2R0HA

Fungal lectin cgl3 in complex with chitotriose (chitotetraose)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
MFHILRLESTVDLSEPLKDNGIIVFQSDKLDLEPSPNLGPTGIDNTNVNLINAKGDVLLHIGIRRRENAFVFNSIPYGESRGPEERIPLEGTFGDRRDPSITIFDHPDRYQIMIDYKTVYYYKKRLEGRCEKVSYKINEGQTPPFSDVLGVTVLYFANVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords CGL3 lectin
publication title Structural Basis for Chitotetraose Coordination by CGL3, a Novel Galectin-Related Protein from Coprinopsis cinerea
pubmed doi rcsb
source organism Coprinus cinereus
total genus 41
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r0hA00
2A7AA 3PVEA 1MZ6A 2WKKA 4YZ1A 1WLCA 3QCWA 2A75A 3TAYA 1VAVA 4C1WA 5FREA 4WV8A 2D3PA 1R1ZA 4YW2A 4FQZA 4K20A 3VKFC 1HQWA 1YO8A 1JN2P 5GZFA 1LEMA 3IKWA 1SLIA 5LK5A 1O4ZA 1LEDA 3LSEA 1AXZA 1G86A 2JDZA 2NZ9A 1MR5A 5DUWA 1V6MA 4R9CA 1YXWA 4BPZA 1CPNA 1GICA 1MS5A 3SITA 3RG0A 3T1MA 2A70A 4ITCA 3KM5A 1H9PA 4YG0A 4LBQB 5JDBA 5GZDA 3RSJA 2CYFA 3AZWA 2WLQA 3WHUA 3AP7A 2TEPA 2D6KA 3H0OA 2OUJA 4YM2A 5GZGA 2ZGNA 4AGGA 5T5OA 5JOXA 2R49A 1PZ8A 2DU0A 4DRVA 2ZBJA 2WJSA 3HR9A 3AZYA 3N3HA 3OGGA 1IKQA 1FAYA 1GLHA 1YIFA 2HYKA 1WD3A 3T1LA 1ULDA 1BXHA 4YZ3A 1NXD1 3N7KA 3N36A 4XYXA 4AVTA 5E89A 5HCFA 2AUYA 5AVAA 2ZGTA 1CIWA 2WQZC 3OY8A 1HQLA 5IK8A 5IK4A 4FP3A 2GNTA 1SCSA 5EYXA 4FOVA 1MACA 5DUVA 2ARBA 1A78A 3IM0A 1KJRA 3FUOA 4FPHA 4XMIA 4ZKTB 3W58A 3SH5A 4YZ5A 1Q8OA 1MS1A 2RHPA 1LOFC 1KDMA 4AGVA 4CZSA 3CNAA 2D44A 1PZ7A 4WVWA 1LGNA 4FOYA 1VALA 2VW1A 3D5OA 4K1ZA 1DYPA 3DGTA 1SCRA 4GKYA 5DZEA 3ENRA 1SFYA 1I3HA 1PZ9A 1DFQA 1FNYA 1DQ5A 3ZSMA 4YM3A 4Q1PA 3RS6A 1CN1A 4LBJA 1CQ9A 2D3RA 2D6OX 5DZGA 2JKBA 2YY1A 4XMAA 1N1YA 4YW3A 1AX0A 3NV2A 3HN1A 1U0AA 2JJ6A 1JXNA 2ZHNA 4Q2FA 1VLNA 1W6MA 1QOOA 4L8QA 1CPMA 5DUXA 1G9CA 1YYNA 1Y7BA 2VW0A 4FPLA 2WT2A 3AJZA 2EXKA 5DXDA 3WG2A 4YZ4A 3BTAA 1LOCA 1W6QB 3WDWA 4BQ1A 2EXJA 3FLPA 1JYIA 3B3QE 1WUVA 2W68A 1UL9A 2ZGRA 4DS0A 2CNAA 1JBCA 1ULGA 3ASIA 1W0PA 2R0FA 3R4UA 3LSDA 4XTPA 3VKMA 4Y20B 4LBKA 1W6OA 2JECA 1WCSA 1AJKA 3OY8B 3M2MA 2AH2A 4YGDA 1G9DA 4XILA 4FPKA 3SH4A 4K21A 1G8WA 2DV9A 2YZ4A 4FPCA 1F31A 2ZHMA 1LGBA 1AF9A 3OYWA 1MS9A 2PHWA 1S0IA 4XBLA 3T2TA 1LHNA 1AJOA 2CWMA 3SLIA 4BLIA 2GMMA 1GZWA 3OPZA 4Y1UA 5HCAA 1UZYA 4Q27A 3I4IA 2GMPA 4LBLA 2W39A 2A6YA 1JUIA 1N3PA 4YGEA 3VUOA 1GYKA 2ZA9A 1QNYA 3O0VA 3NV4A 1LOFA 3V65A 3V0BA 4AYUA 4YG3A 2XB6C 1FATA 3UJQA 4YFWA 4FPYA 1FV3A 5BYNA 2DTWA 1OQ1A 1FX5A 1LESA 1S0CA 1BJQA 4BM8A 2GALA 3O12A 2ARXA 3WVJA 4CTEA 1ZM1A 3POWA 4YG6A 2NYYA 1QGLA 2GNDA 2SLIA 1AX2A 1TEIA 2UWCA 3N35A 2A71A 4CRQA 1O4YA 3IN9A 1AXKA 3WNXA 1V6JA 2CY6A 4R9DA 5T52A 4D69A 3VKOA 1FYUA 2ZGPA 4ISRA 5CNAA 3ZSKA 2VXRA 1ULCA 2A6WA 2EALA 3M3QA 1LHUA 2H0BA 3SISA 3WDVA 4BLJA 1AX1A 5DG2A 3GNEA 3NV1A 2D6NA 5IT6A 4HL0A 4XJZA 1IS4A 3AYEA 1KDKA 4YM1A 4TYSA 2EAKA 1GNZA 2E6VA 4Q26A 3ZSJA 1DIWA 4YGBA 3MW2A 4LBMA 1GBGA 4XTMA 3OBRA 2FHRA 1J1TA 1YI7A 3O0XA 4UW4A 1H30A 3AFKA 1NLSA 1SLAA 4M01A 1IS5A 3JU9A 4P9YA 1BYHA 1ONAA 2CTVA 3PJQA 4NOTA 4Y22A 3UK9A 5H9RA 1UAIA 2E51A 1IKPA 1GZWB 2A6VA 4FPFA 4Y1ZA 3AK0A 1W6NA 2ZGQA 1RITA 2ZAAA 2OVUA 1MS8A 3APBA 2G4IA 3WG4A 1ENRA 3AXEA 2ZGOA 3ILFA 1DQ2A 5GLWA 3W59A 5KXDA 2CWSA 3WDXA 1LGCA 1CVNA 4ZXKA 3WG3A 1S1AA 3PVNA 1QOSA 3FLTA 5EXOA 1DQ1A 4JCKA 1HDKA 4LBNA 4I30A 2ERFA 3ZYPA 4Z8BA 3NV3A 1AXYA 3M3OA 3AZXA 3MEPA 1BKZA 4FQ4A 1BZWA 5H9PA 2ZMKA 1D0HA 1LULA 1S0BA 3GALA 4M3CA 4XBNA 5CB7A 1UX6A 2A5ZA 3B9CA 1GANA 5T55A 1N1VA 3AZZA 2ZKNA 3WZ1A 2AR6A 4Y1XA 4XIKA 3OJBA 5CAZA 2AYHA 4OZXA 1W0OA 2DURA 5GM0A 1MS3A 2VU9A 3VV1A 1N1TA 4XJ9A 4C1XA 1S0DA 1FV2A 2DUPA 1V6NA 1N47A 2ZGLA 3POYA 1VAMA 1X50A 2ZGMA 4PCRA 1SBFA 1S0EA 1IS3A 4XBQA 1WW7A 2DVAA 2I2SA 4GALA 4LBQD 4BMEA 1Z78A 3ILRA 4M00A 2LTNA 1A8DA 2OUHA 2B7YA 2NN8A 5DG1A 4U2AA 4YZ2A 3UJOA 1B09A 1CESA 1Q56A 2EIGA 4R9BA 4WVVA 3L2YA 4AWDA 3AP5A 3WCSA 3IPVA 2AENA 3ZXLA 1W6NB 3VKLA 3NWKA 2V5YA 5EYYA 2NMOA 1N3OA 2ES3A 2VUAA 1QOTA 3ATGA 1QMJA 3C2UA 3N7MA 5T50A 2P37A 4ASMB 4Q8KA 1V6LA 1QDCA 3V0AA 4XOGA 4TZDA 1URXA 4UW5A 4NO4A 1FNZA 2GNMA 4LBOA 4SLIA 4DRRA 1UMZA 4GA9A 2JD4A 4XJAA 4YW5A 2DWRA 2PHRA 4FPOB 3B01A 2ZACA 4Y26A 5H9QA 1WBLA 2NP0A 3BODA 2UWBA 1G9AA 4DPNA 5T5JA 4RL7A 4F83A 1MVEA 2P2KA 4XE9A 3AZVA 1ULFA 3AYDA 1QDOA 1W6PA 4ATEA 2NMNA 1LJ7A 4FP2A 1DLLA 4FVVA 3AJYA 3AXDA 5IUQA 1ZA4A 2A3XA 3AP4A 3WOGA 2R16A 5EWSA 1C1FA 1I1EA 1SLCA 1H9WA 2R0HA 3FLRA 5CA6A 2DVDA 4XDQA 3TB0A 2DUOA 4JRAA 1IS6A 1OFSA 3A4UA 3JUUA 5F9TA 1MS4A 1F5FA 3WDTA 3FUQA 3FFZA 1W6MB 1KQRA 1WLWA 1LECA 5JOWA 1SACA 2D6LX 4LBQA 1WLDA 4U36A 4AVSA 4XXPA 5JMCA 2ENRA 4FPJA 1MVQA 3MW4A 3ZXFA 5JLVA 1MZ5A 2W08A 4AVVA 1S0FA 2LALA 1XQNA 4DQAA 1KJLA 3BOPA 1DYKA 5KXEA 2EXIA 4FOQA 3ZPYA 5GLTA 3V64A 1WBFA 4FOWA 5T5PA 2ZZJA 2OW4A 1ENSA 1UZZA 4H55A 5GLVA 5DUUA 4M3CF 4PBOA 1GSLA 3N7LA 2ZHKA 1WW6A 1AVBA 1C57A 4XJ8A 1V00A 1W6OB 3VKNA 2PHFA 2A6XA 4GWNA 5GLUA 4WZFA 2DVGA 3QLQA 4IQPA 1JHNA 1DGLA 2D3SA 4XXAA 1C4RA 1DZQA 3OYWB 1LOAA 1KRIA 2C9AA 2E7QA 2GN3A 2ZMNA 1W6PB 1CR7A 3WDUA 1DQ6A 4HANA 4BMBA 3A0NA 1LU2A 3POSA 2WT1A 4YGCA 2YMZA 1WW5A 2E7TA 4UW3A 1LU1A 1N3QA 