2IFRA

Crystal structure of scytalido-glutamic peptidase with a peptide based transition state analog
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
206
structure length
204
Chain Sequence
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTAILQTGFDWYGDGTYDAWYEWYPEVSDDFITISEGDSIQMSVTATSDTSGSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEFVPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVSCSYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of scytalidoglutamic peptidase with its first potent inhibitor provides insights into substrate specificity and catalysis.
pubmed doi rcsb
source organism Scytalidium lignicola
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Scytalidopepsin B
total genus 43
structure length 204
sequence length 206
ec nomenclature ec 3.4.23.32: Scytalidopepsin B.
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01828 Peptidase_A4 Peptidase A4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.700 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ifrA00
2IFWA 1Y43B 3TRSB 2IFRA 1S2BA 1S2KA
chains in the Genus database with same CATH superfamily
1QJU1 3LZZA 4LO6B 5L9VA 1AR82 2AREA 2D3PA 4LJHA 3JU9A 1FATA 2O8OA 3VZNA 1R092 2WR9A 5LB6A 4QKDA 2JD4A 4WM8B 5E88A 4UBHA 5LW9A 3JXSA 2C0ZA 3MF9A 2NPIA 1BK0A 3WNMA 3N9MA 2W92A 2WS92 4RGKA 1RUE3 1QXPA 3SMHA 3M3CA 4UFKA 5F5AA 4A3ZA 1ST8A 4DUXA 2FMYA 2XB6C 2J1UA 4UFIA 2XJVA 1SLAA 3OUJA 5D2AA 4PJYA 1IPKA 1BCXA 1LHOA 5FAXA 4QPWA 4O9EA 2JDUA 4RR3C 5A32B 3WG4A 2J42A 4DY5A 2FZ2A 1OFSA 2D5FA 2V09A 2D7FA 3OEBA 4MUVA 2QKDA 4UF0A 2BEOA 5FLJA 2W46A 5FMCA 5FZFA 3WLUA 2TEPA 5CA6A 1W6QA 3CNAA 3HQRA 5DAXA 3TAYA 4TN7A 1ODNA 2GMEA 2YDEA 1XXNA 2XWBB 2ZXQA 2B39A 1CZVA 4LUMA 4Y5SA 3ZX7A 1RUH1 1UMHA 3ZFEC 3WNXA 3GALA 3WUCA 2WNUB 2D6KA 3LEGA 3KS7A 3QOPA 1RUD1 3AYCA 1HRI3 1AR83 1OLQA 2H0BA 3AYDA 3USUB 4XXPA 2UY8A 3HNYM 4MSVA 2CGNA 4D7TA 5IFTA 1IKPA 4Z92B 1POV0 4E2GA 2ZKLA 3HJRA 1R1ZA 3DKWA 1LJ7A 2GC2A 5I0TA 2VCBA 1A8MA 1E5HA 5D8AC 2O0OA 3NMBA 3WNOA 4FOQA 2RM22 4BPZA 4EN6B 2LALA 1R1A1 4ES8A 3BTYA 1DQ4A 3B69A 4SBVA 2BRTA 4NMIA 2WFPA 2XQRA 3INAA 3RRDA 4CP9A 5DZFA 4NIHA 1SLCA 3VDDC 4DQAA 1ZRCA 3RMXA 5JZGC 3TEYA 4JDMA 4COUA 3ZPYA 3E6CC 3ZSLA 1X50A 2BWAA 2P4EA 2I45A 2J1TA 1AL0G 4LBLA 5CKNA 2WFF2 4QDSA 3I59A 3QCWA 4DS0A 1RHI2 4YG0A 3RVHA 4CA9A 2ZACA 3AL6A 3GZEA 4NWWA 2CNAA 2EXIA 2VD7A 4UWDA 4CEYA 1C28A 3PHMA 1ULPA 3WP6A 4EZ4A 1UIJA 2WT1A 4XQ4A 4BYYA 2RS53 4LTAA 1L3JA 4DXSA 2BFUL 3T4HB 1FYUA 1LR5A 2MNGA 3BIEA 4WM7B 2FHRA 1QJX1 2X09A 1NCRA 4IEZA 1RUJ2 5LASA 1C4RA 2Q1ZB 1XE8A 3NSTA 1YQ5A 3RJRA 4RR3B 5DUXA 3IDBB 1GR3A 1I5ZA 3B93A 1W39A 4Q4W2 5H9PA 1BMV1 1R093 3WX5A 2VCMA 4LIVA 2WZR2 3ZYRA 3AKRA 1RC6A 4FCAA 1J3PA 2Y26A 4LT5A 2PTMA 1HRV1 3SXWA 2BTVC 3OJBA 4XW3A 1MPXA 2DV9A 1KJLA 4WV8A 5JI7A 4GH4B 1OI6A 1EPWA 1MZ5A 3I2IA 1F8VA 1IZ3A 3MFAA 3DGTA 3TEXA 4IEPA 5FOJB 2VW0A 3POSA 4YSFA 5CAZA 5IVJA 3ACFA 3PU8A 4XILA 1N47A 2D97A 4Q4V1 1WW6A 4B4RA 1HRV2 4FTSA 2R0HA 3WW4A 3GBFA 1ZBA3 4EN0A 1H9WA 1UF2C 3N3HA 4CUAA 1FOD2 1WW4A 2Z4FA 1LHNA 1TVGA 1RGSA 2QQOA 3JBG3 2WLQA 3UV9A 1UAIA 1JU4A 1UYYA 5H9SA 2XDVA 3K4ZA 1I3HA 3N7KA 1C57A 2HEVF 1WMEA 1UOJA 1BYHA 1RVF3 4PDWA 1VPHA 1UYPA 2GC3A 1R64A 1H1IA 4FQ4A 2P6CA 4NVPA 1KD7A 3VBFB 1B35A 3UGHA 2D6NA 3RZGA 2HEWF 2F6BA 2C6SA 3JZVA 3S57A 3A0NA 2C5DA 5JSOA 1W04A 2QZ2A 5EZWA 3U0ZA 3O5SA 4QPIB 3H0OA 4KG0A 4XQWA 2ZAHA 3J7NA 2WA4A 2DVGA 4ISQA 4LHNA 4F8AA 5C4WB 3MICA 3B02A 2H0VA 3WDVA 2Y8KA 4Q4X3 1W8FA 5FBJA 4ATFA 1VBD1 4CCOA 2MHFA 2QJVA 4CXWA 3BI3A 4NWVA 5J98B 5JXHA 2BGOA 2AH2A 2VBBA 2V4AA 5FO9B 3H42B 1RUF2 2RDSA 2W91A 2XR4A 3OGVA 2E7QA 4PLOA 3W5MA 2ZGRA 4C0BA 1JTZX 3HNBM 4P02B 1SCRA 1TMF1 4I2OA 4UT5A 1NY71 5DMYA 1OVSA 4MYEA 1UZYA 3FMGA 3T09A 3JBG2 3ZFFB 3WOGA 4LKDA 5AVAA 4CCLA 2ARCA 1T2XA 1SQ4A 2L9LA 5A7OA 5F37A 3I59B 3MIHA 4ASMB 2EF6A 5C4WA 4U2AA 1XSQA 3ZM8A 3S0MA 4W8JA 3A23A 1DZQA 4QXHA 4QM8A 2ARAA 5DQ0A 1RUD2 4WM8C 1GQHA 4OQ9A 2VZ1A 5ABJA 3RWKX 2WINB 4Y3OA 2JB4A 3AXDA 3ME2A 3S5QA 3WQBA 3MFCA 4B8EA 4LBOA 1JS9A 1UN1A 3LFIA 4AQ2A 3NV2A 1KS5A 3KD4A 4IE6A 4LHSA 4ORFA 3FBMA 1MS4A 4X6QB 4HKOA 5FZOB 1H2LA 2MEV3 3N7JA 2PMWB 3LB9A 3FE5A 3H8UA 1VBB3 5FYYA 5JOYA 1QF3A 4JDOA 5CYYA 4AGGA 2PLV1 1X8EA 5LATA 2JDMA 5CG9A 2B5HA 1JHJA 2RJLA 2VR4A 4GB32 3MF6A 2JDHA 4PIXA 3H8OA 4IEXA 4HZFA 1NY72 3HD8B 4OI1A 1QU0A 3NJYA 4E2QA 1YWKA 4NHMA 4G4FA 2QE3A 4QU2A 1Y9MA 1EAH3 1LCLA 5J1XA 1F35A 1RUF1 4QU1A 4LHLA 4UW6A 3WHUA 5A1LA 4EYUA 5A1AA 1RUC2 5C8WA 5HCAA 4FXGB 4N53B 5FMBA 3JB4C 2WWUA 4LK6A 4E4HA 3PIJA 4X8NA 1GP5A 1C3HA 5HV4A 4IETA 2WA3A 3WUDA 2IUWA 3WDUA 2ZA9A 4QPGB 2FDGA 2VM9A 3K51A 2R072 3VZJA 4Z8BA 4E4ZA 2HYKA 2ZMNA 3IBMA 3K46A 2YC2A 4E8DA 1GNZA 3P1IA 3ZXJA 1RUNA 1PMIA 1U5IA 3E1F1 3BOPA 4UAPA 5FLHA 3O1UA 3DF0A 2EXJA 1L7QA 3LEMA 4BMEA 1CX1A 3AMQA 4ES9A 1PX4A 3T2PA 5JVVA 3WCSA 3O0XA 4LOTA 4O9GA 3VDDB 2WO3A 3SISA 4QQLA 1GZ9A 4QHOA 2C4XA 4Q4W1 2XBO2 1LHWA 2XOMA 3VLBB 1FMD3 3BU7A 1URXA 1X9TA 2WO1A 3RZZA 4B7KA 5FYVA 3DPRA 5B2GB 3OUHA 1ENSA 3ELNA 4LNVA 5F5QA 1ZRFA 3ES1A 3ZKUA 1QKQA 2FDKA 2JDNA 3UYJA 1Y43B 4QWNA 1GZTA 4QPIC 2HWE3 5J36A 2DVDA 3VHNA 