1RUOA

Catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3')
publication title Aromatic hydrogen bond in sequence-specific protein DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ruoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruoA01
4U0WA 3TO6A 4HAMA 1U78A 3D82A 4A5MA 2MPFA 3U2RA 5ICEA 2F5FA 5AIQA 1FI2A 2X0LA 1YFWA 1OKRA 3B73A 2ZO4A 2HQNA 3MWMA 3DKWA 2DTRA 4GULA 5DUKA 3HSRA 4QGNA 4ZH4F 4BHCA 2H0VA 1ZG3A 4FT8A 2VXZA 1GQHA 5LGUA 2OA2A 2IT0A 1J2XA 2WV0A 2Z3YA 3K9TA 2Y48A 4YFKF 2D2WA 3WTWC 2QJVA 5FGMA 2ZJ2A 4YFNF 2FEZA 2IJLA 3TO9A 2VQAA 3KCCA 4A2UA 3OOPA 4HN0A 2QUFA 2H6CA 2MLGA 4MEXF 4GXOA 3SQNA 4YNIA 4KIBA 4XF9A 1J5YA 4BQAA 2KXLA 2O61A 3IKVA 4WVZA 4L11A 4R1HA 3LQRA 4EM1A 4PJYA 2PEXA 1WI9A 4ONUA 3GO5A 2K0GA 4HBNA 1XCBA 4WXHA 1MJAA 3LQQA 1KQ8A 1O7FA 2DK8A 1U5TB 1YG2A 4K2EA 3RKWA 1GXQA 4KDPA 3RJPA 3NEUA 3WE2A 3MZYA 1K78B 2IXKA 2O8QA 1G3TA 2B5HA 2M30A 2GAUA 4IPAA 2QBYB 3ZP5A 5HS8A 2W85A 3LZZA 4BAYA 3UKVA 4OIPF 2UXXA 4Q0PA 1YW9A 1B9NA 2ZMEA 4OMZA 2Q0OA 1U6GA 4CYDA 2GC2A 4YIIA 5JI6A 4ORFA 2GU9A 2HWVA 1BI2A 4HV6A 1HW1A 3FWEA 2RDPA 1DDNA 2Q30A 4MGIE 5CVUA 2ESHA 4P9FA 5E1ZB 2STTA 2XLAA 2OBPA 5E1RA 1D8KA 1PP7U 4G6QA 3DL3A 2NNNA 1VR3A 5CLSA 3OD0A 3ISPA 2LKPA 1CX4A 1LDJA 2GH2A 1SFEA 1HQCA 1J1LA 4GGGA 5FCCA 1W7PA 2NS0A 2FNAA 5DUIA 5TJJA 5KK1A 2O1QA 3T1BA 5E17F 4M6XA 5D8KB 3DXJF 3EETA 1QBJA 2IXLA 2BEOA 1GVJA 2CV6A 2DFIA 3GFJA 3NSTA 1XDUA 5CU1A 4Q0QA 5BY5A 3CO7C 5EEHA 5KVRA 1MZBA 2KKOA 1RZ4A 2EVXA 1H9GA 2A61A 4P96A 4PIYA 4Q0SA 5F6FA 4PIZA 3M7GA 1PUEE 4I02A 2XAQA 4BIFA 5I8YA 4S04A 1XGSA 3RI4A 1HW5A 4M9XA 2E9QA 2P17A 2P6SA 3TOBA 3ZMVA 1VP6A 5CVRA 3NJZA 2J5PA 4U7BA 4UVAA 4LG0A 2GQQA 3V8LA 5JSRA 4QLCU 5ERIA 5BPIA 5LRRA 3IRQA 3HIFA 5LHGA 2ZKZA 1R5HA 2W57A 3HRTA 3H1MA 1HXDA 4RS8A 2X4HA 3TO7A 4AIHA 1IAWA 3BY6A 5TRDA 4AVCA 1CAWB 5KHJA 4AVAA 2O6GE 2ATFA 1H1IA 4EROA 3M9AA 2IA0A 2HR3A 3ECOA 4HYEA 2XKPA 1ZREA 4IEVA 4XLNF 5ICCA 3BJOA 1T39A 5L3DA 2GC0A 2KIMA 1UW8A 3PFIA 3Q5FA 3USSA 2FF4A 1ZGJA 2XLFA 5BUVA 1TNTA 1NE6A 2FNPA 1PP8F 2FE3A 4AQ2A 1CF7A 2F5DA 4PCQA 3BALA 4LUKA 1LQ1A 1GQGA 4PZJA 1ZZBA 2O03A 1MGTA 3OTFA 2L54A 4RGSA 2O0YA 1XB4A 5JAXA 4L2NA 4WXCA 1Q5OA 4G9YA 3VHRA 4RB3C 2FBIA 3HHGA 4OIQF 4KICA 2HDCA 1ZH5A 1CAVA 1B6AA 1SFNA 2DAOA 5FO5A 2BNOA 2AXLA 2I45A 1I1GA 3ZMTA 3QRFF 5D1IA 3RKXA 4PGHA 2OYZA 3K1NA 3V7RA 2QCSB 4META 2CSOA 2GA2A 1KGSA 2ESNA 4EGZA 4L9JA 5D5WB 2PBIA 1X8MA 2ISYA 4E2QA 3EYYA 5CYVA 4ZYEA 2PHLA 2CQKA 3WW2A 1IRGA 5F1RA 1X3UA 4AD9A 1FC3A 3EYIA 4L18B 1T6SA 2IW5A 3B02A 2HTSA 1RC6A 2L02A 2P5LC 1MJBA 3I71A 3QOPA 3HQXA 2EFOA 2K4JA 3DPTA 4QM8A 3E3VA 3LAGA 1RIOH 2IP2A 5C6CA 1ZAOA 2MHFA 3CUQA 2UYBA 4O5VA 4R79A 1TBXA 5C8WA 5DD4A 2GC3A 2XAFA 1YWKA 2HFHA 2VBZA 3EQEA 1OI6A 2EFWA 1FLIA 5BPDA 4XF4A 4HVOA 5E8IA 4LA2A 4UXAA 3NQOA 1IXSB 1IN4A 2CW0F 1QNTA 3M1EA 5F64A 2JPCA 2ZCWA 4HVQA 2P4WA 3WGHA 1EH7A 2JT1A 4I01A 3PQJA 1KQ0A 3NRVA 4KN7X 5D5VB 3JSPA 5DCMB 1YFUA 5HI0A 4TV7A 4M9SA 4M71A 1B9MA 1IN5A 1JXSA 2Q0AA 1QQIA 5FB2A 3TDZC 4GCVA 1SD6A 2N7GA 3ML6A 2DPUA 3D0JA 1D3YA 1XSDA 3PNAA 5DEQA 3ZPLA 3I58A 3FMQA 3MQ0A 4UVCA 2HS5A 4F8AA 3KP4A 2XROA 2XV4S 3R60A 1IXRC 2PN6A 4JK1X 5DYMA 5D4SA 1QZZA 4WX9A 1LRHA 1D8JA 3J80K 4BNCA 3F21A 1IUYA 4HQEA 2PAKA 3EQLF 4XFBA 2MA3A 5KHIA 2PTMA 4HX8A 2P5KA 3IDCB 4N9IA 4OIRF 3H7YA 1ODDA 1S3JA 5BPXA 4I0AA 3F8NA 4Z2YA 2UXNA 5HS7A 5LGNA 1Z05A 2EWNA 4EJWA 1SMTA 4HW0A 3JAMZ 4EWAA 1QWRA 5JR7B 4PGGA 3P9CA 4J1XA 2C0ZA 2FMLA 1R36A 4EJOA 1XGNA 3QPHA 4FAGA 4I2OA 4LB5A 3I64A 1LB2A 3U1DA 1QPMA 2W84A 4O9GA 3I54A 2XKOA 1WLTA 1G3WA 1YO5C 4FBFA 3E5UA 4X6RB 4IRHA 3FMSA 3FXUA 2QLZA 4KMUX 1Q43A 3HYIA 4ZU7A 4MV2A 2YU3A 5KHGA 3KEOA 1PM7A 3IC7A 2ET7A 1YFHA 2ZBKA 2E7XA 3IDBB 1ZG5A 3GW2A 3RIRA 1O4TA 3GEZA 3FZ3A 1FSHA 3FJSA 3FF5A 3MCZA 2ZFWA 1HW2A 1HSTA 1V4RA 2QENA 1ZZ9A 1U2WA 1FYKA 3FE5A 1MDMB 3QAHA 5FPZA 2EB7A 2IXCA 4R52A 4HDUA 2L01A 1O7LA 4B8XA 2O8XA 2LDUA 1L3JA 5J3UA 1WRJA 1KQ9A 4MHGA 1S8NA 1ZN2A 4KWJA 2ZNZA 4X6QB 2KIUA 1YQAA 3WODF 2MLKA 1BJAA 2BBYA 3HHHA 4G94A 3MPBA 3SCHA 1R23A 2L4AA 3BPVA 1T98A 1CAXB 2GC1A 5D6FA 2LF8A 3VODA 4RB2C 4JBAA 1SD7A 3DV8A 2Z9OA 4YIFA 3ABUA 3WU1B 1ZZCA 5LHIA 3SXYA 3L7WA 5BQTA 5HLGA 3KZYA 5H6QA 2UWMA 4IRIA 4WK8F 3F8BA 4XETA 3KP6A 2JSCA 2OD5A 3RPUA 3QPTA 2Z69A 1HKQA 1L0OC 5ICFA 1W4MA 2MNGA 4KU7A 3QP5A 5H20A 1LDDA 2AS5F 1XDSA 5H6RA 4YYOA 4A0XA 3H50A 1J58A 1R58A 2YX7A 3BPZA 2D5HA 4LJZF 3R0JA 1FXZA 3FM3A 3I53A 2IPQX 3SCFA 3V8KA 4UXNA 4ZYDA 1O3TA 4MQVA 4LLLA 4KIFA 4XFHA 4EWDA 4BXUA 4XSZF 3WTXC 3QP6A 4Q5SF 3M8EA 2VC1A 4MUVA 5I91A 1J75A 1BIBA 3K69A 2XHKA 4KYWA 4HLTA 5K8SA 4LMYA 4EMSA 4IVNA 4D7SA 2ZXJA 1DZRA 1WKMA 3SHFA 4XF3A 1XD7A 1YLLA 3I4PA 4CO8A 3CDHA 2VODA 2OZUA 2Q1ZB 2EV6A 4P9UA 1KU3A 2G7UA 4ENJA 3HRSA 1FZPB 4RD7A 3V7CA 1KU9A 3E5XA 1F4KA 4QMAA 1OD5A 2XVCA 2DLLA 2WWYA 2P7VB 3KE2A 3WTYC 1EH8A 2VE8A 4Y13A 1P4XA 1O57A 2VOPA 4MGKE 1UCXA 5EFUA 4N9HA 5HDKA 2NYXA 4O6JA 3ABTA 4QGMA 5HVQC 1XGOA 2K9ZA 3H1YA 2LSOA 3AAFA 2M5WA 2WC2A 3F8FA 2MD5A 1AOYA 4A0YA 1SD4A 2PAMA 1OPCA 3CJNA 2L4MA 5E1WA 