1RUOA

Catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aromatic hydrogen bond in sequence-specific protein DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3')
total genus 45
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ruoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruoA01
1TW2A 2CYYA 2EV5A 4HVRA 2MH2A 1LRHA 2E1NA 2VBYA 3DQVC 3QU3A 5K8SA 2GAUA 1FWZA 2KIMA 3H3ZA 5KHGA 4PDKA 1HKQA 3ISPA 1C0WA 2MHFA 2ZKLA 4KA4A 1O3SA 2FQPA 1ZG3A 2BE5F 3ZPLA 3EO6A 3KP5A 2L4AA 3GLXA 1Z6RA 1XMAA 5DUKA 3EYIA 4HA8A 4P9FA 3OD0A 4AQ6A 3FMRA 3EJKA 3VHRA 4QGNA 1IRFA 4QX5A 4KIBA 5I0RA 3EBRA 4QLCU 4QWQA 4LD5A 2M8EA 1WA4A 5J48A 1O3QA 4MX3A 5E1RA 5BQTA 1MKMA 2XLAA 2KJCA 1OYIA 2A3SA 4RAZA 1V70A 4G94A 3EQEA 2E7WA 1YLLA 1O57A 2BV6A 2L02A 3HHGA 4M71A 4RAYA 2F5EA 1OPCA 1Y0UA 3FE5A 4MTDA 3TO9A 1QXRA 1IZ1A 4M72A 1O7LA 3CUQC 2IVMA 5BS6A 2ET7A 4R8HA 2WC2A 5D8KB 1FX7A 3DF8A 1H0MA 4YIFA 1ZYRF 4Z07A 4OIRF 1EH8A 3EUHA 1FT9A 4R52A 1YQAA 3ROUA 1ZAOA 4HF0A 1G3TA 2J5OA 1GXQA 2Y75A 1ZG5A 1FXZA 1YHFA 3OCPA 4YNIA 2YX7A 1BI2A 1MJBA 4LLOA 2E9QA 4ASNA 2NYXA 4M9ZA 3P9KA 2NRAC 1XGMA 3FX3A 4QM8A 3TO6A 4EJUA 4O6JA 5DCMB 1RUNA 1F5TA 4I0BA 5ICEA 4XFFA 4JTNA 3DN7A 1XSDA 5D6EA 5H6RA 1LJ9A 3LOIA 1J75A 5DUIA 1EV7A 2O61A 2MLKA 1B6AA 3KP6A 2PJPA 4KYWA 3HRMA 2NS0A 3OF1A 1ZZ6A 3BJOA 4KDPA 4Q0SA 2Z3YA 4ENMA 5L3CA 2ATFA 1R00A 1FLIA 1YS7A 4KIFA 2PAKA 1W5TA 1QQIA 3HSRA 1O5LA 2G9WA 2O0YA 2V79A 4ZU7A 1UHWA 3LAGA 4PIXA 2IXLA 4CICA 4KMFA 2PMHA 3E97A 3MAJA 4R1HA 4U0YA 4Q29A 3U10A 4AWXB 3O14A 2IA0A 1SFXA 3NQOA 3QOPA 4QGLA 1O3RA 2PEXA 2XRNA 2UYAA 1G6NA 2XAQA 3WTWC 2OZ6A 3F8CA 2HS5A 1FP2A 4A0YA 2O3FA 1NZCA 5I8YA 4YFNF 2PI0A 4ONUA 3QAHA 1U12A 1ZHFA 3F6OA 2H6CA 4EJOA 3IDCB 4BQAA 2GC0A 2OPKA 2XL7A 1WWXA 3I4PA 3KMHA 4L0ZB 3IRQA 4RGRA 4E2QA 2C6YA 1SFEA 3H8UA 2FRHA 3IHUA 1JHFA 5ILUA 5HOOA 2VQAA 1IXSB 2ZMEA 4L9TA 4MGYE 4GGGA 4B29A 5CVRA 1P6RA 4N0BA 4ESJA 3RNSA 2A5YB 2CO5A 2KIUA 4MGIE 2IW5A 2DK8A 3HSFA 1H9TA 1J3RA 4LUMA 1XE7A 5C8WA 4M9SA 5LHHA 2GC1A 2X4HA 2JZYA 3HTSB 3P7NA 2ZMEB 4AIJA 2XAJA 4XBFA 4DNCA 5LGTA 1I1GA 3KE2A 4EQQA 3BALA 4DQ2A 1Z05A 4IEUA 1YFWA 1ZLKA 3KLNA 2EFOA 1YW8A 3BP8A 4GYGA 2W25A 4DINB 1YG2A 1VP6A 3ES4A 2F5FA 3KP7A 3IWFA 4P9GA 1FSHA 3I59B 3J7AO 5E16A 5K1YA 3FXQA 3KFWX 2MA3A 2H09A 3K0LA 3F6VA 2B8MA 1FOKA 2FMYA 4S05A 4G7ZF 1DP7P 4TV7A 1U5TC 4IEZA 5LBQA 4ZH4F 4I3PA 1LEBA 3TNQA 4A0XA 3DFGA 3TOAA 1HKSA 2EJRA 4EM0B 3M3IA 3FXRA 1SQ4A 4PGHA 3WODF 4WK8F 4A6DA 4IF4A 5LHIA 1JE8A 1OR7A 1TQIA 3QP5A 1IN5A 4XFAA 3W6JB 2Z5UA 2YPRA 2BEOA 3K1PA 3HRTA 4XSXF 1WKMA 1ZARA 3WTYC 2W24A 4FBFA 3G7DA 2XHKA 4HQEA 1TQMA 3CO6C 1J3QA 2DFIA 1R5GA 4NHJA 4G7OF 1IUYA 4LB5A 1RTVA 2QWWA 3TDZC 1YFXA 3PFIA 3FZ3A 2IRFG 2PBIA 3ST7A 4KMUX 2ELHA 2V1XA 5LEKA 5BUVA 5E20A 1I5ZA 3HSEA 4O3MA 2STWA 5FPXA 5F1RA 4U0VA 1UCXA 3R4KA 1H1IA 3S7EA 1IN7A 1LEAA 2ETHA 4KL1A 4RGXA 3M8EA 2IT0A 1Z7UA 1NHAA 1OMIA 1CF7A 4E2SA 4EWAA 4EJWA 1DPRA 4LLGF 3J80Z 3E5UA 4HLXA 1FYMA 3H3UA 2VC1A 5FPZA 1P4XA 5HDKA 2A6EF 4P5OA 3V8JA 4U88A 4ZYEA 5JSPA 2Z2SB 3SZTA 1FBSA 5HLIA 1WLTA 3FF5A 4X6QB 2GWRA 3DXJF 3C3WA 4MNUA 2KRFA 5LRRA 4RB2C 4YG2F 5ILVA 2QNKA 1B9NA 3QPTA 3GXOA 1YUDA 2ADUA 1UIJA 3HRSA 3GW2A 1EY2A 1QPMA 4MZUA 4M74A 2DLLA 4MTEA 3ELNA 1X3UA 4UXAA 1YFHA 1U5TB 2CGPA 4I02A 4UVAA 3ZN1A 4HDUA 3BJ6A 2IXCA 2CAUA 2XAGA 2DW4A 3WTTC 4HV6A 2FXAA 4QGMA 1GHCA 5CVIA 1UIKA 3ERED 4HF1A 4NVPA 1UPIA 3JAMK 1XRUA 3BU7A 3LA2A 4EGZA 4ENKA 2HZTA 4IRHA 1PP7U 5L3BA 2VE9A 1R5HA 4HYEA 4KFCA 2DU9A 3TO7A 1KA8A 2A07F 3CF6E 5I93A 2P5KA 4S04A 4XFIA 4UNOA 1FP1D 5JHUA 2DQRA 4GULA 1T6SA 1R1TA 2EV6A 2FBKA 3CEWA 4G7HF 4XF4A 1S6LA 3C7JA 2MH9A 3HYIA 5JCTA 2HWVA 1ZG1A 4D7TA 3I53A 1PM7A 3BDDA 2ESNA 2HQRA 1ZRFA 1F4KA 5H20A 1OYWA 3TKYA 4ETSA 4CXFA 1K79A 4XETA 2E7XA 3H1YA 1YO5C 1BI0A 3BY6A 1HW2A 4ZYHA 1A04A 1SD7A 4N9IA 3GF2A 5FD6A 4PIZA 1MD0A 3VODA 4HX8A 3MZHA 1FZPB 1RIOH 1FBQA 5JR3A 1Z1DA 4U7DA 2K7LA 2Y48A 2K4BA 3GWZA 4KICA 4Q0UA 3ABUA 1DDNA 4YYOA 4E2GA 3DPLC 3RDIA 5I8TA 3BPXA 5A2QZ 4LLNA 4B09A 2ZXJA 2EK5A 4LK1F 1SAXA 1X7NA 1E17A 4LEJA 1O5UA 5E8IA 3C3VA 2Q0AA 2ZFWA 2M87A 2H6BA 3I0TA 2N7GA 2STTA 2HTSA 1K78A 2VOOA 4Q5SF 4HMZA 1XDUA 2XLGA 1R36A 2QZ8A 1R1UA 4Q47A 3ETQA 5EEHA 1G3WA 3T1BA 2GA1A 5CYVA 1P92A 1IN8A 2HJIA 3ELKA 2X0LA 3J80K 4RB3C 2OBPA 1EH7A 5KHIA 5HS8A 2RN7A 4XFCA 2GQQA 2M1BA 2A6HF 1LB2A 2XROA 5CJ9A 2XLFA 1K78B 1B59A 1XSXA 5D4RA 1QY4A 5F64A 1LR5A 3DP7A 3C1DA 1G3YA 2YSRA 5FQ0B 3RKWA 4HAMA 3CJNA 3CL1A 2PAMA 4AIHA 3KEOA 5E18F 1FSEA 1YWKA 3E6BA 2HOEA 4LK0F 3M7GA 4HQMA 4MQ9F 1P4WA 5ICGA 4YFKF 1KGSA 2BNOA 1BM9A 2FMLA 4A0ZA 3G3ZA 4TLFA 2D2WA 3R0JA 3HTUA 1DPUA 4XSZF 3MFKA 1QZZA 3FM5A 3MEXA 1TTYA 4FAGA 1E2XA 4Z2YA 2DQLA 2HGCA 3ZDSA 3IRRA 2V9VA 3M8FA 1WSUA 2HQNA 2QQ9A 3L00A 4BNCA 2A68F 3NKTA 4M9XA 4CDGA 5IT9Z 1ON2A 1GVJA 1USSA 4EJTA 2IPQX 1U6GA 1R7JA 2RDPA 3H1MA 3LZZA 2ZNYA 4JBAA 2UXXA 4BHBA 1TBXA 1FBUA 3JAMZ 2O03A 5D8LB 1BJAA 3PLQA 4I98B 3CDHA 2Y0OA 4QMAA 2AXLA 3FM3A 1Q1HA 1V4RA 3MCZA 4Q0QA 2VOPA 1GQHA 4RD7A 3ZMUA 3E6CC 5FLIA 2J5PA 5JVTA 1XGNA 3F21A 1IN4A 