1UMIA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
GSHFYFLSKRRRNLLRNPAGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umiA00
3K46A 3I3BA 3C7OA 3LQCA 2J1EA 3MV11 2VR4A 2Y64A 2YB7A 2KD7A 2C9KA 1W8OA 2BGPA 2WQ8A 3WEZA 1OH4A 2YG0A 2BBAA 1H6YA 1K42A 4XUPA 3UNPA 3CMGA 5JXGA 3THCA 3CDZB 2VL4A 2QQMA 5A1AA 1DLCA 2VZTA 4QPWA 5CYYA 5J1XA 2VOTA 3HNMA 3HEIA 4CU6A 2VZRA 2EIDA 3BN6A 3WNNA 3F2ZA 3OB8A 1NKGA 4A6OA 1PX4A 3SKVA 4E8CA 4W50A 1NUKA 4Z2AA 4D8MA 2R7EB 5HXMA 1JZ8A 2EIBA 2JDAA 2WABA 2VCBA 1JZ4A 4OZOA 4DUXA 5F7UA 4JKKA 4OYUA 1TVGA 1US3A 2XQXA 2V72A 2WBKA 3C7GA 4PT6A 4E8DA 1CX1A 3ACFA 2HLEA 4LQRA 3SKJE 2Y6HA 5LA2A 2QQKA 1CIYA 1EUUA 1CZTA 4MGQA 2WUHA 1GOGA 3CQOA 1PMHX 1CZSA 1JYVA 3OG2A 4DEVA 5JXJA 1RYYA 1UZ0A 3LPFA 3VD3A 3A22A 5IYYA 2W91A 2LS6A 4HG6B 1OF3A 1W8NA 2VZUA 4OMDA 5DQ0A 3VD5A 1UY1A 2YFZA 2DDUA 2WN2A 3AC0A 1XC6A 2V5DA 3VDCA 1O8PA 4CU8A 2XOMA 3I2FA 1K45A 3HJRA 3THDA 4QDQA 3WF2A 4RYDA 3FHQA 1SG3A 1F4HA 5IFTA 3I97A 2BZDA 4D0QA 3C8XA 4JX0A 4XUTA 4XUQA 1JU4A 3WNOA 3DYMA 3CKHA 4DXRA 4W8JA 3NRUA 1L7QA 1GNYA 3OBAA 2ORXA 2V4VA 3C7HA 2J1SA 4XURA 2W47A 2Y6LA 1JYNA 3VD7A 1LNSA 2VMDA 1GU3A 4M4PA 3I2KA 3IDAA 4LKSA 1SHWB 3T2OA 4ZZ8A 2W94A 4JKLA 1GUIA 2Z4FA 1OF4A 1UX7A 1W9SA 4ET7A 4QB2A 2J1VA 3VDBA 1I5PA 1UY4A 1NX9A 3CZUA 2L9LA 4GZ9A 3K4AA 4QDRA 2DCJA 1KGYA 3VD4A 1GMMA 1UY0A 1PMJX 2X05A 2RVAA 2XHNA 4QAWA 1XNTA 4M4RA 4ZY9A 2VZOA 2W1UA 1UYYA 2X10A 2EICA 4CVUA 3HNYM 3E1F1 5EJ1B 4BK5A 4CU9A 1UY3A 3K75B 3MBWA 1K12A 3A23A 5EIYB 3MV01 4ZXEA 3OGSA 1L7RA 3T0BA 1MPXA 2VMFA 3I2GA 5C7GA 2EIEA 3DYPA 3PUHA 1P8JA 2QQIA 3WF4A 4MGSA 1JZ6A 1YQ2A 1EUTA 3LEIA 5LCWL 1H6XA 4A42A 2W46A 1GQPA 3IIIA 4P02B 3HPNA 4MOAA 5B4XA 2VCCA 4PF1A 3WQBA 4CUAA 2WDBA 2JE8A 4QX0A 4IUGA 4DUVA 1ULOA 4XUOA 4CUCA 3WSOA 4JKMA 3T08A 2ZEXA 2BERA 1GOFA 3HNBM 5IHRA 4OMCA 2E31A 2ZEWA 3T09A 3UESA 5HPOA 1UXZA 4UAPA 3IAPA 3PUIA 3ECQA 2W1SA 1J83A 2VTFA 2E33A 2ID4A 3EB7A 4A41A 3T0DA 1W9WA 2VO5A 2ZEZA 3T2QA 4A45A 2XONA 1O59A 4QX3A 3DYOA 5JMOA 1JU3A 3GGLA 1ULPA 4PQQA 2VZ3A 3A21A 1R64A 1K3IA 2X09A 1TG7A 4AG4A 3WNMA 1OT5A 4QX2A 2W3JA 3C7FA 2VMEA 3LEKA 3J7HA 3LPGA 4A4AA 1W9TA 2QQNA 5B4NA 2W5FA 2VJXA 1JI6A 4XUNA 3WF0A 3I2HA 4P00B 4GWJA 1XPWA 5DMYA 5G05L 4LPLA 2WYSA 1UXXX 3JXSA 3U37A 1SDDB 3ETPA 3P6BA 3P1IA 4MO3M 4KMQA 2B4KA 2QQJA 3LEGA 4DEQA 1JYWA 2YFUA 3WNPA 2WAOA 5JXIA 2VMCA 3OGVA 4XVHA 3EYPA 4LHSA 1O8SA 3MO4A 2C4XA 3CIHA 3LE0A 3FHAA 3CZJA 4RN5A 4W4ZA 5LA1A 2E26A 2HYXA 3K77A 2ZEYA 3VD9A 3MUY1 2CDOA 2QQLA 2VCAA 3ZM8A 2ORZA 4MADA 2VQUA 1JZ3A 1HN1A 3K4ZA 4BDVB 4KWUA 3I3DA 4JHZA 1NAEA 1WCQA 1GOHA 5I0DA 4QB1A 3ACIA 5EJZB 2JKXA 1UMHA 1JYXA 2E32A 2VZSA 5CZKA 1PX3A 2CDPA 3NJVA 2VM9A 3BGAA 3UETA 1KEXA 3A7QA 2W9XA 3VDAA 3MUZ1 5C70A 2YC4A 2LW8A 2RJ2A 1IQDC 2WN3A 3C7EA 3I3EA 3GDBA 2B9VA 2J22A 4QX1A 2WO3A 3WF3A 3I2IA 2WAAA 3GM8A 1UWWA 3OEBA 3NQHA 3ACGA 1XNAA 2VZQA 2C26A 2OKXA 2Y6GA 4CU7A 2J1UA 2W95A 2WZEA 4ARYA 4QB6A 4P5YA 4BXSV 3I2JA 3WF1A 3W5MA 1W99A 1F4AA 4UI9L 4XZUG 5C71A 4YPJA 1DYOA 3IB3A 3WNLA 4A3ZA 5JR2A 1UYZA 2J1TA 1J84A 2VC9A 1WKYA 2QQOA 4DXTA 3SEPA 5IFPA 2J7MA 2VZ1A 5LA0A 4AAXA 2BGOA 1JZ5A 2DCKA 3T0AA 3FN9A 4A44A 1T2XA 2WO2A 3ACHA 1JHJA 1W0NA 2Y8KA 3WNKA 5IJRA 5FUIA 4TTGA 4CUBA 3W5NA 3D3AA 2W92A 3DECA 3OGRA 5JXHA 1OD3A 5DPNA 2W1WA 2Y6KA 2VZVA 2J1RA 1UYXA 4FI9A 2ZXQA 3HN3A 2PQSA 3FL7A 3T2PA 1BHGA 2Y6JA 2W1QA 4ZZ5A 1UMIA 2RV9A 1JZ7A 2W87A 3ABZA 2WZ8A 4BK4A 1JZ2A 4P08A 1DP0A 3K4DA 3OEAA 2VQTA 5G04L 2VZPA 4UOJA 4TXWA 1D7PM 3SEEA 5JUVA 1UY2A 3NNGA 3GXUA 4OUEA 1CZVA 3IAQA 4L0PA 1US2A 4ARXA 2YC2A 5DN2A 2QBXA 4QDSA 4DXSA 4KI5M 2J1AA 4BJ0A 4GWIA 4DUWA 3HOBA 2WO1A 3NJXA 2JD9A
chains in the Genus database with same CATH superfamily
3JQWA 3WQ7A 2F4LA 4XQWA 4E2SA 1VMFA 1WW7A 4D6QA 1UQXA 4N9IA 1RINA 2JXAA 3MV11 3FLPA 4Q4X1 4Y5TA 3AFKA 3DN7A 1ENSA 2ADEA 1I5ZA 1W8OA 1XSRA 4MSVA 4COYA 5FR3A 2P3KA 1OLMA 5FLJA 2DYCA 2OPWA 1XB9A 2W0XA 1FXZA 2D5FA 1K42A 1SBEA 3TWIA 2W39A 4AVBA 4XUPA 3UNPA 3VKFC 3CMGA 3ZMNA 1F31A 1OLME 1OUSA 1F5JA 1DZQA 4QHZA 4EYUA 3AZVA 1UOGA 3R4DB 4NAMA 5FPBA 1OKQA 4LE4A 3WNXA 2RR13 2CYFA 4BCUA 4OVEA 3TAYA 3VN4A 3VDDA 4CCCA 3E5UA 1XBFA 5GZEA 5APAA 3RYPA 3ZFFB 5IK8A 1IZ3A 3I3QA 4MZUA 2WC2A 4HVQA 1W90A 4XYXA 1LHWA 4QPGC 3O1UA 3M3OA 5DDJ2 5FRAA 1IGOA 5C4WB 1RUC1 4AEDA 2DVAA 3VBFB 4OQ9A 3MIEA 5FZIA 5FZ7A 3SKVA 4E8CA 2HWC2 3KV9A 2R49A 1PO21 1BBT3 2JX9A 4N7IA 3O0VA 1WA4A 2A70A 1NG0A 2R7EB 3GJAA 3ZFEB 4CDXC 1YQCA 2EIBA 1V00A 2QZ2A 4QX7A 2JDAA 1GZWB 2MEV3 1BBT2 1W2OA 4ZS3A 4XJZA 4B7KA 2AACA 4DUXA 4JKKA 4OYUA 4PDWB 5FYCA 2R16A 4AK3A 5F2SA 1W2NA 3BVCA 4JQTA 4XAEA 5CG8A 4ONUA 2FDHA 2ZKNA 1K5JA 1YQ6A 1RJ7A 4NRQA 4FPEA 1PO23 4M3CA 1KQRA 5JIUA 2VNOA 4XFIA 1AF9A 2Y6FA 3JD73 3ACFA 3P3PA 1E5RA 1GQGA 5BNNC 1WCKA 2RS31 1VRH2 2O14A 1Z7S3 5TSWA 2OYZA 1ZZ8A 2QUOA 3JU9A 5LW9A 1FNZA 3IPVB 1WBLA 2I07B 2WUHA 1OQEA 3LDKA 1EPZA 4L9BA 1WCUA 4CDWC 4P9JA 4IQPA 1ZRFA 2RS32 1H4HA 1W06A 2Z79A 4MYEA 4I0AA 4UW3A 3VBSC 2BVBA 1G6NA 2FZ2A 2D44A 1NQJA 4NWVA 1WBFA 2ZMKA 4B7EA 5IYYA 4GH4C 3SLIA 1W3XA 2W91A 4BU2A 4HG6B 2CNAA 4QX8A 1SLBA 2G19A 3Q8FA 3VBHA 3FUOA 1TQ5A 1RUE1 2VW0A 2ZJCA 5FZ9A 2G1MA 4OI4A 1NZIA 4F83A 4HONA 4QKDA 3LSDA 3ZN5A 4GIQA 5FZLA 4E4ZA 5IVCA 2DF7A 3I2FA 1AL21 4Q5OA 3WINE 1JHNA 2D98A 1K45A 1UOBA 3RJ2X 1ASJ1 3DPRB 2PAEA 3EQEA 5ERLA 2P1BA 2A6VA 4W6YA 3FHQA 3J7LA 1F4HA 5KXCA 2BZDA 1X36A 4U2AA 2H0VA 1FX5A 1JH5A 3AKSA 2OT7A 4XUQA 1JU4A 4PBPA 1E57A 3H8XA 3CKHA 3T4HB 4W8JA 2VUJA 2YGLA 1L7QA 4F7ZA 4C1WA 3OBAA 4HXCA 1I1EA 2ORXA 1GNHA 3RGBA 5FPXA 1UPIA 1CPMA 3EJKA 4WV8A 1J3PA 2J1SA 4LNVA 3TN93 4XQ4A 4P9YA 4Y4YA 4ZXKA 4YFZA 3G7DA 5E6HA 3BI3A 3BYWA 4Q4Y2 2PFWA 5D1IA 2VMDA 1GU3A 5FXXA 1LOFC 5EV7A 3IDAA 4LKSA 1SHWB 3PU8A 4K6BA 1L7LA 1MZEA 4ZZ8A 2PHTA 1BXHA 1UU4A 1SPPA 2PTMA 3VBUB 4ASLA 2Z4FA 3LKJA 1VBE2 5IW0A 2A6XA 4FPLA 1OF4A 3DL3A 2RE9A 4AFBA 2CY6A 4Y1XA 1W9SA 2VOKA 4J25A 1LENA 1DBNA 1YFUA 1U5XA 3UJQA 5LWBA 4FTSA 5JOWA 1QH7A 4E4DX 2PHLA 4YWAA 3W20A 4LOTA 1EAH2 4JGYA 2WWSA 4JRAA 1RUH1 2JDKA 4S2HA 4AF9A 1OQ1A 1ZRDA 1PGL1 5JI9A 4GMP1 3TNPB 1RUI3 2L9LA 4GZ9A 3ZXFA 1KGYA 4GD4A 1QY4A 4J1WA 3VD4A 1GMMA 2X8KA 2FDFA 4MXWB 3URFA 4QPGB 3ZSKA 4Z82A 2XHNA 5F3EA 4CXYA 2DV9A 2OZJA 3BODA 3RPQA 2EXJA 1OFNA 3GALA 3GHNA 1MZ6A 5FY5A 3I54A 1BEV1 5JOZA 1JOPA 3S7EA 4AHXA 1NCQA 2K9ZA 3NV3A 2WA4A 5DUXA 3AB0A 2YPJA 4CVUA 1RL3A 4IV3B 4KWKA 1G9AA 2JDZA 1R092 4IV1C 4FPOB 4Y5SA 1AYM3 1X8MA 4BK5A 1ZREA 4M00A 4OHZA 2WNVA 2IVJA 3ILNA 4CP1A 3DPRC 4IDZA 1W6MB 3V0BB 2JWPA 5C8CC 3AMMA 3HR9A 4H14A 2PHDA 4YW1A 1OQDA 3M3QA 4PCRA 3AX4A 1LEDA 4GJYA 1MPXA 4KQ7A 4MLOA 4LIVA 1A78A 2VAUA 1FYUA 1GLHA 2XJRA 3I8TA 4QU1A 1W9FA 3N3HA 3OPTA 1AJOA 5IAXA 5F5QA 4XFFA 1YQ2A 2RS11 1H4GA 4P9WA 4FVVA 3VZKA 5FPAA 4MGZE 2D6LX 4CDQC 1YRZA 4YVWA 5I8SA 3JB4C 2W46A 1PHMA 4N7UA 4P02B 4YW3A 3FZ3A 3PVEA 3RYKA 4ASKA 2FDJA 3U0ZA 2IXCA 3PMEA 1FPN2 3ZDVA 3WSOA 3AJZA 4WVWA 1UOJA 4C8DA 1JOBA 1Q43A 1VBB3 4UW5A 3N9PA 1ZZ6A 2D6OX 5FZ8A 2BERA 2Y38A 4WVVA 4R4ZA 1DGWA 5EJ3A 4GMP0 4OMCA 4UFKA 2ZMLA 1GP6A 1XRUA 2VVFA 5FO8B 3T09A 2JDHA 1HRI2 1RIRA 2DVFA 3HD8B 3O0WA 3ECQA 2W1SA 2ZHNA 4XFCA 1REDA 4RS5C 4Y3OA 4DIQA 1Q8QA 2F6BA 3ZXAC 3UL2A 4HKWA 2N7GA 2ENRA 1RUC3 2GSYA 2ID4A 5JZGA 2XJTA 4NR1A 3EB7A 1W9WA 3HBKA 3ZYFA 4C0BA 4BQ4A 1QQP1 3T2QA 3WHTA 4Y24A 4K7JA 5FUPA 1QKQA 3H42B 4NHKA 3DYOA 2AEYA 3HVDA 1K5MC 4QXCA 4OI1A 4BIOA 3ZYHA 1JU3A 1OBNA 1XNBA 1XU1A 4S2DA 1AR63 1K5MA 2RR11 2HWB1 3ACLA 4AQTA 3HT1A 3B7MA 5JMCA 5FZFA 3ZDSA 3USUA 2X09A 1K3IA 4L8QA 2VUDA 2JDNA 2YXSA 4TSVA 3V65A 3BU0A 1ENXA 1UL9A 3SXWA 1WW6A 3AMPA 3KCXA 4DS0A 3FX3A 2DVDA 4YZ1A 1MS5A 1DQ6A 1ND2B 1LOEA 3AVRA 4QGMA 4MGIE 4ZU5A 5FXVA 5FYZA 1XYNA 2AYHA 3FBYA 5FYIA 4P14A 1ONAA 3FFQA 5J37A 4DOUA 4FAGA 1N1SA 2FQPA 5HCAA 4BQ2A 4GWJA 2HWF2 1ZBE1 3ILRA 2IXIA 2GZWA 3PJYA 1W6OA 2WYSA 1DFQA 1UXXX 4KL1A 2XUEA 3POFA 4I3GA 4EV0A 5JPNB 3DUIA 3P6BA 4NO4A 3P1IA 3R4UA 1W6PA 4MO3M 4KMQA 5F5AA 5CFCA 5C9AB 4DEQA 1Y43B 2YFUA 5JXIA 1FAYA 1PGL2 4HMZA 4XVHA 3OGVA 2UWAA 1C8NA 5DZEA 5FP8A 3BKZA 3MO4A 5LBBA 3E6DA 1XU2A 4LKEA 3HQXA 3ELNA 4XHXA 3GZAA 1PIV3 5LA1A 1CX4A 2P6HA 3WOGA 1G7YA 2R30A 3Q8BA 1QEXA 1WW5A 2PLV3 1FV3A 3J8F3 3VD9A 1RC6A 3MUY1 1UU6A 2TUNA 4JDMA 2JENA 1MACA 3PTYA 3ZM8A 1WWYA 2DURA 4CP9B 5AC91 4MHRA 2XWJB 1T6GC 3TEXA 3WDVA 4AWDA 3MGUA 1AR93 5DUUA 2JG9B 3BOWA 4FPYA 3AKRA 3QBQA 1HX6A 3KLSA 1GICA 5LRSA 5C3QA 2FMYA 4KWUA 4YARA 1AR71 4CCEA 3F95A 1QOSA 2WNVC 4QQHA 1LOBA 4JGZC 5D8AB 1LHVA 1CN1A 3VHNA 3ZN6B 4UFHA 1LAJA 2A6ZA 1UNBA 3DF0A 2ETEA 3WG1A 2ZAAA 1QU0A 5K0UB 4Q26A 3CNAA 3IKWA 3FBMA 1PX3A 2NM1A 1C3HA 5CFDA 2X5IC 4LUMA 2VM9A 3ZR5A 3UETA 5T5JA 3A7QA 5K0UC 2WZR2 5A32B 4DINB 1GP5A 2WWUA 4JDOA 3OBTA 4P9XA 5C70A 2RG4A 2BYVE 4NHXA 5EXOA 3UV9A 1RUG1 3FE5A 3LA2A 3VBHC 4YG6A 3ZYRA 3MW4A 4YM3A 5BV6A 5JPMB 1BEV3 3IMMA 4EQVA 1HIXA 3PTRB 4QX1A 3S5AA 2WO3A 4YNIA 5BNOC 1WMXA 2PLV2 3J8F2 5HI0A 5FYSA 4BE3A 1XE7A 3H1YA 1V9U2 3S57A 2QNKA 2WFF1 3TN91 1ULCA 1RUH2 5JIAA 1G9BA 4XQDA 2IXKA 4KWJA 3KWVA 3VKNA 4GMP3 4CTEA 4OUSA 4MGKE 1S55A 4UBGA 2W95A 2XLFA 2IFWA 4C90A 5FK7A 4QB6A 3BTXA 2UWCA 4P5YA 3WR0A 1QOOA 5T5LA 1UYPA 4N8MA 1ZBA3 1W99A 1L3JA 2ZCWA 1F4AA 4UI9L 5F9TA 2AC1A 5T5PA 1PO22 1FMD1 4RA0A 3IB3A 4HN1A 3AZZA 4QXKA 3WNLA 1UAIA 4GA9A 5JR2A 1V9U1 3OBZA 4EN9B 2VW2A 3PUSA 2XBO1 4RR3A 3WVJA 4BB3A 1J84A 2A6WA 2VCMA 3D8CA 1AL23 3SEPA 2PLV1 3J8F1 1OLRA 1BMV2 2C9AA 5LBCA 1R1A3 4I3PA 4AAXA 3LSEA 1JZ5A 1EV12 2DCKA 2GN7A 5EFUA 4K21A 2YPDA 4UFJA 3OY8B 4WM7A 3T3YA 1HV0A 2XVLA 1UIJA 2DBNA 4BMEA 4CDUC 3FN9A 3POGA 4AHZA 2P2KA 3R4SA 3ACHA 3ASIA 2Y0IA 4LT5A 3RZKA 4PIXA 2Z2SB 1OSGA 2QFEA 4PDWC 4R8HA 5M0TA 3W5NA 3N4MA 3WXPA 2WINB 2MPFA 1O5LA 2ZZQA 2Q8CA 1OD3A 3OTFA 1YEWA 4XMAA 1GNZA 1E5IA 3VBOA 1YWKA 3UKVA 3IMNA 1BZWA 4RR3C 2E63A 3JZVA 3HN3A 3FL7A 5JSOA 4NE9A 2Y6JA 1F35A 4BPZA 2JG8A 3VV1A 4BQ1A 4D69A 2P3IA 4H3WA 3LFIA 3JD71 3PVNA 4NIGA 2ZX3A 1JZ7A 4MXWA 4CXXA 2XUMA 2VXJA 2ZGUA 1OC1A 4B4QA 3N36A 4S2GA 1H1IA 2I74A 3ON7A 4RS5B 3U10A 3ZOIA 1O3QA 1X33A 1H1AA 4P08A 4B4PA 2NMNA 5L9BA 2GP5A 2AZ5A 5G04L 4CDWA 4XF4A 3ZYGA 1QOTA 3N7LA 1KRIA 4JGYB 4O9EA 3ZXLA 1KD7A 1VIWB 4Q8KA 3ZSMA 5JUVA 5A6QA 2D6NA 3O12A 4OUEA 4XCBA 1VAKA 1NLQA 1WA6X 1UO9A 4L0PA 4ARXA 4OZXA 3PIJA 3T1MA 2XHKA 2QDRA 2CWSA 1W04A 2R063 4Q1RA 5J09A 4KI5M 3AL5A 2MHFA 1RUF1 1H8TB 2JG9C 2H6CA 5IVFA 1SPPB 4DUWA 2DCZA 3HOBA 3H8OA 1HRI3 3DKWA 4LO5B 3ZXDA 2VE1A 3I3BA 1GR3A 2B8MA 3PVOA 1LEMA 3C7OA 4Q0QA 3LQCA 1DLLA 4K40A 4IEOA 5T55A 3H7YA 