1F2NA

Rice yellow mottle virus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
LSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRWDVVYLPEVSATVAGSIEMCFLYDYADTIPRYTGKMSRTAGFVTSSVWYGAEGCHLLSGGSARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLYVIASMVLRDPVDPTLNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D domain swapping modulates the stability of members of an icosahedral virus group.
pubmed doi rcsb
molecule tags Virus
molecule keywords CAPSID PROTEIN
total genus 44
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00729 Viral_coat Viral coat protein (S domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1f2nA00
1ASJ3 2MEV3 3VBUB 2Y26A 4CDWA 2HWD3 3S6PA 2BFUS 5D8AB 4PDWB 5C9AC 1NY72 1AL23 1BMV1 1NG0A 4YVSB 4IV3A 3VDDA 4QPGA 1IHMA 1VRH1 3JBG3 1PO21 1PGW2 5BNOB 4CDXA 4Q4W2 1R1A1 5D8AA 4WM8A 5A33B 1QJY2 5C4WB 4RR3C 1PGL2 1VBA2 3CJIB 2HWD1 1CJDA 2RM22 1GFF2 5ACA2 1FMD3 4NWVA 5CFDB 1QJX2 4LLFA 4RR3A 4GMP1 4Q4V3 2WFF1 4Q4W3 1MQTA 3VBRC 4CDXC 5BNPC 4FTSA 2GSYA 3ZFGC 1VBA3 1AL22 3VDDC 2MEV2 2RS52 4QPGC 1FMD2 3ZXAC 2FZ1A 1RUI3 1ASJ2 4CEYB 4IV3C 3TN91 3VBSA 4RS5B 5C9AA 1RUE3 2RR12 5LK7B 3JD71 1QQP1 1AL0G 1HXS3 1COV1 1RUH3 4CDWC 1HRV2 3ZFFC 1VBC1 1QJY3 1VB4A 3JB8A 2RS51 1RVF1 4RHV2 1RUE2 1AR91 3FBMA 3JBG2 1POV3 1RUJ3 3ZFEC 3VBOC 5ACA3 2BUKA 1EV11 3VBUC 1RUD2 1COV2 1ND3C 4CDQC 1PO23 2XPJA 4RHV1 1OOPA 4AEDB 1TMF3 4YVSC 4QPIA 1Z7S2 1NCRA 1RUG2 5L7OC 4N43C 1EAH2 5AC92 2WFF3 4Q4W1 1AYM2 3CJIA 1ZBE2 2RM23 1SMVA 1NA1B 4NWWA 5A33A 1TMF2 4JGZB 4WM7B 2RMU2 3CJIC 1AYN2 1NCQC 1HRI3 1R093 2HWB1 1R081 5BNNC 1MEC2 4RHV3 1RUG1 5L7OA 3VBRB 1PIV3 1QQP3 1OOPC 4PDWC 1AL21 1AYM1 1HXS1 1RUH1 2RS13 4GB33 3VDDB 1ZBE1 4GH4B 1VBC3 4QPGB 2ZZQA 1QJY1 1RUJ2 2R061 3LOBA 5GKAC 2RR13 2XBO2 1NCRB 1RMU3 1VBD3 4CEYA 4JGYA 1VBE3 3VBOA 4IV1C 2BBVA 1RB8G 4RS5A 1QJX1 1MEC1 1HRI1 4CDUB 5BNOC 2WFF2 1R083 4GB32 1PO13 1R1A3 4CDWB 1ZBA3 1HXS2 1RUH2 2WLPA 4RR3B 4YVWC 1RMU2 2HWE1 1FMD1 1PVC1 2RS11 5CFDC 1CD3G 5C4WA 2X5IB 1AR81 3ZFEB 1BEV2 1VBD1 4CDXB 3VBOB 3VBSC 5J98B 4Q4X1 1AYN3 1VBC2 4WM8B 2BPA2 4SBVA 3DPRB 4IV3B 1RUE1 1AR92 4RS5C 3JD73 1R091 2HWB3 5AC93 2DF7A 1VBD2 3ZFFB 1RUF1 1AR83 1PIV1 2RS53 2ZAHA 3IDEA 1NA1C 1MQTB 4Q4X3 2WZR1 4WM7C 1AYN1 4GMP3 4Q4Y3 1POV1 4CEWC 5CFCC 1F2NA 2HWF3 1FPN3 1R092 1K5MA 1VBE1 1NOVA 1MEC3 3NAPA 4CDQB 5ABJC 2RS33 1RUC2 5AC91 1RUI1 1PIV2 4CDUA 1BMV2 5C8CA 3TN93 1NY71 1AR63 2R062 5A32B 1TMF1 4AEDC 4N43A 1RHI2 1TME1 1NCRC 5JZGC 5DDJ1 5L7OB 1X36A 2PLV1 4QPIC 1VRH2 1H8TA 4IV1B 4Q4Y1 1VBE2 3VBFC 1PO22 1PGW1 1RUC1 1AR93 1RUI2 1R1A2 2R072 1B35B 2HWD2 2HWE2 4N53B 3VBHA 3VBHC 1PGL1 1RUJ1 1A6CA 1RHI1 1Z7S3 3ZFEA 5BNNB 1E57A 1FPN2 5ACA1 2WWSA 1F8VA 4Q4Y2 1OOPB 4Z92B 3VBSB 4Q4X2 3VBFA 1BEV3 4GB31 2MEV1 2GH8A 2QQPA 4GH4C 2RMU3 4FSJA 3ZFFA 1H8TC 4AEDA 3DPRC 4JGYB 1RMU1 1BBT1 4EJRA 5JZGA 5C8CC 2WZR3 3TN92 2WS92 1RUD3 5ABJA 3NAPC 3JD72 4CDUC 1AR71 2IZWA 1AR82 1QQP2 1HRV1 1K5MC 1RUF2 3J8F1 1VRH3 2R073 2HWE3 3ZFGA 1RVF2 1V9U3 4YVWB 3M8LA 5CFCA 2RS31 5FMOS 4N53A 5BNPA 2WZR2 2XBO3 1MQTC 3VBRA 2HWF2 4CEWA 1RUG3 4WM7A 5FOJB 2X5IC 1NA1A 1TME3 1M06G 1AYM3 5FMOL 2PLV3 1ZBE3 5K0UB 1FOD1 1RUD1 1AR62 2R063 4WM8C 5D8AC 1VB2A 5C9AB 2RS32 1RUC3 1TME2 1VAKA 1QJU2 1C8M3 1Z7S1 3HAGA 1AUYA 1EAH1 1ZBA1 4Y4YA 4Q4V2 4RQPC 1VBB2 1D4M1 2R042 5J96B 1PVC3 1COV3 1HX6A 1ND2B 5CFDA 5C4WC 2RMU1 3VBHB 4CEWB 5CFCB 1FPN1 1W39A 1BBT3 1OPOA 1QJU1 4RQPA 2HWB2 1R082 5DDJ2 4YVWA 2ZTNA 2PLV2 1WCDJ 1ZBA2 1HQNA 4JGZA 4Q4V1 1VBB1 2R041 1ND2A 5ABJB 5BNPB 5BNOA 1HRV3 3ZFGB 1VBA1 1D4M3 2VQ0A 1H8TB 4IV1A 2R071 1BBT2 2HWC2 1V9U1 4JGYC 1X33A 2WS93 5DDJ3 4CEYC 5JZGB 2XBO1 5C8CB 4Y5Z0 4QPIB 2FZ2A 4PDWA 1RUF3 1HRI2 2X5IA 3VBFB 1K5MB 3J8F2 4RFT0 1FOD3 1B35C 4N53C 5K0UA 1VBB3 2R043 1DDLA 5BNNA 2RS12 2HWF1 2HWC1 1RVF3 1V9U2 4GMP0 2RM21 1PVC2 1NCQA 2TBVA 4BCUA 1POV0 2WS91 1C8M1 1BEV1 1AR72 1FOD2 1EAH3 3JB4C 1ND3B 1AR61 5K0UC 1EV13 1C8NA 1B35A 4FTBA 3DPRA 1PO12 4YVSA 4FTEA 4GH4A 1ASJ1 3NAPB 4CDQA 1AR73 2RR11 2HWC3 1ND3A 1EV12 1QJU3 4N43B 1D4M2 1C8M2 3J8F3 4RQPB 1QJZA 5A32A 1QJX3 3VBUA 1PO11 1RHI3 1OHFA 1ND2C 4JGZC 2BFUL 1NCQB 3JBG1
chains in the Genus database with same CATH superfamily
3B93A 2GC0A 2P34A 3UV9A 4DXTA 5A70A 1OT5A 3WNKA 4D6QA 4MGKE 2E32A 5FYSA 4D8MA 2OYZA 2WRAA 1JYTA 2X09A 5FY8A 1JTZX 3MLLA 1YNAA 4PDWB 4W6XA 5ISLA 1NY72 2A5ZA 4XACA 2C5DA 4KQ7A 4PJYA 4FOWA 1F4HA 3K51A 1W06A 1CIYA 1UMHA 2VTXJ 3BVCA 5LB6A 3D0SA 4ES9A 2XWBB 3T09A 1F4AA 3IZOA 4LO8A 3VDDA 4D7SA 4Y1VA 1DYKA 2XWJB 3I2IA 3OPZA 3PU8A 4CRQA 4JDMA 3WINE 1OLMA 1WUVA 4DPNA 3AMQA 1GWMA 5HCHA 3B02A 2MHFA 3O1OA 1QOTA 2E7AA 4XAAA 4A45A 2JG8B 2GNBA 2YY1A 3O0WA 1F5JA 3MHZA 4MOAA 2LRPA 4CU7A 1DBNA 1ST8A 4EZHA 3ROUA 2B9UA 1G9DA 4FPCA 4EN9B 1VBA2 2D98A 2RM22 4NWVA 1SLIA 1MS1A 4P5YA 5CFDB 1G9CA 4UF0A 1SDWA 2HH9A 1ENSA 4MGZE 4Q4V3 2WQ8A 4R9DA 5FZ3A 3PJQA 1CVNA 3VD7A 2WO1A 4AF9A 1DFQA 5BNPC 3ZSMA 2Q8DA 2PHRA 1PM7A 1Z78A 5FCCA 4K1ZA 2NM1A 3I2DA 4QQ2A 5LEKA 5BPXA 1XNBA 2EXHA 4JKLA 3N7KA 4XTMA 4ZXKA 2VZUA 3ZXAC 2R32A 1JYIA 1ASJ2 1UY3A 5FY4A 1DZRA 5KXDA 2OZ6A 4AR2A 