1UMIA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
GSHFYFLSKRRRNLLRNPAGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords F-box only protein 2
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed rcsb
source organism Mus musculus
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umiA00
3LEGA 2ORZA 3HNMA 4A4AA 1W8OA 1LNSA 3ACIA 3ABZA 3I97A 2J1AA 4UI9L 3THDA 2VJXA 5C70A 3I2KA 1EUUA 2VO5A 3LQCA 4DUXA 4QDRA 5JR2A 1H6YA 4DUWA 4RN5A 2EIBA 1UXZA 3NQHA 4DEVA 1UWWA 2WABA 4L0PA 2X05A 3VDCA 2V4VA 4QB6A 3IAPA 1NUKA 3WNPA 4XUPA 3IB3A 3T2PA 2VOTA 2W92A 4Z2AA 3OG2A 2YG0A 2WO1A 3OBAA 2BGOA 3ACGA 3LEKA 3WNLA 2E31A 5CZKA 3W5NA 1D7PM 2QQKA 1US2A 1JYWA 1OD3A 1DYOA 1SDDB 3F2ZA 2WYSA 3IIIA 1W8NA 4DUVA 2VTFA 4A44A 1PX4A 2J7MA 3CZJA 3K4DA 3I2IA 1SG3A 2J1SA 1NX9A 2E32A 4FI9A 4TTGA 1CZVA 2W1QA 1JU4A 2RVAA 1JZ2A 3EB7A 3I2JA 1UYYA 3E1F1 4DXTA 2YFZA 2EIEA 4CUAA 4E8CA 2VQTA 5JMOA 1K12A 1UYZA 3WF2A 1YQ2A 1PMJX 3NJXA 2VM9A 4M4PA 5JXGA 5JXHA 4MADA 4M4RA 4TXWA 2JD9A 3OGSA 1XNAA 4CU6A 2WAOA 3WNNA 3MUZ1 4MGQA 2W1WA 2VZRA 4CVUA 1EUTA 5C71A 2WN3A 3DYOA 1OF3A 3HNYM 4CU9A 5LA0A 2DDUA 2QQMA 2W9XA 3VDAA 4XUNA 2VZ3A 2X09A 3A7QA 1ULOA 3UESA 1T2XA 3T0DA 2PQSA 3P6BA 3OGVA 1PX3A 4QDSA 1HN1A 2VMCA 3I2HA 4JKLA 3IAQA 1JHJA 1K45A 1WCQA 1OF4A 4JKMA 4BK5A 3I2GA 2C4XA 2WN2A 1OT5A 3WNMA 1L7RA 3ACFA 3A21A 1W0NA 4CUCA 2C26A 2LS6A 3WSOA 3SKVA 3VD5A 3T0AA 3IDAA 2VZPA 3SEPA 4D0QA 4QB2A 3WEZA 2VCBA 2W1SA 5IFTA 1IQDC 2E33A 2HLEA 4XZUG 3FHAA 2B4KA 3K46A 2DCKA 4JKKA 1US3A 3HEIA 3I3DA 4MO3M 5LCWL 2BGPA 2JKXA 4OZOA 1O8SA 1MPXA 3I2FA 5DPNA 2WAAA 2VZOA 3NNGA 1UYXA 3CZUA 3WNOA 1PMHX 5IJRA 2Y6KA 3LE0A 4JHZA 4A45A 2QQJA 2XQXA 3ACHA 4PT6A 1BHGA 1JZ5A 3I3BA 4GWJA 2QQOA 3K4AA 4W50A 2QQLA 3T0BA 3MO4A 4P02B 2VZQA 2Y6HA 3T2OA 4QX3A 4W4ZA 1CIYA 3GXUA 3NJVA 3T2QA 1P8JA 1W9TA 3WF1A 5JXIA 2EICA 1JZ6A 3P1IA 4QB1A 5JXJA 2OKXA 1J83A 4KMQA 3NRUA 3I3EA 1JYNA 3THCA 2J1EA 4QPWA 4ET7A 4ZZ8A 3U37A 4CU7A 1UY3A 5B4XA 3LPGA 5I0DA 2W94A 4OUEA 3VD4A 1JU3A 1ULPA 4BDVB 2VZ1A 5DQ0A 3UETA 2XOMA 1O8PA 4MGSA 3ETPA 4A41A 5DMYA 4DXSA 3JXSA 3MUY1 3D3AA 3BGAA 2ZEWA 3OEBA 2E26A 4CUBA 2Y6JA 1GOGA 2YB7A 4ARYA 3PUHA 1JZ3A 1F4HA 3MBWA 3K4ZA 2KD7A 1JZ7A 3K77A 3WQBA 2BERA 4QX0A 1W9SA 5IFPA 1F4AA 2VMDA 3DYMA 1JI6A 2W87A 3WF0A 4XUOA 1UY2A 1UXXX 3VD7A 5A1AA 3A22A 2WO2A 1CZTA 4P5YA 4MOAA 5G05L 1WKYA 2JDAA 5CYYA 2Y6GA 2J1RA 4OYUA 2VCAA 3C8XA 1GU3A 4LKSA 2WZ8A 3CQOA 3DYPA 1OH4A 4ZXEA 2VZSA 2ORXA 2V5DA 4DEQA 2Y6LA 1J84A 2J1VA 1GQPA 1UMIA 4BXSV 2W3JA 5EJZB 4ZY9A 1GUIA 2L9LA 2V72A 2W5FA 4OMDA 1UZ0A 4IUGA 3HNBM 2JE8A 3CDZB 4GZ9A 1JYVA 3BN6A 4PQQA 4XUQA 1K3IA 2QQNA 5J1XA 5IYYA 2VZVA 1DP0A 2WBKA 3MV11 2VQUA 4UAPA 2WQ8A 4YPJA 4OMCA 3UNPA 4AAXA 2VZTA 1GOHA 4P08A 4E8DA 3GM8A 3FL7A 3GGLA 2C9KA 3ECQA 3SKJE 2RJ2A 4UOJA 3HOBA 3WF4A 1XC6A 2Z4FA 3WNKA 4KWUA 2VR4A 3EYPA 1UY4A 5B4NA 1JYXA 2RV9A 5IHRA 2W91A 2WDBA 3HPNA 2QBXA 2Y64A 3C7FA 3C7OA 4JX0A 5HXMA 4BJ0A 3ZM8A 2ZXQA 2YFUA 4AG4A 1TVGA 3VDBA 1CZSA 1DLCA 3VD3A 1NAEA 3OEAA 4XURA 2VC9A 2R7EB 2WO3A 2YC4A 1K42A 1W99A 5DN2A 4P00B 2WZEA 2W95A 5EJ1B 2B9VA 1GOFA 1GNYA 3C7GA 4QX2A 1JZ4A 2XONA 3OB8A 3W5MA 3LEIA 1XPWA 2WUHA 2VMFA 2HYXA 3J7HA 4DXRA 1O59A 4A42A 2BBAA 4PF1A 2J1UA 5EIYB 4LQRA 3OGRA 4RYDA 2ZEYA 3MV01 3C7EA 2LW8A 3K75B 3LPFA 2YC2A 1UX7A 1L7QA 2ZEZA 3PUIA 3T08A 4LPLA 4BK4A 1JZ8A 3VD9A 2VMEA 2ZEXA 2ID4A 4A6OA 5LA2A 3A23A 2BZDA 4QDQA 2W1UA 2XHNA 1GMMA 5FUIA 2QQIA 2Y8KA 2X10A 1SHWB 3FHQA 4W8JA 4HG6B 3GDBA 1KGYA 4KI5M 1RYYA 3FN9A 3AC0A 1UY1A 1NKGA 1W9WA 2J1TA 1I5PA 2W46A 3T09A 5LA1A 1XNTA 4CU8A 4ARXA 4QX1A 5JUVA 2J22A 3CMGA 2CDOA 2CDPA 5G04L 4D8MA 4XVHA 2DCJA 3C7HA 3DECA 2VZUA 4LHSA 3CIHA 4GWIA 1CX1A 2VCCA 3WF3A 5C7GA 5HPOA 4A3ZA 3HJRA 2VL4A 3CKHA 3HN3A 1KEXA 5F7UA 2W47A 1UY0A 4ZZ5A 1R64A 1UMHA 4XUTA 2EIDA 1H6XA 1TG7A 3SEEA 4QAWA
chains in the Genus database with same CATH superfamily
3ZYJB 3LEGA 2ORZA 5FQ0A 1OLMA 1QNYA 1W8OA 2XJVA 3N9PA 4IGQA 5F37A 2RS53 1ZBA3 4FPHA 4U2AA 3THTA 3ABZA 1ZM1A 1C5IA 1SLIA 2WNOA 4L2NA 2J1AA 1UIJA 4HL0A 4UI9L 5A3OA 4Q4X1 3ZPOA 3I2KA 2JE9A 3CL1A 3DKQA 1OSGA 1ND2C 3L2YA 3H3LA 1UNBA 4DUXA 5JR2A 5I91A 3VBFA 4C0HA 4U36A 4RN5A 2IFWA 4AL9A 1RUF2 1RB8G 5FZHA 2EIBA 1PM7A 4AAPA 2RDQA 2WABA 1RHI1 4L0PA 4UYBA 2V4VA 4QB6A 2A1XA 1X33A 3OYWB 1LHUA 4IESA 1KS4A 3ZXEA 4EN9B 2VTXA 2W92A 3IN9A 4FXKB 1UU6A 4CCNA 4YWAA 3LEMA 3ITQA 3NL1A 1YC61 3OG2A 3SC7X 3RWKX 2V09A 3NV3A 3OBAA 2D3SA 2BGOA 2ZA9A 4Y4RA 5FXZA 4COVA 3KMHA 3C2UA 5I0RA 3ZN6A 1RUJ3 2PLV2 3KF5A 1UZYA 1EAH3 1US2A 2P34A 4Y1UA 3MIFA 1OD3A 1GKBA 1VBA2 3VZMA 1DGWA 2A7AA 2IWGB 5FZ9A 1FMD3 2IXLA 1V6KA 4HT1T 3LA3A 5ACA3 2WNVA 3IIIA 4LA3A 4A44A 4CDXC 2NQYA 3OBZA 1H9WA 2VMGA 1AR62 5C4WB 4EWAA 4YZ1A 2ERFA 4FI9A 2ZKLA 5JZGC 1FOD1 4LITA 4TTGA 2XWBB 2P37A 1J1LA 1DZTA 3FHIB 1EY2A 2DCZA 3G6JB 2NN8A 3ZLIA 4P9LA 5BYNA 3I2JA 3E1F1 3VDDA 5APAA 4DXTA 1PIV3 4CUAA 1POV3 5JMOA 2PELA 4IERA 4AR2A 1K12A 3AXDA 5LK5A 1PK6C 3WF2A 4IV3A 5DAWA 4QQLA 2GC2A 3O1OA 5FR3A 4M4PA 1VALA 3FMGA 3LA2A 5JXGA 3M3OA 1R092 4M4RA 4CP1A 4Q4W1 5EFUA 4QX7A 1C8M3 3OGSA 2MEV1 5IWFA 1W2AX 4N53B 5EQUA 2WAOA 1LGNA 1S0IA 4RL7A 5FYVA 3MUZ1 2W1WA 4Q4V1 2JG9A 4IEQA 2ATFA 5C71A 1SLCA 4TZDA 1G9BA 3T4HB 3FC0A 1CR7A 1CJPA 1MZ5A 3OBRA 2EVXA 3E5QA 2OPWA 4UFHA 3TNQA 2VVEA 3PIGA 2C24A 4YW4A 1G9DA 5FZLA 2AEZA 1FATA 1ZA4A 2E7TA 2ILMA 3J8F2 5FMBA 1ZRDA 4XTPA 2NYYA 1OQEA 1E57A 2VZ3A 4XF0A 2HH9A 1CVNA 4AE2A 2TBVA 1QEXA 2JB8A 1HQLA 4XF3A 4R4XA 1MZFA 3UESA 1ACCA 3DF0A 4HPKA 2WFF2 1T2XA 1WCUA 3ZSMA 1AR82 1GV9A 3GNEA 1CAVB 3JB8A 4LUMA 5IVYA 3WCRA 2ZMKA 1V9U1 1W6OA 4EWDA 1V6JA 4EV0A 1D4M2 1UN1A 1NOVA 3I2HA 1QJU3 4JKLA 4BWOA 4CP9A 3DUIA 4XQ4A 1JHJA 3AKPA 1KS5A 5LRSA 4IGPA 4AI3A 1KDMA 5HCBA 3I2GA 2ZGMA 4HSJA 2WN2A 4IV1B 4O9GA 4ZONA 1E5HA 4I09A 3VBSB 5FYMA 5FY5A 1BJQA 1MS5A 2OW4A 5A80A 2RR11 3GJAA 3T1MA 4C90A 3A21A 4CEYA 2X53S 1HRV3 1VB2A 3ETQA 2P4EA 3ZSKA 4CUCA 1C28A 4ISRA 3O1TA 2JENA 1RVF3 2VZPA 3SEPA 4D0QA 3RYRA 3WEZA 1Y9GA 2VCBA 2A3XA 1IQDC 4FPYA 4JRAA 4S2HA 2HLEA 1A8DA 4UF0B 4DQAA 1GQGA 1VR3A 4JC1A 4I30A 2Q8DA 3RDIA 1LHOA 3K46A 4KG0A 2DCKA 4AEDA 5IVBA 1IPSA 2YXSA 4OI2A 1LOAA 4IV3C 4AHWA 5EPAA 2B39A 1AVBA 5DAVA 4XZPA 3WDXA 2RMU1 3HEIA 3HBZA 5FXVA 4FPEA 4XOGA 3ZN4A 5LCWL 5FPXA 4FPKA 4RS5B 1ODNA 2BGPA 1EPWA 2WA4A 3DXUA 2D6MA 4OUMA 5FOJB 1XNBA 3WP6A 2VCMA 1LULA 1GWMA 3BIWE 2ZTNA 2HWD3 2FMYA 4QHOA 1WD4A 5EYYA 4LOSA 1PNFA 3J9SA 2R072 1YI9A 3LSDA 2Y38A 4XIOA 3LF7A 4NPLA 1QJX3 5I0TA 1IPJA 5D8AC 5L7OA 3LE0A 3RYPA 2YPDA 4IL7A 1GFF2 4R9AA 1OQ1A 1QQP3 3D0SA 2XQXA 4X6QB 1FPN2 4XF1A 3DCQA 1REFA 4XBQA 1RUG3 4QGNA 3BVCA 3I3BA 1S0EA 2GNBA 3LCPA 3LDBA 4QX5A 1PGW2 1W6QA 3MO4A 1OPOA 2A3YA 4P02B 4QXKA 1BK0A 5H9SA 2X5IC 1GP4A 3CEWA 3R4SA 1G86A 4XFFA 3VBOA 4W4ZA 3NVCA 1RMU3 3FFQA 1GZTA 3NJVA 3T2QA 1YLLA 1P8JA 3WF1A 5JXIA 1NQJA 5FYIA 1JZ6A 1Q43A 2BNOA 5FY8A 1YWKA 2DBNA 5F2SA 4K20A 1OA2A 1MVEA 2V4AA 4EN6B 5E89A 1YIPA 3AFKA 2ZX0A 4JGYC 3APBA 3AZXA 3PJQA 4M3CE 1BK1A 3TEZA 1Z7S1 1OLRA 2LALA 4ZZ8A 1AYN2 1LGBA 3LA7A 4WZCA 1RUD2 5GLWA 4HKWA 1UY3A 5B4XA 1ZBE2 4Z82A 2OQ6A 2VAUA 4GH4C 4LK6A 5FWEA 4OUEA 5I0DA 2OA2A 2PHFA 1X8MA 4Y5Z0 2VZ1A 4KWKA 1BYHA 2RDSA 4INDA 4JGZB 1DQ5A 2R0FA 3OF1A 4FOWA 3CU7A 3ETPA 2Q8CA 2P2KA 5DMYA 4DXSA 2XXZA 4OHZA 2HWF1 3JXSA 3MUY1 1C5HA 1R083 1PGL2 3OBTA 1LOCA 1SCRA 3B9CA 3D3AA 3S0MA 1YJLA 1RTVA 2WLQA 3AVRA 1MEC3 2WQZC 3O5SA 1IQAA 4YVWC 5HCAA 1PHMA 1Q3EA 3JZVA 2B42B 4FOVA 5A7WA 3ZFEC 3ZYRA 1R1ZA 4ARYA 4ZKTB 2HWC2 2WNUA 3PUHA 2PHLA 3CJIA 4CCCA 4D94A 4CPBA 1L7LA 3POGA 2KD7A 1V00A 2GH8A 2JD4A 4G4FA 4L9BA 4QD2A 3KVAA 1PZ9A 5FZOA 3WQBA 5IFPA 2VMDA 4R52A 3NNLA 3NWKA 3WF0A 4H7MA 3ZYFA 1YHFA 4FP2A 3WW2A 5CAZA 1XU2A 2YYOA 2BOIA 5IVFA 1XNDA 1O3SA 4P5YA 5GZCA 5K0UB 3POFA 3M1HA 4R9BA 2Y6GA 4W6XA 1OA3A 4OYUA 3WT3A 4DMIA 5C9AA 2VCAA 2PLV3 4LKSA 1QDCA 2RDRA 2FQPA 4GA9A 1PVC2 4Y20B 3RRDA 3USUA 3CQOA 3VGIA 4XDOA 2ZGUA 1YXWA 4ONUA 4LBOA 3MIEA 3VV1A 3LOBA 1EYBA 1YCIA 2D3PA 3KV9A 3JQXA 2ZGLA 2NMNA 3H42B 1UO9A 2RM22 5JPNB 5JVVA 4FOYA 2W3JA 4ZY9A 3UGFA 1GUIA 4BQ5A 2FZ1A 1DYKA 1UZ0A 3H1YA 2E9QA 4D3WA 1WWYA 2JE8A 3U0ZA 3GZUC 2BPA2 3BN6A 4PQQA 2FDIA 1UZVA 3NNJA 4YGEA 5FY4A 1K3IA 2PHRA 3A4UA 1NCQA 5FQ0B 3CBNA 1LESA 3ZDSA 1TQ5A 4GALA 2VZVA 4BE3A 1YFWA 1IGOA 5SV5A 1W6NA 4PIXA 1ZRCA 1NLQA 3ILFA 2VQUA 4FFHA 4UFLA 2WQ8A 4YW7A 3RNSA 3GBWA 1RUC1 1S0BA 2A71A 2XKPA 3O1VA 3E6BA 4RHV1 3VBFB 4LJHA 2VZTA 3UJQA 1KD7A 3HT1A 4X8NA 4P08A 5FIXA 3MICA 1GWKA 3ECQA 1MZEA 2R49A 4CXXA 2XLGA 4RQPA 4UOJA 1RUE1 1XC6A 2Z4FA 2P3IA 5AC92 1N3PA 2VR4A 1NXMA 4M3CF 4B1MA 2IVIB 3EYPA 4LE3A 1ND3A 3ZPYA 1H1IA 1OXCA 2QFEA 1O5UA 2XHKA 1VBD2 3CJIC 3ZN6B 3BOPA 1LODA 3S6PA 1PVXA 4QU2A 3VZKA 4R8HA 3VKNA 2CSGA 3SCFA 1ASJ2 1QJY3 2JX9A 1JTZX 5JR7B 4JX0A 1LHVA 1BMV2 2HJIA 1VBE1 4BB3A 2WNVB 4DO0A 1FX5A 3HMYA 4YZ3A 2YUEA 4AG4A 1F9KA 1LR5A 1XE7A 3HBKA 3VD3A 3RZHA 2FD8A 4KU7A 2R7EB 2WO3A 2YC4A 3TRSB 3PVOA 5A3TA 5L19A 1W99A 1D4M3 4P00B 2WZEA 2SBAA 2Y33A 4UBHA 3VBUC 3ZDVA 1BCXA 1C1LA 3K3NA 2HBUA 4KWJA 3WLUA 4CZSA 3NO8A 3PDQA 5KR7A 3W5MA 1WLDA 4WM7A 4XJUA 5FZCA 2W39A 5LB6A 3VBHC 2KR2A 1LB2A 1ZBA2 2QNKA 2BBVA 4JHTA 1O59A 3ZSEA 1DIWA 2NP0A 1ALYA 2BBAA 4PF1A 4E4SA 2ET1A 1UD1A 4LHLA 3ZFGC 2W52A 1NY72 3O0WA 3VHNA 3MPBA 4RYDA 2D6NA 1NZIA 1W39A 3LPFA 2YC2A 1EV11 4MGYE 4N8MA 3ZXAC 5JPMB 4IEUA 1LU2A 1TME1 4MGTA 1WBFA 1MQTC 2GALA 2RJLA 3IIAA 3P5BA 3T08A 3UL2A 4K40A 4AI0A 2OQ7A 3N4MA 5LZ6A 1LEDA 5IATA 2TUNA 3MIBA 3HD8B 1OKOA 5FK7A 3VD9A 3LWCA 2ZEXA 4KL1A 5JMCA 3O1SA 2ZGQA 3AYEA 4A6OA 1W3VA 4QDQA 5T5PA 3UV9A 4JDNA 3O0VA 4XDQA 2A3WA 2Y8KA 4A7KA 3HVDA 2X10A 4ZU7A 3ZXFA 3FHQA 2XR4A 1PO11 2XJPA 4W8JA 3GDBA 1KGYA 3KT7A 1VPHA 2Y0OA 3AZWA 4HPKB 3Q8AA 3FN9A 5IVCA 5ACA2 3PVBB 1DQ0A 5FV3A 1NKGA 4K7JA 4K3UA 1OURA 1UZWA 2RE9A 3RZLA 1IS4A 1XNTA 3ALQA 3BCWA 4ARXA 4CP9B 4NO4A 4CU8A 5C5UA 5D1IA 3SNMA 1RXGA 2J22A 3CMGA 1U0AA 1E5SA 2WC2A 2C1FA 4CDUB 2WZR2 5JCTA 4D8MA 2DCJA 3GZAA 1IPKA 3C7HA 3I49A 4OI0A 3DECA 5FCCA 4XACA 1PIV2 2VU9A 1N47A 4CEYB 1J59A 1ST8A 2Q0AA 5C3PA 2KM2A 3AZYA 1X50A 4QPYA 3KCYA 4NR1A 3UKNA 3M3QA 4PDWA 4F3JA 3I8TA 4HVQA 5HPOA 4YM0A 1Q8PA 5A1LA 3W20A 2BW8A 1S55A 2VL4A 4YVSA 3TEWA 2FCUA 5F7UA 3WDUA 3RZMA 3M3CA 3FLPA 4J6GA 4AEDB 3OUHA 4C8DA 2YV8A 1R64A 3VZLA 3GCXA 1H6XA 4UXAA 1AYN3 1AXKA 1RUD3 2R061 2WNEA 5A70A 2CTVA 1D0GA 4Q0PA 3PIJA 4UFIA 5FZFA 3FFZA 4ZPIA 1H8TA 4XXPA 5D21A 1OBNA 3LFMA 5F3EA 3ZR5A 2FDFA 4FOQA 4D7TA 5I8YA 2WZPP 3AMQA 3WUDA 2WO7A 3QLQA 1V6NA 2ETEA 2ZPXA 4I0BA 1H6YA 1KITA 2RDNA 