2GP3A

Crystal structure of the catalytic core domain of jmjd2a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
349
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Jumonji domain-containing protein 2A
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp3A01
5FYMA 5FUPA 5FP3A 2GP3A 3K3NA 5F3EA 4QU1A 3UYJA 2YPDA 2OS2A 5F32A 3PUQA 4AAPA 4CSWA 5FY9A 5FY7A 4BU2A 5FYSA 2XXZA 4D6SA 2YU1A 5IVCA 4TN7A 5FXXA 5F2WA 5FP9A 5A1LA 3DXUA 5A7SA 3KV9A 4QX7A 5F39A 4NUBA 4CCMA 5F5AA 2YBKA 5K4LA 4CCJA 5FZ4A 4URAA 3N9QA 5F3IA 4E4HA 4QX8A 5A7PA 5FV3A 3NJYA 4IGQA 5FJHA 3K2OA 4GAZA 5FY4A 3N9PA 5IVBA 5FZBA 2PXJA 2VD7A 3AVSA 5FZ1A 4D6QA 5FPAA 4IGPA 5LY1A 5FZ8A 5FZ3A 3AL5A 4EZHA 5FPBA 5A80A 3PU8A 4V2WA 3ZPOA 5F5IA 4EYUA 5FYTA 5IVEA 2WWUA 3AL6A 2OX0A 5FYUA 3OPWA 3KV5A 5FZDA 5LW9A 5F3GA 2XUEA 5IVYA 5IVVA 3PTRB 4GJZA 2WWJA 3DXTA 3OPTA 5FZCA 4V2VA 5FP7A 5FZKA 2XMLA 5A3WA 5FP4A 5F3CA 2Q8CA 5ISLA 5A3PA 5FZ0A 5LY2A 5LWBA 3N9OA 3KVAA 5FYHA 5FZFA 5A7NA 5FZ7A 3PUSA 3PURA 4EZ4A 5FZLA 4IGOA 4QXBA 4LITA 2OT7A 3KV4A 4CCKA 5A7QA 2YBPA 5FXWA 5FZGA 4AI9A 4BXFA 5FZAA 4CUGA 5A1FA 5F37A 3PUAA 2Q8EA 5IW0A 5FY1A 5FUNA 3KVBA 4LIUA 5CEHA 5FPUA 4LXLA 4CCLA 4ASKA 2W2IA 3N9MA 2YBSA 4GD4A 5FYCA 2GP5A 5FPLA 5FY8A 5FZOA 4Y33A 2P5BA 5FP8A 5A7WA 2OQ7A 3KV6A 4CCNA 5FZEA 5A3TA 5IVJA 1VRBA 4XDOA 5FZ9A 5FBJA 5E6HA 3U78A 5FXZA 5A3NA 4Y4RA 5FZOB 5IVFA 5KR7A 4UF0A 4HONA 5A7WB 3PDQA 4DO0A 5FZIA 4DIQA 4QXHA 5A7OA 4XDPA 5FZ6A 3ZLIA 5FZMA 2YU2A 5FY5A 4HOOA 5FXVA 5FYBA 5FPVA 3N9NA 3K3OA 3RVHA 5FYVA 4CCOA 5FJKA 3N9LA 5FY0A 4D6RA 4UF0B 4BISA 2XDVA 3PU3A 4Y3OA 3LD8A 3U4SA 5FYIA 4C8DA 5FWEA 3LDBA 5FYZA 2OQ6A 5F5CA 5FWJA 5F2SA 4GJYA 5FYYA 5FZHA 3AVRA 5IWFA 2Q8DA 4LIVA 5ANQA 4QXCA 4QWNA
chains in the Genus database with same CATH superfamily
1CAXA 4QPGA 4UAPA 4DS0A 4XDQA 1QNWA 2UY9A 1TG7A 1EV11 2VW2A 4JZRA 4MG2A 2ETEA 2CGNA 3ZFFB 2VMGA 4J1WA 4DRRA 2C4XA 3PUHA 3VBUA 2P6CA 4S2FA 2RDNA 4A2UA 5BNNB 2B42B 3H1YA 1LKNA 4PDWC 4RS5B 4E4SA 5F2WA 2Y6JA 3MLKA 1NXD1 3OEBA 3VDDC 5I0TA 2Q1FA 2BGCA 2R1DA 2VBDA 2VZ1A 3RWNA 1PGW2 2ZGQA 4L97A 1Y9QA 2XLFA 1V6IA 2ZGKA 2VVFA 4KMQA 5C8CA 4QD2A 1H8TC 3QOPA 1ULFA 2PQSA 4JQRA 2JXAA 2XLAA 3SEPA 1XPWA 3ZFEC 2R7EB 5HV0A 1AR83 2GN7A 4V1PA 3ROUA 3H7YA 3VGIA 3O1TA 3KQRA 4EWDA 1AL23 3FWEA 3EQEA 3WF2A 1XB9A 4U2AA 1PK6A 5JMCA 3PVOA 4PI2A 4YFWA 3QACA 5FRAA 1FXZA 1S0EA 3AYEA 4IV3C 4I2OA 1QWRA 2XVKA 4E4ZA 3IT8A 1SLBA 5GZCA 3CJIC 2D3PA 1ZVFA 2ZKNA 1ALYA 4PJYA 4RR3A 4XAAA 1CX1A 3VBHC 1F35A 4Q29A 2MEV2 3AZYA 1S55A 4PDWA 3UETA 2AH2A 2VMFA 4QU2A 3ZR5A 2RE9A 1U12A 3SH4A 1MZ6A 3AYCA 1OD3A 3VDDA 3WW2A 4B7EA 4CU9A 5CFCB 3IDBB 3LSEA 4MADA 2RDQA 2ZAAA 3I49A 3RGBA 2Q5TA 4QQ2A 5FO8B 1MEC2 2C24A 4XBLA 4CXYA 5HCFA 1RUH2 1COV3 2HEYF 1RUJ1 4LBQB 3ZFEA 5LWBA 1X36A 3W21A 2GC0A 5FZFA 5E16A 1O8PA 1YCIA 2PYTA 5FZ7A 1LOCA 1OVPA 5KHKA 3ZDVA 1O5LA 4KBZA 4B1MA 3AZWA 2VZPA 3T2TA 4MXVA 1S4CA 2P34A 3AZXA 2VNOA 3GCWA 4K8FA 1BVP1 4UOJA 1I6XA 2QQIA 2LTNA 3CJIA 5FUNA 3S0MA 1TEIA 5T5PA 1W2OA 2JG8B 3POBA 3VBHA 4XOGA 2BNMA 2YB7A 4L2NA 1DYPA 5CFDB 2RR13 3FL7A 3KS7A 4YW2A 5AFEA 4XF3A 3ZIXA 3DCQA 4A44A 4NIDA 2XKOA 3B01A 1C5IA 3NV2A 4LBMA 2WO3A 5ABJA 1A6CA 3VBFC 3LDRA 5M0TA 1JODA 1W8OA 3ZIWA 4D0QA 2JWPA 4Y1XA 2VQ0A 4NJ4A 1DQ6A 4QQPA 1BQPA 1OPMA 4X8NA 4XUTA 2Q8OA 4C1WA 4K20A 1A78A 2K9ZA 3TB0A 5B4NA 3AK0A 3I2OA 2FHRA 5FR3A 4OQ9A 3MPBA 3AJYA 5H9PA 4LT5A 3H1WA 5EJZB 4NAOA 3LOIA 5FZ6A 2VR4A 2R1BA 3JZVA 3TNQA 4E9KA 3DF0A 5FXVA 2FDHA 4YM2A 2ARBA 2DYCA 5E8AA 5A3MA 1O5UA 4YM3A 1XSQA 1OI6A 3I2DA 1QDOA 3J8F1 5A3OA 3RZJA 4AL9A 5F5CA 5HCHA 1HRV1 3POJA 4TLFA 4AYUA 5BUVA 2DVAA 5IWFA 4FOWA 1TVGA 5FMOL 1REEA 4GJZA 4N43B 5BNPC 2YG0A 3JD72 4YGEA 2XPJA 1EUUA 4KU7A 1PIV2 3O14A 3VBFA 3BTZA 2JE7A 2IVJA 2R043 4XUPA 5EJ1B 3OGVA 1ENSA 5GM0A 1OKQA 1EAH3 1G7YA 1K12A 2H6CA 3R0RA 4CP9A 4XQDA 1PGL2 3AB0A 1CAXB 4QPGB 4TN7A 2IVIB 2JICA 5BV6A 2VZUA 1NKGA 2A71A 4MVTA 3ZSEA 2VECA 1NZCA 1V0AA 3VBUB 3ES4A 2RV9A 4OMCA 2ADEA 3JQXA 1LU1A 3AZVA 5DUWA 3ZXEA 3VBRC 4CCJA 4E2SA 2FDIA 3UGGA 4XTPA 5LEJA 1I5ZA 1QJU1 4L11A 3RFRA 2NMOA 3IKWA 4K21A 3AFKA 3KCXA 2HEVF 2XQXA 2ZZJA 4DINB 1F9KA 2DTWA 3JBG1 1JOBA 2WT1A 3NJYA 1J3QA 4I30A 1ENQA 5C8CB 1A8DA 4LBOA 4TXWA 5HXMA 1FOD2 5JIUA 4CUBA 4OQ8A 4LORA 1L7LA 4GH4C 4H55A 3SCFA 1AR92 1PK6B 5LBCA 2XVLA 4KWUA 1SLAA 2WZ8A 1BMV2 3WF4A 5F5IA 3P1IA 3WCRA 3A21A 1VBD1 4XF0A 1C8M3 3EMRA 4A3XA 4FT8A 2WDBA 4IEPA 1XE0A 4U36A 2WFF2 3OEAA 2ZGRA 2XUEA 1W6QA 1R083 4RR3B 3T2OA 4CE8A 4UXAA 3ZYFA 1QHDA 5C8WA 1A3KA 2ET1A 4PDWB 2RM23 3MEPA 4ZXEA 3C7HA 2QZ3A 2WT0A 1BBT2 2WSUA 2E6VA 2W87A 4LBKA 4Y1VA 5LCWL 3FX3A 2WUHA 2WYFA 4XBNA 3SCGA 3WQ7A 3PURA 4EZ4A 1AJKA 2E9QA 4L92A 2GNTA 1H2LA 2YGMA 5A7QA 3TWIA 2ADDA 4QKFA 4D7TA 5T55A 2G1MA 3ZFEB 1H1IA 2WNOA 4O61A 4QDSA 5DDJ1 4CCLA 2RVAA 1TQ5A 4GH4A 4PBPA 1RYYA 3WR0A 3H3ZA 3KF5A 4AWDA 3USSA 3IZOA 4AVCA 5I0SA 1GOHA 2XLGA 3WINE 1QJZA 2RMU1 3LE0A 1W8WA 2VVDA 1YHFA 4KWJA 4NN0A 4NIAA 3MZHA 2DVDA 1VBE1 1MS9A 1BKZA 1OLRA 4RQPA 1RB8G 2GAUA 3VBHB 3FLPA 3FLTA 1ASJ2 4PLMA 3CKHA 1AHSA 1E5HA 4MXWA 5C71A 5J3UA 3I3EA 1W2TA 2BTVC 2D7FA 3NSTA 3BOPA 3IAPA 1N1SA 3S7IA 4ES8A 5ABJB 5FLHA 3O1RA 2QBXA 4HOOA 1V6MA 3H8OA 1Y9MA 3OJBA 5F6KA 3OG2A 2W46A 4LO5B 4QMAA 5FYBA 1VPHA 2WN2A 5HCBA 4MLOA 3KF3A 1HQWA 4I3GA 4AG4A 3WF3A 3LGRA 1DG6A 2UYBA 3ORJA 2ZAHA 3VHRA 4ZONA 1ODNA 4AI1A 4YLZA 1QOOA 4CP2A 4AQ2A 1GP4A 2QQOA 4CTEA 1QXRA 4HLTA 3IMMA 5FP3A 1CJPA 5G05L 3RZHA 3I54A 1RL3A 3PNAA 4FFIA 1DFQA 1O3QA 2B45X 2G19A 2HWE1 3OOXA 1LOEA 4GQ7A 1LULA 1XNAA 1YJLA 3CF6E 3PUQA 1SLIA 3PJYA 4JTNA 4M01A 3JU9A 4NVPA 4LK7A 5FYSA 5GALA 3ECQA 1KJLA 4KU8A 4UBGA 4AVAA 4Q4W1 3VHPA 2YGLA 4OI2A 1OKOA 2CWSA 1HV1A 3AKSA 4XPVA 2I74A 2VNRA 3WW1A 3OGSA 1YRZA 1YQ8A 3RYPA 4CP9B 4L0PA 5KHGA 2YBKA 4AI0A 3HAGA 3JXSA 1MEC1 4UBHA 3WZ1A 2WZR2 3M3EA 1NXMA 1RUH1 5H9SA 4E4HA 5CU1A 1I9RA 1PMHX 1ULDA 2XJRA 4HPKA 4NROA 4QQHA 4DMIA 4PLNA 3TN93 4CDUC 1N3OA 4GAZA 1MS8A 5DQ0A 1MVEA 3LDKA 4DB5A 3KSCA 2A6YA 4W65A 1M4WA 3DPRB 3GJBA 4A6SA 4YG3A 2BFUL 1LHWA 2PXJA 4RYDA 1W2NA 2R063 1P8JA 5FZ1A 4AFCA 3N3HA 4CRQA 1AZDA 4FTBA 4QX1A 3VBSA 4NAMA 4Q0SA 4H14A 2ID4A 2V73A 4LO6B 3OBAA 1UD1A 1UXXX 1Z0HA 2D3SA 1FNZA 3KV5A 3NV1A 3OPWA 1VRH1 1HQLA 1RUC3 1OPOA 1ZBA2 1SFPA 2LM3A 5DUVA 3T1MA 3BCWA 3K75B 5FCCA 5FP7A 1DBNA 4Q4V3 3UJOA 4EN8B 4IEOA 5C7GA 1H9PA 1WW7A 1R092 3H0OA 1ULGA 1HRI1 2HBTA 1UN1A 2D44A 4RHV2 2ZXQA 5I8YA 2A3XA 2CTVA 2Z69A 3WP3A 3WP5A 2GH8A 2PTMA 1V9U2 1PVXA 2WQ4A 4UYBA 3KV4A 3WV6A 2W1QA 1UW8A 3VB9A 4IE5A 2QKDA 4ISQA 5JPNB 3POEA 2HWC2 5JI7A 5LA0A 1W8FA 3Q8AA 3ZSKA 1V6NA 2W52A 1OSGA 5A3UA 1JH5A 2YBSA 3MPPG 3SH3A 4B4PA 4JKMA 4CCEA 4BDVB 1RVF2 5A3LA 5I93A 2WO2A 5F9TA 5EIYB 4OYUA 2VUAA 1DGWX 2TUNA 3BOWA 3K46A 2QUOA 2HWF2 4QQLA 1HQNA 2P37A 1UZVA 2ZS6B 3CZJA 3LFIA 1CAWA 5A3NA 5GLWA 2RS32 1YFXA 1QJY3 3LAGA 1S0DA 3N35A 2ATFA 5EJ3A 3UNPA 1GZCA 3MIBA 4RQPB 4XDPA 2MNGA 5FZMA 4OFGA 5DPNA 5EP9A 1SLTA 1R1A3 1RXGA 1TME3 4MXWB 2WZPP 3M8LA 5FJKA 4CU8A 4D6RA 4UI9L 2QQLA 4LBJA 5JWPA 1WUVA 1TZOA 2XKPA 1MS5A 1YUDA 1GNZA 2W08A 1QIQA 4F8AA 1SLLA 4J25A 2QQMA 4BJ0A 2Y8KA 3NV4A 5FUPA 2AEYA 4LO7A 1RUE1 2FDKA 1OHFA 1DQ1A 1D4M2 2A5ZA 2AUYA 2EIDA 2QVSB 1FOD1 4AAPA 1R64A 4RA0A 3VD7A 2VXJA 3J7LA 4ZY9A 5JVVA 1MS1A 3MYXA 3MFCA 3WQ1A 3BYWA 1X9PA 2IUWA 2CWMA 3WDTA 4RN5A 4IETA 2D6NA 3NNFA 2X05A 2XJUA 2ENRA 3VD5A 3B3QE 2R071 1OMIA 1IKPA 3CIHA 4I0BA 2Y6HA 3WUDA 3RSJA 1JYNA 3THCA 5JMOA 5A6XA 1K45A 1BBT1 1IPSA 5L9VA 4DEVA 3WDXA 2EAKA 2ZGNA 3SHRA 4CVUA 3LSDA 2X8KA 4XZUG 1BYHA 1QH7A 1S0IA 5BYNA 2BBVA 3VZNA 1DP0A 3P6BA 4GALA 1W99A 1QMJA 3MF6A 2OPKA 2ZABA 4HPKB 4CEWA 3OB8A 3FZ3A 4KG0A 2VC9A 3WDWA 3K4DA 2I07B 4JCKA 1AF9A 4XVHA 4CDWA 5A6QA 1OF3A 3WNLA 2RJKA 3AL6A 3WG2A 2E32A 1OOPA 4AFDA 4JHZA 3ZN6A 3VBSB 4NO4A 3PHMA 3KT7A 2YXSA 1X7NA 4MHRA 4P00B 1W0OA 1CIYA 3M4FA 4YZ5A 2W47A 2QTWB 5FZ0A 4E4DX 3OUIA 4AW7A 1HV0A 2WWSA 3M3IA 4JHTA 3ZFGA 1RJ8A 2TEPA 4P9IA 3E6BA 5J48A 2BERA 1UU6A 1NCQC 1AYN2 1CAUA 3AP6A 2DURA 4LHSA 1IG0A 1LNSA 2DBIA 5EWSA 4PIZA 4Z82A 5T3NA 2BOIA 1RUI3 4Q4Y3 4LA3A 1H1MA 4B4QA 2B8MA 1I1EA 2Y64A 3N9MA 2RHPA 1QF3A 1ZRFA 1DZTA 4Q27A 5K0UA 5JUVA 4KQ7A 4RL7A 3WUCA 3UT0A 4QKNA 4M3CE 4XFGA 1LOFC 4RGAA 2BUKA 5BNQA 5A3TA 3MLJA 3M3QA 3QH7A 4GIQA 1KFUL 3GHNA 4XFIA 2C0ZA 1E57A 5HXVA 5E6HA 3ZXGA 1UYXA 1AX0A 2VXRA 5IVFA 2GNMA 1ZA7A 3S6PA 4HONA 1SFNA 1US2A 4AOCA 3PDQA 1N1YA 4K7JA 1H2MA 3R05A 1MACA 1HB2A 2Z79A 2YU2A 2A7AA 2SBAA 1RMU1 1CAWB 1OUXA 3Q8CA 3OD0A 4HKOA 3N9LA 4ORFA 2YC2A 4WZCA 3E1F1 1WCQA 4Y3OA 3ZFFC 1Q8SA 4ZU5A 2R041 2G9FA 4AHYA 1EAH1 2WZR1 3D3AA 4IW3A 4YPJA 2IXHA 4N90A 5AFBA 4WVMA 3DECA 5ANQA 5DN2A 2X09A 3TOJA 3SXWA 4P5HA 2WC2A 2GP3A 3A0NA 3CDZB 3T0DA 4Q4X3 3UKTA 5C9AA 4Q2FA 1OVSA 3ITQA 4EN0A 4CDQA 4EE2A 2W9XA 1WW5A 4BM8A 1CR7A 2WS93 3ZYBA 1WLCA 2XL9A 4N7UA 4QKBA 2WA4A 3MDPA 3KQ4B 1AR73 3JB4C 2VE1A 4BB3A 1G9CA 1HB1A 1XYNA 1GR3A 4ZU7A 4DQAA 3WDYA 2DBNA 1HB3A 5GKAC 4AFMA 4IE0A 5TSWA 3HD8B 1J83A 1QQP3 3MO4A 4B4RA 4LJHA 2XBO3 2Y33A 5A1AA 3IDAA 1RUD2 1ZBA1 3TBDA 1LB2A 2JDMA 3QD6A 4YVSA 4FOQA 2YZ4A 2GDFA 3B7MA 4A45A 5B2GB 3P3PA 1ZA4A 3NKGA 4FXKB 4RHV1 2HYXA 1S1AA 1CN1A 5FY4A 5CFCC 1V9U1 2HJIA 2W39A 3ZKUA 1C8M1 4COYA 2XQRA 2K0GA 3HQRA 1UZYA 