4Y26A

Complex of human galectin-7 and galbeta1-3(6oso3)glcnac
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of human galectin-1 inhibition with Ki values in the micro- to nanomolar range
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-7
total genus 28
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4y26A00
1F9KA 4DRRA 4XJ9A 3W59A 1MS9A 2SBAA 1FX5A 3MW2A 3B01A 1AXKA 1CONA 1CQ9A 2A6VA 3FLTA 4M3CF 3R4SA 4GALA 4Q27A 4YGBA 4JC1A 4AVTA 4PBPA 4ATEA 5IK4A 3AXEA 2AYHA 4BLJA 1PZ7A 1URXA 1WLDA 1W6PA 2V73A 2CTVA 3N36A 1LHOA 5H9RA 2VU9A 1C57A 3C2UA 4P14A 3ZPYA 3MPPG 2GNMA 4UW3A 1MVQA 4Y1XA 3T1LA 1YI7A 1GZ9A 3FBYA 4YM2A 1ZA4A 3FUOA 2RHPA 1LENA 1LESA 2ZMLA 2ZGNA 1Q8SA 3VV1A 1FNZA 2ZMNA 1GNZA 5FREA 1GV9A 3Q9OA 2I2SA 4FOVA 2NYYA 1JHNA 1KDMA 1N3OA 4YW2A 1LCLA 1W6OB 4FPFA 5EYYA 3U4XA 1GSLA 2NN8A 1GNHA 1WLWA 2R0HA 2ZABA 3BOPA 4NOTA 4Q1PA 2ZMKA 4XHBA 4GKYA 4R9CA 3V64A 1DQ6A 1YYNA 2ZGQA 1F5FA 1O4ZA 1DQ5A 2H0BA 3AYDA 3FUQA 1N3PA 3MEPA 1LOEA 4XTMA 4XYXA 5SV8A 4H55A 3M1HA 3TB0A 4FQZA 1N1SA 1G7YA 1Q8OA 2G4IA 4AGGA 5T5PA 1RITA 3D4KA 1LOAA 2NM1A 4Y22B 1MZ6A 2VH9A 4FVVA 3V0BB 1CPMA 5DUUA 2PHUA 1A8DA 1CPNA 1EPWA 2CYFA 2CL2A 1VIWB 2GALA 3OGGA 1ULEA 3AJZA 2D6LX 1IKQA 3IMNA 3OY8B 3B9CA 4YW3A 1Q8QA 1WBLA 1S1AA 2R16A 4FQ4A 5GLZA 1SLTA 3JUUA 2WT1A 4UW6A 4YG6A 3SNMA 3WHUA 4YM0A 5GZEA 2CWSA 4Q1RA 2ZGUA 4XILA 3POSA 4P9YA 2JD4A 2D6OX 3ZYRA 4XBNA 1SCSA 3AX4A 2DWRA 1JBCA 1JN2P 1Y7BA 4RA0A 3RG0A 1CJPA 3HN1A 5GLVA 5CBLA 4GA9A 3AYEA 1LOFA 1QGLA 1MR5A 2DURA 2R49A 1DGLA 1LULA 2DUPA 3CNAA 5JVVA 4LBKA 5CAZA 2GN3A 1MS0A 1DQ4A 2P3KA 2A5ZA 5GLTA 5KXDA 1ULDA 1QF3A 3DGTA 4FPYA 3AP9A 4KBBA 2DV9A 3B69A 1MACA 3RRDA 1BYHA 2ZHLA 5GZCA 3PVOA 2YMZA 2DU0A 4FPEA 3ATGA 1IS6A 3SH3A 2P3IA 1W6MB 3JU9A 4R9BA 4C1WA 1Q8VA 2EAKA 3A0NA 2PHXA 1C1LA 2FHRA 3SH4A 4XJZA 1HQWA 3ZSMA 1SLLA 1G9CA 3SH5A 2A75A 1LHUA 2VW2A 2ZBJA 3UJQA 1O4YA 2TEPA 2ZGSA 5IT6A 1S0IA 1AJKA 4K21A 5E88A 2GDFA 2LTNA 4ISQA 1ENSA 1UL9A 2D6MA 4FP3A 2E51A 3FLRA 1SBDA 1G8WA 4LBOA 4YZ3A 1WW5A 2P3JA 4GKXA 4Q2FA 2UWBA 3GALA 1QOSA 2D3PA 2Z42A 2EXHA 4Y1VA 3NWKA 1G9AA 1D0HA 1AX1A 2AR6A 4XOGA 1QOOA 4ASMB 4PF5A 3RS6A 4AGRA 4L8QA 3OY8A 5DUWA 1LOFC 1SLBA 4OZXA 4YM1A 3ZVXA 5BYNA 2OUHA 1S0EA 3WNXA 3USUB 2LALA 1DYKA 4U2AA 1ENQA 3NV2A 4AGVA 2DVFA 4XMIA 1OFSA 3UL2A 4ZXKA 5IK7A 5DZGA 2A3XA 4DFSA 3O5SA 4XXAA 1GICA 2AENA 2UWCA 1FV3A 3KQRA 3VKMA 1S0DA 5AVAA 2ZKNA 4Q8KA 1ULGA 2W39A 3VKFC 2JE9A 1W0PA 1BJQA 1JOJA 2P2KA 4YZ5A 1FYUA 3O12A 5T54A 4YGEA 1LJ7A 1YXWA 2WSVA 2NMOA 2UWAA 4K1YA 5HCFA 1VALA 3WCSA 3FFZA 3V0BA 4FOWA 2DYCA 3I8TA 1S0JA 4JCKA 4YGDA 3ZXLA 1G9BA 1ONAA 1KDKA 1A3KA 3R4UA 3USUA 3OPZA 3ZXKA 2C9AA 2V5YA 3N7MA 4WVWA 1OKQA 1LEMA 2A70A 3AYAA 3HR9A 4FPLA 4Y20B 2GNDA 3RMXA 5KXEA 2CY6A 5IUQA 5IK5A 5FRAA 1N3QA 3PVNA 2EIGA 4P9XA 5DG2A 5LK5A 4AWDA 3AJYA 2AH2A 1N1VA 2CNAA 4AVVA 4FPGA 2A6XA 4Y20A 5EWSA 3B3QE 3BIWE 1LHVA 3WV6A 4AVSA 1DBNA 2DVBA 2A6YA 2D3RA 1GYKA 4DS0A 2WQZC 1KRIA 1ULCA 3OYWB 2PHRA 1UN1A 3RSJA 4DRVA 4SLIA 2P34A 1UZYA 3QLQA 1YO8A 1W6QB 2NMNA 1IS3A 2AREA 3UJOA 2FMDA 3D6EA 5T52A 3WDTA 1JXNA 1W6QA 1CN1A 2HYKA 1KJRA 1LECA 1LTEA 1QNYA 2PHWA 4GWMA 5GZFA 3T1MA 4Z8BA 3AZYA 5JMCA 2B7YA 5F5QA 5T5LA 1G9FA 1QKQA 2ARXA 1IS4A 1MS5A 2E7QA 4BM8A 2W68A 1WUVA 1WLCA 2VUAA 1QDOA 1LGCA 2ZGTA 5GLWA 1V6MA 4M3CA 1AX0A 1ZM1A 1NLSA 2ZGPA 4M01A 1GZWA 4RL7A 1X50A 3N7KA 4W65A 4YG0A 4FPJA 1S0GA 2D43A 1I1EA 4JRAA 5T5OA 4YLZA 3WZ1A 4XJAA 3WOGA 4CTEA 1CVNA 3N7JA 1BQPA 3ENRA 1LGNA 2WT0A 2ES3A 4FPOB 1DQ0A 1GANA 1AJOA 5IK8A 4R9DA 4FOYA 1KQRA 4CZSA 4Q8LA 2PELA 1IS5A 2GMMA 2ENRA 3IPVB 1AXZA 1UMZA 1V6LA 1FAYA 2NZ9A 2DUQA 1ULFA 2XG3A 5H9SA 1HKDA 4IQPA 5L73A 3AZXA 2EXIA 1WCSA 2JJ6A 3MW3A 4YZ4A 1ENRA 3WDUA 4ISRA 2ZGMA 1WW7A 4K20A 5T55A 2ZGRA 4YW1A 4GXLA 4BMEA 5H9PA 3T2TA 2YZ4A 3H0OA 4PQ9A 4UW5A 2GMEA 4D69A 1A78A 1GZWB 5JOYA 1GBGA 3AP6A 5JOZA 4WVVA 3ILNA 3M2MA 2R0FA 1N47A 1G86A 1V00A 4FPHA 3WUDA 1DLLA 1LODA 1W6PB 2DU1A 2GNBA 2PHTA 5E89A 2YROA 4M3CE 1Q8PA 2GNTA 3V0AB 1JYCA 2D6PA 1KJLA 1XQNA 1YIFA 4YW4A 1SLAA 3BODA 1RIRA 1HDKA 3IM0A 3R05A 4LBQD 4Y22A 1DFQA 2R1BA 2WNEA 3VKNA 4F83A 4Q26A 3A0KA 3B00A 4Y1ZA 3M3OA 5DXDA 3ASIA 3MW4A 1SCRA 2A6ZA 3VKLA 3PMEA 2A3WA 3AP4A 4CRQA 4DPNA 1F31A 5HCBA 1SLCA 2PHFA 5DUVA 3NV4A 2EALA 1FV2A 4XJWA 4TZDA 1WD4A 3WHTA 3M3EA 2VXRA 2DUOA 3A4UA 2ERFA 1LEDA 1FNYA 1MS3A 4NO4A 3BTAA 3OYWA 1V6IA 3ILFA 4ZKTB 1TEIA 4YG3A 1GKBA 1H9WA 2A71A 2ZGKA 1J1TA 3D5OA 4K1ZA 5JLVA 1NXD1 2W52A 4XTPA 3SLIA 3WCRA 1JUIA 3ILRA 5CNAA 1PZ8A 4ATFA 3ZSLA 2GN7A 2GMPA 4WV8A 4Y1YA 2DTYA 1UPSA 4WZFA 2ZGOA 3WDXA 3KM5A 1UAIA 2UU8A 3GNEA 1MS8A 3ZXEA 1LOBA 1SBFA 2WJSA 4YW5A 5EYXA 2SLIA 4XMAA 3ZSJA 1W6NB 5GLUA 2KM2A 1V6KA 1KITA 1WBFA 1IOAA 3AP7A 3AZWA 4XZPA 5E8AA 3IN9A 5CA6A 1CESA 4FOQA 3FLPA 2W08A 2D44A 5DUXA 2VY0A 1DYPA 1LU1A 4LBJA 1U0AA 3WG2A 1HLCA 1WD3A 3W58A 2AUYA 3O0VA 4TYSA 2WSUA 3NV3A 4M00A 2WLQA 3AXDA 1AX2A 3PJQA 1G9DA 3SISA 5CB7A 4FPCA 5GJ6A 3WDVA 1WW4A 1DZQA 1MS4A 4U36A 3OBTA 3PVEA 5T5JA 3WG1A 2WT2A 5DZEA 1MZ5A 2VW1A 4YM3A 4YZ1A 2JECA 1LOGA 1R1ZA 2JKBA 