4Y26A

Complex of human galectin-7 and galbeta1-3(6oso3)glcnac
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of human galectin-1 inhibition with Ki values in the micro- to nanomolar range
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-7
total genus 28
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4y26A00
1A8DA 1LOEA 2VUAA 3OBTA 2P37A 3POYA 1S0FA 1HLCA 2OUJA 3AYEA 4ISRA 5GLUA 2ZGRA 1MS0A 3BOPA 5GLVA 4XTPA 5DZGA 3B01A 1G9AA 4I30A 5KXCA 5F5QA 2ZGLA 2ZHLA 1QGLA 1QU0A 1CPMA 1HDKA 4FP2A 4U2AA 1WD4A 3NWKA 3WHUA 1JBCA 3PJQA 3UL2A 3M2MA 1AVBA 4W65A 4WVWA 4FOQA 3PVOA 3D4KA 1WW5A 4BM8A 1B09A 4Q8KA 3ZXKA 2AGSA 2A6XA 1DQ5A 2D6PA 3USUB 4XJWA 1MVQA 1CONA 1ZA4A 3WUDA 3TAYA 1EPWA 1DQ1A 5GLWA 2R16A 5IK4A 3M1HA 1H30A 1GNHA 1DQ2A 1OKQA 3VV1A 5L73A 3ZPYA 3OJBA 1Q8VA 1V6MA 2DVAA 1HQLA 1JYCA 3V65A 1AX2A 2Q5TA 2W52A 1DBNA 3B9CA 3WHTA 1CJPA 2JDZA 5DUVA 2GNTA 4C1WA 3RMYA 5IT6A 1VAVA 2DU0A 2ZGQA 3AZYA 4P14A 1IS6A 1KRIA 4XMIA 4LBLA 4U36A 2H0BA 1RIRA 1MS3A 1IS4A 3SNMA 1S0DA 3JU9A 3OYWA 3OPZA 3RG0A 3WDTA 2SBAA 5GLZA 1YRZA 1WLDA 1LU1A 2EF6A 1QMJA 4YZ5A 1C57A 4YG0A 1UMZA 1LOGA 1V6KA 3W59A 3WG3A 3ZXLA 1LTEA 1LHNA 3SH3A 1G9DA 1X50A 1VALA 1KDKA 1BQPA 4YM1A 2W08A 5IK8A 1G8WA 1W6MB 2CNAA 2GDFA 4XE9A 2D6NA 4TZDA 2A6WA 3O12A 3INAA 2NP0A 3MPPG 1C1FA 1GZ9A 3FUQA 4NOTA 1AJKA 1S0IA 3HMYA 1LHOA 2GNMA 2NM1A 3AXDA 2WJSA 1UZZA 3OY8A 5JDBA 1S0GA 3LSDA 4Y26A 5KXEA 4K21A 3DGTA 5GZDA 1WBLA 2D3SA 1GV9A 5T54A 4YM3A 5CBLA 1DQ6A 2JE7A 4Y20A 5LK5A 3T1LA 3T2TA 2ZBJA 4Y1XA 3OBRA 5CNAA 5H9SA 4AGGA 3O5SA 2A3WA 1BZWA 1JXNA 2P3IA 3NV2A 1AF9A 3OGGA 2UURA 3AX4A 2OUHA 2DVFA 1TEIA 5DZFA 5IUQA 5T5JA 3WOGA 3RS6A 4TYSA 2A71A 3AP7A 3O0VA 3WG4A 3PMEA 5DUWA 4MYEA 3MEPA 3AZVA 1GZWB 2LTNA 3BODA 2EALA 3FLTA 4GA9A 4HL0A 1IS3A 1DGLA 2ZZJA 3NV1A 3PVEA 1IKQA 2D3RA 2ZACA 3AP5A 3N36A 1SLTA 4PBPA 4H55A 5BYNA 2ZGSA 5FREA 2W39A 4AVVA 1MS5A 2PHXA 3AP9A 2VH9A 4YG6A 4YGCA 3UJQA 1VLNA 3AP6A 2PHTA 5HCBA 3M3QA 2A75A 2ARXA 3M3CA 3SH5A 2FHRA 4Y24A 2G4IA 1N1YA 4XBQA 4AVTA 4BQ1A 1W0PA 3AZWA 1KITA 3A4UA 5H9QA 2YROA 2GALA 3WCSA 1SLIA 2DVGA 1GNZA 4CTEA 3ZXJA 4GWNA 1LEMA 1LU2A 3AZXA 4Y22B 2DURA 1LOCA 1WW6A 3FLPA 4YLZA 3WDWA 2D6OX 1HKDA 2D7FA 2KM2A 1S0CA 4XJ8A 1O4YA 2JECA 2R1BA 2JD4A 3GALA 3V64A 5T52A 3ZSKA 3USUA 3POSA 1W6QB 1WUVA 1JYIA 4JC1A 3RMXA 3NV4A 1MS4A 2DVDA 4XXPA 3VUOA 1HQWA 3N7JA 2CWMA 3WDYA 1V6NA 3R4SA 3RRDA 1D2SA 3WNXA 1A78A 4FPYA 2RHPA 5IK7A 2NN8A 4XILA 4LBQA 1G9CA 1UPSA 2FMDA 2A7AA 3FLRA 3POWA 2ZGOA 5GM0A 1DQ0A 2WT0A 2VY0A 1LODA 3MW2A 3N7MA 4XJUA 1YI7A 3JUUA 2DV9A 4XJZA 1ENSA 4FOYA 4BOWA 4XIKA 4ITCA 4BLIA 1H9WA 1NLSA 3U4XA 3PVNA 4AWDA 1Q8OA 3SLIA 2SLIA 1W6PA 1F5FA 2GMMA 2WKKA 4RA0A 4XTMA 5H9PA 3D5OA 3M3OA 1W6PB 2ZHKA 2ZHMA 4YW4A 2R1DA 4R9AA 4AVSA 2ZKNA 1ENQA 1W6MA 2WNEA 1AXZA 2ZGNA 4GKXA 2WSUA 2WQZC 3V0BB 4ASMB 3AXEA 2E53A 1I1EA 5E88A 4FPGA 4XIOA 5DG2A 2GN3A 1CPNA 4Y1VA 2UWCA 4RL7A 1C4RA 1CIWA 1GICA 4ATEA 5GZGA 1KJLA 2EIGA 2WT1A 1DQ4A 3IM0A 4M3CA 4M3CB 1CN1A 2D3PA 1SCSA 4XMAA 4WV8A 3AYAA 4Z8BA 2CWSA 1UZYA 2VW0A 4C1XA 1JUIA 3N7KA 2UWAA 5AVAA 1ENRA 2WSVA 1MR5A 5HCFA 3DUIA 2OVUA 3O0WA 3IMNA 5EYXA 1PZ7A 1DYPA 2AH2A 1V00A 3ILFA 4YZ1A 4LBNA 5JLVA 5GALA 4FPHA 4GALA 1SFYA 4FPJA 1N1TA 4BMBA 2ZMNA 2YV8A 5GLTA 1F31A 5JOZA 1BXHA 4UW3A 4DFSA 2DVBA 3RQ0A 4DPNA 5JMCA 1Z78A 1R1ZA 1N1VA 2EXIA 2DU1A 2ES3A 4XBLA 1BKZA 3HR9A 4PBOA 4R9CA 5E89A 1FATA 5T5LA 3N3HA 4Q27A 1LOFC 2C9AA 1APNA 4WVVA 1CVNA 2D6LX 2ZGMA 3HN1A 3QLQA 4FPFA 4YGBA 5T55A 2PHWA 1ONAA 3AYCA 3VKLA 1W0OA 1MACA 1NXD1 3W58A 4FP3A 3WUCA 3ZXFA 4YW1A 4WZFA 3ATGA 4P9WA 3A0NA 1CESA 1SACA 1DHKB 4GXLA 2GNBA 4R9DA 3N35A 3O0XA 4Y1ZA 4YG3A 1N3QA 5DUUA 3WZ1A 2D44A 2AREA 2ZMLA 3LCPA 2I2SA 4XYXA 4YFZA 3VKOA 2DUQA 1V6OA 4Y1UA 1YO8A 2AYHA 3IKWA 4YW2A 1LJ7A 2ARBA 1Q56A 2PHRA 5T50A 5SV8A 1WBFA 2A5ZA 1RINA 1W6OB 1LHVA 4YGDA 1SBEA 4YZ2A 1LULA 1DYKA 1W6OA 1N3PA 1OQ1A 4XJ9A 2AR6A 1MZ6A 1QOSA 3L2YA 1Q8SA 3LSEA 5JOYA 2DUOA 1PZ9A 1VIWB 1H9PA 4BPZA 1GYKA 1QF3A 3SH4A 3NV3A 4LBKA 2GMPA 1OFSA 1GZWA 2V73A 4GWMA 5H9RA 2E7TA 5FRAA 1AX1A 1JN2P 1W6NA 5F9TA 1GZCA 1G86A 1BYHA 3FUOA 4FPCA 3RSJA 1F9KA 3IPVB 3I8TA 3CNAA 4FOWA 1Z0HA 2A6VA 2OW4A 4R9BA 3D6EA 2HYKA 4KBBA 1AX0A 2AUYA 2CYFA 2YMZA 1IOAA 1S0JA 2CL2A 4JRAA 3C2UA 2D6MA 1ULDA 2XB6C 1ULGA 3H0OA 1S0EA 3SISA 3TB0A 5KXBA 1KQRA 2NZ9A 3WLUA 3ZYRA 2R49A 1KDMA 1IS5A 3WCRA 1G9BA 4XOGA 2GMEA 1J1TA 1A3KA 2ENRA 3ENRA 3R4UA 2W68A 1QNWA 3WV6A 2P2KA 4XHXA 4Q1PA 5EWSA 3KQRA 1LGNA 4FVVA 1LENA 4P9YA 1UKGA 4AGRA 3WDUA 1LOBA 1W6QA 2PHFA 3ZSLA 2EXKA 4Q8LA 4ATFA 1DLLA 5GZCA 2A6ZA 4FQ4A 4XHBA 5DG1A 2Z42A 2B7YA 4K1ZA 4K1YA 4YM0A 5KXDA 5JOWA 3AJYA 4K20A 4BLJA 4CRQA 4DQAA 2ZGUA 4FPKA 1ULEA 5GZFA 2D6KA 1JW6A 4M01A 4NO4A 1SLBA 2ZHNA 2DUPA 3AJZA 4XZPA 1IKPA 4M3CF 1WCSA 2EAKA 1AXKA 3BIWE 5IK5A 1LESA 1FNYA 1PZ8A 4FOVA 2V5YA 4AYUA 2P3KA 2E6VA 1QOTA 2EXJA 1MZ5A 1WW7A 3OYWB 2AENA 4D69A 2VW1A 4Q26A 1GKBA 2D43A 2NMNA 1C1LA 1LHWA 3R05A 2WLQA 1VAMA 1S1AA 2E51A 4FPEA 1G9FA 1LOFA 1G7YA 1FX5A 1O4ZA 1V6JA 4DRRA 2ZGTA 5GZEA 3ZVXA 5DZEA 3V0BA 1QKQA 3ASIA 