3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
1YYVA 3SCHA 2KKOA 3J81Z 4IHTA 3N4MA 2D5HA 5A2QK 3WW4A 4E2GA 5J3UA 4L9VA 4LLOA 2NRAC 3JAMK 2VXZA 1I5ZA 3E6CC 2M45A 4A0YA 1K79A 2Q30A 3V4GA 3KSCA 1NYWA 1GHCA 3CJNA 3UKTA 6PAXA 4UUVA 2VQAA 4WWCA 3NKTA 4KN4X 5D1IA 3I54A 1R22A 2WC2A 4ENMA 2AS5F 4QWQA 2QWWA 1XSXA 1DZRA 4CXFA 3I58A 2E7XA 4B8XA 3QPTA 1ZRRA 2Z9OA 2CYYA 4HYEA 4UHTA 2ZKZA 4HOBA 2YX4A 2WFPA 3HSEA 3OOPA 4UNOA 1MZBA 1I27A 2XKOA 3B02A 3FXRA 5E1WA 2O3FA 1FI2A 2V79A 4YIIA 2Z33A 2E1NA 3QACA 2K02A 1HSTA 1J59A 1LB2A 4GO1A 1IRFA 2IA1A 4JK1X 2GC2A 4PGHA 4QM8A 1IRGA 4PJYA 4RGXA 4BYYA 4LK0F 4IHSA 4YFNF 3MEXA 5LEKA 1ZRDA 1YO5C 4G6QA 3WU1B 5KHHA 1Q3EA 4G94A 4LB5A 3LAGA 2ESNA 1SFXA 4UBHA 2RVCA 5CADA 1O4TA 2W25A 4RGUA 2H0VA 2XAFA 1YLFA 3DN7A 2P17A 3GBFA 3EYYA 1UPIA 4LUKA 5FGMA 2OAZA 2EWNA 3LQRA 1ZZ9A 2KRFA 3ELNA 3K1PA 4XETA 3WE2A 3MZYA 4GCVA 2Y0OA 1KU7A 1QNTA 1YG2A 1DUXC 3HSRA 4O9GA 3SHRA 5HS8A 2C6YA 4UVBA 4KWLA 4ZYDA 2PYTA 5D6FA 1G3SA 3CUOA 1REPC 1NXMA 5ERIA 3JSOA 3MDPA 3E5XA 3NVCA 3H3UA 5FPZA 2K9ZA 1U3EM 2P8TA 1CAVB 4D7TA 3HT2A 1HSJA 3RPUA 4OMZA 3HTSB 2IP2A 1SMTA 5E8GA 4ESJA 4XFBA 1LNWA 2AXLA 4XFHA 4K2EA 1BBYA 2MH9A 2FBIA 1FPQA 3SQNA 1YQAA 3LA2A 4ESBA 4TLFA 2EJRA 2RN7A 1R00A 1T98A 4JTOA 2PQ8A 2P5VA 4KIFA 1JXSA 2IXIA 3O3KA 4MEXF 1XGNA 4L0ZB 2XHKA 1W4MA 5KHIA 2ADUA 2IPQX 3IDBB 4B09A 4IEVA 2IT0A 1I1SA 1LDDA 1S29A 3NW4A 1XN7A 4LA3A 5BV6A 2F4PA 4LG0B 5K5RA 1K78A 2PAEA 1O3SA 1O7LA 5FFZA 4I3PA 1S6LA 3S7IA 4I02A 5JSOA 3LWFA 4LLLA 1XSDA 2B5HA 2PFBA 4A5MA 3KGZA 2XL7A 2BNMA 3LOIA 5LRRA 4LLGF 4MGYE 3FMSA 3HUGA 2RDPA 4KU8A 1EV7A 1LEBA 2HTSA 3R0JA 3CO2A 1EYBA 1GVJA 2K86A 1LJ9A 2CO5A 5HI0A 5I0TA 3F72A 3DXJF 5K1YA 2BGCA 4IEPA 2HDCA 2VC1A 4HVOA 4NHJA 1TW3A 1S7OA 3SXYA 1RZ4A 3M1EA 4QGLA 1MDMB 4Q29A 4M9XA 3TO9A 2GA2A 1JUHA 1B9MA 5E8IA 3KP7A 1JHHA 3ZP5A 1O3QA 4MEYF 3LZZA 4BIFA 2P5KA 5LGTA 2FRHA 5LHHA 4LTAA 3LFKA 1ZLKA 4HV5A 4WXHA 2Z2SB 2H94A 3D0SA 3KP4A 1J3QA 5T3NA 4LJZF 5L3GA 1HXDA 1ZRCA 3WU0A 2DI3A 1RC6A 3T1BA 4MGIE 4LMYA 4QM9A 3OGJA 2HQRA 1R58A 2V9VA 4O5VA 4OIOF 4IERA 3WTUC 3JTGA 2STWA 2RKHA 4UV9A 4WXDA 4B29A 3NRVA 4MH0E 2O8QA 2OZ6A 4AIKA 1OYIA 2EFNA 3ISPA 1H9GA 2FA5A 1W5TA 2XVCA 4GYGA 2RGVA 4KMUX 2K4JA 2MLKA 1Q43A 4IVNA 5D4SA 1ON1A 1X3UA 1IUYA 3LA7A 4WXCA 4KA4A 3SZPA 1WI9A 1ZG1A 5EEGA 4OOIA 5HLGA 3WTTC 1NE4A 2X0LA 3JW4A 1RNLA 1UFMA 1FP2A 1PM7A 2WTEA 3U1DA 4HLTA 1Y9QA 2PHDA 2UY9A 3HSFA 1STZA 1XMKA 2O6GE 5FCCA 2K27A 4WX9A 1R23A 4HSLA 3V7CA 4G6DA 3CF6E 3RYKA 1XGSA 2P7VB 3R61A 1UB9A 5I8TA 3IKTA 4WZCA 4A5NA 2C0ZA 1XCVA 5K8SA 2PAMA 1YLLA 4OU0A 2P6TA 4CICA 3HOTA 3BU7A 2B9UA 4YFXF 2D1VA 3F8MA 3ZMZA 3RIRA 3Q9SA 2M1BA 4P55A 2VE8A 1I1GA 1P92A 5KK1A 5I91A 4HW0A 3GZ6A 3V8JA 1LDKB 3IIAA 3L7WA 2A68F 2O03A 3GVAA 3KFWX 2L4AA 5JHUA 1U2WA 4XFFA 4ZU7A 2W85A 1TQIA 1AWCA 1CAXB 4PZJA 2ZNZA 1DP7P 4FHTA 2F5FA 4RAYA 2OD5A 4XFCA 1OD5A 3ETQA 2HTJA 2YU3A 2QQBA 4WBBA 3P9IA 1E2XA 2CQKA 2ZNYA 1WWXA 4BXUA 5HS7A 4Z2YA 4ENKA 4AXOA 3K2ZA 4XEZA 4M9SA 4M9ZA 1YWKA 1WQ2A 1P4XA 4Q0VA 2X4HA 1AOYA 4R52A 3LQQA 4EWEA 4HA8A 5IT9Z 2UXNA 3FJSA 3CO6C 4U0WA 3SFZA 4Q0UA 4AVCA 1BIBA 1IAWA 3FXUA 1YW8A 5IT9K 1R1UA 1J1LA 1YW7A 1T2KA 1ZG5A 1R7JA 1F1ZA 3BY6A 4YRDA 3L09A 4RB3C 4G7HF 4OIQF 2YR2A 4BNCA 5EZWA 3E6DA 3BDDA 1QGPA 1CAWB 4A0ZA 1VTNC 3GFLA 1YS6A 4BQAA 1RL3A 2VPVA 1TNTA 2XROA 5CU1A 4LUMA 4CYDA 1HKSA 5HVQC 5ILVA 4D7SA 3P9CA 1F4KA 2D1HA 3WTWC 2H6CA 4MGZE 5I8YA 5KHKA 3H50A 3P9KA 2VE9A 1FBQA 1Z1DA 2DPDA 3IWZA 1USTA 2CG4A 3IC7A 3GX4X 3BALA 1LEAA 2VOPA 4M6XA 3W6JB 2R3SA 3FHZA 2D5FA 2EAAA 4KNYA 3DPLC 2QDRA 3HRTA 2KIMA 4EM2A 2ACJA 3IKVA 2J5PA 4YYOA 1L0OC 3I64A 4E70A 4MGRA 1Z9CA 4FX4A 1FLIA 1J9IA 2Y0MA 5FLIA 3QAHA 5CVVA 4PIYA 1PP7U 2VOOA 2A3SA 2G7HA 1JHFA 4UV8A 1SFEA 1EP0A 2A5YB 1QY4A 4XRFA 3NEUA 4N9IA 2GQQA 4XLNF 3ABTA 2EFQA 3E5QA 2QNKA 2MPFA 1J75A 4I7HA 1WA4A 3H3ZA 5D6EA 2JT1A 4MX3A 4XLPF 1OR7A 3BROA 2Q2EA 2D93A 3M70A 3OV8A 2VODA 1ZG3A 2K4BA 4P9GA 5BPDA 2ESHA 1XGOA 3BCWA 2QZ8A 3FM3A 1HKQA 2HR3A 1H9TA 4R79A 3G73A 1YFYA 4RB1A 2YSRA 1PP8F 3FZVA 3EJKA 4YARA 5FD6A 3JAMZ 3I4PA 4IPAA 4IRHA 2ISYA 3H7YA 4KIBA 3PFIA 2JPCA 4M74A 2BBYA 3CEWA 4AVAA 2F5DA 2H6BA 3QP6A 1EH7A 2B0LA 2PQQA 5FDBA 4PGGA 5I93A 3GUDA 3ST7A 3HOSA 4S05A 3PVBB 1CAUA 4HF0A 2HQNA 3GF2A 3QU3A 2O0YA 2F5EA 1R5GA 2B8MA 3HTUA 5BXXA 3SZTA 2QBYB 1RI7A 4CHUA 3MPBA 5JSRA 2ZXJA 1CGPA 3MWMA 3RKYA 3SXWA 1A04A 3MZHA 1W5SA 3I5UA 1JE8A 1VP6A 1OI6A 3S0MA 5DV5A 5J7MA 2Z5UA 2A6HF 5BPIA 5ED4A 5J8CA 5E18F 2MA3A 4EQQA 3TGNA 3E97A 2D40A 4OIPF 3VODA 3FZ3A 5CVRA 5H6RA 1MKMA 5IT3A 2V6CA 4K8FA 3SHFA 3WTZA 5HS9A 4UXNA 1SFNA 2Q0OA 3EO6A 2ZCWA 3BOQA 2XKPA 1Z05A 3H8UA 5EEHA 1R5HA 2DO7A 4HQMA 1IF1A 4ENJA 3ZMTA 2FBKA 1KQ9A 1FYLA 1BIAA 2FNPA 3FWEA 3NL1A 2L01A 3TDUC 2PEXA 1ZREA 4M72A 1J58A 5LHIA 1BM9A 1SD4A 4RB0A 3KLNA 1FNNA 1CAVA 2LKPA 1DPUA 5F64A 1O57A 1K6OA 1CF7A 1HKTA 2BNNA 4GULA 2V1UA 1ZGAA 5BUVA 4ORFA 2QENA 2EFPA 1ONVA 2KXLA 5I8SA 4WVZA 2KJBA 4YFKF 1XDSA 2FEZA 1RGSA 3RYRA 3BB6A 3IRQA 2ISZA 4M73A 4U0YA 4ONUA 2L4MA 