4LBMA 5HCAA 4YFZA 2E7TA 1DHKB 3ZSKA 3SITA 4BQ1A 1S0BA 1W6NA 2OUJA 2ARBA 2JE7A 3L2YA 3M3CA 3TAYA 4XBQA 4C1XA 1N1YA 5GM0A 4BLIA 2ZHNA 3AYCA 1Z0HA 4Y24A 1H9PA 1SBEA 1V6JA 4Y26A 2A3YA 4YGCA 3ZXFA 3AZZA 1W0OA 1AF9A 3POYA 1Q56A 1CIWA 2WKKA 5EXOA 3POWA 3QCWA 3LSDA 2OVUA 5T50A 3VKOA 1LHWA 3UK9A 3O0WA 4XE9A 1UX6A 1AVBA 3V65A 5DG1A 1JYIA 1S0CA 1JW6A 3AP5A 1VAMA 4LBLA 5GALA 3ZXJA 1W6MA 1YRZA 2BQPA 3AFKA 1GZCA 4PCRA 2DTWA 3N3HA 3AK0A 5JDBA 1UKGA 2UURA 2EF6A 2D7FA 2JDZA 4R9AA 2YXSA 2ZACA 1HQLA 4BMBA 5F9TA 3O0XA 3DUIA 4HL0A 3WG3A 1BZWA 1FATA 1N1TA 1SLIA 1W6OA 3NV1A 3WUCA 1LU2A 1DIWA 4FPKA 5GZGA 1V6OA 4MYEA 4DQAA 1I3HA 3OBRA 3WG4A 3IKWA 2ZHMA 4BPZA 2ZGLA 1VAVA 3RMYA 5JOXA 4UW4A 4XIOA 4I30A 1IKPA 1H30A 1C1FA 4YFWA 1RINA 3ZYPA 1AZDA 4BOWA 1MVEA 2YV8A 3AZVA 4XDQA 1LHNA 2D6KA 1BXHA 4XIKA 3VUOA 2NP0A 3M3QA 3WLUA 2Q5TA 1QMJA 1APNA 3IPVA 3LSEA 4FP2A 3LCPA 1SFYA 2D3SA 1AXYA 5GZDA 2DVGA 1DQ2A 3WVJA 1LOCA 2A7AA 3OJBA 4GWNA 1CR7A 3N35A 1UZZA 2ZA9A 4P9WA 5KXCA 1MS1A 4LBQA 2EXJA 1B09A 4ITCA 5JOWA 1OQ1A 2ZHKA 2A6WA 2AGSA 2ZAAA 1QDCA 5KXBA 4HANA 3WDWA 2R1DA 3APBA 4LBQB 3N7LA 1Z78A 5H9QA 4M3CB 1QOTA 1LGBA 1QU0A 2DVDA 2VW0A 4XJ8A 2D6NA 4Y1UA 1D2SA 1DQ1A 3RQ0A 4PBOA 1VLNA 3I4IA 1SACA 1QNWA 1BKZA 2DVAA 2E53A 4YZ2A 4XJUA 1C4RA 3HMYA 4XXPA 2CWMA 1PZ9A 2C5DA 3V0AA 2YY1A 2ZZJA 3INAA 4XBLA 3WDYA 2EXKA 4LBNA 2XB6C 1WW6A 1GLHA 4XHXA 4AYUA 1V6NA 5DZFA 2OW4A 2P37A 2E6VA 1S0FA
chains in the Genus database with same CATH superfamily
5FZKA 1F9KA 1S2EA 2CSGA 5A3LA 1STMA 2RS51 4DRRA 1CWPA 2WNVB 3T2QA 3W59A 1MS9A 3MW2A 4BYYA 3PUIA 1NQJA 4MH0E 3VDAA 1K12A 2B9UA 4IE5A 4AVTA 5FPAA 1XE0A 2OZJA 4IE4A 1VMHA 3BYWA 4QAWA 4BWOA 5B4NA 1PZ7A 1PVC1 1WLDA 2V73A 5H9RA 1LHOA 2VR4A 3ZPYA 2J1VA 2Q8DA 3VD5A 2YUEA 4BH9A 4UW3A 4Y1XA 1C5HA 1EAH3 1UOBA 1ZA4A 2RG4A 3VDDB 2RR12 3B94A 3EXUA 1NCRC 5CG8A 1HXS3 2XVKA 2C9KA 1VBA1 3OF1A 1GNZA 1OVPA 3H7JA 2I2SA 1KFUL 1JHNA 1N3OA 3OTFA 1LCLA 5A3OA 1H1IA 4E27A 1YQCA 3M3IA 2CGPA 2JX9A 2NN8A 1GNHA 4JGZC 4Q1PA 1RJ7A 5JI9A 5EP9A 1RMU1 4COWA 2ZGQA 1DQ5A 2H0BA 5C3RA 1LOEA 4ARXA 1BEV3 2RDNA 3N9MA 3MIDA 4H55A 4QQLA 4RHV3 4TN7A 3THCA 4AOCA 4FQZA 5LBBA 5CFDB 3LA7A 1VBD2 1GQHA 2G4IA 4AGGA 4BK4A 4A6SA 3ZFFB 2NM1A 3BI3A 4Y5Z0 4Z82A 3O1MA 4OYUA 1A8DA 2TBVA 3OGGA 5FZ8A 4ATEA 3Q8EA 3HT1A 3OG2A 1VAKA 4GZ9A 4QKNA 1ZBE2 1IKQA 1BVVA 3FL7A 3OY8B 4XUNA 3RJ2X 3SKVA 1DDLA 1UZVA 1JYNA 3B9CA 3G6JB 3JXSA 1W8OA 1GWMA 1WBLA 2O0OA 2R16A 4F3JA 5GLZA 4LTAA 3WQ1A 3WNNA 2B8MA 4RQPA 4UW6A 3FWEA 3SNMA 3UKVA 4XETA 2XWJB 4NHKA 1QHDA 2ZGUA 1W3VA 4XEZA 3D8CA 4NE9A 4YSFA 4P9YA 2JD4A 2D6OX 4XBNA 4XAAA 1L7LA 3AX4A 4AI1A 3ZSEA 1RUC1 3RZGA 5C70A 5A6QA 1Y7BA 1QEXA 4UOJA 5GLVA 2Y26A 5CBLA 1QGLA 2DURA 2DUPA 3MHZA 2WNVC 3K48A 5A32A 4IE7A 5GLTA 2HWB2 1ULDA 2FMYA 4KBBA 4FPYA 1TVGA 2ZEYA 4LHNA 1ZZBA 3RWNA 2DCJA 1MACA 3P3PA 3OD4A 3ACGA 1YI9A 2P3IA 2P5BA 3I59A 1NA1C 1SZBA 3JU9A 2ET7A 1AYM3 2EAKA 4Q4W2 1U5ZA 4C1WA 4BJ0A 1H2MA 2H0VA 3E6BA 5EQUA 3MF6A 5C9AB 3O1SA 1HQWA 2QQWA 2VVDA 4QXHA 3NVCA 2RMU2 2VTFA 2XJTA 3VL9A 1LHUA 4WVMB 2D97A 5FLIA 5C6CA 4JRLA 2KA3A 3BTXA 2XMLA 2ZGSA 1S0IA 3W5NA 1WMFA 4XPVA 1C8M3 4I0AA 4XFBA 2J22A 4HG6B 2E51A 3FLRA 1SBDA 4GMP1 5HV4A 5JXGA 4I2OA 1JZ6A 5DAWA 4E8DA 3A7QA 3DKQA 2RR13 5FK7A 1QOSA 1QIQA 2XLFA 2EXHA 1K42A 4Y1VA 1RHI1 3DXTA 1AX1A 2JENA 4BIOA 2PYTA 4XOGA 4AGRA 1NX9A 1ZA7A 3N9QA 4MGQA 5D1IA 3WP4A 1S0EA 1W8WA 4P9GA 3WNXA 4ZZ5A 5JR2A 1DGRN 3DXUA 4CP9A 1VE0A 3NV2A 3KCCA 3J7LA 1K5MB 1OFSA 4ZS3A 4BXSV 3BGAA 2WR9A 4PLOA 4RQPC 1EV13 2PLV2 2RJLA 2MPFA 2PTMA 4Q4X3 4DFSA 1RVF3 3E1F1 4GD4A 5BNPC 4H7MA 1PMHX 2UWCA 3KQRA 3VKMA 5LBFA 3PIJA 5C5TA 4FAGA 2Y6KA 2HYXA 4JZRA 4CCDA 1OA2A 1I5PA 1ACCA 1OD5A 3KZ4C 2JIJA 3UNPA 5K8SA 2JE9A 5FCCA 4YZ5A 3TBDA 1ZBA2 2VQUA 2DFBA 5A3WA 3VBHA 4Y5TA 4X8PA 2F4PA 2XJRA 2QBXA 2YBPA 4XFIA 4RS5C 2C26A 2NMOA 5HCFA 4AQ2A 5L9BA 3V0BA 4EE2A 4L2NA 3ZXLA 2ZEXA 5FAXA 1FOD3 1AL21 1KDKA 4MLOA 2X5IA 1A3KA 1JODA 3I7DA 4QM9A 3WF1A 5FIXA 3ZXKA 1HV1A 2C9AA 2QDNA 1OD3A 3DV8A 5L36A 1WCDJ 5KXEA 3WNLA 4W4ZA 2ZTNA 4GH4A 4Q5OA 1XB9A 1N3QA 1O4TA 2BNMA 3CZJA 1MPXA 2QQNA 5F1RA 2WBKA 3AJYA 3MV01 4RS5A 3O1VA 1NUKA 3WV6A 1TMF2 2WO1A 1AR63 2G9GA 5FZ0A 4OMCA 1UQXA 4LUKA 2QQOA 1ND3B 2HEWF 5BNOB 5FXXA 3A21A 3KMHA 4DRVA 2VVEA 1V9U3 2C4XA 1IPSA 2HLEA 1W6QB 3KGLA 3K3NA 4Q4W3 5FQ0B 3HBKA 3I2IA 3OBAA 2Y6HA 2FMDA 2UYAA 4GQ7A 1CAVA 4IV1B 3URFA 2PHLA 4B3NA 3I3BA 3Q8AA 4CDUC 3WDTA 1J3RA 1JXNA 2QQMA 2WAOA 4GWMA 5GZFA 5FP3A 4AEKA 4EJRA 2YBKA 2JG8C 3IDEA 1PX4A 5IVEA 4FBFA 4QHBA 3PUAA 4CDWB 5JZGC 4EQVA 2ARXA 2E7QA 1MS5A 3VBOC 3VLBB 4QWNA 1WUVA 1QDOA 1LGCA 1VBC2 4JHTA 2IXLA 5C3QA 1NLSA 3VHPA 2ZZQA 1X50A 4JGYB 3K77A 4KWKA 4NRPA 3ES4A 4LHLA 2FDFA 1I1EA 3ZIXA 4GH4C 4NRQA 4YLZA 4NR1A 1MZFA 2D98A 2LW8A 4FT8A 1BQPA 2W1WA 2JDNA 2ES3A 2WT0A 3CJXA 3Q8FA 4QPYA 4FTEA 1HRI3 1TME2 2J1AA 4QQHA 5A33A 4XDPA 1F15A 3HWJA 5ACA3 2PELA 2XJSA 3BIEA 1IS5A 4QQOA 4I01A 3ZXAC 2BVBA 5A1LA 1FAYA 5IAXA 1UMHA 3ZYFA 3H8XA 1RB8G 4JVAA 4S2DA 5IVBA 3KQ4B 4P9LA 3AZXA 1SPPB 2R041 2EXIA 1WCSA 2JJ6A 1J3QA 4A3XA 4MGIE 3NQHA 4WM8A 1NA1A 