4Y26A

Complex of human galectin-7 and galbeta1-3(6oso3)glcnac
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-7
publication title Structural basis of human galectin-1 inhibition with Ki values in the micro- to nanomolar range
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 28
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4y26A00
5AVAA 4WV8A 1IKPA 1LODA 1NXD1 2DUQA 3FLRA 4XBNA 3O0WA 4ISQA 1MS5A 1LHVA 5GZEA 3WDWA 2G4IA 3FFZA 3TB0A 1Q8QA 4FOYA 4XIOA 4C1XA 4Q26A 4LBQB 3FUOA 4R9DA 4FP3A 4FPFA 3BIWE 4XJUA 2NYYA 3GALA 1N1SA 1F31A 2D6OX 3DUIA 3QLQA 3NWKA 4GALA 1V00A 2VY0A 2D6MA 2ZGRA 4TYSA 3M3CA 2E7TA 1YO8A 4FOQA 1CPNA 1MS3A 1W6OA 3L2YA 1GICA 4RA0A 1IS5A 1W0PA 2VW2A 3POWA 1A8DA 2GNTA 3N7MA 3D4KA 2A6WA 1SLBA 2PHRA 5E88A 3AZYA 3WZ1A 1DQ5A 1GSLA 3OYWB 4XHBA 2VH9A 2XG3A 4M00A 5JVVA 3V0AA 5E89A 1DGLA 3V0BA 4YGBA 1D0HA 1GKBA 2OW4A 1AJOA 1HKDA 2CWSA 3H0OA 4WVVA 2JD4A 1CN1A 1Q8OA 2D3PA 3AYCA 4XJWA 3SLIA 4YW2A 1BQPA 4M3CE 2A70A 1DBNA 1DYPA 1FYUA 1QF3A 3KM5A 4K20A 4XE9A 1GV9A 5HCFA 5T55A 5CNAA 4YM3A 1WBLA 3PVEA 5GLWA 5HCBA 3WUDA 4ATEA 3SNMA 2GALA 5IUQA 4XTPA 1I1EA 1PZ9A 1PZ7A 1UKGA 4ITCA 1V6NA 4XILA 5SV8A 1S0CA 1GYKA 1KJRA 1UL9A 2ZZJA 1DLLA 4YGEA 3C2UA 1FNZA 3AP5A 3V65A 4FPCA 1FV3A 1LESA 2WT0A 5IT6A 1S1AA 3PMEA 4AGVA 3AZVA 3LCPA 4YGDA 4ISRA 3ZVXA 4M3CF 4NOTA 4PBPA 2ZGLA 3AXEA 1D2SA 1W6OB 4LBQD 3MW3A 1JHNA 1H9PA 1XQNA 2D3SA 1IS4A 2DU1A 3FLPA 3SISA 3OGGA 4YG6A 1N3PA 3HR9A 4AWDA 1UAIA 1WLWA 5JOWA 1HQWA 3ENRA 4Y1UA 5IK4A 3WLUA 1I3HA 2JDZA 2ZA9A 2WSUA 1GZ9A 5EXOA 2VU9A 2D6LX 4UW6A 1C4RA 4DS0A 4BLJA 3AJZA 2KM2A 3RG0A 5IK5A 5IK8A 4AVTA 5DG1A 1SLTA 1V6OA 4MYEA 3RS6A 1CR7A 2ZGUA 3I8TA 3V0AB 2W08A 1OQ1A 1V6JA 1UZZA 1W6MB 1ULFA 4JC1A 4F83A 1S0JA 1N1YA 2ARXA 4LBQA 1R1ZA 1CONA 2UWAA 1VAVA 4Y24A 4M3CB 1QU0A 4YZ4A 1SBDA 1DQ4A 2R0HA 5FRAA 1JYIA 4DRVA 2AR6A 1URXA 3AK0A 4SLIA 4PCRA 4YW5A 3W59A 1LEDA 4YGCA 3BOPA 1QDOA 1CESA 2CNAA 2CTVA 3T1MA 3T2TA 2DV9A 1W6NA 1MS8A 2ZHKA 1C1FA 1QOSA 2GNDA 1CJPA 2V73A 2YY1A 3AJYA 3IMNA 5E8AA 5GM0A 3MW4A 3RRDA 4DRRA 2D6NA 2NP0A 3VKNA 4NO4A 1WD3A 3VKFC 5JDBA 1BZWA 2YMZA 2JE9A 1ENRA 1Q8PA 3N7JA 4Q1PA 2FHRA 2ZKNA 4Y1YA 4AGRA 1N3OA 4BQ1A 2SLIA 1S0EA 2E51A 1DQ1A 5EYXA 3A0NA 2LTNA 2ZACA 4XXAA 2OUHA 1V6LA 3JUUA 2EALA 3WHUA 3BODA 4LBKA 5T54A 1LGNA 1SLIA 1LHWA 2PHWA 4R9CA 3IKWA 3NV3A 1MS9A 3OPZA 1FV2A 3IPVB 3OY8A 2AGSA 1GNHA 4XJ9A 3WDXA 1Y7BA 3HMYA 2H0BA 4CZSA 5JOYA 1AXZA 1V6KA 1LOAA 4YZ3A 2P37A 2WLQA 5F5QA 1LJ7A 4YFWA 2GMEA 3W58A 4L8QA 1LOFA 4W65A 1KDMA 1AX2A 2EAKA 1N3QA 2EXIA 2ZMLA 3O5SA 1X50A 3D6EA 1C57A 3USUB 4WVWA 4XTMA 5F9TA 2AUYA 2CYFA 4XXPA 4XBLA 2EXJA 2DTYA 3WDYA 4GWNA 3WUCA 4R9BA 1LU2A 1SFYA 2ZGNA 1CVNA 3I4IA 1DIWA 1W6NB 3DGTA 3T1LA 5KXBA 2ES3A 1QNYA 4OZXA 1BJQA 4Y22A 4AGGA 2OVUA 4BLIA 1WUVA 4YFZA 3PVOA 2D7FA 1H9WA 1JW6A 1EPWA 3FUQA 1G9BA 1KRIA 1H30A 2PELA 3WCRA 1LOFC 1AXYA 1JOJA 1S0FA 3WDUA 4Q27A 1Q56A 3WOGA 3QCWA 3ZSMA 3N35A 3B00A 1W6MA 2A5ZA 1W6QB 2A6YA 3PVNA 2DVDA 1UPSA 1QOOA 2R1BA 2PHXA 2ZBJA 1W0OA 5T52A 2ZHLA 2GN3A 1DQ2A 4M3CA 2W39A 3OY8B 5DUWA 1GBGA 1N1VA 1F5FA 1G9FA 2A3YA 2NMNA 5DZEA 2E53A 2P3IA 3AP4A 2D44A 5L73A 4YW1A 3WNXA 4BM8A 4Y1ZA 1PZ8A 1MS0A 2ZGTA 4DQAA 1FAYA 2WKKA 2A6ZA 3AP6A 3RSJA 2EIGA 2Z42A 2DTWA 5FREA 3POYA 4PQ9A 2FMDA 3SITA 1ENSA 1DFQA 3O0XA 4XMIA 2E6VA 1SLLA 1LECA 1KITA 1AX0A 5GZDA 4YW4A 4Q8KA 4YG3A 5DZFA 1VAMA 3AXDA 5IK7A 3AFKA 3CNAA 1V6IA 1LOEA 2GNBA 1WBFA 2TEPA 1ULEA 5CB7A 2YV8A 2ZAAA 4GXLA 3ZXLA 1LGCA 4D69A 2ENRA 4R9AA 3MPPG 1WLCA 3M1HA 4Y22B 2AREA 5CAZA 1WCSA 1OFSA 2DU0A 2DWRA 1LOGA 3IPVA 5GLZA 4GKXA 2R0FA 3B3QE 2WT2A 2EXKA 5T5LA 3ILFA 4FPEA 1APNA 1LCLA 2UWBA 3VV1A 4P9YA 5T50A 3UJQA 4YLZA 2JECA 4PF5A 4Q8LA 3GNEA 4FPGA 3USUA 1UN1A 3TAYA 5BYNA 1LHUA 1MACA 1DQ6A 4U2AA 1G9AA 5H9PA 2PHFA 1FATA 2A75A 3O0VA 2P3KA 3ZSLA 4XYXA 5DUVA 1IS3A 1GANA 2VUAA 4ATFA 1QMJA 4IQPA 1GZCA 4KBBA 1AVBA 2YROA 4C1WA 1RIRA 3LSEA 2B7YA 3ZSKA 4ZKTB 2ERFA 2VW0A 3VKMA 1WW5A 4FPHA 5T5OA 3WG2A 1CIWA 1IS6A 1FNYA 1ONAA 1ENQA 2NMOA 2P34A 4YM1A 2V5YA 3M3EA 4WZFA 3ZXEA 4ASMB 4UW4A 3RMXA 1NLSA 5HCAA 4XMAA 4M01A 1LEMA 1WD4A 2VW1A 4Y1VA 4LBOA 1YRZA 2EF6A 4Z8BA 2JE7A 2XB6C 3AP7A 3WG4A 5GZGA 3AZZA 4GKYA 1W6QA 4XIKA 1MS4A 1SBEA 1ZA4A 3WG3A 4BPZA 1FX5A 3IM0A 3ILNA 4GA9A 3AX4A 4YZ2A 1AF9A 1LHOA 1Z0HA 4RL7A 1VIWB 3OBTA 2NN8A 4H55A 1ULGA 1G86A 3RMYA 3M3OA 3KQRA 4AVSA 1VLNA 3OBRA 3Q9OA 1G7YA 1RITA 4Q1RA 2CWMA 4Y20B 3NV1A 5LK5A 1MVQA 2GN7A 4FPKA 4FP2A 1WW7A 1G8WA 1W6PA 2YXSA 4Q2FA 4CTEA 2ZGOA 2PHTA 4K21A 1WW4A 5KXEA 2ZHMA 1OKQA 1A3KA 4P9XA 4XOGA 1ULCA 3R4SA 4BMBA 2D3RA 3NV4A 5T5JA 2P3JA 5DG2A 4DPNA 2GMMA 3PJQA 4YG0A 1WLDA 3BTAA 1UMZA 1MZ5A 1U0AA 4UW3A 4YW3A 1LENA 2DVBA 3WDVA 1HLCA 1YI7A 5EWSA 3AYEA 3FLTA 2UWCA 4LBLA 4FPYA 1QGLA 3WVJA 4FOWA 1WW6A 1GZWA 1LHNA 5H9QA 2WJSA 3MW2A 3UK9A 4P14A 5GLVA 1G9DA 3A4UA 5GALA 1QOTA 1UX6A 3AYDA 3SH3A 4AYUA 3AZWA 3N36A 3AP9A 3ZXKA 2ZGSA 1YIFA 3ILRA 2JJ6A 1CQ9A 4I30A 4HL0A 1O4ZA 4FQZA 5H9RA 1HDKA 1ZM1A 3ZXFA 5H9SA 2DUPA 4JRAA 4BOWA 5CA6A 2ZABA 3WV6A 2AH2A 3SH5A 1LOCA 2DVFA 2GDFA 2RHPA 2DVAA 