3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
4A6EA 5HI0A 5I0TA 3GUDA 4IEXA 1Y3TA 4LG0B 1ZG1A 1ZAOA 3E5UA 2EFOA 1XRUA 2NNNA 3H3UA 5HLGA 3GX4X 4OFGA 1FBSA 3ELKA 1S8NA 2QNKA 1SMTA 5I8SA 5LGTA 3JW4A 3MDPA 5BPXA 1HBXG 4Y15A 4PIZA 3VB2A 2Z9OA 3J81K 2UY8A 2FOKA 4E2QA 5JFRA 2WV0A 2FRHA 3H7JA 1R00A 2FNAA 5TJJA 5L3FA 3BU7A 3ZMTA 1UD1A 4HSLA 1ON1A 5DCMB 2JZYA 1KU9A 5FLJA 3MEXA 1EH8A 1IN5A 2GWRA 4Q0UA 5DD4A 4JBAA 3EYYA 4M71A 2P8TA 1K7AA 1P4WA 4UVBA 3V8LA 5K8SA 2MHFA 2Y0MA 2VBXA 2EFPA 2OU2A 3GWZA 2XAQA 4YFKF 3ZPLA 4R8HA 5H20A 2QVSB 2Z33A 4JK1X 2M45A 5CADA 3SCHA 4LEJA 2C6YA 2IRFG 3WTXC 1CAWB 5E8GA 3OGJA 1FBQA 1K78B 2AXLA 2EV6A 1G3YA 3NW4A 4XF9A 2XKPA 3HRSA 2HOEA 2L4MA 4MGIE 1GXPA 3PQJA 4M74A 3WE3A 5L3CA 2P6SA 2UYBA 3M1EA 3S2WA 2V9VA 4MTDA 1AOYA 5AONA 1IRGA 4EM2A 3GYHX 3SHFA 5C8WA 1ZZ7A 3BP8A 1IUYA 3PQKA 2H6BA 2D40A 2CGPA 2RDPA 4HX8A 2O3FA 2R7FA 1ZZ9A 3I54A 3SHRA 1ZYRF 3HT2A 4KN7X 2VT3A 1EYBA 3UKVA 1HKTA 2OPKA 4YG2F 3J80Z 2B8MA 4XRFA 2PTMA 2EV0A 2TDXA 3JZVA 2H0VA 2PQ8A 3KP6A 1KU3A 4F7ZA 4KDPA 3QPHA 4CO8A 1CAXB 1R1TA 2EFNA 2UXNA 4HBLA 3E6BA 3L9FA 4HSJA 4KICA 2ET7A 3Q9SA 2VONA 4HLTA 3I58A 4XBFA 1BI3A 1T98A 3WTVC 2XAGA 4WXHA 3EYIA 1P2FA 4OIRF 4IESA 2V1XA 3RPQA 2VOOA 1BIAA 5KHJA 4EJTA 1RNLA 3BPZA 4IF4A 2COMA 1E2XA 1NHAA 1IXSB 3FXQA 4I98B 1XSXA 1DP7P 1X8MA 3ZN0A 2W57A 2XL7A 2A69F 1Y0UA 1S7AA 1DGWA 1CF7B 4R1HA 5LRSA 5FLXK 4GCVA 5FLIA 2RGVA 4LMYA 3W6KB 4META 1D8KA 4MNUA 1OYIA 2VE8A 4MQ9F 4PGGA 2C0ZA 3HHGA 3K69A 5LGNA 4B09A 4JQFA 3D0JA 2WTEA 5BXXA 2K27A 1XDUA 3T5XA 3IL2A 2H27A 2O1QA 1QZYA 2F5DA 3K1PA 4AIJA 3K1NA 4Q47A 3T8TA 3TO6A 2QLZA 1MD0A 2O6GE 3LAGA 1IW7F 2HYFA 4Z07A 2L4AA 2ISYA 4EJWA 3JTGA 1AWCA 3LWCA 4I3PA 4U0VA 4X6RB 1FBUA 2GH2A 1MDMB 3GFMA 1ZARA 2LSOA 5DEQA 1K78A 3IHUA 1SEFA 3WTZA 4S04A 1J9IA 2ELHA 1LVAA 2A6EF 4I0AA 5KHKA 2P17A 3MAJA 3F6VA 2ISZA 2MH9A 1JGSA 4XF3A 2YU3A 1BBYA 2Z69A 4M72A 1O57A 2K0GA 4Q5SF 3BJOA 4I0BA 3W6JB 1SFNA 3IRRA 4RGRA 1ZLKA 1ZZBA 5FB2A 5LEKA 2FEZA 1R23A 1U8RA 1R5HA 5BUVA 3WW4A 2D1HA 2HQRA 3Q5FA 1STZA 2HZTA 3QACA 1U78A 3O2PE 3H3ZA 3UKNA 5D1IA 4EQQA 4D7TA 1KYZA 1ZRDA 4GULA 3D5LA 5FCCA 2XKOA 4WVZA 5BOXA 4FBFA 1KQ0A 3C3WA 3ZMSA 4HQEA 3FZVA 2B5HA 3HIFA 4XFIA 3H92A 2JT1A 1YFYA 5E20A 4LJZF 3C1DA 1TW2A 1J2XA 4KMUX 4LLOA 2XRNA 1NE6A 4Y13A 2ESHA 4KN4X 1XDSA 3DP7A 5LHIA 4EMSA 2GZWA 5D6FA 4ESFA 4J1WA 4LA2A 2CFXA 5BPDA 2O0YA 3VODA 1IN4A 3ABTA 4YFNF 5DDGA 1C0WA 1EH6A 1YW8A 5KBFA 1FPQA 3PNAA 4IRHA 4K2EA 2XAFA 5E1WA 4Z2YA 4OLLA 5JVTA 4XSXF 3WODF 5FPXA 4RS8A 5FO5A 3L2CA 3KLNA 3OCPA 1MDMA 4YYOA 1CAVB 1TQIA 1BN5A 3L09A 4ZYHA 5HDGA 3M8FA 4KWLA 1Z6TA 5BPIA 5E1XA 3BOQA 2JPBA 2QQBA 3O3KA 4BIFA 2FQ3A 5D4RA 5J6XA 4HX7A 1Z05A 2XHKA 4GGGA 3TO7A 4AVBA 5JHUA 5ERIA 4HN0A 1W7PD 5BS6A 1G6NA 3ABUA 3BJ6A 5L3BA 2PLYA 1L3JA 4KMFA 4U7DA 4M73A 1FZPB 1VTNC 2QJVA 1OPCA 4AIKA 2PFBA 5JR7B 5C6CA 3KP5A 5DD8A 2L01A 2F5EA 3WTWC 4CYDA 2HTSA 4FT8A 4IEZA 2HJIA 1RUOA 4OMYA 1OD5A 2Q4SA 3NQOA 4BHBA 2NS0A 1O5LA 4YIFA 2ESNA 2J5OA 3FHIB 5T3NA 5HS9A 1RUNA 4L18B 4KIGA 1MJ9A 4I02A 5J3UA 1ODDA 2BBYA 4RB1A 1ON2A 4HVQA 1YLFA 2L3DA 3F23A 5CVUA 4TLFA 5CVJA 1UW8A 3I4PA 4RAZA 2KJCA 3GYDA 5A2QK 4MGRA 4G6QA 2FBKA 1LR5A 4XFGA 3HSFA 4NB5A 3QP6A 1L0OC 3MPBA 4KWJA 4I7HA 1GQHA 3CUOA 5DCFA 1YTYA 5CU1A 1O3QA 5IT9Z 1FY7A 2IT0A 2CQKA 1U6GA 2PEXA 2QZ8A 2OZ6A 2DTRA 3R61A 2DU9A 3ZMZA 1YLLA 1V4RA 4KIBA 3MZHA 4N9HA 3VEPA 3HTSB 5AIPA 2F5FA 1R5GA 4MV2A 2B9UA 5LHGA 2MLKA 4Q0QA 4P5OA 3TOAA 2XAHA 1W7PA 2QQ9A 5FFZA 4QGNA 1MZBA 1DGRA 4EM0B 3M3IA 5JI6A 1FOKA 2K4JA 1FC3A 3F6OA 2ZNYA 2Q0AA 3P9CA 3GXOA 4A5NA 3R6SA 3MWMA 1TBXA 3EO6A 4HX4A 2W84A 1ZVFA 4GYIA 4WXCA 4MEXF 3C18A 3HOTA 3SFZA 5F1RA 4BNCA 4NHJA 4YARA 2PAMA 3LWFA 4LLNA 2AS5F 3TOBA 3LA3A 3RYKA 3QAHA 1WKMA 2ZKZA 3BDDA 1J59A 3KEQA 3H9AA 4AVAA 4LK1F 3AAFA 2XUBA 4CZZA 1OMIA 2CWEA 1CX4A 3NSTA 2FBHA 1GXQA 1SD5A 3BROA 4UBGA 2J5PA 3TNPB 4MX3A 4AIHA 1HW1A 5TRDA 4CHUA 4EROA 5LGUA 5BMZA 2VC0A 5E8IA 4O5VA 1U5TC 3QU3A 2ADUA 5HS7A 1MJAA 2EVXA 3EHKA 5E18F 4KU8A 2VC1A 3M8EA 3T0YA 1H9GA 1SFEA 3LAJA 5I93A 2VODA 4KWKA 3F22A 2A61A 2XLFA 1BI1A 2M30A 2VXZA 3OV8A 3GO5A 3TQNA 4CICA 1PUEE 5E1RA 3I71A 3QOPA 5I0RA 4P9UA 1YFWA 4BYYA 2VECA 3G3ZA 1MJBA 1S6LA 3KMHA 1W5TA 2L02A 2VQAA 2DW4A 1Z6RA 1ZH5A 2XLAA 1Q1HA 3EQEA 2Q30A 3VOEA 2M8EA 2O61A 1P4XA 4ASNA 2EAAA 3BZ6A 4XF4A 2VE9A 1J58A 2OD5A 3ROUA 1YIOA 4M6YA 4ENJA 5ILSA 3FMRA 2RQPA 5JAXA 1IPJA 4IEYA 2VBYA 2MNGA 2PFWA 3M70A 3PFIA 4E2GA 3BWGA 3O6BB 3KE2A 3G7DA 1HW2A 5HLIA 4G7ZF 2K02A 5ICGA 1FSHA 2EV5A 4G7HF 3CLOA 1KGSA 2B0LA 3ZP5A 2ACJA 3P9IA 1PMIA 1LKNA 3RKWA 4HN1A 2KIFA 3FZ3A 1FXZA 3KP3A 2R7DA 4EJUA 3B02A 5ILUA 2I45A 4CDGA 4HV6A 2MLGA 3JSOA 1LB2A 4EJVA 4IEWA 5FLXZ 5CVVA 1BOAA 2XROA 4QGLA 3FM3A 1U2WA 5FQ0A 3C3VA 3QPTA 2GU9A 2A6HF 4FHTA 3REOA 3DL3A 1R36A 2PG4A 3SMHA 1XGMA 2RN7A 1QXJA 3K9TA 2DI3A 1TNTA 4MH0E 4A0ZA 1HSTA 4X6QB 4EWAA 3HRTA 2ZNZA 3E5QA 3DPLC 3F3XA 2UYAA 3MCZA 3ML6A 4XF0A 2JPCA 2KXLA 2GA2A 1JHHA 4G7OF 5FQ0B 2H6CA 3CUQB 4IPAA 3ERED 2DO7A 4ONUA 1UFMA 1FLIA 