3MEPA 4WVZA 4V1PA 4D6RA 5A6YA 4FO9A 1YEWA 5F3IA 1UQXA 3E5UA 5L7OB 1LEMA 4EE2A 1Y7BA 4CCLA 2GP3A 3NQHA 4DEVA 1E5RA 3TB0A 3VDCA 4UFMA 1NUKA 2HWC3 2A6XA 4Z2AA 1E5IA 5CISA 3MFCA 1V6LA 4B29A 5LBFA 1LJ7A 1O3RA 2WO1A 1SFYA 1J3PA 1W6QB 1UIKA 2E31A 4NMIA 5CZKA 3WNLA 3AL5A 2HBTA 3SXWA 3OPZA 5FLHA 1D7PM 2EIGA 2QQKA 3INAA 2BFUL 2I74A 3KGLA 3VBOB 5BNOC 1DYOA 1BBT1 1SDDB 2CHHA 2QQVA 2XL9A 1MVQA 2DUPA 3MF6A 4IEOA 1KJRA 3F2ZA 4WM8A 5HCHA 3HWJA 3FWEA 1W9FA 4RR3A 1NA1C 2Q1FA 3AXEA 1B09A 1W8NA 1J3RA 2XKOA 2XB6C 3PUSA 4XJZA 3ZXGA 4CCJA 1HRV2 1PX4A 3CZJA 3BKZA 2VVDA 2GC0A 4MLOA 2OYZA 4AEMA 2GDFA 3ZXKA 4BA6A 1Q8VA 2BGCA 4RFT0 2OIIA 5KXDA 5BXXA 1JU4A 4MGZE 4NRQA 4QQOA 4EZ4A 4AFAA 1JZ2A 4P9XA 3R4DB 3AZVA 2YHJA 3WG2A 3JD71 4XMIA 4CDWB 3ST7A 3PUAA 2MNGA 4ZS3A 1YFXA 1R1A3 2EIEA 2YFZA 4GB31 3H50A 1J3QA 1AR92 2AH2A 2C6SA 2VQTA 2W0XA 1S0GA 2JICA 4FBFA 2UY9A 4D6SA 1YQ2A 3JBG1 3P3NA 4XAEA 4COZA 1ND2A 4FPCA 1OMIA 2G19A 2PQQA 2ZOEB 2GZWA 3WQ7A 2MPFA 3OUJA 5JXHA 4MADA 4TXWA 4Z07A 3AJZA 4CCMA 1AYM2 4LBKA 4CU6A 5A7WB 1OUSA 2WNUB 1BZWA 2VZRA 3AP7A 4LO7A 5CKQA 3MGUA 2UU8A 5JSPA 2A6VA 2WQ4A 4JQRA 3M3IA 4QT6A 5AVPA 1IG0A 5C33A 2WN3A 4NN0A 1HRI2 5FZOB 3KT4A 5A33A 2Q30A 4HFSA 5EZWA 1PGSA 4K8RB 1LOEA 1VRBA 2ZGSA 3C3VA 5FYZA 3LDKA 4YZ4A 1DGRN 1AXZA 5J37A 5JI7A 4TLFA 3BU7A 5F32A 1I9RA 1UMZA 5C3OA 4LO8A 2ZMNA 4AWDA 3KZ4C 5C9AB 4XUNA 2H6CA 5KXEA 1CGPA 5H9PA 4K21A 2ZS6B 5AFEA 3A7QA 4QGLA 4CDXA 5TSWA 2QUOA 1ENXA 4Q4Y1 5CIRA 1XE0A 1RUI1 1ASJ3 4LUKA 1F5FA 3QACA 4NIIA 5JZGA 3UK9A 5F1RA 5FYHA 4Q4X2 3P6BA 3OGVA 1PX3A 4GMP3 3TWIA 5CFCC 5IW0A 5JIAA 5FUNA 4CCEA 4EYUA 2VH9A 4ITCA 4Q1RA 5JOXA 2QQPA 5FZ7A 5JIUA 5A1FA 4UW5A 4Y3OA 1C3HA 4KH9A 3BOWA 1WCQA 1OF4A 4YM2A 3OPTA 5GLZA 3GBGA 3ORJA 1RHI2 1W8UA 1OT5A 1PK6A 4LMFA 4E2GA 3MLKA 2BUKA 1NCQB 1C8NA 1ZZ9A 3DGTA 1S2KA 2CAVA 1W04A 1UU4A 1W0NA 2RS11 2CU5A 2LS6A 3WSOA 3SKVA 3VD5A 3FBMA 2FDGA 3G7DA 1LTEA 1ZZ8A 4X6RB 3BTXA 2R1DA 5K7PA 3AMPA 4LIVA 2YGMA 4WVMA 3VLBB 1R082 5BNPB 3FHAA 1SMVA 3R0RA 2B4KA 3U4SA 1MEC2 1OUXA 4QKDA 5F5IA 1ZREA 2PN5A 4IE7A 2OX0A 2JJ6A 3TOJA 3I3DA 1NCRA 2HWB3 3BPSA 5L9BA 3ZO0B 4M0HA 4FSJA 2O8OA 3AKSA 1O8SA 1UKGA 4IE0A 5EJ3A 4CP2A 1ND3B 2OUHA 1FOD2 2ZGTA 2QVSB 3T4VA 5DPNA 2WAAA 5LBBA 1VAKA 2VZOA 1UYXA 4GIQA 3R4UA 2YGLA 2XLFA 3D0JA 1HJFA 4O61A 2CL2A 3WNOA 3ILNA 4DZGA 1PMHX 3LFIA 5IJRA 1X9TA 3RZJA 1JUIA 1W2UA 3O12A 2HWE1 1EPZA 1FT9A 1WGPA 4XEZA 4AGRA 4ES8A 1MS3A 3ACHA 2UYAA 2VQ0A 4PT6A 5FY7A 5GZFA 3U14A 5ABJC 1BHGA 3KCCA 5DG2A 2QQOA 2AC1A 4W50A 5LASA 3AP5A 3MF9A 2GN3A 5DDJ1 1RUH1 4HZFA 5HBAA 1CPNA 2JDZA 3GHNA 2VXJA 3O1UA 4I0WB 5IUQA 2BRTA 4X8PA 3ZFFC 4Q0VA 3P3PA 4DRRA 2WZR3 4C91A 2JG8C 1H9PA 4HXCA 1TNRA 4XFCA 2B5HA 2G9GA 1W9TA 2D6KA 4WM7B 2ES3A 2EXIA 5C3SA 4IE6A 3T3YA 5J48A 3HQXA 5JXJA 1Y4WA 2GU9A 1NXD1 1C57A 2UURA 2A6WA 3NRUA 1JYNA 5FYCA 4G3YC 3THCA 3AJYA 4QPWA 4QXCA 2QKDA 1K5JA 5KHKA 3NKTA 5A3WA 4CU7A 1AR71 1HB2A 2FCVA 5SV8A 1MS1A 1S0DA 4LIUA 4QPGB 1RUF1 4G9SB 4ATFA 4EN7B 4NIDA 3V0BA 1YFYA 3N36A 4LKDA 1B35A 1JU3A 4Z1VA 4Y26A 3VD4A 2A73B 1V9U2 3K2OA 1RINA 1UPIA 3WHUA 2I45A 4E4DX 2XOMA 1AJKA 4K1ZA 1O8PA 4A41A 5A3NA 3AK0A 5I93A 1JOBA 5FAXA 3NV4A 4R4ZA 1QKQA 5D8AA 5HV0A 1NCRC 3ILRA 1ZRFA 2E26A 2MHFA 4TN7A 1VBA1 1AL21 5FZIA 1QHDA 4OVEA 1GOGA 5FYSA 4XIKA 4LHNA 1POQA 4N43C 1ZVFA 4XQDA 1MR5A 1QJY2 4XC9A 1JZ3A 5HV4A 1K5MB 1SEFA 5K8SA 2K46A 2H6BA 2AYHA 2YZ4A 1AR61 2D3RA 2AR6A 3AX4A 4BM8A 1F4AA 3KGZA 4Q0SA 1W6PB 2X5IA 1GZCA 3LAGA 3V56A 1UY2A 1RC6A 4CPBD 1H8VA 4W6WA 3MW2A 3N35A 2ZHLA 5CYYA 1DQ4A 2F6BA 2RMU2 4OHWA 3KHCA 2R043 2YDEA 4QHBA 1FXZA 1GU3A 4YFZA 3RSJA 4AZZA 5FO7B 5JI9A 2D5FA 3DYPA 2RJKA 3SQOA 5C6CA 3PJYA 1LU1A 4ZXEA 3BU0A 4L92A 2YU2A 1NE4A 3AFGA 2EXHA 2RG4A 4DEQA 5JSOA 2V5YA 2Y6LA 2J1VA 4JGYA 4PDWB 5FZ8A 1VRH3 3JCIA 3H8OA 3TYJA 1YFUA 2P3KA 2L9LA 4BIFA 1R091 2ZACA 4OMDA 1X36A 4XFIA 4YVSB 1H30A 4OLLA 4J25A 1OFNA 2F4LA 1SBDA 2OZ6A 3HNBM 4GH4A 2C0ZA 5FP7A 1JYVA 5DG1A 2AGSA 1RUOA 4A6SA 4CEWC 3QD6A 5E88A 3M3EA 1W2OA 4LULA 1ZX5A 1NQDA 2DU0A 1TMF1 4BXFA 4CDQB 3AKTA 3LDRA 5FOBB 1UOGA 5J1XA 1CIWA 2D6PA 2PMWB 3U75A 2XBO1 3RMYA 1DP0A 1WW4A 5EYXA 5IK4A 3RG0A 4Q8LA 1H8TB 1KDKA 1UOFA 1T6BX 4W65A 1AR93 3MV11 1WMXA 2ZAHA 5F5CA 4BIOA 1YNAA 3D4KA 4OMCA 4YVWA 3MI8A 2GMMA 2W68A 3J8F1 2CGPA 3BTAA 5GLUA 1B35C 3ZFEA 4AAXA 4DB5A 4CSWA 5CFDC 4CCDA 3QH7A 5DUUA 3PUQA 4AW7A 2EA7A 1HXS3 3FL7A 2C9KA 3VZNA 4NHKA 1FV2A 3RI9A 1VJ2A 2WFF1 1AYM3 1AR81 1DBNA 1F15A 3HOBA 3WF4A 3H7YA 3ZXDA 3DPRA 1QWRA 3QCWA 1VMHA 2WWSA 2OZJA 4N7IA 3GALA 3ZYGA 1O7FA 5H9QA 3B9IA 1VB4A 5KHHA 5KBFA 1HRI3 3R05A 1OC1A 1UOJA 2CNAA 5FPLA 3WG4A 1GYKA 4NUBA 1SPPA 2JECA 2OS2A 3EXUA 3SLIA 4P9WA 5C3RA 1WLTA 1H4GA 4ZU4A 4XCAA 3N9LA 2JDMA 4WM8B 2BJSA 2BYVE 2RS31 3WDVA 3VBRB 2F17A 2ZXQA 4RR3B 2VUCA 2XQRA 5FZGA 3MZHA 2NLRA 1W9YA 2WKKA 2ZX1A 1S0CA 4D7YA 2Q8EA 4ORFA 1XSQA 4M0NA 2VC9A 3OD0A 1QOTA 4LBQA 4Q4X3 1K42A 1W6MA 2P5BA 2JB4A 2LUWA 2W95A 1PO21 2CV6A 2ZGRA 2ZGKA 1W2TA 3A0KA 3UYJA 2B9VA 1YIFA 5DUWA 4FQZA 1U12A 1JYTA 1HKDA 4QX2A 1JZ4A 2WL1A 3WVJA 4HOOA 4DNYA 4WZFA 1LHWA 1RHI3 1XPWA 2BDRA 1OHFA 3VKMA 4NOTA 1ND2B 3J7HA 4UW6A 3EJKA 1H4HA 4DXRA 4UWDA 3PMSA 2GMPA 1UF2C 3L9JT 3ELNA 4OHVA 4JTOA 3J26N 2R071 4LQRA 5DUVA 1JH5A 5DABA 1XB9A 3BPZA 3C7EA 2LW8A 1ZYBA 1W2NA 5A7OA 2WS91 4CXYA 3K3OA 4NVPA 3SHRA 1FPN1 5FJKA 4AGGA 5L9VA 2WRAA 4WBBA 2XJQA 3PU8A 3Q8CA 4GULA 1JZ8A 3M4FA 4HN0A 4AEKA 4C1WA 3V0AA 4OZXA 1DGRA 1F8VA 3THPA 3IM0A 3B01A 3AP4A 2VMEA 2YPJA 3H1MA 2QJVA 1WCSA 1CAXA 2ID4A 1BVVA 4MV2A 4MXWA 4OI4A 4Q0UA 1REEA 3ZMNA 5F3CA 5I8TA 3A23A 2BZDA 1XQNA 1FOD3 5A3LA 4BQ4A 1GICA 3KCXA 3SCGA 1VBC1 4AVSA 3DPRC 5GM0A 3OY8B 4P9JA 3WP3A 2P6CA 2NM1A 2TNFA 4P9GA 4HG6B 4CDXB 2FMDA 2VECA 4E4ZA 3AC0A 1G9AA 3S30A 4XPVA 4FPOB 3UKVA 5JZGB 1DZQA 4YW5A 5GZDA 5C8CB 1GR3A 1RUC2 3GJBA 3WQ1A 5IAXA 1HV0A 4RHV2 3T09A 4QX1A 3GZTB 1WLWA 3MLLA 2ARXA 5BNNB 3VBUA 2ZGOA 3ZIXA 3AVSA 4LT5A 4XILA 1ZBE1 4Q4W3 2WR9A 2MEV3 4XVHA 5FUPA 1NE6A 5KWRA 3SH3A 1MS9A 1PK6B 4LHSA 1RIRA 3VBHA 3VKFC 3CIHA 4Q4V3 5A6QA 2GP5A 1R1A2 2Q8OA 4AHZA 2VOKA 2CWSA 2VCCA 2P6HA 4CA9A 4Q2FA 4XJ9A 2BVVA 3ZFGA 3T1LA 5BV6A 1O6UA 1SLLA 2AZ5A 1CAWA 1OOPC 3POBA 4XJ8A 1PGL1 5D2AA 1WCKA 5AFBA 1Y43B 4XCBA 5E16A 4WVMB 2JEMA 4IEPA 3HJRA 2JDUA 1U5IA 3CKHA 1KEXA 3NAPA 4ZZ5A 4AYUA 5FZ6A 3ZXJA 4FAGA 4YM3A 5A6ZA 5JDBA 2WFPA 1MQTA 1ENQA 2LTNA 1OLME 1TG7A 3H1WA 1ZNPA 2VNRA 2UWBA 1AX1A 3HNMA 4FPLA 4A4AA 3U07A 5IK8A 4CCKA 3KSCA 3IDBB 2BFUS 1QF3A 5J98B 3NW4A 1LNSA 1GZ9A 1PZ7A 1V9U3 3ACIA 1GZWA 3GYDA 3I97A 3PLQA 4QKBA 4XFHA 3ROUA 2K0GA 3THDA 4BCUA 5C70A 5F8PA 4BMEA 1EUUA 3IT8A 2VO5A 3LKJA 3RPQA 4QDRA 2B9UA 4J1XA 4PCRA 3N7MA 4DUWA 3I7DA 1PVC1 1WCDJ 4GWMA 4DIQA 2XH6A 3LIGA 2IXCA 4PBPA 1UWWA 2RM21 3QBQA 2X05A 2RR13 3IAPA 5T50A 3WNPA 1YQ6A 3H9AA 3IB3A 2YG0A 5FP3A 1WUVA 5FPAA 1KFXL 4QXHA 3LB9A 5FDBA 4P5HA 3HIFA 4QHZA 1O4TA 5T5LA 3W5NA 4QPIC 4FQ4A 4CRQA 2BVBA 1YQCA 1TME2 1PMIA 1MZ6A 2D93A 3OGJA 5FO9B 4FPFA 5GZGA 1XYPA 3OYWA 2WYSA 4DXZA 3FZ3A 2RMU3 1TEIA 2PHTA 3VDDB 4DUVA 5F6LB 4NHXA 2J7MA 2DCYA 1FAYA 2NPIA 3K4DA 3HT2A 1LOFC 4CYDA 4YSFA 1SG3A 3I2IA 2J1SA 5A3UA 3FX3A 2P1BA 1NX9A 5F9TA 4SBVA 4MG2A 3RZKA 4IV3B 4BYYA 4BZ4A 1BEV1 2C5DA 3IBMA 5F6KA 3W58A 4B4PA 4PBOA 5BUVA 2W1QA 4NE9A 1O4YA 2RVAA 3AP9A 3EB7A 2FDHA 1XRUA 4JCKA 3SITA 3V0BB 2BNNA 3VKOA 5CVRA 5AC91 2VQAA 4E8CA 2HWB2 5DXDA 4DINB 2ZMLA 1UYZA 2JG9B 4RGGA 1PMJX 5LK7B 3NAPC 3TN91 1RITA 2VM9A 1VBD1 3E6DA 4AK3A 3KQRA 5D8AB 4N7UA 3UGHA 1ULFA 4UT5A 4AOCA 4GD4A 2JD9A 5E6HA 2EAAA 4AFDA 1COV1 1IHMA 3WINE 3WNNA 1BMV1 4QM8A 1WW5A 4CVUA 5FY9A 4PI0A 5FLIA 2GAUA 1CN1A 3KLSA 1ZZCA 3DYOA 1OF3A 3MLJA 4NAMA 4Q8KA 3BIEA 1T6GC 4N90A 3ZYBA 1NLRA 1JOPA 1NYWA 1Q8QA 4YZ2A 3MHZA 1RJ7A 1W06A 5F2WA 2IUWA 2B8MA 2WA3A 2X5IB 1VBB1 5LA0A 4MHRA 2ZBJA 1QH6A 4L97A 2DDUA 5T3NA 5BNOA 1W6OB 2QQMA 4BQ3A 4KU8A 4YYOA 1SLBA 5F5AA 1VAVA 4Y33A 1Z7S3 3ZYPA 1W3XA 1NA1A 2R062 2VNVA 1S0FA 5F39A 5I8SA 3WUCA 4XBNA 4CXWA 4QKFA 2E51A 1ULOA 4GJYA 2A75A 1AJOA 4XE9A 5A32A 3VZJA 3PMEA 2VD7A 2RS51 1A3KA 1ZBA1 3D6EA 4XJAA 4AFBA 2PQSA 4J1WA 1UAIA 2D6LX 3T2TA 4COWA 2DVDA 4JDOA 2HWF3 5ISLA 3IAQA 4GH4B 3ATGA 2XLAA 4LOTA 3PHMA 3VUOA 1N1SA 4QU1A 4SLIA 4DFSA 2AACA 2H0BA 3M8LA 4XW3A 2BOJA 5EXOA 2O0OA 4AEJA 5LW9A 3EQEA 4LBJA 4XDPA 3A0NA 2JWPA 3WNMA 1L7RA 2VBPA 3CLPA 4O65A 1CONA 3ACFA 2GC1A 4LBMA 2DWRA 5GJ6A 2C26A 2IVJA 2IZWA 1ODMA 2ZHKA 1LKNA 5CNAA 1HDKA 4YVWB 1ULCA 4QB2A 5LEKA 2Y26A 4S2GA 2W2IA 1RUJ1 2E33A 3ZFEB 3S7IA 2Q1MA 1EAH1 3PL0A 4XZUG 2ZGPA 4AHYA 3J7MA 4Y5TA 2QZ2A 5C4WC 2CYFA 4QKNA 4JKKA 4N9HA 1FMD1 2VMHA 3U1XA 1DGLA 2ZX3A 5ACA1 4MO3M 1WBLA 2K9ZA 4TLGA 4OZOA 1I1EA 2DURA 5ERLA 4XAAA 2PHWA 4URTA 3WP4A 2R1BA 4OHYA 2DFCA 1JMUB 2UY8A 1MPXA 1W8ZA 3DEMA 1JBCA 1VE0A 3I2FA 3N9MA 4QQ2A 3WHTA 3KT1A 4KGGA 1SPPB 1D2QA 3AZZA 4NHYA 3NNGA 4NJ4A 4BISA 5CKNA 3ZN5A 5HCFA 3KV5A 5ANQA 3CZUA 3ZR6A 3WW3A 4GB32 3TEXA 4QPGC 1TNFA 5HXVA 4A3XA 1PIV1 4RS5A 3ZKUA 4C1XA 2R042 1POV1 3VL9A 1HV1A 1SCSA 3VB9A 4E2QA 3JBG2 5FXXA 4N53C 4A45A 5CFCA 2QQJA 5B2GB 1DFQA 2IC1A 3CJXA 2AREA 2YROA 2JDNA 3DN7A 5JAXA 4NIHA 1JZ5A 1VRH2 3I2DA 4GWJA 1AUYA 2BNMA 4F83A 5LY1A 4LBQB 1M06G 2PTMA 3B7MA 1C8M1 2JDYA 1RUC3 1TE1B 2X8KA 3WXPA 4GMP0 4PHZA 3FLTA 4H2AA 4RHV3 2BWCA 2EF6A 1Q8OA 4V2VA 4AGVA 4ZHNA 4E27A 4DS0A 1H2MA 4MZUA 4XHXA 5CKMA 2RHPA 4HN1A 1OVPA 2DU1A 5L36A 4HONA 4AFCA 1K5MC 4OHXA 5BNQA 4XF9A 1RUE3 3HN1A 4DY3A 3B69A 2EICA 1WD3A 2R30A 2VXRA 4H14A 4OQ9A 3FJSA 5IAVA 1J83A 4KBBA 3FUOA 4KMQA 2YMZA 3FUQA 4Y1YA 3I3EA 3LZZA 2H0VA 2ZX4A 4HETA 1DQ6A 4FT8A 4HK9A 4L11A 4URAA 1LCLA 1XBFA 3U37A 2P3JA 5IVVA 3WW4A 1AL0G 3OGGA 4M3CA 1HXS2 1VMFA 1RUI2 4LBLA 4BDVB 1Q56A 1MS0A 3J4UH 1F2NA 1VBE3 2E63A 4YGDA 3RMXA 2XL7A 3JUUA 4MGIE 4AVBA 4IV1C 3V0AB 3RVHA 2YY1A 3CJIB 3HQRA 5FBZA 2D97A 2ZX2A 1GLHA 4MXWB 2VW1A 3VBSC 1CAXB 4JDMA 3VKLA 1QJU1 1QGLA 2KXLA 1W03A 3BGAA 2VPVA 5FYBA 2YC0A 3OEBA 4FAHA 1S2EA 2BV4A 5BY5A 2JIGA 4BPZA 2YB7A 3SH4A 3CF6E 4Y22A 3MPPG 3MBWA 4LNVA 4A7ZA 1AHSA 3ON7A 5ABJA 4HKLA 3POYA 1HRV1 3OOXA 4BOWA 3KWVA 3N9NA 5EP9A 3USUB 3I54A 2FDKA 1W9SA 5IVJA 1RVF1 2VOVA 2DVAA 5J96B 4XUOA 3KVBA 3BALA 4RS5C 4KQ7A 4RFRB 4XFAA 1UXXX 3VD7A 3VBUB 1SFPA 1GANA 3M2MA 1VIWB 1C1FA 3A22A 4MH0E 3ZFFA 1CZTA 4BQXA 4RA0A 1DDLA 5G05L 2JG8A 1W8TA 2JDAA 3M70A 5GKAC 3ZSLA 5J3UA 2J1RA 3JB4C 2XVKA 1IS5A 1JHNA 1EV13 3AKQA 3B5LB 2R16A 1QY4A 2WZ8A 3KV4A 1TME3 2VZSA 3CNAA 4XHBA 1HW5A 2V5DA 4XF4A 1SQ4A 3ZFGB 4TSVA 1H2NA 3SCHA 1GQPA 4BXSV 4EZHA 2ARBA 5EJZB 2V72A 1N3OA 2HWD1 3J7LA 2PAEA 