3AZYA

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
251
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 57
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3azyA00
1FAYA 4C1WA 3BOPA 2OW4A 4FOYA 4KBBA 1SBDA 1KJRA 2CY6A 1WUVA 2A6WA 1GZ9A 1LCLA 2R16A 1KITA 1IKPA 3W58A 2ZBJA 1S0CA 4Q2FA 1CPMA 1QU0A 1UX6A 2JECA 1BZWA 3AZVA 4Q1PA 1KDMA 2D44A 3AYAA 3AP6A 1MS0A 2ZMKA 4R9AA 3FFZA 3M3OA 1GZWA 1QNWA 4YM2A 2WJSA 1LOAA 5E88A 5EYYA 2SBAA 5EXOA 1Q8QA 3QLQA 3U4XA 2P34A 1J1TA 1G9FA 2JE7A 1UL9A 3V0BB 1W6QA 4AGVA 4UW5A 1O4ZA 3WG4A 1EPWA 3SITA 2ZZJA 1IS5A 3FBYA 4XTMA 3RG0A 3ZSKA 1CPNA 1AVBA 1LEDA 1UN1A 5T52A 3FUOA 4XXAA 5T50A 4FPHA 4LBNA 1ENQA 5HCBA 3WHTA 1CVNA 2AUYA 2CL2A 1KJLA 1ZA4A 1SACA 1MZ5A 1Z78A 4MYEA 2DTYA 2YV8A 1VAMA 5E8AA 1AZDA 5GZEA 4YGEA 5JOZA 2DUPA 1GICA 2ZHMA 1QDOA 3LSEA 3UJQA 4YW3A 4K1YA 1G8WA 1HKDA 1WD3A 2D3PA 4R9DA 1DZQA 1ULCA 3VKFC 5GZCA 3AK0A 2ZGMA 4JCKA 3I8TA 4WVVA 4YW4A 2RHPA 1S0FA 3RMXA 1V6LA 1MVQA 4ITCA 2EXHA 4AWDA 5JOYA 5FRAA 1LODA 1QNYA 4YG3A 3VKNA 1GZWB 1SLLA 1CESA 3WV6A 2D6KA 1JW6A 3WOGA 4XIOA 3AX4A 1AXKA 4IQPA 3O0WA 1MS3A 1QOOA 3I4IA 1FYUA 4Y1XA 2R49A 2ZABA 5T5JA 3ZXLA 3V0AA 4XZPA 4UW3A 3MPPG 1G9DA 2A6XA 2D3SA 4XIKA 2D6MA 2WT1A 4AVVA 5IT6A 2V73A 3AP7A 1DYPA 2A3WA 5GZFA 2ZGKA 1UPSA 3WDUA 2JJ6A 2AR6A 1SLAA 1LGBA 5DUWA 5F9TA 2GMPA 2EXKA 4FPEA 1SLIA 1GYKA 1MS8A 4YGBA 5AVAA 3AP4A 1DQ5A 4BPZA 1QF3A 4XDQA 3AFKA 1FATA 4R9BA 1DYKA 5JOXA 4XHBA 1UKGA 1GKBA 1S0DA 2AREA 4HANA 3VKMA 1Q8PA 3ZXEA 2D6NA 5IK7A 2ZA9A 4P9XA 2AH2A 3NV2A 2XB6C 1IOAA 2OUHA 4FPKA 1SCRA 2DYCA 5H9QA 2D6LX 4CRQA 2E53A 3BIWE 3ZXFA 2DVAA 2WT0A 3AYDA 2ZGPA 1MS5A 3ILFA 4Q27A 3HMYA 1OFSA 5IK5A 1LHUA 2ZGUA 2P2KA 5DG1A 3QCWA 2CNAA 3ZYRA 2R0FA 4CTEA 4FP2A 1MVEA 1V6JA 3WHUA 2VH9A 1N1SA 2W08A 1V6IA 2GMMA 1RITA 4LBMA 1SLBA 2GALA 2ENRA 4Y22A 2VU9A 1ENRA 3WUDA 4JRAA 4K20A 4WV8A 1W0PA 2ZGLA 3R4UA 3VV1A 3WUCA 1ZM1A 2WSVA 1BYHA 2C5DA 3M3QA 2ZGSA 4NOTA 3VUOA 2ZMLA 1ULFA 1WBLA 1N1TA 3B01A 3IN9A 2EXIA 2HYKA 1VALA 3OBTA 4GKXA 1N47A 3ZSMA 1LHVA 2DVFA 4YLZA 1N3PA 3ZSJA 4YM1A 5EWSA 5CNAA 2NP0A 2NM1A 2YMZA 4LBLA 3N3HA 2NMOA 3WCRA 1NLSA 1SBFA 1PZ7A 1FX5A 4XTPA 5FREA 1APNA 2GN3A 3HR9A 2NMNA 1MS1A 1UZYA 2YZ4A 2P3JA 3KM5A 4HL0A 5GLUA 3A0KA 4FQZA 4OZXA 3WDTA 3OGGA 1C1FA 3RSJA 1N1YA 3PJQA 3WDXA 2UWCA 1W6NB 2YY1A 3AJZA 1I1EA 2VW0A 1LHNA 3NV4A 4Y22B 3N7JA 2WT2A 2C9AA 4YW5A 3VKLA 4BMBA 2ZGRA 1LTEA 3WDYA 3IPVA 3RMYA 3W59A 1B09A 1AF9A 1IS3A 1W0OA 2ARXA 1Q8SA 2GNTA 3N35A 3POWA 5DUXA 2ZGNA 1IKQA 3CNAA 3GNEA 4PF5A 4XXPA 3SH4A 4XBQA 3IKWA 3M1HA 1FV3A 3JU9A 1DQ1A 1I3HA 3RQ0A 1QDCA 1W6MB 1JYCA 2W52A 1WD4A 1ULDA 4L8QA 4Y20A 1HQLA 3MEPA 1OKQA 2DVDA 3MW3A 1AXZA 4YW1A 2ZMNA 5EYXA 3WDWA 4GXLA 1DLLA 5T54A 3N36A 4YW2A 4BLJA 4U36A 3SH3A 5T5LA 3FLPA 5GZDA 4XE9A 2P3IA 2ERFA 3AP9A 3ZXKA 2ZHKA 4DQAA 1C4RA 1V00A 1YIFA 4TYSA 3ILNA 4YM0A 1QKQA 3NV1A 4YFWA 4YZ2A 1WLWA 2PHRA 2YXSA 5IUQA 3PMEA 3POSA 5GLTA 4PBPA 1SBEA 1V6MA 2BQPA 3AXDA 4ZKTB 4YFZA 1G9AA 2I2SA 5HCAA 1LOFC 2FMDA 4ISRA 1GLHA 4XBLA 4XYXA 1AX0A 3VKOA 2DUOA 5H9RA 4FP3A 4YG0A 1SLCA 1YRZA 1WW4A 2D6OX 1G86A 3IPVB 4FPLA 1MS9A 4Y1VA 5T5PA 1G9CA 3AP5A 4XMAA 2LTNA 3B9CA 2DU0A 4LBQD 1SCSA 2GN7A 4DRVA 1YXWA 2W68A 4FOWA 5KXDA 1PZ9A 1W6OB 2JDZA 1VLNA 5CB7A 3FUQA 3C2UA 4M3CE 2CWSA 4F83A 1MZ6A 4PQ9A 2ZAAA 4GA9A 4Y20B 5L73A 2DTWA 4D69A 4TZDA 2JD4A 2DURA 3KQRA 1LEMA 3OY8A 2A3YA 4M3CA 2OVUA 2DVBA 3IM0A 3O5SA 1JHNA 2WKKA 1DFQA 1LENA 2P37A 3INAA 3ZVXA 1LU1A 3JUUA 3WZ1A 1SFYA 2E7TA 3AXEA 5KXEA 3N7LA 4FPCA 3M2MA 3USUA 3ASIA 4FVVA 2LALA 4WZFA 5GLZA 2NYYA 1OQ1A 2R1BA 4GKYA 4I30A 1S0BA 2EIGA 3D5OA 1LOCA 1AX1A 4DFSA 1LOGA 1WLDA 3MW2A 4PCRA 5T5OA 2VW2A 2UURA 5DG2A 2EALA 1W6NA 5JLVA 1WLCA 1KRIA 1MACA 4GWNA 1CQ9A 4RA0A 1CJPA 3V64A 4ISQA 1LGCA 2E6VA 3DUIA 2D7FA 3H0OA 1SLTA 2D43A 2GNBA 5GM0A 3WCSA 2ZGQA 5H9PA 3ENRA 1Q8OA 2A7AA 1VAVA 2Q5TA 3PVNA 4FPGA 4M00A 4YZ1A 2A75A 4C1XA 1RINA 1LGNA 3UK9A 1VIWB 1W6PB 1N3OA 2GDFA 4JC1A 3POYA 1S1AA 2GNMA 2ZGOA 1PZ8A 4Q8LA 5DUVA 1V6KA 1CIWA 1DQ0A 3OY8B 3AYCA 4M3CB 1W6MA 5DZEA 3D6EA 1GNZA 2UU8A 2D3RA 4XBNA 3AZYA 2PHUA 2OUJA 3V65A 3SISA 5SV8A 3UJOA 2H0BA 1ULGA 1YI7A 2EAKA 4M3CF 4XJZA 4Y26A 3USUB 4AVSA 4K1ZA 4SLIA 5KXCA 1WCSA 1Q56A 2A6VA 4M01A 1KQRA 2TEPA 4Z8BA 4BLIA 1HDKA 4FPFA 1DQ6A 2CYFA 2E51A 5CA6A 1WW6A 4YGDA 1FV2A 2VUAA 3OPZA 2WSUA 5JMCA 2EF6A 1CN1A 3SLIA 1Y7BA 4AGGA 1C1LA 4BOWA 4R9CA 5KXBA 2A71A 4LBKA 1GZCA 3FLTA 1JYIA 4FPYA 3ZSLA 3HN1A 3WNXA 3NV3A 5DZGA 1ENSA 4FOVA 5CAZA 3TAYA 3NWKA 1FNZA 2SLIA 4PBOA 1V6OA 1GNHA 2PHTA 1LHWA 4FOQA 4YGCA 2AGSA 1LOBA 3OYWB 2A6ZA 2DVGA 3RS6A 3Q9OA 2NN8A 3ZXJA 4Y1UA 3AJYA 1YYNA 4Q1RA 4RL7A 1W6OA 1S0EA 1A3KA 2A3XA 2A70A 2PHXA 2D6PA 1JN2P 2VW1A 3ILRA 1DHKB 4YG6A 3TB0A 1AJKA 3T1LA 1MS4A 4P9WA 3PVOA 1DIWA 1ULEA 4Q26A 1GBGA 3APBA 2EXJA 1QOSA 2WLQA 2VY0A 1U0AA 2YROA 1NXD1 3B3QE 3FLRA 4XHXA 4Y24A 5GLVA 1UAIA 2GNDA 2JE9A 4LBOA 4DPNA 5LK5A 1V6NA 4XJAA 1Q8VA 3MW4A 4K21A 1LULA 1Z0HA 4XJ9A 1H30A 1F31A 2JKBA 3WLUA 5CBLA 3SNMA 4ZXKA 1A78A 5JVVA 3M3EA 2FHRA 3BTAA 1BXHA 1S0IA 5E89A 