3E6BA

Ocpa complexed cprk (c200s)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
211
structure length
208
Chain Sequence
DNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 67
structure length 208
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e6bA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e6bA01
4MGZE 2GC2A 1V3FA 3TDZC 4L2NA 2CYYA 5CVIA 4PIZA 1J3QA 5IT9K 3WU1B 2DQLA 4EMSA 1J59A 3N4MA 1TNSA 4IEOA 4HX4A 3HHGA 4PJYA 3H1YA 1WA4A 5FPXA 2JTVA 2HQNA 5H20A 2W57A 3I59A 4AIHA 1W7PB 1JHHA 3CUOA 4RD7A 3GF2A 3WTWC 2G7UA 4P5OA 3KMHA 3V7SA 2GU9A 2XLAA 4HBNA 4P9FA 4Q48A 3FWEA 1UHWA 2BNMA 1U6GA 3FHIB 4N9HA 1L3JA 4N9IA 3R4KA 2OZ6A 2Y0OA 4CICA 3BCWA 2H94A 1O5LA 1AWCA 2CV6A 1EH8A 1HSTA 3V4GA 5L3CA 2D1VA 1DGWA 1ZAOA 3NJZA 1KQ9A 2X4HA 3FMQA 3N97A 1VR3A 4HW0A 3CLOA 3U2RA 2VOPA 3ACLA 3BJ6A 2JRTA 4AQ6A 5D8LB 1G3YA 1CAVA 4XFBA 5J3UA 4U0YA 4ASNA 5D5XB 3IRQA 2V1DA 2EFWA 4ZU4A 2V09A 3FXUA 2BBYA 2IJLA 3RNSA 3JSOA 4M73A 5KBFA 3GFJA 1QNTA 4RB3C 2Z3YA 1ZLJA 4MQVA 1S6LA 5LRRA 3BWGA 1MD0A 3T1BA 1IN5A 4EJOA 1G3SA 1XSDA 1CAUB 3L7WA 3WG9A 4JTOA 4IEYA 2VXZA 3FZVA 4RB0A 1IAWA 3SZPA 3WTYC 4AVAA 2MPFA 1XGMA 1FYMA 4HMZA 5KHKA 2YU3A 1SFUA 2COMA 5JI6A 2RKHA 4LK0F 5H6RA 1FBSA 4LB5A 3H50A 4ORFA 1XMKA 2M30A 4M72A 1ON2A 3NSTA 1DP7P 1CGPA 1U5TB 4J1WA 2FU4A 3CJXA 2H6CA 5ICCA 2MA3A 1UPIA 4IEWA 4BYYA 2DQRA 2HYGD 5JFRA 3CF6E 1L0OC 2K9ZA 2XKOA 4M9XA 1SQ4A 4MEYF 2HQRA 1QO0D 5E8IA 2JZYA 3S0MA 2IVMA 1Q3EA 3GFMA 1D5VA 3LQQA 2QBYB 3HQXA 3BALA 4UV9A 4KIGA 5I93A 3QP6A 2L01A 2E1CA 3JSPA 1B4AA 3BPVA 1XD7A 1W7PA 5E18F 5ERIA 3M3IA 4XSZF 1F9NA 1ZZ6A 2ISZA 1X7NA 5LGNA 1J5YA 1P4WA 2F5FA 3ISPA 4UBHA 5JR3A 4HX7A 1TLHB 5FFZA 4A0ZA 4XETA 1EPZA 2HWVA 1XRUA 3DN7A 5D1IA 3E6MA 1IUYA 2OZJA 1XDUA 2ESHA 2XRNA 2FOKA 5BUVA 1YS6A 3TDUC 1YLFA 2QVSB 3DV8A 4BQAA 5DCMA 4HN1A 4L9NA 3M7GA 3I53A 4YSFA 4MGRA 5DV5A 3ES1A 4LLNA 2STWA 3MQ0A 1RC6A 2IXJA 3SHFA 2CGPA 5JCTA 4YARA 1PMIA 3MZHA 3H1MA 3ELKA 2GH2A 1Y0UA 5CVUA 1BC8C 4I98B 4NQWA 2WV0A 5C8WA 3NL1A 3WTUC 3KCCA 4EJWA 1HW5A 1QZYA 1YQAA 3I71A 5C6CA 2BGCA 3LA3A 2LF7A 1XDSA 1ZRFA 1FI2A 1UD1A 5CADA 5FLHA 3RPQA 4XBFA 4HDUA 2L4AA 2IW5A 3C7JA 1RUOA 4EGYA 1YFXA 2VBZA 2VODA 2IT0A 4HDVA 1FC3A 1UCRA 3G73A 1P6RA 2Q0AA 4I02A 3WU0A 2L4MA 5BXXA 3VEPA 4D7SA 2HOEA 4ZYEA 4EJUA 2GC3A 4H0EA 2EFNA 4JK1X 3OD0A 2VT3A 4UV8A 2OBPA 1ON1A 2PLYA 5DDGA 2HR3A 4O5VA 4HLXA 3QRFF 3MPBA 1FOKA 2XASA 2RN7A 2FBIA 1WWXA 2V1XA 3J7AO 3VB2A 3R0AA 3TNQA 2M8EA 4I3PA 4GYIA 1O7FA 2UXXA 1TQ5A 4MZUA 3IRRA 4HF1A 1O7LA 4HLTA 1BBYA 5ILSA 1YYVA 2BEOA 2A61A 2RNJA 4QWQA 5KHHA 5LGUA 4LK1F 1VTNC 1MZBA 4PGGA 4CO8A 2KXLA 1S29A 5DEQA 2EFQA 4OLLA 1FSEA 5EZWA 1SMTA 1R58A 4A0XA 2K86A 4Q47A 2DFIA 3TKYA 4EV0A 1LEBA 4WXDA 3QU3A 4ZZLA 2D40A 1XB4A 4KDPA 1DPUA 1UW8A 1WQ2A 2XUBA 3Q9SA 4UVAA 1U5TC 4G7HF 2EV6A 2R3SA 3MZYA 3RZZA 5HLIA 4HBLA 3WTVC 3BOQA 2H09A 3P9CA 1ULYA 4NB5A 3LQRA 2PMHA 3RDIA 1O3QA 4KWKA 4HV5A 1DZTA 2Q8KA 4HVQA 5FLXK 2L54A 4RAYA 3WGIA 3LOIA 4K2EA 1NZCA 1RGSA 1BIAA 1JGSA 3GLXA 5HOOA 3WTTC 3FMSA 1PP8F 3GW2A 1MGTA 1W7PD 4TV7A 2F2EA 4M6YA 2YX4A 4ETSA 4DNCA 4FBFA 3RPUA 4MTDA 1X3UA 1A04A 4KT5C 5F64A 2P5LC 3QU6A 1TQPA 5KHGA 4IESA 3LSTA 4JTNA 1V4RA 5TJJA 2EAAA 1IPJA 3CTAA 3K9TA 1ODDA 3EO6A 1KU3A 3D0SA 4YFNF 1X8EA 3HSEA 1F1ZA 2Q0OA 3F8BA 5E1WA 4MQ9F 4KWJA 3C3WA 1ZGAA 4I2OA 5AIQA 5DCMB 4ESBA 3KP4A 1HKSA 3SXWA 1YWKA 2OQGA 1UHMA 2KIUA 4FAGA 1ZRRA 5E8GA 2VBWA 1U2WA 1B6AA 3BJOA 5A2QK 1LRHA 2VBXA 1O4TA 3GO5A 1JHFA 1OD5A 2FNAA 3WODF 2OA4A 4A6DA 2Y48A 3JAMZ 3WW3A 1Z7UA 3H7JA 1IF1A 2MH2A 2P8TA 3DPLC 4IHSA 4HOBA 4F7ZA 4LFUA 1FXZA 4UNOA 2ET1A 2KJCA 1FNNA 2AS5F 3GYHX 3EUHA 4PGHA 5L3DA 3B73A 2F5EA 3HIFA 1J58A 1H9GA 3I58A 3K1NA 4ENNA 3M8EA 1OYIA 3IKTA 4YFXF 2RV8A 3I5UA 1UIKA 3KGZA 3FM3A 3G3ZA 4WZCA 4MNUA 1P4AA 4LLLA 1Z1DA 3HUGA 1XSVA 5BOXA 2UZKA 5KHIA 4PCQA 4BAYA 1R36A 2V1UA 3NEUA 4K8FA 1HKQA 1S7OA 1KA8A 5FQ0A 3IKVA 2OQRA 1R23A 4LJZF 4IVNA 4LTAA 2H6BA 3ZPLA 4B09A 5ILVA 5IT9Z 3BPXA 4QM8A 1XGOA 3R60A 1J1LA 1XMAA 1RI7A 3P7NA 1B1BA 1U3EM 1SFNA 4KICA 5D5VB 1E2XA 3F6VA 2ACJA 2QM3A 2ETEA 1R1UA 5BPXA 3ULQB 2MBFA 3LA2A 4BNCA 5E17F 2OZUA 2E7WA 2Z5UA 2D1HA 4G6QA 3KP7A 2EJRA 3P9KA 1R1TA 1XCBA 4HA8A 4R1HA 5BQTA 3BPZA 4KUMA 2VPVA 3EDPA 3HOSA 2CSOA 4YG2F 1FLIA 2P6SA 1ZREA 3K69A 4A5NA 3P9IA 2QJVA 1D8KA 3V7RA 3SQNA 2XLGA 2Z9OA 4KFCA 5FD5A 1BI0A 1MJAA 5CVJA 4EM2A 3WW1A 2XLFA 1IN6A 4KU7A 3NQOA 2EWNA 4EQQA 1O5UA 1LVAA 3C3VA 5K8SA 1SD7A 4XF9A 1QWRA 1ZG5A 1X8MA 2PI0A 1BJAA 5KHJA 4OIOF 3NW4A 1O3RA 1ZX5A 3E6CC 2EV5A 4EWEA 2UYAA 5L3EA 1MDMB 3UKTA 4L9VA 1EYBA 4IEUA 2NNNA 3GFIA 2UWMA 2RDPA 2Q1ZB 2EFOA 3W6KB 3FHZA 4I7HA 2B5HA 2ZNZA 3SXYA 1D3YA 1CAUA 2QDRA 4Z2YA 4WWCA 1IN7A 2BV6A 2DW4A 3BZ6A 2PQ8A 3ZDSA 2LSOA 2KKOA 3IIAA 3RTRA 1R22A 4LEJA 4IF4A 3WW2A 3QPHA 3RYKA 2GAUA 3C18A 2WTEA 1EV7A 5EEGA 5E20A 1KU2A 4G8XA 1FYLA 4XEZA 2HS5A 1LNWA 3V7CA 3KP5A 1DDNA 3MWMA 1G3WA 2DBBA 4B8XA 4L11A 2W85A 1Z6TA 3IC7A 1HXDA 4ENKA 2EA7A 5HI0A 2XAFA 1G4DA 4L0YB 4AWXB 1CAXB 2HTJA 3RYPA 4EWDA 2CW0F 1HBXG 1BC7C 1BI1A 3PLQA 5FCCA 3QPTA 