3AYDA 5CB7A 1YYNA 3BTAA 2VW2A 4LBQD 3ZSMA 4OZXA 1FYUA 2UWBA 4Y1YA 4XJAA 1LECA 1URXA 5T5PA 2GN7A 4XBNA 4Q2FA 1U0AA 1SBDA 3OY8B 1N1SA 3AP4A 3ZSJA 1Q8PA 2P3JA 2WT2A 3AFKA 3Q9OA 2R0HA 4BMEA 4PF5A 4Y20B 2JE9A 1UL9A 3M3EA 3UK9A 3WG1A 2ZABA 3A0KA 3B00A 1KJRA 5EXOA 1N3OA 1QNYA 2ZAAA 1CQ9A 1SLCA 4F83A 2ERFA 4PCRA 3N7LA 1XQNA 4UW6A 3T1MA 4M3CE 1WD3A 2TEPA 5HCAA 5CAZA 4FPOB 1YIFA 2DYCA 1MVEA 2DTWA 2VXRA 4Q1RA 1D0HA 1AXYA 4ZXKA 1QOOA 1LOAA 1Q8QA 1ULFA 2LALA 4GKYA 4XXAA 3VKNA 3MW3A 2EXHA 3IPVA 4LBMA 2YY1A 2GNDA 3I4IA 1FAYA 4FPLA 4YFWA 5E8AA 4YZ4A 2ZA9A 4PQ9A 4YZ3A 5DXDA 4M00A 4LBOA 1GSLA 2ZMKA 3VKMA 1ZM1A 1UN1A 1JHNA 2YZ4A 2CY6A 2NMOA 2JKBA 3WDVA 1DFQA 3APBA 3FFZA 4HANA 1JOJA 2PELA 2XG3A 1N47A 3VKFC 1GLHA 2ZGPA 3FBYA 1SLLA 2YXSA 5CA6A 3MW4A 1GBGA 4YM2A 3AZZA 4CZSA 1DIWA 3AK0A 1LHUA 2C5DA 3B3QE 4UW4A 3B69A 3ILNA 4XDQA 1LEDA 4Y22A 1WLWA 2CTVA 4LBJA 1UX6A 2JJ6A 3WDXA 4DRVA 2VU9A 4ZKTB 2UU8A 4L8QA 2A70A 1Y7BA 1AZDA 3WVJA 3ZXEA 3WG2A 3UJOA 1V6LA 3ILRA 1S0BA 1LGCA 2BQPA 1FV3A 1WW4A 1YXWA 4JCKA 1QDCA 2DTYA 2PHUA 2ZGKA 3KM5A 4FQZA 5T5OA 2E7QA 5JOXA 1LCLA 1SBFA 5DUXA 2A6YA 4ISQA 1WLCA 2R0FA 4IQPA 4YW5A 4AGVA 1CR7A 2DWRA 4YGEA 1BJQA 3ZYPA 1MS8A 4DS0A 1AJOA 1UAIA 4LBQB 3IN9A 1SCRA 5GJ6A 1QDOA 1FNZA 4SLIA 1DZQA 1RITA 3GNEA 4YW3A 2A3XA 3SITA 1MS9A 1I3HA 5JVVA 1W6NB 1SLAA 1FV2A 2NYYA 1MS1A 1V6IA 2P34A 1GANA 5EYYA 4UW5A 3QCWA 3V0AB 4P9XA 1LGBA 3V0AA 1ULCA 2A3YA
chains in the Genus database with same CATH superfamily
1UIJA 3JQXA 4XAEA 4ZU4A 1LOEA 1MEC1 2P37A 3FBMA 1S0FA 3POYA 1UIKA 1HLCA 2OUJA 3LZZA 4ORFA 4H2AA 4V2WA 5GLUA 4CCOA 3PJYA 5GLVA 2Y6JA 2ARCA 3ETPA 1UU5A 5DZGA 3PMSA 1G9AA 2ZGLA 2ZHLA 3IMMA 1DGWA 1ZRCA 4N90A 1WD4A 3NWKA 5F5CA 2UYBA 3BIEA 3OOXA 4QXHA 3UL2A 1V9U3 1AVBA 4W65A 5L9BA 4FOQA 3SCFA 1AR82 2C1FA 4MHRA 5JCTA 2CGPA 3VBUC 4BM8A 4Q8KA 4XAAA 1XNBA 4RFRB 1KS5A 1LAJA 4KMQA 1MVQA 2B4KA 3NMBA 2WUHA 3GBGA 1HN0A 3TWIA 1I5ZA 1EPWA 5GLWA 2DCKA 3BVCA 5IK4A 2D5HA 1FMD1 1DQ2A 4A44A 5L73A 3OJBA 1V6MA 1WCQA 3V65A 1AX2A 2OPKA 2W52A 4PLOA 3WHTA 1UYYA 5DUVA 2XBO1 5IT6A 3RMYA 1VAVA 1KRIA 1IS6A 4CDXA 2JIJA 4LBLA 5IYYA 2H0BA 1RIRA 3H3UA 1MS3A 5BNNC 3J7LA 3RG0A 2OA2A 3ES1A 3WDTA 1NZCA 1C57A 1YJLA 1W9TA 4AG4A 1QQP3 5BNQA 5F3IA 5LK7B 1LHNA 5EFUA 1CAXA 1G9DA 3POBA 3RYRA 4XFAA 5FYVA 1AUYA 4D6RA 3AVSA 3MICA 4YM1A 1HW5A 1FOD2 2VM9A 5LA1A 5IW0A 3DXUA 5JIUA 3O12A 1HB4A 5F6KA 1AYM1 4Q4V3 3PU8A 4IE5A 1GZ9A 2R042 4LA2A 5FZ3A 2NP0A 3GBFA 2P1BA 4SBVA 1QJY1 2NM1A 2WJSA 4A6SA 5C8CB 3BGAA 5JDBA 4ARXA 1R1A3 5KXEA 4NHKA 3E5QA 4MXWB 2ET7A 1WBLA 4CPBD 5KHGA 1QXRA 1VMFA 5T54A 2JE7A 3N9NA 1OC1A 1ZZ8A 4LOSA 4Y1XA 1JU3A 1AR71 3WNPA 3VBHA 4IEOA 3O5SA 4BQ4A 4AVCA 3UT0A 1JXNA 3OGGA 4CEYA 1AF9A 2R043 3EBRA 3OPTA 3OPWA 2FD8A 1Y9MA 1TEIA 5DZFA 5IUQA 1PO22 2ARAA 3RS6A 2VMDA 2EIBA 2A71A 4TN7A 3PMEA 5DUWA 3ROUA 3RPQA 4C0HA 4O7XA 2JICA 5HXVA 2LTNA 2EALA 2VZOA 4HL0A 3RWKX 3KF3A 4CEWB 2WC2A 3GGLA 5FMOL 2D3RA 3H8XA 1NE4A 1NCRC 5BYNA 5CFCC 4XQWA 4PF1A 4AVVA 4W6WA 4YW7A 1A6CA 2VH9A 2OQ7A 4YG6A 3UJQA 3ZR5A 3UGGA 1ODMA 4CXXA 5CU1A 5HCBA 1K45A 3UESA 2WA4A 2XJRA 3SH5A 5F5AA 4X8PA 3O14A 4MH0E 4XBQA 4LR4A 3NSTA 1BBT1 2D98A 2IFWA 3MYXA 3OD4A 4PI0A 4CTEA 3AC0A 5FK8A 5DAQA 2A1XA 1MEC2 1O5LA 2HWD1 3ZFFC 1J3RA 2DURA 2YPDA 1HB1A 4N53A 4ARYA 5JUVA 3MDPA 3R6SA 2D7FA 2KM2A 4N53B 3KQ4B 3VBOB 1YQ2A 1F4HA 1UOGA 2J7MA 3KS7A 3E5UA 5FP9A 1WCDJ 2JD4A 3M3IA 3V64A 5T52A 2J1VA 1OOPA 4AI2A 4E9KA 2FDFA 2FQPA 3DKWA 1WUVA 3FFQA 3CZUA 4Q0VA 2HWD2 1ENXA 2YBSA 3NV4A 3RMXA 2DBNA 2HWE2 5IVJA 4I0WB 1C8M1 3OUIA 3K3OA 3KWVA 1HQWA 3EB7A 2RDNA 2ZOEB 5DPNA 4R4XA 4D0QA 4OHYA 3MLJA 2PAKA 3WNXA 2HWC3 3KCCA 5KR7A 5IK7A 2NN8A 2WZR2 5C3QA 1UPSA 2FMDA 5I8YA 2WNOA 2A7AA 2WO7A 3SEPA 1HXS3 4I01A 2X10A 4QX2A 2WT0A 2VY0A 4IV1C 3MW2A 3U1XA 3PIJA 1YI7A 4FFHA 3WINE 4X6QB 1XYOA 1NLRA 3ZYFA 3BI3A 1ZRDA 1O4TA 2DV9A 4BOWA 5J7MA 2RS13 1H2NA 3TN91 1A8MA 5EHDA 1S2BA 3U4XA 3PVNA 2VBBA 4LPLA 4AWDA 3S0MA 1IGOA 1OVPA 2O8QA 3ACGA 4RA0A 5J36A 1JZ8A 1VB2A 5JZGB 1W6PB 4OI0A 1K5MB 4QDRA 4R9AA 5JXIA 1OHFA 2ZKNA 1OPMA 4DXTA 4KGQA 3MO4A 1GWKA 2JWPA 3CLPA 2WZ8A 3AXEA 1QJZA 3AKPA 3CKHA 3FHAA 3GHMA 1F5JA 1POQA 4TLFA 2QQMA 5DG2A 4BHPA 1CWPA 2YBPA 2UWCA 1W3VA 4MXWA 4Q4W1 4AVAA 2W1UA 3Q8CA 5GZGA 2WT1A 3LA3A 2VJXA 1YWKA 3EJKA 1NX9A 4RS5B 2W94A 3NAPA 1MPXA 4AVBA 3LEMA 1K42A 5FZKA 2JDUA 4BQWA 5JXJA 4D7YA 5TSWA 3N7KA 4G9SB 3F95A 3RI8A 1BEV3 4LORA 5AVAA 4AEKA 2BTVC 3K46A 3MGUA 3IMNA 4XUPA 5EYXA 5I0TA 1ZBA3 2GP3A 4Y5Z0 1X33A 5LY1A 2CU5A 3J26N 3WP6A 4LBNA 1D2QA 5GALA 4GALA 2FBEA 4RGAA 1SFYA 4FPJA 2ZMNA 2YV8A 2VR4A 5F2SA 1RJ8A 1X8EA 1F31A 1NA1A 3ITQA 5JOZA 3PU3A 1Y3TA 5G04L 4HSLA 5FXWA 3ACFA 4UF0A 1RB8G 4EN0A 2BVBA 2DU1A 2ES3A 5FKBA 3ZXGA 1BKZA 3I2KA 2WFF3 1W03A 5T5LA 1APNA 4WVVA 1BLZA 3U11A 2ZGMA 1NG0A 3ZMOA 2C24A 3QLQA 4YGBA 5EZWA 2Q8EA 3VKLA 1PIV2 5F32A 3HQXA 1QXJA 1NXD1 1RMU2 5A7WA 4N9HA 3FL7A 3WUCA 2FDHA 5HV0A 3HBZA 2W0XA 4XW3A 1SACA 1QJU2 4UBHA 3E6DA 2HJIA 1ZBE2 1ZVFA 3RYPA 1N3QA 3DV8A 3GM8A 1NE6A 1RUH1 2D44A 2VZVA 3I3EA 2QJVA 3WZ1A 1L7QA 5M0TA 4XYXA 3VKOA 2DUQA 1V6OA 