3AZYA

Crystal structure of the laminarinase catalytic domain from thermotoga maritima msb8
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
251
structure length
251
Chain Sequence
EDWQLVWSQEFDDGVIDPNIWNFEIGNGHAKGIPGWGNGELEYYTDENAFVENGCLVIEARKEQVSDEYGTYDYTSARMTTEGKFEIKYGKIEIRAKLPKGKGIWPALWMLGNNIGEVGWPTCGEIDIMEMLGHDTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFSIEWDEDEVEWYVDGQLYHVLSKDELAELGLEWVFDHPFFLILNVAVGGYWPGYPDETTQFPQRMYIDYIRVYKDMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Laminarinase
publication title Crystal structures of the laminarinase catalytic domain from Thermotoga maritima MSB8 in complex with inhibitors: essential residues for beta-1,3 and beta-1,4 glucan selection.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 57
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.39: Glucan endo-1,3-beta-D-glucosidase.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3azyA00
2P2KA 1MZ6A 3BOPA 4GXLA 2WSUA 1NLSA 2DURA 1V00A 1UL9A 2OUHA 4BQ1A 4XDQA 2ZGRA 3N3HA 1G9BA 2R1BA 3ILRA 1DQ0A 3INAA 4YW2A 1BZWA 1S0FA 1AJKA 2PHUA 2PHTA 5H9PA 3RRDA 1S0DA 3IN9A 5GZGA 1FV3A 1WCSA 3VUOA 2UWAA 2D6NA 4HL0A 2V5YA 4FQZA 1YYNA 4R9BA 2XB6C 2DWRA 1D0HA 1JW6A 2OVUA 2A71A 1F9KA 1N3QA 4P9WA 4XHBA 2A5ZA 1CJPA 1WUVA 3PMEA 1KJLA 1QOTA 4M3CA 2NMNA 1ZA4A 3WCSA 4GKXA 2ZGUA 2VW2A 2ZACA 4XJ9A 4XJAA 4Y1ZA 3T1LA 3UJOA 4PBPA 4Q26A 4Q2FA 5KXBA 2E7TA 2WT0A 1U0AA 1JBCA 1G9FA 3FFZA 5DUXA 1F5FA 2YROA 4AVTA 1CR7A 5T52A 3WV6A 1MR5A 3B3QE 4XXAA 3RMXA 1S1AA 1LHVA 1WD3A 4P9YA 2D6OX 3WG3A 2ARBA 2AYHA 3JU9A 2ZGKA 1LOGA 3KM5A 4GWNA 2DV9A 2ZKNA 5SV8A 3AX4A 4XYXA 1UZZA 4ZKTB 1DLLA 3SH3A 1CIWA 1QDCA 1S0EA 1WLDA 2KM2A 4FPEA 3UK9A 5JDBA 1ULDA 1YI7A 3HMYA 2ZGLA 4GKYA 1RITA 1W0OA 4FPLA 4DS0A 4YZ1A 3D6EA 1N47A 1AXZA 1CPMA 2DYCA 4BM8A 4CTEA 2ZGSA 4ASMB 1BXHA 5DUWA 5KXCA 2PHRA 1LEMA 3ZSKA 2OW4A 1SFYA 3APBA 5GZCA 2P37A 1W6OB 2WNEA 5H9SA 3A0KA 4ZXKA 2YZ4A 4K20A 2ZMNA 4WZFA 4YM1A 5GZDA 3WUCA 3SLIA 1KRIA 3IPVA 3VKOA 2P3JA 3POYA 1ULGA 4BOWA 3FLRA 1LU1A 1VIWB 2VXRA 4FVVA 2H0BA 2TEPA 2NM1A 5FRAA 3WG2A 1QU0A 1QKQA 3AP4A 2GN7A 5H9RA 2WT2A 4Y1VA 5CNAA 2D3PA 1KITA 2DUPA 4PBOA 5IUQA 1MS5A 3M3OA 2D3RA 2YY1A 4YFZA 2A7AA 2CY6A 4UW4A 1V6NA 2EXJA 2JE9A 3BIWE 1XQNA 3M2MA 4LBKA 5GALA 4D69A 4YGDA 4C1WA 3I8TA 1Y7BA 1DGLA 3TAYA 1JOJA 3V0BA 1LODA 1LOFC 1QOSA 1DYKA 1S0JA 1C1LA 1W6OA 5DG2A 5DUUA 1LOEA 4NOTA 2VH9A 4LBMA 4U2AA 4W65A 2DU0A 1AJOA 3QCWA 2CYFA 4FOYA 3WHUA 5IT6A 1SCRA 5GZFA 4M3CF 4AGRA 4ITCA 2NMOA 4FOQA 2ZHKA 1UMZA 4YM0A 2Z42A 3WOGA 1IOAA 1HKDA 2FMDA 1GNHA 2YV8A 4FP2A 3FLPA 1IS4A 2AREA 4XTMA 2NZ9A 5DG1A 2E51A 1SLAA 3KQRA 3W59A 2UWBA 1HQLA 2AR6A 3ZSMA 4Q8KA 3ZSJA 4XILA 4XBQA 3SISA 4F83A 3ZXJA 2UU8A 4YLZA 1QNWA 3SITA 3AJYA 1QDOA 4LBQA 4MYEA 1B09A 1YXWA 2B7YA 3O0WA 4FOVA 3MPPG 5T50A 4AGVA 2OUJA 1RINA 1KDKA 2ES3A 2R0HA 3ENRA 3FLTA 4I30A 4Y20A 3A0NA 5GLUA 5GM0A 1SBFA 2SLIA 1URXA 2GNMA 2NP0A 1IKQA 1V6LA 2R0FA 4M3CB 4XTPA 1V6KA 1UZYA 4R9AA 3UJQA 1ULFA 3POWA 5DZEA 1FAYA 2ZA9A 1D2SA 2VW1A 2A6VA 2WKKA 5JMCA 1LULA 2W08A 1V6MA 1W6QA 3V64A 3B01A 1QGLA 3ZVXA 1W0PA 3AYAA 1S0IA 1ENQA 1LECA 1WBLA 2EIGA 3AK0A 2VUAA 3JUUA 3N7JA 1IKPA 4AVVA 5GLVA 3WUDA 1DBNA 1WBFA 1AXYA 1PZ7A 5GLZA 1HLCA 3U4XA 3V0AA 2UURA 2AH2A 2C9AA 2LTNA 5EWSA 1LHNA 1Z78A 1KDMA 2NN8A 3ZXEA 3FBYA 1KQRA 1AX0A 2JKBA 3OYWA 2DTYA 5CAZA 1DQ5A 1FATA 1QF3A 2DUOA 3RG0A 1OFSA 3O5SA 4YZ3A 3WG4A 3ZPYA 1LHUA 3NV1A 2A3WA 3LSDA 3ZXFA 2GALA 2ZZJA 5T5JA 2W52A 4YW3A 4XBLA 5HCFA 1YIFA 5EXOA 4K21A 4JC1A 4AYUA 2P3KA 5JOYA 2WQZC 4WVVA 1CVNA 4U36A 1GSLA 2DUQA 5F5QA 1Q8SA 3IPVB 1G86A 3AYDA 3ATGA 2P3IA 3AZYA 5JOXA 1QNYA 2GDFA 3AYEA 1IS3A 4ISQA 4DRRA 3VKMA 4M3CE 2EXKA 4LBNA 5CB7A 3VV1A 5DXDA 1GZCA 2DTWA 1H9PA 4YW5A 1H30A 1ONAA 2PHWA 2R16A 5DZFA 4XZPA 1ULCA 1DQ2A 3VKFC 1R1ZA 5DZGA 2A75A 4FPGA 4YFWA 3AZXA 1O4YA 4BLIA 4CZSA 3PVOA 1FYUA 1MS8A 2W39A 3V0BB 1UAIA 1RIRA 3AYCA 2AGSA 1G7YA 1LEDA 1MZ5A 3AZWA 3POSA 3ILFA 2D6KA 5E89A 2CWSA 3ZSLA 3AP7A 1G9AA 2ZMLA 1LOAA 5JLVA 1KJRA 4YZ2A 3WHTA 2EXIA 2ZGPA 4M00A 3WDUA 3B69A 3R4UA 3NV2A 1LTEA 4SLIA 4M01A 2LALA 1MVEA 1SLBA 2CTVA 2YMZA 2A3XA 1LESA 5FREA 4WV8A 1HDKA 3PJQA 3O0VA 2E53A 1ULEA 3AZVA 3RS6A 3OY8B 4LBJA 3WLUA 1Q8QA 4BMEA 4P14A 2ENRA 3RSJA 1DIWA 1VLNA 3WNXA 1A3KA 1PZ9A 1Q8OA 2UWCA 1IS6A 5T5PA 2BQPA 3C2UA 1LGNA 4AVSA 2ZHLA 4LBQB 2ZHMA 1BKZA 4KBBA 2D43A 5JOWA 1W6MA 2GNTA 4FPHA 1BQPA 4PF5A 3H0OA 3AP5A 3ZYRA 2DVBA 1N1YA 4XIKA 3DGTA 4Y20B 3M3EA 4R9CA 4BLJA 3ILNA 1S0BA 1Z0HA 3VKNA 2EF6A 3IM0A 4P9XA 2WLQA 5F9TA 4Y1UA 2FHRA 3OY8A 4Q1RA 2D6LX 2V73A 3ASIA 5DUVA 2ZGQA 3D4KA 2JECA 4GA9A 4YGBA 3W58A 2JJ6A 1UX6A 1UPSA 2A6WA 4FOWA 4JRAA 1DQ4A 2GMEA 3AXEA 5T5LA 1LJ7A 1SLTA 3N7LA 4XBNA 1IS5A 1SCSA 1W6QB 1JN2P 1N1TA 2A3YA 5JOZA 5KXDA 4LBLA 5EYXA 1GANA 3O12A 3ZXLA 1AX2A 4YG3A 3WDTA 1AZDA 3IKWA 5AVAA 1MS1A 1J1TA 1WLWA 1GZWA 3MW4A 5GJ6A 2D6MA 1C57A 3V0AB 2ZMKA 5T55A 4C1XA 1DHKB 4JCKA 1LGBA 4RA0A 1TEIA 1C1FA 3MW2A 3AZZA 3BODA 1ENRA 1W6PA 1YO8A 3OYWB 5T5OA 4Z8BA 5BYNA 2ZGTA 2YXSA 4YZ4A 1OQ1A 1OKQA 3HN1A 3OBTA 3WZ1A 4XJZA 3LSEA 1VAMA 2A70A 2P34A 2XG3A 4YW1A 4YW4A 1W6NA 3NWKA 1ZM1A 