4U0WA 3GZ5A 2Q1ZB 1BOAA 2LF7A 4A5MA 3LAPA 1D8JA 2VPVA 2B9UA 2R7FA 2CWEA 4BIFA 3IC7A 2BGCA 2L01A 1AWCA 1HKTA 5CVUA 4K2EA 3COAC 3CO2A 5BPIA 1ZRRA 1UHMA 2D1VA 2CFXA 2HKXA 2P7VB 3V7RA 1USTA 3LQRA 2ISZA 3DEUA 3I54A 3FHZA 4QXKA 2MLGA 3ECOA 1X82A 2GXGA 5AIPA 4R79A 3NL1A 2JPCA 3V7SA 2FSWA 1CAWB 4FAHA 3RI4A 5I0SA 4EWEA 5KHKA 3Q9SA 2IXKA 5AIQA 4KN4X 4IHSA 3J81Z 3PVBB 5F6FA 2D5HA 3BOQA 2DI3A 1F1ZA 4PJYA 4IETA 2ZNZA 1U5TA 3T8RA 4KWKA 1ZLJA 4KWLA 1NXMA 3EHKA 3SZPA 4KNYA 1ZNPA 3CJXA 3D0JA 3JSPA 3RYKA 5JSRA 1WRJA 2PAEA 5L3EA 2CQKA 4ZYGA 3WTSC 2DTRA 2VC0A 3NW4A 3BCWA 3MWMA 5ILSA 2COMA 3S7IA 2FE3A 3SXWA 1UCRA 2K0GA 3GFLA 4HW0A 2FBIA 4UVCA 4RS8A 2QLZA 2RGVA 4BH9A 5LEJA 1XCVA 3KP3A 1Y9QA 2Y0MA 1QBJA 4MQVA 2HEOA 1DUXC 4MV2A 1TQPA 1YFYA 3KZZA 1MJ9A 2EVXA 2GH2A 4IJAA 3KZYA 2UY8A 2OQRA 3REOA 2LKPA 3G73A 2P5VA 1J2XA 1EP0A 4XFGA 4KT5C 3GUDA 4OIQF 1JUHA 1OI6A 5J8FA 4GXOA 4XFBA 2UWMA 5D4SA 2OZJA 1YS6A 4WCGA 2I45A 4AVAA 4IERA 4HX4A 1ONVA 1QNTA 1ZGJA 1D3YA 2A69F 4IVNA 1UD1A 3N4MA 1ZZCA 4B8XA 4H0EA 4HZFA 3IBMA 2DAOA 4HV5A 1XN7A 1SMTA 2OAZA 2Q4SA 4L18B 3Q9VA 3I64A 1T39A 2H27A 2QVSB 3JSOA 4UVBA 2QJVA 2JSCA 5D5UB 1X8MA 1L0OC 5D1IA 5JFRA 4WBBA 4HVOA 4MUVA 1UW8A 3M1EA 5HS9A 5C6CA 5FGMA 3U11A 1U2WA 4LMYA 1ZZ8A 3MZYA 1U8RA 4KWJA 4XF0A 2DBBA 2HFHA 1ZREA 1MDMB 2IXHA 3ACLA 4KU8A 3TOBA 1BC8C 3GZ6A 3WGIA 4ORFA 4AIKA 2IXIA 4BXUA 2OZUA 3JTGA 4LG0A 1T2KA 3RPQA 1SD4A 5HLHA 2K9ZA 3FXUA 2Z9OA 2PA7A 5E1ZB 2Q30A 5DV5A 4EJVA 4XRFA 4RB1A 1LKNA 1F9NA 3TNPB 2FU4A 4QM9A 1FC3A 3IDBB 4LLLA 2IP2A 4J1XA 3IIAA 2XAHA 3F72A 4EM2A 5J6XA 3KGZA 3ZMZA 3F8BA 4LJZF 3RPUA 4J1WA 1T38A 2OD5A 3LAJA 3LWCA 5CVVA 3HQXA 4UBHA 4YRDA 3T0YA 3E5XA 4BHCA 1S7OA 3JW4A 2JTVA 3J81K 4LULA 5KHJA 2WWYA 4XF1A 4EWDA 4L2NA 4OFGA 4MEYF 1B9MA 1T0FA 3GYDA 4LFUA 3WTVC 5JAXA 5TRDA 3MPBA 1BBYA 1SD6A 1JGSA 3H50A 2PLYA 3PQJA 1Q3EA 5TJJA 2QENA 3IWZA 3LA3A 4YARA 4HDVA 4XLNF 4META 5KBFA 3DL3A 3CUQB 3LWFA 5E1XA 5L3GA 4Q4ZF 2G7UA 3V8KA 1WGPA 4HF2A 2O6GE 3WW2A 2ZCWA 4O9GA 5FFXA 3F8MA 1RNLA 3H9AA 3USSA 1UFMA 4WX9A 1O7FA 2MNGA 1RUOA 3HT1A 3HHHA 1XD7A 3FMSA 1FYKA 2B5HA 4IEPA 2QDRA 5KK1A 3SCFA 4G9YA 3L7WA 5T3NA 4ESFA 3OOPA 4K8FA 3IL2A 1KU3A 2VN2A 4EVIA 4LGWA 2DPUA 5I0UA 5L3DA 2GZWA 3KCCA 4EROA 2PG4A 3DKWA 3ECHA 5K5OA 3LSTA 1EPZA 4XEZA 3R6SA 2XIGA 3NVCA 1NE4A 3K9TA 2W84A 2XKPA 4CO8A 2RKHA 5LGUA 1Y3TA 2BBYA 3IKVA 2Q8KA 1CAUB 1IXCA 4EM1A 2E1CA 3UKNA 5LGNA 2IA2A 1I6XA 2G7HA 3CLOA 5IT3A 2IA1A 1CAWA 3L2HA 3WTZA 1CX4A 5LRSA 2PQQA 3F22A 5BV6A 4UV8A 3D5LA 3ZMSA 1FPQA 1RL3A 3BZ6A 3RTRA 3I58A 4O5VA 1FNNA 4RGUA 5K5RA 2WFPA 2O8XA 1IN6A 3QP6A 1BI3A 5AONA 2QCSB 5J3UA 2HDCA 1AOYA 4GO1A 3EYYA 5J7MA 4HLTA 3FWEA 2VXZA 2ZO4A 1IAWA 3T8TA 4CGZA 2R3SA 2LNBA 1RGSA 3I59A 4Z82A 4ZU5A 2LDUA 3RKXA 1H9GA 3QRFF 1BC7C 4WXDA 3GFMA 3SXYA 1P4AA 3WGHA 2EA7A 1CAVB 4MGZE 1J1LA 3BWGA 2PMUA 3R0AA 2TDXA 4NB5A 2CAVA 2KJBA 4IXAA 4D7SA 3D82A 4AXOA 3HT2A 3SCGA 2QUFA 3KP4A 1RC6A 5HDNA 3GO5A 1SFNA 4IEVA 5EFUA 2XGXA 2K02A 1OFNA 2Q0OA 2EA4A 2PTMA 4Y15A 4CHUA 3V4GA 3OGJA 1U78A 4HOBA 5EZWA 4UUVA 4HX7A 2CSOA 4NQWA 1OKRA 4HSLA 1HXDA 3RJPA 5CVJA 4L5JA 1YLFA 3GFIA 5E8GA 1NYWA 2XAFA 1GXPA 2HR3A 4LUKA 3ZMTA 4IEYA 2DPDA 2MC3A 3M9AA 1QWRA 2A61A 1YIOA 4CZZA 2OYZA 5ICFA 4ENJA 1W7PA 1ZZ9A 5A2QK 5I8SA 1PUEE 1ULYA 1D5VA 1KYZA 1J0RA 3VOEA 5DDGA 1L3LA 1QZYA 2KIFA 3FFQA 1FY7A 2HYFA 1HSTA 2ZKZA 1PDNC 1I27A 4LTAA 4EMSA 4U7BA 2GU9A 3P9IA 4YIIA 2KXLA 3BJAA 3HUGA 5CU1A 3H7JA 2BNNA 4A5NA 2EB7A 1CAUA 1KU9A 2QVOA 3L2CA 3O2PE 2ACJA 3HIFA 3UKTA 2MBFA 2P8TA 3EDPA 4UXNA 4PIYA 4A12A 4ZYDA 2GIVA 3D0SA 3V7CA 1ZZBA 1KYWA 2RVCA 5ERIA 1TLHB 1BIAA 2DK5A 2B0LA 2DT5A 3QACA 3LQQA 3O3KA 4WXHA 3MQ0A 1K7AA 5HVQC 2PHLA 2VODA 1S7AA 5KVRA 4MGRA 4Q48A 1XDSA 4G6QA 4I7HA 1XCBA 3KP2A 2KKOA 2UZKA 2ISYA 5FLXK 2K27A 2ZJ2A 3F8FA 2QQBA 4IEOA 4JVAA 3DPTA 3N97A 3RIRA 5K5QA 4G6DA 2GXBA 4UBGA 1LVAA 4JK1X 4M6YA 2D45A 2UXNA 1ZH5A 2WTEA 4Q0PA 4HLYA 5DCFA 2PQ8A 4L9JA 2F5CA 2XASA 4MEXF 2UYBA 3F8NA 3CLPA 2PYTA 4YFXF 5IT9K 3I7DA 2XL9A 5JI6A 3WTXC 2IC1A 3I5UA 5LHGA 2Z69A 1HW5A 4FHTA 3GYHX 1NE6A 3B02A 4L5IA 5ED4A 1WI9A 4D0PA 3KSCA 3H92A 2IXJA 2VONA 5KHHA 3PQKA 4KIGA 4XF3A 3WGGA 1G4DA 1I1SA 2O8QA 2PFBA 2FNAA 3WE2A 2Z33A 1QGPA 3L09A 5LLQA 3K2ZA 1B4AA 2FBHA 4P96A 1IPJA 3MDPA 1XB4A 1RZ4A 2IJLA 1J9IA 1S3JA 4M6XA 3TQNA 3GEZA 4IEXA 2P6SA 2GA2A 3ML6A 4AVCA 2NAZA 4EV0A 1U3EM 4BHPA 1Q5OA 1S8NA 3GBFA 2YU3A 1R1VA 3K1MA 3P9CA 3FZVA 3GVAA 4OIPF 5FLJA 3PNAA 4WF2A 4FT8A 1O4TA 1ZZ7A 3ZMVA 4A2UA 3HOTA 2Q2EA 2MD5A 4I0AA 2MPFA 5L3FA 1LNWA 4IPAA 2EFPA 5DD4A 1B1BA 4I2OA 3E5QA 2R7DA 3L9FA 1CAVA 2QYOA 4ENNA 3M70A 1CGPA 2FEZA 3OTFA 1J7KA 1Z6TA 5HS7A 5DD8A 1R22A 4MH0E 1QO0D 1IXRC 2XV4S 2RQPA 4LA2A 4P9UA 4ON0A 4O9EA 4X6RB 5D6FA 5FLHA 3SFZA 3VB2A 2OQGA 1BI1A 5BOXA 3Q5FA 1P2FA 2QQAA 2CV6A 4A6EA 1R23A 3VFZA 4MGKE 4JTOA 2VBWA 4YSFA 3SHFA 2WV0A 5EEGA 3GFJA 4WXCA 3ULQB 4ZZDA 3R60A 1SD5A 2FNPA 2ETEA 3WW3A 4XFHA 1XSVA 3KEQA 2HTJA 3ZN0A 3E3VA 1KQ8A 1CF7B 4KN7X 2NNYA 2JPBA 4ZZLA 3ZP5A 2D93A 3W6KB 3EQLF 4XLPF 1R58A 5JSOA 3JZVA 1W7PB 3FHIB 5ICCA 1Z91A 