5A33B 2Y64A 2YB7A 3LAGA 2HWE1 4K1YA 2C9KA 4NIAA 1OOPC 1EPWA 1TME3 1DU3D 1ZX5A 2ARBA 2XPJA 4TLFA 4WM7C 5HXVA 3CJIC 4OQ8A 5FY1A 4P5HA 3E97A 2YG0A 4XJUA 2GNMA 4JC1A 5IAVA 2HBTA 2BW8A 1RMU2 4AHWA 1U0AA 2E53A 1RUD3 5C8CB 1IPJA 5FZ3A 3AP6A 1RUC2 4A7YA 3IWZA 1S2KA 3I4IA 4XF0A 3KM5A 2OA2A 2Q30A 4XFGA 2VL4A 5C3OA 1A34A 4XOGA 4IGQA 3KMHA 1DLCA 2O0OA 4Q4X3 2VZTA 1RHI2 1IOAA 5CYYA 4EZ4A 5H9SA 4PI2A 1XNDA 4HETA 5C3PA 3K3OA 5CAZA 4JRLA 4YFWA 4PLOA 5T54A 1OKOA 3WDXA 5FLIA 3AYEA 2EIDA 3BN6A 3WNNA 4RFT0 3F2ZA 4AGGA 3L9JT 3RJRA 2GH8A 3JB8A 1BK0A 1NKGA 2XJPA 3N7KA 3VBHB 4A6OA 4W50A 5LRRA 5T3NA 3RQ0A 3OD0A 1FT9A 1VBA1 1NUKA 3H7JA 2D6PA 3KB5A 3NAPB 4J6GA 4WVZA 4YZ4A 3WW1A 1LESA 1GWLA 4IERA 3ENRA 4RFRB 2HBUA 4GALA 2QDNA 3AYDA 4AI9A 3SH3A 1FI2A 1W39A 1W8TA 2BWAA 2X5IA 4Y1YA 1Z0HA 4JTOA 4IEVA 4RSUA 1XYOA 1TVGA 4QT6A 2XQXA 2WL1A 1VRBA 1IKQA 5IVVA 4FPCA 2SLIA 4E8DA 3AMHA 4B8EA 1W2UA 2OS2A 2WSUA 1VBA3 4HSJA 1CPNA 4V2VA 1W6QB 1EAH1 4ZHNA 4Y20A 1Z78A 4COUA 4AI1A 1LKNA 2XQRA 4LQRA 1HQWA 1CJPA 1LGCA 2Y6HA 3SKJE 2ZHMA 5LA2A 4M3CB 4OHYA 1RUF2 5DUWA 3O5SA 2BFUL 3Q9OA 3CQOA 1GOGA 4MGQA 2RDSA 1RMU3 3M7AA 2R041 1CAWA 3OG2A 4DEVA 1RYYA 4L2NA 4JAAA 4AFCA 2P3JA 1PIV2 2UU8A 5J96B 3NJYA 2LS6A 1JMUB 1OF3A 3HT2A 5FYHA 3TEZA 4OMDA 1MEC2 4MGYE 3VD5A 4ES9A 1C8M1 1HJGA 5KXDA 2WN2A 2Q4SA 1RUD1 4LTAA 5C4WA 4EE2A 4Z8BA 1HXS2 1DF0A 1PZ9A 1XC6A 4HKLA 2V5DA 5L19A 1NCRA 1RXFA 4FPKA 4CU8A 1MVQA 5FK8A 1BK1A 1GBGA 2WS91 2Y60A 4HK9A 2WNUA 1Y3TA 2R0HA 4CCNA 1YCIA 2WWJA 1YUDA 3THDA 2HWF3 3ZLIA 2EXKA 4YGDA 2A75A 1W8HA 4QDQA 2XH6A 3UK9A 3RFRA 4Z92B 3QH6A 2YGMA 3WD5A 4CPBA 3ROUA 1GQHA 2PQQA 2BOJA 1YFYA 3I97A 1QJX3 1SCSA 4HL0A 5HV0A 2HKXA 3VBRC 4FFFA 3A0KA 4JX0A 4XUTA 2LROA 4AQ2A 3VBRA 5L7OB 4YG0A 3RWNA 1OLQA 3B5LB 5ANQA 3E6CC 4DXRA 1VBD2 2WS92 4CP0A 4IEUA 4CYDA 5CBLA 2GMMA 2X29A 1GNYA 5FZHA 2R062 5JSRA 2BGCA 2K46A 2ET7A 5FIXA 2ZGSA 1S1AA 5FYYA 4EN7B 3ORJA 4XC9A 4EN6B 5H9RA 3KV5A 2ZOEB 4RHV1 5FQ0A 1HB4A 2XL7A 1W8FA 3VD7A 4F3JA 1OMIA 5L36A 1S0CA 3H3UA 3T2OA 1W6NA 5H9QA 2XVGA 2WT1A 1PK6A 1NCRB 2GP3A 2F4PA 3WZ1A 1HXS3 1OXCA 1GUIA 1UMZA 2IFRA 3SQOA 4ZU7A 2YY1A 4PLMA 3PHMA 3O1MA 4QQ2A 4UF0B 4LIUA 4UFIA 1MQTB 2D6KA 4HFSA 2CL2A 5H9PA 1QNYA 4XBNA 1QQP2 3ZKYA 1HRV3 3VDBA 3PIGA 3JBG2 1I5PA 1UY4A 4RQPA 4YM1A 4N90A 1SFPA 4YZ2A 3B69A 3K4AA 2VTXA 2ZZJA 1EP0A 1OH3A 1W3VA 4FXKB 4QDRA 4V1PA 4CEYA 4I01A 4E27A 1HRV1 1RUOA 2DU1A 1R083 3VZMA 1VBD1 1FPN3 4KG8A 4QAWA 1J58A 4GULA 2PHXA 4QKBA 5E16A 1W6QA 3IT8A 1EV13 3O1OA 2B42B 5HBAA 2NYYA 1TMF2 4LBLA 3GJBA 4RHV2 2VPVA 4KG0A 3U4SA 3E1F1 4Q29A 5LBEA 1ZZ7A 1LOAA 3KF3A 4XABA 5CIRA 3MBWA 4AE2A 3LIGA 1JBCA 2GH2A 5EIYB 5FBJA 1V6KA 2XMLA 3MV01 5I8TA 1WW4A 1NYWA 2D5HA 1NY71 3H9AA 4Y1UA 5CKMA 4YVWC 5FMBA 5CFCC 3V64A 2LM3A 1SCRA 2VMFA 4QPIA 1AR81 1YJKA 1IS5A 2ZPXA 2RDQA 1H30A 4DXZA 5DAXA 1AYN3 4X8NA 5GM0A 5DAPA 1U5IA 2FCUA 1EYBA 4MV2A 5E89A 3VHPA 2BOIA 1EUTA 1O5UA 1QJU1 4TYSA 5SV5A 1SLLA 4HKOA 4A42A 4CCDA 1GQPA 4CDQA 2EIGA 1LOFA 5AC92 4XAAA 5C3SA 1CGPA 4MOAA 3D5OA 2HYKA 5GLTA 2VBDA 2VNGA 1YI9A 1AZDA 2YBKA 1MQTA 5FKCA 3M3CA 4DUVA 5BNQA 4XUOA 3PMSA 4IE5A 1Y9QA 3PURA 2YU1A 2D93A 2ES3A 1GYKA 5GJ6A 3EXUA 2D6MA 1VRH1 5DDJ3 1RUG3 2PAKA 5C8CA 2IXHA 1SMVA 3T08A 2QQUA 2OZ6A 4PJYA 3RI8A 4CRQA 3AM2A 1QXRA 3CJIA 5LATA 3HNBM 1LODA 4LBQD 4DPNA 4CE8A 3LZZA 5EP9A 5FYUA 3B94A 3TRSB 3S7IA 1PIV1 2QCSB 1UXZA 2QVSB 2TEPA 4H7MA 2WQZC 1J83A 4LHLA 5A33A 1E5SA 2E33A 1ND3C 2BTVC 1DZTA 2WKKA 2AREA 5BUVA 1WLWA 1ZZCA 3M4FA 5F5CA 5KXEA 2ARAA 2QZ3A 4GB33 4A41A 5CADA 1RITA 5FP7A 5L7OA 1LHUA 1H8TA 3N35A 4YZ3A 1QNWA 5LASA 2XONA 2XDVA 2ZTNA 2WSVA 1ZBE3 3Q8AA 4QX3A 2EXHA 4XZPA 5FAXA 1C8M2 1PGSA 3QLQA 1FV2A 4NIDA 2CV6A 2VZ3A 2JKBA 5A3MA 3A21A 3N9MA 1R64A 2HJIA 2DWRA 5FYBA 1QF3A 1TG7A 3RG0A 4AG4A 3ES1A 1UW8A 4M3CF 4RD7A 4UW4A 4BISA 1OT5A 4QX2A 3E6BA 3IZOA 5D2AA 1OA4A 2UYAA 1AX2A 2WQ4A 2DCTA 3AZXA 4BQ5A 1W8WA 3ZKUA 3THPA 1R091 3J7HA 1AVBA 1CQ9A 3MIFA 4YSFA 2JG8B 3VBOC 4A4AA 5DZFA 4E4SA 2W5FA 1JI6A 3AKPA 2ZX1A 3WF0A 2HWB3 3V0AA 3I2HA 4FT8A 2A1XA 2WLQA 1OA3A 2OUHA 3J26N 2VECA 2W52A 4IV1B 4DQAA 4B1LA 3OUJA 2HEVF 1CAWB 2VBBA 4LO8A 1BMV1 4XBQA 3GZEA 2QQJA 3MW2A 3LEGA 1OOPA 4HBNA 1H2NA 1OUXA 1RUF3 2XBO2 3W21A 3T1LA 3NSTA 5J98B 1AR83 4IEXA 1NXMA 3EYPA 1F15A 2HWC1 1X9TA 4WM7B 4ATFA 3LE0A 2DFBA 1Q8OA 3CZJA 4RN5A 1DQ5A 3RZHA 1NCQC 2E26A 4AVSA 3MYXA 4LBOA 1JTZX 4Q0VA 1VJ2A 5ACA3 2ORZA 1TMF3 1BVVA 3KSCA 1NE4A 4JQRA 3V56A 4NVPA 1VMHA 4Q4V3 3NAPA 3VBSB 4E2GA 2CWMA 3FUQA 3WCRA 1LTEA 2FBEA 3POYA 2RS53 1JZ3A 1HN1A 4FP3A 4AAPA 1ZM1A 4BDVB 3D82A 4ZPIA 4BQ3A 2VD7A 1SACA 1JYCA 2VMGA 3SITA 1C28A 5A70A 1DGLA 2BNMA 1VLNA 1UU5A 3NAPC 5I0DA 1F9KA 5FYMA 3TBDA 4XPVA 5HV4A 1G9DA 2GAUA 2IUWA 1SLTA 3JBG3 5A6ZA 2JKXA 2GU9A 1H9WA 1H8VA 2H6BA 4EWDA 1UMHA 2E32A 4H2AA 4B29A 3SMHA 5C5TA 2JB8A 3DGTA 2CDPA 4FPJA 5A7OA 4LEJA 1KEXA 3MICA 1R082 4PLNA 1RVF3 1QH6A 4NROA 2ZBJA 3VZLA 2YC4A 2EALA 2XKOA 2WZR3 5FZ0A 4NAOA 2WN3A 3GHMA 2R071 3I3EA 2FDIA 3DXTA 1H2LA 2RM23 3WF3A 1S0EA 3NW4A 5CFDB 5I91A 4XIKA 1D4M2 1UZYA 5C8WA 3LF7A 3ACGA 2X53S 3WQ0A 4AVCA 2BP6A 3I49A 1QGLA 5FJHA 1W0OA 2ZX0A 3ZN6A 3ZMOA 3VZOA 1LCLA 1VMJA 2PYTA 2Y6GA 2NPIA 2ZGTA 4LMFA 5D8AA 3U78A 4CU7A 1Q56A 1VB4A 3HQRA 4AI3A 2J1UA 1B35A 4AEKA 4ARYA 5JR7B 2KM2A 4BXSV 2JE9A 3I2JA 4IEQA 1SQ4A 2WFF3 5BXXA 2JG9A 3OUHA 5FPVA 3NV4A 4ZKTB 4XZUG 3OD4A 3O1VA 5C71A 1H2KA 4FQ4A 4I02A 4Q4V1 4EWAA 4A3ZA 1UYZA 3CF6E 4Q4Y1 2J1TA 1UX6A 4CDWB 3JQXA 2AUYA 4AEJA 3TNQA 2P17A 4MUVA 2WS93 1YYNA 5IFPA 4YLZA 1DDLA 4KGGA 2AGSA 2JECA 3BPZA 4SLIA 2JDUA 2NN8A 1DQ0A 4MGTA 3APBA 3USSA 3T0AA 2VMIA 3MLKA 3J9SA 1QDCA 2ADDA 1N3PA 4MVTA 1OA2A 2XJVA 1MEC3 3LB9A 2WO2A 1I9RA 3OCPA 4A44A 4URTA 4OLLA 1W0NA 3VKLA 1H8TC 4CEWA 5CKQA 5CFCB 1KDMA 1T6BX 2JG8C 3VBOB 3WW3A 3M3EA 5A3NA 1W6PB 1F5FA 1ST8A 2GDFA 4CUBA 2OW4A 3D3AA 2W92A 3DECA 5T52A 1YIPA 1ND3A 1FOD3 5BNOB 1IHMA 1I3HA 1AR92 5DPNA 3RSJA 1SBFA 3RZZA 4QD2A 1ENRA 2VUAA 2J1RA 4IEPA 1BLZA 1CAUB 1DQ1A 1AXYA 1CR7A 2VVDA 3AZWA 3P5BA 1VE0A 1BHGA 1ZVFA 4HN0A 4OHXA 3VBFC 2W1QA 5SV8A 2UY8A 4QX5A 5JDBA 3OY8A 4SBVA 3WP4A 4QXHA 3ITQA 4GKYA 2VH9A 2WRAA 4QM8A 3MZHA 2W87A 1ASJ3 4URAA 2WZ8A 4BK4A 4HSLA 5A7PA 1JZ2A 4GB32 1DP0A 2GNBA 1POV3 3WCSA 4JZRA 2DBIA 4S2FA 4RR3B 2ZA9A 4TXWA 4TWTA 2A6YA 3SEEA 4CDUB 3N7JA 2WYFA 1CJDA 4YVSB 2G9GA 1F2NA 1LOGA 1HW5A 3IAQA 3O7OA 4LBQB 2Q8OA 1US2A 5FXZA 2YC2A 4YW7A 1LJ7A 1AR72 2J1AA 4GWIA 1IS6A 4Q8LA 1EY2A 5K9YA 3LOBA 3N9OA 4HOOA 4LLFA 3ZIWA 5FO9B 2YMZA 2JDMA 4GB31 4NPLA 4K20A 3W59A 4M01A 4NUBA 4XXAA 1A8MA 2BQPA 2J1EA 4IE4A 2PHRA 2TNFA 3MI8A 1Z7S1 1O91A 4N43A 3VL8A 2RHPA 3WEZA 2IC1A 4GQ7A 1OH4A 1QXJA 2PHUA 4MX3A 1TE1B 1W28A 1H6YA 1PVC1 4XFAA 1GZ9A 4AVAA 4BZ4A 3NVCA 5LZ6A 1AR62 5JOXA 4N53B 1RJ8A 3HIFA 5DAVA 5D21A 3VB9A 5JXGA 1VRH3 5DDJ1 2WZPP 3U11A 2MEV1 4W6XA 5FY4A 4CXWA 1REFA 1U5YA 3WW4A 1V6JA 4YVSA 1NLRA 2QQMA 5K0UA 2C0ZA 3MFCA 3KCCA 4QPWA 2BFUS 4A6SA 1JUIA 1UN1A 1RUG2 2VOTA 4OCTA 5ACA2 3POBA 5J1XA 3I2OA 4Z1VA 4YVWB 2GC3A 3HNMA 5CEHA 2D97A 5IT6A 1GP4A 3MIBA 4X6QB 2R0FA 3L2YA 1LU2A 4EWEA 3NO8A 3TB0A 4MXVA 4JTNA 5A3OA 4IV3C 4UWDA 4AHYA 2B7YA 5IVBA 1PX4A 3KV6A 3BALA 1COV2 5GLUA 3RYRA 1A3KA 2D3RA 4Z2AA 4IESA 1JOJA 4L92A 1JZ8A 5ACA1 4AR2A 4Z07A 4CCJA 2WNVB 2JE7A 1C57A 1N47A 5KBFA 5KWRA 4ASMB 3GBWA 2VCBA 3LFMA 3RDIA 4OZOA 4YYOA 1ND3B 5F7UA 3EHKA 3GBGA 3O0XA 2MEV2 1US3A 4B4RA 2V72A 2ZGOA 3C7GA 1ACCA 4XIOA 4PT6A 1CX1A 2HWE3 2YU2A 1MS4A 1AR61 1SFNA 2R1DA 3VLBB 3FLRA 4LKDA 2HLEA 1WUVA 5E88A 5LY1A 4DY5A 2V5YA 1OVPA 2A71A 5DG2A 1CZTA 3GCWA 4U36A 3S0MA 1AXZA 1PMHX 4O61A 5CVRA 3EMRA 1GANA 1JYVA 2RJLA 3IDEA 4FFHA 4ZONA 1CONA 5KHJA 1C4RA 1UZ0A 3LPFA 4NHMA 5F39A 1YLLA 2WT2A 4AEMA 2E51A 1YNAA 3A22A 3B00A 4FXGB 4MG2A 5JVVA 4P9LA 3I2DA 1M06G 2GC0A 2VZUA 1HB2A 1QWRA 2VU9A 2QE3A 1R093 3GZTB 2B39A 1R1ZA 4CEYC 1WMEA 4LXLA 4QU2A 1CIWA 1D2QA 3AC0A 4LE3A 4LLOA 1ND2A 5A7NA 3VBUA 3RZJA 5C4WC 3KF5A 5AVAA 4KWLA 3U07A 1DHKB 1ZZ9A 2C6SA 2XOMA 3AXDA 3QCWA 5EQUA 5FOBB 3AK0A 3M8LA 2XJUA 4M0NA 2XBO3 2ZACA 1G86A 1STMA 1C1LA 2JB4A 1ALYA 3ZX7A 1WD4A 3C2UA 1WCSA 2CHHA 2IXJA 4QGLA 3WF2A 4RYDA 1VBC3 2UYBA 4DFSA 2BPA2 3ZO0B 3SH4A 2Q1MA 5L9VA 5FP4A 4TZDA 5F8PA 3C8XA 4A2UA 1W8UA 3ZYIB 3AMQA 2ZABA 2XL9A 3O1SA 4OHVA 4BQWA 3CO2A 2WNOA 5ANNA 3WNOA 4KU8A 1JW6A 1RHI1 3K2OA 1JUHA 5BNPC 4WM8A 1O3RA 1AL22 3NRUA 1RUI1 5JOYA 5JZGB 3M1HA 1HB3A 2R32A 2V4VA 4HK8A 1RUH3 2RMU2 4LO4B 4XURA 5F6KA 3RZGA 1O6UA 5F5IA 2Y6LA 4UBHA 1Y9MA 1WGPA 1S2EA 3WG3A 1LNSA 2CGPA 2NZ9A 3BB6A 1LULA 1WMFA 2VNRA 1SLAA 5F6LB 4Q2FA 2W94A 3RRDA 4BHPA 4JKLA 4X8PA 1Q5OA 1J3RA 4OUMA 3T2TA 2Q5TA 5LY2A 3UJOA 2IWGB 3PLQA 1UX7A 5IVEA 1CD3G 1RGSA 4GXLA 1V0AA 3HMYA 3KT7A 4ORFA 5GALA 3RI9A 3S5QA 4ET7A 3VBSA 3AKTA 4IE7A 4QGNA 1ASJ2 2J1VA 5FLHA 3KHCA 2MNGA 4LO6B 2V09A 1QJU3 3PU3A 1FOD1 1UOFA 3SCGA 1QJEA 3CZUA 4ZS2A 1GZTA 5FMOS 1O3SA 2O8QA 3MHZA 3TEYA 3PNAA 4YW6A 1UY0A 1PMJX 1AR73 1Z7S2 2RVAA 2WFPA 3JD72 4HT1T 2XKPA 3FWEA 4Y26A 5T50A 3PUQA 1X8EA 5IVYA 3TEWA 3CL1A 2VZOA 4IE0A 4I09A 4BLIA 3VUOA 1UYYA 3C3VA 2TBVA 4IGOA 2ZGQA 3D4KA 3HNYM 3MW3A 2R073 1IS3A 3SISA 2R042 5EJ1B 1AX1A 1PM7A 1UY3A 2BU9A 4IV1A 3N9NA 4QHBA 1GZWA 1QHDA 3HWJA 4CP2A 4I30A 3A23A 4LULA 1W9YA 1YQ5A 3ZFEA 5BNPB 2QJVA 1RUE3 1XQNA 4IEZA 4D7TA 3OGSA 1GV9A 4Y4RA 3KT1A 1OD5A 3R6SA 4HLTA 2AEZA 4H7LA 1NOVA 1R081 3I2GA 5I0UA 3VBFA 4QPGA 4CZSA 2EIEA 2ILMA 4O9GA 1P8JA 3WF4A 5KXBA 3OBRA 4MGSA 3WHUA 1GSLA 2E6VA 2GN3A 3LEIA 1QDOA 3CJXA 4Y33A 5LCWL 5LBFA 1H6XA 2D3PA 3IIIA 2ZGRA 1VBC1 1V6NA 2YYOA 2EAAA 2VCCA 4PF1A 5DZGA 3WP5A 3ZFGC 1SFYA 2JJ6A 1H9PA 2JE8A 2RM21 2ZGPA 4GH4A 4QKNA 4QX0A 1ULOA 1PO12 3I3MA 1ODNA 3NNFA 4Q27A 4CUCA 2K0GA 1HXS1 3FLTA 2HWD3 4JKMA 5FZBA 4HANA 2GNTA 4NRMA 4FO9A 4FOYA 2Y34A 3HN1A 2Z69A 4AW7A 4K9SA 2PA7A 3CHXA 2G4IA 3OPWA 5FY0A 5FZEA 2DCYA 1DCSA 1HV1A 1X7NA 3AJYA 1OPOA 5IHRA 3POWA 4V2WA 2ZEWA 1IQAA 3TYJA 3UGHA 2OX0A 1BBT1 1JODA 5AVPA 5I8YA 3IIAA 3AP7A 3ZSEA 3UKNA 4LBKA 5K8SA 2P4EA 4YGEA 2B46X 1D0HA 2PXJA 1H1MA 1QQP3 1B35C 4XJ9A 4YRDA 2VO5A 5EHDA 3ZR6A 3ES4A 4EN0A 3WUCA 3K48A 5IUQA 1N1YA 5IK4A 5FDBA 3ZXEA 4D3WA 5A3LA 3HBZA 4EJRA 1ULPA 4E9KA 1DQ4A 4AEDC 1A8DA 1F8VA 2HWF1 5FBZA 4COVA 4B1MA 4CDQB 4CDXB 4DY3A 1XSQA 3WNMA 3H8RA 2EVXA 4IE6A 3BTAA 2D40A 4XFHA 2VY0A 2W3JA 2H0BA 1NA1B 2DVBA 1DIWA 3LWCA 1PVC3 4JGZB 4M0HA 1O7FA 4ATEA 2OXBA 3LDRA 2VW1A 5EWSA 3LPGA 4QPIB 2D43A 1W9TA 4Q4W3 1YIFA 2VJXA 3Q8CA 4Q4V2 1N3OA 1DGRN 3AFGA 4P00B 4LJHA 4C1XA 5DMYA 1MVEA 2ARXA 4LPLA 3P3NA 2BUKA 3JUUA 