1UMIA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
b'GSHFYFLSKRRRNLLRNPAGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed rcsb
source organism Mus musculus
molecule tags Ligase
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umiA00
2VZOA 4LKSA 4ET7A 2J1UA 2YC2A 2X10A 3C7HA 4E8DA 3HNMA 3C7FA 2WBKA 2QQIA 1R64A 4FI9A 3W5NA 4A3ZA 1IQDC 1SHWB 3K75B 4DEVA 2W9XA 4W4ZA 3ACHA 2W1QA 2W94A 4CU7A 4M4PA 1W9SA 3I2JA 5LA2A 1XNTA 2ZEWA 3NJXA 3VD4A 1UY4A 2C26A 3FHQA 2WYSA 5LCWL 3I97A 5IFTA 2W46A 2HYXA 5DMYA 2OKXA 1UX7A 1O8PA 1PX3A 2KD7A 3FL7A 2WDBA 1ULPA 2X09A 3WF1A 3CQOA 1JZ6A 1JYVA 5HXMA 4QB6A 5JMOA 3LPGA 3W5MA 3BN6A 4ARYA 4CVUA 3F2ZA 1YQ2A 2QQMA 3ECQA 1NX9A 2VZUA 1DYOA 4UAPA 2E26A 1J84A 2WN3A 5B4XA 1UMIA 1US2A 3WQBA 4CUAA 4QX2A 4DXSA 3LEGA 3MBWA 4XUPA 1UXZA 2YFUA 1OD3A 5C70A 2J1EA 2XONA 4D0QA 3GM8A 2Y6HA 2QQOA 3NQHA 1CX1A 4IUGA 5G04L 5JR2A 2W87A 3ABZA 3WNLA 3HPNA 1O8SA 3U37A 4MADA 5IHRA 5J1XA 1K12A 3MUZ1 3ZM8A 2VZ3A 4OMDA 4QDSA 3SKVA 3AC0A 4DXTA 3EB7A 3SEPA 1UY3A 3MUY1 1EUTA 1JZ8A 3SEEA 3K4ZA 1KEXA 3FN9A 5C7GA 2Y6LA 3C7GA 4P08A 4QPWA 3T0AA 4A41A 2QBXA 5B4NA 1WCQA 1DP0A 3OB8A 5EJ1B 5EIYB 2JE8A 3THCA 1H6XA 3T0BA 1JYXA 3C7OA 3IAPA 1WKYA 2WO2A 4PT6A 2C4XA 3VD3A 3VDAA 2W1WA 1UY1A 2BBAA 1F4HA 2PQSA 3CZJA 1US3A 1TVGA 4DEQA 4GWJA 4P00B 1L7QA 4XZUG 4CU8A 3HNYM 4D8MA 2Y6JA 3IDAA 2BGPA 1PX4A 3DECA 3WF3A 4QB1A 1K42A 3C7EA 2WAAA 2L9LA 4CUCA 2VOTA 4MO3M 3K77A 4XUQA 1CZSA 3LQCA 1KGYA 1W9TA 1JU3A 2ORXA 2Y64A 3OEBA 1GOGA 1GUIA 3LEIA 3MO4A 4OYUA 4KWUA 3T0DA 1XC6A 4BDVB 1H6YA 4A6OA 3HOBA 2WN2A 4QB2A 1SDDB 4PQQA 3E1F1 3THDA 2J1RA 2WUHA 4QX1A 1NUKA 4BJ0A 2CDOA 2VZ1A 4MOAA 1JZ5A 4ARXA 2VMEA 3SKJE 4L0PA 5JUVA 4OZOA 3WEZA 1JZ3A 1L7RA 1XNAA 1CZTA 2YG0A 2J1VA 4E8CA 5DN2A 1F4AA 3T2QA 3I2KA 1P8JA 4ZZ5A 2W92A 2VQTA 2LW8A 3NJVA 2VCAA 1CIYA 2BERA 4TTGA 2XHNA 3LEKA 2W91A 3FHAA 1BHGA 5HPOA 3I2HA 2JKXA 4UI9L 1JYWA 2VR4A 3DYOA 1EUUA 2J1TA 2VZRA 2XOMA 1W8NA 2W1SA 2VCCA 2EIEA 2ID4A 2QQKA 4KI5M 1CZVA 2VZSA 4Z2AA 2B9VA 3I3DA 1UZ0A 2V4VA 5LA0A 2RV9A 4ZXEA 4DUWA 4LQRA 2RJ2A 4RN5A 2VQUA 2J1SA 5CYYA 1UMHA 2VMDA 2WQ8A 3IB3A 3CMGA 4XURA 1UXXX 1I5PA 4JX0A 4W50A 4BXSV 4OUEA 1GU3A 4OMCA 1W8OA 3UESA 3T08A 5FUIA 1OT5A 4PF1A 2BZDA 4LPLA 3A23A 3IAQA 2LS6A 2Y6GA 4P02B 3MV11 2VZPA 4KMQA 3WNPA 1UYZA 2BGOA 2E33A 2WABA 4YPJA 1W9WA 4ZZ8A 4A4AA 1JI6A 3T2OA 5C71A 3UNPA 4HG6B 3UETA 5JXJA 4XUOA 4A42A 5JXIA 3DYPA 3HNBM 1JZ7A 3NRUA 1DLCA 3OBAA 2CDPA 4XUNA 1JZ4A 1GMMA 2VZVA 3ETPA 3GDBA 2XQXA 2W3JA 2W95A 2WO3A 2ORZA 3OEAA 4CUBA 3WF2A 4JKLA 1GOHA 1JHJA 4RYDA 2WZ8A 3HJRA 4QDQA 4JKMA 3EYPA 1XPWA 3J7HA 1UYXA 5JXHA 2ZEXA 2ZXQA 3CKHA 2E32A 5A1AA 4GZ9A 2QQNA 3D3AA 2YFZA 3HN3A 4M4RA 4QAWA 1RYYA 2VL4A 3CDZB 1UY2A 3I2FA 3P1IA 3A21A 3VD5A 3WF0A 3LE0A 1JZ2A 3OGVA 2VC9A 2VO5A 2VTFA 3LPFA 1UWWA 4DUVA 3WF4A 1JYNA 5LA1A 2W5FA 1NKGA 4ZY9A 3GXUA 1UY0A 1PMHX 3WNNA 3I3EA 2Y6KA 3P6BA 2X05A 1GNYA 5IFPA 2V72A 2VZTA 3K46A 3WNOA 3WSOA 4QX3A 2W1UA 4BK5A 1K45A 2DDUA 4P5YA 3JXSA 3IIIA 2C9KA 3DYMA 2EIBA 3CZUA 5F7UA 5G05L 2YB7A 2E31A 2VMFA 4JHZA 3OGRA 1LNSA 1JU4A 2J7MA 2J22A 1NAEA 1W0NA 2HLEA 2Z4FA 5CZKA 5DQ0A 2JD9A 4XUTA 4AAXA 3WNMA 5EJZB 1K3IA 3GGLA 4BK4A 4TXWA 2QQJA 3I2IA 2WZEA 3ACIA 3VDBA 3C8XA 1GQPA 3A7QA 4A44A 2YC4A 4XVHA 1OF4A 1HN1A 5IJRA 1UYYA 3WNKA 1MPXA 1W99A 2VCBA 2VJXA 5JXGA 1GOFA 3I3BA 3PUHA 4DUXA 1D7PM 2JDAA 1O59A 3ACFA 5DPNA 4DXRA 1TG7A 4JKKA 2ZEYA 1SG3A 4MGQA 3T09A 2VMCA 4CU6A 2DCKA 2V5DA 2EIDA 3K4AA 4GWIA 5I0DA 3OGSA 2EICA 3OG2A 4UOJA 3MV01 4A45A 3T2PA 2WO1A 4QDRA 4QX0A 4W8JA 1ULOA 4LHSA 3VDCA 3VD9A 2J1AA 3VD7A 1J83A 2RVAA 2Y8KA 4CU9A 2VM9A 2QQLA 5IYYA 3BGAA 3HEIA 3CIHA 2W47A 2B4KA 2VZQA 4AG4A 3PUIA 2DCJA 2ZEZA 2R7EB 3NNGA 1T2XA 3A22A 3ACGA 2WAOA 1OF3A 3I2GA 3K4DA 1OH4A 1PMJX 4MGSA
chains in the Genus database with same CATH superfamily
2YGMA 2ERFA 2VUCA 4M0NA 2D44A 4FSJA 2K9ZA 2QJVA 4UFHA 5LBFA 2RE9A 3D0SA 3PVOA 2GMMA 4YVWB 1F31A 4XTPA 2MEV1 1CVNA 3ZXGA 1D4M2 2HWF3 4LKSA 4ET7A 1X9PA 1YNAA 1Y9MA 2J1UA 4CP9B 4E8DA 2XVGA 1O4TA 2ENRA 4XFAA 2W39A 4AVCA 3NSTA 3RGBA 2BNMA 3V65A 1VRH2 1IQDC 4C90A 4DEVA 1O91A 4LA3A 4Q4Y2 1COV3 4KBBA 3VGIA 1QY4A 2D40A 1UYPA 2XJUA 4A3XA 4CCMA 1X8EA 2ZOEB 3VBRC 3BB6A 1U12A 1SBDA 4WVMB 2HWD2 2J42A 1UY4A 1PVC2 4RGKA 4C1XA 4XETA 2C26A 1CWPA 4RR3B 4J6GA 1QKQA 4LE3A 4A2UA 4YZ3A 3I97A 4U36A 4CCCA 4XFGA 2HYXA 3ZXKA 2MHFA 4YZ5A 4LULA 3A0KA 3Q8AA 2Q4SA 4XAAA 1WZXA 1UX7A 1I5ZA 1O8PA 1G8WA 2EXIA 5GLUA 2BPA2 3ASIA 2QQVA 4NIDA 3POWA 5I8YA 1AUYA 3POJA 4FQ4A 5LB6A 1W6MA 5JMOA 4QQPA 5L9RA 1HRI3 4YZ1A 2P3YA 3N7KA 4RGAA 4B1LA 3U07A 5FZ4A 3F2ZA 1C57A 1U5ZA 2UYBA 2YPDA 4FT8A 2HWC1 4GB31 1POV1 1UPIA 4OFGA 4XABA 1A3KA 1NCQA 5CFDA 2P17A 2ZX0A 2VBBA 5APAA 1DYOA 4QPGA 1ND2C 4Z8BA 1ENSA 1RUE1 2D6NA 4QX2A 4C91A 1ZBE2 4Z82A 2YHJA 3CNAA 5F6LB 3RRDA 5IATA 4Y5SA 2R6QA 5D21A 4WM8C 1YQ5A 1ULEA 2R1DA 1ZREA 4YVSB 2NMOA 3BOWA 1RINA 3KF5A 2AR6A 3ZN4A 4BCUA 4FP2A 4IL7A 2Y6HA 2VQ0A 2QQOA 3IDBB 2I07B 3NQHA 3TEYA 1CX1A 3CBNA 5FJHA 3D6EA 4IUGA 2IUWA 5FMBA 5JR2A 2MEV2 2W87A 4OI1A 1NT0A 3HPNA 5SV5A 4EN6B 5IHRA 5J1XA 1BVVA 2H0VA 2LM3A 1C1FA 1PK6A 2B42B 1OLRA 3LEMA 2RDQA 5T5OA 3DKQA 4A6SA 2VZ3A 3THTA 3SKVA 3H8XA 3EB7A 4KU8A 3B00A 1OH3A 3HT1A 3SEEA 3VHNA 2VULA 3O7OA 2VH9A 4P08A 3SCHA 5LEJA 2AUYA 3I59B 3NV1A 1YFYA 5BNNB 1OURA 2RS51 1CPMA 4LNVA 3EXUA 4GH4C 4UBHA 1ZBA3 3FBMA 3WVJA 5HBAA 2MNGA 5AVAA 2WT1A 2XL9A 5EIYB 3E5XA 1ZZCA 2JE8A 2VPVA 4FXKB 2XLFA 4ZXKA 2VMIA 3T0BA 1ZM1A 3POSA 4NN0A 3C7OA 1O6UA 5FUPA 1OFSA 1WKYA 1BBT3 1O5UA 3N7JA 4HN0A 5K0UB 5AC93 4Z92B 2C4XA 2WKKA 3VD3A 2R043 1R091 1SPPA 2W1WA 2JECA 2DBNA 4E4SA 1CAUB 5F8PA 4K20A 2ZJCA 5BYNA 2RS31 2BBAA 1HXS1 3CJIA 1BK1A 4DNYA 5L36A 4GB32 4H7LA 1XXNA 2HWC2 4GWJA 4CU8A 3UJQA 1H1MA 1YFUA 5A32A 1PX4A 3WF3A 4NAMA 4Y1YA 2ZZQA 3C7EA 3L9JT 3FLRA 5A3WA 4DQAA 3MF6A 4RFT0 1RUE2 3K77A 1IQAA 5JSPA 3NJZA 2WNEA 5FCCA 3QBQA 4LUKA 1UNBA 1GZCA 3AZWA 3DKWA 5FOJB 5IFTA 3OEBA 1GOGA 3LEIA 3MO4A 1NA1B 1NXD1 5FZEA 5CFCC 4KWUA 4XHBA 4BDVB 3T0DA 1Y3TA 3HOBA 3VBRA 5L7OB 1NZIA 5EHDA 5K7PA 1RMU1 1W2AX 5A1LA 1EAH1 1QH6A 3WR0A 4R8HA 4PQQA 4LUMA 3E1F1 4Q0QA 4Y26A 3WW1A 1GV9A 3THDA 3CJXA 4NIAA 3UKTA 4E9KA 5FO9B 1W8TA 4NIHA 2QE3A 1UIKA 1IS4A 1AR72 2VZ1A 1QNWA 4MOAA 2DCZA 4IDZA 4PQ9A 5FK8A 2H0BA 2VMEA 4GALA 5JUVA 2NZ9A 4Q5OA 3WEZA 1IS6A 4CEYA 4YWAA 4YW6A 1LU1A 2OT7A 3D4KA 1C5HA 3MFAA 5KHIA 5FY0A 1V6NA 4AEDC 1NE6A 1S4CA 2C5DA 3WDYA 3DEMA 1CZTA 5F3IA 5CNAA 4Q8KA 4ZHNA 4GKXA 5DN2A 2GC0A 3VBHA 3T2QA 5FO8B 4QD2A 1MZ5A 5GLZA 1IOAA 1W28A 3KZ4C 4Q4X2 3GZAA 3I2KA 1H8TB 1H9PA 1N3OA 3VBSB 2Z5WA 2VQTA 2JDUA 1K5MB 4XDQA 1CIYA 2LTNA 1QJY1 1TME3 3PU8A 4CEWB 4TTGA 3LEKA 2KM2A 1BHGA 1W6QA 1CGPA 1YUDA 5ANNA 5HPOA 1J1TA 1V6IA 2A75A 3HQXA 1HXS2 3DYOA 4TYSA 1U5YA 3SCGA 3WP5A 5A6XA 4OQ8A 5FYZA 2AEYA 2J1TA 2R061 2SLIA 1VBA1 4HK9A 2G9GA 2OVUA 2QZ2A 2VZRA 1MS9A 1EV13 3KV9A 4XMIA 3TN91 1LGNA 1H4HA 2ID4A 3S6PA 4B29A 1ALYA 3S0MA 1VBD3 5FREA 1QU0A 1LR5A 1UN1A 2IVIB 4ES9A 3I3DA 3AKRA 5CFDB 5KBFA 5JSOA 1UZ0A 1RVF3 1GNHA 1X82A 3AZVA 4HMZA 2RV9A 5FTTC 4DUWA 1AR83 4LITA 5F5AA 2RJ2A 2VOXA 1W2UA 2VQUA 3ZYGA 2ZMNA 5EZWA 3JBG1 3GBFA 4IGQA 2JD4A 2CWMA 3BCWA 3CMGA 4GMP3 4RQPA 1I5PA 1RMU2 2E63A 2NPIA 3SHRA 4FP3A 3UT0A 1AF9A 2YUEA 3H1MA 5C3PA 1GU3A 5A7QA 3OJBA 3U10A 4JAAA 4NIIA 3WUCA 3AP9A 2GP5A 3T08A 1HIXA 5IVJA 1SLBA 3BPSA 1TEIA 2G19A 2BZDA 5FY4A 1DQ0A 1IS3A 3IAQA 4OQ9A 1RUD1 2Y6GA 3OD0A 4BZ4A 3MV11 5H9PA 4AR2A 1YWKA 3P5BA 4L2NA 4OI4A 3ZMNA 4NMIA 2DVGA 3LGRA 2BGCA 2A6XA 1HB3A 2BGOA 2E33A 2WABA 4QX7A 5FRAA 4YPJA 3ZFFC 1JI6A 1COV1 5DDJ3 1LENA 5C71A 5F9TA 1POQA 2AH2A 2JG8B 2JDMA 3JCIA 4HG6B 5CISA 5M0TA 3UNPA 4KU7A 4XUOA 3POGA 2EAKA 2QUOA 3SMHA 5CG9A 5GLWA 1JN2P 4QHOA 5FZOB 2FDGA 3ZR6A 4EV0A 1QJY2 2JG9A 5KWRA 2B7YA 2XLAA 4FPCA 2CDPA 2RM23 1UD1A 4XUNA 1REDA 2XBO1 1XNDA 1JZ4A 1DCSA 1SPPB 4KNCA 3WT3A 1REEA 1YQ6A 2UY9A 1UU4A 1GANA 2XQXA 2R062 2WO7A 4X6QB 3WP6A 1HV1A 3CJIB 3M4FA 1QJX3 3TN92 2W3JA 2W95A 4NVPA 5JOWA 1HRI1 3KGLA 3DN7A 2JIJA 3PIJA 4IGOA 5T5PA 1OMIA 2FDHA 5A32B 1JHJA 4DY3A 3SH3A 1W90A 4JKMA 3R0RA 5DAPA 2ZTNA 3DGTA 2GN7A 1RJ8A 3J7HA 1UYXA 1PGW1 5JXHA 2ZEXA 3MIDA 2A6WA 1A8DA 2E32A 3BTZA 1AR91 2XH6A 4JGZA 4ASMB 3FE5A 5F6KA 3JBG2 1JW6A 3SNMA 3C2UA 2D3PA 4R52A 4O9EA 3R4SA 4NOTA 4M4RA 1D4M3 3VHRA 1KD7A 1YFWA 4I3GA 4W65A 4UFJA 1SDWA 3FLTA 1SLIA 3JD71 2TEPA 4ISRA 3I2FA 3P1IA 3A21A 1NLSA 1DHKB 5DZFA 3LE0A 4B4QA 3JQWA 2C9AA 1VRH3 1AVBA 1RUD2 4FOWA 5CKMA 4Q4Y3 1NCRB 3WCSA 3JB4C 1SQ4A 3WF4A 5FZFA 1PNGA 2AEZA 2VG9A 4JTNA 4NHLA 3UK9A 3V0AA 5KXCA 1F5JA 1TNFA 4G3YC 2W5FA 4ZY9A 2HWD3 1COV2 1VPHA 2V09A 4K1ZA 1W03A 3LDBA 5C33A 1PVC3 3OY8A 1LKNA 5FYTA 1W8HA 3MLJA 3OYWA 3WHTA 3VBHB 4EZHA 1YI7A 1OC1A 5LY1A 2ETEA 1ZBA1 4JDMA 1Y9QA 1W0PA 5F2SA 4E4DX 2JIGA 1FATA 4P5YA 4URAA 3JXSA 3URFA 2ATFA 2EIGA 1PM7A 3IIIA 3DYMA 2DCTA 3CZUA 1W6QB 2XBO2 4QKNA 5FYCA 4MXWA 5D8AC 2F4PA 2YB7A 2IFRA 1X33A 2R041 1STMA 4LEJA 2X5IB 5FIXA 2ZABA 5L73A 1HRI2 3D82A 4JHZA 4WVZA 2JDPA 4LO4B 5J36A 2HWE1 2R071 3HQRA 1Q8QA 2C1FA 4I01A 3VL9A 2NP0A 4AEMA 4ITCA 4QXKA 5FP7A 4NPMA 3ROUA 1FYUA 1GYKA 1NE4A 2XJPA 1ZBE3 5K4LA 4NROA 2Y34A 5EJZB 1X36A 4HK8A 4BHPA 4NIGA 3BKZA 1K3IA 1AR92 3A0NA 3J4UH 2QQJA 4XBLA 3MI8A 1OOPA 4YNIA 5CA6A 1DZQA 5T55A 3RS6A 2RJKA 1LESA 2MEV3 3KD4A 3MFCA 1JXNA 4Y20A 2Q8EA 3A7QA 5L19A 4KL1A 5F5IA 4AYUA 4HOOA 3JD72 1NQDA 1UYYA 4MX3A 4C0HA 4JTOA 4RR3C 2CWSA 3NAPC 1MPXA 1W99A 3U0ZA 5E6HA 1QXJA 5FY7A 3ZFGA 3ZYHA 4EWDA 5JXGA 2W68A 4O65A 4Y3OA 3VKLA 5LRRA 3T30A 1XB9A 3I3BA 1BK0A 3IPVB 1H1AA 2JDAA 1O59A 3ACFA 1J3RA 3LA2A 4UW3A 5FLIA 4AVAA 5CBLA 4RSUA 5ABJA 2GNBA 1TG7A 4RS5A 3ZFEB 4Y1XA 3KLSA 2O8QA 1SBFA 3B93A 1AXYA 3AL6A 1GP6A 4N53B 4V2VA 5DUUA 3H8OA 3R4DB 1ZBA2 4Y1UA 2BFUS 2VQAA 4LO7A 3KHBA 1CAXA 3PHMA 1PNFA 2EIDA 5FMOS 4XE9A 4K3UA 1ZZBA 3UV9A 3OGSA 5GZGA 3BU0A 3OG2A 4NRMA 4UOJA 3MV01 3T2PA 1G86A 3UKVA 4TZDA 3KQ4B 2WO1A 4QDRA 5IVEA 2XB6C 4HXCA 4YVSC 1KJRA 2V73A 2HBTA 4GB33 3VDCA 2HWC3 4JDNA 4QWNA 2J1AA 4COWA 1POV3 3WUDA 2BQPA 3JUUA 2D3RA 2WL1A 4HL0A 1V6LA 1GZWB 2HWE2 2R072 2WT0A 4XHXA 5IK7A 1DZTA 3WCRA 1ASJ2 3POBA 2ZGOA 2ZGMA 3CIHA 3WZ1A 1G6NA 1SLAA 4DPNA 1ZA4A 4OZXA 3AYCA 4AG4A 3UKNA 2YBPA 1IPKA 3ME2A 4DMIA 5A3UA 3MIFA 2DCJA 1TQ5A 2R7EB 1QOTA 1ZNPA 2YC0A 2JDNA 2Z42A 4XJZA 4X8NA 5FP3A 3VBOB 4HVOA 4EWAA 1AR81 1PZ7A 1KXGA 4YGCA 4CDWC 1W8WA 2DUQA 3VHOA 1LRHA 1AYN3 4MGSA 4GMP1 1AR73 1YJKA 2BOIA 5DZEA 4CDQB 3OGGA 4E4HA 2BW8A 4TN7A 3AMMA 4L99A 2ARCA 2VZOA 5C5TA 3O1MA 1Y9GA 1IG0A 