4L0YB 1KU7A 1H1MA 3DV8A 1TW3A 1ZVFA 1ZGAA 1PP8F 3ABTA 3ES1A 4HBLA 3WTUC 4P55A 1TQ5A 2P7CB 1XMKA 4OIOF 1EH6A 4OINF 5J8CA 3K1NA 5FLXZ 5FDBA 4I09A 1FI2A 2K86A 3TDUC 2VT2A 3BPZA 3H1WA 3RYRA 2OA4A 1K6OA 4L11A 1TNSA 4Q0VA 5DEQA 4LB6B 4L9VA 2M30A 1OD5A 2EFWA 1UB9A 2F2EA 3KGLA 2DCTA 2EFQA 2L54A 1HSJA 3U2RA 2YX4A 4UV9A 5FFZA 4F8AA 4HVQA 5FB2A 1CAXB 1LDDA 4OMZA 1J59A 3CO7C 1T98A 2OU2A 3BROA 2VE8A 1SMYF 4AD9A 5CADA 4L9NA 2QBYB 1FYLA 2DO7A 1G3SA 2CW0F 1STZA 1ZRDA 1L3JA 3RZZA 1BIBA 1HW1A 2L4MA 3QPHA 3CUQA 4OU0A 5BPXA 3R61A 1IRGA 4ZU4A 2BNMA 2VBZA 3SMHA 2OA2A 5E1WA 4F7ZA 1VR3A 1XE8A 3E6MA 1RI7A 3C18A 4Y13A 3U1DA 4KUMA 4PGGA 3RKYA 3WU0A 1BN5A 1LDKB 2D40A 4AQ2A 3SCHA 5E17F 3KETA 1ODDA 3NSTA 5D5VB 1V3FA 3B73A 3WU1B 1HBXG 1YW7A 2P6TA 2EFNA 1OYYA 5BY5A 3WW4A 3S0MA 4FX4A 2P17A 3U9GA 1Q43A 1W7PD 4BAYA 1KQ0A 2H0VA 2M45A 2V6CA 3MYXA 2VECA 3LA7A 2RNJA 3U0ZA 4ESBA 4KU7A 5HLGA 2CG4A 1DZRA 1KU2A 4OOIA 1MJAA 1S29A 4AVPA 2F4PA 2PN6A 3V8LA 4WVZA 1D8KA 5I0TA 1QXJA 4BYYA 2ZBKA 4GYIA 2HKOA 1DGWA 3ZMDA 3WG9A 2UY9A 5JR7B 3AAFA 1XGSA 4M73A 1VTNC 4IRIA 4JQFA 4EGYA 4FX0A 4IEQA 4IHTA 5D5WB 1J58A 2V1UA 4Y17A 2FF4A 2JRTA 3EETA 1W4MA 3CTAA 3HRUA 3I71A 2K4JA 1IF1A 5BXXA 2C0ZA 1J5YA 4HN1A 4HN0A 3BPVA 5I91A 2D5FA 2XVCA 2F5DA 3JTHA 4HBNA 1LQ1A 1KQ9A 3WW1A 2XUBA 3E6DA 2P5LC 6PAXA 4IESA 4RGSA 1MZBA 1DZTA 5BMZA 5D5XB 1YW9A 4RB0A 1HQCA 2GC2A 1ON1A 5FD5A 5DYMA 3NRVA 4LA3A 4OLLA 1O3TA 1XGOA 2M5WA 1SFUA 2W85A 1REPC 2RC4A 1Z9CA 1SEFA 1JHHA 2FOKA 2V09A 5AVPA 5CLSA 1YYVA 2VBXA 3FMQA 4IEWA 3WE3A 1VJ2A 5BPDA 3CUOA 1CAXA 4GCVA 3ZQ7A 2NNNA 3FJSA 2QBYA 4PCQA 1ZN2A 2JT1A 4MHGA 1IPKA 3GX4X 2L3DA 1J3PA 5DCMA 1LDJA 4I01A 3F3XA 2YR2A 4HSJA 4LG0B 3O6BB 1W5SA 2EAAA 2AS5F 1PMIA 4UHTA 2Z99A 1EYBA 3TGNA 2O1QA 3H7YA 4G8XA 3T5XA 1MDMA 5FQ0A 3UKVA 2PHDA 3HOSA 3OV8A 3SHRA 4WWCA 4PZJA 5HDGA 2RV8A 3NEUA 1DGRA 2ESHA 4H7LA 2V1DA 4IRGA 2P4WA 2EV0A 2BYVE 2D1HA 3KLOA 5FCCA 2EWNA 2VT3A 3VEPA 2QM3A 2FQ3A 1ZRCA 3F23A 3QU6A 5FO5A 1YTYA 4E70A 3SQNA 2GC3A 3LFKA 4OMYA 4XF9A 4N9HA 2XKOA 3S2WA 1TNTA 3RYPA 4JV4A 2LF8A 5HI0A 2PFWA 5H6QA 1IW7F 1YFUA 2LSOA 1GQGA 3K69A 3IKTA 2W57A 1JXSA 4WZCA 2FA5A 1X8EA 1MGTA 2H94A 3BB6A 1WQ2A 3NJZA 4AVBA 1ZX5A 2ET1A 2EA2A 4CYDA 2HYGD
chains in the Genus database with same CATH superfamily
4XAAA 2CYYA 2XSDC 3AMNA 2E1NA 1KFXL 2VBYA 1ETOA 3ZIWA 2KIMA 4YVSA 3CKHA 2HBUA 2RS32 4XQ4A 4DUWA 1KS4A 3LPFA 1EUTA 2E51A 4IDZA 1OC1A 2MHFA 2R5YB 4KA4A 2IEKA 2FQPA 2JWPA 3ZPLA 3KP5A 1ODNA 1DU0A 2XPWA 3I2DA 3AB0A 1O8SA 2MD0A 4HA8A 4P9FA 4EATA 3GHNA 2HWE1 4AQ6A 2DDUA 3QODA 3FMRA 1V55H 3GALA 4CCOA 3VHRA 3GBGA 4N90A 5I0RA 3U14A 4QWQA 4LD5A 2M8EA 3NJXA 1TT5B 2JQ7A 5E1RA 3K46A 5BQTA 1MS4A 2XLAA 5AC92 2A3SA 2VUMJ 5FFOC 3NMBA 5KXCA 2Y0IA 2E7WA 1UZWA 1TVGA 3MIEA 5A3PA 2L02A 3HHGA 4A6OA 3HEFA 4OHXA 1AYM1 4MGSA 5BNPB 1Y0UA 5T50A 2Z79A 1W03A 2DOFA 1QXRA 1WBLA 3AM2A 4OMDA 1IZ1A 4M72A 1O7LA 3CUQC 1EV13 4R8HA 4JGYC 3DF8A 1H0MA 4YIFA 2FD8A 4B47A 1JODA 1O4YA 4V2WA 1FT9A 4DW6A 4R52A 2ME0A 5T5JA 1GXQA 2P3JA 3CCUI 2OTLI 5FKOA 2DFFA 1ULPA 4ASNA 4M9ZA 5FWEA 2NRAC 4L0PA 5DCMB 3M1CA 3QH7A 4XFFA 4JTNA 1R093 2CL2A 3DN7A 2ZAHA 2K46A 2LW8A 5D6EA 1KS5A 4BLIA 3S5QA 1JT0A 1OF3A 4MHRA 5DUIA 2YC2A 1LOAA 5A33B 1A31A 2CMPA 3UESA 3M2MA 4MO3M 3PUSA 2KMUA 5L19A 1W06A 5DM7F 2Z3YA 1JZ5A 3POWA 1R00A 4FOWA 5IVEA 3WVJA 1YS7A 4KIFA 3VYUB 2XUMA 3MBWA 4OHYA 2VBPA 1QQIA 4CZCA 4FPEA 1O5LA 3WR0A 2OVUA 2O0YA 3JR9A 4L92A 5EQUA 4ZU7A 1UHWA 4KMFA 1YRNB 3DXUA 1OBNA 2VNVA 2IVJA 3MAJA 4Q29A 2IFWA 2WNUC 3H8RA 4AI1A 1VQ5I 4C1XA 3QOPA 4YWAA 2PEXA 2XRNA 1G6NA 3ALQA 3RWNA 3B69A 2RMU1 2VC9A 3IKWA 3V64A 1PK6C 1DQ5A 1UX6A 1JYVA 5JPMB 1TZLA 4ONUA 3QAHA 1U12A 1ZHFA 3F6OA 3ZFFB 2WZPP 5M3MJ 3TRSB 2XL7A 3M1HA 5JXHA 1WWXA 3I4PA 3KMHA 3X2QH 4LXLA 4NRPA 4RGRA 2C6YA 1V9U1 3TEYA 4YZ1A 2FRHA 1AR93 1LU2A 3THDA 3A23A 2XF6A 3FHAA 3ZYJB 4UFIA 2H8WA 1E5IA 1MS9A 3SEPA 4B29A 4XDQA 3BTZA 2DA6A 3JRGA 4KGQA 4NRQA 3RNSA 3VDXA 3UGGA 2A6WA 1J3RA 4LUMA 1XE7A 4HNVA 4M9SA 1T95A 2GC1A 5FZDA 3LKJA 2XAJA 4XBFA 2LRPA 5IY5H 1ZBA1 4EQQA 3BALA 1Z78A 3NNLA 1ZLKA 4XUOA 2EFOA 3S1QJ 5ANQA 3ZYGA 3PUHA 3FLRA 2CDOA 2F5VA 1VP6A 4P9GA 4NWVA 2WABA 1MMDA 3KFWX 3HOXJ 1Y43B 4ET7A 2GNTA 2X1DA 1FOKA 4UFHA 1EAH2 4S05A 2O8KA 4FPGA 1DP7P 3EUAA 1G9CA 4AF9A 5L9BA 5LBQA 1SFPA 1LEBA 2Y69H 2YY1A 1HKSA 2E60A 4NHLA 1YEWA 4PGHA 2K85A 1WCMJ 4WK8F 4A6DA 3VKOA 1MW7A 1JE8A 2NOJB 2NQYA 1H8AC 2JJ7A 1OQ1A 4CYCB 2P5BA 2Q1FA 2CFOA 4KNCA 1WKMA 3KHBA 1H0BA 4HKWA 3GCXA 4AYBN 1ZGWA 5IOZA 3K70D 3G1OA 1TMF3 2R071 4UFMA 2LUWA 1G9DA 1Y8RB 4NHJA 2J1TA 4IV3A 4ZS3A 2FZ2A 1IUYA 3MF9A 1YFXA 4GWMA 2GN7A 4RM2A 2RJKA 1MBHA 2IRFG 4KMUX 3WUDA 5BNNB 1OVPA 2J1RA 5LEKA 4GZ9A 3WNXA 1UCXA 1LEAA 2WBKA 4A3KJ 3RQ0A 2ORZA 1PVC1 1Z7UA 1OMIA 1CF7A 4E2SA 2M3AA 4EJWA 3TAYA 4HLXA 3H3UA 3WEZA 1ZBE2 2M8GX 4P5OA 4ZYEA 4LBQD 3IH2A 2YU2A 3TEZA 4BQWA 2Z2SB 3SZTA 2NOGA 1FBSA 3S2DJ 2FD5A 2ZGNA 4CDQA 1WLTA 3J4UH 2C4XA 3DXJF 2HVQA 2RDQA 4RB2C 3NAPC 1PK6B 1B8IA 1QOSA 2QNKA 1B9NA 4EEFG 3GXOA 1N75A 1YUDA 1EV11 3GW2A 1W6PB 1UMHA 5C4WC 4P9XA 3WY6A 