3UK9A 3VD9A 1R081 2JD9A 2PHLA 4P5YA 5DAWA 4LHNA 2DCZA 4FI9A 5F6LB 2VL4A 2WNVC 4HFSA 3H8RA 3BODA 4QPWA 1RVF1 4DXTA 1EP0A 2WQZC 3ZSLA 3B5LB 3HNMA 2P6HA 1WA6X 2EIGA 3ZXAC 1STMA 3J8F2 4CEWB 3WT3A 1HRV2 1VIWB 1X82A 1IOAA 5F3CA 4KL1A 4CDWB 1W8TA 2A3WA 5FP4A 3TYJA 3U0ZA 5FYHA 2QDNA 5JR2A 2V5YA 4LO4B 4JQTA 3K4AA 1OOPB 1JYVA 2VMIA 3TEZA 5CFDC 2VBPA 5EPAA 2WO1A 4QXBA 3ZN6B 3J7MA 1QOSA 1IG3A 3IWZA 3HR9A 3GJAA 4NIIA 4CUGA 3DGTA 4RFRB 5L36A 2E51A 1X8EA 3KVBA 3OBZA 3ZFGB 2RS52 4AVSA 4CDXA 2Q30A 1DDLA 1BZWA 1O4ZA 2BEOA 4JRAA 1CAUB 1O4YA 3BUCA 1ZZ7A 2D6PA 2WO7A 4J6GA 1YQ5A 4JV4A 2ZX4A 2WNVA 4FXGB 4PQ9A 4B1LA 2P5BA 5H9RA 5A7WA 4R4XA 1YIFA 1QJU2 3HQXA 4AAXA 1W6OA 4AQ6A 2ZEYA 1VBC2 1VB2A 3NJVA 1W0PA 1D4M1 1HB4A 1NZIA 2WYSA 1DGRN 4YVWC 5I91A 3OBRA 2ZEZA 4LOTA 5K0UB 3AMMA 4OUEA 2DDUA 4WM7A 4IUGA 2ZGTA 1ZBE3 4PF5A 4HANA 1F4AA 4M4RA 1GYKA 4P08A 4BIOA 3K4ZA 1NQDA 1HW5A 2WNEA 3N9NA 4HKWA 3O7OA 2AC1A 2J22A 3DKQA 1C5HA 3W9AA 4AEJA 4QM8A 3NAPC 1E5SA 3UKVA 1DLCA 3LOBA 4AE2A 5FZAA 4ZS2A 3THTA 5EQUA 5FYMA 4QKDA 1AXZA 5JZGC 1SEFA 1O8SA 3UYJA 4AHWA 5LEKA 1CVNA 1LAJA 3FBMA 5AC93 5FY9A 3H50A 4YVWA 4AVVA 2XXZA 3ZDSA 2ZA9A 3MUY1 4WVMB 3N7JA 4DY5A 4XMAA 2WFPA 1BK0A 4XXPA 5DZEA 3NNJA 2XVGA 4JDNA 5A1LA 5C9AB 4GMP0 1FPN3 3SKJE 4CDQB 2CYFA 1QY4A 1TMF1 2DU0A 4LOSA 5DDJ2 1ULPA 1FMD2 1Q8OA 1UY4A 5DUXA 2FCVA 5JXGA 5F1RA 5I8TA 3O1MA 1IS4A 2RS13 4URAA 4DNYA 5FK7A 3M70A 2RMU2 3NAPA 1NOVA 4TYSA 1WMXA 2YYOA 4UFIA 5J96B 1PK6C 3I2FA 4PCRA 1VBE2 4PLOA 4XHBA 1J1TA 3VBOA 3ZXKA 1A8MA 2LS6A 2OIIA 4XFFA 1H6YA 1UX6A 5JSPA 3LCPA 1POV3 1AYN1 1JS9A 3NNMA 2HWD1 4Y5TA 5D1IA 3WP4A 1VJ2A 4YVSB 4AGRA 5JZGA 4RR3C 2WKKA 1PIV3 1AR63 2F6BA 1ZM1A 3B93A 3ZSMA 5FZ8A 4CPBD 1NCRA 3AX4A 3THDA 4Q4V1 4ES9A 1IZ3A 1BHGA 4LKEA 3RWKX 3LEGA 4F7ZA 5DG1A 4BQ2A 1XNCA 2WA3A 3PVBB 3D4KA 3PUIA 4Z92B 1YFWA 2D43A 3VL8A 4DEQA 3T4VA 3HBZA 1S2EA 1UPSA 5IAXA 4R9AA 5IYYA 1RUF2 2PHDA 1LJ7A 2JKBA 4AEKA 1TNFA 2HWE2 4R9BA 3TEWA 2ZACA 5GZGA 4K1ZA 5FREA 5CKMA 2NQYA 4CCKA 5T52A 4H3WA 2ZGSA 2EA7A 3FUQA 2GNDA 3J26N 5CKQA 1N47A 2DUOA 3HEIA 4AQTA 4FPHA 4Q4W2 4NPRA 1KS5A 4LXLA 4OI1A 3LA7A 2OYZA 2D98A 4CU6A 3F95A 3FHQA 1XOYA 2BZDA 4URTA 3EYPA 1IQDC 4OHXA 4QT6A 4YWAA 4BYYA 1Q5OA 3ZOIA 1VMHA 4YARA 1NA1A 4QX2A 1PZ8A 5ABJC 2EVXA 3AP7A 2KM2A 4WVZA 3D6EA 3POFA 4CDXB 2D5FA 1BEV3 2B4KA 1TME1 4F83A 2JDAA 5FXZA 2WNVB 4AR2A 4A6OA 5EFUA 2VMDA 2WLPA 4IV1A 5L9BA 1X8MA 2Q4SA 5A7WB 4FAHA 2RDSA 3RJRA 1FX5A 2VY0A 3I3DA 5A7OA 3RRDA 4TWTA 1W6OB 4FQZA 1IS5A 4GKYA 1JYXA 2BVVA 3CU7A 4AGGA 3POIA 4COUA 1H2NA 4WM7B 4ISRA 4XJWA 5FO9B 1F8VA 1I5PA 2BGOA 3MW4A 2XB6C 1GWLA 3HN3A 1Z7S3 4GJYA 1RUD1 5T50A 4L9BA 3MIHA 4HETA 5FPZA 1VLNA 3KHBA 2OKXA 3I3QA 1VRH2 2JB4A 4WVVA 4YSFA 4AEDA 3Q9OA 3K3NA 2VGDA 2JDPA 3WNKA 1IGOA 1ZYBA 1XYOA 2UWBA 4DPNA 5JOWA 3TEXA 1HRI2 5JOZA 4JRLA 5FY7A 5IK5A 3FHAA 3LWCA 1S2BA 1W0NA 3GNEA 3L9JT 3SKVA 5APAA 4IERA 4LUMA 1O3RA 1LESA 2P4EA 4CCDA 2CSGA 2QE3A 4HZFA 1NT0A 1OT5A 3FLRA 4HG6B 4CUAA 5KBFA 2P2KA 5E89A 1OLQA 3KV9A 4YVWB 1RUOA 1PO21 5BNOA 5FTTC 1JYTA 1H2KA 4X8PA 3DPRC 1WW6A 5CZKA 1ZZBA 4IESA 4OHWA 5T5LA 4COZA 1O59A 2E26A 4NHYA 4BQWA 1PNGA 1DQ0A 4HT1T 3ILRA 5HBAA 4Y1YA 5CNAA 2K2SA 4C1XA 1WLTA 1G9BA 3BGAA 3RMXA 3ZSJA 3BU0A 2EALA 3WDVA 1JZ2A 4JKKA 1DHKB 1PO13 1W2UA 2GU9A 3NAPB 4QHBA 2XGXA 2VD7A 2L9LA 3I3BA 5C5TA 2F4LA 4NIGA 5LZ6A 1PM7A 5FZ3A 3VBOB 1DGLA 1N3QA 4WBBA 3GZUC 2RS51 4ITCA 1UY0A 3BPZA 2ARAA 1C28A 2PLV2 3HPNA 4V2WA 3GBFA 4BMBA 4EYUA 5JZGB 3LF7A 1MS4A 5C4WC 3WNPA 3AZZA 4CUCA 1C3HA 1GKBA 1XU1A 4A3ZA 1AX2A 2VOXA 3S57A 1NCRB 1ZZ9A 1F15A 1UU4A 1H4HA 1GANA 2VZTA 3DPRA 3I2JA 4NHLA 3FN9A 1VR3A 2WAOA 1VBC1 3AP4A 3FFQA 1EPZA 5C3PA 3ETQA 1AX1A 1RUE2 1C4RA 4R52A 2H0VA 3BPSA 3WF1A 1LENA 4AK3A 1GMMA 1V70A 1PVC3 2R6QA 3VHOA 1LCLA 4EQVA 1IKQA 1B35A 2BNOA 2ERFA 2D5HA 1L3JA 2Q8EA 4COVA 2VUDA 3WD5A 1BVVA 4YRDA 2HYKA 2QQKA 4KWLA 2W2IA 2IFRA 1AR82 2WAAA 5KXCA 3TEYA 4YG6A 5JSOA 2GMEA 5CVRA 3PL0A 5HV4A 4XILA 2J1UA 3MICA 4XQWA 5T54A 1AL22 4P14A 1U0AA 3T0BA 5FY8A 3M1HA 2DU1A 4Y33A 5C4WA 4RQPC 2R072 5C70A 2BQPA 1O3TA 1OF4A 3LKJA 4GWMA 4NPLA 3WHTA 1S0FA 5LATA 3F2ZA 1RHI1 5JDBA 3ELNA 1NA1B 1Q8QA 4BQYA 3VD4A 2IC1A 5FBZA 4DO0A 1W9TA 1R093 3FUOA 2JDHA 5GLVA 4UW5A 1OD5A 4I01A 3OBTA 3CJXA 1IS6A 4XJZA 1AUYA 3CEWA 3CNAA 4FPOB 2DTYA 2DUPA 4JVAA 1WA4A 4IV1B 2OA2A 2XDVA 3L2YA 4Y24A 1J3RA 1FMD1 1COV2 1ONAA 2WBKA 4FOVA 4HXCA 5F2SA 4XE9A 4AVTA 4HKLA 4WVWA 3VKNA 3DL3A 4Y22B 1W04A 5KC6A 3ST7A 5I0DA 3I2GA 1QDCA 1UPIA 2VCAA 3TAYA 4IL7A 1KQRA 4FTSA 1W8NA 4UW3A 1C1FA 3ASIA 3CO2A 1WCKA 5C6CA 3ZO0B 2VJXA 1B09A 1XSRA 5DAXA 1VMFA 3E5UA 3O1OA 1YFYA 2XWBB 3T08A 4AEDB 2UY8A 3GZTB 4EN7B 4ASLA 5A32A 3PVEA 5GLUA 1OFNA 3ZN4A 3Q8BA 4OUSA 1UZ0A 2GN3A 2YHJA 2ZX2A 4HK9A 4UW6A 3T2PA 3SEEA 3FBYA 5FFOC 1Q3EA 4I0AA 3GCXA 3U4XA 4EJRA 1SG3A 4Q5OA 4EN6B 2VUJA 1OH3A 1RUF1 5FMBA 3NO8A 4M0NA 3AMQA 1V6LA 3W59A 5DAVA 5BNOB 4Q8KA 4HL0A 4CA9A 1WLWA 4RSUA 1POV0 4OI4A 4UWDA 1YC61 2V72A 3I4IA 2JECA 1GP5A 3PTYA 5FQ0A 4YW4A 1W6MA 3VBSC 1FATA 1UY3A 4IXLA 1RIRA 4XETA 2JDKA 4KWKA 2F4PA 2FDFA 4EZHA 5FPBA 3KHCA 1XJAA 3ZXJA 1RMU2 3U37A 2B9UA 1S0JA 1RUG1 2JKXA 4LHKA 3AKQA 3N7MA 1H4GA 2JX9A 4W4ZA 3WLUA 2R042 4XF1A 1UYYA 2YROA 1W6NA 1EAH2 1JHJA 1W3XA 4YNIA 5A3WA 2W3JA 4BMEA 2FMDA 2HWB3 3KGZA 2WRAA 5FOBB 5C3RA 4QHZA 1K42A 3GYDA 2NN8A 3SMHA 4ZS3A 3OUJA 4LITA 1VAKA 3UGFA 1WD4A 3AMPA 4JGZC 3SLIA 2O8QA 3M3CA 4C90A 5J09A 3E6CC 4BXFA 1E5IA 3PIGA 3PUAA 2B5HA 2ZTNA 1AYM1 2G9ZA 3AKPA 2ZGOA 1QKQA 2BNNA 1OA4A 3B02A 1NAEA 1LOBA 1OFSA 1OBNA 2PAMA 3VKMA 3D82A 2IXJA 4XF4A 4AHZA 1B35B 2TNFA 2GP5A 1OA2A 1Q43A 1CX4A 1NE4A 3G7DA 4N53A 4LKFA 5LBBA 3GBWA 1AL0G 1US3A 2GH2A 5FZEA 4O9GA 3CL1A 2XG3A 5F5QA 4D7SA 2J1TA 3LQCA 4QXKA 4I02A 5C4WB 5GZEA 1RUNA 2VUCA 3LEIA 3RZKA 5CADA 1IPJA 4BPZA 2NYYA 4K9SA 1YQ6A 1C8M2 4QX0A 2VAUA 4W50A 1C8NA 4CZSA 1EV13 1G9FA 1R082 4JGZA 5J7MA 5ACA3 4AHXA 2R0FA 5DAPA 2BDRA 1GOFA 5FDBA 5IFTA 1EY2A 2BW8A 3KWVA 2LROA 4BLIA 3WG4A 2Q8DA 1JZ8A 2IFWA 3KD4A 4CCCA 4OI0A 4BLJA 1LHNA 1KDKA 1OC1A 1FPN1 2VQTA 3DEMA 5F32A 3HNYM 1ZRIA 3IIIA 3RZGA 4BU2A 1HXS3 1BJQA 1WMEA 1UOFA 2E7QA 4LULA 1APNA 4XTMA 2V09A 3C2UA 2E7TA 4PIYA 3VDBA 1XBFA 1AXKA 1YXWA 1YEWA 2WR9A 3C8XA 4Y4YA 1H8VA 1CIWA 2PLV1 4GB31 2EXKA 3OUHA 4WZFA 5ERLA 1UKRA 5ANNA 1WMFA 2V4AA 4P9JA 3KMHA 4EWEA 1W39A 5CAZA 4XJ8A 2DCKA 1EYBA 1W90A 5A32B 1JN2P 5FZ4A 4AF9A 3AP5A 3ILFA 4LEJA 4LLFA 3HNBM 1AR61 4QX8A 2KA3A 2J1VA 4KI5M 1RTVA 4ET7A 5D21A 5DAQA 3WF0A 4ZPIA 4IEQA 4AI2A 1VBB3 1LTEA 3DYOA 2JE8A 1U5ZA 5DABA 4CEWC 2V5DA 2VZQA 1UYZA 1XC6A 2W1SA 2Q0AA 3PMEA 1VAVA 4Q0QA 1RUJ3 4HSJA 1ZRDA 2Q1MA 2QQUA 4FPCA 3QLQA 3RI8A 2GC3A 4YW6A 2Z2SB 4CDWC 5KXDA 5JOYA 5IT6A 3BKZA 1AR81 2B7YA 3ZYJB 1SMVA 3UESA 4GMP3 1UQXA 3LA3A 2J1SA 2SLIA 1AL21 1OOPC 2CNAA 2GMPA 2ZPXA 4M4PA 1W6MB 5FQ0B 4CP0A 2WZEA 2C26A 4LKSA 1ZZ6A 4D94A 1GU3A 2CGOA 5IVVA 3DXTA 5FZKA 1WZXA 2W91A 3POYA 1UZZA 5CIRA 1O7FA 1SDDB 2D6KA 3ZFGC 1QJX3 2VU9A 2CAVA 3APBA 4KGGA 2ZX3A 1H0BA 3B9CA 3RJ2X 1UAIA 4TZDA 4ATEA 4IEYA 1YI9A 1BCXA 1ND2A 4INDA 5JR7B 1W6NB 1W05A 3BIEA 2AR6A 1D0GA 4MZUA 5FXWA 5FZGA 3VKLA 1OURA 1VBA3 1H9WA 2GALA 1Y9GA 5FY1A 2VZOA 5F7UA 1F2NA 2BOJA 2EIBA 2PAEA 3V64A 4ASKA 1COV1 2FZ1A 2VTXJ 3CHXA 5K0UC 3JB8A 4Q26A 3E6DA 3EBRA 1DQ5A 3HOBA 4QPIA 5KC5A 1TMF2 3TN92 1DZRA 1V6JA 5EHDA 1CESA 4LE4A 2VMHA 2E53A 5FP8A 3ZYPA 1V6OA 2EF6A 1X9TA 2W5FA 1YI7A 1MZ5A 4BOWA 3BTXA 2Z4FA 1R1ZA 1CONA 2DFCA 4J1XA 2R062 3J9SA 2Z5WA 4UFJA 3J8F3 1JXNA 4Y26A 1PGSA 4CYDA 1CAVB 3A23A 1E5RA 4CXWA 4HBNA 4N53B 3I8TA 4UF0A 4XF9A 1Y43B 2P3IA 2Y38A 3MBWA 1NLQA 3ALQA 4FBFA 5J36A 4ZHNA 3PVNA 2HWD2 2RR11 1HN1A 3WOGA 3VKOA 5LRSA 3GZAA 5EYXA 4PQQA 2VOKA 3Q8EA 1ZRCA 1ND3A 1L7QA 5CKNA 2AYHA 2VQAA 4QGNA 1OUSA 3GGLA 4Q4V2 4AZZA 3MIFA 5LASA 5KWRA 3WNMA 5FAXA 3R4SA 5LK7B 3SCHA 2ZX1A 2AREA 4JGZB 4IEVA 3MFAA 3OGRA 2BWAA 4GXLA 1SQ4A 1TE1B 2DVFA 2Y60A 4LLOA 4AQSA 4B8EA 3LB9A 5F3EA 3O0XA 5C9AC 4CDQC 2W92A 4YFZA 3MUZ1 3IMNA 4KNCA 4XFBA 1KEXA 2JIJA 3POWA 4MHUA 1JU3A 1ZZ8A 2FCUA 1A34A 1ZZCA 4MV2A 3JUUA 5IVCA 5FXXA 3LIHA 3JBG3 4IE7A 1LGNA 4R9DA 4CU7A 2PHUA 2EICA 3ZMOA 1W2AX 3P5BA 4LMFA 3TRSB 3ZXLA 1L7RA 4CCMA 1SACA 2BYVE 2YPJA 4YVSC 1W8ZA 3LPGA 3WG3A 2WLQA 5DZFA 2FQPA 2MPFA 4P9WA 3ACLA 3ETPA 1VBD3 1MZFA 3T30A 3R4UA 1TME2 1R1A2 2OZ6A 2VW0A 3WHUA 3O5SA 2Y34A 3WP6A 5K7PA 1GNHA 4A4AA 4YZ1A 3N9PA 2AGSA 2A6WA 3URFA 1GZ9A 3A4UA 3P3NA 1UCXA 4FPEA 4YZ4A 2ZHKA 4HVOA 5LY1A 4YW3A 2VG9A 3N7KA 1D0HA 3K77A 2PHXA 2VVEA 1UL9A 5A70A 3ILNA 4QGMA 4FP3A 3NJXA 2WINB 4IEZA 4OZOA 3OPZA 3R4DB 1GLHA 4OUMA 5LW9A 4Q8LA 2FMYA 2D3RA 1PVC1 5H9QA 3PTRB 4CEYC 1MQTA 4AGVA 3AJZA 3IIAA 5FLJA 2ET7A 3O0WA 4IE4A 5K9YA 3WCSA 1EPWA 5LA9A 5IK7A 1RGSA 4COWA 2RMU3 5G04L 2WIIB 4D7YA 3AKRA 4IGOA 2XUMA 4XMIA 4D3WA 1N1VA 1Q8PA 1ZX5A 2X5IA 2YBPA 1LR5A 5JSRA 3MI8A 1CD3G 5DG2A 3T3YA 3RMYA 3KT4A 4CDXC 3RZLA 1W6PB 2RM21 2CV6A 2Y6KA 1ND2B 3DYPA 4MUVA 4K6BA 1UYPA 4A42A 3O1PA 5LA2A 1S0CA 4L8QA 4MGSA 1PO22 1UNBA 5FPLA 3KV6A 4NE9A 4XC9A 1PNFA 4BIFA 1GFF2 1DGWA 1NY71 3USUA 4Y5Z0 4CEYA 2P3KA 4QPIB 5FBJA 4WM7C 2VOVA 3ZM8A 3VKFC 4Y4RA 5JPMB 3VD3A 2D6LX 2XJTA 2B46X 5FIXA 3D0JA 4QXHA 1REDA 3DV8A 3ZLIA 1K5JA 4LE3A 4P9YA 3ZPYA 5L7OA 4XXAA 2WL1A 2HWE3 