4A0XA 3GEZA 4EJWA 2UXXA 2CSOA 2LNBA 1B4AA 1R36A 5FLXZ 4KDPA 1YHFA 4E2QA 4DNCA 4MGKE 1QZZA 4MZUA 2VT3A 4HV6A 2QJVA 3U10A 1KYZA 3GFJA 5H6QA 1ZZBA 2HYFA 4Z07A 3T8TA 5FLXK 2HOEA 3GWZA 1MJAA 4IF4A 5ICGA 5DCMA 5HLIA 2QM3A 4LG0A 3WTVC 3FE5A 3K1MA 3P7NA 4CGZA 3WGGA 3JZVA 5JR7B 2QLZA 4E2SA 4I98B 4EJTA 5LHGA 2XL9A 3GFMA 3FFQA 5TRDA 3R6SA 1UHMA 1QO0D 2XLGA 1NHAA 2HKOA 1ZRFA 4NVPA 5BOXA 1LDJA 3J80K 2MH2A 4L9JA 3TKYA 3CLOA 4OLLA 3M8EA 1BI1A 5DD8A 2BEOA 3IRRA 3T0YA 3EBRA 1OFNA 1TBXA 4LEJA 4KWJA 5EFUA 2NNNA 4DQ2A 1ZZ8A 3C3WA 1FYMA 1J7KA 2UWMA 4DINB 1SQ4A 3F22A 1MDMA 4YNIA 5LEJA 3ML6A 3GFIA 4IEQA 3FX3A 2BE5F 1R1TA 3ES4A 5ILUA 1W7PD 4IEXA 3K9TA 4KICA 3QRFF 1DDNA 1ZNPA 2MNGA 1K78B 3CUQA 2DK5A 2QYOA 2I45A 3T5XA 2ZMEB 1IW7F 4EJVA 4WCGA 2ATFA 2STTA 5ILSA 3I0TA 2K0GA 4Q0PA 4AD9A 4L11A 1YFXA 3KZZA 3WGHA 3BP8A 3WW3A 2BV6A 2HGCA 5CJ9A 2O8XA 1FBSA 1HQCA 5L3BA 3W6KB 3F8BA 3IDCB 5FO5A 5DUKA 4P96A 1YFWA 2OYZA 4HX4A 1FYKA 2OBPA 3QP5A 1ZZ7A 3C18A 1P6RA 5L3DA 4H0EA 2P4WA 1WGPA 4EV0A 2O1QA 2FXAA 2PI0A 3TOBA 4HVQA 2V1XA 5CLSA 1IN4A 3E6BA 1IPKA 2EFWA 1ZZ6A 2DLLA 2CW0F 2OA4A 3FMQA 4XSXF 5BS6A 1X8MA 3C7JA 2XASA 4ON0A 2ZFWA 2MHFA 2DW4A 4MUVA 2GH2A 3HT1A 1QQIA 2EK5A 4AQ2A 3D82A 3NJZA 2HFHA 1Z6RA 1B6AA 3JSPA 5D5XB 4NB5A 4IEZA 2O61A 5AIQA 1D5VA 4JBAA 1J3PA 5BY5A 5JCTA 2EV6A 2UYBA 2Q0AA 4I01A 5C8WA 2DBBA 1DPRA 3LAPA 2Z69A 2QUFA 4BHCA 5LBQA 3RYPA 2QVOA 1YFUA 4LK1F 4FBFA 1W7PA 4LD5A 3IBMA 1UCXA 4EROA 1D3YA 1FWZA 1G3WA 4HBLA 2DAOA 1MJBA 3K1NA 3CL1A 1TQPA 4Q47A 2OPKA 3EDPA 3SCFA 1SEFA 4IEOA 2PG4A 1J3RA 4ASNA 1V70A 4M71A 1IPJA 5ICEA 1UIKA 4XFGA 2IXHA 1S7AA 4ZYHA 3Q9VA 2P5LC 3ULQB 1P2FA 5J8FA 1CAXA 4N9HA 1X7NA 2V09A 5C6CA 3PQJA 1Y0UA 1IZ1A 2A6EF 3BWGA 3QOPA 1TTYA 1J5YA 4GGGA 3CTAA 1K7AA 4FAGA 4EJOA 3R60A 4HSJA 4BAYA 1S3JA 2PA7A 1ON2A 2E9QA 1T0FA 2VBZA 3PQKA 5L3CA 3KE2A 2HEOA 5K5OA 4UBGA 4MTDA 3O6BB 2G7UA 1FBUA 2ET7A 3BZ6A 3QU6A 2M8EA 1VR3A 2KIFA 4Q5SF 2Y48A 5CYVA 2OZUA 5CVUA 3K0LA 1EH8A 3ELKA 2A61A 1CAWA 1ZARA 1YS7A 3EETA 1H1MA 2FE3A 5CVIA 5CVJA 2VECA 3IL2A 3V7SA 1S8NA 1UD1A 2LSOA 2NNYA 2OA2A 2QVSB 1KU9A 5D5WB 3I71A 1FXZA 3GW2A 1U8RA 4META 2YPRA 2GWRA 1KU3A 3CJXA 2E7WA 5DDGA 4PIXA 1ZYRF 2BNOA 1MGTA 3KETA 4CDGA 1XCBA 3RI4A 4H7LA 3F8CA 4G7ZF 2JTVA 3BPXA 1L3LA 5K5QA 3RJPA 2XAJA 4P9FA 3FHIB 2JZYA 1G3YA 4MQ9F 2Z3YA 3DL3A 2RC4A 1U5TA 3BPVA 1UCRA 1SFUA 3R4KA 2FMYA 4A6DA 5KBFA 2WV0A 5E17F 3C1DA 2JSCA 1P4WA 4IRIA 4HQEA 4X6RB 1O3RA 2DQRA 1WLTA 4MNUA 4Y17A 2HYGD 2PAKA 2GZWA 1KGSA 3MYXA 3MFKA 1H0MA 1T39A 5FQ0B 1LKNA 4ZZLA 5D5VB 4L9TA 2J5OA 4MQVA 1KQ0A 1SD7A 1QWRA 3ABUA 1U12A 1LR5A 5DD4A 5D8KB 1RUNA 3L2CA 4D0PA 4RGRA 4HLYA 1BJAA 1ZGJA 3FF5A 1SMYF 4CZZA 3RPQA 2VONA 4HVRA 3LAJA 4HX8A 4OIRF 3BJ6A 4FX0A 3KEQA 5E16A 2DK8A 3EQEA 3I59B 2DT5A 3DPTA 3KP5A 4R8HA 4AVBA 1X82A 4XF3A 2GC1A 4HF2A 1G6NA 1ZLJA 3T8RA 1XSVA 2KIUA 2PN6A 1RIOH 2GC3A 1RTVA 2GC0A 2VN2A 1BC8C 2MC3A 1EH6A 4N0BA 4JTNA 2OQRA 3E6MA 1SD5A 1TNSA 1SAXA 2PLYA 2M30A 3F6OA 4U7DA 2ZBKA 3FXQA 4WK8F 1F5TA 2M5WA 4P9UA 5L3FA 1UHWA 4QX5A 1HW2A 2R7DA 4RGSA 4EM0B 2UY8A 2Q1ZB 3TOAA 3SMHA 1QZYA 3WE3A 3WODF 4LGWA 2QCSB 3EHKA 4I0BA 3ZMUA 4KWKA 1QXRA 4XF0A 2EFOA 4HDUA 5HDGA 5KHJA 3IWFA 4KYWA 1NE6A 2CFXA 4LFUA 3WTSC 4YSFA 3BJOA 3DKWA 4KFCA 1V3FA 5FD5A 4ZU5A 1PMIA 4A2UA 4G8XA 3ES1A 5FPXA 3J81K 2Y75A 1DZTA 2W84A 2XLAA 4XF9A 4L9NA 3ERED 3KP6A 2F2EA 1I6XA 2IA2A 3WW2A 5DCFA 3C3VA 3WW1A 5DEQA 3MQ0A 2XGXA 3F3XA 4MV2A 3TDZC 2PHLA 4XFIA 2CV6A 4I09A 1Q1HA 3HRMA 2ETEA 1DGWA 1HBXG 4HZFA 4EMSA 5FLJA 4ENNA 1CAUB 3E5UA 4Q0SA 1B9NA 5I0UA 2Q8KA 4YIFA 5ICCA 3RNSA 4XSZF 2PMUA 4R1HA 3ECOA 1IXRC 4KIGA 4HN0A 1GQHA 2D45A 2MBFA 3RTRA 3QPHA 2VBWA 2ELHA 3JTHA 1FSEA 4EM1A 4IEUA 2CGPA 1TLHB 2PTMA 4Y13A 1FT9A 3GYHX 2KJCA 3NSTA 4EGZA 3RDIA 3HYIA 3DP7A 1FY7A 5LGUA 4QXKA 3V8LA 4NQWA 1OPCA 5DUIA 1NZCA 4AQ6A 1QXJA 5FLHA 1EY2A 5H20A 3HQXA 1BI2A 2EV5A 1BN5A 3Q5FA 2VC0A 1G3TA 3KCCA 4Q48A 4ZYGA 5JAXA 2FQPA 1BI3A 2BYVE 3AAFA 2HWVA 4RB2C 4LLNA 4Y15A 4QMAA 4KU7A 2RV8A 4LB6B 2GXBA 2MD5A 2FNAA 1FC3A 2IVMA 2EVXA 3WGIA 1J2XA 4PDKA 1C0WA 1CF7B 4L5IA 3OTFA 1TQMA 2RQPA 2CWEA 2CAUA 4KN7X 3BPZA 1JGSA 4RD7A 4QLCU 4HBNA 4X6QB 1FSHA 2GIVA 1E17A 1IN8A 5LLQA 3KZYA 1P4AA 4AWXB 2P6SA 4LULA 1IN6A 1PDNC 2IC1A 2D2WA 1OYYA 2L54A 3J80Z 3NQOA 3DEUA 2PMHA 3HRUA 3TO6A 4XF1A 3HIFA 2GAUA 2PJPA 5E1RA 3RKXA 3TO7A 3H7JA 2W24A 1Y3TA 1U5TC 4OMYA 1MJ9A 5DCMB 3LSTA 4ZYEA 1O7FA 4GYIA 2EA2A 3V8KA 3VHRA 4L5JA 3IHUA 4EGYA 1XD7A 4U7BA 2IJLA 3GO5A 2DTRA 5E1XA 2IXLA 2ZMEA 4YG2F 3TNQA 3VFZA 1J0RA 3ECHA 3KLOA 4CO8A 2UZKA 2H27A 3U11A 2ZO4A 2XLFA 5AIPA 5E1ZB 4XF4A 3KEOA 1USSA 2RNJA 3B73A 5JVTA 2Z99A 2HZTA 1LQ1A 5E20A 1ODDA 4I2OA 4PCQA 4ESFA 1YTYA 2A69F 1HW5A 3J7AO 4FAHA 1O5UA 3F6VA 5J48A 1XMAA 1R1VA 4L0YB 4F7ZA 3CDHA 1IN7A 4FT8A 1DGRA 5JR3A 1ZVFA 5LGNA 2IA0A 4O6JA 3I53A 1FOKA 3L2HA 2W57A 4PIZA 4IXAA 2GU9A 1Z6TA 4ETSA 3G7DA 5F1RA 3CUQB 1LRHA 3H1YA 3SCGA 2JPBA 3RKWA 3WTYC 3L9FA 3KMHA 2H09A 1KU2A 1XRUA 2LF7A 3BJAA 1WSUA 1TQ5A 2IW5A 5HDNA 2PFWA 3ZQ7A 3I7DA 2LF8A 4BHPA 4LA2A 