2LF8A 3L2HA 3KLNA 5K5RA 2C6YA 2K4JA 4IRHA 2DI3A 4IRIA 2A6EF 2E7XA 4IPAA 2PAEA 3ABTA 1XGNA 4HVOA 2O1QA 3GXOA 4R79A 3CL1A 5JSRA 1H1IA 2XKPA 2HGCA 1JXSA 2FQ3A 4DQ2A 3H92A 4PIXA 4U7DA 4CYDA 1O3SA 3I59B 2CG4A 3GX4X 2KIMA 4OU0A 1U78A 2GWRA 4IEZA 4BXUA 1CAVB 1MJ9A 3ABUA 4PDKA 5HS9A 5HDNA 4LLOA 2PYTA 4E70A 3SCHA 3JTGA 3ES4A 2VT2A 2FBKA 2B9UA 2NRAC 2DCTA 2YR2A 1I1GA 1Y3TA 2YPRA 4LB6B 1QPMA 2X0LA 4M71A 1OR7A 4F8AA 4HZFA 4ENMA 4YFKF 1KYZA 3EBRA 3FXQA 2P5VA 4HAMA 4Z07A 4PIYA 4KA4A 2VN2A 4HQMA 4I09A 4JBAA 5I0RA 5BV6A 2O8QA 2Z2SB 3H7YA 2RQPA 1B9NA 3HT1A 1PDNC 5JHUA 3SMHA 4LD5A 3RI4A 5D4RA 2GC0A 1XE7A 2GC1A 3KP3A 4KMFA 1OPCA 2XL9A 2L3DA 1T39A 4WXHA 2A68F 1F4KA 3GBFA 5DCFA 1UCXA 1EP0A 2UY8A 3DL3A 4H7LA 5JSPA 3VFZA 4QGMA 4O3MA 2Z99A 3I7DA 1UB9A 1YUDA 2ELHA 2ET7A 4L5JA 2CO5A 5BPIA 2PTMA 3L2CA 1SD5A 1V70A 1RUNA 2UYBA 3PVBB 3ECHA 1LDDA 1H9TA 3QOPA 3FF5A 5FB2A 5IT3A 4GULA 2B8MA 2LKPA 1TBXA 2XGXA 3TQNA 1NYWA 1IZ1A 3ML6A 1G6NA 4Y15A 4HQEA 5CU1A 3ZMSA 1QXJA 3T5XA 4XF4A 2UY9A 3L09A 1R7JA 4A5MA 2GXBA 1IRGA 1IN4A 3CUQB 2J5PA 3RKWA 3O6BB 1YLLA 3LZZA 4OIQF 4IEXA 4XFAA 1B59A 1BM9A 2NNYA 2P4WA 2V9VA 2KJBA 5LBQA 1AOYA 1REPC 2IXIA 2AXLA 1U12A 2OD5A 4Q0SA 1BI3A 4QGLA 2NYXA 1J3RA 1QZZA 3L9FA 4YIFA 1P92A 3MCZA 1TW3A 3QAHA 4O6JA 2F5DA 5DD8A 4EGZA 4ONUA 5BS6A 4IXAA 2PHLA 4M9SA 4XFIA 2E9QA 3OGJA 5FFXA 3HRMA 1R1VA 3KGLA 5TRDA 2DPUA 3MEXA 1H1MA 2O03A 3LWCA 5H6QA 1P4XA 2H0VA 4A6EA 1YO5C 1HW2A 1YS7A 3SZTA 4GYGA 3DF8A 5LLQA 5I0SA 2ZO4A 4R52A 2OU2A 3T0YA 4TLFA 1FT9A 2CFXA 4IHTA 4LUKA 1FPQA 2GIVA 2PFBA 2GA2A 3V8LA 4KN4X 1GXPA 5T3NA 2XAJA 4LA2A 3E97A 2H27A 1JE8A 1G3TA 5JSOA 5LHHA 2MNGA 1BI2A 2ZFWA 3E6BA 4R8HA 3ZMDA 4L9JA 1ZHFA 1OYYA 2QQBA 1SFXA 2VQAA 4WVZA 1YFUA 4RAZA 4E2SA 1TQIA 1J0RA 4P55A 1CX4A 4I0AA 5FQ0B 2HJIA 2DLLA 2DK8A 4KIBA 2GA1A 4G7ZF 5KK1A 2FSWA 4OIPF 1WGPA 5E1XA 5DUIA 3H1WA 1FP1D 4P9GA 3F23A 4ZU5A 1XCVA 1YTYA 2Z69A 3J80K 3EQEA 1DPRA 5F1RA 1H0MA 1BOAA 3KSCA 3COAC 3I54A 1HW1A 3OF1A 4EROA 5HS7A 5FD6A 5D6EA 2DPDA 2K7LA 4ZU7A 2QUFA 2RVCA 5J8CA 3F22A 1ZH5A 5ICGA 4MHGA 5JR7B 2ETHA 1XGSA 3ZMUA 2M5WA 2A07F 3J81Z 1SAXA 1I1SA 3J81K 2QBYA 1Q43A 2Q2EA 1GXQA 4UHTA 1KYWA 2PG4A 3HRTA 1J75A 3DEUA 2R7FA 3WTZA 3ZMZA 4O9EA 3F8MA 2ZNYA 1Z91A 4HF2A 2ZBKA 1ZARA 1IXSB 3T8TA 5I0UA 3TGNA 4A0YA 3E5XA 1IPKA 5E1RA 4NHJA 5BMZA 1FBQA 4G9YA 1R00A 4L18B 2MHFA 1IW7F 3KETA 4UBGA 4MV2A 4HV6A 3RIRA 4XRFA 5L3BA 3M8FA 1ZLKA 4IEPA 1USTA 1U5TA 4AIKA 2PAKA 4Y17A 3WGHA 2GZWA 4U88A 2JPCA 5HS8A 4AQ2A 5FLXZ 5F6FA 4X6RB 3FM5A 4XF0A 3CO2A 1FSHA 3SCFA 2ESNA 3CDHA 1LDJA 3GZ6A 1QQIA 3C1DA 4IEQA 3USSA 4A2UA 4HVRA 1Z9CA 4UUVA 2V6CA 3HHHA 1IN8A 3O3KA 3MYXA 5K1YA 1VP6A 4FHTA 2XHKA 3DQVC 4Q5SF 1YG2A 4Q0UA 2EA4A 4XFCA 4GGGA 1ZVFA 2VE9A 1YFWA 1TTYA 2O0YA 2EV0A 3R6SA 3DXJF 5K5QA 2E1NA 2IA2A 5D6FA 2STTA 3WGGA 5BPDA 4YNIA 3CJNA 3NRVA 3EYYA 1MKMA 5HLGA 3JTHA 2EK5A 2PA7A 3S2WA 2FF4A 2VE8A 4XFFA 4ENJA 4RB2C 4G7OF 3ZP5A 1ZZ9A 2M1BA 1SEFA 1O3TA 4G6DA 4G94A 3GUDA 4U0VA 1U8RA 4OMZA 2QVOA 3KP6A 4XSXF 1WKMA 3CUQA 4GO1A 5LEKA 3GFLA 2O3FA 2IP2A 4M9ZA 3L00A 1XE8A 2RC4A 3GYDA 3ZN1A 3ERED 3K1MA 1KU7A 2QQ9A 5J6XA 3ST7A 4M74A 2PEXA 1XSXA 5J48A 2Z33A 4MGIE 2F4PA 4HF0A 4IJAA 3F21A 4RGSA 2M87A 2K02A 3IL2A 1K7AA 2FRHA 3EJKA 2P5KA 1T38A 2KRFA 2YX7A 3TO7A 4QLCU 2QCSB 4KL1A 1IRFA 4WBBA 3F6OA 3CO6C 1ZYRF 2VONA 2XVCA 3D5LA 4HYEA 2BNNA 3BY6A 4LLGF 3GZ5A 3AAFA 1DGRA 2Y75A 3WE3A 2HEOA 5ICFA 1FP2A 2RGVA 2ZCWA 4WXCA 1KQ0A 3F8CA 4UVCA 3WW4A 4BHBA 1UFMA 2I45A 4BHPA 3DPTA 4LGWA 4Q4ZF 3PQJA 1ZZBA 3SCGA 2EA2A 3F8FA 2IXLA 4RGUA 2O6GE 4EM1A 1ZN2A 4YIIA 1ZNPA 2G7HA 4XFGA 3W6JB 1BIBA 2MLKA 5I8TA 3E5UA 2NS0A 2A3SA 2IA1A 1LJ9A 1GVJA 3EETA 3MDPA 1IXRC 4EJVA 3KFWX 5ED4A 2Y0MA 1ZRCA 3U9GA 4WK8F 4MGYE 1HQCA 4KMUX 2A6HF 1KU9A 3H9AA 1I5ZA 3KP2A 2IXKA 4JVAA 1CF7B 1W4MA 2ZKZA 4OMYA 2XIGA 2YSRA 4Y13A 4L0ZB 2QENA 2GQQA 3HSRA 3KZZA 4HX8A 3CEWA 3R0JA 1F5TA 2VECA 3BB6A 4YRDA 2L02A 5ICEA 1K78A 3ZMVA 5HVQC 2G9WA 4AVBA 3OOPA 3VODA 1UIJA 3OTFA 4EVIA 3U10A 4Z82A 5CJ9A 4UXAA 1B9MA 3F8NA 5E1ZB 3O14A 4EM0B 1HKTA 4ZYHA 3QP5A 1L3LA 1J9IA 2EB7A 4EJTA 2KIFA 3F72A 1RL3A 5D5UB 3CUQC 3TNPB 2ZMEB 2EFPA 4AXOA 2XROA 5AVPA 3LWFA 5LGTA 1C0WA 1CAXA 3H3ZA 3LFKA 1RIOH 3CLPA 3PQKA 2MC3A 2IC1A 1K78B 1JUHA 4JV4A 2ZJ2A 2W24A 2OPKA 3E3VA 5FLJA 3FMRA 1WRJA 3DKWA 1CF7A 2R7DA 4EWAA 2DTRA 4CHUA 2PBIA 1ZG3A 3ETQA 4ON0A 3E6DA 3I0TA 1PP7U 1KQ8A 3HTSB 4Q0QA 4KWLA 4I0BA 4ESJA 3K0LA 1D8JA 3Q9VA 3FZ3A 1OYWA 5DYMA 5LHIA 2FMLA 2LDUA 4OOIA 1MDMA 2OAZA 1LKNA 4GCVA 5HDKA 4D0PA 3V8KA 5AIPA 4HLYA 2ATFA 2B0LA 4XFHA 2MLGA 4KNYA 3ROUA 1NXMA 4AVPA 4I01A 4MTEA 3RKYA 2FE3A 4RS8A 1SMYF 3DFGA 3FXRA 5ILUA 3BDDA 3OCPA 4BIFA 3H3UA 3F3XA 4XF1A 4OIRF 3ECOA 4FX4A 2OA2A 4BH9A 1FWZA 5BY5A 5FO5A 5I91A 1TQMA 2Q4SA 3D0JA 3RKXA 4WF2A 1KGSA 1W5TA 1Q5OA 2WWYA 5DD4A 3M70A 3IWFA 2IRFG 2DT5A 4XLPF 2DK5A 1Y9QA 4LA3A 3U0ZA 3HYIA 2P6TA 4UVBA 5DUKA 1K79A 2FNPA 2VOOA 2PN6A 3FE5A 4CZZA 1RZ4A 2P17A 4FX0A 1SFEA 4RB1A 1WLTA 1YFYA 1YIOA 1YW8A 6PAXA 4O9GA 2ISYA 3O2PE 4P96A 2FEZA 2DO7A 3U11A 3TOAA 1QXRA 4L9TA 3V8JA 3HT2A 2D93A 