3M7AA 4QM8A 4MV2A 5A7WA 5FKBA 2YC2A 3C7HA 5K0UC 3HNMA 4R9AA 4R9BA 4FPKA 1CX4A 3INAA 2R1BA 1OSGA 3AB0A 2V5YA 3C7FA 3LDKA 3TBDA 1X7NA 1G9BA 2WBKA 2ZHLA 3SQOA 4FI9A 4PDWA 1QH7A 3IDCB 4W6WA 4EZ4A 3K75B 4YM3A 4ISQA 5LASA 3V0AB 3W5NA 1RUH1 2VGDA 4LBQD 4BQWA 3VBFC 3ACHA 5A3LA 4Q4X3 2W94A 2ZACA 3WW4A 3OY8B 4CU7A 3M3IA 5DDJ1 4IV1B 3NL1A 3LWCA 1G7YA 1QHDA 5C8CA 3LB9A 3I3MA 1B35A 4MVTA 1NXMA 3D8CA 3FMGA 4Q27A 2GMPA 4UF0B 4DFSA 5I8TA 3IKWA 4XFHA 4IEPA 4F8AA 5LCWL 5E89A 4JHTA 1WCSA 2P3JA 1HXS3 1F35A 2DVBA 4MLOA 5EYXA 1VAKA 3WDXA 1NA1C 4D7SA 4PF5A 2QDNA 5FPLA 1MVEA 4AFAA 1TNRA 1RUJ1 2G1MA 4TLFA 5FXZA 3USSA 4B4RA 2PQQA 2X09A 1UOJA 1JYVA 4HKOA 4QB6A 2Y6FA 4YW7A 5HXMA 3WX5A 3LPGA 1KDKA 3UGGA 1PO13 3W5MA 2EAAA 1SFYA 3AXDA 1W6OA 4CVUA 4MSVA 5FY1A 3RZZA 3NNMA 1NG0A 1FPN3 5IUQA 4Z2WA 3PL0A 2VZUA 1RHI1 2OYZA 1W9FA 2EXKA 5FZDA 1W8ZA 1QJZA 2X53S 5FOBB 1RUI3 5B4XA 1QMJA 4BA6A 2A70A 1RMU3 2CGOA 4JRAA 4I0AA 4BQ2A 5GALA 4DXSA 2F4LA 3VDDA 3AXEA 4BIOA 2Y26A 1UXZA 5C70A 1MZ6A 1OD3A 3AKTA 2ZGLA 3PVBB 4MHRA 4S2FA 1M4WA 1XSQA 2G4IA 2BP6A 3GM8A 1C4RA 2YGLA 3KGZA 4YGDA 4D0QA 4D6SA 4F83A 1H8TC 1D4M1 1AHSA 3LSDA 4XF9A 4QXBA 3N35A 4Y4RA 1XOYA 3VBSC 3WNLA 3EO6A 1K5MC 4BU2A 2EA7A 3WNPA 5JZGA 4CEWC 3ZFGB 2FD8A 1GR3A 3N9QA 1K12A 4V1PA 3N9NA 3RYKA 1VRH1 4QDSA 5EPAA 2NLRA 4IV3A 4W6YA 4Q4Y1 4AHYA 3MUY1 1I1EA 4YZ2A 4PIXA 4UYBA 1GWLA 4NPLA 3K4ZA 1RUH2 4I30A 4Q4W3 1WMDA 1KEXA 5L9BA 1CAWB 5C7GA 5F3CA 1ULGA 2Y6LA 1W6NA 3CLPA 4R4XA 5GLTA 1O5LA 3KT1A 3G6JB 5DDJ2 3T0AA 3WNXA 1ND3A 1LOAA 3AKSA 1PVC1 3K3NA 2XDVA 4FOVA 1QJY3 2QBXA 2JICA 4Y1ZA 4OI2A 1WCQA 3OB8A 3ZXFA 1IPSA 3N3HA 1CAXB 1JH5A 1TMF1 2FMDA 4LTAA 1H6XA 2A6YA 2RDSA 4H2AA 2XXZA 4QPIB 1JYXA 2BDRA 5KR7A 2GNDA 2WO2A 4PT6A 4EE2A 2R063 1Q8SA 3HMYA 4HVRA 1N1YA 1J58A 1BZWA 3OTFA 1T6BX 4PI0A 3ZXEA 4Q1RA 1RUJ2 3TN93 4EN8B 4J1WA 5C9AA 5JAXA 1Q56A 1J3QA 5C4WB 1UY1A 4N9IA 2HJIA 3OGJA 4AI9A 4XQDA 2Y38A 1F4HA 1UU6A 4FPLA 1C5IA 2XUMA 2JENA 3KVAA 1MQTA 2XL7A 5ERLA 3RMXA 1OA4A 3HNYM 2Y6JA 4BH9A 1RHI2 1UPSA 4NHMA 2WZPP 2B9UA 2GN3A 4IEUA 1MS4A 4Z07A 1ZRRA 3JBG3 2CV6A 1NOVA 2L9LA 5T50A 3SXWA 4MO3M 4XUQA 4PLMA 3N9OA 1CZSA 2WS91 1KGYA 4BMEA 1JU3A 2ORXA 1EPWA 3DUIA 4H7MA 5FPBA 4CP0A 4JGYA 5IK5A 1WBLA 4CTEA 1XC6A 1H2NA 2PELA 1H6YA 2VNGA 4A6OA 4BIFA 2D3SA 1W6PB 1KITA 2JG8C 4BQ1A 5FZ9A 5A33A 2ET7A 5F3GA 5FZ7A 1RUD3 2WT2A 4P9JA 5BNOA 4HSLA 5LBEA 4YW1A 3RDIA 4LIVA 2XGXA 4BJ0A 1KDMA 3J7NA 1UOGA 2CYFA 3AZZA 3U78A 3NNJA 3R6SA 3Q8BA 3MHZA 4XF4A 2NYYA 3K48A 4XEZA 2YBSA 5GM0A 1A8MA 4XACA 3SCFA 4CPBD 1SLCA 2VMGA 4X8PA 1DGWA 1VJ2A 4PDWB 3N9LA 1LEMA 1XNAA 2DU0A 3DPRA 4B7EA 4E2GA 2ZGQA 3AX4A 2ZGUA 3Q8CA 4AFCA 4E8CA 1F4AA 3RG0A 5JI9A 2CGPA 3E5QA 1TMF2 1QOOA 1B35B 1P8JA 3ZYJB 2XBO3 1UKRA 2W92A 5BUVA 5ISLA 3NJVA 4PHZA 1DYPA 1YHFA 2BERA 2GH8A 4LOTA 2N7GA 4LO5B 2W91A 3FHAA 4HPKB 2PHXA 3QH6A 3I2HA 1RUG2 5FLHA 1SMVA 2Q0AA 5FY8A 2VR4A 4W6XA 3ZSEA 1ODNA 3ALQA 1WGPA 4N43B 4K1YA 2ZMKA 1JODA 1UU5A 1W8NA 2JEMA 5EFUA 4B4PA 1W6OB 2BEOA 1CZVA 1SBEA 1ZRIA 3WDUA 2TUNA 2XMLA 1AR93 3USUA 4AHWA 3GZTB 5DG1A 1NCRC 2PHFA 3ZKYA 4AI8A 4QM9A 1WW4A 2WNUC 1LOBA 1HQLA 3KS7A 4Y22A 4CDXA 2P6CA 2WS92 1E5RA 3NO8A 2DVFA 4ES8A 3H3ZA 4WVWA 4AVBA 4I0BA 3JD73 4FAGA 3O0VA 4JQRA 1Y43B 1UMHA 2WQ8A 3IB3A 4XJ8A 2ZHKA 5LWBA 2W08A 4BLIA 4C8DA 1UXXX 4COYA 3M70A 4XJAA 4Z1VA 5EQUA 1LGCA 3PLQA 1AYN1 5A7OA 5FPUA 4CCDA 1ACCA 1AR71 4LOSA 3UESA 3GZUC 4NAOA 5FP8A 5BV6A 3BTXA 4HN1A 5HCBA 2PAKA 1W9YA 4PF1A 5HV0A 5KHHA 5FYIA 5GLVA 5JZGB 4KWJA 4NO4A 4FPOB 3KQRA 4L8QA 3O0WA 4KG8A 1DQ4A 1OA2A 1SLLA 2XKPA 4P02B 5AFBA 5FZ3A 5BNPA 4AI2A 3E6CC 2P5BA 1XJAA 1LGBA 4KMQA 5HCFA 3UYJA 4AI1A 5AFEA 2OZ6A 1W9WA 4IEYA 4BB3A 1YI9A 1VAVA 2WLPA 4OULA 1C8NA 4Q4X1 1ND3B 4FAHA 1ENQA 2DFBA 2X8KA 1FV3A 1JOPA 3UETA 2CHHA 2VTXJ 2WQ4A 4G9SB 2A6VA 4QXCA 2LALA 2BNNA 2WR9A 4A42A 5JXJA 5JXIA 3DYPA 1OLMA 3TEZA 4NRPA 4LORA 4LBOA 3PMEA 3WQ0A 1F8VA 3AJYA 4XCBA 1DGLA 2CU5A 2OZJA 3APBA 2HWE3 2R073 4CXXA 1WCUA 2BJSA 1ASJ3 3HVDA 3RYPA 3O0XA 1VIWB 1JMUB 3ETPA 4BXFA 1NQJA 3JU9A 1QGLA 1IZ3A 2WO3A 2JE7A 5FYMA 5IWFA 2DCYA 1PO11 4JQTA 3ES4A 1L3JA 2BFUL 3HN1A 1GWMA 3HWJA 2CAUA 2G9ZA 3SH4A 4RYDA 3T2TA 1V6JA 3SISA 3MLLA 5E8AA 5FMOL 1FPN1 2B45X 3AP6A 2XR4A 3EYPA 1XPWA 1OA3A 3BPZA 2OA2A 3M3OA 4QGMA 3W59A 1LULA 2ZXQA 2IXHA 1OKOA 1R1A3 2WFF1 3CKHA 3EMRA 1RUI1 4ARYA 2KR2A 2WNVB 5A6YA 2A3XA 3E97A 4KGQA 3ZFEC 2QQNA 4JGYB 4K7JA 3WQBA 4FPJA 4K40A 4N53C 4AVTA 3MLKA 4IGPA 3GJBA 3J26N 4LKEA 3I8TA 4UXAA 1AYN2 4XF1A 3ZYIB 1VMHA 5IK8A 1PZ9A 2Q30A 4QAWA 1W0OA 3W9AA 4D6RA 5A33B 4M3CA 3ZDVA 3V0BA 5BNOB 1JUHA 3VD5A 2NQYA 3WF0A 1ZRFA 1H2KA 3OGVA 2VC9A 3AK0A 2QQUA 5LY2A 1AL23 2OIIA 3HR9A 1TZOA 3LF7A 2YROA 4Q2FA 3AZXA 2G9FA 2XUEA 4GWNA 1JYNA 1NYWA 5JCTA 1UL9A 4IE7A 2ZAAA 4UWDA 1FV2A 1WLCA 4Q4W1 1DGRA 2C24A 1S0FA 3WY6A 1Y7BA 3GCWA 1ND2A 2QKDA 2IXLA 3I3EA 1X50A 2WLQA 5DAWA 3WHUA 5FYUA 2X05A 3AYAA 2D6KA 5IFPA 1QEXA 2V72A 5A7PA 4WM8A 3WSOA 1LHOA 2W1UA 3NJYA 1W06A 2PMWB 3E6BA 2E51A 2IFWA 3L2YA 2DDUA 1YQCA 4LBQA 3VBOC 3MW3A 1KS5A 2C9KA 2DFCA 3POFA 3PJQA 4LIUA 4BM8A 1W6MB 4CXWA 5LW9A 3POEA 1W8FA 2E31A 4FPHA 4B3NA 4P9LA 2AACA 3T1MA 4XFCA 2FCUA 4CDQC 4AHZA 2CY6A 5KC6A 5KXEA 5KHGA 4OHZA 1LNSA 1NCQB 1PO12 2CL2A 2ZAHA 2ARXA 3DV8A 1UX6A 2LRPA 1Q43A 2J7MA 4Q4V3 5C3SA 4AAPA 3PUQA 4QPGB 2JE9A 4X6RB 3USUB 4ASLA 2HLEA 1FPN2 1E5SA 1G9FA 1AZDA 1V9U1 3H7YA 3IBMA 4NPRA 5CZKA 5DQ0A 4BQ3A 1FMD1 2NMNA 4XUTA 2BVVA 2ZGSA 1HRV1 2WFF2 5I0RA 1Z78A 3M1HA 4LXLA 1RUI2 4H55A 2PAEA 4GH4A 5FBJA 2AC1A 1JOBA 1H9WA 1PIV1 3I2IA 2PHWA 2ZPXA 4NE9A 3VKFC 3KCCA 3MPPG 3ZSLA 1KS4A 3I7DA 4AFDA 5FUNA 4BLJA 4IV1C 2P4EA 3C8XA 1S0EA 4K8RB 1M06G 2YC4A 1OF4A 3M8LA 1HN1A 4LJHA 5IJRA 1ZRCA 1PK6B 2Y0OA 3W21A 4YGEA 4AGRA 5EWSA 4RGGA 5I93A 5J7MA 2JDHA 4YFWA 1N47A 4M3CF 4D94A 4IW3A 1R1ZA 1VBB1 1RUH3 2AYHA 5FYHA 5EV7A 4EN9B 1QXPA 4LBKA 4AQSA 1LOGA 3VV1A 2OX0A 1PHMA 3PUHA 4JRLA 2PHRA 3K51A 4N9HA 4DXRA 1AX0A 1X9TA 2Q1FA 4Q4W2 4S2DA 3B9IA 1LB2A 4CDUC 4JKKA 2D5FA 2ZEYA 4AGGA 3BODA 2XKOA 3MEPA 3NVCA 5A3OA 3T09A 3H8RA 1PZ8A 3EQEA 2DCKA 5CFCA 5HCHA 4UW5A 3JZVA 1RUJ3 4LLOA 4BWOA 1RIRA 1XU2A 2EICA 4HBNA 1BJQA 2OUJA 2XWJB 3R05A 2VY0A 2DBIA 5IW0A 4MZUA 4AEKA 4IE4A 3S5AA 1WA6X 4LHSA 5FP4A 1H8VA 1GZ9A 3VD9A 4CYDA 3VD7A 5IT6A 1SFNA 3UL2A 3M3EA 4KQ7A 4P9WA 2FCTA 5KC5A 3FC0A 1RHI3 2Y8KA 3WOGA 2QQLA 4XOGA 5IYYA 4LE4A 3S57A 3BGAA 2QQWA 3HEIA 1GNZA 1V9U2 1BQPA 2W47A 2B4KA 2VZQA 4N90A 4AEDA 1FMD2 5K9YA 2PYTA 1HRV2 2D6MA 1GP4A 4D3WA 4DB5A 5LZ6A 4QGNA 3THPA 1PIV2 2H6BA 5TSWA 3VBRB 4QKDA 2AENA 1LECA 4PCRA 2ADEA 2QFEA 1OF3A 1S0IA 2JX9A 2ILMA 3O5SA 1ZX5A 3K4DA 2XJQA 1GQGA 4MGKE 4BYYA 2Z2SB 3ZYRA 1HW5A 3PIGA 4Y4YA 1U5IA 1HV0A 1I6XA 1ZZ7A 3BTYA 3FWEA 4QPIC 1LHVA 1O3TA 2GAUA 1VBB2 4CEYB 4YG3A 3ZN6A 2X10A 2VECA 1ONAA 5ACA3 4D69A 1RUOA 1JHNA 1OKQA 1QIQA 1SFPA 5F2WA 2QQIA 2JJ6A 4WZCA 5C3RA 1JTZX 2WA4A 4P9XA 3BI3A 2JDYA 1ODMA 5JLVA 5HXVA 3ZN5A 1TMF3 4V2WA 1S55A 4FBFA 3MDPA 4M4PA 4WM7C 1DG6A 2UWCA 3SH5A 3S30A 5J96B 1W9SA 3I2JA 1PM4A 2VXRA 1XNTA 4PLOA 2GH2A 2WSUA 4QPYA 1Q8OA 1O4ZA 1F9KA 3FHQA 5DUVA 5DZGA 2WYSA 1RUG3 4OVEA 3RWKX 3VBUC 1UOBA 4XF3A 1LOFC 1VAMA 3IM0A 4IEOA 4MG2A 4PJYA 1FOD1 4OUMA 1PMIA 2ZGNA 1F2NA 5DMYA 4FOQA 2OKXA 5IAXA 1DQ1A 4YVWC 3ILNA 4EWEA 3LFIA 3M2MA 1XNBA 1ASJ1 1GWKA 3AVRA 3CQOA 2Q1MA 3WF1A 3ZIXA 1JZ6A 5E88A 2UURA 5BPXA 4YFZA 1C28A 1QQP1 1XE8A 2RS11 2GC3A 4MYEA 1WWYA 3IZOA 1U5XA 1WW6A 1YO8A 3A4UA 3PUAA 3PTRB 2WS93 1MS5A 4FFGA 5CEHA 1MEC2 2VW2A 3ECQA 1BYHA 3Q8EA 5D2AA 1NX9A 1BXHA 1T6GC 2IXKA 4M0HA 4NHYA 3W58A 3ZFFA 3ZO0B 4AE2A 1Z0HA 2A73B 2DTWA 3HIFA 4UAPA 3QD6A 3RZJA 1F15A 2PHLA 5CVRA 2EXHA 4RQPB 4CE8A 3PNAA 1UMIA 1US2A 4XF0A 2GSYA 1AX1A 2D6LX 3BYWA 4YYOA 3ITQA 1R1A1 4RFRB 5JR7B 3LEGA 3MBWA 5A6QA 4ONUA 2VW0A 1CAVA 3W20A 4L97A 2DWRA 4LLFA 2J1EA 3VKOA 1WMEA 2XONA 4QGLA 4GJYA 2DU1A 2OQ7A 3PTYA 4QHZA 3VKNA 3GBWA 5G04L 5J48A 1V00A 3ABZA 3TAYA 1MZEA 5KXBA 3RZMA 2GP3A 3U37A 4MADA 1YFXA 1HQNA 4XAEA 4YRDA 1N3QA 3TNPB 3WD5A 3U11A 3ZM8A 1AL21 4OMDA 4H3WA 4DXTA 3SEPA 4I3PA 1JZ8A 4I02A 1NZCA 4QQOA 1FX5A 4N43C 4XC9A 1ZZ8A 3FN9A 3JQXA 2I74A 4QPWA 4E27A 4M00A 2DVAA 4DO0A 4K21A 1WD4A 3C3VA 1H30A 3ZIWA 1DP0A 2JG9B 5EJ1B 5CFCB 1XRUA 3IWZA 2QDRA 3THCA 1MZFA 3VZKA 4META 2YMZA 4RD7A 3KSCA 4JV4A 3WG4A 5CADA 1FOD2 1BVP1 1JS9A 1YQ8A 1BEV3 2VW1A 3U75A 1R083 1VALA 3NV2A 4HONA 5FPAA 5L9VA 4Q29A 2EF6A 2WIIB 4LK6A 5DABA 4LHKA 3OBZA 1QQP2 2YDEA 2RS12 1J1LA 3UGHA 1US3A 2JDKA 1LAJA 4DEQA 2B5HA 3FLPA 2R30A 4A7ZA 4XZUG 1UKGA 4D8MA 1Q8PA 2VNVA 4Q4V1 1ULCA 1FAYA 2FBEA 2XJTA 1E57A 3QH7A 4JGZB 4QB1A 1XNKA 3WW3A 3AP4A 2WAAA 3GBGA 3CO2A 4CUCA 5BNNC 3MPBA 2E9QA 1RITA 2K0GA 3N9MA 1O7FA 3TNQA 2XPJA 1R1A2 1U0AA 2PLV1 4UFLA 3M3QA 3MZHA 2V4AA 4AVVA 5FJKA 4N8MA 2FHRA 4QQLA 2A1XA 3DXUA 4AEJA 2Z69A 5JPMB 4IE0A 2WN2A 4YM2A 3KF3A 4GQ7A 4INDA 4UW6A 4OHVA 4QB2A 5A70A 3D0JA 1EY2A 5D8AA 2GNTA 4QU1A 2RMU2 4PIYA 3LAGA 1OI6A 2WUHA 2VVFA 2ZGKA 4QX1A 3GNEA 4E2SA 5BNQA 3RZGA 3KWVA 3P3PA 4JZRA 2D5HA 2GDFA 1AL22 5FZMA 4G4FA 1RC6A 2DVDA 4PLNA 4ZONA 4ARXA 4L0PA 4UFKA 4J25A 4OZOA 3AJZA 4E4ZA 5GZEA 2WWUA 4K8FA 5FZ1A 4CP9A 2XJVA 1JZ3A 2VTXA 3OYWB 4E2QA 1LOCA 2LUWA 4BQXA 3FHIB 2YZ4A 4Y24A 4BPZA 3TEXA 5FZGA 2OUHA 4HVQA 2AZ5A 1IS5A 4WVVA 3VB9A 1OUSA 5FPVA 3SLIA 3RZKA 4MGTA 5DUXA 4UBGA 4ZZ5A 2JB4A 2YV8A 3HD8B 4MXWB 5L7OC 2LW8A 4O61A 2WNVC 4WVMA 4XIKA 5F32A 3VHPA 2XHNA 2CAVA 1GBGA 3MIEA 4RR3A 2Q8CA 1POV0 3NAPA 5ANQA 4UI9L 4L92A 2EXJA 3WQ7A 2VVDA 1EUUA 3UGFA 5FXVA 4IEZA 1NLQA 2XOMA 3H3UA 2W1SA 4DS0A 2VCCA 2VNRA 2QQKA 4KI5M 2WFF3 1Q3EA 4BQ5A 4Q4V2 1FI2A 2WNOA 1DGRN 2BVBA 1FT9A 4QKFA 1OOPB 3AMPA 2B9VA 2PTMA 1HLCA 1XBFA 2R0FA 2UWBA 3IMNA 1OLME 4IE5A 2PLV2 1GICA 3AP7A 4WBBA 1JOJA 3IIAA 4LQRA 5GJ6A 4Y20B 4ZXEA 3I54A 2J1SA 5J37A 4AL9A 4NHXA 5C5UA 3N9PA 4XURA 3I2OA 4JX0A 1WD3A 4W50A 3KT4A 1CESA 2O1QA 1Q8VA 3LZZA 4FPEA 4COZA 3MW2A 1W39A 1W8OA 4TLGA 4GJZA 3LDRA 4XW3A 4YVSA 1OT5A 2VUDA 2P2KA 3ENRA 1XU1A 2DV9A 3PMSA 4CCOA 5LEKA 3EHKA 2BBVA 4MH0E 3A23A 4HZFA 4Y5Z0 2GMEA 3VZMA 2ZBJA 1RUF3 2KA3A 5I0TA 2BU9A 4RS5B 2I2SA 1UCXA 5ACA1 5ABJB 2KXLA 2PHDA 3PVNA 3F95A 4P9YA 1YJLA 4ZZ8A 4LKDA 3ZPOA 3OD4A 5CFDC 4COUA 3T2OA 2ZHMA 4XFIA 1S2KA 1DBNA 2C6SA 4QPGC 2Y0IA 1VMJA 2BYVE 4M3CE 4Y5TA 3MIBA 1W2NA 4J1XA 3PJYA 4CDWA 3RJRA 2VBPA 2JB8A 2FQPA 3OBRA 1JZ7A 4KWLA 4R9CA 1UW8A 3OUHA 4XDPA 1RUG1 3RVHA 1GSLA 2YXSA 5A6ZA 3OBAA 3WINE 1S1AA 2VOKA 1IKQA 2Z79A 1DZRA 1GMMA 2VZVA 1J3PA 5FYYA 3ZSJA 4QU2A 5H9SA 3GDBA 1V9U3 1WLDA 5K0UA 2WYFA 1PGL1 1PK6C 3ZYFA 