1WMEA 1MS8A 1W6NB 3WY6A 2BWAA 1POV0 3ASIA 4AVVA 3KF3A 5LY2A 1RUNA 3ZMOA 4BMBA 4Y4YA 1QJX1 2Y60A 1MQTB 1V6OA 1W05A 1IS6A 2WT1A 2XUMA 3AP6A 2QQNA 1O3QA 2HWE2 1PO13 1QQP1 3KS7A 2BU9A 2HEVF 2GNTA 2F4PA 3HAGA 3HR9A 2IXJA 2N7GA 2QQWA 3RYKA 4MSVA 1RUG1 4RQPB 4D69A 1DGWX 1GZWB 2ZHNA 1DF0A 4IEXA 2D5HA 5DDJ2 1RUH2 4M01A 3UNPA 5KC5A 2ZHMA 2ZJCA 4YLZA 3KV6A 2YBPA 2R6QA 5FPBA 1WW7A 1EP0A 4N43A 4WVWA 4JZRA 4LO5B 2WJSA 5FP9A 4OQ8A 4AVCA 1KFUL 4E8DA 2FCTA 3SKJE 3PTYA 5H9RA 2VUJA 1RMU1 3GZEA 1O3TA 2XVLA 3B02A 1F35A 2DUOA 3ZSJA 4B7KA 4I2OA 4Q26A 3WNKA 2O8QA 3PURA 4EWEA 1DHKB 5B4NA 4H7LA 4ZU5A 4CCOA 1GBGA 3IKWA 3WX5A 4XJWA 2ZZQA 4JGZC 4AXOA 4DY5A 1AR72 2HYKA 5FYTA 2RV9A 2FDJA 3PVNA 3BB6A 3POSA 3ZXLA 2W91A 2WDBA 2TEPA 2WWUA 4Q4W2 4B4RA 2MEV2 3B00A 3HPNA 1HLCA 1AX2A 1OVSA 2QBXA 2Y64A 3QOPA 3ZX7A 4AQ2A 3UKTA 4Q4V2 3ZM8A 1NT0A 2R063 2CGOA 2YFUA 4BQYA 1YYNA 1UKRA 1W28A 3VZOA 5IK5A 3X29B 4K6BA 1TVGA 1CZSA 1DLCA 1N3QA 1R081 3OEAA 1PNGA 3U11A 1W90A 4CEWA 3ZYIB 1AL22 4IGOA 4QMAA 1MEC1 4PLNA 1ZZ7A 5EJ1B 2XPJA 2XG3A 5AVAA 2ZAAA 3WQ0A 2ZZJA 5EWSA 2XJTA 3E97A 3C7GA 5FZDA 2GNDA 5K0UC 4CTEA 4LBQD 2DBIA 2XONA 2CAUA 2G4IA 2XJUA 4ATEA 4IEYA 2JDHA 5FYYA 1H2KA 2VMFA 5FMDA 1LHNA 4YRDA 5C8CC 5CFDA 5A6XA 4A42A 2J1UA 1DU3D 2LM3A 4E2SA 5BNNC 2BEOA 3OGRA 3D8CA 2ZGNA 3MW3A 4GAZA 5A7PA 3ZOIA 4LO6B 3S5QA 1I5ZA 3MV01 4AQ6A 3K75B 2DVGA 2PLV1 4QX8A 4MUVA 4NPRA 1BBT3 2P3YA 1S4CA 2VBBA 1L7QA 1SFNA 4JV4A 5KHGA 1H1AA 1AXYA 1NG0A 4ZXKA 5CADA 1QIQA 2BP6A 1XXNA 4BK4A 3GHMA 3NKGA 4I3GA 4OFGA 2RR12 5CU1A 4B8EA 1V6IA 1OH3A 2PA7A 4QQHA 5BNOB 4ASMB 1ZZBA 3TEYA 5LA2A 1DCSA 1G9CA 1KRIA 1TMF2 1PM4A 2WSUA 3AM2A 5FUIA 2Z2SB 1NA1B 4FCAA 5FFOC 3O1RA 4OCTA 3FBYA 1GSLA 1SHWB 2VG9A 3JD73 1DYPA 1F5JA 3VBFC 3RWNA 4COUA 2XBO2 1OFSA 1RYYA 3K51A 4GB33 3EBRA 2DYCA 5ANNA 5A32B 1UY1A 3MYXA 1XNKA 4MGKE 4FTSA 3U10A 5KXCA 1U5ZA 3JBG3 1O91A 2W46A 2PFWA 4JVAA 4R9DA 1ENSA 5FKBA 4LKFA 5JUVA 3V65A 1WW6A 1WMFA 1W0OA 2CDPA 5G04L 2DVBA 2GN7A 2CGNA 3B3QE 2Z79A 1JN2P 5FK8A 3U78A 1A34A 2QDNA 4LO4B 2VZUA 5FMCA 4FPGA 4GWIA 2OT7A 1S2BA 1XJAA 3RS6A 1W8HA 2VTXJ 4RD7A 3WV6A 1CX1A 4LEJA 3DKWA 1PZ8A 4YG0A 2XDVA 4BHPA 2VUDA 1YI7A 4Z92B 1U5YA 2WNVC 2ADDA 5LBEA 4B3NA 5FRAA 4CDUA 5KHJA 4AI9A 1BXHA 4K8FA 4A3ZA 1N1VA 3IPVA 1UW8A 3WW1A 1V6MA 3URFA 2FBEA 4LA2A 3BYWA 3WR0A 1UY0A 1TZOA 1W8WA 5FYUA 2WLPA 2RS32 1UMHA 2D98A 2YBSA 1QJY1 4S2FA 1H0BA 1X7NA 3E5XA 3FE5A 4YARA 2VOXA 1SDWA 5F3GA 3RZGA 1CX4A 3VDDC 4Q4Y3 4P9YA 1ULDA 1RUI3 3WCSA 2NZ9A 3M7AA 2QDRA 1QDOA 4DRVA 5A3PA 4Q29A 2VJXA 1FNYA 1HB1A 4BQWA 1PO22 1H1MA 2O1QA 1D4M1 3LQCA 3ZKYA 4HK8A 5L9RA 5J09A 5GLVA 3N9OA 5FMOS 4IW3A 1UX6A 4XABA 1Z7S2 2K2SA 4Y24A 4YGBA 3H3UA 2R0HA 1O5LA 5FXWA 5JLVA 3IZOA 3WDYA 1CESA 5E1RA 3U4XA 1UXZA 5CFCB 4WVVA 1IS3A 3K48A 4H3WA 1OD5A 3AMHA 5FPZA 4DPNA 2JG9C 3KQ4B 5FZ1A 1A78A 1GP6A 4XFBA 2RS13 2VOTA 4XUPA 5FJHA 3T2PA 2WYFA 2ENRA 2Q4SA 3ACGA 3LEKA 3PNAA 2HWF2 3AYDA 1V70A 5T5JA 2BTVC 3ZYHA 2GNMA 2WS92 4NIGA 4ASKA 1JYWA 1OQDA 5DUXA 2PAKA 2ZCWA 4IQPA 2GSYA 2I2SA 2B45X 2UYBA 2GH2A 4K1YA 1CPMA 3NJYA 2LRPA 4LTAA 1OOPA 1QH7A 1UU5A 3Q8BA 1D2SA 1IKQA 1HB4A 4GKXA 3TAYA 2VTFA 3NJZA 4R9CA 2A5ZA 2JE7A 3BODA 4Y1XA 2E32A 4HLTA 1QJEA 1VBC2 1CZVA 4KGQA 5FLJA 1NZCA 3USSA 4M3CB 5FZ4A 1ZRRA 1UYYA 1AX0A 5FPVA 4KNCA 4CDUC 3AL6A 1QXRA 2FHRA 5M0TA 1JXNA 4MYEA 1LGCA 2IXKA 4JQTA 2HWE3 3N7LA 3NJXA 4FVVA 3H8RA 1GWLA 4CEYC 4FPJA 5A33B 4IXLA 4V2WA 4PLMA 3I3MA 4CDWA 3O7OA 5DDJ3 3DXTA 1RUH3 1XNAA 1PGW1 2D40A 4Y22B 2DVFA 5K9YA 4B1LA 2R32A 4MGQA 5LATA 1EUTA 1IG3A 2D44A 4NRPA 4KWLA 5ABJB 1BLZA 4WV8A 4MXVA 3B93A 5FZ0A 4AEDC 1ZZ6A 4XETA 1DQ2A 1JODA 3HNYM 4Y1VA 4IETA 3VN4A 2DTYA 4CU9A 3POEA 4QPIA 4CE8A 1WMDA 1D4VB 3I59A 3ZFFB 1CD3G 1SLAA 3NV2A 2W9XA 1J1TA 2JG8B 4GJZA 1O4ZA 3VDAA 2WT0A 1AR73 2WT2A 1UZZA 5CA6A 2Y34A 1AYN1 1RUF3 2X09A 4E4HA 1RUD1 3WD5A 4MVTA 4PF5A 1DQ1A 2E6VA 1LOFA 3T0DA 2QCSB 4LXLA 1GP5A 2ZKNA 3UT0A 1RUE2 5L7OC 1X82A 4HKOA 1Y9QA 4YW3A 3LD8A 3H8XA 1OKQA 1YUDA 4QDSA 1YO8A 4EN8B 1HN1A 3H7JA 3NV1A 1S1AA 2VMCA 1MS4A 1XYNA 2GMEA 2W08A 3UGGA 1G7YA 1UOBA 1K45A 2XGXA 2JIJA 4JKMA 1SBFA 1VBA3 1AL23 2PHUA 1Q8SA 4I02A 4BK5A 2C4XA 3RJ2X 1A6CA 4LLOA 3GF6A 2VMIA 5EV7A 5A3MA 1DG6A 5A7SA 2EXKA 4AHXA 3VBOC 2HWC1 1VBE2 1OLQA 4GWNA 3KHBA 3RZZA 4UBGA 4LLFA 4AVAA 5LBCA 1A8MA 1NCRB 1AR63 1MACA 5BPXA 3IDAA 3T0AA 1CAUA 2LROA 1FI2A 1KXGA 1J58A 2OPKA 3VHOA 4D6QA 2W1SA 5IFTA 3LOIA 4N43B 1XSRA 5FY0A 3N3HA 4B4QA 1ONAA 1LECA 2A6ZA 2JDPA 3GCWA 3OSDA 5T52A 1QJFA 1US3A 4M00A 5JOZA 2OXBA 3N7JA 3PTRB 1LOBA 4FFIA 1KJLA 3GBFA 2EAKA 2O14A 1VAMA 4D7SA 3NNFA 1QXJA 2VBDA 2JKXA 3ENRA 4CDWC 3IDEA 3BTYA 1VP6A 4AFMA 5BNPA 1BEV2 2I07B 1L3JA 4CP0A 1R093 4BQ2A 1UL9A 1LOGA 2Y0IA 1XOYA 3S5AA 2VY0A 3FLRA 3H3ZA 2A70A 1FNZA 4YG6A 2HEYF 1R1A1 4MHUA 1TMF3 4QXBA 2VNGA 2Y6KA 3HQUA 1EV12 1BVP1 3RFRA 2ARAA 1HN0A 4JHZA 3TN92 4C0BA 4Y5SA 2WNUC 3VL8A 2XBO3 1U5XA 3EO6A 4JTNA 4ASLA 3SH5A 4L99A 4CEWB 3K4AA 2QQLA 3WOGA 3T0BA 3WDWA 5FMOL 5FZEA 4LK7A 4TWTA 4QGMA 4UW3A 1X9PA 4COYA 3J8F3 1JYIA 1COV2 2VZQA 1REDA 2Q5TA 4ES9A 2Y6HA 3IMMA 4F8AA 2XJSA 4HVOA 2CWMA 3T2OA 5J36A 1Z78A 4QX3A 1CIYA 4IE4A 4P14A 4K9SA 2WFF3 1PO12 3GXUA 1AR83 5C9AC 4JAAA 3LGRA 4NWVA 5DAXA 4DOUA 2SLIA 3AMNA 1VBB2 3P1IA 1B35B 3CHXA 4QB1A 4YW1A 1QJZA 4PIZA 2OKXA 4BLIA 1HIXA 5CFDB 3ME2A 5FZKA 1Y3TA 3I4IA 5FTTC 4NHMA 3DV8A 5C4WA 2X29A 2J1EA 4QWNA 4PQ9A 5LEJA 4NAOA 4ET7A 3D5OA 4YW2A 3MW4A 4OULA 4JRLA 2IXIA 5KC6A 5C8WA 3LPGA 3H8UA 1S0JA 2W94A 4EN0A 1XYOA 2RS52 4AQSA 1ULPA 3POIA 5FKCA 3S57A 1KQRA 1N1TA 2RS33 2VNOA 1ASJ1 3Q8EA 1OA4A 5DQ0A 1SBEA 3RI8A 3UETA 1JUHA 1JW6A 1QU0A 4MGSA 2CY6A 4GMP1 5KXBA 1NCQC 2WWJA 1JYCA 1N1YA 4E9KA 3N7KA 4IEVA 3MIDA 4A2UA 4QPGA 5L73A 4AVTA 1YRZA 2Q1ZB 5JOYA 2E7QA 2ZEWA 3AKRA 2VUAA 4Q0QA 5FZBA 4CUBA 2Y6JA 4O7XA 4P9IA 5J7MA 4N53A 1PO23 4LORA 2PXJA 2DTWA 2B7YA 5BNPC 3WG3A 4NRMA 4EJRA 1F4HA 3K4ZA 1SZBA 5FZAA 3AYAA 4HMZA 1JZ7A 3K77A 4PJYA 1GQHA 1UCXA 3NNMA 4QQPA 4IEZA 3WP5A 3ZIWA 2BERA 4QX0A 1HB3A 4RQPC 3DYMA 1GNHA 3KD4A 3SMHA 1JI6A 2Z5WA 1RUJ2 2W87A 2NMOA 4FFGA 1F31A 1EAH2 4YZ5A 5FWJA 4XQWA 3EMRA 5A1AA 4JGYB 1QMJA 2WO2A 3O1MA 2R073 3KB5A 4BU2A 3I2OA 1ND3C 1FMD2 4LBNA 4MOAA 4OUSA 1NY71 1WKYA 5CG8A 1K5MA 1UPSA 4AF9A 5CEHA 4NHLA 2PAMA 4RSUA 3C8XA 2XWJB 5FO8B 2HWB1 2WS93 4MX3A 2XUEA 4IDZA 1OH4A 1RGSA 3NMBA 2EXJA 2E53A 1FPN3 2ORXA 3Q8FA 3AYCA 1W6PA 3CO2A 4NIAA 1CAVA 3H0OA 4GQ7A 5DZFA 5CB7A 5IK7A 1J84A 1UMIA 2AUYA 3ZVXA 4Z2WA 4PLOA 5EHDA 2VVFA 2B46X 2W5FA 2BQPA 1SACA 3IPVB 2G9ZA 3OJBA 4IUGA 5T5OA 3ACLA 1XE8A 3OPWA 3CDZB 3POJA 4GZ9A 3DL3A 5FPUA 3MIGA 5A7QA 4NPMA 4XUQA 1VBC3 4HVRA 4RGAA 5CG9A 4LKEA 5KHIA 3O0XA 2IFRA 1LRHA 3QH6A 4IV1A 4BQ1A 1BBT2 1UYPA 2HKXA 5IT6A 5IYYA 3VBSA 2WBKA 4FP3A 4O9EA 2VW2A 1YQ8A 3VHPA 3B94A 1C8M2 4UAPA 4XTMA 3DPRB 3N9QA 4YPJA 4WM7C 3RGBA 2Z69A 3POWA 4PI2A 2JDKA 4UF0A 1GNZA 4IE5A 4CDQA 3T30A 1LAJA 4YNIA 2XJRA 2PYTA 1CJDA 1X8EA 1XNCA 1ZBE3 1GOHA 4F7ZA 3GM8A 3JQWA 2WZR1 3GGLA 5DZGA 4FTEA 4XXAA 1C4RA 1M4WA 1STMA 3JD72 2RJ2A 5T54A 4I3PA 4GXLA 1ZRIA 1W8FA 5E8AA 4KWUA 2IXHA 2PHDA 1HQWA 5DAPA 5C3QA 4UW4A 2G1MA 1UY4A 2OUJA 4AI8A 2J42A 2ARCA 1JYXA 1CQ9A 5K4LA 5FP8A 4UFJA 1YQ5A 4I01A 5IHRA 5LWBA 2WSVA 4XBLA 3UJOA 2HEWF 2QZ3A 1ZA7A 2AEYA 1QOSA 4S2DA 2JXAA 2XMLA 1W6MB 3C7FA 3C7OA 3O14A 3W9AA 1W0PA 1LENA 5HXMA 1RL3A 2DFBA 4BJ0A 4IEWA 4OI1A 1OOPB 4AI2A 3AB0A 3BTZA 1HJGA 1QJU2 1IOAA 4HSLA 4HANA 2EALA 2UWCA 3VDBA 5FREA 1WA6X 4Q1PA 3BI3A 1APNA 1NAEA 4YGCA 2QE3A 4LR4A 4XURA 3Q9OA 3AMMA 3LSEA 3IWZA 2VOWA 3IDCB 4LE4A 2D43A 5DN2A 3JU9A 4META 3VBRA 5I0UA 1NLSA 3O1PA 1FYUA 1GOFA 4B7EA 1PVC3 3TNPB 5GALA 1RXFA 1GNYA 1FV3A 4W6YA 5FBJA 1HX6A 2UWAA 2VE1A 4XMAA 5GZEA 2VULA 3OCPA 3WNXA 1RVF2 5FZ3A 2VW0A 3OB8A 2RM23 3LEIA 4Q4Y2 1OI6A 2WUHA 4YM1A 1JS9A 2HYXA 2WIIB 5DZEA 3OD4A 2PHXA 3OTFA 3MFAA 1QOOA 4BH9A 4I0AA 5EIYB 3E6CC 4PDWC 5T55A 2ZEYA 4ISQA 3WDTA 4QM9A 2E7AA 5JOWA 5JWPA 2ZABA 3MIHA 2R041 2ADEA 4YFWA 1WZXA 2YBKA 1UX7A 4LHKA 4YVSC 5A7NA 2VGDA 3S7EA 5GLTA 4FFFA 1DLLA 1D0HA 3W59A 3ES4A 3W21A 2ZEZA 3L2HA 3PVEA 3PUIA 4FXGB 1Z0HA 3SISA 4LPLA 1ULGA 2V73A 4CDQC 2Y6FA 4JGZA 5C5TA 1VRH1 2HWD2 3BUCA 2RS12 4QPIB 4HBNA 4ZS2A 4N9IA 2Z42A 3PU3A 2D6OX 3I59B 3EHKA 4YW6A 1QJX2 5DAQA 2QQUA 1URXA 1H8TC 2D7FA 2AENA 1BEV3 3I3QA 2W1UA 1IKPA 1GMMA 2XHNA 2QQIA 4PIYA 4YG3A 3V64A 1RJ8A 4XFGA 4AI1A 1QQP2 4L8QA 4CUGA 4KBZA 5JSRA 2DCTA 3R6SA 4KI5M 4UFKA 1SLTA 3TBDA 2DUQA 5F5QA 1RUG2 4NROA 1V0AA 1YJKA 2DV9A 2KA3A 4TYSA 5AC93 4Y1ZA 1JOJA 4GKYA 1QXPA 3VBHB 1W9WA 2J1TA 1I5PA 2G9FA 4AQTA 1AR91 2WINB 3TN93 1QNWA 5LA1A 1HQNA 1AZDA 3ES1A 1AF9A 1VBD3 3F95A 4KG8A 1G8WA 3OY8A 5I0SA 2CDOA 3MDPA 1CAWB 4Q5OA 4Z8BA 2XVGA 1RMU2 5K0UA 4NWWA 1BQPA 1HXS1 5LRRA 1I6XA 3IMNA 3OUIA 1COV3 1AYM1 1OPMA 3NAPB 1H2LA 3KM5A 4Y20A 5IVEA 1I3HA 4FTBA 1Y9MA 2ET7A 5C8CA 1Q5OA 2FZ2A 4EQVA 4XYXA 3RJRA 1G6NA 2QTWB 3J7NA 4WM8C 5CBLA 3WF3A 5BNNA 1WA4A 2JKBA 4RGKA 5LA9A 5HI0A 1CAUB 1HRI1 3VBRC 4RR3C 4A7YA 2GC3A 3LIHA 5FZMA 5C7GA 1CWPA 2DF7A 2P17A 3RQ0A 3WZ1A 4BLJA 1VBB3 1VLNA 5FY1A 3D82A 3VHRA 3HN3A 1G9FA 2OVUA 2C9AA 2A6YA 1IZ3A 1XU1A 2W47A 5FP4A 1VMJA 1DZRA 4H55A 4XUTA 2EIDA 1BKZA 2YU1A 4Q27A 1ULEA 4EROA 3WG1A 1ENRA 3NSTA 3SEEA 1WLCA 4QAWA
chains in the Genus database with same CATH topology
