3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
4LLNA 1BIAA 2PJPA 3H1WA 2K4BA 3MZHA 3ELKA 3G3ZA 4L9JA 2PAMA 4AD9A 2K0GA 4ASNA 3IRRA 5BPIA 2D93A 4HQMA 1K7AA 2IJLA 4KICA 1R5HA 2XVCA 5FLIA 2EFPA 4GXOA 3LSTA 3H1YA 2M30A 3SZPA 3MYXA 1FNNA 2UWMA 4P5OA 5LEJA 4ENMA 1SMTA 2PMHA 3LAJA 1SMYF 1K78B 1OPCA 3E3VA 3EYIA 4R52A 2GU9A 1S29A 1IZ1A 1G6NA 3ZMSA 1QPMA 1RUOA 2QM3A 3RTRA 4BQAA 4CZZA 4XFBA 4ZU4A 3J80K 1MJBA 1XRUA 2FQPA 4RB1A 2IXJA 2TDXA 3CO6C 1F9NA 2EA4A 4YARA 3FXUA 3HOTA 2CFXA 1O3TA 3H7YA 4O6JA 1XSXA 5EEGA 2NYXA 4ONUA 1UIKA 1ZAOA 4RS8A 5LBQA 5D5WB 2VT2A 1HW5A 3E6MA 4JV4A 1D8KA 2H94A 2P5VA 3J7AO 3NSTA 3RNSA 1FYKA 1ZGJA 1NE6A 3FX3A 4L0YB 4IPAA 2BV6A 4UXAA 2IA0A 4A0ZA 2PEXA 4HSLA 1EPZA 2RV8A 3I53A 2UYBA 2DCTA 2FEZA 5BS6A 1DDNA 1USSA 2B5HA 4HMZA 3H3ZA 3B73A 4M71A 4HN1A 4IEYA 1RZ4A 4M6YA 2D5HA 3BJOA 3GFJA 1IXRC 2F2EA 1Z91A 3HOSA 3F6OA 4HN0A 3TO9A 3N97A 1E17A 1G4DA 4X6QB 1FT9A 3H3UA 2IA2A 4YRDA 3R61A 2W84A 1UFMA 1BOAA 4YG2F 3KP5A 1H9GA 2A69F 1Y9QA 5FQ0A 2ATFA 4KA4A 4ESFA 2L54A 4XF9A 2P5LC 5LHIA 5I8YA 1UW8A 4I3PA 3QOPA 2RVCA 2UY8A 2ZBKA 5HDKA 3QU6A 3WGHA 4GYGA 3SXWA 1F5TA 3L2CA 4LFUA 4QWQA 4MHGA 5AIPA 5BXXA 2X4HA 3V4GA 4AQ6A 1BI1A 1O7FA 1KU9A 4AIJA 2V6CA 1I1GA 1MZBA 5HDNA 5JSOA 2ZXJA 1B1BA 3E6CC 3TOAA 2LSOA 5ICEA 2FBIA 2YX4A 2P6TA 4DQ2A 1I6XA 3ETQA 4HF0A 4KNYA 1TTYA 3BWGA 4M9ZA 3RKXA 3OGJA 2LF7A 3J80Z 2BNOA 1SQ4A 4ZH4F 1ZRRA 4XFCA 3RPQA 4PGGA 2IRFG 4YSFA 2DBBA 4EJTA 2RDPA 2Z5UA 4AVAA 4IEWA 4KIFA 3H1MA 2GH2A 3WW1A 2HYFA 3PQJA 5L3GA 3IKVA 3IWFA 1IF1A 2VT3A 1LQ1A 1VJ2A 3CUQB 2EFOA 4G6QA 3K0LA 3QPHA 4MNUA 3F21A 4WZCA 3CTAA 4YNIA 2PI0A 1UD1A 2V79A 4AIKA 2JT1A 4HF1A 4I0AA 4O9GA 1ZN2A 2HFHA 1V4RA 3CO7C 3L00A 2XL7A 2HOEA 4H7LA 2XKOA 3KZYA 1LKNA 1B6AA 3DV8A 1U3EM 2HR3A 1CF7A 3TNPB 3O2PE 4AQ2A 1MKMA 2VC0A 1EP0A 2H27A 1O57A 2PFWA 5JFRA 2LKPA 2QBYA 2L4MA 2CYYA 2FMLA 1J3PA 2P7VB 2NRAC 1YFXA 2UZKA 2OYZA 1Z1DA 5ILUA 1FY7A 3SZTA 4LTAA 2XAJA 3WTVC 2HZTA 5CVIA 1T2KA 1PM7A 5TJJA 2DO7A 4HLXA 3D0JA 4M6XA 4ZYGA 1SAXA 3WW2A 1OYWA 2XAFA 2MH2A 2QVOA 1U78A 4R79A 4HX8A 2Q8KA 4N9HA 3IRQA 3DPLC 2O0YA 1LVAA 2VONA 3HSFA 3EDPA 2KJCA 1H1IA 1KYWA 5D6FA 3P7NA 1IRFA 4M72A 2PHLA 4MX3A 1YFYA 4HZFA 2FRHA 2LF8A 1B9NA 1YS6A 5CVJA 4I0BA 2XLFA 3QAHA 2OZUA 2HTSA 2Y0OA 3JSOA 4HX4A 4DINB 5BUVA 4MV2A 2UYAA 2JPBA 4PIZA 1J2XA 1Z6TA 3I59A 2RQPA 5E8GA 3F23A 3KCCA 3FF5A 3RDIA 3BOQA 1W5SA 2KJBA 2DAOA 2IXLA 4ZYDA 2PQQA 1FWZA 2OU2A 4ORFA 3RZZA 4L0ZB 1P6RA 4M9XA 2XLGA 4XF0A 4S04A 3I54A 1H9TA 2RKHA 5E1ZB 1RUNA 3PNAA 2JPCA 4QGNA 4QLCU 1O4TA 4B8XA 3HTUA 2K86A 4P55A 2XAQA 3BZ6A 2XLAA 1SFUA 3F6VA 2DI3A 3LFKA 3DEUA 2Q1ZB 4J1XA 2XIGA 2ETEA 2OPKA 5DCMB 4G9YA 4L9NA 1T0FA 4UVAA 2K9ZA 2HWVA 5FQ0B 3PFIA 4YIIA 5D4RA 3MWMA 1IUYA 3ULQB 3OCPA 3Q5FA 1VP6A 5LLQA 3F8NA 2IXCA 2F5FA 5EEHA 4LEJA 2ET7A 5E18F 3WU0A 1FI2A 2C6YA 2W25A 2FQ3A 4HVRA 5BOXA 4KL1A 3EHKA 3EYYA 3DF8A 3Q9SA 5HOOA 3LQQA 1R36A 3FMQA 1J3QA 1QNTA 2FU4A 4CHUA 4F8AA 5E1RA 2ZCWA 3OF1A 3K1NA 3DL3A 1ULYA 3FZVA 3SCHA 5A2QK 2HQRA 2MHFA 4RGSA 1QXRA 2ZNZA 1IPJA 2DK8A 1SD7A 4HSJA 2F5DA 4IEXA 1HW1A 4XLPF 1ZZ7A 2PYTA 3ES4A 4YFNF 1XDSA 4Q47A 1W4MA 3M1EA 3IDCB 3LQRA 1DUXC 3C1DA 5I0SA 2FBHA 4RB3C 3H50A 3RPUA 4BHBA 4LA3A 4FHTA 4YFKF 3FXRA 2VQAA 3UKVA 1TQIA 3M70A 3I4PA 3KZZA 2V9VA 1J1LA 1S7OA 3HSEA 5K5OA 3R6SA 3G7DA 1NXMA 3K69A 3FM5A 1OKRA 1ONVA 1IXSB 3IC7A 4XFGA 2IVMA 2DQRA 3FE5A 3HQXA 4X6RB 3KLOA 3QP6A 3HTSB 2EK5A 3NQOA 5JCTA 4EJOA 1FYLA 3NVCA 4P9UA 5I8TA 1ZYRF 5F64A 3GYHX 2LNBA 3GUDA 2A07F 5ILSA 1XCVA 5ICFA 2DFIA 3NL1A 1ZGAA 2IW5A 5JVTA 2YSRA 3IL2A 1XGSA 2EB7A 2QBYB 1X8EA 1WI9A 3M8FA 3K9TA 2IXHA 5DCFA 1YO5C 4EWDA 2GC2A 3HHGA 1GHCA 1XGOA 1MJ9A 1A04A 1ZNPA 3I71A 2EAAA 2IC1A 2VN2A 3HT1A 3J81K 1HSJA 1O5LA 3GZ5A 3MQ0A 3L2HA 2DPUA 2QLZA 1RNLA 3HRUA 2HYGD 4G8XA 5BQTA 2RN7A 2ZNYA 2FXAA 4IF4A 1LRHA 4PCQA 3LWFA 2WWYA 3JZVA 3P9CA 3E5UA 2XV4S 1S6LA 2FSWA 5I91A 1ZG5A 4Z2YA 3F8BA 4MGRA 3WGIA 2KIMA 1IN6A 1AOYA 3V8JA 4I7HA 1YS7A 3CF6E 5A2QZ 3QP5A 4JVAA 3V7SA 1SFEA 3WGGA 1PP7U 4GCVA 5E16A 3KGZA 1U5TA 4Q29A 2K27A 1ZREA 2HKOA 1ZVFA 2CV6A 4ZU7A 4Y15A 4AVCA 3I59B 5F6FA 4KDPA 1TLHB 1NZCA 3MEXA 3HRSA 5HLHA 3IHUA 4RB0A 1DGWA 2BEOA 4CYDA 1CAXB 4GGGA 5AVPA 3FM3A 5IT9K 4BH9A 1IXCA 2ISYA 3I7DA 2QYOA 4QM9A 4XEZA 1QGPA 1J59A 1LB2A 1S7AA 2RNJA 5HS8A 5KVRA 3RI4A 2OBPA 1DP7P 3JTHA 4GULA 5L3FA 4RGUA 1F4KA 2DT5A 1XSDA 3R0AA 2I45A 4IRGA 1Q1HA 2XROA 2P17A 3KP3A 4UBGA 2P6SA 2OD5A 2BNNA 1Z7UA 2QDRA 2EFNA 1FC3A 5AIQA 1BI3A 4A12A 1O3RA 2MC3A 4ZU5A 1IPKA 2HS5A 3EQLF 4U7BA 3WTTC 1MGTA 4OINF 5ICCA 2KKOA 4HV5A 3FZ3A 2O8XA 2A3SA 3FXQA 5T3NA 2FF4A 2V1DA 5I8SA 3DQVC 1FPQA 4O3MA 4O9EA 3LA7A 2Y0MA 4IVNA 1YFWA 2QWWA 3F72A 3C3WA 1AWCA 1KQ8A 1S3JA 3J81Z 2XUBA 4OLLA 4I01A 3EETA 2V1XA 1J58A 3GVAA 5HLGA 1XD7A 2MLKA 5DUKA 5FPXA 2M45A 4L9TA 3BCWA 1IN8A 2ZJ2A 3C18A 2VXZA 3P9KA 4Q5SF 2QJVA 3G73A 1RIOH 1SD5A 3U0ZA 4IHTA 1OFNA 1P4WA 4LK1F 4ESJA 3CJNA 1TNSA 2MBFA 1W7PD 4NB5A 4KYWA 4RD7A 3CL1A 5DCMA 5FO5A 1VTNC 4RGXA 1TQPA 2H09A 4HQEA 3HSRA 5LHHA 3BPVA 3LWCA 