2GP3A

Crystal structure of the catalytic core domain of jmjd2a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
349
structure length
349
Chain Sequence
ASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji domain-containing protein 2A
publication title Structural insights into histone demethylation by JMJD2 family members
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 97
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2gp3A01
3N9MA 3K3NA 5FZ4A 5IVYA 5FYZA 5LWBA 2W2IA 4BU2A 4CCNA 4QXCA 5FYVA 5FYBA 5LY2A 5A7PA 2XMLA 4LIUA 3OPWA 5F37A 5FZAA 5FPVA 5LY1A 4GD4A 2OS2A 5FY4A 2YU2A 4V2VA 3N9LA 2XXZA 5IVVA 4URAA 5FZGA 5A3PA 5IVEA 3KVBA 5A7SA 2GP5A 5KR7A 4EYUA 4EZHA 3ZLIA 3KVAA 5ISLA 5F3GA 2PXJA 5FJKA 5A7WA 3NJYA 3PUSA 5FYUA 4TN7A 3PUAA 5FY8A 4Y33A 5IVJA 2OQ6A 4CUGA 5FZ0A 3N9NA 2Q8CA 5FP3A 3UYJA 5E6HA 3U4SA 4XDOA 3ZPOA 5A3NA 2YBKA 3K3OA 4IGQA 5FP8A 4E4HA 5A7OA 4D6RA 4HONA 5FV3A 5FYCA 4D6SA 5F5AA 3N9PA 5FPAA 5FYIA 5FY0A 5A7QA 5FP4A 5FWJA 5A3WA 5F32A 5A1LA 3LD8A 5FPBA 5FZ6A 5FZMA 5FZ7A 5FUPA 5FZHA 4CCLA 3KV9A 5FYHA 4CCMA 5A3TA 4Y3OA 5FY1A 3PURA 3DXUA 5FP9A 5A80A 5ANQA 4LITA 5A7WB 5F3CA 5FYYA 5FZBA 2Q8DA 4D6QA 5IVFA 5IVCA 2YBPA 3PU3A 5LW9A 5FYSA 5FXVA 3AVSA 4QXHA 5IVBA 4QWNA 3K2OA 4QXBA 4UF0A 5F5CA 5FZKA 4BXFA 5CEHA 2VD7A 5K4LA 5FZFA 4UF0B 3RVHA 5FBJA 5FZ9A 3KV4A 4QX8A 4IGOA 5A1FA 3N9OA 4IGPA 3OPTA 5FJHA 5FZCA 4CSWA 5FZIA 5FZEA 5IWFA 4GJZA 2WWUA 4GJYA 5FXXA 4DIQA 3AVRA 2P5BA 4Y4RA 5FYMA 2YU1A 3PDQA 4ASKA 5F3EA 3AL6A 4CCJA 3KV6A 2YPDA 3N9QA 5F2SA 3PU8A 4V2WA 2WWJA 5A7NA 2Q8EA 5FWEA 2YBSA 5FZOA 4QX7A 5FPUA 5FXWA 4AI9A 5FZ1A 5FYTA 3LDBA 5FZLA 5FZ8A 5FY7A 4XDPA 4CCKA 3KV5A 2OT7A 5FZOB 4EZ4A 4LIVA 2GP3A 4CCOA 3DXTA 1VRBA 4LXLA 4GAZA 4BISA 4C8DA 2OX0A 5F2WA 2XUEA 4HOOA 5F3IA 3U78A 5FPLA 5FY9A 5FZ3A 3PTRB 5FP7A 3PUQA 4AAPA 4DO0A 4NUBA 5FZDA 5IW0A 4QU1A 5F39A 5F5IA 5FY5A 3AL5A 5FXZA 2OQ7A 2XDVA 5FUNA