5K0UB 3ECQA 4DEVA 1HXS1 3N9LA 3PUQA 2D44A 5CVRA 5BNOC 1XB9A 1SFNA 1PM4A 5CNAA 3UKVA 3VBHA 1X8MA 2QQPA 5LBCA 3E6BA 1UD1A 1I9RA 2ORXA 1UNBA 3IPVB 3OD0A 1DYOA 2EAAA 3VBFC 5C8CB 4IE7A 1YYNA 1O4YA 1EV12 2HLEA 2R16A 5JZGB 3RZHA 3MLLA 2GH8A 3OBTA 3KV6A 4XXAA 1XSRA 1DYKA 3DV8A 1PNGA 1SACA 5SV8A 3R6SA 1G9BA 2GC1A 2XQXA 2VZOA 1HV1A 1UXXX 3MPBA 3APBA 5AC92 5FUNA 3HR9A 2E9QA 1VALA 4G3YC 2XBO3 2JXAA 2GU9A 1X82A 3AP6A 1RHI1 3DECA 4K1ZA 2ES3A 4RHV3 3SH5A 3WDXA 1SLIA 3G7DA 1CESA 1RUD3 1BEV2 1UU5A 2EXHA 2P5BA 4JZRA 1H2MA 1TNFA 4XFGA 4A41A 4RFRB 1PK6B 4Z07A 4CZSA 4P08A 4OI0A 4GB31 3ZYPA 5E8AA 5J7MA 3ROUA 1UY3A 3THPA 3VN4A 2WS93 3LSEA 3KQ4B 4QKFA 5I0SA 3AZWA 1ZZ9A 3DXTA 2B8MA 4Q26A 2XL9A 2DTYA 1YCIA 4LXLA 1S0BA 1YQ8A 2UWBA 4PBOA 2PQSA 2OZJA 3BUCA 4IL7A 5F3IA 4YGEA 1UPIA 1VBD3 1CN1A 4XBLA 1WCDJ 2W39A 3IKWA 5E6HA 4YZ5A 5KXBA 1H8TA 1NKGA 1MS9A 3VGIA 3W5NA 2XH6A 1RUH2 4HK8A 3LPGA 3OSDA 3ZFEB 5FZ0A 2Z5WA 4QDRA 3CKHA 5L73A 1K5MC 2VU9A 5FY0A 5F2WA 4AI0A 3FWEA 2VMCA 1XNDA 2A3WA 4AQSA 2P17A 5FYBA 1HJFA 2D6OX 5CFCB 2P3JA 1RJ8A 4LBQD 2OUHA 2W1QA 4Q4W3 1NE4A 3CIHA 3ZXDA 1AX0A 2A6ZA 4AG4A 4ZU7A 4Y33A 1H9PA 1VBC1 4FP3A 2JDPA 5FY4A 3ZN6B 3O1SA 1UU4A 3CJXA 2PHFA 5EJ3A 4C1WA 1AYN3 2GC0A 3O12A 2ETEA 2YU2A 4ZU4A 3T2QA 1W6NB 2YMZA 2CHHA 2ZGSA 3DYOA 4D7YA 3OYWA 1TEIA 4P00B 5JXJA 5FY7A 3UNPA 1GANA 5K0UA 1GOFA 4PBPA 5D1IA 2AEZA 1HRV3 3BGAA 1MS3A 1Z78A 1X7NA 1AL22 1B35B 1W8UA 1J59A 1MVQA 1E5IA 3DPRB 3DYPA 2VZRA 4O7XA 4AZZA 2Z69A 5CADA 4FPOB 1STMA 2GN3A 2QUOA 3WP4A 4BIOA 4FPFA 2SLIA 4LUKA 5HCBA 1XNTA 3FLTA 1UY2A 4L11A 3LWCA 1OOPA 4LBJA 4NRQA 4E2SA 1PGL2 4ZZ8A 2W1UA 1IGOA 4EZHA 1DQ1A 1V6LA 4YVSA 1UMZA 2A7AA 1H2NA 3WV6A 3SHRA 1DQ0A 1WBFA 3RDIA 3RPQA 4AI8A 3HT1A 2D3SA 4IERA 4JQTA 1F4AA 1KGYA 4RA0A 2J1AA 4XUOA 1SHWB 3JCIA 1MS1A 3KV4A 4FOVA 4DB5A 1JI6A 3IN9A 1RMU2 3NKGA 2C26A 2Z79A 1ONAA 3O7OA 3S30A 5IVBA 5FP4A 3THCA 2QVSB 3PUAA 3DKQA 5T5JA 5EFUA 1W8TA 3I54A 1QJY2 2D40A 2HWD2 4K9SA 1PNFA 1HLCA 3C2UA 4K7JA 5LA9A 2VZUA 2WZEA 1LOCA 2CDPA 2PHUA 1OLMA 3NVCA 1AJKA 5FZ8A 5IVYA 4AVSA 4B7EA 2BV4A 1C8M3 3WQ7A 2XONA 5I0UA 2K2SA 1KRIA 4DIQA 1LU2A 3A22A 4P5YA 3AK0A 1RMU3 1CD3G 2A73B 2Q8OA 4BLJA 3GJBA 1FNYA 4EJRA 1JZ3A 2YBSA 1H6YA 3MIDA 5FPZA 4Z2WA 1JOPA 2PN5A 3BYWA 1VJ2A 1W8WA 1IS5A 1D4M3 4YZ2A 4HETA 2VGDA 4ITCA 1LOFC 4L92A 4O65A 4C1XA 3ZPOA 3IIAA 1VBC2 5FP3A 5LBFA 2PLV2 2QCSB 2XKPA 4Y1VA 3DXUA 4OCTA 4BQ5A 4JC1A 4PLNA 4D6RA 1GQGA 2AZ5A 3H8XA 2ZS6B 3LOIA 3B00A 3PVBB 4PQ9A 4XMIA 1EV13 2ZHMA 1NUKA 3AJYA 1ZA4A 3U10A 1ENXA 2PHWA 1NOVA 3VZOA 4DUVA 1QXJA 5IFPA 1AYM2 3IZOA 5LK5A 3VHOA 2BNMA 3QLQA 2ZZJA 1LOFA 3L2HA 4FPJA 4HSLA 4QPGC 1RINA 4NHLA 3RFRA 3PMSA 3EXUA 5KHJA 4IEYA 5T5PA 4CRQA 4CDXC 3CJIC 1KDMA 3MUZ1 3K3NA 4ZXKA 5CFDB 1X9PA 5FKCA 3AFGA 2OW4A 4Y5Z0 1TME1 1V0AA 1EAH2 1UOBA 2WBKA 1PIV3 3OPWA 4AEKA 2DF7A 1PHMA 5J3UA 2OPKA 3LPFA 1NYWA 3AXEA 4D69A 3U4XA 1COV1 1TZOA 1IPJA 2GMPA 4J1XA 4GAZA 4R4XA 3D82A 4PLMA 3O0VA 4J6GA 3U1XA 2GP3A 3AKSA 1NT0A 2G1MA 5FBZA 3CMGA 5KXCA 3USUA 2VMFA 2DCTA 3TNPB 4BOWA 2IWGB 4BHPA 4IEOA 4Q8LA 2VQAA 2XVLA 4QQPA 1ZRRA 4I3PA 1GSLA 2Y6GA 1BEV1 5FJKA 2IC1A 2RDRA 2XGXA 3HN1A 5FK7A 2XLFA 3M8LA 1BKZA 1NA1C 4BWOA 4QMAA 4Q5OA 2E32A 1FAYA 2VZ3A 2UURA 2XPJA 5FFOC 3AMMA 3J26N 4RN5A 2W52A 5IK5A 5K4LA 1F15A 2E6VA 3SNMA 5L36A 1DIWA 1N3QA 1XU1A 2FCUA 3KLSA 4F83A 4KWJA 1IPSA 3PVEA 5I0DA 3RZLA 1UKRA 2B4KA 1B35C 4UF0B 3ZYFA 2DUOA 3R4UA 4JHTA 1BVVA 2RS12 4LLFA 3J8F3 4YM2A 1L7LA 1ALYA 1PM7A 1QJU2 3VKOA 2B9UA 4CE8A 5C9AA 2C24A 4GD4A 4XHBA 1MACA 2W1WA 1OQEA 4MVTA 4V2WA 5ANNA 1JUHA 4GJYA 3VDAA 4C91A 4MX3A 1UPSA 1OKQA 2R0FA 4NHXA 1QEXA 1GNYA 3AZYA 3I3DA 2JECA 2R043 3UKNA 4RR3A 1XE7A 2IXIA 2JICA 5LBBA 1ZX5A 4B1LA 2ENRA 2YC0A 3FL7A 3W20A 4LLOA 3TOJA 2AYHA 5GLZA 1LTEA 3OF1A 2PHDA 3B9IA 4FQZA 5HBAA 3ZR5A 4EWDA 2OQ7A 2I74A 2PELA 1CAXB 3L2YA 4NPLA 1ND3B 3URFA 5BUVA 1W90A 2E7AA 2ORZA 1JYVA 4KU7A 2DCYA 3N9NA 2UY9A 2VMDA 4CU9A 1J1LA 4COYA 1NG0A 4RSUA 5A3WA 4Y4YA 2FD8A 1MZ6A 2W95A 1XC6A 4C8DA 3MIGA 3D0SA 4Y1UA 2WZPP 4XABA 3CEWA 5D21A 4XHXA 2BVVA 1LAJA 3OD4A 3SQOA 2ZAAA 1YJKA 3M1HA 1MR5A 1A78A 3BTAA 2WYFA 1U5YA 2QZ3A 5JSRA 1D4VB 2ZEXA 2ILMA 2IXHA 3MIEA 2EAKA 3ZXFA 1QQP3 3V64A 1T6BX 1VBA3 5GZDA 1R081 3MGUA 2K9ZA 1ZNPA 4Y26A 2HWE2 5IHRA 1F2NA 1CONA 4LMFA 5JXGA 1UY0A 5FZHA 5BNNB 1Y7BA 2P3YA 5HCHA 1Y9GA 2ZGTA 1YFWA 4NIIA 3POYA 2YU1A 4RQPC 4XZPA 4FOYA 1J83A 2LS6A 4WVZA 1H4GA 2OZ6A 3KGLA 1ZZCA 1V9U2 1WCKA 5FUIA 4CU7A 2XLGA 1F4HA 3CZJA 4GZ9A 4XC9A 1UYZA 3IAQA 4Y1ZA 4I0AA 3KV5A 3T3YA 3MEPA 1FI2A 1Q43A 1UZVA 1RTVA 1ACCA 2CAVA 2JDZA 2JG9A 4DFSA 2CGOA 3UGGA 2B9VA 2O8QA 3NV1A 1QJY3 2RM21 3OBZA 1HJGA 2IVIB 3AZVA 3D6EA 1ZBA2 3GCWA 1LRHA 1W2TA 1UU6A 3E97A 1W2NA 1C8M2 2BFUS 4XJUA 4CDWC 5C5UA 1ULCA 3M3QA 3ACIA 4Q4X2 4CEWB 1XNKA 2EXKA 4MGZE 1W6PA 4HPKA 3C8XA 3ZKYA 1CAUB 4AFCA 4E4DX 5C3RA 5JI9A 3O1MA 1RUC3 3WNKA 3ILFA 2A5ZA 4QX0A 2ZX4A 1KS4A 1DLLA 2VUJA 3EO6A 2IXLA 1CZTA 4CDUA 1SFYA 4WVMA 5LY2A 2DU0A 2WAAA 5IVVA 3J8F2 4LA3A 3WNLA 5C3PA 3VKNA 2OYZA 2WABA 1A34A 1HX6A 2ZHLA 4NHYA 3ZFEA 1MS8A 2C9AA 2DFBA 2ZGLA 1BK1A 5L7OB 4AVCA 4QPIA 1C8M1 1GV9A 4YLZA 1W8NA 2OPWA 4DY3A 4XTMA 4LKEA 1PO21 5FQ0A 