2R043 3BIWE 4OULA 2D3SA 3ETPA 1RUE2 4ISRA 3ZVXA 2VBPA 2FHRA 4P9IA 1JYWA 3LOIA 4LBJA 3B3QE 3WNPA 2VXRA 4XDOA 1W03A 2VMCA 2V4AA 5DXDA 2YUEA 3THTA 3MIGA 1GWMA 4PHZA 3IBMA 1D4VB 1O8SA 4XF9A 1JYIA 2C4XA 4BWOA 5A3PA 1O4TA 2BNOA 4X6RB 4CEYB 4R9CA 5C9AC 1S4CA 3K77A 1VBB1 1NZCA 4PDWA 1YC61 5F32A 5CFDC 2C24A 4RQPB 4AFDA 4RGAA 4WBBA 1HLCA 3T30A 3WDUA 2QQLA 2P5BA 1V6LA 4A7ZA 3AP9A 4MADA 1V9U3 3ZFGA 3PVBB 1PNFA 1PMIA 4IL7A 1KFXL 2VQUA 1U12A 4AVTA 4UF0A 4WZCA 1VAMA 1YO8A 5FFOC 3AYAA 1CWPA 1VPHA 1WZXA 3K4ZA 3MLJA 2YZ4A 1MR5A 2RS13 1CAXA 3BIEA 4JGZA 2DU0A 1S0DA 4JHZA 4WVMA 3AXEA 3ZFFA 1W6NB 4I0BA 1AYM2 1XNKA 2ERFA 1ZBA2 1WCQA 1NA1C 3HQUA 3JCIA 4AQSA 1GOHA 4Y1ZA 3VL9A 1KS4A 5FXWA 1TME2 3NV2A 3ACIA 1FMD2 4YGCA 5FQ0B 1JN2P 1N1TA 2YC0A 2EA7A 5CZKA 2KXLA 1BKZA 2HEYF 3NJVA 1MEC1 1NE6A 3BGAA 3G6JB 5JAXA 4I2OA 4UXAA 5C6CA 2PELA 2W9XA 2PHWA 2FCVA 1QJY2 3VDAA 3ZIXA 1O4ZA 3POJA 5KR7A 2EF6A 4CCMA 5FREA 1SZBA 4ZU4A 2GMPA 2RJ2A 2YV8A 3INAA 4GKXA 3VBRB 2Z5WA 1W2AX 1COV1 5FZMA 5CNAA 2B9VA 5A7QA 3H1MA 3X29B 4D94A 4Q4Y3 2LTNA 3E5XA 2VULA 1X50A 1HQNA 1S2BA 3AL6A 3GM8A 3MDPA 4H55A 4LA2A 1UWWA 3OEBA 3NQHA 3QD6A 3O1TA 2Q1FA 5DUVA 3J7NA 3DKQA 1XNAA 2VZQA 3KZ4C 4PQ9A 2CU5A 2WNUB 5A6YA 2Q1ZB 1LOCA 1Y7BA 3BPSA 3KD4A 2A3WA 2OKXA 5KHKA 2OPKA 3KQRA 5FPLA 2P3YA 3EO6A 5FZOA 5LEJA 2ZMNA 4NMIA 3RWKX 5J48A 3DXUA 3OUIA 2XLAA 3WF1A 3W5MA 2BBVA 4GH4B 4KBZA 3UKTA 1ULEA 4Y22A 1S0BA 4IEWA 1O4YA 3AKQA 4YPJA 1HKDA 1DYOA 5EYXA 2WNUC 5AC93 2VOVA 3KVAA 2W08A 2ARCA 1SLCA 5KC6A 4KBBA 2VC9A 1WKYA 3UGFA 4DXTA 1HQLA 4IEYA 2VZ1A 3ILFA 1LB2A 3WT3A 1N3QA 5LA0A 4YW4A 2BGOA 2C5DA 4XHBA 2HH9A 4OI2A 1CAVB 1IG0A 2ZS6B 4R4XA 1DGWX 2J42A 5E1RA 1AL0G 1GFF2 4QQPA 4RHV3 4Y20B 5ABJC 1JHJA 1ZZBA 4P9GA 4XACA 5BNPA 1WMDA 3MEPA 5FZKA 2BEOA 5IJRA 4W6WA 3ETQA 1RUNA 4TTGA 3B01A 1C1FA 1CVNA 5GZGA 3DV8A 4K3UA 5JXHA 5GZFA 2EXIA 2X5IB 1FNYA 1ND2C 2HEWF 3K3NA 4AOCA 3WP6A 4LO7A 2Y6KA 2VZVA 1XE8A 1POQA 1MS8A 1UYXA 4FI9A 5FO7B 4CCLA 2PQSA 1AUYA 3T2PA 1PZ7A 3N9LA 5FUNA 3AP4A 1RTVA 3POSA 4CSWA 4ZZ5A 4BA6A 1BVP1 5BPXA 3ZXKA 3NJZA 1R1A1 3WY6A 2WZR1 3CLPA 3I59B 4HPKB 4XTMA 3ZN4A 1HRV2 3ABZA 1TMF1 3OF1A 1ENQA 1RVF1 3K4DA 2OUJA 1H2MA 3OEAA 4YM2A 5GLVA 3UT0A 2VQTA 4YZ5A 3D6EA 1D7PM 4D7YA 4G3YC 1RUJ1 1UY2A 2W2IA 3I7DA 3NNGA 4UYBA 5AFEA 1NY72 4DRRA 3S6PA 2KR2A 1XE0A 2HWC3 5GZDA 1QMJA 3M2MA 1WLTA 2A73B 1MS1A 3ZXGA 3NNLA 1S0GA 2BNNA 1PVC2 1PVXA 2Y33A 2WO1A 4GJZA 1NCRC 4ES8A 3NJXA 2BJSA 3ATGA 3OJBA 4TLGA 2YROA 3K46A 4XE9A 4PIYA 2RS52 1NT0A 1IS4A 5IWFA 2RJKA 1SLIA 4XMIA 1J59A 2HWB2 1S0FA 2VR4A 2VNVA 5A7WA 4AFMA 4FP2A 2KD7A 4Y1VA 4FSJA 2DUQA 3QACA 5FZ6A 1VP6A 2BGPA 2WQ8A 5A7SA 5GZCA 3WDWA 1V70A 5ABJA 5FWEA 2BBAA 4WM8B 5JZGC 5CU1A 2Q0AA 3AP5A 4YW2A 4N9HA 4XJWA 5FY7A 3VKMA 1SDWA 1LHOA 3BUCA 1ULDA 3THCA 3SCHA 2HWD1 3CDZB 3RNSA 4YVSC 1JS9A 5F2WA 3SC7X 4NRPA 1ODMA 5JCTA 2XR4A 1G8WA 3EBRA 5FYVA 5A1AA 5HCHA 1RUJ2 2F17A 3ZSJA 5J7MA 1PGW1 2DUOA 1ZBE2 2DVGA 5KHGA 4W65A 4AQ6A 2GC2A 3HEIA 4CEWC 4LA3A 4QPIC 1REEA 4D6SA 1OVSA 4CU6A 2Z42A 4RS5A 2VZRA 3VKOA 5I0RA 5DABA 4D6RA 4YG3A 5A3UA 2HWD2 4XETA 3VZNA 2CGOA 3QH7A 3OB8A 1E5HA 1YJLA 2CTVA 2NMOA 3W58A 1IG3A 1NXD1 4FBFA 5FMOL 1ZA7A 2R072 1CESA 1Q8VA 4D8MA 1V6IA 3AMNA 5FZ1A 2DUPA 3NMBA 3D0SA 4COZA 5HXMA 2QKDA 3FMGA 3LA7A 5DAQA 2IVIB 2WABA 5A1LA 3OGJA 1JZ4A 4RL7A 1ZRRA 1POV1 1VAVA 3N7MA 1XXNA 3DCQA 1O3TA 3NKGA 2WBKA 3O1RA 5AFBA 1LGBA 2WJSA 4AL9A 2UY9A 2EAKA 4QPYA 1TME1 2WFF2 5CA6A 3GYDA 1HDKA 4JV4A 1PNGA 2QQKA 4RQPC 5FMCA 1N1VA 1CIYA 1EUUA 4KU7A 2PN5A 1W05A 4R52A 3WG2A 5KHIA 5IATA 1YXWA 3POIA 3BTZA 1CZSA 1PM4A 3TOJA 4GAZA 4FQZA 2CAUA 4QQLA 5JXJA 1Q8SA 3M70A 4BH9A 4NHLA 1HRI1 3D0JA 5IVJA 3VD3A 3RZMA 1XYPA 2XJQA 5EZWA 1VR3A 4EZHA 2NQYA 1D4M3 4Q4W1 5EPAA 2JICA 2WNEA 2ZX4A 3GBFA 5FV3A 1W8NA 4LK7A 3LIHA 2P37A 2ZKLA 5DQ0A 1UY1A 2BDRA 2YFZA 3B9CA 3K51A 4LHKA 5FP3A 3SHRA 4R9BA 2DDUA 2OVUA 2O1QA 2ZGLA 3NKTA 5FMDA 3KCYA 1XNCA 1BYHA 2A5ZA 1O8PA 3T4VA 3VDCA 3BU7A 3U1XA 4JVAA 3UYJA 2ET1A 2JIJA 3WLUA 3H1WA 1ZNPA 4KNCA 3OYWB 3HJRA 4R9DA 2UWBA 3IN9A 4J1XA 4IETA 5K4LA 2I45A 2XLGA 3J4UH 1QJY1 4D7SA 4NIIA 4F8AA 5C5UA 2YBPA 1SG3A 5IFTA 4BMBA 2CGNA 4FOQA 5FZDA 4D0QA 1Q8PA 3NV1A 4N53A 3RVHA 2D7FA 3FJSA 3MPBA 4BQXA 1Q3EA 3ALQA 4N53C 3DYMA 4DRVA 1WLDA 1V6OA 5EYYA 4UT5A 3MFAA 4QM9A 4QQOA 1A6CA 5HCBA 5A32A 5GLWA 3NNJA 3C7HA 3ZXJA 4AI8A 4ITCA 4N43B 4UW6A 5C3RA 2W47A 4LOSA 1QXPA 2B5HA 4XXPA 3BCWA 2Y0OA 1Y9GA 2ZAHA 1ZYBA 2RMU3 1JYNA 4COWA 4R9AA 3OYWA 4NPMA 1PO13 2E7QA 5D8AC 4M4PA 3I2KA 5BNNA 2GNDA 5CG9A 5J3UA 1UZZA 1DQ2A 3H50A 4NHYA 2HWE2 2JEMA 3O14A 4CCOA 1EV11 2I2SA 3MIHA 4HVOA 3VGIA 2NLRA 4FPHA 1VALA 4LBQA 4XF1A 4A7KA 1AXKA 1WLCA 1MZFA 3H8UA 2P34A 1OURA 3NWKA 3U75A 4QB2A 5A3TA 1GWKA 3DEMA 4LHNA 1YHFA 1J3QA 2WIIB 3NL1A 4CDUA 4CP9A 3VHOA 2FDKA 2R6QA 1NLSA 5F3CA 4ISQA 3ZFEC 1W2TA 2P6CA 4PI0A 1MQTC 1NX9A 3VDDC 4BYYA 3WP3A 5IK7A 2DCJA 4UFMA 1D0GA 1YQ8A 1KFUL 5F37A 1RXGA 3KGZA 2FMDA 3H0OA 5FP9A 3LGRA 5FZ4A 2X05A 3WG4A 4UFLA 3FFZA 2RS33 4CA9A 3B93A 1XNTA 3LDBA 4K8RB 4GWMA 3ZYPA 4M4RA 5J36A 1WCDJ 3POEA 4ZY9A 3WW2A 3CEWA 5FWJA 1CAUA 3U14A 2W1UA 5C9AA 4DO0A 2X10A 2EICA 1OPMA 1COV3 2OIIA 5BNOA 2RDNA 1PO11 4CU9A 1W6OB 1U5ZA 3K75B 5I93A 4LORA 1K12A 3KHBA 1ULFA 2BRTA 4GWNA 4PBOA 4CEWB 1XOYA 2VVEA 4ZXEA 1HN0A 1ZBA1 1UZVA 2XG3A 1C8M3 3L2HA 4AI2A 1L7RA 3T0BA 5LB6A 1QJU2 4C91A 5I0SA 5C7GA 3DYPA 4LBMA 1KXGA 4PF5A 4DB5A 1J1TA 3PUHA 2QQIA 4Q1PA 1JZ6A 2K2SA 2YBSA 3MF9A 3KV4A 1AR82 5F3GA 3SNMA 1QJX1 4QHOA 1BEV2 3A4UA 4XJ8A 4AXOA 4XBLA 4O65A 1KJLA 4WM8C 2ZGMA 3HPNA 4XJAA 3USUB 5B4XA 3CU7A 5JLVA 1G9CA 3WQBA 4CUAA 2WDBA 1K5MB 4IUGA 3U4XA 1VBB2 2BVVA 2VQ0A 2NP0A 3RS6A 1AR91 2YDEA 3ZSLA 4LBNA 4XF3A 2Q8EA 4JDNA 1B35B 2RDRA 3MLLA 1TEIA 3WUDA 5FOJB 2ZEXA 4XFBA 1GOFA 2CAVA 1LECA 2WA3A 5BNNB 5FTTC 2RS12 4LITA 1M4WA 3A0NA 4NIHA 2E31A 3OPZA 2WO7A 2JDYA 4G4FA 1PK6C 4HZFA 1Y4WA 3N9QA 3UESA 5HPOA 4UAPA 4EROA 4YM0A 2DFCA 3IAPA 1UF2C 3PJQA 3PUIA 4JHTA 2VTFA 5A7WB 1BCXA 4OFGA 1RB8G 5T5OA 4AGVA 3E5QA 1UCXA 4FFGA 1VBC2 4C0HA 2QQVA 5FZCA 3T0DA 5DG1A 2ZEZA 2GC1A 1UPSA 3KT4A 4A45A 5BY5A 4XILA 5KHHA 4QXBA 1O59A 4TN7A 3VBUC 4XCAA 5FY8A 3MPPG 5JMOA 3GGLA 1DG6A 4Q4X2 4CCKA 4PQQA 2KA3A 5LK7B 1ZRIA 2UURA 2W68A 5FYTA 4META 5FCCA 3R0RA 5A3WA 2IZWA 5LEKA 5L73A 1J1LA 3CBNA 4FPGA 1URXA 4Q0SA 5FJKA 4E2QA 1NQDA 5A6XA 2V73A 4BXFA 5F1RA 3C7FA 2VMEA 1KS5A 4LUKA 3TN92 1GZCA 4MHUA 1UKRA 4BIFA 3LEKA 3AZYA 3WQ1A 1UZWA 4FFIA 2C1FA 1LGNA 3KVBA 2ZGNA 2QQNA 3S30A 5HCFA 5B4NA 5A80A 5L7OC 4L97A 4XDQA 4XUNA 3ZYBA 4BQYA 2DTWA 1AYN2 1W6MA 3V0BA 4Q0UA 4NN0A 1VB2A 1XPWA 2FZ1A 1QJFA 5G05L 1PGW2 4FPFA 1VBE1 3JXSA 3U37A 3WV6A 1SDDB 4DZGA 2B9UA 4Z2WA 3IM0A 1I6XA 4IV3A 5BYNA 2B4KA 2VG9A 1NCQB 3H3ZA 2PMWB 2WAOA 5FPUA 1ZRCA 1IKPA 4NPRA 2FD8A 4LHSA 2PAMA 5DAWA 3CIHA 4NOTA 1OOPB 3FHAA 4B3NA 1LR5A 2AR6A 4W4ZA 4M3CE 1RUJ3 4QWNA 1LU1A 2HYXA 3LCPA 4XTPA 4RGKA 3KGLA 3W9AA 1UD1A 2ZEYA 2RM22 1DGRA 1FOD2 3FC0A 3RMXA 5IK5A 2CDOA 4LKFA 2VCAA 5K7PA 5KC5A 2WLPA 4KH9A 3V0AB 3AVSA 2VGDA 4Y5Z0 4Y22B 1HB1A 2A7AA 1W0PA 4CPBD 2XVKA 3GF6A 4E4HA 4LK6A 3H3LA 1HJFA 4L11A 3VHRA 1FPN1 3PDQA 3WDTA 5FZOB 3I3DA 3QOPA 2BV4A 2YHJA 2LRPA 1DYPA 1AYN1 3GCXA 4NWWA 1NAEA 2FCTA 2R1BA 1PZ8A 2R061 2XXZA 4JGYC 1G9FA 4QB1A 2GALA 2XJSA 2LALA 1QJZA 1MS9A 1WD3A 2OQ7A 5EJZB 3ZPOA 1JXNA 1KITA 4BOWA 4KGQA 1KDKA 1JYXA 5E8AA 2VZSA 4IGPA 4N43C 2VOWA 1YFWA 2G9FA 1RVF2 2E7TA 2QTWB 3PUAA 4IW3A 5FPZA 2WT0A 2ZGKA 1BQPA 2ATFA 1SEFA 2ZHLA 1R1A2 4QKFA 3MUZ1 4AI0A 4BLJA 3BOPA 3O1PA 3RMYA 5LA9A 2LW8A 5ABJB 1AYM1 1POV0 1IQDC 4Q0PA 3C7EA 1MZ5A 3GDBA 2J22A 4FOVA 1OI6A 3ZPYA 4PIZA 2DTYA 5CKNA 3I2IA 1S0IA 2GMEA 1C5HA 2WAAA 1VBD3 3B9IA 4FAHA 3OGGA 1AHSA 1IPSA 3DPRA 4HVRA 2Q8DA 3FHIB 3ME2A 3JBG1 4FCAA 5F3IA 1LRHA 5FY9A 2C26A 2G9ZA 3CJIB 4WVMB 3MF6A 2SBAA 5L9RA 3MIDA 2VOXA 4INDA 1CAXB 1AX0A 2WZEA 2Y26A 3R05A 2JDPA 1BJQA 2JIGA 5FKBA 1MS0A 5GLZA 4DNYA 3BTYA 2PHFA 3J7MA 3WDYA 1YFXA 3VZJA 1H0BA 1APNA 1GKBA 1SBDA 2RS51 5ISLA 4XDPA 1VBA2 1X82A 1QJY3 4DMIA 3ZFGB 1TNRA 4XW3A 5GKAC 2ZHKA 2QQPA 2VUCA 4O7XA 2LUWA 1QJX2 2VMHA 4YW5A 2QQOA 4I0WB 2BWCA 2J7MA 2E7AA 4AFAA 3LEMA 1KJRA 1MS3A 2RMU1 5FZGA 3ZYJB 4FTBA 1FATA 3I59A 4HPKA 1DZRA 1FMD3 1V6MA 3IPVA 4L99A 2FDGA 2OQ6A 1OFSA 5CISA 4IXLA 1TZOA 3HAGA 1RUI2 5FZAA 4AVVA 2XB6C 3RZLA 1QIQA 1T2XA 5JSPA 2CSGA 5I0TA 2Y8KA 2VTXJ 5CB7A 3WNKA 5JWPA 2WR9A 1B09A 2RR12 3B02A 3Q8EA 4QMAA 5FUIA 4FOWA 3LA3A 4G9SB 1IPKA 1X9PA 3OGRA 4MH0E 1ULGA 3OOXA 2E9QA 3OSDA 3GNEA 2W1WA 1VBE3 4LR4A 1C5IA 4CUGA 2JD4A 3AYCA 1LHNA 4NJ4A 2ZXQA 3NNMA 3M3IA 4OHWA 3SH5A 1XJAA 1UMIA 1JYTA 4RGGA 4BM8A 2RV9A 4OI0A 1AJKA 1EAH3 1CAVA 1UIKA 4AEDB 1RUD2 1DYKA 2XWBB 1ZA4A 3LD8A 3ZFFC 3IDBB 3WX5A 1NA1A 1D2SA 3IDCB 1YI7A 1TNFA 4EN8B 3UGGA 5JI7A 5A1FA 2AH2A 2A3YA 2VZPA 1OHFA 3KQ4B 3KS7A 3VDDB 4UOJA 4K1ZA 4CDXA 5LK5A 2IXLA 4AYUA 2A3XA 4JCKA 3GXUA 2ZX2A 1D4M1 1CZVA 3PL0A 2O8OA 2VQAA 4K8FA 4YGBA 4AZZA 4A3XA 3SCFA 5DN2A 2QBXA 2AENA 4QDSA 3ST7A 4DXSA 5B2GB 2QQWA 1S0JA 4BJ0A 4AGRA 4XEZA 1RHI3 2B45X 1PK6B 1RMU1 5C33A 4FTEA 3GZUC 4WZFA 4Q4W2 1W8ZA 2XGXA 1UKGA 2JD9A
chains in the Genus database with same CATH topology
