2R0HA

Fungal lectin cgl3 in complex with chitotriose (chitotetraose)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
b'MFHILRLESTVDLSEPLKDNGIIVFQSDKLDLEPSPNLGPTGIDNTNVNLINAKGDVLLHIGIRRRENAFVFNSIPYGESRGPEERIPLEGTFGDRRDPSITIFDHPDRYQIMIDYKTVYYYKKRLEGRCEKVSYKINEGQTPPFSDVLGVTVLYFANVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CGL3 lectin
publication title Structural Basis for Chitotetraose Coordination by CGL3, a Novel Galectin-Related Protein from Coprinopsis cinerea
pubmed doi rcsb
source organism Coprinus cinereus
molecule tags Sugar binding protein
total genus 41
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r0hA00
1ULDA 4YGCA 2A75A 5L73A 1AJOA 1LHNA 5KXCA 2WNEA 3UJOA 1DBNA 1W6PB 5EYXA 1HKDA 3V65A 5HCAA 3RMXA 2AGSA 2JDZA 3BOPA 2LALA 3JU9A 4BMBA 3FBYA 3ZXJA 4YFZA 2I2SA 1DQ2A 2ZGUA 5T50A 4FPGA 3MPPG 3ENRA 3POSA 4XMIA 3NV3A 3IN9A 4YG6A 1MS9A 5KXBA 1FYUA 2WKKA 2GMEA 4P14A 2ZMLA 3WHUA 5EYYA 2D6PA 3I4IA 5GLUA 1APNA 3R05A 2ZGOA 5DUVA 1QMJA 5H9QA 2ZA9A 2W39A 2ZGQA 1GICA 2DTWA 2E6VA 4RL7A 4FQZA 2JECA 1O4ZA 1W0PA 2E7TA 1F5FA 2V73A 2YMZA 1UZZA 2PHRA 1AXYA 1SLBA 1BYHA 1MVEA 3IMNA 3QCWA 3USUA 2GN7A 3ZXFA 2UU8A 4YG0A 5T5OA 2EXKA 1KJLA 1DQ5A 1KQRA 2A3YA 1IKPA 2ZGKA 4GALA 3VKLA 1SCRA 2CYFA 4LBQD 4P9YA 1N3PA 4FOWA 4DS0A 3U4XA 5JOZA 4YM3A 3NV4A 4ITCA 4PBPA 2P2KA 5GLZA 3WG2A 2ZGSA 4BOWA 1IS3A 1ZM1A 1O4YA 3B9CA 2KM2A 3AP9A 3ZXEA 1G86A 5JOXA 2ENRA 1WD4A 2NM1A 3ZYPA 1MACA 5T5LA 4FOYA 5JOYA 4P9WA 4YZ3A 4XJUA 2CNAA 1WLDA 2G4IA 3ILNA 2WT2A 1HDKA 1LGBA 1W6NB 2BQPA 1PZ8A 4M00A 2ERFA 1ENQA 1UZYA 5LK5A 1ENSA 1ULFA 2ARBA 1J1TA 1FV3A 3HMYA 3RG0A 3DUIA 4DRVA 3V0BB 2AENA 1N1SA 1BXHA 2ZKNA 1YI7A 4FPHA 3KQRA 2EIGA 5H9SA 1X50A 1CIWA 3GNEA 4Y1XA 4MYEA 1S0IA 2D6OX 3OPZA 3N7KA 1SLAA 4YGDA 5JMCA 1SBDA 2A6XA 1SFYA 5DZGA 2DYCA 1VAMA 1ENRA 1DHKB 2JE7A 2WQZC 3D4KA 2DVFA 3PVEA 1VIWB 2D6LX 1V6OA 3O12A 2ZBJA 1WCSA 2HYKA 2UURA 3A0KA 4LBLA 3ZYRA 4BM8A 4YW4A 5KXEA 4XHBA 1W6QB 3MW2A 2ZGNA 3N35A 2DVAA 4U2AA 2E7QA 3W58A 3AYDA 1QNWA 4XYXA 4K1ZA 2D7FA 4XTMA 1C1FA 4M3CE 3POYA 2GMPA 4U36A 3AXEA 5CNAA 4AGVA 2AUYA 2DUQA 3WNXA 1MS0A 4XJWA 2NP0A 2GNMA 4YZ2A 1DZQA 2YZ4A 3B01A 1QDCA 3FLTA 4FPLA 4Z8BA 5DZFA 3WG4A 2C9AA 2EF6A 4PQ9A 2W68A 1H30A 1JUIA 2CL2A 4XJZA 4FP2A 1MS8A 3N36A 1UMZA 4YM1A 5H9PA 3VKMA 1PZ7A 2R0HA 1HQLA 1KDKA 2P34A 4ISRA 1V6JA 3NWKA 3INAA 1QU0A 1UN1A 4BLIA 1YYNA 4XBNA 2R16A 4Q26A 3ZSJA 5AVAA 2WSVA 2D3SA 4L8QA 4XZPA 1QOSA 4M3CF 3ZXLA 3OYWB 1LOCA 1BKZA 1LU2A 2WT1A 3B69A 4Y1YA 1RINA 1GBGA 2PHFA 2RHPA 5T55A 1D2SA 4K21A 3AJZA 1ULEA 4LBQB 1CPMA 4FPYA 1V00A 1Y7BA 5GM0A 4YZ1A 1UKGA 4XDQA 2OUHA 3A0NA 2D6KA 4AVVA 1CN1A 1MVQA 4WVWA 2XG3A 1W0OA 3UJQA 3WDWA 5DUWA 3N7LA 2P37A 5CB7A 4C1WA 2C5DA 3T1LA 4OZXA 1CPNA 2Z42A 4YG3A 3HR9A 1UX6A 1VAVA 1DQ6A 2A3XA 4SLIA 3Q9OA 1JBCA 2UWAA 4AGRA 4CZSA 4R9BA 3WHTA 3M1HA 3OY8A 3C2UA 3I8TA 4JCKA 5GLVA 1LGNA 1DQ4A 2EXHA 4RA0A 1KRIA 1DYKA 5JDBA 2UWBA 3BODA 1LGCA 2A6ZA 4XOGA 1MZ6A 1A3KA 1AXKA 2SBAA 5BYNA 1I1EA 1LOFA 1FNYA 5GJ6A 1WBLA 2FMDA 3VV1A 3PMEA 1XQNA 1LHUA 4FPEA 1IS4A 2VU9A 5KXDA 5GZGA 2A70A 2YV8A 5DG2A 4CTEA 3ZSKA 4Q8KA 2R1DA 3H0OA 2DWRA 1G7YA 4GKXA 1OQ1A 1OKQA 2XB6C 1IKQA 4K1YA 1G9BA 1PZ9A 4LBNA 4Y1ZA 4YM0A 1RIRA 2CY6A 2DURA 3M3OA 3O0WA 4FQ4A 4Y24A 1JYIA 3PJQA 3AP5A 3TB0A 3V64A 2ZGPA 3IPVB 3FUOA 1LJ7A 4Y1UA 5T5JA 4JRAA 3OJBA 1AJKA 3MW4A 5EXOA 1LHVA 3WUCA 5FREA 1LCLA 2ZHKA 2W52A 2DU1A 2A3WA 3V0AB 4FOQA 5JLVA 4YW1A 2ZHMA 1NXD1 1LTEA 3LSDA 4XXPA 2P3KA 1G9AA 1LENA 3O0XA 4PBOA 1LESA 5FRAA 1QF3A 2Q5TA 1GYKA 1S0EA 1KITA 2WJSA 1V6MA 2GN3A 5T5PA 4LBQA 1Q8VA 3RS6A 1QOOA 1AX1A 4M3CB 1N47A 2UWCA 2PHUA 1Z0HA 5DZEA 1B09A 4XMAA 1GNHA 1F31A 3WDTA 1CQ9A 5GZFA 1URXA 1W6PA 4UW6A 1Z78A 4JC1A 2ZGTA 4NO4A 4YLZA 3BIWE 4Y22B 4Q27A 2TEPA 2A7AA 4ATFA 5CA6A 3WCRA 5IK7A 1EPWA 1SCSA 4DRRA 2EXIA 5F9TA 3WZ1A 5HCBA 5IK8A 2A6WA 1WW5A 1GLHA 1JN2P 1N1TA 2FHRA 5IUQA 2VXRA 3ATGA 4YW2A 2ZABA 2OW4A 2AR6A 2WT0A 5IK5A 1R1ZA 3DGTA 1SLLA 3N7JA 3FFZA 2ARXA 3SNMA 4GKYA 2GNBA 3AX4A 4WV8A 4XBLA 1WLCA 3AFKA 4XE9A 2ZMNA 1MS3A 2VUAA 4W65A 3MEPA 5F5QA 1Q8SA 2GALA 2W08A 2DVBA 1C4RA 2DTYA 3VKNA 4Q1RA 1H9WA 3ASIA 4M01A 1Q56A 3AYCA 3O5SA 4NOTA 4HL0A 3O0VA 4UW3A 3ZSMA 1UAIA 3WDUA 1GZCA 1WUVA 3AZXA 3WCSA 3USUB 4ZKTB 4TYSA 1DQ0A 1QOTA 4YGBA 4K20A 5E8AA 3M2MA 5E89A 1MS5A 3OBRA 1SBFA 2A6VA 3IPVA 4UW5A 4YFWA 4KBBA 3WUDA 4LBMA 3ZSLA 1S0CA 3WVJA 3CNAA 4I30A 4HANA 3RRDA 2VW1A 3UK9A 1SLCA 1SLTA 4AVSA 4XJ8A 1AZDA 1QNYA 3WV6A 1N3OA 1D0HA 1W6NA 4FPFA 1DQ1A 1GZWB 1MS4A 1ZA4A 2CWSA 3LCPA 4PCRA 3SH3A 2ZHLA 1LODA 1LU1A 1CONA 1JXNA 1LHOA 1QDOA 1WBFA 4DFSA 3V0BA 2EALA 4C1XA 1A78A 3AYAA 3M3QA 2ZHNA 1DGLA 2ZGRA 1FX5A 3FLRA 1GZ9A 1BJQA 3M3CA 2R1BA 1Q8OA 1LHWA 4XILA 2JD4A 1N1VA 1WW6A 4FP3A 3M3EA 2ZGLA 3WDXA 1VALA 3VKOA 1AF9A 3AP7A 1DLLA 3WG3A 4XJ9A 1IS6A 1WW4A 2WLQA 3AK0A 1FAYA 4BMEA 3VUOA 2NMNA 1LOEA 1A8DA 1WLWA 4LBKA 5H9RA 5DUUA 1DFQA 3W59A 1VLNA 1GKBA 1W6QA 4YW5A 2A6YA 4Y1VA 4WZFA 4BLJA 2P3IA 2DU0A 5CBLA 2DV9A 3HN1A 4XXAA 5IK4A 1H9PA 3AZZA 4Q1PA 1V6IA 1GNZA 1SLIA 5GLTA 1AXZA 4Q8LA 2JE9A 4AWDA 2A5ZA 1G9DA 1FATA 3WDVA 3B00A 