4YGCA 4XJUA 3WG1A 5L73A 2D6PA 1PZ8A 1LCLA 1MS3A 2SBAA 5E88A 2ZBJA 4FP3A 2WT1A 3WDVA 1BJQA 1JHNA 1F31A 1LOFA 2DVFA 3R05A 1WW4A 4IQPA 1UKGA 3GNEA 3USUA 4XIOA 3AXDA 2ZAAA 1A8DA 4GWMA 2GMPA 1WLCA 3N7KA 4GALA 4FQ4A 2HYKA 2R1DA 2JD4A 3MW3A 1SLLA 3I4IA 5IK4A 4XE9A 3WVJA 3R4SA 2EXHA 5HCBA 3WDYA 3WDXA 1BYHA 3AJZA 3NV3A 1G9DA 2ERFA 3HR9A 2VY0A 4ISRA 4UW5A 3PVEA 4YGEA 1MS0A 2CWMA 4YM3A 1LU2A 1UN1A 1JYCA 1CQ9A 3N36A 1AVBA 2WJSA 1SBDA 4XJ8A 1JYIA 1LOBA 1V6IA 4UW6A 3SH4A 1CN1A 1S0GA 1AX1A 4Q8LA 3FUOA 1Q56A 3ZYPA 2AUYA 1Q8VA 3D5OA 2CL2A 3IMNA 4CRQA 4Y1YA 3BTAA 2DVGA 1GLHA 4FPJA 4LBOA 2G4IA 3WDWA 1AXKA 4UW3A 3N35A 3T1MA 3UL2A 5GLTA 4Y24A 5GZEA 1SACA 4AGGA 1G9CA 1DFQA 1GYKA 1C4RA 1WW7A 1APNA 5IK7A 1Q8PA 4Y1XA 2ZGOA 3DUIA 5IK8A 4BPZA 3CNAA 1MS9A 2C5DA 1O4ZA 2ZGMA 4PQ9A 4DRVA 2DU1A 5LK5A 1WW5A 3OJBA 3B00A 1GKBA 2PHXA 1W6MB 3A4UA 3OGGA 2R49A 5JVVA 2GNBA 5H9QA 3B9CA 2CNAA 1I1EA 2AENA 2A6YA 1DZQA 2D3SA 2EAKA 4Y22B 4BMBA 1WD4A 3PVNA 2NYYA 5CBLA 3M1HA 3SH5A 1JUIA 1SBEA 2VW0A 3MEPA 5E8AA 1NXD1 1FX5A 1LHOA 2E7QA 1LGCA 4R9DA 1VALA 2PELA 3V65A 3RQ0A 4AWDA 5KXEA 2GN3A 2A6ZA 1MS4A 4FPCA 3QLQA 4RL7A 3L2YA 1VAVA 1H9WA 3T2TA 1HQWA 4K1YA 1GZWB 2Q5TA 3LCPA 3N7MA 1S0CA 3AP6A 1GV9A 4FPYA 4WVWA 4Y22A 3RMYA 3AP9A 2WSVA 3FUQA 2GNDA 4LBQD 5T54A 1LHWA 3M3CA 1FV2A 2D44A 1W6PB 3O0XA 4Y26A 1A78A 1LOCA 1FNYA 1GBGA 2E6VA 2VU9A 3NV4A 4L8QA 4DPNA 4ATEA 1V6OA 4Q27A 2W68A 4PCRA 4YZ5A 2JDZA 1W6NB 2D7FA 2ZABA 1CESA 1X50A 3OPZA 4XJWA 1DQ6A 1QMJA 4YG0A 4TZDA 4XMAA 1GNZA 2EALA 3M3QA 2A6XA 1DYPA 2ARXA 4H55A 1N3OA 5GLWA 3ZXKA 5CA6A 1WW6A 4ATFA 4XXPA 3OBRA 4YG6A 1N1SA 2DVAA 3AFKA 1JXNA 3WCRA 3USUB 1MACA 2ZGNA 2JE7A 1AF9A 1G8WA 1V6JA 2ZHNA 3GALA 4FPOB 4HANA 1N3PA 3TB0A 1CONA 2GMMA 1YRZA 4Q1PA 5HCAA 3VKLA 4TYSA 1FNZA 1MVQA 4XOGA 2PHFA 1SLIA 4YM2A 1QOOA 2I2SA 1LENA 3SNMA 4DFSA 4DQAA 4OZXA 4XMIA 1CPNA 1GZ9A 1I3HA 4FPKA 4XHXA 4FPFA 4K1ZA 1EPWA 1DQ1A 5EYYA 2RHPA 3Q9OA 1ENSA 1SLCA 2DVDA 1N1VA 4NO4A 1GICA 5IK5A
chains in the Genus database with same CATH superfamily
1F15A 3NW4A 2DURA 2E33A 1V00A 2Y6FA 1HJFA 4FAHA 2ZGRA 1G9BA 1PK6C 5A70A 2C24A 3THDA 1P8JA 2GP3A 1HXS2 3MHZA 2H6BA 3RZZA 1JODA 2PHTA 5H9PA 3VBUB 2WUHA 3DYMA 2X29A 2D5FA 1S0DA 2BEOA 3RRDA 1IHMA 1WCSA 4NIAA 1RMU3 2D6NA 3HNYM 2YU2A 3WQ0A 3ZMOA 5BY5A 3VBFC 4FQZA 2XB6C 1KEXA 3VHNA 5D1IA 5HBAA 1BBT1 4Z82A 1Z7S2 5HPOA 1PIV3 4YSFA 3LPGA 1NLRA 3ZYHA 3PMEA 5D2AA 4DXTA 3WP6A 3H8UA 4XUNA 1NUKA 2E9QA 3R4DB 4D6QA 1ZA4A 4GKXA 2ZACA 1PX4A 4Q26A 1OLRA 4Q2FA 5CFCC 5KXBA 4OQ8A 4NJ4A 4FFIA 5JXJA 1U0AA 1G9FA 3LWCA 3E97A 3K3OA 1F5FA 2QJVA 3FHIB 2QQOA 4AFDA 3JXSA 4QXBA 1J84A 5T52A 3GYDA 2HEVF 3B3QE 2D40A 3FBMA 5A7NA 1V9U3 2Y0OA 3RMXA 1S1AA 4P9YA 5C9AC 1TNFA 4GWNA 4CEYC 4JGYB 1LOGA 4EJRA 4UFKA 3AX4A 4DUVA 1DGRA 5A1LA 1IPJA 1DLLA 4LXLA 2BU9A 4FPEA 1OKOA 3UK9A 1YI7A 2OQ7A 2ZGLA 4DS0A 5FY0A 5D8AB 1N47A 4CTEA 4BM8A 1W8HA 4ASMB 4I3GA 1W03A 5DUWA 2W1QA 5FY1A 1RHI3 1ALYA 2PHRA 3SQOA 1ASJ1 1K5JA 5DMYA 3MIGA 1HV0A 3CQOA 3FJSA 1SFYA 2P37A 1IPKA 3AKQA 2LRPA 4JQTA 4MH0E 2XMLA 3VHPA 1US3A 4A2UA 3A0KA 1ND3A 2VOTA 4ZXKA 1AL22 5A7SA 5GZDA 4YVWB 3SEPA 5FQ0A 3SLIA 3VBHB 3IPVA 3H7JA 4HMZA 5EJ1B 5K4LA 3VKOA 1JYVA 1PO11 1ULGA 2RG4A 4CXXA 2X05A 3MYXA 1JU4A 4FVVA 3RYKA 4MO3M 4GIQA 1OUSA 3WG2A 2DFCA 1XNCA 2WT2A 5K0UA 1ODMA 3KGZA 5CNAA 1KITA 1PO23 5C8CB 1NCRA 1QJX3 2YY1A 3M3OA 4UFIA 2A7AA 4YFZA 4FT8A 2QQKA 4R4ZA 1YI9A 3GZEA 1RUC1 4LBKA 2R043 4YGDA 4NN0A 3TAYA 3V0BA 3HAGA 5JMOA 1LODA 1QOSA 2VZ3A 3P3NA 4PIXA 3QACA 1DYOA 4Q4X2 1MQTA 1K42A 1VBB1 2WL1A 2FDHA 2C9KA 2ZXQA 1RJ7A 2XJUA 4YRDA 2RR13 2Q8DA 4DRRA 4MLOA 5F1RA 3ACHA 4LBMA 4XF9A 1BMV2 4ZS3A 2R073 5F32A 3B7MA 2XONA 5EQUA 3SC7X 1XNTA 3FMGA 1I9RA 2DCTA 3KT7A 4FOQA 4IE4A 4AGRA 4J1XA 4LHKA 4W6WA 3E6DA 5A32B 4AEDA 4DUWA 2RJLA 1MEC3 2FMDA 3OGVA 1GNHA 1H2KA 4DY3A 1PM7A 2BNMA 5IYYA 4DEVA 2E51A 1HRV2 3ZN6B 1R082 1POQA 5FMCA 3W59A 2JB4A 1AL0G 4CDXA 4Q8KA 2VULA 4F83A 1J3RA 1UKRA 3GBFA 1QNWA 4NUBA 3TOJA 5JI9A 1ZVFA 1RVF1 2B7YA 3T4VA 4AGVA 5T50A 2Y34A 2QBXA 3PUSA 4R52A 4EROA 2R0HA 4I30A 4Q4V1 3GCXA 5GLUA 5KHJA 4OFGA 1W9YA 3RGBA 4AQ6A 5FP4A 1YWKA 1L7QA 3KLSA 2NP0A 1V6LA 1V6KA 4KBZA 1UZYA 2WZPP 5JSOA 2Q1MA 3PU8A 5K7PA 2WO3A 3D0SA 1RUG1 2ZA9A 4JTNA 3O1PA 2MEV2 1D2SA 5JMCA 1UXXX 2TNFA 4I3PA 3UGGA 1S2KA 2HWB2 3EHKA 4OI2A 1M4WA 4OUEA 4ASKA 4CCLA 5BNQA 1LULA 1RUH1 1HB4A 1XB9A 4UAPA 5C33A 3AL6A 1BBT2 5A80A 4IV1A 2VMFA 3ZVXA 1UOJA 2BGCA 1O59A 4H7LA 2EIGA 3ZFGC 3AK0A 2VUAA 2G19A 3MF6A 3MFCA 3GBGA 2X5IA 3WF3A 3L9JT 3WUDA 4AVBA 4EE2A 1WBFA 1AXYA 1R64A 5ANQA 2UURA 2C9AA 5LY2A 2QKDA 4QPIC 3PUAA 1UU6A 4C0HA 1CAXA 4JGYC 3O7OA 5ANNA 4QXHA 3OYWA 1W2AX 3UESA 2DTYA 5CAZA 1ZYBA 3DYOA 1CJDA 3OPTA 4NIIA 3BIEA 3LA3A 3O5SA 1O91A 2QQMA 2YB7A 4MADA 1H4HA 5L7OA 4LR4A 5D8AC 3DXTA 4HSJA 3PJYA 5DAWA 4LKEA 4AYUA 2QQWA 4B4RA 2J1EA 3N4MA 4FBFA 1XSQA 2WQZC 3KQ4B 4AHZA 2G9ZA 3J4UH 2QQIA 4RYDA 2BVBA 1AL23 2Y6JA 1RUD2 1G86A 1Q5OA 1VBD1 1X33A 3AYDA 3ATGA 3CLPA 4S2HA 4JKKA 1QNYA 1OPOA 5CKQA 1ZBE3 4OZOA 1VP6A 4D0QA 4O65A 4YVWC 3GXUA 2VVFA 1ZZ7A 5FYHA 3WNKA 5CB7A 1ASJ2 1NA1A 2HBTA 2DTWA 1UZWA 3CEWA 3POBA 5E16A 3PUQA 5DZFA 3VBSB 4JHTA 