1UMIA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
GSHFYFLSKRRRNLLRNPAGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box only protein 2
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed rcsb
source organism Mus musculus
molecule tags Ligase
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umiA00
4XUPA 1JU4A 1BHGA 1UY1A 1J83A 3NNGA 2QQMA 2YG0A 2L9LA 3IDAA 3NRUA 2VMCA 3THCA 3MBWA 2C26A 3A7QA 1OD3A 3ACHA 3SEEA 1UXZA 2YFZA 4BXSV 5DPNA 5IFTA 1CX1A 2V4VA 1UZ0A 2WQ8A 3MO4A 1JZ6A 3E1F1 3HOBA 2J7MA 4OMDA 4XVHA 2YC4A 3LQCA 2WN2A 3C7FA 1PMHX 5I0DA 4A6OA 4BJ0A 4BK5A 1UX7A 3K4AA 4JHZA 1W9WA 2W47A 4P5YA 2W92A 1US3A 1UMIA 3VDBA 2VZRA 2R7EB 5LA1A 2E26A 3GDBA 1KEXA 3P1IA 2QBXA 2Z4FA 2C4XA 4M4RA 3LEGA 3ZM8A 2VZPA 1US2A 4A4AA 2YFUA 3I3EA 2VZQA 3ETPA 5EJ1B 2ZEXA 4BK4A 5EIYB 1SDDB 4QB6A 3WF0A 1PX4A 3EYPA 4W50A 4YPJA 3ECQA 1J84A 1UMHA 4ZZ5A 4A45A 3HNMA 3C8XA 2YB7A 3DYOA 3WNLA 2VR4A 4BDVB 4TTGA 5LCWL 2VO5A 2RVAA 4P00B 2WDBA 3A22A 3WF4A 2QQNA 4MGQA 3AC0A 4DEQA 2QQLA 2VCCA 4ARYA 4JX0A 1I5PA 2Y6HA 2VZOA 4DUVA 2QQJA 1ULOA 1GOHA 2J1SA 3T08A 1CZTA 3I2FA 1W99A 3SKJE 2VCAA 4AG4A 5JXJA 1JZ4A 4Z2AA 2VQUA 2W1QA 2VZVA 1DP0A 1SG3A 3I3BA 2VL4A 3K77A 1UYYA 5G04L 1PX3A 3ACGA 3T09A 3ABZA 3I2GA 4L0PA 4A3ZA 3HN3A 4P02B 5J1XA 2HLEA 4MO3M 2W3JA 2J1AA 2VMEA 2ID4A 2ORZA 1GNYA 4GWJA 3T2OA 5CZKA 5JMOA 2VZUA 2WZ8A 2W91A 4CU6A 2W1SA 1O59A 1H6XA 3C7HA 4A44A 1UY2A 3WF2A 4QDQA 3WNOA 3GGLA 4PT6A 1O8PA 3WNKA 3MV11 5CYYA 3T2PA 1UYXA 3OGRA 3LEIA 3VDCA 2RV9A 5DMYA 3DECA 4QDRA 3NJVA 2VZSA 1JYVA 3P6BA 3VDAA 1NKGA 3VD7A 5G05L 3CQOA 2XOMA 1OH4A 3WNPA 1UYZA 2QQIA 1K42A 5IHRA 2E33A 2VZ3A 1NUKA 2J22A 3K75B 1R64A 2B9VA 2Y6GA 3LPGA 3OG2A 1GU3A 3D3AA 1UY3A 1L7RA 3DYMA 3T2QA 4QAWA 2CDPA 5JXIA 2RJ2A 4CU7A 2CDOA 4W4ZA 2W9XA 1WKYA 3OB8A 3OGSA 1LNSA 1EUTA 3FN9A 4QX2A 2W46A 4DEVA 4M4PA 2XHNA 1JU3A 3WNNA 1H6YA 3OEBA 3OEAA 2WN3A 3ACIA 2VJXA 3HNBM 3I3DA 5IJRA 3VD4A 2VQTA 2JDAA 2WAOA 3OBAA 4OMCA 1RYYA 3ACFA 4PQQA 4D0QA 3K4ZA 4XUOA 2ZEWA 3VD3A 4XUQA 3IIIA 2V5DA 1T2XA 1CIYA 1JZ5A 1UXXX 4CU9A 3CMGA 1UWWA 4A42A 3UESA 2X10A 5JUVA 2Y6JA 3T0DA 1W8NA 2WAAA 3HNYM 3WSOA 4CVUA 1YQ2A 1JYNA 2DCKA 2C9KA 2ZXQA 1JZ8A 4DXTA 2ZEZA 4KMQA 3JXSA 4QPWA 4W8JA 1XC6A 1IQDC 4ZXEA 1NAEA 1W9TA 2PQSA 1JYWA 2HYXA 2OKXA 5C7GA 3UNPA 2W87A 3LEKA 4ZY9A 3C7OA 2VC9A 4ARXA 2BGPA 2BGOA 3EB7A 1UY0A 4DXSA 2XQXA 5B4NA 2BERA 5LA2A 2EIDA 5EJZB 2EIBA 1GUIA 4LQRA 4DXRA 3NQHA 5C70A 4AAXA 4XUTA 2JKXA 1OT5A 3U37A 4QB1A 3LPFA 3K46A 5HPOA 3VD5A 1CZVA 4E8CA 2WO2A 3I2IA 4PF1A 1XNTA 1OF4A 3CIHA 3CDZB 2WABA 3PUHA 1GMMA 4KI5M 5DN2A 3VD9A 5LA0A 2W5FA 3W5NA 2EICA 3WF3A 3CZJA 4GZ9A 4JKMA 3FHQA 4QX3A 2E31A 1JHJA 4P08A 2J1VA 5A1AA 4TXWA 2E32A 2J1RA 3I2KA 3LE0A 4XZUG 3C7EA 1JI6A 2WO1A 1K3IA 4D8MA 2BZDA 5JR2A 4OYUA 4QB2A 4IUGA 1GOGA 4XURA 2J1UA 4OZOA 4GWIA 3GXUA 5IYYA 2LW8A 2KD7A 1UY4A 2WO3A 2XONA 3MUY1 2JD9A 3FL7A 2QQKA 3I2HA 1P8JA 2VZTA 2QQOA 2Y64A 4RYDA 4MOAA 1K45A 3HPNA 1XPWA 2X09A 2VOTA 3K4DA 4LPLA 3CZUA 1W9SA 1WCQA 2W1WA 5JXGA 4DUXA 4QX1A 2WBKA 1MPXA 1PMJX 4CUBA 2V72A 2J1EA 3I2JA 3F2ZA 5HXMA 2VCBA 1O8SA 1F4HA 3WEZA 3T0BA 3THDA 4CUAA 2WUHA 2BBAA 2Y6LA 2EIEA 1KGYA 2WZEA 3SEPA 2J1TA 1K12A 3IAPA 3J7HA 1F4AA 4KWUA 5F7UA 4MADA 3C7GA 1GQPA 1L7QA 5IFPA 2Y8KA 3WNMA 4OUEA 4JKLA 4A41A 3WQBA 1ULPA 2W1UA 2VTFA 1TG7A 1DYOA 3HJRA 4QDSA 4HG6B 1JYXA 2W94A 2VZ1A 4E8DA 2B4KA 4UOJA 1OF3A 2DDUA 4CU8A 1D7PM 3OGVA 3MUZ1 2LS6A 3IB3A 4DUWA 3W5MA 3BN6A 3DYPA 4RN5A 3HEIA 4MGSA 4QX0A 1JZ7A 4LHSA 3IAQA 4JKKA 2X05A 1HN1A 3A21A 1JZ2A 3UETA 3GM8A 4CUCA 1EUUA 4ZZ8A 1GOFA 1W0NA 4UI9L 3BGAA 2VMFA 1JZ3A 5JXHA 4ET7A 3NJXA 4UAPA 3WF1A 3A23A 1NX9A 1SHWB 3FHAA 3MV01 4FI9A 5DQ0A 2W95A 2WYSA 5FUIA 5C71A 2JE8A 2ORXA 2Y6KA 1CZSA 2ZEYA 1W8OA 2VMDA 3SKVA 5B4XA 1XNAA 1DLCA 2DCJA 3I97A 4LKSA 1TVGA 2YC2A 2VM9A 3PUIA 3T0AA 4XUNA 3CKHA
chains in the Genus database with same CATH superfamily
1OA3A 1V6JA 1S0JA 3BTXA 1JU4A 1GV9A 2VOVA 4WVMA 1VB2A 2ILMA 3B93A 3NNLA 4KG0A 2RS32 2YG0A 3MIBA 2P5BA 2L9LA 2EA7A 5EXOA 3NRUA 2VMCA 4XFFA 3TEXA 3T4HB 4AQTA 3BTZA 3WT3A 4KH9A 1YFWA 2A75A 2C26A 2ZGOA 3PUAA 1ZZBA 2RMU2 3A7QA 3WDTA 3ZDVA 4HONA 2YROA 3SEEA 3KT1A 2E53A 2YFZA 1SZBA 5F32A 4DINB 4E27A 1CX1A 3VBOA 5BNNB 2QTWB 2WQ8A 1RUF2 1WA6X 4IETA 4K20A 2J7MA 4XVHA 4I01A 4AEMA 3POFA 3LQCA 3C7FA 3I4IA 4LKFA 2WWSA 3JD72 5FZHA 2XLFA 1X9PA 4XW3A 2RR13 2XLAA 2C0ZA 4QQ2A 2MEV3 3POYA 3WP5A 4QGNA 3H50A 2PQQA 2YGLA 1W9WA 4CCDA 1HJGA 1MVQA 1JW6A 4TZDA 4P5YA 2W92A 4PI2A 1YFYA 1NOVA 1RVF3 2DUPA 1YIPA 2E9QA 3ZYJB 1C1LA 2XMLA 1TEIA 2SLIA 2Y33A 1WMDA 1ULEA 3AX4A 1XE7A 4SBVA 3T1MA 2NM1A 4BE3A 4GAZA 4DMIA 1RUI1 2OVUA 2QVSB 5FYIA 3MW3A 1QQP1 1TNRA 3NAPA 4HN0A 4Y5SA 3ZM8A 5CFDC 4UW6A 3SH3A 2VZPA 5I91A 2W0XA 2DWRA 3M2MA 2JDYA 3AJYA 3KD4A 4Y22A 4FBFA 3O1RA 3CJIB 1ODNA 3ETPA 1W06A 4Q4X1 4DRRA 2ZGPA 3ASIA 3ZXGA 1UZVA 1MACA 2ZACA 2H0BA 3KF3A 1UF2C 1SDDB 1FPN3 2MHFA 3N7KA 4IV1B 2CWSA 3WF0A 5EIYB 2FCTA 1G9FA 1PX4A 1XXNA 3VBSA 2XUMA 3ECQA 1J84A 2X8KA 4ZZ5A 4A45A 2QZ2A 3HNMA 4OHZA 2B42B 2Y6FA 3C8XA 4LK7A 1IKPA 2R32A 3J4UH 3MPBA 4LBNA 5LBFA 4B3NA 1ZM1A 4TTGA 1K5MB 3ZFFB 1DQ2A 2MEV2 3A22A 1BYHA 2RHPA 4CDXB 4E4HA 4EROA 4QKNA 2QQNA 2E7QA 5SV5A 4J1XA 1GR3A 2XJTA 3WG3A 3OY8A 2Y6HA 2A6XA 1RVF2 1NZIA 2EALA 1E5HA 2QQJA 2HJIA 1V70A 3T08A 5KXDA 3N9QA 1RMU1 2GC0A 4E2GA 4HOOA 3ZXDA 1ZRDA 4AG4A 4B8EA 4IEYA 4XE9A 5CFCA 4XC9A 3KLSA 2JE9A 4QPIC 3K77A 1UYYA 4X8PA 4YVWB 1E5IA 2Y26A 1YIFA 1WD3A 4BIFA 2CYFA 5GZCA 2GAUA 4L2NA 1UKRA 3I2GA 4A2UA 3DGTA 1VBC3 1FPN2 2XQRA 4AVTA 4P02B 5J1XA 1Y7BA 3IDCB 4COWA 4QMAA 1Q8VA 3AZYA 3KT4A 4RS5C 1OKOA 2GU9A 4CEYC 2XBO3 1OVPA 4XJ8A 1JHNA 4FOQA 3VN4A 3POJA 3IT8A 2Q8EA 3ME2A 1SFYA 1GQHA 3NW4A 3FLPA 4E2SA 4OHYA 4XBLA 3IPVB 2OT7A 1Q56A 4D6QA 2W1SA 1H9WA 3C7HA 4IEWA 3SCFA 3W21A 4D69A 4COUA 1TMF1 1ZYBA 1VIWB 3M3QA 1HQNA 5L73A 3WF2A 1QOTA 4P9YA 3GGLA 1NE4A 1LEDA 1JH5A 1VRH2 3MV11 3I2OA 2G9GA 1W8UA 1ENSA 1V6KA 3NVCA 1MR5A 4AEKA 1W2TA 4RGGA 1XYNA 2YXSA 2ZCWA 2JIJA 1WLDA 2R30A 1DBNA 3NJVA 1AR91 5DG2A 2WQ4A 5EP9A 2GN7A 1NA1A 1JS9A 1W8FA 2PHFA 1VBC2 4I30A 3DF0A 3FC0A 4F83A 2YU1A 5A7SA 5FPLA 1U5IA 1NKGA 2G9ZA 4UFIA 3ZN6B 4CDUC 5CFDB 1CPMA 1B09A 4ATFA 1I3HA 2A5ZA 3W59A 1H8VA 3NNFA 1OH4A 3WNPA 1DDLA 2XBO2 4RFT0 1UYZA 2HBTA 4OLLA 1VBE3 2IC1A 1CAUB 3M7AA 3MFAA 4NRQA 1QWRA 2HWF1 5IHRA 1G9BA 2WNEA 2J22A 2HWC1 1LOCA 3TNQA 2Y6GA 5CA6A 1NXMA 3DEMA 3WG4A 3OG2A 1ULFA 4FFIA 4NHXA 3KVBA 5FYBA 3QACA 3POSA 3SCHA 1FOD1 1SCRA 4A7KA 5CADA 1RUC2 2Y34A 3IN9A 4QD2A 4R52A 1A78A 5FLHA 3O1MA 1BQPA 1HRV3 4JGYA 5FTTC 1O3QA 3T2QA 1E5RA 3WQ1A 4QAWA 4M01A 2CDPA 3I2DA 2VUDA 3DPRC 2RJ2A 4XBNA 3SHRA 1WD4A 3QCWA 3ZSKA 1W6QB 2B9UA 2HEVF 1GWMA 2RJLA 2V09A 3OD0A 3TYJA 1ZBA1 2OX0A 2Y38A 4YW5A 5CBLA 2H6CA 1DQ4A 1EUTA 3WCSA 3FN9A 3ZXAC 4QX2A 2W46A 4Q1RA 4FQ4A 2XHNA 4WVVA 4HKWA 1L7LA 3AYAA 1W6MB 3H8OA 3BTYA 4PIYA 4KU8A 2XKPA 3HQUA 1FMD1 3VD4A 5IJRA 1C3HA 4RQPC 1FNZA 3ZYFA 3KT7A 3AVSA 2A3WA 1J1LA 4MSVA 4ZONA 3WG1A 1RYYA 3B69A 3HQXA 2RS51 3ACFA 3BVCA 4ORFA 2HEWF 5GZEA 4D0QA 3K4ZA 4KBZA 3KV6A 3DV8A 4XUQA 3IIIA 4CU9A 3CMGA 5H9SA 1C8M3 1OLQA 4ASLA 3UESA 2NMOA 2V5YA 1PZ7A 1UZYA 4FTSA 1MQTC 2CSGA 4JGZC 5ANQA 3ZMNA 2Y6JA 2J42A 1QDOA 4K1ZA 1NLRA 1LHUA 4M3CE 4RS5B 3MZHA 2D44A 4CEYB 1AL23 3VKMA 4Y1VA 2WT2A 1HRV2 2K46A 1JZ8A 3PU3A 1G9AA 4G9SB 4DXTA 2X5IC 3AFGA 2ZEZA 4M3CB 4KMQA 5DXDA 2ZPXA 2UURA 4QPWA 4QKDA 4W8JA 2JG8C 3B9IA 5FUPA 1RHI3 1NAEA 1HB1A 3ZPYA 2JECA 1O4YA 1PIV1 1UL9A 3LD8A 4X8NA 1JYWA 1ND3C 2GC3A 3QLQA 4BYYA 2HYXA 5C7GA 3UNPA 1UN1A 4YRDA 2Z5WA 1OD5A 4PLOA 5FY1A 5LK5A 1IPJA 2WZR1 4GJZA 4NE9A 3KHCA 4KBBA 4CP0A 2ADEA 1W05A 1KDKA 2C9AA 3EB7A 2JDNA 3IZOA 4Q8LA 1R091 4FXKB 4PI0A 1ZZ6A 4NWVA 2FZ2A 2XQXA 5B4NA 4Q5OA 4UW4A 2R041 3EJKA 4XF0A 2ZA9A 4QXHA 3M70A 5L7OA 1C8M2 5F3GA 4LQRA 4DXRA 5EJ3A 5C70A 4NIHA 2D6OX 1G86A 3NV4A 1O91A 1OT5A 2IUWA 2VECA 4UWDA 5TSWA 3U37A 4CDUB 5CEHA 2HWD3 3SCGA 3BB6A 2QJVA 4FPJA 2HWB1 4AF9A 1AL22 3EXUA 1H4GA 1VMHA 1XQNA 2LRPA 3KF5A 3OPTA 1CZVA 2DBIA 4XMAA 1EAH1 3AZWA 4HN1A 3P3PA 1S1AA 1AXKA 1CAXB 1S0CA 3D0JA 1YI9A 1IKQA 1UCXA 4YWAA 2DVAA 2YGMA 1KFUL 1RHI2 1W8ZA 1EPZA 3AYCA 1GMMA 3PUHA 4KI5M 1LGBA 4CDQA 5CKNA 3MLJA 2W5FA 4BISA 3ZFGA 4Y20A 3OGGA 1OQDA 5FZ3A 3BCWA 4N8MA 1UMZA 3HWJA 5F3EA 5T3NA 5FY0A 4QX3A 4C90A 1EV13 3DPRB 1T6BX 1ND2A 4GULA 1H2NA 2BP6A 2VGDA 5ISLA 4CTEA 3ZYHA 3I7DA 4CDWA 5JR7B 4CPBD 3O5SA 1AX1A 5CG9A 1Q8OA 2XL7A 3C7EA 1QJX2 3HBZA 4BH9A 4XQDA 1K3IA 1MS8A 1RITA 4OQ8A 1W6OA 1AHSA 3N35A 2Q1ZB 2ZAHA 1ZX5A 5DAWA 1YO8A 3J8F1 1IZ3A 3AMQA 4D94A 5FWJA 4RQPB 1VAMA 1OLME 2F4PA 1T6GC 1UAIA 2BFUS 2HWD2 2J1UA 5F3IA 5A80A 1OHFA 1BK0A 3GXUA 4QXCA 4QT6A 2LW8A 1YQCA 5FCCA 3IDBB 3ZOIA 3IWZA 3AKTA 1DGLA 3LF7A 3WDXA 4W6XA 4NRMA 5IVEA 1BEV3 1Q8QA 2FQPA 1OQEA 2GH8A 5IVFA 2XB6C 4CRQA 4YZ3A 4QPGC 4RL7A 2QQKA 1MQTB 3MW4A 4JGZB 4LBLA 3ZDSA 2FDKA 3AKRA 2VQ0A 5A6YA 5FPUA 4ITCA 3LSDA 4Q4Y1 4LITA 2VOKA 1TME3 2ZBJA 4AL9A 1K45A 5L19A 2X5IB 3HPNA 1EV12 1QJY1 2X09A 3K4DA 4LPLA 4PCRA 1WCQA 1WLCA 5AVPA 4DUXA 4WM8A 5JXGA 3GZEA 2D3SA 2XG3A 1BBT1 1MPXA 1POV1 1PGSA 1JXNA 3B3QE 3GZAA 4W6WA 1ND3B 3MIDA 1QJEA 2DVBA 2J1EA 2ZHMA 2Q8DA 5F37A 5HCAA 1J58A 5HXMA 4PQ9A 5A6QA 5FZIA 1O8SA 1F4HA 3DXTA 2AEZA 2JB4A 3BPZA 1X7NA 2R49A 2BW8A 4XILA 1JTZX 5FY5A 4CUAA 5A33B 2BBAA 4QU1A 5FOBB 3LIGA 4NUBA 2WT1A 1KGYA 2EXHA 3JQWA 5GLTA 5IW0A 1BEV2 2J1TA 3VB9A 2MPFA 1GFF2 3IAPA 4N9HA 3BODA 1F4AA 4IE5A 5FZOB 3EHKA 4JDNA 1H2MA 5F7UA 5I8TA 1QNWA 3WP3A 1JUIA 4AEDC 3KVAA 1AR63 5IFPA 1V9U3 4EN8B 4Z8BA 1SQ4A 2FDFA 4XEZA 1WA4A 5KXBA 1TME2 5JI9A 2VULA 3WQBA 5T5JA 2W08A 2W1UA 3PUQA 4JDOA 1REFA 4LKDA 1QDCA 3HJRA 3ZYRA 4LE4A 4QDSA 5FY4A 4HG6B 4UW3A 5FMDA 5J37A 4EN0A 2VZ1A 3HT1A 4M0HA 4XJUA 2R0FA 2D5HA 4UOJA 4DNYA 5KHGA 4N43C 1XU2A 2JG9B 4AHZA 1OF3A 4XJZA 2P3YA 1H1IA 4QM9A 3E5UA 4QXBA 4CEWC 1D7PM 4H55A 3MUZ1 2P3KA 3DYPA 2JWPA 1NY71 2ADDA 3HEIA 4MGSA 4RGKA 2WO7A 2G9FA 4XPVA 4Y26A 4QX0A 1VBB1 3VBRA 1PMIA 1OOPB 4AQ2A 4LHSA 4HZFA 5IAVA 2VTXJ 1COV3 5CB7A 3A21A 4LOSA 3CO2A 4QQOA 5T50A 4QU2A 1WBLA 4AQ6A 3LA2A 5FZKA 2WNOA 5FZGA 1JZ2A 3UETA 2ZX4A 3HMYA 1OH3A 3KV5A 2K2SA 1EUUA 2ETEA 1N1TA 1RUH1 2BGCA 1CIWA 1AR62 1AR73 4XHXA 1V9U2 4IE0A 2PN5A 3PL0A 1Q8SA 4AXOA 2BV4A 1ULGA 2ZKLA 1GLHA 1BMV2 5JXHA 1OQ1A 3AM2A 4DRVA 4RR3A 3WV6A 4FQZA 1CONA 2DCZA 4QPGB 5JCTA 3H42B 1D0HA 2EF6A 3VKFC 5M0TA 4UAPA 2I74A 4XDQA 5CVRA 1NX9A 3TN91 3ZSEA 3MV01 3ATGA 4FI9A 5DAVA 5DQ0A 1JMUB 4YVSA 1PVC3 4EN9B 2IXJA 4L8QA 2GDFA 2WFF3 4AI1A 1H0BA 1J1TA 5JSOA 