2GP3A

Crystal structure of the catalytic core domain of jmjd2a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
349
Chain Sequence
b'ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji domain-containing protein 2A
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 97
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp3A01
5F2SA 4C8DA 2OQ7A 4V2VA 5E6HA 4CUGA 3AVSA 4Y33A 4LIVA 4D6SA 5A1FA 4CCOA 4D6QA 2GP5A 4AI9A 3RVHA 5F3CA 4URAA 3N9QA 3PUAA 5FYBA 5FJHA 4V2WA 5FYMA 3LDBA 5FZ3A 5FZ8A 5FY0A 5FZKA 4GD4A 5K4LA 5FZMA 5A7WB 2WWJA 3KVBA 4IGOA 4CSWA 5LWBA 5A7QA 2W2IA 5F2WA 5FP4A 5IVCA 5FXXA 5FYVA 3N9PA 4QWNA 5FZ1A 5A7WA 5FPVA 5FZ4A 4NUBA 4XDPA 3OPTA 4HONA 3K2OA 5A7PA 2XXZA 5KR7A 2GP3A 4AAPA 3ZLIA 5FZ7A 3K3NA 5F39A 5FZ6A 4QXHA 2OX0A 4Y3OA 4CCKA 4QU1A 3KV9A 3KVAA 5FZDA 5IVVA 5FWJA 4QX8A 2XMLA 5FYCA 5FZIA 3NJYA 5FZBA 5LW9A 2XDVA 5F3GA 5FP3A 5FYHA 5FZCA 4LXLA 4ASKA 4D6RA 4GAZA 4LITA 2Q8CA 3LD8A 5F5CA 4CCJA 5F5AA 4XDOA 5FYTA 5FYYA 5FJKA 5FZGA 5CEHA 2PXJA 3AL6A 5FZFA 5IVFA 5FYUA 3U4SA 5FV3A 2YBSA 5FWEA 5A3NA 2OT7A 2Q8DA 2XUEA 4GJYA 3OPWA 5A7OA 5FY4A 5FYZA 3N9NA 2P5BA 3AVRA 2Q8EA 5FZ0A 2VD7A 4IGQA 3PU8A 5FYIA 5A3TA 5IVBA 3KV6A 3AL5A 3PURA 2OS2A 3PUQA 4CCMA 3PU3A 5FZAA 5IWFA 3DXTA 5FP7A 4LIUA 3N9LA 2YPDA 2YBKA 4EZHA 4IGPA 5ANQA 2YU1A 4CCLA 4BISA 5FXVA 5FPAA 4EYUA 5FY1A 5F5IA 3U78A 5FUNA 4GJZA 5LY1A 4BU2A 5FY8A 5LY2A 5FPLA 1VRBA 5FZOB 5FUPA 5FXZA 4QXBA 5FYSA 5FZEA 3PUSA 3N9OA 5F3IA 5FZOA 5A3WA 5IVYA 4UF0B 2YBPA 3PDQA 5FBJA 5IVEA 5IVJA 2WWUA 4DIQA 5F32A 3KV4A 4UF0A 5FY5A 3ZPOA 4QXCA 5FP9A 5F3EA 5A7NA 4E4HA 5FXWA 3KV5A 5FZLA 5FPBA 5FZHA 5ISLA 5A3PA 5F37A 4EZ4A 3DXUA 3PTRB 4BXFA 5IW0A 5A7SA 3K3OA 4Y4RA 5FY7A 4TN7A 5FY9A 5A1LA 2OQ6A 2YU2A 5A80A 5FZ9A 4DO0A 4QX7A 5FPUA 5FP8A 4HOOA 4CCNA 3N9MA 3UYJA
chains in the Genus database with same CATH superfamily
1PZ7A 4XZPA 5A70A 2W1QA 1UMZA 2XJVA 4CP2A 4IEZA 5L7OC 3WP5A 1HV1A 1GR3A 3J8F1 1AR81 2JDNA 4CCOA 3I2IA 1RIRA 1VLNA 4LHKA 4L11A 1KS5A 4AI9A 3THCA 1CAVB 1UOFA 3POEA 5C3QA 4V2WA 3B5LB 1Z78A 1MEC1 2VCBA 3SXWA 2TEPA 5BNOA 2AH2A 3W58A 2FDKA 1ZVFA 1H6XA 4MZUA 3H1YA 4IGOA 3RYPA 1R093 1LJ7A 2W2IA 4GB33 2WQ4A 5T3NA 3CQOA 3OYWB 2DUOA 2R1BA 3APBA 4A45A 5FZ4A 3G6JB 5DAXA 4MGQA 1G9AA 1POV1 5DG2A 3LQCA 5H9QA 4YVSA 3LFIA 2ZEYA 4XAEA 1P8JA 1FAYA 4K20A 3N7MA 4LO5B 3HQXA 2NN8A 1XQNA 1CZVA 3K4DA 3LSDA 1W6OB 3KV9A 1IG3A 2PHTA 2QVSB 1PNGA 2R30A 1IS5A 1VBE1 2MPFA 4OHXA 4DPNA 1IQAA 2QDNA 3DEMA 1IS3A 2DTWA 3O1PA 1E57A 3VHPA 1F5FA 3FN9A 2VE1A 1O3TA 3H8UA 4JVAA 1SBFA 1W05A 4E8DA 4X8PA 1W28A 4DQAA 4XJAA 4XDOA 1NG0A 1QXRA 5FYTA 1LENA 4ZZ5A 5FOBB 1HDKA 1U5XA 5FZGA 1AR62 2PAKA 4DOUA 3AL6A 4XF0A 3S5QA 4BK4A 1PGSA 4XFAA 1F2NA 2YHJA 1X82A 1GQGA 4CDUA 1SBEA 2YBSA 3DPRB 3MZHA 1YC61 4UFKA 2JG9A 2RHPA 2RS51 4WVWA 4CUAA 3UL2A 3AKSA 5LASA 2QE3A 3CZUA 4DNYA 1Q3EA 3GJAA 2WNEA 5JIAA 2VJXA 1JI6A 1GP6A 3SCFA 2TBVA 4BA6A 1JOBA 1LHWA 4AVVA 3PUQA 4IEVA 4Y1XA 1BKZA 1EAH3 4NHXA 4LIUA 5C7GA 2YMZA 1I5PA 2YU1A 3MV11 4JGZA 4QM9A 4NOTA 1W2OA 4KG8A 3ALQA 1NA1C 3VN4A 1HB1A 4KWLA 4LORA 4QXBA 2WQZC 3ZXFA 3RDIA 3B94A 4E2QA 2V5YA 3PUSA 4CTEA 1UY2A 3VL8A 4YSFA 2FD8A 4FTBA 4QPIC 1UZ0A 3RI9A 4D69A 1AR71 5A3WA 2FZ1A 1H6YA 3LPFA 1OD3A 2VZ3A 1QOTA 1UY1A 3O0XA 3OUHA 1RTVA 4OI4A 1PX3A 3AK0A 3OB8A 1NYWA 5FXWA 3KV5A 1RUF2 2JX9A 1US3A 4MLOA 4R9CA 3NNLA 4Q4V3 4XDQA 3ZKUA 1LOFA 5BNPB 1COV1 4S2GA 4Q4X2 3NL1A 4P5HA 4Y4YA 5DZFA 1CX4A 1HRV1 1F31A 2ZHMA 2ZKLA 4BMBA 1ZRFA 1U0AA 2OA2A 2CY6A 4DO0A 2WFF2 2BQPA 3U11A 1CGPA 1F5JA 4PIZA 5BXXA 5I0SA 2E7QA 2VBDA 3Q8BA 5ACA2 1W9FA 3MIDA 5K9YA 2ETEA 4NPRA 3ZXAC 4CCCA 3BOWA 4FXGB 4EN9B 1VBA2 3EXUA 2QQLA 3C8XA 3K4ZA 3AP5A 4OUEA 5FZ3A 1WCSA 4EWEA 2VNVA 4HLTA 1LKNA 3PJQA 1PIV1 1OOPC 4S2HA 2VVFA 5GLTA 4M00A 3VZKA 4XFCA 3MEPA 4CP9A 1DGLA 2WFPA 5B4NA 2BBAA 2C1FA 5HCAA 4N43C 3D82A 5FIXA 3CHXA 4WVMB 5DDJ3 1E5IA 1AXZA 3X29B 4LBKA 2KM2A 3WLUA 1M4WA 3VBUB 4AI3A 4R9BA 5FZDA 3SCHA 4AHXA 4JTOA 1WD4A 4Z92B 2XMLA 1O91A 3B9CA 2EAAA 4OULA 1QQP1 3J8F3 4QT6A 1AR83 1NXMA 5A3MA 2GNMA 3NW4A 1EV13 1WGPA 4GAZA 4YM2A 2D3SA 4E4DX 5KXCA 5T50A 3WT3A 5IT6A 3ZFEA 1ODMA 1MEC3 1R092 4GWMA 4IEWA 3CNAA 3H7YA 3W59A 1ULFA 4Y24A 1UAIA 1QJY1 1TEIA 3MIHA 1QMJA 3KB5A 4FPHA 4L99A 5A3LA 3TAYA 4KBBA 3WNLA 4EJRA 4Y22A 4LUMA 2SBAA 1O4YA 1POV3 4HKWA 4UXAA 1I6XA 2CDPA 2VY0A 4LBLA 2CGOA 3KQRA 5JZGC 5JOYA 3EO6A 4BLIA 1J58A 1JTZX 1LEMA 4QXKA 4BXSV 4RS5C 1X36A 2DBNA 1LGBA 4XVHA 3LF7A 5FZAA 1SACA 1VBE3 2CWMA 4IL7A 4FOYA 4YYOA 3KHCA 2Z4FA 2WNUA 4XBLA 4ARYA 1UOJA 2Q1FA 5FXVA 5FPAA 4IQPA 3UJQA 1ENQA 1PK6A 1VBB2 4ZU4A 3WNOA 4GKYA 2WZEA 3WQ7A 4AVBA 2W1UA 3ES4A 2Y8KA 2XKOA 3ZR6A 1U5IA 4IEUA 4XMIA 1S0GA 3EHKA 4UFMA 5JI9A 1MS0A 2ZACA 3QACA 5LK5A 2UWBA 1O5LA 4YVWC 4I2OA 1HRI1 1OVPA 1J3QA 3QLQA 2A1XA 2RS53 3AKPA 1FI2A 2JDZA 2RS33 2WAOA 3MGUA 5H9SA 1W8OA 1YI7A 3WG2A 4LKEA 5FTTC 3AYEA 2A75A 3LCPA 2Z69A 4QXCA 3ZPOA 5BNQA 4CDQB 3OTFA 1XYNA 2RS12 1JZ5A 4NRQA 1RGSA 4RQPB 1W6NB 4DINB 1R081 1EAH2 2DF7A 1Q5OA 4FP2A 4P02B 2AENA 3NAPC 2VUJA 2VCAA 5F37A 5BNPC 1ASJ2 2QNKA 4YPJA 2PYTA 2PHLA 4BYYA 4AHWA 1HXS2 1BMV1 1Q8SA 3PJYA 5FZ9A 4IEXA 1HQNA 3PTYA 1FT9A 1RMU3 1FMD2 2WN2A 4CDWA 2FDHA 2VC9A 2B7YA 4FFHA 3UYJA 2WBKA 3OGGA 5K0UB 4BIOA 4V2VA 2ZGRA 2ZGTA 4XUOA 3FFZA 5CIRA 2YG0A 2IXJA 3MYXA 3P5BA 4IEQA 4BMEA 3H9AA 1AR73 2R071 4Q26A 2D6OX 3O12A 3PUAA 4LBMA 5F3CA 2VO5A 1W39A 4YG6A 5IUQA 1FV2A 3KVBA 1GWLA 1UY3A 2XLGA 2VQAA 4YG0A 1U12A 2FBEA 3J7NA 4NRPA 1H4HA 3OBAA 5FZ1A 3WG4A 1O4ZA 2W0XA 4Y1VA 5DG1A 4L0PA 1COV3 1PO21 1UCXA 3WP3A 3OUIA 2JG8A 1Q8PA 4MHUA 1HRV3 2C5DA 4LBNA 5BPXA 3VZLA 2ZABA 3K3NA 4XMAA 2VZQA 2EXIA 1DQ4A 3C7OA 3I4IA 4OZXA 3LEMA 3M8LA 1SBDA 5LBBA 2K9ZA 4XURA 1D2SA 4BQWA 3O0VA 4M01A 4LO8A 1UX6A 4YW7A 3ACIA 1FXZA 5KHJA 2CU5A 1YFUA 5DUXA 1BBT1 1SDWA 2ES3A 2XDVA 4ZPIA 3B01A 4LOTA 1TNFA 3W21A 1I5ZA 2HWC2 3EYPA 1OPOA 1LRHA 2AGSA 2E7AA 1YFYA 3Q8CA 4UFIA 2YV8A 4G4FA 4O61A 4NROA 1TME3 5KHKA 1UIJA 5IVFA 1GUIA 3E5UA 3WNMA 1PIV3 1QXJA 4F8AA 2C9AA 2PHRA 4Y1UA 4E8CA 3H0OA 3KMHA 5EWSA 2PHWA 4SBVA 5FYZA 3AVRA 3VBFA 4LR4A 4BB3A 4HPKA 2ADEA 1JW6A 3D0SA 3LDKA 2PHUA 3ZR5A 2WNVC 3URFA 1W8TA 2MEV1 4XBNA 1QJX3 4W50A 1WLCA 2E32A 2CTVA 5AC91 5FP7A 4HSJA 3VKLA 2WWSA 2HWF2 1EV12 4RFRB 4IGPA 3ROUA 4QPWA 3R0RA 4UOJA 5A33A 1QOOA 3CL1A 4PIYA 3I2OA 3HD8B 3MIGA 5CADA 3RNSA 4CP1A 4E4SA 4AVAA 3BUCA 2P37A 3HR9A 5FZOB 1OLQA 3BKZA 3LEKA 1LEDA 2A71A 2VQTA 1V00A 4N53A 1UWWA 4M3CE 4Y5TA 1QJY3 4L92A 4G3YC 3P3NA 4XEZA 5CAZA 2JDHA 1YLLA 1H0BA 3I2KA 5BYNA 1AR91 5BNOC 1D0GA 3JZVA 4RL7A 4XQ4A 3MO4A 3KT4A 1ND3A 4YW4A 4JRAA 5I8SA 3WG3A 5AVAA 1MVEA 1RUH1 4CP9B 4AGRA 1NXD1 1DF0A 4P9GA 4LLOA 4MV2A 3ZSJA 4EN0A 4YVSC 3CO2A 2IXLA 4H2AA 1RUC2 2W46A 4TN7A 5E89A 3UGHA 1OA4A 1SFYA 2PELA 1QGLA 4QHBA 5D2AA 5DUVA 3IDBB 4MVTA 4WVZA 4CXYA 1LHOA 1RUG1 5D8AA 3OGJA 4U36A 4IERA 3T30A 4BPZA 4Q1RA 5GLWA 4FPFA 4P9WA 3AYAA 3UGFA 5DPNA 1QF3A 1YRZA 2RS32 3PHMA 4NHMA 1VMJA 1NLQA 4XABA 4XQWA 5A1FA 1HRI3 2WC2A 1CIWA 5LBCA 4X6QB 1XNDA 3LA3A 2VM9A 4HK8A 1DIWA 5T55A 4A7KA 4NJ4A 5HCHA 4CPBD 1KXGA 4XFHA 3FHQA 4CDUC 5ABJA 2OUHA 4TLGA 2ZZJA 2BNOA 1YQ5A 4LULA 2JG9C 3GALA 2XBO2 3UJOA 1V70A 4P9YA 3ZYHA 3FLPA 4BDVB 3LOIA 3PMSA 3I97A 5FBZA 3UK9A 1MZ5A 5C4WA 3TRSB 4HT1T 4TZDA 1RMU2 1DGRA 2FCTA 2ATFA 5HCBA 1EPWA 5I0DA 4H7MA 3DL3A 4ZZ8A 1H9WA 1ZA4A 4AEDB 5FKCA 5K7PA 1PMIA 1Z7S1 1I3HA 2XONA 3R6SA 5HPOA 1ODNA 2D6KA 4JGZC 2E63A 1E5HA 3JQWA 5T5OA 1Q8QA 5J09A 3RZJA 1CIYA 2DYCA 3IDAA 1PK6B 5FP3A 3JD72 2VZUA 5B2GB 2R073 2SLIA 4L9BA 1YJKA 2DCJA 1V9U2 3GM8A 1SFPA 5FCCA 4KMQA 2OKXA 2MNGA 1K12A 2OXBA 4JAAA 1RXGA 2NPIA 3Q8AA 5H9RA 3FJSA 1HRV2 2D40A 2XUEA 1UZVA 4LUKA 1PO23 3BB6A 1XC6A 2QJVA 2V4AA 4I02A 3BTZA 3IAQA 5B4XA 4NPLA 1YJLA 2VZ1A 4QGMA 4QDSA 3MF9A 5JDBA 1WW7A 1HKDA 3U0ZA 4NMIA 1LOFC 2HBTA 4Q0VA 4GIQA 3ZXDA 3B93A 4CCMA 4A42A 4TSVA 4MH0E 2E26A 5C8CA 1NKGA 3N9LA 3UV9A 2D5FA 3CF6E 3RJRA 3IBMA 4UW6A 1YIFA 1YEWA 1NX9A 1PGW2 1BBT3 1W8HA 2Y33A 3T2OA 3RJ2X 2D3PA 4OHWA 3GZUC 5CISA 4HG6B 1H8VA 2CDOA 1V6KA 2BERA 1WBFA 1JYCA 1FOD2 1TME2 2BWAA 2R0HA 4DB5A 3AYCA 3POSA 1R1A1 2QQOA 3BN6A 1OLRA 1UIKA 1PZ9A 5ERLA 1OI6A 1CESA 4YW3A 4MGSA 4LHSA 2HEVF 3RWKX 5C3PA 2RMU3 4SLIA 5FAXA 3TOJA 3ZFGB 2VZSA 3BTYA 1OUSA 1HQLA 1X50A 2VL4A 3LAGA 4PLOA 3PVBB 1QJX2 5E8AA 4C1WA 1UW8A 1QNWA 2MEV3 4UYBA 2VW1A 5FZHA 1AJOA 2R49A 4HKLA 3U14A 3PTRB 2AEYA 3GDBA 3ZMOA 4JKKA 2BYVE 3VHRA 5AC93 4YFZA 2FZ2A 4NRMA 5FY7A 1PMJX 2XJTA 3Q8FA 4W6WA 4LO6B 1OA2A 3ZKYA 4HETA 2YU2A 5A80A 1CAUA 1OD5A 2WLQA 4XW3A 1QHDA 4CCNA 1MQTA 5FMCA 4K1YA 3VDDB 5J7MA 4OI0A 1W9WA 4LIVA 5FFOC 1SLIA 2WAAA 2VOVA 3WHTA 2B42B 5J48A 3O1UA 2WA4A 3RVHA 2RDQA 4URAA 3N9QA 3ZFEC 3MW2A 1MR5A 4M3CA 2NP0A 1AR93 1ZRIA 4WM7A 1STMA 2DCZA 4XFIA 4NIGA 3U10A 3CIHA 2DDUA 2EALA 2VW2A 1U5ZA 4QPYA 5FY0A 5FZKA 3RYKA 4TTGA 3BCWA 5FYVA 2WRAA 1RUH3 4HL0A 4RN5A 2BDRA 4XDPA 2WA3A 2KXLA 4O9EA 3V64A 4FOWA 2NMNA 1C5HA 2GP3A 2VOWA 4HPKB 3VBFB 5LCWL 4KGGA 1VB2A 2YC0A 2ZAAA 5T5PA 3WCSA 1BJQA 3N3HA 5I8YA 5C33A 3VKNA 1RUG3 2V73A 1JYVA 2XWJB 4IV1A 2Y6FA 2FDJA 3H1MA 1VRH1 1JBCA 2WNUC 4ISQA 1LOAA 2VMFA 1C57A 1PK6C 1RHI1 4D3WA 5LW9A 2CAUA 4QX5A 2P6CA 5DN2A 3BU0A 4OHVA 3HEIA 3EJKA 1W6QB 2VVEA 2ZEZA 3ETQA 1NE6A 1QJU1 