3MLJA 2JE8A 3VBRB 1XSQA 5A7SA 1VMFA 1PHMA 3H0OA 4UW5A 1XU1A 1GZWB 3AL5A 4O61A 1NA1B 2YDEA 4C90A 4QM8A 4WVVA 3SMHA 4E9KA 5LY2A 1N47A 1V00A 3RZKA 4LLFA 4BE3A 1ASJ1 4KGQA 1LODA 2DU1A 1W6PB 2GNBA 4XFAA 4L99A 4M3CE 2GNTA 4P08A 2D6PA 4AQTA 1ZRDA 1XQNA 1YIFA 1POV0 3ACLA 5L7OC 3BODA 3HN3A 1HXS2 1RUF2 2XHNA 1HDKA 2VZOA 5DQ0A 1MEC2 4LIUA 1ODNA 2R1BA 2VO5A 4QGLA 3OPWA 5FYIA 3W20A 2XWBB 3B00A 4Y1ZA 3WP5A 3POBA 1WA6X 1B35C 1EAH1 1VBB2 3MW4A 2Q8OA 2HKXA 1QJU2 3VKLA 1SFPA 1UU6A 2WN2A 3HQUA 2Y6FA 5HCBA 4NAOA 1AR62 2VAUA 2GC2A 2WZR2 1DGWA 1CAUA 3GCXA 5DUVA 2VBBA 2EALA 4P5HA 5FYYA 1QJFA 2N7GA 4YWAA 4B1MA 4RR3C 2DF7A 4XJWA 5CFCB 5K9YA 2A1XA 3WHTA 3M3EA 1EPZA 1Z7S1 2VXRA 4Q0UA 3TN91 4QX7A 1LEDA 1FNYA 2W9XA 3T3YA 1JYWA 3KHBA 4R8HA 3OYWA 5IVYA 3ZR5A 3JZVA 2WFF3 1F4AA 3GCWA 2A71A 1BK1A 4QKFA 1NXD1 4XTPA 1XNAA 4ZY9A 2OT7A 3SLIA 3WCRA 1JUIA 4B1LA 3T0AA 4N8MA 2FDIA 4ATFA 5A7NA 3AKTA 4MUVA 4JGZA 3AB0A 2FCTA 3RYPA 3LEIA 2ZGOA 5I0UA 4C0BA 5FXVA 3GNEA 4ZU7A 1RUE3 4XF0A 5L7OB 1VBC3 1SBFA 4YW5A 1AR81 3NSTA 4CP9B 4IEUA 2SLIA 3H7YA 1W0NA 1W6NB 1R1A3 3AP7A 4OLLA 1OLMA 2DCTA 3H42B 1HB4A 5CA6A 2VQ0A 1JU3A 1RUH3 2W08A 3TNPB 2K46A 1DZTA 2PLV3 1W04A 2R7EB 2LROA 2VY0A 2C24A 2VOTA 4H2AA 2QUOA 5FLJA 1OLRA 1AL22 2HWE3 3KD4A 3WG2A 2WWJA 2RDSA 2Y60A 4MGTA 1HLCA 4RS5B 1IQAA 3O0VA 4OI1A 1CGPA 1S2BA 2GU9A 4LO5B 2WLQA 4UFHA 3PJQA 4AK3A 3EBRA 5J09A 1M4WA 1MZEA 4FPCA 3O1UA 1MS4A 2ARAA 3OBTA 4JKLA 2F4LA 3PVEA 3LZZA 5T5JA 1NCQA 1WCKA 4JTOA 4UI9L 3UV9A 3H8OA 1MZ5A 1O7FA 1QJX2 4R4XA 1HW5A 1R1ZA 1S2KA 1W2UA 1UYYA 1W9YA 1A6CA 2WDBA 2WO2A 4HMZA 4IESA 4LBMA 3WEZA 3ZSKA 5JMOA 4BQ1A 1JI6A 1W6NA 2OUJA 1W8NA 2JE7A 3L2YA 1AYM1 1PO13 3DEMA 4Y24A 4GH4B 2PMWB 1PM7A 2YFUA 4IEQA 3I3QA 2A3YA 1U12A 1BMV2 3BU7A 4CCKA 1W0OA 4A4AA 1CIWA 2WKKA 5HCHA 1Y4WA 1TMF3 4NHYA 4IEYA 3GDBA 4AEDA 1WCUA 3GYDA 4XE9A 4QGMA 3V56A 4HKLA 3V65A 1RUG1 1MEC3 1S0CA 2EIBA 3AP5A 5GALA 3VD9A 4ET7A 2Q4SA 4NIAA 1XSRA 1UOFA 1NCRA 1Z7S3 1RC6A 3N3HA 1VBD1 3JB8A 3P3NA 4W8JA 4AVAA 4A41A 5LATA 4AHXA 4IEVA 1W2TA 2VTXJ 4MV2A 5BY5A 2JDZA 2WFF1 2ZACA 3VL8A 3VBRC 4CEYA 3D82A 4RR3A 2BWAA 1QJZA 2VECA 1N1TA 2VC9A 4AXOA 3M4FA 2QQUA 1DIWA 5GZGA 4NPRA 4ZZ8A 4DQAA 1E5RA 4RFRB 3WQBA 5CADA 1I3HA 3WNPA 4UFMA 2MHFA 5FY4A 5FO9B 3DPRC 1YFXA 5B2GB 4BCUA 3RMYA 4E4SA 1W3XA 5FMBA 4WVZA 1DGWX 2VVFA 5FY9A 5E1RA 5HXVA 4QXBA 3WNOA 2YB7A 2YV8A 4MGYE 3WX5A 3NKGA 3EO6A 1AR92 3ZMOA 1H2LA 1O3SA 2NP0A 3SCHA 3KT1A 2CDPA 3NO8A 2XBO3 3NJZA 5FTTC 5BNNC 4X6QB 3DPRB 2Q1FA 4NMIA 1SFYA 1ZBE3 2D3SA 5LA0A 5A32B 3IAQA 5EPAA 3RZZA 3IT8A 4IGPA 2V72A 1GR3A 2VGDA 4COZA 3ZXGA 1UYXA 5KXCA 4WM8B 1MS1A 1HN0A 3MYXA 5LA9A 2ZHKA 4LK7A 2HEVF 1F4HA 5JXIA 2O8QA 2WO3A 1QDCA 5FZBA 4HANA 1W2AX 1F2NA 1Y3TA 3BCWA 2BUKA 1W03A 3PL0A 1QOTA 3PHMA 4M3CB 5H9QA 1COV2 4QX2A 3ACIA 2XQXA 3KS7A 2Y33A 1OT5A 3RQ0A 2ZX0A 1VLNA 4PBOA 5LRRA 1ZYBA 3I4IA 1QNWA 1BKZA 2E32A 2HWB3 4LE4A 3WF3A 4CCLA 3TEWA 4B4PA 2IVIB 3LPGA 1B35B 1C4RA 1QJX3 3BB6A 4XJUA 4XXPA 3VBUB 1LNSA 2CWMA 5I91A 3V0AA 4H7LA 2YY1A 1GQPA 5KC6A 2XJVA 5FMDA 2EXKA 3AMQA 4XF1A 3ZN6A 4B8EA 1BVP1 4LBNA 2XB6C 3B93A 1GLHA 5F3GA 4CDWC 5I8TA 1VB2A 3GGLA 3HPNA 2VMEA 4HFSA 4XJ9A 2LS6A 1GMMA 4YNIA 1OLQA 1FX5A 2ZKLA 3MDPA 1AXKA 1DYOA 1CQ9A 2A6VA 3R4SA 4Q27A 1QJU1 4YGBA 4JC1A 3RZJA 1PVXA 1Y9MA 1RHI2 5BXXA 2VOXA 4BLJA 4Z2AA 1RUJ1 2JDYA 5LBCA 4FSJA 1XYPA 2Y34A 4F8AA 1Z7S2 2PXJA 5CFDC 5ABJC 4N53A 3T1LA 4BXFA 2OYZA 1CZTA 2XQRA 1GZ9A 1RUH1 1LENA 1LESA 2ZMLA 2ZGNA 2VOVA 2IUWA 4P9JA 3T09A 1Q8SA 3RYRA 3ZDVA 5EJ1B 1FNZA 1TG7A 2ZMNA 4LEJA 2WQ8A 3KV4A 2NYYA 1FPN1 1GQGA 4ZONA 2C0ZA 5FZCA 1WA4A 3U10A 5A3UA 2H6BA 2Y38A 5DDJ3 2VMFA 3NKTA 5FXZA 5K7PA 3U4XA 4D6QA 1GSLA 4D6SA 1K5MC 3BOPA 2V4VA 4PDWC 2W2IA 4B7KA 3IIIA 5AFBA 4GKYA 4R9CA 2AC1A 4K9SA 2YFZA 3WW2A 1OPOA 3HNMA 1DQ6A 1YYNA 5FUNA 5LA1A 2BNOA 1EV12 1FI2A 2GAUA 2R043 2VCBA 4OHYA 5FYTA 3GXUA 3ETPA 3JBG3 1ZRFA 1PIV1 1Y9QA 2D5FA 3M1HA 3AKRA 4N43A 4DOUA 2OQ7A 1CZSA 1N1SA 1UY3A 4HOOA 4QDRA 1XU2A 4DXSA 5T5PA 1LOAA 5HPOA 4QX3A 1AYM2 2VH9A 4FVVA 1CPMA 5DAPA 2CL2A 3JB4C 1ZBA3 2RS12 2I45A 2B39A 4NIGA 5D8AA 1RUNA 2RMU3 4MXWB 4AHZA 1CX1A 3OOXA 2BDRA 2VZTA 4YW3A 4E4HA 4B7EA 1Q8QA 3ELNA 1S1AA 4D0QA 4PJYA 2UY8A 3JUUA 1FT9A 2WT1A 4YG6A 3WHUA 2OZ6A 2XR4A 4HZFA 1MQTC 5GZEA 2CWSA 4BDVB 5AC91 3K4AA 3OGVA 2R072 4XILA 3U4SA 4P00B 4M0HA 1ALYA 4MSVA 2BNNA 2JICA 1JBCA 5FZDA 4UWDA 3AKQA 3ZN4A 4I02A 1YFUA 1OQEA 2BRTA 3CDZB 1HJFA 3AYEA 2R49A 1AL0G 1MR5A 3CNAA 4GA9A 3TEXA 1NT0A 4FTBA 1NQDA 4PLMA 4CDQC 5FZLA 1MS0A 2P3KA 3OEBA 4YVSA 5KXDA 3AP9A 3KV6A 2CGOA 2DV9A 2VUJA 3RRDA 1BYHA 3WR0A 3KWVA 4CDUB 1GP5A 2NQYA 5F6LB 2XUEA 3GZEA 3RZHA 4IV1C 2QZ2A 3A0NA 1AYN1 1C1LA 2PHXA 1YQ8A 4XJZA 1LRHA 2IFRA 3THTA 3I2OA 4CU6A 3SH5A 5ACA1 2A75A 2XJQA 2ZBJA 5A7WB 2WNUB 3UJQA 3GZUC 3NRUA 5JZGB 2TEPA 5IT6A 4BQXA 2VBPA 2E33A 1AJKA 1EUUA 4TTGA 2JDHA 5E88A 4FP3A 1I6XA 2D6MA 1YHFA 2W1UA 4LULA 1D4M3 4J1WA 4Q0PA 4XQDA 3RI8A 2FQPA 3S6PA 3JQWA 4LK6A 3ST7A 1G8WA 4LBOA 3NL1A 2W91A 3C7GA 3ZX7A 2UWBA 4TWTA 4IV3B 5IFTA 4RGAA 5FOBB 1VRH1 3KGZA 4K7JA 4IERA 3PUQA 4HSJA 1G9AA 