2R0HA

Fungal lectin cgl3 in complex with chitotriose (chitotetraose)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
160
Chain Sequence
b'MFHILRLESTVDLSEPLKDNGIIVFQSDKLDLEPSPNLGPTGIDNTNVNLINAKGDVLLHIGIRRRENAFVFNSIPYGESRGPEERIPLEGTFGDRRDPSITIFDHPDRYQIMIDYKTVYYYKKRLEGRCEKVSYKINEGQTPPFSDVLGVTVLYFANVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CGL3 lectin
molecule tags Sugar binding protein
source organism Coprinus cinereus
publication title Structural Basis for Chitotetraose Coordination by CGL3, a Novel Galectin-Related Protein from Coprinopsis cinerea
pubmed doi rcsb
total genus 41
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2r0hA00
4YGEA 3AP5A 1Q8OA 5KXCA 5GALA 1MZ5A 1C1FA 5AVAA 2ZGMA 1TEIA 4FPYA 1DZQA 5GZFA 3T1LA 1VIWB 4K1ZA 3WVJA 5CAZA 3WG2A 2ZMKA 3M3QA 1FYUA 2OUHA 5SV8A 1FV3A 2GN7A 2UU8A 1CN1A 3SNMA 4FOQA 4GKXA 1Z78A 4LBOA 2P2KA 3FFZA 2DVBA 1V6LA 1IS4A 3AXEA 1SCRA 3FUQA 1GZWA 2W39A 1CR7A 2ZZJA 3GNEA 1QDOA 2GN3A 3A0NA 3O0WA 4FPLA 4GWMA 1FNYA 4LBQD 4YFWA 1DQ6A 3WNXA 2P34A 1CIWA 3DUIA 4CRQA 2DU0A 1GANA 2UURA 1LOGA 5F5QA 1N3PA 1AVBA 1MR5A 2E6VA 5EWSA 3WG1A 1BKZA 2PHUA 4BMBA 2EXHA 1VALA 1W6NB 5DUUA 3UJQA 5GM0A 3WG4A 2ZACA 5KXEA 2ARBA 3AZVA 1ENSA 2XB6C 1MVQA 2ZHMA 3POWA 5E88A 3WCSA 4XZPA 2JE9A 1AJKA 4Y1UA 2EAKA 2UWCA 1IS3A 4Y24A 1AF9A 1ENRA 3SLIA 2FHRA 3PJQA 1W0OA 3R4UA 4R9AA 3V0AB 4LBQA 3M3EA 5T50A 1LOEA 3HR9A 5GLUA 4FPKA 3AP6A 2BQPA 1G9BA 4AWDA 1V6KA 1WW4A 2WJSA 4Q26A 2CYFA 2P3IA 5IK5A 2ENRA 2GMEA 2VW2A 4FPOB 2A7AA 2YXSA 2DYCA 4H55A 1PZ7A 3WLUA 1JOJA 3N7KA 5DUWA 5BYNA 2A6XA 1N1YA 3ZXEA 1F31A 1WW7A 2A6YA 3ZXKA 4D69A 4DS0A 4P9XA 3AZYA 1KDMA 5T5JA 2E51A 4GALA 1A3KA 2C5DA 5E8AA 4HL0A 1QF3A 1AXKA 1RINA 1SBEA 3ZYPA 2DUOA 2V5YA 2E7TA 2NZ9A 3AYAA 5GZDA 4ISRA 1DYPA 4DRRA 2ZHKA 3WUDA 2LTNA 2DVFA 2GNBA 3IPVA 1Q8VA 3N3HA 5DUVA 1BXHA 1O4ZA 4M3CF 3RMXA 1DHKB 4JRAA 1WUVA 3BODA 4K20A 3NV3A 2CWSA 5HCFA 1BQPA 5EYYA 4PCRA 4TYSA 1G8WA 3M3OA 3B3QE 3T1MA 4FOWA 1V6MA 1HKDA 1SACA 3VKNA 2E7QA 3OY8A 4DQAA 3O0VA 2DUPA 2A6VA 5GLWA 5H9SA 1SBFA 1VAVA 1DBNA 3V0BB 2OUJA 2YV8A 5GLZA 1LULA 3TAYA 3WDXA 2WT2A 2C9AA 2ZGUA 4YLZA 2NP0A 1Q8PA 2RHPA 4YW5A 2ZGQA 2CNAA 3A4UA 3CNAA 1MVEA 4R9BA 1WLCA 3AP7A 1LOFA 3Q9OA 2D6MA 4UW3A 3N7JA 1S0IA 2A6ZA 2JJ6A 3AZZA 1CESA 1MS0A 1BZWA 4WV8A 5T5OA 3UK9A 3VKOA 5KXBA 1HDKA 1R1ZA 4DFSA 2VY0A 5L73A 1KRIA 4XHBA 1W6OA 2ERFA 3DGTA 3O12A 4XILA 4FQZA 3FLTA 1UN1A 2A71A 4HANA 3PVEA 2YZ4A 3B69A 3LCPA 4TZDA 3UL2A 3MW2A 1U0AA 2A5ZA 2DWRA 3NV1A 1SFYA 3ZVXA 3NWKA 2Z42A 3FLRA 4XMIA 1LGNA 1S1AA 4YG3A 2D7FA 3BTAA 1O4YA 2GNTA 1WLWA 3MW4A 4ZKTB 4AGGA 3OYWB 4Y22B 3FBYA 3POSA 4AYUA 1AX1A 1LHOA 5GZGA 1DLLA 1GKBA 5E89A 4PBOA 3V64A 3AP4A 1DFQA 4DRVA 3ZYRA 2PHFA 1IKQA 4ATEA 1PZ8A 2D3SA 2WT0A 4LBLA 2EIGA 1EPWA 5JVVA 2HYKA 4M3CE 4WZFA 4PBPA 1G9CA 1KJLA 1F5FA 4XBQA 3O5SA 2SLIA 3SH4A 3AYDA 2TEPA 3RS6A 2JKBA 2ZABA 4BPZA 3PMEA 1CQ9A 2CY6A 2DUQA 3WDWA 2W68A 1OQ1A 1D2SA 3D4KA 5FRAA 2WNEA 5JDBA 1QOOA 5JOYA 2JD4A 3B9CA 3WV6A 3KM5A 1QOTA 3O0XA 3R05A 3VKMA 4Z8BA 3NV4A 4R9DA 1DQ0A 2P37A 1G7YA 1G9DA 1GNZA 2R1BA 1LOFC 1W0PA 2WSUA 4FP2A 4C1XA 4YGCA 2H0BA 1LTEA 2ZA9A 4XDQA 5DG1A 3IPVB 3RG0A 2R16A 4RL7A 3A0KA 4WVWA 1LESA 1W6QA 3OJBA 4U36A 3WDVA 1I1EA 1V6IA 1LECA 3V65A 2B7YA 1YI7A 1DIWA 2AYHA 3C2UA 1AXZA 1UZZA 1FX5A 2ZKNA 1LCLA 1ZM1A 1HQLA 1I3HA 5DZGA 4WVVA 1LU1A 1GYKA 4Q2FA 2ZGPA 1LJ7A 2AGSA 1APNA 2DV9A 3SITA 3WG3A 1PZ9A 4XJWA 1LHNA 1W6QB 3BOPA 3RMYA 1UZYA 4OZXA 2OVUA 1WD4A 1S0FA 3SISA 5GLTA 1MACA 2YY1A 1LHUA 5T5LA 2OW4A 3ZSMA 1ZA4A 2Q5TA 1W6PB 3AP9A 4CZSA 4Y1YA 4YW3A 2EF6A 4LBMA 1QOSA 3QCWA 4F83A 2AR6A 3N35A 5HCAA 3VKFC 4ITCA 1LOCA 3U4XA 3H0OA 4YZ5A 1KQRA 1A8DA 1MZ6A 2EALA 1DQ2A 2P3KA 2ZGNA 1YIFA 4XJZA 1KDKA 3HN1A 2A6WA 3D6EA 1WBFA 1N3QA 3VV1A 3OPZA 4I30A 1N1VA 4AVVA 1W6OB 2A3YA 2ZBJA 3USUB 3PVNA 3T2TA 1GV9A 3SH5A 4Y26A 2ZGTA 1SBDA 2UWAA 4YGDA 3AX4A 2ES3A 2PHTA 1CVNA 2ZGSA 1JN2P 2A75A 4PF5A 1XQNA 4FPHA 1QKQA 4YW2A 4XHXA 2ZGLA 1B09A 2VW1A 3ENRA 1FATA 3HMYA 3OYWA 1UKGA 1ULDA 3LSDA 3OBRA 1SCSA 2NM1A 4YG6A 4XE9A 3R4SA 2CL2A 1JYCA 3M1HA 5T5PA 1C4RA 5CA6A 1MS9A 4FOYA 1JXNA 1IKPA 1LODA 5FREA 1YXWA 3ZPYA 4Q8KA 3FLPA 1KJRA 4YW4A 4ZXKA 1QMJA 3B01A 3ZXLA 1BYHA 2DVGA 2EXKA 1N1SA 3NV2A 1AX0A 1OKQA 2DURA 5CB7A 3ZXJA 1SLAA 4RA0A 1VLNA 4XYXA 1GSLA 2R1DA 4PQ9A 1S0JA 3AZWA 4R9CA 4YG0A 3RRDA 5IUQA 1W6PA 4GWNA 4YGBA 3IM0A 1SLLA 1WLDA 1CJPA 2A3XA 1MS1A 2CWMA 3WDUA 1ULGA 1MS8A 3RSJA 1DQ5A 2DU1A 4YM3A 1IS5A 1DGLA 1Z0HA 3WHUA 1H9PA 4AGRA 4UW6A 2WKKA 5DZEA 4FOVA 2D44A 4YW1A 1LENA 1NLSA 2W08A 4GA9A 4Q1PA 4Y1XA 2NN8A 4XBNA 2ZMLA 3M2MA 2GMPA 3TB0A 3MW3A 4C1WA 1Q56A 2LALA 2WLQA 1WCSA 3ZXFA 1AXYA 2JDZA 1KITA 2DVAA 1DYKA 3INAA 4K21A 4LBKA 5LK5A 1CPMA 2D6PA 3MEPA 2GNMA 4NO4A 2R49A 4Y1ZA 3WZ1A 1BJQA 3N7MA 5JOWA 1LOAA 1S0GA 2DVDA 2P3JA 4Y20A 4W65A 2D43A 2SBAA 4IQPA 2D6OX 1ONAA 2CTVA 5JOZA 1D0HA 3N36A 1G86A 5IK8A 1IOAA 4FPCA 3IKWA 2ZAAA 3RQ0A 4AVSA 1SLBA 3FUOA 3IMNA 2AENA 1GZWB 4XTPA 5F9TA 4YM2A 1QU0A 3M3CA 4CTEA 1DQ4A 1ENQA 2W52A 4M3CB 2EXJA 3ATGA 2JE7A 4YM1A 3ILRA 1UL9A 3VKLA 3ZSJA 4JC1A 4XXPA 4DPNA 4YZ3A 