2AZ5A 4BE3A 3OD4A 1GOHA 3T1LA 2XHNA 3T4HB 2Q5TA 2D44A 2Y6KA 1RUD2 1JS9A 4CEYA 5EPAA 3IPVB 3SLIA 1XNCA 1Y43B 3OJBA 3E6CC 1WLTA 1XYPA 2C0ZA 3AZWA 4AF9A 4Q29A 4YZ2A 1VALA 3IAPA 3RPQA 1Z7S3 4Y20B 4U2AA 1DZTA 1POQA 2HJIA 1YO8A 5ANQA 1MS9A 3MLLA 4W6XA 3POGA 4FFGA 4JTNA 4CDWC 1I1EA 1FV3A 4AAXA 4MHRA 4N90A 3K46A 1YQ6A 1OLMA 3MPBA 2GC1A 4HN1A 5JI7A 4HFSA 5CKQA 3KGZA 2WN3A 2G4IA 4J1WA 1K5JA 4KQ7A 4QQ2A 2DU1A 5LBEA 2VCCA 4P9IA 2P3KA 1VAKA 5T5JA 2VMCA 1Y9GA 3T4VA 3TN92 5IVYA 1UNBA 3LKJA 4GULA 3HOBA 1U5YA 2WQ8A 4CXXA 2UY8A 3OBZA 5IVEA 5IATA 1UX7A 3A7QA 5F32A 3AMMA 5FY5A 1S2BA 1SMVA 1VR3A 2PN5A 5A3OA 5ABJB 4OMCA 5A7NA 3KCYA 5LK7B 3C7EA 4JGYA 2Z79A 3OF1A 4PQQA 4EZ4A 2GMEA 2JDKA 4QB6A 2JG8C 2GALA 4R9AA 2ZJCA 4BXFA 2QZ2A 1UMHA 5C5TA 4KWKA 5L9RA 3WG1A 1HV0A 1BLZA 2E9QA 2EAKA 1D4M1 2OQ6A 5C8WA 1NA1B 1WD3A 2WYFA 3VBOA 3SCGA 1AZDA 2ZMKA 1JYTA 3LFMA 4PBPA 2ZEWA 1LOEA 5KHGA 3CJIA 4Y1ZA 1R1A3 4FTSA 3A23A 4QPIB 2R0FA 4Y26A 3H8OA 2RMU2 3WR0A 1NCQA 2LM3A 5I0UA 3ATGA 2NM1A 5ANNA 2EICA 2A7AA 3T2TA 4P14A 2ZX1A 3POIA 3O14A 3PLQA 5CB7A 3K4AA 4AEKA 1Y4WA 1CAXA 2RM23 3FC0A 2P34A 5FZMA 1LOBA 1DBNA 2NYYA 2IXKA 1D4VB 4R4XA 4S2FA 3PUHA 5CNAA 5A7WA 4HZFA 3H3LA 3BALA 4XZUG 1Y9MA 1OKOA 3OPTA 4LKFA 4RD7A 5KR7A 3VBFC 3IDEA 5A32B 5C9AA 2Z5WA 1XPWA 3KCCA 5EQUA 3O1VA 1W2UA 2VH9A 2ZX0A 3K48A 2OVUA 5LATA 1EP0A 4EROA 2J1UA 3FBMA 1LECA 2YROA 2JDUA 4QU1A 4CCKA 1A8MA 4OHZA 2RJ2A 3NJZA 3TYJA 3WOGA 1RC6A 4PLNA 5C8CB 3KD4A 4JX0A 4WV8A 3AKRA 3VD4A 5AVPA 4OQ9A 3HMYA 2X05A 1FPN1 3BYWA 1WZXA 2VU9A 4MADA 3CBNA 4XILA 3ZSMA 5IHRA 5F5CA 2ZPXA 1W8UA 1B09A 3J7HA 4N53C 5JMCA 2EIEA 1W6MA 1RUH2 1OOPB 2Y6GA 1XOYA 5FZFA 1UOGA 1ZM1A 1LHVA 1ZBA1 4CA9A 1IKPA 1XU1A 1CZSA 4PHZA 1MACA 5FKBA 3KCXA 3KM5A 4IV3A 1W06A 2A5ZA 4N43B 2QQKA 1C1LA 1KGYA 2YUEA 1GANA 1NLRA 4IE6A 5FY4A 4I30A 4ASLA 4ES8A 5BV6A 1ND3C 2B39A 3RZKA 2AC1A 2GU9A 2A6YA 5GZGA 2LTNA 4P08A 4QB2A 2XGXA 1HN1A 4BQ5A 2YPJA 4M0NA 4PLMA 5JXHA 3PU3A 3R05A 2J22A 1CR7A 2X53S 1CQ9A 3BIWE 3INAA 2R1DA 2XOMA 1VRH3 2VMHA 2XQXA 2JEMA 1NAEA 1RHI3 1PVC1 2J7MA 3S57A 2VZPA 5D8AC 2RDSA 1SQ4A 1XNBA 3ZVXA 2AUYA 2WSUA 2BU9A 4FI9A 2PHDA 2ZAHA 1RUJ1 3AP6A 5F5IA 1JZ7A 2OZ6A 5IFPA 4YZ4A 3ES1A 1FYUA 1XJAA 4CU7A 2AEZA 2Q30A 2R041 1DLCA 2VAUA 2VTXA 1XYOA 2W91A 3WDWA 2J1VA 4YGDA 4DY5A 2WT1A 3VBHA 2GNTA 4W8JA 1SHWB 4MYEA 4M3CB 2PHFA 1L7QA 1SEFA 5JZGB 3KV4A 5ABJC 2O8QA 4A4AA 3TB0A 2JJ6A 5KC5A 4PJYA 4RS5B 1HLCA 1Z7S2 5FPBA 4EN7B 3S7EA 2B5HA 3DXUA 3LOBA 5FQ0B 2WIIB 1QH6A 5C4WC 1CX1A 1BK0A 2GSYA 3UETA 4GH4A 3S30A 3F95A 4Q4W1 4TLFA 3BTAA 1KDKA 1S1AA 1GP5A 3WQ0A 4AFCA 2C4XA 4RHV1 1N3QA 4MGIE 3VDAA 1S0CA 2WT2A 5F9TA 1RUOA 5F2SA 1S2EA 3NMBA 5IJRA 3ACGA 3VKFC 4YVWB 2JKBA 1DYKA 2H6CA 3GZAA 2WZR2 2XUMA 4EE2A 4EWDA 4Q0QA 3ILRA 1EPZA 2OPKA 5FJHA 2QQPA 1BK1A 4Q4Y2 4NVPA 3USUA 1VBD1 1SCSA 1XU2A 3KQ4B 2AR6A 4MXVA 3MDPA 1C28A 3AZVA 3J7MA 5F2WA 3NAPB 4LBQB 1UXZA 2IVJA 5FPVA 4I3PA 1W8WA 3MW4A 1TMF2 4HONA 1RUE1 1AYM1 3AZXA 2YC4A 1GICA 2EIDA 5GZEA 2Z2SB 4CEYB 4AAPA 1KJRA 1SZBA 3QBQA 5GLUA 2G1MA 2IC1A 2JDPA 4XUNA 1G6NA 1D4M3 2P2KA 1KS4A 3DUIA 3GHNA 1X33A 3S0MA 3RG0A 5C8CC 3WEZA 4GQ7A 4AEMA 1S0FA 1AX0A 3NJYA 5FZBA 3DYPA 1NY72 4HANA 5FZCA 4BQ3A 1W3XA 4FPLA 4HXCA 3T0DA 2VGDA 4D6RA 4AVSA 2RM22 2HBUA 4IETA 3DV8A 4CCJA 2DURA 3I59A 3IB3A 4AW7A 2IVIB 5FYYA 4ZY9A 1DYOA 1LNSA 1PHMA 1YYNA 3VBSA 1RB8G 4OQ8A 2F4LA 1W0OA 4N9HA 1W8ZA 5A3NA 4COVA 1XRUA 5BUVA 2WZPP 3ZSEA 3O5SA 1Z0HA 1NQJA 4JZRA 2Q8EA 1AYN1 4XFGA 3VZOA 5CG8A 4K8RB 5L9BA 5FO9B 3PU8A 1XNKA 3T0AA 3P3PA 3S7IA 3SISA 1QJZA 4JGYB 2Y0IA 2G9GA 1ZNPA 1W2TA 3WV6A 1KEXA 3RFRA 1NCRA 5JR2A 2YBKA 1TQ5A 2JE9A 2WS91 2ZBJA 1GWMA 3ZYGA 1NLSA 5DMYA 4A7ZA 1NE4A 1FPN3 1YQ8A 3VBOB 4GB32 1MQTC 2YXSA 2JWPA 2VR4A 2RR11 2B9UA 2BEOA 1PO11 2GMMA 1VRBA 2XLFA 1HJGA 1QIQA 3CJIB 3P6BA 3Q9OA 4QX0A 1S2KA 1W03A 4URTA 4XJUA 2X09A 2XKPA 4MG2A 3I49A 1KJLA 1NCQB 1PVXA 1JUIA 1ZBA3 4E2GA 4I0WB 5FR3A 1PMHX 1JHJA 2BUKA 3AMHA 4WM7C 1O8PA 5FRAA 3AP4A 4JKLA 4XPVA 2Z42A 2CAVA 5C3RA 2WNVB 4UF0A 2JE7A 2CL2A 1QY4A 2ZKNA 5DAPA 5A3UA 3LWCA 4OYUA 1VRH2 4KBZA 2P6HA 4ITCA 3NWKA 5L9VA 4DRVA 1W3VA 2G19A 3O1SA 4LO4B 2D3RA 4GWIA 3SMHA 1ZBE1 1VP6A 2D6MA 4QDQA 5LA1A 4IXLA 1PVC3 5JAXA 2IFWA 2GNDA 3IDCB 1JOJA 3POJA 4OUMA 4IV1C 3DKQA 4HOOA 1RUJ3 2D93A 4XETA 5EHDA 4AQ6A 4ISRA 4NIHA 5IYYA 4CUGA 3NQHA 1YIPA 4S2DA 4O65A 3AVSA 2R043 4ET7A 1HJFA 4Y5Z0 3SC7X 1BEV1 3WX5A 4BK5A 2PFWA 5BNOB 1H4GA 1QNYA 1SLTA 1CD3G 4MUVA 4Z82A 4FT8A 2WUHA 2QBXA 2W08A 1G9CA 3GGLA 1ND2A 5FYMA 1KITA 1BZWA 1OVSA 1W6MB 1O3SA 1UYZA 5C71A 2FDIA 2PLV1 3AKTA 5FP4A 1WA6X 2NLRA 3KS7A 1POV0 2WR9A 4IV3B 4YVSB 4AI2A 3U75A 3USSA 3VV1A 1FX5A 4I01A 1DQ0A 3MFAA 3IZOA 4FPKA 4CEYC 4UAPA 2DCKA 2C26A 3DECA 5CYYA 3ECQA 3W9AA 3FBYA 4KI5M 5EFUA 5FZ7A 1AL21 1UYPA 4Q4W3 4QD2A 4Y3OA 4XF1A 2ZGMA 3JB4C 4FQZA 1AX1A 1OXCA 2YB7A 4UT5A 1J1TA 2P3YA 1QEXA 1XXNA 3I7DA 3O7OA 3OGRA 2VZOA 4E27A 4AI8A 1VBD3 3LEIA 4Q4V2 1K42A 4CDUB 4NHLA 1GQPA 2GMPA 2JG9B 3NNFA 3FLTA 3PL0A 2XHKA 1SPPA 2ARBA 4UI9L 3FE5A 4IW3A 2HWD1 2DCYA 1S0BA 4KU7A 4W4ZA 5HV4A 2FCVA 2ZEXA 4QKDA 4WZCA 4XTMA 1RUE3 5FK7A 4B1LA 2Q4SA 1WCUA 3RZHA 1TVGA 1H9PA 3RS6A 3FFQA 3M70A 1EY2A 2V5DA 3O0WA 2XJRA 3PUIA 4NWWA 4JGYC 4NHYA 4JGZB 2RVAA 1PNFA 3DYOA 1XBFA 3E6DA 5HV0A 1BYHA 4CDXA 2XH6A 4GH4B 1X8EA 4JC1A 4NIAA 1MPXA 3LIHA 4PQ9A 2QCSB 3RYRA 1C8M1 2CNAA 4CCLA 5AFEA 5LEKA 1O6UA 2R061 2ILMA 3VBOC 5DAVA 4C91A 3O1RA 4LKSA 2Y6JA 2BOIA 2W47A 3SH3A 2DVBA 5FY8A 3CJIC 1QJFA 1ACCA 5D21A 2QKDA 1E5RA 3J4UH 3BODA 4XCAA 5JWPA 1NCQC 3JB8A 3Q8EA 5C5UA 5HXVA 1CZTA 4MSVA 1C4RA 2FCUA 3AKQA 5DDJ2 4Z07A 2Q8OA 3VD3A 4FPCA 4XF3A 1XE7A 4BJ0A 3PDQA 1R64A 1JXNA 1VBC1 1AYN3 4Q1PA 5KHIA 4K40A 3N36A 2WWUA 4LPLA 5CA6A 2B9VA 3I3DA 4XQDA 3RSJA 5F3EA 4CRQA 1IS6A 3DN7A 4Y5SA 2VTFA 4AGVA 3J8F2 4DEQA 1I9RA 3NNJA 1AR82 2A3YA 4P9JA 5A6YA 5A3PA 2BNMA 1AXYA 5BY5A 2WABA 5C9AC 2FQPA 1QQP3 1RVF1 1ZX5A 2RJKA 1GSLA 3LA2A 1HB2A 4Y4RA 1MEC2 2WS93 2HWB1 4FPEA 3AYDA 1A3KA 2DVFA 3UGGA 2F4PA 3ZO0B 2RR13 3LIGA 1HIXA 3UKNA 4CEWA 1SFNA 1ULCA 1PO13 1NUKA 3BU7A 3OCPA 3LSEA 4M3CF 4AYUA 2OQ7A 4I3GA 1GZWA 1BXHA 1VAVA 4QPGA 1MVQA 4JHZA 1W99A 3RWNA 1OBNA 2VG9A 3OY8A 3RGBA 3AZYA 1N3OA 1OFSA 3PMEA 2WINB 5IK8A 1WMDA 2Y64A 3LDBA 2JB4A 3BIEA 3VBSB 4CSWA 2WWJA 4Q0SA 4GMP0 1VBE2 4IV3C 4QKBA 2BVBA 4GXLA 1W04A 4IEPA 4NUBA 1SLBA 4UFJA 3SEPA 3IWZA 1IZ3A 2H0VA 3HNBM 1QXPA 2C24A 3WNXA 4QGNA 1JHNA 4QX1A 1ZBE3 3WDUA 1XSQA 1DDLA 1IQDC 2JECA 2VOKA 3HPNA 3JU9A 4QDRA 3VHOA 5C3SA 5IK4A 3IIAA 4LBQD 2FHRA 1L7RA 2R042 2RS52 3H50A 5CFDA 4C90A 1W2NA 3NJVA 1OH3A 1X9TA 1BEV3 4E9KA 1X9PA 2GC3A 2VZTA 5FYHA 3ZFEB 1JH5A 1GU3A 3OSDA 2PMWB 4JHTA 2E6VA 4XHXA 3VBRA 3WQBA 1ULEA 1QU0A 3LD8A 5F5AA 4V1PA 4MGKE 3VZMA 5SV5A 4XACA 1GNZA 3KSCA 5EV7A 3WP4A 2YZ4A 1R083 1B35A 3N7JA 4KU8A 4OFGA 4AG4A 4Y22B 2A3XA 2PLV3 2WO7A 5FV3A 3VBHC 5FWEA 1XE0A 3BVCA 5C3OA 5IAXA 1OMIA 2CV6A 2DCTA 1JU4A 1ZREA 5E88A 4O7XA 2P5BA 1W8FA 2WNOA 3ETPA 4H55A 4NIIA 1ZZ6A 2B8MA 3AMNA 1AL23 5FYIA 3ZYJB 1GV9A 4HVRA 4B4PA 4XIOA 3S5AA 3FUOA 3MW3A 3GXUA 4A7YA 1ZRDA 2WNUB 3M7AA 1AR61 1AR72 3MIEA 3OD0A 3WINE 2LALA 4K8FA 1OLME 1WWYA 4GH4C 3H8XA 4EQVA 1C3HA 3BGAA 4OI2A 1PZ8A 1UOBA 4Q8LA 5IK7A 5FY1A 3O1OA 1XNTA 4ZXEA 4FPJA 1O3QA 3D3AA 2IZWA 4Q27A 4TXWA 3NO8A 3C2UA 1COV2 2ORZA 1UZZA 2E31A 1W2AX 2VOXA 2YGLA 3ZPYA 4B4RA 1GQHA 2XWBB 1DCSA 2LW8A 2HWD3 4FFIA 1A34A 4RGGA 5J1XA 3NRUA 4UBHA 1H1IA 4JQRA 3WQ1A 1ND2B 1OH4A 3RMXA 4IEOA 3TNPB 5K8SA 2AYHA 4AHZA 4BQYA 4PF1A 2ZX2A 2FDFA 1AL0G 3FLRA 2JIJA 3GNEA 3GCXA 4EN6B 4DUVA 3WUDA 5I8TA 4CDWB 1AF9A 1H2NA 5FMOS 1C8M3 5L19A 4WM8A 2NZ9A 1MS8A 1PIV2 2QUOA 3N9MA 5KXBA 1S0JA 2WDBA 2ZZQA 5CBLA 2A6ZA 3POBA 4AFMA 4OHYA 1RUF1 4A3ZA 4HSLA 3AFKA 4Q4X1 5EYXA 1AYN2 4JQTA 1BHGA 1H1AA 4GWNA 4P9XA 4KWUA 4BCUA 2YYOA 1VBC3 5I0RA 3VBSC 2WO1A 2DBIA 1CAVA 1PM4A 2VULA 3G7DA 2WFF1 4UWDA 5LWBA 1UKRA 3BPSA 3HIFA 3D0JA 3MLKA 3QH6A 1QQP2 1V6LA 2JG8B 5KHHA 1RVF3 5ACA1 2QTWB 3OYWA 4YG3A 3VZNA 4CVUA 3TEWA 1QJEA 2QQIA 2QQJA 2HWB3 1IOAA 4IESA 4GKXA 2UU8A 2RR12 1REEA 1GOGA 3GF6A 1VBA1 1QJY2 4LO7A 4TYSA 5FK8A 3RZZA 3U07A 4AE2A 1GLHA 4FOVA 4YZ5A 3KVAA 1NCRC 2UYBA 4CCEA 1HN0A 1W6OA 1UYYA 2VXJA 1ZRCA 4NWVA 4XBQA 4L2NA 4D7TA 4LXLA 4YFWA 3TEYA 1DZRA 1WCDJ 3ZSLA 1ALYA 3KWVA 4JKMA 3ACHA 2XR4A 1DQ2A 3PVEA 1CWPA 5FJKA 3NVCA 3SEEA 4COWA 3I8TA 2Y38A 3VGIA 4AEJA 3E5QA 2PHXA 2AREA 2ORXA 2XG3A 4AVTA 1Y7BA 2LROA 4FO9A 3WF4A 2C9KA 2R6QA 4PF5A 3H8RA 3DPRA 4B7EA 3KZ4C 4MX3A 4CUBA 1YQ2A 3K77A 1WMFA 2UWAA 4C0BA 4JRLA 2ENRA 4PBOA 3AL5A 1WA4A 5FREA 1WMXA 2EA7A 3IMNA 5KWRA 5J37A 1TZOA 2F17A 1HRI2 4JDOA 2VBPA 5HI0A 4FAGA 1BEV2 2J1RA 3AXEA 2H0BA 3NV1A 4BQXA 5A33B 2XL9A 4RR3A 4COYA 4JDMA 5AFBA 4QMAA 3HBKA 3GBFA 1WBLA 4B4QA 1V6OA 4N53B 5FUNA 2HWE1 4CEWB 2JE8A 1LOGA 1R082 1J59A 5KC6A 2PLV2 3KT1A 2D6NA 2V72A 4NO4A 2Y6HA 5A1AA 2DUQA 2BV4A 3CU7A 4LK6A 1J84A 1BMV2 1OA3A 2RV9A 2YFZA 3A4UA 1ND2C 1ND3B 1WUVA 2XB6C 3FX3A 3ST7A 5A6ZA 5IVJA 1TNRA 2GH2A 1T2XA 3AX4A 1VBB1 2XPJA 1ENRA 1OQEA 3FHIB 4HMZA 1ZZCA 2W1WA 4LTAA 5EIYB 2XJPA 3LB9A 3VD7A 3WW2A 3MLJA 1AR63 4YLZA 2R072 5A7SA 3K3OA 1CJDA 4KH9A 2ZXQA 5FY9A 5LRRA 1LGNA 5D8AB 5FMOL 2WSVA 2EF6A 3POFA 5FPUA 2C6SA 1IHMA 2NMOA 2K46A 4E4ZA 2D97A 3R4SA 4ARXA 