2VVEA 2WWSA 3MV11 4YW6A 2ARBA 2BYVE 1YI9A 5T50A 5SV8A 3POIA 2A5ZA 2VNGA 2XLAA 2G1MA 4AW7A 1DDLA 5J3UA 1SBEA 1JODA 4LO5B 3WF1A 5ABJB 1W6OA 4XC9A 5CZKA 1TNRA 1E5HA 3DN7A 1MZ6A 1QOSA 3LSEA 4OQ9A 5JOYA 4CUGA 1VIWB 5CEHA 2OXBA 3F2ZA 3KV5A 1DF0A 3KZ4C 3SH4A 2V73A 2XXZA 2E7TA 2ORXA 2ORZA 1AX1A 5F1RA 4CP9A 2PTMA 3IDCB 5F9TA 1G86A 5DABA 1PIV3 1K12A 1OQEA 4GB33 3VZMA 1QJX1 1BBT3 1YCIA 4P5HA 5C8WA 4M4RA 4AI0A 4L2NA 1H2MA 2VTXA 1Z0HA 3GBWA 2C9KA 5FFOC 4OFGA 4JRAA 5C4WA 4RFT0 3CJIB 4A42A 3KGLA 3IBMA 4PI2A 4UAPA 3POJA 5IWFA 3UYJA 5K0UC 3T0DA 1KQRA 5I0DA 5FZOA 1HRI3 2R49A 3A23A 1RUH3 4QKFA 1KXGA 2QTWB 1OF3A 1UWWA 1RUD2 1W2AX 4J25A 4GMP0 3WCRA 1G9BA 4DZGA 4CU7A 1REDA 4LO6B 3R4UA 3ENRA 4A3XA 1GP6A 2E9QA 3WV6A 2YG0A 2B45X 2P2KA 4IV3C 4XHXA 3ZYJB 1LENA 2Y0IA 2PQSA 2ZX1A 4N7UA 3ZSLA 2WN3A 3U75A 3KT7A 3CJXA 5DG1A 1T6GC 4JGYB 4F8AA 1GOHA 3JD73 4YM0A 5F8PA 4AFMA 4K20A 4YRDA 1HN1A 4BLJA 4CRQA 1I5PA 2QQWA 3GZTB 4XZPA 4XF4A 3LOIA 3VZOA 3AJZA 5D1IA 3GZEA 3RDIA 1JMUB 3RZHA 3MUZ1 4BE3A 2OKXA 3PTRB 2Z4FA 4D7SA 3HWJA 1ZYBA 2VZ3A 4OVEA 2G9ZA 3LD8A 2X05A 1VBE3 4YVWC 5K0UB 4FOVA 3WF2A 2V5YA 1OH4A 2PLV3 2EXJA 1PMIA 3L9JT 2YGLA 1FPN1 1WW7A 3OYWB 3OBAA 4QKDA 4AI9A 3PIGA 4KNCA 3U0ZA 1W2TA 2D43A 1G9FA 1W2NA 3MIHA 3GCXA 1JYVA 4IEPA 1BVP1 1U5YA 3CZJA 1QKQA 3ASIA 4GH4B 5CB7A 1STMA 2OQ6A 1YYNA 2JENA 2JEMA 1PMHX 1OA4A 1JI6A 1NA1C 2VW2A 3H42B 1FYUA 1I9RA 1W8FA 2IWGB 1E57A 4IGPA 5FMCA 2B5HA 4CUBA 4CP1A 4D3WA 4XJAA 1IPJA 5FKCA 1DZTA 1MQTA 5FZ7A 2GH8A 5T5PA 4Q2FA 1UYXA 4LKEA 5L19A 3MFCA 2XDVA 3PHMA 3ZSJA 2WT2A 4RGGA 3VHOA 4PF5A 3NNMA 5FUPA 5CFDC 4FXGB 1W3XA 3NJYA 1PO12 3U07A 1UL9A 3S30A 1JTZX 4Q0SA 4COVA 3I7DA 1ZBE1 3HQRA 2WYSA 1KJRA 4OUEA 1NYWA 1E5SA 4YVSA 3WNKA 5FQ0B 1SLCA 1QY4A 5FAXA 1SPPB 3NKGA 1HRV1 1US3A 3Q8BA 4V2VA 4YVSB 3VBHC 4PCRA 4XQDA 4AI8A 1C8M3 1ZBE3 2WABA 3FHIB 4UW6A 1W39A 2RS11 2Y6KA 1QHDA 4L92A 3TN93 2CV6A 5CAZA 3POGA 4Q1RA 3RFRA 1QOOA 2VZ1A 2D93A 4CDXC 1S4CA 1ULFA 4NMIA 1HRV2 2WR9A 1HJGA 3IPVA 4A41A 3VD9A 5FYSA 4FPLA 4BK4A 1UY2A 1WCKA 2NPIA 4PT6A 1O8SA 4LHKA 4S2DA 5LCWL 2W95A 2FZ1A 1RXGA 4NROA 1UOFA 1QH7A 3VKMA 4WVMA 1ZM1A 1UN1A 3VZNA 3VBSC 5KWRA 3N9PA 3WDVA 5FBJA 5FUNA 2XL7A 3FFZA 3KCXA 1JOJA 4AL9A 2XG3A 5AC93 1REEA 4HN1A 1O6UA 3WQ1A 1PGL2 3HJRA 5IVCA 2G9FA 3ZMNA 3AZZA 4C8DA 4QD2A 3KSCA 1R081 1RUC3 3B3QE 4UW4A 1AR72 1WKYA 2VMHA 4LKDA 1DGRN 5KC6A 4GWJA 4HT1T 5C8CA 2CTVA 4COZA 4PDWA 1IPKA 5IATA 3ZFFA 2BUKA 2HKXA 1RUG1 4HLTA 1JOPA 2ZCWA 4LHLA 3ZM8A 2VU9A 5F7UA 1ST8A 3WVJA 4FTSA 2O0OA 3ETQA 1CAWB 2F6BA 5FZAA 1CAWA 1OQDA 4E8DA 3ABZA 4JCKA 3JD71 2ILMA 1IG3A 3PUQA 3AB0A 4FQZA 2E7QA 4E2GA 2QKDA 3IDBB 2A6YA 3WF3A 2R0FA 4YW5A 1JYTA 1IQAA 1C5HA 1CR7A 3GJAA 4EWAA 1VBA3 5FY5A 4HONA 5FP4A 3SXWA 4QGMA 4AFAA 4SLIA 4IEVA 4BA6A 3GNEA 3OEAA 2A3XA 2XVKA 1IG0A 1UYZA 4NN0A 4YW3A 1VRH1 5DMYA 1SLAA 2EIDA 1V6IA 4UW5A 1IZ3A 3QCWA 4N43B 1HXS1 4RR3A 5FPAA 5AC91 2JG9C 4Q4V1 2GP5A 5FY4A 4META 4BISA 2MEV2 5LBCA 2VUAA 1VBA2 2IXIA 3M7AA 3TEYA 1MS0A 2RS12 3BOPA 3OBZA 5AVPA 1H6XA 5CADA 2VZPA 3B01A 4I30A 4FFGA 1HDKA 4YNIA 4U2AA 3WNLA 2TNFA 2Y6LA 5F3EA 3S57A 3UETA 3WHUA 3PJQA 2QNKA 4WVWA 3NAPC 1UMIA 4LA3A 1FOD3 4JKMA 1PO23 3PUHA 5FPUA 1OKOA 2GZWA 2AACA 3UGFA 3ZXKA 4NIGA 2A6XA 1U5XA 2RR12 5E16A 1VBB2 3WUDA 2Y60A 4JV4A 4AQ6A 2WO2A 4Y5SA 3H8RA 3IZOA 3P3NA 4W50A 2XH6A 4ES9A 1GNHA 1OKQA 5EQUA 3RZJA 4G4FA 4QM9A 4UFLA 2GU9A 1Q8VA 1VPHA 2VECA 1JYCA 1M06G 4GB31 3RYKA 3B9CA 1DBNA 4FFFA 4JHZA 2RDSA 2GNTA 3NNJA 4C1WA 2XJUA 4P14A 2EIEA 3CJIC 3BYWA 5LBFA 4FAHA 1XNCA 3G6JB 5LWBA 2HWE3 3MHZA 1VBD2 2SBAA 1YRZA 1J3QA 1LU1A 1QMJA 3D0SA 5C3PA 4TTGA 1Q43A 1LOGA 1V6KA 2OYZA 5I93A 4DXSA 4IEYA 4IV3A 4OI1A 5CISA 1H8TC 4K6BA 2CDPA 1H8TA 2QQLA 1KDKA 1R092 4QDSA 4D7TA 2W1QA 2C6SA 2KXLA 4Q4X1 4Q4Y1 4E4SA 4ZZ5A 4B1LA 3K48A 1OLQA 2CNAA 1YC61 5D8AC 2D6NA 2AEZA 3MPPG 3J7NA 2LW8A 2WFF2 4X8NA 1LHOA 1UU4A 2VTXJ 4P5YA 3OY8A 1R091 1UQXA 1S0GA 3MF6A 2IVJA 4COYA 1UD1A 4K21A 3DGTA 2WAAA 4KWKA 5GZDA 5CKNA 2RS32 3NQHA 1XU2A 1XBFA 1OPOA 2YFZA 3RZZA 3T1LA 3T2TA 5HV4A 5HI0A 2ZBJA 1XU1A 1OT5A 5HBAA 1QJX2 2GC1A 1NCQB 3OBRA 1ZRIA 4V1PA 5CNAA 5CVRA 5K4LA 1EAH2 4Q0UA 5B4NA 2W47A 3NV2A 3M8LA 2UURA 5L9VA 4LUKA 4CEYB 4LLOA 3NRUA 3KLSA 4EWEA 4OI4A 3RZLA 3B7MA 2ZAHA 5D21A 4CCDA 1POV3 1B35C 2XJVA 1W99A 2W92A 4INDA 5FP7A 4MGQA 1UY0A 4A7YA 4AXOA 1JH5A 1EAH1 4QX7A 2O1QA 5F3GA 1GZWB 3DYPA 3FLTA 3SHRA 5FY8A 5L7OC 4JVAA 4OLLA 2ZZJA 1Y4WA 2RE9A 2FDJA 2XJQA 3KGZA 3V0AA 1W8NA 4YPJA 3AP5A 3N36A 5FZ6A 4XQ4A 4BXSV 2LRPA 2ZGSA 2VZQA 5FREA 4XDOA 4ZU7A 2EVXA 2PHXA 4WVMB 1HV1A 1VBC1 2PHTA 1RGSA 3LEKA 3M3QA 2A75A 2C4XA 1X36A 5FWJA 4OHWA 5FZOB 2G4IA 4B7KA 3OCPA 3OG2A 3O1OA 4ZZ8A 1LB2A 2I74A 2V72A 3WW3A 1K5JA 3CMGA 5ACA3 5H9QA 2GALA 1SLIA 1XYPA 5FK7A 1JZ6A 1Y43B 1LU2A 1ASJ1 3UKVA 2D97A 4CEYC 4YYOA 1W8ZA 1HKDA 5LRSA 3K51A 4KL1A 2R1BA 4P08A 3VBUA 5A33B 4XUQA 3KD4A 3POSA 1ZREA 1BMV2 4BH9A 1VRH2 1JYIA 1RUE1 2PAEA 4XACA 1MS4A 2DVDA 4Z2WA 3ZOIA 1AR92 4UBGA 5FZGA 2FMYA 3MUY1 4OHXA 1RUI1 1ND2B 1KFXL 2BDRA 1XE8A 3N7JA 1W9WA 2CWMA 2QVSB 3R4SA 1SMVA 3RRDA 1D2SA 