1VBC2 4DZGA 5KXDA 1FMD3 3AMQA 1HRV3 1VLNA 3ILRA 1CAUA 2YY1A 3B01A 3FX3A 3KB5A 3RYRA 4CUBA 4JKLA 1BMV1 5E16A 4IEQA 5FY5A 1PIV3 1GLHA 1WBFA 3VBFA 1S0BA 5LATA 3ZX7A 1XSRA 4YZ4A 5JPNB 2XWBB 1YXWA 3NKTA 3GALA 5FYBA 5FAXA 2P1BA 3WG1A 5A1AA 3MGUA 4GZ9A 5CG8A 4B8EA 4D7TA 2UY8A 4EN7B 3JB8A 4D7YA 2HWB2 3AMHA 4QQ2A 3HN3A 4CCJA 4QT6A 1VBB3 3PURA 1H1IA 1NA1A 5A7WB 3CDZB 2R16A 4YW2A 1QDOA 1MACA 5A1FA 1JZ2A 4EYUA 4QX5A 3WP3A 2VO5A 2XQRA 2IZWA 3CJIC 2HEWF 2XVLA 3LPFA 4LBMA 3WXPA 1S0CA 4DUVA 5ACA2 2FDFA 3WW2A 1N3PA 1XE0A 2ET1A 2HBUA 2CGNA 4NRQA 5A7SA 4CXYA 2A7AA 2C0ZA 2D6OX 3OF1A 4FPYA 1NKGA 3T3YA 4FFIA 5T5JA 1DQ5A 1WMFA 5T5LA 4RHV1 5C8CB 2B46X 2AGSA 4OHWA 3MIHA 2W52A 3N7MA 3KVBA 4GD4A 3WNNA 3MW4A 3P6BA 3GJAA 4XYXA 1QJU3 3B7MA 3V56A 3MF9A 2WRAA 2VZTA 2DUOA 4Q8LA 3WNOA 1G9AA 4QX3A 4NUBA 2FDIA 4BK5A 3MICA 2CNAA 2FZ1A 3GYDA 1K45A 5JOYA 2IXCA 1AJOA 1H8TA 2UYAA 1DF0A 4P9IA 1BEV1 3NWKA 3VBSA 4DIQA 3NAPB 1RGSA 2CTVA 1R081 3GHMA 1K5MA 3AFGA 3N36A 1PGL2 3KCXA 4CEWA 1MEC3 2XLGA 2ZX2A 1D2SA 5FZIA 3NV3A 3OGRA 4IEXA 2WZR3 1BMV2 1AXZA 1JU4A 3NV4A 1D4VB 4CEYC 3I2DA 2J22A 1NAEA 4FPGA 4MXVA 1JYCA 2JD9A 3VDDB 3QLQA 2D6PA 3LSEA 2HH9A 4AAXA 1APNA 1QJFA 2RR12 3LOIA 3O1OA 3BTAA 4AW7A 3VBHC 4D6QA 2GC2A 1WUVA 1X8MA 3LKJA 1S0JA 1HJGA 4CCLA 1E5HA 4AF9A 3VDBA 4OCTA 2X29A 4XVHA 1WCDJ 4QKBA 3FFZA 4BQ4A 1HQWA 2BRTA 3HAGA 1S0DA 2VJXA 4IV3B 4OHXA 1Y4WA 2I45A 1UF2C 1O3RA 2X5IC 2IXJA 2WJSA 4DRVA 1ZVFA 1VP6A 3ETQA 3FBYA 4QX8A 3RZLA 4SBVA 1QNYA 3VN4A 3FJSA 5F5QA 1W6NB 1GKBA 2BUKA 1ULDA 3I49A 5K8SA 1V6KA 1N1SA 5H9QA 4DUXA 1D7PM 3SC7X 4BMBA 4RHV2 2ARBA 4LBLA 1C3HA 1ENRA 4IESA 4XXPA 1TE1B 2QQPA 4Q0SA 2W2IA 3HT2A 5EXOA 3WDTA 5F39A 1FOD3 2VXJA 3O1PA 3O1SA 2VMCA 3CU7A 3GZEA 1AL0G 4CU6A 4ORFA 2V5DA 1C8M1 4I09A 5FMDA 1RL3A 3U4SA 4CDWB 4DRRA 4RQPC 1ZZ6A 3K4AA 3EJKA 3RMYA 1ZYBA 1UQXA 2JG8A 5C9AB 5I0DA 3ES1A 2VUAA 4A45A 1BEV2 4K6BA 4LK7A 5IVBA 1QQP3 4W8JA 2R0HA 5JOXA 1R082 2RS13 2O0OA 5FZOA 2ZX4A 1HDKA 1MQTB 2PA7A 1OQDA 2PAMA 1VBE1 3AP5A 1QDCA 5FFOC 2RVAA 1D2QA 4LHLA 3UJOA 1WLWA 4QQHA 2JKBA 1UZZA 3IDEA 5FZAA 2DYCA 4LA2A 1JBCA 4R9DA 2O8OA 4MGZE 1AXKA 2VUJA 5SV8A 3K3OA 3KMHA 1GQHA 3N4MA 5FZLA 3VBFB 1DLLA 3ZMOA 3ZXLA 1XYOA 2ZEZA 1DDLA 2ZGRA 5JOZA 5CAZA 1T2XA 1CD3G 4AOCA 3ZPYA 1XNCA 5FWEA 4AXOA 1H2LA 1ZZ9A 2Q5TA 2WAOA 3GCXA 1CIWA 1XYPA 4OUSA 2MPFA 4QMAA 5I8SA 1DQ6A 2HKXA 2WSVA 4FPFA 4AWDA 3I2GA 3BUCA 3KHCA 4XCAA 1QOSA 3ILFA 5IVVA 2RMU3 3FFQA 4KH9A 2SBAA 5FR3A 2JG9C 1RXFA 5FZKA 3LD8A 1KFUL 2P34A 3P3NA 3VKMA 2Y60A 1RB8G 3ZXDA 1J59A 5C3QA 1LHWA 4FO9A 4YW4A 1HX6A 4BE3A 5FPXA 3DPRB 2TNFA 3VZJA 3ZYPA 1WMXA 4O7XA 4MGIE 2VMHA 3O1RA 1RUF1 1O3QA 1R64A 1AYM1 2DUPA 4A3ZA 1SHWB 1YYNA 2NM1A 1NCRA 2W9XA 2PN5A 4KWKA 4W4ZA 2WNUA 2W1QA 2O14A 4CCKA 3VL8A 2Q8OA 5LA2A 5FP9A 4JGZC 1OVSA 4MGYE 1REFA 1C8M2 2ZEWA 2VOWA 3NJXA 2B39A 3VD4A 2RS52 1VR3A 4NWWA 1VB2A 4XQ4A 3J8F1 4SLIA 3ZSMA 5FPZA 5FO7B 1LOEA 1MR5A 1GFF2 5B2GB 2W46A 1KFXL 1FXZA 3NW4A 1IG3A 1JYTA 1PX3A 1VBE2 2KD7A 3FL7A 3RQ0A 2WDBA 3OPWA 1ULPA 2P3IA 1YCIA 4YW5A 1NY71 3RPQA 1UOFA 4DOUA 5FDBA 4C1WA 3O1TA 2K2SA 1LEDA 1V6MA 4UFMA 1R092 4BOWA 5GZCA 2H6CA 2RS32 2HYKA 3BN6A 1YQ2A 4CDXB 4Y22B 2X5IA 4YGBA 2HEVF 3RI8A 2PLV3 1HKDA 1VMFA 2QQMA 3VZNA 5EP9A 5JIAA 1W8UA 1YIPA 1KJLA 5FY9A 5JI7A 3ZR5A 2E26A 1J84A 2Y33A 2WN3A 2ZGPA 3ZLIA 2A6ZA 2P6HA 2QTWB 2TBVA 4CUAA 3I4IA 4M01A 1G9DA 4XUPA 2YFUA 3QOPA 5H9RA 2Q8DA 4N7IA 1AJKA 1I3HA 1W2OA 1PO21 4GWMA 5A3NA 5A7NA 5LK5A 3PUSA 3RI9A 4IEVA 2Q1ZB 5I0SA 4XJWA 1FNZA 4HT1T 2ADDA 4PBPA 3AL5A 3AVSA 4AFMA 1EAH2 3B3QE 4CSWA 4LT5A 1O8SA 5BNPB 1FNYA 3MUZ1 1KQRA 2GNMA 3ON7A 3T1LA 3PU3A 5LBCA 3AC0A 4Q1PA 5BXXA 5IAVA 3OBTA 3RZHA 1RUF2 1AYM2 1UY3A 2IVJA 1EUTA 3GF6A 4AVSA 4O9GA 5LK7B 1B09A 2HWF1 5CKQA 3IN9A 2RG4A 1E5IA 3AKPA 3C7GA 2PFWA 4L9BA 5IVFA 2LROA 3R4UA 1IKPA 3AYDA 4Y1VA 4EQVA 3O1UA 4A41A 3IPVA 1QWRA 5GKAC 1PVXA 1OOPC 1WCKA 2VE1A 5B4NA 3NNFA 3ZFEA 3H9AA 4UFIA 1KRIA 1QJU1 1SACA 3AKQA 1F5FA 1LCLA 3J8F2 4LO8A 4N53A 4KG0A 1HB2A 3IAPA 2D97A 3GHNA 4YW3A 4CCEA 3QCWA 3H1WA 2UU8A 3O12A 3K2OA 1VBC3 3DF0A 2YU2A 3VDAA 5IVCA 1BCXA 1SEFA 3ELNA 3KT7A 4MHUA 3SITA 1YEWA 4XFBA 3WDWA 3FUQA 1CJPA 1NY72 4GULA 4YG6A 5FYSA 3ZFGC 1SLTA 2PHTA 1Z7S3 4XBNA 4COVA 1MEC1 4FCAA 2PQSA 1QJEA 1AR63 3CZJA 1V0AA 1TVGA 2IC1A 4XBQA 2VBDA 1W2TA 1WW7A 4P00B 1L7QA 2WZR1 1QXRA 2JXAA 4AQ6A 1VBA2 3IDAA 2OPWA 2BGPA 4KBZA 1GZWA 1HJFA 3B9CA 3DECA 5JDBA 4PI2A 4XTMA 3J7LA 1K42A 1BKZA 5ABJC 4JC1A 4FVVA 4GMP0 4RS5C 4DXZA 4HKWA 2OQ6A 3KV5A 2VOTA 2WQZC 4FOYA 2FMYA 1MVQA 2HWB3 3LQCA 3VLBB 1BLZA 1W9TA 1RJ7A 1OUXA 2EVXA 2Y64A 1GUIA 3CEWA 4YM0A 4FTBA 4M3CB 4OYUA 5A3PA 5FMCA 2YYOA 4S2GA 5GZFA 2WWJA 3WQ1A 1PO22 3V0BB 1RUC3 1O3SA 1DIWA 1N1VA 3VBOA 3H3LA 3NMBA 5FYVA 2WFPA 4YLZA 1SDDB 2XJSA 2J1RA 4XZPA 3D5OA 3U14A 5C4WC 1NUKA 2YU1A 1YLLA 3T4HB 1I9RA 2CDOA 2ZX3A 4CDQA 1YC61 2OW4A 4LKFA 1V70A 2ZS6B 1JZ5A 1HB1A 4LHNA 3H7JA 4R4ZA 3SKJE 1OXCA 2HWF2 5C3OA 1ND2B 2GU9A 1GP5A 5FBZA 3LA7A 2DF7A 3OPTA 1L7RA 2YG0A 4JVAA 2J1VA 3RNSA 2WNUB 2GC1A 4CP1A 5CU1A 4WM8B 4CPBA 3LA3A 3O14A 2ZHNA 1Q5OA 4N7UA 5FXXA 3MYXA 5GZDA 5LRSA 1OQEA 4K9SA 4EJRA 2ZGTA 4LBQB 1QJU2 1QF3A 4FQZA 3WP4A 4ATEA 3LFMA 3BIEA 3DXTA 4DY5A 3H50A 2HEYF 4IV1A 3DCQA 1W3VA 2VCAA 3TYJA 1A78A 4UF0A 4YARA 2QVSB 1H4GA 1OD5A 2XHKA 3AMNA 5FZ0A 2JKXA 4LMFA 1JYWA 1IHMA 3WG3A 3AYEA 2VD7A 2BNOA 4IE6A 1BBT1 3LOBA 4LBNA 4WV8A 5AC91 3LIHA 2WZR2 5J98B 2EIEA 4GAZA 4GKYA 2RR13 3OUIA 5C8WA 4PDWC 2VZSA 4GH4B 1WLTA 1D0GA 4Z2AA 1CPNA 1JUIA 4LO6B 4FFHA 4ATFA 2A3YA 4CDUA 3KCYA 1OBNA 2V4VA 5LA0A 5FQ0A 3S7EA 4ZPIA 2DURA 2E7QA 4AI0A 4CP2A 4CZSA 4RN5A 4Q26A 1VB4A 4XJUA 5CYYA 1PGW2 5C8CC 1B35C 1EYBA 3N7LA 2VMDA 3H8UA 1CR7A 3RJ2X 4AFBA 3AZYA 4OUEA 4BXSV 2RMU1 3AM2A 5FWJA 3OCPA 4FXGB 4XDOA 4OMCA 1MS3A 4C0BA 5F37A 4PBOA 4ZU5A 1ULFA 5FXWA 5FUIA 2QCSB 2E7TA 4KGGA 1JYIA 3S5QA 4A7KA 5JVVA 3CL1A 2BTVC 1SCSA 4LPLA 3ACLA 5DUWA 4HLTA 5HCAA 3TWIA 1LTEA 4RHV3 2LS6A 1RXGA 1OQ1A 2EALA 2P3KA 1UIJA 2E53A 5DG2A 2VZPA 3OPZA 1UYZA 4NR1A 1D0HA 4OLLA 5DAXA 4QHBA 5FK7A 5T52A 3TB0A 2JWPA 1SCRA 4A4AA 4B7KA 4F3JA 5DAQA 1LU2A 2D7FA 1CN1A 4S2HA 5A3TA 1CAWA 1OVPA 4AQ2A 4B1MA 4YSFA 3VDDC 4GXLA 5FZCA 2DTYA 4UW4A 5JIUA 3HNBM 5LBBA 1K5JA 1UZYA 3NRUA 3WG2A 2ZKNA 4YM1A 5IVYA 4AQTA 4NJ4A 5JMCA 1DLCA 5HI0A 2WA3A 3BOPA 4Y33A 4QPIA 2ZA9A 3X29B 2ARAA 4HSJA 1CJDA 3NKGA 5FZHA 1BBT2 3BVCA 5JZGC 4IEWA 4CA9A 5JSRA 2BWCA 3J9SA 1TME1 5AC92 4AEDB 3CF6E 1MS0A 4IQPA 2ORZA 2R042 3OEAA 1XYNA 4H14A 4IV3C 5C4WA 3V64A 3WF2A 5KHJA 2RDRA 4AK3A 3VUOA 2B8MA 4ASKA 1GOHA 2QNKA 5T3NA 3KM5A 4IERA 2WZ8A 1DFQA 3HJRA 4QDQA 5EJ3A 3U1XA 1A34A 3QACA 4XXAA 3WV6A 4MUVA 1EV11 3T4VA 1OPOA 1RUE3 1W3XA 1ND3C 3CHXA 4WM7A 5DAVA 5F1RA 1VBD1 1YRZA 5D1IA 1DQ2A 2RJLA 1EP0A 2W0XA 2IWGB 3VBUA 2FDKA 4EN0A 2WWSA 4UT5A 4F7ZA 3D3AA 1LOFA 1RVF1 2YFZA 4NHKA 3LIGA 3B5LB 5CB7A 3POYA 4QXHA 1RYYA 2VL4A 2YPJA 3ZN6B 1UMZA 4IXLA 5T54A 3OSDA 1UY2A 3ZXJA 1DGWX 2VAUA 5FKCA 1W6PA 4YVWA 5A3MA 5C9AC 2BWAA 2ES3A 3POIA 4U2AA 1RTVA 2VVEA 4GA9A 1IPJA 3WDVA 4CCNA 4XJ9A 5LA9A 2VTFA 5JWPA 1PGSA 1NLRA 1UWWA 2QZ3A 4OI0A 3MIGA 2F6BA 1MQTC 4YG0A 5F5CA 3NNLA 3B69A 3PVEA 5LA1A 3ZOIA 3IT8A 1C8M3 2K46A 3GXUA 4XPVA 2RS53 5C6CA 1UY0A 1SZBA 3PDQA 1PMHX 3E5UA 4RL7A 3S7IA 1L7LA 1URXA 1YIFA 2ZCWA 2NN8A 2Y6KA 3BALA 4JCKA 4ZKTB 3RSJA 4BISA 1GNYA 1H2MA 2F17A 1G9CA 3K46A 1ZRDA 1HB4A 2OXBA 2VU9A 4JGYC 5J3UA 4ZS3A 3H1YA 1LJ7A 1S0GA 4HANA 3RWNA 4AGVA 1GZTA 1VBE3 3ZSKA 2EIBA 1CQ9A 1DU3D 5F7UA 1XQNA 1MS1A 1OFNA 1R093 2YBKA 5DXDA 5BNOC 5G05L 1V6OA 2FZ2A 1VBC1 1RUNA 1HN0A 2A3WA 2RS33 5AVPA 2VMFA 1TME2 4HPKA 5KHKA 2R49A 1Z7S1 4L11A 1W04A 4BQYA 1XE7A 2RM21 3ZFFB 2RDNA 4XILA 1UZVA 2VOVA 2ZKLA 3H42B 1S2EA 1AR61 4NWVA 4XQWA 5CIRA 4ZS2A 5FV3A 2ZX1A 3HBZA 4N43A 1W0NA 2D93A 1S2BA 1VRBA 2Z4FA 2XJRA 1ENXA 4I2OA 5IK4A 3DPRC 1EV12 4GIQA 1QJX1 4CDUB 5A80A 2A71A 3WNMA 1CAVB 1VBD2 3GGLA 4BK4A 4TXWA 5FQ0B 2HWB1 2WZEA 1N1TA 1OPMA 2OS2A 4Q0PA 1H0BA 1MS8A 2E7AA 1RVF2 2PXJA 3ACIA 3M3CA 1EAH3 5FZ6A 5I0UA 4A44A 1GQPA 1AR82 1RUC1 4ZU7A 1OLQA 2WC2A 2A5ZA 3OOXA 3ORJA 1LHUA 3ZKUA 1A6CA 3Q8FA 1W05A 3WNKA 5J09A 1DYKA 2BOJA 2VCBA 2IXIA 4JDOA 3AFKA 1AYM3 3G7DA 4AZZA 3ZYBA 4URTA 1WA4A 3TEWA 1NCQC 4P5HA 3EBRA 5FZ8A 1GOFA 1CONA 1ST8A 3H0OA 3KV6A 3OUJA 3RFRA 1AX2A 1O4YA 3E6DA 4FFFA 5DPNA 4AHXA 2FCVA 3I3QA 3VZOA 2ZMLA 1VE0A 3I59A 4Q0UA 3J8F3 5E1RA 4CDXC 5BNNA 5HV4A 3HQUA 4HKLA 2VNOA 1SG3A 2XG3A 4MGQA 3HBKA 4I0WB 4P14A 3TRSB 2ZZJA 2JDZA 2RHPA 4LBJA 1ZA7A 4ZU4A 1C1LA 3FUOA 4Q0VA 1UO9A 3FZ3A 2HWD1 3B94A 3U4XA 2VCMA 2UWAA 3ST7A 2OPKA 1LHNA 1EPZA 4GWIA 5FLJA 3B02A 4DINB 4TWTA 2GALA 3KV4A 4CUGA 4QX0A 2XVKA 1ULOA 4IETA 4XMAA 2E6VA 3IMMA 2BV4A 5BY5A 3TOJA 1J83A 2R32A 4FTEA 4XIOA 3O1VA 1VBA3 1OHFA 1Z7S2 3VZLA 2RM22 4A7YA 1WW5A 4CU9A 4TSVA 2VM9A 3J7MA 1AR62 1UZWA 3BIWE 4HFSA 4EROA 2D43A 2GZWA 5F3EA 2FDJA 1IGOA 2P37A 5FZBA 5BNPC 1UAIA 3L2HA 3WLUA 2RR11 1QJX2 5I91A 3ATGA 3BU7A 3PUIA 1LODA 5CKNA 4RA0A 3NNGA 3DL3A 3Q9OA 4AI3A 1PO23 4WM7B 4OHYA 3A22A 3ZDSA 3ACGA 2AREA 4PIZA 4WZFA 3LCPA 1ZBE1 4FTSA 2D98A 2PHUA 4P9GA 4CRQA 3VBUB 2WINB 1OH4A 5D8AB 5L7OA 1RUC2 4LR4A 1PMJX 5EYYA 2WNVA 4HETA 3ZVXA 4XFFA 2CSGA 3ZXAC
chains in the Genus database with same CATH topology