1NX9A 4QGLA 2A75A 4R4ZA 2ZX0A 3T2QA 2ZOEB 1ENXA 3I2KA 4UF0B 3WW4A 4BISA 5J1XA 2YDEA 2OVUA 4FPKA 1LOGA 3VDCA 4Q4W3 2MEV3 1Q56A 2EXHA 4QB2A 1ND3B 3NQHA 1XNTA 5JIAA 3UKNA 3OY8A 3ABZA 4NWWA 2PMWB 1JUIA 4FPGA 2YV8A 3MHZA 3EJKA 1RUI2 4Q4Y2 4MGTA 5J98B 1J58A 2NM1A 3PLQA 1MEC3 4NHMA 4CSWA 3W5NA 2B39A 4LO8A 1RUH3 1XYPA 2R0HA 2ZBJA 4Z07A 3LFMA 1CWPA 4WV8A 2ZHLA 3BTAA 1RXFA 1S0GA 1WKYA 2AZ5A 4G3YC 4H7LA 3KGLA 2QJVA 2IZWA 4JAAA 4FPLA 2P1BA 2WJSA 3ACIA 3H8UA 1JZ7A 4NUBA 3LA2A 3QCWA 3ZR6A 1IHMA 3ACGA 4HSLA 4XABA 4XFHA 1UMZA 3WX5A 5F3IA 4B3NA 4JKLA 3VBOC 3A22A 4UFLA 2DCTA 4S2HA 3U75A 5JAXA 4IGQA 3CZUA 3WQ0A 3WW3A 4XW3A 3EO6A 4JX0A 2YY1A 1RHI2 2XR4A 2NMNA 4FFHA 2P3YA 4D6QA 1NCRC 1T6GC 3C7EA 4IGPA 1SPPA 2VCMA 3HT2A 3V65A 4QAWA 4GULA 3O1SA 2J1RA 1NG0A 3QBQA 4FOYA 4C91A 3PU8A 4XURA 1QNYA 1ZREA 3TN91 2OX0A 5FMOS 2FBEA 4Q4X2 4X6QB 1BK1A 2XHKA 1W9WA 1UMHA 2BBAA 1UY1A 4JTOA 4MYEA 5IVYA 5IFPA 5EYYA 3OPTA 2XJVA 3GALA 1MZEA 2R061 1KITA 2YUEA 2HEWF 3KVAA 1SDWA 4DUVA 4XIOA 3ES1A 4N9IA 4DUWA 4OULA 1MQTB 3MV01 3JD73 2A6XA 4LHLA 4MOAA 5CBLA 1QQP2 2QQJA 4BCUA 2XBO2 3J7NA 1RUC1 4LIUA 4N8MA 2AACA 4UFMA 4YW5A 1YLLA 5EZWA 3JQWA 4QPYA 4ZZ5A 1DCSA 1NA1C 1LGBA 2PHTA 1UKGA 4GD4A 4SLIA 4WM8A 4ZU4A 2X5IB 5FYCA 3VN4A 2VW1A 4XQ4A 4JGYC 4W6XA 3O1UA 2ZMKA 2AENA 1HLCA 2O0OA 2C6SA 2DWRA 3RYRA 3I2IA 4JDMA 2YC4A 4JC1A 1KXGA 5E1RA 4IV1C 4Q1PA 5ACA1 1KDMA 2ORZA 4G9SB 4F3JA 1YYNA 2JDUA 1WCUA 3NNLA 5D8AA 3VZKA 1VB4A 3N7LA 2QQWA 1RJ7A 3USUB 3M2MA 1K5MC 3FJSA 1RUE3 4CEYB 4LR4A 1Y3TA 2DCJA 3RG0A 3GXUA 3LZZA 1FOD3 4FCAA 4N9HA 4M00A 5FY0A 1MVQA 2C5DA 1JI6A 2IXKA 4C8DA 3LDBA 5T5JA 1JOJA 3NMBA 1RUG2 3H7JA 1QJY1 1AR93 5L7OB 1HXS1 2CDOA 4AEDC 4QX5A 1Y4WA 1NE6A 2NPIA 3OYWA 1QXPA 5K8SA 5LB6A 4JGYA 4AI3A 3DYMA 4N7IA 1NUKA 1QXJA 3OCPA 1FNYA 2WFF3 1R1A1 2OS2A 2R073 3C7FA 5CB7A 4RD7A 5IJRA 2VH9A 3HBKA 3WDUA 2R30A 1J84A 3RYKA 1BBT3 4Y5SA 3AKTA 3OY8B 4JDOA 3SITA 2UYAA 4Y22A 4OHZA 4DXSA 1CZTA 1G8WA 2BU9A 1K5MA 4B29A 5BNOC 1AYM2 5CA6A 4OHYA 5F39A 2D6OX 5BY5A 2KR2A 4XCAA 2DFBA 2UWCA 3HVDA 3RS6A 1VBB1 3MW3A 1JYIA 3AXEA 4OCTA 2BVBA 2JDNA 3I97A 5LBEA 1H8TA 1ZBE2 5A7PA 5FV3A 3MLLA 4BE3A 4YZ3A 2Y0IA 5FJHA 2VQUA 2FZ2A 2QZ2A 1ST8A 1GZTA 2YFUA 3BVCA 4GMP1 5A6YA 1G9DA 3J4UH 3K51A 3OSDA 3SQOA 5IVBA 4P9LA 1DGRA 5IUQA 3AVSA 2GNBA 4IV3A 1DLLA 3THPA 4BQ5A 3E5XA 1UX7A 4DXRA 1ASJ3 2ZGUA 1OH4A 3OGGA 4UT5A 1YQ2A 2DF7A 5KXBA 3NVCA 4Y20A 5FMCA 2WN3A 1NYWA 2LALA 1DF0A 1NLSA 3BALA 1LHOA 1QH6A 1QJX1 3KZ4C 5FYUA 1FAYA 3MIGA 4E27A 1SPPB 5FZDA 2DUQA 2X29A 5AC92 3R6SA 1CPMA 3KCYA 4AEMA 2VCBA 1VBA1 3MF9A 4E8DA 4CP1A 4QQOA 1UF2C 3VV1A 1F5JA 4YGCA 2VBBA 3RNSA 4BZ4A 3A0KA 4KH9A 4HMZA 1B35C 1N3PA 5FZLA 1FPN2 2JG9C 4AVBA 3RQ0A 2OT7A 2BGPA 3IB3A 4TSVA 3J7HA 4NR1A 3VZOA 3IAQA 3VL9A 2VZRA 4AI9A 3EXUA 1S2KA 2RS12 2VPVA 5CEHA 1C57A 4MGIE 5F8PA 2WT2A 4GB32 1D2QA 5FOJB 4TLGA 2C9AA 1KGYA 3MV11 4P9XA 3I7DA 5DMYA 2VNGA 1RMU3 2C1FA 3ZKYA 1WD3A 2VNVA 4HK8A 2B9VA 4DRVA 1GQGA 1AR62 1CZSA 1RUI1 2I2SA 4NRPA 4Q4Y1 3C3VA 4WM8B 4XJUA 3U78A 5SV5A 3HN1A 2BFUS 5KR7A 3I3MA 3AM2A 2WZR3 2W0XA 5C5UA 3WY6A 3WSOA 3H3UA 3IPVA 4Q1RA 1W06A 4BXSV 5IK8A 2JG9A 2FDJA 1LEMA 3UGHA 3RVHA 1PX4A 2H0BA 4CCOA 4CPBA 4P9GA 5JCTA 4OLLA 5D8AB 1G6NA 3D0SA 4AFAA 1JU4A 1CJDA 1J3PA 5FWJA 5FYZA 5GZDA 1AJOA 1G9AA 2Q1ZB 3VUOA 2JB8A 1CGPA 5L19A 2PQQA 5FZHA 5JI9A 3NNGA 3U11A 1ULCA 4A41A 4QX3A 2VM9A 4YGBA 2YMZA 4QU1A 4H2AA 5BNPA 1POQA 4A7YA 2YPDA 3EHKA 1ZBA3 3HWJA 2R16A 3OYWB 4IDZA 1XNKA 2BRTA 3RZZA 4JGYB 1YQCA 1XU2A 4O65A 1O6UA 4RHV3 1N1TA 1HIXA 1NLRA 2VMEA 3NWKA 1O91A 1W9FA 1OA3A 2J7MA 1V9U3 4MO3M 3C7OA 2KD7A 3OTFA 4Q4X1 1BEV2 5AVPA 4BH9A 5CG8A 2HWC3 4SBVA 5A33A 4FVVA 2QNKA 3VBRA 2A1XA 1XE8A 2WS91 3S7EA 1FT9A 1K5MB 3H8XA 3FMGA 1YFUA 3VDDB 1AR71 1RVF3 2VOWA 2O8OA 2CHHA 3IDCB 4XYXA 5FKCA 4Q0PA 2N7GA 2HWF3 2P17A 3RPQA 2DCYA 5FZBA 1UOGA 1H8TB 1QQP1 5AVAA 4LK6A 2XBO1 1FV2A 2C9KA 2Y6LA 4FO9A 1Z7S2 5GJ6A 1GWMA 1LGCA 2RS33 2RR12 5FO7B 4BQ4A 4K40A 5IVEA 5I8SA 3EB7A 5BPXA 2G9GA 4IV3B 1WLDA 1HJFA 3CJIB 1G86A 1GP6A 1U5YA 2OUJA 4Y20B 4Y1ZA 5FZCA 4DOUA 2XMLA 3GF6A 4GWNA 1MR5A 4XBQA 2PHWA 4E2GA 1D7PM 1D2SA 4D8MA 1Z78A 1BXHA 1OLMA 3NV3A 1Y7BA 4GA9A 4I3PA 5CISA 3WNXA 4CXXA 2HBUA 1PMJX 1PMIA 1JZ4A 2Y0OA 1D4M3 1WW4A 1PGW1 2D93A 2X53S 1JYCA 3MW2A 4QHOA 4Z2AA 4DUXA 1WWYA 4ATFA 4LBNA 4A7ZA 4N53C 1OQEA 4ZZ8A 1T6BX 4NPMA 2E63A 4NWVA 4PI0A 2XJQA 4R9CA 3H9AA 1PO12 4RGGA 2E31A 4E2QA 1FI2A 1JYWA 1JZ5A 1SZBA 2J1AA 2ZGMA 4FAGA 3RDIA 3RZMA 2OW4A 3HIFA 3Q8FA 1WGPA 3SNMA 2A70A 3V0AA 2MEV1 3B69A 5FUIA 5GZFA 3VBFB 1ZNPA 1SCSA 2XL7A 3SISA 3IN9A 5FYVA 3VHNA 1PZ7A 1QJFA 2OZJA 3KB5A 5FLIA 3BU7A 3IPVB 1W9SA 1RITA 5FYYA 1YIPA 3NW4A 2JG9B 3AVRA 1CAVA 1GQPA 2XWJB 4KBBA 3BI3A 2V4VA 1ZBE1 3UL2A 5HCAA 4QXCA 1ULEA 1PVC2 4NIHA 2EIEA 1JTZX 3SH5A 1TMF3 1GICA 4UFKA 1LRHA 2I45A 3K48A 4FPJA 3ZYGA 1IQAA 2XH6A 4EROA 3M7AA 1QEXA 4MGQA 5BXXA 4XCBA 5HI0A 2IWGB 2YU1A 3POGA 5BNPB 3GDBA 1S0BA 1KFXL 1PX3A 2FD8A 5A7SA 3HQUA 1AYN3 1K3IA 1LOAA 3ZN5A 1HDKA 2HWD3 4ZKTB 2VULA 2RM22 3HT1A 1PM4A 2EAAA 3GHMA 1I3HA 2CDPA 5KHHA 5AC91 2A6VA 3U07A 3T1LA 2BPA2 3N9QA 3FC0A 5FKBA 1H30A 4BQ3A 2H6BA 1VALA 1LODA 4DZGA 1NY72 3GM8A 1HN0A 4HVQA 2CL2A 5KHIA 4I09A 1W6QB 2GC2A 3OF1A 1SBFA 4CDUA 5A33B 3VBRB 1W28A 1JUHA 2CAUA 2ILMA 3GBGA 2D40A 2XOMA 5FPAA 2W95A 2KXLA 2CGPA 2PN5A 4YW1A 1DU3D 2RS11 2WNUC 4HVRA 2Z42A 4XUOA 1JW6A 2DVGA 3KCCA 4P02B 4LKDA 4LPLA 2IXLA 4ARXA 2ZHNA 1JMUB 5JOXA 1UIKA 4IQPA 5JXIA 3CMGA 4D69A 1HJGA 1UY2A 1GNYA 1POV1 1VAMA 2RG4A 2ZEWA 1OLME 3BN6A 3B00A 3JD71 4PIXA 4S2DA 2DVBA 4GH4B 1PIV1 3D8CA 2Q8CA 5JXHA 5LY2A 3ME2A 1C1LA 1ND2C 4M3CA 4ASMB 1PGL1 1W8HA 2G4IA 4X6RB 3VDAA 1VP6A 2LRPA 1GZWA 4LNVA 4BA6A 3PJQA 2CY6A 2VO5A 2ZHMA 4K8RB 5F37A 1IPKA 3ZMNA 3L2HA 5FPUA 4QPIC 1W3VA 3H1MA 1ODMA 2WNUA 1XXNA 1OQ1A 1YNAA 1M06G 5DZGA 3W5MA 2O14A 3O12A 4NRMA 4BHPA 3S5QA 4YGDA 5IVJA 1AVBA 1VRBA 2WSVA 4XEZA 2VZ3A 4YYOA 2A6ZA 3B9IA 2E33A 3OGJA 2F17A 2OUHA 4S2GA 1RUD3 3W58A 5I0UA 5FPXA 1CQ9A 1W6PA 3DUIA 2W1UA 5LRRA 1O3SA 3M3OA 3ZXFA 1AR91 1RC6A 3RI9A 1ND3C 2R49A 4W6WA 2NLRA 3BIWE 5FPVA 1BMV1 2QCSB 3MGUA 4LBLA 4LA2A 4XAEA 1GV9A 1O4TA 2FCTA 3U4SA 4ONUA 4AXOA 1BEV1 1WCSA 3SC7X 2HWB2 4NOTA 2WFF1 4H7MA 3TNPB 4BK5A 1VMJA 2CU5A 2OQ6A 3N4MA 1DQ4A 3E5QA 1J1LA 3IDEA 3V0AB 2ZJCA 1GSLA 3A7QA 3I59A 3MIEA 1PHMA 2GC1A 2RJ2A 3IM0A 2IXIA 2ZMLA 4IEXA 2WABA 1PO23 4IEUA 1QGLA 3BTYA 1D4VB 2ZEXA 2XONA 4W6YA 2OXBA 2ZGPA 1HRV3 2HLEA 1VE0A 1XE7A 4FFGA 4FPYA 5T5OA 2BJSA 5KHJA 4YW7A 1Z7S1 4KG8A 4D6SA 5C33A 5JLVA 3V0BA 1XRUA 1X50A 3AYDA 3OD4A 3WG1A 5FP9A 5B4XA 3T4HB 1RUC2 5EXOA 4GWIA 4LBQD 4Q0UA 3W20A 1CPNA 4QX7A 4BQXA 5HPOA 3CQOA 5DUUA 4ARYA 1GBGA 3ATGA 2MHFA 1X33A 2RS53 4PT6A 3VZJA 3DN7A 4BK4A 5I0RA 4M3CF 1JZ6A 1ASJ1 3AMHA 1QOTA 2ES3A 2ARCA 2ORXA 1EV12 1SCRA 4O7XA 1QU0A 2BP6A 5ACA2 2LUWA 4BWOA 1QJU3 3MIDA 1ZRRA 2PHFA 4GKXA 4K1YA 4OZXA 1VBC3 1J59A 3AP9A 3HMYA 1DYOA 1WBLA 3WQBA 1UZWA 2O1QA 3ZPOA 4CDUB 5GLTA 2JEMA 1BLZA 2WWUA 2JD4A 3INAA 3WNNA 1MQTC 4XUNA 5F3GA 3KT1A 3VZLA 2NP0A 1PO11 3KM5A 1QJY2 2PFWA 4C0BA 2FDGA 1HXS2 1LU2A 1PZ9A 2PA7A 4V2VA 2E7AA 5A3PA 1RINA 4LQRA 3HJRA 3N9OA 1KRIA 1HX6A 3PUSA 3U14A 5CYYA 3I2HA 3DKWA 1OXCA 3POSA 5L9RA 4TTGA 1FV3A 1WCDJ 4IE6A 2X5IC 2XHNA 5C3SA 1NCQA 4M0HA 5A1FA 2ZCWA 1SFYA 4XJAA 2GSYA 2JENA 1RHI3 2BWCA 5D2AA 5IW0A 2WQ8A 4M3CB 3X29B 2VZVA 4YG0A 3IBMA 4HN0A 4NMIA 1F5FA 1UIJA 2QFEA 1DYKA 3S5AA 1H6XA 2XJPA 5BNNC 1GZWB 1YO8A 4QB1A 5FZOA 5JXJA 2GMMA 3PMSA 5KXEA 4RS5C 1Q8VA 2JJ6A 2RJLA 5IATA 2NZ9A 1LEDA 4MGKE 1VBB2 3ON7A 4UW4A 4QDQA 5FMDA 5EV7A 3GZEA 4XDOA 4AFBA 1LOFA 2YC0A 5DDJ3 1FMD3 2WNUB 2QQVA 1RUJ2 1KD7A 3AYAA 4I0WB 2PAKA 1JHNA 2TBVA 3O1VA 2P3JA 3FHIB 1ULOA 1JOPA 4R8HA 2EXIA 2JIGA 4AI8A 4E8CA 1GOGA 2ARXA 5FZIA 5L7OC 5DXDA 1ACCA 1VBE3 1SBDA 4QDRA 5FY5A 1LHUA 3K3OA 2YFZA 4MX3A 3T0AA 2W94A 3LEMA 4PBOA 1V00A 1H1AA 2VZSA 4MGZE 4QB6A 4Y1UA 3S30A 1DQ2A 4MH0E 4Q0VA 1REFA 1UOBA 1QJX2 4OVEA 3ZFFA 3NRUA 1UO9A 4XACA 4HN1A 4LIVA 5BNNA 2UURA 2EXJA 1R091 1WMDA 3CBNA 4G4FA 4QWNA 5J37A 4RS5A 3V56A 1MS3A 1VBA2 1W8UA 4EV0A 1W03A 4GWJA 4Z2WA 2D6MA 4XFAA 3ACHA 4KGQA 2JDYA 4MSVA 4RFT0 3WVJA 5C3QA 1LECA 3FE5A 3B94A 3PIJA 1ENRA 3I59B 2HWC1 5LBFA 1GWKA 1RUF3 3JCIA 2BV4A 1U5XA 4OMDA 1W9YA 2PELA 3D5OA 2W1WA 3AFGA 3NKTA 5E88A 4LUKA 3DXUA 3H42B 4META 1UMIA 2JE9A 5L73A 3N36A 2VCCA 3T09A 4OHVA 5F5AA 5K4LA 1JZ3A 4IEWA 3ZX7A 2HWF1 4B7KA 3CLPA 3UJQA 1UWWA 2ZKLA 3V0BB 1XNDA 5CG9A 3LIGA 2VMCA 1T2XA 4FQ4A 3U1XA 3AC0A 4W8JA 1WBFA 3NL1A 4FTEA 1EUTA 4LTAA 1GQHA 4XIKA 2RS31 2JG8C 1RUG3 1UOJA 4FP2A 2X10A 2JDZA 5IHRA 3K2OA 1HKDA 1UXZA 3VZMA 3U10A 2Y6GA 2AEZA 4DY3A 5C3OA 4O9EA 4ZXKA 2VTXA 1AXYA 2PHRA 4NHXA 3WEZA 5CFCA 1GUIA 2QQPA 4XZPA 2UWAA 3ZYRA 4YM0A 1URXA 3AL5A 4K3UA 2D97A 1KJRA 4RGKA 5A80A 4QM9A 1DIWA 3C7GA 3FFZA 5FYTA 1TNRA 2J42A 1XNBA 4LBQA 1MS0A 4FPFA 3G6JB 1XQNA 4Z8BA 2RDRA 2A73B 1AYM3 5GLZA 2WWJA 3ZXDA 2OPWA 1FYUA 5IAVA 2K46A 5ISLA 2R32A 4XJ9A 2QDRA 2Y26A 1QJEA 3AXDA 4NRQA 1YJKA 3JBG2 1F31A 2IXCA 3O0VA 1LHVA 3BB6A 5A7NA 4L99A 4PHZA 2JG8A 3ZYHA 1V6KA 4YZ2A 1OQDA 2HKXA 1VRH3 3NJZA 3H3LA 2VTFA 4PF1A 4DFSA 4XFCA 4Z1VA 5CFDA 4XHXA 4BQ1A 4N43C 3E97A 5LA1A 2UU8A 1SHWB 3AMNA 5SV8A 4MGYE 1HRI3 5A6ZA 1F4HA 2W68A 4DXZA 2HWB1 1SBEA 1IS3A 4WM8C 1UU5A 2Y6FA 3ZYIB 2HH9A 3QH6A 3WXPA 1VBD2 4EWAA 1NCQB 2GZWA 2ZZQA 3WNOA 4QPGC 2A3YA 2OQ7A 4CCNA 2XJSA 4EN9B 2ZGLA 4A7KA 3LEKA 3LPFA 5FZ9A 2WS92 3VBUC 4GZ9A 4YM1A 5D8AC 5IK4A 1CZVA 1AR72 5LK5A 5FZOB 3ACFA 4DIQA 2VOTA 4C0HA 1DZQA 2ZMNA 1YWKA 3VLBB 4FFFA 1JBCA 2QQNA 3UV9A 4UFHA 4N43A 4NHKA 1SLCA 2DV9A 3PU3A 5C8CC 3LD8A 5FYIA 5FWEA 4FSJA 3ZVXA 3ENRA 3KLSA 5FK8A 1KS4A 1MPXA 1U5IA 4XUQA 2PLV3 4GB33 2J1EA 1NQJA 2LW8A