1GXPA 4HF1A 5BPXA 2FU4A 3N97A 2A07F 5J6XA 2ZJ2A 3KP3A 1KA8A 5TJJA 1ZAOA 1B1BA 1ZX5A 1QBJA 5KVRA 1YIOA 4ZU4A 2XAQA 5ICFA 4OINF 5HOOA 1BOAA 3LA3A 3U9GA 2LDUA 2FSWA 4QGNA 3HHGA 2NAZA 3TNPB 2ETHA 3F23A 4J1WA 1T6SA 4U0VA 3REOA 3GYDA 4KMFA 2PBIA 2EB7A 3VB2A 4HX7A 4TV7A 4KUMA 3E3VA 1ZN2A 5AVPA 4BH9A 3V7RA 2ET1A 4AIHA 3F8FA 3ACLA 2DCTA 2JRTA 5HDKA 5FFXA 3M8FA 4KT5C 4HDVA 2FQ3A 2NYXA 1Z7UA 2DQLA 1X8EA 1VJ2A 1EPZA 4KL1A 3O2PE 1IXSB 3EYIA 2L3DA 3VOEA 1XGMA 2XAGA 4U88A 4Q0QA 4UVCA 2N7GA 3H9AA 1YFHA 2IXJA 1T38A 4UVAA 1SD6A 2IXKA 4EJUA 3F21A 1XDUA 2FBHA 2VT2A 4BHBA 3COAC 4AIJA 1UW8A 2IRFG 1OYWA 2TDXA 3OD0A 1ZHFA 1MD0A 1W7PB 2DFIA 3ZMVA 3PNAA 2GA1A 3ZN0A 4IJAA 4RS8A 4WF2A 5D4RA 4XFAA 1UIJA 1G4DA 1RUOA 5D5UB 4MHGA 3U0ZA 4JV4A 1CX4A 3ZN1A 3CO7C 4I0AA 2P7CB 2HKXA 4A6EA 3EQLF 3DF8A 1FZPB 1ZZCA 4EWDA 5HLHA 2OZJA 4XBFA 5DYMA 4MTEA 4JVAA 1GXQA 3UKNA 2IXCA 1IN5A 5F6FA 4UXAA 3GLXA 5JFRA 1WRJA 2DPUA 3OF1A 1ULYA 3EUHA 5JI6A 3ZMDA 2K7LA 1BC7C 4IEWA 3R0AA 4QGMA 3GXOA 4GXOA 3M7GA 2ZKLA 2QQ9A 4IESA 4EVIA 2EA4A 4HLXA 3MCZA 1B59A 3U2RA 4IRGA 2COMA 4J1XA 5AONA 3PLQA 1LVAA 3RZZA 2MLGA 3WG9A 2R7FA 3DV8A 4ZZDA 3S2WA 3H1MA 4P5OA 4ZH4F 4O3MA 2QQAA 3OCPA 5I0SA 1OKRA 5D8LB 1XE7A 5L3EA 1KQ8A 1O5LA 3M9AA 1D8JA 4G9YA 5JSPA 3GZ5A 1D8KA 3S7EA 4S04A 4OFGA 5FQ0A 2HS5A 4Q4ZF 3D0JA 3L00A 3MAJA 3KP2A 1FP1D 2CAVA 1FX7A 2FF4A 2V1DA 3ROUA 2XUBA 3G3ZA 4HMZA 1U78A 5FB2A 4M6YA 2GXGA 2EV0A 3VEPA 2M87A 1TW2A 2XAHA 5KHGA 1L3JA 3FMRA 4IETA 2WWYA 3I59A 1Q5OA 1F9NA 2Q4SA 1HW1A 3CUQC 2XIGA 1XB4A 2F5CA 1GQGA 1WKMA 1V4RA 2L02A 2VBXA 2NS0A 2VBYA 1OMIA 3D5LA 3TQNA 1YW9A 2G9WA 3KGLA 2EA7A 1KYWA 4JQFA 1U5TB 4HAMA 3ZPLA 3HHHA 4A12A 3CLPA 3DQVC 3ZDSA 1IXCA 3ZMSA 2DU9A 3O14A 4IEYA 1QPMA 1U6GA 1H1IA 2HJIA 2E1CA 4O9EA 1PUEE 3WTXC 2OU2A 1Z91A 4RAZA 3LWCA 2UYAA 2YX7A 3H92A 3H1WA 1XE8A 3HRSA 4HN1A 3UKVA 4L18B 5I0RA 3F8NA 3K69A 1BI0A 3USSA 5BMZA 4F8AA 5LRSA 4AVPA 3M3IA 3FM5A 2QBYA 2OQGA 2XRNA 1ZH5A 3DFGA 1O3TA 2FMLA 2FOKA 5A2QZ 4G7OF 4L2NA 4Z82A 1YUDA 4EWAA 2XV4S 5BQTA
chains in the Genus database with same CATH superfamily
3MKZA 3H8XA 1FPN2 2X1EA 1BA5A 4IHTA 5J3UA 5F39A 3VBSC 1LOBA 5F5IA 3E6CC 2M45A 4A0YA 1K79A 1RUH1 3KSCA 1OVSA 3CCQI 5L7OA 1S72I 4XR6A 4UUVA 2EXKA 4XVHA 4WWCA 5D1IA 2WC2A 1JHJA 4NHLA 4QDQA 2VXJA 4HG2A 1YXWA 2WAQA 3GTKJ 4CXFA 3I58A 4FPGA 3ZYRA 4XOTA 2E7XA 1KRIA 4MFDA 4EQVA 1ULGA 2Z9OA 2TUNA 4UHTA 5FZEA 2LY2A 3RZMA 2WFPA 4C3IJ 3OY8A 1MZBA 2NXNB 2XKOA 3B02A 5E1WA 1FI2A 1D0YA 4P9LA 3QACA 2K02A 2VASA 2IA1A 4FPHA 4QM8A 4AGRA 4PJYA 1K3IA 1X1AA 4RGXA 4PK4A 3HBKA 4IHSA 4YFNF 3MEXA 2B42B 2PHXA 1QZEA 1R4MB 4GQ7A 3ZFEB 3WNNA 4UBHA 2B39A 2RVCA 1O4TA 1TME3 4HG6B 2W25A 4B3NA 4V2GA 2XAFA 1QU0A 3VBUA 4DRVA 4FTHA 1S4CA 4LUKA 2OAZA 5FJ8J 2KRFA 3ELNA 4G4FA 4RGGA 1N3PA 5BNPA 2Y0OA 3AX4A 2VKVA 3HSRA 4DYQA 4E7IA 4JGZB 3RZDJ 2E32A 4UVBA 5GLVA 2X1DA 4X0GA 1G3SA 1REPC 1WMDA 3IPVA 2XJPA 5JZGC 4CEWB 3NVCA 1VB4A 2ZGSA 5IVVA 3S2DJ 4YGEA 3FXKA 4D7TA 3HN3A 5K0UC 3H35A 4BEHB 4OMZA 2QZ3A 4GFBA 4ESJA 1YX5A 2FDGA 3H9GA 4BE3A 3MIHA 4XQ4A 3K77A 5A6XA 1BEV1 4XFHA 4PBOA 4A6SA 2FBIA 2CW8A 4NN0A 3ABKH 2JG9A 1BLZA 4K40A 1B8IA 4TLFA 2E33A 2RN7A 4FFFA 5FKNA 3CJQB 2P5VA 3ACGA 3U75A 4I76A 1Y56A 1QDCA 3VYTB 2RHPA 3HMYA 4MEXF 4WV8A 5F3CA 4YG0A 4L0ZB 2Y6KA 1BK1A 3IDBB 2V9KA 2UV1A 2P6CA 1I1SA 1LDDA 1XN7A 4UFHA 4AWDA 4LA3A 5BV6A 3AP5A 5K5RA 5A3MA 2DYCA 3JRDA 5EF6A 2G9ZA 2SBAA 4LOTA 5JSOA 2K85A 3HGGA 3PL0A 4XUPA 4LLLA 4NROA 5FZ1A 2B5HA 4A5MA 2XL7A 1C8M3 2BNMA 3MIBA 3OS0A 3I2FA 1W04A 2ZGKA 4MGQA 4YZ2A 5FMOL 1ZA7A 5C9AA 1FOWA 4AAPA 4PJNA 1HB3A 4IO9F 2ZPXA 1FMD3 4QPIC 1EV7A 5C4WB 5EDNA 2HTSA 3R0JA 2A6ZA 2H1KA 2ILMA 1UL9A 5DTDA 2OT7A 5HI0A 3HKZN 5K9YA 2LP0A 3FISA 4IEPA 3VN4A 2HDCA 5AFEA 4D7NA 2CMPA 4NHJA 3WNKA 3WLUA 2A7AA 2XQRA 3ZQQA 1OA4A 1J84A 4Q29A 4M9XA 3TO9A 2ARBA 2GA2A 4SBVA 1IV6A 2ENRA 1JHHA 4ISRA 5FPVA 2XOMA 3AVSA 5F08A 4MEYF 4BQYA 5F6LB 5C5TA 4LTAA 5LHHA 3VBRC 4RAGA 3AL5A 1ZLKA 3Q8AA 4EN9B 4C2UA 3PO2J 1AR63 3IUOA 3PTRB 2H94A 3V0BB 3KP4A 5L3GA 3QOEA 4DZPA 1D4VB 4E7KA 4SLIA 1IS5A 4MGIE 2VOWA 4IV1B 3OGGA 2HQRA 2M9HA 2KDZA 2GLOA 1W06A 2V9VA 2HWC3 1JJ8C 3DXTA 5FAXA 4IERA 3WTUC 3JTGA 2X5IA 3QD6A 2JJ6A 3AG2H 2VMGA 4WXDA 3NRVA 1V5GA 4MH0E 5TSWA 2O8QA 4CP2A 4HETA 1QHDA 5F27A 1W5TA 2XVCA 3GBWA 3SQOA 1JT6A 1I1EA 2RM23 3W21A 2LTNA 4C2MJ 2XVGA 2BBVA 1BR2A 1F5JA 2AC1A 4OOIA 1VBC2 4XJ8A 3OR2C 1PM7A 3O1TA 1ZBE2 3U1DA 2Y6HA 4HLTA 3TW7A 2PHDA 2UY9A 5LBBA 3AL0B 1XMKA 3VL9A 3ZRGA 2W00A 4WX9A 4HSLA 1O4YA 3I3QA 4XQDA 4G6DA 2VOTA 1GZWB 1SVLA 5EGOA 1UB9A 3FKIJ 3WCRA 2W2IA 5J96B 5D8AA 3CJIA 5GKAC 4A5NA 4W6XA 5K8SA 1ENHA 3HAGA 2E53A 2HYXA 2P6TA 4CICA 4PFPA 2CDPA 3IT8A 3LSHA 3N9OA 3F8MA 5AC92 5BNPC 3LF7A 2J1SA 4P55A 2VE8A 4PJ0C 1OJLA 1P92A 2XF5A 4CVUA 2VUJA 2PLV2 2Q8OA 3L7WA 2V1NA 5IP7J 4CUBA 2O03A 3IMNA 5DUVA 3CJTB 3I4MJ 1U2WA 4XFFA 2BUKA 2LYCA 1CAXB 1RUC3 5FZAA 2FBEA 4FHTA 2VAUA 4XFCA 3ZOIA 2X6OA 2YU3A 4D9JA 4DY3A 4Z2YA 3ZYFA 3GNEA 4AXOA 3K2ZA 1ULPA 4XEZA 4MO7A 1HV1A 2DTWA 3IN9A 1P4XA 4Q0VA 1SZBA 