1LENA 2ES3A 5FUIA 2JE8A 2Y6KA 3VBHA 3E6BA 1YQ6A 2YBKA 3WCRA 2ZEYA 2PAKA 4R9DA 3RMYA 2ARBA 4FTEA 3I59A 2JDHA 1W8WA 2HWE1 4B29A 4LKSA 1N1YA 1AJKA 1TE1B 1VBD1 3T0AA 1W04A 3HR9A 1COV2 3QBQA 2IXHA 1OBNA 5FQ0A 5DZFA 5FBJA 2DVFA 3LB9A 1UY1A 2VPVA 2HYKA 1GANA 1IOAA 2A6YA 4ZS3A 3AZXA 3RMXA 1UU5A 2QQMA 2QZ3A 1HB4A 5BYNA 1PO12 1AR72 3PIJA 5KBFA 1FT9A 5IK5A 3I3MA 5A7NA 1U12A 1D4VB 3CL1A 4YGCA 1X8MA 1JBCA 1GWKA 1D4M1 3ACHA 1S2BA 1UXZA 2YC0A 3P3NA 2V4AA 4V2VA 3SXWA 3TNPB 4BXSV 2TUNA 3U0ZA 1O5LA 2XJPA 2Y0IA 1DGWX 4Y5TA 4GMP3 4JC1A 2GALA 1UZ0A 4YFZA 2BVVA 1RUJ3 4AEDB 2FD8A 2EIGA 3E1F1 1FAYA 4W6YA 4OMDA 2PLV3 1PVC2 1N1VA 1RUD2 2WFF2 5DDJ1 2RDRA 4F7ZA 1PMHX 2UWBA 2VNVA 3MPPG 4AFDA 5I0DA 1VE0A 3PLQA 3W20A 3DXUA 3EBRA 1UX7A 3N9LA 2WNVC 2WKKA 1W0PA 1C8NA 2ZGKA 3K4AA 4XF4A 4JAAA 5EHDA 2XHKA 5EPAA 5A6ZA 4HXCA 1XNCA 2W47A 3EMRA 2DV9A 4N43B 4Y4YA 1US3A 1UMIA 2VZRA 5JVVA 2R7EB 5E8AA 5FDBA 4G4FA 4INDA 1LGCA 2XXZA 2CAUA 2VY0A 2QBXA 4DY3A 2Z4FA 2C4XA 5DABA 1MS5A 1NLQA 3FX3A 2WS92 2A7AA 1AYN3 2VTXA 4MXWB 5ABJC 2OPKA 1MEC2 5A32B 4DS0A 2A1XA 3UGGA 2GMEA 3ALQA 2ZEXA 1REEA 4JQRA 5J7MA 5FJHA 2DVDA 1UKGA 4H14A 4PIZA 4R9AA 4Q4V1 3FBYA 3EYPA 4YPJA 3N9OA 2PLV2 4ISRA 3BI3A 4OHVA 3L9JT 4PIXA 3WNLA 2VR4A 3TEYA 4CP9A 4NN0A 5FZAA 3S7IA 2KM2A 2RVAA 1AVBA 1FX5A 5FLIA 1W6PB 3WF4A 5A7WB 5EWSA 1EYBA 3HN1A 4MGQA 2VAUA 2VH9A 1QGLA 2QQLA 1RUG1 2XWBB 3WY6A 4ARYA 2ZX2A 4JX0A 1V00A 5C3RA 4YG0A 2VZOA 3N9MA 1O3SA 1RUI3 4P9WA 1I6XA 2JDPA 1GOHA 2J1SA 3J9SA 4K8FA 3ILFA 1QQP3 3I2FA 5K0UA 5BNOA 5I0SA 5FMBA 3PMEA 1HXS1 1W99A 5JOWA 2XJVA 3RNSA 4FP2A 3GZTB 4X6RB 3KGLA 2VZVA 1SG3A 4Q4X3 4P9LA 4Q2FA 2X53S 3BIEA 2BWAA 1UU6A 1IPSA 3PVNA 2UU8A 1LOAA 4I02A 3R4UA 1EPWA 4B4PA 1J59A 2PAEA 2CGPA 3HN3A 5FO7B 1I5ZA 2RMU3 5C33A 2D6PA 1HQWA 3BOWA 4LKEA 2W3JA 2EAKA 1RL3A 5IK4A 2DCTA 4C91A 2XVGA 3V0BA 1QF3A 5CZKA 4E4SA 5JMOA 1DGRA 4XDOA 3GNEA 2JDKA 1DQ1A 2OUJA 4OUMA 4UF0B 3GF6A 4Z82A 1O59A 1H6XA 3U14A 1RMU3 1S2EA 4XAAA 1SLAA 1RUI2 2XVLA 3N9PA 4HPKB 4LBOA 2ZGSA 3LDBA 1QQP2 3H3ZA 4PT6A 1O8PA 1NCQC 3G6JB 2P34A 3WNKA 1E5SA 4YYOA 1QH6A 2JEMA 1CAWA 3LDRA 2A3XA 1JODA 1VAKA 2WNVB 3JBG1 4FT8A 4GQ7A 4LBQB 3AL6A 3M1HA 4NMIA 5CIRA 3VDCA 2P17A 4Q4X2 3LOBA 1BXHA 1WZXA 5EZWA 2Y0OA 2WNUC 4FAGA 3DECA 4QDRA 4YLZA 1ZA4A 4GMP0 4AVBA 3VV1A 3ZFEA 1WMEA 4AEJA 3CNAA 4COYA 5C3OA 1GZCA 5FLJA 3Q8AA 1JYVA 2GNMA 4JRAA 3VDAA 4PJYA 4IV3C 4MLOA 4J25A 5HXVA 4ONUA 4FPEA 1O3TA 1BLZA 3CQOA 1R1A1 4XHBA 1AL0G 5ABJB 1VBA1 4LBQD 3SLIA 4F3JA 1K42A 4AW7A 2VZ3A 2UWAA 1NUKA 4CCKA 4BLJA 4ZHNA 1TMF3 1X50A 1YQ8A 2NZ9A 3LPGA 4JRLA 2YMZA 5LW9A 2NN8A 2WIIB 2XDVA 4HK8A 4P5HA 1Y43B 1RMU2 4AI8A 4CCCA 5KHKA 5JMCA 4CCJA 3IMNA 2D6KA 2P37A 4XJ9A 3MGUA 1WCKA 2A6WA 2Q8OA 2VVFA 5JZGA 5I0UA 3WP4A 4GWMA 5JXIA 3JQXA 4CU7A 4FAHA 2CDOA 4FCAA 4I09A 4W4ZA 2A6VA 5EYYA 5AC91 3BPSA 2DFBA 3KQ4B 4XQWA 4Y5Z0 1LOFA 2ET7A 2W9XA 4LO6B 4NHLA 1WKYA 2I07B 1YNAA 2ZOEB 3OB8A 3O1PA 2JICA 1HX6A 5L9VA 2ZHNA 1DF0A 1HQLA 4DEVA 3V65A 5L36A 1JU3A 3U4SA 3OEAA 2ZMKA 4XABA 4R4XA 4XMIA 2WN3A 1WW5A 4Y1XA 4YGBA 2QDRA 2VJXA 3RWKX 4BQ5A 1IPKA 3HNBM 3I3DA 3APBA 2VQTA 5D8AA 4DZGA 4CXYA 2HWF3 4RSUA 1BVP1 2DTYA 1HIXA 4LJHA 2PMWB 1CAVB 4D7SA 4IQPA 2ZEWA 4LE3A 4DB5A 1PK6A 2VOXA 5GLWA 3QOPA 1T2XA 4WVWA 1JZ5A 2GH2A 4NAMA 1TMF2 1FOD3 3PJYA 1V0AA 3M3OA 2ZGNA 5FJKA 4CXWA 4IEZA 2LTNA 4GA9A 3EO6A 1U5XA 4ZXKA 3W58A 4ASKA 2WAAA 3POEA 1Z0HA 5FXVA 4CVUA 1JYNA 2QFEA 4GH4A 1STMA 3LZZA 3BU0A 4C1WA 2C9KA 4UFHA 1G9DA 5LY2A 2QUOA 4CA9A 2ZXQA 1XB9A 3CBNA 3L2YA 4E4ZA 4AFMA 2RDQA 2WA3A 1OSGA 2FBEA 2GNBA 5DZGA 1XC6A 3JU9A 2BVBA 4XCBA 1AR92 3RS6A 3KMHA 1VRH3 2E7AA 3WUCA 2BOIA 2JIGA 1W6NB 1YHFA 2FHRA 3WG2A 4AHYA 5J48A 1FMD3 4B4RA 2GSYA 2OKXA 4Q0QA 1NCQB 5LK7B 4YZ2A 3THPA 4EWAA 1R081 2BOJA 1VMFA 1LULA 2AGSA 3MF6A 1H8TC 4HT1T 5FP3A 1ENQA 3M3EA 1SFPA 4XTMA 5F2SA 4ARXA 3VDDC 2BGOA 2HWF2 5C8CA 2BPA2 1UY0A 4XYXA 3H1WA 2HWC2 2IXCA 2WNUB 4LO7A 5GZFA 2D6MA 5LA2A 4Z2WA 1HV1A 3RRDA 3TWIA 2EIBA 2RE9A 3VBFC 3O12A 1FOD2 4N53C 4XUTA 4LEJA 2JKXA 2Q8CA 4IV3B 4WM7A 1UW8A 3OPZA 3BALA 1W90A 1UOJA 2DF7A 4CEWA 1H9PA 4FPLA 4AK3A 2R071 5JOZA 4OI4A 4ZU7A 3VBUA 2WO2A 3I2IA 1ZBA2 4P9IA 5T5OA 3M3IA 2VXJA 1GZWB 2AZ5A 1RUC3 4BCUA 5FUNA 4N90A 4YNIA 3TBDA 3WDWA 4MGZE 3VD9A 1QXRA 5LA0A 3AKQA 4UT5A 3S5AA 4EWEA 4YGEA 1SMVA 2WZR3 1FMD2 2VMGA 1SPPB 2RJKA 2Y60A 3H8RA 2XKOA 3QD6A 2D7FA 2SBAA 3KV9A 3W9AA 4D6SA 1JHJA 4LBMA 3UYJA 3B02A 1R093 2RS52 1NCRA 4OULA 1A6CA 2J1RA 2E6VA 3R4DB 1B35A 2FCVA 2BNNA 2ZGMA 3I2KA 4HMZA 5DAQA 5FWEA 4B4QA 2F17A 5FXXA 1JI6A 5JLVA 4XBQA 5T5PA 3OYWA 2QCSB 3OJBA 2RR11 4D8MA 4AVAA 1ZRCA 4BM8A 3OCPA 2WLQA 4YARA 3HAGA 4P9XA 3VKLA 2RM21 2B45X 1GOGA 2IXIA 1EAH3 3O0WA 3H1YA 4OZOA 2CV6A 4GWIA 2YYOA 3O1OA 2GC1A 4A3XA 3H0OA 2A70A 3V0AA 4DY5A 1O3RA 3B00A 3RZHA 3ACLA 3MUY1 3RI9A 3KZ4C 4RGAA 3M4FA 1PIV2 4QX7A 4BQ2A 3FL7A 1MZ6A 5C4WA 3WDYA 1DGWA 4I3GA 5FIXA 1QHDA 1RXGA 2QQOA 2VW1A 2VZTA 3ZIWA 2FDGA 5E89A 2OYZA 3SH5A 5F3CA 1GNZA 1XOYA 3URFA 1CWPA 2BWCA 2WZR2 2Y64A 1Y4WA 5BNPC 2KR2A 4QKBA 4IE4A 2K0GA 5F5IA 4QPYA 2RDSA 5F1RA 4YZ4A 5F5QA 1R092 1C5HA 4QKFA 3O1UA 1VJ2A 1HW5A 1N3OA 2R042 1KDMA 1PMJX 2WBKA 3NV1A 4JV4A 1XNBA 3USUA 3SC7X 5C9AC 4Q0SA 3VZJA 3ZLIA 2IFRA 3RI8A 1XJAA 3IMMA 4XIKA 2ZHKA 1O4TA 3VBRB 2TNFA 2HWB2 2IZWA 1H8TB 3T0BA 3ZYGA 1EAH2 2OPWA 3VDDB 2WUHA 1UOBA 5H9QA 5FFOC 4WVZA 3ZPOA 3UGHA 1LU1A 1RXFA 2EIEA 2XVKA 1UD1A 5FYMA 4NIIA 3TRSB 4CCEA 4ES8A 1CJPA 4FXGB 1LJ7A 1V6LA 3VBFB 1A3KA 4N53B 3CLPA 2D97A 3T2TA 3J7HA 3N7MA 4YSFA 2G1MA 4FOYA 4GXLA 4MVTA 4Q4Y3 5FYSA 5HCFA 3WW2A 5HI0A 4V1PA 5FYHA 2IWGB 1L7QA 1QJY3 1SEFA 1JOBA 1E57A 1SLTA 2GZWA 4IE6A 5LB6A 2XPJA 2VW2A 4A41A 4B1MA 2G4IA 3N7JA 4U36A 1BBT3 1POV3 2VTFA 1RB8G 4R8HA 1TG7A 2GP5A 1GQGA 5BNNA 1OLRA 2GN3A 1KJLA 1J3RA 2HEYF 4QHZA 5GZDA 2ATFA 2YBSA 4PHZA 4E8DA 3AZZA 5J98B 4MXVA 4DOUA 2EXJA 4TYSA 1HN0A 2BBVA 5FREA 3AKSA 4NHMA 2P2KA 2JX9A 3VKOA 2DUQA 3U4XA 1QJX3 4IESA 3Q9OA 3BN6A 2CGNA 4LK6A 5AVAA 4DUWA 3S5QA 3W5MA 1HV0A 2OUHA 1PGL1 1UYPA 4H7MA 4HKLA 1JZ7A 5SV8A 2CU5A 1A34A 3IAQA 3O0XA 2WWJA 3ZXJA 1HN1A 2PXJA 3OGJA 4QX8A 1TZOA 4PDWA 4AGGA 3KS7A 2P1BA 4ZS2A 1GKBA 3GM8A 5IVVA 1BZWA 5F6KA 3NNMA 1R1ZA 4Q4Y2 2QQVA 1I1EA 1QJY2 1IS6A 3BGAA 5EQUA 3CJIA 4K3UA 4TLGA 1BBT2 1SDWA 1MZFA 3LEMA 3NJXA 3MW2A 1ALYA 3ST7A 3ZYBA 2R1BA 4IV1A 2PFWA 2F6BA 2YDEA 4O65A 2C1FA 1W39A 2JG9C 3FHAA 3UK9A 5APAA 2YZ4A 5JOXA 2QKDA 2AEYA 5BNPB 3LSEA 4FPOB 1VBE1 2AYHA 3AMHA 2ORXA 4K1YA 4TWTA 1K5MA 4FPFA 3ZFFA 4CDXA 1W8OA 1VBB3 1G9CA 1OOPC 3POGA 4LHLA 4JVAA 5FK8A 3SKVA 5B4XA 5IWFA 1XNAA 3V56A 1DLCA 2P6HA 4QGMA 5A3OA 5C9AB 4IDZA 4S2GA 4RHV1 1GYKA 4E2QA 2YC2A 4YW6A 3FE5A 4MX3A 4KGQA 4E4DX 1MS0A 3CKHA 2WR9A 1RUH3 3WOGA 3WW3A 5K8SA 3S6PA 4JDMA 1QNYA 3AL5A 1D0GA 3NJYA 4YM2A 1J83A 2VXRA 3UKVA 3VBOC 2DU1A 5ACA1 4EN7B 3X29B 2ZGQA 2IXKA 3IDAA 1FI2A 2D93A 2ZMNA 4HKOA 5FZ0A 3MBWA 2ZZQA 4YVWA 2PHXA 5GKAC 2B39A 4PF5A 3D6EA 1OD3A 3Q8EA 2ET1A 3VHNA 4H3WA 4MGKE 5IFTA 4LORA 3MO4A 3TOJA 1AX0A 4HBNA 4AYUA 1QXPA 3HOBA 4IGOA 2YC4A 1KS5A 1Q5OA 3WINE 1J3PA 3PURA 1NY72 1UIJA 1MS4A 3GBGA 3VGIA 5ANNA 1DG6A 2LALA 2VU9A 1VBB2 4BJ0A 3DKWA 4BK5A 2RDNA 5I8SA 5FY8A 3IPVA 2Q1FA 3NAPC 2UYAA 5HBAA 4M00A 4BQXA 1OA2A 1XSQA 4PLNA 5F8PA 3SMHA 3J7LA 4F8AA 3VDBA 4BK4A 1RUH2 3K48A 5LBBA 5LA1A 4XFBA 1N3QA 2E26A 1ASJ1 4UBGA 5I93A 4QQLA 4Q27A 2QNKA 1KEXA 3GDBA 3P1IA 5LBCA 4ES9A 3VZOA 1YYNA 3M8LA 1WBFA 4KL1A 3VBSC 4AVVA 4FFHA 2YFUA 3GBFA 1POV0 2ZHLA 3AVRA 5IAXA 3I3EA 3NSTA 2VZQA 1UPSA 3WQ7A 4LXLA 1LTEA 2VE1A 3TN92 1XNKA 3MLLA 4YM1A 4JCKA 1AX2A 1C28A 3K3OA 3VLBB 4BOWA 5A3LA 4B1LA 4QB6A 2VBDA 4FOVA 5CFDA 3B7MA 4W50A 5D21A 5FYZA 1DQ0A 1URXA 5LRRA 1UMHA 2HKXA 1XRUA 3ZN6A 1POQA 4FPHA 2O1QA 1Q3EA 1ZA7A 2FDJA 2YB7A 4BDVB 1CAUA 1AXZA 2Z42A 2HWE2 3S30A 2NQYA 4P00B 2F4LA 3KHBA 2WDBA 5JIAA 2D3RA 4EYUA 3A0NA 4MG2A 4XXAA 3RWNA 1W2NA 1VBD2 4XCAA 3AC0A 4ZPIA 2R061 1CX4A 2VCCA 3FHIB 1OPMA 5CFCC 3PJQA 4HL0A 4LIVA 4B7EA 4BHPA 3ENRA 1SCSA 1YEWA 2VCMA 4H2AA 1GBGA 3E97A 3UKTA 1ULOA 1JOJA 1ZNPA 5A1LA 4DIQA 4IEUA 4ISQA 2B7YA 2NYYA 4ZKTB 2VCAA 5JXJA 4DFSA 4WVMB 1NQJA 1MZ5A 1W6QA 1IG0A 2HBUA 2W1QA 4OI2A 2WC2A 1D4M2 3JCIA 5A7PA 3ZFEB 1ENRA 3I3BA 3LWCA 2VL4A 1IG3A 1WCSA 5G04L 2PA7A 1RTVA 4GB31 1PO13 4Q4V3 2VQAA 4TLFA 1X36A 1O4ZA 1W6MA 1AUYA 1XE0A 3ABZA 4XIOA 1QH7A 3LIHA 5GALA 2QQWA 2PHRA 5FPAA 2UWCA 1OUSA 3NKGA 4KU7A 5DG1A 3VBOB 4A7ZA 1ZRIA 2OS2A 3OUIA 2AUYA 1UPIA 4QPIA 2J1AA 3ZXFA 1W8TA 3WP6A 4XACA 4EWDA 1W2UA 1ZBE1 4OHXA 1AYM1 1LHOA 2E51A 2ID4A 2ORZA 5FYYA 3T2OA 2Q0AA 2JDMA 2WZ8A 3LA7A 1PNGA 2ARCA 5A3WA 5A6XA 4CU6A 2AACA 1SLLA 1RUD3 3ITQA 4O9EA 4Q8KA 3NV3A 4NIAA 2ZZJA 2DURA 1O7FA 2BU9A 1UY2A 4RS5A 3VHPA 4CEYA 4AQSA 4QDQA 3WNOA 3B5LB 1HXS3 3T4VA 2QQUA 4URAA 4CP1A 5A70A 4XOGA 4WZFA 1ZZ7A 5CYYA 5HV4A 1NA1C 4M3CA 1UYXA 2WT0A 3OGRA 5H9PA 3LDKA 3WR0A 3LEIA 3NAPB 1LKNA 4Z92B 4HVOA 5FR3A 4E9KA 4NPLA 3D8CA 2Q4SA 3ZN5A 2WFPA 1QJU1 3OTFA 4AZZA 4K8RB 4C0HA 4QGLA 4Y22B 1QU0A 2BEOA 5JWPA 1GICA 4M0NA 4Q4V2 2VZSA 4JZRA 1OPOA 1JYIA 1N47A 1ZREA 3KSCA 2WS93 1O5UA 1VLNA 4Q0PA 1RINA 4AHXA 3I3QA 2RS11 1PK6B 3GJAA 1MEC3 3VBSB 5K9YA 2VUCA 5G05L 1YLLA 2OZJA 5JPNB 4XETA 2XOMA 1IGOA 5DAXA 3NNJA 2JXAA 5KXEA 3K51A 4JGYC 5CU1A 1LR5A 2E33A 3A4UA 4NROA 2B9VA 1XU1A 1V6IA 5FZMA 1CJDA 1RUE1 4CDUA 5T5LA 4CP2A 1GU3A 4B7KA 1YJLA 3OY8B 3R6SA 1UY3A 5KXCA 1L7RA 3Q8BA 1QJZA 3D0SA 1HXS2 3PHMA 3DYMA 2WQZC 3JBG3 5E1RA 1CAXA 5LEJA 1OFNA 3E6DA 4KQ7A 4A7YA 4LR4A 2ZS6B 5CFCB 4EE2A 3ZR6A 3E6CC 4HLTA 3UJOA 3OGSA 5FKBA 3UJQA 1WUVA 4EV0A 4OHWA 4AVCA 1OI6A 2ZX1A 5LEKA 1D2QA 1H6YA 3OEBA 4MYEA 3FLRA 5GLUA 3S7EA 3DPRA 2JDZA 2BQPA 4BIOA 3KCYA 4LHKA 2JDAA 1VBA3 3OUHA 4OMCA 2Q1MA 1AR81 2EAAA 4LNVA 3AP5A 4AOCA 1UNBA 4YW3A 1NLSA 1X82A 4XUOA 1UU4A 3VD3A 4MUVA 5FY9A 1XSRA 2YU2A 1NXD1 1BKZA 4YM3A 1CIYA 1KQRA 2B8MA 1UXXX 4X6QB 2DFCA 4NRPA 3IKWA 1QMJA 2ZGUA 4A42A 3H3UA 1YUDA 4Z07A 5JUVA 4RQPA 4D7TA 1W8NA 5IUQA 1CD3G 3HNYM 1DQ5A 3MLKA 4Q4W1 2ZGLA 4P14A 1PZ9A 1YQ2A 4V2WA 5FMOL 4DO0A 2UY9A 1LAJA 2A6ZA 2DCKA 1U0AA 2W52A 5I0RA 1OLMA 5AC93 3JBG2 5HV0A 4H7LA 3B9CA 4LBJA 1I9RA 2OQ7A 3NWKA 3RFRA 5LRSA 3JXSA 3LFIA 2C24A 4FP3A 1MQTA 4JGZA 3H8XA 4XTPA 4ZXEA 1W9TA 2PQSA 4O61A 1WMFA 3S0MA 3UL2A 1APNA 3UGFA 3WW1A 4CYDA 3LGRA 4CE8A 1MS9A 2X5IA 1DZQA 1NA1B 5L7OC 2ZX3A 5IK8A 3C7OA 2VC9A 3MF9A 1R1A2 2JG8A 1VBA2 1W03A 3MI8A 3H7JA 1F9KA 4R9CA 5LZ6A 1XYOA 3ZR5A 4XFCA 5FZDA 1GP6A 1ND3A 3AB0A 3AMPA 3WDUA 5A3NA 1YWKA 3DKQA 3LFMA 4Y1UA 2K9ZA 5EJZB 3ZKUA 3AJZA 1GUIA 4YW7A 3VZNA 3MIGA 1GNHA 3NQHA 