OIQF 1KS4A 3HRSA 1W0PA 2DWRA 2PYTA 1D2QA 3MV01 3V0AA 4XQDA 5D8AA 1BI1A 2QGUA 5B1AH 1GQPA 1NLQA 3VOEA 3LSHA 4KISA 2FQ4A 4JDNA 2BBYA 3T09A 1FYMA 5IVCA 2VI6A 2GXBA 4LBQA 2PLV2 1EPZA 5FK8A 1T08B 5J47A 4XABA 1EYBA 1QO0D 1W8NA 4FOQA 3R0JA 3RPQA 2COMA 1B1BA 5CVIA 1FC3A 4D7TA 1XOYA 3BZKA 3IPVA 1ASJ2 3G1MA 3VYTB 3CLPA 2VBZA 1F5TA 1WZ2A 4BEHB 2WFF3 2EZIA 2YU3A 1NXMA 1MBJA 1FBSA 4FTHA 4HN0A 3BG5A 4LK6A 2GIZA 4QX2A 1EPWA 1RXGA 1DQ5A 3WF3A 4P55A 5FY7A 5TGTA 3W20A 1AJOA 1DZRA 2Y69H 1D0HA 1YQ5A 2R16A 4MV2A 3CF5F 2MSYA 2HWC1 3WTVC 1T6GC 4GXOA 1TTYA 3W21A 4BK5A 2XSJC 4RFRB 5EJ1B 1FOKA 3D8CA 3TO9A 2B9VA 5K8SA 5E6HA 1XGOA 4BXUA 3GZAA 5IP9J 2H0BA 3AZZA 1SD5A 2NYYA 4TYSA 3WTWC 4OOIA 1PNFA 1QJFA 2RS52 3M1EA 2DBBA 2Y6LA 3PMEA 1M4WA 5FZMA 1STMA 5LBQA 2HPIA 3KP3A 5JMOA 4IRHA 4UB8C 2XONA 1IS5A 1T6BX 4RAFA 3OYAA 2KZVA 3WW2A 3K4BA 1W90A 5DAPA 1W6NB 1M06G 4BM8A 1H1AA 5L73A 4FVVA 1YRNA 3JW4A 4LHKA 1EY2A 1TMF3 2BOIA 1JZ3A 1G9CA 2PMHA 4I3GA 2HWB3 4LD5A 3VYUB 1GU3A 2K9ZA 3HRUA 1W9SA 2QKMB 1LPQA 2HEWF 2Z5UA 3ONQA 1R49A 2A6TA 2LY9A 4Y1YA 4RGKA 2CQXA 1TME1 3LOBA 1H9TA 2CS3A 3N3HA 1U9OA 4XJ8A 1SDWA 5T55A 5F8PA 2JIGA 2QZ3A 1V9U2 1JBCA 1OLQA 1TQPA 2V1NA 3CDIA 4YFXF 3J80K 2LMDA 3O12A 5HLTA 1JHHA 2K4JA 1S7EA 3F23A 2HWC3 2TRTA 1G9DA 3LAJA 1QHHD 3IBMA 3RZOJ 4AWXB 1X2MA 4YZ2A 2WSVA 1J84A 1N1TA 2OQ6A 1PNGA 2NVYJ 2PHRA 2STWA 1BEV2 1ENQA 1B35B 4MZUA 4R4ZA 3UL2A 4CH7A 3T1MA 1TBXA 1ZVFA 4IE0A 3Q8EA 2DCYA 4XUTA 1ND2B 1OVSA 5CAZA 3OBAA 4YG0A 5B2GB 2VU9A 4DYRA 3BUCA 5ICEA 3ZMTA 1LJ9A 5D5UB 3PUSA 5A70A 1G9FA 1IZ1A 4DRVA 4I02A 3BIWE 2WNVC 4MTEA 3UR3C 4ZXEA 2OAZA 4OZOA 4XKBA 2HDWA 1H2MA 2GNTA 2IVMA 1LU2A 3BP8A 2AR6A 2RHPA 1FAYA 1MEC3 4YWAA 4WVZA 2WABA 4MLOA 4MX3A 4QQ2A 1VQOI 2D6KA 3J4UH 2D5VA 3DLLF 1Z0XA 1HW2A 3HB9A 2OPKA 2QDRA 2IGOA 4BE0A 4COYA 2DJNA 2YGMA 2IFRA 1W9TA 1TME3 2M0MA 2BVVA 1ZLKA 1QJY2 3BU7A 4DYQA 4E7HA 1LGCA 4W4ZA 1HLVA 3NAUA 2HWVA 2WNUB 2WJSA 2GC3A 3DBHB 1W6PB 1HCRA 1N77A 3ZOIA 4WWCA 1MS0A 3VBFB 5ACA3 2I2SA 5C3QA 1DLLA 4HPKB 2KP6A 4XOGA 1F5FA 4UT5A 3TDZC 3OYIA 2CUZA 3S32A 1NZCA 5E8AA 4NWVA 2MA3A 2ERFA 4W6XA 5BNPA 3VEPA 3QWLA 3C7JA 3Q8CA 3KEOA 2IVIB 5J6XA 5D6EA 2WAQA 1JOBA 3A2KA 2M34A 2CH0A 1FMVA 4HKWA 5E89A 2EJRA 4L97A 1R58A 1MMAA 2X5IC 4Y1VA 1CX1A 5F3GA 3OY9A 3ZN4A 4PJMA 4NRPA 4QPIC 2L9LA 2YGLA 5KAIC 5I0DA 1W6MA 5L7OC 4DBRA 2IW5A 5F2WA 4GJYA 2FBEA 3OSGA 2RG4A 1BMV1 4BJTA 1FNZA 4RBOA 2BVLA 2JK3A 1EUUA 1X1CA 4LGWA 5FY9A 5GTHC 3ZYBA 3O1SA 4E2QA 3CMEI 1HLCA 3HEIA 2ZGQA 3VB2A 1W1WE 1FYKA 2Y0OA 5FMCA 3VD9A 3W6JB 2LOOA 3S1NJ 2WAAA 2DTWA 1US2A 3JRHA 1LEBA 3Q8FA 3PU3A 4DPNA 4FXKB 2DUPA 4WVMB 2M8GX 1PIV2 3U78A 1TT5B 4DQ2A 5KXCA 2N7GA 1ZBA3 4XAAA 4NQWA 1WJCA 2V09A 2ZMKA 3K46A 1JUSA 4NIHA 4C2TA 4I09A 4LLOA 3CMAI 1DYKA 2FCTA 2XBO2 1Q8SA 2RJ2A 3NV1A 4GH4B 3RDIA 2Z3YA 2WZEA 4GO1A 3I7DA 4HAMA 4AVPA 3HKZA 4E4SA 4P5HA 3HJEA 2AXLA 1KQ8A 4EWDA 4PSXA 4XRMA 4DFSA 4GKXA 5I93A 2CAUA 5FK7A 5FTTC 3U4XA 3C2HA 1GQHA 2V4AA 2ZFWA 4Q4Y3 1R5ID 5DAVA 5AVAA 3OYCA 3MLKA 5HDGA 3HGYA 4XF1A 3CO7C 3ZYPA 3HJRA 2W47A 3KYDB 1QQP2 2CJJA 4MO7A 2ORZA 4A7ZA 4XILA 2ZNZA 3HQXA 3IPVB 2HWE3 3POYA 3BTLA 3E6BA 1E5RA 1SFNA 1DUXC 1J09A 3MZ8A 2R0HA 4FAGA 2NVUB 2M9HA 1GQGA 3IH3A 2X6XA 2EFWA 5CQEA 2DVAA 2ZGSA 3AJZA 4DEQA 3S17J 1MMSA 5EWSA 4AU7A 2EIBA 4DYCA 1P7JA 3FXKA 3FLTA 2R1DA 5A2QK 2GA2A 3HQUA 3H0DA 3KZIC 3BTZA 1UZWA 4TZDA 1CZVA 1O4ZA 1HW1A 4HSRA 