4QU1A 4MXWA 3TN91 1XXNA 2FMDA 5C9AA 2YBSA 1RUE3 4OLLA 2XL9A 4I3GA 3N4MA 5F7UA 2ZHLA 1QQP1 2VOKA 3WNOA 4YW4A 3CHXA 2GALA 5F32A 2DUOA 3TNPB 4AI3A 4FXGB 3C7FA 5F3EA 3WDTA 1XYOA 4QPYA 3EHKA 4G9SB 1G8WA 2VMGA 1D4VB 2VVDA 4S2GA 2VQUA 5A7WB 2W5FA 3JBG2 4AVVA 2XVLA 2V5DA 4Z82A 4AI2A 1RUJ3 4BWOA 1UY1A 4QX8A 2GNDA 4V2VA 3RMXA 1CAWA 3M3EA 1V0AA 5DQ0A 1EV11 3VBUC 2WLQA 3KLSA 2O1QA 3S0MA 2JDKA 1MS3A 2ID4A 2Y6JA 4B1LA 1WW7A 2EIBA 3N9LA 5CISA 2EALA 3FMGA 3UKTA 1EY2A 5A6QA 4OYUA 3QH6A 4ORFA 2YGLA 3IIAA 2W1SA 5AVPA 4XDQA 3H0OA 2Q8OA 2Q1MA 4IUGA 3IDCB 2OT7A 3GZTB 3ZXLA 4HBNA 1GYKA 2P3IA 1YRZA 3MI8A 2Z69A 4XJZA 1HN1A 3LA2A 4H3WA 1AYM2 3URFA 2ZX1A 4JV4A 3IWZA 3VKLA 2ZKLA 2RM23 1YFUA 3NL1A 3THDA 1H1MA 5J09A 5I0DA 1UY0A 4M0HA 4IEPA 4AFAA 2DTYA 2C26A 4JDOA 1DIWA 4O65A 3DXTA 1DYOA 1UX6A 3HOBA 4KL1A 3T3YA 1HRI3 2ZGOA 3JQWA 3OB8A 2YZ4A 2WUHA 4BOWA 4C0HA 1DHKB 1YQ2A 1PK6A 4RHV3 1GU3A 3VL9A 2W39A 1VMHA 1XE0A 3POWA 3VBRB 1PIV3 5T3NA 2JDHA 1W9WA 3EJKA 1QQP3 5CKQA 3THCA 3W5NA 5JI9A 4PDWC 1PMHX 3AZXA 3ZYRA 3APBA 2RS13 3VDDB 3VKNA 1W0NA 2J1TA 1NQDA 3UGGA 5JIUA 3RRDA 5B4NA 2ZEYA 3LOBA 3ZSKA 3PDQA 2RR13 4ZKTB 2XBO2 4RSUA 1WLWA 5JI7A 3W21A 2VMEA 3LA7A 3I3EA 4JGYA 2B9VA 4AI0A 1QXPA 3PUIA 4R9AA 5BUVA 5JLVA 1MEC1 2ZJCA 2B39A 3GCXA 4QX5A 4HVRA 5J3UA 2QQNA 3B94A 2WFF2 1R083 3PTRB 4GB32 1ENQA 2VH9A 2EIEA 3LEIA 1YIPA 4I09A 4K20A 1RUH2 3D6EA 3OGVA 3Q8CA 3KS7A 4XF3A 2D6PA 4HVQA 2DVBA 5FYHA 1RMU2 1JU3A 3KCCA 1PVC1 3ZKYA 2WQ4A 4QQOA 4JVAA 1YJLA 3F2ZA 1JH5A 2XHNA 5CFDC 2CAUA 4W65A 3LPFA 1YFYA 3LB9A 1RL3A 5EJ3A 3HBKA 4AQ2A 4XDOA 5F2SA 5FY0A 1VBD1 4GIQA 1MPXA 3HNMA 3OCPA 4ATEA 5I91A 5L19A 4NPLA 5A3TA 3IIIA 2OVUA 4LBKA 4PI0A 4XCAA 2GH2A 4CCDA 2X8KA 2ES3A 4OQ8A 4P02B 2VW2A 5HPOA 4GWNA 4SBVA 4XQDA 5FKBA 2VZ1A 1DGRA 5F5IA 2EAKA 1KJLA 2XG3A 4YARA 3O5SA 4NIHA 3ZMNA 3ZX7A 2G19A 4E8DA 2P6HA 2EICA 2RJKA 2W68A 2VGDA 3GJBA 4R4XA 5AC93 1ZZ8A 5E16A 5H9SA 2Q1ZB 4FO9A 1H0BA 2C9KA 2XJRA 4U2AA 1RUF1 1S2KA 3B69A 3AKTA 3OBRA 5EP9A 4JX0A 1AR83 2DFCA 2P3KA 1PIV1 4JHZA 2MNGA 5F9TA 2FMYA 5CIRA 1O4YA 1IG0A 3L2HA 4XFBA 3IDEA 3CL1A 4FPOB 2BOIA 2Y6HA 1IPSA 2J1EA 2JENA 2WFPA 4Q4Y3 4GJZA 2TEPA 2R7EB 5D1IA 3N9OA 5EYYA 2HWF3 1WBLA 1XU1A 1JBCA 3AYDA 1S0FA 3MF6A 2PELA 3P5BA 5HCAA 2WR9A 1OLRA 1A3KA 1SCRA 3QOPA 2IVJA 1MEC3 2XLGA 2RS33 3L2YA 3HVDA 3MFAA 1UZWA 5DABA 2UYBA 4CDUA 4JZRA 1DGWX 1GZWA 2ZS6B 4XIOA 2D43A 1NY71 1AR63 5GZGA 1LEDA 1F5FA 1QDCA 3IMNA 4JRAA 1EP0A 4AFCA 4AEDC 1SBDA 1RHI2 1UMZA 3LEKA 3O7OA 1TME1 1O3SA 1QY4A 1W2TA 4C1WA 3OGJA 2BNOA 4Q27A 5FZCA 1W6PA 4LQRA 5L7OB 2BW8A 3FWEA 4WZFA 3I59B 5F3CA 2P3YA 1PZ7A 3K4ZA 1CAVB 5FZOB 3ZXFA 1CZVA 2PHUA 2VC9A 3VBFC 1PGW1 1IQDC 3AP9A 3PMEA 4PF1A 5JWPA 2R072 1O4ZA 3PUHA 5LWBA 5AFEA 1MS8A 3AFKA 4HKOA 2VJXA 4XXPA 5EIYB 3KSCA 3RVHA 1A6CA 2Y6FA 2IC1A 2DCZA 4QAWA 4EQVA 1HQLA 5GLTA 1E57A 1FPN2 3MF9A 4IE4A 1D0HA 5EXOA 1NX9A 5KR7A 3LEGA 1F8VA 3H3ZA 1DGWA 3AKPA 3GF6A 5I0UA 3FLTA 4QPWA 4Z92B 5FLHA 3BCWA 1BEV3 2LROA 3MIHA 4GB31 3K46A 1W6OA 3LKJA 5HCFA 5FPZA 5JXJA 3LQCA 2RMU3 1NYWA 4J1XA 3RMYA 1V6JA 2ARAA 4AEDA 3MFCA 1NQJA 4JGYB 1DLLA 1OPMA 4LHLA 2VOTA 5KXEA 4ZONA 2VNGA 1NE4A 3MO4A 3TN92 1DF0A 2ZCWA 3POSA 4KWKA 3I4IA 3JD72 1DQ2A 2IZWA 4XAEA 5FV3A 3UKNA 2CDOA 1QQP2 2XLAA 3DKWA 3IN9A 1W2AX 3H8RA 3N9QA 2DWRA 1HLCA 4FPGA 1JMUB 3KCYA 3FN9A 5A3UA 3W58A 4PIYA 2R073 4AG4A 2C1FA 2Z42A 4BZ4A 1OH4A 5FO8B 2OPWA 3KVBA 2KM2A 2RS31 4GALA 1JI6A 4OMDA 5BNPA 3AP7A 3T0DA 1ACCA 1QNWA 2ZABA 3LGRA 2LUWA 3MW2A 4CEWA 4EN6B 1RUG3 1WWYA 1IPJA 4PBOA 3KZ4C 5F8PA 5FP9A 4N9HA 4WM7A 5T50A 4ONUA 5C3RA 1NA1A 3TB0A 4IETA 1TME3 4P00B 2NYYA 4XUTA 1OFNA 1SLLA 1IKQA 2VBBA 5FZDA 3PHMA 2W91A 3K4AA 5CKMA 2JECA 3GZAA 5IVBA 3MZHA 1AR62 2YPDA 3H50A 1UU5A 4M4PA 1W9FA 2FQPA 3GZUC 2EXJA 4HT1T 2BU9A 1U0AA 4YM0A 5FYBA 3ES1A 4GULA 2OS2A 4AQTA 3BB6A 2ZGPA 1VAKA 3NJXA 3I49A 3C7OA 4XOGA 1EPZA 3H1MA 2CDPA 2F6BA 3FLRA 1AUYA 4WVMA 3GYDA 1ZBA1 4UW4A 3UGHA 5G05L 3O1RA 5LY1A 2XQXA 3C8XA 5I8SA 2VPVA 1SQ4A 1XOYA 3A7QA 3AP4A 3HBZA 5CFDA 1JYWA 5DAPA 4Y22A 5FWEA 3M3CA 4AVSA 2RMU1 4DFSA 1SFPA 1ENRA 1PMIA 1TZOA 4UBGA 3VZMA 1ULGA 3AYCA 1XE8A 3N7JA 4GWIA 3HQUA 4YVWA 1LNSA 2ZTNA 4YWAA 3H9AA 3WQ0A 2V09A 3KHBA 2EXKA 1PX4A 5A7PA 2ZHMA 2R041 3QH7A 4IERA 1W6MA 4M3CA 2IXJA 4GQ7A 2J22A 3ZYHA 4XF9A 4W6WA 1ZRDA 1H30A 5GALA 2C6SA 5HXMA 1I1EA 1ZM1A 4K3UA 4WVWA 3ZFGB 4MXWB 5A7NA 3AMNA 2YU1A 1S0CA 1WZXA 3I59A 2R071 3MV01 3AZWA 2BV4A 3WW4A 4A7YA 1W6PB 3RYPA 3T4VA 3PTYA 1N1YA 5DAQA 4QPIB 2PHXA 1UYPA 5JDBA 1RC6A 1RGSA 2P3JA 4PDWA 4CUCA 1Q8PA 4A3XA 4JDNA 3LSEA 2ADDA 2D93A 4R8HA 1Q8QA 1GOFA 4RYDA 1WLTA 2XLFA 3LSDA 2H0BA 4M01A 1PK6C 4PT6A 5F5QA 2B46X 1O3QA 2QQJA 3DECA 2ZHNA 1W9YA 5DUVA 3OOXA 5K0UA 1FI2A 1VBB3 1BKZA 2QQKA 2PN5A 5FKCA 2Y0IA 4XMIA 1OLQA 1UOFA 1RVF3 1J3PA 1VR3A 2HWC1 3BU0A 2BERA 1PVC2 2TBVA 4BCUA 4YW6A 4QGNA 2CU5A 4MV2A 4OHVA 4Q0PA 1FV3A 2WS91 4DQAA 4Y5SA 4QX0A 4TTGA 4KU7A 3TBDA 1T6GC 1P8JA 4O61A 4GD4A 3B3QE 1GNYA 1BQPA 1GNHA 3MLKA 5FREA 4H7LA 5B2GB 4YFWA 1RUNA 3DPRA 3R05A 5GLUA 4DUWA 3ZO0B 4K40A 1JZ3A 1X50A 3U78A 2JG8A 4JHTA 4WBBA 1C1FA 2NMNA 2HLEA 5AVAA 3OY8B 3H3LA 