1H9PA 5T55A 2AYHA 1QGLA 3T2TA 1DBNA 2B7YA 1WW5A 4YM3A 2G4IA 3AZZA 1JUIA 4DRRA 1AXYA 4LBQA 1UZZA 3WG3A 5GALA 1QOTA 5JOWA 1BQPA 1R1ZA 2ZGTA 1YO8A 1LU2A 2DUQA 3RRDA 4ATEA 2PELA 1G9BA 4XMIA 1CR7A 1LHOA 1IS4A 1C57A 3D4KA 1JOJA 1GSLA 2ZHNA 1LOFA 1WBFA 1W6PA 4FQ4A 2DWRA 4DS0A 2DV9A 1D2SA 1HQWA 1TEIA 1DQ2A 2ES3A 4BMEA 1F5FA 5BYNA 1XQNA 1F9KA 4XJWA 3ZYPA 4AVTA 1N1VA 3R4SA 2ZACA 1AX2A 1LECA 2PHWA 4WVWA 4XILA 3ZPYA 5GJ6A 1GANA 3OJBA 3L2YA 1W6QB 1S0GA 2CTVA 2E7QA 3WDVA 4UW4A 2V5YA 1URXA 2R1DA 1O4YA 2GMEA 3M3CA 2ZHLA 2WQZC 1BKZA 4Y1ZA 4AGRA 3O0VA 3PVEA 3R05A 1RIRA 1BJQA 3DGTA 2VXRA 2P3KA 3IMNA 4XOGA 2NZ9A 1D0HA 1LESA 1A8DA 2KM2A 4XJUA 4XJ8A 4UW6A 1LOEA 4LBQB 3WG2A 2DU1A 1MR5A 4H55A 3AYEA 3OBRA 3A0NA 3UL2A 5DUUA 3B00A 1N3QA 1X50A 1LJ7A 2XG3A 3T1MA 4ASMB 4YZ5A 3LSDA 3OYWA 5JDBA 4BQ1A 3N7KA 3WVJA 1JBCA 2W39A 1H9WA 1DGLA 3BODA 2Z42A 4YZ3A 4Q8KA 4CZSA 5GZGA 4P9YA 5HCFA 1DQ4A 2ZKNA 3N7MA 3ATGA 1JXNA 4W65A 2A5ZA 2R0HA 5F5QA 3V0AB 3O12A 4P14A 2A6YA 2UWBA 3AZWA 4AYUA 4U2AA 2UWAA 4GALA 3WG1A 2PHFA 3A4UA 2ARBA 5IK8A 5IK4A 2CWMA 3O0XA 5DXDA 3V0BA 1UMZA 2WNEA 4LBJA 4NO4A 1ONAA 1WW7A 1QMJA 3LCPA 1CONA 4FPJA 1HLCA 3AZXA 5DZFA 4BM8A 4YZ4A 1GV9A 1KDKA 3GALA 1AJOA 4Y1YA 4ATFA 4GWMA 1G7YA 1FNYA 4FPOB 1S0JA 2AENA 5H9SA 5GLWA 1IS6A 3B69A 3SH5A
chains in the Genus database with same CATH superfamily
4P5YA 2VGDA 1OQEA 1BCXA 2HWC3 4AFMA 2FDKA 1GWMA 5EHDA 1W9WA 3JQXA 4LHKA 5K0UB 3W58A 3LOIA 4J25A 4LEJA 4OQ9A 1UD1A 2BU9A 2ZBJA 4Q2FA 4HSJA 4TN7A 5FYUA 4MXWB 1UX6A 1UF2C 2EICA 1HB3A 3FX3A 3ZPOA 3AYAA 4XUPA 4IV3B 3KT7A 3MUZ1 3FFZA 3KF5A 1GZWA 4QXCA 3ZIWA 3OBZA 3CMGA 1ZRFA 1U5ZA 5EYYA 3DPRC 2SBAA 2FBEA 5EXOA 5G04L 3QLQA 3NW4A 1PGL1 1VB2A 2JE7A 1UL9A 4HETA 3VDCA 4AAXA 2HEYF 4K8RB 3V0BB 2WNOA 4MGSA 4N7IA 5FP8A 5C4WB 1QJX2 3HJRA 3PUIA 4ZPIA 3W5MA 1AVBA 1DGWA 1I5PA 2ETEA 2Q0AA 3FUOA 1BHGA 3GXUA 4IDZA 4FPHA 3NJVA 1D4M1 5FWEA 3O1MA 4AQTA 5DDJ3 3I2KA 1UYXA 3G7DA 3RDIA 1O3SA 1KJLA 1ZA4A 3IDCB 4MYEA 2DTYA 2YV8A 3ZFEA 2QDNA 2WWJA 4Y4YA 5HXVA 2BTVC 3A22A 5FZDA 5GZEA 3JBG1 4BB3A 3PUSA 4LHSA 4DIQA 1PMIA 2RDNA 2DUPA 2QCSB 2ZHMA 4D0QA 1L7RA 4NIDA 4YW3A 2XBO2 3KV6A 4R9DA 2D3PA 2BOIA 1DZQA 1CAXA 1AR91 2WNVB 1JYVA 3AK0A 1U5IA 1VRH3 3I8TA 4G9SB 2WZR2 4YARA 4CP9A 1MVQA 5JOYA 3W20A 5FMOL 4QHBA 4BJ0A 1XE0A 2XVGA 3DCQA 4H7MA 4RQPA 3ACHA 4MGYE 3AMPA 3WOGA 4O9EA 2XLGA 2HBTA 3CF6E 3O0WA 3K2OA 4Y1XA 2R49A 2J42A 3V0AA 3LDKA 4XZPA 3WNPA 3ABZA 1ULPA 2A6XA 2GAUA 2J1VA 2D6MA 3LGRA 3ZYGA 3KCCA 1J59A 4EYUA 1QH7A 1DYPA 3H8UA 4HOOA 5DAWA 2JDAA 4H7LA 3K3OA 4ES9A 1OPMA 1LGBA 1X82A 3JCIA 2AZ5A 1RGSA 3NJXA 4UBHA 2XQXA 5CFCB 3I3EA 2JDKA 1NCRB 1SLIA 1MS8A 5LY2A 3AP4A 1ZBE2 5I0UA 4R9BA 3RI8A 2RJLA 4XHBA 1UKGA 1GKBA 1S0DA 2AREA 4HANA 3ZXEA 1PO12 3ZYJB 2LUWA 4XCBA 1EAH1 1MEC1 1ND2B 4LOSA 2XB6C 5JXHA 1XRUA 2OUHA 1SCRA 2DYCA 4AEDB 1YQ8A 1H2KA 1W8OA 2RMU1 3VHRA 2ET1A 4CP2A 1MS5A 2E9QA 2PAKA 3J7NA 5IFTA 1LHUA 4KWJA 2ZGUA 3DYOA 1Y43B 4Y3OA 2CSGA 3IWZA 3LFMA 3ZYRA 4RS5C 2XLFA 1H8TA 2VH9A 1N1SA 1PGW1 2GALA 2VAUA 5CG8A 2P4EA 4AEMA 3NAPA 4QX7A 2XWBB 4JRAA 2XH6A 4N43B 1UMIA 4LO6B 4WV8A 5F6KA 1O3RA 5BNOC 3WUCA 5FBJA 3HT2A 2WSVA 3M3QA 3UYJA 1GOGA 4BK4A 2ZMLA 1W28A 1EUUA 1Z7S3 3EMRA 2RR12 3OBTA 4GKXA 4IW3A 3C3VA 3TYJA 2QZ3A 3ZSMA 4IE5A 5J09A 4KNCA 4HMZA 1R093 1W2AX 5FUIA 2XJRA 4YM1A 3OPWA 5DABA 5SV5A 5ABJC 5CNAA 1F35A 1OD5A 4AFBA 1WMEA 3OBAA 4JQTA 5BUVA 3RZHA 1LAJA 1OLQA 2OIIA 2AC1A 3S0MA 1A34A 1MQTB 1CD3G 3K4ZA 2FZ2A 4NN0A 3UKVA 1SBFA 1JZ7A 1ZRDA 1FX5A 2TNFA 5BPXA 3ORJA 2OT7A 2HWF2 2AEZA 2VO5A 3FN9A 4CEWA 4UAPA 4HL0A 1AR62 4QPGB 2QQKA 2IWGB 4NJ4A 2QQJA 3LA7A 1VBB3 1YFYA 1N1YA 4I0BA 4AHYA 1W6NB 4HK8A 1I1EA 1H8VA 2WDBA 4X8PA 2IXLA 2D93A 4E27A 1LHNA 4Y22B 2C9AA 2HBUA 3H50A 1XOYA 4LITA 2OX0A 3R6SA 4LE4A 1RUD3 4MZUA 2GNTA 1AF9A 3POWA 2J1SA 4MVTA 4NPLA 3W59A 3WF3A 2GP3A 3BPZA 3GNEA 4Q4X2 3E5XA 3SH4A 4XBQA 3OGVA 5FPXA 3OSDA 1FV3A 3JU9A 4OVEA 4ZHNA 4FFGA 1TZOA 3WNOA 4CPBA 1WD4A 4Y5Z0 3DPRA 2IFRA 3T2OA 5D21A 3WDWA 1IPJA 3TEWA 1QJFA 2H6CA 4GXLA 1ZZCA 3OG2A 2XJVA 3HNMA 1NLRA 5J1XA 3FLPA 2K2SA 3ZXKA 2IXJA 4FFIA 1V00A 4LQRA 4YM0A 1NUKA 4JGYC 1AR81 4R4XA 1W9SA 4IE6A 1F4HA 1ZRIA 3VBSC 3VL9A 4YZ2A 3POSA 5GLTA 3NL1A 5EPAA 5BNQA 3AXDA 1W8HA 2BQPA 2WYFA 4META 4AQ6A 4YFZA 2X29A 2I2SA 4ZKTB 1LOFC 2XJSA 2DCZA 4XBLA 5LA2A 1PK6A 1AX0A 4BQYA 3ZKUA 4BQ3A 4O61A 5FWJA 4XFAA 4FBFA 3D0SA 3OOXA 2D6OX 4J6GA 4OMDA 5FZBA 3AKRA 5T5PA 5JPNB 1G9CA 3VBRB 3AP5A 4XMAA 2H6BA 5LATA 4CDXB 4EN0A 1S55A 2DU0A 4LBQD 3RVHA 5FPLA 4DRVA 1JTZX 1NY72 4JV4A 5KXDA 1RXFA 3POFA 1QJY1 5JAXA 5C6CA 1VMHA 3FUQA 3H1YA 1JZ2A 3PU8A 1QJX3 4M3CE 2BBVA 3P1IA 3TN93 4Z2AA 1YFWA 2OZJA 1BBT1 1L3JA 4GA9A 5JCTA 2E7AA 3MZHA 4MHRA 4D69A 1FMD3 4TZDA 2JG9C 4DXZA 2QQWA 3OY8A 4M3CA 2DFBA 4OULA 1BMV2 2J1UA 1BLZA 3RJRA 5FUNA 2QQVA 3ZVXA 4EWDA 3RYPA 4E2QA 2XONA 3O7OA 2G9FA 3M2MA 2PYTA 3LQCA 5LBBA 1JH5A 3FC0A 4PDWB 2WZR3 4WZFA 1R081 4CVUA 4LNVA 2HWE1 5HBAA 2K46A 2NYYA 2EIGA 3OPTA 3D5OA 5K0UC 4AFDA 1K5JA 1NE6A 1KFXL 1O6UA 4OUMA 3ES1A 5A3NA 1UO9A 2Y6HA 2WO2A 4RHV2 