2K9ZA

Nmr structure of the protein tm1112
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
MEVKIEKPTPEKLKELSVEKWPIWEKEVSEFDWYYDTNETCYILEGKVEVTTEDGKKYVIEKGDLVTFPKGLRCRWKVLEPVRKHYNLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein TM1112
publication title Comparison of NMR and crystal structures for the proteins TM1112 and TM1367.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2k9zA00
3JZVA 2EAAA 5EFUA 4D7TA 4HMZA 3ACLA 1ZRCA 4IEOA 2D93A 2GU9A 1OMIA 1UW8A 2EA7A 1NE6A 2ZCWA 1WA4A 4F7ZA 4IEQA 3SCHA 4TLFA 4ORFA 3S7EA 5FQ0B 4XFCA 2QCSB 3FFQA 4Q29A 4QGNA 4UBGA 3NL1A 1QXJA 3UKNA 3ES4A 2PTMA 1Y9QA 5LRSA 1O4TA 4F8AA 5JSOA 2UY9A 3WW1A 3N4MA 4XFHA 2DCTA 4LA3A 3RYRA 2OZ6A 1RUNA 1QY4A 3LA3A 1IPJA 1ZRFA 1ZZ7A 4I09A 5KHJA 3H9AA 4J1WA 1UD1A 1TQ5A 1J3PA 4IEVA 2H6BA 3EHKA 4QXKA 2PA7A 3GYDA 4I01A 5LEJA 2XGXA 5I0UA 4YARA 3LZZA 4UXAA 3USSA 1X8MA 4EWAA 2KXLA 1UIKA 2BNOA 4QM9A 3MZHA 1O3QA 3U10A 4Z07A 2O8QA 4XFIA 1JUHA 1X8EA 3LA2A 2V09A 2CAVA 4MGKE 2FMYA 1HW5A 4IETA 4Q0VA 1EP0A 4AQ2A 1G6NA 1RTVA 1XRUA 2WFPA 1CAVA 3D82A 5FLJA 4XF4A 4IEZA 1NE4A 2D5HA 3I54A 4AVCA 5I8SA 1VJ2A 5CU1A 4QGMA 4EWDA 3S7IA 3ELNA 4YNIA 3OTFA 1ZZBA 2PAEA 2XL9A 1Q5OA 2XKPA 1RGSA 4R8HA 1EYBA 1XE7A 1PM7A 4AVBA 3IBMA 1O5LA 3SCGA 2OPKA 3CJXA 1J1LA 1PMIA 4X6RB 2QDRA 1Y3TA 3DKWA 5C8WA 1J59A 2C0ZA 3KSCA 4J1XA 2ZKLA 4HSLA 2B9UA 2PAKA 4ZU5A 1O3RA 3I7DA 5HI0A 3E5XA 3I59B 3PVBB 4ONUA 3R6SA 3UKVA 4IEPA 3H1MA 4PIYA 4FAGA 1Q43A 3MPBA 5I91A 4JTOA 2PYTA 5D1IA 5J48A 4A2UA 2GH2A 4Q0PA 1U12A 4XFAA 4KU8A 4XF1A 5F1RA 3H7YA 5I8TA 1UPIA 3PNAA 2FQPA 4OFGA 5FQ0A 2I45A 3CL1A 2CAUA 4JTNA 3HT2A 3LA7A 2F4PA 5K8SA 1I6XA 3CF6E 3G7DA 5BPXA 4MUVA 1L3JA 1XE8A 5JAXA 2IXJA 1CAWA 2PHDA 1CAUA 4FT8A 4B29A 3E5QA 1ZZ9A 3CLPA 4WBBA 5BV6A 2XHKA 5J7MA 3IIAA 2QNKA 1CGPA 5JSPA 3ES1A 4WZCA 3IWZA 3E6CC 2GZWA 4H7LA 4ZU4A 2K0GA 2BYVE 1DGRA 1J58A 3ZDSA 4CYDA 3IDCB 4IEUA 4O9GA 3PLQA 4KWLA 1ZZ6A 4HN1A 2PFWA 1YFYA 4JV4A 1Q3EA 4Q0QA 4Z82A 4KWKA 2D40A 4BH9A 3M70A 4EROA 3M3IA 5J3UA 4HVRA 2Y0OA 3H1YA 3QACA 4FAHA 4E2SA 3KGZA 4N9HA 2VPVA 2EVXA 3ROUA 5KBFA 4X6QB 3OF1A 4LA2A 1CAXA 3O14A 3BALA 1ZNPA 3BPZA 1ZX5A 4E2QA 3IDBB 1H1IA 4DINB 1YFXA 4I3PA 2Q4SA 4Q0UA 3UKTA 1WLTA 1LR5A 4XFBA 3ST7A 4LLOA 3E6BA 3KMHA 3WW2A 2PHLA 4P9GA 2BNNA 4OLLA 4PJYA 1YHFA 3ETQA 2XLGA 4AXOA 1SQ4A 3E97A 1QXRA 3HIFA 4BYYA 4HZFA 5I0TA 3SCFA 4HSJA 4LUMA 4Q0SA 1YFUA 3LWCA 4YSFA 2QJVA 4IERA 4EV0A 5I0SA 3OCPA 3L2HA 4RD7A 4XF0A 5C6CA 3HQXA 4WVZA 2UY8A 3EJKA 3H1WA 4L11A 3CEWA 4MGZE 5AVPA 3OGJA 5JCTA 4XFGA 4QX5A 5FDBA 3TNPB 3KCCA 1EY2A 4KU7A 2HJIA 3EO6A 2N7GA 2H6CA 3VHRA 3FJSA 4HN0A 4N9IA 1V70A 3SMHA 4HLTA 4I2OA 4MZUA 3FZ3A 4LULA 2IXIA 4O9EA 2WC2A 2BGCA 4KL1A 4LTAA 2ETEA 2CGPA 3WW4A 3TNQA 1CAVB 2IXLA 1EPZA 1RL3A 5EZWA 1OFNA 4MV2A 4EWEA 1GQHA 1ZZ8A 2ET7A 1OD5A 4E2GA 2XLFA 3NW4A 3WW3A 4YYOA 2PAMA 5BUVA 2HKXA 2K9ZA 4KWJA 3BU7A 5E1RA 3OD0A 3H8UA 2CV6A 1LB2A 4AQ6A 3H50A 5JR7B 3LOIA 3DN7A 2XKOA 3HT1A 3RDIA 2D5FA 2OZJA 2Q0AA 3NVCA 1VP6A 4QMAA 5KHGA 5KHHA 1IPKA 4PIXA 2B8MA 4R52A 4QM8A 5I0RA 2GC3A 4K8FA 2O1QA 3RYKA 5CADA 5FPXA 1O5UA 2XL7A 3H3ZA 1SEFA 5CVRA 2ET1A 3LAGA 4BIFA 3MDPA 3QOPA 1UCXA 5FLIA 2IXHA 1ZZCA 3KGLA 3U11A 1QWRA 3E5UA 4FBFA 1CX4A 2IXCA 4QGLA 1VR3A 2MHFA 5JSRA 3MYXA 4HVQA 1O3TA 2Q1ZB 4IEXA 4XEZA 4D7SA 4HVOA 3DL3A 2P17A 4XF3A 1DZTA 5FCCA 2OYZA 2B5HA 1CAWB 3D0SA 3SHRA 4MGIE 4HBNA 1CAUB 1X7NA 4PIZA 1SFNA 5LRRA 4LUKA 5BXXA 1NZCA 3FE5A 4YRDA 1YFWA 3NJZA 2Z69A 2GAUA 3DV8A 1J3QA 5KHKA 4L2NA 4META 1J3RA 1ZREA 2Z2SB 2XLAA 2GC0A 3SXWA 3BCWA 4MX3A 2MNGA 5KHIA 4XF9A 4I0BA 2ATFA 1FI2A 3H7JA 3RYPA 5FPZA 4UBHA 2BEOA 1ZRRA 2GC2A 4BHPA 3E6DA 1DZRA 2OA2A 2BNMA 2IXKA 1NYWA 3I59A 3RNSA 4XFFA 1I5ZA 1YWKA 4IESA 2UYBA 5E16A 5FLHA 3EQEA 2IC1A 3FX3A 5I93A 4IEWA 4LEJA 1NXMA 1X82A 2MPFA 5I8YA 2VQAA 3RZZA 1CAXB 3NSTA 1FT9A 3NKTA 4AVAA 3FHIB 1OI6A 1DGWA 2VECA 1UIJA 4MGYE 5T3NA 1ZVFA 4JVAA 1FXZA 1GQGA 3H3UA 3EBRA 1YUDA 2PQQA 3S0MA 1RC6A 4MH0E 3U0ZA 1LRHA 1O3SA 3B02A 3C3VA 3GBFA 3FWEA 3BB6A 1ZRDA 1LKNA 4ZU7A 2GC1A 3D0JA 4XETA 2H0VA 2UYAA 1WGPA 3CO2A 5LEKA 1O7FA 5BY5A 1RUOA 4NVPA 2Q30A 3RPQA 2QVSB 4GULA 4I02A 4IEYA 1H1MA 2E9QA 1YLLA 4I0AA
chains in the Genus database with same CATH superfamily
4A44A 2WFF3 3BKZA 1MZ6A 3JZVA 4CDXA 3PDQA 3VL8A 3HEIA 2HWF3 2RM23 4Z1VA 2C9AA 3VBOB 4LBKA 2B46X 5A32B 4CCNA 4FSJA 1OMIA 1UW8A 5DDJ3 4K9SA 3IMMA 4QB1A 1Y9GA 2VZ1A 5K4LA 1FMD2 1WA4A 3VDDA 3KHBA 5B4NA 3ILFA 4IEQA 4Z8BA 5C71A 4TLFA 3CKHA 3JD71 1QJX1 4LO4B 4QU2A 1CWPA 3EB7A 5JOWA 2ARCA 3DPRB 4WVMA 2WZEA 4CA9A 1DDLA 1DYPA 1PZ8A 4UBGA 3NL1A 3D8CA 4CDQB 1LHOA 4HKOA 3VB9A 3W5MA 4QX0A 5BNOC 5L9RA 1PVC1 2JG9B 4Y1VA 4RN5A 5A3UA 5FY0A 1H8TC 2DCTA 4P9YA 2RS31 5CFDA 1ENQA 3OUHA 2O8OA 2OZ6A 5JOYA 2HWB1 4JGZA 1QNWA 3VD7A 1BEV3 1ND2B 4QU1A 4I09A 3KT4A 4AEDB 2VBDA 4GALA 3WG4A 1UD1A 2B42B 5FYHA 4JHTA 3LEMA 1TQ5A 5JI9A 3AL5A 2HBUA 2RHPA 4AI0A 1YQ2A 1PX4A 5CBLA 2H6BA 3EHKA 1D2SA 2OQ7A 2R071 3WF4A 3UT0A 4BK5A 5CG9A 1VRH3 1W2UA 1AR71 3WP5A 2ADEA 2ZABA 4MHUA 4AGGA 5JXIA 3VBFA 3BUCA 1XB9A 1AX1A 2OS2A 2JIJA 4EWAA 1UIKA 