5IK7A 5CBLA 2VUAA 3AJYA 4XIOA 3WDYA 3I8TA 4FPGA 1S0BA 1SLCA 2UWBA 1RIRA 2NYYA 1S0CA 4Q27A 1Q8QA 2R0HA 5H9PA 5T55A 3UJOA 1W6MB 3OGGA 4MYEA 5DUXA 1V00A 5KXDA 3KQRA 3WUCA 1UMZA 2NMNA 4Q1RA 4XXAA 2D6NA 3BIWE 3OY8B 1Y7BA 1N1TA 2XG3A 5IK4A 4ISQA 5GZCA 1QNWA 2ZHLA 5DG2A 1WBLA 1LHVA 1URXA 1UX6A 1N3OA 4NOTA 5T52A 3LSEA 4ASMB 1V6NA 4XMAA 2WSVA 3QLQA 4BM8A 1OFSA 4UW5A 2ZGOA 3POYA 1NXD1 2GMMA 3SH3A 1LU2A 5CNAA 2DTYA 3AK0A 4JCKA 5JOXA 4KBBA 3JUUA 1H30A 1HQWA 2AUYA 2ZMNA 1VAMA 4Y1VA 2D6KA 1ULCA 3ILFA 1YO8A 1X50A 2G4IA 5EXOA 5GLVA 5HCBA 1H9WA 1CPNA 1SLTA 2E53A 2WQZC 2GNDA 3ASIA 4SLIA 5JLVA 1RITA 1W6MA 4YZ2A 4BOWA 4M00A 3AYCA 4XTMA 1UAIA 4Q8LA 1FV2A 1LEDA 1JUIA 2DTWA 4FQ4A 3MPPG 4P9WA 3W59A 1ULFA 3ZSLA 2YMZA 3I4IA 4P9YA 3L2YA 4XJ9A 2ZHNA 1GZ9A 1S0DA 3GALA 4U2AA 4XJUA 4BQ1A 4YFZA 1HLCA 3ZSKA 4YM0A 3WCRA 4K1YA 4M3CA 5DZFA 3AYEA 3V0BA 3WDTA 1GNHA 1GLHA 1FNZA 1QNYA 2A70A 1UPSA 4BLIA 2VU9A 4XBLA 4LBQB 5T54A 4FPFA 3B00A 4XOGA 3W58A 4ATFA 1QGLA 1JYIA 2D3RA 4GKYA 4P14A 1CONA 5IT6A 1FAYA 1DQ1A 1LEMA 1LHWA 4Y20B 2VW0A 3VUOA 4LBJA 4YZ1A 2NMOA 1AZDA 1GICA 2KM2A 2VXRA 2YROA 2ZGRA 1WD3A 4FP3A 5GJ6A 2D3PA 1JW6A 1YRZA 1WW6A 1C1LA 4XIKA 1LGBA 3WOGA 3AJZA 1JHNA 3AZXA 2ZGKA 1Q8SA 1F9KA 1YYNA 2FMDA 1G9FA 4M01A 4LBNA 3IN9A 1IS6A 1ULEA 2PHWA 2GDFA 3JU9A 4L8QA 1MS4A 1AJOA 1GBGA 2A3WA 2VH9A 1N47A 2JECA 4AVTA 5H9RA 2D6LX 1AX2A 1LOBA 2GALA 2PHRA 4YZ4A 1V6JA 4FPEA 1S0EA 2PELA 3ILNA 4FVVA 3OBTA 1MS5A 2PHXA 1LGCA 1GZCA 1MS3A 3N7LA 5DXDA 3V0AA 1C57A 5EYXA 1J1TA 2R0FA 4Y22A 4GXLA 2I2SA 3AXDA 4FPJA 1G9AA 2EXIA 2WT1A 3APBA 4XJ8A 3USUA 3WHTA 4AGVA 4BMEA 4BLJA 2AH2A 2ARXA 2V73A 1W6NA 4XJAA 5JMCA 5GZEA 3D5OA 3AFKA 1A78A 2AREA 4UW4A 1WW5A 1SLIA 1V6OA 1QDCA 3PVOA 1JBCA 5H9QA
chains in the Genus database with same CATH superfamily
4L0PA 4A3XA 3HQXA 5DDJ3 5KXCA 3POEA 3NMBA 3ZFFB 3RYKA 3WY6A 1GP5A 3T0BA 4F3JA 1VIWB 1R092 3HBKA 3LIHA 4K1ZA 4RQPB 5E6HA 4BQXA 1AR62 3SQOA 3CF6E 2XBO3 2G9FA 3VDDC 4QPYA 4D7TA 2GN7A 3LFIA 1Z78A 3TNQA 4GMP3 2XJTA 5AC91 4LBOA 2QDNA 2DVBA 5JXGA 1VBD3 5AVPA 1SCRA 2RR11 1OHFA 2XLGA 3FUQA 3AKRA 3IBMA 5F7UA 3GNEA 1ZBE2 3A0NA 3H1MA 4FPLA 4GWMA 4ZU7A 1RUJ3 4EV0A 3DUIA 4QQHA 1GANA 5F5QA 2LROA 2OPKA 4N7UA 4PIYA 1W8TA 4WVMA 1VALA 1W6NB 3HIFA 4Y4RA 5DUUA 1JODA 3WG4A 3ZYFA 4DXRA 2ARBA 4Q4W3 1UU5A 1ENSA 4DY5A 2HJIA 5LBFA 4LE4A 4Y1UA 4YVSA 1HXS3 4MGTA 1OOPC 3RZHA 3SLIA 2FHRA 4QKFA 1OOPB 2RG4A 4LBQA 3KT7A 4PF1A 1ASJ1 4XF9A 3H8OA 3CJIB 3GCWA 5FKCA 2BQPA 2LW8A 2WJSA 2ET1A 2B46X 3H8XA 3WNMA 2DCTA 2VW2A 2YXSA 2WFF3 4H55A 3VBRA 1ZYBA 4LR4A 5AC92 5F2SA 3WLUA 3MDPA 1UXZA 5DUWA 5BYNA 3TBDA 2A6XA 5CEHA 3OUHA 1KEXA 2BUKA 4P9XA 2ZXQA 4XZUG 4IEWA 5FY7A 1CAUA 3PIGA 3I59B 4Q4V2 3K77A 3ZYPA 4RSUA 4EZ4A 1KGYA 2TNFA 2NZ9A 1VBA3 1TE1B 1J1LA 4OUSA 2WO1A 2BFUS 3WNNA 4CCCA 3VDDB 5ACA1 4MOAA 2DVFA 2GNBA 1UYYA 2RS13 3IPVA 1RUH2 2FCVA 2O14A 1NE4A 4A2UA 2JDNA 3FC0A 5JIUA 1O4ZA 4M3CF 3FHIB 4LHSA 2XWBB 1BK1A 2WINB 4K20A 4QX1A 3VBUA 2EIDA 2CWSA 3KGLA 1ASJ2 1BQPA 5JXHA 2HWB3 4FO9A 4PCRA 4TYSA 4BA6A 2YGMA 3RZKA 1W06A 3B3QE 3ZN5A 1Q5OA 5C33A 5K0UB 1V6MA 5HV0A 1VR3A 4KGQA 2O8OA 1EAH1 1UIKA 1V0AA 1SQ4A 1OBNA 1UMIA 3U0ZA 5C9AB 5H9SA 4OHXA 1DBNA 4GB31 1J84A 4O9EA 4B29A 2J1EA 4HKOA 3P3PA 3PJYA 2OUJA 2WFF1 4A45A 2Z5WA 3M3IA 1R081 4LHNA 2XH6A 3NO8A 5A6YA 2C9AA 1ENXA 5JPMB 4YLZA 4IV1B 2HKXA 3IZOA 4LA2A 4YW5A 2ZGQA 4RS5A 5DPNA 3CNAA 1VP6A 4R9BA 4RQPA 1WLCA 3U78A 5C3SA 2D6MA 3EXUA 3MYXA 1YI9A 1S0IA 4NRQA 3AZZA 4QHOA 1MS0A 3VKOA 3UK9A 1R1ZA 2VZTA 4DFSA 1NA1C 2XHNA 5L73A 5JPNB 1W0NA 2BNNA 2VMFA 3DGTA 2XHKA 2WO3A 2W1QA 4Y33A 4Q0SA 1UY0A 1UN1A 2A71A 3HT1A 2DBIA 1S2KA 3LCPA 1NY72 3I49A 5IJRA 1UU6A 3BPSA 5ABJA 4S2DA 3VBUC 4BQWA 2VJXA 3NWKA 3EBRA 3FLRA 3L2HA 2FDHA 1TMF2 4MHUA 3H1YA 4XMIA 1S55A 2D7FA 2WNVC 5FZ3A 2GNTA 1WLWA 4FXGB 4LKFA 4X6RB 5A7WB 5SV5A 5FXXA 4AGGA 3POSA 3KCXA 1OF4A 5F3CA 5FP7A 5BUVA 5FFOC 1HX6A 5GZGA 3U37A 1S2EA 1GKBA 3N9NA 5E89A 2H6CA 5FZHA 2K2SA 3JD71 1DGRA 4CXXA 2K0GA 4DRVA 1DFQA 1FMD3 1SFPA 2CAUA 1IKQA 5JSPA 2CU5A 4P9GA 4UYBA 4QB1A 4BQYA 3PUHA 1QXJA 2WT0A 3EO6A 3PHMA 5JVVA 4WZFA 2P6CA 4I2OA 2JG9B 4MUVA 2R32A 1G9CA 4LTAA 1YWKA 3OG2A 3SH4A 1QWRA 3AYDA 3MLLA 4LORA 3RS6A 4FTSA 4NWVA 4XF3A 5A3MA 1GQGA 1VBD2 2ZABA 3LAGA 4OI4A 4B7KA 5A7NA 1OQ1A 3J7MA 2RJLA 1ZBE3 3BN6A 2WC2A 3KF3A 4I0WB 5JDBA 1QOOA 3IDEA 5JOYA 3E6CC 3I2IA 4N90A 2D97A 3O0XA 4RGGA 1SHWB 2MEV2 4R9DA 4RN5A 1UY1A 1W8FA 2P37A 4N53A 5FYMA 4OUEA 2X10A 4A4AA 5LEKA 5FY4A 3LE0A 4XDQA 2PLV3 3UYJA 2XJUA 3IPVB 5DG1A 5TSWA 1S2BA 3NKGA 1ODNA 2W95A 1HB3A 1E5RA 4MXWB 4CDXA 2DDUA 3THCA 2EIBA 1CAVB 1YJLA 1PGL2 3OOXA 4WVVA 3HEIA 4NR1A 4Q4Y2 4W4ZA 4Q2FA 2ZGPA 5B2GB 4JQRA 1EY2A 1W99A 5BNPB 4JV4A 3UETA 4XUQA 1UZYA 5F6KA 2AACA 3SISA 1WCKA 3DYPA 3H7JA 1RYYA 3ZFGB 2FDKA 4LNVA 2Y26A 3VBRC 2RE9A 1RUH1 2WZR1 2DCKA 4HVQA 1VBD1 4YVSB 2EF6A 1QJU3 5DAVA 2XQRA 1QOSA 3QCWA 3SCGA 3A7QA 1RUE2 1X33A 2AR6A 3CLPA 3LEIA 1AR92 5DAWA 4COVA 4CPBD 1V70A 5AFEA 2XBO1 3AVSA 2QTWB 4G3YC 4GULA 4Y5TA 1MZ6A 4C91A 1YIFA 2E33A 1W8NA 1NCRB 4XJZA 5FYHA 1WBFA 5M0TA 3OPTA 2PQQA 1N3QA 2OT7A 3VV1A 2JDPA 3OPZA 5FZLA 1N1VA 