4ZY9A 4XBLA 1D0YA 2LRPA 4KBBA 5EXOA 3Q9OA 3ZSJA 4CDXC 2DU1A 4MOAA 2OZ6A 1O3RA 3BPVA 1I3AA 1APNA 1UIJA 5JI9A 3W5MA 4R79A 2CQNA 4A3XA 1XSQA 1OISA 4PBOA 2O6GE 4L5EA 4JRAA 2AC1A 1MPXA 3ZPYA 2IZWA 5A2QZ 1OYYA 2STTA 2NAZA 5C9AC 5E3OA 5GLUA 5LHHA 3C3WA 1HOMA 1WLDA 4XICA 2W4SA 4AK3A 1EV11 3DXTA 1AR93 1X3ZB 5T5OA 3LF7A 5M5WJ 2E51A 2ZGLA 1NCRC 2ZGRA 1K5MC 4ENKA 3CZ6A 2ADDA 3QAHA 2D6LX 1MIJA 2G9FA 4YZ4A 3NWSA 4V2GA 1BIBA 2BGPA 1I9RA 1FV2A 2OV7A 4JQRA 1Y1VJ 3ZXGA 1AWCA 2CFXA 5LBFA 1RUOA 2DCJA 4YW4A 1AL0G 4MGZE 4AGRA 1D2SA 2LVSA 2TUNA 5LEKA 4LE4A 3MIGA 5BYNA 4YW6A 4AQ6A 4AGGA 1BMV2 2R7TA 1TVGA 3L2RA 2OQ7A 2ET7A 2TEPA 3NV2A 4AHYA 4UBHA 4YYOA 3VHOA 1WJEA 2VUCA 3H8XA 1S6LA 1W2OA 5FO7B 3I2HA 5CLSA 1HW5A 1GYKA 3MW2A 3JXSA 5FJ8J 2R4GA 1OPMA 2X51A 3VL8A 4NUBA 1HXS3 2Y6GA 4DBQA 5HXMA 3WX5A 4ZONA 1X1AA 1W6OA 1GICA 4QWQA 2XLFA 3DU6A 1IPKA 3WNPA 2WO1A 2FOKA 4NPMA 2ENRA 2FCUA 3DTEA 1PO11 1XD7A 2R32A 3E1SA 2VKEA 1NY71 4Q4V3 4CPBD 2VVFA 4HV5A 3P9KA 5E3MA 1JKRC 5FKKA 3LNQA 2F17A 3JD71 5I91A 2CQQA 1QJU2 4OAYA 1REDA 4YZ5A 5I0SA 3C1DA 4A4AA 3IMNA 3FDYA 1IXSB 2HYKA 5JIUA 2D3RA 3S0MA 5IFTA 1UCXA 3ABUA 2DBNA 5DXDA 2DCZA 3JRDA 4AVAA 5B4XA 1Y7BA 3ZMOA 2CRGA 3O0VA 3K77A 3ASOH 5FMBA 2VXDA 2LROA 4C3HJ 5CJ9A 1GKBA 2B39A 3LDRA 4NIDA 4XRFA 4N53A 4M72A 2FJ1A 3WUCA 4XK4A 1ETOA 4E7ZA 5FXVA 2HVQA 4CDUC 1IRFA 2F4LA 5DUWA 1GUIA 3NJZA 1XGMA 2EIMH 5T54A 1S8NA 2ESNA 1GXQA 2KDZA 3TEDA 3NWTA 1HBXG 2ISYA 4CHUA 5J3UA 1QA6A 2JENA 4QAWA 2GMEA 1JGGA 1YWKA 3GZUC 1BZWA 1XDUA 4LMYA 3ITQA 2ZACA 3HN1A 1E5SA 2GC2A 4Y4YA 1VNDA 4A7KA 3C2GA 5BOXA 3GTPJ 2A07F 1R5GA 1OLRA 4LBQD 1Z6RA 3EJKA 1HJFA 1W6MB 5FAXA 2BRTA 1X8MA 3JTGA 1JXSA 1VBC3 1UG2A 1S0IA 1DGWY 2FRHA 1XBFA 1ZZ8A 4ESBA 1SACA 3VBHC 2VC0A 3PLQA 3BOQA 5H9SA 2WAFA 4XETA 3TB0A 5FRAA 2HOTA 1OR7C 2VASA 1D4VB 3OUHA 1DLCA 2OYZA 1EV12 4DOZA 2VXJA 1MS8A 4AFBA 1PMIA 4YVWC 4YZ1A 3ZCOA 4NBQA 3Q0WA 1TLHB 3ABKH 4U0WA 1HRV1 5DQ0A 4H14A 5FZEA 3CLOA 4M74A 4D9JA 4C3JJ 4W50A 4XF4A 2DA7A 3OB8A 1G8WA 2J1TA 4IEWA 3T2TA 4NQWB 1GXPA 3T3YA 1Q8OA 2HQ5A 1U0AA 5FJKA 2DVFA 5CQGA 4YFKF 4YGCA 2EZKA 3FKIJ 1U5YA 5CADA 3NRUA 3WHCA 3E6CC 1P4AA 5KHGA 4LA3A 4OINF 1WJ5A 4EGYA 1R1ZA 2VODA 3F8NA 4N43A 1LHNA 4AWDA 1OCCH 2X6YA 2B5HA 3PMSA 3I0TA 3NNLA 1TWCJ 3M8JA 2OC6A 1IQAA 5C4WC 1JTZX 2YU1A 1AA7A 4BXFA 2NS8A 2E32A 3MKZA 4PF1A 2I74A 1QVUA 2VUMJ 1RUF1 3Q9SA 4LKFA 2JA8J 2A6ZA 3L2HA 5K5QA 1UZCA 2GA1A 2P5KA 2L7MP 1Z7S2 2R7QA 1G3WA 4EN0A 4I98B 3QOPA 3MI8A 4XFBA 1WW5A 1TWGJ 4KT5C 1CWPA 5HNHA 1J9IA 3MBWA 1PO12 4LJZF 1ZGJA 4G12A 4I01A 2VZSA 5K7PA 4W6WA 4RSUA 1W05A 3U14A 4FX4A 3N35A 1UZZA 1XNDA 5HVQC 3JD72 4EM1A 2VCBA 2VZOA 4PI2A 2I8DA 2ZEWA 1GSLA 2PN5A 4N7UA 1VRBA 4PIXA 3MIHA 3S1MJ 4CDQA 5J3LA 1RMU1 5KBFA 5JXGA 4DEVA 1IG7A 2RVCA 2HPMA 3E6MA 5IT9K 4JYKA 4AE2A 2FDGA 1D5VA 4A3BJ 2HQAA 4AHXA 2XWBB 2JJ7A 5IAXA 5F7UA 1MJ9A 4YVSB 3S15J 4FQ4A 1A8DA 3AZXA 2JA7J 1RTVA 3BTAA 4MG2A 1VAKA 1MS4A 1H88C 2DQLA 3C7OA 2E31A 2Q8KA 2YV8A 3GLXA 4JC1A 5HDNA 1RUF3 1XB9A 2W2IA 5IVYA 1G9BA 4B4RA 1CGPA 1SLAA 1MR5A 4NRMA 5K5RA 5GLZA 4XORA 3K0LA 1Z21A 1Y1WJ 3CDZB 1TQ5A 4A3KJ 2WWUA 5JMCA 1YNAA 1FP2A 1V6IA 2Y9ZA 1D4M1 3LSIA 4LLLA 3R05A 3VBSB 3O1VA 1JYCA 1KFUL 3QYEA 2UWBA 2CV0A 2MD5A 1RUJ1 3V65A 3BG3A 4ZU4A 4BYYA 3PUAA 2KT0A 2P4WA 2IPQX 1O5LA 4A3JJ 4GWJA 4Y5Z0 1RUNA 1AHSA 2ZX1A 1VRH2 4F91B 1RUE1 3OOXA 1RMU3 4NE9A 4Q47A 4IRIA 3BVCA 5JXIA 3UGGA 