1F2NA

Rice yellow mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
LSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRWDVVYLPEVSATVAGSIEMCFLYDYADTIPRYTGKMSRTAGFVTSSVWYGAEGCHLLSGGSARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLYVIASMVLRDPVDPTLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D domain swapping modulates the stability of members of an icosahedral virus group.
pubmed doi rcsb
molecule tags Virus
molecule keywords CAPSID PROTEIN
total genus 44
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f2nA00
4QPGC 4JGZB 1R081 1B35C 3VBUA 1ASJ1 1CD3G 2WFF3 4CDUA 1ZBA3 4WM7B 1ND2B 3VBSB 1QJU3 2RS12 5AC92 3CJIC 3VDDA 1Z7S1 1RVF1 1FMD3 1SMVA 1RUF2 1EV13 2ZZQA 5BNOA 1OOPB 1MQTC 5K0UB 4GH4B 3IDEA 5K0UC 5L7OC 4YVWC 4Y5Z0 3ZFGB 1HXS2 1POV0 3TN91 2HWE1 3VBRB 4CEWC 1VBC1 3CJIB 1FPN2 1B35A 2BPA2 1AR73 1RUJ2 5FOJB 4NWWA 1RUI3 1VBA3 5C4WA 1AYM2 4QPGB 1EAH1 3VDDC 5BNPB 3VBUB 1BMV1 4RQPB 5ACA1 5BNOC 3JD73 2Y26A 4CDQC 4GB33 2XPJA 1PGW2 1AL23 2HWF3 1POV1 2RM23 2FZ2A 1HRI3 5A32B 1VB2A 1HXS1 4GH4A 1NCQA 3TN92 3VBUC 5BNPC 3VDDB 3DPRC 2R072 5CFCA 4CDQA 1MEC2 1EAH2 4Q4V3 1BEV3 5ACA2 4Q4X1 5ABJA 1MQTA 2WS92 5BNNB 1VRH3 1RMU2 1X36A 5K0UA 1RUG3 4GH4C 2GH8A 2TBVA 2HWC3 1COV3 4LLFA 4NWVA 1ND3A 4RS5A 1FOD1 1NCRA 1NY71 1AR93 4IV3B 1AYN3 4WM7C 5CFCC 4JGYB 1PVC3 1B35B 4CDWC 1RUG1 1AYN1 2R043 2R062 1PO22 1AR91 1VBB1 1R1A1 1TME2 1H8TA 5A33B 3VBFB 1VBE2 1V9U3 1VBD3 3JBG1 1H8TB 2HWC1 2WLPA 4Q4V1 5A33A 1Z7S3 1RUI2 1ND3C 4RS5C 4Q4X2 4IV1B 1NCRC 1M06G 4JGYA 2BUKA 1QJZA 2QQPA 4WM7A 1Z7S2 1NCQC 1VBD2 1HRV3 1RUF1 1QJY3 4CDWA 2BFUS 1FOD2 5BNPA 2R042 4IV1C 3DPRA 1RUF3 4CDXB 5C4WB 5C9AC 2HWE2 1AL21 4Q4Y3 1VBC2 5BNNA 1DDLA 4AEDC 4GB31 4EJRA 5CFDB 5ABJC 1RUJ1 1R1A2 1W39A 4CDXC 1VBE1 3JBG3 3JBG2 5J96B 4RR3B 1RMU3 1AL0G 5CFCB 1R1A3 4YVSB 1RUI1 2WWSA 4WM8C 1HQNA 3LOBA 1NCQB 5A32A 3FBMA 1ZBE1 3J8F2 5ACA3 5C9AA 1VBC3 4CDUB 4N53A 1NCRB 1AR82 4AEDA 1VBA1 1H8TC 4CDXA 3JB8A 4FTEA 1VRH1 4RHV2 1RUH2 1R092 1ZBA1 1PGL2 5D8AB 4WM8A 2BBVA 2HWF2 2VQ0A 4Q4X3 4JGYC 4FTBA 1RHI2 2R071 1VBE3 4Y4YA 2HWB2 4IV3C 3JD72 2WZR1 5DDJ2 1PO23 3S6PA 1PVC2 1RMU1 1RUC2 4IV1A 1PIV3 4N43B 5BNNC 2RR11 1HRI1 1AR72 1RUJ3 3M8LA 4N53B 1NY72 1K5MB 1VBA2 1PO12 1PIV1 1CJDA 1HRV1 1OOPA 3ZXAC 4Q4Y1 1FPN3 3DPRB 2HWD1 3ZFEC 4RQPC 1HXS3 1RUG2 3VBHC 4JGZA 3ZFEB 1VRH2 2R061 4RHV1 1RUH1 4Z92B 2RM21 2PLV2 1TME1 1QJY1 2HWF1 2R073 1K5MC 1FMD2 1C8M1 1V9U1 4Q4V2 4N53C 5J98B 1D4M2 4BCUA 3VBRC 1A6CA 5DDJ1 5AC93 1GFF2 3ZFGC 5L7OB 4N43A 1MQTB 1OOPC 1QQP2 4CDQB 1VBD1 4RQPA 5BNOB 2RR12 1VBB3 1HRI2 1AR71 1ND2C 2R041 3NAPA 4FSJA 1QQP3 1COV1 1PO11 1PIV2 4PDWB 1K5MA 1X33A 1AL22 2HWE3 4IV3A 4PDWC 4Q4Y2 2HWD2 1QJU1 4GMP3 4GB32 3VBRA 1ASJ3 3ZFGA 4CEWB 1EV11 1QJY2 4Q4W2 2PLV3 4YVWB 1C8M2 5CFDA 2RS32 2IZWA 2GSYA 4GMP1 2RMU2 2WFF1 5GKAC 4RFT0 1NG0A 1ZBE2 4SBVA 3J8F1 3VBSC 1QQP1 2RS33 4WM8B 3ZFEA 1AR81 1HX6A 3VBHA 1POV3 4JGZC 4CEYA 3VBHB 1R082 1ASJ2 1RUC3 1WCDJ 2DF7A 1VB4A 1BBT3 2RS11 5DDJ3 5AC91 4AEDB 5CFDC 1QJU2 2RS13 1R091 1ZBA2 1PGL1 2HWB3 1TMF2 1RHI3 2ZTNA 1E57A 5JZGB 4QPIC 4N43C 2X5IA 1RHI1 4Q4W1 2HWB1 4GMP0 3VBOA 1NA1C 1RUH3 3JD71 2WZR2 2WS93 1ND2A 3NAPC 4CEYC 1PVC1 1FPN1 2RMU1 1RUC1 4PDWA 1RB8G 1EAH3 1AYM1 5C8CB 1D4M3 1AR83 2X5IB 5D8AC 1FOD3 4YVSA 1VAKA 1F2NA 3VBOB 1IHMA 4RR3A 3VBFC 1HRV2 1RVF3 4QPIA 5JZGA 1OHFA 1RUE1 3TN93 3VBOC 4CDWB 1PGW1 1RUE3 5FMOS 1BEV1 5C8CC 2RM22 2PLV1 1TMF3 2RS53 1PO13 3ZFFB 1TMF1 4CDUC 1FMD1 1AUYA 1AR62 3VBSA 1C8NA 1V9U2 4CEYB 3NAPB 1D4M1 1QJX2 2MEV3 1BBT2 2XBO3 3CJIA 5FMOL 3ZFFC 4YVSC 1NA1B 1R083 4FTSA 4RR3C 3VBFA 2MEV2 2XBO2 1QJX3 3JB4C 5JZGC 5L7OA 1OPOA 1NOVA 1AR63 1AYM3 1MEC1 4CEWA 5ABJB 2RS52 1RUD1 5C8CA 2RMU3 1COV2 1ZBE3 2X5IC 1R093 2WS91 4RHV3 5C4WC 5C9AB 1RUE2 3HAGA 1NA1A 1RVF2 3ZFFA 4Q4W3 1BEV2 4QPGA 1C8M3 1F8VA 1EV12 1TME3 1MEC3 2R063 1AR61 2ZAHA 1QJX1 2RS31 1BBT1 4QPIB 3J8F3 5D8AA 1ND3B 2HWD3 4RS5B 2BFUL 2WFF2 1AYN2 1RUD3 1PO21 1AR92 1VBB2 4YVWA 2MEV1 2XBO1 2WZR3 2FZ1A 2RR13 1BMV2 5LK7B 2HWC2 2RS51 1RUD2
chains in the Genus database with same CATH superfamily
1YJKA 1UX6A 4JGZB 3O1RA 5LY1A 1B35C 2E33A 4LOTA 1B09A 3RYKA 3VBUA 4CDUA 1QXRA 2WIIB 3OYWB 1ZBA3 4EWEA 1GMMA 3AMNA 2E63A 4FPFA 2ZHLA 2VTXA 4UBGA 2LM3A 3CJIC 5JMOA 1C57A 3KV9A 5CG8A 1FMD3 4IQPA 4OFGA 1JS9A 4P9WA 1RUF2 1DGWX 2CSGA 2YBKA 3ILNA 3PL0A 4HKWA 4C90A 2ZZQA 3OGGA 3MIGA 4YW3A 5K0UB 1VE0A 4XJAA 2E53A 3ZYPA 1W8TA 4YVWC 3I2OA 2W92A 3I3DA 3G6JB 4EWAA 2A6YA 3VZJA 3TN91 3VBRB 2WBKA 4CEWC 4KU8A 5FFOC 1VIWB 2R30A 2Q8DA 1UYYA 1LGNA 3FL7A 4BQ4A 2VG9A 1W8UA 2BW8A 5EIYB 3TEXA 5FYYA 4C0BA 1SLTA 2A3YA 3POJA 4M4PA 5FZOB 2HLEA 1SBEA 3ZDSA 2GU9A 5I0RA 2OA2A 3MIBA 1Q3EA 4DMIA 1ZZ8A 3WNKA 3V64A 3N4MA 1ZRFA 4ZXEA 3OBTA 1C3HA 1XE7A 4XHBA 4XFBA 2DBNA 1MS0A 4YZ5A 1LCLA 4JX0A 2W0XA 5F5QA 4UW6A 4NMIA 5JOWA 3W21A 3R4DB 2YROA 1AL23 2RDQA 4AFBA 5GZDA 5BPXA 3JQWA 4XMAA 3WSOA 3WY6A 4XBLA 4BPZA 1WBFA 2DVBA 1POV1 3HN1A 2QQWA 4AFAA 5CADA 3GZEA 3NV2A 2XL7A 2LTNA 1UL9A 4NHKA 2ZABA 2O8OA 2CGOA 3ES1A 5HCBA 4TZDA 3Q8EA 1G9FA 3GCXA 1DYPA 3VN4A 2VR4A 1KXGA 