5FWEA 3RZGA 5FZEA 1QU0A 3DECA 3M1HA 1OUSA 2Y6KA 2DCZA 4FPJA 4XFIA 2QBXA 4JKKA 1JUIA 2Y6JA 3VLBB 3R0RA 5FMOS 4CUGA 2CAVA 1IGOA 2YUEA 2A6XA 4Y20B 2GNTA 3NJVA 2FMYA 1HW5A 2A71A 4N43A 3WDVA 5BNOB 4M4RA 4GB32 1O8PA 2IFWA 5FZ9A 2XOMA 1X50A 4QX3A 2V4AA 3NV3A 3POWA 3BTXA 1O91A 3D82A 4URAA 3J7HA 2KR2A 4XF4A 5IAXA 3GM8A 5FZ1A 3WDWA 4AI3A 4PQ9A 3K4DA 1RUE1 4Y1UA 5FP7A 2D5HA 1MVQA 4BA6A 1MQTA 3VZOA 4GD4A 4AVCA 1LODA 2PHUA 3GGLA 4PF1A 4QHOA 4RHV3 4CXXA 1GBGA 4QGMA 1TVGA 2CDOA 4EWDA 4MOAA 2R1BA 3RWNA 4IE4A 1JYTA 1TMF3 3ELNA 1WLDA 4QQ2A 3OTFA 2BFUS 4H3WA 3WNNA 1U5XA 1Q8PA 2PAEA 3ILNA 4XVHA 1DQ6A 2ZKNA 1AR63 3LEGA 4Q4W1 4R8HA 3P5BA 4AVBA 1F31A 4IE0A 2XVGA 3I3EA 4HONA 1J1LA 4AVVA 2E32A 5C8WA 1MPXA 4B7KA 3TB0A 2A70A 1J59A 3PUHA 1W39A 2C9KA 2RE9A 3WLUA 2XUEA 4LOTA 2XWJB 3T1MA 4CPBD 1N3PA 3HBKA 2A6YA 5JUVA 1D0GA 4LBJA 2XBO3 1RUD3 5HI0A 2P6HA 3R6SA 1NX9A 2D44A 2HWD3 1GFF2 4XTMA 3AMQA 1Q43A 2RJ2A 3FUQA 2VZVA 4A7ZA 1T2XA 1VBC2 1VE0A 4OZOA 1COV3 5F9TA 1CJPA 2BOIA 1OQEA 5J48A 2LM3A 1JH5A 4Q0PA 4OHYA 3OY8A 4JGYA 2ZHLA 3H7YA 3T2QA 3OBZA 3P3NA 2FQPA 1OSGA 1E5HA 4OFGA 4Y24A 5EXOA 4CDXC 1W6MA 2I45A 1W03A 4MGSA 4DIQA 5FOJB 5JR2A 5M0TA 1DZQA 5FZCA 2TBVA 4JTNA 4QPWA 3HT2A 1I9RA 1UF2C 1LESA 3AP4A 5IFPA 2WS93 4NR1A 2DTYA 1JHJA 4FFIA 3VDDC 3G7DA 5BPXA 4MUVA 2Y60A 3ETPA 5DUXA 2YYOA 3WCRA 1RMU3 2IXJA 3R4DB 1PO22 1W90A 4MXVA 3N9QA 4RFRB 2ILMA 3WG3A 1KDKA 1TE1B 3B3QE 2WWSA 1A78A 3E5QA 5JLVA 2YU2A 5J1XA 1IKPA 1QQP3 2YMZA 4CP2A 5IHRA 1Q56A 2JDKA 5BV6A 2P37A 4DXZA 5FYIA 1B09A 1ZA4A 5J7MA 2NPIA 4AW7A 4A3XA 2QNKA 1W6PA 4OHWA 5FMBA 4FFFA 4IQPA 4Y4RA 1OF4A 4NE9A 1QIQA 2GZWA 3ZX7A 2GP3A 1G9DA 1HRV2 5L7OA 1SLCA 5CFDC 1DGRA 1G9AA 3GDBA 4DUXA 4JGZC 4X8PA 4BLJA 2JDMA 3B69A 4MO3M 1ZZ6A 4P02B 5FY8A 4AHYA 2VCAA 1PGL1 2P6CA 1HRI1 1YFYA 1OLMA 3B5LB 2CU5A 5T5JA 4LBQB 3OYWA 4DFSA 4NUBA 1T6BX 3J8F2 4CDXB 3ECQA 2ZS6B 4QXBA 4KGGA 1DYOA 2D40A 3A23A 1JW6A 1CZVA 2Y26A 3MW4A 4B7EA 5GLZA 4S2FA 1IZ3A 1OA2A 1SLTA 3DYMA 3FLRA 5DXDA 5LA9A 5A7WA 2V4VA 2WQZC 2FDJA 4KG0A 3RGBA 4BQYA 3VDDB 5JXJA 2RDSA 1WMFA 1BBT3 1W9WA 1WD3A 3AVSA 3PL0A 4G4FA 3T2TA 4FAHA 1POQA 5FYSA 4HXCA 4N9HA 3GZAA 2WFF2 5FP9A 1RUH3 2UWCA 4BXFA 2EVXA 4FO9A 3Q8CA 4QQPA 5FP3A 5TSWA 2FDHA 2RM22 3NNLA 4TSVA 1CAXA 1ALYA 4WVMB 3IN9A 4CDUA 4F83A 3HVDA 1LEMA 1GZWA 1ZNPA 1ZX5A 2DURA 3Q8AA 4FOWA 4XZPA 3IDBB 5IFTA 1DQ0A 1H0BA 1UZZA 2WRAA 3PUAA 4BCUA 3QH6A 1YYNA 3WDTA 3CU7A 2BNNA 4YW5A 1YHFA 3DYOA 4C0BA 2BVBA 5CFDB 5GM0A 1XE0A 1QJY1 1G86A 4UFIA 1DBNA 1G7YA 1DQ4A 1RJ8A 2C4XA 2MEV3 2ZX1A 2R041 1Z7S1 4JGZB 5I0TA 4BWOA 4Q0SA 4EYUA 5FP8A 1YFUA 1STMA 4CP9A 1O8SA 4YSFA 4ITCA 1ASJ3 5JXHA 4LBMA 3ZDVA 4BQ4A 3A7QA 5I0SA 3L2HA 1UY4A 3NWKA 4K21A 2VR4A 3TEXA 4RS5A 1C5HA 2BV4A 4OI4A 4XJ8A 5KXCA 5JCTA 3T0DA 4M3CA 5FDBA 3I3MA 1BEV2 2PLV1 1IKQA 3KCCA 1A3KA 5FPVA 1EY2A 2UWBA 4KU7A 1OLME 2HJIA 3VBFB 2VQTA 4GWMA 2VULA 4XDQA 1KITA 2BERA 3V65A 4Y5SA 5APAA 1F4AA 4W8JA 4PQQA 4N9IA 5FUNA 1V70A 2TNFA 1QJU3 3C7FA 5DUVA 3UGHA 2D7FA 2ZGNA 2QUOA 5IVJA 3H0OA 1OQDA 2WL1A 3WNKA 5K0UC 3MLKA 2VCBA 2P1BA 1UXZA 1OH4A 3R4SA 4N43B 4O9EA 2ZAHA 2WC2A 4QDQA 4GAZA 4KL1A 1PMHX 2QQLA 2Y38A 1QJEA 3WP3A 3CHXA 4JGYC 4NHMA 2V5DA 1HB4A 2IXLA 2R7EB 1VBD3 4YM3A 1AF9A 1EPZA 5EZWA 4XTPA 2YC2A 2ZEYA 4EWEA 2WDBA 2EALA 1MQTB 4ATFA 3OG2A 3GZTB 2I2SA 4Q26A 1GNHA 2XLFA 2PXJA 4QB2A 1F5JA 1DIWA 3NRUA 1OF3A 1DGLA 2J1SA 4FPEA 5GZGA 5HBAA 2HKXA 3ZXKA 4GJZA 1RUJ2 4KWJA 4UFJA 1UYZA 5A3MA 1YI9A 4NN0A 3BU7A 3AYEA 3CMGA 3GBGA 5JOZA 5KXEA 1CONA 5E1RA 1W6QA 3OD0A 1F9KA 4Q8LA 4CU8A 2AEYA 5D2AA 1YI7A 1LB2A 4MGQA 1R1ZA 3ZYPA 2XR4A 4IGOA 4UF0A 5FY9A 4AGRA 2ID4A 3IMNA 1SBDA 3HT1A 3AKQA 2A7AA 1TMF2 4YM1A 2Q0AA 1ULPA 4XDOA 1BVP1 4RGKA 1JZ3A 4CCJA 5KHGA 1REEA 5KHHA 4D6SA 3I49A 2D6LX 1AR62 3U78A 2FZ2A 1IQDC 4LXLA 4N7IA 4PIXA 1YIPA 1HB1A 1JYVA 1AXZA 4BQ5A 5I0RA 4AI2A 3HWJA 5L7OC 4M3CE 3I2DA 4UWDA 5K0UB 4GIQA 4P9WA 5FYCA 4XUNA 3RYKA 2XJSA 3FUOA 3LB9A 4K3UA 2BQPA 1BZWA 5J98B 1TNFA 2JE8A 2VQUA 2A5ZA 2ZGTA 1O5UA 5T52A 3VBHC 1FV3A 1SLBA 3H3ZA 2YBKA 1UZ0A 2WNOA 3OY8B 5F2SA 4JGYB 1QH6A 3UJQA 1KRIA 3AZVA 5CB7A 2SBAA 1RUD2 3ZSJA 3ZYHA 2VVDA 1ZZCA 3VBSC 1UYYA 2RS13 2HWD2 1TME1 1W6MB 3GXUA 4FBFA 1CX4A 3SEEA 4BQ3A 1ZBE2 4QGLA 2O0OA 1MS9A 4JCKA 1ODMA 4M3CF 3KVAA 3MYXA 1COV2 5A80A 1UY1A 4LKFA 5A3WA 3GZUC 4HVOA 1VBA1 3M7AA 3ZPOA 4X8NA 1O4YA 2JX9A 4XBLA 2J1TA 1JN2P 1H9WA 1KXGA 2ZHNA 4N53C 5FCCA 1VBB3 4V2WA 3SHRA 3CJIC 2KD7A 2VE1A 4NPMA 4PIZA 2VMHA 2BUKA 3IZOA 3CIHA 1UWWA 1F8VA 3MI8A 3MUZ1 2WS92 1N3OA 2ZX2A 1LOBA 2B4KA 3NJZA 3PHMA 1GICA 4PCRA 1VLNA 1W6PB 2LS6A 1H2KA 2W47A 1UY3A 2A73B 2OUJA 4QKDA 3RRDA 3O0XA 1RHI3 4GMP3 3AKRA 3GJAA 4CCLA 4ES8A 3ALQA 5L7OB 1ZREA 1W9YA 4B4PA 1E5RA 2GC0A 1QQP2 1ZRIA 3BCWA 1JS9A 2VVEA 4OMDA 2JB4A 3OGVA 3WSOA 1QEXA 1YQ5A 2DUOA 3B9IA 2WN3A 5FXWA 4I30A 1OBNA 1L7RA 3JB4C 1XSQA 3WD5A 5HV0A 4E4SA 2AREA 4UBHA 2Y6FA 3J9SA 4JRLA 3OYWB 1G8WA 4JKMA 4LO5B 4WVWA 1NA1A 3VBSB 2Y6LA 5IK5A 1NCRA 4KNCA 3ZXDA 4LNVA 4YZ2A 3D4KA 1DZRA 4YFWA 2BNMA 4RS5C 2DU1A 1ZBA1 5LA0A 2GDFA 4JDOA 3LGRA 3U14A 1GWLA 2WT1A 4XFFA 5A7WB 1I5ZA 