2BW3B 2J1EA 1JODA 4U0WA 2XJVA 4CYCB 1XNTA 5A7NA 2JDUA 3WZ1A 1J1LA 4AK3A 1UG2A 2L9NA 4Q4W2 3CQOA 4BNCA 4ZDPA 1QGPA 3A0NA 1W8FA 2VPVA 1H30A 4PQ9A 2MW8A 4JRLA 1DZQA 4IHVA 4OUMA 5A6ZA 1RUE2 2ZMEC 3P9KA 4QKDA 1EA3A 1UYPA 3K4NA 1OCZH 4XJWA 4AEDB 1JZ5A 4DFSA 3GX4X 2GNMA 2DVBA 1JOPA 3NV1A 3W6JB 4JX0A 4KNYA 1D4M3 2QDRA 5JXIA 2J5PA 2F4IA 3OBZA 3ZN5A 1L0OC 4MGRA 4CU6A 1VBE3 2W39A 4DXTA 3M8JA 1J9IA 5A70A 2PJRB 5FLIA 3QAHA 5CVVA 1W2OA 3Q8FA 4IV1C 2LH9A 4BJ6C 5F5QA 1IOAA 1JHFA 4AAXA 1EP0A 3JRIA 1US3A 1LHVA 3F9KA 2R7SA 1AL23 2GQQA 3R05A 1V9U2 2EFQA 3E5QA 4C90A 2Z5WA 2UWBA 5JOZA 3PSFA 4YW2A 2WQ4A 4OZXA 3P1IA 4AFCA 3BROA 5FY9A 2CHHA 3JUUA 1RMU3 4G3YC 4INDA 2VODA 2K4BA 1OLME 4AL9A 5FXXA 3H8OA 5ACA3 3F2ZA 4K6BA 3FM3A 2HR3A 3HOYJ 1YFYA 1K12A 4LK7A 2YSRA 5FY1A 1GUUA 3FZVA 1AX1A 5FD6A 3JAMZ 1G86A 2XMLA 1LJ7A 5J98B 4IPAA 2X5IC 3H7YA 2LC2A 1PVEA 4KIBA 4XBNA 1JZ3A 4Y26A 2BBYA 2H6BA 5LASA 3AVRA 2XJSA 5J09A 4BQ1A 2LVSA 1Z7LA 3ST7A 3HOSA 1CAUA 5DUUA 3HNMA 1D4M1 1D1AA 4WM7B 4QX2A 2OUHA 3SZTA 5BXXA 3DTIA 2V4VA 5EG0A 4XILA 4CHUA 2ZXJA 1MMDA 2FDIA 1A04A 2EXHA 1VP6A 2ZHLA 2WB1N 1YI2I 1FNZA 3BTXA 2XSJC 2Z5UA 2A6HF 3SYTA 1L7LA 3OYMA 4FTEA 3E97A 1PX3A 3A23A 4QKBA 1JI6A 3VODA 3FZ3A 5ANQA 4V2VA 1MKMA 1W8NA 5IT3A 2IVJA 5HS9A 2V4JC 1H9PA 1SFNA 4PI0A 5EJ1B 3AK0A 5GAHJ 2WUHA 3H8UA 3CJIC 5EEHA 5FXZA 1IF1A 3VZJA 3TWIA 1BIAA 1Z0XA 4EEFG 3GALA 2ME0A 1J58A 1LE8B 1SD4A 2B63J 2HWD3 1FNNA 1CAVA 4D94A 1H8TC 4UUSB 1OA3A 1O57A 3OOUA 4GULA 2ZS6B 1QJY3 1ZGAA 1V6LA 3ASNH 3PIPF 4CP0A 1W2TA 4Q4Y2 1EAH3 5EWSA 1XDSA 3LKJA 3MKLA 1PIV2 1R6RA 1E0EA 2VJIA 3MW3A 3ZQLA 3RYRA 5CB7A 1NG0A 4TSVA 1KITA 3FMGA 3GEZA 1Y9MA 4KISA 2VL4A 2R5ZB 5GJ6A 5F6KA 1VIWB 1AA7A 4URAA 4E7SA 4ZYAA 1JYIA 1PGW2 5FLXK 4A3LJ 3GWZA 4Z1VA 2CGNA 4IF4A 3E1SA 2D97A 1RJ7A 1LEDA 1QPIA 1S55A 3FE5A 5DDJ2 1JOBA 3AMPA 4CGZA 3J26N 3VD4A 1XYPA 2E2HJ 1OOPB 4I98B 4M00A 2XL9A 1Y1VJ 3AJZA 2OTJI 3NAUA 4DUVA 3R6SA 1FOYA 1I3QJ 2XLGA 2GMPA 2ZGQA 5GZGA 1NHAA 5BOXA 4AYBA 1GZCA 3UJOA 4BBRJ 5A3WA 1Y0NA 3S1RJ 3CLOA 2HWD1 2R7WA 4ITCA 4A7ZA 1NY72 3B3QE 3EXUA 3AP7A 4KWJA 2RJKA 4RM3A 1W1WE 4DQ2A 1FYMA 1J7KA 5IUQA 1JZ2A 4DINB 2CQXA 4PF1A 3GFIA 2GNTA 1GZ9A 3FX3A 2R062 4CDUB 1H9WA 5ILUA 4HPQA 1QEXA 1W5CC 3K9TA 4KICA 2EZIA 1ZNPA 5IOYA 1K78B 2NMNA 2QYOA 5IOZA 2I45A 5E89A 1ND2B 4A3JJ 2W48A 2K9NA 2STTA 4JC1A 4Q4X3 4TTGA 3DCFA 3O8GA 2KR2A 2VMHA 3KCXA 4AZZA 1UELB 3KZZA 1F4AA 3BP8A 2DUOA 2HGCA 2O8XA 1H1AA 5L3BA 2F6BA 4DXSA 2R0FA 1S0GA 2BJSA 1XE0A 1FYKA 1GSLA 3QYEA 2OBPA 2V5YA 1ZZ7A 3TEZA 3TN93 5LBCA 2P4WA 1AR93 2AR6A 4EV0A 1RUJ2 2WL1A 3TBDA 2COBA 3ZO0B 5CLSA 2WNVA 4K8RB 2XHNA 1W36D 1VQNI 1ZZ6A 3O1VA 3VDDC 3GTJJ 3PVNA 3ZOBA 5LW9A 4XSXF 1V6KA 3A22A 5BS6A 3GGLA 1F4HA 4XJZA 2B9SA 4ON0A 3IP4B 4WM8B 2ZFWA 2ICWG 2F5VA 4WZFA 3U1XA 1K42A 2A75A 3G6JB 3HT1A 5K7ZA 1WI3A 1NTCA 5A7WA 3RWKX 2M0MA 2HWF3 1A6IA 3D82A 1DF0A 4YM0A 2PHRA 1BVVA 4IEZA 4E7LA 5AIQA 1DQ6A 1D5VA 4JBAA 5FP4A 3ZR6A 3ZQFA 1YRNA 3HN1A 2BXZA 1PUFB 4LK1F 1MMSA 5FZGA 5FYVA 1W7PA 4GMP1 1REEA 4LKSA 3DKYA 1MS1A 1XNCA 4P1WA 3W20A 1SEFA 4FETA 3OEAA 1FX5A 1V70A 4M71A 4QQPA 3QPSA 1IPJA 3Q9VA 3TN91 1VLNA 1MS9A 4W6YA 3G1MA 4D7YA 2Y34A 3PQJA 4DNYA 3VV1A 2VZ1A 5FZCA 1IJWC 1V5FA 1V6IA 4EJOA 1Y39A 3K70C 1X4OA 3JCIA 4DRRA 2I07B 4EN6B 2PA7A 2ZGPA 2HWE3 1SCRA 2E9QA 4YVSA 5IVJA 5L3CA 4LORA 4NDLA 3KE2A 2HEOA 4CZCA 4MTDA 1STMA 2YB7A 1V00A 3U1KA 2HWF1 2M8EA 1VR3A 5C3RA 3AZWA 2M7BA 2OZUA 4HEA2 5CVUA 3KF5A 3K0LA 3TOJA 3JRCA 2A61A 2QF7A 1Y8RB 1H1MA 3WHCA 2P3KA 5CVIA 3WNLA 2VECA 4O65A 1UD1A 2YU2A 2NNYA 5FZKA 2Q8CA 3I71A 5JOXA 1IHMA 1T95A 1VRBA 1G8XA 4HRIA 4PIXA 2BNOA 2VB6A 1UNBA 3KETA 4CDGA 3I56I 1UX6A 3RI4A 3VLBB 1SLBA 1GV2A 4RR3B 4AHXA 5K5QA 3RJPA 1ND2C 2OW4A 2JVHA 3FHIB 2CW7A 4ZY9A 1G3YA 4CDWB 1U5TA 5J47A 3BPVA 3NAPC 4XAEA 4B7KA 2QQIA 4V2FA 2VZVA 4LQRA 4HPKB 2VH9A 2FMYA 4B3XA 2FCTA 2WV0A 4D0QA 5FXVA 2WO1A 4AFAA 5A7OA 2WY7Q 2HYGD 2D6LX 4Y5SA 1WHUA 2GZWA 1AR73 2HWE1 3NWTA 5FQ0B 1T39A 1X33A 4ZZLA 2J5OA 5T54A 3ZFFB 3L2CA 4D0PA 2WZR3 5TISC 1HRI2 2OUMA 1ZGJA 3FF5A 4CZZA 3WDTA 1AYM2 4HVRA 1RVF2 4XACA 3PVOA 1WW4A 4OIRF 5JXHA 3PUIA 3AZYA 3CCSI 4AVBA 4R8HA 1LGBA 1WCMJ 2DMUA 4XF3A 3SC7X 1NK3P 3SKVA 3MV01 2KIUA 2HQAA 4PSXA 4YIRX 1RTVA 4II2A 2CYFA 5FBZA 4JTNA 3GJBA 1R083 1SAXA 2OX0A 4U7DA 3FXQA 1E57A 2H1LA 1VB2A 1SC7A 1VF9A 2PHUA 1UHWA 2LFBA 5FZDA 3BR1A 2Q1ZB 4DOZA 2XGDA 3SMHA 3RGBA 3WE3A 4NC7A 5JXJA 3WODF 1NCQB 4R9AA 2WNVC 1SLLA 5GZFA 2DA3A 2ZXWH 1HOMA 4I0BA 1RJ8A 4KWKA 4AQSA 2XGEA 1QXRA 4XF0A 1WCUA 2WNUB 4C0BA 3ONQA 1IDYA 2Q2EB 3BODA 3A0HC 4JDOA 2BHYA 1NE6A 4P5YA 3FUOA 5M3MJ 3WTSC 1DIWA 3A21A 4K7JA 1PO23 3OBAA 4B43A 1V3FA 5FD5A 2OIIA 1QF3A 4ZU5A 1PMIA 4G8XA 3ES1A 2JA7J 2OJED 4XJAA 1AR71 5DUWA 3H0OA 3ERED 2WN3A 1MQTA 3JBG2 2WT2A 2AREA 1I6XA 4AI8A 2IA2A 1Q8PA 2WFF2 5LK7B 3LGRA 1N77A 2WZR1 5LATA 5LY1A 3TDZC 3S15J 2NS8A 2PHLA 3VD3A 4I09A 1DDLA 1S0DA 1Q1HA 1BKZA 4M6VA 1DGWA 1HBXG 5FMCA 1C8NA 3E5UA 1B9NA 4Y52J 2GN7A 3RNSA 1JYNA 4F92B 1IV8A 3OYKA 1FV3A 4KIGA 5JOWA 1GQHA 2D45A 1AL0G 