2R0HA

Fungal lectin cgl3 in complex with chitotriose (chitotetraose)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
MFHILRLESTVDLSEPLKDNGIIVFQSDKLDLEPSPNLGPTGIDNTNVNLINAKGDVLLHIGIRRRENAFVFNSIPYGESRGPEERIPLEGTFGDRRDPSITIFDHPDRYQIMIDYKTVYYYKKRLEGRCEKVSYKINEGQTPPFSDVLGVTVLYFANVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Chitotetraose Coordination by CGL3, a Novel Galectin-Related Protein from Coprinopsis cinerea
pubmed doi rcsb
source organism Coprinus cinereus
molecule tags Sugar binding protein
molecule keywords CGL3 lectin
total genus 41
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r0hA00
2DWRA 2TEPA 1AF9A 1C1LA 2OUJA 4PBPA 4SLIA 4XBQA 4C1WA 4NOTA 5SV8A 4ATFA 3WG4A 4LBMA 4XJAA 1Z78A 2WJSA 2XG3A 4XILA 3ENRA 1B09A 1FNZA 3CNAA 3WV6A 2JECA 1AVBA 3V0BA 1UX6A 2DUQA 1GNZA 1CQ9A 4YG0A 2A5ZA 2AGSA 1F31A 3AJZA 4AWDA 1MS4A 2D6MA 5E88A 1LGCA 4ATEA 3VKMA 1GSLA 1DZQA 3UK9A 1OQ1A 1VAVA 3M3QA 2VH9A 2VUAA 3IPVA 4DFSA 1BYHA 1UAIA 3N36A 1LULA 4FPCA 4YM2A 5GZEA 2GDFA 4OZXA 3AJYA 1FYUA 2A6YA 4M3CB 2DVDA 2P3JA 1MS5A 4TYSA 3OYWB 1LECA 3I8TA 2A75A 3V0AB 2W08A 2CWMA 4BOWA 3TB0A 2XB6C 4XZPA 5T5PA 1Q8QA 5FRAA 5T5JA 1UL9A 4DRVA 4UW3A 1W6NB 1QOTA 5EYXA 2NN8A 3AZWA 2EF6A 1LODA 1DQ1A 4YM0A 2WSUA 3ATGA 4DQAA 1LHVA 1HQWA 1RITA 1WW7A 2ZGMA 3NWKA 1JXNA 4Y22B 1IS5A 1Q8OA 1IS4A 3ZSLA 4UW4A 5H9SA 5IK5A 1Y7BA 1JW6A 4R9AA 1IKQA 1AXKA 2C5DA 2JJ6A 2UU8A 4PBOA 1MVQA 2PHWA 3AZZA 2D3RA 3OBRA 1NLSA 3A0KA 3O5SA 5CB7A 4Q8LA 2AUYA 1YXWA 4XXPA 3UJQA 1C57A 1OFSA 1VLNA 3FLPA 3JUUA 2Q5TA 4FOYA 2ZKNA 4AVVA 1N3QA 1U0AA 3OPZA 4XJUA 4AVTA 5JOXA 4YW1A 2H0BA 1UZYA 2ZHMA 1N1TA 1HQLA 1WBFA 3ZYRA 1A3KA 3V64A 3GALA 5EWSA 1JHNA 1V6MA 2AENA 1V6OA 3UL2A 4HANA 2W68A 1LHUA 3D6EA 1S0CA 4Y26A 3W58A 1MS1A 2YV8A 3AP7A 3HN1A 1ZA4A 4NO4A 4XHBA 1SLIA 2DVGA 1S0BA 3PVEA 3RS6A 4XYXA 1DYKA 4FQ4A 4CZSA 5HCFA 4UW5A 5E8AA 4R9DA 2R49A 1V6KA 4ASMB 4M3CA 2I2SA 3NV1A 2DU0A 1ZM1A 3OBTA 2WSVA 1R1ZA 2GNBA 4R9CA 2GMMA 3D4KA 1D0HA 5DZEA 3IMNA 1FAYA 1DBNA 1RIRA 5AVAA 1I3HA 4Y1YA 3RG0A 3TAYA 4DS0A 5IK7A 1SBEA 4K1YA 4U36A 3FUOA 4Y1UA 5GJ6A 4GWNA 1DQ0A 4AGRA 2A7AA 2W39A 4XDQA 2PELA 4D69A 2ZGTA 2ZGQA 3AP4A 3AYAA 5EXOA 3B01A 1SCRA 1C4RA 1W6MB 4L8QA 3C2UA 2GALA 1WLWA 1G86A 3A4UA 1LOCA 1CIWA 3AZXA 3M3OA 3RMYA 3SLIA 1DQ4A 1GNHA 4ZXKA 2GNDA 5KXBA 2DVAA 1H9PA 3I4IA 1LOFA 3PVNA 1SBDA 1LOEA 4XJZA 1LCLA 4H55A 3ZXLA 4P14A 4ZKTB 2OW4A 1W6OB 2BQPA 2D6LX 2ZABA 1RINA 1LJ7A 3H0OA 1YRZA 4LBQB 4XIOA 2E7TA 5GM0A 1O4YA 5JLVA 1O4ZA 4Q26A 3A0NA 3KM5A 4XJWA 5KXDA 4FVVA 3WCRA 2LTNA 1GANA 5DG1A 1LOBA 4XE9A 5FREA 1G9AA 1XQNA 2AYHA 2CL2A 5DUWA 1VIWB 4PF5A 3ZSKA 1CN1A 5HCAA 4Y20A 4FPFA 2ZZJA 4Q1PA 1CPNA 1LESA 2D6NA 1WW6A 4YGBA 4P9XA 1N3OA 1ULGA 4P9WA 2JDZA 4LBKA 2A3YA 2B7YA 2NP0A 1X50A 4ISRA 4K20A 5GZCA 1MVEA 1V6NA 5CBLA 1N1SA 2EXHA 3USUB 1S0FA 2ZHLA 2GN3A 4LBNA 1JUIA 1MACA 1PZ7A 3WCSA 4CRQA 3ZSMA 4GALA 5GALA 4LBOA 3WLUA 1KRIA 4FPHA 2A6WA 5E89A 4FPKA 1V6IA 2ZMKA 2ZGUA 3R05A 2R0FA 2GMPA 4Y24A 2YXSA 1IOAA 2A70A 1JOJA 3MW2A 4Y1XA 4YZ2A 3DGTA 2UWAA 1DQ2A 2ZAAA 3W59A 2P37A 4FP2A 4P9YA 3L2YA 2ZGKA 3WUDA 4LBJA 2ZA9A 4XBLA 3WDXA 3ZXKA 4PCRA 1DIWA 5LK5A 1N1YA 1HLCA 1SBFA 2D44A 3HMYA 4LBLA 4YFWA 4DPNA 1LU2A 3IN9A 4YW3A 2ZGOA 5KXCA 2D6PA 4CTEA 4FP3A 2VXRA 3WDUA 1LENA 2C9AA 4YM3A 2G4IA 1OKQA 4JRAA 3ZPYA 5DG2A 1F5FA 3ILNA 5DZFA 1W6NA 2CWSA 2P3KA 5IK4A 1DLLA 1WD3A 1QMJA 2EIGA 1H30A 3LSDA 1CR7A 3SH5A 5CNAA 4YLZA 3SH3A 1LOFC 4FPEA 4R9BA 4UW6A 5T5LA 4Y22A 4M00A 2GN7A 3ILFA 4YW4A 4FOWA 1UMZA 2ZGLA 3FUQA 1N3PA 1GZWB 1LTEA 2DUOA 4AVSA 5H9QA 1QOOA 1YI7A 1ULDA 2OUHA 4XMIA 1FV2A 2DVBA 2WKKA 3MEPA 3FLRA 4F83A 1AJOA 1WLCA 3B3QE 3VV1A 1DGLA 1KJLA 3USUA 4LBQA 1QDCA 1AZDA 1GZ9A 1W6OA 2ENRA 5T54A 3OYWA 1HKDA 2WLQA 3BOPA 3GNEA 1Q8VA 3AP5A 1N47A 3AX4A 3WNXA 3IPVB 2E51A 5H9PA 1Q8PA 3WDVA 1AX0A 5DUXA 2A6ZA 1GYKA 3AK0A 5IT6A 3AXEA 1WW5A 3SH4A 2ZMLA 1BXHA 2D3SA 5T5OA 2A3XA 3HR9A 2KM2A 4YM1A 4GA9A 4TZDA 2YY1A 1CVNA 4RL7A 2DU1A 4U2AA 3MW4A 1QNYA 4Q27A 1SLAA 2JE7A 4XXAA 3O0VA 4LBQD 1LEMA 5GZDA 1JYCA 3T1MA 3N7LA 2FMDA 2VW2A 4FOVA 4YGEA 2GMEA 1W6MA 3DUIA 5GLUA 5GLTA 4YZ5A 3WG3A 4YG3A 2R0HA 2NMNA 4AGVA 2R1BA 1W6PB 5DUUA 1WCSA 1S0EA 5HCBA 1W0OA 2ZGRA 4Q1RA 4Q8KA 1G9CA 3AZYA 3N3HA 2ZGNA 3RRDA 1CONA 1G9FA 2VY0A 1WBLA 2WNEA 1LGBA 1PZ8A 3M3EA 3SNMA 4FPGA 2R16A 2GNMA 1FATA 2W52A 3FLTA 3APBA 1QDOA 1AXYA 3VKLA 4XBNA 4YZ3A 1KDMA 1SLBA 1ULFA 1UZZA 4YW2A 2R1DA 1H9WA 1S0DA 1KJRA 3B69A 4GWMA 4GKYA 4RA0A 1GZCA 2ZGPA 3JU9A 1LEDA 5DUVA 2AR6A 2D6KA 2P2KA 2OVUA 4K21A 4Y1VA 2DV9A 1SFYA 2D43A 1IS3A 4Z8BA 3ZSJA 2VU9A 3AXDA 3RSJA 1DQ5A 1ENRA 4M3CF 1BKZA 1LOAA 2VW0A 3MW3A 1UN1A 4XIKA 5IUQA 2EALA 2JD4A 3ILRA 1QU0A 3U4XA 2CTVA 5CA6A 2RHPA 3T1LA 3T2TA 2FHRA 1JBCA 2DTYA 2ZHNA 2E53A 2V5YA 3M3CA 4WZFA 5GZGA 1W6PA 5DZGA 1GV9A 3AP6A 3ZXEA 5GZFA 5JVVA 1W6QA 2V73A 3V0AA 3ZVXA 5T55A 1SLLA 2E6VA 1KITA 1G8WA 1LOGA 3N7KA 1Q56A 1FNYA 3AYDA 3SITA 1I1EA 3OY8A 1IS6A 5IK8A 3VKOA 2DYCA 5GLWA 2EXKA 4C1XA 1LHNA 5JDBA 4XJ8A 1BJQA 2PHXA 2A71A 2UWCA 3PMEA 2ARXA 1J1TA 1WUVA 4I30A 4AGGA 3FBYA 3BIWE 3POYA 1QF3A 3WZ1A 2DTWA 2P34A 