2VNGA 5FUPA 1W6OB 4AVVA 2P4EA 2RMU2 3MO4A 2QQJA 4UFMA 3ZR6A 3T2TA 1OLMA 2R073 1RUH3 3SH5A 4XUNA 1VMHA 4JGYA 3W5MA 2HWF3 3I3EA 1IGOA 3RVHA 3IWZA 3ZYHA 1CVNA 3SKJE 4E2GA 1PVC1 2ZGSA 4P9IA 5FZCA 2A75A 2Y6FA 5FIXA 3NSTA 4N7IA 2HWB2 3MFAA 2UY8A 2D5HA 1JMUB 4BQ3A 1W8ZA 2RDNA 1YEWA 3HNYM 1B09A 3ENRA 4KG0A 3OYWA 4ET7A 3M4FA 4Q4X1 4EWEA 5FOJB 3OBRA 4XE9A 1RUOA 3VBSA 2CL2A 2WZR2 5T5PA 1C4RA 5CA6A 1GR3A 1MS9A 4FOYA 2MPFA 2ARCA 1BVP1 5EJ3A 1RUE1 3OGRA 5FREA 4Q8KA 3FLPA 5A33B 4I3GA 1T6GC 3WNOA 4OQ8A 3FFQA 2QBXA 5CFCA 1BYHA 3GJAA 3VL8A 2VOXA 2XMLA 5BPXA 3VZKA 4A7YA 1VLNA 2RJ2A 2R1DA 1S0JA 1TMF1 2LS6A 4FCAA 3H50A 1ULOA 1CZSA 2BGPA 3HQUA 5IUQA 2VAUA 2BZDA 3CDZB 4GWNA 5BNNB 5J36A 1OA3A 2A3XA 1MS1A 4H7LA 3RSJA 4BWOA 1DQ5A 4AEDA 1A6CA 1EAH3 4YM3A 1OVSA 3ETQA 3OUIA 3S5QA 3JQWA 4AGRA 2HWB1 4FOVA 1NLSA 2XKOA 4GA9A 4UF0A 1IHMA 1WMFA 1GU3A 3Q8FA 5L7OC 1C5HA 3M2MA 5JZGC 4FFGA 2XUEA 1VRBA 1LR5A 4QQ2A 1SDDB 1WCSA 4AW7A 3VGIA 5JXIA 5FUIA 1UKRA 1VBE1 2DVAA 1DYKA 2LUWA 3K4DA 4LBKA 1CPMA 4CCJA 4FSJA 2GNMA 4NO4A 2OA2A 4RYDA 1AYM3 1BJQA 4G4FA 1FMD2 4IGOA 1S0GA 4KQ7A 4FTBA 4Y20A 2WNVA 1PIV3 1SPPA 2D43A 4MGIE 4YVSC 2C26A 2D6OX 5IVFA 1OPOA 2MEV1 5IK8A 1IOAA 4CEYB 4KI5M 2R041 1GOFA 5CADA 5HI0A 1UYPA 2JDMA 1D7PM 1SLBA 3K51A 4NHKA 3VBSB 4AFBA 2YUEA 4YM2A 1GZTA 5KC5A 3M3CA 5FYVA 2W52A 4N8MA 3ZSEA 3KV9A 2C0ZA 4L9BA 5A33A 3ZSJA 5FOBB 4UFHA 4RHV1 2J1AA 2Y6LA 2ZX0A 4DPNA 4AAPA 2VUAA 3AJYA 1CAWA 1DGRN 4XIOA 1X36A 3OCPA 5FZ7A 2FDIA 4LA3A 1L7QA 1VBC2 1S0CA 5IAVA 4AI2A 1W39A 2WYSA 4HETA 4QB6A 5H9PA 1HV0A 5EFUA 3IAQA 3TRSB 1L7LA 3JXSA 2TUNA 2VZQA 3OGGA 5KXDA 3WUCA 1UMZA 3LOIA 4GJZA 5IVEA 2D6NA 1GQPA 3BIWE 4KBZA 4W6WA 4XQWA 3Q8BA 1YHFA 2XG3A 4XF0A 4IGQA 2OZ6A 3OEAA 2ZHLA 3E5XA 5DG2A 4B4PA 2W9XA 4HN0A 3PVBB 2QCSB 3JB8A 1XOYA 5EPAA 1AL22 4ASMB 1YQ5A 3MIDA 4AQ6A 4EQVA 2IVIB 2VCBA 2ZGOA 3POYA 2GMMA 4QXBA 2JG9C 4XCBA 2DTYA 2RMU1 3AK0A 4JCKA 1MQTC 1OKOA 1RUC3 1W90A 3JD73 1HQWA 3E1F1 2AUYA 1MEC3 2OQ7A 3UKTA 1AYN3 2D6KA 5FPVA 5FZ8A 4NIIA 3ZYIB 1AR93 1YO8A 4AEKA 4ES9A 4QPGB 4RHV2 5FR3A 4QX5A 3RNSA 1H9WA 5ISLA 2E53A 1RUI3 1XRUA 3GXUA 4IERA 2IXJA 4I01A 1W8WA 4PT6A 3ZN6A 2HBUA 3EMRA 4M00A 3IIIA 4C0BA 1F8VA 3RFRA 1FV2A 1P8JA 1RXFA 1ULFA 2VUDA 3I4IA 4P9YA 1YC61 5FPXA 3RZGA 4X8NA 3B94A 1NCQC 4CEWC 3KB5A 5FXVA 2OYZA 3C7GA 4UF0B 1C5IA 3T2QA 4U2AA 4PDWA 3MIFA 5F37A 1WMEA 3ZSKA 1BK0A 3OBAA 3WCRA 4M3CA 4N43C 5DZFA 5C8WA 3BIEA 2VZVA 2A70A 4IE6A 1UPSA 4BLIA 3T0DA 1PGW2 3LEMA 4IGPA 3J8F2 5T54A 5C9AA 3B00A 5I93A 2E26A 2V4VA 4ATFA 1QGLA 5FYSA 4URAA 1ASJ3 1JYIA 4P14A 4D0QA 5IT6A 1WA4A 4NPRA 3VDCA 5C4WA 4LE3A 4UFLA 2PAEA 1BBT1 2HWD3 1LEMA 1ZZCA 1AR72 1NQDA 3LF7A 2JG9A 4XF4A 4Y20B 3S57A 5JIAA 3I2OA 1Y9QA 4UFIA 4IV1C 2RS32 4W8JA 3VUOA 4DEVA 1QY4A 3OSDA 5LW9A 2VXRA 5IFPA 5JR7B 4FP3A 2VMDA 1K45A 1W04A 2JG8B 3TNPB 1UU4A 3LA7A 4QB2A 3SKVA 2QQUA 3AZXA 3W5NA 4RR3C 3O1RA 1YYNA 1F9KA 1FPN1 1XE0A 1YFUA 4OVEA 1X82A 4M01A 4LBNA 1IS6A 1O3QA 5K0UC 2RM21 1JYTA 1AYM1 1UY3A 3AMQA 4MG2A 4BQ2A 1VJ2A 3I59A 2JECA 3HN3A 4CDXB 5FO7B 3Q8AA 4HK8A 1AX2A 5DQ0A 4YZ4A 1E5HA 1V6JA 3K48A 1ZRCA 1QQP2 4A42A 2YDEA 5FZ4A 2PELA 3ILNA 4FVVA 4GJYA 1IG0A 4PLMA 4GD4A 3IDAA 2YBSA 2AZ5A 2YC2A 4HSLA 4CA9A 2VMGA 3FE5A 4FPJA 4K3UA 3QOPA 3SCFA 2VBBA 1C28A 1UY2A 4RR3B 4ZS2A 1J83A 1NLRA 1W6NA 2VZ1A 3DF0A 4AEDB 4Q4V3 1RJ8A 1W3XA 1A78A 3CZJA 2RS31 4UW4A 3VBHA 1JZ7A 1CZTA 1SLIA 3D82A 1AL0G 1BBT3 2BOIA 2YC4A 3BKZA 4P9LA 3SHRA 1LB2A 4IV1A 2ETEA 1ULPA 2B8MA 1PVXA 4P5HA 5H9QA 2YB7A 3ZR5A 4CXWA 1UQXA 2G9ZA 1KD7A 1MZ5A 2WWUA 3WQ7A 2GC0A 1FPN2 5LASA 2VXJA 4FPYA 3AB0A 2C4XA 2B5HA 3WVJA 5FMBA 3N9LA 4B1MA 2OUHA 4RS5B 1FV3A 2W2IA 2Z79A 3WEZA 3ZIXA 4XFCA 5CISA 3GGLA 2WQ8A 3PDQA 5JZGA 4N43B 2UYBA 3LIGA 5FZKA 2P2KA 1BLZA 4JGYB 1QQP1 4M4PA 4ONUA 1OQDA 5A1LA 1V6LA 3AXEA 2OS2A 4DINB 4E4HA 1TNFA 3H3LA 5L36A 1GZWA 4HSJA 1JYXA 2D5FA 2DFCA 3O0WA 5EJZB 1FNYA 2Y0IA 3PU3A 5J48A 1CIWA 2QQIA 2DU0A 3AL6A 1H2LA 4JVAA 5KHJA 1LOGA 1ZREA 3ZYBA 1MR5A 2E6VA 3C7HA 2PHUA 4CU6A 4K7JA 3UJQA 1K5MA 4MZUA 5GM0A 2ZACA 5KXEA 3AZVA 1H8TA 3LA2A 4K6BA 4XZPA 3VHPA 2QKDA 5EJ1B 1CAUB 1SG3A 5EV7A 4QPIC 2UWCA 2HLEA 4M0HA 4E9KA 5BY5A 3AVRA 5LY1A 1KFUL 1O6UA 3PJQA 1W0OA 3PURA 1WMXA 3R4UA 4P08A 3V0AB 3WR0A 4PIZA 3VDDA 1LOEA 3H7YA 5GLUA 4Y5SA 5IFTA 1RXGA 2Y6JA 1E5IA 1WW4A 1WZXA 4GMP1 4Q26A 5FTTC 3NKTA 3ITQA 1TVGA 2CYFA 3WP3A 3ZMOA 4LLFA 2VZSA 1RHI3 4CVUA 5IK5A 2ENRA 3ZO0B 4CCLA 2GMEA 3PMSA 5C3PA 4E8CA 5FYTA 4A6OA 2DYCA 1Y9MA 2VUJA 5IVVA 4P5YA 1CZVA 3N7KA 1TMF3 2VD7A 4IEVA 2GP3A 1F31A 3AKPA 3T2PA 4D69A 4DS0A 2BDRA 3AZYA 3DL3A 4YW6A 3GYDA 3J8F1 1VMJA 4GALA 5T5JA 1PMIA 3ELNA 5E8AA 2VMEA 3ZXGA 2DUOA 1QXPA 3NNJA 1RMU1 1AR71 3POBA 1W03A 2GH2A 3IT8A 5CVRA 1UYZA 1HXS1 2VBPA 2LTNA 1W9SA 3E6BA 3FJSA 3EB7A 2JD9A 3E97A 1NE6A 3N3HA 4YNIA 3RPQA 2VECA 2VNRA 1UCXA 4C90A 2JE8A 2HWE1 2HWF2 3CIHA 3OGJA 4R4ZA 3TWIA 4HOOA 2UYAA 3J8F3 5DAPA 2IFWA 4J1XA 4UBGA 2XGXA 1TZOA 4QQLA 4UI9L 3VBSC 3ZKUA 1ND3A 3R4DB 4H3WA 5EYYA 2ATFA 4OQ9A 4CPBA 3FZ3A 2J1SA 1ZZBA 3M3OA 5F6LB 4AI3A 2RM22 1RUD1 4CEYC 1AR73 5D2AA 1XNAA 1XC6A 1H1AA 1JZ6A 1O59A 1V9U1 1YFXA 2E7QA 