4Q26A 3V0AB 4AAXA 3MICA 1KFXL 3NMBA 3GHMA 2X29A 2R1DA 3KM5A 2VNOA 3LPFA 4CDQC 2ENRA 2QQPA 4Z1VA 3IDEA 3ZFGC 4Q0UA 1S0DA 3ILRA 3VD5A 3ZX7A 1Z7S1 3ZYPA 3DCQA 3GYDA 4E8CA 5AC92 4JGYB 1Q8PA 3J7NA 1DGRN 3AFKA 1OF4A 2XJQA 3P5BA 4LOTA 3CIHA 5FZOA 4XFIA 3C3VA 3CDZB 4NAOA 4CDWC 4MGYE 5DN2A 3QH6A 4BQWA 4CCNA 1H2LA 2ARAA 4XF1A 1F5JA 4IEOA 2EICA 1HKDA 1PGW1 1R083 3CZJA 3FZ3A 3I54A 4FO9A 5FP8A 3WDVA 4IEXA 2VG9A 2D40A 4S2DA 2E31A 3USUB 1A8DA 5EYXA 1ULCA 4GMP1 5FYCA 1OVSA 5A1AA 1UQXA 5F39A 1BCXA 1OA4A 2JDUA 2NP0A 1RUJ1 3ZKYA 1HJFA 4I0AA 1C5IA 3FUQA 1X9TA 4D7YA 5A7QA 5IVBA 1HRI1 4YZ5A 4FTBA 4LT5A 5FPBA 2Q30A 3H9AA 3E5XA 1Y9MA 1S0FA 1Y9QA 3E5QA 3VHOA 4CZSA 4OYUA 1NG0A 3BOPA 1ZZ8A 1OMIA 2R073 4XURA 5C6CA 4AGRA 2OA2A 1RUNA 1DLLA 3NKTA 1RGSA 4OVEA 5IYYA 1OOPA 5FO8B 5IT6A 2KD7A 3BU7A 1UZZA 1OFSA 2XONA 4XF3A 2ARXA 2PYTA 2VNGA 4NPRA 3RYPA 3I2HA 4XXPA 4GKYA 1P8JA 4WM8C 1ODMA 2FMDA 3OUJA 2VBPA 5F9TA 3O0VA 1R082 1AYN1 4RYDA 5BV6A 3R0RA 4LMFA 5GLVA 4MOAA 1VMJA 1AR93 1W8HA 1CQ9A 2B5HA 1TQ5A 1Y9GA 5I0TA 2JKBA 4AI2A 5A1FA 1WW6A 3KCXA 3CZUA 3H8UA 1W9SA 4QPGA 4AI3A 2W1WA 4BA6A 4C8DA 2PTMA 3PVBB 1YFUA 1SFNA 4MV2A 1W28A 3PVOA 3GALA 1U5YA 3RPQA 4CCMA 5IVYA 5DUUA 5J3UA 3V64A 2DTWA 1SBFA 2V72A 5GM0A 1FV3A 3B01A 3GHNA 4Y4RA 2RM23 5L7OB 2C5DA 4FSJA 3RZKA 2VCBA 1RC6A 2VVEA 1PO21 3WEZA 2HWC3 4WZCA 2XUEA 1J3QA 3SQOA 2R072 5FYTA 3THDA 3HT2A 3KV4A 2DBNA 4IL7A 4PDWB 5FZ9A 3MIEA 5T52A 3ELNA 2YY1A 1UZWA 1S0GA 1YJKA 4HANA 4L99A 1JYTA 3N3HA 3RZZA 2WZEA 2E63A 3THTA 4JQTA 1RJ8A 4NWWA 5C8WA 2FDIA 3T30A 4QQHA 2P3IA 1ACCA 4GJYA 1KD7A 3FWEA 1BVVA 4XFHA 2UYBA 4IEPA 4MADA 3CHXA 2RG4A 1NYWA 4HVRA 4CDQB 1ZBA3 5AFEA 4GIQA 4MGIE 3C7GA 1GQPA 4LO5B 2R16A 4NO4A 4Y20B 5T54A 3ZFGB 3WNMA 1U5ZA 3Q8CA 3TEWA 1DIWA 2D6LX 4K21A 4META 1YRZA 2RS31 4Y1ZA 3O1SA 1OC1A 1ULPA 2BTVC 1H30A 3AP9A 4LTAA 5DUXA 1ND2B 2ZJCA 1DYOA 2D5FA 3MFCA 5C3PA 2BJSA 4CDWB 2RMU1 4NVPA 4QXKA 2RR12 1JYXA 1O6UA 1NQDA 1IQAA 4Y24A 4AEDA 1AF9A 3VBRC 1W2OA 3WZ1A 1LHNA 1H2KA 2RS53 5FZFA 3LKJA 2RM22 1UOGA 3B94A 5DUWA 1WWYA 2IXLA 1W6OB 2PHWA 2ZTNA 1RUF1 3RGBA 2FZ1A 2WYFA 4FFGA 3OGVA 2LS6A 4M3CF 2ZGTA 1S4CA 4RN5A 3JD71 4KWLA 3ZO0B 1VR3A 3OOXA 5CKQA 1WW7A 1SLBA 3WSOA 4LUMA 4N43A 3BTAA 2BRTA 4BZ4A 1L3JA 1QJFA 2OIIA 3OBTA 1G8WA 4RR3C 4K6BA 4Q29A 2HH9A 4RFRB 2Z79A 3ETQA 4ZZ8A 3TB0A 2WWUA 1LODA 1GOFA 2WSVA 1ULDA 3PMSA 2CL2A 4UI9L 1PZ8A 1PIV3 1LEMA 4YVSC 4MXWA 4GALA 4W65A 1JZ3A 5GZGA 4FVVA 4DXZA 5A32A 3RJ2X 3VBHC 3TAYA 2PHUA 2G19A 5CKMA 4OQ9A 1CN1A 3TEZA 1LU2A 1VAVA 4WM8B 3SH4A 3WF1A 3A23A 3FUOA 4K7JA 1SACA 1SHWB 3BYWA 4FPYA 2W95A 2BNOA 3H1MA 2FMYA 2R0HA 3NL1A 4UXAA 2WYSA 4L92A 1EY2A 3CEWA 2R043 3OD4A 2VVDA 3DUIA 1XE8A 5BUVA 1W3XA 5JSPA 1GP5A 2VOWA 4IGQA 1W6PA 2QE3A 2Z69A 5A7WA 3WHUA 3OBZA 1GWLA 1QEXA 1F8VA 2DCJA 1FXZA 2MEV1 5EFUA 2HWB3 1F2NA 3U07A 1VP6A 1ZVFA 2PHLA 4I0BA 3RVHA 3WNXA 4NJ4A 1DZTA 4XUNA 5DUVA 4AFCA 4XUPA 1BHGA 1RVF1 3HQRA 4KGGA 4BXFA 1QOOA 5FXZA 2VD7A 3ILNA 1YC61 3NNGA 3OSDA 1DZRA 3ZSMA 2ZMLA 3KWVA 4K40A 1C1FA 3VUOA 3THCA 4FPCA 2E7TA 2KXLA 3AYEA 4FPGA 4AFBA 1DYKA 3RG0A 1KS4A 5JOYA 3RYRA 5DPNA 2V4VA 1GZTA 5A3MA 3LAGA 1CPNA 1JZ6A 5F2WA 2AENA 2WSUA 4L97A 2EVXA 4FFFA 1ZRRA 1FPN1 2W2IA 2WN2A 4IEVA 1WLTA 3U10A 2AR6A 2VMIA 3WLUA 1PGL2 2GMPA 4HK9A 5LBEA 4A6OA 1C4RA 4RHV3 3J8F3 2Q5TA 2WLPA 3OBRA 4UF0A 3PTYA 3BUCA 4JHZA 4D6RA 5IVCA 3D82A 5FAXA 3JUUA 1YCIA 3L2HA 3USSA 1ONAA 4HPKA 5EV7A 5KC5A 4HSJA 1LHVA 5ACA3 2YHJA 2EXIA 4YW4A 3FJSA 5FZLA 4HETA 5DZEA 4BQ3A 1M06G 4NHKA 2WNVA 4M4RA 4MHRA 3LEGA 1VRH1 1H1MA 4LBQA 4UFLA 5L9BA 3UT0A 2P6CA 1US2A 3CF6E 4A4AA 4FPKA 1REDA 1OKQA 4NOTA 5JPMB 2XJUA 4AWDA 4Q1PA 5EJ1B 5J09A 2H0VA 3KQRA 4XJAA 4AVSA 2XGXA 4RR3B 1V6MA 1RUOA 1CESA 4QPIB 4L11A 4L9BA 4U2AA 1F31A 2DYCA 3SNMA 1VBE2 2MNGA 1W9YA 3MYXA 2DCYA 2DU0A 3EQEA 2FDHA 3R4SA 1YFXA 1VBC1 3O7OA 3LOIA 4YVSB 4CXXA 5KC6A 3ZXKA 5K7PA 3DYOA 5ABJA 4Q0VA 2GC2A 3VBHB 4LO4B 5LCWL 2VO5A 1UOFA 3SISA 5BNOC 1DHKB 5K0UC 1QIQA 5BY5A 4RHV2 2W68A 2XBO1 3J8F2 3K3NA 2I45A 2C6SA 3U78A 4ATEA 3I59B 4DEQA 3F95A 3AXDA 3PNAA 2VBBA 4BB3A 5BNQA 5C3SA 1I5PA 2XLGA 2NMNA 1ASJ3 4LUKA 4ZU5A 4DUVA 1VPHA 5ACA2 4UBHA 5FQ0B 4UFKA 1CZTA 3MHZA 1QXJA 4XQ4A 2PHDA 1A8MA 3FMGA 3MDPA 3WUDA 1RUC1 4WV8A 3SKJE 1JZ4A 2P3JA 5JSRA 4Z2AA 2VQUA 1DP0A 5F6LB 2XH6A 5FP7A 1RJ7A 4FOWA 5HCBA 4BQ1A 1LOBA 3D4KA 1H4HA 4LLOA 1WLWA 1LHWA 1FNYA 1PX3A 2LROA 3ACGA 4IERA 4LHNA 4MHUA 3T09A 5C5TA 4L0PA 4A3ZA 5A3PA 1F15A 4KNCA 3POBA 2HLEA 4HSLA 4MO3M 1IS3A 1XNDA 1VRBA 1CAVA 1YXWA 3RDIA 2VMEA 3U11A 1GNYA 4GWJA 1LOGA 4YZ1A 2R063 2VZUA 3KGZA 1SLCA 4NR1A 1X33A 2W91A 3POWA 4RD7A 3NO8A 5CG8A 4OCTA 2JB8A 4A44A 4IE7A 2VUAA 4RA0A 1ASJ2 1RIRA 4I0WB 1MS3A 4MZUA 1LCLA 3VZMA 3ZFEC 3T2PA 4YG3A 3G7DA 1HRV1 4AI9A 1WMXA 1F5FA 2IVIB 4XF9A 4D3WA 4GB33 2RV9A 2OW4A 3HD8B 3RZLA 1W6NA 5DMYA 3RQ0A 3ZXLA 3C2UA 3WX5A 3R05A 4QHOA 1NCQA 4KWJA 1OURA 4R9BA 4A6SA 3AP7A 3VZKA 3P6BA 2CTVA 1YQ5A 1ZBE3 2WJSA 1AYM3 3VD7A 2D3PA 5FY7A 1QOSA 3TN93 1V6OA 1S0BA 2GNDA 1ZZCA 2BYVE 2JD4A 1MZEA 2WNUA 2QQIA 1TNFA 4CP9B 1JN2P 1KJRA 1NZCA 2R062 5JZGC 2WL1A 3PU8A 3K75B 4SLIA 1R64A 3HVDA 2IFWA 4UFJA 5J36A 4IV3A 2CWMA 1LOFC 2HWE3 1PHMA 1C8M1 5CISA 3NJZA 1HB3A 3D3AA 4UW5A 2BUKA 4QHBA 4YG6A 4EZHA 5E16A 1VBD3 3PUSA 4LULA 2XJSA 2A73B 5BNOB 5K0UB 5IATA 1AL21 4AR2A 1GZWA 5LA9A 3D5OA 1QJU3 4QQPA 4LO8A 5D8AC 2EXKA 3OPWA 4GB32 5JIUA 3MEPA 1HLCA 1LNSA 4COZA 1FATA 2XR4A 1RHI1 2JG8B 1SPPA 4M4PA 3WNNA 5FO9B 1PK6C 2RS13 2V73A 1D4M3 4GWNA 4JTNA 4P9JA 3ACIA 4UFMA 3N36A 2VW0A 5FMOS 3ZIXA 1ZBE2 2CNAA 2WAOA 1AYM2 3OBAA 4N9IA 5E88A 5LASA 1IHMA 2LUWA 1HDKA 4LA3A 2YPDA 4PQQA 3OF1A 4GH4C 5AFBA 5DDJ3 2PELA 3V0BB 2V5DA 1RUE3 1UWWA 1SBDA 3CJXA 1QJX1 3GZUC 2X10A 3JB8A 5FZ1A 3GBWA 3DL3A 4S2FA 5FPZA 3T0DA 5KHHA 3BIWE 2B46X 1S2KA 5K4LA 3AYDA 4R4ZA 1Z78A 5FZ6A 2HWD1 4ZU4A 2YPJA 5LY1A 5F5CA 1QY4A 5HCHA 1KITA 1CAWB 2I2SA 2AC1A 1QJU2 1KXGA 3VL9A 3T1LA 1GSLA 1AZDA 3I49A 1IQDC 2N7GA 4NPMA 5L9RA 2WZPP 5C8CC 3HIFA 4Y3OA 2JE7A 5FZCA 2O8OA 3WVJA 2AH2A 2NPIA 2RS12 5H9RA 2W87A 1AR83 2AREA 3HBKA 1JYCA 3LEKA 3FFQA 4YGDA 3O14A 4ZY9A 4BMBA 2QDNA 4JTOA 4WM7C 2BGPA 3H7YA 3UKNA 1EV11 4P9GA 3RZGA 3SITA 1WW4A 4DXSA 2DVGA 5JAXA 3ORJA 5DDJ2 2BERA 3S57A 1DFQA 3VBUC 1RUE2 1DU3D 2EIDA 4LBKA 5FMCA 4Q4W3 1H8TA 5GLZA 4YM0A 4DPNA 5GJ6A 2WA4A 4CCOA 4QB1A 4XAEA 5FZBA 3VDDA 1RUG3 3K46A 3Q8FA 4BQYA 5B2GB 5HPOA 4I3PA 1UX6A 5FZ7A 2WINB 1Y3TA 2ZGRA 1UO9A 1LECA 1XBFA 3PDQA 2BNMA 4QWNA 4PF1A 5JZGB 1XNTA 3VBFA 1F35A 4N53A 1PM7A 4AGVA 1JOPA 1NCRC 1QKQA 3ES1A 4WBBA 1HB2A 1N1SA 2WABA 3WXPA 1BEV1 2CGOA 5BPXA 1H1AA 5I8YA 4QM8A 1B35C 1JUHA 3ZSLA 3N4MA 3J7MA 5CAZA 5FZ8A 3W5NA 4QX5A 4OFGA 4Y33A 1S0EA 4GZ9A 3WF3A 3RZJA 5FZEA 2ZKNA 4PBPA 4YFWA 5FP9A 4JKMA 1AR82 3FHQA 5J96B 3AK0A 1LB2A 4P08A 3AZVA 2J1VA 1W9FA 1UIKA 3KCCA 3M3CA 1PM4A 2VUJA 4TXWA 2E32A 1TME1 5D8AB 3CU7A 3IIAA 3QH7A 1NT0A 4KWKA 1N3PA 5FXWA 4IEQA 5FK7A 4PLMA 3LE0A 4XZUG 3VKNA 2WRAA 4J6GA 1PVXA 1VB4A 2CHHA 4BPZA 1LGNA 2KA3A 5C3QA 2WO1A 5IK7A 4YW2A 5KR7A 3AP4A 5FPVA 2H6BA 5JDBA 2BZDA 3ZN4A 4Q4W2 5JR2A 3WHTA 3PIGA 5LWBA 4QB2A 5CNAA 2IVJA 2UY8A 4IUGA 4AAPA 1Z7S3 4ASMB 5C4WC 4NIGA 2GNTA 1C57A 1RUG2 4XZPA 4NHYA 4GH4B 2PHTA 1ENXA 2VMHA 2D43A 1UY4A 1M4WA 5A3UA 3IBMA 2WO3A 1DCSA 2JD9A 3AMNA 5D2AA 5FRAA 4OZXA 4EZ4A 1W2AX 3RZMA 4CCLA 2A3YA 2Z2SB 5ERLA 4URTA 1ZZ9A 4MGTA 4HVQA 1W3VA 4CPBA 4LLFA 1AJOA 4N7IA 3ZYIB 2BFUL 2TEPA 3GCXA 2JENA 4AHWA 5FV3A 3MIFA 1S55A 1FYUA 1AR61 2OQ6A 3AXEA 3FLTA 1VALA 1V9U1 1XPWA 2VOTA 4UYBA 1LRHA 5KHIA 1NE6A 4BWOA 3PTRB 1BMV1 1HRI3 4QX1A 4AE2A 3AMMA 4O9GA 4K9SA 1MVEA 5C8CB 2XL9A 3ON7A 3T3YA 4C0BA 3ROUA 5KHJA 3GCWA 4CUBA 1R1A3 2O8QA 3AKPA 3K2OA 5BNPA 3LA3A 3I2JA 3F2ZA 4PBOA 2YUEA 4S2HA 1SLIA 4OUSA 4BMEA 1Z7S2 2YBPA 3BKZA 4DQAA 4WM7B 2CAVA 5D1IA 5F5AA 1PNFA 3JZVA 4CEWB 5C9AA 2Y6LA 3POIA 3O1VA 2ZABA 2O0OA 4I2OA 3KB5A 4EJRA 3SEPA 3VBUB 5FPXA 1D2SA 4COVA 5FOJB 3FBMA 1K12A 4TN7A 4XFGA 4OI1A 3LCPA 1OUXA 1CVNA 3ZVXA 4KWUA 3N7LA 1PGW2 1COV1 4IXLA 2XJRA 3GJBA 5BNNC 2R6QA 1LESA 2W39A 4N7UA 3ZXEA 4BU2A 2Y8KA 3VHRA 3ZSJA 4OUEA 5A3TA 3UV9A 4JKLA 1RUJ2 3WQ0A 1PO11 4C1XA 3INAA 1AR71 4JHTA 1BJQA 2FCUA 3IM0A 3I8TA 1FV2A 1NCRB 4HFSA 3H3LA 1HRI2 5BXXA 1XYPA 4LA2A 1B35B 3ES4A 2W94A 3U1XA 2GP3A 2B4KA 1LOEA 1V6NA 4G3YC 1PO23 4AI0A 1G6NA 3OYWB 4AFAA 2LM3A 4TSVA 1WCDJ 2DDUA 4EN6B 2P4EA 4PDWC 1PVC1 5A7OA 4CU8A 3IB3A 1RUD1 2WFF1 4LIUA 1GZ9A 2BDRA 5DAPA 1GP4A 3RYKA 5IVJA 2D98A 3JB4C 1WGPA 1YI7A 2VNRA 1IS5A 1SBEA 1CR7A 5LATA 3VZLA 4JKKA 4IW3A 5FKCA 2X05A 3CJIC 1ST8A 2ZAAA 5A33A 4EQVA 1EP0A 1AXYA 1G7YA 1AYN2 4IV1C 4KG8A 4CUCA 5C4WB 2ERFA 4XDPA 5FP4A 3RJRA 3RSJA 1W0NA 1W0OA 2RS33 1IS4A 3U75A 1OXCA 4J1WA 1CGPA 1DQ6A 5E6HA 1ND2C 4CUGA 2D6NA 3WD5A 1WCUA 5FZ4A 3NV2A 5JI7A 3WW4A 2VMFA 2NLRA 3A0KA 4MH0E 3MIHA 1MS1A 5FBZA 3AP6A 4ET7A 1K5MC 3DN7A 2WS91 3ZFFC 4BQ4A 4CDXC 4NIDA 2OZ6A 4GKXA 2PAMA 3PVEA 1MEC1 4XFAA 3J26N 3ZMOA 3FFZA 1RUF3 5T55A 4YW1A 4IGPA 1PO22 3O1TA 2YV8A 2CY6A 1ZRFA 1S0IA 5C71A 3N9NA 3JD73 5FYUA 2JJ6A 1BK1A 1CZSA 4Y1YA 4BLIA 2PLV1 2GMMA 2ZX0A 2XWJB 2DUOA 4XJWA 2VMDA 5KWRA 4GD4A 2JG9A 1DYPA 2TBVA 2O14A 3I97A 5FYVA 1K5JA 3VL8A 4O7XA 1Q43A 4CSWA 1TVGA 1X8EA 2A71A 2VM9A 3PUIA 2OXBA 4OI0A 5C5UA 4YVWC 1KRIA
chains in the Genus database with same CATH topology
