1RUOA

Catabolite gene activator protein (cap) mutant/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRFTVGRILKMLEDQNLISAHGKTIVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aromatic hydrogen bond in sequence-specific protein DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3')
total genus 45
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ruoA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruoA01
2HKXA 3ABTA 1MDMA 2ELHA 3H7YA 5DYMA 1Z6RA 3RJPA 1IN6A 1KU2A 4RB0A 3VFZA 1V70A 5DCMA 4AIHA 4ZYHA 2F5DA 1IN7A 1U5TC 2CG4A 3HRUA 5BXXA 2J5OA 2VOOA 1MDMB 2UXNA 2GU9A 2STTA 4JQFA 4KUMA 1XMAA 3N4MA 2HOEA 2OBPA 4CDGA 3L09A 2M1BA 1K7AA 4IF4A 3JZVA 2DFIA 3DF8A 3GZ5A 1Y9QA 3NEUA 2WC2A 3EO6A 1KYZA 1BI2A 4ASNA 2D1HA 3TQNA 1QZYA 1QXRA 3H9AA 3FMQA 3BY6A 3H1YA 5JR7B 3DFGA 5J8FA 3HOSA 2QBYA 4NB5A 2HKOA 1UFMA 3CO6C 2Q30A 4S05A 3DL3A 2A6HF 4IRIA 1ZLJA 3UKTA 5LGTA 4ENNA 1FZPB 2KRFA 2P17A 3C18A 3NKTA 5E1XA 4D7SA 4M9SA 3KETA 2HJIA 1Q43A 2XLGA 1BJAA 3EBRA 1JUHA 3FF5A 4QLCU 2DU9A 5AVPA 1FBSA 3GYDA 1EH8A 4HLTA 1OYWA 5BUVA 3S7EA 1T2KA 3FFQA 4EQQA 3COAC 4KNYA 1BI3A 4PIYA 4Y15A 4D0PA 4BHCA 2CAVA 4CXFA 4UBGA 4A6DA 2XL7A 3ZDSA 4IRHA 4A0ZA 1O4TA 1I5ZA 2K0GA 2IXHA 2B9UA 2FBIA 5AONA 5LEKA 2B5HA 2M87A 3QP6A 3I4PA 2VBWA 2NAZA 3G7DA 5E18F 3KP3A 4LJZF 5FD6A 2XKOA 3T5XA 4LK0F 2DPDA 2H0VA 3J81Z 4L2NA 1Z91A 2V1XA 3USSA 4HYEA 3K1NA 2M45A 5D4SA 3RYPA 4AXOA 3T0YA 3BOQA 1W5TA 4HX4A 1XE7A 4G7OF 4P96A 3F8FA 4JTOA 1PDNC 1LVAA 3JSPA 2I45A 5I91A 4U7DA 1FWZA 2D5FA 5DD8A 4LTAA 1B1BA 3KP5A 3U2RA 3WTXC 4UV9A 3ULQB 5I0RA 3HSFA 1S29A 1U8RA 4WCGA 5D1IA 1CGPA 3RPQA 1IF1A 4AVAA 2P6SA 3EETA 1RC6A 4RAYA 2O61A 4HMZA 3WW3A 2DW4A 4IEQA 1I1GA 2P4WA 5A2QK 5I8SA 4YRDA 4KIFA 1CAVA 2L4MA 3CUQC 5ICFA 1YYVA 3HRMA 4NVPA 5KHGA 1ZG3A 1KGSA 4YFXF 1J0RA 2OU2A 3D5LA 3CO7C 2KIMA 4EGZA 2L01A 3SCHA 3PFIA 3SXWA 1F1ZA 3J80K 3KP2A 2ESNA 4G7ZF 4LLLA 2XKPA 5KBFA 1HW1A 1BM9A 4AVBA 4LMYA 3TO7A 4KDPA 1TNTA 2HWVA 2E7XA 3C3WA 1D5VA 2KJBA 2QJVA 2JSCA 3L7WA 4PJYA 1Q5OA 4M74A 2DAOA 3QU6A 2KXLA 2P7VB 2VBZA 3ACLA 3IDBB 4L9NA 3I7DA 4UXNA 1YFUA 5CU1A 3GFMA 2CW0F 2HQNA 3BWGA 3E5QA 3HHGA 4ESBA 1T6SA 4EVIA 3I58A 3BJOA 2L4AA 2MPFA 5HLGA 3R0AA 4LB5A 1JHHA 5L3BA 2HS5A 3F8BA 1CAWB 1REPC 2OYZA 3FXUA 3K1PA 1LJ9A 3NQOA 2FA5A 3LOIA 2PLYA 1TQMA 1J3RA 1GXQA 5K5OA 5J7MA 3EJKA 1DZRA 2KKOA 1FYKA 4RAZA 5BMZA 5D5WB 3FX3A 4LG0B 1BI0A 3SCFA 4UUVA 2Q0AA 1NE4A 2Z3YA 4Q0SA 3QP5A 3GWZA 1I1SA 2OZJA 3V8JA 3WGIA 2XGXA 1FOKA 1S8NA 2HGCA 2PJPA 5D6FA 3TDZC 1IAWA 5E16A 2XAHA 4XSXF 1IPKA 2DK8A 1JGSA 2QWWA 5BV6A 2OZUA 1AOYA 3WGHA 2XAQA 4OMZA 2X0LA 1YG2A 3M8FA 2GC3A 4Q0VA 4L18B 3RKYA 4HSLA 1BI1A 5FGMA 3I59B 3WTYC 3U11A 4MEXF 1TLHB 1VP6A 2RDPA 3R4KA 1O3RA 1Q3EA 3WTVC 1WLTA 4RD7A 4XF3A 1C0WA 2PMUA 3K0LA 1IZ1A 1J59A 2B8MA 4IRGA 5I0SA 3JTHA 1MJAA 1IRFA 5AIQA 1HBXG 2DTRA 4MNUA 5D5VB 4XF1A 2JT1A 2IXIA 3QACA 2XAFA 2GIVA 2KJCA 4A6EA 4GXOA 1XSVA 4DNCA 1USTA 4O6JA 5J6XA 2YU3A 1MZBA 4I7HA 1KU7A 2QENA 2PI0A 4NQWA 3IRRA 1OYYA 5I8YA 4EROA 4MUVA 1ZZ8A 1O3QA 2A07F 2ZO4A 4KWLA 5F1RA 4Y13A 1PM7A 4M71A 2XLAA 1U6GA 3ETQA 2Z99A 3LAPA 4KFCA 3PLQA 1R1TA 4MGRA 2JTVA 1HSJA 4KIBA 4HF2A 2PFWA 4B29A 2FRHA 4IVNA 4ZU7A 2CYYA 3VHRA 4OOIA 3F72A 5BS6A 3BROA 3G3ZA 1W7PA 1F5TA 1IPJA 2PAEA 2Q8KA 2XUBA 3K69A 4CHUA 1XGOA 5D4RA 1XN7A 3PQJA 4Z82A 2UZKA 3LFKA 3BJ6A 2MH2A 2UXXA 4A2UA 3EDPA 2O1QA 2VT2A 2ACJA 2F5CA 1S6LA 1CAWA 1ZVFA 4MGZE 2VECA 3HT2A 4X6RB 2G9WA 2W84A 1J3PA 2FQ3A 1ZARA 4U7BA 2PN6A 5CVUA 5FB2A 2GA2A 3C7JA 2MA3A 1QZZA 3BB6A 4O9EA 4G6DA 4OFGA 3FM3A 2A61A 2P8TA 2VC0A 1DZTA 4HW0A 1IN4A 1FI2A 2D2WA 3RPUA 4MGYE 5L3GA 3GLXA 3DQVC 4A12A 3HT1A 4NHJA 1WRJA 1PMIA 4YSFA 5IT3A 4UVBA 2EAAA 1WI9A 4YARA 2FXAA 2HR3A 4IPAA 2O0YA 3WE3A 4ZYGA 1ZZ9A 4HQEA 2ADUA 4EWDA 4GO1A 3BCWA 4KIGA 4UXAA 3ZMSA 4H7LA 3RNSA 4TV7A 2C0ZA 2BNNA 5LGNA 1O5UA 4M6YA 2BGCA 3BPXA 1R22A 1ZZ7A 1D8JA 2PG4A 2XVCA 3RYKA 2K4BA 4LD5A 1XGMA 1ZRFA 2HTJA 2WFPA 3T8TA 3FXRA 2MH9A 1UHWA 1YW9A 5DCMB 3R60A 3K9TA 3MFKA 1HSTA 4O9GA 2K27A 3CUQA 2BBYA 3KMHA 4UV8A 4BHPA 4Y17A 3ZMVA 2BYVE 1IXRC 3DP7A 5D6EA 3ZMTA 4FX0A 1X8MA 2O03A 3ECHA 1NZCA 1UIJA 3BPZA 2A6EF 3Q9VA 4L9TA 1UCXA 1R58A 5LRSA 2H27A 2HTSA 3RTRA 1HQCA 2F5FA 1DUXC 3FE5A 1V4RA 3GUDA 2EVXA 2L3DA 1YUDA 3F8MA 1I27A 3V4GA 5E1RA 1ZRRA 2E1NA 3TGNA 1SMYF 2FNAA 4HAMA 2YX7A 3KZZA 3H8UA 4QM9A 2ET7A 1EY2A 3RZZA 3U9GA 2G7UA 4KL1A 5BY5A 3QRFF 4L9VA 3T1BA 4P9GA 4WXHA 2X4HA 4ONUA 2LKPA 4WK8F 1BC7C 2VE9A 2IP2A 1SFEA 2O8QA 1KA8A 3BDDA 3Q5FA 2VXZA 1HKQA 3ZMDA 1U12A 5IT9Z 5ILVA 3JAMZ 1OFNA 3SHFA 4MHGA 4BIFA 1JHFA 3TKYA 2OD5A 3T8RA 2F5EA 4N9IA 2V1DA 1XDUA 3H3UA 1PP7U 1K78A 3CDHA 5FQ0B 2A3SA 1RL3A 2PQ8A 1J7KA 3GVAA 5KHIA 2XHKA 4HDVA 2XROA 1G6NA 2Q2EA 2OAZA 1ZG1A 1YS7A 2GH2A 2O8XA 2QCSB 2ESHA 2ZNYA 4LB6B 1BOAA 4M72A 1ZZBA 5LGUA 4PCQA 5E8GA 1FSEA 4XLPF 3H92A 1F9NA 1H9GA 3S7IA 4XETA 3D0SA 3GXOA 4KMFA 3SFZA 1FP2A 4ON0A 3F22A 1RIOH 3ZN1A 1ZAOA 3RIRA 3HSEA 2H6BA 4E2GA 1RI7A 1RUOA 4LLGF 1STZA 2QLZA 3VB2A 2Z33A 4QX5A 5CVRA 1E17A 4G6QA 2CQKA 2EA2A 2D93A 5J48A 2W24A 1O3TA 3KFWX 4N9HA 