2FDGA 2Y60A 4MGTA 1RYYA 3WD5A 3HQUA 1MZEA 1CJPA 4A2UA 2RS11 1PO22 1RITA 2HWD2 1EAH1 2W5FA 4D6SA 1ZYBA 4NR1A 3AMPA 3ZM8A 1WW6A 2PQQA 1BQPA 5IK5A 1ASJ1 4P9LA 4AOCA 3CMGA 3W20A 4J6GA 4XJZA 1HXS1 1SLCA 2E51A 2IWGB 3MHZA 2K2SA 2N7GA 1B35B 4QU2A 1MS1A 2O14A 5F6KA 1FMD1 2I45A 4COUA 2R16A 3MIBA 3MV01 4PIXA 4D8MA 1BBT2 1R1ZA 5C4WB 2BFUS 3E97A 1M06G 1PGL1 2D98A 3SITA 2VXRA 1C8M2 2W39A 5JXGA 1UD1A 4DXZA 3ZLIA 2P4EA 1GYKA 1F4HA 2J1TA 4K6BA 4QX2A 1MZ6A 2O1QA 1YHFA 4HVOA 3VLBB 2E33A 3NV4A 1W9TA 4IUGA 3I2JA 4CDXC 1ZA7A 2GAUA 4FPYA 2IXCA 4BIFA 2ZX3A 3VBUA 2VMEA 3ZYFA 4CCDA 1OF3A 4Q4X3 1G8WA 2KD7A 2MEV2 3NNMA 3PNAA 4LKDA 2JIGA 1JUHA 3SKJE 5HXMA 4YWAA 5AC92 2WFF3 2PXJA 4AWDA 5FYUA 4KNCA 5JOWA 3FMGA 1ENXA 1RVF2 4LA3A 3NKTA 5FO8B 2ZA9A 4XTPA 2L9LA 1VJ2A 2HWB2 2PAMA 5A7OA 5ACA3 1H2LA 3PIGA 1JODA 3N7KA 4GWJA 4D0QA 2P3IA 2WYSA 1UY4A 4CU9A 4DUWA 1GZTA 3POWA 4RGAA 4XAAA 2V4VA 5JOXA 2BOJA 4YGBA 2HWC1 5EYYA 1IGOA 5F5QA 3VB9A 3EMRA 1J83A 1N1SA 2VQUA 4PI2A 1NOVA 3QCWA 4DXSA 1V6NA 2LRPA 3K51A 4HBNA 3JCIA 1S0EA 3H3UA 1AR92 1N47A 2WT0A 3KF5A 3IT8A 2JICA 3CEWA 4EYUA 1DU3D 3GBWA 3M1HA 1SLLA 4DRRA 3ZMNA 4CEWC 3DYMA 2JD4A 1RJ7A 4FFFA 4QX3A 5LY2A 4R8HA 3WNPA 3VDBA 4QPGC 3HAGA 2X29A 1QDOA 1GFF2 4AQTA 2W68A 2VPVA 1X7NA 3B7MA 4OZOA 3MUZ1 2BJSA 2HEYF 1TE1B 3C7HA 4M4PA 4LMFA 2PA7A 2UURA 1OHFA 1ST8A 3ME2A 1RUG2 1EV11 2HWF1 3AJYA 3MI8A 1FNYA 1WMEA 1REFA 1CAWA 1UO9A 2DU0A 2HYXA 2QQNA 1O3RA 1DG6A 2RDRA 4XJ8A 5ISLA 1G9FA 1UPIA 3BI3A 1WLDA 1H30A 2B45X 1IKQA 4AI1A 4CDQA 2ARCA 2BVVA 4RQPA 1W6NA 1CAUB 3D8CA 2VUDA 2JD9A 5E16A 5FUIA 5GJ6A 5JXJA 5CFCA 1MQTB 3L9JT 2ZHNA 2JKXA 5FP8A 1BVP1 2HWE3 2BW8A 1C5IA 2A73B 5CFDC 5I0TA 3HT1A 1QJU3 1DZQA 2FMDA 5DQ0A 2GN3A 1CPNA 2VUAA 4Y33A 4WM7B 1UY0A 3IIIA 5K0UA 3VBRC 1JYNA 3HQRA 3JQXA 2G9FA 2ZGUA 1LTEA 3HNMA 5F8PA 3LPGA 1RUC1 2F6BA 1RUNA 4WBBA 2XJQA 1UZYA 4AFDA 5FZ8A 1B35C 1V6JA 5GZDA 4N7IA 1VBB3 2P17A 4ZU5A 5T52A 2QFEA 2EIBA 1LR5A 2J1EA 4QWNA 5FDBA 2VMGA 1GZ9A 2BFUL 2FMYA 3OEBA 4IE5A 4MXWA 3THPA 1W8NA 1DGRN 5E1RA 1MZFA 2JENA 4RA0A 5IFTA 1JZ8A 2RS31 4BH9A 3CLPA 4H7LA 3THTA 2HYKA 4QB1A 4IV1B 2VECA 5F39A 3GZTB 3KGLA 3ACLA 3RZLA 4YNIA 3GBGA 3MBWA 3R4UA 3H3ZA 4NAOA 4QX8A 1MS4A 1LODA 2RS13 4RR3B 2P1BA 3EQEA 4NPMA 2VNOA 2XBO1 4XCBA 2WLPA 2XVGA 5F3GA 5DAQA 4DZGA 2PQSA 1ASJ3 2Q8CA 3ZDSA 1APNA 3C3VA 2BRTA 3EBRA 4MGYE 1RMU1 1AVBA 2WO3A 5I91A 1HXS3 1YXWA 3HNYM 3NKGA 4LJHA 3V65A 5KXEA 3CJXA 2BGCA 5IAVA 1Q8OA 1FMD3 1C1FA 3T0BA 2GDFA 1JZ2A 1KRIA 1UU4A 4COZA 2WKKA 1LULA 2OT7A 1CN1A 3OEAA 3ORJA 4I0AA 4XHBA 2Q8DA 4GJYA 3VL9A 1OF4A 3GYDA 5LA9A 3N35A 2A6WA 1K5MA 5I93A 4XOGA 1JYXA 4Q5OA 3JD71 3AB0A 2E7TA 5F1RA 1R1A2 1VMHA 1ZZ7A 3MF6A 2W1SA 4UW5A 2OPWA 2OS2A 1V9U1 4A44A 2ERFA 3DXTA 1YWKA 2EIGA 3POYA 4UW3A 3SHRA 4AQ2A 3AMQA 4CU8A 1FNZA 3VUOA 1W0NA 4BISA 5A6QA 4WM8C 3VD5A 4XUQA 2HLEA 1N3PA 1HW5A 1QH7A 3IN9A 4MO3M 3U78A 1JYIA 2W52A 4FSJA 1RINA 4AK3A 2OW4A 5FPLA 3WNNA 4LK7A 1JMUB 2WZ8A 3V0AA 1F35A 5CZKA 1Q8VA 5FZEA 3B3QE 5L36A 3T2QA 5FZOA 1YUDA 3ASIA 2BBVA 1LGCA 1IPKA 1W0PA 1LCLA 1O7FA 2Y34A 4NE9A 4DUXA 2YBPA 2ZOEB 4AZZA 1PGW1 2H6BA 1W6PA 4RFT0 4ZS3A 3JXSA 2IUWA 3A0KA 2ET1A 4AFAA 2CSGA 2HWC3 3PIJA 1FOD1 2GNBA 1TME1 3LGRA 1UXXX 2ZGSA 2VMIA 4QKNA 4K1ZA 3B9IA 4FBFA 2R7EB 4GMP1 5IW0A 4E2SA 3QD6A 3J9SA 2VMDA 2W95A 4Q2FA 1OSGA 2DFBA 2ZHKA 4FOQA 4AFBA 5FLHA 1UL9A 3OG2A 2Q0AA 3I2DA 5CU1A 4EWAA 5FWJA 2EXJA 1DLLA 3SH4A 2A6XA 1QJX1 5KXDA 4AI0A 3RQ0A 1JOPA 3CZJA 4C8DA 3ZX7A 1V6IA 2ARAA 2K0GA 1WKYA 4Z8BA 4ATEA 4JCKA 1CAXB 3M2MA 4QHZA 1IS4A 5LB6A 1MS3A 3ZXEA 3ILNA 4KL1A 4YM0A 2HWF3 5EJ3A 2ARXA 3ZN4A 1GOFA 1LU1A 1HB3A 3QOPA 5A7WB 5FMDA 4J25A 3ABZA 5G04L 5EJ1B 2A6VA 4HVQA 5C9AB 3N9PA 3ZFFA 1GBGA 1RHI2 3AC0A 4EN8B 2B46X 4BWOA 3DPRC 3K2OA 4O9GA 5A7PA 2AACA 2XXZA 1AXKA 1UU6A 1OQDA 2O8OA 3AXDA 4N9IA 4NN0A 1CONA 4AVCA 5FOJB 3DGTA 2HWE2 4K3UA 4NHKA 5FLIA 1DGWA 2E53A 3BPZA 2OX0A 1QJU2 4WZFA 4XUTA 3THDA 1A6CA 3BTXA 5IVVA 2YDEA 1LAJA 1G86A 4RR3C 1OPMA 2D7FA 4UFLA 2NQYA 3I2GA 4AEDA 4NIDA 2ZGLA 1C8NA 4B3NA 2ADDA 2P3JA 3J26N 3U4XA 4RYDA 3T3YA 1RUC3 2BWCA 4QQPA 4LQRA 3HN1A 4XXAA 1DYPA 4YZ3A 5J98B 3S6PA 4YZ1A 3JUUA 2YC2A 3B69A 2YFUA 5JUVA 3OBTA 5JPNB 4ATFA 3I54A 4LE3A 4LBOA 4ASMB 2XJUA 1D7PM 1DP0A 1OUXA 3ZXJA 3I3EA 2X5IA 4DFSA 4M4RA 1CAWB 4OVEA 1OT5A 4PDWA 2VD7A 3H42B 5APAA 2X10A 5GM0A 4RHV3 4LHLA 3R4DB 4XF9A 3PURA 2CWSA 3WZ1A 1VB4A 4XIKA 3ELNA 2CGPA 3MPPG 4LE4A 1WW5A 4LA2A 4LHNA 3TBDA 1VIWB 5CFCB 5BNNA 3OGSA 1Q56A 2XBO3 4LOSA 3AJZA 3NSTA 2VUCA 1QOSA 1RUD1 4Z1VA 3M3OA 5LY1A 2YY1A 4BU2A 1ZZBA 2WL1A 4Q0PA 4Z2WA 4W6YA 1W9SA 3LA7A 5FYSA 4N7UA 3VBHB 1RXFA 3E5XA 3I3QA 1K3IA 1AYM3 1PGL2 4K9SA 2RDNA 3GCWA 3FHAA 1JZ6A 1D4M2 3D6EA 5C6CA 1URXA 2OIIA 1REDA 1OQ1A 4PCRA 3VDCA 3A0NA 3HJRA 3JD73 4XXPA 4ZS2A 3ZFGA 3PVOA 2JDMA 1FATA 4CE8A 5GLZA 4MXWB 3TEXA 1V9U3 1CVNA 4H14A 4ONUA 1ONAA 3FUQA 1SG3A 1H8TA 2J42A 1O8SA 2D6LX 1F15A 3NV2A 3SQOA 2JB8A 4IE4A 3HVDA 3TN91 2RG4A 4YW6A 5GKAC 1EUUA 4XUPA 5DZGA 1LESA 5T5LA 1JU3A 3WSOA 1QDCA 5LBFA 3WVJA 3AZZA 3VBUC 5GLVA 3WW3A 1US2A 4M0HA 3T2PA 3VDDA 3USUB 5JMOA 2B4KA 2BP6A 1UMIA 1A8DA 3VHNA 1GZCA 1J3PA 2VNRA 3WNKA 5JCTA 5K4LA 3SH5A 4AR2A 1UPSA 4DMIA 4IDZA 5A7QA 5FLJA 1S0IA 5IVCA 2YGMA 5FXXA 1Q43A 1FOD3 1VMFA 2BZDA 3KHBA 2RJLA 3M3IA 1FPN2 1RUI1 4BQ1A 5T54A 1K5MB 2X8KA 4GMP3 2RMU1 2ZGOA 3NV3A 2ID4A 4DXTA 4CU6A 1LHNA 5JR7B 4PT6A 5FZ6A 3FZ3A 4META 2KR2A 4YGCA 4FPGA 1ZBA2 1VPHA 2Q1ZB 2W9XA 5LA2A 3WDYA 4YW5A 1XNAA 2LS6A 3L2YA 5L7OA 2EVXA 2W92A 1ZZ9A 3AP9A 3I59B 5EP9A 4QQLA 4ASKA 2A3WA 3JBG1 4LITA 2WO2A 4XC9A 5G05L 3V0AB 3B02A 4FP3A 1EYBA 2XVLA 1W6QA 2I07B 1YI9A 4MGZE 4G9SB 1F4AA 1GNYA 4N8MA 4PI0A 3ZN6A 3T09A 3ZDVA 3TEZA 4OLLA 1F9KA 1PVC2 4ZKTB 5J96B 1CPMA 3T08A 1W6PB 1RUJ2 4ZXKA 2D5HA 5FZ0A 1GNHA 4XJWA 3WY6A 2QQMA 4CXWA 4ZU7A 1GP4A 1G9DA 4AQSA 5LEJA 2PAEA 1WCKA 1NCRB 1YNAA 4I0BA 1D0HA 3IPVA 2QQVA 4IE0A 3TWIA 4CDQC 5LA0A 4RQPC 1SDDB 4QAWA 5IWFA 4RSUA 4BQ4A 4DS0A 3OOXA 4D7SA 2YPDA 5CFCC 5JOZA 4QHOA 4KGQA 3HT2A 1OFNA 4Y20A 3WF0A 4KG0A 3M3CA 1ZZ8A 3B00A 1QWRA 4L97A 5FUPA 5FXZA 1JYWA 3V56A 4CP0A 1DQ1A 2I2SA 3C7FA 3N9OA 3ENRA 5K0UC 1G9BA 4UW4A 5F3IA 3GHMA 1X8MA 4Q4W2 4I09A 3D5OA 1XSRA 1N1YA 4QGLA 4UF0B 3V0BA 5GZCA 3BOPA 2VNGA 4OMDA 2RE9A 3E1F1 4RHV2 2JXAA 4GALA 4YM1A 4OCTA 1OURA 1XE8A 2Q1MA 2EXKA 1HQWA 4K7JA 4LLFA 1UZWA 5CVRA 2CGNA 1DFQA 3ZFFB 4DXRA 2W87A 1AHSA 4A6OA 2VOTA 5JIUA 3FWEA 2JDYA 2QZ3A 3TNQA 3W5NA 5HCFA 3M4FA 3ZSKA 1VBD2 3H7JA 5CG9A 2OUJA 1GKBA 4EV0A 5LRSA 1NZCA 4L8QA 4AGGA 4A3XA 1RUD3 3HBZA 1LHUA 3M3QA 5DAWA 4YW2A 1NA1A 3LDRA 3UNPA 3GJBA 1RUE2 1VAMA 1AYM2 1ULOA 3LEGA 5E6HA 4YRDA 2Y0OA 3VKOA 5A6XA 3RZGA 2GP5A 4QPIA 4QQHA 4X8NA 4OI1A 4INDA 3U37A 5JSOA 1O59A 5FYBA 4FPOB 1D2QA 3WDTA 5DUUA 4XYXA 3OBRA 1ULPA 2DV9A 2ZGKA 2EXHA 5SV8A 2IFRA 3WHUA 1J3RA 5DXDA 1IG0A 5KBFA 5HBAA 5EJZB 2BPA2 3MUY1 4CYDA 3WW4A 1F8VA 1HB4A 1K5MC 1AUYA 2V09A 1S55A 2X5IB 2W94A 4UFHA 4BM8A 4Q0UA 1LU2A 2R063 2WZR1 2ZCWA 4PDWB 4CUCA 3TN93 5A32A 1UYXA 3QH7A 2MHFA 4Q4Y1 4BLJA 1T6BX 2ZGPA 1YFXA 2ZTNA 3AP7A 5FZIA 5BNNB 4W65A 4FVVA 4XFBA 2VBBA 4XE9A 3ZIXA 2XJSA 1TMF1 3WDVA 3WF3A 4C1XA 3MIFA 1BCXA 2ZGNA 1SPPB 2ET7A 2OZJA 3ZYBA 1SCRA 3IKWA 3U4SA 4IE7A 1S4CA 1G7YA 2WS92 3IM0A 3ON7A 3ZXKA 1OOPA 1RUI3 3KT7A 3OPWA 3N9NA 3ZOIA 1TG7A 3SKVA 1JZ4A 1PO12 1NY71 1UU5A 2UY9A 4N43A 1UQXA 1DQ5A 4YGEA 4FCAA 3U1XA 5A3TA 1Y3TA 1NZIA 2RM21 3KV6A 1XB9A 2I74A 3D4KA 3ZXLA 4B8EA 1W90A 3HN3A 4CDXB 3EB7A 3VKMA 1H8TB 3ZYPA 4R52A 2CYFA 4P5YA 3RRDA 3O1MA 2VZVA 3H1WA 5DUWA 2XQRA 4F7ZA 1GWKA 1O4TA 3WCRA 4H3WA 4LEJA 3JBG3 2UYAA 2TUNA 4GJZA 2ZMLA 3ZIWA 3DKWA 1O5UA 5EZWA 4CZSA 1YCIA 1KFXL 1T6GC 5CKMA 2GZWA 2BNNA 3E6BA 3I3MA 1LB2A 1L3JA 2HEWF 4IEYA 4TWTA 4C0HA 1IPSA 3NNGA 2DWRA 4RGKA 1PX4A 1ZBE2 4D7YA 5C70A 3KLSA 3M3EA 1ZRRA 4BZ4A 1ENSA 5FBJA 1R091 3CKHA 1ULGA 4GB31 4R4ZA 5JZGA 3ZFFC 2KA3A 4XFFA 4P00B 5FZLA 5L73A 1YQCA 1WLWA 2GH8A 5M0TA 4Y1YA 5GALA 3T1MA 3I2HA 4RS5A 5TSWA 3DCQA 4ORFA 4QKFA 5FQ0A 2J1SA 4HN0A 2ZMNA 1MS5A 3C7GA 1SLAA 4AL9A 2LUWA 3I2FA 1N1TA 2DVAA 2GC0A 2BGOA 3AFGA 1GZWB 4GZ9A 3ZYIB 4QPGB 3F2ZA 3W5MA 2G9ZA 3N4MA 4AEDC 2DTYA 5L7OB 3CDZB 3OY8B 4FAHA 1GMMA 5GZFA 5JXIA 4HKOA 3WP6A 4D6QA 1AL22 2HH9A 2CHHA 4YVWA 3UT0A 2R32A 4Q8KA 2PTMA 1NT0A 3RI8A 2Y6LA 3A22A 4QM8A 4LNVA 2VZRA 3OPZA 5FPZA 3RMYA 4GD4A 3N7LA 5JVVA 1W9YA 2JDAA 3ZN6B 4Z2AA 1KDMA 4ZONA 1ULDA 4UBGA 1N1VA 1S0DA 2XLAA 3L2HA 2X5IC 1KD7A 3NAPA 3PVNA 4LBQA 5DZEA 5FO7B 5H9PA 5BNPA 1K45A 1UF2C 4JV4A 5DABA 4PDWC 4B7KA 5JSRA 1EUTA 4NAMA 3SNMA 4OUSA 2D6PA 1IPJA 3DF0A 3GZEA 3O1TA 3ZYRA 1V6MA 5JLVA 4QXHA 4DEVA 5CFDB 3ITQA 4HK9A 4J1XA 4AXOA 2GC2A 2A70A 3AM2A 3UESA 1HX6A 4A41A 4AHYA 3P1IA 4CPBA 3LZZA 3K75B 4D94A 4R9DA 4LT5A 3WF1A 3VBRB 3MFCA 4B1MA 5FYCA 5BNNC 2ZX4A 4JDNA 1JN2P 1E5SA 1JZ3A 1KQRA 3MICA 2HKXA 5JSPA 1DGWX 1H2MA 1V0AA 2VQ0A 5FPXA 4K21A 3WDXA 1RL3A 4BQ2A 5CEHA 1PM7A 3VZJA 3WF2A 1KFUL 2DVGA 2O0OA 4QQOA 3ILFA 2WJSA 5FMBA 3LE0A 3I3BA 3OUJA 1AJKA 2VTXJ 3V0BB 3UKTA 2R062 2QDRA 3VD9A 1UKGA 5J36A 2VCMA 2WZR3 3ZFGC 4IGQA 5EXOA 5IVBA 3RZMA 4WVMA 4XJ9A 4KWJA 2IXIA 4Q4Y3 4BHPA 1OC1A 1H8TC 4Q4V1 5JPMB 2XVKA 3NJXA 1YFWA 1RUF3 2W3JA 5D1IA 1VE0A 4EZHA 4F3JA 4A6SA 1VBC2 2VVDA 4YM3A 3OGVA 1DHKB 1QKQA 1TMF3 2UWCA 1WCQA 3ZN5A 1LOCA 5J3UA 1A78A 1DQ6A 2QQWA 2DVDA 1AX2A 2J1AA 3VDDC 4MOAA 3A21A 3WUCA 2DUPA 2GN7A 2OYZA 2Y26A 4X6RB 4YARA 1RUI2 4XF4A 1NQDA 1H2KA 3UKVA 4B29A 5CKNA 2IXHA 1WW4A 3IMMA 2QQUA 4WVVA 4DY3A 4FTEA 2DFCA 3WXPA 4FQ4A 2BTVC 4DIQA 2TNFA 1VBA3 5FP9A 3WW1A 3ZXGA 1BVVA 4FXKB 4BOWA 4E4HA 4ZHNA 1RJ8A 2WNVA 3FL7A 2VW0A 4GA9A 4YW1A 4ES9A 4LBJA 2ZGQA 5F6LB 2ZHLA 1Y9QA 4WM8B 5F7UA 2D43A 1OKQA 5A1LA 3JBG2 5LZ6A 1J1LA 1H1MA 1L7LA 3KF3A 5DDJ1 4QX7A 2ZS6B 1UN1A 2BGPA 3ACFA 2XL7A 3J7LA 4F83A 3HWJA