1GNHA 1GKBA 2DVFA 1HKDA 2UU8A 4FPEA 1D2SA 1UKGA 1UPSA 2ZHLA 3RMXA 1SLBA 3V0BB 3ZVXA 2ZMLA 2A3YA 4PF5A 4K1YA 1EPWA 2BQPA 2D7FA 3M3EA 2A6ZA 1LOBA 4PQ9A 1GZ9A 4P14A 1VIWB 1WD4A 5SV8A 1SBEA 2GDFA 2PHTA 2AREA 3WUDA 1S0JA 3I8TA 2EF6A 1Q8SA 1DQ4A 4P9XA 2NM1A 4GXLA 5T5LA 1A3KA 1ENQA 3AYCA 1APNA 2UURA 2YV8A 3BIWE 3MPPG 2WSUA 1C1LA 1LOGA 1W6QA 2D6MA 2PELA 3PVOA 1LHVA 4M3CE 1SBDA 2P3JA 5E8AA 3WLUA 4AGRA 1LHOA 4Q1RA 1QU0A 3RQ0A 5F5QA 4JC1A 5FRAA 4Y20A 1Z0HA 3PMEA 3FBYA 3WV6A 4ATFA 4MYEA 5JVVA 2ZGSA 5GLZA 2D6PA 4XIOA 2DVBA 3D4KA 1DQ0A 4KBBA 1SLTA 2UWAA 4ISQA 4W65A 2P3IA 2ZGUA 5H9SA 4YLZA 4Y22B 3SNMA 1ULEA 4XZPA 1AZDA 4XJWA 3O5SA 3Q9OA 5HCBA 2JE9A 1V6KA 1LODA 2WT0A 3RMYA 3RRDA 1Q8VA 3B69A 1LCLA 1RINA 1DHKB 2YXSA 5GALA 3IMNA 1QNWA 2V73A 3WCRA 1S0GA 3AYAA 4YM0A 4Y1VA 3OBTA 3USUA 3N7JA 3SH3A 4YFZA 3ILNA 1SLLA 2PHXA 3R05A 1LHWA 1YRZA 5CBLA 1LOEA 5T54A 4Y1YA 4YW1A 5JOZA 3AP6A 2CL2A 4XHBA 5GZEA 2JE7A 4Q8LA 1Q8PA 3WDYA 2A3WA 1WW4A 3ZXJA 1CONA 1QKQA 2DYCA 4XJUA 4XHXA 3ZXKA 2VW2A 2GNBA 2P34A 2PHUA 1G9FA 5E88A 1QF3A 4M3CB 1V6IA 4DFSA 1KITA 5L73A 1MS0A 4RA0A 5GZCA 2YROA 2ZGKA 3R4SA 4Y24A 3LCPA 2D43A 1OKQA 3M3CA 1CJPA 3KQRA 3ZSLA 1JOJA 1F9KA 1DBNA 2EXHA 2GN7A 4P9WA 1G7YA 2WSVA 3WUCA 1N1SA 1GV9A 5IK5A 1LTEA 2VY0A 1RIRA 5IK7A 3AP9A 5KXCA 2Q5TA 5KXBA 3DUIA 2SBAA 3WG1A 1Q8QA 1JW6A 1LENA 2DTYA 2GMEA 3INAA 3HMYA 4UW6A 4BOWA 3M1HA 2KM2A 2WNEA 4FPGA 3IPVB 1HLCA 1G9BA 2E53A 3ZYRA 2ZABA 3UL2A 3U4XA 1BQPA 3D6EA 1IOAA 3WHTA 2C5DA 2P3KA 4YW4A 3USUB 1GZCA 4R9AA 2XG3A 3AX4A 2DUQA 5GJ6A 2R1DA 4GKXA 3V0AB 5JOYA 4PBPA 2AGSA 3ZXEA 1JYCA 2VH9A 2DU1A 2W52A 1V6OA 3MW3A 3O0WA 3B00A 2Z42A 3A0KA 5DZFA 1UN1A 2R1BA 4GWMA 2FMDA
chains in the Genus database with same CATH superfamily
2A7AA 1POQA 2WKKA 2HWE2 2JENA 5FFOC 5A32B 1LB2A 3QCWA 3U0ZA 2A75A 1C8M2 3OF1A 4AEJA 1AYM2 1W9FA 4JTOA 4WV8A 2D3PA 1QJZA 4QQPA 3SKVA 4I2OA 3VBHA 5FZKA 1V9U1 3W21A 3S5QA 1MEC1 3VKFC 1HQWA 3H1MA 4XZUG 5BNOC 1LEMA 2RS52 4IEQA 5CFCB 4OHXA 1JZ8A 3DL3A 1W2UA 5LK7B 2KXLA 1OH4A 1G86A 3KVBA 4RQPC 2JDZA 5AC91 2HWE1 1ND3C 3KQ4B 5C6CA 1MR5A 5DUWA 3JQWA 5J09A 4R9CA 1C8M1 4NHYA 1AYM1 2P4EA 4G9SB 4X6QB 4OI1A 4A41A 3SITA 4BQXA 3T1MA 1RUF3 5BNNA 3KM5A 4IDZA 2RS51 1IZ3A 2VMCA 1W8HA 1DU3D 3AZWA 4BK5A 1RL3A 4NAOA 2TEPA 1DZRA 4H7LA 4AI9A 2WLPA 2ZGNA 4AGGA 4HK8A 1GP5A 2QDRA 1ULPA 2WNUC 4BIFA 5DDJ2 5JOXA 1DP0A 2UY9A 4LK7A 3ABZA 2D98A 1WZXA 5A7QA 4BXFA 3D82A 1UQXA 4CDXA 4E2GA 3N3HA 2WZ8A 4PLNA 1ULDA 3N9NA 1PGW2 1CAXA 4EN0A 2BWCA 5HCFA 5HV0A 4ONUA 5AVAA 2ZGTA 5DAXA 4MGSA 5FZDA 4BK4A 2WQZC 3OY8A 1VBE3 1YWKA 4FP3A 5DDJ1 3HQXA 3MIDA 4EN9B 1SCSA 5EYXA 1CWPA 4FOVA 1Y9GA 2ARBA 3B5LB 4N9IA 5IWFA 4NVPA 2JX9A 4HT1T 4ZKTB 3SH5A 1SFNA 2HWF3 1H6XA 1XE0A 1PGW1 3FWEA 4BDVB 1KDMA 2RDRA 5JI9A 3JD71 3BYWA 3SKJE 4GKYA 2WYFA 4BIOA 3ENRA 4GB33 1IPSA 1PZ9A 2NLRA 2FBEA 5D8AC 5CKNA 1ZNPA 2C9KA 2F6BA 1CN1A 1BK0A 4LA2A 1WA4A 4XDPA 2Y60A 5FYUA 5A33A 1RHI3 5EJ3A 3O1TA 3USSA 4UFKA 5HPOA 4GJZA 4AVBA 5L7OA 3IDBB 3HN1A 1U0AA 4D6SA 1JXNA 2ZHNA 4DNYA 1VLNA 1F5JA 1RVF3 1G9CA 3VDCA 4LKFA 1RUI2 3GF6A 5CADA 4LE3A 3MUZ1 4MZUA 4URTA 2GP3A 4FI9A 4K3UA 5FYCA 3BTYA 4XF4A 2YGMA 3SCHA 1UOJA 3OGVA 2Y6KA 4FPLA 5D1IA 1Y43B 3BTAA 1LOCA 4CP2A 3CQOA 2PYTA 3FLPA 5B4NA 2W68A 3KT4A 1R093 4NRMA 2CNAA 1EYBA 2W9XA 2RG4A 4Z2AA 1QJEA 1W0NA 4XTPA 2FCVA 2YBKA 4CEWC 5LW9A 1W6OA 4D6QA 1RUI1 5A6XA 2DDUA 4MGTA 1R082 2C1FA 2AH2A 3AB0A 4E2SA 4D7YA 3SH4A 4D8MA 4UWDA 3GZAA 2O0OA 1MS9A 1F2NA 1MZEA 2PHWA 1RUJ2 3ZIWA 1RJ7A 2RMU1 1B35B 4A6SA 1JHJA 2XLGA 4D7SA 4BLIA 4IUGA 5LATA 4NAMA 1JTZX 4LBLA 2XJPA 5FZOA 4CUCA 1R081 1JUIA 2BU9A 3QBQA 1GYKA 4Q0VA 3DYOA 5K0UA 1P8JA 1S2EA 4BXSV 4TN7A 4YG3A 3DV8A 4MLOA 1SEFA 2VL4A 4QX2A 1FV3A 1BHGA 5F7UA 1OQ1A 1DGRN 1FX5A 1S0CA 1BJQA 3KMHA 2ARXA 1QJU3 3SCGA 3T30A 4HKLA 4P5YA 3E6CC 2WS93 3E6BA 1AX2A 1TEIA 3N35A 4JGYB 2A71A 4CRQA 3BB6A 4ASKA 1HB3A 2VZPA 4Q4W3 5DAWA 5A70A 2VUDA 3MF6A 2Z2SB 1H0BA 2Y33A 5T52A 5C8CA 1FYUA 5CNAA 4NPLA 4UFIA 1HRV2 1ULCA 1KD7A 1LHUA 3H9AA 1AX1A 2OZ6A 5JSPA 3GCXA 1PGSA 5E16A 3AYEA 1KDKA 3VBOA 1QQP1 1W8UA 2E26A 3BCWA 4TYSA 5FZ4A 2EAKA 4DUXA 1H8TB 4YVSB 2E6VA 4Q26A 1UX7A 3FC0A 2CAUA 2ZX1A 4L2NA 1HB4A 2JIGA 2RS32 4AEDC 1O3QA 1VBB2 3NNMA 1FOD2 4UW4A 3AFKA 4QX8A 2DF7A 4BQWA 4WBBA 4P9YA 1ONAA 4NOTA 3PJQA 4AHYA 1M06G 2P6HA 3CJIA 2JE8A 1UAIA 4Y1ZA 3BIEA 5CG9A 2EIDA 3AK0A 3POFA 1OOPC 1ACCA 4C8DA 2OS2A 1RITA 2VZSA 2OVUA 4PDWB 1KFUL 1UMHA 1V9U3 1EUTA 2G4IA 2DBIA 2ZGOA 5GLWA 1MEC3 4AI2A 5DPNA 4IE7A 3WNPA 2RS31 5FP9A 1FOD1 1S1AA 3PVNA 4DO0A 3FLTA 5JWPA 2OX0A 2VNGA 4QX5A 5AC93 2HWE3 2WZR2 1ODMA 2VBDA 1HDKA 4CDQA 2ZX3A 4NPMA 5CYYA 1C8M3 2ERFA 4FTSA 1AYM3 3NV3A 3MEPA 3UESA 1OLME 1D0HA 1LULA 3GALA 5CFCC 1UX6A 2ZX2A 2RS53 5T55A 3AZZA 1NG0A 3CMGA 4DUWA 1E5HA 4Y1XA 4XIKA 4QQOA 5CAZA 2D93A 1ZRCA 1W0OA 2DURA 5GM0A 3HN3A 3NRUA 3VV1A 5FKBA 1N1TA 4XJ9A 1S0DA 5D2AA 2VULA 2CU5A 1VAMA 2ZGMA 4IGPA 4P9JA 3I3MA 3HIFA 1SBFA 4BMEA 2DVAA 3T4HB 4QKBA 4M00A 1Y9QA 4IEVA 2RV9A 3GYDA 4YZ2A 3UJOA 2EIGA 4JKKA 4UOJA 3L2YA 4QD2A 1QJFA 4AQTA 1KGYA 2XMLA 1DG6A 1L7QA 1QJY1 1UWWA 5CZKA 5DDJ3 5FPLA 1T6BX 