1L7QA 1XCVA 1F31A 2EFNA 4LLNA 1JZ8A 5G04L 2FDHA 2DMUA 1R1TA 2IP2A 1W99A 1H6XA 4P5YA 3X2QH 2C6SA 3HOXJ 4P9UA 1WMDA 4FP3A 1R093 2HJIA 3POJA 1APLC 2DO7A 1T0FC 2VQHA 1X4OA 1YLLA 2EXIA 4QX5A 2EWNA 5LY2A 2Y6FA 1PO21 1VBE3 2A3WA 2P6HA 3OSFA 1V3FA 1KQRA 4LB5A 1XQNA 2QUOA 4BY1J 3KP6A 3P6BA 2GMMA 1WJBA 2XF6A 4P9XA 1JUPA 2VB6A 1WGPA 4KI5M 2BZTA 3CO6C 3MLJA 4OI1A 5E79C 2Y0SN 3CZJA 2GOXB 4MHGA 4LO4B 2NZ9A 2VUJA 1YIJI 2PMWB 1X58A 2DTYA 4L8QA 2X48A 3VZNA 4LOSA 2YYOA 1X9TA 1AL22 3H35A 2WBKA 1CN1A 4PJYA 4L9VA 2ZEXA 1RUJ3 3AKRA 3D0SA 4L18B 1ZELA 1N1VA 2IXHA 5FZHA 4X6AJ 1VQ6I 3RQ4A 4BQWA 5C3RA 2LK2A 1Q1HA 2R071 1C3HA 2V6CA 1ZGAA 1GHCA 1W9FA 1TNRA 1UZ0A 2B9UA 4U88A 5DG1A 5SV5A 2FBIA 2V26A 1RR8C 5LBCA 3DLAA 4CVUA 3RI4A 3DEEA 1Y9GA 2LH9A 3DKYA 1OSGA 5DD4A 4LBOA 4X6QB 4AF9A 3K69A 2XPUA 1SMYF 3N7KA 5I8YA 5DYMA 1G9AA 1LTEA 3KS7A 3ZMNA 1ZRCA 5JOYA 3EYPA 1NK3P 4CZZA 2MG4A 1R64A 3KZZA 2JG8C 3OY8A 1ORKA 1XC6A 4RGUA 4I0WB 3I4NJ 1DQ4A 1GT0C 4CCDA 5D5XB 4ATFA 2P7VB 3MGUA 1ONVA 1JJ6C 4CXYA 4RQPC 5C8CB 2VKHA 1X82A 4MFDA 3ZLIA 5LA0A 1W3XA 3NNJA 1ULGA 3VKMA 2WBMA 1LHOA 4ZU7A 1PZ9A 2ZMEC 3ILFA 3N7JA 1FOWA 2XGEA 5IK5A 2WSUA 5B4NA 3JU9A 2WO3A 4QM9A 4W97A 3DPUA 1V6NA 1P4XA 5FZBA 3WHUA 5EG0B 4W65A 1C0WA 2QJVA 1V70A 1QJEA 2RS31 1VBD3 2WNVA 1D4M2 2ZA9A 3Q0UA 2FQ3A 5CFCA 3ZQCA 4M6YA 5BXXA 3K3NA 3PJYA 1ENXA 3AZWA 1TWHJ 1EF4A 1OPOA 5JVGF 2WKKA 5FBJA 1EUTA 1USSA 4P08A 4DUXA 2V6EA 1UOFA 2RDQA 1S9HA 5LEJA 1UHWA 1RGSA 2OA2A 2KIQA 2YB7A 4IVNA 1RUE2 4NC6A 4XSZF 3TWIA 4YW3A 5LK7B 3VBRA 4OFGA 1RUG3 3PIOF 5M3FJ 2WN3A 3ZFFC 2K2SA 3SXYA 2VOTA 1JTXA 1S3JA 3VLBB 4NC7A 3WP6A 2KFDA 4IE7A 1IJWC 1IXRC 4LE3A 1SC7A 3B6AA 2H1KA 1D7PM 2ESHA 4FPGA 1YO8A 4NNJA 4ESJA 3V4GA 4BE1A 5DZGA 1PO22 1R082 4I30A 3BT9A 4ZC3A 2X6OA 1HB1A 3U37A 5FUPA 4QU2A 3CF2A 5DM7F 5F2SA 4LK0F 1ZLJA 5KHHA 1FTTA 1YFHA 5JI7A 3ETQA 2F48A 1H2LA 5F1JA 2DMTA 2LW8A 2HQRA 3O5SA 4DGWB 1Y39A 4IHXA 3SCHA 2PTMA 4OVEA 4B4CA 1KXGA 3WDVA 4M3CE 1MNDA 3Q0VA 5C4JJ 3HEFA 3FBNB 4LOCA 5DD8A 5EZWA 3OYGA 3LA2A 3ZMUA 5FLMJ 3OYMA 2EIEA 1GR3A 4QKDA 4DXZA 2YC0A 2L02A 4KA4A 4XAEA 4YW7A 3WDYA 2R072 2QQBA 3NAPC 2UWCA 2P5LC 2VOVA 2HS5A 1COV3 3IM0A 3RG0A 3FHAA 2L7FP 1OA4A 2RJKA 2XL7A 2O5RA 3WDXA 2L9SA 2E36A 2E1CA 3WR0A 3I55I 2EINH 2HZTA 1F9KA 3G4SI 2RM23 4A3CJ 5ABJA 3QODA 3A01B 1JU4A 5KVRA 2IRFG 3BC8A 3OS1A 4HG6B 3I3EA 5J8CA 4M6VA 4IE5A 3MWMA 4K8RB 1GOHA 3GTMJ 4OHYA 4WXDA 1I27A 5J8FA 2HI3A 2E53A 2B4KA 1WQ2A 3ZSMA 4CUGA 5LA2A 1MSEC 2OT7A 3E97A 3CCJI 2D1VA 2XLGA 1AYN2 1RVF1 5HPOA 2YZ4A 3CJXA 2VXRA 1N3QA 3X29B 3BTJA 4PT6A 4IQJA 1SFXA 3K4MA 2JDAA 5A1AA 5E18F 5A3MA 4MGTA 3KHCA 4ASKA 2TNFA 3ULQB 1HN1A 2OF7A 1W36D 4LKDA 1G3YA 1YQCA 4V2WA 5E16A 5DCMA 3ZXSA 3KVAA 1UG0A 4BL0B 1R22A 2XXZA 5FD6A 3AP7A 3V42A 1U5TA 5EGOA 4KWUA 4CEWC 1I5ZA 1NG0A 5IOZA 3DEUA 1SMVA 3VDXA 4MXWA 2RS32 3SCGA 3GUDA 1NCQB 1GNYA 1ACIA 1T39A 4XBFA 1RKTA 5CVRA 4RDUA 4JRLA 1XGNA 2F4OB 2HU9A 4DRRA 3WU0A 5FO9B 4Z8BA 3RMYA 4C3IJ 1MEC2 1DPRA 2UZKA 2VE8A 1S2EA 3K70C 1SLIA 3BIEA 4KMUX 3NNMA 1W5TA 1DHKB 3H92A 2MEV2 2IS4A 5IY5H 1IS6A 3ZRGA 1X4PA 2OCEA 5FY0A 4HN1A 2WA3A 4XFFA 2CQKA 4AW7A 3VHNA 1BI3A 1W9YA 2XLAA 2IVJA 4GULA 2UU8A 3WCRA 1PHMA 4OUEA 1RVF3 1YIPA 2WFPA 2QCSB 4J25A 2RC4A 4M71A 5C9AA 4ZTJA 2F5CA 3FF5A 2JD4A 4B8XA 1AKHA 5BNOB 4A93J 1BJQA 3BR5A 3S1RJ 4XYXA 3MFCA 4E4DX 3H50A 2JICA 2DMNA 1DP3A 3KE2A 3BGAA 2VG9A 1J2XA 1W8FA 2QLZA 