2XUEA 4LKFA 1LU2A 5JMOA 3WUCA 3ACGA 3WNLA 4Y20A 1H1IA 3S57A 1AR73 2OW4A 5FZEA 2XJUA 3CO2A 1PHMA 3N3HA 1HDKA 4MGIE 3O1VA 1D4M2 3GCWA 3I7DA 3J8F3 4RQPB 1FX5A 1O3RA 2VUDA 5KC6A 4GXLA 4NJ4A 3WNPA 4QDSA 1PO11 1JZ6A 1ND2C 2CWSA 4FFIA 1LGBA 2D6OX 4S2HA 1UIJA 5FXWA 3GNEA 1OUSA 2VZOA 2FBEA 5A7QA 5BXXA 4QXKA 5A7OA 4AE2A 5E6HA 1S4CA 3RJ2X 4BHPA 5CBLA 1WCQA 3LDBA 4ITCA 4B7KA 5LBEA 2MEV3 5IAXA 3THTA 3MLJA 5A7SA 3VBUB 5FYTA 1UZYA 3BTZA 1UYXA 5DUWA 5F6LB 4CCJA 1US3A 2CTVA 3VKOA 2WIIB 3WXPA 3S5AA 5C9AC 2EIDA 2JD4A 2WWJA 2IWGB 2V73A 1AL23 2YXSA 2RVAA 5L9VA 2ZEXA 2JDNA 3GBGA 2VOVA 2VM9A 3U1XA 4BQ4A 2Z2SB 1W8UA 1VPHA 2H0VA 3ZPYA 1IHMA 5FQ0B 1VRH1 4W4ZA 2P37A 2ZACA 3I2JA 2ZMKA 1PGW2 4B7EA 4CDXA 4Q4W2 4FXKB 4Y22B 5D8AA 3WSOA 1LGCA 3O1SA 2ARBA 3GXUA 3T1LA 5A33B 5LASA 1QJY2 1AF9A 2FDKA 5IK5A 2VUJA 2OPKA 4BIOA 2WSVA 1CJDA 2GP5A 4LBQA 1FMD3 2VTFA 4YW7A 1QJX2 3PUSA 4IGPA 4IE5A 1EUTA 4RR3A 4GMP1 4AL9A 1GP6A 3MIFA 1UX7A 3I3BA 3E6BA 1K12A 2CY6A 1MQTA 3SLIA 4AK3A 5JOZA 1H1AA 2I07B 4Z07A 2CAVA 4KWUA 5FYIA 4YSFA 3OBTA 5A3OA 4DNYA 4NIDA 1ZZ9A 2A3XA 2VMFA 2NZ9A 2GSYA 3DYPA 3ZFGC 1HV0A 1AL22 1GZCA 1SZBA 1VAVA 1VBA3 2JWPA 1MZFA 2QZ2A 1XYNA 3TRSB 3VDDC 3VZJA 4CP9A 4Q0SA 2RS52 4QPGC 5IK7A 3LEMA 2BQPA 2XKOA 3D3AA 4JTOA 1RUI3 3B00A 4HN1A 5HV4A 4L0PA 1G86A 1KDMA 3K2OA 4RS5B 2YYOA 5D21A 4ES8A 5BYNA 1T6BX 4DY5A 2RJ2A 2RR12 4PLMA 1B09A 3JD71 3ILNA 3USUA 4BMBA 1APNA 1QNYA 4KWLA 4FP3A 1JOJA 2BWAA 4PIXA 4EN7B 3BU7A 1HXS3 1COV1 2EVXA 3UT0A 4P9IA 3HR9A 4RN5A 4BYYA 4CDWC 2D6LX 1NKGA 4TSVA 4B29A 1OD5A 2UURA 1AJOA 4IEYA 4COWA 4XCBA 1NZIA 2VAUA 2RDRA 1GV9A 1UWWA 1J58A 3K4DA 2SBAA 4RHV2 4U36A 2DVAA 4D69A 1AR91 3HN3A 1GLHA 2NQYA 3BGAA 3FBMA 2WKKA 1ULPA 1I6XA 4K7JA 4LO5B 1AXKA 1XNKA 1XNTA 1GICA 2YC4A 1CJPA 2B5HA 4XHXA 3ZFEC 2J1AA 2VOXA 5EWSA 2VZSA 3VBOC 4L8QA 4X8NA 4XIKA 1W6NB 1XSQA 1HB3A 1ND3C 2UY8A 3I2KA 4LOTA 1W05A 3G7DA 1YQ8A 3DXUA 2BNNA 3BYWA 4TWTA 2A70A 3WG2A 1U12A 3DL3A 5FP4A 4KGGA 1W6OB 1LOAA 2P4EA 3SMHA 4HKLA 3WNMA 4ISRA 4CZSA 1MS4A 5A3WA 4A3ZA 1RXGA 2WZ8A 4AEDB 2ORXA 1U5ZA 4JKKA 5LBFA 2DVGA 1GANA 4QPIA 5DAVA 2V4VA 5GZFA 3WCSA 4MUVA 3FL7A 2OUJA 1RUG2 1LU1A 3BTAA 5FPBA 4AGVA 3ZSJA 1W8TA 3B5LB 1UO9A 2DDUA 5SV8A 2VCMA 2E6VA 2PFWA 2GP3A 3ZPOA 5AC92 4BMEA 5K8SA 2ZX0A 3GDBA 4LXLA 5I0TA 2JDPA 4UFIA 2ARXA 3VLBB 4GJYA 1SMVA 1AHSA 4NWWA 3A0NA 5A33A 1TMF2 1SLBA 1ULFA 4BLIA 2RMU2 2E7TA 1JZ7A 4YZ2A 1NXMA 2VE1A 1S0GA 4LUKA 3RDIA 5I8TA 1W99A 3H8UA 2GN7A 1H9WA 2VXJA 5BNNC 2JE9A 1JODA 2EF6A 1LEMA 2UWCA 5L7OA 1W6QB 4LBLA 4QKBA 3K75B 1H2LA 4AFMA 5FLIA 4EN0A 2W46A 1RTVA 4AGRA 5FZ7A 1OOPC 1X8EA 4E2QA 1AYM1 1HXS1 1YJKA 1CAXA 2DURA 1ZBE1 1X8MA 3VDCA 4DEQA 2WO3A 2G9GA 1RUJ2 2C9AA 2R061 1MZ6A 5GKAC 1POQA 4XFCA 1NCRB 3J7LA 1DQ6A 3QLQA 3FHQA 3NKTA 3R6SA 5FY7A 5C71A 4L11A 1VBE3 4IEZA 4IV1C 4RFRB 3CQOA 4RS5A 1QJX1 4ISQA 3ZYIB 2YROA 1BK1A 1GZWB 4XBQA 1J1LA 1HRI1 3GHMA 3N35A 4NRPA 5BNOC 4YW2A 4OZXA 3FLPA 1R1A3 2V72A 4IEWA 4NO4A 4ATFA 4HONA 3B7MA 2ATFA 1UQXA 5GJ6A 3NVCA 4I30A 3OBZA 4LBQB 4RR3B 3M70A 4NHXA 4LA2A 1UKGA 2G1MA 2YBPA 2YDEA 4HSLA 4AQ6A 2PAEA 1WMFA 4F3JA 2RS11 4QHOA 1W9SA 1UU4A 3OYWA 1CD3G 2VCAA 3NRUA 5F5AA 1A8DA 1ZREA 3N9MA 3VHNA 3VBSC 2QQOA 2R30A 5E88A 2ZZJA 3NNMA 1UYYA 4Q4X1 1UN1A 5K7PA 4W50A 5E1RA 1RYYA 5IK8A 2OA2A 4HN0A 5F2WA 2BPA2 4UFJA 2ILMA 2WAAA 2QQUA 3HT1A 4FFGA 1N1VA 2VW0A 4IV3B 2O14A 4Q29A 4XHBA 3VD4A 2A1XA 4V1PA 1NZCA 5JOXA 3USUB 1HJGA 1QF3A 1H8VA 2JX9A 4K6BA 5CZKA 3MV11 5IVJA 1CIWA 2WZEA 2XB6C 4BK4A 3AMPA 3AYAA 3ETQA 1VBD2 2AACA 3FFQA 3KCXA 1JXNA 3K77A 3C7GA 3J7MA 4HK8A 1HW5A 1CZTA 1Y9GA 2RS53 4MADA 3UKVA 4D94A 5AFBA 2QDNA 3VUOA 2PAMA 5FY1A 4F83A 4N90A 5HXVA 1POV1 4OUEA 1SBEA 1RIRA 5F3GA 4Y5TA 2RDSA 3MW4A 3E6CC 3LAGA 1CGPA 2HYKA 1R092 4OUSA 4E4HA 1VBE1 2UU8A 1LHVA 2VTXA 3MUY1 4B4RA 2HJIA 3OUIA 4G3YC 4XF1A 5DUXA 3Q8FA 4FCAA 4YW1A 1S0DA 4CDQB 4BISA 1J83A 1RUC2 4TN7A 5A3MA 5AC91 4FQZA 1PIV2 3TEYA 5IVFA 2R1DA 3TN93 3V0AA 1O5UA 3FUQA 3RZZA 1DZQA 2JDYA 4KG8A 1C3HA 1XBFA 2VZ3A 4XFIA 1TMF1 3SQOA 3VGIA 1V00A 4QQLA 5FYYA 1GKBA 4N43A 4LR4A 1N1SA 2P17A 4PQQA 4D7YA 4DY3A 5FZKA 2GMEA 1OQDA 1NCRC 2J1SA 5JZGC 3BKZA 5DDJ1 1I9RA 3N9NA 4LBJA 3P3PA 2PLV1 5F39A 5JVVA 1VRH2 4CU8A 1H8TA 4GWJA 1QGLA 4KBZA 4Q4Y1 4BA6A 1OA2A 4JQTA 1LHOA 5FOBB 4IEUA 2B8MA 4MVTA 4ET7A 5I0SA 5L9BA 1N3OA 1W6MB 1PK6B 5LY2A 3WEZA 4P5HA 2AC1A 3AYEA 4RGGA 3QD6A 4CXXA 1B35B 5FZ4A 1W8OA 2HWE2 4COYA 2ZMNA 2BGCA 4B1MA 1RUJ1 3GBFA 3H42B 1KEXA 1LULA 1RHI1 4FPJA 2W1WA 1JZ4A 2VZRA 5LRRA 3S30A 4LHSA 3O0VA 5A6YA 1JYCA 3T2OA 3MUZ1 1OA4A 4NHLA 4JAAA 4PIZA 1C28A 3ELNA 4DOUA 1OOPB 5FY9A 3WP3A 1YUDA 2GH8A 3KGZA 4WVMB 5IFPA 2W92A 3H7YA 2NP0A 3RJRA 2V4AA 4RGAA 2XDVA 3ZFFA 4KU8A 1SLTA 3MGUA 1RMU1 4DXSA 4EJRA 3RZLA 1LESA 3L9JT 4NAMA 4AVTA 3MW3A 3EBRA 1Z0HA 3BTYA 1YEWA 1WMEA 4Y1ZA 5ABJA 4PBPA 2JDUA 5FK8A 3SITA 3WF2A 1CPNA 4COZA 1DQ0A 3HNYM 2Y0OA 5T55A 1RUF2 1AX0A 1QOSA 4HK9A 1IS3A 5L36A 5EYXA 3TWIA 1WLCA 1X7NA 4FPEA 2HWE3 1CAXB 1V9U3 2DUQA 4IXLA 1HV1A 4YG6A 2QQLA 5E8AA 4YVWB 2Z79A 4N53A 1O8PA 2HEVF 4XBNA 2WZR2 5IW0A 3O1UA 4CUGA 3UJQA 3RWKX 1MACA 2XJTA 2K2SA 3THPA 1XU2A 3W5MA 