4YGEA 1QKQA 3UL2A 3VKFC 1SBEA 1V6LA 1YRZA 5GZCA 4YZ4A 4YM2A 1W6OB 3WDYA 4UW4A 1AX0A 4IQPA 4AGGA 2AH2A 3SH5A 4DPNA 2GNDA 3APBA 1ULGA 3TAYA 1BZWA 2GNTA 2ZAAA 3SISA 3OBTA 5HCFA 1U0AA 1JW6A 3JUUA 4Y20B 3WLUA 1C1LA 2NN8A 2D44A 5SV8A 3RQ0A 2P3JA 1S1AA 4FPKA 4Q2FA 5EWSA 4XTPA 1CESA 2ZGMA 1NLSA 3OYWA 1YO8A 5GLWA 1AX2A 4D69A 2NZ9A 2ES3A 2R49A 2GMMA 4GWMA 1S0GA 1Q8PA 1HQWA 1N1YA 3AZYA 4FPJA 1LOBA 5DUXA 5T52A 5CAZA 4FPOB 1JOJA 1RITA 4XHXA 5IT6A 1GZWA 1LEMA 1MZ5A 2D3RA 2E51A 2CTVA 1G9FA 3AXDA 1V6KA 3ILFA 3MW3A 4CRQA 3SH4A 2D3PA 3ILRA 3OGGA 5GALA 1W6MB 2D6MA 4FPCA 3T2TA 2JKBA 4ZXKA 3SLIA 4LBJA 3AP4A 3PVOA 1UPSA 4YW3A 2YXSA 3POWA 3GALA 1G8WA 4GWNA 4FOVA 4R9DA 4BQ1A 1WD3A 2H0BA 3AP6A 4PF5A 5DXDA 1ULCA 4AYUA 2NMOA 2EAKA 4ASMB 4R9CA 1TEIA 2DVGA 4XBQA 4WVVA 3OY8B 3WOGA 1G9CA 3R4UA 2AYHA 1AVBA 1I3HA 2EXJA 1FV2A 2R0FA 3AZVA 5DG1A 1LECA 3LSEA 2VW2A 4AVTA 3FLPA 2GDFA 1ONAA 4DQAA 4YZ5A 2DVDA 1SACA 1JYCA 2VH9A 3D6EA 2OUJA 4GA9A 4GXLA 1DIWA 4ATEA 3N3HA 1YIFA 3AZWA 4ISQA 3SITA 3ZXKA 1QGLA 4H55A 1DYPA 2DUOA 2VW0A 3AYEA 3QLQA 1LOAA 2SLIA 3L2YA 2PHTA 1F9KA 3ZPYA 1LOGA 3AJYA 1W6OA 1CJPA 1BQPA 1JHNA 4XJAA 3NV2A 1GSLA 1LOFC 2D43A 3D5OA 3NV1A 4BPZA 1GV9A 5JVVA 2JJ6A 1CVNA 3RSJA 3T1MA 1S0JA 2VY0A 2ZACA 4FVVA 5JOWA 2B7YA 2OVUA 4Y20A 1CR7A 1IOAA 1V6NA 2YROA 1MS1A 2ZMKA 4F83A 2A71A 3V0AA 4TZDA 1WW7A 1Q8QA 4P9XA 3N7MA 1UL9A 3RMYA 2CWMA 1GANA 2V5YA 3KM5A 2NYYA 3ZVXA 5GZEA 4XIOA 1KDMA 2WSUA 2LTNA 3PVNA 1S0DA 5T54A 2ZZJA 1IS5A 2D6NA 2PHXA 3R4SA 1MR5A 1S0BA 4M3CA 4XIKA 5GZDA 1KJRA 1S0FA 2AREA 4Y26A 3FUQA 4R9AA 3WG1A 3BTAA 3B3QE 1LULA 2DUPA 1YXWA 2YY1A 4LBOA 1W6MA 1N3QA 1OFSA 4Y22A 2PELA 1LEDA 1HLCA 5E88A 3IM0A 2E53A 3A4UA 1C57A 3IKWA 1FNZA 2PHWA
chains in the Genus database with same CATH superfamily
2XJPA 2DDUA 4L0PA 3LWCA 1LHNA 2JIGA 4JRLA 1YFWA 2FDHA 5IYYA 2XH6A 3AKTA 1OF3A 4D6SA 1REEA 1W99A 2JDZA 2VVDA 2OZJA 2WZR1 3FBYA 2I2SA 2ZGUA 2RS52 3ENRA 4MGIE 4RN5A 3NV3A 4YG6A 3AVRA 4CUGA 2ZX0A 2GMEA 4QAWA 2ZMLA 4OI2A 4EWAA 2VMEA 5A6YA 2FCVA 2D6PA 1XXNA 3I4IA 5GLUA 3R05A 1VMHA 5H9QA 2ZA9A 4PI0A 1UZVA 3MYXA 2E6VA 5C9AA 3K51A 4FQZA 4XUNA 4O61A 3CJIC 3U14A 2RS32 3VHPA 3GJBA 2WO7A 2G19A 2PHRA 1NT0A 1BHGA 1MVEA 3VZMA 4ZZ5A 1NQJA 3LKJA 3QCWA 4JGYA 2UU8A 2DCYA 3HWJA 1KQRA 4BWOA 1RJ8A 1IKPA 3JCIA 4WVMA 5K9YA 3VKLA 2CYFA 1YQCA 4LO4B 3VBFC 1N3PA 1W3VA 1ZZ6A 2D97A 2FQPA 4XF4A 3T08A 4DS0A 1TMF1 3NV4A 5BNQA 1R083 2VMDA 2JG8B 1X36A 2ZGSA 3KT1A 4BQ4A 5FWEA 2JENA 5JI7A 1O4YA 4IE6A 2OA2A 5DAQA 2NM1A 1XE7A 5CG8A 5T5LA 4EN6B 5F1RA 5C7GA 1RVF2 2QQWA 3R0RA 3TBDA 1RHI3 3D8CA 4AEJA 4NIGA 3ILNA 4DY3A 4Q0SA 2WO2A 2XMLA 3JXSA 1XYNA 1QJX3 4FSJA 5LBFA 2X5IC 1ENQA 2WZPP 1KFXL 1UZYA 2WR9A 4JGZB 5LK5A 3GDBA 1IPKA 1FOD1 4B4QA 3LEMA 3N9LA 2XKPA 3OEBA 5FOJB 2H0VA 2ZKNA 4AVCA 2VTXA 4Z07A 4RR3B 3KQRA 5H9SA 2VZVA 2Y6FA 3OPZA 2VCAA 1W28A 3POBA 1SLAA 4AI3A 5JMCA 3ZXDA 1SBDA 2WABA 4HKLA 4B3NA 1GP4A 2A6XA 2PLV3 3GJAA 1YQ6A 3MIGA 2CGPA 1Y9QA 3D4KA 2RS51 5HCHA 1IG3A 2D6LX 5JXIA 2HWB1 3ZKYA 1V6OA 3O12A 1VBA2 1BLZA 1WCSA 4A41A 3VD4A 2HYKA 3A0KA 2OQ6A 1UQXA 5L9BA 5JSRA 5FAXA 2WBKA 3IMMA 2ZGNA 3MDPA 3THPA 1CZTA 4RD7A 2RS31 3LIGA 3W58A 4EE2A 3JB8A 4EV0A 5KHKA 1TE1B 1C5IA 1QNWA 4JQTA 4XYXA 4XTMA 2D7FA 3POYA 4FXGB 4CU8A 2K0GA 4URAA 3JD73 3LD8A 3E5UA 5FZ9A 3VDDA 2RDSA 2YZ4A 3K4AA 3VZKA 5IVBA 4FPLA 4E4ZA 3A21A 3WG4A 3KT7A 5L19A 3BYWA 2W68A 3C7HA 4XFAA 1JUIA 4FP2A 2J42A 4YM1A 4HONA 1W06A 3ZYIB 1PZ7A 1OC1A 2R0HA 3EXUA 3HT1A 3MUZ1 3ZMOA 2JG8A 3CKHA 1TME3 4ISRA 1KGYA 3WR0A 3CZJA 4Q26A 2BDRA 2D3SA 5CFDB 2BRTA 3OYWB 1LOCA 4IGPA 4S2GA 3B69A 4Y1YA 2RHPA 3AC0A 1D2SA 4R52A 2C4XA 1NA1A 1ULEA 2BOJA 2RS13 3SC7X 5A7WB 1K45A 3X29B 1OMIA 2FCUA 2JDKA 4N9HA 1YUDA 2E33A 1OOPC 2OUHA 1MVQA 3I97A 1W0OA 4HBNA 4GZ9A 5DUWA 2IXLA 3B94A 1JS9A 5CB7A 4ZU5A 4EROA 5JZGC 1CPNA 4Q4V2 4P00B 4UXAA 3W5NA 3ON7A 4NIDA 4OI0A 1W05A 1PMJX 5JR7B 4AEDB 4RS5B 2O1QA 1DQ6A 2YC4A 2VVEA 4SLIA 2W3JA 3Q9OA 4NIHA 1JBCA 1OPOA 2VM9A 1BCXA 2UWAA 4FFHA 2YG0A 1VAKA 2VMGA 2GC2A 1DYKA 1W8WA 2QJVA 5DDJ3 5F6KA 5FFOC 5IHRA 3LEKA 4XOGA 4PQQA 3OBZA 1L3JA 2SBAA 2ZAHA 1GWLA 3B93A 1I1EA 3GBGA 3J7NA 4CCNA 4TTGA 4PDWA 2YYOA 2QZ3A 5CIRA 2FDGA 1PIV2 1AR62 4QGLA 3O1VA 3VV1A 1XQNA 2XQXA 1ND3B 2VU9A 3FL7A 3LFIA 5F3IA 2A70A 5FY5A 5DG2A 5KR7A 5A7OA 4HMZA 1UCXA 1CIYA 3ZSKA 5A3TA 4RHV2 2EIDA 4K8RB 4MXVA 4QQLA 2RJLA 2XB6C 4K1YA 3KS7A 3T30A 2DBIA 4LBNA 1YWKA 3O0WA 5FK7A 3AP5A 1DG6A 2VZSA 3V64A 2ZGPA 2FZ1A 4OMDA 2VOVA 3IPVB 3WP4A 5T5JA 3ZYBA 4FAHA 2QQOA 3C7FA 1JTZX 3ZFFA 1UOFA 4IEYA 2D98A 2WZEA 4NE9A 2HWC2 4IEQA 1LHVA 3VL9A 4DUVA 3V0AB 1CAXA 2YU2A 4ZY9A 3C8XA 4KMQA 4X8PA 2VUJA 3LSDA 2KXLA 3VBHC 5L7OC 1XU2A 3R4DB 4QB2A 4UFMA 3D3AA 2WFF1 4LUMA 2CGOA 2JXAA 4N53C 2VQTA 3FZ3A 1PK6A 3FWEA 4IE7A 4P9LA 4CDUB 5A7WA 4QHOA 1JMUB 1AX1A 4IEPA 1I9RA 2W1QA 4AF9A 4LO5B 1AR73 3IZOA 1M06G 2BGPA 1BEV2 1RUD3 5IVVA 4XMAA 5CZKA 2Z4FA 2HWF3 4JDOA 5KC6A 4KBZA 1CQ9A 2B45X 4P5YA 1W6PA 4UW6A 3I49A 2Y6KA 3O1UA 1OQEA 3I2DA 2QQMA 2WAOA 4LE3A 4Q27A 1YI9A 3PTRB 5JWPA 5FK8A 4F3JA 2TEPA 1CX1A 1BBT2 2QCSB 1DCSA 3CJIA 1W9YA 4CDXC 5BNPB 5FZAA 4IL7A 5F2SA 1WW5A 