1RUOA

Catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3')
publication title Aromatic hydrogen bond in sequence-specific protein DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 45
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ruoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruoA01
1H9GA 3M7GA 4I02A 4BHBA 3NVCA 1TQ5A 2LF8A 2V09A 5HLGA 1XE8A 1SD6A 2OPKA 1W7PA 4UV8A 2CAVA 3FF5A 5HDGA 4EGYA 2WC2A 3KZZA 3BY6A 4G9YA 3BU7A 2OQRA 3GZ5A 1D3YA 3U9GA 1RUNA 2DK5A 4HW0A 4KL1A 2FRHA 5L3GA 2PAMA 5BUVA 2GH2A 4M6YA 2DO7A 4ZU4A 4A12A 2XAFA 3QACA 2QWWA 1Q1HA 1OYWA 3F3XA 1U5TB 5CU1A 3OOPA 3FZ3A 3REOA 1MKMA 4I7HA 1IPKA 2RQPA 2V79A 3TGNA 4WBBA 3BCWA 3WE2A 1F9NA 3OF1A 1FPQA 5BV6A 5ICFA 4PIZA 5T3NA 1NE4A 1ZG5A 1VTNC 3BP8A 2PFWA 5FPZA 2IP2A 1B4AA 2TDXA 3WTZA 3WTXC 2XRNA 4HQEA 2O8XA 3LQRA 2A07F 3M8FA 3WTYC 2FF4A 3KP6A 5FLIA 1BOAA 2O3FA 1JUHA 1PP7U 1J75A 5K5QA 1BIAA 3H92A 2R3SA 2QNKA 2UY9A 3ES4A 5ERIA 1SFNA 2GC0A 2ET1A 5FLXZ 2PQ8A 4JVAA 3U10A 4ENNA 4XEZA 2PBIA 1FBUA 1U78A 2R7DA 3CUOA 2WWYA 4XFFA 5I8TA 1W7PD 4K8FA 1JXSA 3WG9A 1YFYA 2VC1A 2DK8A 3GYDA 1F1ZA 3WW4A 1IXSB 3I54A 1D5VA 1O3QA 4S05A 1SFEA 1F5TA 2CAUA 2KKOA 1ZLJA 3QU6A 2D5HA 4ZU5A 3E6BA 4IHTA 2P5VA 4LUMA 2HDCA 2XAGA 4YIFA 1K6OA 2KXLA 3DN7A 3V7CA 3SCHA 4KICA 1ZZ8A 4ZH4F 2YU3A 1MJAA 3CEWA 4HDVA 4LTAA 3PQJA 1XDSA 4P5OA 5JHUA 3DKWA 4OMZA 2IC1A 2MH2A 2O0YA 3PQKA 1ZRDA 3LWCA 2ESNA 2WTEA 2GIVA 3BZ6A 3F21A 4MGYE 5FCCA 1LEBA 1RGSA 1BI0A 4I01A 1Y0UA 3RYRA 3TO9A 2IA1A 3KEOA 3TKYA 3M8EA 5J48A 2PJPA 4M9SA 3WTTC 5L3CA 2J5PA 2QENA 3K9TA 4GULA 1LDDA 3WU1B 4Z82A 1MGTA 1J3RA 4I09A 2F4PA 1L0OC 5BMZA 2ESHA 3E5QA 2BYVE 5KVRA 3IKVA 4Q0SA 4RB2C 5HS8A 2HYFA 2FXAA 2V1DA 3R0JA 5E20A 1PDNC 1USSA 4EM2A 3I71A 1QXRA 1FLIA 4J1XA 4B8XA 4HDUA 4U7BA 1XGOA 3I0TA 4U7DA 3F8CA 5HLHA 2QJVA 5I8SA 4P96A 1HW5A 2Y0OA 2G7UA 4MV2A 5JR7B 1GHCA 2FMYA 1FC3A 3B73A 3M70A 4ESFA 4O9EA 3I4PA 4MGRA 4BXUA 4LLLA 3K1PA 1LNWA 2IXLA 3HRSA 1B59A 4M71A 2HKOA 3LSTA 3JW4A 4PZJA 2UYAA 4RAZA 3RZZA 4PGHA 3WW3A 2H09A 3L00A 1J58A 4H0EA 5HDKA 2ZCWA 1KYZA 1Z9CA 1BC8C 4N9HA 1U3EM 5A2QK 4MGKE 3J80K 5FB2A 5H6RA 3FHZA 4XSZF 2A5YB 1ZLKA 2CWEA 2PHDA 1J3PA 2V6CA 4XF4A 3FWEA 3GYHX 4MQ9F 2P7CB 4OFGA 1MJ9A 2GA1A 4AXOA 4S04A 3SMHA 1B1BA 4N9IA 1ONVA 3SCFA 3ZMTA 4RGRA 1LKNA 3IWFA 5D6EA 4Z2YA 4L0ZB 1P4AA 1LQ1A 3CDHA 5BY5A 1CAUB 4LD5A 4IEXA 1W5TA 3RTRA 4JTNA 2RKHA 3ACLA 3TO7A 2ISYA 4NHJA 2YPRA 2Z5UA 4IHSA 1FBQA 1G4DA 1LR5A 1S3JA 2BNOA 4OU0A 3FM5A 2LKPA 4YNIA 3BWGA 5DV5A 1J2XA 4XF3A 1XE7A 4Q0PA 3I59B 4UBHA 1BI2A 3HT1A 2DU9A 2A6EF 4XLNF 2IA0A 1XN7A 2RNJA 3CJNA 3N97A 2VBZA 1KU3A 1K78B 5A2QZ 5L3DA 4KIBA 2KJBA 2QDRA 2VBXA 2KIUA 3KMHA 4TLFA 2JT1A 2CYYA 1KU9A 3G73A 1RTVA 2D1VA 4QLCU 3MPBA 4UVBA 2NNNA 3EYYA 3CLOA 2STWA 5AVPA 1OKRA 2EWNA 4MTEA 3CL1A 3M9AA 1S7OA 3Q5FA 3RDIA 2VECA 2L54A 3F8FA 1WQ2A 2XLGA 1J3QA 2PMHA 1G6NA 4JK1X 2P5KA 5EZWA 4PGGA 4A5NA 1YO5C 3BALA 1UFMA 2VBWA 4Q47A 4WVZA 5CADA 1FY7A 1OFNA 1G3WA 2MBFA 1YLFA 3EQLF 2QBYA 4BQAA 2XAJA 5D6FA 5LEJA 2FOKA 4GGGA 5DUIA 1ZAOA 3H1YA 4UBGA 3ST7A 2Q8KA 4X6RB 3MDPA 4KN7X 4U88A 4YFKF 2RN7A 4G6QA 4CGZA 1T2KA 1YTYA 2ETHA 4KA4A 1OR7A 4EWAA 2XAHA 2ZXJA 2PA7A 1QWRA 4LK0F 2EFWA 1QZZA 2FBIA 2GQQA 5ED4A 3KEQA 1EV7A 2VE8A 4LK1F 1J59A 1C0WA 1ZVFA 4AQ2A 3GX4X 4HN0A 4Q4ZF 3COAC 3RKYA 4GCVA 4ESBA 1DUXC 1IRFA 5FO5A 1CF7B 3GF2A 3MQ0A 4FAHA 1OD5A 5DEQA 2IXJA 4HVQA 3KSCA 5FGMA 3JSOA 1HKQA 5E1RA 1R00A 1R58A 3L2CA 3NW4A 3M1EA 3BOQA 1XGNA 1Z05A 3HT2A 1FXZA 2PAEA 3HTSB 3EYIA 1U5TC 2Z9OA 4LA3A 3S0MA 1JE8A 3IWZA 1O7FA 5K8SA 1CAXA 1FP1D 2VE9A 4HF1A 3KZYA 2HJIA 4L5JA 1D8KA 4RS8A 1IZ1A 1NXMA 3RI4A 1R1UA 3SZPA 2H6CA 1CGPA 2DTRA 1TW2A 3MWMA 2EV0A 3RIRA 2Q0OA 2DQLA 4QM9A 4YFXF 1I27A 2NAZA 2PQQA 2MLKA 3GLXA 4MH0E 5EEHA 2HR3A 1A04A 2CQKA 1XDUA 4IEYA 4KDPA 4P9GA 2X0LA 1SFUA 4Y13A 2IXHA 1H1IA 4G7ZF 3EQEA 5D5VB 3S2WA 2K4BA 2UXXA 1XRUA 1EH7A 3WTWC 4CZZA 2ZJ2A 3H9AA 4GO1A 3ETQA 2DCTA 4WX9A 3F8BA 1XSXA 2VODA 1LJ9A 1S6LA 1NE6A 4LLNA 2GU9A 1UCXA 1PM7A 2QM3A 3O6BB 1TNTA 3GFIA 1RL3A 4P9UA 1OMIA 2IPQX 2FMLA 3C18A 3K1MA 5KHGA 1ZGJA 3L7WA 1P92A 3KE2A 3RJPA 4UUVA 4UHTA 5DCMA 1IN8A 5IT9Z 4HV6A 4IETA 4IVNA 2VT2A 2ZMEB 4QXKA 4E2SA 4WF2A 2PYTA 5JI6A 2GXBA 2FNAA 4E2QA 1IAWA 2E1CA 2L4AA 5ICEA 3D82A 4KNYA 3GEZA 1CX4A 3ABUA 1YS6A 4YSFA 1WWXA 5F6FA 3IRRA 2MD5A 2C6YA 4CO8A 4R52A 3JAMK 1O3TA 4LMYA 2QYOA 4IRGA 1IUYA 5I93A 3ECHA 2A6HF 1L3LA 1HQCA 4ZYEA 2J5OA 4O6JA 1O3SA 1UHMA 1ZNPA 3SZTA 3LA7A 2M5WA 1Y3TA 4HLTA 1G3SA 4Q0QA 1CAVA 4XBFA 2ZKZA 2K86A 2GC1A 2VXZA 2XV4S 5JCTA 5I8YA 1DDNA 2IXKA 1P4WA 1ZZBA 3DF8A 4L9TA 3PVBB 2LDUA 4AIKA 1FT9A 1BBYA 3FXRA 3UKVA 3SHFA 2B9UA 4FBFA 4KWLA 4XETA 1IW7F 1WRJA 2OAZA 4X6QB 1TQPA 2OQGA 1BC7C 5ICCA 3O3KA 3QPTA 2GA2A 3VHRA 1V4RA 2VQAA 4IF4A 2Z33A 1QPMA 1FSEA 4YG2F 4NQWA 4IRIA 3DXJF 5ILSA 5L3EA 3BROA 4I2OA 2IXIA 2X4HA 4TV7A 3EJKA 2HQRA 4XFCA 4MX3A 3HRUA 2VT3A 1ZX5A 2EK5A 3RYPA 2BE5F 1Q3EA 2F5DA 3M3IA 2QVOA 4PCQA 3ZMVA 3H3UA 4P55A 4YARA 3LA2A 2JRTA 2HGCA 3W6KB 2QVSB 3V7SA 3JTHA 4ZU7A 4A0YA 3QRFF 5LHGA 3E5XA 2B8MA 