1V6IA 4JCKA 4NHMA 4EE2A 3AP6A 4ZS3A 3ZN6A 4I2OA 1AXZA 4C1XA 2GU9A 2WABA 4FPLA 1LOFC 4DIQA 4URAA 5DN2A 1LGNA 2PLV3 2KR2A 3WVJA 2ZGSA 3OTFA 1ONAA 3TEWA 4AW7A 4MLOA 5FFOC 2W52A 5C9AB 2WN2A 4AI1A 1NLSA 3JZVA 1GQGA 1ULDA 3CJXA 3QBQA 3RQ0A 2FDGA 3QCWA 5T5OA 2Q1FA 3WNNA 3CF6E 1UF2C 3OJBA 2FDFA 3EMRA 3O1MA 4MO3M 4OHWA 1TQ5A 2VUCA 2H6BA 2E63A 3P6BA 4RQPC 1XPWA 1VBB2 1WMDA 4QB2A 1VE0A 1XJAA 1F31A 1PVC3 4QQPA 4FOQA 2Y33A 1F9KA 2VBDA 1AZDA 2AYHA 1NLQA 5CVRA 5C4WC 1J1TA 1PNGA 3M4FA 3OGGA 4A41A 4FPFA 1FPN1 4UT5A 3T08A 1OPOA 1QJU1 5K4LA 3AXEA 1HIXA 5DAWA 4XQWA 4Z8BA 2PLV2 1M4WA 1ZBA2 2YPJA 2A3YA 1WW4A 4Q0VA 4Q4V1 5T54A 2DV9A 4FI9A 1LJ7A 2VQAA 3ZVXA 4CXWA 4NVPA 1H8TB 2WT0A 2JIGA 1BBT2 3N36A 1V9U1 2PXJA 3WLUA 2XJVA 4CEYC 4CXYA 5JOWA 2VVEA 4R9CA 5C8CB 4Y5Z0 3FX3A 3I3MA 4YFZA 5DG1A 2IXIA 2TNFA 1RUF3 4FP2A 4Q2FA 1HRI2 3R4DB 2X5IA 2JICA 2Q8EA 3ZMOA 3EO6A 4L2NA 4NPRA 4A7KA 4DZGA 3LDRA 3NO8A 4BE3A 4TLGA 1OC1A 1OI6A 2EXIA 1B35C 2QQMA 3WNXA 4UW3A 1SFYA 2R043 2RE9A 2OZJA 3AK0A 2OQ7A 2RS12 2HWF1 1CAUA 1O7FA 5J37A 4MG2A 1FNZA 4CCEA 1NCQA 1MZEA 3FHAA 4Z2WA 1UMIA 1WD3A 4LBQD 4NOTA 2ERFA 2ZX2A 3NV3A 4JKMA 3WZ1A 3PNAA 1H2NA 2VCCA 4L97A 3TEXA 4CTEA 2YB7A 4MXVA 2YFZA 5FYUA 1AR61 3WQ1A 1EV13 1C8NA 2D5FA 2PTMA 2Y6KA 3BPSA 4Q0QA 2XJSA 5FIXA 3DV8A 4O9GA 1ZVFA 4FTEA 4GH4A 2WDBA 3UGFA 3OF1A 1MZ5A 1FAYA 1ASJ1 2CWMA 1ZZBA 1X9PA 5EJ1B 3WHUA 1XC6A 5FZMA 5FO9B 3O14A 3PVEA 2HWC3 3ATGA 3W59A 1UPSA 3ZDSA 4DINB 1QJU3 4N7IA 2A3WA 4LIUA 3KT7A 4MGQA 5FJKA 2XJQA 4LKEA 2VZPA 5KXBA 3ALQA 1HQWA 1HN0A 4CE8A 4Q5OA 5FZAA 3DUIA 1GMMA 3ES4A 4Y1YA 5JR2A 4CCNA 1OHFA 5H9RA 1KQRA 3M3QA 4X6QB 3CKHA 2IFWA 4LLOA 5FXXA 4B3NA 4JGZC 1W3VA 2Z5WA 2Q0AA 5FY5A 1WCUA 4AEJA 3IPVA 3V0BA 4Q8LA 3JBG1 2AREA 4YGCA 2JD9A 3POIA 3CZUA 4L9BA 5EFUA 4BK5A 4LO4B 4IDZA 4XJ8A 3AC0A 2R6QA 4LKDA 5T52A 1YFWA 3WW2A 2HWD3 2ENRA 3FE5A 5D8AB 5J1XA 1W2UA 4D0QA 2QKDA 4PLNA 1WMXA 1N3QA 2JB8A 1NG0A 3TYJA 3X29B 3POGA 4TLFA 4DEVA 4ZHNA 4IV3A 2WT2A 4JRLA 4QX1A 4YGEA 3TNQA 2BGOA 1QXRA 2Y60A 3MDPA 5I0RA 4YLZA 1W2OA 4AXOA 4AVBA 2B7YA 4OULA 4BQYA 2ZX4A 4YG3A 1PO21 4J6GA 1KD7A 4XUPA 4BU2A 5T5JA 5BNOB 1MS9A 4GZ9A 2VOWA 4WM8A 5IFTA 2NMOA 2E9QA 4QM9A 4XBLA 3PMSA 3VDAA 1JUIA 3Q8BA 4WV8A 1GOHA 1MVEA 3CJIB 4I3PA 1S0JA 4XFFA 2ZMLA 3NNFA 5DAXA 1W90A 3HQXA 3KB5A 1GFF2 3KV6A 4C91A 4UFHA 1PVXA 2WO7A 2XQRA 4QKFA 5I8YA 4UW6A 5FDBA 2ORZA 4YG0A 4UYBA 4LLFA 4OMCA 3FBYA 2YMZA 1F15A 4PI2A 4A42A 4XURA 1V6LA 1WD4A 1WCKA 2X53S 4Q4W3 4S2FA 1Y7BA 4XFHA 3VBRC 3NV2A 4MHUA 2A73B 3SEPA 3ZYFA 4W8JA 3ZN4A 3DYOA 1LAJA 4LUMA 3WG3A 2XOMA 1IS4A 1FMD2 4QHBA 2ETEA 4UAPA 2R1BA 1QEXA 4CEYB 4IV3C 2JG9C 2UYAA 1W8FA 3A21A 4LPLA 3VD5A 3RZJA 3VZOA 4P9LA 3E1F1 3H8OA 5CA6A 1YYNA 5IVYA 1AL0G 2HEYF 1J3QA 4QWNA 3MIBA 1OMIA 3ZXEA 4AQSA 4Z1VA 1L3JA 1VBC1 3CBNA 4XFAA 4LEJA 4META 1QJY3 3JU9A 4WZCA 2OIIA 1OUXA 4DRVA 1NUKA 4OI1A 3ZR6A 2CYFA 4NR1A 5FRAA 1US2A 4RA0A 1RUE2 1W03A 2J7MA 4ZZ5A 2BOJA 3E97A 1MS0A 1OVPA 2WNVC 5F37A 2BGPA 3IAPA 4FVVA 4XETA 4BQWA 1K5JA 2NLRA 3I2GA 2HBTA 1E5SA 4IL7A 4COVA 2FDJA 3ZYPA 5ACA3 2BUKA 1O3TA 1FATA 3OD0A 4HSJA 1ZRFA 2EIGA 2L9LA 4CDQC 5GZCA 3NJVA 1PO23 2HEWF 2XPJA 4KNCA 1REEA 5FMCA 5F6KA 3BN6A 3VHOA 2W1UA 1ZA4A 1YCIA 2WYFA 4H7MA 3VKMA 1NXD1 4CYDA 3A23A 1S0IA 4NIAA 4YVSC 3PL0A 1WGPA 2E51A 1ULOA 1OF4A 5A6ZA 4COUA 2YC0A 2WT1A 3HT2A 1IZ3A 1L7RA 1UY4A 4MH0E 4P9WA 1QIQA 2W08A 4A44A 3H8XA 4O9EA 5LA1A 1LKNA 4Q4W1 5GZEA 1WA6X 2DCTA 3CJIA 4HANA 1K3IA 1NA1B 1OF3A 3N7LA 4HVOA 3SKJE 5CG9A 2VZQA 2PHTA 5JPNB 3CJIC 5H9QA 3LD8A 2WNUC 3POYA 1AYN2 1NCQC 1CX4A 1UOJA 4N7UA 4XDPA 5A7WA 3ZXDA 4BDVB 4DB5A 1AVBA 2DCYA 3K3NA 3KT4A 5T5PA 1I5PA 2CSGA 3C3VA 1L7LA 4INDA 4BQ1A 5JSRA 4LT5A 3POBA 1QXJA 2QVSB 2D6MA 1XSRA 3IMMA 2VMIA 4KI5M 3PUQA 4R4ZA 2F17A 3ZXGA 4IEOA 5FZFA 4CPBA 1W0OA 4XUQA 4Y26A 5ANNA 1H2MA 2JB4A 1FV2A 4IEQA 1TVGA 2IXCA 4H14A 3ILRA 1SLAA 3KQRA 4GB33 3ZIWA 1UAIA 2UY9A 1VBC3 4GH4B 4FFHA 5EPAA 1QJY1 3RZMA 4LO6B 2BVBA 3VHPA 2HBUA 4UOJA 4CEYA 5C5UA 1HKDA 2A6ZA 2OUHA 3SEEA 4M3CE 3WDWA 2XVGA 1C5HA 2E31A 3LPGA 3E5UA 4IE7A 1C57A 4AHWA 3E5QA 4LITA 1H4HA 3RZHA 4CP1A 4A6SA 1W3XA 4CDUB 2WNVA 1PO13 1ZX5A 4HLTA 1UYZA 2A71A 4G4FA 1HXS2 2WLPA 4J25A 5J48A 1KXGA 4D7TA 2A6VA 3RS6A 2WYSA 1PM4A 3FUOA 4LO7A 5C6CA 1WLDA 4DUXA 1MR5A 3VZKA 3CEWA 5BY5A 1DCSA 1DYPA 2CNAA 3VHRA 5CG8A 5C4WA 3KF5A 3I54A 2X5IB 3NW4A 4XILA 1YO8A 3U14A 2WWUA 2CGPA 2VXRA 5FWJA 1QMJA 1XNCA 4LORA 3VBOB 4CDXB 5C70A 5FQ0A 5J98B 1NT0A 2Q5TA 4LHKA 4OVEA 2GNMA 2W3JA 2ZHKA 5I93A 1AYN3 1OVSA 4XQ4A 1ZRIA 5JSPA 4WM8B 4CUBA 2IUWA 1LR5A 3DPRB 4QQHA 3TAYA 3D0JA 4AEMA 5IATA 1XE7A 1GBGA 3H7JA 3UK9A 4BPZA 1W9TA 2I2SA 3NV4A 5CYYA 1RUE1 1AR92 3K48A 4JC1A 2ZPXA 1OBNA 1G7YA 3C7EA 4NAOA 3WR0A 2W94A 3N7MA 1JOPA 1Y43B 2QE3A 3Q8AA 1SPPA 1K45A 2DF7A 2BWCA 3WF3A 3EXUA 3WV6A 1UOGA 5JPMB 3V64A 2YUEA 1QDOA 2H6CA 3MYXA 4QX2A 1W28A 4LMFA 5FP7A 3GZEA 4XW3A 1XRUA 1DU3D 3ASIA 3KGLA 1CR7A 3WP5A 3BALA 3BI3A 4Q4X3 1GP4A 1G6NA 4MHRA 4GMP3 4EV0A 1O4TA 3CZJA 5CFCC 5LRSA 4NHKA 1R1ZA 4LK6A 3WP4A 1DGLA 3DN7A 4P14A 4XJAA 1GP5A 4UFLA 3ZM8A 4MX3A 4CCCA 1K5MA 2GNTA 1NOVA 4XFGA 4XJWA 3W20A 