4HVOA 2Y48A 2EV6A 2G7HA 1YFHA 3U11A 2CG4A 2ZFWA 4TV7A 1FBSA 2DW4A 2MPFA 5IT9Z 3RIRA 3GZ6A 5D6EA 2CWEA 4AWXB 3BROA 1I27A 2QQ9A 2GC0A 4Q0PA 2XL9A 4LA2A 4IRIA 3O14A 2Z3YA 2OAZA 3SCFA 2Q4SA 5BV6A 1C0WA 3B02A 4Y17A 4L5JA 3ZMZA 3C7JA 3EJKA 1ZZCA 4FAHA 1J7KA 4ZYEA 4A5NA 1EV7A 1WA4A 3TO7A 2EFQA 2MLGA 3GFMA 3HHHA 4HBLA 4IHSA 2PQ8A 3R60A 2GQQA 2M87A 2BBYA 2IT0A 2GXBA 3M8EA 4HDUA 1DZRA 2C0ZA 3F8CA 5D5UB 4LUMA 4R8HA 4UV9A 1SFXA 1ZZ8A 3SCGA 1J9IA 4RAZA 2D5FA 4LG0A 4OMYA 1HXDA 4EJWA 3OV8A 2AXLA 3E6BA 3EQEA 1D8JA 2E1CA 4I02A 2NNNA 4BIFA 1YW9A 4QGMA 2W24A 4MH0E 5DYMA 3DN7A 3WTZA 1U5TB 3DPTA 3REOA 3I58A 4DNCA 1BIBA 2CAVA 4LMYA 4O5VA 4YIFA 4K2EA 4L11A 4G7ZF 5FLXK 2Q2EA 1GQHA 4QX5A 2HDCA 2N7GA 2PHDA 1BBYA 2F5CA 5ILVA 2D1VA 4M9SA 1J0RA 3MCZA 4CDGA 4JK1X 1IN4A 2GAUA 1NYWA 1ZLJA 5HS9A 4LK0F 3ROUA 5H6QA 5HLIA 1ZZ9A 3KEQA 1GXPA 4KWJA 3P9IA 2PG4A 3BDDA 4HYEA 5J8CA 1YTYA 3JSPA 5KHKA 3BJAA 4OFGA 2J5OA 2VECA 1BC7C 2EVXA 1RGSA 4MQ9F 3TOBA 4IETA 5CVUA 4G7OF 4WK8F 4G7HF 1UCXA 5JR3A 1RI7A 4WXHA 3L09A 5FPZA 5JSRA 2VBZA 3PLQA 3TGNA 1PMIA 3UKNA 4OOIA 1D5VA 3VEPA 4EJUA 2EA7A 3PQKA 1V3FA 1J75A 1P92A 4HX7A 3S7EA 1BI2A 3VOEA 1ZRFA 5L3DA 1CAWB 2DTRA 3SHRA 3KEOA 4OIOF 4FX0A 2V1UA 2B0LA 1R00A 1XE8A 2VODA 3D0SA 3GFLA 4ZZDA 5D8LB 1XE7A 1P2FA 5AONA 1G3YA 1CAXA 3WTUC 2M1BA 3FWEA 1PP8F 2MD5A 1KU7A 3ZMDA 3IBMA 4JTNA 2DPDA 1WKMA 4RAYA 5DUIA 4MEYF 4EGYA 1R23A 4H0EA 1XCBA 2Z33A 1JE8A 3TQNA 2ADUA 4EGZA 4WVZA 3V7RA 1Q5OA 2NNYA 2OA2A 3NW4A 4IRHA 3Q9VA 4U7DA 4CO8A 2HTJA 1E2XA 2K7LA 3GLXA 4Z82A 1LDKB 2IP2A 4Y13A 5LEKA 2GC1A 3H92A 1XN7A 5FLXZ 3EBRA 2VE9A 3OD0A 2QQBA 3ACLA 4AIHA 5CADA 1UHWA 3FJSA 5FFXA 5I93A 4XLNF 2YR2A 3CUQC 3GBFA 2VE8A 1IRGA 3ELNA 1UCRA 1QZZA 2IPQX 5FD5A 1EYBA 5E8IA 4HBNA 4Z07A 3KLNA 4A6DA 2O8QA 3HYIA 3I0TA 2MNGA 1UIJA 3GW2A 4L5IA 5CLSA 1G3WA 3T1BA 2COMA 2Q0OA 1FP1D 2KIUA 4IJAA 4B09A 4MZUA 4Q4ZF 5KHJA 2ZMEA 2VOOA 3CJXA 3IDBB 5HI0A 4LB5A 2F4PA 3T8TA 4PGHA 2HQNA 2L4AA 1CAVB 2D1HA 3WW3A 1FX7A 1ZH5A 3NEUA 2PAEA 2QCSB 3M7GA 1ZHFA 4ENKA 3DXJF 5D8KB 4KMFA 3BPZA 3ZN0A 2UXXA 2DQLA 2B8MA 1ODDA 5H20A 3RYPA 3VFZA 4LG0B 3CO2A 5CVVA 3EO6A 3WTXC 1YG2A 2X0LA 1HQCA 2YU3A 2HJIA 3SHFA 5J6XA 1TQMA 1QZYA 2HEOA 5BPDA 4CXFA 2VBYA 1IN7A 5L3EA 5E1WA 1ON1A 1W5TA 3M3IA 3KP7A 4LJZF 1WSUA 1MDMB 1YQAA 2BGCA 4QM8A 1Q3EA 5LGUA 2RGVA 3U9GA 3TDUC 1KYZA 2CW0F 3O6BB 1YWKA 5LRSA 2F5EA 1KA8A 2KXLA 1G3SA 4GO1A 3TO6A 4WBBA 4E2SA 5D1IA 1P4XA 4P9FA 3T8RA 2WFPA 1YYVA 1L3LA 4FX4A 5JR7B 3H7JA 2P4WA 1X3UA 4PJYA 1NE4A 2L02A 4IEQA 2FBKA 2P7CB 1EY2A 2K4JA 3WE3A 3FHZA 1WQ2A 4A6EA 1BJAA 2M8EA 2ESNA 3M9AA 1T98A 4M73A 1CAUA 2Q30A 4OIPF 3ZP5A 4N0BA 2YX7A 2NS0A 5HDGA 4E70A 3O3KA 3UKTA 1Y0UA 1S8NA 3NKTA 3JAMK 5LHGA 1IW7F 1Y3TA 4IEOA 1FBUA 5D4SA 3WE2A 5H6RA 3SXYA 4AVBA 1VR3A 2CAUA 4XFIA 3KE2A 4QMAA 3V8KA 1QQIA 3LOIA 4MUVA 1I5ZA 3RYKA 3T5XA 3C3VA 5C6CA 3ZMTA 4UNOA 2L3DA 1RC6A 5CJ9A 2M5WA 4MTDA 3FMRA 3PVBB 3E6DA 2G7UA 2J5PA 4OIRF 1SFNA 2GIVA 3V7CA 1HKSA 4UBHA 2MA3A 3R4KA 4NVPA 2BYVE 4EM2A 4ENJA 2OA4A 3KSCA 3RJPA 4A0YA 2GWRA 2XASA 3LA2A 5ICGA 2A6EF 2EV0A 4PZJA 2IA1A 1BM9A 5TRDA 4HLYA 1UPIA 4CICA 2GXGA 3ECHA 1H0MA 1GXQA 4NQWA 1R22A 1ZRDA 1T6SA 4RB2C 3KGLA 2FNAA 4Q48A 3U10A 4I2OA 5C8WA 3SFZA 2PAKA 3FFQA 1KQ9A 2O6GE 1OI6A 2ELHA 4FAGA 3MDPA 1LEBA 4FT8A 3RYRA 3DFGA 1DZTA 1TNTA 4Q0SA 2CQKA 1X7NA 4A5MA 1R58A 1KGSA 2EA2A 5EZWA 3VHRA 2XAHA 4LLGF 4PIXA 2WC2A 5D5XB 5KHIA 5KK1A 4PIYA 3JTGA 1LDJA 2H6BA 1CAWA 1WLTA 4F7ZA 1HW2A 4EV0A 4U0YA 3DKWA 2Q0AA 3CEWA 1K6OA 2H6CA 1TW2A 4N9IA 1U6GA 3IIAA 4HAMA 2ZMEB 5LGNA 5E17F 1STZA 3JAMZ 5HVQC 4J1WA 4JBAA 3ECOA 3VODA 2XHKA 2O1QA 2FMYA 3MZYA 1B9MA 1O3SA 2FNPA 1YLFA 4KIBA 4CGZA 1XMKA 3W6JB 4MEXF 2O03A 1U8RA 3ZMUA 2RC4A 5J48A 4XFAA 1HKTA 1FSHA 4FBFA 4E2QA 2A6HF 4Q0UA 3CDHA 1YIOA 4YFXF 5I0TA 1GQGA 1SD4A 2P5KA 3COAC 4KWKA 3K1PA 3OTFA 1TW3A 4UV8A 1GVJA 1G3TA 1KU2A 1JGSA 3N4MA 1ZG3A 4HW0A 1XGNA 1REPC 2ETHA 4BNCA 2IXIA 4XBFA 4IESA 1IN5A 1KU3A 1MD0A 3WTSC 2OZ6A 1FLIA 5CYVA 1HBXG 1LR5A 1W7PA 1J3RA 3WODF 2D45A 1R5GA 2UXNA 4OMZA 1Z05A 3LAPA 1JXSA 4WX9A 4UVBA 3JW4A 2XKPA 2ZKLA 5KHGA 3WW4A 3KP4A 5L3CA 4QGLA 3CUOA 5K5QA 1R1UA 3RKWA 1CAVA 1H1MA 1Z6RA 2V09A 4JTOA 1IAWA 1WRJA 2KIFA 3L9FA 1CAUB 1Q43A 3GXOA 1FSEA 1R1TA 2L01A 1YLLA 6PAXA 5FFZA 1UB9A 5FLHA 2W57A 1OMIA 5K1YA 2QQAA 4UHTA 4XF1A 3F3XA 4E2GA 3WTYC 1SD6A 4AXOA 4MQVA 4IEVA 3AAFA 5JSPA 3SQNA 1XDUA 4LLLA 3HRMA 3CLOA 5FCCA 4RGRA 3IWZA 5D5VB 4WF2A 4ENNA 3BPXA 3ZMVA 4KUMA 5JI6A 3ST7A 1PDNC 5I0RA 1X82A 1DGRA 4LGWA 4L18B 3GEZA 1X8MA 4U88A 5K5RA 4EJVA 4BHPA 3F22A 1MDMA 4QXKA 4S05A 5BPXA 2QZ8A 3FMSA 4P96A 3I64A 4KIGA 3KMHA 4L9VA 4MTEA 4IEUA 1YUDA 3FHIB 1FXZA 1V70A 2PN6A 2Y75A 4MGZE 4ZZLA 5CU1A 4KMUX 5FLJA 2JTVA 2ZKZA 3S0MA 5I0UA 2G9WA 2R7FA 3W6KB 3HUGA 3CLPA 1HSTA 1Z9CA 1RL3A 1BC8C 1FP2A 1QBJA 2PA7A 4U0WA 4NHJA 4KT5C 1LDDA 2ESHA 1D3YA 3I5UA 3GYDA 4LD5A 4BHCA 5JAXA 1O5UA 2R3SA 4Q0QA 4EROA 3S7IA 2E7WA 1OYYA 4P9GA 4HOBA 3QPTA 3GX4X 1LNWA 5EFUA 2A5YB 2VBXA 3RKYA 3ZN1A 2FE3A 2LDUA 2PMUA 3ABTA 5KBFA 1B4AA 4XSXF 