3SCGA 4CGZA 3O14A 1AWCA 3WTVC 4MTEA 3HOTA 2D45A 3WTSC 5I0SA 1YFYA 4ZU5A 2DO7A 5LHHA 3RYRA 4AVPA 5DV5A 3BOQA 5BS6A 3R0AA 4JV4A 3KP7A 4LFUA 1ZNPA 1U12A 2OPKA 4G7OF 2BGCA 1J3RA 3F8CA 5CVIA 2QVSB 2YX4A 1RTVA 2B9UA 3LAPA 4WF2A 2D93A 3E6BA 4HA8A 2ZKLA 3SHRA 1HKTA 3LA7A 3L9FA 3KSCA 1Y9QA 2QZ8A 2G7HA 1Y3TA 1X82A 5I0RA 1S7OA 2B8MA 1F5TA 2FA5A 3L2HA 5FLXZ 1FWZA 3HRUA 5E16A 3WW4A 2EFPA 3J81K 3NVCA 5HLIA 4IEUA 1FP1D 1G4DA 3HSEA 4HF0A 1UB9A 1DPRA 1X8EA 1TQPA 2DI3A 1QGPA 3IWFA 3KETA 1UPIA 4OLLA 2ZNYA 1GHCA 1XRUA 2IVMA 2XAGA 2F5EA 4NVPA 4MGZE 1H0MA 3ST7A 4HN1A 1W5TA 2HQRA 5HOOA 2M1BA 2PJPA 3L00A 1ZLJA 1H9TA 1JE8A 5KHKA 5I93A 3MEXA 1HSJA 3K2ZA 2Q4SA 2QDRA 2FBHA 3HTUA 5HLHA 3DEUA 4K8FA 1A04A 5EZWA 4PIXA 3KGZA 1S7AA 2Y75A 2VONA 1UHWA 2VBYA 1ZRRA 2XUBA 1XCVA 2RN7A 4KUMA 5IT9K 2XGXA 4ON0A 5I0TA 1I1SA 1Z6TA 3DFGA 4G8XA 3WW3A 4S05A 1ON1A 1XE8A 2DBBA 2XASA 1JUHA 1XMAA 3K1PA 4H0EA 4AQ6A 1YW8A 2KIFA 2A69F 1Z91A 4WZCA 1R7JA 3NKTA 5KBFA 1ZX5A 1DGWA 4Q0VA 1EH6A 3G3ZA 1FY7A 3FHZA 3HOSA 2F2EA 4HX7A 3Q9VA 4UHTA 2QVOA 4JQFA 4MTDA 1O3QA 4MNUA 3T0YA 2ZMEB 2XLGA 3FXQA 1R1VA 1WA4A 3C3WA 2RKHA 3VFZA 3JTGA 2EAAA 5FPXA 1IXCA 4BHBA 5LGTA 3QU6A 4ESFA 2D40A 5JFRA 2QM3A 1SAXA 2DU9A 3D5LA 5E1XA 2F5CA 3O6BB 1EY2A 1GXPA 2QYOA 3JSOA 4I09A 5D5XB 3KZZA 3MAJA 3BJAA 3E6CC 3TDUC 1XE7A 1TQ5A 3EJKA 4QM9A 1S6LA 1LKNA 1U8RA 2ELHA 2E7WA 3KFWX 2Q2EA 1W7PB 3GZ6A 5I8TA 5HDGA 4JTNA 4XBFA 1W5SA 5JSPA 1KU2A 2RGVA 3ERED 2M45A 4IEQA 3S7IA 3UKNA 1K6OA 4IHSA 2RQPA 3LWFA 2F4PA 4LB6B 4KMFA 2UY9A 2Y0OA 1TQIA 1R5GA 2LNBA 2YSRA 4WWCA 3KP2A 4I98B 4LULA 5JHUA 3KGLA 3M70A 2BNNA 1SFUA 1O3RA 1J0RA 4KIGA 2CYYA 1PDNC 5CADA 1IN7A 4OMYA 4IEWA 2VE9A 2PFBA 2XRNA 2HGCA 4YRDA 4EV0A 2QWWA 4QWQA 1IRFA 1Z6RA 4IESA 3I59A 4HSJA 3HT2A 2FMYA 2YR2A 3RPQA 1BC8C 2OU2A 3OV8A 1TNSA 4Q0UA 4LG0B 3SZTA 3FM5A 2D1HA 4WCGA 3C1DA 1BI0A 2MBFA 4EM0B 1RGSA 3F23A 1E2XA 5L3GA 5FDBA 3TOAA 3JZVA 1JHHA 2DPDA 2IXJA 3ZMSA 4RGRA 3H3UA 1YYVA 3GXOA 3SZPA 3CLPA 2VOOA 3JAMK 3ULQB 2J5OA 1ZGAA 3ZQ7A 3ZDSA 3KLOA 3ZMDA 1YFXA 3H9AA 1S29A 1HKSA 2ETHA 4HOBA 4RAYA 5JVTA 3GFIA 4CICA 1XSXA 3COAC 2VECA 2FU4A 3VB2A 4AIKA 1BI1A 2IA1A 4HMZA 4HLYA 4AIJA 4H7LA 2BV6A 5CVJA 1CF7B 4MEYF 4ETSA 4ENNA 1LVAA 2ETEA 3IL2A 3JTHA 4N0BA 5D4RA 2M87A 4BYYA 5LEJA 1XSVA 2PHDA 3ELKA 4F7ZA 3G73A 3CO6C 1UCRA 3RYPA 3KMHA 4LA3A 3HRMA 1C0WA 2CGPA 1DGRA 5FQ0A 3G7DA 1USTA 5BMZA 1CAVB 3C3VA 1SEFA 2LF7A 2GXBA 3RYKA 2EV0A 1K7AA 4LLNA 3GX4X 2V1UA 3NW4A 2XL9A 3BDDA 3BPXA 4D0PA 2CFXA 1BIAA 2ADUA 2KRFA 2OA4A 1LNWA 1ZZ6A 1P92A 2TDXA 3WTTC 4LK1F 4LTAA 1TLHB 2A68F 1K79A 4Q4ZF 1RUNA 1E17A 4HSLA 4CXFA 5K5RA 2RC4A 3LSTA 2D1VA 4XFCA 3P9KA 4IEXA 2V6CA 4ASNA 4B09A 2YPRA 3F8MA 3EHKA 2HEOA 2RNJA 2DQLA 1YLFA 4IERA 3V8JA 2A3SA 3FZVA 1ZARA 3I59B 4HLXA 4A0ZA 2UY8A 5FLHA 2FBKA 4OFGA 1IPKA 5EEGA 3EDPA 3CUQB 4IF4A 4XFAA 2ISZA 2COMA 4OOIA 2PI0A 1ZG1A 5KHHA 2GWRA 2QQAA 4EM2A 4XFGA 2VBWA 3O3KA 3M3IA 3CF6E 4LGWA 1QXJA 1MKMA 1EP0A 2PFWA 2HJIA 1Z7UA 3WE3A 3ETQA 2BYVE 1IPJA 4GYIA 4XFIA 3E5QA 4IXAA 3CO2A 3RZZA 3C7JA 1VJ2A 1ZYRF 1OMIA 3D0SA 1FYLA 4XSXF 1Q3EA 2D5FA 4ZYGA 3W6KB 2E1NA 4OU0A 5JR3A 4IEYA 1O3SA 3MDPA 1RL3A 3OGJA 2XIGA 1SD5A 4UV9A 2P6TA 1QZYA 3ECHA 2K27A 5ILSA 1LR5A 1K78A 1NYWA 4ESJA 4UV8A 4AWXB 3BP8A 2M8EA 2QBYA 3WU0A 2GZWA 5I0UA 3F6VA 4U0YA 2H09A 4G7HF 4XLPF 1V3FA 2EFNA 5J7MA 1FBUA 5FQ0B 1U5TC 2A5YB 3DQVC 3HT1A 2R7DA 3DF8A 1BC7C 3F72A 1KU7A 4HV5A 3F22A 2H27A 1P4WA 1FX7A 2Z2SB 1I27A 2K4BA 4YARA 4CDGA 1OR7A 4UVBA 1OYYA 4ZZDA 2PAEA 4KT5C 4DNCA 4KU8A 5CVVA 4Z82A 2L3DA 1REPC 3BCWA 3RNSA 4U7DA 5DD8A 1UD1A 2GIVA 3LA2A 1LEAA 4JVAA 1FNNA 2B0LA 2JRTA 1SFXA 3H92A 2EA4A 2EK5A 4L5IA 2DK5A 1YW7A 1SQ4A 5J8CA 4EJUA 1JHFA 1NXMA 4YSFA 3ES1A 4EQQA 3N4MA 1L3LA 3U11A 5BV6A 4IEZA 2EJRA 1DUXC 2A6EF 4MGRA 3ZMZA 5FLXK 2O3FA 1B59A 4A6EA 3U0ZA 1W7PD 1X7NA 4A6DA 2PQQA 2IXHA 2RVCA 4E2GA 5J48A 1MJ9A 5AIPA 3R4KA 2BNMA 3ELNA 5A2QZ 1EV7A 3U9GA 2DQRA 4LLGF 1F1ZA 1O5UA 3WGIA 1FYMA 1STZA 1B1BA 3ROUA 3MYXA 2PMUA 2DCTA 1G3SA 4R8HA 3T8TA 3TNPB 4I0BA 5ILVA 1BBYA 4E2SA 3RKYA 2XAJA 1Y0UA 1CAWA 2KJCA 2QQBA 3E6MA 5T3NA 1P4AA 5AONA 2JTVA 1T38A 2FQ3A 1V70A 4L5JA 1YS6A 4MZUA 5DCFA 2FQPA 2DT5A 3KP5A 4ESBA 2EA2A 3GFMA 2Q8KA 4ENKA 1YHFA 1OFNA 2GA1A 3KEQA 1FPQA 3KLNA 3ZN1A 3L09A 4KWKA 1O5LA 1YS7A 5HDNA 3K1MA 2UYAA 3LOIA 2WFPA 4IHTA 4IJAA 3IWZA 5LBQA 4ZU4A 1H1MA 4XFFA 2C6YA 4O9EA 2P7CB 4L9NA 4YG2F 1YIOA 1QO0D 3M8FA 3CTAA 4L9TA 2V1XA 4KA4A 1MD0A 2ACJA 1IN6A 4I7HA 2IA2A 4P55A 4Q29A 3V4GA 1ONVA 3H8UA 1T0FA 4FAHA 1BI3A 4ZYHA 4KFCA 1ON2A 4U0VA 2PMHA 1Z9CA 2HYFA 3E6DA 5E18F 1TQMA 4Q48A 3H3ZA 1UIKA 3FX3A 1VTNC 3RDIA 1CAUA 1NZCA 4DINB 2PQ8A 2VPVA 5FD5A 5E8GA 4HF2A 3S7EA 2HZTA 1OYWA 4HBLA 1G6NA 5K5OA 1WQ2A 4M74A 4M72A 1FP2A 2HYGD 1HBXG 3GF2A 3FXRA 3F6OA 1QXRA 4LUMA 5JSOA 1FBQA 5E20A 1OYIA 2FSWA 4FX4A 3J81Z 3IIAA 2JPBA 5FD6A 1D5VA 2PA7A 4Z07A 2VT3A 2RV8A 4HVRA 1Q1HA 2MH2A 4MH0E 3VEPA 5LRSA 4A5NA 4MGYE 3WGGA 1R00A 1U3EM 3HTSB 3SMHA 3TQNA 4QGLA 1WWXA 5BXXA 6PAXA 2JZYA 3VOEA 1J9IA 3SXWA 5I8SA 3CLOA 5DCMA 1RI7A 3J7AO 2Z33A 2MH9A 