1RUE3 1A78A 4IE6A 2RHPA 3E6CC 1F2NA 1V0AA 2HLEA 3CIHA 2VTFA 3OD0A 1COV1 2ZKLA 1REFA 2IXCA 3LPFA 4KGGA 5GM0A 5A7QA 2BGCA 4B4PA 2Y6GA 3T0AA 3B93A 3JUUA 3LWCA 1RUF3 2DCTA 1POV0 4IXLA 1ENSA 3RI9A 4XIKA 4ITCA 5FPXA 2OZ6A 3ZLIA 4MX3A 3UKTA 5JZGC 3SLIA 1LNSA 2ZHKA 1UZ0A 2ZHMA 5EP9A 4KWJA 1WCUA 4N53C 1DGWX 4A4AA 2WWUA 1ENQA 2GH2A 2WNEA 3THCA 1GR3A 1EUUA 2OX0A 3NJVA 4GKXA 5C4WB 3OGRA 2OZJA 1TMF2 1XE7A 4XIOA 3C7HA 3NNGA 5D2AA 1CPNA 1PK6C 2NQYA 4Y1VA 2Q8DA 4Q4Y2 3VN4A 3WXPA 4C91A 2EIGA 2QQPA 4B29A 1OUXA 4M3CA 5FZCA 1NY71 2JG8B 1RUJ2 4Q29A 3I3DA 2PHDA 1VBE2 2BOIA 2JDYA 2VOXA 4HOOA 5FPVA 5I0RA 1XNTA 3LDRA 4NHMA 4WV8A 4QB1A 4XMAA 4Z8BA 5I0SA 1UZYA 2CWSA 1TMF3 4MUVA 5KC5A 2HBUA 1AYN1 2UWAA 1ENRA 2ZX4A 2WSVA 1MR5A 2VO5A 3DUIA 3PUIA 3USSA 2VE1A 5FDBA 2AEYA 4J1WA 1OD3A 3WNMA 1H2KA 1O3SA 4AF9A 1UW8A 1JZ7A 2X09A 1JU4A 4BMBA 2ZEWA 4AHXA 4K40A 1ND3B 5GLTA 4OYUA 5APAA 3ZSEA 1OH3A 4MLOA 4UW3A 2YHJA 4DFSA 3GDBA 1QJY3 3U37A 4CDQA 3J7HA 4COWA 3EMRA 2VNRA 2JDAA 3I3QA 3KHCA 1OD5A 3IT8A 4CCNA 2RDQA 2BNOA 2C9AA 1JZ5A 4DO0A 1CVNA 2X29A 4EE2A 1D4M3 2VPVA 3HN1A 4AEDA 1AR63 3MIFA 4EV0A 2YFUA 1J83A 5T55A 3HOBA 2H6CA 3H7JA 1TZOA 5FYUA 3EO6A 5KHJA 2DFBA 5A7PA 4IEZA 4FP3A 3S6PA 3ZXFA 4WZFA 3NVCA 4NPLA 2TUNA 2ADEA 4UI9L 3N35A 3HVDA 3VDDB 2J1SA 2AREA 1VRBA 1OURA 2I2SA 2QUOA 3AFGA 3AKRA 1SFPA 5FMBA 5F3CA 1YO8A 1DLCA 4YW2A 3WP4A 4MGIE 5CYYA 3W9AA 4AHZA 3MIGA 2XQXA 1SHWB 4PDWC 1RUI3 1RUD3 1FXZA 2L9LA 5JXHA 3ZX7A 3FC0A 2W87A 1Z7S2 4H3WA 3O7OA 4NHYA 4YZ2A 3KT4A 2OPWA 4XZUG 1N3PA 1PVC1 1VP6A 4NRPA 5FQ0A 5LRRA 3L2YA 1SPPA 1F4AA 2DUOA 4QXKA 4FBFA 3TNPB 3NV3A 4LBKA 2GMPA 4HK8A 1GZWA 1OLME 4CCCA 4XF1A 2BP6A 5H9RA 4CUAA 3PUSA 5LA2A 3MLLA 1BYHA 1L7LA 2GC3A 3ZN6A 1RJ7A 4S2FA 3QACA 3RSJA 1CZSA 3C7FA 3IPVB 5LY2A 1AR93 4A3ZA 3LF7A 3HQUA 1GZTA 1RVF2 5DAPA 5FWEA 5C6CA 1NOVA 2A6VA 5JSRA 1IQDC 3ZFGC 5ANNA 2RG4A 1OFNA 4IERA 3TN92 3D6EA 3VHRA 4KBBA 1TME2 1W9SA 3ZR6A 1IOAA 3K75B 2XB6C 3SISA 1ULGA 1S0EA 2R7EB 4MGKE 2NZ9A 1YIPA 4CDQC 3VBRB 3BN6A 1AYM2 1UO9A 1IS5A 4CDUB 5FYTA 2F17A 3FHQA 3OGVA 2QQJA 5C9AA 1UKRA 1J1TA 2XWJB 1A3KA 4BB3A 5A1FA 2W68A 3OSDA 4NIAA 2RM22 4EN7B 1KFUL 4E27A 3KQRA 4JQRA 4QX8A 4P9YA 4AGRA 3WDUA 5A3PA 5JR2A 1O3QA 5GZCA 3VBUB 4HN0A 5L7OB 3MFAA 1XSQA 3BALA 1MQTC 1ULPA 4DQAA 3T08A 4I02A 3LQCA 2DCJA 3NKTA 3WP5A 1JW6A 4M01A 1SDWA 1SLBA 4URTA 4CU6A 4LO4B 4RHV2 4M3CF 1RXFA 1WCSA 5CFDA 1GNYA 4QQOA 1PO13 1AXKA 4LT5A 4YVWB 3DF0A 1AR91 1LESA 2B9UA 3MIBA 1NQJA 1VBA1 4NJ4A 3LB9A 4AYUA 2P3KA 4I2OA 1F35A 3AKSA 1MZ5A 4S2HA 2G9GA 2AENA 2RV9A 2VW1A 1EPZA 4CUCA 4YSFA 3MF9A 4E4HA 2NMNA 3J9SA 1UYPA 3R05A 4HMZA 4OUSA 3I3MA 1S1AA 3HAGA 1CAUA 4W6XA 1Q3EA 3UGHA 5JI9A 1CAXB 1FX5A 4DRRA 5J96B 5A3NA 3ZVXA 1YFUA 3V0BA 1Y9GA 3AYDA 3AL6A 4DNYA 3A7QA 1EV13 5BXXA 2XJPA 5FLIA 2JDNA 4D8MA 4LBQD 4Z82A 4OZXA 3WW4A 3ZSMA 4NIHA 2HYXA 5EJ1B 2FZ2A 5FO7B 1ND2C 1BCXA 5A6YA 2GN7A 4XBNA 2QQIA 1U0AA 5FZDA 4ZPIA 1Q8PA 2P3JA 3AMPA 4R8HA 4BMEA 4RS5C 4CYDA 1D4M2 4MGTA 1D0GA 4IESA 1AR62 4WM8C 3LKJA 3WG1A 4KU7A 2GSYA 2HWC1 3ZYBA 3WX5A 2VNVA 1ZRFA 1J3PA 1OUSA 1QNYA 2ZAAA 4BZ4A 1CQ9A 3I2DA 2A73B 2Y34A 3THPA 5HCAA 4FPOB 3G7DA 1MVEA 2BPA2 3O1MA 4FAGA 1COV3 1VBC2 2Q1MA 2LALA 2WWJA 4JAAA 4NAOA 1UY3A 2J1RA 2R6QA 2GC0A 3MW3A 2EXHA 2GC2A 1PX3A 3I4IA 4FTBA 1FAYA 2Y33A 5E8AA 3TYJA 5KHHA 3SCHA 1ACCA 2R071 1M4WA 2ZA9A 4NHXA 4PQ9A 2BNMA 1X8MA 5DXDA 5FPLA 1MEC3 1NCRB 4LBOA 1GSLA 1YLLA 4AEDB 5CFCB 5K9YA 2WZR3 1QQP1 1H2LA 2IZWA 2Q1FA 2ZMKA 3OGSA 1JHNA 1XXNA 5BV6A 1W28A 2CY6A 2D40A 1OXCA 1UY1A 2W2IA 2VD7A 3GCWA 3APBA 1H6YA 2RS51 2PELA 2P6HA 5A3WA 3VKFC 4HZFA 2E63A 4ET7A 5C70A 3D82A 2R063 2HWD3 2PLV1 3URFA 1WMFA 1WMEA 4QDQA 3POEA 3P3PA 4QPWA 2B9VA 1OF4A 3VDDA 3ZDSA 4OCTA 2P6CA 2VMEA 1OOPB 3CF6E 2BERA 4LITA 3GZAA 5ANQA 2A70A 1AZDA 4AAPA 1HIXA 3ILRA 4IL7A 1LGCA 2BQPA 5EPAA 1XE0A 5A6QA 5FOBB 5T5OA 1QDCA 2ZGKA 2R041 1VBD3 4PIZA 5FXZA 1SBFA 4LO8A 2BJSA 4IW3A 2J42A 2DWRA 1BJQA 2HWF2 4Y4RA 1MS8A 2BZDA 4BU2A 3LPGA 1JOBA 5K8SA 2BNNA 1FNZA 2E32A 3N9QA 2X53S 4PQQA 4NIIA 3LGRA 4DINB 1POV1 5JVVA 1H1AA 1W6NB 3QH6A 4WM7B 1FV2A 2NYYA 2P34A 5FZ0A 5F5IA 2Y6HA 1H4HA 5FYBA 3RWNA 3ZPOA 2QQOA 1LGBA 4NWVA 4RR3B 1ULCA 2A3YA 1SCSA 4QWNA 5FIXA 3MBWA 4KWLA 3O1SA 1DG6A 3OBTA 5FYZA 4CCEA 4ISRA 4L99A 3VLBB 4GIQA 1HB3A 3WT3A 3S7EA 1O5UA 4XCBA 4XTPA 2QCSB 5FMDA 1PHMA 4GJYA 3VHPA 1FMD2 1QGLA 1QU0A 2WFPA 1CPMA 4FP2A 4MGYE 4CXYA 3FE5A 1T2XA 1RUE2 4ZY9A 2ZS6B 1JBCA 3POFA 1VAKA 3OF1A 3VZLA 1AYN2 4GAZA 4OULA 4LK7A 4DEQA 3T30A 3PVBB 1WW5A 5F39A 3I2IA 2VL4A 1B09A 5A3MA 2D6PA 4AFCA 2PYTA 1ZA4A 2QQUA 1EV12 2ETEA 3QH7A 3H50A 4LKFA 3BPSA 5FZMA 3TAYA 1DQ1A 3U10A 1FMD3 2R16A 1JS9A 2KA3A 5FXXA 3VV1A 4K8FA 4E2SA 3ZPYA 2JG9B 1UOJA 3ZFGA 1XNAA 4XVHA 2Q5TA 2JG9A 3ZFGB 1GOGA 1PIV1 2VUCA 1ULOA 2JB4A 3AZYA 2XBO3 2CSGA 1BHGA 3H8UA 4U36A 5J48A 3L2HA 3JU9A 5FCCA 2XVGA 1EV11 4UXAA 3WF0A 3BTXA 1WLDA 1ZZBA 2XGXA 2EF6A 3PURA 4AEMA 2W46A 4YZ5A 4QX0A 1TG7A 3WG3A 1RTVA 5DDJ1 3SH3A 5JMOA 1CZVA 2XOMA 3IB3A 4W4ZA 2QE3A 3LOBA 1VALA 3HEIA 4IV3B 1BQPA 3VGIA 4OMCA 2W08A 5IK8A 1UPIA 1G8WA 