2JJ6A 3VBHB 1PVC1 1W6PB 4HPKB 5FZ9A 4XFHA 5JOXA 1XOYA 3LIGA 4LO5B 4LKFA 5K9YA 1E5SA 2WLPA 1AVBA 4ZZ5A 1WMFA 2NLRA 1YIFA 4LBMA 3VBRA 3X29B 3K2OA 5I93A 4XPVA 4YVWC 3VKFC 3ZLIA 1IS3A 1IS4A 5FZLA 3KF3A 4RYDA 4BU2A 5J37A 2HYXA 1NXD1 3BIWE 3L9JT 3OBAA 3FBYA 4XOGA 2ZX3A 1R082 1QNWA 2GMMA 4QB2A 4YW7A 1HRI1 1NXMA 3NNLA 1GWLA 3H7YA 3FFZA 3P5BA 4OULA 3SEPA 3WP5A 4NAOA 2JKXA 4XMAA 3JB8A 1BZWA 1G86A 3KCYA 1AJOA 2Q5TA 4XF9A 1SFPA 3MW2A 2QQMA 2VQ0A 4Q0PA 5DUUA 3PNAA 3K4DA 1S0GA 2X5IA 4XURA 3TNQA 4UOJA 5FZ7A 1US2A 3H3LA 4Q1RA 1QJFA 5FYSA 4Y5TA 3VD9A 2ZEYA 1W0OA 5LRSA 1S0IA 4M4RA 1ULDA 4FPHA 4IDZA 1F31A 1RUE2 1HQLA 2RR12 4JKLA 4XDPA 2W0XA 3RMYA 1I1EA 2HKXA 1JOBA 2WT2A 1W0PA 5EP9A 5F3CA 1MZEA 4CVUA 1W3VA 1CGPA 1RIRA 2Q1MA 1PVXA 3N9PA 4CSWA 4A7KA 4CUCA 4Y1XA 2PFWA 1W0NA 1BBT1 3M2MA 4NHKA 5FIXA 1HB2A 1CWPA 5FMOL 1POV1 1OT5A 3I8TA 1CAWB 1J3QA 3B7MA 4GWIA 3T0BA 3UETA 4XJ8A 1IG0A 1R083 1HQWA 3I2GA 2UWCA 2YUEA 4Q4V3 4OZOA 2X10A 5ABJC 4QDQA 2NYYA 2RMU3 4M0HA 1E57A 4YNIA 2A70A 1TNRA 4H55A 1QH7A 1PIV2 1W9SA 4GWNA 4EQVA 2R7EB 4XJWA 4FFGA 2DVFA 2VC9A 3PDQA 2GAUA 1AXKA 2R071 3EMRA 3PTYA 4UYBA 4XUPA 2A3YA 2Q30A 3T2OA 1MEC3 3K77A 5DZGA 2DU1A 2IZWA 2VH9A 3TWIA 4JTNA 4Q29A 2XHKA 5JOZA 2WNVB 5FZKA 1Z7S3 1NCRB 2JKBA 1FPN1 3WP3A 3ACHA 4GALA 5FZ3A 1U5ZA 2E26A 2WFF1 1CAUA 4JGZC 4XZUG 1DG6A 1OLME 5C9AB 4BXFA 2WIIB 4OQ8A 4M01A 1VAKA 1RUG1 4EWAA 5IJRA 2Y60A 2H6BA 5IWFA 4R4ZA 2XXZA 3NNGA 4OHWA 5KC6A 2IXCA 5A6YA 4NR1A 4K20A 2VJXA 4DINB 1DF0A 5I0RA 1WLCA 5FZMA 5LBEA 2ERFA 2JE9A 1G8WA 1A3KA 2VTFA 1QQP2 3EYPA 1COV2 1Y3TA 5IT6A 1GNHA 3WHTA 1NLSA 3IDAA 4H14A 5FZCA 3ASIA 5CB7A 1J1TA 3S7EA 3O1VA 5T5LA 1ENQA 2VNRA 3A21A 2O1QA 2GZWA 3IMNA 1D0GA 4N8MA 4FAGA 1C1LA 4OLLA 2BZDA 2E63A 5FMDA 1ZZ8A 3E5UA 2P1BA 1SG3A 5DZEA 4NRMA 2ZEZA 2MPFA 5JSPA 1PO23 1LENA 3LE0A 4S2HA 1K3IA 3EB7A 5FZAA 3ZIXA 3P6BA 4Q0UA 4L97A 3HIFA 1AX2A 1KITA 4K8FA 4I01A 5D8AB 1V9U1 1WWYA 4B3NA 5GLVA 3THTA 4BE3A 3LIHA 5EQUA 3T1MA 5CISA 3AP9A 2RR13 1S2BA 4MO3M 2PAKA 5DAPA 2YYOA 4IV3C 3RI8A 3Q8BA 1VP6A 3LQCA 5EIYB 5JPMB 2X8KA 4Q4Y2 1O3QA 3KT1A 1AYM1 1JN2P 3FLPA 2VXRA 4SLIA 3O14A 2LRPA 1ZZ7A 4UW5A 3LA7A 4A3XA 5DUVA 5C8CA 3RZKA 3KVAA 3AB0A 3FFQA 2BPA2 4M3CF 3OGJA 3O0WA 2WNUC 4X6RB 3K48A 1OD5A 3OPTA 3KZ4C 2DWRA 4Q0SA 2WL1A 1T6GC 4JRAA 1JODA 4DRRA 2BBVA 4IQPA 3QD6A 4LITA 4AFMA 5IK7A 1GMMA 1PIV1 5BNPC 1OPOA 2TUNA 1O3SA 1ND2C 1TME3 4LO7A 1SBDA 4XF4A 4YM1A 4CDXB 1AX1A 3R0RA 4RGAA 3PIGA 1V6JA 2OT7A 4LO8A 5HXMA 1MQTC 4JQRA 3O1OA 4IXLA 4OHZA 5F6LB 1NCQC 1EP0A 1PO12 2AUYA 2J1SA 4LO4B 4Z82A 3ENRA 3VHRA 3ZOIA 4COWA 4A42A 1DYPA 4P9YA 5C70A 3MW3A 3QH7A 5IVEA 1JZ5A 1QWRA 1WCUA 1XQNA 4XQDA 3PUSA 4Q8KA 1BMV2 2CGPA 2BOJA 4XCAA 3GZTB 4GKYA 1CPNA 1KEXA 1RUJ1 3OOXA 3SCFA 1YFXA 3LEKA 3PTRB 5F32A 4CYDA 5FWJA 5KHIA 1G6NA 2A71A 1CAXA 2JIGA 1AR63 2LUWA 1VBB1 2XJRA 4KBBA 1HN1A 3POIA 4LPLA 1U0AA 4OVEA 4ASKA 1JZ7A 1GZWB 2JX9A 5G04L 2HWB2 2IVJA 2YXSA 1UQXA 5GZFA 1QJU3 3NAPC 3VZMA 3T2TA 3K4AA 4ET7A 5C9AC 2WUHA 3OPZA 4HONA 2EIEA 2VZQA 3J9SA 5FYMA 4D6SA 4MGQA 1OA2A 2ZOEB 3MV01 1ZZ6A 2NN8A 4YPJA 2N7GA 3ES4A 4IE0A 4XE9A 4OHYA 5A33A 5APAA 1YRZA 1AXYA 3IIIA 1UO9A 3AZXA 4R8HA 4OUEA 3G6JB 1TMF3 3Q8FA 4OHXA 5BXXA 4PQQA 1J84A 3I2DA 2ZX1A 2Q8DA 2D6PA 3KWVA 4C0HA 1QJEA 4N7IA 4CCNA 3ZSJA 4Y20A 4UW3A 1DGRA 2XJTA 5DG1A 3N4MA 4QQOA 5ANQA 5FYUA 5FPXA 1WUVA 1IG3A 2OA2A 3F2ZA 4XF3A 5TSWA 1NE6A 3MI8A 3KCXA 1XYPA 1M4WA 3DYMA 4L8QA 4MGIE 5JUVA 1CJPA 4AF9A 3TEZA 5T3NA 2CAUA 3VL8A 4MV2A 4WM7A 1MVEA 2EVXA 2WQZC 4B1MA 5K0UC 3H50A 1JZ4A 4QAWA 4AFAA 3BTZA 4XEZA 3MIFA 1SPPB 2DUPA 3VBSC 2ID4A 1FOD3 2AACA 1QOSA 5IUQA 1UY1A 5KHHA 1CIWA 5A7WA 4AHXA 5KBFA 1K42A 4GA9A 1WKYA 4YW5A 5LCWL 2BP6A 3WINE 5DN2A 5C8CC 2RMU2 1K5MB 3PLQA 3J8F1 4A44A 3C3VA 4BLIA 4JAAA 3VBRC 4ZONA 5C71A 4TSVA 3U75A 5CIRA 1W2AX 1BVP1 3ZXLA 1DBNA 2EIGA 1DGWA 3HOBA 4ZXEA 5A7NA 5L19A 2HBUA 4IW3A 5FREA 3H1MA 5JZGA 5IAVA 4A7ZA 4B4PA 4WZCA 3K3OA 4QX8A 5AVPA 4WVMB 2RMU1 3J7HA 2J22A 1IS6A 2BJSA 1DDLA 1S55A 3M3IA 2CV6A 4JRLA 2RDNA 5T50A 1GP4A 1Q8OA 2Q0AA 2PHXA 1H30A 3IMMA 1W05A 2XUMA 1AR61 1VBC3 1B09A 5FMOS 4YYOA 2ZHNA 1NLQA 4AEMA 2Y6HA 1VAMA 4YG6A 1PK6C 3KHBA 1RUJ3 4GXLA 1OQ1A 1OH4A 4K40A 3ZYIB 3DUIA 2QQWA 2VAUA 4KH9A 2CWMA 4A6SA 2PYTA 1NZCA 2ZMKA 2RM23 3AFKA 2B42B 2ET7A 1LU1A 3POEA 3V56A 1ULOA 1HXS2 4BQ1A 1QMJA 3NRUA 4P9IA 2CU5A 4D6QA 2VO5A 2Q1FA 2E33A 2BUKA 4CCCA 1XNCA 4D3WA 1PGSA 1WCSA 4DXTA 1GU3A 1IQDC 1OF3A 5FP7A 3USSA 1HV0A 5JWPA 4FO9A 3WG1A 1DP0A 2WS91 2RS51 4XAEA 4CCKA 3OBRA 4NAMA 1A8DA 4PDWB 2XUEA 2VPVA 3AP4A 3EQEA 2ARXA 1AXZA 3CL1A 5T52A 3WVJA 2ZABA 3GHNA 4H2AA 4MLOA 3B01A 2XG3A 2JG8A 2HH9A 4OI4A 1JXNA 4META 5EXOA 3BALA 3TN93 2D6MA 2JE7A 1VR3A 2QQLA 2R063 3CJIA 2J7MA 3RNSA 1W28A 1PVC3 1S1AA 5JIUA 2QTWB 3VKLA 3ZFGA 4PF1A 2PLV3 4NROA 2JDAA 3NV4A 5C5TA 5FY5A 2WQ8A 2FDJA 1ENRA 1R1A3 4AVBA 5E16A 3RYPA 1O3TA 5A6XA 4OMCA 1CVNA 2PXJA 4BDVB 3WNNA 1W2OA 5DPNA 1Q8SA 4DRVA 5BYNA 1OOPB 3WG2A 2V4VA 4GH4C 3ACGA 3TBDA 2WO7A 1O4ZA 2WZR3 4DOUA 1AR92 2A6XA 1QDOA 4GMP3 1VB2A 4BZ4A 1KDKA 3JD72 1LHVA 1YJLA 3N9QA 3NJZA 4UI9L 4AE2A 3S7IA 3VUOA 5BNPB 1RUC1 3ZFGC 4EE2A 5L7OA 5LEJA 5CFCA 3SKVA 5GJ6A 5JR2A 