2Z2SB 5E16A 1BC7C 2QBYA 4UV9A 4FX4A 2STWA 2GC0A 2ZXJA 1CAUA 3R0JA 1J1LA 3BCWA 5H6RA 4XLNF 1FP1D 4G6DA 4O9GA 3USSA 4HVRA 2P7CB 2CAUA 4GXOA 2E7XA 2WC2A 4YNIA 5L3DA 3F8NA 1ZHFA 4UNOA 4LA3A 3ULQB 2LF7A 5J7MA 2XLGA 3IKVA 4RB0A 2KKOA 2RVCA 1REPC 3ES1A 2NRAC 4ENMA 2NAZA 4HLXA 1IAWA 2VOPA 5DUIA 1CAUB 3NJZA 2ET1A 3ECHA 2V79A 2PA7A 2KJBA 3V4GA 2OA2A 2KRFA 2HKXA 3TDUC 4LTAA 4EGYA 1XD7A 4BAYA 4EWDA 4Q48A 3NVCA 1VR3A 1TLHB 3WTYC 2IW5A 4G8XA 2DT5A 2ETHA 1E17A 3DN7A 5J48A 3LA2A 1ZREA 1OYYA 4QLCU 5IT3A 1QY4A 2M5WA 1XCBA 2CW0F 2D5FA 2FSWA 2ZFWA 1J0RA 3HUGA 3FXUA 1ZNPA 1DZTA 2DCTA 2OZUA 3I53A 1YFHA 2K86A 4XETA 1HXDA 4XLPF 1VP6A 4YRDA 1PP7U 2LF8A 4MGYE 3M9AA 3HHHA 3IIAA 1JHFA 4E2SA 3LZZA 1MGTA 5CLSA 4OIOF 1WWXA 2V6CA 3GZ6A 1H1MA 4KFCA 3JAMK 1HQCA 2E1NA 2BNMA 3E6CC 2QENA 3F8CA 4O3MA 1K79A 3EUHA 1I1GA 1YW9A 1R1VA 4LLLA 3I0TA 1DUXC 4IEQA 3HYIA 2HGCA 3ZDSA 2DBBA 5KHHA 2WFPA 1F4KA 2EJRA 4A6DA 4RB3C 3FJSA 1Z91A 3ZN1A 1J3PA 2HFHA 2ZMEA 4AVCA 2V1UA 4MTEA 1P92A 1ZRRA 3I7DA 1K6OA 2ZBKA 5L3EA 1D5VA 3FF5A 3D82A 3R60A 5FD5A 4EM1A 3RJPA 3MFKA 1YWKA 4HOBA 4E70A 2VN2A 2YSRA 1CF7A 4ZZLA 4UVCA 1Z9CA 1FWZA 3FM5A 1T0FA 2XV4S 3WTSC 3CO6C 3WU0A 1WLTA 2EK5A 4HDVA 2H94A 2DPUA 2CO5A 4L0YB 5D4SA 1O7FA 2D1VA 3GF2A 4MHGA 3GW2A 4UXAA 1XGOA 1XGSA 3MZYA 2PHLA 3QP5A 4HAMA 3QRFF 1Y9QA 2MA3A 3TO9A 1NZCA 4HYEA 3EETA 1LDJA 2UXXA 1IN6A 2RC4A 4L5JA 4IEOA 4LUKA 2W25A 1RTVA 1HKQA 1QBJA 2Q0OA 3RZZA 4AWXB 5AIQA 2DFIA 4IEUA 2GC1A 2QYOA 5BQTA 4Q0SA 1DPUA 3DEUA 4OINF 4HBNA 2QBYB 1J5YA 3U1DA 1XCVA 4L9VA 4IXAA 1UHMA 1RGSA 1SFXA 2OZJA 1IN7A 2PJPA 5K5QA 4D7SA 3WW3A 4G94A 2DPDA 2JRTA 2CG4A 1OYWA 5BV6A 3DKWA 3HSRA 1RC6A 1H1IA 5J8CA 1J75A 3LOIA 2IXJA 4OMZA 5CVRA 4BXUA 4KL1A 2QDRA 1G3SA 2CSOA 5F6FA 3Q9VA 1NYWA 4EJOA 4XSZF 1X82A 1ONVA 3KZYA 2PI0A 5D5UB 2G9WA 2GQQA 1QNTA 4PIXA 1J3QA 3NRVA 1O5UA 5HDNA 3HOSA 4IERA 4RGXA 5ICCA 1DPRA 1LNWA 2G7HA 3GFLA 4L9TA 5KVRA 3H1WA 2ZO4A 1J3RA 4LB5A 3H8UA 4L2NA 1B6AA 1GHCA 4RGSA 3IDCB 1YQAA 2MH2A 1Z7UA 4N0BA 3KFWX 4DQ2A 4CGZA 1BC8C 1IZ1A 5E17F 3F72A 1UPIA 2FBIA 2IA2A 3BPXA 3VFZA 4KIFA 2FMLA 3SCGA 4Y17A 4AQ2A 2CAVA 1A04A 2UY9A 3CTAA 1QGPA 3KETA 2E1CA 1TQPA 3ZMVA 1WI9A 3SZPA 4A0XA 3HT1A 4MUVA 2GIVA 3C7JA 3KCCA 3ETQA 4Q29A 3E6DA 3EDPA 1SD6A 2FQPA 5I0SA 4PIYA 4Q0VA 2NNYA 1QPMA 1Q5OA 1KQ9A 4M9SA 1YO5C 2IXKA 4A2UA 1Q3EA 4ZU7A 4HV5A 3SXYA 3NEUA 3WW2A 2P5KA 5HOOA 3S7EA 5FDBA 4MEYF 1HSJA 3I59B 3N4MA 2HYGD 1U3EM 5HS8A 3IRQA 1HKSA 3HTUA 3FHZA 4ZU5A 4HF0A 4G9YA 4QX5A 2EFWA 2IXLA 1JUHA 4P9FA 3RKXA 2K4BA 1QWRA 2BNNA 2LKPA 2NYXA 1WRJA 1IXRC 4PDKA 4RGUA 3U2RA 2PMHA 5HLHA 3WTTC 1UIKA 4U88A 4YSFA 1W4MA 1KU2A 3KGZA 2IXIA 1UCXA 2VBWA 3EBRA 2UWMA 5FFXA 3VHRA 3CJXA 5I8TA 4XFCA 1G3TA 1U5TB 2IA0A 1G4DA 4PJYA 2FXAA 1XB4A 1ZRFA 4WCGA 4L5IA 4FAHA 1V70A 5LRRA 4BQAA 3ACLA 5ILVA 2X0LA 1IRFA 2W24A 1RIOH 1TQMA 1GQGA 4LULA 4ZZDA 1PM7A 2P7VB 2OQRA 5KK1A 4ZYGA 3SZTA 5D8KB 2M1BA 4RB2C 4HQMA 4S05A 2ETEA 2BV6A 1T39A 1LDKB 4IEVA 2IC1A 1O3SA 4ESJA 1MKMA 1T2KA 3H1YA 4LUMA 1R7JA 5I91A 3CJNA 5JSOA 2Y0OA 1JXSA 4XEZA 1X7NA 1O7LA 3L7WA 3K0LA 1ZZ6A 4I09A 1FSEA 4P9GA 2ZMEB 2V1DA 1IPKA 5FPZA 2STTA 2EA7A 3SQNA 4XF1A 4BHCA 1XSVA 1T6SA 4HZFA 3SCFA 3LQQA 3BY6A 4ENKA 1EP0A 3BB6A 2OYZA 1LDDA 1J7KA 3D0SA 1S29A 2GA1A 2N7GA 4UV8A 2Q1ZB 3GEZA 5DUKA 2GXBA 2KIUA 1LEAA 3P7NA 2A5YB 4L9JA 4HA8A 4KA4A 2E7WA 2F5CA 2HTJA 2M87A 2FF4A 1LJ9A 2GC3A 1HW5A 1Z1DA 4O9EA 2BE5F 2BYVE 4PGHA 3EJKA 2EFQA 3H7YA 2FU4A 5JR3A 4UBHA 2DQRA 5D6EA 2YX7A 2XVCA 2EB7A 2HQNA 5D5XB 2O8QA 1B9NA 1W5SA 4PCQA 2D45A 3WGIA 5LEJA 3IDBB 1QZZA 2O03A 5K5OA 3WG9A 2V09A 1BI2A 4JVAA 2DQLA 2DK5A 1UCRA 5D5VB 5FLHA 3NKTA 2K9ZA 1TW3A 2PHDA 3U11A 2PAEA 3IWZA 5LBQA 3H50A 3HQXA 1LRHA 2XASA 2KIMA 3GVAA 1YHFA 4ENNA 5ICEA 2P6TA 4M9XA 4TV7A 3S0MA 5D5WB 2YX4A 2D93A 4FX0A 4JV4A 4UXNA 3U9GA 3B73A 4UVAA 3EQLF 1GVJA 4A5MA 1O4TA 4MQVA 3HRUA 1RL3A 1F5TA 4I01A 4HF2A 4DINB 4UUVA 3O14A 3BJAA 1BIBA 4QXKA 1XMKA 5EEHA 3JSPA 2HDCA 3BALA 2DLLA 1EPZA 2VBZA 2GC2A 4A12A 4UHTA 1BJAA 2W85A 1SFUA 3CL1A 1TNSA 3KZZA 3MQ0A 4QWQA 3FX3A 1QO0D 2GXGA 4LK0F 5HVQC 2PMUA 2IPQX 3CDHA 1LQ1A 2A3SA 4WXDA 4AQ6A 5CYVA 5FD6A 3G73A 1IF1A 1NXMA 2XGXA 3J81Z 4K8FA 3I59A 3QU6A 2FNPA 1IXCA 3DF8A 4U7BA 2LDUA 3V8KA 1ZRCA 2Q2EA 1FI2A 4NVPA 1VJ2A 1ZGAA 2R3SA 3NL1A 2QQAA 2ATFA 4AD9A 4GO1A 1SAXA 3U10A 1H0MA 2Y48A 3L00A 4AVPA 1U5TA 4O6JA 4EGZA 4M9ZA 1WSUA 1ZN2A 5K1YA 1I1SA 2Z5UA 3RYRA 4LFUA 4WZCA 4NQWA 1X8EA 5LLQA 1W7PB 4A0YA 3T1BA 1OI6A 4Q4ZF 1F9NA 3ES4A 4Z82A 3WGGA 4EVIA 3ST7A 3IWFA 2E9QA 3R4KA 4L0ZB 3WW1A 3V7RA 4QMAA 1G3WA 4YFXF 2LNBA 5BY5A 3CEWA 2XIGA 4ETSA 5A2QZ 4I2OA 4IEPA 3GFJA 5IT9K 1DDNA 1JE8A 1USSA 1USTA 5DCMA 3RKYA 3E97A 4L9NA 2JSCA 4U0WA 3HSEA 4WF2A 3CO7C 1XGNA 4ZU4A 1KU7A 3TDZC 3LSTA 3LAPA 5ED4A 2O8XA 3MYXA 3TGNA 1EV7A 2A07F 4ESBA 4IRGA 1SQ4A 3UKTA 2OQGA 4IHSA 5LHHA 1KQ8A 4HLYA 4J1XA 1D3YA 4HVOA 2MBFA 2Z3YA 3PLQA 3ZQ7A 2BEOA 1YS6A 2MD5A 1FYMA 5DV5A 3CF6E 3E6MA 2L54A 2D5HA 3OOPA 2HR3A 4D0PA 1B9MA 5E1ZB 1WGPA 1SMYF 4IJAA 2HWVA 1H9TA 1YW7A 3KP4A 1FP2A 1S3JA 