2VZOA 4LKSA 4ET7A 2J1UA 2YC2A 2X10A 3C7HA 4E8DA 3HNMA 3C7FA 2WBKA 2QQIA 1R64A 4FI9A 3W5NA 4A3ZA 1IQDC 1SHWB 3K75B 4DEVA 2W9XA 4W4ZA 3ACHA 2W1QA 2W94A 4CU7A 4M4PA 1W9SA 3I2JA 5LA2A 1XNTA 2ZEWA 3NJXA 3VD4A 1UY4A 2C26A 3FHQA 2WYSA 5LCWL 3I97A 5IFTA 2W46A 2HYXA 5DMYA 2OKXA 1UX7A 1O8PA 1PX3A 2KD7A 3FL7A 2WDBA 1ULPA 2X09A 3WF1A 3CQOA 1JZ6A 1JYVA 5HXMA 4QB6A 5JMOA 3LPGA 3W5MA 3BN6A 4ARYA 4CVUA 3F2ZA 1YQ2A 2QQMA 3ECQA 1NX9A 2VZUA 1DYOA 4UAPA 2E26A 1J84A 2WN3A 5B4XA 1UMIA 1US2A 3WQBA 4CUAA 4QX2A 4DXSA 3LEGA 3MBWA 4XUPA 1UXZA 2YFUA 1OD3A 5C70A 2J1EA 2XONA 4D0QA 3GM8A 2Y6HA 2QQOA 3NQHA 1CX1A 4IUGA 5G04L 5JR2A 2W87A 3ABZA 3WNLA 3HPNA 1O8SA 3U37A 4MADA 5IHRA 5J1XA 1K12A 3MUZ1 3ZM8A 2VZ3A 4OMDA 4QDSA 3SKVA 3AC0A 4DXTA 3EB7A 3SEPA 1UY3A 3MUY1 1EUTA 1JZ8A 3SEEA 3K4ZA 1KEXA 3FN9A 5C7GA 2Y6LA 3C7GA 4P08A 4QPWA 3T0AA 4A41A 2QBXA 5B4NA 1WCQA 1DP0A 3OB8A 5EJ1B 5EIYB 2JE8A 3THCA 1H6XA 3T0BA 1JYXA 3C7OA 3IAPA 1WKYA 2WO2A 4PT6A 2C4XA 3VD3A 3VDAA 2W1WA 1UY1A 2BBAA 1F4HA 2PQSA 3CZJA 1US3A 1TVGA 4DEQA 4GWJA 4P00B 1L7QA 4XZUG 4CU8A 3HNYM 4D8MA 2Y6JA 3IDAA 2BGPA 1PX4A 3DECA 3WF3A 4QB1A 1K42A 3C7EA 2WAAA 2L9LA 4CUCA 2VOTA 4MO3M 3K77A 4XUQA 1CZSA 3LQCA 1KGYA 1W9TA 1JU3A 2ORXA 2Y64A 3OEBA 1GOGA 1GUIA 3LEIA 3MO4A 4OYUA 4KWUA 3T0DA 1XC6A 4BDVB 1H6YA 4A6OA 3HOBA 2WN2A 4QB2A 1SDDB 4PQQA 3E1F1 3THDA 2J1RA 2WUHA 4QX1A 1NUKA 4BJ0A 2CDOA 2VZ1A 4MOAA 1JZ5A 4ARXA 2VMEA 3SKJE 4L0PA 5JUVA 4OZOA 3WEZA 1JZ3A 1L7RA 1XNAA 1CZTA 2YG0A 2J1VA 4E8CA 5DN2A 1F4AA 3T2QA 3I2KA 1P8JA 4ZZ5A 2W92A 2VQTA 2LW8A 3NJVA 2VCAA 1CIYA 2BERA 4TTGA 2XHNA 3LEKA 2W91A 3FHAA 1BHGA 5HPOA 3I2HA 2JKXA 4UI9L 1JYWA 2VR4A 3DYOA 1EUUA 2J1TA 2VZRA 2XOMA 1W8NA 2W1SA 2VCCA 2EIEA 2ID4A 2QQKA 4KI5M 1CZVA 2VZSA 4Z2AA 2B9VA 3I3DA 1UZ0A 2V4VA 5LA0A 2RV9A 4ZXEA 4DUWA 4LQRA 2RJ2A 4RN5A 2VQUA 2J1SA 5CYYA 1UMHA 2VMDA 2WQ8A 3IB3A 3CMGA 4XURA 1UXXX 1I5PA 4JX0A 4W50A 4BXSV 4OUEA 1GU3A 4OMCA 1W8OA 3UESA 3T08A 5FUIA 1OT5A 4PF1A 2BZDA 4LPLA 3A23A 3IAQA 2LS6A 2Y6GA 4P02B 3MV11 2VZPA 4KMQA 3WNPA 1UYZA 2BGOA 2E33A 2WABA 4YPJA 1W9WA 4ZZ8A 4A4AA 1JI6A 3T2OA 5C71A 3UNPA 4HG6B 3UETA 5JXJA 4XUOA 4A42A 5JXIA 3DYPA 3HNBM 1JZ7A 3NRUA 1DLCA 3OBAA 2CDPA 4XUNA 1JZ4A 1GMMA 2VZVA 3ETPA 3GDBA 2XQXA 2W3JA 2W95A 2WO3A 2ORZA 3OEAA 4CUBA 3WF2A 4JKLA 1GOHA 1JHJA 4RYDA 2WZ8A 3HJRA 4QDQA 4JKMA 3EYPA 1XPWA 3J7HA 1UYXA 5JXHA 2ZEXA 2ZXQA 3CKHA 2E32A 5A1AA 4GZ9A 2QQNA 3D3AA 2YFZA 3HN3A 4M4RA 4QAWA 1RYYA 2VL4A 3CDZB 1UY2A 3I2FA 3P1IA 3A21A 3VD5A 3WF0A 3LE0A 1JZ2A 3OGVA 2VC9A 2VO5A 2VTFA 3LPFA 1UWWA 4DUVA 3WF4A 1JYNA 5LA1A 2W5FA 1NKGA 4ZY9A 3GXUA 1UY0A 1PMHX 3WNNA 3I3EA 2Y6KA 3P6BA 2X05A 1GNYA 5IFPA 2V72A 2VZTA 3K46A 3WNOA 3WSOA 4QX3A 2W1UA 4BK5A 1K45A 2DDUA 4P5YA 3JXSA 3IIIA 2C9KA 3DYMA 2EIBA 3CZUA 5F7UA 5G05L 2YB7A 2E31A 2VMFA 4JHZA 3OGRA 1LNSA 1JU4A 2J7MA 2J22A 1NAEA 1W0NA 2HLEA 2Z4FA 5CZKA 5DQ0A 2JD9A 4XUTA 4AAXA 3WNMA 5EJZB 1K3IA 3GGLA 4BK4A 4TXWA 2QQJA 3I2IA 2WZEA 3ACIA 3VDBA 3C8XA 1GQPA 3A7QA 4A44A 2YC4A 4XVHA 1OF4A 1HN1A 5IJRA 1UYYA 3WNKA 1MPXA 1W99A 2VCBA 2VJXA 5JXGA 1GOFA 3I3BA 3PUHA 4DUXA 1D7PM 2JDAA 1O59A 3ACFA 5DPNA 4DXRA 1TG7A 4JKKA 2ZEYA 1SG3A 4MGQA 3T09A 2VMCA 4CU6A 2DCKA 2V5DA 2EIDA 3K4AA 4GWIA 5I0DA 3OGSA 2EICA 3OG2A 4UOJA 3MV01 4A45A 3T2PA 2WO1A 4QDRA 4QX0A 4W8JA 1ULOA 4LHSA 3VDCA 3VD9A 2J1AA 3VD7A 1J83A 2RVAA 2Y8KA 4CU9A 2VM9A 2QQLA 5IYYA 3BGAA 3HEIA 3CIHA 2W47A 2B4KA 2VZQA 4AG4A 3PUIA 2DCJA 2ZEZA 2R7EB 3NNGA 1T2XA 3A22A 3ACGA 2WAOA 1OF3A 3I2GA 3K4DA 1OH4A 1PMJX 4MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZO A;  4LKS A;  4ET7 A;  2J1U A;  2YC2 A;  2X10 A;  3C7H A;  4E8D A;  3HNM A;  3C7F A;  2WBK A;  2QQI A;  1R64 A;  4FI9 A;  3W5N A;  4A3Z A;  1IQD C;  1SHW B;  3K75 B;  4DEV A;  2W9X A;  4W4Z A;  3ACH A;  2W1Q A;  2W94 A;  4CU7 A;  4M4P A;  1W9S A;  3I2J A;  5LA2 A;  1XNT A;  2ZEW A;  3NJX A;  3VD4 A;  1UY4 A;  2C26 A;  3FHQ A;  2WYS A;  5LCW L;  3I97 A;  5IFT A;  2W46 A;  2HYX A;  5DMY A;  2OKX A;  1UX7 A;  1O8P A;  1PX3 A;  2KD7 A;  3FL7 A;  2WDB A;  1ULP A;  2X09 A;  3WF1 A;  3CQO A;  1JZ6 A;  1JYV A;  5HXM A;  4QB6 A;  5JMO A;  3LPG A;  3W5M A;  3BN6 A;  4ARY A;  4CVU A;  3F2Z A;  1YQ2 A;  2QQM A;  3ECQ A;  1NX9 A;  2VZU A;  1DYO A;  4UAP A;  2E26 A;  1J84 A;  2WN3 A;  5B4X A;  1UMI A;  1US2 A;  3WQB A;  4CUA A;  4QX2 A;  4DXS A;  3LEG A;  3MBW A;  4XUP A;  1UXZ A;  2YFU A;  1OD3 A;  5C70 A;  2J1E A;  2XON A;  4D0Q A;  3GM8 A;  2Y6H A;  2QQO A;  3NQH A;  1CX1 A;  4IUG A;  5G04 L;  5JR2 A;  2W87 A;  3ABZ A;  3WNL A;  3HPN A;  1O8S A;  3U37 A;  4MAD A;  5IHR A;  5J1X A;  1K12 A;  3MUZ 1;  3ZM8 A;  2VZ3 A;  4OMD A;  4QDS A;  3SKV A;  3AC0 A;  4DXT A;  3EB7 A;  3SEP A;  1UY3 A;  3MUY 1;  1EUT A;  1JZ8 A;  3SEE A;  3K4Z A;  1KEX A;  3FN9 A;  5C7G A;  2Y6L A;  3C7G A;  4P08 A;  4QPW A;  3T0A A;  4A41 A;  2QBX A;  5B4N A;  1WCQ A;  1DP0 A;  3OB8 A;  5EJ1 B;  5EIY B;  2JE8 A;  3THC A;  1H6X A;  3T0B A;  1JYX A;  3C7O A;  3IAP A;  1WKY A;  2WO2 A;  4PT6 A;  2C4X A;  3VD3 A;  3VDA A;  2W1W A;  1UY1 A;  2BBA A;  1F4H A;  2PQS A;  3CZJ A;  1US3 A;  1TVG A;  4DEQ A;  4GWJ A;  4P00 B;  1L7Q A;  4XZU G;  4CU8 A;  3HNY M;  4D8M A;  2Y6J A;  3IDA A;  2BGP A;  1PX4 A;  3DEC A;  3WF3 A;  4QB1 A;  1K42 A;  3C7E A;  2WAA A;  2L9L A;  4CUC A;  2VOT A;  4MO3 M;  3K77 A;  4XUQ A;  1CZS A;  3LQC A;  1KGY A;  1W9T A;  1JU3 A;  2ORX A;  2Y64 A;  3OEB A;  1GOG A;  1GUI A;  3LEI A;  3MO4 A;  4OYU A;  4KWU A;  3T0D A;  1XC6 A;  4BDV B;  1H6Y A;  4A6O A;  3HOB A;  2WN2 A;  4QB2 A;  1SDD B;  4PQQ A;  3E1F 1;  3THD A;  2J1R A;  2WUH A;  4QX1 A;  1NUK A;  4BJ0 A;  2CDO A;  2VZ1 A;  4MOA A;  1JZ5 A;  4ARX A;  2VME A;  3SKJ E;  4L0P A;  5JUV A;  4OZO A;  3WEZ A;  1JZ3 A;  1L7R A;  1XNA A;  1CZT A;  2YG0 A;  2J1V A;  4E8C A;  5DN2 A;  1F4A A;  3T2Q A;  3I2K A;  1P8J A;  4ZZ5 A;  2W92 A;  2VQT A;  2LW8 A;  3NJV A;  2VCA A;  1CIY A;  2BER A;  4TTG A;  2XHN A;  3LEK A;  2W91 A;  3FHA A;  1BHG A;  5HPO A;  3I2H A;  2JKX A;  4UI9 L;  1JYW A;  2VR4 A;  3DYO A;  1EUU A;  2J1T A;  2VZR A;  2XOM A;  1W8N A;  2W1S A;  2VCC A;  2EIE A;  2ID4 A;  2QQK A;  4KI5 M;  1CZV A;  2VZS A;  4Z2A A;  2B9V A;  3I3D A;  1UZ0 A;  2V4V A;  5LA0 A;  2RV9 A;  4ZXE A;  4DUW A;  4LQR A;  2RJ2 A;  4RN5 A;  2VQU A;  2J1S A;  5CYY A;  1UMH A;  2VMD A;  2WQ8 A;  3IB3 A;  3CMG A;  4XUR A;  1UXX X;  1I5P A;  4JX0 A;  4W50 A;  4BXS V;  4OUE A;  1GU3 A;  4OMC A;  1W8O A;  3UES A;  3T08 A;  5FUI A;  1OT5 A;  4PF1 A;  2BZD A;  4LPL A;  3A23 A;  3IAQ A;  2LS6 A;  2Y6G A;  4P02 B;  3MV1 1;  2VZP A;  4KMQ A;  3WNP A;  1UYZ A;  2BGO A;  2E33 A;  2WAB A;  4YPJ A;  1W9W A;  4ZZ8 A;  4A4A A;  1JI6 A;  3T2O A;  5C71 A;  3UNP A;  4HG6 B;  3UET A;  5JXJ A;  4XUO A;  4A42 A;  5JXI A;  3DYP A;  3HNB M;  1JZ7 A;  3NRU A;  1DLC A;  3OBA A;  2CDP A;  4XUN A;  1JZ4 A;  1GMM A;  2VZV A;  3ETP A;  3GDB A;  2XQX A;  2W3J A;  2W95 A;  2WO3 A;  2ORZ A;  3OEA A;  4CUB A;  3WF2 A;  4JKL A;  1GOH A;  1JHJ A;  4RYD A;  2WZ8 A;  3HJR A;  4QDQ A;  4JKM A;  3EYP A;  1XPW A;  3J7H A;  1UYX A;  5JXH A;  2ZEX A;  2ZXQ A;  3CKH A;  2E32 A;  5A1A A;  4GZ9 A;  2QQN A;  3D3A A;  2YFZ A;  3HN3 A;  4M4R A;  4QAW A;  1RYY A;  2VL4 A;  3CDZ B;  1UY2 A;  3I2F A;  3P1I A;  3A21 A;  3VD5 A;  3WF0 A;  3LE0 A;  1JZ2 A;  3OGV A;  2VC9 A;  2VO5 A;  2VTF A;  3LPF A;  1UWW A;  4DUV A;  3WF4 A;  1JYN A;  5LA1 A;  2W5F A;  1NKG A;  4ZY9 A;  3GXU A;  1UY0 A;  1PMH X;  3WNN A;  3I3E A;  2Y6K A;  3P6B A;  2X05 A;  1GNY A;  5IFP A;  2V72 A;  2VZT A;  3K46 A;  3WNO A;  3WSO A;  4QX3 A;  2W1U A;  4BK5 A;  1K45 A;  2DDU A;  4P5Y A;  3JXS A;  3III A;  2C9K A;  3DYM A;  2EIB A;  3CZU A;  5F7U A;  5G05 L;  2YB7 A;  2E31 A;  2VMF A;  4JHZ A;  3OGR A;  1LNS A;  1JU4 A;  2J7M A;  2J22 A;  1NAE A;  1W0N A;  2HLE A;  2Z4F A;  5CZK A;  5DQ0 A;  2JD9 A;  4XUT A;  4AAX A;  3WNM A;  5EJZ B;  1K3I A;  3GGL A;  4BK4 A;  4TXW A;  2QQJ A;  3I2I A;  2WZE A;  3ACI A;  3VDB A;  3C8X A;  1GQP A;  3A7Q A;  4A44 A;  2YC4 A;  4XVH A;  1OF4 A;  1HN1 A;  5IJR A;  1UYY A;  3WNK A;  1MPX A;  1W99 A;  2VCB A;  2VJX A;  5JXG A;  1GOF A;  3I3B A;  3PUH A;  4DUX A;  1D7P M;  2JDA A;  1O59 A;  3ACF A;  5DPN A;  4DXR A;  1TG7 A;  4JKK A;  2ZEY A;  1SG3 A;  4MGQ A;  3T09 A;  2VMC A;  4CU6 A;  2DCK A;  2V5D A;  2EID A;  3K4A A;  4GWI A;  5I0D A;  3OGS A;  2EIC A;  3OG2 A;  4UOJ A;  3MV0 1;  4A45 A;  3T2P A;  2WO1 A;  4QDR A;  4QX0 A;  4W8J A;  1ULO A;  4LHS A;  3VDC A;  3VD9 A;  2J1A A;  3VD7 A;  1J83 A;  2RVA A;  2Y8K A;  4CU9 A;  2VM9 A;  2QQL A;  5IYY A;  3BGA A;  3HEI A;  3CIH A;  2W47 A;  2B4K A;  2VZQ A;  4AG4 A;  3PUI A;  2DCJ A;  2ZEZ A;  2R7E B;  3NNG A;  1T2X A;  3A22 A;  3ACG A;  2WAO A;  1OF3 A;  3I2G A;  3K4D A;  1OH4 A;  1PMJ X;  4MGS A; 
#chains in the Genus database with same CATH topology
 2YGM A;  2ERF A;  2VUC A;  4M0N A;  2D44 A;  4FSJ A;  2K9Z A;  2QJV A;  4UFH A;  5LBF A;  2RE9 A;  3D0S A;  3PVO A;  2GMM A;  4YVW B;  1F31 A;  4XTP A;  2MEV 1;  1CVN A;  3ZXG A;  1D4M 2;  2HWF 3;  4LKS A;  4ET7 A;  1X9P A;  1YNA A;  1Y9M A;  2J1U A;  4CP9 B;  4E8D A;  2XVG A;  1O4T A;  2ENR A;  4XFA A;  2W39 A;  4AVC A;  3NST A;  3RGB A;  2BNM A;  3V65 A;  1VRH 2;  1IQD C;  4C90 A;  4DEV A;  1O91 A;  4LA3 A;  4Q4Y 2;  1COV 3;  4KBB A;  3VGI A;  1QY4 A;  2D40 A;  1UYP A;  2XJU A;  4A3X A;  4CCM A;  1X8E A;  2ZOE B;  3VBR C;  3BB6 A;  1U12 A;  1SBD A;  4WVM B;  2HWD 2;  2J42 A;  1UY4 A;  1PVC 2;  4RGK A;  4C1X A;  4XET A;  2C26 A;  1CWP A;  4RR3 B;  4J6G A;  1QKQ A;  4LE3 A;  4A2U A;  4YZ3 A;  3I97 A;  4U36 A;  4CCC A;  4XFG A;  2HYX A;  3ZXK A;  2MHF A;  4YZ5 A;  4LUL A;  3A0K A;  3Q8A A;  2Q4S A;  4XAA A;  1WZX A;  1UX7 A;  1I5Z A;  1O8P A;  1G8W A;  2EXI A;  5GLU A;  2BPA 2;  3ASI A;  2QQV A;  4NID A;  3POW A;  5I8Y A;  1AUY A;  3POJ A;  4FQ4 A;  5LB6 A;  1W6M A;  5JMO A;  4QQP A;  5L9R A;  1HRI 3;  4YZ1 A;  2P3Y A;  3N7K A;  4RGA A;  4B1L A;  3U07 A;  5FZ4 A;  3F2Z A;  1C57 A;  1U5Z A;  2UYB A;  2YPD A;  4FT8 A;  2HWC 1;  4GB3 1;  1POV 1;  1UPI A;  4OFG A;  4XAB A;  1A3K A;  1NCQ A;  5CFD A;  2P17 A;  2ZX0 A;  2VBB A;  5APA A;  1DYO A;  4QPG A;  1ND2 C;  4Z8B A;  1ENS A;  1RUE 1;  2D6N A;  4QX2 A;  4C91 A;  1ZBE 2;  4Z82 A;  2YHJ A;  3CNA A;  5F6L B;  3RRD A;  5IAT A;  4Y5S A;  2R6Q A;  5D21 A;  4WM8 C;  1YQ5 A;  1ULE A;  2R1D A;  1ZRE A;  4YVS B;  2NMO A;  3BOW A;  1RIN A;  3KF5 A;  2AR6 A;  3ZN4 A;  4BCU A;  4FP2 A;  4IL7 A;  2Y6H A;  2VQ0 A;  2QQO A;  3IDB B;  2I07 B;  3NQH A;  3TEY A;  1CX1 A;  3CBN A;  5FJH A;  3D6E A;  4IUG A;  2IUW A;  5FMB A;  5JR2 A;  2MEV 2;  2W87 A;  4OI1 A;  1NT0 A;  3HPN A;  5SV5 A;  4EN6 B;  5IHR A;  5J1X A;  1BVV A;  2H0V A;  2LM3 A;  1C1F A;  1PK6 A;  2B42 B;  1OLR A;  3LEM A;  2RDQ A;  5T5O A;  3DKQ A;  4A6S A;  2VZ3 A;  3THT A;  3SKV A;  3H8X A;  3EB7 A;  4KU8 A;  3B00 A;  1OH3 A;  3HT1 A;  3SEE A;  3VHN A;  2VUL A;  3O7O A;  2VH9 A;  4P08 A;  3SCH A;  5LEJ A;  2AUY A;  3I59 B;  3NV1 A;  1YFY A;  5BNN B;  1OUR A;  2RS5 1;  1CPM A;  4LNV A;  3EXU A;  4GH4 C;  4UBH A;  1ZBA 3;  3FBM A;  3WVJ A;  5HBA A;  2MNG A;  5AVA A;  2WT1 A;  2XL9 A;  5EIY B;  3E5X A;  1ZZC A;  2JE8 A;  2VPV A;  4FXK B;  2XLF A;  4ZXK A;  2VMI A;  3T0B A;  1ZM1 A;  3POS A;  4NN0 A;  3C7O A;  1O6U A;  5FUP A;  1OFS A;  1WKY A;  1BBT 3;  1O5U A;  3N7J A;  4HN0 A;  5K0U B;  5AC9 3;  4Z92 B;  2C4X A;  2WKK A;  3VD3 A;  2R04 3;  1R09 1;  1SPP A;  2W1W A;  2JEC A;  2DBN A;  4E4S A;  1CAU B;  5F8P A;  4K20 A;  2ZJC A;  5BYN A;  2RS3 1;  2BBA A;  1HXS 1;  3CJI A;  1BK1 A;  4DNY A;  5L36 A;  4GB3 2;  4H7L A;  1XXN A;  2HWC 2;  4GWJ A;  4CU8 A;  3UJQ A;  