2V1XA 3R0AA 3DV8A 3E5UA 3HHGA 3O14A 4AVBA 1VP6A 3I58A 2NYXA 3ML6A 3P9KA 4RB0A 4MEYF 2ET7A 4FAGA 3ABTA 1YYVA 5DD4A 4L2NA 5FQ0B 1JHFA 3CLPA 3ERED 5CVVA 1YG2A 1T38A 5K5RA 2FBHA 1ZREA 3E97A 2VOPA 2GZWA 2OZUA 4HV5A 3TOAA 5JAXA 1J5YA 3RYKA 4IXAA 5K1YA 3CUQC 4LGWA 1CAWB 1KA8A 4EVIA 3MZYA 3KP5A 3VB2A 2DI3A 4ONUA 2XKOA 2ZNYA 1LVAA 3F23A 1LDJA 3HQXA 1ZZ6A 2Q0AA 4QGNA 4FX4A 5JSRA 2OYZA 1HKSA 4DNCA 2F5EA 1RIOH 2IW5A 2COMA 4F7ZA 1XD7A 3FM3A 2ACJA 4MEXF 4OIQF 4JV4A 2FEZA 2CGPA 3ZN1A 1ON2A 3BPXA 2EFQA 3I5UA 1ZYRF 3SFZA 4MZUA 2MH9A 1E2XA 1P2FA 2O1QA 4OOIA 5E18F 2RC4A 2P17A 1YW7A 3L09A 2QUFA 5FD5A 2W85A 5D4SA 4ORFA 2UWMA 3U2RA 4CYDA 3F6OA 4Z07A 4ENJA 3L9FA 4WWCA 2Q30A 1PMIA 3WODF 4HF2A 4G7OF 3HSRA 1IPJA 2XKPA 4GYIA 4I3PA 4Y15A 1FZPB 4I0AA 2HFHA 4RD7A 2OZ6A 4N0BA 2XVCA 2PLYA 4KWJA 3OGJA 5H6QA 2O8QA 3E6MA 4IEVA 3ISPA 2K7LA 2P6SA 1R1VA 1OYIA 4AD9A 3K1NA 4IEPA 4HX8A 1DZRA 4A6EA 3V7RA 4RB3C 4EGZA 1MDMA 5BPDA 4EJTA 1JGSA 1REPC 2EB7A 3TNPB 1B9NA 4MGZE 1H9TA 1XMKA 1Z6RA 1O5UA 2Z2SB 1ZGAA 2IT0A 3WE3A 2L3DA 3QU3A 2DBBA 1BIBA 4HYEA 4EJOA 4F8AA 2PHLA 2E7WA 2OD5A 1YQAA 5JSPA 5CVRA 3I64A 2PAKA 3LAGA 1J7KA 3EETA 5I0TA 4KMFA 5JFRA 4O5VA 2R7FA 1RNLA 2B0LA 2L02A 1V3FA 4HBNA 4DQ2A 1XGMA 2PN6A 3DPTA 1HSTA 4L5IA 2QCSB 4U0WA 1GVJA 1V70A 4L9JA 3N4MA 5D8LB 4PJYA 1R5GA 5I0RA 4OLLA 3I7DA 3IIAA 3HIFA 1WLTA 2OU2A 3J80Z 2XLAA 2DLLA 5HS9A 3LQQA 1BN5A 2Z69A 3HTUA 3LA3A 3G3ZA 4HMZA 2A3SA 5J8FA 4L0YB 3LFKA 2IVMA 2CW0F 3T8TA 5D8KB 5E17F 3CUQB 3CF6E 1DPRA 2XHKA 3NKTA 4HVRA 1OPCA 4AVAA 4IJAA 1AOYA 4FT8A 1HW1A 3ZMDA 2E7XA 5K5OA 5E16A 1WKMA 2M8EA 2PFBA 3T8RA 4LG0A 2W57A 4D0PA 2G9WA 3IHUA 4KWKA 1FBSA 3BDDA 1I1GA 1HBXG 2CG4A 2RDPA 4P9FA 2P7VB 4EM0B 5HDNA 4RGXA 3D5LA 2CV6A 3T0YA 5D5XB 3DP7A 4EM1A 2O61A 3W6JB 4OIRF 4BNCA 1SMYF 2K0GA 2UY8A 2JPBA 3IRQA 3GFLA 2V1UA 3TOBA 4ETSA 5AONA 3HOTA 3HRMA 2OBPA 4LUKA 4QMAA 2ELHA 3P9CA 3U1DA 2PTMA 5D1IA 1STZA 5E1XA 3BJ6A 4YFNF 4KYWA 2UXNA 2CFXA 4UVCA 3TDUC 1H0MA 1ZG1A 3BJAA 3V8KA 1SEFA 4EWDA 5C6CA 4HSJA 1TQIA 5CJ9A 3ROUA 1W7PB 4I98B 1TBXA 1UPIA 1CAVB 4R79A 4DINB 3ULQB 1YW8A 3P7NA 1FX7A 4XF9A 2KRFA 3I53A 2XROA 4HLXA 2XL7A 4H7LA 2A69F 3CTAA 3R60A 4KMUX 4O3MA 3D0JA 2NS0A 2B5HA 1X8EA 1LB2A 4M74A 1IRGA 4IERA 4A2UA 1T98A 2VOOA 4M73A 4AQ6A 3S7IA 1X3UA 5FFXA 3QAHA 2N7GA 3DQVC 4HAMA 2VC0A 4JTOA 3FHIB 1GQGA 1YIOA 1K79A 4XFIA 2WFPA 1KU2A 5LHIA 2W24A 5J6XA 1Z1DA 1UW8A 4XF1A 2D2WA 2P8TA 3MCZA 4LB6B 3F8MA 2C0ZA 2STTA 5FLJA 4KT5C 3ELKA 4EJVA 1U6GA 1DGRA 4BYYA 1EPZA 4WCGA 4XFHA 3IDBB 4WK8F 3IBMA 4HSLA 4MUVA 2D45A 3EBRA 1S7AA 4IEWA 1OYYA 1VR3A 3E3VA 4A0XA 3F22A 1NHAA 1O7LA 4KFCA 3TNQA 3T5XA 4LLOA 2KJCA 4IEZA 1SQ4A 4EMSA 3EUHA 1T0FA 3I59A 3GBFA 4YIIA 5E1ZB 4YYOA 3TDZC 3H3ZA 2OZJA 2VBYA 2HYGD 2DPUA 4NB5A 1BJAA 4CICA 1R5HA 1QNTA 4PDKA 4MHGA 5D4RA 1O4TA 4BAYA 3HHHA 4JBAA 2PG4A 3MZHA 4XSXF 5LRRA 3J81K 1PP8F 1KGSA 1U2WA 1EH6A 1I6XA 1MZBA 5J7MA 2EA7A 1ZRRA 1X8MA 4UV9A 4RGUA 2P5LC 3FXQA 2K02A 4UXAA 2HTJA 1WSUA 4U0VA 5L3BA 1BI1A 4LFUA 1WGPA 5CVJA 5FLHA 1T39A 3H7YA 2DW4A 3QOPA 1LDKB 1O3RA 3KP3A 1IXRC 5C8WA 4R8HA 3QP6A 2BV6A 1MJBA 2MC3A 4HN1A 3V8LA 4LEJA 4RB1A 4M6XA 3E6DA 4META 5I0SA 4EQQA 3MFKA 4LJZF 4AWXB 5LHHA 1KYWA 3D0SA 5EFUA 4NVPA 3PNAA 2ZBKA 2H94A 4G6DA 4XFGA 5F1RA 1FSHA 1ZHFA 3EDPA 3DL3A 2VONA 1GQHA 1TTYA 3G7DA 4IRHA 3VODA 1RUOA 3E6CC 2H27A 3J81Z 1QZYA 1X82A 1G3YA 1T6SA 1EH8A 2BBYA 2EVXA 3ZMUA 3OV8A 3U0ZA 4BHPA 1ZARA 1UIKA 2JTVA 1Q5OA 3BPZA 3C3VA 1CF7A 5KHHA 5FLXK 3TO6A 4EWEA 2D40A 3F8NA 2GC3A 4FX0A 3R6SA 4HLYA 4L18B 2IJLA 3FFQA 3HRTA 2HQNA 4ENMA 2XLFA 4QGMA 2EJRA 4WXHA 5J3UA 2ZNZA 1B6AA 3GVAA 2HWVA 4BHCA 3ZN0A 3JAMZ 4Q0VA 1SAXA 3GFJA 1QBJA 4L9VA 1MDMB 4QM8A 1FYMA 4EV0A 2MPFA 5AIQA 4KUMA 2ADUA 1O57A 4RAYA 3ECOA 2QZ8A 2HOEA 5JSOA 2A61A 2CSOA 5ILVA 2DPDA 2AS5F 3LOIA 1YS7A 2KIFA 2RV8A 4UXNA 2Q1ZB 4ZYGA 1XSDA 4QWQA 2QQ9A 2W84A 1SD4A 3MAJA 4MGIE 2Y0MA 2D1HA 4ASNA 2ZFWA 1R23A 4A6DA 1EY2A 2I45A 4EJUA 4AIJA 4KU7A 3UKTA 1TLHB 3FMRA 1UD1A 1NZCA 2K9ZA 3KP7A 3K69A 2EV6A 3LAPA 2DQRA 4OIPF 1SMTA 2L01A 4M9XA 4HQMA 5BPIA 4G8XA 4WXDA 3C1DA 4XFBA 3WTVC 2K27A 2AXLA 1GXQA 5CVUA 1U12A 3RNSA 4D7TA 2UZKA 4GYGA 3GZ6A 1EP0A 4J1WA 4BH9A 2D5FA 3NRVA 3IDCB 5DYMA 2NNYA 2V9VA 3NJZA 5CYVA 4PIYA 3ES1A 4IEQA 3FMSA 3VFZA 1IN6A 1S8NA 4IEOA 5I0UA 5DUKA 5LGNA 2VPVA 4B09A 5I91A 3QPHA 1XGSA 4HOBA 1DPUA 5BQTA 2XL9A 4LG0B 4XF0A 3RPUA 1MD0A 4OINF 2M30A 2ZMEA 1P6RA 2Z3YA 1QQIA 2A68F 4BIFA 3KLOA 4G94A 1AWCA 3SCGA 4MQVA 3Q9SA 3S7EA 2M1BA 1USTA 2FA5A 3KGZA 3H8UA 3ZQ7A 3RKXA 2F2EA 2QBYB 3GUDA 2FBKA 1YFUA 3EO6A 1R1TA 3O2PE 1YFXA 2LNBA 3ZP5A 3AAFA 3T1BA 3JZVA 3CJXA 5LRSA 3F6VA 4G7HF 2LSOA 1E17A 1ZG3A 3OCPA 5IT3A 5BPXA 2FNPA 2P6TA 1DZTA 3ELNA 2Y75A 2FSWA 3NSTA 1FP2A 3HUGA 1FWZA 4ON0A 3RPQA 5JR3A 4HX7A 5HOOA 3CO6C 2IRFG 1RZ4A 4MNUA 1HXDA 1ZN2A 3FX3A 4AVPA 4ENKA 3WTUC 3K2ZA 2KIMA 1ZRCA 2O03A 1U5TA 2OA2A 1DGWA 1WI9A 5D5UB 3WU0A 1FYLA 2FQPA 1IN7A 5FD6A 5KK1A 3SHRA 1UB9A 2XGXA 2PEXA 1U8RA 1NYWA 4LLGF 1FNNA 2M45A 3ZMSA 5ILUA 3HSEA 3P9IA 2GC2A 1CAXB 2RGVA 5HLIA 5EEGA 3HYIA 4EJWA 1XB4A 1YW9A 