5DG2A 4CXYA 4AFCA 5J37A 5LCWL 1PIV3 3A7QA 2W1QA 5FPBA 1CJPA 5DAPA 2E6VA 4HPKA 2D43A 2GNBA 5GM0A 3THDA 2ZGQA 5H9PA 3ENRA 2A7AA 3WCSA 5A70A 1VAVA 2Q5TA 4YZ1A 4DEVA 2UY9A 3UK9A 5C3RA 2BYVE 2QQMA 4XAEA 1L7QA 2GDFA 5FJKA 4JC1A 1XNBA 2ZGOA 4Q8LA 5FQ0A 1PZ8A 3CJIB 4MOAA 4RS5A 5KHGA 2VTFA 5I0TA 1ALYA 2RS11 2QNKA 2Y34A 3AYCA 4S2DA 2BGCA 2OKXA 4CU8A 5C4WC 3D6EA 4EWAA 4H2AA 2ZKLA 1BK0A 5I93A 3AZYA 4P5HA 3VN4A 2V5DA 3IIAA 1PO13 5BNOA 2OPWA 4CUGA 4UOJA 2JG8B 5SV8A 1YI7A 4Y26A 5F8PA 4DUWA 3PUAA 4PIXA 1KQRA 4B1LA 3UNPA 2Z69A 4Z8BA 3SXWA 3JZVA 4KL1A 2E51A 5ABJA 1OFNA 4YGDA 3I59A 1FV2A 3LDRA 4CCOA 3OF1A 4JGZB 4BOWA 4AI3A 2WNVC 5C3OA 3A23A 2XBO1 4V2WA 2ZX3A 3HN1A 3WNXA 2VOWA 3KV9A 1ENSA 2ZPXA 1R1A2 4GMP1 5CAZA 3ES4A 3H7YA 4D3WA 4E2SA 3FJSA 3LEMA 1JYWA 1V6OA 1GNHA 4FOQA 4YGCA 2WABA 2C24A 3MGUA 2A6ZA 2ZEYA 3ZXJA 3ZFFB 4XFFA 1AYM1 3Q8EA 4CDQB 1A3KA 3LDBA 4O7XA 2D6PA 1J3PA 2ZZQA 2RR13 5FPAA 1W3XA 4HVRA 5A32A 3ZSEA 5AC93 1MS4A 4P9WA 2HWB2 4HONA 5D2AA 1OQDA 3E6BA 2EIEA 5F2SA 1GBGA 3N9QA 3GBFA 4NHKA 4QQPA 5A7OA 3OGRA 5BNPB 5CFCC 3GBGA 4ZONA 2RDRA 1NCRC 1NXD1 3OB8A 3VBHB 3QOPA 4CU6A 2WFF1 3KMHA 1DU3D 3ZXDA 2RV9A 3ZFGB 4LBOA 1W2TA 5LK5A 4DO0A 1SMVA 1XNDA 2HWF3 4UFJA 2JDPA 1RUI3 2I45A 3I7DA 3PUQA 4Q0QA 1OPOA 4JX0A 1ND2C 1OKOA 2Z5WA 4AEDC 4CP0A 2FMYA 4N90A 4P9GA 1W9YA 2VNGA 4WZCA 4ZXKA 4Z92B 1A78A 5JVVA 2FHRA 1BXHA 4Q4W1 4BCUA 3H1WA 2AYHA 2WQ4A 3VBFC 2B7YA 1E5SA 3BYWA 3AZZA 3HD8B 1JUIA 4DRRA 5DAXA 2VVDA 4LBQA 3LFIA 3CEWA 1W3VA 2QQUA 1YO8A 4JGYA 4OYUA 5A3WA 4NROA 2VZVA 4V1PA 3RJ2X 3RRDA 4ATEA 2PELA 4D6SA 1HN1A 1G9BA 4Q4X3 5FZ0A 1IS4A 2CDOA 1C57A 4UFMA 1JOJA 3WF2A 1O8PA 1LOFA 1WBFA 2R072 4N43C 3PDQA 5D8AB 2FZ1A 2DWRA 2JDMA 4B8EA 1D2SA 5C8CA 4BMEA 1XQNA 4AI0A 3I2HA 1C3HA 1W8ZA 3PL0A 4HLTA 2ZACA 2HEWF 4WVWA 2D97A 3L2HA 2UY8A 1JZ5A 3ZPYA 1COV1 2B46X 2E33A 2F4PA 1JYTA 4ORFA 3T30A 2WUHA 3WDVA 1K3IA 2RS32 5DMYA 1URXA 4QX3A 1AYN1 2PAEA 1HB4A 4CDUB 4IEWA 3ELNA 3TOJA 3M3CA 4HN1A 4R52A 2WQZC 1BKZA 1MQTC 4Y1ZA 2JG9A 4AGRA 1ASJ2 4MX3A 3WX5A 3ZN6B 1XJAA 4QXKA 1H4HA 1TQ5A 2P3KA 4IEPA 4C91A 2ATFA 4W6XA 1LESA 1HRI1 4QPGC 4XJ8A 5LBEA 4UFLA 3T4VA 4Q5OA 3WG2A 3AVRA 2DU1A 2GC3A 2HH9A 2VBPA 4BIFA 1W8UA 1HV1A 4B4RA 1CWPA 5LY1A 4E9KA 4XF1A 1N3QA 4BXFA 2PLV3 5FP9A 3LSDA 1RUC1 4B1MA 1RMU1 4HVQA 5JDBA 1VBE1 4MO3M 4QKNA 5F5AA 5K0UA 3D82A 3I2IA 3LA3A 2EAAA 1OLMA 1KXGA 1OVSA 1B35B 1H9WA 3G6JB 3PIJA 4OHWA 3UGFA 3ZDVA 4CEYA 3AMNA 4P9YA 3VBOB 1DQ4A 5FYTA 2O1QA 5CIRA 3N7MA 5FK8A 1SQ4A 4FO9A 4KU7A 2A5ZA 4PF1A 2VZPA 4BU2A 5BNNB 5FY5A 5J7MA 1ZBA2 2A6YA 2OZ6A 1RHI3 4XABA 3WG1A 2PHFA 4AK3A 3A4UA 2ARBA 5IK4A 1FPN1 5DXDA 3V0BA 3DN7A 2Y33A 4LBJA 1ONAA 1WW7A 1IZ3A 3UKTA 4D7YA 3O1PA 1AL21 3K48A 2XOMA 1CONA 3LCPA 5FUPA 4NWVA 1XC6A 5C4WA 4AI2A 2Y6JA 2JXAA 3JB8A 5FZ9A 2RS51 4MGZE 4YZ4A 1GV9A 5FYHA 4BM8A 4B7EA 1RC6A 1LRHA 1FNYA 1OD3A 3B7MA 3FHAA 3I3QA 4FPOB 4K8FA 4RHV3 4XF9A 5F3IA 4YSFA 1JZ4A 5FZFA 3H42B 1IS6A 3GHNA 2VMCA 3T3YA 2BGOA 3B69A 4C1WA 3N9LA 3BOPA 3P3PA 1RUH3 2OW4A 4KBBA 4WVMB 5A3TA 3L9JT 2EVXA 2VBBA 3MYXA 5FY0A 1KJRA 2BVBA 2A6WA 5ACA2 3WQ7A 1GZ9A 3HQXA 3BCWA 2R16A 4XC9A 3VBRC 3ZN4A 5FXVA 1D4VB 5I0RA 2L9LA 2WNVA 1IHMA 3VD9A 4ZS2A 4R8HA 1J83A 1CPMA 4A7YA 2JECA 5J48A 1BZWA 1RUJ3 2OPKA 3WQ0A 1BEV2 1K5MA 1YQ2A 1POV1 2A1XA 4Q1PA 4MGIE 1GWLA 4OUSA 2ZMKA 3NKTA 4XF4A 1LOAA 4LLFA 5C71A 2P6HA 3MIBA 2QTWB 4HSLA 4UXAA 3NNFA 2ZX2A 4AEJA 2WA3A 1J1TA 2HLEA 4NVPA 3POIA 4AI8A 5JSPA 4UF0B 4D6RA 4Q0VA 1X9PA 3VLBB 3WG4A 1HXS2 1JU3A 5I91A 3GM8A 3SITA 3H7JA 1IS5A 3QD6A 4XTMA 1FT9A 1CPNA 1LEDA 1UN1A 2OS2A 4GIQA 2RM21 2V4VA 4XXAA 3I2FA 4LBNA 1RUG1 5T50A 5JXGA 4Q4V3 1POQA 5CFCA 2AUYA 3I3MA 2VZOA 1MZFA 4PDWC 1SACA 1MZ5A 1Z78A 2XUEA 1CX4A 3NMBA 5FYVA 4CUAA 2ZS6B 4IXLA 4OI4A 4JZRA 3B5LB 4KGGA 5JR2A 2VOVA 1UYPA 2WN2A 2R7EB 3BU0A 3IAQA 1DZRA 3SHRA 3VKFC 1ND2A 1JI6A 3RWNA 1XNKA 3RMXA 4CSWA 1NZCA 2DDUA 1T2XA 1X33A 1LODA 3VKNA 3VBFA 1RUF1 4JKMA 4GB31 1H1MA 2HWB3 3NRUA 1PVC2 4XIOA 1C8NA 3EHKA 3AX4A 3CJIC 1DGWX 2WIIB 3AL6A 2BUKA 3I4IA 5T5JA 2ZABA 3ZXLA 4Q29A 2WWUA 1VJ2A 2WYSA 1O5UA 2WC2A 1RUE2 2WS92 2HWD3 3C7OA 3MPPG 5FZAA 1ZZ8A 5CISA 1G9DA 4AVVA 2YG0A 4JVAA 1RTVA 4N43A 4S2GA 3WF0A 2J7MA 3AP7A 2A3WA 5GZFA 4DXSA 2UYBA 3EXUA 3VD3A 1SDDB 2JG8C 2JJ6A 1SLAA 1Y3TA 3O1TA 2GMPA 4E4SA 5A7WA 2Q8DA 4FPEA 4XUNA 2YC2A 2XL9A 2JEMA 4RD7A 5FZ6A 4YGBA 5AVAA 1DQ5A 5L36A 1OURA 1Q5OA 4UWDA 4LJHA 4WM8A 5F6LB 2YU2A 4Q4Y2 3VD7A 4JGZC 5IK7A 5CFDA 2K9ZA 2ZA9A 2Y0IA 4QQHA 4GH4B 5F3EA 5I8TA 5CADA 5IVCA 2AH2A 1H4GA 3NV2A 3QBQA 3NJZA 5I8SA 2D6LX 4CRQA 1GQPA 1UU5A 2E53A 2W91A 4AW7A 5KHIA 4J1WA 2XDVA 3WW4A 2DVAA 2WT0A 1QQP1 3AYDA 4KWKA 4H14A 1E5RA 3ILFA 4Q27A 2LRPA 5G05L 5K7PA 5IK5A 5KHKA 1MZEA 4QPGA 3ON7A 3QCWA 1JODA 1WWYA 2Z4FA 3LE0A 4I01A 3ZFFC 4CTEA 4CDQC 2BFUL 1NXMA 3LA2A 4BYYA 5A1LA 3TEYA 1NG0A 2YUEA 4AI9A 1XE8A 1YLLA 2PN5A 1WCQA 3EBRA 1BVVA 1REFA 4COVA 1RITA 1CZVA 2ENRA 3F2ZA 4Y22A 4OFGA 3WUDA 1ACCA 2RS33 2VOXA 5FMOS 2ZGLA 4O65A 1ZM1A 3MLKA 1BYHA 1OA2A 3VBHC 3AL5A 2DFCA 2R062 2WNUB 2RG4A 1WBLA 4L97A 3IN9A 1ASJ3 