1F2NA

Rice yellow mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
LSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRWDVVYLPEVSATVAGSIEMCFLYDYADTIPRYTGKMSRTAGFVTSSVWYGAEGCHLLSGGSARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLYVIASMVLRDPVDPTLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords CAPSID PROTEIN
publication title 3D domain swapping modulates the stability of members of an icosahedral virus group.
pubmed doi rcsb
total genus 44
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f2nA00
1BMV2 4CDQC 5D8AA 1RUI3 4N53A 3ZFGA 2BFUL 1RB8G 2RM21 1FMD2 1VBD1 4CDUC 4YVWC 1COV1 1HRV1 1VBE1 3VBOA 5BNNA 1IHMA 3LOBA 4GH4A 1EAH2 1D4M1 1PVC1 1RUH1 1AR72 2RM23 2ZZQA 5BNPB 4RHV2 4CDQB 1VBD3 2WS93 4GB32 5J96B 4RFT0 1EV12 2HWF2 1COV3 1AR62 1VBE3 5CFDC 1BEV1 3TN92 2WZR2 1E57A 2R041 1AR92 1C8M3 2R073 1D4M3 3JBG1 1NCQC 1PVC3 1RUH3 2HWE2 2Y26A 1RUE1 2MEV3 4YVWB 4CDUB 4JGZC 1F8VA 2R061 2WWSA 4YVSC 2TBVA 3NAPC 1ND3C 5BNPA 1RUI2 1VRH1 4CDQA 1PGL2 1OPOA 1BBT1 1VAKA 3JBG3 5C8CC 1RUE3 1RUF1 2ZAHA 1ASJ1 3FBMA 5CFDB 2R063 4CDUA 1HRI3 4NWWA 4YVWA 1HQNA 1X33A 2DF7A 1AR81 1NCQB 2RS13 3JB4C 3IDEA 1RUD1 2RM22 4JGZB 1R081 5A33B 1BBT3 2WLPA 4YVSB 2GSYA 2WS92 1QJU1 1RMU1 3NAPB 1ND3B 1VB4A 4QPIC 5FMOS 1COV2 2XBO1 1HX6A 1VBE2 2RR12 1R1A1 1C8M2 5CFDA 5C8CB 2R072 1D4M2 1QJX1 1PVC2 1RUH2 2MEV2 1RVF1 1DDLA 1FOD1 1NCQA 1QJY2 1QJU3 1RMU3 4Q4V2 4CEWC 4Q4X1 4JGZA 4IV3C 5A33A 2XBO3 4YVSA 1MEC1 3NAPA 1PO23 1ND3A 2GH8A 1R1A3 3JBG2 1QJX3 4FTBA 4QPIB 1RUE2 1RVF3 3VBOC 4CEYC 1M06G 5C8CA 2IZWA 1QJZA 4IV1C 4GMP3 1HRI2 4GH4B 2RS12 1MEC3 4LLFA 1BBT2 3S6PA 4CEWB 1ZBE3 4IV3B 1HXS1 2X5IC 1RUJ1 2HWC2 4QPIA 1ZBA1 4RR3C 1RUC1 3VBOB 4CEYB 1H8TC 4IV1B 5ACA1 1QJU2 1RMU2 1HXS3 4BCUA 5AC91 2XBO2 1TMF1 4CEWA 1PO22 2WFF1 1ZBA3 4IV3A 5CFCC 1R1A2 1QJX2 1RUC3 3HAGA 2X5IB 1RVF2 5ACA3 2BPA2 4CDWC 4CEYA 5AC93 4RR3B 4IV1A 1MEC2 1TMF3 1H8TB 2WFF3 1B35C 1F2NA 1AYM2 1W39A 1ZBE2 3JD72 5CFCB 1HRV3 1NOVA 5ABJC 2X5IA 1NCRC 2RMU1 2FZ1A 1PO11 5BNOC 4RR3A 4CDWB 1NG0A 3VBUC 1H8TA 5LK7B 1HXS2 5K0UA 1B35B 2QQPA 1VBB1 2RMU3 1BEV3 2R043 5CFCA 1PO13 1RUC2 1PGW1 1CD3G 4QPGC 5ABJB 1NCRB 5AC92 5DDJ1 1VRH3 1TMF2 4CDWA 2BFUS 2WFF2 5BNOB 1VBB3 3VBFC 1RHI1 3VBUB 2FZ2A 1VBD2 1B35A 1RUF3 1ASJ3 1HRV2 1AL21 5DDJ3 4RQPC 1AR83 1QQP1 5ABJA 4Z92B 4FTSA 1NCRA 1RUD3 4QPGB 1RHI3 1R083 1AYN1 1FPN1 5BNOA 3VBUA 4Y5Z0 3VBFB 1AL23 1BMV1 2RMU2 1BEV2 2R042 1GFF2 3VDDC 1SMVA 1FOD3 1AYN3 1FPN3 2R062 4Q4X3 4QPGA 4RQPB 2ZTNA 1WCDJ 1VRH2 3ZFFC 3ZFEC 3VBRC 1VBB2 3M8LA 1PGW2 4AEDC 1POV0 3VBFA 5FOJB 1EAH1 3DPRC 1RUF2 4N43C 1ASJ2 1AR71 2HWD1 5DDJ2 2RS31 1Z7S1 1AR82 3VDDB 5JZGA 1AR61 4RS5C 1K5MC 1RUD2 1RHI2 4RQPA 1R082 1NY71 2RS51 5K0UC 4Q4Y1 3ZFFB 4FSJA 2HWE1 3ZFEB 1RUJ3 3VBRB 2PLV1 2HWD3 1AL22 2RS33 1Z7S3 4AEDB 1AR63 3DPRB 4N43B 2RS53 1FOD2 1AYN2 1POV1 4Q4Y3 3VDDA 5BNPC 1OOPC 4Q4X2 1MQTC 4RS5B 4WM8C 1K5MB 2PLV3 3ZFFA 1A6CA 3ZFEA 5K0UB 5C9AC 2XPJA 3VBRA 3VBHC 4AEDA 1POV3 5A32B 3DPRA 4N43A 2WS91 1C8NA 5FMOL 2RR11 4SBVA 4RS5A 1OOPB 1K5MA 1VB2A 1C8M1 1MQTB 2R071 3VBSC 5L7OC 2MEV1 4WM8B 5C4WC 1RUJ2 1VBC1 2HWD2 1QJY1 1ZBA2 5C9AB 2RS32 1Z7S2 4Q4V1 5A32A 3VBHB 3J8F1 1AL0G 4WM7C 3CJIC 2RR13 4JGYC 1NY72 2RS52 4Q4Y2 5ACA2 1TME1 1VBC3 1OOPA 2PLV2 1QJY3 4CDXC 1MQTA 2BUKA 4Q4V3 4WM8A 1HRI1 4PDWC 1OHFA 5L7OB 3J8F3 3VBSB 2HWB1 2RS11 1AUYA 5C4WB 5C9AA 1VBA1 3VBHA 5JZGC 1TME3 4GMP0 4WM7B 3CJIB 4JGYB 2HWC1 1R091 4Q4W1 1PIV1 1ND2C 4NWVA 2HWB3 1V9U1 1X36A 1VBA3 1RUG1 4CDXB 5L7OA 3VBSA 4PDWB 5C4WA 1NA1C 1QQP3 1PO12 2HWC3 1R093 1PO21 4Q4W3 1PIV3 5JZGB 4WM7A 1V9U3 2VQ0A 3CJIA 4JGYA 1FMD1 1RUG3 1VBC2 5D8AC 4N53C 1ND2B 4GMP1 3ZFGC 4CDXA 4EJRA 3J8F2 4PDWA 4RHV1 1AYM1 1FMD3 1NA1B 1ZBE1 1TME2 4GB31 5BNNC 1EV11 2HWF1 3JD71 4GH4C 2HWB2 3TN91 2WZR1 1AR91 1EAH3 1ND2A 1VBA2 5D8AB 1AR73 4N53B 3JB8A 4RHV3 1AYM3 3ZFGB 4GB33 4Y4YA 1EV13 2HWF3 1QQP2 3JD73 1RUI1 1NA1A 1R092 4Q4W2 1PIV2 3ZXAC 3TN93 1FPN2 1PGL1 2WZR3 1V9U2 4FTEA 1AR93 5GKAC 2HWE3 5BNNB 2BBVA 1RUG2 1CJDA 5J98B
chains in the Genus database with same CATH superfamily
4DEQA 4OI1A 2CGNA 5IK7A 1I3HA 3RG0A 4IL7A 4PQQA 2OPWA 4N53A 4M00A 4B4PA 1JN2P 1VAVA 5C5UA 1H0BA 2KD7A 1CAWA 5FLJA 5FK7A 2NPIA 1W2AX 3GYDA 1W6MB 5LA1A 4YGDA 1FMD2 1UY0A 3ZXGA 5H9QA 3QD6A 3HQXA 3IPVB 4CDUC 2VNOA 1EPWA 1W6PA 4ZZ5A 3NO8A 3T0DA 4OUEA 1SLTA 1WW4A 4WZFA 3LOBA 4Y5SA 3CIHA 1EAH2 2P3YA 3NV1A 1D4M1 4TWTA 1MZ6A 3VHOA 5DABA 4CDQB 4Q26A 4LBJA 3ZOIA 3N7KA 3GBGA 3U07A 4BQ4A 1AR62 3RQ0A 1QOSA 1S0BA 1W6MA 1WBLA 1RXGA 1VBE3 5G05L 4LT5A 2WUHA 1DBNA 3KZ4C 3IPVA 2WT1A 4H2AA 4EWDA 1BEV1 4IEVA 3GZEA 4G3YC 1E57A 2R041 2WZR2 3O12A 3I7DA 2XQXA 1RUH3 3M7AA 4A3ZA 1RUE1 3PIGA 2WZ8A 2VBBA 1C5HA 1PMIA 1STMA 2RJ2A 2W46A 5DUVA 3AMNA 2WWSA 1UYXA 2C24A 4KH9A 3S0MA 1SFYA 1B09A 3BU0A 4LMFA 1VRH1 3AMHA 1KGYA 3T4HB 4CDQA 5C7GA 1LODA 1OA4A 1W2UA 2JIJA 3POFA 1OD5A 1JOPA 5FZAA 5IVYA 1HB2A 1TQ5A 1YFWA 5KC5A 2Z5WA 5D21A 1JZ3A 1O8SA 1YFUA 1N3PA 1C1FA 4DRRA 1DQ5A 2WJSA 3VZMA 1JZ7A 2JD4A 1S0GA 2GC3A 2ZAHA 5G04L 2SBAA 4XZUG 3RZHA 1HRI3 4NWWA 4YW5A 2LROA 1HQNA 4C8DA 