3K46A 3I3BA 3C7OA 3LQCA 2J1EA 3MV11 2VR4A 2Y64A 2YB7A 2KD7A 2C9KA 1W8OA 2BGPA 2WQ8A 3WEZA 1OH4A 2YG0A 2BBAA 1H6YA 1K42A 4XUPA 3UNPA 3CMGA 5JXGA 3THCA 3CDZB 2VL4A 2QQMA 5A1AA 1DLCA 2VZTA 4QPWA 5CYYA 5J1XA 2VOTA 3HNMA 3HEIA 4CU6A 2VZRA 2EIDA 3BN6A 3WNNA 3F2ZA 3OB8A 1NKGA 4A6OA 1PX4A 3SKVA 4E8CA 4W50A 1NUKA 4Z2AA 4D8MA 2R7EB 5HXMA 1JZ8A 2EIBA 2JDAA 2WABA 2VCBA 1JZ4A 4OZOA 4DUXA 5F7UA 4JKKA 4OYUA 1TVGA 1US3A 2XQXA 2V72A 2WBKA 3C7GA 4PT6A 4E8DA 1CX1A 3ACFA 2HLEA 4LQRA 3SKJE 2Y6HA 5LA2A 2QQKA 1CIYA 1EUUA 1CZTA 4MGQA 2WUHA 1GOGA 3CQOA 1PMHX 1CZSA 1JYVA 3OG2A 4DEVA 5JXJA 1RYYA 1UZ0A 3LPFA 3VD3A 3A22A 5IYYA 2W91A 2LS6A 4HG6B 1OF3A 1W8NA 2VZUA 4OMDA 5DQ0A 3VD5A 1UY1A 2YFZA 2DDUA 2WN2A 3AC0A 1XC6A 2V5DA 3VDCA 1O8PA 4CU8A 2XOMA 3I2FA 1K45A 3HJRA 3THDA 4QDQA 3WF2A 4RYDA 3FHQA 1SG3A 1F4HA 5IFTA 3I97A 2BZDA 4D0QA 3C8XA 4JX0A 4XUTA 4XUQA 1JU4A 3WNOA 3DYMA 3CKHA 4DXRA 4W8JA 3NRUA 1L7QA 1GNYA 3OBAA 2ORXA 2V4VA 3C7HA 2J1SA 4XURA 2W47A 2Y6LA 1JYNA 3VD7A 1LNSA 2VMDA 1GU3A 4M4PA 3I2KA 3IDAA 4LKSA 1SHWB 3T2OA 4ZZ8A 2W94A 4JKLA 1GUIA 2Z4FA 1OF4A 1UX7A 1W9SA 4ET7A 4QB2A 2J1VA 3VDBA 1I5PA 1UY4A 1NX9A 3CZUA 2L9LA 4GZ9A 3K4AA 4QDRA 2DCJA 1KGYA 3VD4A 1GMMA 1UY0A 1PMJX 2X05A 2RVAA 2XHNA 4QAWA 1XNTA 4M4RA 4ZY9A 2VZOA 2W1UA 1UYYA 2X10A 2EICA 4CVUA 3HNYM 3E1F1 5EJ1B 4BK5A 4CU9A 1UY3A 3K75B 3MBWA 1K12A 3A23A 5EIYB 3MV01 4ZXEA 3OGSA 1L7RA 3T0BA 1MPXA 2VMFA 3I2GA 5C7GA 2EIEA 3DYPA 3PUHA 1P8JA 2QQIA 3WF4A 4MGSA 1JZ6A 1YQ2A 1EUTA 3LEIA 5LCWL 1H6XA 4A42A 2W46A 1GQPA 3IIIA 4P02B 3HPNA 4MOAA 5B4XA 2VCCA 4PF1A 3WQBA 4CUAA 2WDBA 2JE8A 4QX0A 4IUGA 4DUVA 1ULOA 4XUOA 4CUCA 3WSOA 4JKMA 3T08A 2ZEXA 2BERA 1GOFA 3HNBM 5IHRA 4OMCA 2E31A 2ZEWA 3T09A 3UESA 5HPOA 1UXZA 4UAPA 3IAPA 3PUIA 3ECQA 2W1SA 1J83A 2VTFA 2E33A 2ID4A 3EB7A 4A41A 3T0DA 1W9WA 2VO5A 2ZEZA 3T2QA 4A45A 2XONA 1O59A 4QX3A 3DYOA 5JMOA 1JU3A 3GGLA 1ULPA 4PQQA 2VZ3A 3A21A 1R64A 1K3IA 2X09A 1TG7A 4AG4A 3WNMA 1OT5A 4QX2A 2W3JA 3C7FA 2VMEA 3LEKA 3J7HA 3LPGA 4A4AA 1W9TA 2QQNA 5B4NA 2W5FA 2VJXA 1JI6A 4XUNA 3WF0A 3I2HA 4P00B 4GWJA 1XPWA 5DMYA 5G05L 4LPLA 2WYSA 1UXXX 3JXSA 3U37A 1SDDB 3ETPA 3P6BA 3P1IA 4MO3M 4KMQA 2B4KA 2QQJA 3LEGA 4DEQA 1JYWA 2YFUA 3WNPA 2WAOA 5JXIA 2VMCA 3OGVA 4XVHA 3EYPA 4LHSA 1O8SA 3MO4A 2C4XA 3CIHA 3LE0A 3FHAA 3CZJA 4RN5A 4W4ZA 5LA1A 2E26A 2HYXA 3K77A 2ZEYA 3VD9A 3MUY1 2CDOA 2QQLA 2VCAA 3ZM8A 2ORZA 4MADA 2VQUA 1JZ3A 1HN1A 3K4ZA 4BDVB 4KWUA 3I3DA 4JHZA 1NAEA 1WCQA 1GOHA 5I0DA 4QB1A 3ACIA 5EJZB 2JKXA 1UMHA 1JYXA 2E32A 2VZSA 5CZKA 1PX3A 2CDPA 3NJVA 2VM9A 3BGAA 3UETA 1KEXA 3A7QA 2W9XA 3VDAA 3MUZ1 5C70A 2YC4A 2LW8A 2RJ2A 1IQDC 2WN3A 3C7EA 3I3EA 3GDBA 2B9VA 2J22A 4QX1A 2WO3A 3WF3A 3I2IA 2WAAA 3GM8A 1UWWA 3OEBA 3NQHA 3ACGA 1XNAA 2VZQA 2C26A 2OKXA 2Y6GA 4CU7A 2J1UA 2W95A 2WZEA 4ARYA 4QB6A 4P5YA 4BXSV 3I2JA 3WF1A 3W5MA 1W99A 1F4AA 4UI9L 4XZUG 5C71A 4YPJA 1DYOA 3IB3A 3WNLA 4A3ZA 5JR2A 1UYZA 2J1TA 1J84A 2VC9A 1WKYA 2QQOA 4DXTA 3SEPA 5IFPA 2J7MA 2VZ1A 5LA0A 4AAXA 2BGOA 1JZ5A 2DCKA 3T0AA 3FN9A 4A44A 1T2XA 2WO2A 3ACHA 1JHJA 1W0NA 2Y8KA 3WNKA 5IJRA 5FUIA 4TTGA 4CUBA 3W5NA 3D3AA 2W92A 3DECA 3OGRA 5JXHA 1OD3A 5DPNA 2W1WA 2Y6KA 2VZVA 2J1RA 1UYXA 4FI9A 2ZXQA 3HN3A 2PQSA 3FL7A 3T2PA 1BHGA 2Y6JA 2W1QA 4ZZ5A 1UMIA 2RV9A 1JZ7A 2W87A 3ABZA 2WZ8A 4BK4A 1JZ2A 4P08A 1DP0A 3K4DA 3OEAA 2VQTA 5G04L 2VZPA 4UOJA 4TXWA 1D7PM 3SEEA 5JUVA 1UY2A 3NNGA 3GXUA 4OUEA 1CZVA 3IAQA 4L0PA 1US2A 4ARXA 2YC2A 5DN2A 2QBXA 4QDSA 4DXSA 4KI5M 2J1AA 4BJ0A 4GWIA 4DUWA 3HOBA 2WO1A 3NJXA 2JD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K46 A;  3I3B A;  3C7O A;  3LQC A;  2J1E A;  3MV1 1;  2VR4 A;  2Y64 A;  2YB7 A;  2KD7 A;  2C9K A;  1W8O A;  2BGP A;  2WQ8 A;  3WEZ A;  1OH4 A;  2YG0 A;  2BBA A;  1H6Y A;  1K42 A;  4XUP A;  3UNP A;  3CMG A;  5JXG A;  3THC A;  3CDZ B;  2VL4 A;  2QQM A;  5A1A A;  1DLC A;  2VZT A;  4QPW A;  5CYY A;  5J1X A;  2VOT A;  3HNM A;  3HEI A;  4CU6 A;  2VZR A;  2EID A;  3BN6 A;  3WNN A;  3F2Z A;  3OB8 A;  1NKG A;  4A6O A;  1PX4 A;  3SKV A;  4E8C A;  4W50 A;  1NUK A;  4Z2A A;  4D8M A;  2R7E B;  5HXM A;  1JZ8 A;  2EIB A;  2JDA A;  2WAB A;  2VCB A;  1JZ4 A;  4OZO A;  4DUX A;  5F7U A;  4JKK A;  4OYU A;  1TVG A;  1US3 A;  2XQX A;  2V72 A;  2WBK A;  3C7G A;  4PT6 A;  4E8D A;  1CX1 A;  3ACF A;  2HLE A;  4LQR A;  3SKJ E;  2Y6H A;  5LA2 A;  2QQK A;  1CIY A;  1EUU A;  1CZT A;  4MGQ A;  2WUH A;  1GOG A;  3CQO A;  1PMH X;  1CZS A;  1JYV A;  3OG2 A;  4DEV A;  5JXJ A;  1RYY A;  1UZ0 A;  3LPF A;  3VD3 A;  3A22 A;  5IYY A;  2W91 A;  2LS6 A;  4HG6 B;  1OF3 A;  1W8N A;  2VZU A;  4OMD A;  5DQ0 A;  3VD5 A;  1UY1 A;  2YFZ A;  2DDU A;  2WN2 A;  3AC0 A;  1XC6 A;  2V5D A;  3VDC A;  1O8P A;  4CU8 A;  2XOM A;  3I2F A;  1K45 A;  3HJR A;  3THD A;  4QDQ A;  3WF2 A;  4RYD A;  3FHQ A;  1SG3 A;  1F4H A;  5IFT A;  3I97 A;  2BZD A;  4D0Q A;  3C8X A;  4JX0 A;  4XUT A;  4XUQ A;  1JU4 A;  3WNO A;  3DYM A;  3CKH A;  4DXR A;  4W8J A;  3NRU A;  1L7Q A;  1GNY A;  3OBA A;  2ORX A;  2V4V A;  3C7H A;  2J1S A;  4XUR A;  2W47 A;  2Y6L A;  1JYN A;  3VD7 A;  1LNS A;  2VMD A;  1GU3 A;  4M4P A;  3I2K A;  3IDA A;  4LKS A;  1SHW B;  3T2O A;  4ZZ8 A;  2W94 A;  4JKL A;  1GUI A;  2Z4F A;  1OF4 A;  1UX7 A;  1W9S A;  4ET7 A;  4QB2 A;  2J1V A;  3VDB A;  1I5P A;  1UY4 A;  1NX9 A;  3CZU A;  2L9L A;  4GZ9 A;  3K4A A;  4QDR A;  2DCJ A;  1KGY A;  3VD4 A;  1GMM A;  1UY0 A;  1PMJ X;  2X05 A;  2RVA A;  2XHN A;  4QAW A;  1XNT A;  4M4R A;  4ZY9 A;  2VZO A;  2W1U A;  1UYY A;  2X10 A;  2EIC A;  4CVU A;  3HNY M;  3E1F 1;  5EJ1 B;  4BK5 A;  4CU9 A;  1UY3 A;  3K75 B;  3MBW A;  1K12 A;  3A23 A;  5EIY B;  3MV0 1;  4ZXE A;  3OGS A;  1L7R A;  3T0B A;  1MPX A;  2VMF A;  3I2G A;  5C7G A;  2EIE A;  3DYP A;  3PUH A;  1P8J A;  2QQI A;  3WF4 A;  4MGS A;  1JZ6 A;  1YQ2 A;  1EUT A;  3LEI A;  5LCW L;  1H6X A;  4A42 A;  2W46 A;  1GQP A;  3III A;  4P02 B;  3HPN A;  4MOA A;  5B4X A;  2VCC A;  4PF1 A;  3WQB A;  4CUA A;  2WDB A;  2JE8 A;  4QX0 A;  4IUG A;  4DUV A;  1ULO A;  4XUO A;  4CUC A;  3WSO A;  4JKM A;  3T08 A;  2ZEX A;  2BER A;  1GOF A;  3HNB M;  5IHR A;  4OMC A;  2E31 A;  2ZEW A;  3T09 A;  3UES A;  5HPO A;  1UXZ A;  4UAP A;  3IAP A;  3PUI A;  3ECQ A;  2W1S A;  1J83 A;  2VTF A;  2E33 A;  2ID4 A;  3EB7 A;  4A41 A;  3T0D A;  1W9W A;  2VO5 A;  2ZEZ A;  3T2Q A;  4A45 A;  2XON A;  1O59 A;  4QX3 A;  3DYO A;  5JMO A;  1JU3 A;  3GGL A;  1ULP A;  4PQQ A;  2VZ3 A;  3A21 A;  1R64 A;  1K3I A;  2X09 A;  1TG7 A;  4AG4 A;  3WNM A;  1OT5 A;  4QX2 A;  2W3J A;  3C7F A;  2VME A;  3LEK A;  3J7H A;  3LPG A;  4A4A A;  1W9T A;  2QQN A;  5B4N A;  2W5F A;  2VJX A;  1JI6 A;  4XUN A;  3WF0 A;  3I2H A;  4P00 B;  4GWJ A;  1XPW A;  5DMY A;  5G05 L;  4LPL A;  2WYS A;  1UXX X;  3JXS A;  3U37 A;  1SDD B;  3ETP A;  3P6B A;  3P1I A;  4MO3 M;  4KMQ A;  2B4K A;  2QQJ A;  3LEG A;  4DEQ A;  1JYW A;  2YFU A;  3WNP A;  2WAO A;  5JXI A;  2VMC A;  3OGV A;  4XVH A;  3EYP A;  4LHS A;  1O8S A;  3MO4 A;  2C4X A;  3CIH A;  3LE0 A;  3FHA A;  3CZJ A;  4RN5 A;  4W4Z A;  5LA1 A;  2E26 A;  2HYX A;  3K77 A;  2ZEY A;  3VD9 A;  3MUY 1;  2CDO A;  2QQL A;  2VCA A;  3ZM8 A;  2ORZ A;  4MAD A;  2VQU A;  1JZ3 A;  1HN1 A;  3K4Z A;  4BDV B;  4KWU A;  3I3D A;  4JHZ A;  1NAE A;  1WCQ A;  1GOH A;  5I0D A;  4QB1 A;  3ACI A;  5EJZ B;  2JKX A;  1UMH A;  1JYX A;  2E32 A;  2VZS A;  5CZK A;  1PX3 A;  2CDP A;  3NJV A;  2VM9 A;  3BGA A;  3UET A;  1KEX A;  3A7Q A;  2W9X A;  3VDA A;  3MUZ 1;  5C70 A;  2YC4 A;  2LW8 A;  2RJ2 A;  1IQD C;  2WN3 A;  3C7E A;  3I3E A;  3GDB A;  2B9V A;  2J22 A;  4QX1 A;  2WO3 A;  3WF3 A;  3I2I A;  2WAA A;  3GM8 A;  1UWW A;  3OEB A;  3NQH A;  3ACG A;  1XNA A;  2VZQ A;  2C26 A;  2OKX A;  2Y6G A;  4CU7 A;  2J1U A;  2W95 A;  2WZE A;  4ARY A;  4QB6 A;  4P5Y A;  4BXS V;  3I2J A;  3WF1 A;  3W5M A;  1W99 A;  1F4A A;  4UI9 L;  4XZU G;  5C71 A;  4YPJ A;  1DYO A;  3IB3 A;  3WNL A;  4A3Z A;  5JR2 A;  1UYZ A;  2J1T A;  1J84 A;  2VC9 A;  1WKY A;  2QQO A;  4DXT A;  3SEP A;  5IFP A;  2J7M A;  2VZ1 A;  5LA0 A;  4AAX A;  2BGO A;  1JZ5 A;  2DCK A;  3T0A A;  3FN9 A;  4A44 A;  1T2X A;  2WO2 A;  3ACH A;  1JHJ A;  1W0N A;  2Y8K A;  3WNK A;  5IJR A;  5FUI A;  4TTG A;  4CUB A;  3W5N A;  3D3A A;  2W92 A;  3DEC A;  3OGR A;  5JXH A;  1OD3 A;  5DPN A;  2W1W A;  2Y6K A;  2VZV A;  2J1R A;  1UYX A;  4FI9 A;  2ZXQ A;  3HN3 A;  2PQS A;  3FL7 A;  3T2P A;  1BHG A;  2Y6J A;  2W1Q A;  4ZZ5 A;  1UMI A;  2RV9 A;  1JZ7 A;  2W87 A;  3ABZ A;  2WZ8 A;  4BK4 A;  1JZ2 A;  4P08 A;  1DP0 A;  3K4D A;  3OEA A;  2VQT A;  5G04 L;  2VZP A;  4UOJ A;  4TXW A;  1D7P M;  3SEE A;  5JUV A;  1UY2 A;  3NNG A;  3GXU A;  4OUE A;  1CZV A;  3IAQ A;  4L0P A;  1US2 A;  4ARX A;  2YC2 A;  5DN2 A;  2QBX A;  4QDS A;  4DXS A;  4KI5 M;  2J1A A;  4BJ0 A;  4GWI A;  4DUW A;  3HOB A;  2WO1 A;  3NJX A;  2JD9 A; 
#chains in the Genus database with same CATH topology
 3JQW A;  3WQ7 A;  2F4L A;  4XQW A;  4E2S A;  1VMF A;  1WW7 A;  4D6Q A;  1UQX A;  4N9I A;  1RIN A;  2JXA A;  3MV1 1;  3FLP A;  4Q4X 1;  4Y5T A;  3AFK A;  3DN7 A;  1ENS A;  2ADE A;  1I5Z A;  1W8O A;  1XSR A;  4MSV A;  4COY A;  5FR3 A;  2P3K A;  1OLM A;  5FLJ A;  2DYC A;  2OPW A;  1XB9 A;  2W0X A;  1FXZ A;  2D5F A;  1K42 A;  1SBE A;  3TWI A;  2W39 A;  4AVB A;  4XUP A;  3UNP A;  3VKF C;  3CMG A;  3ZMN A;  1F31 A;  1OLM E;  1OUS A;  1F5J A;  1DZQ A;  4QHZ A;  4EYU A;  3AZV A;  1UOG A;  3R4D B;  4NAM A;  5FPB A;  1OKQ A;  4LE4 A;  3WNX A;  2RR1 3;  2CYF A;  4BCU A;  4OVE A;  3TAY A;  3VN4 A;  3VDD A;  4CCC A;  3E5U A;  1XBF A;  5GZE A;  5APA A;  3RYP A;  3ZFF B;  5IK8 A;  1IZ3 A;  3I3Q A;  4MZU A;  2WC2 A;  4HVQ A;  1W90 A;  4XYX A;  1LHW A;  4QPG C;  3O1U A;  3M3O A;  5DDJ 2;  5FRA A;  1IGO A;  5C4W B;  1RUC 1;  4AED A;  2DVA A;  3VBF B;  4OQ9 A;  3MIE A;  5FZI A;  5FZ7 A;  3SKV A;  4E8C A;  2HWC 2;  3KV9 A;  2R49 A;  1PO2 1;  1BBT 3;  2JX9 A;  4N7I A;  3O0V A;  1WA4 A;  2A70 A;  1NG0 A;  2R7E B;  3GJA A;  3ZFE B;  4CDX C;  1YQC A;  2EIB A;  1V00 A;  2QZ2 A;  4QX7 A;  2JDA A;  1GZW B;  2MEV 3;  1BBT 2;  1W2O A;  4ZS3 A;  4XJZ A;  4B7K A;  2AAC A;  4DUX A;  4JKK A;  4OYU A;  4PDW B;  5FYC A;  2R16 A;  4AK3 A;  5F2S A;  1W2N A;  3BVC A;  4JQT A;  4XAE A;  5CG8 A;  4ONU A;  2FDH A;  2ZKN A;  1K5J A;  1YQ6 A;  1RJ7 A;  4NRQ A;  4FPE A;  1PO2 3;  4M3C A;  1KQR A;  5JIU A;  2VNO A;  4XFI A;  1AF9 A;  2Y6F A;  3JD7 3;  3ACF A;  3P3P A;  1E5R A;  1GQG A;  5BNN C;  1WCK A;  2RS3 1;  1VRH 2;  2O14 A;  1Z7S 3;  5TSW A;  2OYZ A;  1ZZ8 A;  2QUO A;  3JU9 A;  5LW9 A;  1FNZ A;  3IPV B;  1WBL A;  2I07 B;  2WUH A;  1OQE A;  3LDK A;  1EPZ A;  4L9B A;  1WCU A;  4CDW C;  4P9J A;  4IQP A;  1ZRF A;  2RS3 2;  1H4H A;  1W06 A;  2Z79 A;  4MYE A;  4I0A A;  4UW3 A;  3VBS C;  2BVB A;  1G6N A;  2FZ2 A;  2D44 A;  1NQJ A;  4NWV A;  1WBF A;  2ZMK A;  4B7E A;  5IYY A;  4GH4 C;  3SLI A;  1W3X A;  2W91 A;  4BU2 A;  4HG6 B;  2CNA A;  4QX8 A;  1SLB A;  2G19 A;  3Q8F A;  3VBH A;  3FUO A;  1TQ5 A;  1RUE 1;  2VW0 A;  2ZJC A;  5FZ9 A;  2G1M A;  4OI4 A;  1NZI A;  4F83 A;  4HON A;  4QKD A;  3LSD A;  3ZN5 A;  4GIQ A;  5FZL A;  4E4Z A;  5IVC A;  2DF7 A;  3I2F A;  1AL2 1;  4Q5O A;  3WIN E;  1JHN A;  2D98 A;  1K45 A;  1UOB A;  3RJ2 X;  1ASJ 1;  3DPR B;  2PAE A;  3EQE A;  5ERL A;  2P1B A;  2A6V A;  4W6Y A;  3FHQ A;  3J7L A;  1F4H A;  5KXC A;  2BZD A;  1X36 A;  4U2A A;  2H0V A;  1FX5 A;  1JH5 A;  3AKS A;  2OT7 A;  4XUQ A;  1JU4 A;  4PBP A;  1E57 A;  3H8X A;  3CKH A;  3T4H B;  4W8J A;  2VUJ A;  2YGL A;  1L7Q A;  4F7Z A;  4C1W A;  3OBA A;  4HXC A;  1I1E A;  2ORX A;  1GNH A;  3RGB A;  5FPX A;  1UPI A;  1CPM A;  3EJK A;  4WV8 A;  1J3P A;  2J1S A;  4LNV A;  3TN9 3;  4XQ4 A;  4P9Y A;  4Y4Y A;  4ZXK A;  4YFZ A;  3G7D A;  5E6H A;  3BI3 A;  3BYW A;  4Q4Y 2;  2PFW A;  