4SLIA 1QMJA 1SQ4A 4AK3A 3RZHA 1SZBA 1NYWA 4R4XA 2VMHA 5KBFA 4KWLA 4XJ8A 5FLIA 1I9RA 2R072 4LBQD 3LPGA 3AMPA 1UZZA 4CDQA 1EAH2 3SCGA 3EO6A 4QKDA 2BOIA 1CQ9A 1L7LA 2HEYF 3SEEA 1J59A 3VKFC 2W91A 5FP3A 4QT6A 4Q4X1 1KD7A 5ACA2 1W0OA 4YYOA 5I8YA 1MQTA 1QDCA 1QJFA 5A6QA 1RMU2 5K0UA 1CN1A 2C0ZA 1FT9A 3SITA 1UOGA 1LOCA 4R9BA 2NYYA 4XJWA 5BV6A 1COV3 4AI8A 1WCQA 2Y6JA 2XH6A 3J7NA 4NWVA 1ND3A 1FOD1 2YBSA 1VP6A 3OTFA 1V6LA 2CU5A 2EIDA 3D5OA 3FFZA 1IGOA 1NY71 3B3QE 3PMEA 4QX0A 5JR2A 3OD4A 1W6MA 1AR93 4QU2A 4QX3A 3AXDA 2UWCA 3C7GA 1US3A 1AYN3 4K3UA 4XUTA 4XFHA 3UKVA 2J22A 4MGKE 4OQ9A 1PVC3 1B35B 4CDWC 3VD9A 3VD5A 4Q27A 4NIHA 3SISA 4DIQA 2VMDA 1PO22 2VD7A 5C3OA 3T4VA 3RZLA 1VBB1 1Q8SA 1PX3A 1Q8PA 5A33B 4PCRA 2XJRA 2PAEA 4OHVA 3FUOA 1VBE2 2QQMA 2YPJA 1VBD3 4U36A 1YFXA 1GOHA 4AOCA 3E5XA 4AF9A 1H8TB 5DMYA 5FZFA 4LLOA 1GNZA 3P1IA 3CQOA 4IETA 1K42A 2WJSA 4BIOA 1ND3C 2W5FA 2WN2A 3I49A 3DXUA 5FQ0A 1UX7A 2JD4A 4QB2A 1W2AX 2Z42A 4YFWA 4AI1A 2WZEA 3LE0A 1QJZA 1UWWA 1H2KA 4TLFA 5FZ7A 4LUMA 5FJKA 2AREA 1NCQC 2XJQA 4G3YC 3LA3A 2VQTA 1CR7A 4CDWA 4ATFA 2VBBA 5DUWA 4XDOA 5C71A 3IPVB 3AYDA 3RFRA 4HK9A 3MO4A 2ZEXA 3Q8BA 4UBHA 1UZVA 4CU8A 4Q0PA 3APBA 1AL21 4LBOA 4AI0A 3N9PA 1DDLA 4LE4A 3ILFA 1UZWA 4O65A 2VNVA 3NKGA 1UIJA 3KZ4C 1YO8A 4OI0A 2WO3A 3AP6A 5C70A 4KGGA 5JR7B 4WZFA 3T08A 3UGGA 4Q0UA 1O59A 1N3PA 1VBE1 4QHOA 4LIVA 5DAXA 3HQRA 3B5LB 3JBG2 4RR3B 2RE9A 5IVJA 2X10A 3MUZ1 2D6MA 3FBYA 5FZKA 3CKHA 1R1A3 3FLRA 4YVSB 2MNGA 4WM8C 2C5DA 1I3HA 1Y4WA 5FDBA 1QU0A 1UPIA 1NCQB 3SCFA 4MGQA 1YNAA 4PIXA 4WZCA 1NQJA 2Y6GA 3R4UA 3RG0A 1WD4A 2JDYA 1XE8A 3WF2A 2LRPA 5ACA3 3FX3A 2JENA 3MUY1 1BJQA 1NCRB 3C7HA 1HV1A 4IGPA 1VJ2A 3N36A 4NJ4A 5LRRA 2CNAA 4XTMA 4ZU5A 4EROA 3Q8CA 2CWMA 5IAVA 3VZKA 3WVJA 3PU3A 4MGTA 2ZGNA 1G7YA 2VCCA 2V4VA 1ZZBA 3E6CC 4BK4A 5CBLA 3JB8A 3U4XA 3UGHA 5FUNA 1OC1A 4COWA 2BWCA 3P5BA 5JI9A 5A6XA 4OZXA 4PLNA 1UMIA 4QX8A 4NIGA 1PGL2 4WVMA 1KFXL 2D6PA 4YZ2A 2R0HA 1F35A 2W1SA 2WNEA 4IXLA 2DU1A 1RHI2 5DUVA 4FAGA 2R071 1VBE3 1SBDA 1YQ6A 2HWB2 4IV3C 4XEZA 4Y4YA 3LEKA 3WOGA 2GC2A 1VMHA 2EVXA 1UOBA 2VTFA 1WMXA 2A3XA 3S7IA 4NE9A 5B4XA 5FY7A 3H1WA 1OQDA 3HOBA 4JDNA 3IT8A 4A4AA 3VDCA 3S6PA 4AW7A 1NX9A 5KXBA 4XHXA 3O7OA 4FI9A 4YG6A 4P9GA 4F83A 3VKNA 4ZONA 3ETPA 2RR11 5FP9A 5JAXA 1AR72 4P9JA 1S1AA 1P8JA 2RG4A 4QHZA 5FPUA 2JE9A 2IXLA 1NT0A 2IC1A 4LA3A 1VBA2 1PIV1 3IIIA 4B1LA 4CP9A 2Q0AA 5EQUA 3MPPG 5T55A 3MDPA 4YW2A 3WF1A 4AZZA 5FZ0A 2GN7A 5FBZA 3NKTA 3O1UA 1XNBA 2IFWA 1ZVFA 4LORA 1HXS3 1GP6A 2VTXJ 2VW2A 4RQPC 4X8NA 5G05L 5GZGA 2P3IA 5F5CA 3N7MA 3OGRA 3HNMA 3ZFEB 1VRH2 1PVXA 1ZNPA 4RHV1 2R1BA 4BQ3A 4CCEA 4XF1A 3OPTA 1BZWA 2QQKA 4NUBA 4PBPA 4ZS3A 2HWF1 2VNOA 2GC0A 4UFJA 3W5MA 4E4HA 2DCTA 1C8M1 4HETA 3WF4A 3CZUA 3WQ7A 1MZFA 4BCUA 3GHNA 3UT0A 2GDFA 4RYDA 4N8MA 5DDJ1 3POWA 1S0JA 2ID4A 4BLIA 1YUDA 1JYIA 3LSEA 1OOPC 1EPZA 3I59A 4NAOA 4CDQB 4XVHA 2R7EB 4PF1A 3RNSA 3NNLA 3UETA 2B9VA 4RQPA 1WGPA 2O1QA 2PHFA 2A75A 4CZSA 1W8WA 5F9TA 1YQ5A 4HSLA 1VBB3 1HRI2 2W46A 4FT8A 3T0BA 1DQ0A 3K4ZA 1COV1 3T1LA 2GP3A 3VZLA 4P08A 4DXRA 3Q8FA 3MV01 4JQTA 4Y1YA 2QQLA 4CE8A 4K8FA 2B8MA 3E1F1 3AVRA 2OPWA 5KC5A 1ASJ3 2R0FA 2ZMNA 4OHXA 1SACA 2FDIA 1CWPA 1I5PA 3AKPA 4CEWB 1MVQA 1QJY2 3RZMA 1C4RA 3D3AA 5FPVA 3KHCA 2ZX3A 4M3CB 1ZZ7A 4QM9A 3D82A 1CZSA 4Q2FA 5FZEA 2XHNA 4G4FA 4GKXA 3KF3A 1RITA 4NHLA 3IBMA 2WFF1 2HEWF 4CU9A 2CY6A 1YEWA 4WBBA 4RFT0 1EP0A 2F17A 3MLJA 4JTOA 4XZUG 5T50A 4D0QA 1C5IA 2XDVA 3MI8A 1YIPA 1JZ8A 1AR81 3K77A 2DVFA 4JGZC 5DG1A 4OLLA 4L9BA 4CEYA 4CYDA 3BIEA 1O3TA 4JCKA 3USUB 4BQ1A 2W52A 2DF7A 1SPPB 3FHIB 2FD8A 1CX1A 5JXJA 5F8PA 1VB4A 1BBT3 2JG8C 3SNMA 3J9SA 5EP9A 1JZ7A 1R091 3O0WA 3O5SA 2HWB3 2BWAA 2W1QA 4Q1RA 4BK5A 1JZ5A 3M7AA 1TMF2 3U07A 1E57A 1RHI3 2GALA 5I8TA 5JZGB 4QPIC 3DF0A 4XFIA 3WP5A 2FBEA 4AFDA 4D3WA 4MG2A 2FDKA 2ATFA 4MYEA 4QX1A 2BU9A 4GMP0 2WUHA 4FOQA 2A7AA 3EXUA 4B1MA 1W04A 3LSDA 3NNGA 2WZR2 2JDPA 4HXCA 1E5IA 3ZYGA 5D1IA 4HN0A 3BKZA 5CU1A 1LNSA 1ND2A 3ACGA 3NAPC 4CEYC 3TOJA 4INDA 4RL7A 3UKNA 1Q8VA 3MW3A 3AKSA 3AYEA 1HJGA 5LW9A 4CUCA 1IS5A 1AR83 2X5IB 4KQ7A 1X9PA 1ULCA 3HIFA 1JW6A 2J1SA 4HPKB 1I1EA 1F2NA 2AGSA 2P5BA 3VBOB 1REEA 3KM5A 3LEIA 4OCTA 2B39A 4Y5TA 4LHNA 2ZPXA 1GZ9A 2YU2A 3BTXA 2G9FA 4QWNA 1RUE1 5ISLA 4NPLA 1VR3A 4UF0A 5HV0A 5JXHA 3RJ2X 2DURA 4FFFA 2OIIA 4CDWB 2GC1A 5FMOS 2RV9A 5J1XA 1W9SA 5C8CC 4N9IA 1AZDA 1T6GC 2KA3A 5HV4A 4A2UA 4GWMA 1HW5A 2IFRA 3HT2A 3CEWA 4LO6B 1FMD1 4CDUC 1XC6A 1AR62 2GMPA 2KD7A 2WFPA 1QJX2 2MEV3 2OXBA 2XBO3 3CL1A 4M0HA 3DKQA 5JOXA 5K4LA 1KEXA 2XVKA 2YHJA 4XILA 1A3KA 1CIWA 3H7YA 3PDQA 3AC0A 1NA1B 1X7NA 4FPHA 1YLLA 2EXKA 3R05A 3RWKX 3MFCA 2X05A 1MS1A 2PTMA 4E8DA 1LESA 5DZEA 2WWJA 3HPNA 2W39A 2DUPA 4L8QA 4TLGA 1OLMA 5A7NA 4D94A 1FX5A 5I0SA 4B29A 1AYM3 2VJXA 2OS2A 1BVVA 2JJ6A 3K3NA 5FAXA 4ZXKA 3WUCA 3ZXEA 1ZZCA 1DZRA 1DGWA 3INAA 3ZXDA 2Q4SA 5KR7A 4LKFA 2WZPP 1RL3A 2YFUA 2E31A 3WW3A 3O12A 3P6BA 2ILMA 2WS91 3WX5A 3HBKA 1BLZA 2B7YA 5C9AB 3BIWE 3MV11 1NA1A 1ULEA 3NJXA 3DEMA 2C26A 3QD6A 5FPXA 5L73A 1ULOA 3CF6E 1BEV2 1IG0A 1C8M3 5AVPA 1F8VA 3GBFA 4QQ2A 3RYPA 4JKLA 3SKJE 