3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
b'DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
2E1NA 3Q9SA 2MH9A 1J7KA 1O5UA 2HFHA 1QQIA 4LK0F 4ZH4F 2OD5A 3GF2A 1TQIA 1CAWA 3HOSA 1J1LA 1SEFA 4UV8A 1YO5C 4FT8A 4XSZF 1XB4A 2EV0A 2EJRA 5L3CA 5L3GA 1H9GA 1MZBA 3KEOA 5BXXA 2P7CB 4G94A 2FE3A 5L3FA 3P7NA 4QX5A 2DI3A 1USSA 2P5VA 4DQ2A 1EV7A 4HDVA 1CAVB 5DUIA 3H7JA 2CGPA 4XFGA 1P4XA 1OYIA 1H1IA 2V09A 3K1NA 3ZP5A 1SFNA 2VOOA 1OPCA 3MCZA 4EVIA 5KVRA 5I8TA 4RB1A 2IXIA 3DF8A 3R4KA 4M6YA 4GCVA 2Q30A 3NEUA 5FLXZ 1QGPA 2XLFA 2ZNYA 4Q29A 1XSXA 3HRMA 4HSLA 3IC7A 4G7OF 4I01A 4YFKF 1XRUA 4A0ZA 2W57A 6PAXA 3RPQA 2OA2A 2Q0AA 1ZG5A 3F3XA 2KXLA 2NYXA 1Z6RA 3CUQB 1Z9CA 4XRFA 2XLAA 3DN7A 3ISPA 3IWFA 4N9HA 4U7DA 4OMYA 3DPTA 2MLGA 2M8EA 4GXOA 1FYMA 2QVSB 3J80Z 4IRGA 4IEWA 3I53A 2RNJA 3HSEA 3KMHA 3GVAA 2K0GA 4GGGA 2HJIA 1R22A 2H09A 4YFXF 1GQHA 3F6OA 3CLPA 4XF4A 1KGSA 4IERA 4DNCA 1O3RA 4Q48A 3FFQA 4AQ2A 4P96A 2AXLA 3GXOA 1CAWB 2Z33A 2D45A 4KNYA 3GZ5A 1FP2A 1OFNA 4CO8A 2LF7A 1V3FA 4QGLA 4HZFA 2ET7A 2G7HA 3IWZA 3NL1A 1XCVA 3GO5A 4XFBA 2V79A 4CYDA 3MWMA 3UKTA 3ELKA 1IRGA 1XMKA 2A5YB 4WF2A 2PFWA 2IJLA 4D7SA 3BROA 2FMYA 2YSRA 1JHFA 2UY8A 1NZCA 2BBYA 1ONVA 4L9TA 1U8RA 4L5IA 2B8MA 1KYZA 2HYFA 2IA2A 4BQAA 3GFLA 2PBIA 4LTAA 4KIGA 4WWCA 4EJWA 2LNBA 1XMAA 4LK1F 1IN7A 3GFMA 1YFUA 2ZJ2A 3U1DA 3KP7A 1ZZ6A 3RTRA 3ERED 4HN1A 4EGZA 2X0LA 1TQMA 4IF4A 3I64A 5LBQA 3BWGA 1Q3EA 4E70A 1RNLA 5CVJA 2EB7A 5E20A 2ZBKA 3QPTA 3D5LA 4M74A 1B1BA 3BP8A 2VBYA 1G3SA 1LDDA 3IKTA 2CWEA 5KHKA 3ZMVA 5HS7A 3E5XA 1DPUA 3Q9VA 4OIRF 3G3ZA 3NW4A 5H6QA 1JXSA 4AIKA 3LWCA 1K6OA 2WWYA 3GYDA 4IEQA 2E9QA 5D8KB 5LRSA 3RYPA 3SFZA 5BUVA 4M71A 3QRFF 3WTUC 1XE7A 3ZMUA 1AOYA 2MH2A 4WBBA 2MNGA 3LZZA 2R7DA 1REPC 2Q0OA 1UCXA 1QZZA 3F8MA 1QBJA 4I02A 4LLNA 5BOXA 2B0LA 4G9YA 5FLJA 3GUDA 1SFUA 2RQPA 3EYYA 1Z1DA 3QU6A 5J8CA 5E1WA 3JTGA 4GYGA 2JZYA 2FF4A 3CO7C 1X82A 3SCFA 4RB3C 1LEBA 3QP6A 1YLFA 4G8XA 1YUDA 1FXZA 4NB5A 3K2ZA 1K79A 3WTXC 3TKYA 1SD6A 3HHGA 4K2EA 4EQQA 3LA7A 2BYVE 4LJZF 3E97A 1RUNA 3I4PA 3FMSA 2IC1A 1FYKA 4HV6A 2AS5F 3GW2A 2H27A 4CDGA 5DCMA 2O0YA 1O7FA 3H3ZA 2Z5UA 2YPRA 2D5FA 4KYWA 3H50A 1O57A 1UHWA 1XN7A 1G3WA 5A2QK 2CSOA 2FEZA 2KIUA 1WI9A 2IP2A 3KE2A 1IUYA 2XAJA 2PN6A 3ECOA 2F4PA 1USTA 1P4WA 1W5SA 1B9NA 2PAEA 2Q8KA 1HSJA 2OAZA 2R7FA 2YU3A 2DW4A 2Y0MA 5AIPA 1HW5A 1BBYA 3FJSA 1SD5A 2F5CA 4RB2C 1H9TA 1IF1A 2PI0A 3DL3A 3FXQA 1PDNC 1S6LA 1BI1A 2EFOA 3VEPA 4KN4X 1YW8A 1IRFA 4M9XA 4Q0VA 4M72A 3H1WA 3SQNA 5HLHA 3CJXA 2LDUA 5JCTA 2P17A 1FOKA 2QVOA 3EETA 2QYOA 1ZRDA 4M9ZA 5J6XA 2I45A 4BH9A 4LA3A 4LD5A 2W85A 1ZN2A 2PQQA 4IPAA 2EAAA 4IRHA 1U78A 2XROA 5JR3A 3H9AA 1UCRA 3K1MA 2FBIA 1XSDA 3CUQC 1NYWA 3SHFA 1W4MA 2OA4A 2PFBA 1YHFA 3H3UA 2B5HA 4HF0A 1BI3A 3WGGA 1UIJA 4CHUA 5FDBA 1SAXA 2EK5A 2VT3A 1YFWA 2OU2A 2O6GE 2M30A 1Y0UA 2ADUA 3C1DA 2HZTA 2MPFA 1R1VA 1I1SA 2XASA 5LHIA 5ILVA 4MQVA 5DCMB 3GLXA 1P4AA 2NNYA 3M8EA 3MAJA 3WG9A 3GWZA 4A0XA 3W6JB 2K02A 3QOPA 4CXFA 4HA8A 3HSRA 4EROA 4KU7A 3M7GA 2V9VA 2EVXA 1G6NA 5EEGA 1WSUA 3HUGA 4O9GA 2H0VA 4LULA 2DT5A 2GA1A 2F5DA 1RUOA 1ON1A 1OYYA 1IXCA 3ECHA 1IN8A 3I59A 2UXNA 1Z05A 4EWAA 3HQXA 2DPUA 1WWXA 2L4AA 4UXAA 3ZMSA 2E1CA 3V7CA 5DV5A 1VTNC 1QWRA 1QO0D 2KJCA 4HLTA 3KLOA 5FD5A 2XVCA 4B09A 1XGNA 5LRRA 1R1TA 3KFWX 2GH2A 4L9JA 1TBXA 5KHIA 2EFQA 2VODA 5LGNA 4J1WA 2Y0OA 5I93A 3HOTA 2N7GA 2M87A 2NAZA 4MGIE 4WVZA 2FMLA 1TQ5A 4AIHA 4MZUA 3P9CA 3WGHA 4LLOA 5I91A 1ULYA 2A3SA 3NRVA 4ETSA 4ESFA 3NJZA 4XFIA 1ZREA 3KETA 4E2GA 4EJUA 1C0WA 3ROUA 2D93A 2PMHA 2B9UA 1R1UA 3H92A 3ES4A 5HDNA 4A5NA 1KQ0A 3HHHA 3WU0A 4AVCA 4N0BA 2X4HA 3VHRA 1XD7A 1LR5A 2BNOA 4PIZA 1FI2A 2VXZA 4IVNA 2ACJA 1MKMA 2OYZA 1HKTA 3WODF 3SXWA 1GQGA 4UVBA 2L3DA 5J7MA 3BALA 2W84A 2RGVA 1YS6A 3HTSB 5ERIA 1G3TA 1OR7A 4R1HA 3IDBB 4O3MA 3BB6A 1SMTA 4TV7A 5BMZA 3IDCB 2PAMA 1NXMA 1YW9A 5IT9K 3WTWC 2CV6A 1G4DA 5E8IA 2ZXJA 4RB0A 1KA8A 3JAMK 4WCGA 2VOPA 1X8EA 1O7LA 4YNIA 3P9IA 3R61A 4AXOA 3IHUA 3E3VA 3EQEA 2A6HF 3ABTA 4ORFA 4R8HA 3F22A 3CUOA 3OV8A 4MGRA 5LLQA 1LB2A 1J2XA 4LUMA 5FD6A 1YIOA 4WZCA 2H6CA 3RI4A 3DXJF 2M45A 3OTFA 4K8FA 3ACLA 3HT2A 3UKVA 2P8TA 1NHAA 2CO5A 2XL7A 2QUFA 4AVBA 1ZZ9A 1DGRA 4HAMA 2ZKZA 2QJVA 2Q1ZB 1CAUA 5CLSA 4META 2MC3A 4JTOA 2DTRA 3LSTA 4KWLA 3HYIA 3I58A 1TTYA 2VPVA 1BJAA 4Z07A 2FBKA 4KMUX 3LQQA 4PCQA 3R0AA 3WTSC 4Y15A 1WQ2A 2OQRA 4OMZA 4UHTA 4EM1A 1QY4A 2D1VA 3MFKA 2GC2A 2L54A 3IKVA 4D7TA 3VOEA 4QLCU 5CJ9A 4CICA 3FZ3A 3D0SA 5I8SA 3OF1A 3N4MA 2VE9A 2FOKA 3ZQ7A 3F8CA 3KP3A 5D5UB 5H6RA 3SCGA 1ZLJA 2UXXA 5FLIA 4Q5SF 3V7RA 1ZG3A 2MA3A 4DINB 4EMSA 3KZZA 2IXJA 2Q2EA 4NQWA 4RAZA 2E7WA 4WK8F 1KU2A 3EHKA 4RS8A 2FQPA 1GVJA 5J48A 5CVIA 1FBUA 1PP8F 3PLQA 1U5TA 1IXRC 1J3PA 4G6DA 3I7DA 4KDPA 3WW3A 5K5RA 2XAGA 2VBXA 4OLLA 3V7SA 1GXQA 1V4RA 3IRQA 3ZMDA 2F5FA 2IXCA 1JGSA 4YIIA 2RV8A 4HW0A 4RGUA 2QNKA 4JBAA 3VB2A 3MZHA 4XLNF 3WU1B 3U10A 4HBLA 2GXGA 2XIGA 1ZRFA 1BC7C 2Z2SB 4IEPA 2KKOA 4KMFA 5E16A 2EA2A 1P2FA 2D5HA 2RKHA 1QNTA 1HQCA 4BYYA 4KWJA 4E2SA 3RJPA 1DDNA 4LGWA 