4LO6B 5KHHA 4QXCA 4CP9B 5A3MA 3N9PA 2J22A 4DXSA 1RTVA 3B5LB 3AZXA 4CZSA 5C71A 1O3QA 2W39A 1MS8A 3LZZA 4XUPA 1HQNA 5FZ0A 1G7YA 4QPGB 1PO12 5CKNA 4QX3A 3HNMA 2CWSA 5E89A 3VDAA 2YFZA 3CJXA 4Q4X3 1O4TA 1W04A 1PK6A 4NPLA 3WHTA 2EXIA 4M4RA 2Y33A 1YFXA 4SLIA 2HH9A 1ZX5A 2B8MA 1SLBA 2GC1A 2YMZA 4HFSA 1ZBA1 4WV8A 5FMOS 3PJQA 4AFMA 4ZZ8A 3VBFA 1UOFA 5C7GA 4DZGA 1D4VB 1MZEA 5BPXA 2NPIA 1VB2A 5JXGA 1QJFA 3AMPA 4MSVA 1VBB2 1XYNA 3H3LA 4QKDA 5FK8A 3VBOB 3WLUA 4BMEA 2ARAA 3K2OA 1PMHX 1CIYA 2HLEA 2BJSA 2Y6LA 5T5PA 1IS6A 3VGIA 3C2UA 1LGNA 4XFHA 2WZR3 4KNCA 4GWJA 4LBQB 5BNOB 5CFCA 3C8XA 4FPHA 3WQ7A 2EVXA 3H0OA 1VMHA 3IAPA 3POGA 3AP5A 3BALA 4KWJA 1N1YA 4Y20B 1VRH1 1K5MC 2B46X 4Z1VA 4EV0A 3H7YA 4HK9A 3IM0A 4QX5A 1WA6X 3U14A 4XQDA 4XCAA 3OY8A 4LO8A 2JDUA 4Q1RA 4XFFA 5DUVA 5LA2A 1EY2A 4MGIE 2P5BA 4KWKA 5A7QA 4YGBA 5FLJA 2DCZA 4XDPA 2JJ6A 4CEYA 1OD3A 1RVF2 5FZ8A 2YG0A 2N7GA 4M0NA 4PI2A 4CDUB 4PT6A 4XBNA 4ZU5A 5FZHA 5JWPA 1OH3A 4Q4V2 1EUUA 1O3SA 4HKOA 4P9IA 2HJIA 1JS9A 3O12A 3WDTA 2XKOA 3ZKYA 4GMP1 2RJKA 2AC1A 2RJ2A 4BCUA 1GZWA 1DG6A 2OPKA 1RUG2 2D6MA 3N9QA 3V0AB 5CEHA 4OHYA 1RGSA 2ATFA 1ULPA 3VZMA 4A44A 4CU9A 1TEIA 1RUH2 2JX9A 2RM21 1C1FA 4RN5A 3FFQA 4P08A 5DDJ1 1W6PA 2JDNA 3ZXDA 4AEKA 4BXSV 3M7AA 4DO0A 5BYNA 2ZX4A 4Y4RA 2I07B 4E4DX 5JSRA 1VAMA 4HKWA 2FCTA 2XG3A 2RDQA 3OBZA 3LB9A 1W6NA 3NWKA 3IIAA 1ZM1A 3WW1A 3BOWA 2WA3A 3WG1A 4EN7B 2Y6HA 1LCLA 1MS3A 1JZ6A 4AF9A 4HXCA 4K6BA 1W2NA 3DKWA 4X8NA 4FP3A 4LHNA 3R05A 4X6QB 4PIYA 3E6CC 5C3SA 4XIOA 3AXDA 3SKVA 2ZX3A 2ZAAA 3JQXA 1A8DA 4UBGA 4GWMA 3WNOA 5JIAA 4CDQA 2JD4A 3UKNA 1ASJ3 4G3YC 3I4IA 4CEWA 2VOVA 3FHQA 1NQDA 2B45X 3OOXA 1KXGA 3WDXA 1TZOA 2ET1A 3GF6A 5FK7A 3LOBA 3AJZA 3ZR5A 1RUF2 2XJVA 4D8MA 5FOBB 1H0BA 4KG0A 4UW5A 3PVEA 5EZWA 5J96B 1VBD2 4YM3A 5C6CA 2R061 2XJQA 4WZCA 1JYCA 2HWC1 3N36A 1CAVA 2WJSA 1LOBA 4UW6A 4QPGC 3GZAA 3JQWA 2W46A 4GH4B 1S0GA 4I0WB 4QX0A 3FUOA 3MIFA 3P6BA 1DDLA 2J42A 1Q8VA 1FXZA 1XOYA 4CRQA 4HETA 5IVYA 2K0GA 2DVGA 3WNNA 3TNQA 3ZYFA 2BYVE 1RUC3 1BHGA 2VZUA 3UL2A 1JI6A 1R092 4AGGA 2FDIA 4D94A 5LBCA 2D5HA 1DFQA 1OHFA 1WW7A 3KWVA 1Q8PA 5I8SA 4Q4W2 3NNMA 3VBOC 2VMHA 1MS9A 2DU1A 2XVKA 4LEJA 4A3ZA 2DDUA 1ZBA2 1GKBA 1ND2B 5FJKA 1W6MB 4XFAA 2IWGB 4URTA 4BA6A 1UW8A 4A45A 2R49A 2EA7A 2QFEA 2GNBA 3FHAA 3NRUA 4YWAA 2CNAA 2DFBA 2AENA 3RYPA 2XLFA 2D3SA 2RS11 3T30A 4AVCA 4NPMA 2WABA 2WFF1 5LATA 1O8SA 2YHJA 4MOAA 3RZLA 3SH5A 2J1VA 4Z92B 1JUIA 1SBEA 2LUWA 2EICA 3LF7A 4OULA 4B1LA 3OD4A 1FX5A 3OTFA 1RVF3 3PURA 1LGCA 4QPIA 1VALA 3BN6A 3V65A 4AWDA 5KXEA 1CGPA 4JGYA 2ZPXA 4FO9A 1VRH2 2BV4A 3K48A 4YARA 2QTWB 3M4FA 4Q4V3 2HWD1 3RWKX 4E2QA 3SCFA 3T2TA 1HQWA 4AW7A 4FPYA 2Q5TA 5D8AA 4O61A 4WVWA 3RMYA 1GV9A 3K4ZA 2WN2A 3AP9A 4MV2A 4HVQA 4LBQD 4BDVB 1RUG3 1OC1A 3VLBB 4GJZA 5T54A 2IVIB 1DF0A 1RUH3 1ZRCA 3G6JB 1QJZA 2JWPA 4Y26A 5GKAC 2VU9A 4LT5A 4ATEA 1V6OA 4Q27A 4N43B 4GD4A 3MIHA 4RGAA 5IVJA 5FO9B 4YVWA 2AZ5A 1CX1A 1AR62 2PMWB 4Z07A 2AEYA 3J9SA 2VUDA 1GNZA 2JDMA 5KHIA 3GM8A 1UU5A 1NZIA 1OPMA 2XL7A 1DYPA 4WBBA 2RM22 5DDJ2 3GHMA 4AEMA 1XYOA 5F3IA 2V5DA 4XXPA 4KGGA 2BP6A 2ZEYA 1BCXA 3W5MA 2D97A 4FSJA 1ZNPA 4PDWB 3AL5A 3USUB 5C5TA 2ZGNA 2JE7A 2JE8A 4FPOB 4QB1A 2Y6GA 3H50A 3T0AA 3RNSA 3ZYIB 2QE3A 4IERA 3SNMA 5DAVA 4XOGA 2PHFA 4DQAA 2FCVA 1LENA 1PX3A 5FPZA 3JCIA 4OZXA 5FBJA 4N53B 3OG2A 3I7DA 4E27A 4XHXA 4FPFA 4K1ZA 4QU1A 4GAZA 1D7PM 2OXBA 5CZKA 1REFA 5BXXA 2ZJCA 4J25A 4XURA 2VG9A 5A32A 4DNYA 3E6BA 5FDBA 4XFCA 2O1QA 1L7RA 1BK1A 3IDBB 1VBA1 2VMCA 5LRRA 4PQQA 4BQ1A 2HEWF 4NWWA 5JXHA 4A7YA 1MEC1 3LIGA 4MHUA 3N3HA 3U78A 4A6SA 2V4VA 3ILRA 1DQ0A 4GH4C 4XPVA 1POV1 4MHRA 4NIGA 2PAEA 4XF1A 1AJKA 2PHUA 3MIBA 3NJVA 4LE4A 1FV3A 1K5MA 2R062 5FYBA 4ES9A 2HWC2 1YYNA 3PUIA 5C4WB 3UGFA 5FXVA 4LTAA 1F9KA 3TEZA 5JZGB 4X8PA 3IIIA 2ZKLA 2YGMA 1KJLA 1DGWA 2HWF1 1QOTA 3IB3A 3I2KA 3WF2A 2NMNA 3WCSA 1H8VA 2FMYA 3T1LA 1ZBA3 4XJAA 4CYDA 1MQTC 3UJOA 1XJAA 4Q29A 3CHXA 4LK7A 1ND2C 1W9SA 1D2QA 2WT0A 4JGZB 1YJLA 4LLOA 3VHOA 1QEXA 3FFZA 2GU9A 3MF9A 1KFXL 1QQP1 3WINE 3WNPA 4F8AA 2YROA 4IE5A 4IEPA 2VNGA 1WCKA 2XHKA 4LO4B 1WA4A 1UZ0A 1MR5A 2VTFA 4XXAA 1YC61 3WV6A 2Y64A 5FPVA 2WAAA 5FY5A 1VAKA 3BCWA 2D6OX 2KA3A 2Q0AA 1PM4A 2ARBA 5CFDB 4CUAA 2DBNA 2ZKNA 3HWJA 1JHJA 3ZFEB 4RGGA 1VRH3 2RS12 4S2FA 3I2DA 5C5UA 2WFF2 5DAPA 1NCQB 3SH3A 1S0EA 1WLDA 3L2HA 4XUTA 3T2PA 4KWLA 4GKYA 3HMYA 4FTEA 4IEYA 4NHLA 1YCIA 3RVHA 4CCEA 2WO7A 2ZGSA 3LKJA 4WM8B 4Q0PA 4QB6A 5ACA1 4O9EA 4A42A 1LEMA 2UY8A 3ZSKA 1UMIA 1UD1A 1XSRA 2W87A 4CCDA 5CKMA 1SEFA 5FFOC 2HWD2 2QDRA 1XE8A 2XUEA 1GP6A 4OI4A 5H9SA 1W8UA 2ID4A 5IVEA 2ZMNA 4YM1A 2VVEA 4TN7A 1KRIA 4RR3B 3ZOIA 2W91A 2VC9A 3FLRA 3KCCA 4N43C 5ERLA 1PVC1 3ZO0B 4BOWA 2H0BA 3OUIA 5EPAA 2NM1A 3CDZB 5FRAA 3WT3A 2JG9B 1QU0A 3AP4A 4IV1C 5H9RA 4HSLA 1OXCA 4GB31 3VBSA 2D3PA 2DUPA 3B02A 2RM23 5DDJ3 5IUQA 2BBAA 1MS5A 4AHYA 2D3RA 1JMUB 3VN4A 4CP9A 5K8SA 5IAXA 3PUHA 4UW4A 5FO8B 2EXJA 5GALA 5FWEA 4QQHA 2LROA 1GMMA 4JDOA 4C1WA 3I8TA 1Y7BA 2WDBA 2XUMA 4QPGA 1W6OA 4PDWC 3VL8A 5DG2A 2BFUS 4CDWB 1W28A 1LOEA 4COUA 4UBHA 2VH9A 3SHRA 4I09A 4W65A 4IGPA 2DU0A 4Z2AA 2F4PA 2CYFA 1HW5A 4FOYA 1WLTA 1HB1A 4ITCA 4N9HA 