2R1DA 3WHTA 2BQPA 1IKQA 3ZYRA 2E7QA 3B9CA 2ZGKA 1W6PB 2DVGA 1YXWA 1MR5A 2JKBA 4YM0A 2GMPA 1MZ6A 1MVEA 3N7KA 4DFSA 5GZCA 1KJLA 5EYYA 4FPLA 1SLAA 5KXDA 1LOBA 4Y1XA 3U4XA 5JOXA 1DHKB 2A7AA 5DUXA 2A3WA 2DUOA 4TZDA 1DQ0A 2PHUA 3RQ0A 1F9KA 2ARBA 4LBJA 2WNEA 1SBFA 4AVVA 3APBA 3D5OA 1QKQA 1AZDA 3WCSA 2AYHA 2ZGPA 3WG1A 4UW5A 4LBMA 4FPJA 1ULDA 4BMEA 1TEIA 1IOAA 2ZHNA 2P2KA 2ZMKA 1GZWB 1J1TA 2A6XA 3R4UA 1CPMA 2CY6A 3M3QA 4HANA 4XJZA 2DURA 3LSDA 3NV2A 2CL2A 1JN2P 1QDCA 2Q5TA 1SLCA 3B01A 3M2MA 1G9CA 4Y20A 5JMCA 3VKLA 1UZYA 4U36A 3AYAA 1SCSA 2I2SA 3POSA 1VALA 1GNZA 4XHXA 2ZMNA 2WT1A 3R05A 4PBOA 3UJOA 4FVVA 2UU8A 1S0GA 1S0IA 3VUOA 1GLHA 2GNMA 2AENA 1JBCA 2D6PA 4K1ZA 1DYKA 1SCRA 2YZ4A 4K1YA 1B09A 3HN1A 3VKOA 1LULA 1S0DA 3AZXA 4P9WA 5DUUA 4LBNA 3WDTA 2LALA 1LGBA 3V0BB 1C1LA 2SBAA 3N3HA 2NM1A 2EXHA 1S0BA 3O12A 5KXCA 5GLTA 5GJ6A 1BYHA 1AXKA 3ATGA 3MEPA 3V64A 5GZFA 2A3XA 2WSVA 1N47A 4FOVA 4XDQA 3ZXJA 1BXHA 1Q8SA 2W52A 1N1TA 3ZSJA 3IN9A 1O4YA 1MS1A 1LTEA 5CBLA 1Q8VA 1DZQA 3SH4A 1JUIA 2C5DA 2OUJA 3ASIA 4XJ8A 1JYCA 3JU9A 1AJKA 4JCKA 1BKZA 3INAA 1LU1A 2HYKA 4YZ5A 2ZGMA 2D43A 4FPOB 1V6MA 3A0KA 1A78A 5GLUA 3B69A 1KQRA 5DXDA 3ZYPA 4CRQA 2VXRA 2NZ9A 2DYCA 3OYWA 1AX1A 2A6VA 4Y26A 1KDKA 5JLVA 4YZ1A 1QNWA 5DZGA 1SACA 2ZGQA 1YYNA 3FBYA 5T5PA 2WQZC 2A71A 3UL2A 2UURA 2R16A 3ZPYA 4ZXKA 1Z78A 5JOZA 4XZPA 4XJAA 4FQ4A 2W68A 4GWMA 2C9AA 4XBQA 1RINA 3N7LA 2D6KA 3OJBA 1JXNA 1HQLA 4YM2A 2R49A
chains in the Genus database with same CATH superfamily
3JB4C 5AVAA 1IKPA 3BTZA 1RVF2 1NXD1 1AR73 3FLRA 3L9JT 4O61A 2NQYA 1FI2A 4L0PA 4QHOA 1MS5A 1X9TA 4EN0A 3WDWA 4DXTA 4HK9A 4JGYC 1W8OA 3VB9A 2RMU2 4FOYA 4EZHA 2XVGA 4X6QB 4BE3A 5IVCA 4KGGA 1DF0A 4FP3A 2X09A 4HKLA 2WZR1 4KG8A 2NYYA 3BI3A 4JDNA 3QLQA 4YVWC 1HXS3 1ZBE2 3J26N 3ZKYA 2BNNA 3SC7X 1OF4A 2E7TA 5F5IA 1JZ8A 1COV2 1K42A 3IT8A 1R083 3NAPA 3FBMA 1QJEA 1SMVA 5FWJA 4AI0A 5LWBA 3D4KA 1VRH3 2RJKA 3ZKUA 3I2IA 5FZOA 4AEDA 2A6WA 2YBSA 2IWGB 1VPHA 3AZYA 3HQXA 3R4DB 3WZ1A 3AVSA 1FXZA 3MIHA 3MI8A 1AR91 3D8CA 4GZ9A 5BNNA 2VCAA 1OPOA 2ZS6B 4NIHA 2YGLA 1PHMA 2I45A 4DNYA 5FOJB 4OHXA 3VHRA 1WMFA 1ZYBA 4N53A 1CJDA 2XL7A 2EVXA 4XUOA 4WVVA 1ND2B 2JD4A 1HB3A 3GZUC 3BOWA 4YW2A 5FPLA 3SLIA 1H4HA 5K9YA 1DBNA 5T55A 1GV9A 4UBHA 5A7WA 1K5MA 5CNAA 4YM3A 5HCBA 3WUDA 4XACA 3N9LA 4Q4Y2 5F3EA 3VZKA 2ZX1A 1I1EA 1PZ9A 2Y33A 4KMQA 1UMHA 5SV8A 1GYKA 5LY1A 2ZZJA 4YGEA 4BWOA 5FPAA 4LJHA 4QDSA 1W03A 3HJRA 4FPCA 3WF1A 2RM22 1D7PM 1VBA1 1S1AA 3IIIA 5IT6A 4X8PA 4HK8A 4CDQC 1WCQA 3ZR6A 1ZBA1 2W5FA 5FMCA 4WM7C 5FZBA 3WF0A 1RUI3 2R072 4PBPA 1D2SA 4DMIA 5I0SA 5E6HA 5CFDC 1UY0A 3MW3A 1JHNA 5AFBA 3SISA 1F5JA 3LIGA 5KHGA 5L36A 1UAIA 5JOWA 2YDEA 4MXWA 1ALYA 4AEDB 5C8CA 5FP4A 5IK4A 1O59A 2WSUA 1YQ2A 1E5RA 2VU9A 4W6WA 1EYBA 3GBGA 5BNNB 4QGMA 4BLJA 4P9IA 4H7LA 5KHHA 1A8MA 4HKOA 5KHIA 1OH3A 1S2EA 4ARXA 5AC92 1JZ6A 2VUCA 4M4PA 5FK7A 3CU7A 1H2KA 4BHPA 5L7OA 2ZZQA 1D4M1 1PGW1 5BNOB 2Y0IA 2KXLA 2R061 1R1ZA 3M3IA 4C91A 2FCUA 3FHAA 3AKRA 5A7WB 4DZGA 4M3CB 3C3VA 4I0WB 4YZ4A 5FRAA 2R6QA 1PGSA 4XCBA 4CEWC 5IVJA 3K4DA 4W6XA 1QJY2 4E4DX 4YGCA 2FQPA 1OH4A 1OVSA 1QDOA 2CTVA 3ES4A 2B9UA 4N7IA 1VBC2 2C9KA 3T1MA 3SEEA 1W6NA 2VZPA 4LKSA 4WVMB 2ZHKA 1C1FA 1QOSA 1YHFA 3RRDA 2V73A 1OA4A 2GH8A 3MW4A 2HWC1 5C70A 3H3LA 5FP3A 4NHXA 2MEV2 5FLHA 1ZZ8A 3VBFA 2VMIA 1Q8PA 2VMDA 1UIJA 3GHMA 4BISA 3PIGA 1NLQA 4BQ1A 4UFIA 2Q30A 2EA7A 1IHMA 3FMGA 4UYBA 4B4RA 2W9XA 5ABJA 4I2OA 2OUHA 5JXGA 5C8CB 5FY0A 2VQTA 1AL23 4OULA 2AZ5A 1OLMA 1W99A 2CV6A 3RFRA 4R9CA 1ODMA 2BV4A 2WZR2 3TN93 3PUAA 5DQ0A 3OY8A 4NIIA 1GNHA 4COZA 3T09A 4IV1C 3AMHA 4GH4B 3EYPA 1V6KA 4RGAA 4AG4A 1UY1A 2WLQA 1LJ7A 1VBB3 2GC0A 4QXHA 1AR61 5FZMA 1YQCA 3BVCA 3THTA 3U37A 5KC6A 5L7OB 1OI6A 2EIEA 1LOFA 2W2IA 4L8QA 4W65A 1I9RA 1RUG2 4LULA 2AC1A 3LWCA 1GZTA 4RQPB 1TZOA 1X50A 4KU7A 3SHRA 1C57A 3USUB 4FTSA 2Q8CA 3ZYIB 4XXPA 5FZ0A 3PLQA 5I8TA 4IEWA 2UYAA 3WDYA 3WUCA 4R9BA 1WGPA 1LU2A 2ZGNA 4PIYA 3I4IA 1DIWA 1W6NB 3EMRA 5J48A 2PHLA 1XSQA 2ES3A 2R7EB 4HT1T 5LA0A 3LEKA 1CD3G 3DEMA 4NN0A 4Y4RA 1UZ0A 1DZRA 4PLOA 1X7NA 1PO23 2PN5A 4C90A 1G9BA 5A32A 3KHCA 1KS5A 2HWD3 3DL3A 1S0FA 4HPKA 4GMP3 5EZWA 3ZFGA 3ZSMA 2WO3A 4R4ZA 1MZEA 1BEV1 1W6MA 5ABJB 2C4XA 1D2QA 3CL1A 3HN3A 2XHKA 4IERA 5FMBA 1UPSA 4NHYA 2R1BA 3IDCB 3KT7A 2GN3A 3KCYA 1VBA2 2B4KA 3I3EA 2LS6A 3OY8B 5DUWA 4DEQA 5K8SA 2I74A 1ZBA2 4LOSA 1VR3A 3LDBA 2R041 2RMU3 2A3YA 2E33A 2E53A 1TNFA 1UW8A 2Y6KA 5L73A 3WNXA 2JD9A 2CSGA 1F15A 2ZGTA 4CE8A 1ZBE3 1JYNA 4KBZA 2QVSB 1S55A 2IXJA 2Z42A 5FREA 3C7OA 4C8DA 3OG2A 4PQ9A 3SITA 5FZLA 5FY7A 5F32A 5L9VA 3W5NA 5LB6A 4MGKE 2HWF1 1E5HA 5ACA1 4YW4A 3O1UA 5IK7A 3AFKA 3CNAA 3T30A 1V6IA 3FL7A 5IAVA 1OKOA 1WBFA 2VOXA 4XUTA 1LGCA 2KR2A 3ZR5A 3E1F1 5J96B 1D4M2 4LLFA 1DG6A 4AK3A 1WCSA 2RG4A 1OFSA 4BA6A 2G1MA 2R0FA 4CCOA 5C33A 1TMF1 3ZIWA 3POIA 3K75B 3H1WA 4Z82A 4KNCA 3ZFGB 4HETA 3U07A 1GP5A 4Q0VA 3JCIA 1I5PA 3RZJA 4AAXA 2DCZA 5C3QA 1C8M3 5T50A 1UYZA 2PLV1 1T6BX 4CDQB 3GNEA 3J7LA 4HSLA 3C7FA 4U2AA 1DQ6A 1XSRA 2WFPA 2PHFA 2YC0A 1GWKA 2A75A 1PO11 5EQUA 4S2GA 2WABA 2XJTA 5DUVA 