4L9NA 2YX7A 4LFUA 4IETA 3FMRA 3WE3A 1D8KA 2PA7A 5T3NA 2PEXA 3PFIA 2V1XA 5HS8A 2FRHA 4U0YA 4GULA 3COAC 1CF7A 1Z6TA 2CW0F 2PMUA 5HS9A 1CAUB 1LJ9A 2LF8A 5D5WB 5FPXA 4CZZA 5EFUA 3BY6A 1ZX5A 3LA3A 1IAWA 1R36A 1IN4A 2KJBA 1OD5A 4P9FA 3ZMTA 1F4KA 2UYBA 4P9GA 3EYIA 3MEXA 2XGXA 2L02A 1DUXC 2HTJA 1JE8A 1ZZ7A 1FBSA 4X6QB 1J3RA 1XGOA 2DBBA 1YTYA 4KIFA 3BJ6A 3BPXA 2XRNA 1ZZCA 4L0YB 2HKOA 4IRIA 1BI0A 1OYWA 3FHZA 4XF9A 4R52A 2H94A 2UWMA 4AQ6A 2F2EA 2F5EA 1D8JA 2Z9OA 5L3EA 2IW5A 3P9KA 1G3YA 3IIAA 5JR7B 2M1BA 4LA2A 1TQPA 1U5TB 1S7OA 2QZ8A 2GAUA 2K27A 4HVOA 4BXUA 2HGCA 5FB2A 4MQ9F 1ZH5A 3T1BA 1BM9A 1FYLA 1U2WA 1IXSB 2LSOA 3EQLF 2XAQA 5I8YA 2ZMEA 1L3LA 1Q43A 4L18B 1IN5A 3F23A 2NNNA 2OQGA 3M3IA 5D1IA 3PVBB 5FQ0A 1WA4A 1ZZBA 4OIPF 1LNWA 2C6YA 4I7HA 4HF2A 4IEOA 1T0FA 1QXJA 5ICGA 5LEJA 4ON0A 1L3JA 4U7BA 5FO5A 4IHTA 4MGYE 2O3FA 3ULQB 1J59A 1AWCA 5J3UA 3NVCA 5HOOA 2A61A 4Y17A 3WTTC 2YR2A 3REOA 4ZZLA 2VC0A 2RC4A 4EJOA 2VN2A 3TO6A 2OZ6A 1NE4A 1EH7A 3ETQA 4KWKA 4E2QA 2P7VB 3J81K 1L0OC 1FZPB 2MHFA 1EH8A 4FX4A 5TRDA 4LLLA 5I0UA 3C7JA 5TJJA 2G9WA 3OOPA 4XF1A 5E1RA 1I6XA 4L0ZB 3LWFA 1I27A 5EZWA 3R60A 4P5OA 3H1YA 1TLHB 1PP7U 3ZPLA 4OIOF 2E7XA 1IN6A 1ON2A 4KL1A 2ZO4A 3ZN0A 3O6BB 3FX3A 2IXHA 4BAYA 4FBFA 2FQ3A 4I0BA 5KHJA 4A12A 2ZFWA 4ZU7A 3O3KA 2NRAC 2HDCA 4CGZA 4KA4A 3V8LA 1O3QA 1UW8A 4YFNF 1MJAA 1LKNA 1P92A 1D3YA 5K8SA 3QP5A 5I0RA 3KP4A 4I3PA 2ZMEB 3M8FA 3FWEA 2PQ8A 2ZNZA 3BJAA 5BQTA 3GZ6A 5L3DA 4HYEA 1K78A 1JHHA 5K1YA 4AVPA 1Y3TA 5F64A 5FQ0B 1PUEE 1R58A 2ZKLA 2QM3A 1YG2A 2ELHA 4HVRA 2GA2A 3TNQA 3KP2A 4OINF 1B59A 3ZDSA 2YX4A 2FU4A 3TQNA 3FXRA 4PIXA 1X8MA 2P6TA 4ASNA 3N97A 2GXBA 3GBFA 1U6GA 4PIYA 2VBZA 3BPZA 4RGSA 1BI2A 2DQRA 1XGSA 4UV9A 3WGIA 4O6JA 1S3JA 3J7AO 2HQNA 3KEQA 3K69A 5CVUA 5AONA 1KU3A 3H8UA 2RN7A 3JSPA 1F9NA 2QWWA 1NE6A 4Q0SA 4I98B 4P9UA 2OZUA 4M73A 1ZG1A 1Z91A 4RGXA 3FMQA 5CVVA 2V1UA 3QAHA 3FHIB 1UFMA 3DV8A 2L4MA 1UIKA 4QXKA 2MD5A 3L09A 1DZRA 2ISZA 4BNCA 1IZ1A 3CEWA 1P6RA 2M5WA 5D4SA 1Y9QA 4EWDA 1KQ9A 2K86A 1X3UA 3Q5FA 3EDPA 1LEAA 3LFKA 1YWKA 4QM9A 1FSEA 3EBRA 3U9GA 1TW3A 2WC2A 3ABUA 4QGNA 4MTEA 1YFHA 4XEZA 2O8XA 1O3SA 1VJ2A 4PDKA 2Z99A 2HEOA 1ZGAA 5JFRA 1TW2A 2JPCA 1B6AA 1WKMA 1R7JA 2EWNA 4PGHA 1DP7P 3M70A 3RKWA 1K78B 5LHHA 4XFHA 5JAXA 1XDUA 3FF5A 3KCCA 4RAYA 4UBHA 1U5TC 1T6SA 2IPQX 4ENKA 3ES1A 1PMIA 3WTVC 4HLXA 2GU9A 2R3SA 5D6FA 3MZYA 4X6RB 4EGYA 2ET1A 4G6QA 1BN5A 2EFWA 1LVAA 5HVQC 3ZMZA 1H1MA 5HI0A 1Q5OA 5DUKA 2IXLA 2WTEA 1B9MA 3SHRA 1H0MA 5BPDA 5ILUA 1W7PA 1OKRA 4RGRA 3NQOA 3EJKA 3F21A 4B29A 3BOQA 3DQVC 4JVAA 1K7AA 4U0VA 1SD7A 5BPXA 5JSRA 4XBFA 4EWEA 5DD8A 4KFCA 2DQLA 3I0TA 4QM8A 3GEZA 1ZLKA 4PZJA 4GO1A 2Y75A 1ZNPA 1HW2A 4AWXB 1EPZA 1FPQA 1EY2A 2V6CA 4D0PA 5CADA 5H20A 1O5LA 2KRFA 4L11A 2CYYA 3K0LA 1WGPA 4JQFA 4HX4A 2PAKA 2JRTA 4I0AA 3I59B 2JPBA 2GC0A 4YRDA 4A0YA 2K4BA 5D5XB 1MDMA 2STTA 1OI6A 1DZTA 5JSOA 2ISYA 4MHGA 2XHKA 5DDGA 3MYXA 5LHGA 3T8RA 4KIBA 4BHPA 2EA7A 4I2OA 4A5MA 1R5HA 1UHMA 4ZZDA 1J3QA 3CUQA 1A04A 4JV4A 4XETA 3HRSA 4FX0A 2IT0A 3QPHA 2CAVA 5KHHA 1XGMA 5FFXA 5E18F 1FT9A 1LQ1A 2PYTA 2QCSB 2EV6A 3RNSA 3WW2A 5D8LB 4HSJA 4AIJA 1RI7A 5FPZA 4LLGF 3E6CC 1HBXG 1ZGJA 3F8BA 1R00A 1UD1A 2EFPA 5FFZA 2GC3A 2P6SA 3HIFA 1HSTA 4ENJA 2EV5A 3WE2A 4OOIA 2ESNA 2L01A 3TNPB 1W7PB 4A6DA 3GFJA 4HX7A 1S7AA 2FA5A 2UY9A 1RZ4A 2PHDA 4WXCA 1FBQA 2PLYA 3C3VA 1Q1HA 1SD4A 3NSTA 3E6BA 3B02A 5D4RA 2A69F 2BE5F 4MX3A 2DFIA 2VC1A 3S7IA 3RYKA 3SMHA 2KIMA 5I0TA 1J0RA 4YG2F 3WW4A 2P4WA 3CL1A 5JI6A 2IA0A 3EUHA 1EYBA 3USSA 4Z82A 3V8JA 5HDGA 4MTDA 3DFGA 5EEHA 3F6VA 4HV5A 4O9EA 4XSXF 1U3EM 1MDMB 4EJVA 1CAXA 4WXDA 1BOAA 2QQAA 4RD7A 3H7YA 5BPIA 1V70A 3U11A 5ICFA 4IESA 2XKPA 3TOAA 4QWQA 5L3BA 3TDUC 5FLXK 4Y13A 5DCFA 1J75A 1R23A 1W7PD 2PTMA 2GQQA 5ED4A 4FHTA 4Q0QA 3SCHA 4MNUA 4A2UA 1IW7F 1RGSA 3KGZA 1T38A 3CLOA 5FLHA 5JSPA 2XKOA 5K5QA 2HKXA 2NS0A 4PJYA 4N9IA 3QU3A 4QGMA 1JUHA 2WFPA 3BZ6A 4ZYEA 5BV6A 1YQAA 2COMA 1SQ4A 2DCTA 4HDUA 2A68F 4IEVA 1T98A 1F5TA 3J80K 3BU7A 1D5VA 3GYHX 4H7LA 1BIBA 1HXDA 4WX9A 4OFGA 3ELNA 1CX4A 3G7DA 1U12A 1TNTA 4MGZE 2FBHA 3TOBA 1TNSA 2J5PA 3LAPA 2J5OA 3JZVA 2EA4A 3E5QA 2HS5A 2DPDA 4IEXA 4F8AA 2JTVA 2UYAA 4U88A 4IEUA 4MEYF 4OU0A 4NVPA 1YFYA 2O8QA 5KBFA 1FLIA 3T8TA 2Z3YA 3F8FA 2JT1A 3ZN1A 2DAOA 1FX7A 1BC8C 3FE5A 3I5UA 3TDZC 4Q4ZF 3TO9A 5E17F 2O1QA 2HWVA 2GZWA 4EV0A 5ICEA 3M1EA 2GC1A 4OIQF 4MH0E 2QQ9A 2ETEA 1CAXB 1CGPA 3PNAA 3HSFA 3FXUA 2BNMA 2DO7A 2OZJA 3I71A 3R0JA 3KLNA 2D1HA 2HOEA 2IVMA 4HF1A 1FSHA 3PQKA 1RIOH 4I09A 4ONUA 4L9VA 2CQKA 4LMYA 3OGJA 3FM5A 3R6SA 1KQ8A 3AAFA 3O14A 4YSFA 1HW1A 1ZAOA 5D6EA 4KU8A 1FP1D 2V1DA 4ZYGA 2K9ZA 1WLTA 1S8NA 3MPBA 2QBYA 4GYIA 3IRRA 3J81Z 1CF7B 2XLGA 2WV0A 4LEJA 1E2XA 1QXRA 3DEUA 1T2KA 2D40A 4XFCA 5BS6A 4KICA 2VQAA 1ODDA 1HKSA 1MGTA 3DPLC 4KN7X 4HQMA 3WTYC 3FM3A 2LKPA 2IRFG 4P55A 4YIFA 5J8FA 4XFFA 1DPRA 1OMIA 5A2QZ 3L9FA 1MJ9A 3W6KB 3RKXA 1YLLA 4ESJA 3KSCA 2DK8A 3JSOA 1LDJA 3KP5A 3CJNA 1RL3A 2FNPA 2RDPA 1X7NA 3OCPA 2W24A 4HOBA 3CO2A 5I0SA 2TDXA 5AVPA 3VFZA 3QACA 3TO7A 