3G71I 3H1YA 2MNGA 1AR63 2WS92 3TRSB 1UOBA 5EEAA 3GF2A 5K0UB 1OQDA 3M7AA 3UESA 1S5LC 2IGNA 2CAVA 4EMSA 5HBAA 1VQ4I 4XJUA 3FXJA 5J1RA 5FFXA 2BOJA 2EXHA 1SFUA 1BLZA 2EFOA 3V56A 2JDYA 1BBT1 1LNWA 4IEQA 3W59A 4XMAA 1CJDA 3NNGA 3HTUA 2XJQA 1IS4A 5KNLA 4K1ZA 2O8XA 2V5YA 3B93A 3S14J 1S0CA 2ZGOA 5HS9A 4A3MJ 2JA2A 5BNGA 4N9HA 4B1MA 3MMYB 1CX4A 3AP6A 3THTA 4WCGA 4S0HB 4DMIA 2FDIA 1AX1A 1N47A 1O3TA 3OD4A 4FISA 4HW0A 3RZHA 1FMWA 5CKMA 3UT0A 5IYBJ 2MHFA 2ZJ2A 4M0HA 4QX7A 4KGGA 4EQQA 1ZRIA 3LMMA 4O61A 4QMAA 3RI9A 4IXAA 5FZLA 1UF2C 1CAXB 5CFCB 2WA0A 2ZNYA 3ZYJB 3T0YA 3QH7A 4GFBA 1YJKA 1DGRN 2X6WA 2GOMA 5GP9A 1DU6A 1NT0A 3KQ4B 5LBBA 1V6MA 3HQRA 3F6VA 3B02A 2IXCA 4HVRA 1WJAA 3O1UA 3VD3A 3M1CA 1IN4A 2LBFA 4L9NA 1BBT3 1O91A 4QKNA 3ZFGC 1NOVA 4XOPA 1CZTA 3VBRB 3AMNA 4CICA 4NROA 3CUQC 1N3OA 4Q4X2 4AHZA 2RDSA 4IV1A 2VNOA 3I2GA 4GYIA 3TW6A 1D0GA 4IEYA 1R36A 4QKBA 2BWAA 4CDUA 1NKGA 5EJCA 1ND3C 4QM8A 2YR2A 4IV3C 5IJRA 3PVNA 3H5AA 1JZ2A 1ODDA 1OKRA 2K5CA 4U0YA 2VQ0A 1LECA 4KMQA 4ZU5A 1ULOA 5FYTA 4ZZDA 3FK7A 3VSLA 5JR2A 2ZX3A 3CMGA 2JG9C 3I3MA 2KD7A 4KIFA 1ODNA 1T33A 3Q9VA 4O9EA 3OYNA 1CPNA 4H7MA 2X9DA 2E35A 3MDPA 2H09A 5DZEA 2IUWA 3K4JA 1KFXL 2DBIA 2DOFA 2DPDA 5ICGA 2BQPA 4BQ4A 1YYNA 2RE9A 4C91A 5APAA 2BNNA 4UFMA 3EDPA 5FZIA 4NC8A 2AXTC 3CHXA 1AUYA 1MS1A 3VBHA 1ENHA 5A3NA 1BR2A 3KP4A 5ICFA 3ZQLA 2A75A 1D0XA 3CO2A 1DDNA 2VQUA 3U1XA 4QDRA 3K2AA 4JDMA 1QQIA 3CQOA 2XHKA 4XUOA 3M3YJ 4AEDC 3RKQA 3SEEA 4A3ZA 2X4HA 4QPGC 2JA6J 3WGHA 1GP6A 3M4OJ 4DUWA 1U8RA 5D2AA 3JB4C 5FPVA 2E60A 1NQDA 1VQ9I 1V6OA 2HVRA 2OIIA 5DAXA 5GAHJ 2C1FA 2HWF3 3O0XA 5FP4A 1LFUP 4KIGA 3OG2A 4XSXF 5ABJB 2ECCA 4BIFA 1DQ2A 5F5QA 2QQIA 5FBZA 1VLNA 4P9WA 1YJWI 2Z99A 3ZFEC 3MPBA 3WQ1A 3ZKYA 2O0OA 2W95A 3LWFA 2CW8A 3JRIA 2VONA 1F43A 1KS5A 2VCCA 2EA2A 5FXWA 3O14A 3UV9A 2VMDA 5K4LA 4FTEA 3E0JB 4RHV1 3H0GJ 4BJ0A 1H2KA 4II2A 3HYIA 1WWYA 5H2FC 1RKWA 2E1MC 3THDA 5EPAA 4FPJA 1J5YA 3VODA 2FA5A 3NL1A 1TQIA 1UAAA 1B4AA 3OYJA 3OWTA 4K20A 4RR3C 1GV2A 4YRVA 3VHPA 4GZ9A 3RWNA 3SCFA 4EQVA 1NLSA 1HXS2 5DCMB 1JTYA 1AR71 1U9NA 2DTZA 4RLFA 4QX8A 4EJTA 2UWAA 2AZ5A 1U5ZA 3SXWA 2VTFA 1U5TB 2KJBA 2R042 1T8IA 4FPEA 4L9TA 4DQAA 1H6YA 2F5EA 2QQMA 2KRHA 2FX0A 3U07A 4G6TB 2NQYA 5DAQA 5GAEJ 3I2KA 2Y6KA 1OD3A 3IIIA 3KV6A 1BJAA 1O4TA 2CY6A 3SKJE 2LYCA 2YC2A 2R061 2H8RA 3GXOA 1SDDB 2BW3B 2PFBA 3MAJA 2K9LA 2WIIB 1XPXA 4IETA 2VZ3A 5A6ZA 3B6CA 1DFQA 1TEIA 4CEYA 5BPXA 1FOD1 3FIWA 1AJKA 1QNYA 1PVEA 1RHI2 4Z92B 4GRIA 1LOFC 2QTWB 2PHLA 1GZWB 2YUEA 3OL4A 2XKOA 1SG3A 2XRLA 4CP1A 4WZCA 3ZIWA 3OOUA 5A7SA 5AC91 2D6MA 2GSYA 1DQ6A 3OL3A 1W0UA 5FP3A 2PJRA 2NXNB 1SCRA 1WMEA 1WHUA 2GP3A 1YTYA 1BL0A 2ELHA 1WMFA 4FPHA 4L5JA 5IVVA 3FXMA 2RQQA 2AUYA 1RJ8A 1Y8RB 3EQLF 1AR73 2XROA 4PGHA 4OQ9A 4I0AA 4J01A 1QDCA 5GJ6A 3UGFA 2GM4A 5K9YA 5JXJA 3HBLA 3BR2A 5AFBA 4CU6A 1FTZA 5GZDA 1DYPA 4EROA 2M1BA 5E1WA 1OLME 3SHFA 3KV5A 3VZLA 5FR3A 5KXDA 4YARA 2X0LA 5T5JA 1OHFA 1K4TA 4KN4X 4XN0A 4LEJA 2AQEA 1L3JA 2CHHA 3ZDSA 5DMYA 4Y17A 3HOVJ 2L7KA 3OCPA 2IWGB 4DXSA 1AOYA 3WF4A 2WAOA 1HX6A 5F0HA 1PM7A 5FOJB 2WZPP 4D69A 3FUQA 1LESA 4UUSB 2R49A 5ANNA 5F6LB 3LAPA 2CGOA 5FZDA 1I3QJ 2XB0X 3WDUA 1A6QA 3A0KA 4EYUA 3KYCB 2BOLA 4Q4ZF 3KGZA 2DA1A 2HDDA 2JA5J 4YM3A 5J1UA 4JGYC 1A6IA 5GZEA 3T4HB 1GMMA 3TOAA 5LBEA 2K27A 5FFZA 3CESA 5J48A 3TBDA 1OXCA 4UW5A 1DGLA 1W8UA 2CTVA 4NIGA 4RHV2 5GTIC 2WNEA 3N9QA 2A73B 