3LEGA 2ORZA 3HNMA 4A4AA 1W8OA 1LNSA 3ACIA 3ABZA 3I97A 2J1AA 4UI9L 3THDA 2VJXA 5C70A 3I2KA 1EUUA 2VO5A 3LQCA 4DUXA 4QDRA 5JR2A 1H6YA 4DUWA 4RN5A 2EIBA 1UXZA 3NQHA 4DEVA 1UWWA 2WABA 4L0PA 2X05A 3VDCA 2V4VA 4QB6A 3IAPA 1NUKA 3WNPA 4XUPA 3IB3A 3T2PA 2VOTA 2W92A 4Z2AA 3OG2A 2YG0A 2WO1A 3OBAA 2BGOA 3ACGA 3LEKA 3WNLA 2E31A 5CZKA 3W5NA 1D7PM 2QQKA 1US2A 1JYWA 1OD3A 1DYOA 1SDDB 3F2ZA 2WYSA 3IIIA 1W8NA 4DUVA 2VTFA 4A44A 1PX4A 2J7MA 3CZJA 3K4DA 3I2IA 1SG3A 2J1SA 1NX9A 2E32A 4FI9A 4TTGA 1CZVA 2W1QA 1JU4A 2RVAA 1JZ2A 3EB7A 3I2JA 1UYYA 3E1F1 4DXTA 2YFZA 2EIEA 4CUAA 4E8CA 2VQTA 5JMOA 1K12A 1UYZA 3WF2A 1YQ2A 1PMJX 3NJXA 2VM9A 4M4PA 5JXGA 5JXHA 4MADA 4M4RA 4TXWA 2JD9A 3OGSA 1XNAA 4CU6A 2WAOA 3WNNA 3MUZ1 4MGQA 2W1WA 2VZRA 4CVUA 1EUTA 5C71A 2WN3A 3DYOA 1OF3A 3HNYM 4CU9A 5LA0A 2DDUA 2QQMA 2W9XA 3VDAA 4XUNA 2VZ3A 2X09A 3A7QA 1ULOA 3UESA 1T2XA 3T0DA 2PQSA 3P6BA 3OGVA 1PX3A 4QDSA 1HN1A 2VMCA 3I2HA 4JKLA 3IAQA 1JHJA 1K45A 1WCQA 1OF4A 4JKMA 4BK5A 3I2GA 2C4XA 2WN2A 1OT5A 3WNMA 1L7RA 3ACFA 3A21A 1W0NA 4CUCA 2C26A 2LS6A 3WSOA 3SKVA 3VD5A 3T0AA 3IDAA 2VZPA 3SEPA 4D0QA 4QB2A 3WEZA 2VCBA 2W1SA 5IFTA 1IQDC 2E33A 2HLEA 4XZUG 3FHAA 2B4KA 3K46A 2DCKA 4JKKA 1US3A 3HEIA 3I3DA 4MO3M 5LCWL 2BGPA 2JKXA 4OZOA 1O8SA 1MPXA 3I2FA 5DPNA 2WAAA 2VZOA 3NNGA 1UYXA 3CZUA 3WNOA 1PMHX 5IJRA 2Y6KA 3LE0A 4JHZA 4A45A 2QQJA 2XQXA 3ACHA 4PT6A 1BHGA 1JZ5A 3I3BA 4GWJA 2QQOA 3K4AA 4W50A 2QQLA 3T0BA 3MO4A 4P02B 2VZQA 2Y6HA 3T2OA 4QX3A 4W4ZA 1CIYA 3GXUA 3NJVA 3T2QA 1P8JA 1W9TA 3WF1A 5JXIA 2EICA 1JZ6A 3P1IA 4QB1A 5JXJA 2OKXA 1J83A 4KMQA 3NRUA 3I3EA 1JYNA 3THCA 2J1EA 4QPWA 4ET7A 4ZZ8A 3U37A 4CU7A 1UY3A 5B4XA 3LPGA 5I0DA 2W94A 4OUEA 3VD4A 1JU3A 1ULPA 4BDVB 2VZ1A 5DQ0A 3UETA 2XOMA 1O8PA 4MGSA 3ETPA 4A41A 5DMYA 4DXSA 3JXSA 3MUY1 3D3AA 3BGAA 2ZEWA 3OEBA 2E26A 4CUBA 2Y6JA 1GOGA 2YB7A 4ARYA 3PUHA 1JZ3A 1F4HA 3MBWA 3K4ZA 2KD7A 1JZ7A 3K77A 3WQBA 2BERA 4QX0A 1W9SA 5IFPA 1F4AA 2VMDA 3DYMA 1JI6A 2W87A 3WF0A 4XUOA 1UY2A 1UXXX 3VD7A 5A1AA 3A22A 2WO2A 1CZTA 4P5YA 4MOAA 5G05L 1WKYA 2JDAA 5CYYA 2Y6GA 2J1RA 4OYUA 2VCAA 3C8XA 1GU3A 4LKSA 2WZ8A 3CQOA 3DYPA 1OH4A 4ZXEA 2VZSA 2ORXA 2V5DA 4DEQA 2Y6LA 1J84A 2J1VA 1GQPA 1UMIA 4BXSV 2W3JA 5EJZB 4ZY9A 1GUIA 2L9LA 2V72A 2W5FA 4OMDA 1UZ0A 4IUGA 3HNBM 2JE8A 3CDZB 4GZ9A 1JYVA 3BN6A 4PQQA 4XUQA 1K3IA 2QQNA 5J1XA 5IYYA 2VZVA 1DP0A 2WBKA 3MV11 2VQUA 4UAPA 2WQ8A 4YPJA 4OMCA 3UNPA 4AAXA 2VZTA 1GOHA 4P08A 4E8DA 3GM8A 3FL7A 3GGLA 2C9KA 3ECQA 3SKJE 2RJ2A 4UOJA 3HOBA 3WF4A 1XC6A 2Z4FA 3WNKA 4KWUA 2VR4A 3EYPA 1UY4A 5B4NA 1JYXA 2RV9A 5IHRA 2W91A 2WDBA 3HPNA 2QBXA 2Y64A 3C7FA 3C7OA 4JX0A 5HXMA 4BJ0A 3ZM8A 2ZXQA 2YFUA 4AG4A 1TVGA 3VDBA 1CZSA 1DLCA 3VD3A 1NAEA 3OEAA 4XURA 2VC9A 2R7EB 2WO3A 2YC4A 1K42A 1W99A 5DN2A 4P00B 2WZEA 2W95A 5EJ1B 2B9VA 1GOFA 1GNYA 3C7GA 4QX2A 1JZ4A 2XONA 3OB8A 3W5MA 3LEIA 1XPWA 2WUHA 2VMFA 2HYXA 3J7HA 4DXRA 1O59A 4A42A 2BBAA 4PF1A 2J1UA 5EIYB 4LQRA 3OGRA 4RYDA 2ZEYA 3MV01 3C7EA 2LW8A 3K75B 3LPFA 2YC2A 1UX7A 1L7QA 2ZEZA 3PUIA 3T08A 4LPLA 4BK4A 1JZ8A 3VD9A 2VMEA 2ZEXA 2ID4A 4A6OA 5LA2A 3A23A 2BZDA 4QDQA 2W1UA 2XHNA 1GMMA 5FUIA 2QQIA 2Y8KA 2X10A 1SHWB 3FHQA 4W8JA 4HG6B 3GDBA 1KGYA 4KI5M 1RYYA 3FN9A 3AC0A 1UY1A 1NKGA 1W9WA 2J1TA 1I5PA 2W46A 3T09A 5LA1A 1XNTA 4CU8A 4ARXA 4QX1A 5JUVA 2J22A 3CMGA 2CDOA 2CDPA 5G04L 4D8MA 4XVHA 2DCJA 3C7HA 3DECA 2VZUA 4LHSA 3CIHA 4GWIA 1CX1A 2VCCA 3WF3A 5C7GA 5HPOA 4A3ZA 3HJRA 2VL4A 3CKHA 3HN3A 1KEXA 5F7UA 2W47A 1UY0A 4ZZ5A 1R64A 1UMHA 4XUTA 2EIDA 1H6XA 1TG7A 3SEEA 4QAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEG A;  2ORZ A;  3HNM A;  4A4A A;  1W8O A;  1LNS A;  3ACI A;  3ABZ A;  3I97 A;  2J1A A;  4UI9 L;  3THD A;  2VJX A;  5C70 A;  3I2K A;  1EUU A;  2VO5 A;  3LQC A;  4DUX A;  4QDR A;  5JR2 A;  1H6Y A;  4DUW A;  4RN5 A;  2EIB A;  1UXZ A;  3NQH A;  4DEV A;  1UWW A;  2WAB A;  4L0P A;  2X05 A;  3VDC A;  2V4V A;  4QB6 A;  3IAP A;  1NUK A;  3WNP A;  4XUP A;  3IB3 A;  3T2P A;  2VOT A;  2W92 A;  4Z2A A;  3OG2 A;  2YG0 A;  2WO1 A;  3OBA A;  2BGO A;  3ACG A;  3LEK A;  3WNL A;  2E31 A;  5CZK A;  3W5N A;  1D7P M;  2QQK A;  1US2 A;  1JYW A;  1OD3 A;  1DYO A;  1SDD B;  3F2Z A;  2WYS A;  3III A;  1W8N A;  4DUV A;  2VTF A;  4A44 A;  1PX4 A;  2J7M A;  3CZJ A;  3K4D A;  3I2I A;  1SG3 A;  2J1S A;  1NX9 A;  2E32 A;  4FI9 A;  4TTG A;  1CZV A;  2W1Q A;  1JU4 A;  2RVA A;  1JZ2 A;  3EB7 A;  3I2J A;  1UYY A;  3E1F 1;  4DXT A;  2YFZ A;  2EIE A;  4CUA A;  4E8C A;  2VQT A;  5JMO A;  1K12 A;  1UYZ A;  3WF2 A;  1YQ2 A;  1PMJ X;  3NJX A;  2VM9 A;  4M4P A;  5JXG A;  5JXH A;  4MAD A;  4M4R A;  4TXW A;  2JD9 A;  3OGS A;  1XNA A;  4CU6 A;  2WAO A;  3WNN A;  3MUZ 1;  4MGQ A;  2W1W A;  2VZR A;  4CVU A;  1EUT A;  5C71 A;  2WN3 A;  3DYO A;  1OF3 A;  3HNY M;  4CU9 A;  5LA0 A;  2DDU A;  2QQM A;  2W9X A;  3VDA A;  4XUN A;  2VZ3 A;  2X09 A;  3A7Q A;  1ULO A;  3UES A;  1T2X A;  3T0D A;  2PQS A;  3P6B A;  3OGV A;  1PX3 A;  4QDS A;  1HN1 A;  2VMC A;  3I2H A;  4JKL A;  3IAQ A;  1JHJ A;  1K45 A;  1WCQ A;  1OF4 A;  4JKM A;  4BK5 A;  3I2G A;  2C4X A;  2WN2 A;  1OT5 A;  3WNM A;  1L7R A;  3ACF A;  3A21 A;  1W0N A;  4CUC A;  2C26 A;  2LS6 A;  3WSO A;  3SKV A;  3VD5 A;  3T0A A;  3IDA A;  2VZP A;  3SEP A;  4D0Q A;  4QB2 A;  3WEZ A;  2VCB A;  2W1S A;  5IFT A;  1IQD C;  2E33 A;  2HLE A;  4XZU G;  3FHA A;  2B4K A;  3K46 A;  2DCK A;  4JKK A;  1US3 A;  3HEI A;  3I3D A;  4MO3 M;  5LCW L;  2BGP A;  2JKX A;  4OZO A;  1O8S A;  1MPX A;  3I2F A;  5DPN A;  2WAA A;  2VZO A;  3NNG A;  1UYX A;  3CZU A;  3WNO A;  1PMH X;  5IJR A;  2Y6K A;  3LE0 A;  4JHZ A;  4A45 A;  2QQJ A;  2XQX A;  3ACH A;  4PT6 A;  1BHG A;  1JZ5 A;  3I3B A;  4GWJ A;  2QQO A;  3K4A A;  4W50 A;  2QQL A;  3T0B A;  3MO4 A;  4P02 B;  2VZQ A;  2Y6H A;  3T2O A;  4QX3 A;  4W4Z A;  1CIY A;  3GXU A;  3NJV A;  3T2Q A;  1P8J A;  1W9T A;  3WF1 A;  5JXI A;  2EIC A;  1JZ6 A;  3P1I A;  4QB1 A;  5JXJ A;  2OKX A;  1J83 A;  4KMQ A;  3NRU A;  3I3E A;  1JYN A;  3THC A;  2J1E A;  4QPW A;  4ET7 A;  4ZZ8 A;  3U37 A;  4CU7 A;  1UY3 A;  5B4X A;  3LPG A;  5I0D A;  2W94 A;  4OUE A;  3VD4 A;  1JU3 A;  1ULP A;  4BDV B;  2VZ1 A;  5DQ0 A;  3UET A;  2XOM A;  1O8P A;  4MGS A;  3ETP A;  4A41 A;  5DMY A;  4DXS A;  3JXS A;  3MUY 1;  3D3A A;  3BGA A;  2ZEW A;  3OEB A;  2E26 A;  4CUB A;  2Y6J A;  1GOG A;  2YB7 A;  4ARY A;  3PUH A;  1JZ3 A;  1F4H A;  3MBW A;  3K4Z A;  2KD7 A;  1JZ7 A;  3K77 A;  3WQB A;  2BER A;  4QX0 A;  1W9S A;  5IFP A;  1F4A A;  2VMD A;  3DYM A;  1JI6 A;  2W87 A;  3WF0 A;  4XUO A;  1UY2 A;  1UXX X;  3VD7 A;  5A1A A;  3A22 A;  2WO2 A;  1CZT A;  4P5Y A;  4MOA A;  5G05 L;  1WKY A;  2JDA A;  5CYY A;  2Y6G A;  2J1R A;  4OYU A;  2VCA A;  3C8X A;  1GU3 A;  4LKS A;  2WZ8 A;  3CQO A;  3DYP A;  1OH4 A;  4ZXE A;  2VZS A;  2ORX A;  2V5D A;  4DEQ A;  2Y6L A;  1J84 A;  2J1V A;  1GQP A;  1UMI A;  4BXS V;  2W3J A;  5EJZ B;  4ZY9 A;  1GUI A;  2L9L A;  2V72 A;  2W5F A;  4OMD A;  1UZ0 A;  4IUG A;  3HNB M;  2JE8 A;  3CDZ B;  4GZ9 A;  1JYV A;  3BN6 A;  4PQQ A;  4XUQ A;  1K3I A;  2QQN A;  5J1X A;  5IYY A;  2VZV A;  1DP0 A;  2WBK A;  3MV1 1;  2VQU A;  4UAP A;  2WQ8 A;  4YPJ A;  4OMC A;  3UNP A;  4AAX A;  2VZT A;  1GOH A;  4P08 A;  4E8D A;  3GM8 A;  3FL7 A;  3GGL A;  2C9K A;  3ECQ A;  3SKJ E;  2RJ2 A;  4UOJ A;  3HOB A;  3WF4 A;  1XC6 A;  2Z4F A;  3WNK A;  4KWU A;  2VR4 A;  3EYP A;  1UY4 A;  5B4N A;  1JYX A;  2RV9 A;  5IHR A;  2W91 A;  2WDB A;  3HPN A;  2QBX A;  2Y64 A;  3C7F A;  3C7O A;  4JX0 A;  5HXM A;  4BJ0 A;  3ZM8 A;  2ZXQ A;  2YFU A;  4AG4 A;  1TVG A;  3VDB A;  1CZS A;  1DLC A;  3VD3 A;  1NAE A;  3OEA A;  4XUR A;  2VC9 A;  2R7E B;  2WO3 A;  2YC4 A;  1K42 A;  1W99 A;  5DN2 A;  4P00 B;  2WZE A;  2W95 A;  5EJ1 B;  2B9V A;  1GOF A;  1GNY A;  3C7G A;  4QX2 A;  1JZ4 A;  2XON A;  3OB8 A;  3W5M A;  3LEI A;  1XPW A;  2WUH A;  2VMF A;  2HYX A;  3J7H A;  4DXR A;  1O59 A;  4A42 A;  2BBA A;  4PF1 A;  2J1U A;  5EIY B;  4LQR A;  3OGR A;  4RYD A;  2ZEY A;  3MV0 1;  3C7E A;  2LW8 A;  3K75 B;  3LPF A;  2YC2 A;  1UX7 A;  1L7Q A;  2ZEZ A;  3PUI A;  3T08 A;  4LPL A;  4BK4 A;  1JZ8 A;  3VD9 A;  2VME A;  2ZEX A;  2ID4 A;  4A6O A;  5LA2 A;  3A23 A;  2BZD A;  4QDQ A;  2W1U A;  2XHN A;  1GMM A;  5FUI A;  2QQI A;  2Y8K A;  2X10 A;  1SHW B;  3FHQ A;  4W8J A;  4HG6 B;  3GDB A;  1KGY A;  4KI5 M;  1RYY A;  3FN9 A;  3AC0 A;  1UY1 A;  1NKG A;  1W9W A;  2J1T A;  1I5P A;  2W46 A;  3T09 A;  5LA1 A;  1XNT A;  4CU8 A;  4ARX A;  4QX1 A;  5JUV A;  2J22 A;  3CMG A;  2CDO A;  2CDP A;  5G04 L;  4D8M A;  4XVH A;  2DCJ A;  3C7H A;  3DEC A;  2VZU A;  4LHS A;  3CIH A;  4GWI A;  1CX1 A;  2VCC A;  3WF3 A;  5C7G A;  5HPO A;  4A3Z A;  3HJR A;  2VL4 A;  3CKH A;  3HN3 A;  1KEX A;  5F7U A;  2W47 A;  1UY0 A;  4ZZ5 A;  1R64 A;  1UMH A;  4XUT A;  2EID A;  1H6X A;  1TG7 A;  3SEE A;  4QAW A; 
#chains in the Genus database with same CATH topology
 3ZYJ B;  3LEG A;  2ORZ A;  5FQ0 A;  1OLM A;  1QNY A;  1W8O A;  2XJV A;  3N9P A;  4IGQ A;  5F37 A;  2RS5 3;  1ZBA 3;  4FPH A;  4U2A A;  3THT A;  3ABZ A;  1ZM1 A;  1C5I A;  1SLI A;  2WNO A;  4L2N A;  2J1A A;  1UIJ A;  4HL0 A;  4UI9 L;  5A3O A;  4Q4X 1;  3ZPO A;  3I2K A;  2JE9 A;  3CL1 A;  3DKQ A;  1OSG A;  1ND2 C;  3L2Y A;  3H3L A;  1UNB A;  4DUX A;  5JR2 A;  5I91 A;  3VBF A;  4C0H A;  4U36 A;  4RN5 A;  2IFW A;  4AL9 A;  1RUF 2;  1RB8 G;  5FZH A;  2EIB A;  1PM7 A;  4AAP A;  2RDQ A;  2WAB A;  1RHI 1;  4L0P A;  4UYB A;  2V4V A;  4QB6 A;  2A1X A;  1X33 A;  3OYW B;  1LHU A;  4IES A;  1KS4 A;  3ZXE A;  4EN9 B;  2VTX A;  2W92 A;  3IN9 A;  4FXK B;  1UU6 A;  4CCN A;  4YWA A;  3LEM A;  3ITQ A;  3NL1 A;  1YC6 1;  3OG2 A;  3SC7 X;  3RWK X;  2V09 A;  3NV3 A;  3OBA A;  2D3S A;  2BGO A;  2ZA9 A;  4Y4R A;  5FXZ A;  4COV A;  3KMH A;  3C2U A;  5I0R A;  3ZN6 A;  1RUJ 3;  2PLV 2;  3KF5 A;  1UZY A;  1EAH 3;  1US2 A;  2P34 A;  4Y1U A;  3MIF A;  1OD3 A;  1GKB A;  1VBA 2;  3VZM A;  1DGW A;  2A7A A;  2IWG B;  5FZ9 A;  1FMD 3;  2IXL A;  1V6K A;  4HT1 T;  3LA3 A;  5ACA 3;  2WNV A;  3III A;  4LA3 A;  4A44 A;  4CDX C;  2NQY A;  3OBZ A;  1H9W A;  2VMG A;  1AR6 2;  5C4W B;  4EWA A;  4YZ1 A;  2ERF A;  4FI9 A;  2ZKL A;  5JZG C;  1FOD 1;  4LIT A;  4TTG A;  2XWB B;  2P37 A;  1J1L A;  1DZT A;  3FHI B;  1EY2 A;  2DCZ A;  3G6J B;  2NN8 A;  3ZLI A;  4P9L A;  5BYN A;  3I2J A;  3E1F 1;  3VDD A;  5APA A;  4DXT A;  1PIV 3;  4CUA A;  1POV 3;  5JMO A;  2PEL A;  4IER A;  4AR2 A;  1K12 A;  3AXD A;  5LK5 A;  1PK6 C;  3WF2 A;  4IV3 A;  5DAW A;  4QQL A;  2GC2 A;  3O1O A;  5FR3 A;  4M4P A;  1VAL A;  3FMG A;  3LA2 A;  5JXG A;  3M3O A;  1R09 2;  4M4R A;  4CP1 A;  4Q4W 1;  5EFU A;  4QX7 A;  1C8M 3;  3OGS A;  2MEV 1;  5IWF A;  1W2A X;  4N53 B;  5EQU A;  2WAO A;  1LGN A;  1S0I A;  4RL7 A;  5FYV A;  3MUZ 1;  2W1W A;  4Q4V 1;  2JG9 A;  4IEQ A;  2ATF A;  5C71 A;  1SLC A;  4TZD A;  1G9B A;  3T4H B;  3FC0 A;  1CR7 A;  1CJP A;  1MZ5 A;  3OBR A;  2EVX A;  3E5Q A;  2OPW A;  4UFH A;  3TNQ A;  2VVE A;  3PIG A;  2C24 A;  4YW4 A;  1G9D A;  5FZL A;  2AEZ A;  1FAT A;  1ZA4 A;  2E7T A;  2ILM A;  3J8F 2;  5FMB A;  1ZRD A;  4XTP A;  2NYY A;  1OQE A;  1E57 A;  2VZ3 A;  4XF0 A;  2HH9 A;  1CVN A;  4AE2 A;  2TBV A;  1QEX A;  2JB8 A;  1HQL A;  4XF3 A;  4R4X A;  1MZF A;  3UES A;  1ACC A;  3DF0 A;  4HPK A;  2WFF 2;  1T2X A;  1WCU A;  3ZSM A;  1AR8 2;  1GV9 A;  3GNE A;  1CAV B;  3JB8 A;  4LUM A;  5IVY A;  3WCR A;  2ZMK A;  1V9U 1;  1W6O A;  4EWD A;  1V6J A;  4EV0 A;  1D4M 2;  1UN1 A;  1NOV A;  3I2H A;  1QJU 3;  4JKL A;  4BWO A;  4CP9 A;  3DUI A;  4XQ4 A;  1JHJ A;  3AKP A;  1KS5 A;  5LRS A;  4IGP A;  4AI3 A;  1KDM A;  5HCB A;  3I2G A;  2ZGM A;  4HSJ A;  2WN2 A;  4IV1 B;  4O9G A;  4ZON A;  1E5H A;  4I09 