1D0HA 5FMCA 3RPQA 2AR6A 4AFDA 5C8WA 2VD7A 3POJA 1QOOA 4ASMB 4PF5A 1ASJ2 3RS6A 4L8QA 1HRI2 1RXFA 1AR71 2JG8A 2P6CA 4OZXA 3RI9A 1YQ2A 3HBZA 4LQRA 3C7OA 3D0SA 2F17A 1ZNPA 1DYKA 1ENQA 4CVUA 3LE0A 3R6SA 2DVFA 4S2HA 4CCOA 2WWUA 1NZIA 5E16A 2G1MA 5DZGA 2LM3A 2JG9B 2OPWA 3MFAA 4NIDA 4QKDA 1Y9GA 2CU5A 1H8TB 5FUIA 3WNMA 5FDBA 1QQP3 2ZEZA 5BNPB 1S0DA 1UY4A 5AVAA 2RS32 2G9ZA 2VUCA 2ZKNA 4N53C 1DZRA 3PDQA 3BKZA 4CU9A 1GOHA 1LR5A 4TLFA 3KF5A 1FYUA 1ND3C 4CCJA 1IHMA 4YGEA 2Y0OA 1LJ7A 2ETEA 2BZDA 4GB32 3O1OA 2HWD2 1YXWA 2GC3A 3RGBA 1W8TA 1JS9A 1XXNA 2IVJA 2X29A 3WCSA 5BNNB 4FOWA 3N4MA 4K40A 4QXKA 4LLOA 1S0JA 4JCKA 4YGDA 4AEMA 1O3TA 1ONAA 4GWJA 3R4UA 1KFXL 1RUG3 3AKSA 3PVBB 2V5YA 4AI8A 1O3QA 1FMD1 4QPGB 1OKQA 2PAEA 4HPKB 5IK5A 4LXLA 4HT1T 5IATA 4QKBA 1HN1A 3MO4A 3O7OA 3VHNA 3ABZA 4P9XA 5DG2A 5FKBA 5LK5A 3HIFA 2AH2A 1N1VA 2JIGA 4AVVA 4EN9B 5LEKA 2XL7A 3B3QE 1LHVA 2ADDA 5I0TA 1XRUA 3B5LB 4AVSA 4D3WA 4CDXC 3ZFGC 2DVBA 1J3PA 1SFNA 1QJX1 2A6YA 5B4XA 2WQZC 3LFMA 3OYWB 2VNVA 4E8CA 1T6BX 3ZN5A 3S7EA 3FX3A 4N7IA 5JWPA 5EJ3A 1SEFA 3D6EA 2QQVA 4Y4RA 2VXJA 5T52A 2HWF1 3PNAA 1KJRA 3T1MA 4L11A 1JZ8A 3AZYA 5JMCA 5CKMA 1BLZA 2B7YA 4KG8A 5F5QA 2ZAHA 4NWWA 2BEOA 1QKQA 1O8PA 3EMRA 3C7FA 1RUJ3 2P6HA 4AG4A 3NJYA 5C9AC 4M3CA 3KHCA 1GZWA 4OVEA 3H3UA 2BTVC 2DCYA 2D43A 2Z2SB 4JRAA 4XQ4A 5FZ3A 1W8HA 5T5OA 5I0SA 4JQTA 4CTEA 5J7MA 3OUIA 3ENRA 3K4ZA 4FPOB 1AJOA 2OQ6A 1UY0A 4H3WA 2OKXA 4FOYA 1KQRA 3I59B 3THPA 1R1A1 4L9BA 3HAGA 3QOPA 1UXZA 3J7NA 1REDA 1JUHA 3OCPA 1OA3A 5FY7A 1UMZA 1V6LA 2NZ9A 4XCAA 4FXGB 2RS31 1J84A 1ULFA 4Q0QA 3O1PA 3LA2A 4NIIA 1YFYA 4KWUA 4QB6A 4MXWA 3ON7A 5FPBA 2VPVA 3MW3A 2VMDA 4YZ4A 2J7MA 1F35A 4M4PA 5I93A 4ISRA 4P02B 2ZOEB 3VGIA 1JU4A 2E26A 1WW7A 5T55A 4DUXA 3WQ7A 1CAUB 1NKGA 1QH7A 1T6GC 5FBJA 4YW1A 4CSWA 2YZ4A 4EWAA 4XZUG 4D69A 2GMEA 2UY9A 1A78A 2WL1A 5KHKA 4WM7A 3OGSA 1AYN3 4CXYA 2K9ZA 3LB9A 5LW9A 1EAH2 1VBB1 3RZMA 2KXLA 4COVA 4FPHA 3WUDA 1NXMA 1R093 2ARCA 1DLLA 2JDUA 2QKDA 4KNCA 4YARA 5IVCA 3TN92 3HVDA 4IEXA 5IVJA 1JYCA 1RL3A 4YVSB 1H2KA 3SHRA 4QU1A 1PVC3 3AL6A 3F2ZA 3I2HA 3ZFFA 1NE6A 3QH7A 1J1LA 3AKPA 3Q8BA 1X7NA 5FPXA 3SCFA 3TOJA 4W6WA 4NUBA 2A3WA 3ROUA 1F31A 1SLCA 2PHFA 3MIFA 3NV4A 1FV2A 5FV3A 4MX3A 2VMCA 3K4DA 3VBSC 3AFGA 5KHIA 2HWC3 1BEV2 3ZFFC 1MS3A 4EWEA 3BTAA 3ILFA 1TEIA 3WP6A 5JPMB 2ZGKA 1FOD1 2JD9A 4RYDA 2UYBA 3EYPA 3PUSA 4OHVA 4CDUA 4LA2A 4J25A 5FJHA 2GZWA 1VPHA 2GMPA 4JTNA 2Q8EA 3H1WA 5ACA2 2IXIA 4URTA 2DTYA 5A6XA 2UU8A 3OSDA 2BPA2 5A3MA 3BU0A 1MS8A 2JEMA 2WA3A 3ZN6B 3ZXEA 1X8MA 1OHFA 2IFWA 4PT6A 2VZQA 2ADEA 1WBFA 5FMOS 4URAA 4XZPA 3I3MA 4IEPA 4FOQA 5DUXA 1XE8A 1LU1A 4LBJA 4BU2A 4XF9A 1WD3A 3PTRB 2YHJA 1YWKA 4IEOA 3CJIC 4TYSA 5FJKA 2WSUA 3IAPA 3W58A 1CZVA 3NV3A 4Q4Y1 2BW8A 1QJY3 1U5YA 4M00A 1CAVB 3AXDA 4HBNA 3OBZA 1RUC3 3N9LA 4XW3A 3VBOB 2X05A 4J1XA 1V70A 1UW8A 2DBNA 3SISA 5FWJA 4UYBA 3WDVA 3S5QA 2BOIA 3ZFEB 2VZ3A 5FYVA 3PU8A 2X10A 4Q4X1 4CA9A 4YM3A 3PURA 1PIV2 3WT3A 1VBE3 2JKBA 2XVGA 3W5MA 5J37A 5BNQA 3O1TA 2JG9C 4YFZA 1O5LA 5C9AA 2P4EA 3SITA 1A34A 3B02A 4I09A 3M7AA 4IE6A 5FZGA 2DCKA 3M3CA 4YPJA 4AQ6A 4C1XA 4XBQA 4DXRA 3AC0A 5F3IA 1FPN2 5J48A 1H9PA 2KR2A 2J1EA 4OHZA 3ZXFA 1NY71 1M06G 3AZZA 3ZPOA 4XFFA 5A7PA 2QQPA 2BBAA 2RS52 3ITQA 4JDMA 4ZXEA 3I3EA 1ZZ9A 3WQ0A 3ZO0B 1OOPC 2X53S 3CHXA 3QCWA 1EP0A 2OVUA 4LO6B 5T50A 3UK9A 1RYYA 4N43B 2R30A 4J6GA 5DG1A 2MNGA 4META 2QCSB 2J1UA 5K4LA 4RD7A 5C5UA 4PCRA 1O3RA 2JDAA 1PGSA 1TZOA 2WIIB 5C71A 2BGOA 3AK0A 1UKGA 1UCXA 4HSLA 2W1SA 2EF6A 2B42B 3TWIA 4AL9A 4YW7A 5JIAA 4ASLA 5F9TA 2ZX1A 4HL0A 4E4DX 2VCMA 1FATA 1SLIA 1W6OA 2QQLA 2VNRA 3NV1A 4AHWA 4BZ4A 4Y5SA 3NAPA 3ZIWA 2K0GA 5CIRA 3BOWA 3BUCA 4PLNA 3WG4A 4CXXA 1ENXA 2HBTA 5JOXA 4UW4A 4XIOA 3LIHA 4I30A 1UU5A 1C1FA 3LEGA 4S2FA 2HWF3 1AR83 2ZEWA 3B9IA 1XNTA 1AZDA 3KSCA 1MVEA 1J58A 2H6CA 3WXPA 4XDQA 4HXCA 5EV7A 1BXHA 4KU8A 4DMIA 3U11A 2BGPA 2IXJA 1QMJA 3IPVA 3FZ3A 4XDOA 1C28A 1SDDB 2DBIA 3DF0A 3LCPA 4PI2A 3ZOIA 1AXYA 4NJ4A 3VDCA 1DQ2A 3JD71 1LOCA 2A7AA 3OJBA 4QMAA 2CDOA 4MHUA 4Q4Y3 3VHRA 4EWDA 2EA7A 1W05A 2ZA9A 4KWJA 5FY5A 1MQTB 1NY72 4I3PA 1PO12 3C3VA 4LBQA 1H6YA 1E57A 1B09A 2YU1A 4WBBA 3T08A 5CFCA 1RHI3 4AI9A 2XXZA 4F7ZA 2AGSA 2WNUA 4C91A 5KXBA 3WDWA 4I3GA 4LBQB 5CYYA 1H4GA 1V9U2 1QU0A 1LGBA 2XHKA 3JD72 4XJ8A 2D6NA 4Y1UA 4AQSA 1D2SA 1F5JA 2B46X 2RE9A 4IV3A 4RHV2 5KWRA 5JPNB 2DVAA 2E53A 2VZVA 2ZX4A 1AR61 4LO7A 1VBC1 4YZ2A 4CPBA 5HV0A 3HMYA 5IVVA 2OPKA 2OX0A 2HJIA 2C5DA 1NYWA 3INAA 4XF3A 5BPXA 4A7KA 2W94A 3KV5A 3WDYA 1RJ8A 4JHZA 2GH2A 4RGKA 5IJRA 4BQYA 5C3PA 3U07A 3GBFA 2ZJCA 3BTZA 1WW6A 4AYUA 1V6NA 5DZFA 1TNFA 3I2DA 3MFCA 4Y1YA 1S0FA 1NLQA 3O14A 4NROA 4OCTA 3VBHC 3GBWA 5J3UA 3HNBM 1CONA 4M3CF 5HBAA 2C6SA 4GALA 2W92A 1WWYA 4PBPA 4LHSA 1UY1A 4W6XA 5IK4A 2AYHA 1RUE1 1URXA 5BNPA 1HRV2 4A6OA 2CTVA 3C2UA 1C57A 4P14A 3MPPG 2GNMA 4IW3A 4ONUA 4I0BA 2JKXA 4CDQA 1XYOA 4YM2A 3S7IA 1RUI2 5F37A 3FMGA 2YG0A 3RWKX 5T3NA 2XBO2 2QQIA 5FPZA 1PO11 4NRMA 5BNNA 5FREA 2GP5A 3Q9OA 3OD0A 2QVSB 2BJSA 2JDKA 4LORA 5FBZA 2R073 1KDMA 2HWC1 4XC9A 4BHPA 2Q8CA 3IDCB 