2XDVA 2J1VA 4XAEA 3V56A 1JN2P 2V09A 5LB6A 3W5MA 2BPA2 4ARXA 2W47A 4Y4RA 3WNKA 1PIV1 2XHKA 4YW2A 1JZ8A 2R043 4PI2A 4YVWC 1NCRC 3VBFA 1SLLA 3FFZA 2ARXA 3SNMA 4XE9A 1PO22 4XBLA 5CKMA 2WC2A 3POIA 4QQPA 1S2BA 2ZMNA 4QU2A 2V4AA 4V2VA 4RHV1 3OGJA 2GH2A 5ACA3 1Q8SA 1UD1A 3A22A 3NNMA 1PVC3 2JD9A 3OEAA 4B4RA 3H3LA 4LO6B 2PQQA 4RFT0 3RYKA 4NOTA 3DN7A 4E2GA 5LW9A 1UAIA 1GMMA 2R063 4ZKTB 3USUB 2TUNA 5C8CB 1VBB3 4XF9A 1QOTA 2X09A 2VD7A 2XBO1 3J8F2 1RUC2 4DXSA 3LF7A 4YFWA 3IPVA 2ZX4A 1OXCA 4UW5A 1ASJ3 3OPWA 4LBMA 3PNAA 4HG6B 2KA3A 1CAUB 4I30A 3KSCA 2WINB 5J1XA 1R64A 1FMD1 2E26A 1O5UA 4QXBA 3RRDA 4JHZA 4C8DA 4XJ8A 2FDFA 1AR92 1HRV2 4XFGA 1N3OA 4AFCA 2IXIA 1YFXA 1FI2A 4IEWA 2A1XA 5BNOA 1W6NA 1DQ1A 1MS4A 2CWSA 2B9VA 4O9GA 4PCRA 5C33A 3WP5A 1XSRA 4IE5A 2J1TA 4GAZA 4BQXA 1LB2A 1QDOA 4AHWA 3V0BA 4LTAA 5FO8B 1HX6A 1BEV1 2ZHNA 3GXUA 4QD2A 2XWJB 4QB6A 1KD7A 1QQP3 5CISA 1GUIA 1BJQA 3M3CA 2R1BA 2ZOEB 3UT0A 3ZOIA 1XJAA 3WF0A 1LHWA 3LIHA 2E31A 1GWMA 1JYNA 4FP3A 5K4LA 1XU1A 2JWPA 1D4M3 5A6QA 3TN91 1AF9A 1IS6A 1SDWA 1AYN3 4GWIA 3VBOC 4AI8A 1O59A 2QE3A 1LRHA 1A8DA 2MNGA 3ETQA 4X6QB 1NOVA 3POEA 5FPBA 1GKBA 2QFEA 4UFHA 2DU0A 1UO9A 1H9PA 3AZZA 1NE6A 3N9NA 5M0TA 4AVAA 1HB1A 4AWDA 2A5ZA 1G9DA 4XF0A 3LOBA 5CU1A 5FZIA 4IE0A 1QKQA 4NPMA 3VKFC 5F39A 1GWKA 3H3ZA 3M7AA 4BQ2A 4QXHA 5I0UA 3VGIA 2VC9A 1Q5OA 4LA3A 1OVPA 5E1RA 5LBCA 4D7SA 3SKVA 2NLRA 3Q8AA 2VZUA 1IQAA 4Y4YA 4W6YA 3J8F1 1RUC1 1XNTA 4A42A 2GNTA 3EJKA 4K7JA 2HWD2 3ES1A 1COV2 5FPAA 4E8DA 4PIZA 1EV13 2RJ2A 1REDA 2D44A 4N9IA 5SV8A 2UY9A 1C3HA 1L7LA 5FZ0A 1OOPA 1H1AA 2B4KA 2PAEA 1DGRA 1GOGA 4ONUA 1AUYA 1ZNPA 4XTPA 1Z7S1 1R092 2ZGMA 3PUHA 2OIIA 1AR91 1HRV1 3S7IA 3U07A 2VCBA 1AX2A 2WN3A 4EJRA 3K48A 2NZ9A 4GJYA 4WBBA 4DUWA 3N4MA 4CU6A 1RMU2 1RUH3 4CA9A 1LOBA 4RYDA 4FPOB 1RITA 2P6CA 1X8MA 1ZA7A 2ZEYA 2WNUC 4LE4A 3ZM8A 4ZS3A 1I6XA 4XUTA 1Y4WA 2O8OA 2E51A 1U5ZA 1G9FA 1VBC2 3AXDA 3FBMA 1QHDA 3ZMNA 2UYAA 3L9JT 3MW3A 4K6BA 3DEMA 1J1LA 3CQOA 4FPCA 4BISA 5CEHA 2JKBA 4LKEA 4AAPA 3JBG1 3O14A 1UPSA 5LEJA 1YQ2A 3VZJA 3N9MA 3POWA 3TWIA 3VZOA 5IVEA 3GALA 4GWNA 1O7FA 4BQ1A 2WDBA 3B5LB 4KI5M 1FPN2 4RGGA 5FXVA 1SHWB 1ULCA 4BYYA 4MG2A 4HSLA 3M3IA 1UXZA 4BK4A 4B1LA 4A7YA 1TEIA 1YQ5A 3U4SA 4BJ0A 3RZLA 3B9IA 1AVBA 3PUAA 4XC9A 3NL1A 4KH9A 1BVVA 2LUWA 4E2QA 1OFNA 2R0FA 3VD7A 3RYPA 1LECA 2QDRA 3LSEA 4QX2A 4XVHA 2GDFA 3H7JA 1RGSA 2R32A 4DQAA 2DVDA 3NW4A 2VH9A 2OUJA 4ATEA 4DINB 1DIWA 1UU5A 4EWDA 5L36A 1YIFA 4Z82A 1XPWA 3ZXKA 5F37A 2B5HA 5K0UC 1H6YA 4UFKA 1T6BX 2SLIA 3K77A 3L2YA 3IDEA 1F9KA 3KF3A 1LOGA 5JSPA 4FFFA 4HVQA 3VBHA 5C9AC 2LROA 5L7OA 5J7MA 1GSLA 1LOFC 5CFCB 2D43A 4BPZA 4QKNA 5FWJA 4N53A 1S0JA 2VY0A 2ZACA 4FVVA 4MZUA 4A2UA 4XF1A 3MV01 1IOAA 2YROA 3BPSA 4TZDA 2Y0IA 5JPNB 3AKRA 1WW7A 4P9XA 2WWUA 2P6HA 1JU3A 3K75B 4P9JA 1XNBA 2ET1A 3ZVXA 4Q4Y3 2PMWB 4QX3A 1ZZ7A 5CKQA 2W91A 1MZFA 5IFPA 4M4PA 4WZCA 5FMBA 5FP4A 1VBC1 2PHXA 4M3CA 4LKFA 1KJRA 1S4CA 4CDXA 3HBZA 2CSGA 4Y26A 2WN2A 3IDBB 2RDQA 1OA2A 3OGVA 1W2UA 2YY1A 2Q4SA 1QEXA 2XONA 2R30A 1MQTB 3NJVA 5E88A 1B35C 4UF0B 1NCRA 2ERFA 4N43C 3TEZA 3WD5A 2A75A 3DL3A 1XNCA 3WT3A 1MEC1 2EICA 1FPN1 1AR81 2WNEA 1SZBA 3I3QA 4QPGC 4UFLA 3SKJE 3V65A 4OZOA 4A6OA 5HCAA 5K8SA 5A33B 3JZVA 4Z92B 4XURA 3U4XA 2BYVE 1CAVA 2CGNA 4AQ2A 4A44A 4JAAA 3HT2A 3NAPA 4BMBA 1DQ2A 2RE9A 2VMCA 2VNRA 3MHZA 4DXTA 1K5JA 3CEWA 1MS9A 3J9SA 4P14A 2RR13 3G7DA 5EYYA 5A1LA 2Y38A 1APNA 1JYVA 3UGGA 2ZGOA 1YEWA 1QMJA 1NUKA 3PMSA 2W39A 2W1SA 1OHFA 2EIEA 2DTWA 4RL7A 4EWEA 2JECA 1O4ZA 1QJX2 1W0PA 1NZCA 4NWWA 1F5FA 4OQ8A 1UZZA 5LA0A 1GNYA 4NIIA 3VBSB 2R073 2Y64A 2HBTA 4X6RB 5DAPA 2BBAA 4A6SA 3EMRA 3PL0A 4YG0A 5T5OA 2FZ2A 2EXKA 1IGOA 3IIIA 2A3YA 4X8NA 4FAGA 2Q0AA 5BXXA 1E5HA 4GALA 4XFIA 3H50A 1C8NA 2MEV1 1XOYA 1V70A 4UI9L 3ZXAC 4AFAA 5A80A 2Q8DA 4RGKA 2PLV2 4IW3A 5FP9A 4MHUA 4PF1A 2P2KA 1POQA 3ROUA 3ZFGB 1KFUL 3MF9A 4DXZA 5LCWL 2QNKA 1PGW1 1IS3A 1ZM1A 3BTZA 4ZXEA 5JOXA 2ENRA 3E97A 1DDLA 3NNJA 1WD4A 1VBE3 1MACA 4FOYA 4Q4W2 2P5BA 4HN0A 2ADDA 5JOYA 4AR2A 4GB33 1OLQA 5A32A 1YJKA 2JG8C 1AHSA 1WLDA 2XLGA 4QPYA 5L9RA 3E6CC 2P3YA 2G4IA 2O0OA 2XGXA 4OHXA 3VBOA 4UOJA 1C8M1 1LGBA 4ZHNA 2HJIA 5D8AB 1PZ8A 1RUF1 4MGZE 4M00A 1WZXA 2RVAA 3UKVA 2WL1A 3THDA 2CDPA 3CBNA 5B4XA 1ENSA 1ULFA 1WWYA 1FV3A 3BVCA 3HMYA 5F32A 4K9SA 3DUIA 4DRVA 5FP7A 3ACFA 3KT4A 4WM7B 4QQOA 4GWJA 5FZ4A 1MQTA 3BTYA 1US3A 5C3OA 1CIWA 4IESA 3HEIA 4MYEA 4FTSA 2PFWA 1S0IA 2D6OX 3WW4A 5A1FA 2FDIA 1PM7A 4JGZC 3LQCA 5A33A 3DF0A 3MIEA 4QHZA 5LWBA 4KQ7A 4MGKE 3ITQA 1OKOA 4JKLA 1US2A 2VZ1A 4RR3C 2VBPA 4XPVA 4BIFA 5JIUA 4AQSA 5KXEA 5EP9A 1ZBE2 2P1BA 3KV6A 4ASLA 2DVAA 1VJ2A 5JR2A 2RS12 4BK5A 2ID4A 2E7QA 2GC1A 4Z2AA 4BHPA 4K1ZA 3GHMA 1WMDA 4XQWA 3VBSA 2RDRA 5JPMB 3WNXA 2DCTA 4A45A 1ODNA 2W87A 3MGUA 3ELNA 5LRRA 1RJ7A 1DZQA 3I3EA 3K3NA 5E16A 1NCQB 3WNPA 4Z8BA 4Y33A 1ND2B 2C9AA 5FPUA 1PO11 3Q8FA 2RMU3 3NNFA 2WNUA 2CL2A 4Q4X3 1O3SA 3IBMA 1JZ2A 1RUJ1 2P34A 1OSGA 3THTA 1QU0A 2O8QA 3N9PA 3WF3A 4Q4W1 4XBNA 3ZSJA 5AVAA 4JTOA 4CEWB 1QOSA 4ZZ8A 2YC2A 1GBGA 1QJFA 3TRSB 4K21A 1QXRA 2WO1A 1CAWB 1CPMA 1V00A 4CCKA 4YZ1A 5A3LA 5F6LB 5HBAA 