2ZHKA 1CQTA 2BNOA 4INDA 5JDBA 4M0NA 5IOYA 5LZ6A 1MS3A 4ES9A 2Z1DA 5GLTA 5DDJ3 2PLYA 2EVXA 3WHTA 2OS2A 2LBFB 3AFHA 1UAIA 2UURA 4KQ7A 3SHRA 3OEBA 4WVWA 4IEPA 2IXSA 4ZH4F 3WTZA 5FZFA 4V1PA 2WO2A 3M7GA 1C8M1 3DBRB 4EM0B 3UKVA 4IV1B 4UVBA 4NHMA 3GEZA 2JT1A 1BW5A 4MO3M 3TQNA 1UY0A 2J5OA 3HBKA 2BV4A 2KPMA 1W3VA 4BDZA 4BWOA 1RR7A 5IPAA 4NWWA 3IV5A 5LA1A 1YW9A 1LB2A 3H3ZA 1BKZA 4H7LA 3G3ZA 1OF4A 2R062 4JGZA 3BWGA 2VJJA 4OI0A 4ENNA 3FFQA 5IWFA 3VZOA 1R1A3 3RJRA 2QYOA 3DKWA 3DF0A 1R4MB 3FUOA 3A0HC 2HLEA 3W6KB 5B5EC 4WK8F 4JK1X 1D5YA 1FOD2 3LD8A 3B9IA 1SVLA 1CAVA 4CZCA 4HVOA 2ADEA 2HYGD 4ITVA 2G19A 5EIYB 2ZMLA 1W6QA 1E5IA 4C8DA 2VC9A 4NHKA 5J1XA 5TJJA 2XR4A 4QGMA 3W2WA 2V9KA 4TSVA 4PFOA 5AC92 3WNOA 1IW7F 2GN3A 4RQPA 3IZOA 4D1QA 3ZYHA 3U2RA 3WU2C 2ZCWA 3WQBA 4R4XA 2XL9A 4WM7C 2ZGKA 2A68F 3CJIA 4FFIA 4A69C 2DUQA 5A33B 1WD3A 4KICA 2XIGA 3CCVI 1RL3A 2BV6A 2F6CA 2MABA 2JEMA 4UUTA 4IHTA 2GQQA 1C8M3 5B66C 5E8IA 3AYCA 5JOXA 1LEDA 3SYTA 2M3AA 3O1TA 1DYOA 4P9LA 4RAZA 3TN91 4HZFA 1XE0A 4HOOA 2ZGNA 1SFEA 2PN6A 2WL1A 1HA8A 1REFA 3L2VA 2HR3A 2XWJB 3AVSA 3C7HA 2Y9YA 4ARYA 2CWMA 2BY3A 5KC5A 3C7GA 3NRVA 2W0XA 1HV1A 3ZMDA 4NHXA 1A8MA 4BDYA 4XJWA 2D1HA 3AL0C 3FMGA 1D1BA 2BWCA 2HTJA 2VULA 6PAXA 1ULFA 2WC2A 3KIOA 2KXLA 2XB5A 3KGLA 1P9QC 3S1QJ 2RVAA 1POV1 3N9OA 5FWJA 4QPWA 5CKQA 4EN9B 5KXEA 3IT8A 1RUI2 2P8TA 2QE3A 5GM0A 3CCEI 1H8TC 2A6WA 3ATGA 5A3WA 5FPUA 2EZLA 3L7WA 3VDDC 2ETHA 2P5VA 4EVIA 2Y6HA 4LO7A 4XL9A 3IAQA 2B0LA 5F5AA 1OOPC 1BOAA 4MH0E 1VBE2 5BNQA 4YG3A 4OAZA 1P4WA 3AAFA 5HOOA 1HB4A 1HSTA 4UB6C 5L36A 5CU1A 4HQMA 1T56A 3VZJA 1BR4A 3OJBA 5FDBA 4AOCA 4U0VA 4EE2A 1UU4A 4BHBA 4CEYB 1ETVA 4LOTA 3I53A 3RYRA 3OIPA 5CPRB 4XUNA 4Y15A 4DO0A 4P9FA 2DCKA 3R0AA 1FBUA 1JZ7A 1H9GA 4FCYA 4XTPA 5A1FA 4HVQA 1CAWA 4OHVA 5I0RA 2V1UA 5FIXA 3OS2A 3CP2A 2LNBA 1XNKA 3NAPA 5I8SA 2BXZA 4RMNA 3VL9A 2PJRB 1CESA 1R23A 1POV3 3GF6A 4XEZA 4QX1A 4BXSV 3FHIB 3CL1A 1XMAA 3AXDA 3VFZA 1JYWA 5A6XA 4YW1A 5DAWA 1PK6C 4A45A 5E1RA 1V55H 1Z0HA 4K6BA 1MQTB 1G59A 1ZQ3P 3GHMA 4XJZA 2NYXA 2DFIA 3BJ6A 3UKTA 1ZHFA 4AR2A 4ETSA 4F92B 3K3OA 3ZVXA 1O7LA 4XE9A 3OF1A 2F4IA 4A5NA 3BODA 3B69A 4UW4A 5J09A 2D5FA 2MGQA 3BR0A 3WGIA 5F5CA 2K3FA 2OBPA 5B1BH 2YG0A 2LREA 2HOSA 1ETWA 1AHDP 1Z78A 2YSRA 4K2EA 4BKXA 4FX0A 5L3CA 1OVPA 2KQRA 2VC1A 2ARAA 3WDTA 4M3GA 1SZBA 3LDBA 2ELKA 4OULA 3J8F2 3I59A 4YW2A 4RM2A 1AX2A 4KWLA 1JUMA 3ZN1A 2B42B 1N1YA 3AYAA 3IRQA 5DN2A 3JRAA 4A12A 1AVBA 4UW6A 3WG1A 5FYYA 1A34A 1IRGA 5FLVA 5JLVA 4MQ9F 5T5LA 5BMZA 1K79A 5HXVA 3WTYC 2Y48A 3B9CA 3L2UA 1UFMA 3VKOA 2HTSA 4LFUA 3I56I 4META 1TZOA 1IKQA 4FSJA 3TN92 3I2JA 1Y3TA 2DQRA 5JFRA 3FZ3A 5BNNA 1YOVB 3I2FA 3AKTA 3H1MA 1QOOA 1MBEA 2W87A 1VBD2 3SH4A 1EA3A 1T38A 4Q0PA 4ESFA 1HC8A 5FZAA 3LE0A 2LF7A 4K40A 2L01A 1QRYA 4MGIE 2W85A 3CJQB 2VM9A 4WXHA 1QZZA 2JDHA 1DZQA 4OI4A 4EWEA 4HL0A 3QCWA 2Z33A 1ZK8A 5CKTA 1Z9CA 4AI2A 2IA0A 3ASIA 3CCYA 1E57A 4XXPA 2XGXA 3NJYA 2DA5A 5ERLA 1TT0A 3E6DA 1V5GA 3LWCA 5L3DA 4JKKA 2XV4S 2D40A 3NKGA 4FP2A 1YW8A 3HMYA 2A6EF 4XQFA 1YUDA 1VQNI 4YRDA 1IN6A 1FEXA 3OUJA 2ETEA 4R8HA 5FPAA 2FXAA 2VT2A 1W7PA 4C2UA 1LGNA 4LLGF 3I2IA 2NMNA 3F21A 3CQZJ 1UX7A 3LCPA 2AREA 5HI0A 1DCSA 1CR7A 2HYXA 4QDSA 2FQPA 3SEQA 2DA3A 3WU1B 3SH3A 1TZLA 4UHTA 3D3AA 4IHWA 2Y8KA 5EEGA 4JGZB 4XIOA 1REPC 5F32A 3W5NA 2VQGA 3LQQA 1RUD1 1B8IB 3HOUJ 4M6XA 5FXZA 3SLIA 3ZQQA 1Q5OA 1OQ1A 4K9SA 