4MSVA 4XE9A 3KMHA 2IXLA 4QXCA 4TZDA 3KB5A 3INAA 1RUF2 3JD72 1O7FA 1C1FA 3FUQA 4N9IA 2ZJCA 4PLNA 4Q0PA 1MQTB 2GNMA 3HBKA 5BNOA 3AXDA 1QEXA 1UZZA 4Y26A 5DDJ2 5C8CC 2HEWF 1WMXA 2IVIB 2O14A 2E31A 4CE8A 1R093 1RVF1 4YM3A 4BCUA 4CDWA 3BU0A 3JCIA 4CSWA 3J8F3 2Z79A 2K9ZA 4AI3A 4B1MA 4CDWB 2YUEA 2A3WA 2LUWA 2P3IA 3AX4A 4D6QA 2WFF1 1IPSA 3WOGA 4HPKB 4UYBA 3KV4A 2X5IC 3P1IA 3O0VA 5C71A 4P9JA 3WG4A 4MYEA 1J1LA 1RUI2 5FYCA 1RUJ3 4JKLA 3BODA 5LEJA 1YFXA 4GA9A 4LK6A 5ERLA 2BEOA 5A3OA 1IS3A 1DGLA 3PVEA 3H3ZA 4GZ9A 4HG6B 1EAH3 1MZFA 1NA1B 5F2WA 1WLTA 5FP8A 2ZACA 4AAXA 5IVYA 1CX4A 5IVVA 2JE8A 2W39A 3AP9A 3VBSB 4MOAA 1VLNA 1ASJ2 1C3HA 2ARXA 3AMQA 1U5ZA 3CHXA 3M3CA 2VG9A 4IGOA 4I3GA 4Y24A 3IDAA 1N1YA 1KGYA 3T4HB 3BCWA 3PUAA 4GB32 2K0GA 1NKGA 1Z7S3 3BUCA 4RSUA 2BOJA 4LIVA 2YC4A 5C3OA 3WCSA 1RVF3 2DVGA 4NIDA 3FJSA 3ZXJA 3D3AA 4Q4W3 3FMGA 1LEMA 2WNUB 3FLPA 4LE3A 1WW6A 4YLZA 2D6OX 4QPGC 4JDMA 1W9FA 1S0CA 3WD5A 2JECA 5BUVA 3VBOA 3GALA 1B35A 3ZSKA 4MGZE 3USUA 1AYM3 4LO7A 2QDNA 2VOWA 4JC1A 5IVBA 4XXPA 3NJZA 3JZVA 1L3JA 5BNOC 2RJ2A 4JGYC 3LAGA 2Q8CA 2NLRA 4JX0A 3WDYA 1V6NA 4MHUA 2WQ4A 2YYOA 5FP3A 4WVZA 4DMIA 4XILA 4LBQA 1G9CA 2WS93 1TME3 1UXZA 5FZ9A 1SFNA 5B2GB 5EIYB 3C7OA 5LASA 4LXLA 4MZUA 3B5LB 1GWLA 5D8AA 4ZU5A 3RZMA 1BMV1 1WGPA 4Y4YA 1TVGA 1TME1 4BLIA 1NLSA 1XNDA 4Y33A 5LEKA 2SLIA 1W6PA 2QQKA 4QU1A 2GMMA 2WKKA 5IJRA 4XTMA 2WNUC 3O1TA 1W05A 4L9BA 1NT0A 1D4M1 2R1DA 4D6SA 1NUKA 3SKJE 3VDAA 2BFUS 4EN6B 1AXZA 4AHYA 1H8VA 2P17A 5FLJA 3V0BB 4ASMB 2E53A 2R30A 3HPNA 5JSOA 4ZS3A 1PK6B 3IDEA 1PX4A 3ZKYA 4XF3A 2GN3A 3ZYGA 1FOD1 4DIQA 1I6XA 1V9U1 3MLKA 1S2EA 4CP0A 1GICA 2WA3A 4H14A 1KJLA 1YEWA 2N7GA 1GUIA 1C8M2 1ODNA 2MHFA 3IM0A 1U12A 2R072 2VMIA 2FDKA 3KF5A 3A22A 2D3PA 4RS5A 2VQUA 3AYAA 5FZEA 4B4RA 4EYUA 2J22A 2VW0A 3NL1A 4WM7C 4QXBA 1JUIA 1XOYA 3I54A 4C1XA 4FT8A 2LS6A 1YQ6A 4DB5A 2J1EA 5HCFA 4COUA 2OVUA 3O0WA 2XKPA 1AR73 2WZR1 3FX3A 2RMU1 2WBKA 3ILFA 4QQPA 4HVQA 5FR3A 3GXUA 2VOTA 2HWF1 3D8CA 1ND3C 2JB8A 2VQTA 1ND3A 3ON7A 2MPFA 1N1TA 1YNAA 3OEBA 4MO3M 4QAWA 5FYYA 3LIHA 4BYYA 4QQ2A 5E6HA 2DVBA 5FJKA 3RQ0A 1PNGA 4DPNA 5JMCA 1Z78A 1UY4A 2ZPXA 3KCYA 2QZ2A 1R1ZA 1N1VA 2EXIA 4XBLA 3H3LA 3GJBA 4QPYA 1RHI2 1FATA 1LOFC 2IXJA 3PLQA 4HVOA 1CAUB 4FPFA 3NNLA 2PHWA 1ONAA 1ALYA 1TNFA 4ONUA 4KG8A 4L11A 1MACA 3W58A 1J84A 4O9GA 4YW1A 1RUG3 2F4PA 1Y9QA 2Q4SA 2Z5WA 1QQP2 1OLRA 3A0NA 3ACHA 3H7YA 1CESA 4P9WA 4RHV1 4R9DA 2GNBA 4RQPC 3SQOA 3HD8B 4GD4A 4Y1ZA 3T3YA 2XUMA 5DUUA 1OA3A 1VMJA 1RHI1 3K77A 2VZTA 2WINB 2CAVA 4LEJA 4YFZA 4UT5A 5AC92 3TBDA 4B7EA 2AYHA 4BQ3A 4CPBA 1LJ7A 1NQDA 2WYFA 3I97A 1Q56A 1GOFA 3K4DA 2YDEA 5BY5A 1WBFA 2R062 4HBNA 4QB2A 1UOBA 4W6YA 2F4LA 1W6OB 1LHVA 1RUOA 4YGDA 5FUIA 4AQTA 1DYKA 1WWYA 4BJ0A 1OQ1A 4A45A 4XJ9A 4DXZA 2W9XA 2J1AA 2PLV2 5FV3A 4H7LA 1Q8SA 1W2UA 3CU7A 1PZ9A 2CGNA 4EZ4A 1H9PA 1AHSA 3JB8A 4BPZA 5ISLA 1GYKA 1QF3A 3U14A 1ZZ9A 2WIIB 4GWMA 3KT1A 4OHVA 1JYWA 1X7NA 5A6ZA 4FI9A 5FRAA 3O1RA 1W6NA 4WM7A 1YFWA 5EV7A 3FUOA 5F6LB 3E1F1 5BNPA 3ZN6B 1F9KA 1LRHA 1Z7S1 3I8TA 3NO8A 5JZGA 4LIUA 4TSVA 4QQLA 4HFSA 3CNAA 3LDKA 1GQGA 4CU8A 1YHFA 2JDKA 3ZXDA 1XNKA 4R9BA 3WSOA 5DAXA 2HYKA 1W8WA 1AX0A 2CYFA 1S0JA 2CL2A 4NPRA 3PTYA 2D6MA 1ULDA 2JDMA 2RMU2 3H0OA 3N9LA 3VZKA 3P6BA 5JI7A 3WLUA 1GP5A 3AKTA 1CIYA 1PO21 1TQ5A 1J59A 3C3VA 2XKOA 4XOGA 5L36A 4GMP3 4XETA 4HETA 1SEFA 1ZBA2 2BVVA 2ENRA 2VBPA 4AE2A 2FCUA 2HEVF 3O1PA 4P9LA 5EWSA 1B35B 1AL21 5IHRA 1LGNA 4FVVA 1JZ3A 3NAPB 5B4XA 4GMP1 1LOBA 4DOUA 1AR61 3EXUA 2EXKA 2IFRA 1DLLA 4BWOA 3B9IA 3I2HA 1CGPA 1FI2A 1ZBA1 1ND2A 1QJFA 4K1YA 1CAVA 2Y8KA 3K3NA 2ZGUA 4FPKA 1CAVB 1AYN3 5GZFA 5A3TA 2VMGA 4K7JA 1L7RA 1IKPA 1R1A2 1C5IA 5J1XA 4Q4X2 4IV1B 2XHNA 3BIWE 4I0BA 4LLFA 5IK5A 2WRAA 4QX1A 4QHBA 1FNYA 1PZ8A 3VDCA 2BGPA 2B46X 1RMU3 3WR0A 1PNFA 1PGSA 1T6BX 5DQ0A 2RMU3 4CDQB 4DY5A 2B42B 2E6VA 3C8XA 3VHNA 2YU1A 3I2JA 4Q26A 4BIFA 1GKBA 3EHKA 3SKVA 3I49A 1C1LA 1OBNA 4UOJA 2VCAA 2WLQA 1VAMA 2E51A 4FPEA 5KBFA 3RVHA 2WL1A 1EUTA 2XJSA 4ASKA 1O3TA 1G7YA 1V6JA 4PIXA 4GH4C 3M4FA 4IETA 4GH4A 2XONA 3LE0A 1RL3A 4HKLA 2PXJA 2JDHA 4ZXEA 3C7GA 1BBT2 2BU9A 3J4UH 3T2QA 3ZIWA 2IUWA 3MV01 1O8PA 1XC6A 1W8OA 1AL23 1GQPA 2UWBA 3ES4A 4Y1YA 1URXA 2HWC2 4KI5M 4UFKA 1BEV2 1SBDA 3JBG2 3K4ZA 3OY8B 2VCMA 5IFPA 3AFKA 3Q9OA 2R0HA 2VQAA 4Y20B 1W8TA 2CGOA 3RZKA 2XR4A 4RGKA 3M3EA 5CKMA 1C28A 4LE4A 2MNGA 4QQHA 3VD5A 3W20A 3VL8A 2VC9A 5KHKA 3ZYIB 4YVSC 5EXOA 1N3OA 5BPXA 3T0BA 4CU9A 4S2GA 3IWZA 4F83A 2GAUA 5A6XA 2ERFA 4K8RB 1XQNA 4P9IA 3T1MA 1WD3A 3RZGA 1YIFA 5A32A 2DTWA 2VXRA 4UWDA 1D0HA 3MI8A 2O8OA 2QQNA 5C5UA 2RS52 3WQBA 1QJX3 4LNVA 2WDBA 3T2PA 2BWCA 2XLFA 4GWIA 3VDDC 4XXAA 3VKNA 3S5AA 1NAEA 4LBMA 5FY7A 2Y0OA 1HJFA 4YFWA 4EROA 5FYIA 4MVTA 4Q4Y3 4CEWC 1DCSA 5IVEA 1DU3D 3T4VA 3DCQA 2CAUA 3AL5A 3Q8AA 4M00A 5FZBA 1GQHA 4B8EA 5FLHA 5GKAC 1JHJA 2YZ4A 1VJ2A 2PN5A 4LUMA 2UY9A 2ZXQA 2YC2A 5FY9A 4HANA 4TLGA 4WM8B 4AOCA 2XHKA 1N47A 2ZGPA 1IHMA 1SLLA 5CA6A 2VNOA 3MW4A 1VRH3 5BNPC 1O59A 4KQ7A 4YM2A 4CZSA 1DIWA 1EYBA 1LHUA 2HEYF 3B69A 4Y22A 2WNVB 1UMHA 2XJTA 4LBJA 4NVPA 4ES8A 