4YVWB 1VALA 3ZFGC 1F4AA 4QHOA 1O8SA 2QQOA 3ZSJA 1N3PA 1UW8A 3GBWA 1ND3B 5F37A 1YC61 3W21A 4B29A 4LULA 4UFIA 5HV0A 4EJRA 1W8TA 4LBLA 3RZMA 2AEYA 2PTMA 1PNFA 4G3YC 3WCRA 2R041 2VMHA 1VMFA 4DINB 3I54A 2WFPA 4LUMA 3HR9A 2VXJA 2XLAA 4GWJA 1I5ZA 1MS1A 1UZYA 1NA1A 2P3JA 2YZ4A 3E97A 3KM5A 5GLUA 3O1RA 2VC9A 3A0KA 3JBG3 1SZBA 3WDTA 3LIHA 3RSJA 4GZ9A 4BA6A 2UWCA 3H8RA 2VW0A 3ACLA 4CDWA 5D8AC 1X8EA 2G9ZA 3NV4A 1ZBA3 1PO22 2WZPP 5FO7B 2WWSA 2ZGRA 3VKLA 4E4HA 4A7ZA 1LTEA 3RYKA 3RZKA 4OLLA 3RMYA 4LA2A 3VBRA 1B09A 1IS3A 2ARXA 3VZNA 4MXVA 1YI9A 1OXCA 5B2GB 5DUXA 4Z82A 2ZGNA 3CNAA 1H2LA 4RR3A 1AR71 4EROA 3W5NA 2YFZA 4N53A 5LK7B 1CZSA 3TN92 1DQ1A 1O5LA 4E4DX 4XEZA 2QQPA 3RFRA 4QM9A 4CDUC 1FMD2 1ULDA 5JXJA 1JUHA 2ZTNA 1HQLA 1POV0 3MEPA 2DVDA 5I0DA 1AXZA 1O59A 4QX2A 4RGGA 5EYXA 2XGXA 4AQSA 4B7KA 1QY4A 1V0AA 5KHJA 1DLLA 1US3A 1VBC1 5T54A 4D7SA 4YW2A 3SH3A 1PM4A 4COYA 5ACA3 4DQAA 2ZHKA 4NPMA 1YIFA 4TYSA 2Q4SA 3KB5A 2XJTA 4LTAA 1QKQA 4YFWA 3WR0A 1OBNA 2YXSA 3B94A 3HNBM 5IUQA 4QD2A 1SG3A 2QBXA 1JOBA 2G9GA 4IEQA 2HWC1 1EAH3 1BEV3 1MEC3 4GD4A 3GZTB 3KWVA 4PDWA 5IATA 2Y6GA 2FMDA 4ISRA 5KR7A 4CCDA 4ZU5A 2DUOA 3FL7A 1SLCA 1B35C 1H0BA 4LXLA 4Z2WA 1PIV2 1WW4A 3H8XA 3IDBB 5FZOB 1G86A 3IPVB 4Y1VA 3VBOC 3K4AA 4KG0A 4TLGA 3MIGA 5EP9A 4DEQA 5BNNC 1SCSA 2GN7A 1YXWA 3O1SA 1W6OB 1ZYBA 4IGQA 1HXS3 3GHMA 4PI2A 5CB7A 1UY0A 3JB4C 3MF9A 2JIGA 4FT8A 1OLRA 3IMMA 5L73A 1OF4A 5ANQA 2J22A 3WEZA 2JD4A 1QJU2 2BDRA 4NAMA 1LEMA 5F32A 5FYBA 4IV1B 2DVBA 5DN2A 1GMMA 1V9U1 1GP4A 4AAPA 3OGJA 1DFQA 2P37A 2CGNA 4M4PA 5A7PA 4AL9A 2WL1A 3JUUA 5EJ3A 1P8JA 3WP5A 1Q3EA 4QU1A 4FPCA 2JG8A 1WMFA 5DDJ1 1SFPA 3HQRA 3WP4A 1UU6A 4FVVA 4YRDA 5FMBA 5KHHA 2VMDA 2XL7A 2IUWA 3H9AA 2OA2A 4QKBA 1ST8A 5GLZA 2GZWA 4C8DA 3BTXA 1OQ1A 2R1BA 5D1IA 4FFHA 3VDDB 4L9BA 4HK9A 1HJFA 1PVC3 1WLDA 3KT1A 5T5OA 2VW2A 4JKLA 4XAAA 4DXTA 5I0SA 4PJYA 5FZEA 4COZA 5C70A 3WY6A 1MACA 4GWNA 1CQ9A 3V64A 1VRH1 4ISQA 2W46A 4CP1A 2DCKA 2WS93 1RUE3 1ENXA 2YB7A 1NCQB 3POBA 5APAA 5C3SA 3BTZA 4QGLA 4MUVA 1CGPA 4FPGA 5JMOA 2A75A 1JS9A 1RINA 3PIGA 1DP0A 3LZZA 1UY1A 5A6ZA 4CDQA 5DUVA 5AC92 1GR3A 3VZJA 4ZY9A 4A45A 1DQ0A 5TSWA 1W6MA 2GC2A 5DZEA 2JE8A 3OTFA 1FOD2 2GC1A 4AHWA 4K3UA 2XVLA 3U4XA 4Q4Y3 2Q30A 2W0XA 2IXCA 3ACFA 2OUJA 3V65A 1AHSA 3WINE 4IESA 4COUA 2H0BA 1ULGA 2EAKA 3VBUB 3USUB 4DZGA 4HZFA 4AVSA 5FY1A 1WCSA 2H0VA 1Q56A 3ZFGA 3SCGA 3ACGA 4OQ8A 1RUI2 2VBDA 1TMF2 1YQ6A 4DUXA 4FPFA 2BNNA 1W05A 2ZAHA 2VUAA 3OPZA 2WSUA 5JMCA 2EF6A 1CN1A 2VZSA 4I0WB 3SLIA 1RJ8A 4OHYA 5FV3A 2A71A 1GZCA 3GJAA 3AC0A 2JENA 3ZSLA 3NV3A 2OQ6A 4KGQA 3T2PA 4FOVA 1FNZA 5B4XA 3BOWA 4PT6A 2VPVA 3JD73 3C7GA 4LE3A 3K46A 3OYWB 4DY5A 3Q9OA 3AB0A 4AHXA 4Q1RA 1S0EA 2A3XA 1CIYA 2A70A 2R063 1GWKA 1QHDA 2VW1A 3LF7A 3Q8CA 1DHKB 4YG6A 3HIFA 5E1RA 2VZQA 2C26A 3T1LA 3POEA 2VE1A 5D8AA 3U37A 5A3LA 1H6XA 4LA3A 1W39A 2VCMA 2YPJA 2EXJA 3APBA 1KGYA 4QB6A 4NE9A 3RZGA 1R64A 2BERA 2VY0A 4DXRA 4B4PA 3J7MA 4YW6A 4XFGA 3FLRA 1TG7A 1Z7S1 3B3QE 4Y24A 2ZXQA 3S7IA 3O14A 1YQCA 4XUQA 1R091 1SPPA 5EQUA 4DPNA 1V6NA 1ZZBA 2BEOA 2JD9A 1VRBA 1XU1A 1XNCA 2XMLA 3CU7A 2AACA 4K21A 5IHRA 1CAWA 1H30A 5LA0A 4JHZA 4YNIA 2ORZA 3K4DA 2XJQA 2JKBA 3MBWA 3KV5A 5CBLA 2BPA2 3SNMA 1CAVA 2HEVF 3WP3A 1PX3A 3ZN6A 1OT5A 3MFAA 2C4XA 4HG6B 4IEVA 3AMHA 3MIDA 1WW5A 1MPXA 1S2BA 5FO9B 1PO23 2W47A 1C8M1 2HWE3 4L11A 1XBFA 2VR4A 3KCYA 3DECA 1BQPA 3J8F2 3UKNA 5JOWA 1VBB1 1HRV2 2PLV2 2YHJA 2BNMA 1VMJA 4Y4RA 1PM7A 1WMDA 4W8JA 3D4KA 1DGRA 1GSLA 2ZHNA 5JPMB 1W6PA 2ZX1A 5F2WA 4FQ4A 2DV9A 4CU9A 1DQ2A 5EZWA 1RUD1 3IB3A 3O1UA 1OSGA 3UT0A 1UU4A 5BYNA 1YJLA 1N1VA 4YVWC 3SCHA 1AX2A 5BNNA 3MV01 4BK5A 4FXKB 3SMHA 1RHI2 3OJBA 3L2YA 1S0GA 2CTVA 1X36A 1JZ8A 1ND3C 3URFA 5ISLA 4BE3A 4A3XA 2J1AA 5FPUA 1W2UA 2ZHLA 2Q8OA 5FK7A 3ZX7A 1KRIA 4JRLA 2CGPA 2JICA 3ITQA 4IEOA 5FOBB 4PHZA 3IMNA 3IAPA 2NZ9A 3KVBA 1W0NA 5FZ3A 4CCJA 1A8DA 5T3NA 1KS4A 3C7HA 3ZR6A 4H55A 1IG3A 4EN9B 1RUH2 3I49A 3IIIA 4IV3C 3ZIXA 1LJ7A 2HKXA 1RXGA 2MEV2 1CAXB 3T1MA 4WVMA 1EV12 3PU3A 4CA9A 4YWAA 4P02B 1ODMA 2VG9A 4QKDA 4EZHA 3GCWA 1JBCA 5A33A 2BBAA 2W39A 2KD7A 1RUJ2 3AVSA 2WR9A 4RQPB 4Q8KA 2ZKNA 1QJU3 1O4TA 2B45X 3AFGA 4A44A 2W95A 3I3BA 5FZLA 2XQRA 3V0AB 3MIFA 2ARCA 1QJX1 3HT1A 4KMQA 2PQSA 2Y8KA 3SC7X 4AG4A 1L7LA 3AZWA 4OI2A 4CXWA 1UY3A 4XFCA 4X8NA 4F3JA 2VMFA 3FHIB 2CWMA 5FYYA 3ZMOA 4A2UA 4UF0A 1VBA2 2Y6FA 3LPFA 4MG2A 4AXOA 3TWIA 2F4LA 4BQWA 3THCA 1QMJA 1HLCA 1PMJX 1XYPA 2VULA 3GALA 5FMDA 1AJOA 4ATFA 2WO1A 4Q4V2 4E4ZA 1NLQA 3HWJA 5FFOC 3DKQA 1GP6A 5H9SA 3PVBB 4HT1T 1C1LA 1T6GC 1GOFA 2JDHA 2YGMA 5FYZA 2Q8EA 2C9KA 1FAYA 1W03A 4Y33A 2WZR1 1OH3A 4XUOA 2WO3A 5CKQA 4DNYA 4FOYA 1Y9MA 3CL1A 1YCIA 3K75B 2YDEA 1WCKA 1OA3A 4A41A 1GZTA 4EQVA 1HB2A 4E8CA 3DF0A 1S0CA 4HVOA 2JB8A 4AVCA 3AZVA 4QU2A 1KDMA 1UZ0A 1FI2A 2D44A 2QZ2A 5FAXA 4CE8A 1MS0A 4R9AA 1FOD3 1QNWA 3M3OA 4TXWA 1QH6A 2FDFA 1K12A 4BQXA 3NAPB 4XF0A 2XVKA 4ZS3A 3F95A 2P34A 5FP7A 4FAHA 1X8MA 5C7GA 3DKWA 5HCAA 2HWD2 2QDRA 4IV1C 4I0AA 1W6QA 4AGVA 3E6CC 2D5HA 1ZBE1 4AI1A 1EPWA 4LR4A 1W8WA 4UBGA 1HQNA 2X09A 