chains in the Genus database with same CATH topology
5FYMA 5FUPA 5FP3A 2GP3A 3K3NA 5F3EA 4QU1A 3UYJA 2YPDA 2OS2A 5F32A 3PUQA 4AAPA 4CSWA 5FY9A 5FY7A 4BU2A 5FYSA 2XXZA 4D6SA 2YU1A 5IVCA 4TN7A 5FXXA 5F2WA 5FP9A 5A1LA 3DXUA 5A7SA 3KV9A 4QX7A 5F39A 4NUBA 4CCMA 5F5AA 2YBKA 5K4LA 4CCJA 5FZ4A 4URAA 3N9QA 5F3IA 4E4HA 4QX8A 5A7PA 5FV3A 3NJYA 4IGQA 5FJHA 3K2OA 4GAZA 5FY4A 3N9PA 5IVBA 5FZBA 2PXJA 2VD7A 3AVSA 5FZ1A 4D6QA 5FPAA 4IGPA 5LY1A 5FZ8A 5FZ3A 3AL5A 4EZHA 5FPBA 5A80A 3PU8A 4V2WA 3ZPOA 5F5IA 4EYUA 5FYTA 5IVEA 2WWUA 3AL6A 2OX0A 5FYUA 3OPWA 3KV5A 5FZDA 5LW9A 5F3GA 2XUEA 5IVYA 5IVVA 3PTRB 4GJZA 2WWJA 3DXTA 3OPTA 5FZCA 4V2VA 5FP7A 5FZKA 2XMLA 5A3WA 5FP4A 5F3CA 2Q8CA 5ISLA 5A3PA 5FZ0A 5LY2A 5LWBA 3N9OA 3KVAA 5FYHA 5FZFA 5A7NA 5FZ7A 3PUSA 3PURA 4EZ4A 5FZLA 4IGOA 4QXBA 4LITA 2OT7A 3KV4A 4CCKA 5A7QA 2YBPA 5FXWA 5FZGA 4AI9A 4BXFA 5FZAA 4CUGA 5A1FA 5F37A 3PUAA 2Q8EA 5IW0A 5FY1A 5FUNA 3KVBA 4LIUA 5CEHA 5FPUA 4LXLA 4CCLA 4ASKA 2W2IA 3N9MA 2YBSA 4GD4A 5FYCA 2GP5A 5FPLA 5FY8A 5FZOA 4Y33A 2P5BA 5FP8A 5A7WA 2OQ7A 3KV6A 4CCNA 5FZEA 5A3TA 5IVJA 1VRBA 4XDOA 5FZ9A 5FBJA 5E6HA 3U78A 5FXZA 5A3NA 4Y4RA 5FZOB 5IVFA 5KR7A 4UF0A 4HONA 5A7WB 3PDQA 4DO0A 5FZIA 4DIQA 4QXHA 5A7OA 4XDPA 5FZ6A 3ZLIA 5FZMA 2YU2A 5FY5A 4HOOA 5FXVA 5FYBA 5FPVA 3N9NA 3K3OA 3RVHA 5FYVA 4CCOA 5FJKA 3N9LA 5FY0A 4D6RA 4UF0B 4BISA 2XDVA 3PU3A 4Y3OA 3LD8A 3U4SA 5FYIA 4C8DA 5FWEA 3LDBA 5FYZA 2OQ6A 5F5CA 5FWJA 5F2SA 4GJYA 5FYYA 5FZHA 3AVRA 5IWFA 2Q8DA 4LIVA 5ANQA 4QXCA 4QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYM A;  5FUP A;  5FP3 A;  2GP3 A;  3K3N A;  5F3E A;  4QU1 A;  3UYJ A;  2YPD A;  2OS2 A;  5F32 A;  3PUQ A;  4AAP A;  4CSW A;  5FY9 A;  5FY7 A;  4BU2 A;  5FYS A;  2XXZ A;  4D6S A;  2YU1 A;  5IVC A;  4TN7 A;  5FXX A;  5F2W A;  5FP9 A;  5A1L A;  3DXU A;  5A7S A;  3KV9 A;  4QX7 A;  5F39 A;  4NUB A;  4CCM A;  5F5A A;  2YBK A;  5K4L A;  4CCJ A;  5FZ4 A;  4URA A;  3N9Q A;  5F3I A;  4E4H A;  4QX8 A;  5A7P A;  5FV3 A;  3NJY A;  4IGQ A;  5FJH A;  3K2O A;  4GAZ A;  5FY4 A;  3N9P A;  5IVB A;  5FZB A;  2PXJ A;  2VD7 A;  3AVS A;  5FZ1 A;  4D6Q A;  5FPA A;  4IGP A;  5LY1 A;  5FZ8 A;  5FZ3 A;  3AL5 A;  4EZH A;  5FPB A;  5A80 A;  3PU8 A;  4V2W A;  3ZPO A;  5F5I A;  4EYU A;  5FYT A;  5IVE A;  2WWU A;  3AL6 A;  2OX0 A;  5FYU A;  3OPW A;  3KV5 A;  5FZD A;  5LW9 A;  5F3G A;  2XUE A;  5IVY A;  5IVV A;  3PTR B;  4GJZ A;  2WWJ A;  3DXT A;  3OPT A;  5FZC A;  4V2V A;  5FP7 A;  5FZK A;  2XML A;  5A3W A;  5FP4 A;  5F3C A;  2Q8C A;  5ISL A;  5A3P A;  5FZ0 A;  5LY2 A;  5LWB A;  3N9O A;  3KVA A;  5FYH A;  5FZF A;  5A7N A;  5FZ7 A;  3PUS A;  3PUR A;  4EZ4 A;  5FZL A;  4IGO A;  4QXB A;  4LIT A;  2OT7 A;  3KV4 A;  4CCK A;  5A7Q A;  2YBP A;  5FXW A;  5FZG A;  4AI9 A;  4BXF A;  5FZA A;  4CUG A;  5A1F A;  5F37 A;  3PUA A;  2Q8E A;  5IW0 A;  5FY1 A;  5FUN A;  3KVB A;  4LIU A;  5CEH A;  5FPU A;  4LXL A;  4CCL A;  4ASK A;  2W2I A;  3N9M A;  2YBS A;  4GD4 A;  5FYC A;  2GP5 A;  5FPL A;  5FY8 A;  5FZO A;  4Y33 A;  2P5B A;  5FP8 A;  5A7W A;  2OQ7 A;  3KV6 A;  4CCN A;  5FZE A;  5A3T A;  5IVJ A;  1VRB A;  4XDO A;  5FZ9 A;  5FBJ A;  5E6H A;  3U78 A;  5FXZ A;  5A3N A;  4Y4R A;  5FZO B;  5IVF A;  5KR7 A;  4UF0 A;  4HON A;  5A7W B;  3PDQ A;  4DO0 A;  5FZI A;  4DIQ A;  4QXH A;  5A7O A;  4XDP A;  5FZ6 A;  3ZLI A;  5FZM A;  2YU2 A;  5FY5 A;  4HOO A;  5FXV A;  5FYB A;  5FPV A;  3N9N A;  3K3O A;  3RVH A;  5FYV A;  4CCO A;  5FJK A;  3N9L A;  5FY0 A;  4D6R A;  4UF0 B;  4BIS A;  2XDV A;  3PU3 A;  4Y3O A;  3LD8 A;  3U4S A;  5FYI A;  4C8D A;  5FWE A;  3LDB A;  5FYZ A;  2OQ6 A;  5F5C A;  5FWJ A;  5F2S A;  4GJY A;  5FYY A;  5FZH A;  3AVR A;  5IWF A;  2Q8D A;  4LIV A;  5ANQ A;  4QXC A;  4QWN A; 
#chains in the Genus database with same CATH topology
 1CAX A;  4QPG A;  4UAP A;  4DS0 A;  4XDQ A;  1QNW A;  2UY9 A;  1TG7 A;  1EV1 1;  2VW2 A;  4JZR A;  4MG2 A;  2ETE A;  2CGN A;  3ZFF B;  2VMG A;  4J1W A;  4DRR A;  2C4X A;  3PUH A;  3VBU A;  2P6C A;  4S2F A;  2RDN A;  4A2U A;  5BNN B;  2B42 B;  3H1Y A;  1LKN A;  4PDW C;  4RS5 B;  4E4S A;  5F2W A;  2Y6J A;  3MLK A;  1NXD 1;  3OEB A;  3VDD C;  5I0T A;  2Q1F A;  2BGC A;  2R1D A;  2VBD A;  2VZ1 A;  3RWN A;  1PGW 2;  2ZGQ A;  4L97 A;  1Y9Q A;  2XLF A;  1V6I A;  2ZGK A;  2VVF A;  4KMQ A;  5C8C A;  4QD2 A;  1H8T C;  3QOP A;  1ULF A;  2PQS A;  4JQR A;  2JXA A;  2XLA A;  3SEP A;  1XPW A;  3ZFE C;  2R7E B;  5HV0 A;  1AR8 3;  2GN7 A;  4V1P A;  3ROU A;  3H7Y A;  3VGI A;  3O1T A;  3KQR A;  4EWD A;  1AL2 3;  3FWE A;  3EQE A;  3WF2 A;  1XB9 A;  4U2A A;  1PK6 A;  5JMC A;  3PVO A;  4PI2 A;  4YFW A;  3QAC A;  5FRA A;  1FXZ A;  1S0E A;  3AYE A;  4IV3 C;  4I2O A;  1QWR A;  2XVK A;  4E4Z A;  3IT8 A;  1SLB A;  5GZC A;  3CJI C;  2D3P A;  1ZVF A;  2ZKN A;  1ALY A;  4PJY A;  4RR3 A;  4XAA A;  1CX1 A;  3VBH C;  1F35 A;  4Q29 A;  2MEV 2;  3AZY A;  1S55 A;  4PDW A;  3UET A;  2AH2 A;  2VMF A;  4QU2 A;  3ZR5 A;  2RE9 A;  1U12 A;  3SH4 A;  1MZ6 A;  3AYC A;  1OD3 A;  3VDD A;  3WW2 A;  4B7E A;  4CU9 A;  5CFC B;  3IDB B;  3LSE A;  4MAD A;  2RDQ A;  2ZAA A;  3I49 A;  3RGB A;  2Q5T A;  4QQ2 A;  5FO8 B;  1MEC 2;  2C24 A;  4XBL A;  4CXY A;  5HCF A;  1RUH 2;  1COV 3;  2HEY F;  1RUJ 1;  4LBQ B;  3ZFE A;  5LWB A;  1X36 A;  3W21 A;  2GC0 A;  5FZF A;  5E16 A;  1O8P A;  1YCI A;  2PYT A;  5FZ7 A;  1LOC A;  1OVP A;  5KHK A;  3ZDV A;  1O5L A;  4KBZ A;  4B1M A;  3AZW A;  2VZP A;  3T2T A;  4MXV A;  1S4C A;  2P34 A;  3AZX A;  2VNO A;  3GCW A;  4K8F A;  1BVP 1;  4UOJ A;  1I6X A;  2QQI A;  2LTN A;  3CJI A;  5FUN A;  3S0M A;  1TEI A;  5T5P A;  1W2O A;  2JG8 B;  3POB A;  3VBH A;  4XOG A;  2BNM A;  2YB7 A;  4L2N A;  1DYP A;  5CFD B;  2RR1 3;  3FL7 A;  3KS7 A;  4YW2 A;  5AFE A;  4XF3 A;  3ZIX A;  3DCQ A;  4A44 A;  4NID A;  2XKO A;  3B01 A;  1C5I A;  3NV2 A;  4LBM A;  2WO3 A;  5ABJ A;  1A6C A;  3VBF C;  3LDR A;  5M0T A;  1JOD A;  1W8O A;  3ZIW A;  4D0Q A;  2JWP A;  4Y1X A;  2VQ0 A;  4NJ4 A;  1DQ6 A;  4QQP A;  1BQP A;  1OPM A;  4X8N A;  4XUT A;  2Q8O A;  4C1W A;  4K20 A;  1A78 A;  2K9Z A;  3TB0 A;  5B4N A;  3AK0 A;  3I2O A;  2FHR A;  5FR3 A;  4OQ9 A;  3MPB A;  3AJY A;  5H9P A;  4LT5 A;  3H1W A;  5EJZ B;  4NAO A;  3LOI A;  5FZ6 A;  2VR4 A;  2R1B A;  3JZV A;  3TNQ A;  4E9K A;  3DF0 A;  5FXV A;  2FDH A;  4YM2 A;  2ARB A;  2DYC A;  5E8A A;  5A3M A;  1O5U A;  4YM3 A;  1XSQ A;  1OI6 A;  3I2D A;  1QDO A;  3J8F 1;  5A3O A;  3RZJ A;  4AL9 A;  5F5C A;  5HCH A;  1HRV 1;  3POJ A;  4TLF A;  4AYU A;  5BUV A;  2DVA A;  5IWF A;  4FOW A;  1TVG A;  5FMO L;  1REE A;  4GJZ A;  4N43 B;  5BNP C;  2YG0 A;  3JD7 2;  4YGE A;  2XPJ A;  1EUU A;  4KU7 A;  1PIV 2;  3O14 A;  3VBF A;  3BTZ A;  2JE7 A;  2IVJ A;  2R04 3;  4XUP A;  5EJ1 B;  3OGV A;  1ENS A;  5GM0 A;  1OKQ A;  1EAH 3;  1G7Y A;  1K12 A;  2H6C A;  3R0R A;  4CP9 A;  4XQD A;  1PGL 2;  3AB0 A;  1CAX B;  4QPG B;  4TN7 A;  2IVI B;  2JIC A;  5BV6 A;  2VZU A;  1NKG A;  2A71 A;  4MVT A;  3ZSE A;  2VEC A;  1NZC A;  1V0A A;  3VBU B;  3ES4 A;  2RV9 A;  4OMC A;  2ADE A;  3JQX A;  1LU1 A;  3AZV A;  5DUW A;  3ZXE A;  3VBR C;  4CCJ A;  4E2S A;  2FDI A;  3UGG A;  4XTP A;  5LEJ A;  1I5Z A;  1QJU 1;  4L11 A;  3RFR A;  2NMO A;  3IKW A;  4K21 A;  3AFK A;  3KCX A;  2HEV F;  2XQX A;  2ZZJ A;  4DIN B;  1F9K A;  2DTW A;  3JBG 1;  1JOB A;  2WT1 A;  3NJY A;  1J3Q A;  4I30 A;  1ENQ A;  5C8C B;  1A8D A;  4LBO A;  4TXW A;  5HXM A;  1FOD 2;  5JIU A;  4CUB A;  4OQ8 A;  4LOR A;  1L7L A;  4GH4 C;  4H55 A;  3SCF A;  1AR9 2;  1PK6 B;  5LBC A;  2XVL A;  4KWU A;  1SLA A;  2WZ8 A;  1BMV 2;  3WF4 A;  5F5I A;  3P1I A;  3WCR A;  3A21 A;  1VBD 1;  4XF0 A;  1C8M 3;  3EMR A;  4A3X A;  4FT8 A;  2WDB A;  4IEP A;  1XE0 A;  4U36 A;  2WFF 2;  3OEA A;  2ZGR A;  2XUE A;  1W6Q A;  1R08 3;  4RR3 B;  3T2O A;  4CE8 A;  4UXA A;  3ZYF A;  1QHD A;  5C8W A;  1A3K A;  2ET1 A;  4PDW B;  2RM2 3;  3MEP A;  4ZXE A;  3C7H A;  2QZ3 A;  2WT0 A;  1BBT 2;  2WSU A;  2E6V A;  2W87 A;  4LBK A;  4Y1V A;  5LCW L;  3FX3 A;  2WUH A;  2WYF A;  4XBN A;  3SCG A;  3WQ7 A;  3PUR A;  4EZ4 A;  1AJK A;  2E9Q A;  4L92 A;  2GNT A;  1H2L A;  2YGM A;  5A7Q A;  3TWI A;  2ADD A;  4QKF A;  4D7T A;  5T55 A;  2G1M A;  3ZFE B;  1H1I A;  2WNO A;  4O61 A;  4QDS A;  5DDJ 1;  4CCL A;  2RVA A;  1TQ5 A;  4GH4 A;  4PBP A;  1RYY A;  3WR0 A;  3H3Z A;  3KF5 A;  4AWD A;  3USS A;  3IZO A;  4AVC A;  5I0S A;  1GOH A;  2XLG A;  3WIN E;  1QJZ A;  2RMU 1;  3LE0 A;  1W8W A;  2VVD A;  1YHF A;  4KWJ A;  4NN0 A;  4NIA A;  3MZH A;  2DVD A;  1VBE 1;  1MS9 A;  1BKZ A;  1OLR A;  4RQP A;  1RB8 G;  2GAU A;  3VBH B;  3FLP A;  3FLT A;  1ASJ 2;  4PLM A;  3CKH A;  1AHS A;  1E5H A;  4MXW A;  5C71 A;  