3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
3F8CA 1OYWA 1MJ9A 1U78A 2ZNYA 3T8TA 4ZYGA 2VBXA 4JTOA 3DQVC 1ZYRF 4I0BA 4HF1A 3HOSA 4HV5A 4RS8A 3DPLC 1FX7A 1KQ8A 4XF3A 1QZZA 4KT5C 3WTTC 3CL1A 2P7CB 3RIRA 5BQTA 2V79A 2D5HA 2B9UA 1BN5A 4MV2A 2BNNA 3F8FA 1RL3A 3ZMTA 1EY2A 2XAFA 3SCFA 1UD1A 1ZGJA 4YFNF 4Q0QA 4HX7A 1JUHA 2Q30A 3ES4A 3KP7A 5FCCA 1ONVA 2HEOA 5JR3A 3DN7A 3DP7A 1B59A 2OQRA 3K1MA 2XAHA 2F5CA 2VN2A 2E1NA 4WK8F 1O5LA 1YFXA 4PDKA 1NE6A 5BUVA 4PGGA 4IXAA 5E8GA 5JFRA 5E1ZB 4MNUA 1FI2A 1QQIA 2P5KA 3P9KA 5FLJA 2A6HF 3LFKA 3LAGA 4CXFA 1CF7B 3GZ6A 2Q8KA 3DFGA 3RJPA 4HQEA 3CO2A 2DQRA 1OFNA 2YX7A 1IW7F 4M72A 3GVAA 3QU6A 2E1CA 3NEUA 2W84A 1ZRFA 2JPCA 4GGGA 2D40A 4IEXA 3ROUA 1BI2A 2PAMA 3WTUC 4L18B 1Z1DA 3TDUC 1YLFA 2FNAA 2VBYA 3PQKA 3VEPA 4HLXA 2CW0F 2XAQA 3WU0A 3MDPA 3G7DA 5FO5A 3SFZA 4H0EA 3RDIA 1ZREA 4HF0A 4CICA 4ZYDA 5DCFA 2PFBA 3LQRA 4HV6A 2Y0MA 1XGMA 1UCXA 4WX9A 1DZTA 4NB5A 1NE4A 2PQQA 5IT3A 1HBXG 5K1YA 1W7PD 2WTEA 4KN4X 2L4MA 4LLLA 1GQGA 3WTWC 2P5LC 1H9GA 3BJOA 2VODA 2PMHA 3BJ6A 3F6VA 2FQPA 3RPQA 3SXYA 1WRJA 2QDRA 2XLFA 2YPRA 3R60A 3I59A 1FYLA 2PEXA 2PG4A 3FWEA 4Q4ZF 2HOEA 5ILUA 3DPTA 1ZAOA 4O9GA 3QPHA 1K78B 2VE9A 2JPBA 4Q48A 4MEXF 4IEOA 1SD6A 3ABUA 5D4RA 4WXHA 3QOPA 3UKNA 2QQ9A 4ZU4A 5JVTA 2LDUA 2O3FA 1RC6A 3R61A 2M45A 1SD4A 3EQLF 3WW3A 5I0TA 4GCVA 5BY5A 4KU8A 2KIMA 4B09A 4OIPF 1P4XA 4DNCA 1LDDA 2HKXA 2PMUA 3L00A 1EYBA 4P96A 3MAJA 4QGNA 3IBMA 4CYDA 1V70A 2K9ZA 3UKTA 4IEUA 5BOXA 3F23A 2B5HA 2XV4S 4HVRA 4K2EA 1TQPA 5E8IA 3I4PA 1YS7A 3LOIA 3U9GA 4Y17A 4BAYA 3BWGA 1O3TA 4KNYA 1Y9QA 3TNQA 1FSEA 2CYYA 1OYYA 3IKTA 1IXCA 1LJ9A 4LLOA 3BPXA 5ICGA 4RGSA 3RKWA 2FOKA 3RTRA 2BNMA 4KWLA 5ICFA 2GIVA 2K0GA 3QP6A 5HDGA 3VB2A 2Q2EA 1KYZA 5JHUA 2YR2A 1SFNA 5L3BA 1MDMA 4MEYF 2RKHA 4XF1A 4XFGA 4N9HA 1U8RA 5LLQA 2W85A 3ZDSA 2HS5A 1ZLKA 2OZJA 2D1HA 4XBFA 2WFPA 2STWA 3F6OA 2E9QA 2XL7A 1Z91A 3CLOA 4PZJA 1Y0UA 4X6QB 1ON2A 5I8SA 4A0YA 3HQXA 5I0SA 1SQ4A 1FP2A 2GA2A 1YW9A 1XGSA 2Z99A 5CVJA 3ABTA 4CHUA 3GFLA 3E5XA 3H1YA 5EZWA 2UYBA 2JRTA 3ELKA 6PAXA 3T5XA 1YS6A 4PJYA 4D7SA 4P5OA 2AXLA 5HI0A 1EH6A 3E6MA 4WWCA 4HSLA 4MTEA 4ENMA 4EGZA 2VONA 2V09A 4L5IA 2FMYA 4XF0A 2FE3A 4Y13A 5BPDA 4UV9A 2MH2A 2BEOA 1CF7A 1S7AA 1V4RA 4O9EA 4Z2YA 3EETA 1R1VA 2VXZA 1J2XA 4IERA 5AIQA 4XETA 2HYGD 5LHIA 1Q43A 1FOKA 4AD9A 1ZN2A 1KYWA 4LA2A 5KHHA 4FT8A 4I0AA 3JZVA 1YFYA 1O3SA 1YYVA 2D5FA 4JV4A 2DI3A 2IXKA 2QQBA 3E5UA 3GEZA 5ILVA 5FQ0A 3BROA 4XEZA 3KZZA 2EWNA 2ELHA 1J75A 1P4AA 2MD5A 3WTXC 3T8RA 4IF4A 2GWRA 3CUQA 4UBHA 1DGRA 5KHKA 1BBYA 2P4WA 2R7DA 2Y48A 4YIFA 3DV8A 5CADA 4KIFA 3HOTA 4R1HA 1YUDA 5E1XA 2F5EA 4A6EA 2EA4A 2ADUA 2QJVA 4MUVA 4CO8A 2FF4A 1J1LA 2OU2A 1RUOA 1UHWA 2RGVA 3CUQC 4OIRF 1QXRA 2TDXA 3NJZA 5LHHA 3CF6E 2YX4A 4KL1A 5FB2A 3VODA 3P7NA 3DXJF 1SD7A 2Z3YA 5D5WB 3HRSA 3HTUA 2ZXJA 4ZYEA 2A61A 3ZN0A 2A68F 2UYAA 4OIQF 2ZMEB 3M9AA 5HLIA 4AXOA 5LRRA 3WG9A 2Y0OA 4YSFA 2COMA 3O14A 4EVIA 3P9IA 3R6SA 3F22A 4GO1A 4UVCA 3FHIB 1FXZA 3D5LA 3CLPA 4KN7X 3W6JB 1K78A 1ZRDA 4UUVA 5HS8A 4AIJA 1MKMA 1IZ1A 3KFWX 1UW8A 3D0SA 1XD7A 2IVMA 4KFCA 2MA3A 2P6SA 1CAWB 5C6CA 2DAOA 2IXJA 2EK5A 2XIGA 3GFMA 4MGRA 5LEJA 2GH2A 1J3PA 4GYGA 3F8BA 3TOBA 4ASNA 4IRGA 1G6NA 1K6OA 2IXIA 2ZKLA 4G6DA 2G9WA 2Z5UA 2VT2A 3V8JA 1FBUA 4A5MA 2UY8A 3TQNA 4ONUA 3V8LA 1YFWA 1HKSA 4I09A 1DDNA 1QY4A 3GWZA 4GULA 3MFKA 4A0XA 4MTDA 2E7WA 1AWCA 4Z82A 4M9ZA 4G7ZF 2DK5A 1U6GA 1D5VA 4ETSA 2H27A 1XMKA 1PUEE 1MZBA 3COAC 3L2HA 3ZPLA 1TNTA 2VBWA 2DW4A 1CAUB 3OCPA 5KHGA 2V1UA 4M71A 4QXKA 3BALA 4IJAA 4IHTA 1J9IA 1OPCA 3PVBB 4LULA 4L11A 4XFIA 4MGYE 2EFWA 3HSEA 1ZGAA 4JQFA 2ZFWA 2PJPA 4OMZA 5L3FA 1D8KA 1LR5A 2HQNA 3BU7A 1QBJA 4LB5A 3EYYA 2G7HA 3HRMA 2ACJA 4IEYA 3ZP5A 3H7JA 4X6RB 4FBFA 4QLCU 1OR7A 4CZZA 3EJKA 2RQPA 2F5DA 1BI0A 4YIIA 4MGZE 5BS6A 3LA7A 1ZG1A 4B8XA 2PQ8A 2GXGA 2PA7A 4PIYA 3O6BB 1ZVFA 4UHTA 3KP5A 4Q5SF 1GXPA 4BH9A 2LSOA 3SMHA 3DKWA 2OA4A 3EUHA 1UPIA 5FLIA 4M9XA 1U5TB 3G3ZA 2P5VA 1BIAA 5LEKA 2IXHA 2JSCA 5DV5A 5BMZA 1SFUA 3DEUA 3I54A 4LUKA 2CO5A 4XF4A 1BOAA 2ATFA 3E97A 2PI0A 4Q29A 2MC3A 5BXXA 4JK1X 1XE7A 2UZKA 1W5SA 1RZ4A 1LDKB 1BIBA 5HDKA 3G73A 4IRIA 4O3MA 5E1RA 4P9UA 3U2RA 4QMAA 2D45A 1W5TA 2HZTA 5JSRA 2K4BA 1FYMA 4I3PA 4IEVA 2PHDA 5D8KB 4Q0PA 4KDPA 1RGSA 4AIHA 1RTVA 5TJJA 4L2NA 4IEPA 5LGNA 4QGMA 4A2UA 2PLYA 2QLZA 2EVXA 3IHUA 1CAVB 1USSA 2ZNZA 4HYEA 5LHGA 1Z7UA 2CV6A 1REPC 1STZA 3D0JA 4R52A 4G9YA 2Q0AA 2MNGA 2F2EA 3FJSA 1YQAA 4CGZA 4RB1A 3FM3A 4FAGA 3USSA 4LB6B 2Y75A 2ZBKA 1G3TA 3CTAA 1HKTA 1K7AA 1EH7A 1H1IA 3F72A 2DBBA 4UBGA 4Q47A 2OYZA 3RYPA 1UB9A 2GU9A 5CU1A 5K8SA 3HTSB 5FGMA 3V4GA 1SFEA 3DL3A 3IWZA 5CVIA 1JHFA 3EO6A 1Q1HA 1IPJA 3BDDA 1QZYA 3NW4A 1O5UA 2CAVA 2FEZA 4E2GA 4D7TA 1BI3A 1T6SA 5LGUA 4G8XA 3Q5FA 1R5HA 1GQHA 1S3JA 3IKVA 1FWZA 3QRFF 5KHJA 2STTA 5J3UA 2NS0A 1Z6RA 4KU7A 1R36A 3OTFA 2OZ6A 3WE2A 1F4KA 2FQ3A 2FRHA 2XAGA 3WGIA 2VECA 2WC2A 1C0WA 3RKYA 2ZKZA 1W7PB 3CO7C 1L0OC 2A3SA 2O03A 4BNCA 2DO7A 5DUKA 3F8NA 2KKOA 2XLAA 2D1VA 1XGNA 1LQ1A 2KJBA 2EV5A 3IDBB 