4XUPA 1JU4A 1BHGA 1UY1A 1J83A 3NNGA 2QQMA 2YG0A 2L9LA 3IDAA 3NRUA 2VMCA 3THCA 3MBWA 2C26A 3A7QA 1OD3A 3ACHA 3SEEA 1UXZA 2YFZA 4BXSV 5DPNA 5IFTA 1CX1A 2V4VA 1UZ0A 2WQ8A 3MO4A 1JZ6A 3E1F1 3HOBA 2J7MA 4OMDA 4XVHA 2YC4A 3LQCA 2WN2A 3C7FA 1PMHX 5I0DA 4A6OA 4BJ0A 4BK5A 1UX7A 3K4AA 4JHZA 1W9WA 2W47A 4P5YA 2W92A 1US3A 1UMIA 3VDBA 2VZRA 2R7EB 5LA1A 2E26A 3GDBA 1KEXA 3P1IA 2QBXA 2Z4FA 2C4XA 4M4RA 3LEGA 3ZM8A 2VZPA 1US2A 4A4AA 2YFUA 3I3EA 2VZQA 3ETPA 5EJ1B 2ZEXA 4BK4A 5EIYB 1SDDB 4QB6A 3WF0A 1PX4A 3EYPA 4W50A 4YPJA 3ECQA 1J84A 1UMHA 4ZZ5A 4A45A 3HNMA 3C8XA 2YB7A 3DYOA 3WNLA 2VR4A 4BDVB 4TTGA 5LCWL 2VO5A 2RVAA 4P00B 2WDBA 3A22A 3WF4A 2QQNA 4MGQA 3AC0A 4DEQA 2QQLA 2VCCA 4ARYA 4JX0A 1I5PA 2Y6HA 2VZOA 4DUVA 2QQJA 1ULOA 1GOHA 2J1SA 3T08A 1CZTA 3I2FA 1W99A 3SKJE 2VCAA 4AG4A 5JXJA 1JZ4A 4Z2AA 2VQUA 2W1QA 2VZVA 1DP0A 1SG3A 3I3BA 2VL4A 3K77A 1UYYA 5G04L 1PX3A 3ACGA 3T09A 3ABZA 3I2GA 4L0PA 4A3ZA 3HN3A 4P02B 5J1XA 2HLEA 4MO3M 2W3JA 2J1AA 2VMEA 2ID4A 2ORZA 1GNYA 4GWJA 3T2OA 5CZKA 5JMOA 2VZUA 2WZ8A 2W91A 4CU6A 2W1SA 1O59A 1H6XA 3C7HA 4A44A 1UY2A 3WF2A 4QDQA 3WNOA 3GGLA 4PT6A 1O8PA 3WNKA 3MV11 5CYYA 3T2PA 1UYXA 3OGRA 3LEIA 3VDCA 2RV9A 5DMYA 3DECA 4QDRA 3NJVA 2VZSA 1JYVA 3P6BA 3VDAA 1NKGA 3VD7A 5G05L 3CQOA 2XOMA 1OH4A 3WNPA 1UYZA 2QQIA 1K42A 5IHRA 2E33A 2VZ3A 1NUKA 2J22A 3K75B 1R64A 2B9VA 2Y6GA 3LPGA 3OG2A 1GU3A 3D3AA 1UY3A 1L7RA 3DYMA 3T2QA 4QAWA 2CDPA 5JXIA 2RJ2A 4CU7A 2CDOA 4W4ZA 2W9XA 1WKYA 3OB8A 3OGSA 1LNSA 1EUTA 3FN9A 4QX2A 2W46A 4DEVA 4M4PA 2XHNA 1JU3A 3WNNA 1H6YA 3OEBA 3OEAA 2WN3A 3ACIA 2VJXA 3HNBM 3I3DA 5IJRA 3VD4A 2VQTA 2JDAA 2WAOA 3OBAA 4OMCA 1RYYA 3ACFA 4PQQA 4D0QA 3K4ZA 4XUOA 2ZEWA 3VD3A 4XUQA 3IIIA 2V5DA 1T2XA 1CIYA 1JZ5A 1UXXX 4CU9A 3CMGA 1UWWA 4A42A 3UESA 2X10A 5JUVA 2Y6JA 3T0DA 1W8NA 2WAAA 3HNYM 3WSOA 4CVUA 1YQ2A 1JYNA 2DCKA 2C9KA 2ZXQA 1JZ8A 4DXTA 2ZEZA 4KMQA 3JXSA 4QPWA 4W8JA 1XC6A 1IQDC 4ZXEA 1NAEA 1W9TA 2PQSA 1JYWA 2HYXA 2OKXA 5C7GA 3UNPA 2W87A 3LEKA 4ZY9A 3C7OA 2VC9A 4ARXA 2BGPA 2BGOA 3EB7A 1UY0A 4DXSA 2XQXA 5B4NA 2BERA 5LA2A 2EIDA 5EJZB 2EIBA 1GUIA 4LQRA 4DXRA 3NQHA 5C70A 4AAXA 4XUTA 2JKXA 1OT5A 3U37A 4QB1A 3LPFA 3K46A 5HPOA 3VD5A 1CZVA 4E8CA 2WO2A 3I2IA 4PF1A 1XNTA 1OF4A 3CIHA 3CDZB 2WABA 3PUHA 1GMMA 4KI5M 5DN2A 3VD9A 5LA0A 2W5FA 3W5NA 2EICA 3WF3A 3CZJA 4GZ9A 4JKMA 3FHQA 4QX3A 2E31A 1JHJA 4P08A 2J1VA 5A1AA 4TXWA 2E32A 2J1RA 3I2KA 3LE0A 4XZUG 3C7EA 1JI6A 2WO1A 1K3IA 4D8MA 2BZDA 5JR2A 4OYUA 4QB2A 4IUGA 1GOGA 4XURA 2J1UA 4OZOA 4GWIA 3GXUA 5IYYA 2LW8A 2KD7A 1UY4A 2WO3A 2XONA 3MUY1 2JD9A 3FL7A 2QQKA 3I2HA 1P8JA 2VZTA 2QQOA 2Y64A 4RYDA 4MOAA 1K45A 3HPNA 1XPWA 2X09A 2VOTA 3K4DA 4LPLA 3CZUA 1W9SA 1WCQA 2W1WA 5JXGA 4DUXA 4QX1A 2WBKA 1MPXA 1PMJX 4CUBA 2V72A 2J1EA 3I2JA 3F2ZA 5HXMA 2VCBA 1O8SA 1F4HA 3WEZA 3T0BA 3THDA 4CUAA 2WUHA 2BBAA 2Y6LA 2EIEA 1KGYA 2WZEA 3SEPA 2J1TA 1K12A 3IAPA 3J7HA 1F4AA 4KWUA 5F7UA 4MADA 3C7GA 1GQPA 1L7QA 5IFPA 2Y8KA 3WNMA 4OUEA 4JKLA 4A41A 3WQBA 1ULPA 2W1UA 2VTFA 1TG7A 1DYOA 3HJRA 4QDSA 4HG6B 1JYXA 2W94A 2VZ1A 4E8DA 2B4KA 4UOJA 1OF3A 2DDUA 4CU8A 1D7PM 3OGVA 3MUZ1 2LS6A 3IB3A 4DUWA 3W5MA 3BN6A 3DYPA 4RN5A 3HEIA 4MGSA 4QX0A 1JZ7A 4LHSA 3IAQA 4JKKA 2X05A 1HN1A 3A21A 1JZ2A 3UETA 3GM8A 4CUCA 1EUUA 4ZZ8A 1GOFA 1W0NA 4UI9L 3BGAA 2VMFA 1JZ3A 5JXHA 4ET7A 3NJXA 4UAPA 3WF1A 3A23A 1NX9A 1SHWB 3FHAA 3MV01 4FI9A 5DQ0A 2W95A 2WYSA 5FUIA 5C71A 2JE8A 2ORXA 2Y6KA 1CZSA 2ZEYA 1W8OA 2VMDA 3SKVA 5B4XA 1XNAA 1DLCA 2DCJA 3I97A 4LKSA 1TVGA 2YC2A 2VM9A 3PUIA 3T0AA 4XUNA 3CKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUP A;  1JU4 A;  1BHG A;  1UY1 A;  1J83 A;  3NNG A;  2QQM A;  2YG0 A;  2L9L A;  3IDA A;  3NRU A;  2VMC A;  3THC A;  3MBW A;  2C26 A;  3A7Q A;  1OD3 A;  3ACH A;  3SEE A;  1UXZ A;  2YFZ A;  4BXS V;  5DPN A;  5IFT A;  1CX1 A;  2V4V A;  1UZ0 A;  2WQ8 A;  3MO4 A;  1JZ6 A;  3E1F 1;  3HOB A;  2J7M A;  4OMD A;  4XVH A;  2YC4 A;  3LQC A;  2WN2 A;  3C7F A;  1PMH X;  5I0D A;  4A6O A;  4BJ0 A;  4BK5 A;  1UX7 A;  3K4A A;  4JHZ A;  1W9W A;  2W47 A;  4P5Y A;  2W92 A;  1US3 A;  1UMI A;  3VDB A;  2VZR A;  2R7E B;  5LA1 A;  2E26 A;  3GDB A;  1KEX A;  3P1I A;  2QBX A;  2Z4F A;  2C4X A;  4M4R A;  3LEG A;  3ZM8 A;  2VZP A;  1US2 A;  4A4A A;  2YFU A;  3I3E A;  2VZQ A;  3ETP A;  5EJ1 B;  2ZEX A;  4BK4 A;  5EIY B;  1SDD B;  4QB6 A;  3WF0 A;  1PX4 A;  3EYP A;  4W50 A;  4YPJ A;  3ECQ A;  1J84 A;  1UMH A;  4ZZ5 A;  4A45 A;  3HNM A;  3C8X A;  2YB7 A;  3DYO A;  3WNL A;  2VR4 A;  4BDV B;  4TTG A;  5LCW L;  2VO5 A;  2RVA A;  4P00 B;  2WDB A;  3A22 A;  3WF4 A;  2QQN A;  4MGQ A;  3AC0 A;  4DEQ A;  2QQL A;  2VCC A;  4ARY A;  4JX0 A;  1I5P A;  2Y6H A;  2VZO A;  4DUV A;  2QQJ A;  1ULO A;  1GOH A;  2J1S A;  3T08 A;  1CZT A;  3I2F A;  1W99 A;  3SKJ E;  2VCA A;  4AG4 A;  5JXJ A;  1JZ4 A;  4Z2A A;  2VQU A;  2W1Q A;  2VZV A;  1DP0 A;  1SG3 A;  3I3B A;  2VL4 A;  3K77 A;  1UYY A;  5G04 L;  1PX3 A;  3ACG A;  3T09 A;  3ABZ A;  3I2G A;  4L0P A;  4A3Z A;  3HN3 A;  4P02 B;  5J1X A;  2HLE A;  4MO3 M;  2W3J A;  2J1A A;  2VME A;  2ID4 A;  2ORZ A;  1GNY A;  4GWJ A;  3T2O A;  5CZK A;  5JMO A;  2VZU A;  2WZ8 A;  2W91 A;  4CU6 A;  2W1S A;  1O59 A;  1H6X A;  3C7H A;  4A44 A;  1UY2 A;  3WF2 A;  4QDQ A;  3WNO A;  3GGL A;  4PT6 A;  1O8P A;  3WNK A;  3MV1 1;  5CYY A;  3T2P A;  1UYX A;  3OGR A;  3LEI A;  3VDC A;  2RV9 A;  5DMY A;  3DEC A;  4QDR A;  3NJV A;  2VZS A;  1JYV A;  3P6B A;  3VDA A;  1NKG A;  3VD7 A;  5G05 L;  3CQO A;  2XOM A;  1OH4 A;  3WNP A;  1UYZ A;  2QQI A;  1K42 A;  5IHR A;  2E33 A;  2VZ3 A;  1NUK A;  2J22 A;  3K75 B;  1R64 A;  2B9V A;  2Y6G A;  3LPG A;  3OG2 A;  1GU3 A;  3D3A A;  1UY3 A;  1L7R A;  3DYM A;  3T2Q A;  4QAW A;  2CDP A;  5JXI A;  2RJ2 A;  4CU7 A;  2CDO A;  4W4Z A;  2W9X A;  1WKY A;  3OB8 A;  3OGS A;  1LNS A;  1EUT A;  3FN9 A;  4QX2 A;  2W46 A;  4DEV A;  4M4P A;  2XHN A;  1JU3 A;  3WNN A;  1H6Y A;  3OEB A;  3OEA A;  2WN3 A;  3ACI A;  2VJX A;  3HNB M;  3I3D A;  5IJR A;  3VD4 A;  2VQT A;  2JDA A;  2WAO A;  3OBA A;  4OMC A;  1RYY A;  3ACF A;  4PQQ A;  4D0Q A;  3K4Z A;  4XUO A;  2ZEW A;  3VD3 A;  4XUQ A;  3III A;  2V5D A;  1T2X A;  1CIY A;  1JZ5 A;  1UXX X;  4CU9 A;  3CMG A;  1UWW A;  4A42 A;  3UES A;  2X10 A;  5JUV A;  2Y6J A;  3T0D A;  1W8N A;  2WAA A;  3HNY M;  3WSO A;  4CVU A;  1YQ2 A;  1JYN A;  2DCK A;  2C9K A;  2ZXQ A;  1JZ8 A;  4DXT A;  2ZEZ A;  4KMQ A;  3JXS A;  4QPW A;  4W8J A;  1XC6 A;  1IQD C;  4ZXE A;  1NAE A;  1W9T A;  2PQS A;  1JYW A;  2HYX A;  2OKX A;  5C7G A;  3UNP A;  2W87 A;  3LEK A;  4ZY9 A;  3C7O A;  2VC9 A;  4ARX A;  2BGP A;  2BGO A;  3EB7 A;  1UY0 A;  4DXS A;  2XQX A;  5B4N A;  2BER A;  5LA2 A;  2EID A;  5EJZ B;  2EIB A;  1GUI A;  4LQR A;  4DXR A;  3NQH A;  5C70 A;  4AAX A;  4XUT A;  2JKX A;  1OT5 A;  3U37 A;  4QB1 A;  3LPF A;  3K46 A;  5HPO A;  3VD5 A;  1CZV A;  4E8C A;  2WO2 A;  3I2I A;  4PF1 A;  1XNT A;  1OF4 A;  3CIH A;  3CDZ B;  2WAB A;  3PUH A;  1GMM A;  4KI5 M;  5DN2 A;  3VD9 A;  5LA0 A;  2W5F A;  3W5N A;  2EIC A;  3WF3 A;  3CZJ A;  4GZ9 A;  4JKM A;  3FHQ A;  4QX3 A;  2E31 A;  1JHJ A;  4P08 A;  2J1V A;  5A1A A;  4TXW A;  2E32 A;  2J1R A;  3I2K A;  3LE0 A;  4XZU G;  3C7E A;  1JI6 A;  2WO1 A;  1K3I A;  4D8M A;  2BZD A;  5JR2 A;  4OYU A;  4QB2 A;  4IUG A;  1GOG A;  4XUR A;  2J1U A;  4OZO A;  4GWI A;  3GXU A;  5IYY A;  2LW8 A;  2KD7 A;  1UY4 A;  2WO3 A;  2XON A;  3MUY 1;  2JD9 A;  3FL7 A;  2QQK A;  3I2H A;  1P8J A;  2VZT A;  2QQO A;  2Y64 A;  4RYD A;  4MOA A;  1K45 A;  3HPN A;  1XPW A;  2X09 A;  2VOT A;  3K4D A;  4LPL A;  3CZU A;  1W9S A;  1WCQ A;  2W1W A;  5JXG A;  4DUX A;  4QX1 A;  2WBK A;  1MPX A;  1PMJ X;  4CUB A;  2V72 A;  2J1E A;  3I2J A;  3F2Z A;  5HXM A;  2VCB A;  1O8S A;  1F4H A;  3WEZ A;  3T0B A;  3THD A;  4CUA A;  2WUH A;  2BBA A;  2Y6L A;  2EIE A;  1KGY A;  2WZE A;  3SEP A;  2J1T A;  1K12 A;  3IAP A;  3J7H A;  1F4A A;  4KWU A;  5F7U A;  4MAD A;  3C7G A;  1GQP A;  1L7Q A;  5IFP A;  2Y8K A;  3WNM A;  4OUE A;  4JKL A;  4A41 A;  3WQB A;  1ULP A;  2W1U A;  2VTF A;  1TG7 A;  1DYO A;  3HJR A;  4QDS A;  4HG6 B;  1JYX A;  2W94 A;  2VZ1 A;  4E8D A;  2B4K A;  4UOJ A;  1OF3 A;  2DDU A;  4CU8 A;  1D7P M;  3OGV A;  3MUZ 1;  2LS6 A;  3IB3 A;  4DUW A;  3W5M A;  3BN6 A;  3DYP A;  4RN5 A;  3HEI A;  4MGS A;  4QX0 A;  1JZ7 A;  4LHS A;  3IAQ A;  4JKK A;  2X05 A;  1HN1 A;  3A21 A;  1JZ2 A;  3UET A;  3GM8 A;  4CUC A;  1EUU A;  4ZZ8 A;  1GOF A;  1W0N A;  4UI9 L;  3BGA A;  2VMF A;  1JZ3 A;  5JXH A;  4ET7 A;  3NJX A;  4UAP A;  3WF1 A;  3A23 A;  1NX9 A;  1SHW B;  3FHA A;  3MV0 1;  4FI9 A;  5DQ0 A;  2W95 A;  2WYS A;  5FUI A;  5C71 A;  2JE8 A;  2ORX A;  2Y6K A;  1CZS A;  2ZEY A;  1W8O A;  2VMD A;  3SKV A;  5B4X A;  1XNA A;  1DLC A;  2DCJ A;  3I97 A;  4LKS A;  1TVG A;  2YC2 A;  2VM9 A;  3PUI A;  3T0A A;  4XUN A;  3CKH A; 
#chains in the Genus database with same CATH topology
 1OA3 A;  1V6J A;  1S0J A;  3BTX A;  1JU4 A;  1GV9 A;  2VOV A;  4WVM A;  1VB2 A;  2ILM A;  3B93 A;  3NNL A;  4KG0 A;  2RS3 2;  2YG0 A;  3MIB A;  2P5B A;  2L9L A;  2EA7 A;  5EXO A;  3NRU A;  2VMC A;  4XFF A;  3TEX A;  3T4H B;  4AQT A;  3BTZ A;  3WT3 A;  4KH9 A;  1YFW A;  2A75 A;  2C26 A;  2ZGO A;  3PUA A;  1ZZB A;  2RMU 2;  3A7Q A;  3WDT A;  3ZDV A;  4HON A;  2YRO A;  3SEE A;  3KT1 A;  2E53 A;  2YFZ A;  1SZB A;  5F32 A;  4DIN B;  4E27 A;  1CX1 A;  3VBO A;  5BNN B;  2QTW B;  2WQ8 A;  1RUF 2;  1WA6 X;  4IET A;  4K20 A;  2J7M A;  4XVH A;  4I01 A;  4AEM A;  3POF A;  3LQC A;  3C7F A;  3I4I A;  4LKF A;  2WWS A;  3JD7 2;  5FZH A;  2XLF A;  1X9P A;  4XW3 A;  2RR1 3;  2XLA A;  2C0Z A;  4QQ2 A;  2MEV 3;  3POY A;  3WP5 A;  4QGN A;  3H50 A;  2PQQ A;  2YGL A;  1W9W A;  4CCD A;  1HJG A;  1MVQ A;  1JW6 A;  4TZD A;  4P5Y A;  2W92 A;  4PI2 A;  1YFY A;  1NOV A;  1RVF 3;  2DUP A;  1YIP A;  2E9Q A;  3ZYJ B;  1C1L A;  2XML A;  1TEI A;  2SLI A;  2Y33 A;  1WMD A;  1ULE A;  3AX4 A;  1XE7 A;  4SBV A;  3T1M A;  2NM1 A;  4BE3 A;  4GAZ A;  4DMI A;  1RUI 1;  2OVU A;  2QVS B;  5FYI A;  3MW3 A;  1QQP 1;  1TNR A;  3NAP A;  4HN0 A;  4Y5S A;  3ZM8 A;  5CFD C;  4UW6 A;  3SH3 A;  2VZP A;  5I91 A;  2W0X A;  2DWR A;  3M2M A;  2JDY A;  3AJY A;  3KD4 A;  4Y22 A;  4FBF A;  3O1R A;  3CJI B;  1ODN A;  3ETP A;  1W06 A;  4Q4X 1;  4DRR A;  2ZGP A;  3ASI A;  3ZXG A;  1UZV A;  1MAC A;  2ZAC A;  2H0B A;  3KF3 A;  1UF2 C;  1SDD B;  1FPN 3;  2MHF A;  3N7K A;  4IV1 B;  2CWS A;  3WF0 A;  5EIY B;  2FCT A;  1G9F A;  1PX4 A;  1XXN A;  3VBS A;  2XUM A;  3ECQ A;  1J84 A;  2X8K A;  4ZZ5 A;  4A45 A;  2QZ2 A;  3HNM A;  4OHZ A;  2B42 B;  2Y6F A;  3C8X A;  4LK7 A;  1IKP A;  2R32 A;  3J4U H;  3MPB A;  4LBN A;  5LBF A;  4B3N A;  1ZM1 A;  4TTG A;  1K5M B;  3ZFF B;  1DQ2 A;  2MEV 2;  3A22 A;  1BYH A;  2RHP A;  4CDX B;  4E4H A;  4ERO A;  4QKN A;  2QQN A;  2E7Q A;  5SV5 A;  4J1X A;  1GR3 A;  2XJT A;  3WG3 A;  3OY8 A;  2Y6H A;  2A6X A;  1RVF 2;  1NZI A;  2EAL A;  1E5H A;  2QQJ A;  2HJI A;  1V70 A;  3T08 A;  5KXD A;  3N9Q A;  1RMU 1;  2GC0 A;  4E2G A;  4HOO A;  3ZXD A;  1ZRD A;  4AG4 A;  4B8E A;  4IEY A;  4XE9 A;  5CFC A;  4XC9 A;  3KLS A;  2JE9 A;  4QPI C;  3K77 A;  1UYY A;  4X8P A;  4YVW B;  1E5I A;  2Y26 A;  1YIF A;  1WD3 A;  4BIF A;  2CYF A;  5GZC A;  2GAU A;  4L2N A;  1UKR A;  3I2G A;  4A2U A;  3DGT A;  1VBC 3;  1FPN 2;  2XQR A;  4AVT A;  4P02 B;  5J1X A;  1Y7B A;  3IDC B;  4COW A;  4QMA A;  1Q8V A;  3AZY A;  3KT4 A;  4RS5 C;  1OKO A;  2GU9 A;  4CEY C;  2XBO 3;  1OVP A;  4XJ8 A;  1JHN A;  4FOQ A;  3VN4 A;  3POJ A;  3IT8 A;  2Q8E A;  3ME2 A;  1SFY A;  1GQH A;  3NW4 A;  3FLP A;  4E2S A;  4OHY A;  4XBL A;  3IPV B;  2OT7 A;  1Q56 A;  4D6Q A;  2W1S A;  1H9W A;  3C7H A;  4IEW A;  3SCF A;  