4NIGA 4CU6A 4AOCA 2XKPA 3LA3A 1LTEA 3NAPA 2DBNA 4I0BA 1RUI1 5FUIA 5L73A 5FMBA 2J1VA 2QJVA 2WL1A 3OUJA 4LA3A 3UJOA 4K9SA 3ZYGA 5C8CA 1V70A 2R062 3N9PA 5A32B 1PMJX 2D44A 5D2AA 4OHXA 3NKGA 1HB4A 4GKYA 4Q0UA 3ECQA 3MEPA 1V6KA 4XE9A 1XNAA 3VZLA 2E26A 2GDFA 2RV9A 4IV1B 5GM0A 3WT3A 1SACA 2DVFA 3HPNA 3J7NA 4N8MA 1VBE2 3OY8A 1EUUA 4YRDA 4S2DA 2W2IA 2XH6A 1PO22 2P1BA 4SLIA 2W87A 3HMYA 4PF5A 5LBBA 3WDVA 4IE0A 1AR93 3OBAA 4M0NA 4HPKB 3T0AA 2WC2A 1R1A2 4CVUA 3LF7A 2K0GA 3IM0A 4GKXA 1KGYA 4OI2A 3VBHA 4TZDA 3VBHC 3OD4A 4XZPA 1Z7S3 3CMGA 5CKNA 4AAPA 4AZZA 1UZVA 1JYNA 1VMFA 5BNNB 2BNMA 3O0XA 4YZ4A 1O5LA 2QUOA 4KH9A 3SCHA 5SV5A 3WW1A 5FPUA 4ZPIA 2YU2A 2AZ5A 4CPBD 1ODMA 4BXFA 4A7ZA 3ZXKA 2QQPA 3KV5A 1RJ7A 2PQSA 1YQ5A 4GH4C 1O59A 1H8TC 3NV1A 5JXIA 1CN1A 1I5ZA 1KJRA 3H3UA 3ZDVA 4AFDA 4CP9B 1LHNA 2JKXA 3I97A 5FP8A 5JZGA 1W8NA 1EPWA 2R16A 5C8CC 2RG4A 3CNAA 3AKSA 3EB7A 2BP6A 2FDIA 4ZU7A 1RUD3 1OXCA 3NAPC 1VMJA 3ON7A 4JQRA 5KHHA 1LCLA 3AKRA 2LM3A 1AR71 1VALA 3Q9OA 4EWAA 1HRV1 5FPVA 1K5MC 3T2TA 3NJYA 5FXVA 3POEA 1GZ9A 3J8F1 4DS0A 4MYEA 2O0OA 5EQUA 4ZZ8A 1IOAA 5CFCA 3IDBB 1S0EA 4YZ3A 1FXZA 2QTWB 5FMOS 4FAHA 3SISA 3VBRA 5JXHA 2BRTA 4OZOA 3BODA 1A34A 1UXXX 3WG1A 5FOJB 2X5IC 2WSUA 2BJSA 1AX1A 5IK4A 3ACFA 1Y4WA 1CZSA 1AYM3 3HNBM 3VD3A 1WW6A 1ZBE3 5K0UB 2A7AA 1QKQA 1FOD1 1PNFA 2CHHA 3PVNA 2YGMA 2PMWB 4XXAA 4OUMA 2R063 1Q5OA 4WM8C 2GC3A 2DBIA 3U10A 3UYJA 3ACHA 1D2SA 3MICA 2XGXA 5ERLA 2RS32 4XC9A 4LK7A 3ZR5A 1PGSA 2ZGQA 4HFSA 1TME2 1WW5A 4YNIA 4HETA 1C8M3 1Z7S1 5C3OA 5TSWA 3HAGA 3BTXA 2KA3A 1EAH1 1UU6A 2QQVA 2B45X 4Y4YA 4E4DX 3R4SA 1IKPA 3AZVA 3JUUA 1VAMA 3U37A 5KHJA 2R042 1D4M1 1UPIA 5IYYA 2YC2A 3ACIA 3VZNA 1Q43A 5FXZA 2W9XA 5HI0A 1HX6A 1ND2B 1XB9A 3LCPA 4UFMA 2B42B 4QX7A 1UY2A 4NUBA 3RI8A 5JIAA 4I02A 3VBHB 1Q8OA 4CEWB 5CFCB 4XTPA 4CCLA 4RQPA 3PVOA 1TEIA 3AZYA 1R082 5DDJ2 4QDQA 2DTWA 1SPPB 2AENA 1HQNA 5A1LA 4D6RA 4JGZA 2K46A 1LOGA 1UIKA 3RFRA 2W95A 3AJYA 3E6DA 5BNOA 1HRV3 5BNQA 2NN8A 4YGBA 2CGOA 2KD7A 5EHDA 1VBA1 3WX5A 3TEZA 3PU3A 1JN2P 2AR6A 4IV1A 3OGSA 5HBAA 1ODNA 2HWC2 4K1YA 2IVIB 1X33A 4OCTA 1Y3TA 3RWNA 5JZGB 2JG9B 2R49A 1JU4A 4UI9L 2A6XA 5JCTA 1W2NA 3ZSLA 4RL7A 4P9JA 5FYZA 4ZY9A 3LFMA 5IWFA 3VBFB 4C90A 2B4KA 4A2UA 4NRMA 2ET7A 3WQ7A 2G9FA 3ZYBA 2ZEZA 1LENA 3ETPA 4UW5A 1S2BA 1FOD3 3ABZA 4N53C 3T2QA 4XYXA 2VULA 1ZRCA 3M7AA 2WO2A 2R0HA 2WNUA 3OGRA 1DDLA 5BNNA 4QGLA 2I45A 4A6OA 4DXRA 1V9U2 2RM21 2GMMA 4OI0A 2N7GA 4YW3A 4Y24A 1WCSA 5CB7A 5DPNA 4Q8KA 3OG2A 1JYXA 4BXSV 1UZ0A 1C8M1 5IT6A 1BEV1 4ZXEA 4Y1XA 1AR72 4FQ4A 5CAZA 4HZFA 3R0RA 2VMHA 1EAH3 4HOOA 1UL9A 3JB4C 1ND3B 4QX3A 1REFA 4XZUG 5KXCA 1B35A 5C8WA 3U75A 4MZUA 3AVRA 4BQ2A 4YVSA 1BXHA 4BH9A 3LIGA 4Y20B 5FZGA 3WUDA 1D7PM 4I0AA 1KFUL 5KHGA 3KV9A 3IT8A 4Q1PA 2QZ3A 1F35A 4LTAA 4P9XA 1BVVA 4D3WA 5C33A 3MBWA 3GALA 2Q30A 5KBFA 4CDQA 2DU0A 2RR11 3GGLA 1SCSA 2W47A 1T2XA 3D5OA 1EV12 4B8EA 4BLJA 1QU0A 2VQTA 1TG7A 3RNSA 4ASMB 2WBKA 2WNEA 5A1FA 1VIWB 5IAVA 5FPXA 1KS5A 2DFBA 5FYCA 2Y38A 4HMZA 5GZDA 1RHI3 2X05A 4FBFA 3I2OA 1NE6A 4M00A 3VV1A 1BK0A 3B01A 2WZPP 5FZ6A 1DQ4A 3TOJA 2Y64A 4CA9A 1X82A 1Y9QA 4C0BA 5FZ8A 4XF0A 2EAAA 3S7EA 4YM3A 3ZIXA 1SFNA 3SH3A 1QH7A 2K9ZA 1ZYBA 1LODA 2DCKA 1ASJ3 1V6OA 3DGTA 2VZVA 1D2QA 4YZ5A 3T1MA 4YPJA 3EYPA 2RHPA 2Y26A 1ENXA 4CP2A 5LA0A 3LOIA 4W6YA 4CDWA 1H2KA 5DMYA 3S6PA 2D6KA 1EYBA 2BFUS 3HQRA 2AEYA 2BVVA 1SG3A 3BUCA 2ZGNA 2DUPA 1LRHA 3U11A 4ASLA 1BMV1 2JG9A 4KBBA 4IE6A 1O8SA 4E4SA 2ET1A 2GAUA 4LNVA 4Y3OA 4B4QA 5KWRA 4YVSB 1QJEA 1QOOA 1LOEA 2PYTA 1C4RA 4OHYA 4TXWA 1W6NA 1YWKA 2F4PA 3JXSA 1E5HA 2JIJA 2D40A 2DVDA 2NPIA 2O8QA 4QPGA 2ZKNA 5J36A 5B4XA 5IVVA 2PA7A 2YFUA 1OKOA 3JBG3 1WKYA 4YM2A 2X10A 4BQ3A 4XUNA 3ZXJA 1QJFA 3Q8EA 1R1A1 2Q4SA 3RSJA 5FPAA 5T5LA 5C4WB 4RR3C 1PGL2 2JE7A 4P08A 2HWD1 3J4UH 4D6SA 3DEMA 3USSA 5ACA2 3HN1A 3I3QA 4LBNA 4NPMA 1HJFA 2A6YA 4CP0A 3OSDA 1YI7A 1XNDA 2VNOA 4QXBA 3J26N 2VG9A 4C8DA 4EWEA 2WFF1 2WA4A 3BPZA 4O7XA 4CDXC 3U4SA 5FP3A 5JAXA 2VL4A 3AX4A 4FTSA 1UZZA 2ZAAA 4A4AA 4UXAA 1V6NA 2MEV2 4V2WA 4Q26A 3C2UA 2JDZA 4FOYA 3WQBA 2ZEWA 4NRQA 4BQ5A 5HV0A 4AEKA 4LE3A 4I01A 2DCJA 2PAKA 2WNOA 4YM1A 2FZ1A 5GLZA 1YHFA 2IXLA 5FBJA 2Y6GA 3LE0A 4AI9A 3PURA 5GLWA 3RZKA 4CCKA 2CGNA 3VBSA 2D6NA 3LDKA 4ARYA 5FZBA 5LK7B 3RYKA 3SNMA 1N47A 3IB3A 3MPBA 1RUH3 2JEMA 5JSOA 2BBAA 3AM2A 4PCRA 2BZDA 3SH4A 1HRV2 4IGOA 3ZFFC 4NN0A 3KWVA 1SBFA 1BHGA 3S7IA 2XHKA 1VB4A 3ZOIA 1TE1B 3JB8A 1E5IA 3A4UA 1WA4A 1RVF1 1YQ6A 2RS51 1GR3A 3NJZA 3PJYA 4FPHA 4Q1RA 1CPMA 1R64A 2BEOA 4HPKA 5FJHA 4AYUA 4EWDA 3RI9A 1UNBA 1UW8A 3OEBA 2YBKA 2QDRA 3AJZA 3FHIB 3SCFA 1POV3 3VN4A 3H1YA 5FZOA 3ME2A 4LIVA 1CX1A 4QB6A 2P5BA 5FO7B 1GQPA 4AFBA 3UETA 1RUD2 1COV2 3QACA 2VCBA 4AVCA 1LOCA 1VP6A 2XUMA 2UWAA 3DCQA 1XQNA 3INAA 2ARCA 4PQ9A 1UXZA 3NNJA 4XABA 1G9BA 4E2SA 4XMAA 4IW3A 3UNPA 3IKWA 1UKRA 2WJSA 4RHV1 3V65A 1JZ5A 1OOPA 3D82A 3NWKA 1TMF3 4OFGA 1Z7S2 3HIFA 2QFEA 4K8RB 1NCRA 2J1RA 2XMLA 5L7OC 2FCUA 3K3OA 1ZZCA 3HD8B 4N43C 2O8OA 1U5IA 1Q8VA 3AMMA 5M0TA 1EAH2 1ZRRA 1D0GA 2OXBA 4CCOA 3I3DA 4CCMA 3PIJA 2ZGTA 2WFF3 2BTVC 1GOGA 1CAWB 2WAOA 1GZTA 4MGYE 2A6WA 4E27A 