3RMXA 3AYCA 1YIFA 4XMAA 4YZ4A 3M1HA 2ES3A 4YFZA 5CAZA 1V6LA 2NM1A 2EAKA 4Y20B 4Y1ZA 4BQ1A 3WUCA 3WHTA 1APNA 1AJKA 4FPOB 4ISQA 3SISA 4JCKA 4ITCA 1PZ9A 1DFQA 1VALA 1HDKA 3BTAA 1A8DA 3WOGA 1QKQA 2CY6A 3PVOA 3QLQA 2ZMNA 4FPYA 3ZXJA 4HL0A 4BPZA 5KXEA 3UJOA 1CJPA 1LHWA 1DQ6A 1MZ6A 1G7YA 1ONAA 4YZ1A 1S0GA 1IKPA 2YZ4A 3ZXFA 4YG6A 4FOQA 3IM0A 1N1VA 3KQRA 5JOZA 3V0BB 1V6JA 5H9RA 1QOSA 2YMZA 1LHOA 3RQ0A 1ENQA 4GXLA 4MYEA 3IKWA 1W0PA 1GKBA 3AYEA 1CESA 3OJBA 2YROA 5T50A 3ZYPA 1GICA 1SLTA 2EXJA 1QGLA 4PQ9A 1G9BA 3N7JA 1ULEA 4YGDA 2UURA 1W6QB 4W65A 2WT1A 4Q2FA 1D2SA 3N35A 1DHKB 1LGNA 1Z0HA 1UKGA 1JYIA 1FV3A 2HYKA 3WDWA 1UPSA 1MS8A 4AYUA 1FX5A 2D3PA 1WW4A 5T52A 3O0XA 3FFZA 3V65A 3VUOA 2JE9A 1MS0A 1GZWA 3INAA 1S0JA 3OY8B 2JKBA 2A6XA 1AXZA 1MZ5A 4IQPA 4M3CE 4BMBA 3MPPG 2PHFA 5F9TA 2DURA 3R4SA 5GLVA 1NXD1 2NZ9A 1BZWA 5DXDA 2DUPA 1JN2P 1GLHA 2LALA 1MS3A 2EXIA 3AP9A 4FPJA 4KBBA 5JOYA 3D5OA 2P3IA 1A78A 2GNTA 2PHTA 3ASIA 3N7MA 4XHXA 1DYPA 2SLIA 5JOWA 1MS9A 3POSA 3VKFC 3O0WA 4XTMA 1WLDA 5EYYA 2WT0A 3AFKA 4JC1A 2D7FA 1GBGA 2E7QA 3NV3A 5F5QA 4XJ9A 4BM8A 2NYYA 1EPWA 3WDYA 5BYNA 2ZGSA 3VKNA 1LU1A 2ZHKA 4BMEA 3WDTA 4XOGA 3QCWA 2WQZC 1QNWA 1WD4A 2Z42A 1KQRA 2SBAA 3O12A 1AX2A 3WG2A 1AX1A 3Q9OA 2UWBA 1YYNA 3OGGA 2PHUA 1URXA 1C1FA 3WHUA 1S1AA 4YGCA 2WT2A 3R4UA 4WVVA 1F9KA 4WVWA 1BQPA 1MR5A 1TEIA 1V00A 4K1ZA 3BODA 3NV4A 1G9DA 3WG1A 2ZACA 1SCSA 2DVFA 3B9CA 4BLIA 2A3WA 2AREA 2NMOA 3POWA 1S0IA 2AH2A 1ENSA 1KDKA 4FQZA 4GKXA 2ZBJA 1CPMA 4DRRA 3LCPA 3AZVA 5L73A 1Q8SA 2ARBA 2PHRA 4YW5A 1YO8A 4FPLA 4BLJA 1VAMA 4XTPA 3WVJA 2CYFA 2VW1A 1SLCA 2A6VA 2ERFA 3B00A 4M01A 1SACA 2D6OX 1ULCA 2CNAA 4WV8A 5GLZA 5JMCA 3PJQA 3LSEA 3M2MA 3NV2A
chains in the Genus database with same CATH superfamily
2TEPA 4AFMA 4YVSC 4NOTA 3WG4A 4XJAA 1JMUB 1P8JA 1TME1 1YHFA 4P5YA 1LB2A 3GZUC 5EJZB 1B09A 2O14A 1A34A 2PXJA 1YUDA 5FQ0A 4R8HA 2JECA 1NKGA 3V0BA 1UX6A 2DUQA 3ES1A 4CEYC 2AGSA 4B4QA 4AWDA 5JAXA 1MS4A 1PIV3 3BALA 4AEKA 2JG9B 1LGCA 1GSLA 1DZQA 4IEYA 3M3QA 4B4PA 4DNYA 4A7ZA 1OH3A 1BYHA 1HXS1 2QQOA 4OUSA 5HPOA 2D40A 5GZEA 5J1XA 1JZ6A 2XJUA 5JR2A 2A6YA 5FZLA 3OTFA 2P3JA 1MS5A 4TYSA 2ZS6B 2YC0A 1LECA 1KFUL 4AG4A 2W08A 3BYWA 4TXWA 2CDPA 2XB6C 3MF9A 5KHJA 2WZ8A 5T5PA 1NXMA 1Q8QA 2V4AA 4HN0A 1AR93 4XVHA 1WLTA 5C4WC 1UL9A 5FZ3A 4DRVA 1DYOA 4X8NA 5EYXA 5CFDC 2IWGB 1OOPC 4HOOA 1RC6A 3AZWA 2VNRA 2DDUA 2GZWA 2WSUA 4G9SB 4N53A 1UOFA 3NKTA 3NWKA 1C5IA 1S2EA 1ODMA 2XXZA 1UW8A 4LLOA 2C5DA 3PUAA 3I2GA 1JYNA 3OBRA 1EAH3 3O5SA 4Q8LA 4XXPA 3PTYA 3VL8A 3LE0A 1OFSA 3VZJA 1VLNA 3JUUA 3VD3A 4FO9A 4LHLA 1N3QA 1U0AA 2G19A 2VZRA 2W5FA 4E27A 4XUQA 4YW1A 5GKAC 4E8CA 2ZHMA 3DPRC 5FFOC 3RZLA 4G4FA 4J1WA 3TBDA 2WFF1 4EV0A 3MIBA 3T2QA 3UL2A 2W1QA 3KT7A 5F37A 3NAPA 2R7EB 4CDWB 2W1UA 4AI2A 1ZA4A 3RS6A 4XHBA 1CZTA 4RYDA 4XYXA 1DYKA 4FQ4A 5EPAA 4CE8A 4UW5A 4LKFA 4KMQA 4R9DA 4ASMB 4M3CA 4FFHA 5HV0A 2YPDA 1BVP1 1JI6A 2XMLA 2MNGA 1RUC1 2J22A 1PVC3 2ZX2A 4CCEA 1FAYA 1I3HA 4Y1YA 3S5AA 3ZYFA 4QKNA 2BW8A 3ROUA 4BYYA 1OA4A 1NA1B 1NE6A 4Y1UA 4IW3A 5ACA1 1WA6X 4PI0A 2OS2A 3LKJA 2W39A 1Z7S1 2BVVA 5K7PA 2BFUS 4HMZA 2F6BA 2ZGQA 4GWJA 3RNSA 1SCRA 3J7MA 4QXHA 4DIQA 4L8QA 1OKOA 1RUG1 2GALA 3DKQA 3K3NA 2XHKA 3A4UA 3IAPA 4TSVA 1ZRCA 3M3OA 5F2SA 3KMHA 1GNHA 2PMWB 3IT8A 4MV2A 2WWSA 1LOFA 2LRPA 4GMP0 1OQDA 4JTOA 5LRSA 1RTVA 3CBNA 1LOEA 4XJZA 1LCLA 3ZXLA 1SMVA 4DUVA 3UGFA 2BQPA 2H6BA 2R063 2VE1A 3JBG1 4A42A 5IYYA 1OUSA 4N9HA 4JKLA 4MHRA 2CGNA 1RUG2 4QPWA 1UYYA 4QPYA 3VDDA 4GQ7A 2QQPA 3WCRA 1GANA 1R1A3 1LOBA 5DG1A 3T2OA 5HCAA 4Q4X3 4Q1PA 4XFHA 1TZOA 1LESA 4P9XA 1N3OA 1ULGA 2MHFA 2JDZA 4F8AA 3WW1A 1R1A1 2H0VA 3FC0A 2Q8EA 2VVEA 2AZ5A 4E2QA 2NP0A 1BEV3 3NNGA 3HAGA 4K20A 1MVEA 4LIVA 4A3ZA 2OZJA 4OI1A 2VMCA 2PA7A 2EXHA 2J7MA 2RG4A 4NROA 4R4ZA 4LBNA 4LMFA 3I3MA 5DAXA 1Y3TA 2RM23 2I74A 4NIHA 4E4DX 5JWPA 4LBOA 3WLUA 1K3IA 2PN5A 2Q1MA 5FZGA 4P02B 5K9YA 4CEYA 3R05A 2R0FA 4P00B 2JICA 4IE6A 4O7XA 5CKNA 4FSJA 1PO22 5LBEA 1JOJA 2WAAA 4Y1XA 1NQJA 4YZ2A 2WFF2 3P6BA 2ZAAA 1OBNA 4P9YA 2FZ1A 3L2YA 2VTXA 1XNTA 1YNAA 3NNJA 4QD2A 4W6YA 2WO3A 1V0AA 2VOXA 2ZA9A 3ZPOA 1OLME 1W2NA 1GZTA 2BBVA 2ORXA 1QJX3 1IQDC 4LBLA 4Q4V3 4YFWA 3IN9A 1GWLA 5BNNB 2HWB1 2UY8A 3WNMA 4CP9A 4CTEA 4MLOA 1E57A 4FI9A 2WYFA 5E16A 1RJ8A 5DG2A 5FZKA 1F5FA 1OPOA 3O1UA 5C4WA 2CWSA 3O1RA 3GYDA 3VBSA 1GU3A 1BBT3 4NHKA 2FDHA 4XCAA 2VTFA 1HN1A 3UKTA 4XF4A 4GAZA 4IV3A 2HLEA 3HQRA 4YLZA 3DECA 3SH5A 4BIOA 4KGGA 3VBUA 4GH4B 5FZIA 5T5LA 3VD4A 2IXKA 4QB6A 2WABA 4M00A 1YJKA 3ILFA 4WM7B 3OGVA 3H8UA 1UMZA 2ZGLA 4FOWA 4YW4A 5C3PA 1ZRFA 4ARYA 3D82A 4AVSA 3MFCA 1J3PA 2VCAA 4AQSA 1YI7A 4RS5C 2FDFA 1ULDA 2XBO3 3WT3A 1J3QA 1FV2A 2V72A 3VDDB 3LEKA 2NPIA 4DUWA 5FP4A 4UI9L 4AXOA 1ZBE1 1H2MA 5FZ6A 2QVSB 4Q0SA 3USUA 5HI0A 1ND2C 3I49A 2Y6KA 1IQAA 3J7NA 1HKDA 2QQIA 2OZ6A 3GCWA 3CF6E 2RDSA 1VPHA 3BOPA 4LOTA 5A7OA 3NAPC 1NLQA 3QD6A 1Q8VA 5D8AC 4E2GA 1NQDA 3AX4A 2BOJA 4D6QA 1J59A 3WDVA 1PGW1 1AX0A 5DUXA 4CEWB 5IT6A 2VJXA 5BNOA 4HN1A 1UOBA 5BNPA 1D4M1 3SH4A 1PIV1 1W2AX 2ZMLA 4MX3A 3T4VA 1D0GA 1SDDB 2AEZA 1K5MA 4ZY9A 3JB4C 4JX0A 3MIFA 1C28A 3RJRA 2YY1A 