1KRIA 2VVFA 4E8CA 5FRAA 1TE1B 4E9KA 1EPWA 1W2UA 3L2HA 1XNDA 4OQ8A 4Z07A 2RS31 2AZ5A 5IW0A 3M3EA 4DEQA 3RWNA 4UF0B 2ZHMA 4JZRA 1TEIA 2VZSA 5DAWA 1DG6A 1KDMA 4AHWA 1AR92 1VBB2 5A7OA 3DYOA 2BZDA 1JOPA 3CZJA 1JUHA 2WZR3 4UWDA 2VECA 2P3JA 1MACA 4AGVA 1EUTA 4ZHNA 1QWRA 1GBGA 4NHMA 3PURA 1KFUL 2RJKA 1MPXA 3B00A 1ASJ1 4CXYA 4ET7A 4M00A 1O91A 1S0GA 5FZOA 4ARXA 1ND2B 2PYTA 3AMMA 3SH5A 5AC92 1KQRA 3M1HA 3NO8A 3NNJA 1RVF1 4QAWA 3NV1A 4XZPA 1SMVA 5CVRA 1S0FA 2E26A 2XLAA 4YLZA 4YG0A 4CCMA 3OGSA 2P17A 4QB6A 1OH3A 3ACLA 1AX0A 5L7OC 1HN0A 2PHLA 2Y8KA 4Y5Z0 1OF4A 1POV0 1IOAA 2NLRA 4YPJA 1ENXA 2C1FA 2HWE1 4DO0A 5FZAA 1VBC1 2F6BA 3AFKA 5LCWL 2VUAA 3ES4A 3CJIB 2YUEA 1GICA 3SC7X 2NN8A 1QJEA 2JG9B 2VE1A 2WABA 3H9AA 3LB9A 5FMCA 4BQ2A 2BPA2 3DYMA 1RUJ2 3USUA 4BIFA 4BHPA 5FOJB 1RUI3 4HLTA 2XJSA 5FZ8A 5IK4A 2GN3A 4DUWA 3IPVA 4LBJA 4KWUA 3VDDC 1YRZA 2ZJCA 1V6KA 3FC0A 3VBUB 4DRRA 2KXLA 5ACA1 3NQHA 4H55A 5F6LB 4EE2A 1DF0A 1XE0A 4XABA 4B3NA 1AX2A 4TSVA 3T30A 3ZXGA 2Y26A 2BTVC 3FJSA 3POEA 5GZCA 1AJOA 2AYHA 3ZYIB 2XPJA 1YCIA 1PGW2 1XNAA 3A7QA 3EB7A 1JZ3A 1CZVA 2P3KA 4Q29A 5J3UA 4IE5A 5IVEA 5FYUA 5FYBA 1S2EA 3UNPA 1DGRN 3WG4A 3MIFA 5L19A 2FDFA 1T6BX 1HRI3 3WR0A 1UKGA 4AEJA 1VB2A 4OYUA 4GH4A 3AYAA 2BNMA 2JDKA 1RC6A 2ZX1A 2ARXA 3DV8A 2WO2A 3DYPA 4RD7A 1OUXA 2WL1A 2QQIA 2ARBA 2XKPA 1MS3A 3VBUC 5BNPC 3VDDB 4IGQA 3SLIA 3WW2A 3CDZB 4JV4A 3OG2A 3DPRC 4GA9A 2BNOA 1GUIA 3I2JA 2BOJA 4WVZA 2ZEWA 1WMFA 4Y33A 3T09A 1X82A 4CU7A 2QUOA 1JMUB 5ERLA 3I59B 4E2SA 2Q8CA 4PLMA 5F2WA 4A7ZA 5BNNB 1X36A 2ADEA 2JIGA 3WT3A 1ZX5A 1RUG3 1FNYA 5F2SA 1NUKA 1XNTA 3GJBA 1A8DA 1PZ8A 4LLFA 5CIRA 3ZYJB 2VZQA 4EN0A 3GJAA 4RS5A 5C8WA 2NQYA 1XXNA 3RZJA 2AH2A 3EJKA 2OQ6A 2VVEA 4UW5A 4AI9A 5BY5A 5IK5A 1XNCA 2J1TA 1JYXA 2ZEYA 1QGLA 4GKYA 2XG3A 4JGYB 4FFGA 2E9QA 2D43A 1W6QA 1AYN1 3IDBB 4M3CF 1AR91 3BN6A 3QCWA 1KJLA 1ZZ6A 4XCBA 4CUGA 2ZGRA 1CAWB 1LOFC 4A44A 3I4IA 1O5LA 1RYYA 2WT0A 4M01A 4BZ4A 4FPJA 3U11A 1EUUA 3JBG1 3BCWA 2HWC1 2WLPA 4L92A 2UURA 1BKZA 5LBEA 1Z7S3 1RUI2 3PJQA 3Q9OA 2OZ6A 2YFZA 4A6OA 2BGCA 2Z5WA 1M06G 1DIWA 1YIFA 3LCPA 5IFPA 2X53S 1W0NA 4AHZA 5A3LA 4JC1A 2K9ZA 3BB6A 4AQ2A 1XU2A 3ZN6A 4CP1A 1HRV3 1NE6A 2EIBA 5A7SA 3T0AA 4I0BA 4XIOA 4LHKA 4XQ4A 5FLJA 4YSFA 4NN0A 1RINA 1FOD2 1GYKA 2JKBA 1NKGA 2Y38A 3LPFA 4OUSA 5F3GA 1PMIA 5J48A 1LOFA 3PTYA 4BLJA 1JI6A 5C9AC 4FFIA 4WVVA 1IKPA 3D0SA 5FPAA 5T5OA 3MEPA 1VBC2 1CAUB 5FZ3A 3WF3A 4GB31 5GLZA 1IPKA 3HNBM 3T2OA 2JEMA 3LIHA 4ZS2A 3ZSMA 4KBBA 1VPHA 3IZOA 5ABJC 4CCNA 5C5TA 5FXXA 1W6OB 1R1A2 3ZR5A 4BQ5A 1W39A 1J1TA 1AHSA 1DBNA 2GP5A 3PUSA 4IERA 2ORXA 3ABZA 5EJ3A 3ZOIA 4B8EA 5JOZA 5FUPA 2YV8A 3JBG3 4AYUA 5I8SA 5J96B 5JMCA 1LAJA 3OB8A 4TYSA 4XFCA 2GNDA 3USSA 3ZYBA 1RMU3 4LXLA 3ZXFA 4F7ZA 2B42B 5IVCA 3C7OA 3WHUA 4I3GA 1PM7A 4L97A 3POIA 5A3PA 4AVAA 2IXIA 3ZXKA 3MLKA 5A32A 3J8F2 1FATA 5C9AA 2PELA 4CDUB 4Q0SA 1HJFA 5I93A 3H8RA 4CCKA 4AFCA 1H2MA 4UFMA 4DNYA 3ZR6A 1TNRA 5I0UA 1OFSA 3GDBA 2VY0A 1BK1A 4AAPA 2I45A 4D6QA 1XNKA 3QH7A 2HKXA 1DYKA 3HQXA 2IVJA 4M0NA 1OD5A 3WD5A 5T5JA 2WR9A 1Y9QA 3GXUA 4PF5A 4CDXA 3BOPA 3WW1A 4CUBA 1ZREA 1RUH2 5FZDA 1FV2A 1N47A 4KGQA 5L9RA 4Q4X3 4CTEA 4JGYC 2NZ9A 4QGMA 4J6GA 4F8AA 4HMZA 5IVYA 1ST8A 3FUQA 4OI2A 1DHKB 1DGRA 1HV0A 2B46X 2WO7A 2VW0A 4KL1A 4P00B 4XTPA 5FP8A 2UU8A 4Q1PA 4QDRA 1W99A 4BU2A 2RDRA 2G1MA 2Y60A 1JODA 4XUPA 5FYZA 3S7EA 2CWSA 3X29B 1PO23 3AP4A 3HNYM 2RDSA 4IEWA 2D3PA 1RUC2 5APAA 1ONAA 1BQPA 1V6MA 1DU3D 4TTGA 1UIKA 5JWPA 2PMWB 2WINB 1LECA 3QH6A 4L0PA 1PIV3 4N43B 4RSUA 4XC9A 4Y1ZA 1CAVA 2XVLA 5BNNC 1UYXA 1HRI1 1DQ4A 1GP5A 3PVEA 2Y6KA 1H8VA 1LOBA 4HONA 4N53B 5HCFA 4ARYA 4XF9A 5LA0A 1ZA7A 3A0KA 3PIGA 1OQEA 3VDAA 1IPJA 1CJPA 1CJDA 1OA4A 1YC61 2DTWA 1UNBA 3O1PA 3OUJA 4FXGB 4C8DA 3DPRB 3RMXA 2VMFA 5CB7A 4MXWA 4QQPA 5HCHA 4BXFA 4JRLA 5H9RA 4AI3A 1OA2A 4H14A 4XMIA 3SMHA 1J58A 5JPMB 1X8MA 3N9LA 2R061 1RUH1 4HBNA 2PLV2 5HXVA 4QX2A 3AK0A 1UYPA 5EJZB 3VZOA 5FYVA 3T2QA 1VRBA 4DOUA 1MZEA 2YC4A 4XFGA 1FMD2 1K5MC 3KV5A 3MFAA 1V9U1 3DECA 3TB0A 3ZYFA 1XBFA 2YDEA 3VD7A 4ZKTB 2JG9A 2P3YA 1SLAA 4NIIA 2I07B 3TEWA 2Z79A 1SEFA 4OMCA 4IEYA 3ZFGC 1YFWA 1V0AA 5L7OB 1NZIA 2W95A 4XUOA 1YWKA 1MQTB 2YY1A 1SCSA 5IAXA 3OBZA 1VBD1 3UK9A 3N9MA 5I0TA 4YW6A 1D0GA 4OUEA 4Z82A 3N9NA 2V5YA 5FZ6A 2ZHNA 3UL2A 1YI9A 1QQP3 2AUYA 3LQCA 2EAAA 5M0TA 1PO11 2AEZA 4FOYA 4XFAA 3WDTA 3THDA 3S5AA 1REDA 1K5MA 1X33A 1AL22 2HWE3 4IV3A 4Q4Y2 4I0WB 2HWD2 1ENSA 2XLGA 4PLOA 4GMP3 2G9GA 4XXAA 1UO9A 2ZAAA 5DUUA 2Q8OA 3NVCA 5E6HA 4IEXA 2J1RA 1LENA 4E2QA 1EV11 2WRAA 4KNCA 4Z2AA 5JSRA 4ASKA 3KQRA 1JTZX 1VAMA 2PLV3 3VB9A 1SDDB 3AZVA 4N7UA 4JQRA 2PFWA 2WAOA 4GMP1 2K2SA 2CYFA 3RPQA 2VXJA 1OA3A 3WDXA 4LEJA 2WO1A 3U78A 2VZPA 3H8UA 5GKAC 4LO5B 1IS3A 4EWDA 2VOWA 3B93A 3VZMA 3O1TA 2WNUC 1QQP1 2RS33 3KS7A 2BDRA 2DWRA 3POBA 4ASLA 1HKDA 1UU6A 3ZXLA 3VBHA 2IXJA 1ZM1A 2HEVF 4IEPA 4S2GA 2OW4A 3W20A 1HB1A 2VZUA 3FN9A 4L11A 4DUXA 1A8MA 3FMGA 4LPLA 4OVEA 1R082 1ASJ2 1UQXA 3UJQA 2GZWA 3N3HA 5CA6A 2QE3A 1RIRA 1W3XA 1UW8A 3W58A 5GZFA 4KWKA 2FDGA 5EXOA 5DDJ3 2A6VA 5FXWA 2VUDA 2RS13 5FZCA 4IEUA 5FBJA 3NSTA 4ZZ8A 