2H0VA 2HKOA 4KIGA 1TQIA 2W57A 3H3UA 3QU3A 2QYOA 5JSOA 5J8CA 2FBHA 1BJAA 2HWVA 1CX4A 3GX4X 1OMIA 1HSJA 1UIKA 2EFPA 2K27A 2XLGA 2BE5F 1OD5A 4KICA 3TDZC 2OPKA 5F1RA 2IXLA 3MEXA 3IIAA 2NRAC 3B73A 2PAKA 2VOPA 3F21A 3L2CA 2NYXA 3JTHA 3I64A 1NHAA 1EPZA 2K4JA 4OMYA 1DP7P 3RZZA 2JTVA 5LGTA 2C6YA 3ZMSA 1E2XA 2H6BA 3BCWA 2BNOA 5BPXA 1FP1D 2IA2A 4ENKA 2QNKA 2ET7A 3RYKA 3NQOA 2QQAA 1I1GA 1O7FA 4XFAA 1HQCA 4L0YB 3BPZA 4OFGA 1YFHA 2UXNA 2B0LA 3HT2A 4LK0F 3FM5A 2DPDA 3Q9VA 4E2QA 3GZ5A 5K5RA 4EM1A 4ENNA 5DD4A 4LJZF 3LWFA 1U2WA 4UXAA 2FBKA 1ZZBA 2FU4A 4YARA 5K5QA 4IPAA 4ZH4F 2KXLA 3TGNA 2GC0A 3J81Z 2X4HA 5ILSA 1DPRA 1KU9A 5HOOA 1KU3A 3HYIA 2R3SA 1XSXA 1HW2A 1L3JA 1R7JA 4LLGF 4QM9A 5I91A 1U5TA 3KLNA 3HIFA 5HLGA 1FT9A 3CJNA 2PAEA 1O3RA 5DCMB 5LRSA 2GC1A 2GAUA 4EJVA 4RAYA 1HSTA 2QVOA 5CJ9A 2DK8A 1U5TC 1WKMA 3WTZA 4AVPA 3VHRA 3V7SA 3WGHA 3K0LA 4BYYA 1LRHA 3WW2A 5E20A 1RI7A 4LK1F 3OGJA 4LUMA 3ETQA 2CGPA 2Z33A 3O2PE 1ZHFA 1CAXB 4P55A 2XUBA 4IEWA 3B02A 2XVCA 2NNYA 2I45A 1XB4A 1WGPA 2LNBA 2CFXA 1YHFA 5H20A 3R0AA 5D5XB 1CAVA 3W6KB 1KA8A 1PM7A 3FHZA 1IN8A 3VOEA 1JGSA 1TNSA 2BBYA 2VT3A 4LFUA 1XDUA 1R00A 4ESJA 2ET1A 4PGHA 4XFFA 1SEFA 4AQ2A 3Q9SA 1QNTA 5H6QA 1XMAA 3C18A 2L02A 3JW4A 3N97A 1QO0D 1T39A 2PTMA 3E5QA 1S29A 2QBYB 2F5FA 2O8QA 1L3LA 2IXCA 2QVSB 5D6EA 1PP8F 1XGOA 3RPUA 1ZX5A 2K02A 3MQ0A 3QP5A 2EJRA 2DQLA 4LG0B 4UVBA 1DUXC 2P6TA 4L5JA 1UFMA 4XFCA 5D5UB 1BC8C 4XF9A 2EA2A 1I6XA 1PDNC 4Q0VA 1OKRA 1SMYF 4JVAA 4RB0A 5BV6A 4Q0UA 1H9TA 3S7EA 1G4DA 1A04A 2IA1A 3MZYA 2VBZA 2XROA 3HSRA 4O6JA 4RB3C 5IT9Z 4TLFA 3E6CC 3WGGA 4L0ZB 1H1MA 5CVRA 3SCHA 2GC3A 1J5YA 3MCZA 4OOIA 1TQ5A 3KP6A 4WXDA 1W7PA 3JSOA 3KZYA 3TO9A 4IETA 1WLTA 4FHTA 2XRNA 1X8EA 3KSCA 3QPTA 5FPXA 2B8MA 3BJAA 2UXXA 4ZU5A 1I1SA 3CUOA 2P8TA 1AOYA 1S8NA 3J81K 4F7ZA 2FNPA 3V8KA 4I01A 4NVPA 1KQ0A 4EM0B 5AVPA 5T3NA 1CGPA 3RYRA 1YFUA 1HXDA 1I5ZA 2QENA 4E2SA 5TRDA 2A6EF 1GHCA 2VQAA 3RNSA 2ETHA 3K1NA 5ERIA 1Q5OA 2VOOA 1B1BA 5ED4A 3IRRA 1JXSA 3BOQA 4N9IA 3ZMZA 3EHKA 3REOA 1G3YA 3WTSC 4RGRA 5DEQA 1IN4A 4ON0A 3H1MA 4ESBA 1FLIA 4ZU7A 3RKXA 1ZZ6A 1KU2A 5A2QK 3I59B 3V7CA 4Y15A 3R4KA 4WCGA 3V7RA 1FPQA 1FNNA 4NHJA 3U1DA 3LAJA 3MWMA 3OD0A 4FX0A 4Z07A 2MPFA 3WU1B 4OU0A 2HGCA 2EAAA 1IRGA 5I0RA 4R8HA 2QWWA 2D93A 1YIOA 5FD5A 2UY9A 1G3SA 1LB2A 1WSUA 1DGWA 2AS5F 1FSHA 1FYKA 3H9AA 2HDCA 4MH0E 4LLNA 4HF2A 3N4MA 2FSWA 3E6DA 5D4SA 3LAPA 4HLTA 2H6CA 2BYVE 2KRFA 1MJBA 3OOPA 1TLHB 3OF1A 5CLSA 2MLGA 3M8EA 3PQJA 4XLPF 3FX3A 3LWCA 2V1DA 4HMZA 4HSJA 3K1PA 4WVZA 4HZFA 3H3ZA 1Z9CA 3KETA 1UHMA 1XDSA 2F4PA 3BP8A 4E70A 3HUGA 1KGSA 2QCSB 4HOBA 5EFUA 4OINF 4A6DA 3SZTA 1XSVA 1QWRA 5DDGA 1J7KA 3GYHX 3ZQ7A 5D1IA 1ZZ8A 5F64A 4MQVA 2XKOA 4RD7A 1O57A 5EEGA 3TKYA 2O6GE 3U10A 5H6RA 2A07F 1D8JA 4MGKE 4IESA 3CEWA 1D3YA 5AONA 2CQKA 2IC1A 1U3EM 3JAMZ 2HTSA 1CAXA 2XL9A 5J8FA 3BZ6A 5AIPA 4GYIA 3SZPA 1LKNA 1X3UA 4IHSA 2C0ZA 4EWAA 3EYIA 3SHRA 4LA3A 4EWDA 1QXJA 2W24A 2O0YA 5IT9K 3WW4A 1S7OA 1LEAA 2ZJ2A 4LTAA 1ZH5A 2RVCA 1R22A 1ZG3A 2XKPA 2EFOA 4HLYA 4AVCA 3ES1A 4RB2C 3JSPA 1R1UA 2PN6A 1ON1A 2YU3A 2DT5A 4HX4A 3ECHA 3M8FA 3PNAA 1X82A 5CYVA 4HN1A 4RGXA 1MDMB 4ZZLA 1XN7A 2QBYA 5C8WA 3GF2A 1LVAA 3LSTA 2H94A 2OZUA 4H7LA 1USTA 1MJAA 3OV8A 1XSDA 5DUIA 4LG0A 3DF8A 4BHPA 1TW3A 5J7MA 3I53A 5FFXA 4HBNA 4ORFA 2E7XA 3U11A 2QZ8A 5L3CA 4XLNF 2Z69A 3M70A 5E1WA 5I8YA 2GZWA 1HW5A 4YFKF 2RNJA 5ICEA 2G7UA 4QM8A 3LA3A 2Z2SB 4KA4A 4U0YA 1T38A 1H0MA 3LQQA 3JTGA 3I7DA 4R79A 5L3EA 1WQ2A 5L3DA 3HHGA 3IL2A 4AVAA 2VC1A 1IPKA 3H1WA 3I0TA 4IRHA 2V1XA 1ZLJA 5J48A 4HBLA 4XSZF 1ODDA 2D2WA 3BPVA 3SHFA 1WI9A 1X7NA 2OA2A 2L54A 3TOAA 4S05A 1IN6A 2X0LA 4KWJA 2ZMEA 5L3GA 1J3RA 1J59A 1O4TA 3FMSA 5K5OA 4L9JA 3GUDA 3KEOA 2A69F 2ISYA 5FD6A 1YWKA 3MZHA 3GYDA 2DCTA 2VE8A 4LMYA 4M73A 5FPZA 1R5GA 2OAZA 1VR3A 2CAUA 5JCTA 5FQ0B 4GXOA 1VJ2A 2BV6A 2A5YB 3CUQB 3ZN1A 5F6FA 4KYWA 2LF8A 2L4AA 3L9FA 4A0ZA 3S2WA 1YW8A 2ZCWA 1BC7C 1B6AA 3LZZA 2KIUA 1CAWA 1IAWA 1YLLA 4I2OA 1BI1A 3ST7A 5KK1A 3M7GA 4BHCA 3NL1A 4I02A 2RC4A 4PCQA 3C3WA 2M1BA 3KP3A 5FLHA 3U0ZA 2FXAA 2HR3A 3ML6A 4G6QA 2FMLA 4HDVA 3T0YA 3WTVC 4P9GA 3I5UA 3JAMK 1OYIA 1WWXA 2EV6A 4CDGA 1ZNPA 4EMSA 1TQMA 1IF1A 3ZMUA 4KIBA 2M8EA 5HVQC 3M3IA 3E3VA 1FBQA 1LDJA 4JBAA 2HJIA 3EQEA 2QUFA 3ECOA 4HA8A 4PIZA 4F8AA 3KP2A 2ETEA 3NSTA 1Z6TA 1CAUA 3K2ZA 1EV7A 2DLLA 4MX3A 3KGZA 2PYTA 1ZG5A 4U88A 3MPBA 1DZRA 2M30A 2MLKA 1XCBA 4MHGA 2MBFA 4J1XA 4YNIA 1F5TA 4G94A 1Z05A 3CDHA 1I27A 5BPIA 5HLHA 5CVVA 1PMIA 2VC0A 2GC2A 4L9NA 3K69A 2ZO4A 1RUNA 3L09A 4EJTA 3RI4A 2O1QA 1F1ZA 2OBPA 1RIOH 1SMTA 4O5VA 4KMFA 1T0FA 4HQMA 3ERED 2R7FA 2ESHA 3CO6C 2XGXA 5FLXZ 4AQ6A 4Q0SA 5FFZA 1ZRCA 3M1EA 3L7WA 5JAXA 1E17A 4JTNA 2O61A 3C7JA 3NKTA 3BY6A 1NZCA 1MGTA 3GO5A 4MZUA 3FMRA 1SFXA 3FE5A 4WBBA 1SAXA 2LF7A 3F3XA 3NVCA 4ENJA 1Q3EA 4BIFA 2CWEA 4M6YA 4RGUA 5D8LB 5JR7B 4UXNA 1R23A 4EQQA 2EB7A 1YO5C 3K9TA 1ZRRA 5LBQA 1T2KA 3S7IA 1ZARA 3WODF 3H92A 3CJXA 3HRTA 2KJCA 3PFIA 4U0VA 4QWQA 1S6LA 3KMHA 3HHHA 4EM2A 2UWMA 3H50A 1JE8A 4HVOA 5JSPA 1IUYA 2MH9A 