5H20A 4O9GA 1LRHA 3WGHA 3MEXA 5CVIA 4ZZDA 2L4MA 1XSVA 2XAQA 5FDBA 3DPLC 3NL1A 5KBFA 1IN4A 3WTSC 1I1SA 1W4MA 3WW2A 1L3JA 1IF1A 2EAAA 1J0RA 2MNGA 1KQ9A 3OTFA 3ZDSA 3RKWA 3KP2A 2F5FA 1DP7P 2BGCA 4XLPF 1D8JA 3KP4A 1J9IA 2ETEA 1ZZ7A 4XFAA 3PLQA 3H7JA 4JQFA 3MYXA 3BPVA 2YX4A 4LULA 6PAXA 1YWKA 2DFIA 2FU4A 3ZMZA 2GAUA 1RC6A 4D7SA 5HI0A 2K4JA 1ZRFA 4E2GA 2E9QA 4LA2A 1XCVA 4ZZLA 1SFXA 2G7HA 2H0VA 4XRFA 3KFWX 5FQ0A 1SD7A 4L9NA 1UIJA 3ZPLA 1YUDA 2YSRA 2D93A 3F72A 2W25A 2E1NA 1ON1A 5DCMB 1CAWA 1FOKA 1TW3A 2QQBA 4HA8A 5KHJA 1Z6TA 4RGSA 1BI3A 3FMQA 5E1WA 5LEKA 1YLLA 3GWZA 1LEAA 4HBLA 5DD8A 4UNOA 3WW1A 4AIHA 4ESJA 3NEUA 2LF7A 3DFGA 4IEUA 1IN5A 5ICGA 1PUEE 2HS5A 2NRAC 3U11A 2BEOA 3Q9VA 2P4WA 2QLZA 2HTSA 2HKXA 2QQAA 2IXCA 4HZFA 4ZYDA 1QGPA 5BXXA 3GXOA 3LWFA 2XUBA 5DDGA 4HF0A 2HEOA 2ZKLA 1QO0D 3BJOA 3IL2A 3FJSA 3KLNA 2OA4A 1W5SA 4FHTA 3H1MA 3HOSA 1X7NA 3IKTA 4Y17A 2EFOA 5J8CA 3VOEA 1UCRA 4KN4X 3V8JA 1XMAA 3V4GA 1TNSA 1Y9QA 4IESA 3GFMA 3VEPA 3GW2A 4I0BA 1ZZCA 2XASA 2ISZA 4Q29A 5DCFA 3TQNA 2VN2A 2MA3A 3LAJA 5HVQC 1IXCA 4WXCA 1YHFA 1R36A 1KU7A 4M9ZA 5LBQA 1I5ZA 1O5LA 1ULYA 1R7JA 2EV5A 1Q43A 2MHFA 5TRDA 3HSFA 2YR2A 4Q5SF 2Q2EA 5CLSA 1Z91A 4K2EA 2UYBA 3CO2A 1OI6A 2ATFA 2F5CA 4QGLA 5E8IA 1G3TA 4B29A 5F64A 2ZO4A 3K0LA 1HSJA 3OD0A 1R22A 1ODDA 4YRDA 5HS7A 4QX5A 3SXWA 4A5MA 4Q48A 2IA2A 2WV0A 1YFHA 1VJ2A 1ZH5A 2BNNA 4KIFA 5JVTA 2EA2A 2FE3A 2H6BA 1K7AA 2XIGA 1JHHA 4IPAA 3NQOA 3SQNA 2JPCA 1HW2A 1SD5A 5E8GA 1CAUA 1TQMA 2Y48A 2PMUA 3H50A 4PIXA 4HVOA 5FFZA 4HX4A 4L11A 4R1HA 1WA4A 2PI0A 5IT9K 3KCCA 4CXFA 3LZZA 3GO5A 3H1WA 3USSA 3J7AO 4U0YA 3IC7A 2CO5A 3QP5A 4KU8A 3CO7C 4KIGA 3SXYA 3FE5A 4LB5A 4AVCA 5LLQA 3FXUA 5KHIA 4E70A 2GXGA 2EFNA 2FQ3A 4A0ZA 2O6GE 1K78A 1KQ8A 4WZCA 4OMYA 3UKNA 2M87A 2BNMA 3C3WA 1QY4A 1F4KA 3CUQA 3PFIA 3WGIA 2JSCA 1S29A 3WGGA 4Q0UA 1GXPA 3DEUA 1XCBA 4CHUA 4CDGA 2JZYA 5AIPA 3R61A 5LGUA 1J1LA 2HZTA 2DAOA 4ZYHA 1UHWA 5TJJA 1FYKA 3EHKA 4MTDA 3JTGA 2Q4SA 4OIOF 4GXOA 3KETA 2EFPA 1RI7A 1HKTA 4EROA 2EA4A 5L3FA 5D5WB 5FPXA 3KGLA 1FI2A 3JSPA 5BS6A 3BB6A 3L2HA 1Z7UA 1H1MA 2MLGA 3B02A 1EYBA 5LGTA 2DT5A 1ZZ9A 3R4KA 1YFWA 4UVAA 1KQ0A 2Z99A 5BOXA 3FZVA 1BM9A 5KHKA 3C7JA 1QXJA 1P4XA 2GWRA 2RVCA 4M72A 2YX7A 1B9MA
chains in the Genus database with same CATH superfamily
4I02A 4ZONA 2BBVA 5HLGA 2YV8A 4GWMA 1B35B 2K9NA 3Q8FA 2E34A 2AQFA 5L73A 3FDYA 2HWB2 1OQDA 2W47A 3FF5A 5HDGA 4CP9A 2DUQA 4CYCB 1Z0XA 4LOTA 5LBCA 4BQ3A 4RDUA 3HUGB 3CMGA 2OQRA 2QKDA 3ZQFA 3PSFA 4DXRA 3CD6I 2PAMA 4BU2A 2GH2A 4IGPA 1V6KA 1GDTA 4XBLA 4ZU4A 3QACA 2XAFA 1YHQI 1RUD3 1YJNI 2G4IA 1GYKA 1U5TB 4WVMB 5EG0A 3FZ3A 3O12A 1DCSA 1YO8A 4UF0A 1OLME 3REOA 1RKWA 3I55I 3IT8A 1QF3A 1RMU3 3SJMA 1F9NA 3OF1A 4CXXA 1FPQA 2LRPA 2K9QA 1OA4A 5T3NA 1NE4A 3BP8A 3GHMA 1OD3A 4QD2A 3WTXC 4A3EJ 3AP9A 3DWLE 1OQEA 5A80A 1DGWX 5M0TA 1FNYA 5LASA 4MIMA 3IAQA 4C0HA 3EXUA 2P4EA 4RAFA 1PVC3 3TEZA 2V9KA 3T1LA 3CCSI 3H92A 3RCOA 2A3WA 3KS7A 2YGLA 5FLXZ 1V6MA 2Y6JA 2PQ8A 1PO12 2GN3A 3OBAA 4XEZA 2R7DA 5B4XA 1N3OA 1NOVA 2WWYA 4XFFA 4FQGA 2VC1A 2DK8A 1IXSB 2R5ZA 1WD3A 3IZOA 2LK2A 4Y1XA 2ZBJA 2HEVF 1QKQA 4ZU5A 4IHTA 2P5VA 2AXTC 1DGRN 2ZJRF 2OTLI 2D6NA 2KR2A 3H35A 1T0FC 4YIFA 5DN2A 3DN7A 3V7CA 4W1UA 4KICA 2J22A 1H6YA 4OMDA 1JYCA 3PQJA 2Z16A 4P5OA 4YZ2A 3ASNH 3HZJA 3LWCA 1WBLA 2GIVA 2YROA 3JU9A 3BZ6A 2CS3A 3F21A 4XORA 5DABA 3RGBA 5C9AB 2ZGRA 2GOMA 3HOUJ 4GWIA 4UAPA 1K45A 2IA1A 5CFDC 3K51A 2LY2A 3UETA 1CWPA 1T56A 1TZLA 3MO4A 4G12A 2K46A 2KP6A 1YQCA 3VBRA 2QKMB 4V2GA 3WTTC 4KH9A 3S3MA 5L3CA 3CIHA 3DKYA 3K9TA 4CDWC 1ZTRA 1JYNA 1ASJ2 1G9AA 1K83J 3DUIA 2QDNA 1BJQA 3T3YA 3RSNA 2K9LA 3AL6A 1L0OC 1D0GA 2BYVE 1I3AA 4Q0SA 5HS8A 2HYFA 2FXAA 3GTOJ 4D7MA 4EM2A 1V9U3 3J8F2 3I71A 4JX6A 4U7BA 3CJIB 3S2HJ 4B4RA 1R4MB 3F8CA 1Z7S2 5E3MA 2Z4FA 3GJBA 1GHCA 3CCMI 2FMYA 4UFJA 5CEHA 4DEVA 4BE2A 2LUWA 3OJBA 3U4SA 1RXGA 1IG7A 3I4PA 1RUJ1 3WNMA 1QJFA 3K1PA 1LNWA 4FE4A 3HRSA 3S8PA 4TLGA 3AKQA 4RAZA 2H09A 1V55H 3L00A 1J58A 2R0HA 3M07A 1FNZA 1UZWA 4W6XA 4F92B 4N9HA 1U3EM 2A75A 1S0DA 3GGLA 2LOOA 5LBFA 3URFA 1C1FA 2LMDA 2P7CB 3VDBA 1MJ9A 5FZKA 4BQWA 1K12A 1LUJB 1JJ8C 1RUJ3 4UT5A 1F8VA 4N9IA 4HPKA 1ONVA 1JW6A 5C8CA 3IWFA 1I1EA 2P1BA 3LFMA 3CDHA 1NX9A 3RQIA 1CAUB 3RZMA 3TRSB 3ZYJB 5C71A 4QPIB 3CDIA 3O8GA 3K3NA 3C7FA 1WBFA 1BVVA 1VBC1 1H9WA 1IV6A 2Z5UA 3RVHA 1NLRA 4LBNA 2YUEA 2ZJPF 1LULA 4P08A 5AVAA 1MS0A 3VYRB 3FM5A 3HWJA 1WPKA 5IJRA 3ZYBA 1JT6A 2GMPA 5DV5A 4HG2A 1AR63 5L36A 3FXOA 1H8TB 4UI9L 4XTPA 3I59B 5JOYA 1BI2A 3H5RA 2GALA 1U9NA 4XLNF 2OX0A 2VL4A 3CJNA 3PVNA 5HCHA 5FRNA 4LO5B 1W8UA 1QHHD 5FOJB 4LO7A 1YI2I 2WZR3 2JT1A 4PJLA 2QSHX 4NHMA 4DY5A 3MPBA 2BW8A 4JRLA 1UZZA 2NNNA 3IM0A 1VBC3 3HDDA 2STWA 4GMP0 1GWMA 5J1UA 1YXWA 5A1FA 3MVPA 3ZGKA 2NOJB 2X5IC 2ZGOA 3M9AA 4YW1A 3Q5FA 1WQ2A 1G8XA 1J3QA 3WNXA 5C4XJ 2CRGA 3H36A 2P6HA 5HLTA 4PGGA 3BALA 5CADA 2MEV1 3V0AA 4Q27A 2L5QA 2X48A 3K2OA 4ET7A 2ZMEC 4LHKA 3LFIA 3DF0A 4CEYC 3CJRB 2VBPA 3WQ1A 4N53B 5FMOS 3ZYIB 4YVWB 2KISA 3OYKA 4W4ZA 3POGA 3MDPA 4KN7X 4IV1B 5F3GA 5A7SA 4CDQA 1T2KA 2ETHA 2Z42A 