5HPOA 3RG0A 1TMF3 3FBYA 2ZEXA 4FCAA 1C5HA 4IL7A 1YJKA 1RVF2 4ARXA 1NQDA 1PO11 2YBPA 2BNOA 4XFBA 3S57A 3KSCA 4JHTA 2JDUA 1AYN3 3WHTA 4FTSA 1CVNA 2CL2A 3RZLA 4NIGA 1VBD2 5CVRA 1OUXA 1VAMA 2YGLA 3VDDC 5E8AA 3V56A 5F7UA 1IQDC 3GZAA 5JOZA 1TME2 4KH9A 4N9IA 5A7SA 3LOBA 1QDOA 3UJQA 1C28A 3VBSA 1HRI3 1WD3A 2WA4A 4HKWA 3VZOA 1ULCA 4CXXA 5GZCA 1UNBA 2ZGMA 2O14A 4YW4A 4QDQA 1NCQC 1V6LA 2J1RA 4ITCA 5FRAA 1U5YA 3PLQA 1CESA 3C8XA 2D6KA 4QX8A 1EUTA 4A42A 1DDLA 1D7PM 1OMIA 1RMU3 4LKEA 3FWEA 4IQPA 4JTNA 1ZNPA 5F3CA 2XPJA 1QOOA 2BV4A 1FYUA 2G19A 3ALQA 1UCXA 4UFHA 3UV9A 2RR11 4W6WA 4UW3A 3P6BA 2D3SA 4XIKA 5FCCA 3U1XA 5LWBA 3WW1A 5A6XA 5IT6A 3TEXA 2ZGKA 1UPSA 4XFHA 1UOGA 3WDUA 3PTYA 4IE0A 2AR6A 3VBUC 5IWFA 2Y60A 1PGL2 1UY2A 2EXKA 4YVWA 2ET7A 1FPN3 1WA6X 2I07B 4QXBA 5IJRA 2B9VA 4XDQA 3AFKA 3U0ZA 2HWF1 1DYKA 5JOXA 1ND3A 1GP5A 1AR61 3DV8A 2RS53 3UGHA 4XQDA 3ETPA 3J8F3 1D4M2 1W2NA 4MSVA 1IOAA 1HRV3 4FPKA 4QWNA 4XCAA 3E5QA 3LKJA 1GQHA 1KS5A 3ZXFA 3KHCA 4M4RA 4BIOA 2Q1MA 3HMYA 3JBG2 3OCPA 4Y5SA 2YU1A 2F6BA 2PQQA 5JIUA 4HFSA 5DG1A 1PK6B 4CU7A 5B4NA 4MXWA 5CU1A 2R0FA 3GF6A 4FP2A 3UESA 1H6YA 1V6JA 1AR92 4E2GA 3FZ3A 4IV3A 4Q4X1 5FXWA 4QB2A 1V6IA 4LBMA 4FXGB 1SLBA 3KVAA 2FDJA 5FR3A 2XJUA 3QH6A 4K20A 1OI6A 1W0PA 5LA1A 2E63A 1QWRA 3VV1A 4KWLA 5IAVA 5AFBA 4LIVA 3D8CA 4A6SA 2C5DA 4P9IA 5C5TA 2GH8A 4NOTA 1WZXA 3U14A 2XJPA 3P3NA 1ULFA 3PNAA 1Q43A 2HYKA 4KQ7A 5M0TA 1N47A 1O7FA 2DVFA 4NUBA 4YLZA 1I6XA 3FFQA 1WGPA 5JI9A 4KWUA 3SKJE 5EWSA 2YPDA 2NP0A 2NM1A 2YMZA 5E6HA 2MPFA 4X6QB 5FY8A 2VUCA 3N3HA 2NMOA 3FBMA 2MEV3 1NLSA 1J84A 2VQ0A 1EV13 5FYSA 1PZ7A 4XTPA 2VUJA 5LW9A 5FREA 4BISA 4CDXC 5L9VA 5FYIA 5FPZA 2IFWA 3ZR5A 1QXRA 4FQZA 4JKKA 4OZXA 1EAH2 1MEC2 1IGOA 3RZZA 1C1FA 4MHUA 4EE2A 3PJQA 1OC1A 1NY71 2PHDA 3WDXA 4EN7B 2YY1A 4IEUA 2O0OA 2RMU2 2Z2SB 2VCBA 1S2EA 4HPKB 3D0JA 3N7JA 2WT2A 4YW5A 4BMBA 1ZRCA 2B9UA 1VPHA 3C7FA 1VAKA 2JDYA 3IPVA 4AF9A 1US2A 1ZA7A 1W0OA 4QKFA 5A1AA 3N35A 5FZHA 4NHYA 5A3PA 1VBA3 1UX7A 1IKQA 2W1SA 4PF5A 4XXPA 5FQ0B 1NE4A 2VNRA 3UETA 3M1HA 2EIDA 4AFAA 1PGW2 2P6CA 1BMV1 4OHXA 3THPA 1VE0A 5JSRA 2LW8A 3RQ0A 1CX1A 1JYCA 2XKPA 2W52A 1OOPB 1W04A 4JAAA 1HJGA 4BDVB 1G6NA 4LIUA 5JUVA 1NCRA 1OKQA 4YW1A 3DXUA 2ZMNA 5BNOB 3VD4A 1JZ3A 3QH7A 4IERA 4IV1A 2VJXA 5GKAC 3ZM8A 4IEZA 4BLJA 5T5LA 1NAEA 4XE9A 2WAAA 3AP9A 2QUOA 2TBVA 4QDSA 4BHPA 4RHV1 1S2KA 1KD7A 3BVCA 3ILNA 5EJZB 4AEDA 4E8DA 3I2GA 1TE1B 2IZWA 3NV1A 3CDZB 3ZOIA 2D5FA 2P3YA 4PBPA 1SBEA 1V6MA 2CAUA 2RDSA 1YEWA 2Y6KA 5FLJA 1GLHA 3VDDA 4JTOA 4FP3A 2PHLA 4YG0A 3H8OA 5FZMA 3S5AA 4RQPC 2W92A 4FPLA 4A4AA 3KHBA 2LTNA 2ZX4A 3BU7A 4FOWA 4NWWA 1NCQA 1PZ9A 3N9OA 2PAMA 2CDPA 4ASLA 3C2UA 5CYYA 2CWSA 3GJBA 3ME2A 1MZ6A 1RVF3 3LAGA 4Y20B 5L19A 2DTWA 5FBZA 2ZX0A 4AQ2A 2DURA 4XW3A 5K9YA 2LM3A 2A3YA 4HBNA 3ZYIB 3IM0A 1VBD3 2VMIA 3S30A 2ADDA 1UOBA 1LENA 4WM7B 3VZKA 1WA4A 2W94A 1LU1A 4H3WA 2VOKA 3TNQA 3MICA 2E7TA 3AXEA 1TME3 3N7LA 5KXEA 4CCCA 1MQTA 1HV0A 3I97A 5FDBA 4MLOA 3SEPA 2Y38A 3VBUA 1UQXA 3ASIA 3EYPA 3USUA 3BUCA 2LALA 1DF0A 4NIIA 1ZZ6A 2BWCA 1FXZA 2BGPA 2VZ1A 1R1A1 4KG8A 4AHZA 4RFRB 2R043 2VL4A 4HN0A 1S0BA 1XYOA 5IYYA 1AX1A 5FZ8A 1WLTA 5FP3A 1LOGA 5CKNA 3U07A 3CBNA 1W6NA 1AR82 2CHHA 3SEEA 1LR5A 2W3JA 1LGCA 3DUIA 1I9RA 2I74A 2XHNA 3LIGA 4JGYB 5AVPA 2VVEA 2NQYA 1WCDJ 1JHJA 1Q8OA 3JD72 3PVNA 2HWB1 4M00A 4BXSV 5BNPC 4LOTA 4FTBA 3WT3A 4NIAA 3I3DA 5A6QA 4FTEA 1VIWB 2X5IB 3OGSA 1PX4A 4LHNA 3H1MA 3POYA 5C8CB 3X29B 2KXLA 5FY7A 4BH9A 2IXKA 2QQLA 4QX5A 1W8NA 5L9RA 4IGOA 3CZJA 1QJY2 2UU8A 1AR73 1UWWA 1Y4WA 3CKHA 5J3UA 5L7OB 1X9TA 3KD4A 2PHUA 2TUNA 1E5IA 1BBT2 3J7LA 4KBZA 4XUTA 3SISA 1D4M3 1K45A 5FZ1A 5FXZA 3U75A 1KEXA 4K1ZA 4SLIA 2A6VA 4QB1A 1OHFA 4M01A 5JZGB 2X05A 2R30A 2WZ8A 4UI9L 4Q0PA 5C8WA 4W6YA 4LO8A 2CYFA 2P17A 2IVIB 3LEGA 5FKCA 3NNMA 4PLMA 4F8AA 1UOJA 1OUSA 2ORXA 1BK1A 2OQ7A 2V4AA 1Y7BA 4QDRA 4QHZA 5F39A 4A3ZA 4AGGA 1JYNA 5KXBA 3M3IA 3FLTA 4LBKA 1JYIA 1AR93 1RUOA 4FPYA 4I02A 5FOJB 3USSA 4LKDA 4Y5TA 2P5BA 5FYCA 1EY2A 5J96B 5JWPA 2D98A 1R082 5LBFA 2R071 2CAVA 2HWE2 2QE3A 3NWKA 4LK6A 4PBOA 5IFPA 2PHTA 4CDXA 4QGNA 1J3RA 1LOBA 3DEMA 2DVGA 4PI0A 3U11A 1X7NA 4Y1UA 3AJYA 4RL7A 2PHXA 4CEYB 2RJ2A 5IVVA 1JN2P 4AVAA 1IG0A 3TB0A 1AJKA 2RS31 4ONUA 4X6RB 3Q8FA 3MIHA 1ULEA 2GSYA 3PVOA 4Q26A 2J1EA 1UIJA 1U0AA 3VL8A 4ARYA 2FDIA 5KC6A 1ASJ1 1YNAA 2GH2A 2IXHA 3IZOA 5E16A 5GLVA 1UAIA 2RS12 4B4QA 2GNDA 4W4ZA 3LEIA 3OUJA 2Y6LA 1Q8VA 1V9U3 5C3QA 4QXHA 1LULA 4XJ9A 3TNPB 1REEA 5EJ1B 3ZO0B 2W1WA 2YBKA 5C9AB 1O3TA 2ILMA 2RMU3 1NOVA 1S0IA 4CPBD 1H9PA 4L0PA 4TLFA 4URTA 4ASKA 1QGLA 3T2TA 1DBNA 4LT5A 5JI7A 4XQ4A 2G4IA 1PK6C 1AXYA 2WQ8A 4XACA 1QOTA 1NX9A 1R1ZA 2ZGTA 4IE7A 2O8OA 4AEKA 1WKYA 4XMIA 1CR7A 1XYNA 3HAGA 4RN5A 3ZLIA 1LHOA 2WAOA 4NRPA 1K5MB 1ZBA1 3MI8A 3WQBA 5FY4A 5J36A 1REDA 2BJSA 4QMAA 1HQWA 3B9IA 5LBCA 1TEIA 3CJIA 3AKQA 1YFXA 3NVCA 4QT6A 3N4MA 2HYXA 3MV11 4ZU4A 3ZYPA 3MHZA 4LO4B 4AVTA 1AYM2 3VZLA 1EPZA 1BVP1 2FQPA 4DMIA 2VECA 1GANA 4MGKE 2E7QA 4NAOA 1YUDA 3S5QA 2QQNA 3WF1A 1U5XA 4LHLA 4XFIA 1GFF2 4EWEA 3BKZA 