chains in the Genus database with same CATH topology
5F2SA 4C8DA 2OQ7A 4V2VA 5E6HA 4CUGA 3AVSA 4Y33A 4LIVA 4D6SA 5A1FA 4CCOA 4D6QA 2GP5A 4AI9A 3RVHA 5F3CA 4URAA 3N9QA 3PUAA 5FYBA 5FJHA 4V2WA 5FYMA 3LDBA 5FZ3A 5FZ8A 5FY0A 5FZKA 4GD4A 5K4LA 5FZMA 5A7WB 2WWJA 3KVBA 4IGOA 4CSWA 5LWBA 5A7QA 2W2IA 5F2WA 5FP4A 5IVCA 5FXXA 5FYVA 3N9PA 4QWNA 5FZ1A 5A7WA 5FPVA 5FZ4A 4NUBA 4XDPA 3OPTA 4HONA 3K2OA 5A7PA 2XXZA 5KR7A 2GP3A 4AAPA 3ZLIA 5FZ7A 3K3NA 5F39A 5FZ6A 4QXHA 2OX0A 4Y3OA 4CCKA 4QU1A 3KV9A 3KVAA 5FZDA 5IVVA 5FWJA 4QX8A 2XMLA 5FYCA 5FZIA 3NJYA 5FZBA 5LW9A 2XDVA 5F3GA 5FP3A 5FYHA 5FZCA 4LXLA 4ASKA 4D6RA 4GAZA 4LITA 2Q8CA 3LD8A 5F5CA 4CCJA 5F5AA 4XDOA 5FYTA 5FYYA 5FJKA 5FZGA 5CEHA 2PXJA 3AL6A 5FZFA 5IVFA 5FYUA 3U4SA 5FV3A 2YBSA 5FWEA 5A3NA 2OT7A 2Q8DA 2XUEA 4GJYA 3OPWA 5A7OA 5FY4A 5FYZA 3N9NA 2P5BA 3AVRA 2Q8EA 5FZ0A 2VD7A 4IGQA 3PU8A 5FYIA 5A3TA 5IVBA 3KV6A 3AL5A 3PURA 2OS2A 3PUQA 4CCMA 3PU3A 5FZAA 5IWFA 3DXTA 5FP7A 4LIUA 3N9LA 2YPDA 2YBKA 4EZHA 4IGPA 5ANQA 2YU1A 4CCLA 4BISA 5FXVA 5FPAA 4EYUA 5FY1A 5F5IA 3U78A 5FUNA 4GJZA 5LY1A 4BU2A 5FY8A 5LY2A 5FPLA 1VRBA 5FZOB 5FUPA 5FXZA 4QXBA 5FYSA 5FZEA 3PUSA 3N9OA 5F3IA 5FZOA 5A3WA 5IVYA 4UF0B 2YBPA 3PDQA 5FBJA 5IVEA 5IVJA 2WWUA 4DIQA 5F32A 3KV4A 4UF0A 5FY5A 3ZPOA 4QXCA 5FP9A 5F3EA 5A7NA 4E4HA 5FXWA 3KV5A 5FZLA 5FPBA 5FZHA 5ISLA 5A3PA 5F37A 4EZ4A 3DXUA 3PTRB 4BXFA 5IW0A 5A7SA 3K3OA 4Y4RA 5FY7A 4TN7A 5FY9A 5A1LA 2OQ6A 2YU2A 5A80A 5FZ9A 4DO0A 4QX7A 5FPUA 5FP8A 4HOOA 4CCNA 3N9MA 3UYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F2S A;  4C8D A;  2OQ7 A;  4V2V A;  5E6H A;  4CUG A;  3AVS A;  4Y33 A;  4LIV A;  4D6S A;  5A1F A;  4CCO A;  4D6Q A;  2GP5 A;  4AI9 A;  3RVH A;  5F3C A;  4URA A;  3N9Q A;  3PUA A;  5FYB A;  5FJH A;  4V2W A;  5FYM A;  3LDB A;  5FZ3 A;  5FZ8 A;  5FY0 A;  5FZK A;  4GD4 A;  5K4L A;  5FZM A;  5A7W B;  2WWJ A;  3KVB A;  4IGO A;  4CSW A;  5LWB A;  5A7Q A;  2W2I A;  5F2W A;  5FP4 A;  5IVC A;  5FXX A;  5FYV A;  3N9P A;  4QWN A;  5FZ1 A;  5A7W A;  5FPV A;  5FZ4 A;  4NUB A;  4XDP A;  3OPT A;  4HON A;  3K2O A;  5A7P A;  2XXZ A;  5KR7 A;  2GP3 A;  4AAP A;  3ZLI A;  5FZ7 A;  3K3N A;  5F39 A;  5FZ6 A;  4QXH A;  2OX0 A;  4Y3O A;  4CCK A;  4QU1 A;  3KV9 A;  3KVA A;  5FZD A;  5IVV A;  5FWJ A;  4QX8 A;  2XML A;  5FYC A;  5FZI A;  3NJY A;  5FZB A;  5LW9 A;  2XDV A;  5F3G A;  5FP3 A;  5FYH A;  5FZC A;  4LXL A;  4ASK A;  4D6R A;  4GAZ A;  4LIT A;  2Q8C A;  3LD8 A;  5F5C A;  4CCJ A;  5F5A A;  4XDO A;  5FYT A;  5FYY A;  5FJK A;  5FZG A;  5CEH A;  2PXJ A;  3AL6 A;  5FZF A;  5IVF A;  5FYU A;  3U4S A;  5FV3 A;  2YBS A;  5FWE A;  5A3N A;  2OT7 A;  2Q8D A;  2XUE A;  4GJY A;  3OPW A;  5A7O A;  5FY4 A;  5FYZ A;  3N9N A;  2P5B A;  3AVR A;  2Q8E A;  5FZ0 A;  2VD7 A;  4IGQ A;  3PU8 A;  5FYI A;  5A3T A;  5IVB A;  3KV6 A;  3AL5 A;  3PUR A;  2OS2 A;  3PUQ A;  4CCM A;  3PU3 A;  5FZA A;  5IWF A;  3DXT A;  5FP7 A;  4LIU A;  3N9L A;  2YPD A;  2YBK A;  4EZH A;  4IGP A;  5ANQ A;  2YU1 A;  4CCL A;  4BIS A;  5FXV A;  5FPA A;  4EYU A;  5FY1 A;  5F5I A;  3U78 A;  5FUN A;  4GJZ A;  5LY1 A;  4BU2 A;  5FY8 A;  5LY2 A;  5FPL A;  1VRB A;  5FZO B;  5FUP A;  5FXZ A;  4QXB A;  5FYS A;  5FZE A;  3PUS A;  3N9O A;  5F3I A;  5FZO A;  5A3W A;  5IVY A;  4UF0 B;  2YBP A;  3PDQ A;  5FBJ A;  5IVE A;  5IVJ A;  2WWU A;  4DIQ A;  5F32 A;  3KV4 A;  4UF0 A;  5FY5 A;  3ZPO A;  4QXC A;  5FP9 A;  5F3E A;  5A7N A;  4E4H A;  5FXW A;  3KV5 A;  5FZL A;  5FPB A;  5FZH A;  5ISL A;  5A3P A;  5F37 A;  4EZ4 A;  3DXU A;  3PTR B;  4BXF A;  5IW0 A;  5A7S A;  3K3O A;  4Y4R A;  5FY7 A;  4TN7 A;  5FY9 A;  5A1L A;  2OQ6 A;  2YU2 A;  5A80 A;  5FZ9 A;  4DO0 A;  4QX7 A;  5FPU A;  5FP8 A;  4HOO A;  4CCN A;  3N9M A;  3UYJ A; 
#chains in the Genus database with same CATH topology
 1PZ7 A;  4XZP A;  5A70 A;  2W1Q A;  1UMZ A;  2XJV A;  4CP2 A;  4IEZ A;  5L7O C;  3WP5 A;  1HV1 A;  1GR3 A;  3J8F 1;  1AR8 1;  2JDN A;  4CCO A;  3I2I A;  1RIR A;  1VLN A;  4LHK A;  4L11 A;  1KS5 A;  4AI9 A;  3THC A;  1CAV B;  1UOF A;  3POE A;  5C3Q A;  4V2W A;  3B5L B;  1Z78 A;  1MEC 1;  2VCB A;  3SXW A;  2TEP A;  5BNO A;  2AH2 A;  3W58 A;  2FDK A;  1ZVF A;  1H6X A;  4MZU A;  3H1Y A;  4IGO A;  3RYP A;  1R09 3;  1LJ7 A;  2W2I A;  4GB3 3;  2WQ4 A;  5T3N A;  3CQO A;  3OYW B;  2DUO A;  2R1B A;  3APB A;  4A45 A;  5FZ4 A;  3G6J B;  5DAX A;  4MGQ A;  1G9A A;  1POV 1;  5DG2 A;  3LQC A;  5H9Q A;  4YVS A;  3LFI A;  2ZEY A;  4XAE A;  1P8J A;  1FAY A;  4K20 A;  3N7M A;  4LO5 B;  3HQX A;  2NN8 A;  1XQN A;  1CZV A;  3K4D A;  3LSD A;  1W6O B;  3KV9 A;  1IG3 A;  2PHT A;  2QVS B;  1PNG A;  2R30 A;  1IS5 A;  1VBE 1;  2MPF A;  4OHX A;  4DPN A;  1IQA A;  2QDN A;  3DEM A;  1IS3 A;  2DTW A;  3O1P A;  1E57 A;  3VHP A;  1F5F A;  3FN9 A;  2VE1 A;  1O3T A;  3H8U A;  4JVA A;  1SBF A;  1W05 A;  4E8D A;  4X8P A;  1W28 A;  4DQA A;  4XJA A;  4XDO A;  1NG0 A;  1QXR A;  5FYT A;  1LEN A;  4ZZ5 A;  5FOB B;  1HDK A;  1U5X A;  5FZG A;  1AR6 2;  2PAK A;  4DOU A;  3AL6 A;  4XF0 A;  3S5Q A;  4BK4 A;  1PGS A;  4XFA A;  1F2N A;  2YHJ A;  1X82 A;  1GQG A;  4CDU A;  1SBE A;  2YBS A;  3DPR B;  3MZH A;  1YC6 1;  4UFK A;  2JG9 A;  2RHP A;  2RS5 1;  4WVW A;  4CUA A;  3UL2 A;  3AKS A;  5LAS A;  2QE3 A;  3CZU A;  4DNY A;  1Q3E A;  3GJA A;  2WNE A;  5JIA A;  2VJX A;  1JI6 A;  1GP6 A;  3SCF A;  2TBV A;  4BA6 A;  1JOB A;  1LHW A;  4AVV A;  3PUQ A;  4IEV A;  4Y1X A;  1BKZ A;  1EAH 3;  4NHX A;  4LIU A;  5C7G A;  2YMZ A;  1I5P A;  2YU1 A;  3MV1 1;  4JGZ A;  4QM9 A;  4NOT A;  1W2O A;  4KG8 A;  3ALQ A;  1NA1 C;  3VN4 A;  1HB1 A;  4KWL A;  4LOR A;  4QXB A;  2WQZ C;  3ZXF A;  3RDI A;  3B94 A;  4E2Q A;  2V5Y A;  3PUS A;  4CTE A;  1UY2 A;  3VL8 A;  4YSF A;  2FD8 A;  4FTB A;  4QPI C;  1UZ0 A;  3RI9 A;  4D69 A;  1AR7 1;  5A3W A;  2FZ1 A;  1H6Y A;  3LPF A;  1OD3 A;  2VZ3 A;  1QOT A;  1UY1 A;  3O0X A;  3OUH A;  1RTV A;  4OI4 A;  1PX3 A;  3AK0 A;  3OB8 A;  1NYW A;  5FXW A;  3KV5 A;  1RUF 2;  2JX9 A;  1US3 A;  4MLO A;  4R9C A;  3NNL A;  4Q4V 3;  4XDQ A;  3ZKU A;  1LOF A;  5BNP B;  1COV 1;  4S2G A;  4Q4X 2;  3NL1 A;  4P5H A;  4Y4Y A;  5DZF A;  1CX4 A;  1HRV 1;  1F31 A;  2ZHM A;  2ZKL A;  4BMB A;  1ZRF A;  1U0A A;  2OA2 A;  2CY6 A;  4DO0 A;  2WFF 2;  2BQP A;  3U11 A;  1CGP A;  1F5J A;  4PIZ A;  5BXX A;  5I0S A;  2E7Q A;  2VBD A;  3Q8B A;  5ACA 2;  1W9F A;  3MID A;  5K9Y A;  2ETE A;  4NPR A;  3ZXA C;  4CCC A;  3BOW A;  4FXG B;  4EN9 B;  1VBA 2;  3EXU A;  2QQL A;  3C8X A;  3K4Z A;  3AP5 A;  4OUE A;  5FZ3 A;  1WCS A;  4EWE A;  2VNV A;  4HLT A;  1LKN A;  3PJQ A;  1PIV 1;  1OOP C;  4S2H A;  2VVF A;  5GLT A;  4M00 A;  3VZK A;  4XFC A;  3MEP A;  4CP9 A;  1DGL A;  2WFP A;  5B4N A;  2BBA A;  2C1F A;  5HCA A;  4N43 C;  3D82 A;  5FIX A;  3CHX A;  4WVM B;  5DDJ 3;  1E5I A;  1AXZ A;  3X29 B;  4LBK A;  2KM2 A;  3WLU A;  1M4W A;  3VBU B;  4AI3 A;  4R9B A;  5FZD A;  3SCH A;  4AHX A;  4JTO A;  1WD4 A;  4Z92 B;  2XML A;  1O91 A;  3B9C A;  2EAA A;  4OUL A;  1QQP 1;  3J8F 3;  4QT6 A;  1AR8 3;  1NXM A;  5A3M A;  2GNM A;  3NW4 A;  1EV1 3;  1WGP A;  4GAZ A;  4YM2 A;  2D3S A;  4E4D X;  5KXC A;  5T50 A;  3WT3 A;  5IT6 A;  3ZFE A;  1ODM A;  1MEC 3;  1R09 2;  4GWM A;  4IEW A;  3CNA A;  3H7Y A;  3W59 A;  1ULF A;  4Y24 A;  1UAI A;  1QJY 1;  1TEI A;  3MIH A;  1QMJ A;  3KB5 A;  4FPH A;  4L99 A;  5A3L A;  3TAY A;  4KBB A;  3WNL A;  4EJR A;  4Y22 A;  4LUM A;  2SBA A;  1O4Y A;  1POV 3;  4HKW A;  4UXA A;  1I6X A;  2CDP A;  2VY0 A;  4LBL A;  2CGO A;  3KQR A;  5JZG C;  5JOY A;  3EO6 A;  4BLI A;  1J58 A;  1JTZ X;  1LEM A;  4QXK A;  4BXS V;  4RS5 C;  1X36 A;  2DBN A;  1LGB A;  4XVH A;  3LF7 A;  5FZA A;  1SAC A;  1VBE 3;  2CWM A;  4IL7 A;  4FOY A;  4YYO A;  3KHC A;  2Z4F A;  2WNU A;  4XBL A;  4ARY A;  1UOJ A;  2Q1F A;  5FXV A;  5FPA A;  4IQP A;  3UJQ A;  1ENQ A;  1PK6 A;  1VBB 2;  4ZU4 A;  3WNO A;  4GKY A;  2WZE A;  3WQ7 A;  4AVB A;  2W1U A;  3ES4 A;  2Y8K A;  2XKO A;  3ZR6 A;  1U5I A;  4IEU A;  4XMI A;  1S0G A;  3EHK A;  4UFM A;  5JI9 A;  1MS0 A;  2ZAC A;  3QAC A;  5LK5 A;  2UWB A;  1O5L A;  4YVW C;  4I2O A;  1HRI 1;  1OVP A;  1J3Q A;  3QLQ A;  2A1X A;  2RS5 3;  3AKP A;  1FI2 A;  2JDZ A;  2RS3 3;  2WAO A;  3MGU A;  5H9S A;  1W8O A;  1YI7 A;  3WG2 A;  4LKE A;  5FTT C;  3AYE A;  2A75 A;  3LCP A;  2Z69 A;  4QXC A;  3ZPO A;  5BNQ A;  4CDQ B;  3OTF A;  1XYN A;  2RS1 2;  1JZ5 A;  4NRQ A;  1RGS A;  4RQP B;  1W6N B;  4DIN B;  1R08 1;  1EAH 2;  2DF7 A;  1Q5O A;  4FP2 A;  4P02 B;  2AEN A;  3NAP C;  2VUJ A;  2VCA A;  5F37 A;  5BNP C;  1ASJ 2;  2QNK A;  4YPJ A;  2PYT A;  2PHL A;  4BYY A;  4AHW A;  1HXS 2;  1BMV 1;  1Q8S A;  3PJY A;  