2RS33 3O14A 3OY8A 3ZDSA 2MEV3 3ZOIA 4A44A 1XNKA 4BJ0A 1RL3A 2PQSA 2QQWA 2RV9A 2Q8DA 1GWLA 1UMHA 2W1WA 5LBCA 1O8PA 1W9YA 4A6SA 4CP9B 3WDXA 2WT2A 4QM8A 4MGKE 4IE4A 1FT9A 5IW0A 2RHPA 1AYN1 1YQ2A 5IVYA 5JZGB 3RYPA 3A4UA 4OMCA 4AQ2A 1MVEA 3JB4C 2B9VA 1DGWX 1LOFA 1L3JA 2X8KA 3DKWA 3MIHA 3Q9OA 5I8YA 5LY2A 5JI9A 1LAJA 2JJ6A 3W21A 1VPHA 1BZWA 5KXBA 5CG8A 1HDKA 1IPJA 4CXYA 2KXLA 4CYDA 4QXCA 1W6OA 5JUVA 3D8CA 3ZYGA 1R1A1 4XILA 4AI9A 4JTNA 2ZEZA 1YJKA 3FLTA 2N7GA 4WM7C 3PVEA 1VBB3 2CGNA 4RFRB 4IEPA 5F8PA 2Q8OA 3HT2A 3UL2A 5IWFA 1U0AA 4TZDA 5DAXA 5EIYB 2VNOA 4E8DA 4CDQB 1SFYA 4XABA 2GZWA 5LA1A 5DN2A 1OMIA 3CO2A 3BTAA 2VNVA 4ZKTB 3MW4A 3S5AA 5FPUA 1RUD3 3BGAA 3MF6A 4H2AA 3OYWB 4AYUA 3FBYA 4CDUB 1LHOA 1OI6A 4P02B 1XJAA 5FUNA 4IUGA 3AP4A 1BEV2 3O7OA 5CFDB 3LA3A 1YIPA 1NZIA 2J22A 2XJPA 4LBLA 2QZ3A 1PGSA 2EIGA 1EPWA 4SBVA 5CKMA 5EQUA 5D21A 1WWYA 2HYKA 4M3CE 4D6QA 1RJ7A 1ND3B 1ST8A 4PBPA 2XJQA 1H8VA 1KXGA 2R30A 1QHDA 4B7EA 4XBQA 3J4UH 5CKQA 1NT0A 1W9TA 1SFNA 2E31A 4OZOA 3PMEA 4MX3A 3BUCA 1GP4A 2G9GA 2O1QA 4H14A 4EYUA 2ZCWA 1D2SA 5KHIA 3T09A 1YUDA 5FRAA 3HJRA 2WNEA 1AR83 4I3PA 1TME1 2D93A 2VZUA 2WS92 3ACLA 3KM5A 1QOTA 4GMP0 1ZZ9A 1C3HA 5CYYA 1DQ0A 2WR9A 1WCUA 1NCRC 4OLLA 2GP5A 2R1BA 2H0BA 5C8CC 2ZA9A 4AQTA 4QWNA 4QHBA 3RG0A 3U75A 4MLOA 4RL7A 1JTZX 3RYRA 1W6QA 3OJBA 4EWAA 3N9MA 1SPPB 4IEUA 1LECA 3LDBA 1Z7S3 1DIWA 2QQMA 1AXZA 4NIAA 1FX5A 4MXVA 3VL9A 1D4M1 4WM8C 3HWJA 4QT6A 4N43A 1GYKA 3BI3A 2ZX1A 1LJ7A 4LIVA 2DV9A 2XXZA 4OYUA 3KF5A 2C1FA 3SITA 4XJWA 3MIEA 1LHNA 1W6QB 4LKEA 3RMYA 2IUWA 4GQ7A 1M4WA 1Y43B 4LO6B 1S0FA 5LRSA 2OXBA 1NUKA 3EJKA 2JKXA 3E5UA 2QZ2A 4GWJA 3ZIWA 1W6PB 4CDUA 3AP9A 4CZSA 4HVOA 3AC0A 2DF7A 2VOKA 3VZOA 2JEMA 4YW3A 2GH8A 1RUF2 5CFCC 2JIGA 3N35A 4LHKA 4N9IA 5HCAA 3VKFC 4ITCA 3DKQA 3H0OA 4NIDA 4QQPA 4IV3C 3RI8A 2Y34A 1YQ8A 2P3KA 2ZGNA 4ZZ8A 3OTFA 1H4HA 1KDKA 3BYWA 3THPA 1HB2A 2PLV1 3AMHA 1RUG3 2FCUA 1T2XA 4A7KA 1PIV2 3AM2A 4I30A 4IESA 3AMPA 4Q4W1 1F35A 5CZKA 2YYOA 3T30A 4JGZB 4Y26A 1SBDA 1OH3A 3KLSA 3UGFA 2ES3A 2PHTA 3GZAA 4CUGA 2DCJA 1JN2P 2IXCA 4AR2A 2FBEA 4PF5A 5F5AA 1XQNA 4XAEA 2Q30A 2VM9A 2IWGB 4L97A 1UX7A 3GCXA 5IAXA 2VW1A 3TN93 1FATA 1OQEA 5FXZA 3CL1A 1ULDA 5KHKA 1QH6A 2R071 3ZFFA 1UF2C 2XKPA 3ACFA 3R4SA 4K9SA 3M1HA 5F2WA 2K9ZA 2VVDA 3CKHA 1HIXA 3QD6A 1IKPA 1LODA 5FP3A 1RB8G 1W3VA 1YXWA 2I45A 3C3VA 5FDBA 1KJRA 4ZXKA 5HCHA 1QMJA 5DABA 2BFUL 1JU3A 3GHMA 2WNVB 3ZXLA 3MLKA 3MBWA 1T6BX 1N1SA 2EXKA 4HFSA 1H2MA 4KNCA 4E27A 5DDJ1 2D98A 1OKQA 5FYZA 1SLAA 2WL1A 2OPWA 4RA0A 3VBUB 4XYXA 2JB4A 4PQ9A 2X09A 2W46A 2L9LA 4R9CA 3H1WA 1CGPA 1W6PA 1D4VB 3BOWA 4A3ZA 1WLDA 2VUCA 1CJPA 2XVKA 3NJZA 2GC2A 2CWMA 2ZAHA 4XFAA 4LPLA 4HK9A 3WDUA 2Q4SA 2B45X 2WYFA 4OI0A 4K8FA 4P9JA 2WQ4A 1NA1B 4D3WA 1RUC2 3OF1A 1H9PA 1PO13 1UIJA 2XJRA 1QQP3 1MEC2 2W08A 2WNUA 1JZ3A 3PUIA 3KHCA 3KVBA 5A6ZA 4RHV3 4L11A 3BTXA 1RUI2 4GIQA 2B39A 3CMGA 1REFA 1XNBA 1PO23 2Z69A 4LLOA 3VBFC 5CG9A 5A7PA 3ZXFA 3MICA 2C24A 1QJY2 2VMHA 4N9HA 3JZVA 2R7EB 3MEPA 1JS9A 2WZEA 2R49A 4Y1ZA 5JOWA 2DVDA 2P3JA 3CU7A 3I2HA 2WS91 1W2AX 4BHPA 1ONAA 4COUA 4ZY9A 3N36A 1NX9A 4OHWA 1O91A 3RQ0A 1QJEA 2NLRA 1LRHA 3IMNA 2AENA 1GZWB 2EAAA 2I07B 4XTPA 1H8TB 2ZS6B 2XDVA 2PMWB 4DZGA 3HOBA 5JMOA 3ATGA 1WCDJ 3VKLA 4XXPA 2HWD2 4GAZA 2BJSA 4QX8A 2QUOA 3K3NA 4IEYA 1OA2A 5CBLA 4DXZA 3WDYA 3I8TA 4KWKA 5FAXA 1SLCA 2P17A 1RIRA 1UYXA 2UWBA 2VGDA 4XDPA 4XPVA 4PHZA 5L9BA 5BV6A 1Q8QA 3WNKA 1YNAA 5T55A 2XWJB 1X9TA 1OXCA 2DCYA 1MPXA 5FJKA 2JWPA 2O0OA 1V00A 2NMNA 4BK4A 1VBA1 5CFDA 2RDRA 1XU2A 3OY8B 3BCWA 4JDOA 5IK4A 1UZVA 4ISQA 3VDAA 5A80A 3VBHB 4CUBA 1QNWA 2B9UA 5GZCA 1LHVA 4IEQA 4NPMA 2YBPA 3LPFA 4NOTA 4PJYA 2F6BA 1RVF1 3LSEA 4XMAA 1US3A 3UKNA 1ZZ6A 2WABA 1OFSA 2XL9A 4AHWA 2E63A 4TTGA 5FP4A 2IXHA 4UW5A 1LU2A 4S2HA 5JOXA 1HRV2 2ZEWA 3JUUA 5FY1A 4YPJA 5L9VA 5HBAA 1H30A 1VRH1 3W20A 3RZLA 1HW5A 3ON7A 1RUNA 1O7FA 1NCRA 2YBKA 3MIGA 5FYBA 2R061 3KD4A 3ILFA 1EV12 3NNMA 3MUZ1 2IC1A 4I09A 5EXOA 4Z07A 4BQ5A 5KBFA 2DFBA 1JYNA 2GNDA 1YQ6A 4EN6B 3UT0A 1W6MA 5JLVA 4BOWA 2HEWF 3FX3A 3AYCA 1R083 3J26N 2W3JA 4GH4A 4FQ4A 5LA2A 3GBGA 3FHQA 5A1FA 2HWC1 5HV4A 1DCSA 5E16A 1VBB1 2WA3A 4XJ9A 1OD5A 3WF0A 4BYYA 4NWWA 3HNBM 1ZRFA 2W0XA 1AR63 2LRPA 2BV4A 4YM0A 5JXJA 1H6YA 2ZPXA 3LFMA 1NOVA 2W91A 2Z2SB 3I2KA 3FN9A 3SEEA 4NRPA 1GNHA 4YVWC 3LKJA 1FNZA 4JHTA 2O8QA 4FTEA 3WQ1A 4XOGA 4GZ9A 5F1RA 3F2ZA 3GBFA 2RS51 1OURA 3OGSA 2X29A 2VR4A 2D3RA 3RDIA 2Y6GA 2RM23 4CCEA 4CSWA 1DQ1A 1RUJ2 1VRH2 2FMYA 1W2OA 3AMNA 3ZFFC 2ZJCA 5ACA3 1GOHA 4OI2A 5D8AC 1PX4A 3S7EA 1MQTA 3NJVA 1NQJA 2R062 3M7AA 4LBJA 4YZ1A 3VD4A 3PLQA 1AZDA 2YROA 1WD3A 4UWDA 3GJBA 2D3PA 4FBFA 1WW6A 3Q8CA 1UD1A 4XIKA 1OSGA 1U5ZA 2H0VA 1JHNA 3AJZA 3WOGA 2HWC3 3MLJA 2FMDA 1G9FA 4AOCA 1R091 3MUY1 3JU9A 4L8QA 4E2SA 2JDHA 4TN7A 2BGOA 3S7IA 3SCHA 4QHZA 3IAPA 4AVTA 5FYYA 4CCNA 1XSRA 5A7OA 1IQAA 4FPEA 4B3NA 2XONA 1RHI2 1YCIA 5A32B 3GZTB 3ACGA 3KV5A 3I54A 4PDWC 1MS5A 2PHXA 1MS3A 2WFF2 5FMOS 2OKXA 3B5LB 3HNMA 4HPKA 1ZBE1 1US2A 1H1IA 3QH6A 3AKTA 5EYXA 3KV6A 3T3YA 4BIOA 3X29B 5EP9A 4NIGA 3ETPA 3G6JB 2ORZA 2WT1A 3NW4A 3USUA 4AK3A 4AGVA 1Y3TA 