3NWKA 2NMOA 1D7PM 4DEQA 1WKYA 4QB2A 3TEXA 4LKDA 3ATGA 2Q8DA 1HRI2 4QKDA 5A6YA 2C6SA 3N7MA 3P3PA 3K4DA 5LBFA 5BUVA 4ASMB 2R062 4TZDA 4XOGA 2CSGA 2WZEA 2X5IA 5C4WC 3K2OA 4NO4A 3JD73 1TZOA 4IE5A 2LROA 5IVVA 3RZLA 1RXFA 4SLIA 1GOHA 5IVCA 4NIHA 3DECA 4XJAA 5A3PA 1G6NA 4LO5B 3VDDA 2PXJA 4ARYA 1SDWA 1WBLA 3ZO0B 4CU8A 3BODA 3ETPA 2NP0A 3MIFA 1G9AA 5T5JA 4A7ZA 2BYVE 1HRI1 4RL7A 1JYXA 4F83A 2ZJCA 4EE2A 5F8PA 2R061 1UY1A 1X36A 1VMHA 3IDAA 1LJ7A 3FN9A 1ZA4A 3AP4A 2R16A 2PAMA 1I1EA 3CEWA 3FLRA 4GIQA 5CA6A 4XDQA 5FQ0A 3TB0A 5A1LA 2JDNA 3JUUA 2VO5A 3QH7A 4UI9L 2NPIA 1QEXA 1VPHA 4H3WA 1JMUB 1US3A 1WA6X 2ZCWA 4NIIA 3ZN6A 1KQRA 1RUI3 3N9PA 5JOWA 4YYOA 1SACA 4ZS2A 1ODNA 4HSLA 4AFDA 1MVQA 3AKQA 3WNOA 3ZXFA 1MZ5A 3FHAA 2LALA 4RGGA 2TNFA 3LDRA 5KXEA 4ZXEA 1NKGA 3VBUA 1ZBA2 2P17A 2RMU3 3VHOA 1WBFA 2OXBA 5IYYA 4FOWA 5CISA 2JG8A 5F1RA 4MXVA 1E5IA 1UZZA 1QXPA 4COZA 4D94A 2ZHKA 1QXRA 1RTVA 3DKWA 4XJ8A 2B9UA 1OKOA 1V00A 5F37A 1R083 4Q0UA 3TN92 2RJKA 3KF5A 1TE1B 2PHFA 2A6XA 1H2KA 2ZX0A 5GLUA 2DVGA 2FZ2A 1JODA 4XFHA 1BBT1 1ZBA1 1D4M2 2ET1A 4Q0QA 2BEOA 4CU7A 4K9SA 3G7DA 5I0UA 1KRIA 2HYXA 2E7QA 2ZMNA 3MLLA 3PIGA 5EHDA 1CR7A 4HANA 4YGCA 3E5QA 3H3UA 1NQDA 1RUOA 1KXGA 4LE4A 1HKDA 3FHQA 3UKTA 5JR2A 1D2SA 3NNGA 1AHSA 2YC4A 4ET7A 3OPWA 1UPSA 1I5PA 1Y3TA 4HG6B 2KD7A 3WQBA 3V0BB 2ZMLA 2A3YA 4HLTA 5FZHA 4AXOA 3I97A 4K1YA 2D7FA 4CP9A 4KH9A 3H8OA 1I5ZA 4N8MA 2PLV2 3IAPA 1GZ9A 4JGYC 1VIWB 1ALYA 1QQP3 1XOYA 3SHRA 5SV8A 4N90A 2FDIA 5FXWA 2GDFA 3LA7A 2AREA 3MLJA 4RS5B 3KV6A 3I8TA 3VD3A 4P9XA 3P6BA 2XJUA 2ZTNA 1OQDA 3C7OA 4FAHA 2VTXA 2OT7A 1ASJ2 2YV8A 4HVRA 4XW3A 4AI8A 2WSUA 4CYDA 1C1LA 1W6QA 2PLV1 3WLUA 2W5FA 4M3CE 1SBDA 1H8TC 4Q1RA 1QU0A 1VRBA 3NJXA 4YVSC 4AI3A 2VZQA 4XUPA 5F5QA 2HLEA 3I7DA 3L2HA 1Z0HA 1NA1B 3EQEA 4HPKA 2XR4A 2IUWA 4K8RB 4S2GA 5FXVA 2BNNA 5JVVA 3RJRA 2RS33 4W6YA 2XJTA 1FOD3 1MZFA 1ASJ1 2UWAA 3AMMA 4ISQA 4MX3A 4DEVA 1W2NA 3ZR6A 5ACA2 1YC61 2HWD2 1W03A 4XZPA 5JZGA 4XJWA 3O5SA 3Q9OA 4PDWC 1V6KA 2QKDA 2WT0A 4LO8A 4Z2WA 2XDVA 3NJVA 2WFPA 5B4XA 1QNWA 2J1VA 5FYYA 3WCRA 3WNKA 1ND2A 1X8MA 5FMOL 1O59A 4MHUA 2Y34A 4LQRA 3U11A 2RJ2A 5CBLA 4Q4V2 5F39A 1LOEA 4GZ9A 5JOZA 5FYBA 2XKOA 4QDSA 5ACA1 5GZEA 2JE7A 1CAUA 2QE3A 3HT1A 4IV1B 2HWD1 4KG8A 3DEMA 4QPIB 2QQVA 2OYZA 2D5FA 1GNYA 2BRTA 1OC1A 1XSRA 4CEYA 1CONA 2UYBA 4UYBA 4XJUA 4MADA 2VZVA 1W06A 5FWEA 5JXJA 4CP0A 5I91A 4Q0SA 1QF3A 3DPRC 5FZMA 3BI3A 4CDUC 1KITA 5L73A 4YPJA 2YUEA 4DFSA 2BERA 4Q4V1 2ZGKA 2LM3A 4IE6A 4XUNA 1E57A 1YIPA 4AVAA 4Q0PA 1QJY3 2XKPA 2W47A 1PMHX 1JOJA 1XB9A 5LBEA 4XURA 4XUOA 1OT5A 1GQHA 2EXHA 1G7YA 2WAOA 1TME2 1GFF2 4HETA 5IK5A 1LTEA 1UKRA 2V72A 3B94A 4Q5OA 4QWNA 5FY0A 2WNVA 5C9AA 3UGHA 5KXCA 1ZA7A 3DUIA 3HWJA 4CVUA 2SBAA 5FCCA 3RZZA 5I0RA 4DOUA 3K46A 1AYN2 1JW6A 2DTYA 3CIHA 2GMEA 3INAA 4UW6A 4MH0E 5J7MA 2WNEA 3ES1A 3IPVB 2O1QA 4BYYA 1HLCA 2ZKLA 3GZUC 2WUHA 3RYKA 1OSGA 1OFNA 1IPJA 5CKQA 2BP6A 1TME1 1HRI3 4JV4A 4P9IA 4XCAA 4IETA 2C5DA 4GMP1 3LKJA 2QUOA 3ZXDA 3VBRA 2XG3A 2R063 4XPVA 5FV3A 5FXZA 4LHSA 1NZCA 1OPMA 2R1DA 3GXUA 3ZKYA 4AAPA 3IZOA 2VM9A 4J1WA 1TNRA 1AYN1 3U4SA 2VH9A 4CDWB 2G9ZA 3MW3A 3O0WA 3WEZA 4EWDA 2HEWF 2J42A 2FMDA 3PVEA 3M70A 1DYOA 4YZ1A 3POJA 3ZPOA 4AFMA 3RZJA 3A22A 3GBGA 3VLBB 5FREA 3M4FA 1R1ZA 4YW2A 4ES9A 3P1IA 5LRRA 5C33A 1NCQC 1XYOA 5J1XA 3O1VA 1TQ5A 1NLRA 4MGIE 4B1LA 1PMIA 5BXXA 3ZFGA 2X53S 5FUNA 1SLIA 4KMQA 5ISLA 2QQNA 2VBBA 2UYAA 4J1XA 3ZSEA 1PK6B 2ZXQA 3LIHA 1V6MA 1UOGA 1YXWA 1MS5A 4FFGA 2MHFA 3E5XA 3ZFFA 3RG0A 1RHI2 5FTTC 4ITCA 3LB9A 1UU4A 4LBQB 3VHNA 5JDBA 3RSJA 2HEYF 4DUVA 2JDKA 3H0OA 2ZS6B 2OUJA 1PNGA 2W1WA 5FJKA 2CGOA 4IV3B 1BBT3 1IQAA 1ZBA3 3DCQA 5T5OA 2JWPA 2R49A 5JMOA 4OLLA 5F5IA 2DU0A 3EHKA 1W3VA 4DRVA 3I2OA 1ZZBA 2QQUA 3OGGA 2OA2A 1IKQA 4D7TA 2ARAA 2Q1MA 1YIFA 5F3IA 1WD3A 3VZMA 3T1LA 1UZVA 1NX9A 1OA3A 3MICA 4JHZA 1WWYA 4BHPA 4LEJA 3N7KA 4IGOA 1UZ0A 4WM8A 4AVTA 1HV1A 4CCJA 2AUYA 2I07B 4B4QA 5C5UA 1JZ7A 1CIWA 4LIUA 1D0GA 4LLFA 2GNTA 3C7GA 2G9GA 4QPGC 5A1FA 2WNOA 2YC0A 1QHDA 1MACA 3AL5A 4MG2A 3RPQA 3IM0A 3FUOA 4ES8A 2GC3A 3CZJA 1HXS2 4HN1A 4FPHA 5HXVA 3S5AA 4YZ5A 5F32A 1O91A 5JSRA 1J3QA 2ET7A 2D44A 1PZ7A 4FOYA 2PAEA 3D3AA 3DGTA 2AZ5A 1I3HA 3EB7A 3WF3A 5BNOA 1FNYA 1DQ5A 4Q1PA 2PLV3 3ITQA 2XQRA 4GD4A 2PMWB 4RQPA 4XMAA 4Q29A 4RS5C 1HXS1 1ND3A 4Q2FA 3WNMA 1AR71 2QQWA 3KCYA 5A6ZA 3POBA 1W6MA 2OPWA 4L8QA 3QOPA 4QAWA 1UD1A 1ASJ3 4Z92B 2QBXA 2WS92 1GMMA 2DCYA 3K51A 5JXHA 2JKXA 4KU8A 1UIKA 2RDQA 1LR5A 4RR3B 5HXMA 2XVGA 2C4XA 3WDWA 2TUNA 4XF3A 1CIYA 2JDPA 1S4CA 2R30A 1BK1A 4C0BA 2WNUA 3ACFA 3GBWA 3FZ3A 3KV4A 4AOCA 3ASIA 3MIHA 5JPMB 3LSDA 3WW3A 1EV11 4XACA 1WCSA 4FCAA 3OY8B 4RFRB 2XUMA 4TLFA 5ACA3 4FPKA 2D40A 3ACLA 1G8WA 2YZ4A 5B2GB 2HWD3 4H14A 3MFCA 3BPSA 3OYWA 1AF9A 3KVAA 2LW8A 2E33A 4KI5M 4CU6A 3T2TA 4XBLA 2A73B 1AUYA 2VPVA 1AJOA 3AKSA 3DKQA 5A3WA 2CWMA 2FCTA 4HVQA 3RWKX 2VCAA 3OPZA 3O1UA 4Q27A 1RUG2 2GMPA 3RZMA 2W39A 4CU9A 3O1OA 2VMFA 2A6YA 4Q4V3 1RUH2 4IV1C 4Y5TA 5JR7B 4QPIC 1V9U2 3J7LA 4CCKA 5A33B 1XC6A 2WC2A 3FJSA 4IEOA 4AYUA 4XFBA 2BOJA 1FATA 3LGRA 4JVAA 4Q4X2 3UJQA 2W94A 5D8AA 3S30A 1PM7A 