3ZN4A 1JHNA 5DAQA 3E5QA 3CBNA 3IB3A 4HFSA 1GOHA 3ZYHA 4AVVA 1RB8G 1CR7A 1FX5A 1PGW2 4LE4A 1FV2A 2HWC2 2PQQA 1W9WA 2ADEA 2Y6FA 3T0DA 4AW7A 1C1FA 1CJDA 5LZ6A 3WDYA 2NP0A 3I97A 1O59A 1W6OA 2ZGOA 4MGSA 5EJ1B 1J3RA 2VUDA 3T08A 1PVC2 2RVAA 3GZUC 2GDFA 1DCSA 4CU8A 4OMDA 4TWTA 1FMD1 2VW1A 4ZY9A 2KR2A 4HBNA 1HW5A 2Y34A 2ATFA 2D5HA 4O61A 1GLHA 1ASJ2 3NQHA 4TZDA 4BIFA 2XLAA 3V0AA 3RWNA 4MGYE 3VBSB 4MHUA 5K7PA 2SBAA 3JUUA 2C9KA 3N7LA 3LA2A 1VBE1 2ZCWA 1QHDA 5F7UA 3HQUA 5JLVA 2GALA 4A7YA 3ILNA 1OFNA 3AX4A 2WNVC 4CTEA 5A3NA 2DVBA 1Q8QA 4QXKA 5G05L 3MLJA 1RUI3 1D0HA 3PL0A 4IE5A 4YZ3A 4QKNA 1VAVA 4BQXA 3SH3A 4LEJA 5FUPA 1W2UA 5C6CA 3IDCB 3DCQA 4CCMA 3JBG1 4PIZA 3OGRA 5EYXA 1VRBA 3Q8CA 1WGPA 4W6XA 2IXKA 4D94A 1ZBA1 5JDBA 2VMHA 4RGGA 4Q0VA 1S2EA 2KA3A 4L99A 5I8SA 3NV3A 2WDBA 1QIQA 1MQTA 1OF4A 2WT0A 4IV1C 1S0FA 4L9BA 5GZEA 2DYCA 4KWKA 1W9FA 1LKNA 5A33B 4JHZA 3MIBA 5BV6A 4NPMA 2JG9B 4CP0A 2GNDA 2R042 4X8PA 2ZX0A 2ZX2A 3RZMA 5JCTA 3BU0A 3SCGA 2O14A 3NO8A 2B45X 4LA2A 4Q27A 3ATGA 3HN3A 4BA6A 4HXCA 5F5IA 2V72A 2VZVA 4I09A 3GGLA 4COVA 4F3JA 5CBLA 2P3IA 1U5XA 2DDUA 3IPVA 3RZJA 2VTXJ 2E51A 4PF5A 5FP8A 3UJQA 3MUY1 3ZDSA 3S6PA 3I2JA 3VBSA 2CL2A 5FYCA 1EV11 1AHSA 1IQAA 1VMFA 3GYDA 1GBGA 1KQRA 1R091 3WEZA 3W9AA 1GZWA 1VMHA 2QDNA 1QOTA 4XFCA 2QFEA 4QB1A 2ZHKA 3OEAA 5DABA 4IV3B 1DGRN 1OUSA 2VL4A 3VDDA 3A0KA 3VBHC 3N36A 3CQOA 1QJX3 5E1RA 3TEWA 4FSJA 2VNGA 2Y0IA 1OD3A 4ZU5A 2BGCA 4LK7A 1BLZA 1SLLA 2UYAA 1RUG3 2RS52 3NNJA 2YPJA 4HG6B 5FKBA 5A3LA 2WYSA 3I2HA 4AK3A 3QH6A 1DQ6A 1MEC2 5BPXA 4W6YA 4XVHA 1JU3A 1HXS3 3NJVA 4N43C 2F4LA 4BQWA 1GP6A 4XDOA 1AF9A 1DZRA 1H4HA 1RVF1 3POFA 4PI0A 5IW0A 4UFJA 1LEDA 1W8OA 3HPNA 4CP1A 1BEV3 5GLTA 4YW3A 2YROA 3H1YA 3NWKA 4HLTA 4N43A 5C3SA 4QHZA 1UL9A 1UWWA 2VOXA 3I2FA 2Q8EA 3TN91 4DUWA 4YW1A 3T30A 4INDA 4S2FA 3AKQA 4XJ9A 1RITA 4ISRA 5EJZB 4J25A 3MHZA 2F4PA 3FUQA 1YC61 2JENA 2WN3A 3U11A 1COV3 1SBEA 1H8TB 2VOTA 3AVRA 4JGYC 1G9FA 4RS5B 5LWBA 1Y4WA 1JYWA 4OFGA 4Q4Y1 1N3OA 1HRI2 2XKOA 2CWSA 2FBEA 5FYIA 3GXUA 4BJ0A 3I3EA 1CPMA 2VW2A 2MEV2 2WWSA 1MQTB 4N9IA 1O7FA 3OUIA 1S2KA 1HIXA 2P2KA 1PO22 4YGDA 2F17A 1O5UA 4GMP0 1SEFA 4IV1A 3ORJA 5ABJB 3H7JA 1C8NA 5ACA3 1AR73 5GM0A 2R32A 1WLWA 1YIPA 1YUDA 5A7QA 2DBIA 5A3TA 3HQXA 3N35A 1YQ6A 3U14A 4IEVA 2WRAA 3ITQA 3NAPA 2K46A 4LKSA 3BPSA 5L9BA 1Q5OA 3KT7A 5CFDC 1V6KA 3IDEA 3IAPA 4AFBA 1OMIA 4P9GA 5FXXA 4FI9A 1BJQA 1ZVFA 3POJA 3DL3A 5CU1A 1W6MA 4A6OA 2PHRA 5HXVA 1NAEA 3A4UA 3VD7A 4FTBA 1LOAA 3HVDA 2WNVA 1WA6X 4QB6A 4M3CB 1ND3C 3VB9A 1AYN2 5C3OA 4ZS2A 4AOCA 1POQA 1X36A 3BOWA 2QNKA 2DUQA 1RUF3 1OQDA 2R30A 4CDWA 1ZRDA 2XHNA 1UMIA 4QPYA 4RD7A 4KG8A 3H3UA 1LGCA 2CSGA 2FQPA 3I49A 2LM3A 5LEKA 3JQWA 1REFA 3R4DB 1JYTA 4DPNA 5GLWA 2XVGA 1CX4A 2W87A 4R9AA 1D2SA 2RJ2A 1N1YA 1Z0HA 2G9ZA 5FR3A 1FPN2 1UY4A 5A7SA 2VZTA 5ACA2 4ZKTB 4OUMA 1Q3EA 2MEV1 1QDCA 1OSGA 4AI3A 4BB3A 2RV9A 4YGBA 1DZTA 4PIYA 1H1AA 5HCFA 5DDJ2 2HWB1 1SPPA 3GM8A 2WNUA 1K45A 5EV7A 3EBRA 1W9TA 2QBXA 3ZFGB 2FCVA 1W9YA 3B9CA 1GOGA 1UOGA 4LOSA 1S4CA 2A6WA 3AM2A 2VG9A 2BBAA 3CJIB 1WA4A 3C7OA 1SLBA 4GWMA 5CKQA 3HAGA 4K6BA 2YHJA 1H6XA 1Z7S1 5FY1A 5KHGA 3H9AA 3RI9A 4RHV1 4AEDB 4QX3A 5FWEA 1WBLA 4P9XA 4HVQA 2RS31 1DLCA 2VCAA 3CU7A 5KXEA 2HWC1 2D98A 3RG0A 3ETPA 2YB7A 3M3EA 4DNYA 3IM0A 2X53S 2AC1A 2Y6LA 4M4PA 4A45A 2V73A 2EICA 4QD2A 1XNAA 1W06A 3ZXAC 1XJAA 2WSUA 5FZ4A 3WY6A 1DU3D 4XAAA 4NRPA 2ZGPA 1QY4A 2J1EA 3AMNA 1JYNA 4Y1YA 3OY8A 4LIUA 5J96B 4LQRA 1SDWA 1Q8VA 3MDPA 4AGVA 5BNQA 1BQPA 2ARBA 5DG2A 1LEMA 1YI9A 1Z7S2 2VUAA 3A7QA 1GKBA 3GBGA 1BBT3 4AEDA 1ZREA 4K1YA 2VTXA 2TBVA 5F1RA 3R4SA 4LULA 2FDHA 1PO11 2W1SA 5FJHA 4AR2A 1LODA 4GH4A 2C1FA 2R49A 4YZ1A 4OUSA 5F39A 1YQ2A 3UGFA 1RXFA 1I6XA 2XJSA 4ZPIA 1LOEA 4XFAA 3WQ0A 4AI1A 1O4TA 1SCSA 1VRH1 3FX3A 4FVVA 2KM2A 1RJ7A 4Z1VA 5A3MA 3ZYJB 5BNOA 4HKLA 1QJX2 4XIKA 4QT6A 2XJUA 4AI2A 4L2NA 5M0TA 5EHDA 1GWKA 4IGQA 1OC1A 1VB4A 5FZ1A 1OH3A 2WC2A 4FXKB 2B7YA 5E89A 1SDDB 5JPNB 4V2VA 3RYRA 3LDRA 2HJIA 5A7PA 5FQ0B 1IKQA 3SCHA 4E4SA 3PJQA 4CPBD 1SLTA 4OYUA 3MW4A 4LBQA 4UXAA 3OB8A 4KGQA 4UFHA 3WXPA 4BISA 2AENA 4DXZA 5ACA1 4QX1A 4QHBA 2BDRA 1ZM1A 4YWAA 3GF6A 2DTWA 1W6MB 4XUTA 4FOWA 4CP9B 2WNOA 1O6UA 4K3UA 3LKJA 4XETA 3WDTA 3KHCA 5BY5A 1GYKA 1YNAA 2XL7A 4I02A 1LGBA 3KM5A 3PUHA 1CQ9A 2HWC3 5A70A 5JXIA 2DCZA 5CG8A 2DCKA 1VBA2 4XYXA 1OA4A 3TYJA 2Y33A 3D4KA 5D8AA 1ZBE1 2FDIA 4DZGA 5LA1A 3JQXA 2HWB3 3R05A 4JGZA 4TXWA 3WQ1A 2A3XA 1SBFA 3FUOA 4CDUB 2ZMLA 2VZSA 3C7FA 4YARA 4I3GA 1XYNA 1OOPC 3V0BA 1OHFA 1ASJ3 2OXBA 4GMP1 4AQ6A 3ACLA 2HEYF 5AFEA 3WF4A 2OVUA 4QGMA 3KMHA 1OA3A 2FCTA 3J7LA 5FY8A 1WLDA 1O91A 3LSDA 4CEWA 5A6ZA 5T5OA 4FPGA 3CO2A 2IFRA 1TME2 3I3QA 2YBKA 4H7LA 4P5HA 1RXGA 4TLGA 5CFDA 1O5LA 2I2SA 2BVBA 5FO8B 5FPLA 3GBWA 4Y20B 2OUJA 3M70A 4XJZA 3ZR6A 1EPZA 3NNFA 5FZIA 5FV3A 3VBOC 1FMD2 3LEIA 4LBQB 2B46X 1VBD2 4CUBA 4ARXA 3VD4A 5FYTA 4UBGA 4I0BA 4R9DA 2VVFA 4NIGA 4LBNA 1RUG2 3ZMOA 3WDWA 1QJY1 3P3PA 4UFMA 1PMJX 1WMDA 3HMYA 5IVFA 2X5IC 1BBT2 1UW8A 3W58A 3NNMA 4Y4RA 3E6DA 5BNOB 5C4WC 5HV0A 1N1SA 3GCXA 1APNA 1WD3A 2VMEA 1CAVA 1QGLA 2J1VA 2W68A 1AR81 2JG9C 2P34A 3T4VA 2E7TA 1FPN3 1NA1B 4Y22A 1AR71 1LGNA 4A2UA 