2BP6A 4XJUA 4LR4A 3ZVXA 2MYSA 2LR8A 4P14A 4EM1A 4DUWA 3OY8B 2VBPA 3PL8A 1RUF2 4CU8A 2ZTNA 2B7EA 4HANA 3GYHX 4CCJA 2RS33 4ATFA 1PNGA 1PZ9A 3O1OA 1UPSA 2FOWA 3RDIA 1LHUA 3OMYA 2DOAA 2MEV2 2D7FA 4M3GA 5CISA 1W0TA 1ULOA 4YM3A 3PUHA 1ZYBA 1OPCA 4AQ6A 5FLHA 3LSMA 5D21A 4RDUA 4YW7A 1BN5A 3Q5FA 1UY3A 2XSDC 1G3TA 1JGGA 5JAXA 1YCIA 3VBUB 1YYNA 4MGSA 1ULEA 3AAFA 4K1ZA 1IRZA 1IG0A 4Y15A 4RR3C 4QMAA 2RV8A 2E1MC 4LB6B 3IDEA 5FYUA 3VKFC 2FNAA 4B48A 4UB6C 1UX7A 4YELA 1NZIA 4Y24A 1LHWA 3SEZA 1CF7B 4O61A 1TZLA 4NIHA 3OGVA 3BPZA 4KN7X 1WW7A 4ZC3A 5LA0A 1IG3A 3OR1C 1E17A 3IPVB 1IN8A 3KZYA 2CUFA 5EJCA 2QKDA 3JRFA 3BTLA 2P6SA 3PUAA 5C3PA 3MO4A 1IN6A 4Z2AA 5LK5A 3B01A 1IKPA 1QNYA 4YPJA 1EV13 3HG9A 3J80Z 2ZX2A 3VBHB 2FMDA 2BBAA 1H2KA 3FUQA 4XURA 3PIOF 3HIFA 4AVVA 1N1SA 5E1RA 3RKXA 4Y7NJ 3H7JA 3HDDA 5CFDA 3ZQIA 2JG9B 1Y3TA 1U5TC 4OMYA 4PT6A 5IP9J 3S1MJ 5IVYA 5DCMB 1NG6A 4HK8A 4I6ZA 3RI8A 4GKXA 3UETA 1X3WB 1XD7A 3KX2A 2E2IJ 4C2TA 2RMU3 2ZEWA 2DVFA 3ZYBA 2CH0A 1RR7A 3AYAA 1ZGWA 4DIQA 1RRJA 5IVBA 3MGUA 4AIDA 2UZKA 2H27A 2HU9A 1OBNA 2B45X 4NPRA 5E1ZB 1A8MA 3JR9A 3JRBA 2ZFUA 4BQ5A 1WJFA 1IZ3A 2RNJA 3K4AA 3B73A 1Y4WA 2Z99A 3ZYPA 1ODDA 2BY2A 4ESFA 1ZELA 1JTZX 2YV8A 3I2OA 1OR7C 3F6VA 1GZTA 4IV3A 5JIUA 5E79C 3VYUB 3J7ZI 4L0YB 5EZHA 3CDHA 4XDOA 3AKQA 2HEVF 4MO3M 4FPKA 1AYN3 4O6JA 1U0JA 1FOKA 3VPRA 1RR8C 3L2HA 4ZS2A 4CRQA 4IXAA 1A3KA 4HXCA 2RS13 3M3CA 1VQ4I 4GWIA 3I4NJ 1D0XA 4ARXA 4II3A 2LG4A 3L9FA 4DMIA 2ES3A 2M0CA 1DYPA 1KU2A 3CF5F 1XRUA 1AJOA 3B69A 1MBFA 4ZDOA 1GXPA 1BHGA 2FU4A 1KZHA 5CFCA 2YPDA 3ZM8A 5J6XA 3MLLA 2X6XA 4U2AA 3ETPA 4BQ3A 1QBJA 4RN5A 1MEC2 1OKQA 4OINF 2VC9A 5HOOA 4QGNA 3NNMA 2R5YB 2YMZA 1XSRA 3S17J 4J1WA 2OQ6A 4KMFA 3F95A 4GXLA 1JYXA 5DZGA 3VB2A 4HX7A 5FPLA 4KUMA 3KLSA 1A8DA 1ZN2A 4BH9A 4RYDA 2ET1A 4J6GA 4AIHA 4CCKA 2JRTA 3LFMA 1Q8VA 2EBIA 1POV3 4Z8BA 4CDQA 3KZIC 3AG1H 3HBLA 3SFIA 3O2PE 1W6PA 1RUI2 4MXWA 4AHYA 2L3DA 2R7ZJ 1G9FA 2OTLI 1XGMA 2XAGA 4FPFA 5EYRA 2RS11 4AC0A 2N7GA 3B5LB 1YFHA 5IVFA 4PUSA 4EATA 1VBC1 3F21A 4ABZA 4P9YA 3COAC 4AIJA 1UW8A 1YC61 2TDXA 3ABMH 2PHTA 1MD0A 5LBFA 4LK6A 2DFIA 3ZMVA 3E7LA 5D8AB 2GA1A 1R1A2 3GM8A 3ON7A 3RCOA 4NHXA 4XFAA 4WF2A 1UIJA 2BGOA 1RUOA 2DYRH 5D5UB 3KF3A 5BNOA 3MLKA 3VBHC 5A3TA 3VD9A 1DG6A 2P7CB 3EQLF 3WXPA 4C3JJ 5HLHA 2NVUB 4NO4A 3T1LA 5HODA 1GOGA 5DYMA 2ELJA 4JVAA 4GMP0 4HNUA 3OUHA 1IN5A 2LKSA 2RAEA 2DPUA 4E4HA 3EUHA 3T09A 4IEWA 2K7LA 3ZMDA 4CPBD 3NV3A 3GXOA 4GXOA 1MZFA 4HLXA 2LOOA 2BZDA 1MBJA 2COMA 5FYYA 2M3AA 2R041 4JRAA 1RKWA 1POV1 1IRXA 3DV8A 4ZZDA 3S2WA 3CMYA 3DU5A 1V55H 4QWNA 4ZH4F 3ASIA 4GA9A 2CWMA 4MHUA 4BM8A 1JZ6A 4K9SA 5L3EA 1O5LA 3M9AA 2KLOA 3CP2A 4YFWA 1IC8A 1D8JA 5CEHA 1QOTA 5JSPA 1DQ4A 5B1AH 4B1RA 2HDWA 3S7EA 1MIJA 3LL7A 3HXLA 4Q4ZF 2TEPA 1FX7A 2FF4A 3ROUA 1KGYA 3S5QA 3RQIA 2JIJA 2E31A 5J3LA 5KAFC 1W6OA 4FCAA 2R7XA 4FOQA 3K4DA 1JZ8A 2B4KA 3JCUC 5KHGA 1L3JA 1TE1B 4OI4A 3NJXA 4IETA 2DVAA 1Q5OA 4FTSA 4UF0A 1F9NA 5IY5H 4BE1A 4OULA 1XB4A 2F5CA 2L02A 2VBXA 2LS6A 2LK2A 2G19A 3PMSA 1XJAA 3TQNA 4KMQA 3P6BA 2HVQA 2EA7A 4JQFA 2BGPA 1NH3A 3EMRA 3P3NA 4C1XA 1HJGA 4CDXA 2PMZN 5GAEJ 3OGRA 1SACA 3T4VA 1AX0A 1S0CA 5FTTC 1AXYA 1PUEE 2OCEA 3POEA 1F5FA 1RUH2 1LECA 3CZ6A 4QKNA 1I5PA 2JDAA 3H1WA 2ADEA 4HN1A 3UKVA 3OIPA 2I10A 3USSA 2R4GA 2ZHMA 3GTPJ 2AENA 3ILRA 2FMLA 3M8LA 2ZHKA 4L2NA 5G04L 1OA2A 1MNMC 2G9FA 3S3NA 2HVSA 3R4SA 3PUSA 1YYVA 3N4MA 2D5HA 5CFCC 3B6AA 4L9VA 4LLOA 4BE2A 2IZWA 2VXZA 4A3ZA 2EXIA 3V4GA 4Y20B 4JHZA 4QU2A 3UKTA 1NQDA 1RPWA 1MMAA 4KN4X 3I54A 3I3MA 4ENMA 5FYSA 3N7MA 3N7JA 3RS6A 1ETKA 4AGVA 3NNFA 1JYVA 2DBNA 4EN0A 5FZLA 2IXSA 3QPTA 4GAZA 1HN0A 5JUVA 4HYEA 2ZKZA 2VBBA 2DCYA 3OOPA 4UNOA 3DPRB 4JZRA 1OQDA 2JK3A 3JB4C 2O8KA 3VBFA 1C1LA 3AFKA 1Y8QB 2VQLA 3FXRA 2O3FA 4YIIA 2Q1MA 2Z33A 5EG0B 4NOTA 1HSTA 5IK4A 4A7YA 1IRFA 4PGHA 4AM3A 5H2FC 5JPNB 4RQPC 4BYYA 4LK0F 2R0QC 1CX1A 3B9IA 2A73B 4QPGA 3PUBA 4LB5A 3LAGA 1SFXA 1N25A 1VBB3 5T55A 3DUIA 2P0WA 2H0VA 3DN7A 1BCXA 3GBFA 2RR13 2EWNA 4Q1PA 3TEYA 5DG2A 1ODMA 5HCBA 2WSVA 4COVA 3WE2A 3HVDA 1VFCA 1BEV2 3B9CA 1QNTA 1YG2A 1S7EA 5FMOS 5LCWL 4YZ5A 1DUXC 5BNOC 5HS8A 2C6YA 3JQXA 3GTQJ 4H3WA 3CUOA 1W3VA 1ENXA 1QGLA 3ZN6A 5ERIA 3MDPA 3E5XA 4J19A 4QDSA 2P8TA 1CAVB 4XCAA 3KHBA 1HSJA 3RPUA 3I49A 1XMXA 3AMMA 3K4KA 4XFBA 1LNWA 1TME2 4W65A 3EYPA 2AXLA 4HNTA 4K2EA 2NVXJ 1WJCA 1DLLA 5DAXA 1K6YA 1H2NA 4XUQA 2R49A 1R00A 2PQ8A 1ENQA 4I30A 4MVTA 1I50J 2XHKA 1KS5A 3RZHA 4NNJA 2ADUA 1W6MB 1LKXA 4B09A 3DEWA 2VUCA 5A7PA 1LHNA 1VBB1 1GP4A 2NOGA 2LKXA 2YPJA 4BKXA 1YJ9I 3SEQA 2JECA 3S7IA 2BY3A 3OS2A 1W28A 1F35A 2W7NA 4JQTA 2W1SA 4XK4A 4OI0A 4XC9A 3L2VA 3FMSA 3HUGA 4ASKA 3AMHA 4KU8A 1LEBA 3CO2A 2ZOEB 1GVJA 1Q56A 3J7MA 1W6NA 1RXFA 3QQAA 5I0TA 1WJAA 3TP3A 1N1TA 2G9GA 3I2DA 3LEKA 1YJWI 2BGCA 4CDXC 1IPSA 4BACA 2Y0SN 2VC1A 1KQRA 4QU1A 1S7OA 2HWB3 1K4SA 5FREA 2ZMNA 5KCMA 2AACA 4KT6A 2AZ5A 3RFRA 4PJMA 3SNMA 3UGFA 3WR0A 3M3QA 2X8KA 1PMHX 1H6XA 3RZLA 3AZZA 1O3QA 4QHOA 1H6YA 3FXMA 3LSGA 3CDZB 3AP9A 2P5KA 5LGTA 3KYCB 2NS7A 4HV5A 3VDBA 