4RGUA 1MKMA 1W4MA 1J9IA 3F3XA 4LLOA 2MC3A 3E5XA 4Q5SF 2ZMEB 1UB9A 4M73A 2KIFA 2Q0OA 1FSHA 1U3EM 4PIXA 1FP1D 1MD0A 2EWNA 3MYXA 3F21A 4M6XA 3QU3A 3WTSC 3ST7A 2IVMA 3LZZA 2ZBKA 2M8EA 4KN4X 1WA4A 3NJZA 4PGGA 2MBFA 1ZYRF 4EGYA 4ZU5A 5EEHA 2NNYA 4OLLA 1WGPA 5K8SA 1YO5C 5FFXA 4Q0PA 4E2QA 1CAXA 4HF0A 3ABUA 2LSOA 3WW4A 1RZ4A 4HVQA 3NVCA 2G7HA 2RN7A 3IIAA 3P9KA 3PQKA 2E1CA 2Z69A 3CUOA 2XAGA 5HVQC 4GYGA 2NS0A 1EV7A 3QAHA 1O57A 1J2XA 4L11A 3E6DA 4LLNA 2LDUA 1WKMA 2ET1A 2YPRA 5FLXZ 3OV8A 4Q0UA 5KVRA 2C6YA 4UHTA 1U5TB 4J1XA 4KU8A 5LEJA 4IEPA 4AIJA 5FO5A 5CYVA 4CICA 3EYIA 2ETEA 4M9ZA 3DPLC 3N97A 4IXAA 3VOEA 3CEWA 3R6SA 1U2WA 3MZHA 2R7FA 3OCPA 3HQXA 2GXGA 1DGRA 4L0ZB 4CO8A 1LR5A 3PVBB 5JI6A 3IWZA 1OKRA 3R61A 1QGPA 4L5JA 5E1ZB 2STWA 2F4PA 1Z05A 1USSA 3GFJA 2DBBA 2LF7A 1YS6A 1IUYA 4EM0B 3HOTA 1YQAA 1ZG5A 3IRQA 3TOAA 1HKSA 5JSRA 4EJWA 4KWKA 3DN7A 2RGVA 2P6TA 4I02A 1G3SA 4U0YA 5HI0A 2NRAC 4Q4ZF 1FBUA 1LDJA 1ON2A 4ZYDA 1DPUA 2HYFA 3ZMZA 2QQ9A 1S3JA 1L3LA 1S7AA 1CAUA 3KLOA 3V7SA 2CO5A 4XFAA 2UYAA 1FBQA 1QO0D 1QQIA 4L5IA 4QXKA 1XD7A 3ML6A 4BYYA 5LHIA 4OIPF 4XFHA 1RGSA 1NE6A 2RQPA 1J75A 1DDNA 5K5RA 2VE8A 1XCVA 1W5SA 4XRFA 4WXCA 2EV0A 4AVPA 1D3YA 1YFWA 4G7HF 3LWCA 3CF6E 3IKTA 1IN8A 1XSXA 2GZWA 5TRDA 1LDDA 1ZZ6A 1R1VA 4KYWA 5CJ9A 2E9QA 1ON1A 4A5MA 2XASA 5EZWA 2ETHA 2MLGA 4ESFA 5FD5A 2PAMA 1Z6TA 4ENJA 3LQQA 1O7FA 3PNAA 4IHSA 1FY7A 1S7OA 1P6RA 1SD5A 3EHKA 3UKVA 1R5HA 3O2PE 4B09A 5D8KB 2R7DA 2ZXJA 2EA7A 4LK1F 4KICA 1O5LA 2QQAA 4K2EA 5CVIA 4ESJA 5EEGA 2W25A 4LUKA 4HLXA 2QVSB 1FXZA 4P9FA 4HA8A 1NHAA 2COMA 1Y3TA 4ZU4A 3ZN0A 4FHTA 1SEFA 1KQ0A 3F6OA 1FX7A 3OF1A 3G73A 1R23A 4XSZF 2NYXA 3MWMA 2PFBA 3M7GA 4IEYA 5T3NA 1ZGAA 2CGPA 3WTZA 4YFKF 3KSCA 3WG9A 2Y0OA 2NNNA 2A69F 2QQBA 3BALA 4META 2D5HA 4XFFA 1TTYA 2DK5A 1U78A 4HN0A 4HX7A 1K6OA 4MX3A 3SCGA 5BPIA 4YFNF 1YIOA 3BU7A 3M70A 2PYTA 2KIUA 2PQQA 3ES4A 3SMHA 1K79A 2OZ6A 2OA2A 3P7NA 4UVCA 2BEOA 2H94A 1R1UA 2Q1ZB 4HOBA 4HQMA 3HTUA 3C1DA 1ZH5A 4HF1A 5I8TA 2J5PA 4LEJA 5DCFA 3V8LA 1O3SA 1DGWA 5CVJA 3HYIA 3ZPLA 2MD5A 4BQAA 4P9UA 3EQLF 4YNIA 4KN7X 5FQ0A 1SQ4A 3FMRA 2H09A 2VBXA 2P5KA 2DLLA 5E20A 1Y0UA 1L0OC 4EMSA 4QGNA 2OQRA 3SQNA 4WF2A 4PGHA 3S0MA 2IRFG 2EFNA 4XBFA 2WV0A 5ICGA 5BQTA 5HDNA 3Q9SA 3E97A 3SXYA 5DV5A 4BNCA 2DQRA 1ULYA 1AWCA 3D0JA 1CF7B 1O7LA 2PTMA 4UVAA 4YIIA 1E2XA 4HZFA 5JHUA 3DPTA 4IESA 1RUNA 3LAJA 3WODF 1R7JA 2QYOA 4U0WA 4IEWA 3NRVA 1X3UA 1QWRA 4E70A 5CVVA 3AAFA 4RGRA 4HX8A 1XGNA 3CTAA 3SHRA 2PEXA 2D45A 3L00A 3KE2A 3FZ3A 1EH6A 1CAXB 5ED4A 1R36A 2PMHA 3FJSA 1Q1HA 5LRRA 2ISZA 2V09A 3BJAA 2GC2A 4KA4A 1T0FA 3NL1A 3HSRA 5LLQA 2FBHA 1IXSB 4GCVA 3JW4A 4MGIE 3H1MA 2CWEA 1OYIA 2OA4A 2N7GA 2UWMA 4UNOA 4EM1A 3CUQB 3GF2A 2MHFA 1W7PD 3R0JA 1B9MA 4MQVA 4XFGA 4RGXA 1PP8F 2F2EA 1TQPA 4P55A 1DP7P 2Q4SA 1YW8A 4JTNA 2W57A 2VONA 1FPQA 1TNSA 4I09A 3IC7A 1TQIA 2XAJA 5ILSA 1XRUA 2GQQA 3REOA 1TW2A 3KEQA 3M3IA 4XFIA 1XE8A 2EFQA 1H1IA 2RC4A 4RGSA 3J80Z 3ELNA 2HFHA 4N0BA 2WWYA 5CLSA 4CGZA 2CFXA 1UPIA 4HDUA 3FHZA 2R3SA 1Z7UA 3BP8A 4EJUA 4IEOA 4AQ2A 1XDSA 1BIAA 3GYHX 4G94A 2WTEA 4KWJA 2P7CB 3ROUA 4HLYA 4EV0A 4R79A 2XV4S 4EJTA 1VTNC 4O5VA 1ZRDA 2FF4A 4MGKE 3TNPB 4U0VA 2BE5F 4AWXB 4QGLA 2UY9A 2FSWA 5H6QA 4BAYA 2JRTA 3E6MA 1K78B 5E8IA 1EYBA 1P4AA 1XGSA 1P92A 1YW7A 4I01A 4IHTA 1OD5A 4Z2YA 2IC1A 1DPRA 3J7AO 5DUKA 1QY4A 3WW2A 4JBAA 2DCTA 5I0TA 3GO5A 4G9YA 2XL9A 2M5WA 1J3QA 3MPBA 4DQ2A 4WVZA 5C8WA 2EB7A 2RV8A 4L9JA 3I64A 2IA2A 3LSTA 2IXJA 4WXDA 5E17F 1FLIA 1ZREA 4QM8A 4JVAA 3LA7A 5HDKA 1WWXA 4GYIA 1X8EA 5K1YA 3WTUC 4HSJA 4LUMA 2IXLA 1GVJA 3CL1A 3WU0A 5DEQA 4I3PA 2QVOA 3U0ZA 4P5OA 3C3VA 4A0YA 2A68F 3B02A 4AD9A 1TBXA 2AXLA 1FYMA 1PUEE 3FM5A 4O3MA 1FT9A 4XF0A 1XMKA 1P4XA 1YFYA 4HV5A 3E6CC 2ISYA 1GQHA 4EJOA 1OR7A 2YX4A 3GX4X 4RB3C 1NYWA 1MJ9A 3LWFA 1X82A 1KQ8A 3D82A 3E5UA 2BNOA 3MCZA 3H7JA 2ATFA 1RTVA 3IBMA 3U10A 1LEAA 3WTTC 1LKNA 1IXCA 3MDPA 3GFLA 3KCCA 4MTEA 4MH0E 1HW5A 2K4JA 4IEXA 3TO9A 4HVOA 5A2QZ 3TO6A 5I0UA 1HKTA 4F8AA 3RKXA 4A0XA 4LA2A 5FPXA 3L9FA 2VPVA 3EUHA 1SFXA 4QWQA 4GGGA 3KP7A 1CF7A 1XSDA 3IDCB 2Y48A 4A5NA 1V3FA 4OIOF 2D1VA 1JXSA 3O3KA 2EFPA 1UW8A 1XB4A 3U1DA 4AIKA 5FLIA 3I59A 4ZZLA 2GXBA 2RNJA 1SFNA 4LULA 5DDGA 4KT5C 4YYOA 2QDRA 3HIFA 1ZLKA 3DEUA 2O6GE 4WX9A 3FWEA 4EWAA 4M9XA 3F8CA 1F4KA 1R00A 2L54A 3MQ0A 1QXJA 1LQ1A 5JSOA 1OMIA 5FLJA 1YFHA 2FBKA 1GQGA 4X6QB 2RVCA 4U88A 1FC3A 4EWEA 4OU0A 3WGGA 4FBFA 2Z5UA 3LA3A 5L3DA 1BC8C 5D5UB 3IL2A 1CX4A 3O6BB 1XCBA 2LNBA 2DPUA 4HVRA 4IJAA 4KMUX 3BZ6A 1ONVA 3VEPA 3ES1A 3KP6A 5JR3A 3H50A 1LDKB 2V79A 2PA7A 4OIQF 5BPXA 4QGMA 5KHJA 3F8NA 1YHFA 4XLNF 5FPZA 5LHHA 2GWRA 3RKWA 4I2OA 4ORFA 4RS8A 1GXPA 4R52A 4ETSA 4OIRF 5JSPA 2VT3A 5ERIA 1Z1DA 2JPBA 2K9ZA 3P9CA 2OQGA 5HOOA 2IT0A 2V9VA 1LB2A 1W7PB 1H0MA 2OPKA 4OMYA 2MLKA 2FMYA 5HLIA 5HS9A 4TLFA 5FCCA 1B9NA 1BBYA 3V7CA 3WE2A 1BIBA 1J58A 5FFZA 1X7NA 4BH9A 3I0TA 3K1MA 1NXMA 5E1WA 5KK1A 4Q48A 5L3EA 3MEXA 5F6FA 3LQRA 2IA1A 3TDUC 2FNPA 2FMLA 4D7TA 2HYGD 4HV6A 5F64A 3FMSA 4IEVA 1G3YA 2D40A 4LA3A 2GC0A 2Z9OA 3RI4A 2YR2A 3RYRA 4J1WA 3NW4A 1EP0A 