2D43A 4B4QA 3WW2A 4FPCA 5I91A 2WNEA 1J58A 1VIWB 4Q1PA 5FPVA 3WW3A 4CU6A 1XBFA 3FHAA 3S5AA 4GWJA 2GN7A 5CKMA 4CDQA 2VXJA 3JD73 1QXRA 4KGGA 4WM7C 1ND3A 3RQ0A 3NKTA 4BMBA 1VBB2 2ZJCA 2NQYA 3C7HA 3BCWA 4QQHA 3OY8B 4R9BA 4XBQA 5FZGA 2RG4A 3ZSMA 4Y24A 1MEC1 4CCDA 2ZTNA 2A1XA 1UZZA 3SKJE 5L9RA 2DFCA 3WW1A 1V70A 4COZA 3KF5A 1HB3A 4GIQA 3LF7A 2YPDA 2W3JA 2XMLA 4HVOA 1GFF2 2VECA 4NN0A 2A6YA 4JGYA 4BCUA 3FN9A 4FT8A 2TNFA 4N53A 2FDFA 3KQRA 4CDXA 3T0AA 2VMIA 3KGZA 1FV3A 3J4UH 4MXVA 1NCQA 4DMIA 3FHIB 4QPGA 2PHLA 2YG0A 2DVAA 5F9TA 1LULA 2RR11 4CCEA 4K21A 1GQPA 1KFUL 2GNMA 2Z42A 2QQKA 4HOOA 3LD8A 1V9U3 4AL9A 5FZDA 2LW8A 2Q4SA 4KWUA 1AR72 1PZ8A 4DEQA 3AP7A 4F7ZA 2ET1A 3WNPA 1PGL1 1MZFA 4LBKA 2YFZA 1VE0A 3AMPA 4HMZA 5CZKA 2HWF2 4Z2AA 1RUI1 1KXGA 3HWJA 3O1PA 2QQVA 3IWZA 2AR6A 2VULA 4W50A 4AEDC 4AQTA 3AL5A 4CXYA 2OIIA 5IVCA 2Y6KA 2ZEWA 4BXSV 5FPUA 5IYYA 3U4SA 4M3CE 4TTGA 3POGA 3NJXA 3WZ1A 5FLIA 3WCRA 3LAGA 5FZOA 4ZS3A 4MH0E 3UK9A 2ADDA 1K12A 4IEUA 2W5FA 4FPYA 5I8YA 3W21A 2R041 4IGOA 5CEHA 5JAXA 3OTFA 3POWA 4D0QA 4PHZA 5JMOA 1OKOA 4KMQA 2RS33 3D8CA 5ISLA 2BERA 4TYSA 3VZLA 5KR7A 1REEA 2R062 1ND2A 1YQCA 4Q4X1 3F95A 3KVBA 1ZYBA 3CZUA 4KWLA 2X29A 2WQ4A 1H8TC 4R52A 3KV9A 5HPOA 3O1TA 2VOVA 4CCJA 2YGMA 4KL1A 5LA2A 3KB5A 2BGPA 1OURA 4MZUA 4RQPB 4MHRA 1WCQA 1K5MA 1NZIA 5AC93 1WW7A 3KT4A 1YFUA 2HWF3 5DUWA 1OVPA 4AXOA 4QXBA 1VBE2 5FOBB 4MGTA 3B5LB 2OX0A 4AFDA 1PMHX 3QBQA 4HVRA 5LK7B 4N53C 1GUIA 3MPPG 4JV4A 4V1PA 3V0AB 3HBZA 3I7DA 2R073 1HN0A 4QM9A 1C5HA 3UESA 4LE3A 1ZBE2 4EN9B 4EWEA 5FRAA 1OPMA 4AHWA 3AKTA 4FBFA 3EHKA 1NQDA 3OCPA 4AAPA 1ULEA 3UKTA 2K0GA 2QQIA 2V5DA 3CDZB 1W8ZA 1EUUA 4KBZA 3AMHA 3LDKA 1FT9A 4OZXA 4Q2FA 4D8MA 2H6CA 2D3RA 5FY9A 4ASLA 2R1DA 3ABZA 5SV5A 3KCCA 3WF0A 3ST7A 3FC0A 4I30A 3OG2A 2HWE1 5A7WB 3ZVXA 4PT6A 4FAHA 1TQ5A 5BNPA 4QX7A 4CDQC 1DGLA 4HANA 3NAPB 2R061 4AYUA 3FLRA 4WZFA 3PVNA 2VQTA 1AZDA 4B29A 2ZGKA 2W94A 1VRH3 5F8PA 3U37A 1V00A 2W9XA 3BODA 4QGLA 1POV3 1RUH3 1X33A 1QH6A 2VE1A 3BPZA 4GKXA 2GP5A 2VVEA 5T54A 3WF2A 1V6OA 1UKGA 3EJKA 4LHKA 2G9FA 4EN8B 3P3NA 1ND2B 3ZSKA 1CAWA 5GLUA 1PK6A 5FZBA 4RS5A 4AWDA 4BM8A 1HB1A 2YGLA 3JD71 2GH2A 1NX9A 1YXWA 2GNBA 4URTA 5LY1A 4XFIA 1G9DA 5FYHA 1NCQB 5F3GA 5KXDA 1SMVA 1ZZBA 1RUE1 3C7GA 1HQNA 1S0CA 4UW4A 1O8PA 5T55A 3DPRC 1RMU1 1JYXA 4JCKA 3ZXGA 2VQUA 2OQ6A 3ETQA 1D4M1 1QJZA 1UOFA 5JR7B 3GNEA 4WM8A 5A80A 4FP2A 3ZO0B 5GZCA 2J1RA 3LFMA 2JDKA 1FXZA 1AR91 3M7AA 2RS13 1V6MA 2V5YA 1JBCA 2RS32 5K8SA 4A4AA 1F5JA 3VBOB 5J09A 2JIJA 3GDBA 3HT2A 4OHVA 3N9OA 4W6WA 5LRRA 1AYM3 2ZBJA 4IGPA 4ARYA 3VBRB 4WBBA 3QACA 1OLRA 2PHTA 2VMGA 4XBNA 1DGWX 2CDOA 4W65A 4YVSB 2WZR1 2WN2A 4FTEA 3SEEA 1AL23 4WVWA 4QXCA 5J48A 3I3MA 3AZZA 2XJQA 4XFFA 4TLFA 2WZ8A 3ZN6A 1CAVB 1N1VA 4XIOA 1EY2A 2G19A 3B94A 1GICA 1LB2A 1K5JA 3I2OA 4DXRA 4UFLA 1W6NA 2CYFA 3RGBA 1JZ2A 2BQPA 4HSJA 4AVAA 4BH9A 4CEYB 2FMDA 1JYIA 3OGGA 4YVWA 2PA7A 2VBPA 1ZBE3 5I8TA 3THDA 2XJPA 1XE0A 1AR62 1HKDA 2JDYA 3UJOA 3AJZA 3VDBA 2EIBA 3ZFFC 4NIDA 1G7YA 2ZGMA 4M3CA 1V6IA 5KWRA 2RDQA 4N7UA 1YHFA 4NJ4A 1P8JA 3ALQA 4D7SA 1I5PA 3TRSB 4YFWA 2WWJA 1H2KA 4S2DA 2VUCA 5CFCC 1LESA 4XCBA 1AR93 4R9CA 3H1WA 4YW6A 4W4ZA 4AHYA 2ZKNA 5DDJ1 3O1RA 3VBUB 1F5FA 3LA3A 2BW8A 2HWD3 4FPLA 5H9RA 5AFBA 3N7MA 5KC5A 1TE1B 5FP9A 5FZEA 3UT0A 1GWMA 1AYN1 2NZ9A 5GKAC 3U78A 3CF6E 1R1A2 2IXJA 1W03A 4YM0A 2HBTA 2P3KA 2P37A 4OI2A 4AEJA 4KI5M 1W6QB 1S0DA 2YFUA 1E5RA 4M0NA 5A3OA 4ATEA 4XJAA 4BQ2A 5IAXA 4JGZB 1UX6A 1JOJA 3PMEA 1JUIA 2KXLA 5FTTC 3BTXA 1OBNA 5EWSA 4M00A 3ZSEA 5A32A 1WZXA 1BXHA 2QQNA 2WFF3 4U36A 1DQ2A 4BQYA 1S0JA 2FZ1A 4P9LA 1UYXA 2D6LX 3WT3A 5F5CA 2UYBA 4H3WA 1Y9QA 1IHMA 2ZGNA 2ZPXA 3GHMA 3KSCA 4JDNA 4G9SB 1JH5A 1XNBA 4EV0A 4AGRA 3VKMA 2RHPA 2NM1A 4KQ7A 4ONUA 4S2GA 4CDUC 1DHKB 4KNCA 4DO0A 4YVWB 1L7RA 3UL2A 1US3A 3PUIA 4C90A 3V0BB 1PZ7A 1CZSA 3ILRA 4AHZA 2WJSA 4XF1A 3NL1A 1WMXA 1XPWA 1A6CA 3VD3A 4LORA 3WSOA 2CY6A 3D5OA 5F6KA 2PAMA 1JMUB 3OGSA 3SITA 4BK4A 4XFBA 3WR0A 3ZFFA 1VMJA 3ZXKA 1EUTA 1PZ9A 1QOOA 2NMNA 4CP2A 2IFWA 1KFXL 1PO13 3MO4A 3E5XA 1FOD1 4E9KA 4GJZA 4BQ3A 4CXXA 1OUXA 3DN7A 1VBE3 3BB6A 1S0EA 2Y6JA 2NMOA 5FYZA 5FZ6A 1UCXA 3TN92 2QDRA 2WAOA 3ZYGA 3CHXA 1NQJA 4P9WA 1O8SA 5FCCA 1W6OB 3C7EA 1TG7A 1YLLA 4CPBA 1XYOA 1JW6A 1REDA 2JWPA 3MV11 5DDJ3 3VZKA 3BVCA 4QX5A 2RJKA 4J1WA 5H9QA 3HBKA 4BK5A 1QNYA 1LOBA 1Q56A 2KD7A 3MBWA 3PJYA 4GB33 2Q8CA 2BU9A 1LNSA 2ZGQA 4YW4A 4NIAA 5C33A 4Y22B 4CEYC 5FXZA 3ZMNA 3SH4A 5GZGA 4QQ2A 3FHQA 1O3RA 3HNMA 4RL7A 4AAXA 2WO2A 1RVF2 1ODMA 3VBOA 4YVSC 1UIKA 2EA7A 5FXWA 1D4M2 4QX2A 3RS6A 1ZA7A 2LTNA 4QKBA 4CUGA 4LR4A 1HDKA 4QGNA 4EN7B 4EROA 2VCCA 1H1MA 1XRUA 3B3QE 1DQ5A 3IT8A 3WG3A 3D3AA 4CEWC 1YI7A 1YFYA 5EYYA 4XUNA 1W8HA 1W99A 2RS11 1NCRC 5F3EA 4MGKE 1AL21 4JGYB 2VY0A 2W08A 4RS5C 3PVOA 2AGSA 3ZIWA 4AVTA 2ZZQA 1OXCA 2E31A 2W2IA 2RE9A 3AVSA 4GULA 5KHKA 4KU8A 3ZN5A 4FFIA 4FPKA 4IE4A 1SZBA 3Q9OA 4RFT0 3WD5A 2CTVA 4FFHA 2YC4A 1MS5A 4MXWB 4YFZA 5A3UA 4YZ4A 5FPAA 2BNNA 5DXDA 3LOBA 4IUGA 5F2SA 1U12A 2JG8C 3MZHA 1V6NA 5FPBA 1RYYA 5FK8A 1N3PA 4IV3A 3J7MA 1XU2A 2BWCA 4CDWB 2JEMA 1Q8PA 4H7MA 4IESA 1GZCA 4Q4Y3 3POBA 2QQJA 4HT1T 2G9GA 1UXZA 2Y64A 3OYWB 