1IS3A 2YPDA 4AXOA 4B7KA 1F4AA 3KS7A 1POV3 3E5UA 2YROA 4C1WA 1DZTA 1RIRA 1JODA 3LSEA 5HXVA 4Q29A 4ZKTB 2VW0A 1H8VA 3I3BA 4CCMA 4LIVA 1CIWA 2VTFA 3ZXEA 1ENQA 2OXBA 4ASMB 1H1IA 5BNPC 1EV11 4AFMA 4SBVA 4ARYA 5C3OA 2RS51 2XJQA 3HT2A 3MYXA 3CJIA 2BU9A 4IGPA 1YQ5A 2G9ZA 4MUVA 2XKOA 4Y1VA 2XBO1 2EF6A 5FLIA 1HB4A 5FY8A 3POEA 3SCGA 4BU2A 4AQTA 2VNVA 1L7RA 2JE7A 4G3YC 3WG4A 5GZGA 5D8AC 3AZZA 4GKYA 3H1MA 1ZA4A 1SBEA 2L9LA 3GZAA 2Y60A 3MV01 5I8YA 1TG7A 4JQTA 1OXCA 1FX5A 3IM0A 5FZDA 4J1WA 3AX4A 4XUNA 1DP0A 3TOJA 3URFA 1VIWB 4LE3A 2NN8A 3GBWA 3SKVA 1ULGA 1G86A 2Y38A 2OZ6A 5K0UC 3M3OA 4QPIA 2XJVA 2FDIA 1BLZA 2WR9A 4ZXEA 2J1VA 3DKQA 4B1MA 1MVQA 2FZ1A 4FPKA 4R52A 1LAJA 4FP2A 5FZAA 1O3RA 1TQ5A 1ULPA 4AHXA 1UF2C 4XEZA 2KA3A 3D0SA 3JD73 3VGIA 3I7DA 3I59A 3VDCA 1ZA7A 1A3KA 5JZGC 4XOGA 3RPQA 3S7IA 2JG8B 5EJ3A 4KQ7A 2D3RA 4BMBA 4ES9A 5DG2A 1MEC2 3WNNA 3WNKA 3OUIA 3QH7A 4YG0A 1WLDA 4AF9A 1UMZA 1MZ5A 3PURA 3VD3A 4N8MA 3WDVA 2LM3A 3T08A 2YG0A 4AHYA 4D8MA 3KF5A 3UESA 4FFHA 3FLTA 1HN1A 4XF9A 1W9FA 5DPNA 2Q8EA 3UYJA 4CP1A 2QQPA 5FKBA 1QGLA 1W39A 3P3PA 5CZKA 5FYTA 2BERA 1WW6A 3C8XA 3W21A 4MVTA 1LHNA 1PMIA 1JMUB 1VP6A 4YVSB 3MW2A 2R042 1GQPA 2E7AA 2RS31 2HWE1 4P14A 5GLVA 2JB8A 4Q4X1 1XE8A 2WZR3 4CU9A 5FZEA 1W8WA 3AMMA 1OOPC 4EYUA 3ZXKA 2BP6A 1FMD1 2GC3A 5C7GA 2YB7A 3B93A 1UOBA 1W8ZA 1W9TA 3KV4A 2E9QA 2JDMA 5A7OA 5FYUA 4CCEA 2WA4A 1C5HA 1O4ZA 2ZX2A 4BXSV 4Y5TA 5J09A 1YI9A 3CF6E 1UXXX 4JRAA 4XUPA 3IIAA 5CA6A 2HWF2 1CGPA 5ACA2 5C4WB 1FPN1 2QQJA 5FYCA 3T0AA 5B4NA 2ZX0A 4NHKA 5A3WA 3FE5A 3VDDC 2DBNA 5DDJ1 3ZYRA 2BZDA 2E7QA 5KHKA 2OS2A 2ZGKA 3IZOA 1JZ4A 1YXWA 1AR93 1MR5A 1J84A 3VHOA 1PMJX 1RUH3 1JYWA 4LA2A 1MVEA 3N7KA 4DFSA 5GZCA 1KJLA 1ND3A 3AM2A 5KXDA 5IVVA 5EHDA 4JGZB 1TMF2 1U5YA 2HBUA 2PAMA 2C0ZA 1UMIA 4Y33A 2IXHA 4CDUC 4IV3A 2QQWA 1K3IA 3LA3A 1SBFA 3D5OA 1W04A 1QKQA 1AZDA 4H7MA 3WCSA 2AYHA 3WINE 5FFOC 4MGZE 2RE9A 3N9QA 4FPJA 2PLV2 5A3OA 4BMEA 1NG0A 1IOAA 3I2DA 1NE4A 2ZMKA 2W87A 1YCIA 1WCDJ 2J22A 1NXMA 3LD8A 1FOD2 3RZZA 1IPSA 1W8NA 3POBA 4HANA 4DXZA 4D7TA 1PO12 5IYYA 3NV2A 4QX1A 1JN2P 4N43A 1VBA3 3ZIXA 4AVBA 2VQUA 5F5AA 3ZM8A 5FUPA 1H8TB 1ZBA3 3IDBB 4HVQA 1VALA 1GNZA 2RS13 4LMFA 4O65A 3ROUA 4OI0A 3OSDA 2WT1A 3R05A 1RGSA 3ES1A 1GMMA 1TNRA 1MQTC 3KV6A 2AENA 1JBCA 4XUQA 2RS52 4K1ZA 4K1YA 2YC2A 4AEMA 1JZ2A 1AYN2 5C6CA 4CUGA 4P9WA 4TLFA 5DUUA 4LBNA 1RHI1 2Y34A 3V0BB 2SBAA 3X29B 1RUF1 5BXXA 4HVRA 5FJHA 4DXRA 2DCYA 1RJ7A 4D6SA 4I3PA 3O12A 5KXCA 3LIHA 4LLOA 1BYHA 1DGWA 5GJ6A 3R6SA 4ZHNA 5IVBA 3MEPA 5GZFA 5EFUA 2D5FA 2WSVA 5A1AA 2RV9A 1BXHA 2Y8KA 1D4M3 3GZTB 3ZSJA 5HI0A 5FDBA 3BU0A 1O4YA 1MS1A 3BGAA 4A6SA 5CBLA 2R063 5EJ1B 2XL9A 1Q8VA 3MICA 2W91A 2VL4A 1DZQA 1NCQC 1GR3A 1JUIA 3DYPA 3MIBA 3SH4A 1JYCA 3C7HA 1AJKA 1W06A 3WQ1A 3BTXA 3LOBA 1BKZA 5LY2A 1W3VA 2ZEWA 3AMPA 4LHSA 4ONUA 2Z69A 1V6MA 3OEBA 1A78A 4IL7A 3AL6A 2YU2A 3I3QA 2NZ9A 3I2OA 4Y26A 4YZ1A 2TUNA 4N43B 3VBSB 1SACA 1YYNA 1RL3A 2HWC3 2WQZC 3I2FA 4AE2A 1AR81 4ZXKA 1YFWA 1OLME 2QNKA 2W68A 4GB31 4IEOA 4N90A 2QQVA 1PK6C 1RINA 2VE1A 3PTYA 1SPPA 5C9AA 2RJ2A 1LODA 3ZN5A 5ANQA 3Q8AA 1NE6A 5LEJA 1QXRA 4XBNA 3O0WA 4I0AA 1LHVA 2RS32 2HWE2 1KFUL 3WNOA 2WNUC 3SCHA 1W8HA 5A6QA 4RR3C 4R9DA 1FMD2 2VNRA 4ZONA 3GALA 2H6BA 1F31A 2PTMA 3NWKA 1U5XA 2WZ8A 3HQUA 5B2GB 1AR63 1V00A 1X8MA 3M3CA 2Q0AA 1YO8A 4FOQA 2WWUA 2F17A 3ZDVA 2WS92 3ZFEB 1MS3A 2JDHA 1VBD2 2XWBB 5I0UA 1GICA 2ET1A 4LO6B 1YEWA 2B46X 3JBG1 2HWB2 3TEXA 4K8FA 5DDJ2 5FBJA 3VBOC 2X53S 3WW1A 4QKNA 1UKRA 4QD2A 1SLBA 5E88A 5FY1A 1GFF2 2ZKLA 1OF3A 1DQ5A 3HOBA 4JTNA 3AKSA 4IEVA 3SMHA 3TNQA 4CDWC 4RS5A 5FPXA 1P8JA 4A3XA 3LE0A 4XHBA 2VH9A 1WMXA 3LF7A 1DU3D 2JXAA 5LA9A 5HV4A 5FYYA 4P5YA 1RMU2 1ZZ7A 2BRTA 2K0GA 1DGLA 1HRI2 1AJOA 1HKDA 2W0XA 2XVLA 3H0OA 1HV1A 1CN1A 3AYCA 4RN5A 1CAUB 4XFHA 1NA1C 5JR2A 3NAPC 1QF3A 3AFGA 1GUIA 4K20A 2QZ3A 2Y0OA 4CVUA 5C9AB 1WBLA 3PVEA 4ATEA 1BEV3 1D4VB 5IUQA 4XTPA 4WVZA 5L9BA 4ITCA 1V6NA 4AEDC 4TN7A 1KJRA 3HNYM 4NE9A 2FDHA 4Q4W1 2WO2A 3GZEA 1H1AA 3J9SA 3V65A 3VLBB 1GWLA 3BPZA 2WT0A 2XMLA 1M4WA 1DCSA 2R043 3PMEA 4E4SA 4Q4Y1 1UCXA 1NCRA 4ISRA 4N53C 3K77A 4NOTA 5CKQA 2QDRA 2IUWA 1ZZ6A 1UPIA 4CP9A 5HCHA 1IS4A 1PVC2 5A7NA 2ADEA 3HR9A 1RHI2 5F7UA 1K5MC 3VZMA 4E2QA 1RUF2 3DYOA 4A7YA 4Y1UA 2JDZA 4LEJA 1SG3A 3H8UA 3VBRA 1W2UA 1B35B 4P9JA 4AW7A 2VQAA 5EXOA 2PMWB 2IXCA 4UW6A 4UFHA 1C4RA 2WLPA 2KM2A 4QMAA 4P5HA 1BHGA 5IK5A 4AVTA 4QX2A 4R8HA 4ZY9A 5CADA 1SLTA 2ZAHA 4M0NA 4MYEA 4PIZA 2UY9A 5A6ZA 3MZHA 1R1A3 2W08A 4PF1A 1UZZA 1ULFA 2W47A 4JC1A 2OT7A 4F83A 4YSFA 1S0JA 1N1YA 2JKXA 1QJU3 2QDNA 1TMF3 4KI5M 4URTA 4COVA 5A3MA 2UWAA 4DUVA 3IAPA 3LA2A 1C8NA 5F6LB 4IE0A 4O7XA 2PAKA 1DQ4A 2YUEA 4DRVA 5C5UA 2AR6A 1URXA 4EN8B 2J1SA 2BJSA 2JWPA 5C8CC 3W59A 1LEDA 5FZ7A 2E63A 5D2AA 4AI8A 1CESA 1POV0 2K46A 1XC6A 3J7NA 2VBBA 3THDA 1AR82 2XHNA 5FXWA 1JYIA 1CJPA 4YPJA 2CAUA 1T2XA 1IGOA 2P5BA 3HIFA 1NCRB 3VKFC 4JQRA 5JDBA 3O1TA 2Q4SA 5L7OC 4QU2A 2WAOA 2YMZA 1IG3A 3KQ4B 1QJY1 2DDUA 2JIJA 5J98B 1R093 2OX0A 1UNBA 4LQRA 4JDMA 1VBC1 2J1TA 3P3NA 5EYXA 2BWCA 5LRRA 4XXAA 1EV13 1V6LA 