chains in the Genus database with same CATH superfamily
3M8LA 4AI3A 2C9AA 3B9IA 4M00A 4P08A 1C8M2 3HEIA 2DVFA 1R091 2BFUL 2BOJA 1WW6A 1VBB1 5LWBA 3GYDA 4RS5B 4X8PA 1AR61 4QT6A 2WO7A 1HRV1 1MR5A 3KF3A 1UMZA 4GKYA 5AVAA 4AVCA 3TEYA 2EXKA 2VW0A 3MBWA 3CU7A 4WM7C 1XB9A 1DQ5A 5CU1A 2RDQA 4V2VA 4UBGA 3ZR5A 1NYWA 4XHXA 5FZGA 1YIFA 3VD7A 2Y6HA 1H6YA 3OD0A 1WUVA 2NLRA 4Y20B 5A7SA 2QCSB 3UKTA 4EYUA 2WA4A 1DIWA 2HWE1 2JDZA 1MS5A 4YVWB 3PUSA 2WAAA 2XGXA 3PUAA 3NO8A 2LTNA 4KGQA 4XMAA 2GH8A 4Z07A 5FZ0A 5DAWA 3AB0A 1RMU1 4CDQB 2OZJA 3C7EA 4IV1B 4ZHNA 1W6NA 2CGNA 4QPIB 3I3DA 1BVP1 5BNNB 1OUSA 4XDQA 4KWJA 1SQ4A 3OUJA 2FZ2A 1ODMA 4W6WA 3OOXA 3O1MA 1LGBA 4YGBA 3GM8A 1XSRA 4JGYB 3J7NA 1L7QA 4B1LA 4XBNA 2ARAA 4AI8A 1W6QB 1ODNA 2WLQA 1YQ8A 2Y8KA 3NQHA 5L9VA 4CDUA 1BBT1 5LA0A 3WUCA 2JKBA 2VCMA 5DUVA 4YVWC 1UZVA 5HCAA 3LWCA 2B7YA 1CZVA 5FY1A 1V6OA 3DXUA 1J1TA 3ETQA 5FP9A 5CFCA 5A80A 4IETA 1QF3A 4Q4X3 2TEPA 3T4HB 3C7FA 1T6GC 4IV1C 4M0NA 4QAWA 4QX1A 2A7AA 3VBOA 3S7EA 2WT0A 3DUIA 4PQQA 4GALA 1UOGA 5FXVA 1ENXA 2WT1A 3BCWA 2C5DA 3LAGA 1COV1 2CAVA 4GH4A 4NIAA 5FZKA 3V0AB 3ZYFA 4JX0A 3T4VA 3H1MA 2D98A 3WOGA 4MOAA 1DGRN 4Q4Y2 5K4LA 5L7OA 1CAVA 3CIHA 4Z92B 4UF0B 5I93A 4JGYC 3IN9A 5H9SA 1UOBA 1YJKA 1FAYA 1RUG1 1OMIA 1PM4A 1PIV1 3FLPA 5I0TA 4LOTA 2GZWA 5IYYA 4Q0QA 1D4VB 2FQPA 4LE3A 4AE2A 1REDA 3J8F2 5T5JA 2VO5A 2WYFA 3BN6A 3BOPA 3DN7A 1XE7A 1MVQA 1OH4A 2B4KA 4OHYA 3I59A 2XHKA 3OGGA 4XIOA 3H7JA 4ZPIA 4CCKA 2ARBA 3OBTA 1OH3A 5JIAA 1IPJA 4CCCA 4TYSA 2DBNA 1C4RA 1RB8G 1US3A 1NOVA 2A6WA 4HN0A 3K75B 4YG3A 4MADA 1GZTA 1JYTA 2JDHA 4MGIE 4AOCA 2WQ4A 4XURA 3S5QA 4XZPA 2I07B 5BNOB 1GSLA 2GU9A 2WLPA 3PJYA 3PUIA 3SEPA 5IATA 4QDRA 2VBDA 1U5ZA 4AVSA 3P5BA 2XDVA 5FUNA 3T08A 4E8DA 4MXWA 3OTFA 1YQ2A 4Y1ZA 4Q2FA 1SPPB 3C2UA 4Y22A 4JDOA 5HBAA 1D2SA 1RINA 