3OSFA 4RS5A 2ZXJA 2VR4A 3SEEA 2V1NA 4LK0F 2JJ6A 1OC1A 1WI3A 2XWJB 3WF2A 4KT6A 4K20A 2Y6GA 1HV0A 4LK1F 2E5ZA 1MZEA 1ZVFA 2M8GX 4HN0A 4YZ5A 4CP9B 4XBQA 1AXYA 1DUXC 1ENQA 2VCAA 2ELKA 1CF7B 2LBFB 3POJA 1OD5A 4XPVA 4C2UA 1KZHA 4HVQA 3KSCA 1CZVA 1QOTA 3M3EA 1R00A 2PLV1 4D9JA 5FYUA 2W92A 3RI8A 1Z3YA 3HT2A 1FXZA 5A70A 3HTSB 3EYIA 2Z9OA 3POWA 5FZAA 3IWZA 1FP1D 3DKQA 3KZYA 4L5JA 4DXTA 4N8MA 4RS8A 2OUHA 1D4M3 4RM2A 2H6CA 1VBE2 4Y3OA 3MWMA 1UMHA 4LO6B 1DQ5A 4Z92B 5FP7A 4YFXF 1I27A 2NAZA 1PMHX 3GLXA 2WAFA 5GZCA 4A7ZA 1XDUA 2PLV3 3KF5A 3LSDA 4KDPA 1SFPA 3NJVA 1TWAJ 2KDOA 3OYFA 3INAA 2IXHA 2CFOA 1H1IA 4G7ZF 3VL9A 4GZ9A 2H8RA 3I9V2 3LDKA 4Q4Y3 3A0NA 4C9YA 5ERLA 2DFBA 4Y7NJ 1R1A3 3FN9A 2UWCA 1F35A 5LBBA 3FHQA 2W2IA 4CZZA 4M4PA 4C2TA 2JA2A 1SBEA 4Z8BA 4GO1A 5BNQA 4YW2A 2ZHNA 4YM1A 1NE6A 3WNPA 5A32A 4DQAA 3P1IA 1NAEA 4P5HA 3GFIA 1RL3A 4CCMA 4P9UA 1MEC2 2RM22 1OMIA 2IPQX 2FMLA 5FY8A 2R4GA 1ZGJA 1X50A 1PIV3 1R5ID 1IOAA 2OS2A 4CUGA 4IE4A 5J09A 3TEWA 4A3KJ 4CPBA 1IN8A 2WWUA 4LIUA 4QXHA 2JDHA 2VT2A 3X2QH 1D0YA 4RFT0 4WF2A 3PO2J 2PYTA 4XJUA 3AL5A 4UB8C 1IAWA 2L4AA 5FP8A 1IGOA 2WN3A 4YM2A 2DBIA 4YSFA 5F6FA 2MD5A 4EATA 2WNUB 3IAPA 3JAMK 4LMYA 2QYOA 2QQWA 5I93A 3ECHA 4B7EA 1N3PA 1O3SA 1UHMA 4XMIA 5L9BA 4XCAA 1PGW1 3LA7A 1REDA 2M5WA 5IOZA 3LSJA 2ZB9A 1MSEC 1FJLA 3WQBA 2ZKZA 3HOVJ 4LR4A 2VXZA 4LITA 1OF4A 1VF9A 5I8YA 1KGYA 1P4WA 3DCFA 4L9TA 1VQ7I 2LDUA 4AIKA 1S1AA 3AYCA 3FXRA 3SHFA 2B9UA 3ZR6A 4KWLA 5DZGA 1IW7F 2OAZA 4X6QB 5FY1A 1TQPA 3AXEA 4II3A 1LOBA 4LQRA 3QPTA 5E3OA 2WBMA 3N9LA 4HEA2 2Z33A 1FSEA 2ID3A 3MFAA 2UWAA 2QE3A 3OIOA 2V72A 2VO5A 2YC4A 4TV7A 2HEWF 2HQRA 2DMNA 4XFCA 4MX3A 4FPOB 3HRUA 1NCQC 2GMMA 2GM4A 1D2SA 4GB32 1Q3EA 2XBO1 4ZZ5A 2F5DA 4AEJA 3M3IA 2JDPA 5GAEJ 2CNAA 1C4RA 2JRTA 4BBRJ 2QSFX 5FREA 5K0UA 4S0HB 3V7SA 3HMYA 1WLCA 3PIGA 5FZ9A 5K7PA 1BBT1 4A0YA 5LHGA 4XKVA 3E5UA 2FDIA 2DMQA 3SDGA 2DVBA 3AZYA 3WQ7A 3VGIA 1W6PB 2JECA 1JKQC 4OQ8A 3S5AA 2DA3A 4LBKA 5TSWA 1K42A 4XABA 4CP1A 1YYVA 5C4WC 4YVSC 4BDZA 3GZEA 2PHWA 3A22A 3B94A 5K5RA 2E1MC 3FXKA 1ZREA 3TOAA 4AEDB 2A05A 3NAPB 1EAH2 1CAWB 1BBT3 3MZYA 3PUSA 3VB2A 3H9GA 3RI9A 2DI3A 2GNMA 3G6EI 4ONUA 2XKOA 4PUSA 3K4NA 4CCNA 1ZELA 5TGTA 1ZZ6A 1TMF1 4QGNA 5JSRA 4DNCA 1RIOH 1W8WA 2CGNA 2VQCA 3PDQA 3H0OA 4MEXF 4C0BA 1PNGA 2CGPA 3K4BA 2VBDA 3BPXA 1ENXA 3I5UA 1IDYA 1ZYRF 3CCRI 3S14J 4HOOA 1NG0A 1P2FA 3WCRA 2JG8A 3T30A 1LHNA 1LFBA 5CZKA 3PUBA 1CD3G 3GHNA 4ORFA 2L2OA 3L9FA 2JWPA 2NPIA 4HF2A 2WZ8A 5HXVA 1TMF3 1X4OA 1BXHA 1VBB2 4CCJA 4RD7A 2WNOA 2XVCA 4WM8A 2YBKA 4CU8A 4KWJA 3OGJA 2O14A 3AZWA 5IK5A 2O8QA 3CZ6A 2K7LA 3TB0A 1OYIA 2YHJA 4HX8A 4U87A 3T4HB 3ABMH 4D69A 4EGZA 1LPQA 4EJTA 2RREA 3LSGA 4NHKA 2EB7A 3MUZ1 3TNPB 1P9QC 1O5UA 1Z6RA 3PVOA 3FUOA 3WE3A 1JOBA 2L3DA 4HYEA 2XG3A 3LAGA 1J7KA 2RR12 4KMFA 4O5VA 4MVTA 3N05A 3W5MA 2ZACA 2L02A 1MMGA 3VSLA 1SMVA 2E33A 1F43A 1RVF2 3ZXSA 4UB6C 2E71A 1KRIA 4GH4C 2PN6A 4TN7A 4U0WA 4ZXKA 3BI3A 1RR8C 4BQ1A 3HJEA 3BOWA 4AR2A 2OU2A 3J80Z 3HOZJ 2DLLA 5HS9A 3W3CA 3LQQA 1BN5A 4GA9A 3LSRA 2Z69A 3LA3A 3G3ZA 3CCEI 4HMZA 5DMYA 2CW0F 1JXNA 5A32B 3IPVA 2M2EA 3CF6E 3VYTB 1ND2B 2HOTA 4ZKTB 1UMZA 1HDPA 2B42B 3WDWA 4LHLA 4M3CE 1AOYA 4XIDA 4DFSA 4AI2A 5JZGC 3ZMDA 4N43B 1JHNA 3WSOA 3T8RA 1ENHA 2W57A 2L7KA 3ZXLA 3KV5A 4D0PA 3IHUA 2A6TA 1FBSA 3W6VA 2CV2A 1COV1 4XW3A 3W21A 2EIBA 2A6YA 4DZGA 4U2AA 3S3OA 2CG4A 3O1TA 3JUUA 3L2RA 4RGXA 2J1UA 4PQ9A 2CV6A 1QJY2 3WEZA 5IYBJ 1TWCJ 2O61A 5HCBA 2K0GA 5CFCB 4YFZA 2HVQA 2JPBA 3IRQA 3GFLA 2V1UA 1LEDA 4ETSA 3HOWJ 3SEZA 1UYYA 3LD8A 1VBD2 1VMHA 4GIQA 5CKNA 4QMAA 2ELHA 3ERMA 3PUIA 5E1XA 1GV5A 1AR72 1V6JA 3HKZN 4XR6A 3WCSA 2CUJA 1TNFA 3CCUI 3BJAA 4EWDA 5C6CA 4XKWA 1W7PB 3U1XA 2L7MP 1TBXA 2AHQA 1UPIA 1SLTA 4DINB 3MI8A 4XF9A 2FMDA 4XUOA 1PMJX 2KRFA 2P37A 4CDXA 2IBDA 2XL7A 5FYIA 2IGOA 1ZBE1 4CUBA 5EJZB 4O3MA 3D0JA 4M6VA 4KGGA 2WFF1 4Y22A 1VNDA 5JPMB 4NIAA 3DEMA 4FI9A 4IERA 4NN0A 1Y39A 1C5IA 2BY2A 2GNDA 2W87A 2NQYA 1O4ZA 3KVBA 2D3RA 2CMPA 2BWCA 3WF1A 2PJRA 4Y4YA 3DQVC 4XCBA 2VC0A 3FHIB 5SV5A 1MZ5A 5H9PA 1K79A 4QQHA 2QQKA 5LHIA 2G19A 3AMMA 2MW8A 1UW8A 1ZBE3 5B4NA 4NBQA 2QQLA 3F8MA 3LIGA 1GP6A 3LSHA 4YZ4A 3SZGA 4KT5C 4PI2A 4EJVA 4QB6A 3H5NA 1NLSA 3A7QA 2GLOA 3O1VA 3IBMA 4HSLA 4MUVA 4IEWA 1VR3A 2NOGA 5HNHA 3O0WA 1O7LA 5FZDA 3AYEA 3TNQA 1BMV2 1SBDA 3T5XA 4C1WA 4LLOA 4KBZA 1SQ4A 4A3GJ 3BR0A 5H9QA 4AFAA 1BYHA 2ZA9A 5B1AH 5FK8A 3MEPA 3GXUA 2HYGD 3LKJA 2DPUA 4NB5A 5ABJA 3K4LA 2HYKA 1R5HA 1QNTA 1RUC2 1VALA 3W2WA 4JGYA 2LYCA 4BAYA 3HHHA 4NJ4A 1JOJA 1JS9A 1PP8F 2PQSA 3MLLA 1I6XA 2K2SA 3WNKA 4FISA 4GFBA 1UXZA 2P5LC 5T5LA 3ZXFA 3WG1A 4J00A 5HPOA 1XOYA 3OIPA 1LHWA 2NMOA 1W04A 2JICA 4LKSA 4AGGA 2WRAA 4CXYA 1FPN1 4HKOA 3WDXA 1T39A 2DW4A 3ZFEA 5JMOA 3QOPA 1NK2P 4FQZA 2DCKA 1LDKB 1AR82 2A70A 3KP3A 1GZWB 4R8HA 2PELA 3QP6A 4AOCA 2VZUA 1MJBA 3VZJA 3CP8A 2YC2A 4M6XA 5D21A 1H2KA 1GANA 3ZOBA 2CWSA 3HR9A 4BDYA 3JD72 3POYA 2ZBKA 5GKAC 3VDDC 2H94A 4XFGA 4AC0A 3EDPA 2COBA 3DL3A 2QQJA 4IRHA 1S72I 1RUOA 4GDFA 3ZKYA 1W9FA 2GP5A 1FPN3 3ZMUA 5E8AA 1QHGA 3OV8A 1OR7C 4CVUA 