3BU7A 4RGXA 3D82A 1LEAA 4N0BA 2XV4S 4LG0A 1WSUA 4FT8A 1OKRA 2LNBA 3M9AA 4OFGA 1S7AA 1GHCA 4UXNA 3I4PA 2MH9A 3JW4A 1CAWA 4YYOA 2XAQA 4J1XA 4KIFA 1FY7A 3BROA 2NAZA 5D4SA 2VBYA 2WFPA 2D2WA 2F5CA 1CAWB 1T2KA 3K1PA 4ZYDA 1K6OA 1ZZ8A 4HSLA 1X82A 1Z05A 2A69F 2PQQA 4ZZDA 5D8KB 2HKXA 4GXOA 1E17A 2QZ8A 5I8SA 3REOA 4IETA 2K27A 3IDCB 5FGMA 3EYIA 1USSA 2XAGA 1LQ1A 4MX3A 2VC1A 3NKTA 2JT1A 1I27A 4OINF 1NE4A 3EQLF 5LRSA 1PM7A 3S7EA 4ESFA 2V79A 4AIJA 4QMAA 1MJBA 1DZRA 4HN0A 1ONVA 3KEOA 2CAUA 2O61A 1LDKB 3JZVA 1NE6A 4XLNF 4A12A 3RYRA 2C0ZA 2W84A 2PFWA 4IRGA 5J7MA 2UXNA 2K0GA 2HTSA 5D5WB 2ZXJA 5CLSA 4QX5A 1LB2A 3H8UA 5I8YA 3TO9A 1YW9A 2GXGA 4KYWA 1S8NA 2XAHA 4NVPA 3M1EA 4META 1FX7A 3SFZA 4MUVA 3JAMK 2M45A 4XF3A 3TO6A 4PZJA 3HSFA 1RNLA 4WCGA 1J7KA 1ZG1A 1GQHA 2MD5A 4S04A 2TDXA 4WX9A 4QGNA 1T6SA 2D5HA 2WC2A 5EEHA 5K5OA 1TNTA 4MH0E 3BP8A 4LULA 5CVRA 3B02A 2D45A 2JSCA 2P7CB 2PJPA 3G7DA 1P2FA 3HRUA 3LAJA 4M6XA 1OMIA 1T0FA 4AD9A 4ZH4F 1HSJA 3HOTA 3IBMA 1BN5A 3BJAA 2HDCA 4S05A 3HTUA 1ZZ7A 4IERA 5LHGA 5E16A 3U1DA 3IWZA 2BNOA 1YHFA 2O8XA 3RJPA 4D7TA 5FLIA 2OYZA 1QBJA 4ZYGA 3ZMTA 3R61A 1RTVA 3EHKA 2CWEA 2QQAA 3GEZA 3OV8A 2PAMA 3WTSC 1R5GA 1DUXC 2XL7A 3PNAA 2Q30A 4Q0PA 4AVCA 4X6QB 1SD6A 3LAGA 4Q0VA 5CYVA 2N7GA 4JQFA 4CDGA 1STZA 3J80Z 2ZKLA 3T8RA 1EY2A 3LA7A 4LUMA 3KLOA 2K4BA 4HSJA 2IXCA 2J5OA 3TOBA 4MEXF 2FQPA 3CO7C 4U7BA 4IEVA 3ZN0A 3FJSA 3WTXC 1Z6RA 2ZMEA 4BHCA 1ZZCA 5KVRA 4Q29A 3K2ZA 3SHRA 1WI9A 4LG0B 5L3FA 3KE2A 1LR5A 1YFHA 4E2QA 2VC0A 2PHDA 2PMUA 4RGRA 1FYKA 2EVXA 1FZPB 1VJ2A 5LEJA 2IPQX 5J8FA 1SD4A 4LMYA 3LAPA 3MAJA 3I64A 2FBHA 5JVTA 3UKVA 4FAHA 2BYVE 1OFNA 1QGPA 1YW7A 1R5HA 1EH6A 2DU9A 3FFQA 1GQGA 2QWWA 1T98A 3HRSA 5AONA 5L3GA 5FPZA 1W5SA 5A2QZ 4P9UA 1PUEE 5EFUA 2D5FA 5I0TA 5JAXA 2FMYA 3VHRA 2JPBA 1J2XA 3DP7A 3KEQA 4U0WA 2IA0A 1EH7A 1Q1HA 3VOEA 1XN7A 1IXCA 4E2GA 3KZYA 3Q5FA 4CXFA 2HYFA 4MGKE 2QYOA 4CGZA 4B29A 3E5QA 1S3JA 3FX3A 5HLHA 1NHAA 3IDBB 1O57A 2W25A 3ELNA 3NVCA 2DAOA 2QLZA 4KN7X 5CVVA 5HDGA 4KU8A 1I6XA 3WE2A 3PFIA 2A5YB 1J3PA 2HFHA 1QY4A 5FDBA 4QM9A 2IXHA 1FBUA 3IHUA 3S7IA 2HKOA 3QACA 2CQKA 1OI6A 2CAVA 3ZQ7A 3GWZA 4QXKA 4L5IA 1TW2A 2BE5F 2HZTA 3MFKA 2QNKA 1ZRDA 2FXAA 2FA5A 2ADUA 4DINB 1ZGJA 3GVAA 2P7VB 3UKNA
chains in the Genus database with same CATH superfamily
2COBA 4A69C 4MGZE 1WCUA 4P9IA 2LMDA 2CYYA 3TB0A 3WT3A 3CHXA 5IT9K 5J96B 4RGAA 3MFAA 1JYVA 3N4MA 1TNSA 5FLMJ 1N78A 1V6NA 3AYAA 3ZN6A 5C44J 2E2HJ 5F6KA 2JTVA 1G9BA 5H20A 3I59A 4KNCA 5IP9J 4W97A 3AP4A 3OD4A 4W8JA 1W7PB 1JN2P 5GLTA 1JHHA 4RD7A 2RMU3 2DCJA 1Y9GA 4Q48A 2J1TA 1UHWA 1U6GA 2AHQA 4AI0A 1GP6A 1IKQA 3VBOB 3R4KA 5EXOA 2X1CA 1POV0 1DQ2A 3GHNA 3CJTB 3O1RA 4A3BJ 3N9NA 2H94A 1K5MA 1AWCA 3I3BA 2CJJA 4AF9A 1WW4A 3IB3A 1HSTA 3D4KA 3V4GA 2HWF2 1LGBA 4EJRA 2WL1A 1K61A 2Q8CA 3S2HJ 1ZAOA 4IHXA 3OS2A 4XBQA 3FMQA 5FMCA 3N97A 1ETVA 3IUOA 3U2RA 2IWGB 3BJ6A 1ULGA 4AQ6A 1W28A 5D8LB 1G3YA 4C2UA 9ANTA 4WM7B 5J3UA 1CX1A 4U0YA 1XSRA 4ASNA 2HLEA 3WG2A 1V55H 2HYKA 4B7EA 2V09A 2BBYA 5FO9B 4RR3A 4B1LA 1UXZA 5FY8A 1ZLJA 1GVDA 2WNVC 1S6LA 2AACA 3BWGA 5JWPA 1G3SA 1LOFC 1XSDA 2XJTA 3SZPA 3WTYC 4HT1T 4AFBA 2COMA 5L9BA 5JI6A 3LDKA 2OUMA 4LB5A 4TXWA 3H50A 4ORFA 5FZ6A 5G04L 3JRAA 2DFBA 2W92A 2PXJA 4J1WA 2BZTA 1XTAA 4AUXA 4XOTA 4I99C 2JQ7A 2FUG2 2DQRA 1O4XA 2KISA 5H9QA 3J7AY 3CF6E 3ZR6A 1URXA 2ZACA 1L0OC 4OI1A 3KD4A 4IEJA 2JZYA 3S0MA 2IVMA 3CC2I 3AP7A 1QDOA 3VHPA 1Q3EA 3GFMA 4LKDA 3HQXA 3EUKL 4Y4RA 4KIGA 1JS9A 2L01A 1E5SA 3ZVXA 4YW5A 1JYTA 4ATEA 4URAA 3M3IA 4XSZF 5TSWA 1HV0A 1ZZ6A 1X7NA 2VXJA 2O5RA 1DGWX 4HX7A 3PSFA 1PJRA 2DUPA 3TRSB 5F9TA 2CV1A 5LB6A 5D1IA 3MF9A 5EHDA 1N3PA 2A6WA 2OZJA 2ESHA 2XRNA 2YMZA 3DLAA 1I50J 2K40A 4BQAA 3KPHA 4J19A 1UN1A 2M4GA 1SLTA 4BJ0A 4FPOB 2DA7A 2PLV1 2R0QC 1DP0A 1RC6A 2ZPXA 3SHFA 2R061 1VF9A 5JCTA 1YHQI 2FX0A 3MZHA 4Q4Y1 2FBEA 1JKQC 1RR7A 2AYHA 1H6XA 3G1MA 2GH2A 5SV5A 3CCMI 5CVUA 1BC8C 2QQWA 2WV0A 3W2WA 2YC4A 3JREA 2R041 3WD5A 1HW5A 1UKGA 1NZIA 2J22A 2YPJA 1LNSA 1OPMA 2LF7A 4XJWA 1UD1A 4OULA 3RPQA 4LNVA 4F93B 4CU7A 2R063 3ZOBA 2F4MB 5K7HA 4EGYA 4KISA 2VODA 3DWLE 4KG8A 4DJAA 3PJQA 3VD5A 4D7SA 2XUMA 1UOGA 2HOEA 3Q0VA 2TUNA 1W04A 2ZGSA 4JK1X 3WR0A 1HB1A 1H6YA 4CA9A 4ASMB 3QD6A 2OBPA 1QMJA 3M1HA 3S1QJ 5FPUA 5C3SA 1TP4A 1Y9MA 3MPBA 3NO8A 2JIJA 1MS1A 4ZTFA 3VB2A 4IV3B 2M8EA 3DTEA 3DGTA 3IRRA 4HF1A 3S5QA 3RZDJ 2Y0SN 1BBYA 2BEOA 3AM2A 1RVF2 3IPVB 2RNJA 5KHHA 4QPIC 3CESA 1VTNC 4L92A 3VN4A 2WZR3 5IW0A 3UK9A 4OLLA 1B8IB 5CQGA 1UY3A 2H1KA 2SBAA 1GP4A 3TKYA 4QQLA 4EV0A 1LEBA 4GH4C 2L7FP 2X29A 4AIDA 4ZZLA 3CCUI 2D40A 3PL0A 2ECBA 3FLPA 5GAHJ 3MMYB 2E32A 2M4KA 1J84A 2HWC3 5HLIA 1HDKA 2VZSA 5FROA 3RDIA 1RUE1 3TW6A 1JTZX 2EALA 4KWKA 3MLLA 2Q8KA 5FLXK 2X6XA 4ES9A 4K2EA 2BP6A 1XXNA 3OPTA 4CDWC 1UL9A 5GTHC 1WMFA 2F2EA 1JYWA 4M6YA 4FBFA 1LPQA 2L7MP 5J47A 4FOQA 1X3UA 4KT5C 2P5LC 1SLBA 2AQFA 1V4RA 1IPJA 4RFRB 1VE0A 1ODDA 3EO6A 4DB5A 1VZ0A 4OHZA 4SLIA 2PMWB 3KV5A 4MQ9F 3MW3A 4KWJA 2D6PA 2EF6A 5IVFA 5FO8B 4I2OA 2RJ2A 1STMA 1SLIA 2OQGA 1BZWA 2WN3A 2VBWA 1JODA 4CCLA 2MG4A 3LSJA 