3W21 A;  4D69 A;  4COU A;  1TMF 1;  1ZYB A;  1VIW B;  3M3Q A;  1HQN A;  5L73 A;  3WF2 A;  1QOT A;  4P9Y A;  3GGL A;  1NE4 A;  1LED A;  1JH5 A;  1VRH 2;  3MV1 1;  3I2O A;  2G9G A;  1W8U A;  1ENS A;  1V6K A;  3NVC A;  1MR5 A;  4AEK A;  1W2T A;  4RGG A;  1XYN A;  2YXS A;  2ZCW A;  2JIJ A;  1WLD A;  2R30 A;  1DBN A;  3NJV A;  1AR9 1;  5DG2 A;  2WQ4 A;  5EP9 A;  2GN7 A;  1NA1 A;  1JS9 A;  1W8F A;  2PHF A;  1VBC 2;  4I30 A;  3DF0 A;  3FC0 A;  4F83 A;  2YU1 A;  5A7S A;  5FPL A;  1U5I A;  1NKG A;  2G9Z A;  4UFI A;  3ZN6 B;  4CDU C;  5CFD B;  1CPM A;  1B09 A;  4ATF A;  1I3H A;  2A5Z A;  3W59 A;  1H8V A;  3NNF A;  1OH4 A;  3WNP A;  1DDL A;  2XBO 2;  4RFT 0;  1UYZ A;  2HBT A;  4OLL A;  1VBE 3;  2IC1 A;  1CAU B;  3M7A A;  3MFA A;  4NRQ A;  1QWR A;  2HWF 1;  5IHR A;  1G9B A;  2WNE A;  2J22 A;  2HWC 1;  1LOC A;  3TNQ A;  2Y6G A;  5CA6 A;  1NXM A;  3DEM A;  3WG4 A;  3OG2 A;  1ULF A;  4FFI A;  4NHX A;  3KVB A;  5FYB A;  3QAC A;  3POS A;  3SCH A;  1FOD 1;  1SCR A;  4A7K A;  5CAD A;  1RUC 2;  2Y34 A;  3IN9 A;  4QD2 A;  4R52 A;  1A78 A;  5FLH A;  3O1M A;  1BQP A;  1HRV 3;  4JGY A;  5FTT C;  1O3Q A;  3T2Q A;  1E5R A;  3WQ1 A;  4QAW A;  4M01 A;  2CDP A;  3I2D A;  2VUD A;  3DPR C;  2RJ2 A;  4XBN A;  3SHR A;  1WD4 A;  3QCW A;  3ZSK A;  1W6Q B;  2B9U A;  2HEV F;  1GWM A;  2RJL A;  2V09 A;  3OD0 A;  3TYJ A;  1ZBA 1;  2OX0 A;  2Y38 A;  4YW5 A;  5CBL A;  2H6C A;  1DQ4 A;  1EUT A;  3WCS A;  3FN9 A;  3ZXA C;  4QX2 A;  2W46 A;  4Q1R A;  4FQ4 A;  2XHN A;  4WVV A;  4HKW A;  1L7L A;  3AYA A;  1W6M B;  3H8O A;  3BTY A;  4PIY A;  4KU8 A;  2XKP A;  3HQU A;  1FMD 1;  3VD4 A;  5IJR A;  1C3H A;  4RQP C;  1FNZ A;  3ZYF A;  3KT7 A;  3AVS A;  2A3W A;  1J1L A;  4MSV A;  4ZON A;  3WG1 A;  1RYY A;  3B69 A;  3HQX A;  2RS5 1;  3ACF A;  3BVC A;  4ORF A;  2HEW F;  5GZE A;  4D0Q A;  3K4Z A;  4KBZ A;  3KV6 A;  3DV8 A;  4XUQ A;  3III A;  4CU9 A;  3CMG A;  5H9S A;  1C8M 3;  1OLQ A;  4ASL A;  3UES A;  2NMO A;  2V5Y A;  1PZ7 A;  1UZY A;  4FTS A;  1MQT C;  2CSG A;  4JGZ C;  5ANQ A;  3ZMN A;  2Y6J A;  2J42 A;  1QDO A;  4K1Z A;  1NLR A;  1LHU A;  4M3C E;  4RS5 B;  3MZH A;  2D44 A;  4CEY B;  1AL2 3;  3VKM A;  4Y1V A;  2WT2 A;  1HRV 2;  2K46 A;  1JZ8 A;  3PU3 A;  1G9A A;  4G9S B;  4DXT A;  2X5I C;  3AFG A;  2ZEZ A;  4M3C B;  4KMQ A;  5DXD A;  2ZPX A;  2UUR A;  4QPW A;  4QKD A;  4W8J A;  2JG8 C;  3B9I A;  5FUP A;  1RHI 3;  1NAE A;  1HB1 A;  3ZPY A;  2JEC A;  1O4Y A;  1PIV 1;  1UL9 A;  3LD8 A;  4X8N A;  1JYW A;  1ND3 C;  2GC3 A;  3QLQ A;  4BYY A;  2HYX A;  5C7G A;  3UNP A;  1UN1 A;  4YRD A;  2Z5W A;  1OD5 A;  4PLO A;  5FY1 A;  5LK5 A;  1IPJ A;  2WZR 1;  4GJZ A;  4NE9 A;  3KHC A;  4KBB A;  4CP0 A;  2ADE A;  1W05 A;  1KDK A;  2C9A A;  3EB7 A;  2JDN A;  3IZO A;  4Q8L A;  1R09 1;  4FXK B;  4PI0 A;  1ZZ6 A;  4NWV A;  2FZ2 A;  2XQX A;  5B4N A;  4Q5O A;  4UW4 A;  2R04 1;  3EJK A;  4XF0 A;  2ZA9 A;  4QXH A;  3M70 A;  5L7O A;  1C8M 2;  5F3G A;  4LQR A;  4DXR A;  5EJ3 A;  5C70 A;  4NIH A;  2D6O X;  1G86 A;  3NV4 A;  1O91 A;  1OT5 A;  2IUW A;  2VEC A;  4UWD A;  5TSW A;  3U37 A;  4CDU B;  5CEH A;  2HWD 3;  3SCG A;  3BB6 A;  2QJV A;  4FPJ A;  2HWB 1;  4AF9 A;  1AL2 2;  3EXU A;  1H4G A;  1VMH A;  1XQN A;  2LRP A;  3KF5 A;  3OPT A;  1CZV A;  2DBI A;  4XMA A;  1EAH 1;  3AZW A;  4HN1 A;  3P3P A;  1S1A A;  1AXK A;  1CAX B;  1S0C A;  3D0J A;  1YI9 A;  1IKQ A;  1UCX A;  4YWA A;  2DVA A;  2YGM A;  1KFU L;  1RHI 2;  1W8Z A;  1EPZ A;  3AYC A;  1GMM A;  3PUH A;  4KI5 M;  1LGB A;  4CDQ A;  5CKN A;  3MLJ A;  2W5F A;  4BIS A;  3ZFG A;  4Y20 A;  3OGG A;  1OQD A;  5FZ3 A;  3BCW A;  4N8M A;  1UMZ A;  3HWJ A;  5F3E A;  5T3N A;  5FY0 A;  4QX3 A;  4C90 A;  1EV1 3;  3DPR B;  1T6B X;  1ND2 A;  4GUL A;  1H2N A;  2BP6 A;  2VGD A;  5ISL A;  4CTE A;  3ZYH A;  3I7D A;  4CDW A;  5JR7 B;  4CPB D;  3O5S A;  1AX1 A;  5CG9 A;  1Q8O A;  2XL7 A;  3C7E A;  1QJX 2;  3HBZ A;  4BH9 A;  4XQD A;  1K3I A;  1MS8 A;  1RIT A;  4OQ8 A;  1W6O A;  1AHS A;  3N35 A;  2Q1Z B;  2ZAH A;  1ZX5 A;  5DAW A;  1YO8 A;  3J8F 1;  1IZ3 A;  3AMQ A;  4D94 A;  5FWJ A;  4RQP B;  1VAM A;  1OLM E;  2F4P A;  1T6G C;  1UAI A;  2BFU S;  2HWD 2;  2J1U A;  5F3I A;  5A80 A;  1OHF A;  1BK0 A;  3GXU A;  4QXC A;  4QT6 A;  2LW8 A;  1YQC A;  5FCC A;  3IDB B;  3ZOI A;  3IWZ A;  3AKT A;  1DGL A;  3LF7 A;  3WDX A;  4W6X A;  4NRM A;  5IVE A;  1BEV 3;  1Q8Q A;  2FQP A;  1OQE A;  2GH8 A;  5IVF A;  2XB6 C;  4CRQ A;  4YZ3 A;  4QPG C;  4RL7 A;  2QQK A;  1MQT B;  3MW4 A;  4JGZ B;  4LBL A;  3ZDS A;  2FDK A;  3AKR A;  2VQ0 A;  5A6Y A;  5FPU A;  4ITC A;  3LSD A;  4Q4Y 1;  4LIT A;  2VOK A;  1TME 3;  2ZBJ A;  4AL9 A;  1K45 A;  5L19 A;  2X5I B;  3HPN A;  1EV1 2;  1QJY 1;  2X09 A;  3K4D A;  4LPL A;  4PCR A;  1WCQ A;  1WLC A;  5AVP A;  4DUX A;  4WM8 A;  5JXG A;  3GZE A;  2D3S A;  2XG3 A;  1BBT 1;  1MPX A;  1POV 1;  1PGS A;  1JXN A;  3B3Q E;  3GZA A;  4W6W A;  1ND3 B;  3MID A;  1QJE A;  2DVB A;  2J1E A;  2ZHM A;  2Q8D A;  5F37 A;  5HCA A;  1J58 A;  5HXM A;  4PQ9 A;  5A6Q A;  5FZI A;  1O8S A;  1F4H A;  3DXT A;  2AEZ A;  2JB4 A;  3BPZ A;  1X7N A;  2R49 A;  2BW8 A;  4XIL A;  1JTZ X;  5FY5 A;  4CUA A;  5A33 B;  2BBA A;  4QU1 A;  5FOB B;  3LIG A;  4NUB A;  2WT1 A;  1KGY A;  2EXH A;  3JQW A;  5GLT A;  5IW0 A;  1BEV 2;  2J1T A;  3VB9 A;  2MPF A;  1GFF 2;  3IAP A;  4N9H A;  3BOD A;  1F4A A;  4IE5 A;  5FZO B;  3EHK A;  4JDN A;  1H2M A;  5F7U A;  5I8T A;  1QNW A;  3WP3 A;  1JUI A;  4AED C;  3KVA A;  1AR6 3;  5IFP A;  1V9U 3;  4EN8 B;  4Z8B A;  1SQ4 A;  2FDF A;  4XEZ A;  1WA4 A;  5KXB A;  1TME 2;  5JI9 A;  2VUL A;  3WQB A;  5T5J A;  2W08 A;  2W1U A;  3PUQ A;  4JDO A;  1REF A;  4LKD A;  1QDC A;  3HJR A;  3ZYR A;  4LE4 A;  4QDS A;  5FY4 A;  4HG6 B;  4UW3 A;  5FMD A;  5J37 A;  4EN0 A;  2VZ1 A;  3HT1 A;  4M0H A;  4XJU A;  2R0F A;  2D5H A;  4UOJ A;  4DNY A;  5KHG A;  4N43 C;  1XU2 A;  2JG9 B;  4AHZ A;  1OF3 A;  4XJZ A;  2P3Y A;  1H1I A;  4QM9 A;  3E5U A;  4QXB A;  4CEW C;  1D7P M;  4H55 A;  3MUZ 1;  2P3K A;  3DYP A;  2JWP A;  1NY7 1;  2ADD A;  3HEI A;  4MGS A;  4RGK A;  2WO7 A;  2G9F A;  4XPV A;  4Y26 A;  4QX0 A;  1VBB 1;  3VBR A;  1PMI A;  1OOP B;  4AQ2 A;  4LHS A;  4HZF A;  5IAV A;  2VTX J;  1COV 3;  5CB7 A;  3A21 A;  4LOS A;  3CO2 A;  4QQO A;  5T50 A;  4QU2 A;  1WBL A;  4AQ6 A;  3LA2 A;  5FZK A;  2WNO A;  5FZG A;  1JZ2 A;  3UET A;  2ZX4 A;  3HMY A;  1OH3 A;  3KV5 A;  2K2S A;  1EUU A;  2ETE A;  1N1T A;  1RUH 1;  2BGC A;  1CIW A;  1AR6 2;  1AR7 3;  4XHX A;  1V9U 2;  4IE0 A;  2PN5 A;  3PL0 A;  1Q8S A;  4AXO A;  2BV4 A;  1ULG A;  2ZKL A;  1GLH A;  1BMV 2;  5JXH A;  1OQ1 A;  3AM2 A;  4DRV A;  4RR3 A;  3WV6 A;  4FQZ A;  1CON A;  2DCZ A;  4QPG B;  5JCT A;  3H42 B;  1D0H A;  2EF6 A;  3VKF C;  5M0T A;  4UAP A;  2I74 A;  4XDQ A;  5CVR A;  1NX9 A;  3TN9 1;  3ZSE A;  3MV0 1;  3ATG A;  4FI9 A;  5DAV A;  5DQ0 A;  1JMU B;  4YVS A;  1PVC 3;  4EN9 B;  2IXJ A;  4L8Q A;  2GDF A;  2WFF 3;  4AI1 A;  1H0B A;  1J1T A;  5JSO A;  1LEN A;  2ES3 A;  5FUI A;  2JE8 A;  2Y6K A;  3VBH A;  3E6B A;  1YQ6 A;  2YBK A;  3WCR A;  2ZEY A;  2PAK A;  4R9D A;  3RMY A;  2ARB A;  4FTE A;  3I59 A;  2JDH A;  1W8W A;  2HWE 1;  4B29 A;  4LKS A;  1N1Y A;  1AJK A;  1TE1 B;  1VBD 1;  3T0A A;  1W04 A;  3HR9 A;  1COV 2;  3QBQ A;  2IXH A;  1OBN A;  5FQ0 A;  5DZF A;  5FBJ A;  2DVF A;  3LB9 A;  1UY1 A;  2VPV A;  2HYK A;  1GAN A;  1IOA A;  2A6Y A;  4ZS3 A;  3AZX A;  3RMX A;  1UU5 A;  2QQM A;  2QZ3 A;  1HB4 A;  5BYN A;  1PO1 2;  1AR7 2;  3PIJ A;  5KBF A;  1FT9 A;  5IK5 A;  3I3M A;  5A7N A;  1U12 A;  1D4V B;  3CL1 A;  4YGC A;  1X8M A;  1JBC A;  1GWK A;  1D4M 1;  3ACH A;  1S2B A;  1UXZ A;  2YC0 A;  3P3N A;  2V4A A;  4V2V A;  3SXW A;  3TNP B;  4BXS V;  2TUN A;  3U0Z A;  1O5L A;  2XJP A;  2Y0I A;  1DGW X;  4Y5T A;  4GMP 3;  4JC1 A;  2GAL A;  1UZ0 A;  4YFZ A;  2BVV A;  1RUJ 3;  4AED B;  2FD8 A;  2EIG A;  3E1F 1;  1FAY A;  4W6Y A;  4OMD A;  2PLV 3;  1PVC 2;  1N1V A;  1RUD 2;  2WFF 2;  5DDJ 1;  2RDR A;  4F7Z A;  1PMH X;  2UWB A;  2VNV A;  3MPP G;  4AFD A;  5I0D A;  1VE0 A;  3PLQ A;  3W20 A;  3DXU A;  3EBR A;  1UX7 A;  3N9L A;  2WNV C;  2WKK A;  1W0P A;  1C8N A;  2ZGK A;  3K4A A;  4XF4 A;  4JAA A;  5EHD A;  2XHK A;  5EPA A;  5A6Z A;  4HXC A;  1XNC A;  2W47 A;  3EMR A;  2DV9 A;  4N43 B;  4Y4Y A;  1US3 A;  1UMI A;  2VZR A;  5JVV A;  2R7E B;  5E8A A;  5FDB A;  4G4F A;  4IND A;  1LGC A;  2XXZ A;  2CAU A;  2VY0 A;  2QBX A;  4DY3 A;  2Z4F A;  2C4X A;  5DAB A;  1MS5 A;  1NLQ A;  3FX3 A;  2WS9 2;  2A7A A;  1AYN 3;  2VTX A;  4MXW B;  5ABJ C;  2OPK A;  1MEC 2;  5A32 B;  4DS0 A;  2A1X A;  3UGG A;  2GME A;  3ALQ A;  2ZEX A;  1REE A;  4JQR A;  5J7M A;  5FJH A;  2DVD A;  1UKG A;  4H14 A;  4PIZ A;  4R9A A;  4Q4V 1;  3FBY A;  3EYP A;  4YPJ A;  3N9O A;  2PLV 2;  4ISR A;  3BI3 A;  4OHV A;  3L9J T;  4PIX A;  3WNL A;  2VR4 A;  3TEY A;  4CP9 A;  4NN0 A;  5FZA A;  3S7I A;  2KM2 A;  2RVA A;  1AVB A;  1FX5 A;  5FLI A;  1W6P B;  3WF4 A;  5A7W B;  5EWS A;  1EYB A;  3HN1 A;  4MGQ A;  2VAU A;  2VH9 A;  1QGL A;  2QQL A;  1RUG 1;  2XWB B;  3WY6 A;  4ARY A;  2ZX2 A;  4JX0 A;  1V00 A;  5C3R A;  4YG0 A;  2VZO A;  3N9M A;  1O3S A;  1RUI 3;  4P9W A;  1I6X A;  2JDP A;  1GOH A;  2J1S A;  3J9S A;  4K8F A;  3ILF A;  1QQP 3;  3I2F A;  5K0U A;  5BNO A;  5I0S A;  5FMB A;  3PME A;  1HXS 1;  1W99 A;  5JOW A;  2XJV A;  3RNS A;  4FP2 A;  3GZT B;  4X6R B;  3KGL A;  2VZV A;  1SG3 A;  4Q4X 3;  4P9L A;  4Q2F A;  2X53 S;  3BIE A;  2BWA A;  1UU6 A;  1IPS A;  3PVN A;  2UU8 A;  1LOA A;  4I02 A;  3R4U A;  1EPW A;  4B4P A;  1J59 A;  2PAE A;  2CGP A;  3HN3 A;  5FO7 B;  1I5Z A;  2RMU 3;  5C33 A;  2D6P A;  1HQW A;  3BOW A;  4LKE A;  2W3J A;  2EAK A;  1RL3 A;  5IK4 A;  2DCT A;  4C91 A;  2XVG A;  3V0B A;  1QF3 A;  5CZK A;  4E4S A;  5JMO A;  1DGR A;  4XDO A;  3GNE A;  2JDK A;  1DQ1 A;  2OUJ A;  4OUM A;  4UF0 B;  3GF6 A;  4Z82 A;  1O59 A;  1H6X A;  3U14 A;  1RMU 3;  1S2E A;  4XAA A;  1SLA A;  1RUI 2;  2XVL A;  3N9P A;  4HPK B;  4LBO A;  2ZGS A;  3LDB A;  1QQP 2;  3H3Z A;  4PT6 A;  1O8P A;  1NCQ C;  3G6J B;  2P34 A;  3WNK A;  1E5S A;  4YYO A;  1QH6 A;  2JEM A;  1CAW A;  3LDR A;  2A3X A;  1JOD A;  1VAK A;  2WNV B;  3JBG 1;  4FT8 A;  4GQ7 A;  4LBQ B;  3AL6 A;  3M1H A;  4NMI A;  5CIR A;  3VDC A;  2P17 A;  4Q4X 2;  3LOB A;  1BXH A;  1WZX A;  5EZW A;  2Y0O A;  2WNU C;  4FAG A;  3DEC A;  4QDR A;  4YLZ A;  1ZA4 A;  4GMP 0;  4AVB A;  