4P9YA 1XB9A 3VDDC 3ELNA 3V0AA 1BK0A 4PJMA 2M7BA 1W8TA 3GTGJ 4I02A 4UVAA 2ARXA 2FMDA 4YZ4A 2WAQA 3VBFA 3BJ6A 5JOWA 1UG2A 4Y33A 3FDYA 1W0OA 5IVVA 2DW4A 1JN2P 3WTTC 5A3NA 5J09A 5FZBA 2JA2A 4QGMA 2BUKA 4XOPA 2HWB3 2PHFA 4B3XA 4SLIA 3O1RA 3ESWB 2GM4A 4HF1A 4NVPA 3UYJA 1S0EA 1W2AX 3MI8A 1PZ9A 3JAMK 1DLCA 4RGGA 3BU7A 3SJMA 2PN5A 1Q56A 2LKXA 2VE9A 1HIXA 4NNJA 1U5YA 3TO7A 3VD7A 1BMV2 3GZUC 3CF6E 3UETA 2QQ8A 4NJ4A 1WH5A 4S04A 1RUH3 2QF7A 4MLOA 1CONA 4ASMB 5J98B 1RUE2 2JG9C 4IE0A 2VKHA 5E3NA 2EV6A 3CEWA 3PJYA 3DCQA 3HYIA 5JCTA 2HWVA 5EDNA 5TGTA 3S17J 1E3OC 1V6KA 3PMSA 1IJWC 2IS4A 1ST8A 1RUD1 3HOYJ 2E7XA 2ZTNA 3H1YA 2DU1A 4A3EJ 2X1EA 1LEMA 1C4RA 2HEYF 2JDKA 4ZYHA 4QIWN 3D1NI 4CRQA 3R0RA 2WADA 4YLZA 2NM1A 1FZPB 1HN1A 1RIOH 4Y5SA 2RDNA 5JR3A 4C2TA 1OLME 1GZWB 3L9JT 1D7PM 3ABUA 3DPLC 2HWF1 5A2QZ 4QB2A 1SVLA 2EK5A 4CA9A 1E17A 2BW8A 3KD4A 2M87A 3OSFA 2N7GA 4FXKB 2X6XA 2BVMA 3OS0A 1K78A 2YROA 4HMZA 5FXWA 3K2OA 1XDUA 2RR13 1JXNA 2OXBA 2CDPA 5TSWA 2KL4A 3UNGC 2X0LA 3J80K 1G7YA 2OBPA 2ZC2A 2A73B 1EH7A 3RVHA 5HS8A 2J1UA 2E71A 3ZXGA 2XROA 1APLC 2WFF2 5HBAA 4B44A 1VBE3 1G3YA 1NY72 3VZJA 3VBHA 1XYOA 1QKQA 3CL1A 2PAMA 2SBAA 1FSEA 1MIJA 2HOEA 3M7GA 1KGSA 2FMLA 4KBBA 4M0NA 3JRDA 1U5XA 4A0ZA 3G3ZA 3JD73 2ZMNA 2YHJA 3HTUA 1VQ9I 3MFKA 4A7KA 4FAGA 4A3ZA 1E2XA 1W8OA 2DQLA 2HGCA 1RETA 3O8GA 1R6RA 3MMYB 1HXS1 1WSUA 5F8PA 3L00A 4BNCA 2A68F 2QQOA 4CDGA 5IT9Z 4XLFA 1U6GA 2ZGMA 1L7QA 4Q4X1 1TBXA 1W0UA 1BJAA 1KD7A 1HRV2 1FV3A 3N9OA 4WVMB 1FIPA 1Y1WJ 1GQHA 3ZYRA 4RD7A 1IDZA 5FLIA 4Z8BA 2Y6JA 1XGNA 3F21A 5F9TA 3GJAA 1OJLA 5LFAA 2Q1ZB 2E7TA 1YXWA 3KV9A 3D5RC 1RUC2 4BE2A 2R7FA 2CWEA 2ZA9A 3KV4A 3VL9A 3IC7A 3I49A 1OCOH 1AWCA 1HKTA 5CVUA 5BPIA 2CFXA 3AL6A 4XJAA 3O1VA 3V7RA 1OQEA 3KQ4B 4QAWA 3FHZA 4QXKA 1HV0A 1R082 3NL1A 4FQZA 1CAWB 2FSWA 2AEZA 1WD4A 3IPVB 3K6GA 3IN9A 5KHKA 3SZGA 2IXKA 1VQ4I 4KN4X 4IHSA 3J81Z 3AP6A 2R7WA 5F6FA 3K10A 5F27A 3ZQHA 3HGYA 1X19A 3TW6A 2CGOA 4YG6A 1F1ZA 4PJYA 4IETA 3MHZA 3T8RA 4KWKA 2DUQA 3GTPJ 2AREA 4O61A 3NJVA 1ZLJA 2VB6A 1NXMA 4X0GA 3ZSJA 5DUVA 2B9SA 2Z42A 3RYKA 2EALA 5JSRA 3JBG2 5A3TA 2DTRA 1XSRA 1IS6A 3CBNA 5FY0A 3SXWA 2K0GA 4HW0A 2FBIA 4UVCA 2PLV3 2RGVA 3RJ2X 1XCVA 5E3MA 5EPAA 4GMP1 1DUXC 3AC0A 4CDXA 3FXMA 4MV2A 3CJQB 4QKBA 3OYWB 4B4CA 3I8TA 2OQRA 3REOA 2LKPA 5KAFC 1P9QC 3DBRB 2P5VA 2LOOA 2B4KA 1WHUA 2JECA 1DYOA 1EP0A 4XABA 4KT5C 5EJZB 2W00A 2K9NA 5J8FA 4XFBA 1D4M1 1UELB 2L9LA 2YUSA 1W6OB 4E6KG 4XE9A 4AU7A 2JRMA 3I9V2 4IERA 1MMSA 3AZYA 1D3YA 1B72B 1SFKA 3R4UA 4B8XA 2VI6A 5HV4A 1ENHA 1XN7A 4BQQA 1PZ8A 2DODA 1OOPC 1UY1A 4LE4A 4L18B 3Q9VA 1T39A 1ENXA 4ZYAA 2QVSB 4OYUA 2JSCA 5D5UB 2D7FA 3N9PA 1E3PA 2EXIA 1L0OC 4PUSA 3VKFC 4WBBA 3HUGB 4QPIA 4JX0A 2K2SA 3S1MJ 3ZYFA 2OX0A 1LAJA 5FGMA 1Z0HA 1DQ6A 4LMYA 4XF0A 2HFHA 3CF2A 3WGIA 3GZ6A 4ORFA 5CQGA 4R4XA 5FP8A 2ID6A 4WVVA 4IHXA 3VBFC 4LG0A 2VD7A 3H5RA 1T2KA 4XUNA 3LD8A 4COVA 3JREA 3OS2A 2K9ZA 1XNDA 2PA7A 5A32B 2DT6A 1QNYA 5DV5A 4QPGC 2PMWB 1N1YA 2VLAA 1W9YA 1LKNA 3HJEA 1DCSA 2FU4A 4QM9A 2YU9J 1FC3A 4R4ZA 4EN0A 5J1XA 3H8XA 1K5MB 1PNFA 4J1XA 3T2PA 2TUNA 2XAHA 3B94A 1XX5A 2DA3A 4EM2A 5J6XA 2VJ4A 1S0JA 4LJZF 3RPUA 3FL7A 1T38A 2VZQA 4M3EA 3HQXA 4COUA 2LTPA 1EAH1 3S93A 4HNUA 4XLEA 4P00B 1S7OA 4N4OB 2JTVA 1X1DA 4XF1A 3EXUA 5C7GA 4EWDA 1LKXA 4OFGA 2L7KA 3GYDA 3OGGA 4LFUA 4CEYA 2LVSA 5TRDA 3HR9A 3MPBA 1SD6A 5FYUA 4YELA 1JGSA 2PLYA 3PQJA 5GAGJ 4YFZA 3BKZA 5TJJA 3LA3A 4XLNF 5E1XA 3LWFA 2XPUA 4YGEA 2V9PA 3OYMA 4NHMA 5EHDA 3WW2A 1HLCA 4A7ZA 3WHBA 2C1FA 4KITB 2PQSA 1UWWA 4PQ9A 2MNGA 3HT1A 3FMSA 2VZ1A 3P1IA 1X4OA 4BQ1A 3L7WA 2CV0A 3T08A 3IL2A 1Z77A 4ISQA 3I3EA 3PFYA 2OQ6A 3NJYA 1BA5A 4K20A 1LTEA 4EROA 3NWTA 3VBRB 1LJ7A 4ATEA 5FMDA 3LSTA 3R6SA 4OHZA 1UX7A 3K9TA 4DY5A 2ILMA 3MIGA 2ZXQA 2Q8KA 3MLJA 4EM1A 2E1CA 1HDPA 1JW6A 3DBHB 3C7OA 1GZCA 4BQXA 5IT3A 4M4PA 3KT4A 3T1MA 5BV6A 3H3VK 4UV8A 3BZKA 3ZMSA 1NKGA 1W8NA 2KQRA 3THCA 4E27A 3CU7A 3CIHA 1IOAA 5K5RA 2WFPA 1WVRA 2O8XA 2LM3A 2FJ1A 5AONA 2QCSB 3A7QA 5J3UA 4BIOA 5F3IA 1KONA 4AAXA 5J7MA 3GHMA 3MPPG 2NP0A 1IAWA 3T8TA 1POV0 3LE0A 3FC0A 4QQOA 4ZU5A 3S14J 2ECBA 3RKXA 2XC7A 3ONQA 3QRFF 2CUJA 2EXKA 2H1KA 4R9CA 4D7YA 3SXYA 3WGHA 3A0NA 2EA7A 1F35A 1SLTA 4MGZE 3SEQA 4IGQA 4Q4Y1 3R0AA 2CAVA 3C7GA 1VB2A 2VGDA 2YPDA 2DTYA 2PHRA 2V1NA 1QEXA 3ZFEB 2QQVA 1PVC2 1SFNA 4IEVA 3PVNA 4ANJA 1OFNA 1QJY3 3SLIA 2E53A 3PUIA 4PSXA 5EZWA 4UUVA 1I5PA 3BPSA 4HKOA 1NXD1 4GB31 3HQRA 3ZIXA 1OUXA 3RJPA 4C3IJ 5CVJA 4L5JA 5EYRA 4GWIA 4C0BA 4ASLA 3GFIA 2BW3B 5E8GA 2HR3A 2FDJA 3ZMTA 3HPNA 3AL0C 3ZXEA 4V1PA 2A61A 5F7UA 4CZZA 5A2QK 1QJU2 2PHWA 1PUEE 1D5VA 1Z7S2 2WZ8A 1X9TA 4Y3OA 3SDBA 2Y9ZA 2MEV3 4MFEA 1R1A1 3BG9A 4LBNA 4GH4A 2R92J 1NA1C 1XMXA 5IYCJ 3P9IA 2VZPA 3BJAA 1TME3 4YM2A 5CU1A 4NPRA 1AR62 3BCAA 2A7AA 4Y1UA 1DLLA 3ABLH 4Y4RA 5C3EJ 4SBVA 3O7OA 2BXYA 5M3FJ 2D6PA 3IM0A 2MBFA 1LFBA 4UXNA 3M3EA 3FUOA 3K75B 4Q4W3 3DECA 2Y6KA 5ERIA 1TLHB 3KYCB 2DT5A 5FYYA 2J42A 1WD3A 3ZQIA 3LQQA 1PM4A 2Y6LA 1K7AA 2J1EA 2VODA 3IAQA 4NAOA 2BFUL 3I4MJ 1GQPA 1S7AA 5APAA 2CNAA 2RDSA 4I7HA 4M3CB 3WUCA 