2YYOA 1A34A 4HKOA 3K3OA 2YC0A 2EXJA 1LGBA 1Z0HA 1PK6B 5IVBA 1QH7A 3TAYA 2E7QA 1OBNA 1W6QB 1RUH3 2ZS6B 2A6ZA 3BYWA 3J4UH 3KF5A 3SHRA 3BVCA 1YXWA 4AI2A 2WS93 3AZWA 1W6NA 1VAVA 2EXIA 3RS6A 1RUC1 3MF6A 4MADA 4HL0A 3WNPA 1W3VA 2R6QA 4PDWA 1N3OA 1OLME 4YW5A 2BJSA 2BVVA 4P5YA 1CGPA 2LALA 1GANA 4EQVA 1HB2A 2WSUA 3URFA 5ANNA 5LEJA 1VAKA 5SV8A 2E6VA 4A3ZA 1O3QA 3M3OA 1T2XA 3F95A 3OY8A 5FZ9A 3THTA 2Y34A 4YARA 2VMEA 3CJXA 4E27A 2XQRA 5FZGA 3IB3A 1OHFA 3GZAA 1HB3A 1K12A 2QBXA 4QQHA 3TN93 1JYTA 3KHBA 2V09A 1NLQA 4LBQA 5A70A 3MGUA 2ZXQA 2EICA 5LA1A 5JXGA 5FJHA 1RUE3 3V0BA 2RM22 2D40A 1J3QA 3J7LA 1PO13 2D97A 3U0ZA 1VALA 3RZZA 5LZ6A 2ZGLA 3TRSB 1AUYA 4FPYA 3VBSA 4Z8BA 1C8NA 1V9U2 3NAPB 1RUOA 1D4M1 3AKTA 3M70A 4DEVA 4EN8B 2JDHA 3HBZA 5JI7A 5FMOL 4MVTA 3ZFFC 4WVMB 1G6NA 4YGDA 4YVSC 3FZ3A 1R083 3LD8A 4LUKA 2YXSA 2JX9A 3ZSEA 1HQWA 1QJX3 5JZGC 4GXLA 2D6LX 1OPOA 5DQ0A 1Q43A 2I2SA 1UY0A 2RS52 4FPEA 5EHDA 1GQHA 2WT2A 2JG8B 3T2TA 4GWIA 1BCXA 1D4VB 4XUNA 4BOWA 4H3WA 2BP6A 2C24A 2X5IC 1UF2C 1R093 4FQ4A 2ZGPA 2XJVA 3T2PA 1E5HA 4XBQA 2V4AA 3HAGA 5JLVA 2VOVA 2PQQA 2W2IA 5JSPA 5LWBA 5FPZA 5JDBA 4UAPA 4FVVA 4KU7A 3NJVA 3ZFFA 3PJYA 3AP5A 2PA7A 1UOFA 2ZOEB 4AFMA 1HIXA 4FOVA 3AMHA 3ZX7A 2CHHA 1KITA 2VMIA 3PTRB 3THCA 1G9BA 5CEHA 2JWPA 4Y1UA 1JYCA 2BYVE 1QJX1 2B9UA 4QPIB 3LKJA 5DAQA 4A7KA 4CVUA 3I7DA 5FTTC 1GR3A 4XJUA 3L9JT 5SV5A 1H6YA 3VHPA 1MR5A 2TEPA 4QHBA 1J84A 1O8SA 2DCYA 2XJUA 4UI9L 1JN2P 2VGDA 5J37A 4KG0A 3VHRA 2VW1A 1HB4A 1W8FA 2CL2A 4CRQA 3MPBA 2KR2A 4JDOA 4LBLA 1YQ2A 4HANA 2HWC2 2A70A 3QACA 2RS51 1W6PA 4QPGC 2WFF3 2VQAA 1H1IA 3PUQA 2LW8A 5C3PA 3VBSB 2RS12 3ZDVA 5FYIA 4FP3A 2WC2A 2XMLA 1SG3A 1ULDA 1Z7S1 3CIHA 2O8QA 4LBMA 4XURA 4LO7A 2VUCA 5GM0A 1W2OA 1EV13 1K45A 3OF1A 1OOPB 4P9YA 2AACA 2VL4A 4MGZE 4R9CA 4CP2A 3TEZA 2A73B 4CA9A 3H1MA 4NIDA 3ATGA 2I74A 1G9CA 2ZA9A 1YYNA 4S2FA 1W8ZA 1F31A 4R52A 1WBLA 2W9XA 1GV9A 1GOGA 3JUUA 3U10A 4AVBA 2ZX4A 1GZCA 5F3CA 3R4SA 3ZMOA 5FY5A 3VV1A 3TNPB 3POYA 4OULA 1B35A 1VLNA 5F37A 1H2LA 2FMDA 1VBA3 5C4WA 1ZA4A 4Y20A 1AYM2 2JB4A 1EAH1 4LNVA 4AQSA 3BALA 5CYYA 1W6MB 4W50A 3C2UA 3JQXA 4MV2A 4RQPB 5E8AA 1ZRCA 1BK0A 1BHGA 1CESA 4HFSA 4PHZA 4PT6A 4HKLA 4COVA 4YRDA 2PQSA 5C6CA 4J1XA 4U2AA 4AVSA 1Q8QA 4CDQC 1JOBA 3IAPA 4XW3A 4OHWA 4X6RB 1UCXA 3NW4A 3ZMNA 3QBQA 1OI6A 4FPGA 4XBNA 4MHUA 2HWF3 3H0OA 3WNOA 3ME2A 2AC1A 4HSJA 4IGOA 1CAXA 1QHDA 1EY2A 4YZ4A 3I2GA 1UMZA 5A32B 1HXS1 3ON7A 1ZYBA 5GLVA 3BODA 1CZTA 3VKMA 2BBAA 5GLUA 2GH2A 1O3RA 2ERFA 5J36A 3GBGA 2QZ3A 4NRPA 4D69A 4P5HA 2DVGA 2IXHA 1NQDA 2W87A 1YQ8A 4IEQA 4AVTA 4G9SB 4CP9B 4B7EA 3PLQA 1Y9GA 4M3CE 1YJLA 1URXA 4ORFA 5CFCA 2OX0A 1MEC2 4MLOA 3ASIA 4JVAA 1Q56A 4Q4V3 3R6SA 1NZCA 4FXKB 2BGOA 2ZKNA 3ZPOA 3O1VA 2WKKA 3KWVA 5FWJA 2D3RA 2NPIA 1H9WA 4YM3A 3ZN4A 3POSA 5ABJA 1LEDA 3OSDA 3WQ0A 3VGIA 2GMMA 1AX1A 5T54A 4P9XA 4URTA 4MGIE 1WWYA 2TBVA 4QX5A 2ZX0A 5F5AA 1L7QA 2XXZA 4I3PA 4H7MA 5A6ZA 1LODA 4ONUA 4Y22A 1NCRA 4XAEA 1QKQA 3AZYA 4IL7A 4JRAA 3VKLA 3I97A 4IV3B 4B4RA 1YHFA 2QQNA 5KHJA 3OGJA 1W6PB 5CFCC 4IW3A 5IVFA 3K2OA 5FO8B 1RUG1 4Q8KA 5IHRA 5JIAA 1AJKA 2D5FA 1QIQA 2QZ2A 2R043 3OJBA 4QMAA 5FLHA 5A80A 5HBAA 4FQZA 4DPNA 1R1A1 2W47A 1TME2 1J3PA 1QY4A 1O4TA 1OKOA 2F4LA 2WQ8A 5LA2A 3VBFB 2OYZA 3T1MA 1ULFA 1V9U3 4PQ9A 2WNOA 2ZX2A 2WNVB 4Q4V1 3N35A 2WNVA 3GCWA 1HLCA 3I3EA 1OQ1A 2QTWB 3N7KA 1AXKA 4KG8A 4B7KA 2A6WA 2BVBA 2CV6A 3ALQA 4Q4X2 4YG3A 3M4FA 1NCRC 2MHFA 5E88A 4S2DA 4JGYA 4UYBA 4CCLA 5FXVA 1D7PM 1H4HA 1WD3A 4C1WA 3JXSA 1JYWA 2QQPA 5FYCA 2DU0A 1PHMA 1SLBA 2WSVA 1U5IA 1QJY3 1ULGA 3AFGA 4MGYE 2BFUS 2TNFA 4AGRA 4O9GA 4IE0A 3AJZA 2Q30A 3FWEA 5BNPA 5CISA 3RJRA 1LEMA 4XQDA 5FMBA 2ORZA 1RUF3 3DPRA 4Y3OA 2D5HA 1SFNA 3TBDA 1S4CA 4IEVA 1W05A 1KDKA 2VXRA 5BNNA 1QNWA 3DKWA 3EQEA 3AXEA 3K4AA 4N9HA 5DUXA 5LBFA 4AEDC 1AF9A 1PGSA 2WNVC 3VUOA 2YBPA 1YQCA 2Z2SB 3RYRA 3WP4A 3O1MA 4JHTA 2VMGA 5FYSA 5A7WB 3MLLA 3EHKA 4LBKA 2PHTA 3B7MA 1D2QA 4BM8A 3DUIA 4XF4A 1W2NA 2PHRA 5FY9A 3LIGA 5IT6A 1O8PA 4LO8A 3J26N 5HPOA 4DS0A 5F3EA 1QOTA 3ZVXA 5HI0A 1AL0G 5CFCB 2B5HA 4HOOA 5CKMA 4MXWB 1RUI1 2C4XA 3WF0A 1GZWA 2QCSB 4DY5A 5BUVA 4GZ9A 4C91A 4Y1VA 4Y26A 3FBMA 3I8TA 3AP7A 1UU4A 1VBC3 4GJYA 4N53A 1RXGA 3WDVA 4AXOA 1NLSA 1NXMA 2O14A 2VQUA 5DPNA 1AR82 3H3LA 4AEDA 1UY2A 3I3MA 4BXSV 1VBA1 4COZA 1JBCA 3WCSA 1H8TC 2OVUA 4K7JA 4P9LA 5L36A 3MF9A 4A7YA 1PK6A 4LE3A 3OGVA 5F7UA 5C3QA 2OKXA 1GZTA 4RGGA 3MBWA 3ZIWA 1MS8A 1R092 1W8NA 2WWUA 2Y0IA 3J7MA 3AYCA 3IN9A 2Q1FA 4RFRB 4WM8A 5D8AB 4IE4A 1S0EA 4COYA 3NL1A 3PMSA 3ECQA 2RHPA 4YZ3A 4BJ0A 2G9ZA 3AB0A 2X29A 4BMBA 1TQ5A 3OOXA 4QDQA 4YGEA 3JD72 5JVVA 4HVQA 4IESA 2E32A 2WZR1 1S2KA 3OUIA 2K46A 3RRDA 3VHOA 2JIJA 1PVC2 5FOBB 1JOJA 4QXKA 3WUDA 1S0CA 4HN1A 2DBIA 4IV1A 4CXXA 1JU3A 2W1WA 4J25A 1PK6C 5GZEA 2GMEA 4GJZA 1XRUA 2E51A 4FPOB 4LBNA 3VD3A 5FV3A 3VL9A 4CP0A 1RUJ3 2QVSB 5HXMA 4RGKA 2D98A 4TN7A 3WW4A 1PO12 2PHXA 3VL8A 2P2KA 3I2IA 1OOPA 3ZXAC 1REFA 1LOEA 2UWBA 3FLPA 2EIEA 2AEYA 5DABA 1S55A 2HJIA 4Q4Y1 5FZ4A 3M3QA 4BA6A 1UN1A 2HWD1 3I3QA 2P6CA 5GLWA 1DQ5A 1NAEA 3GGLA 3ZFEC 5IYYA 1OSGA 1RUG2 2XB6C 2Y6HA 4RA0A 