5J3U A;  3I3E A;  1W2T A;  2BTV C;  2D7F A;  3NST A;  3BOP A;  3IAP A;  1N1S A;  3S7I A;  4ES8 A;  5ABJ B;  5FLH A;  3O1R A;  2QBX A;  4HOO A;  1V6M A;  3H8O A;  1Y9M A;  3OJB A;  5F6K A;  3OG2 A;  2W46 A;  4LO5 B;  4QMA A;  5FYB A;  1VPH A;  2WN2 A;  5HCB A;  4MLO A;  3KF3 A;  1HQW A;  4I3G A;  4AG4 A;  3WF3 A;  3LGR A;  1DG6 A;  2UYB A;  3ORJ A;  2ZAH A;  3VHR A;  4ZON A;  1ODN A;  4AI1 A;  4YLZ A;  1QOO A;  4CP2 A;  4AQ2 A;  1GP4 A;  2QQO A;  4CTE A;  1QXR A;  4HLT A;  3IMM A;  5FP3 A;  1CJP A;  5G05 L;  3RZH A;  3I54 A;  1RL3 A;  3PNA A;  4FFI A;  1DFQ A;  1O3Q A;  2B45 X;  2G19 A;  2HWE 1;  3OOX A;  1LOE A;  4GQ7 A;  1LUL A;  1XNA A;  1YJL A;  3CF6 E;  3PUQ A;  1SLI A;  3PJY A;  4JTN A;  4M01 A;  3JU9 A;  4NVP A;  4LK7 A;  5FYS A;  5GAL A;  3ECQ A;  1KJL A;  4KU8 A;  4UBG A;  4AVA A;  4Q4W 1;  3VHP A;  2YGL A;  4OI2 A;  1OKO A;  2CWS A;  1HV1 A;  3AKS A;  4XPV A;  2I74 A;  2VNR A;  3WW1 A;  3OGS A;  1YRZ A;  1YQ8 A;  3RYP A;  4CP9 B;  4L0P A;  5KHG A;  2YBK A;  4AI0 A;  3HAG A;  3JXS A;  1MEC 1;  4UBH A;  3WZ1 A;  2WZR 2;  3M3E A;  1NXM A;  1RUH 1;  5H9S A;  4E4H A;  5CU1 A;  1I9R A;  1PMH X;  1ULD A;  2XJR A;  4HPK A;  4NRO A;  4QQH A;  4DMI A;  4PLN A;  3TN9 3;  4CDU C;  1N3O A;  4GAZ A;  1MS8 A;  5DQ0 A;  1MVE A;  3LDK A;  4DB5 A;  3KSC A;  2A6Y A;  4W65 A;  1M4W A;  3DPR B;  3GJB A;  4A6S A;  4YG3 A;  2BFU L;  1LHW A;  2PXJ A;  4RYD A;  1W2N A;  2R06 3;  1P8J A;  5FZ1 A;  4AFC A;  3N3H A;  4CRQ A;  1AZD A;  4FTB A;  4QX1 A;  3VBS A;  4NAM A;  4Q0S A;  4H14 A;  2ID4 A;  2V73 A;  4LO6 B;  3OBA A;  1UD1 A;  1UXX X;  1Z0H A;  2D3S A;  1FNZ A;  3KV5 A;  3NV1 A;  3OPW A;  1VRH 1;  1HQL A;  1RUC 3;  1OPO A;  1ZBA 2;  1SFP A;  2LM3 A;  5DUV A;  3T1M A;  3BCW A;  3K75 B;  5FCC A;  5FP7 A;  1DBN A;  4Q4V 3;  3UJO A;  4EN8 B;  4IEO A;  5C7G A;  1H9P A;  1WW7 A;  1R09 2;  3H0O A;  1ULG A;  1HRI 1;  2HBT A;  1UN1 A;  2D44 A;  4RHV 2;  2ZXQ A;  5I8Y A;  2A3X A;  2CTV A;  2Z69 A;  3WP3 A;  3WP5 A;  2GH8 A;  2PTM A;  1V9U 2;  1PVX A;  2WQ4 A;  4UYB A;  3KV4 A;  3WV6 A;  2W1Q A;  1UW8 A;  3VB9 A;  4IE5 A;  2QKD A;  4ISQ A;  5JPN B;  3POE A;  2HWC 2;  5JI7 A;  5LA0 A;  1W8F A;  3Q8A A;  3ZSK A;  1V6N A;  2W52 A;  1OSG A;  5A3U A;  1JH5 A;  2YBS A;  3MPP G;  3SH3 A;  4B4P A;  4JKM A;  4CCE A;  4BDV B;  1RVF 2;  5A3L A;  5I93 A;  2WO2 A;  5F9T A;  5EIY B;  4OYU A;  2VUA A;  1DGW X;  2TUN A;  3BOW A;  3K46 A;  2QUO A;  2HWF 2;  4QQL A;  1HQN A;  2P37 A;  1UZV A;  2ZS6 B;  3CZJ A;  3LFI A;  1CAW A;  5A3N A;  5GLW A;  2RS3 2;  1YFX A;  1QJY 3;  3LAG A;  1S0D A;  3N35 A;  2ATF A;  5EJ3 A;  3UNP A;  1GZC A;  3MIB A;  4RQP B;  4XDP A;  2MNG A;  5FZM A;  4OFG A;  5DPN A;  5EP9 A;  1SLT A;  1R1A 3;  1RXG A;  1TME 3;  4MXW B;  2WZP P;  3M8L A;  5FJK A;  4CU8 A;  4D6R A;  4UI9 L;  2QQL A;  4LBJ A;  5JWP A;  1WUV A;  1TZO A;  2XKP A;  1MS5 A;  1YUD A;  1GNZ A;  2W08 A;  1QIQ A;  4F8A A;  1SLL A;  4J25 A;  2QQM A;  4BJ0 A;  2Y8K A;  3NV4 A;  5FUP A;  2AEY A;  4LO7 A;  1RUE 1;  2FDK A;  1OHF A;  1DQ1 A;  1D4M 2;  2A5Z A;  2AUY A;  2EID A;  2QVS B;  1FOD 1;  4AAP A;  1R64 A;  4RA0 A;  3VD7 A;  2VXJ A;  3J7L A;  4ZY9 A;  5JVV A;  1MS1 A;  3MYX A;  3MFC A;  3WQ1 A;  3BYW A;  1X9P A;  2IUW A;  2CWM A;  3WDT A;  4RN5 A;  4IET A;  2D6N A;  3NNF A;  2X05 A;  2XJU A;  2ENR A;  3VD5 A;  3B3Q E;  2R07 1;  1OMI A;  1IKP A;  3CIH A;  4I0B A;  2Y6H A;  3WUD A;  3RSJ A;  1JYN A;  3THC A;  5JMO A;  5A6X A;  1K45 A;  1BBT 1;  1IPS A;  5L9V A;  4DEV A;  3WDX A;  2EAK A;  2ZGN A;  3SHR A;  4CVU A;  3LSD A;  2X8K A;  4XZU G;  1BYH A;  1QH7 A;  1S0I A;  5BYN A;  2BBV A;  3VZN A;  1DP0 A;  3P6B A;  4GAL A;  1W99 A;  1QMJ A;  3MF6 A;  2OPK A;  2ZAB A;  4HPK B;  4CEW A;  3OB8 A;  3FZ3 A;  4KG0 A;  2VC9 A;  3WDW A;  3K4D A;  2I07 B;  4JCK A;  1AF9 A;  4XVH A;  4CDW A;  5A6Q A;  1OF3 A;  3WNL A;  2RJK A;  3AL6 A;  3WG2 A;  2E32 A;  1OOP A;  4AFD A;  4JHZ A;  3ZN6 A;  3VBS B;  4NO4 A;  3PHM A;  3KT7 A;  2YXS A;  1X7N A;  4MHR A;  4P00 B;  1W0O A;  1CIY A;  3M4F A;  4YZ5 A;  2W47 A;  2QTW B;  5FZ0 A;  4E4D X;  3OUI A;  4AW7 A;  1HV0 A;  2WWS A;  3M3I A;  4JHT A;  3ZFG A;  1RJ8 A;  2TEP A;  4P9I A;  3E6B A;  5J48 A;  2BER A;  1UU6 A;  1NCQ C;  1AYN 2;  1CAU A;  3AP6 A;  2DUR A;  4LHS A;  1IG0 A;  1LNS A;  2DBI A;  5EWS A;  4PIZ A;  4Z82 A;  5T3N A;  2BOI A;  1RUI 3;  4Q4Y 3;  4LA3 A;  1H1M A;  4B4Q A;  2B8M A;  1I1E A;  2Y64 A;  3N9M A;  2RHP A;  1QF3 A;  1ZRF A;  1DZT A;  4Q27 A;  5K0U A;  5JUV A;  4KQ7 A;  4RL7 A;  3WUC A;  3UT0 A;  4QKN A;  4M3C E;  4XFG A;  1LOF C;  4RGA A;  2BUK A;  5BNQ A;  5A3T A;  3MLJ A;  3M3Q A;  3QH7 A;  4GIQ A;  1KFU L;  3GHN A;  4XFI A;  2C0Z A;  1E57 A;  5HXV A;  5E6H A;  3ZXG A;  1UYX A;  1AX0 A;  2VXR A;  5IVF A;  2GNM A;  1ZA7 A;  3S6P A;  4HON A;  1SFN A;  1US2 A;  4AOC A;  3PDQ A;  1N1Y A;  4K7J A;  1H2M A;  3R05 A;  1MAC A;  1HB2 A;  2Z79 A;  2YU2 A;  2A7A A;  2SBA A;  1RMU 1;  1CAW B;  1OUX A;  3Q8C A;  3OD0 A;  4HKO A;  3N9L A;  4ORF A;  2YC2 A;  4WZC A;  3E1F 1;  1WCQ A;  4Y3O A;  3ZFF C;  1Q8S A;  4ZU5 A;  2R04 1;  2G9F A;  4AHY A;  1EAH 1;  2WZR 1;  3D3A A;  4IW3 A;  4YPJ A;  2IXH A;  4N90 A;  5AFB A;  4WVM A;  3DEC A;  5ANQ A;  5DN2 A;  2X09 A;  3TOJ A;  3SXW A;  4P5H A;  2WC2 A;  2GP3 A;  3A0N A;  3CDZ B;  3T0D A;  4Q4X 3;  3UKT A;  5C9A A;  4Q2F A;  1OVS A;  3ITQ A;  4EN0 A;  4CDQ A;  4EE2 A;  2W9X A;  1WW5 A;  4BM8 A;  1CR7 A;  2WS9 3;  3ZYB A;  1WLC A;  2XL9 A;  4N7U A;  4QKB A;  2WA4 A;  3MDP A;  3KQ4 B;  1AR7 3;  3JB4 C;  2VE1 A;  4BB3 A;  1G9C A;  1HB1 A;  1XYN A;  1GR3 A;  4ZU7 A;  4DQA A;  3WDY A;  2DBN A;  1HB3 A;  5GKA C;  4AFM A;  4IE0 A;  5TSW A;  3HD8 B;  1J83 A;  1QQP 3;  3MO4 A;  4B4R A;  4LJH A;  2XBO 3;  2Y33 A;  5A1A A;  3IDA A;  1RUD 2;  1ZBA 1;  3TBD A;  1LB2 A;  2JDM A;  3QD6 A;  4YVS A;  4FOQ A;  2YZ4 A;  2GDF A;  3B7M A;  4A45 A;  5B2G B;  3P3P A;  1ZA4 A;  3NKG A;  4FXK B;  4RHV 1;  2HYX A;  1S1A A;  1CN1 A;  5FY4 A;  5CFC C;  1V9U 1;  2HJI A;  2W39 A;  3ZKU A;  1C8M 1;  4COY A;  2XQR A;  2K0G A;  3HQR A;  1UZY A;  3UK9 A;  3VD9 A;  1R08 1;  2JD9 A;  2PHL A;  4P5Y A;  5DAW A;  4LHN A;  2DCZ A;  4FI9 A;  5F6L B;  2VL4 A;  2WNV C;  4HFS A;  3H8R A;  3BOD A;  4QPW A;  1RVF 1;  4DXT A;  1EP0 A;  2WQZ C;  3ZSL A;  3B5L B;  3HNM A;  2P6H A;  1WA6 X;  2EIG A;  3ZXA C;  1STM A;  3J8F 2;  4CEW B;  3WT3 A;  1HRV 2;  1VIW B;  1X82 A;  1IOA A;  5F3C A;  4KL1 A;  4CDW B;  1W8T A;  2A3W A;  5FP4 A;  3TYJ A;  3U0Z A;  5FYH A;  2QDN A;  5JR2 A;  2V5Y A;  4LO4 B;  4JQT A;  3K4A A;  1OOP B;  1JYV A;  2VMI A;  3TEZ A;  5CFD C;  2VBP A;  5EPA A;  2WO1 A;  4QXB A;  3ZN6 B;  3J7M A;  1QOS A;  1IG3 A;  3IWZ A;  3HR9 A;  3GJA A;  4NII A;  4CUG A;  3DGT A;  4RFR B;  5L36 A;  2E51 A;  1X8E A;  3KVB A;  3OBZ A;  3ZFG B;  2RS5 2;  4AVS A;  4CDX A;  2Q30 A;  1DDL A;  1BZW A;  1O4Z A;  2BEO A;  4JRA A;  1CAU B;  1O4Y A;  3BUC A;  1ZZ7 A;  2D6P A;  2WO7 A;  4J6G A;  1YQ5 A;  4JV4 A;  2ZX4 A;  2WNV A;  4FXG B;  4PQ9 A;  4B1L A;  2P5B A;  5H9R A;  5A7W A;  4R4X A;  1YIF A;  1QJU 2;  3HQX A;  4AAX A;  1W6O A;  4AQ6 A;  2ZEY A;  1VBC 2;  1VB2 A;  3NJV A;  1W0P A;  1D4M 1;  1HB4 A;  1NZI A;  2WYS A;  1DGR N;  4YVW C;  5I91 A;  3OBR A;  2ZEZ A;  4LOT A;  5K0U B;  3AMM A;  4OUE A;  2DDU A;  4WM7 A;  4IUG A;  2ZGT A;  1ZBE 3;  4PF5 A;  4HAN A;  1F4A A;  4M4R A;  1GYK A;  4P08 A;  4BIO A;  3K4Z A;  1NQD A;  1HW5 A;  2WNE A;  3N9N A;  4HKW A;  3O7O A;  2AC1 A;  2J22 A;  3DKQ A;  1C5H A;  3W9A A;  4AEJ A;  4QM8 A;  3NAP C;  1E5S A;  3UKV A;  1DLC A;  3LOB A;  4AE2 A;  5FZA A;  4ZS2 A;  3THT A;  5EQU A;  5FYM A;  4QKD A;  1AXZ A;  5JZG C;  1SEF A;  1O8S A;  3UYJ A;  4AHW A;  5LEK A;  1CVN A;  1LAJ A;  3FBM A;  5AC9 3;  5FY9 A;  3H50 A;  4YVW A;  4AVV A;  2XXZ A;  3ZDS A;  2ZA9 A;  3MUY 1;  4WVM B;  3N7J A;  4DY5 A;  4XMA A;  2WFP A;  1BK0 A;  4XXP A;  5DZE A;  3NNJ A;  2XVG A;  4JDN A;  5A1L A;  5C9A B;  4GMP 0;  1FPN 3;  3SKJ E;  4CDQ B;  2CYF A;  1QY4 A;  1TMF 1;  2DU0 A;  4LOS A;  5DDJ 2;  1ULP A;  1FMD 2;  1Q8O A;  1UY4 A;  5DUX A;  2FCV A;  5JXG A;  5F1R A;  5I8T A;  3O1M A;  1IS4 A;  2RS1 3;  4URA A;  4DNY A;  5FK7 A;  3M70 A;  2RMU 2;  3NAP A;  1NOV A;  4TYS A;  1WMX A;  2YYO A;  4UFI A;  5J96 B;  1PK6 C;  3I2F A;  4PCR A;  1VBE 2;  4PLO A;  4XHB A;  1J1T A;  3VBO A;  3ZXK A;  1A8M A;  2LS6 A;  2OII A;  4XFF A;  1H6Y A;  1UX6 A;  5JSP A;  3LCP A;  1POV 3;  1AYN 1;  1JS9 A;  3NNM A;  2HWD 1;  4Y5T A;  5D1I A;  3WP4 A;  1VJ2 A;  4YVS B;  4AGR A;  5JZG A;  4RR3 C;  2WKK A;  1PIV 3;  1AR6 3;  2F6B A;  1ZM1 A;  3B93 A;  3ZSM A;  5FZ8 A;  4CPB D;  1NCR A;  3AX4 A;  3THD A;  4Q4V 1;  4ES9 A;  1IZ3 A;  1BHG A;  4LKE A;  3RWK X;  3LEG A;  4F7Z A;  5DG1 A;  4BQ2 A;  1XNC A;  2WA3 A;  3PVB B;  3D4K A;  3PUI A;  4Z92 B;  1YFW A;  2D43 A;  3VL8 A;  4DEQ A;  3T4V A;  3HBZ A;  1S2E A;  1UPS A;  5IAX A;  4R9A A;  5IYY A;  1RUF 2;  2PHD A;  1LJ7 A;  2JKB A;  4AEK A;  1TNF A;  2HWE 2;  4R9B A;  3TEW A;  2ZAC A;  5GZG A;  4K1Z A;  5FRE A;  5CKM A;  2NQY A;  4CCK