3IBMA 2OBPA 4UNOA 4NHJA 4S05A 3C3WA 3OD0A 4M9SA 5E1ZB 2G7UA 2O61A 2XV4S 1W5TA 3BPVA 3LOIA 5C6CA 1ZARA 1XDSA 1XCBA 3WW1A 3HT1A 1O3TA 4EM2A 3L7WA 4WXHA 4MGKE 4PGGA 1KU7A 5FCCA 4MUVA 2XUBA 3HTUA 2VE8A 4HX8A 1J9IA 5HDKA 4UVAA 1S29A 1QPMA 3E5UA 3SZPA 3F8NA 2GWRA 3CDHA 3M9AA 5CVRA 4HVQA 2FNAA 1RTVA 1DGWA 1HKQA 4Z2YA 4R79A 4MEXF 2RVCA 5E8GA 2K7LA 3RKYA 2BEOA 2QBYB 3L00A 1ZZ8A 4UBGA 2KIFA 2D2WA 3UKNA 1O4TA 4Q0PA 2HTSA 2Q4SA 4LUKA 1FWZA 3CO6C 2Y48A 4H0EA 3S2WA 3V4GA 4IHSA 5C8WA 3T5XA 4LB5A 1VR3A 1J58A 2K4JA 4HBNA 4O5VA 2PHLA 3BJOA 4XF3A 1F1ZA 2ETHA 5JVTA 4Q0UA 2W25A 3E6MA 2XAHA 3GX4X 3V8KA 3O2PE 4BHBA 3G73A 1RC6A 1YYVA 2ZCWA 5DYMA 4JTNA 1ZYRF 3MQ0A 4B8XA 4IEYA 1I5ZA 2UZKA 3EO6A 3RZZA 1EH6A 4HLYA 4HMZA 4L2NA 2BNNA 2O03A 2MLKA 4UVCA 3KGLA 5LEKA 2DLLA 3ML6A 1GHCA 2QDRA 4ZU5A 3LAJA 5D5VB 5E1XA 5FGMA 3CF6E 4ZYDA 1B4AA 1XE8A 4AVAA 2STWA 2HQRA 1VP6A 4FAHA 3DKWA 2A6EF 2VONA 5LGUA 3K1PA 3RYRA 5IT3A 2XL9A 1SFEA 4A6EA 2MBFA 4HN0A 2IXKA 3T0YA 3S0MA 2ESHA 4S04A 2P5KA 4ZU4A 2QLZA 1PM7A 1KU9A 4XF0A 1SFXA 5LGTA 5DEQA 3HRUA 3LAGA 4TLFA 4JK1X 4ENNA 1BIAA 4J1XA 3D82A 3GFIA 3KP6A 4IXAA 5HLIA 2DK5A 2CAUA 3KZYA 1FNNA 4KT5C 5JHUA 1UPIA 2FSWA 4XFAA 2FXAA 4EJTA 3L2HA 3BCWA 5DD4A 1J5YA 4LB6B 3NKTA 4Q47A 3VODA 3B73A 1ZRCA 5CYVA 4LG0A 3L2CA 5KK1A 3U0ZA 1Z7UA 4M6XA 1T39A 1YFXA 4AD9A 1XSVA 3CTAA 2CG4A 2GIVA 3SZTA 2VBWA 2JSCA 2EFNA 2P5LC 4IEZA 4YYOA 3RPUA 3SXYA 1R5GA 1UB9A 3IL2A 1E17A 4QMAA 2QQBA 2C0ZA 1YW7A 2CFXA 4G7ZF 1MJBA 4KUMA 5F1RA 2HR3A 1FY7A 3I54A 1CAVA 4UXNA 2HYGD 1EP0A 3JTHA 2PG4A 5IT9Z 5BY5A 2QENA 2XAFA 4IJAA 5F6FA 4HQEA 5ILSA 5CU1A 3S7EA 1I1GA 3JAMZ 2VT2A 3RIRA 4L5JA 4FAGA 5HLGA 3WTZA 5K5OA 3LA2A 4XLPF 1SMYF 1GXPA 4G7HF 3PQJA 3C18A 3D0JA 1IPJA 2BV6A 2DU9A 4ENMA 2H6BA 2IA1A 1LDKB 5AIQA 4BHCA 3RDIA 2VECA 5ICCA 4ZYHA 3MDPA 3E6DA 3U2RA 4F7ZA 3DP7A 2Z69A 3LQRA 1ZVFA 4U0WA 1IPKA 4ESBA 2ATFA 4YARA 3K9TA 1MD0A 3H1MA 5KHGA 3HRTA 2BGCA 1YS7A 3FZVA 3TGNA 4BIFA 1ZHFA 1FC3A 1QZYA 1WRJA 4MV2A 3F72A 1STZA 3BDDA 2OPKA 3JW4A 2PJPA 1LRHA 2A07F 4EM0B 3ST7A 1ZRRA 1KYWA 4LG0B 4UUVA
chains in the Genus database with same CATH superfamily
2R7WA 2PN5A 4Z92B 3PTYA 2E1NA 2MH9A 2QQJA 5H9SA 2TNFA 5F08A 3BTXA 2BTVC 5LBEA 2MC4A 2OD5A 1TMF3 1W6PB 3GF2A 4QX7A 1SEFA 2V73A 3DTIA 1PVXA 2L7ZA 4FT8A 3ACHA 4RGAA 1GR3A 2WZPP 4FPLA 1HB1A 4IV3A 4LLFA 1H9GA 3AG4H 3OSFA 1JS9A 3G1LA 2DMUA 4LQRA 5SV8A 4AVZA 1WLDA 2DI3A 1QXPA 1EV7A 2YG0A 1CAVB 1RUI3 1CX1A 2TCTA 2Z16A 2CGPA 4XMYA 5L7OC 2JX9A 2V09A 3ZP5A 1VQ5I 2CDOA 1KS5A 2VOOA 1OPCA 4EVIA 5I8TA 2HDWA 1GZ9A 5FLXZ 3RSNA 3FBMA 4Q29A 1YE9A 1AR61 2E34A 3D5OA 1GNZA 1XRUA 6PAXA 1WI3A 2EIDA 2D3PA 1AF9A 4DGWB 4OUSA 2QE3A 1I39A 1Z6RA 2M9HA 1Z9CA 4YW4A 2XPJA 2L7KA 4OMYA 2O8OA 2XMLA 2X51A 1X4OA 1FYMA 4ZHNA 1T95A 1QU3A 4IEWA 3GVAA 2K0GA 4DZGA 2I5UA 4GGGA 4X6AJ 1DCSA 2IBDA 4CEYC 5LCWL 3F6OA 3LD8A 1RHI2 3G71I 2AXLA 3GXOA 1FP2A 4CO8A 4QGLA 4CU6A 4IV3B 3IWZA 3G6EI 3NL1A 3GO5A 1CPNA 1MSFC 1AR63 3ELKA 3WQ7A 3F95A 2DCYA 4D7SA 3TN92 2DVBA 4QPYA 4K40A 2R7OA 1ONVA 4D0QA 2OCCH 2RNGA 1XYOA 4E8DA 1S55A 4OVEA 1ENHA 1QJU3 4F91B 3VHNA 2IA2A 4BQAA 5JDBA 1IJWC 3GFLA 2PBIA 3O12A 1QJZA 4EJWA 1QNYA 1MMSA 2VZSA 1XC5A 4W4ZA 4EN8B 3KP7A 3HQUA 1ZZ6A 1AHSA 2ZGRA 4IXLA 4PJNA 2X0LA 3T4VA 3FHNA 3RWNA 2VQUA 2JWPA 3CJIA 2ZGQA 4IO9F 4YW6A 1NAEA 1MEC1 3M07A 3W6VA 3V65A 4FOQA 3AL6A 4D6SA 1GV9A 1SMVA 3HBZA 1G3SA 1LDDA 2C26A 3H0GJ 2X1DA 3AL5A 5KHKA 3HBLA 1E57A 3LSJA 4JHZA 4OIRF 3IH3A 3LEIA 3T2OA 3O0WA 4IQPA 2DV9A 3NW4A 2LH9A 4JGZA 2W00A 4FO9A 2WWYA 3GYDA 1AR83 5D8KB 2ZX2A 1EUTA 1RUG3 2WN3A 4M71A 3OS2A 1XE7A 1AOYA 2NQYA 2DDAA 4OWRB 3S3MA 2R7DA 2RDRA 1W8TA 1U0AA 1MBHA 5BOXA 2LALA 3Q8BA 2Y31A 1SFUA 4N8MA 2UWAA 4AFDA 3QU6A 5J8CA 1XBFA 4NR1A 3B7MA 2HOTA 2PELA 3DWLE 1MS0A 1JZ8A 4RB3C 1LEBA 2XGCA 5JZGA 3ZPOA 4G8XA 1YUDA 3K2ZA 5LK7B 3K70C 1SD6A 2VIXA 2CHHA 4EQQA 1XSQA 3LA7A 1HDDC 4LJZF 3V42A 2AS5F 1SHWB 3CD6I 5K7PA 4CDGA 1GNYA 5DCMA 3VBSA 2VMGA 4BQ5A 3I2DA 2VZVA 5JXHA 2MGQA 2XRLA 2DCEA 5FYMA 1XN7A 1G3WA 1RR7A 1UYYA 1Y9GA 2IP2A 1HRI1 5EV7A 5GZCA 3CJIB 5LZ6A 2AXTC 2PN6A 3ECOA 2YC0A 2PAEA 1B9NA 1TT5B 3CQOA 4CCCA 4M00A 5FAXA 3DKXA 3B5LB 4KBZA 4IKFA 1BVP1 1HDKA 2KM2A 4ITCA 3GZEA 1BBYA 3FJSA 4ASLA 4EN9B 5FZHA 1H2KA 4CP2A 1I3AA 3HGYA 4C2TA 4DOZA 2MYSA 4AEDB 4M9XA 2W48A 3POYA 2WY7Q 4JGZB 5LY2A 1JOBA 5JCTA 2P17A 4NRQA 1SBDA 3E0JB 5EPAA 5J6XA 1FAYA 3AYEA 2W95A 1PO12 4IPAA 2VMEA 2FBIA 3CUQC 1NYWA 3ZFFA 5FY1A 1Y7BA 4QD2A 4JP0A 3PM1A 2EQRA 2EINH 1WLCA 1HRI3 1D2SA 1DIWA 4OI4A 4CHUA 5EWSA 4GMP1 1F43A 2EK5A 4ATFA 1YFWA 5JZGB 1RPWA 2O6GE 2M30A 3WNMA 5EJCA 1IC8A 2ZHNA 2XASA 1VLNA 1TVGA 5ILVA 3MIBA 4QX2A 4PF1A 1X1BA 5DCMB 3VBSB 1IQAA 1LECA 1P4AA 1RUJ2 1LGBA 2OIIA 2DFFA 3Q8AA 3SNMA 2XF6A 4A0XA 3S93A 1XYPA 4DYQA 4A3DJ 2HWE2 1U5YA 4CXFA 4M6VA 4EROA 4AVTA 5F7UA 1LOFA 1XMXA 3BQZA 3HMYA 1W36C 5C8CA 3KX2A 2C6SA 3HUGA 1N3QA 1I5PA 1ULFA 2D3SA 4UFIA 5GADJ 4CCOA 5GLWA 4NC7A 1ON1A 5FYYA 3ETPA 3I59A 2YBKA 2UXNA 1Z05A 2AR6A 2KZVA 4UXAA 2LK2A 1SDDB 3ZMSA 1OXCA 3IAPA 2WR9A 1QWRA 5EGOA 