3VBHC 4AHXA 1OVSA 1GNHA 2GAUA 3AVSA 2DCZA 2VO5A 1SCRA 5FY1A 1W8OA 3AKQA 2WLQA 4Z92B 3LEGA 1GU3A 4YW1A 1TME1 4OI4A 1QJY1 2JICA 4ISQA 1GWKA 2R073 3BOWA 3K48A 5A1AA 3CLPA 4BISA 5J98B 4ES9A 2J1AA 1D4M2 1OFNA 3ETQA 4LITA 5CKNA 1O4YA 2FCTA 3VBRC 4ZZ5A 1A6CA 1DQ6A 2YG0A 4QB1A 1DFQA 2HBTA 5G04L 1O3SA 3D4KA 1HQLA 5I91A 1KJRA 1BYHA 3GHMA 1W03A 2SBAA 2P6HA 1OD3A 2H6BA 1IKQA 1W0PA 1V00A 2J42A 2QFEA 1Y3TA 5K9YA 4UT5A 4ZY9A 1GP4A 1WW5A 3HD8B 4LULA 2GNBA 1O6UA 4CCCA 1W06A 4HG6B 2XKOA 2RR12 1UZ0A 1NE4A 3U75A 1H1MA 2R041 3PUIA 3TYJA 1OKQA 1LHWA 4FSJA 4NR1A 4K1ZA 5IJRA 4EZ4A 1H30A 1PIV2 2XVGA 1SLCA 1UAIA 2QKDA 1SLLA 3ACHA 3PVBB 4PDWC 2QQUA 3K51A 3ST7A 3AJYA 3ZO0B 4EYUA 1QJU1 3OBAA 3ZM8A 4GB32 4L99A 2B4KA 3VBRA 5KHHA 4CU6A 4MOAA 3K75B 5A3NA 1SDWA 4MZUA 4DRVA 2LROA 4FPKA 4Q4W2 5LEKA 3M2MA 3PHMA 4YVWB 5JIUA 2YMZA 5B4NA 1OPMA 3C7FA 4FAHA 2RS32 2IZWA 2H6CA 4PJYA 4XIKA 3U4SA 1W8HA 3HMYA 4I09A 1D2SA 5FO7B 2W3JA 1US2A 4R9DA 4D7SA 2WZ8A 4BMEA 1ZBE2 1GKBA 1XYOA 3J8F1 3VBSC 5KWRA 1WLTA 4WM8B 5KC6A 5IATA 1DP0A 4AAXA 3THPA 1POQA 1HX6A 1OH4A 1O7FA 3AZZA 2XR4A 3BPZA 2JXAA 1E5RA 1WCDJ 2VNRA 3B69A 4QDSA 3UJOA 3B9CA 2Z4FA 3FE5A 3IMNA 2RS11 2WAAA 2XOMA 5AC91 1U0AA 4AEDB 1G9AA 1QJU2 5DXDA 3RZKA 5FR3A 1PGL1 3P3PA 4BB3A 3HJRA 3T4HB 4BDVB 2E7AA 5FUIA 2XWJB 4O7XA 1GLHA 5T3NA 1OXCA 4HPKA 4QU1A 2Q5TA 4N43C 3ZYHA 2QQJA 1QNYA 2X5IA 2Y33A 5FK7A 3WEZA 5KXCA 2XL9A 4XYXA 3W5NA 1M4WA 3JD71 2UYBA 4D8MA 2JDUA 2Q1MA 4LHLA 1GWLA 5IFTA 1F15A 1PVC1 4AEKA 3OPZA 2RMU1 3ZYRA 4D6SA 4HVRA 3M3CA 4LJHA 3UYJA 1W6NB 4BWOA 2YZ4A 1U12A 4CUAA 1JZ6A 1EAH3 5FKBA 1AYM1 2A5ZA 2VULA 3IDAA 3B02A 3L2YA 1R64A 4MUVA 1FOD3 4NROA 3ILRA 2VZRA 2VZTA 2Q8EA 3VBFC 1HRV2 1RVF3 4QPIA 4O61A 1XB9A 3JU9A 1MS9A 2CGPA 2ET7A 2NMNA 4TWTA 5EYXA 1WLWA 1PGW1 4K6BA 3S30A 2R16A 1BEV1 3A21A 4PBOA 4R9AA 4JDMA 4NOTA 5F32A 5TSWA 1N1SA 2PLV1 4MO3M 5H9QA 1TMF3 5IK8A 5C5UA 2RS53 2A6XA 3ZFFB 1MS4A 4MHRA 4XACA 1HDKA 3SCHA 2OUJA 2VOKA 4MH0E 2OT7A 2VU9A 1WZXA 4JKMA 1WCUA 4RGAA 1NLRA 3BTZA 1I6XA 1BBT2 3CJIA 3WP3A 4QX7A 4BQYA 5FYTA 1J83A 2WYFA 2XLFA 1I5ZA 1KS5A 3KB5A 1WLDA 2R1DA 1PNGA 4FTSA 3IMMA 2QJVA 2XUEA 3ZN6B 2D7FA 3VBFA 2J1UA 4ATEA 3FHQA 4KBZA 4DXSA 1V6IA 4XE9A 3I54A 4Y1XA 2WDBA 4BQXA 5FXZA 4A3XA 3H7JA 1DQ2A 4CEWA 5ABJB 1CAUA 1SHWB 3GBWA 1RUD1 4Y5SA 4UOJA 4LKDA 5GJ6A 5C8CA 2QDRA 1H4GA 3A0NA 1J1LA 1RUNA 4XETA 4JAAA 4GIQA 1GQPA 1D0HA 2PAKA 1N1VA 2ZGMA 3ACIA 4BE3A 3O0VA 5FZBA 1YI7A 3RSJA 4RHV3 5C4WC 2VUJA 1JH5A 5FYMA 3PUAA 3ZIXA 1YFUA 3RDIA 4J1WA 3KVAA 3KV6A 4I02A 4Q4W3 2BQPA 2PXJA 1Y43B 3SXWA 3V0BB 1EV12 3G7DA 2VCBA 1C1LA 3KD4A 1TNFA 3CBNA 1LTEA 1TME3 5E89A 5C33A 1GSLA 1FXZA 5H9PA 1X8EA 1F5FA 1GWMA 2ZAHA 3JCIA 3NRUA 3RQ0A 2VPVA 1AXYA 2ZEZA 4EN7B 5FCCA 5I0DA 4UFKA 3VLBB 1BBT1 4FPLA 4EZHA 3J8F3 5D8AA 2HWD3 2PHWA 4RS5B 1ENQA 1WKYA 4Y4RA 2WFF2 1ZRRA 3MW2A 3N9QA 1AYN2 4V2WA 2YB7A 3OEBA 4CPBD 1RUD3 1PO21 3R0RA 2DFBA 2OQ7A 2MEV1 2XBO1 1F4AA 2FZ1A 1OT5A 1PMHX 4XDQA 3PNAA 2WQ4A 1BMV2 1UKRA 1O5UA 3VHNA 2X8KA 3NNMA 3H1YA 3PVNA 4YM0A 3V65A 4YFZA 1G9DA 2D44A 2VCMA 1R081 3EMRA 4QM8A 1LHNA 1CD3G 5T5PA 3ZPYA 5F3IA 3D8CA 3FLTA 3T3YA 3WP6A 3ZXJA 1ZZ9A 4DUVA 3H3UA 1EYBA 4NVPA 4WM7B 5FZ1A 1QJU3 2WNUB 5FIXA 3H8XA 3E6BA 3VDDA 2VNGA 2KM2A 1KS4A 1JYNA 2JDZA 5FY4A 2J1EA 2VCAA 2CAVA 4YM2A 1UY4A 4XOGA 1N3QA 4PI0A 1S0BA 5BNOA 5A3OA 1MQTC 1FI2A 1W9YA 3D0JA 3IDEA 4GH4B 1PZ7A 5K0UC 5K7PA 5A6YA 1F9KA 3ZFGB 1HXS2 1STMA 3KGZA 4IUGA 1F4HA 2FCVA 2BGPA 5EJ1B 2HYKA 4AG4A 2XQXA 5KHIA 3MIHA 1FPN2 1L7RA 1UU5A 2BRTA 2VMCA 3C3VA 1AR73 1LJ7A 2CGNA 4NWWA 4P9IA 3UGFA 4FO9A 2NMOA 4QPGB 1WMDA 1QXJA 1XJAA 2DFCA 5BNPB 1JU4A 4XF3A 2PHDA 1BMV1 2PAMA 5JXIA 1IQDC 1PZ9A 3D6EA 2Y0OA 2BERA 2D6OX 3IDCB 2FCUA 3ZSKA 2GNMA 2ZGQA 5BNOC 5FY8A 4CCDA 3I2HA 3JD73 1GOFA 2RVAA 5FZMA 1CX4A 2LS6A 2XJTA 4GB33 2DTYA 2IXKA 4A41A 4EN9B 1XYPA 2R49A 2ZKLA 5C7GA 4RN5A 4XPVA 1XOYA 1XU1A 4CCOA 3NJZA 3LFIA 4IDZA 1LU2A 5LB6A 2JKXA 2RM23 2R32A 4QKNA 4F3JA 2EAKA 4BQWA 5KHKA 2O0OA 2DUOA 2FZ2A 3V56A 2W1UA 4FCAA 1UZYA 4YNIA 5E16A 5IVVA 2SLIA 4UFIA 1NCQA 1H0BA 1GNYA 3TN92 3LEMA 2ET1A 5A3MA 2FDHA 3WHTA 4IE6A 5BNQA 3ZLIA 3E5UA 4LK7A 1YFYA 2NP0A 2D93A 2IXCA 2QNKA 3O1OA 3I2DA 2GNTA 3BTAA 2W08A 2P37A 3N7LA 5A3TA 1SFYA 3NWKA 4L2NA 4YM1A 3ZSJA 1HN1A 2D6KA 3POGA 5L9VA 3PIJA 1BEV3 3BPSA 4YW7A 3B94A 4C0HA 1W6OA 2WS92 4W65A 3VD4A 1VRH3 1LR5A 3SH4A 4OI1A 1V70A 1C5HA 3RI8A 3E6DA 1IS4A 2GH8A 2TUNA 4GH4C 4HT1T 3UV9A 3MZHA 3WQ1A 1OLQA 2D3SA 1ACCA 2HWC3 2VVDA 1R1ZA 2YPDA 1SLIA 2Z69A 3ENRA 4NAMA 3SH3A 2K0GA 4E4ZA 1S2BA 4I30A 4PIYA 5KXEA 4XJZA 3OCPA 2J7MA 3C7EA 5FP7A 3BU7A 3PVOA 1OURA 4JKKA 3GYDA 4URAA 3UKTA 4QQOA 3ITQA 2OUHA 4A45A 4WM7C 1LU1A 4DZGA 1Y9MA 4LQRA 3K4DA 2VZ3A 4YGCA 1U5YA 5F39A 5CZKA 1WW4A 4Q0VA 4E2GA 1G8WA 1A78A 3NMBA 4JTNA 4CSWA 4K40A 2R062 3WV6A 4DINB 2ZGUA 3N7JA 4WV8A 2WYSA 5IUQA 1AXZA 1CAVB 1H8TA 3GNEA 1XSRA 4XUQA 2P1BA 3GALA 4BYYA 4LBQB 2V72A 2ZGKA 4KH9A 4MSVA 5LATA 3HEIA 1TG7A 2DV9A 3BUCA 5A33A 4Z1VA 3E5QA 3EYPA 3FHAA 4Q5OA 1WLCA 4KI5M 4DB5A 4RS5C 1AVBA 4MX3A 3KV4A 3RGBA 1H1AA 4NRQA 4IV1B 1O4ZA 5DN2A 5A1LA 2ZHKA 2W68A 2A71A 2BUKA 