3PIGA 2ZHKA 4QX7A 4IGOA 1OH4A 2Z42A 3OGJA 4YM0A 1IOAA 3IWZA 1OOPB 4L97A 3FLPA 3VBOA 2BPA2 3RZHA 2AREA 2Q30A 3KQRA 4QX8A 5AC91 2UWBA 1HQLA 1XRUA 2AR6A 4E4SA 3ZSJA 1XBFA 1UCXA 2Z4FA 3ZYGA 3SITA 3AJYA 1QDOA 4LBQA 1OI6A 4CCMA 2VCBA 4L92A 1J58A 2ES3A 2R063 2WNVB 2HWC3 1VBA2 4Y20A 3A0NA 3ALQA 3J8F1 5GM0A 2SLIA 5L36A 1DCSA 5FYSA 1URXA 1MEC2 4DOUA 2BERA 3PU3A 5C4WC 2J1RA 2BOJA 4M3CB 4XTPA 2PYTA 3VZLA 4PI0A 3WP5A 1UY3A 4R9AA 2W1WA 1C5HA 4QAWA 3RZKA 4W8JA 2VW1A 1EUTA 2WKKA 4CSWA 4CDUA 4TXWA 2ZX2A 4FFGA 3AKSA 3V64A 3B01A 4JGZC 5ISLA 4IE7A 2OKXA 2Z2SB 3PDQA 3VBRB 3AYAA 1S0IA 1ENQA 1LECA 5LA1A 3N7JA 3EQEA 2Q8OA 3ZIWA 4NMIA 5FV3A 4AVVA 5F7UA 3MV01 1DBNA 3ZXGA 2ORZA 1Q3EA 2BDRA 1J83A 3FWEA 1PZ7A 1WMEA 2RV9A 3D3AA 3V0AA 5EWSA 1C8M1 2DBIA 2NN8A 1UYZA 1QQP2 1JU3A 2RS13 3FBYA 3O14A 5CFDC 4FTBA 2WFF3 1WMXA 3DXUA 4S2GA 2DCYA 2OA2A 1DQ5A 1FATA 2DUOA 4L99A 3RG0A 2OS2A 1NCQC 3WP4A 3WG4A 3ZPYA 5IVBA 2A3WA 3LSDA 5F5AA 4XW3A 3EO6A 5T5JA 3QH6A 4LJHA 5FO7B 4Q0QA 2G1MA 4AAPA 1RUNA 2QQNA 2IVJA 1H2MA 1RUE1 1ZZ9A 2HWD3 2VTXA 4WVVA 5KWRA 5G04L 1GSLA 2DUQA 3WW2A 3CO2A 2PFWA 5F5QA 1Q8SA 3BTYA 3OD0A 4H3WA 5F3EA 1PNGA 1GWKA 3AZYA 5JOXA 5CYYA 3PIJA 2FD8A 5ACA2 3VKMA 4JKMA 5EJZB 1MPXA 4LBNA 1Y9QA 4LA3A 4YW5A 1GZCA 4CU6A 1H30A 1U12A 4HPKB 3NNJA 4XZPA 3VD5A 1CZVA 4CU8A 4K7JA 1ULCA 1DQ2A 2JG9C 4QMAA 4FPGA 4E8CA 1O4YA 2WWUA 5JPMB 2JG8B 4QQ2A 4B7KA 1COV1 2CAUA 1AR73 2YBKA 3A23A 1XE7A 2AGSA 1LEDA 1V70A 4PJYA 1MZ5A 4BK5A 1SDDB 4A7ZA 2D6KA 1PVC2 4W6YA 2GAUA 5LWBA 3AP7A 1E5RA 3I97A 2K2SA 2ZMLA 4B1MA 1KJRA 3HVDA 3OGSA 4M00A 4GH4A 3B69A 3R4UA 4GB32 4C0BA 4CDWC 1ZBE2 3NJXA 3OPWA 2XJTA 4M01A 4LITA 1OQDA 2VXJA 3B93A 2VZPA 1LESA 1LR5A 1K3IA 2CV6A 5LB6A 1ULEA 4MGZE 3CU7A 2BOIA 2W92A 4G4FA 2G9GA 3PTRB 4LBJA 1H1MA 1PGW1 5FPXA 1AR91 1Q8QA 3LA2A 2ENRA 3QD6A 1OOPC 1VLNA 1YQ5A 1BLZA 3T2QA 1REEA 2XVGA 1Q8OA 3HT2A 4OVEA 2WWJA 4V1PA 5AVPA 2BQPA 4AQSA 1F4AA 3ZR6A 2C26A 2IXLA 5IJRA 1ND2A 1BKZA 2RDNA 3PTYA 1KS5A 1W6MA 1DGRN 2GNTA 4KBBA 4LO5B 5FYCA 4P00B 5FXZA 4AXOA 4CDQC 4UWDA 4CEWC 2PA7A 3ZYRA 3W5NA 2DVBA 2IUWA 4XIKA 1RXGA 3DGTA 4AHXA 3M3EA 3ELNA 3RYRA 1VBA3 4R9CA 1H4GA 3KF5A 5B4NA 2IXCA 2VQAA 1Z0HA 2WNVC 2XR4A 1WGPA 5G05L 3ZPOA 5AC92 5F9TA 3C7EA 1H6XA 4FI9A 2B5HA 2NQYA 2D6LX 2KXLA 2V73A 2ZGQA 1O5UA 4EZHA 3DL3A 4XUQA 1POV3 3Q8FA 4RS5B 4XVHA 5F39A 2EIBA 3W58A 4EN8B 4AFAA 4EZ4A 1UX6A 1UPSA 2A6WA 4FOWA 3V56A 4B3NA 3FN9A 1SLTA 2WZR2 5FYYA 1IS5A 1SCSA 1W6QB 1N1TA 2A3YA 3J8F2 4JKLA 1FT9A 3S6PA 5KXDA 5J09A 4AOCA 1UXZA 3RI9A 1TME1 2OIIA 4LULA 3VBUC 1AZDA 2HWF3 2BWCA 3KD4A 3WY6A 3NSTA 5GJ6A 2LW8A 2VZOA 2WR9A 2Y38A 3HPNA 3VBRC 2VUCA 2QCSB 5C70A 5HXMA 1AR81 1Y3TA 1LGBA 4FFHA 2C0ZA 4LMFA 2H6CA 5A33B 2VMEA 2CAVA 1XYPA 5FY8A 3ZDSA 1OQEA 1GOHA 5BUVA 1QQP3 2ZX0A 4ZHNA 1GP5A 2X53S 1OLQA 1YQ2A 5FZMA 3HN1A 2YDEA 3OBTA 4N43A 3H3ZA 3OSDA 2A70A 4NHMA 4XJZA 2PQSA 2YFUA 4AI3A 3OUHA 4PLOA 1TNRA 5E6HA 4YW4A 1EYBA 3CJIB 2HYXA 4Y5TA 4LLFA 2YYOA 1US2A 5L73A 1C8M2 1PZ8A 2Q1FA 2WIIB 2YBSA 2TUNA 1ACCA 4IEOA 5E88A 3D0JA 2ZBJA 4LNVA 2B4KA 4BB3A 3UGHA 4CUGA 3KHCA 2WT1A 2DVFA 1RUI1 2YC2A 3CZJA 4OYUA 4PDWA 3O1SA 1VBE1 3H1MA 3GNEA 3USUA 1K45A 2XBO1 5KHKA 5FY9A 4GALA 4W50A 5ACA3 3PL0A 1Y9MA 4N90A 4QT6A 1L7LA 1SLLA 1Y9GA 2JDPA 3N9NA 3POFA 1JUHA 4XE9A 5FLIA 5HCBA 5KC5A 3UV9A 5L9VA 4N53A 3I2HA 1RUE2 1BYHA 3F95A 1YFWA 3KHBA 3ST7A 2VY0A 1WMDA 1GUIA 3T0BA 4YGEA 4Q4Y1 3WQBA 4IEXA 4BU2A 3U37A 1LU2A 2PLV3 2JG8C 1NT0A 4QHOA 5F5CA 1PVC3 1JYIA 1V6IA 4RHV1 3CL1A 2CHHA 1AX1A 4WVZA 2RS51 1FPN1 1TMF1 4GB33 4HVRA 4HN1A 2ZX1A 2CGNA 3DCQA 4LK6A 2UYAA 3VBHC 4AI2A 1E5HA 4L11A 1OA2A 4LBOA 2G4IA 1COV2 1AXKA 4ZZ5A 4UW3A 3N35A 3T1MA 2V4AA 4XF0A 3I2OA 2FDFA 5GLTA 4BZ4A 5GZEA 1SHWB 3IDCB 3MZHA 3HIFA 1GYKA 1W2OA 3BVCA 4OUMA 5C4WA 1APNA 2OZJA 4Y1XA 3NMBA 5C8CC 5IK7A 2ZGOA 3AVSA 1KGYA 1GQGA 4IEVA 5JZGA 1H2LA 5IK8A 4XETA 2ZTNA 2ZGMA 4DRVA 1ODNA 1CZTA 3OJBA 5T3NA 2BRTA 3ZN5A 1F2NA 5B4XA 2QNKA 1UO9A 2YC4A 3MUZ1 3A4UA 3IDAA 4CUCA 5H9QA 2YUEA 2Z79A 2A6YA 1OURA 2D98A 4JGZA 1AR92 3ZX7A 4LPLA 4CPBD 4Y22B 1RUC2 5JI7A 3J7HA 3PVNA 5CBLA 3THCA 1FOD1 1EP0A 2ZEXA 3K51A 3M1HA 1ZRDA 1W06A 1DGWX 1WCUA 3U1XA 5AC93 3D82A 3OB8A 1OMIA 1WCQA 1LHOA 2W1UA 4R9DA 2PELA 4ZU4A 5CFDA 4EWEA 2A6ZA 1WKYA 2PHDA 2WRAA 4FPCA 4N8MA 5FUNA 3ZFEA 3J8F3 4RL7A 1NCQA 1W2TA 2PAKA 1H9WA 3VDCA 3LCPA 3N7MA 3AP6A 4AVAA 3WP3A 2ADDA 4CP0A 1UYYA 4WM8A 1U5ZA 3MGUA 1JYTA 2VOXA 3HQXA 3UETA 4BHPA 2JDAA 1FNYA 1GBGA 3NV4A 4IESA 1TME2 4MX3A 5FYTA 5KR7A 1OLMA 3WF4A 3LFIA 1CESA 4FFFA 4LUMA 2WA4A 3H8RA 2VBBA 1DQ6A 1QMJA 4IE6A 4NAMA 5I8YA 1AR82 3HN3A 4TZDA 5FPAA 1LRHA 5FWJA 2JG9A 3CJIC 1C8M3 4H55A 1DU3D 1N3OA 1SFPA 1UQXA 4ATFA 3GZTB 5LEJA 4J6GA 2WYSA 2GH2A 5I0UA 1MACA 2ZOEB 4NRMA 1UF2C 3ZFFB 1UIJA 3TB0A 5HCAA 3VKLA 4O7XA 1MVQA 1ZA7A 4CDWA 5LEKA 4YM2A 1QOOA 2I2SA 2WNOA 2TBVA 2WZEA 3ZIXA 3I2GA 4QGLA 1RUE3 4PLNA 4BQ5A 3NKGA 3Q9OA 1GQHA 1YHFA 2DCKA 5LCWL 1VBE2 3O1VA 4ET7A 5FZ4A 1N1VA 1VE0A 1S4CA 1X36A 5BNNB 1GICA 2XBO2 3NQHA 1OOPA 3BOPA 3C7HA 4IUGA 1OF4A 4HK8A 4I01A 1NLSA 4QWNA 4XDQA 1GR3A 2VCCA 4GMP0 5I0SA 3E1F1 4YW2A 1BZWA 5LA0A 1ST8A 1ZZ6A 1HRI1 4Q4Y2 1J3PA 3J7NA 2AEZA 1COV3 