2BVLA 5FD5A 1GZCA 3MEPA 3PUHA 2X8KA 1AVBA 5LRRA 3V56A 5ACA2 2E33A 5M3FJ 4QXBA 4L9JA 4Q8LA 2EFQA 5LGNA 4J1WA 2L0KA 2P34A 2IEKA 1APNA 3T1LA 4MGIE 2FMLA 5IVCA 4AIHA 1V9U1 3P9CA 4LLOA 2ZTNA 3VYUB 2EALA 1C8M3 5IPAA 4ETSA 2FDFA 3SC7X 4NIIA 1ZREA 4FTBA 1KD7A 3VBOC 4EJUA 3P3PA 4B3XA 3ROUA 1FMD1 1FTTA 2PMHA 4XNFA 3T09A 3ES4A 3ZOIA 3MW2A 2RMU1 1XD7A 5GAEJ 2ZZQA 1FV3A 1FEXA 1BMV1 4XJ9A 5A7NA 2CS3A 4AEJA 3VPRA 4KQ7A 5C8CB 3WG1A 3HUGB 3WDXA 2RGVA 2DJIA 4FISA 2NVUB 3AVRA 3K46A 2F5VA 4UB8C 3BB6A 1GZWA 4JX0A 4RHV3 2EIJH 4TV7A 2XAUA 1NXMA 3Q9OA 2LRDA 5IT9K 2CV6A 1V9U3 2F6BA 1W2OA 4RB0A 5C3OA 1UL9A 3JAMK 3PL8A 2VOPA 1X8EA 3LFUA 3R61A 5T5PA 5EGOB 3IDAA 2A6HF 2E7AA 4ORFA 5DM7F 3F22A 3BR2A 4DBQA 1H8AC 3OV8A 2IVJA 2Q5TA 4IX7A 4KJZA 3ZXAC 4LUMA 2ILMA 4I6ZA 3RI4A 3DXJF 1GOFA 4LO8A 1Q8VA 4NPRA 3ACLA 3UKVA 1CJPA 5LFAA 1ZZ9A 1JBCA 2ICWG 3ZXSA 2QJVA 2DTRA 3VDXA 3A21A 5CFCC 2VPVA 4Z07A 1TMF2 3KIOA 3TBIA 3LQQA 3HOWJ 4Y15A 3SDGA 4A45A 4BZ4A 1QJY3 1QY4A 1RXGA 2D1VA 2SLIA 1EV11 1A34A 2WNEA 2QQPA 5CJ9A 4FTEA 3MUY1 2P37A 1IKQA 3F8CA 4XRSG 5EXOA 1L7RA 1ZLJA 2UXXA 4Q5SF 1ODMA 3V7RA 4HPKB 4LBOA 5C4XJ 4EMSA 2IXJA 4A4AA 2FQPA 1FIPA 1CZTA 1PP8F 3PLQA 2VXDA 1U5TA 4AOCA 1MPXA 1GZWB 5AC91 1LPQA 3I7DA 3ZN5A 1UF2C 1N1YA 1R49A 5E88A 1B35B 1HKDA 1RUC2 4L8QA 1V4RA 1LEMA 1IG0A 3ZMDA 1O8SA 2VNOA 1W8UA 3VBHC 3A0NA 1JUIA 4XAAA 3PTRB 3VB2A 2Y6JA 2FOWA 1K3IA 2GXGA 3F0CA 4IEPA 5CAZA 5A3MA 2EA2A 4XXPA 2O7OA 5DZFA 1POV3 2RKHA 1CIWA 4BYYA 2XSJC 3UNPA 1EV13 4QX1A 3LOCA 3IAM2 2YX7A 1D8KA 2PA7A 1Q8SA 1VBE1 3ZXLA 1I9RA 3LSHA 2FRHA 4U0YA 2YDEA 1R1ZA 3SZGA 3COAC 1CF7A 5BNNC 3AZYA 5FPXA 4CZZA 3WDVA 1ZX5A 3H42B 1IN4A 5A80A 1SLBA 1OLQA 2ARXA 3SLIA 3BUCA 4LOTA 1F4KA 3EYIA 4P14A 3W2AA 2XGXA 2L02A 1OA3A 1ZZ7A 1FBSA 1YTYA 3CMEI 3BJ6A 4XOTA 1O4YA 5JR2A 2HPIA 3SQOA 1BI0A 2ZFUA 3CZUA 3J7MA 2H94A 4XQFA 5KCMA 4D7MA 2NM1A 3ILRA 4HKLA 4AI1A 1UOGA 2BXYA 4Y22B 3DPRC 3M2MA 4NBQA 1U5TB 2K27A 4GD4A 2DA5A 2PLV3 5L9BA 3U1XA 1W0UA 5FB2A 3WZ1A 1BM9A 1WBLA 4Q4W1 3U14A 1O91A 3JQXA 4Q8KA 2LSOA 3EQLF 5A1FA 5C3PA 1KITA 2P0WA 1GUIA 3H0OA 3JR9A 1OPOA 1MZ5A 2XJPA 3PNVA 1Q43A 4HRIA 2K2SA 4DMIA 1HN1A 2OQGA 5D1IA 1GDTA 1BR4A 3KVBA 4OIPF 2XHNA 1AR82 1QXJA 5ICGA 4ZTJA 3T0DA 2XXZA 5IYBJ 4YM0A 1VMFA 2O3FA 2V7FA 1J59A 1AWCA 5J3UA 1VB4A 2W82A 4ZZLA 4AI0A 2VC9A 1LKXA 4XKCA 2XF7A 3MV01 3RZDJ 1DZQA 2BY1A 5JPNB 2XB5A 1JYIA 4EJOA 2VN2A 1NE4A 3OL4A 1EJ9A 3S1RJ 1G86A 5CFDC 2VI6A 4KWKA 2P7VB 1L0OC 1UX7A 3LDBA 1EH8A 4F83A 1X9TA 3WG4A 4Q4W3 5DQ0A 2VULA 5TRDA 5I0UA 2Y34A 4RQPC 1QOOA 3ACFA 4FETA 4L0ZB 3RS6A 1Y8RB 3LWFA 3OYWA 3R60A 3H1YA 4OIOF 1COV3 1F35A 5EG0A 4O65A 2WNOA 4AUXA 1GNHA 4O61A 2A6VA 3WP6A 2ZO4A 1W2NA 3O6BB 1FJLA 1T33A 4XQDA 3RZOJ 2YB7A 5SV5A 2ZFWA 4ZU7A 4ZDPA 4TTGA 1RMU1 2HDCA 2BHZA 4B48A 3LE0A 4KA4A 3V8LA 3MIGA 2WYSA 4XUNA 4BM8A 1SLLA 5FOBB 4BLIA 2X6WA 1P92A 3CCEI 3FC0A 1D3YA 2R7VA 5FPBA 4I3PA 4HL0A 1VMHA 4IQJA 2PQ8A 2KR2A 2ZNZA 3BJAA 4IV1B 5K1YA 3S16J 1PUEE 1LHNA 1UOJA 2ZOEB 1YOVB 2F48A 2DN0A 3AKZA 2P3YA 2YU1A 2KQRA 3TOJA 4UW3A 5HNHA 1U9NA 3TQNA 4FSJA 4Y5SA 4D5CA 4E8CA 2XB6C 1X8MA 5EJ3A 2P6TA 3A0BC 4ASNA 1DQ0A 5T55A 2GXBA 5B2GB 4HONA 3GBFA 1U6GA 2XBO3 2VBZA 1RUF1 1BI2A 1XGSA 2E2JJ 1W6NA 1RYYA 3CDZB 1S3JA 1WKYA 4EZHA 5CVUA 2LYCA 3AKPA 1KU3A 1W1WE 4XKVA 1UU6A 4Z8BA 3JSPA 2KRHA 4Q0SA 4BDZA 4MOAA 3CKHA 2IUWA 4Y4YA 1ZG1A 2QKMB 4GIQA 5CVVA 5E6HA 3VBRC 4Q4X1 3FHIB 3OYWB 2D6PA 2Y6LA 4K7JA 5HPOA 1UIKA 3ZYHA 4BJTA 5DABA 1GP5A 1KONA 3ZRGA 5FWJA 1IZ1A 5T5JA 3BR6A 2X6YA 2FDGA 3VYRB 3ZMOA 5D4SA 1Y9QA 3GTJJ 4EWDA 1WD4A 1V6IA 1KQ9A 1VBC3 1Z7S3 3ZMNA 1X3UA 4NPMA 3Q5FA 3EDPA 1YQCA 1LEAA 3LFKA 1NCQA 1IV6A 2ZAAA 1FSEA 4QDSA 3O1SA 2E7TA 2XSDC 1MH4A 2W1UA 2W52A 2OC6A 1H2LA 2P3IA 5IVFA 1OCRH 1ZGAA 2XR4A 1TW2A 5IT6A 5FP7A 1QMJA 1DP7P 4PGHA 2ID6A 1PVC3 3M70A 1OQEA 4XUTA 3CMGA 4QKBA 3FF5A 3ZR5A 2DA6A 4XVHA 1OLME 4RAYA 3S1MJ 4UBHA 4HNTA 4CP1A 1GWKA 1E5RA 1PMIA 3WTVC 4HLXA 4Q4X3 2GU9A 1OURA 2R3SA 1PX3A 3O1UA 4C2MJ 1PGW2 3MZYA 4OHWA 1JI6A 3UV9A 3JD71 5DM6F 5HVQC 1T6GC 2HVQA 3ZGKA 3KV9A 3FBIB 2Q8EA 3MW4A 4YZ3A 2IXLA 2XVGA 1W6NB 3PUQA 1H0MA 2XOMA 1K4TA 1C8M2 4L9BA 2WAFA 3EJKA 4D6RA 3F21A 1MNDA 1UPSA 5B1AH 4U0VA 2E32A 3BCAA 4OI1A 5JSRA 2YU9J 4KFCA 3J8F3 1DYOA 1YNAA 3K4LA 5KC6A 2V1NA 4PZJA 2ZEXA 2Y75A 5FPAA 3BR5A 3LQCA 4D0PA 3HNMA 3N9OA 1JYWA 2OUJA 2VASA 3VLBB 3GHNA 5K7ZA 1D0HA 1IZ3A 3ZFEC 2PAKA 4I0AA 2J1RA 3VKMA 1MBJA 1NCQB 2RS51 4II3A 3VBUA 5D5XB 2WZ8A 4YPJA 5IK7A 1WW4A 2XJSA 4CDWB 1W8NA 2B7YA 5DDGA 1NQJA 3T8RA 4KIBA 3BVCA 3HPNA 4I2OA 4A5MA 2YROA 4E4SA 3CUQA 4E7ZA 3HRSA 3GM8A 1JHJA 2ZGSA 1RKTA 2VQCA 1MSEC 5C3RA 2CAVA 2WAAA 5FFXA 3HDDA 5JIUA 4XDPA 1FT9A 1AX2A 2R7QA 2EV6A 4GB31 3WW2A 5D8LB 3QODA 1GLNA 4LLGF 5FJ8J 3MBWA 5FXZA 1IRXA 2P6SA 1HSTA 2L9NA 2EV5A 2HWF1 4OOIA 1ONAA 4XDQA 3KM5A 3OWTA 3BR3A 2GOMA 2FA5A 2RS53 5H9PA 1Y9MA 1VRH1 3P5BA 1G9BA 5DUWA 3BLYA 3OSGA 1REDA 1AL21 2EF6A 1BBT2 3HJRA 3B02A 2DFIA 4WM8A 4D69A 3RYKA 1AR92 5FLMJ 1RUH1 4E7JA 4QB1A 3NO8A 5FYCA 2JA8J 3HOXJ 2P4WA 3PSFA 1RUE2 3SKJE 5TGTA 