5FZ9 A;  4IEX A;  1HQN A;  3PTY A;  1FT9 A;  1RMU 3;  1FMD 2;  2WN2 A;  4CDW A;  2FDH A;  2VC9 A;  2B7Y A;  4FFH A;  3UYJ A;  2WBK A;  3OGG A;  5K0U B;  4BIO A;  4V2V A;  2ZGR A;  2ZGT A;  4XUO A;  3FFZ A;  5CIR A;  2YG0 A;  2IXJ A;  3MYX A;  3P5B A;  4IEQ A;  4BME A;  3H9A A;  1AR7 3;  2R07 1;  4Q26 A;  2D6O X;  3O12 A;  3PUA A;  4LBM A;  5F3C A;  2VO5 A;  1W39 A;  4YG6 A;  5IUQ A;  1FV2 A;  3KVB A;  1GWL A;  1UY3 A;  2XLG A;  2VQA A;  4YG0 A;  1U12 A;  2FBE A;  3J7N A;  4NRP A;  1H4H A;  3OBA A;  5FZ1 A;  3WG4 A;  1O4Z A;  2W0X A;  4Y1V A;  5DG1 A;  4L0P A;  1COV 3;  1PO2 1;  1UCX A;  3WP3 A;  3OUI A;  2JG8 A;  1Q8P A;  4MHU A;  1HRV 3;  2C5D A;  4LBN A;  5BPX A;  3VZL A;  2ZAB A;  3K3N A;  4XMA A;  2VZQ A;  2EXI A;  1DQ4 A;  3C7O A;  3I4I A;  4OZX A;  3LEM A;  3M8L A;  1SBD A;  5LBB A;  2K9Z A;  4XUR A;  1D2S A;  4BQW A;  3O0V A;  4M01 A;  4LO8 A;  1UX6 A;  4YW7 A;  3ACI A;  1FXZ A;  5KHJ A;  2CU5 A;  1YFU A;  5DUX A;  1BBT 1;  1SDW A;  2ES3 A;  2XDV A;  4ZPI A;  3B01 A;  4LOT A;  1TNF A;  3W21 A;  1I5Z A;  2HWC 2;  3EYP A;  1OPO A;  1LRH A;  2AGS A;  2E7A A;  1YFY A;  3Q8C A;  4UFI A;  2YV8 A;  4G4F A;  4O61 A;  4NRO A;  1TME 3;  5KHK A;  1UIJ A;  5IVF A;  1GUI A;  3E5U A;  3WNM A;  1PIV 3;  1QXJ A;  4F8A A;  2C9A A;  2PHR A;  4Y1U A;  4E8C A;  3H0O A;  3KMH A;  5EWS A;  2PHW A;  4SBV A;  5FYZ A;  3AVR A;  3VBF A;  4LR4 A;  4BB3 A;  4HPK A;  2ADE A;  1JW6 A;  3D0S A;  3LDK A;  2PHU A;  3ZR5 A;  2WNV C;  3URF A;  1W8T A;  2MEV 1;  4XBN A;  1QJX 3;  4W50 A;  1WLC A;  2E32 A;  2CTV A;  5AC9 1;  5FP7 A;  4HSJ A;  3VKL A;  2WWS A;  2HWF 2;  1EV1 2;  4RFR B;  4IGP A;  3ROU A;  4QPW A;  3R0R A;  4UOJ A;  5A33 A;  1QOO A;  3CL1 A;  4PIY A;  3I2O A;  3HD8 B;  3MIG A;  5CAD A;  3RNS A;  4CP1 A;  4E4S A;  4AVA A;  3BUC A;  2P37 A;  3HR9 A;  5FZO B;  1OLQ A;  3BKZ A;  3LEK A;  1LED A;  2A71 A;  2VQT A;  1V00 A;  4N53 A;  1UWW A;  4M3C E;  4Y5T A;  1QJY 3;  4L92 A;  4G3Y C;  3P3N A;  4XEZ A;  5CAZ A;  2JDH A;  1YLL A;  1H0B A;  3I2K A;  5BYN A;  1AR9 1;  5BNO C;  1D0G A;  3JZV A;  4RL7 A;  4XQ4 A;  3MO4 A;  3KT4 A;  1ND3 A;  4YW4 A;  4JRA A;  5I8S A;  3WG3 A;  5AVA A;  1MVE A;  1RUH 1;  4CP9 B;  4AGR A;  1NXD 1;  1DF0 A;  4P9G A;  4LLO A;  4MV2 A;  3ZSJ A;  4EN0 A;  4YVS C;  3CO2 A;  2IXL A;  4H2A A;  1RUC 2;  2W46 A;  4TN7 A;  5E89 A;  3UGH A;  1OA4 A;  1SFY A;  2PEL A;  1QGL A;  4QHB A;  5D2A A;  5DUV A;  3IDB B;  4MVT A;  4WVZ A;  4CXY A;  1LHO A;  1RUG 1;  5D8A A;  3OGJ A;  4U36 A;  4IER A;  3T30 A;  4BPZ A;  4Q1R A;  5GLW A;  4FPF A;  4P9W A;  3AYA A;  3UGF A;  5DPN A;  1QF3 A;  1YRZ A;  2RS3 2;  3PHM A;  4NHM A;  1VMJ A;  1NLQ A;  4XAB A;  4XQW A;  5A1F A;  1HRI 3;  2WC2 A;  1CIW A;  5LBC A;  4X6Q B;  1XND A;  3LA3 A;  2VM9 A;  4HK8 A;  1DIW A;  5T55 A;  4A7K A;  4NJ4 A;  5HCH A;  4CPB D;  1KXG A;  4XFH A;  3FHQ A;  4CDU C;  5ABJ A;  2OUH A;  4TLG A;  2ZZJ A;  2BNO A;  1YQ5 A;  4LUL A;  2JG9 C;  3GAL A;  2XBO 2;  3UJO A;  1V70 A;  4P9Y A;  3ZYH A;  3FLP A;  4BDV B;  3LOI A;  3PMS A;  3I97 A;  5FBZ A;  3UK9 A;  1MZ5 A;  5C4W A;  3TRS B;  4HT1 T;  4TZD A;  1RMU 2;  1DGR A;  2FCT A;  2ATF A;  5HCB A;  1EPW A;  5I0D A;  4H7M A;  3DL3 A;  4ZZ8 A;  1H9W A;  1ZA4 A;  4AED B;  5FKC A;  5K7P A;  1PMI A;  1Z7S 1;  1I3H A;  2XON A;  3R6S A;  5HPO A;  1ODN A;  2D6K A;  4JGZ C;  2E63 A;  1E5H A;  3JQW A;  5T5O A;  1Q8Q A;  5J09 A;  3RZJ A;  1CIY A;  2DYC A;  3IDA A;  1PK6 B;  5FP3 A;  3JD7 2;  2VZU A;  5B2G B;  2R07 3;  2SLI A;  4L9B A;  1YJK A;  2DCJ A;  1V9U 2;  3GM8 A;  1SFP A;  5FCC A;  4KMQ A;  2OKX A;  2MNG A;  1K12 A;  2OXB A;  4JAA A;  1RXG A;  2NPI A;  3Q8A A;  5H9R A;  3FJS A;  1HRV 2;  2D40 A;  2XUE A;  1UZV A;  4LUK A;  1PO2 3;  3BB6 A;  1XC6 A;  2QJV A;  2V4A A;  4I02 A;  3BTZ A;  3IAQ A;  5B4X A;  4NPL A;  1YJL A;  2VZ1 A;  4QGM A;  4QDS A;  3MF9 A;  5JDB A;  1WW7 A;  1HKD A;  3U0Z A;  4NMI A;  1LOF C;  2HBT A;  4Q0V A;  4GIQ A;  3ZXD A;  3B93 A;  4CCM A;  4A42 A;  4TSV A;  4MH0 E;  2E26 A;  5C8C A;  1NKG A;  3N9L A;  3UV9 A;  2D5F A;  3CF6 E;  3RJR A;  3IBM A;  4UW6 A;  1YIF A;  1YEW A;  1NX9 A;  1PGW 2;  1BBT 3;  1W8H A;  2Y33 A;  3T2O A;  3RJ2 X;  2D3P A;  4OHW A;  3GZU C;  5CIS A;  4HG6 B;  1H8V A;  2CDO A;  1V6K A;  2BER A;  1WBF A;  1JYC A;  1FOD 2;  1TME 2;  2BWA A;  2R0H A;  4DB5 A;  3AYC A;  3POS A;  1R1A 1;  2QQO A;  3BN6 A;  1OLR A;  1UIK A;  1PZ9 A;  5ERL A;  1OI6 A;  1CES A;  4YW3 A;  4MGS A;  4LHS A;  2HEV F;  3RWK X;  5C3P A;  2RMU 3;  4SLI A;  5FAX A;  3TOJ A;  3ZFG B;  2VZS A;  3BTY A;  1OUS A;  1HQL A;  1X50 A;  2VL4 A;  3LAG A;  4PLO A;  3PVB B;  1QJX 2;  5E8A A;  4C1W A;  1UW8 A;  1QNW A;  2MEV 3;  4UYB A;  2VW1 A;  5FZH A;  1AJO A;  2R49 A;  4HKL A;  3U14 A;  3PTR B;  2AEY A;  3GDB A;  3ZMO A;  4JKK A;  2BYV E;  3VHR A;  5AC9 3;  4YFZ A;  2FZ2 A;  4NRM A;  5FY7 A;  1PMJ X;  2XJT A;  3Q8F A;  4W6W A;  4LO6 B;  1OA2 A;  3ZKY A;  4HET A;  2YU2 A;  5A80 A;  1CAU A;  1OD5 A;  2WLQ A;  4XW3 A;  1QHD A;  4CCN A;  1MQT A;  5FMC A;  4K1Y A;  3VDD B;  5J7M A;  4OI0 A;  1W9W A;  4LIV A;  5FFO C;  1SLI A;  2WAA A;  2VOV A;  3WHT A;  2B42 B;  5J48 A;  3O1U A;  2WA4 A;  3RVH A;  2RDQ A;  4URA A;  3N9Q A;  3ZFE C;  3MW2 A;  1MR5 A;  4M3C A;  2NP0 A;  1AR9 3;  1ZRI A;  4WM7 A;  1STM A;  2DCZ A;  4XFI A;  4NIG A;  3U10 A;  3CIH A;  2DDU A;  2EAL A;  2VW2 A;  1U5Z A;  4QPY A;  5FY0 A;  5FZK A;  3RYK A;  4TTG A;  3BCW A;  5FYV A;  2WRA A;  1RUH 3;  4HL0 A;  4RN5 A;  2BDR A;  4XDP A;  2WA3 A;  2KXL A;  4O9E A;  3V64 A;  4FOW A;  2NMN A;  1C5H A;  2GP3 A;  2VOW A;  4HPK B;  3VBF B;  5LCW L;  4KGG A;  1VB2 A;  2YC0 A;  2ZAA A;  5T5P A;  3WCS A;  1BJQ A;  3N3H A;  5I8Y A;  5C33 A;  3VKN A;  1RUG 3;  2V73 A;  1JYV A;  2XWJ B;  4IV1 A;  2Y6F A;  2FDJ A;  3H1M A;  1VRH 1;  1JBC A;  2WNU C;  4ISQ A;  1LOA A;  2VMF A;  1C57 A;  1PK6 C;  1RHI 1;  4D3W A;  5LW9 A;  2CAU A;  4QX5 A;  2P6C A;  5DN2 A;  3BU0 A;  4OHV A;  3HEI A;  3EJK A;  1W6Q B;  2VVE A;  2ZEZ A;  3ETQ A;  1NE6 A;  1QJU 1;  2AZ5 A;  4BE3 A;  3OD4 A;  1GOH A;  3T1L A;  2XHN A;  3T4H B;  2Q5T A;  2D44 A;  2Y6K A;  1RUD 2;  1JS9 A;  4CEY A;  5EPA A;  3IPV B;  3SLI A;  1XNC A;  1Y43 B;  3OJB A;  3E6C C;  1WLT A;  1XYP A;  2C0Z A;  3AZW A;  4AF9 A;  4Q29 A;  4YZ2 A;  1VAL A;  3IAP A;  3RPQ A;  1Z7S 3;  4Y20 B;  4U2A A;  1DZT A;  1POQ A;  2HJI A;  1YO8 A;  5ANQ A;  1MS9 A;  3MLL A;  4W6X A;  3POG A;  4FFG A;  4JTN A;  4CDW C;  1I1E A;  1FV3 A;  4AAX A;  4MHR A;  4N90 A;  3K46 A;  1YQ6 A;  1OLM A;  3MPB A;  2GC1 A;  4HN1 A;  5JI7 A;  4HFS A;  5CKQ A;  3KGZ A;  2WN3 A;  2G4I A;  4J1W A;  1K5J A;  4KQ7 A;  4QQ2 A;  2DU1 A;  5LBE A;  2VCC A;  4P9I A;  2P3K A;  1VAK A;  5T5J A;  2VMC A;  1Y9G A;  3T4V A;  3TN9 2;  5IVY A;  1UNB A;  3LKJ A;  4GUL A;  3HOB A;  1U5Y A;  2WQ8 A;  4CXX A;  2UY8 A;  3OBZ A;  5IVE A;  5IAT A;  1UX7 A;  3A7Q A;  5F32 A;  3AMM A;  5FY5 A;  1S2B A;  1SMV A;  1VR3 A;  2PN5 A;  5A3O A;  5ABJ B;  4OMC A;  5A7N A;  3KCY A;  5LK7 B;  3C7E A;  4JGY A;  2Z79 A;  3OF1 A;  4PQQ A;  4EZ4 A;  2GME A;  2JDK A;  4QB6 A;  2JG8 C;  2GAL A;  4R9A A;  2ZJC A;  4BXF A;  2QZ2 A;  1UMH A;  5C5T A;  4KWK A;  5L9R A;  3WG1 A;  1HV0 A;  1BLZ A;  2E9Q A;  2EAK A;  1D4M 1;  2OQ6 A;  5C8W A;  1NA1 B;  1WD3 A;  2WYF A;  3VBO A;  3SCG A;  1AZD A;  2ZMK A;  1JYT A;  3LFM A;  4PBP A;  2ZEW A;  1LOE A;  5KHG A;  3CJI A;  4Y1Z A;  1R1A 3;  4FTS A;  3A23 A;  4QPI B;  2R0F A;  4Y26 A;  3H8O A;  2RMU 2;  3WR0 A;  1NCQ A;  2LM3 A;  5I0U A;  3ATG A;  2NM1 A;  5ANN A;  2EIC A;  2A7A A;  3T2T A;  4P14 A;  2ZX1 A;  3POI A;  3O14 A;  3PLQ A;  5CB7 A;  3K4A A;  4AEK A;  1Y4W A;  1CAX A;  2RM2 3;  3FC0 A;  2P34 A;  5FZM A;  1LOB A;  1DBN A;  2NYY A;  2IXK A;  1D4V B;  4R4X A;  4S2F A;  3PUH A;  5CNA A;  5A7W A;  4HZF A;  3H3L A;  3BAL A;  4XZU G;  1Y9M A;  1OKO A;  3OPT A;  4LKF A;  4RD7 A;  5KR7 A;  3VBF C;  3IDE A;  5A32 B;  5C9A A;  2Z5W A;  1XPW A;  3KCC A;  5EQU A;  3O1V A;  1W2U A;  2VH9 A;  2ZX0 A;  3K48 A;  2OVU A;  5LAT A;  1EP0 A;  4ERO A;  2J1U A;  3FBM A;  1LEC A;  2YRO A;  2JDU A;  4QU1 A;  4CCK A;  1A8M A;  4OHZ A;  2RJ2 A;  3NJZ A;  3TYJ A;  3WOG A;  1RC6 A;  4PLN A;  5C8C B;  3KD4 A;  4JX0 A;  4WV8 A;  3AKR A;  3VD4 A;  5AVP A;  4OQ9 A;  3HMY A;  2X05 A;  1FPN 1;  3BYW A;  1WZX A;  2VU9 A;  4MAD A;  3CBN A;  4XIL A;  3ZSM A;  5IHR A;  5F5C A;  2ZPX A;  1W8U A;  1B09 A;  3J7H A;  4N53 C;  5JMC A;  2EIE A;  1W6M A;  1RUH 2;  1OOP B;  2Y6G A;  1XOY A;  5FZF A;  1UOG A;  1ZM1 A;  1LHV A;  1ZBA 1;  4CA9 A;  1IKP A;  1XU1 A;  1CZS A;  4PHZ A;  1MAC A;  5FKB A;  3KCX A;  3KM5 A;  4IV3 A;  1W06 A;  2A5Z A;  4N43 B;  2QQK A;  1C1L A;  1KGY A;  2YUE A;  1GAN A;  1NLR A;  4IE6 A;  5FY4 A;  4I30 A;  4ASL A;  4ES8 A;  5BV6 A;  1ND3 C;  2B39 A;  3RZK A;  2AC1 A;  2GU9 A;  2A6Y A;  5GZG A;  2LTN A;  4P08 A;  4QB2 A;  2XGX A;  1HN1 A;  4BQ5 A;  2YPJ A;  4M0N A;  4PLM A;  5JXH A;  3PU3 A;  3R05 A;  2J22 A;  1CR7 A;  2X53 S;  1CQ9 A;  3BIW E;  3INA A;  2R1D A;  2XOM A;  1VRH 3;  2VMH A;  2XQX A;  2JEM A;  1NAE