3H9GA 1W0UA 2LR8A 1LRHA 2VBXA 3Q8BA 2FNAA 1QJY2 1MNMC 4A6DA 2Y48A 5FY1A 2ID4A 1T8IA 3DPLC 1KJRA 2VZTA 4IHSA 4HOBA 4F7ZA 3KCXA 3VDDA 4CCCA 2OPTA 3C8XA 4B4PA 2KJCA 3A03A 1UMHA 2I74A 2NS8A 5FZ8A 3HIFA 4FISA 3I58A 3SNMA 3K1NA 5CZKA 4DQAA 3JB4C 2UU8A 2YGMA 4XCBA 1QQP1 2Z79A 3H3VK 2HYXA 4XVHA 4DEVA 1OYIA 3IKTA 4YFXF 3PURA 2JDYA 4MNUA 5ABJC 5F5AA 1F43A 1UY4A 4DUVA 3AZZA 5F3IA 3HUGA 4G6TB 5BOXA 3M4FA 5HV4A 4TTGA 4EZ4A 5EJ1B 3ACGA 2YU1A 5JHFA 1A5JA 5KHIA 1N3OA 1AR71 4ABZA 4K8FA 4LQRA 1HKQA 3VKOA 2G9FA 1R23A 3ZXFA 3X2QH 3HKZA 1TME3 2XVKA 3W9AA 4ZY9A 5IT9Z 4IDZA 2F5VA 4R9AA 5FY4A 4MOAA 5E79C 1XMAA 4COUA 1BKZA 4MXVA 5D5VB 4FPEA 5HNFA 4Q5OA 1OCRH 4BUPA 2ACJA 2ETEA 4IL7A 5F0CA 5BPXA 3VBRA 1N1TA 3OJBA 4C3JJ 2WABA 4BNCA 2OZUA 3VD7A 4M3CF 1QF3A 5FYYA 2X5IC 3GM8A 1D4M2 2EJRA 2EPFA 1R1TA 2P3YA 1XCBA 4HA8A 2GBYA 5BQTA 4N8MA 3BPZA 5JOWA 2VGDA 4F91B 3C7HA 3R05A 4YG2F 1ND3C 3R4UA 4IOAF 1D8KA 1ORKA 2CDPA 5CG9A 3PFYA 4OUMA 2Q5TA 3KQ4B 1V9U2 3K3OA 3K77A 5FD5A 1UMZA 1VBC1 1V6IA 5IHRA 1BI0A 1UZVA 1C1FA 3V65A 4LJHA 3S6PA 1HQWA 1TMF3 2XLFA 1IN6A 1GZCA 3CDIA 3POSA 5J37A 5T5JA 3ZKYA 4DMIA 3BG6A 4CP9A 4HPKB 3BUCA 2EV5A 3VDAA 1VMJA 3K4JA 4V19K 5J98B 3UKTA 1VQ5I 3FXLA 2ZKNA 4IEUA 2NNNA 3GFIA 3ZX7A 4C3IJ 3ORJA 1GZTA 3OB8A 5CYYA 2E51A 1W8ZA 4Q4V2 2F6BA 4I7HA 2ZX2A 4Z2YA 1SPPB 5CPRB 4QPGA 2BWCA 1IS6A 4N43B 5FZIA 1ZQ3P 4KT6A 2DW4A 5A3TA 1WMEA 2KKOA 5J36A 1W6PB 4LEJA 3TP0A 3RYKA 1MH4A 3C18A 4XJ9A 2VMDA 5EEGA 3OYNA 4XEZA 2LBFB 4PDWC 1R093 3KP5A 3MWMA 1RUG1 5KC6A 2QQNA 5EJCA 4ENKA 1BVP1 4A7YA 5GAGJ 4BE1A 3ZYIB 1QVTA 2GNDA 1OLME 2DV9A 1CAXB 1BR4A 4EWDA 2C4XA 2CW0F 3BR2A 4G9SB 2DDUA 1BC7C 1DLLA 3L2HA 2DYCA 2DN0A 2K4JA 2C6YA 4IRHA 1L7RA 1R092 2G1MA 3LB9A 1E5RA 3HUGB 5FZ3A 2XKPA 2GOMA 5IOYA 1LOGA 1DQ0A 2FQ3A 5F39A 3H92A 4DUWA 2HWF3 2XXZA 5T55A 1O3SA 1LGNA 2CG4A 2RDRA 3CLQA 2DT7B 3ZFEB 2KIMA 1OLQA 2E6VA 4XURA 1MJ9A 2WS93 2Y6KA 1QU3A 4LLOA 1IQAA 2VT2A 5AC92 1D0HA 1N77A 2B9UA 3MKYB 4Q1RA 1I1GA 5FMOL 1T33A 4YEJA 2L9SA 2JDAA 3MIGA 2E1MC 1N1VA 2R1DA 4LB6B 2JG9C 3J4UH 1EA3A 3VLBB 3DLLF 3EMRA 4AI3A 1UZYA 4JX4A 4ENMA 4RHV2 3LEIA 4HAMA 2P5VA 4Z07A 4I09A 3CU7A 2XGDA 4C0BA 1ULDA 4LBQD 5KWRA 4C0HA 3HGYA 1RUD2 5JVGF 1SG3A 5FP7A 4BU2A 3E0JB 3RI4A 4JDMA 2Y38A 4XUOA 4XKVA 5DAPA 4J01A 1QOSA 1AU7A 4CTEA 3F95A 4KMFA 5B4NA 4CDQC 4EN6B 3VYTB 5B1AH 5F0HA 1GKBA 1RR8C 1EP0A 2UY8A 3JRIA 4H7LA 2DA6A 3HGGA 3VFZA 4AQSA 1UB9A 2WO2A 1XG1A 3QCWA 2CO5A 5E3MA 1OQDA 4LKFA 4C8DA 3ECHA 1YITI 1LOAA 1OLRA 3FF5A 3VBFC 3GZUC 3BR0A 2VVFA 3EXUA 2B8MA 3OOXA 4PI0A 2LKPA 5J1YA 3GF6A 4UF0B 1NYWA 4BK4A 2W1WA 4V2GA 1PUFA 3NQHA 1G6NA 5I0DA 4HQEA 1IDYA 2N8GA 3IMMA 4YW6A 2UY9A 5IT6A 3L09A 4QWNA 2K3PA 1AJKA 4N53A 1RUI1 4CDUA 3SJMA 3CUQB 4BISA 1W8FA 2CL2A 4UUTA 1MEC2 1YLLA 4OIQF 4A3XA 1W8TA 1LHVA 2YUSA 4AFMA 5KHDA 1XNKA 2CS3A 3C7EA 4GZ9A 3U78A 4Q0SA 1ZBE2 1BI3A 5FLVA 5DS9A 5HPOA 5DD8A 4ONUA 1PGW1 2PHLA 4XFIA 3HOWJ 1PO11 2DPUA 2BZDA 4K6BA 4MHUA 2H0VA 2VMIA 1OA4A 4Y1XA 4M3BA 4E4ZA 1RYYA 3HPNA 4OZOA 1XS9A 4OQ9A 5GZFA 3MPPG 3IH2A 3WUDA 3DF8A 4AZZA 2OU2A 3T0YA 4TLFA 4FPCA 1F35A 3VWBA 2BQPA 4LUKA 3V8LA 3OYJA 4YGCA 2BWAA 4LA2A 2H27A 3URFA 1G3TA 1TE1B 1BI2A 3E6BA 2BVVA 2YYOA 4M3CE 4ZDPA 1GV9A 1OYYA 1JHJA 4WVZA 4XN0A 4G4FA 3JU9A 2UV1A 1TQIA 3H36A 1AVBA 1J0RA 1WBFA 5FQ0B 4YG3A 2J1EA 2DLLA 5EPAA 2GA1A 4NIDA 4S2DA 2DCYA 4ARYA 2HWE1 4QHOA 2XBO2 4GH4B 2JECA 3H1WA 4P9GA 1XCVA 4FTHA 2EXHA 3J80K 2VO5A 4YM0A 5FXVA 5F1RA 1LOCA 1OVSA 2OX0A 5FZMA 3OF1A 4AVTA 3OSDA 5EP9A 5HS7A 1S9HA 2DPDA 1E3OC 3VBUC 5FP4A 1OQYA 2R4GA 4MO3M 3ZMUA 1CQTA 4IQPA 2M5WA 3AVRA 4AHXA 2VKDA 5H9SA 4N7UA 1Q43A 1ETYA 1GXQA 3K70D 3WNXA 2ZMLA 1J75A 3L2YA 3DEUA 1US2A 2R7FA 3ZMZA 1WI3A 1V6KA 3F8MA 2RNGA 5JDBA 1Z91A 2G4IA 2JICA 3WG3A 1JOBA 1IXSB 3Q8AA 1HC8A 3MN2A 5E1RA 2LRDA 2RM21 5BMZA 1UQXA 4G9YA 1JYIA 1R00A 1WHUA 2OCEA 4IE5A 4AVVA 1IW7F 4UBGA 4MV2A 2FOWA 1MNEA 5L3BA 1ZLKA 4IEPA 2JA8J 5JZGC 1IS5A 4Y17A 2DDAA 3WGHA 3CD6I 2JPCA 4XICA 2L9NA 1OXCA 4IV1A 4CDXA 1RHI2 3CO2A 1RXFA 3SCFA 3CDHA 4LITA 1IG0A 2XAUA 1OVPA 3WQ0A 1UNBA 1I3HA 1CN1A 2BJSA 3I2JA 2X1EA 3HHHA 3MYXA 4K8RB 3JD72 5K1YA 4UFJA 1SACA 3VDXA 1WLWA 1VRBA 3JQWA 2BY0A 3Q8CA 4Q0UA 3RFRA 2EA4A 1KFUL 4GGGA 4NNJA 1V5EA 2K5CA 3ZXEA 5G05L 5BNPC 3HJRA 3IAS2 5B66C 4QQHA 2W0XA 3DXJF 4OHYA 3MUZ1 2IS1A 1MVQA 2GIZA 3NWTA 5HLGA 3ZXAC 1XNDA 4JGZC 5HCBA 1K6YA 5L9VA 4YPJA 3J7YJ 5DMYA 4FTSA 3ZQIA 4XFFA 4OI2A 3VD4A 1SEFA 4FOVA 5GTIC 3FC0A 4XSXF 4UW5A 1DG6A 4H14A 3CUQA 4COWA 3PIGA 3BOWA 3GFLA 2VL4A 5J40A 1OURA 1XE8A 1AL22 3GYDA 5J1UA 2HQ5A 4IOCF 2X10A 3RKQA 3ST7A 2ZAHA 2ZJCA 3POFA 2F6CA 2VW2A 4MGIE 1DIWA 1EAH2 1UKRA 3BCBA 2BW8A 4RGSA 3POIA 2M87A 2K02A 3EJKA 2KD7A 2YX7A 1E3PA 2W52A 3TO7A 1C8M3 4K1ZA 4URTA 4AK3A 1IRFA 1LHUA 2GMPA 4P9WA 4WBBA 3QYFA 2VONA 1VNDA 1RUH1 5CKNA 3I4MJ 5DDJ2 1VQ8I 1WH5A 3H9QA 2P3IA 3SYTA 3J7MA 5K9YA 1MIJA 1FP2A 4LO6B 4TWTA 1JBCA 2O9LA 3WHUA 2VZRA 1UO9A 2OV7A 4BHBA 1UFMA 5E88A 2I45A 4QX7A 4BHPA 3OIQA 3PQJA 3SCGA 5A7PA 2O6GE 2E53A 4C1WA 3VUOA 1ZNPA 3W6JB 4NIIA 3W5MA 1BIBA 1WJEA 4IV1C 4CDXC 3UETA 