3I59A 1LESA 3ZDVA 4A4AA 4BM8A 5AC92 3ZYFA 5LRSA 5LA9A 5J36A 1RUG1 1ZM1A 3HQUA 4YG6A 3LDKA 4A42A 3MPBA 4O61A 1RUH1 5A7NA 3HNMA 2VE1A 3V56A 1AXKA 5FMDA 3GZTB 2QQOA 2GC2A 4E4HA 3B9IA 3LPGA 3VKOA 4Q4X1 5LEJA 3PL0A 1FI2A 1ZZ8A 3M3QA 4UFLA 3SISA 4OYUA 3RYPA 1YI9A 3VD5A 3WDVA 1TME3 5DG2A 3GNEA 5IW0A 2D6NA 5IT6A 4GMP3 3ZN5A 5A3OA 4CCMA 4YM1A 5FMCA 5LBCA 5LA1A 3RJ2X 3GJBA 2QZ2A 2JB4A 3NL1A 1GNZA 1W8TA 3LFMA 1Q43A 2XJVA 3I2GA 1AYN3 2VMIA 2HBTA 1QH7A 1NLQA 2VQTA 1OA2A 2EICA 3GGLA 3PNAA 3OBRA 2FHRA 4JDNA 4CEWA 1XNBA 1OHFA 3TYJA 4MGZE 1NLSA 1LKNA 1OF4A 3JU9A 1J3PA 1RGSA 2QCSB 2Y26A 2CTVA 3UK9A 5I93A 3O1SA 3N4MA 5FZEA 5H9RA 4A7YA 1YQ5A 5I8SA 1IKPA 5JPNB 5L9VA 4FPFA 3RZGA 1ZRDA 3I3QA 1DGRA 3G6JB 1W6NA 5A7SA 1MS8A 3APBA 5CU1A 4CDWC 3WG4A 5K0UB 4JDOA 1YJKA 2WO7A 3KCXA 4LO4B 4QQHA 4XVHA 3UGFA 2CWSA 5DAVA 1NT0A 1UYZA 5FLJA 1CVNA 1C28A 2JDHA 4W6XA 1OVPA 5FLHA 3UV9A 1DQ1A 2DCTA 4W6WA 2Q4SA 5LY2A 4JCKA 1W8OA 4A7KA 3HBKA 3JD72 1NOVA 5BV6A 4XAEA 4LBNA 3T2PA 3EBRA 4I30A 2Y64A 3ZYPA 4Z8BA 4QHBA 1HQNA 1AXYA 3M3OA 3AZXA 2VC9A 4ZZ8A 4I09A 2EAAA 2ZMKA 5FO8B 3OBZA 5CB7A 3RDIA 3HQRA 4N7UA 3AM2A 4OCTA 4WM7C 5ABJB 4NN0A 1N1VA 1OD5A 1JI6A 5C8CB 2AR6A 1JOPA 2VD7A 1PK6C 3OJBA 4B1MA 2RDNA 4OZXA 2VU9A 4C1XA 1FV2A 5A6QA 3ZYIB 4FTBA 1X50A 3VBOB 3VHRA 2P5BA 2XJRA 1YNAA 2Q8EA 4AG4A 2IXJA 4DXRA 4LULA 1Z78A 2XPJA 1GQGA 4GH4B 5F3CA 1UCXA 5FBJA 5DG1A 4U2AA 3OUHA 4IV3C 4META 1Q56A 3TEYA 4KWLA 1VBD2 3AP5A 5EZWA 2AENA 4FFHA 3ZXLA 4AEDA 4FFFA 2ID4A 5CFDB 3THTA 2JG9B 2YBSA 2XJQA 1OH3A 2VUAA 4MXWA 5FZ3A 1QOTA 2VQ0A 1WCKA 5C5TA 3LA3A 1OOPA 1H1MA 4JTNA 2RMU2 5T50A 1ZRFA 1V6LA 3PDQA 3CKHA 1JU3A 3SQOA 1VBD1 5CIRA 2WL1A 4QHOA 2HBUA 3D0SA 3LD8A 4O9GA 4UF0B 3BPZA 2O8OA 4R4ZA 3B01A 5FYHA 5FZ0A 4ZU5A 4BZ4A 1LAJA 3NAPB 5FZIA 2IXCA 3J7HA 4PT6A 2UWBA 1UOBA 5KWRA 1RJ8A 1HXS3 2IXLA 2BFUL 2IXHA 4V2WA 2ADDA 5F5CA 2OZJA 1AR73 2KR2A 2MPFA 2F4LA 1W6PA 3B02A 2Y6FA 4B8EA 1DLLA 1NZIA 5C70A 3AXDA 5CFCA 5EWSA 3KT1A 2H6CA 3WSOA 2R0HA 2HWB2 1YLLA 2DVDA 1VBA2 1IPKA 5FOJB 2DUOA 4JRAA 4MHRA 1OFSA 1W9YA 4QQ2A 5K4LA 1PX4A 2MNGA 1C8NA 1XRUA 2WR9A 4DY5A 4N43B 1EV13 1R1A2 2Y0IA 1AR62 1K5MC 1LECA 2Q30A 5IVYA 1VRH2 2IXIA 2ZAHA 4TSVA 3X29B 5BNPC 5I8YA 1QQP2 4I0BA 4R8HA 4RR3C 1PM4A 2VCMA 1S0FA 1XQNA 1KJLA 3BOPA 2HWB1 1VBA1 3OTFA 3NVCA 3UYJA 3ZPYA 4CCLA 4M4PA 4NRPA 3V64A 5T5PA 3KZ4C 4LT5A 4H55A 3C8XA 5GLVA 4M3CF 3N7LA 1R1A1 1AR61 1WW6A 4CP1A 1AVBA 1C57A 5A3LA 3OEAA 3WD5A 4QB1A 1VRH1 1K42A 5FJHA 2XXZA 1W99A 4OHVA 3VDDB 4AHZA 1X8EA 3QLQA 3CF6E 2GU9A 2GH8A 4IQPA 1O5UA 5DN2A 5C4WA 2VUJA 1DGLA 2D3SA 1XE8A 3TWIA 3ZLIA 1A8MA 1XNDA 4LLOA 2C9AA 4RHV2 2GN3A 2BTVC 3K4ZA 3VB9A 2WWUA 3K4AA 4NRQA 2FCUA 5IJRA 5EJ1B 1HJFA 1RUG3 1W8FA 2WT1A 1WW5A 5A7WB 4ZZ5A 2E7TA 2WWJA 1JYWA 1C5IA 1N3QA 4UW3A 4NWWA 5CVRA 1RUH3 4D0QA 1YQ8A 4CCDA 1QJX2 1BEV1 2VNRA 1T2XA 3CBNA 4FPEA 5ANQA 3S6PA 5HBAA 1K45A 2WRAA 2YPJA 5FQ0B 3ZVXA 4Q4X3 5KHKA 4ZONA 3SEPA 1EPWA 2BQPA 1ZYBA 3Q8CA 4RHV1 4ZU7A 4CXWA 4HSJA 1DGWX 5C3PA 4XUQA 4PQ9A 4TWTA 5G04L 2ORZA 4P14A 2J1TA 4A6OA 4YNIA 2LS6A 2PHTA 1JU4A 1QJX1 3MF9A 1GP4A 2B42B 3O14A 3DF0A 4WVZA 4PF1A 1OBNA 1T6GC 2DCJA 3VBUB 4AR2A 1ENQA 1YFYA 3ACGA 4EJRA 2B8MA 1LOGA 3PVOA 4JHTA 1IGOA 2W46A 2P3JA 5A7PA 4MO3M 1LHOA 1QJY2 2RVAA 1UY2A 3WY6A 5IFPA 1J3RA 3C7EA 5APAA 4JC1A 1UIJA 1O6UA 5FRAA 5BY5A 5JXGA 5IVFA 3FBYA 4AEMA 4B4RA 5FMBA 2VAUA 1YFXA 1YJLA 2WN2A 3WQ0A 3D4KA 3VBFB 4KBBA 5LWBA 2W3JA 1SLTA 1ST8A 1FMD2 3BOWA 4Y22B 1ULEA 2I45A 1W04A 4EV0A 3LEMA 1LODA 3F95A 1CJDA 4K6BA 1Q8VA 2IWGB 4LOSA 5EQUA 3R0RA 4QU1A 3VHPA 4HOOA 4A44A 1S2KA 2YXSA 5A80A 3IMNA 5IVJA 2V73A 1S0GA 5IVEA 1HX6A 4Y1VA 5C3OA 3LEIA 3OBTA 3USUA 2BZDA 1X7NA 1SLLA 3R05A 1LHWA 1UO9A 2ARCA 5T54A 3WXPA 4QXCA 1GR3A 4L11A 1FMD1 5FDBA 2F17A 3IT8A 4Q8LA 1Q8PA 5EIYB 1WW4A 1C5HA 3ZXJA 5JUVA 2WO1A 1TMF1 2JDAA 2P34A 1OMIA 2PHUA 5ABJC 1OXCA 3URFA 4YVWB 5KHHA 5E88A 3AMQA 1PO11 2BV4A 4JGYA 4M3CB 3I2IA 1H4HA 2B4KA 4RA0A 2BVVA 2IC1A 3W20A 2BFUS 3C3VA 4BQ3A 2D43A 4B3NA 3RI9A 3M3CA 3THCA 1DCSA 4B7EA 1F9KA 5JIAA 2GAUA 4BA6A 1OQEA 1WMFA 1DDLA 1WCDJ 4EQVA 4GH4C 2YB7A 5FYSA 1COV1 5FPAA 4DXTA 4FXGB 2PQSA 2BGOA 2IXKA 1BLZA 3BUCA 4LJHA 1H8TA 4YVSA 2BJSA 3LOBA 3ZYHA 4LUKA 3LFIA 4EN7B 1VBD3 5FO9B 5F2WA 2VZ1A 1LENA 4BISA 1CAVB 5CFDC 5J37A 2JG9C 3TRSB 4K7JA 1RUNA 4MGKE 4EN6B 3AVSA 3ZYRA 3IDEA 3MFAA 3UL2A 1X9PA 5EFUA 3U4XA 1GU3A 2VQAA 3H7JA 3RNSA 4IEZA 3D6EA 1ND2B 3WHTA 1BBT2 2ATFA 5C71A 4R9AA 2EIBA 4PDWA 3FFQA 5IFTA 3ZX7A 2B46X 4UBHA 4GKXA 4ZU4A 3V0AB 3WF4A 1BVVA 2AGSA 4LTAA 1ZBE2 3ZXEA 4SBVA 2W52A 1V6OA 2Z69A 1PGL2 3NAPC 3B00A 2Z42A 3A0KA 3ST7A 3DXUA 4ASLA 3ACHA 1TVGA 1MZ6A 3FX3A 4NJ4A 1WLCA 1B35C 1H2LA 3RVHA 2VVFA 5JCTA 2PHDA 2BUKA 4RD7A 1EY2A 3TAYA 1VAVA 3VZLA 4CCEA 2WYSA 2PQQA 1XSQA 2VUCA 4JRLA 4JQRA 3ZYGA 4FQZA 2TBVA 2PFWA 5GKAC 3VD9A 1YO8A 4QX1A 1JN2P 1ZBE1 2VG9A 3MV11 4NE9A 3AKPA 5GZFA 3IKWA 3DPRA 4QKNA 1PGL1 1O4ZA 1LEDA 3WINE 3IDCB 4CDUA 5FZBA 1AXZA 2HWB3 2J7MA 1XU2A 1VBA3 1PIV1 2NZ9A 4CUBA 3O1RA 4NIDA 4NHMA 4LBMA 2K2SA 3PU3A 4N43C 4IE0A 4BPZA 1CPNA 1R1A3 1AR63 2GH2A 3KB5A 1OLQA 2RS12 1VRH3 1XYNA 1SFPA 