5D1I A;  2VMD A;  1GU3 A;  5FXX A;  1LOF C;  5EV7 A;  3IDA A;  4LKS A;  1SHW B;  3PU8 A;  4K6B A;  1L7L A;  1MZE A;  4ZZ8 A;  2PHT A;  1BXH A;  1UU4 A;  1SPP A;  2PTM A;  3VBU B;  4ASL A;  2Z4F A;  3LKJ A;  1VBE 2;  5IW0 A;  2A6X A;  4FPL A;  1OF4 A;  3DL3 A;  2RE9 A;  4AFB A;  2CY6 A;  4Y1X A;  1W9S A;  2VOK A;  4J25 A;  1LEN A;  1DBN A;  1YFU A;  1U5X A;  3UJQ A;  5LWB A;  4FTS A;  5JOW A;  1QH7 A;  4E4D X;  2PHL A;  4YWA A;  3W20 A;  4LOT A;  1EAH 2;  4JGY A;  2WWS A;  4JRA A;  1RUH 1;  2JDK A;  4S2H A;  4AF9 A;  1OQ1 A;  1ZRD A;  1PGL 1;  5JI9 A;  4GMP 1;  3TNP B;  1RUI 3;  2L9L A;  4GZ9 A;  3ZXF A;  1KGY A;  4GD4 A;  1QY4 A;  4J1W A;  3VD4 A;  1GMM A;  2X8K A;  2FDF A;  4MXW B;  3URF A;  4QPG B;  3ZSK A;  4Z82 A;  2XHN A;  5F3E A;  4CXY A;  2DV9 A;  2OZJ A;  3BOD A;  3RPQ A;  2EXJ A;  1OFN A;  3GAL A;  3GHN A;  1MZ6 A;  5FY5 A;  3I54 A;  1BEV 1;  5JOZ A;  1JOP A;  3S7E A;  4AHX A;  1NCQ A;  2K9Z A;  3NV3 A;  2WA4 A;  5DUX A;  3AB0 A;  2YPJ A;  4CVU A;  1RL3 A;  4IV3 B;  4KWK A;  1G9A A;  2JDZ A;  1R09 2;  4IV1 C;  4FPO B;  4Y5S A;  1AYM 3;  1X8M A;  4BK5 A;  1ZRE A;  4M00 A;  4OHZ A;  2WNV A;  2IVJ A;  3ILN A;  4CP1 A;  3DPR C;  4IDZ A;  1W6M B;  3V0B B;  2JWP A;  5C8C C;  3AMM A;  3HR9 A;  4H14 A;  2PHD A;  4YW1 A;  1OQD A;  3M3Q A;  4PCR A;  3AX4 A;  1LED A;  4GJY A;  1MPX A;  4KQ7 A;  4MLO A;  4LIV A;  1A78 A;  2VAU A;  1FYU A;  1GLH A;  2XJR A;  3I8T A;  4QU1 A;  1W9F A;  3N3H A;  3OPT A;  1AJO A;  5IAX A;  5F5Q A;  4XFF A;  1YQ2 A;  2RS1 1;  1H4G A;  4P9W A;  4FVV A;  3VZK A;  5FPA A;  4MGZ E;  2D6L X;  4CDQ C;  1YRZ A;  4YVW A;  5I8S A;  3JB4 C;  2W46 A;  1PHM A;  4N7U A;  4P02 B;  4YW3 A;  3FZ3 A;  3PVE A;  3RYK A;  4ASK A;  2FDJ A;  3U0Z A;  2IXC A;  3PME A;  1FPN 2;  3ZDV A;  3WSO A;  3AJZ A;  4WVW A;  1UOJ A;  4C8D A;  1JOB A;  1Q43 A;  1VBB 3;  4UW5 A;  3N9P A;  1ZZ6 A;  2D6O X;  5FZ8 A;  2BER A;  2Y38 A;  4WVV A;  4R4Z A;  1DGW A;  5EJ3 A;  4GMP 0;  4OMC A;  4UFK A;  2ZML A;  1GP6 A;  1XRU A;  2VVF A;  5FO8 B;  3T09 A;  2JDH A;  1HRI 2;  1RIR A;  2DVF A;  3HD8 B;  3O0W A;  3ECQ A;  2W1S A;  2ZHN A;  4XFC A;  1RED A;  4RS5 C;  4Y3O A;  4DIQ A;  1Q8Q A;  2F6B A;  3ZXA C;  3UL2 A;  4HKW A;  2N7G A;  2ENR A;  1RUC 3;  2GSY A;  2ID4 A;  5JZG A;  2XJT A;  4NR1 A;  3EB7 A;  1W9W A;  3HBK A;  3ZYF A;  4C0B A;  4BQ4 A;  1QQP 1;  3T2Q A;  3WHT A;  4Y24 A;  4K7J A;  5FUP A;  1QKQ A;  3H42 B;  4NHK A;  3DYO A;  2AEY A;  3HVD A;  1K5M C;  4QXC A;  4OI1 A;  4BIO A;  3ZYH A;  1JU3 A;  1OBN A;  1XNB A;  1XU1 A;  4S2D A;  1AR6 3;  1K5M A;  2RR1 1;  2HWB 1;  3ACL A;  4AQT A;  3HT1 A;  3B7M A;  5JMC A;  5FZF A;  3ZDS A;  3USU A;  2X09 A;  1K3I A;  4L8Q A;  2VUD A;  2JDN A;  2YXS A;  4TSV A;  3V65 A;  3BU0 A;  1ENX A;  1UL9 A;  3SXW A;  1WW6 A;  3AMP A;  3KCX A;  4DS0 A;  3FX3 A;  2DVD A;  4YZ1 A;  1MS5 A;  1DQ6 A;  1ND2 B;  1LOE A;  3AVR A;  4QGM A;  4MGI E;  4ZU5 A;  5FXV A;  5FYZ A;  1XYN A;  2AYH A;  3FBY A;  5FYI A;  4P14 A;  1ONA A;  3FFQ A;  5J37 A;  4DOU A;  4FAG A;  1N1S A;  2FQP A;  5HCA A;  4BQ2 A;  4GWJ A;  2HWF 2;  1ZBE 1;  3ILR A;  2IXI A;  2GZW A;  3PJY A;  1W6O A;  2WYS A;  1DFQ A;  1UXX X;  4KL1 A;  2XUE A;  3POF A;  4I3G A;  4EV0 A;  5JPN B;  3DUI A;  3P6B A;  4NO4 A;  3P1I A;  3R4U A;  1W6P A;  4MO3 M;  4KMQ A;  5F5A A;  5CFC A;  5C9A B;  4DEQ A;  1Y43 B;  2YFU A;  5JXI A;  1FAY A;  1PGL 2;  4HMZ A;  4XVH A;  3OGV A;  2UWA A;  1C8N A;  5DZE A;  5FP8 A;  3BKZ A;  3MO4 A;  5LBB A;  3E6D A;  1XU2 A;  4LKE A;  3HQX A;  3ELN A;  4XHX A;  3GZA A;  1PIV 3;  5LA1 A;  1CX4 A;  2P6H A;  3WOG A;  1G7Y A;  2R30 A;  3Q8B A;  1QEX A;  1WW5 A;  2PLV 3;  1FV3 A;  3J8F 3;  3VD9 A;  1RC6 A;  3MUY 1;  1UU6 A;  2TUN A;  4JDM A;  2JEN A;  1MAC A;  3PTY A;  3ZM8 A;  1WWY A;  2DUR A;  4CP9 B;  5AC9 1;  4MHR A;  2XWJ B;  1T6G C;  3TEX A;  3WDV A;  4AWD A;  3MGU A;  1AR9 3;  5DUU A;  2JG9 B;  3BOW A;  4FPY A;  3AKR A;  3QBQ A;  1HX6 A;  3KLS A;  1GIC A;  5LRS A;  5C3Q A;  2FMY A;  4KWU A;  4YAR A;  1AR7 1;  4CCE A;  3F95 A;  1QOS A;  2WNV C;  4QQH A;  1LOB A;  4JGZ C;  5D8A B;  1LHV A;  1CN1 A;  3VHN A;  3ZN6 B;  4UFH A;  1LAJ A;  2A6Z A;  1UNB A;  3DF0 A;  2ETE A;  3WG1 A;  2ZAA A;  1QU0 A;  5K0U B;  4Q26 A;  3CNA A;  3IKW A;  3FBM A;  1PX3 A;  2NM1 A;  1C3H A;  5CFD A;  2X5I C;  4LUM A;  2VM9 A;  3ZR5 A;  3UET A;  5T5J A;  3A7Q A;  5K0U C;  2WZR 2;  5A32 B;  4DIN B;  1GP5 A;  2WWU A;  4JDO A;  3OBT A;  4P9X A;  5C70 A;  2RG4 A;  2BYV E;  4NHX A;  5EXO A;  3UV9 A;  1RUG 1;  3FE5 A;  3LA2 A;  3VBH C;  4YG6 A;  3ZYR A;  3MW4 A;  4YM3 A;  5BV6 A;  5JPM B;  1BEV 3;  3IMM A;  4EQV A;  1HIX A;  3PTR B;  4QX1 A;  3S5A A;  2WO3 A;  4YNI A;  5BNO C;  1WMX A;  2PLV 2;  3J8F 2;  5HI0 A;  5FYS A;  4BE3 A;  1XE7 A;  3H1Y A;  1V9U 2;  3S57 A;  2QNK A;  2WFF 1;  3TN9 1;  1ULC A;  1RUH 2;  5JIA A;  1G9B A;  4XQD A;  2IXK A;  4KWJ A;  3KWV A;  3VKN A;  4GMP 3;  4CTE A;  4OUS A;  4MGK E;  1S55 A;  4UBG A;  2W95 A;  2XLF A;  2IFW A;  4C90 A;  5FK7 A;  4QB6 A;  3BTX A;  2UWC A;  4P5Y A;  3WR0 A;  1QOO A;  5T5L A;  1UYP A;  4N8M A;  1ZBA 3;  1W99 A;  1L3J A;  2ZCW A;  1F4A A;  4UI9 L;  5F9T A;  2AC1 A;  5T5P A;  1PO2 2;  1FMD 1;  4RA0 A;  3IB3 A;  4HN1 A;  3AZZ A;  4QXK A;  3WNL A;  1UAI A;  4GA9 A;  5JR2 A;  1V9U 1;  3OBZ A;  4EN9 B;  2VW2 A;  3PUS A;  2XBO 1;  4RR3 A;  3WVJ A;  4BB3 A;  1J84 A;  2A6W A;  2VCM A;  3D8C A;  1AL2 3;  3SEP A;  2PLV 1;  3J8F 1;  1OLR A;  1BMV 2;  2C9A A;  5LBC A;  1R1A 3;  4I3P A;  4AAX A;  3LSE A;  1JZ5 A;  1EV1 2;  2DCK A;  2GN7 A;  5EFU A;  4K21 A;  2YPD A;  4UFJ A;  3OY8 B;  4WM7 A;  3T3Y A;  1HV0 A;  2XVL A;  1UIJ A;  2DBN A;  4BME A;  4CDU C;  3FN9 A;  3POG A;  4AHZ A;  2P2K A;  3R4S A;  3ACH A;  3ASI A;  2Y0I A;  4LT5 A;  3RZK A;  4PIX A;  2Z2S B;  1OSG A;  2QFE A;  4PDW C;  4R8H A;  5M0T A;  3W5N A;  3N4M A;  3WXP A;  2WIN B;  2MPF A;  1O5L A;  2ZZQ A;  2Q8C A;  1OD3 A;  3OTF A;  1YEW A;  4XMA A;  1GNZ A;  1E5I A;  3VBO A;  1YWK A;  3UKV A;  3IMN A;  1BZW A;  4RR3 C;  2E63 A;  3JZV A;  3HN3 A;  3FL7 A;  5JSO A;  4NE9 A;  2Y6J A;  1F35 A;  4BPZ A;  2JG8 A;  3VV1 A;  4BQ1 A;  4D69 A;  2P3I A;  4H3W A;  3LFI A;  3JD7 1;  3PVN A;  4NIG A;  2ZX3 A;  1JZ7 A;  4MXW A;  4CXX A;  2XUM A;  2VXJ A;  2ZGU A;  1OC1 A;  4B4Q A;  3N36 A;  4S2G A;  1H1I A;  2I74 A;  3ON7 A;  4RS5 B;  3U10 A;  3ZOI A;  1O3Q A;  1X33 A;  1H1A A;  4P08 A;  4B4P A;  2NMN A;  5L9B A;  2GP5 A;  2AZ5 A;  5G04 L;  4CDW A;  4XF4 A;  3ZYG A;  1QOT A;  3N7L A;  1KRI A;  4JGY B;  4O9E A;  3ZXL A;  1KD7 A;  1VIW B;  4Q8K A;  3ZSM A;  5JUV A;  5A6Q A;  2D6N A;  3O12 A;  4OUE A;  4XCB A;  1VAK A;  1NLQ A;  1WA6 X;  1UO9 A;  4L0P A;  4ARX A;  4OZX A;  3PIJ A;  3T1M A;  2XHK A;  2QDR A;  2CWS A;  1W04 A;  2R06 3;  4Q1R A;  5J09 A;  4KI5 M;  3AL5 A;  2MHF A;  1RUF 1;  1H8T B;  2JG9 C;  2H6C A;  5IVF A;  1SPP B;  4DUW A;  2DCZ A;  3HOB A;  3H8O A;  1HRI 3;  3DKW A;  4LO5 B;  3ZXD A;  2VE1 A;  3I3B A;  1GR3 A;  2B8M A;  3PVO A;  1LEM A;  3C7O A;  4Q0Q A;  3LQC A;  1DLL A;  4K40 A;  4IEO A;  5T55 A;  3H7Y A;  5A33 B;  2Y64 A;  2YB7 A;  3LAG A;  2HWE 1;  4K1Y A;  2C9K A;  4NIA A;  1OOP C;  1EPW A;  1TME 3;  1DU3 D;  1ZX5 A;  2ARB A;  2XPJ A;  4TLF A;  4WM7 C;  5HXV A;  3CJI C;  4OQ8 A;  5FY1 A;  4P5H A;  3E97 A;  2YG0 A;  4XJU A;  2GNM A;  4JC1 A;  5IAV A;  2HBT A;  2BW8 A;  1RMU 2;  4AHW A;  1U0A A;  2E53 A;  1RUD 3;  5C8C B;  1IPJ A;  5FZ3 A;  3AP6 A;  1RUC 2;  4A7Y A;  3IWZ A;  1S2K A;  3I4I A;  4XF0 A;  3KM5 A;  2OA2 A;  2Q30 A;  4XFG A;  2VL4 A;  5C3O A;  1A34 A;  4XOG A;  4IGQ A;  3KMH A;  1DLC A;  2O0O A;  4Q4X 3;  2VZT A;  1RHI 2;  1IOA A;  5CYY A;  4EZ4 A;  5H9S A;  4PI2 A;  1XND A;  4HET A;  5C3P A;  3K3O A;  5CAZ A;  4JRL A;  4YFW A;  4PLO A;  5T54 A;  1OKO A;  3WDX A;  5FLI A;  3AYE A;  2EID A;  3BN6 A;  3WNN A;  4RFT 0;  3F2Z A;  4AGG A;  3L9J T;  3RJR A;  2GH8 A;  3JB8 A;  1BK0 A;  1NKG A;  2XJP A;  3N7K A;  3VBH B;  4A6O A;  4W50 A;  5LRR A;  5T3N A;  3RQ0 A;  3OD0 A;  1FT9 A;  1VBA 1;  1NUK A;  3H7J A;  2D6P A;  3KB5 A;  3NAP B;  4J6G A;  4WVZ A;  4YZ4 A;  3WW1 A;  1LES A;  1GWL A;  4IER A;  3ENR A;  4RFR B;  2HBU A;  4GAL A;  2QDN A;  3AYD A;  4AI9 A;  3SH3 A;  1FI2 A;  1W39 A;  1W8T A;  2BWA A;  2X5I A;  4Y1Y A;  1Z0H A;  4JTO A;  4IEV A;  4RSU A;  1XYO A;  1TVG A;  4QT6 A;  2XQX A;  2WL1 A;  1VRB A;  1IKQ A;  5IVV A;  4FPC A;  2SLI A;  4E8D A;  3AMH A;  4B8E A;  1W2U A;  2OS2 A;  2WSU A;  1VBA 3;  4HSJ A;  1CPN A;  4V2V A;  1W6Q B;  1EAH 1;  4ZHN A;  4Y20 A;  1Z78 A;  4COU A;  4AI1 A;  1LKN A;  2XQR A;  4LQR A;  1HQW A;  1CJP A;  1LGC A;  2Y6H A;  3SKJ E;  2ZHM A;  5LA2 A;  4M3C B;  4OHY A;  1RUF 2;  5DUW A;  3O5S A;  2BFU L;  3Q9O A;  3CQO A;  1GOG A;  4MGQ A;  2RDS A;  1RMU 3;  3M7A A;  2R04 1;  1CAW A;  3OG2 A;  4DEV A;  1RYY A;  4L2N A;  4JAA A;  4AFC A;  2P3J A;  1PIV 2;  2UU8 A;  5J96 B;  3NJY A;  2LS6 A;  1JMU B;  1OF3 A;  3HT2 A;  5FYH A;  3TEZ A;  4OMD A;  1MEC 2;  4MGY E;  3VD5 A;  4ES9 A;  1C8M 1;  1HJG A;  5KXD A;  2WN2 A;  2Q4S A;  1RUD 1;  4LTA A;  5C4W A;  4EE2 A;  4Z8B A;  1HXS 2;  1DF0 A;  1PZ9 A;  1XC6 A;  4HKL A;  2V5D A;  5L19 A;  1NCR A;  1RXF A;  4FPK A;  4CU8 A;  1MVQ A;  5FK8 A;  1BK1 A;  1GBG A;  2WS9 1;  2Y60 A;  4HK9 A;  2WNU A;  1Y3T A;  2R0H A;  4CCN A;  1YCI A;  2WWJ A;  1YUD A;  3THD A;  2HWF 3;  3ZLI A;  2EXK A;  4YGD A;  2A75 A;  1W8H A;  4QDQ A;  2XH6 A;  3UK9 A;  3RFR A;  4Z92 B;  3QH6 A;  2YGM A;  3WD5 A;  4CPB A;  3ROU A;  1GQH A;  2PQQ A;  2BOJ A;  1YFY A;  3I97 A;  1QJX 3;  1SCS A;  4HL0 A;  5HV0 A;  2HKX A;  3VBR C;  4FFF A;  3A0K A;  4JX0 A;  4XUT A;  2LRO A;  4AQ2 A;  3VBR A;  5L7O B;  4YG0 A;  3RWN A;  1OLQ A;  3B5L B;  5ANQ A;  3E6C C;  4DXR A;  1VBD 2;  2WS9 2;  4CP0 A;  4IEU A;  4CYD A;  5CBL A;  2GMM A;  2X29 A;  1GNY A;  5FZH A;  2R06 2;  5JSR A;  2BGC A;  2K46 A;  2ET7 A;  5FIX A;  2ZGS A;  1S1A A;  5FYY A;  4EN7 B;  3ORJ A;  4XC9 A;  4EN6 B;  5H9R A;  3KV5 A;  2ZOE B;  4RHV 1;  5FQ0 A;  1HB4 A;  2XL7 A;  1W8F A;  3VD7 A;  4F3J A;  1OMI A;  5L36 A;  1S0C A;  3H3U A;  3T2O A;  1W6N A;  5H9Q A;  2XVG A;  2WT1 A;  1PK6 A;  1NCR B;  2GP3 A;  2F4P A;  3WZ1 A;  1HXS 3;  1OXC A;  1GUI A;  1UMZ A;  2IFR A;  3SQO A;  4ZU7 A;  2YY1 A;  4PLM A;  3PHM A;  3O1M A;  4QQ2 A;  4UF0 B;  4LIU