A;  3VBS B;  5FYM A;  5FY5 A;  1BJQ A;  1MS5 A;  2OW4 A;  5A80 A;  2RR1 1;  3GJA A;  3T1M A;  4C90 A;  3A21 A;  4CEY A;  2X53 S;  1HRV 3;  1VB2 A;  3ETQ A;  2P4E A;  3ZSK A;  4CUC A;  1C28 A;  4ISR A;  3O1T A;  2JEN A;  1RVF 3;  2VZP A;  3SEP A;  4D0Q A;  3RYR A;  3WEZ A;  1Y9G A;  2VCB A;  2A3X A;  1IQD C;  4FPY A;  4JRA A;  4S2H A;  2HLE A;  1A8D A;  4UF0 B;  4DQA A;  1GQG A;  1VR3 A;  4JC1 A;  4I30 A;  2Q8D A;  3RDI A;  1LHO A;  3K46 A;  4KG0 A;  2DCK A;  4AED A;  5IVB A;  1IPS A;  2YXS A;  4OI2 A;  1LOA A;  4IV3 C;  4AHW A;  5EPA A;  2B39 A;  1AVB A;  5DAV A;  4XZP A;  3WDX A;  2RMU 1;  3HEI A;  3HBZ A;  5FXV A;  4FPE A;  4XOG A;  3ZN4 A;  5LCW L;  5FPX A;  4FPK A;  4RS5 B;  1ODN A;  2BGP A;  1EPW A;  2WA4 A;  3DXU A;  2D6M A;  4OUM A;  5FOJ B;  1XNB A;  3WP6 A;  2VCM A;  1LUL A;  1GWM A;  3BIW E;  2ZTN A;  2HWD 3;  2FMY A;  4QHO A;  1WD4 A;  5EYY A;  4LOS A;  1PNF A;  3J9S A;  2R07 2;  1YI9 A;  3LSD A;  2Y38 A;  4XIO A;  3LF7 A;  4NPL A;  1QJX 3;  5I0T A;  1IPJ A;  5D8A C;  5L7O A;  3LE0 A;  3RYP A;  2YPD A;  4IL7 A;  1GFF 2;  4R9A A;  1OQ1 A;  1QQP 3;  3D0S A;  2XQX A;  4X6Q B;  1FPN 2;  4XF1 A;  3DCQ A;  1REF A;  4XBQ A;  1RUG 3;  4QGN A;  3BVC A;  3I3B A;  1S0E A;  2GNB A;  3LCP A;  3LDB A;  4QX5 A;  1PGW 2;  1W6Q A;  3MO4 A;  1OPO A;  2A3Y A;  4P02 B;  4QXK A;  1BK0 A;  5H9S A;  2X5I C;  1GP4 A;  3CEW A;  3R4S A;  1G86 A;  4XFF A;  3VBO A;  4W4Z A;  3NVC A;  1RMU 3;  3FFQ A;  1GZT A;  3NJV A;  3T2Q A;  1YLL A;  1P8J A;  3WF1 A;  5JXI A;  1NQJ A;  5FYI A;  1JZ6 A;  1Q43 A;  2BNO A;  5FY8 A;  1YWK A;  2DBN A;  5F2S A;  4K20 A;  1OA2 A;  1MVE A;  2V4A A;  4EN6 B;  5E89 A;  1YIP A;  3AFK A;  2ZX0 A;  4JGY C;  3APB A;  3AZX A;  3PJQ A;  4M3C E;  1BK1 A;  3TEZ A;  1Z7S 1;  1OLR A;  2LAL A;  4ZZ8 A;  1AYN 2;  1LGB A;  3LA7 A;  4WZC A;  1RUD 2;  5GLW A;  4HKW A;  1UY3 A;  5B4X A;  1ZBE 2;  4Z82 A;  2OQ6 A;  2VAU A;  4GH4 C;  4LK6 A;  5FWE A;  4OUE A;  5I0D A;  2OA2 A;  2PHF A;  1X8M A;  4Y5Z 0;  2VZ1 A;  4KWK A;  1BYH A;  2RDS A;  4IND A;  4JGZ B;  1DQ5 A;  2R0F A;  3OF1 A;  4FOW A;  3CU7 A;  3ETP A;  2Q8C A;  2P2K A;  5DMY A;  4DXS A;  2XXZ A;  4OHZ A;  2HWF 1;  3JXS A;  3MUY 1;  1C5H A;  1R08 3;  1PGL 2;  3OBT A;  1LOC A;  1SCR A;  3B9C A;  3D3A A;  3S0M A;  1YJL A;  1RTV A;  2WLQ A;  3AVR A;  1MEC 3;  2WQZ C;  3O5S A;  1IQA A;  4YVW C;  5HCA A;  1PHM A;  1Q3E A;  3JZV A;  2B42 B;  4FOV A;  5A7W A;  3ZFE C;  3ZYR A;  1R1Z A;  4ARY A;  4ZKT B;  2HWC 2;  2WNU A;  3PUH A;  2PHL A;  3CJI A;  4CCC A;  4D94 A;  4CPB A;  1L7L A;  3POG A;  2KD7 A;  1V00 A;  2GH8 A;  2JD4 A;  4G4F A;  4L9B A;  4QD2 A;  3KVA A;  1PZ9 A;  5FZO A;  3WQB A;  5IFP A;  2VMD A;  4R52 A;  3NNL A;  3NWK A;  3WF0 A;  4H7M A;  3ZYF A;  1YHF A;  4FP2 A;  3WW2 A;  5CAZ A;  1XU2 A;  2YYO A;  2BOI A;  5IVF A;  1XND A;  1O3S A;  4P5Y A;  5GZC A;  5K0U B;  3POF A;  3M1H A;  4R9B A;  2Y6G A;  4W6X A;  1OA3 A;  4OYU A;  3WT3 A;  4DMI A;  5C9A A;  2VCA A;  2PLV 3;  4LKS A;  1QDC A;  2RDR A;  2FQP A;  4GA9 A;  1PVC 2;  4Y20 B;  3RRD A;  3USU A;  3CQO A;  3VGI A;  4XDO A;  2ZGU A;  1YXW A;  4ONU A;  4LBO A;  3MIE A;  3VV1 A;  3LOB A;  1EYB A;  1YCI A;  2D3P A;  3KV9 A;  3JQX A;  2ZGL A;  2NMN A;  3H42 B;  1UO9 A;  2RM2 2;  5JPN B;  5JVV A;  4FOY A;  2W3J A;  4ZY9 A;  3UGF A;  1GUI A;  4BQ5 A;  2FZ1 A;  1DYK A;  1UZ0 A;  3H1Y A;  2E9Q A;  4D3W A;  1WWY A;  2JE8 A;  3U0Z A;  3GZU C;  2BPA 2;  3BN6 A;  4PQQ A;  2FDI A;  1UZV A;  3NNJ A;  4YGE A;  5FY4 A;  1K3I A;  2PHR A;  3A4U A;  1NCQ A;  5FQ0 B;  3CBN A;  1LES A;  3ZDS A;  1TQ5 A;  4GAL A;  2VZV A;  4BE3 A;  1YFW A;  1IGO A;  5SV5 A;  1W6N A;  4PIX A;  1ZRC A;  1NLQ A;  3ILF A;  2VQU A;  4FFH A;  4UFL A;  2WQ8 A;  4YW7 A;  3RNS A;  3GBW A;  1RUC 1;  1S0B A;  2A71 A;  2XKP A;  3O1V A;  3E6B A;  4RHV 1;  3VBF B;  4LJH A;  2VZT A;  3UJQ A;  1KD7 A;  3HT1 A;  4X8N A;  4P08 A;  5FIX A;  3MIC A;  1GWK A;  3ECQ A;  1MZE A;  2R49 A;  4CXX A;  2XLG A;  4RQP A;  4UOJ A;  1RUE 1;  1XC6 A;  2Z4F A;  2P3I A;  5AC9 2;  1N3P A;  2VR4 A;  1NXM A;  4M3C F;  4B1M A;  2IVI B;  3EYP A;  4LE3 A;  1ND3 A;  3ZPY A;  1H1I A;  1OXC A;  2QFE A;  1O5U A;  2XHK A;  1VBD 2;  3CJI C;  3ZN6 B;  3BOP A;  1LOD A;  3S6P A;  1PVX A;  4QU2 A;  3VZK A;  4R8H A;  3VKN A;  2CSG A;  3SCF A;  1ASJ 2;  1QJY 3;  2JX9 A;  1JTZ X;  5JR7 B;  4JX0 A;  1LHV A;  1BMV 2;  2HJI A;  1VBE 1;  4BB3 A;  2WNV B;  4DO0 A;  1FX5 A;  3HMY A;  4YZ3 A;  2YUE A;  4AG4 A;  1F9K A;  1LR5 A;  1XE7 A;  3HBK A;  3VD3 A;  3RZH A;  2FD8 A;  4KU7 A;  2R7E B;  2WO3 A;  2YC4 A;  3TRS B;  3PVO A;  5A3T A;  5L19 A;  1W99 A;  1D4M 3;  4P00 B;  2WZE A;  2SBA A;  2Y33 A;  4UBH A;  3VBU C;  3ZDV A;  1BCX A;  1C1L A;  3K3N A;  2HBU A;  4KWJ A;  3WLU A;  4CZS A;  3NO8 A;  3PDQ A;  5KR7 A;  3W5M A;  1WLD A;  4WM7 A;  4XJU A;  5FZC A;  2W39 A;  5LB6 A;  3VBH C;  2KR2 A;  1LB2 A;  1ZBA 2;  2QNK A;  2BBV A;  4JHT A;  1O59 A;  3ZSE A;  1DIW A;  2NP0 A;  1ALY A;  2BBA A;  4PF1 A;  4E4S A;  2ET1 A;  1UD1 A;  4LHL A;  3ZFG C;  2W52 A;  1NY7 2;  3O0W A;  3VHN A;  3MPB A;  4RYD A;  2D6N A;  1NZI A;  1W39 A;  3LPF A;  2YC2 A;  1EV1 1;  4MGY E;  4N8M A;  3ZXA C;  5JPM B;  4IEU A;  1LU2 A;  1TME 1;  4MGT A;  1WBF A;  1MQT C;  2GAL A;  2RJL A;  3IIA A;  3P5B A;  3T08 A;  3UL2 A;  4K40 A;  4AI0 A;  2OQ7 A;  3N4M A;  5LZ6 A;  1LED A;  5IAT A;  2TUN A;  3MIB A;  3HD8 B;  1OKO A;  5FK7 A;  3VD9 A;  3LWC A;  2ZEX A;  4KL1 A;  5JMC A;  3O1S A;  2ZGQ A;  3AYE A;  4A6O A;  1W3V A;  4QDQ A;  5T5P A;  3UV9 A;  4JDN A;  3O0V A;  4XDQ A;  2A3W A;  2Y8K A;  4A7K A;  3HVD A;  2X10 A;  4ZU7 A;  3ZXF A;  3FHQ A;  2XR4 A;  1PO1 1;  2XJP A;  4W8J A;  3GDB A;  1KGY A;  3KT7 A;  1VPH A;  2Y0O A;  3AZW A;  4HPK B;  3Q8A A;  3FN9 A;  5IVC A;  5ACA 2;  3PVB B;  1DQ0 A;  5FV3 A;  1NKG A;  4K7J A;  4K3U A;  1OUR A;  1UZW A;  2RE9 A;  3RZL A;  1IS4 A;  1XNT A;  3ALQ A;  3BCW A;  4ARX A;  4CP9 B;  4NO4 A;  4CU8 A;  5C5U A;  5D1I A;  3SNM A;  1RXG A;  2J22 A;  3CMG A;  1U0A A;  1E5S A;  2WC2 A;  2C1F A;  4CDU B;  2WZR 2;  5JCT A;  4D8M A;  2DCJ A;  3GZA A;  1IPK A;  3C7H A;  3I49 A;  4OI0 A;  3DEC A;  5FCC A;  4XAC A;  1PIV 2;  2VU9 A;  1N47 A;  4CEY B;  1J59 A;  1ST8 A;  2Q0A A;  5C3P A;  2KM2 A;  3AZY A;  1X50 A;  4QPY A;  3KCY A;  4NR1 A;  3UKN A;  3M3Q A;  4PDW A;  4F3J A;  3I8T A;  4HVQ A;  5HPO A;  4YM0 A;  1Q8P A;  5A1L A;  3W20 A;  2BW8 A;  1S55 A;  2VL4 A;  4YVS A;  3TEW A;  2FCU A;  5F7U A;  3WDU A;  3RZM A;  3M3C A;  3FLP A;  4J6G A;  4AED B;  3OUH A;  4C8D A;  2YV8 A;  1R64 A;  3VZL A;  3GCX A;  1H6X A;  4UXA A;  1AYN 3;  1AXK A;  1RUD 3;  2R06 1;  2WNE A;  5A70 A;  2CTV A;  1D0G A;  4Q0P A;  3PIJ A;  4UFI A;  5FZF A;  3FFZ A;  4ZPI A;  1H8T A;  4XXP A;  5D21 A;  1OBN A;  3LFM A;  5F3E A;  3ZR5 A;  2FDF A;  4FOQ A;  4D7T A;  5I8Y A;  2WZP P;  3AMQ A;  3WUD A;  2WO7 A;  3QLQ A;  1V6N A;  2ETE A;  2ZPX A;  4I0B A;  1H6Y A;  1KIT A;  2RDN A;  3MEP A;  4WVZ A;  4V1P A;  4D6R A;  5A6Y A;  4FO9 A;  1YEW A;  5F3I A;  1UQX A;  3E5U A;  5L7O B;  1LEM A;  4EE2 A;  1Y7B A;  4CCL A;  2GP3 A;  3NQH A;  4DEV A;  1E5R A;  3TB0 A;  3VDC A;  4UFM A;  1NUK A;  2HWC 3;  2A6X A;  4Z2A A;  1E5I A;  5CIS A;  3MFC A;  1V6L A;  4B29 A;  5LBF A;  1LJ7 A;  1O3R A;  2WO1 A;  1SFY A;  1J3P A;  1W6Q B;  1UIK A;  2E31 A;  4NMI A;  5CZK A;  3WNL A;  3AL5 A;  2HBT A;  3SXW A;  3OPZ A;  5FLH A;  1D7P M;  2EIG A;  2QQK A;  3INA A;  2BFU L;  2I74 A;  3KGL A;  3VBO B;  5BNO C;  1DYO A;  1BBT 1;  1SDD B;  2CHH A;  2QQV A;  2XL9 A;  1MVQ A;  2DUP A;  3MF6 A;  4IEO A;  1KJR A;  3F2Z A;  4WM8 A;  5HCH A;  3HWJ A;  3FWE A;  1W9F A;  4RR3 A;  1NA1 C;  2Q1F A;  3AXE A;  1B09 A;  1W8N A;  1J3R A;  2XKO A;  2XB6 C;  3PUS A;  4XJZ A;  3ZXG A;  4CCJ A;  1HRV 2;  1PX4 A;  3CZJ A;  3BKZ A;  2VVD A;  2GC0 A;  4MLO A;  2OYZ A;  4AEM A;  2GDF A;  3ZXK A;  4BA6 A;  1Q8V A;  2BGC A;  4RFT 0;  2OII A;  5KXD A;  5BXX A;  1JU4 A;  4MGZ E;  4NRQ A;  4QQO A;  4EZ4 A;  4AFA A;  1JZ2 A;  4P9X A;  3R4D B;  3AZV A;  2YHJ A;  3WG2 A;  3JD7 1;  4XMI A;  4CDW B;  3ST7 A;  3PUA A;  2MNG A;  4ZS3 A;  1YFX A;  1R1A 3;  2EIE A;  2YFZ A;  4GB3 1;  3H50 A;  1J3Q A;  1AR9 2;  2AH2 A;  2C6S A;  2VQT A;  2W0X A;  1S0G A;  2JIC A;  4FBF A;  2UY9 A;  4D6S A;  1YQ2 A;  3JBG 1;  3P3N A;  4XAE A;  4COZ A;  1ND2 A;  4FPC A;  1OMI A;  2G19 A;  2PQQ A;  2ZOE B;  2GZW A;  3WQ7 A;  2MPF A;  3OUJ A;  5JXH A;  4MAD A;  4TXW A;  4Z07 A;  3AJZ A;  4CCM A;  1AYM 2;  4LBK A;  4CU6 A;  5A7W B;  1OUS A;  2WNU B;  1BZW A;  2VZR A;  3AP7 A;  4LO7 A;  5CKQ A;  3MGU A;  2UU8 A;  5JSP A;  2A6V A;  2WQ4 A;  4JQR A;  3M3I A;  4QT6 A;  5AVP A;  1IG0 A;  5C33 A;  2WN3 A;  4NN0 A;  1HRI 2;  5FZO B;  3KT4 A;  5A33 A;  2Q30 A;  4HFS A;  5EZW A;  1PGS A;  4K8R B;  1LOE A;  1VRB A;  2ZGS A;  3C3V A;  5FYZ A;  3LDK A;  4YZ4 A;  1DGR N;  1AXZ A;  5J37 A;  5JI7 A;  4TLF A;  3BU7 A;  5F32 A;  1I9R A;  1UMZ A;  5C3O A;  4LO8 A;  2ZMN A;  4AWD A;  3KZ4 C;  5C9A B;  4XUN A;  2H6C A;  5KXE A;  1CGP A;  5H9P A;  4K21 A;  2ZS6 B;  5AFE A;  3A7Q A;  4QGL A;  4CDX A;  5TSW A;  2QUO A;  1ENX A;  4Q4Y 1;  5CIR A;  1XE0 A;  1RUI 1;  1ASJ 3;  4LUK A;  1F5F A;  3QAC A;  4NII A;  5JZG A;  3UK9 A;  5F1R A;  5FYH A;  4Q4X 2;  3P6B A;  3OGV A;  1PX3 A;  4GMP 3;  3TWI A;  5CFC C;  5IW0 A;  5JIA A;  5FUN A;  4CCE A;  4EYU A;  2VH9 A;  4ITC A;  4Q1R A;  5JOX A;  2QQP A;  5FZ7 A;  5JIU A;  5A1F A;  4UW5 A;  4Y3O A;  1C3H A;  4KH9 A;  3BOW A;  1WCQ A;  1OF4 A;  4YM2 A;  3OPT A;  5GLZ A;  3GBG A;  3ORJ A;  1RHI 2;  1W8U A;  1OT5 A;  1PK6 A;  4LMF A;  4E2G A;  3MLK A;  2BUK A;  1NCQ B;  1C8N A;  1ZZ9 A;  3DGT A;  1S2K A;  2CAV A;  1W04 A;  1UU4 A;  1W0N A;  2RS1 1;  2CU5 A;  2LS6 A;  3WSO A;  3SKV A;  3VD5 A;  3FBM A;  2FDG A;  3G7D A;  1LTE A;  1ZZ8 A;  4X6R B;  3BTX A;  2R1D A;  5K7P A;  3AMP A;  4LIV A;  2YGM A;  4WVM A;  3VLB B;  1R08 2;  5BNP B;  3FHA A;  1SMV A;  3R0R A;  2B4K A;  3U4S A;  1MEC 2;  1OUX A;  4QKD A;  5F5I A;  1ZRE A;  2PN5 A;  4IE7 A;  2OX0 A;  2JJ6 A;  3TOJ A;  3I3D A;  1NCR A;  2HWB 3;  3BPS A;  5L9B A;  3ZO0 B;  4M0H A;  4FSJ A;  2O8O A;  3AKS A;  1O8S A;  1UKG A;  4IE0 A;  5EJ3 A;  4CP2 A;  1ND3 B;  2OUH A;  1FOD 2;  2ZGT A;  2QVS B;  3T4V A;  5DPN A;  2WAA A;  5LBB A;  1VAK A;  2VZO A;  1UYX A;  4GIQ A;  3R4U A;  2YGL A;  2XLF