5DTDA 1ZARA 5BS6A 3CD6I 1CAVB 1IG0A 3PQJA 2ZC2A 3NJXA 1LEMA 4GQ7A 1FMD2 2VTXJ 1Y0UA 3PUFA 2PLV1 3OBTA 2VMIA 1RI7A 3GJBA 2QQLA 1T2KA 1LAJA 1QDOA 4FXGB 2DMQA 4R9AA 1WGXA 3WNMA 1JT0A 5FPZA 3T0BA 3QYBA 3D1NI 5JVTA 3PO2J 3LB9A 4GALA 2GXGA 2RKHA 3ILRA 3CJIB 1LE8A 3O3KA 1LUJB 1WW6A 3DPLC 4HLTA 3SEZA 2ORXA 2P3JA 1X2NA 1PVC3 1AYM1 2O9LA 4UNOA 3ZXAC 1K78A 3SZGA 1Q8QA 4HT1T 5J96B 4BU2A 3OV8A 4RFT0 3MF9A 3DYOA 5H9RA 2C26A 2YBSA 4MIMA 2CU7A 1X3WB 3V7SA 2DVBA 1ON1A 1WSUA 4HKOA 3Q5FA 1HSJA 4ONUA 1IAWA 2BY0A 2LALA 2JDPA 2VMEA 5BPDA 5E20A 1VPHA 3JCUC 5TRDA 1Z67A 5KHDA 2P37A 4JAAA 4NO4A 4BGDA 2GZWA 3WF0A 5IUQA 3BG9A 5KHIA 2VVDA 1VQLI 4YGDA 1KA8A 1A35A 4XLCA 4QX0A 2W1WA 4XIDA 1KQ9A 1UZVA 3ZFGA 4HANA 1D1CA 3IRRA 4CCCA 2ZEZA 1TE1B 2CV6A 4A6DA 1SAXA 1B35C 1WLTA 2PLV3 1H30A 4CCMA 3UJQA 3KETA 1AU7A 2DMPA 1ND2C 1LOCA 1MZ6A 3ZIXA 3WTXC 2XJTA 2QQ9A 3S3OA 3QLQA 2DT6A 1MDMB 5CYYA 1ASJ3 5CEHA 4JCKA 3NMBA 2QSFX 1K12A 2VY0A 4IV3A 4GJZA 3FLRA 4CP9B 2Y33A 3DPRA 1Q3EA 2VW2A 4XIKA 5CIRA 4QB2A 2R93J 1FATA 4M00A 1IS3A 1ETYA 1RB8G 4QQOA 2CWEA 2WQZC 1V9U1 2BW8A 2XPVA 1STZA 5C3OA 4HOBA 2DFFA 5LHGA 2XQRA 3J7AY 1XN7A 2G9WA 2XF7A 1P7IA 3PTYA 2CUFA 3S8PA 2V73A 2VO5A 4XLAA 5FFOC 1XX5A 2CW0F 4Q8KA 4MGQA 1U78A 3J7AO 2D3SA 1VQMI 4D6QA 5KHJA 4BAYA 4TWTA 1WUVA 2QFEA 4CYCB 3O7OA 1JYTA 2A6YA 2RS53 1CAWB 2ZXIA 2WNUC 3NSTA 3IUOA 4JV4A 4C1XA 4Q4W1 1R4NB 4Y7NJ 2O03A 1VI0A 1VMJA 5JZGA 3ZQIA 4FFGA 1YRZA 5FZ4A 3VBFC 4PJ0C 4AEDA 2C0ZA 1AR81 2YUSA 4LG3A 2PBIA 1O6UA 3MIBA 4NMIA 3F8CA 4LULA 3VSKA 2XHNA 3TP0A 1OUSA 4OU0A 3G6EI 2DOEA 1TG7A 2XUMA 3KCYA 5E3LA 1RUD2 3SEPA 2P81A 2HWD1 4QWNA 4TTGA 4BE3A 3CJRB 3ZFEA 3ZGKA 1BC7C 2JWPA 2YY1A 3K4AA 2XAGA 4OMZA 1YHQI 1QJY1 5DEQA 3B3QE 2ZZJA 4A3FJ 4KN7X 1ZX5A 2OUHA 2F5DA 3CDLA 1QPIA 2EXJA 2QBYB 1V9U3 3EB7A 2FMDA 2RMU1 4GAZA 2TDXA 5JR3A 1A6CA 3IH4A 2O8QA 2A05A 4LK7A 4OYUA 3ZOBA 2A6HF 4B7KA 1BEV3 5IP7J 4KH9A 2D98A 1LDKB 1ZGWA 4HFSA 3JRFA 3S3MA 4YM2A 3PIJA 1V54H 1SLLA 1VAMA 1AYM2 1VP6A 4IRGA 5IVEA 1PGL1 1S0EA 3PUHA 2CNAA 1EH8A 3AVRA 5BNNB 2Q1FA 4KNCA 5IFPA 2IXJA 3ZX7A 1E3OC 3A4CA 3WHBA 3WF2A 2B46X 1SQ4A 2V4VA 2HXOA 1QGLA 3M9AA 1SBEA 1HV0A 2ZTNA 4GH4C 3D6EA 3A0BC 2DYCA 3CJTB 3QPHA 1TL8A 2E26A 3KQRA 5JR7B 4IOCF 3VDCA 1NZIA 2CSGA 4FTBA 1QMJA 4GWMA 3GTKJ 5E17F 4AIKA 2I5UA 4D0PA 5ED4A 2P4EA 1ZRFA 1JN2P 3CCLI 5FYVA 2PQQA 1QJY3 4QXCA 3VKFC 2KKOA 2NOJB 4E2SA 4H3WA 3U4SA 1W7PB 1W0OA 2DF7A 2JSPA 1XJAA 1SCSA 4UBGA 2DOAA 5ILVA 2RGVA 1ONAA 4YGEA 3F72A 3RTRA 4XJAA 1PIV1 3T30A 3I71A 5IVJA 5L3EA 3AL5A 2PI0A 4IL7A 3EMRA 1IQDC 3TAYA 4WVVA 3CF6E 5C5TA 5C4XJ 3RS6A 4Q27A 3LEGA 2RS11 2XBO1 5BV6A 1WW4A 4AM3A 5GZCA 3USSA 1MH3A 1V5EA 3RPUA 5FPXA 3HSEA 3EUHC 1ZZ7A 3F0CA 3N9PA 3GFLA 3IDCB 4RGGA 2LSOA 4XR6A 1G3TA 4IGPA 2ZXJA 2QSHX 1J3QA 1WI3A 3OGSA 3DKXA 2M7BA 4ZDPA 2GU9A 2BE5F 3ZSLA 3J7ZI 4WM8A 3LSDA 2OUJA 4E27A 2PX9A 1NG6A 1YEWA 4JX5A 1B9MA 1W4MA 1DU0A 3QBQA 3JSPA 2EIGA 4BBSJ 4Z2AA 3RJ2X 4HBNA 4UVAA 4AQTA 2W1SA 3B00A 3ZSEA 1N78A 2AQFA 3ABTA 4JX4A 3M2MA 3SDGA 1GZ9A 1QQP1 2AENA 4L0PA 2NS0A 5EQUA 4Q4W2 4CCEA 1BA5A 4IE6A 3BR6A 5FKLA 4QQPA 1UYXA 4LHSA 1URXA 3GTQJ 1AR82 3NWKA 4ZYEA 2JUGA 3KLSA 3S93A 1QKQA 1LE8B 1KZHA 1B59A 1SMTA 1K83J 4NJ4A 4CCOA 5E1XA 3K7AJ 3NW4A 3VN4A 3FJSA 3DCFA 5DZFA 1BVP1 3HPNA 5DUKA 1E2XA 1GV9A 2OA4A 4OI2A 4WBBA 2BERA 1RUC2 2HWD2 1PIV3 1NQJA 4CGZA 3ECQA 2K46A 2JB8A 1FP1D 4PIZA 1DQUA 3AFGA 4BDVB 