5B2GB 4JDMA 3ZXGA 4BHPA 1O91A 1R092 4AFDA 3ZXDA 4OQ9A 3NKGA 2IXLA 2O0OA 4NRMA 4XAEA 4D7TA 4L0PA 1RUF3 2ZAHA 2Z69A 3W59A 3WP5A 4EZHA 2ZOEB 1ZA4A 1DGRA 4LE4A 2E7AA 1ZREA 1W8ZA 4QGLA 5KHHA 2JD4A 2R30A 5LBEA 4LORA 5EPAA 2ZGMA 4A4AA 5JSPA 1YCIA 2ZGTA 3VDCA 3G6JB 3MIDA 5LEJA 4JHZA 3SH3A 4AAXA 1N1VA 1UX7A 2AZ5A 2WZR2 1VBA1 3CZUA 4DXRA 3VDBA 5FP4A 3THCA 1NG0A 2YY1A 1QQP1 1R1ZA 1BHGA 2OXBA 2RG4A 3S6PA 2Z5WA 1ZRIA 3CJIA 2B42B 1H4GA 3OBAA 3MIGA 1T2XA 1LOAA 1W8HA 3MIEA 3G7DA 3ZYRA 4I09A 1WW4A 1JUIA 3OBZA 3WCSA 2NQYA 3EB7A 1FV2A 2D6NA 2DCTA 3MPBA 4FOQA 4KU8A 5L36A 3AMNA 1CAWA 5K0UC 2ORZA 3ZKYA 4BQ3A 2G9ZA 2HWF3 4XFBA 3TOJA 2WNVA 1RUH2 4CP0A 5A3UA 3ZIXA 4CEWC 2Y60A 1O3QA 1EPZA 4H2AA 4JKMA 5FZ9A 3E6DA 1FPN3 2ZGKA 3S30A 1Q8OA 5AVPA 4CUAA 4IQPA 3U10A 3SH5A 2E63A 2BWAA 2WNEA 4XF4A 2VY0A 4YVSC 4E4DX 1SBDA 1VBD1 2NPIA 3V0BB 4WVZA 1W6MB 3ZSMA 2LS6A 3E5UA 4PLOA 5AC93 4DOUA 5CB7A 1ND2A 4FBFA 2HWC2 3KV6A 4IL7A 5F2SA 1UYXA 1RJ7A 3MPPG 2ZHMA 3WG3A 4OMCA 4XJ9A 2DCZA 5H9RA 4XW3A 4QQHA 3USUB 5FY7A 3PVNA 4LIVA 2Q8OA 1RXGA 2EVXA 4Y20A 2PHFA 2X5IA 4XF1A 4CDWC 1LB2A 4JAAA 1Y3TA 2WAOA 3O1RA 4NROA 1GZCA 1W3VA 1JOBA 1LOFC 2VBPA 3F2ZA 4Q26A 4BLJA 1Q43A 5FPLA 4EN6B 1VBB3 1YI7A 2GMMA 3VD5A 1F5JA 3AZXA 1AR63 4AAPA 3BU0A 1W04A 3EXUA 1HRV3 5IW0A 1V0AA 4CDQA 3BIEA 1RHI1 2WFPA 2WO2A 4HVRA 4QPIA 1UMHA 1W8TA 1PNFA 3ZSKA 4GXLA 5EYXA 4A7YA 2V09A 4CCNA 4BU2A 1RUC2 4EWEA 3WSOA 3CQOA 2C26A 2FDHA 2Y6LA 4CDXB 2DFCA 2HWE3 4YW7A 1LHVA 2IVJA 1D0HA 1XJAA 1HQLA 3FHQA 3N9LA 4OFGA 4N53C 2WNUB 3ZFFA 3IDCB 4RQPB 1HB2A 1RMU3 2EXJA 4LHSA 4S2HA 3WD5A 4C0BA 4QGNA 4R4ZA 3GALA 4Z82A 5KR7A 1FMD2 2GNMA 2XLGA 4EWDA 2R061 2X8KA 3GDBA 5FYUA 1SDWA 2GDFA 3MIFA 4FFHA 4FPFA 4UFKA 4XFAA 1TME2 3TNPB 4XJ8A 3HAGA 4KWLA 1DZTA 4HVOA 4QPYA 1K5MB 1CPNA 1NY71 3P1IA 1NA1B 3H1YA 4DY3A 2VZQA 2ZGOA 4AHZA 3U14A 4EROA 1WMFA 1XXNA 3ACHA 3K3OA 