4JZRA 3DV8A 3IN9A 2RMU1 3TN91 3LQCA 3PMSA 1NE6A 1H8TB 2V5YA 1AYN3 4NRPA 3VBSC 4R9BA 2WNVA 2XOMA 2DWRA 1D0HA 3HJRA 4XHBA 2A71A 2LS6A 1N3QA 2WZ8A 5FZLA 1CAWB 2RS52 4BQXA 1FPN2 4LKFA 4HBNA 4IETA 4BJ0A 4M3CA 4CE8A 3Q8CA 3KVAA 3LEMA 4P02B 4UFMA 2OQ6A 2VW2A 2QUOA 1B35B 4QB2A 4XJ9A 4AFCA 2E63A 1OA3A 4PBPA 2R32A 5J1XA 1W05A 2E7TA 3BB6A 1AYM1 1VB4A 4I0BA 2QQUA 1AR93 2MPFA 2Q1ZB 1GFF2 3VBUA 4NHXA 3S7IA 3NL1A 3E5UA 2B42B 1VMJA 4WM7B 3AKRA 3ES1A 3VBRA 4QPWA 5AFBA 4JTOA 4RD7A 3VL9A 3NJYA 4CXWA 4UT5A 1V0AA 2ZGKA 2X8KA 2DV9A 4C90A 2ORXA 2FZ2A 3IBMA 4AI8A 5KHGA 1FOD2 1QDCA 1YQ6A 1W8WA 3AKTA 3HQUA 5JDBA 1NG0A 5BNOC 1RITA 1W0OA 4FPLA 1HN1A 4YZ1A 3BU0A 2DYCA 1AXZA 1CPMA 1O7FA 2X10A 4AI1A 1XNKA 1BXHA 3RPQA 3N9OA 2BWAA 3MUY1 3APBA 5GZCA 2JENA 2VD7A 4BIOA 2WNEA 4MZUA 5J7MA 3BKZA 5BNPB 3UT0A 4QQOA 1XXNA 2J1SA 1QY4A 4IEUA 5A7OA 2YZ4A 1TME3 4K20A 4WZFA 1YQCA 3J7MA 1GQPA 4CDUC 2P3JA 3POYA 4MGQA 4LORA 4LE3A 1OSGA 1JYXA 1AR83 2CGOA 2JDHA 3MPBA 4XFIA 2VMDA 2BUKA 4HPKA 4NHKA 4Y1VA 3THPA 3VDBA 2CGPA 3AB0A 3ECQA 4OLLA 4E2GA 1U5IA 3M2MA 3BIWE 4D69A 4E2SA 3H8XA 2JG8A 2W0XA 5JR2A 3MICA 5FYZA 4XCBA 3RZJA 4CDXB 2XPJA 1SG3A 1J1LA 1DYKA 1S0JA 1C1LA 2O0OA 2J1UA 2PXJA 3ORJA 2VCAA 2XLGA 4LHSA 4CPBA 5A3PA 3ZFFC 5DUUA 4D7SA 1AR71 3SMHA 4NOTA 2YPDA 3TNPB 4OMCA 4OHWA 1VJ2A 3TBDA 3VBHA 4U2AA 5M0TA 3LPFA 3QCWA 1W8NA 4QKNA 5IT6A 1SCRA 3ZYBA 4D7TA 3MLLA 4V2WA 1RUI3 2XWJB 1RL3A 4XDOA 5JXIA 1VBE3 4HN0A 1HKDA 5C8CA 2QQPA 2YV8A 2XBO3 1XC6A 1F4HA 4FP2A 3WX5A 3LDBA 5DG1A 5IW0A 4KMQA 4ZONA 3WEZA 2W5FA 2FQPA 3ZN4A 1HB3A 4NPRA 4LKSA 2PQQA 1VMFA 3CF6E 4XILA 3ZXJA 2UU8A 2C6SA 4UF0B 5A7PA 3ACIA 4QGNA 1UY1A 4MYEA 5FZ6A 4FOVA 3WW3A 4Q4Y3 4N9IA 3VDDB 3MPPG 1NQJA 2WO1A 1RINA 1KDKA 2VUJA 3FLTA 2QZ3A 2X5IB 4RHV3 1SBFA 1OLME 3MDPA 4YNIA 1H8TC 2ZCWA 2RS53 2R0FA 1FPN3 1TMF3 3P3PA 3ZSEA 5A3NA 4IW3A 1NAEA 4UYBA 2FBEA 5CIRA 3UJQA 1ULFA 1FAYA 1E5SA 1IGOA 2ADEA 5FZFA 3ZN6A 1XE0A 4DB5A 2A6VA 2RMU2 5FZCA 5FP7A 1B35C 3A22A 1QJY1 4XF3A 4Y3OA 3VD3A 3AFGA 1W9WA 1W6QA 4V2VA 4JVAA 5FP8A 1QGLA 1UY4A 3FE5A 2I74A 3H9AA 3JZVA 3IAQA 4MUVA 1WBLA 2QQJA 4RGKA 2WNUB 4CXYA 4FTSA 1IKPA 2XXZA 4DUXA 5FXWA 4TWTA 2Q8EA 3U4XA 2VBPA 5I0TA 2VZTA 1AYM2 2LTNA 1LHNA 3GHNA 5A33A 2XQXA 4BE3A 4IGQA 4QM9A 1AX0A 2JKBA 5JPNB 1FOD3 1GWLA 1NA1B 1TG7A 1UYPA 3ITQA 1QF3A 3LAGA 1W90A 4YZ3A 3H1YA 2YGLA 1LHUA 4BWOA 4C91A 2EAAA 3NV1A 1PNFA 4L2NA 4LOSA 3QBQA 3DN7A 3CJIA 3M3IA 2ET7A 5C3PA 2GH8A 1HXS1 5LW9A 2UY9A 3NAPB 2B39A 2BVVA 3EMRA 3ZDVA 2F6BA 5IFPA 3SEEA 1YFUA 2P3KA 4KG8A 3W21A 5FYVA 5JOYA 3Q8AA 1CVNA 3ZM8A 2O8QA 1QH6A 2O8OA 5BNPC 2WQ8A 3S5AA 3S5QA 4CP1A 3AYEA 1PHMA 4ISQA 1JZ8A 1X9PA 4M3CE 2EXKA 3VV1A 5DXDA 2I45A 1ONAA 4KU7A 4X6RB 3VBFB 5FR3A 3ROUA 1GP4A 3FX3A 4QDQA 4N7UA 1HJGA 3H3UA 3LFMA 4WVMB 3VKFC 5A1AA 1R1ZA 5DZGA 4IEZA 3I59B 2A75A 4YFWA 5EJ3A 2YPJA 3KS7A 2VMGA 4A4AA 2IC1A 4B29A 3PVOA 1FYUA 1VBC1 1RIRA 4Q0UA 4K40A 3AZWA 5KBFA 3CBNA 2HEYF 3I3QA 4HVOA 2AACA 5JSPA 1LOAA 5JLVA 1XU2A 1GNYA 4Y5Z0 5L9BA 2PLV1 3X29B 5FMOL 3NV2A 4OHVA 2LALA 5FMDA 3WF1A 3POJA 3BYWA 2VJXA 2W95A 1W0NA 3E5QA 1A34A 5FREA 3THTA 3I3BA 5ABJB 2E53A 3AZVA 3OY8B 2IFWA 4QQPA 1U5YA 4QDRA 5C9AB 3RSJA 1AR72 4AHWA 2F4LA 1SZBA 2GC2A 1CAUB 2IXKA 4UOJA 3W9AA 2IFRA 3AM2A 1DP0A 3B94A 5FZ3A 1AHSA 2WS91 3BPSA 5FZKA 5LBFA 1JOBA 4CCCA 2D43A 5JOWA 2XJPA 2ZAHA 4PF5A 3POIA 1WCDJ 5DN2A 5HCHA 4UFHA 4Z2WA 3RZGA 5A3UA 4CVUA 2NLRA 4N53C 3VZOA 2HKXA 3AMMA 1RC6A 1I5ZA 4P9XA 1NOVA 4Y1UA 3P1IA 1UY2A 2FHRA 2MHFA 1VR3A 4LIUA 3WNXA 4B7EA 4NROA 3LD8A 2RS31 2JECA 1RUOA 4GA9A 4EN0A 1JZ5A 2YC0A 4OUSA 1S55A 1HRI3 2JXAA 1DQ4A 2GMEA 3AXEA 4IV3B 4MXWB 2RMU3 3TN93 3N7LA 5I8TA 1F8VA 3NJZA 3K75B 2JEMA 1W3VA 3KT4A 5JOZA 5BNOA 5DPNA 3SCGA 2J1TA 1GANA 5JAXA 3H42B 4OMDA 2C1FA 1AX2A 3ZXLA 2Y8KA 5IHRA 2B9UA 4QKFA 5LZ6A 5K9YA 1ZZBA 5AVAA 5FLHA 4E8DA 1J1TA 1WLWA 2BGOA 4TSVA 1BMV1 3T3YA 2ZMKA 3NNFA 2WNUC 4A3XA 1DHKB 4JCKA 4RA0A 1QJY2 3HQRA 5FJHA 5JZGC 1AYM3 3BODA 4GULA 1ENRA 5T5OA 1XNDA 5J3UA 2ZGTA 3S57A 2VZVA 2YXSA 1OQ1A 1OKQA 1L3JA 1EV11 3RFRA 4META 3LSEA 1HRV1 4MG2A 4LUKA 5IFTA 2Q8CA 3ZKUA 1CX4A 4YGCA 3USSA 4ZY9A 2HWF2 5FZIA 3KV9A 3OUJA 5F3CA 2GC3A 2JDKA 1W8OA 3JB4C 4MGSA 2WAOA 2SBAA 2VZRA 4XACA 1OT5A 5FCCA 2KD7A 1OBNA 3CMGA 5A3TA 3VHRA 3KCYA 1JHNA 4HOOA 1WW4A 2QDNA 2VVDA 1UKGA 3OEAA 2VZQA 3ZFFA 4PIZA 2WC2A 2GMPA 1W3XA 3ZFEC 2Y6KA 4FQ4A 4PHZA 5FZDA 5FYMA 1W99A 1XNBA 2EXHA 2RE9A 3R4SA 3WVJA 3SCHA 2MEV1 5FIXA 3WDYA 1JOPA 5A6ZA 4UFLA 2HWB1 2PTMA 5FKBA 2ERFA 4QD2A 1G9DA 2Z69A 1F5JA 4LHLA 4ISRA 1HX6A 4WM8C 3WD5A 2CWMA 3U4SA 3K46A 1UN1A 5I91A 1QJU1 4BH9A 5BNNA 2XGXA 2HBUA 3AMNA 1AVBA 5FZ7A 1SBDA 3W20A 3IT8A 3SH4A 1NXMA 1CN1A 3WF0A 2BW8A 1Q56A 3IMNA 5CU1A 4QQLA 3TYJA 1FI2A 1XPWA 4RR3C 1RXFA 2VGDA 1VBC2 3ZFGB 4JDNA 2V72A 3C7OA 3I2IA 4OCTA 1G9CA 2P6CA 1J59A 5ABJC 1H8TA 1C4RA 3M70A 2OT7A 5I0DA 1UNBA 4KGQA 5BV6A 4NRQA 2PLV2 3ABZA 3DUIA 4QPIB 4BPZA 1CAWA 2C5DA 4SBVA 1AYN1 5HV0A 4B4PA 5LK5A 3KMHA 2ZZQA 5A7WB 4ES8A 3GBWA 1C3HA 4P9JA 4BISA 5LASA 1B35A 1DZRA 4JHZA 1X8MA 4Y33A 4ZPIA 1I1EA 3NNLA 1W8ZA 1DZQA 1RUD1 2EAKA 5HI0A 2WN3A 5FZBA 1WD4A 1GWMA 3A21A 2NYYA 4Q0SA 4WM7A 4YVSB 3MEPA 