1W90A 2VULA 3WHUA 2RS53 3BODA 4LBKA 1OURA 3QH6A 5T54A 2DCTA 2P3YA 2PHWA 1LHWA 1OC1A 3FHIB 3ZXAC 2MEV1 1FV2A 3OPZA 2XBO3 4XVHA 3IPVB 5G04L 1ZRRA 4MO3M 2AGSA 4NMIA 4NUBA 4L11A 4AQSA 1AXZA 3DXTA 3KCCA 4LITA 1GOFA 3MF6A 4MLOA 3I2KA 4YZ3A 5A3UA 1NLRA 3W5MA 3E6CC 3DCQA 3IB3A 3W58A 4D0QA 2BVVA 2FBEA 5A7QA 3JBG2 1SFPA 2XDVA 3E6BA 1YFYA 2EAKA 3MFCA 1N3QA 5A6YA 3VBFC 1RXFA 2QFEA 4EN6B 4RYDA 2FDFA 5LBFA 5F3CA 4HZFA 3S5AA 1CAWB 4S2DA 4Y3OA 3MLKA 1RUD3 5ABJC 4IEPA 4EROA 1DLCA 5LA2A 1UWWA 5CISA 4MADA 1RUG1 4DUXA 1W8FA 3H7JA 1IQAA 2A73B 4CDXB 3D82A 4AFDA 2XVKA 4OZXA 4XQDA 4YYOA 4Y22A 4AGGA 1WUVA 5FZKA 4CXXA 1XBFA 2VCCA 4K9SA 3FUQA 1EPWA 2RR11 1KRIA 2VXJA 2VZUA 4QQPA 1E57A 3BUCA 1LOFC 5FY4A 5FZHA 1JOJA 4D6RA 3ACLA 4EN7B 3QCWA 3N35A 3B00A 4Q4W2 2A5ZA 1W6QB 5FYHA 2DVDA 5BNOA 1QOOA 1ZREA 1NQJA 4DINB 3PU8A 1XOYA 1MZFA 2ZHLA 1J59A 4QGLA 4B7EA 3H3ZA 4M3CA 1O6UA 2RS33 1JU4A 1ULOA 3PIJA 1N1VA 4PDWA 1OLRA 4Q4X3 4NIGA 2WWJA 2BPA2 4NIDA 4NWWA 3LFIA 4Q0SA 2NMNA 2QQOA 3RDIA 4E4HA 2WIIB 1FMD3 5DZEA 4DXSA 4TTGA 3AP4A 2D44A 3UV9A 4YW1A 2WNOA 4BM8A 2WFF1 1PZ8A 1JI6A 2VBPA 4DQAA 3VD4A 3H50A 4WVMA 2YU1A 1BBT3 3ZMNA 1CWPA 5CFCB 2DTWA 3CZJA 3MGUA 1Z7S1 2JENA 1FPN3 2DF7A 5FIXA 2FDKA 1PVXA 3O1SA 1NKGA 1KITA 5DDJ3 3T2QA 4YG3A 2WZEA 4Z2AA 1LOEA 5JXHA 4LK6A 3S7EA 3NNGA 3GF6A 5CG9A 3UNPA 2ENRA 4R9AA 3MPPG 4IE5A 4F8AA 3CQOA 1WLCA 3M1HA 3E5XA 2AREA 4Y22B 2J1AA 4Z2WA 5CAZA 4XDPA 5F5CA 4CU7A 1VB2A 1ZRCA 1LOGA 5GLZA 4GKXA 4MZUA 3ZFFA 1UD1A 5LBCA 2QQLA 2WT2A 2EXKA 2HH9A 5T5LA 4GH4A 1QH6A 3SEPA 2VZTA 1O4TA 1APNA 2D98A 1F35A 4N9IA 3WT3A 3LQCA 1YQ6A 1W9SA 4Q4V1 2W1WA 4L99A 5CKMA 1DDLA 4YLZA 4RQPA 3ACIA 4PF5A 5FXXA 3USUA 4D7YA 3SXWA 1UN1A 4PDWB 3JB8A 5H9PA 5DAXA 3O1VA 1C5IA 2YBKA 1LB2A 2MNGA 4COWA 4JV4A 3DECA 1GANA 5A1LA 5KWRA 2BFUL 2VZOA 1PGL1 3ETQA 3VBHC 1GZCA 3WP4A 4ZU4A 2V4VA 4QPWA 1W8TA 3ACFA 3EJKA 3VKMA 1A34A 5DMYA 1HN0A 2H0VA 1WW5A 4FPHA 3VDBA 1KS4A 2VOTA 2P34A 4ZU7A 2OA2A 2V5YA 3M3EA 4WZFA 1UOJA 4Q5OA 4UW4A 4LUMA 1RHI3 4W50A 2GH2A 4XMAA 5HCAA 1GP4A 4BQXA 2FD8A 1RUF3 1LEMA 2VW1A 5BUVA 2A1XA 2QUOA 1JUHA 3H9AA 4L2NA 4Z8BA 3WNPA 4P00B 2BFUS 5JAXA 4GWJA 1MS4A 1WA6X 3AVRA 3BTYA 1RTVA 2YFZA 4BPZA 4CA9A 3IMMA 4RGKA 3GBFA 4CPBD 1ODNA 2XJUA 1AF9A 3OB8A 3ZFFB 4RL7A 3QACA 1RUJ1 5BV6A 5DAPA 3OBTA 4KWUA 4AVSA 2X29A 3KQRA 4RHV2 4XQWA 5IVYA 2P6HA 3JQXA 1JOBA 2WNVB 4Q1RA 2CWMA 2IVIB 3RZMA 2JDUA 3FHQA 4D3WA 1POQA 2FDJA 4Y20B 3WP3A 3IAQA 2P6CA 4HKWA 1W2TA 4PIXA 1G8WA 2EIBA 2YXSA 3KD4A 4NVPA 4XFIA 3CJIC 4MGSA 3WP5A 2PHTA 4CTEA 1WW4A 2G9FA 2ZHMA 4EWAA 2RR12 1AR83 3FJSA 5T5JA 2AACA 2GMMA 4XF4A 3PJQA 4CPBA 4GB33 4UW3A 4FCAA 2Q1MA 4YW3A 4Y4YA 5C3RA 2OQ6A 2MPFA 3J8F1 5DAQA 5FY5A 5EWSA 3AYEA 4QPIC 3S57A 1ENXA 3PDQA 1NOVA 5JXJA 1MEC1 1GZWA 4BQWA 1DGRA 2CHHA 3LB9A 4QM8A 4XC9A 1QXJA 3DF0A 1HRV2 2CGPA 4XQ4A 1Y9QA 3A4UA 3AYDA 2WN3A 5F39A 1K45A 1RVF3 1OPMA 2WFF2 2Z2SB 4PJYA 2BNMA 3N36A 4XURA 3VBOA 2OZJA 2WA3A 3VD9A 4CDQA 4DO0A 2Y26A 5FR3A 1Z7S2 4JHTA 4W6YA 5H9RA 1HDKA 3DPRC 3KT4A 4JGYB 2DUPA 1V9U2 2YC4A 3ZDSA 2BOJA 1LOCA 1JTZX 2DVFA 1AYM1 4QX7A 2GDFA 1XYPA 2RHPA 4A7ZA 1F2NA 4RGGA 4YVWB 5FXZA 3WHTA 2JE8A 3NW4A 1VBE1 2WAAA 1COV3 4YM0A 5HV0A 4HOOA 4HN1A 5CFDA 5A1FA 2KD7A 1MZ6A 3CZUA 1TME1 2ILMA 5EYYA 3LDKA 4DY3A 1SLAA 1LOBA 4WZCA 3HPNA 1DHKB 1VMJA 2X5IC 4E8DA 2VECA 1W9YA 1DQ0A 1C28A 1ASJ1 2ARBA 4JRLA 1J3QA 2X10A 3I97A 3FN9A 4LBJA 1XNBA 4Q4V2 2WZPP 5ANNA 2ZGPA 4Z92B 4BQYA 1ZX5A 4UW5A 2O1QA 4LBMA 4OUSA 4A45A 4FBFA 5HBAA 1O3QA 5DAWA 2E32A 3OD0A 3F95A 2VMGA 1VJ2A 3K51A 1GZWB 1J1TA 3KWVA 3R4UA 2LROA 1K12A 4MG2A 1CPMA 2ORXA 3J4UH 1YJKA 5JIAA 1QJX1 4LHNA 4XJZA 1Y4WA 3ORJA 2F6BA 5JPNB 1BCXA 1PGL2 1ND3C 4Q4Y3 4U36A 1US2A 3AYAA 3MDPA 3TEZA 1K5JA 1SCSA 3POSA 3ZYHA 1NUKA 4XHXA 3MUZ1 2QQKA 3RYRA 1I6XA 4FVVA 1FOD1 1O8SA 2FMYA 2XOMA 1H6XA 4IV3C 2LRPA 2JG8A 3A22A 2YZ4A 1B09A 2RM23 1BK1A 3VKOA 5I0RA 2JIGA 3RNSA 2LW8A 4PI0A 3L2HA 4WM7B 4NAOA 3N3HA 2R073 2WN2A 4P08A 1S0BA 5CFDB 1YFXA 2ID4A 5GLTA 1QEXA 1SHWB 4N43C 4WBBA 1AYN1 2A3XA 3OUHA 4LOTA 3U1XA 3ZXJA 1RUJ2 5M0TA 4YVSA 2W52A 1ZZCA 2WBKA 2OPWA 3K2OA 4I01A 3OF1A 3K4ZA 1RUE1 4UOJA 4IW3A 2OUJA 5APAA 5T3NA 1F8VA 3DYMA 5CU1A 4INDA 5EJZB 2ATFA 5AC93 4QX5A 2GAUA 3AB0A 2HKXA 2ZGMA 2D43A 4YZ5A 1JYTA 3VZLA 3O1OA 1KQRA 3F2ZA 5DXDA 3ZYPA 4CEYA 1Q5OA 5C4WA 2GSYA 2XLFA 2DYCA 1UZWA 3OYWA 4Y5Z0 1KDKA 4XFAA 3NNMA 5DZGA 5EP9A 2ZGQA 4M0HA 5T5PA 1HV0A 4MGIE 3UL2A 3ZPYA 2HBTA 4B4PA 4BH9A 1Z78A 1AR71 1CAXB 3IBMA 4H2AA 2JB4A 4XAEA 3NJXA 4XZPA 4CEWB 5JOZA 1W28A 2O0OA 2Q1ZB 2QKDA 1QJY3 2QQUA 3J8F2 2C9AA 4XJAA 4YM2A 1CIYA 2VCBA 4K6BA 1VBC3 3GYDA 2WO1A 4JGZA 2DUQA 5K4LA 5JR7B 3I2HA 2D5HA 1ZRIA 2V4AA 4ISQA 2MEV3 2YBPA 3BB6A 3FFZA 3GHNA 4K3UA 1Q8QA 3HT1A 2HLEA 4YW6A 3TB0A 3AKPA 4LBQB 3FUOA 4FPFA 3KT1A 1O3SA 5JUVA 3ALQA 1EP0A 1OT5A 4HONA 4XJUA 1N1SA 2D6OX 3DUIA 1J58A 4JAAA 2VY0A 2ZGRA 2D6MA 3MO4A 4I02A 4C0BA 2RDRA 5FMDA 4BDVB 3K4AA 4NRMA 1W6OA 3L2YA 1AYM2 1IS5A 2VW2A 5FJKA 3POWA 1A8DA 2GNTA 4IV1B 5L19A 1H8TA 1VBE2 3U14A 2HJIA 5C9AC 4IGOA 2CGOA 2PHRA 4NHMA 3VL9A 3VD7A 4QKDA 2JG9C 3UGGA 