4HVQA 4G94A 1DPUA 4L2NA 3H9AA 1ZLKA 3LZZA 4UVCA 2CSOA 1O3QA 2VBWA 2CGPA 1OYIA 1QO0D 4EVIA 4XFHA 3HT2A 4XF3A 4A2UA 4WCGA 4KN7X 5CVRA 2ET1A 2QENA 1R1VA 3QU3A 1PUEE 2GC3A 3ES1A 3GFIA 3D82A 1O7LA 5LRRA 5K8SA 4HV6A 2DU9A 4G6DA 1F1ZA 4LUKA 5FGMA 2XRNA 4IEZA 1USTA 2QNKA 2A68F 4XFFA 2W85A 4EMSA 4BXUA 5JHUA 3EUHA 3QRFF 4XRFA 3E5QA 4Q0VA 1RTVA 2VC1A 4WXDA 3OOPA 1EH6A 4OIQF 4HF2A 3USSA 4BYYA 3R0JA 4HDVA 2EFWA 4JQFA 2GA1A 1DPRA 5L3BA 5KHHA 2D40A 2OQRA 2Z9OA 2ACJA 4EWAA 5DV5A 3BJ6A 1YW8A 4IEPA 2OZJA 1K78A 2Z99A 2NAZA 3ERED 4IERA 2XAGA 3V8LA 2OQGA 3TDZC 4K8FA 3HRTA 4EM0B 2FA5A 5F1RA 1L3JA 4U0VA 3KETA 1FYMA 2UY9A 1YFUA 4OU0A 4ON0A 5J8FA 1B59A 1U5TC 3TNQA 5J3UA 4D0PA 3BU7A 1WWXA 5FD6A 4HA8A 1BI0A 2XGXA 2VPVA 3T0YA 1U2WA 3QACA 1EH7A 1W7PB 3HIFA 4IXAA 3L7WA 5DD4A 1EH8A 3ZDSA 2KRFA 1ZRCA 3S2WA 5FDBA 2BNMA 4AVPA 1UHMA 3GWZA 2DLLA 1QXJA 4KFCA 3BALA 3NJZA 1XMAA 3ZPLA 5DDGA 4XSZF 4HLTA 3BB6A 4BAYA 1OR7A 2EV5A 2K02A 3ABUA 5FB2A 1ZX5A 2IXKA 2WTEA 1BN5A 2E7XA 4MGKE 1KQ0A 2B9UA 1T38A 2FOKA 4LULA 3E5XA 4XETA 4KU7A 1XGMA 4MGYE 4LB6B 2P8TA 2DK5A 1JHHA 2E1NA 1I1SA 1U12A 2JRTA 2EWNA 2JZYA 1FZPB 3SMHA 3H8UA 3U2RA 5ED4A 4UXNA 2Z69A 1JUHA 3MPBA 3LAGA 5E1XA 3WTWC 4EQQA 3K2ZA 1ZG1A 1XSVA 4WXCA 1P4AA 2ISZA 5DD8A 1TQ5A 3BY6A 3DP7A 1ON2A 4WWCA 2AS5F 3K1MA 5BY5A 3VB2A 1SEFA 4R1HA 4UUVA 1R7JA 2E9QA 3MFKA 1TBXA 2H0VA 4I09A 2MH9A 2QUFA 4LLOA 4MGIE 4EM1A 3WU1B 5BMZA 1JHFA 2PFBA 1OD5A 1LEAA 2WV0A 2R7DA 2ZO4A 3GO5A 4EWEA 4GYIA 4A0XA 1CGPA 4YYOA 3KFWX 3F8FA 2Z2SB 1CF7B 1ZZBA 2PLYA 4D7SA 4I98B 4ETSA 1K79A 1LJ9A 3MAJA 5DEQA 3U1DA 2HGCA 2GA2A 2YPRA 3E97A 3ZQ7A 1CX4A 4KU8A 1T39A 3F8MA 1QWRA 3KP2A 4PDKA 4M74A 4B29A 2PBIA 1YW7A 2BE5F 2STWA 3D5LA 3GF2A 3WG9A 2QVSB 1J5YA 1ZARA 1NHAA 1FOKA 4KN4X 2STTA 5ERIA 1QY4A 3ISPA 1XB4A 2O61A 2EJRA 2VOPA 4TLFA 4XF4A 2D2WA 2HKXA 3CUQA 5E20A 1ZZ6A 2JSCA 3IKTA 3TKYA 4D7TA 4ZYHA 2CO5A 1YHFA 5IT3A 2PTMA 3BP8A 5LGTA 4META 1WGPA 5J7MA 2A61A 3NRVA 3LA3A 1FBQA 1HKQA 2GZWA 2O3FA 1MJAA 3KP6A 3ML6A 5HS7A 4KWLA 1L0OC 4ESBA
chains in the Genus database with same CATH superfamily
4LLNA 4CU9A 3PNYA 3H1WA 2K4BA 4XQFA 5C44J 3FHQA 2YHJA 4BA6A 1X2MA 2YS9A 4LOSA 1SACA 3WU2C 4HQMA 3QPLA 3EYPA 4HFSA 5FZIA 3GZUC 3ZR8X 4EZ4A 2EFPA 1ND2A 1YQ5A 1GNZA 1AJKA 4GXOA 3LSTA 4QKBA 3AC0A 4RR3C 3FXOA 4IL7A 4OZOA 1HB4A 3VD3A 3GZAA 5LEJA 1C3HA 2B46X 2PMHA 4QQLA 2HI3A 3LAJA 1K78B 1D7PM 3POJA 1R64A 2J1RA 5FZ4A 4QPWA 1YX5A 2GXAA 3UESA 1S29A 3ZMSA 1SAUA 3BG9A 5F0CA 4H2AA 3K3NA 1XXNA 4XFBA 3OY8B 2VBBA 4IXLA 4RB1A 4IUGA 4GWNA 2TDXA 1F9NA 4LPLA 3ASNH 4XE9A 2CFXA 5LASA 4O6JA 2NYXA 1UIKA 2ILMA 1ZAOA 2VCAA 4RS8A 5AFBA 3CCQI 1S4CA 3OYBA 2JJ6A 4JV4A 3OWTA 1P8JA 4QXBA 2P5VA 2R073 1SDDB 1MQTB 2BV6A 4UXAA 3OIOA 3IMMA 4A0ZA 1D4M3 4XYXA 2RV8A 3I53A 2DCTA 3DLAA 4CA0A 2LS6A 3MEPA 3ZFGC 4D5FA 1VBC1 4M71A 4C3IJ 3ESWB 3ABLH 4IEYA 1RZ4A 2R7VA 3I3MA 4L99A 3JD72 4P9IA 4RS5C 5FZGA 1P7JA 3HOSA 5T5OA 1P9QC 3V42A 3AB0A 4KITB 5B5EC 4CDWC 2DCJA 2IA2A 2CQNA 3KQRA 4K6BA 3R61A 2W84A 1VQ6I 1UFMA 4LOCA 3W2VA 4M3CE 4M00A 3VYUB 3KV5A 3RZHA 2ATFA 1OFSA 5FRNA 4XF9A 3AKZA 2P5LC 4GH4B 3S3NA 2TUNA 4HG6B 3USUB 5H9SA 1HF0A 1UMZA 2UY8A 2ZBKA 5HDKA 1AL23 3I2FA 2QQOA 1F5TA 5FOBB 3ABKH 1QRYA 4MHGA 3ONQA 2X4HA 3V4GA 4J01A 5A33A 5JI7A 1O7FA 1KU9A 2VZTA 2V6CA 3K10A 3VBFC 1MZBA 2M7AA 5JSOA 3FLRA 1Z21A 3PIPF 2RMU1 4G6TB 2FBIA 2UU8A 3IDEA 3V0BA 4DQ2A 2PQSA 2A6XA 4KNYA 1TTYA 4M9ZA 2M0MA 2W08A 2FMDA 2LF7A 2BNOA 2VPRA 1ZRRA 4P9WA 1BL0A 3KVAA 3RPQA 2IRFG 3K4KA 1CZTA 1Y43B 4EJTA 2ZEZA 1HN0A 1BLZA 4YW5A 1HXS2 4KIFA 3WY6A 1OCCH 3WW1A 1JXNA 1AKHA 2HYFA 1W6QA 2XJVA 5I0DA 2W1QA 1IF1A 3CMGA 3NAPB 4LBQB 1LQ1A 5J4YA 2CJJA 3CUQB 4G6QA 3QPHA 3F21A 4WZCA 1B8IA 3H42B 1UD1A 4AEDB 4FQGA 4AIKA 1BBT3 2GOMA 5G04L 1V4RA 5EDNA 3L00A 2YGMA 3TEYA 2E2HJ 2XL7A 1FMVA 1LOEA 1YIFA 2WYFA 2R32A 5JUVA 3NQHA 1MKMA 3POBA 1T56A 1H2LA 1B72B 5FKNA 1XNCA 2LKPA 4ZS3A 5FYCA 5F2WA 1HC8A 2Y6FA 3MI8A 4ISRA 4JHZA 4Y33A 4AI3A 2OCCH 3SZTA 4OYUA 1T2KA 5CVIA 3MPPG 1PM7A 4HLXA 3AZYA 3HZJA 3A01B 1A34A 4ZYGA 1OYWA 2XAFA 1V6KA 2QVOA 2ZBJA 5BNNA 4XJZA 3RQ4A 2OUMA 4CCCA 3ME2A 2O0YA 1RUH3 2VONA 2JUGA 3V0AA 3RSNA 1H1IA 2A6WA 3P7NA 4R9DA 1IRFA 2NN8A 4E8DA 4A6OA 4OQ8A 2EAKA 1K5JA 1DQ4A 2LF8A 3L9JT 2XSDC 4I76A 2ZGLA 5FZOB 2OVUA 4IOCF 3QAHA 3NKGA 2OPWA 3FK6A 2HTSA 1IHMA 4FPKA 3JSOA 3OGGA 4HX4A 1QKQA 3NJVA 3RI8A 1N3QA 1AX2A 2VPLA 1MEC3 5A1FA 4A3CJ 1KONA 1H8TC 2JPBA 4PIZA 3VBHC 4ZS2A 5B1AH 5C33A 1KXGA 3FF5A 1ULCA 1MS4A 1HJGA 2KJBA 5EYYA 1RC9A 2ZGMA 1FWZA 1UYXA 1PNFA 2JXAA 4L0ZB 2XLGA 4S04A 3AL0B 2VZ1A 3ZQIA 4Y4RA 3D8CA 2K86A 1O4ZA 5F8PA 3TBDA 1SFUA 3PSIA 1VI0A 2HQ5A 4Q4W2 4Q4Y1 1JODA 2Q1ZB 2XIGA 3URFA 4YW4A 3UV9A 2P3YA 5IVBA 4HNVA 2ZX0A 2WFF1 2K9ZA 2AQFA 2HWVA 5FQ0B 4W50A 2EH3A 3ZSLA 1IS4A 1JYTA 3K4MA 5LLQA 2IXCA 1VMFA 5EEHA 1AUYA 2Z79A 1IKPA 1ZBA1 4LEJA 4NWVA 4BBSJ 1SLBA 2R041 3S3MA 1UN1A 3IPVA 4FP3A 3EHKA 2J1VA 3TP0A 4KJZA 5HOOA 1R36A 2VMCA 1J3QA 1QNTA 4NIHA 3U1KA 5FY9A 3FZVA 5A2QK 3GTOJ 1D5YA 3S5QA 4RGSA 1J1TA 2VJXA 2W48A 2DK8A 1SD7A 