1Y39A 2ISYA 5K4LA 2K27A 4IEOA 1UZZA 3DPTA 4DUVA 4D7MA 2AQFA 2Q8OA 1W2NA 4W6WA 1OCPA 3NWSA 4L99A 4JP0A 5A7WB 2WL1A 1FNZA 2QEXI 2F5CA 1QA6A 4W6YA 1EPWA 4MEXF 2UYBA 3CLPA 2XUEA 2BBAA 2GMPA 3OOUA 3JQWA 4IKFA 5LHGA 4JDMA 1HW5A 2VCAA 3GYHX 4AI0A 2YXSA 3ZFFA 2KZVA 2IS1A 5JZGB 3A21A 3H92A 4CDUB 3BLYA 3WGGA 1UG0A 4UUSB 4A41A 1US3A 3PHMA 3IZOA 1YQ8A 3AMQA 4D7NA 4B3NA 1QGPA 2FUG2 2FBHA 4P96A 4GALA 5IW0A 1S3JA 3DYOA 4HNTA 1W0TA 2LBFA 3JCUC 3PVEA 3WQ7A 1QHDA 1QVTA 2YU3A 3K1MA 5FIXA 3FZVA 5FLJA 1JHNA 2VH9A 4QB6A 4FE4A 4X1EA 1ZZ7A 4CUAA 4XZUG 3K3OA 3CJRB 2VKDA 1LNWA 3RQIA 1LGBA 5DAVA 2EFPA 5DD4A 2VY0A 1CIYA 1TP4A 3OL3A 4CU9A 2FEZA 4A3BJ 2XJQA 2YV8A 4UF0B 4URTA 4LLFA 2R7SA 4DOZA 2M4GA 4JGZC 4K6BA 5J3LA 1WCDJ 3W2WA 1U9OA 3Q5FA 2QQAA 1D0XA 4RS5B 1R23A 4MGKE 2VMGA 3SHFA 3P6BA 5EEGA 3GFJA 4WXCA 1YJNI 4P5HA 5FKMA 3BTXA 2FNPA 4DB5A 5LZ6A 3WW3A 4XFHA 1XSVA 3ZN0A 4AW7A 4S2HA 4XILA 1Q8PA 4M3CA 2IS6A 2PLV2 3H3LA 4ZZLA 3OG2A 3SFIA 4Q4V3 3VKLA 1OT5A 5T5LA 1QVUA 2DVFA 1W7PB 2HOSA 1Z91A 2W1SA 4B4RA 1TW3A 5F32A 1S0BA 1ZGAA 2V72A 4F92B 3ZQLA 3WTUC 1MS3A 1XMKA 3BN6A 2JUCA 4OIOF 4DO0A 2ZS6B 3K1NA 5FLXZ 5FDBA 2ZX0A 1RHI3 2K86A 1P7JA 5F1JA 2Y6GA 3TDUC 2VUCA 5JZGA 4PI0A 2W3JA 3ZSKA 5DEQA 4NPMA 3HM5A 4LB6B 1V0AA 2RR12 2M30A 5SV5A 5DM6F 1V54H 1HXS3 3K4ZA 3KGLA 3LCPA 2VTXJ 4QQLA 1OA3A 1UHSA 3NNFA 4DYCA 2X5IA 2UUZA 2WSUA 4HVQA 4HT1T 1QOTA 1SMYF 2HI3A 1B35C 5CADA 4L9NA 1BBT2 3JXSA 1L3JA 1N3QA 5J1YA 1BIBA 5K7ZA 1HW1A 3CUQA 5BPXA 3TN91 3K4AA 4ZU4A 1MBEA 3SMHA 2OA2A 4F7ZA 1VR3A 2NN8A 4Y13A 4DBQA 2JUGA 3U1DA 1UYZA 4KUMA 1KDKA 5C5UA 3BI3A 1RIRA 1GU3A 3S15J 4AEJA 1BN5A 3D3AA 2BWAA 2D40A 4TTGA 3SQOA 1AX2A 3KETA 4FOYA 3AP4A 1R71A 3NSTA 4Q2FA 3APBA 2LMDA 1YW7A 2E5NA 2EFNA 5BY5A 3BTAA 3LSIA 2D6NA 4FX4A 2BY2A 4DFSA 3ZMOA 1S0CA 3BG6A 5IOYA 1Q43A 2K3FA 3FIWA 3MYXA 5G05L 3WDWA 2C9AA 2RNJA 5FPLA 4ESBA 4KU7A 1GR3A 4BQ5A 1CESA 2XJRA 1KU2A 2ME6A 1OH4A 4N7IA 1W36C 1TNRA 3LIHA 1S29A 2XR4A 4AVPA 2F4PA 5H9RA 4YW2A 1Y9GA 2KM2A 1IG0A 2DXIA 2ZBKA 3WOGA 4AI8A 3NWKA 5GALA 4FPOB 2WN3A 4OWRB 5J96B 3AAFA 4HPQA 4Y1VA 4IEQA 2PJRA 5D5WB 1J58A 2V1UA 3AKSA 4CEWA 2DDBA 4W65A 2JRTA 5IATA 1W4MA 2DTZA 3ZSLA 4B3AA 1XS9A 5EG0B 1QIQA 2XVCA 2F5DA 3ZLIA 5EZHA 2Q8CA 5B4NA 5FZ9A 1HRV1 2CRGA 2IUWA 4OI2A 2YU1A 1HCRA 1R1ZA 4H2AA 3ZFGB 2X51A 3VYRB 4HEA2 2FDIA 1SLBA 3I3LA 3VD3A 3GXUA 4LA3A 2ZGPA 3VZMA 5JWPA 3NV3A 1XGOA 1SFUA 4E7JA 1T08B 4AC0A 4W8JA 2V09A 3IDEA 4IX7A 3WP3A 2VBXA 3FMQA 2MW8A 1ERDA 1CAXA 2DA4A 1OISA 1XYNA 3FJSA 2QBYA 1ZN2A 4J19A 3DKYA 1IPKA 3NAPB 4Y5TA 2DT7B 1J3PA 5DCMA 4L5EA 2V26A 2D43A 3F3XA 3TMOA 4G4FA 3LFUA 1J1TA 2JDYA 2EAAA 2AS5F 2Z99A 3M3CA 3TGNA 5EYXA 3I4NJ 3H7YA 1NY71 1H8TB 1RUE3 5FJKA 1A6QA 1PZ7A 2PHDA 2ZSIB 1QU3A 2RV8A 5BNNA 1H8VA 3OBZA 2BYVE 3KLOA 2B63J 2YUEA 1FEXA 1UAIA 3U37A 1K6YA 1AR82 4PBOA 4XQFA 3ORJA 4EN9B 2Y64A 2FDKA 1VQLI 3BTCA 3S2WA 4JV4A 4AE2A 3CCVI 1PVC3 1JXSA 1DIWA 1VBB3 3O12A 3GJBA 4Y1ZA 3BB6A 4Q27A 1VBA2 2DJNA 4CDQC 5DAXA 2VL4A 2Q8EA 4FCYA 1AXKA 1ZX5A 2V7FA 4NHXA 1LOEA 1X33A 2A6YA 3J7YJ 4HVRA 2O7OA 3VBFB 3CDLA 3DQVC 2KISA 5K8SA 2GAUA 5F0CA 1Q8OA 4E7KA 4K21A 3H3ZA 2DF7A 4XJZA 1VMJA 2I07B 5T54A 1ULDA 2XJSA 3MKLA 1O3SA 2D6LX 4NPLA 5K7FA 5IFTA 5FY4A 3EO6A 2BY0A 2WO1A 3SH5A 2VW2A 1Z6RA 3QLQA 3VGIA 2VKVA 5DUKA 1PGW2 4AEDC 3C2GA 4BDYA 1N3OA 2NS7A 1RMU2 1S2KA 3B6CA 4V2VA 3WCSA 3WX5A 5F37A 1BVP1 2X6YA 2Z16A 1IRFA 4QGNA 4QX5A 2BGOA 3EBRA 4XTMA 1MR5A 4Y20B 4PLNA 4FISA 2OIIA 3BZCA 4MX3A 4EN6B 5FXXA 1MKMA 1MS8A 2WLPA 4RAZA 2EICA 1R4NB 4PDWB 2WA4A 1RRJA 4UUTA 1IS3A 1JGGA 3FXJA 2QGUA 2CYFA 2BV6A 1ZBA3 4RAYA 3C2BA 1OPCA 3FE5A 4B7KA 3POEA 3WG1A 5BS6A 2ET7A 3PDQA 1FMD2 4K1YA 1UYXA 1FOWA 5LY2A 1W8HA 1ZYRF 3K3NA 1C8M2 2KRCA 4CDXC 2DA5A 3EUHA 2P37A 1YQAA 1C8NA 4JHZA 4HF0A 4DXTA 2J5OA 4M6VA 1WJDA 4E4SA 4XR6A 5DAPA 2Y75A 1ZG5A 2JD4A 4ABZA 3CJIC 4BQ3A 2YX7A 5CFDA 4BE0A 5KNLA 3WQ1A 3FX3A 5K0UC 2GDFA 4DUXA 1RUNA 1F5TA 2VUAA 3GGLA 5F5AA 4W4ZA 5ICEA 5FZ4A 5LA9A 5F3EA 4XJ9A 1BKZA 4A3FJ 1IRZA 5H6RA 2BZDA 1LJ9A 3LOIA 1J75A 2RMU3 1JOJA 4JYKA 2PJPA 1VQOI 3CZUA 3HRMA 2NS0A 3OF1A 3VBRC 4NC8A 1WUVA 3OYWA 2LKSA 4KDPA 4Q0SA 4CEYB 3T2QA 4ENMA 5L3CA 2ATFA 1FLIA 4IEJA 3JRAA 4AVVA 5GLVA 2G9WA 2JE9A 1D2SA 2B7EA 2VVFA 3BQZA 2IXLA 1XOYA 3MKWB 1B72A 3HL2A 1PGL1 2Q8DA 1AU7A 1JJ6C 1SPPB 4U0YA 3WHTA 4AWXB 3O14A 1HOMA 2QZ2A 3DXTA 3OYKA 4YVWC 5A1AA 3NQOA 1OLRA 1RYYA 4QGLA 2QZ3A 4E4ZA 2WQ4A 2XAQA 2R7ZJ 3WTWC 2OZ6A 2HS5A 4XMAA 3BTIA 4A0YA 5JOYA 5I8YA 1N1SA 4YFNF 3CD6I 3Q8CA 2PI0A 1ND2B 1W36D 1R091 2W47A 2LR8A 1VBB1 4DGWB 2R063 4L97A 4BQAA 2GC0A 3AMHA 2VZTA 2ERFA 2YGMA 1PHMA 2DCEA 3IRQA 1S72I 4E2QA 1SFEA 1CQ9A 2DWRA 3T09A 3ZXFA 3VZOA 4XURA 3QOEA 5JVVA 2ELKA 4XBNA 3T2OA 4BKXA 1JHFA 5ILUA 5HOOA 4YRVA 2ZMEA 4MGYE 4GRIA 2Z5WA 5AC91 2M4KA 2ZMLA 4ZPIA 1W5CC 5GJ6A 1NCRB 3B9IA 5DZFA 4N0BA 3OSGA 2A5YB 4F55A 2CO5A 2KIUA 2VCBA 4FPCA 3KQRA 4BWOA 4I0WB 3NQHA 4BQOA 1ASJ3 5C8WA 5GKAC 5M5XJ 1I3AA 2JZYA 3KWVA 3H9GA 4AIJA 1AYM3 1T2XA 4DNCA 1I1GA 5FP4A 5M5YJ 1Z05A 4Y5Z0 3PTRB 1CQTA 3KLNA 3JRIA 2XPVA 3SKVA 3IPVA 3BP8A 