A;  5T52 A;  4H3W A;  2ZGS A;  2EA7 A;  3FUQ A;  2GND A;  3J26 N;  5CKQ A;  1N47 A;  2DUO A;  3HEI A;  4AQT A;  4FPH A;  4Q4W 2;  4NPR A;  1KS5 A;  4LXL A;  4OI1 A;  3LA7 A;  2OYZ A;  2D98 A;  4CU6 A;  3F95 A;  3FHQ A;  1XOY A;  2BZD A;  4URT A;  3EYP A;  1IQD C;  4OHX A;  4QT6 A;  4YWA A;  4BYY A;  1Q5O A;  3ZOI A;  1VMH A;  4YAR A;  1NA1 A;  4QX2 A;  1PZ8 A;  5ABJ C;  2EVX A;  3AP7 A;  2KM2 A;  4WVZ A;  3D6E A;  3POF A;  4CDX B;  2D5F A;  1BEV 3;  2B4K A;  1TME 1;  4F83 A;  2JDA A;  5FXZ A;  2WNV B;  4AR2 A;  4A6O A;  5EFU A;  2VMD A;  2WLP A;  4IV1 A;  5L9B A;  1X8M A;  2Q4S A;  5A7W B;  4FAH A;  2RDS A;  3RJR A;  1FX5 A;  2VY0 A;  3I3D A;  5A7O A;  3RRD A;  4TWT A;  1W6O B;  4FQZ A;  1IS5 A;  4GKY A;  1JYX A;  2BVV A;  3CU7 A;  4AGG A;  3POI A;  4COU A;  1H2N A;  4WM7 B;  4ISR A;  4XJW A;  5FO9 B;  1F8V A;  1I5P A;  2BGO A;  3MW4 A;  2XB6 C;  1GWL A;  3HN3 A;  1Z7S 3;  4GJY A;  1RUD 1;  5T50 A;  4L9B A;  3MIH A;  4HET A;  5FPZ A;  1VLN A;  3KHB A;  2OKX A;  3I3Q A;  1VRH 2;  2JB4 A;  4WVV A;  4YSF A;  4AED A;  3Q9O A;  3K3N A;  2VGD A;  2JDP A;  3WNK A;  1IGO A;  1ZYB A;  1XYO A;  2UWB A;  4DPN A;  5JOW A;  3TEX A;  1HRI 2;  5JOZ A;  4JRL A;  5FY7 A;  5IK5 A;  3FHA A;  3LWC A;  1S2B A;  1W0N A;  3GNE A;  3L9J T;  3SKV A;  5APA A;  4IER A;  4LUM A;  1O3R A;  1LES A;  2P4E A;  4CCD A;  2CSG A;  2QE3 A;  4HZF A;  1NT0 A;  1OT5 A;  3FLR A;  4HG6 B;  4CUA A;  5KBF A;  2P2K A;  5E89 A;  1OLQ A;  3KV9 A;  4YVW B;  1RUO A;  1PO2 1;  5BNO A;  5FTT C;  1JYT A;  1H2K A;  4X8P A;  3DPR C;  1WW6 A;  5CZK A;  1ZZB A;  4IES A;  4OHW A;  5T5L A;  4COZ A;  1O59 A;  2E26 A;  4NHY A;  4BQW A;  1PNG A;  1DQ0 A;  4HT1 T;  3ILR A;  5HBA A;  4Y1Y A;  5CNA A;  2K2S A;  4C1X A;  1WLT A;  1G9B A;  3BGA A;  3RMX A;  3ZSJ A;  3BU0 A;  2EAL A;  3WDV A;  1JZ2 A;  4JKK A;  1DHK B;  1PO1 3;  1W2U A;  2GU9 A;  3NAP B;  4QHB A;  2XGX A;  2VD7 A;  2L9L A;  3I3B A;  5C5T A;  2F4L A;  4NIG A;  5LZ6 A;  1PM7 A;  5FZ3 A;  3VBO B;  1DGL A;  1N3Q A;  4WBB A;  3GZU C;  2RS5 1;  4ITC A;  1UY0 A;  3BPZ A;  2ARA A;  1C28 A;  2PLV 2;  3HPN A;  4V2W A;  3GBF A;  4BMB A;  4EYU A;  5JZG B;  3LF7 A;  1MS4 A;  5C4W C;  3WNP A;  3AZZ A;  4CUC A;  1C3H A;  1GKB A;  1XU1 A;  4A3Z A;  1AX2 A;  2VOX A;  3S57 A;  1NCR B;  1ZZ9 A;  1F15 A;  1UU4 A;  1H4H A;  1GAN A;  2VZT A;  3DPR A;  3I2J A;  4NHL A;  3FN9 A;  1VR3 A;  2WAO A;  1VBC 1;  3AP4 A;  3FFQ A;  1EPZ A;  5C3P A;  3ETQ A;  1AX1 A;  1RUE 2;  1C4R A;  4R52 A;  2H0V A;  3BPS A;  3WF1 A;  1LEN A;  4AK3 A;  1GMM A;  1V70 A;  1PVC 3;  2R6Q A;  3VHO A;  1LCL A;  4EQV A;  1IKQ A;  1B35 A;  2BNO A;  2ERF A;  2D5H A;  1L3J A;  2Q8E A;  4COV A;  2VUD A;  3WD5 A;  1BVV A;  4YRD A;  2HYK A;  2QQK A;  4KWL A;  2W2I A;  2IFR A;  1AR8 2;  2WAA A;  5KXC A;  3TEY A;  4YG6 A;  5JSO A;  2GME A;  5CVR A;  3PL0 A;  5HV4 A;  4XIL A;  2J1U A;  3MIC A;  4XQW A;  5T54 A;  1AL2 2;  4P14 A;  1U0A A;  3T0B A;  5FY8 A;  3M1H A;  2DU1 A;  4Y33 A;  5C4W A;  4RQP C;  2R07 2;  5C70 A;  2BQP A;  1O3T A;  1OF4 A;  3LKJ A;  4GWM A;  4NPL A;  3WHT A;  1S0F A;  5LAT A;  3F2Z A;  1RHI 1;  5JDB A;  3ELN A;  1NA1 B;  1Q8Q A;  4BQY A;  3VD4 A;  2IC1 A;  5FBZ A;  4DO0 A;  1W9T A;  1R09 3;  3FUO A;  2JDH A;  5GLV A;  4UW5 A;  1OD5 A;  4I01 A;  3OBT A;  3CJX A;  1IS6 A;  4XJZ A;  1AUY A;  3CEW A;  3CNA A;  4FPO B;  2DTY A;  2DUP A;  4JVA A;  1WA4 A;  4IV1 B;  2OA2 A;  2XDV A;  3L2Y A;  4Y24 A;  1J3R A;  1FMD 1;  1COV 2;  1ONA A;  2WBK A;  4FOV A;  4HXC A;  5F2S A;  4XE9 A;  4AVT A;  4HKL A;  4WVW A;  3VKN A;  3DL3 A;  4Y22 B;  1W04 A;  5KC6 A;  3ST7 A;  5I0D A;  3I2G A;  1QDC A;  1UPI A;  2VCA A;  3TAY A;  4IL7 A;  1KQR A;  4FTS A;  1W8N A;  4UW3 A;  1C1F A;  3ASI A;  3CO2 A;  1WCK A;  5C6C A;  3ZO0 B;  2VJX A;  1B09 A;  1XSR A;  5DAX A;  1VMF A;  3E5U A;  3O1O A;  1YFY A;  2XWB B;  3T08 A;  4AED B;  2UY8 A;  3GZT B;  4EN7 B;  4ASL A;  5A32 A;  3PVE A;  5GLU A;  1OFN A;  3ZN4 A;  3Q8B A;  4OUS A;  1UZ0 A;  2GN3 A;  2YHJ A;  2ZX2 A;  4HK9 A;  4UW6 A;  3T2P A;  3SEE A;  3FBY A;  5FFO C;  1Q3E A;  4I0A A;  3GCX A;  3U4X A;  4EJR A;  1SG3 A;  4Q5O A;  4EN6 B;  2VUJ A;  1OH3 A;  1RUF 1;  5FMB A;  3NO8 A;  4M0N A;  3AMQ A;  1V6L A;  3W59 A;  5DAV A;  5BNO B;  4Q8K A;  4HL0 A;  4CA9 A;  1WLW A;  4RSU A;  1POV 0;  4OI4 A;  4UWD A;  1YC6 1;  2V72 A;  3I4I A;  2JEC A;  1GP5 A;  3PTY A;  5FQ0 A;  4YW4 A;  1W6M A;  3VBS C;  1FAT A;  1UY3 A;  4IXL A;  1RIR A;  4XET A;  2JDK A;  4KWK A;  2F4P A;  2FDF A;  4EZH A;  5FPB A;  3KHC A;  1XJA A;  3ZXJ A;  1RMU 2;  3U37 A;  2B9U A;  1S0J A;  1RUG 1;  2JKX A;  4LHK A;  3AKQ A;  3N7M A;  1H4G A;  2JX9 A;  4W4Z A;  3WLU A;  2R04 2;  4XF1 A;  1UYY A;  2YRO A;  1W6N A;  1EAH 2;  1JHJ A;  1W3X A;  4YNI A;  5A3W A;  2W3J A;  4BME A;  2FMD A;  2HWB 3;  3KGZ A;  2WRA A;  5FOB B;  5C3R A;  4QHZ A;  1K42 A;  3GYD A;  2NN8 A;  3SMH A;  4ZS3 A;  3OUJ A;  4LIT A;  1VAK A;  3UGF A;  1WD4 A;  3AMP A;  4JGZ C;  3SLI A;  2O8Q A;  3M3C A;  4C90 A;  5J09 A;  3E6C C;  4BXF A;  1E5I A;  3PIG A;  3PUA A;  2B5H A;  2ZTN A;  1AYM 1;  2G9Z A;  3AKP A;  2ZGO A;  1QKQ A;  2BNN A;  1OA4 A;  3B02 A;  1NAE A;  1LOB A;  1OFS A;  1OBN A;  2PAM A;  3VKM A;  3D82 A;  2IXJ A;  4XF4 A;  4AHZ A;  1B35 B;  2TNF A;  2GP5 A;  1OA2 A;  1Q43 A;  1CX4 A;  1NE4 A;  3G7D A;  4N53 A;  4LKF A;  5LBB A;  3GBW A;  1AL0 G;  1US3 A;  2GH2 A;  5FZE A;  4O9G A;  3CL1 A;  2XG3 A;  5F5Q A;  4D7S A;  2J1T A;  3LQC A;  4QXK A;  4I02 A;  5C4W B;  5GZE A;  1RUN A;  2VUC A;  3LEI A;  3RZK A;  5CAD A;  1IPJ A;  4BPZ A;  2NYY A;  4K9S A;  1YQ6 A;  1C8M 2;  4QX0 A;  2VAU A;  4W50 A;  1C8N A;  4CZS A;  1EV1 3;  1G9F A;  1R08 2;  4JGZ A;  5J7M A;  5ACA 3;  4AHX A;  2R0F A;  5DAP A;  2BDR A;  1GOF A;  5FDB A;  5IFT A;  1EY2 A;  2BW8 A;  3KWV A;  2LRO A;  4BLI A;  3WG4 A;  2Q8D A;  1JZ8 A;  2IFW A;  3KD4 A;  4CCC A;  4OI0 A;  4BLJ A;  1LHN A;  1KDK A;  1OC1 A;  1FPN 1;  2VQT A;  3DEM A;  5F32 A;  3HNY M;  1ZRI A;  3III A;  3RZG A;  4BU2 A;  1HXS 3;  1BJQ A;  1WME A;  1UOF A;  2E7Q A;  4LUL A;  1APN A;  4XTM A;  2V09 A;  3C2U A;  2E7T A;  4PIY A;  3VDB A;  1XBF A;  1AXK A;  1YXW A;  1YEW A;  2WR9 A;  3C8X A;  4Y4Y A;  1H8V A;  1CIW A;  2PLV 1;  4GB3 1;  2EXK A;  3OUH A;  4WZF A;  5ERL A;  1UKR A;  5ANN A;  1WMF A;  2V4A A;  4P9J A;  3KMH A;  4EWE A;  1W39 A;  5CAZ A;  4XJ8 A;  2DCK A;  1EYB A;  1W90 A;  5A32 B;  1JN2 P;  5FZ4 A;  4AF9 A;  3AP5 A;  3ILF A;  4LEJ A;  4LLF A;  3HNB M;  1AR6 1;  4QX8 A;  2KA3 A;  2J1V A;  4KI5 M;  1RTV A;  4ET7 A;  5D21 A;  5DAQ A;  3WF0 A;  4ZPI A;  4IEQ A;  4AI2 A;  1VBB 3;  1LTE A;  3DYO A;  2JE8 A;  1U5Z A;  5DAB A;  4CEW C;  2V5D A;  2VZQ A;  1UYZ A;  1XC6 A;  2W1S A;  2Q0A A;  3PME A;  1VAV A;  4Q0Q A;  1RUJ 3;  4HSJ A;  1ZRD A;  2Q1M A;  2QQU A;  4FPC A;  3QLQ A;  3RI8 A;  2GC3 A;  4YW6 A;  2Z2S B;  4CDW C;  5KXD A;  5JOY A;  5IT6 A;  3BKZ A;  1AR8 1;  2B7Y A;  3ZYJ B;  1SMV A;  3UES A;  4GMP 3;  1UQX A;  3LA3 A;  2J1S A;  2SLI A;  1AL2 1;  1OOP C;  2CNA A;  2GMP A;  2ZPX A;  4M4P A;  1W6M B;  5FQ0 B;  4CP0 A;  2WZE A;  2C26 A;  4LKS A;  1ZZ6 A;  4D94 A;  1GU3 A;  2CGO A;  5IVV A;  3DXT A;  5FZK A;  1WZX A;  2W91 A;  3POY A;  1UZZ A;  5CIR A;  1O7F A;  1SDD B;  2D6K A;  3ZFG C;  1QJX 3;  2VU9 A;  2CAV A;  3APB A;  4KGG A;  2ZX3 A;  1H0B A;  3B9C A;  3RJ2 X;  1UAI A;  4TZD A;  4ATE A;  4IEY A;  1YI9 A;  1BCX A;  1ND2 A;  4IND A;  5JR7 B;  1W6N B;  1W05 A;  3BIE A;  2AR6 A;  1D0G A;  4MZU A;  5FXW A;  5FZG A;  3VKL A;  1OUR A;  1VBA 3;  1H9W A;  2GAL A;  1Y9G A;  5FY1 A;  2VZO A;  5F7U A;  1F2N A;  2BOJ A;  2EIB A;  2PAE A;  3V64 A;  4ASK A;  1COV 1;  2FZ1 A;  2VTX J;  3CHX A;  5K0U C;  3JB8 A;  4Q26 A;  3E6D A;  3EBR A;  1DQ5 A;  3HOB A;  4QPI A;  5KC5 A;  1TMF 2;  3TN9 2;  1DZR A;  1V6J A;  5EHD A;  1CES A;  4LE4 A;  2VMH A;  2E53 A;  5FP8 A;  3ZYP A;  1V6O A;  2EF6 A;  1X9T A;  2W5F A;  1YI7 A;  1MZ5 A;  4BOW A;  3BTX A;  2Z4F A;  1R1Z A;  1CON A;  2DFC A;  4J1X A;  2R06 2;  3J9S A;  2Z5W A;  4UFJ A;  3J8F 3;  1JXN A;  4Y26 A;  1PGS A;  4CYD A;  1CAV B;  3A23 A;  1E5R A;  4CXW A;  4HBN A;  4N53 B;  3I8T A;  4UF0 A;  4XF9 A;  1Y43 B;  2P3I A;  2Y38 A;  3MBW A;  1NLQ A;  3ALQ A;  4FBF A;  5J36 A;  4ZHN A;  3PVN A;  2HWD 2;  2RR1 1;  1HN1 A;  3WOG A;  3VKO A;  5LRS A;  3GZA A;  5EYX A;  4PQQ A;  2VOK A;  3Q8E A;  1ZRC A;  1ND3 A;  1L7Q A;  5CKN A;  2AYH A;  2VQA A;  4QGN A;  1OUS A;  3GGL A;  4Q4V 2;  4AZZ A;  3MIF A;  5LAS A;  5KWR A;  3WNM A;  5FAX A;  3R4S A;  5LK7 B;  3SCH A;  2ZX1 A;  2ARE A;  4JGZ B;  4IEV A;  3MFA A;  3OGR A;  2BWA A;  4GXL A;  1SQ4 A;  1TE1 B;  2DVF A;  2Y60 A;  4LLO A;  4AQS A;  4B8E A;  3LB9 A;  5F3E A;  3O0X A;  5C9A C;  4CDQ C;  2W92 A;  4YFZ A;  3MUZ 1;  3IMN A;  4KNC A;  4XFB A;  1KEX A;  2JIJ A;  3POW A;  4MHU A;  1JU3 A;  1ZZ8 A;  2FCU A;  1A34 A;  1ZZC A;  4MV2 A;  3JUU A;  5IVC A;  5FXX A;  3LIH A;  3JBG 3;  4IE7 A;  1LGN A;  4R9D A;  4CU7 A;  2PHU A;  2EIC A;  3ZMO A;  1W2A X;  3P5B A;  4LMF A;  3TRS B;  3ZXL A;  1L7R A;  4CCM