3I71A 5HS8A 3MAJA 1A04A 2PHLA 1RNLA 1WQ2A 1IW7F 5D8LB 2VODA 1CAVB 3DKWA 3CO2A 3HRTA 4WZCA 2FQPA 5KHKA 1ZHFA 3JSOA 5JVTA 4Z07A 2IPQX 4ZZDA 4ENMA 1VJ2A 1YLLA 1L3JA 5AIPA 3ECOA 4XFCA 1SD7A 4I0AA 3LA2A 2BNMA 3GW2A 2B0LA 2PHDA 1JE8A 2XRNA 4KU7A 3L2CA 4FT8A 1EH7A 1T98A 4I0BA 5I93A 2LF8A 2HEOA 3ZMUA 2H6CA 1QBJA 3KZYA 2MNGA 3QPHA 3FHIB 2HQRA 4XFBA 2GC1A 2UY8A 4UBHA 2K02A 1B4AA 3OOPA 1QPMA 4EJVA 2M30A 4IEUA 3J81K 2VQAA 3W6JB 3HHHA 5LBQA 2QM3A 2ZFWA 4AVCA 4LG0A 1BN5A 3GEZA 1P4WA 4PIZA 2XIGA 2UYBA 1I6XA 2EK5A 4CYDA 2VOPA 1LNWA 2QNKA 1FYLA 2EV6A 2AS5F 2EFOA 1G3WA 2V1UA 3WTWC 1GHCA 4QMAA 3ZP5A 1SAXA 3ISPA 4MZUA 1H9TA 1ODDA 4Q29A 4MEYF 3I53A 2XLFA 3SZPA 3W6KB 3CLPA 5BOXA 1H1MA 3JAMK 3GBFA 1J1LA 1YTYA 4JK1X 2FU4A 5ILUA 2EV5A 3M1EA 3CJNA 3DXJF 4IEZA 4IETA 2HDCA 3B73A 3OGJA 5HDGA 5JFRA 2TDXA 1B59A 4I98B 4WWCA 5HLHA 2YSRA 4HBNA 3EYYA 2IJLA 4K8FA 2ZCWA 3WW1A 4IERA 4R1HA 2QUFA 4ZH4F 1UIKA 4FAGA 2ZNZA 5CADA 2IA0A 3RDIA 2VN2A 3H3ZA 4EM2A 3VODA 5C6CA 2GA1A 3IWFA 3IKVA 4L0YB 1HXDA 5KHHA 3S2WA 1ZX5A 1ZNPA 3I5UA 3ERED 4HBLA 3QOPA 4H0EA 3M8EA 1ZZCA 1P2FA 1SFUA 4AQ6A 1IN5A 2CSOA 2E7WA 3V7RA 3MZYA 2IXCA 3IHUA 1ZRCA 2RKHA 4YG2F 5ICCA 2PBIA 1KQ9A 2ZMEA 3ELKA 4JV4A 1SD4A 3P9IA 1G4DA 5H6RA 4BXUA 1R5GA 3KP4A 4LFUA 4MQ9F 4R8HA 3TOBA 1WSUA 1UHMA 3KGLA 4HN1A 2EA4A 1G3TA 2V6CA 3E3VA 1UCRA 3ZQ7A 4DINB 4FAHA 1UD1A 3V8KA 1CAUB 2Z2SB 3HTSB 5L3FA 3F23A 2IW5A 3GZ6A 1OI6A 4CZZA 2P5LC 4XF4A 1T38A 4RB2C 5LHGA 5ICEA 3CLOA 3HUGA 5K5QA 2Y75A 1FNNA 4PZJA 3KGZA 1MGTA 3UKNA 3BPVA 2ZJ2A 4YIFA 1HW2A 3H1WA 4Q0QA 4B8XA 5HS7A 2GAUA 1EPZA 3I54A 1J5YA 4BHBA 3SZTA 4RB1A 4ENKA 3FXQA 3TNQA 3O14A 2A5YB 2L02A 2VBYA 5FDBA 2ZKLA 1SD6A 5D5XB 3QPTA 1KU9A 4WBBA 4ZYEA 2K86A 3KLNA 5FLXK 2CV6A 5FLHA 5IT9K 4S04A 1SMTA 3JTGA 4GULA 5TJJA 1B6AA 3K2ZA 5L3CA 2ZKZA 4LGWA 3L2HA 1LRHA 1D8KA 2EFWA 3CJXA 2BV6A 1KU3A 5J3UA 2HZTA 5JAXA 1YFXA 5JCTA 2DO7A 5BPDA 2PAKA 1U5TA 1ZN2A 3LAGA 1YWKA 4E2SA 2P5VA 2K7LA 2DI3A 4XF9A 1Z9CA 3NSTA 2DT5A 1TQ5A 2QZ8A 3DV8A 1OPCA 4XEZA 3KEOA 5EFUA 3OD0A 2JZYA 4MTDA 3GFIA 2Y0MA 2W85A 2O3FA 2QBYB 4F7ZA 5J8CA 3F6VA 4G8XA 4FX4A 5H20A 5DD4A 4OINF 4MV2A 2JPCA 1MJBA 2IXKA 1QNTA 1TW3A 1KYWA 2FEZA 2EJRA 5DUIA 1YLFA 2CAUA 3E6BA 1VR3A 3WU1B 2FOKA 3M9AA 4Q47A 2FE3A 3EQEA 6PAXA 1T39A 3OTFA 1ZGJA 2VC1A 3HRSA 2DQLA 1LEBA 3FZVA 1IRGA 4PDKA
chains in the Genus database with same CATH superfamily
1MDMA 3OG2A 2EZKA 5DYMA 1IN6A 1BW6A 1MBHA 1KU2A 2ZEXA 5FPUA 4FSJA 4V1PA 3HRUA 2DMTA 4M3EA 2XPUA 3BYWA 3UGGA 4FPEA 2DDBA 1YQ6A 2VOOA 2BHYA 5H9RA 1MQTC 4AI0A 2NM1A 2YS9A 5IOYA 4QD2A 3Q0UA 3N4MA 4XBNA 1ASJ1 2Y33A 3L09A 2M1BA 2IGKA 4AWDA 3IN9A 3IDAA 1W8OA 3DF8A 4CRQA 2YV8A 5E79C 3GNEA 4GMP3 3I97A 2VZ3A 4I30A 2ZX2A 2ICWG 4MG2A 3TWIA 2RDSA 4FISA 4IUGA 5J40A 5J8FA 2VU9A 4Q2FA 4LO7A 1UFMA 4QPOA 3BT9A 3DL3A 2GN3A 5LGTA 1RXFA 3WNPA 4E9KA 2DYSH 2CV1A 1K5MA 4M9SA 3HOZJ 1HRI1 1OA2A 3SKVA 1X9PA 2XLGA 5JOZA 2TCTA 3FF5A 4QLCU 5E3OA 4YG6A 2ZXWH 1FBSA 3B3QE 2W82A 1RUF3 2WYSA 5BUVA 4XL9A 1RUF1 2Y31A 1T2KA 5L7OB 4KNYA 2W4SA 2XJRA 4IXLA 3AKTA 2X1CA 2IS4A 4P9JA 4CXFA 2YC4A 2XL7A 5CISA 1R082 3VKMA 1H2KA 3OD4A 5AONA 2K9SA 1E0EA 4A44A 4QWNA 2NAZA 3L2QA 5E18F 3G7DA 2XKOA 1KXGA 5EGOB 4NWVA 3J81Z 1KDMA 1Q8QA 3LEGA 1DQUA 4E4ZA 2M45A 3VBRB 4P9XA 3T0YA 2KL4A 1CQ9A 4A69C 3LEKA 1XE7A 4G7OF 2PELA 3DPRC 3F8FA 3UYJA 3CJRB 4ITVA 4JTOA 2RREA 4XJAA 1FWZA 5DD8A 5CG8A 3KP5A 5IVEA 1IV6A 1RESA 1W2NA 2DFEA 3J7ZI 3VBRC 3IAS2 4BY7J 2GOXB 1G9CA 2DA2A 1U5XA 4BK5A 5A7NA 5A6QA 1NOVA 5FKCA 1UN1A 4IEQA 1I1GA 1ENSA 1BR4A 1S0JA 5I8SA 4X1EA 1L7LA 4LG3A 4Y26A 4YFWA 1E5IA 3CUQC 3HRMA 4NVPA 1S1AA 1KGSA 2OU2A 3ME2A 5HXVA 3CO7C 4EGZA 5DUWA 2A3WA 4BLJA 4QKFA 1B35C 2PHTA 3J80K 1NK3P 3KP2A 1UG2A 4GMP0 4JGYB 3ZFEC 2VKEA 3N9MA 1D2QA 3NAPC 4LMYA 3TO7A 3RQIA 2R071 2DFBA 2FDJA 3GTGJ 1D5VA 2P34A 3L2VA 2X8KA 3UJOA 1OLMA 3NKGA 4XNFA 4YGCA 2E31A 2DAOA 3KT1A 4XCAA 3FFZA 2VBZA 1UWWA 3ACLA 3I7DA 3BIEA 3I3MA 1LODA 2QBXA 3OYLA 3OMYA 4ESBA 1T6SA 3PO3J 1GZWA 2L4AA 3AMMA 5HLGA 3R0AA 2VULA 1JHHA 3IIIA 3GZEA 3UT0A 1DGRM 5L3BA 1CAWB 1ND3A 2W08A 1MH4A 3ZXLA 5A7QA 3K1PA 1NCRC 1LJ9A 4BWOA 4MFDA 4E7HA 1XSRA 1PGW1 1RUC2 4FXKB 3LOIA 2WZEA 4OHXA 3EJKA 2IGNA 1FYKA 2SBAA 5BMZA 2BZDA 1Y9GA 3FX3A 1BL0A 3SCFA 2Q0AA 4UT5A 1NE4A 1ZKGA 2ID4A 3BTCA 2KZGA 3ZN5A 2E7TA 1U0AA 2OZJA 5L9VA 1PK6B 2MC4A 2XGXA 1JOBA 1YIPA 4QXBA 3LMMA 2EIBA 5D6FA 1IAWA 5IT6A 3F0CA 1IPKA 1MBGA 4BGDA 1X58A 2OZUA 3PU8A 3FC0A 4Q0VA 5J36A 1HLCA 4CPBD 1RVF2 4WM8A 3K46A 2KDOA 3UETA 2Q1FA 1WLTA 4XF3A 1S55A 2OPTA 4A3BJ 4Y22A 1WD4A 1J59A 2B8MA 4K1YA 3JTHA 5H9PA 3CCEI 2DTRA 3AKZA 4II3A 5D5VB 3HAGA 4URTA 1OF3A 2WFF1 1ND2A 2GIVA 2KJCA 4GXOA 4JX4A 2GH8A 4E7LA 1VB2A 2QENA 4JHZA 3JD73 4N8MA 1OYYA 1QJY2 5I8YA 1OLTA 3QD6A 4EROA 5E3NA 2JICA 2ZXHA 2A07F 2ZO4A 4KWLA 3KYLA 4Y13A 2XLAA 4L99A 1U6GA 4CE8A 2V4JC 1F4AA 4IZZA 4MGRA 2PFWA 2ZGMA 1AJKA 3VBRA 2FRHA 1PK6A 1C1FA 3J7HA 2KP6A 3VHRA 4OOIA 3J26N 3F72A 4A3EJ 1DCSA 5BS6A 4DB5A 1GWMA 2LRDA 1W7PA 1IS4A 1Y4WA 1XN7A 3IZOA 4NC8A 1W6PB 3NV1A 2UZKA 3LFKA 4DZGA 1X1CA 3B01A 2Q8OA 2XVLA 1ZVFA 2GNBA 