5A2QZ 3H8UA 2Z9OA 4UVAA 3FZVA 1UCRA 1GXQA 5I93A 3C1DA 4DINB 1F9NA 1JHHA 3I71A 3KEQA 3TO6A 4WZCA 2OD5A 3GW2A 3VFZA 3I58A 3ISPA 1TBXA 4YYOA 3FXRA 1IRFA 4ESFA 3QAHA 2MHFA 3KGLA 4XRFA 4OLLA 2KIFA 1EH8A 4M6XA 1T98A 2M5WA 2V6CA 3BB6A 3O3KA 1O7LA 4XSXF 1LNWA 2DTRA 2N7GA 1IXSB 1U12A 1BM9A 3P9CA 2HQRA 3SQNA 4G7HF 2WV0A 2HFHA 1QGPA 2NNNA 1FZPB 4LEJA 1WA4A 3WTYC 3J7AO 2L01A 5JI6A 1TW2A 3ULQB 3C3VA 2YSRA 4A5NA 3IWFA 4EJOA 3FXUA 4OIOF 5FDBA 1J0RA 2K86A 5J6XA 2P7VB 2NAZA 1J58A 4BXUA 1PP7U 4AIKA 2XAJA 1XRUA 2W25A 4HDUA 1LEBA 4G7OF 3ELNA 4EJWA 3F8MA 5KHIA 3J80Z 4M74A 1UIJA 2FBIA 4U0WA 1B4AA 1R1TA 2J5PA 3ACLA 1J3QA 2GQQA 4FX4A 2J5OA 2PFWA 4HAMA 4S04A 2IRFG 3IDCB 3WW1A 4IEZA 2EFNA 4UNOA 3T1BA 2Q4SA 1YTYA 1IN7A 3KP4A 1TTYA 4RAZA 4AVBA 4LD5A 5E16A 2P17A 4YRDA 2PHLA 5E18F 4P9FA 5HS9A 1SD5A 2DFIA 1R58A 2V9VA 2L3DA 2IPQX 3SCGA 1NYWA 5FLXK 3PLQA 4HX8A 3WE3A 3S0MA 2IP2A 2JZYA 1VP6A 4B29A 2VPVA 4EV0A 2K7LA 1P4WA 4PIXA 4DQ2A 1V3FA 1GVJA 3LA2A 3IRQA 4EWEA 2HYFA 3GBFA 4UV8A 4J1WA 3FMQA 3GLXA 4NQWA 1P2FA 2BGCA 3KE2A 3SXWA 3FFQA 2GXBA 4I98B 4L9VA 1K79A 4WXCA 5HDNA 1FC3A 2WWYA 3KLOA 3ZMDA 3GFJA 3E6BA 2HTJA 4XFHA 1VTNC 5DD8A 4YG2F 4BHBA 4YFXF 4HVQA 2LKPA 2IJLA 4U7BA 2DU9A 2GA1A 1B9NA 2QM3A 3EDPA 4QGLA 1DPUA 2IA0A 2EV0A 2EA7A 4I7HA 4QX5A 4U7DA 2IW5A 2Q1ZB 1XE8A 1IXRC 2PBIA 4M9SA 1YW7A 4EGYA 1HW1A 4ZYHA 5ICCA 1OI6A 1KQ9A 4KWKA 4MGIE 3HRUA 5KBFA 1EP0A 3GXOA 1FBSA 2H09A 4META 4WF2A 2M87A 2CSOA 2XHKA 4IVNA 3HSFA 2Q0OA 2RN7A 5DYMA 5D5VB 2ISZA 1ZZ9A 1G3WA 2RV8A 2JT1A 1ZZCA 2OQGA 5KVRA 5E17F 4ZZDA 4L9TA 3D82A 3TO7A 3AAFA 5I0UA 3ZMVA 4IEQA 2CG4A 3FF5A 5DCMA 1Y3TA 3KCCA 1YG2A 3FXQA 4XFBA 2XASA 4BQAA 4EROA 3QACA 1NXMA 1KU7A 1B9MA 1XCVA 3H7YA 4A12A 1IN5A 4D0PA 4HW0A 3UKVA 1P6RA 4TV7A 1ULYA 4LGWA 2DPUA 1ZZ7A 5D6FA 1FY7A 1MD0A 3NRVA 3J80K 5EEHA 1QPMA 3TNPB 4AWXB 4N0BA 4HN0A 4FAHA 3EBRA 3HT1A 3GFIA 4MQ9F 1HKQA 2IT0A 5I8TA 3R0JA 5HS7A 2ESNA 1O3QA 2EFQA 1RNLA 1X8MA 5CVUA 1P92A 4EJUA 4K8FA 2O8XA 1W4MA 3MYXA 2RDPA 3IC7A 4KMUX 3FZ3A 4KUMA 2FA5A
chains in the Genus database with same CATH superfamily
1QIQA 4IV1B 5C3SA 4TZDA 2ZNYA 3HB9A 3T8TA 1ZYRF 4YM3A 4HV5A 4BIOA 2Y30A 4C0BA 4RS8A 1KQ8A 5A6ZA 4RGAA 4LBQA 5EG0B 4KT5C 3CL1A 1UZ0A 1MQTB 1TP4A 4MO7A 5IP6A 3KX2A 4DW6A 3SEEA 1R093 4MV2A 5T5OA 1RL3A 2XAFA 2FDHA 1UD1A 4XUTA 3OSGA 1SFPA 1Z21A 2R5YA 1V6LA 3A23A 1JT0A 1ONVA 3UK9A 5JR3A 3DP7A 2YROA 2YG0A 2F5CA 4QAWA 3AKPA 2E6VA 2VN2A 2B7EA 2VZPA 3LL7A 1RKTA 5FZ3A 4WK8F 2A73B 2Y34A 1YFXA 4PDKA 2ES3A 4IXAA 2ZX4A 3GM8A 5E1ZB 1QH7A 1CN1A 3AMHA 3RPUD 3ZR8X 3V0AB 1AR82 2Q8KA 2K40A 3DCFA 3DFGA 2AQFA 5SV5A 3WDYA 2AHQA 1BJQA 2LTPA 3BTZA 4AVZA 1OFNA 4PT6A 2YX7A 3OSFA 3GVAA 2WQ4A 2JIJA 1SAUA 5FZBA 1HOMA 5F39A 2R49A 4EQVA 3ROUA 1BI2A 3OIPA 2J1VA 5J1XA 3TDUC 3OYIA 3PQKA 4OUMA 2XAQA 4QPIC 3WDWA 4NE9A 1RUF3 1WD4A 3SFZA 4H0EA 1H8TC 2JVHA 2WA3A 4HF0A 4BJ6C 4ZYDA 5F3CA 5DCFA 4LO4B 3LQRA 2Y0MA 4OWRB 4HEA2 1PO13 1S0GA 1UCXA 2DVAA 1NE4A 1DZTA 4NB5A 1JUMA 5IT3A 4FCAA 4KN4X 4LLLA 5C71A 2P5LC 3BJOA 4XVHA 2VQTA 1Q8QA 2E60A 1QRYA 4Q4V3 4QPWA 2FQPA 2I2SA 4QXHA 1AX1A 4GKXA 3I59A 3DPRB 5C5TA 1R083 4A93J 2W94A 4PUSA 4TTGA 2W91A 3IPVB 2CUFA 4WM7B 1ZYBA 1UXXX 3WV6A 2ZGKA 5JHFA 1VQ5I 4MEXF 2YC0A 1R091 3Q9OA 2R7XA 3ABUA 2BQPA 4SBVA 3QOPA 2QQ9A 1LOAA 3N7LA 3J7YJ 2KISA 1EKEA 4XTMA 2LMDA 4GCVA 4XKWA 1AL0G 4B09A 3G71I 1W6PA 1P4XA 4DNCA 1LDDA 3HEIA 4P96A 1EAH3 1LENA 2OCEA 4BE3A 2XC7A 1UOJA 4A3CJ 2UV1A 3UKTA 1SLAA 4IEUA 1N25A 1K5JA 1TQPA 4ZS3A 3U9GA 4Y17A 1MPXA 4BE2A 4LKDA 2JICA 2CUEA 3PIOF 4X0GA 1ZM1A 4LITA 1Y9QA 1RKWA 3TNQA 1T2XA 4QQOA 1OYYA 1SMVA 1IXCA 1FIPA 1NTCA 2FOKA 3Q8EA 4D5FA 2V73A 1CZSA 2XGDA 2BNMA 1R092 2CH0A 1PK6C 5JHUA 2AUYA 4MEYF 2RKHA 4XF1A 4N9HA 3BR3A 5LLQA 1YRNB 2GN7A 2W85A 3ZDSA 5T5JA 2X9DA 2HS5A 2D1HA 5EG0A 4XBFA 2BUKA 2STWA 2E9QA 4QT6A 1PO11 2WSVA 2WAQA 4PZJA 1ON2A 5JWPA 3GTQJ 5I0SA 1SQ4A 2WO7A 2WB1A 3WHUA 1TMF1 2Z99A 5CVJA 3HOBA 2RVAA 1UYZA 4Q4V1 3POYA 4AE2A 2LFBA 2I10A 1D2QA 3JD72 1ND3B 6PAXA 1PVXA 4D7SA 4GH4C 4P5OA 2AXLA 4KG8A 1R081 2R5ZA 3K51A 2VZRA 1JXNA 4A3JJ 1WLWA 3E6MA 5IUQA 4WWCA 3J7MA 1OKOA 4KBZA 1IRXA 2CS3A 2VZ1A 4L5IA 4HG2A 3VDDA 4XF0A 1ENQA 2FE3A 4UB6C 2EXJA 4NUBA 1JZ5A 3V0AA 1ULGA 1S7AA 1V4RA 3ZSKA 3CP8A 4Z2YA 3AYAA 1R1VA 3J7ZI 2VR4A 4XETA 2DOAA 1W3XA 4CDXC 4LORA 4A3BJ 5LHIA 3PL0A 4LE3A 1FAYA 4FT8A 1SACA 4I0AA 1O3SA 2VZSA 3SNMA 3I3BA 1PO12 1ENRA 3E5UA 1AXZA 1EAH1 3GEZA 1OT5A 2ELHA 3GJBA 1W36C 1TMF2 1U5XA 2GWRA 4BZ4A 4K6BA 1AVBA 4UBHA 1DGRA 4OHXA 4ABZA 1BBYA 4Q4V2 1DQ5A 4NC8A 4FPJA 1Y7BA 3HOTA 1YUDA 3ZGKA 5C4WA 4A6EA 3KS7A 2F4OB 2EA4A 2V1NA 1W8NA 3LSMA 2YUSA 5JPMB 2Y6KA 2RGVA 3O1MA 3B9CA 3JRIA 1YJWI 4KL1A 2VM9A 2B63J 2A6VA 5F9TA 3GGLA 3VODA 3UKGA 2W5FA 2CWSA 5D5WB 5T52A 5LY1A 3ZN0A 2UYAA 2ZX1A 3ZRGA 5LRRA 3WG9A 1QU3A 2AO9A 3DPRA 4YSFA 2I5UA 5JR2A 1SDWA 4ZTJA 4FP3A 1XC6A 3U37A 4EVIA 3R6SA 4HPQA 2R0FA 3IPVA 5CFDB 2VKEA 2F6CA 3DU5A 2DA3A 2ZGSA 2N8GA 3W6JB 1ZRDA 5A6QA 1MKMA 1MS4A 3KFWX 1EAH2 1Z3XA 1LGNA 3D0SA 4Y5TA 4TXWA 4KFCA 2XWJB 4IV3C 