A;  1SAC A;  2BYV E;  2YPJ A;  4YVS C;  1W8Z A;  3LPG A;  3WG3 A;  2WLQ A;  5DZF A;  2FQP A;  2MPF A;  4P9W A;  3ACL A;  3ETP A;  1VBD 3;  1MZF A;  3T30 A;  3R4U A;  1TME 2;  1R1A 2;  2OZ6 A;  2VW0 A;  3WHU A;  3O5S A;  2Y34 A;  3WP6 A;  5K7P A;  1GNH A;  4A4A A;  4YZ1 A;  3N9P A;  2AGS A;  2A6W A;  3URF A;  1GZ9 A;  3A4U A;  3P3N A;  1UCX A;  4FPE A;  4YZ4 A;  2ZHK A;  4HVO A;  5LY1 A;  4YW3 A;  2VG9 A;  3N7K A;  1D0H A;  3K77 A;  2PHX A;  2VVE A;  1UL9 A;  5A70 A;  3ILN A;  4QGM A;  4FP3 A;  3NJX A;  2WIN B;  4IEZ A;  4OZO A;  3OPZ A;  3R4D B;  1GLH A;  4OUM A;  5LW9 A;  4Q8L A;  2FMY A;  2D3R A;  1PVC 1;  5H9Q A;  3PTR B;  4CEY C;  1MQT A;  4AGV A;  3AJZ A;  3IIA A;  5FLJ A;  2ET7 A;  3O0W A;  4IE4 A;  5K9Y A;  3WCS A;  1EPW A;  5LA9 A;  5IK7 A;  1RGS A;  4COW A;  2RMU 3;  5G04 L;  2WII B;  4D7Y A;  3AKR A;  4IGO A;  2XUM A;  4XMI A;  4D3W A;  1N1V A;  1Q8P A;  1ZX5 A;  2X5I A;  2YBP A;  1LR5 A;  5JSR A;  3MI8 A;  1CD3 G;  5DG2 A;  3T3Y A;  3RMY A;  3KT4 A;  4CDX C;  3RZL A;  1W6P B;  2RM2 1;  2CV6 A;  2Y6K A;  1ND2 B;  3DYP A;  4MUV A;  4K6B A;  1UYP A;  4A42 A;  3O1P A;  5LA2 A;  1S0C A;  4L8Q A;  4MGS A;  1PO2 2;  1UNB A;  5FPL A;  3KV6 A;  4NE9 A;  4XC9 A;  1PNF A;  4BIF A;  1GFF 2;  1DGW A;  1NY7 1;  3USU A;  4Y5Z 0;  4CEY A;  2P3K A;  4QPI B;  5FBJ A;  4WM7 C;  2VOV A;  3ZM8 A;  3VKF C;  4Y4R A;  5JPM B;  3VD3 A;  2D6L X;  2XJT A;  2B46 X;  5FIX A;  3D0J A;  4QXH A;  1RED A;  3DV8 A;  3ZLI A;  1K5J A;  4LE3 A;  4P9Y A;  3ZPY A;  5L7O A;  4XXA A;  2WL1 A;  2HWE 3;  1NX9 A;  4QGL A;  2A75 A;  4R4Z A;  2ZX0 A;  3T2Q A;  2ZOE B;  1ENX A;  3I2K A;  4UF0 B;  3WW4 A;  4BIS A;  5J1X A;  2YDE A;  2OVU A;  4FPK A;  1LOG A;  3VDC A;  4Q4W 3;  2MEV 3;  1Q56 A;  2EXH A;  4QB2 A;  1ND3 B;  3NQH A;  1XNT A;  5JIA A;  3UKN A;  3OY8 A;  3ABZ A;  4NWW A;  2PMW B;  1JUI A;  4FPG A;  2YV8 A;  3MHZ A;  3EJK A;  1RUI 2;  4Q4Y 2;  4MGT A;  5J98 B;  1J58 A;  2NM1 A;  3PLQ A;  1MEC 3;  4NHM A;  4CSW A;  3W5N A;  2B39 A;  4LO8 A;  1RUH 3;  1XYP A;  2R0H A;  2ZBJ A;  4Z07 A;  3LFM A;  1CWP A;  4WV8 A;  2ZHL A;  3BTA A;  1RXF A;  1S0G A;  1WKY A;  2AZ5 A;  4G3Y C;  4H7L A;  3KGL A;  2QJV A;  2IZW A;  4JAA A;  4FPL A;  2P1B A;  2WJS A;  3ACI A;  3H8U A;  1JZ7 A;  4NUB A;  3LA2 A;  3QCW A;  3ZR6 A;  1IHM A;  3ACG A;  4HSL A;  4XAB A;  4XFH A;  1UMZ A;  3WX5 A;  5F3I A;  4B3N A;  4JKL A;  3VBO C;  3A22 A;  4UFL A;  2DCT A;  4S2H A;  3U75 A;  5JAX A;  4IGQ A;  3CZU A;  3WQ0 A;  3WW3 A;  4XW3 A;  3EO6 A;  4JX0 A;  2YY1 A;  1RHI 2;  2XR4 A;  2NMN A;  4FFH A;  2P3Y A;  4D6Q A;  1NCR C;  1T6G C;  3C7E A;  4IGP A;  1SPP A;  2VCM A;  3HT2 A;  3V65 A;  4QAW A;  4GUL A;  3O1S A;  2J1R A;  1NG0 A;  3QBQ A;  4FOY A;  4C91 A;  3PU8 A;  4XUR A;  1QNY A;  1ZRE A;  3TN9 1;  2OX0 A;  5FMO S;  2FBE A;  4Q4X 2;  4X6Q B;  1BK1 A;  2XHK A;  1W9W A;  1UMH A;  2BBA A;  1UY1 A;  4JTO A;  4MYE A;  5IVY A;  5IFP A;  5EYY A;  3OPT A;  2XJV A;  3GAL A;  1MZE A;  2R06 1;  1KIT A;  2YUE A;  2HEW F;  3KVA A;  1SDW A;  4DUV A;  4XIO A;  3ES1 A;  4N9I A;  4DUW A;  4OUL A;  1MQT B;  3MV0 1;  3JD7 3;  2A6X A;  4LHL A;  4MOA A;  5CBL A;  1QQP 2;  2QQJ A;  4BCU A;  2XBO 2;  3J7N A;  1RUC 1;  4LIU A;  4N8M A;  2AAC A;  4UFM A;  4YW5 A;  1YLL A;  5EZW A;  3JQW A;  4QPY A;  4ZZ5 A;  1DCS A;  1NA1 C;  1LGB A;  2PHT A;  1UKG A;  4GD4 A;  4SLI A;  4WM8 A;  4ZU4 A;  2X5I B;  5FYC A;  3VN4 A;  2VW1 A;  4XQ4 A;  4JGY C;  4W6X A;  3O1U A;  2ZMK A;  2AEN A;  1HLC A;  2O0O A;  2C6S A;  2DWR A;  3RYR A;  3I2I A;  4JDM A;  2YC4 A;  4JC1 A;  1KXG A;  5E1R A;  4IV1 C;  4Q1P A;  5ACA 1;  1KDM A;  2ORZ A;  4G9S B;  4F3J A;  1YYN A;  2JDU A;  1WCU A;  3NNL A;  5D8A A;  3VZK A;  1VB4 A;  3N7L A;  2QQW A;  1RJ7 A;  3USU B;  3M2M A;  1K5M C;  3FJS A;  1RUE 3;  4CEY B;  4LR4 A;  1Y3T A;  2DCJ A;  3RG0 A;  3GXU A;  3LZZ A;  1FOD 3;  4FCA A;  4N9H A;  4M00 A;  5FY0 A;  1MVQ A;  2C5D A;  1JI6 A;  2IXK A;  4C8D A;  3LDB A;  5T5J A;  1JOJ A;  3NMB A;  1RUG 2;  3H7J A;  1QJY 1;  1AR9 3;  5L7O B;  1HXS 1;  2CDO A;  4AED C;  4QX5 A;  1Y4W A;  1NE6 A;  2NPI A;  3OYW A;  1QXP A;  5K8S A;  5LB6 A;  4JGY A;  4AI3 A;  3DYM A;  4N7I A;  1NUK A;  1QXJ A;  3OCP A;  1FNY A;  2WFF 3;  1R1A 1;  2OS2 A;  2R07 3;  3C7F A;  5CB7 A;  4RD7 A;  5IJR A;  2VH9 A;  3HBK A;  3WDU A;  2R30 A;  1J84 A;  3RYK A;  1BBT 3;  4Y5S A;  3AKT A;  3OY8 B;  4JDO A;  3SIT A;  2UYA A;  4Y22 A;  4OHZ A;  4DXS A;  1CZT A;  1G8W A;  2BU9 A;  1K5M A;  4B29 A;  5BNO C;  1AYM 2;  5CA6 A;  4OHY A;  5F39 A;  2D6O X;  5BY5 A;  2KR2 A;  4XCA A;  2DFB A;  2UWC A;  3HVD A;  3RS6 A;  1VBB 1;  3MW3 A;  1JYI A;  3AXE A;  4OCT A;  2BVB A;  2JDN A;  3I97 A;  5LBE A;  1H8T A;  1ZBE 2;  5A7P A;  5FV3 A;  3MLL A;  4BE3 A;  4YZ3 A;  2Y0I A;  5FJH A;  2VQU A;  2FZ2 A;  2QZ2 A;  1ST8 A;  1GZT A;  2YFU A;  3BVC A;  4GMP 1;  5A6Y A;  1G9D A;  3J4U H;  3K51 A;  3OSD A;  3SQO A;  5IVB A;  4P9L A;  1DGR A;  5IUQ A;  3AVS A;  2GNB A;  4IV3 A;  1DLL A;  3THP A;  4BQ5 A;  3E5X A;  1UX7 A;  4DXR A;  1ASJ 3;  2ZGU A;  1OH4 A;  3OGG A;  4UT5 A;  1YQ2 A;  2DF7 A;  5KXB A;  3NVC A;  4Y20 A;  5FMC A;  2WN3 A;  1NYW A;  2LAL A;  1DF0 A;  1NLS A;  3BAL A;  1LHO A;  1QH6 A;  1QJX 1;  3KZ4 C;  5FYU A;  1FAY A;  3MIG A;  4E27 A;  1SPP B;  5FZD A;  2DUQ A;  2X29 A;  5AC9 2;  3R6S A;  1CPM A;  3KCY A;  4AEM A;  2VCB A;  1VBA 1;  3MF9 A;  4E8D A;  4CP1 A;  4QQO A;  1UF2 C;  3VV1 A;  1F5J A;  4YGC A;  2VBB A;  3RNS A;  4BZ4 A;  3A0K A;  4KH9 A;  4HMZ A;  1B35 C;  1N3P A;  5FZL A;  1FPN 2;  2JG9 C;  4AVB A;  3RQ0 A;  2OT7 A;  2BGP A;  3IB3 A;  4TSV A;  3J7H A;  4NR1 A;  3VZO A;  3IAQ A;  3VL9 A;  2VZR A;  4AI9 A;  3EXU A;  1S2K A;  2RS1 2;  2VPV A;  5CEH A;  1C57 A;  4MGI E;  5F8P A;  2WT2 A;  4GB3 2;  1D2Q A;  5FOJ B;  4TLG A;  2C9A A;  1KGY A;  3MV1 1;  4P9X A;  3I7D A;  5DMY A;  2VNG A;  1RMU 3;  2C1F A;  3ZKY A;  1WD3 A;  2VNV A;  4HK8 A;  2B9V A;  4DRV A;  1GQG A;  1AR6 2;  1CZS A;  1RUI 1;  2I2S A;  4NRP A;  4Q4Y 1;  3C3V A;  4WM8 B;  4XJU A;  3U78 A;  5SV5 A;  3HN1 A;  2BFU S;  5KR7 A;  3I3M A;  3AM2 A;  2WZR 3;  2W0X A;  5C5U A;  3WY6 A;  3WSO A;  3H3U A;  3IPV A;  4Q1R A;  1W06 A;  4BXS V;  5IK8 A;  2JG9 A;  2FDJ A;  1LEM A;  3UGH A;  3RVH A;  1PX4 A;  2H0B A;  4CCO A;  4CPB A;  4P9G A;  5JCT A;  4OLL A;  5D8A B;  1G6N A;  3D0S A;  4AFA A;  1JU4 A;  1CJD A;  1J3P A;  5FWJ A;  5FYZ A;  5GZD A;  1AJO A;  1G9A A;  2Q1Z B;  3VUO A;  2JB8 A;  1CGP A;  5L19 A;  2PQQ A;  5FZH A;  5JI9 A;  3NNG A;  3U11 A;  1ULC A;  4A41 A;  4QX3 A;  2VM9 A;  4YGB A;  2YMZ A;  4QU1 A;  4H2A A;  5BNP A;  1POQ A;  4A7Y A;  2YPD A;  3EHK A;  1ZBA 3;  3HWJ A;  2R16 A;  3OYW B;  4IDZ A;  1XNK A;  2BRT A;  3RZZ A;  4JGY B;  1YQC A;  1XU2 A;  4O65 A;  1O6U A;  4RHV 3;  1N1T A;  1HIX A;  1NLR A;  2VME A;  3NWK A;  1O91 A;  1W9F A;  1OA3 A;  2J7M A;  1V9U 3;  4MO3 M;  3C7O A;  2KD7 A;  3OTF A;  4Q4X 1;  1BEV 2;  5AVP A;  4BH9 A;  5CG8 A;  2HWC 3;  4SBV A;  5A33 A;  4FVV A;  2QNK A;  3VBR A;  2A1X A;  1XE8 A;  2WS9 1;  3S7E A;  1FT9 A;  1K5M B;  3H8X A;  3FMG A;  1YFU A;  3VDD B;  1AR7 1;  1RVF 3;  2VOW A;  2O8O A;  2CHH A;  3IDC B;  4XYX A;  5FKC A;  4Q0P A;  2N7G A;  2HWF 3;  2P17 A;  3RPQ A;  2DCY A;  5FZB A;  1UOG A;  1H8T B;  1QQP 1;  5AVA A;  4LK6 A;  2XBO 1;  1FV2 A;  2C9K A;  2Y6L A;  4FO9 A;  1Z7S 2;  5GJ6 A;  1GWM A;  1LGC A;  2RS3 3;  2RR1 2;  5FO7 B;  4BQ4 A;  4K40 A;  5IVE A;  5I8S A;  3EB7 A;  5BPX A;  2G9G A;  4IV3 B;  1WLD A;  1HJF A;  3CJI B;  1G86 A;  1GP6 A;  1U5Y A;  2OUJ A;  4Y20 B;  4Y1Z A;  5FZC A;  4DOU A;  2XML A;  3GF6 A;  4GWN A;  1MR5 A;  4XBQ A;  2PHW A;  4E2G A;  1D7P M;  1D2S A;  4D8M A;  1Z78 A;  1BXH A;  1OLM A;  3NV3 A;  1Y7B A;  4GA9 A;  4I3P A;  5CIS A;  3WNX A;  4CXX A;  2HBU A;  1PMJ X;  1PMI A;  1JZ4 A;  2Y0O A;  1D4M 3;  1WW4 A;  1PGW 1;  2D93 A;  2X53 S;  1JYC A;  3MW2 A;  4QHO A;  4Z2A A;  4DUX A;  1WWY A;  4ATF A;  4LBN A;  4A7Z A;  4N53 C;  1OQE A;  4ZZ8 A;  1T6B X;  4NPM A;  2E63 A;  4NWV A;  4PI0 A;  2XJQ A;  4R9C A;  3H9A A;  1PO1 2;  4RGG A;  2E31 A;  4E2Q A;  1FI2 A;  1JYW A;  1JZ5 A;  1SZB A;  2J1A A;  2ZGM A;  4FAG A;  3RDI A;  3RZM A;  2OW4 A;  3HIF A;  3Q8F A;  1WGP A;  3SNM A;  2A70 A;  3V0A A;  2MEV 1;  3B69 A;  5FUI A;  5GZF A;  3VBF B;  1ZNP A;  1SCS A;  2XL7 A;  3SIS A;  3IN9 A;  5FYV A;  3VHN A;  1PZ7 A;  1QJF A;  2OZJ A;  3KB5 A;  5FLI A;  3BU7 A;  3IPV B;  1W9S A;  1RIT A;  5FYY A;  1YIP A;  3NW4 A;  2JG9 B;  3AVR A;  1CAV A;  1GQP A;  2XWJ B;  4KBB A;  3BI3 A;  2V4V A;  1ZBE 1;  3UL2 A;  5HCA A;  4QXC A;  1ULE A;  1PVC 2;  4NIH A;  2EIE A;  1JTZ X;  3SH5 A;  1TMF 3;  1GIC A;  4UFK A;  1LRH A;  2I45 A;  3K48 A;  4FPJ A;  3ZYG A;  1IQA A;  2XH6 A;  4ERO A;  3M7A A;  1QEX A;  4MGQ A;  5BXX A;  4XCB A;  5HI0 A;  2IWG B;  2YU1 A;  3POG A;  5BNP B;  3GDB A;  1S0B A;  1KFX L;  1PX3 A;  2FD8 A;  5A7S A;  3HQU A;  1AYN 3;  1K3I A;  1LOA A;  3ZN5 A;  1HDK A;  2HWD 3;  4ZKT B;  2VUL A;  2RM2 2;  3HT1 A;  1PM4 A;  2EAA A;  3GHM A;  1I3H A;  2CDP A;  5KHH A;  5AC9 1;  