4RL7A 2Y26A 3THTA 3TEYA 2Y6LA 1RHI2 2GC1A 5L7OC 2R061 3JBG3 4U2AA 3GDBA 2WO1A 4QAWA 1LEMA 5GZDA 3T1MA 3B9IA 3RJ2X 5FPBA 4B1MA 4QXKA 4E2SA 2VTXJ 1ND3C 3KT1A 4BISA 5FCCA 4DY3A 5GLTA 2MEV2 4Q4Y3 4AF9A 4QX3A 5FY7A 5FTTC 4JKKA 5KHHA 1NZIA 1W6PB 4FFIA 5DUUA 4AGVA 4B29A 4XF0A 1TQ5A 4QHZA 3VBOC 2ZGRA 4Q8KA 3RYPA 3B93A 4KWKA 3H3UA 2Q8OA 3VBSB 4LO4B 1ZBE3 2ZGNA 3KSCA 3WNNA 4BDVB 5A1AA 3KV6A 2WNEA 2ADDA 1VBE2 5F2WA 4FPGA 3SNMA 4AI9A 2LS6A 2R16A 2GNMA 3BI3A 5DMYA 1HRV3 3MFAA 4UBGA 4UAPA 4XUTA 3U37A 1H9WA 1WMFA 1VBD1 2W92A 4ZU4A 4GKYA 2GC0A 2XPJA 1NT0A 2AR6A 5DUVA 3ZFEA 1OD3A 4K21A 1XOYA 1Y9GA 2DV9A 3HNYM 4AHYA 1UY0A 4R4XA 5A1LA 1NLRA 3ZSJA 4RQPC 2VU9A 4QHOA 2WR9A 3RSJA 5AFBA 1ENRA 2DCYA 4EE2A 2VW0A 4RN5A 1ULPA 4KGQA 3VDCA 1OLMA 4ZU7A 4KWJA 4CP0A 3PL0A 4CXXA 3POJA 2RHPA 5FZHA 1CD3G 4CEWC 4MGIE 3WP3A 4EZ4A 5F8PA 1XB9A 4WZFA 3ZFFB 3ETPA 4D6SA 2LROA 3WINE 4A2UA 3RWKX 1GV9A 3AP6A 3NVCA 1PMHX 3C3VA 1RUF3 1W6QA 2RS31 2IVIB 1AR73 2V73A 3LEGA 4UFJA 3ZYHA 4COYA 2R32A 1EV11 3N7KA 3U14A 3VN4A 3WNLA 1SZBA 4QPIC 4RGGA 3BTXA 2VD7A 4Q4X1 5CKMA 5EJ3A 3D0SA 5CFCA 5FPUA 4D0QA 3NNLA 4K8RB 2W91A 3HN3A 2KD7A 4C1XA 4ES8A 4LHKA 3EHKA 3LPGA 4CVUA 5BV6A 2PHXA 4AVAA 3H7JA 3MICA 1XE0A 2A71A 4AZZA 2P4EA 3CDZB 2ARXA 3J4UH 4OHZA 4AAXA 1WUVA 4I30A 3GBFA 5A7PA 3FBYA 2HWE3 1G6NA 1PK6C 2RDRA 4BQ4A 3RZGA 2ZX4A 4AI0A 5FO9B 3S0MA 1JH5A 1R091 3GHNA 4Y20B 2JWPA 1APNA 1AJKA 3SISA 1GUIA 5I0DA 4ITCA 5J09A 3DYOA 4NIDA 1DFQA 2QZ3A 1RXGA 4AL9A 1LR5A 2CGPA 5JXGA 1H1AA 4IV1A 1DF0A 1OLRA 2PHDA 5C3QA 4HL0A 3NKGA 1K5MB 4NJ4A 3WF3A 4OUMA 1MZ6A 1ONAA 3PIGA 3Q8AA 1NCQC 5FMOL 5JOZA 3BIEA 3KQRA 4TN7A 3RZHA 5H9RA 3LDRA 4ARXA 5K0UB 2V09A 5LA0A 2JIGA 1WKYA 2QDRA 2WS92 4QX0A 2BGPA 1NCQB 2P6HA 1AYN2 1CESA 3ZX7A 4MH0E 4GB33 4XZUG 1NZCA 4LULA 2EXJA 1QGLA 5T3NA 3LD8A 1G9BA 4QHBA 1W05A 4YGDA 4N43A 2J1TA 4W65A 1WZXA 1H8TB 3U11A 3U75A 1POV1 3JD72 5D8AA 1UOGA 3N35A 1NCRC 4JV4A 5FY4A 1LGNA 4YPJA 4I09A 1JYIA 5FMCA 4LJHA 5FY8A 1FX5A 2BZDA 4XAAA 3VBFA 2P3YA 1L7QA 3O0XA 3IWZA 5FPLA 3V65A 1PMJX 3VBOB 5BNOC 3VUOA 1JOPA 3DV8A 1SFNA 3INAA 3OY8B 3CMGA 2A6XA 4QGLA 3ABZA 5F9TA 2MPFA 2WL1A 3IDAA 1UX7A 2DURA 4NHYA 5GLVA 1NXD1 2EIEA 2NZ9A 3WF4A 5DXDA 1UZ0A 1GLHA 4FPJA 3U78A 1VB2A 5LA9A 3VB9A 4D7TA 1O59A 3V64A 2PHTA 3MBWA 3ZN6A 5ANQA 5EYYA 2WT0A 4LTAA 5IFPA 1FOD2 3CJXA 1ENXA 3NL1A 4RR3C 4CCDA 4DEQA 5F1RA 5CG9A 3HBZA 5FK8A 1CAXA 4URTA 4H2AA 1O3QA 3PU8A 4N53B 1VMFA 4FAHA 2DBNA 2VC9A 2ZGSA 2ZHKA 3ZFFC 4PQQA 2C0ZA 3VDAA 4QWNA 2BU9A 1QNWA 3VBFB 1BHGA 3DF0A 3O12A 1VBB3 4GJZA 3QOPA 3WG2A 1IPKA 3KV5A 2XQRA 4KWLA 4ORFA 3OGGA 3T30A 1F4HA 4IEUA 5A3PA 1OA2A 4CPBD 3H1MA 3VZOA 5F5IA 1EAH2 4WVVA 2HWC2 1F9KA 4W50A 4D6RA 5IHRA 3DXUA 2WZR1 1V00A 1AUYA 2DF7A 1U5YA 1QQP1 2R071 2FDKA 3FMGA 4DOUA 4LIUA 5A7WA 2WLPA 2VQUA 4FQZA 1WCKA 2Q1FA 4GKXA 4YW7A 2JDAA 4QKBA 1W2UA 4MOAA 1FPN3 5L73A 1Q8SA 1OLQA 2PHRA 4RD7A 5IJRA 1JYVA 4YW5A 3PDQA 4NHMA 1YO8A 4FPLA 2WNUB 5DAQA 4BLJA 4XTPA 1R082 4NPLA 2VW1A 1DGWA 1VBD3 2ERFA 1VE0A 4NRQA 2YYOA 4PDWC 3LF7A 1SACA 3EB7A 1ULCA 5ANNA 5FYMA 4E4HA 1RYYA 2N7GA 3THPA 3ZXDA 4XABA 3LSEA 4LA2A 2DWRA 2RS52 1C1LA 4C1WA 1DP0A 3HIFA 4ZS2A 1RUJ1 4DXRA 5EP9A 4LBMA 2R043 2XJTA 1Z78A 4WBBA 2PLV1 3HT1A 2WJSA 2XG3A 1H4GA 3VL9A 3ENRA 3URFA 1FNZA 2X05A 1M06G 4IGOA 3CKHA 5KHIA 1ZBA2 4QPGB 2VXJA 5FBZA 3WV6A 1AVBA 1IZ3A 5I91A 4CCNA 1M4WA 1GNZA 1AYM2 4YG0A 1ND3B 2J1RA 3AJZA 4EN8B 1ZYBA 3BN6A 1UD1A 1F2NA 5FOBB 2D6MA 5E88A 5C70A 1DU3D 2Y33A 4L97A 1QEXA 5J7MA 4Z92B 4B7EA 3VKMA 4MGYE 5FQ0B 3UK9A 1Y43B 2VUAA 1OSGA 3TYJA 2JDKA 4I0WB 4FPCA 2RVAA 4YM2A 1V9U1 4OZXA 4CU8A 3AJYA 1OH4A 4M3CB 2DVDA 2BP6A 3OYWB 5JZGC 2A75A 1DDLA 2K9ZA 4BOWA 1W99A 3K4ZA 3ZFGA 4CDUB 4LKEA 5FXVA 4AAPA 3RI8A 4D3WA 5C5TA 3T0AA 4AFBA 3NO8A 2P5BA 3CJIA 3E6DA 2CAUA 3GZTB 1CAUA 3PIJA 4FT8A 3I54A 4HK8A 5FLIA 3ATGA 1R1A2 2W95A 4KH9A 1WW7A 2ZGMA 3TEXA 4CP9B 1C8M3 1QJU3 4Y22B 1Q8OA 4META 3ZSLA 2VZTA 4UW4A 3N9QA 5IK5A 2UU8A 3H50A 4CP2A 2PHWA 4JGZB 2D3RA 3S7IA 1NY72 4LQRA 5FZAA 3ORJA 2AUYA 1YXWA 1H2LA 2TNFA 2XKOA 3E6BA 5C8CC 3FLPA 2Y60A 2XJPA 4FOYA 5A32B 1DZRA 2HWF3 2VUDA 4AVVA 4OI4A 5A6YA 1NOVA 4XJUA 3OUIA 5A7QA 3ZR6A 5A3UA 5AC92 2JDHA 1H8TC 1RGSA 1N1TA 1HQLA 3ZYRA 3POGA 2YGMA 3I3QA 3FN9A 2QZ2A 5I8SA 4CYDA 5FPZA 4HANA 2FDJA 2W68A 2JDUA 4HKOA 4Y26A 1MS1A 3WG1A 2WFF3 3SCHA 4LE4A 1SHWB 4BB3A 3J8F2 3A23A 5HCFA 1XXNA 2R49A 1V6KA 1RUJ2 2C1FA 3LGRA 4XQ4A 5LB6A 3NV1A 3I7DA 4Z07A 4NIGA 3POFA 1ZM1A 3IMMA 2RS51 1ZZ9A 2GNBA 3NRUA 4FXKB 4R9CA 1PGSA 2GMMA 3D4KA 2VBBA 1OA3A 1RIRA 1HJGA 3RG0A 5AVAA 4DS0A 3LOBA 2GP3A 2Y0OA 5EJ1B 4MHUA 5IK7A 4BCUA 1AR62 2VOTA 2B8MA 2FQPA 4GWNA 4EYUA 5FUNA 1OMIA 1OXCA 2VR4A 5FXZA 1BK1A 1TE1B 4N90A 2GH8A 4D69A 1ST8A 4IEXA 1BBT2 3KCCA 4F7ZA 3LEIA 2VMGA 1W2TA 3Q8FA 4N43B 1QHDA 3AP4A 3AYAA 3OEBA 4UFHA 1C4RA 2X10A 3GGLA 3HBKA 1W6MB 4HLTA 1BCXA 1Q43A 1JZ7A 1LOCA 2R6QA 3KHBA 2B45X 2HH9A 2JDMA 1XPWA 3SLIA 1W8NA 3B5LB 5EFUA 4YW6A 3PVNA 5A33B 1CAWA 1UCXA 3TNQA 4CXWA 3SCFA 1EAH1 4ZKTB 3OF1A 2D6LX 2ZABA 1LJ7A 5BNQA 4LBQB 4XIOA 4N53C 5JMOA 3TEZA 1J58A 1MPXA 5ABJA 1JYWA 5J96B 4OLLA 4J1XA 5FO8B 2FCUA 