1JI8A 2ZHMA 4OMCA 4II2A 1C1LA 4IKFA 3R6SA 4AYUA 2WA4A 3FFQA 1I5PA 4ENMA 3AG4H 4QGMA 2VJ4A 5F6KA 4XNFA 2WSUA 5J3UA 2ZNZA 4J01A 1A36A 4D0QA 1JGGA 5F7UA 1CX1A 5LA9A 1B6AA 4DYRA 3T2TA 4YGBA 4LBJA 1MS1A 1JTXA 3BZCA 3GFJA 1MMSA 2ORZA 4L9VA 4EV0A 2MPFA 3GZTB 2W52A 4KUMA 4AWDA 1O57A 2A6ZA 4OHZA 2CUFA 2QZ8A 2HOEA 2CSOA 5ILVA 2DPDA 3F9KA 2KLOA 3OR2C 1AYM2 3UKGA 3U1KA 2VZ1A 4UXNA 2QQ9A 1DQ6A 4ZXEA 3TL4X 2XF6A 1DGLA 1SFKA 3PNTA 1YIJI 2HPIA 1R23A 4A6DA 3ZN5A 1VQMI 2ZX3A 4AIJA 2CHHA 4KU7A 3AZXA 1TME2 2JA7J 5IK7A 1OUXA 2F6BA 4XXPA 3KP7A 3BIEA 1Y4WA 3K69A 4QPOA 1SPPA 4OIPF 1ZGWA 1OISA 5BPIA 2IS2A 3VZKA 1C8M1 1W36D 3C1DA 2M0CA 3CC2I 2K27A 2VUJA 3JBG1 1AL22 1D2QA 4D7TA 2UZKA 2E7AA 1RUE2 1VBA1 5C5TA 1AA7A 2W46A 5FZOB 4COUA 4J1WA 4BH9A 1GMMA 3NRVA 1UOBA 4QPGA 2NNYA 3T1MA 1QJU2 5IK4A 5A3PA 1Y1WJ 1REFA 1A5JA 3I2IA 4W6WA 4IEQA 1UO9A 4OAYA 2BERA 2VB6A 2CQNA 5DUKA 2VPVA 2EZLA 4B09A 1A8MA 4BQ2A 2F4OB 5JLWA 4YM3A 2XL9A 3RPUA 4OINF 2LKXA 5BNNC 4NWVA 3FK6A 1QQIA 2RV9A 1VBA3 4XIOA 1E5RA 1ZR4A 4FTBA 3SCGA 5J3LA 2QF7A 4BACA 3DPUA 3KGZA 2JG9B 4TTGA 3ZQ7A 2P2KA 3PUFA 5FZ3A 2ZXIA 4DJAA 3WINE 1HRV1 3MIEA 5EIYB 1R1TA 3TN91 2VZSA 2XPWA 5DQ0A 2ELJA 1Q8OA 1BEV1 2XVKA 3NKGA 2ARAA 3UYJA 2GMEA 2WWSA 4INDA 3AAFA 3T1BA 2YBSA 1IGNA 4Q4W1 1PK6C 3CJXA 3F6VA 2LSOA 2R49A 2G0EA 1ZG3A 5DS9A 3OCPA 3I3LA 2Y60A 1RUG2 2P6TA 2Y75A 1H6XA 3CJQB 1TWFJ 5JR3A 4KG0A 2ZGNA 5EGOA 3CO6C 4B3XA 3D8CA 4MNUA 3S16J 3MHZA 1HRV3 3RZLA 4C30A 3PMEA 2VTFA 1ZRCA 3K2ZA 5C3OA 2O03A 1BEV3 2C4XA 2OA2A 3V65A 3F2ZA 3AL0B 2QZ3A 1ETVA 1E5SA 4Y22B 5KK1A 3L2VA 4OHYA 2IGMA 2V4AA 4Q4W3 3KV4A 4LLGF 1PJRA 5ILUA 4NROA 3HYIA 5FZBA 2HWC1 4EQVA 1RUD2 3WGHA 3MEXA 4ZZDA 2ZGMA 1GLHA 3DPLC 3C2UA 1MNMC 3RRDA 1HF0A 1I1SA 1RMU2 1FMWA 2MSYA 1KQ9A 4DNYA 2DYSH 5FYHA 3VUOA 2AC1A 4QXBA 4C2MJ 3K48A 1E3PA 3OYMA 1DP7P 3NAUA 3KP4A 2WS93 1NXD1 2WYSA 2X8KA 2HWC3 5FYVA 4OHWA 4JQFA 1PVC2 2CDOA 1O59A 4COYA 2DFIA 2FU4A 3ZMZA 2GAUA 2EIJH 1DP0A 3D4KA 5HI0A 1ZRFA 1XCVA 3QH7A 5M5YJ 4XRFA 5ABJB 5C3SA 3MBWA 4D1QA 1UIJA 1YUDA 4JGYB 1KONA 4X1EA 1MNDA 3F72A 2W25A 1ON1A 5DCMB 1L7QA 3JQXA 2JB4A 2QQBA 5IW0A 2DUPA 1X1BA 5E1WA 3VBSC 3GWZA 1BKZA 1LEAA 1ONAA 2GNTA 1XSRA 2ZEXA 4ESJA 2DVDA 4GRIA 1MBGA 2LF7A 5GALA 1W9TA 2KL4A 3DKXA 5FUPA 3M3QA 3ZFEB 3G6JB 2KRCA 2HS5A 4BXFA 2NRAC 3S3NA 4ZYDA 5KXBA 4BDVB 3GXOA 2WIIB 2ADEA 1POV1 4LBLA 2CYFA 4B1RA 5A6YA 1YNAA 3IKTA 5IP6A 3VOEA 1YQ8A 1UCRA 3GZNB 4OYUA 1TNSA 1PO23 3IAS2 2X1CA 3TP3A 2XGCA 4IXLA 5KC6A 2XASA 2ISZA 4IHVA 4JRAA 4Q29A 5C3PA 2MA3A 4FCYA 1IXCA 1V9U2 1R36A 3C2GA 1KU7A 4AHXA 3ZXKA 1I5ZA 4LBQB 5IP7J 4RSUA 2Q2EA 1KJLA 5GAGJ 3OPZA 1OI6A 1G3TA 4PLMA 4PSXA 2DDBA 1WH7A 4DBQA 2LY1A 3OD0A 1ODDA 4QX5A 3F0CA 3ZFGB 4A5MA 4KISA 2J1EA 4D5CA 3BR5A 3FFZA 5A1AA 3USUA 2VM9A 3N9PA 2KD7A 4XVHA 2RS31 4XBNA 3QD6A 2E5NA 2XIGA 3KX2A 3NQOA 3LNQA 3IIIA 2LC2A 1IQAA 5E8GA 1VB2A 1ENRA 4FOQA 3AP7A 3HG9A 5A3TA 5FFZA 1NQDA 3WZ1A 1WA4A 2PI0A 3CF2A 5LBEA 4YZ1A 4R9AA 5FTTC 3GO5A 1ZQ3P 2R7QA 5FY9A 3I49A 2E7TA 4E7JA 3IC7A 2CO5A 4KU8A 1RUJ2 1GZTA 4E9KA 3NNFA 4LB5A 1U9OA 1KS4A 5KHIA 2HEYF 3ZLIA 1XNCA 2X9DA 1KQ8A 1Q1VA 2K85A 3JRBA 3MKZA 2RS33 3K75B 4J19A 1M4WA 2BNMA 2WAAA 1UOFA 3C3WA 1ERDA 3CUQA 1SLIA 3WGIA 5FZFA 5DDJ1 1CZSA 1IG3A 5FZGA 4QPGB 4EE2A 4Q0UA 4P5YA 1AR62 4AE2A 2JZYA 5AIPA 1RJ7A 4CU6A 4S2DA 4IW3A 4IZZA 1JZ6A 2HZTA 3ZXGA 1UHWA 5EXOA 3JTGA 2E51A 2WZR2 1RI7A 2EFPA 1QU0A 1POGA 3O7OA 5L3FA 3KGLA 1J1TA 1X1PA 3L2HA 1H1MA 1N25A 1AYN1 1VBC2 3JB4C 5FWJA 3B00A 2WNVA 5ANNA 1OLMA 5LW9A 2R7UA 2YS9A 2D6MA 1Y9MA 1BM9A 5KHKA 4UOJA 3Q3SA 2W82A 1PGL1 3R4SA 4IV3A 1P4XA 2GWRA 4IEJA 4M72A 4ZTFA 4ZPIA 3ZO0B 1GUUA 1TQ5A 2LF8A 3WF4A 3HNMA 3IP4B 4Q4X3 1AYN3 1RUH1 2XVLA 3GZ5A 3IN9A 4QPYA 3UR3C 1RUNA 4HW0A 2XSJC 4AYBN 2R061 2FRHA 1T2XA 4E4DX 4A3IJ 2V5YA 4B7KA 1SANA 3NQHA 1MKMA 1IPKA 1RIRA 2RQPA 3TGNA 4WBBA 3OL4A 3W9AA 2BRTA 2XJPA 3I3EA 2HZDA 2RJKA 1XPXA 1ZG5A 2WZEA 2PFWA 5FPZA 2P34A 5A33A 2XRNA 1RUH3 2KMUA 2A07F 4XXAA 1FOD1 5FLIA 2R063 5BNOB 1JUHA 3VBOB 2R3SA 2QNKA 2MG4A 1YOVB 1SLAA 1SFNA 2OT7A 2ZC2A 2ET1A 4NIDA 1D4M2 2BZDA 2E7QA 2OIIA 4BS9A 2PBIA 1U78A 2VTXJ 4A44A 4A3DJ 2R073 4QDSA 5FYBA 1YFYA 1F1ZA 2E35A 4XIKA 1D4VB 3D5SC 1FAYA 1ZLJA 4M3GA 1TT0A 2ZEYA 3N7JA 2Y6KA 3HPNA 4Q4Y2 1TE1B 3EUHC 3KHCA 3T2PA 1OOPC 2RG4A 3SCHA 2HI3A 1R1A2 1ZZ8A 3ZKUA 2VMEA 1XDSA 1YIFA 1GP5A 2K40A 1ZRDA 5IPAA 4F93B 2ZGTA 5H9RA 2V26A 5FLVA 4MGYE 2HYJA 5FCCA 4Y1UA 4R9BA 1LEBA 2DURA 4LPLA 4COVA 2Y34A 4Z2AA 3ILRA 3TO9A 4XDOA 2FQ4A 3B6CA 1HB4A 1D0XA 3TKYA 1VMJA 1N1SA 1PIV2 2CSGA 4M9SA 4F52A 3KCXA 5FY5A 1GICA 4GULA 2YUSA 2JMWA 4YM0A 2JJ7A 5CA6A 3TWIA 4Z82A 2R043 1WCDJ 3SEQA 2F4PA 5BMZA 5A6XA 2ESHA 2E1OA 3E5QA 4RB2C 1K5JA 2V1DA 1W1WE 5IVJA 2DA2A 1XGOA 1B8IA 4Y1VA 5JWPA 2PMZN 4P9JA 3RMYA 1HW5A 2Y0OA 1HQNA 3I2GA 1X4PA 3ZYRA 2IAIA 3ZSJA 3M70A 2ZTNA 4HNUA 3OUIA 3PJQA 2AEZA 1XG1A 1KS5A 3ALQA 1MH4A 1W36C 5BNPA 2IXLA 1B59A 3LSTA 3RZZA 4PGHA 1WLWA 4H0EA 5HDKA 4EN8B 4GAZA 2VCBA 1IS5A 4FVVA 1BC8C 1QJX1 5IOYA 5J40A 5H6RA 4LG3A 3FHZA 1EUUA 2A5YB 3H3LA 2V6CA 1WJAA 3FWEA 3GYHX 1W6NA 