1AX1A 5GZFA 2W84A 2RR11 4R9BA 3PIGA 1J3PA 1RUJ2 4U7BA 3GTQJ 4Q4W1 1FX5A 2R043 2FJ1A 3JRDA 2GA2A 3C7JA 1DGWX 1QZZA 1OUXA 1NZIA 1TME2 4A7YA 2ZTNA 4YGBA 3CCVI 2A61A 2P8TA 3ZXKA 5DMYA 4CCJA 4CZSA 4KGGA 3VD9A 4YM3A 1D4M2 1WH5A 4MGYE 2WQ8A 3JD72 4PDWC 2W47A 3DQVC 4OI0A 2F4LA 2A05A 1X50A 4NIGA 2FXAA 3O8GA 3E1SA 3WE3A 1ZZ9A 2CL2A 5CKMA 1HF0A 2JENA 4ES9A 1MBEA 4Y20A 4M3GA 1FJLA 2ADUA 4IL6C 3BCWA 3J4UH 1MS3A 1PX4A 4V19K 4F92B 2I07B 2C0ZA 2PMZN 1XE0A 4NPMA 1O5UA 3BPXA 4QTRA 1TT5B 4C91A 1C3HA 2DTYA 4HL0A 3KV9A 4JZRA 1ERDA 4LD5A 5IP9J 3OY9A 3RFRA 2WFPA 1BA5A 5F5AA 1AR63 1D4VB 4OI2A 4UFMA 2MH9A 1YW9A 1G7YA 1LGBA 3K9TA 5FY1A 5F0HA 3HJRA 3HXLA 2JG8C 2K27A 4W1UA 5ABJC 2X85A 4BISA 3HQUA 4UV8A 3ZMVA 3ZSEA 2BYVE 1IXRC 3I3QA 5A3WA 1N3OA 3JQXA 2O03A 1QJX2 1NZCA 3WV6A 3WU2C 1G59A 3GMEA 3BPZA 5C3RA 4L9TA 3E7LA 1UCXA 1R58A 1VBB2 2P6CA 2BBAA 1VQ7I 3EUAA 1HQCA 3OYBA 4BMEA 4XMYA 1HDPA 1YUDA 4PI2A 4YIRX 2VGDA 2UWCA 1ZRRA 1MBKA 4FFHA 5D2AA 5CAZA 5JI9A 5BNNB 3LFUA 4UFLA 5LBBA 2BW3B 1JXNA 3H0GJ 2LTNA 1EY2A 1S0IA 3ZM8A 2J1TA 4KL1A 2WIIB 2VZRA 1PHMA 3T1BA 1SBDA 2RM22 4WXHA 2Q8DA 3O1UA 1AR73 4WK8F 1QH7A 4CP9A 1KA8A 2VXZA 1HKQA 1R1A1 3VHNA 4IHYA 3AB0A 5ILVA 1ENHA 4LK6A 3JAMZ 1OFNA 5M5YJ 2NOGA 4ZS2A 2R7XA 4BIFA 3CJIB 4XAEA 3VLBB 3TKYA 1KGYA 2OD5A 2LP0A 4QDRA 1WKYA 3LF7A 1OVPA 4X8NA 4HDVA 2XROA 1G6NA 1SHWB 1AR93 1ULFA 3H8RA 2RS31 2ESHA 4LB6B 1BOAA 3PM1A 4KT6A 4M72A 4GKYA 3TEZA 4QX2A 3HM5A 4OUSA 1JOJA 1F9NA 1H9GA 4CUGA 5FYYA 2VQHA 2VIXA 3GXOA 3SFZA 4PF1A 4FVVA 1RIOH 1PX3A 3HD8B 1ZAOA 3THDA 4B4QA 2H6BA 2L0KA 2QLZA 5FROA 1W9SA 1KFUL 2VTFA 2EA2A 2D93A 4NHKA 2Z4FA 2W24A 3HR9A 4LO5B 2D5VA 1UY2A 2XQXA 1W4MA 4GWIA 4UF0B 3PJYA 2X1DA 3M3QA 4Q5SF 2WAOA 1UB9A 1FSHA 4LBKA 2LM3A 3MYXA 2HWD2 4RGAA 3OOXA 1SVMA 5IVJA 3ST7A 3LZZA 2DTZA 3T1LA 2X5IC 1TMF1 4EQVA 4KN4X 2XVGA 3I2OA 3NJZA 2W0XA 1PJRA 1WJFA 2MBFA 5K0UA 1T0FC 4Y52J 4CDQA 4OLLA 1H8TA 1A8DA 2K46A 2QA4I 2ZC2A 2JSPA 4HPKA 1RZ4A 4XRSA 2AO9A 1MMSA 2GLOA 3PQKA 2E1CA 2Z69A 1QMJA 4DYRA 1Q8SA 5GTIC 4XAAA 2NYYA 1QDCA 5HVQC 5C8CA 2NS0A 1OFSA 3IT8A 2WBKA 1BR1A 1O57A 5EZGA 4AIDA 1Y1WJ 3OYKA 4L11A 3PVOA 3H9QA 4LLNA 1HB2A 2EILH 1SANA 2YPRA 5FLXZ 4ZTJA 3ZFGA 5BNOC 4XBQA 5LEJA 1P7IA 5FO5A 3EYIA 3N97A 3R6SA 4YW6A 1O4ZA 2GXGA 1MQTA 4CXWA 3CQOA 4CO8A 2P3JA 3IWZA 4Q4W3 4D3WA 1QGPA 3PNTA 3LCPA 2WRAA 1NQJA 2QQNA 1USSA 2DBBA 4LO8A 3RJ2X 1I6HJ 3HOTA 3RWKX 2VY0A 3GJAA 2LVSA 3TOAA 5JSRA 4EJWA 4L8QA 2JN6A 4KWKA 3WG2A 2RGVA 3HOVJ 2P6TA 3VN4A 2JA5J 4I02A 3RMXA 4O65A 1Z7S2 2YYOA 1ON2A 3FK7A 2ZHKA 2DF7A 2VCCA 3GTOJ 2F6CA 3HOXJ 3H9JA 4ZYDA 2QZ3A 3PSFA 4KWUA 1JTYA 4YW3A 5CKQA 2M7BA 4JQRA 3ZMZA 2QQ9A 5FP7A 1L3LA 2W1OA 1O6UA 1QO0D 4QXKA 2CV0A 3VL9A 4BYYA 1RGSA 2A7AA 2L9VA 1DDNA 3MKYB 1RUE2 2GMPA 1A6QA 2XMLA 4WXCA 1D3YA 1YFWA 1HRV2 4A3MJ 4KYWA 3TW6A 1ON1A 2Y9YA 1ZBE3 4A5MA 3KT7A 1ETVA 4BEHB 3BLYA 5FD5A 1Z6TA 4CH7A 4J01A 4ENJA 3LQQA 2XBO1 1S7OA 1P6RA 1W3XA 2H1LA 4MLOA 1QH6A 1R5HA 3K51A 4BACA 4B09A 1DQ5A 2EA7A 3GBGA 3OYEA 1O5LA 5GZDA 4V2WA 2VXDA 2AACA 2GMMA 4HA8A 3HPHA 3EYPA 1Y3TA 4GH4C 3IV5A 4ZU4A 4CSWA 3F6OA 5B1BH 3VHPA 1R23A 1X19A 2NYXA 2PFBA 5T3NA 1ZGAA 1GP4A 1K4TA 1MNMC 3WTZA 3KSCA 3WG9A 2XB6C 2O8KA 3CJQB 2X5IA 1QHGA 2K9LA 1W8TA 2AYHA 4CYCB 5JVVA 1TTYA 4MX3A 4DRVA 1VBB3 1YIOA 2R5ZB 3BU7A 2PYTA 1BOBA 2VZ1A 2OZ6A 3PSIA 5FKMA 2BEOA 1K6YA 4LITA 4XHXA 3ZSKA 4BE3A 2H94A 5EV7A 1AX2A 4BQQA 3DTIA 4CEYA 1V6OA 3BTZA 2VZPA 1JZ4A 4XIKA 5J96B 5AFBA 4LEJA 2FOWA 4D0QA 2JX9A 1Y8RB 2MD5A 4P9UA 1F31A 4XKWA 4KN7X 5FQ0A 1SQ4A 4AQTA 3FMRA 1RUI2 2HBTA 3D5OA 2P5KA 2PXJA 5CB7A 1Y0UA 2WO2A 1HCRA 4JGZC 3S0MA 5JR2A 2IRFG 4IDZA 2WV0A 1JS9A 1D1BA 2Z16A 1ZTRA 1ORKA 2XONA 1AWCA 2JA8J 4HPQA 4MXWA 4II2A 4HZFA 4IESA 2BQPA 3WODF 4UFKA 4ET7A 3IDEA 3SHRA 3KVAA 5ERLA 3L00A 1CAXB 2PMHA 4CDUC 2ISZA 2V09A 3BG5A 5FY5A 2DDAA 3OGGA 1I3AA 2HYJA 3HSRA 5LLQA 2M4GA 4N4OB 3CNAA 1NAEA 1WPKA 2COBA 4MGIE 2LFBA 1DU6A 5KXDA 2D6LX 3S2DJ 3Q3SA 2UWMA 4WV8A 1Y8QB 3G71I 3H0DA 4M6VA 3A4CA 3GF2A 4B3XA 3LKJA 1WBLA 1PP8F 3FBIB 2A1XA 4N7IA 3CJIC 2F2EA 3O1SA 2CWMA 1E57A 4UF0A 3WNLA 4CCKA 4BY1J 3LSPA 3ILFA 5DUXA 1AX0A 1V6NA 3ZFEA 2Q4SA 2W57A 3IC7A 3A21A 3BN6A 5ILSA 4WVWA 3NV4A 5LA2A 3KEQA 2R7ZJ 3CDLA 1XE8A 1WCKA 2MD0A 2ZGQA 2WWYA 5FZDA 3HNBM 4CGZA 1FMD3 1ULPA 1GVDA 5ISLA 3CCJI 5F32A 2R3SA 3GJBA 2ZGNA 3GYHX 1UZCA 4KWJA 5GTHC 1GLHA 1LOEA 5B5EC 1E5HA 3CD6I 2CSGA 2XB0X 3K70D 1XC6A 4IV3A 3DU5A 3ABKH 3CMGA 2R7QA 3VBHC 5A33A 2G1MA 2YPDA 5G05L 2Y9ZA 4N4NB 2DVGA 2FF4A 4MGKE 1ZA4A 3IM0A 4W8JA 4AWXB 1ULOA 1NLQA 4UB8C 2XF7A 4XLHA 2JRTA 3B00A 2W87A 3BTJA 4Q4V3 4PT6A 1K78B 5E8IA 4A42A 2IC1A 1P4AA 1W6OA 1N1VA 3ZSJA 1DPRA 3LFIA 5T5LA 2VKDA 3J7AO 3VZJA 4KNCA 3ZKUA 5AC92 4JBAA 2DCTA 2XHNA 4G9YA 4UFJA 3V0BB 3ABMH 2M5WA 1VNDA 3NWKA 1JUIA 4IQPA 1W8FA 5E17F 1ZREA 2VPLA 1DYOA 4QM8A 1S0CA 3WHCA 4JVAA 5FYZA 1S2BA 1W6PA 5HDKA 2F6BA 3MO4A 1ASJ3 2YU2A 3ZFEB 4BQ4A 1T6GC 3AK0A 4YVSC 2M2EA 4E8CA 3CL1A 1GVJA 3X2QH 4RGKA 5DEQA 1T2XA 1QIQA 2O5RA 1MS9A 4P5OA 1W6MB 3C3VA 3B02A 2E35A 2DT6A 1H4HA 1JZ2A 1KS5A 1RUD3 3RZDJ 2JIJA 1Z3YA 2K5CA 3P5BA 