1WBLA 1AJKA 4IESA 5E16A 5GLWA 1PK6A 4RR3A 3VKMA 1YQ8A 3I3QA 4P9IA 1KS4A 4S2HA 1XYPA 5I93A 3WHUA 4PDWA 2VZSA 5T5PA 4LEJA 5EQUA 1ULCA 1C8M1 3CJIB 1X82A 2JDPA 2MPFA 1BQPA 2E33A 2VQAA 1CAXB 3JD73 1FAYA 4HFSA 5HPOA 1GZWB 4DXRA 3LDRA 4MLOA 1MS1A 3FHIB 1OI6A 5FZFA 4AVTA 1UIJA 2JDYA 3MIHA 4OHZA 4B3NA 1H1AA 3F2ZA 1ZVFA 2XONA 3KF5A 3BIEA 1NG0A 1QDOA 5CISA 3BN6A 4AFBA 3Q8FA 4EN7B 1RC6A 1LOCA 4MH0E 3POSA 4FP3A 2B45X 1R1A3 5SV5A 2HWC3 2XJUA 1LRHA 4CXYA 4FPOB 3FLPA 4CP9B 2EIEA 1SPPA 3B02A 5C5UA 2RS51 2WNEA 4SLIA 4XIOA 3TBDA 1LKNA 4ZU7A 2GC1A 2BW8A 1L7QA 4XETA 3TOJA 5IJRA 2H0VA 2Q8CA 4RS5B 2D43A 1SZBA 1W04A 1RVF3 5F3CA 5DAXA 3T0AA 2P5BA 5FAXA 2DWRA 1IS3A 2MEV2 4CU9A 4H2AA 4M3CB 5LEKA 5A3PA 3OD4A 4NRMA 1HB2A 2ZPXA 1ASJ2 1ULFA 3ENRA 3J7LA 3FL7A 2QVSB 4GULA 4I02A 2PHTA 4PLOA 5GLUA 1XNCA 1UKGA 4Y22A 3VDBA 1MS4A 5A1AA 3AJZA 4FFGA 1YLLA 5IATA 3GNEA 2ZMLA 1A34A 3ZXFA 1RXGA 2GNMA 5FYVA 3RZHA 4YGEA 2VNOA 4LO6B 3U37A 3RZJA 2QQWA 3I3BA 4FQZA 3QBQA 4XHXA 2VMIA 2D93A 2GU9A 3AZXA 5FWJA 3HQRA 4DEVA 2R1DA 3O5SA 4Q4Y1 1KFXL 2EA7A 2ZX4A 4M01A 2ZCWA 4XYXA 4XURA 3SCHA 1QJU2 1RUF3 5ACA2 1HN0A 4DXTA 5FZIA 2AEZA 1IG3A 4XQWA 1R081 5FQ0B 1OOPC 3FFQA 4TZDA 4Q29A 1ULGA 1KEXA 5BNQA 1JMUB 1K5MA 2BVVA 2OQ6A 4LQRA 4F8AA 3PJYA 5JI7A 2UY9A 4CDWA 2VXRA 4DUWA 1W6QB 4XXPA 1W3XA 2IVIB 3ZPYA 4NIIA 3RYRA 4OZXA 4UF0B 5AVAA 1W05A 4GKXA 1AYM1 2EXKA 3OBAA 2AYHA 1DLLA 2WSUA 4OYUA 1IPJA 1ZZ7A 4FPHA 5KHJA 1OURA 4QB6A 4ISQA 3BVCA 1VBE3 4HPKA 1J3PA 2G9ZA 4FPKA 1AL21 2VY0A 2WQ8A 3OEBA 1RUG2 2J22A 2R061 2L9LA 3CQOA 3D6EA 4LHNA 3MV01 5I0DA 4CEYA 1QJFA 4AFAA 2PA7A 2QQKA 2F4LA 3A22A 5A1FA 4XC9A 4UFLA 5FUIA 4EN8B 3LZZA 3Q9OA 4Q1RA 4A7YA 3SISA 5AC92 2D98A 2ZGKA 4AOCA 1GNZA 5C5TA 2BNOA 5A7QA 3JQWA 4NHXA 4CSWA 1NCRC 3RJ2X 4CRQA 3MZHA 1GOGA 3NV4A 4Z07A 2V5YA 2BDRA 5A3LA 2VMDA 3LA2A 1LOFA 1AR81 3DEMA 2V09A 4FP2A 2V73A 3K46A 4RR3C 4XHBA 5A7PA 1JOJA 1JYXA 1DGRN 3OPZA 4IETA 3KM5A 4PDWC 2UU8A 2W94A 1GNYA 3A0KA 5FFOC 1G6NA 5FYZA 1JODA 4N7UA 3B7MA 2GNBA 2BTVC 5FPLA 1BK0A 4IEZA 1RUC1 1AJOA 1NE4A 2WZ8A 1NXD1 1QH7A 1PO23 1PIV1 1IPSA 2CTVA 2W95A 1CIWA 2X09A 1AUYA 5I8SA 1D2QA 3MEPA 3ZYGA 1MZEA 5K7PA 4COZA 3VBOC 3M3EA 3LSDA 2WZR1 1ZZBA 4BK4A 3HNMA 1H4GA 1Q5OA 2XKPA 2NMOA 3SKJE 1RGSA 3SH5A 3IB3A 3SCGA 3WV6A 1WLWA 2OPKA 2XVKA 3CJXA 4X6RB 1H9PA 3KSCA 4AGVA 3DPRC 4TTGA 4J1XA 2ZKLA 4HSLA 2B9UA 2BGPA 1SFPA 3TRSB 1NCRB 4ZU5A 4PHZA 3I7DA 1URXA 1REDA 3JBG1 1S0JA 4R9DA 1EAH2 2GH8A 1ENXA 4W6XA 5LZ6A 1WMEA 1QF3A 1PK6B 4RR3B 5FP4A 3RZMA 5CA6A 4XAAA 5F3EA 3K75B 2PMWB 4GWJA 3HD8B 5LBEA 1FYUA 2YPJA 2VNRA 4PDWB 2HYKA 5FXVA 4BQWA 5FZLA 1CIYA 3C8XA 2RJLA 3ZVXA 1U12A 4A45A 1JTZX 1OPOA 4XF1A 5I8TA 2BP6A 4QQLA 1ZM1A 4AEDC 3WUCA 5F37A 4UFHA 1XSRA 1HQLA 1NT0A 3OGRA 1X9PA 1LNSA 2R49A 1LULA 4NHKA 2AUYA 2F4PA 5C9AA 2XPJA 3WX5A 2DU0A 1F5FA 3CF6E 5EPAA 2YC0A 1XE8A 4FPYA 4JX0A 3JD72 5JAXA 4AZZA 2PHDA 1JHNA 1CAUA 2YGMA 3I2GA 4A4AA 1X36A 4GXLA 1U0AA 4AI1A 1S2KA 2XJQA 3X29B 1JBCA 1SPPB 2R043 3U4SA 1FOD1 2D3PA 5T55A 4CCDA 1K5MC 5EJZB 1PVC2 4CDWC 1CGPA 1YEWA 5JSPA 3ES1A 3IWZA 3ZYRA 3FHQA 5IK8A 2TEPA 1R1A2 2K0GA 2ZHMA 3USUA 2HWC2 2W68A 3SC7X 4BZ4A 4HT1T 5FO8B 1F4HA 2VO5A 4CYDA 1DG6A 2D6MA 3HN3A 3WDUA 2A1XA 4IEUA 4ZY9A 5DZGA 4ZXKA 1RIRA 4COUA 1W2NA 4NRPA 4C8DA 2FMDA 4KWLA 5FKCA 4CCEA 4GJYA 4NO4A 2PFWA 2OUHA 4BE3A 4QKNA 2HEYF 1RVF2 3LIHA 1UOJA 3HPNA 3QCWA 3THDA 2YPDA 4YZ4A 2JEMA 4KWKA 2XB6C 3KCYA 5J96B 2JWPA 2WQ4A 3KV4A 4EROA 3VD3A 1AL0G 1HLCA 2KA3A 4ES9A 4HVRA 4AWDA 2ZGQA 4D94A 4DRVA 3UJOA 1Q8QA 3H1YA 4DB5A 1BJQA 1C3HA 2Y6GA 4E2SA 1JU3A 2VMFA 1MS3A 4YGCA 3BU0A 2YGLA 1ST8A 3NNGA 3ZYIB 1GU3A 3UGGA 5F3GA 3WF0A 5KBFA 5L73A 2Y8KA 5KC5A 5FOBB 1D4M1 1S0GA 1LOFC 2VJXA 1W2TA 1K5MB 1W28A 2D3SA 4DINB 5IVYA 4XMIA 4I3PA 3OEAA 4CDWB 1C1LA 1RUF2 3RS6A 1OA3A 3ST7A 4A42A 3KMHA 2OKXA 4R4ZA 2PHLA 5EIYB 1X9TA 1SLAA 1UO9A 3ETQA 2XLGA 4AXOA 1UAIA 1RUJ3 5FY5A 2NP0A 3E97A 1FX5A 1DF0A 2X10A 3HIFA 4BYYA 2IWGB 3PIGA 3SCFA 2B39A 4EN9B 4OI1A 5FO7B 1UOGA 1AR91 3KS7A 2RR13 2WNUC 1W99A 3KV6A 5FYUA 2EXHA 4LKEA 2F17A 5FMOL 3OCPA 4HPKB 4RD7A 4U36A 4BQXA 4XF0A 1G9CA 3AM2A 5C6CA 4KGQA 4DZGA 4Q4W2 2WAOA 1V9U1 1UN1A 3MW3A 4WVZA 4V1PA 1MACA 1CVNA 4L11A 4RGGA 4XABA 5AVPA 3OGJA 4MXWA 2E31A 4LIVA 5FZ0A 5EYYA 2NZ9A 2WINB 2BPA2 1JOPA 4D7YA 4GB31 4BMEA 4NIGA 2VMCA 5BNNA 3EO6A 1VBE2 1WCKA 3GHMA 3U07A 1WW5A 2N7GA 1LHNA 2H6CA 4LBNA 2EXIA 4HN0A 4IXLA 2BFUL 2JENA 2QQUA 4LK7A 1OLRA 2X8KA 4KBZA 4Y1YA 3ZSLA 4MZUA 4FOYA 4QKFA 4NAOA 2YBPA 3IT8A 2ZJCA 4JC1A 3NNFA 4YW4A 2ZEXA 1ZBE3 2H0BA 4BB3A 2CGPA 5LY2A 5G05L 1LGNA 1NAEA 2VW2A 2JIGA 3POJA 4Y5Z0 3N7LA 1RL3A 5GZEA 1OFNA 4B1LA 2FDFA 5DAQA 3AP7A 4IV1A 3E1F1 3SLIA 1GQHA 1VPHA 1ZZ8A 2ET7A 4QPYA 2XQXA 5LASA 3ZXLA 2BWAA 2Q5TA 4FTEA 4KG8A 1PGW2 3WW3A 4YYOA 2WNUB 5IT6A 5BUVA 5GKAC 3A4UA 3WEZA 1UY0A 2DVGA 4HL0A 3ZXAC 5C33A 4LMFA 2CDPA 2VZUA 1HN1A 2HWE1 5IVEA 1V6KA 1HXS3 3WUDA 1PO11 3FFZA 5IUQA 1VBC1 2JDHA 3MIFA 4AI8A 1NKGA 2E51A 3H50A 4LE4A 5FZMA 2XKOA 4XUPA 2DV9A 2D5FA 3RDIA 4E9KA 4EN0A 1UZWA 2OZJA 3NVCA 3BODA 1UOFA 1N1VA 4Q2FA 2ADDA 4O7XA 4QXHA 3GALA 4QMAA 