2D97A 4XFFA 4YG0A 4OUMA 2CYFA 3CDZB 3ZFEB 3WHUA 4UT5A 2D6KA 3BU0A 4YM2A 3HNBM 4OQ9A 5GZGA 4OVEA 3I3EA 2J1SA 4CSWA 4QX7A 5HCHA 2WFF2 3NNLA 1A6CA 1PZ8A 2ADEA 1O3TA 3OB8A 2ZBJA 2WJSA 4LNVA 3VBRB 2J1UA 4XABA 2VECA 1FAYA 1GLHA 3H8RA 1H6YA 1S2BA 3H7YA 1BXHA 2RS11 3AFGA 3K48A 4JGZB 4YZ3A 2VOVA 1BEV3 4CCCA 2K9ZA 3N36A 4XYXA 3VBSB 4XQ4A 5E89A 3C7FA 3J4UH 1E5RA 3VDAA 3AKRA 2WFF1 3HBZA 1VJ2A 4CXXA 4RHV3 4ARXA 3GHMA 1Y4WA 4XQDA 3UNPA 4E27A 5K9YA 1SPPA 1KJRA 5FP7A 4N53B 4HK9A 4IEYA 3J7MA 3W58A 3DYMA 1Q8OA 5E6HA 4ZPIA 1QJX3 1V0AA 2RHPA 4UFHA 1LOFC 2VZOA 2K0GA 4AGVA 4HVOA 3U78A 4XFGA 1VALA 1NCQA 2VW1A 4EN8B 1DYPA 4FFIA 1SCRA 3CZUA 5J48A 1SFYA 3POEA 3BALA 1O4TA 3ZIXA 3OUJA 4EZHA 3ZSMA 3F2ZA 4QGNA 5JXIA 3MDPA 1YQ6A 4LBJA 4XTMA 2BPA2 1CQ9A 1UNBA 4MGQA 2D3RA 1D4VB 1XNTA 1H1IA 2JKBA 2YY1A 1N1YA 1WCUA 3ZFFB 4QXHA 4YW3A 1AX0A 3NV2A 2JJ6A 2GSYA 4BQYA 1PVXA 5DABA 3BGAA 5I0DA 1RXGA 5DUXA 4Y4RA 2YDEA 4IESA 5EJZB 4I01A 2QZ3A 4KGQA 3A7QA 4COVA 4E9KA 2YYOA 2EXKA 1JH5A 3AJZA 2ZEYA 4MVTA 2FQPA 3HVDA 3CO2A 4XF1A 1CZVA 3JZVA 2BDRA 2EXJA 3B3QE 1WUVA 2K46A 1UL9A 1GQPA 2ZGRA 4DS0A 3VDBA 1JBCA 1W0PA 2R0FA 3VKMA 5I8TA 2E7AA 4Y20B 3VBFC 3M7AA 3E5UA 3UT0A 1AJKA 4Y33A 4QT6A 1G9DA 1MQTB 3J7NA 4XILA 1FMD3 3LOIA 2VVEA 5T3NA 4DIQA 5L9RA 2E31A 3KV9A 3LZZA 2DV9A 4FPCA 4LKSA 5G05L 1F31A 2VBPA 4IW3A 2P3YA 3DN7A 2DFBA 4LHKA 2VR4A 1UU6A 1GP6A 2YHJA 1S0IA 4XCBA 1SDDB 2WZPP 1LHNA 4CCOA 1PHMA 5FPXA 1TMF3 2HKXA 3PVBB 5FZFA 4BCUA 1RUC1 1GZWA 4Y1UA 1HN0A 4QPGA 1UZYA 3NNFA 1PO13 4B29A 5FZCA 1MPXA 2EA7A 3KS7A 4YGEA 1N3PA 4QQLA 2ZA9A 1UY0A 3I2FA 3KWVA 3O0VA 4MGYE 3NV4A 4OI2A 3LF7A 3V65A 3V0BA 1X33A 3RWNA 3S0MA 2FDGA 5IHRA 1NXMA 4RQPB 1L7LA 1ZRIA 2CAVA 3H42B 4YFWA 3EXUA 4YVWC 1COV3 2DTWA 1US2A 4R4XA 4QM9A 3T2OA 2GALA 2PN5A 2BW8A 3PU8A 3Q8AA 4AFBA 4CTEA 3POWA 2WO3A 2SLIA 4YW6A 4RS5A 3OPTA 1J1LA 4RYDA 3UETA 1O3SA 1O4YA 4UFJA 3E1F1 4DZGA 5F2SA 1NUKA 2CY6A 2QVSB 4R9DA 4WVMB 2E9QA 2Z79A 4D69A 4FAGA 2ZGPA 1JZ3A 2VXRA 2I74A 1CAWB 2EALA 4FT8A 2H0BA 2WIIB 4E4SA 4DMIA 3NV1A 4XUTA 2OKXA 1IS4A 2VCCA 1WLTA 3D8CA 1GWLA 3KHBA 2GZWA 3E6DA 3PIJA 3OGJA 3ZSJA 2RM22 1DIWA 4FBFA 3MW2A 2FDHA 1GBGA 1W2TA 2W1QA 4JKLA 4KWJA 1O8SA 1YI7A 2W91A 2JXAA 4PIYA 4M01A 1IS5A 3GDBA 1BYHA 2VOKA 1NCRB 5EP9A 3TOJA 1JYTA 2E51A 3A21A 2A6VA 4KQ7A 3ZXAC 1CZSA 5C3RA 1RUD2 1K12A 2XONA 2ZAAA 1VB4A 3I2DA 3GM8A 3RGBA 3ZYBA 4QXBA 1HN1A 1ENRA 4QM8A 2B39A 1JZ2A 1DQ2A 2ZOEB 2RM21 4BQ2A 1ZBE3 3OD0A 5FLIA 2JEMA 1RB8G 3WDXA 1LGCA 1W8NA 3ZXGA 4ZXKA 1OURA 1QOSA 5EXOA 5FZAA 3O1MA 1AL0G 1ZZ9A 4IV1A 1PIV3 1UY4A 2W95A 5D8AB 3U14A 4QPIA 4LHNA 5LZ6A 3N9MA 5LB6A 5FY9A 1RUD1 3K3NA 1AR81 3C7HA 4PI2A 4E2QA 1BZWA 1A34A 3VBHB 1RUE2 3LQCA 4IXLA 3B9CA 4QHZA 1GANA 4QPYA 2CDOA 1OPOA 2G1MA 1JS9A 2ZKNA 5K8SA 1AR72 1YFWA 2F4PA 4BQ4A 2AYHA 3KF3A 2BNOA 2O8QA 2AACA 2DUPA 4W8JA 2ZGLA 1N47A 4QGMA 4OULA 3AVRA 2XOMA 4IGQA 4AQ6A 3PUAA 4JDMA 1IS3A 1WW7A 4GALA 4LBQD 4WZCA 2GC0A 2RS13 1RUE1 4TXWA 3ZFEC 2OUHA 2B7YA 5HI0A 1W39A 2NN8A 5BNNB 1B09A 2B9VA 1CESA 2CV6A 2HWC1 4RGKA 1ZVFA 4RFT0 2W1SA 4NWVA 5FP4A 3UGGA 1X82A 4AWDA 4CUAA 1PO22 3W5NA 1OF3A 3IPVA 1EV12 4FXKB 4NIAA 5JAXA 1ZREA 2WFF3 5A3MA 1HW5A 4OI0A 1W6NB 4HKOA 2XQXA 2XWJB 4IE4A 5CEHA 3MIBA 1N3OA 4AE2A 4CDXB 2XWBB 4JGZC 1QMJA 3C2UA 3VBSC 4YWAA 1F35A 4OHWA 1NA1C 5FY1A 2P37A 3B93A 4IEXA 5FYZA 1IG3A 1URXA 3J9SA 5FK8A 2ETEA 1CAXB 4CDWA 1FNZA 2GNMA 3H1YA 1PO21 2MEV2 3WW1A 4DRRA 3CL1A 4IL7A 5CKMA 3FL7A 4GA9A 2DWRA 2PHRA 3MUY1 4NUBA 4N53C 5H9QA 1VR3A 1J84A 2YG0A 4DPNA 4H2AA 3MLKA 2XHKA 3U10A 2XVLA 4GAZA 1MVEA 2P2KA 4OUSA 3ROUA 3SXWA 3AZVA 1ULFA 4A45A 1QDOA 4ATEA 5C7GA 5FUPA 5FZ6A 1NQJA 2NMNA 2EVXA 3B7MA 3PUHA 4HKWA 4FVVA 3AJYA 4E4ZA 4NHXA 2VZ3A 2MEV1 1GUIA 3I54A 4WM7A 4AK3A 1C1FA 1SLCA 1H9WA 4PLOA 4E8CA 1PK6A 2CHHA 1EUUA 4AI0A 3MI8A 5FZ8A 1I6XA 3CHXA 5F3GA 2VZUA 4XFIA 4PLMA 3S57A 1SQ4A 2BBAA 2Y6HA 3UKNA 5L7OB 2R072 1NE4A 1EPZA 1GWKA 1FPN2 2D6LX 4LBQA 4U36A 1WLDA 4MV2A 4AVSA 4XXPA 4EROA 2ENRA 4LITA 5A3TA 5JMCA 5JLVA 4RGAA 4AEDB 5KR7A 4QKFA 4AVVA 4MUVA 4DQAA 3BVCA 4IV3A 2JD9A 4LHLA 1CD3G 1DYKA 4QDQA 4AW7A 1H2NA 4MXWB 2EXIA 4INDA 3QD6A 1PMJX 2Y38A 5GLTA 2RJLA 5FY8A 1V70A 3TEWA 4NPRA 3SCFA 1RUC3 1ENSA 1YUDA 4D3WA 4PBOA 2R071 5FPUA 1MQTC 1FPN1 4PIXA 1W6OB 2XGXA 3VZNA 2QTWB 4QGLA 3U37A 4DXZA 3LEGA 4GWNA 1IHMA 3VD4A 4WZFA 1FT9A 5FPVA 5CG8A 3WX5A 1JHNA 4XXAA 1DZQA 3PMSA 3ZDSA 2VMGA 1W6PB 2GP5A 1DQ6A 4BMBA 4OI4A 3A0NA 3POSA 2YMZA 4W4ZA 3AKTA 1LU1A 2VZTA 2IFWA 2DVFA 2UU8A 2ZEXA 3L9JT 3MBWA 5FZOB 1UKGA 2VMHA 1YEWA 1RMU2 3RMXA 3S7EA 1SLBA 4LMFA 4OFGA 2IZWA 1CX4A 4XDOA 5FXXA 4LORA 3T0AA 1VMFA 2CGNA 4UAPA 4CXYA 1UPIA 2Z4FA 3BTXA 1LOBA 5LEKA 2QDNA 3T0DA 1JZ6A 4QMAA 3RYRA 1WD4A 3KV5A 4RSUA 2ILMA 4M0HA 3GCWA 1S0JA 3K77A 1NY72 2EF6A 1Q8SA 1DQ4A 5FKCA 4AI1A 4COUA 1RMU1 1O5LA 1K5MA 4LO7A 1A3KA 2QNKA 4QB6A 2UURA 3BIWE 5BNPA 2WQ8A 4LR4A 3GZEA 1U5YA 4O7XA 4RR3A 2PELA 3ZOIA 1LHVA 2WWSA 1SG3A 1XYPA 3RQ0A 3WNLA 1ENXA 2VTFA 3ZR5A 1VE0A 1UW8A 3MV01 3PMEA 3U1XA 4A3ZA 3VGIA 2RM23 4BU2A 1NY71 4ATFA 1JYNA 2ZGSA 3NJYA 5GLZA 5C4WB 2VZRA 2D6PA 5IVBA 4XIOA 1W8ZA 1NCRC 1DQ0A 1NYWA 