2UU8A 5FXVA 4ZHNA 1D2QA 3MYXA 4HK9A 2VZPA 1C5IA 2Y0OA 4P14A 4YGCA 5JIAA 2OKXA 3M4FA 4JKMA 2W47A 4MOAA 1VBA1 1EAH1 5IK4A 1RUOA 3W59A 3D0JA 2GNTA 4RQPA 1W3XA 4URAA 1ULFA 2JB8A 2BNOA 2XVKA 4PCRA 3RYKA 3K75B 5IATA 5B4NA 2VOKA 4YW2A 1JZ8A 1LOGA 3T1LA 3CLPA 3DEMA 5L7OC 4JKKA 5IK8A 2ZGUA 1HB4A 5BNNC 2WKKA 4P9JA 5HI0A 4YG3A 2DURA 5ERLA 3PU3A 2YZ4A 4N9HA 3VV1A 5LA0A 2BOIA 2DBNA 3I2KA 2R1BA 1TMF2 4XDQA 4FPEA 2XWJB 2D93A 1UZ0A 3GJAA 3RSJA 3MLKA 3VL9A 3VBFA 3FJSA 5C7GA 5FO7B 1PX3A 1JYCA 3SLIA 3PURA 1PGW1 5B4XA 1H8VA 2UWAA 1CIYA 2BYVE 4E8CA 3AKPA 1RL3A 1AUYA 2EALA 2QQUA 1QQP1 3GZAA 3H3ZA 4MADA 3WF3A 4MXWA 4E27A 2VBDA 5BNNA 1WLTA 1VLNA 4IV1B 2GSYA 3NW4A 1FNZA 2I07B 3AYEA 3AP5A 4NUBA 4YRDA 2OS2A 3U07A 3HEIA 3VBUC 5C3QA 1G9AA 4AI9A 1ASJ1 1WD4A 2WSVA 4WVVA 2HWD1 1YO8A 3RJ2X 1YEWA 1UX7A 2VVDA 5A6QA 5DAVA 5A1FA 2Y38A 4FFFA 4HN1A 3VBUA 1MS0A 1ZRIA 2HWF1 3BN6A 2JE8A 4PI2A 5AC91 1RUI2 1BHGA 3BKZA 3Q8EA 5GALA 1N1TA 2JG8B 2XBO1 4HL0A 4L0PA 3VDCA 3LGRA 1F9KA 2VOWA 3LDBA 1EYBA 4HKWA 4NE9A 2R6QA 3VD5A 3WF1A 5A3PA 2JD9A 4K8RB 4NPRA 3SC7X 2PAEA 3ZXEA 2AEYA 2G4IA 2E53A 3TB0A 2VNVA 1RHI3 3V65A 4Q4V2 2P6HA 4IEWA 4XF0A 2X5IB 4N90A 1UZWA 4HN0A 2X05A 2A75A 2Z2SB 4XACA 4GQ7A 1NLRA 3AC0A 1VRH2 3FZ3A 1D7PM 5JOWA 1G9CA 4MG2A 1LHUA 4I0WB 4XTPA 3I3BA 4NOTA 4N43B 4RHV2 2YV8A 4PDWC 1KJRA 2EIDA 4CDQB 3I4IA 3ON7A 1M06G 4BQ4A 2VNOA 1ULGA 4JVAA 3ZYBA 1LECA 1IOAA 1DFQA 3Q8AA 2YBPA 3LCPA 2YY1A 1WW5A 4JTOA 3ZDVA 5JMCA 4YM3A 2A6VA 1NA1A 1JZ6A 3M3OA 4JX0A 3VHPA 4NO4A 5DAWA 4IEQA 4XUQA 1H0BA 5EPAA 3H8RA 5FDBA 3AYAA 2DCJA 2LROA 4Q0QA
chains in the Genus database with same CATH topology
1QJU1 3LZZA 4LO6B 1AR82 2AREA 2D3PA 3JU9A 1FATA 2O8OA 3VZNA 1R092 2JD4A 4WM8B 5E88A 4UBHA 2C0ZA 3MF9A 2NPIA 2WS92 1RUE3 1QXPA 3SMHA 3M3CA 2FMYA 2XB6C 2XJVA 1SLAA 4PJYA 1IPKA 1BCXA 1LHOA 5FAXA 5A32B 4O9EA 3WG4A 4RR3C 2FZ2A 4DY5A 1OFSA 2D5FA 2V09A 2D7FA 4MUVA 2QKDA 2BEOA 5FLJA 5CA6A 3WLUA 2TEPA 1W6QA 3CNAA 3TAYA 2GMEA 2YDEA 1XXNA 2XWBB 2B39A 4LUMA 3ZX7A 1RUH1 3ZFEC 3WNXA 3GALA 3WUCA 2WNUB 2D6KA 3KS7A 3QOPA 1RUD1 3AYCA 1HRI3 1AR83 1OLQA 2H0BA 3AYDA 3USUB 4XXPA 2UY8A 4D7TA 4MSVA 2CGNA 1IKPA 4Z92B 1POV0 4E2GA 2ZKLA 1R1ZA 3DKWA 1LJ7A 2GC2A 5I0TA 4F8AA 1A8MA 5BNQA 5D8AC 2O0OA 4BPZA 4EN6B 4FOQA 2RM22 4ES8A 2LALA 1R1A1 1DQ4A 3B69A 4SBVA 2WFPA 3INAA 3RRDA 5DZFA 1SLCA 3VDDC 4DQAA 1ZRCA 3RMXA 5JZGC 4JDMA 4COUA 3ZPYA 3E6CC 3ZSLA 1X50A 2BWAA 2I45A 1AL0G 4LBLA 2WFF2 3I59A 3QCWA 4DS0A 1RHI2 4YG0A 2ZACA 4NWWA 2CNAA 2EXIA 4CEYA 1C28A 3PHMA 3WP6A 1UIJA 2WT1A 4XQ4A 4BYYA 2RS53 4LTAA 1L3JA 2BFUL 1FYUA 1LR5A 2MNGA 4WM7B 2FHRA 1QJX1 1NCRA 4IEZA 1RUJ2 1C4RA 2Q1ZB 1XE8A 3NSTA 3RJRA 4RR3B 5DUXA 3IDBB 1GR3A 1I5ZA 3B93A 1W39A 4Q4W2 5H9PA 1BMV1 1R093 3WX5A 2WZR2 3ZYRA 3AKRA 1RC6A 4FCAA 1J3PA 2Y26A 4LT5A 2PTMA 1HRV1 3SXWA 2BTVC 3OJBA 4XW3A 2DV9A 1KJLA 4WV8A 5JI7A 4GH4B 1OI6A 1EPWA 1MZ5A 1F8VA 1IZ3A 3MFAA 3DGTA 4IEPA 5FOJB 2VW0A 3POSA 4YSFA 5CAZA 4XILA 1N47A 2D97A 4Q4V1 1WW6A 4B4RA 1HRV2 4FTSA 2R0HA 3WW4A 3GBFA 1ZBA3 4EN0A 1H9WA 1UF2C 3N3HA 1FOD2 1WW4A 1LHNA 1RGSA 3JBG3 2WLQA 3UV9A 1UAIA 5H9SA 3N7KA 1I3HA 1C57A 2HEVF 1WMEA 4PDWA 1BYHA 1RVF3 2GC3A 1H1IA 4FQ4A 4NVPA 1KD7A 3VBFB 1B35A 2D6NA 2HEWF 2F6BA 3JZVA 3A0NA 2C5DA 3U0ZA 2QZ2A 5EZWA 3O5SA 4QPIB 3H0OA 4KG0A 4XQWA 2ZAHA 4LHNA 2WA4A 2DVGA 4ISQA 5C4WB 3MICA 3B02A 2H0VA 3WDVA 4Q4X3 4ATFA 1VBD1 2MHFA 2QJVA 4NWVA 5J98B 2AH2A 5FO9B 1RUF2 2E7QA 4PLOA 2ZGRA 4C0BA 1JTZX 1SCRA 1TMF1 4I2OA 1NY71 4MYEA 1UZYA 3FMGA 3JBG2 3ZFFB 3WOGA 5AVAA 1SQ4A 3I59B 3MIHA 4ASMB 2EF6A 5C4WA 4U2AA 3S0MA 1DZQA 4QM8A 1RUD2 4WM8C 1GQHA 5ABJA 2WINB 3AXDA 3ME2A 4B8EA 3MFCA 4LBOA 1UN1A 4AQ2A 3NV2A 1KS5A 3KD4A 4ORFA 3FBMA 1MS4A 4X6QB 4HKOA 1H2LA 2MEV3 3N7JA 3LB9A 3FE5A 3H8UA 1VBB3 5JOYA 1QF3A 4JDOA 4AGGA 2PLV1 1X8EA 5CG9A 2B5HA 2RJLA 4GB32 3MF6A 4PIXA 4IEXA 4HZFA 1NY72 3HD8B 4OI1A 1QU0A 4E2QA 1YWKA 4NHMA 4G4FA 2QE3A 4QU2A 1EAH3 1LCLA 1RUF1 4LHLA 4UW6A 3WHUA 1RUC2 5C8WA 5HCAA 4FXGB 4N53B 3JB4C 4X8NA 1C3HA 4IETA 2WA3A 3WUDA 3WDUA 2ZA9A 4QPGB 3K51A 2R072 3VZJA 4Z8BA 4E4ZA 2HYKA 2ZMNA 3IBMA 1GNZA 3ZXJA 1RUNA 1PMIA 1U5IA 3BOPA 5FLHA 3DF0A 2EXJA 4BMEA 3AMQA 4ES9A 5JVVA 3WCSA 3O0XA 4O9GA 3VDDB 3SISA 4QQLA 1GZ9A 4Q4W1 2XBO2 1LHWA 3VLBB 1FMD3 3BU7A 1URXA 3RZZA 4B7KA 3DPRA 5B2GB 1ENSA 3ELNA 4LNVA 5F5QA 1ZRFA 3ES1A 1QKQA 1Y43B 4QPIC 2HWE3 5J36A 2DVDA 3VHNA 5K0UB 3ECQA 1HXS1 5CVRA 2D44A 5BNOC 5CNAA 1SFNA 3UKVA 3VBHA 2QQPA 1X8MA 3E6BA 1UD1A 1I9RA 3IPVB 3OD0A 2EAAA 3VBFC 5C8CB 1YYNA 1O4YA 1EV12 2R16A 5JZGB 3MLLA 2GH8A 3OBTA 4XXAA 1DYKA 3DV8A 1PNGA 1SACA 5SV8A 3R6SA 1G9BA 2GC1A 1HV1A 3MPBA 3APBA 5AC92 3HR9A 2E9QA 1VALA 4G3YC 3AP6A 2GU9A 2JXAA 1X82A 2XBO3 1RHI1 4K1ZA 3SH5A 2ES3A 4RHV3 3WDXA 1SLIA 3G7DA 1CESA 1RUD3 1BEV2 1UU5A 2EXHA 1H2MA 1TNFA 4XFGA 1PK6B 4Z07A 4CZSA 4OI0A 4GB31 3ZYPA 5E8AA 5J7MA 3ROUA 3THPA 3VN4A 2WS93 3LSEA 5I0SA 3AZWA 1ZZ9A 2B8MA 4Q26A 2XL9A 2DTYA 1YCIA 1S0BA 4PBOA 2UWBA 2OZJA 4IL7A 4YGEA 1UPIA 1VBD3 1CN1A 4XBLA 1WCDJ 2W39A 3IKWA 5KXBA 4YZ5A 1H8TA 3VGIA 1MS9A 2XH6A 1RUH2 4HK8A 3ZFEB 2Z5WA 5L73A 1K5MC 2VU9A 4AI0A 3FWEA 1XNDA 2A3WA 4AQSA 2P17A 2D6OX 5CFCB 2P3JA 1RJ8A 4LBQD 2OUHA 4Q4W3 