5F5QA 1PK6A 1UMHA 2XWJB 1AR81 1NCQB 2RS13 2ZX1A 3D3AA 2XKPA 1A8DA 5FO9B 4LUMA 3HT1A 4O61A 4JGZB 3FJSA 1BBT3 2DYCA 3FBYA 3IDBB 2GSYA 2WS92 5T5LA 1OA2A 3VD3A 1W6OB 5FMOS 1O4TA 3U1XA 2PHXA 1QH6A 2JDZA 4AHXA 1SG3A 2XBO1 1HX6A 2R0HA 5I0DA 2IVJA 2RDNA 3LDRA 5GLTA 4MXWB 4UBGA 3SMHA 2VTFA 4M3CB 2ADEA 1W8HA 1C8M2 2P3IA 2R072 4BISA 1PVC2 2VCAA 3RMXA 3DECA 5F9TA 3GZTB 1JW6A 2NQYA 1NCQA 1UYPA 2CHHA 2YY1A 1QJU3 3ZXEA 4C0BA 5FPZA 4JGZA 4IV3C 5FZOB 3I97A 3MLKA 5HI0A 3EJKA 1MVQA 1W6OA 2O1QA 1OPMA 3VL8A 1R1A3 2J1VA 3GJBA 1Y9GA 4OMCA 3A4UA 1QJX3 3JBG2 1G9CA 4QPIB 5DUWA 4MXWA 1DF0A 2BDRA 3WG1A 4LBMA 4M3CA 3CJXA 3OEBA 2IZWA 4XJWA 3UKVA 3CNAA 1HIXA 1UAIA 4IV1C 4AHWA 4AFBA 1OD3A 3AYDA 2P4EA 3TB0A 1UN1A 3TEYA 1QKQA 4LLFA 4ZS2A 4Q8KA 3VL9A 2FDIA 3WP3A 5IAVA 5EV7A 5FO7B 2XDVA 3GXUA 5FZOA 2D6KA 3DYPA 3NQHA 4XTMA 1ZBE3 3MLLA 4TZDA 4DIQA 1ZRCA 2YBKA 1DYKA 5L9BA 4JDNA 2EIGA 3WLUA 4BXFA 1PNGA 2QQKA 2WWUA 4WVMB 4XABA 4D3WA 4QPIA 1HB3A 3N3HA 5A3MA 1SACA 2ORZA 1Q8QA 4CVUA 1V6LA 3THPA 4Z07A 3LOIA 5LBEA 4CEYB 1H8TC 4XJZA 4F83A 5BV6A 1LENA 3CQOA 4LKDA 1JYWA 1T6BX 1HXS3 2EXIA 4EV0A 1N47A 3LIGA 3I8TA 2YROA 4BMEA 1XJAA 4I3PA 1TMF1 1GQPA 1PO22 4LO4B 1ZBA3 4UFJA 2EALA 3KCXA 3U14A 2UWBA 1UMZA 4WVMA 4UOJA 3HAGA 4HG6B 1S4CA 3EXUA 2DURA 4PBOA 3ZIWA 1RVF2 2P1BA 4JKMA 2NN8A 3NKGA 4MHRA 3PURA 2EIDA 4NPLA 1GNYA 3LDKA 2DVBA 5FPBA 2NLRA 4GKXA 4CEYA 2BP6A 5JIAA 4XW3A 1XNDA 1MEC2 1OF4A 2WABA 4OZOA 1UX6A 2A70A 2PHUA 1F2NA 1VMFA 3CU7A 1JZ5A 3I2OA 2A1XA 3WUCA 4NRPA 2VZSA 5GZCA 5IVBA 1OLQA 3I3BA 4I3GA 4QGLA 3B93A 1AVBA 3LSDA 1NZIA 3DKWA 5CFCB 4JDMA 4NOTA 5FZMA 4NPMA 1KJLA 2D7FA 2VW0A 4AGVA 4QMAA 5ABJC 4OMDA 4XETA 1MPXA 2JDKA 2HEVF 1GR3A 3OSDA 3PJQA 4FQ4A 1ZRDA 2VUCA 4EROA 1E5HA 4EZHA 4CYDA 4Q1PA 1W9FA 4MUVA 4E9KA 5FZ7A 1YQ8A 1ULDA 3WHUA 3UGHA 1NUKA 4XPVA 2Y33A 1YUDA 2WQZC 1B35B 2OKXA 4D7TA 4S2HA 3OYWB 1OQ1A 1BEV3 3LFIA 2R043 4CZSA 4LBKA 1W3VA 5CFCA 3ZSLA 3GF6A 5CBLA 4GWJA 4XC9A 3ROUA 3HOBA 5A1FA 1OLME 4INDA 4JKLA 4QXHA 5DAXA 4CCJA 3RZLA 2YGMA 4IE0A 2B5HA 3NKTA 2HBTA 1NCRB 2WO3A 1LGBA 5FLHA 5GZFA 4DINB 5AC92 2QNKA 1VRH3 2Y6HA 4DB5A 2BFUS 1LU1A 3OUJA 5FY4A 2QQMA 1VBB3 3NJYA 3HQUA 3VBFC 2OZJA 4YARA 3BVCA 1HV0A 1PGSA 2XJRA 1B35A 1FYUA 2VMEA 2R49A 2F4LA 4BQ1A 3OYWA 5FKCA 1C4RA 5FZDA 2Z2SB 2WBKA 3GJAA 3MGUA 4YG3A 5F2SA 3N7MA 4B8EA 1JYVA 2PTMA 3NJZA 2V4VA 4IEUA 5DDJ3 5LA9A 1EY2A 3T1LA 1AR83 1JMUB 2Y0IA 4Z92B 1KQRA 2DUQA 1NCRA 1NZCA 3BPZA 3H42B 1Y9QA 5TSWA 4AG4A 1RHI3 4LPLA 4HSLA 1AYN1 1G6NA 2FCVA 1I6XA 4QKFA 4AQ6A 4I0AA 3SCFA 1MZFA 2FCUA 1C1LA 1V6JA 2YDEA 3T2OA 1AL23 4LHSA 4A41A 5FRAA 3B5LB 5F3IA 3BUCA 1SBEA 2OW4A 1GZTA 1JUHA 2E51A 4MADA 3AL5A 4Q0UA 2R062 2VVDA 2B4KA 4GXLA 5LA2A 4RQPB 3RSJA 2VCMA 1H9WA 2TNFA 5AFBA 2Y6JA 4JAAA 3KVAA 3UJOA 3BKZA 1D0GA 4L92A 1V00A 2DVGA 3W9AA 3M8LA 4Q5OA 3OGGA 5DXDA 1POV0 2WNVC 2XJUA 4LBNA 5IK8A 2G1MA 4DY5A 1RUF2 2FDGA 1XRUA 2AREA 5FZBA 4K7JA 3POIA 3MIBA 3ON7A 3WF1A 4FPOB 1J83A 1OF3A 1RINA 5SV5A 3WDXA 4LE3A 3SEPA 1Q56A 2VW2A 3ZN4A 3ZXJA 3TOJA 4N9IA 4CXYA 5EP9A 4OUSA 3ZXDA 1N3QA 3AFKA 4RQPA 3BOWA 1DU3D 1ULOA 4YWAA 4AW7A 5K0UC 5FPXA 2ARCA 4GJZA 2GMEA 3OBZA 4HVRA 1J3RA 2QQIA 2D5HA 3DKQA 2BGCA 3RNSA 4M4PA 3U78A 3ZYHA 1ZZCA 1FV2A 2HWD3 3Q9OA 5JCTA 3AFGA 3MLJA 4YW3A 4AEDB 1YIPA 1ENQA 1AR63 2JG9B 1M4WA 1V70A 3DPRB 3S5AA 4EN8B 2OIIA 1S2BA 2ORXA 3WQ0A 3ZXFA 2RS53 3E5UA 4Q4Y3 2ZAAA 2CV6A 2D40A 3LA7A 4XXPA 1ULEA 3L9JT 4Z82A 2XONA 1MQTC 1GKBA 5IK5A 3T2TA 3VHNA 1XYNA 1FV3A 4RGKA 1WW5A 1QXRA 2ZEXA 2X8KA 5C9AC 4BK4A 3V65A 5FYMA 2X29A 3I2JA 1DLLA 2A6ZA 3RWNA 1AXYA 3AXDA 1CZSA 5E88A 2UY8A 3O1OA 1DGRA 4XF4A 1POV3 2ZX2A 5FZLA 4AEDA 5I0RA 2JG9A 3DPRA 4ZONA 3B9CA 3VGIA 3O1SA 4EZ4A 5FPVA 3WW4A 2ZGSA 1XC6A 4K6BA 5FPLA 1J59A 4Y26A 2ZJCA 3KVBA 1W9YA 4IQPA 1J58A 2RR11 5I8SA 5FXXA 3ZKUA 2VZ3A 3I2KA 4S2GA 2IVIB 5L7OC 2D3PA 2AENA 1UPSA 4WVWA 5CKNA 2H0VA 2VZPA 2UURA 3THTA 4CCMA 2I45A 1IQDC 3LEMA 4DOUA 1W8TA 1WMXA 1H4HA 1UCXA 2BV4A 2W94A 1XQNA 1Z7S2 2E63A 2Y6FA 4AEMA 2PHRA 3AYCA 3VBHB 1UY1A 4CPBA 4NHMA 3BTZA 2YUEA 3D4KA 4JGYC 1NY72 4H3WA 4QQ2A 1WWYA 4CU6A 3I2DA 3UYJA 2KR2A 5DZGA 3P1IA 1LOGA 4P9JA 4CXXA 3HNYM 1GWLA 4HPKB 5B4XA 1VBC3 2PLV2 3OGVA 4IEPA 3UJQA 3UGGA 4HVQA 2BUKA 4TN7A 2DVDA 1AF9A 1QEXA 1OI6A 1S0FA 2XL9A 3K75B 1WLTA 4G9SB 1XE0A 2ZGTA 3HBZA 3M70A 3J8F3 2WT2A 2HWB1 3E5QA 4UT5A 4XURA 2I74A 1OVPA 3WG2A 2VXJA 4W50A 5C4WB 5KHGA 4AFMA 4A45A 2PHDA 1O6UA 2BERA 3VBHA 1S0DA 3OTFA 4QQHA 4PI0A 3KGLA 2J1AA 1TME3 1LULA 2NMNA 5BNQA 1F9KA 1ZREA 2CY6A 5I0UA 2RDQA 2K9ZA 1Y9MA 3ETQA 3RFRA 4AVBA 5F2WA 4QM8A 2HWC1 2OQ7A 1US3A 2EAKA 3AC0A 4COWA 1X9TA 1ND2C 2JXAA 3MHZA 4HPKA 5CYYA 3USUB 2CGOA 1OFSA 3FHQA 5HCBA 3UT0A 4XEZA 2ZHNA 4P00B 4CDXB 2YMZA 2GU9A 5JI9A 3FHIB 5JPMB 4JC1A 1DLCA 1H6YA 3OBRA 5C4WA 3GCXA 3GDBA 3EB7A 3S7EA 1DGWX 1REFA 1W6NB 4K40A 4JRAA 3WCSA 4D6SA 1CIYA 2BVBA 2W5FA 2XLGA 5AVAA 5SV8A 1PIV3 3M1HA 3OOXA 4UFMA 5LBFA 4PF5A 5LY2A 5JZGB 2WNUC 2GNBA 4OHWA 3HQRA 3G6JB 2JDPA 3AKTA 3PUIA 5HXMA 1NXD1 3R0RA 4IESA 5L9VA 3USUA 1PM7A 2GH2A 5F39A 1D7PM 4N53C 2ZHMA 1GOHA 3O1MA 4GMP1 4YLZA 2OPKA 4GJYA 1WLCA 2YZ4A 