1H1M A;  1YFU A;  5A32 A;  1PX4 A;  3WF3 A;  4NAM A;  4Y1Y A;  2ZZQ A;  3C7E A;  3L9J T;  3FLR A;  5A3W A;  4DQA A;  3MF6 A;  4RFT 0;  1RUE 2;  3K77 A;  1IQA A;  5JSP A;  3NJZ A;  2WNE A;  5FCC A;  3QBQ A;  4LUK A;  1UNB A;  1GZC A;  3AZW A;  3DKW A;  5FOJ B;  5IFT A;  3OEB A;  1GOG A;  3LEI A;  3MO4 A;  1NA1 B;  1NXD 1;  5FZE A;  5CFC C;  4KWU A;  4XHB A;  4BDV B;  3T0D A;  1Y3T A;  3HOB A;  3VBR A;  5L7O B;  1NZI A;  5EHD A;  5K7P A;  1RMU 1;  1W2A X;  5A1L A;  1EAH 1;  1QH6 A;  3WR0 A;  4R8H A;  4PQQ A;  4LUM A;  3E1F 1;  4Q0Q A;  4Y26 A;  3WW1 A;  1GV9 A;  3THD A;  3CJX A;  4NIA A;  3UKT A;  4E9K A;  5FO9 B;  1W8T A;  4NIH A;  2QE3 A;  1UIK A;  1IS4 A;  1AR7 2;  2VZ1 A;  1QNW A;  4MOA A;  2DCZ A;  4IDZ A;  4PQ9 A;  5FK8 A;  2H0B A;  2VME A;  4GAL A;  5JUV A;  2NZ9 A;  4Q5O A;  3WEZ A;  1IS6 A;  4CEY A;  4YWA A;  4YW6 A;  1LU1 A;  2OT7 A;  3D4K A;  1C5H A;  3MFA A;  5KHI A;  5FY0 A;  1V6N A;  4AED C;  1NE6 A;  1S4C A;  2C5D A;  3WDY A;  3DEM A;  1CZT A;  5F3I A;  5CNA A;  4Q8K A;  4ZHN A;  4GKX A;  5DN2 A;  2GC0 A;  3VBH A;  3T2Q A;  5FO8 B;  4QD2 A;  1MZ5 A;  5GLZ A;  1IOA A;  1W28 A;  3KZ4 C;  4Q4X 2;  3GZA A;  3I2K A;  1H8T B;  1H9P A;  1N3O A;  3VBS B;  2Z5W A;  2VQT A;  2JDU A;  1K5M B;  4XDQ A;  1CIY A;  2LTN A;  1QJY 1;  1TME 3;  3PU8 A;  4CEW B;  4TTG A;  3LEK A;  2KM2 A;  1BHG A;  1W6Q A;  1CGP A;  1YUD A;  5ANN A;  5HPO A;  1J1T A;  1V6I A;  2A75 A;  3HQX A;  1HXS 2;  3DYO A;  4TYS A;  1U5Y A;  3SCG A;  3WP5 A;  5A6X A;  4OQ8 A;  5FYZ A;  2AEY A;  2J1T A;  2R06 1;  2SLI A;  1VBA 1;  4HK9 A;  2G9G A;  2OVU A;  2QZ2 A;  2VZR A;  1MS9 A;  1EV1 3;  3KV9 A;  4XMI A;  3TN9 1;  1LGN A;  1H4H A;  2ID4 A;  3S6P A;  4B29 A;  1ALY A;  3S0M A;  1VBD 3;  5FRE A;  1QU0 A;  1LR5 A;  1UN1 A;  2IVI B;  4ES9 A;  3I3D A;  3AKR A;  5CFD B;  5KBF A;  5JSO A;  1UZ0 A;  1RVF 3;  1GNH A;  1X82 A;  3AZV A;  4HMZ A;  2RV9 A;  5FTT C;  4DUW A;  1AR8 3;  4LIT A;  5F5A A;  2RJ2 A;  2VOX A;  1W2U A;  2VQU A;  3ZYG A;  2ZMN A;  5EZW A;  3JBG 1;  3GBF A;  4IGQ A;  2JD4 A;  2CWM A;  3BCW A;  3CMG A;  4GMP 3;  4RQP A;  1I5P A;  1RMU 2;  2E63 A;  2NPI A;  3SHR A;  4FP3 A;  3UT0 A;  1AF9 A;  2YUE A;  3H1M A;  5C3P A;  1GU3 A;  5A7Q A;  3OJB A;  3U10 A;  4JAA A;  4NII A;  3WUC A;  3AP9 A;  2GP5 A;  3T08 A;  1HIX A;  5IVJ A;  1SLB A;  3BPS A;  1TEI A;  2G19 A;  2BZD A;  5FY4 A;  1DQ0 A;  1IS3 A;  3IAQ A;  4OQ9 A;  1RUD 1;  2Y6G A;  3OD0 A;  4BZ4 A;  3MV1 1;  5H9P A;  4AR2 A;  1YWK A;  3P5B A;  4L2N A;  4OI4 A;  3ZMN A;  4NMI A;  2DVG A;  3LGR A;  2BGC A;  2A6X A;  1HB3 A;  2BGO A;  2E33 A;  2WAB A;  4QX7 A;  5FRA A;  4YPJ A;  3ZFF C;  1JI6 A;  1COV 1;  5DDJ 3;  1LEN A;  5C71 A;  5F9T A;  1POQ A;  2AH2 A;  2JG8 B;  2JDM A;  3JCI A;  4HG6 B;  5CIS A;  5M0T A;  3UNP A;  4KU7 A;  4XUO A;  3POG A;  2EAK A;  2QUO A;  3SMH A;  5CG9 A;  5GLW A;  1JN2 P;  4QHO A;  5FZO B;  2FDG A;  3ZR6 A;  4EV0 A;  1QJY 2;  2JG9 A;  5KWR A;  2B7Y A;  2XLA A;  4FPC A;  2CDP A;  2RM2 3;  1UD1 A;  4XUN A;  1RED A;  2XBO 1;  1XND A;  1JZ4 A;  1DCS A;  1SPP B;  4KNC A;  3WT3 A;  1REE A;  1YQ6 A;  2UY9 A;  1UU4 A;  1GAN A;  2XQX A;  2R06 2;  2WO7 A;  4X6Q B;  3WP6 A;  1HV1 A;  3CJI B;  3M4F A;  1QJX 3;  3TN9 2;  2W3J A;  2W95 A;  4NVP A;  5JOW A;  1HRI 1;  3KGL A;  3DN7 A;  2JIJ A;  3PIJ A;  4IGO A;  5T5P A;  1OMI A;  2FDH A;  5A32 B;  1JHJ A;  4DY3 A;  3SH3 A;  1W90 A;  4JKM A;  3R0R A;  5DAP A;  2ZTN A;  3DGT A;  2GN7 A;  1RJ8 A;  3J7H A;  1UYX A;  1PGW 1;  5JXH A;  2ZEX A;  3MID A;  2A6W A;  1A8D A;  2E32 A;  3BTZ A;  1AR9 1;  2XH6 A;  4JGZ A;  4ASM B;  3FE5 A;  5F6K A;  3JBG 2;  1JW6 A;  3SNM A;  3C2U A;  2D3P A;  4R52 A;  4O9E A;  3R4S A;  4NOT A;  4M4R A;  1D4M 3;  3VHR A;  1KD7 A;  1YFW A;  4I3G A;  4W65 A;  4UFJ A;  1SDW A;  3FLT A;  1SLI A;  3JD7 1;  2TEP A;  4ISR A;  3I2F A;  3P1I A;  3A21 A;  1NLS A;  1DHK B;  5DZF A;  3LE0 A;  4B4Q A;  3JQW A;  2C9A A;  1VRH 3;  1AVB A;  1RUD 2;  4FOW A;  5CKM A;  4Q4Y 3;  1NCR B;  3WCS A;  3JB4 C;  1SQ4 A;  3WF4 A;  5FZF A;  1PNG A;  2AEZ A;  2VG9 A;  4JTN A;  4NHL A;  3UK9 A;  3V0A A;  5KXC A;  1F5J A;  1TNF A;  4G3Y C;  2W5F A;  4ZY9 A;  2HWD 3;  1COV 2;  1VPH A;  2V09 A;  4K1Z A;  1W03 A;  3LDB A;  5C33 A;  1PVC 3;  3OY8 A;  1LKN A;  5FYT A;  1W8H A;  3MLJ A;  3OYW A;  3WHT A;  3VBH B;  4EZH A;  1YI7 A;  1OC1 A;  5LY1 A;  2ETE A;  1ZBA 1;  4JDM A;  1Y9Q A;  1W0P A;  5F2S A;  4E4D X;  2JIG A;  1FAT A;  4P5Y A;  4URA A;  3JXS A;  3URF A;  2ATF A;  2EIG A;  1PM7 A;  3III A;  3DYM A;  2DCT A;  3CZU A;  1W6Q B;  2XBO 2;  4QKN A;  5FYC A;  4MXW A;  5D8A C;  2F4P A;  2YB7 A;  2IFR A;  1X33 A;  2R04 1;  1STM A;  4LEJ A;  2X5I B;  5FIX A;  2ZAB A;  5L73 A;  1HRI 2;  3D82 A;  4JHZ A;  4WVZ A;  2JDP A;  4LO4 B;  5J36 A;  2HWE 1;  2R07 1;  3HQR A;  1Q8Q A;  2C1F A;  4I01 A;  3VL9 A;  2NP0 A;  4AEM A;  4ITC A;  4QXK A;  5FP7 A;  4NPM A;  3ROU A;  1FYU A;  1GYK A;  1NE4 A;  2XJP A;  1ZBE 3;  5K4L A;  4NRO A;  2Y34 A;  5EJZ B;  1X36 A;  4HK8 A;  4BHP A;  4NIG A;  3BKZ A;  1K3I A;  1AR9 2;  3A0N A;  3J4U H;  2QQJ A;  4XBL A;  3MI8 A;  1OOP A;  4YNI A;  5CA6 A;  1DZQ A;  5T55 A;  3RS6 A;  2RJK A;  1LES A;  2MEV 3;  3KD4 A;  3MFC A;  1JXN A;  4Y20 A;  2Q8E A;  3A7Q A;  5L19 A;  4KL1 A;  5F5I A;  4AYU A;  4HOO A;  3JD7 2;  1NQD A;  1UYY A;  4MX3 A;  4C0H A;  4JTO A;  4RR3 C;  2CWS A;  3NAP C;  1MPX A;  1W99 A;  3U0Z A;  5E6H A;  1QXJ A;  5FY7 A;  3ZFG A;  3ZYH A;  4EWD A;  5JXG A;  2W68 A;  4O65 A;  4Y3O A;  3VKL A;  5LRR A;  3T30 A;  1XB9 A;  3I3B A;  1BK0 A;  3IPV B;  1H1A A;  2JDA A;  1O59 A;  3ACF A;  1J3R A;  3LA2 A;  4UW3 A;  5FLI A;  4AVA A;  5CBL A;  4RSU A;  5ABJ A;  2GNB A;  1TG7 A;  4RS5 A;  3ZFE B;  4Y1X A;  3KLS A;  2O8Q A;  1SBF A;  3B93 A;  1AXY A;  3AL6 A;  1GP6 A;  4N53 B;  4V2V A;  5DUU A;  3H8O A;  3R4D B;  1ZBA 2;  4Y1U A;  2BFU S;  2VQA A;  4LO7 A;  3KHB A;  1CAX A;  3PHM A;  1PNF A;  2EID A;  5FMO S;  4XE9 A;  4K3U A;  1ZZB A;  3UV9 A;  3OGS A;  5GZG A;  3BU0 A;  3OG2 A;  4NRM A;  4UOJ A;  3MV0 1;  3T2P A;  1G86 A;  3UKV A;  4TZD A;  3KQ4 B;  2WO1 A;  4QDR A;  5IVE A;  2XB6 C;  4HXC A;  4YVS C;  1KJR A;  2V73 A;  2HBT A;  4GB3 3;  3VDC A;  2HWC 3;  4JDN A;  4QWN A;  2J1A A;  4COW A;  1POV 3;  3WUD A;  2BQP A;  3JUU A;  2D3R A;  2WL1 A;  4HL0 A;  1V6L A;  1GZW B;  2HWE 2;  2R07 2;  2WT0 A;  4XHX A;  5IK7 A;  1DZT A;  3WCR A;  1ASJ 2;  3POB A;  2ZGO A;  2ZGM A;  3CIH A;  3WZ1 A;  1G6N A;  1SLA A;  4DPN A;  1ZA4 A;  4OZX A;  3AYC A;  4AG4 A;  3UKN A;  2YBP A;  1IPK A;  3ME2 A;  4DMI A;  5A3U A;  3MIF A;  2DCJ A;  1TQ5 A;  2R7E B;  1QOT A;  1ZNP A;  2YC0 A;  2JDN A;  2Z42 A;  4XJZ A;  4X8N A;  5FP3 A;  3VBO B;  4HVO A;  4EWA A;  1AR8 1;  1PZ7 A;  1KXG A;  4YGC A;  4CDW C;  1W8W A;  2DUQ A;  3VHO A;  1LRH A;  1AYN 3;  4MGS A;  4GMP 1;  1AR7 3;  1YJK A;  2BOI A;  5DZE A;  4CDQ B;  3OGG A;  4E4H A;  2BW8 A;  4TN7 A;  3AMM A;  4L99 A;  2ARC A;  2VZO A;  5C5T A;  3O1M A;  1Y9G A;  1IG0 A;  3M7A A;  4QM8 A;  4MV2 A;  5A7W A;  5FKB A;  2YC2 A;  3C7H A;  5K0U C;  3HNM A;  4R9A A;  4R9B A;  4FPK A;  1CX4 A;  3INA A;  2R1B A;  1OSG A;  3AB0 A;  2V5Y A;  3C7F A;  3LDK A;  3TBD A;  1X7N A;  1G9B A;  2WBK A;  2ZHL A;  3SQO A;  4FI9 A;  4PDW A;  1QH7 A;  3IDC B;  4W6W A;  4EZ4 A;  3K75 B;  4YM3 A;  4ISQ A;  5LAS A;  3V0A B;  3W5N A;  1RUH 1;  2VGD A;  4LBQ D;  4BQW A;  3VBF C;  3ACH A;  5A3L A;  4Q4X 3;  2W94 A;  2ZAC A;  3WW4 A;  3OY8 B;  4CU7 A;  3M3I A;  5DDJ 1;  4IV1 B;  3NL1 A;  3LWC A;  1G7Y A;  1QHD A;  5C8C A;  3LB9 A;  3I3M A;  1B35 A;  4MVT A;  1NXM A;  3D8C A;  3FMG A;  4Q27 A;  2GMP A;  4UF0 B;  4DFS A;  5I8T A;  3IKW A;  4XFH A;  4IEP A;  4F8A A;  5LCW L;  5E89 A;  4JHT A;  1WCS A;  2P3J A;  1HXS 3;  1F35 A;  2DVB A;  4MLO A;  5EYX A;  1VAK A;  3WDX A;  1NA1 C;  4D7S A;  4PF5 A;  2QDN A;  5FPL A;  1MVE A;  4AFA A;  1TNR A;  1RUJ 1;  2G1M A;  4TLF A;  5FXZ A;  3USS A;  4B4R A;  2PQQ A;  2X09 A;  1UOJ A;  1JYV A;  4HKO A;  4QB6 A;  2Y6F A;  4YW7 A;  5HXM A;  3WX5 A;  3LPG A;  1KDK A;  3UGG A;  1PO1 3;  3W5M A;  2EAA A;  1SFY A;  3AXD A;  1W6O A;  4CVU A;  4MSV A;  5FY1 A;  3RZZ A;  3NNM A;  1NG0 A;  1FPN 3;  5IUQ A;  4Z2W A;  3PL0 A;  2VZU A;  1RHI 1;  2OYZ A;  1W9F A;  2EXK A;  5FZD A;  1W8Z A;  1QJZ A;  2X53 S;  5FOB B;  1RUI 3;  5B4X A;  1QMJ A;  4BA6 A;  2A70 A;  1RMU 3;  2CGO A;  4JRA A;  4I0A A;  4BQ2 A;  5GAL A;  4DXS A;  2F4L A;  3VDD A;  3AXE A;  4BIO A;  2Y26 A;  1UXZ A;  5C70 A;  1MZ6 A;  1OD3 A;  3AKT A;  2ZGL A;  3PVB B;  4MHR A;  4S2F A;  1M4W A;  1XSQ A;  2G4I A;  2BP6 A;  3GM8 A;  1C4R A;  2YGL A;  3KGZ A;  4YGD A;  4D0Q A;  4D6S A;  4F83 A;  1H8T C;  1D4M 1;  1AHS A;  3LSD A;  4XF9 A;  4QXB A;  3N35 A;  4Y4R A;  1XOY A;  3VBS C;  3WNL A;  3EO6 A;  1K5M C;  4BU2 A;  2EA7 A;  3WNP A;  5JZG A;  4CEW C;  3ZFG B;  2FD8 A;  1GR3 A;  3N9Q A;  1K12 A;  4V1P A;  3N9N A;  3RYK A;  1VRH 1;  4QDS A;  5EPA A;  2NLR A;  4IV3 A;  4W6Y A;  4Q4Y 1;  4AHY A;  3MUY 1;  1I1E A;  4YZ2 A;  4PIX A;  4UYB A;  1GWL A;  4NPL A;  3K4Z A;  1RUH 2;  4I30 A;  4Q4W 3;  1WMD A;  1KEX A;  5L9B A;  1CAW B;  5C7G A;  5F3C A;  1ULG A;  2Y6L A;  1W6N A;  3CLP A;  4R4X A;  5GLT A;  1O5L A;  3KT1 A;  3G6J B;  5DDJ 2;  3T0A A;  3WNX A;  1ND3 A;  1LOA A;  3AKS A;  1PVC 1;  3K3N A;  2XDV A;  4FOV A;  1QJY 3;  2QBX A;  2JIC A;  4Y1Z A;  4OI2 A;  1WCQ A;  3OB8 A;  3ZXF A;  1IPS A;  3N3H A;  1CAX B;  1JH5 A;  1TMF 1;  2FMD A;  4LTA A;  1H6X A;  2A6Y A;  2RDS A;  4H2A A;  2XXZ A;  4QPI B;  1JYX A;  2BDR A;  5KR7 A;  2GND A;  2WO2 A;  4PT6 A;  4EE2 A;  2R06 3;  1Q8S A;  3HMY A;  4HVR A;  1N1Y A;  1J58 A;  1BZW A;  3OTF A;  1T6B X;  4PI0 A;  3ZXE A;  4Q1R A;  1RUJ 2;  3TN9 3;  4EN8 B;  4J1W A;  5C9A A;  5JAX A;  1Q56 A;  1J3Q A;  5C4W B;  1UY1 A;  4N9I A;  2HJI A;  3OGJ A;  4AI9 A;  4XQD A;  2Y38 A;  1F4H A;  1UU6 A;  4FPL A;  1C5I A;  2XUM A;  2JEN A;  3KVA A;  1MQT A;  2XL7 A;  5ERL A;  3RMX A;  1OA4 A;  3HNY M;  2Y6J A;  4BH9 A;  1RHI 2;  1UPS A;  4NHM A;  2WZP P;  2B9U A;  2GN3 A;  4IEU A;  1MS4 A;  4Z07 A;  1ZRR A;  3JBG 3;  2CV6 A;  1NOV A;  2L9L A;  5T50 A;  3SXW A;  4MO3 M;  4XUQ A;  4PLM A;  3N9O A;  1CZS A;  2WS9 1;  1KGY A;  4BME A;  1JU3 A;  2ORX A;  1EPW A;  3DUI A;  4H7M A;  5FPB A;  4CP0 A;  4JGY A;  5IK5 A;  1WBL A;  4CTE A;  1XC6 A;  