5TGTA 3O1TA 2C26A 2YXSA 1FT9A 4XF0A 4PJJA 4RSUA 1ASJ2 1QHDA 2AENA 2CQXA 4EJOA 1CN1A 3MD2A 2X6XA 3A7QA 2VOTA 1UOGA 2BNOA 1O91A 4AFMA 3IBMA 1LKNA 4FFIA 1P9QC 4MH0E 5A2QZ 3HBKA 4F8AA 2MYSA 3RKXA 2LH9A 4A0XA 1BZWA 5JMCA 2TEPA 4FFFA 4MXWB 4QWQA 1Y0NA 1CF7A 1XSDA 2A73B 1V3FA 3W2AA 4OIOF 3S15J 2VPRA 2WNVA 3O3KA 4I76A 4FOYA 4D7MA 4LO4B 2EZHA 1XB4A 4OI4A 5FLIA 1S0FA 2GXBA 1QNYA 2RM23 2DUQA 4YYOA 1ZLKA 1OKQA 5C3PA 4XABA 3DEUA 4GB33 2BBVA 3Q8EA 2WY8Q 2R7RA 3W58A 2EALA 3BTYA 3F8CA 2D3SA 5DXDA 1D0GA 1QXJA 3BCBA 2A6XA 4Y4YA 2BVLA 2PX9A 2ZHMA 4OU0A 4YW4A 1JT0A 1G86A 3WGGA 4FBFA 5IOZA 3M4FA 2LRPA 4N43A 1D4M1 4PHZA 2NQYA 1H0BA 3TL4X 1COV3 4Q1RA 1RITA 5KXCA 4HVRA 2DPUA 1UL9A 4P00B 2LLKA 4CUCA 3DTKA 1ONVA 3VEPA 5K7PA 5JXIA 1EKEA 4GALA 1E5SA 4QGMA 1D7PM 2PHRA 3RCOA 4XLNF 5FY7A 2GWRA 3CC2I 3LDBA 3PUSA 2X5IB 4PBOA 5ERIA 2K9ZA 2D6MA 1V6JA 3P9CA 2OVUA 4XMIA 3WQ1A 4OQ8A 5A1FA 2IT0A 3WEZA 3OGRA 3NRUA 1H0MA 2V1NA 2B42B 5HLIA 5FCCA 5FREA 2E5ZA 1BBYA 2ME6A 3V7CA 3T2QA 2MSYA 1UQXA 1BIBA 1FAYA 1QOOA 2W1WA 4BH9A 2RS32 5E1WA 5KK1A 2CQNA 3VBUC 5F6FA 2DUPA 3DXUA 4F93B 3TDUC 4U87A 2FNPA 4D7TA 4AU7A 2XSDC 2HYGD 2BP6A 3FMSA 2D40A 4ABZA 2JA2A 3HMYA 2YR2A 4IE4A 1BHGA 1TME1 3GCWA 1QJX1 3H8XA 2KIQA 2AREA 4NRMA 5D8LB 1LHOA 1TME3 2FQPA 4W6YA 3ZMOA 2Y69H 3VKLA 2R042 4ZZDA 1DLCA 5LK7B 1Y7BA 1L3JA 5AIPA 3R4UA 1BBT3 2BNMA 4GAZA 2QSGX 2C9KA 1GLNA 1REEA 1JE8A 3WINE 2XRNA 1PUFA 3SQOA 4YG3A 5I93A 4ZTFA 3ZMUA 1QBJA 1R091 5FP3A 1R093 4FPHA 4C9YA 4XFBA 5K9YA 5GPCA 3AP5A 2UY8A 2CNAA 1QPMA 4EJVA 5C4WB 4M01A 1Z0HA 3J81K 3CDZB 3W6JB 4F52A 5HV0A 3KZIC 4LG0A 2C4XA 3ORJA 4IV1C 2VG9A 5JLXA 3QQAA 2NMNA 1ENQA 2QNKA 2DMNA 2EFOA 2AS5F 1G3WA 1GHCA 2DVBA 4CDWA 2DJIA 2KFDA 1ODDA 2TBVA 4LKDA 3I53A 2XLFA 5JVGF 1B35A 5BOXA 1CQTA 2KT0A 4FQGA 5J37A 2NVXJ 3R4DB 4RQPC 2BERA 2EV5A 2A6WA 1MR5A 1SFPA 2YC2A 2VJIA 5EZHA 3OGJA 4XDQA 5FY9A 3VPRA 1K5MB 4I98B 1WUVA 4TTGA 3EPZA 2IJLA 1JKRC 3KF3A 4K8FA 2J1VA 1ENRA 4IERA 4KI5M 1OISA 3FISA 2Y60A 4ZH4F 1GUUA 2ZNZA 5FTTC 4QPQA 3ZYJB 3K4LA 2ZS6B 2VN2A 4EM2A 1RUG3 3RI8A 5T55A 2XQRA 4HXCA 1U5ZA 2X09A 1SZBA 3MKWB 1SLTA 4DBQA 2VMFA 1HA8A 3M8EA 1ZZCA 4HK9A 3AP4A 3FL7A 2RR12 1MZEA 1W9TA 1UZVA 1WA6X 3MZYA 2ZZJA 3MKLA 1UAAA 3KZ4C 1ZRCA 2RKHA 4YG2F 1KQ9A 2E63A 2JIGA 4QKDA 2OV7A 2GP3A 3FK6A 2IZWA 1DQ1A 3S16J 1MS5A 1ACCA 5K0UC 2BVMA 5H6RA 3PJQA 1MZFA 2P3KA 1SACA 4HN1A 4CU8A 2V6CA 2ELKA 4DXTA 3ZQ7A 2OUMA 2SLIA 2Z2SB 2IW5A 1NLSA 3GZ6A 1OI6A 2YROA 5J47A 5A3MA 5AC91 4OZOA 5DAVA 1CIWA 3VDCA 1BQPA 5HCAA 2Y75A 5F04A 3KGZA 4AM3A 3K2OA 1JUSA 5KHDA 5HLTA 3BPVA 4YIFA 2HLEA 3PTYA 4Q0QA 4WVMA 2HVQA 1EPZA 3P3PA 1J5YA 3SZTA 5LBFA 2M0MA 2ZKLA 4LORA 4SLIA 3B6AA 3QPTA 5FUNA 3G1MA 3C7OA 1PVXA 4WBBA 1N47A 1D1AA 5FLXK 4AC0A 1ODNA 5IT9K 4S04A 3T0DA 2XPVA 1OCRH 2ZMEC 4CCNA 2H8RA 1SMTA 5L3CA 3VUOA 2RHPA 1HV1A 2YBSA 3W3CA 4HG2A 4Q8KA 2HWB1 4E2SA 1JTXA 4GJZA 1Z9CA 1XTAA 2DT5A 3SC7X 3LSKA 2QZ8A 2JA7J 5E3LA 1OPCA 4HEA2 4IV1A 2VQLA 3ACFA 4A93J 1VQKI 5EFUA 5IJRA 1YQCA 2WB1N 2JZYA 2Y0MA 2QQLA 4DS0A 1QZEA 3F6VA 2WO3A 2WS92 2L9NA 3OY8B 5DPNA 3EUHC 3R4SA 4CCLA 2A3XA 2FOKA 4Q47A 1EAH1 2FE3A 4EYUA 2BW8A 1YX5A 6PAXA 4IO9F 5F0CA 1F9KA 1ZGJA 1URXA 3HRSA 5FUIA 3FUQA 1TNFA 2CGOA 3LOBA 2R49A 2ZX4A 1NQDA 1X9TA 2OXBA 2ZGSA 3Q8CA 3D1NI 1Z6RA 3RJPA 1APLC 1S0GA 4RB0A 3MPPG 5FPBA 2VNVA 1V70A 5DCMA 1D5YA 1DBNA 2F5DA 1IN7A 4EN0A 4DO0A 1EUUA 4JRLA 1YOVB 3JCIA 3BQYA 1MDMB 2DCEA 5IY5H 5FPVA 5FV3A 3DKXA 3FMGA 1WJBA 3OS0A 2WL1A 1XMAA 3U4XA 4BQ5A 1OA4A 4A6SA 1K7AA 3JZVA 1XYOA 4C0BA 2DFIA 3EO6A 1KYZA 1RC9A 1QZYA 3H9AA 3WF3A 2HOSA 2EAKA 1CWPA 2OS2A 4D6RA 3H1YA 4XKCA 3HOSA 3B9CA 3CO6C 2Q30A 3L2RA 2P2KA 2ARCA 3WF2A 2WINB 1MACA 4IRIA 3M3YJ 2VUCA 4ENNA 2D6OX 1EA3A 1G2HA 2KRFA 1NUKA 5J1RA 4AEKA 2OW4A 2P17A 1KQRA 3NKTA 2CUZA 1R092 5E1XA 3K48A 1CIYA 2W2IA 3OYNA 1Q43A 5DAXA 2IEKA 1JUHA 3TOJA 1K12A 1UAIA 1W8NA 2K3PA 1EH8A 1JZ7A 1OYWA 1VBD2 4XIDA 4D8MA 2F48A 2ZHNA 3FFQA 1VE0A 4CEWB 1B35B 4W6XA 1FNYA 3COAC 3P5JA 1OJLA 4PIYA 4CXXA 4Y15A 4FP3A 3ASOH 2DODA 2HEYF 4BJ5C 2ZPXA 3WQ7A 4IRHA 1JYCA 1O4TA 3G4SI 1WCMJ 4LHSA 5LEKA 4PDWA 3QP6A 5LB6A 2VBWA 2VZSA 4IE0A 2C5DA 4LJZF 4UUSA 4LK0F 2DPDA 2V1XA 3NWSA 4FCYA 3K1NA 3PNVA 3AL5A 1GZTA 3RYPA 5FBZA 3BOQA 1W5TA 3DGTA 4HX4A 1J1TA 5A1AA 2WABA 5FYSA 4OI1A 4OZXA 3TN93 4DXRA 2RMU2 2W7NA 3SISA 2D5FA 2XBO2 4LE4A 1LOGA 2EBIA 4UV9A 3ULQB 4GH4A 2A3YA 4K9SA 2X6OA 2XF5A 1QHHD 4WCGA 4BQXA 1SMVA 4XLFA 1O8SA 5D1IA 1CGPA 3RPQA 1IF1A 2P6SA 4XICA 4IOAF 1RC6A 5FZ8A 1VMJA 3M3EA 2ORXA 3WW3A 5DM7F 2DW4A 2WJSA 1W8HA 4PBPA 4YRDA 4IW3A 3VD5A 3WP3A 3ECQA 4Y22B 1YYVA 1IJWC 2QKDA 4YFXF 4E4DX 2KIMA 3W5MA 3PFIA 5FBJA 5L7OC 4CU9A 1F1ZA 3C7EA 5A7WB 2ESNA 4G7ZF 4LLLA 1OQYA 1I3QJ 2Y6HA 4F3JA 3MN2A 1T6BX 5FLMJ 4LBQB 1BM9A 1IS5A 4X8PA 3C3WA 2EF6A 3VBOA 3OYDA 4NAOA 4M4PA 2A70A 1PVC3 4MSVA 2F4IA 1LJ7A 3ZMNA 3ZPOA 4MVTA 4QIWN 2CUJA 3IDBB 4ZKTB 2R0HA 4L9NA 1FPN1 3LGRA 4YZ4A 4ES8A 5CBLA 2XAUA 5IP7J 5FZ1A 3K3NA 2HQNA 3HHGA 2M34A 1YIFA 4EVIA 3I58A 2X9DA 5FXXA 3PIOF 2OUHA 2MPFA 1VBC1 2G9ZA 3NNMA 4M0HA 4W6WA 3LL7A 4K1ZA 1F4HA 4TSVA 