2W39A 3GTLJ 4N7UA 3KYDB 3DFGA 3OD4A 3F6VA 4HV5A 4O9EA 4L97A 2LTNA 2D43A 3VBUB 5DAWA 4PLMA 4FP3A 2Z79A 4RD7A 3H7YA 4NHLA 1JUPA 5ICFA 3N9LA 5D21A 1EUUA 1MS5A 5LASA 3ON7A 3TOAA 4GDFA 2R1DA 2XJRA 3BTCA 1R23A 2VBDA 1QOSA 1EKEA 4A93J 1VBA2 2JSPA 4E6KG 4MADA 1ZBA3 4MO7A 4A2UA 3B69A 3DYMA 1IW7F 1VRH3 2HEVF 3ESWB 2XKOA 3O7OA 1VAKA 2X1EA 1ULEA 1B8IA 4F55A 4N53C 2R061 4OHYA 1XQNA 1DP3A 4CDQA 3OGSA 2EXIA 2DCTA 4IEVA 3I55I 3OYDA 3RQ0A 5IVYA 3K4JA 2VY0A 3GCMA 3WF3A 2OUHA 1CX4A 3G7DA 1U12A 4II2A 4MGZE 2XQXA 4C9YA 3PO3J 1TNSA 2WZR2 2HQ5A 1UMHA 3O1TA 1JUSA 2EA4A 1PO21 1X1CA 4PBOA 2HS5A 2HPMA 3GLLA 5BNPA 1VQ7I 2JXAA 4XZUG 3EB7A 4HSTA 5FYZA 2YFZA 3CMYA 2ZX4A 2GC1A 2K3PA 3PU3A 1XYNA 2LR8A 4ZS3A 3DEEA 1OQYA 3MKYB 2OZJA 4MG2A 5C4JJ 2W68A 1DGWY 1RUD1 2D1HA 2HOEA 5FPVA 4I09A 4EN0A 2FCUA 4YVWC 2JUCA 1MACA 3FM5A 1R1A1 1JYXA 1KQ8A 2RS31 3VD9A 1ZAOA 3TP3A 4KU8A 2V1DA 4ZYGA 3SKVA 1S8NA 4AI8A 2RV9A 2VPLA 3H9QA 3J81Z 1QA6A 4Q5OA 4V2VA 3JRIA 5DUXA 2Y64A 4WVWA 3DEUA 1T2KA 2ZGLA 4H2AA 4CDQB 4FFGA 2HLEA 2BZDA 2Y38A 5GP9A 2IRFG 4YIFA 4BL0B 1MJ9A 3RKXA 4DUWA 3JSOA 3LFMA 3CJNA 1K5JA 2FNPA 1DQ2A 2KZGA 5L73A 1X7NA 2LBFA 3FISA 4HOBA 1V54H 1C5HA 4JCKA 3FBYA 3RRDA 3QACA 2O8KA 1CD3G 1S7EA 3T2TA 5BNPB 3I4NJ 2GMMA 3SH4A 1X2NA 4EN7B 4XONA 2GDFA 4V2WA 5IP6A 1DFQA 2G7UA 3VBFC 1HC8A 1ST8A 3LOIA 2EIGA 3WV6A 1ZARA 4YM3A 5FO9B 2VCMA 4KH9A 1HF0A 1LHOA 3H3LA 2IVIB 3I2HA 1O3TA 4EM2A 3L7WA 4MGKE 1A78A 4UFJA 3POJA 1D2QA 1XNBA 4B44A 1XNCA 4CXWA 2GN7A 1FOWA 1FV2A 4RBOA 5FUPA 2VJ4A 2Z4FA 1ND3A 2WNUA 3CDHA 3M9AA 2LM3A 4HVQA 3NNGA 4DW6A 3S3NA 1DGWA 4MHRA 1OQDA 4MEXF 2VL8A 3RKYA 1TME2 2NXNB 2Q1FA 4AQTA 3L00A 4UFKA 5LWBA 3PNTA 5ANQA 2V9PA 4WZFA 3S6PA 3ZR6A 4NIDA 3GCXA 4H0EA 2RR11 4IHSA 3JXSA 4Q26A 3AL0C 4LB5A 1VR3A 4HBNA 3BJOA 1HJFA 3OG2A 4HEA2 3OPWA 3CCLI 4IHXA 4Q0UA 3ABZA 1N25A 1EAH1 1S0EA 2XAHA 2E2IJ 5FY0A 5GPAA 1YJNI 1IG3A 1OD3A 4NROA 2VPRA 3G73A 1YYVA 2ZCWA 2LBFB 4PSWA 4B8XA 4CZSA 4COWA 1I5ZA 5IHRA 3DKYA 2I2SA 1YC61 1LE8A 1EH6A 4HLYA 1YQ2A 1VBB1 1WW6A 2TBVA 1F5JA 1QH7A 4IE5A 4UVCA 4X8PA 2DLLA 3HOZJ 2CUEA 3ML6A 2WS92 2R071 3N05A 3APBA 2R92J 3PVNA 4CDUC 5LD2C 1JHNA 3AMHA 3WNNA 1XJAA 4PFPA 2X6OA 1POV0 1XE8A 4AVAA 4AHZA 3SEPA 2VCAA 3HR9A 2TEPA 1AU7A 2VONA 3JUUA 5LGUA 5GPCA 2QFEA 4R9CA 3BZCA 3C2BA 3M8LA 2VZUA 5E89A 3OYCA 3POSA 4RN5A 2BXZA 1Z7S2 4YW5A 4AWDA 1P8JA 3S0MA 1X33A 3PUIA 1H4HA 2A6YA 3WQBA 3QYFA 4ZU4A 5DG2A 1OVSA 2NZ9A 1KU9A 1ND3B 2WNUB 2DCKA 1SFXA 1LULA 4XF0A 2OXBA 5DEQA 1GWMA 3LAGA 3ZPYA 5E3MA 3B94A 1OC1A 4BQWA 4ES9A 3L2RA 3KP6A 1XX5A 5C4WC 4IXAA 5HLIA 3JQWA 2CAUA 4S2HA 1UPIA 1K5MC 2PJRA 5ABJA 5K7HA 3OYLA 4Q47A 1SLTA 1MZEA 2R0FA 4G12A 2B45X 3CLQA 5FZMA 5HXVA 2JKXA 3J7AY 3ZM8A 3CTAA 2CG4A 2GIVA 5K0UC 2P5LC 2JVGA 2GSYA 3N7LA 4RM2A 3LEKA 5A7OA 1YW7A 5KXDA 4NHXA 1QJX3 4W6YA 1FY7A 3R4SA 2WADA 2J1UA 4FPGA 1LE8B 4UXNA 1IV8A 2A5ZA 2PG4A 3KYLA 4AHWA 2NVYJ 1N75A 4QKFA 4HQEA 5FKNA 2HNHA 1VBD1 3WTZA 5K5OA 1YJLA 2ZGUA 1BEV1 1GXPA 4G7HF 3PQJA 3OPZA 3L2YA 1JI8A 4KG8A 2DU9A 4ENMA 1FPN1 5FRMA 1LDKB 4BHCA 1SFOJ 1VRBA 1QJEA 3DP7A 2ATFA 2CY6A 1GWLA 2EIKH 2WINB 3BTZA 4Y5Z0 2YUEA 3BTJA 1MS9A 4A42A 3W5MA 5DAXA 2BGCA 2XC7A 4DY5A 2WB1N 1ETVA 4COYA 4HSRA 1FC3A 3K75B 1STZA 3BDDA 3AC0A 2PJRB 2A07F 2VKVA 3GMEA 5ABJB 2EZHA 3T0BA 3ST7A 3A1YA 2P6HA 3Q3SA 5BYNA 4QPIC 1O5UA 3ENRA 2HFHA 5C70A 3QH7A 3I3DA 1UY4A 1TQIA 2DF7A 1WCDJ 1OPMA 4XJZA 1YO5C 4XSZF 2VZ1A 2EV0A 3WP5A 3I3BA 3J7YJ 2Y6KA 4M0NA 5L3GA 5IVBA 1MZBA 4I99C 3KEOA 1ASJ1 2WWSA 2FE3A 3P7NA 2VMFA 3PDQA 1OJLA 2IS2A 2P6CA 4ASKA 1N1TA 2W87A 5DUIA 4B4QA 2W1OA 1P4XA 1OYIA 4BXXJ 3H36A 4LE4A 1GKBA 4BDYA 1H1IA 2R0QC 3K1NA 2FDKA 4Y1YA 1SC7A 1T56A 5KVRA 3WF1A 4H14A 1BL0A 1DGRM 3BTIA 3R4KA 4GCVA 3EUAA 2OPTA 2HI3A 2VZPA 5T54A 1QGPA 5FO8B 2ZNYA 4XLFA 1DLCA 3NV1A 4RGKA 4HSLA 4Q4Y1 1CQ9A 1W5CC 4YFKF 2ZGTA 4A0ZA 2W57A 3RZJA 3NWTA 5EJZB 1AX0A 2Q0AA 2M0MA 4C91A 4BEHA 3USUA 1UZVA 1J84A 2Y60A 1HXS3 2ZGNA 4NIGA 2OVUA 4RYDA 4AHYA 2YV8A 5BNOC 1WZ2A 3A22A 4IZZA 2M8EA 5FZ3A 3AM2A 1AR71 3S15J 1PVEA 3J80Z 1UYZA 2O9LA 3HSEA 4BGDA 4OMDA 5HV0A 3NV4A 1ETXA 2HXOA 2H09A 4YFXF 5FP8A 2JE8A 2DFBA 3CLPA 3VYTB 1ODNA 1AKHA 1KGSA 4IERA 4DNCA 3ONQA 4Q48A 1SDWA 3JBG2 2M7AA 4FTHA 2XUEA 2XJUA 4KNYA 2D45A 1OFNA 3OIOA 2G7HA 1XCVA 1E5HA 3OMYA 1JJ8C 3UKTA 1XMKA 2HVSA 4BE1A 1Z7LA 4WF2A 3F9KA 2IJLA 3BROA 5FLVA 2FMYA 2Y30A 2BBYA 4LKEA 4L9TA 2JUGA 2K5CA 4L5IA 3IIIA 3TB0A 1KYZA 5B5EC 3CCMI 2MG4A 2KP6A 3ACGA 2LY2A 5DN2A 4MGQA 2LNBA 1R083 1W8ZA 1TZOA 1SLIA 3GFMA 2WO7A 1CESA 4HN1A 5DDJ3 2IGOA 2DBIA 1HRV1 1TQMA 2ERFA 5LBQA 2YPDA 2RG4A 1Q3EA 2UU8A 4E70A 2TUNA 4QHZA 5F0CA 1RNLA 1AYM3 2EB7A 4BEHB 3USUB 3QPTA 3VYSB 1H6XA 4QPQA 5M5YJ 3X29B 3BP8A 2VBYA 3ZSMA 1MMGA 3RFRA 1WLWA 2DMQA 1SACA 1ULDA 2Y0SA 5DMYA 1DPUA 1MS3A 2E2HJ 1YIFA 2DA2A 1JXSA 1MH3A 5EYRA 4C1WA 2K40A 4OHXA 2YGMA 1HCRA 3KYCB 2Y9ZA 2A6XA 3QRFF 3WTUC 4UFMA 1Q8QA 4FOYA 4AFMA 2PMZA 2VCCA 3VL9A 3RZHA 5LATA 2VW1A 2JEMA 4YGBA 4YFZA 4R9AA 3GTGJ 2ZKNA 3HGGA 2KL4A 4G9YA 5FLJA 2RQPA 4RLFA 1Z1DA 5E1WA 1NCRA 2JZYA 