1H2N A;  2PEL A;  1H6Y A;  2VNG A;  4A6O A;  4BIF A;  2D3S A;  1W6P B;  1KIT A;  2JG8 C;  4BQ1 A;  5FZ9 A;  5A33 A;  2ET7 A;  5F3G A;  5FZ7 A;  1RUD 3;  2WT2 A;  4P9J A;  5BNO A;  4HSL A;  5LBE A;  4YW1 A;  3RDI A;  4LIV A;  2XGX A;  4BJ0 A;  1KDM A;  3J7N A;  1UOG A;  2CYF A;  3AZZ A;  3U78 A;  3NNJ A;  3R6S A;  3Q8B A;  3MHZ A;  4XF4 A;  2NYY A;  3K48 A;  4XEZ A;  2YBS A;  5GM0 A;  1A8M A;  4XAC A;  3SCF A;  4CPB D;  1SLC A;  2VMG A;  4X8P A;  1DGW A;  1VJ2 A;  4PDW B;  3N9L A;  1LEM A;  1XNA A;  2DU0 A;  3DPR A;  4B7E A;  4E2G A;  2ZGQ A;  3AX4 A;  2ZGU A;  3Q8C A;  4AFC A;  4E8C A;  1F4A A;  3RG0 A;  5JI9 A;  2CGP A;  3E5Q A;  1TMF 2;  1QOO A;  1B35 B;  1P8J A;  3ZYJ B;  2XBO 3;  1UKR A;  2W92 A;  5BUV A;  5ISL A;  3NJV A;  4PHZ A;  1DYP A;  1YHF A;  2BER A;  2GH8 A;  4LOT A;  2N7G A;  4LO5 B;  2W91 A;  3FHA A;  4HPK B;  2PHX A;  3QH6 A;  3I2H A;  1RUG 2;  5FLH A;  1SMV A;  2Q0A A;  5FY8 A;  2VR4 A;  4W6X A;  3ZSE A;  1ODN A;  3ALQ A;  1WGP A;  4N43 B;  4K1Y A;  2ZMK A;  1JOD A;  1UU5 A;  1W8N A;  2JEM A;  5EFU A;  4B4P A;  1W6O B;  2BEO A;  1CZV A;  1SBE A;  1ZRI A;  3WDU A;  2TUN A;  2XML A;  1AR9 3;  3USU A;  4AHW A;  3GZT B;  5DG1 A;  1NCR C;  2PHF A;  3ZKY A;  4AI8 A;  4QM9 A;  1WW4 A;  2WNU C;  1LOB A;  1HQL A;  3KS7 A;  4Y22 A;  4CDX A;  2P6C A;  2WS9 2;  1E5R A;  3NO8 A;  2DVF A;  4ES8 A;  3H3Z A;  4WVW A;  4AVB A;  4I0B A;  3JD7 3;  4FAG A;  3O0V A;  4JQR A;  1Y43 B;  1UMH A;  2WQ8 A;  3IB3 A;  4XJ8 A;  2ZHK A;  5LWB A;  2W08 A;  4BLI A;  4C8D A;  1UXX X;  4COY A;  3M70 A;  4XJA A;  4Z1V A;  5EQU A;  1LGC A;  3PLQ A;  1AYN 1;  5A7O A;  5FPU A;  4CCD A;  1ACC A;  1AR7 1;  4LOS A;  3UES A;  3GZU C;  4NAO A;  5FP8 A;  5BV6 A;  3BTX A;  4HN1 A;  5HCB A;  2PAK A;  1W9Y A;  4PF1 A;  5HV0 A;  5KHH A;  5FYI A;  5GLV A;  5JZG B;  4KWJ A;  4NO4 A;  4FPO B;  3KQR A;  4L8Q A;  3O0W A;  4KG8 A;  1DQ4 A;  1OA2 A;  1SLL A;  2XKP A;  4P02 B;  5AFB A;  5FZ3 A;  5BNP A;  4AI2 A;  3E6C C;  2P5B A;  1XJA A;  1LGB A;  4KMQ A;  5HCF A;  3UYJ A;  4AI1 A;  5AFE A;  2OZ6 A;  1W9W A;  4IEY A;  4BB3 A;  1YI9 A;  1VAV A;  2WLP A;  4OUL A;  1C8N A;  4Q4X 1;  1ND3 B;  4FAH A;  1ENQ A;  2DFB A;  2X8K A;  1FV3 A;  1JOP A;  3UET A;  2CHH A;  2VTX J;  2WQ4 A;  4G9S B;  2A6V A;  4QXC A;  2LAL A;  2BNN A;  2WR9 A;  4A42 A;  5JXJ A;  5JXI A;  3DYP A;  1OLM A;  3TEZ A;  4NRP A;  4LOR A;  4LBO A;  3PME A;  3WQ0 A;  1F8V A;  3AJY A;  4XCB A;  1DGL A;  2CU5 A;  2OZJ A;  3APB A;  2HWE 3;  2R07 3;  4CXX A;  1WCU A;  2BJS A;  1ASJ 3;  3HVD A;  3RYP A;  3O0X A;  1VIW B;  1JMU B;  3ETP A;  4BXF A;  1NQJ A;  3JU9 A;  1QGL A;  1IZ3 A;  2WO3 A;  2JE7 A;  5FYM A;  5IWF A;  2DCY A;  1PO1 1;  4JQT A;  3ES4 A;  1L3J A;  2BFU L;  3HN1 A;  1GWM A;  3HWJ A;  2CAU A;  2G9Z A;  3SH4 A;  4RYD A;  3T2T A;  1V6J A;  3SIS A;  3MLL A;  5E8A A;  5FMO L;  1FPN 1;  2B45 X;  3AP6 A;  2XR4 A;  3EYP A;  1XPW A;  1OA3 A;  3BPZ A;  2OA2 A;  3M3O A;  4QGM A;  3W59 A;  1LUL A;  2ZXQ A;  2IXH A;  1OKO A;  1R1A 3;  2WFF 1;  3CKH A;  3EMR A;  1RUI 1;  4ARY A;  2KR2 A;  2WNV B;  5A6Y A;  2A3X A;  3E97 A;  4KGQ A;  3ZFE C;  2QQN A;  4JGY B;  4K7J A;  3WQB A;  4FPJ A;  4K40 A;  4N53 C;  4AVT A;  3MLK A;  4IGP A;  3GJB A;  3J26 N;  4LKE A;  3I8T A;  4UXA A;  1AYN 2;  4XF1 A;  3ZYI B;  1VMH A;  5IK8 A;  1PZ9 A;  2Q30 A;  4QAW A;  1W0O A;  3W9A A;  4D6R A;  5A33 B;  4M3C A;  3ZDV A;  3V0B A;  5BNO B;  1JUH A;  3VD5 A;  2NQY A;  3WF0 A;  1ZRF A;  1H2K A;  3OGV A;  2VC9 A;  3AK0 A;  2QQU A;  5LY2 A;  1AL2 3;  2OII A;  3HR9 A;  1TZO A;  3LF7 A;  2YRO A;  4Q2F A;  3AZX A;  2G9F A;  2XUE A;  4GWN A;  1JYN A;  1NYW A;  5JCT A;  1UL9 A;  4IE7 A;  2ZAA A;  4UWD A;  1FV2 A;  1WLC A;  4Q4W 1;  1DGR A;  2C24 A;  1S0F A;  3WY6 A;  1Y7B A;  3GCW A;  1ND2 A;  2QKD A;  2IXL A;  3I3E A;  1X50 A;  2WLQ A;  5DAW A;  3WHU A;  5FYU A;  2X05 A;  3AYA A;  2D6K A;  5IFP A;  1QEX A;  2V72 A;  5A7P A;  4WM8 A;  3WSO A;  1LHO A;  2W1U A;  3NJY A;  1W06 A;  2PMW B;  3E6B A;  2E51 A;  2IFW A;  3L2Y A;  2DDU A;  1YQC A;  4LBQ A;  3VBO C;  3MW3 A;  1KS5 A;  2C9K A;  2DFC A;  3POF A;  3PJQ A;  4LIU A;  4BM8 A;  1W6M B;  4CXW A;  5LW9 A;  3POE A;  1W8F A;  2E31 A;  4FPH A;  4B3N A;  4P9L A;  2AAC A;  3T1M A;  4XFC A;  2FCU A;  4CDQ C;  4AHZ A;  2CY6 A;  5KC6 A;  5KXE A;  5KHG A;  4OHZ A;  1LNS A;  1NCQ B;  1PO1 2;  2CL2 A;  2ZAH A;  2ARX A;  3DV8 A;  1UX6 A;  2LRP A;  1Q43 A;  2J7M A;  4Q4V 3;  5C3S A;  4AAP A;  3PUQ A;  4QPG B;  2JE9 A;  4X6R B;  3USU B;  4ASL A;  2HLE A;  1FPN 2;  1E5S A;  1G9F A;  1AZD A;  1V9U 1;  3H7Y A;  3IBM A;  4NPR A;  5CZK A;  5DQ0 A;  4BQ3 A;  1FMD 1;  2NMN A;  4XUT A;  2BVV A;  2ZGS A;  1HRV 1;  2WFF 2;  5I0R A;  1Z78 A;  3M1H A;  4LXL A;  1RUI 2;  4H55 A;  2PAE A;  4GH4 A;  5FBJ A;  2AC1 A;  1JOB A;  1H9W A;  1PIV 1;  3I2I A;  2PHW A;  2ZPX A;  4NE9 A;  3VKF C;  3KCC A;  3MPP G;  3ZSL A;  1KS4 A;  3I7D A;  4AFD A;  5FUN A;  4BLJ A;  4IV1 C;  2P4E A;  3C8X A;  1S0E A;  4K8R B;  1M06 G;  2YC4 A;  1OF4 A;  3M8L A;  1HN1 A;  4LJH A;  5IJR A;  1ZRC A;  1PK6 B;  2Y0O A;  3W21 A;  4YGE A;  4AGR A;  5EWS A;  4RGG A;  5I93 A;  5J7M A;  2JDH A;  4YFW A;  1N47 A;  4M3C F;  4D94 A;  4IW3 A;  1R1Z A;  1VBB 1;  1RUH 3;  2AYH A;  5FYH A;  5EV7 A;  4EN9 B;  1QXP A;  4LBK A;  4AQS A;  1LOG A;  3VV1 A;  2OX0 A;  1PHM A;  3PUH A;  4JRL A;  2PHR A;  3K51 A;  4N9H A;  4DXR A;  1AX0 A;  1X9T A;  2Q1F A;  4Q4W 2;  4S2D A;  3B9I A;  1LB2 A;  4CDU C;  4JKK A;  2D5F A;  2ZEY A;  4AGG A;  3BOD A;  2XKO A;  3MEP A;  3NVC A;  5A3O A;  3T09 A;  3H8R A;  1PZ8 A;  3EQE A;  2DCK A;  5CFC A;  5HCH A;  4UW5 A;  3JZV A;  1RUJ 3;  4LLO A;  4BWO A;  1RIR A;  1XU2 A;  2EIC A;  4HBN A;  1BJQ A;  2OUJ A;  2XWJ B;  3R05 A;  2VY0 A;  2DBI A;  5IW0 A;  4MZU A;  4AEK A;  4IE4 A;  3S5A A;  1WA6 X;  4LHS A;  5FP4 A;  1H8V A;  1GZ9 A;  3VD9 A;  4CYD A;  3VD7 A;  5IT6 A;  1SFN A;  3UL2 A;  3M3E A;  4KQ7 A;  4P9W A;  2FCT A;  5KC5 A;  3FC0 A;  1RHI 3;  2Y8K A;  3WOG A;  2QQL A;  4XOG A;  5IYY A;  4LE4 A;  3S57 A;  3BGA A;  2QQW A;  3HEI A;  1GNZ A;  1V9U 2;  1BQP A;  2W47 A;  2B4K A;  2VZQ A;  4N90 A;  4AED A;  1FMD 2;  5K9Y A;  2PYT A;  1HRV 2;  2D6M A;  1GP4 A;  4D3W A;  4DB5 A;  5LZ6 A;  4QGN A;  3THP A;  1PIV 2;  2H6B A;  5TSW A;  3VBR B;  4QKD A;  2AEN A;  1LEC A;  4PCR A;  2ADE A;  2QFE A;  1OF3 A;  1S0I A;  2JX9 A;  2ILM A;  3O5S A;  1ZX5 A;  3K4D A;  2XJQ A;  1GQG A;  4MGK E;  4BYY A;  2Z2S B;  3ZYR A;  1HW5 A;  3PIG A;  4Y4Y A;  1U5I A;  1HV0 A;  1I6X A;  1ZZ7 A;  3BTY A;  3FWE A;  4QPI C;  1LHV A;  1O3T A;  2GAU A;  1VBB 2;  4CEY B;  4YG3 A;  3ZN6 A;  2X10 A;  2VEC A;  1ONA A;  5ACA 3;  4D69 A;  1RUO A;  1JHN A;  1OKQ A;  1QIQ A;  1SFP A;  5F2W A;  2QQI A;  2JJ6 A;  4WZC A;  5C3R A;  1JTZ X;  2WA4 A;  4P9X A;  3BI3 A;  2JDY A;  1ODM A;  5JLV A;  5HXV A;  3ZN5 A;  1TMF 3;  4V2W A;  1S55 A;  4FBF A;  3MDP A;  4M4P A;  4WM7 C;  1DG6 A;  2UWC A;  3SH5 A;  3S30 A;  5J96 B;  1W9S A;  3I2J A;  1PM4 A;  2VXR A;  1XNT A;  4PLO A;  2GH2 A;  2WSU A;  4QPY A;  1Q8O A;  1O4Z A;  1F9K A;  3FHQ A;  5DUV A;  5DZG A;  2WYS A;  1RUG 3;  4OVE A;  3RWK X;  3VBU C;  1UOB A;  4XF3 A;  1LOF C;  1VAM A;  3IM0 A;  4IEO A;  4MG2 A;  4PJY A;  1FOD 1;  4OUM A;  1PMI A;  2ZGN A;  1F2N A;  5DMY A;  4FOQ A;  2OKX A;  5IAX A;  1DQ1 A;  4YVW C;  3ILN A;  4EWE A;  3LFI A;  3M2M A;  1XNB A;  1ASJ 1;  1GWK A;  3AVR A;  3CQO A;  2Q1M A;  3WF1 A;  3ZIX A;  1JZ6 A;  5E88 A;  2UUR A;  5BPX A;  4YFZ A;  1C28 A;  1QQP 1;  1XE8 A;  2RS1 1;  2GC3 A;  4MYE A;  1WWY A;  3IZO A;  1U5X A;  1WW6 A;  1YO8 A;  3A4U A;  3PUA A;  3PTR B;  2WS9 3;  1MS5 A;  4FFG A;  5CEH A;  1MEC 2;  2VW2 A;  3ECQ A;  1BYH A;  3Q8E A;  5D2A A;  1NX9 A;  1BXH A;  1T6G C;  2IXK A;  4M0H A;  4NHY A;  3W58 A;  3ZFF A;  3ZO0 B;  4AE2 A;  1Z0H A;  2A73 B;  2DTW A;  3HIF A;  4UAP A;  3QD6 A;  3RZJ A;  1F15 A;  2PHL A;  5CVR A;  2EXH A;  4RQP B;  4CE8 A;  3PNA A;  1UMI A;  1US2 A;  4XF0 A;  2GSY A;  1AX1 A;  2D6L X;  3BYW A;  4YYO A;  3ITQ A;  1R1A 1;  4RFR B;  5JR7 B;  3LEG A;  3MBW A;  5A6Q A;  4ONU A;  2VW0 A;  1CAV A;  3W20 A;  4L97 A;  2DWR A;  4LLF A;  2J1E A;  3VKO A;  1WME A;  2XON A;  4QGL A;  4GJY A;  2DU1 A;  2OQ7 A;  3PTY A;  4QHZ A;  3VKN A;  3GBW A;  5G04 L;  5J48 A;  1V00 A;  3ABZ A;  3TAY A;  1MZE A;  5KXB A;  3RZM A;  2GP3 A;  3U37 A;  4MAD A;  1YFX A;  1HQN A;  4XAE A;  4YRD A;  1N3Q A;  3TNP B;  3WD5 A;  3U11 A;  3ZM8 A;  1AL2 1;  4OMD A;  4H3W A;  4DXT A;  3SEP A;  4I3P A;  1JZ8 A;  4I02 A;  1NZC A;  4QQO A;  1FX5 A;  4N43 C;  4XC9 A;  1ZZ8 A;  3FN9 A;  3JQX A;  2I74 A;  4QPW A;  4E27 A;  4M00 A;  2DVA A;  4DO0 A;  4K21 A;  1WD4 A;  3C3V A;  1H30 A;  3ZIW A;  1DP0 A;  2JG9 B;  5EJ1 B;  5CFC B;  1XRU A;  3IWZ A;  2QDR A;  3THC A;  1MZF A;  3VZK A;  4MET A;  2YMZ A;  4RD7 A;  3KSC A;  4JV4 A;  3WG4 A;  5CAD A;  1FOD 2;  1BVP 1;  1JS9 A;  1YQ8 A;  1BEV 3;  2VW1 A;  3U75 A;  1R08 3;  1VAL A;  3NV2 A;  4HON A;  5FPA A;  5L9V A;  4Q29 A;  2EF6 A;  2WII B;  4LK6 A;  5DAB A;  4LHK A;  3OBZ A;  1QQP 2;  2YDE A;  2RS1 2;  1J1L A;  3UGH A;  1US3 A;  2JDK A;  1LAJ A;  4DEQ A;  2B5H A;  3FLP A;  2R30 A;  4A7Z A;  4XZU G;  1UKG A;  4D8M A;  1Q8P A;  2VNV A;  4Q4V 1;  1ULC A;  1FAY A;  2FBE A;  2XJT A;  1E57 A;  3QH7 A;  4JGZ B;  4QB1 A;  1XNK A;  3WW3 A;  3AP4 A;  2WAA A;  3GBG A;  3CO2 A;  4CUC A;  5BNN C;  3MPB A;  2E9Q A;  1RIT A;  2K0G A;  3N9M A;  1O7F A;  3TNQ A;  2XPJ A;  1R1A 2;  1U0A A;  2PLV 1;  4UFL A;  3M3Q A;  3MZH A;  2V4A A;  4AVV A;  5FJK A;  4N8M A;  2FHR A;  4QQL A;  2A1X A;  3DXU A;  4AEJ A;  2Z69 A;  5JPM B;  4IE0 A;  2WN2 A;  4YM2 A;  3KF3 A;  4GQ7 A;  4IND A;  4UW6 A;  4OHV A;  4QB2 A;  5A70 A;  3D0J A;  1EY2 A;  5D8A A;  2GNT A;  4QU1 A;  2RMU 2;  4PIY A;  3LAG A;  1OI6 A;  2WUH A;  2VVF A;  2ZGK A;  4QX1 A;  3GNE A;  4E2S A;  5BNQ A;  3RZG A;  3KWV A;  3P3P A;  4JZR A;  2D5H A;  2GDF A;  1AL2 2;  5FZM A;  4G4F A;  1RC6 A;  2DVD A;  4PLN A;  4ZON A;  4ARX A;  4L0P A;  4UFK A;  4J25 A;  4OZO A;  3AJZ A;  4E4Z A;  5GZE A;  2WWU A;  4K8F A;  5FZ1 A;  4CP9 A;  2XJV A;  1JZ3 A;  2VTX A;  3OYW B;  4E2Q A;  1LOC A;  2LUW A;  4BQX A;  3FHI B;  2YZ4 A;  4Y24 A;  4BPZ A;  3TEX A;  5FZG A;  2OUH A;  4HVQ A;  2AZ5 A;  1IS5 A;  4WVV A;  3VB9 A;  1OUS A;  5FPV A;  3SLI A;  3RZK A;  