1ZBE2 2MPFA 1CESA 3ZN6B 5E89A 5IVCA 4JGZB 2FCTA 4WM7B 3ITQA 1UD1A 1W6QA 4EYUA 4XJ9A 2GC2A 2LALA 1OFSA 1R093 1JW6A 1U5YA 1R081 2HWB1 2GZWA 1CQ9A 3KD4A 1MEC2 2VUAA 1RUG1 3A0KA 3LZZA 4QXCA 5LZ6A 3AL6A 5LEJA 5FZIA 4PLOA 5FR3A 4FPYA 5F3IA 3RG0A 3OPWA 3ZLIA 1GWLA 1BZWA 3RGBA 1AL21 1RUH1 1YC61 1WBFA 2C24A 4AVAA 4M3CF 5FYVA 1ALYA 1S2EA 1SEFA 2AEZA 4MGSA 5DZGA 2AH2A 4QPGB 2ZZQA 3P3NA 3WDUA 2QNKA 3GHNA 4GAZA 3U07A 5C3QA 5JMCA 1YIFA 2J42A 1VBD3 1RMU3 3AMHA 5FYMA 3ZYJB 4Y4RA 1KITA 2VY0A 2QCSB 3M3IA 3WF4A 1MVQA 3AP5A 3T30A 1W0PA 3VBOA 4AGGA 2BBVA 1LB2A 1RB8G 4F8AA 2WA3A 4ASKA 2D3SA 1OH3A 2I74A 3CIHA 4IGQA 5EJZB 1Q3EA 4TYSA 5DXDA 4HXCA 5JUVA 1REDA 4NROA 4KMQA 1ZBA3 4CDWB 1HB1A 2EA7A 2ZX3A 2ZXQA 2XVKA 4YVWC 2VBPA 2HWE1 2D3PA 4RD7A 1FMD1 4LE4A 4URTA 2IXHA 4Z2AA 5C3SA 1JZ2A 2PHFA 2Z4FA 5FLJA 4NIIA 3KQ4B 5KHKA 3NNGA 5A3PA 3I8TA 1KDKA 1H6XA 3KHCA 4X8PA 2WNVB 3OPTA 2IFRA 5L9RA 5FAXA 3RZGA 5ANQA 1KRIA 5F1RA 1AR81 3ZFEB 1BEV2 4QDRA 1DLCA 3WDXA 1J59A 1CAVA 2BYVE 2G4IA 1GWKA 2JXAA 3PUAA 2JDAA 4CUAA 1FT9A 4E2GA 3GJAA 3LFIA 5JR7B 4AWDA 4B4PA 2PHLA 1VBC2 3J9SA 3SXWA 3POJA 2P6CA 1YQCA 1N1TA 1PZ8A 4KGQA 2XXZA 2D5HA 1H6YA 2DYCA 1RUOA 4BQXA 1DQ1A 5LBCA 1DZTA 4RS5C 4DXZA 3JD73 1TNFA 4P9YA 2VMCA 3WP6A 3FZ3A 2FCVA 1LHWA 1R091 1UCXA 2HWB3 2OX0A 3R4UA 1JHNA 3OUHA 2WN3A 1YFXA 1LOFA 3SC7X 3ZFFB 5BV6A 1CAUB 2UWBA 4QB1A 1XYPA 3UL2A 2D7FA 2A75A 4F7ZA 3DF0A 2ZAHA 4IESA 5C5TA 1ZZ6A 1NA1C 1OD3A 4E4ZA 1MQTB 2WZR1 4WM7C 1AYN1 1Q56A 4XPVA 1QH6A 4PHZA 2WNUB 4CEWC 4NHYA 1F2NA 1OLME 5KHIA 2G9ZA 1FPN3 4XUOA 2ZBJA 3VB9A 1DQ5A 2RDQA 3AB0A 3MIGA 4BJ0A 1OQ1A 1S0BA 2JDMA 4FT8A 1X9TA 5ABJC 4XJUA 3WW3A 1O6UA 3T0BA 4HKWA 1YLLA 4ARXA 1BMV2 3SKVA 4UBHA 5JOYA 3GBWA 3KVAA 3W9AA 5CADA 5JXGA 3G6JB 3CU7A 1SHWB 4QD2A 4KWJA 2JKBA 1O91A 1OA3A 3O12A 4BB3A 4NMIA 4BIFA 2VW1A 3IDAA 1X36A 3I2HA 4QPIC 2E33A 1HB2A 1J3RA 1UOBA 3J7HA 3IAQA 1L7QA 3M1HA 4XEZA 4Y33A 4AI8A 4OI4A 5IVEA 3KM5A 3UESA 4CSWA 2ZGMA 4P9GA 4IQPA 4RGKA 3MIDA 1W8HA 5A80A 1RUC1 4AHXA 2RJLA 1RUI2 1W04A 5K9YA 2OKXA 2BDRA 1IPKA 2HWD2 2PHDA 4N53B 3P1IA 2WINB 4MSVA 4YGDA 1PGL1 2FDHA 1IGOA 1NAEA 2QBXA 3M2MA 3ZFEA 5KC5A 1OKQA 5ACA1 4FOVA 2SLIA 4K8FA 2WWSA 3NMBA 4R9BA 2PQQA 2IXKA 3VD9A 4Q4Y2 3AKQA 4N9IA 3C7HA 1V6MA 5C7GA 1A78A 3ENRA 2R0FA 3AVSA 4LOSA 1JUHA 4Q4X2 3VBFA 3VBSB 4AHYA 2MEV1 3U0ZA 3POFA 3ZN5A 1VJ2A 4HL0A 4FSJA 1GNZA 2LTNA 1S55A 3DPRC 3SHRA 3V56A 4OHZA 1KFXL 1BBT1 5CEHA 5C3PA 1RITA 5GLVA 1DGRN 4ZU4A 2VR4A 2ZA9A 3LIHA 5FK7A 2W0XA 2WZR3 3WDYA 2JJ6A 5IUQA 2FHRA 2WS92 5FZHA 4FAGA 2YV8A 2VMDA 3SH5A 1W8ZA 4CDUC 1LOBA 1AR82 1GSLA 3JCIA 4L99A 3ZKUA 4DMIA 2ADEA 4K21A 1VRH3 2X29A 1ULCA 2VU9A 4AAXA 4DO0A 5IHRA 1JYVA 3ZFGA 1G9FA 1RVF2 2PHWA 3M8LA 2AUYA 4BM8A 2HKXA 4DUVA 1Q8SA 4UFKA 5FTTC 3IBMA 1IG3A 2XBO3 2GN3A 1S1AA 2ZGLA 1MQTC 4IEXA 2HWF2 1KS4A 1PZ9A 1ULEA 3AFGA 4AHZA 3A22A 2VNVA 3OYWB 5H9PA 5LK5A 1LHUA 3AZZA 2XR4A 3BOWA 1M06G 5FMOL 4ZS2A 4QKDA 1H9PA 4WVVA 4MGTA 4R52A 1K42A 3VL8A 3JQXA 1RUD1 4LJHA 5DZEA 3KV4A 5FUNA 4YZ1A 5D8AC 1H4GA 1VB2A 1C1LA 5CNAA 3F95A 1RUC3 3MIEA 5IJRA 1GUIA 5A3LA 1BYHA 5FZ1A 5LW9A 4GA9A 4JTNA 2F4LA 3VKFC 1STMA 1AXYA 1QJU2 1AX2A 3ACLA 3BOPA 1VLNA 3FFZA 4QHZA 4LBMA 4UWDA 4UF0B 5LA2A 1JS9A 2V5YA 2ZGUA 3NSTA 1C5IA 3PVBB 4H2AA 4XVHA 4L92A 2J1UA 3D8CA 4GWMA 2TUNA 3GM8A 4Q4V2 1CONA 4M4RA 2ZGRA 5DZFA 3MPPG 2XONA 3CLPA 4NE9A 3WD5A 1IS6A 2OQ6A 3KF3A 5J96B 3AL5A 4FFFA 3T4HB 2VZTA 4QM8A 1G9AA 4QKNA 1COV3 1DP0A 4M3CB 4ZU5A 5G04L 1RXFA 4H55A 3ST7A 5A6XA 1QWRA 3DYMA 1FYUA 3ZSEA 5APAA 1NLRA 1BVP1 2VECA 3T2PA 1VRBA 3FC0A 3FJSA 1W39A 1BBT3 1Y9MA 5FPLA 1QHDA 2HWB2 2YG0A 5F5CA 3NNLA 5LCWL 1WCDJ 5HCBA 1J84A 5EZWA 2FD8A 3WCRA 1VBB1 1ND2A 5ABJB 2D3RA 5BNPB 4KG0A 1I3HA 4XF4A 3WF1A 5J7MA 1JOBA 4HG6B 2Y34A 5FUPA 1D4M3 1ZA7A 2VQ0A 5FZ0A 3HWJA 5A1AA 4JGYC 1ZZ7A 2ZOEB 1SLCA 2WS93 5DDJ3 3O1PA 1RJ8A 3DKQA 2VVFA 2W1QA 1W8WA 2CV6A 2XBO1 4EZ4A 4QGMA 3RPQA 3M3OA 3LWCA 3WF0A 5FZ9A 2FZ2A 1OURA 1YXWA 4LULA 4Y1UA 5A3NA 4QMAA 1JZ8A 4I0WB 4LBOA 1URXA 4X6RB 3H1WA 1BCXA 2P2KA 3CDZB 2GC1A 5FZLA 2JG8C 2LS6A 1JHJA 1K5MB 1TNRA 3J8F2 5CU1A 4LKSA 1SDDB 5DG2A 1AJKA 4RFT0 5LATA 2QQIA 2YHJA 3OEAA 3D4KA 2QQWA 3I2FA 1N3PA 5FMDA 3ORJA 4GMP0 5DUUA 3B9CA 1U5XA 1LECA 3BIEA 3IPVB 3V0BB 1BJQA 3B9IA 3WOGA 1RINA 2XJPA 2Y8KA 1CWPA 3RYRA 1POV0 1OQEA 1ZNPA 2Y6LA 1BLZA 3VDBA 3PLQA 2GMPA 3AXDA 1PX3A 1FOD2 2JE8A 2RDNA 2D97A 2ZGKA 3HJRA 3E5XA 3ILFA 2AGSA 2E7QA 4IEVA 5K0UC 4FTBA 2VNRA 4J1WA 1PO12 3EQEA 4QU2A 3S5QA 4DRRA 3U4XA 2HYXA 2VD7A 2KXLA 3WY6A 4QT6A 1IS5A 4QXHA 4EROA 1FNYA 4YW5A 3WG4A 4EN8B 2E53A 3NAPB 2C0ZA 3WHTA 3V0AB 4YYOA 2CL2A 2DU1A 1ND3A 1E5RA 1GQHA 4LHNA 4N43B 4WVZA 1C8M2 1QJZA 2VO5A 4OQ9A 2WQZC 1QJX3 5A32A 1IQAA 2C4XA 3PIGA 4E9KA 5EV7A 3VBUA 1DG6A 3NQHA 3HEIA 1A8MA 1OSGA 4CU9A 1MS5A 4E8CA 3O1TA 3BIWE 5LA9A 3KMHA 2BFUL 4FPKA 1NCQB 2LW8A 5FBZA 2Q8CA 2XL7A 3SCGA 1YI9A 3KT1A
chains in the Genus database with same CATH topology