2A6V A;  3U07 A;  3T1L A;  2BPA 2;  3N9Q A;  3FC0 A;  5FKB A;  1H30 A;  4BQ3 A;  2H6B A;  1VAL A;  1LOD A;  4DZG A;  1NY7 2;  3GM8 A;  1HN0 A;  4HVQ A;  2CL2 A;  5KHI A;  4I09 A;  1W6Q B;  2GC2 A;  3OF1 A;  1SBF A;  4CDU A;  5A33 B;  3VBR B;  1W28 A;  1JUH A;  2CAU A;  2ILM A;  3GBG A;  2D40 A;  2XOM A;  5FPA A;  2W95 A;  2KXL A;  2CGP A;  2PN5 A;  4YW1 A;  1DU3 D;  2RS1 1;  2WNU C;  4HVR A;  2Z42 A;  4XUO A;  1JW6 A;  2DVG A;  3KCC A;  4P02 B;  4LKD A;  4LPL A;  2IXL A;  4ARX A;  2ZHN A;  1JMU B;  5JOX A;  1UIK A;  4IQP A;  5JXI A;  3CMG A;  4D69 A;  1HJG A;  1UY2 A;  1GNY A;  1POV 1;  1VAM A;  2RG4 A;  2ZEW A;  1OLM E;  3BN6 A;  3B00 A;  3JD7 1;  4PIX A;  4S2D A;  2DVB A;  4GH4 B;  1PIV 1;  3D8C A;  2Q8C A;  5JXH A;  5LY2 A;  3ME2 A;  1C1L A;  1ND2 C;  4M3C A;  4ASM B;  1PGL 1;  1W8H A;  2G4I A;  4X6R B;  3VDA A;  1VP6 A;  2LRP A;  1GZW A;  4LNV A;  4BA6 A;  3PJQ A;  2CY6 A;  2VO5 A;  2ZHM A;  4K8R B;  5F37 A;  1IPK A;  3ZMN A;  3L2H A;  5FPU A;  4QPI C;  1W3V A;  3H1M A;  1ODM A;  2WNU A;  1XXN A;  1OQ1 A;  1YNA A;  1M06 G;  5DZG A;  3W5M A;  2O14 A;  3O12 A;  4NRM A;  4BHP A;  3S5Q A;  4YGD A;  5IVJ A;  1AVB A;  1VRB A;  2WSV A;  4XEZ A;  2VZ3 A;  4YYO A;  2A6Z A;  3B9I A;  2E33 A;  3OGJ A;  2F17 A;  2OUH A;  4S2G A;  1RUD 3;  3W58 A;  5I0U A;  5FPX A;  1CQ9 A;  1W6P A;  3DUI A;  2W1U A;  5LRR A;  1O3S A;  3M3O A;  3ZXF A;  1AR9 1;  1RC6 A;  3RI9 A;  1ND3 C;  2R49 A;  4W6W A;  2NLR A;  3BIW E;  5FPV A;  1BMV 1;  2QCS B;  3MGU A;  4LBL A;  4LA2 A;  4XAE A;  1GV9 A;  1O4T A;  2FCT A;  3U4S A;  4ONU A;  4AXO A;  1BEV 1;  1WCS A;  3SC7 X;  2HWB 2;  4NOT A;  2WFF 1;  4H7M A;  3TNP B;  4BK5 A;  1VMJ A;  2CU5 A;  2OQ6 A;  3N4M A;  1DQ4 A;  3E5Q A;  1J1L A;  3IDE A;  3V0A B;  2ZJC A;  1GSL A;  3A7Q A;  3I59 A;  3MIE A;  1PHM A;  2GC1 A;  2RJ2 A;  3IM0 A;  2IXI A;  2ZML A;  4IEX A;  2WAB A;  1PO2 3;  4IEU A;  1QGL A;  3BTY A;  1D4V B;  2ZEX A;  2XON A;  4W6Y A;  2OXB A;  2ZGP A;  1HRV 3;  2HLE A;  1VE0 A;  1XE7 A;  4FFG A;  4FPY A;  5T5O A;  2BJS A;  5KHJ A;  4YW7 A;  1Z7S 1;  4KG8 A;  4D6S A;  5C33 A;  5JLV A;  3V0B A;  1XRU A;  1X50 A;  3AYD A;  3OD4 A;  3WG1 A;  5FP9 A;  5B4X A;  3T4H B;  1RUC 2;  5EXO A;  4GWI A;  4LBQ D;  4Q0U A;  3W20 A;  1CPN A;  4QX7 A;  4BQX A;  5HPO A;  3CQO A;  5DUU A;  4ARY A;  1GBG A;  3ATG A;  2MHF A;  1X33 A;  2RS5 3;  4PT6 A;  3VZJ A;  3DN7 A;  4BK4 A;  5I0R A;  4M3C F;  1JZ6 A;  1ASJ 1;  3AMH A;  1QOT A;  2ES3 A;  2ARC A;  2ORX A;  1EV1 2;  1SCR A;  4O7X A;  1QU0 A;  2BP6 A;  5ACA 2;  2LUW A;  4BWO A;  1QJU 3;  3MID A;  1ZRR A;  2PHF A;  4GKX A;  4K1Y A;  4OZX A;  1VBC 3;  1J59 A;  3AP9 A;  3HMY A;  1DYO A;  1WBL A;  3WQB A;  1UZW A;  2O1Q A;  3ZPO A;  4CDU B;  5GLT A;  2JEM A;  1BLZ A;  2WWU A;  2JD4 A;  3INA A;  3WNN A;  1MQT C;  4XUN A;  5F3G A;  3KT1 A;  3VZL A;  2NP0 A;  1PO1 1;  3KM5 A;  1QJY 2;  2PFW A;  4C0B A;  2FDG A;  1HXS 2;  1LU2 A;  1PZ9 A;  2PA7 A;  4V2V A;  2E7A A;  5A3P A;  1RIN A;  4LQR A;  3HJR A;  3N9O A;  1KRI A;  1HX6 A;  3PUS A;  3U14 A;  5CYY A;  3I2H A;  3DKW A;  1OXC A;  3POS A;  5L9R A;  4TTG A;  1FV3 A;  1WCD J;  4IE6 A;  2X5I C;  2XHN A;  5C3S A;  1NCQ A;  4M0H A;  5A1F A;  2ZCW A;  1SFY A;  4XJA A;  2GSY A;  2JEN A;  1RHI 3;  2BWC A;  5D2A A;  5IW0 A;  2WQ8 A;  4M3C B;  3X29 B;  2VZV A;  4YG0 A;  3IBM A;  4HN0 A;  4NMI A;  1F5F A;  1UIJ A;  2QFE A;  1DYK A;  3S5A A;  1H6X A;  2XJP A;  5BNN C;  1GZW B;  1YO8 A;  4QB1 A;  5FZO A;  5JXJ A;  2GMM A;  3PMS A;  5KXE A;  4RS5 C;  1Q8V A;  2JJ6 A;  2RJL A;  5IAT A;  2NZ9 A;  1LED A;  4MGK E;  1VBB 2;  3ON7 A;  4UW4 A;  4QDQ A;  5FMD A;  5EV7 A;  3GZE A;  4XDO A;  4AFB A;  1LOF A;  2YC0 A;  5DDJ 3;  1FMD 3;  2WNU B;  2QQV A;  1RUJ 2;  1KD7 A;  3AYA A;  4I0W B;  2PAK A;  1JHN A;  2TBV A;  3O1V A;  2P3J A;  3FHI B;  1ULO A;  1JOP A;  4R8H A;  2EXI A;  2JIG A;  4AI8 A;  4E8C A;  1GOG A;  2ARX A;  5FZI A;  5L7O C;  5DXD A;  1ACC A;  1VBE 3;  1SBD A;  4QDR A;  5FY5 A;  1LHU A;  3K3O A;  2YFZ A;  4MX3 A;  3T0A A;  2W94 A;  3LEM A;  4PBO A;  1V00 A;  1H1A A;  2VZS A;  4MGZ E;  4QB6 A;  4Y1U A;  3S30 A;  1DQ2 A;  4MH0 E;  4Q0V A;  1REF A;  1UOB A;  1QJX 2;  4OVE A;  3ZFF A;  3NRU A;  1UO9 A;  4XAC A;  4HN1 A;  4LIV A;  5BNN A;  2UUR A;  2EXJ A;  1R09 1;  1WMD A;  3CBN A;  4G4F A;  4QWN A;  5J37 A;  4RS5 A;  3V56 A;  1MS3 A;  1VBA 2;  1W8U A;  4EV0 A;  1W03 A;  4GWJ A;  4Z2W A;  2D6M A;  4XFA A;  3ACH A;  4KGQ A;  2JDY A;  4MSV A;  4RFT 0;  3WVJ A;  5C3Q A;  1LEC A;  3FE5 A;  3B94 A;  3PIJ A;  1ENR A;  3I59 B;  2HWC 1;  5LBF A;  1GWK A;  1RUF 3;  3JCI A;  2BV4 A;  1U5X A;  4OMD A;  1W9Y A;  2PEL A;  3D5O A;  2W1W A;  3AFG A;  3NKT A;  5E88 A;  4LUK A;  3DXU A;  3H42 B;  4MET A;  1UMI A;  2JE9 A;  5L73 A;  3N36 A;  2VCC A;  3T09 A;  4OHV A;  5F5A A;  5K4L A;  1JZ3 A;  4IEW A;  3ZX7 A;  2HWF 1;  4B7K A;  3CLP A;  3UJQ A;  1UWW A;  2ZKL A;  3V0B B;  1XND A;  5CG9 A;  3LIG A;  2VMC A;  1T2X A;  4FQ4 A;  3U1X A;  3AC0 A;  4W8J A;  1WBF A;  3NL1 A;  4FTE A;  1EUT A;  4LTA A;  1GQH A;  4XIK A;  2RS3 1;  2JG8 C;  1RUG 3;  1UOJ A;  4FP2 A;  2X10 A;  2JDZ A;  5IHR A;  3K2O A;  1HKD A;  1UXZ A;  3VZM A;  3U10 A;  2Y6G A;  2AEZ A;  4DY3 A;  5C3O A;  4O9E A;  4ZXK A;  2VTX A;  1AXY A;  2PHR A;  4NHX A;  3WEZ A;  5CFC A;  1GUI A;  2QQP A;  4XZP A;  2UWA A;  3ZYR A;  4YM0 A;  1URX A;  3AL5 A;  4K3U A;  2D97 A;  1KJR A;  4RGK A;  5A80 A;  4QM9 A;  1DIW A;  3C7G A;  3FFZ A;  5FYT A;  1TNR A;  2J42 A;  1XNB A;  4LBQ A;  1MS0 A;  4FPF A;  3G6J B;  1XQN A;  4Z8B A;  2RDR A;  2A73 B;  1AYM 3;  5GLZ A;  2WWJ A;  3ZXD A;  2OPW A;  1FYU A;  5IAV A;  2K46 A;  5ISL A;  2R32 A;  4XJ9 A;  2QDR A;  2Y26 A;  1QJE A;  3AXD A;  4NRQ A;  1YJK A;  3JBG 2;  1F31 A;  2IXC A;  3O0V A;  1LHV A;  3BB6 A;  5A7N A;  4L99 A;  4PHZ A;  2JG8 A;  3ZYH A;  1V6K A;  4YZ2 A;  1OQD A;  2HKX A;  1VRH 3;  3NJZ A;  3H3L A;  2VTF A;  4PF1 A;  4DFS A;  4XFC A;  4Z1V A;  5CFD A;  4XHX A;  4BQ1 A;  4N43 C;  3E97 A;  5LA1 A;  2UU8 A;  1SHW B;  3AMN A;  5SV8 A;  4MGY E;  1HRI 3;  5A6Z A;  1F4H A;  2W68 A;  4DXZ A;  2HWB 1;  1SBE A;  1IS3 A;  4WM8 C;  1UU5 A;  2Y6F A;  3ZYI B;  2HH9 A;  3QH6 A;  3WXP A;  1VBD 2;  4EWA A;  1NCQ B;  2GZW A;  2ZZQ A;  3WNO A;  4QPG C;  2A3Y A;  2OQ7 A;  4CCN A;  2XJS A;  4EN9 B;  2ZGL A;  4A7K A;  3LEK A;  3LPF A;  5FZ9 A;  2WS9 2;  3VBU C;  4GZ9 A;  4YM1 A;  5D8A C;  5IK4 A;  1CZV A;  1AR7 2;  5LK5 A;  5FZO B;  3ACF A;  4DIQ A;  2VOT A;  4C0H A;  1DZQ A;  2ZMN A;  1YWK A;  3VLB B;  4FFF A;  1JBC A;  2QQN A;  3UV9 A;  4UFH A;  4N43 A;  4NHK A;  1SLC A;  2DV9 A;  3PU3 A;  5C8C C;  3LD8 A;  5FYI A;  5FWE A;  4FSJ A;  3ZVX A;  3ENR A;  3KLS A;  5FK8 A;  1KS4 A;  1MPX A;  1U5I A;  4XUQ A;  2PLV 3;  4GB3 3;  2J1E A;  1NQJ A;  2LW8 A; 
#chains in the Genus database with same CATH homology
 5FYM A;  5FUP A;  5FP3 A;  2GP3 A;  3K3N A;  5F3E A;  4QU1 A;  3UYJ A;  2YPD A;  2OS2 A;  5F32 A;  3PUQ A;  4AAP A;  4CSW A;  5FY9 A;  5FY7 A;  4BU2 A;  5FYS A;  2XXZ A;  4D6S A;  2YU1 A;  5IVC A;  4TN7 A;  5FXX A;  5F2W A;  5FP9 A;  5A1L A;  3DXU A;  5A7S A;  3KV9 A;  4QX7 A;  5F39 A;  4NUB A;  4CCM A;  5F5A A;  2YBK A;  5K4L A;  4CCJ A;  5FZ4 A;  4URA A;  3N9Q A;  5F3I A;  4E4H A;  4QX8 A;  5A7P A;  5FV3 A;  3NJY A;  4IGQ A;  5FJH A;  3K2O A;  4GAZ A;  5FY4 A;  3N9P A;  5IVB A;  5FZB A;  2PXJ A;  2VD7 A;  3AVS A;  5FZ1 A;  4D6Q A;  5FPA A;  4IGP A;  5LY1 A;  5FZ8 A;  5FZ3 A;  3AL5 A;  4EZH A;  5FPB A;  5A80 A;  3PU8 A;  4V2W A;  3ZPO A;  5F5I A;  4EYU A;  5FYT A;  5IVE A;  2WWU A;  3AL6 A;  2OX0 A;  5FYU A;  3OPW A;  3KV5 A;  5FZD A;  5LW9 A;  5F3G A;  2XUE A;  5IVY A;  5IVV A;  3PTR B;  4GJZ A;  2WWJ A;  3DXT A;  3OPT A;  5FZC A;  4V2V A;  5FP7 A;  5FZK A;  2XML A;  5A3W A;  5FP4 A;  5F3C A;  2Q8C A;  5ISL A;  5A3P A;  5FZ0 A;  5LY2 A;  5LWB A;  3N9O A;  3KVA A;  5FYH A;  5FZF A;  5A7N A;  5FZ7 A;  3PUS A;  3PUR A;  4EZ4 A;  5FZL A;  4IGO A;  4QXB A;  4LIT A;  2OT7 A;  3KV4 A;  4CCK A;  5A7Q A;  2YBP A;  5FXW A;  5FZG A;  4AI9 A;  4BXF A;  5FZA A;  4CUG A;  5A1F A;  5F37 A;  3PUA A;  2Q8E A;  5IW0 A;  5FY1 A;  5FUN A;  3KVB A;  4LIU A;  5CEH A;  5FPU A;  4LXL A;  4CCL A;  4ASK A;  2W2I A;  3N9M A;  2YBS A;  4GD4 A;  5FYC A;  2GP5 A;  5FPL A;  5FY8 A;  5FZO A;  4Y33 A;  2P5B A;  5FP8 A;  5A7W A;  2OQ7 A;  3KV6 A;  4CCN A;  5FZE A;  5A3T A;  5IVJ A;  1VRB A;  4XDO A;  5FZ9 A;  5FBJ A;  5E6H A;  3U78 A;  5FXZ A;  5A3N A;  4Y4R A;  5FZO B;  5IVF A;  5KR7 A;  4UF0 A;  4HON A;  5A7W B;  3PDQ A;  4DO0 A;  5FZI A;  4DIQ A;  4QXH A;  5A7O A;  4XDP A;  5FZ6 A;  3ZLI A;  5FZM A;  2YU2 A;  5FY5 A;  4HOO A;  5FXV A;  5FYB A;  5FPV A;  3N9N A;  3K3O A;  3RVH A;  5FYV A;  4CCO A;  5FJK A;  3N9L A;  5FY0 A;  4D6R A;  4UF0 B;  4BIS A;  2XDV A;  3PU3 A;  4Y3O A;  3LD8 A;  3U4S A;  5FYI A;  4C8D A;  5FWE A;  3LDB A;  5FYZ A;  2OQ6 A;  5F5C A;  5FWJ A;  5F2S A;  4GJY A;  5FYY A;  5FZH A;  3AVR A;  5IWF A;  2Q8D A;  4LIV A;  5ANQ A;  4QXC A;  4QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...