2GP5A 4RR3C 2OYZA 2ZA9A 5F9TA 3WDWA 1H2MA 2LD5A 2EXKA 4JC1A 1TQMA 1QQP3 3N35A 1GZCA 1DZRA 2ELJA 2RNGA 3CP2A 4XPVA 3ON7A 4HRIA 3OR1C 1H2NA 4XC9A 4SBVA 1VAMA 2JECA 4OUMA 3DPUA 1AU7A 3ZFGC 3ZRGA 2XAHA 4XSXF 3WDYA 4P5YA 3BTIA 2DK8A 2HWE3 4UAPA 4OMZA 2GC3A 1LHVA 3AXEA 1PYVA 4K7JA 1UYZA 5A7WA 4TYSA 1Q8OA 3U11A 1Q3EA 3WTVC 4RD7A 3VHOA 3K0LA 1MBFA 4TZDA 4IRGA 5I0SA 3BZCA 1IRFA 1UO9A 4LBLA 2FZ1A 1TVGA 2ZSHB 4MNUA 4S2GA 2BFUL 2QQOA 4XF1A 1JZ5A 1BK0A 2RMU3 2ZMNA 3AL6A 2VMEA 4DW6A 2UWAA 5A70A 5DZGA 2E6VA 1USTA 1SDDB 2E32A 5J6XA 2WZR3 1YE9A 1ETOA 1KU7A 4BPZA 3JRGA 2PI0A 2R5YB 2AC1A 4FTEA 3DU6A 5FMOL 1O3QA 5KXBA 1JYVA 5F1RA 1PM7A 1WWYA 5FZ3A 3FHNA 2Z99A 3LAPA 4YGDA 3ASNH 1R1TA 4KIBA 4RA2A 2DV9A 3EB7A 2OC6A 3LNQA 2JKBA 5F08A 2LKSA 3V42A 4AI9A 2HOTA 2EXJA 5EXOA 5IK7A 1OA3A 1VBD3 3BROA 1SEUA 1F15A 1WZ2A 4Y1ZA 2J22A 2PAEA 1VZ0A 4CHUA 5D4RA 3P3NA 1RUE1 4Z82A 2LYCA 3H9GA 3BJ6A 3ZIXA 4QPIB 2CHHA 2O1QA 2JG9B 5L7OA 2F5CA 1QJFA 3RWNA 2VOWA 3H8OA 3DTEA 2VECA 1XG1A 3HT2A 4YM1A 5C9AA 3FHAA 3ABZA 1VQ4I 3KF5A 3AYCA 2PN6A 1CVNA 4G9SB 1RETA 4IGPA 4AEMA 2C6SA 5JPNB 1QGLA 3POSA 2LMDA 1FTZA 4XQ4A 4O9EA 4OFGA 1U5IA 4PUSA 3SDGA 2VC0A 4BCUA 1DZTA 4HW0A 3QH7A 3KT4A 1IN4A 1FI2A 5IPAA 2PLV1 3VDDC 2BGPA 3GLXA 5L36A 3HT1A 5J3LA 5IVFA 1PMIA 2IGMA 2EAAA 1KD7A 1WI9A 2W91A 4CDUB 3K4ZA 4AAXA 4G6TB 3UESA 2E34A 5ACA1 5ANNA 3RZJA 4XJUA 3U1XA 4DY3A 4RM3A 2DYCA 4EWDA 3I3EA 1VBB1 1PGW2 1RUC1 2DA1A 2WNUA 4TV7A 3OYWB 4NIDA 1RUH3 1IG7A 3M7AA 3GTLJ 1R22A 4YZ1A 4OQ9A 3M1HA 1XS9A 2ID6A 4Z6YA 2LW8A 3BR0A 3HN1A 1AKHA 1ZRFA 3OYCA 4NPLA 4RMNA 2VXRA 4Q26A 1IQAA 3FXRA 1IKPA 2I5UA 5DCMB 4AHXA 3MFKA 3AKQA 1HSTA 3MZ8A 2E1MB 2BBYA 2KMUA 5C3QA 4BHPA 4GJYA 2JB8A 5D6EA 3DP7A 3ZMTA 4FX0A 1X8MA 2QSFX 3O0XA 4Q8LA 1RINA 4ARYA 2CWSA 3Q9VA 4UFIA 5FKKA 2H27A 1W6NB 3ZR5A 4XURA 2OT7A 3NAPB 1W28A 2E1NA 2FNAA 4MXVA 5J4VA 2YX7A 3H8UA 4Z8BA 2ET7A 3RZZA 2FUG2 2G7UA 3U9GA 1JYTA 1XPWA 5EJZB 1GSLA 4ONUA 4CCOA 4GDFA 1BC7C 4S2HA 2JUGA 2IP2A 2O8QA 3S6PA 2JUCA 1ONAA 1RYYA 3BG6A 3OYGA 3IUOA 3ZMDA 2GN7A 2BXYA 3CCYA 3HBZA 4M4RA 2PJRB 2WY7Q 1VQ8I 2F5EA 4N9IA 2V1DA 3CBNA 1XDUA 2DCJA 1PP7U 1SLCA 4URAA 5EJCA 1WLDA 3WP6A 1RL3A 3GVAA 4XE9A 5KHIA 2R041 3S5AA 2Q2EA 1Q8PA 2O8XA 3ATGA 1ZZBA 5LGUA 2VCMA 3HDDA 1WZXA 3SDBA 2PLV2 4CEYB 3S7IA 3D0SA 3VBSA 3BGAA 1FP2A 2R4GA 1C8NA 2JDPA 1S5LC 3RIRA 3VKFC 4E2GA 1LEMA 4COUA 4KITB 4LLGF 1FOYA 3K7AJ 3O0WA 2NOJB 2JRMA 3NAUA 1RUF2 4LK7A 2XWBB 1JYXA 1QJEA 4DOUA 4G6QA 4IV3C 2LTPA 5J48A 4XONA 1O3TA 2XJSA 4OAYA 1ZBA3 2IBDA 1KDKA 5DS9A 3F3XA 4J00A 4A3JJ 4LLOA 2MC3A 2QDNA 1I50J 5FWJA 4IX7A 3O1PA 3ZX7A 5FMDA 2ZMEB 3KPHA 1F5JA 1T56A 1U3EM 4PIXA 1LENA 3F21A 2WFF3 2IVMA 5ANQA 1WGXA 2WNOA 4JKLA 4OHZA 1UHSA 3NNLA 2WNUC 1A8MA 2ZX1A 4M3DA 1ZYRF 2W1SA 5EEHA 2NNYA 3ZYIB 1QJZA 3ABUA 2YPJA 4PLOA 5EQUA 1PK6C 4HVQA 2G7HA 1HQLA 5CFDC 3C7FA 3OGVA 3P9KA 1NG7A 2E1MC 4BEHA 4BK4A 2XAGA 1WBFA 1JGGA 1HDKA 4GYGA 1EV7A 3E0JB 2FDGA 1J2XA 3VYTB 3E6DA 4S0HB 1HC8A 2LDUA 1PZ8A 1WKMA 3H3LA 2WAQA 1FTTA 1RUH2 2VJJA 4J1XA 3W2VA 4QSHA 4E7SA 5CNAA 1PNGA 5KC6A 4CICA 1ZRIA 4M9ZA 1FV3A 3VOEA 3CEWA 3OCPA 3ZXAC 1SBEA 4AYBA 3PVBB 1OKRA 2STWA 2F4PA 4DXSA 5D8AB 4DUWA 1Z05A 4AFBA 1OBNA 5JZGC 1UX6A 5GAGJ 1YQAA 4Y24A 1YO8A 3DN7A 1G3SA 2YBPA 3NNFA 5HI0A 2NRAC 1UJ8A 4Q4ZF 2CUFA 1JODA 4C2MJ 2R072 1R6RA 2B63J 2JDKA 2DA4A 2KRCA 4YW7A 1KFXL 1DPUA 4DEQA 3WNNA 4W97A 4AVZA 2HYFA 1XPXA 3JB8A 1S7AA 1T33A 4XFAA 2WAAA 1I3HA 2UYAA 5CFDB 4L5IA 1VQ6I 3ML6A 4OIPF 3POBA 1RIRA 2VE8A 1XCVA 2EV0A 4AVPA 2WA0A 2F5VA 3CF6E 3LWCA 4CDXA 3GBWA 1IN8A 1XSXA 5GLWA 1LDDA 2VXJA 4N43C 1R1VA 5CJ9A 3ABLH 2XASA 3R0RA 5LCWL 1CX1A 2W92A 4ESFA 1ETXA 4IHSA 3OSDA 2P3YA 1MSFC 1SD5A 3EHKA 2VW1A 2X29A 3UKVA 1MEC2 5C5UA 5D8KB 2ZXJA 5JHFA 3LEIA 2TRTA 3OWTA 2QQAA 4ESJA 2WSUA 3VD3A 4FPKA 3U4SA 2COMA 5C70A 1FX7A 1H88C 2AEYA 3AYEA 2VJXA 3PHMA 2DJNA 3M7GA 5FZ9A 4IEYA 3VYSB 1GU3A 3IP4B 3VDAA 2CGPA 1UKGA 2HOAA 5EG0A 5EYYA 1QJU1 2QQBA 4META 4JX6A 2XGEA 4C1WA 4HN0A 4HX7A 5BPIA 5FY4A 5IP6A 3M70A 2D3RA 3T30A 3SMHA 5LW9A 4BE1A 2OA2A 2DA5A 4UVCA 5M5WJ 1ZELA 1HRI2 3TBIA 1QNWA 5GZEA 4A3GJ 1S2KA 2Q1ZB 5HPOA 4HQMA 4F91B 1LOBA 1POQA 3A22A 4MADA 2O7OA 4ZZ5A 1OQ1A 2J5PA 4MIMA 3UGFA 3AYDA 4IE7A 4QT6A 2VMHA 5C4WA 4YM0A 3FIWA 5CVJA 1MNEA 3HYIA 4MO7A 4BQAA 3AMNA 2MEV3 1G8WA 3BG7A 5E20A 2IS2A 5FZIA 1L0OC 4Q4X2 1WJDA 2OQRA 4PCRA 4WF2A 5KAIC 1XYPA 3MFAA 4UOJA 3C7GA 2EFNA 4QQHA 5J98B 1QKQA 3VV1A 1LNSA 1LU2A 5M3MJ 4IQJA 3M3OA 3OIPA 3SXYA 5IFTA 5BNPC 5L19A 2A5ZA 1JYNA 4YIIA 4UFHA 1VBE2 1RB8G 5JHUA 3IPVA 2JDUA 1R7JA 2QYOA 3V0AA 2NMOA 4DY5A 3MLJA 1XQNA 1X3UA 3OBTA 5CVVA 3CTAA 3ZQFA 2Y0SA 2D45A 2I74A 3H1CA 2ES3A 1HN1A 4QXHA 3I4MJ 5ED4A 5A7SA 2K40A 2XOMA 3AZWA 1Q1HA 5DN2A 3I2GA 2AGSA 2NVTJ 1UYPA 3A01B 1IXSB 3USUA 1EPWA 4OHWA 4FE4A 3H1MA 4EATA 5IHRA 2ENRA 3MUY1 1BEV2 1IS6A 1MVQA 1WJEA 1T8IA 2WS91 4V2VA 2MHFA 1AR71 2NLRA 4MQVA 1CPNA 1TQPA 3HWJA 1B8IB 1MNDA 4JTNA 1YW8A 3ZGKA 3THPA 4PI0A 5LBEA 2XAJA 1TQIA 4OCTA 1XRUA 3AKPA 2BRTA 2JXAA 4FOQA 2FDHA 3SEPA 1N77A 1H1IA 3B6CA 3ZQIA 4RGSA 5IVVA 1J84A 1CR7A 1W9FA 3ZXJA 