4IGQA 5FKCA 4AI1A 1TE1B 2R041 1VPHA 2IFWA 2D43A 1NQDA 1BQPA 2JIJA 5EZWA 3WT3A 1HW5A 1BBT3 1QJX1 1ZRRA 4OMDA 1CESA 1H6XA 5F5AA 3PIGA 4B4QA 1HXS1 4DQAA 1Q56A 1EAH1 1RUI1 1ULEA 2ZAAA 1ST8A 3GF6A 1QJEA 4K1ZA 1I9RA 4FQ4A 1QGLA 4E8CA 4RQPC 1S0JA 3WP6A 1W2NA 3I2GA 3UNPA 4WV8A 5T52A 3WDYA 1QNWA 1TVGA 4UFJA 4KH9A 3TWIA 1VBA2 2ILMA 2QBXA 2A71A 1OPOA 4LHLA 4FPEA 1COV3 2DVDA 3P3PA 4A3ZA 3RNSA 3SQOA 1QQP2 4HLTA 4NIGA 1RGSA 1SLBA 4L92A 4WVMB 4Y1UA 1V6NA 5ANQA 2BFUS 1IQAA 5EV7A 1QXJA 4NRPA 2CWMA 4YFZA 2VH9A 2JG8C 2VULA 5IK8A 2JB4A 2XONA 2ZHLA 3JCIA 5I0SA 5K7PA 3PVEA 4L2NA 1MZEA 1RUG3 2W39A 1KFXL 1PIV3 1NT0A 4O65A 5JR2A 1PO23 2RS12 2WABA 5A6ZA 1WMEA 4Y1VA 3M3OA 1H9PA 1LOBA 4CP9A 1QJU1 4D69A 2ARXA 4N43B 5CNAA 4QX8A 4QX2A 1DYOA 1OUXA 2ETEA 4FO9A 3VBUC 1C57A 1DHKB 4P9YA 5FZIA 1DZRA 5LASA 2Y0OA 1YFXA 4MUVA 5BYNA 3C7OA 2WWUA 4K20A 3ZFGB 1C5HA 3GCWA 1UIKA 2A6ZA 3KMHA 2E7QA 1O4ZA 3POGA 4KG8A 4TSVA 3A0KA 5A33A 1PMIA 5LK5A 4XQ4A 3VHRA 1VAMA 2HEWF 4AQSA 2WUHA 3EMRA 1X9PA 4FQZA 1S0DA 1KITA 4LO6B 1YO8A 4PIYA 4XUQA 2JIGA 4Q29A 5DUXA 5LA1A 3WNKA 4I3GA 1DGWA 3ALQA 4C8DA 1AL0G 1G6NA 1AJOA 4OQ8A 4K40A 4JC1A 3AZYA 3WW1A 4BE3A 1XOYA 1RUD1 1OQDA 1PGSA 1R1A2 4NUBA 4XUPA 3ROUA 1SLCA 3ST7A 2J7MA 1UOJA 2JDYA 4LBOA 5D8AC 4CA9A 2A70A 2ZMLA 4QPGB 3AKSA 2NMNA 3R4UA 2WA3A 4B8EA 4ZXKA 2P4EA 1NCRB 1HLCA 2PA7A 5LY2A 5DG1A 5HCHA 3WDVA 3M3CA 2XMLA 3OPWA 4J1XA 1OT5A 4JGZB 2GMEA 4AHWA 4COYA 1HB4A 3ABZA 5DAQA 2GSYA 1D2QA 2KXLA 4BA6A 1ND3C 2NZ9A 3E97A 4K6BA 2VG9A 3OD4A 1AX1A 5FPZA 2PHDA 3ZIWA 4I02A 3DPRB 3JU9A 4C0HA 4AZZA 4Q4V2 2X10A 4AVVA 1AXYA 2A3XA 4TTGA 4AFBA 5FO8B 1UXZA 1JW6A 3JBG1 3QACA 4QD2A 2PXJA 2YYOA 4IEYA 3Q8EA 1K3IA 1MS4A 1ZRCA 4DZGA 4RGAA 4IEXA 1WLTA 5F2WA 1BEV2 1G9FA 3VL8A 4QPGC 1W9TA 4XDOA 2ZJCA 2G9GA 1AXKA 1RUJ1 2VZPA 4CPBD 2A6XA 1U0AA 4KI5M 3WW3A 1W8WA 3NSTA 1HDKA 2E51A 4JRAA 3VDDC 2VXJA 