3OB8A 1UWWA 3A0NA 4QKBA 3EHKA 2C1FA 2YB7A 2QVSB 5CFDC 3MIHA 2P37A 1I5ZA 1K5MB 2C5DA 1C28A 1EAH3 1HRI1 1PK6C 1OD3A 2QBXA 1UX6A 1SDDB 3NO8A 1TNFA 1VAVA 1XE8A 2QTWB 5A70A 1UY2A 4OUSA 4AGRA 1HIXA 2GC3A 3O1SA 1W0NA 3EYPA 2BW8A 2VBBA 3WHTA 1LGNA 1DQ4A 3H1MA 5K0UA 5FZ8A 1IG0A 1WKYA 4F7ZA 1ZRCA 2UWBA 4CXYA 1MZ6A 1A3KA 2GSYA 4RS5C 4DMIA 2QUOA 5FQ0B 1ZBE1 4AFBA 5LY1A 4GMP0 4HPKB 1S2EA 1LOFA 1ZZ8A 3S7EA 3DXTA 3GHNA 4KWJA 3PMEA 1O3RA 5KXDA 2BNMA 1RUE3 2MHFA 2N7GA 2VUCA 1AR72 4NJ4A 4B7KA 4D0QA 1W2AX 2E63A 4CTEA 2HWF2 1OQ1A 1UIJA 1IKQA 1TQ5A 4FCAA 1AYM3 1RIRA 4ZU7A 3M3OA 4PT6A 1ND3C 1DGWX 1O5LA 3PJQA 3ZYJB 2WS93 1ND2A 4GMP3 1OPMA 5IJRA 5F3CA 3UKTA 2YDEA 2V72A 2LW8A 2YHJA 1V9U3 2DF7A 2TBVA 4JRAA 3S6PA 3IT8A 1AJKA 2XXZA 3RNSA 3ZKUA 3BOWA 1JYWA 5B4NA 3AMPA 1LCLA 5DAXA 4AI9A 3M70A 1Q43A 3FHIB 1R1A3 1PX4A 5JLVA 1B35A 2R042 1NXD1 3H9AA 1W9WA 3LDBA 3KD4A 1HV1A 4N43A 4XXPA 3WXPA 4LHNA 4CEWA 4PBOA 1LESA 5FRAA 1NXMA 1QF3A 2PA7A 4QPGA 1NY71 3AB0A 3BB6A 2JG9B 1CAWA 5ACA2 2ZX1A 1QWRA 1QOOA 3WY6A 2BBVA 4GD4A 2GU9A 2WQ4A 4FFIA 3MUY1 2UWCA 2PHUA 1UX7A 3AMMA 5BNOC 5C3PA 1B09A 1POV0 3HNYM 2IXHA 2ILMA 1F31A 3S5AA 2R062 1XRUA 3DV8A 4JC1A 4NO4A 3QOPA 5APAA 2BV4A 2VNGA 4PLNA 3BCWA 4Y22B 4CDUC 1YHFA 1CZVA 2W0XA 3PDQA 4CEYB 4E9KA 5C4WB 3I54A 4NRMA 5I0SA 1OA4A 2CDOA 4W6XA 5IK7A 1QJZA 1H6XA 3U37A 4CVUA 4Y5SA 5F9TA 5HCBA 2QQNA 5IK8A 2A6WA 4M0HA 3AFGA 4YW6A 2FHRA 1H8TB 5IUQA 2LRPA 2VXRA 1VB4A 5FQ0A 5HV4A 1POV3 2OW4A 2VTXJ 1R1ZA 4P9GA 2WYSA 4D3WA 5BNPC 4CUCA 3AFKA 3ZN5A 3CLPA 3H42B 5ISLA 1UY4A 5JMOA 3OUJA 1VBD2 2B9UA 4W65A 5F5QA 4UWDA 5I8SA 4M0NA 3VKNA 1H9WA 3ASIA 4W6WA 1Q56A 5DPNA 4BIOA 1D4M2 4I3PA 5EQUA 4A7KA 3ZSMA 4JDNA 2VO5A 4WM8B 1GZCA 2G1MA 4Q0QA 1DYOA 5FYSA 3ORJA 5E8AA 2ORZA 5A7SA 5C6CA 5F7UA 3OBRA 2MPFA 4OUEA 4PIYA 1RVF1 5KBFA 3ACHA 3WUDA 3ZSLA 1S0CA 3CL1A 2R041 5G04L 1JZ5A 4IEXA 1ODMA 2VW1A 2J7MA 5C8CC 1QNYA 1XNDA 2C6SA 3WV6A 4COVA 1PHMA 4MH0E 2CV6A 5DAVA 1GZWB 4CUAA 1ZA4A 4QM9A 5GKAC 1JUHA 4JGZA 5A3MA 2WZR3 2YFUA 1WBFA 3HQXA 2EALA 5FP3A 1A78A 2I74A 3AYAA 3M3QA 1ZBA2 1OI6A 2HWE2 3B02A 1FX5A 5FUIA 1YFUA 4RR3A 2P4EA 4IEZA 3LGRA 2EVXA 1Y43B 1H4HA 2IZWA 4GH4B 4XILA 5FY4A 4CDWB 4C91A 1N1VA 2DCJA 5JAXA 2PHLA 3C7EA 3FHQA 4NUBA 1VBA1 1EV12 3AL5A 4XJ9A 5C4WA 3AK0A 2Z2SB 1KS5A 1UF2C 1REFA 3ACLA 1OH3A 3WP3A 3OBAA 4UFIA 1A34A 2ZEZA 3LA3A 3LA2A 4JKKA 2D5FA 5FZEA 4YW5A 4C1XA 4DY5A 4ES9A 2CHHA 2W94A 2ZX3A 1TMF3 4QM8A 5LBEA 3VDCA 4QX0A 1W39A 3HN1A 4XXAA 4KG8A 1YLLA 3DYMA 3P1IA 4PLOA 4AFDA 1SLIA 2X53S 1VBD1 4NPRA 1F15A 4XFBA 1WCQA 4I2OA 1FATA 5A3UA 1OF4A 5F3GA 2LS6A 3UL2A 1GQPA 2Y6GA 1SBEA 1V6LA 4BQ5A 5GZCA 1W8HA 3DXUA 3ECQA 3JQXA 4YZ4A 2RG4A 4YM2A 1W6OB 2X8KA 4CCLA 2J1RA 4QPIB 4D6QA 5BNNB 4K40A 1JYTA 1ULGA 4GULA 1BZWA 3SISA 3T2QA 1JYXA 3ST7A 3D0JA 5IWFA 1U0AA 4CXXA 2VMHA 4Y20B 1C1LA 3O1RA 5BPXA 1S1AA 3SXWA 1FOD3 2IWGB 1CJDA 4Q2FA 3VHNA 2WLPA 1HXS2 2HBUA 5CFDA 3U75A 4JV4A 1T6GC 1NLSA 3OYWA 3UYJA 2C0ZA 1E5IA 4D69A 2R49A 3PLQA 2GMMA 3LAGA 1S0GA 2QQJA 1Q8PA 1HQWA 1N1YA 5CAZA 5DUXA 1JOJA 4XHXA 4W50A 1GZWA 1LEMA 1YJLA 2RS53 3FC0A 4Q4V1 4DB5A 3PIGA 1QJU2 2HWB3 1ZBA1 2HWE1 4J1XA 4KWUA 4LO7A 3QH6A 4CRQA 3SH4A 2D3PA 2DCZA 2VMFA 3ZR5A 2YPDA 1TVGA 2A73B 4OI4A 1RUI2 1W2NA 4AEDA 1NE4A 2ARCA 4RS5A 4MXWB 3KHCA 4LQRA 2W2IA 2Q8CA 2X10A 2RS33 3IDAA 2J1SA 4E27A 3BIEA 4IERA 1S2KA 2QZ2A 4LLOA 4O65A 4Y5TA 4E2SA 1UY1A 2EAAA 1ZRDA 4R9DA 1RUG2 1TG7A 3AP6A 3FJSA 4PF5A 3T4VA 4OHYA 2VJXA 1AR61 4ASMB 4R9CA 2DVGA 5L9VA 4WVVA 1JU4A 1ST8A 3OY8B 5FKCA 3R4UA 1G9CA 1XNKA 1F8VA 4QX8A 1ND3A 4AVTA 2OS2A 4KGQA 4BA6A 1BVP1 4LA2A 1SACA 3A23A 3NAPC 4CDQB 2NQYA 3NJYA 3BU0A 4GXLA 4HZFA 4L11A 5BY5A 4CCDA 1LAJA 3OGSA 3SITA 3O1PA 1QGLA 4L2NA 2IVIB 3AYEA 2BNOA 2XR4A 1LOAA 5J36A 3AJYA 1W6OA 3RZMA 3C7OA 3OD4A 1BQPA 2FDJA 1JHNA 2E7AA 2G9GA 2RM22 3I2HA 2ZPXA 2HWC1 2AEZA 5EPAA 5AVPA 5FLIA 3D5OA 3NV1A 4LK7A 4O7XA 4AXOA 1GV9A 2FCTA 1CVNA 1X9TA 4NVPA 3ZFEB 5FUPA 2Y0OA 3I3BA 4G3YC 4Y20A 1HXS1 3VHOA 2ZMKA 3AM2A 4O9EA 4F83A 3V0AA 2A71A 4GIQA 1Q8QA 3HQRA 3KQ4B 4OLLA 5CFCC 2RR12 3ME2A 3P6BA 5LY2A 4NHXA 2DFCA 4XCBA 3BI3A 5GZEA 4XIOA 1KDMA 2LTNA 5FBZA 3ZIXA 4CDUA 4AHYA 1QJU1 1OA3A 3EO6A 3E1F1 3M8LA 4DO0A 1ENXA 1STMA 2HEWF 4CUBA 4LR4A 1S0FA 1RUI1 4R9AA 4IE4A 4S2DA 3BTAA 4NRPA 1IPJA 3TEXA 1YXWA 1BBT1 5FO7B 1BK0A 2VOXA 1N3QA 1OFSA 2HEVF 2YC0A 2PELA 1UOBA 3T2OA 2E53A 2QKDA 5HI0A 1FNZA 1EY2A 1RUG1 1ULDA 5L73A 4AG4A 4E8CA 5BNPA 1ULOA 3S5QA 3LZZA 4QDQA 1DBNA 5EYXA 5KXCA 3OGRA 3IAPA 4A7ZA 2VZPA 4QB1A 2AGSA 3Q8EA 1ZYBA 3JU9A 3SEPA 1MQTC 1PO21 4YFZA 3LPFA 5FYCA 5T50A 2W5FA 1X33A 1VBE2 4FPGA 3TEYA 4YYOA 3T3YA 3POSA 2VBDA 3IN9A 4LNVA 1FYUA 2WKKA 3WW3A 2JDYA 4JVAA 1W3XA 3WHUA 4GB32 2QQVA 5FYZA 4LT5A 2Y6HA 5DUVA 2ETEA 2ZGQA 3CZUA 4Z2WA 5FDBA 3AL6A 3B7MA 4CDQA 3QH7A 4XQ4A 2IXCA 1U5YA 2YMZA 4OFGA 4YNIA 1EP0A 4E4SA 1AXYA 1OT5A 1SLBA 2AC1A 3IMNA 3J4UH 1PMIA 1ZRFA 2RM21 2GN7A 3USUA 5C8CA 4P9IA 3RI9A 5FMCA 2WFF3 1KJLA 1DQ5A 3LEIA 1SCRA 2VGDA 4P9YA 1E5SA 4AK3A 1UW8A 4J6GA 3ZXGA 4FTBA 1CAUA 4HVOA 5F5CA 4INDA 5I0TA 3VBSC 3ZFEA 4AE2A 4YM3A 4YARA 5JOZA 4PBPA 1W03A 4YVSB 3WG2A 5GLZA 