1IZ1A 2PYTA 2OQRA 5FLIA 4G6DA 5JCTA 3R61A 3V7SA 2A07F 1RNLA 2HOEA 2W25A 2ET1A 4A12A 3HUGA 4U88A 3FHIB 2NNYA 3EUHA 3C18A 1KYWA 2FOKA 5L3FA 1EPZA 4PDKA 2R3SA 3BJ6A 3BROA 1ZHFA 5DDGA 4MX3A 2V9VA 4CZZA 1XMKA 3KP3A 3REOA 3W6JB 5L3EA 1ZZ8A 3P7NA 1WSUA 5IT9Z 3DN7A 1FBSA 4LK0F 2NRAC 4UNOA 3QU3A 3GYHX 4Q47A 4CHUA 3WW1A 1CGPA 5D6EA 3TKYA 2PLYA 1XGMA 2QNKA 3MZHA 5CJ9A 3TGNA 2EFQA 2P8TA 4RGXA 4KNYA 4RAZA 2OAZA 4HF1A 3PLQA 4RGUA 3R6SA 4YFXF 4RB0A 3CJXA 2W24A 2XAHA 1BN5A 3DP7A 4IEPA 1CAUB 3UKTA 2WTEA 4FX0A 1DPUA 3WG9A 2FRHA 3F3XA 5J6XA 1JGSA 2HKOA 3CL1A 1ULYA 3MFKA 1FOKA 2MC3A 3FMRA 3H7JA 2V79A 3CUOA 2PG4A 3O2PE 2K02A 4Y15A 1P2FA 4EWEA 1PMIA 3E97A 4L0ZB 3RTRA 3IRRA 5BOXA 2IRFG 1EYBA 2VBXA 4LLOA 4KN4X 4EVIA 3GZ5A 1KA8A 3IKTA 2VC0A 3BZ6A 2V1DA 4KWLA 4TLFA 1MDMA 3LAJA 2K7LA 4M6YA 3SFZA 2G9WA 3WTZA 2NAZA 1QY4A 5IT3A 3S2WA 3GBFA 3TNQA 5K5QA 1IF1A 4NQWA 1XN7A 5AVPA 2UZKA 3S0MA 4P9GA 1J3PA 2EV5A 5FFZA 1UHMA 3CUQC 1USSA 2KJBA 3ZN0A 2P5VA 1CAXA 1BOAA 1FSEA 4M9ZA 1FT9A 4HX4A 4FHTA 4GYGA 4BHPA 1UFMA 3Q9SA 5D8LB 4JTOA 3ACLA 2CWEA 2CAUA 1DZTA 4I3PA 3CEWA 2HTJA 2H94A 4Y17A 1I6XA 5L3BA 4AXOA 1TW2A 3GVAA 2K86A 4MQ9F 1DP7P 1UIJA 1R1UA 4DQ2A 1ZVFA 4AVBA 1I5ZA 4M73A 3OF1A 4XF0A 2V09A 3BWGA 1R22A 4IETA 4NHJA 2CAVA 3EBRA 3PVBB 3WTUC 3EO6A 5ED4A 1B4AA 3GYDA 1YUDA 3N97A 3I5UA 4WXDA 4L0YB 1WGPA 3FFQA 1TW3A 2Y0MA 1ZRFA 1ZZ7A 3H1WA 5K1YA 2E1CA 5FFXA 1T2KA 1ZRDA 1J3QA 2BE5F 4XF1A 5ILUA 4HZFA 1J59A 4RB1A 3PQKA 3GFLA 3IHUA 3GWZA 1TTYA 1NE4A 5FLJA 3GUDA 1YTYA 4NB5A 2IC1A 5LLQA 4KL1A 2CO5A 1P6RA 2R7FA 1F9NA 4ENMA 3I0TA 4XRFA 3OCPA 3NL1A 1KYZA 2VT2A 4OIOF 2IXIA 2OQGA 3JW4A 2GXGA 2FXAA 3P9IA 4O3MA 4QX5A 5ICGA 4UUVA 4P5OA 2VN2A 1IW7F 5D5UB 3K0LA 3T5XA 4HDVA 1NHAA 5HS9A 3J80Z 1ZLKA 3T8RA 5LEKA 4L9VA 1IN8A 4LEJA 1LJ9A 4EJVA 3LWCA 1SMYF 1R1TA 4UBGA 5J8FA 4EJTA 4IRGA 3L2CA 2QQ9A 1RUOA 3IBMA 1U5TA 1J7KA 1Z1DA 2OZJA 1LDKB 4QXKA 4ZZLA 4J1WA 4EGYA 4B29A 2STWA 2XL7A 4D7TA 4WBBA 2Z5UA 3LFKA 2OZ6A 1BM9A 5L3CA 4BH9A 4OINF 4LD5A 3ZMUA 4XEZA 2DW4A 4IEOA 4E70A 4HQMA 3ES4A 4UBHA 5A2QK 1ZRCA 3QACA 3DPLC 2A6HF 3U10A 3HSFA 2EA7A 3GLXA 3BU7A 3BB6A 2CG4A 1LEBA 4GO1A 4G7ZF 3LA3A 2Z99A 1G3YA 2H6BA 3I7DA 2HKXA
chains in the Genus database with same CATH superfamily
3TO6A 1U5XA 3SISA 1GFF2 2L7FP 4NWVA 2LMDA 4MFDA 4XVHA 4XJ8A 4RHV2 2ZGUA 3MKWB 1PNFA 1X1DA 1WPKA 1AYN1 2E1MB 5A7OA 3MWMA 2DTRA 3HSRA 3I2GA 3KQ4B 1W05A 1EAH3 1MNMC 4II2A 1MMSA 5A7PA 2IT0A 1S7EA 4WVWA 1RPWA 4HPQA 2Z3YA 3K9TA 1WW6A 2Y48A 5IYDJ 1AR62 4AL9A 1XX5A 3WTWC 4K1YA 2JSPA 3OUHA 1HB1A 4BPZA 3UGHA 3LDBA 3TO9A 4TTGA 1C28A 3NO8A 3C7EA 2YYOA 1OF3A 3SQNA 4YNIA 2BY0A 4KIBA 2UU8A 2VOXA 3WQ0A 1D1AA 4BKXA 4A3KJ 1UU6A 5EYXA 2ZAHA 4IGQA 1WI9A 3GO5A 1XYOA 5ACA1 1XCBA 4WXHA 1MJAA 3PSFA 4XN0A 3LQQA 4Y3OA 3M2MA 1O7FA 4A42A 5HBAA 3QH7A 4K2EA 1GXQA 5L9VA 3WE2A 4OCTA 1H8TC 1K78B 2R1DA 2LKXA 1QH6A 3LEGA 3C2HA 4IPAA 5C8CA 3UKVA 4OIPF 3RG0A 1B9NA 2K85A 4OMZA 3LSJA 1A6IA 1PK6B 2LK2A 4ORFA 4RGGA 3PJQA 1BI2A 1IOAA 2RDPA 3MEPA 2NVQJ 3BODA 4P9FA 2LY9A 4AE2A 1ULFA 4CCCA 3DTKA 2ECCA 3OD0A 2ZXQA 3ZFFC 4HK8A 5KHDA 4ET7A 4PJMA 1YI7A 2WWUA 1MH3A 1SFEA 1J1LA 4GGGA 3OR2C 3VSLA 3AP9A 4CRQA 4M6XA 5D8KB 2BXZA 2V9KA 2CV0A 3LSEA 3EETA 1MACA 2XG3A 2ECBA 3F2ZA 3NSTA 4K21A 4LG3A 1W6QA 5EEHA 5KVRA 1FNYA 3CC2I 5M5WJ 2DOEA 3ZQIA 2VCBA 3TL4X 4LBLA 2D3SA 5GTHC 5FKCA 2YG0A 5T5JA 1P7JA 5T50A 3IB3A 1D5YA 3K2AA 1C8M2 1XGSA 1KQRA 1ND3B 3RRDA 5EQUA 2E9QA 4XCAA 3ZMVA 3HM5A 4D6SA 3NJZA 4WM7B 4U7BA 5JDBA 1UXZA 4LG0A 3V8LA 3N9LA 1HDDC 5ERIA 1BLZA 1F9KA 5LRRA 1RUI1 5LHGA 3WV6A 2HNHA 3A21A 2W57A 5SV5A 1OOPA 1Y43B 4CA0A 4TZDA 4AIHA 3WUCA 5FZDA 2P3YA 3ZFEC 5F3EA 3FMGA 5KHJA 1ULDA 1TT5B 4Z92B 1H1IA 4OYUA 5IP7J 4FXKB 3VBHB 5ICCA 5HPOA 1T39A 2LALA 5L3DA 2KIMA 1C4RA 3Q5FA 1TNRA 3S5QA 2FF4A 1GVDA 1ZGJA 2XLFA 4TXWA 5KXBA 5BUVA 3QYBA 2G9FA 2FNPA 4IL6C 1EV12 1PP8F 2VTXJ 3I49A 3GM8A 4QPOA 4WM8B 3OYBA 4AI1A 1GQGA 1DZQA 2E7QA 4WVVA 1HRV1 1MGTA 3NV2A 2A6VA 4RN5A 4RGSA 2O0YA 1XB4A 4XCBA 1LOCA 5IAXA 2DJNA 1ASJ2 2IXSA 1S2KA 4RL7A 4RB3C 4Y5TA 1ZM1A 2FBIA 4HNTA 3AG2H 4OIQF 2HDCA 1GLHA 3GTLJ 1RMU2 4IHYA 1CAVA 5A3MA 4YG3A 2K3FA 4RMNA 3KWVA 1N3OA 3P1IA 4XTPA 3ZSMA 3AG4H 1Y39A 1QQP3 1I1GA 3OJBA 2WRAA 3QRFF 5GPCA 3BN6A 4LT5A 5DDJ1 1JTXA 4IZZA 2UWCA 1UOJA 4META 2CSOA 3ZYJB 2GA2A 1KGSA 4ISQA 2J1UA 1MH4A 4XUNA 4FISA 2OQ7A 3JU9A 3CIHA 3ZIWA 2VQUA 3ZQQA 2CQKA 2XQRA 3IN9A 1X3UA 3HNBM 3EYIA 1T6SA 2PMZA 2WFF3 3ZXKA 3NAUA 3PTYA 3E3VA 5CFCC 2IWGB 4EN6B 2B7YA 4XN3A 4BQ4A 3CUQA 1I50J 1VQPI 5GADJ 5FP4A 5DD4A 1MQTA 2JENA 2HFHA 3VDBA 2EFWA 2G19A 4PK4A 4D7YA 3BR0A 1F5FA 4F52A 4C2MJ 1AYN2 4AI0A 3MW2A 4HKOA 2EAKA 4G3YC 3CCLI 5F64A 3C2GA 1YQ6A 3PQJA 1BJZA 4XMYA 4DS0A 2VJJA 5B66C 1ZQ3P 5F3GA 2VZSA 1LEDA 4M71A 1B9MA 4FFIA 4JKMA 1I1EA 3WR0A 2OKXA 1QQIA 3SITA 5JXJA 1UYZA 4AEDA 5CISA 1SC7A 1H4GA 4LITA 1W0PA 1SG3A 1P9QC 4NPLA 3AMHA 2HWD2 1XSDA 3G1OA 3BUCA 2K46A 1SACA 4UVCA 3MF9A 2A6TA 2HS5A 2JD9A 3IP4B 1ACIA 2A3YA 1GP4A 2PN6A 1R6RA 1HB3A 5LY1A 5JUVA 2ARAA 3J80K 1AF9A 1RHI1 3F21A 1IUYA 1G9FA 4MLOA 5ACA2 