5J3UA 4CDXA 3M3CA 4EJRA 5CEHA 5FREA 2ZMKA 3N7JA 4MLOA 1G7YA 1W6NA 3GHNA 5CZKA 1ZRIA 1XE8A 1AYM1 2IXHA 3AZVA 3H3LA 3KT7A 1S0CA 2QDRA 3POBA 2Q1FA 1LCLA 4MGSA 4P9WA 2HWF1 3E1F1 4NUBA 1W8FA 2WSUA 3MIDA 1US2A 3TN91 4OFGA 1AR91 2JE9A 3PLQA 4DEVA 1FNZA 1OH4A 3AP5A 4NO4A 4JKKA 4E8CA 2JWPA 3JB8A 4RHV3 4ET7A 3OBAA 3HNMA 1SCRA 1YI9A 5CKMA 4PLNA 3KT1A 3ZYFA 4L0PA 4BPZA 4Y1VA 5E1RA 2E33A 2V09A 4NIHA 1V9U2 1Z78A 2VMIA 2AYHA 3KV6A 4DY3A 1SDDB 1F4HA 1UY2A 1RUG2 3DUIA 4IEWA 4D7SA 5BUVA 1SCSA 1CJDA 4GH4B 5J98B 4EWEA 1QF3A 4AHZA 2JECA 3ZM8A 2BGPA 2N7GA 4CDQC 4PCRA 4BJ0A 3WV6A 2WQ4A 2A6VA 5HV4A 5DUXA 2LTNA 2W08A 1WMFA 5JMCA 2PXJA 5LCWL 2HKXA 1IS4A 2Y6LA 1TVGA 2KXLA 3GBWA 2XL7A 1UOGA 2BGOA 3N9OA 4UWDA 5FY1A 3WQBA 4CU8A 1A3KA 4QU2A 4PQ9A 2D6OX 1V6NA 1J3QA 2PQSA 3C7OA 1VBE1 2JX9A 3VBOA 3TEZA 1HLCA 4M0NA 2HH9A 4Y3OA 1IHMA 5IVEA 5FZEA 1W8NA 3LPGA 4GH4A 3KQRA 5A80A 5FYYA 1WA4A 1GANA 1RUH1 2YPJA 5JI7A 1AR72 2RM23 5BNPB 2VQTA 4AWDA 1JOJA 1OQDA 2Q5TA 4GB32 5C3RA 1JHJA 4LOSA 4XMAA 1EV12 5JR7B 4N7UA 1COV3 4K9SA 4QGMA 2WC2A 3OEAA 5F3EA 4A44A 5KXDA 1O3RA 5J7MA 4ZU7A 4YW4A 2PFWA 1UX7A 5KWRA 3WT3A 3KLSA 1NCQC 5EWSA 1R64A 4YVWB 1Y43B 1HQWA 4QD2A 2G9GA 4JGZC 4J1XA 4HLTA 4JQTA 4D6QA 4ISRA 2DUOA 1F8VA 3WDWA 4D6RA 5BNPA 1UIJA 4LBQB 1RUI2 3MV11 4Q0SA 1X8MA 2FDFA 4DQAA 3KS7A 4AR2A 4OZXA 1PGL2 1ULFA 2D93A 3PVBB 1BBT1 5J48A 1VAKA 4XJAA 4AEJA 1ENRA 4AL9A 5GLVA 1SQ4A 2AR6A 4N7IA 1HJFA 3IIIA 4W4ZA 5FCCA 5CFDB 2R063 3I2IA 4CUGA 5J09A 5JUVA 4HONA 4YVWA 1IZ3A 4ASKA 5FZ6A 1JZ4A 2WDBA 1BQPA 3IDEA 3U4XA 3O1UA 1R081 5H9RA 4LBQA 1UZZA 2ZEZA 4YVSB 1UL9A 1LHVA 1QJU1 1YYNA 4LEJA 1ND3B 1UYYA 2YBPA 4MXVA 4PBPA 4QPIC 5CIRA 4FCAA 1WD3A 2QQLA 4CP2A 2VUAA 1BLZA 2P37A 3O1TA 3IB3A 1UF2C 3MF6A 1R1A1 2VC9A 3DGTA 4U36A 2B46X 2R16A 5CFDA 3WOGA 1D4M2 1QJX1 2MEV2 5FZ0A 5C8CB 1XSRA 1NE6A 2Z69A 4BXSV 1KFXL 4YM3A 5FXVA 1FOD1 3I2FA 1VE0A 2CTVA 1RMU3 2DCZA 3TRSB 3WZ1A 4LHKA 4Q4V2 5A3PA 1KDKA 2QQUA 5FKBA 2K0GA 3KV9A 4YVSA 1VIWB 1YFXA 4XXAA 4YSFA 2YG0A 1ND3A 2XUEA 2JD9A 2ZMLA 3NNLA 2CL2A 3ABZA 4KG8A 4QXBA 3LE0A 3DV8A 4DRVA 1POQA 1RUE2 2CDOA 4FPGA 4AZZA 4CEYC 5FV3A 4NROA 4DMIA 2A5ZA 5C8CA 5ERLA 5DUUA 1W90A 1GOFA 4GMP3 3O1RA 1OLRA 3UL2A 2JG8B 3RYKA 5KXEA 3RI9A 4MHUA 2DBIA 4P08A 1W8ZA 1WLDA 2JB4A 2JB8A 4RL7A 4YZ1A 1W6QB 4XQDA 3J7HA 1HN0A 4CEWB 2GC0A 4Y5TA 1HXS1 2I2SA 5FXWA 1SZBA 2JEMA 4LUKA 3BIEA 2CAVA 2W9XA 1GYKA 3BOPA 3LEGA 1W2TA 2PA7A 2ZGKA 1GZCA 3MPPG 1V6OA 1ZBA1 3KHBA 5JXJA 4JVAA 4Z1VA 3MW2A 1JBCA 1PHMA 5FY0A 2ZXQA 3CMGA 4ISQA 1REDA 2JG8A 4F3JA 3APBA 1UY4A 5IJRA 2VZRA 3VD7A 1AJKA 5F6LB 4YZ2A 1W6QA 2QFEA 2CDPA 2XBO2 1ZNPA 2Z42A 4HZFA 4LBOA 1QOOA 5A3TA 5J36A 4CEWA 5CFCC 4Q29A 4CU9A 2DTWA 4P9LA 4XUTA 5LBCA 4XMIA 1RUC3 4IE7A 2ARBA 1S2EA 1KXGA 2JICA 2QTWB 2X5IB 1VMHA 2VGDA 3QH7A 5FYZA 2V4AA 2E6VA 3MEPA 1X82A 2BW8A 3A23A 1H1MA 2OUJA 4RR3B 4F8AA 1RYYA 4E2SA 1VAMA 2D43A 1OLMA 2WFF3 5FK8A 5LWBA 2ZABA 1B35C 2YC2A 1AX0A 1AXKA 3NNJA 5IHRA 2WO1A 1LU2A 3FC0A 4O7XA 2EXJA 1CZVA 3MIFA 4GAZA 2O0OA 5EZWA 3ZXLA 4IGQA 2X5IA 1NCRC 5AFEA 2FZ1A 5IFPA 1PZ8A 3VZKA 4HK9A 4P02B 1UU5A 3AKRA 2BJSA 3BCWA 2VM9A 3ITQA 4MZUA 1PK6B 4RR3A 4XTPA 5EPAA 4B29A 4KG0A 4DPNA 5I8YA 1ZZBA 2FBEA 1MS9A 3TNQA 2ZS6B 4CCLA 2DCYA 1AX1A 3KSCA 3L2HA 4EE2A 2QQPA 3Q8CA 1VBB1 4BM8A 2RMU3 2VNGA 2ZX0A 5C33A 2VZVA 4UXAA 4LK7A 1K5JA 1SLIA 4MSVA 1CZTA 3CKHA 1CD3G 2ZPXA 1UNBA 3ZPYA 3ILRA 1ONAA 5DZEA 4E2GA 2XVKA 1W28A 3J7MA 4XFBA 3BTYA 5DDJ1 3VUOA 1FNYA 4LIVA 2IUWA 3K77A 1RXFA 2ZA9A 1TMF2 3V56A 3LEIA 5BNOB 3ZN6B 2WFPA 1CAVB 5LEJA 1RHI1 3MIHA 3VBUB 2P3JA 3B69A 1VBD2 1IS3A 3WW2A 5KXBA 2ZBJA 4FT8A 3T30A 1HRV2 3B00A 4HMZA 3IWZA 3SXWA 1AL21 4B1LA 4RQPC 4BIOA 5A7SA 3V0BB 2ERFA 3N9NA 5A3UA 3RZGA 2YPDA 3SKVA 4QPGB 1D0HA 1Q5OA 1R083 2VY0A 3J9SA 3OPWA 3MI8A 5FZ8A 5FZ3A 3ZN6A 3R4UA 2YFZA 2MNGA 1CAVA 4ZKTB 5BNOA 4MX3A 2WKKA 2GALA 5FY7A 3RVHA 3VBUA 4P9YA 3H8RA 4N8MA 4S2FA 5DAPA 5KXCA 4GWMA 1H8VA 2W1UA 2QZ2A 3AJZA 3OCPA 3RI8A 1GFF2 2FQPA 2PMWB 2ZGLA 5F5CA 3WNLA 1SMVA 1Z0HA 3SKJE 1FOD3 4PT6A 3V0BA 3AM2A 4LQRA 3WX5A 1YQ6A 4QPGA 1EUUA 1UU6A 1DZQA 2W47A 2ZTNA 3LSEA 3CDZB 3VKFC 3I3MA 1OBNA 5D2AA 4XYXA 3ME2A 3I59B 2W39A 5HCAA 2BU9A 3KD4A 4QPYA 4MH0E 2XHNA 4K21A 4AEDC 3AP4A 4UFIA 1DQ4A 3BB6A 5CG9A 2JG9C 1WKYA 2R1DA 1EAH1 3DPRC 4HK8A 4YW2A 3VHPA 1ASJ2 2PHTA 4TYSA 4A6SA 1W3XA 4FO9A 1T6GC 1X50A 2AEZA 2HWD1 1WZXA 3AMMA 2BQPA 2VCCA 4C1WA 2Z79A 3VDDB 1AR61 1OKOA 1LOFA 4GULA 1W0PA 1RUD2 2AZ5A 3NVCA 2VVEA 1H2KA 3GZUC 3WINE 2WL1A 2RS51 2ZEYA 1CPMA 1YXWA 3C8XA 2PAEA 1HDKA 3K51A 2GMPA 4Q4Y1 1OC1A 1S0EA 3I59A 1UKRA 4I0BA 4ATFA 3VBRB 3E97A 2EVXA 2YC0A 4ARXA 4FVVA 3ST7A 2RS33 4B4RA 5CU1A 3M3QA 4N43B 3PUSA 4I02A 2XJPA 4Y22B 1AYN2 1EYBA 1POV1 3VDDA 4DXSA 1MZ5A 5CVRA 4HKOA 1RJ8A 3MW3A 4HVOA 3AP9A 3LGRA 4Q4X2 5FXZA 1WCKA 3OUIA 4RS5B 2WO7A 5FZIA 4Y4RA 4AI0A 2V5YA 2ENRA 4W6WA 2J42A 4P9GA 5EQUA 3SQOA 3VBRA 4LO6B 3VBHC 1VLNA 4MO3M 4E27A 1W99A 4ZS3A 3SCHA 3IT8A 4N43A 3NJXA 2WS91 4P14A 2AH2A 4Y22A 3JZVA 5FMOL 3AYEA 2A71A 5BPXA 3V64A 1DGLA 3MIEA 1O3SA 4Q8LA 2B7YA 3POEA 2VD7A 2Y6GA 4IEXA 4RS5A 1YIFA 5H9PA 1OOPB 2ET1A 