3CCEI 1J3QA 5T3NA 3WU0A 3CMAI 4LMYA 4DEVA 3OGJA 5GLWA 2RV9A 3Q0WA 1DQ1A 3PTYA 4OIOF 3JU9A 2STWA 2RKHA 1LOEA 1SDWA 3VZOA 3HBZA 5FK7A 4B8EA 1OYIA 5E88A 4UW5A 4LO8A 2KHMA 3VDCA 3PURA 3J8F3 1A31A 1FATA 1Q43A 4H55A 4IVNA 2CJJA 4JDMA 1DLCA 1CIYA 1UZYA 1PGL1 1GNZA 5EEGA 4DBQA 1ODNA 1NE4A 1Z3YA 3ATGA 1JU4A 2W92A 1UFMA 2WR9A 3OUIA 1RUJ1 4QAWA 5SV8A 2RS53 2VZUA 1DGLA 1R23A 3WHTA 5A7WB 1RHI3 4BGDA 5GTHC 4UFLA 4CCCA 3A01A 3R61A 4QPGC 4QQLA 3TBIA 1V54H 2XXZA 4O7XA 2OXBA 1REFA 2C0ZA 5EYYA 1XCVA 1YRNB 1YLLA 1BYHA 3BU7A 2KP6A 3LD8A 3I4IA 4YFXF 2V4AA 2D1VA 4E8CA 3RIRA 4XUNA 2K40A 5FZ3A 3GXUA 4Y33A 5KK1A 4OHXA 3V8JA 3GDBA 2ID4A 2WYSA 4OQ8A 5FYTA 3WF1A 5FP3A 3UJQA 1RUD1 2L4AA 1POQA 5FZ4A 4ZU7A 5CKQA 4D69A 1DP7P 4RAYA 1OD5A 4QQOA 3OOXA 5T5LA 1E2XA 2CQKA 2ZEXA 4LBLA 1MS5A 2DVGA 4GKYA 4IL7A 1VQ6I 2L5QA 1WUVA 2X4HA 1AOYA 2VO5A 4YVSB 2UXNA 3KCYA 4Z6YA 3CO6C 3ZSLA 1YI7A 1H4GA 4Y1UA 2F4OB 1B72A 1RHI1 1R1UA 1YW7A 1C1FA 1T2KA 1ZG5A 1ND3B 5E3MA 1BW6A 4QXBA 3WP6A 2W1OA 5KR7A 4YRDA 3VSLA 3THPA 3DYMA 4G7HF 4OIQF 2KRHA 5A3LA 3NWSA 3E6DA 2WS91 1VTNC 2CU5A 1RB8G 1BBT3 3FHNA 2XROA 1PK6C 3ALQA 2GH8A 5H9PA 5CU1A 4LUMA 4CYDA 2WLQA 1LEMA 4BOWA 5ILVA 4M3CE 2ZBJA 5F7UA 3P9CA 1F4KA 5I8YA 5KHKA 1NA1A 1VMFA 1FBQA 1Z1DA 4TWTA 2VQGA 2DPDA 1COV3 1USTA 2ADDA 2CG4A 3ZFGB 3M3EA 2PHFA 4M6XA 4UAPA 1YE9A 2ELKA 5GP9A 5JLVA 1DCSA 4LLFA 2KIMA 2ACJA 4GH4A 4YYOA 2D6MA 1Z9CA 1FLIA 4PIYA 1MH4A 4FVVA 3FC0A 2G7HA 3LSIA 1G8WA 3VD7A 1QY4A 4QD2A 2JE7A 2LRPA 2M34A 3GZAA 2MPFA 1TMF1 1ACCA 4I7HA 4JOMA 4FFHA 1W2AX 2JT1A 4BQ4A 4XLPF 2ZGUA 3AMNA 4IE6A 4NIAA 2WRAA 1C3HA 3VYSB 3J4UH 1XGOA 1HDPA 1D4M2 1K4TA 4R79A 2VCBA 2F4LA 3EJKA 4CUGA 4YARA 3ZXGA 2C5DA 2ECCA 3NQHA 4XHBA 1DBNA 1VBA3 4IRHA 4XICA 1WLDA 1W9TA 1DHKB 2XG3A 1AYM1 4B4QA 1RVF1 2JPCA 5C71A 1OH4A 2HOTA 4CUAA 2VULA 2PHWA 5CPRB 2Y6FA 2QKMB 5IHRA 5C5UA 1BZWA 1COV1 2PQQA 5FDBA 4FOYA 1UYXA 4HF0A 1O4XA 2HQNA 3QU3A 1OD3A 2F5EA 1YNAA 1QQP3 4M4PA 2YGMA 2R7OA 3MPBA 3IM0A 4LHNA 3RKYA 2JEMA 3MZHA 1W5SA 4J01A 4AF9A 3GBGA 2KL4A 5CIRA 1OISA 2ZSIB 4N43B 5FP7A 5J8CA 5E18F 1LAJA 4W6WA 4F55A 4Q5OA 2X10A 4OIPF 1GQPA 4S0HB 2OC6A 4X6AJ 2JKBA 4IGPA 3ZXAC 3T1MA 3C2BA 4K8FA 3WTZA 3H5AA 2N8GA 3EO6A 2ZCWA 2HOSA 4I3GA 2XKPA 1Z05A 3WG1A 2VTXJ 1FOXA 1KQ9A 2XPJA 5H9QA 1FYLA 2FNPA 3FWEA 2L01A 3VZNA 4XONA 4AVSA 2RREA 3TDUC 5FUPA 4CU9A 1AU7A 1W39A 1WD4A 4M72A 3FHAA 2NOJB 5FKMA 1NXD1 3HEFA 3KLNA 2HPIA 3Q8BA 3K51A 2JKXA 2KA3A 4UFJA 1DPUA 3AC0A 1YI9A 1K6OA 1KXGA 3KD4A 3N3HA 2BNNA 4N7IA 2V1UA 3S1QJ 4RHV1 2EFPA 1ALYA 2FEZA 4FPYA 1UOFA 2R1BA 1QQP1 1Z67A 3IRQA 4M73A 4U0YA 1C5IA 1FV2A 2L4MA 4A0XA 4ONUA 3AKSA 5FO8B 3T3YA 4R4XA 5APAA 5HXMA 1T8IA 1R36A 4KDPA 5HPOA 4AI0A 1YHFA 2LLKA 4DNCA 4MGKE 2VT3A 5H6QA 5FKCA 1ZZBA 1UWWA 1QOSA 3GJAA 4FPOB 1MJAA 2KIQA 2WNOA 3H5NA 2HWD2 1V0AA 2VMCA 5GPCA 3Q3SA 1CONA 2VD7A 3LNQA 2QM3A 1PJRA 1UXXX 2DOFA 5IWFA 3K1MA 3JRHA 3WGGA 4B4CA 1QJY2 5H9RA 3OSDA 4AYBN 1CZSA 2QE3A 3VUOA 3BR6A 1EAH2 4PLNA 3T0AA 3GFMA 2L0KA 1LENA 4BY7J 1UHMA 4EZ4A 1QO0D 5FFOC 3W59A 1Z78A 1U5IA 2HKOA 1EUTA 4Q8KA 1ZRFA 4L9BA 5J1YA 3IDAA 1LDJA 4A41A 4YGBA 2MH2A 4L9JA 1NA1C 4BISA 1BI1A 1W9YA 3NNLA 4GWJA 3HOWJ 2ORZA 4LT5A 5F2WA 1PMJX 4ZS3A 3TYJA 1VQLI 4CP9A 1SQ4A 4NRMA 2DVDA 4HL0A 1MDMA 4YNIA 3ML6A 4LHKA 5CFDB 5D2AA 4QB2A 3AYDA 3VWBA 4MFEA 2BE5F 3MW2A 3HJRA 3ES4A 3MMYB 4BY1J 4PLOA 4FPJA 3CUQA 2TNFA 3OYDA 4F93B 4N53C 1JHNA 2VZTA 2O14A 2XDVA 2HH9A 3MD2A 3VGIA 4EJVA 5FKLA 2LRDA 3HKZA 1ULDA 4AD9A 3NV2A 1FTZA 2XPVA 4YM2A 1PHMA 2VGDA 1HQCA 4LO5B 3EB7A 3IDCB 1IG7A 5FO5A 1Y1WJ 1WA6X 4ZZ8A 1UAAA 1JUIA 2OYZA 1JTYA 2JA6J 3BI3A 4IV3B 3SEPA 1ZBE3 4NUBA 2JG8B 2FD5A 1P6RA 3GTMJ 5L3DA 4H0EA 2R073 4N90A 2VCCA 1NOVA 4QDRA 1TNFA 2O1QA 4XKBA 4XHXA 3M1CA 3W2VA 1W9FA 5IVEA 4BQQA 3OSFA 3H1CA 1IO2A 1IPKA 1UU4A 4XKVA 1RXGA 2CW0F 2OA4A 2XWJB 5B3SH 4MG2A 3HB9A 3C7JA 1B09A 2ZACA 2J1UA 2XASA 2DW4A 4NWWA 4IE7A 2LM3A 1WJEA 2GN3A 3HPGA 5AC93 3ZYIB 4AQ2A 1ITYA 1B6AA 5J40A 4NB5A 5E3NA 2O61A 1G9DA 3TN92 5A32A 2PLV3 1J3PA 1WLCA 2IVIB 2W68A 1CD3G 5JCTA 4AFBA 5LD2C 3GTLJ 4UYBA 2Q0AA 2HBTA 4R4ZA 1DPRA 1OC1A 4BHCA 5LBQA 1YFUA 4LKFA 5FY4A 4LD5A 1FWZA 2A3WA 3CL1A 4M3CA 3EDPA 3SCFA 4HOOA 5FY8A 2EQRA 1J3RA 2M7AA 3BKZA 5ICEA 2XH6A 2CV0A 3HNYM 2HWF2 2W3JA 2QQUA 3ULQB 1P2FA 4DXZA 3RMYA 1HRV3 2R071 4N9HA 1X7NA 3IKWA 1GFF2 2V09A 4CDQB 5C6CA 1J1TA 2VPRA 1J5YA 5F9TA 1W6PB 4GGGA 3K7AJ 1K7AA 1EPWA 2VZQA 2YFZA 4H4KC 5FKOA 4HT1T 3O5SA 2W1QA 2M2EA 4ZXKA 4LBQD 4Y5TA 2CUJA 1CR7A 1AHSA 1UY0A 2DURA 4GJYA 1FBUA 3AXEA 2PMWB 5HBAA 2WO7A 3VZKA 5JZGA 2E7QA 5FYMA 1SFYA 1GV5A 2RDRA 2WWSA 5K0UA 1R64A 2DA6A 3O12A 5LA2A 1ZARA 1YS7A 2RJ2A 3V7SA 1YITI 1S8NA 1SLAA 5IP6A 1F8VA 2OA2A 1KU9A 2RJLA 3J7LA 5D5WB 3FBYA 1FXZA 3K3NA 1U8RA 5GLUA 1X2NA 3CJXA 1ULCA 2HWE2 3I9V2 5C4JJ 3I3DA 3ACIA 3AL6A 3HM5A 4G7ZF 4LO6B 1W03A 1WW5A 4P9FA 1HRV1 4BDYA 4W97A 2Z3YA 2C26A 4K20A 2RC4A 1JKRC 1P8JA 5FJHA 1NK2P 1UCRA 4CA9A 1SFUA 4A6DA 5KBFA 1O3RA 3ZQCA 2PAKA 5IFTA 3DBHB 3QWLA 1P9QC 1UY4A 3MYXA 1AXKA 4E4SA 5D5VB 1U5ZA 1KQ0A 