2PHLA 4Q26A 3FJSA 2ZX3A 3I59A 1XQNA 2CL2A 2WZR3 2CAVA 4PF5A 2JB4A 1CPNA 2WWJA 4YGBA 1F4AA 1UXXX 1WMDA 1W8FA 2D5FA 4ZZ8A 1GOHA 1YJLA 1YFXA 2B7YA 4KG0A 2Q8DA 2B9VA 5GZCA 2K0GA 1BEV1 3ZMNA 4OCTA 5CBLA 1EP0A 2ZHLA 3MGUA 2X8KA 2B42B 1MEC3 2GN3A 1RHI1 1JUIA 2OA2A 3ALQA 4ZU5A 5K8SA 1RMU3 2PLV2 5DAVA 1QJY3 3MLLA 1XJAA 4GALA 2VAUA 4TLGA 4C8DA 3ZYGA 2A6WA 4QDQA 2ZMKA 3K75B 3TRSB 3OSDA 2WNUC 5FYCA 1AR82 4F3JA 1RB8G 2A70A 1W3VA 3MW2A 5L7OA 1VRH2 2UWAA 1RVF3 1DQ2A 3FWEA 2RMU2 3ZYIB 4A41A 4CDWA 4W4ZA 4HKWA 4YVWB 2XLFA 2HWD3 4MADA 1PHMA 3E5XA 4LOSA 4RHV1 4X6RB 3RZJA 1LAJA 1N1YA 1HLCA 1SBFA 1UNBA 1D4M3 2D44A 2FMYA 5FPVA 5L9BA 4O65A 5IAVA 2JENA 2YPJA 4QKDA 5FZMA 2BEOA 4L0PA 2X5IC 5DAPA 1JZ3A 2VXRA 1ZBE2 1RUC2 4P08A 2PYTA 2C9AA 2BTVC 2HEVF 2V5DA 2G4IA 3SHRA 3ZPYA 4YM3A 1CWPA 3U0ZA 2RS13 2WQ8A 3KQ4B 4DXSA 5DZFA 1QIQA 3KCYA 1DLLA 5L36A 3E5UA 1VBE1 1QMJA 4BQXA 4CA9A 2BVBA 1CR7A 1QH7A 1ZZ6A 3A7QA 1LOFC 4FPEA 3NNFA 2WZPP 3PUHA 4GB31 5JI9A 4NN0A 1RUE3 1FOD1 4R9BA 4EZHA 3KVBA 4RR3B 4A6SA 1IG3A 3P1IA 4MXWA 4KG8A 3FUQA 1GZWB 2O8QA 2DUOA 3FL7A 1C3HA 2WWUA 3RZZA 1J83A 3GBGA 3BU0A 2WNVB 4XMIA 4HK9A 4XQWA 1CX4A 1H8VA 1COV3 4V1PA 1AJOA 3K4AA 5D2AA 1E5HA 2YHJA 2WA4A 4LBQA 2DCTA 3WR0A 1AZDA 3WNPA 5JXIA 2JG8A 2YFUA 3OYWA 1DGRA 3TN93 5JPNB 5C9AB 5HCHA 2WLQA 2X53S 4CEWA 5FP8A 3AP5A 4QQOA 1CZVA 3IPVB 1W8WA 5H9PA 4HBNA 4AI8A 4CCKA 4OHVA 5B4NA 1GYKA 2W1WA 4GWIA 3AXEA 5LY1A 1EV12 2FZ2A 4RS5B 5KHGA 3SEEA 1WW5A 2YFZA 5CFCC 2VGDA 3HR9A 1HIXA 2KM2A 4YM1A 2ZEYA 4MGTA 4GA9A 1Q3EA 3VZMA 1NA1A 4COWA 4QX1A 1XE8A 2PAMA 1HB4A 1JYCA 2VPVA 2ZEWA 3CEWA 4HVRA 4JGYC 3B02A 4NPRA 4JVAA 5IVEA 3DUIA 1HRI1 4SBVA 5GLUA 1UMIA 2R0HA 5C71A 1QH6A 5C3OA 4EQVA 2XHNA 4KQ7A 5BNNC 1AL23 2WQ4A 4Q1RA 2C6SA 3N3HA 1KS5A 1ZZCA 2VECA 3OOXA 2VZSA 1G9FA 2E32A 3M3EA 3CZUA 2XJVA 5CFCB 1JU3A 1U5IA 1QJY1 5FYUA 1XBFA 1FATA 5JIUA 2WS93 1X36A 2RR12 1UU5A 5FY1A 1AYN3 4XBNA 4AEJA 1R093 1SLBA 1VB4A 1ULFA 4YW2A 3FE5A 1S0DA 5IW0A 3KT4A 4GWMA 5A7SA 2I07B 1LEDA 4BQ3A 2P2KA 2OPKA 3MDPA 4DEVA 2D43A 2KR2A 4I3PA 1WCQA 3D8CA 4IDZA 5C9AC 5KWRA 5LZ6A 2RS32 4BA6A 4AFDA 2RJKA 1BKZA 1LOAA 1JUHA 4YYOA 1L3JA 1UN1A 4XIKA 5E6HA 2XDVA 3LFIA 2EALA 2JD4A 2O1QA 5JZGB 3U4XA 2BWCA 2CTVA 5BPXA 5CZKA 4CU7A 3T1LA 3VBFC 3M70A 2C9KA 1SFPA 2ZHNA 3M3CA 1UY2A 4Q4Y1 5GZGA 3SXWA 3TEWA 5GZFA 3H9AA 5CIRA 3S7EA 3W5MA 1VBB1 1IHMA 1I5ZA 1KITA 4RQPB 1G8WA 1PO11 1Q56A 4N7IA 1LNSA 1GOGA 4ZS3A 1TME2 5J3UA 5CU1A 3EYPA 3H8RA 1ND2B 2ORZA 5FY0A 4EROA 2DYCA 4Z2WA 1PGL1 3GHMA 2VNOA 3POEA 1X9TA 1LHNA 4QGNA 4XJ8A 4CDXB 4Y4YA 3WF0A 2BYVE 3HJRA 2UWCA 2WAOA 2ZCWA 4ASLA 1J1TA 1HB3A 2X5IA 3LQCA 3ZIXA 2XL7A 3AMMA 1JODA 4GULA 2WS91 5HV4A 3FHIB 1UIJA 1YQ2A 1VBB2 2FCTA 1ND3A 4UFMA 3ZO0B 5FKCA 3M1HA 1COV1 4QQHA 1NE4A 4KU7A 2CGOA 4NIAA 1V6LA 4PDWB 4MGQA 4QT6A 5LASA 3WUCA 3Q8BA 1JHJA 1I5PA 4FPOB 4IE7A 5LATA 2NLRA 3CZJA 2WN2A 2YUEA 4H14A 5FYIA 3PVOA 1LRHA 2BGCA 2ZMNA 3ZXJA 5F3CA 3C7EA 2QQWA 1OOPA 1C8NA 2JG8B 4JTNA 5C8WA 3UJOA 3E1F1 3ZIWA 1G7YA 4IUGA 1UU6A 2YZ4A 4FOQA 3IM0A 1N1VA 2QBXA 5J98B 1X7NA 1V6JA 3MHZA 1QOSA 5K0UC 2YMZA 2VNGA 2BJSA 4XW3A 4CDXA 3RQ0A 1ASJ3 1RUD3 1HW5A 3IKWA 1Z7S2 4IE5A 4MXVA 1O91A 4FTBA 3BTYA 1W0NA 3AYEA 4IL7A 2PTMA 3JCIA 3OJBA 2YROA 5CYYA 5G05L 1GICA 4JKMA 5T50A 3NMBA 3WXPA 4OULA 3ZFEC 5LCWL 2ILMA 5I0UA 1AYM1 1TMF3 1ULEA 4RQPA 4UOJA 2RV9A 3ZSEA 3DL3A 1VBA2 2IUWA 3DPRB 3UGGA 3D0JA 2Q4SA 1RUF1 1S2BA 1DHKB 4I2OA 1Z0HA 2C4XA 1AYM3 4GJYA 4XF9A 5IFTA 4I01A 1NY71 2PAEA 4AYUA 5ACA3 4L2NA 2D3PA 4Q4W2 2Y0IA 3LA3A 4LT5A 5T52A 1O5UA 4OMDA 1WMXA 2WO7A 4AEMA 2XLGA 1FPN1 1MS0A 4M3CE 1PK6B 2IVJA 2Q0AA 1MZ5A 3OGRA 4BMBA 3MPPG 3WD5A 3LA7A 2GH2A 2RE9A 3LFMA 1JN2P 1YFWA 2LALA 3AP9A 4K3UA 1JZ8A 4P9LA 2AACA 5C5UA 2GNTA 4JDNA 5JOWA 1DYPA 1XSRA 2SLIA 3H7YA 1MS9A 3POSA 1UPIA 4DUXA 3MF6A 3EBRA 4JGYA 4AHZA 2W0XA 5LRRA 5FZEA 2QQUA 2D7FA 3GJAA 1T6GC 3IIAA 1RUH3 2E7QA 2HWC1 2IZWA 3NV3A 2E33A 4BM8A 1EPWA 4UWDA 1LKNA 5BNNA 2HBUA 1ZVFA 1S4CA 1ASJ1 1RUD1 2FCVA 2VOWA 4XOGA 1X33A 1WD4A 2JEMA 4NAMA 4AK3A 4KNCA 1HXS3 1C8M2 1KQRA 1QJU2 1AX2A 1RXFA 1TG7A 3ACHA 4IETA 3Q9OA 4WM8B 1BLZA 4GD4A 2RMU1 4YRDA 1DGWX 1H1MA 3WHUA 2OXBA 3TWIA 4YGCA 2WT2A 3R4UA 1UOJA 1BQPA 1MR5A 2W46A 4IV1C 1VP6A 4W6XA 5DDJ3 2JG9C 4BIFA 3NV4A 2Y6JA 2JIJA 1GP5A 1NCQA 3B9CA 2RJLA 2Q8CA 2X29A 4OHYA 3RDIA 4BLIA 2A3WA 1RJ7A 4B7KA 1OD5A 1ENSA 1ULOA 4N9IA 3KGLA 4Q0QA 5AC93 4QPGC 3B94A 1W90A 3AZVA 4AQ2A 1H2NA 2ARBA 1EY2A 5FZ4A 2IXHA 4CUCA 3HT2A 1W2OA 2W9XA 1H8TA 1SLCA 3B00A 3U07A 3AMQA 3OBAA 4WV8A 3O14A 1E5IA 5GLZA 2UY9A 4DY5A 5JMCA 4XFIA 2BNMA 5IVVA 2LUWA 3VZLA 1AF9A 2B5HA 2OUJA 3UKVA 2WDBA 2BBAA 4ZONA 5SV8A 4ATFA 2K46A 2BGOA 3EXUA 5IVYA 2FDGA 3MYXA 4FBFA 1RUJ3 4XILA 4B8EA 5A7NA 4CU6A 4NPMA 4O9GA 3ACIA 2E26A 3FX3A 5FPXA 1UY4A 5JPMB 2EAAA 1F31A 2VUJA 3AB0A 1YWKA 3UNPA 1QQP2 1YEWA 2DFCA 3U1XA 2IXCA 2EIDA 1D4VB 4NIIA 5C3SA 1VMJA 3H1WA 1GP6A 4PF1A 5JI7A 1AR92 3IPVA 3VBRB 2VMDA 4DFSA 1UAIA 2DCJA 3N36A 1JTZX 1QXRA 2GDFA 1US2A 4Y3OA 2QQJA 4WM7A 4GMP3 4RR3A 3S6PA 1KS4A 4CU9A 1BK0A 2JDNA 4D8MA 1OUXA 3V0AB 3I8TA 3Q8EA 1PVXA 2B39A 2CWMA 3K77A 1W28A 3TB0A 