4MGT A;  5DUX A;  4UBG A;  4ZZ5 A;  2JB4 A;  2YV8 A;  3HD8 B;  4MXW B;  5L7O C;  2LW8 A;  4O61 A;  2WNV C;  4WVM A;  4XIK A;  5F32 A;  3VHP A;  2XHN A;  2CAV A;  1GBG A;  3MIE A;  4RR3 A;  2Q8C A;  1POV 0;  3NAP A;  5ANQ A;  4UI9 L;  4L92 A;  2EXJ A;  3WQ7 A;  2VVD A;  1EUU A;  3UGF A;  5FXV A;  4IEZ A;  1NLQ A;  2XOM A;  3H3U A;  2W1S A;  4DS0 A;  2VCC A;  2VNR A;  2QQK A;  4KI5 M;  2WFF 3;  1Q3E A;  4BQ5 A;  4Q4V 2;  1FI2 A;  2WNO A;  1DGR N;  2BVB A;  1FT9 A;  4QKF A;  1OOP B;  3AMP A;  2B9V A;  2PTM A;  1HLC A;  1XBF A;  2R0F A;  2UWB A;  3IMN A;  1OLM E;  4IE5 A;  2PLV 2;  1GIC A;  3AP7 A;  4WBB A;  1JOJ A;  3IIA A;  4LQR A;  5GJ6 A;  4Y20 B;  4ZXE A;  3I54 A;  2J1S A;  5J37 A;  4AL9 A;  4NHX A;  5C5U A;  3N9P A;  4XUR A;  3I2O A;  4JX0 A;  1WD3 A;  4W50 A;  3KT4 A;  1CES A;  2O1Q A;  1Q8V A;  3LZZ A;  4FPE A;  4COZ A;  3MW2 A;  1W39 A;  1W8O A;  4TLG A;  4GJZ A;  3LDR A;  4XW3 A;  4YVS A;  1OT5 A;  2VUD A;  2P2K A;  3ENR A;  1XU1 A;  2DV9 A;  3PMS A;  4CCO A;  5LEK A;  3EHK A;  2BBV A;  4MH0 E;  3A23 A;  4HZF A;  4Y5Z 0;  2GME A;  3VZM A;  2ZBJ A;  1RUF 3;  2KA3 A;  5I0T A;  2BU9 A;  4RS5 B;  2I2S A;  1UCX A;  5ACA 1;  5ABJ B;  2KXL A;  2PHD A;  3PVN A;  3F95 A;  4P9Y A;  1YJL A;  4ZZ8 A;  4LKD A;  3ZPO A;  3OD4 A;  5CFD C;  4COU A;  3T2O A;  2ZHM A;  4XFI A;  1S2K A;  1DBN A;  2C6S A;  4QPG C;  2Y0I A;  1VMJ A;  2BYV E;  4M3C E;  4Y5T A;  3MIB A;  1W2N A;  4J1X A;  3PJY A;  4CDW A;  3RJR A;  2VBP A;  2JB8 A;  2FQP A;  3OBR A;  1JZ7 A;  4KWL A;  4R9C A;  1UW8 A;  3OUH A;  4XDP A;  1RUG 1;  3RVH A;  1GSL A;  2YXS A;  5A6Z A;  3OBA A;  3WIN E;  1S1A A;  2VOK A;  1IKQ A;  2Z79 A;  1DZR A;  1GMM A;  2VZV A;  1J3P A;  5FYY A;  3ZSJ A;  4QU2 A;  5H9S A;  3GDB A;  1V9U 3;  1WLD A;  5K0U A;  2WYF A;  1PGL 1;  1PK6 C;  3ZYF A;  1VBC 2;  4DZG A;  5KXD A;  1FMD 3;  3AMQ A;  1HRV 3;  1VLN A;  3ILR A;  1CAU A;  2YY1 A;  3B01 A;  3FX3 A;  3KB5 A;  3RYR A;  4CUB A;  4JKL A;  1BMV 1;  5E16 A;  4IEQ A;  5FY5 A;  1PIV 3;  1GLH A;  1WBF A;  3VBF A;  1S0B A;  5LAT A;  3ZX7 A;  1XSR A;  4YZ4 A;  5JPN B;  2XWB B;  1YXW A;  3NKT A;  3GAL A;  5FYB A;  5FAX A;  2P1B A;  3WG1 A;  5A1A A;  3MGU A;  4GZ9 A;  5CG8 A;  4B8E A;  4D7T A;  2UY8 A;  4EN7 B;  3JB8 A;  4D7Y A;  2HWB 2;  3AMH A;  4QQ2 A;  3HN3 A;  4CCJ A;  4QT6 A;  1VBB 3;  3PUR A;  1H1I A;  1NA1 A;  5A7W B;  3CDZ B;  2R16 A;  4YW2 A;  1QDO A;  1MAC A;  5A1F A;  1JZ2 A;  4EYU A;  4QX5 A;  3WP3 A;  2VO5 A;  2XQR A;  2IZW A;  3CJI C;  2HEW F;  2XVL A;  3LPF A;  4LBM A;  3WXP A;  1S0C A;  4DUV A;  5ACA 2;  2FDF A;  3WW2 A;  1N3P A;  1XE0 A;  2ET1 A;  2HBU A;  2CGN A;  4NRQ A;  5A7S A;  4CXY A;  2A7A A;  2C0Z A;  2D6O X;  3OF1 A;  4FPY A;  1NKG A;  3T3Y A;  4FFI A;  5T5J A;  1DQ5 A;  1WMF A;  5T5L A;  4RHV 1;  5C8C B;  2B46 X;  2AGS A;  4OHW A;  3MIH A;  2W52 A;  3N7M A;  3KVB A;  4GD4 A;  3WNN A;  3MW4 A;  3P6B A;  3GJA A;  4XYX A;  1QJU 3;  3B7M A;  3V56 A;  3MF9 A;  2WRA A;  2VZT A;  2DUO A;  4Q8L A;  3WNO A;  1G9A A;  4QX3 A;  4NUB A;  2FDI A;  4BK5 A;  3MIC A;  2CNA A;  2FZ1 A;  3GYD A;  1K45 A;  5JOY A;  2IXC A;  1AJO A;  1H8T A;  2UYA A;  1DF0 A;  4P9I A;  1BEV 1;  3NWK A;  3VBS A;  4DIQ A;  3NAP B;  1RGS A;  2CTV A;  1R08 1;  3GHM A;  1K5M A;  3AFG A;  3N36 A;  1PGL 2;  3KCX A;  4CEW A;  1MEC 3;  2XLG A;  2ZX2 A;  1D2S A;  5FZI A;  3NV3 A;  3OGR A;  4IEX A;  2WZR 3;  1BMV 2;  1AXZ A;  1JU4 A;  3NV4 A;  1D4V B;  4CEY C;  3I2D A;  2J22 A;  1NAE A;  4FPG A;  4MXV A;  1JYC A;  2JD9 A;  3VDD B;  3QLQ A;  2D6P A;  3LSE A;  2HH9 A;  4AAX A;  1APN A;  1QJF A;  2RR1 2;  3LOI A;  3O1O A;  3BTA A;  4AW7 A;  3VBH C;  4D6Q A;  2GC2 A;  1WUV A;  1X8M A;  3LKJ A;  1S0J A;  1HJG A;  4CCL A;  1E5H A;  4AF9 A;  3VDB A;  4OCT A;  2X29 A;  4XVH A;  1WCD J;  4QKB A;  3FFZ A;  4BQ4 A;  1HQW A;  2BRT A;  3HAG A;  1S0D A;  2VJX A;  4IV3 B;  4OHX A;  1Y4W A;  2I45 A;  1UF2 C;  1O3R A;  2X5I C;  2IXJ A;  2WJS A;  4DRV A;  1ZVF A;  1VP6 A;  3ETQ A;  3FBY A;  4QX8 A;  3RZL A;  4SBV A;  1QNY A;  3VN4 A;  3FJS A;  5F5Q A;  1W6N B;  1GKB A;  2BUK A;  1ULD A;  3I49 A;  5K8S A;  1V6K A;  1N1S A;  5H9Q A;  4DUX A;  1D7P M;  3SC7 X;  4BMB A;  4RHV 2;  2ARB A;  4LBL A;  1C3H A;  1ENR A;  4IES A;  4XXP A;  1TE1 B;  2QQP A;  4Q0S A;  2W2I A;  3HT2 A;  5EXO A;  3WDT A;  5F39 A;  1FOD 3;  2VXJ A;  3O1P A;  3O1S A;  2VMC A;  3CU7 A;  3GZE A;  1AL0 G;  4CU6 A;  4ORF A;  2V5D A;  1C8M 1;  4I09 A;  5FMD A;  1RL3 A;  3U4S A;  4CDW B;  4DRR A;  4RQP C;  1ZZ6 A;  3K4A A;  3EJK A;  3RMY A;  1ZYB A;  1UQX A;  2JG8 A;  5C9A B;  5I0D A;  3ES1 A;  2VUA A;  4A45 A;  1BEV 2;  4K6B A;  4LK7 A;  5IVB A;  1QQP 3;  4W8J A;  2R0H A;  5JOX A;  1R08 2;  2RS1 3;  2O0O A;  5FZO A;  2ZX4 A;  1HDK A;  1MQT B;  2PA7 A;  1OQD A;  2PAM A;  1VBE 1;  3AP5 A;  1QDC A;  5FFO C;  2RVA A;  1D2Q A;  4LHL A;  3UJO A;  1WLW A;  4QQH A;  2JKB A;  1UZZ A;  3IDE A;  5FZA A;  2DYC A;  4LA2 A;  1JBC A;  4R9D A;  2O8O A;  4MGZ E;  1AXK A;  2VUJ A;  5SV8 A;  3K3O A;  3KMH A;  1GQH A;  3N4M A;  5FZL A;  3VBF B;  1DLL A;  3ZMO A;  3ZXL A;  1XYO A;  2ZEZ A;  1DDL A;  2ZGR A;  5JOZ A;  5CAZ A;  1T2X A;  1CD3 G;  4AOC A;  3ZPY A;  1XNC A;  5FWE A;  4AXO A;  1H2L A;  1ZZ9 A;  2Q5T A;  2WAO A;  3GCX A;  1CIW A;  1XYP A;  4OUS A;  2MPF A;  4QMA A;  5I8S A;  1DQ6 A;  2HKX A;  2WSV A;  4FPF A;  4AWD A;  3I2G A;  3BUC A;  3KHC A;  4XCA A;  1QOS A;  3ILF A;  5IVV A;  2RMU 3;  3FFQ A;  4KH9 A;  2SBA A;  5FR3 A;  2JG9 C;  1RXF A;  5FZK A;  3LD8 A;  1KFU L;  2P34 A;  3P3N A;  3VKM A;  2Y60 A;  1RB8 G;  3ZXD A;  1J59 A;  5C3Q A;  1LHW A;  4FO9 A;  4YW4 A;  1HX6 A;  4BE3 A;  5FPX A;  3DPR B;  2TNF A;  3VZJ A;  3ZYP A;  1WMX A;  4O7X A;  4MGI E;  2VMH A;  3O1R A;  1RUF 1;  1O3Q A;  1R64 A;  1AYM 1;  2DUP A;  4A3Z A;  1SHW B;  1YYN A;  2NM1 A;  1NCR A;  2W9X A;  2PN5 A;  4KWK A;  4W4Z A;  2WNU A;  2W1Q A;  2O14 A;  4CCK A;  3VL8 A;  2Q8O A;  5LA2 A;  5FP9 A;  4JGZ C;  1OVS A;  4MGY E;  1REF A;  1C8M 2;  2ZEW A;  2VOW A;  3NJX A;  2B39 A;  3VD4 A;  2RS5 2;  1VR3 A;  4NWW A;  1VB2 A;  4XQ4 A;  3J8F 1;  4SLI A;  3ZSM A;  5FPZ A;  5FO7 B;  1LOE A;  1MR5 A;  1GFF 2;  5B2G B;  2W46 A;  1KFX L;  1FXZ A;  3NW4 A;  1IG3 A;  1JYT A;  1PX3 A;  1VBE 2;  2KD7 A;  3FL7 A;  3RQ0 A;  2WDB A;  3OPW A;  1ULP A;  2P3I A;  1YCI A;  4YW5 A;  1NY7 1;  3RPQ A;  1UOF A;  4DOU A;  5FDB A;  4C1W A;  3O1T A;  2K2S A;  1LED A;  1V6M A;  4UFM A;  1R09 2;  4BOW A;  5GZC A;  2H6C A;  2RS3 2;  2HYK A;  3BN6 A;  1YQ2 A;  4CDX B;  4Y22 B;  2X5I A;  4YGB A;  2HEV F;  3RI8 A;  2PLV 3;  1HKD A;  1VMF A;  2QQM A;  3VZN A;  5EP9 A;  5JIA A;  1W8U A;  1YIP A;  1KJL A;  5FY9 A;  5JI7 A;  3ZR5 A;  2E26 A;  1J84 A;  2Y33 A;  2WN3 A;  2ZGP A;  3ZLI A;  2A6Z A;  2P6H A;  2QTW B;  2TBV A;  4CUA A;  3I4I A;  4M01 A;  1G9D A;  4XUP A;  2YFU A;  3QOP A;  5H9R A;  2Q8D A;  4N7I A;  1AJK A;  1I3H A;  1W2O A;  1PO2 1;  4GWM A;  5A3N A;  5A7N A;  5LK5 A;  3PUS A;  3RI9 A;  4IEV A;  2Q1Z B;  5I0S A;  4XJW A;  1FNZ A;  4HT1 T;  2ADD A;  4PBP A;  3AL5 A;  3AVS A;  4AFM A;  1EAH 2;  3B3Q E;  4CSW A;  4LT5 A;  1O8S A;  5BNP B;  1FNY A;  3MUZ 1;  1KQR A;  2GNM A;  3ON7 A;  3T1L A;  3PU3 A;  5LBC A;  3AC0 A;  4Q1P A;  5BXX A;  5IAV A;  3OBT A;  3RZH A;  1RUF 2;  1AYM 2;  1UY3 A;  2IVJ A;  1EUT A;  3GF6 A;  4AVS A;  4O9G A;  5LK7 B;  1B09 A;  2HWF 1;  5CKQ A;  3IN9 A;  2RG4 A;  1E5I A;  3AKP A;  3C7G A;  2PFW A;  4L9B A;  5IVF A;  2LRO A;  3R4U A;  1IKP A;  3AYD A;  4Y1V A;  4EQV A;  3O1U A;  4A41 A;  3IPV A;  1QWR A;  5GKA C;  1PVX A;  1OOP C;  1WCK A;  2VE1 A;  5B4N A;  3NNF A;  3ZFE A;  3H9A A;  4UFI A;  1KRI A;  1QJU 1;  1SAC A;  3AKQ A;  1F5F A;  1LCL A;  3J8F 2;  4LO8 A;  4N53 A;  4KG0 A;  1HB2 A;  3IAP A;  2D97 A;  3GHN A;  4YW3 A;  4CCE A;  3QCW A;  3H1W A;  2UU8 A;  3O12 A;  3K2O A;  1VBC 3;  3DF0 A;  2YU2 A;  3VDA A;  5IVC A;  1BCX A;  1SEF A;  3ELN A;  3KT7 A;  4MHU A;  3SIT A;  1YEW A;  4XFB A;  3WDW A;  3FUQ A;  1CJP A;  1NY7 2;  4GUL A;  4YG6 A;  5FYS A;  3ZFG C;  1SLT A;  2PHT A;  1Z7S 3;  4XBN A;  4COV A;  1MEC 1;  4FCA A;  2PQS A;  1QJE A;  1AR6 3;  3CZJ A;  1V0A A;  1TVG A;  2IC1 A;  4XBQ A;  2VBD A;  1W2T A;  1WW7 A;  4P00 B;  1L7Q A;  2WZR 1;  1QXR A;  2JXA A;  4AQ6 A;  1VBA 2;  3IDA A;  2OPW A;  2BGP A;  4KBZ A;  1GZW A;  1HJF A;  3B9C A;  3DEC A;  5JDB A;  4PI2 A;  4XTM A;  3J7L A;  1K42 A;  1BKZ A;  5ABJ C;  4JC1 A;  4FVV A;  4GMP 0;  4RS5 C;  4DXZ A;  4HKW A;  2OQ6 A;  3KV5 A;  2VOT A;  2WQZ C;  4FOY A;  2FMY A;  1MVQ A;  2HWB 3;  3LQC A;  3VLB B;  1BLZ A;  1W9T A;  1RJ7 A;  1OUX A;  2EVX A;  2Y64 A;  1GUI A;  3CEW A;  4YM0 A;  4FTB A;  4M3C B;  4OYU A;  5A3P A;  5FMC A;  2YYO A;  4S2G A;  5GZF A;  2WWJ A;  3WQ1 A;  1PO2 2;  3V0B B;  1RUC 3;  1O3S A;  1DIW A;  1N1V A;  3VBO A;  3H3L A;  3NMB A;  5FYV A;  2WFP A;  4YLZ A;  1SDD B;  2XJS A;  2J1R A;  4XZP A;  3D5O A;  3U14 A;  5C4W C;  1NUK A;  2YU1 A;  1YLL A;  3T4H B;  1I9R A;  2CDO A;  2ZX3 A;  4CDQ A;  1YC6 1;  2OW4 A;  4LKF A;  1V70 A;  2ZS6 B;  1JZ5 A;  1HB1 A;  4LHN A;  3H7J A;  4R4Z A;  3SKJ E;  1OXC A;  2HWF 2;  5C3O A;  1ND2 B;  2GU9 A;  1GP5 A;  5FBZ A;  3LA7 A;  2DF7 A;  3OPT A;  1L7R A;  2YG0 A;  4JVA A;  2J1V A;  3RNS A;  2WNU B;  2GC1 A;  4CP1 A;  5CU1 A;  4WM8 B;  4CPB A;  3LA3 A;  3O14 A;  2ZHN A;  1Q5O A;  4N7U A;  5FXX A;  3MYX A;  5GZD A;  5LRS A;  1OQE A;  4K9S A;  4EJR A;  2ZGT A;  4LBQ B;  1QJU 2;  1QF3 A;  4FQZ A;  3WP4 A;  4ATE A;  3LFM A;  3BIE A;  3DXT A;  4DY5 A;  3H50 A;  2HEY F;  4IV1 A;  3DCQ A;  1W3V A;  2VCA A;  3TYJ A;  1A78 A;  4UF0 A;  4YAR A;  2QVS B;  1H4G A;  1OD5 A;  2XHK A;  3AMN A;  5FZ0 A;  2JKX A;  4LMF A;  1JYW A;  1IHM A;  3WG3 A;  3AYE A;  2VD7 A;  2BNO A;  4IE6 A;  1BBT 1;  3LOB A;  4LBN A;  4WV8 A;  5AC9 1;  3LIH A;  2WZR 2;  5J98 B;  2EIE A;  4GAZ A;  4GKY A;  2RR1 3;  3OUI A;  5C8W A;  4PDW C;  2VZS A;  4GH4 B;  1WLT A;  1D0G A;  4Z2A A;  1CPN A;  1JUI A;  4LO6 B;  4FFH A;  4ATF A;  2A3Y A;  4CDU A;  3KCY A;  1OBN A;  2V4V A;  5LA0 A;  5FQ0 A;  3S7E A;  4ZPI A;  2DUR A;  2E7Q A;  4AI0 A;  4CP2 A;  4CZS A;  4RN5 A;  4Q26 A;  1VB4 A;  4XJU A;  5CYY A;  1PGW 2;  5C8C C;  1B35 C;  1EYB A;  3N7L A;  2VMD A;  3H8U A;  1CR7 A;  3RJ2 X;  4AFB A;  3AZY A;  4OUE A;  4BXS V;  2RMU 1;  3AM2 A;  5FWJ A;  3OCP A;  4FXG B;  4XDO