1XS9A 5C7GA 3O1MA 1MMGA 1LR5A 5DD4A 2BQPA 2JG8C 2PX9A 1G9AA 3G1OA 3MIGA 1YJKA 1BJAA 4QPIA 2VMEA 4XXAA 3RPQA 5BNQA 3FHQA 3LAJA 3JD73 3BJ6A 2QDNA 4RS5C 4FX0A 2R7QA 1BOBA 5E16A 1SBFA 3NRUA 4HF2A 2DMQA 4OUEA 1I39A 1XSVA 2PN6A 2JIGA 4UOJA 2VN2A 5A3NA 4N0BA 3E6MA 1HB4A 3VBOB 2PLYA 5JIAA 3F6OA 1AR72 4WK8F 1A6QA 1F5TA 2CQQA 2WAOA 4P9UA 1ZK8A 1HW2A 3AG3H 3VBRA 4LPLA 1GT0C 2VIXA 3OYWA 2LUWA 4LGWA 1AHDP 2WZR2 2WA3A 5J37A 3EHKA 2HZDA 5GZEA 1LCLA 4XKWA 3SZGA 1JU3A 2EFOA 2XAUA 1D0GA 2E19A 2X6YA 4NHMA 3DKWA 4A2UA 4RA0A 2W47A 4PDWC 3J81K 5FLVA 2JE8A 4RGAA 1DZTA 4JGYC 4CSWA 2X29A 3MV11 2AGSA 2VZSA 3KP6A 2F2EA 1K5MC 2AH2A 2JENA 3KV4A 3K2OA 3WW2A 5LWBA 3LPGA 1LFUP 1Z7S1 2ZMKA 2ARXA 4LXLA 4MV2A 3FXLA 4XFIA 4BUPA 2J7MA 1LOGA 3JD71 3WOGA 3HRMA 4ASLA 4BMEA 2ETEA 3C2UA 3LFIA 2WB1A 4HZFA 5FLJA 3QODA 4ENNA 1R49A 1PIV3 4Q0SA 2Z79A 1POGA 2MGQA 2Q8KA 2DXIA 5ICCA 3OJBA 4XSZF 4R1HA 3FL7A 1IXRC 4AGGA 1PO22 4HN0A 4EJRA 1VBD1 2ZEYA 2MBFA 2XVLA 2ZJQF 3RTRA 4JGZA 1QU3A 3K4ZA 5F5CA 4CCNA 1FSEA 1P7JA 4EYUA 3VBFB 2V26A 2LROA 3CC4I 1PO13 2KJCA 1ZBA1 1IS6A 4AE2A 2WAEA 2JB4A 4E9KA 1FY7A 2W52A 4OUSA 2P1BA 2KD7A 4QXKA 3V8LA 1HXS3 1WBLA 5ABJC 2CQNA 5FZ8A 2EZKA 3CF2A 5H20A 1NLQA 3HQXA 2K9MA 2CV1A 2VC0A 3KCCA 4ZYGA 4Q48A 2MG4A 1BI3A 2CRGA 5HCFA 2HWVA 4KU7A 4C8DA 3O1PA 4UFMA 2IS6A 2IVMA 5F0CA 1TT5B 3B93A 4PDKA 3BZKA 4L5IA 1V6JA 1LFPA 4W4ZA 1OFCX 4HBNA 4PLMA 2GIVA 3ZN6B 3RZJA 4CU7A 5LLQA 4YW3A 1P4AA 1SAUA 2R063 2C9AA 1PDNC 3BTCA 2D2WA 5HNFA 2Q8EA 2E7AA 3K4MA 3DEUA 3CD6I 4Y1XA 2IUWA 2PJPA 4HSRA 1WCQA 2JX9A 4LO7A 4DS0A 3G1LA 5G05L 4S2FA 4OHWA 2W24A 4XRMA 1D5YA 1TME1 3V42A 3LSTA 4ZYEA 4GYIA 2EA2A 2P6HA 1GICA 4XIKA 3VHRA 4L5JA 1WMEA 4KGQA 2XPWA 3IHUA 2IJLA 1HXS1 4OI1A 2M4KA 2ZMEA 4HONA 1XX5A 1OCCH 2HXOA 3ECHA 4QKFA 3PUFA 4DBRA 1RUG3 1TP4A 3EPZA 2W94A 1UMQA 3OYFA 2XLFA 5AIPA 5SV5A 4Y4RA 2VW1A 3S30A 1X1DA 4EN7B 4H7MA 3POJA 3KEOA 4DQAA 3LDKA 1QH6A 2G1MA 4PCQA 4A44A 3V0BA 2A69F 1HW5A 1O5UA 2P34A 3S8PA 4IOAF 2Y26A 1E5RA 4IV1A 2WT1A 1WCSA 5JR3A 1FOD3 4QQ2A 2VE1A 2W57A 4Z92B 3SJMA 1Z6TA 2LBFB 3H1YA 3MI8A 5KWRA 3ABZA 2BW8A 5GLTA 1DQ2A 5T5OA 1XC5A 3PVEA 2RVAA 5HCHA 4MXVA 2C24A 2NM1A 3N97A 1VALA 1Y43B 1MH3A 4IHWA 5A1LA 1R4NB 5E3OA 4ZHNA 5KVRA 1YIOA 4ZU4A 2XAQA 5FXWA 5ICFA 3IMMA 1MBEA 3I2JA 1C8M1 1AYN2 2LDUA 3OYGA 4GIQA 1GZWA 3RSNA 2NAZA 3TNPB 3ZFEC 2ETHA 5K4LA 1T6SA 4U0VA 3REOA 1JZ7A 1FMD1 2RS12 2I5UA 1H2LA 1UZWA 3CZJA 2PBIA 2EB7A 4TV7A 5JMOA 2TRTA 1XYOA 2ERFA 2WBMA 3AZXA 3F0CA 3VB9A 3V0AB 3M1HA 3ACLA 2DCTA 5FOBB 2I2SA 3SDGA 3T30A 1JI8A 3FXJA 3G2BA 2IS1A 1X8EA 4JGZC 4LBOA 4Y4YA 2R92J 1XC6A 1EPZA 1XTAA 2CY6A 1IXSB 1FOD1 4XLFA 1LFBA 5CBLA 1OHFA 3VOEA 1IQAA 4CEWC 2WV1A 1VRH3 4Q0QA 1VI0A 2VQUA 4QPQA 2KT0A 2LREA 2D43A 1GDTA 3BN6A 1AR61 2V73A 1SD6A 2NQYA 1XDUA 3GHNA 4BHBA 1YEWA 2YU9J 2P3IA 3OD0A 3A01B 3O0WA 2P4EA 4N7UA 2HOAA 2HWC1 1LGNA 1OLTA 4X8PA 1H8TA 5D4RA 2R042 1G4DA 3U0ZA 3ZR8X 2VY0A 4CYCA 4I0AA 4YRVA 3DF8A 2MD0A 2YBPA 4EWDA 1GOHA 3LIGA 2DU0A 1ACIA 2RM21 2EPFA 4RFRB 1BJZA 5JFRA 3OF1A 3WG3A 5JI6A 5C8CB 2DBIA 2FJ1A 3USUB 1ENSA 2QQ9A 5FRMA 4EVIA 3OYLA 3LSKA 3MCZA 1X50A 4XAAA 4D5CA 4ES9A 4XBLA 3U2RA 1TNRA 4J1XA 4A3CJ 5AONA 2VCMA 3RZZA 2UWCA 3TP0A 4AEDA 3ZCOA 2R0HA 4P5OA 3VD5A 4JCKA 1HRI3 3DBLB 1XE7A 3TEWA 5J1XA 1UMIA 5DZEA 2NPIA 4XTMA 1DGWX 1VRH1 5C4WC 4CEYB 2ZKNA 3AXDA 3POYA 4S04A 2PJRA 3D0JA 3KP2A 3ZSMA 2JDYA 2CAVA 2C9KA 2YXSA 1Z77A 2IS4A 5FB2A 3AKTA 1D0HA 2GXGA 4Q4V3 5T52A 1OLRA 3ILNA 2MSYA 2XAHA 3TMOA 5IK5A 2K3FA 2DA7A 4AVTA 1BJQA 1WMXA 2QCOA 1R1ZA 2VUAA 3N35A 1GQGA 5EQUA 3PM1A 4C1WA 2VBYA 4RL7A 2JE9A 5DMYA 3IZOA 3HPHA 1RUC1 4NC8A 2XBO3 2B9VA 3ZPLA 4HAMA 1UJ8A 4N4OB 4J25A 4B4PA 3DQVC 3ZDSA 2DU9A 1H1IA 1H89C 4GH4B 5LB6A 1QVUA 2A5WA 1Z91A 1QJU3 3LWCA 2UYAA 2YX7A 4YG3A 4KBBA 3HRSA 4XBQA 2IEKA 3FBMA 4BQ2A 1BI0A 4BL0B 4WM7A 4AVPA 1C28A 3FM5A 2XRNA 1MZ5A 1D2QA 1O3TA 5A2QZ 5IYDJ 1S0IA 1YUDA 4EWAA 4LBQB 4BS9A 3RZGA 1TEIA 2H8WA 4YW4A 2KKOA 2R1DA 2NRAC 4KI5M 4Q4V1 1I5ZA 3WVJA 3AL0C 2V6EA 2YROA 2Q30A 2XR4A 1NYWA 1V5EA 5A6YA 3UNPA 1HLVA 3S2HJ 3DF0A 3NKTA 1RUF3 3VDDA 4B4RA 1R22A 1WW6A 4DB5A 5EJZB 1XSXA 4UI9L 3ZX7A 3WNOA 5CG8A 1VBE1 1KFUL 4PJLA 4B8XA 1ASJ3 3S3MA 1ZRRA 2CYYA 1QJX3 2AXTC 2IGKA 2L9SA 2YX4A 4HOBA 3HSEA 1LE8A 2QKLB 4QX3A 3I3EA 1I27A 5AVAA 4IUGA 1MR5A 2E1NA 1AL21 2R7VA 1XXNA 4UUSA 1J59A 1NCRB 1AX2A 1LB2A 2VJXA 1IRGA 3SKJE 1UO9A 1UZCA 1GNYA 5LEKA 3S1NJ 2BVLA 1YO5C 1RMU1 3BTZA 4G6QA 2Y33A 3WU1B 5HLTA 3ZXKA 4CXWA 1OURA 4G94A 5ACA1 2VOKA 5CADA 3ACFA 5C8CC 3L2UA 2HEYF 1W8UA 1YQ6A 3KV5A 2H8RA 2R5ZA 3LQRA 4YVWB 1ZZ9A 2VNVA 2V72A 2W82A 5A1FA 1TT0A 3MZYA 4GCVA 3S93A 1UN1A 5JLWA 3LEMA 1OCTC 4IQPA 2ZGOA 1XYNA 3CC2I 2AEYA 3OG2A 1S0JA 3SHRA 3KYDB 4WVMB 5JI7A 4KWLA 2ZX4A 5J1RA 3KQ4B 3L2WA 3HR9A 1NXMA 3WG7H 1X1BA 4QIWN 1DU0A 3JSOA 2JUCA 4CEYC 1XNDA 2K9ZA 1I6HJ 3N9MA 3U07A 2W46A 3W5NA 3HTSB 2IP2A 5E8GA 2EIMH 5GZDA 1VBB2 1HB1A 3ZQGA 1FTTA 1ASJ1 2MC4A 3AFHA 4ISQA 3POSA 2PQSA 3BR2A 1SVOA 4LMFA 3LSDA 3LOCA 2MH9A 4JKKA 1W90A 3MPPG 1FPQA 3OIOA 1S5LC 