4OIQF 1SD4A 5L3GA 3L2HA 4RD7A 4WWCA 3S7IA 3FXRA 2QM3A 3IBMA 4ZH4F 1TTYA 2Y75A 3R0AA 4ON0A 1FNNA 1KA8A 1X3UA 3J80K 4QGMA 4WK8F 2XAJA 3DFGA 3RDIA 3E3VA 1Q43A 3DXJF 2OAZA 4HF1A 1YYVA 4YIIA 5KHIA 3RTRA 4QM8A 2CV6A 4WBBA 4XFBA 3TNQA 1RI7A 4IHTA 4MGZE 3TKYA 2K7LA 5CJ9A 1R22A 2ZKLA 1I27A 2Z99A 3SXWA 1NE4A 2H09A 1YUDA 5I8YA 1PP8F 3I64A 3CO2A 2DK8A 3F8BA 4N9IA 1CAVA 2ZJ2A 3CUQC 1TQ5A 5CVIA 4LB6B 2BGCA 2VT2A 1B4AA 4XFAA 2Q8KA 3FWEA 3OF1A 3GFIA 2YPRA 2PN6A 4KYWA 3HRMA 1WQ2A 4L11A 4BHPA 4CXFA 5ICFA 3H1MA 3I5UA 2DAOA 4KT5C 4LG0A 2FE3A 1ZZ8A 2X4HA 3FE5A 1F1ZA 4PZJA 2PAKA 3P9KA 2XL9A 3K1MA 3F21A 3OD0A 1XSDA 1OR7A 3ZMUA 4HMZA 2EA2A 1EY2A 4P55A 3FFQA 4ZYEA 2IXCA 1ZG3A 4B8XA 1FYKA 2QWWA 1FT9A 4GYGA 5DYMA 1YG2A 1V3FA 2IA1A 1CAXA 3GZ5A 3FMQA 3K2ZA 4RAYA 3OTFA 4AXOA 4OOIA 2HS5A 1UHWA 2QUFA 3F8FA 2EA4A 2FA5A 1ZG5A 5J8FA 3FMSA 2P5LC 2P4WA 2MC3A 4R52A 1PDNC 3RI4A 1O3RA 3T8RA 4M6XA 1OKRA 1P4AA 2QCSB 1BM9A 3E5XA 3COAC 5I0UA 4MZUA 3KP7A 3IC7A 1QXRA 1S7OA 4H0EA 3WU1B 1T38A 1DZRA 2IVMA 4LLGF 1XE7A 2HEOA 4H7LA 4MGKE 1B1BA 2G7UA 2P5VA 4F8AA 4KNYA 1WA4A 4ORFA 2GAUA 1UB9A 2ZCWA 1ZX5A 5JCTA 2OBPA 3M7GA 3CUQA 3RPUA 5D8LB 1KYWA 4XFHA 5EFUA 3J7AO 2FMYA 5JSPA 4HW0A 4LD5A 4OIPF 5KHGA 3RYPA 2YR2A 4HDUA 4FAGA 2MPFA 3KEOA 3CLPA 1LEBA 1YFXA 1OFNA 2IJLA 3WTUC 2WWYA 3WGHA 4B29A 4KU7A 1FYLA 3BPVA 3RIRA 4OU0A 5F64A 4P96A 3WE2A 2IXHA 3KLOA 1BI0A 5EZWA 3GBFA 6PAXA 2F4PA 3KGLA 3KP2A 3GLXA 4EWEA 5K5RA 1YFUA 3V7SA 1SD7A 1R58A 3U0ZA 1FX7A 1ZGJA 2A68F 4JTOA 4KUMA 4R79A 3N97A 3JAMZ 3IKTA 2QVOA 3JTHA 4QM9A 4JTNA 4XFFA 3LFKA 1UIJA 1I5ZA 4LGWA 5HDKA 3ZMDA 2D2WA 3ISPA 5AVPA 1RZ4A 4EV0A 1IN8A 1XMAA 2IP2A 1B59A 3LQRA 3DQVC 1CGPA 2PQQA 2RV8A 1R1UA 2HKOA 2PBIA 2RKHA 2F2EA 1L3LA 1EH7A 1P6RA 4IETA 2JTVA 1ZLJA 5FGMA 1XN7A 3LA7A 1ZZCA 3PVBB 1QQIA 3KSCA 3ECOA 3DPTA 3ELNA 3RNSA 1D8JA 2UZKA 1U12A 1XE8A 4DNCA 3F8MA 2CYYA 3V8JA 1YS7A 4IVNA 1CAWA 4IRIA 2BNOA 3DV8A 2OA4A 2VPVA 2PYTA 4BH9A 5H6QA 4WX9A 2RNJA 2EWNA 1ULYA 5EEGA 4ZYDA 3V7CA 4U0YA 4Q0PA 5JSRA 1O3TA 1I6XA
chains in the Genus database with same CATH superfamily
4AWDA 3H8RA 5EV7A 4A6EA 3OPZA 3NKGA 5I0TA 1I3QJ 3GUDA 4IEXA 4MXVA 1ETWA 2X48A 3FKJA 1P7JA 2NNNA 3MW3A 1V55H 1W0TA 2QNKA 1J84A 3RSNA 3ACIA 2C1FA 2LALA 5BPXA 3V0AA 2Y0IA 3M3YJ 1XNCA 5JFRA 1ULCA 1AF9A 2WV0A 3H7JA 4BY1J 3SDGA 1G9DA 3AZZA 2X6YA 2JE8A 4WV8A 3PUHA 1EAH3 2JZYA 3CU7A 4QX2A 2WADA 2JDPA 5FKCA 4M71A 4PQ9A 3N7JA 4JDMA 3I3QA 4DRVA 3H35A 2MGQA 4UVBA 3TWIA 2EZKA 1RUG3 2MHFA 2Y0MA 3ZFEC 3GWZA 1HXS3 2XAQA 3RCOA 1MEC2 2M45A 2XSJC 2QQKA 2WNEA 3WTXC 1DU6A 3VD9A 1CAWB 1LU2A 1Z3YA 2GNTA 3WG1A 3NW4A 4XF9A 4JKKA 3S3MA 2L4MA 1R082 1GXPA 3U75A 5A7PA 4M74A 2UYBA 1XU2A 1BJQA 2RS13 4HOOA 1AOYA 4FTSA 4LKEA 5A3NA 1IRGA 3C7FA 2ZB9A 3GYHX 3SHFA 3H9QA 3GHNA 2K9SA 3PQKA 4M3CE 2RM23 2CQQA 2JRMA 1DCSA 2CGPA 2NP0A 2RDPA 3OEAA 4RA2A 1ZZ9A 2IGNA 1ZYRF 4KQ7A 5FZKA 2WB1A 5FYZA 1HKTA 2W47A 4B4RA 2PTMA 2Y6FA 4MSVA 2PQ8A 2Q8CA 4BKXA 3G4SI 1QJY2 4NIHA 2OW4A 3QPHA 2RDSA 2AHQA 4CO8A 4BOWA 5F32A 4W8JA 1MQTA 1RXFA 4FO9A 1NCQB 3A1YA 1VBD2 2LBFB 1SBEA 4PT6A 3I58A 1BI3A 1JODA 4BMEA 4MG2A 1X3ZB 1DHKB 4EN6B 2ZEYA 2GSYA 1HDDC 4NIAA 1PGSA 5KHJA 3WT3A 1RNLA 2CJJA 3FXQA 4XDQA 4I98B 1DP7P 4XMIA 4DS0A 1RUD1 5J40A 2NVYJ 1Y0UA 1N47A 1ZBA3 4ARYA 1S7AA 1RUI1 5E89A 3OUHA 1UELB 5LRSA 4BY7J 1AJOA 1LENA 5FLIA 2RGVA 2PLV2 2VE8A 4PGGA 4D7NA 2J22A 4DOUA 5JOZA 1B8IB 5BXXA 3F2ZA 2HDDA 1QZYA 2F5DA 1W9FA 4NNJA 5JOXA 3LIGA 4AIJA 3RGBA 3K4DA 1LVKA 3ZFGB 3KVBA 2UUZA 2QLZA 1WFXA 2VC9A 3RKQA 1LHOA 1MD0A 1IW7F 1BMV2 4WM8B 1SANA 2ISYA 1RUC1 4JGYC 3D3AA 1ACIA 2VKHA 4I3PA 1FBUA 1MDMB 3GFMA 1DFQA 4RGKA 3DPRB 2LSOA 5DEQA 1K78A 3CQZJ 4UY8I 2D6KA 4CEYC 1T8IA 1C8M2 1J9IA 2ID4A 4KMQA 2CW7A 3F6VA 3QPSA 2JKXA 3L2RA 2BBVA 1O57A 1I39A 1HV1A 4W6WA 3BJOA 3OL3A 3ZXKA 5C9AA 1AXKA 4QX8A 3IRRA 4RGRA 5LEKA 4A45A 3K3OA 1U8RA 1R5HA 1ZA7A 3WW4A 3WXPA 2HQRA 4PSXA 1F9KA 1K5MA 1NLRA 1C4RA 3UKNA 2G4IA 3BR1A 2YXSA 5D1IA 2X10A 1ZRDA 4GULA 2E63A 5EIYB 2VBBA 4TTGA 2G1MA 1HLVA 4FBFA 1KQ0A 4MVTA 3A21A 2C9AA 4HQEA 4XN3A 1NQDA 1SAUA 4KJZA 2B5HA 1OKQA 3J8F2 3HIFA 3KWVA 4UI9L 3C1DA 2ZGNA 1HDKA 4J00A 3KZIC 2OJED 1PO22 1WJFA 2NVXJ 3DP7A 3CJQB 4CDXC 2DU1A 2MFZA 2ZZJA 2K5CA 4LA2A 4BK4A 3HB9A 1UYYA 2XQXA 5BPDA 1UOBA 3VODA 1XNTA 5C70A 3ABTA 2QFEA 5FZ0A 4AFDA 4YFNF 5DDGA 2FHRA 4LG3A 3LFMA 2X6OA 1LU1A 1W1WE 4QTRA 3THTA 4DB5A 3PUIA 2R072 1B35C 4XSXF 5FZ6A 2BW8A 1TC3C 5FPXA 2ZGUA 4PBOA 5FPAA 3OCPA 3RQ4A 4YYOA 5KXBA 2JG8B 4TXWA 4QXCA 3M8FA 2CUFA 5B3SH 4XHBA 3EMRA 3D5SC 5AC91 3AL5A 3CF5F 2PHXA 4BIFA 4HX7A 4M3CB 1QPIA 3BTAA 2J1VA 5ERIA 5L3BA 1VBE3 2ORZA 2LKSA 3APBA 4U7DA 5FY8A 3N9QA 4M73A 2R7RA 1FZPB 2QJVA 2VMDA 5A1AA 3KP5A 5B1AH 4YELA 2L01A 2QQOA 1VRH2 5FWJA 3WTWC 3M3OA 3VLBB 1QVUA 4M4PA 4FT8A 3WNLA 2R93J 4OMYA 3NQOA 2NPIA 1DBNA 2WO7A 1IV8A 1V5EA 4G12A 4AYUA 4A3IJ 1A35A 3FHIB 5T3NA 3MN2A 4UFMA 2W92A 1RUNA 3PJYA 4KIGA 4NN0A 5J3UA 1N25A 1ODDA 1YLFA 5CVUA 5CVJA 2OCEA 1UW8A 2OKXA 3I4PA 5GLZA 2EH3A 2KJCA 2FX0A 2WQ4A 1C8NA 1EUTA 1PO11 1L0OC 