3VV1 A;  3ZFE A;  1WME A;  4AEJ A;  3CNA A;  4COY A;  5C3O A;  1GZC A;  5FLJ A;  3Q8A A;  1JYV A;  2GNM A;  4JRA A;  3VDA A;  4PJY A;  4IV3 C;  4MLO A;  4J25 A;  5HXV A;  4ONU A;  4FPE A;  1O3T A;  1BLZ A;  3CQO A;  1R1A 1;  4XHB A;  1AL0 G;  5ABJ B;  1VBA 1;  4LBQ D;  3SLI A;  4F3J A;  1K42 A;  4AW7 A;  2VZ3 A;  2UWA A;  1NUK A;  4CCK A;  4BLJ A;  4ZHN A;  1TMF 3;  1X50 A;  1YQ8 A;  2NZ9 A;  3LPG A;  4JRL A;  2YMZ A;  5LW9 A;  2NN8 A;  2WII B;  2XDV A;  4HK8 A;  4P5H A;  1Y43 B;  1RMU 2;  4AI8 A;  4CCC A;  5KHK A;  5JMC A;  4CCJ A;  3IMN A;  2D6K A;  2P37 A;  4XJ9 A;  3MGU A;  1WCK A;  2A6W A;  2Q8O A;  2VVF A;  5JZG A;  5I0U A;  3WP4 A;  4GWM A;  5JXI A;  3JQX A;  4CU7 A;  4FAH A;  2CDO A;  4FCA A;  4I09 A;  4W4Z A;  2A6V A;  5EYY A;  5AC9 1;  3BPS A;  2DFB A;  3KQ4 B;  4XQW A;  4Y5Z 0;  1LOF A;  2ET7 A;  2W9X A;  4LO6 B;  4NHL A;  1WKY A;  2I07 B;  1YNA A;  2ZOE B;  3OB8 A;  3O1P A;  2JIC A;  1HX6 A;  5L9V A;  2ZHN A;  1DF0 A;  1HQL A;  4DEV A;  3V65 A;  5L36 A;  1JU3 A;  3U4S A;  3OEA A;  2ZMK A;  4XAB A;  4R4X A;  4XMI A;  2WN3 A;  1WW5 A;  4Y1X A;  4YGB A;  2QDR A;  2VJX A;  3RWK X;  4BQ5 A;  1IPK A;  3HNB M;  3I3D A;  3APB A;  2VQT A;  5D8A A;  4DZG A;  4CXY A;  2HWF 3;  4RSU A;  1BVP 1;  2DTY A;  1HIX A;  4LJH A;  2PMW B;  1CAV B;  4D7S A;  4IQP A;  2ZEW A;  4LE3 A;  4DB5 A;  1PK6 A;  2VOX A;  5GLW A;  3QOP A;  1T2X A;  4WVW A;  1JZ5 A;  2GH2 A;  4NAM A;  1TMF 2;  1FOD 3;  3PJY A;  1V0A A;  3M3O A;  2ZGN A;  5FJK A;  4CXW A;  4IEZ A;  2LTN A;  4GA9 A;  3EO6 A;  1U5X A;  4ZXK A;  3W58 A;  4ASK A;  2WAA A;  3POE A;  1Z0H A;  5FXV A;  4CVU A;  1JYN A;  2QFE A;  4GH4 A;  1STM A;  3LZZ A;  3BU0 A;  4C1W A;  2C9K A;  4UFH A;  1G9D A;  5LY2 A;  2QUO A;  4CA9 A;  2ZXQ A;  1XB9 A;  3CBN A;  3L2Y A;  4E4Z A;  4AFM A;  2RDQ A;  2WA3 A;  1OSG A;  2FBE A;  2GNB A;  5DZG A;  1XC6 A;  3JU9 A;  2BVB A;  4XCB A;  1AR9 2;  3RS6 A;  3KMH A;  1VRH 3;  2E7A A;  3WUC A;  2BOI A;  2JIG A;  1W6N B;  1YHF A;  2FHR A;  3WG2 A;  4AHY A;  5J48 A;  1FMD 3;  4B4R A;  2GSY A;  2OKX A;  4Q0Q A;  1NCQ B;  5LK7 B;  4YZ2 A;  3THP A;  4EWA A;  1R08 1;  2BOJ A;  1VMF A;  1LUL A;  2AGS A;  3MF6 A;  1H8T C;  4HT1 T;  5FP3 A;  1ENQ A;  3M3E A;  1SFP A;  4XTM A;  5F2S A;  4ARX A;  3VDD C;  2BGO A;  2HWF 2;  5C8C A;  2BPA 2;  1UY0 A;  4XYX A;  3H1W A;  2HWC 2;  2IXC A;  2WNU B;  4LO7 A;  5GZF A;  2D6M A;  5LA2 A;  4Z2W A;  1HV1 A;  3RRD A;  3TWI A;  2EIB A;  2RE9 A;  3VBF C;  3O12 A;  1FOD 2;  4N53 C;  4XUT A;  4LEJ A;  2JKX A;  2Q8C A;  4IV3 B;  4WM7 A;  1UW8 A;  3OPZ A;  3BAL A;  1W90 A;  1UOJ A;  2DF7 A;  4CEW A;  1H9P A;  4FPL A;  4AK3 A;  2R07 1;  5JOZ A;  4OI4 A;  4ZU7 A;  3VBU A;  2WO2 A;  3I2I A;  1ZBA 2;  4P9I A;  5T5O A;  3M3I A;  2VXJ A;  1GZW B;  2AZ5 A;  1RUC 3;  4BCU A;  5FUN A;  4N90 A;  4YNI A;  3TBD A;  3WDW A;  4MGZ E;  3VD9 A;  1QXR A;  5LA0 A;  3AKQ A;  4UT5 A;  3S5A A;  4EWE A;  4YGE A;  1SMV A;  2WZR 3;  1FMD 2;  2VMG A;  1SPP B;  2RJK A;  2Y60 A;  3H8R A;  2XKO A;  3QD6 A;  2D7F A;  2SBA A;  3KV9 A;  3W9A A;  4D6S A;  1JHJ A;  4LBM A;  3UYJ A;  3B02 A;  1R09 3;  2RS5 2;  1NCR A;  4OUL A;  1A6C A;  2J1R A;  2E6V A;  3R4D B;  1B35 A;  2FCV A;  2BNN A;  2ZGM A;  3I2K A;  4HMZ A;  5DAQ A;  5FWE A;  4B4Q A;  2F17 A;  5FXX A;  1JI6 A;  5JLV A;  4XBQ A;  5T5P A;  3OYW A;  2QCS B;  3OJB A;  2RR1 1;  4D8M A;  4AVA A;  1ZRC A;  4BM8 A;  3OCP A;  2WLQ A;  4YAR A;  3HAG A;  4P9X A;  3VKL A;  2RM2 1;  2B45 X;  1GOG A;  2IXI A;  1EAH 3;  3O0W A;  3H1Y A;  4OZO A;  2CV6 A;  4GWI A;  2YYO A;  3O1O A;  2GC1 A;  4A3X A;  3H0O A;  2A70 A;  3V0A A;  4DY5 A;  1O3R A;  3B00 A;  3RZH A;  3ACL A;  3MUY 1;  3RI9 A;  3KZ4 C;  4RGA A;  3M4F A;  1PIV 2;  4QX7 A;  4BQ2 A;  3FL7 A;  1MZ6 A;  5C4W A;  3WDY A;  1DGW A;  4I3G A;  5FIX A;  1QHD A;  1RXG A;  2QQO A;  2VW1 A;  2VZT A;  3ZIW A;  2FDG A;  5E89 A;  2OYZ A;  3SH5 A;  5F3C A;  1GNZ A;  1XOY A;  3URF A;  1CWP A;  2BWC A;  2WZR 2;  2Y64 A;  1Y4W A;  5BNP C;  2KR2 A;  4QKB A;  4IE4 A;  2K0G A;  5F5I A;  4QPY A;  2RDS A;  5F1R A;  4YZ4 A;  5F5Q A;  1R09 2;  1C5H A;  4QKF A;  3O1U A;  1VJ2 A;  1HW5 A;  1N3O A;  2R04 2;  1KDM A;  1PMJ X;  2WBK A;  3NV1 A;  4JV4 A;  1XNB A;  3USU A;  3SC7 X;  5C9A C;  4Q0S A;  3VZJ A;  3ZLI A;  2IFR A;  3RI8 A;  1XJA A;  3IMM A;  4XIK A;  2ZHK A;  1O4T A;  3VBR B;  2TNF A;  2HWB 2;  2IZW A;  1H8T B;  3T0B A;  3ZYG A;  1EAH 2;  2OPW A;  3VDD B;  2WUH A;  1UOB A;  5H9Q A;  5FFO C;  4WVZ A;  3ZPO A;  3UGH A;  1LU1 A;  1RXF A;  2EIE A;  2XVK A;  1UD1 A;  5FYM A;  4NII A;  3TRS B;  4CCE A;  4ES8 A;  1CJP A;  4FXG B;  1LJ7 A;  1V6L A;  3VBF B;  1A3K A;  4N53 B;  3CLP A;  2D97 A;  3T2T A;  3J7H A;  3N7M A;  4YSF A;  2G1M A;  4FOY A;  4GXL A;  4MVT A;  4Q4Y 3;  5FYS A;  5HCF A;  3WW2 A;  5HI0 A;  4V1P A;  5FYH A;  2IWG B;  1L7Q A;  1QJY 3;  1SEF A;  1JOB A;  1E57 A;  1SLT A;  2GZW A;  4IE6 A;  5LB6 A;  2XPJ A;  2VW2 A;  4A41 A;  4B1M A;  2G4I A;  3N7J A;  4U36 A;  1BBT 3;  1POV 3;  2VTF A;  1RB8 G;  4R8H A;  1TG7 A;  2GP5 A;  1GQG A;  5BNN A;  1OLR A;  2GN3 A;  1KJL A;  1J3R A;  2HEY F;  4QHZ A;  5GZD A;  2ATF A;  2YBS A;  4PHZ A;  4E8D A;  3AZZ A;  5J98 B;  4MXV A;  4DOU A;  2EXJ A;  4TYS A;  1HN0 A;  2BBV A;  5FRE A;  3AKS A;  4NHM A;  2P2K A;  2JX9 A;  3VKO A;  2DUQ A;  3U4X A;  1QJX 3;  4IES A;  3Q9O A;  3BN6 A;  2CGN A;  4LK6 A;  5AVA A;  4DUW A;  3S5Q A;  3W5M A;  1HV0 A;  2OUH A;  1PGL 1;  1UYP A;  4H7M A;  4HKL A;  1JZ7 A;  5SV8 A;  2CU5 A;  1A34 A;  3IAQ A;  3O0X A;  2WWJ A;  3ZXJ A;  1HN1 A;  2PXJ A;  3OGJ A;  4QX8 A;  1TZO A;  4PDW A;  4AGG A;  3KS7 A;  2P1B A;  4ZS2 A;  1GKB A;  3GM8 A;  5IVV A;  1BZW A;  5F6K A;  3NNM A;  1R1Z A;  4Q4Y 2;  2QQV A;  1I1E A;  1QJY 2;  1IS6 A;  3BGA A;  5EQU A;  3CJI A;  4K3U A;  4TLG A;  1BBT 2;  1SDW A;  1MZF A;  3LEM A;  3NJX A;  3MW2 A;  1ALY A;  3ST7 A;  3ZYB A;  2R1B A;  4IV1 A;  2PFW A;  2F6B A;  2YDE A;  4O65 A;  2C1F A;  1W39 A;  2JG9 C;  3FHA A;  3UK9 A;  5APA A;  2YZ4 A;  5JOX A;  2QKD A;  2AEY A;  5BNP B;  3LSE A;  4FPO B;  1VBE 1;  2AYH A;  3AMH A;  2ORX A;  4K1Y A;  4TWT A;  1K5M A;  4FPF A;  3ZFF A;  4CDX A;  1W8O A;  1VBB 3;  1G9C A;  1OOP C;  3POG A;  4LHL A;  4JVA A;  5FK8 A;  3SKV A;  5B4X A;  5IWF A;  1XNA A;  3V56 A;  1DLC A;  2P6H A;  4QGM A;  5A3O A;  5C9A B;  4IDZ A;  4S2G A;  4RHV 1;  1GYK A;  4E2Q A;  2YC2 A;  4YW6 A;  3FE5 A;  4MX3 A;  4KGQ A;  4E4D X;  1MS0 A;  3CKH A;  2WR9 A;  1RUH 3;  3WOG A;  3WW3 A;  5K8S A;  3S6P A;  4JDM A;  1QNY A;  3AL5 A;  1D0G A;  3NJY A;  4YM2 A;  1J83 A;  2VXR A;  3UKV A;  3VBO C;  2DU1 A;  5ACA 1;  4EN7 B;  3X29 B;  2ZGQ A;  2IXK A;  3IDA A;  1FI2 A;  2D93 A;  2ZMN A;  4HKO A;  5FZ0 A;  3MBW A;  2ZZQ A;  4YVW A;  2PHX A;  5GKA C;  2B39 A;  4PF5 A;  3D6E A;  1OD3 A;  3Q8E A;  2ET1 A;  3VHN A;  4H3W A;  4MGK E;  5IFT A;  4LOR A;  3MO4 A;  3TOJ A;  1AX0 A;  4HBN A;  4AYU A;  1QXP A;  3HOB A;  4IGO A;  2YC4 A;  1KS5 A;  1Q5O A;  3WIN E;  1J3P A;  3PUR A;  1NY7 2;  1UIJ A;  1MS4 A;  3GBG A;  3VGI A;  5ANN A;  1DG6 A;  2LAL A;  2VU9 A;  1VBB 2;  4BJ0 A;  3DKW A;  4BK5 A;  2RDN A;  5I8S A;  5FY8 A;  3IPV A;  2Q1F A;  3NAP C;  2UYA A;  5HBA A;  4M00 A;  4BQX A;  1OA2 A;  1XSQ A;  4PLN A;  5F8P A;  3SMH A;  3J7L A;  4F8A A;  3VDB A;  4BK4 A;  1RUH 2;  3K48 A;  5LBB A;  5LA1 A;  4XFB A;  1N3Q A;  2E26 A;  1ASJ 1;  4UBG A;  5I93 A;  4QQL A;  4Q27 A;  2QNK A;  1KEX A;  3GDB A;  3P1I A;  5LBC A;  4ES9 A;  3VZO A;  1YYN A;  3M8L A;  1WBF A;  4KL1 A;  3VBS C;  4AVV A;  4FFH A;  2YFU A;  3GBF A;  1POV 0;  2ZHL A;  3AVR A;  5IAX A;  3I3E A;  3NST A;  2VZQ A;  1UPS A;  3WQ7 A;  4LXL A;  1LTE A;  2VE1 A;  3TN9 2;  1XNK A;  3MLL A;  4YM1 A;  4JCK A;  1AX2 A;  1C28 A;  3K3O A;  3VLB B;  4BOW A;  5A3L A;  4B1L A;  4QB6 A;  2VBD A;  4FOV A;  5CFD A;  3B7M A;  4W50 A;  5D21 A;  5FYZ A;  1DQ0 A;  1URX A;  5LRR A;  1UMH A;  2HKX A;  1XRU A;  3ZN6 A;  1POQ A;  4FPH A;  2O1Q A;  1Q3E A;  1ZA7 A;  2FDJ A;  2YB7 A;  4BDV B;  1CAU A;  1AXZ A;  2Z42 A;  2HWE 2;  3S30 A;  2NQY A;  4P00 B;  2F4L A;  3KHB A;  2WDB A;  5JIA A;  2D3R A;  4EYU A;  3A0N A;  4MG2 A;  4XXA A;  3RWN A;  1W2N A;  1VBD 2;  4XCA A;  3AC0 A;  4ZPI A;  2R06 1;  1CX4 A;  2VCC A;  3FHI B;  1OPM A;  5CFC C;  3PJQ A;  4HL0 A;  4LIV A;  4B7E A;  4BHP A;  3ENR A;  1SCS A;  1YEW A;  2VCM A;  4H2A A;  1GBG A;  3E97 A;  3UKT A;  1ULO A;  1JOJ A;  1ZNP A;  5A1L A;  4DIQ A;  4IEU A;  4ISQ A;  2B7Y A;  2NYY A;  4ZKT B;  2VCA A;  5JXJ A;  4DFS A;  4WVM B;  1NQJ A;  1MZ5 A;  1W6Q A;  1IG0 A;  2HBU A;  2W1Q A;  4OI2 A;  2WC2 A;  1D4M 2;  3JCI A;  5A7P A;  3ZFE B;  1ENR A;  3I3B A;  3LWC A;  2VL4 A;  1IG3 A;  1WCS A;  5G04 L;  2PA7 A;  1RTV A;  4GB3 1;  1PO1 3;  4Q4V 3;  2VQA A;  4TLF A;  1X36 A;  1O4Z A;  1W6M A;  1AUY A;  1XE0 A;  3ABZ A;  4XIO A;  1QH7 A;  3LIH A;  5GAL A;  2QQW A;  2PHR A;  5FPA A;  2UWC A;  1OUS A;  3NKG A;  4KU7 A;  5DG1 A;  3VBO B;  4A7Z A;  1ZRI A;  2OS2 A;  3OUI A;  2AUY A;  1UPI A;  4QPI A;  2J1A A;  3ZXF A;  1W8T A;  3WP6 A;  4XAC A;  4EWD A;  1W2U A;  1ZBE 1;  4OHX A;  1AYM 1;  1LHO A;  2E51 A;  2ID4 A;  2ORZ A;  5FYY A;  3T2O A;  2Q0A A;  2JDM A;  2WZ8 A;  3LA7 A;  1PNG A;  2ARC A;  5A3W A;  5A6X A;  4CU6 A;  2AAC A;  1SLL A;  1RUD 3;  3ITQ A;  4O9E A;  4Q8K A;  3NV3 A;  4NIA A;  2ZZJ A;  2DUR A;  1O7F A;  2BU9 A;  1UY2 A;  4RS5 A;  3VHP A;  4CEY A;  4AQS A;  4QDQ A;  3WNO A;  3B5L B;  1HXS 3;  3T4V A;  2QQU A;  4URA A;  4CP1 A;  5A70 A;  4XOG A;  4WZF A;  1ZZ7 A;  5CYY A;  5HV4 A;  1NA1 C;  4M3C A;  1UYX A;  2WT0 A;  3OGR A;  5H9P A;  3LDK A;  3WR0 A;  3LEI A;  3NAP B;  1LKN A;  4Z92 B;  4HVO A;  5FR3 A;  4E9K A;  4NPL A;  3D8C A;  2Q4S A;  3ZN5 A;  2WFP A;  1QJU 1;  3OTF A;  4AZZ A;  4K8R B;  4C0H A;  4QGL A;  4Y22 B;  1QU0 A;  2BEO A;  5JWP A;  1GIC A;  4M0N A;  4Q4V 2;  2VZS A;  4JZR A;  1OPO A;  1JYI A;  1N47 A;  1ZRE A;  3KSC A;  2WS9 3;  1O5U A;  1VLN A;  4Q0P A;  1RIN A;  4AHX A;  3I3Q A;  2RS1 1;  1PK6 B;  3GJA A;  1MEC 3;  3VBS B;  5K9Y A;  2VUC A;  5G05 L;  1YLL A;  2OZJ A;  5JPN B;  4XET A;  2XOM A;  1IGO A;  5DAX A;  3NNJ A;  2JXA A;  5KXE A;  3K51 A;  4JGY C;  5CU1 A;  1LR5 A;  2E33 A;  3A4U A;  4NRO A;  2B9V A;  1XU1 A;  1V6I A;  5FZM A;  1CJD A;  1RUE 1;  4CDU A;  5T5L A;  4CP2 A;  1GU3 A;  4B7K A;  1YJL A;  3OY8 B;  3R6S