2Y0IA 5KXBA 4Q4V1 3KQRA 2R16A 2D6OX 4LE3A 2B8MA 3PVEA 4WV8A 4R52A 2D6KA 2Y64A 4QM8A 2XUMA 1ZBA3 3WZ1A 4QXCA 2WSVA 3WQ0A 4K8FA 2VUDA 1U5YA 3SH3A 5CADA 2P3KA 5FPXA 1GUIA 5IVVA 3OGGA 1BK1A 2QQMA 1LGCA 1SEFA 1PGL2 1HRI2 3LAGA 5GZCA 3QOPA 2VM9A 1UCXA 1I3HA 4B8EA 2V72A 4IUGA 1NQJA 3WNOA 2Y33A 1CPMA 3MPPG 2IXCA 2WBKA 2FDIA 4RA0A 2VC9A 5JSRA 5JMCA 3POYA 1FPN1 2RMU3 1H6YA 2VTXA 2WT2A 3ME2A 2Q1ZB 1K3IA 5C9AB 4NROA 1UOBA 2NQYA 2WUHA 4XEZA 4ATEA 3IM0A 3LIGA 5F2WA 1W8HA 3UYJA 3ZR6A 1C5IA 2P17A 4E8DA 4XF3A 1DZTA 4NIAA 3SKVA 2B5HA 3ZKYA 3VBFC 2R30A 4XQ4A 1WMDA 3W20A 1HRV1 3AKTA 1CAUB 1C8NA 4HBNA 2IZWA 5LATA 3VD4A 1AYN1 5IVFA 1GMMA 3I2JA 3VUOA 1FV2A 5H9PA 1OLQA 1JZ2A 3MIGA 2HBTA 4QDRA 5FPUA 2VXJA 4YM2A 5CZKA 2Z69A 1D7PM 2GAUA 4MG2A 5FBZA 3VHOA 3DGTA 3J8F1 4N43C 1SCSA 5KHKA 5K9YA 1KJRA 2JXAA 4R9CA 4NMIA 3WQ1A 4Y1ZA 4YVSA 3USUB 4B1MA 1IQAA 2ZBJA 3ZKUA 1QJY2 5FMDA 4CTEA 4AHZA 5C3RA 1Y7BA 1AXKA 3EXUA 4YLZA 3MIBA 2R042 4AHWA 5KHIA 2X5IA 1W0PA 3ZLIA 4O65A 3MIEA 4XF9A 4XACA 1W3VA 4I0BA 3V0AA 5FPZA 1LU2A 3O1MA 1MQTC 1NLRA 4NWWA 4CEWA 1UU5A 2GC2A 2WFF1 2DFCA 2XG3A 5GZDA 4OUEA 3AZYA 4BHPA 2GN7A 1UZVA 3PUSA 4ZHNA 2HWF1 5EP9A 2ZGLA 5LBFA 2RM21 1GANA 4LIUA 5FK8A 5FZOA 3KWVA 2GMMA 2SLIA 1AVBA 3I59A 3K3OA 3PIJA 5LK7B 3MGUA 4NPRA 2VBPA 3WT3A 2ZACA 3PVOA 5DDJ1 4AEJA 4Z92B 5CG8A 1WD4A 1N3QA 1N1SA 3W9AA 5A7NA 3FX3A 3AP9A 5JZGA 5BNNC 2FCTA 3T4VA 5EHDA 2YV8A 1ND3A 1DU3D 2HLEA 4IGQA 4XCAA 5FKBA 2CGNA 5HCFA 4KWUA 3NSTA 4YW1A 1WW7A 1VB4A 2QQPA 1R083 1WZXA 3ITQA 1XNTA 5ACA3 5BNPA 3H8XA 2VECA 2LUWA 1ULEA 4MADA 4OMCA 4QAWA 4NOTA 5T3NA 3C7EA 3VD9A 3VZKA 1GQGA 4GWNA 4BM8A 3H3UA 3ZYBA 3EBRA 4YZ5A 3POFA 2PQQA 2WT0A 2ZZJA 3MBWA 1LOGA 1W06A 1SLLA 4OUSA 4IV1C 1W8FA 1BEV1 2DVAA 3N9MA 3WF3A 1YCIA 3ZMOA 3AXEA 3AMPA 3BB6A 3L2YA 1LOAA 1VAMA 5CKMA 3B93A 3D0JA 3N3HA 5H9QA 3AP5A 3ZR5A 3ZMNA 4LITA 1CZSA 1D4VB 5SV8A 3EYPA 4COVA 1WGPA 1VRH1 4LBQD 1US3A 4WZFA 2E53A 3D3AA 4MXWB 1RUOA 4JKLA 1EPWA 2QKDA 2RR12 5F6KA 1JYNA 1S55A 2CYFA 2RVAA 1RUG3 5HCBA 5BNNB 1QOSA 3LKJA 3SH4A 1RITA 2DVDA 1RUI1 4HKLA 1W8ZA 1H30A 1H1MA 2E9QA 4QPIA 4R9AA 1UXXX 1JU4A 4XXAA 1HB3A 1GOFA 2YB7A 3THTA 3VHPA 3QD6A 2EAAA 5AC93 5EFUA 4FPLA 4LOSA 1AR83 1OHFA 2BRTA 1HDKA 3ACLA 4LHLA 3SNMA 3WY6A 3WXPA 1OXCA 4Z2AA 2VZPA 4OULA 5LY1A 2ZHKA 1AX0A 2W1SA 1GSLA 1NE6A 3TN91 1M4WA 4DEQA 4W50A 2GP5A 3N7MA 2OX0A 2CWMA 5IAVA 2EIDA 2W9XA 4IV1B 1KD7A 4XFCA 2QCSB 4WM7A 4RHV1 4QGNA 3URFA 4QDSA 4A7KA 2FDKA 4QPGA 2W39A 1S0EA 1QXJA 1BKZA 2HYXA 3ES4A 1Y9QA 2PELA 3NV1A 4P5YA 4CP1A 1Q8OA 3TEWA 3N4MA 5GJ6A 1QXPA 1JYWA 1XPWA 1XYOA 5BYNA 1OD3A 3HAGA 3JU9A 4XUQA 1AX2A 4LA3A 4NIHA 3POGA 1GZCA 4RQPA 4IL7A 4CDUC 1POV0 4CCMA 4J6GA 4DY5A 1EUUA 4ZKTB 1WLCA 2XBO1 2YG0A 4IE7A 4ZZ5A 2AACA 3H9AA 1K12A 1YC61 3BIWE 4MYEA 4B29A 3KCXA 4XCBA 1W8OA 3AZWA 3OSDA 1HXS2 5C3PA 3HQUA 4L99A 4YVSC 2PQSA 2Q1MA 3LPGA 4AQTA 3ZM8A 4CUAA 1COV1 4YFZA 1UKRA 2C1FA 1TG7A 2JG8A 2WJSA 4Q4X3 4CVUA 2BBVA 2X5IC 4Y4YA 4I01A 3TWIA 4NJ4A 5LEJA 1EAH3 1V6IA 2XGXA 1DGWX 4LPLA 2WIIB 1CN1A 4OQ8A 1X8MA 3KHCA 3I2FA 5C8CA 5CIRA 5EYXA 4Q5OA 2DBNA 4G3YC 4F3JA 1O3QA 1ZBA2 1ACCA 3J4UH 5CKQA 2Q8EA 3U10A 5JDBA 4K1ZA 2CL2A 1JZ5A 1JUHA 1CPNA 1X8EA 3TAYA 2WS91 4AFDA 2OIIA 3FBYA 2A6WA 2VNGA 3ZYFA 1LECA 1QKQA 1B35A 3H8OA 4MGKE 5LA1A 2ZXQA 3KVBA 1KJLA 2GSYA 1RMU1 5JZGC 2QQJA 4Q0VA 3ZFFA 1C8M2 4BXSV 1H2MA 1ND3C 2CGOA 4AQ2A 1RTVA 5LB6A 1XNAA 1US2A 2AC1A 1SDDB 2TUNA 2E7QA 2WFPA 3ZFEA 1CAVA 1N1TA 1QQP1 3ON7A 4QX1A 2RMU2 4BU2A 3WG1A 3NQHA 3NNMA 1P8JA 3LE0A 2WYFA 4GMP0 4XW3A 4UW6A 2E6VA 4CDUB 1QJX3 2A3YA 5BNPC 1DP0A 2VUJA 2VW0A 3C2UA 5B2GB 3IKWA 2BZDA 3I54A 3V64A 5DG1A 2VZOA 4N8MA 4YNIA 1IHMA 4HK8A 4YVSB 5JMOA 2XL9A 2W1WA 1GOHA 1SBFA 4YW7A 2XXZA 2CWSA 4P14A 2LRPA 1XE7A 2XVLA 2VOWA 1PM7A 2VQ0A 1PVC3 2X5IB 4FTBA 2VH9A 4YW2A 2QDRA 3ACGA 4C91A 3V0AB 2RS33 2GALA 1W0OA 5FXZA 2C0ZA 4ARYA 4CEWB 3ABZA 2HWB3 3LOBA 1LJ7A 1YQ6A 2WZPP 5GZFA 1O3RA 1XJAA 5FZOB 4P9XA 2PHFA 3E5XA 1YIFA 3I59B 3MLLA 3NMBA 3PVBB 4ONUA 3H1MA 4PIYA 4UYBA 2J1VA 3UKVA 4FAGA 5HXMA 2RG4A 3LSEA 4XBNA 5FIXA 3JB8A 4E4DX 5CFCA 3MPBA 3ACFA 1BBT1 3DUIA 4JTOA 4NWVA 2VCCA 2YFUA 2R073 5FZ7A 5HXVA 4CPBA 1ULOA 2PYTA 5JZGB 2BWCA 4A2UA 1RUH1 1ND3B 2VOXA 1Q8VA 5GLVA 2JDUA 2E26A 4XFAA 1AR73 2ARBA 4QPIC 4CU7A 3K51A 1W8TA 1ONAA 2YU1A 1QOTA 1QNYA 1UPIA 2JDAA 3WHTA 2C26A 3RFRA 3CL1A 3GBWA 1ZYBA 1D4M3 5BNPB 2CAUA 3PU3A 4NIDA 1SCRA 2R32A 3LA7A 5K8SA 3AMMA 4Q4Y2 5C3SA 1GYKA 1OFSA 5CEHA 4LR4A 1WCQA 1J1TA 2JG9A 3KF3A 1ODNA 2ZGOA 4BDVB 2NLRA 2MEV1 4H14A 1GP6A 1R082 1HJGA 4WM7C 3HOBA 3LEIA 1ULDA 4QPGC 1ASJ1 4ZS3A 4YZ3A 3SEPA 2QDNA 3POEA 4YG0A 1RUE3 1AR93 5IK7A 5FZGA 3RMYA 5JPNB 4YM0A 2OW4A 4DNYA 4D8MA 2JB8A 2WWJA 4L8QA 5GLTA 5DAVA 2WYSA 3ZN4A 2DCKA 4XUOA 5LBCA 3VKNA 2JDNA 4H7LA 2B7YA 4JHZA 4AVSA 4AQSA 3HR9A 4ISRA 3WR0A 3ZDSA 1AYM2 4Q4W3 4RQPC 4AEMA 4C0HA 1I5PA 4O9GA 2JKXA 3FC0A 3PLQA 4Q27A 1JI6A 4S2GA 4DMIA 3PURA 4HN1A 4QPIB 5FZBA 4EZHA 3LCPA 4XJAA 1QGLA 3MW2A 5FRAA 3BI3A 1NLSA 5FREA 3PVNA 4OVEA 4Z82A 2YXSA 1XBFA 5G04L 2R0HA 4BH9A 2JG8C 2D97A 3M3IA 3PTYA 3NJYA 4HG6B 1YJLA 