2X10A 2GMEA 5FZGA 2W87A 3WF4A 3O0VA 4HKLA 4YVSB 1RIRA 2WFF2 1BJQA 4XQWA 2BVVA 1NYWA 4JGZA 3KZ4C 5A6YA 5ACA1 4QPIB 3RNSA 2KM2A 2VTXA 4XJUA 3KGZA 4R4ZA 4UW6A 1DYOA 1YQ5A 1ULOA 5FKBA 4A7KA 3A0NA 5A3UA 3UL2A 2YFUA 3B00A 5DUUA 1BEV1 1X50A 3MO4A 3VHOA 3WSOA 4LO5B 4NMIA 5LA9A 4Q4W2 3CLPA 3IT8A 4I3PA 3WD5A 3WVJA 3ZFFA 2VQAA 3VBFB 1UXZA 4CYDA 4L92A 1DGLA 1U12A 2Z42A 1UYYA 3BODA 2JDNA 5GZGA 4MGTA 2X53S 3ATGA 4W65A 1HXS1 2NPIA 2XXZA 1SFNA 2W2IA 2WZEA 4BQ5A 1OOPC 1H2MA 2UWBA 5BNPA 4U2AA 2MHFA 2UWAA 3GCXA 4GALA 3VBHA 5ANNA 3ZXAC 2FDGA 1XNTA 3O0XA 4LK7A 4MV2A 1PNGA 1UMZA 1GUIA 2VZRA 3GZEA 1NKGA 4NO4A 5F3GA 1DCSA 1HN0A 1QJZA 4ES8A 3ZN5A 1EYBA 3ZXGA 1COV2 1XB9A 5A7WB 3J9SA 3AZXA 5LASA 4GWIA 2Y64A 5DZFA 2YC4A 3AMQA 2VD7A 1RYYA 4CCLA 4GWMA 3T4HB 2B39A 4WM8B 1AYN2 1G7YA 4QPYA 4BQ2A 3KGLA 1S0JA 2AENA 1QXPA 1IQAA 3T2QA 1AR83 5CFDB 5LZ6A 4HKOA 4OI1A 4N7UA 1CAUB 1UKRA 3TBDA 2ZEWA 4CCMA 4K6BA 1F2NA 4MADA 1SBDA 2CY6A 1WUVA 4COWA 3HQUA 1HRI2 1PVC1 1LCLA 2RJKA 1KITA 1IKPA 4IE4A 2DF7A 4QX0A 1C8M3 3N9MA 5FLIA 4FAGA 1QU0A 2V09A 5K8SA 1ZZ9A 1RUE1 2WS91 5FY9A 2VOTA 4IEXA 2VUDA 3AP6A 3CHXA 3T08A 1RUC2 3LPGA 3DL3A 1QJY3 4YM2A 3JQWA 1RMU2 3KQ4B 4NPRA 2WJSA 4UYBA 5E88A 1VBE2 4JDMA 5AFEA 2JWPA 1NQJA 1V70A 2IC1A 3SQOA 1Q8QA 4NRQA 1BBT3 4OHVA 4S2HA 4N9HA 5FXXA 1G9FA 5IVYA 5LB6A 5DAQA 3R0RA 4BWOA 3WW3A 4ZU7A 3E6DA 3B02A 4UW5A 1O4ZA 4WM7C 2ZZJA 4GH4C 4Q4Y1 3ZSKA 4CDUA 3PUHA 5F1RA 3MFCA 5T52A 3MUY1 3RZJA 3NQHA 1ENQA 1FPN2 5HCBA 3SCFA 3BTYA 1W90A 4XPVA 5LEKA 2QVSB 3WNMA 3WP6A 1AL22 1KFUL 1R083 2W1UA 3DYMA 1AZDA 4OCTA 4YGEA 2RS52 2RVAA 5L9BA 1GICA 3LSEA 3WNNA 4K1YA 1G8WA 1HKDA 1NA1B 3VD5A 2A73B 2VCCA 1YIPA 2WO7A 4JCKA 2C0ZA 1IPKA 4WVVA 5ERLA 3I2DA 2RHPA 1S0FA 2KR2A 5FPVA 3M7AA 4AWDA 2EXHA 1QNYA 3AMMA 4YG3A 1GZWB 1B35A 2YYOA 1SLLA 3JD71 3PMSA 3WV6A 1GQGA 1JW6A 2X5IC 4CDWB 5EIYB 2WNUC 3VBOA 5LRSA 2Q1FA 5C8CC 1AXKA 1MS3A 1WCUA 2R061 3OD4A 2OYZA 5C5UA 2VZTA 1HB1A 2RS13 1CZTA 2WT1A 5L7OC 4RR3B 3R4DB 2ADEA 4N53B 2V73A 2ZJCA 1H1IA 3B93A 4P08A 1UZWA 5CKMA 1O3QA 5K4LA 2CU5A 3AKPA 1CJDA 3OEBA 2BZDA 1LNSA 5DUWA 3T0DA 5F9TA 1JMUB 3WW2A 2XKOA 1GYKA 5JZGC 3RI9A 4BPZA 5IVBA 1QF3A 3ZFEB 5LEJA 1FATA 3J7HA 1ODNA 5FTTC 3GZUC 3GGLA 3PJYA 4CUCA 3VKMA 4YPJA 1Q8PA 2RM22 2D6NA 4P9XA 4G4FA 1W8FA 1WMXA 1RUG2 4GULA 5HXMA 5H9QA 4LUKA 2XBO3 4ET7A 3BIWE 2C1FA 2VQTA 4CP9B 2ZGPA 3TRSB 3RYRA 4GMP3 3ROUA 3ETQA 3LD8A 3ZDSA 1OFSA 1PO21 2G1MA 5A1FA 1D2QA 1DGRN 3OEAA 2P2KA 2VMEA 4BQ4A 2CNAA 3HVDA 3ST7A 4CEYC 4LKSA 1K42A 1MVEA 1PHMA 2VQUA 4CCKA 4OI0A 1AYM3 4KI5M 4LMFA 3WHUA 3MLLA 2W08A 2GMMA 4W50A 1PVXA 3TN91 1OF3A 3OD0A 4Q0UA 2VU9A 1ENRA 1RUF2 3RWKX 4GB32 4YYOA 1FMD1 2B8MA 3R4UA 4FSJA 2D40A 4P9LA 1YWKA 2W9XA 1TNFA 2ZGSA 4IETA 4N8MA 3K77A 2Q8CA 4JDOA 3VUOA 1GOHA 1N1TA 2WRAA 2EXIA 3B01A 3S6PA 2WFF3 1VB4A 1LHVA 1DG6A 2XWJB 1LKNA 3AKTA 4I2OA 1OOPA 1ZBE3 4NHXA 3WNLA 4XF3A 1VR3A 4IGPA 2OXBA 4FI9A 4PIYA 4DY3A 5C9AC 3ZYBA 1SEFA 5LRRA 4UFKA 4L99A 1J1LA 4Q4W3 3CZUA 1W9FA 1APNA 2GN3A 1O91A 2QQIA 4NR1A 2NMNA 4LPLA 1VP6A 1PIV1 4PLOA 1XSRA 3NKGA 1GNYA 3OGGA 3CO2A 1F8VA 1H8TB 5CEHA 2N7GA 1QEXA 3AJZA 1TVGA 2DBNA 1K5MC 3ECQA 1C5IA 4B3NA 1QQP2 5A80A 5A3MA 1S4CA 3LEKA 2JKXA 1NZIA 3WDYA 5IAXA 3NNLA 2Y0OA 1Q8SA 1QJU1 3VZMA 2V72A 4XZUG 5FYMA 3IKWA 4OZOA 2JB4A 4PQQA 2YC0A 4NHLA 3THTA 1COV3 3K51A 1I3HA 3HEIA 1QDCA 1W6MB 3EO6A 3IDEA 4GJYA 1UOFA 3HPNA 2WBKA 2PA7A 3J4UH 4L8QA 4Y20A 3A21A 1HIXA 1PMHX 3MW3A 4YVSC 1JZ6A 4NRMA 4C0BA 5FP4A 3N36A 4U36A 4XURA 4QPIC 4MH0E 4WM7A 4UT5A 5IVFA 1XNAA 2EA7A 5GZDA 2P3IA 2ERFA 4GH4A 2XUMA 4CEWB 1C4RA 4IEYA 4AOCA 1AR63 2VTXJ 3BPSA 1WLWA 1ZZ7A 2E31A 2PHRA 3PMEA 4SBVA 2XHKA 2R042 1G9AA 1DZTA 3I2OA 3AM2A 1ZVFA 4XYXA 1RUC3 5F5CA 3VKOA 5H9RA 5I8YA 1VBE3 2ZCWA 1YRZA 3HBKA 3N9NA 1AL0G 1MS9A 3NNGA 2B4KA 3PTRB 5AC91 3B9CA 4LLOA 4NIHA 1W9TA 2WN3A 3S7EA 2W68A 3EB7A 1H2NA 1FOD1 3EQEA 2JDZA 1VLNA 3MIEA 4IUGA 3WXPA 4RFT0 3SH5A 3FE5A 3LB9A 3RGBA 4F83A 3H3ZA 2Z79A 2X5IA 4PQ9A 2UYAA 2WNUA 2ZAAA 3DPRB 4AE2A 3HBZA 2F17A 3KQRA 4QGMA 4OHZA 3U4SA 2QJVA 3T0BA 2E32A 1AR72 2OVUA 5JR7B 3VDAA 1AL23 3O5SA 1RUI1 1JHNA 4HXCA 2WKKA 1TMF1 4XDOA 5L7OA 2VM9A 3C7EA 3INAA 4WM8C 1SPPB 2R32A 5F5IA 1J3QA 3WZ1A 1SFYA 3WQ1A 3ZYFA 1QXJA 1EP0A 5CFDC 1CAWB 3FHQA 3WNKA 2R6QA 5JZGA 1VBC2 4ZZ8A 1CAVB 1DLCA 2B42B 4ZXEA 4I30A 2YBSA 4GKYA 3CIHA 1LOCA 1STMA 4DFSA 3MW2A 3NNJA 2GC0A 4PCRA 2UURA 1RUNA 3KF3A 2EALA 3K3NA 3BB6A 2FCUA 3IDAA 1JU4A 5JLVA 1WLCA 3KS7A 4M0NA 3M70A 2VNVA 4J1XA 1D0GA 1HX6A 2ARAA 1SHWB 2RE9A 2VVFA 4RA0A 3ZMNA 3VHPA 2D7FA 2HWC2 3H0OA 1JYXA 1POV3 1QJEA 1OLME 1SLTA 4QAWA 2FCTA 4TSVA 4CUBA 1RB8G 4C1XA 5FLHA 2Y26A 3T09A 4O9GA 1LGNA 4RYDA 3AKSA 5C33A 1W6PB 5JSOA 4XETA 5KWRA 1N3OA 1XXNA 1XU2A 1AUYA 1S1AA 2GNMA 1V6KA 1PGSA 5JXIA 1CIWA 3OY8B 4M3CB 5FJHA 4D94A 2CGOA 1GNZA 5DPNA 3PHMA 3MF6A 4JDNA 5HV4A 4QX1A 2D3RA 3EJKA 1ZREA 4INDA 1T6BX 4XBNA 4NHMA 3CQOA 2MNGA 2RM23 3HN3A 1RUG3 3POJA 5FZIA 4KU8A 3VB9A 2BWAA 3H3UA 2W5FA 3NO8A 3UJOA 4M3CF 4XJZA 3O1OA 5KXCA 3VGIA 3JXSA 4WVZA 1V9U2 2BW8A 2DCTA 2ZEZA 3GDBA 2TEPA 