1N78A 1R9TJ 4I3GA 3N7LA 2E33A 1V6NA 3LQCA 2JB8A 3IDCB 1ZKGA 3GZEA 4XONA 2JDUA 2RJKA 4D3WA 2AC1A 3F8NA 1Z0XA 4HNUA 5LGNA 2O9LA 2JKBA 2EWNA 4EJWA 1SMTA 3OY8A 1OBNA 1QWRA 4J1XA 3AP5A 1R36A 2E71A 3OS1A 2P2KA 1JZ2A 4GB31 3IDEA 1ULCA 4HPKB 4I2OA 2WAQN 3U1DA 5LWBA 3B6AA 2JX9A 5IPAA 2XKOA 4O9GA 3ZYFA 1YO5C 3IH4A 3E5UA 4E7ZA 4KMUX 1NCQC 2OW4A 3W2AA 4ZU7A 2HOAA 4LJHA 2ZGPA 5B1BH 1HIXA 5KAFC 1PM7A 3IC7A 3DUIA 1Z7LA 2ZBKA 3OYKA 2HYJA 4Y22A 1VLNA 1O4TA 4CEYB 5C9AB 4WVMA 1RB8G 1OHFA 1HSTA 1EAH1 4F3JA 1V4RA 1ND2C 4NMIA 2VI6A 3CD6I 2OS2A 3HQRA 1MDMB 2LBFA 5C5UA 4V1PA 5FY0A 1OH3A 2L01A 1L3JA 1KQ9A 3JB4C 2ZNZA 4X6QB 4YVSC 3I3BA 4GMP3 3MPBA 4X8NA 3SCHA 1R23A 2L4AA 3PJYA 1FMWA 2GC1A 4DPNA 4E4DX 1NCRB 5AVAA 5D6FA 4E7JA 2R7WA 4JX0A 3DV8A 3OS0A 2VUMJ 5FZLA 4YIFA 3WHTA 4RS5C 2X85A 5BQTA 5H6QA 2UWMA 2D6PA 1QKQA 1N1VA 4WK8F 4RBOA 3KP6A 1V00A 3QPTA 1TWHJ 4P02B 1W4MA 1H88C 2MNGA 4JZRA 4KU7A 2BDRA 3PIGA 5H20A 1XDSA 4XL9A 4RA2A 3A7QA 1RUI2 5H6RA 4YYOA 4A0XA 3NMBA 3WP5A 2BERA 4ATFA 3M3OA 1DIWA 3U1KA 1IO2A 2C1FA 2IVIB 3V8KA 4UXNA 4ZYDA 1O3TA 4EWDA 1JYWA 2PHXA 3M8EA 4NIDA 3FUOA 2X8KA 2RV9A 4W8JA 4FPOB 4XYXA 3K69A 3PMEA 5M0TA 4LMYA 3ZCOA 4JRLA 3WHCA 4YZ5A 4XF3A 3OYLA 4CP9A 3EUKL 1GLNA 4CO8A 1KU3A 4ENJA 3HRSA 2WL1A 4RD7A 5FZ9A 3V7CA 1KU9A 4XE9A 4QTRA 4AVVA 1HRV2 4QMAA 3S6PA 1JYTA 2H1LA 4UF0A 4QU2A 2DLLA 2P7VB 4QU1A 1EH8A 2QQUA 2AACA 3H3LA 2KL4A 2ZGOA 1UCXA 5K0UB 3VBSC 4A41A 1AJOA 4O6JA 3VYUB 4PDWC 1K5JA 1XGOA 3POJA 2WWSA 2M5WA 3F8FA 5L7OA 2MD5A 2E6VA 2CNAA 4AFMA 1SD4A 3FC0A 4UWDA 4BISA 3CJNA 4V2VA 3WOGA 3PL8A 2L4MA 5E1WA 5DDJ2 3UNGC 2R7EB 4CGZA 2EF6A 1AWCA 3WTVC 3A01B 3VD9A 4MTEA 3HOTA 1UMZA 2VZRA 1NX9A 3WTSC 5FWEA 2DO7A 3RYRA 5DV5A 3CKHA 4LFUA 1U12A 1W1WE 2BGCA 3M3YJ 1B35C 3F8CA 2QSFX 2ZAAA 2YX4A 1YQ8A 2D93A 3E6BA 4GD4A 3NAPC 2VIXA 4D69A 5IT6A 1FTZA 4LIVA 5FYCA 5KXCA 5I0RA 4BL0B 5FZAA 2R4GA 3G2BA 2HPIA 4TLGA 3WW4A 1HQWA 3NVCA 5HLIA 4E9KA 1CIYA 3T1LA 2OTJI 3HSEA 1KS4A 2VGDA 5A7WB 2E5NA 1X8EA 3H5RA 2HXIA 2DTWA 4CCNA 4BDYA 3QCWA 2W1WA 1BMV1 1JZ4A 1UPIA 3TEDA 2ZJQF 4V2GA 3ZXEA 4BE3A 3VBRA 2QQKA 1JUIA 1RJ8A 4MGZE 3AFGA 3JRBA 5H9SA 1JKOC 3IAPA 2HQRA 1LAJA 2WJSA 4GJYA 2F4IA 1HSJA 1F2NA 1FV2A 3PNYA 2B9VA 2QDRA 1RUJ1 5F1JA 1QQP1 2DVGA 1A04A 2W00A 1RHI2 3S57A 1K83J 5TGTA 1VQNI 1RYYA 4KUMA 1H8TB 2EXKA 4ON0A 4CP0A 1Z6TA 3DFGA 4XKCA 1HOMA 2ARCA 1TMF3 4HETA 5JLVA 1JTYA 1CESA 1XE8A 2XASA 1X1CA 5LCWL 1JUHA 2VL8A 5F0FA 1YW8A 2KIFA 2A69F 1Z91A 3NKTA 2F4MB 4CXXA 4GB32 2XDVA 2WFF1 3FHZA 2F2EA 2D6MA 2VCAA 2JVHA 2FJ1A 3Q9VA 4MTDA 1A6CA 1JZ3A 1RR7A 2RKHA 1V9U3 2FCUA 3JTGA 2WZR3 1VZ0A 4ESFA 5JFRA 4ZTJA 3D5LA 2WKKA 1EY2A 3V42A 5A7NA 2PHFA 4GFBA 2XJRA 2RS53 1EAH2 1GBGA 4XLEA 4GWMA 3VDAA 1J83A 2D6OX 4GDFA 2I74A 2CWSA 4P9LA 2Q2EA 1W7PB 3GZ6A 4HT1T 3VKFC 2YU2A 3VBFA 1LODA 5ABJB 2IBDA 2GM4A 3B93A 1QPIA 2VE1A 1K6OA 2GMMA 3KYCB 1A6QA 2KT0A 4LB6B 4DJAA 2UY9A 4AYUA 4XBLA 3ZR8X 4ZDOA 4LULA 3R05A 1V6IA 5LFAA 3KGLA 4M6VA 1XYNA 1VRH3 3AKRA 3T0BA 3T1MA 4IEWA 5A6ZA 3CMEI 1A36A 1IRFA 4HSJA 3I2HA 5DUVA 3RPQA 2IEKA 4YVWC 1MBEA 2OU2A 3OV8A 5B5EC 2JK3A 4RLQA 4Q0UA 2B9SA 5FYUA 1ETVA 3WP3A 1H6YA 2HDDA 3C1DA 1LVKA 1BI0A 1W5CC 2W4SA 4W50A 3S2DJ 4L8QA 4XDOA 1JHHA 5CKNA 3JXSA 2CL2A 3GXOA 2O0OA 1GQPA 4E7HA 2ZX0A 2M0MA 2VXJA 2J5OA 3HJEA 1ZGAA 4HNVA 4PF1A 3ZDSA 2GOXB 3BR5A 3Q0VA 3H9AA 5CFDA 1UJ8A 5F7UA 4GWIA 2R043 1M06G 2VECA 3KX2A 2FU4A 4C8DA 2E1OA 2IA1A 3ACHA 3WQ7A 4HMZA 4CVUA 2H1KA 3J7MA 4FFGA 2BTVC 4NIIA 4MEYF 4V19K 4ETSA 4ENNA 3DBRB 3KT4A 3IL2A 3JTHA 4N0BA 3NJYA 2EZKA 1XSVA 5JIUA 5FY5A 2JQ7A 2R7VA 1ZBA3 3CCQI 3KMHA 1C0WA 1RUH3 3C7GA 1USTA 4GMP1 3IAM2 1QOSA 3VN4A 3C3VA 1JODA 1SEFA 2CSGA 2LF7A 3RYKA 2WO7A 1GZWA 2EV0A 1K7AA 1HF0A 1X50A 2D5VA 3GX4X 2JG8C 4Y4RA 2R5ZA 1GNYA 5FMOS 1YXWA 3QYEA 4D0PA 1YYNA 3AP7A 2ADUA 2K3PA 2XGCA 1WLDA 5J40A 4UI9L 5CFCB 4LK1F 3SEZA 3RGBA 3BR6A 3PUBA 2R93J 4UY8I 3R4SA 4D6QA 5D8AA 2EIBA 2VLAA 3PVNA 2D1VA 3KEYA 2VMHA 3ZR6A 4XFCA 4BZ4A 3TMOA 4ASNA 4LO6B 2YPRA 5JOXA 2PN5A 2A3WA 4X0GA 4Y33A 2HEOA 2DQLA 4CEWC 1UZWA 1MSEC 2VKEA 2HQAA 3M8JA 1ZARA 4JQTA 4HLXA 2FBKA 2V1NA 4IV3C 3K4LA 1VQ7I 3VV1A 3C7HA 2CMPA 2Y38A 4Y24A 3FFZA 4YW5A 5BNPB 4OOIA 2VASA 2V73A 1YX3A 1U0JA 2ICWG 2NXNB 4COZA 5LATA 2VM9A 1BMV2 2JKXA 3A22A 2BYVE 1IPJA 2DA3A 4BM8A 5CPRB 1TWFJ 2BQPA 3RZZA 2E60A 4B4CA 4XSXF 1Q3EA 2D5FA 1DG6A 1TT0A 1F4HA 5DUXA 2E1NA 2JG9C 3OG2A 3FLRA 3INAA 1X3WB 2H0BA 3H5AA 1LR5A 1K78A 1NYWA 1IG0A 1QQP2 3AZVA 4ESJA 1WKYA 3PTRB 2L7KA 4P9JA 4AWXB 2ZHKA 5JLXA 2GZWA 5I0UA 1UAIA 2H09A 2VBBA 5FTTC 5C4JJ 3CC4I 4XLPF 1O91A 3AXEA 2ZOEB 4XZUG 1LHNA 5J7MA 1O4ZA 2BY1A 5FYIA 1KU7A 2CGNA 2ZXIA 3HPNA 1P4WA 1S0EA 1I27A 3AKTA 1SCRA 4H2AA 3OBTA 4CDGA 1YJKA 3MZ8A 5CB7A 1OYYA 5FY4A 2WFF2 4DNCA 4KU8A 5CVVA 1W9FA 2ZA9A 3BCWA 1MBFA 2XF5A 1UD1A 2ZS6B 1HDPA 1LENA 1LEAA 3AFHA 5F2WA 1FNNA 2EA4A 2EK5A 2DK5A 1YW7A 1FOWA 3DXTA 4FQGA 1ND2B 4GKYA 4IOAF 4DFSA 4YSFA 3ES1A 2C24A 3N4MA 1L3LA 5BV6A 2EJRA 1QJFA 5FLXK 1XNCA 1FAYA 4A6EA 1LULA 2K2SA 2VZ1A 4LO4B 4CE8A 4YVSB 2HEWF 5FPAA 3U0ZA 1X7NA 4AZZA 4A6DA 