1P7IA 2MA3A 4GKYA 4FSJA 2P6SA 5BNNC 3OSDA 3E0JB 1W2TA 1IDZA 2YV8A 2IXJA 5K7HA 5LEJA 2XIGA 3TB0A 3F8BA 3U4XA 1JT6A 1RUI3 5EEAA 1G6NA 1K6OA 3DF0A 4G6DA 4Y52J 1FBUA 4OCTA 1RITA 3TQNA 4A6SA 3V8LA 1YFWA 1HKSA 1DDNA 3GWZA 5FY4A 4GULA 3MFKA 4A0XA 4M9ZA 2WQZC 5E3MA 4DBRA 1URXA 4ETSA 4P08A 1XMKA 3VYRB 4FE7A 3ZPLA 4QIWN 3FC0A 3GTOJ 4PJJA 1NG0A 1BA5A 4NIAA 3RG0A 4M71A 3S2DJ 5B66C 4JRLA 3T3YA 1OPCA 3ZSJA 4LULA 4QSHA 2W95A 1RUJ3 3LPGA 4A3DJ 5EP9A 1ZGAA 3NJXA 2AACA 2RJLA 4B7KA 1G8XA 2CNAA 2HQNA 3DPUA 4RDUA 1NKGA 5AC93 5HCAA 5FPUA 1YRNA 4XLAA 4EN7B 1PNGA 1VQ8I 2DA1A 4NHYA 2L7FP 3JR9A 3AXEA 1X1DA 4NWVA 4FTHA 3EJKA 4JQRA 3FBIB 2F5DA 4CTEA 2FCTA 2K9LA 2PQ8A 2GXGA 4UHTA 3KP5A 4Q5SF 1GXPA 1NCQB 4IXLA 2LSOA 5IW0A 2IWGB 3GZTB 1OPMA 2HYJA 2VKVA 3EUHA 1UPIA 4M9XA 3G3ZA 1OR7C 3AL5A 2IXHA 5LEKA 1SFUA 3I54A 3HM5A 3H8XA 4XF4A 3SC7X 2XDVA 4Q29A 2HEWF 2QQUA 3ZYJB 1SCRA 2XR4A 4JK1X 1Y1VJ 1POV0 5BXXA 2RNGA 1BIBA 4YM1A 1MBEA 1Z67A 2CQ7A 2IGMA 4YZ3A 5JSRA 2W48A 4CH7A 3J7AY 1FIAA 3OIQA 4QXBA 4IEVA 4Q0PA 1LCLA 2K5CA 2W82A 1M06G 3SZGA 1C8M3 3VV1A 1RGSA 4AIHA 4XQFA 4L2NA 5LK7B 1RUI1 4F92B 3LE0A 1QJEA 4I99C 4F3QA 3VZKA 1W6QB 5FYCA 5FYYA 2CQNA 3ZKUA 1T95A 3UESA 1K45A 2Q0AA 2M4KA 3WG7H 4KBBA 4ZDLA 4FAGA 2Y75A 1NAEA 4GWJA 3CTAA 3SH3A 1RETA 1H1IA 2DBBA 2ID6A 1AXKA 4QX0A 1UB9A 3LCPA 2QFEA 3WZ1A 2RAEA 3HTSB 4DBQA 4DPNA 1OQDA 3OPZA 1SFEA 3DL3A 3IWZA 1FOYA 5CVIA 5FIXA 1O6UA 2IFWA 5ANNA 2NMOA 1GP5A 1O5UA 4XC9A 2CAVA 2GNTA 2FEZA 1F4AA 3OS0A 4E2GA 5AC91 1C57A 3HVDA 4A7ZA 1BI3A 4WM8B 3K2AA 5LGUA 4UFJA 4G8XA 4XDQA 1GQHA 2LRPA 2RE9A 1S3JA 4HT1T 4UW3A 2VJJA 5IVBA 3PNYA 4FOQA 3KF5A 2E71A 4KU7A 2HYKA 1A31A 5A3NA 3ACGA 4L0PA 1F4KA 2FRHA 2XAGA 3B69A 3U14A 3WGIA 3ZXKA 1C0WA 3RKYA 5FP7A 4B1LA 4QDRA 1V9U3 3VZOA 1L0OC 3VDCA 2O03A 4BNCA 4YVWC 3MV01 3F8NA 2R4GA 1NG6A 2P3JA 2XLAA 2D1VA 1DQ1A 1NY71 4BQ2A 1CQ9A 2EV5A 2H0VA 3K4JA 2HKOA 4KIGA 4QPQA 2BWCA 4RSUA 2W57A 1IV6A 4FQZA 5ERLA 5JSOA 5J8CA 1JYTA 1CX4A 3AMQA 3GX4X 1UIKA 3DKYA 1POQA 5GJ6A 2Y2ZA 3BTYA 4YGDA 3RZLA 4A45A 2NRAC 5AC92 4BQQA 2B4KA 1C8M1 3CJIB 3I64A 1NHAA 4I30A 1U0JA 1LOEA 2D6PA 3WDXA 1ENXA 1V6MA 2ZEZA 1OH3A 3ZMSA 1VBC3 1HDDC 4XTPA 2BNOA 1FP1D 2IA2A 4AQSA 1C8NA 3NQOA 4L0YB 3POJA 3BPZA 4G3YC 2UXNA 2YFUA 2B0LA 3HT2A 3FM5A 3U75A 3GZ5A 3T4VA 3ZQFA 1ODMA 3AFHA 1IS6A 4UXAA 4XYXA 4LNVA 1ZZBA 4YW5A 3VKNA 1UKRA 1NY72 2E31A 2TEPA 3TP3A 3WHCA 3I2HA 2PHRA 2EF6A 5A7OA 3NAPB 1BL0A 1ZR2A 3THCA 1DPRA 5HOOA 1KU3A 4AGVA 2E1MB 3HYIA 3CZ6A 2JA8J 4N53B 2LY2A 2BPA2 3KLNA 1T56A 5HLGA 1T0FC 1FT9A 2IUWA 4XIKA 3J8F2 2Y0SA 2CU7A 1O3RA 1LHWA 5LRSA 1C8M2 4FFHA 1S55A 4RAYA 1SBEA 2K9QA 2BHZA 4XOPA 4B7EA 3LSGA 3ASNH 1QJU3 5DTDA 4AVPA 3LF7A 3RZHA 1NX9A 4CP1A 3ZO0B 3H42B 1LHOA 3WNNA 3OGJA 3DKQA 5L36A 2YXSA 3UGHA 2RS13 2XVCA 1XB4A 1IOAA 1D0XA 1TE1B 4KWUA 3R0AA 2VZOA 5E8AA 5D5XB 3W6KB 1PM7A 1IN8A 3VOEA 4BM8A 1W6QA 4Y20A 2E5NA 1NH3A 1MR5A 5GZFA 1R00A 4UOJA 1KJRA 1SEFA 4AQ2A 3HZJA 2VL4A 1XMAA 1WVRA 4FISA 5DAPA 5GPAA 1T39A 5HCBA 4BLJA 4IL6C 2PTMA 4ZYAA 1PIV3 2QBYB 2O8QA 1AF9A 4OZXA 3ZXDA 4FQ4A 3BR0A 4GWNA 1I1EA 3RPUA 2DCEA 3B01A 3CMEI 4EATA 3D5RC 5FZMA 4LG0B 4AW7A 3P1IA 3ZQCA 2ZEXA 4XFCA 3AYDA 1VBC1 4H4KC 4V2WA 1I6XA 4GMP0 2EILH 1SMYF 3R4DB 5K0UC 1NQJA 3X2QH 1PMJX 5HNFA 1YQ5A 4PDWB 4WM8A 1SLTA 1H9TA 2IA1A 3Q8FA 1QQP1 2JIGA 2FJ1A 3HSRA 3CJQB 4O6JA 1XNCA 3WP6A 5HODA 3AG3H 3PJRA 5IT9Z 4TLFA 4XRMA 1UMHA 2P3KA 3WGGA 1GZ9A 5FY1A 1IS5A 4XONA 2GC3A 1SPPB 4AHZA 1NQDA 4ZY9A 4AHXA 1TQ5A 2HWE3 3AP4A 3AZYA 5FZGA 2HWB3 2CV0A 3GZUC 3TO9A 4IETA 4D6RA 2EXHA 4PFOA 1X8EA 1TT0A 3KSCA 3K4DA 2B8MA 4LO7A 4AM3A 2J1AA 1AOYA 2NYYA 3J81K 1MSEC 1GT0C 1DFQA 4PJ0C 3SDBA 4WV8A 1VBC2 1XS9A 1V5GA 3HWJA 1ETWA 2XBO2 4NVPA 4V19K 2CGNA 1W9TA 2R1DA 4FCYA 1E3HA 2QENA 1TWCJ 5TRDA 2A6EF 3E7LA 5A3OA 3CJIA 4CEWA 1QJFA 2BVBA 3RNSA 4QQPA 3K1NA 5ERIA 3VBHA 1HX6A 3I2IA 1Q5OA 2VOOA 1QQP2 3FKIJ 2EIDA 3ZYPA 5CISA 3IRRA 4Q8KA 3OEAA 3ZMZA 4K1YA 5E3OA 1G3YA 3IP4B 1T08B 4RGRA 1SLCA 5C5UA 1FLIA 1XNAA 4ZU7A 3RI9A 1QZEA 3ZFGB 1XNDA 4Y15A 1PIV1 2GH8A 3U1DA 5FO9B 3OD0A 4BS9A 3WU1B 3CESA 5F27A 4XJUA 2XMLA 4IW3A 3NAPA 2LUWA 3H9AA 2HDCA 4MH0E 4Y1ZA 1V6OA 2W52A 4HF2A 1DU3D 4HLTA 2YU1A 3KF3A 2H6CA 2BYVE 2KRFA 1TME1 3ZYFA 1WZXA 4F55A 2A6ZA 4JCKA 3DYOA 3M8EA 2XF7A 1WCDJ 3FBNB 4HMZA 4FOWA 3H3ZA 1UHMA 4LKSA 1XDSA 2F4PA 1QEXA 3K2OA 5JMCA 2ZMKA 4BQ4A 4J25A 1BCXA 2L7ZA 2VTXJ 5DDGA 1J7KA 4YG6A 5DAQA 2V6EA 2ZOEB 2DJNA 4MQVA 1WGXA 1W0TA 3U10A 5H6RA 1UZWA 3PTYA 4C8DA 1UOGA 1YNAA 2XJQA 3RZGA 5AONA 2CQKA 2LROA 3CP2A 3JAMZ 2HWB1 1IV8A 5JMOA 3ZOBA 5J8FA 3BZ6A 3DGTA 4XLFA 1PIV2 1YHQI 1DU6A 2OVUA 3IAS2 3S3NA 4GAZA 2W24A 4XOTA 2ZJ2A 4JGYB 2H1LA 1P7JA 2RVCA 1D2SA 1ZG3A 3GTGJ 3RFRA 3JUUA 2VD7A 1I5PA 1ENHA 3OYKA 5LB6A 3S57A 4LMFA 4GD4A 4N4NB 2Y33A 1QOTA 5T5PA 3PNAA 5FMOL 3HN3A 5BYNA 1N78A 2X1CA 1MS3A 4RGXA 3R4SA 2QBYA 1TME2 3VD4A 2WT2A 2B39A 1KFXL 4QQ2A 1JJ6C 4X8PA 1EV13 2H94A 2OZUA 1F35A 4DXRA 2X1EA 5DUIA 5FBZA 4LG0A 4AHWA 2R042 5C9AA 4LKEA 4LOSA 1VQMI 3AMPA 4XJ8A 4MO3M 2GZWA 5A6XA 2G7UA 