2HFHA 4N0BA 2Y26A 1ETYA 4XUPA 5LY1A 2R061 1HV0A 5GLTA 4EJUA 3JUUA 2ZOEB 4AQ2A 4AGRA 1XDSA 1O4YA 1XC5A 2WTEA 4QHBA 2YUEA 2M9HA 2MEV1 2QQPA 4CDUA 2VZQA 4N43B 5FJHA 3ETPA 3ROUA 1VB4A 4RM2A 2VTXA 3AMHA 2QFEA 4R79A 1FMD2 2XV4S 5F5IA 3UNPA 4O5VA 1BCXA 4PJNA 1GWKA 2JDNA 1GANA 2YUSA 4UI9L 4L97A 4D9JA 3E6MA 4V2GA 2IVIB 1NH3A 4ASKA 1XGSA 1P92A 1YW7A 4IHTA 1H4GA 3CJIA 2PJRA 3EXUA 2FCUA 5DUKA 3BIWE 2JE9A 5I0TA 1VRH2 5T52A 1HLVA 3URFA 4DQ2A 3WDVA 1EV11 4QX3A 4L9JA 1AYM2 2BPA2 3ZQCA 3IKWA 1KZHA 2WN2A 5A32B 4UW3A 1NT0A 2V7FA 3OBRA 4MYEA 3WDXA 4JGZA 3MIEA 1X8EA 4PK4A 1EV13 2BW3A 4LUMA 2BXZA 4F55A 1RUJ3 2IXLA 4D5CA 3JBG2 2VOKA 3U0ZA 2A68F 1TBXA 3SYTA 3NAPA 4ZHNA 2R073 3NV2A 2D7FA 1R49A 3Q9OA 1QQP1 4IOCF 1PUEE 2XPJA 3POGA 1LEDA 3H5RA 1MPXA 4HV5A 3E6CC 4E7KA 3WY6A 1GWLA 4AG4A 4RB3C 1C8M1 1X82A 1W6MA 5FZEA 1RHI2 2HWF1 3SJMA 5GAHJ 3U10A 3WTTC 1IXCA 3G1OA 3GFLA 4MTEA 2M3AA 1HW5A 1FPN3 4IEXA 4HVOA 1MS0A 4P1WA 2BVBA 1S7EA 1XNDA 5FPXA 1YQ8A 2VPVA 3RS6A 3IDCB 1WHUA 3KP7A 2QE3A 2Y48A 4A5NA 1W2OA 1VRBA 1VBC2 1YI2I 2R7EB 5FPAA 3L1PA 1UW8A 3U1DA 3V0BA 2WNUB 4WM8B 4LULA 2R92J 4KT5C 1NX9A 1Z21A 1W8UA 4DZJA 2KZVA 4DOZA 1TP4A 3LEMA 1POGA 5FR3A 4WX9A 3FWEA 2V73A 1K61A 4AEDC 2V72A 1A3KA 2WLPA 4AHWA 3BODA 1LQ1A 5FLJA 2RVCA 2GM4A 2ORZA 4RQPA 2NVUB 3WF0A 2Z5UA 4JGYC 4ASMB 5L3DA 3B9IA 5D5UB 4IV3B 2IWGB 4RBOA 1Z0XA 3VGIA 4HNVA 1GUIA 3AVRA 2HQAA 2B7EA 3ZOBA 3I55I 2PA7A 4OIQF 1ND3B 3FXJA 1Q56A 1YHFA 2QTWB 3RKWA 1OURA 4I2OA 2ZJQF 1RRJA 1AXYA 1AR82 2PMZA 2V26A 3F9KA 2VT3A 1RMU2 3I2DA 1WLWA 1LB2A 2VCBA 4K21A 1REDA 2FMYA 1VI0A 2DOFA 5HS9A 3ZVXA 4IL7A 1HJGA 1W6QA 2OQ7A 1SPPA 1D2SA 2XGDA 3CC7I 3H35A 1NCQC 2EXIA 4NMIA 2HBUA 3MFCA 3KQRA 2IA1A 1G8XA 1XXNA 1O8PA 3HQRA 4JOMA 1SG3A 5IYCJ 2GMEA 3NW4A 3ZIWA 3LIGA 3D5SC 3K75B 3NJXA 4AHZA 3MAJA 3K4KA 3THTA 2UWBA 3VSLA 2JQ7A 3RG0A 2LBFA 4AFCA 2VODA 2LROA 3DKWA 1ND2B 3CO2A 1IHMA 3I2HA 4ISQA 3MV01 3OIOA 1W0UA 5A3UA 5M0TA 4YVSB 3QCWA 2IPQX 1TZLA 4FPFA 4DUXA 2JD4A 3QPLA 2EIMH 4XFCA 4RS5A 1SD7A 2HWB2 3LA2A 3GW2A 2B0LA 1HKDA 2YU1A 2PHDA 5GLUA 5C9AC 4GFBA 4B48A 4I0BA 1YQ5A 2LF8A 2HEOA 1JN2P 3MHZA 3S1RJ 3KZYA 2EIJH 3OL4A 3QPHA 3J7YJ 4HANA 1H8TC 4LBOA 2HQRA 4XOGA 4UBHA 1YRNA 4IHWA 2K02A 1ZYBA 2RM21 3VDBA 1VQMI 1A6IA 2M30A 3T0BA 4IEUA 2ZFWA 4AVCA 3K70C 2WKKA 5KNLA 1BN5A 1V5GA 2UYBA 2ZAHA 1L7QA 3AZVA 3S17J 2OCEA 3ZQHA 3DYMA 1LNWA 1W99A 3PDQA 2V1UA 2VO5A 3FLRA 1LHWA 1SAXA 4ZS3A 4JYKA 3SZPA 4CEWA 5CEHA 4ATEA 3ENRA 3FXMA 1LFBA 4FPCA 1N3PA 4XJ8A 1K83J 3M1EA 3LPGA 3VBHB 1JUPA 4OULA 3N05A 1XNTA 5JFRA 2DOAA 3ERMA 4RDUA 2YSRA 2Y34A 4HBNA 3KCXA 1E3PA 3N9OA 3CCRI 1SC7A 3WW1A 2WAEA 2JVHA 4R1HA 1GDTA 1QA6A 2ZHLA 1KJLA 5CADA 4NHMA 3OL3A 3HNMA 3BOWA 3H3ZA 2VL8A 5CQGA 5LWBA 2I8DA 4RR3B 4DJAA 1S9HA 3J7LA 2H8WA 3IWFA 3IKVA 3POYA 4DMIA 5FXWA 3QOPA 1CZTA 3IMMA 3JXSA 5HCBA 2HWD1 4EN9B 1POV0 1OR7C 4G4FA 4COVA 5E3MA 4D7NA 2VQCA 1SFUA 2YU9J 1IN5A 1UU4A 1AL21 5F2WA 2IXCA 3VYRB 4ZDOA 2ZMEA 4LO6B 3SLIA 1SD4A 3P9IA 3BCAA 3PU3A 4BXUA 3KP4A 1AL23 3UJQA 4AK3A 4ITCA 2BY0A 4R8HA 3KGLA 1UHMA 1AR72 1G3TA 1UYYA 2RS13 1UCRA 2ZBJA 4DINB 4XQDA 5FZHA 4CU6A 1RUJ1 2XC7A 3V8KA 1CAUB 4FPLA 4HG6B 3N3HA 2QF7A 4XF4A 2W68A 1T38A 1REFA 4RB2C 5LHGA 2LKXA 5ICEA 2VUMJ 3HUGA 1V9U3 3QWLA 1MGTA 1OCOH 3UKNA 4M3FA 1SFYA 4D6SA 4CA0A 2ZJ2A 4DEVA 3FN9A 5HS7A 5FFOC 5T54A 4NHXA 5EF6A 4H7MA 3TNQA 1HJFA 3LIHA 3BZKA 1OQEA 5A7PA 2CDOA 4B47A 2K86A 5FLHA 4NAMA 3BI3A 2LY1A 4M3CF 4LPLA 3CC4I 3ZQGA 1OKOA 3O1MA 2O9LA 3DCQA 4GULA 4L0PA 5H9SA 4OWRB 1LRHA 2EFWA 5J3UA 2HZTA 2KM2A 4E27A 5BPDA 3I2FA 3HOWJ 3WT3A 3DWLE 3LAGA 1YWKA 4Y5SA 2W3JA 2K7LA 1JBCA 2DI3A 1H30A 2WFF2 2ZX3A 4E6KG 1LOCA 3PURA 3NSTA 4XUTA 4DUVA 1TQ5A 1JI6A 3DV8A 1KONA 1X4OA 4Y3OA 1GMMA 2DVAA 4JX0A 2J1AA 1ETQA 3OEAA 4YG0A 3WNMA 2A6YA 4PJLA 5CKTA 4FX4A 5H20A 4XVHA 1YJ9I 4B7EA 1TW3A 2EJRA 2B9SA 5DUIA 2ARXA 4NHYA 3E6BA 1VR3A 3CCUI 1LOFC 3M9AA 3AM2A 5A6YA 1W36C 5CFCA 4XXPA 1T39A 3WF1A 2DQLA 5C8CC 2WO7A 5EYXA 3TBDA 1H8AC 2YZ4A 1IRGA 3PIPF 2F4MB 4D69A 1DIWA 3DBRB 2D98A 3ZYBA 2G19A 2ELHA 2ZFUA 4MOAA 1QJU2 2P81A 1W04A 5A3PA 3MI8A 3PUAA 3CHXA 4AIHA 4ZYHA 2CG4A 1BW5A 2XG3A 2QSHX 2GDFA 4EZHA 3CCLI 5BXXA 2J5OA 4A3CJ 5BNPA 1G9AA 3K4JA 4N53A 3FLTA 2QQKA 4Q4W2 2P37A 4BXFA 2EIEA 2STTA 2NN8A 1RJ7A 1BBT2 2QCOA 2HOEA 4BBRJ 2OBPA 4CDGA 3WX5A 1SAUA 2WYFA 3R05A 2R063 5FZAA 2WC2A 2Y6JA 1ZR4A 4CCMA 3RSNA 2HYXA 1N25A 3Q0WA 1IG3A 4BBSJ 1TWAJ 4ASNA 1F35A 2D1HA 1FPN2 1QXRA 3FMQA 2QQVA 3BY6A 1M06G 4HETA 4RHV2 3JB4C 3GXUA 2QBYA 4Z1VA 4Y5Z0 5K7FA 4XYXA 2A6HF 3UKTA 2WT1A 1VAVA 2WZR2 3MKZA 2CJJA 4ISRA 4Z2WA 4D7SA 2L9RA 3ZXGA 3HB9A 2HJIA 3B93A 2QGUA 1OF4A 5F3EA 2RS33 2W5FA 5AVPA 4P9IA 2JWTA 1OOPA 4BMBA 4QKNA 4AOCA 4Q4V2 4Y4RA 3OSFA 1BI3A 2HWD3 4UWDA 4QPIA 2CAVA 1K45A 4UBGA 4A6DA 3ZDSA 2CU7A 2W94A 3ZN4A 1ETWA 4C1XA 2B9UA 2B5HA 2M87A 3I4PA 4J6GA 5TSWA 4EE2A 4ARXA 5FD6A 4BQYA 1C8M2 1KITA 5KC5A 3USSA 2E2JJ 1HIXA 3S8PA 4AXOA 3VDXA 1GQPA 5DABA 2VJ5A 3WP4A 2ZABA 1OPMA 2D6NA 3BOPA 1U9NA 2HPIA 5FZ7A 4RAFA 5J1YA 2LALA 3PIJA 1QQP2 1LVAA 3JSPA 5FMCA 4U7DA 3Q8AA 2ECBA 4LTAA 1BBT1 3NNGA 