3B7MA 4OHVA 4LK6A 2ARXA 3MGUA 5A3TA 3WW4A 5GZEA 3D5OA 3CHXA 1ZNPA 1J59A 4QDQA 3OBZA 3LOBA 1K5MC 1QDCA 3T2OA 3PVOA 4ISRA 4OULA 5F32A 3NAPC 3S30A 4HN1A 3AP5A 1WA6X 1OPMA 2BRTA 2RR13 1Q8OA 4NPLA 4X8PA 4YGEA 2PYTA 2VPVA 5FY8A 3DXTA 5AVAA 3WF2A 1DU3D 1TEIA 2ZGMA 3ECQA 1SZBA 1DZQA 4WM8A 4WVMB 4W6XA 3WG2A 4O9GA 2JICA 5T3NA 3C7FA 4E4ZA 3POIA 5SV8A 1CAWB 1CN1A 1F5JA 3SNMA 3MV01 3AFGA 4F8AA 4LUMA 4LO7A 5C8CB 1J58A 3FMGA 3CEWA 2WNUC 5LB6A 5C3OA 3FFZA 4ZPIA 1JZ5A 1W28A 2W39A 2W5FA 2ZZJA 1QDOA 4LBQD 3ZMNA 4YFWA 3U11A 1DQ6A 4MO3M 4CRQA 5DMYA 3OD0A 5FZDA 2UURA 2XUMA 4NHXA 1N3PA 1HRV1 5EWSA 4JHZA 3WG1A 1BKZA 5K9YA 4BISA 2EXHA 4CE8A 4XCAA 1EV11 2XB6C 1MVQA 2ZHMA 1GWMA 4ZHNA 3WCSA 1AJKA 3RJRA 2EAKA 4RGAA 4KWLA 3WF3A 4XFIA 1AF9A 4HPKB 4KG8A 4WZCA 3DCQA 3J9SA 4AFAA 4R9AA 4DIQA 3G7DA 4JRLA 3M3EA 5A32A 3HR9A 3VBOC 1JZ4A 1BVVA 3F95A 1A34A 3AP6A 4COWA 1HRV3 1G9BA 4AWDA 1V6KA 1B35C 4COZA 1VBB2 5HXMA 4Q4X3 4MXWA 1EV13 2A7AA 5EZWA 2Y6KA 1PZ7A 4I0BA 3PTYA 5EHDA 2V72A 5FZFA 3VHOA 3ZXEA 1WW7A 4QMAA 5A3OA 3ZXKA 4CDQC 3WNLA 5FP9A 1R082 3MF9A 1XBFA 2E51A 1XYOA 2E7AA 1A3KA 2VZOA 2XJVA 3NVCA 4I02A 2WNUB 2BOJA 2IVJA 1D2QA 4HL0A 1AXKA 1RINA 3D0JA 4Z1VA 2V5YA 4MGSA 1RUG2 3AYAA 5GZDA 5D1IA 1UOBA 3CJIA 4ZZ5A 5FQ0B 1DYPA 4BZ4A 4BH9A 3WUDA 4DRRA 3BU7A 5FBJA 2VMIA 3E5QA 4KH9A 3ZKYA 5I8TA 1Q8VA 3POGA 1JU4A 4QU2A 1IQDC 5DUVA 4DUWA 1BXHA 1HN1A 3RMXA 5JSOA 2EIEA 1AR91 3SC7X 4JRAA 1OH4A 2P3YA 2XBO2 3NAPB 4QPIA 4OHYA 3R6SA 5BXXA 2VTXA 4CDWC 1K5MB 3DXUA 4NIHA 1DYOA 2Q8EA 3T08A 5LBBA 3T1MA 1UWWA 4FOWA 3NJYA 1HKDA 2D40A 3VKNA 1W2NA 2WS93 3O1VA 4EZHA 3BTYA 4DQAA 5ANNA 3J7LA 2WN2A 1AHSA 3VZLA 1SBFA 1VAVA 1G6NA 4DY3A 3V0BB 3GBWA 3KT1A 3FBMA 3RWNA 4PDWB 1LULA 3TAYA 1GMMA 2NP0A 2XJSA 4OFGA 4XF1A 4AI8A 5FYUA 2J1UA 3V56A 2CNAA 4XAAA 3AP7A 1RUG1 1JHJA 1SDWA 1QJX2 4Q4Y3 4UW3A 3ZDVA 2BBAA 2IFRA 1O4TA 2A6ZA 3N7JA 4LHLA 4LXLA 2R043 4NRMA 5T5OA 4CCMA 5BNPC 3HD8B 3BU0A 2VY0A 2Y33A 4O7XA 1RTVA 1KRIA 4XHBA 4XEZA 5C3RA 2FDJA 4XFGA 1JOPA 1UOJA 4HANA 4QGLA 2VTXJ 2AC1A 3B69A 4FFHA 3ZLIA 1CWPA 2DCZA 1PM4A 5FZ0A 2DWRA 3ZVXA 5AC93 4RR3A 2VZPA 2Z42A 4QX3A 5A3NA 4HXCA 3VBFA 4YG3A 1XU1A 3U10A 2BNMA 2ADEA 4MHRA 3LB9A 1D4M3 1ZZ7A 1CAXA 1WGPA 2WBKA 1DLLA 3CQOA 2RR12 4XFHA 3ZFEC 3K3OA 2ADDA 1OUSA 2W47A 3JBG2 1Y9GA 3V64A 1PGL1 1WMDA 1YQCA 4FAHA 1I9RA 3ZYRA 2PHFA 4ATEA 4OI1A 1PZ8A 1O5LA 2W1SA 3A22A 2WO7A 2IXIA 4NHYA 3ABZA 3KT4A 1TG7A 2RS12 3KMHA 3NAPA 4J1WA 4QPIB 1QJX1 2X5IC 4UFJA 2KD7A 2YFZA 5FWEA 4OHZA 4MV2A 2BPA2 3O5SA 2SLIA 3VZJA 1ZRDA 3WXPA 4EN8B 2JKBA 4BPZA 2DUQA 2CY6A 2JIJA 3RI9A 3WDWA 2BERA 1WCQA 4CP0A 4PI0A 4HBNA 2WZR3 3O1PA 1W8UA 2JD4A 3B9CA 5A1AA 3WV6A 5I0UA 3R0RA 3VKMA 4D7SA 3N9OA 4Z8BA 3NV4A 4HZFA 5FY0A 2IZWA 1G7YA 2EICA 5FLJA 1GNZA 3SMHA 5C4WB 1G9DA 1LOFC 3LD8A 4C1XA 1H6XA 4AHXA 4YGCA 3VD5A 5LCWL 1H0BA 2JENA 3ZXAC 3VHNA 2R16A 3PL0A 4HT1T 3A0KA 3NQHA 4WVWA 1LESA 4A41A 3WDVA 2HWE3 1OFNA 3V65A 4RS5C 1GOGA 1ZVFA 2AYHA 4C8DA 3JBG1 3POFA 2ZKNA 1ZM1A 4Z82A 3QACA 4AF9A 1RMU3 5DZGA 3ZFEA 1DZRA 1LU1A 4Q4V1 2BNOA 4JDMA 4URTA 1PZ9A 3W9AA 1NCQA 4BCUA 4CEWA 2OVUA 1WD4A 2Y6HA 2Y8KA 5GLTA 4Q4X2 1MACA 5FWJA 2OW4A 3WF4A 1ZA4A 3ZSMA 4GH4B 4AEDC 3SEPA 2YHJA 2VZRA 4LBMA 4OCTA 3DV8A 1PVC3 2WDBA 1X8MA 4LKDA 1KS4A 4MVTA 3WP4A 5FYIA 1A8DA 3DPRB 1A8MA 3ES1A 5KR7A 3DECA 3P5BA 3HN1A 2A6WA 5ANQA 2AEYA 3D6EA 1NXMA 1GNYA 2JDUA 1H8TC 2ZBJA 2ZTNA 3USUB 1XPWA 3JCIA 2J7MA 4AVAA 1VMFA 1BCXA 1GV9A 4N53C 3LZZA 1NAEA 3UGGA 4GB32 2UWAA 2QFEA 4D8MA 5FZOA 4L99A 4Y5Z0 3HPNA 4KGGA 4FPHA 1Q43A 5LBEA 4IL7A 2OQ6A 4FT8A 3KGZA 5FYCA 1DDLA 1GWKA 2IXLA 3OD4A 5FLIA 3HMYA 5K4LA 2JG8C 1UKGA 3THTA 4KWJA 5LATA 3K75B 3PNAA 2NM1A 4YG6A 3VBFB 1JYCA 1ZA7A 2C6SA 1XYNA 3VD3A 4EN7B 4YYOA 2FCTA 2FZ1A 2HEYF 2R063 3ZPYA 4Z2WA 2ZX2A 3ACHA 3B01A 5FQ0A 2A73B 1NY71 2XOMA 2HH9A 4JTOA 2DVGA 5FY9A 5IVCA 2CDPA 4BU2A 2FQPA 2Z4FA 3NV2A 5FBZA 5CB7A 3PIJA 4QKNA 4EJRA 5CFCB 3CJXA 2R042 3M70A 4ZONA 5I0TA 3RRDA 1BMV1 4YARA 1K12A 4YGBA 2WNOA 3IM0A 1SLLA 4IETA 5FMOL 1JI6A 4CEYA 1NCQB 5DAQA 5FLHA 4CEWB 4CU8A 1ULGA 1MS8A 4R4XA 4JAAA 3LGRA 2WAOA 1KFXL 1X7NA 2RDQA 3JD72 3JQXA 1I5ZA 1OLME 2WKKA 2YPDA 4UW6A 1X9PA 2D44A 4YW1A 4XW3A 1DGWA 1XSQA 3RZMA 2QVSB 4Y1XA 2X05A 2RS11 4XBNA 4P00B 2ZMLA 2VMCA 5J37A 2GMPA 3MW3A 4FFIA 2WLQA 3DN7A 1COV2 2P6HA 3KZ4C 4Q0PA 1AXYA 1K3IA 5A6XA 1JYWA 3AL5A 2JDZA 1UOGA 3INAA 1ZBA3 4QPWA 5LK5A 3DPRC 1TME3 2D6PA 1MQTB 3WZ1A 2Q1ZB 2VO5A 4NJ4A 4EN0A 2ZZQA 3ALQA 4W65A 2SBAA 4IQPA 5BNQA 2RMU3 2CTVA 2XVGA 4GH4C 3T0AA 2QQVA 1G86A 5BNNA 4FPCA 3IKWA 4IE5A 4LITA 3O1TA 2VCMA 4AVSA 5JCTA 1BMV2 1FOD3 1OT5A 5F9TA 3J7NA 1ENQA 1HB1A 2EXJA 4QX7A 1C8M3 2JE7A 4Q5OA 4YM1A 3O1MA 3ILRA 4OUMA 4XUTA 1U5IA 4JC1A 2JX9A 3RJ2X 1VRH3 3ZM8A 5ACA2 4YZ3A 2ZEXA 5IK7A 1ALYA 3VB9A 2BU9A 4Q4Y1 5F5IA 4FPGA 1W9WA 1S0BA 4Z92B 1CAXB 2Q8CA 3KSCA 4V2VA 1U12A 4BB3A 4BE3A 3SXWA 1UW8A 2R0HA 1ZRIA 2UY9A 3DEMA 5A7QA 3UJOA 3H3ZA 3ZN6B 5FZBA 1GFF2 3RZJA 4QDRA 1COV1 3KQRA 3LEGA 1DF0A 3N9PA 4NHLA 4QX2A 3C8XA 3PUSA 1VBE2 3NNGA 4DXSA 4CCKA 3GM8A 4LUKA 1FI2A 1WBLA 4QGMA 1URXA 4WM8B 4ASLA 3C7OA 1ND2B 5JI7A 1V6NA 5FPBA 2WSVA 3QLQA 