A;  1RHI 3;  1PVC 1;  2J7M A;  3S57 A;  2VZP A;  5D8A C;  2RDS A;  1SQ4 A;  1XNB A;  3ZVX A;  2AUY A;  2WSU A;  2BU9 A;  4FI9 A;  2PHD A;  2ZAH A;  1RUJ 1;  3AP6 A;  5F5I A;  1JZ7 A;  2OZ6 A;  5IFP A;  4YZ4 A;  3ES1 A;  1FYU A;  1XJA A;  4CU7 A;  2AEZ A;  2Q30 A;  2R04 1;  1DLC A;  2VAU A;  2VTX A;  1XYO A;  2W91 A;  3WDW A;  2J1V A;  4YGD A;  4DY5 A;  2WT1 A;  3VBH A;  2GNT A;  4W8J A;  1SHW B;  4MYE A;  4M3C B;  2PHF A;  1L7Q A;  1SEF A;  5JZG B;  3KV4 A;  5ABJ C;  2O8Q A;  4A4A A;  3TB0 A;  2JJ6 A;  5KC5 A;  4PJY A;  4RS5 B;  1HLC A;  1Z7S 2;  5FPB A;  4EN7 B;  3S7E A;  2B5H A;  3DXU A;  3LOB A;  5FQ0 B;  2WII B;  1QH6 A;  5C4W C;  1CX1 A;  1BK0 A;  2GSY A;  3UET A;  4GH4 A;  3S30 A;  3F95 A;  4Q4W 1;  4TLF A;  3BTA A;  1KDK A;  1S1A A;  1GP5 A;  3WQ0 A;  4AFC A;  2C4X A;  4RHV 1;  1N3Q A;  4MGI E;  3VDA A;  1S0C A;  2WT2 A;  5F9T A;  1RUO A;  5F2S A;  1S2E A;  3NMB A;  5IJR A;  3ACG A;  3VKF C;  4YVW B;  2JKB A;  1DYK A;  2H6C A;  3GZA A;  2WZR 2;  2XUM A;  4EE2 A;  4EWD A;  4Q0Q A;  3ILR A;  1EPZ A;  2OPK A;  5FJH A;  2QQP A;  1BK1 A;  4Q4Y 2;  4NVP A;  3USU A;  1VBD 1;  1SCS A;  1XU2 A;  3KQ4 B;  2AR6 A;  4MXV A;  3MDP A;  1C28 A;  3AZV A;  3J7M A;  5F2W A;  3NAP B;  4LBQ B;  1UXZ A;  2IVJ A;  5FPV A;  4I3P A;  1W8W A;  3MW4 A;  1TMF 2;  4HON A;  1RUE 1;  1AYM 1;  3AZX A;  2YC4 A;  1GIC A;  2EID A;  5GZE A;  2Z2S B;  4CEY B;  4AAP A;  1KJR A;  1SZB A;  3QBQ A;  5GLU A;  2G1M A;  2IC1 A;  2JDP A;  4XUN A;  1G6N A;  1D4M 3;  2P2K A;  1KS4 A;  3DUI A;  3GHN A;  1X33 A;  3S0M A;  3RG0 A;  5C8C C;  3WEZ A;  4GQ7 A;  4AEM A;  1S0F A;  1AX0 A;  3NJY A;  5FZB A;  3DYP A;  1NY7 2;  4HAN A;  5FZC A;  4BQ3 A;  1W3X A;  4FPL A;  4HXC A;  3T0D A;  2VGD A;  4D6R A;  4AVS A;  2RM2 2;  2HBU A;  4IET A;  3DV8 A;  4CCJ A;  2DUR A;  3I59 A;  3IB3 A;  4AW7 A;  2IVI B;  5FYY A;  4ZY9 A;  1DYO A;  1LNS A;  1PHM A;  1YYN A;  3VBS A;  1RB8 G;  4OQ8 A;  2F4L A;  1W0O A;  4N9H A;  1W8Z A;  5A3N A;  4COV A;  1XRU A;  5BUV A;  2WZP P;  3ZSE A;  3O5S A;  1Z0H A;  1NQJ A;  4JZR A;  2Q8E A;  1AYN 1;  4XFG A;  3VZO A;  5CG8 A;  4K8R B;  5L9B A;  5FO9 B;  3PU8 A;  1XNK A;  3T0A A;  3P3P A;  3S7I A;  3SIS A;  1QJZ A;  4JGY B;  2Y0I A;  2G9G A;  1ZNP A;  1W2T A;  3WV6 A;  1KEX A;  3RFR A;  1NCR A;  5JR2 A;  2YBK A;  1TQ5 A;  2JE9 A;  2WS9 1;  2ZBJ A;  1GWM A;  3ZYG A;  1NLS A;  5DMY A;  4A7Z A;  1NE4 A;  1FPN 3;  1YQ8 A;  3VBO B;  4GB3 2;  1MQT C;  2YXS A;  2JWP A;  2VR4 A;  2RR1 1;  2B9U A;  2BEO A;  1PO1 1;  2GMM A;  1VRB A;  2XLF A;  1HJG A;  1QIQ A;  3CJI B;  3P6B A;  3Q9O A;  4QX0 A;  1S2K A;  1W03 A;  4URT A;  4XJU A;  2X09 A;  2XKP A;  4MG2 A;  3I49 A;  1KJL A;  1NCQ B;  1PVX A;  1JUI A;  1ZBA 3;  4E2G A;  4I0W B;  5FR3 A;  1PMH X;  1JHJ A;  2BUK A;  3AMH A;  4WM7 C;  1O8P A;  5FRA A;  3AP4 A;  4JKL A;  4XPV A;  2Z42 A;  2CAV A;  5C3R A;  2WNV B;  4UF0 A;  2JE7 A;  2CL2 A;  1QY4 A;  2ZKN A;  5DAP A;  5A3U A;  3LWC A;  4OYU A;  1VRH 2;  4KBZ A;  2P6H A;  4ITC A;  3NWK A;  5L9V A;  4DRV A;  1W3V A;  2G19 A;  3O1S A;  4LO4 B;  2D3R A;  4GWI A;  3SMH A;  1ZBE 1;  1VP6 A;  2D6M A;  4QDQ A;  5LA1 A;  4IXL A;  1PVC 3;  5JAX A;  2IFW A;  2GND A;  3IDC B;  1JOJ A;  3POJ A;  4OUM A;  4IV1 C;  3DKQ A;  4HOO A;  1RUJ 3;  2D93 A;  4XET A;  5EHD A;  4AQ6 A;  4ISR A;  4NIH A;  5IYY A;  4CUG A;  3NQH A;  1YIP A;  4S2D A;  4O65 A;  3AVS A;  2R04 3;  4ET7 A;  1HJF A;  4Y5Z 0;  3SC7 X;  1BEV 1;  3WX5 A;  4BK5 A;  2PFW A;  5BNO B;  1H4G A;  1QNY A;  1SLT A;  1CD3 G;  4MUV A;  4Z82 A;  4FT8 A;  2WUH A;  2QBX A;  2W08 A;  1G9C A;  3GGL A;  1ND2 A;  5FYM A;  1KIT A;  1BZW A;  1OVS A;  1W6M B;  1O3S A;  1UYZ A;  5C71 A;  2FDI A;  2PLV 1;  3AKT A;  5FP4 A;  1WA6 X;  2NLR A;  3KS7 A;  1POV 0;  2WR9 A;  4IV3 B;  4YVS B;  4AI2 A;  3U75 A;  3USS A;  3VV1 A;  1FX5 A;  4I01 A;  1DQ0 A;  3MFA A;  3IZO A;  4FPK A;  4CEY C;  4UAP A;  2DCK A;  2C26 A;  3DEC A;  5CYY A;  3ECQ A;  3W9A A;  3FBY A;  4KI5 M;  5EFU A;  5FZ7 A;  1AL2 1;  1UYP A;  4Q4W 3;  4QD2 A;  4Y3O A;  4XF1 A;  2ZGM A;  3JB4 C;  4FQZ A;  1AX1 A;  1OXC A;  2YB7 A;  4UT5 A;  1J1T A;  2P3Y A;  1QEX A;  1XXN A;  3I7D A;  3O7O A;  3OGR A;  2VZO A;  4E27 A;  4AI8 A;  1VBD 3;  3LEI A;  4Q4V 2;  1K42 A;  4CDU B;  4NHL A;  1GQP A;  2GMP A;  2JG9 B;  3NNF A;  3FLT A;  3PL0 A;  2XHK A;  1SPP A;  2ARB A;  4UI9 L;  3FE5 A;  4IW3 A;  2HWD 1;  2DCY A;  1S0B A;  4KU7 A;  4W4Z A;  5HV4 A;  2FCV A;  2ZEX A;  4QKD A;  4WZC A;  4XTM A;  1RUE 3;  5FK7 A;  4B1L A;  2Q4S A;  1WCU A;  3RZH A;  1TVG A;  1H9P A;  3RS6 A;  3FFQ A;  3M70 A;  1EY2 A;  2V5D A;  3O0W A;  2XJR A;  3PUI A;  4NWW A;  4JGY C;  4NHY A;  4JGZ B;  2RVA A;  1PNF A;  3DYO A;  1XBF A;  3E6D A;  5HV0 A;  1BYH A;  4CDX A;  2XH6 A;  4GH4 B;  1X8E A;  4JC1 A;  4NIA A;  1MPX A;  3LIH A;  4PQ9 A;  2QCS B;  3RYR A;  1C8M 1;  2CNA A;  4CCL A;  5AFE A;  5LEK A;  1O6U A;  2R06 1;  2ILM A;  3VBO C;  5DAV A;  4C91 A;  3O1R A;  4LKS A;  2Y6J A;  2BOI A;  2W47 A;  3SH3 A;  2DVB A;  5FY8 A;  3CJI C;  1QJF A;  1ACC A;  5D21 A;  2QKD A;  1E5R A;  3J4U H;  3BOD A;  4XCA A;  5JWP A;  1NCQ C;  3JB8 A;  3Q8E A;  5C5U A;  5HXV A;  1CZT A;  4MSV A;  1C4R A;  2FCU A;  3AKQ A;  5DDJ 2;  4Z07 A;  2Q8O A;  3VD3 A;  4FPC A;  4XF3 A;  1XE7 A;  4BJ0 A;  3PDQ A;  1R64 A;  1JXN A;  1VBC 1;  1AYN 3;  4Q1P A;  5KHI A;  4K40 A;  3N36 A;  2WWU A;  4LPL A;  5CA6 A;  2B9V A;  3I3D A;  4XQD A;  3RSJ A;  5F3E A;  4CRQ A;  1IS6 A;  3DN7 A;  4Y5S A;  2VTF A;  4AGV A;  3J8F 2;  4DEQ A;  1I9R A;  3NNJ A;  1AR8 2;  2A3Y A;  4P9J A;  5A6Y A;  5A3P A;  2BNM A;  1AXY A;  5BY5 A;  2WAB A;  5C9A C;  2FQP A;  1QQP 3;  1RVF 1;  1ZX5 A;  2RJK A;  1GSL A;  3LA2 A;  1HB2 A;  4Y4R A;  1MEC 2;  2WS9 3;  2HWB 1;  4FPE A;  3AYD A;  1A3K A;  2DVF A;  3UGG A;  2F4P A;  3ZO0 B;  2RR1 3;  3LIG A;  1HIX A;  3UKN A;  4CEW A;  1SFN A;  1ULC A;  1PO1 3;  1NUK A;  3BU7 A;  3OCP A;  3LSE A;  4M3C F;  4AYU A;  2OQ7 A;  4I3G A;  1GZW A;  1BXH A;  1VAV A;  4QPG A;  1MVQ A;  4JHZ A;  1W99 A;  3RWN A;  1OBN A;  2VG9 A;  3OY8 A;  3RGB A;  3AZY A;  1N3O A;  1OFS A;  3PME A;  2WIN B;  5IK8 A;  1WMD A;  2Y64 A;  3LDB A;  2JB4 A;  3BIE A;  3VBS B;  4CSW A;  2WWJ A;  4Q0S A;  4GMP 0;  1VBE 2;  4IV3 C;  4QKB A;  2BVB A;  4GXL A;  1W04 A;  4IEP A;  4NUB A;  1SLB A;  4UFJ A;  3SEP A;  3IWZ A;  1IZ3 A;  2H0V A;  3HNB M;  1QXP A;  2C24 A;  3WNX A;  4QGN A;  1JHN A;  4QX1 A;  1ZBE 3;  3WDU A;  1XSQ A;  1DDL A;  1IQD C;  2JEC A;  2VOK A;  3HPN A;  3JU9 A;  4QDR A;  3VHO A;  5C3S A;  5IK4 A;  3IIA A;  4LBQ D;  2FHR A;  1L7R A;  2R04 2;  2RS5 2;  3H50 A;  5CFD A;  4C90 A;  1W2N A;  3NJV A;  1OH3 A;  1X9T A;  1BEV 3;  4E9K A;  1X9P A;  2GC3 A;  2VZT A;  5FYH A;  3ZFE B;  1JH5 A;  1GU3 A;  3OSD A;  2PMW B;  4JHT A;  2E6V A;  4XHX A;  3VBR A;  3WQB A;  1ULE A;  1QU0 A;  3LD8 A;  5F5A A;  4V1P A;  4MGK E;  3VZM A;  5SV5 A;  4XAC A;  1GNZ A;  3KSC A;  5EV7 A;  3WP4 A;  2YZ4 A;  1R08 3;  1B35 A;  3N7J A;  4KU8 A;  4OFG A;  4AG4 A;  4Y22 B;  2A3X A;  2PLV 3;  2WO7 A;  5FV3 A;  3VBH C;  5FWE A;  1XE0 A;  3BVC A;  5C3O A;  5IAX A;  1OMI A;  2CV6 A;  2DCT A;  1JU4 A;  1ZRE A;  5E88 A;  4O7X A;  2P5B A;  1W8F A;  2WNO A;  3ETP A;  4H55 A;  4NII A;  1ZZ6 A;  2B8M A;  3AMN A;  1AL2 3;  5FYI A;  3ZYJ B;  1GV9 A;  4HVR A;  4B4P A;  4XIO A;  3S5A A;  3FUO A;  3MW3 A;  3GXU A;  4A7Y A;  1ZRD A;  2WNU B;  3M7A A;  1AR6 1;  1AR7 2;  3MIE A;  3OD0 A;  3WIN E;  2LAL A;  4K8F A;  1OLM E;  1WWY A;  4GH4 C;  3H8X A;  4EQV A;  1C3H A;  3BGA A;  4OI2 A;  1PZ8 A;  1UOB A;  4Q8L A;  5IK7 A;  5FY1 A;  3O1O A;  1XNT A;  4ZXE A;  4FPJ A;  1O3Q A;  3D3A A;  2IZW A;  4Q27 A;  4TXW A;  3NO8 A;  3C2U A;  1COV 2;  2ORZ A;  1UZZ A;  2E31 A;  1W2A X;  2VOX A;  2YGL A;  3ZPY A;  4B4R A;  1GQH A;  2XWB B;  1DCS A;  2LW8 A;  2HWD 3;  4FFI A;  1A34 A;  4RGG A;  5J1X A;  3NRU A;  4UBH A;  1H1I A;  4JQR A;  3WQ1 A;  1ND2 B;  1OH4 A;  3RMX A;  4IEO A;  3TNP B;  5K8S A;  2AYH A;  4AHZ A;  4BQY A;  4PF1 A;  2ZX2 A;  2FDF A;  1AL0 G;  3FLR A;  2JIJ A;  3GNE A;  3GCX A;  4EN6 B;  4DUV A;  3WUD A;  5I8T A;  4CDW B;  1AF9 A;  1H2N A;  5FMO S;  1C8M 3;  5L19 A;  4WM8 A;  2NZ9 A;  1MS8 A;  1PIV 2;  2QUO A;  3N9M A;  5KXB A;  1S0J A;  2WDB A;  2ZZQ A;  5CBL A;  2A6Z A;  3POB A;  4AFM A;  4OHY A;  1RUF 1;  4A3Z A;  4HSL A;  3AFK A;  4Q4X 1;  5EYX A;  1AYN 2;  4JQT A;  1BHG A;  1H1A A;  4GWN A;  4P9X A;  4KWU A;  4BCU A;  2YYO A;  1VBC 3;  5I0R A;  3VBS C;  2WO1 A;  2DBI A;  1CAV A;  1PM4 A;  2VUL A;  3G7D A;  2WFF 1;  4UWD A;  5LWB A;  1UKR A;  3BPS A;  3HIF A;  3D0J A;  3MLK A;  3QH6 A;  1QQP 2;  1V6L A;  2JG8 B;  5KHH A;  1RVF 3;  5ACA 1;  2QTW B;  3OYW A;  4YG3 A;  3VZN A;  4CVU A;  3TEW A;  1QJE A;  2QQI A;  2QQJ A;  2HWB 3;  1IOA A;  4IES A;  4GKX A;  2UU8 A;  2RR1 2;  1REE A;  1GOG A;  3GF6 A;  1VBA 1;  1QJY 2;  4LO7 A;  4TYS A;  5FK8 A;  3RZZ A;  3U07 A;  4AE2 A;  1GLH A;  4FOV A;  4YZ5 A;  3KVA A;  1NCR C;  2UYB A;  4CCE A;  1HN0 A;  1W6O A;  1UYY A;  2VXJ A;  1ZRC A;  4NWV A;  4XBQ A;  4L2N A;  4D7T A;  4LXL A;  