A;  4UFI A;  1MQT B;  2D6K A;  4HFS A;  2CL2 A;  5H9P A;  1QNY A;  4XBN A;  1QQP 2;  3ZKY A;  1HRV 3;  3VDB A;  3PIG A;  3JBG 2;  1I5P A;  1UY4 A;  4RQP A;  4YM1 A;  4N90 A;  1SFP A;  4YZ2 A;  3B69 A;  3K4A A;  2VTX A;  2ZZJ A;  1EP0 A;  1OH3 A;  1W3V A;  4FXK B;  4QDR A;  4V1P A;  4CEY A;  4I01 A;  4E27 A;  1HRV 1;  1RUO A;  2DU1 A;  1R08 3;  3VZM A;  1VBD 1;  1FPN 3;  4KG8 A;  4QAW A;  1J58 A;  4GUL A;  2PHX A;  4QKB A;  5E16 A;  1W6Q A;  3IT8 A;  1EV1 3;  3O1O A;  2B42 B;  5HBA A;  2NYY A;  1TMF 2;  4LBL A;  3GJB A;  4RHV 2;  2VPV A;  4KG0 A;  3U4S A;  3E1F 1;  4Q29 A;  5LBE A;  1ZZ7 A;  1LOA A;  3KF3 A;  4XAB A;  5CIR A;  3MBW A;  4AE2 A;  3LIG A;  1JBC A;  2GH2 A;  5EIY B;  5FBJ A;  1V6K A;  2XML A;  3MV0 1;  5I8T A;  1WW4 A;  1NYW A;  2D5H A;  1NY7 1;  3H9A A;  4Y1U A;  5CKM A;  4YVW C;  5FMB A;  5CFC C;  3V64 A;  2LM3 A;  1SCR A;  2VMF A;  4QPI A;  1AR8 1;  1YJK A;  1IS5 A;  2ZPX A;  2RDQ A;  1H30 A;  4DXZ A;  5DAX A;  1AYN 3;  4X8N A;  5GM0 A;  5DAP A;  1U5I A;  2FCU A;  1EYB A;  4MV2 A;  5E89 A;  3VHP A;  2BOI A;  1EUT A;  1O5U A;  1QJU 1;  4TYS A;  5SV5 A;  1SLL A;  4HKO A;  4A42 A;  4CCD A;  1GQP A;  4CDQ A;  2EIG A;  1LOF A;  5AC9 2;  4XAA A;  5C3S A;  1CGP A;  4MOA A;  3D5O A;  2HYK A;  5GLT A;  2VBD A;  2VNG A;  1YI9 A;  1AZD A;  2YBK A;  1MQT A;  5FKC A;  3M3C A;  4DUV A;  5BNQ A;  4XUO A;  3PMS A;  4IE5 A;  1Y9Q A;  3PUR A;  2YU1 A;  2D93 A;  2ES3 A;  1GYK A;  5GJ6 A;  3EXU A;  2D6M A;  1VRH 1;  5DDJ 3;  1RUG 3;  2PAK A;  5C8C A;  2IXH A;  1SMV A;  3T08 A;  2QQU A;  2OZ6 A;  4PJY A;  3RI8 A;  4CRQ A;  3AM2 A;  1QXR A;  3CJI A;  5LAT A;  3HNB M;  1LOD A;  4LBQ D;  4DPN A;  4CE8 A;  3LZZ A;  5EP9 A;  5FYU A;  3B94 A;  3TRS B;  3S7I A;  1PIV 1;  2QCS B;  1UXZ A;  2QVS B;  2TEP A;  4H7M A;  2WQZ C;  1J83 A;  4LHL A;  5A33 A;  1E5S A;  2E33 A;  1ND3 C;  2BTV C;  1DZT A;  2WKK A;  2ARE A;  5BUV A;  1WLW A;  1ZZC A;  3M4F A;  5F5C A;  5KXE A;  2ARA A;  2QZ3 A;  4GB3 3;  4A41 A;  5CAD A;  1RIT A;  5FP7 A;  5L7O A;  1LHU A;  1H8T A;  3N35 A;  4YZ3 A;  1QNW A;  5LAS A;  2XON A;  2XDV A;  2ZTN A;  2WSV A;  1ZBE 3;  3Q8A A;  4QX3 A;  2EXH A;  4XZP A;  5FAX A;  1C8M 2;  1PGS A;  3QLQ A;  1FV2 A;  4NID A;  2CV6 A;  2VZ3 A;  2JKB A;  5A3M A;  3A21 A;  3N9M A;  1R64 A;  2HJI A;  2DWR A;  5FYB A;  1QF3 A;  1TG7 A;  3RG0 A;  4AG4 A;  3ES1 A;  1UW8 A;  4M3C F;  4RD7 A;  4UW4 A;  4BIS A;  1OT5 A;  4QX2 A;  3E6B A;  3IZO A;  5D2A A;  1OA4 A;  2UYA A;  1AX2 A;  2WQ4 A;  2DCT A;  3AZX A;  4BQ5 A;  1W8W A;  3ZKU A;  3THP A;  1R09 1;  3J7H A;  1AVB A;  1CQ9 A;  3MIF A;  4YSF A;  2JG8 B;  3VBO C;  4A4A A;  5DZF A;  4E4S A;  2W5F A;  1JI6 A;  3AKP A;  2ZX1 A;  3WF0 A;  2HWB 3;  3V0A A;  3I2H A;  4FT8 A;  2A1X A;  2WLQ A;  1OA3 A;  2OUH A;  3J26 N;  2VEC A;  2W52 A;  4IV1 B;  4DQA A;  4B1L A;  3OUJ A;  2HEV F;  1CAW B;  2VBB A;  4LO8 A;  1BMV 1;  4XBQ A;  3GZE A;  2QQJ A;  3MW2 A;  3LEG A;  1OOP A;  4HBN A;  1H2N A;  1OUX A;  1RUF 3;  2XBO 2;  3W21 A;  3T1L A;  3NST A;  5J98 B;  1AR8 3;  4IEX A;  1NXM A;  3EYP A;  1F15 A;  2HWC 1;  1X9T A;  4WM7 B;  4ATF A;  3LE0 A;  2DFB A;  1Q8O A;  3CZJ A;  4RN5 A;  1DQ5 A;  3RZH A;  1NCQ C;  2E26 A;  4AVS A;  3MYX A;  4LBO A;  1JTZ X;  4Q0V A;  1VJ2 A;  5ACA 3;  2ORZ A;  1TMF 3;  1BVV A;  3KSC A;  1NE4 A;  4JQR A;  3V56 A;  4NVP A;  1VMH A;  4Q4V 3;  3NAP A;  3VBS B;  4E2G A;  2CWM A;  3FUQ A;  3WCR A;  1LTE A;  2FBE A;  3POY A;  2RS5 3;  1JZ3 A;  1HN1 A;  4FP3 A;  4AAP A;  1ZM1 A;  4BDV B;  3D82 A;  4ZPI A;  4BQ3 A;  2VD7 A;  1SAC A;  1JYC A;  2VMG A;  3SIT A;  1C28 A;  5A70 A;  1DGL A;  2BNM A;  1VLN A;  1UU5 A;  3NAP C;  5I0D A;  1F9K A;  5FYM A;  3TBD A;  4XPV A;  5HV4 A;  1G9D A;  2GAU A;  2IUW A;  1SLT A;  3JBG 3;  5A6Z A;  2JKX A;  2GU9 A;  1H9W A;  1H8V A;  2H6B A;  4EWD A;  1UMH A;  2E32 A;  4H2A A;  4B29 A;  3SMH A;  5C5T A;  2JB8 A;  3DGT A;  2CDP A;  4FPJ A;  5A7O A;  4LEJ A;  1KEX A;  3MIC A;  1R08 2;  4PLN A;  1RVF 3;  1QH6 A;  4NRO A;  2ZBJ A;  3VZL A;  2YC4 A;  2EAL A;  2XKO A;  2WZR 3;  5FZ0 A;  4NAO A;  2WN3 A;  3GHM A;  2R07 1;  3I3E A;  2FDI A;  3DXT A;  1H2L A;  2RM2 3;  3WF3 A;  1S0E A;  3NW4 A;  5CFD B;  5I91 A;  4XIK A;  1D4M 2;  1UZY A;  5C8W A;  3LF7 A;  3ACG A;  2X53 S;  3WQ0 A;  4AVC A;  2BP6 A;  3I49 A;  1QGL A;  5FJH A;  1W0O A;  2ZX0 A;  3ZN6 A;  3ZMO A;  3VZO A;  1LCL A;  1VMJ A;  2PYT A;  2Y6G A;  2NPI A;  2ZGT A;  4LMF A;  5D8A A;  3U78 A;  4CU7 A;  1Q56 A;  1VB4 A;  3HQR A;  4AI3 A;  2J1U A;  1B35 A;  4AEK A;  4ARY A;  5JR7 B;  2KM2 A;  4BXS V;  2JE9 A;  3I2J A;  4IEQ A;  1SQ4 A;  2WFF 3;  5BXX A;  2JG9 A;  3OUH A;  5FPV A;  3NV4 A;  4ZKT B;  4XZU G;  3OD4 A;  3O1V A;  5C71 A;  1H2K A;  4FQ4 A;  4I02 A;  4Q4V 1;  4EWA A;  4A3Z A;  1UYZ A;  3CF6 E;  4Q4Y 1;  2J1T A;  1UX6 A;  4CDW B;  3JQX A;  2AUY A;  4AEJ A;  3TNQ A;  2P17 A;  4MUV A;  2WS9 3;  1YYN A;  5IFP A;  4YLZ A;  1DDL A;  4KGG A;  2AGS A;  2JEC A;  3BPZ A;  4SLI A;  2JDU A;  2NN8 A;  1DQ0 A;  4MGT A;  3APB A;  3USS A;  3T0A A;  2VMI A;  3MLK A;  3J9S A;  1QDC A;  2ADD A;  1N3P A;  4MVT A;  1OA2 A;  2XJV A;  1MEC 3;  3LB9 A;  2WO2 A;  1I9R A;  3OCP A;  4A44 A;  4URT A;  4OLL A;  1W0N A;  3VKL A;  1H8T C;  4CEW A;  5CKQ A;  5CFC B;  1KDM A;  1T6B X;  2JG8 C;  3VBO B;  3WW3 A;  3M3E A;  5A3N A;  1W6P B;  1F5F A;  1ST8 A;  2GDF A;  4CUB A;  2OW4 A;  3D3A A;  2W92 A;  3DEC A;  5T52 A;  1YIP A;  1ND3 A;  1FOD 3;  5BNO B;  1IHM A;  1I3H A;  1AR9 2;  5DPN A;  3RSJ A;  1SBF A;  3RZZ A;  4QD2 A;  1ENR A;  2VUA A;  2J1R A;  4IEP A;  1BLZ A;  1CAU B;  1DQ1 A;  1AXY A;  1CR7 A;  2VVD A;  3AZW A;  3P5B A;  1VE0 A;  1BHG A;  1ZVF A;  4HN0 A;  4OHX A;  3VBF C;  2W1Q A;  5SV8 A;  2UY8 A;  4QX5 A;  5JDB A;  3OY8 A;  4SBV A;  3WP4 A;  4QXH A;  3ITQ A;  4GKY A;  2VH9 A;  2WRA A;  4QM8 A;  3MZH A;  2W87 A;  1ASJ 3;  4URA A;  2WZ8 A;  4BK4 A;  4HSL A;  5A7P A;  1JZ2 A;  4GB3 2;  1DP0 A;  2GNB A;  1POV 3;  3WCS A;  4JZR A;  2DBI A;  4S2F A;  4RR3 B;  2ZA9 A;  4TXW A;  4TWT A;  2A6Y A;  3SEE A;  4CDU B;  3N7J A;  2WYF A;  1CJD A;  4YVS B;  2G9G A;  1F2N A;  1LOG A;  1HW5 A;  3IAQ A;  3O7O A;  4LBQ B;  2Q8O A;  1US2 A;  5FXZ A;  2YC2 A;  4YW7 A;  1LJ7 A;  1AR7 2;  2J1A A;  4GWI A;  1IS6 A;  4Q8L A;  1EY2 A;  5K9Y A;  3LOB A;  3N9O A;  4HOO A;  4LLF A;  3ZIW A;  5FO9 B;  2YMZ A;  2JDM A;  4GB3 1;  4NPL A;  4K20 A;  3W59 A;  4M01 A;  4NUB A;  4XXA A;  1A8M A;  2BQP A;  2J1E A;  4IE4 A;  2PHR A;  2TNF A;  3MI8 A;  1Z7S 1;  1O91 A;  4N43 A;  3VL8 A;  2RHP A;  3WEZ A;  2IC1 A;  4GQ7 A;  1OH4 A;  1QXJ A;  2PHU A;  4MX3 A;  1TE1 B;  1W28 A;  1H6Y A;  1PVC 1;  4XFA A;  1GZ9 A;  4AVA A;  4BZ4 A;  3NVC A;  5LZ6 A;  1AR6 2;  5JOX A;  4N53 B;  1RJ8 A;  3HIF A;  5DAV A;  5D21 A;  3VB9 A;  5JXG A;  1VRH 3;  5DDJ 1;  2WZP P;  3U11 A;  2MEV 1;  4W6X A;  5FY4 A;  4CXW A;  1REF A;  1U5Y A;  3WW4 A;  1V6J A;  4YVS A;  1NLR A;  2QQM A;  5K0U A;  2C0Z A;  3MFC A;  3KCC A;  4QPW A;  2BFU S;  4A6S A;  1JUI A;  1UN1 A;  1RUG 2;  2VOT A;  4OCT A;  5ACA 2;  3POB A;  5J1X A;  3I2O A;  4Z1V A;  4YVW B;  2GC3 A;  3HNM A;  5CEH A;  2D97 A;  5IT6 A;  1GP4 A;  3MIB A;  4X6Q B;  2R0F A;  3L2Y A;  1LU2 A;  4EWE A;  3NO8 A;  3TB0 A;  4MXV A;  4JTN A;  5A3O A;  4IV3 C;  4UWD A;  4AHY A;  2B7Y A;  5IVB A;  1PX4 A;  3KV6 A;  3BAL A;  1COV 2;  5GLU A;  3RYR A;  1A3K A;  2D3R A;  4Z2A A;  4IES A;  1JOJ A;  4L92 A;  1JZ8 A;  5ACA 1;  4AR2 A;  4Z07 A;  4CCJ A;  2WNV B;  2JE7 A;  1C57 A;  1N47 A;  5KBF A;  5KWR A;  4ASM B;  3GBW A;  2VCB A;  3LFM A;  3RDI A;  4OZO A;  4YYO A;  1ND3 B;  5F7U A;  3EHK A;  3GBG A;  3O0X A;  2MEV 2;  1US3 A;  4B4R A;  2V72 A;  2ZGO A;  3C7G A;  1ACC A;  4XIO A;  4PT6 A;  1CX1 A;  2HWE 3;  2YU2 A;  1MS4 A;  1AR6 1;  1SFN A;  2R1D A;  3VLB B;  3FLR A;  4LKD A;  2HLE A;  1WUV A;  5E88 A;  5LY1 A;  4DY5 A;  2V5Y A;  1OVP A;  2A71 A;  5DG2 A;  1CZT A;  3GCW A;  4U36 A;  3S0M A;  1AXZ A;  1PMH X;  4O61 A;  5CVR A;  3EMR A;  1GAN A;  1JYV A;  2RJL A;  3IDE A;  4FFH A;  4ZON A;  1CON A;  5KHJ A;  1C4R A;  1UZ0 A;  3LPF A;  4NHM A;  5F39 A;  1YLL A;  2WT2 A;  4AEM A;  2E51 A;  1YNA A;  3A22 A;  3B00 A;  4FXG B;  4MG2 A;  5JVV A;  4P9L A;  3I2D A;  1M06 G;  2GC0 A;  2VZU A;  1HB2 A;  1QWR A;  2VU9 A;  2QE3 A;  1R09 3;  3GZT B;  2B39 A;  1R1Z A;  4CEY C;  1WME A;  4LXL A;  4QU2 A;  1CIW A;  1D2Q A;  3AC0 A;  4LE3 A;  4LLO A;  1ND2 A;  5A7N A;  3VBU A;  3RZJ A;  5C4W C;  3KF5 A;  5AVA A;  4KWL A;  3U07 A;  1DHK B;  1ZZ9 A;  2C6S A;  2XOM A;  3AXD A;  3QCW A;  5EQU A;  5FOB B;  3AK0 A;  3M8L A;  2XJU A;  4M0N A;  2XBO 3;  2ZAC A;  1G86 A;  1STM A;  1C1L A;  2JB4 A;  1ALY A;  3ZX7 A;  1WD4 A;  3C2U A;  1WCS A;  2CHH A;  2IXJ A;  4QGL A;  3WF2 A;  4RYD A;  1VBC 3;  2UYB A;  4DFS A;  2BPA 2;  3ZO0 B;  3SH4 A;  2Q1M A;  5L9V A;  5FP4 A;  4TZD A;  5F8P A;  3C8X A;  4A2U A;  1W8U A;  3ZYI B;  3AMQ A;  2ZAB A;  2XL9 A;  3O1S A;  4OHV A;  4BQW A;  3CO2 A;  2WNO A;  5ANN A;  3WNO A;  4KU8 A;  1JW6 A;  1RHI 1;  3K2O A;  1JUH A;  5BNP C;  4WM8 A;  1O3R A;  1AL2 2;  3NRU A;  1RUI 1;  5JOY A;  5JZG B;  3M1H A;  1HB3 A;  2R32 A;  2V4V A;  4HK8 A;  1RUH 3;  2RMU 2;  4LO4 B;  4XUR A;  5F6K A;  3RZG A;  1O6U A;  5F5I A;  2Y6L A;  4UBH A;  1Y9M A;  1WGP A;  1S2E A;  3WG3 A;  1LNS A;  2CGP A;  2NZ9 A;  3BB6 A;  1LUL A;  1WMF A;  2VNR A;  1SLA A;  5F6L B;  4Q2F A;  2W94 A;  3RRD A;  4BHP A;  4JKL A;  4X8P A;  1Q5O A;  1J3R A;  4OUM A;  3T2T A;  2Q5T A;  5LY2 A;  3UJO A;  2IWG B;  3PLQ A;  1UX7 A;  5IVE A;  1CD3 G;  1RGS A;  4GXL A;  1V0A A;  3HMY A;  3KT7 A;  4ORF A;  5GAL A;  3RI9 A;  3S5Q A;  4ET7 A;  3VBS A;  3AKT A;  4IE7 A;  4QGN A;  1ASJ 2;  2J1V A;  5FLH A;  3KHC A;  2MNG A;  4LO6 B;  2V09 A;  1QJU 3;  3PU3 A;  1FOD 1;  1UOF A;  3SCG A;  1QJE A;  3CZU A;  4ZS2 A;  1GZT A;  5FMO S;  1O3S A;  2O8Q A;  3MHZ A;  3TEY A;  3PNA A;  4YW6 A;  1UY0 A;  1PMJ X;  1AR7 3;  1Z7S 2;  2RVA A;  2WFP A;  3JD7 2;  4HT1 T;  2XKP A;  3FWE A;  4Y26 A;  5T50 A;  3PUQ A;  1X8E A;  5IVY A;  3TEW A;  3CL1 A;  2VZO A;  4IE0 A;  4I09 A;  4BLI A;  3VUO A;  1UYY A;  3C3V A;  2TBV A;  4IGO A;  2ZGQ A;  3D4K A;  3HNY M;  3MW3 A;  2R07 3;  1IS3 A;  3SIS A;  2R04 2;  5EJ1 B;  1AX1 A;  1PM7 A;  1UY3 A;  2BU9 A;  4IV1 A;  3N9N A;  4QHB A;  1GZW A;  1QHD A;  3HWJ A;  4CP2 A;  4I30 