1ZZ7A 2PYTA 3GJBA 1XDSA 1HRI2 2BHZA 1RIRA 1MS3A 2HZDA 3IAS2 4NE9A 2VJIA 5I0SA 1HV1A 4BHBA 4LA3A 3T08A 4YFKF 3VDXA 3EPZA 2RDRA 3KZZA 2E5ZA 5DTDA 3R6SA 3G7DA 4IQJA 3FKIJ 1ONVA 4PSWA 4BUPA 3FE5A 3HQXA 2D44A 4E27A 3QWLA 4J6GA 3W2WA 1X19A 5JCTA 4EJOA 5GTIC 3NVCA 5I8TA 5F64A 2LNBA 3GUDA 2RDSA 3S14J 1MNEA 2XB0X 5ILSA 1DQ1A 2IW5A 5JVTA 4QX1A 5SV8A 3TEXA 1X8EA 4WM8C 3M8FA 4B3AA 1GUUA 5FZAA 2VUCA 5DCFA 1ZELA 1LENA 5L7OC 5LBEA 4AI9A 4JGZB 1R4MB 1GHCA 1XGOA 2VVFA 5LK7B 1ZNPA 4FE4A 3I71A 2W39A 5A6XA 2KP6A 1TT0A 3OYCA 2P34A 2ELKA 1O5LA 1W0OA 4PJ0C 4RFRB 2NS8A 4D0QA 1DGWX 3L2HA 2R7SA 2QLZA 1REDA 1RNLA 1VZ0A 5BQTA 1RVF2 2ZNYA 3B7MA 1QHHD 3P1IA 4HNUA 4FO9A 3VDBA 1WJAA 1LRHA 2WWYA 1GKBA 4QQPA 3E5UA 3ZMNA 1MS8A 2FSWA 2VZQA 1ZG5A 1OURA 3WGIA 1IN6A 2DFBA 5A3UA 3V8JA 2JDYA 1IG0A 3V7SA 5E16A 1FOWA 2DODA 3BR6A 3I59B 2DU0A 1S2EA 4KDPA 3MEXA 2DCEA 4FPLA 2KZGA 4RB0A 3JRCA 1DGWA 2XF6A 2XMLA 3ZXDA 5AVPA 2QA4I 2QQPA 3FM3A 1H1AA 2O7OA 1IXCA 3ZXAC 2L0KA 2R0FA 2VQUA 1QGPA 1S7AA 3RI4A 2ZXIA 4YG3A 4GULA 2DT5A 4D8MA 1DLLA 2RR11 1XSDA 2I45A 4LR4A 1V6LA 3KP3A 1HIXA 2VZVA 2OD5A 4D9JA 1Q8PA 1JOPA 5IATA 4TYSA 2WT0A 2QDRA 4K9SA 3SZGA 5FPLA 3POSA 2K9NA 1OKOA 1BI3A 1G7YA 4ZU5A 4AYBN 1MH4A 1IPKA 1DGLA 1AF9A 3GALA 1WCMJ 4Q27A 5DUUA 5FYMA 1MGTA 4OINF 5ICCA 4HV5A 2QKLB 3PUQA 1SLTA 4X1EA 1R083 2A3SA 2WO7A 3PJRA 1D4VB 1ULGA 2KQRA 1LOBA 4Q4X2 1YFWA 3WP3A 4UW5A 1KQ8A 3W58A 3J81Z 3U37A 2XUBA 4OLLA 4HT1T 1AR91 4BM8A 3R0RA 1XD7A 5LK5A 5DUKA 3S2DJ 2VQTA 2BOIA 4YW2A 1POV3 3BCWA 4CUBA 2WQZC 1DGRN 3ZYRA 3SEEA 3G73A 1LE8A 4X0GA 4BDZA 3ZO0B 3CJNA 1PGL1 4WM7B 4NB5A 4RD7A 2NMOA 1GBGA 1VQLI 5A3PA 5IP6A 5CISA 3AJYA 3KF5A 5FYIA 3WG1A 1TQPA 5A3MA 5A3LA 2RS33 3HSRA 5LHHA 2O0OA 5H9PA 4QWNA 1YE9A 4NDLA 2VL4A 1X4OA 2XHNA 4HVOA 3BTLA 2A3WA 2FCTA 2G7HA 3CESA 1FBSA 3GCMA 1BJQA 2XONA 3GZ6A 5FFOC 5D6EA 1RUJ1 5HODA 4D6SA 4LITA 2VQLA 2QQ9A 2X6OA 4QQOA 4F83A 3VLBB 1IKQA 1BEV3 2DVAA 1YX3A 4NPLA 2RDNA 3GF6A 3NV4A 3B02A 3WF0A 3AXEA 3ZOIA 4GMP3 2WB1N 1AR71 1ZZCA 4ZYEA 2LYCA 5CNAA 3FXLA 4M01A 1SLLA 4AYBA 1W8HA 3GFMA 3KEYA 4HBLA 4IHSA 2WNEA 2CQXA 3R60A 1W0UA 4DNYA 2M87A 1MZ5A 4LHSA 4RFT0 3DTKA 3M8EA 3JRFA 2X10A 1DZRA 2C0ZA 3V64A 2ID3A 1ZZ8A 4KWUA 1BK0A 2MABA 4LG0A 1FNZA 1HXDA 2E31A 2AXLA 5HPOA 2E1CA 3BR2A 2RMU2 4I02A 3OYEA 1ZA4A 5FKCA 3WD5A 1OQDA 4MH0E 3T4VA 3DN7A 1LOFA 3DPTA 3REOA 1W2NA 4P08A 1JKOC 1ZR4A 2CAVA 2VJJA 4YIFA 4BWOA 4K2EA 3ZOBA 5FLXK 3H9GA 4XBQA 1M4WA 4QX5A 3OMYA 2ZA9A 1W9WA 2AHQA 3DBLB 4GAZA 1ZTRA 4ZZ5A 3G1OA 4Z2WA 5JZGB 4M9SA 1J0RA 5EYXA 3MCZA 3W3CA 1MQTC 3KHCA 3CMMA 3LSRA 1IN4A 2ZKNA 2GAUA 1ZLJA 1HRV2 3AK0A 5H6QA 5C4XJ 3KEQA 5FWEA 1GXPA 2JE7A 2BBAA 4CCJA 4KWJA 3SYTA 3AMNA 1JUPA 3NWTA 5J3LA 1BC7C 5L36A 1SVMA 3IB3A 3IT8A 2WLPA 2ME6A 3S15J 4NQWB 2LLKA 1RGSA 4IETA 1NUKA 2H8WA 5JR3A 4DUVA 5J47A 4KBBA 4AK3A 2DFCA 3LSEA 3BLYA 1W6MA 2VBZA 2V72A 3ILFA 1D2QA 3TGNA 1ENSA 4OOIA 4A3EJ 5BNOA 4GH4C 4EJUA 2ORZA 3HOBA 3PQKA 2HPIA 3AKRA 3BG6A 2EIGA 1F15A 4UT5A 1BI2A 1CAWB 2DTRA 4OIOF 2LY9A 5CFDA 4FXKB 1PJRA 5C4WB 3WF3A 3JRDA 3GFLA 4NIDA 3AFKA 5D8LB 1P2FA 5E3MA 1RUI1 5AONA 1VQOI 1CAXA 4BBRJ 3FWEA 1PP8F 2MD5A 2P6CA 4B4RA 5JVGF 2WZR1 1LHWA 3WQBA 3FL7A 5ANNA 2W94A 3H35A 1PNGA 1D0XA 4EGYA 1R23A 3J7HA 4OHVA 1HDPA 2KPMA 1XCBA 2Z33A 1QXPA 3OOUA 3FBIB 4EGZA 4WVZA 1QHGA 1Q5OA 1JUSA 4CO8A 1VQ9I 4AE2A 2K7LA 2DA5A 3ZQQA 2HWF2 5LEKA 1AYM2 3ZMOA 2O9LA 2ARCA 3BC8A 1QJX2 4Y3OA 3EBRA 3U4XA 1F8VA 1W1WE 1H2MA 2ZX3A 2Y0SA 3NAPC 5I93A 4A7ZA 3CCJI 1W2OA 3CUQC 2VE8A 1IRGA 3VBOB 1UCRA 1QZZA 4XIKA 2IPQX 1EYBA 1JHJA 4UF0B 4AEDC 1XNAA 1OFCX 2P37A 4Z07A 3R05A 2D6OX 2O8QA 3HYIA 2MNGA 3QPSA 1PX4A 4Q4Y2 2Q0OA 2KIUA 3K6GA 3ZQHA 4GIQA 2R93J 1H6XA 2RAEA 1JZ7A 3VBSB 1MSEC 2JJ7A 5DZGA 2WFF2 3CJXA 3H8XA 4BQNA 3ZYGA 1VBB3 2MYSA 2J1UA 3MLKA 3S2HJ 5C71A 3JQXA 1SCSA 3QODA 3WW3A 2DU1A 1ZBA2 1FMWA 4COUA 2R042 2I8DA 5FY0A 4DZPA 2M8GX 2PAEA 2QCSB 3ZR6A 1IQDC 1ZHFA 4ENKA 3BPZA 3RZKA 1XB9A 1NCRB 3Q8EA 2BW3A 5APAA 3LOBA 1SBFA 2FUG2 2JA7J 2R061 2CL2A 1MNDA 1ODDA 5H20A 3RYPA 1YG2A 4SBVA 1I50J 1HQCA 2YU3A 3A22A 4FFFA 3RVHA 5J6XA 2RS51 1QZYA 3BTXA 5BPDA 5FUPA 3HOYJ 1ON1A 1W5TA 2YG0A 3M3IA 5GLTA 4LJZF 1WSUA 1MDMB 2VE1A 4QM8A 5DAQA 2Y8KA 1YJWI 1VMHA 1KFXL 2RGVA 2K2SA 1N47A 3TDUC 1KYZA 2AQEA 2CW0F 3WF1A 3O6BB 2F5EA 2VBPA 5GP9A 4MGQA 5IOYA 4GO1A 4XC9A 5A3WA 2YU2A 3EB7A 1QJY3 4MXVA 3WVJA 2DN0A 3T8RA 3KYLA 4AGGA 5A32B 2C4XA 1FATA 3PJYA 2VNGA 1D0ZA 2WR9A 4PJYA 2K9QA 4S0HB 4IEQA 3AL0C 4KT6A 2P7CB 2KMUA 3VPRA 1EY2A 1UKRA 5JWPA 1ND3A 2OTLI 3W6VA 2WKKA 2M8EA 2ESNA 4RSUA 2ZS6B 3PURA 1VRH3 2Q30A 4OIPF 3RZMA 5HLTA 1WCQA 1SPPA 1Y0UA 3VKNA 4RHV3 2A6TA 3JAMK 5LHGA 2EXIA 3AG2H 3PNTA 1F9KA 1JS9A 2CHHA 1V6IA 4CCOA 3CCLI 4AM3A 2VM9A 4DXRA 5A70A 1NK2P 3PIOF 3WF2A 4HKOA 4QQHA 3OSGA 3N7MA 2ZZQA 1VR3A 2Y31A 2CAUA 4QMAA 3ZM8A 2WT1A 1QQIA 1Y8RB 3T5XA 4AVZA 1S0JA 1O4YA 2L3DA 1RC6A 5CJ9A 2M5WA 2W68A 3FMRA 4ANJA 3E6DA 4JRLA 2G7UA 2J5PA 4OIRF 1HKSA 1UU5A 3R4KA 2BYVE 3A4UA 2WQ8A 1FTZA 5F3GA 5A3OA 3AL6A 3RJPA 3LA2A 2HWD1 3J7NA 4NAMA 