A;  3D0J A;  1HJF A;  4O61 A;  2CL2 A;  3WNO A;  3ILN A;  4DZG A;  1PMH X;  3LFI A;  5IJR A;  1X9T A;  3RZJ A;  1JUI A;  1W2U A;  3O12 A;  2HWE 1;  1EPZ A;  1FT9 A;  1WGP A;  4XEZ A;  4AGR A;  4ES8 A;  1MS3 A;  3ACH A;  2UYA A;  2VQ0 A;  4PT6 A;  5FY7 A;  5GZF A;  3U14 A;  5ABJ C;  1BHG A;  3KCC A;  5DG2 A;  2QQO A;  2AC1 A;  4W50 A;  5LAS A;  3AP5 A;  3MF9 A;  2GN3 A;  5DDJ 1;  1RUH 1;  4HZF A;  5HBA A;  1CPN A;  2JDZ A;  3GHN A;  2VXJ A;  3O1U A;  4I0W B;  5IUQ A;  2BRT A;  4X8P A;  3ZFF C;  4Q0V A;  3P3P A;  4DRR A;  2WZR 3;  4C91 A;  2JG8 C;  1H9P A;  4HXC A;  1TNR A;  4XFC A;  2B5H A;  2G9G A;  1W9T A;  2D6K A;  4WM7 B;  2ES3 A;  2EXI A;  5C3S A;  4IE6 A;  3T3Y A;  5J48 A;  3HQX A;  5JXJ A;  1Y4W A;  2GU9 A;  1NXD 1;  1C57 A;  2UUR A;  2A6W A;  3NRU A;  1JYN A;  5FYC A;  4G3Y C;  3THC A;  3AJY A;  4QPW A;  4QXC A;  2QKD A;  1K5J A;  5KHK A;  3NKT A;  5A3W A;  4CU7 A;  1AR7 1;  1HB2 A;  2FCV A;  5SV8 A;  1MS1 A;  1S0D A;  4LIU A;  4QPG B;  1RUF 1;  4G9S B;  4ATF A;  4EN7 B;  4NID A;  3V0B A;  1YFY A;  3N36 A;  4LKD A;  1B35 A;  1JU3 A;  4Z1V A;  4Y26 A;  3VD4 A;  2A73 B;  1V9U 2;  3K2O A;  1RIN A;  1UPI A;  3WHU A;  2I45 A;  4E4D X;  2XOM A;  1AJK A;  4K1Z A;  1O8P A;  4A41 A;  5A3N A;  3AK0 A;  5I93 A;  1JOB A;  5FAX A;  3NV4 A;  4R4Z A;  1QKQ A;  5D8A A;  5HV0 A;  1NCR C;  3ILR A;  1ZRF A;  2E26 A;  2MHF A;  4TN7 A;  1VBA 1;  1AL2 1;  5FZI A;  1QHD A;  4OVE A;  1GOG A;  5FYS A;  4XIK A;  4LHN A;  1POQ A;  4N43 C;  1ZVF A;  4XQD A;  1MR5 A;  1QJY 2;  4XC9 A;  1JZ3 A;  5HV4 A;  1K5M B;  1SEF A;  5K8S A;  2K46 A;  2H6B A;  2AYH A;  2YZ4 A;  1AR6 1;  2D3R A;  2AR6 A;  3AX4 A;  4BM8 A;  1F4A A;  3KGZ A;  4Q0S A;  1W6P B;  2X5I A;  1GZC A;  3LAG A;  3V56 A;  1UY2 A;  1RC6 A;  4CPB D;  1H8V A;  4W6W A;  3MW2 A;  3N35 A;  2ZHL A;  5CYY A;  1DQ4 A;  2F6B A;  2RMU 2;  4OHW A;  3KHC A;  2R04 3;  2YDE A;  4QHB A;  1FXZ A;  1GU3 A;  4YFZ A;  3RSJ A;  4AZZ A;  5FO7 B;  5JI9 A;  2D5F A;  3DYP A;  2RJK A;  3SQO A;  5C6C A;  3PJY A;  1LU1 A;  4ZXE A;  3BU0 A;  4L92 A;  2YU2 A;  1NE4 A;  3AFG A;  2EXH A;  2RG4 A;  4DEQ A;  5JSO A;  2V5Y A;  2Y6L A;  2J1V A;  4JGY A;  4PDW B;  5FZ8 A;  1VRH 3;  3JCI A;  3H8O A;  3TYJ A;  1YFU A;  2P3K A;  2L9L A;  4BIF A;  1R09 1;  2ZAC A;  4OMD A;  1X36 A;  4XFI A;  4YVS B;  1H30 A;  4OLL A;  4J25 A;  1OFN A;  2F4L A;  1SBD A;  2OZ6 A;  3HNB M;  4GH4 A;  2C0Z A;  5FP7 A;  1JYV A;  5DG1 A;  2AGS A;  1RUO A;  4A6S A;  4CEW C;  3QD6 A;  5E88 A;  3M3E A;  1W2O A;  4LUL A;  1ZX5 A;  1NQD A;  2DU0 A;  1TMF 1;  4BXF A;  4CDQ B;  3AKT A;  3LDR A;  5FOB B;  1UOG A;  5J1X A;  1CIW A;  2D6P A;  2PMW B;  3U75 A;  2XBO 1;  3RMY A;  1DP0 A;  1WW4 A;  5EYX A;  5IK4 A;  3RG0 A;  4Q8L A;  1H8T B;  1KDK A;  1UOF A;  1T6B X;  4W65 A;  1AR9 3;  3MV1 1;  1WMX A;  2ZAH A;  5F5C A;  4BIO A;  1YNA A;  3D4K A;  4OMC A;  4YVW A;  3MI8 A;  2GMM A;  2W68 A;  3J8F 1;  2CGP A;  3BTA A;  5GLU A;  1B35 C;  3ZFE A;  4AAX A;  4DB5 A;  4CSW A;  5CFD C;  4CCD A;  3QH7 A;  5DUU A;  3PUQ A;  4AW7 A;  2EA7 A;  1HXS 3;  3FL7 A;  2C9K A;  3VZN A;  4NHK A;  1FV2 A;  3RI9 A;  1VJ2 A;  2WFF 1;  1AYM 3;  1AR8 1;  1DBN A;  1F15 A;  3HOB A;  3WF4 A;  3H7Y A;  3ZXD A;  3DPR A;  1QWR A;  3QCW A;  1VMH A;  2WWS A;  2OZJ A;  4N7I A;  3GAL A;  3ZYG A;  1O7F A;  5H9Q A;  3B9I A;  1VB4 A;  5KHH A;  5KBF A;  1HRI 3;  3R05 A;  1OC1 A;  1UOJ A;  2CNA A;  5FPL A;  3WG4 A;  1GYK A;  4NUB A;  1SPP A;  2JEC A;  2OS2 A;  3EXU A;  3SLI A;  4P9W A;  5C3R A;  1WLT A;  1H4G A;  4ZU4 A;  4XCA A;  3N9L A;  2JDM A;  4WM8 B;  2BJS A;  2BYV E;  2RS3 1;  3WDV A;  3VBR B;  2F17 A;  2ZXQ A;  4RR3 B;  2VUC A;  2XQR A;  5FZG A;  3MZH A;  2NLR A;  1W9Y A;  2WKK A;  2ZX1 A;  1S0C A;  4D7Y A;  2Q8E A;  4ORF A;  1XSQ A;  4M0N A;  2VC9 A;  3OD0 A;  1QOT A;  4LBQ A;  4Q4X 3;  1K42 A;  1W6M A;  2P5B A;  2JB4 A;  2LUW A;  2W95 A;  1PO2 1;  2CV6 A;  2ZGR A;  2ZGK A;  1W2T A;  3A0K A;  3UYJ A;  2B9V A;  1YIF A;  5DUW A;  4FQZ A;  1U12 A;  1JYT A;  1HKD A;  4QX2 A;  1JZ4 A;  2WL1 A;  3WVJ A;  4HOO A;  4DNY A;  4WZF A;  1LHW A;  1RHI 3;  1XPW A;  2BDR A;  1OHF A;  3VKM A;  4NOT A;  1ND2 B;  3J7H A;  4UW6 A;  3EJK A;  1H4H A;  4DXR A;  4UWD A;  3PMS A;  2GMP A;  1UF2 C;  3L9J T;  3ELN A;  4OHV A;  4JTO A;  3J26 N;  2R07 1;  4LQR A;  5DUV A;  1JH5 A;  5DAB A;  1XB9 A;  3BPZ A;  3C7E A;  2LW8 A;  1ZYB A;  1W2N A;  5A7O A;  2WS9 1;  4CXY A;  3K3O A;  4NVP A;  3SHR A;  1FPN 1;  5FJK A;  4AGG A;  5L9V A;  2WRA A;  4WBB A;  2XJQ A;  3PU8 A;  3Q8C A;  4GUL A;  1JZ8 A;  3M4F A;  4HN0 A;  4AEK A;  4C1W A;  3V0A A;  4OZX A;  1DGR A;  1F8V A;  3THP A;  3IM0 A;  3B01 A;  3AP4 A;  2VME A;  2YPJ A;  3H1M A;  2QJV A;  1WCS A;  1CAX A;  2ID4 A;  1BVV A;  4MV2 A;  4MXW A;  4OI4 A;  4Q0U A;  1REE A;  3ZMN A;  5F3C A;  5I8T A;  3A23 A;  2BZD A;  1XQN A;  1FOD 3;  5A3L A;  4BQ4 A;  1GIC A;  3KCX A;  3SCG A;  1VBC 1;  4AVS A;  3DPR C;  5GM0 A;  3OY8 B;  4P9J A;  3WP3 A;  2P6C A;  2NM1 A;  2TNF A;  4P9G A;  4HG6 B;  4CDX B;  2FMD A;  2VEC A;  4E4Z A;  3AC0 A;  1G9A A;  3S30 A;  4XPV A;  4FPO B;  3UKV A;  5JZG B;  1DZQ A;  4YW5 A;  5GZD A;  5C8C B;  1GR3 A;  1RUC 2;  3GJB A;  3WQ1 A;  5IAX A;  1HV0 A;  4RHV 2;  3T09 A;  4QX1 A;  3GZT B;  1WLW A;  3MLL A;  2ARX A;  5BNN B;  3VBU A;  2ZGO A;  3ZIX A;  3AVS A;  4LT5 A;  4XIL A;  1ZBE 1;  4Q4W 3;  2WR9 A;  2MEV 3;  4XVH A;  5FUP A;  1NE6 A;  5KWR A;  3SH3 A;  1MS9 A;  1PK6 B;  4LHS A;  1RIR A;  3VBH A;  3VKF C;  3CIH A;  4Q4V 3;  5A6Q A;  2GP5 A;  1R1A 2;  2Q8O A;  4AHZ A;  2VOK A;  2CWS A;  2VCC A;  2P6H A;  4CA9 A;  4Q2F A;  4XJ9 A;  2BVV A;  3ZFG A;  3T1L A;  5BV6 A;  1O6U A;  1SLL A;  2AZ5 A;  1CAW A;  1OOP C;  3POB A;  4XJ8 A;  1PGL 1;  5D2A A;  1WCK A;  5AFB A;  1Y43 B;  4XCB A;  5E16 A;  4WVM B;  2JEM A;  4IEP A;  3HJR A;  2JDU A;  1U5I A;  3CKH A;  1KEX A;  3NAP A;  4ZZ5 A;  4AYU A;  5FZ6 A;  3ZXJ A;  4FAG A;  4YM3 A;  5A6Z A;  5JDB A;  2WFP A;  1MQT A;  1ENQ A;  2LTN A;  1OLM E;  1TG7 A;  3H1W A;  1ZNP A;  2VNR A;  2UWB A;  1AX1 A;  3HNM A;  4FPL A;  4A4A A;  3U07 A;  5IK8 A;  4CCK A;  3KSC A;  3IDB B;  2BFU S;  1QF3 A;  5J98 B;  3NW4 A;  1LNS A;  1GZ9 A;  1PZ7 A;  1V9U 3;  3ACI A;  1GZW A;  3GYD A;  3I97 A;  3PLQ A;  4QKB A;  4XFH A;  3ROU A;  2K0G A;  3THD A;  4BCU A;  5C70 A;  5F8P A;  4BME A;  1EUU A;  3IT8 A;  2VO5 A;  3LKJ A;  3RPQ A;  4QDR A;  2B9U A;  4J1X A;  4PCR A;  3N7M A;  4DUW A;  3I7D A;  1PVC 1;  1WCD J;  4GWM A;  4DIQ A;  2XH6 A;  3LIG A;  2IXC A;  4PBP A;  1UWW A;  2RM2 1;  3QBQ A;  2X05 A;  2RR1 3;  3IAP A;  5T50 A;  3WNP A;  1YQ6 A;  3H9A A;  3IB3 A;  2YG0 A;  5FP3 A;  1WUV A;  5FPA A;  1KFX L;  4QXH A;  3LB9 A;  5FDB A;  4P5H A;  3HIF A;  4QHZ A;  1O4T A;  5T5L A;  3W5N A;  4QPI C;  4FQ4 A;  4CRQ A;  2BVB A;  1YQC A;  1TME 2;  1PMI A;  1MZ6 A;  2D93 A;  3OGJ A;  5FO9 B;  4FPF A;  5GZG A;  1XYP A;  3OYW A;  2WYS A;  4DXZ A;  3FZ3 A;  2RMU 3;  1TEI A;  2PHT A;  3VDD B;  4DUV A;  5F6L B;  4NHX A;  2J7M A;  2DCY A;  1FAY A;  2NPI A;  3K4D A;  3HT2 A;  1LOF C;  4CYD A;  4YSF A;  1SG3 A;  3I2I A;  2J1S A;  5A3U A;  3FX3 A;  2P1B A;  1NX9 A;  5F9T A;  4SBV A;  4MG2 A;  3RZK A;  4IV3 B;  4BYY A;  4BZ4 A;  1BEV 1;  2C5D A;  3IBM A;  5F6K A;  3W58 A;  4B4P A;  4PBO A;  5BUV A;  2W1Q A;  4NE9 A;  1O4Y A;  2RVA A;  3AP9 A;  3EB7 A;  2FDH A;  1XRU A;  4JCK A;  3SIT A;  3V0B B;  2BNN A;  3VKO A;  5CVR A;  5AC9 1;  2VQA A;  4E8C A;  2HWB 2;  5DXD A;  4DIN B;  2ZML A;  1UYZ A;  2JG9 B;  4RGG A;  1PMJ X;  5LK7 B;  3NAP C;  3TN9 1;  1RIT A;  2VM9 A;  1VBD 1;  3E6D A;  4AK3 A;  3KQR A;  5D8A B;  4N7U A;  3UGH A;  1ULF A;  4UT5 A;  4AOC A;  4GD4 A;  2JD9 A;  5E6H A;  2EAA A;  4AFD A;  1COV 1;  1IHM A;  3WIN E;  3WNN A;  1BMV 1;  4QM8 A;  1WW5 A;  4CVU A;  5FY9 A;  4PI0 A;  5FLI A;  2GAU A;  1CN1 A;  3KLS A;  1ZZC A;  3DYO A;  1OF3 A;  3MLJ A;  4NAM A;  4Q8K A;  3BIE A;  1T6G C;  4N90 A;  3ZYB A;  1NLR A;  1JOP A;  1NYW A;  1Q8Q A;  4YZ2 A;  3MHZ A;  1RJ7 A;  1W06 A;  5F2W A;  2IUW A;  2B8M A;  2WA3 A;  2X5I B;  1VBB 1;  5LA0 A;  4MHR A;  2ZBJ A;  1QH6 A;  4L97 A;  2DDU A;  5T3N A;  5BNO A;  1W6O B;  2QQM A;  4BQ3 A;  4KU8 A;  4YYO A;  1SLB A;  5F5A A;  1VAV A;  4Y33 A;  1Z7S 3;  3ZYP A;  1W3X A;  1NA1 A;  2R06 2;  2VNV A;  1S0F A;  5F39 A;  5I8S A;  3WUC A;  4XBN A;  4CXW A;  4QKF A;  2E51 A;  1ULO A;  4GJY A;  2A75 A;  1AJO A;  4XE9 A;  5A32 A;  3VZJ A;  3PME A;  2VD7 A;  2RS5 1;  1A3K A;  1ZBA 1;  3D6E A;  4XJA A;  4AFB A;  2PQS A;  4J1W A;  1UAI A;  2D6L X;  3T2T A;  4COW A;  2DVD A;  4JDO A;  2HWF 3;  5ISL A;  3IAQ A;  4GH4 B;  3ATG A;  2XLA A;  4LOT A;  3PHM A;  3VUO A;  1N1S A;  4QU1 A;  4SLI A;  4DFS A;  2AAC A;  2H0B A;  3M8L A;  4XW3 A;  2BOJ A;  5EXO A;  2O0O A;  4AEJ A;  5LW9 A;  3EQE A;  4LBJ A;  4XDP A;  3A0N A;  2JWP A;  3WNM A;  1L7R A;  2VBP A;  3CLP A;  4O65 A;  1CON A;  3ACF A;  2GC1 A;  4LBM A;  2DWR A;  5GJ6 A;  2C26 A;  2IVJ A;  2IZW A;  1ODM A;  2ZHK A;  1LKN A;  5CNA A;  1HDK A;  4YVW B;  1ULC A;  4QB2 A;  5LEK A;  2Y26 A;  4S2G A;  2W2I A;  1RUJ 1;  2E33 A;  3ZFE B;  3S7I A;  2Q1M A;  1EAH 1;  3PL0 A;  4XZU G;  2ZGP A;  4AHY A;  3J7M A;  4Y5T A;  2QZ2 A;  5C4W C;  2CYF A;  4QKN A;  4JKK A;  4N9H A;  1FMD 1;  2VMH A;  3U1X A;  1DGL A;  2ZX3 A;  5ACA 1;  4MO3 M;  1WBL A;  2K9Z A;  4TLG A;  4OZO A;  1I1E A;  2DUR A;  5ERL A;  4XAA A;  2PHW A;  4URT A;  3WP4 A;  2R1B A;  4OHY A;  2DFC A;  1JMU B;  2UY8 A;  1MPX A;  1W8Z A;  3DEM A;  1JBC A;  1VE0 A;  3I2F A;  3N9M A;  4QQ2 A;  3WHT A;  3KT1 A;  4KGG A;  1SPP B;  1D2Q A;  3AZZ A;  4NHY A;  3NNG A;  4NJ4 A;  4BIS A;  5CKN A;  3ZN5 A;  5HCF A;  3KV5 A;  5ANQ A;  3CZU A;  3ZR6 A;  3WW3 A;  4GB3 2;  3TEX A;  4QPG C;  1TNF A;  5HXV A;  4A3X A;  1PIV 1;  4RS5 A;  3ZKU A;  4C1X A;  2R04 2;  1POV 1;  3VL9 A;  1HV1 A;  1SCS A;  3VB9 A;  4E2Q A;  3JBG 2;  5FXX A;  4N53 C;  4A45 A;  5CFC A;  2QQJ A;  5B2G B;  1DFQ A;  2IC1 A;  3CJX A;  2ARE A;  2YRO A;  2JDN A;  3DN7 A;  5JAX A;  4NIH A;  1JZ5 A;  1VRH 2;  3I2D A;  4GWJ A;  1AUY A;  2BNM A;  4F83 A;  5LY1 A;  4LBQ B;  1M06 G;  2PTM A;  3B7M A;  1C8M 1;  2JDY A;  1RUC 3;  1TE1 B;  2X8K A;  3WXP A;  4GMP 0;  4PHZ A;  3FLT A;  4H2A A;  4RHV 3;  2BWC A;  2EF6 A;  1Q8O A;  4V2V A;  4AGV A;  4ZHN A;  4E27 A;  4DS0 A;  1H2M A;  4MZU A;  4XHX A;  5CKM