1MMDA 3VKLA 1W05A 1GBGA 4KA4A 1Q8OA 2HWB2 3AG1H 3JTGA 3UYJA 4QU2A 5TSWA 2WNVC 5L3EA 1W39A 2G9GA 3IL2A 4XCAA 2GMPA 1VIWB 1DP3A 2ZSIB 1AYM3 2QQVA 4AVAA 3PMSA 1PZ9A 4CYCB 2Z4FA 5DAXA 3I0TA 4KGQA 3CZJA 2V1XA 4MHRA 1SCSA 4HBLA 4XSZF 9ANTA 4RS5B 2JWPA 2RDQA 1IN6A 4AGRA 4MSVA 1U8BA 4IOCF 1K5MB 2X0LA 2ZMEA 2CTVA 3S1QJ 5IP7J 5K5OA 4MFEA 3SDGA 5FP8A 5FD6A 2WY8Q 4AVVA 3DEWA 5JDBA 1IRZA 3ECQA 2XF6A 5EWSA 4M73A 1VRH2 1J84A 4XUNA 5FPZA 1R5GA 2OAZA 1VR3A 2CAUA 4ZTFA 2RREA 1JGGA 2X5IB 2P1BA 2BV6A 3CUQB 3ZN1A 3R05A 1D1BA 1S0DA 5EJ1B 2JQ7A 3L9FA 1KS4A 2IS2A 2VOXA 4RLQA 4A0ZA 3ZMOA 3S2WA 2KIUA 1CAWA 2DFFA 3M7GA 2ZGOA 3WF4A 2RC4A 3GCMA 4P5YA 1W9WA 1TT5B 3V0BB 2M1BA 1RVF2 3U0ZA 2R7RA 3TYJA 3BG9A 2VJ5A 4G6QA 2CQXA 2JDUA 1TZLA 3AFGA 4P9GA 4E27A 5IVJA 2EV6A 2P2KA 4KIBA 4ARXA 5HVQC 3L9JT 3QWLA 4QWNA 4IL7A 4JBAA 1EV11 2QUFA 1BBT1 1UO9A 2WNUB 4HA8A 5DAWA 4PIZA 3WHTA 3NRUA 1CAUA 3W20A 1FMWA 4ZC3A 2DLLA 3BT9A 4BDYA 1AUYA 1XSRA 3KGZA 3ZR5A 2WA0A 2JDKA 2D43A 2XGCA 4XICA 3LFIA 3FHAA 1LODA 2MBFA 1HV1A 1UX7A 4J1XA 3S15J 5HLHA 1PMIA 1OCTC 3CCVI 1RUNA 4PQ9A 3L09A 4EJTA 1KEXA 2O1QA 5F7UA 3MMYB 4O5VA 2XGXA 3FXMA 4AQ6A 3INAA 4C2UA 2WL1A 4C1XA 2VG9A 1E5SA 4LT5A 2ZZQA 1E17A 1GZWB 4BUPA 2A6YA 1RUD3 3C7JA 1KGYA 1UMQA 3ZIWA 4TYSA 3GO5A 1OF4A 2W1OA 1SAXA 1RPWA 5FMBA 3NVCA 5C8CB 3T0DA 1EV12 4XJWA 4D7YA 1MH3A 4M6YA 1BBT2 5AVAA 2HVRA 1KONA 4JGYA 2JE9A 2XPWA 2ENRA 1R23A 3OYEA 1PX3A 3DCQA 2EB7A 1YO5C 1LJ7A 3VBSB 2R30A 4OYUA 1XC5A 1ZRRA 2LLKA 3WODF 1ULFA 2M7BA 2K3PA 4CU9A 5L7OB 5JSPA 2Z9OA 3FZVA 4E7KA 1H1AA 1VAVA 1UCRA 1W9SA 1CQTA 1US2A 3ZYGA 3RWKX 3C1DA 4N8MA 5C3RA 5IAVA 1JHHA 3KEQA 5A3UA 4OHVA 4ESFA 2R7EB 1EUUA 1IHMA 4OLLA 2KIFA 3ME2A 1S7EA 4M6XA 2VPLA 2V6CA 3BB6A 5IVYA 3O3KA 4XSXF 2Q5TA 3MW2A 4RQPC 2X51A 4AYUA 3TAYA 4CZCA 1IQAA 3W59A 3T30A 2DT6A 1MEC3 1KJLA 3VHPA 1Z77A 3GTLJ 1LESA 4XDPA 1LOFC 2W39A 3ABZA 3CCJI 1FZPB 1OBNA 1XSQA 5JI6A 2D6NA 1TW2A 4NIDA 4D3WA 3MHZA 3IWFA 4W97A 1K5MA 1GFF2 2K86A 5J6XA 4QKDA 3RSJA 5FZIA 5B1AH 3CCQI 2OTLI 1LEBA 4G7OF 3ELNA 4EJWA 3F8MA 3CDLA 4M74A 1PGW1 4CCCA 5E3LA 4JX0A 4FX4A 5KCMA 2FBEA 4E7JA 3W9AA 2PFWA 3VDBA 1XNKA 3TRSB 2IRFG 4DEVA 2RM21 2X5IA 1ULOA 2W4SA 5FLMJ 1FJLA 4IEZA 2WADA 3H5RA 4YW4A 4KMQA 2Q4SA 1RUD1 2JD9A 3HKZN 3BPSA 1MNMC 4BJ5C 4YGCA 4QTRA 4GXLA 5LATA 3ZXLA 5HS9A 1FMD3 1I3QJ 2A71A 1SD5A 3KEYA 2DFIA 4QPIB 4RBOA 4AEKA 3P3NA 2IPQX 4DB5A 1H8TB 3PLQA 3HPNA 4HX8A 3WE3A 4DEQA 5C4WC 2L9RA 2XSDC 5F2SA 4II2A 1P4WA 3WNMA 4M0HA 3JRFA 2NS7A 1GVJA 3IRQA 3N9QA 1EUTA 4UV8A 1AL21 3GLXA 3OUHA 1L7LA 3RJ2X 1P2FA 2XB5A 2FMDA 2PHUA 1K79A 1PGW2 1H2LA 1FC3A 3DWLE 1UZZA 3ZMDA 1YQ2A 2HEYF 4BHBA 4RYDA 2RM22 4HVQA 2LKPA 5A7WB 2DU9A 4U7BA 2HNHA 4ET7A 1DPUA 1Y0NA 2BGPA 4UFMA 1TC3C 5A7QA 1GWMA 1RUD2 2Q1ZB 3VB9A 1XE8A 2DA5A 1WMFA 2VC9A 3OMYA 3I9V2 1ETVA 1V6KA 2YYOA 3C7GA 4Z92B 4EGYA 1MEC1 1KQ9A 4MGIE 3POSA 5IVVA 2H09A 4PFPA 3CQOA 2BW3A 2CSOA 4IVNA 1STMA 3NJVA 2RMU3 4FXKB 2ISZA 1MIJA 2GNDA 3I2JA 3B9IA 2JT1A 1JZ7A 3ACHA 2WZPP 1W03A 4RAFA 3OGGA 4PSWA 2O5RA 5KVRA 3PUAA 1DG6A 2IVJA 2WS93 3AG2H 1OA2A 1ULDA 3ZSMA 3AAFA 1L7QA 1TWGJ 1AL22 1W9YA 5C8CA 3MF9A 5I0UA 2CG4A 3HBKA 5FXWA 4CU7A 3OYJA 4CCJA 4XFBA 2WY7Q 4K21A 2Z79A 3VBSA 4BDZA 3I2OA 4MGSA 3MKWB 1XCVA 3H7YA 3H8RA 3JRCA 4DGWB 1AU7A 1UWWA 1XNBA 1DBNA 5FKOA 2E51A 1FY7A 2XGEA 5L7OA 5F5IA 3DEEA 1MD0A 1A5JA 1WLDA 1C1LA 1ST8A 1QPMA 1OOPC 3PVNA 5KXEA 1GR3A 2BFUL 4HN0A 3MN2A 1PK6B 4FAHA 3VZLA 1MEC2 3HT1A 3OYBA 2UU8A 2IT0A 5I8TA 3R0JA 1O3QA 1RNLA 1S5LC 1BR2A 2Z1DA 1X8MA 3KM5A 4Y24A 1UG0A 4BJTA 1YI2I 3MYXA 4R9CA 4OHYA 1MJ9A 2NN8A 4YFWA 3ASIA 3BCBA 3WOGA 2HXIA 4BEHB 1BEV3 1RUE3 3WTTC 2P7CB 2J1UA 2V79A 4XHBA 2D5HA 3WINE 5FZDA 4RN5A 1HRI2 1Z7S3 4UYBA 1QDOA 3NARA 5LBBA 4Y1XA 3QYBA 1JZ8A 3HOVJ 1OLQA 1C5HA 1Y8QB 4YFNF 4Q0QA 2Q30A 3S1MJ 1ONAA 2FDFA 4AI1A 1B59A 2OQRA 2XAHA 1CESA 3JQXA 5B3SH 3IH2A 3H5NA 2LD5A 5EZHA 4CDXB 2NVUB 1Q56A 3OIOA 3JRDA 3RZJA 5E8GA 5JFRA 5BNPA 4LO5B 2ZXIA 2RMU1 4IO9F 4CCOA 4RHV3 1QQIA 3O8GA 4S2HA 2WNEA 1A6QA 2KLOA 2VXJA 1VBA1 4N43A 4CXFA 3T1LA 2DA2A 3GZ6A 3RJPA 3KZ4C 4TLGA 4M3CB 3CO2A 2DQRA 2VIXA 5TISC 1NLSA 4QPIA 1A6IA 4NNJA 3K46A 1BK1A 2YPJA 4GGGA 1Q8VA 5EYRA 1U9OA 3PIGA 4LXLA 2D40A 3PTRB 2C5DA 5DM6F 4LOTA 1CPMA 5JOYA 4N4OB 1MBJA 2HWF1 4XQDA 4L18B 4YELA 4AYBN 3LGRA 2O0OA 1X4OA 3MDPA 1HN0A 3G7DA 5FO5A 1K83J 2DCYA 3ZXSA 1B72A 4WX9A 1ALYA 3SITA 3JRHA 1W7PD 2BY3A 2L4MA 3WTWC 1MS1A 2RMU2 2PMHA 3HR9A 2P81A 1OPOA 4IKFA 3ORJA 3OR1C 3SXYA 1WRJA 5GKAC 2QDRA 2XLFA 4XIOA 2YPRA 1VBA2 1GNHA 3R60A 4IGPA 5M5YJ 3CD6I 3LEMA 2PEXA 2PG4A 2IS6A 3FWEA 3WUDA 2HOEA 5HV0A 4IV3B 5ILUA 1UMZA 3WNXA 1WW4A 1BEV1 1RUE1 5BNNB 3DPTA 2YPDA 1MSFC 4P1WA 4OQ8A 2VE9A 1Z7S1 4M0NA 2R16A 5DQ0A 2HWF2 2VCMA 1IQDC 3BR1A 1VQKI 5JVTA 2MG4A 2LDUA 1RUC3 5B4XA 3HKZA 2M45A 4Y1YA 3EQLF 3WW3A 3ZQGA 5BY5A 5SV8A 4S2DA 2VUCA 3AFKA 2HKXA 4UF0A 1XQNA 4GQ7A 4B4QA 5JOZA 5GZCA 3PNVA 3LOBA 1V70A 3T09A 2K9ZA 4C3HJ 3LKJA 4LBKA 5BOXA 3F23A 4HVRA 4K2EA 3I4PA 2WJSA 3LOIA 3WP3A 1JKPC 3BWGA 3OGVA 4KNYA 4E4DX 5FZ1A 