1C8M1 2R071 4EN0A 5FBZA 5T50A 4WM8B 4QDRA 3KCYA 2DFBA 5C4WC 1VMJA 1RUJ2 2VUJA 3K3NA 1UZWA 1VBC1 1VJ2A 4CP9B 2BEOA 4TSVA 4EN7B 4OQ8A 3PVEA 2FD8A 2YC4A 2JIGA 4YM0A 1W8OA 2JDHA 4AI8A 4JDOA 3ENRA 1AL0G 3J8F1 2QUOA 2WR9A 4GALA 1GNZA 5HV0A 5HCHA 3AKSA 1FAYA 3M4FA 1K12A 5FZHA 5LEKA 1P8JA 5ACA2 1K42A 2J1EA 4JHTA 3SH5A 2CSGA 4JTOA 3IAQA 4FPKA 1TME1 4ORFA 1OOPA 2I07B 4CDXC 4IEQA 4P5HA 3WQ7A 1KEXA 4Q4V3 4WM8A 4AYUA 2J1UA 1F15A 4NHKA 2RJLA 4FI9A 4IE6A 3VBSB 4GIQA 4CP9A 4FFGA 4DO0A 1LJ7A 1AUYA 1WBFA 3VN4A 3ZR5A 1JYNA 2RJKA 3LD8A 4AGGA 4UFLA 1CR7A 1YJLA 3BPSA 1N1SA 2UYAA 2J1TA 3E5XA 4UW3A 5IYYA 4PJYA 3RZKA 4Q0QA 5JZGC 1X9PA 4HL0A 4BHPA 1YJKA 2Q1MA 3JU9A 1GU3A 3I3QA 4LA3A 2P34A 3AJYA 3CZUA 1CONA 1PIV1 4NWVA 1BVVA 3F95A 4FPCA 1ZA7A 2ZGMA 2WYFA 1VBA3 3I54A 4AVCA 4G4FA 4CCDA 2C0ZA 3VBSA 4PHZA 2RHPA 5DAVA 4CA9A 4GWNA 3CBNA 2VCBA 3ZYPA 2LS6A 1PO12 5DG1A 1X7NA 4V2VA 4XCAA 1HB1A 1R093 1PO21 4Q4W3 3T4VA 1ULCA 5FFOC 4CTEA 1VALA 1W0NA 4LHLA 1BKZA 4MG2A 4QXKA 4AVSA 4DZGA 1NE4A 2VOXA 5C5TA 1IQAA 3W5MA 4IEYA 3P3PA 3IAPA 2VZUA 1HW5A 1W8UA 5GLZA 2PN5A 5A6ZA 2YB7A 2JKXA 1HKDA 1MS5A 2JDUA 2Q8CA 4HKWA 1KD7A 3ZO0B 4E4SA 5C70A 3QOPA 4META 1KRIA 5B4NA 2K2SA 4RHV1 1NA1B 1FMD3 1ALYA 1NLQA 2F17A 4ATEA 4YRDA 5A3LA 3OUHA 2ZEWA 4ES9A 2LRPA 5JLVA 2R0FA 2ZGPA 3ALQA 4GH4C 1XBFA 5DQ0A 1RUNA 4BQ3A 3ZYBA 4AFDA 3KGZA 1JH5A 2HWB2 2VZOA 1MR5A 2HEYF 1EAH3 1DZRA 1GZWB 1QDOA 3ACLA 2CYFA 1H1IA 5FWJA 3OPZA 4BMBA 1A34A 2AACA 3WG3A 3MPBA 2E9QA 4P9XA 1JOBA 2A6XA 1QQP2 2UY9A 2GAUA 4SLIA 3VDBA 1NA1A 2XLFA 3PVOA 4NRQA 5EJ3A 5A3OA 2YXSA 1D2SA 3AK0A 4QHBA 1FPN2 2WZR3 3D6EA 1L7RA 4FPFA 2E7QA 4LTAA 5GKAC 5HXVA 4BQWA 2VNVA 3I2HA 3HN3A 3LFMA 4IE5A 4Y1ZA 3D5OA 2XUMA 3KMHA 5BNPC 4BOWA 1JODA 1RITA 1GZWA 2NMOA 1YCIA 3NL1A 2C6SA 4RN5A 4ES8A 5JSRA 4TTGA 4QDSA 2QZ3A 4XFGA 1T2XA 5F6KA 3BU7A 1L3JA 2WT0A 2DVFA 1ODMA 3VZLA 2BFUL 3H3UA 1RB8G 1Q3EA 2RM21 2XWBB 2ZHLA 2F6BA 1VRBA 3AMPA 4AE2A 3BTXA 4YZ5A 1CAXB 4YVWC 1HB4A 4CPBD 1COV1 1PX4A 2FDHA 3WSOA 5F8PA 2V73A 3EYPA 2W1WA 2NM1A 1MS3A 4IE4A 2UWAA 2E7TA 2CWSA 3U37A 4Z8BA 2GP3A 5GZDA 4AQSA 4C1XA 1FI2A 1VBD3 2WS93 1GMMA 3Q8BA 3ZYGA 5A7QA 3D82A 2BTVC 2HWF2 4MGZE 3S30A 4KU8A 3UK9A 2CAUA 5CFDC 1S0IA 3KWVA 2W52A 1RUOA 1CAXA 4O9GA 4IETA 3TN92 4DXZA 1I5PA 2GC1A 2QJVA 4A7YA 1AR92 1C8M3 1WCQA 2WSVA 2R073 2WYSA 3A22A 1PVC3 2HWE2 2QQOA 2Y26A 1I1EA 1Y3TA 2PAMA 2R061 4URTA 3KB5A 5E89A 4YVSC 2XJQA 4FAGA 1ND3C 2Q4SA 3MUZ1 1LKNA 4X6QB 5CA6A 3RWKX 4A2UA 2LALA 4LR4A 2HBUA 3RRDA 4B7EA 3QLQA 5IVFA 4Q0PA 5H9SA 2OZ6A 3ZR6A 3JBG3 4QDQA 1ZZ8A 1BYHA 5C8CC 5FP3A 1QNWA 1D4VB 1RUF1 1YQCA 1O3TA 3O5SA 3I3DA 2OQ6A 3FBMA 3M3EA 4XUNA 3VHRA 1BCXA 5FZFA 3DL3A 1GBGA 2WQ8A 2Q0AA 3WVJA 1DHKB 1OH3A 2Y0OA 2DF7A 1GV9A 3ETPA 3J4UH 1JYIA 2Y34A 4AK3A 3OBTA 4LO8A 4JQRA 1G8WA 4QWNA 3WDYA 1LECA 2F4PA 3AP6A 3HVDA 4CCKA 1XB9A 3HBKA 5FUIA 3NAPB 4X6RB 1RMU1 4A7ZA 3K48A 2LUWA 2RVAA 4ITCA 4KWKA 5AVPA 5FJHA 4DFSA 3EQEA 3BALA 2VAUA 4WVZA 2Q30A 1DG6A 1VBE2 1LHUA 4A6OA 2WNOA 5C3OA 2DBNA 3FZ3A 3POSA 3FE5A 3WEZA 2JG8C 2W68A 5APAA 5C8WA 5L19A 5FPAA 1RUH2 1CESA 2Z4FA 2VOKA 3RZMA 3ZSJA 1QIQA 1QJY2 3SC7X 4FBFA 1XU1A 1ZZ6A 4K8FA 4CEWC 4W6YA 1GICA 1GUIA 4Y1XA 3OPTA 3MIGA 3NAPA 3VZJA 3N4MA 1I9RA 1OQEA 1PO23 2ARXA 2GH8A 1BJQA 3M3IA 4QX5A 4XBLA 2VTXJ 1URXA 2BNNA 2X05A 3PDQA 5FP7A 4FTBA 4FAHA 5FPUA 3OGRA 1UZ0A 4FPLA 1RVF3 3WUDA 4R9CA 1WMEA 1LOAA 1M06G 1QJZA 3NV3A 1AXZA 4QB6A 4RD7A 1HRI2 1W2NA 1N1TA 4EYUA 1LB2A 2C1FA 5T5PA 4BDVB 3C7EA 2ZGNA 2RS12 1MEC3 3N36A 2C9AA 2ZCWA 4LULA 4FFFA 4HKLA 5FTTC 1UOJA 4A3XA 4BB3A 3R4SA 1O5UA 1CPNA 1BBT2 4K1YA 2BOJA 1UWWA 1O91A 1OA3A 4Q27A 5EYYA 1XYPA 2WA3A 1SLLA 4C91A 1IGOA 2C4XA 2X5IC 4MGYE 1LOCA 3E6DA 4NJ4A 4UI9L 3PNAA 5FBJA 1JTZX 4GKYA 2Y60A 3GM8A 4UYBA 3ZDVA 4KQ7A 2DFCA 4FFHA 4RR3C 1RUC1 4O9EA 1ZVFA 3VBOB 1IS6A 3H3ZA 1XNAA 3ZDSA 1W2OA 2ID4A 2EIBA 1QJU2 1AHSA 2A6WA 4ZU4A 3FLTA 4LLOA 3ACIA 4L11A 2G9ZA 3FFZA 3NNFA 2ES3A 4AVVA 1K3IA 2VUDA 3U4SA 5FYCA 1N1YA 2WFF1 5E6HA 2CGPA 3HEIA 2VU9A 3OF1A 4DUVA 2CWMA 1R1A2 4LE4A 1ULGA 1SFPA 4WZCA 1QJX2 3AVSA 1LNSA 1IPJA 4MGIE 3USSA 1ST8A 4NHYA 3ELNA 4QX1A 4XJUA 4BA6A 1LR5A 5KC6A 3TYJA 1YRZA 5ACA3 2YHJA 2ZX4A 2FMYA 3C7FA 1PK6C 4KWUA 1KFUL 2VR4A 3MV01 4QQPA 1CIWA 3SH3A 5AC93 5FMDA 1H1AA 2TEPA 3WDTA 3UV9A 5FYVA 3GNEA 3NMBA 2XOMA 3SH4A 1DCSA 4QX3A 4HSJA 4YPJA 3VD9A 3ZIXA 1UIKA 4HXCA 4NHLA 1ZBE2 3FHAA 5CB7A 2O14A 4NPRA 3LCPA 5FUNA 2PYTA 1PZ7A 3O0VA 1Q8SA 2W1SA 2WLQA 3JD72 2R6QA 3WNKA 4ZZ8A 5B2GB 3I2GA 3WDVA 2RMU1 5L73A 3LF7A 1TZOA 2AUYA 3ECQA 4QKNA 5BNOC 1C5IA 1UU4A 4CDWB 3VBUC 2H6BA 4KGQA 1HXS2 4BYYA 5LK7B 3GALA 4YNIA 5K0UA 2LM3A 1UY3A 3ES1A 2QQVA 3BGAA 3PMEA 4QB2A 1XYOA 1NQDA 4I30A 3Q8AA 3F2ZA 1JUIA 5JXHA 1PX3A 4AQTA 2C26A 1PO13 3PMSA 1PGW1 3WY6A 4KMQA 1JYCA 1JU4A 4YZ3A 2Y6KA 1IS5A 3PUAA 3EBRA 5GZEA 1GWKA 4QPGC 1UOBA 4D94A 2YFUA 4LORA 3B01A 4XAAA 2ZGOA 4JX0A 5F3GA 1DGWA 1XPWA 5ANNA 1UYZA 4CDWA 3OJBA 3PTYA 3I49A 3BODA 1JZ6A 1VR3A 4L97A 2UYBA 1V6IA 2DWRA 2ZACA 5LW9A 2FZ2A 4KBZA 3PVNA 4QX2A 3VLBB 2YU2A 1RUF3 2OT7A 2OVUA 3DCQA 1V0AA 1Y4WA 1UOFA 4YM1A 1DQ1A 1LOFC 1N1VA 4M0HA 