4BLIA 1HDKA 2DBIA 1DQ6A 2BP6A 5CA6A 5DAVA 2BRTA 1WW6A 4D8MA 5KC5A 2DCYA 1NA1C 3J8F1 1F5JA 1GU3A 3IBMA 2IVJA 1HRV1 4R9CA 2PLV1 3VHNA 5DDJ2 5IVJA 5C9AA 1F15A 5DZGA 1TNRA 3KV4A 2PMWB 1UY4A 3TAYA 4WBBA 2SLIA 1XSQA 5FZOA 4CDWC 1RUF3 3POGA 1Y9QA 1LHWA 1JOPA 2CV6A 2LS6A 4GB33 5J98B 2AGSA 2P1BA 4MGQA 3ACIA 3RS6A 2NN8A 2BFUS 2VCAA 2NLRA 3MLJA 1YYNA 5A33B 4TTGA 2FD8A 1W6OA 3OUIA 3SKVA 4RS5B 1VRH2 4XVHA 3KT4A 3U10A 3ILRA 2PXJA 2LROA 4S2FA 1RHI1 4RR3C 2Q1ZB 4N53C 4Z07A 1DIWA 4QM8A 4DB5A 1XE7A 1QOSA 3UGGA 3BIEA 3Q8BA 3HNYM 3Q8AA 3KLSA 1E5HA 2YROA 4XHXA 4L2NA 4RSUA 2HJIA 4GMP0 3ZFEC 2JE9A 3ZYHA 5C3PA 1OA4A 5HI0A 4JQRA 4XJAA 2PFWA 4YW7A 2K0GA 3BALA 3MW4A 5IW0A 1Z0HA 5ABJB 3I59B 1ZX5A 3ZKYA 4F7ZA 1M06G 1F31A 4OMCA 4BZ4A 1RUH1 2ID4A 3KCXA 4FFFA 3FMGA 3WLUA 5A7NA 4YVSA 2MEV1 4AVBA 3M3EA 2C6SA 1EV11 3BTAA 3N9PA 5E89A 5T55A 1QQP3 4P9JA 4QPIA 4RGAA 4YM3A 1R1A3 1UXXX 3DXTA 5A3OA 2VMGA 1UZZA 3WG3A 5GALA 3I2JA 1UPIA 4GQ7A 1RUJ1 2KA3A 3T0AA 5BY5A 1Y9GA 2VNOA 3M8LA 1LU2A 2DUQA 4C90A 2QKDA 3RPQA 3E1F1 5FIXA 4DOUA 3U78A 5A32B 5FZCA 3NJYA 4A6OA 4DS0A 3PURA 4CCEA 4RGKA 2ES3A 5HCHA 1F5FA 1F9KA 4XJWA 1VBA1 1W2OA 3H3LA 3R4SA 4GAZA 1LECA 2J1TA 2PHWA 3HOBA 4GJZA 5BXXA 4D7TA 2JIJA 4I09A 3MPBA 3J26N 4PLNA 4XILA 5GJ6A 5IVEA 5CG9A 4EZ4A 1W6QB 5FZ7A 4UW4A 2V5YA 4LORA 4Q4V1 2R1DA 1O4YA 2BOJA 2E26A 2GU9A 3D3AA 1RJ7A 4Z1VA 1Z7S2 2GP5A 3PVEA 3R05A 4QPWA 4K7JA 5FO8B 4I3GA 4LO7A 3DGTA 2VXRA 1NT0A 1XPWA 4XOGA 1R092 3OUHA 4M0HA 2WLPA 3W9AA 1UIKA 4PIZA 1D0HA 3TEZA 3GYDA 5DQ0A 3P5BA 1LOEA 1ZRRA 3MDPA 4K9SA 4LBQB 4LKFA 4EV0A 1MR5A 3AYEA 3OBRA 5FZ4A 1H8TC 3NSTA 2O8QA 2QFEA 3VBSB 5KBFA 4XDPA 1CAUA 2XG3A 1W06A 2ZOEB 4OUEA 5FZKA 4V2VA 4ASMB 4YZ5A 3BGAA 3NAPC 2JX9A 3DYPA 1J58A 1UYZA 3OYWA 4BQ1A 3N7KA 4CCNA 5FMCA 5BV6A 2R073 1C8M2 2X8KA 4K40A 1UMHA 1UZVA 4AR2A 4QQOA 1OVPA 4YZ3A 5A7QA 4CZSA 1VBB2 2VZ3A 2HWD1 1H1AA 3LWCA 5EV7A 1YHFA 5HCFA 3E5UA 1JXNA 1OH4A 3BN6A 1IPSA 1SDWA 2R0HA 2XR4A 5CZKA 5F5QA 3VDBA 3O12A 4P14A 4DUVA 2VZUA 4D6QA 4AZZA 1HW5A 1RVF1 2DCJA 4AYUA 1LB2A 4EN6B 5IK8A 1RUD2 1M4WA 3M4FA 1E57A 4P00B 2WINB 3CJXA 1A6CA 4QQ2A 1YFUA 4TWTA 2WNEA 2JG9B 3BI3A 4EN8B 5EFUA 5JIAA 1VBD1 2B5HA 1VBC3 4FPJA 4QQLA 4ZZ5A 4CEWC 1KDKA 4Q0SA 3O1VA 4Y1YA 1TME1 2IXIA 2EIBA 2FCVA 2FDHA 1W99A 4URAA 4C0HA 3QACA 5GLWA 2WLQA 2RDQA 1RL3A 1A8MA 1QIQA
chains in the Genus database with same CATH topology
2VGDA 1OQEA 1BCXA 2HWC3 4AFMA 3JQXA 4LHKA 5K0UB 3W58A 3LOIA 4LEJA 1UD1A 2ZBJA 4Q2FA 4HSJA 4MXWB 1UX6A 1UF2C 3FX3A 3AYAA 4IV3B 3KT7A 3FFZA 1GZWA 3ZIWA 1ZRFA 1U5ZA 5EYYA 3DPRC 2SBAA 2FBEA 5EXOA 3QLQA 3NW4A 1PGL1 1VB2A 2JE7A 1UL9A 4HETA 3V0BB 2HEYF 4N7IA 5C4WB 1QJX2 1AVBA 1DGWA 2ETEA 2Q0AA 3FUOA 4FPHA 1D4M1 4AQTA 5DDJ3 3G7DA 3RDIA 1O3SA 1KJLA 1ZA4A 3IDCB 4MYEA 2DTYA 2YV8A 3ZFEA 2QDNA 4Y4YA 5HXVA 2BTVC 5GZEA 3JBG1 1PMIA 2DUPA 2QCSB 2ZHMA 4YW3A 2XBO2 4R9DA 2D3PA 1DZQA 1CAXA 1AR91 2WNVB 3AK0A 1U5IA 1VRH3 3I8TA 4G9SB 2WZR2 4YARA 1MVQA 5JOYA 5FMOL 4QHBA 2XVGA 4H7MA 4RQPA 4MGYE 3AMPA 3WOGA 4O9EA 2XLGA 3CF6E 3O0WA 4Y1XA 2R49A 3V0AA 4XZPA 2A6XA 2GAUA 3LGRA 3ZYGA 2D6MA 1J59A 3KCCA 1QH7A 1DYPA 3H8UA 4H7LA 4ES9A 1OPMA 1LGBA 1X82A 3JCIA 2AZ5A 1RGSA 4UBHA 5CFCB 1NCRB 1SLIA 1MS8A 3AP4A 1ZBE2 5I0UA 4R9BA 3RI8A 2RJLA 4XHBA 1UKGA 1GKBA 1S0DA 2AREA 4HANA 3ZXEA 1PO12 3ZYJB 2LUWA 1EAH1 1MEC1 1ND2B 2XB6C 1XRUA 2OUHA 1SCRA 2DYCA 4AEDB 1H2KA 2RMU1 3VHRA 2ET1A 4CP2A 1MS5A 2E9QA 2PAKA 1LHUA 4KWJA 2ZGUA 1Y43B 3IWZA 3ZYRA 4RS5C 2XLFA 1H8TA 2VH9A 1N1SA 1PGW1 2GALA 5CG8A 4AEMA 3NAPA 2XWBB 4JRAA 2XH6A 4N43B 4LO6B 4WV8A 5F6KA 1O3RA 5BNOC 3WUCA 3HT2A 2WSVA 3M3QA 2ZMLA 1Z7S3 3OBTA 3TYJA 2RR12 4GKXA 3C3VA 2QZ3A 3ZSMA 5J09A 4KNCA 4HMZA 1R093 2XJRA 4YM1A 5SV5A 5ABJC 5CNAA 1OD5A 4AFBA 1WMEA 5BUVA 1OLQA 2OIIA 3S0MA 1MQTB 1CD3G 2FZ2A 4NN0A 3UKVA 1SBFA 1FX5A 2TNFA 5BPXA 2HWF2 4CEWA 4HL0A 1AR62 4QPGB 2IWGB 3LA7A 1VBB3 1YFYA 1N1YA 4I0BA 4AHYA 1W6NB 4HK8A 1I1EA 1H8VA 4X8PA 2IXLA 2D93A 4E27A 1LHNA 4Y22B 2C9AA 3H50A 3R6SA 4LE4A 1RUD3 4MZUA 2GNTA 1AF9A 3POWA 4MVTA 3W59A 3BPZA 3GNEA 4Q4X2 3E5XA 3SH4A 4XBQA 5FPXA 1FV3A 3JU9A 4OVEA 1WD4A 4Y5Z0 3DPRA 2IFRA 3WDWA 1IPJA 2H6CA 4GXLA 1ZZCA 2XJVA 1NLRA 3FLPA 2K2SA 3ZXKA 2IXJA 1V00A 4YM0A 4JGYC 1AR81 4R4XA 3VBSC 4YZ2A 3VL9A 3POSA 5GLTA 3NL1A 5BNQA 3AXDA 2BQPA 4META 4AQ6A 4ZKTB 4YFZA 2X29A 2I2SA 5HCAA 1LOFC 2XJSA 2DCZA 4XBLA 1PK6A 1AX0A 4XFAA 4FBFA 3D0SA 4J6GA 2D6OX 5JPNB 1G9CA 3AKRA 5T5PA 3VBRB 3AP5A 4XMAA 2H6BA 4CDXB 4EN0A 1S55A 2DU0A 4LBQD 4DRVA 1JTZX 1NY72 4JV4A 5KXDA 1QJY1 5JAXA 5C6CA 3FUQA 3H1YA 2BBVA 1QJX3 4M3CE 3TN93 1YFWA 2OZJA 1BBT1 1L3JA 4GA9A 5JCTA 2E7AA 3MZHA 4D69A 1FMD3 4TZDA 2JG9C 4DXZA 3OY8A 4M3CA 2DFBA 4OULA 1BMV2 3RJRA 3ZVXA 4EWDA 3RYPA 4E2QA 3O7OA 2G9FA 3M2MA 2PYTA 1JH5A 3FC0A 4PDWB 2WZR3 4WZFA 1R081 4LNVA 2HWE1 5HBAA 2NYYA 2EIGA 3D5OA 5K0UC 4AFDA 1NE6A 1KFXL 4OUMA 3ES1A 4RHV2 5DG2A 5J37A 4AFCA 1PIV3 1CJPA 2E6VA 4HPKA 2D43A 2GNBA 5GM0A 3WCSA 2ZGQA 5H9PA 3ENRA 2A7AA 1ZRDA 1VAVA 2Q5TA 4YZ1A 2UY9A 3UK9A 2BYVE 2GDFA 5FQ0A 4JC1A 1XNBA 2ZGOA 4Q8LA 1PZ8A 3CJIB 