1O8PA 5L9RA 3VD7A 3AMHA 2WS92 1XNAA 3NVCA 5APAA 3LEKA 3NO8A 3RQ0A 2XJSA 1BVP1 5I0RA 2EIEA 2QQLA 4B8EA 3QLQA 4IV3C 3RZMA 4JX0A 4YW7A 4M4PA 4K8FA 1QXJA 2CSGA 2VNOA 1UY0A 3EYPA 2RS32 5LBEA 5CADA 1JZ4A 2JKXA 3FUQA 3RWNA 1BK0A 2Q4SA 1WZXA 2IXIA 2BTVC 3BU7A 1QJY3 3M3CA 4QX1A 1IPSA 3JD71 3G7DA 3ZYJB 4ZXEA 1CWPA 2ZEZA 3ZLIA 2E6VA 4L8QA 3PNAA 2XQRA 5BNPA 2LM3A 1YLLA 4Y4YA 3DPRB 2P3YA 1TQ5A 4EWDA 4PCRA 3KT1A 4PLMA 2JD9A 2D7FA 2XLAA 3PVBB 1JH5A 5FUPA 3U07A 3WXPA 2P1BA 3OPZA 4JV4A 2EALA 1GOGA 1EAH1 1MZFA 4FXGB 5GLWA 5CA6A 3LE0A 2XH6A 4NIHA 1OVSA 1VRBA 4YG6A 5LY1A 3N9LA 1EV12 2DVAA 5A3WA 3AFKA 3ZXAC 5B2GB 3WCRA 1JZ3A 2WO2A 1G8WA 1V6JA 2OPWA 2QZ2A 1N3PA 2GMMA 1YRZA 2R7EB 2ZEWA 4AAXA 4TYSA 3O1UA 1FNZA 4MVTA 4QPYA 1HXS3 1SLIA 1K12A 4XQWA 5FZOB 4DFSA 3VB9A 3ACFA 1K5MB 4FPKA 1YJKA 4AQ2A 4EN9B 4RQPB 3BUCA 1DQ1A 1OVPA 5EYYA 5FTTC 5FYUA 2RHPA 4NE9A 1Z7S3 4KI5M 3T09A 4Q0VA 5IATA 1S2BA 2P2KA 1MZ6A 4GXLA 1UYXA 3EJKA 2WSUA 2OUHA 1UL9A 3LEGA 3MLKA 5D21A 2R1BA 3INAA 2E7AA 1S0FA 2IXJA 5IWFA 4GZ9A 4UF0A 1VBC3 1E57A 4ARYA 3VDDA 5GZGA 4K3UA 3VUOA 1RYYA 3A7QA 2UWAA 1T6BX 1QJU2 4HL0A 4QHBA 1JW6A 2OVUA 4NR1A 4P9WA 1D4M1 2A73B 4NIDA 2A5ZA 1CJPA 1WUVA 2K9ZA 4EYUA 2VQUA 3ACLA 4P9GA 2BNNA 1NLQA 3ME2A 3Q8EA 5FPBA 4Y1ZA 2ZGUA 2J1AA 4XFGA 5DAXA 3TEWA 1JBCA 4GWIA 5DUXA 3DEMA 2ETEA 4AVTA 3PLQA 1CR7A 3GJAA 5FZGA 5KC6A 1AYN2 1X82A 1UMHA 2GC0A 3AMQA 3VD9A 5A3LA 1JYNA 2XKPA 1UWWA 4K8RB 2WNUA 1LHVA 2WS93 1W9TA 1HB2A 1WD3A 4YVSC 5CISA 3WG3A 2A1XA 4P9LA 5FKCA 1RUF1 2AYHA 2Y26A 3JU9A 3KM5A 3VZNA 3KZ4C 5SV8A 4YYOA 1WWYA 1LKNA 3QH7A 4XYXA 1UZZA 1EPZA 2XWBB 4ZKTB 1CIWA 2KM2A 2PAMA 1DZTA 2MNGA 3AC0A 4TLFA 4C8DA 3AVRA 1ULDA 3MI8A 1PGW2 5FAXA 3D6EA 5EFUA 5HXVA 1H2NA 2RS33 4EQVA 2ARCA 3QOPA 2XJRA 5J36A 1O3RA 1W8TA 5KXCA 4P5HA 4COYA 3I2FA 2OW4A 3R0RA 3FC0A 3NAPA 2WFPA 2PN5A 3DYPA 1W6OB 1R091 4BIFA 2VNVA 3C3VA 5IVCA 1PGSA 4XAAA 1Y43B 4UXAA 3VZKA 4RS5C 1ENXA 3HBKA 3WUCA 4QHZA 4MGYE 4I0AA 4Q4W1 4PF1A 4AEJA 1NE4A 4UI9L 1NYWA 3RJ2X 5J37A 3DPRC 1LU1A 1VIWB 1H1AA 2VXRA 2VZ1A 2TEPA 2WWSA 4OHXA 5FP3A 1REDA 4A41A 1LNSA 1QKQA 5F6KA 4D6RA 1W2UA 2GN7A 1D0GA 1UOGA 2O14A 3JD72 3KF3A 3MFAA 4PBOA 4KH9A 5FBZA 1R1A1 4WVMA 1JYWA 4NAOA 5DABA 2CY6A 3OF1A 1V6NA 3I59A 5FP9A 4AK3A 2JE9A 4LKDA 1XQNA 2BFUL 3OBAA 4ONUA 5FXXA 1EV13 5C3OA 4OI0A 1ZRFA 1DGLA 1JOJA 4BQ3A 1HRV3 1LOFC 1R083 3U75A 5EV7A 4D6SA 3NNGA 2W3JA 5A1FA 3KV6A 3I2JA 4HT1T 1EAH2 1SPPB 2VECA 4RR3A 1AJOA 1IZ3A 1IG3A 4HZFA 3WHUA 3I54A 3KV4A 4CCOA 5GZFA 4QX2A 4M3CF 2X09A 4RQPC 2NMOA 4B4QA 1UOBA 1OA4A 1UMZA 3WOGA 5ABJA 2FCUA 3D8CA 4S2DA 3C7GA 3MV11 4HKLA 4ORFA 5LK7B 5F8PA 3TEYA 5C9AA 1IS4A 4XTMA 5FOJB 2NZ9A 3O1TA 3IMMA 4IEQA 1SLAA 4AI0A 1CAUA 3HD8B 1O5LA 3ZSMA 3DECA 2Z5WA 2MEV3 2GZWA 2WYFA 1OD5A 2VOKA 2YU1A 3ZMNA 4XBQA 3E5XA 3SISA 2HWB3 3GDBA 2RDSA 4YLZA 4BQ2A 4NVPA 4H14A 1B09A 1YXWA 1BBT3 3O0WA 5LBBA 4H7MA 2OUJA 1QJU3 3ENRA 4RFT0 2W9XA 1RUI2 3F2ZA 3LGRA 1AR61 1UZVA 1YEWA 2GNMA 3JBG1 3R6SA 2VNRA 1IKQA 4BQYA 2KR2A 4URAA 3WSOA 4IL7A 4ZU7A 3MIDA 3POWA 5DZEA 3ETPA 3GZUC 1X8EA 4QKBA 1ZREA 4LQRA 1KFUL 4IV3A 4MXWA 4A7KA 2ZS6B 2W08A 1V6MA 4QU2A 1D4M2 2WINB 3J7LA 3K77A 1PVXA 1GZTA 1W0PA 1C28A 5F6LB 3LDKA 3JUUA 3O1OA 4RHV2 1VPHA 3K4AA 5IAVA 5GLVA 5CG9A 3KV5A 1TMF2 4XQ4A 1SMVA 1HLCA 3ACGA 3KSCA 5E1RA 5GLZA 1LB2A 2AH2A 4QDSA 5A6XA 1YFYA 4R4XA 1Z78A 1KDMA 3MBWA 4JAAA 3ZXEA 1RUD3 1KQRA 2WLPA 1W39A 5FZ9A 1DLCA 3I3DA 2J7MA 4RFRB 4KL1A 1W9FA 1OFSA 4L9BA 1C5IA 3GJBA 3ZXFA 2R6QA 1BEV1 1J3QA 2GALA 4EWAA 2ZZJA 1T2XA 4XC9A 5HV4A 1RUJ1 2W52A 4YW3A 1IG0A 4XBLA 5HCFA 1Y4WA 1YIFA 5EXOA 3ETQA 4JRLA 2VZSA 1ULOA 4JC1A 4K21A 5A6QA 3HOBA 3TWIA 1PO13 1ND3B 1U5XA 4U36A 3LA7A 4LA2A 2PHLA 5FQ0B 1FMD1 2UYBA 3BTXA 3IPVB 3I3EA 2P3IA 2CDPA 5FPLA 5FY7A 2HWE1 2GDFA 1YIPA 1IS3A 3TRSB 2B9VA 1A6CA 1H9PA 2R16A 3DKQA 2PHWA 5K0UB 1NCRB 3WQ1A 3JD73 5EIYB 1IQDC 1H1IA 2BGPA 3HT1A 2JDYA 5DAQA 2P6HA 4BLIA 1O3TA 1VBB3 2JIJA 3HEIA 3JB8A 2FDKA 4O9GA 3V0BB 1UAIA 3AYCA 4R8HA 2W47A 4CCJA 1RMU1 3POSA 3BPZA 3ILFA 4E4ZA 1MQTB 5JIUA 4YW6A 3BI3A 3ZSLA 3M8LA 1G9AA 2VAUA 2CDOA 1NX9A 4YZ2A 1PIV1 2H0VA 2GSYA 2ZGPA 3SKJE 3WDUA 1EAH3 1LTEA 2OX0A 2P17A 1C8NA 1R1A2 4K9SA 1MVEA 2CTVA 1RB8G 4RSUA 2QQVA 2A3XA 2VBDA 4XAEA 1HDKA 1QJEA 4AEDB 3O0VA 3ZFGA 3AKPA 2R30A 3RS6A 4COWA 4CCKA 4AFBA 4KU8A 3LOIA 1ZZCA 4P14A 1DIWA 4BYYA 2XL9A 1ZRRA 3RI8A 1A3KA 1PZ9A 2UWCA 5F5IA 1WMFA 2G9FA 1V9U1 4AVSA 3T2OA 5F2WA 2ZHLA 1SFNA 4LOTA 5F3GA 5A7WA 2ZHMA 3RDIA 4D7YA 3B9IA 1BQPA 4MXVA 1XU1A 4UFJA 4XFBA 1QXPA 4NWVA 1UU4A 2VMIA 1PMJX 4BLJA 3I3MA 2V09A 1YQ8A 3ILNA 4W4ZA 1S0BA 3NKTA 3VKNA 2EF6A 4DEQA 4DMIA 2WLQA 2C4XA 4NHYA 3ASIA 1ZZ8A 3OCPA 4YVSA 3D4KA 3K4DA 3ES4A 4L0PA 5A3OA 2XHNA 3S7EA 2VQTA 3C7FA 1HIXA 2W2IA 5BNNC 1UIKA 3HNBM 3P5BA 4JRAA 1AUYA 1RHI1 3K3NA 2D93A 3KGLA 5T5LA 4E4HA 3U10A 1KD7A 5EP9A 1LJ7A 1OUXA 3IDEA 1JZ7A 4M0HA 3UYJA 1JN2P 2E26A 3UKVA 4DY5A 4IV1B 1D4M3 3N9MA 3JBG2 4LBLA 5EYXA 4BK4A 1JTZX 4YG3A 3IKWA 1MS1A 2OYZA 3MW4A 1NY71 3T4HB 3BTZA 1C57A 3CIHA 4I02A 5T55A 2CU5A 4C1XA 4KWUA 3LIHA 2P4EA 2VCMA 4IXLA 2JB8A 1O6UA 4GJYA 1UPIA 4IE0A 4OHZA 4DINB 1RJ8A 2FDJA 1CAXB 1PO21 2WQ4A 3AZZA 1QJX1 1HRI2 