4A3XA 2IXKA 5C8WA 1D0GA 1YFYA 3FN9A 3B9CA 1HB2A 3AP9A 3U11A 1O3QA 1G86A 3I2IA 3ZYPA 5FMDA 4H14A 2JIJA 3A7QA 4F8AA 4P9WA 3VD9A 2YBSA 1KS4A 2CNAA 1QJY2 1PX3A 1VP6A 4XUPA 3ZFGC 3HPNA 2Q8OA 1HDKA 1K12A 3T0DA 2BQPA 5AFEA 1JOBA 1RXFA 1W8UA 4ES8A 1VRH2 5AC92 2ARBA 1J1TA 1J83A 4PLMA 4GJZA 2VZ3A 2ZS6B 1YI7A 3GZEA 4LORA 2RMU2 4PIXA 3BKZA 4Q4X2 5D8AC 3NMBA 3KGZA 3GNEA 2OYZA 4CSWA 3N7KA 3RGBA 1J3PA 3KF5A 3GZAA 2DYCA 2RV9A 5DZGA 1DHKB 2JE7A 1VR3A 2WQZC 4WM7C 2DVFA 3PVEA 1GU3A 3VDAA 3K2OA 1NQDA 4YVWB 2ZBJA 3KZ4C 5FXZA 2UURA 3ZYRA 4AHXA 3F2ZA 2XBO3 1CGPA 2LM3A 1OQDA 5J98B 1W9SA 1W6QB 5IVJA 3VDBA 4MGYE 3D82A 2WA3A 4U2AA 3AYDA 1W8TA 4B7EA 3VUOA 3NRUA 1FMD3 4MGTA 1AL22 2IFRA 4TXWA 2HEYF 2HWD1 5CNAA 1COV1 2QQLA 2WAAA 2AUYA 1HB4A 1I5PA 1TNRA 2F6BA 1EAH2 3AKPA 2GNMA 1F4HA 2AACA 2D40A 4XAAA 2BFUL 4ASKA 4YZ2A 2BNNA 1G6NA 3VHRA 1R091 4N8MA 4NRQA 1H30A 4Q5OA 1XYOA 3I2OA 1BEV3 4XJZA 1MS8A 1UMZA 3EB7A 2WNVB 4MADA 1RMU1 5KHJA 2Y60A 1OBNA 3MIDA 3NJXA 1H8VA 4MUVA 4YVSA 5DABA 1RC6A 3H1WA 1W04A 1V6JA 3MLJA 3NWKA 4NMIA 5FKBA 3RJRA 3INAA 3W9AA 2JDPA 1UN1A 1NCQC 2YU1A 1WLTA 2R16A 3MLKA 3TN93 1ND2C 4EN0A 4NN0A 3HJRA 1UMHA 4LXLA 3RWKX 4XFFA 1LKNA 4G4FA 4XZPA 4M3CF 1QJY1 3K4DA 2VECA 1BKZA 2WT1A 3VBUB 1SPPB 1RINA 4XACA 5T55A 3AJZA 3GZTB 4LBQB 3OUIA 1RUE2 5FYIA 1Y7BA 1H4GA 3PUSA 5IVYA 1U5XA 1VRH1 2OT7A 3RPQA 3VB9A 4A3ZA 5AC91 5A3PA 4XDQA 5JXHA 2D6KA 2Q8EA 2DFBA 4AVVA 4CEWC 4WVWA 2XG3A 3UJQA 1OVSA 3N7LA 3NSTA 3HD8B 4C1WA 1R082 3C3VA 3WP6A 3LB9A 5IFTA 2FMYA 4IGOA 3PJYA 5FZ1A 5ERLA 3H8RA 1JODA 2Z42A 3OPTA 4YG3A 4MO3M 2WS92 2JDHA 5FBJA 3R6SA 4K3UA 1IHMA 2FBEA 5ABJB 2OPKA 4IXLA 4NAMA 4QDRA 4WVZA 1QY4A 4CCJA 1ACCA 4R9BA 1EUTA 3M1HA 3C2UA 4LEJA 4JCKA 5GLVA 4FI9A 2ZKLA 4AHZA 4XETA 5DMYA 2WFPA 1K5MC 5HXMA 1RHI2 3ZSEA 5JDBA 4ZONA 1R1A2 3ZDVA 3J8F3 1RUC3 5FV3A 3USSA 2VR4A 3MFAA 1FNYA 3WNNA 2Y6LA 1XC6A 2XVKA 1J59A 1V0AA 3HVDA 1HJGA 3BALA 4OYUA 3RZKA 4RQPB 1NLQA 1BMV2 1AL21 3K46A 3ZLIA 5FYYA 1IS4A 1F4AA 1Z7S3 2V4VA 3ES4A 4HSJA 3ZR6A 1AR93 1HRV3 2VCCA 3OTFA 4N90A 4Q8KA 5FLJA 3VBRB 3H0OA 1KEXA 5A7NA 1G7YA 5CFCA 4AEKA 5LRSA 2CAUA 2XJRA 3GBFA 3I7DA 4A4AA 1G9BA 1P8JA 2VOTA 1W8ZA 4NPLA 4YM0A 2CY6A 2DURA 3I59B 3NVCA 4XEZA 5FXWA 4Y24A 1JHJA 4L97A 2VTFA 2BFUS 2O14A 1LJ7A 3CDZB 3KVBA 3KCXA 5FY0A 3H7YA 1O91A 2WNVA 3DYOA 3OJBA 5EFUA 5DN2A 2VZTA 3JBG3 4MHRA 2TNFA 3VD3A 2ZHKA 2GP5A 2W52A 3IWZA 4LKSA 2DU1A 3AKQA 2CU5A 2Q1MA 4NHMA 5BV6A 3LDKA 5IVFA 2IUWA 2K9ZA 3VZLA 3O0XA 5AC93 3RZGA 5HXVA 2BZDA 3C7GA 3JD72 1DU3D 2Q5TA 2WJSA 4QU1A 2GN3A 4LBQA 1Q8VA 1ZVFA 3UNPA 4D7YA 1ZZ9A 2IFWA 4YSFA 4JQRA 2ET7A 4UF0A 1N47A 5IATA 1H1IA 1R081 4HFSA 1Z0HA 5DZEA 3NKTA 2PAMA 3ZN6B 1GNHA 2Y34A 4FT8A 3ZIWA 3NQHA 1URXA 4XFHA 1CD3G 5GZFA 1Z78A 5F5AA 1TME2 2YFZA 2ZGTA 5C3RA 1O8PA 2JG9C 4HOOA 3MI8A 2GAUA 3MIBA 3J26N 1XB9A 1W2TA 3EQEA 5ABJA 1UY3A 2YUEA 4MX3A 4IGQA 4ATFA 3WCRA 5CA6A 3DPRB 4DXRA 1EPWA 1RHI1 4R8HA 4QHBA 2EXIA 5JI9A 4IEUA 3OD0A 5IAXA 3RFRA 3HIFA 1N1TA 1QJX1 2XUMA 4XFCA 4UBHA 3ATGA 4JX0A 5C4WC 4AI1A 1D7PM 2WT0A 3DGTA 2VOKA 5EIYB 4D8MA 2WYFA 4GKYA 3AX4A 2V5DA 1HV0A 3P3PA 1O8SA 3FX3A 4HKOA 1FXZA 4ORFA 3AVSA 2FDKA 5J09A 3MICA 4OULA 4PJYA 2W08A 3H8XA 1C4RA 3ZDSA 2PLV1 5I8TA 4Q1RA 4NIAA 3AYCA 1SFPA 5FJHA 2JDAA 4LK6A 1PMHX 3JB4C 1JZ7A 1WUVA 5I0DA 2CAVA 4Q0PA 4JGYB 5DDJ2 4C90A 5JCTA 3ZFGA 1DQ0A 1W2OA 3GZUC 2VUDA 4K20A 3M2MA 4QKFA 3VZNA 1MS5A 1ZZCA 3H3UA 5FCCA 1IZ3A 1SBFA 2A6VA 3VD5A 3RZZA 4KBBA 1NZIA 2OKXA 3WVJA 1H1MA 2AZ5A 2PHDA 4WM8C 2B42B 2BVVA 2VPVA 2XVLA 1SLTA 1S55A 4FFGA 1AZDA 4QKDA 1MEC3 1FPN3 1AR83 1D0HA 5FZ6A 1GFF2 2W46A 4JHTA 4FPFA 2F17A 3JD71 5CVRA 3OOXA 4JKMA 5D8AA 1SQ4A 5LA9A 4BU2A 2XPJA 3J7MA 4HT1T 2ZHLA 1LODA 5JSOA 1LHOA 3WINE 2JB8A 4DFSA 4WM7A 2KD7A 1OUXA 1DGLA 5A3NA 2VZRA 1GZ9A 3ALQA 3WSOA 5FLHA 2BTVC 3WQ7A 1TME1 1OD5A 3KWVA 2J1AA 2JD4A 2XJTA 3M3EA 1IPSA 2ZGLA 3WDXA 1VALA 3MLLA 4AQTA 2VE1A 2GC0A 1DLLA 3AP7A 4B1MA 4CU9A 4NHYA 4S2HA 5J37A 3UETA 5FYHA 3L2HA 1ZRIA 1RXGA 4GQ7A 5A3WA 5BUVA 2HH9A 2WLQA 1E5RA 1FAYA 4IV1B 1H0BA 1X7NA 4LHKA 4XW3A 4AEDC 4BMEA 1LOEA 1UYZA 4ZPIA 4LBKA 3LA7A 2RS11 4GH4C 5H9RA 4CDWC 4I02A 2BGOA 3W59A 4H2AA 4BQYA 4JDMA 2A6YA 4Y1VA 1XNAA 4WZFA 3ZN4A 2MEV3 2P3IA 2PQSA 4BLJA 2DV9A 5KHIA 2IC1A 4LKDA 4QQHA 1GR3A 1RUD2 1V6IA 2B39A 2W1WA 4RSUA 5FY7A 5GLTA 2HWB2 2JE9A 3WDVA 1UYPA 3B00A 4YGEA 2XJUA 1YQ8A 4OQ9A 3WF2A 3IDCB 1EPZA 2WRAA 1YRZA 1HN1A 1NCQA 1QH7A 3MPBA 4BCUA 3CHXA 2BOIA 2BU9A 1AX0A 4IQPA 4AGGA 2AH2A 5DDJ1 1GZTA 1GQGA 4QX7A 1O3TA 2GNDA 4KWLA 1C8M3 1A8MA 1GOHA 3TAYA 4AI2A 5FO9B 1M4WA 1RUF3 1UIKA 3OBTA 4IV3B 5FPZA 3VDDB 1JW6A 3LE0A 3PU3A 4L92A 3WLUA 1J84A 5ANQA 3RQ0A 1CX4A 1PVXA 5FZCA 3T2PA 2P3JA 3LFMA 4HVRA 4FPKA 1UYYA 1UZ0A 5FYBA 4QPIC 4E4HA 5BNNC 1CESA 3DYPA 1ALYA 2I07B 4XCAA 1NKGA 4GWMA 3E5QA 5B2GB 3AZYA 5T52A 3RZJA 2WZ8A 1PVC2 3LDRA 4P02B 3U78A 4E4DX 1WA4A 4AFMA 5LA1A 2CTVA 1W8OA 2JICA 1K5MA 1OURA 3FE5A 1VBB2 1NA1B 4ARYA 1LNSA 2D6MA 2D93A 1F5JA 2WUHA 3SLIA 2JB4A 3Q8CA 4LBJA 2XLFA 3AP4A 5FZ7A 1ASJ2 4L99A 5FZGA 4QXCA 1UNBA 3S0MA 4YW3A 3UESA 5FPXA 5SV5A 5F2WA 1QJEA 1H2KA 1UPIA 4AYUA 4IV1A 2NMOA 4DZGA 