2NVYJ 3CCSI 2XJPA 1FSEA 3A01B 4NO4A 1PK6A 5EQUA 3VBRB 1LJ9A 4NRPA 1BEV2 5ICGA 3KV4A 2VBPA 4RGSA 4CXWA 1VBD3 1H89C 5KXBA 2SBAA 1Z7S2 1HQLA 3RTRA 1JTYA 3VPRA 1KYZA 4C91A 5L3BA 1MDMA 4XFGA 3F9KA 4AAPA 2IFRA 5IOZA 3HQRA 2OZJA 3GALA 3F6OA 4URAA 1Y0UA 1SFOJ 5JOXA 5I8SA 4A0YA 4GH4A 3A4CA 5CEHA 2ARXA 2VBDA 1XYPA 2GA2A 1YW9A 5FZ7A 4CHUA 4AOCA 5IYCJ 3ELKA 4YVSC 5APAA 5A3LA 3T5XA 3J4UH 1D4M1 4V2GA 2OTJI 2VGDA 1EH6A 1HKDA 3ZOIA 4CDXA 4ENMA 1ZBA3 4NHXA 4QHBA 2Y64A 2FMYA 1HQWA 4Y13A 1YCIA 5FBJA 1GOFA 5C7GA 3UV9A 3K4KA 2BEOA 1D5YA 4JHZA 1J2XA 2HYGD 1RUH3 1Q43A 3CZUA 4AWDA 1XPXA 2TBVA 4NPLA 4LHKA 4G6TB 2R6QA 4LA2A 5KHHA 3JZVA 1MS9A 2WV1A 1FOD3 1COV1 4O61A 2W47A 1HV0A 1Y6IA 2MD5A 2RR11 4AL9A 3I55I 4CP9A 5FTTC 2IBDA 2Y48A 3A02A 4YIFA 5CADA 3KQRA 4Q4X1 1YO8A 4R1HA 2L7MP 3MKZA 5FYVA 1D4M2 4NIIA 5GTHC 2JG9C 1S0EA 3AP7A 2Z42A 1Y56A 1RINA 2R072 1N1VA 1MZEA 1TZOA 2WR9A 4XBNA 5LHHA 3OJBA 4Q2FA 2YX4A 3OS1A 4XUPA 5A70A 3MD2A 2W0XA 3P7NA 2OJED 2ZJPF 2Z3YA 4ZYEA 5IVEA 3K4AA 5E89A 4LBMA 2RS33 4OIQF 2F48A 3M9AA 4XNFA 2UWAA 2Y0OA 2ID4A 1GZCA 3O14A 4IV3A 4CEYC 3P9IA 5CG9A 2E33A 3F22A 4GO1A 2WAAA 1VBE3 5BNNA 2VQCA 2O9LA 3JREA 3PUBA 3HGGA 1COV2 4CPBD 3KLSA 5HS8A 4YVWB 4AIJA 4AFAA 1QMJA 4QDSA 3NV3A 3M2MA 5FKMA 2W68A 4MG2A 2RR12 4LHSA 5J40A 3VD5A 4LQRA 1V5EA 5GLWA 2DVGA 3GFMA 4C2MJ 2J1SA 1J3PA 1OA3A 4M00A 4BWOA 4M3GA 4Q4X2 2BDRA 2LM3A 4PHZA 4LR4A 3CDZB 2ZKLA 3LQCA 2G9WA 1BQPA 4GZ9A 3BQZA 4A5MA 4COVA 1E3PA 3QLQA 3ZN6B 2UY8A 4FOVA 2JUCA 2W1QA 4CEWC 5M0TA 3VBHC 3BR2A 1AWCA 1AR93 2LTNA 3POFA 4TSVA 4AYBA 4AI0A 2IGOA 2W1WA 2H27A 2EXKA 3VUOA 1OQYA 1RUH1 3N7KA 1PUEE 1MZBA 4BQYA 3ILRA 3L2HA 2X6YA 2ARAA 2JA2A 3EUAA 1OLTA 2XJUA 4LHNA 1J9IA 4L11A 2WWUA 3HSEA 3HOUJ 2ZFWA 1AKHB 4PJLA 1FOWA 4D8MA 1D8KA 3UT0A 1G9AA 3GCWA 5BNOA 1LR5A 4JDOA 4FPYA 2G7HA 3HRMA 5KR7A 4IEYA 2VUDA 3ZP5A 2VJXA 4IHYA 2RDRA 1H8VA 4X6RB 4FBFA 1OR7A 1A8MA 4YIIA 1BI0A 1W0PA 4B8XA 3O5SA 1VBB2 3VDXA 2PA7A 4PIYA 3KQ4B 1X1PA 3LDKA 1JU3A 2DTZA 3H9QA 1G9BA 1PZ7A 4OI2A 2RS31 2DUOA 3N9OA 4NAMA 5LBEA 1XB9A 1RMU1 1APNA 1BIAA 4HK8A 1UMIA 3U4SA 2JSCA 5J1YA 1DDLA 3ZFFA 3S17J 1RUH2 3FBMA 3N36A 3QCWA 3N9MA 5FYBA 2E2JJ 3WP5A 3MFAA 3C8XA 2GP5A 4PK4A 5LZ6A 2YDEA 2UZKA 2W9XA 1JKOC 1RZ4A 2X85A 4DYQA 5HDKA 5E1RA 1WCSA 4QMAA 2D45A 4CUBA 2JUGA 2PHDA 2CRGA 5IWFA 4P9XA 4P5HA 5A3PA 4KDPA 4BBRJ 2YHJA 3M1CA 5TJJA 4IEPA 2HOSA 4COWA 4QGMA 2PLYA 1O4XA 3IHUA 3I8TA 1E5IA 1EF4A 4NIGA 2W3JA 3FLPA 3WNOA 3U07A 2O7OA 3H35A 4FPCA 1AR91 4BQ5A 2RS32 4GB33 2ZBKA 5K9YA 1W2AX 1RMU2 3NO8A 1GV5A 1HKTA 3WG1A 3F72A 5DZGA 5K0UB 2WZR1 4YRVA 3MUY1 3JB4C 3V42A 1YYNA 5CU1A 1OXCA 2DMNA 5E3NA 3OBAA 4B8EA 2L9LA 1W99A 2F6BA 3EO6A 1Q1HA 2QQOA 1UX6A 4D94A 1QZYA 3A7QA 4B4RA 3O0VA 3USUA 3C7OA 2VI6A 2VU9A 1R9TJ 3POEA 1V00A 2AEZA 3X29B 4HKWA 1HJGA 4QPGB 3D5OA 3F95A 2VNGA 1X1BA 4NMIA 1R5ID 4HFSA 1JOPA 4GRIA 4BDVB 4LO6B 1K42A 4YVWA 5JIUA 1YE9A 1GZTA 2RS51 4ZPIA 3OTFA 5FO7B 2FQ3A 4XMYA 3GTPJ 3LEIA 2OUMA 2R063 5HPOA 2ZKZA 1W7PB 2BBVA 5DUXA 2M0MA 1SFKA 1WZ2A 2NP0A 5FP4A 1Z78A 2KJBA 4R4XA 1AR61 5JZGC 2LS6A 2ZXHA 2WZR2 4QD2A 3ZN6A 2XONA 5EJCA 3QU3A 5GM0A 1MMAA 3PJQA 3VBOC 1PVC3 1BJAA 1QF3A 1OMIA 2EFPA 2K27A 2OPKA 3RMYA 2IXLA 3LSEA 2ADDA 1OFSA 3AX4A 2PAKA 5FZOA 3QQAA 5M5XJ 1JW6A 2BXYA 4DZJA 3JTHA 2D6MA 1HLCA 2K4JA 1QHHD 1WFXA 5HNHA 1DP7P 3ETPA 4KH9A 2TRTA 5LGTA 3LOCA 2C6YA 4AEDA 1QJY3 1E2XA 4IZZA 5BPXA 4ES9A 1BZWA 2RS52 3H9GA 2QQAA 2EZHA 1I1GA 2JRMA 4GWMA 1YFHA 2QQMA 3ZXJA 2MC4A 3Q0VA 4GB31 2DPDA 3Q9VA 4E2QA 4QX1A 4ENNA 4EM1A 2QF7A 3MIEA 3VD7A 3HG9A 3SEPA 5GALA 2FU4A 5T55A 4ZH4F 1AR62 1NG7A 2X4HA 1ULCA 2P37A 2R3SA 1HW2A 1L3JA 1R7JA 4QM9A 1CJDA 4V2VA 4Y1UA 3W2AA 5A3MA 5DCMB 1PVEA 2GC1A 3M7AA 4EJVA 4W4ZA 3CLQA 3AVSA 1ETQA 1OSGA 5CJ9A 4E6KG 2B42B 1HB4A 4B4CA 1U5TC 1WKMA 3ILNA 3WTZA 3VHRA 1BLZA 3WGHA 4BYYA 1LRHA 5E20A 3O1VA 4LK1F 4LUMA 3ETQA 3VBUB 2G4IA 2R061 3T0AA 2C26A 1ZHFA 4P55A 3B02A 2NNYA 4GB32 1WGPA 2OS2A 1MQTC 2LNBA 2GOMA 1YXWA 2HWC2 5GLVA 3FHZA 1ULPA 2BBYA 2VT3A 4ESJA 2ET1A 3BG7A 1HN1A 5GAEJ 1PVC1 2C9AA 3MLKA 1FV2A 4J00A 3N97A 5FKBA 3CCLI 1DQ0A 1QVTA 3BN6A 2Q8DA 3E5QA 2F5FA 3RI8A 2OKXA 1JMUB 5D6EA 1XGOA 3BTJA 4LBQB 5K0UA 3MQ0A 3QP5A 1BVP1 5LCWL 3SISA 5EDNA 2DQLA 4PLMA 1GICA 2AR6A 2VUJA 4DIQA 1QJY1 3NNLA 3K48A 2WNVB 2PHTA 3ERMA 3S2HJ 2E35A 1OKRA 2KP6A 4HXCA 1MW7A 2VXDA 3WG3A 2R062 2DTWA 4W1UA 2VJ4A 3L1PA 4XLCA 2XROA 4MVTA 4NROA 4NJ4A 4ATEA 3E6CC 2CV1A 4B3AA 3PM1A 3KYLA 3MCZA 4BXFA 5I0DA 1PVC2 4AEJA 1D0ZA 3KP6A 4P9IA 1W7PA 5B5EC 2OQ7A 1VQ7I 1K6YA 5FPXA 2FDGA 2MW8A 4CP0A 5IHRA 3OBTA 4IE6A 3C7FA 2P8TA 1S8NA 5L9VA 2WINB 1IG0A 1ETOA 5DDJ1 5FZ4A 1AR83 3JBG1 3VYSB 4I01A 2DU0A 1OFCX 2JE8A 3AXDA 2Y60A 5AVPA 5T3NA 1CGPA 1HXDA 4E2SA 2ECBA 2EIBA 4ZHNA 2QDNA 1B09A 2ETHA 2QZ2A 4BQNA 1IDYA 5FUPA 1FPN2 3D6EA 1JUIA 3ATGA 5FZLA 1DZQA 1J09A 3CC2I 1W8ZA 3OYMA 5DEQA 1S2BA 2EIJH 1OVSA 1ND2C 1UYYA 3H1MA 1SDDB 4ZONA 3RKXA 1ZZ6A 3FUQA 4Y5SA 1XMXA 4CCLA 1JUPA 3I59B 3V7CA 2B9VA 4HPKA 5FFOC 3R4KA 2KHMA 3V7RA 3WDTA 1FNNA 3LAJA 4FX0A 2JD4A 