A;  2RHP A;  4HN1 A;  1OVP A;  2DU1 A;  5L36 A;  4HON A;  4AFC A;  1K5M C;  4OHX A;  5BNQ A;  4XF9 A;  1RUE 3;  3HN1 A;  4DY3 A;  3B69 A;  2EIC A;  1WD3 A;  2R30 A;  2VXR A;  4H14 A;  4OQ9 A;  3FJS A;  5IAV A;  1J83 A;  4KBB A;  3FUO A;  4KMQ A;  2YMZ A;  3FUQ A;  4Y1Y A;  3I3E A;  3LZZ A;  2H0V A;  2ZX4 A;  4HET A;  1DQ6 A;  4FT8 A;  4HK9 A;  4L11 A;  4URA A;  1LCL A;  1XBF A;  3U37 A;  2P3J A;  5IVV A;  3WW4 A;  1AL0 G;  3OGG A;  4M3C A;  1HXS 2;  1VMF A;  1RUI 2;  4LBL A;  4BDV B;  1Q56 A;  1MS0 A;  3J4U H;  1F2N A;  1VBE 3;  2E63 A;  4YGD A;  3RMX A;  2XL7 A;  3JUU A;  4MGI E;  4AVB A;  4IV1 C;  3V0A B;  3RVH A;  2YY1 A;  3CJI B;  3HQR A;  5FBZ A;  2D97 A;  2ZX2 A;  1GLH A;  4MXW B;  2VW1 A;  3VBS C;  1CAX B;  4JDM A;  3VKL A;  1QJU 1;  1QGL A;  2KXL A;  1W03 A;  3BGA A;  2VPV A;  5FYB A;  2YC0 A;  3OEB A;  4FAH A;  1S2E A;  2BV4 A;  5BY5 A;  2JIG A;  4BPZ A;  2YB7 A;  3SH4 A;  3CF6 E;  4Y22 A;  3MPP G;  3MBW A;  4LNV A;  4A7Z A;  1AHS A;  3ON7 A;  5ABJ A;  4HKL A;  3POY A;  1HRV 1;  3OOX A;  4BOW A;  3KWV A;  3N9N A;  5EP9 A;  3USU B;  3I54 A;  2FDK A;  1W9S A;  5IVJ A;  1RVF 1;  2VOV A;  2DVA A;  5J96 B;  4XUO A;  3KVB A;  3BAL A;  4RS5 C;  4KQ7 A;  4RFR B;  4XFA A;  1UXX X;  3VD7 A;  3VBU B;  1SFP A;  1GAN A;  3M2M A;  1VIW B;  1C1F A;  3A22 A;  4MH0 E;  3ZFF A;  1CZT A;  4BQX A;  4RA0 A;  1DDL A;  5G05 L;  2JG8 A;  1W8T A;  2JDA A;  3M70 A;  5GKA C;  3ZSL A;  5J3U A;  2J1R A;  3JB4 C;  2XVK A;  1IS5 A;  1JHN A;  1EV1 3;  3AKQ A;  3B5L B;  2R16 A;  1QY4 A;  2WZ8 A;  3KV4 A;  1TME 3;  2VZS A;  3CNA A;  4XHB A;  1HW5 A;  2V5D A;  4XF4 A;  1SQ4 A;  3ZFG B;  4TSV A;  1H2N A;  3SCH A;  1GQP A;  4BXS V;  4EZH A;  2ARB A;  5EJZ B;  2V72 A;  1N3O A;  2HWD 1;  3J7L A;  2PAE A;  1WME A;  1MS8 A;  1W6N B;  3WY6 A;  2BWA A;  1POV 0;  3ASI A;  4AVV A;  3KF3 A;  5LY2 A;  1RUN A;  3ZMO A;  4BMB A;  4Y4Y A;  1QJX 1;  2Y60 A;  1MQT B;  1V6O A;  1W05 A;  1IS6 A;  2WT1 A;  2XUM A;  3AP6 A;  2QQN A;  1O3Q A;  2HWE 2;  1PO1 3;  1QQP 1;  3KS7 A;  2BU9 A;  2HEV F;  2GNT A;  2F4P A;  3HAG A;  3HR9 A;  2IXJ A;  2N7G A;  2QQW A;  3RYK A;  4MSV A;  1RUG 1;  4RQP B;  4D69 A;  1DGW X;  1GZW B;  2ZHN A;  1DF0 A;  4IEX A;  2D5H A;  5DDJ 2;  1RUH 2;  4M01 A;  3UNP A;  5KC5 A;  2ZHM A;  2ZJC A;  4YLZ A;  3KV6 A;  2YBP A;  2R6Q A;  5FPB A;  1WW7 A;  1EP0 A;  4N43 A;  4WVW A;  4JZR A;  4LO5 B;  2WJS A;  5FP9 A;  4OQ8 A;  4AVC A;  1KFU L;  4E8D A;  2FCT A;  3SKJ E;  3PTY A;  5H9R A;  2VUJ A;  1RMU 1;  3GZE A;  1O3T A;  2XVL A;  3B02 A;  1F35 A;  2DUO A;  3ZSJ A;  4B7K A;  4I2O A;  4Q26 A;  3WNK A;  2O8Q A;  3PUR A;  4EWE A;  1DHK B;  5B4N A;  4H7L A;  4ZU5 A;  4CCO A;  1GBG A;  3IKW A;  3WX5 A;  4XJW A;  2ZZQ A;  4JGZ C;  4AXO A;  4DY5 A;  1AR7 2;  2HYK A;  5FYT A;  2RV9 A;  2FDJ A;  3PVN A;  3BB6 A;  3POS A;  3ZXL A;  2W91 A;  2WDB A;  2TEP A;  2WWU A;  4Q4W 2;  4B4R A;  2MEV 2;  3B00 A;  3HPN A;  1HLC A;  1AX2 A;  1OVS A;  2QBX A;  2Y64 A;  3QOP A;  3ZX7 A;  4AQ2 A;  3UKT A;  4Q4V 2;  3ZM8 A;  1NT0 A;  2R06 3;  2CGO A;  2YFU A;  4BQY A;  1YYN A;  1UKR A;  1W28 A;  3VZO A;  5IK5 A;  3X29 B;  4K6B A;  1TVG A;  1CZS A;  1DLC A;  1N3Q A;  1R08 1;  3OEA A;  1PNG A;  3U11 A;  1W90 A;  4CEW A;  3ZYI B;  1AL2 2;  4IGO A;  4QMA A;  1MEC 1;  4PLN A;  1ZZ7 A;  5EJ1 B;  2XPJ A;  2XG3 A;  5AVA A;  2ZAA A;  3WQ0 A;  2ZZJ A;  5EWS A;  2XJT A;  3E97 A;  3C7G A;  5FZD A;  2GND A;  5K0U C;  4CTE A;  4LBQ D;  2DBI A;  2XON A;  2CAU A;  2G4I A;  2XJU A;  4ATE A;  4IEY A;  2JDH A;  5FYY A;  1H2K A;  2VMF A;  5FMD A;  1LHN A;  4YRD A;  5C8C C;  5CFD A;  5A6X A;  4A42 A;  2J1U A;  1DU3 D;  2LM3 A;  4E2S A;  5BNN C;  2BEO A;  3OGR A;  3D8C A;  2ZGN A;  3MW3 A;  4GAZ A;  5A7P A;  3ZOI A;  4LO6 B;  3S5Q A;  1I5Z A;  3MV0 1;  4AQ6 A;  3K75 B;  2DVG A;  2PLV 1;  4QX8 A;  4MUV A;  4NPR A;  1BBT 3;  2P3Y A;  1S4C A;  2VBB A;  1L7Q A;  1SFN A;  4JV4 A;  5KHG A;  1H1A A;  1AXY A;  1NG0 A;  4ZXK A;  5CAD A;  1QIQ A;  2BP6 A;  1XXN A;  4BK4 A;  3GHM A;  3NKG A;  4I3G A;  4OFG A;  2RR1 2;  5CU1 A;  4B8E A;  1V6I A;  1OH3 A;  2PA7 A;  4QQH A;  5BNO B;  4ASM B;  1ZZB A;  3TEY A;  5LA2 A;  1DCS A;  1G9C A;  1KRI A;  1TMF 2;  1PM4 A;  2WSU A;  3AM2 A;  5FUI A;  2Z2S B;  1NA1 B;  4FCA A;  5FFO C;  3O1R A;  4OCT A;  3FBY A;  1GSL A;  1SHW B;  2VG9 A;  3JD7 3;  1DYP A;  1F5J A;  3VBF C;  3RWN A;  4COU A;  2XBO 2;  1OFS A;  1RYY A;  3K51 A;  4GB3 3;  3EBR A;  2DYC A;  5ANN A;  5A32 B;  1UY1 A;  3MYX A;  1XNK A;  4MGK E;  4FTS A;  3U10 A;  5KXC A;  1U5Z A;  3JBG 3;  1O91 A;  2W46 A;  2PFW A;  4JVA A;  4R9D A;  1ENS A;  5FKB A;  4LKF A;  5JUV A;  3V65 A;  1WW6 A;  1WMF A;  1W0O A;  2CDP A;  5G04 L;  2DVB A;  2GN7 A;  2CGN A;  3B3Q E;  2Z79 A;  1JN2 P;  5FK8 A;  3U78 A;  1A34 A;  2QDN A;  4LO4 B;  2VZU A;  5FMC A;  4FPG A;  4GWI A;  2OT7 A;  1S2B A;  1XJA A;  3RS6 A;  1W8H A;  2VTX J;  4RD7 A;  3WV6 A;  1CX1 A;  4LEJ A;  3DKW A;  1PZ8 A;  4YG0 A;  2XDV A;  4BHP A;  2VUD A;  1YI7 A;  4Z92 B;  1U5Y A;  2WNV C;  2ADD A;  5LBE A;  4B3N A;  5FRA A;  4CDU A;  5KHJ A;  4AI9 A;  1BXH A;  4K8F A;  4A3Z A;  1N1V A;  3IPV A;  1UW8 A;  3WW1 A;  1V6M A;  3URF A;  2FBE A;  4LA2 A;  3BYW A;  3WR0 A;  1UY0 A;  1TZO A;  1W8W A;  5FYU A;  2WLP A;  2RS3 2;  1UMH A;  2D98 A;  2YBS A;  1QJY 1;  4S2F A;  1H0B A;  1X7N A;  3E5X A;  3FE5 A;  4YAR A;  2VOX A;  1SDW A;  5F3G A;  3RZG A;  1CX4 A;  3VDD C;  4Q4Y 3;  4P9Y A;  1ULD A;  1RUI 3;  3WCS A;  2NZ9 A;  3M7A A;  2QDR A;  1QDO A;  4DRV A;  5A3P A;  4Q29 A;  2VJX A;  1FNY A;  1HB1 A;  4BQW A;  1PO2 2;  1H1M A;  2O1Q A;  1D4M 1;  3LQC A;  3ZKY A;  4HK8 A;  5L9R A;  5J09 A;  5GLV A;  3N9O A;  5FMO S;  4IW3 A;  1UX6 A;  4XAB A;  1Z7S 2;  2K2S A;  4Y24 A;  4YGB A;  3H3U A;  2R0H A;  1O5L A;  5FXW A;  5JLV A;  3IZO A;  3WDY A;  1CES A;  5E1R A;  3U4X A;  1UXZ A;  5CFC B;  4WVV A;  1IS3 A;  3K48 A;  4H3W A;  1OD5 A;  3AMH A;  5FPZ A;  4DPN A;  2JG9 C;  3KQ4 B;  5FZ1 A;  1A78 A;  1GP6 A;  4XFB A;  2RS1 3;  2VOT A;  4XUP A;  5FJH A;  3T2P A;  2WYF A;  2ENR A;  2Q4S A;  3ACG A;  3LEK A;  3PNA A;  2HWF 2;  3AYD A;  1V70 A;  5T5J A;  2BTV C;  3ZYH A;  2GNM A;  2WS9 2;  4NIG A;  4ASK A;  1JYW A;  1OQD A;  5DUX A;  2PAK A;  2ZCW A;  4IQP A;  2GSY A;  2I2S A;  2B45 X;  2UYB A;  2GH2 A;  4K1Y A;  1CPM A;  3NJY A;  2LRP A;  4LTA A;  1OOP A;  1QH7 A;  1UU5 A;  3Q8B A;  1D2S A;  1IKQ A;  1HB4 A;  4GKX A;  3TAY A;  2VTF A;  3NJZ A;  4R9C A;  2A5Z A;  2JE7 A;  3BOD A;  4Y1X A;  2E32 A;  4HLT A;  1QJE A;  1VBC 2;  1CZV A;  4KGQ A;  5FLJ A;  1NZC A;  3USS A;  4M3C B;  5FZ4 A;  1ZRR A;  1UYY A;  1AX0 A;  5FPV A;  4KNC A;  4CDU C;  3AL6 A;  1QXR A;  2FHR A;  5M0T A;  1JXN A;  4MYE A;  1LGC A;  2IXK A;  4JQT A;  2HWE 3;  3N7L A;  3NJX A;  4FVV A;  3H8R A;  1GWL A;  4CEY C;  4FPJ A;  5A33 B;  4IXL A;  4V2W A;  4PLM A;  3I3M A;  4CDW A;  3O7O A;  5DDJ 3;  3DXT A;  1RUH 3;  1XNA A;  1PGW 1;  2D40 A;  4Y22 B;  2DVF A;  5K9Y A;  4B1L A;  2R32 A;  4MGQ A;  5LAT A;  1EUT A;  1IG3 A;  2D44 A;  4NRP A;  4KWL A;  5ABJ B;  1BLZ A;  4WV8 A;  4MXV A;  3B93 A;  5FZ0 A;  4AED C;  1ZZ6 A;  4XET A;  1DQ2 A;  1JOD A;  3HNY M;  4Y1V A;  4IET A;  3VN4 A;  2DTY A;  4CU9 A;  3POE A;  4QPI A;  4CE8 A;  1WMD A;  1D4V B;  3I59 A;  3ZFF B;  1CD3 G;  1SLA A;  3NV2 A;  2W9X A;  1J1T A;  2JG8 B;  4GJZ A;  1O4Z A;  3VDA A;  2WT0 A;  1AR7 3;  2WT2 A;  1UZZ A;  5CA6 A;  2Y34 A;  1AYN 1;  1RUF 3;  2X09 A;  4E4H A;  1RUD 1;  3WD5 A;  4MVT A;  4PF5 A;  1DQ1 A;  2E6V A;  1LOF A;  3T0D A;  2QCS B;  4LXL A;  1GP5 A;  2ZKN A;  3UT0 A;  1RUE 2;  5L7O C;  1X82 A;  4HKO A;  1Y9Q A;  4YW3 A;  3LD8 A;  3H8X A;  1OKQ A;  1YUD A;  4QDS A;  1YO8 A;  4EN8 B;  1HN1 A;  3H7J A;  3NV1 A;  1S1A A;  2VMC A;  1MS4 A;  1XYN A;  2GME A;  2W08 A;  3UGG A;  1G7Y A;  1UOB A;  1K45 A;  2XGX A;  2JIJ A;  4JKM A;  1SBF A;  1VBA 3;  1AL2 3;  2PHU A;  1Q8S A;  4I02 A;  4BK5 A;  2C4X A;  3RJ2 X;  1A6C A;  4LLO A;  3GF6 A;  2VMI A;  5EV7 A;  5A3M A;  1DG6 A;  5A7S A;  2EXK A;  4AHX A;  3VBO C;  2HWC 1;  1VBE 2;  1OLQ A;  4GWN A;  3KHB A;  3RZZ A;  4UBG A;  4LLF A;  4AVA A;  5LBC A;  1A8M A;  1NCR B;  1AR6 3;  1MAC A;  5BPX A;  3IDA A;  3T0A A;  1CAU A;  2LRO A;  1FI2 A;  1KXG A;  1J58 A;  2OPK A;  3VHO A;  4D6Q A;  2W1S A;  5IFT A;  3LOI A;  4N43 B;  1XSR A;  5FY0 A;  3N3H A;  4B4Q A;  1ONA A;  1LEC A;  2A6Z A;  2JDP A;  3GCW A;  3OSD A;  5T52 A;  1QJF A;  1US3 A;  4M00 A;  5JOZ A;  2OXB A;  3N7J A;  3PTR B;  1LOB A;  4FFI A;  1KJL A;  3GBF A;  2EAK A;  2O14 A;  1VAM A;  4D7S A;  3NNF A;  1QXJ A;  2VBD A;  2JKX A;  3ENR A;  4CDW C;  3IDE A;  3BTY A;  1VP6 A;  4AFM A;  5BNP A;  1BEV 2;  2I07 B;  1L3J A;  4CP0 A;  1R09 3;  4BQ2 A;  1UL9 A;  1LOG A;  2Y0I A;  1XOY A;  3S5A A;  2VY0 A;  3FLR A;  3H3Z A;  2A70 A;  1FNZ A;  4YG6 A;  2HEY F;  1R1A 1;  4MHU A;  1TMF 3;  4QXB A;  2VNG A;  2Y6K A;  3HQU A;  1EV1 2;  1BVP 1;  3RFR A;  2ARA A;  1HN0 A;  4JHZ A;  3TN9 2;  4C0B A;  4Y5S A;  2WNU C;  3VL8 A;  2XBO 3;  1U5X A;  3EO6 A;  4JTN A;  4ASL A;  3SH5 A;  4L99 A;  4CEW B;  3K4A A;  2QQL A;  3WOG A;  3T0B A;  3WDW A;  5FMO L;  5FZE A;  4LK7 A;  4TWT A;  4QGM A;  4UW3 A;  1X9P A;  4COY A;  3J8F 3;  1JYI A;  1COV 2;  2VZQ A;  1RED A;  2Q5T A;  4ES9 A;  2Y6H A;  3IMM A;  4F8A A;  2XJS A;  4HVO A;  2CWM A;  3T2O A;  5J36 A;  1Z78 A;  4QX3 A;  1CIY A;  4IE4 A;  4P14 A;  4K9S A;  2WFF 3;  1PO1 2;  3GXU A;  1AR8 3;  5C9A C;  4JAA A;  3LGR A;  4NWV A;  5DAX A;  4DOU A;  2SLI A;  3AMN A;  1VBB 2;  3P1I A;  1B35 B;  3CHX A;  4QB1 A;  4YW1 A;  1QJZ A;  4PIZ A;  2OKX A;  4BLI A;  1HIX A;  5CFD B;  3ME2 A;  5FZK A;  1Y3T A;  3I4I A;  5FTT C;  4NHM A;  3DV8 A;  5C4W A;  2X29 A;  2J1E A;  4QWN A;  4PQ9 A;  5LEJ A;  4NAO A;  4ET7 A;  3D5O A;  4YW2 A;  3MW4 A;  4OUL A;  4JRL A;  2IXI A;  5KC6 A;  5C8W A;  3LPG A;  3H8U A;  1S0J A;  2W94 A;  4EN0 A;  1XYO A;  2RS5 2;  4AQS A;  1ULP A;  3POI A;  5FKC A;  3S57 A;  1KQR A;  1N1T A;  2RS3 3;  2VNO A;  1ASJ 1;  3Q8E A;  1OA4 A;  5DQ0 A;  1SBE A;  3RI8 A;  3UET A;  1JUH A;  1JW6 A;  1QU0 A;  4MGS A;  2CY6 A;  4GMP 1;  5KXB A;  1NCQ C;  2WWJ A;  1JYC A;  1N1Y A;  4E9K A;  3N7K A;  4IEV A;  3MID A;  4A2U A;  4QPG A;  5L73 A;  4AVT A;  1YRZ A;  2Q1Z B;  5JOY A;  2E7Q A;  2ZEW A;  3AKR A;  2VUA A;  4Q0Q A;  5FZB A;  4CUB A;  2Y6J A;  4O7X