2JJ6A 4DRVA 2KR2A 5HXMA 3JQWA 5FPBA 2UU8A 3ZFEC 4JGYA 1Y7BA 2FDGA 4FO9A 3WG2A 1YUDA 3WW1A 2W1WA 5ABJC 1FPN2 1SDDB 3QD6A 1S0BA 5J98B 3WNNA 5JWPA 1FV3A 2H6BA 2VOKA 4XEZA 2XVLA 1YXWA 4WZCA 4AFDA 1PGL1 2DTYA 4AHWA 1H4GA 4QHZA 2PFWA 4DUXA 2X5IA 2IXKA 2WZEA 3OUJA 4IQPA 2Q1ZB 4AGVA 1KD7A 5I91A 4DS0A 1RMU1 3WNOA 3MIDA 3IN9A 4XFHA 5GJ6A 1QDOA 2DFCA 3E97A 4N7IA 1WZXA 1RITA 2W1SA 4A7ZA 4DEVA 1W8UA 3HN3A 4LJHA 1NY72 4UFIA 1LKNA 2YU2A 1GANA 1UZVA 3IIIA 4RR3C 2RJLA 3ACIA 4RQPA 5EYYA 3V0AB 4IE0A 4P9XA 4RQPB 5FOJB 1DP0A 1XSRA 2EAKA 5A80A 1RYYA 1A8DA 2Y38A 2WNVC 1K5MA 1K5MC 5C5TA 3BPZA 5JXGA 3QOPA 3AYEA 3VBRC 1MZEA 2FCTA 2ZGRA 4YARA 3ZFEB 5BNNB 2VZSA 3Q8FA 4XFIA 3ZDVA 2VAUA 4M4PA 5KXCA 5F5QA 3H1MA 5JAXA 2WN2A 5LA0A 4FCAA 4CXWA 2UYAA 2W5FA 1HQNA 3LEGA 4KBZA 3M2MA 4IE7A 1YFYA 3PVOA 5T3NA 4IDZA 5LBBA 1H1MA 1PM4A 3D4KA 4Q0QA 1ASJ3 5IAXA 2FDIA 1K3IA 2AGSA 1HRV3 3CL1A 3N9MA 2Q0AA 4HKOA 1DQ5A 5ACA1 2OIIA 4G3YC 4XJWA 3USUB 1CONA 2DCZA 1UNBA 2I45A 3GHNA 4QKNA 1PVC3 1GP4A 2HWB2 5FYHA 2C0ZA 3ZO0B 5L7OA 4Z1VA 4PHZA 3M1HA 1H30A 2PHLA 3K4AA 4QMAA 4HXCA 3AMNA 4AR2A 2DVAA 1HQLA 2ZX3A 5IVFA 5FJHA 4XFCA 3W5MA 4Y5TA 1G6NA 1CJPA 2JDZA 2DU0A 2YBKA 2ZGQA 4IV1A 4XFGA 5K0UA 2LM3A 2ZTNA 4IEXA 4XMIA 3GF6A 1GMMA 4Q4V2 1IS4A 3EQEA 3SNMA 1S0DA 3OYWA 3OPZA 1V70A 2BW8A 5GLZA 1VBB1 5A1AA 4RYDA 1X9PA 4YG0A 4Z2AA 1UMZA 3ZXLA 3W59A 1LTEA 1X50A 3THDA 2XPJA 5A70A 1JZ2A 2R073 4NWWA 1H8TB 2BFUL 3JB4C 5F37A 2Z69A 2JDPA 1W6MB 2GDFA 5LBEA 5L9RA 2XBO2 1O91A 4MG2A 2A6WA 3SC7X 4JDNA 4NOTA 3DPRA 4W8JA 2OT7A 2WO1A 4QPIA 4CVUA 1AJKA 1S0IA 3M70A 5KHIA 3HMYA 1JZ4A 3MZHA 4LMFA 1W2OA 2WNVA 3LSDA 4RHV3 1PGW1 2JXAA 1F8VA 2D3SA 3RNSA 4ZHNA 1GV9A 2WZPP 5CBLA 1DQ6A 5LK5A 1ZZ7A 4Y20A 2JG8A 4NUBA 4QB6A 3BB6A 5H9SA 3VBFB 1UXXX 4AGGA 1HRI2 1BZWA 4XUOA 1BEV1 3VBHB 3E6BA 3KVAA 2OUHA 3VD4A 2DVFA 1TMF1 2X5IB 4F7ZA 2JKXA 5C9AC 3ELNA 4PLMA 5T5JA 4TYSA 2J1UA 3VBOC 3AP7A 4FTEA 2VBDA 5DDJ3 5FO9B 2QFEA 3MEPA 5FZFA 3AZVA 1OSGA 4CP9B 1VBB3 1J58A 4X6RB 2XUEA 4D94A 3NV1A 5A3LA 2YB7A 1AL0G 2V09A 1IKQA 1HRI1 2VVFA 1SLTA 3N4MA 4HSJA 4H55A 4PBPA 4TWTA 2EICA 1MS5A 3D0JA 4YGCA 1QH6A 3OTFA 3AP6A 2DF7A 4ASLA 1HX6A 3CJIA 5JSPA 4JGZC 4NRQA 2FHRA 3GYDA 3TNQA 1DZRA 1QJU1 5FXVA 1C8NA 2DCYA 4AVTA 2C26A 1W0PA 4BQ1A 4CDWC 4DUWA 3AZWA 1W0NA 1KITA 4AQSA 3VBFC 1ZA7A 3A4UA 2YROA 2RDRA 1GNZA 4XUNA 4GWNA 1NXMA 3AZXA 3LA2A 2R061 4Y22B 1LOCA 4GULA 3WDWA 3WP3A 2XQRA 3ZFFB 4KH9A 4XJ8A 2VULA 3PDQA 1O4YA 1UX7A 1FT9A 5DAVA 1BVVA 1W6QB 2P4EA 3NNFA 4I3PA 4R4ZA 3UNPA 2DDUA 3BTYA 2VQ0A 3VUOA 2PMWB 3ZN4A 5FY1A 3TRSB 2Y6FA 5HCHA 1GWMA 2H0VA 4FPYA 2IXHA 1S55A 1UF2C 4KU8A 4QGLA 2DBIA 1NLQA 2IC1A 4XPVA 2WLPA 1RHI3 4BIOA 4EQVA 5CFDB 3FLRA 3POWA 1F15A 2ZGOA 4ZONA 2HWE1 1DQ0A 2E26A 3N7MA 1LODA 4JGZB 2Q30A 4XJUA 5LW9A 4OHZA 2RJKA 1DYOA 4XJZA 4FOYA 4E4ZA 1H9WA 3BU7A 1ZNPA 1VE0A 1RUC2 4J1XA 1Q8OA 2YGMA 1GFF2 3KV9A 1F5FA 1RUG2 5FY0A 4EN9B 5JPNB 5H9PA 2RS31 3D5OA 3M3OA 2ID4A 3EYPA 4YW4A 4AVSA 2VGDA 1W6MA 1V9U2 2UY8A 5C4WC 5FZLA 3ZFEA 3JBG1 5A1LA 3O1UA 1NZIA 2ZGNA 1AR83 1COV2 1VBC3 2OS2A 2HBTA 2WSUA 1QJEA 2WQZC 4KG0A 1I1EA 1X82A 3DYOA 4FPGA 5E88A 5JR7B 3TEXA 5BNOB 3TEWA 4B4QA 3VD3A 1PK6A 2BBVA 4RL7A 4A7KA 5FZHA 1C4RA 3LEIA 5G05L 1CIWA 4ATEA 1CZTA 2HWB1 2HWF3 3CDZB 3DEMA 3LFMA 3AKQA 2AZ5A 4XCAA 1DQ4A 5A7SA 5I8SA 1W04A 2W3JA 4M0NA 5FZ4A 3U4SA 3VB9A 4M3CB 1CN1A 2WAOA 4FSJA 1RUNA 3VBFA 1E5IA 2QBXA 4URAA 1HXS2 2VMCA 3X29B 4CCMA 3CQOA 3LFIA 4Q5OA 4CP2A 1ZRRA 2J1TA 4QPIC 3FWEA 1YQ5A 3AM2A 3FN9A 4QKBA 3B94A 1KS4A 3VL9A 2QZ3A 4BQYA 3ACLA 1PZ7A 1DYPA 2AH2A 1V00A 2MEV3 3GZUC 4IEUA 4YZ1A 3JXSA 1W8HA 4Z07A 5JLVA 4E8CA 5LA9A 2Y26A 4QU2A 4FPHA 3S5QA 3TOJA 2RR13 3ZXAC 1OI6A 3PL0A 1W06A 2G19A 4YVWA 5AFBA 1LR5A 2VCBA 1BXHA 3ST7A 2V4AA 4BXFA 2Z2SB 5J09A 2RM21 1AR81 2BGOA 3Q8EA 5FZ1A 1D7PM 1NCRA 3HR9A 3JBG3 4PBOA 4R9CA 5E89A 5CFCA 4LQRA 3N3HA 4Q27A 5A3UA 3I2GA 3H1WA 1Q5OA 2D6LX 3FZ3A 4LTAA 4Q4X3 3NJXA 5LB6A 2P3YA 4AEDC 2KD7A 2RM23 2XLGA 4LULA 3HIFA 3AYCA 4WM8A 4CCJA 3THTA 5LZ6A 1JUHA 1W0OA 5A7WB 3DPRB 1UU6A 5FYMA 2WO3A 1QXPA 2FCVA 3LIGA 4XFFA 1PM7A 3ATGA 1QIQA 2B39A 1XJAA 1R1A1 4N43C 1PVXA 1DHKB 4GXLA 3O0XA 2JX9A 4JZRA 1BK0A 4YG3A 4OI2A 2ZMLA 2EAAA 3LCPA 4OZOA 1R083 1RUC1 4BDVB 1HV0A 3CBNA 4NE9A 4Y1UA 3IKWA 5E1RA 2XL9A 4M0HA 2BWAA 1VR3A 4IEQA 1SZBA 1OOPC 2PHRA 3WF4A 1EY2A 1US2A 2ZZQA 4XDPA 2Q8OA 1RINA 1UZWA 3I59B 5FZ8A 1CX1A 1NCQA 2ADDA 1PGW2 1LULA 1W9YA 4O65A 3AMHA 1YQ8A 3ZIXA 5ABJA 1A34A 2AR6A 3KV6A 4JRLA 2PA7A 4LKSA 5CKQA 2VUJA 4JTNA 3V56A 3ZN5A 1OFSA 2V5DA 3OB8A 4B3NA 3CEWA 1FPN3 4AZZA 1OMIA 4Y3OA 1W90A 1JN2P 4I09A 1GZCA 3DPRC 3W21A 2XWBB 4FPCA 1VBE1 5FPZA 1HB2A 1D4VB 5SV5A 2VXJA 4CEWA 4UFMA 4XF9A 4CCLA 2BV4A 1AL22 4FOWA 3RGBA 2OW4A 4NRMA 2RS33 4BK5A 3I2OA 4QGNA 4L0PA 4N8MA 3VBSA 2AUYA 2YMZA 3S7IA 4E2QA 1R082 3C2UA 4E4DX 4P9GA 4GJZA 2HH9A 3TB0A 5KXBA 4CDUC 3KVBA 1QWRA 3ZYRA 2ZEZA 4CDUA 4NHLA 4OQ8A 1UCXA 1YJKA 1KDMA 1GU3A 1RUF1 4MV2A 4QX3A 4QPGA 1WA4A 3VBRA 5BNNA 2E33A 1OVSA 1JYXA 1WMDA 2TBVA 3C7EA 2GMEA 4QPGB 3W5NA 1ZZCA 3NW4A 3RJRA 2VOVA 2WS91 5C9AB 4Z92B 1QNWA 