1RKTA 3V0AB 2A3SA 4AEDC 5A3UA 3WG1A 3GTGJ 1Z77A 1DU3D 3KFWX 5FZAA 5FFOC 3WX5A 3U9GA 4WK8F 2NQYA 2PMZN 4BQ5A 2A6HF 1CIYA 4CZSA 1KU9A 3H9AA 1CF7B 1W4MA 3TYJA 4OMYA 3HL2A 4XQ4A 4XAAA 2XIGA 3ZPYA 4II2A 3WQ7A 3R0JA 1ZYBA 4YRDA 3VZMA 3LFMA 4JHTA 1IV6A 2G9WA 3VPRA 4AVBA 3OOPA 4Q4V3 3VODA 1H30A 3TAYA 5CG8A 4NN0A 2JA6J 4UXAA 4BOWA 5EV7A 1AXYA 3P5JA 2JWPA 3M07A 3QP5A 3KB5A 1L3LA 3F9KA 4PLNA 3HNBM 3F72A 4CDQA 1NK3P 1F8VA 1MVEA 4E27A 1IKPA 4XHBA 2W94A 5K0UB 5D2AA 1ZBE1 2XROA 3BI3A 5LGTA 1NLSA 2WJSA 3KYLA 1H2MA 5A7SA 1OQ1A 1RIOH 1QGLA 4CE8A 1W36D 4YGDA 1DGWY 1MBKA 2CQXA 1BA5A 3LIGA 3PNTA 3FMRA 2VKHA 2FDFA 2IS4A 3P5BA 1WW6A 1CF7A 2R7DA 1HV1A 4QKBA 3VYUB 1ZG3A 3E6DA 3I0TA 1WZ2A 1LULA 2YBPA 5C9AC 1KQ8A 4BQ2A 4GJYA 2E71A 3BLYA 4Q0QA 5FY5A 4KWLA 3O1PA 1MS3A 3FK7A 4I0BA 2LKXA 1YQ8A 3FZ3A 5DYMA 2R0HA 4GCVA 4QDRA 4FXGB 2CUJA 2VZQA 4O65A 4D0PA 3V8KA 5AIPA 5IVYA 4QAWA 1W6MB 2OQ7A 3ZO0B 3PUAA 4Y5Z0 1Q1VA 2X09A 3PJRA 1TVGA 4XFHA 2ADDA 1FOD1 1NXMA 4OHWA 4I01A 1UZWA 5GAEJ 4RS8A 4CXXA 3OGGA 3BDDA 3MIHA 1DQ6A 3R4SA 2E7QA 4FX4A 2CY6A 5FO5A 1OF4A 3GTPJ 2TEPA 4HG2A 1KGSA 3K4MA 2G19A 4RHV1 3BIWE 3IH4A 3HG9A 1LFUP 1C5HA 2DBIA 4A7ZA 1Y9QA 3LD8A 1TZLA 1AYM1 4MG2A 3J8F1 4UVBA 1D2SA 4DEQA 3EPZA 3J7HA 4PSXA 4LMFA 4RB1A 1HRV1 1YW8A 2IS2A 3BTIA 2ISYA 3O2PE 3DCFA 4P96A 3ZQLA 2P2KA 5A7WA 1DP3A 3DTKA 3H5NA 4RBOA 1BEV2 2R7UA 2EZHA 2VJXA 1Z67A 5C4WC 3D82A 2JSPA 3X29B 3RZHA 4W50A 4M3CB 3J7LA 1LEAA 1BK0A 5IVJA 1DQ4A 2Y0SA 1AYN2 4LG0A 1T08B 3RCOA 1VQLI 1FNYA 2VC9A 1S7AA 5FOBB 3D6EA 1Z7LA 2M7AA 4EEFG 1POV3 3JW4A 4YYOA 2XAQA 1H8TA 3G1LA 4M3DA 4FXKB 4C2TA 1JZ3A 4BIOA 2ECCA 1T2KA 1W6NB 2BUKA 5IWFA 2A69F 4ZZDA 5D8KB 2OT7A 4QPIB 4CP2A 1QKQA 4B1MA 3REOA 4CXYA 2K27A 1RVF1 3AMHA 3OGSA 2BPA2 1CR7A 4CCJA 4OINF 2VCAA 2W1QA 1PM7A 1LTEA 2ZX1A 4YZ4A 4XBLA 2NP0A 3U1XA 4AIJA 4PFPA 4QMAA 4LBOA 4JCKA 4NE9A 1ONVA 4FQGA 1MH3A 3NV3A 1BMV2 3JZVA 1NQJA 3MICA 4XLNF 5FXXA 4ZKTB 5IPAA 4LXLA 1DQ5A 2W84A 5ACA1 4XIOA 2AENA 2HTSA 4Y1UA 1HRI3 4QX5A 4DRVA 1JYNA 3THTA 1TZOA 4KYWA 1S8NA 2W1SA 3SFZA 4E7HA 4MUVA 3JAMK 4E4HA 4E9KA 3R0RA 1XJAA 2UWBA 3MV11 3ZIXA 3IV5A 5D8AA 3VBRC 4QX8A 3HSFA 2WZR1 1RNLA 4DZPA 1LGCA 4NROA 2YC0A 2MD5A 4HK9A 3TN92 3I8TA 4YGBA 4AI2A 1AJOA 2ZGKA 3T3YA 1T6SA 3SEEA 1MMGA 2DMNA 2CGNA 5LBCA 1VPHA 3B02A 2P7CB 4FP2A 1KZHA 1OD3A 3LAJA 1OMIA 2L9RA 2WWJA 1BN5A 1RUE2 4S05A 3HTUA 2D6LX 3IWZA 3RJPA 2X5IA 4XQWA 1R1ZA 4FFGA 4XUTA 3C2UA 2CWEA 1JZ5A 2WN2A 1SVLA 1MEC3 1ND3A 2NMOA 1SC7A 5J4YA 4ITVA 3ENRA 4CDGA 1L7QA 2LC2A 3J80Z 3RI8A 2XVLA 1GOFA 4LUMA 4RL7A 4HSJA 5LBBA 4HPQA 3O1TA 5T54A 2XSJC 1ODNA 2MABA 3FJSA 2Y6HA 2EQRA 1ZZCA 3KLSA 5L19A 5KVRA 2R93J 1WI9A 2PMZA 1W9WA 5FY9A 3ZSMA 4M3CA 1RUE3 1YFHA 4E2QA 3OSFA 2VC0A 4PCRA 3DBLB 5FK8A 1FYKA 1FZPB 1VJ2A 3WQ1A 4L0PA 5FJHA 5F6LB 5CBLA 3POWA 2FBHA 4FAHA 2BYVE 3DPRA 5C3PA 5T5OA 3ZN6B 1W6OA 2GP3A 3KHCA 2LK2A 2HEWF 1W5SA 3MIDA 5A2QZ 2D5FA 2FMYA 4DXSA 2X9DA 3O1VA 3VKMA 2VXRA 4CCDA 3VOEA 3A23A 3KZYA 3Q5FA 3DEMA 5LK7B 4IV1B 4CDXB 2QYOA 2XBO3 3E5QA 1YIPA 3FX3A 1FMWA 2P4EA 1NHAA 3IDBB 2WT0A 1HRI2 1YJKA 1AF9A 3OIOA 1MS9A 2WNUA 1QY4A 2AEYA 1VBC2 3LF7A 3IHUA 5KCMA 1OI6A 1W0PA 4QXKA 1KS5A 3MFKA 3HC7A 2P1BA 3NMBA 1ZRDA 1VIWB 1W8UA 4UF0A 1JGGA 4JGZB 3KCYA 3P1IA 2VQUA 5BYNA 1WWYA 2E36A 2IFWA 4QTRA 2WAOA 4L2NA 2WKKA 3BKZA 4PIZA 4KI5M 5GZDA 3LOCA 3UT0A 4UB8C 2DQLA 1J59A 3BC8A 3MFCA 3O1OA 4IEOA 4HX4A 4PJYA 5IFPA 1LOBA 3H1YA 5T5LA 1V9U1 2VL8A 3O0WA 5FPXA 2ZZJA 3UKGA 1U5ZA 2R7QA 4AIHA 1JMUB 3L2WA 1ENRA 3OOUA 3CUOA 2R072 3GF2A 1I9RA 2G7UA 4P5OA 2A3WA 2CTVA 4A44A 2XLAA 5C4XJ 3KVAA 3FWEA 4JKLA 3BR6A 1TMF1 4LBLA 3IZOA 4NRMA 1FPN1 4N9IA 2Q1MA 5JZGB 2Y0OA 3BCWA 1W6NA 1DU0A 2R062 5KAFC 2CV6A 4PQ9A 1ZK8A 4MADA 1FAYA 4YG0A 3NJZA 1VAKA 3AKZA 1H8TC 1VR3A 2V9PA 1B09A 3CLOA 3ACLA 3M2MA 4IQ4A 1GT0C 1YRNA 1AYM2 3GTMJ 2W1UA 1LU2A 4XFBA 2DUQA 4Y1ZA 1DZQA 5BNPB 1BR1A 3D8CA 4ZU4A 3O1MA 3LE0A 2Z3YA 4MQVA 2ID6A 1WBLA 4Y22B 4QIWN 1PZ7A 2VMHA 1MD0A 3T1BA 1FOYA 4GWJA 4H55A 1DLCA 3U37A 3L7WA 3WG9A 4JTOA 4IEYA 3ZYHA 2VXZA 3FZVA 2ERFA 1IAWA 4AVAA 2MPFA 1PGL1 1SFUA 3JRCA 5FZEA 1MZEA 2RKHA 1SFPA 4LK0F 5L7OC 4XRMA 3FLTA 2HVSA 3IP4B 3NSTA 1DP7P 1U5TB 1LFPA 2W00A 2BERA 4RMNA 2FU4A 2WY7Q 5ICCA 2MA3A 1W2UA 1UPIA 4IEWA 4A3LJ 1A78A 4HK8A 2Y6FA 2K9ZA 3PNYA 4ANJA 2F4OB 3M8LA 1SQ4A 4OCTA 1J09A 2O8KA 5LK5A 2D97A 3HN3A 4IGQA 2KL4A 2A5WA 1Z78A 1IPSA 1SFYA 3BALA 4UV9A 4YZ2A 5A1AA 4QB2A 2E1CA 3ZR5A 3BTXA 1B4AA 1DHKB 1X33A 4BKXA 2RS53 1W7PA 5E18F 2F17A 1HB2A 3VGIA 1F9NA 3FK6A 1WJAA 4Y1YA 3WP5A 2ZOEB 1J5YA 1P4WA 2F5FA 3ISPA 4UBHA 4C90A 3Q0WA 1VAMA 2V5DA 4N4NB 2XHNA 5FFZA 1RMU2 2V6EA 3HDDA 1DYOA 2YZ4A 1EPZA 1XRUA 3DN7A 4JAAA 3VBRB 3E6MA 1XDUA 1OUSA 1SBDA 3VSLA 1YLFA 2QVSB 3MO4A 5DCMA 4YG6A 4DXZA 4L9NA 1CD3G 3BN6A 1UMIA 4OQ8A 1A8MA 4I76A 4XJAA 4LLNA 1QA6A 4KBBA 4ISRA 2IXJA 3OYCA 2NVQJ 2XR4A 1UYPA 1Y0UA 3GZTB 4I98B 1UZ0A 2E1OA 5FP9A 1MZFA 4KWUA 3LPGA 4LIVA 4OHXA 1YQAA 5JLXA 3JCIA 3I71A 4DS0A 1IG3A 5C6CA 3LA3A 1QVUA 1DYKA 2DOAA 5DG2A 2BFUL 3VSKA 1W2TA 3DTIA 1UX7A 2IW5A 1RUOA 1FC3A 1UCRA 4OYUA 1P6RA 