1NE4A 3ZXDA 1AX0A 2A6ZA 4AG4A 4ZU7A 1H9PA 1VBC1 4FP3A 3ZN6B 1UU4A 3CJXA 2PHFA 5EJ3A 4C1WA 1AYN3 2GC0A 3O12A 2ETEA 4ZU4A 1W6NB 2YMZA 2ZGSA 4D7YA 3OYWA 1TEIA 1GANA 5K0UA 4PBPA 5D1IA 1HRV3 1MS3A 1Z78A 1X7NA 1AL22 1B35B 1J59A 1MVQA 3DPRB 2Z69A 5CADA 4FPOB 2GN3A 2QUOA 3WP4A 4BIOA 4FPFA 2SLIA 4LUKA 5HCBA 3FLTA 4L11A 3LWCA 1OOPA 4LBJA 4E2SA 1PGL2 1IGOA 1DQ1A 1V6LA 4YVSA 1UMZA 2A7AA 1H2NA 3WV6A 3SHRA 1DQ0A 1WBFA 3RDIA 3RPQA 4AI8A 3HT1A 2D3SA 4IERA 4RA0A 3JCIA 1MS1A 4FOVA 4DB5A 3IN9A 1RMU2 3NKGA 2Z79A 1ONAA 3O7OA 3S30A 2QVSB 5T5JA 5EFUA 3I54A 1QJY2 2D40A 2HWD2 4K9SA 1PNFA 1HLCA 3C2UA 4K7JA 1LOCA 4AVSA 2PHUA 4B7EA 3NVCA 1AJKA 1C8M3 3WQ7A 5I0UA 2K2SA 1KRIA 1LU2A 3AK0A 1RMU3 1CD3G 2A73B 2Q8OA 4BLJA 4EJRA 1FNYA 3MIDA 5FPZA 4Z2WA 2PN5A 1VJ2A 1IS5A 1D4M3 4YZ2A 4HETA 2VGDA 4ITCA 1LOFC 4L92A 4C1XA 3IIAA 1VBC2 2PLV2 2QCSB 2XKPA 4Y1VA 4JC1A 4PLNA 1GQGA 2AZ5A 2ZS6B 3LOIA 3B00A 3PVBB 4PQ9A 4XMIA 1EV13 2ZHMA 3AJYA 3U10A 1ZA4A 1ENXA 2PHWA 1NOVA 3VZOA 1QXJA 1AYM2 5LK5A 3VHOA 2BNMA 3QLQA 2ZZJA 1LOFA 3L2HA 4FPJA 4HSLA 4QPGC 1RINA 4NHLA 3PMSA 3EXUA 5KHJA 4IEYA 5T5PA 4CRQA 4CDXC 3CJIC 1KDMA 4ZXKA 5CFDB 3AFGA 2OW4A 4Y5Z0 1TME1 1EAH2 1PIV3 4AEKA 2DF7A 1PHMA 5J3UA 2OPKA 1NYWA 3AXEA 4D69A 3U4XA 1COV1 4J1XA 1IPJA 2GMPA 4R4XA 3D82A 4PLMA 3O0VA 4J6GA 3AKSA 5FBZA 5KXCA 3USUA 2DCTA 3TNPB 4BOWA 2IWGB 4BHPA 4IEOA 4Q8LA 2VQAA 2XVLA 4QQPA 1ZRRA 4I3PA 1GSLA 1BEV1 2IC1A 2XGXA 3HN1A 2XLFA 3M8LA 1BKZA 1NA1C 4BWOA 4QMAA 1FAYA 2UURA 2XPJA 5FFOC 3AMMA 3J26N 2W52A 5IK5A 2E6VA 3SNMA 5L36A 1DIWA 1N3QA 1XU1A 4F83A 3KLSA 4KWJA 3PVEA 1UKRA 1B35C 2DUOA 3R4UA 1BVVA 2RS12 4LLFA 3J8F3 4YM2A 1PM7A 1ALYA 1QJU2 3VKOA 2B9UA 5C9AA 4XHBA 1MACA 4MVTA 1OQEA 1JUHA 4C91A 4MX3A 1UPSA 1OKQA 2R0FA 3AZYA 2JECA 2R043 3UKNA 4RR3A 1XE7A 2IXIA 2JICA 1ZX5A 2ENRA 2YC0A 4LLOA 3TOJA 2AYHA 5GLZA 1LTEA 3OF1A 2PHDA 3B9IA 4FQZA 5HBAA 4EWDA 2I74A 2PELA 1CAXB 3L2YA 3URFA 1ND3B 5BUVA 2E7AA 4KU7A 2DCYA 2UY9A 1J1LA 4COYA 1NG0A 4RSUA 4Y4YA 1MZ6A 3MIGA 3D0SA 4Y1UA 2WZPP 3CEWA 4XHXA 2BVVA 3OD4A 2ZAAA 1YJKA 3M1HA 1MR5A 1A78A 3BTAA 1U5YA 2QZ3A 5JSRA 1D4VB 3MIEA 2ILMA 2IXHA 3ZXFA 2EAKA 1QQP3 3V64A 1VBA3 5GZDA 1R081 3MGUA 2K9ZA 1ZNPA 4Y26A 2HWE2 1F2NA 1CONA 5BNNB 1Y7BA 2ZGTA 1YFWA 3POYA 4RQPC 4XZPA 4FOYA 4WVZA 1H4GA 2OZ6A 3KGLA 1ZZCA 1V9U2 1WCKA 2XLGA 4Y1ZA 4I0AA 3MEPA 1FI2A 1Q43A 1RTVA 2CAVA 2JDZA 2JG9A 4DFSA 2CGOA 2O8QA 3NV1A 1QJY3 2RM21 3D6EA 3AZVA 1ZBA2 1LRHA 1UU6A 3E97A 2BFUS 1C8M2 4XJUA 4CDWC 1ULCA 3M3QA 4Q4X2 4CEWB 1XNKA 2EXKA 4MGZE 1W6PA 4HPKA 4AFCA 1CAUB 4E4DX 5JI9A 1RUC3 3ILFA 2A5ZA 2ZX4A 1KS4A 1DLLA 2VUJA 3EO6A 2IXLA 4CDUA 1SFYA 4WVMA 2DU0A 3J8F2 4LA3A 3VKNA 2OYZA 1HX6A 2ZHLA 3ZFEA 1MS8A 2C9AA 2DFBA 2ZGLA 1BK1A 5L7OB 4AVCA 4QPIA 1C8M1 1GV9A 4YLZA 4DY3A 4XTMA 5FQ0A 1PO21 2JJ6A 3VBHB 1PVC1 1W6PB 4HPKB 4XFHA 5JOXA 4LO5B 5K9YA 2WLPA 1AVBA 1WMFA 2NLRA 1YIFA 4LBMA 3VBRA 3X29B 5I93A 4XPVA 4YVWC 3VKFC 5J37A 1IS3A 1IS4A 1NXD1 3BIWE 3L9JT 3FBYA 4XOGA 2ZX3A 1R082 1QNWA 2GMMA 1HRI1 1NXMA 3H7YA 3FFZA 4OULA 3WP5A 4XMAA 3JB8A 1BZWA 1G86A 3KCYA 1AJOA 2Q5TA 4XF9A 3MW2A 2VQ0A 4Q0PA 5DUUA 3PNAA 1S0GA 2X5IA 3TNQA 4Q1RA 5LRSA 1W0OA 1S0IA 1ULDA 4FPHA 1F31A 1RUE2 1HQLA 2RR12 2W0XA 3RMYA 1I1EA 2HKXA 2WT2A 1W0PA 1MZEA 1CGPA 1RIRA 2Q1MA 1PVXA 4A7KA 4Y1XA 2PFWA 3M2MA 1BBT1 4NHKA 5FMOL 1POV1 3I8TA 1CAWB 1J3QA 3B7MA 4XJ8A 1R083 1HQWA 2UWCA 2YUEA 4Q4V3 5ABJC 2NYYA 2RMU3 4M0HA 1E57A 4YNIA 2A70A 1TNRA 4H55A 1QH7A 1PIV2 4GWNA 4XJWA 2DVFA 2GAUA 1AXKA 2R071 3PTYA 2A3YA 2Q30A 1MEC3 5DZGA 2DU1A 2IZWA 2VH9A 3TWIA 4JTNA 4Q29A 2XHKA 5JOZA 2WNVB 1Z7S3 1NCRB 2JKBA 1FPN1 3WP3A 4GALA 1U5ZA 2WFF1 1CAUA 4JGZC 1DG6A 5C9AB 2WIIB 4M01A 1VAKA 1RUG1 4EWAA 2H6BA 4R4ZA 4OHWA 5KC6A 2IXCA 4NR1A 4K20A 4DINB 1DF0A 5I0RA 1WLCA 2ERFA 2JE9A 1G8WA 1A3KA 1QQP2 1COV2 1Y3TA 5IT6A 1GNHA 3WHTA 1NLSA 4H14A 3ASIA 5CB7A 1J1TA 3S7EA 5T5LA 1ENQA 2VNRA 2O1QA 2GZWA 3IMNA 1D0GA 4FAGA 1C1LA 4OLLA 2E63A 1ZZ8A 3E5UA 5DZEA 2MPFA 5JSPA 1PO23 1LENA 4S2HA 3ZIXA 4Q0UA 4L97A 3HIFA 1AX2A 1KITA 4K8FA 4I01A 5D8AB 1V9U1 4B3NA 5GLVA 3THTA 4BE3A 3T1MA 3AP9A 2RR13 1S2BA 2PAKA 2YYOA 4IV3C 3RI8A 1VP6A 5JPMB 1O3QA 2X8KA 4Q4Y2 3KT1A 1AYM1 1JN2P 3FLPA 2VXRA 4SLIA 3O14A 1ZZ7A 4UW5A 3LA7A 4A3XA 5DUVA 5C8CA 3AB0A 3FFQA 2BPA2 4M3CF 3OGJA 3O0WA 2WNUC 4X6RB 3K48A 1OD5A 3KZ4C 2DWRA 4Q0SA 2WL1A 1T6GC 4JRAA 4DRRA 2BBVA 4IQPA 3QD6A 4AFMA 5IK7A 1PIV1 5BNPC 1OPOA 2TUNA 1O3SA 1ND2C 1TME3 4LO7A 1SBDA 4XF4A 4YM1A 4CDXB 1AX1A 3R0RA 4RGAA 1V6JA 4LO8A 1MQTC 4JQRA 4IXLA 4OHZA 5F6LB 1NCQC 1EP0A 1PO12 2AUYA 4LO4B 4Z82A 3VHRA 3ENRA 4COWA 1DYPA 4P9YA 3MW3A 3QH7A 1QWRA 4XQDA 1XQNA 4Q8KA 1BMV2 2CGPA 3GZTB 4GKYA 1CPNA 1RUJ1 3SCFA 1YFXA 4CYDA 5KHIA 1G6NA 2A71A 1CAXA 1AR63 2LUWA 1VBB1 2XJRA 4KBBA 1U0AA 4OVEA 1GZWB 2JX9A 2HWB2 2YXSA 5GZFA 1QJU3 3NAPC 3VZMA 3T2TA 5C9AC 3OPZA 3J9SA 1OA2A 2ZOEB 1ZZ6A 2NN8A 2N7GA 3ES4A 4XE9A 4OHYA 5A33A 1YRZA 1AXYA 3AZXA 4R8HA 3G6JB 1TMF3 4OHXA 5BXXA 3I2DA 2ZX1A 2D6PA 4C0HA 4N7IA 3ZSJA 4Y20A 4UW3A 1DGRA 2XJTA 5DG1A 3N4MA 4QQOA 5FPXA 1WUVA 2OA2A 4XF3A 5TSWA 1NE6A 3MI8A 3KCXA 1XYPA 1M4WA 4L8QA 4MGIE 1CJPA 4AF9A 5T3NA 2CAUA 3VL8A 4MV2A 4WM7A 1MVEA 2EVXA 2WQZC 5K0UC 3H50A 