2ET1A 1KEXA 3T2OA 3MIEA 5IFTA 4IUGA 4Q1PA 4EN8B 1UKGA 3IIAA 4AI1A 5CG9A 1W6QA 2PHFA 2X8KA 4Q8LA 3BOWA 4XABA 3VD7A 4ATFA 3DYMA 2A6ZA 3I3BA 1S2KA 4FQ4A 4XHBA 2Z42A 4Q4W2 4DY3A 2B7YA 4K1ZA 4O9EA 5C3RA 1E5RA 3QBQA 4DXRA 5FBZA 5JOWA 3AJYA 5KXDA 1ULEA 3J8F1 4O61A 4OUMA 3R4DB 2D6KA 1CD3G 4HVRA 4NO4A 2ZHNA 2DUPA 3DKQA 4JHTA 3ME2A 3K2OA 3KHBA 4K9SA 2ZEXA 4JGZA 1VB4A 4A2UA 4UFHA 2V4VA 1NCQC 4LHNA 4XFBA 3SEEA 1VMHA 5ACA2 2MEV1 2B8MA 4DUVA 1QOTA 4P00B 1BK1A 4CCKA 1QJU3 3DL3A 3J7MA 4D69A 3IAQA 2W91A 3WQ7A 1XRUA 1LHWA 2CDOA 2D5FA 5EJZB 2RS53 2P5BA 1H1IA 4WBBA 1LOFA 3ORJA 3AVRA 3DECA 1O4ZA 4QM8A 5A7NA 1P8JA 2Y64A 3T09A 2CHHA 2JD9A 3LDBA 2ZGTA 5GZEA 5HPOA 5DZEA 3R0RA 1H0BA 1R64A 4RN5A 2WQ8A 4BQ5A 3BTAA 3AMMA 1PVC2 2HWB3 4QT6A 5D8AB 1RUD1 4JDOA 1EP0A 4UFJA 4CA9A 4AQ2A 3VDBA 1ZX5A 1LECA 4PIYA 1TE1B 1JYNA 3H1YA 1N1SA 2K2SA 2JG8C 1U5IA 3AP4A 4IE4A 1DGRA 4MGSA 5JPMB 5C33A 2BRTA 4IGQA 3MPBA 4GQ7A 3VZJA 4YWAA 1X9TA 2VCCA 2JE9A 3HNBM 2XMLA 3HT2A 3CO2A 3UK9A 2ZABA 3P5BA 3TEZA 2PAMA 3A0KA 3B00A 4NAMA 4JTOA 3ALQA 1XYNA 4HK9A 3UV9A 4EWDA 2VZRA 1SG3A 4HPKA 3HNMA 4F3JA 3WY6A 1QJY2 2K46A 4FXKB 3N7LA 4M3CE 5A32B 2TEPA 4L97A 4P02B 2DYCA 4ZXKA 5I0UA 2RVAA 1AXYA 2JIGA 2R32A 4TXWA 4C90A 1LOAA 2YPJA 1Q8QA 4RD7A 4C0BA 4GKYA 3PNAA 1OLMA 4CDXB 5DN2A 5J37A 5AFEA 4AK3A 3H9AA 1YQCA 4NPMA 2YY1A 2GNDA 1ZZ6A 2RR11 4H7MA 4YZ4A 4UF0B 4YZ3A 5FTTC 1O3RA 4LHSA 4NR1A 2NMOA 3RJ2X 2JKBA 2VZUA 3HNYM 4QX5A 5I8TA 1DFQA 5FO8B 2ZX2A 3SCGA 3O1VA 1GLHA 3FBYA 1PMJX 2PQQA 4I0AA 2YXSA 5FZIA 4IEWA 1GBGA 5A7OA 4BQXA 3BTZA 3LA7A 2ZEYA 3AK0A 4AFBA 2C5DA 4QPIB 3ILNA 4XDQA 5JIAA 5C3SA 4K3UA 1LEDA 1CJDA 2WNUA 5CG8A 2BBAA 1WLWA 4XUTA 3B02A 4OMDA 4R52A 3WQ0A 1UX6A 4ZS2A 5IAVA 1RUJ1 5K7PA 4PDWB 3WDXA 1PO11 1XPWA 1VBD1 2QQVA 4PJYA 4ZKTB 3SMHA 1WA6X 4L8QA 5DAWA 3ZKUA 5C7GA 3ZXEA 2QDRA 3I59A 5A33A 1XB9A 1V6LA 4HKWA 3UJOA 4MXVA 3OUHA 2I07B 4A6OA 1WW4A 1RUH2 1SQ4A 3WEZA 3WW2A 1RC6A 2PHUA 3KM5A 4AEJA 4FFIA 4JKKA 5JOXA 2E7AA 1LCLA 5DUXA 2YC0A 1WLCA 3I2FA 4ISQA 4J6GA 4LOTA 4YGEA 2ATFA 2VUDA 3HT1A 3ZYPA 5LATA 1AJOA 1OA2A 1UAIA 3DXTA 4LBQB 1SCRA 5EJ3A 3U78A 4BQ2A 1DZQA 3ECQA 3SITA 3UKNA 3H8OA 1MS9A 3J8F2 1I3HA 2ZX0A 5CIRA 3E5XA 4QHOA 2AC1A 4EJRA 3BKZA 1MS1A 4N43A 5FMOS 4XURA 2VMFA 4JQTA 4EZHA 5BNPB 3IAPA 4MADA 2LROA 2VVDA 3OGJA 4KWUA 2WS92 2EA7A 3N9OA 3A21A 4XF0A 3ZYHA
chains in the Genus database with same CATH topology
1UIJA 3JQXA 4ZU4A 1LOEA 1MEC1 2P37A 3FBMA 1S0FA 3POYA 1UIKA 1HLCA 2OUJA 3LZZA 4ORFA 5GLUA 3PJYA 5GLVA 5DZGA 1UU5A 3PMSA 1G9AA 2ZGLA 2ZHLA 1ZRCA 1DGWA 4N90A 1WD4A 3NWKA 2UYBA 3UL2A 1V9U3 1AVBA 4W65A 4FOQA 3SCFA 1AR82 2C1FA 5JCTA 2CGPA 3VBUC 4BM8A 4Q8KA 1XNBA 1KS5A 1MVQA 3GBGA 3TWIA 1I5ZA 1EPWA 5GLWA 2DCKA 5IK4A 2D5HA 1FMD1 1DQ2A 5L73A 3OJBA 1V6MA 3V65A 1AX2A 2OPKA 2W52A 4PLOA 3WHTA 5DUVA 2XBO1 5IT6A 3RMYA 1VAVA 1KRIA 1IS6A 4CDXA 4LBLA 2H0BA 1RIRA 3H3UA 1MS3A 5BNNC 3RG0A 2OA2A 3ES1A 3WDTA 1NZCA 1C57A 1YJLA 4AG4A 1QQP3 5BNQA 5LK7B 1LHNA 5EFUA 1CAXA 1G9DA 3RYRA 4XFAA 1AUYA 3MICA 4YM1A 1HW5A 1FOD2 5JIUA 3O12A 5F6KA 1AYM1 4Q4V3 2NP0A 1GZ9A 2R042 4LA2A 3GBFA 4SBVA 1QJY1 2NM1A 2WJSA 5C8CB 5JDBA 1R1A3 5KXEA 4NHKA 3E5QA 4MXWB 2ET7A 1WBLA 5KHGA 1QXRA 5T54A 2JE7A 4Y1XA 1ZZ8A 1AR71 3VBHA 4IEOA 3O5SA 4AVCA 1JXNA 3OGGA 4CEYA 1AF9A 2R043 3EBRA 1TEIA 5DZFA 5IUQA 1PO22 3RS6A 2A71A 3PMEA 5DUWA 3RPQA 4C0HA 2JICA 5HXVA 2LTNA 2EALA 4HL0A 4CEWB 2WC2A 5FMOL 2D3RA 1NE4A 1NCRC 5BYNA 5CFCC 4XQWA 4AVVA 4W6WA 1A6CA 2VH9A 4YG6A 3UJQA 5CU1A 5HCBA 2WA4A 2XJRA 3SH5A 4X8PA 3O14A 4MH0E 4XBQA 4LR4A 3NSTA 1BBT1 2D98A 2IFWA 3MYXA 3OD4A 4CTEA 1MEC2 1O5LA 2HWD1 3ZFFC 1J3RA 2DURA 4N53A 3MDPA 3R6SA 2D7FA 2KM2A 4N53B 3VBOB 3KS7A 3E5UA 1WCDJ 2JD4A 3M3IA 3V64A 5T52A 4E9KA 1OOPA 4AI2A 2FQPA 3DKWA 1WUVA 3FFQA 4Q0VA 2HWD2 1ENXA 3NV4A 3RMXA 2HWE2 4I0WB 1C8M1 1HQWA 2ZOEB 4R4XA 4OHYA 3MLJA 2PAKA 3WNXA 2HWC3 3KCCA 5IK7A 2NN8A 2WZR2 1UPSA 2FMDA 5I8YA 2A7AA 1HXS3 4I01A 2WT0A 2VY0A 4IV1C 3MW2A 1YI7A 3WINE 4X6QB 1XYOA 1NLRA 1ZRDA 1O4TA 2DV9A 4BOWA 5J7MA 2RS13 1H2NA 3TN91 1A8MA 1S2BA 3U4XA 3PVNA 4AWDA 3S0MA 1IGOA 2O8QA 5J36A 4RA0A 1VB2A 5JZGB 1W6PB 4OI0A 1K5MB 4R9AA 1OHFA 2ZKNA 1OPMA 4KGQA 3CLPA 3AXEA 1QJZA 3AKPA 3GHMA 1F5JA 4TLFA 5DG2A 4BHPA 2UWCA 4MXWA 4Q4W1 4AVAA 5GZGA 2WT1A 3LA3A 1YWKA 3EJKA 4RS5B 3NAPA 4AVBA 4D7YA 5TSWA 3N7KA 4G9SB 3RI8A 1BEV3 5AVAA 4AEKA 2BTVC 3MGUA 3IMNA 5EYXA 5I0TA 1ZBA3 4Y5Z0 1X33A 3J26N 3WP6A 4LBNA 1D2QA 5GALA 4GALA 2FBEA 4RGAA 1SFYA 4FPJA 2ZMNA 2YV8A 1RJ8A 1X8EA 1F31A 1NA1A 5JOZA 1Y3TA 4HSLA 1RB8G 4EN0A 2BVBA 2DU1A 2ES3A 3ZXGA 1BKZA 2WFF3 5T5LA 1APNA 4WVVA 3U11A 2ZGMA 1NG0A 3ZMOA 3QLQA 4YGBA 5EZWA 3VKLA 1PIV2 3HQXA 1QXJA 1NXD1 1RMU2 4N9HA 3WUCA 3HBZA 2W0XA 4XW3A 1SACA 1QJU2 4UBHA 3E6DA 2HJIA 1ZBE2 1ZVFA 3RYPA 1N3QA 3DV8A 1NE6A 1RUH1 2D44A 3WZ1A 2QJVA 4XYXA 3VKOA 2DUQA 1V6OA 2VVEA 2WWSA 2ARBA 2BYVE 1YI9A 5T50A 5SV8A 2A5ZA 2VNGA 2XLAA 4AW7A 1DDLA 5J3UA 1SBEA 4LO5B 5ABJB 1W6OA 1TNRA 3DN7A 1MZ6A 1QOSA 3LSEA 5JOYA 1VIWB 1DF0A 3KZ4C 3SH4A 2V73A 2E7TA 1AX1A 5F1RA 5F9TA 2PTMA 3IDCB 1G86A 1PIV3 1OQEA 4GB33 3VZMA 