2IA1A 1FV3A 2Y6HA 1ETOA 3OS0A 3WHUA 3S6PA 2PELA 3A0KA 4CICA 1R9TJ 3T4HB 2VW2A 1R22A 4RB2C 3A2KA 2ZMKA 3KGLA 2BW8A 4PDWA 5ABJB 4Q48A 3PO2J 5C3SA 5C8WA 3FFQA 2PAKA 2R7EB 2A5ZA 1NX9A 4URTA 4JOMA 1EAH2 1LEBA 1NCQA 2GALA 3RYRA 9ANTA 5EZWA 1OH3A 3VHRA 5D5XB 4COYA 1SEUA 4GXLA 1VBE1 1SMVA 5KHIA 4FPEA 2DOAA 2ZGUA 4LNVA 4QPQA 2RR12 2WT2A 3PMEA 1UZYA 4FPJA 4OCTA 1Z0HA 4XCBA 3WUCA 1LULA 1HW2A 2Y33A 1K6OA 5FBZA 3CF5F 5EP9A 1WFXA 3ZXKA 1AXKA 4NHYA 4TLGA 2ZMEB 2PHFA 4AHXA 1LODA 4J1WA 4TWTA 4BCUA 3RRDA 4BJ0A 2E26A 1JTZX 2MG4A 4AEKA 5FO9B 3VZMA 4E7KA 3ECOA 1A3KA 4JGZC 3F2ZA 4CGZA 1VBC3 3L2WA 1U8RA 3ZMUA 2EINH 1V00A 4XFAA 1HKTA 2RQQA 1R4NB 3BTAA 4E2QA 3K4CA 1AR92 1VQ8I 3TP3A 3HL2A 3AP6A 2CRGA 5FZ6A 2R5YA 5FV3A 1WBLA 3ZXLA 3H0OA 1D1CA 3BTYA 4YLZA 1JOBA 2OUHA 3IMNA 3H5NA 1EUTA 2JD9A 3LMMA 4UV8A 1G3TA 1JGSA 3N4MA 2HEVF 4HW0A 3DF0A 1MW7A 2UWCA 4BNCA 1PGL2 4RN5A 2A6YA 4XBFA 2YU1A 2WNUB 3GBWA 1FLIA 4K40A 1J3RA 3H8RA 1O8SA 2D45A 1R5GA 1PVC1 4OMZA 3O1PA 2A5WA 1AR83 4BISA 1JXSA 2V6EA 3JW4A 1TC3C 1A8DA 1JMUB 1XU1A 3OYLA 4JX6A 2JA2A 4IV1B 1R1UA 3RKWA 3WCRA 2YPJA 1WRJA 4BACA 1CAUB 2V7FA 1R1TA 1RUJ2 5IVVA 2ECBA 2L01A 4OMCA 4PJNA 1JYIA 1HLCA 4ASKA 4XF1A 4E2GA 3JBG2 3VWBA 4OI1A 1WMXA 2DA2A 1T0FC 4E8CA 4RGRA 1SCRA 1AR72 1R5ID 4WF2A 5D5VB 3BPXA 4Y1XA 4KUMA 1ORKA 1SFKA 5D8AB 1J09A 4BQXA 1FIPA 4HKWA 1QVUA 5K5RA 4EJVA 5K0UB 2IGKA 4BHPA 2ARXA 4QXKA 5BPXA 4M0NA 2QZ8A 3I64A 4KIGA 4JAAA 4U2AA 4L9VA 1URXA 1RUD1 4XIDA 1G2HA 3B9IA 4MGZE 4Q4V1 4KBZA 4ZZLA 2ZX2A 4KMUX 5CU1A 2MFZA 2JTVA 2ZX1A 1UL9A 4IE7A 3S0MA 2VQCA 3JU9A 3INAA 2N8GA 2R7FA 1RUC1 1HSTA 2WUHA 3IH3A 5DPNA 5FZBA 1UPSA 3AP4A 4FPOB 3ON7A 1Y56A 1VNDA 3TBIA 2HWC1 2BVMA 3KZIC 2AXTC 2ESHA 3I5UA 4DJAA 4WM7C 2WAAA 2JIJA 4AEMA 4E7SA 4RS5A 3M1CA 4JDNA 4B1RA 1UOGA 5FRAA 5EPAA 3GX4X 1LNWA 5EFUA 4LMFA 3PIJA 3CIHA 2AR6A 2VBXA 2FE3A 4PLNA 2W87A 3ABTA 5AC91 2BDRA 2QQKA 5DUVA 4L2NA 1WCUA 5FTTC 2WIIB 3LZZA 1K5MB 2OQ6A 5FBJA 3VBUA 1OYIA 4JDMA 2WS91 1X1BA 1GLNA 3HT2A 4XF3A 3D3AA 4A2UA 4WCGA 2ET1A 5FYTA 5CKQA 3WXPA 4PLOA 3IDAA 3U75A 3GFIA 1OUXA 1GSLA 3E1SA 2OPTA 4IO9F 5K8SA 2ZGSA 4G6DA 2CFOA 1HOMA 2J22A 3ZPYA 4IEZA 3VBFA 2A68F 2W85A 1QQP2 1BK1A 2KIQA 2BZTA 1T2XA 2VZUA 3C7FA 1LVKA 4RM2A 3MUY1 4U87A 4E7HA 3I97A 1FIAA 1YNAA 2DCYA 5IVFA 3USSA 2JK3A 4BYYA 3HEFA 2O5RA 3GJAA 5KCMA 4HPQA 1F5FA 2IS2A 1RUI2 2D40A 3PUBA 4Q4Y3 2CY6A 4EWAA 4YZ5A 1KGYA 1VQNI 1YW8A 2WZR2 4IEPA 4OMDA 2Z99A 2QQLA 2GDFA 2W46A 2EICA 3TDZC 4K8FA 5F7UA 3HRTA 2FA5A 2WFF3 1DU3D 5K7FA 3VD7A 3HKZA 2UY9A 4OU0A 4ON0A 5KXDA 1B59A 2OIIA 3MFCA 5E79C 5FZ1A 5FK8A 5CFCA 2ZEWA 4Q5OA 2XSJC 3K2AA 1W7PB 2R043 2AH2A 3L7WA 5DD4A 1S0DA 5E3OA 5GLZA 4V2VA 4NC6A 2BNMA 1WW6A 5JZGC 3THDA 3GWZA 4LQRA 1QXJA 1V55H 4KFCA 3BALA 2L9RA 1RUG1 3BB6A 4A3IJ 2K02A 4U36A 5FP9A 2IS6A 3BI3A 5FB2A 1AXYA 2IXKA 2WTEA 1KQ0A 4IE0A 4ASLA 1W6NA 2FOKA 4QD2A 2FZ2A 3I3EA 1ODNA 2DK5A 3GBGA 4LJHA 1U12A 2JRTA 4UXNA 2DMTA 3LAGA 4QPGB 3WTWC 4W65A 4FVVA 4RBOA 4E7ZA 2CMPA 3QYFA 4BQ2A 3CCSI 4WXCA 4CYCB 3OYWB 4WWCA 1PUFA 1RUF3 4PHZA 5G05L 1C8NA 1TWGJ 2MH9A 2ZHMA 2QUFA 4LLOA 5A7NA 1FPN1 2PFBA 1OD5A 1H8TA 2WV0A 5A6ZA 3VZNA 3GO5A 1RETA 4RDUA 3P3PA 2R062 2Z2SB 5FZ3A 5F3EA 5T54A 3HGGA 5KR7A 4I98B 1DU6A 2E36A 2NQYA 2RM21 1WW4A 5FP4A 1HQLA 4N4NB 5J1RA 5M5WJ 2LY1A 1EPWA 1KJLA 5T50A 1LAJA 4D7MA 2GA2A 1WW5A 5FKOA 3ZQLA 2QQMA 1T39A 1MZ6A 1C57A 4PDKA 1NG0A 2QGUA 3M3YJ 3KPHA 2STWA 5DZEA 3D5LA 3GF2A 3KS7A 1VAKA 1TP4A 2VXJA 2WABA 1NHAA 2C24A 1OJLA 4KN4X 2STTA 5ERIA 1QY4A 4IGPA 2CQ7A 1R1A3 3ISPA 2PHUA 4OUMA 2O61A 4L9BA 2EJRA 1S0CA 2VOPA 3VBOC 1SLIA 2PMZN 1BR4A 3WNXA 2VKDA 1R71A 5IYCJ 5IP9J 5GZDA 4GB31 2VUJA 4F92B 5IK4A 2W0XA 4FISA 5IT3A 4META 1WGPA 3I3LA 3ZSMA 2KM2A 2F17A 3CDLA 3VBSC 4KWLA 4XIOA 4ESBA 4M3FA 3S1MJ 3FLTA 3MZHA 4N90A 3G3ZA 2W52A 3U21A 2K0GA 4ASNA 2G9GA 1J84A 2D93A 1QU3A 2IJLA 4KICA 3EUAA 3BR3A 3BIEA 2XVCA 4GQ7A 3VZJA 4D6RA 4EEFG 2HWB2 3MYXA 1NCRC 1T95A 4XJUA 2DMQA 1SMYF 2L7KA 3OYIA 2PJRA 5IFPA 3KQ4B 3QCWA 4ARXA 4BMEA 4BQAA 3J80K 1UX7A 2IXJA 4UFLA 4N7UA 5J09A 4YARA 3DKQA 5EWSA 5FKKA 3HOTA 5JXGA 4FOYA 3H7YA 4DZGA 5EEGA 3D6EA 4WVMB 4LKEA 1OUSA 5LBQA 2WNOA 2VT2A 2QQWA 2H94A 1WMEA 3J7AO 2BWCA 3ZQFA 3BTJA 4DUXA 1OISA 2PEXA 4IV3B 5BS6A 5ACA2 1DDNA 5F0HA 3DPRA 1GMMA 2VJ5A 3B73A 4MFDA 5F2SA 5J37A 3N7LA 3I3DA 3NNGA 1JYNA 4C0BA 2DUOA 1YQ2A 2D5HA 3BJOA 1IXRC 2F2EA 2R7QA 1Z91A 1JHNA 2DOEA 4D5CA 4XILA 3CLQA 2K9LA 3TO9A 2FDJA 3N97A 4X6QB 5H9RA 2YZ4A 2C9KA 2BXYA 4ZHNA 2NP0A 4DO0A 4B47A 1W5CC 1UW8A 3SQOA 1IDYA 2X5IB 4P1WA 1AL21 2YDEA 3SXWA 2DVFA 5AIPA 4AQ6A 5AVAA 1BI1A 1L7QA 4ITVA 2VZPA 3PJQA 4JQTA 1D1BA 2CW7A 2XGDA 5LBCA 1W05A 3E6CC 3TOAA 2A1XA 1A6QA 1TVGA 5EV7A 1Z67A 2JEMA 4L0PA 4NWWA 2HXIA 2P6TA 4AHYA 1AL0G 3ETQA 4HF0A 3CMAI 3OGJA 3BWGA 3RKXA 3MHZA 2WV1A 5ABJC 4IZZA 2CGNA 1GV2A 5C7GA 1LU2A 4XFCA 2PHWA 2DBBA 3LEKA 2DV9A 2RDPA 3AZZA 3HPHA 1PVC2 4AVAA 4JDOA 1GP4A 5HCBA 1T33A 3IKVA 3HG9A 1OD3A 3IWFA 2HWE3 3KCXA 1VJ2A 3N36A 4NRQA 2EFOA 5JMCA 3FKJA 2V79A 5B2GB 2JT1A 4I0AA 4CUGA 1ZN2A 