1UOGA 1RXGA 1TME2 4FAHA 4CEYB 2WS91 3O1PA 1S2BA 1SFNA 1UU6A 1VBD1 1RUG3 3CBNA 3OYWB 3A7QA 4B1LA 5J7MA 1ZRFA 2XG3A 2HWB1 4JZRA 4M00A 5JVVA 3V0AA 5FQ0A 1ASJ2 4N9HA 3BU7A 3V0BA 3GM8A 4YGBA 1D0HA 1GKBA 2CWSA 3AMNA 4XJWA 1Q8OA 1PIV2 5AFEA 3VBUC 4B3NA 1BQPA 4M3CE 3KM5A 1DYPA 1FYUA 4XE9A 3S30A 5HCFA 3BCWA 1DGWX 1O8PA 2N7GA 4MXVA 1JZ5A 4OI2A 2W94A 1UOFA 3LA7A 2QTWB 2JDNA 3T2PA 4FAGA 3ZYFA 4XF0A 1QJX2 1HJGA 1PZ7A 1RMU1 1UKGA 4XILA 4XCAA 5JI9A 1Q3EA 1HRI1 2G9GA 1E5IA 4LIUA 1L7QA 4DEVA 4BQ5A 1FV3A 4RS5C 1LESA 1I5ZA 3KZ4C 3NKGA 3LCPA 4OQ8A 4YGDA 2QQNA 4MHUA 3ZVXA 4M3CF 5A3NA 2ZGLA 1IPJA 4QXCA 4CCCA 1OBNA 1Y3TA 4IUGA 1W6OB 4LKDA 3T0DA 2VNGA 3VBSA 1WWYA 2V72A 1XQNA 2D3SA 3ACHA 3FLPA 1Z7S3 4YG6A 3Q8EA 1N3PA 4UF0A 3UGHA 3LAGA 1O7FA 2QZ2A 4BCUA 3ENRA 4IE6A 4IESA 2BGCA 4LHKA 4XFCA 3WLUA 5IATA 2WQ4A 1GZ9A 4XFGA 1WMDA 3IDEA 4NRPA 5LRSA 2D6LX 1YWKA 4L92A 5FY9A 2OQ7A 2WDBA 3B5LB 3OBZA 1SDWA 3RG0A 1PVC1 4AVCA 4IEQA 3B7MA 4BYYA 3UETA 3V0AB 2XKPA 5FQ0B 1CR7A 2RJLA 3I8TA 3MHZA 4ZU5A 4EN9B 5J36A 1OQ1A 1RUE2 1V6JA 3BKZA 3JZVA 4OHWA 3RGBA 4W8JA 1NCRC 2Y6HA 4AOCA 3A23A 4AQ6A 5F1RA 1CONA 3PUSA 3GCWA 3OTFA 4UT5A 1VAVA 2GU9A 3MIDA 1SBDA 1IQDC 4Q4V3 1XU2A 3ZFEA 3AK0A 4SLIA 4IE4A 4YW5A 3VBRC 5JWPA 3T2TA 2CNAA 1RJ8A 4LO7A 2DV9A 4E4ZA 4OFGA 2CDOA 4LPLA 4FXGB 1AR72 2GNDA 2WINB 5GM0A 4DRRA 2IVJA 3IMNA 3KF3A 5KBFA 1H2MA 1NT0A 3ST7A 4AQ2A 4NO4A 1WD3A 2VMHA 3P6BA 1JZ7A 2JDYA 2XGXA 3ZOIA 1BZWA 1HW5A 1JS9A 2XR4A 1ENRA 1RC6A 3R0RA 2FHRA 2ZKNA 3I2GA 1N3OA 3J7HA 2SLIA 5I0TA 1S0EA 2J7MA 4K40A 4UF0B 3TN91 1HXS2 1IG0A 2LTNA 2ZACA 4QM9A 4JDOA 3EQEA 5F37A 3G7DA 1CAUA 1UY4A 3LGRA 1SLIA 4B4QA 3POFA 3IKWA 3OGJA 1MS9A 3T2OA 3CMGA 3WF3A 2W1UA 3WDXA 4XJ9A 5KR7A 3H8RA 1VRH2 1Y7BA 2X8KA 4S2HA 2H0BA 4CZSA 4PT6A 1HX6A 2F4LA 5IW0A 3PUHA 1DYOA 4YFWA 5BNPB 4EZ4A 2GMEA 1CZSA 1AX2A 1RUJ3 4Z1VA 2ZMLA 3O5SA 5FKCA 4DIQA 2J42A 4XTMA 3AL5A 2ZJCA 5ERLA 1WCKA 5F9TA 4O9GA 5FZFA 3ABZA 2CYFA 4IEZA 4K8RB 4QQLA 2EXJA 4XBLA 4AZZA 3RZLA 4M4RA 1ND2C 4XF1A 3VZJA 4GWNA 4QGNA 1CX1A 3B9IA 4XZUG 2IFWA 1NX9A 5A3PA 2ETEA 2XPJA 2RDNA 3ITQA 3N4MA 3DGTA 4RD7A 4QB6A 4QAWA 2HWD1 5K0UB 4C0HA 4JVAA 1QNYA 1ZZ9A 4BJ0A 4BLIA 1FT9A 1B35A 2VJXA 1VMFA 2CAVA 2D7FA 2PA7A 4JX0A 1VMHA 1H9WA 2D93A 4KWJA 1H30A 3WCRA 1GWMA 3PNAA 4OHVA 4GMP0 3ZYGA 1HB1A 3J8F3 3KVAA 3WDUA 1OFNA 2ARAA 3K3OA 3JQWA 1Q56A 4Q27A 3WOGA 3WQ7A 4URAA 3CEWA 3PVNA 5I91A 5FK8A 1MEC3 2QQMA 3H7YA 1VAKA 4BK5A 4H14A 4EJRA 1XE7A 5B4XA 4CUCA 4Q0QA 4HLTA 1GBGA 3S5QA 1EAH1 4BQ2A 1F5FA 1CAVA 1V70A 3N9MA 4XDOA 1G9FA 2NPIA 5FWEA 1HB2A 4AEKA 3TEWA 5FAXA 4LO5B 2Q8DA 1MS0A 3RZKA 2XUEA 4JHZA 5BNNC 2A6ZA 5FP9A 2EIGA 5LBBA 3POYA 4NPLA 4UFKA 2FMDA 3C7GA 4A7KA 5JIUA 5LCWL 2Y6LA 2CGNA 2B9VA 3O0XA 4UFMA 1OOPB 3GJBA 4NPRA 4XW3A 1SLLA 5DAVA 1AX0A 3ZX7A 4Q8KA 3CDZB 4MOAA 1VBE3 1VAMA 3AXDA 5BNOC 3NJYA 5EPAA 1ZNPA 2IXKA 2GNBA 1U12A 2TEPA 3ZXLA 1T6GC 1ULEA 2YV8A 2ZAAA 5JCTA 2HEWF 2VCMA 4IE7A 2HWF3 5ACA3 5F2SA 2VUJA 3KV9A 3OPTA 3PTRB 1OD5A 3MPBA 5LBEA 3VDDB 2IC1A 2DU0A 2DWRA 3IPVA 1RUOA 1ASJ3 2OYZA 3U10A 1WZXA 5FZIA 4ES8A 3PUQA 4X8NA 3FZ3A 1XPWA 4X6RB 5F2WA 3OOXA 5JSOA 4YNIA 2Q1FA 1LCLA 2UWBA 2HEYF 1XJAA 3UJQA 1LR5A 2JECA 5I93A 4Q8LA 1QJX3 4FPGA 4LA3A 1A6CA 1CAWA 5BYNA 1REFA 3H3UA 3UT0A 4A44A 1POV1 1G9AA 5LZ6A 3M7AA 4MGQA 1CAVB 5JXIA 2B42B 4G9SB 3O0VA 5G05L 1W2NA 2P3KA 2PLV3 2G19A 3K46A 3DKWA 4GWIA 1Y43B 3IWZA 4ATFA 3O14A 4KBBA 4J25A 3TN92 1V0AA 4CDXA 2BOIA 1AVBA 1FOD3 3NL1A 3ZFFC 2B7YA 2ERFA 3O1RA 1PO13 2BUKA 1MPXA 4I0BA 4GH4C 5HPOA 2FDGA 2PAEA 1R64A 2NMOA 1ONAA 1VBB2 4YM1A 1BMV1 4KWLA 4KWKA 3UKTA 1NLSA 5A3TA 4E2SA 1UXZA 2H6CA 4M01A 5D1IA 3WW4A 1WD4A 4FFFA 3PJYA 1YRZA 2ZTNA 4RQPC 2GC1A 4CSWA 3WX5A 2AEZA 2P1BA 1MQTB 3H42B 5IWFA 3WXPA 1W6QA 4XIKA 3CLPA 3WG3A 3RZHA 1AYN3 2E31A 5J37A 2QCSB 1J1LA 1UU5A 1QWRA 4GA9A 2WUHA 1LHOA 1YUDA 1Z0HA 4IETA 2VGDA 4H55A 1H6YA 3RJ2X 3RMYA 4I09A 1NY72 1XXNA 3OGRA 2D97A 3JD71 1G7YA 1RITA 1YC61 3NMBA 5FO7B 4AFBA 2C1FA 1PO22 5FMOL 1CZTA 1WA4A 1WW7A 3TWIA 5CFCA 2HWD2 2VTXJ 1Y9MA 4K7JA 4Q2FA 4KGQA 2ZGOA 3PU3A 4LKFA 1NCQB 5LATA 4TXWA 5KXEA 3WNLA 1OA3A 1UYYA 3NJZA 4Q0PA 4RHV1 5FP8A 3RYKA 5A33B 1ULCA 2YPJA 4QXBA 5E1RA 3NV4A 2P3JA 4DPNA 5FZGA 4BIFA 1OVPA 3P5BA 2J1RA 1AUYA 2QQIA 5JPMB 3P1IA 1PNGA 3NNLA 1LENA 2XLGA 2DVBA 3B02A 4CDWA 1YI7A 4TSVA 4V1PA 4CYDA 4LO4B 5FMOS 5C71A 1BK0A 4NJ4A 1CX4A 2JICA 2UWCA 4LBLA 4FPYA 4WM8A 3T0BA 2J1UA 4FOWA 1QH7A 3POGA 5FBZA 3VHPA 1EAH2 4FTEA 1YNAA 2VZVA 5BNQA 2RDSA 1PK6B 1NA1A 1G9DA 1UX6A 1TE1B 4AI1A 3SH3A 4AYUA 4N7UA 4NIAA 2ZGSA 4CCLA 4V2VA 1LNSA 1CQ9A 3THCA 4XF3A 4I30A 2HWE3 3VDAA 3ZPOA 1W3XA 2C6SA 2VMFA 4FQZA 3MFAA 4HL0A 1ZM1A 2WNUB 4QPGA 3QOPA 4YW7A 1HRV1 5H9SA 4AHZA 5F6KA 4BOWA 4RR3B 3S0MA 1OHFA 5FYVA 3SH5A 1OLQA 1RUH1 2VMCA 4AI3A 4LTAA 3SKJE 2R1DA 2WO7A 3KV5A 3OGSA 4GQ7A 2Z4FA 3U0ZA 1IKQA 2QJVA 3LOIA 5K7PA 1EY2A 2WS93 2IFRA 2JKBA 2VZQA 3VZNA 1VBD3 2XONA 4ZS3A 3UKVA 5C8WA 3W9AA 4JKMA 4BK4A 4O9EA 3ZFGC 3FC0A 2HWB3 1GOHA 1V9U1 1W9WA 2W3JA 4FPLA 4KH9A 4OLLA 3KSCA 3VBOB 4F7ZA 3U4XA 5JOXA 4UXAA 2A7AA 1C8M2 3DXUA 4LXLA 5DUXA 1X9PA 