1EV11 5BNOA 3H42B 1GV9A 3QACA 2XJRA 1VBD1 5F5IA 3AVRA 4FCAA 1J83A 2CY6A 5FMCA 2R0FA 3N35A 1H8TA 5C8CC 5ANNA 3NV2A 2J1EA 4JRAA 1S0BA 1NA1C 3ROUA 4X6QB 5FYBA 1WA6X 1PGSA 2P34A 3OF1A 4WM7B 4TYSA 1AR82 2Z79A 1WCSA 2W3JA 3O14A 4QPGB 1WW6A 5DAWA 2JICA 3FMGA 3MUY1 5F5QA 1L7LA 4HK9A 4SBVA 4FTSA 1C4RA 3MO4A 1H1IA 2BU9A 3ZSMA 1PK6C 4Q0UA 3UKTA 4JAAA 3ZFFC 1WLTA 3AP6A 3PMSA 2QTWB 1LR5A 1VRBA 4N90A 3MIDA 4XFBA 3WDYA 3J7MA 1GP4A 4NHLA 2HWE3 1MS5A 1QXRA 4RQPB 1PIV2 4OCTA 5A33A 4HZFA 1R091 3KB5A 1XOYA 2G9FA 4LUMA 3GJBA 1BLZA 2Y6HA 4GA9A 2VU9A 4JZRA 4NHYA 4C1WA 3JUUA 5FBJA 4EV0A 4ET7A 1YO8A 1BMV1 1RJ7A 3BTZA 1POV1 2HEVF 2IUWA 3HQXA 1XQNA 4S2DA 4PLMA 4P00B 2D3RA 2JG8B 3EJKA 2W92A 3CEWA 1CQ9A 1JZ8A 4QX5A 2VL4A 3AK0A 1MEC1 4IE5A 4E4ZA 2QZ3A 3N9OA 3HBZA 1WBFA 5ERLA 3RZKA 2RS11 1JOBA 5C8CB 4OI2A 4XAEA 1VB2A 3V56A 3T09A 4XJZA 5F6LB 3JBG2 2ENRA 1NA1B 5LWBA 3VHRA 2D6NA 1HRI3 5FYMA 4Q4X2 4FVVA 3OJBA 4QQOA 4C90A 2ZX3A 2PHXA 4I2OA 1S0FA 5CFCC 1B35B 3FZ3A 1FPN3 4A41A 4LULA 2IXIA 3T08A 2A6VA 4TXWA 3LFMA 4Y33A 1VBB1 2P4EA 3ZFFB 3K48A 2BGCA 1JYCA 4LTAA 2WN2A 2YFZA 2ETEA 1NY71 3WW4A 3TNQA 1CAVB 2OPWA 4V2VA 5L19A 4ASLA 2Q1FA 1ENSA 3GF6A 4L97A 4B4RA 1VALA 1AYN3 4MV2A 2W91A 4DS0A 4WM8A 2J42A 4LJHA 3RSJA 1KDMA 4HETA 2NN8A 1NUKA 1IG0A 2PAMA 1W9FA 1RHI1 2K9ZA 1S1AA 4GMP1 2W52A 2AR6A 1UMHA 2E63A 5D8AA 1GLHA 4LK6A 4QWNA 3I97A 1LAJA 3OPWA 1E5IA 1RXFA 2A3XA 1QJX2 1YXWA 4Y26A 2BJSA 1ENRA 5DN2A 3C7HA 3S5AA 3P1IA 1QJY3 1Y9MA 3DN7A 4K6BA 5JR7B 5DABA 3VKLA 5CAZA 2ZX0A 1M06G 3S30A 1VIWB 1Z7S3 4LBQA 5FZKA 5H9RA 4Z2WA 1K42A 4LO8A 3AMHA 5EJ3A 2VZQA 1PMJX 5CFCB 2GMPA 4BOWA 2Q8DA 2RS32 3H3LA 4YGDA 3KT7A 4CCOA 5KXDA 2HWB2 2FBEA 4UW3A 2E7TA 2Z42A 4AAXA 5CVRA 4BIFA 3MDPA 3PMEA 2PLV3 1LGBA 4Y22B 5A1LA 4W65A 1FMD1 3J7NA 1OVSA 1UY2A 1YQCA 4Y5TA 1QWRA 1V6NA 2RDRA 2J7MA 5FXXA 5FJKA 2ZTNA 3O1OA 3O1PA 2MHFA 2ZAAA 1W0NA 2R072 2ZMNA 3WQBA 1O3TA 4IEXA 3MFAA 5C70A 4ASMB 4CEYC 3QLQA 5A6YA 1AR72 2VOKA 5B4XA 3M2MA 4JDMA 4YPJA 2OYZA 1QMJA 1QDCA 3D0SA 1R1A1 2ZEZA 4K40A 4MGIE 2HWC1 2GMEA 1D4M2 1F2NA 5LRRA 4CZSA 5FZAA 2YHJA 4YRDA 4OI0A 1YFWA 3INAA 2ZGMA 1FNZA 1SBEA 1S0DA 2DF7A 2LTNA 3LPFA 3R4UA 1RVF1 2JD9A 3L9JT 1CX1A 4DY3A 5DMYA 3O0VA 3OPTA 4L2NA 4META 4DO0A 1J3RA 1MS8A 1NOVA 3WP6A 2Z2SB 3O7OA 2XLAA 4RL7A 2AZ5A 2BGOA 1AHSA 2MNGA 3UESA 1RUE2 1D0HA 1AR92 2ES3A 5JPMB 2C6SA 4AF9A 2ATFA 1FI2A 3H7JA 5A7OA 4XILA 5JVVA 3WQ7A 1MVEA 1UX6A 2WKKA 1RUI3 3ATGA 1UL9A 4LO7A 4W6YA 4GQ7A 1V9U2 2OA2A 4TLGA 3K3NA 1NYWA 4UFMA 3S6PA 4PBOA 1OC1A 4KI5M 3RNSA 4W4ZA 2UYBA 2WABA 4CEYB 2J1UA 2XDVA 5FLHA 4EZ4A 5EWSA 4CUCA 1RUF1 1OKQA 2J1RA 4IEWA 1H8TB 1TNRA 5LK5A 3T0BA 3TN93 5DZFA 3N9NA 3JCIA 1ZRCA 1NXMA 3WVJA 4DRRA 1PZ9A 3KZ4C 3FN9A 4ZPIA 4P5HA 3RZZA 1WKYA 1OUXA 2IVJA 3Q8BA 4A6SA 4L9BA 4CCKA 1FT9A 4UI9L 3NKTA 1DCSA 1FATA 4AYUA 4D69A 5KR7A 1NLQA 1TME3 4IDZA 3B94A 3DKQA 1XC6A 2BOJA 4TWTA 3JQXA 3S5QA 4MGYE 3UNPA 1O59A 4JVAA 1U5ZA 1FXZA 4FPGA 2CSGA 1VBA3 3HNBM 1YUDA 4YG6A 3S0MA 3K4ZA 1H2LA 4FXKB 4BLIA 3T3YA 4AR2A 3ORJA 5A33B 4U2AA 4WM8C 3AJYA 1O3SA 4GZ9A 1HIXA 2A6ZA 4DQAA 3FWEA 1VBE1 4CCCA 3MICA 1H2NA 4BISA 1ZRDA 4Q8KA 3D5OA 5C9AC 2W87A 3ZIWA 3T2PA 5A6XA 5FZHA 3WG2A 2HWE2 5FK7A 5D8AC 2P3IA 5E8AA 1R64A 5DZEA 5K0UA 2ARAA 2ORXA 1PO12 3CO2A 1HQNA 2G9GA 3VBRA 4INDA 5BY5A 1SACA 3I2KA 2AENA 4NVPA 4UW5A 5A3OA 1UMZA 4CXWA 5C3OA 1GZTA 3RPQA 5ISLA 3BTAA 3M3CA 4QX7A 1AZDA 1LOEA 1HQWA 2B9VA 5T5OA 1APNA 4Q4V2 4PF5A 4IEYA 4A3ZA 1BYHA 5FZ3A 3OOXA 2XWBB 3PUQA 5A70A 2OVUA 3T4HB 1G9BA 1OVPA 3CZUA 4D7TA 2LALA 4HMZA 1HV0A 4KH9A 5LA2A 1PGW1 3WDXA 5GALA 1LCLA 4IEOA 2YZ4A 1K45A 4BMBA 3KLSA 2Z4FA 4RGAA 5LW9A 2ZGPA 3U4XA 4F7ZA 2VTFA 1HKDA 1UU4A 3VKOA 1UNBA 4YW6A 3NKGA 3VGIA 4ORFA 3N7KA 1PO21 3DCQA 2DFBA 2EIGA 1C8M3 3S7EA 2X05A 4WM8B 1FPN2 5T50A 1VMFA 3I2OA 2WO3A 3O1SA 3THCA 1IS4A 1CD3G 4K8RB 3UKNA 5JOXA 2PTMA 1F35A 4YGBA 5LRSA 1O4TA 4P9JA 4XJUA 2DYCA 2I74A 1NQDA 5JSOA 1CZTA 1V6LA 3WW1A 1DQ2A 5CNAA 5D8AB 5F5AA 3PU8A 4XFHA 3I4IA 1AYN2 1TEIA 3MLJA 5F3IA 1LENA 5FY7A 1VAVA 1W9TA 3VBHA 4MVTA 5A3TA 1LTEA 3B00A 4BIOA 1RUNA 1WUVA 2VG9A 1QY4A 1HX6A 3IAPA 2K46A 3ASIA 3LA3A 1ZRFA 1IS6A 3VBSA 1Y43B 4J1WA 4P08A 3FLTA 2DUQA 2WO2A 2RS53 3RI8A 3TYJA 5IW0A 3ZSEA 1V6MA 1QHDA 2I07B 4IEVA 4WVVA 5LBBA 5FTTC 3AYCA 4QXKA 4XPVA 5T5LA 3I2HA 1LEDA 3GYDA 4AI9A 3RQ0A 4AEKA 3V0BA 1Z7S2 5I0UA 2HEWF 3H8RA 1UPSA 4N53A 1UX7A 2EF6A 4FPFA 3ZO0B 4UXAA 4KMQA 4CUBA 2WA4A 4YARA 3USSA 3CJIA 1N47A 5FY1A 2KXLA 2HWF2 3T2OA 4QM9A 3VDAA 1PM4A 4M0HA 1OA4A 3NJXA 1CJDA 4JQTA 5A7SA 3GHNA 3WF2A 3ZIXA 2CHHA 4YVWA 2ARXA 5F39A 3RMXA 1W8UA 2O8QA 3RWKX 1XNBA 3C7OA 4Q1PA 5DUUA 2E7AA 5DDJ2 4L92A 4B4QA 1I1EA 2Y34A 4AG4A 3RZLA 1MZFA 2DVFA 2PLV2 4K1YA 3N7JA 2XJTA 2DVBA 1CESA 3GCWA 2VGDA 2VW1A 5A6QA 1EP0A 1XRUA 1NCQA 2ZZQA 4Q4Y3 1W2OA 1OKOA 5FLJA 1GKBA 2PHWA 3IDAA 4XDPA 3G6JB 2ORZA 2DCJA 4YZ1A 5L36A 3W59A 2JKBA 2ZGSA 4DUVA 4YWAA 1VJ2A 1UYPA 1W9SA 3C7GA 5CU1A 3RJRA 3S7IA 3WP4A 3MF9A 1QJZA 1QOOA 1KGYA 2W08A 3T1LA 5J09A 4AFMA 1EYBA 3FBMA 3IBMA 1O5LA 4HOOA 4K20A 4FOVA 2W1UA 3ILRA 2UURA 3W5NA 4RFT0 1PMIA 3JXSA 1J84A 