2LW8A 2Q1ZB 1CAVA 4XZPA 3VBRC 1GMMA 3ZFFA 4IERA 4LK6A 5T5JA 2ZZQA 3I97A 4UW3A 3PUQA 3UETA 2ATFA 4XFGA 4Y5Z0 4B3NA 1Y9MA 2NN8A 4DINB 4NRMA 3DYPA 3HVDA 1FMD3 5FK7A 1LODA 1DQ1A 4YM0A 3LB9A 4DZGA 1PX4A 1HQWA 1RITA 2W87A 3W9AA 1JXNA 1IS4A 1ACCA 5H9SA 1H6XA 1JW6A 1Y7BA 4R9AA 5LWBA 3NSTA 1AXKA 1EUUA 2CSGA 1JZ2A 3WNKA 5FYYA 2DCKA 3AM2A 3K51A 4XUPA 3A0KA 2L9LA 1UKRA 2XLAA 5CB7A 3TNPB 3UJQA 1OT5A 2WN3A 4PIYA 1C57A 1HRI2 4L11A 1KXGA 2J1SA 3MV11 4DO0A 3O7OA 3ZLIA 2VBPA 3AVRA 3EQEA 5IATA 3FZ3A 4Q0VA 1RMU2 2PLV3 4AVTA 5HXVA 1QJY2 5JOXA 2H0BA 1UZYA 1W9TA 3T09A 1KFXL 1OHFA 3A22A 1AHSA 3JD71 3GALA 5EWSA 1OVSA 3PJYA 1YC61 3WP5A 1V6MA 1RUI2 1V6OA 2AENA 5M0TA 4WVMA 2WUHA 1AR83 1LHUA 3D6EA 1HQNA 4YVWA 1S0CA 3RZMA 3PU3A 3W58A 4XURA 2YV8A 4NO4A 3ZFGB 1VRH3 2DVGA 1S0BA 3RI9A 2BDRA 1BBT1 3TOJA 4EWDA 4RSUA 5C8CB 5FUIA 2I2SA 1HN0A 3KS7A 5JIAA 2WSVA 1R1ZA 4BH9A 4LO8A 1K5MC 4NVPA 3UKNA 2BUKA 2VCMA 3N9PA 3M4FA 3WSOA 5FWEA 1SBEA 1XE7A 3CLPA 3D3AA 4JAAA 3VBHB 5BUVA 5KBFA 1DQ0A 2RS12 4AGRA 2A7AA 4XDQA 2PELA 3I2IA 3AL6A 5D8AB 2VZ1A 1DZTA 3RZKA 3MO4A 3BPSA 2R062 2VZQA 2VZUA 3T3YA 3UESA 2Y8KA 3C2UA 1PVC2 1WLWA 1G86A 1YFUA 1RUG3 2HEWF 2G1MA 3AZXA 3C8XA 4Q0UA 4Y33A 4FAGA 4HPKB 4E8DA 2CHHA 5KXBA 2GNDA 2DVAA 1H9PA 1B35B 1GWKA 1WWYA 4UT5A 4H55A 4Q4X2 2JG9A 4AI3A 2ARAA 1RINA 2XL9A 1NG0A 3H0OA 2Y6HA 1COV2 1SG3A 2E7TA 1BEV2 3NJVA 5GM0A 1O4YA 2GAUA 1W39A 3I2FA 1VRBA 4NWWA 1O4ZA 4TWTA 5KXDA 3A0NA 4QPGA 3HNBM 4FVVA 2RS11 4ONUA 2LTNA 3FBMA 5FREA 3TN92 1G9AA 3WQ7A 4A7YA 3NJYA 3VDBA 1CGPA 1QJZA 2ZPXA 4FPFA 2GC3A 2D6NA 3N9NA 1WW6A 1R081 1O6UA 2XOMA 5L9VA 1XYNA 2WC2A 2A3YA 3I2JA 3MLKA 4LHSA 4BWOA 4Y4RA 1W8UA 1V6NA 1N1SA 1U5XA 4PLMA 2VNVA 2VL4A 3RFRA 4COUA 4LK7A 5A3WA 4CRQA 2J1AA 2G9FA 3WCSA 3ZSMA 4CCJA 4WVMB 1TNRA 3KWVA 3C7GA 5GALA 5E89A 2XJSA 1V6IA 3BCWA 2ZGUA 4PIXA 2GMPA 4BQ5A 4HONA 4NWVA 2Z2SB 1UQXA 4L9BA 1CIYA 1NA1C 2R30A 3DGTA 4CP1A 4B1LA 1WGPA 3OB8A 3KV4A 1VBA1 1VBC3 5F5CA 1AL0G 4LBJA 5C33A 3VHPA 2W94A 3RWNA 3WDXA 3MPBA 4PCRA 5JR7B 2VBDA 3ZXKA 4MO3M 5LK5A 1ZRDA 3KLSA 4CDQA 5JSRA 1LU2A 1QXJA 4YW3A 2ZGOA 2D6PA 3DCQA 1PO23 2E7AA 4LORA 5FBJA 3WDUA 1H1IA 1LENA 1QJFA 3Q8CA 1PO21 2VVDA 4RFRB 1WD3A 1D7PM 3LSDA 1QJX2 4Q4V2 5FY9A 1K12A 1W8TA 3HD8B 3POBA 3WQ1A 1ZNPA 2QDNA 5DPNA 1O7FA 2J1EA 2W2IA 5BY5A 4Y22A 3LIGA 2GN7A 4K7JA 4GIQA 1OI6A 3LA2A 3RYRA 3LEMA 4BZ4A 3RPQA 3OBZA 3VHRA 4KU8A 1LTEA 5ABJC 4XC9A 3M7AA 3K4DA 3J9SA 4JQTA 1PX3A 2VULA 4OYUA 2DVBA 1AR91 3MEPA 1XU1A 1O3SA 4LHNA 5JCTA 1DGLA 1QDCA 1GZ9A 4N8MA 1W6OA 3BTZA 2ENRA 1AYN1 1FT9A 2ADEA 2DCZA 2Z4FA 4HT1T 5T54A 4EWAA 2YU1A 3VHOA 2QCSB 4N43C 2VM9A 3GNEA 3MV01 4YVWC 1N47A 1PGL2 5F5AA 3I59B 4HETA 2E51A 4ZPIA 2LM3A 2XUEA 1TME3 3J26N 4LLFA 3ZYBA 5TSWA 2RDNA 1ZX5A 2GU9A 3SKJE 3THCA 5B4XA 2PFWA 4OVEA 4AQ6A 1BXHA 3OGJA 2JDPA 4NE9A 4FFFA 4FFGA 1AR81 5T5OA 2A3XA 1KGYA 2MEV3 3OG2A 4JZRA 5IVBA 4TZDA 1CVNA 3PHMA 1Y9QA 2DU1A 2WNVA 4QU2A 5CVRA 3PUSA 3MW4A 1QNYA 2YG0A 3WY6A 2JE7A 2WYSA 3I2HA 1XC6A 1ZBA1 2FMDA 3QBQA 1SQ4A 4B4RA 4CSWA 3C7FA 4YGEA 2E9QA 3MIEA 1W6MA 3KHCA 3C7HA 3MUZ1 2R073 2QFEA 4YG3A 3VD7A 3WG3A 3J7HA 4BE3A 1RHI3 2R1BA 3NJZA 4JRLA 1WCSA 2OQ6A 3I3EA 1XU2A 3HPNA 5HCBA 1CZSA 1W0OA 1GWMA 1G9CA 1H2KA 1YI9A 3CU7A 1CONA 2BNNA 2VY0A 1W03A 4IE4A 1POV0 5A7WB 1LGBA 1PZ8A 4JGZC 2RJ2A 1RL3A 1XNBA 4URAA 4AI1A 5FYVA 3FLTA 1QDOA 3VKLA 1O3RA 4YZ3A 2D5HA 4J6GA 4QX2A 1UZZA 4IEZA 1NYWA 1UYPA 2R1DA 4JDMA 4K6BA 4Z1VA 4XFCA 3ZFEB 1KJRA 3B69A 4RA0A 3R4DB 4UFKA 4EN6B 1GZCA 3BOWA 4JDOA 1VMHA 1VBA3 5FPAA 5J36A 5A3MA 3JQXA 2D6KA 4Q4W1 2OVUA 2KA3A 4DMIA 1IS3A 4JQRA 2YBSA 2Z69A 5C4WB 5IAXA 2WZEA 1F8VA 4KBZA 1PNGA 4M3CF 1J1LA 1IG0A 1O5LA 1RUF2 2DFBA 3MW3A 4YWAA 5F3IA 2QQNA 5IUQA 2Z5WA 4MSVA 1UU4A 1EPZA 5F7UA 3AKQA 3ILRA 4LUKA 3SMHA 1QU0A 3B7MA 5FZOB 5CA6A 5A3NA 3OPTA 3QH7A 5FR3A 1PM4A 1XNKA 2FHRA 5FY5A 4MUVA 2BWAA 2ZAHA 4QB1A 3T2TA 2E53A 3NNMA 4QU1A 5DZGA 1W9FA 1W9SA 4V2WA 3ZN4A 4C90A 2KXLA 2UYAA 4PHZA 5LA2A 4E4SA 1W8ZA 2F4LA 1SLLA 1W8OA 2E6VA 4AW7A 1POV3 4LR4A 5LEKA 2YU2A 1TMF1 1FNYA 3AYDA 5FZ0A 1XSQA 5IK8A 3EO6A 4FXGB 3SCGA 3OEAA 2FBEA 1RUH2 4TLFA 5FJKA 5GLWA 2EXKA 3FHQA 5B2GB 5JDBA 2I45A 5DAWA 1BJQA 4UF0B 4CDQC 2D93A 1UZWA 3T4HB 3KF3A 3MI8A 4CDUA 5ABJB 1OF3A 1MEC1 4A6OA 4Z82A 1F5JA 2VO5A 1IPJA 3POYA 1HXS2 3WZ1A 4H3WA 4P9IA 3AYCA 5LBCA 4GZ9A 4CUAA 4YZ4A 2B9UA 1UWWA 4YFZA 2QQMA 4LO7A 4S2DA 1C8M1 1QJU1 1REDA 2IC1A 5A33A 5CAZA 3PLQA 4QDSA 3VBSC 2EAKA 2VVFA 3JXSA 5KHKA 3GBWA 1OF4A 4ISQA 5DDJ2 1HB1A 4JCKA 4IV3C 4P9JA 2FDIA 1VALA 1ODNA 1T6BX 3BTAA 4MGZE 1A8DA 3VBUC 1QKQA 4KWUA 2HWE2 2D98A 4I3GA 2CV6A 4GB32 3CJIC 4NUBA 3P5BA 3KF5A 2O8OA 4AEDA 2B46X 2YC4A 1LHWA 4YZ1A 2VZVA 4AEDB 1S0GA 3F95A 4XF1A 3ZXFA 3HWJA 4YG6A 4A44A 4BXSV 3KVAA 3V0BB 5FWJA 3JD73 1AR61 1LHOA 2P1BA 1GFF2 4MYEA 3AMPA 4GXLA 2XWBB 2W1SA 4O61A 3ETQA 3LAGA 4HPKA 1PO13 3SKVA 3IBMA 4NRPA 1ND2A 4PQ9A 5FZBA 5C8CA 5C9AA 1BMV2 2Y6FA 2F4PA 3N7JA 2EVXA 1YQCA 2F17A 1W6QB 3L9JT 3O1OA 4Q2FA 3T0BA 4FTEA 3CO2A 4OZOA 1UKGA 1PM7A 4LO6B 2VG9A 3POIA 4WM8A 3GM8A 3WDWA 4XFFA 1UPSA 3O1SA 1POQA 1WW4A 3T08A 1QQP3 2VMEA 3FFZA 4XPVA 2X09A 3UT0A 