A;  4OMC A;  1MS3 A;  4C0B A;  5F37 A;  4PBO A;  4ZU5 A;  1ULF A;  5FXW A;  5FUI A;  2QCS B;  2E7T A;  4KGG A;  1JYI A;  3S5Q A;  4A7K A;  5JVV A;  3CL1 A;  2BTV C;  1SCS A;  4LPL A;  3ACL A;  5DUW A;  4HLT A;  5HCA A;  3TWI A;  1LTE A;  4RHV 3;  2LS6 A;  1RXG A;  1OQ1 A;  2EAL A;  2P3K A;  1UIJ A;  2E53 A;  5DG2 A;  2VZP A;  3OPZ A;  1UYZ A;  4NR1 A;  1D0H A;  4OLL A;  5DAX A;  4QHB A;  5FK7 A;  5T52 A;  3TB0 A;  2JWP A;  1SCR A;  4A4A A;  4B7K A;  4F3J A;  5DAQ A;  1LU2 A;  2D7F A;  1CN1 A;  4S2H A;  5A3T A;  1CAW A;  1OVP A;  4AQ2 A;  4B1M A;  4YSF A;  3VDD C;  4GXL A;  5FZC A;  2DTY A;  4UW4 A;  5JIU A;  3HNB M;  5LBB A;  1K5J A;  1UZY A;  3NRU A;  3WG2 A;  2ZKN A;  4YM1 A;  5IVY A;  4AQT A;  4NJ4 A;  5JMC A;  1DLC A;  5HI0 A;  2WA3 A;  3BOP A;  4Y33 A;  4QPI A;  2ZA9 A;  3X29 B;  2ARA A;  4HSJ A;  1CJD A;  3NKG A;  5FZH A;  1BBT 2;  3BVC A;  5JZG C;  4IEW A;  4CA9 A;  5JSR A;  2BWC A;  3J9S A;  1TME 1;  5AC9 2;  4AED B;  3CF6 E;  1MS0 A;  4IQP A;  2ORZ A;  2R04 2;  3OEA A;  1XYN A;  4H14 A;  4IV3 C;  5C4W A;  3V64 A;  3WF2 A;  5KHJ A;  2RDR A;  4AK3 A;  3VUO A;  2B8M A;  4ASK A;  1GOH A;  2QNK A;  5T3N A;  3KM5 A;  4IER A;  2WZ8 A;  1DFQ A;  3HJR A;  4QDQ A;  5EJ3 A;  3U1X A;  1A34 A;  3QAC A;  4XXA A;  3WV6 A;  4MUV A;  1EV1 1;  3T4V A;  1OPO A;  1RUE 3;  1W3X A;  1ND3 C;  3CHX A;  4WM7 A;  5DAV A;  5F1R A;  1VBD 1;  1YRZ A;  5D1I A;  1DQ2 A;  2RJL A;  1EP0 A;  2W0X A;  2IWG B;  3VBU A;  2FDK A;  4EN0 A;  2WWS A;  4UT5 A;  4F7Z A;  3D3A A;  1LOF A;  1RVF 1;  2YFZ A;  4NHK A;  3LIG A;  3B5L B;  5CB7 A;  3POY A;  4QXH A;  1RYY A;  2VL4 A;  2YPJ A;  3ZN6 B;  1UMZ A;  4IXL A;  5T54 A;  3OSD A;  1UY2 A;  3ZXJ A;  1DGW X;  2VAU A;  5FKC A;  1W6P A;  4YVW A;  5A3M A;  5C9A C;  2BWA A;  2ES3 A;  3POI A;  4U2A A;  1RTV A;  2VVE A;  4GA9 A;  1IPJ A;  3WDV A;  4CCN A;  4XJ9 A;  5LA9 A;  2VTF A;  5JWP A;  1PGS A;  1NLR A;  1UWW A;  2QZ3 A;  4OI0 A;  3MIG A;  2F6B A;  1MQT C;  4YG0 A;  5F5C A;  3NNL A;  3B69 A;  3PVE A;  5LA1 A;  3ZOI A;  3IT8 A;  1C8M 3;  2K46 A;  3GXU A;  4XPV A;  2RS5 3;  5C6C A;  1UY0 A;  1SZB A;  3PDQ A;  1PMH X;  3E5U A;  4RL7 A;  3S7I A;  1L7L A;  1URX A;  1YIF A;  2ZCW A;  2NN8 A;  2Y6K A;  3BAL A;  4JCK A;  4ZKT B;  3RSJ A;  4BIS A;  1GNY A;  1H2M A;  2F17 A;  1G9C A;  3K46 A;  1ZRD A;  1HB4 A;  2OXB A;  2VU9 A;  4JGY C;  5J3U A;  4ZS3 A;  3H1Y A;  1LJ7 A;  1S0G A;  4HAN A;  3RWN A;  4AGV A;  1GZT A;  1VBE 3;  3ZSK A;  2EIB A;  1CQ9 A;  1DU3 D;  5F7U A;  1XQN A;  1MS1 A;  1OFN A;  1R09 3;  2YBK A;  5DXD A;  5BNO C;  5G05 L;  1V6O A;  2FZ2 A;  1VBC 1;  1RUN A;  1HN0 A;  2A3W A;  2RS3 3;  5AVP A;  2VMF A;  1TME 2;  4HPK A;  5KHK A;  2R49 A;  1Z7S 1;  4L11 A;  1W04 A;  4BQY A;  1XE7 A;  2RM2 1;  3ZFF B;  2RDN A;  4XIL A;  1UZV A;  2VOV A;  2ZKL A;  3H42 B;  1S2E A;  1AR6 1;  4NWV A;  4XQW A;  5CIR A;  4ZS2 A;  5FV3 A;  2ZX1 A;  3HBZ A;  4N43 A;  1W0N A;  2D93 A;  1S2B A;  1VRB A;  2Z4F A;  2XJR A;  1ENX A;  4I2O A;  5IK4 A;  3DPR C;  1EV1 2;  4GIQ A;  1QJX 1;  4CDU B;  5A80 A;  2A71 A;  3WNM A;  1CAV B;  1VBD 2;  3GGL A;  4BK4 A;  4TXW A;  5FQ0 B;  2HWB 1;  2WZE A;  1N1T A;  1OPM A;  2OS2 A;  4Q0P A;  1H0B A;  1MS8 A;  2E7A A;  1RVF 2;  2PXJ A;  3ACI A;  3M3C A;  1EAH 3;  5FZ6 A;  5I0U A;  4A44 A;  1GQP A;  1AR8 2;  1RUC 1;  4ZU7 A;  1OLQ A;  2WC2 A;  2A5Z A;  3OOX A;  3ORJ A;  1LHU A;  3ZKU A;  1A6C A;  3Q8F A;  1W05 A;  3WNK A;  5J09 A;  1DYK A;  2BOJ A;  2VCB A;  2IXI A;  4JDO A;  3AFK A;  1AYM 3;  3G7D A;  4AZZ A;  3ZYB A;  4URT A;  1WA4 A;  3TEW A;  1NCQ C;  4P5H A;  3EBR A;  5FZ8 A;  1GOF A;  1CON A;  1ST8 A;  3H0O A;  3KV6 A;  3OUJ A;  3RFR A;  1AX2 A;  1O4Y A;  3E6D A;  4FFF A;  5DPN A;  4AHX A;  2FCV A;  3I3Q A;  3VZO A;  2ZML A;  1VE0 A;  3I59 A;  4Q0U A;  3J8F 3;  5E1R A;  4CDX C;  5BNN A;  5HV4 A;  3HQU A;  4HKL A;  2VNO A;  1SG3 A;  2XG3 A;  4MGQ A;  3HBK A;  4I0W B;  4P14 A;  3TRS B;  2ZZJ A;  2JDZ A;  2RHP A;  4LBJ A;  1ZA7 A;  4ZU4 A;  1C1L A;  3FUO A;  4Q0V A;  1UO9 A;  3FZ3 A;  2HWD 1;  3B94 A;  3U4X A;  2VCM A;  2UWA A;  3ST7 A;  2OPK A;  1LHN A;  1EPZ A;  4GWI A;  5FLJ A;  3B02 A;  4DIN B;  4TWT A;  2GAL A;  3KV4 A;  4CUG A;  4QX0 A;  2XVK A;  1ULO A;  4IET A;  4XMA A;  2E6V A;  3IMM A;  2BV4 A;  5BY5 A;  3TOJ A;  1J83 A;  2R32 A;  4FTE A;  4XIO A;  3O1V A;  1VBA 3;  1OHF A;  1Z7S 2;  3VZL A;  2RM2 2;  4A7Y A;  1WW5 A;  4CU9 A;  4TSV A;  2VM9 A;  3J7M A;  1AR6 2;  1UZW A;  3BIW E;  4HFS A;  4ERO A;  2D43 A;  2GZW A;  5F3E A;  2FDJ A;  1IGO A;  2P37 A;  5FZB A;  5BNP C;  1UAI A;  3L2H A;  3WLU A;  2RR1 1;  1QJX 2;  5I91 A;  3ATG A;  3BU7 A;  3PUI A;  1LOD A;  5CKN A;  4RA0 A;  3NNG A;  3DL3 A;  3Q9O A;  4AI3 A;  1PO2 3;  4WM7 B;  4OHY A;  3A22 A;  3ZDS A;  3ACG A;  2ARE A;  4PIZ A;  4WZF A;  3LCP A;  1ZBE 1;  4FTS A;  2D98 A;  2PHU A;  4P9G A;  4CRQ A;  3VBU B;  2WIN B;  1OH4 A;  5D8A B;  5L7O A;  1RUC 2;  4LR4 A;  1PMJ X;  5EYY A;  2WNV A;  4HET A;  3ZVX A;  4XFF A;  2CSG A;  3ZXA C; 
#chains in the Genus database with same CATH homology
 2VZO A;  4LKS A;  4ET7 A;  2J1U A;  2YC2 A;  2X10 A;  3C7H A;  4E8D A;  3HNM A;  3C7F A;  2WBK A;  2QQI A;  1R64 A;  4FI9 A;  3W5N A;  4A3Z A;  1IQD C;  1SHW B;  3K75 B;  4DEV A;  2W9X A;  4W4Z A;  3ACH A;  2W1Q A;  2W94 A;  4CU7 A;  4M4P A;  1W9S A;  3I2J A;  5LA2 A;  1XNT A;  2ZEW A;  3NJX A;  3VD4 A;  1UY4 A;  2C26 A;  3FHQ A;  2WYS A;  5LCW L;  3I97 A;  5IFT A;  2W46 A;  2HYX A;  5DMY A;  2OKX A;  1UX7 A;  1O8P A;  1PX3 A;  2KD7 A;  3FL7 A;  2WDB A;  1ULP A;  2X09 A;  3WF1 A;  3CQO A;  1JZ6 A;  1JYV A;  5HXM A;  4QB6 A;  5JMO A;  3LPG A;  3W5M A;  3BN6 A;  4ARY A;  4CVU A;  3F2Z A;  1YQ2 A;  2QQM A;  3ECQ A;  1NX9 A;  2VZU A;  1DYO A;  4UAP A;  2E26 A;  1J84 A;  2WN3 A;  5B4X A;  1UMI A;  1US2 A;  3WQB A;  4CUA A;  4QX2 A;  4DXS A;  3LEG A;  3MBW A;  4XUP A;  1UXZ A;  2YFU A;  1OD3 A;  5C70 A;  2J1E A;  2XON A;  4D0Q A;  3GM8 A;  2Y6H A;  2QQO A;  3NQH A;  1CX1 A;  4IUG A;  5G04 L;  5JR2 A;  2W87 A;  3ABZ A;  3WNL A;  3HPN A;  1O8S A;  3U37 A;  4MAD A;  5IHR A;  5J1X A;  1K12 A;  3MUZ 1;  3ZM8 A;  2VZ3 A;  4OMD A;  4QDS A;  3SKV A;  3AC0 A;  4DXT A;  3EB7 A;  3SEP A;  1UY3 A;  3MUY 1;  1EUT A;  1JZ8 A;  3SEE A;  3K4Z A;  1KEX A;  3FN9 A;  5C7G A;  2Y6L A;  3C7G A;  4P08 A;  4QPW A;  3T0A A;  4A41 A;  2QBX A;  5B4N A;  1WCQ A;  1DP0 A;  3OB8 A;  5EJ1 B;  5EIY B;  2JE8 A;  3THC A;  1H6X A;  3T0B A;  1JYX A;  3C7O A;  3IAP A;  1WKY A;  2WO2 A;  4PT6 A;  2C4X A;  3VD3 A;  3VDA A;  2W1W A;  1UY1 A;  2BBA A;  1F4H A;  2PQS A;  3CZJ A;  1US3 A;  1TVG A;  4DEQ A;  4GWJ A;  4P00 B;  1L7Q A;  4XZU G;  4CU8 A;  3HNY M;  4D8M A;  2Y6J A;  3IDA A;  2BGP A;  1PX4 A;  3DEC A;  3WF3 A;  4QB1 A;  1K42 A;  3C7E A;  2WAA A;  2L9L A;  4CUC A;  2VOT A;  4MO3 M;  3K77 A;  4XUQ A;  1CZS A;  3LQC A;  1KGY A;  1W9T A;  1JU3 A;  2ORX A;  2Y64 A;  3OEB A;  1GOG A;  1GUI A;  3LEI A;  3MO4 A;  4OYU A;  4KWU A;  3T0D A;  1XC6 A;  4BDV B;  1H6Y A;  4A6O A;  3HOB A;  2WN2 A;  4QB2 A;  1SDD B;  4PQQ A;  3E1F 1;  3THD A;  2J1R A;  2WUH A;  4QX1 A;  1NUK A;  4BJ0 A;  2CDO A;  2VZ1 A;  4MOA A;  1JZ5 A;  4ARX A;  2VME A;  3SKJ E;  4L0P A;  5JUV A;  4OZO A;  3WEZ A;  1JZ3 A;  1L7R A;  1XNA A;  1CZT A;  2YG0 A;  2J1V A;  4E8C A;  5DN2 A;  1F4A A;  3T2Q A;  3I2K A;  1P8J A;  4ZZ5 A;  2W92 A;  2VQT A;  2LW8 A;  3NJV A;  2VCA A;  1CIY A;  2BER A;  4TTG A;  2XHN A;  3LEK A;  2W91 A;  3FHA A;  1BHG A;  5HPO A;  3I2H A;  2JKX A;  4UI9 L;  1JYW A;  2VR4 A;  3DYO A;  1EUU A;  2J1T A;  2VZR A;  2XOM A;  1W8N A;  2W1S A;  2VCC A;  2EIE A;  2ID4 A;  2QQK A;  4KI5 M;  1CZV A;  2VZS A;  4Z2A A;  2B9V A;  3I3D A;  1UZ0 A;  2V4V A;  5LA0 A;  2RV9 A;  4ZXE A;  4DUW A;  4LQR A;  2RJ2 A;  4RN5 A;  2VQU A;  2J1S A;  5CYY A;  1UMH A;  2VMD A;  2WQ8 A;  3IB3 A;  3CMG A;  4XUR A;  1UXX X;  1I5P A;  4JX0 A;  4W50 A;  4BXS V;  4OUE A;  1GU3 A;  4OMC A;  1W8O A;  3UES A;  3T08 A;  5FUI A;  1OT5 A;  4PF1 A;  2BZD A;  4LPL A;  3A23 A;  3IAQ A;  2LS6 A;  2Y6G A;  4P02 B;  3MV1 1;  2VZP A;  4KMQ A;  3WNP A;  1UYZ A;  2BGO A;  2E33 A;  2WAB A;  4YPJ A;  1W9W A;  4ZZ8 A;  4A4A A;  1JI6 A;  3T2O A;  5C71 A;  3UNP A;  4HG6 B;  3UET A;  5JXJ A;  4XUO A;  4A42 A;  5JXI A;  3DYP A;  3HNB M;  1JZ7 A;  3NRU A;  1DLC A;  3OBA A;  2CDP A;  4XUN A;  1JZ4 A;  1GMM A;  2VZV A;  3ETP A;  3GDB A;  2XQX A;  2W3J A;  2W95 A;  2WO3 A;  2ORZ A;  3OEA A;  4CUB A;  3WF2 A;  4JKL A;  1GOH A;  1JHJ A;  4RYD A;  2WZ8 A;  3HJR A;  4QDQ A;  4JKM A;  3EYP A;  1XPW A;  3J7H A;  1UYX A;  5JXH A;  2ZEX A;  2ZXQ A;  3CKH A;  2E32 A;  5A1A A;  4GZ9 A;  2QQN A;  3D3A A;  2YFZ A;  3HN3 A;  4M4R A;  4QAW A;  1RYY A;  2VL4 A;  3CDZ B;  1UY2 A;  3I2F A;  3P1I A;  3A21 A;  3VD5 A;  3WF0 A;  3LE0 A;  1JZ2 A;  3OGV A;  2VC9 A;  2VO5 A;  2VTF A;  3LPF A;  1UWW A;  4DUV A;  3WF4 A;  1JYN A;  5LA1 A;  2W5F A;  1NKG A;  4ZY9 A;  3GXU A;  1UY0 A;  1PMH X;  3WNN A;  3I3E A;  2Y6K A;  3P6B A;  2X05 A;  1GNY A;  5IFP A;  2V72 A;  2VZT A;  3K46 A;  3WNO A;  3WSO A;  4QX3 A;  2W1U A;  4BK5 A;  1K45 A;  2DDU A;  4P5Y A;  3JXS A;  3III A;  2C9K A;  3DYM A;  2EIB A;  3CZU A;  5F7U A;  5G05 L;  2YB7 A;  2E31 A;  2VMF A;  4JHZ A;  3OGR A;  1LNS A;  1JU4 A;  2J7M A;  2J22 A;  1NAE A;  1W0N A;  2HLE A;  2Z4F A;  5CZK A;  5DQ0 A;  2JD9 A;  4XUT A;  4AAX A;  3WNM A;  5EJZ B;  1K3I A;  3GGL A;  4BK4 A;  4TXW A;  2QQJ A;  3I2I A;  2WZE A;  3ACI A;  3VDB A;  3C8X A;  1GQP A;  3A7Q A;  4A44 A;  2YC4 A;  4XVH A;  1OF4 A;  1HN1 A;  5IJR A;  1UYY A;  3WNK A;  1MPX A;  1W99 A;  2VCB A;  2VJX A;  5JXG A;  1GOF A;  3I3B A;  3PUH A;  4DUX A;  1D7P M;  2JDA A;  1O59 A;  3ACF A;  5DPN A;  4DXR A;  1TG7 A;  4JKK A;  2ZEY A;  1SG3 A;  4MGQ A;  3T09 A;  2VMC A;  4CU6 A;  2DCK A;  2V5D A;  2EID A;  3K4A A;  4GWI A;  5I0D A;  3OGS A;  2EIC A;  3OG2 A;  4UOJ A;  3MV0 1;  4A45 A;  3T2P A;  2WO1 A;  4QDR A;  4QX0 A;  4W8J A;  1ULO A;  4LHS A;  3VDC A;  3VD9 A;  2J1A A;  3VD7 A;  1J83 A;  2RVA A;  2Y8K A;  4CU9 A;  2VM9 A;  2QQL A;  5IYY A;  3BGA A;  3HEI A;  3CIH A;  2W47 A;  2B4K A;  2VZQ A;  4AG4 A;  3PUI A;  2DCJ A;  2ZEZ A;  2R7E B;  3NNG A;  1T2X A;  3A22 A;  3ACG A;  2WAO A;  1OF3 A;  3I2G A;  3K4D A;  1OH4 A;  1PMJ X;  4MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...