4Y5Z0 2WSVA 2YV8A 1H1AA 1ND3A 4CPBD 3MVPA 4C0BA 5A2QZ 1WMEA 3U9GA 4IHXA 4RS5B 2OC6A 1FOXA 1JI8A 4A3BJ 4H14A 4WM7A 4AI9A 3BR2A 1B1BA 1QHHD 2ZGNA 4Q27A 2PMUA 3I2OA 1G3SA 4I0BA 5JI7A 2XAJA 3EUAA 3CDLA 3E6MA 2VVDA 2MABA 5AONA 3R4UA 2JTVA 3K70D 5JVGF 2J7MA 3MICA 1T38A 3FISA 3ZX7A 4L5JA 1VF9A 1JT6A 2VNRA 1YS6A 4YG6A 1TMF1 4AEJA 4CDQB 4AHXA 3GFMA 2Q8KA 4KNCA 4MIMA 5A3PA 4JHZA 4ENKA 2W91A 1US2A 2ZFUA 2X6WA 1S0BA 1FPQA 3G1MA 4M0NA 5FYMA 3U1XA 3PUFA 2TRTA 2QA4I 4WM8A 2WAFA 1EJ9A 1YS7A 3RFRA 3K1MA 4IHTA 4IJAA 2HWC3 3IWZA 1TME3 5FYBA 1H1MA 5BYNA 2P7CB 1V9U1 4L9NA 5C8CC 2WZR1 2MGQA 1YIOA 2LY1A 1WLCA 4Q4V3 3CTAA 4AM3A 1MD0A 2DMTA 4OAZA 3ZMOA 2HI3A 2WB1N 3HGYA 2R7SA 3V4GA 1IS6A 4Q29A 4XPVA 2FBEA 1M1EB 1T0FA 2RS51 4B4PA 3WEZA 3QPSA 5LB6A 1LHOA 1Z9CA 5DAVA 3E6DA 2OV7A 4BU2A 1H6XA 1D1BA 1VTNC 3RDIA 3WQBA 3KZIC 1CAUA 3VZJA 1NZCA 4DINB 4COVA 5FD5A 1OQ1A 2RAEA 3FXOA 2BGPA 4HBLA 4I76A 3OYMA 2HYGD 4KBZA 1B35B 3GF2A 3NV4A 5HNHA 5IFPA 2E34A 1ACCA 1NQDA 1QGLA 1VRH1 2DDUA 4DYRA 2LRPA 3NAPB 5JSOA 2DVAA 1OYIA 2FSWA 1HLCA 4NJ4A 3IIAA 2Y0SN 2PA7A 4KI5M 4CU8A 4AI8A 2RV8A 2C26A 3PFYA 4MH0E 3K4AA 4A5NA 3KCXA 3J7ZI 2VTFA 3FN9A 3HTSB 2Q8EA 1LOEA 2JB4A 3RZOJ 3IT8A 1VBE3 2XPJA 4OI1A 2JZYA 4ZZ5A 1J9IA 5LK7B 4DZJA 1RC9A 5IK5A 1J1TA 2OQRA 2Y34A 2B7EA 5IFTA 3R61A 1OOPC 1RNLA 2W25A 2PHTA 3B69A 4N43B 4U88A 3EUHA 4XOTA 3C18A 4MADA 5L3FA 4PDKA 3BROA 3MIFA 5DDGA 1JYVA 3G71I 3DYPA 4DBQA 5JPMB 2MSYA 3WCRA 3KP3A 3REOA 2DUOA 5DUWA 1WSUA 5CKTA 2AREA 4FOWA 1IV8A 3PO2J 3VYSB 5IT9Z 3GTPJ 3DN7A 3JRHA 2WYFA 5C5TA 3M4OJ 2ZEZA 4CHUA 5H9QA 4R4ZA 2GNTA 1ZBA1 1Q8VA 4ZXEA 4LOTA 4AI3A 1A8MA 2PLYA 1UYPA 2ELKA 1RUH1 4A3XA 1F43A 2EFQA 2JA8J 3R4DB 1IG7A 4RB0A 1GOGA 2GMPA 1VQ4I 1BN5A 2CJJA 2XHNA 2CV1A 1PX4A 2VL4A 4LBMA 2KISA 1DQ1A 2WY7Q 4XW3A 1MBJA 1ZELA 5TISC 1LPQA 2D43A 5J1RA 1HRI3 5J6XA 2W46A 1JGSA 2PHUA 2VR4A 4NHYA 5DG1A 1DQ5A 1FOKA 2MC3A 4DEQA 3FMRA 3S8PA 2V79A 2ZABA 3LSGA 3AG1H 4EWEA 1PMIA 3E97A 1UY1A 4MVTA 4AW7A 4LKSA 4L99A 4PLNA 1WZXA 5A3WA 2IRFG 3RZHA 1WBFA 5C9AA 4LLOA 1D2QA 3JQXA 3GZ5A 1KA8A 3TEXA 4BJ6C 3BZ6A 3F9KA 4QHOA 1MDMA 3LNQA 3HC7A 1QY4A 3SNMA 1HN0A 1XN7A 2UZKA 3ZXGA 1MMDA 3ZQFA 4YGBA 4ARXA 2HBTA 5FFZA 3HQUA 1UHMA 3CUQC 2KJBA 3ZN0A 1FSEA 1MQTC 1NCRA 1KDKA 4AAXA 4JGZC 3LOBA 3OBZA 1PHMA 4XXPA 5KC6A 1Y7BA 3MN2A 1OFSA 4IHWA 2H94A 3NNFA 2DMQA 1PGSA 4COWA 1QZEA 2QQOA 2VQ0A 3K7AJ 5F5CA 2NVTJ 2EZLA 3E7LA 4HL0A 4M01A 1UIJA 1R1A3 1E5IA 3BTLA 4DQ2A 3PUHA 3OS2A 1I5ZA 4M73A 3OF1A 5GALA 3BWGA 4AEDC 4NHJA 2CAVA 4B7EA 3TYJA 2Y64A 3GYDA 3N97A 1AX2A 2X1DA 1ENRA 2WWJA 3POYA 2E1CA 4A3GJ 3N05A 2W08A 4IV1B 1TMF2 1T2KA 4XF1A 2JVGA 2GBYA 4HZFA 2P6CA 1VPHA 1UY3A 1VMJA 2ZXHA 3PQKA 4KJZA 2ELJA 1QF3A 1WCKA 4KL1A 4UAPA 5FXVA 4Q4W3 3AKQA 2E2IJ 3J7LA 3LMMA 5HV4A 4DYQA 2MYSA 1KYZA 1SBEA 2BY3A 4IQJA 4XBQA 4A6OA 1PVC1 4AHYA 2F4OB 2FXAA 3P9IA 5FY1A 4P9XA 1V9U2 2WZR2 2VB6A 4NUBA 2VN2A 3O5SA 2XB0X 5K0UA 4HDVA 5F9TA 3J80Z 1ZLKA 1POGA 1OLTA 3SYTA 4AK3A 5LEKA 4L9VA 5EF6A 1QHGA 4LEJA 4XACA 5JOZA 3J4UH 1SCSA 2RS52 4EJTA 4IRGA 3LGRA 3PDQA 4AFBA 2EIKH 4GIQA 3L2CA 1U5TA 5I0DA 2OZJA 2ID3A 2J1EA 4ZZLA 4NDLA 1UY2A 3VD7A 4D7TA 3O0VA 2YDEA 2Q1MA 1AR81 2JG8B 4OINF 3DEMA 5EZGA 3WLUA 4BEHB 1TZOA 4LD5A 4OWRB 1V54H 2NVYJ 3M8LA 2F6CA 4HQMA 3N35A 1PO13 4R9CA 4A3EJ 5DUUA 2A5ZA 4YZ4A 4ZS3A 3IZOA 3FBMA 1CZTA 1X4PA 1K5MB 4YELA 1QNYA 4XLAA 3T2TA 3BR3A 1VRH2 4D94A 3BZKA 4BQ3A 4D8MA 3OEBA 2KDOA 2VMGA 3BTXA 2CG4A 2DBIA 2ZX4A 4GO1A 1KJRA 3LA3A 2H6BA 1XG1A 3PNTA 1YIPA 1S0FA 5EWSA 4U0WA 5EP9A 4JC1A 1HA8A 1C57A 2YZ4A 4K9SA 3D82A 4FCAA 4A5MA 3OIPA 1SZBA 4IV3B 1NK2P 1JYXA 2F5FA 3FXLA 4RM3A 1X2MA 3QYFA 5TSWA 2WA0A 1DYKA 5FO9B 2HQNA 4XC9A 5J47A 4QGNA 4KBBA 4NIAA 2HWC1 4FT8A 1TME1 2WSUA 2WV0A 2FQ4A 4BXSV 3K4NA 2QJVA 3P6BA 5FGMA 2FEZA 2IJLA 1UU5A 3HR9A 1E3HA 2UUZA 4Q4V1 1AR92 2R042 1BR4A 5CBLA 3OOPA 2JG9B 2MLGA 1MZFA 1S0DA 4XF9A 1HQLA 2KXLA 2O61A 2SLIA 4WVZA 4L11A 5E3OA 4PJYA 5F04A 2GP5A 5CKQA 4BE2A 1R64A 4FPJA 3V65A 1ZBA2 1MZ6A 1NA1B 4HBNA 1RUH2 2O5RA 2WZ8A 4W6XA 4LBQA 2DK8A 3A0NA 2J1SA 2FDIA 5DMYA 3J7NA 3MZYA 4A3FJ 4FASD 2O8QA 3L2WA 2ADEA 2B5HA 1E3OC 5L7OC 3HOWJ 1GT0C 3QQAA 1GV2A 1RKWA 4ZDPA 4UT5A 2Q0OA 4Y26A 1U6GA 4CYDA 2GC2A 4HRIA 1RITA 5CVUA 4XOGA 5E1ZB 2STTA 2XLAA 5CA6A 2OBPA 1PP7U 4QD2A 4G6QA 1W8HA 4XUOA 4C90A 1VBE1 1HV1A 3ISPA 3SH3A 5C4XJ 4C91A 2ZMEC 4H55A 4Q1PA 1DQUA 4IQ4A 2GH2A 4BQYA 2GN7A 2JDKA 2HOTA 5FCCA 2DMUA 1W7PA 3ZSKA 5TJJA 2VZUA 4OAYA 4XLCA 5ABJA 3RWKX 2W52A 3MBWA 2LG4A 3WNKA 1QBJA 3HEFA 2VD7A 2BEOA 1GVJA 1A5JA 3DPUA 2FD8A 1XDUA 3ZQHA 4PJLA 4Q0QA 5BY5A 2VOWA 2KKOA 3OWTA 3BG7A 1VQMI 3AYAA 4PIYA 1OPMA 1JYNA 4XQ4A 2WV1A 3SQOA 3PVOA 3ORJA 3THCA 2XAQA 4S04A 4BK5A 3ZN6B 3I3DA 4GQ7A 3RI4A 2DBNA 1HW5A 3VHNA 1H89C 3VBRC 2PHWA 1VP6A 2DU0A 3NARA 4UVAA 5CQGA 5JSRA 3IRQA 2EALA 2VZ3A 2ZKZA 3HRTA 4E4ZA 3ASIA 3RKQA 1SBDA 3VWBA 1MMGA 4LR4A 4RS8A 1IAWA 2YY1A 2KR2A 5TRDA 3QPLA 2JIJA 2O6GE 4II3A 3K70C 1HRI1 2IA0A 3OYFA 2NS7A 3ECOA 4HYEA 2XKPA 4IEVA 3CLQA 4FOYA 3BIEA 4XLNF 3H8OA 4MO7A 3BJOA 1JS9A 4NHLA 3B01A 2KD7A 