2Q8OA 3JXSA 4JKMA 4NMIA 4LUMA 4I3GA 1L3JA 2P3IA 2X10A 2ZGUA 4M4RA 3SNMA 4KNCA 2YU2A 1O3RA 1RUD3 1AZDA 2VNOA 3CJIB 5KHIA 3IB3A 2JE9A 3RMYA 3KLSA 1GWMA 1AR83 3RRDA 1LCLA 2VTXJ 1DHKB 3M8LA 3NNJA 4F7ZA 3MGUA 4YM0A 3H1WA 2Y6GA 4YRDA 3N7JA 2FD8A 4TTGA 2XJSA 3AC0A 3WP4A 3NQHA 3JB4C 2YFUA 1F4HA 4Y1YA 4YW1A 2QQLA 1H1AA 2CL2A 4XHBA 1W2AX 4Z07A 3RZHA 3LE0A 1QKQA 2DYCA 2VOXA 4CDQB 1W28A 3KCCA 4XHXA 3VBHC 1DF0A 3ETQA 4L0PA 3OOXA 1XBFA 4MSVA 1BCXA 1RUE3 1G9FA 1YCIA 2A1XA 5AVPA 5A32A 3HEIA 3OG2A 1V6IA 3NO8A 2PA7A 2HWC3 5FYIA 3SMHA 3R4SA 5KHGA 3LCPA 4DB5A 2E32A 1WCQA 2XL9A 2P6CA 3ZSLA 3OSDA 4F3JA 4HXCA 4KGGA 1DBNA 1U12A 4AVCA 4AFCA 5EV7A 3LA2A 2GN7A 4P9WA 2WSVA 1R64A 3WP5A 1OLRA 1N1SA 1GV9A 4KBZA 1REDA 2R042 2VY0A 5BNNC 4FSJA 1RIRA 4PJYA 2Q5TA 5KXBA 3KSCA 1BMV2 1HB1A 3WG1A 1Q8QA 1PO23 3VZOA 4O65A 3JBG2 3HMYA 4BOWA 3ZKUA 3M1HA 1ZX5A 4P00B 2JIJA 3OUIA 4XQWA 4CDXC 5FYVA 2WA4A 4URAA 1BQPA 1AL22 1UXZA 5FZGA 4OHZA 5AFEA 1IOAA 1ZZCA 2W0XA 2LRPA 3JB8A 2R041 1GZCA 2WINB 2PAKA 4X6RB 3USUB 2DBNA 2DUQA 5FZLA 1BMV1 3WW4A 3J8F2 2X5IB 2MEV3 1JYCA 1O7FA 3IIAA 2DU1A 3JBG1 1CZTA 1RUJ1 4ZS3A 4J25A 1UN1A 2R1BA 1LRHA 4GWMA 1BEV2 1G9BA 1W3XA 1F4AA 4H7MA 5FK7A 1AL21 2CGPA 3FMGA 3POGA 3TNQA 2QFEA 3ZM8A 3ME2A 4C1WA 1IQDC 2RDSA 5LASA 4F8AA 2JDMA 4AF9A 5FIXA 4XAAA 1POV1 4K20A 4NROA 2V4VA 5ABJA 3J8F1 1HJGA 4PQQA 1C3HA 3WNNA 3W5MA 4OZOA 5LK5A 2P1BA 3LSEA 1EP0A 5LA0A 3NKGA 3RI8A 3VZJA 5L7OC 3WR0A 5FP8A 3U75A 4Q4Y2 3OD4A 1VBC2 4ZHNA 3OGRA 1GICA 2R073 2VQUA 2WAAA 2W92A 4GH4A 3ZN6B 1FPN3 2A70A 1H9PA 4Z1VA 4DY3A 5KBFA 3LEKA 5GZDA 1HRV1 5FY5A 3K3OA 2WLQA 2QQIA 3AP7A 5FZ1A 5A3NA 3IWZA 1W90A 1YQCA 4QU2A 4Q4Y1 4XEZA 5CFDA 2JG9A 1VBC1 2W2IA 3HR9A 3LPFA 3AZYA 2JG8B 3ELNA 2BNMA 2HYKA 5FOBB 5KC5A 3AMPA 1VBB1 3ON7A 5D21A 4YARA 1VB2A 1KEXA 1NXD1 3M3IA 4GMP0 3N9QA 3T09A 1OLMA 4LPLA 5JSOA 1ULOA 1SMVA 4UF0A 2XHNA 3P3NA 5IK8A 1HQLA 1RYYA 1HV0A 2V4AA 5IK4A 2O14A 4Y3OA 2XVKA 3NAPA 4KG0A 5SV5A 3NSTA 1KFXL 5DUVA 4COYA 2G9FA 1A78A 3JQXA 4BB3A 1EAH2 4XMIA 1JZ5A 4KWUA 1B35A 4GJYA 1MS1A 5IAVA 5K0UC 3DPRB 3I2KA 2XLFA 2VGDA 4EZ4A 4CDUB 1TMF2 4K8FA 3WQ1A 4CZSA 3CNAA 5M0TA 2FDKA 1XNAA 2WZR1 1RMU3 1LGNA 2H0VA 2Q1FA 3D5OA 3KGZA 4K1ZA 2Y6LA 4WVWA 5DZEA 4FTEA 1PO12 5A7OA 1K5JA 4QX3A 1DFQA 3OCPA 1XE7A 4YM3A 3RS6A 2G19A 3PUIA 1VMJA 4PIZA 5F3EA 2VCBA 3OEBA 4CP9B 2D6OX 5DZGA 1STMA 1F15A 1EAH1 3O1PA 4XF0A 3CU7A 2X29A 3PHMA 4N43A 1QOOA 5J98B 1COV2 1AR92 2B5HA 4HN0A 3PLQA 1CPMA 2V09A 1I9RA 1XU1A 1YYNA 1W9WA 1M4WA 5C8CC 1Y7BA 4RN5A 1REFA 4IEWA 1X9TA 2BWAA 2VW0A 2CDPA 4BE3A 4JAAA 2WT2A 4M0NA 5DXDA 3WG2A 1HIXA 4YZ4A 3T0BA 3OGSA 5BNQA 1W6QB 1TG7A 4BQ1A 3VBOC 2WDBA 2Y8KA 4B4PA 1JYIA 4N7IA 3HNYM 2YBPA 3WCSA 1ULGA 3NMBA 3R4UA 2OIIA 4LK6A 5L9BA 1AR91 3EO6A 4HPKB 4GWJA 4LBKA 3W9AA 4I0AA 2JECA 4P9LA 5E1RA 2Q8CA 4C0HA 3M2MA 2PTMA 4YGDA 1Q5OA 1PX3A 3CJIC 4YW7A 3ZMOA 4K21A 2X05A 4P08A 2ZHMA 1SPPB 1LGBA 3RFRA 5JZGB 5I0SA 3R4DB 3SLIA 4OHYA 1REEA 1XXNA 2GMMA 5A7WA 5HCAA 4HONA 1S55A 5JI7A 3MZHA 3I4IA 1NCQB 3NW4A 2J1AA 5L19A 4LO6B 4S2FA 1VAKA 3T4VA 3VUOA 1QNYA 4EWEA 5AFBA 1H2MA 1LOFA 4CDQC 2X09A 1CAUB 2XBO2 2V5DA 2XB6C 2YGLA 3EMRA 2QJVA 3I3BA 4QX0A 4FPYA 3HD8B 5BYNA 4CEYB 3O12A 1PIV2 1Z7S2 4JX0A 3WQ7A 5LBBA 3WVJA 2QQJA 5FZ9A 2NYYA 1QGLA 2GNDA 3WP3A 5FPZA 4G3YC 5IATA 2UWCA 3IN9A 3WNXA 3H3ZA 1UYYA 1U5ZA 1V6JA 5BPXA 4CPBD 4FO9A 5HV4A 5FYMA 2XBO1 2E63A 3DYPA 4UBGA 2WBKA 4AQSA 3ZSKA 4ISRA 2A6WA 2B45X 5FAXA 3KT7A 4BLJA 1FXZA 2Y0OA 3THPA 2VNVA 4LXLA 2IFRA 3N9OA 4HL0A 1Z7S1 3JCIA 2R043 4XJZA 2RR12 2HJIA 1NAEA 1JOBA 1W2OA 4K40A 1DGWA 1XJAA 2EIEA 2WNVB 5C9AB 4I0WB 5LCWL 5DAPA 4YGBA 4J6GA 3JBG3 3VBFA 1OI6A 1RUJ3 4GWIA 1J1TA 2XUEA 3O0XA 4V1PA 1H30A 2WO2A 4XFCA 5FBZA 1SLAA 1H8VA 5DQ0A 3ALQA 4Y22A 4Y5Z0 3H8XA 1AL23 1GZWB 3QACA 4QPGB 3ES4A 2JICA 1UYPA 3U07A 2RR11 4PI0A 2VOWA 2ZGQA 3POIA 3TN91 4E8DA 4GULA 4D6RA 2X5IC 2Q1ZB 1POV3 4HMZA 1QY4A 3AXEA 3ILFA 1O8PA 3J8F3 3W59A 5LY1A 5C3SA 5KXDA 3I2HA 1WMXA 1D4M1 5ERLA 3FE5A 3VDDC 3WG3A 2OQ7A 5ANNA 4MOAA 2YFZA 4AHXA 2QQKA 2UY8A 2Z5WA 3MIEA 4AQ2A 2ZX4A 5TSWA 4XETA 3ACIA 4O9EA 1QIQA 4FQ4A 1DZTA 3DXTA 1BKZA 5H9PA 4YVWA 1ZRRA 1S0BA 4CE8A 4M3CA 1KS4A 2WA3A 4XBNA 2A5ZA 2N7GA 4LKEA 1HRV3 3HAGA 3WZ1A 2DCKA 3ZFGB 3FBMA 2ZEZA 3TNPB 1MS3A 5F5AA 2D5HA 3KD4A 3LIGA 3WW2A 3I3DA 4Q4Y3 4L99A 2FDFA 1V6NA 2W87A 4AEKA 4CPBA 3POYA 1J58A 1VBC3 3Q8BA 4PCRA 4X8PA 4NHKA 1S0EA 4XBQA 1YHFA 2I2SA 2ZZQA 3ILRA 2WABA 3VZKA 1VBB3 2LTNA 1GOGA 1A8DA 2IVJA 2JB8A 4R9BA 4WVVA 3FHIB 2R7EB 2H6BA 4BH9A 1CAVA 3VBUC 1W8WA 4IEPA 2JG8C 2NQYA 5J96B 2L9LA 2DFCA 4P02B 1W9TA 4QPWA 2V5YA 5EYYA 3BU7A 3VKLA 2ES3A 2BGPA 3WT3A 1XNKA 4A3XA 3ECQA 3VL9A 1OD3A 1U5XA 4KL1A 4BJ0A 1L7RA 4IERA 4Q8KA 3V0AA 1PVC2 1UY3A 1QDCA 1J83A 4UW5A 2WZR3 2Q0AA 1RUC2 2KA3A 4LIVA 3CJXA 4WM8B 3NKTA 5FYTA 5FWJA 2BBVA 4LBOA 4NR1A 4P5HA 4UFMA 4XC9A 1UMZA 1KS5A 2JD4A 4YW5A 3I49A 4FPOB 4Y26A 2ZACA 4Z82A 2J1RA 3IBMA 1SHWB 3PTYA 4KU7A 4DXSA 1EAH3 2FMYA 3K75B 4CA9A 4COWA 1CX1A 2PHLA 1UU5A 4V2VA 4XE9A 3AYDA 1PVC1 1TNFA 1UF2C 3WF0A 3PUQA 4FP2A 3EJKA 2WQ4A 5F6LB 5IUQA 2A3XA 3VD7A 3WOGA 1XPWA 2W1UA 5IAXA 