1Y3TA 3DKWA 3O1TA 2JDZA 4ZZ8A 5FR3A 2QE3A 1BCXA 4ZS2A 2VMEA 3B9CA 1SMVA 3HMYA 3IPVA 1GZ9A 2G4IA 4LORA 5C4WA 1HJFA 2PAKA 1AYM3 1YJKA 2ZGRA 3AC0A 1MZ5A 3N9PA 5FYTA 3ZSKA 1SG3A 1VRH2 2VTXJ 5EJ1B 2VOTA 1BVVA 4H7MA 3OUJA 4IEPA 3VBRC 4XBQA 2O14A 1JZ4A 1AL23 2OT7A 5I91A 3BPSA 4R4XA 2XJVA 1UQXA 2ZEWA 2R063 5D1IA 2WR9A 1RUI2 1EV13 2GH2A 3M3QA 3K2OA 4GH4A 4KU8A 5F1RA 3KQ4B 5E6HA 2RDNA 4M4PA 2F6BA 1VMJA 5FZ6A 3KV5A 1S2EA 3PNAA 4I0WB 3M3OA 4XMAA 4AFCA 1WCUA 5FQ0A 2XHNA 1WWYA 4BQ1A 1U5IA 2JECA 3U1XA 1RINA 4QKBA 3N36A 4NRQA 3O1UA 3VZNA 3SITA 5LCWL 1I6XA 1C28A 2X29A 4PLNA 2VUAA 3TN92 3VHNA 4URTA 3BGAA 3DF0A 1L3JA 2DBIA 1RUJ1 4EQVA 3K4AA 1CAWA 4XQDA 1PZ7A 1RYYA 1TME2 4FT8A 1XNDA 4LBOA 4RHV2 1ZZ9A 2G1MA 1Y4WA 2RR11 2XH6A 4O61A 4NAMA 3UK9A 2NMNA 4BJ0A 1GQPA 3CLPA 4WBBA 1R093 1RUC3 4KQ7A 2WA3A 3VKFC 3UETA 2FD8A 2XHKA 1VBA2 1PIV3 1TMF1 1LHWA 2VMGA 3IIAA 3PTRB 3LDKA 3GCXA 3WOGA 3NAPA 2LW8A 4WZCA 5FZDA 1POV3 1TZOA 1AR61 5A6ZA 1HV1A 1JZ6A 3E6CC 3VBRB 3THPA 4ZU4A 5H9SA 2WZR3 1W6OA 2BYVE 2FDGA 4IW3A 4LKDA 4QHZA 4Y1XA 4XOGA 1J58A 5KC6A 1OH3A 3IDCB 2WNVA 1S2BA 1W6NA 1MEC3 2VVFA 3ACHA 5DG2A 3ZXJA 3VZJA 2XBO2 1XNKA 4QHBA 1MS0A 4MSVA 1JXNA 2AGSA 4JV4A 1Q3EA 3QH7A 4Q0QA 3RI9A 2FCVA 5E88A 1RUD1 1OOPA 1WCDJ 4FQ4A 2HWD1 3PUIA 2HH9A 1H6XA 3M70A 1ZBE1 3JBG3 3I8TA 5J3UA 3I3DA 3ZN6A 2VAUA 2VCMA 2K2SA 3AB0A 3CDZB 4COWA 2Y0OA 3VZLA 2VUCA 3ZXGA 2QFEA 3GZEA 3KGZA 4CEWC 5HCHA 2VPVA 2Q8OA 2YY1A 3POIA 4I3GA 4YVWC 5FUPA 5FV3A 4LA2A 5FY4A 2D6PA 2P2KA 3AMNA 3BALA 3VZMA 3BPZA 4E2QA 4LT5A 1PNFA 3LEKA 3HN1A 5IVBA 5L9VA 2FCUA 1RMU2 1YFXA 1Q8SA 2Q4SA 4AE2A 4EN6B 4IGPA 3A0NA 2C5DA 3ZFGA 1V00A 3CNAA 1HXS1 1NCQC 2QQNA 4GKYA 4LLOA 3E6BA 4G9SB 2OXBA 3VBUA 4P9GA 3WW2A 5AFEA 4OLLA 4PJYA 5JXGA 2ZGUA 3VBHB 1SQ4A 3BOWA 2JJ6A 5IYYA 2JD4A 1VAKA 2DDUA 3Q8EA 4HSJA 2PN5A 5ABJA 4XE9A 1XYNA 2VNVA 3LWCA 4UW4A 1BHGA 4LLFA 4XJWA 2QJVA 4IERA 1IOAA 3MFCA 4K7JA 4MHRA 5DAPA 3O1VA 1SDWA 5F32A 2NYYA 1FOD3 4UFKA 4XZUG 1X33A 2XQRA 1SFYA 3LD8A 5C7GA 3LDBA 2UY8A 2KM2A 4AHXA 3H1WA 5FPAA 4MGZE 3RVHA 4XFGA 3V0BB 1YNAA 1GP5A 3K77A 2W0XA 4W6WA 1E57A 3TNPB 3ZXEA 5F7UA 4AAPA 4IV3A 4N53B 4LBLA 5FJHA 2EIBA 2W46A 5C4WC 4A6OA 5C3QA 2RS52 3NNJA 2X53S 3KD4A 5CYYA 3ZYJB 1OPMA 1V6OA 1FMD3 4D0QA 3MV11 5L9BA 4YVWB 3FJSA 2RMU1 2GN3A 3ACIA 1UZYA 3LQCA 3SMHA 4HLTA 2UWAA 4OUMA 2VZ3A 1A8DA 1BBT2 4UOJA 2EXJA 1G9FA 2XJPA 1S4CA 2ZMKA 1W8NA 3VBOA 3CBNA 1RUH2 1N1YA 3IIIA 5A32A 3WINE 3OBTA 4RYDA 3T30A 1KS5A 1NCQB 4QX2A 1Z78A 2DTWA 4GH4C 5J36A 1C57A 2QZ2A 3P3PA 2QQOA 4ASKA 5IK4A 3IDEA 1XU1A 4FI9A 3W58A 4ARXA 4ZONA 2R6QA 1OD5A 4Y3OA 3NW4A 3DPRA 2VZTA 2WLPA 3HJRA 3MHZA 4E2GA 2WO7A 4CDQA 5DUWA 3ZOIA 4FPCA 1XXNA 1NZIA 2JE7A 4KBBA 3AXDA 4JDNA 5T54A 3OUIA 3WNMA 3IAQA 3KT1A 3H8UA 2W5FA 5F5CA 4DXSA 3LFIA 3SQOA 2ZOEB 1AXYA 2CV6A 4AQ6A 3DYPA 3OGSA 1VMHA 3OB8A 3POBA 4PI0A 4GWIA 1XU2A 3IPVB 3LOIA 5C4WB 3N9LA 1C1FA 5JIAA 1DLCA 1VP6A 1ND2A 3AKPA 3A21A 5A3NA 1OQ1A 4AEDA 3EMRA 1IPKA 2CNAA 2P3YA 5IVCA 3WF1A 3NAPC 4COYA 2RV9A 3OBRA 3M8LA 1JZ7A 3R05A 3PJQA 4XIKA 2GC3A 2VBBA 2O1QA 1V9U3 5DPNA 2WNVC 5FZ4A 3VV1A 5IWFA 5HCAA 2XL7A 1LHUA 4D3WA 1DHKB 1W2AX 2ET1A 4R9BA 4QT6A 1BXHA 4TN7A 4GH4B 4QD2A 3I2IA 5FLIA 2VOVA 2IXHA 4GB33 3KGLA 3B01A 3U11A 3E5UA 1QJU1 5ACA1 4PBPA 1AL22 5J37A 1VR3A 2RJKA 4HVQA 2R062 4JQRA 1EV12 4D7SA 3DL3A 4FXGB 1DQ1A 1VBD2 2FZ1A 3AZZA 4AL9A 4Y20A 3FHAA 2YROA 4PI2A 5DQ0A 4PT6A 1W8WA 1PX3A 5FZ8A 4M00A 4E4HA 1CAWB 1KQRA 3AL6A 3AYDA 4IE6A 1DFQA 1GR3A 5EV7A 4E8CA 1LU1A 1X7NA 3HNYM 3VD5A 4OQ9A 2PHRA 1SFNA 3NO8A 4EE2A 3AFGA 3F95A 4QX8A 4LUKA 5F8PA 5BXXA 1PHMA 1NZCA 3FE5A 4YG3A 4C1XA 2EAKA 3WNPA 3O12A 3ZN5A 4L0PA 1O4ZA 5ANQA 3U75A 2DCYA 3RG0A 1B35C 3DV8A 4RSUA 1J3QA 3M4FA 1S0CA 3NAPB 3ZFGC 4DOUA 2BBAA 5HV4A 1UYXA 3BOPA 1KFUL 1WMXA 1MR5A 4FOQA 3VBUC 3VL9A 1W6OB 3O0WA 3S57A 3SXWA 1A8MA 3ZFEC 1RUG1 1R092 2WNVB 4MX3A 1W6NB 3BTYA 1RUC2 2W1QA 1RB8G 4NPLA 1GWKA 4BPZA 1UMIA 5ABJC 2ERFA 3RYPA 1PO13 1PNGA 1VBC3 1V6JA 4XJ9A 3AKSA 4BQ2A 3BYWA 2BEOA 1A6CA 1ZRRA 3J26N 4CP0A 5CKNA 5AC91 1BMV2 1OOPB 4XUTA 1PVXA 3TEYA 2WZR2 3E6DA 3P6BA 3WNLA 4AK3A 2IXKA 4Q4V3 1OT5A 3VDCA 4D6QA 1MEC2 4UAPA 2A75A 4ZXEA 3UGFA 1YWKA 4H55A 3ZN6B 5E89A 4IV3C 2GNDA 3W21A 3EQEA 2IC1A 2RS12 2WO1A 5KWRA 2A3WA 2YC4A 2JE9A 5FYYA 1SLIA 5I8YA 1LHVA 4LHSA 3MF6A 3UV9A 2WAAA 1ZA7A 1H4HA 4HANA 3WCSA 5JWPA 1DQ5A 4LHKA 2EICA 1O6UA 4AVAA 2C24A 2WNUA 1DGWA 2YDEA 4P9LA 1VBB2 1E5SA 2RDQA 2IFRA 2WLQA 4QQHA 3AX4A 5D21A 1T6GC 3ZFGB 2G19A 4M0NA 4UT5A 1NY72 5JIUA 1IS5A 1H8VA 4OHXA 2P3JA 3VBUB 1S0IA 2QQVA 5AFBA 3ZFEB 3U0ZA 1EUTA 4LKSA 2QQIA 1HRV3 4E27A 5ABJB 2VD7A 3UL2A 2ZA9A 2YBSA 3TEZA 1JYIA 1RHI2 1CR7A 3APBA 3C3VA 3GBFA 4CDQC 1V0AA 3VN4A 5FO9B 4DPNA 3AYAA 3DXUA 4CE8A 2WWUA 3AFKA 1FNYA 1UU6A 2XMLA 2UYAA 4FFHA 2W2IA 4OHVA 4Q4X1 4YW3A 2JG9C 3J8F3 4MGTA 1EAH1 1Z0HA 1O7FA 1SHWB 3CZJA 4HKWA 4EJRA 2VZRA 2NM1A 2Z5WA 1K5JA 4IV3B 1GWMA 3DXTA 2Q30A 4J25A 3O1RA 1WW4A 2AH2A 1REFA 1F15A 4CU6A 2J1AA 4D6RA 1FOD2 1ND2C 2FHRA 5FPBA 3WNXA 3KV9A 1DYKA 3LF7A 4I0AA 2DUPA 1YRZA 2LROA
chains in the Genus database with same CATH topology