3B3QE 4CE8A 4FOVA 3SISA 3VB9A 5EXOA 1HN1A 1V6MA 3AMQA 3N9MA 2D6MA 3PU3A 5IUQA 5A7PA 1REEA 1DGRN 4HN1A 5FOBB 2G9FA 2G19A 3W58A 4UAPA 3S7IA 4E2QA 2FMDA 2BNMA 3E6CC 4COZA 5FYSA 5F5AA 5D1IA 4L8QA 2D98A 5EJ1B 4XFIA 3THCA 5I8TA 3ZMNA 3AXEA 1BEV2 3WP5A 1CN1A 4NMIA 2R042 3VV1A 4AVTA 1CWPA 3OY8B 2L9LA 4MOAA 3VDDC 4BWOA 4XF3A 4XIOA 2ZGQA 5I0TA 1FPN3 3H8XA 3LA2A 3FUQA 4FPJA 1IOAA 4AFAA 1W05A 3AKQA 2A6YA 3P6BA 3FX3A 4GQ7A 1VRH2 1U12A 4Y1YA 4U2AA 4DS0A 2JDAA 2X53S 3VBRC 5K4LA 1EUTA 1HQLA 1VBB2 2VZQA 2DDUA 2BZDA 4XJ8A 2W2IA 3AYAA 4BIFA 3R4DB 3PJYA 4XF9A 5KHKA 1QH7A 2J1SA 4R9AA 1CVNA 1J3PA 4N43C 4K20A 4UFHA 4LO7A 1AR71 1O8PA 3RYPA 4FPYA 3OY8A 1XE7A 4K1ZA 3VDCA 3SNMA 5DDJ2 2XLAA 4TLGA 5EYXA 2RS31 2V5DA 4BQ2A 1QOTA 1AR82 2DCKA 4H7MA 5FUPA 4PLOA 3IBMA 4RS5C 1OXCA 3HNBM 2ZMNA 3SCGA 3UKTA 1WUVA 3X29B 4CCCA 1RHI2 2AC1A 2IXIA 5KR7A 2EICA 2ARAA 5FYTA 4BU2A 2UWCA 3ZFFB 5IW0A 4FSJA 1WGPA 2JDYA 3ZFEB 4M3CF 4XILA 3T2QA 3DN7A 2D44A 4NHXA 2ADDA 4RFRB 1CJPA 1OUXA 3URFA 4EQVA 1AL22 1GP5A 4K3UA 4S2DA 1Z7S3 2P6HA 4LBLA 2AEYA 3B9IA 4EWAA 3A7QA 4WV8A 4GWIA 4OUMA 4UW6A 5A1AA 1LAJA 4ZY9A 4B4QA 1DQ0A 5JMOA 3N7LA 3POJA 4QAWA 2ZX3A 1C57A 1OOPC 1OURA 1RTVA 1PZ9A 1WA6X 4CRQA 1JHNA 1UXZA 1XNTA 4OI4A 4WM8C 5E8AA 1K5MB 1UO9A 2J1RA 1OVSA 2PLV3 3GHMA 4QT6A 4XE9A 4XOGA 1QNYA 4XFAA 1H30A 3ZFFA 1A6CA 3ZFEA 5IVCA 2XPJA 2EIEA 4ARYA 3J7LA 2JDMA 2VMCA 2ATFA 5KBFA 3GBFA 5LRSA 1NYWA 2CU5A 5JIUA 4EN9B 5IVJA 1YWKA 2P5BA 4LXLA 1C8NA 2XMLA 2AGSA 4PIZA 1YFYA 4AAXA 2IWGB 3EHKA 4OI0A 3OG2A 1Q43A 3WDUA 3POWA 4DXRA 1YI7A 4A4AA 2VOVA 1K5MA 1VB2A 3ZLIA 1RJ7A 3VBSC 2MEV1 4J6GA 2WZPP 4GD4A 2XXZA 3E6BA 2B42B 3VDAA 3H7JA 3TNPB 4X8NA 2WO2A 2HWD2 3C7GA 1VP6A 1GWMA 1UW8A 3ZN5A 4Q4V1 2DCJA 3FUOA 4KNCA 3T1MA 5JWPA 3QCWA 2VOWA 4QB1A 3BTAA 1AX2A 5HCFA 1PNFA 3DEMA 4J1WA 4EN6B 3WF3A 3KHCA 4FQZA 2WZEA 3TWIA 2VPVA 1F4AA 2RS52 3H1YA 4Q4Y2 2VG9A 4I01A 4E4DX 2D3RA 4HFSA 3INAA 3UETA 2XQRA 1RL3A 3ORJA 3ZYRA 5I91A 1LHNA 4JCKA 3T08A 3HIFA 4WBBA 1O5LA 3L2YA 4URAA 3WXPA 1QJY3 4R4ZA 3OD4A 5DPNA 2VBDA 5FYBA 2FDJA 2WRAA 4OVEA 4Z2AA 1OUSA 1OHFA 4R4XA 4UBHA 2DTYA 3OD0A 4NE9A 2KA3A 2QE3A 3D8CA 2YU1A 5FY8A 3VKOA 1DP0A 1A8MA 1VBA1 5T54A 4AF9A 1ENXA 2GNMA 2BWCA 2HYKA 4E4ZA 3BI3A 3PUHA 2VMGA 1S55A 4WM7B 3CJIB 4QPWA 1GOGA 2GP5A 3W21A 1R091 3NW4A 4LA2A 4Q4W1 3PHMA 3FLPA 1H2MA 4OQ9A 5KHIA 5HBAA 4YM2A 2DV9A 3HT2A 2BOIA 2JENA 4AHYA 1Y7BA 2MHFA 3WCRA 2JE8A 3PIJA 4PDWB 3OGSA 2IC1A 4R8HA 1NA1C 3NRUA 3K2OA 2A3XA 4XFHA 1UKGA 5LBBA 5FDBA 3M3OA 1ODNA 2HLEA 3PTRB 3N9QA 2VW1A 4Q0VA 1FX5A 5EJZB 1S0JA 2OUHA 3W5NA 1Q8PA 4H55A 4WM7A 1V9U3 1DYPA 3CJIA 3KT4A 3AX4A 1NX9A 2XG3A 5CAZA 1FMD1 1QWRA 1WD4A 2BBAA 1RUG3 4OI2A 5DAWA 3K3OA 1VBC2 4YYOA 5KHJA 2VH9A 5T5OA 5LZ6A 1J1LA 2B45X 3WNMA 2HEWF 5I0SA 1UXXX 2GN7A 3JQXA 4UW5A 1H4GA 3TAYA 3J8F2 5EHDA 3FLRA 2Q1ZB 1UQXA 2A3YA 2ZOEB 4PDWA 4RYDA 1CX1A 2XH6A 4W8JA 3FWEA 4KU7A 5GLUA 3ZSMA 1RIRA 3ZVXA 1QU0A 4AQ2A 3O0WA 4F7ZA 1TME2 4XHXA 3WD5A 2PELA 2QCSB 5JOWA 2RDSA 3ZYIB 1G86A 4ZXEA 1GZ9A 4L99A 5FZ9A 5F7UA 1DZTA 2WZR1 4BQYA 1JZ8A 1LGNA 4AI3A 5D8AB 1AR73 3J26N 2IXKA 3MO4A 4NR1A 5LASA 3WF4A 3ZFGB 5FIXA 4GB33 3J7NA 3TEWA 4N9HA 1EV13 3JD73 1W9SA 1QJEA 4YGBA 4QKBA 4LK6A 5FMBA 5GZGA 2O8QA 5A7NA 1GNHA 1LEDA 5LB6A 1PIV2 3ZXAC 4COVA 5FJKA 3ES4A 4KWLA 1LHWA 1TNFA 2VZTA 1SBDA 1U5YA 3NSTA 5BNNB 2BBVA 3IZOA 2CNAA 4R9DA 5T3NA 1W8WA 4CP0A 2QVSB 2W95A 4CSWA 3MFCA 4R9BA 5D8AA 5L36A 1X8EA 1RUI3 1UD1A 5DMYA 3AP7A 1EP0A 1AZDA 2PHLA 3ZFGA 1NLRA 5FR3A 3LB9A 1O59A 3NNMA 4GA9A 1U0AA 4AGRA 1R1ZA 5J37A 4NIIA 1DYOA 1VBD1 3QH6A 3H8UA 2UU8A 5FZCA 2W92A 1Q8OA 2OYZA 1VPHA 1JYXA 4M4RA 3ZX7A 4ONUA 4Z2WA 5GLWA 2EXKA 2OX0A 4CCNA 1HRV1 2Y8KA 5LY1A 5BNNA 4JV4A 2R30A 4IERA 2GN3A 4QQOA 4DNYA 3IN9A 5C3QA 2VOTA 4PI2A 4UF0B 2DU0A 4XUPA 4L2NA 2QKDA 3THDA 1PVC1 3WNOA 2D6PA 2ZZQA 4R52A 2B9VA 1LTEA 1FT9A 2D6LX 1JS9A 4RHV2 1ZX5A 3IMNA 3JXSA 4HOOA 4CCEA 1MS0A 2VVFA 5J96B 4RFT0 3DF0A 4MYEA 1WCSA 3C3VA 3KQ4B 2WA4A 5J1XA 2DU1A 3IM0A 1SLBA 2Y64A 1IKPA 3GZAA 4LKEA 5CISA 2JKBA 3ILNA 4A42A 5K8SA 5GALA 1D4M3 2XVGA 2MEV3 3JBG1 4CDUB 4ZHNA 3ATGA 2SLIA 2WIIB 1DQ6A 4UF0A 1G9BA 3JUUA 2TBVA 5GM0A 3VKLA 3NAPC 4AXOA 3MW4A 2P3KA 5KHHA 4TLFA 3IIAA 4UW4A 2QQWA 3SLIA 3WHTA 3K4AA 4YW1A 2R1BA 3AVRA 4KWJA 4CCOA 5T52A 1OPOA 5LK5A 2ZZJA 4XDPA 4YW6A 3AZXA 3C7HA 5CG8A 1RUE3 3WF0A 3FL7A 4AFCA 4PLMA 5DZFA 2Q8EA 4CUAA 4FP3A 1ASJ1 1ZYBA 4XF1A 5K9YA 3A21A 1NQJA 4TXWA 4CDUA 4Q1RA 1XNKA 4Y33A 1X33A 1GP4A 1AJOA 1SEFA 4RGAA 1HV1A 5LRRA 3JB4C 3ZSEA 1H6XA 1RUD1 1N3OA 2PHWA 1QJFA 2RM22 2YYOA 4COUA 4XDOA 3RJRA 5A33B 3U0ZA 3RZJA 1MACA 5FP8A 2WLPA 1O4YA 1SLCA 5FWEA 4FXGB 3PL0A 1VB4A 4D69A 3FN9A 1COV2 1NLSA 4GZ9A 3WR0A 3MZHA 3R05A 5JAXA 4BZ4A 2QBXA 2RR12 1KJRA 1ULPA 2VL4A 4YW7A 1GSLA 5A6QA 1F5JA 1J1TA 1YQ2A 1BMV2 4XQ4A 3UNPA 1G9FA 3LWCA 4OHVA 5IFTA 4OYUA 3ACFA 1RVF1 1DDLA 4D8MA 1ZM1A 2JJ6A 4XBQA 1QMJA 3VKMA 3RPQA 4Q4X1 3SHRA 4QX0A 5A33A 1CQ9A 1BZWA 2GNTA 2VMHA 2XBO3 2GNDA 2PHFA 1MEC1 3FMGA 2VO5A 4PF1A 4KGGA 3PU8A 3POGA 4ASLA 5JXIA 3WP4A 2JE7A 1DQ2A 3Q8EA 5IK4A 3VBOC 3CZJA 2B39A 2A73B 5C3SA 2RE9A 2IXJA 1JZ2A 4NRMA 