3SQNA 1YQAA 1M06G 2BERA 5F32A 4AEDC 2B7YA 2EJRA 2VZRA 3E0JB 1Q8QA 5B4XA 4R9CA 4F91B 4JTOA 3UT0A 2VMFA 4A3BJ 1JXSA 3O3KA 4S2DA 1B35B 1W4MA 4Y22B 4QHBA 4M3DA 1MS0A 4G12A 3U4XA 4CDUA 1FJLA 3O0VA 4KQ7A 2F4PA 3GZUC 1W9SA 4BQOA 3HNBM 1K78A 2PAEA 3KZ4C 4JAAA 1O7LA 4I3PA 1ND2A 4I02A 4FP2A 4NJ4A 2P3JA 2ECBA 2JJ7A 3KGZA 4U36A 3NAPA 3FK6A 1QJY1 1G9CA 2D6PA 3LDRA 4LLGF 5FRNA 3LSPA 1LOFC 3PNVA 4E7ZA 1EAH1 1PM4A 1IQDC 5KXDA 3DBRB 1EYBA 2OVUA 5DG1A 3BOPA 2DTZA 3ZQHA 2AQEA 2IFRA 4HVOA 1NG7A 1RZ4A 4Y5Z0 4AUXA 1MDMB 1MEC3 1WLWA 4AI3A 3KP7A 5FIXA 4K1YA 1ERDA 2A6YA 1BW5A 3LZZA 4D6QA 2XF7A 1Q1VA 4WM7C 4IKFA 3POWA 2AQFA 2WJSA 3LFKA 4MIMA 1EJ9A 2A5ZA 3HC7A 1MACA 4WXHA 5FKKA 3D0SA 4F3QA 4LJZF 3KT4A 3W2WA 1PGL2 1ZRCA 3BIWE 1RC6A 5LBEA 3T1BA 2VQTA 1DGRM 3I2HA 2VMIA 4O5VA 4A7KA 2QQNA 2RDSA 3BR0A 4UV9A 4PSWA 2E5NA 3GZTB 1RUI3 2WY8Q 1BQPA 1X2MA 3UNGC 1H9GA 4AHZA 2FQ4A 2FA5A 4BLIA 1UY2A 5F37A 2RGVA 4KMUX 1LTEA 2K4JA 4MADA 1HF0A 3VDXA 5D4SA 1X3UA 5BNNB 5FY0A 3LA7A 3ZIXA 4WXCA 4KA4A 1WI9A 1ZG1A 4RAFA 5HLGA 1W0UA 2DCZA 1W8ZA 1LHOA 2ZSHB 2DCJA 3JW4A 2ZJCA 1RNLA 1Z3XA 3QBQA 5JI9A 4FE4A 2HNHA 3VBSB 3ESWB 1STZA 2O6GE 2L9RA 5FZIA 2EAKA 4Q4X1 2RNGA 4V1PA 3G71I 2VXDA 2P7VB 3FLPA 1RUD2 5I8TA 4F52A 2XVKA 1KDKA 3RQ4A 3IKTA 1HLCA 1U5XA 2DFBA 1JBCA 1ZR2A 1ORKA 4OU0A 2QSGX 3HOTA 4XN0A 2X05A 5F3GA 2B9UA 3ZMZA 3Q9SA 1I1GA 4IQJA 1NLSA 1AR91 2O0OA 3ZPOA 4W1UA 3GZ6A 5FKBA 1QJZA 1LDKB 3IIAA 5JHFA 1ETVA 5JHUA 2VNRA 1B35C 1RHI2 3S32A 5CYYA 2IFWA 4PZJA 1OOPC 1FAYA 2OD5A 2WZ8A 2EIDA 4FPCA 1VQ9I 2QQBA 2WS92 3UR3C 1F9KA 2ZNYA 3CCMI 1AR83 1WWXA 2XB0X 5EP9A 4KG8A 3KVBA 2SLIA 4RR3A 4M9SA 1UZZA 4M9ZA 1YWKA 2LW8A 2GMMA 4S2GA 1D1BA 3BQZA 4R52A 3MF6A 5K7FA 4EWEA 4HA8A 4UUTA 5IT9Z 1SFOJ 1XNKA 3FJSA 3INAA 3WP3A 2JA2A 3IIIA 1BIBA 1IAWA 4HPKA 4V19K 5FBJA 1YW8A 1XQNA 1E3HA 1R7JA 5JZGB 1W0OA 3BY6A 4RB3C 1I9RA 2QA4I 4ZONA 5K0UB 3CMEI 4CDUC 3BDDA 3ZXSA 4A0ZA 2WO2A 3GFLA 4BQAA 2DT7B 2R7UA 4LIUA 3UK9A 1HKSA 5KC6A 3ZMOA 5HVQC 3OYNA 3C7FA 4A3MJ 2AHQA 3GCMA 4NIIA 2D1HA 1QIQA 3HOUJ 3H50A 2VE9A 2GNDA 5A3PA 1TMF2 1OF3A 3I3BA 3WDUA 3BALA 3O0XA 1GKBA 1LEAA 1U8BA 4PCRA 1OPOA 2ZGLA 3FHZA 2D5FA 2EAAA 1GOFA 4QX0A 3HRTA 2Q5TA 1S1AA 4QX7A 4EM2A 3I64A 3O7OA 4E70A 2KZGA 4E7HA 4OMDA 4FX4A 5GM0A 3J7HA 1MBKA 1OSGA 4DXRA 4UV8A 5ISLA 2A5YB 1AR81 3H36A 3WDVA 3GCWA 1BBT2 4XRFA 1F15A 3WINE 5DAQA 2IGOA 3ABTA 4XLNF 3MKWB 2JDMA 1NCQA 1RINA 3H3ZA 5D6EA 2L2OA 3CCRI 3MFCA 4I99C 4MX3A 5A33B 1OR7A 2WNUA 1O8PA 2VOVA 2Q2EA 1COV2 2D93A 3H42B 3OV8A 2L9LA 2PMZA 1ZG3A 5BPDA 2P3YA 2ESHA 5GZCA 5BNNC 1NX9A 4QPIB 4WM8C 1YX3A 2Y9YA 3FN9A 1OH3A 1PP8F 3X2QH 3NJVA 3A03A 1WWYA 2J1AA 1SMVA 2WLPA 4Y1YA 2ISYA 1MBGA 4A93J 3PFIA 5EPAA 2VKDA 1NKGA 3CEWA 2F5DA 3I3LA 2VW0A 3DEMA 2JDPA 3I2KA 3GUDA 4F3JA 2IGNA 2CFOA 3LPFA 3LDBA 2O0YA 5IYBJ 4BA6A 3PJQA 1R5GA 3WG4A 1GR3A 3VBRB 2QBYB 1GU3A 2F4MB 1AUYA 3OYWB 2R7RA 5CKNA 2CL2A 3C8XA 5JSRA 3VKMA 3SXWA 2Z16A 3W6VA 1JE8A 3S0MA 2VVEA 2OUJA 5DV5A 1BEV3 5BPIA 3CCUI 5KHDA 1VBA2 4EQQA 3TGNA 5IATA 2EIGA 2D40A 3M4OJ 1G59A 3ZKYA 5H6RA 1SFKA 3RKQA 5L7OB 2V6CA 3SHFA 3QYBA 4RHV2 2XB6C 3BOQA 4DZGA 4BE0A 1DYOA 3OL4A 1Y7BA 2ZC2A 4ENJA 1ST8A 1QQP2 1R081 3NL1A 4FOVA 2PEXA 1ZREA 2VQCA 2BOLA 1BM9A 3ZDVA 2WN2A 4XTPA 3CLQA 4RB0A 1YIJI 3RQ0A 5DPNA 4IE0A 5F64A 2NVTJ 3FLRA 4IX7A 1CF7A 1HKTA 1RYYA 5BUVA 4ORFA 2OKXA 2KXLA 2DDBA 4TN7A 1H8VA 5IT6A 3AB0A 1RESA 1PO21 2XGCA 4FISA 3VBHA 4COZA 4EJWA 3RZOJ 2LNBA 1Y6IA 4E2QA 1JYCA 2D6NA 4MZUA 2QJVA 5BNPB 2WYFA 4Z07A 1EUUA 3B00A 5FOJB 1N3OA 4CDWC 2FDFA 2DFEA 4RLQA 3LSJA 5HXVA 5ICGA 5DCMA 5HLIA 1ETOA 4LG0A 1AF9A 4YW5A 3V56A 1D1CA 1R5ID 2Q1FA 5JR7B 3W5MA 1VZ0A 2QLZA 2F6CA 3K3OA 1OFSA 4CCDA 4E2SA 3CIHA 4KNCA 4EJTA 5LHGA 3OYIA 5TRDA 3B7MA 1W05A 4OCTA 3PDQA 3ZFFC 4AEMA 1OUXA 1UYZA 2JMWA 3T2PA 4NIDA 1ZTRA 2ZXQA 3TKYA 2Y60A 3M8EA 2JQ7A 5DD8A 2BEOA 3EBRA 3AKRA 1B8IB 4FSJA 2RS31 4LEJA 2DFCA 5EFUA 2NNNA 1ZZ8A 2ZMLA 2XJUA 3ZIWA 3WF0A 1W2NA 3C3WA 4YZ1A 1MSFC 1CPMA 3DTKA 2QQKA 3HJEA 4D1QA 5LEJA 1A36A 1MW7A 2CWSA 4HKOA 4IEQA 1JJ6C 4Q8LA 4OZOA 2EF6A 1R1TA 1CJDA 1W7PD 3L2QA 3QRFF 4E4ZA 2MNGA 4XXPA 2TBVA 3JB8A 1YIPA 2EXJA 2DA1A 2UU8A 3T5XA 1DGRN 1NCQC 2ZMEB 1IW7F 5DAVA 5ILSA 3I0TA 2K0GA 4Q0PA 4URTA 2WNUC 1J83A 4QXHA 2VXRA 1YFXA 3HD8B 2JB8A 3R0RA 2WBKA 5C9AB 2FHRA 2Y0SA 3WW3A 5J4VA 2BV6A 2DOEA 1GYKA 1UAIA 2JICA 1A78A 5FYCA 4XMIA 3F8BA 1LULA 4COYA 5DUKA 2BTVC 4P96A 3WP5A 4HX4A 1WPKA 1EV11 4JX6A 2XQXA 2R5YA 3CP8A 3SISA 2GDFA 2FXAA 2YUSA 4BIOA 3TOBA 4EZHA 4FQGA 1IN4A 1LESA 3HEIA 5L7OC 2WADA 1KS4A 5FK8A 4YG6A 2A6TA 2EFWA 2DLLA 1OF4A 2WT0A 4IDZA 4QPWA 2P37A 2IWGB 1O59A 2I8DA 2E63A 2RMU1 1BVP1 1ENRA 2MHFA 3VL8A 3WSOA 2GH2A 4CXYA 1QQIA 3WG2A 2EK5A 2VZOA 1S2KA 4V2WA 1Z6RA 2ID6A 2AEZA 2XUEA 2X5IB 5D5XB 5FZOA 3KPHA 1ONAA 3TAYA 4MSVA 3KT1A 2R072 4L8QA 1HA8A 4I01A 2Z69A 3VHOA 2QUFA 3RYPA 2QVOA 4Y1ZA 2R32A 4OYUA 1UMHA 3FFZA 4FBFA 1DQUA 3OYEA 1UCXA 2WABA 4EROA 4HBLA 4MLOA 5HV4A 2DN0A 1MJBA 3MF9A 2GSYA 3NO8A 5I0DA 3K1NA 3LSEA 1TQPA 1X1CA 4Q47A 2OPKA 4BQXA 4IEOA 1JMUB