1M4WA 3DPRC 4AQSA 5EYRA 4FTHA 1K61A 3KD4A 1YTYA 3WHCA 4BDYA 5JXIA 1FY7A 1HB4A 4QPIA 3AKQA 3ZMZA 2XXZA 1Q8OA 3VEPA 3AMPA 4NHXA 3HTSB 3ZSKA 3G6EI 1W05A 1DGRM 2DTYA 1RUH2 4P5OA 1TT5B 5FFZA 3IT8A 3ACFA 2DDUA 4EM0B 1HLCA 3FHQA 2ZGRA 5IAXA 5FXZA 1FC3A 3F6OA 3M3EA 2ZNYA 1WCMJ 2K9MA 2CTVA 2VCCA 2W84A 4IX7A 4GYIA 4WXCA 2DBIA 5F1RA 4NHJA 1E57A 3SEEA 3TOBA 3LA3A 3UGFA 4U2AA 2VG9A 1WKMA 2ZKZA 3BDDA 4KGGA 3QPLA 3CMGA 4EN9B 2X1DA 2JE7A 4LK1F 3AAFA 1JI8A 2ZC2A 4G3YC 1TWAJ 2Y9ZA 1H8VA 1UMHA 2KA3A 1SD5A 4K9SA 3AP7A 2RR11 3V64A 2BZDA 4MX3A 1HW1A 4CHUA 4BLJA 5E8IA 4MXWA 4CCCA 4O5VA 5A7OA 4YRVA 2IXSA 5HS7A 3QD6A 3GMEA 1RUC2 1AR61 5L73A 2L0KA 4KU8A 3HNYM 3IV5A 3K77A 3I3DA 4NAOA 3M8EA 1QJX3 4II2A 1FV2A 5EZGA 5FZ3A 3CCMI 1SFEA 2YMZA 2MEV2 3F22A 4KWKA 4CDUA 2JA6J 5IVEA 2L9NA 2EXKA 5A32A 3W58A 3WDTA 1C1LA 2V4AA 5IK8A 1XC5A 1V5GA 2XGEA 1UMQA 2HVSA 2UWAA 2GN3A 4GRIA 4FPJA 2VJIA 1QH7A 2XBO1 4BU2A 3KMHA 1IS5A 2L02A 2IUWA 5IK4A 5LD2C 2WFF3 1ZH5A 3EQEA 4QSHA 2G19A 1GWKA 3VOEA 1IKPA 3OYWA 2O61A 1ZBA2 4ASNA 1OH3A 3H8OA 4MHUA 1J58A 1HN0A 5GAGJ 2X09A 3HZJA 1YX3A 2ECCA 1FNYA 1JGGA 1PO23 3WNKA 1LEMA 4AF9A 1S55A 2W3JA 2VASA 3PFIA 1DU0A 3C8XA 3W2VA 4N4NB 5FKNA 5HLIA 4CU8A 3GTKJ 2K02A 3ZN4A 3JQWA 1KGSA 4PDWC 5IFTA 2ACJA 1BHGA 3BYWA 1LKNA 1WBLA 2KIFA 3FZ3A 4L9BA 1QJY1 3B6CA 4QXBA 3LOBA 3B00A 3MICA 4HV6A 4XKCA 4XAAA 4XURA 1LB2A 4EJVA 5FLXZ 1BOAA 3VHNA 1H30A 1U2WA 3VBFA 1KRIA 2A6WA 2KLOA 4FHTA 2XWBB 2PG4A 3W5NA 3PUFA 3SMHA 3VBFC 1J1TA 4UFKA 1XGMA 2RN7A 1QXJA 2DI3A 1IS4A 1TNTA 2DJIA 1OQDA 4X6QB 4EWAA 5FO9B 3E5QA 4LIVA 1EA3A 2V4JC 2W1SA 1H9WA 5BYNA 4XR6A 1DP3A 5K0UA 2JPCA 5FWEA 1VZ0A 1JHHA 4G7OF 3HPHA 3HNMA 4E27A 2P3IA 4IPAA 2DO7A 4ONUA 4FOYA 1OC1A 4DZPA 2ADDA 5LK7B 1BC7C 2STWA 2DCZA 1JU3A 1RR7A 1VAMA 2JUCA 1CAUA 3R0JA 5H6RA 4GALA 5IP7J 1VBA1 2X53S 3USSA 4HVRA 4PJLA 1DQ4A 3A0NA 2E5ZA 3F8NA 3B9IA 1ZHFA 1J83A 3DU5A 1VBA2 5DDJ3 5KCMA 4RB0A 2KKOA 1REPC 4HLXA 4QT6A 3QBQA 2ZS6B 4HK9A 1TME2 2VOPA 1QJZA 3K2OA 3KX2A 4CCOA 1XQNA 5A6ZA 2O0OA 2LY9A 4YZ4A 2VJ5A 5E6HA 2JDZA 5IVFA 4UT5A 1RB8G 1XD7A 1Z77A 1YQ2A 1OVPA 1YE9A 4N4OB 3T4VA 1S0FA 1MVEA 1OYYA 4RM2A 1QY4A 4RR3C 2CW0F 1JOBA 4RAGA 4CZSA 1UYXA 4A3MJ 1QA6A 1U5IA 1WLWA 3TBDA 1SVOA 1ZNPA 5FKKA 2DCTA 4A3KJ 1OOPB 3MF9A 1YFHA 4L0PA 2FDHA 1W04A 3GCXA 4XETA 4D6QA 3WCSA 5K7PA 1VP6A 3K10A 2LF8A 4IV3C 4CUBA 3MGUA 3ZOBA 3M9AA 2QQPA 4Q4Y1 5F5IA 1JHFA 4E2SA 5JI7A 5LBBA 4KFCA 2VQCA 4C2TA 3QODA 3E6CC 3LSKA 2GLOA 3OY8B 1CJPA 1DUXC 1JOJA 2HWF1 2FDIA 2K9QA 3Q0UA 4BWOA 4UYBA 3K75B 2YU9J 3HYIA 4HNVA 3FL7A 1FMD1 4CCKA 3RMXA 4D6RA 1ZRRA 2VQ0A 1RHI1 3WF2A 2ZBKA 3AYAA 1FTTA 3D82A 5FD5A 4CA9A 4DMIA 3OYWB 3S93A 4I6ZA 1LECA 5E3NA 4HOBA 2LD5A 2QQ8A 1B35A 2VL4A 4C0BA 3SKJE 3JU9A 1VQ6I 2ZBJA 5ISLA 4A3DJ 2R071 5A7SA 2XBO2 1WJBA 3WTSC 2ZMNA 5LFAA 3BZKA 3IP4B 1T0FC 1GICA 4L0YB 3VKLA 4FOVA 4UXAA 3MZYA 5M5YJ 3QP5A 1A34A 2MEV1 4PDWA 5L19A 4R4ZA 3UYJA 2YUSA 4XQWA 3POIA 1ENHA 3HD8B 4JQTA 2W25A 1RTVA 2KM2A 1HKQA 3HOZJ 1Y43B 2XQRA 1SDDB 2X1EA 1JZ8A 2K46A 4AWXB 2DFIA 2GC1A 4CDQC 3ON7A 4OINF 4XLFA 2QBYB 1J5YA 3MLLA 2XVKA 2VJ4A 3VKNA 4IHVA 1AL23 3ASIA 4OHZA 2ZX2A 4DZGA 4EN0A 3BQZA 3KHCA 4GB31 1XSRA 1ND3A 5EYYA 2RMU1 3BR3A 5DDJ1 3QWLA 4M3BA 5A7QA 4ZHNA 3WW3A 4G94A 2JRTA 2DPDA 3J7YJ 2CG4A 1BQPA 5BV6A 1H1IA 3DYOA 3LOIA 1IJWC 4P08A 3OG2A 2JG9C 1NYWA 2XHNA 4EJOA 1D2SA 4W1UA 3KZYA 1RMU3 5KWRA 2M9HA 2P4EA 4BL0B 1X33A 2JX9A 3KQRA 5GZCA 2G9WA 4XZUG 2GQQA 1J3QA 5ICCA 1DPRA 3LGRA 1LNWA 3UGHA 3C7OA 2YS9A 4LB5A 3H8UA 4XE9A 4L2NA 1B6AA 1GHCA 5JZGC 2MH2A 3VDCA 2HWE1 1NH3A 3I4IA 1NG6A 4LK7A 5L9BA 4XONA 1BZWA 1UPIA 4J6GA 2IA2A 3WUDA 3G1MA 5EYXA 2FMLA 4Y17A 4AQ2A 2CAVA 2RS52 3WQ7A 1A04A 3U78A 1QGPA 2XPUA 5IVJA 3CP2A 2XWJB 3SZPA 4A0XA 3HT1A 4Q1PA 4LKSA 2LVSA 2VMFA 2ZXIA 2WB1N 2Z5WA 4CDWB 1VQPI 2FQPA 2V4VA 1X1PA 2DFEA 1NX9A 5CFDC 4LE4A 2DA7A 1B72A 2E34A 3HJRA 2W87A 2M7AA 3PL8A 4A2UA 2IGKA 4ZU7A 4HV5A 4PJNA 2GNBA 3NEUA 3WW2A 2NS7A 1YOVB 5FDBA 3BG6A 4MEYF 2JG8A 2VXRA 3I59B 1PGL2 3CDIA 2HYGD 2RM22 1HKSA 1PM4A 3HTUA 2JK3A 2BERA 3FHZA 3DF0A 4G9YA 5E88A 3SH3A 1SVMA 1XB9A 2IXLA 2CQNA 3T09A 3R0RA 3RKXA 2RM21 1FV3A 3DYPA 2LKPA 3I3EA 4Q4X1 5JDBA 2PMHA 4U88A 2E1MC 4M3CA 3KGZA 2F6CA 1WLCA 3HEFA 2UWMA 2Y0SN 4G6TB 3CJXA 1OURA 2FXAA 3GTLJ 1XB4A 4DIQA 3D1NI 3AG4H 4I0WB 5C3RA 3QQAA 1HIXA 4IOCF 3ACLA 4UF0A 4DYQA 5H9SA 3UJQA 4COUA 4M0HA 5TISC 4N43B 4ASMB 1RIOH 1CIWA 1TQMA 1US2A 1PM7A 2RJLA 1Z3XA 2P7VB 4LJHA 3AVRA 5KK1A 3GCMA 3ZXEA 5D8KB 4RB2C 5FUPA 1FAYA 2WRAA 2F48A 3KYDB 2HWB1 1LDKB 2IC1A 4FPFA 2JDKA 1MKMA 2ARXA 3H1YA 1QJU3 4LUMA 3LPFA 1XSQA 5JSOA 2QSGX 1O7LA 3ZYRA 3K0LA 5IATA 4PF5A 3PO2J 2XC7A 3ZQCA 2VZVA 5C7GA 2HWB2 4LO5B 1CESA 4PHZA 2IFWA 1IPKA 2RS12 3I2JA 4CH7A 2STTA 2D43A 4MFDA 3CCQI 3WU2C 2GXAA 3SCFA 2VQGA 3LQQA 4FETA 3UT0A 3BCAA 3BB6A 1YO8A 2OYZA 1LDDA 2EINH 2IGOA 5GKAC 4NRPA 2PN5A 2ZEXA 1Z7LA 3PMSA 2FMDA 3M2MA 3OPTA 3KIOA 3P7NA 3I97A 1D0GA 2Q1FA 2A5YB 2BW3A 5DG2A 4O61A 1NY71 4HA8A 5FREA 5EJCA 1VQMI 1KS4A 4UOJA 4ABZA 4LHLA 1JZ2A 1WD4A 1HW5A 