2ZBJA 1OH3A 3MVPA 2W25A 4DINB 1YG2A 3ES4A 3UL2A 3KP7A 3ASIA 3IWFA 3ON7A 1FSHA 5ACA2 4I30A 2JG9B 3I59B 5K1YA 3FXQA 4LK7A 1QQP1 1LOBA 3K0LA 4BS9A 1HV1A 2B8MA 2NMOA 3ZO0B 3TBDA 4XDPA 4Z6YA 4PT6A 2IXSA 1REEA 2RG4A 4TV7A 1U5TC 2HWE3 4I3PA 3LEKA 4FSJA 3BR2A 5DG2A 4RFT0 2EJRA 1JUMA 2Z4FA 5FJ8J 4LT5A 3FXRA 3J7AY 1LGNA 5C3QA 3BG5A 4AG4A 2JVHA 1MEC1 1OR7A 3OYAA 1IN5A 2XPJA 2YPRA 3IP4B 3FXLA 3K1PA 3WINE 4XSXF 1YC61 4MG2A 1TG7A 2EIEA 1VBD2 1V6LA 4FPYA 1ZARA 2M0CA 1WMDA 4FBFA 1PVXA 2JG8A 3PUAA 1J3QA 1R5GA 1A36A 2R1BA 2JJ6A 3O8HA 2QUOA 2X5IB 3I97A 3PFIA 2AO9A 4C91A 5JMCA 3ST7A 4NWWA 3VDCA 5HODA 5FUIA 3UNPA 4M3BA 3KM5A 5BUVA 4M3FA 3WNPA 5FPXA 2STWA 4U0VA 1GV5A 1H1IA 1AVBA 4XKWA 2ETHA 5A80A 1QHHD 4FTHA 1JTZX 2WQ8A 2IT0A 4XJUA 3U4SA 4LLGF 2ZX1A 1FYMA 3ME2A 3CCJI 2VC1A 1P4XA 3V8JA 3PNTA 1SAUA 1GUIA 3ZXLA 4AYUA 5F5IA 4OUSA 3PIGA 5HLIA 1FOYA 3P5BA 2OUJA 1TME2 2EH3A 3VZNA 3FF5A 2Y6HA 1TWFJ 5IVJA 4MNUA 4YG2F 1QJX2 2JE7A 3CCLI 1SACA 2ADUA 1UIJA 3ZFFC 3HRSA 4IQ4A 1O4ZA 4MZUA 4M74A 4MTEA 4QPQA 1U5TB 2JA6J 3DPRB 1X3WB 5KC5A 4A6SA 2QQWA 1FPN3 4NR1A 1L7LA 1PYVA 1FX5A 3Q3SA 2HNHA 3S3MA 1I3QJ 2AEYA 2G1MA 3ZN4A 4FI9A 4RLQA 5IHRA 4F52A 4U2AA 2XWBB 1UXZA 5IAVA 3UK9A 1UIKA 2IBDA 1G9BA 5FXVA 2QFEA 5GLWA 2L2OA 2DA1A 5T52A 2R041 1HJGA 3AZWA 3LA2A 2HZTA 4IRHA 1PP7U 1DQ2A 1QDOA 4AI2A 2M9HA 3CZJA 1KA8A 4A3LJ 5FPBA 5FZ6A 2P5KA 4NQWB 5HNHA 2E2IJ 3LSRA 4XFIA 4UNOA 1FP1D 5JHUA 1LHUA 2DQRA 1YQ5A 2R0FA 1T6SA 2EF6A 1R1TA 3UT0A 4BMEA 1S6LA 3C7JA 1CWPA 1ZG1A 2PXJA 3I2IA 4DEQA 2R0QC 1UZYA 4RR3C 4RL7A 1T0FC 2VIXA 4BE1A 1RHI1 3VYSB 2FX0A 4EJRA 2I74A 2HQRA 1KDMA 2WZEA 2OF7A 1OYWA 4ETSA 4BA6A 1X58A 1XNAA 2RHPA 1ORKA 1B8IB 1HW2A 2QCOA 3INAA 1VQPI 5FYVA 3G1LA 3GF2A 1OURA 1NQDA 2EBIA 2E32A 1MD0A 3VODA 2FHRA 4Q4V1 4Q4Y2 1Z1DA 2K7LA 4LNVA 2BPA2 5FKKA 2E2JJ 4KICA 3NO8A 1DDNA 5EEAA 3RDIA 3BPXA 5DDJ1 3UGHA 3VD9A 4B09A 2ZXJA 2ZGQA 1WW6A 1SBFA 4RS5A 4XCAA 4LEJA 5E8IA 2Q0AA 2ZFWA 5LA1A 1UOGA 3PVOA 1B35B 2W46A 1MMNA 4GDFA 2VOOA 4FQGA 4YG0A 1OD3A 4B7EA 1NLRA 1F15A 3ETQA 5EEHA 1G3WA 3T1BA 3A2KA 1BEV1 4LE3A 2YBSA 4BUPA 2VMEA 3FN9A 1IN8A 2F4IA 5FR3A 1I39A 3HOBA 2BBVA 1IGNA 1VQ6I 4WM8C 4XFCA 3K48A 2A6HF 1LB2A 5HPOA 5CJ9A 1K78B 1WWYA 1B59A 1XSXA 4UYBA 5F64A 3PU8A 3N35A 5FQ0B 2P3IA 3CJNA 5H2FC 3KEOA 4CCNA 1LHWA 3OL4A 2W94A 5ICGA 2DMQA 2YC0A 1H9WA 4N7UA 2VW1A 4XHXA 1BM9A 1A5JA 1W3XA 2DVGA 1MMGA 3WNLA 1RMU3 4LOTA 1K45A 1KZHA 4C1WA 5IT6A 2GALA 4Z2YA 4PLMA 4AI3A 3IRRA 2WB1A 3M8FA 1NK2P 2ARAA 1LEDA 2Y34A 4FTBA 3NKTA 1UF2C 1C57A 1ON2A 4EJTA 2IPQX 4AR2A 1R7JA 3LZZA 3QCWA 1QRYA 2O03A 2F17A 3V42A 5JIUA 5C71A 2Y0OA 1M06G 3K4BA 1NCQA 1Q1HA 3BGAA 3MUZ1 1IV6A 4Q0QA 2VOPA 1QXPA 1QF3A 2FCTA 2VZVA 3CMEI 1K5MA 1QJZA 3E6CC 3O0VA 4WM7B 2VOKA 2LF7A 1QJU3 2A5WA 1Y56A 4PF5A 1JMUB 2WKKA 3J8F3 4E8CA 3G6JB 2BGCA 2CS3A 3COAC 3C2HA 2V6EA 1NH3A 4C3JJ 3GCWA 1AHSA 5FLVA 1NUKA 2D5VA 3DEUA 1GWKA 1RUH2 2R7RA 4N53B 5C3SA 2GXGA 4R79A 3PIPF 5FY9A 3OGSA 1RUJ3 4YVWB 3V7SA 3RI4A 5I0SA 1YYNA 4FQ4A 3N9QA 4AHZA 2R93J 3WF2A 4Q4W1 5IWFA 4XONA 3PIOF 4YW6A 3KT7A 1LHVA 2DI3A 2ZNZA 4HOOA 4P1WA 1TME1 4KNYA 4GWJA 2A75A 3CJXA 2VPRA 3D0JA 5BYNA 3W59A 1AR72 2DMNA 2VC0A 3W21A 1R1A3 3BCWA 1ULGA 2VOWA 4J01A 4NAMA 5ILSA 5LY1A 4EZHA 4XUPA 4PFPA 3HAGA 3GFLA 1R081 2WS91 2QLZA 4BH9A 3MGUA 4H3WA 3CNAA 1AJOA 3KP3A 2WAAA 1Y9QA 2CSGA 3B01A 4MQVA 1V5FA 4XUTA 4LO8A 5GLTA 1TQPA 2EVXA 3MICA 2GH2A 2WYFA 3I3BA 1TZOA 1Y4WA 3NV4A 4PHZA 5CQEA 4LKDA 4ZC3A 5C9AC 4IE7A 2DTWA 3HN1A 4OMCA 3M8LA 4JDNA 4GXOA 5FZAA 3LOCA 5D4SA 2XF7A 2OZJA 4WCGA 2I45A 4AVAA 4MIMA 4HX4A 1ULFA 2HXIA 1ZGJA 1VBA3 3N4MA 2HWD1 4BU2A 4FXGB 3VBSA 1DGRM 2OAZA 5LBBA 2DFBA 2Q4SA 3DLLF 5FTTC 1UPSA 3I64A 2R6QA 1A6CA 3JSOA 3QYFA 3I3MA 2QJVA 4CP1A 2B42B 3DUIA 1N3PA 2CGNA 5D1IA 1C28A 4HVOA 2NMNA 4MUVA 5JLWA 1RKTA 1UW8A 1A35A 5FREA 3ZYBA 5JPNB 2ZB9A 1ZZ8A 1ZREA 2IXHA 3QPLA 2KFDA 1BC8C 3WF4A 2ZJRF 4XKVA 2VL8A 4QQPA 1Z0XA 3CMAI 2HLEA 5A7QA 3JTGA 1VLNA 5B1AH 1RC9A 2HH9A 1OKOA 1SD4A 1EKEA 1F2NA 1HRI2 3AYDA 5CKNA 1NQJA 1MSEC 4IO9F 3KYLA 3GTKJ 4RB1A 2RS11 2ZX2A 4X8PA 5FZ0A 1POQA 3QH6A 4LLLA 4WVMA 5A1LA 1DQUA 3PJQA 2F48A 3IIAA 5AFEA 2XSJC 1S7EA 4RYDA 3F8BA 4J1WA 3LAJA 2HOTA 1K61A 3CQOA 3HVDA 3E5XA 2C26A 2WIIB 3CCYA 4J00A 3AYAA 4BHCA 1VBA1 1RUC1 1GZ9A 2SLIA 4L2NA 1W39A 4XBLA 2VMHA 1T0FA 1MZ5A 1W6MB 1S0DA 4YG3A 4PDWC 3K7AJ 2RE9A 3WTVC 5FMOL 1BCXA 4H4KC 3AJYA 4DRVA 2VQCA 1F8VA 1JTYA 3H50A 2RDRA 1JS9A 2QENA 2FZ1A 5CBLA 3X29B 5L3GA 4Q4ZF 4ES9A 5CIRA 1WGPA 5F39A 3FMGA 2ZCWA 4O9GA 5FFXA 1UMQA 2BOIA 2WUHA 4CZSA 2W92A 2R5ZA 1H2MA 3SYTA 1WMEA 3CP8A 4JGZA 3HHHA 3SKJE 3N9NA 1FYKA 3C7EA 4Q4W2 2WS93 1JYCA 2VNOA 5KK1A 3POBA 2G4IA 5T3NA 3OOPA 1GP4A 3RPUD 3VZLA 1RUI2 2OT7A 5C70A 3RJRA 2GZWA 5FWJA 2VMDA 5FP3A 1GUUA 4C2MJ 1PGW1 2XIGA 4P9WA 3OS1A 4COYA 2XKPA 1DP0A 1WJ5A 2RKHA 5FZIA 2LH9A 4D6RA 4COZA 3AL0B 1IXCA 1CAUB 3UKNA 1QPIA 1QDCA 5LGNA 1YJLA 1I6XA 2E7QA 4D5CA 4LKSA 1SG3A 1RUI1 3CLOA 1AKHB 1CAWA 1RUJ1 1CX4A 2PQQA 2MGQA 3AVSA 1ULOA 3KIOA 3ZOBA 3RTRA 1FNNA 2MSYA 3PUBA 4HSTA 1BI3A 5IPAA 2P34A 5CKQA 2JE8A 