2EZIA 2FF4A 2GM4A 2WDBA 1X82A 2WNVC 3QP6A 1ETYA 2RJ2A 1FXZA 3C7GA 1K79A 5GZEA 4K2EA 4XUQA 2BYVE 2XH6A 3H9JA 3GTOJ 3E97A 4NRMA 2IC1A 2WLQA 1FYKA 5FFOC 4HV6A 4CCLA 3OUIA 3VD5A 3AMMA 2O0YA 2DUPA 3NV3A 1O7FA 4KYWA 4XACA 1O57A 3R4DB 4X0GA 2BY0A 2VVEA 1ZBE2 3N9MA 1RVF1 1GMMA 1IUYA 1JYCA 3X2QH 1W5SA 1XNTA 2I07B 4FP2A 1EPWA 4M3CF 1SCRA 3SH5A 5C3SA 3SFIA 2B42B 1SD5A 5A7WA 2F5CA 4RB2C 4ITVA 1H9TA 3N9NA 5A3LA 3MKZA 3B00A 1PDNC 1S6LA 1BI1A 3VEPA 4RR3A 2BZTA 4PLOA 4XZPA 3H1WA 5HLHA 3CJXA 4IE4A 1POQA 5L7OB 2QVOA 4IE7A 5ISLA 1QQP1 2QYOA 5D8AA 4M9ZA 3M3EA 1E3OC 4LA3A 3WG7H 2XROA 3RMXA 3K1MA 1XPXA 2YBSA 3ABKH 1LHVA 1U0JA 3SHFA 2PFBA 3CDLA 4MVTA 2A5WA 1N77A 3K4MA 4HF0A 1BI3A 2VH9A 1BA5A 1ALYA 1NCRB 2XVLA 2A71A 1JJ6C 5JMCA 2VT3A 1NX9A 1P9QC 1W9FA 2A3WA 3C7OA 1Y0UA 3C1DA 4LORA 1QOTA 4AFAA 4Q4V1 4XIOA 4S2FA 4MQVA 2BU9A 2HZDA 4AYBN 3MKWB 4XABA 2WSVA 3GLXA 2JA7J 4DXZA 2NNYA 2WFF3 4GWNA 3OS1A 2K02A 3NNFA 3FXKA 5A70A 3QOPA 4CEYB 3WHBA 3R0RA 3HSRA 2OQ6A 4H7MA 4IV3C 3M7GA 3R05A 2V9VA 1W6OA 2EVXA 2A7AA 4O9GA 1SZBA 1JODA 4K6BA 2F5DA 2GP5A 1OYYA 4AI9A 3ECHA 1IN8A 4P9XA 1UELB 2L4AA 4INDA 4RR3B 5CBLA 5JI7A 4DRRA 5DV5A 1VTNC 1ZQ3P 4KISA 2KJCA 3OYAA 2VOVA 2ZGOA 2RM23 2ELKA 2XVCA 1VQMI 2VJ5A 1E3PA 5D8AB 3PIGA 2GH2A 5CQGA 5FKKA 1KDMA 5KHIA 3HL2A 5F6LB 4BQ3A 2AGSA 2Y0OA 3TL4X 1D4M1 2M87A 4JDNA 2CDPA 3WGHA 2GH8A 1B72A 1XOYA 4AR2A 5I0DA 4Y26A 1YIPA 3M1CA 1FIAA 4CPBD 4OAZA 3NJZA 3EUKL 5CG9A 3KETA 1C0WA 1Q8OA 1JU4A 2B9UA 3RCOA 2CFOA 3DLLF 5FJHA 4LBNA 1VIWB 4A5NA 2EIMH 4NUBA 2VXRA 3FIWA 2X4HA 2GN3A 5J09A 3VHRA 2XPVA 3ZYRA 2NP0A 2R7ZJ 3PIOF 3BOWA 1LR5A 3MUZ1 2ACJA 4MGSA 3UNGC 1MKMA 3MW3A 1ULCA 3SXWA 1W6QA 1W6OB 4K8RB 1UZCA 5J7MA 1LHUA 3BALA 1GP4A 4F52A 1G3TA 1PIV3 3MI8A 3IDBB 2JG8A 1POGA 1K6YA 3WDWA 2R4GA 3A02A 2YHJA 2HWD3 3Q0UA 2R49A 4QWNA 3W2VA 5BMZA 2VJXA 3IH2A 1S0FA 4NIHA 5E8IA 2ZXJA 5FBZA 4M3GA 3EPZA 4WCGA 1IPSA 2J42A 3AYCA 1O7LA 1GT0C 4OMCA 4YNIA 3P9IA 5IJRA 4IW3A 3VZKA 4IOAF 3E3VA 1FMD2 4Z1VA 5LBFA 1ACIA 3I2OA 4XCAA 5LK5A 1KDKA 1MVEA 2JA2A 3DTEA 2MEV3 5LLQA 2CNAA 2ZHMA 5FD6A 3CJIC 1YIOA 2CQQA 1H88C 4WZCA 2H6CA 2K3FA 3OTFA 4FCAA 1QDOA 4K8FA 3FUOA 3TEWA 2NS7A 2CO5A 2E71A 2QUFA 5T5OA 1BMV2 4DNYA 1B72B 2G4IA 4V2GA 1OSGA 3ZQLA 1CAUA 4B7EA 4YG6A 4TZDA 3LSTA 4KWLA 4AEDC 2VQGA 4JGZC 1V55H 3I2FA 5C5TA 3DXTA 4CA0A 2X5IA 1AYN2 2OQRA 3MFKA 1PM4A 2GC2A 4EN6B 4D7TA 1FX5A 4CP9A 3G4SI 3OBTA 2KMUA 1RHI1 3OF1A 4JX5A 2VE9A 3N4MA 2FOKA 3FN9A 1KS4A 1AX1A 3KP3A 1HIXA 1IQDC 3IMNA 2Y26A 1E0EA 5FLIA 3WHTA 3KZZA 2DUQA 2Q2EA 1E5SA 2E7WA 1PK6A 1YQ6A 1QGLA 1BZWA 3K4KA 5J48A 5CVIA 1FBUA 4UUSB 3T4HB 2GNMA 5GKAC 1GU3A 5FZ4A 4G6DA 5JZGC 1IDZA 4KDPA 5K5RA 2XAGA 3HN1A 2VBXA 2KFDA 1BK0A 1MBKA 4OLLA 1MS1A 3V7SA 2AZ5A 3IB3A 3ZYFA 5K4LA 3ZKUA 2F5FA 2J7MA 1JGSA 4RGUA 3VBSC 3TBDA 2L2OA 1HXS2 1LU1A 2QCOA 3WU1B 3U78A 2SBAA 2QSHX 3PUBA 4R4XA 3SYTA 4KMFA 4FQGA 1PJRA 4BQQA 1P2FA 1BVVA 5M5WJ 2IAIA 1DDNA 5A33A 4LO4B 4XBNA 3WE3A 5T3NA 4BACA 5DUUA 1RHI3 4YLZA 4K20A 3OY8A 1T08B 2JJ7A 2PX9A 3CCQI 4GULA 4J19A 4TWTA 1CAUB 1REFA 2LF8A 5D5WB 1R36A 4JGYA 1SVLA 1OD5A 4P9FA 3MICA 2F4LA 3ZMTA 3TN93 2UYBA 2DBNA 4P9GA 2G9GA 2X5IB 2PQSA 3UETA 5LBBA 3PVEA 4IGOA 5EP9A 3M8JA 4X6QB 2E1MB 4WM7A 4CP9B 2V9KA 3BPXA 1LENA 2XRNA 1MZFA 4IRIA 1A8MA 1AL0G 4N43A 1JTZX 4F92B 3K2OA 1TWCJ 4AQ6A 2Y6FA 3ZFFC 5L3EA 3P9KA 1PK6B 2LG4A 4URTA 1G3YA 4KGQA 2R5ZA 1TQPA 4CSWA 3EXUA 2VOTA 2QZ8A 3DU6A 4CUGA 1VBE2 4HVOA 2DURA 1WJFA 5A6QA 2HGCA 5JVGF 1SVMA 1RINA 3HM5A 4MQ9F 1JKPC 4UFHA 4BJ0A 4JQRA 1IXSB 1XU1A 5FYTA 4ET7A 4EJRA 4Y1UA 3IDEA 5A7QA 2R30A 1S5LC 2M4KA 5I8YA 3M3YJ 1LCLA 2O0OA 4IDZA 3L2QA 1ZTRA 4L18B 4H55A 5FYSA 3LIHA 3AYDA 1WUVA 4RA0A 1WJBA 1LOFC 5C8CC 2HXIA 4JC1A 3VSKA 3PIJA 1WA4A 2F4MB 3JB4C 2ZX0A 1ZZBA 5A33B 1LNWA 2DDBA 1A31A 2E5NA 4B47A 1OVPA 2Z5WA 3NAPA 3OY8B 2ZB9A 5FO5A 4MGYE 2VJIA 5FPLA 3NVCA 4PBPA 3K4NA 1RKWA 3NWKA 4Y17A 2YR2A 2Q8OA 4JGYB 1VQOI 4LITA 1X50A 4E7KA 4XJ8A 4FPOB 4BXSV 3TO6A 5F3CA 2BBAA 3KQRA 4FX4A 4WM7B 4DEQA 1B09A 3C7JA 4IQ4A 5E1RA 1I6XA 2UURA 2J1EA 2V5YA 4R9BA 1I27A 1U5IA 3KV4A 4QPWA 1VE0A 3QWLA 3S1QJ 2R5ZB 3ZN0A 3TEXA 4FBFA 3V0AA 2FQ3A 4UI9L 4A12A 5JXIA 2WRAA 3FHAA 4ZS2A 4WV8A 4P02B 5CKQA 3UESA 2CW7A 1DF0A 2H0BA 5D2AA 1MJAA 2RDQA 1LKNA 4G9SB 3IM0A 3V64A 1JGGA 1TWAJ 5I0RA 3KP4A 2ZMKA 1X58A 3T2PA 4D8MA 5BQTA 3GZ6A 3D8CA 4AEKA 4HYEA 1JUMA 1KEXA 3K4AA 1OFSA 2XWBB 1KJLA 2QM3A 4C8DA 1V6KA 1F4HA 2ELHA 2GMPA 3TNQA 2DOEA 4Y24A 1PO13 1LU2A 4OINF 1S2BA 3NAPB 1B59A 2FU4A 1LOAA 1VMJA 4NIAA 3VSLA 1JN2P 4PIYA 1MNEA 4B3NA 4ZPIA 3BPZA 4NAOA 3Q8EA 4CYCA 2DQRA 2HQNA 2P4EA 1RMU2 3H8UA 1ZKGA 1F9NA 3PIPF 3GGLA 1NE6A 5ACA1 4I98B 4YW7A 1I3HA 3BI3A 4RGXA 3FMQA 3KV5A 2V1UA 1UFMA 3DV8A 4ANJA 1RUJ3 1TWHJ 4QXKA 2MD5A 3L09A 2HWE3 1V6LA 1OCCH 2ISZA 3VZJA 5DAQA 1VAMA 1LEDA 4BNCA 2WFF2 4HT1T 3V0AB 3CEWA 2BUKA 2M5WA 2HQAA 2M0CA 1TP4A 1YWKA 4QM9A 3EBRA 1PZ9A 2WC2A 4J6GA 3ABUA 1DGLA 1SPPA 1RUF2 3OGGA 1UZZA 4XEZA 4E27A 1OOPA 3IAQA 4PDKA 2HEOA 5B3SH 5FY7A 5JFRA 4QX8A 4QDQA 1R7JA 1R092 3RKWA 5IYCJ 1GFF2 