3WDWA 2VOXA 1ENRA 2XONA 4XFFA 3EBRA 4WM7A 3OD0A 1Z7S2 5FZIA 1VBD2 4QGLA 4QPWA 2VH9A 1RUF1 2BNNA 2YU1A 2ZGOA 5CNAA 1IPSA 4PI2A 4H7LA 5LASA 3AL5A 3KT4A 2OPKA 4X8PA 4GALA 2R042 2VC9A 1RJ7A 4CCJA 1LOAA 3KCYA 3SQOA 4XXPA 2NM1A 1CAXB 4IV1C 2JDNA 4Y20B 4CDXB 5FP4A 2UWAA 3AP9A 5C4WB 4HZFA 4Q26A 2HWE2 4Q4Y3 4H2AA 5FKCA 2VAUA 1CONA 5CFDB 1VMFA 4EJRA 4MXVA 1WUVA 1W28A 5E1RA 5FZHA 2DVDA 2XJPA 4OHZA 3KSCA 1RUJ1 3GZTB 4GULA 4FFHA 2DVAA 3KVBA 4FOWA 1LOGA 4CDXC 3LZZA 3AMQA 3A4UA 2JDMA 4ZPIA 4YGBA 2YC2A 3CMGA 1LRHA 1C28A 2Q1ZB 1WW7A 4UFHA 4A6SA 3U37A 4QXBA 1TVGA 2WWSA 1HQNA 3K46A 5FPBA 3LOBA 3LA7A 2RJ2A 3I3BA 1UXZA 5DZFA 1H9PA 1GZWB 1U5ZA 4AVVA 4QD2A 5C3RA 1ZBE1 4QQLA 4E4DX 4OHYA 3DL3A 4W6XA 5FREA 2VOTA 4AR2A 3U14A 1G86A 3A23A 3W9AA 1GQGA 3DXTA 3NJYA 4W6YA 4N7IA 3BI3A 3LDBA 5FWEA 3IM0A 3MIEA 4P14A 5ANQA 5IK7A 3WQBA 5J7MA 3LFMA 4YW4A 3IIAA 4IEOA 4W4ZA 3HR9A 4UW3A 1ULPA 2VBDA 5EFUA 3S57A 2B45X 3KLSA 2WN3A 3WDUA 5LBBA 5CAZA 1JUIA 1QXPA 3I2KA 4K1YA 5JCTA 4FTEA 1VRH1 4RHV2 2GC3A 1OVPA 1ZBA1 5JOYA 2EF6A 2BBVA 3KT1A 2HWF2 2VQ0A 1K3IA 1H2NA 4EN6B 4FTBA 3UESA 4AQ6A 1SPPA 3FFQA 3HVDA 1OUSA 2UYAA 5JPNB 3O14A 1U5XA 1W2TA 1QF3A 5FPLA 1WCKA 5DDJ2 3KQ4B 2BEOA 3KT7A 2C6SA 4R8HA 5A7QA 1S0IA 1JYVA 1UD1A 5A1FA 2V5DA 1MVEA 1RMU1 1WMEA 3TWIA 4GD4A 3JZVA 5LK5A 3WLUA 4P02B 3CNAA 5EWSA 1CAWA 3P3NA 2ARAA 4LOSA 3E97A 2HBUA 1MS5A 2DUQA 2YGLA 3M8LA 4I0AA 1UYZA 3LGRA 3OUHA 4V1PA 5A7PA 1NY72 3MYXA 2CDPA 3A22A 1K5MB 3B01A 4LK6A 2C9KA 2P4EA 1IS6A 1DCSA 1HRV1 4HK8A 1DYOA 4Q8LA 3WNXA 2W94A 4AL9A 1DLCA 4OZOA 3C8XA 3SKVA 4ZU7A 1FPN3 5J09A 3LA2A 4FBFA 2V73A 2QQVA 5EV7A 4LTAA 3H8OA 3PUHA 5FZLA 4LHSA 3IWZA 4JGZA 4AEMA 4QGNA 1DLLA 3S0MA 1V6OA 2RM21 4DY3A 1QOOA 2XHKA 3BU0A 5DAPA 1KGYA 5AVAA 1IQAA 4NO4A 4B4QA 2WA3A 4Y22B 1X9TA 3CO2A 1ODMA 3KCCA 2ADDA 4Q4V2 2IWGB 2VZOA 4K20A 4N53C 4QXHA 1Y7BA 5BYNA 1SFPA 1WW6A 5LY2A 1WA6X 1BXHA 2UY9A 5D21A 3QLQA 4M3CA 5AC93 4LIUA 1GFF2 4PIZA 1CPMA 3H42B 4LMFA 3N9OA 4Q0QA 4K9SA 4N43A 1BVP1 1QQP2 2JD9A 2WA4A 1OMIA 2ES3A 3OBRA 3AKRA 2DCJA 3H50A 1DZTA 3ELNA 1RJ8A 5BNOB 1ZRDA 2UY8A 5K8SA 4K8RB 1W9TA 4D7TA 2J1VA 1APNA 1AR71 4NHYA 2OZJA 4W8JA 1ND2C 3NAPA 1RGSA 2G19A 1UMHA 4EV0A 4Z2WA 5A3WA 3WZ1A 1C1FA 4ITCA 2WNUA 4PDWB 2X09A 4D6RA 4OMDA 2RJLA 1FAYA 2JE8A 4CPBA 4WVWA 2IUWA 4XAAA 2JG9C 3AL6A 1JZ4A 3VDBA 2H0VA 3OEAA 5DG2A 2EIGA 3B9IA 2WT1A 3ZFGA 5GLTA 4IE7A 4QPYA 3HN3A 2ZMLA 2VZ1A 5FYHA 2C9AA 1DGLA 3WNMA 1LGCA 3OY8B 2EALA 1C8M2 3O1SA 4GQ7A 3MICA 4XF0A 4DXZA 5DAVA 5CFDA 2N7GA 3RI9A 2GSYA 1RTVA 1RXFA 3SEPA 3Q8AA 4ISRA 1MZ5A 2JECA 4UFLA 3ZKYA 2RMU2 1UOJA 3HWJA 1WCSA 4I2OA 1W90A 1F5JA 2H0BA 1NG0A 4SBVA 3WXPA 1LHUA 5EZWA 2A3WA 5LRSA 1UXXX 2HYXA 1CVNA 3VZNA 3AM2A 3WDYA 3ZFEA 5HCAA 3LWCA 5JUVA 5F5IA 4XCAA 4NIAA 1CIYA 4FPCA 1JHJA 5T52A 1POV3 4UW4A 1LKNA 4ES8A 1X50A 1CPNA 2P34A 2FDJA 3VBHB 4LKSA 2D6NA 4ZU4A 4TXWA 4XQWA 4O9EA 1RUC3 1PMJX 1IZ3A 3IKWA 3KCXA 3I2FA 4IEZA 1QOSA 3GZUC 3ROUA 2XUMA 4N90A 3WNLA 1UY1A 3O0XA 3NV4A 1DZQA 2ZACA 2EXHA 4AQTA 4KWJA 3MW4A 5CFDC 5EPAA 4LKEA 5FO9B 1L3JA 3LF7A 1ZBA2 5LA9A 5FMDA 1ZRIA 5BXXA 1UPSA 3S5QA 1XYNA 1VMJA 5A3UA 2ZTNA 2PHUA 1J3RA 4CXWA 2PN5A 1LB2A 2JDAA 2A1XA 1RHI1 2ARCA 2JB8A 3DGTA 3GM8A 4META 1LHVA 4UXAA 4Q4W1 3DCQA 2HWB1 3VBOA 1NA1C 1E5SA 4DXTA 1V6NA 4QKFA 1S0DA 2DCKA 2E7TA 1SBFA 4X6QB 2FHRA 4Y24A 5AFEA 2CDOA 2AR6A 2XGXA 4AE2A 4NRMA 5H9SA 1FPN1 2DDUA 2IVIB 2ZMKA 1PNFA 3KMHA 3GF6A 4MGSA 3J7HA 3IAQA 1Q5OA 2BV4A 5F1RA 1DQ1A 2ZGSA 1JZ2A 1RB8G 4LO4B 3WCRA 5B2GB 5C8CB 1D4M3 5FK8A 3HQUA 3WNNA 2F4PA 4R4ZA 5D8AC 4YVSA 5KHGA 5FY0A 5L9BA 4XJ9A 4LR4A 3POFA 3RVHA 3ZKUA 3T0DA 1IHMA 4RR3A 4LT5A 2Y64A 5AFBA 1FYUA 5T5LA 5JZGA 4ASMB 4K21A 3U1XA 4PQQA 4I01A 2Y6LA 4NHXA 1JHNA 3VBOC 2WQZC 2AENA 3LAGA 1WA4A 3WG2A 2DYCA 1N1YA 1PX4A 2ZGTA 1NXD1 1W9WA 1K5JA 1OLRA 1Q8OA 2RDNA 1TMF1 2VBPA 4FP2A 1QDOA 2JE7A 1IG3A 4CEYB 4YZ1A 3TNQA 3MIDA 4S2HA 3W59A 4NPMA 1ALYA 5DZGA 3WINE 3ORJA 4B4PA 3TEYA 3ACFA 3NNFA 3LDRA 5LBCA 2L9LA 1LHOA 2G4IA 4XDPA 2HH9A 1PM4A 4RR3C 4GWNA 1Z78A 3LOIA 5CKQA 2MEV2 2XBO2 3JB4C 5KXDA 3BTYA 2EA7A 2CTVA 4V2VA 1W9FA 5L7OA 1NOVA 3RZGA 1LULA 1AR63 2JG8A 5CG9A 4QXCA 3WG3A 3MHZA 1MEC1 4AVCA 3AZXA 3BGAA 5FQ0B 5IWFA 3DN7A 3CHXA 3CU7A 4M4RA 1XSQA 2RMU3 1COV2 1ZBE3 4HVOA 3F2ZA 5D2AA 3OYWA 2VZVA 2Y6FA 2ZZJA 5F6KA 1FV3A 3QOPA 4QKBA 1RUE2 4W6WA 2YGMA 3WG1A 1RVF2 4NPRA 4A42A 4AGGA 2ZCWA 2XWBB 3HT1A 3RMYA 4COUA 3V0AB 3ZSLA 5GALA 2ENRA 1N1TA 2FMYA 1H6XA 4QPGA 1UY3A 4LA2A 4BH9A 4JHZA 2QQOA 1QEXA 1MEC3 1TZOA 4OUMA 3ZN5A 1MZ6A 2R063 1AR61 1XPWA 3OPWA 3NV3A 3M3IA 4GWJA 4AHYA 3VKOA 1QH6A 2LUWA 4KMQA 5A7WA 2QDNA 2ZBJA 1ND3B 5JSOA 2BFUL 3AX4A 3KGLA 2VM9A 2CAUA 4E4SA 5C3SA 1OF3A 2MPFA 4GAZA 4C1XA 4YVWA 4DFSA 1V6JA 2ETEA 4DQAA 3H3ZA 3PU8A 4D7YA 2RR13 1XQNA 5LK7B 1JXNA 3LDKA 2FQPA 4AWDA 3V0AA 1ODNA 4YWAA 1RUD2 1FNZA 5EYYA
chains in the Genus database with same CATH topology