1YO8A 2L9LA 3MW2A 3OYWB 4RS5A 4YPJA 4CA9A 1PGL1 4TTGA 4YZ4A 3TN92 2R041 3H8OA 3WZ1A 3DPRA 2P34A 4YW1A 2K46A 2OZ6A 5L7OB 3S0MA 2ILMA 3IZOA 3RJRA 1PMIA 5L19A 4XJUA 2RR11 2W94A 1RUF3 2D6PA 4A6OA 4DIQA 4QM8A 2GP5A 4WM7C 1VBD3 3I49A 2R071 5FPUA 3VD4A 4F3JA 2VOWA 5F2SA 3WDVA 2DF7A 1BJQA 1LOFA 1F31A 2XVLA 4OQ9A 3UNPA 1ND3C 4IQPA 1QH7A 3LEIA 1BEV2 3N7KA 1WLCA 5EHDA 1RUJ2 4EN6B 4BXFA 2HYKA 2R1DA 4G9SB 2Y60A 3MW3A 4W6XA 2IZWA 3KVBA 2JIGA 5IK4A 5FZOA 4IDZA 3EB7A 1Q43A 5FYIA 3WNLA 1R093 1YUDA 2BNOA 3NV3A 4RQPA 4JQRA 3CKHA 3HR9A 4XF4A 4E9KA 5K0UC 1NCRC 3WW4A 1M06G 1FMD2 4HONA 1MS0A 3O1MA 4Q4W3 2HWE2 5IVFA 3O1RA 1GU3A 4ASLA 5C3QA 1POV0 4BQWA 4D3WA 1CQ9A 3H1WA 4XJ8A 4XZUG 3MLJA 1PK6B 4Q8LA 1Z7S1 1TVGA 4AI9A 2EIDA 3PHMA 5TSWA 3ZYPA 1H6YA 1GOFA 2AUYA 3CZUA 3D5OA 2CL2A 5FUIA 2DCJA 1R1A3 1CD3G 1W8FA 4Y1YA 4AR2A 2BZDA 2WBKA 3BTAA 1GLHA 4FPJA 3WDWA 4AG4A 5C3RA 3KB5A 1KS4A 4LO7A 1RMU2 4XEZA 1SACA 4QGMA 4Y24A 5LA9A 2F17A 4MGKE 4QXKA 3T08A 4CP2A 4AZZA 4IEWA 5FZAA 4AEDC 5IVVA 5FZEA 1PIV2 1I6XA 5A6YA 1E5IA 3CNAA 2FZ1A 1O4ZA 4PQ9A 1X7NA 1WW5A 3LDRA 3S30A 3B00A 5DQ0A 2VTXJ 4N7IA 4CDXC 5CFCB 2PHXA 5SV5A 3OGGA 2RDRA 3POEA 1F35A 1G6NA 5JVVA 1SQ4A 4COZA 3FL7A 4COVA 3B9CA 4GQ7A 1BVVA 3U11A 5C8WA 4CU7A 1LAJA 1QWRA 2W1SA 3HBZA 4CUBA 2E31A 1OF3A 5J48A 4BMBA 3UKTA 4ZS2A 3SXWA 4BQ4A 1A8MA 3KCXA 3BGAA 4Q5OA 1V9U2 2JICA 2VW0A 4AQTA 1JZ2A 5E8AA 5JUVA 4CEYB 2XDVA 4H2AA 1YNAA 1NXD1 2VM9A 2E7QA 4LIVA 1T6GC 1STMA 1HV1A 2GN3A 3J26N 1SDWA 2VQ0A 5AFEA 3OEBA 4GMP3 1MS4A 1NZCA 2YBPA 3GCWA 4FAGA 1AR63 1I5PA 4F7ZA 4JDMA 3JBG3 1VAVA 3L2YA 2VE1A 1AL21 1UX7A 4K1YA 3TEXA 1GZWB 3GGLA 3VDDC 1S0CA 4Y22A 4I2OA 1ZBE1 1IQAA 3OGRA 2WSVA 2GNDA 3DF0A 2VL4A 1RHI2 2X5IC 3ON7A 4MGTA 2VO5A 1X9TA 1LHWA 2Y0IA 1FV2A 2D44A 1W6PB 1NKGA 1OFNA 3O0XA 1QIQA 4AL9A 1A78A 1LOCA 3Q8BA 5JCTA 4DPNA 1S2EA 3T0DA 3MIEA 4XUOA 1ZRIA 2W68A 5FY4A 3VZJA 4YZ5A 2JDZA 4AE2A 1W6NB 2FDGA 1NY72 3WNMA 2ZABA 2E32A 4CCNA 1X50A 4FCAA 4Q4X1 4HLTA 4XJWA 4YG0A 4KQ7A 4XMAA 5J98B 3M3QA 2IXHA 5L7OC 2A6XA 2RVAA 2ARXA 1QXRA 1PO22 4INDA 3ZXKA 4Z8BA 1QJX2 1WW6A 4HG6B 4P5YA 4XABA 4ARXA 3EBRA 1PGL2 3OBRA 3FZ3A 1N1SA 2R042 3URFA 4DXZA 3U0ZA 3EXUA 1JXNA 2ZHNA 3GALA 1AF9A 4Y5SA 4HANA 2VR4A 4FXKB 1CONA 4Q1PA 5I93A 1BEV3 4DXRA 5FMBA 4CDQB 1CZSA 2QVSB 1HN0A 1QHDA 1RUJ3 2RR12 5JR7B 4CEWB 4TLGA 3MO4A 1R081 4XMIA 5CVRA 1CPNA 1GZ9A 1I3HA 1NA1C 1SPPA 5CG8A 2R072 1EPWA 2WZR1 2BBVA 1TE1B 2VPVA 5F37A 1FMD3 1ENSA 1SLCA 2DVDA 4J1WA 3WR0A 5LRSA 4OI1A 5FZ1A 2HWE3 4NO4A 3NAPC 1CAVB 5IK5A
chains in the Genus database with same CATH topology
3NW4A 2DURA 1V00A 4FAHA 2ZGRA 1G9BA 1PK6C 1HXS2 2H6BA 3RZZA 5H9PA 2PHTA 3VBUB 2X29A 2D5FA 1S0DA 2BEOA 3RRDA 1IHMA 1WCSA 1RMU3 2D6NA 5BY5A 3WQ0A 3ZMOA 3VBFC 4FQZA 2XB6C 3VHNA 5D1IA 5HBAA 1BBT1 4Z82A 1Z7S2 1PIV3 4YSFA 1NLRA 3PMEA 3WP6A 3H8UA 2E9QA 3R4DB 1ZA4A 4GKXA 2ZACA 4Q26A 1OLRA 4Q2FA 5CFCC 5KXBA 1U0AA 1G9FA 3LWCA 3E97A 1F5FA 2QJVA 3FHIB 4AFDA 5T52A 3GYDA 2HEVF 3B3QE 2D40A 3FBMA 1V9U3 2Y0OA 3RMXA 1S1AA 4P9YA 5C9AC 1TNFA 4GWNA 4CEYC 4JGYB 1LOGA 4EJRA 3AX4A 1DGRA 1IPJA 1DLLA 4FPEA 3UK9A 1YI7A 2ZGLA 4DS0A 5D8AB 1N47A 4CTEA 4BM8A 4ASMB 4I3GA 5DUWA 1RHI3 1ALYA 2PHRA 1ASJ1 3MIGA 1HV0A 3FJSA 1SFYA 2P37A 1IPKA 3AKQA 3VHPA 4MH0E 4A2UA 3A0KA 1ND3A 4ZXKA 1AL22 5GZDA 4YVWB 5FQ0A 3SLIA 3VBHB 3IPVA 3H7JA 4HMZA 3VKOA 1PO11 1ULGA 3MYXA 4FVVA 3RYKA 4GIQA 3WG2A 2DFCA 1XNCA 2WT2A 5K0UA 3KGZA 5CNAA 1KITA 1PO23 5C8CB 1NCRA 1QJX3 2YY1A 3M3OA 4YFZA 2A7AA 4FT8A 4R4ZA 1YI9A 1RUC1 4LBKA 2R043 4YGDA 4NN0A 3TAYA 3V0BA 3HAGA 1LODA 1QOSA 3P3NA 4PIXA 3QACA 4Q4X2 1MQTA 1VBB1 2WL1A 1RJ7A 2XJUA 4YRDA 2RR13 5F1RA 4MLOA 4LBMA 4XF9A 1BMV2 2R073 3B7MA 4AGRA 3KT7A 3FMGA 1I9RA 2DCTA 4FOQA 4J1XA 4LHKA 4W6WA 3E6DA 5A32B 4AEDA 2RJLA 1MEC3 2FMDA 1GNHA 1H2KA 4DY3A 1PM7A 2BNMA 2E51A 1HRV2 3ZN6B 1R082 3W59A 1AL0G 4CDXA 4Q8KA 2VULA 4F83A 1J3RA 1UKRA 3GBFA 1QNWA 3TOJA 5JI9A 1ZVFA 1RVF1 2B7YA 4AGVA 5T50A 4R52A 4EROA 2R0HA 4I30A 4Q4V1 5GLUA 5KHJA 4OFGA 4AQ6A 1YWKA 3KLSA 2NP0A 1V6LA 1V6KA 1UZYA 2WZPP 5JSOA 2Q1MA 5K7PA 3D0SA 1RUG1 2ZA9A 4JTNA 2MEV2 1D2SA 5JMCA 2TNFA 4I3PA 1S2KA 2HWB2 3EHKA 4OI2A 1M4WA 5BNQA 1LULA 1RUH1 5C33A 1BBT2 4IV1A 3ZVXA 2BGCA 4H7LA 2EIGA 3ZFGC 3AK0A 2VUAA 3MF6A 3MFCA 3GBGA 2X5IA 3WUDA 3L9JT 4AVBA 1WBFA 1AXYA 2UURA 2C9AA 2QKDA 4QPIC 1UU6A 4C0HA 1CAXA 4JGYC 3O7OA 3OYWA 2DTYA 5CAZA 1ZYBA 1CJDA 3LA3A 3O5SA 1O91A 1H4HA 5L7OA 4LR4A 5D8AC 4HSJA 3PJYA 4AYUA 4B4RA 3N4MA 4FBFA 2WQZC 4AHZA 3J4UH 2BVBA 1AL23 4AXOA 1RUD2 1G86A 1Q5OA 1VBD1 1X33A 3AYDA 3ATGA 3CLPA 4S2HA 1QNYA 1OPOA 1ZBE3 1VP6A 4DRRA 4YVWC 2VVFA 1ZZ7A 5CB7A 1ASJ2 1NA1A 5E16A 2DTWA 3CEWA 5DZFA 3VBSB 4LO6B 5KHHA 5A3MA 1RTVA 3B5LB 3AZXA 4CZSA 1O3QA 2W39A 1MS8A 3LZZA 1HQNA 1G7YA 4QPGB 1PO12 5E89A 2CWSA 4Q4X3 3CJXA 1O4TA 1PK6A 3WHTA 2EXIA 1YFXA 4SLIA 1ZX5A 2B8MA 1SLBA 2GC1A 2YMZA 4HFSA 1ZBA1 4WV8A 5FMOS 3PJQA 4AFMA 3VBFA 4DZGA 1D4VB 1MZEA 5BPXA 2NPIA 1VB2A 3AMPA 4MSVA 1VBB2 1XYNA 3VBOB 3WLUA 4BMEA 3VGIA 5T5PA 1IS6A 3C2UA 1LGNA 4XFHA 2WZR3 4KNCA 4LBQB 5BNOB 5CFCA 4FPHA 3WQ7A 2EVXA 3H0OA 3AP5A 3BALA 4KWJA 1N1YA 4Y20B 1VRH1 1K5MC 2B46X 4Z1VA 4EV0A 3H7YA 