3B93A 2GC0A 2P34A 3UV9A 4MGKE 2OYZA 1JTZX 3MLLA 1YNAA 4PDWB 4W6XA 1NY72 2A5ZA 2C5DA 4KQ7A 4PJYA 4FOWA 3K51A 3D0SA 4ES9A 2XWBB 4LO8A 3VDDA 4Y1VA 1DYKA 2XWJB 3OPZA 4CRQA 4JDMA 3WINE 1WUVA 4DPNA 3AMQA 3B02A 2MHFA 1QOTA 2E7AA 2JG8B 2GNBA 2YY1A 3O0WA 1F5JA 1G9DA 1DBNA 3ROUA 2B9UA 4FPCA 4EN9B 1VBA2 2D98A 2RM22 4NWVA 1SLIA 1MS1A 5CFDB 1G9CA 1SDWA 4MGZE 1ENSA 4Q4V3 4R9DA 3PJQA 1CVNA 4AF9A 1DFQA 5BNPC 3ZSMA 2PHRA 1PM7A 1Z78A 5FCCA 4K1ZA 2NM1A 3I2DA 4QQ2A 5LEKA 5BPXA 1XNBA 2EXHA 3N7KA 4XTMA 4ZXKA 3ZXAC 2R32A 1ASJ2 1DZRA 5KXDA 2OZ6A 3TN91 4MXWA 1XXNA 2FMDA 5C9AA 1RUE3 4OLLA 2XL9A 4I3GA 3N4MA 2ZHLA 1QQP1 2VOKA 4YW4A 2GALA 4AI3A 2DUOA 3TNPB 4FXGB 3WDTA 1XYOA 4QPYA 3EHKA 4G9SB 1G8WA 2VMGA 1D4VB 2VVDA 4S2GA 3JBG2 4AVVA 2XVLA 4Z82A 4AI2A 1RUJ3 4BWOA 2GNDA 3RMXA 1CAWA 3M3EA 1EV11 3VBUC 2WLQA 3KLSA 2O1QA 3S0MA 1MS3A 1WW7A 2EALA 3FMGA 3UKTA 1EY2A 3QH6A 4ORFA 2YGLA 3IIAA 5AVPA 4XDQA 3H0OA 2Q8OA 2Q1MA 3IDCB 3GZTB 3ZXLA 4HBNA 1GYKA 2P3IA 1YRZA 3MI8A 2Z69A 4XJZA 3LA2A 4H3WA 1AYM2 3URFA 2ZX1A 4JV4A 3IWZA 3VKLA 2ZKLA 2RM23 1YFUA 3NL1A 1H1MA 5J09A 4M0HA 4IEPA 4AFAA 2DTYA 4JDOA 1DIWA 1UX6A 4KL1A 1HRI3 2ZGOA 3JQWA 4BOWA 2YZ4A 4C0HA 1DHKB 3VL9A 1PK6A 4RHV3 2W39A 3POWA 3VBRB 1PIV3 5T3NA 3EJKA 1QQP3 5JI9A 4PDWC 3AZXA 3ZYRA 3APBA 2RS13 3VDDB 3VKNA 1NQDA 5JIUA 3RRDA 3LOBA 3ZSKA 4ZKTB 2RR13 2XBO2 4RSUA 1WLWA 5JI7A 3LA7A 4JGYA 4AI0A 1QXPA 5BUVA 4R9AA 5JLVA 1MEC1 2ZJCA 2B39A 4QX5A 4HVRA 5J3UA 3B94A 2WFF2 1R083 4GB32 1ENQA 2VH9A 4I09A 1YIPA 4K20A 1RUH2 3D6EA 4XF3A 3KS7A 2D6PA 4HVQA 2DVBA 1RMU2 3KCCA 1PVC1 2WQ4A 4QQOA 4JVAA 1YJLA 1JH5A 5CFDC 2CAUA 4W65A 1YFYA 3LB9A 1RL3A 5EJ3A 4AQ2A 1VBD1 4GIQA 5L19A 3OCPA 4ATEA 5I91A 4LBKA 2OVUA 2GH2A 2X8KA 2ES3A 2VW2A 4GWNA 4SBVA 4XQDA 1DGRA 2EAKA 1KJLA 2XG3A 4YARA 3O5SA 3ZMNA 3ZX7A 2RJKA 2W68A 2VGDA 4R4XA 5AC93 1ZZ8A 5E16A 5H9SA 2Q1ZB 4FO9A 1H0BA 2XJRA 4U2AA 1RUF1 1S2KA 3B69A 3AKTA 3OBRA 1AR83 2DFCA 2P3KA 1PIV1 2MNGA 5F9TA 2FMYA 5CIRA 1O4YA 3L2HA 4XFBA 3IDEA 3CL1A 4FPOB 2WFPA 2JENA 4Q4Y3 2TEPA 5D1IA 5EYYA 2HWF3 1WBLA 1XU1A 1JBCA 3AYDA 1S0FA 3MF6A 2PELA 5HCAA 1OLRA 1A3KA 1SCRA 3QOPA 1MEC3 2XLGA 2RS33 3L2YA 3MFAA 4CDUA 2UYBA 1DGWX 1GZWA 2ZS6B 4XIOA 1NY71 2D43A 1AR63 5GZGA 1LEDA 1F5FA 1QDCA 3IMNA 4JRAA 1EP0A 4AFCA 4AEDC 1SBDA 1RHI2 1UMZA 3O7OA 1TME1 1O3SA 1QY4A 4C1WA 3OGJA 2BNOA 4Q27A 1W6PA 5L7OB 2BW8A 3FWEA 4WZFA 3I59B 1PZ7A 1CAVB 3ZXFA 2PHUA 3VBFC 1PGW1 3AP9A 3PMEA 5JWPA 2R072 1O4ZA 5AFEA 1MS8A 3AFKA 4HKOA 4XXPA 3KSCA 1A6CA 2IC1A 2DCZA 1HQLA 5GLTA 1E57A 1FPN2 3MF9A 5EXOA 1D0HA 1F8VA 3H3ZA 1DGWA 3AKPA 3GF6A 5I0UA 3FLTA 4Z92B 5FLHA 3BCWA 1BEV3 4GB31 3MIHA 1W6OA 3LKJA 5HCFA 5FPZA 3RMYA 2RMU3 1NYWA 4J1XA 1V6JA 4AEDA 3MFCA 1NQJA 4JGYB 1DLLA 1OPMA 4LHLA 5KXEA 2VNGA 1NE4A 3TN92 1DF0A 2ZCWA 3POSA 4KWKA 3I4IA 3JD72 1DQ2A 2IZWA 3UKNA 2XLAA 1QQP2 3DKWA 3IN9A 2DWRA 1HLCA 4FPGA 3KCYA 3W58A 4PIYA 2R073 4AG4A 2C1FA 2Z42A 4BZ4A 5FO8B 2KM2A 2RS31 4GALA 5BNPA 3AP7A 1QNWA 2ZABA 3LGRA 2LUWA 3MW2A 4CEWA 4EN6B 1RUG3 4PBOA 1IPJA 3KZ4C 4N9HA 4WM7A 5T50A 4ONUA 1NA1A 3TB0A 4IETA 1TME3 2NYYA 1OFNA 1SLLA 1IKQA 3PHMA 2JECA 3GZAA 3MZHA 1AR62 3H50A 1UU5A 2FQPA 3GZUC 2EXJA 4HT1T 1U0AA 4YM0A 3ES1A 4GULA 4AQTA 3BB6A 2ZGPA 1VAKA 4XOGA 1EPZA 3H1MA 2F6BA 3FLRA 1AUYA 4WVMA 3GYDA 1ZBA1 4UW4A 5I8SA 2VPVA 1SQ4A 5CFDA 3AP4A 3HBZA 4Y22A 3M3CA 4AVSA 2RMU1 4DFSA 1ENRA 1PMIA 4UBGA 3VZMA 1ULGA 3AYCA 1XE8A 3N7JA 4YVWA 2ZTNA 3H9AA 3WQ0A 2V09A 2EXKA 2ZHMA 2R041 3QH7A 4IERA 1W6MA 4M3CA 2IXJA 4GQ7A 4XF9A 4W6WA 1ZRDA 1H30A 5GALA 1I1EA 1ZM1A 4K3UA 4WVWA 3ZFGB 4MXWB 3AMNA 1S0CA 3I59A 2R071 3AZWA 3WW4A 4A7YA 1W6PB 3RYPA 3PTYA 1N1YA 4QPIB 2PHXA 5JDBA 1RC6A 1RGSA 2P3JA 4PDWA 1Q8PA 4A3XA 4JDNA 3LSEA 2D93A 4R8HA 1Q8QA 1WLTA 2XLFA 3LSDA 2H0BA 4M01A 1PK6C 1O3QA 5F5QA 2B46X 5DUVA 2ZHNA 5K0UA 1FI2A 1VBB3 1BKZA 2PN5A 2Y0IA 4XMIA 1OLQA 2HWC1 1RVF3 1J3PA 1VR3A 1PVC2 2TBVA 4BCUA 4QGNA 4MV2A 4OHVA 4Q0PA 1FV3A 2WS91 4DQAA 4KU7A 3TBDA 1T6GC 3B3QE 1BQPA 1GNHA 3MLKA 5FREA 4H7LA 5B2GB 4YFWA 1RUNA 3DPRA 3R05A 5GLUA 3ZO0B 4K40A 1X50A 2JG8A 4WBBA 1C1FA 2NMNA 5AVAA 3OY8B 1LU2A 3WUCA 4Y20A 1H1IA 1AR73 2OW4A 2XJUA 3CO2A 1PHMA 3N3HA 1HDKA 4MGIE 1D4M2 1O3RA 3I7DA 3J8F3 4RQPB 1FX5A 5KC6A 4GXLA 1PO11 1ND2C 2CWSA 1LGBA 2D6OX 4S2HA 1UIJA 3GNEA 2FBEA 5BXXA 4QXKA 4AE2A 4BHPA 3RJ2X 5CBLA 4ITCA 4B7KA 2MEV3 3THTA 3MLJA 3VBUB 1UZYA 5DUWA 5F6LB 2CTVA 3VKOA 2WIIB 3WXPA 5C9AC 2JD4A 2IWGB 2V73A 1AL23 2YXSA 3GBGA 2VOVA 2Z2SB 2H0VA 3ZPYA 1IHMA 5FQ0B 1VRH1 2P37A 2ZACA 2ZMKA 1PGW2 4B7EA 4CDXA 4Q4W2 4FXKB 4Y22B 5D8AA 1LGCA 2ARBA 5A33B 3T1LA 1QJY2 1AF9A 5IK5A 2VUJA 2OPKA 4BIOA 2WSVA 1CJDA 4LBQA 1FMD3 1QJX2 4RR3A 4GMP1 3MIFA 3E6BA 2CY6A 1MQTA 3SLIA 4AK3A 5JOZA 1H1AA 2I07B 4Z07A 2CAVA 4YSFA 3OBTA 4DNYA 1ZZ9A 2A3XA 2NZ9A 2GSYA 3ZFGC 1HV0A 1AL22 1GZCA 1VAVA 1VBA3 4LBMA 3VDDC 1MZFA 2QZ2A 1XYNA 3TRSB 3VZJA 5IK7A 4Q0SA 2RS52 4QPGC 2BQPA 2XKOA 4JTOA 1RUI3 3B00A 4HN1A 1G86A 1KDMA 4ES8A 4RS5B 2YYOA 5BYNA 4DY5A 2RR12 4PLMA 1B09A 3JD71 3ILNA 3USUA 4BMBA 1APNA 1QNYA 4KWLA 4FP3A 1JOJA 2BWAA 4PIXA 4EN7B 3BU7A 1HXS3 1COV1 2EVXA 4P9IA 3HR9A 4BYYA 4CDWC 2D6LX 4TSVA 4B29A 1OD5A 2UURA 1AJOA 4IEYA 4COWA 1GV9A 1J58A 2SBAA 4RHV2 4U36A 2DVAA 4D69A 1AR91 1GLHA 2NQYA 3FBMA 2WKKA 1I6XA 4K7JA 4LO5B 1AXKA 1XNKA 1GICA 1CJPA 2B5HA 4XHXA 3ZFEC 2VOXA 5EWSA 