4FPFA 5EYYA 4CEYB 1OUSA 1Q5OA 1WLWA 2WAAA 3POEA 4NOTA 4XHBA 1ZRCA 2ZMKA 4YVWA 3V64A 4UF0A 4HLTA 2PA7A 3J8F2 3K51A 3MEPA 4XYXA 1JYTA 2XKPA 1N3PA 2BGCA 1W06A 2XOMA 5SV8A 2PHDA 1BBT3 3TNQA 5FOJB 3TB0A 5DAVA 1WMXA 3THDA 5IYYA 1Q8OA 3E5UA 1OF4A 1R081 1RITA 3D4KA 4Y22B 2VZRA 3LPFA 5DUUA 1ZRIA 2PHUA 3GJBA 1CPNA 2R062 4YVWC 4PIXA 1VIWB 2Y6GA 2YU2A 1AUYA 1ULEA 4Q4Y2 1TNRA 4TLGA 4JDNA 3VBSB 3IMNA 1QQP1 2CV6A 3RJRA 3LEKA 4CPBD 5FY1A 4OHXA 1V9U1 2Q1MA 2BV4A 1CAWB 1XNBA 1O8SA 5DAQA 2R6QA 5K0UA 2IXKA 3A23A 2WLPA 1PNFA 4UBHA 4YM0A 1MEC1 3CQOA 2ZS6B 4Q1RA 1UOGA 3WP3A 3POSA 2WC2A 3KT7A 1OQDA 4C0HA 5A70A 2QQJA 5A80A 1JN2P 2IXCA 4XUOA 2B9VA 4LT5A 2GH8A 3RG0A 1KEXA 3PIGA 3KCYA 1OBNA 2XGXA 4LHKA 4CYDA 2EAAA 5LB6A 1OLME 5JVVA 1DGLA 1LULA 5KC5A 4M4RA 4CCCA 4PIYA 4CUCA 2GN3A 4MOAA 1DQ4A 2A5ZA 2VZUA 1QF3A 3DGTA 4LA3A 5LASA 2FD8A 1RXGA 5ERLA 3WINE 4Y4YA 4DINB 3B7MA 3G7DA 3PVOA 2JXAA 4E4ZA 3U78A 1XJAA 1IS6A 3ATGA 3CBNA 1DCSA 1GOFA 1W6MB 2MEV1 1Q8VA 1DG6A 2RM23 3VDDC 3MUY1 2FHRA 2VE1A 1NOVA 2VL4A 1SLLA 3L2HA 1UU4A 1K5MA 1G9CA 2CAVA 5DMYA 2BYVE 1O4YA 5F5IA 4LOTA 4L97A 2QJVA 2GDFA 2LTNA 3CJIA 1ENSA 4N7UA 2JWPA 4QDQA 4NHLA 2HWE2 4AI0A 2G9FA 4YZ3A 1WW5A 1YCIA 2P3JA 1H8TC 2PAKA 3WD5A 2RV9A 4QX1A 2XVLA 4MZUA 1RUC2 1PNGA 3M70A 2Z42A 1K45A 4EV0A 2PLV1 3CU7A 3VZNA 5G05L 2RS13 2W0XA 3K2OA 1RMU3 4CCNA 2WWSA 5AFEA 1YQ6A 3FHAA 2FDHA 3OY8A 4KWLA 5DUWA 1LOFC 1SLBA 4RFT0 4YM1A 1P8JA 5L9VA 1GP6A 4CEWB 1W8FA 4IGOA 3VBFC 3MICA 4JKKA 2LALA 4U2AA 1PX3A 3E5QA 3ZYIB 3ZYGA 4L0PA 4XMIA 4BQ4A 1W90A 3UL2A 5IK7A 1PGL1 2LUWA 5JSOA 3CLPA 2BP6A 2J1TA 4GB31 2A3XA 4WM7B 4E2QA 1UWWA 1SMVA 4XXAA 1GICA 3S5AA 5HXMA 2FCUA 1JZ4A 1IQDC 1YFWA 3VN4A 1LAJA 1ZZ7A 5FZOA 2JDMA 4UFJA 1ULGA 2W39A 1KS5A 3VKFC 3Q8CA 1O91A 2VM9A 1W0PA 3H3LA 1HIXA 1W8UA 1JOJA 1ZBE1 4BB3A 2Y6JA 2GSYA 3JD73 2PQQA 5I8SA 3T30A 3TN93 4XVHA 2YC4A 1R092 1OH3A 4K1YA 2FZ1A 3C7HA 2FBEA 3RZLA 4JQRA 2DYCA 4IGQA 1IG0A 3VZLA 2OS2A 5F7UA 1UKRA 2VQAA 1G9BA 3VDDA 1YJKA 3OPZA 3N7MA 4L92A 3DPRA 4QPIB 3AYAA 3HR9A 4W50A 1SPPA 2W3JA 2CY6A 5IUQA 3LAGA 1BEV1 3WF2A 3EHKA 2BFUS 3OGRA 1C8M2 1ND2B 4EYUA 2EIGA 4HVQA 4UFLA 3FE5A 4AWDA 4QHOA 3DECA 2YGLA 4FPGA 3HNYM 4ZU5A 1W99A 2VG9A 4HKWA 1D4M2 1XNDA 1RUD2 2D3RA 3DYOA 4LKEA 5FYMA 4DS0A 3VD4A 1ULCA 4AEDB 4OUSA 4QB2A 4RGGA 2J1SA 4ARYA 5J1XA 1IZ3A 3UKTA 3KB5A 5C3SA 4BK5A 4KBZA 2TUNA 3QLQA 1YO8A 2NMNA 1IS3A 1W28A 2AREA 3WF0A 3VZOA 2VMIA 5AC93 2W95A 1W6QA 1QJEA 3T2PA 1LTEA 1QNYA 3OUHA 1MQTA 4QPWA 3VBUA 3ZFEC 1JOBA 5A6ZA 1PO21 1SQ4A 4YYOA 5T5LA 1G9FA 1IS4A 2W68A 1VBA2 3LGRA 4JV4A 5IFPA 3AMMA 2ZGTA 2DCZA 2VMGA 4Y3OA 1V6MA 2WABA 5GLWA 1ZM1A 5DDJ2 2P17A 2XLGA 1AR73 4NAMA 3ECQA 1VMJA 4RL7A 4W65A 1S55A 2I07B 3ZYBA 2W46A 4QX5A 1UPIA 2ID4A 1YJLA 1S0GA 1PMIA 3OPTA 3WZ1A 5FZ6A 4XJAA 4ZPIA 1RMU2 3RYKA 1LGNA 1GANA 2XL9A 5C8CC 3VBOA 5TSWA 2EIEA 4PHZA 3U1XA 4Q8LA 4CZSA 1REFA 3KCXA 4NIHA 2B5HA 5DDJ1 3SKJE 3GZAA 5F2SA 2GMMA 2ENRA 5C4WB 1X33A 2WNUC 2XG3A 4OI4A 3NW4A 5FZFA 5JAXA 3LF7A 1D2QA 3WDUA 1ENRA 3E97A 2BOJA 2ZGMA 1PIV3 5JSPA 4DUVA 2RDRA 2ZGRA 4RN5A 4BMEA 3LKJA 4OULA 1ZZ6A 3K3OA 3WY6A 4PQ9A 3MZHA 3I2FA 2QZ3A 4CUAA 1POQA 2W5FA 4G9SB 4OMDA 5A3PA 5IW0A 3FHIB 1G86A 2Q30A 3QH6A 4V1PA 1VBE1 2RMU1 5E89A 5FYCA 1O5UA 4ASKA 4NHXA 4EZHA 2RVAA 3V0AB 4XCBA 4IXLA 1C8M1 3VBSA 5IVFA 3RDIA 5FXWA 2VTXA 4GMP3 3R05A 4IDZA 4UT5A 1FOD2 3VKNA 3ZLIA 4F83A 3KLSA 5DXDA 3ASIA 1QH6A 4CP1A 2RM22 1V0AA 3CEWA 1KGYA 5FZIA 3AP4A 4CRQA 4DPNA 4XABA 1SDWA 1UOJA 1VP6A 4QQ2A 2WS91 4AEJA 2KD7A 4Z92B 1VBA3 4IV3C 4QXCA 3IB3A 3JBG2 4TZDA 1WD4A 1PGW2 2DFCA 2R042 5F39A 3A4UA 2DUOA 1JZ7A 3UGHA 1VBD3 1ODMA 3ACFA 3T4HB 5FZ1A 1V6IA 4ZKTB 3POFA 5DPNA 2AZ5A 1B35A 1QXJA 3J9SA 3LDBA 1J1TA 4K1ZA 3GJAA 2PAMA 1EV11 3MIBA 2W52A 1HB1A 4K8RB 5AC92 1X8EA 3M8LA 4KGGA 3ILRA 1AR93 4WZCA 5CNAA 1HQNA 4CDXB 1PZ8A 3OEAA 4CXWA 1JYVA 4RHV1 5L7OA 4HK9A 4AI2A 4YVSC 1UPSA 5KBFA 4PDWB 4FO9A 4TSVA 3WDXA 4HVRA 4HN1A 4COYA 3SCGA 3DN7A 1VRBA 1LOBA 2FCVA 2WJSA 1ZREA 2YC2A 5EYXA 3VDBA 4CEYC 4EN8B 4LO4B 1US3A 3ZSJA 2Z4FA 2KM2A 1V6KA 3AZWA 2RR11 1D0GA 2IWGB 3IN9A 4MG2A 5CISA 5F3CA 4A44A 1WGPA 3IDAA 2D44A 2O1QA 4R52A 1WZXA 3DYPA 1C5IA 5EHDA 2VNOA 1LB2A 2AUYA 5FZOB 3K46A 5K0UB 1PGW1 1L3JA 5BNOC 1AX2A 1NCQB 2F6BA 4HVOA 4H14A 1JMUB 2X8KA 3ZYJB 5F6KA 5GJ6A 1WW4A 1RGSA 1DZQA 1U5IA 3IBMA 4BQWA 1OH4A 5EZWA 4AR2A 2WT2A 4SBVA 2HWD3 2RJ2A 3P6BA 1VBB3 1WMDA 1G6NA 3CL1A 5FP4A 1LOGA 5HCAA 4XF4A 2E7TA 4QB1A 4WM8C 4KMQA 1ULOA 4XACA 5CU1A 1S0BA 3J7HA 2ARBA 2WNVA 4A42A 3MF9A 1IG3A 3TAYA 3BN6A 4KL1A 2ZHNA 1VJ2A 4K3UA 5CKQA 3WW1A 1CX4A 2VBDA 1V6JA 4LE3A 4FFGA 5FYUA 4LPLA 2OA2A 5LZ6A 1OXCA 1REEA 3POYA 2YC0A 1E5IA 2XJPA 5EXOA 3POWA 4JGYA 2ET1A 1O59A 1LHWA 2RS33 1AL23 2WQ4A 2E9QA 2WS93 2Z79A 1UX6A 3O0WA 5CFDA 1JYIA 1QXPA 3ZXJA 2VUDA 4LBLA 1FMD3 5FYSA 3W21A 1RUF3 4UBGA 3LWCA 2BQPA 3FJSA 1GZCA 1VRH2 2ZPXA 2DTWA 4G4FA 4JAAA 1W9TA 4MADA 4MGZE 4RR3B 3SXWA 3QD6A 1UY2A 1X36A 5ABJA 5CFCC 4QT6A 5JDBA 3PUHA 4CE8A 4JDOA 4C8DA 1D7PM 1HQLA 3NNFA 1H2NA 3J26N 1NLRA 3GBGA 3O0XA 4XURA 4BMBA 1ND2A 2V4AA 3L9JT 1YNAA 3WG3A 