2XJTA 4O9EA 2XPWA 4S2FA 3MUY1 4CCLA 1MBGA 1SHWB 2DQRA 2DFHA 4M6VA 4AGVA 1ODNA 2BRTA 1B9NA 3ZN6A 4LIUA 5JI9A 2JQ7A 1W5SA 4PCQA 2CW8A 2X29A 1V00A 3IDBB 1XTAA 1H2MA 3ZYBA 2HWD2 1BI2A 4F92B 3PHMA 2JKBA 2RAEA 3ZFGA 3BG7A 3PIGA 3VD5A 4N7UA 5D5VB 2R7OA 3IKWA 3NNMA 4XIDA 1W8FA 4UW6A 4YGEA 3U11A 1JN2P 2E2HJ 2PAEA 1WKYA 1KITA 2GNDA 3HQXA 2IAIA 3BG9A 1PIV2 1PX4A 1RMU2 2XASA 2WLPA 2LK2A 4DXZA 1VLNA 2WNUB 5T52A 3S0MA 2L2OA 4YFWA 4FX0A 2ORXA 2RV9A 2JDMA 1GOGA 2DFBA 3U9GA 3B73A 4BZ4A 1UXXX 1QIQA 1AX0A 1RL3A 2O8OA 1MS5A 4I01A 5FK8A 1K5MC 3MIBA 3VYSB 3WP3A 1W8UA 2ERFA 1XMKA 4K3UA 3JSPA 4CP9A 2VBZA 4ZDPA 3VDDB 4A12A 2ADEA 4UHTA 3O1SA 3I3LA 1SFUA 3CL1A 3MQ0A 4AI9A 3FX3A 2VUCA 4IV1B 3WDWA 3RWNA 5BNOC 4WXDA 4FPGA 4AU7A 5FYCA 1MBHA 3G73A 1IF1A 4FOWA 3J81Z 2RS33 4K8FA 4H14A 5DMYA 2L9VA 3L2WA 2RVAA 2KRHA 1N1TA 1RUF3 2JVHA 3HN1A 3NL1A 5EJ1B 4AD9A 3J7MA 1SAXA 2RDRA 2LC2A 1RITA 2YDEA 2FDGA 3U10A 3V56A 5D8AA 2XUEA 1VBC1 3PIJA 5A3PA 4M9ZA 5K1YA 1U5YA 3JR9A 4FQ4A 3ZKYA 4LFUA 4WZCA 4NQWA 4AGRA 1X8EA 2A6ZA 2X5IA 4A0YA 3ZQLA 3ES4A 4Z82A 5TGTA 4HXCA 3IWFA 4WZFA 3R4KA 3CKHA 3NNGA 5J1XA 3WP5A 2LNBA 2XIGA 5IOYA 1IOAA 3RI8A 4IEPA 3OS2A 3GFJA 5IT9K 1DDNA 1JE8A 3HMYA 1USTA 4IE4A 4HFSA 3E97A 2ZZQA 2DMTA 1OCTC 3HSEA 4WF2A 4RQPC 4N53B 1XGNA 1UZCA 3THDA 1H0BA 4IGPA 2O8XA 1LOAA 3K4CA 4NE9A 2A07F 5LBFA 3V65A 4ESBA 4IRGA 3UKTA 1QJU1 5FZ9A 4Z2WA 4HLYA 4O65A 4XNFA 2Z3YA 1FYMA 5DV5A 1A5JA 2HR3A 2UURA 5E1ZB 1NCRA 1WGPA 4OUSA 2EXHA 2V73A 4WVVA 4B3NA 1FNZA 1YW7A 1VF9A 3KP4A 1NY72 3AP4A 1S3JA 3LQCA 4XYXA 2XB0X 3PU3A 3PSFA 3OIOA 5BNGA 4ZH4F 1TNFA 1BR2A 2ZJCA 3GTPJ 2WZPP 2Y75A 3SISA 3GBWA 3R0AA 2FDKA 1KA8A 4QGMA 1FIPA 1PMHX 2CDPA 2NN8A 3PTRB 2OC6A 5KHIA 3IAPA 2MD0A 3RTRA 4QDRA 4ZC3A 4AEMA 1W6NB 2CV6A 2VIXA 2E51A 2DUPA 4KGQA 3PNYA 2QQLA 2VXDA 2K7LA 2D7FA 1C5HA 4IL6C 5FFOC 3OYJA 1GT0C 1CQ9A 3F8BA 2P2KA 2ZJ2A 1LHUA 3ZVXA 4WVMA 5CVIA 1UG0A 2AEZA 1B4AA 1V6KA 2Q8KA 3CZUA 1R4NB 1O8SA 4FI9A 5F3EA 2OPTA 5FXXA 1WVRA 2VO5A 4YGCA 4P9LA 3CC4I 4XACA 4BE1A 4CXFA 2D3RA 3WNXA 2HBUA 5ICFA 1XNAA 4A3XA 5CG9A 1ZZ8A 3RJ2X 2WA0A 3OPWA 1JMUB 1VMJA 3K1MA 3OD0A 1H8AC 3J9SA 1GZTA 3U1KA 1Z7S3 3WP4A 4YG0A 1K42A 1F5JA 4RLQA 4ZYEA 2L9LA 4DO0A 1JZ6A 2IA1A 3GZ5A 1A8DA 1BEV1 3K2ZA 4RAYA 3AXDA 1RUE2 4XQFA 2HWE3 3F8FA 1RKWA 1O6UA 4E4HA 4FQGA 5J8FA 3I3MA 3OBTA 3W2AA 2P5LC 1NG0A 3ILRA 2HYJA 3RI4A 1D4M1 1REDA 3T8RA 4JKLA 1UL9A 4A3JJ 2A6TA 4MZUA 3IC7A 4JP0A 4H0EA 1EJ9A 4FCAA 3X29B 3LKJA 4AI3A 1V9U3 1UWWA 2CWMA 3POSA 5FYSA 3BOPA 1DZRA 1Z7S1 2IVMA 4LLGF 1ALYA 1OLQA 1XE7A 1UNBA 2W1WA 2HEOA 3CHXA 1HJGA 2VUMJ 3HKZA 2QZ3A 2QQJA 4XQ4A 4Z1VA 4QX0A 2XR4A 4KNYA 4IQJA 1WA4A 3ZFFA 2GAUA 5JCTA 3M7GA 3HWJA 4CDUB 1N1YA 3CUQA 2A75A 3N7LA 5EFUA 3J7AO 4CYCA 3T30A 5JSPA 4ATFA 3U4XA 3BTZA 5GLWA 3RYPA 5JXGA 2GMEA 3AC0A 2HEWF 3KEOA 5T54A 4CDQA 4B4PA 1ULOA 1F2NA 4X8PA 4PLNA 1W6OB 3IH3A 2E71A 1YRZA 4B29A 4AW7A 1U8BA 5F64A 1OOPC 2QQWA 3OBAA 5DZGA 2E2IJ 3GTGJ 1B35B 5A7WA 1W90A 4XLEA 3GLXA 5IJRA 3NWTA 2WN2A 1RUJ1 3V7SA 5J96B 2A68F 3Q8AA 4R79A 4ZXEA 2KRCA 1HRV3 5JLVA 5KAIC 1BVP1 4DYRA 1U0JA 1OVSA 3IKTA 5FZIA 4C2MJ 2DVGA 2XB6C 1JH5A 1ULEA 4QKDA 3NV4A 4LGWA 3WHBA 4DW6A 3I2OA 1D0YA 3C2GA 4AM3A 1RZ4A 3LQRA 2PQQA 3HKZN 1R1UA 3RJRA 2HKOA 2PBIA 4Z92B 4IHXA 2QQVA 2HOSA 1NLQA 1KQRA 1EH7A 1P6RA 1R1A3 5JLXA 3PVBB 1ZZCA 1QQIA 3KSCA 2DOEA 1HRI3 3ELNA 5CKMA 3U14A 1ZKGA 2E6VA 3F8MA 3FBYA 1MZ5A 2QBXA 2J7MA 4IVNA 4XABA 4AI2A 3D6EA 3MKYB 2EIKH 1LOFC 5FIXA 3S17J 2ENRA 5A3MA 2PYTA 3AJZA 1Y0NA 5EEGA 2WY8Q 3OR1C 4Q0PA 5FRAA 1IV6A 2B4KA 1TG7A 4F83A 1F15A 4KT6A 4NHYA 4CEWC 4XZPA 3I3BA 3OYIA 2ZPXA 2AENA 1ZAOA 1DP0A 2AUYA 4OWRB 2VNVA 2X1CA 1SVLA 1XYNA 2R7SA 1QJY3 3H3UA 3GX4X 5HLGA 3H42B 4TN7A 4OFGA 1AR62 3OGRA 1FBSA 4CCNA 4IUGA 1S8NA 3KCYA 1GZWB 4KNCA 2YU2A 1W2TA 3KPHA 4Y4YA 3MDPA 1V9U1 5CNAA 3VB2A 3MMYB 1KDMA 2Z9OA 5DQ0A 1MBKA 3OYAA 1MQTC 1R00A 1S5LC 2FNAA 5TJJA 3ZMTA 4H7MA 3M1HA 3IMNA 1KU9A 3O0XA 2GWRA 4JBAA 1WCDJ 4EZHA 2GOMA 5A33B 3I2IA 4M3GA 2R043 1K7AA 2VZRA 3DCFA 3ZR6A 1IGNA 1JBCA 3C2UA 4BUPA 2OU2A 3VBUA 4OHYA 4YFKF 5BNNC 1FATA 5H20A 2QVSB 3DTKA 1UXZA 1ND2C 2Q8DA 5E8GA 3HOVJ 3N9NA 2I5UA 1K78B 4Y33A 4BJTA 2XKPA 3HRSA 2ZGKA 3ZYJB 4MGIE 4BB3A 4R9BA 3SITA 1W6QB 3WE3A 2P6SA 2Y30A 5C4JJ 4QPGB 2V9VA 4MTDA 2JA5J 1UYZA 3KS7A 5AONA 4TWTA 4YGBA 2WSVA 1VQ7I 3ILNA 1PO12 1ZZ7A 4MO7A 2M8GX 2O3FA 2HWD1 1W9SA 1ENSA 1WLDA 1IKQA 1VBD3 3I54A 4QHZA 4XCAA 2JUGA 1HOMA 1ENRA 4CEWB 2H1KA 1X19A 1EYBA 5FYBA 4YG2F 3J80Z 2B8MA 4XRFA 2EV0A 2TDXA 1PIV1 3KP6A 4NC7A 1WJCA 1T6GC 1CAXB 1R1TA 4HBLA 1QU0A 1TL8A 3E6BA 1SLBA 2XGCA 2E32A 3QH7A 4AYBN 1H89C 4HSJA 2NYYA 3K46A 4SBVA 1US3A 4FP2A 1UU6A 2ET7A 4URTA 3Q9SA 5DM7F 2RQQA 5FZCA 3M3CA 4DUWA 1F43A 2VD7A 2X05A 1T98A 4A7KA 3WTVC 2XAGA 4WXHA 1AHDP 4IESA 2VOOA 4GWIA 4EJTA 4E7KA 1E2XA 5H9QA 1XSXA 2UWBA 2WV1A 1QKQA 2W57A 4CCEA 2A69F 1HX6A 2WAQN 1DF0A 1DGWA 2YC2A 3PVNA 4R1HA 1NCQC 5FLXK 2EF6A 1RKTA 4GCVA 3GF6A 1COV1 1TWCJ 4META 4HPQA 1QGLA 5IYYA 4MNUA 3RZKA 1OYIA 4XUQA 3HHGA 3VYTB 4B09A 1O4YA 3NARA 