4OU0A 2HGCA 4R8HA 2V9KA 5FKKA 4AFDA 2BHYA 2D93A 1YIOA 1G3SA 1X50A 1FSHA 3IMMA 3M3EA 5GZGA 5E88A 3N4MA 5IYYA 2BV4A 5C33A 5DDJ2 3JBG2 2DVDA 1VAMA 3MO4A 3PNTA 3OF1A 5CYYA 3CHXA 2ZHLA 3PQJA 3FLRA 5IY5H 4WVZA 3K1PA 4XJAA 3KETA 4E9KA 2A3WA 4RL7A 1W6PB 3BP8A 4ZDOA 1KGSA 2BP6A 1HDPA 4E4HA 4A6DA 1FEXA 1H2KA 3RMXA 2PX9A 3GYHX 1MZ5A 1RUG3 5F64A 2XKOA 5EEGA 3PVOA 2A07F 5CA6A 4IESA 1UYXA 3CEWA 5D21A 2IC1A 1K4TA 3M3QA 1WCMJ 2XJVA 2YGLA 3MGUA 2HTSA 3K4ZA 2XL9A 1WKYA 2IGKA 4GYIA 3A4UA 2DN0A 1UU6A 4XQ4A 1X3UA 1ITYA 4IHSA 3LSIA 3EYIA 3SHRA 3WY6A 2CYFA 4LA3A 1QXJA 4BE1A 1OC1A 2O0YA 3WU2C 5IT9K 3EMRA 1S7OA 2IS1A 1LGBA 3TEYA 4COZA 3FDYA 4YZ2A 2EFOA 4HLYA 3PFYA 2AGSA 1DGRN 4KT6A 1MNDA 3TBIA 1TNFA 1R1UA 3KIOA 3RQ4A 2J1TA 1K4SA 4CVUA 3BCAA 3ECHA 1ND3C 2LC2A 1RRJA 2GP3A 4HN1A 3MZ8A 2P4EA 4RA0A 1R1A2 4ZZLA 3EXUA 4XPVA 1XN7A 3GF2A 1US3A 3LSTA 3CCRI 1USTA 1MJAA 3OV8A 3TEZA 1XSDA 5JXHA 2DU1A 5DPNA 4KQ7A 4PF1A 5J7MA 4L97A 1AXYA 2OCCH 3I53A 2WNVA 4Z1VA 2QZ8A 2WNOA 5E1WA 4YFKF 2ZGMA 2RNJA 2B45X 2KM2A 3PUQA 3FHNA 1G8WA 4RFT0 4QX7A 3U21A 2VE1A 5FZFA 1OLME 2R5ZB 4FETA 1KD7A 2VQUA 2CU5A 2ARBA 3AJZA 4FE4A 1OKQA 4Y4RA 5K4LA 1CZVA 4A3GJ 1U0AA 2VZUA 3VDDB 4FOYA 2M2EA 3JD73 5C4JJ 2JWTA 1QNWA 5AFEA 4AHYA 2DYRH 5FROA 1ODDA 2D6OX 1WI9A 3A0NA 1REFA 4CRQA 2X8KA 3H8OA 5BNPC 3FMSA 2DBNA 1YWKA 4YM0A 4LMYA 2DCKA 1POV3 2JECA 4XKBA 4N43C 4JKKA 5JCTA 1O8PA 1RUG1 2CGOA 5FYHA 1MVQA 1PO22 4RR3C 1VJ2A 3MKLA 4PBPA 3LSPA 4K9SA 3RS6A 3GNEA 4Q4W2 1F2NA 4CPBA 1LEDA 3ZYBA 3IUOA 5C4WB 1B6AA 3LZZA 3OBRA 1IAWA 4I2OA 1I3HA 4NC7A 1TNRA 1V6JA 1HDKA 5A80A 2ZB9A 4I02A 3AM2A 4XZPA 2JA7J 3C3WA 5FXVA 1TMF3 3KP3A 2HR3A 2C6SA 3N05A 3OBZA 3ML6A 3T0YA 3JAMK 1ZNPA 2ORXA 1TQMA 1IF1A 4GALA 3ZMUA 1DIWA 4BB3A 3M3IA 3E3VA 1FBQA 3EQEA 5CKQA 3KB5A 3NJYA 1Z6TA 1A36A 3POBA 4YLZA 1CONA 2NVQJ 5A3TA 1KDMA 2F4MB 1RUG2 4U88A 4CDWC 2MLKA 4MHGA 1F5TA 1SVLA 3RKQA 2EIMH 1YITI 1FMVA 2GC2A 2ZO4A 5H9SA 2DA4A 4W50A 1F1ZA 1FOXA 1LHUA 3IKWA 1SMTA 5JIAA 3UNGC 5K7PA 4KMFA 4UY8I 2JB8A 3CO6C 3JD71 1ZRCA 2EQRA 1W0OA 1DYKA 2X6XA 3BY6A 1NZCA 3PUSA 2XPVA 2WT0A 4HOOA 4MZUA 4OMCA 2H8WA 4XW3A 3UR3C 1SFXA 4H55A 4M01A 4FO9A 2M34A 1RXGA 1X3WB 2LF7A 4HNTA 4BIFA 3H36A 2OT7A 4DQAA 4RGUA 1POV1 3APBA 1AR72 5JR7B 2XVKA 2P3IA 4UXNA 4V1PA 2E32A 1HQNA 1OOPB 3K4CA 5EGOA 5LBQA 1YIJI 1T2KA 3S7IA 4XE9A 4FFIA 5E6HA 3OEBA 3H92A 4M6VA 2KRHA 1UY1A 2XQRA 3PFIA 4NR1A 3DTIA 2GXAA 5JI9A 4EM2A 3NMBA 4OQ9A 2MH9A 4IHXA 1IG3A 5IOYA 4UVAA 2VBBA 3D5SC 5I93A 1E5HA 5FMOS 1BW6A 2UUZA 2OD5A 4RQPA 3VFZA 3I58A 3K4BA 3ISPA 4ISRA 1TBXA 4YYOA 1VMHA 4JP0A 2FOWA 1YQCA 2MHFA 4EN8B 2PLV3 5DUWA 2GMEA 1EH8A 2CV2A 1LOFA 1T98A 2M5WA 1PUFA 1M4WA 2VZ3A 4HNVA 1DQ2A 4DYCA 2D98A 4CCEA 3H1CA 2VASA 2N7GA 3HN1A 4G7HF 2WV0A 1QJX3 4W6XA 3J7AO 3I2KA 2OX0A 3U78A 4A5NA 3ZPYA 1G86A 4OIOF 1JUSA 2P7VB 2NAZA 2XPUA 5J47A 4BXUA 2RDNA 4AIKA 1XRUA 2W25A 3S30A 1OUXA 3ZN5A 1LAJA 2FBIA 5EF6A 3ZN4A 1B4AA 1ASJ2 2ZMLA 4CUGA 3BYWA 3DTKA 2NXNB 5KAFC 4S04A 1WJDA 2EZIA 4UNOA 4D6QA 5AFBA 3QH6A 2WRAA 3M07A 2R7ZJ 1YTYA 1IN7A 3GBWA 1TTYA 2JJ7A 1JU4A 2D7FA 2KR2A 3D4KA 5E16A 1V55H 4YRDA 1LOCA 3AZVA 4LBNA 2PHLA 1CWPA 5E18F 2QQIA 1JTXA 2BGOA 1OLRA 5FR3A 3AKSA 3B00A 4BA6A 2DF7A 4YG0A 1NYWA 5JUVA 2ZEWA 2ZABA 2DFBA 4B29A 4CA9A 3ON7A 4DQ2A 4J19A 3LA2A 4M3DA 4OUEA 3MIGA 4FPKA 3M3CA 4J1WA 3FMQA 4HSRA 1ZBE1 2BGCA 3KE2A 3SXWA 4WXCA 3AZXA 2WQ8A 4NRMA 5LWBA 3GFJA 3E6BA 4LK7A 2D6KA 1VTNC 5DD8A 4YG2F 3PSFA 2PLV1 2IJLA 3BGAA 4GMP3 3EDPA 1B9NA 1IC8A 2EV0A 2Y0SN 1QVUA 4HSTA 4QX5A 4U7DA 1POGA 2E5ZA 3DUIA 4QU1A 2ZGTA 1ZA4A 2J7MA 1REDA 1W8WA 2HU9A 4ZYHA 2GDFA 5ICCA 3IAPA 1Y4WA 1WCKA 1GWLA 3OYDA 1QJX1 4WZFA 1I50J 1EP0A 4UFHA 3WG2A 1T6GC 4META 3A03A 2M87A 1HB2A 3A0BC 3ZQHA 2FZ1A 3BR5A 1OHFA 1TWAJ 2Q0OA 2ZS6B 1Y9MA 2GBYA 2VTXA 5DYMA 3I97A 1ZZ9A 3TL4X 5KAIC 5FWJA 2OQGA 3HJEA 2NM1A 3VL8A 3WDUA 1S0CA 3T4HB 1JYVA 2JENA 5CNAA 5GZEA 1RR7A 3VKMA 2F4IA 1Z7LA 3FF5A 2BERA 1Y3TA 4XAAA 4QDQA 1ZBE2 4H7MA 3KCCA 4GFBA 2XASA 3ZIXA 4BJ0A 4BQAA 4Q1PA 1OOPA 1CZTA 1B9MA 1DQ4A 3NQHA 2JDYA 4A12A 2PLV2 1IN5A 3WEZA 4D0PA 4HW0A 1P6RA 2DOFA 4TV7A 1ULYA 1WLCA 4II3A 5D6FA 5KHDA 2LOOA 3OUJA 1DGWY 3NRVA 4CDQA 5EEHA 4F91B 3KZIC 2BOJA 4AWXB 4N0BA 3N35A 5JXIA 5BNOC 4MQ9F 4E7SA 3LSKA 1QJX2 1WWYA 3FK6A 1G2HA 2QKMB 1LTEA 2JA6J 2V72A 3UNPA 4EJUA 4NC6A 1W4MA 5CKMA 3PUFA 3FZ3A 1YI7A 1QKQA 3F8CA 3T1MA 1U78A 3PO2J 2FD5A 4ZYGA 2VBXA 2LBFA 2PMWB 5A7PA 4I0BA 4HF1A 2V4JC 3HOSA 3WQBA 5KC5A 2R32A 1FX7A 3EB7A 2ZHKA 4YVSB 3Q8AA 1BN5A 3VDAA 4IQJA 3ZFFC 3ZMTA 4H2AA 5FZKA 4GMP1 3SCFA 2ZGNA 1AZDA 3J8F3 3RZOJ 3VSKA 3MPPG 2XB0X 4BU2A 1LVKA 2M7AA 2UWCA 5FCCA 2HEOA 2RDSA 3DN7A 2PHFA 2LW8A 1GOHA 5ISLA 4RFRB 2E1NA 5F3IA 1NOVA 4Y20B 5GPCA 3KPHA 2D97A 5BUVA 1T6BX 1TG7A 3VHOA 3OS2A 2FDIA 3OYAA 1VB2A 3ONQA 4MNUA 1OCPA 1FI2A 2Y9ZA 3RRDA 3B6AA 3P9KA 2A6HF 4PDWC 1D1CA 4XKCA 3LAGA 1CF7B 1FATA 2DWRA 1VALA 1GUIA 4DOUA 4HQEA 5FUNA 3Q0WA 1VB4A 2PMZN 1IW7F 4M72A 1N1SA 3CMAI 3NEUA 2W84A 3GTKJ 2JPCA 2X05A 4PBOA 1SEUA 5HBAA 5FV3A 3OOUA 3HOYJ 5C70A 2PAMA 