5FZ9A 3K3OA 3OL3A 4LO6B 4NRPA 1Z21A 2I10A 5J4VA 1HB3A 4PHZA 1U5TC 3KS7A 2X85A 2RM22 4ENKA 4TN7A 5GLTA 4JKLA 4EGYA 2HWB1 4G6QA 5KWRA 2IS1A 1BN5A 4FOWA 3I3EA 2EFWA 2WWUA 3IMMA 4Q1PA 3DPRB 4A3FJ 4CYCB 1CONA 2WTEA 2DU0A 4AFCA 2JE7A 5EZGA 4RGRA 1PMHX 4Y52J 1FTZA 4KWUA 5C9AA 3NQOA 2ARBA 4BJ5C 1LFPA 3BOQA 4QSHA 2MFZA 4NN0A 2IGKA 1W2AX 5BPXA 4XBFA 2DQLA 2E19A 3H35A 1DQ6A 3QD6A 3GEZA 4XJAA 3HQRA 4JQTA 4HANA 5LA1A 4Q1RA 2FCVA 1ZNPA 5CADA 1QRYA 5H20A 1O5LA 3I9V2 4UF0B 4V1PA 1TMF1 1WGPA 4HX4A 3H8RA 2JRTA 2D7FA 2JPBA 2GC0A 3JD72 4A0YA 1UQXA 2ELJA 3MVPA 3SH3A 1MDMA 2P81A 5JLWA 3HNBM 1W8WA 3OYFA 1KXGA 4KT6A 1V6NA 1O6UA 1SPPB 5JSOA 2BERA 2HWD2 1RUI1 1OOPB 3O1RA 2EA7A 5A6XA 4ZZDA 4XETA 4GQ7A 4ISRA 1UWWA 1BCXA 1TC3C 5KHHA 2VNGA 1K61A 2JQ7A 4RQPB 5CISA 3QBQA 2QSFX 2QCSB 2W91A 3HD8B 4AYBA 1QDCA 3KF3A 3GTMJ 4HSJA 5FPZA 1RI7A 2JDPA 1RUC1 2EFPA 1V5GA 3SEQA 1LGCA 1LNSA 4W97A 4R9DA 4ENJA 3WE2A 2A6ZA 1E3HA 2L01A 2HEWF 3WXPA 3BR1A 3UYJA 4F3QA 1MS4A 5C9AB 5A3WA 2UY9A 2PHDA 4QXHA 4IUGA 1FBQA 2PLYA 3UGFA 2ZS6B 4P08A 2B7EA 1HB2A 1AZDA 1Q1HA 1SD4A 1QF3A 3NSTA 5FY9A 4XBLA 5FXVA 2R93J 4A69C 5D4RA 1S72I 4BMBA 5HLTA 1MS8A 3S7IA 5IVJA 2FQ4A 3PVOA 3JRGA 4NHKA 4MIMA 5I0TA 4YG2F 4AI2A 4K1YA 5JI6A 2VBPA 2D6MA 3VD7A 3EUHA 1EYBA 3USSA 4GB32 4XTPA 1JU3A 2ID3A 1BYHA 3MIEA 4MO3M 1MDMB 1H2NA 4XOGA 4WXDA 1RUC3 3G1MA 2OS2A 2HWF2 5LA0A 1LFUP 3VD3A 3HB9A 5F5IA 5L3BA 4Y13A 3AXDA 4NAMA 5TSWA 2PTMA 2GQQA 4XQ4A 5ED4A 4FHTA 1QJU1 4KG0A 4I0WB 4SLIA 4GAZA 4QPGA 3M3OA 1RGSA 3KZIC 1T38A 2A70A 1AL22 5FLHA 3VZMA 2HKXA 4IE6A 3LDRA 4PJYA 3WEZA 2AYHA 5FK7A 1RUH2 3ABMH 1I6HJ 5CNAA 4CU8A 2Y8KA 3P6BA 4FPFA 1T98A 4GALA 1Y6IA 3BU7A 1PYVA 2DFCA 3GHMA 4PJMA 4H7LA 3TP0A 4A3MJ 3U1KA 4GJZA 2W46A 2JIJA 3ELNA 1GUUA 4CEWA 2ES3A 2R5YA 3M7AA 3WOGA 1T8IA 3K2AA 3CBNA 2QDNA 2HWC2 2J5PA 1AR81 2J5OA 4R4ZA 1RUG1 4YVSA 5IW0A 4M3DA 4IEXA 3RI8A 2JTVA 4U88A 4MEYF 4OU0A 5IVEA 5KBFA 3UJQA 4P9JA 2JT1A 4CUAA 3ZN1A 2DAOA 1J83A 2R7RA 3S8PA 1BC8C 5FZKA 4Q4ZF 5LB6A 3M1EA 5EQUA 2R062 2QQ9A 4MH0E 1CPMA 1R4MB 1SANA 3HSFA 5IFTA 2BNMA 5IYYA 3NNLA 2Y6GA 2DT6A 5KAFC 4HF1A 3KLSA 4ONUA 4L9VA 2CWMA 4CCMA 1STMA 4LMYA 2R32A 3OGJA 2J1SA 4QPGB 1Q8PA 1HB4A 4QPOA 2FUG2 2R7SA 1HW1A 3AKRA 1MBGA 4AEDA 1Y1WJ 1NH3A 1WLTA 5GZDA 1R9TJ 2PHTA 3RZLA 2QBYA 1PO22 3IRRA 1NCQC 3HN3A 1MQTA 4BK5A 1YJWI 3MPPG 1QXRA 2D40A 2W08A 2WQZC 1ODDA 3OIPA 5A1AA 1H8VA 3FK6A 3NJYA 1D5YA 3DPLC 3VKFC 5GTHC 4HQMA 3FM3A 3WNOA 3H5NA 5A2QZ 3L9FA 3KSCA 4CEWB 2QQUA 1PZ7A 2R5YB 5JOYA 3OYGA 3OEAA 4RS5A 4XHXA 4IL7A 1FOD2 1RUD2 3K48A 5I0SA 2TDXA 3K6GA 1LOEA 5IP9J 3S32A 2ME0A 3FLPA 4GH4A 3VFZA 3TO7A 3B9CA 4YVSB 3IBMA 4UNOA 3C3WA 2AENA 4M3CA 3OD0A 1K42A 2IWGB 4BQYA 2KISA 2XV4S 2JG9A 2B4KA 3BPVA 3FXJA 5IK8A 1XDSA 4FE7A 5FY4A 4XXAA 1WCSA 2RDSA 4XLAA 3JREA 4PGGA 3CHXA 1ZGWA 4MUVA 3HTUA 1OQ1A 2VE8A 1YO8A 3IN9A 2WIIB 2A05A 1A6QA 2NOJB 3FKIJ 5HDKA 2XJTA 3I49A 1S29A 3OYJA 3GJAA 2Z1DA 4XQWA 5FMOS 1JZ4A 2GIZA 3F8NA 4SBVA 1GVDA 4XN3A 1W9TA 1RTVA 3ZXFA 5E8GA 1OT5A 3CQZJ 2QBYB 2Y9YA 2W1WA 2DT7B 1MQTB 3VBUC 4BBSJ 4D1QA 2P3JA 1R4NB 1O4TA 4Q0PA 1YQ8A 5BNQA 3NMBA 2P2KA 1NQDA 1OA2A 3V4GA 4B7KA 3T5XA 2GALA 4N4NB 3I4MJ 4O5VA 4PDWA 2BW3A 4EATA 2RS12 5J1YA 2JMWA 2L7MP 3AP6A 2W25A 4CH7A 3E6MA 3QPSA 3O2PE 4RS5B 4BHBA 4IEJA 1UU4A 1ZYRF 3LSIA 4PCRA 4IEYA 3HAGA 3CC2I 4GH4B 2EICA 2BNNA 2MLKA 3EMRA 3S3OA 3DLAA 1YEWA 3KGLA 4QHBA 2QDRA 1H2MA 4DIQA 2ZAHA 4M3CB 4XJWA 1RB8G 3C2HA 3LAJA 1W0PA 2OF7A 5E1XA 5FGMA 3CF6E 4ZY9A 4YZ1A 4FPCA 2JG9B 2STWA 4P5YA 3AKQA 1C8M1 3DKWA 4FAHA 3K1PA 4LBKA 3AFGA 2XL9A 4A6EA 2RR12 2PHRA 2IXKA 3T0YA 1LOCA 1MMNA 4Y33A 1KJRA 3VHPA 4ARYA 1CWPA 4FOVA 4WM8C 1VNDA 3NWSA 1DP0A 3HJEA 1EAH2 3D82A 1F5FA 2W4SA 5AFEA 1PGL2 2JB4A 3IAS2 4LHNA 1FNNA 4AYUA 3NJVA 2FSWA 1VBB2 5F2WA 3L2HA 3AZWA 1J5YA 2WZEA 5CYVA 4LG0A 1RETA 4CCEA 5FP4A 1JT6A 2R072 3BKZA 4M6XA 4YZ5A 3CMAI 1UXZA 3ASIA 4RHV1 4UYBA 2GBYA 4BJ6C 5FP9A 1Y39A 4PDWB 2EFNA 2BW3B 1R5GA 2OT7A 5A7PA 2QQBA 4OCTA 2C0ZA 2HOAA 4KUMA 3POBA 3WDUA 5KHDA 5J4YA 2CU5A 1G7YA 1EP0A 2VQHA 3WQ0A 3ILNA 3WF2A 2QKDA 2JD4A 4FQZA 2DVFA 5FK8A 2QENA 5BY5A 5F6FA 5CU1A 3T0AA 1I1GA 3THCA 4CDQC 1UU5A 4ASMB 3FXMA 4HNUA 2RE9A 1SLCA 3KHCA 3CC4I 4JRLA 2K85A 3C18A 3D4KA 3I8TA 2BVMA 4XDOA 2WYFA 2DOFA 4HPKA 4CCNA 3W21A 4XK4A 5AIQA 5CIRA 3NKGA 3BIEA 1LUJB 2LFBA 2VECA 3G2BA 4BDVB 3WCRA 3U2RA 5K9YA 4JZRA 3LQRA 1IPKA 4ESBA 4YARA 1QJY1 3S30A 1B35A 2BV4A 4L92A 2CV2A 3WLUA 4DS0A 4DZJA 5FZBA 3U37A 1WD3A 3N35A 5BNPC 3JCUC 5EJ1B 2D6OX 1Z3YA 4BIFA 4QT6A 4CCDA 3MV11 1QZYA 1TNFA 4MV2A 1OISA 3F72A 1SVOA 2OPKA 1LRHA 2PXJA 4EM0B 1VFCA 3A2KA 2E7QA 3QOEA 3OYIA 1QVUA 2WV1A 2RDNA 4LG0B 1I50J 4COVA 1VBD2 3Q9SA 4XIKA 3RWKX 2H1LA 1J7KA 1BEV2 5FROA 1QQIA 4LK0F 4ZH4F 5F8PA 2UWBA 3C7FA 2OCEA 1CAWA 1YI2I 1J1LA 5C71A 5DXDA 1DLLA 4UV8A 4BE0A 4C0HA 1XB4A 1FPN2 1XE0A 5L3CA 3HEFA 3MO4A 3QH6A 5J1UA 5L3FA 4QX5A 2P5VA 1USSA 4JOMA 2VZRA 5GAHJ 4ATEA 2W0XA 4XFGA 1BBT3 3AZZA 3G6JB 4CDXA 1VALA 5FZLA 4QU2A 1POV1 4L0PA 3LSDA 2JIGA 1AR93 2E51A 4UW4A 4M6YA 2Q30A 1RUE3 3NEUA 