4YFW A;  3TEY A;  1DZR A;  1WCD J;  3ZSL A;  1ALY A;  3KWV A;  4JKM A;  3ACH A;  2XR4 A;  1DQ2 A;  3PVE A;  1CWP A;  5FJK A;  3NVC A;  3SEE A;  4COW A;  3I8T A;  2Y38 A;  3VGI A;  4AEJ A;  3E5Q A;  2PHX A;  2ARE A;  2ORX A;  2XG3 A;  4AVT A;  1Y7B A;  2LRO A;  4FO9 A;  3WF4 A;  2C9K A;  2R6Q A;  4PF5 A;  3H8R A;  3DPR A;  4B7E A;  3KZ4 C;  4MX3 A;  4CUB A;  1YQ2 A;  3K77 A;  1WMF A;  2UWA A;  4C0B A;  4JRL A;  2ENR A;  4PBO A;  3AL5 A;  1WA4 A;  5FRE A;  1WMX A;  2EA7 A;  3IMN A;  5KWR A;  5J37 A;  1TZO A;  2F17 A;  1HRI 2;  4JDO A;  2VBP A;  5HI0 A;  4FAG A;  1BEV 2;  2J1R A;  3AXE A;  2H0B A;  3NV1 A;  4BQX A;  5A33 B;  2XL9 A;  4RR3 A;  4COY A;  4JDM A;  5AFB A;  4QMA A;  3HBK A;  3GBF A;  1WBL A;  4B4Q A;  1V6O A;  4N53 B;  5FUN A;  2HWE 1;  4CEW B;  2JE8 A;  1LOG A;  1R08 2;  1J59 A;  5KC6 A;  2PLV 2;  3KT1 A;  2D6N A;  2V72 A;  4NO4 A;  2Y6H A;  5A1A A;  2DUQ A;  2BV4 A;  3CU7 A;  4LK6 A;  1J84 A;  1BMV 2;  1OA3 A;  2RV9 A;  2YFZ A;  3A4U A;  1ND2 C;  1ND3 B;  1WUV A;  2XB6 C;  3FX3 A;  3ST7 A;  5A6Z A;  5IVJ A;  1TNR A;  2GH2 A;  1T2X A;  3AX4 A;  1VBB 1;  2XPJ A;  1ENR A;  1OQE A;  3FHI B;  4HMZ A;  1ZZC A;  2W1W A;  4LTA A;  5EIY B;  2XJP A;  3LB9 A;  3VD7 A;  3WW2 A;  3MLJ A;  1AR6 3;  4YLZ A;  2R07 2;  5A7S A;  3K3O A;  1CJD A;  4KH9 A;  2ZXQ A;  5FY9 A;  5LRR A;  1LGN A;  5D8A B;  5FMO L;  2WSV A;  2EF6 A;  3POF A;  5FPU A;  2C6S A;  1IHM A;  2NMO A;  2K46 A;  4E4Z A;  2D97 A;  3R4S A;  4ARX A;  2FDG A;  2Y60 A;  4MGT A;  1RYY A;  3WD5 A;  3HQU A;  1MZE A;  1CJP A;  4A2U A;  2RS1 1;  1PO2 2;  1RIT A;  2HWD 2;  1EAH 1;  2W5F A;  4D6S A;  1ZYB A;  4NR1 A;  3AMP A;  3ZM8 A;  1WW6 A;  2PQQ A;  1BQP A;  5IK5 A;  1ASJ 1;  4P9L A;  4AOC A;  3CMG A;  3W20 A;  4J6G A;  4XJZ A;  1HXS 1;  1SLC A;  2E51 A;  2IWG B;  3MHZ A;  2K2S A;  2N7G A;  1B35 B;  4QU2 A;  1MS1 A;  2O14 A;  5F6K A;  1FMD 1;  2I45 A;  4COU A;  2R16 A;  3MIB A;  3MV0 1;  4PIX A;  4D8M A;  1BBT 2;  1R1Z A;  5C4W B;  2BFU S;  3E97 A;  1M06 G;  1PGL 1;  2D98 A;  3SIT A;  2VXR A;  1C8M 2;  2W39 A;  5JXG A;  1UD1 A;  4DXZ A;  3ZLI A;  2P4E A;  1GYK A;  1F4H A;  2J1T A;  4K6B A;  4QX2 A;  1MZ6 A;  2O1Q A;  1YHF A;  4HVO A;  3VLB B;  2E33 A;  3NV4 A;  1W9T A;  4IUG A;  3I2J A;  4CDX C;  1ZA7 A;  2GAU A;  4FPY A;  2IXC A;  4BIF A;  2ZX3 A;  3VBU A;  2VME A;  3ZYF A;  4CCD A;  1OF3 A;  4Q4X 3;  1G8W A;  2KD7 A;  2MEV 2;  3NNM A;  3PNA A;  4LKD A;  2JIG A;  1JUH A;  3SKJ E;  5HXM A;  4YWA A;  5AC9 2;  2WFF 3;  2PXJ A;  4AWD A;  5FYU A;  4KNC A;  5JOW A;  3FMG A;  1ENX A;  1RVF 2;  4LA3 A;  3NKT A;  5FO8 B;  2ZA9 A;  4XTP A;  2L9L A;  1VJ2 A;  2HWB 2;  2PAM A;  5A7O A;  5ACA 3;  1H2L A;  3PIG A;  1JOD A;  3N7K A;  4GWJ A;  4D0Q A;  2P3I A;  2WYS A;  1UY4 A;  4CU9 A;  4DUW A;  1GZT A;  3POW A;  4RGA A;  4XAA A;  2V4V A;  5JOX A;  2BOJ A;  4YGB A;  2HWC 1;  5EYY A;  1IGO A;  5F5Q A;  3VB9 A;  3EMR A;  1J83 A;  1N1S A;  2VQU A;  4PI2 A;  1NOV A;  3QCW A;  4DXS A;  1V6N A;  2LRP A;  3K51 A;  4HBN A;  3JCI A;  1S0E A;  3H3U A;  1AR9 2;  1N47 A;  2WT0 A;  3KF5 A;  3IT8 A;  2JIC A;  3CEW A;  4EYU A;  1DU3 D;  3GBW A;  3M1H A;  1SLL A;  4DRR A;  3ZMN A;  4CEW C;  3DYM A;  2JD4 A;  1RJ7 A;  4FFF A;  4QX3 A;  5LY2 A;  4R8H A;  3WNP A;  3VDB A;  4QPG C;  3HAG A;  2X29 A;  1QDO A;  1GFF 2;  4AQT A;  2W68 A;  2VPV A;  1X7N A;  3B7M A;  4OZO A;  3MUZ 1;  2BJS A;  2HEY F;  1TE1 B;  3C7H A;  4M4P A;  4LMF A;  2PA7 A;  2UUR A;  1OHF A;  1ST8 A;  3ME2 A;  1RUG 2;  1EV1 1;  2HWF 1;  3AJY A;  3MI8 A;  1FNY A;  1WME A;  1REF A;  1CAW A;  1UO9 A;  2DU0 A;  2HYX A;  2QQN A;  1O3R A;  1DG6 A;  2RDR A;  4XJ8 A;  5ISL A;  1G9F A;  1UPI A;  3BI3 A;  1WLD A;  1H30 A;  2B45 X;  1IKQ A;  4AI1 A;  4CDQ A;  2ARC A;  2BVV A;  4RQP A;  1W6N A;  1CAU B;  3D8C A;  2VUD A;  2JD9 A;  5E16 A;  5FUI A;  5GJ6 A;  5JXJ A;  5CFC A;  1MQT B;  3L9J T;  2ZHN A;  2JKX A;  5FP8 A;  1BVP 1;  2HWE 3;  2BW8 A;  1C5I A;  2A73 B;  5CFD C;  5I0T A;  3HT1 A;  1QJU 3;  1DZQ A;  2FMD A;  5DQ0 A;  2GN3 A;  1CPN A;  2VUA A;  4Y33 A;  4WM7 B;  1UY0 A;  3III A;  5K0U A;  3VBR C;  1JYN A;  3HQR A;  3JQX A;  2G9F A;  2ZGU A;  1LTE A;  3HNM A;  5F8P A;  3LPG A;  1RUC 1;  2F6B A;  1RUN A;  4WBB A;  2XJQ A;  1UZY A;  4AFD A;  5FZ8 A;  1B35 C;  1V6J A;  5GZD A;  4N7I A;  1VBB 3;  2P17 A;  4ZU5 A;  5T52 A;  2QFE A;  2EIB A;  1LR5 A;  2J1E A;  4QWN A;  5FDB A;  2VMG A;  1GZ9 A;  2BFU L;  2FMY A;  3OEB A;  4IE5 A;  4MXW A;  3THP A;  1W8N A;  1DGR N;  5E1R A;  1MZF A;  2JEN A;  4RA0 A;  5IFT A;  1JZ8 A;  2RS3 1;  4BH9 A;  3CLP A;  4H7L A;  3THT A;  2HYK A;  4QB1 A;  4IV1 B;  2VEC A;  5F39 A;  3GZT B;  3KGL A;  3ACL A;  3RZL A;  4YNI A;  3GBG A;  3MBW A;  3R4U A;  3H3Z A;  4NAO A;  4QX8 A;  1MS4 A;  1LOD A;  2RS1 3;  4RR3 B;  2P1B A;  3EQE A;  4NPM A;  2VNO A;  2XBO 1;  4XCB A;  2WLP A;  2XVG A;  5F3G A;  5DAQ A;  4DZG A;  2PQS A;  1ASJ 3;  2Q8C A;  3ZDS A;  1APN A;  3C3V A;  2BRT A;  3EBR A;  4MGY E;  1RMU 1;  1AVB A;  2WO3 A;  5I91 A;  1HXS 3;  1YXW A;  3HNY M;  3NKG A;  4LJH A;  3V65 A;  5KXE A;  3CJX A;  2BGC A;  5IAV A;  1Q8O A;  1FMD 3;  1C1F A;  3T0B A;  2GDF A;  1JZ2 A;  1KRI A;  1UU4 A;  4COZ A;  2WKK A;  1LUL A;  2OT7 A;  1CN1 A;  3OEA A;  3ORJ A;  4I0A A;  4XHB A;  2Q8D A;  4GJY A;  3VL9 A;  1OF4 A;  3GYD A;  5LA9 A;  3N35 A;  2A6W A;  1K5M A;  5I93 A;  4XOG A;  1JYX A;  4Q5O A;  3JD7 1;  3AB0 A;  2E7T A;  5F1R A;  1R1A 2;  1VMH A;  1ZZ7 A;  3MF6 A;  2W1S A;  4UW5 A;  2OPW A;  2OS2 A;  1V9U 1;  4A44 A;  2ERF A;  3DXT A;  1YWK A;  2EIG A;  3POY A;  4UW3 A;  3SHR A;  4AQ2 A;  3AMQ A;  4CU8 A;  1FNZ A;  3VUO A;  1W0N A;  4BIS A;  5A6Q A;  4WM8 C;  3VD5 A;  4XUQ A;  2HLE A;  1N3P A;  1HW5 A;  1QH7 A;  3IN9 A;  4MO3 M;  3U78 A;  1JYI A;  2W52 A;  4FSJ A;  1RIN A;  4AK3 A;  2OW4 A;  5FPL A;  3WNN A;  4LK7 A;  1JMU B;  2WZ8 A;  3V0A A;  1F35 A;  5CZK A;  1Q8V A;  5FZE A;  3B3Q E;  5L36 A;  3T2Q A;  5FZO A;  1YUD A;  3ASI A;  2BBV A;  1LGC A;  1IPK A;  1W0P A;  1LCL A;  1O7F A;  2Y34 A;  4NE9 A;  4DUX A;  2YBP A;  2ZOE B;  4AZZ A;  1PGW 1;  2H6B A;  1W6P A;  4RFT 0;  4ZS3 A;  3JXS A;  2IUW A;  3A0K A;  2ET1 A;  4AFA A;  2CSG A;  2HWC 3;  3PIJ A;  1FOD 1;  2GNB A;  1TME 1;  3LGR A;  1UXX X;  2ZGS A;  2VMI A;  4QKN A;  4K1Z A;  3B9I A;  4FBF A;  2R7E B;  4GMP 1;  5IW0 A;  4E2S A;  3QD6 A;  3J9S A;  2VMD A;  2W95 A;  4Q2F A;  1OSG A;  2DFB A;  2ZHK A;  4FOQ A;  4AFB A;  5FLH A;  1UL9 A;  3OG2 A;  2Q0A A;  3I2D A;  5CU1 A;  4EWA A;  5FWJ A;  2EXJ A;  1DLL A;  3SH4 A;  2A6X A;  1QJX 1;  5KXD A;  4AI0 A;  3RQ0 A;  1JOP A;  3CZJ A;  4C8D A;  3ZX7 A;  1V6I A;  2ARA A;  2K0G A;  1WKY A;  4Z8B A;  4ATE A;  4JCK A;  1CAX B;  3M2M A;  4QHZ A;  1IS4 A;  5LB6 A;  1MS3 A;  3ZXE A;  3ILN A;  4KL1 A;  4YM0 A;  2HWF 3;  5EJ3 A;  2ARX A;  3ZN4 A;  1GOF A;  1LU1 A;  1HB3 A;  3QOP A;  5A7W B;  5FMD A;  4J25 A;  3ABZ A;  5G04 L;  5EJ1 B;  2A6V A;  4HVQ A;  5C9A B;  3N9P A;  3ZFF A;  1GBG A;  1RHI 2;  3AC0 A;  4EN8 B;  2B46 X;  4BWO A;  3DPR C;  3K2O A;  4O9G A;  5A7P A;  2AAC A;  2XXZ A;  1AXK A;  1UU6 A;  1OQD A;  2O8O A;  3AXD A;  4N9I A;  4NN0 A;  1CON A;  4AVC A;  5FOJ B;  3DGT A;  2HWE 2;  4K3U A;  4NHK A;  5FLI A;  1DGW A;  2E53 A;  3BPZ A;  2OX0 A;  1QJU 2;  4WZF A;  4XUT A;  3THD A;  1A6C A;  3BTX A;  5IVV A;  2YDE A;  1LAJ A;  1G86 A;  4RR3 C;  1OPM A;  2D7F A;  4UFL A;  2NQY A;  3I2G A;  4AED A;  4NID A;  2ZGL A;  1C8N A;  4B3N A;  2ADD A;  2P3J A;  3J26 N;  3U4X A;  4RYD A;  3T3Y A;  1RUC 3;  2BWC A;  4QQP A;  4LQR A;  3HN1 A;  4XXA A;  1DYP A;  4YZ3 A;  5J98 B;  3S6P A;  4YZ1 A;  3JUU A;  2YC2 A;  3B69 A;  2YFU A;  5JUV A;  3OBT A;  5JPN B;  4ATF A;  3I54 A;  4LE3 A;  4LBO A;  4ASM B;  2XJU A;  1D7P M;  1DP0 A;  1OUX A;  3ZXJ A;  3I3E A;  2X5I A;  4DFS A;  4M4R A;  1CAW B;  4OVE A;  1OT5 A;  4PDW A;  2VD7 A;  3H42 B;  5APA A;  2X10 A;  5GM0 A;  4RHV 3;  4LHL A;  3R4D B;  4XF9 A;  3PUR A;  2CWS A;  3WZ1 A;  1VB4 A;  4XIK A;  3ELN A;  2CGP A;  3MPP G;  4LE4 A;  1WW5 A;  4LA2 A;  4LHN A;  3TBD A;  1VIW B;  5CFC B;  5BNN A;  3OGS A;  1Q56 A;  2XBO 3;  4LOS A;  3AJZ A;  3NST A;  2VUC A;  1QOS A;  1RUD 1;  4Z1V A;  3M3O A;  5LY1 A;  2YY1 A;  4BU2 A;  1ZZB A;  2WL1 A;  4Q0P A;  4Z2W A;  4W6Y A;  1W9S A;  3LA7 A;  5FYS A;  4N7U A;  3VBH B;  1RXF A;  3E5X A;  3I3Q A;  1K3I A;  1AYM 3;  1PGL 2;  4K9S A;  2RDN A;  3GCW A;  3FHA A;  1JZ6 A;  1D4M 2;  3D6E A;  5C6C A;  1URX A;  2OII A;  1RED A;  1OQ1 A;  4PCR A;  3VDC A;  3A0N A;  3HJR A;  3JD7 3;  4XXP A;  4ZS2 A;  3ZFG A;  3PVO A;  2JDM A;  1FAT A;  4CE8 A;  5GLZ A;  4MXW B;  3TEX A;  1V9U 3;  1CVN A;  4H14 A;  4ONU A;  1ONA A;  3FUQ A;  1SG3 A;  1H8T A;  2J42 A;  1O8S A;  2D6L X;  1F15 A;  3NV2 A;  3SQO A;  2JB8 A;  4IE4 A;  3HVD A;  3TN9 1;  2RG4 A;  4YW6 A;  5GKA C;  1EUU A;  4XUP A;  5DZG A;  1LES A;  5T5L A;  1JU3 A;  3WSO A;  1QDC A;  5LBF A;  3WVJ A;  3AZZ A;  3VBU C;  5GLV A;  3WW3 A;  1US2 A;  4M0H A;  3T2P A;  3VDD A;  3USU B;  5JMO A;  2B4K A;  2BP6 A;  1UMI A;  1A8D A;  3VHN A;  1GZC A;  1J3P A;  