3SH5A 2VVDA 1Z1DA 3FN9A 2OC6A 4C3JJ 1YLFA 4ES8A 5IK8A 2FNAA 1OCZH 4HLXA 2CW0F 2VL8A 4NWWA 2EIKH 4D9JA 3KYDB 4XHXA 3SYTA 3DBLB 4S2GA 3RDIA 3G1OA 2BOIA 1ZREA 1LGCA 5H9QA 2RV9A 3GHNA 3HXLA 1HBXG 5K1YA 2W00A 3OR2C 3OYCA 4CEYB 1H9GA 2R0HA 3VKFC 2VOWA 1UOFA 1WW6A 2VODA 1MBHA 5JLWA 1H30A 3BJ6A 3F6VA 1PNFA 3RPQA 1WJCA 1Y39A 2BY2A 1UAAA 4XAEA 5GAHJ 2KD7A 4Q4ZF 1JTZX 2WZEA 4DXTA 1X2NA 2JMWA 1WJEA 1DYOA 1SLIA 1CR7A 5CKNA 3MVPA 5IT6A 1K78B 3FFZA 4W6WA 2JPBA 4Q48A 3JXSA 2WT1A 4IEOA 1SD6A 1UU5A 1D1AA 3CMMA 3J8F1 2ZJRF 2DFCA 4XMAA 5FZHA 4PF5A 5FZAA 2R7OA 1X9TA 1RC6A 4CEWB 3R61A 5I0TA 1GUUA 3VBHB 5ANQA 5F0FA 4OIPF 2E63A 3BIEA 5FWEA 3A22A 1EYBA 4BY1J 2XBO3 5B4NA 1IKQA 2VMFA 2FQ4A 1C3HA 1WBFA 2AYHA 4CYDA 3VD3A 3CCUI 2B5HA 2XV4S 5E8IA 1YS7A 4BAYA 3AB0A 4A69C 4AEDC 4EE2A 1QQP3 1B8IA 1U5IA 2VZTA 2DXIA 2JG8C 5A7SA 3IKTA 2VW0A 3BPXA 3P5BA 3T2TA 1HIXA 2Y38A 2YS9A 2DBIA 1X33A 1AX2A 2KT0A 3ZQQA 1B35C 2BFUS 1W1WE 3TW6A 5ICFA 2GIVA 3T2QA 2K0GA 3QP6A 5HDGA 3TEDA 3DLAA 2B9SA 2YR2A 1SFNA 4XMIA 3O1OA 1U8RA 3NWSA 3L2QA 3SJMA 1ZLKA 3HDDA 4YVSA 3CLOA 2YBKA 4X6QB 1A78A 1ACIA 3HQXA 4LOCA 2NQYA 2X29A 4G4FA 1FP2A 5CFCC 3MV11 3HEFA 3FUOA 3MKYB 5EZWA 2UYBA 2JRTA 1N3PA 4PJYA 3G1LA 4M3BA 3IAM2 1J83A 4P02B 2HBUA 5FYMA 3OG2A 4ZXKA 5HI0A 1G9DA 2XG3A 3M8LA 5A32A 4HSLA 1N3QA 4FI9A 1NCRA 2V09A 2PHXA 2BU9A 3M1HA 1O91A 3ZFEC 2ARCA 1V54H 5J36A 2MH2A 1CF7A 5IYDJ 4B48A 1FOKA 4AD9A 1W8HA 2EPFA 1KYWA 5FPLA 1XG1A 4AK3A 5C3EJ 3O7OA 3VZJA 1UF2C 3SLIA 1NXD1 4JV4A 5C9AB 3WG4A 1YX3A 4RS5C 4XRSA 4RGKA 2XBO1 5ILVA 2JG9A 5FQ0A 4CCMA 2EWNA 3UJQA 1P4AA 3NKGA 3WTXC 4HKLA 1TME3 3L2VA 2P0WA 1JH5A 1I6HJ 1WMDA 3D8CA 3O0XA 4AI9A 3DV8A 1LOGA 4KIFA 4Y7NJ 2PELA 2X6WA 1X19A 1ETYA 5A33A 2R043 2F5EA 2G19A 2R7TA 2ADUA 1UY0A 1ZRIA 3GDBA 3VWBA 2QZ3A 2FF4A 1J1LA 2OU2A 4UW5A 3CUQC 3GHMA 4OIRF 2TDXA 3NJZA 5DG1A 2KDZA 3CF6E 3DBHB 4CEYA 4DNYA 2IAIA 3DXJF 1SD7A 2K3FA 3HRSA 2ZXJA 2A61A 4PLNA 4IQ4A 1W8UA 2ZMEB 3BC8A 3NNJA 3T08A 3ABKH 5HLIA 1W0NA 1D0HA 3NNGA 4U36A 2HDWA 2COMA 3OPWA 3CJRB 3FKJA 2K9MA 2VQLA 1RHI1 3GF6A 3I3QA 3FHIB 1BR1A 1K78A 2DMUA 2CDPA 1OCCH 1IZ1A 1WHUA 1BYHA 1XD7A 2IVMA 1JN2P 5JZGB 3GXUA 5CG8A 3AP5A 3TN91 2VCCA 1CAWB 2WNUC 5C6CA 2DAOA 3VYTB 4FPGA 2GH2A 4MGRA 1VRH3 4GYGA 2CUZA 3TOBA 2HYXA 4ASNA 2JJ6A 5J09A 3M3YJ 2BWAA 1JS9A 4IRGA 2IXIA 1IJWC 1UNBA 2PMZA 4A3XA 2VT2A 4Q1RA 5D2AA 3ZX7A 4ZDPA 5FJ8J 1VMJA 4I09A 2WWSA 1VQPI 1QY4A 3QBQA 4QB1A 2VO5A 4MTDA 4Z82A 4G7ZF 4XUOA 4BISA 3QH7A 2W1UA 1D5VA 3OD4A 4B43A 1CX1A 1UG2A 3IH4A 1TNTA 2W2IA 1RVF3 2DW4A 1CAUB 1RHI2 1F15A 2OPTA 2XRLA 4IJAA 4IHTA 5IATA 4IEJA 1H9PA 1G9FA 4YW1A 5FAXA 4XFIA 4CA0A 5F1JA 5J4VA 4OMZA 5L3FA 4NHLA 2GSYA 3I2GA 1QBJA 1AA7A 2FX0A 3TN92 3S1RJ 5E79C 2ACJA 2R041 2RJKA 3U1KA 3H7JA 4M3CE 2ZGUA 3MIFA 3CDIA 1GV9A 2ECCA 2RQPA 4MGZE 5BS6A 3LA7A 4UT5A 1ZG1A 4PI2A 1A35A 2B46X 3VL9A 1RESA 4BH9A 1V5FA 3SMHA 2M9HA 2ERFA 5J4YA 3HMYA 5FLIA 4RA2A 1U5TB 2P5VA 2FDJA 5BMZA 3DEUA 1LHVA 4Z2AA 4LUKA 2CO5A 5DAVA 1NA1A 3K4MA 3S5QA 1LULA 3E97A 2PI0A 4XLHA 2CUJA 2MC3A 2CY6A 1LDKB 4IRIA 3CC4I 1E57A 4HKOA 1MS0A 2X1DA 1PMHX 2QBXA 5F32A 3BKZA 2GNMA 4XL9A 1NK2P 4JHTA 2WA4A 5D8KB 5IVCA 2ICWG 1BBT3 1IGNA 3S32A 5F5AA 2CJJA 3A2KA 4LG3A 1VRH1 2NVXJ 3AKRA 4A2UA 1VFCA 2EVXA 1CAVB 2ZZJA 2UWBA 3ZYIB 4HYEA 5LHGA 3TMOA 4K7JA 4YW2A 4UUSA 4R52A 2MNGA 3OYLA 2HH9A 2RHPA 3KWVA 1NUKA 5DXDA 1AHSA 4RB1A 3FM3A 2NS8A 1G3TA 4JRAA 2VMCA 5DZEA 3KVBA 1K7AA 4AUXA 2PXJA 1EH7A 3K4NA 3OL4A 1GP6A 5F6KA 1RVF1 1YX5A 3EPZA 3WXPA 3AKTA 1H0BA 1N77A 4UBGA 4AR2A 3FXJA 5J37A 2DVFA 2EALA 2GU9A 3KT4A 2JDZA 3PUHA 1XXNA 5M3FJ 3V4GA 1FTTA 2HQAA 3BQYA 2MEV1 2RJ2A 5KWRA 2XXZA 3NW4A 5G04L 3HJRA 4JDNA 4LK6A 5FZCA 3HD8B 2VMIA 3Q5FA 2KZGA 4UW6A 5HCFA 3PU3A 3IKVA 3S5AA 3VHNA 1FWZA 3AP9A 2NS0A 4QX2A 2HQ5A 1Z6RA 1Y9GA 2WO2A 2V5YA 5JZGA 2VZQA 1J1TA 2VECA 1NZIA 2A3YA 5IK5A 3L2RA 4DJAA 3VBOA 2BW8A 4RM3A 5C3QA 2DO7A 3RZDJ 5FY9A 1XGNA 1LQ1A 1BR4A 5L9BA 5FOBB 3IDBB 4QPYA 4M3CF 5IFPA 2E53A 3H3UA 1W90A 3OGSA 1HSJA 3VN4A 1ULEA 4KICA 2PJRA 2GN3A 2MEV2 3OYFA 1JJ8C 2X48A 4C30A 3MEXA 3LDBA 2M8GX 3IIAA 4HETA 3CIHA 3UL2A 2DDAA 4A41A 3RWNA 2A05A 3L2CA 1ND2B 2IVIB 4EYUA 4OMYA 2ZGRA 2DFEA 1FX5A 2JVGA 3I2FA 2PN5A 3BCWA 3WCRA 4N7UA 4ENKA 2HOTA 2ET7A 3RYKA 3ZXFA 4XFAA 1HQCA 2XJRA 2B7YA 4OFGA 3JU9A 2JDNA 1WPKA 3ACIA 1DU0A 5EXOA 1PJRA 5F3EA 4LK0F 5L73A 3O12A 3ZMNA 2ZGQA 5K5RA 3OYNA 5DD4A 4LJZF 3LWFA 1U2WA 3MW4A 2FBKA 2X53S 5B1BH 1UL9A 2BW3B 1DP0A 2RM23 1YJNI 5EIYB 5FMDA 2JN6A 3TGNA 2QQPA 2GC0A 1VRBA 2TNFA 3POGA 3CMGA 2L9VA 3HPGA 2YY1A 2LK2A 4LLGF 1U5TA 1RB8G 4CCDA 3WF0A 4DUWA 4COYA 4Z2WA 4IV1A 1RUF1 2W87A 3OL3A 3VLBB 1KS5A 3WF1A 3HUGB 1W6NB 2QVOA 2HWD3 3TOJA 1SC7A 1MQTA 2YC2A 2D6LX 3V7SA 1H6YA 4J6GA 3T2OA 3S6PA 2OV7A 1AL23 2CGPA 4DMIA 2XUBA 2CFXA 5H20A 2V5DA 5LA2A 1CAVA 1KA8A 4JGZC 1RXFA 2CHHA 1WJFA 5EJ3A 4LFUA 4N7IA 1LHNA 3Q9SA 1JYNA 3MEPA 4V2FA 3AKQA 3FHQA 3CF2A 5H6QA 1LKXA 3SEZA 2L02A 2WYSA 4DO0A 1QO0D 2WLPA 1EPWA 1HA8A 1S29A 2LP0A 2IXCA 2QVSB 1YIFA 1Y8RB 1U5YA 1RUF2 4LPLA 4YGEA