2VZ3A 4D5CA 3NWSA 4XLAA 1XDUA 1MMNA 2H27A 3P6BA 3K1PA 1XOYA 1S72I 3O1RA 3K1NA 2WSUA 3I56I 1QU3A 2XBO3 3ZLIA 1UZZA 3VKFC 2MW8A 3ABLH 2HYFA 4Z07A 3VYRB 2L4AA 3WZ1A 4EJWA 3JTGA 1AWCA 2DA5A 4A3BJ 3LWCA 3S2DJ 3BTLA 1YEWA 2FJ1A 1ZARA 4ZS2A 3IHUA 1SPPB 4S04A 2TNFA 4LO6B 1S4CA 5SV5A 2ELHA 2A6EF 1RUJ2 2V5YA 2M7BA 3MAJA 2MH9A 1JGSA 1BBYA 4M72A 2TUNA 4JGYA 3M07A 4RDUA 3JRHA 3BN6A 4I0BA 1JYXA 4UB6C 2XMLA 2W1QA 1IHMA 1ZZBA 1R23A 2YUEA 1BBT1 2VPRA 3FMGA 2D1HA 3VBUB 4Y5SA 1JYVA 2HZTA 4CP0A 4AHYA 1U78A 3O2PE 3H3ZA 4QQOA 5DM6F 2C26A 4EQQA 2VJXA 3ZYFA 1YC61 1VNDA 2XKOA 5BOXA 5EHDA 3ZMSA 3K70C 4XBLA 1R9TJ 1K4SA 4D69A 2VR4A 3H92A 2DA3A 3RMYA 1TW2A 5FY5A 4Y24A 2YPJA 5E79C 4L5EA 3O8GA 4KN4X 5ANQA 4BMBA 1OJLA 2LUWA 3GDBA 4K21A 3SEPA 4MHRA 3PIOF 1TMF1 2CFXA 2DU0A 1IN4A 3WNNA 2NLRA 5FAXA 4D7MA 1EH6A 1RVF2 4CDWA 2LROA 2ZACA 1YW8A 3S15J 5KBFA 1IRXA 4BBRJ 3P1IA 5GPCA 5E1WA 4RLFA 3SNMA 1QOOA 1WA6X 4NWWA 1RJ7A 2WUHA 3L2CA 1PVC3 2WBMA 1AX2A 5JVGF 3L09A 1RUH1 3SKVA 4ZYHA 4KG0A 4KITB 5HODA 1AL21 1NAEA 4KWLA 5KXEA 5BPIA 2BGPA 3OD4A 2JPBA 1YNAA 3G1OA 1DDLA 4B48A 5J6XA 1OQYA 5L9RA 4DXTA 2HPMA 1Z0HA 1XU1A 4AVBA 3RG0A 2W7NA 4HN0A 4XTMA 1OISA 2NXNB 1JYWA 4NPLA 1AR92 3BJ6A 4D1QA 1HB2A 4L99A 1Q8QA 1KJRA 5F37A 5EF6A 4AIKA 4PJJA 5JR7B 2OUMA 5C6CA 1JT6A 2OCCH 3AKTA 1IDYA 5DD8A 2F5EA 4ASKA 3GTJJ 1JU4A 2ARCA 3J7HA 3RVHA 2Q4SA 2VW2A 4BHBA 3GHMA 2NS0A 3VSLA 3TEXA 1O5LA 4D94A 4YIFA 4GKYA 1RUC3 5HS9A 3HC7A 5J36A 4L18B 1MJ9A 4I02A 3VD7A 1ON2A 2YGLA 4Y1UA 1HQNA 2RS51 4MGQA 4COYA 3H5NA 3PNTA 2XF5A 4RAZA 3K4MA 2V72A 3VD4A 1QJU2 4G6QA 2FBKA 4LOCA 4A42A 5CZKA 1LR5A 4XFGA 3HSFA 1K12A 4NB5A 1GV2A 4P9WA 4D3WA 5APAA 4D9JA 3CUOA 5JXHA 5HXMA 3TOJA 5D8AB 4BJ6C 4M0NA 1U6GA 5FYUA 5BNPC 3R61A 1YLLA 4KIBA 2WWJA 4AI0A 5FBZA 3MUZ1 3WINE 4CZCA 3U1XA 5LHGA 2MLKA 1QZEA 4Q0QA 3ZQIA 2R7QA 2ZABA 2GP3A 2B46X 1FOKA 1OBNA 2JG9B 2FD5A 2P3KA 5M5WJ 2Q0AA 2KZVA 1GLHA 1ULDA 3R6SA 2JN6A 3MWMA 3EO6A 3CCEI 3C18A 1VBC2 3SFZA 3CZ6A 4BNCA 4LLNA 2EICA 1J59A 4DJAA 3K4AA 3KT4A 1WJEA 5FYYA 4AVAA 2NS8A 2YG0A 2XUBA 4CZZA 1CX4A 2CWEA 4WVMB 3ILFA 1CN1A 3LSMA 4RS5C 3WVJA 1HQWA 4AIHA 2JDAA 2JJ7A 4GQ7A 1D1AA 5LGUA 4GAZA 2VC0A 4UW5A 1K5JA 3NJXA 3QU3A 1MJAA 1IRZA 2EVXA 3EHKA 5K7ZA 5L7OB 2BWAA 3CJRB 1LHNA 2DCEA 1H9GA 5FPLA 3ZM8A 4E8DA 3LAJA 2WAEA 4W97A 4H3WA 2VXZA 3OV8A 1NG7A 2WINB 3TQNA 4V2GA 1GP5A 4GH4A 3S30A 4S0HB 3LSIA 1UU5A 4BYYA 4I30A 1BK1A 2WN3A 3MIGA 2VTXJ 5FYHA 1W5TA 3OGSA 3CC2I 1WJ5A 3B3QE 4IEJA 1OLTA 4NIDA 2Q30A 3RI9A 1FEXA 4EJRA 3H0OA 1LKXA 4ZJZA 4C3IJ 4XF4A 1RUF1 3MIHA 5FUIA 2WNVC 1YIOA 2J1SA 5ILSA 3FMRA 2XH6A 5JAXA 4IEYA 1S1AA 2YFUA 4E2GA 3BWGA 2WT2A 3MBWA 1MMGA 2BXZA 3O6BB 3G7DA 4ZY9A 1HW2A 2L7KA 4G7ZF 1BW5A 1CIYA 2B0LA 3B5LB 2W94A 1UY1A 3AZYA 1FJLA 4XMAA 4MGSA 4PJMA 1FXZA 3KP3A 2R7DA 3B02A 3ZCOA 2I45A 5FKMA 4CDGA 4KISA 2H8WA 4IEWA 1ZR4A 3GJAA 4BPZA 3FM3A 1APNA 3C3VA 1RUF2 2VCMA 1TT0A 3PURA 1RVF1 3REOA 3S2HJ 4R9DA 3S6PA 4AHXA 1G9FA 1RUD2 4RS5A 2KDOA 3AK0A 4A0ZA 2ZNZA 3DPLC 3F3XA 3S3NA 4JAAA 1R091 1RMU1 4Y1ZA 4QB2A 4B47A 1QDCA 3L2VA 4M00A 2GA2A 2WFF1 1HXS2 4AFAA 3CUQB 1QF3A 3MF6A 4E6KG 5DZEA 2GC0A 1V54H 4FE4A 1H2LA 3AMHA 3Q8EA 5LA2A 3JUUA 2DN0A 3BCWA 4B3AA 4C1XA 1EAH2 2P7CB 2E7XA 3CCVI 3USUA 3S8PA 3CCLI 1Y4WA 4BGDA 2CQXA 2BW3B 2A6XA 5EJZB 1Q1VA 1VFCA 4LA3A 3ULQB 4XDOA 3IKVA 4OYUA 1FOWA 4ENMA 2NRAC 2ZEZA 4RHV3 5DUIA 4FXGB 1CAUB 5DXDA 5A1LA 3NAPC 2VOTA 3GXUA 4Z8BA 2KJBA 3V4GA 5FO8B 2KRFA 3TDUC 5FPBA 4BAYA 1SZBA 2HWF3 5LBEA 4B1RA 4ARXA 5CEHA 2GALA 5CFCB 2VZOA 4ZS3A 3WTYC 2IW5A 2DT5A 2ETHA 4EATA 1S2BA 3LA2A 5BNOA 5IT3A 1RC9A 2W5FA 4Y26A 5ABJA 1UQXA 1W36C 5T5PA 2A70A 2LM3A 4GFBA 3CJIB 3MD2A 3O8HA 4NR1A 2F6BA 1DZTA 4LO4B 1SFPA 2H8RA 1HXDA 4YRDA 5C44J 1V0AA 4XK4A 2JG9A 3IIAA 1MGTA 5FZ8A 4OIOF 1P9QC 3BODA 1WWXA 1L7LA 2V6CA 3GZ6A 4G9SB 3AMNA 2VXJA 3JAMK 3ZRGA 1DYKA 3FLRA 1TVGA 3AZVA 3F8CA 4O3MA 4JQRA 1SLTA 4YM0A 2JSPA 1F5FA 1R1VA 4LLLA 3I0TA 2R7VA 3W21A 3UJOA 1WW5A 2VZTA 2IBDA 1F4KA 1JOPA 1AR91 1OFSA 2O8KA 3I2HA 3ZN1A 1LOGA 2KD7A 4KBBA 4EN7B 2HFHA 4AVCA 4COVA 2FQ4A 3K70D 5FTTC 3R60A 2YHJA 4C2UA 2CDOA 3AL0B 3ZOIA 5DAWA 4E70A 3BTJA 2PHRA 5BNOB 1W8OA 2YSRA 1XE0A 3PVEA 4M3FA 1CF7A 2HXOA 4ZZLA 4YM3A 4F3QA 3S14J 1Z9CA 2WAFA 3FM5A 1T0FA 1LNSA 2YBKA 1Q8VA 2EK5A 3SEQA 3ABZA 4HDVA 4CXYA 2H94A 2DPUA 2CO5A 5D4SA 4MHGA 1C8M3 1XGSA 2WDBA 2CFOA 4HAMA 4PFOA 4WM7B 3QRFF 1Y9QA 3CNAA 2A5WA 4HYEA 1AYN2 3UNGC 2ID3A 4N90A 1IN6A 4Y5TA 3VBOB 4RQPA 2Q0OA 1BL0A 1PUFA 4W6YA 4IEUA 4QD2A 4QHBA 4Q0SA 4GB32 2IGMA 1W28A 5BNQA 5F2WA 3RQIA 1A31A 3INAA 3DLAA 3K6GA 4RAFA 4V2FA 3NNJA 2P0WA 5ERLA 2WZR2 5FXWA 1SFXA 4D8MA 1H4HA 2JDUA 5K5QA 2E26A 1SLIA 2DXIA 1ZELA 3V42A 3AXEA 2KMUA 3DKWA 3IIIA 5J8CA 1GBGA 3CESA 4MXWB 5C3SA 5CVRA 4BXUA 5F6FA 1GUUA 4BQNA 5A6QA 4HEA2 1ZQ3P 1X82A 4XSZF 4XUTA 2VU9A 1DIWA 1I50J 3NRVA 4E7SA 4BLIA 2Y6JA 2BVBA 1RINA 2R061 2G7HA 3JRFA 1IC8A 3ZPOA 2ZO4A 2VUAA 4L8QA 1J3RA 1RUD3 1NK2P 5T5LA 4RL7A 4FP3A 5HCBA 1FOXA 1HDPA 4YZ5A 4GMP0 2QGUA 3OYKA 1OLRA 4YW5A 5K4LA 4DQ2A 1PK6A 1Y7BA 