4PI2A 4S2FA 4XFBA 4XVHA 1HJFA 4IXLA 4DUVA 1JH5A 3GHNA 4TWTA 2VG9A 4MGZE 4KBBA 1NG0A 3C7EA 2MHFA 4K40A 1H1MA 2ZMNA 3IDCB 4LJHA 3VN4A 4L92A 1PVC2 4IE0A 2G4IA 4LOTA 1M06G 5IHRA 1JYVA 1UPIA 1XE8A 1UNBA 1CPNA 3ASIA 3ZFEB 1DP0A 2QDRA 3NNLA 3K4ZA 4SLIA 2Y0OA 4WBBA 4NMIA 4XTMA 5FMDA 3PU8A 1QJZA 1LEDA 1JUIA 2DTWA 1V9U3 3H9AA 3W59A 3CZUA 2WZPP 3ZSLA 3TEXA 1AYM2 1FPN3 1O3SA 3L2YA 1WKYA 4NE9A 4JKKA 5BNNC 4XJUA 3UNPA 4BQ1A 1PMJX 1HV1A 5CFDC 4UBHA 5C5TA 1QNYA 2WA4A 1RGSA 4LO8A 4PQQA 1X8EA 4FPFA 3FHAA 3L9JT 4AFDA 1NKGA 4IEZA 4E4DX 3BB6A 3T4HB 1CONA 4BQ4A 3TEYA 5G04L 1LHWA 1DZTA 4QU1A 3Q8EA 4BXSV 3J7HA 1VAKA 5C71A 2KM2A 1VBC3 3OEBA 2ZGRA 4PIXA 1TQ5A 3P1IA 5GJ6A 1U5YA 1JW6A 1CX4A 2WWSA 2YG0A 3K46A 5FPAA 1CD3G 2WUHA 2V4AA 1EUUA 2ZGKA 3IDBB 1Q8SA 2OX0A 4AHZA 4IEXA 4AE2A 5FP8A 2H6BA 3IN9A 1ULEA 2PHWA 2GDFA 5C5UA 3UKVA 5FK8A 5A7WA 1LNSA 1MZEA 2A3WA 2XR4A 2VH9A 1QJX3 1JZ8A 5H9RA 4X6QB 4CDWB 3IMMA 2CGPA 2D6LX 1LOBA 1NA1A 2VVEA 2GALA 4W50A 3ZXDA 3HBZA 1FMD1 2I74A 1ACCA 3O1OA 4ASKA 1EP0A 5DXDA 3WINE 4ZXEA 4J25A 5A3PA 4QGNA 2JG8A 1J1TA 2R0FA 4KL1A 3WT3A 1HRI3 2J42A 3I2JA 5FXWA 2FDFA 4GXLA 2I2SA 4NHMA 2EXIA 1AYN2 3APBA 4XJ8A 3WHTA 4META 4NVPA 1EPZA 2Y38A 1PM7A 4AVBA 4BMEA 4BLJA 1XE7A 4XQDA 4BDVB 1ZBA2 4XJAA 3U07A 5IVJA 1W8OA 2ORXA 5B4XA 2AREA 2VQTA 1EUTA 1W2UA 3ZFGC 1PNFA 3B02A 3EHKA 4CP1A 5I91A 3VBOA 3RGBA 1VBC1 2E9QA 5GALA 3WQBA 4Z2AA 3JBG3 4QM9A 1C1FA 5C6CA 4L2NA 4QDSA 5FMCA 4AHYA 4MSVA 5GZFA 3T1LA 5CAZA 4D7YA 2CAVA 2ZMKA 3M3QA 1B35B 1FYUA 5I0SA 1REEA 3U14A 3WW3A 2UU8A 2VQUA 4FOQA 3MFCA 2HYXA 4KWUA 4GKXA 1D0GA 3MI8A 5LRRA 5HXVA 1RC6A 4QD2A 1IS4A 2PN5A 4GWIA 1AL21 3KVAA 1CR7A 4CU9A 2GN3A 4C0HA 5LA0A 4LMFA 3WNXA 2P34A 2QNKA 3VD9A 4Y4YA 2VOWA 1AVBA 2RDSA 3T4VA 4BMBA 5L19A 1ZBA1 5A3UA 4AFCA 1UZ0A 1VB2A 3POWA 3ME2A 5A6QA 5J96B 4PLOA 5E88A 2QQLA 4XUPA 2JE9A 3K2OA 1H2NA 2Y60A 2HWF1 1IS3A 2HWE2 4Y24A 4RGKA 1ENRA 2W1UA 4CCDA 4E2QA 4AL9A 4DUXA 2RS53 5T50A 3UESA 4FPKA 3BALA 5CU1A 1QEXA 4XQ4A 5I0RA 1AR81 4V1PA 2VZ3A 1ND2C 2P3IA 2Q1FA 2PTMA 4LO5B 4FPOB 2GC1A 2ZKLA 1LKNA 5LA9A 4QXKA 1W2TA 3TEZA 4XUOA 1JOJA 2NQYA 3WX5A 1H4GA 1N1YA 1IZ3A 5FZMA 4AI1A 3ZFGA 5LWBA 2A6YA 2TBVA 5FZEA 4B4QA 1PGW1 1KDMA 1D4M2 3MIBA 2XVLA 2YPJA 2C5DA 4JGYC 1QF3A 1XXNA 3M8LA 1SBEA 1OUXA 4NAOA 2VULA 4KU7A 4LK7A 4XURA 2E7TA 1BBT2 1JUHA 4JDNA 3VHRA 2ZHKA 2RJKA 2WFPA 3OGVA 2PHDA 3A21A 5J7MA 4FI9A 1R1A2 1PO21 1IPSA 1PHMA 1R093 1DHKB 1F4AA 1WUVA 3BODA 2C9KA 4EROA 3NV3A 4AQSA 5HCFA 5JAXA 5C7GA 1G8WA 3O1SA 3WD5A 5B4NA 4WM7A 5FPLA 1AR82 1W9FA 1SACA 2BYVE 2JDKA 4KMQA 2J1RA 1XYPA 5D8AA 3O0VA 1JOBA 2DUPA 2A6VA 5GLWA 3MV11 4O61A 2JXAA 5HPOA 1UZWA 2YV8A 1GQHA 5GLZA 4DO0A 3I3MA 3LDRA 2IXKA 2ZGUA 3NRUA 4S2GA 2HBTA 2YU2A 3AKQA 5F5CA 1Q8PA 5D8AB 3KHBA 2ZEYA 1F2NA 2WN3A 4CDXC 1RMU2 2BVBA 3HAGA 4G9SB 5IYYA 3DPRA 4AXOA 1EYBA 5CKNA 1HXS2 2BWCA 1CESA 1GUIA 4D6SA 4WV8A 3BTZA 4UAPA 3NNFA 4JGZA 1QXRA 4YVWA 4YVWB 2ERFA 1KS5A 1ODMA 3O12A 3OPWA 4AZZA 3A23A 1CIYA 1HN0A 4FQZA 4QPGA 2WWJA 1XB9A 2BWAA 2P5BA 3CBNA 3KS7A 5FJHA 2YZ4A 4I0AA 2VOTA 3TEWA 3MW2A 1RUF3 2A5ZA 4AG4A 5BNPA 3PUAA 3HQRA 3NV1A 4MH0E 4ZU4A 4D94A 1XNTA 1YFYA 2CSGA 3LDKA 1LGNA 4Y3OA 1S1AA 4JKLA 1O4YA 4A7ZA 3FWEA 5K8SA 2BP6A 1COV3 2YFUA 4MADA 4QX0A 4Y22B 4YRDA 3N9QA 1AX1A 4Q0VA 4FXKB 1UY4A 4EWDA 4PBOA 1VE0A 3CJIC 4GB33 4RD7A 3QBQA 2WZ8A 4MGYE 1POV1 1J3QA 2D3SA 1RVF3 3THDA 5I8SA 5E1RA 1PO11 5JR2A 1GP6A 3KQ4B 4CCOA 1L7RA 1YFWA 4ORFA 2EVXA 1KJLA 1F5FA 2WAAA 2CHHA 3UV9A 2PAKA 2TEPA 1NZCA 1QJY1 1I6XA 4LEJA 3S6PA 1CQ9A 4B1LA 1RUF1 2W68A 1Q3EA 3D4KA 5KHHA 3VBHC 4HKWA 2JB8A 4N53B 1OLQA 4Q0QA 3UGHA 4UT5A 1UOFA 3ORJA 2CV6A 2QE3A 4LULA 4QPGC 3R05A 2EA7A 3LWCA 3DYOA 2QQNA 1JZ2A 1PIV1 4FP2A 1W0PA 2WSUA 3IIAA 4LOSA 4ARYA 5KC6A 4Q4W2 5J3UA 1ZZ8A 4DEQA 1LTEA 3EQEA 2G1MA 3AKSA 3D0SA 4U36A 1I1EA 1SMVA 4Q0UA 1VBE3 2WRAA 1V6IA 5G05L 2B7YA 1YI7A 2GSYA 4QKDA 3ZPOA 3C2UA 4RQPC 1UZZA 3KCCA 1LCLA 4XETA 1HQLA 3TN91 1I3HA 3H42B 3ES4A 2ID4A 2CDOA 2AGSA 1APNA 3OB8A 3WG3A 3EYPA 1S4CA 1PO12 3BOPA 2R6QA 4OZXA 3H8UA 4OMDA 2YY1A 5T5LA 1LHUA 2PAMA 4Q29A 4RFT0 3VZNA 5C70A 2Q5TA 1AUYA 1QIQA 1O3TA 3GDBA 4Y1YA 5L9RA 4BIFA 1PO22 4F83A 2OZJA 1CJDA 3U4XA 1LOCA 1QJY3 4YZ5A 2CGOA 1KQRA 2HEVF 1TME2 2EALA 1DQ2A 1PK6A 1REDA 2G19A 3P6BA 4HLTA 4EE2A 5C4WC 1OOPA 1RUD2 3OUJA 1OD3A 3GF6A 1I5PA 5ERLA 3RWKX 5J09A 1HB4A 1V9U2 1VB4A 2A3YA 3PVNA 4DB5A 2VQAA 1C8NA 1F15A 2VBDA 4UXAA 2ZGTA 1DLCA 3URFA 4YGDA 1R1A3 3AX4A 1E5SA 1BEV3 4QAWA 4IDZA 1FOD2 2FZ2A 1PNGA 1QKQA 4YW2A 1C8M2 2VCAA 4XHXA 2QJVA 1UO9A 1B35A 2RVAA 2X5IB 5LEJA 2XLFA 3ACIA 5FZOB 2ZGLA 2YC0A 4CP9A 4CP2A 3E6DA 4YSFA 3ROUA 2GAUA 2ZOEB 4W6YA 1O5UA 3LSDA 1SCSA 5C8CA 3IB3A 4LQRA 2Q1MA 4LIUA 5L7OB 3LPGA 1JXNA 2V09A 1PK6C 2VQ0A 4YW4A 5K0UA 1POQA 2J1VA 2VTFA 1QH7A 4INDA 1AX0A 3P3NA 4ES8A 2DURA 5FCCA 5FY5A 3ZXJA 2PLV2 1YLLA 2XQXA 4QQOA 5F39A 2BEOA 1GSLA 1J3PA 1OA4A 3ZYJB 3AZWA 4YG0A 4M0NA 1Z7S2 1FXZA 2OIIA 2W92A 3ZX7A 4DOUA 1O8SA 3B9IA 2DU1A 3TYJA 1POV3 4NROA 5A7SA 4MGQA 1IS5A 1DGLA 1Z0HA 3GZUC 2B4KA 4HMZA 2HWD1 3WHUA 3S0MA 4ZU5A 5DZEA 1LENA 1BEV1 4JQTA 4Q1PA 5AFBA 2BBVA 4BXFA 2PHLA 2NN8A 