2HDCA 1SBEA 2C5DA 2WSVA 3EYYA 1UU4A 4C30A 1CJPA 4CCLA 4CU6A 2WZR1 1V6IA 1XC6A 2VE1A 2BTVC 2WLQA 3J8F1 1DYPA 1H9GA 5A3UA 3IT8A 4WXDA 1W2UA 1HJFA 1X1PA 4HANA 4DXRA 3ZQCA 3NRUA 2TDXA 2KJBA 4XTPA 4M3CE 4BQ4A 4IXAA 4XNFA 4D7SA 1VAVA 4DNYA 4N53A 2PMZN 4AXOA 1W6NA 2DUOA 2QDNA 5JI9A 3Q0WA 4XAEA 1HQLA 1A6IA 3SISA 5HDNA 3GO5A 2NZ9A 4X8NA 3ZR8X 1DQ4A 5CISA 2QKMB 2PTMA 4Y1XA 1GNZA 4HOBA 4IHWA 4XXAA 4HX7A 4DZJA 4NQWA 3SH4A 3MIDA 1OKRA 1HXDA 1X9PA 4Z92B 4BOWA 1YLFA 1QU0A 5FZKA 5IK8A 5FAXA 4LUKA 2WNVB 2RS52 4GMP3 2MC3A 3RQ4A 1Y9MA 3J9SA 2QQIA 5ICFA 2W9XA 1MBGA 1W7PA 1VPHA 2PLV1 5B3SH 2WWUA 1KYZA 1L3LA 2OW4A 1FY7A 3H0DA 2HYFA 4K8RB 4OHVA 4AFAA 5DDJ2 4U7BA 4KBZA 2GU9A 2DYSH 2RQQA 2KXLA 5EJCA 2W39A 4DZGA 3HUGA 4QPIB 2M2EA 1U0JA 3LEIA 4A5NA 1CAUA 1KU9A 3O2PE 1PK6A 2N8GA 1MACA 2TNFA 4CDQB 2P8TA 2GH8A 4PIYA 4A12A 1WZ2A 5JLXA 5FZ7A 2GIVA 2HPIA 3D0SA 3V7CA 1ZZBA 1KYWA 2RVCA 1TNFA 2DK5A 4PJ0C 1Z7LA 5FZOA 5DZGA 4M4RA 2OV7A 1IG7A 2JDHA 4ZDPA 5H9SA 5C33A 4WXHA 2CW8A 3MQ0A 3H1CA 5DDJ3 2PHLA 2VJIA 5D2AA 1XDSA 3MEPA 1IZ3A 2ZEWA 1XCBA 3KP2A 2R7UA 1IDYA 1REFA 5DPNA 3DWLE 5DG1A 2ZJ2A 3E1SA 3F8FA 3DU5A 3CC7I 1NTCA 3N97A 4JVAA 4XHBA 5K5QA 1HB1A 3ZKUA 1LVAA 5BNNC 4M6YA 2D45A 1ZH5A 2WTEA 2X48A 3B9CA 4Q0PA 3AXEA 1CZSA 5DCFA 5FZ1A 3M3QA 3ACIA 4FOVA 2WB1N 1US2A 4KI5M 2Z69A 3OMYA 4UW3A 3B02A 4L5IA 1WI9A 4D0PA 2IGOA 2I10A 5FKNA 3PQKA 3OYLA 4XF3A 1G4DA 4CP2A 1NZIA 1QJX3 2COBA 2FNAA 4LBKA 4OI0A 1B4AA 5CB7A 4KT6A 3CDIA 2IJLA 2LREA 4M6XA 3HNYM 2YS9A 3TQNA 3CESA 2GA2A 2P1BA 1QGLA 1HLVA 3VDDB 4EV0A 4BHPA 2YPJA 2DCZA 1S8NA 4DEVA 1V6JA 1R1VA 2IGMA 4M01A 3GVAA 2L9SA 4OIPF 2L5QA 5HV0A 4BXFA 4D0QA 3FK7A 3AZXA 3KV5A 5C4WB 4IPAA 1DP3A 1YQ2A 2QSHX 3DPRC 3LDRA 1TWAJ 5F5QA 3M70A 1W3VA 1ENSA 1QH6A 5BNOB 5FYCA 4YVSB 1FPN1 2DFCA 1J7KA 1Z6TA 4ITCA 4MH0E 1P7IA 4GJYA 5HCBA 1WMFA 3POYA 3EPZA 5FLHA 3VB2A 5KXEA 3C2UA 4D3WA 2W7NA 1SHWB 3HC7A 2RR11 1I3HA 1BI1A 3GMEA 4MADA 4AM3A 2BWCA 1P2FA 3VFZA 3VBUA 2AGSA 2WJSA 4XZPA 2WV0A 4FTSA 4I6ZA 2KD7A 3R60A 2JDNA 1SD5A 3KV6A 4LO4B 1KQ8A 1NA1B 1DG6A 4CE8A 1KEXA 4LBLA 1VE0A 2RJLA 3ZP5A 2D93A 2JB4A 5A33A 3W6KB 3A0HC 3S1NJ 2GSYA 4IV3B 4CEWC 2A70A 4L0YB 3ZPOA 1KU7A 3DV8A 1ND2A 3ZMNA 4XLHA 3LL7A 3L2YA 4CXWA 1RUD3 1TQ5A 1EH6A 3D6EA 5J8CA 1MNDA 1E5HA 2L9VA 1VQ7I 3BPZA 4DQAA 4FTEA 3CQZJ 2B46X 5C8CC 4L11A 4L9BA 3IH3A 2IWGB 4L9VA 2VU9A 1OD5A 2GN3A 1K4TA 2GMMA 2E7AA 2F2EA 3ZYHA 1DQ1A 2WA0A 2DCTA 1RJ7A 4DXSA 3U2RA 1XSQA 2OC6A 5FB2A 4WM8B 3ACFA 1T98A 2OU2A 1N1TA 5GM0A 4AD9A 1R5ID 4CCEA 1DF0A 1EUUA 3QPHA 5FJHA 4MSVA 4E8DA 2A5ZA 4AGVA 1W04A 4PSWA 4BGDA 3K4MA 2D6KA 3B5LB 3JCIA 1XE8A 3V0AB 3HJRA 2E36A 1GV9A 3E6MA 1HRI3 1XYPA 1RI7A 3CCEI 1ZBA2 1JU4A 4I76A 1JKRC 4LITA 2CJJA 3LFIA 4LK6A 5A3WA 1A8DA 2RM21 1X3ZB 1LDKB 3MLKA 5E17F 3MZ8A 4AFCA 3WSOA 1ASJ1 1ETQA 3WU1B 1HBXG 2P6TA 1POGA 3IB3A 3DYMA 3WW4A 3WNMA 3S0MA 5GADJ 3T0BA 5FYHA 2P17A 2NXNB 2HQAA 2H0VA 2V6CA 1H88C 2VECA 4QWNA 3U0ZA 1XNCA 1WCKA 2GNMA 4YW7A 1R49A 5GTIC 3K4CA 1JJ8C 4OOIA 1PIV1 2XBO2 1ETWA 2R061 4WVZA 2EQRA 2DCKA 2KP6A 2DVDA 4FFGA 4MVTA 1F43A 2XH6A 4IW3A 1MH4A 1AYM2 2HKOA 1M4WA 4BY1J 3ZMDA 2ZZJA 3WG9A 2XVLA 5JR7B 1XGSA 1OLQA 2ID4A 4XDOA 1H8TA 3DTKA 2FF4A 4BISA 2R073 2ID3A 3EETA 1GOHA 5ACA3 4AOCA 3WCRA 3HBZA 3Q0VA 3HRUA 1IF1A 2JKXA 5BXXA 2C0ZA 5C4JJ 2CV2A 5I91A 3OIPA 3JTHA 2E35A 4DY3A 1KQ9A 1BR4A 2BVBA 4WVWA 1UOBA 4TYSA 3E6DA 2P5LC 4NOTA 5E88A 3H5AA 4BPZA 1DZTA 2NLRA 5BMZA 2HWE2 1L7RA 4RB0A 2DVAA 5JXIA 4XMIA 5FD5A 4BJ6C 2DA2A 4HFSA 5FO8B 2EIJH 5FXZA 4OLLA 4NC6A 1TL8A 1JHHA 2FOKA 2J1SA 4YGBA 5AVPA 1JZ2A 1OOPA 4FPHA 5L7OB 5CLSA 1W0PA 2WWSA 1R1A2 3O1TA 4CP0A 4QQ2A 1AJKA 3ZQ7A 2Y6FA 4Y24A 2JT1A 1D0ZA 2XQRA 3PURA 4QSHA 3GX4X 2V5YA 1SDDB 3O1OA 3AMPA 2YR2A 4HSJA 4LG0B 1W5SA 5ABJB 1S1AA 1ZBE3 2DYCA 2JG8B 3OBAA 1U0AA 1MDMA 2ZGKA 1U5ZA 1OLTA 4PZJA 5HDGA 3NEUA 2LP0A 2AACA 5EZGA 4XICA 2WNVC 1XC5A 2P4WA 1ASJ2 2D1HA 3ZGKA 2VT3A 1G2HA 2FQ3A 1ZRCA 2LK2A 1VBD1 4O7XA 3JB8A 3QU6A 3SQNA 2GC3A 4XF9A 4N9HA 2XKOA 1V9U3 2P2KA 4CCMA 3OUIA 5HI0A 3OYFA 1IW7F 5EGOA 3I2JA 3IKTA 2W57A 1H89C 4DYRA 3J26N 2AUYA 1GNYA 2FA5A 1AXZA 1RUF1 1PX4A 1D5YA 3DLAA 4RR3B 2EZHA 3H36A 3KZ4C 1NK3P 3K4DA 5FYTA 4GKXA 3RFRA 2HYGD 1BOBA 4NC7A 1OQYA 2EV5A 2WNUB 1VBC3 1LRHA 2J1VA 1D0GA 1YI7A 2PMZA 3QU3A 5A70A 1F31A 4NMIA 1DU6A 2GMEA 1ENRA 1DZQA 2RS31 3OPZA 2ZKLA 3KS7A 2J7MA 4IV1C 5K7PA 3T2TA 1ZG3A 2DBIA 1MVQA 5F3CA 1WZXA 5A3LA 1K5MC 4TZDA 5SV8A 5GZDA 3FBNB 5EP9A 1MH3A 4V2GA 3EJKA 4MXWA 2YZ4A 5EJ1B 2XONA 2OJED 4QLCU 2H0BA 2JDAA 4II3A 1WA4A 1O3QA 1JOPA 1D2QA 1OYIA 1RUG1 5EF6A 3PTYA 1V70A 1WI3A 2HQ5A 1AX0A 2RS12 3JRCA 2OQ7A 1YLLA 3Q8AA 3OGVA 3ABMH 4D8MA 4RFRB 4MTDA 1LFPA 3TO9A 2L7FP 3VZKA 3WXPA 5D8KB 3NV2A 1W2OA 1DQ0A 3WP4A 4CUBA 3S16J 3OYHA 4FPLA 4OAYA 4HG6B 1U9NA 4JAAA 2WRAA 1LFUP 1YHFA 3J7HA 1MJBA 1IS4A 2YYOA 3TOJA 4Q4X2 4NHKA 3H9JA 5GLUA 1VRH2 4QM8A 5FZ8A 4EJUA 4O6JA 2LALA 3PUFA 1B09A 1GSLA 1RKWA 2F6BA 1XSDA 3OYBA 3GTQJ 4AYBA 5A3OA 3I2FA 3WG7H 4LO5B 1SLIA 5CFDB 3BOPA 2O61A 2MLKA 5GPAA 2R7XA 3KCXA 1MS0A 4KYWA 4HXCA 5EV7A 3FXKA 4XOTA 2HWC3 