3F72A 1W03A 1CZTA 4DBQA 2R5ZA 2BU9A 2O7OA 2JECA 3O1PA 4KIFA 3SCGA 3ZO0B 2D6MA 5EG0A 2ECBA 3KETA 2E1CA 3ZMVA 2WA3A 2QE3A 3NV2A 4MUVA 4FTBA 3A02A 1YI7A 2QQMA 1NZIA 4S2GA 2M34A 5I0SA 4HL0A 4IQPA 4LNVA 4IOAF 4ZTJA 3RZLA 1KQ9A 3ONQA 3USUB 4M9SA 4OI0A 3HGYA 2IXKA 4FPYA 3JQXA 1YIPA 1ASJ2 3FXOA 2P5KA 2ID6A 2TCTA 1KJLA 2WS93 4CXWA 1EAH1 3UK9A 2ZGLA 2HWC1 4HF0A 3WDUA 3V0BB 5A3WA 3GZNB 4LBMA 1JUHA 3VBSB 4MIMA 4P9FA 4GZ9A 1QMJA 3POFA 1OF4A 2IS2A 1QWRA 5C8CA 3T1MA 1WRJA 1WWYA 4JRAA 4BJ5C 4PDKA 4RGUA 1MZEA 4YSFA 1W4MA 3C7EA 1UYPA 3ZXDA 2VBWA 5LCWL 3EBRA 3PUSA 1YQ5A 5I8TA 4Q5OA 2E35A 3WQBA 5D8AC 1ZRFA 1GFF2 4L5IA 1V70A 1NLSA 4IE5A 1DQ2A 1GANA 3LSJA 3J26N 1IRFA 5F9TA 2XUMA 1BLZA 1GQGA 3T2OA 1QHDA 5SV8A 3BLYA 2OQRA 3POGA 2HVQA 1WJAA 5FPUA 1DG6A 1R1A1 4R9AA 4S05A 2HQAA 5HV4A 1F4AA 2DUOA 2F4OB 1W6MA 4AFMA 4A7YA 3BTYA 2AR6A 3VBFB 1H8TC 4RGGA 3AZWA 2X51A 4QKFA 1R7JA 3CJNA 1SBFA 2CUEA 3LOCA 1X7NA 1X1DA 5D2AA 3BR5A 3EXUA 1FSEA 4P9GA 4N43C 2DMNA 4LQRA 2ME6A 3ZFFC 4OHVA 2V1DA 1N3OA 1STMA 2EA7A 4XF1A 3EUAA 1TME1 4BHCA 4PQQA 4DRRA 1XSVA 3CBNA 3TMOA 3LE0A 1ZTRA 1EP0A 5FMOL 5LY1A 4F52A 5F6LB 3L1PA 2GA1A 5B66C 1K6YA 3MKZA 2Q1ZB 3CJTB 2YC0A 5DUKA 2WYFA 1N77A 4JGZB 2LLKA 2HNHA 5FZHA 4L9JA 4KA4A 2F5CA 2HTJA 2LOOA 4HKOA 5FY1A 2FF4A 3K4LA 3I2GA 4Y1VA 1CZSA 1IG7A 1V6OA 4PK4A 1Z1DA 2KIQA 5F08A 1IS6A 4DYCA 1WW4A 4Y3OA 1PIV3 3AL6A 2FU4A 1I3HA 3V0AB 2YX7A 2XVCA 2EB7A 2VZUA 4CEWA 3N9LA 3ZPYA 4CU6A 2GM4A 3FN9A 3KV4A 2C9KA 2BFUL 5GZFA 3R4SA 4D5FA 4DXSA 2NVQJ 2V09A 1PZ7A 1S2KA 4IDZA 1GNZA 3ZXGA 2WNUC 5HCHA 3Q8CA 2K9ZA 2PHDA 4FCYA 4ISQA 5DDJ2 1VQ8I 3K4JA 2I07B 3LNQA 2BUKA 3H50A 1LRHA 3MZ8A 3GVAA 1SDWA 5FUNA 2Y6HA 3LB9A 3TW7A 1R71A 1RUI2 5ICEA 1JKRC 2A05A 3T3YA 4M9XA 3DU6A 4TV7A 1UMIA 5D5WB 4BE2A 4CXXA 2DMPA 4UXNA 4UVAA 3EQLF 4A5MA 3OYFA 5FZGA 4MQVA 3HRUA 3SH5A 5JPNB 2A3WA 2LH9A 1QNYA 4N53C 4HF2A 3NQHA 4W65A 4UUVA 2A71A 4XOGA 1F4HA 4C9YA 1RIRA 3BALA 1AVBA 2DLLA 2IEKA 2QDNA 2GC2A 3OB8A 2XF7A 3JD73 1A6QA 3PUQA 4PI2A 4LK0F 3JRGA 3OYEA 4LHKA 2A3SA 4JHTA 2VZSA 5FD6A 1MZ6A 4E7LA 4BQWA 1NXMA 1JI6A 2P37A 3OS1A 2V6EA 2FNPA 1IXCA 4U7BA 2LDUA 1UO9A 4F55A 1BR4A 2R0HA 1ZM1A 1VJ2A 1MS8A 4UF0B 1GU3A 4AZZA 4CTEA 3HQUA 2ATFA 4DZJA 2ZJRF 3LDRA 3FK7A 4AVPA 1VQOI 2X6XA 2JDNA 4PLMA 4EGZA 1WSUA 1U9NA 2WWUA 2Z5UA 2VM9A 3T1BA 4NC6A 4Q4ZF 1NCQA 1YQ8A 4IE7A 2WYSA 4EVIA 1OPMA 2YFZA 2E9QA 1XNKA 3VDBA 1NTCA 3RQ0A 3WW1A 5GJ6A 1S0EA 4QMAA 1G3WA 4YFXF 5BY5A 1QRYA 2ZFUA 5FZOA 4CPBA 1JYTA 4QQPA 2RR12 5DCMA 4L9NA 2JSCA 5LASA 2AQFA 1Q8PA 5AFBA 1XYPA 4B1LA 3CO7C 5A70A 1LUJB 4ZU4A 4YM1A 5LA1A 3LAPA 1PVC1 3AKPA 2YU1A 1BMV1 1D2QA 4IL7A 3WX5A 1MEC3 1SQ4A 1TZOA 2OQGA 5CFDA 2JWPA 4IHSA 3NNLA 1YHQI 1KONA 2B42B 4IGQA 1KQ8A 4J1XA 4HVOA 1J09A 4K1ZA 1YJNI 2XJPA 2BEOA 2VQTA 4YPJA 3CF6E 3SZGA 4FASD 1CPNA 3OOPA 4HKWA 3OWTA 3MLKA 4K20A 2WFF2 3IAS2 4EN8B 2H0BA 5DTDA 2KQRA 3HOWJ 1FP2A 4OIQF 5FZOB 3VN4A 1SG3A 2QM3A 4PF1A 3ZSLA 1AR93 1IUFA 3KEYA 2HBTA 3TEDA 1KGYA 4KH9A 4K6BA 1XXNA 4B4CA 2GIZA 4FE7A 1VB2A 4WK8F 4B1MA 3IZOA 3E3VA 5FRMA 2W1UA 1YIFA 1Q43A 1E0EA 5FMCA 3T08A 3HOBA 1JYNA 2ZMEC 2MYSA 1VBB2 4RSUA 3BR0A 2XOMA 4IW3A 4LBNA 4QQHA 3B94A 4MGZE 3TKYA 1R22A 3OBZA 2M0CA 2KISA 3SXWA 1NE4A 3RFRA 2G9GA 1POQA 1WCSA 3I64A 1OCZH 1WZXA 1V6LA 3ECQA 1TQ5A 3I49A 5ACA3 4LB6B 4XRSG 1F35A 4JX4A 3GM8A 2VBDA 2OT7A 4YWAA 2VLAA 1WQ2A 3P3NA 3KZ4C 3ASOH 3IH4A 4BQ1A 1X4PA 3I5UA 1RUE3 4E7IA 2QSFX 1TNRA 4KT5C 2FE3A 3ZFGC 2W0XA 4MFEA 1AKHA 3EUKL 5IP9J 3P9KA 2XL9A 1XNDA 2RE9A 2D6NA 1UY4A 4LT5A 3ZMUA 1EY2A 4PCRA 1JKOC 2IXCA 2F4LA 4CCJA 3TBIA 3T0BA 4X6AJ 3N36A 1YG2A 1V3FA 2SBAA 2BHYA 2W08A 3FMQA 2Z1DA 4AXOA 4JDOA 2OVUA 3OUIA 5B2GB 1PK6C 1EV11 3GGLA 3UR3C 2QUFA 1APLC 3JD72 3FHAA 3BVCA 2OUHA 4CPBD 2WLQA 4R52A 2A1XA 3JBG2 2I2SA 1P7IA 2QCSB 4EQVA 1E3OC 2LG4A 4FFFA 5IYCJ 4IZZA 1LOFA 3KV9A 1HF0A 2GMMA 4XDPA 2KL4A 1Y9GA 1K45A 4WM8C 4H7LA 2AO9A 2Y0SA 1GWLA 5BNNB 4U36A 2G7UA 1NA1A 1SCSA 4UFIA 4F8AA 5EWSA 4LKDA 4BQ4A 2YYOA 1WCQA 2ZCWA 1H88C 1Z67A 3CIHA 5IW0A 3RPUA 1KYWA 3HBKA 3TN93 3LDKA 4HW0A 4OIPF 4NC8A 3FUOA 3FHNA 4HDUA 2HWC3 2Y2ZA 3WHTA 1BYHA 3EYPA 2W95A 1BA5A 1JHNA 5IYBJ 3CJIA 5C33A 3K48A 3IUOA 5IVCA 3WTUC 5HV0A 5FZFA 4JRLA 2LS6A 1FYLA 3BPVA 3RIRA 2DVFA 4OU0A 4XUNA 2X9DA 4W4ZA 1H2KA 1BI0A 1D4VB 1ULFA 1KXGA 6PAXA 3KP2A 3OYBA 4EWEA 5K5RA 4QPGC 2LTPA 1YFUA 5T50A 1QNWA 4PJ0C 1FX7A 3VZJA 3FXLA 2W1OA 4BQQA 4JTNA 1VQNI 5HDKA 2QUOA 4K40A 3I2FA 1LFPA 2D2WA 2WA4A 3ISPA 3O1OA 5AVPA 3HBZA 4HANA 2IP2A 4PFPA 1S9HA 3DQVC 3CDZB 5F5AA 5FV3A 2RV8A 2RKHA 2RR13 1L3LA 1SFKA 5ACA1 2ME0A 2JTVA 3POJA 3Q0WA 3ECOA 3DPTA 3DBLB 2UZKA 1U5ZA 2CYYA 1YJWI 2WIIB 1G9AA 2EAKA 1DQ5A 1PO13 2FBEA 3LSHA 3CMYA 4BH9A 5H6QA 4LBOA 1ULYA 1R49A 2VTFA 2E19A 2CH0A 4HSTA 4QHOA 2XG3A 4QX1A 3ME2A 2O9LA 3X2QH 2XJQA 1HB1A 1Y3TA 4LG0B 3BIEA 2BHZA 2ELJA 1YJLA 1QOTA 3E5UA 1UZ0A 2EFOA 1CVNA 1AR81 1VQ5I 2BJSA 4NPMA 5ACA2 4BQXA 4R4XA 2ZA9A 1FOD3 1SMTA 3S1MJ 2ZTNA 2R7ZJ 9ANTA 5I8SA 1SACA 4FSJA 4Y15A 4PIZA 1AL22 1AHSA 2UY8A 4CUCA 3I2DA 4YZ1A 1OR7C 2PX9A 