4MQ9F 4OFGA 3M7AA 1W0OA 2GA1A 2Y26A 5FY0A 5FXZA 5F0FA 1B1BA 3OGVA 3ZMTA 1LHUA 4AAXA 5D6EA 4Z2YA 2VVDA 4ARYA 3A01A 4BE0A 2NS8A 4OAZA 2RKHA 2W39A 1QJX3 4NHJA 2AREA 2RS53 3KV6A 3I2OA 4QU1A 3QPLA 1R083 3BWGA 4JKMA 1J2XA 1UU4A 2VQLA 5FY7A 1SLCA 2VD7A 3K77A 1WJBA 1YIPA 1XE7A 4Q0PA 2EZKA 4PSWA 4UBHA 4YW7A 4GMP1 3HT1A 2ZS6B 1DQ4A 1EF4A 1XN7A 2VBZA 2BXYA 1XS9A 1APNA 2DCJA 4KIBA 4PCRA 2QDRA 2KIUA 3KMHA 3BCBA 1WUVA 4L0PA 2CYYA 2CGOA 3G73A 3PIOF 3OYAA 1RTVA 2D1VA 3QYFA 2JA6J 3CNAA 1W03A 5CFDB 1OKRA 4UW4A 2ICWG 2CQQA 1CPMA 3ZQHA 5M3FJ 3RDIA 2L54A 1DU3D 2XLGA 1I39A 4PJJA 4OUMA 4CDWB 3NNMA 5EZWA 2VBWA 2ZJCA 5HNFA 5FKNA 4CEWA 1G3WA 5FP9A 1H2NA 2MBFA 2Y64A 1YLFA 3X29B 1I9RA 1BBT2 2XAJA 4LBOA 5IHRA 4H14A 2RE9A 3N9NA 1ZAOA 3I3BA 3ST7A 2Q8KA 4E8CA 4U88A 1XYNA 4YFKF 4XOTA 1HIXA 1YTYA 3OR1C 3K4JA 2QEXI 1W6QA 5G05L 2ID4A 1DLLA 5FV3A 2EFWA 3VBHC 5AC93 3K4CA 1YX3A 3TEYA 4BQQA 4A45A 3KEQA 3OGSA 1OURA 2DFEA 3HB9A 1GWKA 3VHPA 4AQ2A 1POQA 3HC7A 1D0HA 4GCVA 5FO5A 3MQ0A 3TEXA 4FAHA 2IXJA 2OCCH 2J1SA 4DY3A 5FGMA 4MGTA 1HKQA 2HPMA 1X33A 3L2CA 3M1EA 2VMCA 1PUFA 1W6MA 1XGNA 1TMF2 4BPZA 2WO2A 4A6OA 1U5TC 1S0IA 1S0CA 1JE8A 4FFHA 1VQOI 4AEMA 4KBBA 4HF1A 4NPLA 4LJHA 2A5WA 3AJYA 2YFZA 4YIRX 2ZHKA 3FK7A 1CR7A 1NXMA 3SZPA 5FXXA 4C3HJ 1XTAA 4IQPA 3AVRA 2Q8CA 3BG3A 2EV0A 5A33B 3NWSA 1FV3A 1SG3A 2FZ2A 4PJNA 3BT9A 4JDMA 4MH0E 2CQKA 2X0LA 2DTZA 4E4HA 2ZEZA 4W8JA 2I10A 1HLVA 4Y13A 4AI9A 5J1XA 4G9SB 5CG8A 2C9KA 3OYNA 4V2FA 1XRUA 1WH5A 1EH7A 1YCIA 5F3IA 1MQTC 5C4WA 1YI9A 1IV8A 2ZJ2A 3H9AA 4RLFA 5F5QA 4XICA 2DCTA 3DPRA 1JU4A 4LLNA 2GU9A 3RWKX 3GZUC 2JE8A 3C18A 3K1MA 2X5IB 3L7WA 3N9QA 1VZ0A 2WA0A 2Y33A 1ULEA 1AR91 3ORJA 1AHSA 3D5RC 2BVBA 3EPZA 5HODA 1N78A 1JZ2A 2JVHA 1UY2A 2IWGB 3OSGA 2ZAAA 1GR3A 3ZM8A 4HV6A 4PDWA 4IETA 2ZMEB 3POEA 3ZXAC 4CEYB 1YJLA 2FNAA 2R0FA 5FXVA 5EF6A 4KNYA 3MICA 1VMFA 1Y7BA 4NRMA 5JOWA 4C3IJ 2C6YA 4CO8A 4OZXA 1ZBA1 1NH3A 3OB8A 4ISRA 1O3TA 2GIZA 4D94A 3P5JA 2MC4A 1IUYA 4FFFA 1RHI1 1AR93 2VNGA 1L3LA 3ZIXA 4ZYEA 4RR3C 2GN7A 3ATGA 4JQTA 1U0JA 3SZTA 2H0BA 1A3KA 4B3AA 4HLTA 2RHPA 4GWJA 4Q0QA 4XBFA 1B8IB 4IOCF 2XXZA 2XV4S 3Q8AA 2QSGX 2JD9A 1HDDC 1A6QA 3JREA 3QYEA 1DDNA 1ZBA3 3DF8A 3N9MA 3UNGC 3PVBB 2HWD1 2E63A 3UKVA 4FBFA 4XETA 1NA1A 2WWJA 2PHRA 2OQGA 2AUYA 1UG2A 2IVJA 2GA2A 3I4NJ 4CPBD 5FYMA 4URAA 3ZYFA 5FIXA 1F15A 1F9KA 3WNOA 5FYTA 4YG2F 1I6HJ 2CU7A 4NQWA 4IRIA 3DXJF 2L9SA 3A23A 1WJEA 3MIDA 3BROA 1W6OB 3CCLI 4I2OA 5FP4A 2OPWA 2X4HA 4XQWA 3KT7A 4LHNA 2VOWA 4KI5M 4P9LA 3RFRA 1TP4A 2HWD3 1OQ1A 1QOOA 5FZEA 2Y9YA 4XLAA 3KT4A 3RMXA 1IC8A 1WA6X 5KHDA 1OHFA 4PCQA 3U78A 2VJIA 5EJCA 2HGCA 1QNYA 4IGOA 3JTHA 1ZBE2 1YQ6A 2BOIA 4AGVA 2Y6FA 3HHGA 3GTJJ 2NYXA 2LRDA 3P9KA 1DGWY 5GP9A 3ZFFC 1YRNA 4Y33A 2ET7A 3KYDB 3ASIA 2G1MA 3WUDA 1O4YA 2JDNA 4FAGA 3ABTA 5FQ0B 1JHFA 4BGDA 1YG2A 4EN0A 1LOGA 2GZWA 2FD5A 2X51A 4W6YA 2OZUA 4CDUA 4DO0A 3VBFC 5JAXA 1DG6A 4QB2A 1OVSA 2WUHA 4IXAA 4LGWA 4YLZA 3H5AA 5DM7F 4NRPA 3KZIC 1OFCX 4Y20A 2ZNYA 1WW6A 3E1SA 1LVAA 5KXEA 1PX4A 1LDJA 3HQXA 1XJAA 1UY3A 4Z2WA 2OYZA 1HKSA 2VCMA 3VZNA 2COMA 2VJJA 4ITVA 2ACJA 5FO8B 4JV4A 3MLJA 2FEZA 1RETA 3CMAI 3P3PA 3SFIA 5F3CA 4X6AJ 4MZUA 3T4VA 4O61A 2FDFA 2O1QA 5E18F 2P17A 2W68A 4GKYA 5F37A 4FPGA 1HA8A 1N3QA 3KEYA 3FKIJ 3F6OA 4Z07A 3M3OA 4ENJA 1B35A 4G7OF 1UYZA 3WHUA 1CVNA 3KV9A 4D7YA 3OYDA 1LHOA 4GJYA 3E6MA 3Q8CA 3CESA 5GTHC 1VQ6I 5EP9A 1FPN2 4E7KA 4WVMA 4RB3C 4XMYA 1PUFB 5BPDA 1W6MB 2D98A 3CZUA 1JGSA 4YG3A 4MGQA 4MGZE 1MSFC 2Y0SA 4A3MJ 3HPHA 1NCQB 3QU3A 2DBBA 4F8AA 3OS1A 2PHLA 4LOSA 2OD5A 1YQAA 1MMAA 3I64A 3FKJA 2PAKA 4C90A 1MPXA 5JFRA 1A6IA 1V3FA 1I3HA 1JYXA 2O0OA 4ZDLA 4NWWA 5GLTA 4D8MA 1NLQA 2RQQA 1HCRA 2QCSB 2OQ6A 4BUPA 3VPRA 5KNLA 3AKPA 3WNNA 3I3DA 4BK4A 4BY7J 1F5JA 1I50J 4C91A 1WLTA 3V64A 5IAXA 5C4WB 4YVSB 2ZX1A 1MIJA 2JDUA 5LY2A 2RMU1 1ST8A 3HTUA 2E1MB 1PYVA 1AX2A 2VVEA 2A3SA 3OPTA 5J8FA 3LFKA 3VHOA 3BGAA 3O1SA 2J1TA 4DXSA 2L7FP 3ZDVA 2XHKA 2GH8A 4IJAA 1EA3A 2NS7A 1HW1A 4IGQA 5K5OA 3V0BB 4AF9A 2G9WA 4KWKA 5LA2A 1K5MC 1I1GA 4JAAA 2AENA 2L9VA 2CV1A 3D5LA 1SDDB 4D6QA 4P9YA 4CP0A 1YC61 3SITA 3VDDA 4BNCA 4KJZA 4TYSA 3TOBA 1ULDA 2BWAA 5JI9A 3S2DJ 4AQSA 2OBPA 3VBRC 4AFMA 2VOVA 3GF6A 2VAUA 4M3CF 2DA7A 5ANQA 4YFNF 1VBA2 4OULA 2UXNA 2UWBA 2CFXA 3FHAA 3IB3A 1IUFA 1ULCA 4NIIA 1SEFA 3CJIA 5LD2C 3HQUA 5CJ9A 4XUQA 1PO11 2CWMA 1R71A 3NV3A 4I98B 3DTKA 2KDZA 2EIEA 3P7NA 1Q8PA 3V42A 2IS6A 3I53A 3W58A 4H7LA 1LE8B 1ENSA 2A69F 3SLIA 1D1BA 2C26A 4KMUX 4WVWA 5JMCA 1LB2A 1HRI1 1SEUA 1UHSA 4A2UA 1GFF2 2VJXA 1T98A 1NA1B 5FYZA 4B47A 4IOAF 3S7IA 2VZPA 1A6CA 2DA4A 3ASOH 2E31A 1Q8SA 1NUKA 3KZ4C 3CBNA 2BV4A 2BVMA 5CNAA 2N7GA 2OVUA 4AHZA 1HRV2 3MIGA 4I0WB 1STMA 4OI4A 1GQGA 1BEV2 3A1YA 1S2BA 5FZ1A 2WFPA 1LU1A 1KU2A 5FXWA 3CP2A 5J6XA 5AFEA 3WG7H 4Q4W2 4LB6B 2C0ZA 2JKXA 4GH4B 5FZ7A 1F4AA 3ELKA 1HRI3 3S1QJ 3J7AY 4OQ9A 4WCGA 4XFHA 1SC7A 3IDBB 4WK8F 5C8CC 4QPIA 1D0ZA 4IE0A 2A71A 2LY9A 1S7AA 4AIDA 3F22A 3GBWA 2HWF3 1B09A 4LE3A 2KJCA 4MSVA 2BBAA 3QBQA 3I3MA 2VLAA 2IS1A 3LCPA 4NPMA 3RZGA 1OBNA 3AG2H 1H8TA 3WHBA 1XU1A 