4AFAA 4XEZA 3MIFA 2DUPA 3VBSC 1FOD3 1QOSA 5IUQA 5KHHA 4AHXA 1CIWA 5KBFA 4GA9A 4YW5A 3WINE 5C8CC 2RMU2 1K5MB 3PLQA 3J8F1 3C3VA 4BLIA 4JAAA 3VBRC 4TSVA 5CIRA 1BVP1 3ZXLA 1DBNA 2EIGA 1DGWA 5L19A 5FREA 3H1MA 5JZGA 4A7ZA 4B4PA 4WZCA 5AVPA 4WVMB 2RMU1 1IS6A 1DDLA 1S55A 3M3IA 2CV6A 4JRLA 5T50A 1Q8OA 2Q0AA 2PHXA 1H30A 2XUMA 1AR61 1VBC3 1B09A 5FMOS 4YYOA 2ZHNA 4AEMA 1VAMA 4YG6A 1PK6C 1RUJ3 4GXLA 1OQ1A 4K40A 3ZYIB 3DUIA 4KH9A 2CWMA 2PYTA 1NZCA 2ZMKA 2RM23 3AFKA 2B42B 2ET7A 1LU1A 3V56A 1HXS2 4BQ1A 1QMJA 4P9IA 2BUKA 1XNCA 4D3WA 1PGSA 1WCSA 3USSA 1HV0A 5JWPA 4FO9A 3WG1A 2WS91 2RS51 3OBRA 4PDWB 1A8DA 2VPVA 3AP4A 3EQEA 2ARXA 1AXZA 3CL1A 5T52A 3WVJA 2ZABA 3GHNA 4MLOA 3B01A 2XG3A 2JG8A 4OI4A 1JXNA 4META 5EXOA 3BALA 3TN93 2D6MA 2JE7A 1VR3A 2R063 3CJIA 3RNSA 1PVC3 1S1AA 5JIUA 3VKLA 3ZFGA 2PLV3 3NV4A 1ENRA 1R1A3 4AVBA 5E16A 3RYPA 1O3TA 1CVNA 4DRVA 1Q8SA 5BYNA 1OOPB 3WG2A 4GH4C 3TBDA 2WZR3 1O4ZA 4DOUA 1AR92 2A6XA 1QDOA 4GMP3 1VB2A 4BZ4A 1KDKA 3JD72 1LHVA 1YJLA 3NJZA 4AE2A 3S7IA 3VUOA 5BNPB 1RUC1 3ZFGC 5L7OA 5LEJA 5CFCA 5GJ6A 3ZN4A 1JHNA 3E5QA 4HFSA 4AVVA 1RB8G 1CR7A 1FX5A 1PGW2 4LE4A 1FV2A 2HWC2 2PQQA 4AW7A 1C1FA 1CJDA 3WDYA 2NP0A 1W6OA 2ZGOA 1J3RA 1PVC2 3GZUC 2GDFA 4TWTA 1FMD1 2VW1A 4HBNA 1HW5A 2ATFA 2D5HA 1GLHA 1ASJ2 4TZDA 4BIFA 2XLAA 3V0AA 3RWNA 4MGYE 3VBSB 5K7PA 2SBAA 3JUUA 3N7LA 3LA2A 1VBE1 2ZCWA 1QHDA 5JLVA 2GALA 4A7YA 3ILNA 1OFNA 3AX4A 2WNVC 4CTEA 2DVBA 1Q8QA 4QXKA 3MLJA 1RUI3 1D0HA 4YZ3A 1VAVA 3SH3A 4LEJA 1W2UA 5C6CA 3IDCB 3JBG1 4PIZA 5EYXA 1WGPA 4W6XA 2IXKA 4D94A 1ZBA1 5JDBA 2VMHA 4RGGA 4Q0VA 2KA3A 4L99A 5I8SA 3NV3A 2WT0A 1MQTA 5GZEA 4IV1C 1S0FA 4L9BA 2DYCA 4KWKA 5A33B 1LKNA 3MIBA 5BV6A 2JG9B 4CP0A 2GNDA 2R042 4X8PA 2ZX0A 2ZX2A 5JCTA 3SCGA 3NO8A 2B45X 4LA2A 4Q27A 3ATGA 4BA6A 4COVA 4I09A 4F3JA 5CBLA 2P3IA 1U5XA 3IPVA 2E51A 4PF5A 3UJQA 3ZDSA 3S6PA 3VBSA 2CL2A 1EV11 1AHSA 1IQAA 3GYDA 1GBGA 1KQRA 1R091 3W9AA 1GZWA 2QDNA 1QOTA 4XFCA 2QFEA 2ZHKA 4IV3B 1DGRN 3VDDA 3A0KA 3VBHC 3N36A 1QJX3 5E1RA 4FSJA 2VNGA 2Y0IA 4ZU5A 2BGCA 1SLLA 2UYAA 1RUG3 2RS52 2YPJA 5A3LA 4AK3A 3QH6A 1DQ6A 1MEC2 5BPXA 4W6YA 1HXS3 4N43C 1AF9A 1DZRA 1H4HA 1RVF1 1LEDA 4CP1A 1BEV3 5GLTA 4YW3A 2YROA 3H1YA 3NWKA 4HLTA 4N43A 1UL9A 2VOXA 3TN91 4YW1A 4INDA 4S2FA 3AKQA 4XJ9A 1RITA 4ISRA 2F4PA 3FUQA 3U11A 2JENA 1COV3 1SBEA 1H8TB 4JGYC 1G9FA 4RS5B 4OFGA 4Q4Y1 1N3OA 1HRI2 2XKOA 2CWSA 2FBEA 1CPMA 2VW2A 2MEV2 2WWSA 1MQTB 4N9IA 1O7FA 1S2KA 1HIXA 2P2KA 1PO22 4YGDA 1O5UA 4GMP0 1SEFA 4IV1A 5ABJB 3H7JA 1C8NA 5ACA3 1AR73 5GM0A 2R32A 1WLWA 1YIPA 1YUDA 3HQXA 3N35A 4IEVA 3NAPA 1Q5OA 3KT7A 5CFDC 1V6KA 3IDEA 4AFBA 1OMIA 4P9GA 1BJQA 1ZVFA 3DL3A 5CU1A 1W6MA 2PHRA 5HXVA 3A4UA 4FTBA 1LOAA 2WNVA 4M3CB 1ND3C 1AYN2 1X36A 3BOWA 2QNKA 2DUQA 1RUF3 1OQDA 2R30A 4CDWA 1ZRDA 4QPYA 4RD7A 4KG8A 3H3UA 1LGCA 2FQPA 2LM3A 5LEKA 3JQWA 1REFA 3R4DB 4DPNA 5GLWA 2XVGA 1CX4A 4R9AA 1D2SA 1N1YA 1Z0HA 1FPN2 5ACA2 4ZKTB 4OUMA 1Q3EA 2MEV1 1QDCA 1OSGA 4AI3A 4YGBA 1DZTA 4PIYA 1H1AA 5HCFA 5DDJ2 2HWB1 2WNUA 5EV7A 3EBRA 3ZFGB 3B9CA 2A6WA 3AM2A 2VG9A 3CJIB 1WA4A 4GWMA 1SLBA 3HAGA 4K6BA 2YHJA 1Z7S1 5KHGA 3H9AA 3RI9A 4RHV1 4AEDB 1WBLA 4P9XA 4HVQA 2RS31 3CU7A 5KXEA 2HWC1 2D98A 3RG0A 3M3EA 4DNYA 3IM0A 2X53S 2V73A 4QD2A 3ZXAC 3WY6A 2WSUA 1DU3D 2ZGPA 1QY4A 3AMNA 4Y1YA 3OY8A 5J96B 1SDWA 1Q8VA 3MDPA 4AGVA 1BQPA 2ARBA 5DG2A 1LEMA 1YI9A 1Z7S2 2VUAA 3GBGA 1GKBA 4AEDA 1BBT3 1ZREA 4K1YA 2TBVA 5F1RA 3R4SA 4LULA 1PO11 1LODA 4GH4A 2C1FA 2R49A 4YZ1A 4OUSA 1I6XA 2XJSA 1LOEA 4XFAA 3WQ0A 4AI1A 1O4TA 1SCSA 1VRH1 3FX3A 4FVVA 2KM2A 1RJ7A 4Z1VA 5A3MA 3ZYJB 5BNOA 4HKLA 1QJX2 4XIKA 4QT6A 2XJUA 4AI2A 4L2NA 1VB4A 2WC2A 4FXKB 2B7YA 5E89A 5JPNB 3RYRA 2HJIA 5FQ0B 1IKQA 3SCHA 4E4SA 3PJQA 1SLTA 3MW4A 4LBQA 4UXAA 4KGQA 3WXPA 4DXZA 2AENA 5ACA1 4QHBA 1ZM1A 3GF6A 2DTWA 1W6MB 4FOWA 3WDTA 4XETA 4K3UA 3LKJA 5BY5A 1GYKA 1YNAA 2XL7A 4I02A 1LGBA 3KM5A 1CQ9A 2HWC3 2DCZA 5CG8A 2DCKA 1VBA2 4XYXA 1OA4A 3TYJA 3D4KA 5D8AA 1ZBE1 4DZGA 3JQXA 2HWB3 3R05A 4JGZA 3WQ1A 4CDUB 2A3XA 1SBFA 3FUOA 2ZMLA 4YARA 4I3GA 1XYNA 1OOPC 3V0BA 1OHFA 1ASJ3 4GMP1 4AQ6A 3ACLA 2HEYF 5AFEA 2OVUA 4QGMA 3KMHA 1OA3A 4CEWA 1WLDA 1O91A 3LSDA 5T5OA 4FPGA 3CO2A 2IFRA 1TME2 4H7LA 4P5HA 5CFDA 1O5LA 2I2SA 2BVBA 5FO8B 3GBWA 4Y20B 2OUJA 3M70A 4XJZA 1EPZA 3VBOC 1FMD2 4LBQB 2B46X 1VBD2 4UBGA 4I0BA 4R9DA 2VVFA 4LBNA 1RUG2 3ZMOA 3WDWA 1QJY1 3P3PA 1WMDA 3HMYA 2X5IC 1BBT2 1UW8A 3W58A 5C4WC 3E6DA 5BNOB 1N1SA 2W68A 1APNA 1WD3A 1CAVA 1QGLA 1AR81 2JG9C 2P34A 2E7TA 1FPN3 1NA1B 4Y22A 1AR71 1LGNA 4A2UA 2D43A 4B4QA 3WW2A 4FPCA 5I91A 2WNEA 1J58A 1VIWB 4Q1PA 3WW3A 2GN7A 4CDQA 3JD73 1QXRA 4KGGA 4WM7C 1ND3A 3RQ0A 3NKTA 4BMBA 1VBB2 2ZJCA 2NQYA 4R9BA 3BCWA 4QQHA 3OY8B 4XBQA 3ZSMA 4Y24A 1MEC1 2ZTNA 1UZZA 2DFCA 3WW1A 1V70A 4COZA 4GIQA 4HVOA 1GFF2 2VECA 4NN0A 2A6YA 4JGYA 4BCUA 4FT8A 2TNFA 4N53A 3KQRA 4CDXA 2VMIA 3KGZA 1FV3A 3J4UH 4MXVA 1NCQA 4DMIA 3FHIB 4QPGA 2PHLA 2DVAA 5F9TA 1LULA 2RR11 4K21A 1KFUL 2GNMA 2Z42A 1V9U3 2Q4SA 1AR72 1PZ8A 3AP7A 4F7ZA 2ET1A 1PGL1 1MZFA 4LBKA 3AMPA 4HMZA 2HWF2 1RUI1 1KXGA 3HWJA 3IWZA 2AR6A 2VULA 4AEDC 4AQTA 2OIIA 4M3CE 3WZ1A 5FLIA 3WCRA 3LAGA 4MH0E 3UK9A 4IEUA 4FPYA 5I8YA 2R041 5JAXA