1T33A 1MS0A 5HV0A 4Z6YA 1MNEA 1PMHX 3ZXSA 2DWRA 2OIIA 3PFIA 3GCWA 1IS5A 3USSA 4LBOA 4QPIB 2WR9A 3AL0C 2IS2A 4AQ2A 3S3MA 2PX9A 3ASOH 1ITYA 1LQ1A 4GJZA 1F5JA 3DCFA 3ABMH 5M5YJ 4LHNA 2O03A 4XIOA 5FXXA 2DN0A 2L54A 4CXWA 1STMA 3VHRA 4G9YA 5F2SA 4KICA 1ZH5A 1CWPA 1B6AA 1SFNA 1XSRA 4LPLA 2RQQA 2GSYA 4ZY9A 5B4NA 2A6YA 2BXYA 2QQMA 2BNOA 3KQRA 5FP3A 1ENQA 5K7FA 1BOBA 3UJOA 3EPZA 3ECQA 3V7RA 3IH2A 3N3HA 1S0JA 4XTMA 2XXZA 4EGZA 4FO9A 5JOYA 1UMQA 5D5WB 4TN7A 2M7BA 2ISYA 4E2QA 1GWLA 1R1A1 4ZDLA 4QHBA 2PHLA 1LEMA 3VBFC 3CMMA 1FC3A 3VD3A 1W0UA 2IW5A 3B02A 4L18B 4Y1XA 2HTSA 3VBUB 2BHZA 2MC4A 2P5LC 1W6PA 3AZWA 3I97A 3I71A 3BG6A 3HQXA 3K3OA 1AYM3 2BW8A 4BXXJ 2VTXA 3OPZA 1ZAOA 2B46X 3LEIA 1VQOI 1T6GC 2MHFA 4LK7A 4UW5A 3NWTA 5BNPA 3CCMI 5FBJA 2GC3A 2RDNA 2XAFA 1YWKA 4BOWA 2VVEA 5A32A 4HONA 1WA6X 3VL9A 4LA2A 4I6ZA 4BE0A 4UXAA 4Q4W1 3WG2A 5G05L 2CW0F 1QNTA 4HVQA 2LUWA 4BXFA 3WGHA 3ZR5A 5IOZA 1TME2 1VALA 1KQ0A 4TYSA 3JSPA 3NJXA 5CEHA 5DCMB 4EN8B 3BKZA 3FDYA 2KQRA 4LK6A 1IN5A 1CJDA 3TDZC 1ETWA 4Q4V2 3LEMA 2BVLA 3VB9A 3I3EA 4BY7J 2DPUA 2QZ2A 1KXGA 1Z77A 1D3YA 2Z16A 1Q1VA 4GMP0 4V2FA 3KB5A 1SANA 2JN6A 3FHNA 2ZX1A 3IKWA 4F8AA 3KP4A 1YE9A 2XROA 1OISA 3AYCA 5CFDC 3R60A 2R5YA 4JK1X 5D4SA 1QZZA 1SAUA 2CHHA 4HQEA 2PAKA 1Z7S3 3EQLF 3BZCA 2MA3A 3S3OA 5KHIA 1JT0A 2P5KA 4OIRF 3UNPA 3JQWA 1PO11 4Z2YA 2KMUA 3ZSJA 3NNJA 4HW0A 2FUG2 2W1OA 3P9CA 2VJXA 3DPRA 4EJOA 1XGNA 3VHOA 3QPHA 2A7AA 4FAGA 1UOGA 2VNGA 5FZCA 4LO5B 3SEEA 5JPNB 4JQRA 1QPMA 1QA6A 4FBFA 1ND2A 2QQNA 4X6RB 3J9SA 2QLZA 1W03A 3MKYB 4MV2A 2YU3A 3M7AA 5LASA 5KHGA 3KEOA 2ET7A 1VBE2 3NRUA 1TC3C 3CP8A 2ZGTA 1ZG5A 1W28A 1LOFA 3FZ3A 4NRPA 2DFFA 4LMFA 5D8AC 1XE0A 1G9AA 3DEWA 1IKQA 1MQTB 2E1MC 1POV0 4JGZB 2CQQA 1ZZ9A 1T56A 1U2WA 4GXLA 3FE5A 4MYEA 4D9JA 3OSFA 5FRMA 4RS5A 4JGYB 4HDUA 2DOFA 3T0DA 4B8XA 2QQ8A 1JI6A 2ZGLA 2L2OA 2KIUA 3WODF 4G94A 2YUEA 2CTVA 3U37A 1CAXB 2PQSA 1H8AC 4PI0A 2DFEA 4GH4B 4JDMA 1QRYA 1Y1VJ 5LHIA 3SXYA 3WDVA 5HLGA 3KZYA 4F93B 2JSCA 2OD5A 4CDQA 1HKQA 2DDAA 1LDDA 3I4IA 3JCUC 2D7FA 2E53A 4RQPB 4YZ2A 5K7PA 4LBJA 3I9V2 1MS8A 2D5HA 4LJZF 1UKGA 4LBQD 1V6JA 1FXZA 3I53A 3SCFA 1X19A 1DYOA 2TCTA 1HRI2 2Y0IA 4M4RA 3LPFA 3WTXC 3HKZA 4Q5SF 1S2EA 4QDQA 1J75A 1VNDA 1BIBA 3LFMA 4TSVA 1W36D 1HDKA 1GZCA 1MZ5A 2XHKA 3GBWA 4HLTA 3ZMNA 3WINE 3AZXA 1WKMA 3DU5A 3CNAA 1YLLA 3I4PA 1K6YA 2Q1ZB 3AMNA 4P9UA 4IEJA 1DQ6A 1FZPB 1AXYA 4UFLA 3KYLA 3OEAA 4XAEA 5JIAA 2WAQA 1W8TA 3G4SI 1VQKI 2DT7B 2A73B 2AGSA 4HOOA 4Y13A 3BI3A 4KG0A 3JB8A 4Y22B 1P4XA 2VOPA 4B3NA 2W95A 3O0WA 2LOOA 2HWE3 2CUZA 4QGMA 2Y9ZA 1NH3A 3H1YA 2LSOA 2WC2A 4G12A 3LE0A 1B35A 4BK4A 4A0YA 4UFIA 1OPCA 4YW4A 3SCGA 3O14A 2IAIA 1DU3D 2WINB 3NAPA 3DF0A 4W65A 4FPFA 3MKLA 1QIQA 1YFYA 4XQDA 2BGOA 3GBGA 1GV9A 2XBO1 3GTGJ 1R1A2 4UW3A 3QWLA 1IV6A 2NOGA 1ND3C 4Q8KA 1ZNPA 1HLVA 1G9BA 2OPKA 1J3RA 2QVSB 5CVIA 5BNNA 2ZSHB 1X9TA 3C7OA 1EUTA 4XXAA 1QJU3 4WM7C 5FZ1A 4WF2A 4HA8A 2ZKLA 3SHRA 2HPMA 3LA7A 3JRCA 2C6SA 4LBNA 3FBYA 2M0CA 3KSCA 4G6TB 2QZ8A 3K4MA 2ZEWA 4DNYA 3LEKA 4XIDA 1QJX3 1F5TA 1R083 5FLXZ 3AXDA 4N43A 3GZNB 3I3MA 3CDZB 5FY9A 2A3XA 2EFPA 2JA2A 5DZEA 4IEUA 1N3QA 4MXVA 4A6SA 2FOWA 1G4DA 1AJKA 2VULA 4HF0A 4NAOA 2W48A 1IDYA 2FD5A 1U8BA 4Q4W2 1UB9A 1TQPA 5IAVA 1R4NB 2O14A 5FYYA 3E1SA 3KETA 1L7RA 1GHCA 2HEVF 2LRDA 1XRUA 4B3AA 4IHVA 2DA7A 4WM8C 2Q5TA 2PMZN 1GUIA 3KV5A 1XOYA 2R32A 1IPSA 5CZKA 1H0MA 3ST7A 1GMMA 3FXKA 3Q3SA 1ODNA 3QOEA 3WCSA 2R6QA 1ZLJA 2K9NA 3H0OA 4PBPA 5I93A 3MEXA 2L9RA 1BL0A 5IK7A 4UF0B 2FBHA 2RS33 4ARYA 3HTUA 5HLHA 4K8FA 2JDAA 5EZWA 3KGZA 1YRNA 2UWAA 2VBYA 1E3PA 2E63A 2XUBA 1XCVA 2RN7A 4HG6B 2VZOA 2OVUA 1I1SA 1T0FC 4MGTA 4G8XA 4W6YA 3CJIC 1LU1A 2DBBA 2DFHA 1XMAA 3K1PA 3K4DA 1N1SA 1R7JA 1ZX5A 1DGWA 3KCYA 1EH6A 4FPGA 1BBT3 1FY7A 2X29A 5FY8A 4UUSA 1W6NB 3MFAA 1AYM1 4HX7A 3T0AA 4UHTA 2Y30A 1RRJA 4CTEA 2WT0A 2ZMEB 3RWNA 2HVSA 1WI3A 3QD6A 1R1VA 2D6KA 5B1AH 5DABA 5FPXA 1CX1A 1IXCA 2M8GX 4BHBA 5LGTA 4K7JA 3GMEA 3QU6A 4COYA 3WD5A 3JRDA 1OT5A 5EJZB 4FTHA 3ME2A 2XRLA 3IMMA 1KZHA 5C4WA 2F5CA 2R0QC 2QYOA 2LLKA 4JKKA 2CYFA 3KZZA 2O8OA 3VPRA 1QU3A 2J1RA 3GZUC 2NMOA 1XE7A 1TQ5A 4XRMA 2OUHA 3KFWX 1X1BA 5HDGA 4XBFA 4CXYA 5JSPA 4NROA 2YBPA 4LQRA 4HSTA 5GTIC 3ACGA 3T2QA 3S15J 4KMFA 3EUHC 3GALA 2Y0OA 2LNBA 4Y5SA 4WWCA 3KP2A 2VY0A 5FMOL 4D5CA 2QKDA 5JHUA 3HNMA 2R063 1ENSA 1Z78A 2YFUA 4IV1A 1J0RA 4KIGA 4MHRA 3BIWE 4DO0A 1Z7S1 5M3MJ 3V0BB 1OA4A 2B4KA 4OMYA 4AEKA 2PFBA 1W9TA 5BNGA 2HGCA 5EZHA 4E7IA 3L1PA 1JH5A 3POGA 2DT6A 1Y56A 4IESA 2B45X 2GALA 1KS5A 2EH3A 2FMYA 4W1UA 2YR2A 1BC8C 3FM5A 2D1HA 3UK9A 4WCGA 1SMVA 1E2XA 3JZVA 2AYHA 4AVTA 3ZMSA 3AX4A 4RGRA 3AL0B 1YYVA 3CLPA 1LGBA 5KR7A 2G1MA 2ZBJA 2LD5A 1WH5A 3IPVB 4L97A 5FLVA 3KLOA 3EB7A 1UY0A 2ETHA 4YW2A 1DFQA 2NPIA 2DV9A 4CICA 1XSXA 5LA1A 3N7KA 1TP4A 4AIKA 1BI1A 3I8TA 3Q8FA 5CIRA 4HLYA 2NZ9A 3RZKA 2BV6A 1YQ5A 1SDDB 1CF7B 5C9AC 5T5PA 5FWJA 2RDRA 2ETEA 3ACFA 2DMPA 5LEJA 1UZCA 4M3EA 4BEHA 1ZA7A 3SDGA 4ITCA 4F7ZA 2BFUL 3RYPA 1ZR2A 2I07B 4LA3A 1VAMA 4QB6A 2CGPA 1E5SA 5FQ0A 4ZTFA 2W94A 1ONAA 3MLJA 1K5MA 