2EAKA 1YIPA 4HPKA 4XABA 2AEYA 2OPWA 5AFBA 4KL1A 3WNLA 2H6CA 2X29A 1WCDJ 1PO13 4COWA 5DQ0A 4LMFA 2EXJA 1AR71 1FV2A 3AZVA 2OZ6A 1RUD1 4YW7A 5DG1A 5J3UA 2VW2A 1QQP2 2HWF1 3FLPA 4NR1A 3S30A 4YZ5A 1JYCA 3IB3A 3D6EA 5LK7B 1RUJ3 1OUSA 4GA9A 4IUGA 4PDWB 4Y5Z0 4DUXA 1RUNA 1WMXA 2VVFA 4ISQA 1WMEA 3CF6E 4Q4W3 5C70A 4H55A 2DUOA 5C3QA 1H2MA 1AYN2 2PHTA 1OLME 2Y33A 3OG2A 1L7RA 1CJPA 3KB5A 2VZOA 2XJSA 3FFQA 4XJAA 5JIAA 4CDQC 5LZ6A 3NV2A 4OHVA 2JE8A 1O6UA 5T3NA 5JVVA 4RFRB 3RSJA 5JOWA 4NROA 4IV3A 3IAQA 4AL9A 3MF6A 1V6NA 3UGFA 4CXWA 1MS1A 3DECA 5D2AA 4BXSV 1HRI3 4EN8B 4LOSA 3N7MA 4DOUA 4CPBD 2XLAA 1Y3TA 3PURA 3ZFFB 2CWMA 1DLCA 1GANA 5F3EA 5ACA1 4CCMA 2NYYA 3ZFEC 1PVC1 2JG9A 3PVNA 3N9OA 3Q8BA 1CAXB 4KG0A 2ZZQA 4QGMA 5T54A 4META 4PHZA 5EHDA 2D6NA 4BB3A 1J3QA 4B8EA 1MR5A 1S0BA 2R061 5GZDA 4CP2A 1VBB1 2AREA 1ZREA 1ZBE3 1PK6B 1WCKA 1LULA 2ORXA 4XDOA 1ASJ1 4MLOA 1Q3EA 4LBOA 5FYMA 2WFF2 4Y22A 4H7MA 4CEYA 1HLCA 1IQDC 4IEVA 3A4UA 3IKWA 3I2GA 2PAKA 4YGCA 2QQIA 3TOJA 1AJOA 2XVGA 3PVBB 4CP1A 3UJOA 3GCWA 5FY8A 1W6PB 3TNQA 1HKDA 1D2QA 4AI0A 1PGL2 2Y6JA 1U12A 3RMXA 1RUH2 1H8TA 3BOPA 2LALA 5I93A 3H8OA 3ZXJA 2K46A 1MPXA 2OX0A 2VNVA 3CJIB 3UV9A 4HK9A 4C0BA 4D7TA 3MPPG 2WA4A 4XMIA 5IVCA 4TWTA 2R6QA 5KXBA 1QQP1 3GM8A 3RZHA 4IDZA 2C24A 3VL8A 3HOBA 1RTVA 1GICA 1D4M1 1QXJA 2VCMA 2KR2A 4H7LA 4QGNA 4YWAA 2E7TA 3VBFB 3OF1A 3ZYFA 1QIQA 1JZ6A 1W8NA 2V73A 5FYTA 2XQRA 4LOTA 4BXFA 3KHBA 1AYN1 3PTYA 2WO3A 4I01A 1GP5A 1BYHA 5IAVA 5FY9A 5CADA 2Y26A 4WM8A 5D1IA 1SG3A 5FXXA 4LLFA 2ATFA 3ZXFA 4CE8A 4HN1A 2BWCA 1UZWA 4QDSA 3DCQA 2ZGKA 2J1UA 4LO8A 4LBQD 3ACGA 1JZ4A 3UGHA 4FOWA 1JZ3A 1DZTA 4KGGA 4BE3A 4FXKB 3PUQA 4ITCA 4XZUG 3BU7A 2VAUA 2J1EA 4BOWA 2E9QA 1HW5A 4CP0A 4DEQA 5FR3A 2KM2A 3ZXEA 4I0WB 1RB8G 2H6BA 2XBO2 2X5IB 4AW7A 2QQPA 2GZWA 3E5XA 3POFA 1XE0A 5C3SA 4YZ3A 4XJUA 4YVSC 3KVAA 4OHWA 4QMAA 2WIIB 2WT2A 1FMD2 3I2FA 1W6NB 2K2SA 5BNOB 1CWPA 4GH4A 1EV11 4CDWA 5EJ3A 3RG0A 3V0BB 2DBNA 1E57A 2AENA 1N1SA 1BXHA 3CIHA 2YPJA 4DIQA 4FPHA 2EIGA 1PGL1 1X50A 4XUQA 4Y1XA 1RUH1 4AOCA 1W9FA 4YGDA 4HLTA 4TSVA 4Q4Y2 1SFYA 3GYDA 1VAMA 1ENRA 2PN5A 1KXGA 1TZOA 2GP3A 1H2NA 5EZWA 2ARAA 1DZRA 1VIWB 3CJXA 2W92A 4XF3A 2RJKA 3TN92 5A3OA 2DCKA 4K8FA 4YRDA 2YGMA 2ZEWA 4LBLA 3OUHA 4BM8A 4W4ZA 4YW4A 1PM4A 4XHBA 4R4XA 1RUOA 5FY1A 1RVF3 3MW2A 3GCXA 3N35A 3RYRA 3MV11 3F95A 3KV9A 5FZOB 3ZYGA 4LUKA 4DNYA 2PTMA 1C1FA 4M3CE 4OUMA 2GMPA 4QPIA 3HN3A 4U36A 3AXEA 4AGVA 5BNNA 1ULPA 1YNAA 5I8YA 4B4PA 2DUQA 5FOBB 5FIXA 1MS0A 1UY0A 1W90A 1VE0A 4XJWA 2YBPA 2NP0A 3KGLA 3B01A 1QDCA 3FLTA 5A6XA 5CKNA 4FBFA 1BK1A 5DZFA 5KHHA 3GGLA 2UY8A 2EF6A 1UXXX 4PQ9A 5FPVA 4CU7A 1UU4A 4EZHA 4D94A 3N36A 5H9PA 5FJKA 3VKMA 1HQLA 1KDKA 2EA7A 4ZU4A 4LIVA 3FHAA 3MO4A 4BLIA 4KWKA 1YYNA 1OH4A 4Y3OA 1OOPB 2GH8A 1VBA3 2WSVA 4L8QA 2X5IA 3E6BA 3T09A 3ZXLA 4EQVA 1HN0A 2WNVC 1LU2A 2R072 4I0BA 5F8PA 2JX9A 5JZGB 2PHFA 4IEOA 5K7PA 3TNPB 5KC5A 2OQ7A 1Z7S2 4OCTA 4NAOA 5FYVA 1YCIA 4FPYA 4UAPA 5GM0A 3KCCA 1UKGA 4MXWA 3M4FA 3JQWA 4XDPA 1CN1A 3WNMA 2BJSA 4HETA 3WDWA 2I45A 1JH5A 4TLFA 5I91A 3VBUC 3T1LA 4OZXA 5EJZB 1RYYA 3KMHA 1OLMA 1QH6A 1GOFA 3WEZA 1VBD3 4BZ4A 2VULA 2JDMA 3HR9A 2A3XA 4Q4Y1 3NNGA 1UOJA 3ACIA 3GBWA 3OCPA 4G9SB 4HKWA 4CZSA 2G9ZA 3OY8A 4I09A 3AMNA 3I8TA 4B29A 3TYJA 4C0HA 2BWAA 3JBG2 4D6RA 2EXHA 3BGAA 2VNOA 3GF6A 2HYXA 4RA0A 1KRIA 4FTEA 3BODA 1LGCA 2A6ZA 4Z1VA 5FZLA 1AXKA 4KNCA 3W20A 5ABJC 5BYNA 3I2KA 1J58A 4TN7A 3WQ0A 4LJHA 2VL4A 5GJ6A 1WBLA 2NPIA 2BGCA 2VQ0A 4QT6A 2FMDA 5F5IA 1Y9MA 5G05L 1LHUA 4FPEA 5FZOA 5D21A 4YPJA 4CP9B 5GZGA 4DEVA 2YV8A 1SMVA 3POJA 4XQDA 1DGWA 1HQNA 3WX5A 2R1DA 4Q0UA 2DWRA 3ABZA 4GKXA 1OKQA 2B8MA 4LPLA 4EN7B 1PZ9A 2HLEA 4RQPC 4V2WA 4Y1ZA 1NYWA 4Q4V3 2UYBA 4FO9A 1ZBA3 4FQ4A 2HWE3 4N7IA 1WA6X 4CYDA 5J96B 3TB0A 1JYIA 2RR11 2XWBB 2ZXQA 1PNFA 4W8JA 3VBHB 3FUOA 4Y1UA 5L7OB 3VBRC 3MBWA 1O4TA 1W8FA 4N53B 2BERA 2Y8KA 2PXJA 3MW4A 3CU7A 5EXOA 3WUCA 5A6ZA 5FREA 4CCEA 3HAGA 5JXJA 2BP6A 2YGLA 2A3WA 3OSDA 4IETA 4FOQA 5A7QA 4YW1A 2ZHMA 5FMOL 2R071 1LTEA 3T0AA 5KWRA 2D5HA 1FT9A 2P3KA 1ZRRA 1LENA 4N7UA 3WNOA 4EZ4A 1G9AA 1UU6A 5JZGA 1PIV3 1AR63 1GYKA 1S0EA 1KITA 3RS6A 1V6MA 5T5PA 2RDNA 3T4HB 2YBKA 1X8EA 3MZHA 3BPZA 3AMQA 4M3CB 4BDVB 2Z79A 4NWVA 4QWNA 4CDXB 4J1WA 2R7EB 2XJVA 4RHV3 4COUA 3WDTA 3WQ1A 5HPOA 2FD8A 2ZEXA 4YLZA 5FPLA 5CG9A 3BIWE 3ZX7A 1VBE1 2Q1ZB 5LEKA 2VOWA 4AAXA 2A7AA 2F4LA 1NCRB 2EIBA 3DKWA 4GB31 1SCSA 1K42A 4OVEA 4DRRA 5FZMA 5JXGA 5KHGA 3WZ1A 4LHLA 1GLHA 1UMIA 2HWC3 3NNLA 1MEC2 3HNMA 1AR82 4LITA 1CAVB 1EYBA 2Q1FA 3DKQA 2JDUA 3NAPB 5FZ3A 2E32A 2ZABA 1AL0G 2AR6A 5TSWA 2G9FA 5IK5A 3DPRC 3N7JA 1HXS3 3TEWA 2GNBA 1UKRA 1PGSA 1WLCA 4WV8A 1UOGA 4OHZA 3QACA 1ZZBA 1XSQA 5LASA 1MS3A 3NJZA 2VUAA 3MEPA 2P17A 4CP9A 2GALA 2DVBA 3FMGA 1Y9GA 2DTYA 4Q29A 3AKSA 4M01A 4QQ2A 4I3GA 5EJ1B 3O5SA 1EUUA 1NG0A 1QJU3 3O0VA 4HL0A 4L9BA 4MV2A 4UW3A 5FUNA 3S57A 3WDUA 3AZXA 3WCSA 4TYSA 1SEFA 1VMFA 3KV5A 1DGRN 4YGBA 4QX5A 5E89A 1RUI3 4EN9B 1ZX5A 3RVHA 2L9LA 3U10A 1BBT3 3MFCA 4UFJA 3CNAA 2W95A 4LIUA 3U1XA 3BN6A 1F35A 1PNGA 4BQWA 4HANA 2MEV2 4MOAA 3WQBA 3UK9A 1RUG3 1SLCA 4JGYC 4AVSA 3D0SA 