A;  1UY3 A;  5KXC A;  1L7R A;  3Q8B A;  1QJZ A;  3D0S A;  1HXS 2;  3PHM A;  3DYM A;  2WQZ C;  3JBG 3;  5E1R A;  1CAX A;  5LEJ A;  1OFN A;  3E6D A;  4KQ7 A;  4A7Y A;  4LR4 A;  2ZS6 B;  5CFC B;  4EE2 A;  3ZR6 A;  3E6C C;  4HLT A;  3UJO A;  3OGS A;  5FKB A;  3UJQ A;  1WUV A;  4EV0 A;  4OHW A;  4AVC A;  1OI6 A;  2ZX1 A;  5LEK A;  1D2Q A;  1H6Y A;  3OEB A;  4MYE A;  3FLR A;  5GLU A;  3S7E A;  3DPR A;  2JDZ A;  2BQP A;  4BIO A;  3KCY A;  4LHK A;  2JDA A;  1VBA 3;  3OUH A;  4OMC A;  2Q1M A;  1AR8 1;  2EAA A;  4LNV A;  3AP5 A;  4AOC A;  1UNB A;  4YW3 A;  1NLS A;  1X82 A;  4XUO A;  1UU4 A;  3VD3 A;  4MUV A;  5FY9 A;  1XSR A;  2YU2 A;  1NXD 1;  1BKZ A;  4YM3 A;  1CIY A;  1KQR A;  2B8M A;  1UXX X;  4X6Q B;  2DFC A;  4NRP A;  3IKW A;  1QMJ A;  2ZGU A;  4A42 A;  3H3U A;  1YUD A;  4Z07 A;  5JUV A;  4RQP A;  4D7T A;  1W8N A;  5IUQ A;  1CD3 G;  3HNY M;  1DQ5 A;  3MLK A;  4Q4W 1;  2ZGL A;  4P14 A;  1PZ9 A;  1YQ2 A;  4V2W A;  5FMO L;  4DO0 A;  2UY9 A;  1LAJ A;  2A6Z A;  2DCK A;  1U0A A;  2W52 A;  5I0R A;  1OLM A;  5AC9 3;  3JBG 2;  5HV0 A;  4H7L A;  3B9C A;  4LBJ A;  1I9R A;  2OQ7 A;  3NWK A;  3RFR A;  5LRS A;  3JXS A;  3LFI A;  2C24 A;  4FP3 A;  1MQT A;  4JGZ A;  3H8X A;  4XTP A;  4ZXE A;  1W9T A;  2PQS A;  4O61 A;  1WMF A;  3S0M A;  3UL2 A;  1APN A;  3UGF A;  3WW1 A;  4CYD A;  3LGR A;  4CE8 A;  1MS9 A;  2X5I A;  1DZQ A;  1NA1 B;  5L7O C;  2ZX3 A;  5IK8 A;  3C7O A;  2VC9 A;  3MF9 A;  1R1A 2;  2JG8 A;  1VBA 2;  1W03 A;  3MI8 A;  3H7J A;  1F9K A;  4R9C A;  5LZ6 A;  1XYO A;  3ZR5 A;  4XFC A;  5FZD A;  1GP6 A;  1ND3 A;  3AB0 A;  3AMP A;  3WDU A;  5A3N A;  1YWK A;  3DKQ A;  3LFM A;  4Y1U A;  2K9Z A;  5EJZ B;  3ZKU A;  3AJZ A;  1GUI A;  4YW7 A;  3VZN A;  3MIG A;  1GNH A;  3NQH A;  4Q26 A;  3V0A B;  4AAX A;  3MIC A;  1KFX L;  3NMB A;  3GHM A;  2X29 A;  2R1D A;  3KM5 A;  2VNO A;  3LPF A;  4CDQ C;  2ENR A;  2QQP A;  4Z1V A;  3IDE A;  3ZFG C;  4Q0U A;  1S0D A;  3ILR A;  3VD5 A;  3ZX7 A;  1Z7S 1;  3ZYP A;  3DCQ A;  3GYD A;  4E8C A;  5AC9 2;  4JGY B;  1Q8P A;  3J7N A;  1DGR N;  3AFK A;  1OF4 A;  2XJQ A;  3P5B A;  4LOT A;  3CIH A;  5FZO A;  4XFI A;  3C3V A;  3CDZ B;  4NAO A;  4CDW C;  4MGY E;  5DN2 A;  3QH6 A;  4BQW A;  4CCN A;  1H2L A;  2ARA A;  4XF1 A;  1F5J A;  4IEO A;  2EIC A;  1HKD A;  1PGW 1;  1R08 3;  3CZJ A;  3FZ3 A;  3I54 A;  4FO9 A;  5FP8 A;  3WDV A;  4IEX A;  2VG9 A;  2D40 A;  4S2D A;  2E31 A;  3USU B;  1A8D A;  5EYX A;  1ULC A;  4GMP 1;  5FYC A;  1OVS A;  5A1A A;  1UQX A;  5F39 A;  1BCX A;  1OA4 A;  2JDU A;  2NP0 A;  1RUJ 1;  3ZKY A;  1HJF A;  4I0A A;  1C5I A;  3FUQ A;  1X9T A;  4D7Y A;  5A7Q A;  5IVB A;  1HRI 1;  4YZ5 A;  4FTB A;  4LT5 A;  5FPB A;  2Q30 A;  3H9A A;  3E5X A;  1Y9M A;  1S0F A;  1Y9Q A;  3E5Q A;  3VHO A;  4CZS A;  4OYU A;  1NG0 A;  3BOP A;  1ZZ8 A;  1OMI A;  2R07 3;  4XUR A;  5C6C A;  4AGR A;  2OA2 A;  1RUN A;  1DLL A;  3NKT A;  1RGS A;  4OVE A;  5IYY A;  1OOP A;  5FO8 B;  5IT6 A;  2KD7 A;  3BU7 A;  1UZZ A;  1OFS A;  2XON A;  4XF3 A;  2ARX A;  2PYT A;  2VNG A;  4NPR A;  3RYP A;  3I2H A;  4XXP A;  4GKY A;  1P8J A;  4WM8 C;  1ODM A;  2FMD A;  3OUJ A;  2VBP A;  5F9T A;  3O0V A;  1R08 2;  1AYN 1;  4RYD A;  5BV6 A;  3R0R A;  4LMF A;  5GLV A;  4MOA A;  1VMJ A;  1AR9 3;  1W8H A;  1CQ9 A;  2B5H A;  1TQ5 A;  1Y9G A;  5I0T A;  2JKB A;  4AI2 A;  5A1F A;  1WW6 A;  3KCX A;  3CZU A;  3H8U A;  1W9S A;  4QPG A;  4AI3 A;  2W1W A;  4BA6 A;  4C8D A;  2PTM A;  3PVB B;  1YFU A;  1SFN A;  4MV2 A;  1W28 A;  3PVO A;  3GAL A;  1U5Y A;  3RPQ A;  4CCM A;  5IVY A;  5DUU A;  5J3U A;  3V64 A;  2DTW A;  1SBF A;  2V72 A;  5GM0 A;  1FV3 A;  3B01 A;  3GHN A;  4Y4R A;  2RM2 3;  5L7O B;  2C5D A;  4FSJ A;  3RZK A;  2VCB A;  1RC6 A;  2VVE A;  1PO2 1;  3WEZ A;  2HWC 3;  4WZC A;  2XUE A;  1J3Q A;  3SQO A;  2R07 2;  5FYT A;  3THD A;  3HT2 A;  3KV4 A;  2DBN A;  4IL7 A;  4PDW B;  5FZ9 A;  3MIE A;  5T52 A;  3ELN A;  2YY1 A;  1UZW A;  1S0G A;  1YJK A;  4HAN A;  4L99 A;  1JYT A;  3N3H A;  3RZZ A;  2WZE A;  2E63 A;  3THT A;  4JQT A;  1RJ8 A;  4NWW A;  5C8W A;  2FDI A;  3T30 A;  4QQH A;  2P3I A;  1ACC A;  4GJY A;  1KD7 A;  3FWE A;  1BVV A;  4XFH A;  2UYB A;  4IEP A;  4MAD A;  3CHX A;  2RG4 A;  1NYW A;  4HVR A;  4CDQ B;  1ZBA 3;  5AFE A;  4GIQ A;  4MGI E;  3C7G A;  1GQP A;  4LO5 B;  2R16 A;  4NO4 A;  4Y20 B;  5T54 A;  3ZFG B;  3WNM A;  1U5Z A;  3Q8C A;  3TEW A;  1DIW A;  2D6L X;  4K21 A;  4MET A;  1YRZ A;  2RS3 1;  4Y1Z A;  3O1S A;  1OC1 A;  1ULP A;  2BTV C;  1H30 A;  3AP9 A;  4LTA A;  5DUX A;  1ND2 B;  2ZJC A;  1DYO A;  2D5F A;  3MFC A;  5C3P A;  2BJS A;  4CDW B;  2RMU 1;  4NVP A;  4QXK A;  2RR1 2;  1JYX A;  1O6U A;  1NQD A;  1IQA A;  4Y24 A;  4AED A;  1AF9 A;  3VBR C;  1W2O A;  3WZ1 A;  1LHN A;  1H2K A;  2RS5 3;  5FZF A;  3LKJ A;  2RM2 2;  1UOG A;  3B94 A;  5DUW A;  1WWY A;  2IXL A;  1W6O B;  2PHW A;  2ZTN A;  1RUF 1;  3RGB A;  2FZ1 A;  2WYF A;  4FFG A;  3OGV A;  2LS6 A;  4M3C F;  2ZGT A;  1S4C A;  4RN5 A;  3JD7 1;  4KWL A;  3ZO0 B;  1VR3 A;  3OOX A;  5CKQ A;  1WW7 A;  1SLB A;  3WSO A;  4LUM A;  4N43 A;  3BTA A;  2BRT A;  4BZ4 A;  1L3J A;  1QJF A;  2OII A;  3OBT A;  1G8W A;  4RR3 C;  4K6B A;  4Q29 A;  2HH9 A;  4RFR B;  2Z79 A;  3ETQ A;  4ZZ8 A;  3TB0 A;  2WWU A;  1LOD A;  1GOF A;  2WSV A;  1ULD A;  3PMS A;  2CL2 A;  4UI9 L;  1PZ8 A;  1PIV 3;  1LEM A;  4YVS C;  4MXW A;  4GAL A;  4W65 A;  1JZ3 A;  5GZG A;  4FVV A;  4DXZ A;  5A32 A;  3RJ2 X;  3VBH C;  3TAY A;  2PHU A;  2G19 A;  5CKM A;  4OQ9 A;  1CN1 A;  3TEZ A;  1LU2 A;  1VAV A;  4WM8 B;  3SH4 A;  3WF1 A;  3A23 A;  3FUO A;  4K7J A;  1SAC A;  1SHW B;  3BYW A;  4FPY A;  2W95 A;  2BNO A;  3H1M A;  2FMY A;  2R0H A;  3NL1 A;  4UXA A;  2WYS A;  4L92 A;  1EY2 A;  3CEW A;  2R04 3;  3OD4 A;  2VVD A;  3DUI A;  1XE8 A;  5BUV A;  1W3X A;  5JSP A;  1GP5 A;  2VOW A;  4IGQ A;  1W6P A;  2QE3 A;  2Z69 A;  5A7W A;  3WHU A;  3OBZ A;  1GWL A;  1QEX A;  1F8V A;  2DCJ A;  1FXZ A;  2MEV 1;  5EFU A;  2HWB 3;  1F2N A;  3U07 A;  1VP6 A;  1ZVF A;  2PHL A;  4I0B A;  3RVH A;  3WNX A;  4NJ4 A;  1DZT A;  4XUN A;  5DUV A;  4AFC A;  4XUP A;  1BHG A;  1RVF 1;  3HQR A;  4KGG A;  4BXF A;  1QOO A;  5FXZ A;  2VD7 A;  3ILN A;  1YC6 1;  3NNG A;  3OSD A;  1DZR A;  3ZSM A;  2ZML A;  3KWV A;  4K40 A;  1C1F A;  3VUO A;  3THC A;  4FPC A;  2E7T A;  2KXL A;  3AYE A;  4FPG A;  4AFB A;  1DYK A;  3RG0 A;  1KS4 A;  5JOY A;  3RYR A;  5DPN A;  2V4V A;  1GZT A;  5A3M A;  3LAG A;  1CPN A;  1JZ6 A;  5F2W A;  2AEN A;  2WSU A;  4L97 A;  2EVX A;  4FFF A;  1ZRR A;  1FPN 1;  2W2I A;  2WN2 A;  4IEV A;  1WLT A;  3U10 A;  2AR6 A;  2VMI A;  3WLU A;  1PGL 2;  2GMP A;  4HK9 A;  5LBE A;  4A6O A;  1C4R A;  4RHV 3;  3J8F 3;  2Q5T A;  2WLP A;  3OBR A;  4UF0 A;  3PTY A;  3BUC A;  4JHZ A;  4D6R A;  5IVC A;  3D82 A;  5FAX A;  3JUU A;  1YCI A;  3L2H A;  3USS A;  1ONA A;  4HPK A;  5EV7 A;  5KC5 A;  4HSJ A;  1LHV A;  5ACA 3;  2YHJ A;  2EXI A;  4YW4 A;  3FJS A;  5FZL A;  4HET A;  5DZE A;  4BQ3 A;  1M06 G;  4NHK A;  2WNV A;  4M4R A;  4MHR A;  3LEG A;  1VRH 1;  1H1M A;  4LBQ A;  4UFL A;  5L9B A;  3UT0 A;  2P6C A;  1US2 A;  3CF6 E;  4A4A A;  4FPK A;  1RED A;  1OKQ A;  4NOT A;  5JPM B;  2XJU A;  4AWD A;  4Q1P A;  5EJ1 B;  5J09 A;  2H0V A;  3KQR A;  4XJA A;  4AVS A;  2XGX A;  4RR3 B;  1V6M A;  1RUO A;  1CES A;  4QPI B;  4L11 A;  4L9B A;  4U2A A;  1F31 A;  2DYC A;  3SNM A;  1VBE 2;  2MNG A;  1W9Y A;  3MYX A;  2DCY A;  2DU0 A;  3EQE A;  2FDH A;  3R4S A;  1YFX A;  1VBC 1;  3O7O A;  3LOI A;  4YVS B;  4CXX A;  5KC6 A;  3ZXK A;  5K7P A;  3DYO A;  5ABJ A;  4Q0V A;  2GC2 A;  3VBH B;  4LO4 B;  5LCW L;  2VO5 A;  1UOF A;  3SIS A;  5BNO C;  1DHK B;  5K0U C;  1QIQ A;  5BY5 A;  4RHV 2;  2W68 A;  2XBO 1;  3J8F 2;  3K3N A;  2I45 A;  2C6S A;  3U78 A;  4ATE A;  3I59 B;  4DEQ A;  3F95 A;  3AXD A;  3PNA A;  2VBB A;  4BB3 A;  5BNQ A;  5C3S A;  1I5P A;  2XLG A;  2NMN A;  1ASJ 3;  4LUK A;  4ZU5 A;  4DUV A;  1VPH A;  5ACA 2;  4UBH A;  5FQ0 B;  4UFK A;  1CZT A;  3MHZ A;  1QXJ A;  4XQ4 A;  2PHD A;  1A8M A;  3FMG A;  3MDP A;  3WUD A;  1RUC 1;  4WV8 A;  3SKJ E;  1JZ4 A;  2P3J A;  5JSR A;  4Z2A A;  2VQU A;  1DP0 A;  5F6L B;  2XH6 A;  5FP7 A;  1RJ7 A;  4FOW A;  5HCB A;  4BQ1 A;  1LOB A;  3D4K A;  1H4H A;  4LLO A;  1WLW A;  1LHW A;  1FNY A;  1PX3 A;  2LRO A;  3ACG A;  4IER A;  4LHN A;  4MHU A;  3T09 A;  5C5T A;  4L0P A;  4A3Z A;  5A3P A;  1F15 A;  4KNC A;  3POB A;  2HLE A;  4HSL A;  4MO3 M;  1IS3 A;  1XND A;  1VRB A;  1CAV A;  1YXW A;  3RDI A;  2VME A;  3U11 A;  1GNY A;  4GWJ A;  1LOG A;  4YZ1 A;  2R06 3;  2VZU A;  3KGZ A;  1SLC A;  4NR1 A;  1X33 A;  2W91 A;  3POW A;  4RD7 A;  3NO8 A;  5CG8 A;  4OCT A;  2JB8 A;  4A44 A;  4IE7 A;  2VUA A;  4RA0 A;  1ASJ 2;  1RIR A;  4I0W B;  1MS3 A;  4MZU A;  1LCL A;  3VZM A;  3ZFE C;  3T2P A;  4YG3 A;  3G7D A;  1HRV 1;  4AI9 A;  1WMX A;  1F5F A;  2IVI B;  4XF9 A;  4D3W A;  4GB3 3;  2RV9 A;  2OW4 A;  3HD8 B;  3RZL A;  1W6N A;  5DMY A;  3RQ0 A;  3ZXL A;  3C2U A;  3WX5 A;  3R05 A;  4QHO A;  1NCQ A;  4KWJ A;  1OUR A;  4R9B A;  4A6S A;  3AP7 A;  3VZK A;  3P6B A;  2CTV A;  1YQ5 A;  1ZBE 3;  2WJS A;  1AYM 3;  3VD7 A;  2D3P A;  5FY7 A;  1QOS A;  3TN9 3;  1V6O A;  1S0B A;  2GND A;  1ZZC A;  2BYV E;  2JD4 A;  1MZE A;  2WNU A;  2QQI A;  1TNF A;  4CP9 B;  1JN2 P;  1KJR A;  1NZC A;  2R06 2;  5JZG C;  2WL1 A;  3PU8 A;  3K75 B;  4SLI A;  1R64 A;  3HVD A;  2IFW A;  4UFJ A;  5J36 A;  4IV3 A;  2CWM A;  1LOF C;  2HWE 3;  1PHM A;  1C8M 1;  5CIS A;  3NJZ A;  1HB3 A;  3D3A A;  4UW5 A;  2BUK A;  4QHB A;  4YG6 A;  4EZH A;  5E16 A;  1VBD 3;  3PUS A;  4LUL A;  2XJS A;  2A73 B;  5BNO B;  5K0U B;  5IAT A;  1AL2 1;  4AR2 A;  1GZW A;  5LA9 A;  3D5O A;  1QJU 3;  4QQP A;  4LO8 A;  5D8A C;  2EXK A;  3OPW A;  4GB3 2;  5JIU A;  3MEP A;  1HLC A;  1LNS A;  4COZ A;  1FAT A;  2XR4 A;  1RHI 1;  2JG8 B;  1SPP A;  4M4P A;  3WNN A;  5FO9 B;  1PK6 C;  2RS1 3;  2V73 A;  1D4M 3;  4GWN A;  4JTN A;  4P9J A;  3ACI A;  4UFM A;  3N36 A;  2VW0 A;  5FMO S;  3ZIX A;  1ZBE 2;  2CNA A;  2WAO A;  1AYM 2;  3OBA A;  4N9I A;  5E88 A;  5LAS A;  1IHM A;  2LUW A;  1HDK A;  4LA3 A;  2YPD A;  4PQQ A;  3OF1 A;  4GH4 C;  5AFB A;  5DDJ 3;  2PEL A;  3V0B B;  2V5D A;  1RUE 3;  1UWW A;  1SBD A;  3CJX A;  1QJX 1;  3GZU C;  2X10 A;  3JB8 A;  5FZ1 A;  3GBW A;  3DL3 A;  4S2F A;  5FPZ A;  3T0D A;  5KHH A;  3BIW E;  2B46 X;  1S2K A;  5K4L A;  3AYD A;  4R4Z A;  1Z78 A;  5FZ6 