1BZWA 3WUCA 4CCEA 5ABJB 5A1FA 1KXGA 2WZR3 1LU2A 2ZCWA 3GM8A 5LK7B 4CDWA 2VCAA 4MYEA 1D4VB 4INDA 2W1QA 3MPBA 3OBRA 3ZFGB 3SC7X 1PO22 4BPZA 1Q43A 1YUDA 5FYHA 4E2SA 1ND3A 1PMJX 2MEV3 4QGNA 3ZDSA 3J8F3 3DL3A 1IKPA 3ZXDA 4DUWA 3ZYPA 2WFF2 4GMP0 2WYSA 4CDQB 2VMHA 3CIHA 4O9GA 5LA2A 5A1AA 2QNKA 3H1YA 4BOWA 4DXZA 3BTYA 3ZR6A 2P1BA 3LOIA 4PIZA 1LHNA 5C8CB 1H4HA 3IMMA 4XIKA 3VUOA 4FFIA 3BVCA 4GAZA 3NJVA 3SEPA 4B4QA 4LMFA 1XC6A 3WLUA 1T2XA 2ZX3A 5IHRA 5EJZB 4COUA 1HJGA 4FP2A 1QY4A 4Q4V1 1ZZCA 4LR4A 2DVGA 3WF4A 1RUE2 2WINB 2EVXA 2IZWA 4GWNA 1CR7A 3N35A 4BQ5A 1QJY1 1UZZA 1GZTA 1R082 4V2VA 4QD2A 4HPKA 2EXJA 4QPGA 1VR3A 4UFIA 4CU7A 4QX0A 4LIVA 5DAXA 1HRV3 2AACA 1XPWA 4IEWA 2R1DA 2WYFA 3APBA 4CCMA 3N7LA 2J1RA 1Z78A 2WN3A 3I97A 4KH9A 2DVDA 2VW0A 4UAPA 4D94A 1DQ1A 3MV11 5L19A 2AEZA 5G04L 4HKOA 2XDVA 5DN2A 4AE2A 4EN6B 5FP8A 2QQKA 3NNGA 3LD8A 4DY5A 4DNYA 1FMD2 1CAWA 1PZ9A 2ZZJA 1ZZ8A 5APAA 4CEWC 5ANNA 3U0ZA 4O9EA 3MLLA 4WVMA 2ATFA 2WUHA 4XHXA 2JG9A 2WZ8A 4JGZB 2RS11 3H8RA 4XFGA 2P37A 2E6VA 2QE3A 1POV3 2VQTA 3J7MA 2HWE1 4XFHA 3VHOA 5CEHA 1X9PA 3PMSA 1DF0A 1GNYA 2SBAA 3B01A 2ORZA 4LJHA 3FLTA 4AFCA 3P5BA 4UF0B 1ZX5A 2WFPA 3HEIA 4AZZA 2FDGA 5FZ9A 3MIEA 3AXEA 3ZM8A 2IXHA 2X09A 1GP4A 2XONA 4ES8A 4AW7A 3MIHA 1W6PA 3NJXA 3U14A 3N36A 4AAXA 4D7SA 2VU9A 3DKWA 3O1RA 3IZOA 3ZKUA 4OI0A 1MVQA 4QDSA 1YI7A 4CP0A 3FBYA 4LNVA 2RJKA 3JQXA 1XNCA 4GWIA 3FUOA 2RHPA 3U75A 1PK6A 5CG9A 3FC0A 4X6RB 4LKSA 4TXWA 5FP9A 2FZ2A 1GOGA 3S0MA 4CDXA 4FFHA 4PDWA 4D6RA 1J59A 2WZEA 5C4WC 4A3ZA 2QFEA 3VV1A 1GV9A 5SV5A 4FOVA 4B4RA 4BQ2A 1HB3A 2HBUA 3E6CC 2B4KA 3ETQA 4YW2A 3VBFA 1W6OB 2JDPA 3DCQA 1XYNA 1JYXA 3POIA 2R0HA 2ZABA 3H1MA 3ES1A 4B29A 1OSGA 1COV1 3ORJA 1GU3A 4FTSA 2TNFA 1L7QA 1AR91 1F5FA 3MBWA 1O4ZA 3AYDA 3PTYA 4MVTA 2VULA 3FUQA 4XTMA 3I2GA 2ORXA 3H8UA 4GULA 1UIKA 2C1FA 3GHNA 3AM2A 5F5CA 1DU3D 1G7YA 1OFNA 4DZGA 3NNMA 3UYJA 3T0DA 4HONA 4NVPA 3V0BB 1MZ6A 5FPLA 4CEWA 5GKAC 5FQ0A 1EPWA 1US2A 2CYFA 2GALA 4Z07A 2D5HA 3AJZA 2D6LX 3AMPA 4EN7B 2V09A 3H50A 3IWZA 4D7TA 3GZTB 2YYOA 4FQ4A 1SLTA 1NZCA 3J8F1 4ES9A 3N9OA 5A7QA 1OI6A 1UD1A 3I3DA 1RUI1 1R1A2 3ZYRA 1SCSA 2DWRA 2R061 4DXTA 4NPLA 3IDBB 2RDQA 3PJYA 4RA0A 3ZFGA 1CJPA 1QQP2 3HN1A 3OGJA 1LOFA 5KR7A 2WA4A 1OKOA 1KD7A 2HH9A 4Q4V3 2W47A 4LBKA 3VZKA 5CAZA 1C3HA 4XUTA 5CZKA 1EYBA 1BMV1 4AFBA 3C7EA 4FFFA 1NG0A 2BVVA 3B69A 2EIDA 2ZHLA 4A45A 2YMZA 2DU0A 1H1MA 3OB8A 4FPEA 4IETA 1JTZX 3SEEA 3FFQA 3KF3A 3SH3A 4R9BA 5FR3A 5FPUA 3SH4A 3LIGA 4OUMA 1HRV1 3ZSMA 5JXHA 3CZUA 4G3YC 2JB8A 4AHYA 2VW2A 5F2WA 1WCQA 1C8NA 1OPMA 1W2OA 4K21A 2IC1A 1W9WA 3LDKA 3LFIA 1UL9A 4ISQA 4UXAA 2HWB1 5FP7A 2GC1A 4AF9A 4ZHNA 5A7WA 4IEZA 5I0DA 4P9IA 2Y0IA 3NNJA 4GKXA 4Q2FA 3GALA 3UGFA 1FPN3 3HOBA 3EB7A 5ANQA 5FKCA 4Z2WA 1U5XA 5KHHA 4AFMA 5I0RA 2ZXQA 2MEV2 2XH6A 5BUVA 5FLHA 4W6YA 2D3PA 4P5YA 3VBHB 2WNOA 2J42A 2E63A 3ME2A 3QACA 3NWKA 5IAVA 1AHSA 1IPJA 3FHQA 5KHGA 2BFUL 4JGYC 1VBE2 5D8AB 1YIPA 3VBUC 4Q0SA 3MGUA 3ZFEA 5C4WA 3ZVXA 2OUHA 4CUBA 4DEQA 5BYNA 1Q3EA 5FZHA 4DY3A 1X82A 1BBT1 1CIYA 4FI9A 3CMGA 4UFKA 3T0BA 3USUB 4A7YA 3VZMA 3RVHA 4AGVA 5C3OA 2YPJA 3IIAA 4ZXKA 4OQ8A 4XUPA 5A7OA 1NE4A 1JZ2A 2HWD1 5FYBA 2XPJA 3R4DB 3KV9A 3O5SA 5LRSA 2AENA 1FV3A 2PFWA 4HN0A 3ZMNA 5FUPA 4Q8KA 3S57A 3QBQA 3LDRA 4XAEA 4BISA 4N9IA 1BJQA 1YLLA 4AFAA 2P2KA 4MHRA 2Q0AA 3O12A 4K8FA 4LKFA 5T54A 1UYZA 2Y64A 3FBMA 3ZKYA 1TME3 2WSVA 2UWAA 1VALA 4I0WB 5I8YA 3FFZA 2GC0A 5FYZA 3I8TA 4AAPA 3N9NA 3POGA 2P3YA 1RUJ2 3USUA 1GWKA 4NHMA 1I9RA 1SG3A 1UF2C 4WVWA 4KU7A 4FAHA 4RQPB 1LEMA 2A70A 4MGKE 4Y20B 4FPLA 4QPIC 2GNDA 5DABA 2WRAA 3RMXA 1AR72 4DO0A 5M0TA 2FDKA 5FRAA 5J98B 1F8VA 3PVNA 3I2KA 1IPKA 3VBFB 2CNAA 1HXS1 1OOPA 2OIIA 2A6XA 4Y20A 1AR82 5EWSA 3BIWE 4ORFA 4CP2A 3K75B 1DBNA 5LBEA 2XLAA 1KRIA 1GYKA 1E5SA 1AYN2 1RVF2 3VB9A 2A73B 3MIGA 1OA4A 2PHRA 1J83A 1UN1A 3RSJA 1EY2A 4SLIA 2P34A 4S2GA 1OVSA 1UZYA 1K3IA 2VZSA 1CAXA 2XJUA 2YBSA 1UNBA 1COV3 5D2AA 3UJOA 4ZS2A 5FZEA 1NAEA 5LCWL 5L9RA 4OFGA 1CN1A 2HYKA 4Z8BA 1LECA 1OMIA 2PHWA 2YPDA 2DDUA 1QJU3 3A22A 4JX0A 1BCXA 1UX7A 3KVAA 4OI2A 1TMF1 1R083 1EUTA 5FY0A 4BM8A 4DEVA 2VUAA 1W9FA 1OURA 1I5ZA 1WLCA 3E6DA 4OUEA 4MGSA 4V2WA 1AX0A 1OOPB 2ZGPA 4M01A 5FZ7A 3RNSA 3N7KA 4YG0A 4FPJA 1L7RA 2VNGA 4O65A 3WOGA 1CVNA 2BU9A 1GWLA 3J4UH 3N7JA 1DQ0A 4MO3M 5IK8A 4R9DA 1BBT2 5FO7B 4O7XA 4OQ9A 2R071 2WZR1 3SQOA 1PK6B 3EQEA 1ULPA 1WKYA 3TYJA 5ISLA 1OC1A 2FDJA 4OHWA 2OXBA 3AMHA 3IPVB 3NAPC 4QQPA 1AXZA 5F8PA 5FFOC 2DUQA 1A8MA 5H9SA 1QWRA 1XE7A 2BBVA 1HKDA 4IQPA 5L73A 1S4CA 2BWCA 4N90A 5CVRA 1RUF1 3WSOA 2ZX2A 3ALQA 4K20A 4XUQA 2QTWB 3R0RA 4NN0A 4GXLA 4Q4X2 4QU2A 5E6HA 5H9PA 3T2TA 3LOBA 1ST8A 5JXJA 5JOYA 2RM21 1UIJA 1GBGA 3AP6A 5C33A 5JOZA 1JZ3A 2VOKA 3ILNA 3M2MA 2G19A 1UZWA 2R0FA 2JB4A 1RUD3 2RS53 2W87A 2NPIA 2WZPP 1PK6C 2VCCA 5FWEA 4KI5M 2PHTA 2YROA 1Q8PA 2VZPA 3AVRA 1TQ5A 1KJLA 4YW4A 4AI3A 1VB4A 5C8CA 1BHGA 1SLAA 5LEJA 5GZCA 3GF6A 2AEYA 4N9HA 5FZMA 1RIRA 3U37A 1NCRB 1PGL2 3IM0A 4LBQD 2X5IC 4Y22A 5A3TA 1DFQA 2WNEA 4Q26A 3A0KA 3D0JA 3M3OA 3P1IA 4QPIA 1VRH3 1SCRA 2A6ZA 2K2SA 5JCTA 