2VNR A;  3WNK A;  5JCT A;  5K4L A;  3SH5 A;  4AR2 A;  1UPS A;  4DMI A;  4IDZ A;  5A7Q A;  5FLJ A;  1S0I A;  5IVC A;  2YGM A;  5FXX A;  1Q43 A;  1FOD 3;  1VMF A;  2BZD A;  3KHB A;  2RJL A;  3M3I A;  1FPN 2;  1RUI 1;  4BQ1 A;  5T54 A;  1K5M B;  2X8K A;  4GMP 3;  2RMU 1;  2ZGO A;  3NV3 A;  2ID4 A;  4DXT A;  4CU6 A;  1LHN A;  5JR7 B;  4PT6 A;  5FZ6 A;  3FZ3 A;  4MET A;  2KR2 A;  4YGC A;  4FPG A;  1ZBA 2;  1VPH A;  2Q1Z B;  2W9X A;  5LA2 A;  3WDY A;  4YW5 A;  1XNA A;  2LS6 A;  3L2Y A;  5L7O A;  2EVX A;  2W92 A;  1ZZ9 A;  3AP9 A;  3I59 B;  5EP9 A;  4QQL A;  4ASK A;  2A3W A;  3JBG 1;  4LIT A;  2WO2 A;  4XC9 A;  5G05 L;  3V0A B;  3B02 A;  4FP3 A;  1EYB A;  2XVL A;  1W6Q A;  2I07 B;  1YI9 A;  4MGZ E;  4G9S B;  1F4A A;  1GNY A;  4N8M A;  4PI0 A;  3ZN6 A;  3T09 A;  3ZDV A;  3TEZ A;  4OLL A;  1F9K A;  1PVC 2;  4ZKT B;  5J96 B;  1CPM A;  3T08 A;  1W6P B;  1RUJ 2;  4ZXK A;  2D5H A;  5FZ0 A;  1GNH A;  4XJW A;  3WY6 A;  2QQM A;  4CXW A;  4ZU7 A;  1GP4 A;  1G9D A;  4AQS A;  5LEJ A;  2PAE A;  1WCK A;  1NCR B;  1YNA A;  4I0B A;  1D0H A;  3IPV A;  2QQV A;  4IE0 A;  3TWI A;  4CDQ C;  5LA0 A;  4RQP C;  1SDD B;  4QAW A;  5IWF A;  4RSU A;  4BQ4 A;  4DS0 A;  3OOX A;  4D7S A;  2YPD A;  5CFC C;  5JOZ A;  4QHO A;  4KGQ A;  3HT2 A;  1OFN A;  4Y20 A;  3WF0 A;  4KG0 A;  3M3C A;  1ZZ8 A;  3B00 A;  1QWR A;  4L97 A;  5FUP A;  5FXZ A;  1JYW A;  3V56 A;  4CP0 A;  1DQ1 A;  2I2S A;  3C7F A;  3N9O A;  3ENR A;  5K0U C;  1G9B A;  4UW4 A;  5F3I A;  3GHM A;  1X8M A;  4Q4W 2;  4I09 A;  3D5O A;  1XSR A;  1N1Y A;  4QGL A;  4UF0 B;  3V0B A;  5GZC A;  3BOP A;  2VNG A;  4OMD A;  2RE9 A;  3E1F 1;  4RHV 2;  2JXA A;  4GAL A;  4YM1 A;  4OCT A;  1OUR A;  1XE8 A;  2Q1M A;  2EXK A;  1HQW A;  4K7J A;  4LLF A;  1UZW A;  5CVR A;  2CGN A;  1DFQ A;  3ZFF B;  4DXR A;  2W87 A;  1AHS A;  4A6O A;  2VOT A;  5JIU A;  3FWE A;  2JDY A;  2QZ3 A;  3TNQ A;  3W5N A;  5HCF A;  3M4F A;  3ZSK A;  1VBD 2;  3H7J A;  5CG9 A;  2OUJ A;  1GKB A;  4EV0 A;  5LRS A;  1NZC A;  4L8Q A;  4AGG A;  4A3X A;  1RUD 3;  3HBZ A;  1LHU A;  3M3Q A;  5DAW A;  4YW2 A;  1NA1 A;  3LDR A;  3UNP A;  3GJB A;  1RUE 2;  1VAM A;  1AYM 2;  1ULO A;  3LEG A;  5E6H A;  4YRD A;  2Y0O A;  3VKO A;  5A6X A;  3RZG A;  2GP5 A;  4QPI A;  4QQH A;  4X8N A;  4OI1 A;  4IND A;  3U37 A;  5JSO A;  1O59 A;  5FYB A;  4FPO B;  1D2Q A;  3WDT A;  5DUU A;  4XYX A;  3OBR A;  1ULP A;  2DV9 A;  2ZGK A;  2EXH A;  5SV8 A;  2IFR A;  3WHU A;  1J3R A;  5DXD A;  1IG0 A;  5KBF A;  5HBA A;  5EJZ B;  2BPA 2;  3MUY 1;  4CYD A;  3WW4 A;  1F8V A;  1HB4 A;  1K5M C;  1AUY A;  2V09 A;  1S55 A;  2X5I B;  2W94 A;  4UFH A;  4BM8 A;  4Q0U A;  1LU2 A;  2R06 3;  2WZR 1;  2ZCW A;  4PDW B;  4CUC A;  3TN9 3;  5A32 A;  1UYX A;  3QH7 A;  2MHF A;  4Q4Y 1;  4BLJ A;  1T6B X;  2ZGP A;  1YFX A;  2ZTN A;  3AP7 A;  5FZI A;  5BNN B;  4W65 A;  4FVV A;  4XFB A;  2VBB A;  4XE9 A;  3ZIX A;  2XJS A;  1TMF 1;  3WDV A;  3WF3 A;  4C1X A;  3MIF A;  1BCX A;  2ZGN A;  1SPP B;  2ET7 A;  2OZJ A;  3ZYB A;  1SCR A;  3IKW A;  3U4S A;  4IE7 A;  1S4C A;  1G7Y A;  2WS9 2;  3IM0 A;  3ON7 A;  3ZXK A;  1OOP A;  1RUI 3;  3KT7 A;  3OPW A;  3N9N A;  3ZOI A;  1TG7 A;  3SKV A;  1JZ4 A;  1PO1 2;  1NY7 1;  1UU5 A;  2UY9 A;  4N43 A;  1UQX A;  1DQ5 A;  4YGE A;  4FCA A;  3U1X A;  5A3T A;  1Y3T A;  1NZI A;  2RM2 1;  3KV6 A;  1XB9 A;  2I74 A;  3D4K A;  3ZXL A;  4B8E A;  1W90 A;  3HN3 A;  4CDX B;  3EB7 A;  3VKM A;  1H8T B;  3ZYP A;  4R52 A;  2CYF A;  4P5Y A;  3RRD A;  3O1M A;  2VZV A;  3H1W A;  5DUW A;  2XQR A;  4F7Z A;  1GWK A;  1O4T A;  3WCR A;  4H3W A;  4LEJ A;  3JBG 3;  2UYA A;  2TUN A;  4GJZ A;  2ZML A;  3ZIW A;  3DKW A;  1O5U A;  5EZW A;  4CZS A;  1YCI A;  1KFX L;  1T6G C;  5CKM A;  2GZW A;  2BNN A;  3E6B A;  3I3M A;  1LB2 A;  1L3J A;  2HEW F;  4IEY A;  4TWT A;  4C0H A;  1IPS A;  3NNG A;  2DWR A;  4RGK A;  1PX4 A;  1ZBE 2;  4D7Y A;  5C70 A;  3KLS A;  3M3E A;  1ZRR A;  4BZ4 A;  1ENS A;  5FBJ A;  1R09 1;  3CKH A;  1ULG A;  4GB3 1;  4R4Z A;  5JZG A;  3ZFF C;  2KA3 A;  4XFF A;  4P00 B;  5FZL A;  5L73 A;  1YQC A;  1WLW A;  2GH8 A;  5M0T A;  4Y1Y A;  5GAL A;  3T1M A;  3I2H A;  4RS5 A;  5TSW A;  3DCQ A;  4ORF A;  4QKF A;  5FQ0 A;  2J1S A;  4HN0 A;  2ZMN A;  1MS5 A;  3C7G A;  1SLA A;  4AL9 A;  2LUW A;  3I2F A;  1N1T A;  2DVA A;  2GC0 A;  2BGO A;  3AFG A;  1GZW B;  4GZ9 A;  3ZYI B;  4QPG B;  3F2Z A;  3W5M A;  2G9Z A;  3N4M A;  4AED C;  2DTY A;  5L7O B;  3CDZ B;  3OY8 B;  4FAH A;  1GMM A;  5GZF A;  5JXI A;  4HKO A;  3WP6 A;  4D6Q A;  1AL2 2;  2HH9 A;  2CHH A;  4YVW A;  3UT0 A;  2R32 A;  4Q8K A;  2PTM A;  1NT0 A;  3RI8 A;  2Y6L A;  3A22 A;  4QM8 A;  4LNV A;  2VZR A;  3OPZ A;  5FPZ A;  3RMY A;  4GD4 A;  3N7L A;  5JVV A;  1W9Y A;  2JDA A;  3ZN6 B;  4Z2A A;  1KDM A;  4ZON A;  1ULD A;  4UBG A;  1N1V A;  1S0D A;  2XLA A;  3L2H A;  2X5I C;  1KD7 A;  3NAP A;  3PVN A;  4LBQ A;  5DZE A;  5FO7 B;  5H9P A;  5BNP A;  1K45 A;  1UF2 C;  4JV4 A;  5DAB A;  4PDW C;  4B7K A;  5JSR A;  1EUT A;  4NAM A;  3SNM A;  4OUS A;  2D6P A;  1IPJ A;  3DF0 A;  3GZE A;  3O1T A;  3ZYR A;  1V6M A;  5JLV A;  4QXH A;  4DEV A;  5CFD B;  3ITQ A;  4HK9 A;  4J1X A;  4AXO A;  2GC2 A;  2A70 A;  3AM2 A;  3UES A;  1HX6 A;  4A41 A;  4AHY A;  3P1I A;  4CPB A;  3LZZ A;  3K75 B;  4D94 A;  4R9D A;  4LT5 A;  3WF1 A;  3VBR B;  3MFC A;  4B1M A;  5FYC A;  5BNN C;  2ZX4 A;  4JDN A;  1JN2 P;  1E5S A;  1JZ3 A;  1KQR A;  3MIC A;  2HKX A;  5JSP A;  1DGW X;  1H2M A;  1V0A A;  2VQ0 A;  5FPX A;  4K21 A;  3WDX A;  1RL3 A;  4BQ2 A;  5CEH A;  1PM7 A;  3VZJ A;  3WF2 A;  1KFU L;  2DVG A;  2O0O A;  4QQO A;  3ILF A;  2WJS A;  5FMB A;  3LE0 A;  3I3B A;  3OUJ A;  1AJK A;  2VTX J;  3V0B B;  3UKT A;  2R06 2;  2QDR A;  3VD9 A;  1UKG A;  5J36 A;  2VCM A;  2WZR 3;  3ZFG C;  4IGQ A;  5EXO A;  5IVB A;  3RZM A;  4WVM A;  4XJ9 A;  4KWJ A;  2IXI A;  4Q4Y 3;  4BHP A;  1OC1 A;  1H8T C;  4Q4V 1;  5JPM B;  2XVK A;  3NJX A;  1YFW A;  1RUF 3;  2W3J A;  5D1I A;  1VE0 A;  4EZH A;  4F3J A;  4A6S A;  1VBC 2;  2VVD A;  4YM3 A;  3OGV A;  1DHK B;  1QKQ A;  1TMF 3;  2UWC A;  1WCQ A;  3ZN5 A;  1LOC A;  5J3U A;  1A78 A;  1DQ6 A;  2QQW A;  2DVD A;  1AX2 A;  2J1A A;  3VDD C;  4MOA A;  3A21 A;  3WUC A;  2DUP A;  2GN7 A;  2OYZ A;  2Y26 A;  4X6R B;  4YAR A;  1RUI 2;  4XF4 A;  1NQD A;  1H2K A;  3UKV A;  4B29 A;  5CKN A;  2IXH A;  1WW4 A;  3IMM A;  2QQU A;  4WVV A;  4DY3 A;  4FTE A;  2DFC A;  3WXP A;  4FQ4 A;  2BTV C;  4DIQ A;  2TNF A;  1VBA 3;  5FP9 A;  3WW1 A;  3ZXG A;  1BVV A;  4FXK B;  4BOW A;  4E4H A;  4ZHN A;  1RJ8 A;  2WNV A;  3FL7 A;  2VW0 A;  4GA9 A;  4YW1 A;  4ES9 A;  4LBJ A;  2ZGQ A;  5F6L B;  2ZHL A;  1Y9Q A;  4WM8 B;  5F7U A;  2D43 A;  1OKQ A;  5A1L A;  3JBG 2;  5LZ6 A;  1J1L A;  1H1M A;  1L7L A;  3KF3 A;  5DDJ 1;  4QX7 A;  2ZS6 B;  1UN1 A;  2BGP A;  3ACF A;  2XL7 A;  3J7L A;  4F83 A;  3HWJ A; 
#chains in the Genus database with same CATH homology
 5F2S A;  4C8D A;  2OQ7 A;  4V2V A;  5E6H A;  4CUG A;  3AVS A;  4Y33 A;  4LIV A;  4D6S A;  5A1F A;  4CCO A;  4D6Q A;  2GP5 A;  4AI9 A;  3RVH A;  5F3C A;  4URA A;  3N9Q A;  3PUA A;  5FYB A;  5FJH A;  4V2W A;  5FYM A;  3LDB A;  5FZ3 A;  5FZ8 A;  5FY0 A;  5FZK A;  4GD4 A;  5K4L A;  5FZM A;  5A7W B;  2WWJ A;  3KVB A;  4IGO A;  4CSW A;  5LWB A;  5A7Q A;  2W2I A;  5F2W A;  5FP4 A;  5IVC A;  5FXX A;  5FYV A;  3N9P A;  4QWN A;  5FZ1 A;  5A7W A;  5FPV A;  5FZ4 A;  4NUB A;  4XDP A;  3OPT A;  4HON A;  3K2O A;  5A7P A;  2XXZ A;  5KR7 A;  2GP3 A;  4AAP A;  3ZLI A;  5FZ7 A;  3K3N A;  5F39 A;  5FZ6 A;  4QXH A;  2OX0 A;  4Y3O A;  4CCK A;  4QU1 A;  3KV9 A;  3KVA A;  5FZD A;  5IVV A;  5FWJ A;  4QX8 A;  2XML A;  5FYC A;  5FZI A;  3NJY A;  5FZB A;  5LW9 A;  2XDV A;  5F3G A;  5FP3 A;  5FYH A;  5FZC A;  4LXL A;  4ASK A;  4D6R A;  4GAZ A;  4LIT A;  2Q8C A;  3LD8 A;  5F5C A;  4CCJ A;  5F5A A;  4XDO A;  5FYT A;  5FYY A;  5FJK A;  5FZG A;  5CEH A;  2PXJ A;  3AL6 A;  5FZF A;  5IVF A;  5FYU A;  3U4S A;  5FV3 A;  2YBS A;  5FWE A;  5A3N A;  2OT7 A;  2Q8D A;  2XUE A;  4GJY A;  3OPW A;  5A7O A;  5FY4 A;  5FYZ A;  3N9N A;  2P5B A;  3AVR A;  2Q8E A;  5FZ0 A;  2VD7 A;  4IGQ A;  3PU8 A;  5FYI A;  5A3T A;  5IVB A;  3KV6 A;  3AL5 A;  3PUR A;  2OS2 A;  3PUQ A;  4CCM A;  3PU3 A;  5FZA A;  5IWF A;  3DXT A;  5FP7 A;  4LIU A;  3N9L A;  2YPD A;  2YBK A;  4EZH A;  4IGP A;  5ANQ A;  2YU1 A;  4CCL A;  4BIS A;  5FXV A;  5FPA A;  4EYU A;  5FY1 A;  5F5I A;  3U78 A;  5FUN A;  4GJZ A;  5LY1 A;  4BU2 A;  5FY8 A;  5LY2 A;  5FPL A;  1VRB A;  5FZO B;  5FUP A;  5FXZ A;  4QXB A;  5FYS A;  5FZE A;  3PUS A;  3N9O A;  5F3I A;  5FZO A;  5A3W A;  5IVY A;  4UF0 B;  2YBP A;  3PDQ A;  5FBJ A;  5IVE A;  5IVJ A;  2WWU A;  4DIQ A;  5F32 A;  3KV4 A;  4UF0 A;  5FY5 A;  3ZPO A;  4QXC A;  5FP9 A;  5F3E A;  5A7N A;  4E4H A;  5FXW A;  3KV5 A;  5FZL A;  5FPB A;  5FZH A;  5ISL A;  5A3P A;  5F37 A;  4EZ4 A;  3DXU A;  3PTR B;  4BXF A;  5IW0 A;  5A7S A;  3K3O A;  4Y4R A;  5FY7 A;  4TN7 A;  5FY9 A;  5A1L A;  2OQ6 A;  2YU2 A;  5A80 A;  5FZ9 A;  4DO0 A;  4QX7 A;  5FPU A;  5FP8 A;  4HOO A;  4CCN A;  3N9M A;  3UYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...