2X9DA 2W91A 2HFHA 3CO7C 2XJQA 3PMSA 3OL3A 3POIA 4BB3A 3KZYA 1UMQA 4R4ZA 3AM2A 3O2PE 2ZMEC 4YM1A 1O57A 3MLJA 4ASMB 4S2GA 1J3PA 2P7VB 3MKZA 2LW8A 2NRAC 3WT3A 3ZX7A 2OYZA 4X8NA 1WBFA 3T2TA 2BRTA 2HNHA 1ND2B 5M5XJ 2DO7A 1ZBE2 3D0JA 4XMAA 3AJZA 3FC0A 5HBAA 1RUD2 4ZDOA 4Q4V2 4N9HA 3DPLC 1LVAA 4AFMA 1RUH1 3HSFA 1UQXA 2KJCA 1OLME 4P9XA 5D6FA 3SITA 1U9NA 2WZEA 1H2KA 2H0BA 3THCA 3JR9A 4UUSA 4QB2A 5FKBA 2JDHA 2LR8A 4A93J 1XNKA 4AI1A 2HWC2 3GTMJ 1ZKGA 2VOXA 1G59A 3DPUA 3GCXA 4DINB 2WNUC 3IAPA 4MV2A 3OR2C 3CD6I 1J2XA 3JCUC 4INDA 1N75A 1NQJA 5FY8A 1N1TA 1W5SA 1W8OA 1IPSA 3AKTA 4J25A 3BR5A 4ZYDA 2PQQA 3DKYA 4XK4A 2WZR3 4ORFA 4AGRA 3FIWA 4PUSA 4M9XA 3MIDA 1QH6A 2QEXI 1E57A 4W97A 2RKHA 5E1ZB 1RUNA 2WS92 2JPCA 4QGNA 2K3PA 4B8XA 3AYCA 3TB0A 3HTUA 1LPQA 3CDZB 4P55A 5GKAC 3OYJA 3BZ6A 4CXWA 3F6VA 2YUEA 3FK7A 2BUKA 4UW6A 1BXHA 1QH7A 4L9NA 3IH4A 1ETQA 1LOAA 2AC1A 3RQIA 5D8AC 3POGA 1X1PA 3PFIA 5D4RA 3ULQB 5K0UC 3Q5FA 4M3CB 1VP6A 1S5LC 4XRSA 5E18F 1CJPA 1NG6A 1JTXA 2C6YA 2Z5WA 4XHXA 4HVRA 5BOXA 3WOGA 3Q9SA 1I3AA 4YFZA 3VD9A 1MQTA 4QHZA 4CHUA 4F8AA 5E1RA 2TEPA 1NKGA 1BOBA 2ZCWA 4QTRA 3OF1A 3G6EI 2BZDA 1J83A 4ITCA 4QXHA 2MHFA 1QXRA 1IV6A 3V0BB 1ITYA 3ES4A 1OOPB 2AGSA 3SEQA 4PT6A 3PM1A 4IOAF 4ZPIA 3M1EA 3IDCB 3LQRA 5EJZB 3VV1A 4M3CF 4RB3C 3H3VK 1S2KA 3PU3A 5F3CA 2NVUB 3ZPOA 4FHTA 3FXRA 2VQAA 4DY3A 1AR62 4V2WA 5FMBA 1AKHB 1RUG2 3PUAA 4Y1ZA 4S2FA 1J1LA 4OI2A 2E1MB 3HSEA 4NIGA 1CZVA 4A42A 3QQAA 1OKRA 1B8IB 2RS53 1K5MC 4CDUB 1COV3 3HVDA 2DQRA 4ATFA 5DAVA 4JGYB 1Y6IA 3THPA 3HTSB 2EK5A 1S2BA 1FYLA 4P9UA 1ZYRF 3GYHX 1EKEA 3I55I 2BU9A 3A03A 5ICFA 3THTA 3UKGA 3RCOA 1ZGAA 3AZXA 3IL2A 2PX9A 2EB7A 2P2KA 1REFA 4CCLA 3WQ0A 1WI9A 4N53A 2VKVA 3WG3A 1DQ0A 2IXHA 4XUQA 4EWDA 4NUBA 5FUIA 3HHGA 4XTPA 2XBO2 2EAAA 2GNTA 2XJRA 3GZ5A 4K1YA 2D6KA 1W6OA 3M7AA 3HRUA 2ZHKA 1LOGA 2VXRA 2HYGD 3V0AB 2R7TA 1W6PA 4QX2A 3TEDA 1OA2A 5GAHJ 5FYUA 2FXAA 4IF4A 5ANQA 1HDKA 3JZVA 3AKQA 1QDOA 3P9CA 2RM22 1S6LA 1PIV1 4CDWB 4Z2YA 2KIMA 1YRNA 3CF6E 4I7HA 5FZ9A 3ZQGA 3OS1A 1ULPA 4XZUG 3ACGA 4JVAA 2C6SA 3LNQA 1SFEA 3PUSA 1SLAA 2KL4A 5FJKA 3N05A 5J4VA 2HKOA 2CV6A 2JECA 4AVCA 2ZXHA 5EYRA 1NZCA 3RS6A 3LL7A 5HLHA 3IHUA 2BEOA 1B72A 3BUCA 1FJLA 4XDQA 2AREA 3LOCA 5IT9K 4DW6A 3K4DA 4BH9A 4EN0A 2ISYA 3I7DA 1S72I 2QYOA 3UGHA 3I3QA 2FDIA 2HWD3 4PF5A 3QYBA 4Y1UA 5HS8A 5KVRA 3NWSA 4G12A 2HEWF 4PJLA 5CPRB 2TBVA 3VZKA 1Z78A 3A01A 1Y8QB 1DLCA 5DUXA 3AMHA 1HLVA 2XROA 3WNLA 2OF7A 4QPGC 4AR2A 4DYQA 5FLVA 1DHKB 1JYWA 2WAQN 1VBD2 5IYYA 1O3RA 3H8OA 5CKTA 4RQPA 1JYCA 3EQLF 5FZOA 5FO8B 3HPGA 4U7BA 2EPFA 4CSWA 2KKOA 3MV01 5FZ7A 3WHTA 1V54H 1UZZA 4OUEA 3ZKUA 1R081 2V1DA 5I8SA 3DQVC 4O3MA 1VQPI 2XGEA 4O9EA 1VBE3 3IPVB 4NNJA 3ZKYA 1QU0A 2JWTA 3LA7A 2HOSA 1WZ2A 2QWWA 2J1EA 3F72A 3QOEA 1SC7A 1UZCA 5FP3A 1S3JA 4BXXJ 2GMMA 3CKHA 2ELJA 3CHXA 5HLGA 5JR2A 4IL6C 2KLOA 3BIWE 2GMPA 3P9KA 5HXMA 3U0ZA 4IHTA 3VHOA 4ESJA 2MBFA 1US3A 1Y4WA 3IN9A 4BU2A 3PVEA 2WDBA 2R072 4JRAA 4FETA 2A73B 4QDRA 3PUIA 1ETKA 2H09A 2ZOEB 4HQEA 2DMUA 3VSKA 2RS31 1D4M2 5FYBA 1YFHA 2LKSA 2ZFWA 3AXDA 5T55A 3I2OA 2MPFA 4XKCA 1ZR2A 1UO9A 1KFUL 2Y64A 3OBRA 1WCKA 4C2UA 5CAZA 2YFUA 2Y6JA 4FOWA 4MHRA 4LA2A 1U0AA 4IRIA 3O14A 2Q1MA 1NH3A 3TEWA 3SCFA 3AP9A 3AYDA 4L5JA 3R4DB 3C7JA 3OL4A 4FAHA 1X3ZB 3UNPA 1J7KA 2HYKA 3SLIA 2WAQA 1YXWA 3VYSB 4NBQA 1ZGWA 5CKMA 4GRIA 1EV7A 1WA4A 3C2UA 4L8QA 2W1WA 3HHHA 4AFBA 2COBA 2E2JJ 2FBEA 3WDWA 1AL22 2IT0A 3NV3A 1DBNA 3OOXA 3MO4A 4HDUA 4IGOA 2XOMA 3F8CA 5D5UB 5CZKA 1SFXA 3HGYA 1LECA 3SCGA 5CYYA 1LTEA 4ZDLA 2LRPA 3C8XA 2EZKA 4OMYA 2GN3A 2DUQA 4EJWA 2R30A 1S0IA 3OV8A 3E6BA 3EQEA 5F6LB 2FDFA 1YI9A 3OR1C 4BIFA 1TG7A 3HQUA 1NA1B 4QGMA 4FCAA 3D5SC 2K9SA 5DYMA 2KFDA 3VBRA 4CP9A 4A7YA 4XUOA 3I58A 1BIBA 2CSGA 3I2JA 2Q2EA 1XJAA 4OI4A 2N7GA 1GANA 2BY2A 2LFBA 1VQ5I 2JDKA 1KDMA 1WPKA 5FZDA 4Q4V3 3SISA 5HS9A 2D3PA 3ZYIB 4BE1A 4XOPA 1ZZ9A 3OEAA 5EZHA 2PMWB 4IV3C 4CVUA 1RUC3 2YFZA 1YJLA 4BY1J 3P9IA 5L9BA 3CDIA 1RMU1 5EZGA 5KHKA 2DVDA 4OFGA 2CGOA 2UWBA 2BY3A 3RFRA 2HVRA 4C30A 1R49A 4MQ9F 4MO7A 5FZHA 5CVUA 4G7HF 5F5IA 3S3OA 1CESA 4CZSA 5BNPB 1UCXA 1TWCJ 4UOJA 4BQQA 4CCNA 3L09A 2B9SA 1YITI 3KIOA 2XPWA 3OG2A 1X50A 2YPDA 3GZEA 5AC93 3L2RA 2P81A 3WHBA 1J75A 4FFHA 2X5IC 3FFZA 2WS93 3VOEA 3WNMA 1FOD3 2JDNA 4QDSA 3TEZA 2V1UA 1SDWA 1TE1B 1RUH2 1EA3A 2JKXA 4X6AJ 1YO8A 4ZZDA 1G3YA 3WTUC 2NYYA 3ERMA 4JTNA 2DPDA 1WKMA 4ZYAA 4RAYA 5DUIA 1LE8B 4H0EA 1SLCA 2ADUA 3HOWJ 3O1TA 3ITQA 1VAMA 2OA2A 3NW4A 3LB9A 1GVDA 2HTJA 2Y6KA 1W3XA 1MMAA 3GLXA 1Q8VA 4DYRA 4Z82A 2B45X 4H14A 3A7QA 3WP5A 4Y13A 3U1XA 2GC1A 1ZM1A 1UY0A 3A4CA 1MIJA 4XDOA 3OD0A 2QQBA 3RZLA 4AIHA 2X85A 3CCEI 1V6MA 2VZSA 1DYOA 2KHMA 3GBFA 3LSHA 4GALA 4Y20B 1WCDJ 4YW6A 1LESA 4YRVA 1CIWA 4UFHA 3KLNA 1N78A 4ZXEA 4A6DA 1W8TA 2LRDA 2L7ZA 1UU6A 1YQCA 4YZ3A 3B9CA 5EG0A 4P9JA 5FPUA 4B09A 5DDJ1 1HQWA 3TN91 2VOOA 2WNVB 1RUG3 3KM5A 1LGCA 2ZPXA 1B09A 4LB5A 1XS9A 3ZFFA 4PGHA 1KJRA 2ZHNA 1GZWA 2DA4A 2L4AA 3JRAA 2D1HA 1F43A 5E88A 1ND2C 1RUE3 5IP7J 1ZH5A 1XTAA 4Z1VA 5KC5A 2JDAA 