2Y6GA 2QQWA 2O0OA 1B1BA 5LA0A 3NQHA 3OS1A 2G9GA 3S1NJ 2VBPA 3HSFA 1S29A 3M2MA 1PIV1 4AVAA 3EETA 3ZXSA 3AX4A 4CXYA 4RAYA 1P7JA 1HRV1 3RMYA 2K9MA 4YVSA 4B44A 2P4WA 3WNKA 3A02A 1LCLA 5D21A 2L4MA 3H5AA 1ZG3A 2R7OA 1UYXA 2QUOA 1DGWY 1J0RA 1JTZX 2GNMA 2VQTA 5FYIA 1PMHX 3SCHA 3IAPA 2RMU1 2V5DA 3SXWA 3TYJA 2QEXI 1GNZA 2XKPA 5KBFA 2VH9A 1HW1A 1QDOA 5FOJB 4KG0A 4AVBA 3SH3A 5F39A 3UL2A 4IGOA 3RJRA 2HWVA 1C5HA 2Y2ZA 2JSCA 3QOEA 1MMAA 3L7WA 4PJYA 4BDYA 3AP9A 3D6EA 2ZJRF 1FEXA 2P7VB 1W6QB 1A6CA 2R30A 1D0XA 1G9BA 3H5NA 4HSRA 2XDVA 5CU1A 2CH0A 2LY9A 2CW0F 1HXS2 2H0BA 4LT5A 5CYYA 3BJOA 2WO1A 3ZCOA 2DVDA 3ZYHA 3RI9A 2R1DA 3M4OJ 3F8BA 1REPC 4PLMA 4A3XA 4FPOB 4E4SA 2JG9A 1WMEA 2FA5A 2D43A 1CZVA 1DGLA 3KLSA 2LREA 1J3RA 3ACHA 3TN92 3ZFFC 3WLUA 1GXQA 5FZMA 4XACA 3U78A 1H2LA 2CY6A 4IKFA 1OT5A 4GB31 2NPIA 4RAZA 4TN7A 3A03A 5D5WB 2GALA 1BI0A 3K77A 5JIUA 4JP0A 1SCSA 3GWZA 1MH3A 1JJ8C 1I1SA 1MMDA 1ZQ3P 2HVRA 4XJZA 3V8JA 3WGIA 4MGTA 1FOKA 4NC7A 1E3OC 1TT0A 3TDZC 2G4IA 5E16A 3JCUC 3VBSC 4XUQA 1AOYA 2XXZA 3W20A 1YG2A 2B39A 4L18B 3RKYA 5CQEA 4JGYA 1PUFB 4HSLA 1BI1A 5FGMA 4Z2AA 3CMEI 4F83A 4ZZ8A 3I59B 1BMV2 3WTYC 3HL2A 4MEXF 3QYEA 4UW5A 4UUTA 1IZ1A 3OEBA 1U8BA 2AR6A 2VD7A 5AIQA 1HBXG 4QQLA 2RDRA 1JYIA 5FMOS 4QPGC 3O8HA 2IXIA 3QACA 1SVLA 4AYUA 5F0FA 4S2DA 1XSVA 4XRMA 1S0DA 4O6JA 4OAZA 1TMF3 5LATA 1ACIA 4GH4B 1MZBA 4I7HA 3IAM2 2O14A 3DUIA 4LNVA 4MUVA 5FYBA 3N36A 3DEWA 2YC0A 3JQWA 4CUBA 4M71A 1RUI1 4QPYA 1EAH2 4RLFA 3ETQA 4KFCA 1X3ZB 1O4XA 1GV9A 2XJVA 3MV11 3OUIA 3GCMA 2C9AA 4B29A 1VIWB 1GP6A 4IVNA 2WNVC 4ZU7A 2KD7A 5JWPA 1STMA 3RZKA 1SPPB 3BG3A 3KYCB 3HPNA 2KISA 4PDWB 3D8CA 3G3ZA 1JYWA 1IPJA 3DEMA 2BOJA 1WCSA 2XUBA 3K69A 2IFRA 1XGOA 3PQJA 1ZBA2 1UOFA 2MH2A 2MG4A 4A2UA 1GT0C 4QPWA 2VT2A 2ZGLA 4QPGB 5F3CA 1A35A 1W36D 1S6LA 2CS3A 5FP4A 5A3OA 4MGZE 1X1BA 1MZ5A 3A0BC 2BVVA 3UGHA 2FQ3A 5FK7A 5CVUA 1GZWB 2B46X 2MA3A 1TEIA 3OUJA 3VBUB 4G6DA 2CDPA 3I49A 1FNZA 2BZTA 3M8LA 1B72A 2VNOA 1IC8A 3PJRA 4OMCA 3CMYA 2CUEA 2VUAA 5SV5A 3RPUA 4CP1A 5L3GA 4AGGA 3DPRB 5FP9A 4YELA 2P0WA 1Y9MA 3WG7H 3KIOA 4A12A 1UU5A 4NHJA 3ZXDA 3KV4A 1WRJA 2X6WA 4UW6A 2W39A 3BR1A 4UVBA 2E26A 5FZ0A 2CQ7A 2E1OA 2GXAA 2ZXQA 4YARA 3SNMA 2HR3A 2O0YA 2P5BA 4ZYGA 4HQEA 5FZFA 5A6ZA 3TN91 2X6YA 4GO1A 1ND3C 4UXAA 3ZMSA 5C3OA 4H7LA 3ZN6A 4A3IJ 5LGNA 4AUXA 2VCAA 3I3LA 4M6YA 2BGCA 2CQQA 4KG8A 1ZZ7A 1F5FA 3RYKA 2HU9A 4RA0A 1GR3A 3T0AA 2DYRH 1RR8C 3T8TA 1NLRA 1QPIA 3S1QJ 4XLCA 2WB1A 5FXVA 2R0FA 2AEZA 1DQ4A 2OTJI 2YFZA 4Y17A 3VKNA 2OCCH 4A3DJ 3D4KA 3BKZA 3KV5A 4XN3A 2DXIA 3P6BA 5JMOA 1ODMA 4NHLA 5BNOA 1QVTA 3OIQA 1UIJA 3FXOA 4WM8C 4LBNA 2HTSA 5GADJ 3J9SA 1DUXC 5LA9A 2L9SA 3GUDA 1W2TA 2EVXA 2VI6A 4DPNA 4BL0B 1I27A 3V4GA 5E1RA 4E4HA 5EGOA 3K10A 4UUSB 1SMYF 3T08A 2ADDA 3PVEA 1R5ID 2XJPA 1IS3A 4K6BA 5FYCA 3QRFF 4L9VA 4P9GA 1X1PA 2X4HA 3VBFA 1FOD2 2VR4A 3W6VA 3BDDA 3Q5FA 2N8GA 3VKOA 3HPGA 1PIV2 1LFPA 5T5PA 2VLAA 5IT9Z 3LDRA 3C2UA 4XORA 4YLZA 5FXZA 1TNRA 5FZOA 2JDZA 5BNQA 5LD2C 1AL0G 3T8RA 2VNGA 1W6OB 4Q27A 3H3UA 1K78A 1OQDA 4QAWA 2JE7A 1J7KA 4M00A 2XHKA 3IB3A 2G9FA 3N9PA 5FJ8J 2GH2A 2M4KA 2R7TA 4CCDA 2ZNYA 4C2TA 1VBA2 1QXPA 1NCQA 4PCQA 3V65A 2YG0A 1UZZA 3K4AA 2NXNB 5I0DA 2EIDA 1WW5A 4KMFA 4ZJZA 4ON0A 2RS52 1PMJX 2JVGA 5FOBB 4JCKA 4NBQA 5IK4A 1RI7A 1RUOA 1R4NB 5HCHA 1EAH3 3VB2A 1GV5A 2Z33A 2OF7A 5GAEJ 5CVRA 1E17A 4PLNA 2K3FA 4LHLA 1NK2P 4HT1T 5JUVA 4Q5OA 1WMXA 2Y6KA 2E33A 4N53B 2DBIA 3KFWX 5JLVA 1PO22 4N9HA 4RGUA 4WM7C 1MKMA 5FZ4A 3OGSA 3K4NA 1N1TA 1QOTA 1J9IA 1AR91 1UXXX 1GKBA 3I9V2 3E5XA 3ZYGA 1R083 5EIYB 4M73A 5DG2A 2WZR1 1H6XA 5HBAA 1C8M3 3BTXA 4NJ4A 5K4LA 3WTSC 3USUB 1COV2 1TZOA 3A01A 2HPMA 2VVDA 2EIKH 1QJX3 1WVRA 4EGYA 4ZU5A 1WLCA 1WGPA 4NNJA 3M3CA 5FFXA 4FI9A 1IGNA 2LSOA 1SLAA 4RR3A 5IK5A 3WW4A 2Q5TA 3IIAA 1NA1A 4N7UA 3CUOA 1Y43B 4H4KC 3EUKL 3V0AB 3MF9A 1JJ6C 3AMPA 3AKSA 2BFUS 2DDUA 2I10A 2UU8A 2AH2A 1OLRA 1YI9A 2XGCA 1NXD1 3BTLA 2ECCA 4WM7B 4RLQA 2ET1A 4U2AA 4BJTA 3OV8A 3T2PA 4Q0UA 5KVRA 2C6YA 3ZQLA 3JRCA 4NOTA 4UHTA 1U5TB 3ZQQA 2K85A 3PNYA 4AIJA 3ZPYA 5CYVA 4RGGA 1PVC2 4GRIA 3LB9A 4IXAA 1U2WA 2R7FA 1FMVA 4C3IJ 2HWE2 1NY71 3B7MA 1DGRA 2PHXA 3OUHA 4L0ZB 3PTRB 1LR5A 1R9TJ 4CDWB 3J8F3 2HZDA 1V6IA 4RFRB 2LF7A 3NV3A 3L2UA 3PUIA 4EM0B 4YZ3A 2A6ZA 4FO9A 2BUKA 4AQSA 1DZQA 1S2EA 5KWRA 1OCCH 3DYPA 1LDJA 1DG6A 5D8AA 5C5TA 3HVDA 3WG1A 2QKMB 2R5ZA 4XQFA 1S3JA 1DFQA 1CJDA 2XWJB 2D6PA 1FBQA 2UUZA 1QQIA 1XD7A 3TEWA 5EG0B 1NE6A 2RQPA 5DQ0A 4EZ4A 1DGRN 2DFHA 2EZLA 1J75A 3AC0A 1VFCA 1W5SA 4XRFA 1RUG2 3VZOA 3ZSMA 2CRGA 4G7HF 4LBMA 2VNRA 2GZWA 5TRDA 3OS2A 1ZZ6A 2BWCA 2E9QA 1WJAA 4BDZA 5EZWA 2P6HA 2PAMA 4JHTA 4XDOA 1O7FA 3GTKJ 1FOXA 3PNAA 4LOTA 5GKAC 2MEV2 4QX7A 1UXZA 3OOUA 4LKSA 4AHYA 3AJYA 1BJZA 1HXS3 2R7DA 3RPUD 4LK1F 1V6LA 2R062 3L2YA 5FZGA 1IQDC 4K2EA 5CVIA 4BLIA 3JREA 5EEGA 4HLXA 2QVSB 4R9AA 4P9FA 3U75A 4C30A 4G3YC 2XUMA 4FHTA 1SEFA 1KQ0A 2GIZA 3ZOIA 3OF1A 5E6HA 3K4CA 3G73A 1JKQC 3M8JA 2VZVA 5IFPA 4E8DA 3WDUA 4YFKF 2Y0OA 3LSHA 2M8GX 4CP2A 1VMHA 4GA9A 5IYYA 2JMWA 2XR4A 1BMV1 2D5HA 4XFFA 5KAFC 1U78A 1K6OA 3PL8A 4XTMA