3VBOC 4L8QA 4X8NA 4XIKA 1W6NB 2UY8A 1ND3C 3G7DA 2BNNA 3WG2A 4TWTA 2A70A 1U12A 3DL3A 4KGGA 1W6OB 1LOAA 3SMHA 4HKLA 4ISRA 4CZSA 1MS4A 4AEDB 1U5ZA 2DVGA 1GANA 4QPIA 5GZFA 3WCSA 4MUVA 2OUJA 1RUG2 1LU1A 3BTAA 4AGVA 3ZSJA 3B5LB 5SV8A 2E6VA 2PFWA 5AC92 4BMEA 5K8SA 2ZX0A 5I0TA 2ARXA 3VLBB 1SMVA 1AHSA 4NWWA 3A0NA 5A33A 1TMF2 1SLBA 1ULFA 4BLIA 2RMU2 2E7TA 4YZ2A 1NXMA 4LUKA 1S0GA 3RDIA 5I8TA 3H8UA 2GN7A 1H9WA 5BNNC 2JE9A 2EF6A 1LEMA 2UWCA 5L7OA 1W6QB 4LBLA 1H2LA 4AFMA 5FLIA 4EN0A 1RTVA 4AGRA 1OOPC 1X8EA 4E2QA 1AYM1 1HXS1 1YJKA 1CAXA 2DURA 1ZBE1 1X8MA 2G9GA 1RUJ2 2C9AA 2R061 1MZ6A 5GKAC 4XFCA 1NCRB 1DQ6A 3QLQA 3NKTA 3R6SA 4L11A 1VBE3 4IEZA 4IV1C 4RS5A 1QJX1 4ISQA 3ZYIB 2YROA 1BK1A 1GZWB 4XBQA 1J1LA 1HRI1 3GHMA 3N35A 5BNOC 4YW2A 4OZXA 3FLPA 1R1A3 4IEWA 4NO4A 4ATFA 3B7MA 2ATFA 5GJ6A 3NVCA 4I30A 4LBQB 4RR3B 3M70A 4LA2A 1UKGA 4AQ6A 2YDEA 4HSLA 4F3JA 2PAEA 1WMFA 2RS11 1UU4A 3OYWA 1CD3G 1A8DA 1ZREA 3VHNA 3VBSC 2R30A 5E88A 2ZZJA 4Q4X1 1UN1A 5K7PA 5E1RA 5IK8A 2OA2A 4HN0A 2BPA2 2ILMA 3HT1A 1N1VA 2VW0A 4IV3B 4XHBA 4Q29A 4V1PA 1NZCA 5JOXA 3USUB 1QF3A 1H8VA 2JX9A 4K6BA 1CIWA 2XB6C 3AMPA 3AYAA 3ETQA 1VBD2 3FFQA 3KCXA 1JXNA 4HK8A 1HW5A 2RS53 4D94A 3UKVA 5AFBA 2QDNA 3VUOA 2PAMA 4F83A 4N90A 5HXVA 1POV1 1SBEA 1RIRA 3MW4A 3E6CC 3LAGA 1CGPA 2HYKA 1R092 4OUSA 1VBE1 2UU8A 1LHVA 4B4RA 2HJIA 4G3YC 4XF1A 5DUXA 4FCAA 4YW1A 1S0DA 4CDQB 1RUC2 5AC91 4FQZA 1PIV2 2R1DA 3TN93 3V0AA 1O5UA 3FUQA 3RZZA 1DZQA 4KG8A 4XFIA 1C3HA 3VGIA 3WHTA 5BNQA 1TMF1 1V00A 4QQLA 1GKBA 4N43A 4LR4A 1N1SA 2P17A 4D7YA 4DY3A 2GMEA 1OQDA 1NCRC 5JZGC 5DDJ1 1I9RA 4LBJA 3P3PA 2PLV1 5JVVA 1VRH2 1H8TA 1QGLA 4Q4Y1 4BA6A 1OA2A 5FOBB 1LHOA 4IEUA 2B8MA 4MVTA 5I0SA 1N3OA 1W6MB 1PK6B 4P5HA 3AYEA 4RGGA 3QD6A 1B35B 2HWE2 4COYA 2ZMNA 2BGCA 1RUJ1 3GBFA 1LULA 1RHI1 4FPJA 5LRRA 3S30A 3O0VA 1JYCA 1OA4A 4NHLA 4JAAA 4PIZA 1C28A 3ELNA 4DOUA 1OOPB 3WP3A 1YUDA 2GH8A 3KGZA 4WVMB 2NP0A 3H7YA 3RJRA 4RGAA 3ZFFA 4KU8A 1SLTA 3MGUA 1RMU1 4EJRA 1LESA 3L9JT 4AVTA 3MW3A 3EBRA 1Z0HA 1WMEA 4Y1ZA 5ABJA 4PBPA 3SITA 1CPNA 4COZA 1DQ0A 2Y0OA 5T55A 1RUF2 1AX0A 1QOSA 4HK9A 1IS3A 5L36A 5EYXA 3TWIA 1WLCA 1X7NA 4FPEA 2HWE3 1CAXB 1V9U3 2DUQA 4IXLA 1HV1A 4YG6A 4YVWB 5E8AA 2Z79A 4N53A 2HEVF 4XBNA 2WZR2 3UJQA 1MACA 2XJTA 2K2SA 3THPA 1XU2A 1V6IA 4JCKA 4NHMA 3AP6A 3ZN6A 4I2OA 1AXZA 4C1XA 2GU9A 4FPLA 1LOFC 1LGNA 2PLV3 3WVJA 2ZGSA 3OTFA 1ONAA 4AW7A 4MLOA 5FFOC 2W52A 5C9AB 4AI1A 1NLSA 3JZVA 1GQGA 1ULDA 3CJXA 3QBQA 3RQ0A 3QCWA 5T5OA 3CF6E 1UF2C 3OJBA 4OHWA 1TQ5A 2H6BA 2E63A 4RQPC 1VBB2 1WMDA 1F31A 1PVC3 4QQPA 4FOQA 1F9KA 1AZDA 2AYHA 5CVRA 5C4WC 1J1TA 1PNGA 3M4FA 3OGGA 4FPFA 1FPN1 1OPOA 1QJU1 3AXEA 1HIXA 4XQWA 4Z8BA 2PLV2 1M4WA 1ZBA2 2YPJA 2A3YA 1WW4A 4Q0VA 4Q4V1 5T54A 2DV9A 1LJ7A 2VQAA 3ZVXA 4NVPA 1H8TB 2WT0A 1BBT2 3N36A 1V9U1 3WLUA 2XJVA 4CEYC 5JOWA 2VVEA 4R9CA 5C8CB 4Y5Z0 3FX3A 4YFZA 5DG1A 2IXIA 2TNFA 1RUF3 4FP2A 4Q2FA 1HRI2 3R4DB 2X5IA 2JICA 3ZMOA 4A7KA 3EO6A 4L2NA 4NPRA 4DZGA 3NO8A 4BE3A 1OI6A 2EXIA 1B35C 3WNXA 4UW3A 1SFYA 2R043 2RE9A 2OZJA 3AK0A 2RS12 2HWF1 1CAUA 1O7FA 5J37A 1FNZA 1NCQA 1MZEA 4Z2WA 1WD3A 4LBQD 4NOTA 2ERFA 2ZX2A 3NV3A 3WZ1A 3PNAA 1H2NA 4L97A 4CTEA 4MXVA 3WQ1A 1AR61 1EV13 1C8NA 2D5FA 2PTMA 4Q0QA 2XJSA 3DV8A 4O9GA 1ZVFA 4FTEA 4GH4A 3OF1A 1MZ5A 1FAYA 1ASJ1 2CWMA 1ZZBA 3WHUA 5FO9B 3O14A 3PVEA 2HWC3 3ATGA 3W59A 1UPSA 3ZDSA 4DINB 1QJU3 4N7IA 2A3WA 3KT7A 2XJQA 5KXBA 3ALQA 1HQWA 3DUIA 3ES4A 4Y1YA 1OHFA 5H9RA 1KQRA 3M3QA 4X6QB 2IFWA 4LLOA 4B3NA 4JGZC 2Z5WA 2Q0AA 4AEJA 3IPVA 3V0BA 4Q8LA 3JBG1 2AREA 4YGCA 4L9BA 5EFUA 4LO4B 4XJ8A 5T52A 2R6QA 1YFWA 3WW2A 2HWD3 2ENRA 3FE5A 5D8AB 1W2UA 2QKDA 4PLNA 1N3QA 1NG0A 3TYJA 3X29B 4TLFA 4IV3A 2WT2A 4JRLA 4YGEA 3TNQA 3MDPA 1QXRA 5I0RA 4YLZA 4AXOA 4AVBA 2B7YA 4OULA 2ZX4A 4YG3A 1PO21 4J6GA 1KD7A 5BNOB 5T5JA 1MS9A 2VOWA 4WM8A 2NMOA 2E9QA 4QM9A 4XBLA 3PMSA 1JUIA 4WV8A 1MVEA 3CJIB 4I3PA 1S0JA 4XFFA 2ZMLA 3HQXA 3KB5A 1GFF2 4C91A 1PVXA 5I8YA 4UW6A 5FDBA 4YG0A 4LLFA 3FBYA 2YMZA 1V6LA 1WD4A 1WCKA 2X53S 4Q4W3 4S2FA 1Y7BA 4XFHA 3VBRC 3NV2A 2A73B 3ZN4A 4LUMA 3WG3A 1IS4A 1FMD2 4QHBA 2ETEA 2R1BA 4CEYB 4IV3C 2JG9C 2UYAA 3VZOA 4P9LA 5CA6A 1YYNA 1AL0G 2HEYF 1J3QA 3MIBA 1OMIA 3ZXEA 4AQSA 4Z1VA 1L3JA 1VBC1 4XFAA 5A3MA 4LEJA 4META 1QJY3 3JU9A 4WZCA 2OIIA 4DRVA 4OI1A 2CYFA 4NR1A 5FRAA 4RA0A 1RUE2 3E97A 1MS0A 2WNVC 4FVVA 4XETA 2NLRA 4IL7A 3ZYPA 1O3TA 5ACA3 2BUKA 1FATA 3OD0A 4HSJA 1ZRFA 2EIGA 4CDQC 5GZCA 1PO23 2HEWF 2XPJA 4KNCA 1REEA 5F6KA 3VHOA 1ZA4A 1YCIA 4H7MA 3VKMA 1NXD1 4CYDA 1S0IA 4YVSC 1WGPA 2E51A 4COUA 2YC0A 2WT1A 3HT2A 1IZ3A 4MH0E 4P9WA 2W08A 4O9EA 1LKNA 4Q4W1 5GZEA 2DCTA 3CJIA 4HANA 4HVOA 1NA1B 3N7LA 5CG9A 2PHTA 5JPNB 3CJIC 5H9QA 2WNUC 3POYA 1AYN2 1NCQC 1CX4A 3ZXDA 4N7UA 4DB5A 1AVBA 2DCYA 3KT4A 5T5PA 4BQ1A 4LT5A 3C3VA 4INDA 5JSRA 1QXJA 2QVSB 2D6MA 2VMIA 4R4ZA 3ZXGA 4IEOA 1W0OA 4Y26A 1H2MA 4IEQA 1FV2A 2IXCA 4H14A 3ILRA 1SLAA 3KQRA 4GB33 3ZIWA 1UAIA 2UY9A 1VBC3 4GH4B 1QJY1 4LO6B 2BVBA 3VHPA 4CEYA 1HKDA 2A6ZA 2OUHA 3WDWA 4M3CE 2XVGA 1C5HA 3E5UA 4AHWA 1C57A 3E5QA 1H4HA 4CP1A 4CDUB 2WNVA 1PO13 1ZX5A 4HLTA 2A71A 4G4FA 1HXS2 2WLPA 5J48A 1KXGA 4D7TA