4XZPA 2VE1A 4XDQA 3UKNA 5IVVA 1SBFA 4CUBA 3B02A 5FLIA 1CAUB 5FY9A 4AVAA 1JYTA 4BLIA 5IATA 4XJ9A 5FZ4A 2A7AA 2D6NA 3S6PA 3N35A 1F31A 4LHNA 3I4IA 1HJGA 1BHGA 2EXHA 4IV3B 1U5IA 1DIWA 5FO8B 1YC61 4AOCA 4C90A 4NIAA 1RUJ1 1W06A 2MPFA 1YQ5A 2HWC2 3CEWA 5CKQA 2HJIA 1NAEA 3H9AA 1CX4A 5EFUA 3HR9A 2XVLA 1NXMA 4ZU5A 3H8OA 5T55A 1SLAA 5IT6A 4AI2A 4IUGA 3O1PA 1LOBA 3KF5A 4WVVA 4E4HA 2FHRA 4IV1B 3ACHA 4FXKB 1CAUA 4XIKA 1RMU2 1U5ZA 3NWKA 5ACA1 4ZXKA 5LA0A 1APNA 2XGXA 2D97A 4BCUA 2TUNA 5AC91 3ZYJB 4M3CE 5DN2A 4JHZA 3QACA 4KI5M 4IV3A 1W04A 2DCTA 4FFIA 1FXZA 3MDPA 2BYVE 1PM4A 4H14A 4HANA 4BQXA 2P6CA 1IPKA 3BYWA 2PAKA 5A1LA 1YHFA 5EIYB 2W1QA 4NAMA 4XUQA 1KITA 3U11A 2BPA2 2XHKA 4CDWC 1L7LA 2VNRA 3A0NA 3BIWE 5F32A 1YO8A 4IV1A 1SDWA 1TMF3 1H8TB 2ILMA 3AL6A 3JQWA 4HETA 3T0AA 2E26A 5CNAA 5FY5A 5GJ6A 3AB0A 4CU7A 1O3QA 2C9KA 3LEKA 1AYM2 1W39A 3EO6A 3T0BA 4HBNA 1ZZ7A 3Q8FA 5BXXA 5JR2A 3LPFA 2WWJA 1XOYA 5A70A 1HRV3 1NOVA 3I3EA 5JSPA 3ZSKA 1RGSA 1I5ZA 2VZ1A 1PO11 4FPEA 4QXCA 4CP1A 2ET7A 1MS4A 4YG0A 5IAXA 5T5JA 1TE1B 2XKOA 4QX7A 3VD4A 1XNCA 2WNEA 1IKQA 1NG0A 3DYOA 5FMCA 1H8TA 2FDKA 4NIGA 4IXLA 4BE3A 4RSUA 3O14A 3H0OA 4H7LA 3ZPOA 1TG7A 1E5IA 3IDAA 2B8MA 3WP6A 1SFNA 1YEWA 2D3SA 2OS2A 4QHZA 4OHYA 4QU1A 1BK1A 4XFFA 4XVHA 2YV8A 1RUC2 2JDNA 2XR4A 1ENSA 1OMIA 2HYXA 2B9UA 3LZZA 1H9PA 4PIXA 1UMIA 4DUWA 5ABJB 3NV4A 2NYYA 3KF3A 3U10A 5BYNA 3M2MA 1GP6A 1GQHA 3O7OA 3RGBA 4YG6A 3IKWA 4MVTA 2WFF2 4COYA 1H2NA 4V2WA 4I2OA 5HPOA 4AEKA 1ACCA 1K45A 2C5DA 4P9IA 4XUOA 5BY5A 1ZRFA 2A75A 3GCWA 3WNXA 1ASJ3 4O65A 4LKSA 4OULA 3MF9A 4YFZA 2LW8A 3HD8B 4C0HA 5JSOA 1L7QA 4IGPA 2J22A 4FP2A 4LNVA 2NP0A 5FZGA 1QQP1 1ZRRA 3TEXA 2Y38A 3UESA 3DXUA 5ABJA 2GZWA 4JTNA 4FTSA 2E32A 1QGLA 1RUD3 2BRTA 4XAEA 2DUPA 2W87A 1CGPA 5JOZA 3KV4A 1WLWA 3V0AB 2BNOA 1FPN1 4B1MA 3KM5A 3C2UA 2D5FA 1UZYA 3CHXA 2GC2A 5JVVA 2DVAA 3CLPA 3W59A 4FOQA 4Y5Z0 3VBFB 3WW1A 5F3CA 1LOEA 1QHDA 1BMV1 2RMU2 4I0WB 4DUXA 4QM9A 1RC6A 1H2LA 1ZZ9A 2OXBA 3BN6A 3D0SA 2EAAA 2W0XA 1AYN3 1SPPB 3T2PA 2VBPA 4QGNA 1S1AA 4ASMB 2P2KA 4BLJA 2O8OA 3SEEA 3LQCA 4Q4X3 1F35A 1JXNA 1WCDJ 2E31A 4RGGA 5FYUA 3ZFEC 3ZFFC 1LESA 3V0AA 3LAGA 4IEOA 5F1RA 1QDCA 1YLLA 3DXTA 2X10A 1XU2A 4AI1A 2G4IA 1PGW2 4XHBA 3VBFA 1D2QA 5FOJB 5M0TA 2EA7A 3ZMOA 4NIDA 2XJSA 3H1WA 5C6CA 2K46A 3CO2A 4QHOA 2VXRA 3MYXA 2Q8OA 3RJ2X 4RA0A 1Z7S1 1SPPA 3WF2A 2VJXA 5JZGA 4OHXA 3VD5A 1BXHA 3GGLA 3MICA 1K5MC 2W3JA 2XJVA 2BVVA 1R082 3B94A 1LGCA 1MVEA 1NY71 2ZGUA 1MZEA 2WAAA 1TEIA 2HWE1 3P3NA 4OHZA 4NAOA 2IXCA 1RUJ3 1PVXA 1DFQA 1IG0A 2PLV1 3VZNA 3HN1A 4BK5A 4M01A 4L9BA 3POYA 4Y24A 4LIUA 2WNVB 4NVPA 5FYIA 1EPZA 2VMFA 1FOD2 3OB8A 2YBSA 1GLHA 5A3NA 3W20A 4D7YA 1JI6A 4QKDA 3KCCA 5FP4A 1YNAA 5C71A 3WG4A 1IG3A 2E53A 3WW3A 4LJHA 4XFCA 5C3PA 4XCBA 5K0UB 2ZGRA 3RMYA 1UZVA 3VKNA 1G9DA 2ZKNA 4CXWA 5L9RA 4V1PA 3LA3A 2KM2A 3WQ1A 1O4ZA 1U5XA 4PIYA 4Y1UA 2WNVA 3K46A 5A32B 4Q2FA 5DG2A 4W6XA 5FZKA 2IFRA 5JOYA 5FZ1A 2XB6C 3FFQA 4FPHA 3N9PA 1NKGA 3LIHA 3O1VA 2QDNA 2ZKLA 4SBVA 1XXNA 4N90A 1W9WA 4LITA 1W0OA 1MQTB 3LDBA 1MS8A 3ASIA 2VULA 1FATA 4IGOA 3OGJA 1ZA4A 4IW3A 5LATA 5JOXA 1QJY1 4XBNA 1ZBA2 4LBQD 3AZZA 5A7WB 2RS32 2PQQA 1TNRA 4YZ4A 5C9AB 4LKFA 3CF6E 1C28A 3AZYA 3NNGA 3PUQA 4QX8A 5A32A 1QXPA 4LO5B 3CJIC 1O7FA 2RR13 4FOYA 1OSGA 4WM7C 5E16A 4A7KA 4JRLA 3ZXKA 2P17A 4UFKA 3TBDA 5A3WA 5FAXA 3HPNA 3N9LA 2R7EB 2ETEA 1J84A 3H1MA 2IFWA 3S57A 4KBBA 4FOWA 1MQTA 5JPNB 3DYMA 4YGCA 2WAOA 3G7DA 1HRI1 3RS6A 4PDWC 5A6XA 3ZKYA 5FQ0B 4B3NA 5L7OB 5IWFA 2RS11 5FP9A 3R6SA 1E5SA 4MV2A 4XACA 4X8PA 5A7WA 1GQGA 5C9AA 1PMJX 5DAQA 5ANQA 1V6KA 3H7YA 3S5QA 1KS4A 3SITA 2IXLA 3ACGA 3MUY1 1MS1A 4AI9A 1PMHX 4GMP0 5A6YA 1JU3A 4XQWA 3P5BA 3B7MA 4JGYB 4QQLA 3UGFA 4MGTA 1LHOA 2J7MA 4ZPIA 4YFWA 2HWB3 2V72A 3ILFA 1V9U1 2W91A 3AKPA 1BVP1 3O0XA 3WNPA 1X36A 4JZRA 1RUG1 4J25A 4BQ5A 5FQ0A 5L7OA 2WINB 3LKJA 3A0KA 4DXTA 5ISLA 4HN0A 4MGQA 3U75A 3VZOA 2ZHKA 3K4DA 1QQP3 1IPSA 2RDRA 3HMYA 5F5IA 2WN3A 3IMMA 4D0QA 2YGLA 1OFNA 2HWC3 1W9TA 3HWJA 3MBWA 1OT5A 4MGKE 1NT0A 2H0BA 5A7OA 3RZZA 2H6CA 2FCTA 2VQ0A 3D0JA 2VQUA 4JGYA 2RG4A 1OKQA 2GDFA 4Y20B 2VECA 3K4ZA 2QQNA 5D8AC 4LOTA 5I93A 3RYRA 5JXGA 2EF6A 1ND2B 4B7KA 3ZFGC 1KS5A 4BH9A 1WW6A 2BWAA 4W65A 2XJTA 1QXJA 1E5RA 1Q8VA 2VQAA 2E7AA 4IEZA 1SHWB 1C3HA 3CL1A 5JDBA 2VTXA 4OLLA 3KV5A 3WNNA 1QY4A 1ZBE1 2VMDA 4GB31 1F5FA 5BNNC 1EV11 3JD71 4CUCA 1XSQA 2NZ9A 4IDZA 1BK0A 3MFAA 3IDCB 4NN0A 4Y20A 4YGEA 4P5YA 1UPIA 2OA2A 2WNUB 4K8RB 2QQJA 4XF0A 2A3WA 3QBQA 1LEMA 3JCIA 5F37A 1ND2A 1VBA2 3AZWA 2Q8DA 3H50A 3NV2A 4OCTA 3HJRA 4N53B 5K7PA 2WN2A 1G9AA 1AYM3 3EMRA 3NJVA 1S2KA 2GMMA 4Y4YA 1CAWB 2HWF3 1WMDA 5CADA 1RUI1 4HT1T 1R092 1XNBA 4Q4W2 4KL1A 3RDIA 1WCUA 4I09A 3T3YA 1A78A 3TN93 1PGL1 2R32A 4FTEA 1W6PB 1AR93 2HWE3 2X09A 1KDMA 2RV9A 5FYHA 4AAPA 3T09A 2WNUA 1LRHA 1WW7A 4E8DA 1W03A
chains in the Genus database with same CATH topology