4AI8A 4LK7A 3VZOA 4XBLA 2J1SA 2VMIA 2JUCA 3RWNA 2B8MA 1R093 4LG0B 1AYN1 5IY5H 3WTXC 2X0LA 4IE5A 4CDXA 1WLCA 5IYBJ 2XRLA 2VBYA 1SVOA 5L3EA 5E1WA 3T0BA 4KH9A 4CXXA 4CCMA 5JXHA 3KP7A 3OYGA 1Q3EA 5LGUA 2YY1A 1FPN3 2W3JA 1YWKA 5LRSA 1GWLA 4P5YA 4MHUA 1KA8A 5HXVA 4A41A 3NJXA 3HPNA 4WBBA 1P4XA 1JZ4A 1QJY1 2LTNA 3ATGA 2EILH 3S8PA 3GTPJ 1L3LA 5FY1A 2YC2A 4FX4A 5JR7B 4QT6A 2XC7A 3H0DA 2F48A 2FBKA 1A35A 2RM23 1MH3A 1YRZA 4A6EA 1JI8A 4LBMA 3UL2A 4M73A 2VCCA 2ZC2A 3ZP5A 2NS0A 1S8NA 5JDBA 4RHV1 3NKTA 1X9PA 2XJTA 1DZQA 4K3UA 4F3QA 1QIQA 2HBUA 3G1MA 1W6MB 5GZFA 2WY8Q 2VNVA 1HV0A 3H0GJ 4BE2A 5H6RA 2WAFA 1IJWC 4YZ1A 2ZSHB 4LHLA 2W1OA 5BNOB 4XFIA 3ZFEA 3HQRA 4CU6A 4PFPA 1ZA7A 4IW3A 2FD5A 1IG3A 3BTIA 4MOAA 2W9XA 2YU9J 5LA2A 4GB33 4MTDA 2AZ5A 2Z16A 2DYCA 4YIRX 2OCEA 4YVSA 5JZGA 5DABA 4NVPA 4ENJA 3LD8A 1FTTA 5CEHA 4LE4A 2X29A 2QFEA 3OJBA 4FOVA 5ICGA 4PZJA 2XJSA 2JG8A 4HLYA 1U5ZA 1OOPC 1A36A 2V4VA 1GXQA 4NQWA 2YBKA 3RJ2X 4YGBA 3I2IA 2JRMA 3KZ4C 3U10A 4I2OA 3IAQA 2VTXA 1OI6A 2ELHA 3PSFA 3ZXJA 5A1LA 1W04A 2Y9ZA 2MW8A 3MDPA 2NVQJ 1DP0A 5IPAA 1DZTA 1TNTA 2BP6A 2E1MC 1OQ1A 5GALA 2FZ1A 2VUDA 1R58A 1JH5A 3OBTA 2DFEA 4CDUC 2WQ4A 5JPMB 4JGYC 4PIYA 2BWAA 3S57A 3JTGA 1MSFC 1ASJ1 1CAWA 1T08B 5C4WA 4EV0A 3DKWA 2Q0AA 3CEWA 3S17J 4QHOA 4ZJZA 1TW2A 2DFFA 3BYWA 1U6GA 1T6BX 3N7KA 1JZ6A 5HVQC 1IS6A 4GWIA 3U4SA 3VDCA 4JBAA 1I3HA 2Q8CA 3VODA 3CZJA 2W7NA 2GN7A 3B94A 1O91A 5TISC 1YLFA 4KIBA 1XMKA 1R082 2L2OA 5FXVA 1JBCA 2IEKA 2FDKA 4FE7A 2BW3B 5J48A 3A0HC 2LROA 5F6KA 2QBXA 1FSHA 4AVTA 1W8UA 1LHUA 5IK7A 2QQIA 2A6HF 4UFJA 3CDHA 4BGDA 5FWJA 4AIDA 5C5UA 1YIOA 3SEZA 1ODMA 4YFXF 3TMOA 5I0TA 1WA6X 1ZYBA 3COAC 4KWKA 3AP7A 3VBOA 4UF0A 1ZG3A 3WG7H 3C7HA 3O1RA 4IESA 4E7IA 5HNFA 1KD7A 3T30A 1IN5A 1XMXA 2O8KA 1KU3A 3WTSC 2OZ6A 1ZRIA 2JKBA 1LR5A 3QLQA 2ZGNA 2UXNA 1W2TA 3LAPA 1AR81 3VBSA 2H1LA 1CONA 2ARBA 4UVBA 2RS32 1W99A 2UURA 5KHDA 4RGGA 4CTEA 2D6LX 3KP4A 5L3CA 4QGLA 1X33A 1HB2A 4PLMA 1ND3B 4XUPA 2DTWA 1EV11 2V09A 2KIFA 2GBYA 3L9FA 4FFIA 3PDQA 5IHRA 4LLFA 4D1QA 2P3IA 2HXOA 1UB9A 2FX0A 2RS11 1ULFA 4UHTA 1BEV2 4Z6YA 1QEXA 3WTYC 1WD4A 2Y69H 1Y39A 4B4PA 1OA4A 4BXFA 2DF7A 3PUFA 3SQNA 4LLLA 2NMNA 1YHQI 1PMJX 4NOTA 3IWZA 1OSGA 5JI6A 1YCIA 2OS2A 1X82A 3MMYB 3GEZA 4MLOA 3KX2A 4I6ZA 1TMF3 3F22A 1MDMA 2CV0A 3FMSA 4P96A 1W2UA 1W9YA 2HYJA 3KMHA 1S0BA 1Y7BA 3Q0UA 4P14A 1FXZA 2D7FA 4OQ9A 1JU4A 4HRIA 2IS1A 5FLJA 5IAXA 1CJDA 2ZKZA 2KDOA 3DBRB 3MZ8A 4XLEA 3ZYFA 5J98B 3W6KB 3CLPA 3HUGA 4NIAA 2PHXA 1BC8C 2RV9A 1LFBA 2X6XA 4MG2A 4NHJA 1GP5A 1LDDA 2XDVA 2LK2A 3VYTB 1ETWA 4B43A 4BHCA 1O5UA 4PDWB 2R3SA 1KITA 1JZ5A 3S7IA 2E7WA 2LALA 2BVLA 1OYYA 1GOFA 4PJJA 4HOBA 1W0TA 1NCQB 2YROA 1Z0XA 4OHZA 2A5YB 5LFAA 1LEDA 4R9AA 3FXMA 4XSXF 4AC0A 4BQOA 3OYAA 2BQPA 1DPUA 3VZLA 3SH4A 1JYXA 2Y9YA 4UVCA 2CSOA 2VBWA 2WAEA 2W47A 4CEWA 3HMYA 4NPRA 5T5JA 4Y22A 4Y24A 4Z92B 4XFHA 4TZDA 1HCRA 2JA5J 2QUOA 4H7MA 4F52A 5CVRA 3VSLA 4CU7A 4D6QA 5LBBA 4QX7A 1H30A 3DEMA 3TOJA 3X2QH 2QSGX 1B35A 3S32A 3LQCA 4EMSA 5JHUA 1E3OC 1H89C 4XRFA 4HKLA 4Q0VA 3OPTA 2GLOA 3N9NA 4AUXA 4UFIA 1EH6A 4O61A 2ZEYA 3J7MA 4IQPA 4HF2A 3RZJA 4AYUA 2EFWA 4IHVA 3D5RC 4NJ4A 1BMV1 2VMHA 5L3BA 2E7QA 2R5YB 5KHHA 1JU3A 2Z9OA 3DYMA 3LE0A 4N4OB 1AZDA 2JG9A 5HV4A 3WNOA 3V8LA 2OQGA 1OVSA 4GA9A 4LKFA 1X2NA 5F1RA 1L3JA 4U0VA 3KETA 1NA1C 2XAUA 1RINA 2CYFA 2XVLA 5J8FA 3SH5A 3TNQA 3NMBA 3RPUD 2JICA 5FD6A 2R7RA 2PXJA 1QA6A 1ONAA 1BI0A 2XGXA 1U2WA 1LNSA 4YW3A 4W1UA 3ZDSA 3S2WA 4AVPA 1HDDC 1UHMA 1UHSA 1WH5A 1S55A 1Z7S3 3VDDA 3NJZA 3ZSKA 1XMAA 3I56I 4XSZF 4HLTA 4AFCA 2BHYA 2A7AA 3W21A 1JT6A 2WO2A 2M0CA 1ZX5A 3CCUI 2FHRA 3FUOA 4MGKE 1WW7A 2FCVA 4LULA 3GTQJ 1O4XA 3E5XA 3GDBA 4KU7A 4MGYE 4Q2FA 3NNLA 3SMHA 4PFOA 3G1LA 2V4AA 5ED4A 1VIWB 2Y34A 1JUHA 3LDBA 1V9U3 5BNPC 1OKQA 3AZVA 3FLPA 1D2SA 5DDJ2 1ZG1A 4NRMA 5FR3A 1VBB2 1N77A 1JZ8A 1O8PA 1RUF1 3LSDA 5DAPA 4CA9A 3K1MA 5BY5A 4DRVA 4UUVA 2E9QA 1CX1A 1X58A 1NK3P 3AFHA 5BMZA 4C2MJ 4HPKA 1SG3A 4K1ZA 1LEAA 4Y26A 1HX6A 2ZO4A 2NPIA 2D98A 4GYIA 1Y9GA 1CGPA 4YYOA 2D6MA 1G9CA 4XAAA 3VL9A 3A23A 1CF7B 4AHWA 1AYN2 1ZZBA 1TEIA 4ETSA 4MFEA 2GH8A 2NVXJ 5DM7F 2QQ8A 4IV1A 3I4NJ 4CPBA 3F95A 3IKWA 4XBNA 4DBQA 3FMGA 1LJ9A 3MAJA 4XNFA 2W4SA 2DBIA 2HGCA 1ENXA 1OF3A 2YPRA 2VLAA 1WH7A 2QE3A 1MMDA 3F8MA 4ES8A 1QWRA 3KV4A 4M74A 3W2AA 2MEV1 1LFUP 1QJY2 5LCWL 3I49A 4CZCA 1N1YA 4BLIA 1FOKA 5D8AA 4ZY9A 1R1A1 3B3QE 5JXJA 4XF4A 1PIV3 2HKXA 2JSCA 4LBJA 3LDRA 4D7TA 1VRH2 2HLEA 4ZYHA 3RMYA 4B1LA 1YHFA 4RHV2 4W4ZA 3BP8A 4FSJA 5J7MA 1XNTA 2F6CA 1X4PA 3KP6A 3ZGKA 3HJRA 5B1BH 5HS7A 1L0OC 2J7MA 1BIAA 2WNVC 2PJPA 2E71A 1FX5A 3WUDA 4E4ZA 3I2HA 3ELKA 4XABA 1WI3A 2PAMA 3MICA 1H6YA 5FPAA 4AD9A 5BPIA 4AGVA 5FLIA 3H1YA 3SZPA 4LT5A 5A6YA 3S1NJ 4W8JA 4ENMA 1SMTA 2VIXA 4XJ9A 4R52A 2GU9A 3M2MA 1IZ1A 1G6NA 5FYSA 1QPMA 2QM3A 4ZU4A 2FQPA 5CFCB 3JD71 4BMBA 2EA4A 4P02B 4RMNA 5JOWA 2WBMA 1ULDA 4DXTA 1XSXA 3GGLA 1ETYA 2HPMA 4XTMA 4B3NA 3O8HA 5EJ1B 5C8CB 4XQWA 4KMQA 2JWPA 2X8KA 3I9V2 1D8KA 3K4ZA 5C3RA 3RNSA 1NE6A 3FX3A 3G4SI 4L0YB 4FPCA 