2FRHA 3OYMA 5L3FA 4Y4RA 5A3OA 3BU7A 1UD1A 2JA2A 1VBB3 4AK3A 1ON1A 1HKDA 3CMAI 3MEXA 1EH8A 1IN5A 5DD4A 3EYYA 3POEA 2JEMA 3DXUA 3CP8A 1P4WA 4AG4A 3V8LA 1GMMA 3GBGA 2EFPA 2DOAA 3ALQA 1VRH1 4GH4B 3ZPLA 1MH4A 4R8HA 3B93A 1G59A 5CADA 2BDRA 4RHV2 2IRFG 1AR71 4YVSB 5L36A 2JIGA 3OGJA 1TMF3 1YQCA 4LITA 2EV6A 1G3YA 1W9YA 3BCBA 2ZGMA 3MIFA 3PQJA 1K83J 5EP9A 4OQ8A 1R081 3VBSA 5L3CA 4K1YA 2ZGQA 3HPNA 1TP4A 1MS1A 3S2WA 4KBZA 2JMWA 2JJ6A 2PELA 3U21A 3IH2A 5DAQA 2BFUS 2HH9A 5KXCA 5H2FC 4SLIA 1R092 1T33A 4A41A 3JB8A 1IUYA 2RS32 2D40A 4FFGA 4HX8A 1UHSA 1GZWA 1FMWA 1FTZA 5J09A 1MSFC 4BXXJ 4B44A 4FTEA 3UKVA 5KNLA 2OPKA 1PNGA 2PQSA 4RHV1 4B43A 2XSDC 3JZVA 3JRIA 5FY9A 4GD4A 3N9OA 3DECA 3AYEA 1IQAA 2FZ1A 2H0VA 2NMOA 1KU3A 3OL4A 1XYOA 4F7ZA 5GLUA 1GP4A 1GZCA 2UXNA 3LSRA 4Z6YA 1HB3A 4Y1XA 3K7AJ 4KICA 5JZGB 3URFA 4HLTA 5IOZA 5CA6A 4XBFA 1H9PA 5FYTA 3W6VA 1UY2A 1P2FA 1RPWA 3FLPA 4IE0A 2V1XA 3RPQA 1IPSA 3GZEA 4JKMA 1QHGA 3BPZA 2FDFA 1IXSB 3EPZA 1X8MA 3T0DA 3ZN0A 1ULGA 4UUTA 2A3YA 4IV1C 1H2NA 1CF7B 1X1CA 1AKHB 2AGSA 1FMD2 1C3HA 2WNVA 5FZBA 4LMYA 3W6KB 1V5FA 3LEGA 4P9XA 4MQ9F 3K69A 1MSEC 1F8VA 5LGNA 4JQFA 3D0JA 2WTEA 4COZA 1CX1A 1JTXA 3ZMNA 3IL2A 2AC1A 1H1AA 3SLIA 3ZXJA 1AYN3 1XS9A 3T8TA 1XMXA 3TO6A 5FMOS 2O6GE 3LAGA 1MMAA 4XW3A 2VNRA 3BPSA 2Y6KA 2VQUA 5LA0A 1PVC2 3ZQQA 4U0VA 3PJRA 1LESA 2YROA 3AFKA 1PGW2 2LW8A 3WQ0A 5GAHJ 1SEFA 3WTZA 4CDXA 2ELKA 5HLTA 3OIQA 1DGWY 1JUPA 5M0TA 2ISZA 3PM1A 4XF3A 2YU3A 3W2WA 2Z69A 2VMIA 2W82A 2QCOA 2VVEA 4XJWA 5C4XJ 3VPRA 4QAWA 4P9YA 4FPKA 2WJSA 3T2PA 3W6JB 1SFNA 2GN7A 2D3PA 2FEZA 2EBIA 2WS92 3WQ1A 2E7QA 2W52A 4A7ZA 1XX5A 3Q5FA 3OUJA 1STZA 2B9SA 4BDZA 5GP9A 4XKVA 1OQEA 5B1BH 1PZ9A 4D7TA 1KYZA 2DDBA 4JGYB 2MC4A 4WVZA 4OHWA 4C0HA 5FKOA 2VE1A 5H9PA 2ARAA 2X6WA 3J4UH 4XFIA 2JT1A 5F3IA 3ZSMA 4XUOA 4Q1RA 2EIDA 4NHMA 4LJZF 5GTHC 2GOXB 1J2XA 5F8PA 4LLOA 2XRNA 2ESHA 1XDSA 2PMZN 2J1EA 2J1TA 2KT0A 1QJFA 2GZWA 4P14A 5J1UA 4YVSA 2FDJA 5D6FA 4ESFA 4J1WA 1V6NA 5E3LA 4Y5Z0 2FUG2 2VZQA 2VL8A 4Y20B 5J3LA 4YIRX 1C0WA 4J19A 1D0ZA 1YIJI 4Q8LA 3S5AA 2HPIA 2VY0A 3C2HA 3VDXA 3P5BA 1VBA3 2RMU2 4IRHA 3M4FA 4K2EA 4Z2YA 1GDTA 5JVTA 4B7KA 5C5TA 2QKLB 3WODF 4RS8A 5FO5A 3KLNA 2Y64A 3UNPA 2VQLA 4BQ2A 5C4WB 4YZ3A 5HDGA 5E1XA 1OCRH 3O3KA 3S1NJ 4OZOA 5C3PA 4YVWA 3MV11 2DT6A 4PLOA 1DU3D 2E1MB 3BQYA 1W7PD 5BS6A 3DKYA 3ABUA 2PLYA 1L3JA 5LK5A 4KMFA 1FPN2 1VALA 2PJRB 3KCXA 2PFBA 5C3OA 2QQIA 1W6NA 5FZ4A 4LE3A 2X8KA 4CYDA 2F4MB 1RUOA 1PGL1 1W8NA 5C9AC 2ESNA 2I10A 3WY6A 4Y7NJ 2AREA 3SYTA 4RB1A 4HVQA 1W6MB 2L3DA 4IXLA 1Z7S2 4XILA 2VULA 4IE6A 4RGAA 4TLFA 3DWLE 3ZYPA 2W4SA 3A0KA 4DOZA 2JE9A 4JDNA 4XHXA 3OYHA 3GYDA 5A2QK 2ICWG 3H3VK 4WVWA 4MGRA 3WF1A 5F3GA 1VMFA 2MABA 4QKNA 2QA4I 4L92A 3QP6A 1DQ6A 5FP9A 2VVFA 3MPBA 1Y1VJ 3MEPA 4I7HA 1QEXA 3SJMA 2D6PA 2DYSH 5DCFA 3LFUA 4LHSA 5CU1A 5IT9Z 1UZYA 3HM5A 4XJZA 3KHBA 2QZ8A 2AH2A 2OZ6A 2DTRA 2DU9A 3NNFA 1V4RA 2G0EA 4N53A 3MZHA 4N9HA 3THPA 1WHUA 5AIPA 2F5FA 2AYHA 3TEZA 5FKLA 2B9UA 2KP6A 2D6LX 3VZLA 1T2XA 3CLQA 1AYN1 3TOAA 2XAHA 1MZBA 2R7WA 1DGRA 3M3IA 4GWMA 4XOPA 5BNPB 5JI6A 1MIJA 1RESA 3O1UA 2K4JA 1LGNA 2K3PA 1IDZA 2CNAA 2MG4A 3P9CA 4B3XA 4QDQA 4V19K 5A33A 4A5NA 4BS9A 1TBXA 3PMEA 1TEIA 4INDA 4MEXF 5K7FA 4G4FA 2PAMA 3LWFA 2AS5F 3RYKA 2RJ2A 4OUEA 1Y56A 3H9AA 1R093 1Y6IA 5F39A 1RRJA 5CIRA 2UV1A 4UBGA 4CA0A 1MMDA 3LEIA 2WQZC 2J5PA 1V9U2 1NA1B 2DA4A 2VMCA 5FP8A 5TRDA 1KEXA 5BMZA 1OA4A 1U5TC 4C1WA 2ADUA 4F91B 5DZFA 3ITQA 4A3EJ 4DFSA 3SDBA 3TAYA 3T0YA 3PUBA 5LATA 2EIGA 4AFCA 1MQTB 2JB8A 2A61A 2W91A 3TB0A 2M30A 4DNYA 3GO5A 2IVIB 1PUEE 1O4ZA 3WUCA 2ILMA 3I71A 3QOPA 1KS5A 5I0RA 3WHUA 2VECA 3VBHA 3FKIJ 1MJBA 1S6LA 1S2EA 4AVZA 2VGDA 1SLAA 2VQAA 1Q1HA 4LBQB 2BV4A 3IPVB 1B8IA 2DCKA 2RMU3 5HCFA 4A44A 2L9SA 4E7JA 3KLSA 1WI3A 3FIWA 5FZDA 5JR2A 2EAAA 2M0MA 4X8NA 2L7FP 2DA1A 2OD5A 3WLUA 4GKXA 3ROUA 1K3IA 3U4SA 1OUSA 2RQPA 4YGDA 1IPJA 3M3QA 2VBYA 4KWUA 4ATEA 2R30A 2PFWA 1BOBA 1OXCA 2QKDA 2CV2A 3R4UA 4XXAA 3KE2A 3A01B 3ZXLA 4HRIA 3I4NJ 5DUWA 3K4BA 3JD71 2P34A 4G7HF 1POGA 2CRGA 1HXS1 4JX5A 2DFCA 3A4UA 5K0UB 3P9IA 1AX1A 1PMIA 3RKWA 4CEYA 3VWBA 5ILUA 4XICA 2KZGA 3CF2A 4X1EA 2R0FA 3IM0A 5G04L 4PBPA 1OF3A 4QGLA 3CMEI 4C3HJ 5JHFA 4WM7A 4XOTA 3DL3A 2E31A 2R4GA 3CJIC 5IVYA 5K7HA 1A3KA 2QSHX 3A23A 3K9TA 1JUMA 5A7WB 3SEZA 1U9OA 3O0VA 1GKBA 2VOXA 4YVSC 1HRI1 2VCBA 1X58A 4RQPB 2KXLA 3AB0A 4QDSA 1X2MA 1URXA 5FQ0B 3M1CA 2CS3A 1UY3A 4CDQB 1UFMA 1FLIA 2O14A 3LEMA 2Z2SB 5E16A 2QBYA 2W46A 2HLEA 2ZXJA 1LAJA 1E3PA 2JDYA 1AR82 1J1LA 1FP1D 4O9GA 5FP3A 2CAUA 3TYJA 3RZHA 1FOYA 1MMSA 1N1VA 4M3CF 4KG8A 3HQRA 1HV0A 1ZBE3 1ZYBA 1R5ID 2GH8A 3NJVA 5J7MA 2RVCA 3OR2C 1IAWA 2DVBA 4JHZA 1X4OA 5BNNA 3ECHA 1GOHA 5LB6A 5IPAA 1D4M3 4RR3A 1T95A 3WOGA 2Z4FA 2LTNA 2HKXA 2ZGOA 4Y20A 3Q0VA 3NVCA 2QTWB 2Y8KA 4AEDB 1TLHB 1JTZX 1R1A2 4G8XA 4E4SA 2YV8A 5J48A 1ZREA 3T2QA 4QLCU 4OCTA 2M5WA 1XCBA 3LPGA 2NVUB 5C5UA 2FSWA 2HVRA 2WS91 3J7AY 4AQTA 3HUGA 5F5QA 4N7IA 2L7ZA 2OZUA 3I53A 1D0XA 4DEVA 5HXVA 4IGOA 1PP7U 4CVUA 3TL4X 5F6KA 4NHLA 3LZZA