2WFF3 1MZ6A 3JZVA 4CDXA 3VL8A 2HWF3 2RM23 4Z1VA 2C9AA 3VBOB 4LBKA 2B46X 5A32B 4FSJA 1OMIA 1UW8A 5DDJ3 4K9SA 3VDDA 1FMD2 1WA4A 3ILFA 4IEQA 4Z8BA 4TLFA 3JD71 1QJX1 4LO4B 4QU2A 5JOWA 3DPRB 4WVMA 1DDLA 1DYPA 1PZ8A 4UBGA 3NL1A 3D8CA 4CDQB 1LHOA 4HKOA 5BNOC 1PVC1 2JG9B 4Y1VA 1H8TC 2DCTA 4P9YA 2RS31 5CFDA 1ENQA 2O8OA 2OZ6A 5JOYA 2HWB1 4JGZA 1QNWA 1BEV3 1ND2B 4I09A 3KT4A 4AEDB 4GALA 3WG4A 1UD1A 2B42B 1TQ5A 5JI9A 2RHPA 4AI0A 5CBLA 2H6BA 3EHKA 1D2SA 2R071 5CG9A 1VRH3 1W2UA 1AR71 3WP5A 2ZABA 4AGGA 3VBFA 1AX1A 4EWAA 1UIKA 1QU0A 3M1HA 2DCZA 4FPJA 4XFIA 1JUIA 3VLBB 3R0RA 5FMOS 2CAVA 1IGOA 2YUEA 2A6XA 4Y20B 2GNTA 4N43A 2FMYA 1HW5A 2A71A 3WDVA 5BNOB 4GB32 2IFWA 1X50A 3POWA 3NV3A 1O91A 3D82A 4XF4A 3WDWA 4AI3A 4PQ9A 1RUE1 4Y1UA 2D5HA 1MVQA 4BA6A 1MQTA 3VZOA 4AVCA 1LODA 2PHUA 4RHV3 1GBGA 4QGMA 4EWDA 2R1BA 3RWNA 1TMF3 3ELNA 1WLDA 4QQ2A 3OTFA 2BFUS 4H3WA 1U5XA 1Q8PA 2PAEA 3ILNA 1DQ6A 2ZKNA 1AR63 4Q4W1 4R8HA 4AVBA 1F31A 2XVGA 1J1LA 4AVVA 5C8WA 4B7KA 3TB0A 2A70A 1J59A 1W39A 2RE9A 3WLUA 2XWJB 3T1MA 1N3PA 2A6YA 1D0GA 4LBJA 2XBO3 1RUD3 5HI0A 3R6SA 2D44A 2HWD3 1GFF2 4XTMA 3AMQA 1Q43A 3FUQA 4A7ZA 1VBC2 5F9TA 1COV3 1CJPA 1OQEA 5J48A 2LM3A 1JH5A 4Q0PA 3OY8A 4JGYA 2ZHLA 3H7YA 3P3NA 2FQPA 1OSGA 4OFGA 4Y24A 5EXOA 4CDXC 4OHYA 1W6MA 2I45A 5FOJB 1DZQA 2TBVA 4JTNA 3HT2A 1I9RA 1UF2C 1LESA 3AP4A 2WS93 4NR1A 2DTYA 3VDDC 3G7DA 5BPXA 4MUVA 5DUXA 2YYOA 3WCRA 1RMU3 2IXJA 3R4DB 1PO22 4MXVA 3WG3A 2ILMA 1KDKA 1TE1B 3B3QE 2WWSA 1A78A 3E5QA 5JLVA 1IKPA 1QQP3 2YMZA 4CP2A 1Q56A 5BV6A 2P37A 4DXZA 1B09A 1ZA4A 5J7MA 2NPIA 4AW7A 4A3XA 2QNKA 1W6PA 4OHWA 4IQPA 2GZWA 3ZX7A 1G9DA 1HRV2 5L7OA 1SLCA 5CFDC 1DGRA 1G9AA 4JGZC 4X8PA 4BLJA 3B69A 1ZZ6A 4AHYA 1PGL1 1HRI1 1YFYA 3B5LB 5T5JA 4LBQB 3OYWA 4DFSA 3J8F2 4CDXB 3ECQA 2ZS6B 4KGGA 2D40A 1JW6A 3MW4A 2Y26A 4B7EA 5GLZA 4S2FA 1IZ3A 1OA2A 1SLTA 3FLRA 5DXDA 3ZMOA 4KG0A 2WQZC 3VDDB 1WMFA 1BBT3 1WD3A 3T2TA 4G4FA 4FAHA 4N9HA 3GZAA 2WFF2 1RUH3 2UWCA 2EVXA 4FO9A 4QQPA 5TSWA 2RM22 4TSVA 1CAXA 1ALYA 4WVMB 3IN9A 4CDUA 4F83A 1LEMA 1GZWA 1ZNPA 1ZX5A 2DURA 4FOWA 4XZPA 3IDBB 1DQ0A 1H0BA 1UZZA 4BCUA 3QH6A 1YYNA 3WDTA 3CU7A 2BNNA 4YW5A 1YHFA 4C0BA 5CFDB 2BVBA 5GM0A 1QJY1 1G86A 1DBNA 1G7YA 1DQ4A 1RJ8A 2MEV3 2ZX1A 4JGZB 2R041 1Z7S1 5I0TA 4BWOA 4Q0SA 1YFUA 4YSFA 4ITCA 1ASJ3 4LBMA 5I0SA 3L2HA 3NWKA 4K21A 4RS5A 1C5HA 4OI4A 4XJ8A 5KXCA 5JCTA 4M3CA 5FDBA 1BEV2 2PLV1 1IKQA 3KCCA 1A3KA 1EY2A 2UWBA 4KU7A 2HJIA 3VBFB 4GWMA 2VULA 4XDQA 1KITA 3V65A 4N9IA 1V70A 2TNFA 1QJU3 5DUVA 2D7FA 2ZGNA 2QUOA 3H0OA 1OQDA 2WL1A 5K0UC 3MLKA 4N43B 3R4SA 4O9EA 2ZAHA 2WC2A 4KL1A 2Y38A 3WP3A 4JGYC 4NHMA 2IXLA 1VBD3 4YM3A 1AF9A 1EPZA 5EZWA 4XTPA 4EWEA 4ATFA 2EALA 1MQTB 3GZTB 2I2SA 4Q26A 1GNHA 2XLFA 1F5JA 1DIWA 4FPEA 1DGLA 5GZGA 5HBAA 2HKXA 3ZXKA 1RUJ2 4KWJA 5A3MA 1YI9A 4NN0A 3BU7A 3AYEA 3GBGA 5KXEA 5JOZA 1CONA 5E1RA 1W6QA 3OD0A 1F9KA 4Q8LA 1YI7A 1LB2A 1R1ZA 3ZYPA 4AGRA 3IMNA 1SBDA 3HT1A 3AKQA 2A7AA 1TMF2 4YM1A 2Q0AA 1BVP1 5KHGA 1REEA 5KHHA 2D6LX 1AR62 2FZ2A 4PIXA 4N7IA 1YIPA 1AXZA 5I0RA 4AI2A 3HWJA 5L7OC 4M3CE 3I2DA 5K0UB 4GIQA 4P9WA 3RYKA 2XJSA 3FUOA 3LB9A 4K3UA 2BQPA 1BZWA 5J98B 1TNFA 2ZGTA 3VBHC 2A5ZA 1O5UA 5T52A 1FV3A 1SLBA 3H3ZA 3OY8B 3UJQA 4JGYB 1QH6A 1KRIA 3AZVA 5CB7A 2SBAA 1RUD2 3ZSJA 2VVDA 1ZZCA 3VBSC 2RS13 2HWD2 1TME1 1W6MB 4FBFA 1CX4A 1ZBE2 4QGLA 2O0OA 1MS9A 4JCKA 4M3CF 3MYXA 1COV2 3GZUC 4HVOA 1VBA1 3M7AA 4X8NA 1O4YA 2JX9A 4XBLA 1JN2P 1H9WA 1KXGA 2ZHNA 4N53C 5FCCA 1VBB3 3SHRA 3CJIC 4PIZA 2VMHA 2BUKA 1F8VA 3MI8A 2WS92 1N3OA 2ZX2A 1LOBA 3NJZA 3PHMA 1GICA 4PCRA 1VLNA 1W6PB 1H2KA 2OUJA 2A73B 3RRDA 3O0XA 1RHI3 4GMP3 3AKRA 4ES8A 3ALQA 5L7OB 1ZREA 4B4PA 2GC0A 1QQP2 3BCWA 2VVEA 2DUOA 3B9IA 3WD5A 4I30A 3JB4C 4E4SA 2AREA 4UBHA 4JRLA 3J9SA 4LO5B 3OYWB 1G8WA 4WVWA 1NA1A 3VBSB 5IK5A 1NCRA 4KNCA 3ZXDA 4LNVA 4YZ2A 3D4KA 1DZRA 4YFWA 2BNMA 4RS5C 2DU1A 1ZBA1 2GDFA 4JDOA 3LGRA 2WT1A 4XFFA 1I5ZA 1WBLA 1AJKA 4IESA 5E16A 5GLWA 1PK6A 4RR3A 3VKMA 4P9IA 1KS4A 4S2HA 1XYPA 5I93A 3WHUA 4PDWA 5T5PA 4LEJA 1ULCA 1C8M1 3CJIB 1X82A 2MPFA 1BQPA 2VQAA 1CAXB 3JD73 1FAYA 4HFSA 1GZWB 4MLOA 1MS1A 3FHIB 1OI6A 4AVTA 1UIJA 3MIHA 4OHZA 4B3NA 1H1AA 1ZVFA 1NG0A 1QDOA 4AFBA 4EN7B 1RC6A 1LOCA 4MH0E 3POSA 4FP3A 2B45X 1R1A3 5SV5A 2HWC3 2XJUA 1LRHA 4FPOB 3FLPA 3B02A 2RS51 2WNEA 4SLIA 4XIOA 3TBDA 1LKNA 4ZU7A 2GC1A 2BW8A 4XETA 3TOJA 2H0VA 4RS5B 2D43A 1RVF3 5FAXA 2DWRA 1IS3A 2MEV2 4M3CB 5LEKA 3OD4A 2ZPXA 1ASJ2 1ULFA 3ENRA 2QVSB 4GULA 4I02A 2PHTA 4PLOA 5GLUA 1XNCA 1UKGA 4Y22A 1MS4A 3AJZA 1YLLA 3GNEA 2ZMLA 3ZXFA 2GNMA 4YGEA 2VNOA 4LO6B 4FQZA 3QBQA 4XHXA 2VMIA 2D93A 2GU9A 3AZXA 2R1DA 3O5SA 4Q4Y1 1KFXL 2EA7A 2ZX4A 4M01A 2ZCWA 4XYXA 3SCHA 1QJU2 1RUF3 5ACA2 4XQWA 1R081 5FQ0B 1OOPC 3FFQA 4TZDA 4Q29A 1ULGA 5BNQA 1K5MA 2BVVA 4F8AA 3PJYA 5JI7A 2UY9A 4CDWA 2VXRA 1W6QB 4XXPA 3ZPYA 3RYRA 4OZXA 5AVAA 4GKXA 1AYM1 2EXKA 2AYHA 1DLLA 2WSUA 1IPJA 1ZZ7A 4FPHA 5KHJA 4ISQA 1VBE3 4HPKA 1J3PA 4FPKA 1AL21 2VY0A 1RUG2 2R061 3D6EA 4LHNA 4CEYA 4AFAA 2PA7A 4EN8B 3LZZA 3Q9OA 4Q1RA 4A7YA 3SISA 5AC92 2D98A 2ZGKA 1GNZA 2BNOA 3JQWA 3MZHA 1NCRC 