1W9SA 4IEUA 4PHZA 3T3YA 5BNOB 2BOIA 3O7OA 4L92A 5FY4A 1PNFA 1YFUA 2JDYA 5FZ7A 4C90A 1K3IA 2AEYA 3AMNA 1OVSA 3J26N 1IS6A 5F9TA 2C24A 3A4UA 5F6KA 1MS4A 3HPNA 1F5FA 1ND3B 4QDRA 3WDTA 1AR93 3FUQA 3FFZA 4L9BA 3UKVA 1W6MB 1WLWA 1NE6A 1RUF2 5EPAA 3MIGA 4FPJA 3MW4A 3ZFEA 2ORXA 2W08A 4AAXA 3KGLA 4OMCA 2FDJA 4AZZA 2C0ZA 1QXJA 1UYXA 1ZZ6A 3PJYA 5L36A 4FOQA 4W50A 1XNCA 2ZZJA 3LWCA 2OW4A 2WNUB 3AL6A 5DUUA 4NIGA 4HBNA 1GSLA 4UXAA 4JGZA 1U5IA 2WN3A 1RUF1 2Y6JA 4HZFA 3VBSA 1IG0A 3VKNA 1NA1A 1BVP1 2QQPA 5JZGC 4S2DA 1GZTA 3IAQA 1YQ2A 1C4RA 3OYWB 3EYPA 3PUSA 1LOAA 1VBE2 4ORFA 4XF9A 3WDUA 3PURA 1ND2C 2LUWA 2HH9A 5FO7B 4Y4YA 4OQ8A 4N53A 1LU2A 2OQ6A 3OBAA 1GNHA 1GKBA 3AMHA 3T2QA 1AR82 2VOTA 4WM7B 4B7KA 2HWF2 3GHNA 3S7IA 1ZZ7A 2VMDA 3P5BA 4L97A 2VVDA 1SZBA 2ZHLA 2XBO3 1E5SA 4G4FA 2DCZA 3H8UA 3IIIA 4CEYC 4GB32 1JYVA 4NHLA 4PF5A 1VBE1 1QWRA 3LDBA 1Q3EA 3M3EA 2JDUA 5A3UA 4JZRA 5J3UA 2YC2A 1Z7S3 2A6ZA 3I59B 2VMEA 1UXXX 5A1AA 1SBEA 3I2JA 1OUSA 1WMDA 2HWF1 3WUDA 1RVF2 4GQ7A 4HFSA 5I0TA 4A2UA 2J22A 2NM1A 3Q8EA 4ZY9A 4GXLA 2R6QA 5KHJA 4S2HA 5T5LA 3AYCA 4CUGA 3HT2A 1APNA 5C8WA 4E4DX 3MO4A 3MHZA 4GB31 1WGPA 2HEVF 2HWC2 5FY7A 3MPPG 4JQTA 2D6MA 4EYUA 1UMIA 5E8AA 4AGRA 1RHI1 2RR13 1GOFA 3TN93 2WNVC 3TBDA 2BVBA 5FUIA 5C9AC 1R092 3LAGA 4LOTA 4BQ5A 5KC6A 4Y20A 3SEEA 1RVF1 2IVIB 5LA2A 3WV6A 2AC1A 4MYEA 1D4M3 3RZKA 1D2QA 1MQTA 4AHWA 2DVBA 3ZYJB 5DAQA 4BWOA 3PTRB 4CEWB 3ZN4A 1JZ4A 3VN4A 2AEZA 4W65A 1W05A 2XH6A 2X8KA 4YLZA 1DLCA 5H9SA 4CCNA 2J1EA 5HCBA 1OUXA 5C3QA 2R32A 3H3LA 3Q8FA 3VBRC 3B69A 4YSFA 1RINA 1WMEA 4I02A 1R091 5GALA 2QQMA 4QXKA 3T08A 1RC6A 3AYAA 3MYXA 4X8NA 1POV0 5FR3A 5K7PA 3BN6A 3SH3A 4YFZA 3ILNA 2YU1A 4TLGA 2PHXA 1YRZA 5FMOS 2XLAA 3AP6A 4Y5SA 3N9LA 3GBFA 3E97A 2ZPXA 3WF2A 1QH6A 4DINB 1H4GA 3WDYA 1UZWA 2A3WA 2VXJA 3ZXKA 2VW2A 3CLPA 2GNBA 3VL8A 3BTZA 4I3PA 5FP3A 5DMYA 1QJU2 3ZFGC 3QH6A 3ORJA 1K5MB 4OUEA 1MS0A 5BNPB 5GZCA 2YROA 4Y24A 4XFAA 2FZ1A 3HOBA 1Y9MA 1OKQA 4Q4W2 4WVMA 1CJPA 3KQRA 4R52A 4AFAA 2BGCA 1CAWA 2ZEWA 4KWKA 4OMDA 4EWAA 4C91A 3TEZA 3WUCA 3ZFFC 3HJRA 5FPBA 3BKZA 3KHCA 1F8VA 1QJU1 3NJZA 5IK7A 3SC7X 3AP9A 1JUHA 2RE9A 2WS91 3H50A 1CGPA 4N9HA 4Q4W1 2GC1A 2KM2A 4FPGA 1NCRA 2E53A 1OA4A 3THDA 2ZABA 2VJXA 2YPDA 3WF1A 3D0JA 5JIUA 4LA3A 2P3KA 2C26A 3GJAA 4YW4A 4WM8C 1PVC3 3WP6A 3AX4A 1VP6A 1OOPB 5GJ6A 1UOFA 2XL7A 1LNSA 4PBPA 5JOYA 4P9GA 1MEC2 3IMMA 3ZMNA 2OPKA 1HB2A 5DZFA 3R6SA 1J59A 3A23A 4AL9A
chains in the Genus database with same CATH topology
2A7AA 2WKKA 2HWE2 2JENA 5FFOC 5A32B 1LB2A 3QCWA 3U0ZA 2A75A 1C8M2 3OF1A 4AEJA 1AYM2 4JTOA 4WV8A 2D3PA 1QJZA 4QQPA 4I2OA 3VBHA 1V9U1 1MEC1 3VKFC 1HQWA 3H1MA 5BNOC 1LEMA 2RS52 4IEQA 5CFCB 4OHXA 3DL3A 1W2UA 5LK7B 2KXLA 1G86A 4RQPC 5AC91 2JDZA 2HWE1 1ND3C 5C6CA 1MR5A 5DUWA 3JQWA 5J09A 4R9CA 1C8M1 1AYM1 4G9SB 4X6QB 4OI1A 3SITA 3T1MA 1RUF3 5BNNA 3KM5A 2RS51 1IZ3A 1DU3D 3AZWA 1RL3A 2TEPA 1DZRA 4H7LA 2WLPA 2ZGNA 4AGGA 4HK8A 4BIFA 2QDRA 2WNUC 5BY5A 5JOXA 5DDJ2 2UY9A 2D98A 3D82A 4CDXA 3N3HA 4PLNA 1ULDA 1PGW2 1CAXA 4EN0A 2BWCA 5HCFA 4ONUA 5AVAA 2ZGTA 2WQZC 3OY8A 1VBE3 1YWKA 4FP3A 5DDJ1 3HQXA 3MIDA 4EN9B 1SCSA 5EYXA 4FOVA 2ARBA 3B5LB 4N9IA 4NVPA 2JX9A 4HT1T 4ZKTB 3SH5A 1SFNA 2HWF3 1PGW1 3FWEA 1KDMA 5JI9A 3JD71 4BIOA 4GKYA 3ENRA 4GB33 1PZ9A 2NLRA 2FBEA 5D8AC 1ZNPA 2F6BA 1CN1A 4LA2A 1WA4A 5A33A 1RHI3 5EJ3A 3USSA 4AVBA 5L7OA 3IDBB 3HN1A 1U0AA 1JXNA 2ZHNA 4DNYA 1VLNA 1F5JA 1RVF3 1G9CA 5CADA 1RUI2 3GF6A 4LE3A 4MZUA 4URTA 4K3UA 4XF4A 2YGMA 3SCHA 4FPLA 5D1IA 1Y43B 3BTAA 1LOCA 4CP2A 2PYTA 3FLPA 2W68A 3KT4A 1R093 2CNAA 1EYBA 4XTPA 4CEWC 1W6OA 1RUI1 1R082 2C1FA 2AH2A 3AB0A 4E2SA 4D7YA 3SH4A 3GZAA 2O0OA 1MS9A 1F2NA 1MZEA 2PHWA 1RUJ2 3ZIWA 1RJ7A 2RMU1 1B35B 2XLGA 4D7SA 4BLIA 1JTZX 4LBLA 2XJPA 1R081 1JUIA 3QBQA 1GYKA 4Q0VA 5K0UA 4YG3A 3DV8A 4MLOA 1SEFA 1FV3A 1OQ1A 1DGRN 1FX5A 1S0CA 1BJQA 3KMHA 2ARXA 1QJU3 3SCGA 4HKLA 3E6CC 2WS93 3E6BA 1AX2A 1TEIA 3N35A 4JGYB 2A71A 4CRQA 3BB6A 4Q4W3 3MF6A 2Z2SB 1H0BA 5T52A 5C8CA 1FYUA 5CNAA 1HRV2 1ULCA 1KD7A 1LHUA 3H9AA 1AX1A 2OZ6A 5JSPA 1PGSA 5E16A 3AYEA 1KDKA 3VBOA 1QQP1 3BCWA 4TYSA 2EAKA 1H8TB 4YVSB 2E6VA 4Q26A 3FC0A 2CAUA 2ZX1A 4L2NA 2RS32 1O3QA 4AEDC 1VBB2 1FOD2 4UW4A 3AFKA 2DF7A 4WBBA 4P9YA 1ONAA 4NOTA 3PJQA 4AHYA 1M06G 3CJIA 1UAIA 4Y1ZA 5CG9A 3AK0A 1OOPC 1RITA 2OVUA 4PDWB 1KFUL 1V9U3 2G4IA 2ZGOA 5GLWA 1MEC3 4AI2A 2RS31 1FOD1 1S1AA 3PVNA 5JWPA 3FLTA 4QX5A 2VNGA 5AC93 2HWE3 2WZR2 1HDKA 4CDQA 2ZX3A 1C8M3 2ERFA 4FTSA 1AYM3 3NV3A 3MEPA 1D0HA 1LULA 3GALA 5CFCC 1UX6A 2ZX2A 2RS53 5T55A 3AZZA 1NG0A 4Y1XA 4XIKA 4QQOA 5CAZA 2D93A 1ZRCA 1W0OA 2DURA 5GM0A 3VV1A 1N1TA 4XJ9A 1S0DA 2VULA 1VAMA 2ZGMA 4P9JA 3HIFA 1SBFA 4BMEA 2DVAA 4M00A 1Y9QA 4IEVA 3GYDA 4YZ2A 3UJOA 2EIGA 3L2YA 4QD2A 4AQTA 1DG6A 1QJY1 5DDJ3 3NWKA 2NMOA 3ATGA 1HRI2 3N7MA 3P3PA 5BUVA 4ASMB 2R062 4TZDA 4XOGA 2X5IA 5C4WC 4NO4A 3JD73 4SLIA 4XJAA 1G6NA 4LO5B 3VDDA 1SDWA 1WBLA 3ZO0B 2NP0A 3BODA 3MIFA 1G9AA 5T5JA 4A7ZA 2BYVE 1HRI1 4RL7A 4F83A 2ZJCA 2R061 1X36A 1LJ7A 1ZA4A 3AP4A 2R16A 2PAMA 1I1EA 3CEWA 3FLRA 4GIQA 5CA6A 4XDQA 5FQ0A 3TB0A 3JUUA 3QH7A 2NPIA 3ZN6A 4H3WA 