1WMXA 5FKCA 1JXNA 2VOXA 4BJ5C 4I02A 2L4MA 3KYCB 4HFSA 1OHFA 4ZYEA 1V9U3 1ULOA 4GAZA 4FCAA 1HN1A 2GC3A 2V4AA 4H0EA 2PELA 2VT3A 1F15A 1ALYA 4F55A 5DDGA 1X50A 4O5VA 3LSPA 2XJSA 3MW4A 2DTYA 1X3WB 4X8PA 4HLXA 1FOKA 2ZTNA 2WQ4A 2Q8DA 2HOAA 3ZSLA 1UMQA 2FBIA 2YHJA 1ETKA 4BLIA 5DTDA 3LOBA 3J7AO 4XZPA 3R0AA 1HJGA 3J7ZI 3VBHB 2K9LA 3K4NA 1TQ5A 3BG3A 2HDDA 1O7LA 1UHSA 5JZGA 4NHLA 4AHZA 2A61A 5LGUA 5GLZA 4CO8A 4FCYA 2KXLA 4CEYA 1WCMJ 1Q8QA 5DEQA 5AFBA 1I5PA 1FSEA 2C24A 2F48A 1SMTA 4HL0A 1X3ZB 4MXWB 3S3OA 2DFIA 5JPNB 4PFOA 2R5YB 2XMLA 4XNFA 1TME2 3JBG3 3QU3A 3VDDB 1AKHB 1Y56A 4KDPA 1DPUA 3WCRA 2VCCA 2LTNA 4NHKA 2XUBA 1JJ6C 1U5TC 2R3SA 3MZYA 2H09A 3P9CA 5IUQA 1S0BA 1O3QA 4FOYA 1F5JA 1B35B 4RAYA 2XPUA 4XACA 2AO9A 1RGSA 4GKYA 3GLXA 1MGTA 4ES8A 4U36A 4TV7A 5FYZA 5A32B 4ETSA 3ACIA 4RA2A 1RMU3 4MTDA 1O4ZA 3T09A 3QU6A 2VNGA 4WV8A 4IESA 3LSTA 1DYPA 3VKNA 3CCRI 5TJJA 4IKFA 2EAAA 4MGSA 2VMGA 3CTAA 3L2VA 1KU3A 3EUAA 4W6XA 4E8DA 2VUAA 3VBSA 1NLQA 5E1WA 3DXTA 2DFEA 1VBB2 4CCEA 2E33A 2BW3B 4NC7A 1OUXA 1UG0A 2O8OA 1JZ8A 5AIQA 5DCMB 4DY3A 3KP4A 1HKSA 2CV2A 4YW3A 4FAGA 5IATA 2VKVA 1ZRRA 2FDIA 4PF1A 2EXJA 5FPVA 4FFFA 4AVSA 5A2QK 1OH4A 1FNZA 2XDVA 1AR81 2CHHA 3D1NI 4AU7A 4FE7A 3JAMZ 2NMNA 2DUOA 1IF1A 1ENXA 5IVEA 3RVHA 5FZHA 1Y6IA 1IC8A 2NZ9A 2WO7A 3GYHX 3B73A 3UNPA 1Q56A 4HSTA 1HF0A 2FCVA 4F52A 1FEXA 1VBE2 3LEGA 2RV8A 1UIKA 4AFAA 4BQYA 2K9NA 4V1PA 3OSGA 3RG0A 1XSVA 1RB8G 2CDOA 2YROA 2D6NA 4FFHA 4XRSA 3CMYA 1R36A 3C2BA 3NEUA 1S7OA 1KA8A 2HWB3 2W68A 3K4AA 1ERDA 4LJZF 3U75A 2H6BA 5ILVA 4QM8A 1XGOA 3R60A 1K83J 2RS51 1CJDA 5A6XA 4S0HB 1RI7A 2ZX4A 4QB1A 1U3EM 5FBZA 1K42A 1S0EA 3M3OA 3LGRA 2A6VA 2VOVA 1R1UA 1N47A 2JA7J 3LEKA 4CXWA 1BW5A 5HCHA 3ZYJB 2NLRA 4ZDLA 4JDOA 5A3OA 5IP7J 4XC9A 3ZFEC 2E7WA 4A3FJ 2B7YA 3MUY1 2Y33A 2TNFA 4R1HA 2V73A 4KUMA 1LODA 1RUC1 2VPVA 2WRAA 2P3JA 2CSOA 4PJNA 5GZGA 1FLIA 2P6SA 1WCDJ 3ZOIA 4I3GA 4YZ5A 2KRCA 1KQRA 1Y0NA 5CFDA 1D1BA 5HV0A 1V6MA 1GICA 4E7ZA 2XONA 4BPZA 2YG0A 4GMP0 2DCZA 5FZ7A 3WW1A 4WZFA 4KU7A 3NQOA 4EQQA 1I6HJ 1LVAA 1KDMA 1SD7A 4KGGA 4XF9A 2BY3A 1X8MA 2PI0A 3RZLA 1O3RA 1XU1A 2UYAA 2DODA 1I3QJ 1EYBA 3GTOJ 2ELJA 1YJ9I 2Y9YA 3OYHA 2RDPA 5GM0A 3CP8A 3U21A 2XVGA 1JZ7A 3FHZA 4FVVA 2ME6A 2B5HA 5JXIA 4HNVA 1YQ6A 2QDRA 4QKFA 1IN7A 1H8AC 2BU9A 3B94A 5FKOA 3I2KA 3BZ6A 3BR5A 1K12A 3FXMA 3DBHB 4QSHA 1DGRN 4B3AA 2LSOA 3ZFFB 3FXOA 1R22A 4IF4A 5A3LA 2FD8A 3WW2A 3QPHA 2CQQA 2BVBA 2ORZA 1EV7A 1VQMI 5E20A 1FYLA 4YFWA 3N7KA 5C3OA 3LNQA 2W85A 1HXDA 1KONA 3SFIA 2XAFA 3WDUA 2HXOA 2JE8A 2JG8C 5E3LA 1VQPI 4AYUA 3RYPA 1HBXG 2NXNB 1BI1A 1IG7A 3PLQA 3QPTA 2LF8A 2RM23 5K5RA 3AMMA 4YVWB 2QSGX 2DMUA 4IPAA 1T6GC 2WS92 3CL1A 4R79A 5JSRA 2L7KA 1NKGA 2DXIA 4ZDOA 1PO23 2JIGA 2HGCA 1JXSA 5IK7A 2DA5A 4U7DA 1OPOA 4LBJA 2VZVA 5FKNA 1X1PA 3LFUA 4PDKA 5HDNA 1OA2A 3SCHA 1Q8SA 1JHNA 2ZJPF 2NRAC 2RDNA 2PHUA 3D3AA 1JUMA 1G9DA 2YPRA 3J8F2 4L9BA 2ZJQF 4Q8KA 2R7VA 1QPMA 3LIHA 1OR7A 5ISLA 4GB32 4YFKF 1HRV2 3FXQA 4UI9L 4PIYA 3C2HA 4HQMA 4D3WA 5I0RA 2D6OX 3H7YA 4A6OA 4BBSJ 1S7EA 3S3MA 3SMHA 4LD5A 2QKDA 5D4RA 2GC0A 5F3EA 2J7MA 3DCQA 4CDUB 4KBZA 2P34A 1XE7A 1GP5A 1CZVA 4Y24A 3NNLA 3ONQA 4BY7J 1K5MC 2QQOA 1EV13 3HBLA 2A68F 2VTXJ 2E60A 2LALA 1UCXA 1TT5B 5IK4A 2B63J 3WZ1A 3K7AJ 5F08A 4O3MA 4FPGA 1H1AA 1YUDA 2ELHA 5IK8A 3JRFA 4NJ4A 2VB6A 3PL8A 2PTMA 3L2CA 1G7YA 1SD5A 1RUNA 3H8XA 2R5ZB 3K46A 1F2NA 4NMIA 3TBIA 2YXSA 4XHXA 5IT3A 2WT1A 3WNOA 5BNPA 4GULA 2WB1A 1TBXA 5GALA 2WFF1 1ND2B 4NIHA 3ML6A 3AZWA 2A71A 4Y15A 1QIQA 4UAPA 2KP6A 2DVBA 2O14A 4FASD 1XC5A 2HYJA 1RESA 4PSWA 4A5MA 1PO12 3WF4A 4HSRA 1R083 5AFEA 1N25A 4QXCA 2QEXI 2HOSA 1R1A2 4Y26A 4MLOA 2ZSIB 3NAUA 5IVVA 2M7BA 2WLPA 4IEXA 4XFAA 1B59A 2P4WA 2NNYA 2JE9A 1AOYA 1BJZA 2IXIA 2OUHA 2OD5A 1PK6C 1QZZA 3L9FA 2JA5J 3MCZA 4NPMA 4Q4X1 4BMBA 1POQA 4C91A 2HPMA 3OGJA 5C4WA 1T6BX 5DZEA 3U4SA 5TRDA 1TC3C 5EIYB 4J25A 1UY2A 2QQKA 1YO5C 1OCPA 4B44A 2KFDA 3OYWB 2IGNA 1OKQA 3SZTA 2WR9A 4AFDA 2ZO4A 5CKMA 3ZN5A 1AR61 3JCUC 1FT9A 2CFXA 1T56A 3S93A 4RLFA 3CJIC 4Z8BA 4QXBA 2GIVA 3KX2A 3MV01 1ACIA 4RHV3 1GXPA 2XAJA 1H0BA 1W9TA 2X6OA 4RAGA 5JSOA 1C57A 2MNGA 1N75A 2W95A 2ZFWA 3HQRA 3B6AA 4R8HA 2CU7A 3ZMDA 4L9JA 2ZA9A 3GLLA 2QQBA 1SFXA 2E35A 1RXGA 2VQAA 1YFUA 4E2SA 1S0JA 1D1AA 3AYCA 4G7ZF 1NQDA 5KK1A 3WCSA 4XTMA 5FZLA 3ZYRA 4AAPA 3RMXA 4CEWB 3K4DA 2BVLA 4ZU5A 3O8GA 2Z69A 1XQNA 3IH3A 1AXZA 1DPRA 2M9HA 1NCRB 1U5XA 4IE4A 2VMCA 1BOAA 3KSCA 3M3YJ 1SLAA 1UOJA 2KHMA 5FD6A 2WAFA 4XONA 5D6EA 2K7LA 4QPGB 2RVCA 3F22A 3NNGA 4NRPA 2W5FA 2CUZA 1ZH5A 2HH9A 5JR7B 1XGSA 3RWKX 1GNHA 5L9RA 3PHMA 1Y8RB 4FO9A 1SAXA 1K3IA 2HWC1 2ZHMA 1PZ8A 1JTYA 4IHWA 2TCTA 3IN9A 2CW8A 1UG2A 1VQNI 3K51A 5DUXA 1KYWA 5HLTA 1TME1 4N90A 4CUGA 3BZKA 4YZ3A 4XDOA 4AFCA 4KQ7A 1V5FA 3PSIA 1RUI3 2ZNYA 1VBA2 2EH3A 4AW7A 1ZARA 3T8TA 2BDRA 2QKMB 3IM0A 3GTJJ 3ZYBA 5DAXA 4BQQA 4JGYB 4NHJA 4MGTA 3SZGA 1ZA4A 2MHFA 4IV3A 5GPAA 5JIAA 4HV6A 1EUTA 3ZQHA 1NUKA 3H8OA 3MKLA 5BNOB 2AC1A 3QPLA 1PMHX 2GZWA 2LS6A 1VBD2 2CWMA 1TNFA 2KIQA 5F6FA 4XF0A 1YI7A 1LDJA 3C1DA 4OI4A 5FUIA 4NIAA 4UUVA 