4I2OA 2XBO3 3PM1A 3I4MJ 4HV6A 1NYWA 1POGA 2JRMA 3G1OA 2PELA 1B72A 2VBXA 3NKTA 2ELJA 2RMU2 4ZYAA 2HEVF 3E1F1 5A7WA 3Q8BA 4XRSG 1WLWA 2JWTA 1JKOC 3WQ7A 2D3PA 1LKNA 1S0DA 1W2UA 4IHYA 3S30A 5FRMA 4JX0A 4L11A 3P9CA 2CV2A 1CQ9A 2JECA 5FY1A 3S5QA 4ZZ5A 4N9IA 1E0EA 3J7YJ 2FSWA 4GMP1 1O5UA 2FD5A 3F6OA 3UNGC 4JQFA 4IOAF 3HWJA 4LJHA 5HV0A 1XSRA 3PNYA 1PGL2 2WWYA 4JBAA 2YROA 1QQP3 4BS9A 2WTEA 4NPLA 4AG4A 1ENRA 3TMOA 3S5AA 3WP3A 1PUFA 1WWXA 5FZCA 3F3XA 1FNYA 2PAKA 3FX3A 4M73A 3U9GA 4CCNA 3GFMA 3L2CA 2VKDA 3DPRB 2WR9A 2DCEA 3BZ6A 3CCRI 2GDFA 1C5HA 3AG3H 2DYRH 4EZHA 2ZJCA 2ZXWH 2EF6A 2ZGPA 2IAIA 2DV9A 3OYWB 1LU1A 4AVBA 4Y3OA 2CYYA 1NA1A 4BCUA 2LS6A 2EAKA 5I8TA 3RQIA 3LOIA 1HN0A 4OMDA 1SFPA 4XCBA 1XNAA 4HEA2 1XS9A 3L9JT 1YX3A 4MTDA 3KLOA 5FLXZ 4YFWA 2GNBA 3A21A 1QXJA 1IUYA 3ELKA 4Y22A 4M01A 2ZEYA 4WM7A 4PIYA 4BLIA 5JZGB 2BGOA 5D4SA 3APBA 4QX3A 5FZ7A 2W84A 5KC6A 5CISA 1IN8A 3A4UA 2RS12 1CAUA 4GMP3 5BNPC 4YIRX 2WWSA 3K70D 4P5OA 4BBRJ 5ILSA 5I0TA 1QJU1 3H0OA 2DI3A 2ZXHA 4G8XA 1LGBA 4LITA 4XDOA 1RIRA 2P5BA 2ZABA 3V0BA 2A6XA 3RRDA 1V6KA 3W58A 3V0AB 2MPFA 3LFIA 5D8AB 5A7QA 3ERMA 2ZKZA 2KIMA 3RZLA 3OYKA 1JODA 4WXCA 5HCBA 2A7AA 1W7PD 4BH9A 3WCSA 4CCKA 3C8XA 5FMOS 1GNZA 4LBQB 4JTNA 4V2VA 2RR11 2L4MA 4Q5OA 3H5NA 2ADUA 1RITA 4HSTA 1AX0A 1S29A 4HQEA 1G86A 2COBA 1VBA2 1DBNA 3TKYA 3INAA 3SZPA 3WD5A 3T08A 1ZN2A 3H9QA 3O6BB 1D0ZA 1RXFA 3A03A 4NIIA 2NRAC 4FETA 4AIHA 4Z07A 3V8KA 2Z2SB 5GKAC 3HM5A 4BZ4A 4LA2A 1C1FA 3VBOA 1JZ6A 4XLHA 1OOPA 5HLGA 3RI8A 5A3PA 5CFDA 3L2QA 1BIAA 2BY1A 2B63J 5LB6A 1AXZA 1X19A 4PBPA 2Q2EA 1J3PA 1VBB2 4IERA 3VB9A 3M3QA 3QU6A 1REEA 4LG0A 5IK4A 2VZUA 4PDWA 3WE2A 4MEXF 1QJU3 4UAPA 2BVBA 4BOWA 3WTTC 3BG7A 2VZPA 3LFKA 2VNRA 5BPIA 1EV7A 4CA9A 1FPN1 1SPPA 4KBZA 3HSFA 4G7HF 1VQ7I 4J1XA 3A7QA 4LBJA 2BJSA 1YITI 1FZPB 2E2HJ 1W03A 4CDWA 2CSOA 3WXPA 4EJWA 3SC7X 1RUH1 3HOZJ 4NHLA 4OHXA 3AZYA 3BPSA 2VKVA 1YRNB 2DVGA 2O8OA 2P2KA 5EFUA 1QJX2 1UN1A 3K2OA 3OBRA 3B5LB 4UYBA 2K9NA 2NVTJ 2DJIA 1NAEA 3H3LA 1WKMA 1UJ8A 1OLTA 1PK6A 2P3YA 2YXSA 2IC1A 3URFA 1GVJA 4YSFA 2GLOA 5EF6A 1R1A2 3MIDA 1UPIA 5DPNA 3VBUA 1JOJA 1UCRA 3ST7A 4LIVA 4A0ZA 1QZEA 4UI9L 4DNCA 3FHZA 3F8MA 3K1NA 2H1LA 4H2AA 4WM8B 4HYEA 2WZR1 2OQRA 4XXAA 3N9MA 1Z77A 4LTAA 4AGVA 4ISQA 4AD9A 3PFIA 4M9ZA 1Z7S1 4LMFA 4PJLA 4YVSC 2LUWA 3WV6A 1LFBA 5HNFA 1WCSA 3KMHA 3HGGA 1Q56A 1WZXA 2B8MA 2BNMA 2PMZA 1QXPA 3WW1A 1EV13 4IQ4A 1DDLA 1HRI1 5FYMA 5A32A 2DAOA 3EHKA 2VJIA 3RQ0A 4G9SB 2NLRA 1YI7A 4Q8LA 2YDEA 2LC2A 4B44A 2G4IA 3FXRA 2ZAHA 1NTCA 1SFOJ 3DCQA 2LY1A 4B3AA 2R0QC 2RDRA 2UY9A 4O65A 3LA7A 5F5IA 2M2EA 3BN6A 1X33A 4NHYA 1RC6A 1YG2A 4AI0A 3WNLA 5L9VA 3VBSC 4COUA 4S05A 2JMWA 2M87A 3BTXA 3IHUA 3C3VA 2A71A 1PDNC 3CLQA 1B72B 2RR12 1F1ZA 2QCOA 4IQPA 5FJHA 1EAH2 4IF4A 1LHWA 5A7WB 4F93B 2VZTA 3GFJA 4QXKA 3M8FA 5GAGJ 2BTVC 3H1CA 4BQNA 1YFYA 4BMEA 4D3WA 2WB1A 5BNPB 1FT9A 1OBNA 4DY3A 3N4MA 2QQVA 1JGSA 1O57A 5J36A 4Y33A 3DYMA 1Z7S3 3AFKA 3TOJA 3RGBA 3MPPG 1T98A 2O8KA 5HCHA 2ZAAA 5JLWA 4BEHA 2EIDA 2IS6A 4XF0A 3FMQA 1PO13 1DGWA 2BP6A 3A02A 4CU9A 1FPQA 1XSXA 1KGYA 3JD73 1XDSA 1YC61 2PHUA 2ZMNA 1W04A 2ZHNA 4Y20A 1U6GA 4R9BA 1DP7P 2DT5A 4GIQA 4C0BA 4R1HA 5LGNA 1VRH1 1NA1B 3LQRA 3GYDA 4HSJA 1I50J 3UKNA 3RIRA 4KGQA 3PIGA 1FPN2 3HRTA 1H4GA 4HX8A 3CDHA 4GB31 5FP8A 4Y13A 5CB7A 1Z7UA 2R3SA 1KQ0A 4FPOB 3AMMA 4U7BA 1VJ2A 1RUH2 3KEQA 5EDNA 4YG2F 4HNUA 4IEXA 