3UKNA 3RWNA 2XHNA 5C71A 3O7OA 3LCPA 1PGW2 3SH3A 1UYXA 3PIJA 5FMOS 2ZCWA 1LU1A 1PO23 3U0ZA 3SCHA 1CONA 1HB3A 1JXNA 1AYM2 1K3IA 3SCFA 2RMU1 2JKXA 1VPHA 1HJFA 2VZQA 2XKOA 3K3OA 3LPGA 4Q4X1 5A32B 4S2FA 3T0BA 1JOPA 2ZGRA 3VBOB 4CPBA 5C5UA 3FLRA 2WNOA 3URFA 3I2JA 1Q8OA 5LBBA 1V9U2 1C8M2 3QD6A 1NAEA 1WW6A 2OXBA 2X05A 4AZZA 1RUF2 4KU7A 2J22A 5FYUA 3VKOA 4NHKA 3WG3A 4URTA 3G6JB 4UT5A 1QXPA 2F4PA 4P08A 3SCGA 1WW4A 2NMNA 4YVWA 5LATA 2RM23 1WLWA 3HBKA 1NX9A 2XUEA 3CMGA 5DUUA 1DFQA 5IW0A 2XJQA 1VLNA 1W6QA 3THCA 5HV0A 2BUKA 4LULA 4ET7A 3POGA 4UYBA 3BTXA 1F2NA 5CBLA 3BUCA 4IV1C 5IK4A 4Q1PA 2HKXA 1EAH1 1GNZA 1AXZA 4Q8LA 4M4RA 3AMHA 3KV4A 1SFNA 4QXKA 4V1PA 5DAWA 5EV7A 2XL9A 1D4VB 2WWJA 2ZTNA 3J7LA 1VB2A 4R4ZA 2ZX2A 3WF1A 2WQ8A 3WDYA 2C9KA 4UW4A 4ZS2A 5FZKA 3E6DA 1U5IA 2QQKA 1H2LA 1VRBA 3SH5A 4JZRA 5ANNA 1DF0A 3CO2A 4DPNA 3APBA 1X9PA 3QBQA 4BH9A 2ZAAA 5HCFA 1T2XA 3JUUA 2NN8A 4LHSA 3ZYHA 3H1YA 2VMIA 2VQUA 4P5HA 3WW2A 5E6HA 2WWSA 4QX1A 4J25A 3SEEA 2IVJA 2WNUB 5EWSA 4Q0VA 5JUVA 5FZHA 3KLSA 3H8UA 1PO12 1YO8A 1RUE1 3EBRA 5GLWA 3VBUA 1SPPA 1DP0A 4NHLA 2ES3A 3VDDC 2QQUA 3LEGA 4IV3C 1CZSA 1NLRA 4FPJA 2C26A 3RJ2X 3HQUA 1RUJ2 5IT6A 5CYYA 1AYM1 1MZ5A 2D3RA 2JDNA 1C5HA 2XL7A 4CCCA 1RL3A 4COZA 3IIAA 4AVBA 4TLGA 2WS91 1V6KA 3ILFA 4GMP1 1JI6A 3ILRA 3OGGA 4RGAA 4KU8A 1V9U1 1W6MB 5FZBA 5GALA 4CCOA 3T2TA 4ZXKA 3W21A 4OI1A 3PVOA 3I3DA 3K4ZA 4MGQA 2YXSA 1R1A1 2W1UA 4XUOA 1G8WA 3NKGA 3P5BA 4FOVA 2HWD3 1NA1C 1COV3 2W9XA 3J7HA 1WD3A 2H0BA 4I0AA 5FP8A 2VG9A 2QDNA 5DXDA 4CEYC 1HRI2 1X82A 3SQOA 4MGSA 4XBQA 3HNBM 1BMV1 1XBFA 2BVBA 3WOGA 4SBVA 1R093 2AYHA 2WZR2 4OMCA 2Z5WA 3RDIA 5K0UB 1I3HA 4RQPA 4UBGA 5LA2A 3ETPA 4JTNA 2VQAA 1RMU3 1H8TC 1ONAA 3ZO0B 3N9QA 5FZDA 4AQ6A 1WGPA 5C9AB 5J48A 1WMFA 3RI8A 3VBRA 4MSVA 4COYA 3N3HA 3PU8A 3O1OA 4AEMA 3AZWA 1DYPA 2VW0A 1VBC3 5I0RA 3QLQA 3I59A 1QJY3 3ZPYA 5A7PA 4WVMB 3PUIA 4PDWC 3ZPOA 4BQ3A 2PYTA 5FZFA 3VLBB 1VRH3 4HK8A 2JJ6A 4QPWA 3SHRA 1J3RA 3T1MA 4EYUA 1POV1 3O1MA 3WW1A 3VN4A 2B7YA 2OVUA 3I3MA 1CR7A 1TMF2 4HXCA 1GQHA 1L7QA 2IXJA 3P3NA 3SMHA 3KCYA 1UL9A 2VXJA 3RMYA 5C5TA 1A6CA 2JEMA 1MZEA 2V5YA 3KM5A 1YC61 2WSUA 1LR5A 1S0DA 1OLRA 2Z69A 2Q30A 2XOMA 1B35B 2ZZJA 3O1TA 1IS5A 2B46X 3R4SA 4XIKA 4N43B 1VMJA 3ZN6A 1WCUA 3ZFFC 5FTTC 1GP6A 1W9TA 3FUQA 3MIFA 4QPGB 3WG1A 3B3QE 2BEOA 2DUPA 4H3WA 4MVTA 1W6MA 3DPRA 3PHMA 2ADEA 1LEDA 3WF4A 1NY72 2ZJCA 3IM0A 1XYPA 1FOD2 5A1AA 1C57A 1AL23 3LOIA 2PHWA
chains in the Genus database with same CATH topology
2XJPA 3LWCA 1LHNA 4JRLA 1YFWA 2XH6A 3AKTA 1REEA 2JDZA 2VVDA 2OZJA 2WZR1 3FBYA 2I2SA 2ZGUA 2RS52 3ENRA 4MGIE 4YG6A 3NV3A 2ZX0A 2GMEA 2ZMLA 4OI2A 4EWAA 2D6PA 1XXNA 3I4IA 5GLUA 3R05A 5H9QA 2ZA9A 3MYXA 2E6VA 5C9AA 3K51A 4FQZA 3CJIC 2RS32 3VHPA 2PHRA 1MVEA 3VZMA 1NQJA 3LKJA 3QCWA 4JGYA 2UU8A 2DCYA 3HWJA 1KQRA 4BWOA 1RJ8A 1IKPA 3JCIA 4WVMA 5K9YA 3VKLA 2CYFA 4LO4B 3VBFC 1N3PA 1ZZ6A 2D97A 2FQPA 4XF4A 4DS0A 1TMF1 3NV4A 5BNQA 1R083 2JG8B 1X36A 2ZGSA 3KT1A 5JI7A 2JENA 1O4YA 2OA2A 2NM1A 1XE7A 5CG8A 5T5LA 4EN6B 5F1RA 1RVF2 3R0RA 3TBDA 1RHI3 3D8CA 4AEJA 3ILNA 4DY3A 4Q0SA 1XYNA 1QJX3 4FSJA 2WZPP 2X5IC 1ENQA 1KFXL 1UZYA 4JGZB 5LK5A 1IPKA 1FOD1 4B4QA 2XKPA 5FOJB 2H0VA 2ZKNA 4AVCA 4Z07A 4RR3B 3KQRA 5H9SA 3OPZA 1SLAA 4AI3A 5JMCA 3ZXDA 1SBDA 4HKLA 4B3NA 2A6XA 2PLV3 3MIGA 2CGPA 1Y9QA 3D4KA 2RS51 2D6LX 2HWB1 1V6OA 3O12A 1VBA2 1WCSA 2HYKA 3A0KA 5JSRA 5FAXA 2ZGNA 3MDPA 3THPA 4RD7A 2RS31 3W58A 4EV0A 3JB8A 5KHKA 1TE1B 1C5IA 1QNWA 4XYXA 4XTMA 2D7FA 3POYA 4FXGB 2K0GA 3JD73 3E5UA 3VDDA 2YZ4A 3VZKA 4FPLA 3WG4A 3KT7A 5L19A 2W68A 4XFAA 1JUIA 4FP2A 4YM1A 3ZYIB 1PZ7A 2R0HA 3EXUA 3HT1A 3ZMOA 2JG8A 1TME3 4ISRA 3WR0A 4Q26A 2D3SA 5CFDB 3OYWB 1LOCA 4S2GA 3B69A 4Y1YA 2RHPA 1D2SA 4R52A 1ULEA 1NA1A 2RS13 3X29B 1OMIA 4N9HA 1YUDA 2OUHA 1OOPC 1MVQA 1W0OA 4HBNA 5DUWA 2IXLA 3B94A 5CB7A 4ZU5A 4EROA 5JZGC 1CPNA 4Q4V2 4UXAA 4OI0A 5JR7B 4AEDB 4RS5B 2O1QA 1DQ6A 4SLIA 2VVEA 3Q9OA 1JBCA 1OPOA 1BCXA 2UWAA 1VAKA 2VMGA 2GC2A 1DYKA 5F6KA 2QJVA 5DDJ3 5FFOC 4XOGA 1L3JA 2SBAA 2ZAHA 3B93A 1I1EA 3GBGA 4PDWA 2YYOA 2QZ3A 5CIRA 1PIV2 1AR62 4QGLA 3VV1A 1XQNA 1ND3B 2VU9A 2A70A 5DG2A 4HMZA 1UCXA 3ZSKA 4RHV2 4MXVA 4QQLA 2RJLA 2XB6C 4K1YA 3KS7A 4LBNA 1YWKA 3O0WA 3AP5A 1DG6A 3V64A 3WP4A 2ZGPA 2FZ1A 4E4ZA 2VOVA 3IPVB 5T5JA 4FAHA 1JTZX 3ZFFA 4IEYA 2D98A 2HWC2 4IEQA 1LHVA 3VL9A 3V0AB 1CAXA 4X8PA 2VUJA 3LSDA 2KXLA 3VBHC 5L7OC 1XU2A 3R4DB 4N53C 2WFF1 4LUMA 2CGOA 2JXAA 3FZ3A 1PK6A 3FWEA 4P9LA 4CDUB 1AX1A 4IEPA 1I9RA 4AF9A 4LO5B 1AR73 1M06G 1BEV2 1RUD3 4XMAA 4JDOA 2HWF3 5KC6A 1CQ9A 2B45X 1W6PA 4UW6A 1OQEA 3I2DA 4Q27A 4LE3A 1YI9A 5JWPA 4F3JA 2TEPA 1BBT2 2QCSB 3CJIA 4CDXC 5BNPB 4IL7A 1WW5A 3V56A 1JN2P 2V09A 2BPA2 1PIV1 2XHKA 4YW2A 2R043 4YVWC 1NCRC 3VBFA 1SLLA 3FFZA 2ARXA 3SNMA 4XE9A 1PO22 4XBLA 2WC2A 4QQPA 1S2BA 2ZMNA 4QU2A 4RHV1 3OGJA 2GH2A 5ACA3 1Q8SA 1UD1A 1PVC3 4B4RA 4LO6B 2PQQA 4RFT0 3RYKA 4NOTA 3DN7A 4E2GA 1UAIA 2R063 4ZKTB 3USUB 2TUNA 5C8CB 1VBB3 4XF9A 1QOTA 2XBO1 3J8F2 1RUC2 4YFWA 3IPVA 2ZX4A 4UW5A 1ASJ3 4LBMA 3PNAA 2KA3A 1CAUB 4I30A 3KSCA 2WINB 1FMD1 3RRDA 1O5UA 4XJ8A 1AR92 1HRV2 4XFGA 1N3OA 