A;  4P9I A;  5J7M A;  4N53 A;  1PO2 3;  4LOR A;  2PXJ A;  2DTW A;  2B7Y A;  5BNP C;  3WG3 A;  4NRM A;  4EJR A;  1F4H A;  3K4Z A;  1SZB A;  5FZA A;  3AYA A;  4HMZ A;  1JZ7 A;  3K77 A;  4PJY A;  1GQH A;  1UCX A;  3NNM A;  4QQP A;  4IEZ A;  3WP5 A;  3ZIW A;  2BER A;  4QX0 A;  1HB3 A;  4RQP C;  3DYM A;  1GNH A;  3KD4 A;  3SMH A;  1JI6 A;  2Z5W A;  1RUJ 2;  2W87 A;  2NMO A;  4FFG A;  1F31 A;  1EAH 2;  4YZ5 A;  5FWJ A;  4XQW A;  3EMR A;  5A1A A;  4JGY B;  1QMJ A;  2WO2 A;  3O1M A;  2R07 3;  3KB5 A;  4BU2 A;  3I2O A;  1ND3 C;  1FMD 2;  4LBN A;  4MOA A;  4OUS A;  1NY7 1;  1WKY A;  5CG8 A;  1K5M A;  1UPS A;  4AF9 A;  5CEH A;  4NHL A;  2PAM A;  4RSU A;  3C8X A;  2XWJ B;  5FO8 B;  2HWB 1;  2WS9 3;  4MX3 A;  2XUE A;  4IDZ A;  1OH4 A;  1RGS A;  3NMB A;  2EXJ A;  2E53 A;  1FPN 3;  2ORX A;  3Q8F A;  3AYC A;  1W6P A;  3CO2 A;  4NIA A;  1CAV A;  3H0O A;  4GQ7 A;  5DZF A;  5CB7 A;  5IK7 A;  1J84 A;  1UMI A;  2AUY A;  3ZVX A;  4Z2W A;  4PLO A;  5EHD A;  2VVF A;  2B46 X;  2W5F A;  2BQP A;  1SAC A;  3IPV B;  2G9Z A;  3OJB A;  4IUG A;  5T5O A;  3ACL A;  1XE8 A;  3OPW A;  3CDZ B;  3POJ A;  4GZ9 A;  3DL3 A;  5FPU A;  3MIG A;  5A7Q A;  4NPM A;  4XUQ A;  1VBC 3;  4HVR A;  4RGA A;  5CG9 A;  4LKE A;  5KHI A;  3O0X A;  2IFR A;  1LRH A;  3QH6 A;  4IV1 A;  4BQ1 A;  1BBT 2;  1UYP A;  2HKX A;  5IT6 A;  5IYY A;  3VBS A;  2WBK A;  4FP3 A;  4O9E A;  2VW2 A;  1YQ8 A;  3VHP A;  3B94 A;  1C8M 2;  4UAP A;  4XTM A;  3DPR B;  3N9Q A;  4YPJ A;  4WM7 C;  3RGB A;  2Z69 A;  3POW A;  4PI2 A;  2JDK A;  4UF0 A;  1GNZ A;  4IE5 A;  4CDQ A;  3T30 A;  1LAJ A;  4YNI A;  2XJR A;  2PYT A;  1CJD A;  1X8E A;  1XNC A;  1ZBE 3;  1GOH A;  4F7Z A;  3GM8 A;  3JQW A;  2WZR 1;  3GGL A;  5DZG A;  4FTE A;  4XXA A;  1C4R A;  1M4W A;  1STM A;  3JD7 2;  2RJ2 A;  5T54 A;  4I3P A;  4GXL A;  1ZRI A;  1W8F A;  5E8A A;  4KWU A;  2IXH A;  2PHD A;  1HQW A;  5DAP A;  5C3Q A;  4UW4 A;  2G1M A;  1UY4 A;  2OUJ A;  4AI8 A;  2J42 A;  2ARC A;  1JYX A;  1CQ9 A;  5K4L A;  5FP8 A;  4UFJ A;  1YQ5 A;  4I01 A;  5IHR A;  5LWB A;  2WSV A;  4XBL A;  3UJO A;  2HEW F;  2QZ3 A;  1ZA7 A;  2AEY A;  1QOS A;  4S2D A;  2JXA A;  2XML A;  1W6M B;  3C7F A;  3C7O A;  3O14 A;  3W9A A;  1W0P A;  1LEN A;  5HXM A;  1RL3 A;  2DFB A;  4BJ0 A;  4IEW A;  4OI1 A;  1OOP B;  4AI2 A;  3AB0 A;  3BTZ A;  1HJG A;  1QJU 2;  1IOA A;  4HSL A;  4HAN A;  2EAL A;  2UWC A;  3VDB A;  5FRE A;  1WA6 X;  4Q1P A;  3BI3 A;  1APN A;  1NAE A;  4YGC A;  2QE3 A;  4LR4 A;  4XUR A;  3Q9O A;  3AMM A;  3LSE A;  3IWZ A;  2VOW A;  3IDC B;  4LE4 A;  2D43 A;  5DN2 A;  3JU9 A;  4MET A;  3VBR A;  5I0U A;  1NLS A;  3O1P A;  1FYU A;  1GOF A;  4B7E A;  1PVC 3;  3TNP B;  5GAL A;  1RXF A;  1GNY A;  1FV3 A;  4W6Y A;  5FBJ A;  1HX6 A;  2UWA A;  2VE1 A;  4XMA A;  5GZE A;  2VUL A;  3OCP A;  3WNX A;  1RVF 2;  5FZ3 A;  2VW0 A;  3OB8 A;  2RM2 3;  3LEI A;  4Q4Y 2;  1OI6 A;  2WUH A;  4YM1 A;  1JS9 A;  2HYX A;  2WII B;  5DZE A;  3OD4 A;  2PHX A;  3OTF A;  3MFA A;  1QOO A;  4BH9 A;  4I0A A;  5EIY B;  3E6C C;  4PDW C;  5T55 A;  2ZEY A;  4ISQ A;  3WDT A;  4QM9 A;  2E7A A;  5JOW A;  5JWP A;  2ZAB A;  3MIH A;  2R04 1;  2ADE A;  4YFW A;  1WZX A;  2YBK A;  1UX7 A;  4LHK A;  4YVS C;  5A7N A;  2VGD A;  3S7E A;  5GLT A;  4FFF A;  1DLL A;  1D0H A;  3W59 A;  3ES4 A;  3W21 A;  2ZEZ A;  3L2H A;  3PVE A;  3PUI A;  4FXG B;  1Z0H A;  3SIS A;  4LPL A;  1ULG A;  2V73 A;  4CDQ C;  2Y6F A;  4JGZ A;  5C5T A;  1VRH 1;  2HWD 2;  3BUC A;  2RS1 2;  4QPI B;  4HBN A;  4ZS2 A;  4N9I A;  2Z42 A;  3PU3 A;  2D6O X;  3I59 B;  3EHK A;  4YW6 A;  1QJX 2;  5DAQ A;  2QQU A;  1URX A;  1H8T C;  2D7F A;  2AEN A;  1BEV 3;  3I3Q A;  2W1U A;  1IKP A;  1GMM A;  2XHN A;  2QQI A;  4PIY A;  4YG3 A;  3V64 A;  1RJ8 A;  4XFG A;  4AI1 A;  1QQP 2;  4L8Q A;  4CUG A;  4KBZ A;  5JSR A;  2DCT A;  3R6S A;  4KI5 M;  4UFK A;  1SLT A;  3TBD A;  2DUQ A;  5F5Q A;  1RUG 2;  4NRO A;  1V0A A;  1YJK A;  2DV9 A;  2KA3 A;  4TYS A;  5AC9 3;  4Y1Z A;  1JOJ A;  4GKY A;  1QXP A;  3VBH B;  1W9W A;  2J1T A;  1I5P A;  2G9F A;  4AQT A;  1AR9 1;  2WIN B;  3TN9 3;  1QNW A;  5LA1 A;  1HQN A;  1AZD A;  3ES1 A;  1AF9 A;  1VBD 3;  3F95 A;  4KG8 A;  1G8W A;  3OY8 A;  5I0S A;  2CDO A;  3MDP A;  1CAW B;  4Q5O A;  4Z8B A;  2XVG A;  1RMU 2;  5K0U A;  4NWW A;  1BQP A;  1HXS 1;  5LRR A;  1I6X A;  3IMN A;  3OUI A;  1COV 3;  1AYM 1;  1OPM A;  3NAP B;  1H2L A;  3KM5 A;  4Y20 A;  5IVE A;  1I3H A;  4FTB A;  1Y9M A;  2ET7 A;  5C8C A;  1Q5O A;  2FZ2 A;  4EQV A;  4XYX A;  3RJR A;  1G6N A;  2QTW B;  3J7N A;  4WM8 C;  5CBL A;  3WF3 A;  5BNN A;  1WA4 A;  2JKB A;  4RGK A;  5LA9 A;  5HI0 A;  1CAU B;  1HRI 1;  3VBR C;  4RR3 C;  4A7Y A;  2GC3 A;  3LIH A;  5FZM A;  5C7G A;  1CWP A;  2DF7 A;  2P17 A;  3RQ0 A;  3WZ1 A;  4BLJ A;  1VBB 3;  1VLN A;  5FY1 A;  3D82 A;  3VHR A;  3HN3 A;  1G9F A;  2OVU A;  2C9A A;  2A6Y A;  1IZ3 A;  1XU1 A;  2W47 A;  5FP4 A;  1VMJ A;  1DZR A;  4H55 A;  4XUT A;  2EID A;  1BKZ A;  2YU1 A;  4Q27 A;  1ULE A;  4ERO A;  3WG1 A;  1ENR A;  3NST A;  3SEE A;  1WLC A;  4QAW A; 
#chains in the Genus database with same CATH homology
 3LEG A;  2ORZ A;  3HNM A;  4A4A A;  1W8O A;  1LNS A;  3ACI A;  3ABZ A;  3I97 A;  2J1A A;  4UI9 L;  3THD A;  2VJX A;  5C70 A;  3I2K A;  1EUU A;  2VO5 A;  3LQC A;  4DUX A;  4QDR A;  5JR2 A;  1H6Y A;  4DUW A;  4RN5 A;  2EIB A;  1UXZ A;  3NQH A;  4DEV A;  1UWW A;  2WAB A;  4L0P A;  2X05 A;  3VDC A;  2V4V A;  4QB6 A;  3IAP A;  1NUK A;  3WNP A;  4XUP A;  3IB3 A;  3T2P A;  2VOT A;  2W92 A;  4Z2A A;  3OG2 A;  2YG0 A;  2WO1 A;  3OBA A;  2BGO A;  3ACG A;  3LEK A;  3WNL A;  2E31 A;  5CZK A;  3W5N A;  1D7P M;  2QQK A;  1US2 A;  1JYW A;  1OD3 A;  1DYO A;  1SDD B;  3F2Z A;  2WYS A;  3III A;  1W8N A;  4DUV A;  2VTF A;  4A44 A;  1PX4 A;  2J7M A;  3CZJ A;  3K4D A;  3I2I A;  1SG3 A;  2J1S A;  1NX9 A;  2E32 A;  4FI9 A;  4TTG A;  1CZV A;  2W1Q A;  1JU4 A;  2RVA A;  1JZ2 A;  3EB7 A;  3I2J A;  1UYY A;  3E1F 1;  4DXT A;  2YFZ A;  2EIE A;  4CUA A;  4E8C A;  2VQT A;  5JMO A;  1K12 A;  1UYZ A;  3WF2 A;  1YQ2 A;  1PMJ X;  3NJX A;  2VM9 A;  4M4P A;  5JXG A;  5JXH A;  4MAD A;  4M4R A;  4TXW A;  2JD9 A;  3OGS A;  1XNA A;  4CU6 A;  2WAO A;  3WNN A;  3MUZ 1;  4MGQ A;  2W1W A;  2VZR A;  4CVU A;  1EUT A;  5C71 A;  2WN3 A;  3DYO A;  1OF3 A;  3HNY M;  4CU9 A;  5LA0 A;  2DDU A;  2QQM A;  2W9X A;  3VDA A;  4XUN A;  2VZ3 A;  2X09 A;  3A7Q A;  1ULO A;  3UES A;  1T2X A;  3T0D A;  2PQS A;  3P6B A;  3OGV A;  1PX3 A;  4QDS A;  1HN1 A;  2VMC A;  3I2H A;  4JKL A;  3IAQ A;  1JHJ A;  1K45 A;  1WCQ A;  1OF4 A;  4JKM A;  4BK5 A;  3I2G A;  2C4X A;  2WN2 A;  1OT5 A;  3WNM A;  1L7R A;  3ACF A;  3A21 A;  1W0N A;  4CUC A;  2C26 A;  2LS6 A;  3WSO A;  3SKV A;  3VD5 A;  3T0A A;  3IDA A;  2VZP A;  3SEP A;  4D0Q A;  4QB2 A;  3WEZ A;  2VCB A;  2W1S A;  5IFT A;  1IQD C;  2E33 A;  2HLE A;  4XZU G;  3FHA A;  2B4K A;  3K46 A;  2DCK A;  4JKK A;  1US3 A;  3HEI A;  3I3D A;  4MO3 M;  5LCW L;  2BGP A;  2JKX A;  4OZO A;  1O8S A;  1MPX A;  3I2F A;  5DPN A;  2WAA A;  2VZO A;  3NNG A;  1UYX A;  3CZU A;  3WNO A;  1PMH X;  5IJR A;  2Y6K A;  3LE0 A;  4JHZ A;  4A45 A;  2QQJ A;  2XQX A;  3ACH A;  4PT6 A;  1BHG A;  1JZ5 A;  3I3B A;  4GWJ A;  2QQO A;  3K4A A;  4W50 A;  2QQL A;  3T0B A;  3MO4 A;  4P02 B;  2VZQ A;  2Y6H A;  3T2O A;  4QX3 A;  4W4Z A;  1CIY A;  3GXU A;  3NJV A;  3T2Q A;  1P8J A;  1W9T A;  3WF1 A;  5JXI A;  2EIC A;  1JZ6 A;  3P1I A;  4QB1 A;  5JXJ A;  2OKX A;  1J83 A;  4KMQ A;  3NRU A;  3I3E A;  1JYN A;  3THC A;  2J1E A;  4QPW A;  4ET7 A;  4ZZ8 A;  3U37 A;  4CU7 A;  1UY3 A;  5B4X A;  3LPG A;  5I0D A;  2W94 A;  4OUE A;  3VD4 A;  1JU3 A;  1ULP A;  4BDV B;  2VZ1 A;  5DQ0 A;  3UET A;  2XOM A;  1O8P A;  4MGS A;  3ETP A;  4A41 A;  5DMY A;  4DXS A;  3JXS A;  3MUY 1;  3D3A A;  3BGA A;  2ZEW A;  3OEB A;  2E26 A;  4CUB A;  2Y6J A;  1GOG A;  2YB7 A;  4ARY A;  3PUH A;  1JZ3 A;  1F4H A;  3MBW A;  3K4Z A;  2KD7 A;  1JZ7 A;  3K77 A;  3WQB A;  2BER A;  4QX0 A;  1W9S A;  5IFP A;  1F4A A;  2VMD A;  3DYM A;  1JI6 A;  2W87 A;  3WF0 A;  4XUO A;  1UY2 A;  1UXX X;  3VD7 A;  5A1A A;  3A22 A;  2WO2 A;  1CZT A;  4P5Y A;  4MOA A;  5G05 L;  1WKY A;  2JDA A;  5CYY A;  2Y6G A;  2J1R A;  4OYU A;  2VCA A;  3C8X A;  1GU3 A;  4LKS A;  2WZ8 A;  3CQO A;  3DYP A;  1OH4 A;  4ZXE A;  2VZS A;  2ORX A;  2V5D A;  4DEQ A;  2Y6L A;  1J84 A;  2J1V A;  1GQP A;  1UMI A;  4BXS V;  2W3J A;  5EJZ B;  4ZY9 A;  1GUI A;  2L9L A;  2V72 A;  2W5F A;  4OMD A;  1UZ0 A;  4IUG A;  3HNB M;  2JE8 A;  3CDZ B;  4GZ9 A;  1JYV A;  3BN6 A;  4PQQ A;  4XUQ A;  1K3I A;  2QQN A;  5J1X A;  5IYY A;  2VZV A;  1DP0 A;  2WBK A;  3MV1 1;  2VQU A;  4UAP A;  2WQ8 A;  4YPJ A;  4OMC A;  3UNP A;  4AAX A;  2VZT A;  1GOH A;  4P08 A;  4E8D A;  3GM8 A;  3FL7 A;  3GGL A;  2C9K A;  3ECQ A;  3SKJ E;  2RJ2 A;  4UOJ A;  3HOB A;  3WF4 A;  1XC6 A;  2Z4F A;  3WNK A;  4KWU A;  2VR4 A;  3EYP A;  1UY4 A;  5B4N A;  1JYX A;  2RV9 A;  5IHR A;  2W91 A;  2WDB A;  3HPN A;  2QBX A;  2Y64 A;  3C7F A;  3C7O A;  4JX0 A;  5HXM A;  4BJ0 A;  3ZM8 A;  2ZXQ A;  2YFU A;  4AG4 A;  1TVG A;  3VDB A;  1CZS A;  1DLC A;  3VD3 A;  1NAE A;  3OEA A;  4XUR A;  2VC9 A;  2R7E B;  2WO3 A;  2YC4 A;  1K42 A;  1W99 A;  5DN2 A;  4P00 B;  2WZE A;  2W95 A;  5EJ1 B;  2B9V A;  1GOF A;  1GNY A;  3C7G A;  4QX2 A;  1JZ4 A;  2XON A;  3OB8 A;  3W5M A;  3LEI A;  1XPW A;  2WUH A;  2VMF A;  2HYX A;  3J7H A;  4DXR A;  1O59 A;  4A42 A;  2BBA A;  4PF1 A;  2J1U A;  5EIY B;  4LQR A;  3OGR A;  4RYD A;  2ZEY A;  3MV0 1;  3C7E A;  2LW8 A;  3K75 B;  3LPF A;  2YC2 A;  1UX7 A;  1L7Q A;  2ZEZ A;  3PUI A;  3T08 A;  4LPL A;  4BK4 A;  1JZ8 A;  3VD9 A;  2VME A;  2ZEX A;  2ID4 A;  4A6O A;  5LA2 A;  3A23 A;  2BZD A;  4QDQ A;  2W1U A;  2XHN A;  1GMM A;  5FUI A;  2QQI A;  2Y8K A;  2X10 A;  1SHW B;  3FHQ A;  4W8J A;  4HG6 B;  3GDB A;  1KGY A;  4KI5 M;  1RYY A;  3FN9 A;  3AC0 A;  1UY1 A;  1NKG A;  1W9W A;  2J1T A;  1I5P A;  2W46 A;  3T09 A;  5LA1 A;  1XNT A;  4CU8 A;  4ARX A;  4QX1 A;  5JUV A;  2J22 A;  3CMG A;  2CDO A;  2CDP A;  5G04 L;  4D8M A;  4XVH A;  2DCJ A;  3C7H A;  3DEC A;  2VZU A;  4LHS A;  3CIH A;  4GWI A;  1CX1 A;  2VCC A;  3WF3 A;  5C7G A;  5HPO A;  4A3Z A;  3HJR A;  2VL4 A;  3CKH A;  3HN3 A;  1KEX A;  5F7U A;  2W47 A;  1UY0 A;  4ZZ5 A;  1R64 A;  1UMH A;  4XUT A;  2EID A;  1H6X A;  1TG7 A;  3SEE A;  4QAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...