4OI1A 2CGNA 5IK7A 1I3HA 3RG0A 4IL7A 4N53A 4M00A 4B4PA 1JN2P 1VAVA 1H0BA 1CAWA 5FLJA 2NPIA 3GYDA 1W6MB 4YGDA 1FMD2 3ZXGA 5H9QA 3QD6A 3HQXA 3IPVB 4CDUC 2VNOA 1EPWA 1W6PA 3NO8A 4WZFA 1SLTA 1WW4A 3LOBA 1EAH2 3NV1A 1D4M1 4TWTA 1MZ6A 3VHOA 4CDQB 4Q26A 4LBJA 3N7KA 3GBGA 3U07A 1AR62 3RQ0A 1QOSA 1S0BA 1W6MA 1WBLA 1VBE3 4LT5A 1DBNA 3KZ4C 3IPVA 2WT1A 4EWDA 1BEV1 4IEVA 4G3YC 1E57A 2R041 2WZR2 3O12A 3I7DA 1RUH3 3M7AA 1RUE1 1C5HA 1PMIA 5DUVA 3AMNA 2WWSA 3S0MA 4KH9A 1SFYA 1B09A 1VRH1 3AMHA 4CDQA 1LODA 1OA4A 1W2UA 1OD5A 5KC5A 1TQ5A 1YFWA 2Z5WA 1YFUA 1N3PA 1C1FA 4DRRA 1DQ5A 2WJSA 3VZMA 2JD4A 1S0GA 2GC3A 2ZAHA 2SBAA 1HRI3 4NWWA 4YW5A 1HQNA 5F5QA 1PK6A 2XWJB 1AR81 1NCQB 2RS13 2ZX1A 2XKPA 1A8DA 5FO9B 4LUMA 3HT1A 4JGZB 3FJSA 1BBT3 2DYCA 3FBYA 3IDBB 2GSYA 2WS92 5T5LA 1OA2A 1W6OB 5FMOS 1O4TA 4AHXA 2PHXA 1QH6A 2JDZA 2XBO1 1HX6A 2R0HA 5GLTA 4MXWB 4UBGA 3SMHA 4M3CB 1C8M2 2P3IA 2R072 5F9TA 1PVC2 3RMXA 3GZTB 1JW6A 2NQYA 1NCQA 3ZXEA 2YY1A 1QJU3 4C0BA 5FPZA 4JGZA 4IV3C 3MLKA 5HI0A 3EJKA 1MVQA 1W6OA 2O1QA 1OPMA 3VL8A 1R1A3 1G9CA 3A4UA 1QJX3 3JBG2 4QPIB 5DUWA 4MXWA 1DF0A 3WG1A 4LBMA 4M3CA 3CJXA 3UKVA 2IZWA 4XJWA 3CNAA 1HIXA 1UAIA 4IV1C 4AHWA 4AFBA 3TB0A 3AYDA 1UN1A 1QKQA 4LLFA 4Q8KA 3VL9A 3WP3A 5EV7A 5FO7B 2D6KA 4XTMA 1ZRCA 1ZBE3 3MLLA 4TZDA 1DYKA 3WLUA 4JDNA 2EIGA 1PNGA 4WVMB 4D3WA 4QPIA 3N3HA 5A3MA 1SACA 1Q8QA 1V6LA 3THPA 4Z07A 3LOIA 4CEYB 1H8TC 4XJZA 4F83A 5BV6A 1LENA 1HXS3 2EXIA 4EV0A 1N47A 3I8TA 2YROA 4BMEA 4I3PA 1TMF1 1PO22 4LO4B 1ZBA3 2EALA 3KCXA 2UWBA 1UMZA 4WVMA 3HAGA 4PBOA 3EXUA 3ZIWA 2DURA 1RVF2 2NN8A 3NKGA 2DVBA 2NLRA 4GKXA 4CEYA 5JIAA 4XW3A 1XNDA 1MEC2 1UX6A 2A70A 2PHUA 1F2NA 3CU7A 3WUCA 5GZCA 1OLQA 4I3GA 4QGLA 3B93A 1AVBA 3LSDA 3DKWA 5CFCB 4JDMA 4NOTA 1KJLA 2D7FA 2VW0A 4AGVA 4QMAA 5ABJC 4XETA 3PJQA 2HEVF 1GR3A 4FQ4A 1ZRDA 4EROA 4CYDA 4Q1PA 4MUVA 4E9KA 1ULDA 3WHUA 4XPVA 1YUDA 2WQZC 1B35B 4D7TA 4S2HA 3OYWB 1OQ1A 1BEV3 2R043 4CZSA 4LBKA 5CFCA 3ZSLA 3GF6A 5CBLA 3ROUA 4INDA 2YGMA 2B5HA 3NKTA 1NCRB 5FLHA 1LGBA 5GZFA 4DINB 5AC92 2QNKA 1VRH3 4DB5A 2BFUS 1LU1A 1VBB3 3VBFC 2OZJA 4YARA 1HV0A 1PGSA 2XJRA 1B35A 1FYUA 4BQ1A 2R49A 3OYWA 1C4RA 2Z2SB 4YG3A 4B8EA 3MGUA 3N7MA 2PTMA 3NJZA 5DDJ3 4IEUA 1EY2A 3T1LA 1AR83 2Y0IA 4Z92B 1KQRA 2DUQA 1NCRA 1NZCA 3BPZA 5TSWA 1Y9QA 4AG4A 1RHI3 4HSLA 1AYN1 1G6NA 1I6XA 4AQ6A 4I0AA 3SCFA 1MZFA 1C1LA 1V6JA 2YDEA 1AL23 5FRAA 3B5LB 1SBEA 2OW4A 1JUHA 2E51A 4Q0UA 2R062 2VVDA 4GXLA 4RQPB 3RSJA 1H9WA 2TNFA 5AFBA 4JAAA 3UJOA 1D0GA 4L92A 1V00A 2DVGA 3W9AA 3M8LA 3OGGA 5DXDA 1POV0 2WNVC 2XJUA 4LBNA 5IK8A 4DY5A 1RUF2 1XRUA 2AREA 4K7JA 3MIBA 4FPOB 1RINA 5SV5A 3WDXA 4LE3A 3ZXJA 1Q56A 2VW2A 3ZN4A 3TOJA 4N9IA 4OUSA 3ZXDA 1N3QA 3AFKA 4RQPA 3BOWA 1DU3D 4AW7A 5K0UC 5FPXA 2GMEA 1J3RA 2D5HA 2BGCA 3RNSA 1ZZCA 1FV2A 2HWD3 3Q9OA 5JCTA 3AFGA 3MLJA 4YW3A 4AEDB 1YIPA 1ENQA 1AR63 2JG9B 1M4WA 1V70A 3DPRB 4EN8B 2OIIA 1S2BA 3WQ0A 3ZXFA 2RS53 3E5UA 4Q4Y3 2ZAAA 2CV6A 2D40A 3LA7A 4XXPA 1ULEA 3L9JT 4Z82A 1MQTC 1GKBA 5IK5A 3VHNA 1XYNA 1FV3A 1WW5A 1QXRA 2X8KA 5C9AC 3V65A 2X29A 1DLLA 2A6ZA 3RWNA 1AXYA 3AXDA 5E88A 2UY8A 1DGRA 4XF4A 1POV3 2ZX2A 4AEDA 5I0RA 2JG9A 3DPRA 3VGIA 3B9CA 3WW4A 2ZGSA 4K6BA 1J59A 4Y26A 2ZJCA 5I8SA 4IQPA 1J58A 2RR11 4S2GA 5L7OC 2D3PA 2AENA 1UPSA 4WVWA 2H0VA 2UURA 3THTA 2I45A 4DOUA 1H4HA 1UCXA 1XQNA 1Z7S2 2E63A 4AEMA 2PHRA 3AYCA 3VBHB 4NHMA 2YUEA 3D4KA 4JGYC 1NY72 4H3WA 4QQ2A 3I2DA 5DZGA 1LOGA 4P9JA 4HPKB 1VBC3 2PLV2 4IEPA 3UJQA 4HVQA 2BUKA 2DVDA 1AF9A 2XL9A 1OI6A 1S0FA 4HVRA 4G9SB 1WLTA 3SCGA 4DMIA 2ZGTA 3HBZA 3M70A 3J8F3 2WT2A 2HWB1 3E5QA 2I74A 3WG2A 5C4WB 5KHGA 4AFMA 2PHDA 3VBHA 1S0DA 3OTFA 4QQHA 3KGLA 1TME3 1LULA 2NMNA 5BNQA 1F9KA 1ZREA 2CY6A 5I0UA 2K9ZA 3ETQA 4AVBA 4QM8A 2HWC1 4COWA 2EAKA 2JXAA 1ND2C 4HPKA 3USUB 2CGOA 1OFSA 5HCBA 4XEZA 2ZHNA 4CDXB 2YMZA 2GU9A 5JI9A 3FHIB 5JPMB 4JC1A 3OBRA 5C4WA 3S7EA 1DGWX 1REFA 1W6NB 4K40A 4JRAA 3WCSA 2BVBA 2XLGA 5AVAA 5SV8A 1PIV3 3M1HA 4PF5A 5JZGB 2WNUC 2GNBA 4OHWA 3G6JB 3AKTA 1NXD1 3R0RA 4IESA 3USUA 1PM7A 2GH2A 4N53C 2ZHMA 4GMP1 4YLZA 2OPKA 1WLCA 2YZ4A 5J3UA 4CDXA 3M3CA 4EJRA 5FREA 2ZMKA 3N7JA 4MLOA 1G7YA 1W6NA 3GHNA 1XE8A 1AYM1 2IXHA 3AZVA 3KT7A 1S0CA 2QDRA 1LCLA 4P9WA 2HWF1 2WSUA 3MIDA 3TN91 4OFGA 2JE9A 1AR91 3PLQA 1FNZA 3AP5A 4NO4A 3JB8A 4RHV3 1SCRA 1YI9A 4PLNA 3KT1A 4BPZA 4Y1VA 5E1RA 2V09A 1V9U2 1Z78A 2VMIA 2AYHA 4DY3A 4IEWA 1RUG2 3DUIA 4D7SA 1SCSA 1CJDA 4GH4B 5J98B 4EWEA 1QF3A 4AHZA 2JECA 4CDQC 2N7GA 4PCRA 3WV6A 2WQ4A 2A6VA 5DUXA 2LTNA 2W08A 1WMFA 5JMCA 2HKXA 1IS4A 2KXLA 3GBWA 2XL7A 4YZ5A 1A3KA 4QU2A 4PQ9A 2D6OX 1V6NA 1J3QA 1VBE1 2JX9A 3VBOA 1HLCA 4M0NA 1IHMA 4GH4A 3KQRA 1WA4A 1GANA 1RUH1 2YPJA 5JI7A 1AR72 2RM23 5BNPB 4AWDA 1JOJA 1OQDA 2Q5TA 4GB32 4XMAA 1EV12 5JR7B 4N7UA 1COV3 4K9SA 4QGMA 2WC2A 5KXDA 1O3RA 5J7MA 4ZU7A 4YW4A 2PFWA 5KWRA 3WT3A 3KLSA 1NCQC 5EWSA 4YVWB 1Y43B 1HQWA 4QD2A 2G9GA 4JGZC 4J1XA 4HLTA 4ISRA 2DUOA 1F8VA 3WDWA 5BNPA 1UIJA 4LBQB 1RUI2 4Q0SA 1X8MA 4DQAA 3KS7A 4OZXA 1PGL2 1ULFA 2D93A 3PVBB 1BBT1 5J48A 1VAKA 4XJAA 4AEJA 1ENRA 5GLVA 1SQ4A 2AR6A 4N7IA 5FCCA 5CFDB 5J09A 2R063 4YVWA 1IZ3A 1BQPA 3IDEA 3U4XA 1R081 5H9RA 4LBQA 1UZZA 4YVSB 1UL9A 1LHVA 1QJU1 1YYNA 4LEJA 1ND3B 4MXVA 4PBPA 5CIRA 4QPIC 4FCAA 1WD3A 4CP2A 2VUAA 2P37A 1UF2C 3MF6A 1R1A1 3DGTA 4U36A 5CFDA 2B46X 2R16A 3WOGA 5C8CB 1D4M2 1QJX1 2MEV2 