1QJX1 1BBT3 1YCIA 4P5HA 5C8WA 4AI0A 4L2NA 1H2MA 1Z0HA 3GBWA 5FFOC 4OFGA 4JRAA 5C4WA 4RFT0 3CJIB 3KGLA 3IBMA 5K0UC 1KQRA 1HRI3 2R49A 1RUH3 1KXGA 1RUD2 3WCRA 4GMP0 1G9BA 4DZGA 1REDA 4LO6B 3R4UA 3ENRA 4A3XA 2E9QA 3WV6A 2B45X 2P2KA 4IV3C 4XHXA 3ZYJB 1LENA 2Y0IA 2ZX1A 4N7UA 3ZSLA 3KT7A 3CJXA 5DG1A 1T6GC 4JGYB 4F8AA 3JD73 4YM0A 4AFMA 4K20A 4YRDA 4BLJA 4CRQA 3GZTB 4XZPA 4XF4A 3LOIA 3VZOA 3AJZA 5D1IA 3RDIA 4BE3A 4D7SA 3HWJA 1ZYBA 4OVEA 1VBE3 4YVWC 5K0UB 4FOVA 2V5YA 2PLV3 2EXJA 1PMIA 3L9JT 2YGLA 1FPN1 1WW7A 3OYWB 4KNCA 3U0ZA 2D43A 1G9FA 3MIHA 4IEPA 1BVP1 1U5YA 1QKQA 3ASIA 4GH4B 5CB7A 1YYNA 2JENA 2JEMA 1OA4A 1NA1C 2VW2A 1FYUA 1I9RA 2IWGB 1E57A 4D3WA 2B5HA 4CP1A 4XJAA 1IPJA 1DZTA 1MQTA 5T5PA 2GH8A 5L19A 4Q2FA 3MFCA 3PHMA 3ZSJA 2WT2A 4RGGA 3VHOA 4PF5A 5CFDC 4FXGB 1PO12 3U07A 1UL9A 3S30A 1JTZX 4Q0SA 4COVA 3I7DA 1ZBE1 1KJRA 1NYWA 4YVSA 5FQ0B 1SLCA 1QY4A 5FAXA 3NKGA 1HRV1 4YVSB 3VBHC 4PCRA 4XQDA 4AI8A 1C8M3 1ZBE3 4UW6A 3FHIB 1W39A 2RS11 3TN93 1QHDA 4L92A 5CAZA 2CV6A 4Q1RA 1QOOA 2D93A 4CDXC 1ULFA 1HRV2 3IPVA 4FPLA 1WCKA 2NPIA 4LHKA 4S2DA 2FZ1A 1QH7A 3VKMA 4WVMA 1ZM1A 1UN1A 3VZNA 3VBSC 5KWRA 3WDVA 2XL7A 3FFZA 3KCXA 1JOJA 5AC93 2XG3A 1REEA 4HN1A 3WQ1A 1PGL2 2G9FA 3ZMNA 3AZZA 4QD2A 3KSCA 1R081 1RUC3 3B3QE 4UW4A 1AR72 2VMHA 1DGRN 5KC6A 4HT1T 5C8CA 2CTVA 4COZA 4PDWA 1IPKA 3ZFFA 2BUKA 2HKXA 1RUG1 4HLTA 2ZCWA 4LHLA 2VU9A 4FTSA 3WVJA 2O0OA 3ETQA 1CAWB 2F6BA 1CAWA 1OQDA 4JCKA 3JD71 2ILMA 4FQZA 3AB0A 2E7QA 4E2GA 2QKDA 3IDBB 2A6YA 2R0FA 4YW5A 1IQAA 1C5HA 1CR7A 4EWAA 1VBA3 3SXWA 4QGMA 4AFAA 4SLIA 4IEVA 4BA6A 3GNEA 4YW3A 2A3XA 2XVKA 4NN0A 1VRH1 1SLAA 1V6IA 4UW5A 1IZ3A 3QCWA 4N43B 1HXS1 4RR3A 5AC91 2JG9C 4Q4V1 4META 2MEV2 2VUAA 1VBA2 2IXIA 3M7AA 1MS0A 2RS12 3BOPA 5AVPA 5CADA 3B01A 4I30A 1HDKA 4YNIA 4U2AA 2TNFA 3WHUA 3PJQA 2QNKA 4WVWA 3NAPC 4LA3A 1FOD3 1PO23 2GZWA 3ZXKA 2A6XA 1U5XA 2RR12 5E16A 1VBB2 3WUDA 4JV4A 4AQ6A 3P3NA 2XH6A 4ES9A 1GNHA 1OKQA 4G4FA 4QM9A 2GU9A 1Q8VA 2VECA 1M06G 1JYCA 4GB31 3RYKA 3B9CA 1DBNA 2GNTA 4C1WA 2XJUA 4P14A 3CJIC 4FAHA 1XNCA 3G6JB 2HWE3 1VBD2 2SBAA 1YRZA 1J3QA 1LU1A 1QMJA 3D0SA 1Q43A 1LOGA 1V6KA 2OYZA 5I93A 4IEYA 4IV3A 4OI1A 1H8TC 4K6BA 1H8TA 1KDKA 1R092 4D7TA 2KXLA 4Q4X1 4Q4Y1 4E4SA 3K48A 1OLQA 2CNAA 5D8AC 2D6NA 3MPPG 2WFF2 4X8NA 1LHOA 1UU4A 3OY8A 1R091 1S0GA 3MF6A 4COYA 1UD1A 4K21A 3DGTA 4KWKA 5GZDA 2RS32 1XU2A 1OPOA 3RZZA 3T1LA 3T2TA 5HI0A 2ZBJA 1XU1A 5HBAA 1QJX2 2GC1A 1NCQB 3OBRA 4V1PA 5CNAA 5CVRA 3ROUA 5K8SA 1EAH2 4Q0UA 3NV2A 3M8LA 2UURA 4LUKA 4CEYB 4LLOA 3KLSA 4EWEA 4OI4A 3B7MA 2ZAHA 1POV3 1B35C 2XJVA 4INDA 4A7YA 4AXOA 1JH5A 1EAH1 2O1QA 1GZWB 3FLTA 3SHRA 5L7OC 4JVAA 4OLLA 2ZZJA 2RE9A 2XJQA 3KGZA 3AP5A 3N36A 4XQ4A 4ZU7A 2ZGSA 5FREA 2EVXA 2PHXA 4WVMB 1HV1A 1VBC1 2PHTA 1RGSA 3M3QA 2A75A 1X36A 4OHWA 2G4IA 4B7KA 3OCPA 1LB2A 2I74A 3WW3A 5ACA3 5H9QA 2GALA 1SLIA 1XYPA 1Y43B 1LU2A 1ASJ1 3UKVA 2D97A 4CEYC 4YYOA 1HKDA 5LRSA 3K51A 4KL1A 2R1BA 3VBUA 5A33B 1ZREA 3KD4A 3POSA 1BMV2 4BH9A 1VRH2 1JYIA 1RUE1 2PAEA 1MS4A 2DVDA 4Z2WA 1AR92 4UBGA 2FMYA 4OHXA 1RUI1 1ND2B 1KFXL 1XE8A 3N7JA 2CWMA 2QVSB 3R4SA 1SMVA 3RRDA 1D2SA 1RUE3 1A78A 3E6CC 2RHPA 1F2NA 3OD0A 1COV1 2ZKLA 1REFA 2IXCA 4KGGA 5GM0A 4B4PA 2BGCA 3B93A 3JUUA 3LWCA 1RUF3 2DCTA 1POV0 4IXLA 1ENSA 3RI9A 4XIKA 4ITCA 5FPXA 2OZ6A 4MX3A 3UKTA 5JZGC 3SLIA 2ZHKA 2ZHMA 4KWJA 4N53C 1DGWX 1ENQA 2GH2A 2WNEA 1GR3A 4GKXA 5C4WB 2OZJA 1TMF2 1XE7A 4XIOA 1CPNA 1PK6C 2NQYA 4Y1VA 4Q4Y2 3VN4A 3WXPA 4C91A 2EIGA 2QQPA 4B29A 4M3CA 1NY71 2JG8B 1RUJ2 4Q29A 2PHDA 1VBE2 2VOXA 5I0RA 4NHMA 4XMAA 4WV8A 4Z8BA 5I0SA 1UZYA 2CWSA 1TMF3 4MUVA 5KC5A 1AYN1 2UWAA 1ENRA 2ZX4A 2WSVA 1MR5A 3DUIA 3USSA 5FDBA 4J1WA 1H2KA 1O3SA 4AF9A 1UW8A 4BMBA 4AHXA 4K40A 1ND3B 5GLTA 3ZSEA 4MLOA 4UW3A 2YHJA 4DFSA 1QJY3 4CDQA 4COWA 2VNRA 1OD5A 3IT8A 2BNOA 2C9AA 1CVNA 2X29A 1D4M3 2VPVA 3HN1A 4AEDA 1AR63 3MIFA 4EV0A 5T55A 2H6CA 3H7JA 3EO6A 5KHJA 2DFBA 4IEZA 4FP3A 3S6PA 3ZXFA 4WZFA 3NVCA 2TUNA 3N35A 3VDDB 2AREA 2I2SA 2QUOA 3AFGA 3AKRA 1YO8A 4YW2A 3WP4A 4MGIE 3W9AA 4AHZA 3MIGA 4PDWC 1RUI3 1RUD3 1FXZA 3ZX7A 3FC0A 1Z7S2 4H3WA 3O7OA 4YZ2A 3KT4A 1N3PA 1PVC1 1VP6A 5FQ0A 5LRRA 3L2YA 2DUOA 4QXKA 4FBFA 3TNPB 3NV3A 4LBKA 2GMPA 4HK8A 1GZWA 4XF1A 5H9RA 3MLLA 1BYHA 3ZN6A 2GC3A 1RJ7A 4S2FA 3QACA 3RSJA 3IPVB 1AR93 1RVF2 5C6CA 1NOVA 2A6VA 5JSRA 3ZFGC 3TN92 1OFNA 4IERA 3VHRA 3D6EA 4KBBA 1TME2 1IOAA 2XB6C 3SISA 1ULGA 1S0EA 4MGKE 2NZ9A 1YIPA 4CDQC 3VBRB 1AYM2 1IS5A 4CDUB 5C9AA 1UKRA 1J1TA 2XWJB 1A3KA 2W68A 2RM22 4EN7B 1KFUL 4E27A 3KQRA 4JQRA 4P9YA 4AGRA 3WDUA 1O3QA 5GZCA 3VBUB 4HN0A 5L7OB 3MFAA 3BALA 1MQTC 4DQAA 4I02A 2DCJA 3NKTA 3WP5A 1JW6A 4M01A 1SDWA 1SLBA 4URTA 4LO4B 4RHV2 4M3CF 1WCSA 5CFDA 4QQOA 1PO13 1AXKA 4LT5A 4YVWB 3DF0A 1AR91 1LESA 2B9UA 3MIBA 1NQJA 1VBA1 4AYUA 3LB9A 2P3KA 4I2OA 3AKSA 1MZ5A 4S2HA 2G9GA 2AENA 4YSFA 2VW1A 1EPZA 3MF9A 2NMNA 3J9SA 3R05A 4HMZA 4OUSA 1S1AA 3HAGA 1CAUA 4W6XA 1Q3EA 5JI9A 1CAXB 1FX5A 4DRRA 5J96B 3ZVXA 1YFUA 3V0BA 3AYDA 4DNYA 1EV13 5BXXA 2XJPA 5FLIA 4LBQD 4Z82A 4OZXA 3WW4A 3ZSMA 2FZ2A 5FO7B 1ND2C 1BCXA 2GN7A 4XBNA 1U0AA