4RS5A 5KHGA 5I0TA 1ALYA 2RS11 2QNKA 4S2DA 3AYCA 5C4WC 2BGCA 3D6EA 4EWAA 2ZKLA 5I93A 3AZYA 4P5HA 3VN4A 3IIAA 1PO13 5BNOA 2JG8B 5SV8A 1YI7A 4Y26A 4PIXA 1KQRA 2Z69A 4Z8BA 3SXWA 3JZVA 4KL1A 2E51A 5ABJA 1OFNA 4YGDA 3I59A 1FV2A 3OF1A 4JGZB 4BOWA 4AI3A 2WNVC 2XBO1 2ZX3A 3HN1A 3WNXA 2VOWA 1ENSA 2ZPXA 1R1A2 4GMP1 5CAZA 3ES4A 3H7YA 4D3WA 4E2SA 3FJSA 1V6OA 1GNHA 4FOQA 4YGCA 3MGUA 2A6ZA 3ZXJA 3ZFFB 4XFFA 1AYM1 4CDQB 1A3KA 2D6PA 1J3PA 2ZZQA 2RR13 4HVRA 5AC93 5A32A 3ZSEA 1MS4A 4P9WA 2HWB2 1OQDA 3E6BA 1GBGA 4NHKA 3GBFA 4QQPA 5BNPB 5CFCC 3GBGA 3VBHB 1NCRC 1NXD1 3QOPA 2WFF1 3KMHA 1DU3D 3ZXDA 3ZFGB 4LBOA 5LK5A 1SMVA 1XNDA 2HWF3 1RUI3 2I45A 3I7DA 4Q0QA 1OPOA 1ND2C 2Z5WA 4AEDC 4CP0A 2FMYA 4N90A 4P9GA 4ZXKA 2VNGA 4WZCA 4Z92B 1A78A 5JVVA 2FHRA 1BXHA 4Q4W1 4BCUA 3H1WA 2AYHA 2WQ4A 3VBFC 2B7YA 3HD8B 3AZZA 4DRRA 1JUIA 2VVDA 4LBQA 3CEWA 1YO8A 4JGYA 3RJ2X 4V1PA 3RRDA 4ATEA 2PELA 1G9BA 4Q4X3 1IS4A 1C57A 1JOJA 1LOFA 1WBFA 2R072 4N43C 5D8AB 2FZ1A 2DWRA 4B8EA 1D2SA 5C8CA 4BMEA 1XQNA 4AI0A 1C3HA 4HLTA 2ZACA 2HEWF 4WVWA 2D97A 3L2HA 2UY8A 3ZPYA 1COV1 2B46X 2F4PA 4ORFA 3WDVA 2RS32 1URXA 1AYN1 2PAEA 4CDUB 4IEWA 3ELNA 3TOJA 3M3CA 4HN1A 4R52A 2WQZC 1BKZA 1MQTC 4Y1ZA 2JG9A 4AGRA 1ASJ2 4MX3A 3WX5A 3ZN6B 4QXKA 1H4HA 1TQ5A 2P3KA 4IEPA 4C91A 2ATFA 4W6XA 1LESA 1HRI1 4QPGC 4XJ8A 3WG2A 2DU1A 2GC3A 4BIFA 1HV1A 4B4RA 4E9KA 4XF1A 1N3QA 2PLV3 3LSDA 1RUC1 1RMU1 4HVQA 5JDBA 1VBE1 5K0UA 3D82A 3LA3A 2EAAA 1KXGA 4OHWA 1B35B 1H9WA 4CEYA 3G6JB 5I0RA 3AMNA 4P9YA 3VBOB 1DQ4A 2O1QA 5CIRA 3N7MA 5BNNB 1SQ4A 4FO9A 4KU7A 2A5ZA 5J7MA 1ZBA2 2A6YA 2OZ6A 1RHI3 3WG1A 2PHFA 4AK3A 3A4UA 2ARBA 5IK4A 1FPN1 5DXDA 3V0BA 3DN7A 4LBJA 1ONAA 1WW7A 1IZ3A 3UKTA 4D7YA 1AL21 3K48A 3LCPA 1CONA 5C4WA 4AI2A 4NWVA 3JB8A 2JXAA 2RS51 4MGZE 4YZ4A 1GV9A 4BM8A 4B7EA 1RC6A 1LRHA 1FNYA 3B7MA 4YSFA 4XF9A 4FPOB 4K8FA 4RHV3 1IS6A 3GHNA 3B69A 4C1WA 3P3PA 3BOPA 1RUH3 2OW4A 4KBBA 4WVMB 3L9JT 2EVXA 3MYXA 1KJRA 2BVBA 2A6WA 5ACA2 3WQ7A 1GZ9A 3HQXA 3BCWA 2R16A 3VBRC 3ZN4A 1D4VB 2WNVA 1IHMA 4R8HA 4A7YA 1CPMA 2JECA 5J48A 1BZWA 1RUJ3 2OPKA 3WQ0A 1BEV2 1K5MA 4Q1PA 1POV1 4MGIE 4OUSA 2ZMKA 3NKTA 4XF4A 1LOAA 4LLFA 3MIBA 4HSLA 4UXAA 2ZX2A 4AEJA 2WA3A 1J1TA 4NVPA 4AI8A 5JSPA 4Q0VA 3VLBB 3WG4A 1HXS2 5I91A 3SITA 3H7JA 1IS5A 3QD6A 4XTMA 1FT9A 1CPNA 1LEDA 1UN1A 4GIQA 2RM21 4XXAA 5T50A 4LBNA 1RUG1 4Q4V3 5CFCA 2AUYA 1MZFA 4PDWC 1SACA 1MZ5A 1Z78A 1CX4A 2ZS6B 4IXLA 4OI4A 3B5LB 4KGGA 2VOVA 1DZRA 3SHRA 3VKFC 1ND2A 3RWNA 1XNKA 3RMXA 1NZCA 1X33A 1LODA 3VKNA 3VBFA 1RUF1 4GB31 1H1MA 2HWB3 1PVC2 4XIOA 1C8NA 3EHKA 3AX4A 3CJIC 1DGWX 2WIIB 2BUKA 3I4IA 5T5JA 2ZABA 3ZXLA 4Q29A 1VJ2A 1O5UA 2WC2A 1RUE2 2WS92 2HWD3 3MPPG 1G9DA 1ZZ8A 4AVVA 4JVAA 1RTVA 4N43A 4S2GA 3AP7A 2A3WA 5GZFA 2UYBA 3EXUA 2JG8C 2JJ6A 1SLAA 1Y3TA 2GMPA 4E4SA 4FPEA 2XL9A 2JEMA 4RD7A 4YGBA 5AVAA 1DQ5A 5L36A 1Q5OA 4WM8A 5F6LB 4Q4Y2 4JGZC 5IK7A 5CFDA 2K9ZA 2ZA9A 2Y0IA 4QQHA 4GH4B 5I8TA 5CADA 2AH2A 1H4GA 3NV2A 3QBQA 3NJZA 5I8SA 2D6LX 4CRQA 1UU5A 2E53A 4AW7A 5KHIA 4J1WA 3WW4A 2DVAA 2WT0A 1QQP1 3AYDA 4KWKA 4H14A 3ILFA 4Q27A 5K7PA 5IK5A 5KHKA 1MZEA 4QPGA 3QCWA 4I01A 3ZFFC 4CTEA 4CDQC 2BFUL 1NXMA 3LA2A 4BYYA 2YUEA 1NG0A 1XE8A 1YLLA 2PN5A 3EBRA 1BVVA 1REFA 4COVA 1RITA 2ENRA 4Y22A 4OFGA 3WUDA 2RS33 2VOXA 5FMOS 2ZGLA 1ZM1A 3MLKA 1BYHA 1OA2A 3VBHC 2DFCA 2R062 2WNUB 1WBLA 4L97A 3IN9A 1ASJ3 4YVWB 1VALA 3ZFGC 3ZSJA 1N3PA 1UW8A 3GBWA 1ND3B 4B29A 4LULA 4EJRA 4LBLA 2PTMA 1PNFA 4G3YC 3WCRA 2R041 2VMHA 4DINB 3I54A 2WFPA 4LUMA 3HR9A 2XLAA 1I5ZA 1MS1A 1UZYA 1NA1A 2P3JA 2YZ4A 3E97A 3KM5A 5GLUA 3JBG3 3A0KA 3WDTA 3RSJA 4BA6A 2UWCA 2VW0A 3ACLA 4CDWA 5D8AC 1X8EA 3NV4A 1ZBA3 1PO22 2WZPP 5FO7B 2WWSA 2ZGRA 3VKLA 4A7ZA 1LTEA 3RYKA 4OLLA 3RMYA 4LA2A 3VBRA 1B09A 1IS3A 2ARXA 3VZNA 4MXVA 1YI9A 5B2GB 5DUXA 4Z82A 2ZGNA 3CNAA 1H2LA 4RR3A 1AR71 4EROA 4N53A 5LK7B 3TN92 1DQ1A 1O5LA 4E4DX 4XEZA 2QQPA 4QM9A 4CDUC 1FMD2 1ULDA 1JUHA 2ZTNA 1HQLA 1POV0 3MEPA 2DVDA 1AXZA 4RGGA 5EYXA 4AQSA 2XGXA 4B7KA 1QY4A 5KHJA 1DLLA 5T54A 1VBC1 4D7SA 4YW2A 3SH3A 4COYA 5ACA3 4DQAA 2ZHKA 1YIFA 4TYSA 2Q4SA 3KB5A 2XJTA 4LTAA 1QKQA 4YFWA 3WR0A 2YXSA 3B94A 5IUQA 4QD2A 4IEQA 2G9GA 2HWC1 1EAH3 1BEV3 1MEC3 4PDWA 3GZTB 2FMDA 4ISRA 4ZU5A 2DUOA 1SLCA 1B35C 1H0BA 4Z2WA 1PIV2 1WW4A 3IDBB 1G86A 3IPVB 4Y1VA 3VBOC 4KG0A 3MIGA 5BNNC 1SCSA 2GN7A 1YXWA 1W6OB 1ZYBA 1HXS3 3GHMA 5CB7A 3JB4C 3MF9A 4FT8A 1OLRA 5L73A 2JD4A 1QJU2 1LEMA 4IV1B 2DVBA 1V9U1 3OGJA 1DFQA 2P37A 2CGNA 2WL1A 3JUUA 5EJ3A 3WP5A 1Q3EA 4FPCA 2JG8A 1WMFA 5DDJ1 3WP4A 1UU6A 4FVVA 4YRDA 5KHHA 2XL7A 3H9AA 2OA2A 5GLZA 2GZWA 1OQ1A 2R1BA 5D1IA 3VDDB 4L9BA 4HK9A 1PVC3 1WLDA 3KT1A 5T5OA 2VW2A 5I0SA 4PJYA 4COZA 3WY6A 1MACA 4GWNA 1CQ9A 3V64A 1VRH1 4ISQA 4CP1A 2DCKA 2WS93 1RUE3 1ENXA 1NCQB 4QGLA 4MUVA 1CGPA 4FPGA 2A75A 1RINA 3LZZA 4CDQA 5DUVA 5AC92 1GR3A 3VZJA 1DQ0A 5TSWA 1W6MA 2GC2A 5DZEA 3OTFA 1FOD2 2GC1A 4AHWA 4K3UA 2XVLA 4Q4Y3 2Q30A 2W0XA 2IXCA 2OUJA 3V65A 1AHSA 3WINE 4IESA 4COUA 2H0BA 1ULGA 2EAKA 3VBUB 3USUB 4DZGA 4HZFA 4AVSA 1WCSA 2H0VA 1Q56A 3ZFGA 3SCGA 1RUI2 1TMF2 4FPFA 2BNNA