4W8JA 4J25A 1GZWA 4CUBA 1S0JA 1HRV1 1O8PA 2JKBA 1AXZA 2HWB2 4ZXEA 4BK5A 2PHFA 3I2KA 4IXLA 2HEYF 3VLBB 3ZN5A 3H1YA 3R4SA 3IAQA 4OFGA 4QX8A 3ZDSA 4XACA 1BZWA 1MQTA 2J1VA 2DUPA 3G7DA 1XNDA 4Q5OA 3ZKUA 2A1XA 5JOYA 2BFUL 4KBBA 2P3IA 1A78A 1ZRIA 3N7MA 4XHXA 5CKQA 1MZEA 1BVVA 4ZHNA 5APAA 2VCBA 4K8FA 3VKFC 4AVBA 2VZPA 3OUHA 3AFKA 4JC1A 3PTRB 4WM7C 5BNPB 5FMOS 4NAOA 1GBGA 2XH6A 4EWEA 3MZHA 3H8XA 5F5QA 4IEVA 4XJ9A 1RUH1 2HWC3 5FP3A 3WDYA 2IXLA 1HX6A 4LKDA 3VBOA 2QQLA 3QCWA 1FMD2 2WQZC 4AFAA 1V9U3 5FZ8A 5A32A 3J7LA 2NQYA 3ZDVA 1REFA 2Z42A 1AR71 1B35C 2SBAA 5EZWA 2JD9A 5CFDA 1FOD3 1AX1A 3IDEA 2O0OA 2UWBA 2PQQA 2PHUA 1URXA 3ZN6B 1FPN2 5LY2A 4MGKE 3BKZA 1S1AA 3X29B 3BVCA 4WVWA 1TEIA 1R083 4GMP1 1VBD2 4HZFA 5EIYB 1HRI3 2WO2A 4K1ZA 1PNFA 4NMIA 3BODA 4QXCA 1SEFA 4M0HA 5I93A 1G9DA 5LEJA 2DVFA 5FZFA 4CEYB 5FYBA 4RHV2 2RS53 1OC1A 2AREA 2AH2A 2A73B 4D7YA 4DRRA 3VBHC 1RMU1 4D7SA 2BPA2 5FXWA 3AKTA 2D97A 1RUI3 2CU5A 2HWE1 4JHTA 4PLOA 1VAMA 2Q30A 4IESA 2CYFA 4C91A 3DPRA 2E31A 4M01A 1UYZA 2D6OX 2VQ0A 5FLJA 3USSA 2QQVA 2WFPA 3M2MA 3NV2A 1DLCA 4XBQA 4SLIA 4UBHA 4PBPA 4X8PA 3S57A 4S2GA 4IEQA 1U5ZA 3OGSA 1RUOA 4HVOA 3K2OA 4XETA 3TN91 1NX9A 3N9MA 4RFT0 3SEPA 1QJX1 4Q4V1 4M0NA 3CNAA 3GCXA 4DXTA 2ET1A 2HWF1 3N9LA 5CG8A 2ZEZA 1CQ9A 3THDA 2A5ZA 4QPIA 1YLLA 4HKLA 5I8YA 2WNUA 5JXJA 1PMIA 4QDRA 2VOKA 4ATEA 3BPZA 1CAWB 2OIIA 4RGAA 2R042 2DBIA 1OQ1A 2IXJA 1VAVA 2AC1A 1OURA 2HJIA 2VH9A 2VMHA 5C6CA 1ZBA3 4CDUC 2BERA 5LBFA 3CQOA 1LULA 5FMBA 5I0SA 2QNKA 3H3ZA 3UV9A 3RVHA 1FYUA 2W47A 2EICA 3WF2A 4Z2AA 3ES4A 4R52A 4I0BA 1UF2C 1H6YA 3K46A 3T2PA 1RUE1 5F3GA 3KD4A 1K45A 1UY3A 3VHNA 4AR2A 3VD5A 4A45A 5FRAA 3NJXA 5EV7A 1W6NB 3PURA 3SC7X 3ON7A 2QJVA 1QOTA 1WCUA 3HOBA 4QQPA 1GQHA 3K3OA 4PIZA 2WA3A 2EF6A 2V4VA 4W6WA 3WQBA 4DQAA 1LHVA 5KR7A 1FMD1 1ZZBA 1IS5A 3W21A 1XRUA 3GZAA 3GJBA 5LW9A 1IKQA 2EA7A 2JJ6A 4PBOA 1A8MA 1GQGA 1MVQA 3AZZA 1NLSA 2IFRA 1YIPA 2XVKA 4YVSB 3G6JB 3VZKA 3IDBB 2Q5TA 3F2ZA 1VBC1 3EMRA 3JZVA 2ZKNA 3R6SA 3AKPA 3OPZA 2RDQA 4WZCA 1UZVA 3U10A 4ET7A 1YFYA 3H3LA 1WBFA 1A3KA 3KZ4C 5F3EA 1JHNA 2EIBA 2ZTNA 2VQTA 5HXMA 3OPWA 5FDBA 3AP7A 2Z79A 3HN1A 1SLIA 2HWF2 1AR63 3PVEA 2RR11 3LZZA 1VBC2 1X8MA 2ZX1A 4CZSA 1T2XA 5HBAA 5L7OB 5IVFA 4FCAA 5E8AA 1MQTC 1PVC1 4LO5B 4BK4A 4COVA 2WIIB 3IDCB 2DU0A 3OBTA 1JZ5A 3ACLA 3FHAA 2IFWA 4LE3A 2OQ7A 1D0HA 5DZEA 3WW3A 3IMNA 1HB2A 1DBNA 3TAYA 3QACA 4P5HA 2ZXQA 5FMDA 5FZDA 5F39A 4K1YA 4U36A 3FUOA 1PIV2 5GJ6A 3J8F3 3RGBA 4IEOA 2ZGTA 4COZA 2BNOA 5KC6A 1OQEA 4QX5A 3EJKA 3PMSA 1UY1A 2UYBA 3ACFA 3QH6A 3B01A 3C7OA 5F6KA 2GP5A 1RVF1 2JDYA 1STMA 1S2KA 4BU2A 1B35A 2WRAA 1CIWA 5EXOA 5DN2A 2WBKA 3RMYA 3VBRA 4E9KA 5JUVA 1DQ4A 4ZXKA 3I4IA 4QB2A 3M3IA 2WZR2 1SBDA 5EQUA 1U12A 1X8EA 4M4PA 2OW4A 4P14A 1W6OB 3BB6A 1IGOA 4XEZA 1YRZA 3E6CC 5JLVA 1W8HA 5BNOB 4RS5A 2VMIA 3LOIA 1ALYA 3MIGA 3KM5A 4XJWA 5F6LB 3VBHA 1O3TA 1MEC2 4XE9A 4KL1A 2C24A 2AYHA 5DUWA 1VIWB 3AFGA 1Q5OA 3DEMA 1CN1A 1NUKA 4NR1A 4Y20A 5L9RA 2ZZJA 3ZSKA 3LDBA 5D21A 1JOBA 4P9WA 4A7KA 4LBKA 3WW2A 1X50A 3M8LA 2XVGA 4ISRA 4M4RA 5ERLA 4OQ9A 4XQDA 5L19A 3USUB 1S0FA 3N4MA 1MACA 1PZ7A 5SV5A 2XKPA 1WMEA 5A6ZA 5KC5A 5FZ7A 2XWJB 1KRIA 4FPHA 2XGXA 2ZEXA 5EHDA 4FPKA 3ZXGA 4CCLA 4IGPA 5FIXA 3AKSA 1D4M2 4Y24A 2QQKA 3SQOA 3MIHA 1ZRRA 2YXSA 3WQ0A 5IVCA 1IOAA 4GH4A 5A70A 2CDOA 3N9OA 3W59A 2P37A 3WX5A 4FP2A 4G3YC 1GNYA 2HWD1 2ZGKA 4NHLA 3PVBB 4QQ2A 2R072 3WUDA 1K5JA 1UMHA 4UFLA 3ECQA 4XBLA 3S30A 4EN7B 4CUGA 3AVSA 4H7MA 2ARCA 4QGMA 1DIWA 1F35A 1J3RA 4AQTA 4V2VA 4DPNA 3HMYA 2OYZA 2ET7A 5ISLA 1QXPA 5KXCA 4EJRA 4FP3A 4XF3A 3JQWA 1W04A 1RUE2 3ZFGC 1CAUB 4JRAA 1OKQA 3DXTA 5CISA 1RVF2 2QE3A 3CJIB 4MG2A 1K42A 2RMU3 3AKRA 3ILNA 4HG6B 5FZCA 4E4ZA 4DXZA 1KEXA 1W6NA 2P3KA 4Q29A 4XFAA 5IK4A 2HWD2 3I3BA 5JSPA 2YC2A 4UYBA 2EIGA 1XYOA 1H30A 1D2QA 1VRH1 3K48A 4JGZA 4O9EA 5IVJA 5CNAA 3SH3A 3HQUA 1RUC3 4P9GA 5I0RA 4UW6A 1H4HA 5FYHA 2XBO1 1OFNA 3P3NA 1OVPA 3I3DA 4HXCA 1N3PA 4L92A 5G04L 5FJHA 4X6QB 1QY4A 3ZXAC 2VCCA 4EN9B 1VR3A 5FYZA 5H9QA 1QOOA 4ZZ5A 1CX1A 5K0UA 1JU4A 2OUHA 4OUEA 4Y5TA 2OPWA 2WKKA 3WP6A 3FLRA 4CDXC 4F83A 2OKXA 3NW4A 3H8OA 1WLCA 5FAXA 3B3QE 4MVTA 3VV1A 1KJLA 1C5HA 5F32A 3J8F1 4Q0PA 4AE2A 4JHZA 1DCSA 3AC0A 5BXXA 5FP9A 4IV1B 3HQXA 2H6CA 3OUJA 4N7UA 1EUTA 4KI5M 3WF1A 1ZREA 1W9WA 3WNXA 5FZ1A 1W06A 1SPPB 4HFSA 1Q8PA 5A1FA 4OI0A 3O1TA 2A6ZA 1L7LA 3AK0A 4YNIA 1REEA 3VD9A 1J84A 3GZEA 2ID4A 2E63A 2HYXA 3ITQA 1ZA7A 4UFIA 3O1PA 2VZ3A 2AEYA 2D3SA 3T0DA 3I2OA 2RM22 5J37A 3DN7A 3DKWA 1Y4WA 1O4TA 3RYKA 4HSJA 2J42A 2VOVA 5C3RA 3PUIA 4Q27A 4XXAA 1SLAA 5A6XA 3O0VA 2PQSA 4LBQD 1EV13 1PGW2 4QMAA 4XDOA 1HJFA 1I9RA 1US3A 3N7LA 4PI2A 2BOIA 3ZMOA 3ZR5A 2VW2A 4FOVA 1A6CA 4XUOA 2GMEA 4AHXA 2YBKA 3U4SA 4MZUA 4YZ5A 3ZYJB 2BV4A 4OHXA 2RM21 2NMNA 1H0BA 1L7RA 4IEWA 4XDPA 2C26A 2RR13 4IV3B 5DDJ1 1KD7A 1VAKA 3BGAA 3VZNA 4UXAA 1R092 2XQXA 5FYSA 4BQYA 1S0EA 3O1VA 3OD0A 3ZM8A 2XVLA 4FTSA 1O8SA 2JX9A 2VZOA 3AZYA 1YCIA 3DYMA 3HNMA 2WINB 3S5QA 3RRDA 3WP4A 4CPBA 5I8TA 3VGIA 2JE8A 1WBLA 2VMFA 4XUNA 5CADA 1NCRB 2R041 1PO12 2W52A 2G9ZA 3APBA 4HVQA 4LPLA 1AXYA 5E1RA 1CJDA 3MUY1 1KDMA 