3RJ2X 4CRQA 3NV4A 4Z07A 2V5YA 3LA2A 1LOFA 1AR81 4FP2A 2V09A 2V73A 4RR3C 4XHBA 1JOJA 1DGRN 3OPZA 4IETA 3KM5A 4PDWC 2UU8A 5FFOC 3A0KA 1G6NA 4N7UA 3B7MA 2GNBA 2BTVC 4IEZA 1RUC1 1AJOA 1NE4A 1NXD1 1QH7A 1PO23 1PIV1 2CTVA 1CIWA 1AUYA 5I8SA 1D2QA 3MEPA 3ZYGA 1MZEA 5K7PA 4COZA 3VBOC 3M3EA 3LSDA 2WZR1 1ZZBA 1H4GA 1Q5OA 2XKPA 2NMOA 1RGSA 3SH5A 3SCGA 3WV6A 1WLWA 2OPKA 2XVKA 3CJXA 4X6RB 1H9PA 3KSCA 4AGVA 3DPRC 4J1XA 2ZKLA 4HSLA 2B9UA 3TRSB 1NCRB 4ZU5A 3I7DA 1URXA 1REDA 3JBG1 1S0JA 4R9DA 1EAH2 2GH8A 1ENXA 4W6XA 1WMEA 1QF3A 1PK6B 4RR3B 5CA6A 3HD8B 1FYUA 2YPJA 2VNRA 4PDWB 2HYKA 2RJLA 3ZVXA 1U12A 1JTZX 1OPOA 4XF1A 5I8TA 4QQLA 1ZM1A 4AEDC 3WUCA 1HQLA 2R49A 1LULA 4NHKA 2AUYA 2F4PA 5C9AA 2XPJA 3WX5A 2DU0A 1F5FA 3CF6E 2YC0A 1XE8A 4FPYA 5JAXA 3JD72 2PHDA 2YGMA 1JHNA 1CAUA 1X36A 4GXLA 1U0AA 4AI1A 1S2KA 2XJQA 3X29B 1JBCA 2R043 1FOD1 2D3PA 5T55A 1K5MC 1PVC2 4CDWC 1CGPA 5JSPA 3ES1A 3IWZA 3ZYRA 5IK8A 2TEPA 1R1A2 2K0GA 2ZHMA 3USUA 2HWC2 2W68A 4BZ4A 4HT1T 5FO8B 4CYDA 1DG6A 2D6MA 3WDUA 4IEUA 4COUA 5DZGA 4ZXKA 1RIRA 2FMDA 4KWLA 4NO4A 2PFWA 2OUHA 4BE3A 2HEYF 1RVF2 3QCWA 4YZ4A 2JEMA 4KWKA 2XB6C 3KCYA 5J96B 2WQ4A 4EROA 1AL0G 1HLCA 2KA3A 4ES9A 4HVRA 4AWDA 2ZGQA 4D94A 4DRVA 3UJOA 1Q8QA 3H1YA 4DB5A 1BJQA 1C3HA 4E2SA 4YGCA 1MS3A 2YGLA 3ZYIB 5KBFA 5L73A 5KC5A 5FOBB 1D4M1 1S0GA 1LOFC 1K5MB 2D3SA 4DINB 4XMIA 4I3PA 4CDWB 1C1LA 1RUF2 3RS6A 1OA3A 3ST7A 3KMHA 4R4ZA 2PHLA 1SLAA 3ETQA 2XLGA 4AXOA 1UAIA 1RUJ3 2NP0A 3E97A 1FX5A 1DF0A 3HIFA 4BYYA 2IWGB 3SCFA 2B39A 4EN9B 4OI1A 5FO7B 1AR91 3KS7A 2RR13 2WNUC 2EXHA 5FMOL 3OCPA 4HPKB 4RD7A 4U36A 1G9CA 4XF0A 3AM2A 5C6CA 4KGQA 4DZGA 4Q4W2 1V9U1 1UN1A 3MW3A 4WVZA 4V1PA 1MACA 1CVNA 4L11A 4RGGA 5AVPA 3OGJA 4MXWA 5EYYA 2NZ9A 2WINB 2BPA2 4D7YA 4GB31 4BMEA 5BNNA 3EO6A 1VBE2 1WCKA 3GHMA 3U07A 1WW5A 2N7GA 1LHNA 2H6CA 4LBNA 2EXIA 4HN0A 4IXLA 2BFUL 2JENA 1OLRA 2X8KA 4Y1YA 3ZSLA 4MZUA 4FOYA 3IT8A 2ZJCA 4JC1A 4YW4A 1ZBE3 2H0BA 2CGPA 1LGNA 2VW2A 4Y5Z0 5GZEA 3N7LA 1RL3A 1OFNA 3AP7A 4IV1A 3SLIA 1GQHA 1ZZ8A 2ET7A 4QPYA 3ZXLA 2BWAA 2Q5TA 4FTEA 4KG8A 1PGW2 3WW3A 4YYOA 2WNUB 5IT6A 5BUVA 5GKAC 3A4UA 2DVGA 4HL0A 3ZXAC 5C33A 2HWE1 1V6KA 1HXS3 3WUDA 1PO11 3FFZA 5IUQA 1VBC1 4AI8A 3MIFA 2E51A 3H50A 4LE4A 2XKOA 3RDIA 2DV9A 2D5FA 4E9KA 4EN0A 4Q2FA 2OZJA 3NVCA 3BODA 5KXBA 1N1VA 3GALA 4QMAA 2Y0IA 4Q4V1 3KQRA 2R16A 2D6OX 4LE3A 2B8MA 3PVEA 4WV8A 4R52A 2D6KA 4QM8A 2XUMA 1ZBA3 3WZ1A 3WQ0A 2WSVA 4K8FA 3SH3A 1U5YA 5CADA 5FPXA 2P3KA 3OGGA 1BK1A 1LGCA 1SEFA 1PGL2 1HRI2 3LAGA 5GZCA 3QOPA 1UCXA 1I3HA 4B8EA 1NQJA 1CPMA 3MPPG 2IXCA 4RA0A 5JSRA 5JMCA 3POYA 1FPN1 2RMU3 2WT2A 3ME2A 2Q1ZB 5C9AB 2NQYA 4XEZA 4ATEA 3IM0A 1C5IA 2P17A 4XF3A 1DZTA 2B5HA 3VBFC 2R30A 4XQ4A 1WMDA 1HRV1 3AKTA 1CAUB 1C8NA 4HBNA 2IZWA 1AYN1 3VUOA 1FV2A 5H9PA 1OLQA 3MIGA 4YM2A 2Z69A 2GAUA 5FBZA 3VHOA 3DGTA 3J8F1 4N43C 1SCSA 5KHKA 5K9YA 1KJRA 2JXAA 4R9CA 3WQ1A 4Y1ZA 4YVSA 3USUB 4CTEA 1IQAA 2ZBJA 1QJY2 4AHZA 1Y7BA 1AXKA 3EXUA 4YLZA 3MIBA 2R042 4AHWA 5KHIA 2X5IA 1W0PA 3MIEA 4XF9A 4I0BA 3V0AA 5FPZA 1LU2A 1MQTC 1NLRA 4NWWA 4CEWA 1UU5A 2GC2A 2WFF1 2DFCA 2XG3A 5GZDA 3AZYA 4BHPA 2GN7A 2HWF1 2ZGLA 2RM21 1GANA 2GMMA 2SLIA 1AVBA 3I59A 5LK7B 3MGUA 4NPRA 3WT3A 4AEJA 2ZACA 3PVOA 5DDJ1 4Z92B 5CG8A 1WD4A 1N3QA 1N1SA 3W9AA 3FX3A 3AP9A 5JZGA 5BNNC 2YV8A 1ND3A 1DU3D 2CGNA 5HCFA 3NSTA 4YW1A 1WW7A 1VB4A 2QQPA 1R083 5ACA3 5BNPA 2VECA 2LUWA 1ULEA 4NOTA 5T3NA 3VZKA 1GQGA 4GWNA 4BM8A 3H3UA 3EBRA 4YZ5A 2PQQA 2WT0A 2ZZJA 1LOGA 1SLLA 4OUSA 4IV1C 1BEV1 2DVAA 1YCIA 3AXEA 3AMPA 3BB6A 3L2YA 1LOAA 1VAMA 3B93A 3D0JA 3N3HA 5H9QA 3AP5A 3ZMNA 5SV8A 1D4VB 4COVA 1WGPA 1VRH1 4LBQD 4WZFA 2E53A 4MXWB 1RUOA 1EPWA 2QKDA 2RR12 5F6KA 1S55A 2CYFA 1RUG3 5HCBA 5BNNB 1QOSA 3LKJA 3SH4A 1RITA 2DVDA 1RUI1 4HKLA 1H30A 1H1MA 2E9QA 4QPIA 4R9AA 4XXAA 3THTA 3VHPA 3QD6A 2EAAA 5AC93 5EFUA 4FPLA 1AR83 1OHFA 3ACLA 1HDKA 1ZRCA 4LHLA 3SNMA 3WY6A 3WXPA 4OULA 2ZHKA 1AX0A 1GSLA 1NE6A 3TN91 1M4WA 3N7MA 2CWMA 4IV1B 1KD7A 4XFCA 2QCSB 4WM7A 4RHV1 4QGNA 3URFA 4A7KA 4QPGA 2W39A 1S0EA 1QXJA 1BKZA 3ES4A 1Y9QA 2PELA 3NV1A 4CP1A 1Q8OA 3N4MA 5GJ6A 1QXPA 1XYOA 5BYNA 3HAGA 3JU9A 1AX2A 4LA3A 1GZCA 4RQPA 4IL7A 4CDUC 1POV0 4J6GA 4DY5A 4ZKTB 1WLCA 2XBO1 3H9AA 4MYEA 3BIWE 3KCXA 3AZWA 1HXS2 4L99A 4YVSC 2Q1MA 4AQTA 1COV1 4YFZA 1UKRA 2C1FA 2JG8A 4Q4X3 2WJSA 2BBVA 2X5IC 4Y4YA 4I01A 3TWIA 5LEJA 1EAH3 1V6IA 2XGXA 1DGWX 2WIIB 1CN1A 1X8MA 5C8CA 5CIRA 5EYXA 4G3YC 4F3JA 1O3QA 1ZBA2 3J4UH 5JDBA 3U10A 4K1ZA 2CL2A 1JUHA 1CPNA 1X8EA 3TAYA 2WS91 4AFDA 2OIIA 3FBYA 2A6WA 2VNGA 1LECA 1QKQA 1B35A 4MGKE 1KJLA 2GSYA 1RMU1 5JZGC 4Q0VA 3ZFFA 1C8M2 1H2MA 1ND3C 2CGOA 4AQ2A 1RTVA 2TUNA 3ZFEA 2E7QA 2WFPA 1CAVA 1N1TA 1QQP1 2RMU2 3WG1A 4GMP0 4XW3A 4UW6A 2E6VA 4CDUB 1QJX3 2A3YA 5BNPC 2VUJA 2VW0A 3C2UA 5B2GB 3IKWA 3I54A 3V64A 5DG1A 4YNIA 1IHMA 4HK8A 4YVSB 2XL9A 1SBFA 2CWSA 4P14A 1XE7A 2XVLA 2VOWA 1PM7A 2VQ0A 1PVC3 2X5IB 4FTBA 2VH9A 4YW2A 2QDRA 4C91A 3V0AB 2RS33 2GALA 1W0OA 2C0ZA 4CEWB 2HWB3 3LOBA 1LJ7A 2WZPP 5GZFA 1O3RA 4P9XA 2PHFA 3E5XA 1YIFA 3I59B 3MLLA 3PVBB 4ONUA 3UKVA 3H1MA 4PIYA 4FAGA 3LSEA 4E4DX 4XBNA 5CFCA