1NE6A 2Z69A 4YM3A 1KFXL 1FOD1 2CTVA 1RMU3 2DCZA 3TRSB 3WZ1A 4LHKA 4Q4V2 1KDKA 2K0GA 4YVSA 1VIWB 1YFXA 4XXAA 4YSFA 1ND3A 2ZMLA 2CL2A 4KG8A 4DRVA 3DV8A 1RUE2 4FPGA 4CEYC 2A5ZA 5C8CA 5DUUA 4GMP3 1OLRA 3UL2A 2JG8B 3RYKA 5KXEA 3RI9A 1WLDA 4RL7A 4YZ1A 1W6QB 4XQDA 4CEWB 2GC0A 1HXS1 2I2SA 2JEMA 4LUKA 2CAVA 1GYKA 3BOPA 2PA7A 3MPPG 2ZGKA 1GZCA 1V6OA 1ZBA1 4JVAA 4Z1VA 3MW2A 1JBCA 1PHMA 4ISQA 1REDA 2JG8A 4F3JA 3APBA 1AJKA 5F6LB 4YZ2A 1W6QA 2QFEA 2Z42A 2XBO2 1ZNPA 4HZFA 4LBOA 1QOOA 5J36A 4CEWA 5CFCC 4Q29A 2DTWA 4P9LA 4XMIA 1RUC3 2ARBA 2JICA 1KXGA 2X5IB 2VGDA 3QH7A 2E6VA 3MEPA 1X82A 2BW8A 1H1MA 2OUJA 4RR3B 4F8AA 4E2SA 1VAMA 2D43A 2WFF3 2ZABA 1B35C 1AX0A 1AXKA 1LU2A 3FC0A 2EXJA 3MIFA 2O0OA 5EZWA 3ZXLA 2X5IA 1NCRC 5AFEA 2FZ1A 1PZ8A 3VZKA 4HK9A 1UU5A 3AKRA 3BCWA 4MZUA 4RR3A 4B29A 4DPNA 1PK6B 4XTPA 5BUVA 4KG0A 5I8YA 1ZZBA 2FBEA 1MS9A 3TNQA 2ZS6B 2DCYA 1AX1A 3KSCA 3L2HA 2QQPA 1VBB1 4BM8A 2RMU3 2VNGA 2ZX0A 5C33A 4UXAA 1SLIA 4MSVA 1CD3G 2ZPXA 3ZPYA 3ILRA 1ONAA 5DZEA 4E2GA 2XVKA 4XFBA 5DDJ1 3VUOA 1FNYA 2ZA9A 3V56A 1TMF2 5BNOB 3ZN6B 2WFPA 1CAVB 5LEJA 1RHI1 3MIHA 3VBUB 2P3JA 3B69A 1VBD2 1IS3A 3WW2A 5KXBA 2ZBJA 4FT8A 1HRV2 3B00A 4HMZA 3IWZA 3SXWA 1AL21 4RQPC 4BIOA 3V0BB 2ERFA 4QPGB 1D0HA 1Q5OA 1R083 2VY0A 3J9SA 3MI8A 5BNOA 3ZN6A 3R4UA 4ZKTB 2MNGA 1CAVA 4MX3A 2WKKA 2GALA 3VBUA 4P9YA 4S2FA 5KXCA 4GWMA 1H8VA 3OCPA 2QZ2A 3AJZA 3RI8A 1GFF2 2FQPA 2ZGLA 1SMVA 1Z0HA 1FOD3 3V0BA 3AM2A 3WX5A 4QPGA 1UU6A 1DZQA 2ZTNA 3VKFC 3LSEA 4XYXA 3ME2A 3I59B 2W39A 5HCAA 3KD4A 4QPYA 4MH0E 4K21A 4AEDC 3AP4A 1DQ4A 3BB6A 5CG9A 2JG9C 2R1DA 1EAH1 3DPRC 4HK8A 4YW2A 3VHPA 1ASJ2 2PHTA 4TYSA 4FO9A 1T6GC 1X50A 2HWD1 3AMMA 2BQPA 4C1WA 2Z79A 3VDDB 1AR61 1LOFA 4GULA 1W0PA 1RUD2 2AZ5A 3NVCA 2VVEA 1H2KA 3GZUC 3WINE 2WL1A 2RS51 3T2TA 1CPMA 1YXWA 4Q4Y1 2PAEA 1HDKA 3K51A 2GMPA 1S0EA 3I59A 1UKRA 4I0BA 4ATFA 3VBRB 3E97A 2EVXA 2YC0A 4FVVA 3ST7A 2RS33 4B4RA 5CU1A 3M3QA 4N43B 4I02A 2XJPA 4Y22B 1AYN2 1EYBA 1POV1 3VDDA 1MZ5A 5CVRA 4HKOA 1RJ8A 3MW3A 4HVOA 3AP9A 3LGRA 4Q4X2 1WCKA 4RS5B 4AI0A 2V5YA 2ENRA 4W6WA 4P9GA 3VBRA 4LO6B 3VBHC 1VLNA 4E27A 3SCHA 3IT8A 4N43A 2WS91 4P14A 2AH2A 4Y22A 3JZVA 5FMOL 3AYEA 2A71A 5BPXA 3V64A 1DGLA 3MIEA 1O3SA 4Q8LA 2B7YA 4IEXA 4RS5A 1YIFA 5H9PA 1OOPB 2ET1A 1C8M1 2R071 4EN0A 5FBZA 5T50A 4WM8B 3KCYA 2DFBA 5C4WC 2VUJA 1RUJ2 1VBC1 1VJ2A 2BEOA 4TSVA 4EN7B 3PVEA 4YM0A 4AI8A 4JDOA 3ENRA 1AL0G 3J8F1 2QUOA 4GALA 1GNZA 3AKSA 1FAYA 3M4FA 5LEKA 5ACA2 3SH5A 4JTOA 4FPKA 1TME1 4ORFA 1OOPA 2I07B 4CDXC 4IEQA 4P5HA 3WQ7A 4Q4V3 4WM8A 4AYUA 4NHKA 2RJLA 3VBSB 4GIQA 1LJ7A 1AUYA 1WBFA 3VN4A 2RJKA 4AGGA 1CR7A 1YJLA 3E5XA 1N1SA 2UYAA 4UW3A 4PJYA 4Q0QA 5JZGC 4HL0A 4BHPA 1YJKA 2Q1MA 3JU9A 4LA3A 2P34A 3AJYA 1CONA 1PIV1 4NWVA 1BVVA 4FPCA 2ZGMA 3I54A 1VBA3 4AVCA 4G4FA 2C0ZA 3VBSA 2RHPA 4GWNA 3ZYPA 1PO12 5DG1A 1X7NA 1R093 1PO21 4Q4W3 4CTEA 1ULCA 5FFOC 1VALA 4LHLA 1BKZA 4QXKA 4AVSA 4DZGA 1NE4A 2VOXA 1IQAA 4IEYA 3P3PA 1HW5A 5GLZA 2PN5A 1HKDA 1MS5A 4HKWA 1KD7A 3ZO0B 4E4SA 3QOPA 4META 1KRIA 2K2SA 4RHV1 1NA1B 1FMD3 1ALYA 4ATEA 4YRDA 5A3LA 4ES9A 5JLVA 2R0FA 2ZGPA 3ALQA 4GH4C 1RUNA 4AFDA 3KGZA 1JH5A 2HWB2 1MR5A 2HEYF 1DZRA 1EAH3 1GZWB 1QDOA 3ACLA 2CYFA 1H1IA 3OPZA 4BMBA 3WG3A 3MPBA 2E9QA 4P9XA 2A6XA 1QQP2 2UY9A 2GAUA 4SLIA 1NA1A 2XLFA 3PVOA 5EJ3A 2YXSA 1D2SA 3AK0A 4QHBA 1FPN2 2WZR3 3D6EA 4FPFA 2E7QA 4LTAA 5GKAC 5HXVA 4Y1ZA 3D5OA 2XUMA 3KMHA 5BNPC 4BOWA 1RITA 1GZWA 2NMOA 1YCIA 3NL1A 4ES8A 1BMV2 5JSRA 4XFGA 2QZ3A 5F6KA 3BU7A 1L3JA 2WT0A 2DVFA 3VZLA 2BFUL 3H3UA 1RB8G 1Q3EA 2RM21 2XWBB 2ZHLA 2F6BA 3AMPA 4AE2A 1CAXB 4YVWC 1COV1 2V73A 2NM1A 1MS3A 2UWAA 2E7TA 2CWSA 4Z8BA 5GZDA 4AQSA 4C1XA 1FI2A 1VBD3 2WS93 3ZYGA 3D82A 2BTVC 2HWF2 4MGZE 3S30A 4KU8A 3UK9A 2CAUA 5CFDC 1S0IA 1RUOA 2W52A 1CAXA 4O9GA 4IETA 3TN92 4DXZA 2GC1A 2QJVA 4A7YA 1AR92 1C8M3 2WSVA 2R073 1PVC3 2HWE2 2Y26A 1I1EA 1Y3TA 2PAMA 2R061 4URTA 3KB5A 5E89A 4YVSC 2XJQA 4FAGA 1ND3C 2Q4SA 1LKNA 4X6QB 5CA6A 4A2UA 2LALA 4LR4A 3RRDA 4B7EA 3QLQA 4Q0PA 5H9SA 2OZ6A 3JBG3 1ZZ8A 1BYHA 5C8CC 1QNWA 1D4VB 1RUF1 1O3TA 3O5SA 3FBMA 3VHRA 3M3EA 1BCXA 3DL3A 1GBGA 2Q0AA 3WVJA 1DHKB 2Y0OA 2DF7A 1GV9A 3J4UH 1JYIA 4AK3A 3OBTA 4LO8A 4JQRA 1G8WA 3WDYA 1LECA 2F4PA 3AP6A 3NAPB 4X6RB 1RMU1 4A7ZA 3K48A 2LUWA 4ITCA 4KWKA 5AVPA 4DFSA 3EQEA 3BALA 4WVZA 2Q30A 1DG6A 1VBE2 1LHUA 3FZ3A 3POSA 3FE5A 2W68A 2JG8C 5L19A 5C8WA 1RUH2 1CESA 2VOKA 3ZSJA 1QJY2 4FBFA 1XU1A 1ZZ6A 4K8FA 4CEWC 4W6YA 1GICA 4Y1XA 3MIGA 3NAPA 3VZJA 3N4MA 1I9RA 1OQEA 1PO23 2ARXA 2GH8A 1BJQA 3M3IA 4QX5A 4XBLA 1URXA 2BNNA 4FTBA 4FAHA 4FPLA 1RVF3 3WUDA 4R9CA 1WMEA 1LOAA 1M06G 1QJZA 3NV3A 1AXZA 4RD7A 1HRI2 1N1TA 1LB2A 2C1FA 5T5PA 2ZGNA 2RS12 1MEC3 3N36A 2C9AA 2ZCWA 4LULA 4HKLA 5FTTC 4A3XA 3R4SA 1O5UA 1CPNA 1BBT2 4K1YA 1O91A 1OA3A 4Q27A 5EYYA 1XYPA 2WA3A 1SLLA 4C91A 1IGOA 2X5IC 4MGYE 1LOCA 3E6DA 3PNAA 1JTZX 4GKYA 4KQ7A 2DFCA 4RR3C 1RUC1 4O9EA 1ZVFA 3VBOB 1IS6A 3H3ZA 3ZDSA 1QJU2 1AHSA 2A6WA 4ZU4A 3FLTA 4LLOA 4L11A 3FFZA 2ES3A 4AVVA 1N1YA 2WFF1 2CGPA 3OF1A 2VU9A 2CWMA 1R1A2 4LE4A 1ULGA 4WZCA 1QJX2 1IPJA 4MGIE 3USSA 3ELNA 4XJUA 4BA6A 1LR5A 5KC6A