1YJKA 1UX6A 4JGZB 1B35C 1B09A 3RYKA 3VBUA 4CDUA 1QXRA 2WIIB 3OYWB 1ZBA3 4EWEA 3AMNA 2E63A 4FPFA 2ZHLA 4UBGA 2LM3A 3CJIC 1C57A 5CG8A 1FMD3 4IQPA 4OFGA 4P9WA 1RUF2 1DGWX 3ILNA 4HKWA 4C90A 2ZZQA 3OGGA 3MIGA 4YW3A 5K0UB 4XJAA 2E53A 3ZYPA 4YVWC 3G6JB 4EWAA 2A6YA 3VZJA 3TN91 3VBRB 4CEWC 4KU8A 5FFOC 1VIWB 2R30A 1LGNA 2VG9A 2BW8A 4C0BA 1SLTA 2A3YA 1SBEA 3ZDSA 2GU9A 5I0RA 2OA2A 3MIBA 1Q3EA 4DMIA 1ZZ8A 3V64A 3N4MA 1ZRFA 3OBTA 1C3HA 1XE7A 4XHBA 4XFBA 4YZ5A 1MS0A 1LCLA 2W0XA 5F5QA 4UW6A 5JOWA 3R4DB 2YROA 1AL23 4AFBA 5GZDA 5BPXA 3JQWA 4XMAA 3WY6A 4XBLA 4BPZA 1WBFA 2DVBA 1POV1 3HN1A 4AFAA 5CADA 3NV2A 2XL7A 2LTNA 1UL9A 4NHKA 2ZABA 2O8OA 2CGOA 3ES1A 5HCBA 4TZDA 1G9FA 1DYPA 3VN4A 4SLIA 1KXGA 1QMJA 1SQ4A 4AK3A 4R4XA 1NYWA 2VMHA 5KBFA 4KWLA 4XJ8A 5FLIA 1I9RA 2R072 4LBQD 4CDQA 3AMPA 1UZZA 1EAH2 3SCGA 3EO6A 1CQ9A 2HEYF 1J59A 3VKFC 4QT6A 4Q4X1 1KD7A 5ACA2 1W0OA 4YYOA 5I8YA 1MQTA 1QDCA 1RMU2 5K0UA 1CN1A 2C0ZA 1FT9A 3SITA 1LOCA 4R9BA 2NYYA 4XJWA 5BV6A 1COV3 4AI8A 2XH6A 4NWVA 1ND3A 1FOD1 3OTFA 1VP6A 1V6LA 3D5OA 3FFZA 3PMEA 1IGOA 1NY71 3B3QE 3OD4A 1W6MA 1AR93 4QU2A 3AXDA 2UWCA 1AYN3 4K3UA 4XFHA 3UKVA 4MGKE 1PVC3 1B35B 4CDWC 4Q27A 3SISA 1PO22 1VBB1 1Q8SA 1Q8PA 5A33B 4PCRA 2XJRA 2PAEA 4OHVA 3FUOA 1VBE2 2YPJA 4U36A 1VBD3 1YFXA 3E5XA 4AF9A 1H8TB 4LLOA 1GNZA 4IETA 2WJSA 4BIOA 1ND3C 5FQ0A 2JD4A 2Z42A 4YFWA 4AI1A 1QJZA 1H2KA 4TLFA 4LUMA 2AREA 1NCQC 2XJQA 4G3YC 3LA3A 1CR7A 4CDWA 4ATFA 5DUWA 3IPVB 3AYDA 4HK9A 4UBHA 4Q0PA 3APBA 1AL21 4LBOA 4AI0A 1DDLA 4LE4A 3ILFA 3NKGA 1UIJA 3KZ4C 1YO8A 4OI0A 3AP6A 4KGGA 5JR7B 4WZFA 4Q0UA 1N3PA 1VBE1 3JBG2 3B5LB 4RR3B 2RE9A 2D6MA 3FBYA 1R1A3 3FLRA 4YVSB 2MNGA 4WM8C 2C5DA 1I3HA 5FDBA 1QU0A 1UPIA 1NCQB 3SCFA 1YNAA 4PIXA 4WZCA 1NQJA 3R4UA 3RG0A 1WD4A 1XE8A 5ACA3 3FX3A 2JENA 1BJQA 1NCRB 1HV1A 1VJ2A 3N36A 5LRRA 2CNAA 4XTMA 4ZU5A 4EROA 2CWMA 3WVJA 2ZGNA 1G7YA 1ZZBA 3E6CC 5CBLA 3JB8A 3U4XA 4COWA 2BWCA 5JI9A 4OZXA 4PLNA 1PGL2 4WVMA 1KFXL 2D6PA 4YZ2A 2R0HA 2WNEA 4IXLA 2DU1A 1RHI2 5DUVA 4FAGA 2R071 1VBE3 1SBDA 4Y4YA 2HWB2 4IV3C 4XEZA 3WOGA 2GC2A 2EVXA 2A3XA 3S7IA 3H1WA 1OQDA 4JDNA 3IT8A 3S6PA 4AW7A 5KXBA 4XHXA 3O7OA 4YG6A 4P9GA 4F83A 3VKNA 2RR11 5JAXA 1AR72 4P9JA 1S1AA 2JE9A 2IXLA 4LA3A 2IC1A 1VBA2 1PIV1 2Q0AA 3MPPG 5T55A 3MDPA 4YW2A 2GN7A 5FBZA 3NKTA 1XNBA 2IFWA 1ZVFA 4RQPC 1HXS3 2VW2A 5GZGA 4X8NA 2P3IA 3N7MA 3ZFEB 1VRH2 1PVXA 1ZNPA 4RHV1 2R1BA 4XF1A 1BZWA 4PBPA 2HWF1 2VNOA 2GC0A 2DCTA 1C8M1 4HETA 3WQ7A 1MZFA 4BCUA 3GHNA 2GDFA 5DDJ1 3POWA 1S0JA 4BLIA 1YUDA 1JYIA 3LSEA 1OOPC 1EPZA 3I59A 4CDQB 3RNSA 4RQPA 1WGPA 2O1QA 2PHFA 2A75A 4CZSA 5F9TA 4HSLA 1VBB3 1HRI2 4FT8A 1DQ0A 1COV1 3T1LA 3VZLA 4Y1YA 4K8FA 2B8MA 5KC5A 1ASJ3 2R0FA 2ZMNA 4OHXA 1SACA 3AKPA 4CEWB 1MVQA 1QJY2 1C4RA 2ZX3A 4M3CB 1ZZ7A 4QM9A 3D82A 4Q2FA 4G4FA 4GKXA 1RITA 4NHLA 3IBMA 2WFF1 2HEWF 2CY6A 4WBBA 4RFT0 1EP0A 5T50A 3MLJA 4JTOA 1C5IA 3MI8A 1YIPA 1AR81 2DVFA 4JGZC 5DG1A 4OLLA 4L9BA 4CEYA 4CYDA 1O3TA 4JCKA 3USUB 4BQ1A 2W52A 2DF7A 3FHIB 1VB4A 1BBT3 2JG8C 3SNMA 3J9SA 1R091 3O0WA 3O5SA 2HWB3 2BWAA 4Q1RA 3M7AA 1TMF2 3U07A 1E57A 1RHI3 2GALA 5I8TA 5JZGB 4QPIC 3DF0A 4XFIA 3WP5A 2FBEA 4AFDA 4D3WA 2ATFA 4MYEA 4GMP0 4FOQA 2A7AA 3EXUA 3ZYGA 3LSDA 2WZR2 5D1IA 4HN0A 5CU1A 1ND2A 3NAPC 4CEYC 3TOJA 4INDA 4RL7A 3UKNA 1Q8VA 3MW3A 3AYEA 3AKSA 1IS5A 1AR83 2X5IB 4KQ7A 4HPKB 1ULCA 3HIFA 1JW6A 1I1EA 1F2NA 2AGSA 3VBOB 1REEA 3KM5A 2B39A 4LHNA 2ZPXA 1GZ9A 2G9FA 1RUE1 1VR3A 3RJ2X 2DURA 2OIIA 4CDWB 2GC1A 5FMOS 5C8CC 4N9IA 1AZDA 1T6GC 2KA3A 4A2UA 4GWMA 1HW5A 2IFRA 3HT2A 3CEWA 4LO6B 1FMD1 4CDUC 1AR62 2GMPA 2WFPA 1QJX2 2MEV3 2XBO3 4M0HA 3CL1A 5JOXA 2XVKA 4XILA 2YHJA 1A3KA 1CIWA 3H7YA 1NA1B 1X7NA 4FPHA 1YLLA 2EXKA 3R05A 3MFCA 1MS1A 2PTMA 1LESA 5DZEA 2W39A 2DUPA 4L8QA 4D94A 1FX5A 5I0SA 4B29A 1AYM3 4ZXKA 1BVVA 2JJ6A 5FAXA 3WUCA 3ZXEA 1ZZCA 1DZRA 1DGWA 3INAA 3ZXDA 2Q4SA 2WZPP 1RL3A 3WW3A 3O12A 2ILMA 2WS91 3WX5A 2B7YA 5C9AB 3BIWE 1NA1A 1ULEA 3QD6A 5FPXA 5L73A 3CF6E 1BEV2 1C8M3 5AVPA 1F8VA 3GBFA 4QQ2A 3RYPA 1KRIA 2VVFA 5FRAA 1TE1B 4E9KA 1EPWA 1W2UA 3L2HA 1XNDA 4Z07A 2RS31 2AZ5A 3M3EA 3RWNA 2ZHMA 1TEIA 1DG6A 1KDMA 4AHWA 1AR92 1VBB2 1JUHA 2WZR3 2VECA 2P3JA 1MACA 4AGVA 1QWRA 1GBGA 4NHMA 1KFUL 2RJKA 3B00A 1ASJ1 4M00A 1O91A 1S0GA 1ND2B 2PYTA 3AMMA 3SH5A 5AC92 1KQRA 3M1HA 3NO8A 1RVF1 3NV1A 4XZPA 1SMVA 5CVRA 1S0FA 2XLAA 4YG0A 4YLZA 2P17A 3ACLA 1AX0A 5L7OC 2PHLA 4Y5Z0 1POV0 1IOAA 2NLRA 1ENXA 2C1FA 2HWE1 1VBC1 2F6BA 3AFKA 2VUAA 3ES4A 3CJIB 2YUEA 1GICA 2NN8A 2JG9B 3H9AA 3LB9A 2BPA2 1RUJ2 3USUA 4BIFA 4BHPA 5FOJB 1RUI3 4HLTA 2XJSA 5IK4A 2GN3A 3IPVA 4LBJA 3VDDC 1YRZA 2ZJCA 1V6KA 3FC0A 3VBUB 4DRRA 2KXLA 5ACA1 4H55A 5F6LB 1DF0A 4B3NA 1AX2A 4TSVA 3ZXGA 2Y26A 2BTVC 3FJSA 5GZCA 1AJOA 2AYHA 3ZYIB 2XPJA 1YCIA 1PGW2 2P3KA 4Q29A 5J3UA 1DGRN 3WG4A 3MIFA 5L19A 1HRI3 3WR0A 1UKGA 4AEJA 1VB2A 4GH4A 3AYAA 2BNMA 1RC6A 2ZX1A 2ARXA 3DV8A 4RD7A 2WL1A 2ARBA 2XKPA 1MS3A 3VBUC 5BNPC 3VDDB 3WW2A 3SLIA 4JV4A 3DPRC 4GA9A 2BNOA 4WVZA 1WMFA 1X82A 2QUOA 3I59B 4E2SA 4PLMA 4A7ZA 5BNNB 1X36A 3WT3A 1ZX5A 1RUG3 1FNYA 1A8DA 1PZ8A 4LLFA 5CIRA 3ZYJB 4EN0A 4RS5A 5C8WA 2NQYA 1XXNA 2AH2A 3EJKA 2VVEA 4UW5A 5BY5A 5IK5A 1XNCA 1QGLA 4GKYA 2XG3A 4JGYB 2E9QA 2D43A 1W6QA 1AYN1 3IDBB 4M3CF 1AR91 3QCWA 1KJLA 1ZZ6A 2ZGRA 1CAWB 1LOFC 3I4IA 1O5LA 2WT0A 4M01A 4BZ4A 4FPJA 3U11A 3JBG1 3BCWA 