2CQ7A 3O3KA 4CH7A 3V64A 2WO1A 2JMWA 2XJVA 4FP3A 3RSJA 2V5YA 3OYWA 3ZM8A 4YW1A 1ZVFA 1AZDA 5GADJ 2KQRA 3R6SA 3UGHA 4ET7A 2E1NA 2IA2A 2ZS6B 5K5QA 1G9FA 2ZGPA 2MC4A 2HWD2 4JRAA 5BPDA 4YNIA 3CJNA 1IS4A 2XWBB 4G3YC 5CB7A 1MBGA 5BNNC 5C9AA 1MKMA 3JTHA 4JOMA 1D4M3 2VE8A 3WF3A 1OF3A 4RB2C 4G7OF 3ZP5A 1ZZ9A 2JB8A 1X1CA 4HKLA 2XJRA 4G6DA 5DDJ1 1BBT3 4U0VA 4Y7NJ 3KP6A 3FLRA 2ZX3A 4GO1A 3THPA 2R071 2O3FA 2Y8KA 4M9ZA 1CPMA 3L00A 1R091 4IL6C 2RC4A 1QPIA 3ZN1A 2OVUA 5DAQA 3A02A 3EYPA 5J6XA 2Y69H 4NPLA 3FBMA 4M74A 1NG6A 2PEXA 2DURA 1XSXA 1ZBA2 2PHWA 1X36A 4NUBA 2F4PA 4R4ZA 4PJMA 3WINE 4HF0A 4IJAA 4A3MJ 3F21A 2WFF3 2R7SA 2FRHA 1ZR4A 2P5KA 2AGSA 5EQUA 1IGOA 1WH7A 3DPUA 1HRV3 4KL1A 2LH9A 3J7NA 5M5WJ 5HCAA 3QH6A 4LE3A 3ZR8X 5DM7F 4C2MJ 2VVEA 2VBPA 4LLGF 3GZ5A 3AAFA 2NS7A 4Y52J 2HEOA 4UFHA 2OPWA 4YWAA 1JZ2A 4WXCA 2R92J 3GXUA 1D7PM 4RSUA 3WW4A 2WNUB 1QJFA 1HB3A 1QDCA 3AZYA 2ARCA 2EA2A 2UUZA 3F8FA 3ZGKA 1QEXA 5EYYA 3I56I 2K9SA 1NCQC 1S0FA 1WCSA 3TBDA 2RS11 3W6VA 1RUF2 2QQUA 5I8TA 1Y1VJ 4XQFA 1ULCA 1YIJI 3V0BA 2HBUA 3EETA 2WNVA 1IXRC 2CSGA 4P5HA 1ZRCA 1G9CA 2RJLA 4MGYE 1OCZH 5FYIA 5CIRA 2IXKA 1DU6A 5A7QA 3CJQB 2ZKZA 3KIOA 4GMP3 2LY1A 2QENA 1ASJ1 2GQQA 3HSRA 3CEWA 2VQGA 1F5TA 2J1VA 2VECA 3WV6A 5IFTA 2VW1A 1WJDA 1K78A 5C4JJ 4N4OB 2W47A 1MMDA 5FZKA 3OTFA 5FRAA 4K1YA 4Z82A 4IXLA 1B8IA 1B9MA 5E1ZB 1HKTA 4ZYHA 4IQJA 1BQPA 1V00A 2XJQA 2I10A 4Z2AA 4P9LA 2GH8A 4BCUA 1RUI2 1LJ7A 4EJTA 5BNGA 1K5MB 2DDBA 4SBVA 2ZMEB 2EIDA 3OEAA 1ZTRA 1X1AA 2BXZA 2K2SA 3H9JA 2MGQA 3O5SA 1NX9A 1Z3XA 3H3ZA 3LFKA 1VQOI 2MC3A 4XIKA 3E3VA 4XRSG 2W9XA 1NA1B 1X9PA 5LBFA 2BY2A 3AP5A 4QB6A 1TWAJ 4PQQA 5FZGA 3WP3A 1HXS1 1U5YA 2VQTA 1AL23 1PP7U 3OYFA 2D43A 3B93A 3WY6A 4ESJA 3K0LA 4E4SA 3Q9VA 2O0OA 4OWRB 2IS6A 5LHIA 2OC6A 2LDUA 1GNYA 1LKNA 4Z1VA 2E2IJ 3OY8B 4WM8A 2PLV3 3ASOH 3U14A 3WSOA 2ATFA 1H2NA 4KNYA 3KV6A 3G71I 3QPSA 1O4YA 4FQ4A 4MTEA 3K48A 4HXCA 1XPXA 3DFGA 3OCPA 3N9LA 4KH9A 3ABLH 3H3UA 3OS0A 3ECOA 4L5EA 3HXLA 4BH9A 2ZSHB 2VU9A 3CC7I 3TN91 3K4LA 1TQMA 1NG0A 2Q4SA 3UV9A 3D0JA 4QQ2A 4Q4W2 1Q5OA 2WWYA 3CKHA 3RZKA 1JKOC 3IWFA 2WSVA 2DT5A 2K46A 1HIXA 4RGGA 4M3EA 5FZDA 2DK5A 2EXIA 4LA3A 4E7LA 2P6TA 1GUIA 3D5RC 2Z5WA 4E7KA 4CZZA 2P17A 4FX0A 3PU3A 2X6WA 1WLTA 4XKBA 1WZXA 1YIOA 5FYMA 6PAXA 4O9GA 1NCQB 4RM3A 1QXRA 2Y6GA 3ACFA 2LY9A 4E7IA 2E5ZA 3ZLIA 4LHLA 1APLC 2BHZA 1X4PA 3AKSA 3OUHA 2XG3A 2J1AA 1YCIA 3FBNB 1M4WA 4EN9B 4XW3A 1OKRA 1LU1A 2HBTA 3M9AA 3VBFB 1RINA 2W39A 2DF7A 3ME2A 4H2AA 4LBQA 4UT5A 2V9KA 2VBYA 2WFPA 1CAWB 1K6OA 5LBEA 5EGOA 2HKXA 2QZ8A 5I8SA 3KM5A 4XLHA 3EYIA 3HWJA 3K10A 2FCUA 4FSJA 2XAGA 3O7OA 2VC1A 1Z7S2 3NKTA 1VAVA 5M3MJ 1I27A 1K4SA 1SPPA 3OYEA 3PVNA 1W8NA 2LREA 1REFA 5FIXA 3ASIA 3B7MA 1J83A 2RS33 3I49A 2CAUA 1APNA 2D3SA 3UGFA 5A7OA 1NE6A 4A12A 3ZFGA 2PFWA 2UXNA 5JPMB 1GR3A 1X1BA 2ZXJA 2LKSA 3MKZA 1LB2A 2I2SA 1YEWA 3W59A 1JI6A 5A3PA 1YW9A 2W87A 1GLNA 1LEMA 3M1EA 1W03A 4META 1FX7A 3BU0A 2C1FA 2M45A 3JR9A 5FWEA 1OH3A 2RMU1 4WCGA 1J7KA 1ZG1A 1HJFA 3IAPA 5A6ZA 1D0GA 4S04A 3LSMA 3ZPOA 4XDQA 4AEDB 2JG9B 3OL3A 1VBE1 3AX4A 1MBHA 2D5HA 5K5OA 1W6MA 2ZJRF 5LFAA 1UJ8A 5CVRA 3IKWA 2ZXWH 1P2FA 1VBC3 3S1MJ 1T0FA 2VNVA 1P8JA 3AZXA 3IBMA 2AEZA 3BJAA 4O7XA 3ZQFA 4Q2FA 1UU5A 3LSRA 3U1DA 4K40A 1YHFA 1D4M1 4PJ0C 4B43A 1C8M2 4IGOA 2R7XA 3GBWA 4XN3A 4LO7A 1LE8B 3ZMTA 1U8BA 2BFUS 3U4XA 4OAZA 3AKPA 2XB0X 2QQAA 3GEZA 1S0GA 3WTSC 1R5GA 1DUXC 3RJRA 3LCPA 4Z6YA 2GXAA 4Q0PA 3BT9A 3OR2C 3AP6A 1SD6A 2AXTC 5DZFA 2EIKH 4JQFA 4DZGA 3AG3H 2ZKLA 2VZ1A 1HLVA 1EY2A 3LA7A 5AC93 3KLOA 4GQ7A 3GTKJ 5EWSA 5LY1A 2J5OA 3TOBA 1ULFA 3JBG1 1WVRA 3CO7C 4BBRJ 2ICWG 3ZN0A 1HDDC 1W6QA 3WTXC 4KJZA 5J09A 1FPN2 3USUB 1PVEA 2D6KA 1CVNA 3PUSA 1NY71 1D1CA 4Q29A 3K2ZA 3NJXA 4CU9A 4LOSA 1A8DA 5L3FA 5F5IA 3KE2A 4XJZA 1U0AA 1C4RA 1MS8A 2WO3A 3PUFA 3FKIJ 3MEPA 2PHDA 5GKAC 4RAFA 4RGRA 2VBDA 1HX6A 1W2AX 1RKWA 3LAPA 3MAJA 4QPWA 3I64A 3UKVA 2ZXIA 4Z92B 1YW7A 2CFOA 5KXEA 2DU9A 3FFQA 1T98A 4CEWC 2JG8A 2W2IA 4EN0A 1VBD1 2VAUA 4P9UA 3VYSB 5JAXA 3VHRA 1G86A 2J1SA 1GLHA 4XAEA 1REEA 3AFKA 3KEQA 4U0WA 2IUWA 1EH7A 1XN7A 3DECA 4CCOA 4QQOA 1EAH3 4E2GA 1H2KA 3OYBA 1RUC2 1A35A 2HYFA 1QNWA 1PVC1 4CGZA 2W08A 1S3JA 1TG7A 1O57A 3PU8A 2W25A 4ZONA 3ELNA 3NVCA 1BJQA 3UJQA 2DAOA 4KN7X 5F5CA 5HDGA 4IHYA 5A3MA 3PFIA 4BE3A 2HFHA 1ZRIA 3UYJA 4QPOA 1IRZA 2O7OA 5DN2A 3S7IA 4JDNA 5LATA 4K21A 2CAVA 3ZQ7A 3GWZA 4L5IA 2KT0A 2QNKA 5J3LA 2JDUA 2LBFA 1OT5A 5GJ6A 5APAA 1H4GA 3S30A 2FA5A 1V0AA 1XNTA 4DINB 3FUQA 1KXGA 1ZGJA 2AQEA 2EIBA 4BXSV 4IO9F 2D98A 1LE8A 3LFIA 4A41A 1LKXA 1V3FA 3DXUA 1IZ3A 3B9CA 5EF6A 2VE1A 1OOPA 1J3QA 3WU1B 4YW4A 4IE6A 3Q9OA 2YUEA 4EMSA 1TT0A 2VNOA 3KVBA 4B4RA 3BQZA 3ESWB 1BLZA 1IRXA 3H3LA 1UZCA 1DQ1A 1WA4A 3PMSA 3QYEA 1SFOJ 5FRNA 2WZ8A 2NYYA 5FYSA 1S0IA 1E3HA 2W57A 4EZHA 1ZBA1 3DBRB 4A3EJ 4HBNA 4P9FA 2VXDA 3FISA 1P9QC 2QFEA 2VPLA 4N9HA 4BY1J 1L3JA 3MBWA 3M3QA 5CKTA 2EINH 4CICA 2OXBA 4BQNA 4P1WA 4LO4B 1O5LA 5FXWA 3KZ4C 1LFBA 5F2SA 1EH8A 3RS6A 4AGRA 3NV1A 2D1VA 3SEZA 3E7LA 4AGGA 1JTXA 1DGWA 1PNFA 3AJYA 2X4HA 2PX9A 1B35C 2M34A 2JD4A 