4JGZC 5KHGA 2ZX3A 4J6GA 3RZZA 2B42B 3TB0A 3ST7A 4CUAA 4C1WA 1Q56A 2LALA 2A1XA 1IPKA 1RUE3 2KR2A 5F3GA 4NAMA 3VLBB 3LEKA 2WLPA 1KITA 2GC3A 4K21A 2QQPA 4AEJA 5ABJC 1DG6A 2V5DA 4IV3B 4JX0A 1CAVA 2F4PA 2MNGA 3N7MA 1LOAA 2AEZA 4DXTA 1POV0 2BW8A 2F4LA 2P1BA 3DYMA 3MPBA 3POJA 4O65A 4TSVA 5J98B 4DNYA 5BNOC 1RVF2 1BHGA 5DDJ2 5F3IA 5GKAC 5JOZA 1D0HA 4YWAA 4TLFA 4AEMA 1OC1A 2ZAAA 3WQ0A 2VVFA 5FZAA 4AI0A 4D6RA 2WO2A 1K42A 1CX1A 2LM3A 4AVCA 3FUOA 1Z7S1 2PA7A 2VOVA 4XFFA 4QKBA 3I3DA 5CIRA 3I3QA 4TLGA 3VD7A 3WF1A 4E4SA 1QU0A 1HRI1 1W05A 4CTEA 3BVCA 1DQ4A 4XC9A 3ZN4A 4M3CB 1ND2A 4LKSA 1UL9A 2W94A 4WVZA 4BK5A 2XLAA 3TN92 2YGLA 1PMHX 5FO9B 2ILMA 2Q0AA 1MEC1 3GZEA 5L7OA 2QQKA 1IG3A 4XACA 3V0BA 2NYYA 5APAA 3KWVA 4Q27A 1RUI1 4R52A 3I2FA 3VBRB 1W6MB 1AR61 2HWC2 2F17A 2ET7A 1MZFA 4MYEA 5DUXA 2PFWA 3D3AA 3TOJA 4Q1RA 5FKBA 4XXAA 5FZ9A 4ZS3A 4F7ZA 2K46A 1NLQA 1H2KA 1Y7BA 1N1TA 4CUCA 3LQCA 1QJFA 3I3BA 4H7MA 1UX6A 1N3OA 1XNCA 1W8HA 3WP5A 4IEOA 4COYA 2BTVC 1K5JA 4BM8A 2XL7A 1PX3A 5FK7A 1UXXX 5BNOB 5BNOA 1F4HA 2RS52 3SH3A 1NXD1 3VBOB 1ND3C 5CNAA 2FDGA 4UOJA 4AAXA 5FZGA 5ABJB 1HRI2 4HG6B 1O3RA 1QJU2 1VAMA 2PXJA 4IE7A 2Y64A 4Y1VA 1FOD1 1OLRA 1ULCA 3KCYA 3AMMA 3NJXA 5FPZA 1X50A 5FV3A 4EN9B 3I97A 5A70A 5GLVA 5HCBA 1ZRRA 2J1TA 3FL7A 1SLTA 2WQZC 4K8RB 3WW2A 4B8EA 1C8M1 4JKMA 4XDOA 1RITA 3I2DA 4YZ2A 1E57A 4CDUC 5I0DA 5JSRA 1UAIA 4Q8LA 4TXWA 3VDBA 2FD8A 1NYWA 2ZX4A 3MPPG 4P9WA 2VC9A 2R072 2YMZA 3PTRB 2VL4A 1VBA2 2X53S 1GZ9A 2ZHNA 1S0DA 4KU8A 3GALA 4CDWA 3U4SA 4HKLA 4WM7B 1OVPA 4YFZA 3O1UA 1HLCA 2QQOA 2JDAA 4AFMA 3H8RA 4K1YA 1RHI1 3AYEA 2E32A 3WDTA 1GLHA 4NN0A 3QH7A 2VU9A 2VE1A 4LBQB 4XBLA 3H3UA 3W58A 2NPIA 5K7PA 5KWRA 2VCCA 1Y4WA 4GKYA 1PK6B 2ARAA 3VZMA 2W87A 1FAYA 2GU9A 1HQNA 4HVRA 5A3WA 1QJU1 1TNRA 2VW0A 4R8HA 4JZRA 2NMOA 1GICA 1RUC1 4IV3A 2JDYA 3USSA 2KA3A 3WW1A 1STMA 1YRZA 1C1LA 1SEFA 1LGBA 3PUQA 4V2WA 5LK7B 5FZ1A 5IVBA 3WSOA 5FO8B 4LO4B 3B93A 4DMIA 4UFKA 3NL1A 4CU7A 1WLTA 3MHZA 4ARXA 3N4MA 4HONA 1MS4A 5FZIA 5A3LA 1AJOA 3K4AA 5C3QA 5F3EA 3MZHA 1GBGA 1XNDA 5LZ6A 3BPZA 1N47A 2X5IA 1EAH2 2DBNA 4M4RA 1AL23 2BGCA 1U5XA 5J1XA 2PHRA 3WP6A 1OF3A 2BVVA 3KV4A 1S0EA 5T52A 3OBTA 2YU1A 1LGCA 1GZCA 4NUBA 3N7LA 3V0AA 2WIIB 1C57A 4IW3A 5FZ6A 4Y22A 3HVDA 5JWPA 1J3RA 3AXDA 4QXHA 4YW7A 1G9AA 5C9AC 4B4RA 4CDQA 4FAGA 1HJGA 1RUJ1 2AH2A 2V73A 5JMCA 3WNPA 3I7DA 3AFKA 1ZX5A 1WW5A 4LT5A 3I2GA 1V6OA 4PLNA 3U1XA 4FFFA 2XPJA 1JBCA 1R64A 5IATA
chains in the Genus database with same CATH topology
4A3XA 3HQXA 5DDJ3 5KXCA 3ZFFB 3RYKA 3WY6A 4F3JA 1VIWB 1R092 4K1ZA 1AR62 4RQPB 3CF6E 2XBO3 2G9FA 3VDDC 4QPYA 4D7TA 2GN7A 1Z78A 3TNQA 4GMP3 2XJTA 5AC91 4LBOA 2QDNA 2DVBA 1VBD3 5AVPA 1SCRA 2RR11 1OHFA 2XLGA 3FUQA 3AKRA 3IBMA 3GNEA 1ZBE2 3A0NA 3H1MA 4FPLA 4GWMA 4ZU7A 1RUJ3 4EV0A 3DUIA 4QQHA 1GANA 5F5QA 2OPKA 4N7UA 4PIYA 4WVMA 1VALA 1W6NB 3HIFA 5DUUA 3WG4A 2ARBA 4Q4W3 1UU5A 1ENSA 4DY5A 2HJIA 4LE4A 4Y1UA 4YVSA 1HXS3 1OOPC 3SLIA 2FHRA 1OOPB 4LBQA 3KT7A 4XF9A 1ASJ1 3CJIB 2BQPA 2WJSA 2ET1A 2B46X 2DCTA 2VW2A 2YXSA 2WFF3 4H55A 3VBRA 1ZYBA 4LR4A 5AC92 3WLUA 3MDPA 5DUWA 5BYNA 3TBDA 2A6XA 2BUKA 4P9XA 4IEWA 1CAUA 3I59B 4Q4V2 3ZYPA 4RSUA 2TNFA 2NZ9A 1VBA3 1TE1B 1J1LA 4OUSA 2BFUS 3VDDB 2DVFA 2GNBA 3IPVA 2RS13 1RUH2 1NE4A 4A2UA 3FC0A 5JIUA 1O4ZA 4M3CF 3FHIB 2XWBB 1BK1A 2WINB 4K20A 3VBUA 2CWSA 3KGLA 1ASJ2 1BQPA 2HWB3 4FO9A 4PCRA 4TYSA 4BA6A 2YGMA 3B3QE 3ZN5A 1Q5OA 5C33A 5K0UB 1V6MA 1VR3A 4KGQA 2O8OA 1EAH1 1UIKA 1SQ4A 3U0ZA 5C9AB 5H9SA 4OHXA 1DBNA 4GB31 4O9EA 4B29A 4HKOA 3P3PA 3PJYA 2OUJA 2WFF1 2Z5WA 3M3IA 1R081 4LHNA 2XH6A 3NO8A 5JPMB 2C9AA 1ENXA 4YLZA 4IV1B 2HKXA 4LA2A 4YW5A 2ZGQA 4RS5A 3CNAA 1VP6A 4R9BA 4RQPA 1WLCA 2D6MA 3EXUA 3MYXA 1YI9A 1S0IA 3AZZA 3VKOA 1MS0A 3UK9A 1R1ZA 4DFSA 5JPNB 1NA1C 5L73A 2BNNA 3DGTA 2XHKA 4Q0SA 1UN1A 2A71A 3HT1A 3LCPA 1S2KA 1NY72 1UU6A 5ABJA 4S2DA 3VBUC 3NWKA 3EBRA 3FLRA 3L2HA 1TMF2 4XMIA 3H1YA 1S55A 2D7FA 2WNVC 2GNTA 1WLWA 4FXGB 4X6RB 5SV5A 4AGGA 3POSA 3KCXA 5BUVA 5FFOC 1HX6A 5GZGA 1GKBA 5E89A 2H6CA 2K2SA 3JD71 1DGRA 2K0GA 4DRVA 1DFQA 1FMD3 2CAUA 1IKQA 5JSPA 4P9GA 1QXJA 2WT0A 3EO6A 3PHMA 5JVVA 4WZFA 4I2OA 2JG9B 4MUVA 2R32A 1G9CA 4LTAA 1YWKA 3SH4A 1QWRA 3AYDA 3MLLA 3RS6A 4FTSA 4NWVA 4XF3A 5A3MA 1GQGA 1VBD2 2ZABA 3LAGA 4OI4A 4B7KA 1OQ1A 2RJLA 1ZBE3 4I0WB 2WC2A 5JDBA 1QOOA 3IDEA 5JOYA 3E6CC 4N90A 2D97A 3O0XA 4RGGA 2MEV2 4R9DA 4N53A 2P37A 5LEKA 4XDQA 2PLV3 2XJUA 3IPVB 5DG1A 5TSWA 1S2BA 3NKGA 4MXWB 4CDXA 1CAVB 1YJLA 1PGL2 4WVVA 4Q4Y2 4NR1A 4Q2FA 2ZGPA 5B2GB 4JQRA 1EY2A 5BNPB 4JV4A 1UZYA 5F6KA 3SISA 3ZFGB 1WCKA 3H7JA 4LNVA 2Y26A 3VBRC 2RE9A 1RUH1 2WZR1 2DCKA 4HVQA 1VBD1 4YVSB 2EF6A 1QJU3 3SCGA 1QOSA 3QCWA 4COVA 1RUE2 1X33A 2AR6A 3CLPA 1AR92 1V70A 5AFEA 2XBO1 4G3YC 4GULA 1MZ6A 4C91A 1YIFA 4XJZA 1NCRB 1WBFA 2PQQA 1N3QA 3VV1A 3OPZA 1N1VA 2VNGA 4AVVA 1W6OB 2RMU2 3T2TA 2R073 1RUH3 3SH5A 4JGYA 2HWF3 1IGOA 3IWZA 1CVNA 4E2GA 1PVC1 2ZGSA 4P9IA 2A75A 3NSTA 4N7IA 2HWB2 3MFAA 2UY8A 2D5HA 1B09A 3ENRA 4KG0A 3OYWA 3M4FA 4Q4X1 4EWEA 5FOJB 3OBRA 4XE9A 1RUOA 3VBSA 2CL2A 2WZR2 5T5PA 1C4RA 5CA6A 1GR3A 1MS9A 4FOYA 2MPFA 1BVP1 5EJ3A 