A;  2HWD 1;  4ZU4 A;  2YPJ A;  5LY1 A;  5F5C A;  1QY4 A;  5HCH A;  1KIT A;  1CAW B;  2I2S A;  2AC1 A;  1QJU 2;  1KXG A;  3VL9 A;  3T1L A;  1GSL A;  1AZD A;  3I49 A;  1IQD C;  2N7G A;  4NPM A;  5L9R A;  2WZP P;  5C8C C;  3HIF A;  4Y3O A;  2JE7 A;  5FZC A;  2O8O A;  3WVJ A;  2AH2 A;  2NPI A;  2RS1 2;  5H9R A;  2W87 A;  1AR8 3;  2ARE A;  3HBK A;  1JYC A;  3LEK A;  3FFQ A;  4YGD A;  3O14 A;  4ZY9 A;  4BMB A;  2QDN A;  4JTO A;  4WM7 C;  2BGP A;  3H7Y A;  3UKN A;  1EV1 1;  4P9G A;  3RZG A;  3SIT A;  1WW4 A;  4DXS A;  2DVG A;  5JAX A;  3ORJ A;  5DDJ 2;  2BER A;  3S57 A;  1DFQ A;  3VBU C;  1RUE 2;  1DU3 D;  2EID A;  4LBK A;  5FMC A;  4Q4W 3;  1H8T A;  5GLZ A;  4YM0 A;  4DPN A;  5GJ6 A;  2WA4 A;  4CCO A;  4QB1 A;  4XAE A;  5FZB A;  3VDD A;  1RUG 3;  3K46 A;  3Q8F A;  4BQY A;  5B2G B;  5HPO A;  4I3P A;  1UX6 A;  5FZ7 A;  2WIN B;  1Y3T A;  2ZGR A;  1UO9 A;  1LEC A;  1XBF A;  3PDQ A;  2BNM A;  4QWN A;  4PF1 A;  5JZG B;  1XNT A;  3VBF A;  1F35 A;  4N53 A;  1PM7 A;  4AGV A;  1JOP A;  1NCR C;  1QKQ A;  3ES1 A;  4WBB A;  1HB2 A;  1N1S A;  2WAB A;  3WXP A;  1BEV 1;  2CGO A;  5BPX A;  1H1A A;  5I8Y A;  4QM8 A;  1B35 C;  1JUH A;  3ZSL A;  3N4M A;  3J7M A;  5CAZ A;  5FZ8 A;  3W5N A;  4QX5 A;  4OFG A;  4Y33 A;  1S0E A;  4GZ9 A;  3WF3 A;  3RZJ A;  5FZE A;  2ZKN A;  4PBP A;  4YFW A;  5FP9 A;  4JKM A;  1AR8 2;  3FHQ A;  5J96 B;  3AK0 A;  1LB2 A;  4P08 A;  3AZV A;  2J1V A;  1W9F A;  1UIK A;  3KCC A;  3M3C A;  1PM4 A;  2VUJ A;  4TXW A;  2E32 A;  1TME 1;  5D8A B;  3CU7 A;  3IIA A;  3QH7 A;  1NT0 A;  4KWK A;  1N3P A;  5FXW A;  4IEQ A;  5FK7 A;  4PLM A;  3LE0 A;  4XZU G;  3VKN A;  2WRA A;  4J6G A;  1PVX A;  1VB4 A;  2CHH A;  4BPZ A;  1LGN A;  2KA3 A;  5C3Q A;  2WO1 A;  5IK7 A;  4YW2 A;  5KR7 A;  3AP4 A;  5FPV A;  2H6B A;  5JDB A;  2BZD A;  3ZN4 A;  4Q4W 2;  5JR2 A;  3WHT A;  3PIG A;  5LWB A;  4QB2 A;  5CNA A;  2IVJ A;  2UY8 A;  4IUG A;  4AAP A;  1Z7S 3;  4ASM B;  5C4W C;  4NIG A;  2GNT A;  1C57 A;  1RUG 2;  4XZP A;  4NHY A;  4GH4 B;  2PHT A;  1ENX A;  2VMH A;  2D43 A;  1UY4 A;  1M4W A;  5A3U A;  3IBM A;  2WO3 A;  1DCS A;  2JD9 A;  3AMN A;  5D2A A;  5FRA A;  4OZX A;  4EZ4 A;  1W2A X;  3RZM A;  4CCL A;  2A3Y A;  2Z2S B;  5ERL A;  4URT A;  1ZZ9 A;  4MGT A;  4HVQ A;  1W3V A;  4CPB A;  4LLF A;  1AJO A;  4N7I A;  3ZYI B;  2BFU L;  2TEP A;  3GCX A;  2JEN A;  4AHW A;  5FV3 A;  3MIF A;  1S55 A;  1FYU A;  1AR6 1;  2OQ6 A;  3AXE A;  3FLT A;  1VAL A;  1V9U 1;  1XPW A;  2VOT A;  4UYB A;  1LRH A;  5KHI A;  1NE6 A;  4BWO A;  3PTR B;  1BMV 1;  1HRI 3;  4QX1 A;  4AE2 A;  3AMM A;  4O9G A;  4K9S A;  1MVE A;  5C8C B;  2XL9 A;  3ON7 A;  3T3Y A;  4C0B A;  3ROU A;  5KHJ A;  3GCW A;  4CUB A;  1R1A 3;  2O8Q A;  3AKP A;  3K2O A;  5BNP A;  3LA3 A;  3I2J A;  3F2Z A;  4PBO A;  2YUE A;  4S2H A;  1SLI A;  4OUS A;  4BME A;  1Z7S 2;  2YBP A;  3BKZ A;  4DQA A;  4WM7 B;  2CAV A;  5D1I A;  5F5A A;  1PNF A;  3JZV A;  4CEW B;  5C9A A;  2Y6L A;  3POI A;  3O1V A;  2ZAB A;  2O0O A;  4I2O A;  3KB5 A;  4EJR A;  3SEP A;  3VBU B;  5FPX A;  1D2S A;  4COV A;  5FOJ B;  3FBM A;  1K12 A;  4TN7 A;  4XFG A;  4OI1 A;  3LCP A;  1OUX A;  1CVN A;  3ZVX A;  4KWU A;  3N7L A;  1PGW 2;  1COV 1;  4IXL A;  2XJR A;  3GJB A;  5BNN C;  2R6Q A;  1LES A;  2W39 A;  4N7U A;  3ZXE A;  4BU2 A;  2Y8K A;  3VHR A;  3ZSJ A;  4OUE A;  5A3T A;  3UV9 A;  4JKL A;  1RUJ 2;  3WQ0 A;  1PO1 1;  4C1X A;  3INA A;  1AR7 1;  4JHT A;  1BJQ A;  2FCU A;  3IM0 A;  3I8T A;  1FV2 A;  1NCR B;  4HFS A;  3H3L A;  1HRI 2;  5BXX A;  1XYP A;  4LA2 A;  1B35 B;  3ES4 A;  2W94 A;  3U1X A;  2GP3 A;  2B4K A;  1LOE A;  1V6N A;  4G3Y C;  1PO2 3;  4AI0 A;  1G6N A;  3OYW B;  4AFA A;  2LM3 A;  4TSV A;  1WCD J;  2DDU A;  4EN6 B;  2P4E A;  4PDW C;  1PVC 1;  5A7O A;  4CU8 A;  3IB3 A;  1RUD 1;  2WFF 1;  4LIU A;  1GZ9 A;  2BDR A;  5DAP A;  1GP4 A;  3RYK A;  5IVJ A;  2D98 A;  3JB4 C;  1WGP A;  1YI7 A;  2VNR A;  1IS5 A;  1SBE A;  1CR7 A;  5LAT A;  3VZL A;  4JKK A;  4IW3 A;  5FKC A;  2X05 A;  3CJI C;  1ST8 A;  2ZAA A;  5A33 A;  4EQV A;  1EP0 A;  1AXY A;  1G7Y A;  1AYN 2;  4IV1 C;  4KG8 A;  4CUC A;  5C4W B;  2ERF A;  4XDP A;  5FP4 A;  3RJR A;  3RSJ A;  1W0N A;  1W0O A;  2RS3 3;  1IS4 A;  3U75 A;  1OXC A;  4J1W A;  1CGP A;  1DQ6 A;  5E6H A;  1ND2 C;  4CUG A;  2D6N A;  3WD5 A;  1WCU A;  5FZ4 A;  3NV2 A;  5JI7 A;  3WW4 A;  2VMF A;  2NLR A;  3A0K A;  4MH0 E;  3MIH A;  1MS1 A;  5FBZ A;  3AP6 A;  4ET7 A;  1K5M C;  3DN7 A;  2WS9 1;  3ZFF C;  4BQ4 A;  4CDX C;  4NID A;  2OZ6 A;  4GKX A;  2PAM A;  3PVE A;  1MEC 1;  4XFA A;  3J26 N;  3ZMO A;  3FFZ A;  1RUF 3;  5T55 A;  4YW1 A;  4IGP A;  1PO2 2;  3O1T A;  2YV8 A;  2CY6 A;  1ZRF A;  1S0I A;  5C71 A;  3N9N A;  3JD7 3;  5FYU A;  2JJ6 A;  1BK1 A;  1CZS A;  4Y1Y A;  4BLI A;  2PLV 1;  2GMM A;  2ZX0 A;  2XWJ B;  2DUO A;  4XJW A;  2VMD A;  5KWR A;  4GD4 A;  2JG9 A;  1DYP A;  2TBV A;  2O14 A;  3I97 A;  5FYV A;  1K5J A;  3VL8 A;  4O7X A;  1Q43 A;  4CSW A;  1TVG A;  1X8E A;  2A71 A;  2VM9 A;  3PUI A;  2OXB A;  4OI0 A;  5C5U A;  4YVW C;  1KRI A; 
#chains in the Genus database with same CATH homology
 4XUP A;  1JU4 A;  1BHG A;  1UY1 A;  1J83 A;  3NNG A;  2QQM A;  2YG0 A;  2L9L A;  3IDA A;  3NRU A;  2VMC A;  3THC A;  3MBW A;  2C26 A;  3A7Q A;  1OD3 A;  3ACH A;  3SEE A;  1UXZ A;  2YFZ A;  4BXS V;  5DPN A;  5IFT A;  1CX1 A;  2V4V A;  1UZ0 A;  2WQ8 A;  3MO4 A;  1JZ6 A;  3E1F 1;  3HOB A;  2J7M A;  4OMD A;  4XVH A;  2YC4 A;  3LQC A;  2WN2 A;  3C7F A;  1PMH X;  5I0D A;  4A6O A;  4BJ0 A;  4BK5 A;  1UX7 A;  3K4A A;  4JHZ A;  1W9W A;  2W47 A;  4P5Y A;  2W92 A;  1US3 A;  1UMI A;  3VDB A;  2VZR A;  2R7E B;  5LA1 A;  2E26 A;  3GDB A;  1KEX A;  3P1I A;  2QBX A;  2Z4F A;  2C4X A;  4M4R A;  3LEG A;  3ZM8 A;  2VZP A;  1US2 A;  4A4A A;  2YFU A;  3I3E A;  2VZQ A;  3ETP A;  5EJ1 B;  2ZEX A;  4BK4 A;  5EIY B;  1SDD B;  4QB6 A;  3WF0 A;  1PX4 A;  3EYP A;  4W50 A;  4YPJ A;  3ECQ A;  1J84 A;  1UMH A;  4ZZ5 A;  4A45 A;  3HNM A;  3C8X A;  2YB7 A;  3DYO A;  3WNL A;  2VR4 A;  4BDV B;  4TTG A;  5LCW L;  2VO5 A;  2RVA A;  4P00 B;  2WDB A;  3A22 A;  3WF4 A;  2QQN A;  4MGQ A;  3AC0 A;  4DEQ A;  2QQL A;  2VCC A;  4ARY A;  4JX0 A;  1I5P A;  2Y6H A;  2VZO A;  4DUV A;  2QQJ A;  1ULO A;  1GOH A;  2J1S A;  3T08 A;  1CZT A;  3I2F A;  1W99 A;  3SKJ E;  2VCA A;  4AG4 A;  5JXJ A;  1JZ4 A;  4Z2A A;  2VQU A;  2W1Q A;  2VZV A;  1DP0 A;  1SG3 A;  3I3B A;  2VL4 A;  3K77 A;  1UYY A;  5G04 L;  1PX3 A;  3ACG A;  3T09 A;  3ABZ A;  3I2G A;  4L0P A;  4A3Z A;  3HN3 A;  4P02 B;  5J1X A;  2HLE A;  4MO3 M;  2W3J A;  2J1A A;  2VME A;  2ID4 A;  2ORZ A;  1GNY A;  4GWJ A;  3T2O A;  5CZK A;  5JMO A;  2VZU A;  2WZ8 A;  2W91 A;  4CU6 A;  2W1S A;  1O59 A;  1H6X A;  3C7H A;  4A44 A;  1UY2 A;  3WF2 A;  4QDQ A;  3WNO A;  3GGL A;  4PT6 A;  1O8P A;  3WNK A;  3MV1 1;  5CYY A;  3T2P A;  1UYX A;  3OGR A;  3LEI A;  3VDC A;  2RV9 A;  5DMY A;  3DEC A;  4QDR A;  3NJV A;  2VZS A;  1JYV A;  3P6B A;  3VDA A;  1NKG A;  3VD7 A;  5G05 L;  3CQO A;  2XOM A;  1OH4 A;  3WNP A;  1UYZ A;  2QQI A;  1K42 A;  5IHR A;  2E33 A;  2VZ3 A;  1NUK A;  2J22 A;  3K75 B;  1R64 A;  2B9V A;  2Y6G A;  3LPG A;  3OG2 A;  1GU3 A;  3D3A A;  1UY3 A;  1L7R A;  3DYM A;  3T2Q A;  4QAW A;  2CDP A;  5JXI A;  2RJ2 A;  4CU7 A;  2CDO A;  4W4Z A;  2W9X A;  1WKY A;  3OB8 A;  3OGS A;  1LNS A;  1EUT A;  3FN9 A;  4QX2 A;  2W46 A;  4DEV A;  4M4P A;  2XHN A;  1JU3 A;  3WNN A;  1H6Y A;  3OEB A;  3OEA A;  2WN3 A;  3ACI A;  2VJX A;  3HNB M;  3I3D A;  5IJR A;  3VD4 A;  2VQT A;  2JDA A;  2WAO A;  3OBA A;  4OMC A;  1RYY A;  3ACF A;  4PQQ A;  4D0Q A;  3K4Z A;  4XUO A;  2ZEW A;  3VD3 A;  4XUQ A;  3III A;  2V5D A;  1T2X A;  1CIY A;  1JZ5 A;  1UXX X;  4CU9 A;  3CMG A;  1UWW A;  4A42 A;  3UES A;  2X10 A;  5JUV A;  2Y6J A;  3T0D A;  1W8N A;  2WAA A;  3HNY M;  3WSO A;  4CVU A;  1YQ2 A;  1JYN A;  2DCK A;  2C9K A;  2ZXQ A;  1JZ8 A;  4DXT A;  2ZEZ A;  4KMQ A;  3JXS A;  4QPW A;  4W8J A;  1XC6 A;  1IQD C;  4ZXE A;  1NAE A;  1W9T A;  2PQS A;  1JYW A;  2HYX A;  2OKX A;  5C7G A;  3UNP A;  2W87 A;  3LEK A;  4ZY9 A;  3C7O A;  2VC9 A;  4ARX A;  2BGP A;  2BGO A;  3EB7 A;  1UY0 A;  4DXS A;  2XQX A;  5B4N A;  2BER A;  5LA2 A;  2EID A;  5EJZ B;  2EIB A;  1GUI A;  4LQR A;  4DXR A;  3NQH A;  5C70 A;  4AAX A;  4XUT A;  2JKX A;  1OT5 A;  3U37 A;  4QB1 A;  3LPF A;  3K46 A;  5HPO A;  3VD5 A;  1CZV A;  4E8C A;  2WO2 A;  3I2I A;  4PF1 A;  1XNT A;  1OF4 A;  3CIH A;  3CDZ B;  2WAB A;  3PUH A;  1GMM A;  4KI5 M;  5DN2 A;  3VD9 A;  5LA0 A;  2W5F A;  3W5N A;  2EIC A;  3WF3 A;  3CZJ A;  4GZ9 A;  4JKM A;  3FHQ A;  4QX3 A;  2E31 A;  1JHJ A;  4P08 A;  2J1V A;  5A1A A;  4TXW A;  2E32 A;  2J1R A;  3I2K A;  3LE0 A;  4XZU G;  3C7E A;  1JI6 A;  2WO1 A;  1K3I A;  4D8M A;  2BZD A;  5JR2 A;  4OYU A;  4QB2 A;  4IUG A;  1GOG A;  4XUR A;  2J1U A;  4OZO A;  4GWI A;  3GXU A;  5IYY A;  2LW8 A;  2KD7 A;  1UY4 A;  2WO3 A;  2XON A;  3MUY 1;  2JD9 A;  3FL7 A;  2QQK A;  3I2H A;  1P8J A;  2VZT A;  2QQO A;  2Y64 A;  4RYD A;  4MOA A;  1K45 A;  3HPN A;  1XPW A;  2X09 A;  2VOT A;  3K4D A;  4LPL A;  3CZU A;  1W9S A;  1WCQ A;  2W1W A;  5JXG A;  4DUX A;  4QX1 A;  2WBK A;  1MPX A;  1PMJ X;  4CUB A;  2V72 A;  2J1E A;  3I2J A;  3F2Z A;  5HXM A;  2VCB A;  1O8S A;  1F4H A;  3WEZ A;  3T0B A;  3THD A;  4CUA A;  2WUH A;  2BBA A;  2Y6L A;  2EIE A;  1KGY A;  2WZE A;  3SEP A;  2J1T A;  1K12 A;  3IAP A;  3J7H A;  1F4A A;  4KWU A;  5F7U A;  4MAD A;  3C7G A;  1GQP A;  1L7Q A;  5IFP A;  2Y8K A;  3WNM A;  4OUE A;  4JKL A;  4A41 A;  3WQB A;  1ULP A;  2W1U A;  2VTF A;  1TG7 A;  1DYO A;  3HJR A;  4QDS A;  4HG6 B;  1JYX A;  2W94 A;  2VZ1 A;  4E8D A;  2B4K A;  4UOJ A;  1OF3 A;  2DDU A;  4CU8 A;  1D7P M;  3OGV A;  3MUZ 1;  2LS6 A;  3IB3 A;  4DUW A;  3W5M A;  3BN6 A;  3DYP A;  4RN5 A;  3HEI A;  4MGS A;  4QX0 A;  1JZ7 A;  4LHS A;  3IAQ A;  4JKK A;  2X05 A;  1HN1 A;  3A21 A;  1JZ2 A;  3UET A;  3GM8 A;  4CUC A;  1EUU A;  4ZZ8 A;  1GOF A;  1W0N A;  4UI9 L;  3BGA A;  2VMF A;  1JZ3 A;  5JXH A;  4ET7 A;  3NJX A;  4UAP A;  3WF1 A;  3A23 A;  1NX9 A;  1SHW B;  3FHA A;  3MV0 1;  4FI9 A;  5DQ0 A;  2W95 A;  2WYS A;  5FUI A;  5C71 A;  2JE8 A;  2ORX A;  2Y6K A;  1CZS A;  2ZEY A;  1W8O A;  2VMD A;  3SKV A;  5B4X A;  1XNA A;  1DLC A;  2DCJ A;  3I97 A;  4LKS A;  1TVG A;  2YC2 A;  2VM9 A;  3PUI A;  3T0A A;  4XUN A;  3CKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...