1GQGA 4MGYE 4LO8A 1F9KA 2CDPA 3KMHA 1QIQA 4QQOA 2OKXA 3RQ0A 2WNEA 3QD6A 4W4ZA 3ZXGA 3APBA 4CDWB 3NQHA 2GC2A 3EO6A 3LPGA 4UI9L 3V56A 5I8SA 1UIKA 4OQ9A 3WR0A 3NNJA 3A21A 4CUAA 2W1SA 5C3SA 4WM8B 4NWVA 1RMU3 2BTVC 3VHNA 5A7PA 2E26A 3FFQA 1RUC1 1HRI3 2A6XA 1X33A 3M3QA 2RS11 4OI4A 1NA1B 3NAPB 2WNVA 1QDCA 3S6PA 1SLCA 3M2MA 2WYSA 1G9CA 4Y20A 1UY3A 1W05A 4AAPA 2VG9A 3NKTA 3VL8A 1UZYA 4COUA 1IPKA 5FZOB 3IDAA 1C3HA 4QPGB 4PBOA 3UJOA 1SEFA 1HIXA 3VUOA 1GLHA 2GNMA 4BXFA 1BMV2 3M4FA 2D6PA 1DYKA 1SCRA 5JI7A 4HSJA 1WKYA 3HN1A 3AZXA 4CCNA 3WDTA 1EPZA 3HAGA 4N53B 5FYIA 3RI8A 1C1LA 2PYTA 4GAZA 4V2WA 1PNFA 4GJYA 5EV7A 3MIFA 4XFFA 1PVC3 3SQOA 4EWDA 2Y6FA 3ATGA 3LZZA 1K5MB 3V64A 1E5SA 4FOVA 4QPYA 1Q8SA 4B8EA 3ZO0B 1N1TA 1OMIA 1LTEA 2BYVE 2O14A 1OUXA 2O8QA 2DBIA 3EBRA 3JD72 1YIPA 2Y6GA 3ASIA 4QX8A 1Q43A 3JU9A 4QKBA 3RI9A 5FZ3A 4JCKA 2ORZA 2JG8C 2W1QA 4AHWA 5A6XA 3INAA 4FXKB 4PLMA 4JTOA 1U5ZA 4JGYA 4UFJA 3A0KA 1PX3A 2VXRA 2YYOA 2A6VA 5JLVA 4HVOA 2ZEYA 1QNWA 1IZ3A 4GD4A 4YVWA 2R16A 1CZVA 1KXGA 2XLAA 3HQRA 2VZ1A 4MXWB 4GWMA 4YVSC 4XBQA 5FUNA 2D6KA 3VZOA 1HQLA 2OPKA 4WV8A 3N9OA 3VN4A 3WD5A 1BVP1 1YLLA 3WF2A 2EIDA 4J6GA 5FYZA 3LEIA 5GZEA 3H8XA 2G4IA 3O7OA 3Q8BA 2Z5WA 3ZN4A 1O3TA 4C1XA 4XIOA 1VRBA 2ZXQA 4Q26A 4CEYC 3OGVA 5C4WC 4UBGA 1F4HA 3BIWE 4CCDA 3NRUA 1JU3A 1OQEA 2PHDA 1UX7A 3AC0A 3PHMA 4GALA 4EE2A 1OA2A 3I2JA 4TYSA 2VC9A 1ZZBA 2JDKA 1AR92 1CPNA 2F4PA 1RUH2 2V5DA 4RA0A 5IFPA 1W0PA 3LDRA 3NNFA 5IVFA 2BWAA 3N7MA 4AI9A 2PQSA 4DY5A 1KGYA 3ZN6A 4JGZC 3U75A 4AL9A 2ZCWA 1XNDA 4IEYA 2VAUA 3I54A 1XNTA 5FLJA 1EUTA 1GSLA 2UY8A 3JBG3 4QQHA 2ZEXA 4E2GA 3VBFB 2FZ2A 5FV3A 5FPBA 3NSTA 4QDQA 3GJAA 4LE4A 4R4XA 1GP6A 1PX4A 4YWAA 4WM7A 1GU3A 3TEYA 5E89A 2OW4A 1NZCA 4HBNA 4ZS2A 4QT6A 2D3PA 3WF4A 2A70A 3KGLA 4ASKA 5GLWA 4IEUA 1RUC2 4AFCA 2WYFA 3SNMA 2GALA 4AR2A 4D7SA 1H8TC 3MF9A 3DN7A 4S2FA 5FZ4A 2RS12 4CRQA 3DV8A 1PM4A 1JHJA 3I49A 3OEAA 2B39A 1S0CA 5JMOA 1UL9A 3UKNA 3HNBM 4CCKA 1DLLA 2UYBA 3C2UA 1FNZA 1PIV1 3GXUA 2IXIA 3AP5A 4GULA 3ZMOA 3WQ0A 1EAH3 2VZSA 1STMA 2XUMA 1NZIA 2FCTA 4MHRA 4MSVA 4AGVA 3AZVA 2JX9A 2BGOA 4GJZA 4Q4W3 5FZ6A 3C7EA 3AXEA 4D94A 5CEHA 4LBQD 2VUDA 1H9PA 1HQNA 2BNOA 2DU1A 3WNMA 4TWTA 3OGGA 1O5LA 3W20A 5FO8B 1WLTA 3KB5A 4QX3A 1CAXA 3CHXA 1WLWA 2ZX4A 3GCXA 3ZN6B 1HQWA 1Y9GA 4AWDA 4CEWA 1GQHA 4LUKA 1I3HA 2XQRA 2GP3A 2ZA9A 3VD5A 3ZYBA 1PGW2 3BIEA 2V09A 1UQXA 3OBAA 2R062 1R1A1 3OPWA 5FP7A 3VBHA 1RB8G 4RSUA 4DS0A 4QXKA 1S2KA 2B8MA 5FTTC 3AJZA 5A32B 2WRAA 1QJU1 4BQ3A 5IK8A 4OVEA 1QQP1 5DG1A 1ACCA 1V6OA 4HPKB 3FX3A 3RS6A 2ZGUA 5FPUA 5A80A 3RZGA 4JKLA 4LT5A 3GDBA 4QWNA 2RDQA 1W6MB 4PQQA 5FZ9A 3CJXA 5CKNA 4L9BA 5A70A 3MUY1 4NPMA 4ORFA 2ARXA 4LBQA 3RWKX 4QDRA 3I3MA 5CIRA 4LHLA 3EHKA 4Y24A 2VVFA 2Q8OA 3VBSC 4IGQA 1SDDB 2HWC2 5AVPA 4FI9A 5BPXA 5C3PA 4MH0E 1QU0A 1XB9A 2R0HA 4RFT0 2P4EA 4PHZA 2FCVA 5FYBA 2R32A 4MV2A 3WP6A 4PCRA 2VR4A 5A7SA 3BOPA 1PMHX 2VNOA 4OZOA 2JDAA 4IV1A 5CVRA 5J1XA 4F3JA 1US3A 1MS8A 2YY1A 5A3LA 1R091 3Q8CA 3AJYA 5E8AA 4IDZA 3LEMA 1QY4A 2D6NA 2NP0A 2IZWA 3VKNA 1BVVA 3Q8FA 4FSJA 2VQ0A 4QQ2A 4A6OA 1EUUA 3TNPB 1J83A 2JE9A 3WY6A 1NQDA 3N7JA 4Q1PA 3RWNA 4FFIA 3MIEA 4Y1YA 3ZXDA 4AGRA 2XJRA 1WCUA 4AFAA 2E51A 1DQ1A 3N9PA 3A0NA 1AR62 3JUUA 2VMEA 2EALA 1LGNA 3SCFA 3ZFEC 3NV3A 3VBHB 1RUNA 4QHBA 4AEJA 1L7LA 3HMYA 2K2SA 5JOYA 2BEOA 4B29A 3G6JB 1LOAA 5F5QA 2P37A 5BY5A 1HXS1 1H2LA 2YHJA 4CXWA 5EIYB 1NAEA 4META 1RUD1 1R081 2Z79A 1KDMA 2C26A 2EXIA 3USSA 3D6EA 2VM9A 4WVWA 5FCCA 1H4GA 1VRH1 2B45X 2BDRA 5SV5A 1UY2A 3CKHA 4G4FA 2ZOEB 2AUYA 4LK7A 4E8CA 1XYNA 2DTYA 4HN0A 4HXCA 2D40A 4TLGA 3MLJA 1SFYA 3LFMA 1CVNA 1XRUA 3QBQA 3DPRA 5D21A 3T1LA 5KXBA 3HWJA 1BEV2 1XNCA 4RHV3 2O8OA 1BJQA 3WW2A 2OVUA 1YJLA 2VPVA 3PVOA 2W92A 1QJFA 3KLSA 2VZRA 4DB5A 1JW6A 1JZ3A 2PELA 1AXYA 3CJIB 4HG6B 1ZVFA 2Y6JA 2TNFA 3BPSA 2A6YA 2RR13 2WWSA 4NAMA 2X5IA 2GP5A 2PHXA 1W0OA 2ZBJA 4Q0UA 4J1XA 5T52A 1REDA 4NROA 5LASA 4Z07A 1DQ2A 3T4VA 2W39A 3WW3A 4E27A 1BBT1 3NVCA 4FT8A 2I07B 4OMDA 4QPIB 3UGFA 3FWEA 2CU5A 2P3IA 1B35C 3T4HB 1X82A 1RUI1 4Y1ZA 1FAYA 2WKKA 2RVAA 4JKKA 4LKEA 4DUWA 3AP6A 4XABA 1WMEA 3AMQA 3RSJA 1HRV3 4KL1A 2TBVA 1AHSA 4L97A 3HNMA 1ENSA 1DFQA 2IXLA 3T3YA 3I59B 1R1A2 2VD7A 2WFF3 2YFUA 3BN6A 2E6VA 4XMIA 1LECA 5FPVA 5GZDA 4YFZA 5DZFA 4ZPIA 1QJU2 5GKAC 5IVEA 2HEVF 1D0GA 3CIHA 1QQP2 2ZEZA 3DPRB 4D69A 2VBDA 5CB7A 3ZSEA 4GXLA 5KC5A 1YFUA 1V9U3 3HBZA 4LORA 5FZ1A 4A4AA 2VOKA 2Y64A 4CUBA 5F8PA 2NLRA 2AEYA 4QHZA 3ELNA 3B3QE 4XFBA 4A42A 4OYUA 3ILFA 4UAPA 4FPEA 5BNPA 1X36A 4P02B 5FZCA 4QKFA 3RYPA 3PUIA 2BBAA 3K48A 3RJRA 3VV1A 1L3JA 2ADDA 2DCKA 1RUC3 2X5IB 4P9YA 3M8LA 3LPFA 1OUSA 1R092 1SQ4A 4RFRB 4ASLA 2DCJA 4EQVA 5D8AA 3TAYA 1LHUA 1MACA 1UO9A 1VB4A 5FO9B 1FATA 1EV12 1QHDA 1M06G 3HD8B 3ZSLA 2VVDA 3PVBB 2BGPA 4XYXA 1H0BA 3CO2A 3OD4A 2VUAA 5JSPA 1QMJA 2XBO2 3HVDA 4IQPA 4LR4A 5K0UA 3ZSKA 4FFGA 3NJVA 4DOUA 4ZZ8A 4YARA 1KFXL 4ZZ5A 2VO5A 5T5OA 3WG2A 1IS6A 1FNYA 3ZLIA 1ND3B 3ZYJB 1GOGA 2WC2A 3RMXA 2PXJA 1AL21 5J3UA 1UU4A 4UWDA 4LBOA 1ST8A 3AKQA 4FO9A 1LKNA 5IJRA 4IV3B 2XB6C 3AP7A 1LRHA 3D0JA 