4UUTA 3I59A 3GBFA 3J7HA 4XE9A 1MZ6A 5E1ZB 5LA1A 3H3ZA 2UUZA 2OZJA 2VBYA 1Z7S1 1GT0C 1DFQA 1T6BX 1WCSA 2XJSA 3N35A 5JZGB 1QQP3 1YRNB 4JOMA 3WP4A 2VASA 4MHGA 5D4RA 2WS92 1HDKA 1ITYA 5D8AA 2V4VA 4XSXF 5LRRA 4XZPA 4D6SA 3J81K 2WAQN 2I2SA 1X8MA 4UV9A 4UXAA 4B8EA 3UNPA 2XJVA 3FXJA 1S0GA 3VDCA 2W3JA 3CCQI 1JZ5A 3MIBA 1IKPA 3WOGA 4NE9A 1WGPA 5CVJA 2MD0A 3HBLA 4V19K 3NRUA 4RB1A 1UELB 4YVWA 4META 5I0SA 4EQQA 3MFKA 1HQWA 4LJZF 4C8DA 5LHHA 2LM3A 2YU1A 3D0SA 2XOMA 4IV1A 4G6DA 5IVFA 1FSHA 1TTYA 5K7HA 3VODA 4EZ4A 1UZVA 3J81Z 1QZYA 2BHYA 4CDQC 1T6SA 2BBYA 2EVXA 1VQ4I 2OKXA 3DBHB 4RS5C 5BNGA 3BPZA 1CF7A 5KHHA 5FLXK 2LBFA 4EWEA 3F8NA 4HLYA 4L18B 3NWKA 5IFPA 2CW8A 3HRTA 2HQNA 2XLFA 1PO22 2DU0A 4P9IA 1QVTA 1Y8RB 1UY0A 4YFWA 4E7SA 2R7SA 4QIWN 4UFMA 3ECOA 5F5AA 1ODNA 5JSOA 2HBTA 1BVP1 3NWTA 3O1UA 3OYHA 2HLEA 1YS7A 2QTWB 2KIFA 2Q1ZB 4UYBA 4ZYGA 5K7ZA 1DYKA 1N47A 2W84A 4BB3A 1SD4A 2W9XA 1JZ4A 4MGIE 2Y0MA 2D1HA 2ZFWA 1JKPC 4M3CB 2I45A 1YITI 1BA5A 3G4SI 4L92A 3FMRA 4ES9A 3QPSA 1QRYA 2VBBA 4K3UA 2R16A 3ZSLA 3A0KA 3LAPA 3IH4A 2VNVA 3EUAA 1S2KA 2WT0A 4HQMA 4RMNA 4XFBA 3WTVC 2AXLA 1JH5A 2R7TA 1VFCA 4A41A 4GYGA 5GPCA 3UGFA 3KQ4B 2DMTA 2JK3A 3WQ0A 1QEXA 2LALA 5GADJ 3R05A 3UV9A 5DYMA 1ZA7A 3NJZA 5HCFA 4LO8A 5CYVA 2EBIA 2NP0A 3VBSA 4ZHNA 1YE9A 4FPEA 1JOPA 3ES1A 3BTZA 1S8NA 1W0TA 2RS32 4IEOA 5LGNA 3QPHA 2YY1A 4HOBA 5BQTA 4XF0A 3IDAA 3LEMA 3TYJA 1WMXA 3ILNA 2A68F 2DCEA 1TVGA 3ZMOA 2DDAA 4AI3A 5FLMJ 3Q9SA 3S7EA 3H8UA 2F2EA 2QBYB 2VZQA 1VBE1 4E4SA 3EO6A 1FMVA 2WNUA 3VDDB 3N7LA 4LHSA 5JLXA 2W1SA 4YGDA 1BW6A 1UZ0A 2LNBA 1BJZA 1Z0HA 4DW6A 1X1AA 2VQUA 4XAAA 3ZSKA 1GNZA 2W08A 4HKLA 5F3EA 3IH3A 2V5DA 2QQ8A 3BTLA 1NKGA 2TEPA 2YBPA 3OWTA 1FP2A 2WLPA 3NSTA 2VIXA 1FWZA 1BK0A 4ON0A 2VGDA 5C70A 4CXWA 4HX7A 5HOOA 1RZ4A 3MD2A 3ZXDA 4BEHB 1ZN2A 1DU0A 1E57A 3TMOA 3RJ2X 2JKBA 1WI9A 2QA4I 2LD5A 2BU9A 4Q4V1 2FQPA 3CZJA 2XGXA 1DHKB 3MPPG 2C1FA 4Q4X2 1OCCH 5C3EJ 1AYN2 3ZQGA 3ZMSA 1MEC1 3DYMA 3RPUD 1CAXB 3VD9A 2DT7B 2F6CA 2XPJA 4ARXA 5H20A 1C8NA 4E7IA 3WLUA 1LRHA 4CSWA 2XAQA 4QX1A 3NL1A 3VD3A 3S30A 3WUCA 2M3AA 3WXPA 3WW2A 5J36A 1R091 4JHZA 4NAMA 2R92J 5FRAA 1X9PA 1S0FA 4Q4V3 4JZRA 2MNGA 5EWSA 3BTAA 3RKWA 3KP2A 2DFHA 1ORKA 2NMNA 2BGCA 4D6RA 2R062 2EIGA 1UNBA 1WMDA 5FY4A 5FWEA 3MYXA 2WAQA 2OW4A 4QKFA 4LULA 4Y26A 5K0UC 4M01A 5C5UA 5KAIC 6PAXA 4PF1A 1Z67A 4UUSB 1W6PA 5LATA 3GCMA 4E2GA 2E9QA 1R093 3ZXEA 1BHGA 1SFXA 2H0VA 4YGEA 2WQZC 2R072 2ZABA 1ETWA 2JRMA 1SD7A 3FHNA 1X1CA 3GTPJ 1DQ0A 3RWNA 3QYBA 1JUIA 4R9DA 5D8AB 3BKZA 4YPJA 5BNNB 4AEDA 2D93A 3NNJA 3NAPA 1X1DA 5TISC 1CAWA 3HNYM 5FZIA 3APBA 1TW3A 2XDVA 4RGSA 5FZ4A 2DMUA 3VYUB 4HBLA 3K10A 1E5HA 3NEUA 4DYCA 2LG4A 4IEUA 1DP3A 1IN5A 2V7FA 5ICGA 2JXAA 4DZPA 5A7QA 3MKYB 2VUCA 3Q9VA 2QQAA 3LGRA 2YGMA 1E0EA 5M5WJ 5A6ZA 3BYWA 2L9RA 1PK6B 3FC0A 5DDGA 3R4DB 1VQNI 4J6GA 3BJOA 3IL2A 1MS3A 2OA4A 4GB31 3CMMA 4MFDA 2CW7A 2VULA 4FHTA 4Y17A 5J8CA 4B44A 3BVCA 2Y8KA 2JG8C 2A3YA 5EYRA 3B3QE 4AW7A 2G9ZA 3VYSB 2PMWB 1XNDA 3POBA 2BW3A 4I0BA 4BOWA 2CH0A 2R042 1UX7A 4Q1RA 5F0CA 2L0KA 5DM6F 2FJ1A 3TQNA 2BJSA 1J84A 2MEV3 2W7NA 1YHFA 1LU2A 3RZJA 2VXRA 4H4KC 4WM8C 1DBNA 5CAZA 5GZEA 2W48A 2MHFA 4PF5A 1MS4A 2B4KA 3HSFA 4Q5SF 1VI0A 5CLSA 1Z91A 3DGTA 3MF9A 4K2EA 3CO2A 3Q9OA 1XYOA 5JXHA 4ZJZA 2ZMLA 1R22A 4BQ4A 4YRDA 5HS7A 4OHXA 2NYYA 3MV11 2Z79A 1BCXA 2R5YB 1EAH1 1VJ2A 4BE1A 1ZH5A 2EA2A 2FE3A 4IPAA 2R7WA 2D3SA 1GVDA 1H4HA 1ETXA 3WVJA 2LFBA 1I3QJ 1TQMA 2Y48A 1OJLA 2NVTJ 3ZVXA 5FKKA 2K3FA 2F4LA 3VD5A 4HX4A 4L11A 3MV01 5JOXA 1IO2A 1QDOA 5F08A 4QKNA 3ZXJA 4NRQA 2MABA 3FIWA 5FPAA 4KIGA 1KD7A 4QKBA 2RDNA 4IX7A 5LLQA 3VD4A 1OOPA 4F3QA 4E70A 4SBVA 3AC0A 4Q2FA 3W2VA 4A0ZA 2C9AA 1K78A 1W28A 1O8SA 2IGNA 1NCRC 2Q5TA 1QJX2 2Y2ZA 2RS52 4E8DA 1SLBA 1HXS1 4AI8A 3DBRB 2KA3A 1R082 3CMYA 1QY4A 1VBB1 2ZKNA 1ND2A 2JSCA 5EHDA 3WGGA 2QQIA 4SLIA 1NQJA 5G04L 1XCBA 3VBSB 1UX6A 5L9RA 2DF7A 2EALA 4S2HA 1T08B 4ZYHA 4N43A 4ATFA 4OCTA 1FYKA 2NVYJ 4MTDA 3J7ZI 2Q4SA 4OIOF 4GXOA 4M0NA 2ZFUA 3BQZA 1HKTA 3LEIA 4PHZA 3DYPA 3FLPA 3UK9A 3JSPA 2MLGA 1N1VA 4NHXA 3PUQA 2DT5A 1HXS3 1ZZ9A 2VQHA 1ZKGA 1ZR2A 4O7XA 3R4KA 5CFCA 4UVAA 1KQ0A 2X1DA 4DYQA 5BOXA 4AQTA 2Y69H 3Q0VA 4RYDA 3PFYA 4C3JJ 3BG7A 1BR1A 4JYKA 4AVSA 3WG4A 1IPSA 2OXBA 1QXJA 4G3YC 5C3QA 2O7OA 2RVCA 3M8LA 3G1MA 1B9MA 1H9GA 1HX6A 3NVCA 1XE8A 1SD6A 1W7PA 2CAVA 4EGYA 3BY6A 4FPLA 4LE4A 3DEEA 4QX8A 1D3YA 3U9GA 2O8OA 3CU7A 3M3YJ 2DK5A 4AFBA 2Y31A 3UT0A 5L3GA 4XMAA 5BUVA 2DO7A 3VSKA 2QWWA 1Q1HA 4CDXC 5FZ8A 1K6YA 3F3XA 5T5JA 3SC7X 5IVVA 5CU1A 2Y9ZA 5AC92 3POFA 2Q8OA 4QHOA 3O1OA 3BU0A 2L9NA 2WO3A 4I7HA 3WE2A 2JENA 1D5YA 5BV6A 4PIZA 3ZCOA 1IJWC 1EV11 1VTNC 3KHBA 2TDXA 2VMHA 4HQEA 3CQOA 3AZZA 3PNYA 1U8BA 5DZEA 1HN1A 3M8FA 2VZOA 3UL2A 2FF4A 2BVVA 3KP6A 5EJ3A 3WHCA 1BOAA 5T52A 3LSEA 3TEDA 4GKXA 4P02B 2J7MA 3LSPA 3ES4A 2GC0A 1OXCA 4QX0A 1CJDA 1KFUL 4DXZA 1FBUA 3PHMA 3CUOA 2EH3A 2RDRA 2YC0A 5I8TA 3WG9A 1EV13 2J1VA 2WL1A 3NNLA 1D5VA 3GCWA 2TRTA 3M4OJ 1UKGA 1UMIA 1Y1VJ 1SFEA 1YEWA 1SACA 4HNVA 1ACIA 2CAUA 3TBIA 1UY1A 2MYSA 2HNHA 1JTYA 1W8ZA 