2HNHA 3T2QA 1AR62 4HW0A 2VOPA 2TBVA 4XLEA 2QZ3A 1BXHA 1CAVA 3NJVA 5LW9A 2ZMEC 4C9YA 1K4TA 5D5XB 3IRQA 2V1DA 1DGRM 1XBFA 3FXUA 2IJLA 4M73A 5KBFA 3GFJA 1QNTA 2B45X 4RB3C 5EG0A 3BTJA 4YW2A 3OUJA 2VH9A 2AREA 5LRRA 1FMD2 1R4MB 1R4NB 4RB0A 1J1TA 1XGMA 4CDWB 3MI8A 3OY9A 3JXSA 3GZNB 3H1CA 3JUUA 3CZUA 1D5YA 3VZLA 1OR7C 1RVF3 1FBSA 3O0VA 2PJRB 2M30A 4XCAA 1ON2A 3PJYA 3CIHA 5LASA 1PK6A 3CJXA 2A3XA 4BYYA 2NPIA 4NIGA 5JFRA 3HOXJ 1GV5A 2XKOA 3AL0C 4D0QA 4CUAA 4V2FA 4EN8B 2DA1A 5L7OB 1UYZA 3N7JA 2Y30A 3H42B 2BGOA 1RETA 3PUIA 1RUG3 1I3AA 3AG2H 4DY5A 1A6QA 2P3KA 3QP6A 5FXZA 3JSPA 5ERIA 4XDPA 2ZFUA 5FY7A 5IY5H 2ISZA 4V2WA 3ON7A 2WSUA 2VPRA 4NC6A 3V42A 1TLHB 5DUWA 3DUIA 3DYOA 2VLAA 4XETA 2VOKA 3OBAA 4FPKA 2XPWA 2ZHLA 5FYTA 1IUYA 5E6HA 2R043 2FOKA 1YS6A 2BRTA 2A7AA 4IV3C 1WJCA 1OA3A 2BHYA 4A3KJ 4DOUA 1WMDA 4YSFA 1H88C 4MGRA 5DV5A 3ES1A 2GALA 3MQ0A 2WBKA 2JEMA 1EJ9A 1OSGA 4WVMB 2CGPA 1JU3A 2MD0A 4AAXA 3H1MA 2XJPA 2BXYA 4DO0A 4NQWA 3S2DJ 2FQ4A 1Q8VA 2EIEA 5FRMA 1PMJX 2BGCA 4DXTA 1XDSA 5LCWL 4XBFA 1W1WE 1WGXA 4AR2A 3C7JA 2Y6LA 2VBZA 2IT0A 4HDVA 1AR82 4FTBA 2DTZA 5C8CC 5BXXA 1W6OB 3VEPA 2VD7A 2KR2A 2DU1A 2DFHA 1AA7A 4X6AJ 1S1AA 2DTWA 3DKQA 1MACA 2I07B 3OD0A 1LHNA 4N43C 4UV8A 3IT8A 5IP6A 4BQWA 2PLYA 2ZAAA 5FJKA 5FV3A 3QRFF 5A1LA 1ACCA 2X53S 2E1MB 2D6MA 4COYA 1WWXA 2AH2A 2V1XA 1W3VA 3NV2A 2HXIA 5ABJA 5IK5A 3KHBA 1IO2A 4GYIA 1O7FA 2UXXA 3RQ4A 4MZUA 4HLTA 4TZDA 3H0OA 2CWSA 1T0FC 4HEA2 4QWQA 5GPCA 2VJ5A 4PGGA 2EFQA 5FPLA 1R58A 2JWTA 1VFCA 2L0KA 2Y9ZA 1PUFB 2K86A 1LAJA 2YBSA 4Q47A 3S16J 4QU1A 4BA6A 2M2EA 1AR63 2R7OA 4PF5A 5A32A 1XB4A 3M8JA 3Q9SA 3WXPA 3RZZA 2IXSA 4AYBA 1S2KA 2B4KA 5H9RA 4HBLA 3BOQA 3OYLA 1ULEA 1H9WA 3HR9A 2L54A 2L2OA 3WGIA 1JGSA 3WTTC 5LA2A 4UFKA 1PP8F 1NCRA 3O0XA 1MQTC 3JRHA 4XIDA 2YX4A 1QOOA 2BW3A 3RPUA 1O8SA 1A04A 2VY0A 1O6UA 3VHOA 5TGTA 3JRBA 5KHGA 2JXAA 4JTNA 1PO22 3HSEA 2Q0OA 1A34A 4WM7C 1WUVA 2WNEA 2DWRA 3C3WA 2HWD1 1E57A 5B5EC 1ZGAA 1JZ6A 3ZIWA 3OPWA 3VBHA 3ZXKA 4ESBA 3SXWA 1YWKA 1UHMA 2NVUB 4B48A 1Z3YA 3M4OJ 1U2WA 1QU0A 3BJOA 3UR3C 1GOHA 1O4TA 3GO5A 1JHFA 4OAYA 1OD5A 2EILH 5J1XA 3WODF 2OA4A 3ABKH 2VCBA 5IVCA 3WW3A 2JDMA 3A22A 1TWHJ 3H7JA 4LBKA 5DABA 4AE2A 2YFUA 2VZPA 4AHYA 4AC0A 4BL0B 1FOXA 1SFKA 4P9JA 1Y39A 2ET1A 2DVAA 3EUHA 3WNMA 4RDUA 4X1EA 1W06A 2F5EA 2JB4A 2KLOA 4DYRA 4AEJA 1G9AA 1H9GA 3SH4A 4ENNA 2ZBJA 3M8EA 1ZGWA 3ITQA 2RS32 3T0BA 2Z4FA 1S0CA 2K85A 3V56A 3G3ZA 4EQVA 3MW2A 1NT0A 2VJ4A 4GIQA 4LLLA 1Z1DA 3K4CA 2A6ZA 4RN5A 2JA2A 5GLVA 4E6KG 5FUNA 3J8F3 3ZXLA 1SBFA 4NAMA 4PCQA 4BAYA 4BJTA 3T1MA 5BNOA 2B46X 2XJUA 1VMFA 5FQ0A 3IKVA 2OQRA 4GRIA 2YDEA 1IHMA 1ENSA 4B09A 3Q0UA 4XR6A 1RUJ1 3BPXA 4AVZA 2Y26A 2VTXA 2F4LA 3BR1A 2X05A 3KT1A 1XNAA 3P7NA 4BQ1A 1B1BA 2GMEA 4DZJA 2LROA 4QKDA 4KICA 1E2XA 1RUD1 2QM3A 4RLQA 1YI2I 5A6YA 2IAIA 2ZGRA 3AZVA 2MBFA 3LA2A 2AZ5A 5C33A 4LORA 2A6XA 1WPKA 4ZZ8A 4G6QA 2D1HA 4D7YA 1IGNA 3N9QA 3EDPA 3WLUA 4RYDA 1ZELA 3DKXA 3VBHC 2FCTA 1CZTA 3AMNA 1ZREA 3K69A 2CNAA 3P9IA 3AP9A 1WJFA 2QJVA 4CVUA 3L9JT 4LOTA 4D1QA 2Z9OA 3POJA 5GZEA 2DBNA 4HPKA 1ASJ2 3SLIA 1T95A 2E7AA 4XXPA 1POGA 2E5NA 4UY8I 2R042 1MJAA 5M3FJ 1SEUA 3KT7A 4P5YA 2WWSA 5K8SA 3PVEA 3VKFC 3O8HA 1ZG5A 1BJAA 2A75A 3UESA 4M3GA 2JUGA 4OIOF 3S1RJ 1FOD3 1ZX5A 1Y43B 3ZFGB 2RS12 2A73B 4EWEA 5L3EA 5KNLA 1MDMB 3ZXDA 1SAUA 2UWMA 2E31A 2LOOA 3LDBA 4CUBA 2BBAA 2ZNZA 2ELKA 1CAUA 3K70C 1PM4A 2VULA 1SHWB 5JOZA 2GNTA 2BV6A 1BR2A 3AL0B 3ZYPA 4XJUA 4UOJA 4QHZA 3ZDSA 3IIAA 2Q8OA 1BHGA 3RTRA 1RMU1 1H9PA 5EGOB 3WNPA 2DJNA 1ND2C 2WTEA 1ULPA 4G8XA 3V7CA 1DDNA 4MXWA 1PYVA 4UW6A 4B8XA 4L11A 2EA7A 1Z6TA 3MHZA 3JRGA 5JIUA 3ILFA 1QHHD 2VIXA 5FCCA 2JD9A 4UWDA 2LY2A 3KLNA 4I0WB 1EPWA 1VQKI 2DI3A 5K0UA 2A6EF 2E7XA 4IW3A 3LSHA 1XGNA 2O1QA 1H1IA 2QF7A 2XPVA 2WADA 1S2BA 2WAQA 3AMQA 1QOTA 4DQ2A 3WDVA 4CYDA 3OYMA 2WZR2 2WA0A 4S2GA 2GWRA 4IEZA 3HOBA 1YOVB 1UX6A 1AHSA 3VB9A 2PYTA 4E70A 1WD3A 3JTGA 3ES4A 3HAGA 2FBKA 3LQCA 4A3GJ 2GN7A 3VDBA 3POEA 2JE7A 5IJRA 2WAQN 2YR2A 2M0MA 3LSIA 3BIEA 2P6HA 3T4HB 4DW6A 5FR3A 4M71A 3ZFFC 3DYPA 5L7OA 4MIMA 4HZFA 3V0AA 3GJBA 2H8WA 5IYDJ 3IDEA 2Z16A 4JBAA 4CA0A 3SKVA 1POV1 5F5QA 5FZ1A 2RQPA 3HT1A 4P9YA 5JHUA 5C3QA 4MFEA 2HPIA 2GC1A 4XLAA 1RHI1 2L7ZA 3H0GJ 3KP3A 3OS1A 2CRGA 3GGLA 2XL9A 1XSQA 2A5ZA 4OMDA 2VW0A 1HOMA 3M1CA 5HCFA 3U1KA 3O1UA 2EZIA 3DL3A 1VRH2 4UYBA 2RM22 5C70A 5JSPA 1FTTA 2Z99A 3I7DA 3T2PA 2X8KA 2ET7A 5F8PA 5BPIA 1V70A 1BMV1 4N43A 1IUFA 3ZFGC 1CIWA 2GMMA 1FX5A 3MD2A 2XGXA 3P3NA 3TQNA 3BTYA 1W99A 1HQLA 1IZ1A 4CYCB 1YQ2A 3ZMSA 3T5XA 2P5BA 4XF4A 2A05A 3I3EA 3GALA 3HVDA 3T2OA 4D7MA 2MEV2 3NJYA 3CNAA 3VBUA 2GXBA 2AUYA 4M0HA 4G12A 3GCWA 3RKWA 3O6BB 5HXVA 5JOXA 5FO7B 1TWFJ 2LTPA 3ZMOA 4PBPA 3ASNH 4LHKA 1BM9A 5LBQA 4YVWA 1REPC 4FETA 3NAPB 4J6GA 4QGLA 2NYXA 1KEXA 1TW3A 3QAHA 4O6JA 4NAOA 3N36A 4EGZA 4N7IA 5BS6A 2VBBA 4M9SA 2E9QA 1W0OA 5LD2C 3ZXGA 5FFXA 1XYPA 3KGLA 3OYGA 3CBNA 3RI9A 1VQ7I 3L2RA 1H1MA 2O03A 2ZEYA 3LWCA 5H6QA 1P4XA 3M3CA 2DJIA 2NOGA 1KITA 2HWD3 4TLGA 4ZXEA 4RM2A 1QJEA 1H89C 1R64A 4Y22A 1EF4A 4BZ4A 4PDWB 4FI9A 2XF7A