3MBWA 3KHBA 1UZVA 3ME2A 5JZGA 4CXYA 1RUD2 1R082 1S4CA 1VBB1 2MHFA 1UYPA 2WL1A 2LUWA 4NR1A 2HYXA 3ILNA 5JSRA 4QB2A 4YZ2A 3GGLA 3KVBA 4A2UA 4EV0A 3N9NA 4CDXC 5LK7B 5FYSA 1VLNA 3OBRA 1AL0G 1J3RA 2VOVA 3Q9OA 2P17A 4PI2A 2R30A 3NV1A 5LK5A 2GN7A 4XETA 5DN2A 1KEXA 1W6PA 2ARCA 4EWEA 2EICA 4BQ4A 4OMCA 5D8AB 4K21A 3KCXA 1OOPA 1OKQA 2QE3A 3TRSB 4A41A 3PL0A 4P9XA 1NY71 3R4SA 4AVAA 2VOWA 2B5HA 4KU8A 3BTAA 1PO21 2JG9A 1U0AA 3E5QA 3E6DA 3MIGA 4CP0A 3LKJA 5E16A 4MGTA 3HEIA 2VVEA 1J3PA 1HLCA 4Q4X2 1JOPA 3ETPA 4GMP1 4AI2A 3VDDA 3EB7A 3H1YA 5I0DA 4HMZA 3WVJA 1RVF1 1W2OA 4YRDA 4MX3A 1ZRDA 1BBT2 3PMSA 5CYYA 2X05A 5H9QA 2WJSA 3VBUA 3UK9A 5CFCC 5IAXA 1FPN2 5FXVA 5JZGB 1NYWA 1QJZA 1QOTA 1HJFA 5GALA 1O5UA 3RVHA 1RUI2 4UFLA 4A3ZA 2RMU1 2XXZA 2QBXA 3AZWA 3KGZA 5IFTA 3AP9A 3BYWA 4P9LA 3U78A 3H8OA 1YIFA 1DGRN 3ILRA 5DABA 2JJ6A 4NHLA 4OHZA 3TYJA 1X8EA 4CDUA 2XQXA 1ZBE1 3ZXFA 1REEA 4QB1A 2BW8A 4XPVA 1COV1 4QX0A 3NO8A 2ZABA 5KHJA 3WV6A 4CU6A 2AH2A 3AKTA 4OCTA 1H1MA 2DVAA 2XWJB 3WEZA 1W0NA 3J7MA 2BQPA 1OSGA 1JYXA 4WM8C 3B9CA 1W6PB 2DVGA 2XJPA 1QXPA 4HFSA 3D3AA 3POJA 2GMPA 1AYM3 2WQ8A 1SPPB 5FZ8A 3MV11 2XH6A 4Y1XA 5HXMA 4OI1A 4CP2A 4COYA 2A3WA 2DUOA 4TZDA 2JG9B 2PHUA 3JXSA 3TBDA 1MQTA 1TME3 4XAAA 2ET7A 4PDWC 4AVVA 4QPGC 5FOBB 2EAAA 3WG1A 3I3DA 2K9ZA 2YGMA 1ULDA 2ZPXA 1TEIA 3B94A 1XNKA 2ZHNA 2P2KA 1C8M1 3MLLA 1KD7A 2J1EA 2CY6A 5FUIA 1PIV3 4NRQA 3VBUB 2ZX3A 3OUJA 2DURA 3LSDA 2CL2A 5TSWA 2Q5TA 3B01A 4ET7A 4D6QA 5JMCA 2VTXA 4KG0A 3VKLA 4E9KA 1U5IA 4PLNA 3ECQA 4CCJA 2BBVA 2JEMA 2I2SA 2RM21 2VZ3A 3WQBA 5L9RA 4CDUB 3WSOA 1VE0A 2ZMNA 3M70A 2C24A 4BIOA 5C5TA 1NCQA 1W2AX 2UU8A 2OIIA 2DFBA 1S0IA 1TVGA 1S0GA 4P9GA 5A33A 2R071 3EXUA 4BZ4A 1W8UA 4IEXA 4RS5B 1AL22 5F3GA 1O91A 1H2NA 1G6NA 1OD3A 5FYMA 1LULA 1S0DA 3O1MA 2DFCA 4OHYA 2LALA 1LGBA 1XU1A 1XE0A 1SZBA 1UYXA 2NM1A 2XJSA 4IXLA 3U11A 2EXHA 1XNAA 3THPA 5ISLA 1AXKA 4OUEA 1QQP3 2WNVC 3HBKA 4H3WA 1XYOA 4QU1A 1RYYA 4XDQA 1N47A 3E97A 5LW9A 2PFWA 3IN9A 1PK6A 5AC91 5LEKA 4GIQA 4LNVA 4I3GA 2C5DA 4XJ8A 1GNYA 4OUMA 4BB3A 4Y5SA 2BVBA 1OQDA 3LEGA 1LU1A 2HYKA 1RUE3 3ACGA 4FPOB 2W95A 2WNUA 4GB32 3K3NA 3OCPA 1PM7A 3B69A 5GLUA 4RR3A 3ON7A 4FTBA 1AX1A 1JYVA 2GZWA 2W46A 2PQQA 4CP9B 3FBYA 5LA1A 2A71A 2UURA 5IHRA 1YQ8A 5CG8A 1ND2A 4FQ4A 3VBRB 5F3IA 2JDPA 3BALA 5FPZA 3U4SA 3N7LA 3OJBA 4CU8A 1JXNA 2R49A 1JH5A
chains in the Genus database with same CATH topology
3JB4C 5AVAA 1IKPA 1RVF2 1NXD1 1AR73 3FLRA 3L9JT 2NQYA 1FI2A 1MS5A 4EN0A 3WDWA 4HK9A 4JGYC 2RMU2 4FOYA 2XVGA 4X6QB 4BE3A 4KGGA 1DF0A 4FP3A 4KG8A 4HKLA 2WZR1 2NYYA 4JDNA 3QLQA 4YVWC 1HXS3 1ZBE2 3J26N 2BNNA 2E7TA 1COV2 3IT8A 1R083 3NAPA 3FBMA 1SMVA 4AI0A 3D4KA 1VRH3 2RJKA 4AEDA 2A6WA 2IWGB 3AZYA 3HQXA 3R4DB 3WZ1A 1FXZA 3MIHA 3MI8A 1AR91 3D8CA 5BNNA 1OPOA 2ZS6B 2YGLA 1PHMA 2I45A 4DNYA 5FOJB 4OHXA 3VHRA 1WMFA 1ZYBA 4N53A 1CJDA 2XL7A 2EVXA 4WVVA 1ND2B 2JD4A 3GZUC 3BOWA 4YW2A 3SLIA 5K9YA 1H4HA 1DBNA 5T55A 1GV9A 4UBHA 1K5MA 5CNAA 4YM3A 5HCBA 3WUDA 4Q4Y2 3VZKA 2ZX1A 1I1EA 1PZ9A 5SV8A 1GYKA 2ZZJA 4YGEA 4BWOA 4FPCA 2RM22 5IT6A 1VBA1 1S1AA 4X8PA 4HK8A 1ZBA1 4WM7C 1RUI3 2R072 4PBPA 1D2SA 4DMIA 5I0SA 5CFDC 3MW3A 1JHNA 5AFBA 3SISA 1F5JA 5KHGA 5L36A 1UAIA 5JOWA 2YDEA 4MXWA 1ALYA 4AEDB 5C8CA 5IK4A 2WSUA 2VU9A 4W6WA 1EYBA 3GBGA 5BNNB 4QGMA 4BLJA 4P9IA 4H7LA 5KHHA 1A8MA 4HKOA 5KHIA 5AC92 4BHPA 5L7OA 3CU7A 1H2KA 2ZZQA 1D4M1 1PGW1 5BNOB 2Y0IA 2KXLA 2R061 1R1ZA 3M3IA 4C91A 3AKRA 4DZGA 4M3CB 3C3VA 4I0WB 4YZ4A 5FRAA 2R6QA 1PGSA 4CEWC 4W6XA 1QJY2 4E4DX 4YGCA 2FQPA 1QDOA 4N7IA 2CTVA 3ES4A 2B9UA 3T1MA 1VBC2 1W6NA 4WVMB 2ZHKA 1C1FA 1QOSA 1YHFA 3RRDA 2V73A 1OA4A 2GH8A 3MW4A 2HWC1 2MEV2 5FLHA 1ZZ8A 3VBFA 2VMIA 1Q8PA 1UIJA 3GHMA 4BQ1A 2Q30A 2EA7A 1IHMA 3FMGA 4B4RA 5ABJA 4I2OA 2OUHA 5C8CB 1AL23 4OULA 2AZ5A 2CV6A 4R9CA 2WZR2 3TN93 4COZA 3OY8A 1GNHA 4IV1C 3AMHA 4GH4B 1V6KA 4RGAA 4AG4A 2WLQA 1LJ7A 1VBB3 2GC0A 3THTA 1AR61 5L7OB 5KC6A 1OI6A 4L8QA 1LOFA 4W65A 1I9RA 1RUG2 4LULA 3LWCA 4RQPB 3SHRA 1X50A 4KU7A 1C57A 3USUB 4FTSA 3ZYIB 4XXPA 3PLQA 5I8TA 4IEWA 2UYAA 3WDYA 3WUCA 4R9BA 1WGPA 1LU2A 2ZGNA 4PIYA 3I4IA 1DIWA 1W6NB 5J48A 2PHLA 2ES3A 4HT1T 1CD3G 4NN0A 1DZRA 4PLOA 1X7NA 1PO23 2PN5A 4C90A 1G9BA 5A32A 1KS5A 2HWD3 3DL3A 1S0FA 4HPKA 4GMP3 5EZWA 3ZFGA 3ZSMA 4R4ZA 1MZEA 1BEV1 1W6MA 5ABJB 1D2QA 3CL1A 2XHKA 4IERA 1UPSA 2R1BA 3IDCB 3KT7A 2GN3A 3KCYA 1VBA2 3OY8B 5DUWA 5K8SA 2I74A 1ZBA2 1VR3A 2R041 2RMU3 2A3YA 2E53A 1TNFA 1UW8A 5L73A 3WNXA 2ZGTA 1ZBE3 2QVSB 1S55A 2IXJA 2Z42A 5FREA 4PQ9A 3SITA 4MGKE 2HWF1 5ACA1 4YW4A 5IK7A 3AFKA 3CNAA 1V6IA 1WBFA 2VOXA 1LGCA 5J96B 1D4M2 4LLFA 1DG6A 4AK3A 1WCSA 1OFSA 4BA6A 2R0FA 5C33A 1TMF1 3ZIWA 3H1WA 4Z82A 4KNCA 3ZFGB 4HETA 3U07A 4Q0VA 3JCIA 2DCZA 1C8M3 5T50A 2PLV1 4CDQB 3GNEA 4HSLA 4U2AA 1DQ6A 2WFPA 2PHFA 2YC0A 2A75A 1PO11 4S2GA 2XJTA 5DUVA 1IS3A 4AXOA 4B7KA 3KS7A 1POV3 3E5UA 2YROA 4C1WA 1DZTA 1RIRA 3LSEA 4ZKTB 5HXVA 4Q29A 2VW0A 1H8VA 1CIWA 3ZXEA 4ASMB 1ENQA 5BNPC 1H1IA 1EV11 4AFMA 4SBVA 2RS51 2XJQA 3HT2A 3MYXA 3CJIA 4Y1VA 5FLIA 4MUVA 2XKOA 2XBO1 2EF6A 3SCGA 4AQTA 4G3YC 2JE7A 3WG4A 5GZGA 