2ECBA 3BPSA 3H42B 5ISLA 2KXLA 2X05A 5DG2A 1MJAA 2XBO3 5J98B 4LO4B 5JHUA 3DKWA 2MH2A 4HNTA 5ABJC 4V2VA 2O0YA 3PQKA 2DBNA 5JXIA 1VB4A 1NT0A 3BTJA 3T0BA 2FDGA 1RGSA 1BI0A 1AXKA 4I01A 3LDBA 3RYRA 3VL8A 3K4KA 2XJTA 2W1UA 1CONA 1VPHA 3M8EA 5J48A 2PJPA 3LFUA 1U5ZA 1GZWA 3ZFEC 2ZGLA 1MGTA 1J3RA 3PUHA 3VBHA 5IK8A 5FPBA 4AI0A 2YPJA 3ACGA 1DQUA 3ENRA 1QH6A 3DEWA 2VU9A 3OY9A 1FLIA 1QXRA 4J1XA 4HDUA 2Y6LA 4EN7B 2VUDA 3I0TA 4U7DA 4XILA 5HLHA 4P96A 2G7UA 1R9TJ 4C1XA 1WGXA 1FC3A 3THTA 1XSQA 4RGAA 3B73A 1BMV1 3GTMJ 1AR92 4XUNA 2BW3B 1ZA4A 4MGRA 4BXUA 1DQ1A 2GBYA 4LLLA 1P7JA 4M71A 2HKOA 5FUIA 1JZ3A 3RZKA 2UYAA 1OCPA 3WW3A 3ZSEA 3HEFA 1J83A 4DMIA 1KYZA 1Z9CA 1RXFA 4NPRA 2DFCA 5A2QK 1CJPA 3MUY1 3J80K 4XSZF 1PVXA 2CWEA 1WMFA 1ZBA2 2YU2A 3VKFC 4XF4A 1Y6IA 1YI7A 4BLIA 3WP3A 5ACA2 2WO1A 4AXOA 4S04A 3SMHA 1GUIA 3SCFA 4L97A 4RGRA 3VLBB 2VKEA 3BTCA 2UV1A 1TWGJ 4L0ZB 2KM2A 1LQ1A 5IATA 3VDAA 1W5CC 1MQTA 4IEXA 1AR81 2H8WA 4XRMA 2DYRH 2VZTA 4JTNA 3ACLA 3TO7A 2ISYA 4FPJA 2C5DA 4AI1A 2BFUS 2ME0A 4XJ8A 2W0XA 1S3JA 3GDBA 5F2WA 4OU0A 4MG2A 1RUF1 2HWD2 4XF3A 2FD8A 2JB8A 2HDDA 1OOPB 2HWE2 3AKRA 2A6EF 2JSPA 2Y30A 3JB8A 4NIGA 3A03A 2RNJA 1KU3A 1K78B 5A2QZ 5L3DA 3AP6A 5FZOA 2KJBA 1TC3C 2D3PA 3AX4A 2VBXA 4NHYA 4TLFA 5CIRA 4M3DA 1KU9A 5F8PA 1OPOA 1OT5A 4QLCU 1GNYA 4LKFA 2FX0A 3CLOA 1TNRA 4QPGC 4ASKA 4K21A 4JX0A 1Y9GA 5AVPA 4MTEA 2ZXQA 4GXLA 1XC5A 1RUF3 2GNBA 3CL1A 3WG3A 4XACA 1S7OA 3OS2A 2B9VA 1G9BA 3DU5A 1QXPA 1W8OA 1QIQA 1G6NA 2R7RA 5J4VA 3HBKA 1LOFC 5IYCJ 1YO5C 1UFMA 4F3JA 3GMEA 1FY7A 1OFNA 2OUJA 2JG9A 5DAPA 4BQAA 4RL7A 1AYM1 1TWHJ 2FOKA 5DUIA 3POSA 4BQYA 2DU1A 4HT1T 4DRRA 5B2GB 5M5XJ 1LVKA 2RN7A 1MW7A 4G6QA 4CGZA 2OCEA 2O8KA 3WV6A 4KA4A 1UZCA 2VPRA 4BJTA 3ZYHA 4BQ5A 2FBIA 2RS12 1COV3 5ED4A 4HSTA 1EV7A 1J59A 1C0WA 3COAC 4ESBA 1IRFA 4FP3A 2ECCA 3GF2A 5DEQA 3KVAA 2EF6A 4QDQA 4LOCA 1AYM3 3K4ZA 5JI7A 3GALA 2VI6A 1N75A 4N4OB 1RUE1 5E1RA 1R58A 2NVQJ 4D7NA 1W0NA 1RUI1 3NW4A 4CUAA 3BOQA 2K9MA 3AXDA 5J1YA 4ZS3A 2LTPA 2PAEA 4JKLA 4BY1J 2BOJA 3DXTA 4LA3A 1O7FA 1QJU1 3BR1A 5K8SA 4OWRB 2BPA2 5T50A 2HJIA 4URTA 1D8KA 2JDKA 1IZ1A 4MLOA 3VN4A 1R1UA 2WT1A 1CGPA 2DTRA 5FPLA 1G7YA 4I99C 4XAEA 3RIRA 1UAIA 2GDFA 2DQLA 1IKQA 3AJZA 2MLKA 1RUE3 1Z77A 1RUI3 2WFF3 2WY7Q 1LOAA 2NLRA 1SFUA 3AMNA 3AMPA 1FTZA 2WKKA 2JUCA 1FOXA 4ZY9A 2FCTA 1UL9A 4Q8LA 1UPSA 3AZVA 2NVXJ 2PXJA 1SVMA 2XQXA 4W97A 3CCVI 2A5ZA 3W5NA 3WTWC 1HB2A 2FBEA 1MH3A 5KAFC 4FPCA 4EEFG 3ETQA 4CA9A 3F8BA 3VBFA 2VODA 1LJ9A 1S6LA 4NC6A 1MBFA 2ZMKA 1UCXA 5FPUA 2IGKA 3GZAA 3MFCA 1F2NA 4XN3A 1TNTA 4JGZA 2AGSA 3KLSA 3BLYA 1H2LA 3K46A 1P92A 2WO7A 4UUVA 3LPGA 3VV1A 4UHTA 1Z7LA 1NY72 1D7PM 5DCMA 5J4YA 3DLAA 2G9GA 4OVEA 2YXSA 5IT9Z 3B6AA 4IVNA 2A3XA 4CZSA 4E2SA 3S15J 4AL9A 1CN1A 1LENA 2VKHA 3JRAA 4OI1A 1X19A 4E2QA 4IHWA 1WZXA 5AFBA 2R30A 3D82A 4HANA 2KIQA 2TNFA 3ABUA 1YS6A 2JA5J 3IRRA 3DTEA 3C7OA 1NG7A 4R52A 1HV1A 3VBUC 4IRGA 4HL0A 1GOGA 3BR6A 3G2BA 3GCXA 2A6HF 1HQCA 4KITB 1SBFA 3VBHB 3ABKH 4K6BA 4TZDA 1IZ3A 1H2MA 1Y3TA 5FYSA 1CAVA 2WNEA 2K86A 1UG0A 3E7LA 1S9HA 3HNBM 3WF3A 5A7PA 4AFCA 5JCTA 1M06G 1LAJA 1HLCA 1PVC1 2XB6C 1ZZBA 3KPHA 2O9LA 5M3MJ 4WM7C 2GSYA 1WVRA 5F0HA 4Y52J 3VZLA 4LBQA 2AR6A 2IVIB 4QTRA 3O3KA 1XMXA 4UW6A 3AP5A 1WJ5A 4IF4A 2BHZA 5FBJA 2XGDA 1F5FA 2VQ0A 5IVBA 2XB5A 3N7KA 5FKMA 5ILSA 3RZHA 3ZFGA 5L3EA 2HVSA 4UW5A 1TL8A 4FE7A 3CCJI 3EJKA 4BJ5C 4HRIA 4YW5A 5A3OA 2VT3A 1LKXA 2ZX0A 1ZX5A 1OCRH 2EK5A 5EYYA 1IS6A 3POIA 4FFGA 3QLQA 3OYGA 2B46X 2D43A 1MQTB 5KXCA 3O5SA 1WW7A 3TBDA 1UOJA 4E7LA 2XJQA 4FOWA 3OY8B 2QVSB 3LSKA 2EILH 3KCYA 4FPFA 1BZWA 3OEBA 3O14A 1HRI2 1K4TA 1CZTA 4JKKA 2ZSHB 3ML6A 2X29A 4I76A 5H2FC 4MEYF 3AKZA 3AMHA 3OS0A 1MS9A 4OI0A 2HWF2 1OCOH 5DD4A 2JE9A 3ERED 5CVVA 1T38A 1T33A 2FBHA 1K5MA 3E97A 3ZN6B 4JDNA 2VW0A 1QOSA 2RJ2A 1J5YA 3RYKA 1H9PA 1V9U1 3CUQC 3G1OA 3DBLB 3KP5A 2EIDA 1QQP2 4A3BJ 2J1AA 3RQ4A 1C8M3 1VQKI 2Q0AA 1S5LC 4FX4A 3JBG3 2F5EA 2IW5A 4F7ZA 3L1PA 3OYIA 2PN5A 5EEAA 5H9SA 1XD7A 3FM3A 4AFDA 4UFHA 3A2KA 5GLUA 4RR3B 4OIQF 5JUVA 4MFEA 3ZN1A 2HU9A 1A34A 2EFQA 1X9TA 4CU9A 4AVZA 4OOIA 2WNVC 2K9SA 3J7YJ 5FBZA 2W85A 1RPWA 3M3CA 2WA3A 3OYEA 2M7BA 1FEXA 3J7MA 1GLNA 3AP4A 3VKOA 4QXCA 3U2RA 4CYDA 4IV3C 3HSRA 1IPJA 2XKPA 4I3PA 2ID6A 2HFHA 2Z5WA 3IDEA 1OCTC 2OZ6A 5T54A 2GOXB 3D3AA 2JUGA 4QQPA 2D6PA 4RQPA 2X85A 2QKLB 2AEYA 3KD4A 4IEVA 3ISPA 1R1VA 1LFPA 2EAKA 4AD9A 2R1DA 3TN93 1W06A 4AK3A 1XE0A 4AZZA 1HKDA 5GLWA 1MDMA 3K7AJ 4N7IA 3PIPF 1GQPA 5F6LB 4QDRA 3PU3A 1B9NA 2CUZA 1H8AC 1AR61 1H9TA 1XMKA 2Z2SB 3JQWA 1ZGAA 3M2MA 2IT0A 4Y1YA 1BIBA 4EJOA 2E7WA 4DOUA 3JXSA 5CVRA 5FYCA 4XJWA 2WZR1 2R7FA 2B0LA 1UOGA 2EPFA 5BNOA 1VRH1 1MBEA 2X10A 2WB1N 3I56I 3VBOA 1LTEA 1WJDA 4DQ2A 1Y8QB 2XQRA 1LCLA 3WF0A 4DOZA 3I97A 3DPTA 2VTXA 3PURA 4YWAA 1US3A 1V70A 3OUHA 3N4MA 5D8LB 1UQXA 1XBFA 1R5GA 5I0RA 4OLLA 2JIJA 3ZFFB 5FZ6A 3I7DA 4XONA 3ITQA 4F83A 5JDBA 3SKVA 2KRHA 3HL2A 4L0YB 2IVMA 3VBFB 1SVLA 2XRLA 5D8KB 1VRH3 3NV2A 3SKJE 4B1LA 1DPRA 1R4NB 1ND3A 3NKTA 2H1LA 2AZ5A 4JGZB 4AVAA 3GTKJ 1XQNA 1YRZA 3PTRB 1AJKA 4MHUA 4PBPA 4XKBA