1RUC3 2J42A 1TL8A 3QH6A 4LLNA 5A1FA 2RM23 1NCRC 3POSA 2XL9A 2E19A 5EJ3A 3DKXA 1LU2A 2VQGA 4OHVA 1GR3A 2Y69H 3LCPA 5KAIC 1ZZ6A 2TDXA 2A68F 4Q4ZF 4HSLA 5LW9A 3PU8A 3LSTA 4A3DJ 1TZLA 4INDA 1FTTA 2WA3A 1ULGA 2XOMA 4IEXA 2V6CA 4B09A 2VCMA 3EHKA 3WF2A 3CF5F 1YLFA 4ASLA 3MUZ1 2EPFA 3ZOBA 2UY8A 5FLHA 5A6QA 4OFGA 5BNQA 3CJTB 3EDPA 1WJCA 4CYCA 1ZG1A 1O4XA 2CDOA 3GCMA 3ZXLA 2VBWA 4R9BA 3G6EI 3CF6E 3BCAA 4QX0A 2HOSA 5C7GA 1ETOA 1ST8A 1MKMA 3BLYA 1G86A 2HJIA 1Z7UA 3ETQA 1OSGA 3VBOB 2V4JC 4XKVA 2G9ZA 2BHYA 1NA1A 3W6KB 5JR3A 2WNUB 3ERMA 1SBFA 4OI4A 3H42B 1UMIA 3MDPA 3OGJA 5FAXA 1XC5A 2XIGA 2L0KA 2HWE1 3OL4A 1MPXA 1QZYA 5K0UC 3VD4A 4UV8A 4A3ZA 3DTIA 2CGOA 3D8CA 2M8EA 1JUMA 3WU0A 4OI0A 3F6VA 3WNNA 4G7HF 3AM2A 3B3QE 3HL2A 2EFNA 1ORKA 1FBUA 5JXGA 2XUMA 1U5TC 1OVSA 5LA0A 3DF8A 1BC7C 4PLMA 2JDZA 2EINH 3CU7A 1GZWB 2K4BA 1V6OA 4BACA 1OCTC 2Y6HA 2B63J 1DLCA 1OR7A 1QJU1 1UZZA 1XB9A 4CCOA 3V64A 4BIOA 5FXZA 1AYM2 3BVCA 1REPC 5M5XJ 1ULEA 5FUIA 1NLQA 1YO8A 5DPNA 2MEV3 2BW3A 2GIVA 3LA2A 1QJX1 1R081 4JVAA 1W6OA 2X6YA 2JRTA 1SFXA 5D8AB 4RA0A 4L5IA 3MLLA 3M3EA 3AP4A 1NXMA 5IYCJ 4EQQA 4DIQA 1FPN3 2VBDA 2XH6A 3OGRA 4RSUA 2O3FA 1B59A 2IS4A 2YS9A 4XQFA 3HD8B 3ZYPA 2XGDA 4IE6A 4XRSA 4E6KG 3ZN6A 3CCYA 5AIPA 3R4KA 3ELNA 2VUCA 5H9PA 3K4CA 1XNDA 4COUA 1JUSA 3H1CA 1R1ZA 3KLSA 2ZGSA 2DQRA 3HPGA 3G1LA 1F1ZA 3WGIA 1SLIA 1OH4A 1STZA 2L9SA 4CCJA 2E32A 2NVXJ 2RS31 2ZXWH 4HG2A 2DCTA 1SEUA 1UYYA 4E2SA 3MFCA 4CCKA 1W8UA 1Z7S2 1MS1A 5L36A 4FFHA 2QQBA 3T2PA 2E7AA 4A45A 2FQ3A 4CZSA 4ESBA 5EJCA 3DWLE 2PHRA 3PIOF 2EIDA 1WCUA 3ZQLA 3I2IA 4P5YA 5CAZA 2KLOA 4QPIA 3KEQA 3S1RJ 3ZO0B 3WU2C 1BBT1 3RJ2X 1RVF1 4DZPA 5A33B 5HDNA 2D44A 2UYAA 3RS6A 2WFPA 3WNXA 1MVQA 2Q1FA 5LBQA 4ZU4A 5C3RA 3AMMA 2IGOA 4XFFA 2C6YA 3G6JB 3OUJA 2M9HA 5LD2C 3X2QH 1IRZA 3ZRGA 4IO9F 3M8FA 3ZXJA 3H9JA 4I7HA 4P55A 5DM6F 2F5VA 1ONVA 4I0WB 4LOCA 4YW7A 1GNHA 4FAHA 2X5IB 1GV5A 2BU9A 3ZSLA 4ZYHA 4KFCA 1S2BA 1QOOA 1ZYBA 2VMCA 2HYFA 5E18F 2WS93 1W8WA 1W6MB 5EGOB 3FX3A 3OOUA 5G04L 2PQ8A 4CDXB 5ABJC 4YG0A 5E8GA 2WT1A 3BOPA 1IQDC 5F3IA 1OYWA 3CCJI 2P3IA 5T54A 3VBUA 5CG9A 2RJ2A 1WQ2A 1UQXA 4M74A 5FK7A 3OGSA 1KD7A 4M72A 1FP2A 2LS6A 2R061 3RZDJ 4LUMA 5KNLA 3UJQA 3ZLIA 4E8CA 3VKNA 4CCDA 1QHDA 2ZHLA 4Q5OA 3LPGA 1PGL1 1FBQA 4BDVB 1QEXA 3J81Z 1PMJX 2JPBA 5FD6A 1D5VA 1O59A 2MH2A 3T4HB 3VEPA 4MGYE 5HXVA 3W21A 3OUIA 3SMHA 4QGLA 5IUQA 5BXXA 3ILNA 3PU3A 4NRQA 4V2WA 3SXWA 5I8SA 3CLOA 5DCMA 4BE1A 1RI7A 2DFBA 3AZZA 4M3GA 2MH9A 1IZ1A 4E7LA 2PYTA 3AL6A 5JCTA 4M3CA 1HQNA 3V7SA 2A07F 1UY4A 3APBA 2NNYA 4AYBA 4P14A 2FOKA 1VQ8I 4PI2A 3LSPA 3WNPA 2R3SA 5EDNA 1S5LC 2V9VA 1OUSA 2RMU2 3NNGA 5F0HA 4RFT0 1QU0A 1L7LA 4E7KA 1ZZ8A 4N8MA 4PJNA 5F32A 3I2KA 4IX7A 3WP6A 4LK0F 2NRAC 2LTNA 1YI2I 3KS7A 3GYHX 4XDQA 1CGPA 1RUJ3 5D6EA 4KH9A 2HWE2 2XWJB 3H0DA 1XGMA 2QNKA 3MZHA 1JHNA 1R093 1RIRA 2LREA 3MKZA 4KNYA 2NVUB 4HF1A 3TWIA 1RUC1 1ALYA 3CJXA 3CJIB 4A7ZA 2XAHA 3D5RC 3DP7A 3IH3A 3A0KA 3ZKYA 2RM21 4JOMA 4XICA 1CAUB 5K7ZA 3UKTA 1LUJB 2CUJA 2HYKA 1JTZX 4IGOA 2Z4FA 1RUD3 4L5EA 4MO3M 3MFKA 2JXAA 1LECA 5C3SA 2WQ4A 5GLTA 2X53S 3H3VK 2LR8A 1P2FA 1QJU2 3D1NI 2H8RA 3IRRA 2YGLA 4F92B 1RINA 4KN4X 2Y33A 3A0HC 1OLME 3IKTA 4JGZA 1D0YA 4KWLA 1ZBE3 1JZ7A 1R082 3W6VA 3LAJA 3VHPA 2K7LA 2NAZA 4J01A 3HZJA 5K5QA 3T4VA 4JGYA 1W2AX 3JUUA 5AVPA 3S0MA 2JDMA 1J3PA 4XURA 3W59A 5B2GB 3U78A 3OSGA 1USSA 5BNPC 1W2TA 1V5FA 2NN8A 1CAXA 2DA6A 4FHTA 4GYGA 1MS5A 4RAGA 2VJIA 4BHPA 1MS4A 1VB4A 4GH4A 4JTOA 3VZNA 1DZTA 3DCQA 1FOD3 2VJ4A 5EPAA 4BQWA 5KXEA 2HTJA 2GXAA 2YFZA 5FUPA 2BRTA 2P34A 3PM1A 4N53C 3OYNA 1I6XA 4P08A 4AXOA 1KEXA 1RJ7A 1DP7P 1SLBA 2CUEA 4RQPA 1R1UA 3QODA 5GM0A 1PM4A 2RS32 4A4AA 3WNOA 3S5AA 1OXCA 4J00A 3VKMA 3WTUC 5ED4A 3B6CA 3I5UA 4U36A 1HB4A 1WGPA 2XJTA 3FFQA 1ZRFA 3H1WA 3RPUD 5K1YA 2CFOA 1ZRDA 4GALA 5ISLA 5ILUA 3RZGA 4AEMA 1J59A 4RB1A 4ATEA 3LIGA 3FXMA 3VKOA 1TTYA 3LDRA 3SDBA 3GUDA 1YTYA 4NB5A 2ZGQA 1BBT2 2CO5A 2M34A 3BPSA 3BTAA 3HOZJ 2ZHMA 1UZ0A 3RCOA 3I0TA 3NL1A 1F8VA 2VT2A 2MEV1 2IXIA 2YBSA 3JW4A 4XKWA 3DPRC 4B47A 1GUUA 1K61A 1VIWB 1AX0A 1IW7F 5D5UB 3OPTA 3K0LA 1A78A 1FPN1 2BVMA 3WDYA 2W9XA 2R7ZJ 2YPDA 1R1TA 3A2KA 1Q8SA 3H9QA 4YGEA 5J8FA 5FRAA 2OUJA 4LKDA 2G4IA 1RUOA 3IBMA 4QXKA 1UWWA 5KCMA 2XL7A 1DGLA 3CESA 5FZFA 4QAWA 1LOFC 4WBBA 2Z5UA 2OZ6A 3VYRB 5E8AA 1UX6A 1B72A 3T08A 2DA4A 3ZMUA 1DQ4A 1C3HA 3DBHB 3THTA 3HN3A 4E70A 4FI9A 2LKSA 2WNVB 4FVVA 4UBHA 1ZRCA 1BXHA 2R062 2VOTA 3DPLC 3GTJJ 2RREA 1PJRA 3AJYA 1PGL2 3U10A 2EA7A 1W8FA 3GLXA 3O1VA 4KITB 3IMNA 1WJAA 2WAEA 2DA1A 2VC9A 4NHKA 2Z99A 4UW4A 3J26N 4PBOA 2HKXA 1HN1A 1PVEA 2ADDA 4HAMA 1U78A 2NQYA 1MS3A 1G7YA 3GZTB 1VE0A 2DVFA 2JDHA 2RS13 4CDQC 5ERLA 5AIQA 1FI2A 3EXUA 3RVHA 2X0LA 2P0WA 1OKRA 3GGLA 4GULA 3OGGA 3BTCA 4ZH4F 4BHCA 2H0VA 1ZG3A 4LKEA 1DQ0A 1UKRA 2VXZA 2JUCA 1GQHA 5LGUA 2OA2A 2XMLA 4PT6A 1J2XA 4Y52J 4Z1VA 4BUPA 1DHKB 1WHUA 1ERDA 1GICA 4YFKF 3F95A 2ZJ2A 3KCCA 2R16A 1POV3 2CV2A 1NT0A 1N1TA 4HN0A 2QUFA 3CCRI 4MEXF 3RMXA 4H3WA 5IJRA 5J4VA 4QB1A 1C1FA 1IRXA 3ZN5A 3IKVA 2DCEA 3LSHA 4EM1A 2PEXA 4MHUA 