4HK9A 3IM0A 4QX5A 4XQDA 3OY8A 4LO8A 4Q1RA 4XFFA 5DUVA 1EY2A 4MGIE 4KWKA 4YGBA 5FLJA 2DCZA 4CEYA 2JJ6A 1RVF2 2N7GA 4M0NA 4CDUB 4XBNA 4ZU5A 5JWPA 4Q4V2 1O3SA 4HKOA 4P9IA 2HJIA 3O12A 3WDTA 2XKOA 4GMP1 2RJKA 4BCUA 1GZWA 1DG6A 2OPKA 1RUG2 2D6MA 3V0AB 4OHYA 1RGSA 2ATFA 3VZMA 1TEIA 1RUH2 2JX9A 2RM21 1C1FA 5DDJ1 3FFQA 3ZXDA 1W6PA 4AEKA 5BYNA 3M7AA 2ZX4A 2I07B 4E4DX 1VAMA 4HKWA 2XG3A 3LB9A 1W6NA 3NWKA 3IIAA 1ZM1A 3WW1A 3BOWA 2WA3A 3WG1A 4EN7B 1LCLA 1MS3A 4AF9A 4K6BA 3DKWA 4X8NA 4FP3A 4LHNA 3R05A 4X6QB 4PIYA 3E6CC 4XIOA 3AXDA 2ZX3A 2ZAAA 3JQXA 1A8DA 4UBGA 4GWMA 5JIAA 4CDQA 2JD4A 3UKNA 1ASJ3 4G3YC 3I4IA 4CEWA 2VOVA 1NQDA 2B45X 1KXGA 3WDXA 2ET1A 3GF6A 3LOBA 3AJZA 1RUF2 2XJVA 5FOBB 1H0BA 4KG0A 4UW5A 3PVEA 5EZWA 5J96B 1VBD2 4YM3A 5C6CA 2R061 2XJQA 4WZCA 1JYCA 2HWC1 3N36A 1CAVA 2WJSA 1LOBA 4UW6A 4QPGC 3GZAA 3JQWA 4GH4B 1S0GA 4I0WB 3FUOA 3MIFA 1DDLA 1Q8VA 1FXZA 4CRQA 4HETA 2K0GA 2DVGA 3TNQA 2BYVE 1RUC3 3UL2A 1R092 4AGGA 4D94A 2D5HA 1DFQA 1OHFA 1WW7A 1Q8PA 5I8SA 4Q4W2 3VBOC 2VMHA 1MS9A 2DU1A 2XVKA 4LEJA 1ZBA2 1GKBA 1ND2B 1W6MB 4XFAA 2IWGB 4URTA 4BA6A 1UW8A 2R49A 2EA7A 2QFEA 2GNBA 2CNAA 2DFBA 2AENA 3RYPA 2XLFA 2D3SA 2RS11 4AVCA 2WFF1 2YHJA 3SH5A 4Z92B 1JUIA 1SBEA 2LUWA 4OULA 3OD4A 1FX5A 3OTFA 1RVF3 4QPIA 1LGCA 3V65A 1VALA 4AWDA 1CGPA 5KXEA 4JGYA 2ZPXA 4FO9A 1VRH2 3K48A 4YARA 3M4FA 4Q4V3 4E2QA 2HWD1 3SCFA 3T2TA 1HQWA 4AW7A 4FPYA 2Q5TA 5D8AA 4WVWA 3RMYA 1GV9A 3AP9A 4MV2A 4HVQA 4LBQD 1RUG3 3VLBB 5T54A 1DF0A 1RUH3 1ZRCA 3G6JB 1QJZA 4Y26A 5GKAC 2VU9A 4LT5A 4ATEA 1V6OA 4Q27A 4N43B 3MIHA 4RGAA 5FO9B 4YVWA 2AZ5A 1AR62 4Z07A 3J9SA 1GNZA 5KHIA 1UU5A 2XL7A 1OPMA 4WBBA 1DYPA 5DDJ2 2RM22 3GHMA 4AEMA 1XYOA 4XXPA 4KGGA 4FSJA 1BCXA 2D97A 1ZNPA 4PDWB 3USUB 2ZGNA 2JE7A 4FPOB 3H50A 3ZYIB 3RNSA 2QE3A 4IERA 3SNMA 4XOGA 2PHFA 4DQAA 1LENA 5FPZA 3JCIA 4OZXA 4N53B 3I7DA 4E27A 4XHXA 4FPFA 4K1ZA 1REFA 5BXXA 2ZJCA 2VG9A 5A32A 4DNYA 3E6BA 5FDBA 4XFCA 2O1QA 1BK1A 3IDBB 1VBA1 5LRRA 4BQ1A 2HEWF 4NWWA 4A7YA 1MEC1 3N3HA 4XPVA 3ILRA 1DQ0A 4GH4C 1POV1 2PAEA 4XF1A 1AJKA 2PHUA 3MIBA 4LE4A 1FV3A 1K5MA 2R062 4ES9A 2HWC2 1YYNA 5C4WB 4LTAA 1F9KA 5JZGB 4X8PA 2ZKLA 2YGMA 1KJLA 1DGWA 2HWF1 1QOTA 2NMNA 3WCSA 1H8VA 2FMYA 3T1LA 1ZBA3 4XJAA 4CYDA 1MQTC 3UJOA 4Q29A 1ND2C 2WT0A 1D2QA 4JGZB 1YJLA 4LLOA 3VHOA 3FFZA 2GU9A 3MF9A 1KFXL 1QQP1 3WINE 4F8AA 2YROA 4IEPA 2VNGA 1WCKA 2XHKA 4LO4B 1WA4A 3WV6A 1MR5A 4XXAA 5I91A 1VAKA 3BCWA 2D6OX 2KA3A 2Q0AA 2ARBA 5CFDB 2ZKNA 3HWJA 3ZFEB 4RGGA 1VRH3 2RS12 4S2FA 3I2DA 2WFF2 1NCQB 3SH3A 1S0EA 1WLDA 3L2HA 4KWLA 4GKYA 3HMYA 4FTEA 4IEYA 4NHLA 1YCIA 2ZGSA 3LKJA 4WM8B 4Q0PA 5ACA1 4O9EA 1LEMA 2UY8A 3ZSKA 1UD1A 1SEFA 5FFOC 2HWD2 2QDRA 1XE8A 4OI4A 5H9SA 2ZMNA 4YM1A 2VVEA 1KRIA 4RR3B 4N43C 3KCCA 3FLRA 4BOWA 1PVC1 3ZO0B 2H0BA 2NM1A 5FRAA 3WT3A 2JG9B 1QU0A 3AP4A 4IV1C 5H9RA 4HSLA 4GB31 3VBSA 2D3PA 2DUPA 3B02A 2RM23 5DDJ3 5IUQA 5K8SA 1MS5A 4AHYA 2D3RA 3VN4A 4UW4A 5FO8B 2EXJA 5GALA 4QQHA 4JDOA 4C1WA 3I8TA 1Y7BA 2XUMA 4QPGA 1W6OA 4PDWC 3VL8A 5DG2A 2BFUS 4CDWB 1LOEA 4COUA 4UBHA 2VH9A 3SHRA 4I09A 4W65A 2DU0A 2F4PA 2CYFA 1HW5A 4FOYA 1WLTA 4ITCA 4N9HA 2ZHKA 4YM0A 2Z42A 3OGJA 1IOAA 3IWZA 1OOPB 4L97A 3FLPA 3VBOA 2BPA2 2AREA 2Q30A 3KQRA 5AC91 2UWBA 1HQLA 1XRUA 2AR6A 4E4SA 3ZSJA 1UCXA 3ZYGA 3SITA 3AJYA 1QDOA 4LBQA 1OI6A 4L92A 1J58A 2ES3A 2R063 2WNVB 2HWC3 1VBA2 4Y20A 3A0NA 3ALQA 3J8F1 5GM0A 2SLIA 5L36A 1URXA 1MEC2 4DOUA 5C4WC 3VZLA 4M3CB 3WP5A 4XTPA 2PYTA 4R9AA 1C5HA 2VW1A 2WKKA 4CDUA 2ZX2A 3AKSA 3V64A 3B01A 4JGZC 2Z2SB 3VBRB 3AYAA 1S0IA 1ENQA 1LECA 3N7JA 3EQEA 2Q8OA 3ZIWA 4AVVA 1DBNA 3ZXGA 1Q3EA 3FWEA 1PZ7A 1WMEA 3V0AA 5EWSA 1C8M1 2NN8A 1QQP2 3FBYA 2RS13 3O14A 5CFDC 4FTBA 2WFF3 4S2GA 2DCYA 2OA2A 1DQ5A 1FATA 2DUOA 4L99A 3RG0A 1NCQC 3WP4A 3WG4A 3ZPYA 2A3WA 3LSDA 4XW3A 3EO6A 5T5JA 3QH6A 5FO7B 4Q0QA 1H2MA 1RUE1 1ZZ9A 2HWD3 5KWRA 4WVVA 1GSLA 2DUQA 3WW2A 3CO2A 2PFWA 5F5QA 1Q8SA 3OD0A 4H3WA 1PNGA 3AZYA 5JOXA 5ACA2 3VKMA 4LBNA 1Y9QA 4LA3A 4YW5A 1GZCA 1H30A 1U12A 4HPKB 4XZPA 4K7JA 1ULCA 1DQ2A 2JG9C 4QMAA 4FPGA 1O4YA 5JPMB 2JG8B 4QQ2A 4B7KA 1COV1 2CAUA 1AR73 1XE7A 2AGSA 1LEDA 1V70A 4PJYA 1MZ5A 4A7ZA 2D6KA 1PVC2 4W6YA 2GAUA 3AP7A 2K2SA 2ZMLA 1KJRA 4M00A 4GH4A 3B69A 3R4UA 4GB32 4C0BA 4CDWC 1ZBE2 2XJTA 4M01A 1OQDA 3B93A 1LESA 1LR5A 2CV6A 1ULEA 4MGZE 3CU7A 4G4FA 2G9GA 4LBJA 1H1MA 1PGW1 5FPXA 1AR91 1Q8QA 3LA2A 2ENRA 3QD6A 1OOPC 1VLNA 3WNXA 1REEA 2XVGA 1Q8OA 3HT2A 4OVEA 4V1PA 5AVPA 4EN8B 2BQPA 4AQSA 2IXLA 1ND2A 1BKZA 3PTYA 4KBBA 1KS5A 1W6MA 1DGRN 2GNTA 1RUNA 4LO5B 4CDQC 4CEWC 2PA7A 3ZYRA 2DVBA 4AHXA 4XIKA 3DGTA 3M3EA 3ELNA 3RYRA 1VBA3 4R9CA 1H4GA 2IXCA 2VQAA 1Z0HA 2WNVC 5AC92 1WGPA 5F9TA 2B5HA 2NQYA 2D6LX 2KXLA 2V73A 2ZGQA 1O5UA 3DL3A 1POV3 4RS5B 3W58A 4AFAA 1UX6A 1UPSA 2A6WA 4FOWA 3V56A 4B3NA 1SLTA 2WZR2 1IS5A 1SCSA 1W6QB 1N1TA 2A3YA 3J8F2 3S6PA 1FT9A 5KXDA 5J09A 3RI9A 1TME1 2OIIA 4LULA 3VBUC 1AZDA 2HWF3 2BWCA 3KD4A 3WY6A 3NSTA 5GJ6A 2Y38A 3VBRC 2QCSB 1AR81 1Y3TA 1LGBA 2C0ZA 5A33B 2H6CA 2CAVA 1XYPA 3ZDSA 1OQEA 5BUVA 1QQP3 2ZX0A 2X53S 1OLQA 3HN1A 2YDEA 3OBTA 4N43A 3H3ZA 4NHMA 2A70A 4XJZA 4AI3A 4PLOA 1TNRA 4YW4A 1EYBA 3CJIB 4LLFA 2YYOA 5L73A 1C8M2 1PZ8A