2WUHA 4AGVA 3VB9A 2XLFA 1F4AA 5H9QA 3K70D 1XSXA 3HRMA 4ZYAA 4G7OF 4I01A 3DEMA 4Y22A 3KWVA 3RPQA 4YM1A 4NNJA 4NHYA 4YG0A 2E35A 4QQPA 2M3AA 2W5FA 1OLTA 3RPUD 4XRFA 4JRAA 2YY1A 3VWBA 2O14A 5FMDA 1ASJ2 1VBA3 3DPTA 2MLGA 4GXOA 3JRCA 4I3GA 3WCSA 4BY7J 2BRTA 5KR7A 1D1BA 4IRGA 2CTVA 3B9IA 3I53A 5FZ8A 3KMHA 4LBMA 2HJIA 3H8XA 4E4DX 5B66C 1YI9A 2QQMA 3MFAA 4XUPA 1GQHA 1JTYA 4AFBA 4S2DA 2IFRA 1I1EA 5A3UA 1W39A 1G9AA 1O3RA 2PLV1 4AGGA 3BG3A 3FFQA 4AQ2A 4P96A 1CAWB 2Z33A 1Z67A 1ND3C 2M8GX 2WNUC 5FO7B 4BLJA 5L36A 2VB6A 4HZFA 3OR1C 3CIHA 4HG6B 4CYDA 3MWMA 1IRGA 3AVSA 1S2KA 2I8DA 5FYIA 1LODA 2VM9A 1JXNA 1DQ4A 1JHFA 2UY8A 1O4XA 1NZCA 1NY72 3A4UA 3GF6A 2VMIA 2E31A 5BNGA 3ERMA 1U8RA 4CDXB 2WZR3 2HYFA 4O7XA 1AR72 2VQ0A 2BP6A 1D1AA 4LK1F 1L7QA 1V6OA 5IYDJ 3J7LA 2JDAA 1IN7A 4QQLA 1YFUA 2ZJ2A 4BB3A 3RTRA 3DPUA 4EGZA 1UZYA 5M3MJ 3OYNA 1E5IA 2R042 4IF4A 4GKYA 3BWGA 4K21A 3CCUI 2EH3A 3HXLA 5F39A 3VUOA 5E20A 4FASD 3WDYA 3S14J 1JOPA 2CWEA 5KAIC 4XPVA 1W36D 5HS7A 3E5XA 3Q9VA 4COUA 3CU7A 3LB9A 5J1RA 5H6QA 3BT9A 1K6OA 1COV1 2COBA 2JK3A 5CKNA 2E9QA 1NA1A 2ENRA 3U07A 2B63J 2WQ8A 3RYPA 2VR4A 4IV1A 2L9SA 3PJYA 3ZMUA 3DEWA 2MH2A 4A3JJ 4WBBA 3GALA 1YXWA 3LZZA 1REPC 2Q0OA 5HV4A 4PT6A 3F8MA 3LSGA 3Q0WA 4I02A 4LLNA 2B0LA 1XG1A 1HRV2 2NVQJ 3GUDA 5L9VA 3EYYA 2LMDA 2VZTA 5A3NA 2W7NA 2VOWA 4GYGA 3CO7C 3G1OA 3SCFA 3DXUA 2LD5A 1YLFA 4XC9A 2FDJA 3BG6A 3Q8CA 4NB5A 5ABJC 3RJRA 2JD9A 3TKYA 1MW7A 3HHGA 1FMWA 2E60A 1RUNA 2AC1A 2QQKA 4QXCA 3FMSA 2E26A 3GW2A 5DG1A 3H3ZA 4Q2FA 2D5FA 1SFPA 1UHWA 5A2QK 1PMJX 1UAAA 3T1MA 3KE2A 5EF6A 3TWIA 2XBO1 3FMGA 3ZQGA 3RJ2X 2BHYA 4CPBA 1USTA 1V5FA 3OYEA 1GYKA 4U36A 4A3BJ 1H8TA 2YU3A 1CR7A 1L7LA 2F4OB 2R7EB 3MKLA 2DW4A 5AIPA 3B01A 1HW5A 3C7EA 3THDA 3FK7A 2VU9A 2PI0A 1QHDA 2WS91 2EFOA 4YFWA 1YW8A 5HNFA 4M72A 3JRBA 3BG9A 3SQNA 5FZEA 2LDUA 3WY6A 4W1UA 1NA1B 1TME3 5FY8A 2ME6A 5HCFA 1MBFA 5E3NA 2OPWA 2QBXA 4GKXA 4LD5A 1ZN2A 4ZJZA 2EAAA 1S4CA 5CZKA 1VBC1 4IRHA 1Z7S1 1U78A 3H9AA 4OYUA 1AJOA 2E6VA 1UCRA 2V5DA 1YCIA 1W4MA 2VZOA 2X6XA 5J96B 2R16A 1RVF2 3IV5A 2YXSA 2KPMA 1UIJA 1W3VA 3ASOH 5FKMA 2YS9A 3VDDA 2BQPA 2X29A 2MPFA 1KGYA 1PVC1 2XPWA 2ZXIA 1I1SA 4YZ2A 1S0BA 2JA6J 4YW1A 1MMDA 3OYBA 2DU1A 1TEIA 3B6CA 2HBTA 2WS93 3K3NA 4BOWA 3M8EA 2BOJA 2E63A 3BCBA 3GWZA 3W6JB 2AO9A 1KRIA 1QQP2 4HA8A 1VAVA 1Y56A 4KU7A 2ZJCA 5EEGA 3AP7A 1Y43B 1YX3A 2DT5A 3ZXGA 1H8TB 4I30A 1RUOA 1WBFA 3BPSA 2IXSA 4EWAA 1TWFJ 3HWJA 4F3JA 4JYKA 2DJNA 2VZ3A 1DBNA 4CDWA 1V0AA 4ARXA 2NLRA 2IZWA 1MBEA 4ABZA 2E1CA 1AXKA 4RM3A 2QEXI 3J8F1 5IUQA 3VDAA 2B46X 4HLTA 2LLKA 2CH0A 5J1XA 4Q4V2 4LJHA 3KFWX 2GMEA 3MLJA 3BTAA 4DXSA 3MIFA 2WQ4A 2VNRA 4YEJA 2VODA 3AG1H 3HOTA 1BK1A 4MSVA 2VKDA 2NAZA 4WVZA 1ND2A 4MZUA 4QQHA 2R7UA 5FUNA 2A3SA 2HYJA 2YC2A 2VUMJ 4RL7A 1H30A 3VGIA 4C1XA 1D0XA 5G05L 1GLHA 3FXOA 4XFIA 3VDDB 3ZSJA 2WA3A 1UKRA 3OBRA 5A3OA 5LY1A 4Y5TA 3H92A 3AZVA 2DA3A 4B43A 4X1EA 4KGGA 1W9YA 3RZGA 1KQ0A 3WU0A 4AVCA 4N0BA 1PNFA 3T30A 3JRAA 2BNOA 4PIZA 2VXZA 3J7HA 3WNLA 4BQ4A 2ZEYA 3WF4A 1W0TA 4A44A 4DJAA 4Y1VA 1VQ4I 5LW9A 4YELA 4E7IA 2W84A 1YS6A 5ERIA 3A0KA 1OR7A 2B9VA 1D4M2 3MIDA 1SMTA 5GLUA 5IP7J 5FP3A 2PAMA 3GDBA 1YW9A 1NLSA 1DGWX 1G4DA 1KA8A 2VMDA 2BPA2 3GJBA 4LG3A 5FMBA 2QTWB 4J00A 1SG3A 5FKCA 1G9CA 1UY1A 2Y0IA 4R8HA 2AHQA 5IOYA 3MF6A 4MGTA 3JRHA 1FATA 1VF9A 4ZDLA 2IS6A 3CDIA 1X3WB 1X2MA 5C7GA 2X9DA 2QA4I 3OY9A 2M45A 3U4SA 4S0HB 5H2FC 2W92A 3D3AA 2P8TA 1ND2B 4D7NA 3ZN4A 3OR2C 2PHUA 2ZGKA 4AVBA 4HAMA 1UY2A 2ZKZA 2Q1ZB 4MXWA 5CLSA 4LBLA 1Y1VJ 2LP0A 2AH2A 3HKZN 2R7TA 3HYIA 3I58A 2VUDA 1TTYA 1UO9A 2CMPA 2FBKA 4KMUX 5L9RA 4PCQA 4HKWA 4DOUA 3WTSC 1WQ2A 3GXUA 2HVRA 1U8BA 1ZBA1 2JJ6A 2L54A 3VOEA 4AL9A 4B8EA 4CICA 3FZ3A 5EIYB 2WABA 1S0IA 4DUVA 1VQ9I 5I8SA 3C7HA 3ZQ7A 3M1HA 3JBG1 2G1MA 5D5UB 5H6RA 3SCGA 4OQ8A 4XKWA 3PJQA 2XJVA 2VUAA 4DINB 3ZFGA 5FKLA 2D98A 3EHKA 1UJ8A 1NCRC 4RS8A 1HA8A 3ZYJB 1YRNA 2E36A 3CCVI 1N1VA 4QKNA 2VTXA 3RI9A 5C33A 3IRQA 2IXCA 2RV8A 4HW0A 2QNKA 2LY9A 4NWVA 4Y4RA 4JBAA 5LBCA 1WCUA 2XIGA 1ZRFA 3T2QA 5E16A 5C3QA 3BG7A 2D5HA 4IGQA 3HG9A 4N7IA 1JZ5A 1QNTA 1HQCA 4KWJA 3RJPA 4L9NA 4LFUA 4IETA 4XMAA 3PFIA 2JENA 4Y7NJ 3JBG3 1SBEA 4MXWB 1S0GA 5HS9A 1LJ9A 2NPIA 4ZKTB 4Z2AA 3BY6A 4D7YA 3LA3A 4RR3C 3QCWA 2CGNA 2KJBA 3W59A 1PX4A 1ETWA 3N7KA 2JB8A 5IK4A 2EILH 2WAQN 2YUSA 3C8XA 2W1QA 5D8AC 3I56I 4BA6A 4EZ4A 2J22A 4KIFA 1OH3A 2BOLA 1ZZCA 4QB2A 4L0YB 4MFDA 3DGTA 3FHZA 4OZXA 4R52A 4CZCA 1ETQA 2UWMA 4C3IJ 2Z9OA 1BQPA 3ZFGB 2IW5A 3IIAA 4EE2A 2M1BA 4LA2A 1YRNB 4RFRB 2H8RA 1S7OA 4CU9A 1R6RA 5AVAA 5GALA 5FUIA 1ZH5A 3T1BA 1CN1A 1D7PM 1F31A 1UMIA 2EZKA 1FYLA 2BJSA 2D97A 3U75A 1U2WA 2WBKA 4DXTA 4BS9A 5EYYA 4RAGA 4LBJA 5T52A 3KF5A 1OCOH 2ZMEA 3BQYA 1L3LA 3J26N 4QKDA 2NOGA 2ZXHA 1IN5A 3Q8FA 2NNNA 4D9JA 2KD7A 1ZBE1 3PVBB 3ZYGA 5FQ0A 2BY2A 2C6YA 4IEOA 1T0FA 4ON0A 3POGA 2ID4A 1L3JA 1ACCA 2AEYA 1OA4A 3ULQB 2A61A 2N8GA 1US3A 1BW5A 3REOA 2EIBA 1M1EB 4FE4A 1KZHA 1MEC3 2OZ6A 1YJKA 3ETQA 3IKWA 4LKFA 5GLZA 4AW7A 4E2QA 1FZPB 3WX5A 2YGLA 2K9SA 3I3LA 4LLLA 3PU8A 5TJJA