A;  3A23 A;  4LUL A;  1W9Y A;  1YQ5 A;  3ZFE A;  5BNP B;  2QJV A;  1RUE 3;  1XQN A;  4IEZ A;  4D7T A;  3OGS A;  1GV9 A;  4Y4R A;  3KT1 A;  1OD5 A;  3R6S A;  4HLT A;  2AEZ A;  4H7L A;  1NOV A;  1R08 1;  3I2G A;  5I0U A;  3VBF A;  4QPG A;  4CZS A;  2EIE A;  2ILM A;  4O9G A;  1P8J A;  3WF4 A;  5KXB A;  3OBR A;  4MGS A;  3WHU A;  1GSL A;  2E6V A;  2GN3 A;  3LEI A;  1QDO A;  3CJX A;  4Y33 A;  5LCW L;  5LBF A;  1H6X A;  2D3P A;  3III A;  2ZGR A;  1VBC 1;  1V6N A;  2YYO A;  2EAA A;  2VCC A;  4PF1 A;  5DZG A;  3WP5 A;  3ZFG C;  1SFY A;  2JJ6 A;  1H9P A;  2JE8 A;  2RM2 1;  2ZGP A;  4GH4 A;  4QKN A;  4QX0 A;  1ULO A;  1PO1 2;  3I3M A;  1ODN A;  3NNF A;  4Q27 A;  4CUC A;  2K0G A;  1HXS 1;  3FLT A;  2HWD 3;  4JKM A;  5FZB A;  4HAN A;  2GNT A;  4NRM A;  4FO9 A;  4FOY A;  2Y34 A;  3HN1 A;  2Z69 A;  4AW7 A;  4K9S A;  2PA7 A;  3CHX A;  2G4I A;  3OPW A;  5FY0 A;  5FZE A;  2DCY A;  1DCS A;  1HV1 A;  1X7N A;  3AJY A;  1OPO A;  5IHR A;  3POW A;  4V2W A;  2ZEW A;  1IQA A;  3TYJ A;  3UGH A;  2OX0 A;  1BBT 1;  1JOD A;  5AVP A;  5I8Y A;  3IIA A;  3AP7 A;  3ZSE A;  3UKN A;  4LBK A;  5K8S A;  2P4E A;  4YGE A;  2B46 X;  1D0H A;  2PXJ A;  1H1M A;  1QQP 3;  1B35 C;  4XJ9 A;  4YRD A;  2VO5 A;  5EHD A;  3ZR6 A;  3ES4 A;  4EN0 A;  3WUC A;  3K48 A;  5IUQ A;  1N1Y A;  5IK4 A;  5FDB A;  3ZXE A;  4D3W A;  5A3L A;  3HBZ A;  4EJR A;  1ULP A;  4E9K A;  1DQ4 A;  4AED C;  1A8D A;  1F8V A;  2HWF 1;  5FBZ A;  4COV A;  4B1M A;  4CDQ B;  4CDX B;  4DY3 A;  1XSQ A;  3WNM A;  3H8R A;  2EVX A;  4IE6 A;  3BTA A;  2D40 A;  4XFH A;  2VY0 A;  2W3J A;  2H0B A;  1NA1 B;  2DVB A;  1DIW A;  3LWC A;  1PVC 3;  4JGZ B;  4M0H A;  1O7F A;  4ATE A;  2OXB A;  3LDR A;  2VW1 A;  5EWS A;  3LPG A;  4QPI B;  2D43 A;  1W9T A;  4Q4W 3;  1YIF A;  2VJX A;  3Q8C A;  4Q4V 2;  1N3O A;  1DGR N;  3AFG A;  4P00 B;  4LJH A;  4C1X A;  5DMY A;  1MVE A;  2ARX A;  4LPL A;  3P3N A;  2BUK A;  3JUU A;  2R04 3;  3BIW E;  4OUL A;  2D3S A;  3ETP A;  1RUE 2;  4ISR A;  3ZVX A;  2VBP A;  2FHR A;  4P9I A;  1JYW A;  3LOI A;  4LBJ A;  3B3Q E;  3WNP A;  2VXR A;  4XDO A;  1W03 A;  2VMC A;  2V4A A;  5DXD A;  2YUE A;  3THT A;  3MIG A;  1GWM A;  4PHZ A;  3IBM A;  1D4V B;  1O8S A;  4XF9 A;  1JYI A;  2C4X A;  4BWO A;  5A3P A;  1O4T A;  2BNO A;  4X6R B;  4CEY B;  4R9C A;  5C9A C;  1S4C A;  3K77 A;  1VBB 1;  1NZC A;  4PDW A;  1YC6 1;  5F32 A;  5CFD C;  2C24 A;  4RQP B;  4AFD A;  4RGA A;  4WBB A;  1HLC A;  3T30 A;  3WDU A;  2QQL A;  2P5B A;  1V6L A;  4A7Z A;  3AP9 A;  4MAD A;  1V9U 3;  3ZFG A;  3PVB B;  1PNF A;  1PMI A;  4IL7 A;  1KFX L;  2VQU A;  1U12 A;  4AVT A;  4UF0 A;  4WZC A;  1VAM A;  1YO8 A;  5FFO C;  3AYA A;  1CWP A;  1VPH A;  1WZX A;  3K4Z A;  3MLJ A;  2YZ4 A;  1MR5 A;  2RS1 3;  1CAX A;  3BIE A;  4JGZ A;  2DU0 A;  1S0D A;  4JHZ A;  4WVM A;  3AXE A;  3ZFF A;  1W6N B;  4I0B A;  1AYM 2;  1XNK A;  2ERF A;  1ZBA 2;  1WCQ A;  1NA1 C;  3HQU A;  3JCI A;  4AQS A;  1GOH A;  4Y1Z A;  3VL9 A;  1KS4 A;  5FXW A;  1TME 2;  3NV2 A;  3ACI A;  1FMD 2;  4YGC A;  5FQ0 B;  1JN2 P;  1N1T A;  2YC0 A;  2EA7 A;  5CZK A;  2KXL A;  1BKZ A;  2HEY F;  3NJV A;  1MEC 1;  1NE6 A;  3BGA A;  3G6J B;  5JAX A;  4I2O A;  4UXA A;  5C6C A;  2PEL A;  2W9X A;  2PHW A;  2FCV A;  1QJY 2;  3VDA A;  3ZIX A;  1O4Z A;  3POJ A;  5KR7 A;  2EF6 A;  4CCM A;  5FRE A;  1SZB A;  4ZU4 A;  2GMP A;  2RJ2 A;  2YV8 A;  3INA A;  4GKX A;  3VBR B;  2Z5W A;  1W2A X;  1COV 1;  5FZM A;  5CNA A;  2B9V A;  5A7Q A;  3H1M A;  3X29 B;  4D94 A;  4Q4Y 3;  2LTN A;  3E5X A;  2VUL A;  1X50 A;  1HQN A;  1S2B A;  3AL6 A;  3GM8 A;  3MDP A;  4H55 A;  4LA2 A;  1UWW A;  3OEB A;  3NQH A;  3QD6 A;  3O1T A;  2Q1F A;  5DUV A;  3J7N A;  3DKQ A;  1XNA A;  2VZQ A;  3KZ4 C;  4PQ9 A;  2CU5 A;  2WNU B;  5A6Y A;  2Q1Z B;  1LOC A;  1Y7B A;  3BPS A;  3KD4 A;  2A3W A;  2OKX A;  5KHK A;  2OPK A;  3KQR A;  5FPL A;  2P3Y A;  3EO6 A;  5FZO A;  5LEJ A;  2ZMN A;  4NMI A;  3RWK X;  5J48 A;  3DXU A;  3OUI A;  2XLA A;  3WF1 A;  3W5M A;  2BBV A;  4GH4 B;  4KBZ A;  3UKT A;  1ULE A;  4Y22 A;  1S0B A;  4IEW A;  1O4Y A;  3AKQ A;  4YPJ A;  1HKD A;  1DYO A;  5EYX A;  2WNU C;  5AC9 3;  2VOV A;  3KVA A;  2W08 A;  2ARC A;  1SLC A;  5KC6 A;  4KBB A;  2VC9 A;  1WKY A;  3UGF A;  4DXT A;  1HQL A;  4IEY A;  2VZ1 A;  3ILF A;  1LB2 A;  3WT3 A;  1N3Q A;  5LA0 A;  4YW4 A;  2BGO A;  2C5D A;  4XHB A;  2HH9 A;  4OI2 A;  1CAV B;  1IG0 A;  2ZS6 B;  4R4X A;  1DGW X;  2J42 A;  5E1R A;  1AL0 G;  1GFF 2;  4QQP A;  4RHV 3;  4Y20 B;  5ABJ C;  1JHJ A;  1ZZB A;  4P9G A;  4XAC A;  5BNP A;  1WMD A;  3MEP A;  5FZK A;  2BEO A;  5IJR A;  4W6W A;  3ETQ A;  1RUN A;  4TTG A;  3B01 A;  1C1F A;  1CVN A;  5GZG A;  3DV8 A;  4K3U A;  5JXH A;  5GZF A;  2EXI A;  2X5I B;  1FNY A;  1ND2 C;  2HEW F;  3K3N A;  4AOC A;  3WP6 A;  4LO7 A;  2Y6K A;  2VZV A;  1XE8 A;  1POQ A;  1MS8 A;  1UYX A;  4FI9 A;  5FO7 B;  4CCL A;  2PQS A;  1AUY A;  3T2P A;  1PZ7 A;  3N9L A;  5FUN A;  3AP4 A;  1RTV A;  3POS A;  4CSW A;  4ZZ5 A;  4BA6 A;  1BVP 1;  5BPX A;  3ZXK A;  3NJZ A;  1R1A 1;  3WY6 A;  2WZR 1;  3CLP A;  3I59 B;  4HPK B;  4XTM A;  3ZN4 A;  1HRV 2;  3ABZ A;  1TMF 1;  3OF1 A;  1ENQ A;  1RVF 1;  3K4D A;  2OUJ A;  1H2M A;  3OEA A;  4YM2 A;  5GLV A;  3UT0 A;  2VQT A;  4YZ5 A;  3D6E A;  1D7P M;  4D7Y A;  4G3Y C;  1RUJ 1;  1UY2 A;  2W2I A;  3I7D A;  3NNG A;  4UYB A;  5AFE A;  1NY7 2;  4DRR A;  3S6P A;  2KR2 A;  1XE0 A;  2HWC 3;  5GZD A;  1QMJ A;  3M2M A;  1WLT A;  2A73 B;  1MS1 A;  3ZXG A;  3NNL A;  1S0G A;  2BNN A;  1PVC 2;  1PVX A;  2Y33 A;  2WO1 A;  4GJZ A;  1NCR C;  4ES8 A;  3NJX A;  2BJS A;  3ATG A;  3OJB A;  4TLG A;  2YRO A;  3K46 A;  4XE9 A;  4PIY A;  2RS5 2;  1NT0 A;  1IS4 A;  5IWF A;  2RJK A;  1SLI A;  4XMI A;  1J59 A;  2HWB 2;  1S0F A;  2VR4 A;  2VNV A;  5A7W A;  4AFM A;  4FP2 A;  2KD7 A;  4Y1V A;  4FSJ A;  2DUQ A;  3QAC A;  5FZ6 A;  1VP6 A;  2BGP A;  2WQ8 A;  5A7S A;  5GZC A;  3WDW A;  1V70 A;  5ABJ A;  5FWE A;  2BBA A;  4WM8 B;  5JZG C;  5CU1 A;  2Q0A A;  3AP5 A;  4YW2 A;  4N9H A;  4XJW A;  5FY7 A;  3VKM A;  1SDW A;  1LHO A;  3BUC A;  1ULD A;  3THC A;  3SCH A;  2HWD 1;  3CDZ B;  3RNS A;  4YVS C;  1JS9 A;  5F2W A;  3SC7 X;  4NRP A;  1ODM A;  5JCT A;  2XR4 A;  1G8W A;  3EBR A;  5FYV A;  5A1A A;  5HCH A;  1RUJ 2;  2F17 A;  3ZSJ A;  5J7M A;  1PGW 1;  2DUO A;  1ZBE 2;  2DVG A;  5KHG A;  4W65 A;  4AQ6 A;  2GC2 A;  3HEI A;  4CEW C;  4LA3 A;  4QPI C;  1REE A;  4D6S A;  1OVS A;  4CU6 A;  2Z42 A;  4RS5 A;  2VZR A;  3VKO A;  5I0R A;  5DAB A;  4D6R A;  4YG3 A;  5A3U A;  2HWD 2;  4XET A;  3VZN A;  2CGO A;  3QH7 A;  3OB8 A;  1E5H A;  1YJL A;  2CTV A;  2NMO A;  3W58 A;  1IG3 A;  1NXD 1;  4FBF A;  5FMO L;  1ZA7 A;  2R07 2;  1CES A;  1Q8V A;  4D8M A;  1V6I A;  3AMN A;  5FZ1 A;  2DUP A;  3NMB A;  3D0S A;  4COZ A;  5HXM A;  2QKD A;  3FMG A;  3LA7 A;  5DAQ A;  2IVI B;  2WAB A;  5A1L A;  3OGJ A;  1JZ4 A;  4RL7 A;  1ZRR A;  1POV 1;  1VAV A;  3N7M A;  1XXN A;  3DCQ A;  1O3T A;  3NKG A;  2WBK A;  3O1R A;  5AFB A;  1LGB A;  2WJS A;  4AL9 A;  2UY9 A;  2EAK A;  4QPY A;  1TME 1;  2WFF 2;  5CA6 A;  3GYD A;  1HDK A;  4JV4 A;  1PNG A;  2QQK A;  4RQP C;  5FMC A;  1N1V A;  1CIY A;  1EUU A;  4KU7 A;  2PN5 A;  1W05 A;  4R52 A;  3WG2 A;  5KHI A;  5IAT A;  1YXW A;  3POI A;  3BTZ A;  1CZS A;  1PM4 A;  3TOJ A;  4GAZ A;  4FQZ A;  2CAU A;  4QQL A;  5JXJ A;  1Q8S A;  3M70 A;  4BH9 A;  4NHL A;  1HRI 1;  3D0J A;  5IVJ A;  3VD3 A;  3RZM A;  1XYP A;  2XJQ A;  5EZW A;  1VR3 A;  4EZH A;  2NQY A;  1D4M 3;  4Q4W 1;  5EPA A;  2JIC A;  2WNE A;  2ZX4 A;  3GBF A;  5FV3 A;  1W8N A;  4LK7 A;  3LIH A;  2P37 A;  2ZKL A;  5DQ0 A;  1UY1 A;  2BDR A;  2YFZ A;  3B9C A;  3K51 A;  4LHK A;  5FP3 A;  3SHR A;  4R9B A;  2DDU A;  2OVU A;  2O1Q A;  2ZGL A;  3NKT A;  5FMD A;  3KCY A;  1XNC A;  1BYH A;  2A5Z A;  1O8P A;  3T4V A;  3VDC A;  3BU7 A;  3U1X A;  4JVA A;  3UYJ A;  2ET1 A;  2JIJ A;  3WLU A;  3H1W A;  1ZNP A;  4KNC A;  3OYW B;  3HJR A;  4R9D A;  2UWB A;  3IN9 A;  4J1X A;  4IET A;  5K4L A;  2I45 A;  2XLG A;  3J4U H;  1QJY 1;  4D7S A;  4NII A;  4F8A A;  5C5U A;  2YBP A;  1SG3 A;  5IFT A;  4BMB A;  2CGN A;  4FOQ A;  5FZD A;  4D0Q A;  1Q8P A;  3NV1 A;  4N53 A;  3RVH A;  2D7F A;  3FJS A;  3MPB A;  4BQX A;  1Q3E A;  3ALQ A;  4N53 C;  3DYM A;  4DRV A;  1WLD A;  1V6O A;  5EYY A;  4UT5 A;  3MFA A;  4QM9 A;  4QQO A;  1A6C A;  5HCB A;  5A32 A;  5GLW A;  3NNJ A;  3C7H A;  3ZXJ A;  4AI8 A;  4ITC A;  4N43 B;  4UW6 A;  5C3R A;  2W47 A;  4LOS A;  1QXP A;  2B5H A;  4XXP A;  3BCW A;  2Y0O A;  1Y9G A;  2ZAH A;  1ZYB A;  2RMU 3;  1JYN A;  4COW A;  4R9A A;  3OYW A;  4NPM A;  1PO1 3;  2E7Q A;  5D8A C;  4M4P A;  3I2K A;  5BNN A;  2GND A;  5CG9 A;  5J3U A;  1UZZ A;  1DQ2 A;  3H50 A;  4NHY A;  2HWE 2;  2JEM A;  3O14 A;  4CCO A;  1EV1 1;  2I2S A;  3MIH A;  4HVO A;  3VGI A;  2NLR A;  4FPH A;  1VAL A;  4LBQ A;  4XF1 A;  4A7K A;  1AXK A;  1WLC A;  1MZF A;  3H8U A;  2P34 A;  1OUR A;  3NWK A;  3U75 A;  4QB2 A;  5A3T A;  1GWK A;  3DEM A;  4LHN A;  1YHF A;  1J3Q A;  2WII B;  3NL1 A;  4CDU A;  4CP9 A;  3VHO A;  2FDK A;  2R6Q A;  1NLS A;  5F3C A;  4ISQ A;  3ZFE C;  1W2T A;  2P6C A;  4PI0 A;  1MQT C;  1NX9 A;  3VDD C;  4BYY A;  3WP3 A;  5IK7 A;  2DCJ A;  4UFM A;  1D0G A;  1YQ8 A;  1KFU L;  5F37 A;  1RXG A;  3KGZ A;  2FMD A;  3H0O A;  5FP9 A;  3LGR A;  5FZ4 A;  2X05 A;  3WG4 A;  4UFL A;  3FFZ A;  2RS3 3;  4CA9 A;  3B93 A;  1XNT A;  3LDB A;  4K8R B;  4GWM A;  3ZYP A;  4M4R A;  5J36 A;  1WCD J;  3POE A;  4ZY9 A;  3WW2 A;  3CEW A;  5FWJ A;  1CAU A;  3U14 A;  2W1U A;  5C9A A;  4DO0 A;  2X10 A;  2EIC A;  1OPM A;  1COV 3;  2OII A;  5BNO A;  2RDN A;  1PO1 1;  4CU9 A;  1W6O B;  1U5Z A;  3K75 B;  5I93 A;  4LOR A;  1K12 A;  3KHB A;  1ULF A;  2BRT A;  4GWN A;  4PBO A;  4CEW B;  1XOY A;  2VVE A;  4ZXE A;  1HN0 A;  1ZBA 1;  1UZV A;  2XG3 A;  1C8M 3;  3L2H A;  4AI2 A;  1L7R A;  3T0B A;  5LB6 A;  1QJU 2;  4C91 A;  5I0S A;  5C7G A;  3DYP A;  4LBM A;  1KXG A;  4PF5 A;  4DB5 A;  1J1T A;  3PUH A;  2QQI A;  4Q1P A;  1JZ6 A;  2K2S A;  2YBS A;  3MF9 A;  3KV4 A;  1AR8 2;  5F3G A;  3SNM A;  1QJX 1;  4QHO A;  1BEV 2;  3A4U A;  4XJ8 A;  4AXO A;  4XBL A;  4O65 A;  1KJL A;  4WM8 C;  2ZGM A;  3HPN A;  4XJA A;  3USU B;  5B4X A;  3CU7 A;  5JLV A;  1G9C A;  3WQB A;  4CUA A;  2WDB A;  1K5M B;  4IUG A;  3U4X A;  1VBB 2;  2BVV A;  2VQ0 A;  2NP0 A;  3RS6 A;  1AR9 1;  2YDE A;  3ZSL A;  