1OR7C 1ZZ6A 1HDKA 3BJOA 4CCJA 5B4XA 5FZGA 3GBWA 4RGKA 4K40A 5D8AC 2WAFA 1BLZA 2PAKA 3HNMA 2K9QA 4RAGA 1W5TA 2LD5A 1AR92 3RZJA 1TWHJ 3AKTA 1JZ8A 3J7NA 5DAQA 1HRV3 2AYHA 3F2ZA 4DPNA 2V79A 1HN0A 3LAGA 3WLUA 4R9AA 2WT0A 2TCTA 2BY3A 1GOFA 4NIIA 3GZAA 2PMHA 3E97A 5KXDA 1I6HJ 2BHZA 1Z21A 3QYEA 2ZPXA 1GMMA 2VMFA 3PNVA 3U10A 1AL0G 1VRBA 2QQKA 1MSFC 4AHWA 4MXWB 1O3RA 2JDZA 2WQZC 5B2GB 3T1LA 5FZMA 4FVVA 3SDGA 2JDPA 5IP7J 3JRFA 3F8CA 3OR2C 1JZ7A 2UWCA 3AZZA 2BOJA 3O1UA 4EJOA 2OPKA 5IK5A 1YRZA 2VOTA 3WU2C 4L0ZB 4B4PA 3MD2A 3H8UA 1MPXA 1C1FA 1W8WA 4PCRA 3IHUA 5A6XA 3WDXA 1IXSB 4JDOA 2W0XA 4XRSA 2DU0A 3OUJA 2LG4A 2JENA 1F36A 5FRAA 1BXHA 4ESJA 3VHNA 2L7ZA 1BEV2 2DK8A 4P9LA 2CQXA 1JKPC 1RESA 2VULA 3VD4A 1F5JA 5LHHA 3WHUA 3P7NA 2ZMEB 3VSLA 1OCTC 5C9AB 5LGTA 2HPMA 5FBJA 4DQ2A 1MZEA 4IEUA 2JA8J 1OFCX 1YW8A 4E4DX 5F6LB 4DBRA 4GYGA 2VQGA 1ZK8A 1MS5A 3CLQA 4OZOA 3J7AO 3VN4A 1N25A 5IYDJ 1EA3A 3ZVXA 1Y6IA 3F6VA 3VBHB 4QB1A 4XL9A 4CPBA 4XORA 2FMYA 1BZWA 4G7ZF 1UZ0A 3ZXAC 2CQ7A 2JN6A 4IEZA 2QQLA 4ZH4F 2GNBA 3TNQA 5KR7A 3TOAA 4DS0A 2X9DA 5CFCC 1GANA 1SQ4A 4II2A 3O1PA 4IF4A 3ZQGA 3QP5A 3MW3A 4XFAA 2Z5UA 2BEOA 3B6AA 1JTXA 4RA2A 1RR7A 2BOLA 3TW7A 4AIDA 1PO23 4Q8KA 9ANTA 4WZFA 1D4M2 2W24A 3G7DA 4HQEA 4LIUA 5C3PA 3S8PA 4OVEA 3O0WA 2HWC1 2DFIA 3OGRA 2R4GA 4G7OF 1FTTA 1RTVA 1W1WE 3FZ3A 2PBIA 2VTFA 3FK6A 4IL7A 2ZZQA 3TP0A 2PELA 2V1XA 2R042 1RITA 5E20A 4O3MA 1HC8A 3R4KA 3S7EA 1IN7A 5D8AA 2P0WA 4KL1A 2CWSA 3ZOIA 5L9RA 4RGXA 2OPWA 5KXBA 1NHAA 2OPTA 4EWAA 1K12A 3EB7A 5IK7A 2VMCA 1AA7A 3J80Z 2ZGSA 3IDAA 5FPZA 1YIFA 2A6EF 2WS92 4TWTA 5FPVA 2JIJA 1NLQA 4NIGA 1WW4A 1BR1A 5JSPA 2ZXIA 5JR2A 4RHV3 3OYEA 4X6QB 2GWRA 3OSDA 3C3WA 1H9PA 5LRRA 2ZXHA 2XRLA 4QD2A 3NARA 1A8MA 1SLCA 5BNOA 3V65A 3AKRA 2EIMH 5DS9A 1QPMA 1Z67A 1EY2A 1VRH1 2A1XA 4UXAA 1X3UA 1YJWI 1YFHA 2CGPA 3HDDA 4YVSC 5C4XJ 3PSFA 1TE1B 1XXNA 4OULA 5E3LA 4HDUA 4KG8A 2IXCA 2AHQA 3Q0UA 5JXJA 1RUG3 4GH4B 4RHV2 2FXAA 3P3NA 1K4SA 2HZDA 3M7AA 2W2IA 2CY6A 1X4PA 4QU1A 3CC2I 5CVIA 4AEDA 2CW7A 1MMAA 4NRMA 2W52A 2KPMA 1XRUA 3HZJA 5F04A 4XN3A 4ENKA 5M0TA 5L3BA 2JA5J 1FMWA 4PQQA 3BG3A 4F3QA 4KFCA 5IVYA 5T55A 3T3YA 2A07F 3ASNH 5I93A 2K5CA 2HEWF 4YZ5A 4XRMA 4RQPC 4M3GA 5GTHC 1UN1A 5EXOA 4UW4A 1YRNA 4GULA 2FBKA 4G7HF 2MH9A 3R05A 2LS6A 1W99A 1IQAA 3I53A 2X53S 2OUMA 3BDDA 2ESNA 3W20A 3FKJA 3KEYA 4F3JA 3WZ1A 1LUJB 5H20A 1VBC1 3ZR5A 4CXFA 3GLLA 1TWCJ 4YPJA 4XETA 2XBO3 4ZZ8A 5C4WA 1YO5C 3VV1A 2ZGLA 3BY6A 2GLOA 4QHOA 2QKLB 3I2KA 4E9KA 3V0BB 4IV1A 4CCCA 1A04A 1SD7A 1YQCA 3MZHA 1UY3A 4LBJA 4RBOA 4A3CJ 4Y22B 5E89A 4ASKA 1ZYBA 3QPSA 1YX5A 2NPIA 4YYOA 4E2GA 5GZCA 1AR73 2YBPA 5FKCA 5J37A 2HYXA 3VKMA 4LK1F 1SAXA 3TL4X 3GM8A 1O5UA 3W5MA 2H6BA 1H2LA 2BERA 2STTA 2DDAA 2HTSA 2LBFB 2BY1A 1RUF2 5FPUA 2DV9A 2QZ8A 4D6QA 1R1UA 4QDQA 4Q47A 5JLVA 2PJRB 2XQXA 3O1MA 5CYVA 1P92A 4LMFA 3ELKA 1AUYA 4RB3C 2JKBA 4AHXA 4XBQA 2RN7A 4GFBA 2M1BA 1WJCA 2MEV1 4OI4A 3FHNA 3SC7X 2Y33A 1LR5A 1SFYA 3DP7A 2ARBA 3WP5A 2YSRA 4H7MA 3R4SA 3D8CA 2R32A 3RKWA 3CJTB 3L2VA 4HAMA 4MOAA 3BQYA 5E18F 3MLLA 4JX4A 4JQRA 2BRTA 3OPWA 4LK0F 4HQMA 1P4WA 3W6VA 3ZX7A 4BZ4A 3S5AA 4YFKF 4Y20A 1QHGA 5FZLA 5DTDA 4UW6A 4TLFA 2D2WA 1OHFA 2BW3A 2QQNA 4S0HB 4XSZF 4Q4V2 3JRHA 1UQXA 4FCAA 4UOJA 1QZZA 3VHPA 3MEXA 2A6ZA 4TSVA 2V9VA 2HQNA 2QQ9A 1W6QB 1QJY1 1GWMA 3OYDA 3UV9A 3VBSC 2CU5A 1XE0A 2ZABA 4Y1YA 5GPCA 1W2TA 4JC1A 1CZTA 1KFUL 2ZNYA 4JBAA 3IH4A 2UXXA 4BHBA 3ZRGA 1FBUA 2ZMKA 1VBE2 4BACA 5FK7A 4BDVB 3FM3A 1HQWA 1V4RA 2KLOA 4XIKA 2Y9YA 5DUWA 5ACA1 2XOMA 3MW4A 2RS53 1XTAA 2J5PA 4F93B 5JVTA 1RB8G 2HVSA 4U0WA 2A6XA 1BOAA 4N43A 4A5MA 1GV2A 1D8JA 5FYIA 4BIFA 4CCDA 4UF0A 2EXJA 2VNGA 1NG0A 2L01A 4OAZA 3BTJA 5GZEA 1ZRRA 1G8XA 1VNDA 4GD4A 1COV1 4DYQA 5FY8A 1PIV3 4XC9A 4XKBA 2ISZA 2AQEA 4Z1VA 4A3GJ 3QD6A 1IO2A 3MN2A 1X82A 2WO3A 4N8MA 5JZGC 2BGPA 3AP9A 2JPCA 2E5ZA 4FAHA 1OCCH 3AG4H 2L9RA 3E1F1 3DKQA 5F5CA 5AIQA 3GTOJ 3URFA 3HWJA 2VUJA 1FTZA 1ACCA 3BOQA 1LNSA 1U5TA 3N7MA 3OY8A 3LOBA 1LHOA 3D5SC 4KWLA 3EHKA 1CVNA 3BUCA 1QJFA 1ZNPA 3JSPA 2AH2A 2RM23 1OVSA 1C3HA 5L3EA 2CQKA 4ZYGA 4KGGA 5BNQA 3NW4A 3THTA 1D1AA 3HXLA 1SFOJ 1AYN1 4OZXA 3G71I 2COMA 3S7IA 2EZKA 4AVZA 2WNOA 3MF6A 1UU6A 1QBJA 4Q1RA 5FMBA 4LBOA 1YFYA 1MJ9A 4BLJA 1H8TC 3K70C 2EINH 4ES8A 2UY8A 1BQPA 3FLTA 2CH0A 3H42B 3RZGA 1J2XA 3TB0A 4PI2A 4XFGA 5CG8A 3H5NA 2E19A 1PUFA 3GUDA 4OIQF 4S2FA 4WM7C 1JUHA 2DMTA 1W28A 1YS6A 4TN7A 2F4MB 4OQ8A 1ONVA 1QNTA 4ZS2A 4IVNA 2D98A 1ZZCA 4H0EA 4HZFA 3IBMA 4HV5A 2XJUA 1UKGA 4DXZA 2A3XA 1BBT3 4CYCA 2H27A 4M0HA 4UVBA 2X6OA 2VZUA 1D0HA 1FOD3 2O9LA 3S1RJ 5H9QA 3W9AA 4NBQA 1FAYA 1P8JA 3ABKH 5C6CA 1U2WA 3C8XA 3MZYA 1NG6A 1MDMB 3ACLA 1S0IA 1RJ8A 4BXUA 4GIQA 5DZEA 2OZUA 2OCCH 3N9MA 2DMPA 1IQDC 4LIVA 4QKFA 4Y26A 1E57A 2BHYA 1SEUA 1GLNA 2F4OB 3A4UA 1G59A 5IYYA 4J6GA 1U5IA 1NCQC 5E1ZB 1LCLA 3IMMA 4EJVA 4Z2WA 2WNVA 4A3JJ 4IV1B 4BCUA 2WY8Q 4FOQA 1Z3XA 2DA7A 2UWBA 1J83A 2XB6C 4XRSG 1W9SA 5FBZA 2JVGA 2HVRA 3OEAA 5DABA 2VXJA 4GXLA 3F72A 4S2DA 1VALA 1STMA 3ZSEA 1RINA 2OD5A 5FKBA 2D44A 3LWCA 5CVVA 1UAAA 1PO13 4UBHA