3P5JA 4BJ5C 1D0GA 3OY9A 4HSLA 4C8DA 1EPZA 2UYBA 1LEMA 2FEZA 1WLDA 1W6NB 2LP0A 5IWFA 3AG4H 3CJIA 4HN1A 4KGGA 3I3BA 2KDZA 4XQDA 2UV1A 4CDQA 4J19A 1ASJ2 1K4SA 5FP7A 1CIYA 2G1MA 3X29B 4FQZA 2BV4A 3GFJA 4D3WA 4XJAA 3H5RA 2F4LA 3QH6A 3F6OA 3M8LA 1JYVA 4HN0A 3DEEA 3ZYJB 2Q8EA 5GZGA 1FT9A 3H3UA 1PUFB 1MS0A 1BOAA 4YG2F 3S30A 2CV2A 1LUJB 5BNOC 1Y9QA 1GZTA 3UYJA 4XLFA 4ESFA 4KA4A 1C8M3 2L54A 4M3BA 5FZFA 3UR3C 1VBC2 2RVCA 2VBDA 3AFGA 3WGHA 4GYGA 5JLXA 5BXXA 5IJRA 2P3JA 1FNYA 4EATA 3M3OA 5HDNA 5LWBA 3ZSJA 2ZXJA 1B1BA 5JPNB 5ICEA 3O12A 2KT0A 3NNMA 2NZ9A 1RPWA 1I6XA 2LUWA 3OIQA 2R1BA 3ZN6B 1SQ4A 2R5ZA 3FBYA 5LA0A 1AU7A 4PGGA 2Z5UA 1PVXA 1AR82 4IEWA 4QPYA 3VN4A 3H1MA 2GH2A 3K4NA 2Y38A 2M34A 4BIOA 1GOGA 3OYWA 4XJ8A 5L3GA 2HWE1 3UNGC 2VT3A 2M9HA 2QKDA 3HXLA 2IS4A 4IDZA 4CP1A 3V56A 4O9GA 2X6WA 2GMEA 2RJLA 2RS12 1ENQA 4LOTA 2HOEA 3AMMA 5H9QA 1WZXA 2P6HA 2XKOA 1ALYA 3DV8A 1U3EM 1GV9A 3TNPB 4AQ2A 2O14A 4P00B 4QPIA 2H27A 2PFWA 5JFRA 2QBYA 2Y0SN 2CYYA 3PL0A 4LK6A 2FMLA 2Z4FA 5E6HA 2MC4A 1YFXA 1Z1DA 2I10A 2HVQA 2XAJA 4OWRB 4ZTFA 1RMU3 4M6XA 2VO5A 3B01A 3WW2A 2MH2A 5IVYA 1U78A 4R79A 4HX8A 2Q8KA 2EIJH 4I3GA 5TGTA 4MXWB 4IHWA 3EDPA 2F6BA 1DP3A 1H2NA 3VKOA 3N9QA 4JQRA 2PHLA 2YV8A 1OXCA 4MSVA 2F4MB 2QDNA 2XLFA 3SNMA 2TCTA 3CJRB 4XL9A 3LSGA 3K46A 4LKSA 4EN6B 2ZABA 3O1OA 3JREA 5BUVA 4Q4W1 4XCAA 5GZCA 2VNOA 2BPA2 4YM3A 1RHI3 1FMD3 3KCCA 5LZ6A 1YQ8A 2K40A 4S2HA 4Q26A 3BOQA 4CEYA 1JOJA 1MR5A 2DAOA 3DPRB 1UJ8A 2XH6A 4C1WA 1ND3C 5EEAA 3QD6A 3C2HA 2DDUA 4FPHA 3RZZA 1P6RA 3D4KA 4XF0A 2FDGA 3UGFA 3ZRGA 3I54A 1H4HA 1V6JA 1H9TA 4OZXA 2A71A 3WDVA 3PNAA 2P1BA 1N3OA 2BGOA 4UFMA 2E19A 2DYSH 2CWMA 2YC4A 5F9TA 2XLAA 4H4KC 3WDYA 3GMEA 1M06G 2ENRA 4J1XA 2ETEA 2OPKA 4XDPA 5DCMB 2FCUA 4G9YA 4GDFA 4FTSA 2ES3A 2ADDA 2ID6A 4F91B 3MWMA 1IUYA 1WJCA 3O7OA 1HRI1 4E4HA 1IQAA 1MS1A 3F8NA 1VBA1 1OCPA 2ET7A 3WU0A 2W25A 2FQ3A 2VKEA 3HN1A 1UOBA 2XQXA 1F5JA 4L97A 3EYYA 1BMV2 2CUEA 3ACHA 3NNJA 4G3YC 3FMQA 2A6ZA 4HSTA 2C5DA 5BNGA 2ZSIB 1PO23 3K1NA 3DL3A 2IAIA 5DDJ3 1ULYA 2J1TA 3LPFA 1H8VA 2HQRA 3TN93 1SFYA 2K5CA 3VKFC 2ZNZA 1RR7A 4IEXA 1HW1A 4XLPF 4D69A 4YFNF 4PDWC 4JHTA 3FDYA 1VMJA 2IWGB 1DUXC 3C1DA 3H50A 2JDUA 4Y52J 3I4MJ 1NCQC 3UKVA 2NOGA 1TQIA 2LBFA 3M70A 5LW9A 2V9VA 2F4OB 2X51A 1UAIA 5K5OA 1AYN3 3K69A 3J26N 4V2GA 3FM5A 3V65A 4XFGA 3IC7A 1DGRM 3CCVI 1COV1 1C1LA 4X6RB 2X5IA 3B6CA 5K7PA 1XCVA 3M4OJ 2OUJA 2DFIA 2VKHA 3NL1A 4QQ2A 4AOCA 4LO8A 4OULA 5LY1A 5IFTA 1LU1A 4DEVA 3FXJA 5FOJB 5IW0A 1QNYA 3K9TA 2DCZA 2VOVA 1RUF2 2ORXA 2VG9A 3BVCA 5BNQA 1G9FA 3BR1A 3ZQCA 1XNBA 1A04A 2VXDA 4YVWA 4E6KG 2IC1A 4BEHB 4DQAA 2XWBB 3J81K 1OH4A 4LBOA 1HSJA 3MQ0A 2HVSA 2BVVA 4C2TA 4G8XA 2V5YA 2RN7A 1BQPA 3HOXJ 1W36D 2ZXQA 4UUSB 3LWFA 3LSIA 1SHWB 4LIUA 4KNCA 1T6GC 1JZ2A 2XV4S 1VAVA 4E7JA 5L19A 4BKXA 4CP2A 3E1F1 4AFDA 3I4IA 3F8BA 4MGRA 2VZ3A 2JN6A 1AOYA 1UMHA 2X6YA 1YS7A 5A2QZ 3QP5A 2L7FP 1PP7U 4CUAA 4GCVA 2LC2A 1TME3 1U5TA 2K27A 1ZREA 4CP0A 1ZVFA 4ZU7A 5FKLA 2X05A 2Y0IA 5F6FA 1TLHB 4YG6A 4N43B 3VHPA 1GU3A 3RI9A 3PNVA 3J7ZI 4QKDA 1R1A2 2B7EA 2VAUA 4QB1A 4A45A 4QM9A 1LB2A 2GSYA 2RNJA 2OBPA 1DP7P 1XOYA 1K6YA 4RGUA 1F4KA 4Q4X1 1O6UA 3R0AA 4IRGA 2VB6A 1YJKA 2QF7A 2P6SA 1V5FA 5JIAA 2BNNA 4EYUA 3PTRB 5DN2A 1NOVA 4XURA 2G19A 3FHAA 3ASOH 3HJEA 2EIDA 3WDUA 2A3XA 2HS5A 5L9VA 5GLUA 4HK9A 4QXCA 2G0EA 1XNDA 4R9BA 5EHDA 5EJ3A 2VOWA 3FXQA 2C9AA 2FF4A 3GZNB 3NJYA 2DT6A 2BOLA 1XU2A 2WA3A 2Y0MA 4IVNA 3BU0A 1ASJ3 2EIBA 1OPMA 3C3WA 4W6WA 2HQAA 2R7UA 3CCYA 1AWCA 1PK6A 3B69A 1DQ2A 4I01A 3EETA 2MLKA 2YXSA 2XXZA 5FPXA 3LIHA 2M45A 2ZJ2A 3C18A 2D5VA 2BGPA 5F3IA 2L5QA 4RGAA 4YFWA 1ETVA 2EXJA 4LK1F 1ACCA 1W7PD 2IVJA 1GFF2 2ERFA 2V73A 3OUIA 2E51A 2KISA 1UX6A 3MIBA 4XRMA 3CL1A 1G8WA 5JLVA 5FO5A 1WGXA 4RGXA 1BZWA 2I2SA 4P9YA 1OBNA 5FZ8A 2Y6LA 3BPVA 2PLV3 2XF7A 3VBUC 2DT7B 2Y48A 2EV6A 3BQZA 3U11A 3JQWA 4M3CA 2ZEXA 3DGTA 4QIWN 3RIRA 4JKKA 1UOFA 4XUNA 2X1DA 2V1NA 1UMIA 2BY1A 2NM1A 2OAZA 2VUMJ 4N53B 3RG0A 1UF2C 3AMQA 3FISA 1C0WA 3WHCA 2ZJRF 5FREA 2CQQA 3ZMZA 2OW4A 3EJKA 4DOUA 2L7MP 4LO6B 3OD4A 4DFSA 2A3YA 4UY8I 1DG6A 1W9TA 4A5NA 1OOPA 1JJ6C 3PFYA 3TO7A 1EV13 2EFQA 2PQ8A 1W6OB 5E89A 2GXBA 2QSFX 1W6PB 1GWKA 4FXGB 1KQRA 2RS13 4FOQA 1H0BA 1UZVA 2OQ7A 1C5HA 1HRV1 4RR3A 1XPXA 4UV9A 4Y1VA 1I1EA 3NV1A 4E9KA 4Q8KA 4RAZA 5H2FC 3TYJA 2XB5A 2X09A 1S0FA 3RSJA 4CDUA 1YRNB 5C9AB 3VL8A 1ENRA 3GHNA 1GDTA 5LATA 5CFCC 1YW9A 4JGYA 4XZPA 4DNCA 5FY7A 3GTLJ 5KAIC 4G7ZF 4O7XA 4GJZA 4WV8A 5C8CC 2NS7A 2E2IJ 1PO11 2YBPA 4JZRA 2F5CA 2EBIA 1V6OA 1MBJA 2D1VA 1NYWA 2Y30A 2DA1A 2OKXA 1GICA 5HLIA 2VGDA 2HWE2 5LA1A 1WJ5A 2A70A 2PG4A 3BDDA 2ZGKA 3HKZN 1DU0A 4AW7A 1Z3YA 1YTYA 3JSPA 3BJAA 4C1XA 2VECA 3WG4A 3ZFGA 3WV6A 4UYBA 1I3QJ 2EVXA 4YWAA 3TOBA 2F5VA 3O0XA 1RI7A 2G4IA 4RQPB 1RRJA 2E33A 4CDWA 1Q8OA 3PLQA 5A7WA 2M4GA 1OQEA 1LHVA 3UKNA 4AU7A 1D5VA 2VOKA 1P92A 2V9PA 2HWF1 3S7EA 2RHPA 1AYM1 1ZRFA 4JKLA 5L3DA 4NN0A 4ZXKA 3SHRA 3KEOA 1GV5A 1FOD1 1QJX1 1XE8A 5C4JJ 1XE7A 1OA3A 2M1BA 2WA4A 3DWLE 3ZMDA 5IK5A 3IBMA 3OYKA 1BW5A 4EN7B