3PMEA 3TEYA 4NPMA 2XBO1 1H1AA 3T2OA 4DIQA 1W39A 3WW3A 3VBRA 1GFF2 4Y33A 4R4ZA 4D7YA 4YVWB 4A7ZA 5CKNA 3HQRA 2EICA 3MUZ1 2ERFA 4LUMA 3D3AA 1H8VA 3BPSA 4NO4A 4WM7C 2Y8KA 1HV0A 1PO23 4N43C 2D40A 1X9TA 2HWF2 4YG3A 3OUJA 1GKBA 1H9WA 1H6XA 2BERA 3D5OA 4CU8A 2V5DA 5JLVA 1E5HA 1POV1 1DGRA 4Q29A 3WNKA 3TEZA 1W9SA 4EROA 3ZSLA 2GN7A 4WV8A 1UMIA 1YEWA 3F95A 4PQQA 4GIQA 4WZFA 1RUOA 3KM5A 1UAIA 1OUXA 4XFCA 1PVC2 2GP3A 4JKMA 2LRPA 5JZGA 5AVPA 5J36A 5FZ4A 4K6BA 4IUGA 1HRI1 1JOPA 2ILMA 1ZBA1 4XMAA 2QDRA 5GLUA 5JR7B 5C7GA 1KITA 3CF6E 1IOAA 4BIFA 5E8AA 2B45X 1CESA 3FLPA 1DLCA 1LKNA 4PF1A 4FCAA 1DYPA 2E7AA 2CGNA 1U0AA 5F5AA 5FPVA 1R64A 3HJRA 3UGGA 2HWC2 1CJDA 4MXVA 5JI7A 4LO8A 1G9DA 2E31A 3HD8B 3KT4A 5CB7A 5A3NA 3LA3A 3HT2A 1PM4A 2JG8B 4U36A 1JH5A 2Q1ZB 5HI0A 3E5XA 1SHWB 3WG1A 5DZEA 3H9AA 4LKDA 2VW1A 1RVF1 4FXKB 2WO7A 1RUD1 2Z69A 4YZ1A 5A6YA 1ZRRA 2JECA 1ASJ3 1DHKB 1GUIA 2O14A 3UKNA 3BALA 4LITA 4QPGC 5EFUA 4NWVA 4Q4W1 2PQSA 4KQ7A 1UO9A 4QX8A 3HQXA 4E2GA 2NLRA 4AEDC 1N1YA 3MLKA 5GM0A 3NMBA 3AYCA 4Q0VA 1Z0HA 3VD7A 1W8ZA 3TRSB 4BLIA 1SBEA 4Y26A 3PLQA 4IL7A 4YGCA 1YC61 2I74A 2VJXA 4EN0A 2XKOA 1TME1 1AF9A 1Q56A 1CD3G 1HX6A 1ND2C 2YGMA 5FO8B 3LSDA 5A33B 3N9PA 3VKOA 2L9LA 1HB2A 3BPZA 2PN5A 3DYMA 1AVBA 1RTVA 4N53B 1JW6A 1VAMA 3CKHA 2R32A 1W6MA 1YRZA 4ZU4A 1RUI3 3AFKA 4BA6A 3LEMA 3S30A 3FN9A 3I54A 5EIYB 5LWBA 2UURA 1NCQC 3GHMA 3ZYHA 1YQ5A 2D7FA 4R9AA 2YXSA 4XQWA 5JIUA 4HK8A 2XUMA 3DUIA 3RFRA 3UESA 1WLTA 1UYPA 1H8TA 4FPKA 1V6OA 1W2NA 1RUG2 4X8NA 1R091 3IKWA 1WMEA 4IE0A 2ZHMA 5F3EA 1KS4A 1VAVA 1XNKA 3MI8A 3NAPB 3UT0A 1H30A 1ZVFA 3ACHA 2O8OA 4YFWA 1RINA 4A2UA 4CUGA 4GB33 4D8MA 1QJY2 3PU3A 4QHZA 1CAXB 2HEYF 3AZVA 1Y43B 2D6KA 4EZ4A 4YRDA 1BK0A 5BNOA 3M3QA 2Q5TA 2VOWA 1APNA 3LSEA 5IWFA 2CAUA 3KVBA 2Y6LA 1D4M1 1QXRA 1UZ0A 5FZAA 5GZDA 4AVCA 3WVJA 4BQ3A 1XOYA 5FK8A 4GJZA 5LY1A 3JBG1 3W9AA 4HETA 4YW6A 3LQCA 5FY8A 3CJIB 4GJYA 4P9WA 4RSUA 3USSA 3WW4A 3VD3A 5JOWA 4ITCA 4AVBA 1OQ1A 1H0BA 1UXXX 3I2JA 2A6WA 3AMNA 1FXZA 1OF3A 1RUH2 3X29B 2ZAAA 5K0UC 3H3ZA 4PI0A 3VZJA 1DP0A 5JUVA 2VZ1A 1XBFA 3CO2A 3T4VA 5J96B 3AVSA 3EJKA 4DB5A 4Q4V2 1IGOA 1SACA 3C8XA 5F32A 2WS92 4OZOA 2D93A 3NNLA 5FMOL 4M0NA 1O6UA 1JZ5A 4KG0A 2R063 4XBLA 2X5IB 5JSRA 3I49A 4IV1A 1TE1B 1JHJA 4LOSA 3JCIA 5D8AC 3UETA 4Z1VA 5BV6A 2OW4A 5D21A 5KHJA 1K5JA 2CHHA 2ZGLA 2Z5WA
chains in the Genus database with same CATH topology
1F9KA 5A3LA 2RS51 4DRRA 2WNVB 3W59A 1MS9A 3MW2A 4BYYA 1NQJA 4MH0E 2B9UA 4AVTA 2OZJA 4BWOA 1PZ7A 1PVC1 1WLDA 2V73A 5H9RA 1LHOA 3ZPYA 2YUEA 4BH9A 4UW3A 4Y1XA 1C5HA 1EAH3 1ZA4A 3VDDB 2RR12 3B94A 3EXUA 1NCRC 5CG8A 1HXS3 2XVKA 1VBA1 3OF1A 1GNZA 3H7JA 2I2SA 1KFUL 1JHNA 1N3OA 3OTFA 1LCLA 1H1IA 4E27A 3M3IA 2CGPA 2JX9A 2NN8A 1GNHA 4JGZC 4Q1PA 1RJ7A 5JI9A 1RMU1 4COWA 2ZGQA 1DQ5A 2H0BA 1LOEA 1BEV3 4H55A 4RHV3 3MIDA 4QQLA 5CFDB 4FQZA 3LA7A 1VBD2 1GQHA 2G4IA 4AGGA 3ZFFB 2NM1A 4Y5Z0 4Z82A 1A8DA 2TBVA 3OGGA 4ATEA 3HT1A 1VAKA 1ZBE2 1IKQA 1BVVA 3OY8B 3RJ2X 1DDLA 3B9CA 3G6JB 1WBLA 2O0OA 2R16A 4F3JA 5GLZA 4LTAA 3WQ1A 2B8MA 4RQPA 4UW6A 3FWEA 3SNMA 3UKVA 4XETA 2XWJB 4NHKA 1QHDA 2ZGUA 4XEZA 3D8CA 4YSFA 4P9YA 2JD4A 2D6OX 4XBNA 3AX4A 4AI1A 3ZSEA 1RUC1 1Y7BA 5GLVA 2Y26A 5CBLA 1QGLA 2DURA 2DUPA 2WNVC 3K48A 5GLTA 2HWB2 1ULDA 2FMYA 4KBBA 4FPYA 4LHNA 1ZZBA 3RWNA 2DCJA 1MACA 3P3PA 3OD4A 1YI9A 2P3IA 3I59A 3JU9A 1NA1C 4C1WA 5A32A 2ET7A 1AYM3 2EAKA 4Q4W2 1U5ZA 1H2MA 2H0VA 3E6BA 3MF6A 5C9AB 1HQWA 2VVDA 3NVCA 2RMU2 2XJTA 3VL9A 1LHUA 4WVMB 2D97A 5FLIA 5C6CA 4JRLA 2KA3A 2ZGSA 1S0IA 1WMFA 4XPVA 1C8M3 4I0AA 4XFBA 2E51A 3FLRA 1SBDA 4GMP1 4I2OA 2RR13 1QOSA 2XLFA 2EXHA 4Y1VA 1RHI1 4BIOA 1AX1A 2JENA 2PYTA 4XOGA 4AGRA 5D1IA 3WP4A 1S0EA 4P9GA 3WNXA 1DGRN 3NV2A 3KCCA 1K5MB 1OFSA 4PLOA 4RQPC 1EV13 2PLV2 2RJLA 2MPFA 2PTMA 4Q4X3 4DFSA 1RVF3 5BNPC 4H7MA 2UWCA 3KQRA 3VKMA 4FAGA 1OA2A 1OD5A 3KZ4C 5K8SA 2JE9A 5FCCA 4YZ5A 3TBDA 1ZBA2 2DFBA 3VBHA 4X8PA 2F4PA 2XJRA 4XFIA 4RS5C 2NMOA 5HCFA 4AQ2A 3V0BA 4L2NA 3ZXLA 5FAXA 1FOD3 1AL21 1KDKA 4MLOA 2X5IA 1A3KA 3I7DA 4QM9A 3ZXKA 5L36A 1HV1A 2C9AA 2QDNA 3DV8A 1WCDJ 5KXEA 2ZTNA 4GH4A 1N3QA 1O4TA 2BNMA 5F1RA 3AJYA 4RS5A 3WV6A 1TMF2 1AR63 2G9GA 4LUKA 1ND3B 2HEWF 5BNOB 3KMHA 4DRVA 2VVEA 1V9U3 1W6QB 3KGLA 4Q4W3 5FQ0B 4GQ7A 2FMDA 2UYAA 4IV1B 1CAVA 4B3NA 3URFA 2PHLA 4CDUC 3WDTA 1J3RA 1JXNA 4GWMA 5GZFA 4AEKA 4EJRA 2JG8C 3IDEA 4FBFA 4QHBA 4CDWB 5JZGC 2ARXA 2E7QA 1MS5A 3VBOC 3VLBB 1WUVA 1QDOA 1LGCA 1VBC2 2IXLA 1NLSA 3VHPA 2ZZQA 1X50A 4JGYB 4KWKA 3ES4A 4LHLA 1I1EA 3ZIXA 4GH4C 4YLZA 4NR1A 1MZFA 2D98A 4FT8A 1BQPA 2WT0A 3CJXA 2ES3A 4QPYA 4FTEA 1HRI3 1TME2 4QQHA 5A33A 3HWJA 5ACA3 2PELA 2XJSA 1IS5A 4QQOA 4I01A 3ZXAC 2BVBA 1FAYA 1RB8G 4JVAA 4S2DA 4P9LA 3AZXA 2R041 2EXIA 1WCSA 2JJ6A 1J3QA 4A3XA 4MGIE 4WM8A 1NA1A 3MLJA 3VBRB 1PHMA 3H0OA 4UW5A 1XU1A 1GZWB 1NA1B 2YDEA 4C90A 4QM8A 4WVVA 3SMHA 4E9KA 1N47A 1V00A 4LLFA 4BE3A 1ASJ1 4KGQA 1LODA 2DU1A 1W6PB 2GNBA 4XFAA 4L99A 4M3CE 2GNTA 2D6PA 4AQTA 1ZRDA 1XQNA 1YIFA 1POV0 3ACLA 5L7OC 3BODA 1HXS2 1RUF2 1HDKA 1MEC2 2R1BA 4QGLA 2XWBB 3B00A 4Y1ZA 3WP5A 1B35C 1EAH1 1VBB2 