4LBN A;  4XF3 A;  2Q8E A;  4JDN A;  1B35 B;  2RDR A;  3MLL A;  1TEI A;  3WUD A;  5FOJ B;  2ZEX A;  4XFB A;  1GOF A;  2CAV A;  1LEC A;  2WA3 A;  5BNN B;  5FTT C;  2RS1 2;  4LIT A;  1M4W A;  3A0N A;  4NIH A;  2E31 A;  3OPZ A;  2WO7 A;  2JDY A;  4G4F A;  1PK6 C;  4HZF A;  1Y4W A;  3N9Q A;  3UES A;  5HPO A;  4UAP A;  4ERO A;  4YM0 A;  2DFC A;  3IAP A;  1UF2 C;  3PJQ A;  3PUI A;  4JHT A;  2VTF A;  5A7W B;  1BCX A;  4OFG A;  1RB8 G;  5T5O A;  4AGV A;  3E5Q A;  1UCX A;  4FFG A;  1VBC 2;  4C0H A;  2QQV A;  5FZC A;  3T0D A;  5DG1 A;  2ZEZ A;  2GC1 A;  1UPS A;  3KT4 A;  4A45 A;  5BY5 A;  4XIL A;  5KHH A;  4QXB A;  1O59 A;  4TN7 A;  3VBU C;  4XCA A;  5FY8 A;  3MPP G;  5JMO A;  3GGL A;  1DG6 A;  4Q4X 2;  4CCK A;  4PQQ A;  2KA3 A;  5LK7 B;  1ZRI A;  2UUR A;  2W68 A;  5FYT A;  4MET A;  5FCC A;  3R0R A;  5A3W A;  2IZW A;  5LEK A;  5L73 A;  1J1L A;  3CBN A;  4FPG A;  1URX A;  4Q0S A;  5FJK A;  4E2Q A;  1NQD A;  5A6X A;  2V73 A;  4BXF A;  5F1R A;  3C7F A;  2VME A;  1KS5 A;  4LUK A;  3TN9 2;  1GZC A;  4MHU A;  1UKR A;  4BIF A;  3LEK A;  3AZY A;  3WQ1 A;  1UZW A;  4FFI A;  2C1F A;  1LGN A;  3KVB A;  2ZGN A;  2QQN A;  3S30 A;  5HCF A;  5B4N A;  5A80 A;  5L7O C;  4L97 A;  4XDQ A;  4XUN A;  3ZYB A;  4BQY A;  2DTW A;  1AYN 2;  1W6M A;  3V0B A;  4Q0U A;  4NN0 A;  1VB2 A;  1XPW A;  2FZ1 A;  1QJF A;  5G05 L;  1PGW 2;  4FPF A;  1VBE 1;  3JXS A;  3U37 A;  3WV6 A;  1SDD B;  4DZG A;  2B9U A;  4Z2W A;  3IM0 A;  1I6X A;  4IV3 A;  5BYN A;  2B4K A;  2VG9 A;  1NCQ B;  3H3Z A;  2PMW B;  2WAO A;  5FPU A;  1ZRC A;  1IKP A;  4NPR A;  2FD8 A;  4LHS A;  2PAM A;  5DAW A;  3CIH A;  4NOT A;  1OOP B;  3FHA A;  4B3N A;  1LR5 A;  2AR6 A;  4W4Z A;  4M3C E;  1RUJ 3;  4QWN A;  1LU1 A;  2HYX A;  3LCP A;  4XTP A;  4RGK A;  3KGL A;  3W9A A;  1UD1 A;  2ZEY A;  2RM2 2;  1DGR A;  1FOD 2;  3FC0 A;  3RMX A;  5IK5 A;  2CDO A;  4LKF A;  2VCA A;  5K7P A;  5KC5 A;  2WLP A;  4KH9 A;  3V0A B;  3AVS A;  2VGD A;  4Y5Z 0;  4Y22 B;  1HB1 A;  2A7A A;  1W0P A;  4CPB D;  2XVK A;  3GF6 A;  4E4H A;  4LK6 A;  3H3L A;  1HJF A;  4L11 A;  3VHR A;  1FPN 1;  3PDQ A;  3WDT A;  5FZO B;  3I3D A;  3QOP A;  2BV4 A;  2YHJ A;  2LRP A;  1DYP A;  1AYN 1;  3GCX A;  4NWW A;  1NAE A;  2FCT A;  2R1B A;  1PZ8 A;  2R06 1;  2XXZ A;  4JGY C;  1G9F A;  4QB1 A;  2GAL A;  2XJS A;  2LAL A;  1QJZ A;  1MS9 A;  1WD3 A;  2OQ7 A;  5EJZ B;  3ZPO A;  1JXN A;  1KIT A;  4BOW A;  4KGQ A;  1KDK A;  1JYX A;  5E8A A;  2VZS A;  4IGP A;  4N43 C;  2VOW A;  1YFW A;  2G9F A;  1RVF 2;  2E7T A;  2QTW B;  3PUA A;  4IW3 A;  5FPZ A;  2WT0 A;  2ZGK A;  1BQP A;  2ATF A;  1SEF A;  2ZHL A;  1R1A 2;  4QKF A;  3MUZ 1;  4AI0 A;  4BLJ A;  3BOP A;  3O1P A;  3RMY A;  5LA9 A;  2LW8 A;  5ABJ B;  1AYM 1;  1POV 0;  1IQD C;  4Q0P A;  3C7E A;  1MZ5 A;  3GDB A;  2J22 A;  4FOV A;  1OI6 A;  3ZPY A;  4PIZ A;  2DTY A;  5CKN A;  3I2I A;  1S0I A;  2GME A;  1C5H A;  2WAA A;  1VBD 3;  3B9I A;  4FAH A;  3OGG A;  1AHS A;  1IPS A;  3DPR A;  4HVR A;  2Q8D A;  3FHI B;  3ME2 A;  3JBG 1;  4FCA A;  5F3I A;  1LRH A;  5FY9 A;  2C26 A;  2G9Z A;  3CJI B;  4WVM B;  3MF6 A;  2SBA A;  5L9R A;  3MID A;  2VOX A;  4IND A;  1CAX B;  1AX0 A;  2WZE A;  2Y26 A;  3R05 A;  2JDP A;  1BJQ A;  2JIG A;  5FKB A;  1MS0 A;  5GLZ A;  4DNY A;  3BTY A;  2PHF A;  3J7M A;  3WDY A;  1YFX A;  3VZJ A;  1H0B A;  1APN A;  1GKB A;  1SBD A;  2RS5 1;  5ISL A;  4XDP A;  1VBA 2;  1X82 A;  1QJY 3;  4DMI A;  3ZFG B;  1TNR A;  4XW3 A;  5GKA C;  2ZHK A;  2QQP A;  2VUC A;  4O7X A;  2LUW A;  1QJX 2;  2VMH A;  4YW5 A;  2QQO A;  4I0W B;  2BWC A;  2J7M A;  2E7A A;  4AFA A;  3LEM A;  1KJR A;  1MS3 A;  2RMU 1;  5FZG A;  3ZYJ B;  4FTB A;  1FAT A;  3I59 A;  4HPK A;  1DZR A;  1FMD 3;  1V6M A;  3IPV A;  4L99 A;  2FDG A;  2OQ6 A;  1OFS A;  5CIS A;  4IXL A;  1TZO A;  3HAG A;  1RUI 2;  5FZA A;  4AVV A;  2XB6 C;  3RZL A;  1QIQ A;  1T2X A;  5JSP A;  2CSG A;  5I0T A;  2Y8K A;  2VTX J;  5CB7 A;  3WNK A;  5JWP A;  2WR9 A;  1B09 A;  2RR1 2;  3B02 A;  3Q8E A;  4QMA A;  5FUI A;  4FOW A;  3LA3 A;  4G9S B;  1IPK A;  1X9P A;  3OGR A;  4MH0 E;  1ULG A;  3OOX A;  2E9Q A;  3OSD A;  3GNE A;  2W1W A;  1VBE 3;  4LR4 A;  1C5I A;  4CUG A;  2JD4 A;  3AYC A;  1LHN A;  4NJ4 A;  2ZXQ A;  3NNM A;  3M3I A;  4OHW A;  3SH5 A;  1XJA A;  1UMI A;  1JYT A;  4RGG A;  4BM8 A;  2RV9 A;  4OI0 A;  1AJK A;  1EAH 3;  1CAV A;  1UIK A;  4AED B;  1RUD 2;  1DYK A;  2XWB B;  1ZA4 A;  3LD8 A;  3ZFF C;  3IDB B;  3WX5 A;  1NA1 A;  1D2S A;  3IDC B;  1YI7 A;  1TNF A;  4EN8 B;  3UGG A;  5JI7 A;  5A1F A;  2AH2 A;  2A3Y A;  2VZP A;  1OHF A;  3KQ4 B;  3KS7 A;  3VDD B;  4UOJ A;  4K1Z A;  4CDX A;  5LK5 A;  2IXL A;  4AYU A;  2A3X A;  4JCK A;  3GXU A;  2ZX2 A;  1D4M 1;  1CZV A;  3PL0 A;  2O8O A;  2VQA A;  4K8F A;  4YGB A;  4AZZ A;  4A3X A;  3SCF A;  5DN2 A;  2QBX A;  2AEN A;  4QDS A;  3ST7 A;  4DXS A;  5B2G B;  2QQW A;  1S0J A;  4BJ0 A;  4AGR A;  4XEZ A;  1RHI 3;  2B45 X;  1PK6 B;  1RMU 1;  5C33 A;  4FTE A;  3GZU C;  4WZF A;  4Q4W 2;  1W8Z A;  2XGX A;  1UKG A;  2JD9 A; 
#chains in the Genus database with same CATH homology
 3K46 A;  3I3B A;  3C7O A;  3LQC A;  2J1E A;  3MV1 1;  2VR4 A;  2Y64 A;  2YB7 A;  2KD7 A;  2C9K A;  1W8O A;  2BGP A;  2WQ8 A;  3WEZ A;  1OH4 A;  2YG0 A;  2BBA A;  1H6Y A;  1K42 A;  4XUP A;  3UNP A;  3CMG A;  5JXG A;  3THC A;  3CDZ B;  2VL4 A;  2QQM A;  5A1A A;  1DLC A;  2VZT A;  4QPW A;  5CYY A;  5J1X A;  2VOT A;  3HNM A;  3HEI A;  4CU6 A;  2VZR A;  2EID A;  3BN6 A;  3WNN A;  3F2Z A;  3OB8 A;  1NKG A;  4A6O A;  1PX4 A;  3SKV A;  4E8C A;  4W50 A;  1NUK A;  4Z2A A;  4D8M A;  2R7E B;  5HXM A;  1JZ8 A;  2EIB A;  2JDA A;  2WAB A;  2VCB A;  1JZ4 A;  4OZO A;  4DUX A;  5F7U A;  4JKK A;  4OYU A;  1TVG A;  1US3 A;  2XQX A;  2V72 A;  2WBK A;  3C7G A;  4PT6 A;  4E8D A;  1CX1 A;  3ACF A;  2HLE A;  4LQR A;  3SKJ E;  2Y6H A;  5LA2 A;  2QQK A;  1CIY A;  1EUU A;  1CZT A;  4MGQ A;  2WUH A;  1GOG A;  3CQO A;  1PMH X;  1CZS A;  1JYV A;  3OG2 A;  4DEV A;  5JXJ A;  1RYY A;  1UZ0 A;  3LPF A;  3VD3 A;  3A22 A;  5IYY A;  2W91 A;  2LS6 A;  4HG6 B;  1OF3 A;  1W8N A;  2VZU A;  4OMD A;  5DQ0 A;  3VD5 A;  1UY1 A;  2YFZ A;  2DDU A;  2WN2 A;  3AC0 A;  1XC6 A;  2V5D A;  3VDC A;  1O8P A;  4CU8 A;  2XOM A;  3I2F A;  1K45 A;  3HJR A;  3THD A;  4QDQ A;  3WF2 A;  4RYD A;  3FHQ A;  1SG3 A;  1F4H A;  5IFT A;  3I97 A;  2BZD A;  4D0Q A;  3C8X A;  4JX0 A;  4XUT A;  4XUQ A;  1JU4 A;  3WNO A;  3DYM A;  3CKH A;  4DXR A;  4W8J A;  3NRU A;  1L7Q A;  1GNY A;  3OBA A;  2ORX A;  2V4V A;  3C7H A;  2J1S A;  4XUR A;  2W47 A;  2Y6L A;  1JYN A;  3VD7 A;  1LNS A;  2VMD A;  1GU3 A;  4M4P A;  3I2K A;  3IDA A;  4LKS A;  1SHW B;  3T2O A;  4ZZ8 A;  2W94 A;  4JKL A;  1GUI A;  2Z4F A;  1OF4 A;  1UX7 A;  1W9S A;  4ET7 A;  4QB2 A;  2J1V A;  3VDB A;  1I5P A;  1UY4 A;  1NX9 A;  3CZU A;  2L9L A;  4GZ9 A;  3K4A A;  4QDR A;  2DCJ A;  1KGY A;  3VD4 A;  1GMM A;  1UY0 A;  1PMJ X;  2X05 A;  2RVA A;  2XHN A;  4QAW A;  1XNT A;  4M4R A;  4ZY9 A;  2VZO A;  2W1U A;  1UYY A;  2X10 A;  2EIC A;  4CVU A;  3HNY M;  3E1F 1;  5EJ1 B;  4BK5 A;  4CU9 A;  1UY3 A;  3K75 B;  3MBW A;  1K12 A;  3A23 A;  5EIY B;  3MV0 1;  4ZXE A;  3OGS A;  1L7R A;  3T0B A;  1MPX A;  2VMF A;  3I2G A;  5C7G A;  2EIE A;  3DYP A;  3PUH A;  1P8J A;  2QQI A;  3WF4 A;  4MGS A;  1JZ6 A;  1YQ2 A;  1EUT A;  3LEI A;  5LCW L;  1H6X A;  4A42 A;  2W46 A;  1GQP A;  3III A;  4P02 B;  3HPN A;  4MOA A;  5B4X A;  2VCC A;  4PF1 A;  3WQB A;  4CUA A;  2WDB A;  2JE8 A;  4QX0 A;  4IUG A;  4DUV A;  1ULO A;  4XUO A;  4CUC A;  3WSO A;  4JKM A;  3T08 A;  2ZEX A;  2BER A;  1GOF A;  3HNB M;  5IHR A;  4OMC A;  2E31 A;  2ZEW A;  3T09 A;  3UES A;  5HPO A;  1UXZ A;  4UAP A;  3IAP A;  3PUI A;  3ECQ A;  2W1S A;  1J83 A;  2VTF A;  2E33 A;  2ID4 A;  3EB7 A;  4A41 A;  3T0D A;  1W9W A;  2VO5 A;  2ZEZ A;  3T2Q A;  4A45 A;  2XON A;  1O59 A;  4QX3 A;  3DYO A;  5JMO A;  1JU3 A;  3GGL A;  1ULP A;  4PQQ A;  2VZ3 A;  3A21 A;  1R64 A;  1K3I A;  2X09 A;  1TG7 A;  4AG4 A;  3WNM A;  1OT5 A;  4QX2 A;  2W3J A;  3C7F A;  2VME A;  3LEK A;  3J7H A;  3LPG A;  4A4A A;  1W9T A;  2QQN A;  5B4N A;  2W5F A;  2VJX A;  1JI6 A;  4XUN A;  3WF0 A;  3I2H A;  4P00 B;  4GWJ A;  1XPW A;  5DMY A;  5G05 L;  4LPL A;  2WYS A;  1UXX X;  3JXS A;  3U37 A;  1SDD B;  3ETP A;  3P6B A;  3P1I A;  4MO3 M;  4KMQ A;  2B4K A;  2QQJ A;  3LEG A;  4DEQ A;  1JYW A;  2YFU A;  3WNP A;  2WAO A;  5JXI A;  2VMC A;  3OGV A;  4XVH A;  3EYP A;  4LHS A;  1O8S A;  3MO4 A;  2C4X A;  3CIH A;  3LE0 A;  3FHA A;  3CZJ A;  4RN5 A;  4W4Z A;  5LA1 A;  2E26 A;  2HYX A;  3K77 A;  2ZEY A;  3VD9 A;  3MUY 1;  2CDO A;  2QQL A;  2VCA A;  3ZM8 A;  2ORZ A;  4MAD A;  2VQU A;  1JZ3 A;  1HN1 A;  3K4Z A;  4BDV B;  4KWU A;  3I3D A;  4JHZ A;  1NAE A;  1WCQ A;  1GOH A;  5I0D A;  4QB1 A;  3ACI A;  5EJZ B;  2JKX A;  1UMH A;  1JYX A;  2E32 A;  2VZS A;  5CZK A;  1PX3 A;  2CDP A;  3NJV A;  2VM9 A;  3BGA A;  3UET A;  1KEX A;  3A7Q A;  2W9X A;  3VDA A;  3MUZ 1;  5C70 A;  2YC4 A;  2LW8 A;  2RJ2 A;  1IQD C;  2WN3 A;  3C7E A;  3I3E A;  3GDB A;  2B9V A;  2J22 A;  4QX1 A;  2WO3 A;  3WF3 A;  3I2I A;  2WAA A;  3GM8 A;  1UWW A;  3OEB A;  3NQH A;  3ACG A;  1XNA A;  2VZQ A;  2C26 A;  2OKX A;  2Y6G A;  4CU7 A;  2J1U A;  2W95 A;  2WZE A;  4ARY A;  4QB6 A;  4P5Y A;  4BXS V;  3I2J A;  3WF1 A;  3W5M A;  1W99 A;  1F4A A;  4UI9 L;  4XZU G;  5C71 A;  4YPJ A;  1DYO A;  3IB3 A;  3WNL A;  4A3Z A;  5JR2 A;  1UYZ A;  2J1T A;  1J84 A;  2VC9 A;  1WKY A;  2QQO A;  4DXT A;  3SEP A;  5IFP A;  2J7M A;  2VZ1 A;  5LA0 A;  4AAX A;  2BGO A;  1JZ5 A;  2DCK A;  3T0A A;  3FN9 A;  4A44 A;  1T2X A;  2WO2 A;  3ACH A;  1JHJ A;  1W0N A;  2Y8K A;  3WNK A;  5IJR A;  5FUI A;  4TTG A;  4CUB A;  3W5N A;  3D3A A;  2W92 A;  3DEC A;  3OGR A;  5JXH A;  1OD3 A;  5DPN A;  2W1W A;  2Y6K A;  2VZV A;  2J1R A;  1UYX A;  4FI9 A;  2ZXQ A;  3HN3 A;  2PQS A;  3FL7 A;  3T2P A;  1BHG A;  2Y6J A;  2W1Q A;  4ZZ5 A;  1UMI A;  2RV9 A;  1JZ7 A;  2W87 A;  3ABZ A;  2WZ8 A;  4BK4 A;  1JZ2 A;  4P08 A;  1DP0 A;  3K4D A;  3OEA A;  2VQT A;  5G04 L;  2VZP A;  4UOJ A;  4TXW A;  1D7P M;  3SEE A;  5JUV A;  1UY2 A;  3NNG A;  3GXU A;  4OUE A;  1CZV A;  3IAQ A;  4L0P A;  1US2 A;  4ARX A;  2YC2 A;  5DN2 A;  2QBX A;  4QDS A;  4DXS A;  4KI5 M;  2J1A A;  4BJ0 A;  4GWI A;  4DUW A;  3HOB A;  2WO1 A;  3NJX A;  2JD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...