3K9TA 4Y22B 2VPLA 3SISA 3AXEA 4PHZA 3HXLA 2XJSA 4LO5B 1H8AC 3IIAA 1MBKA 4J6GA 1GZCA 2CW7A 1Q8PA 4UFIA 4ENJA 4M3CF 5HLHA 4A6SA 2GIVA 1CAUB 3O1RA 1IRZA 2W7NA 3COAC 4COZA 4BQ3A 4XMYA 1PX4A 4ISRA 4RS5A 1Q43A 3IAS2 3FC0A 2X85A 1RETA 4KITB 5GZGA 2Q0OA 5M5YJ 5T3NA 3V0BB 2EH3A 4BNCA 4IEOA 3ACIA 3IAM2 4BJ5C 2PG4A 2QVOA 2EXKA 4P9JA 1AL21 4W6YA 3MCZA 2WZR2 1UMZA 5CYVA 1MKMA 4S2GA 3HDDA 4G6DA 3I9V2 2WY8Q 1RIOH 2VN2A 1BOBA 3ELNA 4CE8A 4FQGA 1MD0A 2E6VA 1SFKA 3ZN0A 2VH9A 2CWSA 2R7UA 2V9VA 1VRH3 2NS7A 3CNAA 2M45A 5C8CC 2AS5F 1ZR4A 2CO5A 3OGVA 3ZMSA 1MW7A 5F27A 1JYIA 5KAFC 3FMRA 1UD1A 3IN9A 1MZFA 3C18A 3GBGA 4XFGA 3RPUD 1HRI2 4EN8B 3LZZA 1IDZA 1ND2A 2DA2A 4PF5A 4LBKA 3KSCA 2W57A 1HRV3 2NPIA 2CDOA 2WY7Q 2IA2A 2JKXA 1PZ8A 3ZQHA 5CFDB 2D6OX 1R00A 2RJLA 2W52A 3RJPA 2X8KA 4NPRA 5IAVA 3DF8A 4AVCA 2OPTA 2A5WA 3HRMA 1LKXA 3LSEA 4OQ8A 3ZM8A 2WYSA 2OKXA 4PDWB 2UYBA 3RKWA 4L0ZB 1FI2A 2XVKA 5CNAA 3NVCA 4BXXJ 4G7OF 3T0DA 2IT0A 3JAMZ 4RAYA 4N43C 3F8FA 3FISA 1WBLA 2VE1A 3FN9A 4BK4A 1SPPB 4OMYA 3GALA 2VOKA 4N4OB 1LHUA 1ZBE2 5FYZA 2OCCH 3DL3A 4NRQA 3CCMI 4CDWB 3JBG1 4KU7A 1QVTA 3M1HA 2VQTA 2BXYA 4A6EA 1W8ZA 4UW3A 4I7HA 3N7LA 4KJZA 2W1OA 4CRQA 2FZ2A 1KGSA 1OYWA 1J59A 1WVRA 1JMUB 3QD6A 2OX0A 2HKOA 3BDDA 4NDLA 5DUUA 2K9MA 5JWPA 3E3VA 5A7NA 2VOOA 1UL9A 3WUDA 2DN0A 3DTKA 4D5CA 3VD4A 4BHPA 3T2QA 3BJAA 5BUVA 3VBUB 1UB9A 1XC5A 5HCAA 5JOWA 4LBLA 5FYBA 5LW9A 1TC3C 1W06A 4Y5SA 2BYVE 4CP0A 4J19A 3RKXA 4IEVA 1GBGA 4IHVA 4DZGA 4Y1ZA 2QSGX 4GB32 1X9PA 3GTGJ 4II3A 3GHNA 1NHAA 4PQ9A 1UY3A 1W8TA 3R4UA 5DV5A 4E2GA 1HDDC 4AEMA 1W6OB 2R7OA 4A3LJ 2ICWG 1C1LA 1YFUA 1JE8A 3BY6A 2IS2A 4RGSA 1S0JA 3P5BA 1XCBA 2FMYA 2EILH 4EJUA 1R081 1OCRH 3O8GA 4DZPA 1I5PA 4AZZA 4QKFA 1PVC2 5A32B 1FX7A 4BQ2A 3BCAA 1K4SA 2I07B 3LDKA 1ULPA 1K6YA 1RYYA 1VZ0A 3WGGA 1WLCA 5DUXA 1G7YA 4BIOA 3TEWA 1J3RA 2RQPA 2QM3A 2QQWA 4COVA 2P3KA 1YQ8A 5JUVA 2OU2A 3EUKL 1EKEA 4GA9A 1USTA 2HYJA 1D4M3 1FYUA 2E2IJ 3M4FA 2HNHA 2XJUA 2F5VA 4UFHA 2YPJA 3KV4A 2XRNA 4GH4A 2FCVA 4NAMA 1LR5A 1E17A 2HBUA 4UFJA 5FZ8A 2HDCA 5EZHA 3KCCA 2NP0A 3LGRA 4X0GA 2E19A 2CGNA 4N53B 3H9AA 4URTA 2YX7A 1RUE3 3K51A 1IDYA 2FD8A 3AP5A 3NQHA 3GDBA 3BYWA 1I6HJ 3BTCA 3GZ6A 5JI6A 1OMIA 1QJZA 4KUMA 4AI9A 4IGOA 2VZVA 3GFIA 5C33A 2P6TA 1TMF1 2ACJA 3JR9A 2Z9OA 2HWB1 2QKLB 2XB6C 3PJRA 3UYJA 1I3HA 1FY7A 2WADA 1JU3A 1PVXA 4A41A 1VF9A 1PO23 1QIQA 1HDPA 1R083 4P9IA 5E88A 1NCQC 3GZ5A 3S16J 4ZHNA 3TDUC 4CYDA 3EUHA 2EK5A 3MHZA 4DW6A 1ZNPA 4JZRA 1R5HA 3LSTA 1AYN1 3CMMA 3P5JA 1PGW1 1YIOA 5LWBA 4Y20B 2HEOA 2M4GA 3ASNH 3VZKA 2KRCA 1NX9A 1FSHA 1N3PA 1IPJA 1MMDA 4M3EA 2K02A 2D44A 4D6SA 1YLFA 3H36A 4A5MA 3JBG2 1W28A 4NIAA 2P7CB 1U0JA 5FO5A 1OLMA 4QDQA 3DYPA 4JKMA 4RGXA 1L7LA 2XMLA 1H2NA 2R073 1F8VA 3ZXKA 2R7WA 5M3MJ 2HZDA 1TW3A 3LPFA 5BNOC 3WDWA 3REOA 3G2BA 1QH6A 2Y31A 3ORJA 2D97A 3VPRA 5E8GA 3RZDJ 2EFPA 4EJRA 2XAJA 4AC0A 2D2WA 4MNUA 3MQ0A 3TEZA 3HUGA 4RS5B 1MEC1 3QACA 3ZPOA 2EA4A 5K0UC 2L54A 1ZAOA 3RSJA 4HG2A 4N43B 5HV4A 2JVHA 3GGLA 3WG7H 2MEV1 2OZUA 4N90A 5FMDA 1OJLA 3DKQA 1B09A 2DTRA 3N9NA 2XG3A 3OPTA 2Z4FA 4COWA 4BQQA 3ABMH 1AYN3 4XW3A 2XAHA 2E9QA 5FKBA 2VJ4A 5ACA1 3N05A 2HQNA 3VV1A 3GJAA 3D5OA 3AJYA 3HOTA 4RS8A 2WFF2 1IF1A 1VR3A 5FGMA 1H1IA 5LD2C 1JW6A 3I5UA 5C3PA 1FX5A 3PJQA 2W92A 4D94A 1W2TA 3IP4B 2IS1A 2WS91 3KHBA 3POWA 3E5QA 3S7EA 3ON7A 4L9BA 3J80Z 3MW3A 2VJ5A 1UQXA 2X5IA 1YIFA 2Z5WA 3POSA 4IESA