1MIJA 2WS91 1LFUP 2VAUA 2V5DA 4H4KC 4EZHA 4ONUA 1WBLA 2K0GA 3AJZA 3JRIA 1KQ8A 4IW3A 1U5TB 1YG2A 1RUC2 3RKWA 4KDPA 3NEUA 3POWA 1W6NA 2RM22 1G3TA 5FZOA 2M30A 3IDAA 2EILH 3ZP5A 3LZZA 3UT0A 2UXXA 2ZMEA 5GZEA 2K9LA 4YIIA 5JI6A 4XHBA 2GU9A 5GZDA 2J1VA 3PL0A 4XJUA 1DDNA 2JE7A 2Q30A 1G9DA 4ZC3A 5LBCA 2ESHA 2C9KA 5GZGA 4ZYAA 1OUXA 2VUJA 3QBQA 1CPMA 2NNNA 2X6XA 4RFRB 2LKPA 3HMYA 1CX4A 5BNNC 4D1QA 1HQCA 3GF6A 3OYEA 2FNAA 5DUIA 5A3NA 5KK1A 1IGNA 2O1QA 4CPBA 3HBZA 3DXJF 5FKBA 2JECA 2IXLA 3H9GA 5EG0B 3Q8AA 5L73A 1DGRM 3GFJA 4N43C 5CU1A 3FK6A 4BA6A 4C2TA 3ZYBA 1MZBA 3HB9A 4B43A 1UZYA 4P96A 3N9QA 3JBG3 5F6FA 5IYYA 4PIZA 4GWNA 1S4CA 1N25A 3M7GA 4BBRJ 5FYHA 3V0BA 1PUEE 5FV3A 1VAVA 1KJLA 2P4EA 4PCRA 5I8YA 2XF7A 2WLPA 4AFDA 2BZTA 2P17A 2YB7A 2EQRA 3KV9A 1X1PA 3K77A 3WX5A 5CVRA 2J5PA 1R091 2W82A 4CSWA 5IVCA 4QLCU 5B3SH 4BMEA 3HIFA 2A05A 1R5HA 4ZONA 4N90A 2MFZA 2X4HA 5FZ7A 3HWJA 2HU9A 4AVCA 1CAWB 5FJHA 3MW3A 1AL0G 2EBIA 4B48A 4LBQB 4AVAA 3VDDA 4EROA 3M9AA 4FCYA 3K46A 2HR3A 1RUD1 3IPVA 5C3PA 4B3XA 4HEA2 1A3KA 1W8NA 3TP0A 1UW8A 4YFZA 2RG4A 1CZVA 5FPLA 3OR1C 1TNTA 2DJIA 1Y1WJ 3O1MA 1Q8PA 2MEV2 3HBLA 1LKXA 1CF7A 2F5DA 1XQNA 1ZBE1 1GSLA 4LUKA 3OL3A 3SH4A 4PZJA 1POQA 1ZZBA 3OYJA 1UL9A 3ALQA 5IOYA 3OTFA 1IGOA 1H0BA 1WLWA 5JAXA 4L2NA 3K4KA 1VQ5I 1C8NA 2AXTC 5C44J 1FPN2 2BJSA 1GNZA 3ENRA 2J1TA 3PIPF 2ME0A 1K12A 1X36A 1OD3A 3POIA 1K42A 2AXLA 1LTEA 2I45A 2YXSA 4ZXKA 2ZMLA 1DYPA 2CQNA 1FOD1 5D1IA 1SLCA 3U21A 3K4JA 2W68A 2XJSA 3K1NA 4WZFA 1WMFA 5JMCA 5C4WC 1VBA3 4AVZA 2QCSB 5FZ4A 1NK3P 2PBIA 3M07A 1X8MA 4ZYEA 3ITQA 3RSNA 3WW2A 1IRGA 3LFUA 3HBKA 1JKPC 4XJZA 1MJBA 3QLQA 3PHMA 1BK1A 4O65A 2EFOA 2K4JA 4JHTA 4JKLA 3B00A 4QM8A 3ABKH 3I56I 5C6CA 5A80A 5DZGA 1TEIA 1AKHA 3PJRA 2UYBA 4R79A 3KYDB 1JMUB 5C8WA 4NR1A 2EIJH 3BG9A 4IV1C 3EQEA 1OI6A 1GDTA 5CYYA 3CZUA 5E8IA 4ZS2A 3NQOA 3J8F3 4NAMA 2FDGA 1IN4A 3VBOA 2JPCA 1WFXA 2ZCWA 5FKNA 1EH7A 2JT1A 3K4BA 2EICA 5FKOA 3NRVA 5FYTA 4RR3B 2C5DA 4Y4YA 1YFUA 5HI0A 3S17J 1IQAA 1FV3A 2A5WA 2WNUA 4CU6A 4NPMA 4RGKA 3HUGB 4IOCF 2GNDA 2N7GA 3ML6A 4KISA 3D0JA 4QKNA 1D4M3 2AZ5A 4KG8A 4CUAA 4EJRA 3S2HJ 1HJFA 3ZPLA 1XTAA 3I58A 3FMQA 1SVOA 4BY1J 3VZOA 4QX2A 2XV4S 5DYMA 4WX9A 1WW5A 2KDZA 3KIOA 1LRHA 2O7OA 2WS92 4B1RA 5LA2A 1ULOA 4DUXA 3BOWA 5F5QA 3ZGKA 3ZFGB 4QPGC 2PTMA 4HX8A 3H7YA 4RGAA 1ODDA 1S3JA 4KMQA 1UHSA 1D2SA 3O1TA 3USUA 2OUMA 4YZ3A 3LB9A 5HS7A 1Z05A 2X10A 4AWDA 5AC93 4DEVA 4HK9A 1EF4A 4M0HA 5JR7B 5EJ1B 2DUQA 2VCCA 3MGUA 1WWYA 1N3PA 4CDWC 1Z67A 1C5HA 1K5MC 3ZYGA 3I64A 2VQHA 1LB2A 5C71A 4K20A 1WLTA 3HDDA 3PO3J 1OKQA 4IRHA 2IGNA 2JWTA 1Q43A 3OYDA 3HOYJ 5T5OA 3HYIA 3FUQA 2HVRA 1W6PB 1DP0A 2YC4A 2RS11 1MR5A 4OUSA 4X6AJ 5JZGA 3FXJA 5FOBB 2E7XA 3GW2A 4C3IJ 3CMGA 3FJSA 5DN2A 4PUSA 1MMNA 3FF5A 3MCZA 5IVBA 3LKJA 1BQPA 3SKJE 1V6MA 5HCBA 2QENA 4O7XA 3MV11 5A32B 3QAHA 5FPZA 1V6KA 1S55A 4BQOA 1A34A 1O7LA 2A1XA 1YHQI 1WRJA 4PJ0C 4MHGA 1S8NA 4KWJA 4N53B 1POV1 2Y6JA 2M2EA 1MS9A 1YQAA 2MLKA 1BJAA 2BBYA 2XAUA 2X1EA 4QX7A 3BPVA 4FOQA 4XJ9A 1WJBA 1T98A 3DGTA 2WBMA 4AC0A 3WDWA 3P3NA 1VBC3 1SD7A 2Z9OA 3ABUA 3M1CA 3E1F1 3JRFA 2VXDA 3CCSI 2ZKNA 3F8BA 1RUJ2 5F08A 5H2FC 5EV7A 2Y26A 1R092 1YQCA 2M4KA 2VKHA 1UNBA 2R5YB 3LDKA 2X51A 1NA1C 2CH0A 3H5NA 1J58A 5C3QA 3BPZA 5A33A 3SLIA 3R0JA 3W20A 1KRIA 2IPQX 4XFHA 4KIFA 4BXUA 3W9AA 3GCXA 4ABZA 1RUD2 3QP6A 2HVQA 1NLRA 4DY3A 2ORZA 4U2AA 5DAXA 4KYWA 5LBEA 4AFAA 4EMSA 4D7SA 1TE1B 3DPRB 4FTBA 2ME6A 1WCSA 4AF9A 1XD7A 1PVC3 2ZPXA 2CS3A 3OD4A 2VODA 2EV6A 3C7FA 2X5IA 3EYPA 2G7UA 1D0HA 1ZBE2 1IZ3A 5IP6A 3HG9A 1OR7C 3E5XA 1XNBA 2MW8A 1VQ9I 4E4HA 1R71A 1W6MA 4S2FA 1GYKA 2VQTA 2HWD1 2XVCA 5EGOA 2RDSA 2WWYA 3WTYC 3LF7A 4CDXA 4OUEA 1O57A 5EFUA 2NYXA 4YZ1A 2DTYA 5HVQC 2K9ZA 3AAFA 1AOYA 1FOD2 1AR83 3GTKJ 3WUDA 5FKKA 3BC8A 2PAMA 1JXNA 3JBG1 4XM3A 1YOVB 4FTSA 1XBFA 2UURA 2E31A 2D45A 3J7AY 3OPWA 5I0SA 1BEV3 5H9RA 4AVPA 3BOQA 5BS6A 3R0AA 2F6BA 3MD2A 4G7OF 1OVPA 4MGQA 1OCCH 2A71A 4U87A 2KZGA 3CP2A 4FSJA 1RTVA 4M3CE 5K4LA 1WJEA 2VZVA 2JMWA 2QDNA 3KT1A 1U9OA 1Y9QA 1BVVA 3A4CA 1X82A 1S7OA 3ESWB 3L2HA 3HRUA 1DQ2A 2XVLA 4OI2A 1NG0A 4A69C 2QE3A 2COBA 1BW5A 4QQPA 1GOFA 3LSIA 1ODMA 1W0TA 5IVEA 2M3AA 3DEEA 1OC1A 1RUG3 2D6LX 1DPRA 4HSRA 1E0EA 2I5UA 3ZN4A 3IWFA 4QPIC 2YU1A 4M3FA 3UGGA 2ZX2A 5HXMA 1BVP1 3T30A 4HN1A 3CMAI 4A7KA 2PJPA 1H9TA 1BK0A 3LD8A 3L2RA 3A0BC 3K2ZA 3CJIA 1S9HA 2H8WA 5GAGJ 2Q4SA 2OT7A 1XU2A 2HWF3 5A3UA 1W90A 2LVSA 2LC2A 3W3CA 2DXIA 2LW8A 4PIXA 2Y75A 1UHWA 1LJ7A 1SVMA 1ZRRA 1VBA1 1QDCA 1FX5A 5IT9K 2XGXA 1I5PA 5I0TA 5F3CA 4S05A 3MO4A 5FOJB 1K45A 4QKBA 5GLZA 4H0EA 3VUOA 5FBZA 4AQ6A 2VPLA 3CJQB 2VW2A 3WNMA 5CG8A 4QPYA 5D21A 3G3ZA 1F35A 3HOSA 2AENA 3VBUC 4EATA 4JQFA 4LBKA 1O3QA 3B5LB 3T0YA 1PO23 3HN1A 4DRRA 2Q8CA 5BNNB 1WW7A 2DOAA 3C3WA 1OCZH 3VFZA 1PYVA 5IK8A 2RS12 2RJLA 2X05A 4Q4Y3 2D40A 4FOVA 4Q26A 2DU9A 3ZQGA 5E1XA 1V5GA 2RE9A 3RSJA 3J8F1 5LBBA 1GXPA 1KONA 2XSJC 2IS6A 4I09A 1PIV3 2XPVA 3MAJA 1JU4A 4FPLA 4URTA 3UR3C 5J36A 3EJKA 4QM9A 1U8RA 5C3OA 2ELHA 3BCBA 5FP9A 2LFBA 1G2HA 5I8TA 2OJED 1O8SA 2L9NA