5D8AC 3AZZA 4GKYA 3H1MA 1ZA4A 1SBEA 3GZAA 5I8YA 1FX5A 3IM0A 4J1WA 3AX4A 3TOJA 3URFA 1VIWB 4LE3A 2NN8A 3GBWA 1ULGA 1G86A 2Y38A 2OZ6A 5K0UC 3M3OA 4QPIA 2XJVA 1MVQA 2FZ1A 4FPKA 4R52A 4FP2A 1O3RA 1TQ5A 4AHXA 1UF2C 4XEZA 2KA3A 3D0SA 3JD73 3VGIA 3I7DA 3I59A 1A3KA 5JZGC 4XOGA 3RPQA 3S7IA 2JG8B 5EJ3A 4KQ7A 2D3RA 4BMBA 4ES9A 5DG2A 1MEC2 3QH7A 4YG0A 1WLDA 4AF9A 1UMZA 1MZ5A 3WDVA 2LM3A 4AHYA 3FLTA 4XF9A 4CP1A 2QQPA 1QGLA 1W39A 3P3PA 1WW6A 4MVTA 1LHNA 1PMIA 1VP6A 4YVSB 3MW2A 2R042 2E7AA 2RS31 2HWE1 4P14A 5GLVA 4Q4X1 1XE8A 2WZR3 3AMMA 1OOPC 3ZXKA 1FMD1 2GC3A 3B93A 2E9QA 2WA4A 1C5HA 1O4ZA 2ZX2A 5J09A 1YI9A 3CF6E 4JRAA 5CA6A 1CGPA 3IIAA 2HWF2 5ACA2 5C4WB 1FPN1 2ZX0A 4NHKA 3VDDC 3FE5A 5DDJ1 3ZYRA 5KHKA 2E7QA 2ZGKA 1YXWA 1AR93 1MR5A 3VHOA 1RUH3 4LA2A 1MVEA 3N7KA 4DFSA 5GZCA 1KJLA 1ND3A 3AM2A 5KXDA 4JGZB 1TMF2 1U5YA 2PAMA 2C0ZA 2IXHA 4CDUC 4IV3A 3LA3A 1SBFA 3D5OA 1QKQA 1AZDA 4H7MA 3WCSA 2AYHA 3WINE 5FFOC 4MGZE 2RE9A 4FPJA 2PLV2 4BMEA 1NG0A 1IOAA 3I2DA 1NE4A 2ZMKA 1YCIA 1WCDJ 1NXMA 3RZZA 1FOD2 4HANA 4DXZA 4D7TA 1PO12 3NV2A 1JN2P 4N43A 1VBA3 3ZIXA 4AVBA 1H8TB 1ZBA3 3IDBB 4HVQA 1VALA 1GNZA 2RS13 4OI0A 3ROUA 2WT1A 3R05A 1RGSA 3ES1A 1TNRA 1MQTC 2AENA 1JBCA 2RS52 4K1ZA 4K1YA 4AEMA 1AYN2 5C6CA 4P9WA 4TLFA 5DUUA 4LBNA 1RHI1 3V0BB 2SBAA 3X29B 1RUF1 5BXXA 4HVRA 2DCYA 1RJ7A 4I3PA 3O12A 5KXCA 4LLOA 1BYHA 1DGWA 5GJ6A 3R6SA 3MEPA 5GZFA 5EFUA 2D5FA 2WSVA 1BXHA 3GZTB 1D4M3 3ZSJA 5HI0A 5FDBA 1O4YA 1MS1A 5CBLA 2R063 2XL9A 1Q8VA 3MICA 1DZQA 1NCQC 1GR3A 1JUIA 3SH4A 3MIBA 1JYCA 3WQ1A 1AJKA 3LOBA 1BKZA 3AMPA 4ONUA 2Z69A 1V6MA 1A78A 4IL7A 2NZ9A 4Y26A 4YZ1A 2TUNA 4N43B 3VBSB 1SACA 1YYNA 1RL3A 2HWC3 2WQZC 4AE2A 1AR81 4ZXKA 1YFWA 2QNKA 2W68A 4GB31 4IEOA 4N90A 1PK6C 1RINA 3PTYA 5C9AA 1LODA 3ZN5A 5LEJA 1NE6A 1QXRA 4XBNA 3O0WA 4I0AA 1LHVA 2RS32 2HWE2 1KFUL 2WNUC 3SCHA 4RR3C 4R9DA 1FMD2 2VNRA 3GALA 2H6BA 1F31A 2PTMA 3NWKA 1U5XA 5B2GB 1AR63 1V00A 1X8MA 3M3CA 2Q0AA 1YO8A 4FOQA 2WS92 3ZFEB 1MS3A 5I0UA 1VBD2 2XWBB 1GICA 2ET1A 4LO6B 2B46X 3JBG1 2HWB2 4K8FA 5DDJ2 3VBOC 2X53S 3WW1A 1UKRA 4QD2A 1SLBA 5E88A 1GFF2 2ZKLA 1DQ5A 4JTNA 3AKSA 4IEVA 3SMHA 3TNQA 4CDWC 4RS5A 5FPXA 4A3XA 4XHBA 2VH9A 1DU3D 2JXAA 1RMU2 1ZZ7A 2K0GA 1DGLA 1HRI2 1AJOA 1HKDA 2W0XA 2XVLA 3H0OA 1HV1A 1CN1A 3AYCA 1CAUB 4XFHA 1NA1C 3NAPC 1QF3A 3AFGA 4K20A 2QZ3A 2Y0OA 5C9AB 1WBLA 3PVEA 4ATEA 1BEV3 1D4VB 5IUQA 4XTPA 4WVZA 4ITCA 1V6NA 4AEDC 1KJRA 4Q4W1 1H1AA 3J9SA 3V65A 3VLBB 3BPZA 2WT0A 1M4WA 2R043 3PMEA 4E4SA 4Q4Y1 1UCXA 1NCRA 4ISRA 4N53C 4NOTA 2QDRA 1ZZ6A 1UPIA 1IS4A 1PVC2 3HR9A 1RHI2 1K5MC 3VZMA 4E2QA 1RUF2 4A7YA 4Y1UA 2JDZA 4LEJA 3VBRA 3H8UA 1W2UA 1B35B 4P9JA 4AW7A 2VQAA 5EXOA 2IXCA 4UW6A 1C4RA 2WLPA 2KM2A 4QMAA 4P5HA 5IK5A 4AVTA 4R8HA 5CADA 1SLTA 2ZAHA 4M0NA 4MYEA 4PIZA 2UY9A 3MZHA 1R1A3 2W08A 1UZZA 1ULFA 4JC1A 4F83A 4YSFA 1S0JA 1N1YA 2QDNA 1QJU3 4COVA 1TMF3 4URTA 5A3MA 2UWAA 3LA2A 1C8NA 5F6LB 2PAKA 1DQ4A 2YUEA 4DRVA 2AR6A 1URXA 4EN8B 5C8CC 3W59A 1LEDA 2E63A 4AI8A 1CESA 1POV0 1AR82 1JYIA 1CJPA 2CAUA 1IGOA 3HIFA 1NCRB 3VKFC 4JQRA 5JDBA 2Q4SA 5L7OC 4QU2A 2YMZA 1QJY1 5J98B 1R093 4JDMA 1VBC1 3P3NA 5EYXA 2BWCA 5LRRA 4XXAA 1EV13 1V6LA 2VULA 3WHUA 2RS53 3BODA 4LBKA 5T54A 3QH6A 2DCTA 2PHWA 1LHWA 3FHIB 3ZXAC 2MEV1 1FV2A 3OPZA 2XBO3 3IPVB 1ZRRA 2AGSA 4L11A 4AQSA 1AXZA 4YZ3A 3KCCA 4MLOA 3MF6A 3E6CC 1NLRA 3W58A 2BVVA 2FBEA 3JBG2 3E6BA 3MFCA 1YFYA 2EAKA 1N3QA 3VBFC 2QFEA 4EN6B 4HZFA 1CAWB 4S2DA 3MLKA 1RUD3 5ABJC 4IEPA 4EROA 1RUG1 3H7JA 1IQAA 2A73B 4CDXB 3D82A 4AFDA 2XVKA 4OZXA 4XQDA 4YYOA 4Y22A 4AGGA 1WUVA 4K9SA 3FUQA 1EPWA 2RR11 1KRIA 4QQPA 1E57A 1LOFC 1JOJA 3ACLA 4EN7B 3QCWA 3N35A 3B00A 4Q4W2 2A5ZA 1W6QB 2DVDA 5BNOA 1QOOA 1ZREA 1NQJA 4DINB 1MZFA 2ZHLA 1J59A 4QGLA 4B7EA 3H3ZA 4M3CA 2RS33 4PDWA 1N1VA 1OLRA 4Q4X3 2BPA2 4NWWA 4Q0SA 2NMNA 3RDIA 2WIIB 1FMD3 5DZEA 3AP4A 2D44A 3UV9A 4YW1A 4BM8A 2WFF1 1PZ8A 4DQAA 3H50A 4WVMA 3ZMNA 1BBT3 5CFCB 2DTWA 3MGUA 1Z7S1 2JENA 1FPN3 2DF7A 1PVXA 1KITA 5DDJ3 4YG3A 1LOEA 3S7EA 3GF6A 5CG9A 2ENRA 4R9AA 3MPPG 4F8AA 1WLCA 3M1HA 3E5XA 2AREA 4Y22B 4Z2WA 5CAZA 1VB2A 1ZRCA 1LOGA 5GLZA 4GKXA 4MZUA 3ZFFA 1UD1A 2WT2A 2EXKA 5T5LA 4GH4A 1QH6A 1O4TA 1APNA 2D98A 4N9IA 3WT3A 4Q4V1 4L99A 1DDLA 4YLZA 4RQPA 4PF5A 4D7YA 3USUA 3SXWA 1UN1A 4PDWB 3JB8A 5H9PA 1C5IA 1LB2A 2MNGA 4COWA 4JV4A 1GANA 5KWRA 2BFUL 1PGL1 3ETQA 3VBHC 1GZCA 3WP4A 4ZU4A 3EJKA 3VKMA 2H0VA 1WW5A 4FPHA 1KS4A 2P34A 4ZU7A 2OA2A 2V5YA 3M3EA 4WZFA 4UW4A 4LUMA 1RHI3 5HCAA 2GH2A 4XMAA 1RUF3 1LEMA 2VW1A 5BUVA 2QUOA 1JUHA 3H9AA 4L2NA 4Z8BA 2BFUS 5JAXA 1MS4A 1RTVA 4BPZA 3GBFA 2XJUA 1AF9A 3ZFFB 4RL7A 3QACA 1RUJ1 5BV6A 3OBTA 4AVSA 2X29A 3KQRA 4RHV2 4XQWA 3JQXA 2WNVB 4Q1RA 2CWMA 4D3WA 4Y20B 3WP3A 4HKWA 4PIXA 1G8WA 2YXSA 3KD4A 4NVPA 4XFIA 3CJIC 3WP5A 4CTEA 2PHTA 1WW4A 2G9FA 2ZHMA 4EWAA 2RR12 1AR83 3FJSA 5T5JA 2GMMA 4XF4A 3PJQA 4GB33 4UW3A 4FCAA 2Q1MA 4YW3A 4Y4YA 2MPFA 3J8F1 5EWSA 3AYEA 4QPIC 1ENXA 1NOVA 1MEC1 1GZWA 1DGRA 3LB9A 4QM8A 1QXJA 3DF0A 1HRV2 2CGPA 4XQ4A 1Y9QA 3A4UA 3AYDA 1RVF3 2WFF2 1OPMA 4PJYA 2Z2SB 2BNMA 3N36A 3VBOA 2OZJA 2WA3A 4CDQA 2Y26A