3CHXA 4CCOA 1AL22 4ASKA 4BQWA 4K40A 2ZGPA 3JU9A 3AL5A 1GP4A 1UXZA 5CFDB 2TBVA 1X9PA 3NAPB 4Y1VA 2FD8A 1SFYA 4C0HA 4Z8BA 3AXDA 3P3PA 4BHPA 1DQ5A 3LIHA 4LEJA 4XCBA 1GQPA 1NCRA 2XBO2 2ZJCA 1DG6A 1JZ4A 4LUMA 1YQ6A 2JKXA 5FKBA 3IIIA 2B4KA 1GOFA 2ETEA 4WM8C 2HWB3 4AFCA 3R0RA 4LITA 3BU7A 1JBCA 4YVSA 2YGLA 2DTYA 4OHWA 2V5YA 4LNVA 2G9GA 1W6PA 2RS33 4A3XA 3ZXEA 4QM8A 5JVVA 5FP7A 5K4LA 3OD4A 4AOCA 3V0AA 1OPMA 3IB3A 3ZVXA 5T55A 4DB5A 1RUNA 4GH4C 5IWFA 1LOGA 2PAKA 1UO9A 5BNPC 1V70A 4OI2A 4CXYA 3ACGA 3W20A 3SITA 1I1EA 3OY8A 1IS6A 3VKOA 4CDWC 3LDKA 2ZX0A 3I2DA 4QX7A 2YDEA 4XFBA 4HSLA 2QKDA 2TUNA 2VUCA 2XJRA 3GF6A 2WNVC 4EN0A 3H42B 3PNAA 4CCCA 3PMEA 2VQAA 1CAVB 2ZOEB 1QJEA 1V9U2 1ZZ7A 3A21A 4PJYA 4WVZA 3WNOA 4AGGA 3IZOA 3BIWE 1QF3A 2DTWA 2P34A 3JBG2 4QPIB 3RMXA 1YIFA 2XUMA 4QKFA 4XMAA 3HEIA 3BUCA 2ES3A 5LK7B 1E5SA 2Y38A 5DQ0A 5AVPA 1ZZ8A 5FO7B 4BJ0A 2NM1A 3UGHA 1JYXA 3W5NA 4Y1ZA 1E5RA 2JB8A 1SPPA 4BQ1A 5FYTA 3WHTA 1YQ8A 2P6CA 4OQ8A 2IXIA 1F15A 1I6XA 5A3OA 1PZ9A 3ST7A 1FI2A 4Q4Y2 4I02A 1HDKA 4INDA 3FFQA 4LXLA 3WOGA 2YBPA 3JB8A 3MLJA 2CY6A 1SDWA 2QTWB 4L99A 3QLQA 4RHV3 5LBBA 4FPYA 2JXAA 5KXEA 5I0TA 4BPZA 2ZKLA 1GR3A 2MEV1 1CJPA 1DQ6A 1TMF2 1IKPA 1FXZA 2X5IB 1OOPB 4Y5SA 2HBTA 1VBE3 1VJ2A 1WA4A 4UF0A 4ES9A 1ENQA 2YB7A 5D1IA 3AMNA 1HRV2 4A4AA 2K2SA 4AHWA 3ELNA 1W0PA 1GKBA 1NAEA 1TNFA 5ACA2 5AFEA 5J48A 3ZYPA 4MXWB 1W9YA 4PLNA 5A6QA 4LKSA 1SLTA 1UIKA 4PDWA 2JG8C 3WEZA 3E5QA 1AL21 4TTGA 2UURA 1DGRN 3KGZA 2W3JA 3VBUB 3WW4A 4MGSA 2WT1A 5A3LA 1D2SA 4YSFA 1UYXA 3UYJA 1ASJ2 1RUD2 4IGQA 1FV3A 2HYKA 2OX0A 1Z7S3 1IPSA 5AC91 4OMCA 1MS8A 4XAEA 1RUI1 3ZKYA 5FOJB 5C7GA 2JE9A 2GSYA 4IEPA 4S2HA 2Y6GA 4IQPA 3KB5A 2Y34A 3L2HA 1JYTA 3OCPA 1CAXB 2XJQA 1YQ5A 1TVGA 3CL1A 2EXIA 1MS3A 4CDQB 3ZOIA 2XR4A 3D5OA 3ASIA 5FV3A 4JGYB 2WNOA 1AR72 2J1UA 4Q4W3 5FLHA 5JXHA 3O0WA 4XTMA 1WLDA 4CCMA 4RGKA 3V56A 2HKXA 4H7LA 2P17A 1QWRA 5FZOA 1R64A 5JZGA 3NQHA 1HV1A 4QM9A 2BRTA 3CIHA 2NYYA 3GXUA 4QQLA 5FXXA 4BMEA 1PK6A 1LU1A 1WCDJ 1XNAA 3VKNA 5BYNA 4IE0A 3WDTA 2OT7A 3KV9A 5FUPA 4PT6A 2QUOA 4YARA 3KCXA 3O1MA 4I0AA 4D94A 1HV0A 1XYPA 1YYNA 3LPFA 5JSOA 1C1FA 5A80A 4BXFA 4C0BA 5FZ9A 3LWCA 5DABA 1X82A 3MIDA 1MQTB 4S2FA 2XONA 4LA3A 2Y64A 4AEDC 4NHXA 5LA1A 2ZACA 1SCSA 3POWA 2NMOA 1S0IA 1KDKA 2ZBJA 3VDDC 1MZFA 1CPMA 5A3TA 1JS9A 3LCPA 4BQ2A 3E97A 2GC2A 1XNCA 3ME2A 1W3XA 3WVJA 1EYBA 5CEHA 2A6VA 1BMV1 2CNAA 1S55A 3PJQA 4QXBA 3AMHA 4K9SA 4AVCA
chains in the Genus database with same CATH topology
2TEPA 4AFMA 4YVSC 4NOTA 3WG4A 4XJAA 1YHFA 1TME1 1LB2A 3GZUC 1B09A 5FQ0A 1YUDA 4R8HA 2JECA 3V0BA 1UX6A 2DUQA 3ES1A 4CEYC 2AGSA 4B4QA 4AWDA 5JAXA 1MS4A 1PIV3 3BALA 4AEKA 2JG9B 1LGCA 1GSLA 1DZQA 4IEYA 3M3QA 4B4PA 4DNYA 4A7ZA 1BYHA 1HXS1 4OUSA 2D40A 5GZEA 2XJUA 2A6YA 3OTFA 2P3JA 1MS5A 4TYSA 2ZS6B 2YC0A 1LECA 1KFUL 4AG4A 2W08A 2XB6C 3MF9A 5KHJA 5T5PA 1NXMA 1Q8QA 4HN0A 1AR93 5C4WC 1WLTA 1UL9A 4DRVA 4X8NA 5EYXA 5CFDC 2IWGB 1OOPC 1RC6A 3AZWA 2VNRA 2GZWA 2WSUA 4G9SB 4N53A 3NKTA 3NWKA 1C5IA 1UW8A 4LLOA 2C5DA 3OBRA 1EAH3 3O5SA 4Q8LA 4XXPA 3PTYA 3VL8A 1OFSA 3VZJA 1VLNA 3JUUA 4FO9A 4LHLA 1N3QA 1U0AA 4E27A 4YW1A 5GKAC 2ZHMA 3DPRC 5FFOC 4G4FA 4J1WA 3TBDA 2WFF1 4EV0A 3MIBA 3UL2A 3KT7A 3NAPA 4CDWB 4AI2A 1ZA4A 3RS6A 4XHBA 4XYXA 1DYKA 4FQ4A 4UW5A 4R9DA 4ASMB 4M3CA 1BVP1 2MNGA 1RUC1 1PVC3 2ZX2A 1FAYA 1I3HA 4Y1YA 2BW8A 3ROUA 4BYYA 1OA4A 1NA1B 1NE6A 4Y1UA 5ACA1 3LKJA 2W39A 1Z7S1 2BVVA 5K7PA 2BFUS 4HMZA 2F6BA 2ZGQA 3RNSA 1SCRA 4L8QA 1RUG1 2GALA 2XHKA 3A4UA 4TSVA 1ZRCA 3M3OA 3KMHA 1GNHA 3IT8A 4MV2A 2WWSA 1LOFA 4GMP0 1OQDA 4JTOA 5LRSA 1RTVA 1LOEA 4XJZA 1LCLA 3ZXLA 1SMVA 2BQPA 2H6BA 2R063 3JBG1 4N9HA 2CGNA 1RUG2 4QPYA 3VDDA 4GQ7A 2QQPA 3WCRA 1GANA 1R1A3 1LOBA 5DG1A 5HCAA 4Q4X3 4Q1PA 4XFHA 1LESA 4P9XA 1N3OA 1ULGA 2MHFA 2JDZA 4F8AA 3WW1A 1R1A1 2H0VA 3FC0A 4E2QA 2VVEA 2AZ5A 2NP0A 1BEV3 4K20A 3HAGA 1MVEA 2OZJA 4OI1A 2PA7A 2EXHA 4R4ZA 4LBNA 1Y3TA 2RM23 2I74A 4E4DX 5JWPA 4LBOA 3WLUA 2PN5A 2Q1MA 5K9YA 4CEYA 3R05A 2R0FA 2JICA 4FSJA 1PO22 1JOJA 4Y1XA 1NQJA 4YZ2A 2WFF2 2ZAAA 4P9YA 2FZ1A 3L2YA 4QD2A 4W6YA 1YNAA 2ZA9A 2VOXA 2BBVA 1QJX3 4LBLA 4Q4V3 4YFWA 3IN9A 5BNNB 2HWB1 2UY8A 4CTEA 4MLOA 1E57A 5E16A 1RJ8A 5DG2A 1F5FA 1OPOA 5C4WA 2CWSA 3GYDA 3VBSA 1BBT3 4NHKA 3UKTA 4XF4A 4IV3A 3SH5A 4YLZA 4BIOA 4KGGA 3VBUA 4GH4B 5T5LA 2IXKA 4M00A 1YJKA 3ILFA 4WM7B 4FOWA 3H8UA 1UMZA 2ZGLA 4YW4A 1ZRFA 3D82A 4AVSA 3MFCA 1J3PA 4AQSA 1YI7A 4RS5C 1ULDA 2XBO3 3WT3A 1J3QA 1FV2A 3VDDB 2NPIA 4AXOA 1ZBE1 1H2MA 2QVSB 4Q0SA 3USUA 5HI0A 1ND2C 1IQAA 1HKDA 2OZ6A 3CF6E 3BOPA 3NAPC 3QD6A 4E2GA 1Q8VA 5D8AC 1NQDA 3AX4A 1J59A 3WDVA 1PGW1 1AX0A 5DUXA 4CEWB 5IT6A 5BNOA 4HN1A 5BNPA 1D4M1 3SH4A 1PIV1 2ZMLA 4MX3A 1D0GA 1K5MA 3JB4C 3MIFA 1C28A 3RJRA 2YY1A 4RL7A 2Y26A 3THTA 1RHI2 2GC1A 5L7OC 2R061 3JBG3 4U2AA 1LEMA 5GZDA 3T1MA 3B9IA 3RJ2X 4QXKA 4E2SA 1ND3C 3KT1A 5FCCA 4DY3A 5GLTA 2MEV2 4Q4Y3 4AF9A 5FTTC 5KHHA 4AGVA 1W6PB 5DUUA 4B29A 4XF0A 1TQ5A 3VBOC 2ZGRA 4Q8KA 3RYPA 3B93A 4KWKA 3H3UA 2Q8OA 3VBSB 4LO4B 1ZBE3 2ZGNA 3KSCA 2WNEA 3SNMA 1VBE2 4FPGA 2R16A 2GNMA 1HRV3 3MFAA 4UBGA 1H9WA 1WMFA 1VBD1 4ZU4A 4GKYA 