4AFCA 2IXIA 1YFXA 1FI2A 4IEWA 5BNOA 1W6NA 1DQ1A 1MS4A 2CWSA 4O9GA 4PCRA 5C33A 3WP5A 1LB2A 1QDOA 4AHWA 3V0BA 4LTAA 5FO8B 1HX6A 1BEV1 2ZHNA 4QD2A 2XWJB 1KD7A 1QQP3 1BJQA 3M3CA 2R1BA 2ZOEB 1LHWA 4FP3A 1XU1A 1D4M3 3TN91 1AF9A 1IS6A 1SDWA 1AYN3 3VBOC 4AI8A 2QE3A 1LRHA 1A8DA 2MNGA 3ETQA 4X6QB 1NOVA 1GKBA 2QFEA 2DU0A 1H9PA 3AZZA 1NE6A 4AVAA 4AWDA 2A5ZA 1G9DA 4XF0A 3LOBA 5CU1A 1QKQA 3VKFC 3H3ZA 3M7AA 5I0UA 3VGIA 1Q5OA 4LA3A 5E1RA 4D7SA 2NLRA 1IQAA 4Y4YA 4W6YA 3J8F1 1RUC1 2GNTA 3EJKA 4K7JA 2HWD2 3ES1A 1COV2 4PIZA 1EV13 1REDA 2D44A 4N9IA 5SV8A 2UY9A 1C3HA 1OOPA 1H1AA 4ONUA 2PAEA 1DGRA 1AUYA 1ZNPA 4XTPA 1Z7S1 1R092 2ZGMA 2OIIA 1AR91 1HRV1 3S7IA 3U07A 4EJRA 1AX2A 3N4MA 3K48A 2NZ9A 4WBBA 1RMU2 1RUH3 1LOBA 4FPOB 1RITA 1X8MA 4LE4A 2WNUC 1I6XA 2O8OA 2E51A 1U5ZA 1G9FA 1VBC2 3AXDA 3FBMA 1QHDA 3ZMNA 2UYAA 3L9JT 3MW3A 4K6BA 1J1LA 4FPCA 2JKBA 3JBG1 3O14A 1UPSA 5LEJA 3VZJA 3POWA 3TWIA 3VZOA 3GALA 4GWNA 1O7FA 4BQ1A 3B5LB 1FPN2 4RGGA 1ULCA 4BYYA 4HSLA 3M3IA 4A7YA 1TEIA 3B9IA 1AVBA 4E2QA 3NL1A 4KH9A 1BVVA 2LUWA 1OFNA 2R0FA 3RYPA 1LECA 2QDRA 3LSEA 2GDFA 3H7JA 1RGSA 2R32A 4DQAA 2DVDA 3NW4A 2VH9A 2OUJA 4ATEA 4DINB 1DIWA 1UU5A 4EWDA 5L36A 1YIFA 4Z82A 3ZXKA 2B5HA 5K0UC 2SLIA 3L2YA 3IDEA 1F9KA 1LOGA 5JSPA 4HVQA 3VBHA 5C9AC 5L7OA 5J7MA 1GSLA 1LOFC 5CFCB 2D43A 4BPZA 4N53A 1S0JA 2VY0A 2ZACA 4FVVA 4MZUA 4A2UA 4XF1A 1IOAA 2YROA 4TZDA 2Y0IA 5JPNB 3AKRA 1WW7A 4P9XA 4P9JA 1XNBA 2ET1A 3ZVXA 4Q4Y3 1ZZ7A 1MZFA 4WZCA 1VBC1 2PHXA 4M3CA 1KJRA 4CDXA 3HBZA 4Y26A 3IDBB 1OA2A 1W2UA 2YY1A 2Q4SA 2R30A 1MQTB 5E88A 1B35C 1NCRA 2ERFA 4N43C 3WD5A 2A75A 3DL3A 1XNCA 3WT3A 1MEC1 1FPN1 1AR81 2WNEA 4QPGC 3V65A 5HCAA 5K8SA 5A33B 3JZVA 4Z92B 3U4XA 2BYVE 1CAVA 2CGNA 4AQ2A 4JAAA 3HT2A 3NAPA 4BMBA 1DQ2A 2RE9A 2VNRA 3CEWA 1MS9A 3J9SA 4P14A 2RR13 3G7DA 5EYYA 2Y38A 1APNA 2ZGOA 1QMJA 3PMSA 2W39A 1OHFA 2DTWA 4RL7A 4EWEA 2JECA 1O4ZA 1QJX2 1W0PA 1NZCA 4NWWA 1F5FA 1UZZA 3VBSB 2R073 4X6RB 2FZ2A 4YG0A 5T5OA 2EXKA 1IGOA 2A3YA 4X8NA 2Q0AA 5BXXA 4GALA 4XFIA 3H50A 1C8NA 2MEV1 3ZXAC 1V70A 4AFAA 2PLV2 2P2KA 3ROUA 3ZFGB 1KFUL 3MF9A 4DXZA 2QNKA 1PGW1 1IS3A 1ZM1A 5JOXA 2ENRA 3E97A 1DDLA 1WD4A 1VBE3 1MACA 4FOYA 4Q4W2 5JOYA 4HN0A 4GB33 1OLQA 5A32A 1YJKA 2JG8C 1AHSA 1WLDA 2XLGA 4QPYA 3E6CC 2G4IA 2O0OA 2XGXA 4OHXA 3VBOA 1C8M1 1LGBA 2HJIA 5D8AB 1PZ8A 1RUF1 4MGZE 4M00A 3UKVA 2WL1A 1ENSA 1ULFA 1FV3A 3HMYA 4K9SA 3DUIA 4DRVA 3KT4A 4WM7B 4QQOA 1MQTA 1CIWA 4IESA 4MYEA 4FTSA 2PFWA 1S0IA 2D6OX 3WW4A 1PM7A 4JGZC 5A33A 3DF0A 3MIEA 4KQ7A 4MGKE 4RR3C 4XPVA 4BIFA 5JIUA 4AQSA 5KXEA 1ZBE2 4ASLA 2DVAA 1VJ2A 2RS12 2E7QA 2GC1A 4BHPA 4K1ZA 3GHMA 1WMDA 4XQWA 3VBSA 5JPMB 3WNXA 2DCTA 5LRRA 3MGUA 3ELNA 1RJ7A 1DZQA 5E16A 1NCQB 4Z8BA 1ND2B 2C9AA 1PO11 2RMU3 2WNUA 2CL2A 4Q4X3 1O3SA 3IBMA 1RUJ1 2P34A 1OSGA 3THTA 1QU0A 2O8QA 4Q4W1 4XBNA 3ZSJA 5AVAA 4JTOA 4CEWB 1QOSA 1GBGA 3TRSB 4K21A 1QXRA 1CAWB 1CPMA 1V00A 4YZ1A 5A3LA 5F6LB 5HBAA 3A0NA 3EHKA 2C1FA 5CFDC 2QVSB 3MIHA 2P37A 1I5ZA 1K5MB 2C5DA 1C28A 1EAH3 1HRI1 1PK6C 1UX6A 3NO8A 1TNFA 1VAVA 1XE8A 4OUSA 4AGRA 1HIXA 2GC3A 2BW8A 3WHTA 1LGNA 1DQ4A 3H1MA 5K0UA 4F7ZA 1ZRCA 2UWBA 1MZ6A 1A3KA 2GSYA 4RS5C 4DMIA 2QUOA 5FQ0B 1ZBE1 4AFBA 4GMP0 4HPKB 1LOFA 1ZZ8A 3S7EA 3GHNA 4KWJA 3PMEA 1O3RA 5KXDA 2BNMA 1RUE3 2MHFA 2N7GA 1AR72 4B7KA 4CTEA 2E63A 2HWF2 1OQ1A 1UIJA 1IKQA 1TQ5A 4FCAA 1AYM3 1RIRA 4ZU7A 3M3OA 1ND3C 1DGWX 1O5LA 3PJQA 3ZYJB 2WS93 1ND2A 4GMP3 1OPMA 3UKTA 2YDEA 2YHJA 1V9U3 2DF7A 2TBVA 4JRAA 3S6PA 3IT8A 1AJKA 3RNSA 3BOWA 3AMPA 1LCLA 3M70A 1Q43A 3FHIB 1R1A3 5JLVA 1B35A 2R042 1NXD1 3H9AA 3KD4A 1HV1A 4N43A 4XXPA 3WXPA 4LHNA 4CEWA 4PBOA 1LESA 5FRAA 1NXMA 1QF3A 2PA7A 4QPGA 1NY71 3AB0A 3BB6A 2JG9B 1CAWA 5ACA2 2ZX1A 1QWRA 1QOOA 3WY6A 2BBVA 2GU9A 2WQ4A 2UWCA 2PHUA 3AMMA 5BNOC 1B09A 1POV0 2IXHA 2ILMA 1F31A 2R062 1XRUA 3DV8A 4JC1A 4NO4A 3QOPA 2VNGA 4PLNA 3BCWA 4Y22B 4CDUC 1YHFA 2W0XA 4CEYB 4E9KA 5C4WB 3I54A 5I0SA 1OA4A 4W6XA 5IK7A 1QJZA 5F9TA 5HCBA 5IK8A 2A6WA 4M0HA 3AFGA 2FHRA 1H8TB 5IUQA 2VXRA 1VB4A 5FQ0A 1POV3 2OW4A 1R1ZA 4P9GA 4D3WA 5BNPC 3AFKA 3ZN5A 3CLPA 1VBD2 2B9UA 4W65A 5F5QA 5I8SA 4M0NA 3VKNA 1H9WA 3ASIA 4W6WA 1Q56A 4BIOA 1D4M2 4I3PA 4A7KA 3ZSMA 4JDNA 4WM8B 1GZCA 4Q0QA 5E8AA 5C6CA 3OBRA 2MPFA 4PIYA 1RVF1 5KBFA 3WUDA 3ZSLA 1S0CA 3CL1A 2R041 4IEXA 2VW1A 5C8CC 1QNYA 1XNDA 3WV6A 4COVA 1PHMA 4MH0E 2CV6A 1GZWB 1ZA4A 4QM9A 5GKAC 1JUHA 4JGZA 5A3MA 2WZR3 1WBFA 3HQXA 2EALA 1A78A 2I74A 3AYAA 3M3QA 1ZBA2 1OI6A 2HWE2 3B02A 1FX5A 1YFUA 4RR3A 4IEZA 3LGRA 2EVXA 1Y43B 1H4HA 2IZWA 4GH4B 4XILA 4C91A 4CDWB 1N1VA 2DCJA 5JAXA 2PHLA 1VBA1 1EV12 4XJ9A 5C4WA 3AK0A 2Z2SB 1KS5A 1UF2C 1REFA 3ACLA 3WP3A 3LA3A 3LA2A 2D5FA 4YW5A 4DY5A 4ES9A 2ZX3A 1TMF3 4QM8A 1W39A 3HN1A 4XXAA 4KG8A 1YLLA 4PLOA 4AFDA 1SLIA 2X53S 1VBD1 4NPRA 4XFBA 4I2OA 1FATA 3UL2A 1SBEA 1V6LA 5GZCA 3ECQA 3JQXA 4YZ4A 4YM2A 1W6OB 2X8KA 4QPIB 5BNNB 4K40A 1ULGA 4GULA 1BZWA 3SISA 3ST7A 3D0JA 1U0AA 2VMHA 4Y20B 1C1LA 5BPXA 1S1AA 3SXWA 1FOD3 2IWGB 1CJDA 4Q2FA 3VHNA 2WLPA 1HXS2 5CFDA 4JV4A 1T6GC 1NLSA 3OYWA 2C0ZA 4D69A 2R49A 3PLQA 2GMMA 3LAGA 1S0GA 1Q8PA 1HQWA 1N1YA 5CAZA 5DUXA 1JOJA 4XHXA 1GZWA