3MW4A 2Q8OA 2HKXA 1QJU2 3VKLA 1UU6A 5HCBA 1AR62 2WZR2 2GC2A 1DGWA 1CAUA 5DUVA 5KHIA 2EALA 4P5HA 5I0RA 2N7GA 4RR3C 2DF7A 4XJWA 5CFCB 5K9YA 3WHTA 3M3EA 1EPZA 1Z7S1 2VXRA 4Q0UA 3TN91 1LEDA 1FNYA 4R8HA 3OYWA 3JZVA 2WFF3 2A71A 1BK1A 1NXD1 4XTPA 3SLIA 3WCRA 1JUIA 4ATFA 3AKTA 4MUVA 4JGZA 3AB0A 3RYPA 2ZGOA 5I0UA 4C0BA 3GNEA 4ZU7A 1RUE3 4XF0A 5L7OB 1VBC3 1SBFA 4YW5A 1AR81 3NSTA 4IEUA 2SLIA 3H7YA 1W6NB 1R1A3 3AP7A 4OLLA 2DCTA 5CA6A 2VQ0A 3TNPB 1RUH3 2W08A 1DZTA 2PLV3 2VY0A 5FLJA 2QUOA 1OLRA 1AL22 2HWE3 3KD4A 3WG2A 1HLCA 4RS5B 1IQAA 3O0VA 4OI1A 1CGPA 1S2BA 2GU9A 4LO5B 2WLQA 3PJQA 4AK3A 3EBRA 5J09A 1M4WA 1MZEA 4FPCA 1MS4A 3OBTA 3PVEA 3LZZA 5T5JA 1NCQA 1WCKA 4JTOA 3UV9A 1MZ5A 1O7FA 1QJX2 4R4XA 1HW5A 1R1ZA 1S2KA 1W2UA 4HMZA 4LBMA 1A6CA 4IESA 3ZSKA 4BQ1A 1W6NA 2OUJA 2JE7A 3L2YA 1AYM1 1PO13 4Y24A 4GH4B 1PM7A 4IEQA 2A3YA 1U12A 1BMV2 3BU7A 1W0OA 1CIWA 2WKKA 1TMF3 4IEYA 4AEDA 3GYDA 4XE9A 4QGMA 3V56A 4HKLA 3V65A 1RUG1 1MEC3 1S0CA 5GALA 3AP5A 2Q4SA 1NCRA 1Z7S3 1RC6A 3N3HA 1VBD1 3JB8A 3P3NA 4AVAA 4AHXA 4IEVA 4MV2A 5BY5A 2JDZA 2WFF1 2ZACA 3VL8A 3VBRC 4CEYA 3D82A 4RR3A 2BWAA 1QJZA 2VECA 1N1TA 4AXOA 3M4FA 1DIWA 5GZGA 4NPRA 4DQAA 5CADA 1I3HA 5FO9B 2MHFA 3DPRC 1YFXA 5B2GB 4BCUA 3RMYA 4E4SA 4WVZA 1DGWX 2VVFA 5E1RA 5HXVA 2YV8A 4MGYE 3WX5A 3NKGA 3EO6A 1AR92 3ZMOA 1H2LA 1O3SA 2NP0A 3SCHA 3KT1A 3NO8A 2XBO3 3NJZA 5FTTC 5BNNC 4X6QB 3DPRB 1SFYA 1ZBE3 2D3SA 5A32B 3RZZA 3IT8A 1GR3A 2VGDA 4COZA 3ZXGA 5KXCA 4WM8B 1MS1A 3MYXA 2ZHKA 2HEVF 2O8QA 1QDCA 4HANA 1F2NA 1Y3TA 3BCWA 2BUKA 5H9QA 4M3CB 1QOTA 3PHMA 1COV2 3KS7A 3RQ0A 2ZX0A 1VLNA 4PBOA 5LRRA 1ZYBA 3I4IA 1QNWA 1BKZA 2HWB3 4LE4A 4B4PA 1B35B 1C4RA 1QJX3 3BB6A 4XJUA 4XXPA 3VBUB 2CWMA 5I91A 3V0AA 4H7LA 2YY1A 5KC6A 2XJVA 2EXKA 3AMQA 4XF1A 3ZN6A 4B8EA 1BVP1 4LBNA 2XB6C 3B93A 1GLHA 4CDWC 5I8TA 1VB2A 4HFSA 4XJ9A 4YNIA 1OLQA 1FX5A 2ZKLA 3MDPA 1AXKA 1CQ9A 2A6VA 3R4SA 4Q27A 1QJU1 4YGBA 4JC1A 1PVXA 1RHI2 5BXXA 2VOXA 4BLJA 1RUJ1 4FSJA 1XYPA 4F8AA 1Z7S2 5CFDC 5ABJC 4N53A 3T1LA 2OYZA 1GZ9A 1RUH1 1LENA 1LESA 2ZMLA 2ZGNA 2VOVA 4P9JA 1Q8SA 3RYRA 1FNZA 2ZMNA 4LEJA 2NYYA 1FPN1 1GQGA 2C0ZA 1WA4A 3U10A 2H6BA 2Y38A 5DDJ3 3NKTA 5K7PA 3U4XA 1GSLA 1K5MC 3BOPA 4PDWC 4B7KA 5AFBA 4GKYA 4R9CA 4K9SA 3WW2A 1OPOA 1DQ6A 1YYNA 2BNOA 1EV12 1FI2A 2GAUA 2R043 4OHYA 1ZRFA 3JBG3 1PIV1 1Y9QA 2D5FA 3M1HA 3AKRA 4N43A 4DOUA 1N1SA 1XU2A 5T5PA 1LOAA 1AYM2 2VH9A 4FVVA 1CPMA 2CL2A 3JB4C 1ZBA3 2RS12 2I45A 2B39A 5D8AA 1RUNA 2RMU3 4MXWB 4AHZA 4YW3A 4B7EA 1Q8QA 3ELNA 1S1AA 4PJYA 2UY8A 3JUUA 1FT9A 2WT1A 4YG6A 3WHUA 2OZ6A 4HZFA 1MQTC 5GZEA 2CWSA 5AC91 4XILA 2R072 4M0HA 1ALYA 4MSVA 2BNNA 2JICA 1JBCA 3ZN4A 3AKQA 4I02A 1YFUA 1OQEA 4GA9A 3AYEA 3CNAA 1AL0G 1MR5A 2R49A 4FTBA 1NQDA 4PLMA 4CDQC 1MS0A 2P3KA 4YVSA 5KXDA 3AP9A 2CGOA 2DV9A 2VUJA 3RRDA 1BYHA 3WR0A 4CDUB 2NQYA 5F6LB 4IV1C 2QZ2A 3A0NA 1AYN1 1C1LA 2PHXA 4XJZA 1LRHA 2IFRA 3THTA 3SH5A 5ACA1 2A75A 2XJQA 2ZBJA 3UJQA 2WNUB 3GZUC 5JZGB 2TEPA 5IT6A 1AJKA 5E88A 4FP3A 1I6XA 2D6MA 1YHFA 4LULA 4Q0PA 1D4M3 4J1WA 4XQDA 3RI8A 2FQPA 3S6PA 3JQWA 3ST7A 1G8WA 4LBOA 3NL1A 3ZX7A 2UWBA 4TWTA 4IV3B 4RGAA 5FOBB 1VRH1 3KGZA 4K7JA 4IERA 4HSJA 1G9AA 1D0HA 5C8WA 3RPQA 2AR6A 4AFDA 4ASMB 1QOOA 4PF5A 1ASJ2 3RS6A 4L8QA 1HRI2 4OZXA 1AR71 2JG8A 3RI9A 3HBZA 3D0SA 1ZNPA 1DYKA 1ENQA 3R6SA 2DVFA 4S2HA 5E16A 5DZGA 2LM3A 2JG9B 3MFAA 1H8TB 5FDBA 1QQP3 5BNPB 1S0DA 5AVAA 2RS32 2ZKNA 4N53C 1DZRA 1LR5A 4TLFA 1FYUA 1ND3C 1IHMA 4YGEA 2Y0OA 1LJ7A 2ETEA 4GB32 2HWD2 1YXWA 2GC3A 1XXNA 5BNNB 2X29A 3WCSA 4FOWA 3N4MA 4K40A 4QXKA 4LLOA 1S0JA 4JCKA 4YGDA 4AEMA 1O3TA 1ONAA 3R4UA 1KFXL 1RUG3 3AKSA 3PVBB 2V5YA 4AI8A 1O3QA 1FMD1 4QPGB 1OKQA 2PAEA 4HPKB 5IK5A 4HT1T 3O7OA 3VHNA 4P9XA 5DG2A 5LK5A 3HIFA 2AH2A 1N1VA 4AVVA 4EN9B 5LEKA 2XL7A 3B3QE 1LHVA 5I0TA 1XRUA 3B5LB 4AVSA 4D3WA 4CDXC 3ZFGC 2DVBA 1J3PA 1SFNA 1QJX1 2A6YA 2WQZC 3OYWB 3ZN5A 3S7EA 3FX3A 4N7IA 5JWPA 5EJ3A 1SEFA 3D6EA 5T52A 2HWF1 3PNAA 1KJRA 3T1MA 4L11A 3AZYA 5JMCA 2B7YA 4KG8A 5F5QA 2ZAHA 4NWWA 2BEOA 1QKQA 1RUJ3 4AG4A 5C9AC 4M3CA 1GZWA 4OVEA 3H3UA 2BTVC 2DCYA 2D43A 2Z2SB 4JRAA 4XQ4A 5T5OA 5I0SA 5J7MA 4CTEA 3ENRA 4FPOB 1AJOA 4H3WA 4FOYA 1KQRA 3I59B 3THPA 1R1A1 4L9BA 3HAGA 3QOPA 1REDA 1JUHA 3OCPA 1OA3A 1UMZA 1V6LA 2NZ9A 4FXGB 2RS31 1ULFA 4Q0QA 3LA2A 1YFYA 4MXWA 2VPVA 3MW3A 4YZ4A 5I93A 4ISRA 2ZOEB 3VGIA 1WW7A 5T55A 3WQ7A 1CAUB 1QH7A 1T6GC 4YW1A 2YZ4A 4EWAA 4D69A 2GMEA 2UY9A 1A78A 2WL1A 5KHKA 4WM7A 1AYN3 2K9ZA 3LB9A 1EAH2 1VBB1 2KXLA 4COVA 4FPHA 3WUDA 1NXMA 1R093 4YARA 1DLLA 2QKDA 4KNCA 3TN92 4IEXA 1JYCA 1RL3A 4YVSB 1H2KA 3SHRA 1PVC3 3ZFFA 1NE6A 3QH7A 1J1LA 3AKPA 1X7NA 5FPXA 3SCFA 3TOJA 4W6WA 2A3WA 3ROUA 1F31A 1SLCA 2PHFA 3MIFA 3NV4A 1FV2A 4MX3A 3VBSC 3AFGA 2HWC3 1BEV2 3ZFFC 1MS3A 4EWEA 3BTAA 3ILFA 1TEIA 3WP6A 5JPMB 2ZGKA 1FOD1 2UYBA 4OHVA 4CDUA 4LA2A 2GZWA 2GMPA 4JTNA 5ACA2 3H1WA 2IXIA 4URTA 2DTYA 2UU8A 2BPA2 5A3MA 1MS8A 2JEMA 2WA3A 3ZN6B 3ZXEA 1X8MA 1OHFA 2IFWA 1WBFA 5FMOS 4XZPA 4IEPA 4FOQA 5DUXA 1XE8A 1LU1A 4LBJA 4XF9A 1WD3A 2YHJA 1YWKA 4IEOA 3CJIC 4TYSA 3W58A 2WSUA 4Q4Y1 3NV3A 2BW8A 1QJY3 1U5YA 4M00A