2ZCWA 1KQRA 1RUI3 5JOWA 4YYOA 1SACA 4HSLA 4AFDA 1MVQA 3AKQA 3ZXFA 1MZ5A 2LALA 4RGGA 2TNFA 5KXEA 3VBUA 1ZBA2 2P17A 2RMU3 3VHOA 1WBFA 4FOWA 5F1RA 2JG8A 4MXVA 1UZZA 1QXPA 4COZA 4D94A 2ZHKA 1QXRA 1RTVA 3DKWA 4XJ8A 2B9UA 1V00A 1R083 4Q0UA 3TN92 2RJKA 1TE1B 2PHFA 2A6XA 1H2KA 2ZX0A 5GLUA 2DVGA 2FZ2A 4XFHA 1BBT1 1ZBA1 1D4M2 2ET1A 4Q0QA 2BEOA 4K9SA 3G7DA 5I0UA 1KRIA 2E7QA 2ZMNA 3MLLA 1CR7A 4HANA 4YGCA 3E5QA 3H3UA 1NQDA 1RUOA 1KXGA 4LE4A 1HKDA 3UKTA 1D2SA 1AHSA 1UPSA 1Y3TA 3V0BB 2ZMLA 2A3YA 4HLTA 4AXOA 4K1YA 2D7FA 4KH9A 1I5ZA 2PLV2 1GZ9A 4JGYC 1VIWB 1ALYA 1QQP3 3SHRA 5SV8A 4N90A 2GDFA 3LA7A 2AREA 3MLJA 4RS5B 3I8TA 4P9XA 2XJUA 2ZTNA 1OQDA 4FAHA 1ASJ2 2YV8A 4HVRA 4XW3A 4AI8A 2WSUA 4CYDA 1C1LA 1W6QA 2PLV1 3WLUA 4M3CE 1SBDA 1H8TC 4Q1RA 1QU0A 4YVSC 5F5QA 3I7DA 3L2HA 1Z0HA 1NA1B 3EQEA 4HPKA 4S2GA 2BNNA 5JVVA 3RJRA 2RS33 4W6YA 2XJTA 1FOD3 1MZFA 1ASJ1 2UWAA 3AMMA 4ISQA 4MX3A 5ACA2 2HWD2 4XZPA 5JZGA 4XJWA 3O5SA 3Q9OA 4PDWC 2WT0A 1V6KA 2QKDA 4LO8A 4Z2WA 2WFPA 1QNWA 3WCRA 1ND2A 1X8MA 5FMOL 3U11A 5CBLA 4Q4V2 1LOEA 5JOZA 2XKOA 5ACA1 5GZEA 2JE7A 1CAUA 2QE3A 3HT1A 4IV1B 2HWD1 4KG8A 2OYZA 4QPIB 2D5FA 4CEYA 1CONA 2UYBA 4XJUA 4CP0A 5I91A 4Q0SA 1QF3A 3DPRC 4CDUC 1KITA 5L73A 4DFSA 2YUEA 4Q4V1 2ZGKA 2LM3A 1E57A 1YIPA 4AVAA 4Q0PA 1QJY3 2XKPA 1JOJA 1GQHA 2EXHA 1G7YA 1TME2 1GFF2 4HETA 5IK5A 1LTEA 1UKRA 3B94A 2WNVA 5C9AA 5KXCA 3DUIA 3HWJA 2SBAA 5FCCA 3RZZA 5I0RA 4DOUA 1AYN2 1JW6A 2DTYA 2GMEA 3INAA 4UW6A 4MH0E 5J7MA 2WNEA 3ES1A 3IPVB 2O1QA 4BYYA 1HLCA 2ZKLA 3GZUC 3RYKA 1OSGA 1OFNA 1IPJA 1TME1 1HRI3 4JV4A 4P9IA 4IETA 2C5DA 4GMP1 3LKJA 2QUOA 3ZXDA 3VBRA 2XG3A 2R063 4XPVA 1NZCA 1OPMA 2R1DA 4J1WA 1TNRA 1AYN1 4CDWB 2VH9A 3MW3A 3O0WA 4EWDA 2HEWF 2FMDA 3PVEA 3M70A 4YZ1A 4AFMA 3VLBB 3GBGA 5FREA 3M4FA 1R1ZA 4YW2A 4ES9A 5LRRA 5C33A 1NCQC 1XYOA 1TQ5A 1NLRA 4MGIE 1PMIA 5BXXA 3ZFGA 2X53S 1SLIA 4J1XA 2UYAA 3ZSEA 1PK6B 1V6MA 1YXWA 1MS5A 2MHFA 3E5XA 3ZFFA 3RG0A 1RHI2 5FTTC 4ITCA 3LB9A 1UU4A 4LBQB 3VHNA 5JDBA 3RSJA 2HEYF 3H0OA 2ZS6B 2OUJA 1PNGA 2CGOA 4IV3B 1BBT3 1IQAA 1ZBA3 5T5OA 2R49A 4OLLA 2DU0A 3EHKA 4DRVA 1ZZBA 3OGGA 2OA2A 1IKQA 4D7TA 2Q1MA 1YIFA 3VZMA 1WD3A 3T1LA 1OA3A 3MICA 4BHPA 4LEJA 3N7KA 4WM8A 4AVTA 1HV1A 2AUYA 2I07B 4B4QA 1CIWA 1D0GA 4LLFA 2GNTA 2G9GA 4QPGC 2YC0A 1QHDA 1MACA 3RPQA 3IM0A 3FUOA 4ES8A 2GC3A 1HXS2 4HN1A 4FPHA 5HXVA 4YZ5A 1O91A 5JSRA 1J3QA 2ET7A 2D44A 1PZ7A 4FOYA 2PAEA 3DGTA 2AZ5A 1I3HA 5BNOA 1FNYA 1DQ5A 4Q1PA 2PLV3 4RQPA 4XMAA 4Q29A 4RS5C 1HXS1 1ND3A 4Q2FA 1AR71 3KCYA 1W6MA 4L8QA 3QOPA 1UD1A 1ASJ3 4Z92B 2WS92 2DCYA 3K51A 4KU8A 1UIKA 1LR5A 4RR3B 2XVGA 3WDWA 2TUNA 4XF3A 2R30A 4C0BA 1BK1A 2WNUA 3GBWA 3FZ3A 3ASIA 3MIHA 5JPMB 3LSDA 3WW3A 1EV11 1WCSA 4FCAA 3OY8B 2XUMA 4TLFA 5ACA3 4FPKA 2D40A 3ACLA 1G8WA 2YZ4A 5B2GB 2HWD3 4H14A 3MFCA 3OYWA 1AF9A 3T2TA 4XBLA 2A73B 1AUYA 2VPVA 1AJOA 3AKSA 4HVQA 2CWMA 3OPZA 4Q27A 1RUG2 2GMPA 2W39A 4Q4V3 2A6YA 1RUH2 4IV1C 5JR7B 4QPIC 1V9U2 5A33B 2WC2A 3FJSA 4IEOA 4AYUA 4XFBA 1FATA 3LGRA 4JVAA 4Q4X2 3UJQA 5D8AA 3S30A 1PM7A 3I59A 1LESA 4BM8A 5AC92 5LRSA 5J36A 1RUG1 1ZM1A 4YG6A 3MPBA 1RUH1 3V56A 1AXKA 3GZTB 2GC2A 3B9IA 3VKOA 4Q4X1 5LEJA 1FI2A 1ZZ8A 3M3QA 3SISA 3WDVA 3RYPA 1YI9A 1TME3 5DG2A 3GNEA 5IT6A 2D6NA 4GMP3 3ZN5A 4YM1A 3RJ2X 2QZ2A 3NL1A 1GNZA 1Q43A 2XJVA 1AYN3 2VMIA 1QH7A 4LBMA 3PNAA 1OA2A 4XTMA 1F8VA 3OBRA 2FHRA 4JDNA 4CEWA 1XNBA 1OHFA 3TYJA 4MGZE 1NLSA 1LKNA 5I93A 3JU9A 1J3PA 1RGSA 2QCSB 2Y26A 2CTVA 3UK9A 3N4MA 5H9RA 4A7YA 5I8SA 1IKPA 5JPNB 4FPFA 1ZRDA 1DGRA 3G6JB 1W6NA 1MS8A 3APBA 5CU1A 4CDWC 3WG4A 5K0UB 4JDOA 1YJKA 3KCXA 4LO4B 4QQHA 2CWSA 5FLJA 1CVNA 1C28A 4W6XA 5FLHA 3UV9A 1DQ1A 2DCTA 4W6WA 2Q4SA 4JCKA 4A7KA 5BV6A 3JD72 1NOVA 4LBNA 3EBRA 4I30A 3ZYPA 4Z8BA 4QHBA 1HQNA 1AXYA 3M3OA 3AZXA 4I09A 2EAAA 2ZMKA 5FO8B 5CB7A 3RDIA 4N7UA 3AM2A 4WM7C 5ABJB 4NN0A 1N1VA 1OD5A 5C8CB 2AR6A 1PK6C 3OJBA 4OZXA 2VU9A 4C1XA 1FV2A 3ZYIB 4FTBA 1X50A 3VBOB 3VHRA 2XJRA 1YNAA 4AG4A 2IXJA 4LULA 1Z78A 2XPJA 1GQGA 4GH4B 1UCXA 5DG1A 4U2AA 4IV3C 4META 1Q56A 4KWLA 1VBD2 3AP5A 5EZWA 2AENA 3ZXLA 4AEDA 5CFDB 3THTA 2JG9B 2XJQA 2VUAA 4MXWA 1QOTA 2VQ0A 1WCKA 3LA3A 1OOPA 1H1MA 4JTNA 2RMU2 5T50A 1ZRFA 1V6LA 1VBD1 5CIRA 2WL1A 3D0SA 4O9GA 3BPZA 2O8OA 4R4ZA 3B01A 4ZU5A 4BZ4A 3NAPB 2IXCA 2UWBA 5KWRA 1RJ8A 1HXS3 2IXLA 2BFUL 2IXHA 2OZJA 1AR73 2MPFA 1W6PA 3B02A 4B8EA 1DLLA 3AXDA 5CFCA 5EWSA 3KT1A 2H6CA 2R0HA 2HWB2 1YLLA 2DVDA 1VBA2 1IPKA 5FOJB 2DUOA 4JRAA 1OFSA 4QQ2A 2MNGA 1C8NA 1XRUA 4DY5A 4N43B 1EV13 1R1A2 2Y0IA 1AR62 1K5MC 1LECA 2Q30A 1VRH2 2IXIA 2ZAHA 4TSVA 3X29B 5BNPC 5I8YA 1QQP2 4I0BA 4R8HA 4RR3C 1S0FA 1XQNA 1KJLA 3BOPA 2HWB1 1VBA1 3OTFA 3NVCA 3ZPYA 3V64A 5T5PA 3KZ4C 4LT5A 4H55A 5GLVA 4M3CF 3N7LA 1R1A1 1AR61 1WW6A 4CP1A 1AVBA 1C57A 5A3LA 3WD5A 1VRH1 4OHVA 3VDDB 4AHZA 1X8EA 3QLQA 3CF6E 2GU9A 2GH8A 4IQPA 1O5UA 5C4WA 2VUJA 1DGLA 2D3SA 1XE8A 3TWIA 1A8MA 1XNDA 4LLOA 2C9AA 4RHV2 2GN3A 2BTVC 1RUG3 2WT1A 1WW5A 2E7TA 1C5IA 1N3QA 4UW3A 4NWWA 5CVRA 1RUH3 1QJX2 1BEV1 2VNRA 4FPEA 3S6PA 5HBAA 2YPJA 5FQ0B 3ZVXA 4Q4X3 5KHKA 1EPWA 2BQPA 1ZYBA 4RHV1 4ZU7A 4HSJA 1DGWX 4PQ9A 4TWTA 4P14A 4YNIA 2PHTA 1QJX1