2GC0A 2XPJA 5DUVA 2AR6A 3ZFEA 4K21A 2DV9A 4AHYA 4R4XA 1NLRA 3ZSJA 4RQPC 2VU9A 3RSJA 5AFBA 1ENRA 2DCYA 2VW0A 4KGQA 4ZU7A 4KWJA 4CP0A 2RHPA 1CD3G 4CEWC 4MGIE 3WP3A 4WZFA 3ZFFB 3WINE 4A2UA 1GV9A 3AP6A 3NVCA 3C3VA 1RUF3 1W6QA 2RS31 4COYA 1AR73 2V73A 2R32A 1EV11 3N7KA 3VN4A 4QPIC 4RGGA 4Q4X1 5EJ3A 3D0SA 5CFCA 4C1XA 4ES8A 4LHKA 3EHKA 5BV6A 2PHXA 4AVAA 3H7JA 3MICA 2A71A 3J4UH 4OHZA 2ARXA 1WUVA 4I30A 3GBFA 3FBYA 2HWE3 1G6NA 1PK6C 2ZX4A 4AI0A 5FO9B 3S0MA 1JH5A 1R091 3GHNA 4Y20B 1APNA 1AJKA 3SISA 5J09A 4ITCA 1DFQA 2QZ3A 1LR5A 2CGPA 1H1AA 4IV1A 1DF0A 1OLRA 2PHDA 4HL0A 3NKGA 1K5MB 4OUMA 1MZ6A 1ONAA 1NCQC 5FMOL 5JOZA 3KQRA 5H9RA 5K0UB 2V09A 2WS92 2QDRA 1NCQB 1AYN2 1CESA 3ZX7A 4MH0E 4GB33 1NZCA 4LULA 2EXJA 1QGLA 5T3NA 1G9BA 4QHBA 4YGDA 4N43A 4W65A 4AFAA 1H8TB 3U11A 1POV1 3JD72 5D8AA 3N35A 1NCRC 4JV4A 1LGNA 4I09A 1JYIA 1FX5A 3VBFA 3O0XA 3IWZA 3V65A 5BNOC 3VBOB 3VUOA 3DV8A 1SFNA 3INAA 3OY8B 2A6XA 4QGLA 5F9TA 2MPFA 2WL1A 2DURA 5GLVA 1NXD1 2NZ9A 5DXDA 1GLHA 4FPJA 4D7TA 1VB2A 3V64A 2PHTA 3ZN6A 5EYYA 2WT0A 4LTAA 1FOD2 3CJXA 1ENXA 3NL1A 4RR3C 5F1RA 5CG9A 3HBZA 1CAXA 4URTA 1O3QA 4N53B 4FAHA 2ZGSA 2ZHKA 3ZFFC 2C0ZA 1QNWA 3VBFB 3DF0A 3O12A 1VBB3 3WG2A 3QOPA 1IPKA 4KWLA 4ORFA 3OGGA 4IEUA 1OA2A 3H1MA 3VZOA 1EAH2 4WVVA 2HWC2 1F9KA 2WZR1 1V00A 1AUYA 2DF7A 1U5YA 1QQP1 2R071 3FMGA 4DOUA 2WLPA 4FQZA 1WCKA 4GKXA 1W2UA 1FPN3 5L73A 1Q8SA 1OLQA 2PHRA 4RD7A 4YW5A 4NHMA 1YO8A 4FPLA 2WNUB 4BLJA 4XTPA 1R082 2VW1A 1DGWA 1VBD3 2ERFA 4PDWC 2YYOA 1SACA 1ULCA 2N7GA 3THPA 3ZXDA 3LSEA 4LA2A 2DWRA 2RS52 1C1LA 4C1WA 3HIFA 1RUJ1 4LBMA 2R043 2XJTA 1Z78A 4WBBA 2PLV1 3HT1A 2WJSA 2XG3A 1H4GA 3VL9A 3ENRA 3URFA 1FNZA 1M06G 5KHIA 1ZBA2 4QPGB 3WV6A 5FBZA 1AVBA 1IZ3A 5I91A 1M4WA 1GNZA 1AYM2 4YG0A 1ND3B 3AJZA 4EN8B 1ZYBA 1UD1A 1F2NA 5FOBB 2D6MA 5E88A 5J7MA 1DU3D 4L97A 4Z92B 4B7EA 3VKMA 4MGYE 5FQ0B 3UK9A 1Y43B 2VUAA 1OSGA 3TYJA 4I0WB 4FPCA 4YM2A 1V9U1 4OZXA 3AJYA 4M3CB 2DVDA 3OYWB 5JZGC 2A75A 1DDLA 2K9ZA 4BOWA 3ZFGA 4CDUB 3RI8A 4D3WA 4AFBA 3NO8A 3CJIA 3E6DA 2CAUA 3GZTB 1CAUA 4FT8A 4HK8A 3I54A 5FLIA 3ATGA 1R1A2 4KH9A 1WW7A 2ZGMA 1C8M3 1QJU3 4Y22B 1Q8OA 4META 3ZSLA 4UW4A 5IK5A 2UU8A 3H50A 4CP2A 2PHWA 4JGZB 2D3RA 3S7IA 1NY72 2AUYA 1YXWA 1H2LA 2TNFA 2XKOA 3E6BA 5C8CC 3FLPA 2XJPA 4FOYA 5A32B 1DZRA 2HWF3 4AVVA 4OI4A 1NOVA 4XJUA 5AC92 1H8TC 1RGSA 1N1TA 1HQLA 3ZYRA 2YGMA 2QZ2A 5I8SA 4CYDA 5FPZA 4HANA 2W68A 4HKOA 4Y26A 1MS1A 3WG1A 2WFF3 3SCHA 4LE4A 3J8F2 5HCFA 1XXNA 2R49A 1V6KA 1RUJ2 2C1FA 3LGRA 4XQ4A 3NV1A 3I7DA 4Z07A 1ZM1A 4FXKB 2RS51 1ZZ9A 2GNBA 4R9CA 1PGSA 2GMMA 3D4KA 1OA3A 1RIRA 3RG0A 5AVAA 4DS0A 3LOBA 2Y0OA 5IK7A 4BCUA 1AR62 2B8MA 2FQPA 4GWNA 1OMIA 1BK1A 1TE1B 4N90A 2GH8A 4D69A 4IEXA 1BBT2 3KCCA 4F7ZA 2VMGA 4N43B 1QHDA 3AP4A 3AYAA 5EXOA 1C4RA 4HLTA 1W6MB 1BCXA 1Q43A 1LOCA 2R6QA 2B45X 3SLIA 3B5LB 5EFUA 3PVNA 5A33B 1CAWA 1UCXA 3TNQA 3SCFA 1EAH1 4ZKTB 3OF1A 2D6LX 2ZABA 1LJ7A 5BNQA 4LBQB 4XIOA 4N53C 1J58A 5ABJA 4OLLA 4J1XA 5FO8B 2PHLA 4Q26A 3FJSA 2ZX3A 3I59A 1XQNA 2CL2A 2WZR3 2CAVA 4PF5A 1CPNA 4YGBA 1WMDA 2D5FA 1YJLA 1YFXA 2B7YA 4KG0A 5GZCA 2K0GA 1BEV1 3ZMNA 5CBLA 1EP0A 2ZHLA 3MGUA 2X8KA 2B42B 1MEC3 2GN3A 1RHI1 1JUIA 2OA2A 3ALQA 4ZU5A 5K8SA 1RMU3 2PLV2 1QJY3 3MLLA 4GALA 3ZYGA 2A6WA 2ZMKA 3TRSB 2WNUC 1AR82 4F3JA 1RB8G 2A70A 3MW2A 5L7OA 1VRH2 2UWAA 1RVF3 1DQ2A 3FWEA 2RMU2 3ZYIB 4CDWA 4HKWA 4YVWB 2XLFA 2HWD3 1PHMA 3E5XA 4RHV1 4X6RB 1N1YA 1HLCA 1SBFA 2D44A 1D4M3 2FMYA 2JENA 2YPJA 2BEOA 2X5IC 2VXRA 1ZBE2 1RUC2 3SHRA 2PYTA 2C9AA 2BTVC 2HEVF 4YM3A 2G4IA 3ZPYA 3U0ZA 2RS13 5DZFA 3KCYA 1DLLA 5L36A 3E5UA 1VBE1 1QMJA 2BVBA 1CR7A 1QH7A 1ZZ6A 1LOFC 4FPEA 2WZPP 4GB31 5JI9A 4NN0A 1RUE3 1FOD1 4R9BA 4RR3B 4MXWA 4KG8A 3FUQA 1GZWB 2O8QA 2DUOA 1C3HA 3RZZA 3GBGA 2WNVB 4XMIA 4HK9A 4XQWA 1CX4A 1H8VA 1COV3 4V1PA 1AJOA 2YHJA 2WA4A 4LBQA 2DCTA 3WR0A 1AZDA 2JG8A 3OYWA 1DGRA 3TN93 5JPNB 5C9AB 2WLQA 2X53S 4CEWA 3AP5A 4QQOA 3IPVB 5H9PA 4HBNA 4AI8A 2FZ2A 4OHVA 1GYKA 3AXEA 1EV12 4RS5B 5KHGA 1WW5A 5CFCC 2VGDA 3HR9A 1HIXA 2KM2A 4YM1A 4GA9A 1Q3EA 3VZMA 1NA1A 4COWA 1XE8A 2PAMA 1JYCA 3CEWA 2VPVA 4HVRA 4JGYC 3B02A 4NPRA 4JVAA 3DUIA 1HRI1 4SBVA 5GLUA 2R0HA 1QH6A 4KQ7A 5BNNC 1AL23 2WQ4A 4Q1RA 3N3HA 1KS5A 1ZZCA 2VECA 1G9FA 3M3EA 2XJVA 5CFCB 1U5IA 1QJY1 5JIUA 1FATA 2WS93 1X36A 2RR12 1UU5A 1AYN3 4XBNA 4AEJA 1R093 1SLBA 1VB4A 1ULFA 4YW2A 3FE5A 1S0DA 3KT4A 4GWMA 2I07B 1LEDA 2OPKA 2P2KA 3MDPA 2D43A 4I3PA 3D8CA 5C9AC 5KWRA 2RS32 4BA6A 4AFDA 2RJKA 1BKZA 1LOAA 1JUHA 4YYOA 1L3JA 1UN1A 4XIKA 2EALA 2JD4A 2O1QA 5JZGB 3U4XA 2BWCA 2CTVA 5BPXA 3T1LA 3VBFC 3M70A 2ZHNA 3M3CA 4Q4Y1 5GZGA 3SXWA 5GZFA 3H9AA 5CIRA 3S7EA 1VBB1 1IHMA 1I5ZA 1KITA 4RQPB 1G8WA 1PO11 1Q56A 4N7IA 1TME2 5J3UA 5CU1A 1ND2B 4EROA 2DYCA 4Z2WA 1PGL1 3GHMA 2VNOA 1LHNA 4QGNA 4XJ8A 4CDXB 4Y4YA 2BYVE 2UWCA 2ZCWA 4ASLA 1J1TA 3ZIXA 2X5IA 2XL7A 3AMMA 4GULA 2WS91 3FHIB 1UIJA 1VBB2 1ND3A 3ZO0B 3M1HA 1COV1 4QQHA 1NE4A 4KU7A 2CGOA 1V6LA 4PDWB 4QT6A 3WUCA 4FPOB 2NLRA 4H14A 2YUEA 3PVOA 1LRHA 2BGCA 2ZMNA 3ZXJA 1OOPA 1C8NA 2JG8B 4JTNA 5C8WA 3UJOA 3ZIWA 1G7YA 1UU6A 2YZ4A 4FOQA 3IM0A 1N1VA 5J98B 1X7NA 1V6JA 1QOSA 5K0UC