2HWC1 2WLPA 4L92A 2UURA 1BKZA 1Z7S3 1RUI2 3PJQA 3Q9OA 2OZ6A 2BGCA 2Z5WA 1M06G 1DIWA 1YIFA 3LCPA 2X53S 4AHZA 5A3LA 4JC1A 2K9ZA 3BB6A 4AQ2A 1XU2A 3ZN6A 4CP1A 1HRV3 1NE6A 4I0BA 4XIOA 4LHKA 4XQ4A 5FLJA 4YSFA 4NN0A 1RINA 1FOD2 1GYKA 2JKBA 2Y38A 4OUSA 1PMIA 5J48A 1LOFA 3PTYA 4BLJA 5C9AC 4WVVA 1IKPA 3D0SA 5T5OA 3MEPA 1VBC2 1CAUB 4GB31 5GLZA 1IPKA 2JEMA 3ZSMA 4KBBA 5ABJC 1W6OB 1R1A2 1W39A 1J1TA 1AHSA 1DBNA 4IERA 5EJ3A 4B8EA 5JOZA 2YV8A 3JBG3 4AYUA 5I8SA 5J96B 5JMCA 4TYSA 4XFCA 2GNDA 3USSA 3ZXFA 1RMU3 4F7ZA 2B42B 3WHUA 4I3GA 1PM7A 4L97A 4AVAA 2IXIA 3ZXKA 3MLKA 5A32A 3J8F2 1FATA 5C9AA 2PELA 4CDUB 4Q0SA 5I93A 4AFCA 1H2MA 4DNYA 1TNRA 5I0UA 1OFSA 2VY0A 1BK1A 2I45A 1XNKA 3QH7A 2HKXA 1DYKA 3HQXA 4M0NA 1OD5A 3WD5A 5T5JA 4CDXA 1Y9QA 4PF5A 3BOPA 3WW1A 1ZREA 1RUH2 1FV2A 1N47A 4KGQA 4CTEA 4Q4X3 4JGYC 2NZ9A 4QGMA 4J6GA 4F8AA 4HMZA 4OI2A 3FUQA 3WG3A 1DHKB 1DGRA 1HV0A 2B46X 3T2TA 2VW0A 4KL1A 4XTPA 2UU8A 4Q1PA 3S7EA 2CWSA 3X29B 1PO23 3AP4A 4IEWA 2D3PA 1RUC2 1ONAA 1BQPA 1V6MA 1DU3D 1UIKA 5JWPA 3VZKA 2WINB 1LECA 3QH6A 4Y1ZA 1PIV3 4N43B 4RSUA 5BNNC 1CAVA 2XVLA 1HRI1 1DQ4A 3PVEA 1H8VA 1LOBA 4N53B 5HCFA 4XF9A 3A0KA 1OQEA 1IPJA 1CJPA 1CJDA 1OA4A 2DTWA 4FXGB 3DPRB 3RMXA 5CB7A 4MXWA 4QQPA 4JRLA 5H9RA 4AI3A 1OA2A 4H14A 4XMIA 3SMHA 1J58A 5JPMB 1X8MA 2R061 1RUH1 4HBNA 2PLV2 5HXVA 3AK0A 4DOUA 3VZOA 1MZEA 4XFGA 1FMD2 1K5MC 3MFAA 1V9U1 3TB0A 2YDEA 4ZKTB 2JG9A 1SLAA 2I07B 2Z79A 1SEFA 4IEYA 3ZFGC 1YFWA 5L7OB 1YWKA 1MQTB 2YY1A 1SCSA 1VBD1 3UK9A 5I0TA 1D0GA 4Z82A 2V5YA 2ZHNA 3UL2A 1YI9A 1QQP3 2AUYA 2EAAA 1PO11 4FOYA 4XFAA 3WDTA 1REDA 1K5MA 1X33A 1AL22 2HWE3 4IV3A 4Q4Y2 4I0WB 2HWD2 1ENSA 2XLGA 4PLOA 4GMP3 2G9GA 4XXAA 2ZAAA 5DUUA 2Q8OA 3NVCA 4IEXA 1LENA 4E2QA 1EV11 4KNCA 5JSRA 3KQRA 1JTZX 1VAMA 2PLV3 3AZVA 4N7UA 4JQRA 2PFWA 4GMP1 2K2SA 2CYFA 3RPQA 3WDXA 1OA3A 4LEJA 3H8UA 5GKAC 4LO5B 1IS3A 4EWDA 2VOWA 3B93A 3VZMA 2WNUC 1QQP1 2RS33 3KS7A 2DWRA 4ASLA 1HKDA 1UU6A 3ZXLA 3VBHA 2IXJA 1ZM1A 2HEVF 4IEPA 4S2GA 2OW4A 4L11A 1A8MA 3FMGA 4OVEA 1R082 1ASJ2 3UJQA 2GZWA 3N3HA 5CA6A 2QE3A 1RIRA 1UW8A 3W58A 5GZFA 4KWKA 5EXOA 5DDJ3 2A6VA 2RS13 4IEUA 3NSTA 2YYOA 4HKOA 2YC0A 2EXJA 1LGBA 1Z0HA 1PK6B 1QH7A 3TAYA 2E7QA 1W6QB 1RUH3 2ZS6B 2A6ZA 3J4UH 3SHRA 1YXWA 4AI2A 2WS93 3AZWA 1W6NA 1VAVA 2EXIA 3RS6A 1RUC1 3MF6A 4HL0A 2R6QA 4PDWA 1N3OA 4YW5A 2BVVA 1CGPA 2LALA 1GANA 2WSUA 3URFA 5LEJA 1VAKA 5SV8A 2E6VA 1O3QA 3M3OA 3OY8A 3THTA 4YARA 3CJXA 4E27A 4QQHA 1OHFA 3GZAA 3TN93 4LBQA 2V09A 3MGUA 1RUE3 3V0BA 2RM22 2D40A 1J3QA 1PO13 2D97A 3U0ZA 1VALA 3RZZA 2ZGLA 3TRSB 1AUYA 4FPYA 3VBSA 4Z8BA 1C8NA 1V9U2 3NAPB 1RUOA 1D4M1 3AKTA 3M70A 4EN8B 3HBZA 5JI7A 5FMOL 4MVTA 3ZFFC 4WVMB 1G6NA 4YGDA 4YVSC 3FZ3A 1R083 4LUKA 2YXSA 2JX9A 3ZSEA 1HQWA 1QJX3 5JZGC 4GXLA 2D6LX 1OPOA 1Q43A 2I2SA 2RS52 4FPEA 1GQHA 2WT2A 2JG8B 1BCXA 1D4VB 4BOWA 4H3WA 2X5IC 1UF2C 1R093 4FQ4A 2ZGPA 2XJVA 4XBQA 3HAGA 5JLVA 2VOVA 2PQQA 5JSPA 5FPZA 5JDBA 4FVVA 4KU7A 3ZFFA 3PJYA 3AP5A 2PA7A 2ZOEB 4AFMA 1HIXA 4FOVA 3AMHA 3ZX7A 2VMIA 1KITA 1G9BA 4Y1UA 1JYCA 2BYVE 1QJX1 2B9UA 4QPIB 3LKJA 4A7KA 3I7DA 5FTTC 1GR3A 4XJUA 3L9JT 5SV5A 3VHPA 1MR5A 2TEPA 4QHBA 2DCYA 2XJUA 1JN2P 2VGDA 5J37A 4KG0A 3VHRA 2VW1A 2CL2A 4CRQA 3MPBA 4JDOA 4LBLA 4HANA 2HWC2 2A70A 3QACA 2RS51 1W6PA 4QPGC 2WFF3 2VQAA 1H1IA 3VBSB 2RS12 4FP3A 2WC2A 1ULDA 1Z7S1 2O8QA 4LBMA 4LO7A 5GM0A 1EV13 3OF1A 1OOPB 4P9YA 4MGZE 4CP2A 4R9CA 2A73B 3H1MA 3ATGA 2I74A 1G9CA 2ZA9A 1YYNA 4S2FA 1F31A 4R52A 1WBLA 1GV9A 3JUUA 4AVBA 3U10A 2ZX4A 1GZCA 3R4SA 3ZMOA 3VV1A 3TNPB 3POYA 4OULA 1B35A 1VLNA 1H2LA 2FMDA 1VBA3 5C4WA 1ZA4A 4Y20A 1AYM2 1EAH1 4LNVA 4AQSA 3BALA 1W6MB 3C2UA 3JQXA 4MV2A 4RQPB 5E8AA 1ZRCA 1CESA 4HFSA 4HKLA 4COVA 4YRDA 5C6CA 4J1XA 4U2AA 4AVSA 1Q8QA 4CDQC 4XW3A 4OHWA 4X6RB 1UCXA 3NW4A 3ZMNA 3QBQA 1OI6A 4FPGA 4XBNA 2HWF3 3H0OA 3ME2A 4HSJA 1CAXA 1QHDA 1EY2A 4YZ4A 1UMZA 5A32B 1HXS1 1ZYBA 5GLVA 3BODA 3VKMA 5GLUA 2GH2A 1O3RA 2ERFA 5J36A 3GBGA 2QZ3A 4D69A 4P5HA 2DVGA 2IXHA 1NQDA 4IEQA 4AVTA 4G9SB 4B7EA 3PLQA 4M3CE 1YJLA 1URXA 4ORFA 5CFCA 1MEC2 4MLOA 3ASIA 4JVAA 1Q56A 4Q4V3 3R6SA 1NZCA 4FXKB 2ZKNA 2WKKA 2D3RA 2NPIA 1H9WA 4YM3A 3ZN4A 3POSA 5ABJA 1LEDA 3WQ0A 3VGIA 2GMMA 1AX1A 5T54A 4P9XA 4URTA 4MGIE 2TBVA 4QX5A 2ZX0A 4I3PA 4H7MA 1LODA 4ONUA 4Y22A 1NCRA 1QKQA 3AZYA 4IL7A 4JRAA 3VKLA 4IV3B 4B4RA 1YHFA 5KHJA 3OGJA 1W6PB 5CFCC 5FO8B 1RUG1 4Q8KA 5JIAA 1AJKA 2D5FA 2QZ2A 2R043 3OJBA 4QMAA 5FLHA 5HBAA 4FQZA 4DPNA 1R1A1 1TME2 1J3PA 1QY4A 1O4TA 3VBFB 2OYZA 3T1MA 1ULFA 1V9U3 4PQ9A 2ZX2A 2WNVB 4Q4V1 3N35A 2WNVA 4B7KA 1HLCA 1OQ1A 4KG8A 3N7KA 1AXKA 2A6WA 2BVBA 2CV6A 3ALQA 4Q4X2 4YG3A 3M4FA 1NCRC 2MHFA 5E88A 4S2DA 4JGYA 1H4HA 1WD3A 4C1WA 2QQPA 2DU0A 1PHMA 1SLBA 2WSVA 1U5IA 1QJY3 1ULGA 3AFGA 4MGYE 2BFUS 2TNFA 4AGRA 4O9GA 3AJZA 2Q30A 3FWEA 5BNPA 3RJRA 1LEMA 4XQDA 3DPRA 1RUF3 2D5HA 1SFNA 3TBDA 4IEVA 1KDKA 2VXRA 5BNNA 1QNWA 3DKWA 3EQEA 3AXEA 4N9HA 5DUXA 4AEDC 1AF9A 1PGSA 2WNVC 3VUOA 2Z2SB 3RYRA 3WP4A 2VMGA 3MLLA 3EHKA 4LBKA 2PHTA 3B7MA 1D2QA 4BM8A 3DUIA 4XF4A 2PHRA 5IT6A 4LO8A 3J26N 4DS0A 1QOTA 3ZVXA 5HI0A 1AL0G 5CFCB 2B5HA 4MXWB 1RUI1 1GZWA 2QCSB