1RUE1 5FREA 4Q8KA 3FLPA 5A33B 4I3GA 1T6GC 3FFQA 5CFCA 1BYHA 3VL8A 2VOXA 5BPXA 3VZKA 4A7YA 1VLNA 2R1DA 1S0JA 1TMF1 4FCAA 3H50A 5IUQA 5J36A 4GWNA 5BNNB 1OA3A 2A3XA 1MS1A 4H7LA 3RSJA 4BWOA 1DQ5A 4AEDA 1A6CA 1EAH3 4YM3A 3ETQA 3JQWA 4AGRA 2HWB1 4FOVA 1NLSA 2XKOA 4GA9A 1IHMA 1WMFA 5L7OC 1C5HA 3M2MA 5JZGC 4QQ2A 1LR5A 1WCSA 4AW7A 3VGIA 1UKRA 1VBE1 2DVAA 1DYKA 2LUWA 4LBKA 1CPMA 4FSJA 2GNMA 4NO4A 2OA2A 1AYM3 1BJQA 4G4FA 1FMD2 4FTBA 1S0GA 4KQ7A 4Y20A 2WNVA 1PIV3 2D43A 4MGIE 4YVSC 2D6OX 1OPOA 2MEV1 5IK8A 1IOAA 4CEYB 2R041 5CADA 5HI0A 1SLBA 3K51A 3VBSB 4NHKA 4AFBA 2YUEA 4YM2A 5KC5A 3M3CA 2W52A 3ZSEA 2C0ZA 4L9BA 5A33A 3ZSJA 5FOBB 4RHV1 4DPNA 2ZX0A 2VUAA 3AJYA 1CAWA 1DGRN 4XIOA 1X36A 3OCPA 4LA3A 1VBC2 1S0CA 4AI2A 1W39A 4HETA 5H9PA 1HV0A 5EFUA 3TRSB 3OGGA 2TUNA 5KXDA 3WUCA 1UMZA 3LOIA 2D6NA 3BIWE 4W6WA 4XQWA 1YHFA 2XG3A 4XF0A 2OZ6A 2ZHLA 3E5XA 5DG2A 4B4PA 4HN0A 3PVBB 2QCSB 3JB8A 1AL22 4ASMB 3MIDA 4AQ6A 2ZGOA 3POYA 2GMMA 2JG9C 2DTYA 2RMU1 3AK0A 4JCKA 1MQTC 1RUC3 3JD73 1HQWA 2AUYA 1MEC3 3UKTA 1AYN3 2D6KA 3ZYIB 1AR93 1YO8A 4AEKA 4ES9A 4QPGB 4RHV2 4QX5A 3RNSA 1H9WA 2E53A 1RUI3 1XRUA 4IERA 2IXJA 4I01A 3ZN6A 4M00A 4C0BA 1F8VA 1FV2A 1ULFA 3I4IA 4P9YA 5FPXA 4X8NA 3B94A 1NCQC 4CEWC 3KB5A 2OYZA 1C5IA 4U2AA 4PDWA 3MIFA 1WMEA 3ZSKA 3WCRA 5C8WA 4M3CA 4N43C 5DZFA 2A70A 1UPSA 4BLIA 1PGW2 5C9AA 5T54A 3J8F2 5I93A 3B00A 4ATFA 1QGLA 1ASJ3 1JYIA 4P14A 5IT6A 1WA4A 4NPRA 5C4WA 4LE3A 2PAEA 1BBT1 2HWD3 1LEMA 1AR72 1NQDA 1ZZCA 4XF4A 2JG9A 4Y20B 5JIAA 1Y9QA 3VUOA 4IV1C 2RS32 1QY4A 2VXRA 5JR7B 4FP3A 2JG8B 3TNPB 1UU4A 3LA7A 3AZXA 4RR3C 1YYNA 1F9KA 1FPN1 1YFUA 4OVEA 1X82A 4M01A 4LBNA 1IS6A 1O3QA 5K0UC 2RM21 1AYM1 3AMQA 1VJ2A 3I59A 2JECA 4CDXB 5FO7B 4HK8A 1AX2A 4YZ4A 1V6JA 3K48A 1ZRCA 1QQP2 2YDEA 2PELA 3ILNA 4FVVA 4PLMA 2AZ5A 4HSLA 2VMGA 3FE5A 4FPJA 4K3UA 3QOPA 3SCFA 1C28A 4RR3B 1NLRA 1W6NA 3DF0A 4AEDB 4Q4V3 1RJ8A 1A78A 2RS31 4UW4A 3VBHA 1SLIA 3D82A 1AL0G 1BBT3 4P9LA 3SHRA 1LB2A 4IV1A 2ETEA 4P5HA 2B8MA 1PVXA 5H9QA 1KD7A 1MZ5A 3WQ7A 2GC0A 1FPN2 4FPYA 3AB0A 2B5HA 3WVJA 2OUHA 4RS5B 1FV3A 2Z79A 3ZIXA 4XFCA 5JZGA 4N43B 2UYBA 2P2KA 4JGYB 1QQP1 4ONUA 1OQDA 1V6LA 3AXEA 4DINB 1TNFA 5L36A 1GZWA 4HSJA 2D5FA 2DFCA 3O0WA 1FNYA 2Y0IA 5J48A 1CIWA 2DU0A 1H2LA 4JVAA 5KHJA 1LOGA 1ZREA 1MR5A 2E6VA 2PHUA 4K7JA 3UJQA 1K5MA 4MZUA 5GM0A 2ZACA 5KXEA 3AZVA 1H8TA 3LA2A 4K6BA 4XZPA 3VHPA 2QKDA 1CAUB 5EV7A 4QPIC 2UWCA 4M0HA 4E9KA 5BY5A 1KFUL 3PJQA 1W0OA 3R4UA 3V0AB 3WR0A 4PIZA 3VDDA 1LOEA 3H7YA 5GLUA 1WW4A 4GMP1 4Q26A 5FTTC 3NKTA 2CYFA 3WP3A 3ZMOA 4LLFA 1RHI3 5IK5A 2ENRA 3ZO0B 2GMEA 3PMSA 2DYCA 2VUJA 3N7KA 1TMF3 4IEVA 1F31A 3AKPA 4D69A 4DS0A 3AZYA 3DL3A 5T5JA 3GYDA 3J8F1 4GALA 1PMIA 3ELNA 5E8AA 3ZXGA 2DUOA 1QXPA 1RMU1 1AR71 2GH2A 3IT8A 5CVRA 1HXS1 2LTNA 3E6BA 3FJSA 3N3HA 3E97A 1NE6A 4YNIA 3RPQA 2VECA 2VNRA 1UCXA 4C90A 2HWE1 2HWF2 3OGJA 4R4ZA 3TWIA 2UYAA 3J8F3 2IFWA 4J1XA 4UBGA 2XGXA 4QQLA 3VBSC 1ND3A 3R4DB 4H3WA 5EYYA 2ATFA 3FZ3A 3M3OA 1ZZBA 5F6LB 4AI3A 2RM22 1RUD1 4CEYC 1AR73 1H1AA 2E7QA 1V9U1 1YFXA 2RS33 3O14A 3OY8A 3ZDSA 2MEV3 1XNKA 1RL3A 3WDXA 2WT2A 4QM8A 1FT9A 2RHPA 1AYN1 5JZGB 3RYPA 3A4UA 4AQ2A 1MVEA 3JB4C 3DKWA 1DGWX 1LOFA 1L3JA 2X8KA 3MIHA 3Q9OA 5I8YA 5JI9A 2JJ6A 1BZWA 5KXBA 5CG8A 1HDKA 1IPJA 2KXLA 4CYDA 1W6OA 3D8CA 3ZYGA 1R1A1 4XILA 4JTNA 1YJKA 3FLTA 2N7GA 4WM7C 3PVEA 1VBB3 2CGNA 2Q8OA 4IEPA 3UL2A 4TZDA 3HT2A 1U0AA 2VNOA 4CDQB 1SFYA 2GZWA 3CO2A 1OMIA 3BTAA 4ZKTB 3MW4A 1RUD3 3MF6A 3OYWB 4AYUA 3FBYA 4CDUB 1LHOA 1OI6A 3AP4A 1BEV2 3O7OA 5CFDB 3LA3A 1YIPA 2XJPA 4LBLA 2QZ3A 1PGSA 2EIGA 1EPWA 4SBVA 2HYKA 4M3CE 1RJ7A 1ND3B 4PBPA 2XJQA 1H8VA 1KXGA 2R30A 1QHDA 4B7EA 4XBQA 3J4UH 1SFNA 3PMEA 4MX3A 2G9GA 2O1QA 4H14A 2ZCWA 1D2SA 5KHIA 1YUDA 5FRAA 2WNEA 1AR83 4I3PA 1TME1 2D93A 2WS92 3ACLA 3KM5A 1QOTA 4GMP0 1ZZ9A 1C3HA 1DQ0A 4OLLA 1NCRC 2R1BA 2H0BA 5C8CC 2ZA9A 4AQTA 4QHBA 3RG0A 4MLOA 4RL7A 1JTZX 3RYRA 1W6QA 3OJBA 4EWAA 4IEUA 1LECA 1Z7S3 1DIWA 1AXZA 3VL9A 1FX5A 4MXVA 1D4M1 4WM8C 3HWJA 4QT6A 4N43A 1GYKA 2ZX1A 1LJ7A 2DV9A 3SITA 2C1FA 4XJWA 3MIEA 1LHNA 1W6QB 5BNPC 3RMYA 4GQ7A 1M4WA 1Y43B 4LO6B 1S0FA 5LRSA 3EJKA 3E5UA 2QZ2A 3ZIWA 1W6PB 4CDUA 3AP9A 4CZSA 4HVOA 3VZOA 2DF7A 2VOKA 2JEMA 4YW3A 2GH8A 1RUF2 5CFCC 3N35A 4LHKA 4N9IA 5HCAA 3VKFC 4ITCA 3H0OA 4QQPA 4IV3C 3RI8A 2ZGNA 2P3KA 3OTFA 1H4HA 1KDKA 3THPA 2PLV1 3AMHA 1RUG3 4A7KA 1PIV2 3AM2A 4I30A 4IESA 3AMPA 4Q4W1 2YYOA 4JGZB 4Y26A 1SBDA 3KLSA 2ES3A 2PHTA 3GZAA 2DCJA 1JN2P 2IXCA 2FBEA 4PF5A 1XQNA 2Q30A 2IWGB 4L97A 2VW1A 3TN93 1FATA 1OQEA 3CL1A 1ULDA 5KHKA 1QH6A 2R071 3ZFFA 1UF2C 2XKPA 4K9SA 3R4SA 3M1HA 2K9ZA 2VVDA 1HIXA 3QD6A 1IKPA 1LODA 1RB8G 1YXWA 2I45A 3C3VA 5FDBA 1KJRA 4ZXKA 1QMJA 2BFUL 3GHMA 2WNVB 3ZXLA 3MLKA 2EXKA 1N1SA 4HFSA 4KNCA 1H2MA 4E27A 5DDJ1 2D98A 1OKQA 1SLAA 2WL1A 4RA0A 3VBUB 4XYXA 4PQ9A 4R9CA 1CGPA 3H1WA 1W6PA 1D4VB 3BOWA 1WLDA 1CJPA 2XVKA 3NJZA 2GC2A 2CWMA 2ZAHA 4XFAA 3WDUA 4HK9A 2Q4SA 2B45X 4OI0A 4K8FA 4P9JA 2WQ4A 1NA1B 4D3WA 1RUC2 3OF1A 1H9PA 1PO13 2XJRA 1UIJA 1QQP3 1MEC2 2W08A 2WNUA 4RHV3 4L11A 1RUI2 4GIQA 2B39A 1REFA 1XNBA 1PO23 2Z69A 4LLOA 3VBFC 5CG9A 3ZXFA 3MICA 1QJY2