4A2UA 2BNMA 3HQXA 5C8CB 3DPRC 4IE7A 5A1LA 1PK6C 2X53S 1UD1A 2DVBA 3MIHA 2XVKA 5FUPA 3LB9A 4XUTA 2DUOA 5FZHA 5I8SA 3V0BA 5JVVA 2UY8A 5JOWA 4CCMA 2HWB1 2F17A 1JHNA 2V5DA 3H0OA 4COWA 4B1MA 1ZZ6A 1RUI2 3ACGA 3PURA 3GCXA 1IQDC 3GXUA 1WGPA 1CAXB 4NPMA 3VBFC 1ZZBA 2CDOA 2WS92 5IVFA 3V64A 4AEDC 2EXHA 4FPYA 5LZ6A 5LW9A 2PHXA 1SDDB 3WNPA 1VRH1 3W58A 5JZGC 3IDEA 1YI9A 1UKRA 1F4HA 4XEZA 1W0OA 3R6SA 4LBLA 1YXWA 4OI1A 1VBD3 1AR91 1NZCA 1AR71 3H7YA 2CDPA 2XLFA 3NNLA 2VCCA 2VBBA 1G86A 1GOFA 1F4AA 3THTA 1JZ8A 1REFA 5L9RA 1UZYA 4AK3A 2VZ3A 1X36A 1QJU2 4LHNA 4YW6A 1IS6A 1EYBA 1PZ9A 1VBE2 3B94A 1HN1A 3M2MA 1X8EA 4OHVA 1SFPA 3PDQA 1HN0A 2QQWA 3L2YA 1UY0A 1OA2A 5A7NA 4K8FA 5A70A 3LDKA 2P37A 1YIPA 2YBSA 4MO3M 3ACIA 4D3WA 3D6EA 1CJDA 2WSUA 1ZZ9A 2C4XA 3DV8A 3EO6A 4JTNA 3UV9A 1W9YA 2BJSA 5FZ1A 5FZ8A 3W9AA 2WNUA 1GZWB 1NAEA 1MZ6A 1POV1 2RR12 2VZUA 1X33A 4G3YC 4JVAA 1RHI3 4CU9A 4MHUA 3MF9A 4XACA 2OZ6A 1G9BA 2XPJA 2UWBA 1JZ4A 2Z4FA 2RE9A 3NMBA 4NHYA 3OUHA 1Q8PA 3PIJA 4GQ7A 4MH0E 3WQBA 4DUVA 3PTRB 4IESA 4XMIA 3ES4A 5I0RA 1W99A 1S55A 1ZBA1 3ELNA 1K5MA 3PL0A 4PDWC 2UURA 2R0HA 3VDAA 4DRVA 2VGDA 3K4AA 1AXZA 1Z7S2 1G7YA 2MEV2 1DQ2A 1O8PA 1ULCA 5F6KA 2XBO3 4YW1A 2QQOA 2VE1A 1Q5OA 5KBFA 2DU0A 3NNFA 4NMIA 2W1WA 5EJZB 3VBHC 5ACA1 3WINE 3TEZA 2OPKA 5FPVA 4J6GA 2OS2A 3KHBA 4Y5TA 1QIQA 2R063 2YU2A 1W90A 1NQJA 2RM21 4UYBA 3VZMA 2GALA 2YGMA 3KGLA 3GJAA 1R082 3A22A 2J1VA 2GAUA 4JV4A 4W8JA 4PCRA 2BU9A 2HEYF 3J4UH 4LK7A 4M4RA 4CU7A 3LSEA 3THPA 4NIIA 2R043 3VBRB 2BTVC 1DU3D 2KA3A 4L99A 4TN7A 4Y24A 2OQ6A 1A8DA 1XNCA 1B09A 1N1YA 3AP4A 1QJX3 5I91A 4R8HA 4AEJA 1VALA 1EV13 4QHOA 4QM9A 4AI2A 4CEYA 1HXS3 1E57A 3MHZA 3JBG2 1EAH3 1RUE1 4JZRA 5HCBA 3UJQA 2A3WA 2QQLA 4E4HA 5FP8A 5JMCA 1GP6A 2E53A 4MGSA 4XFFA 2PQSA 3VZNA 3SXWA 5AFEA 4CE8A 4LK6A 1E5HA 4XBQA 4LKEA 1FX5A 1UKGA 2ARCA 3NV4A 5C7GA 3PVOA 3MIBA 4GULA 1LJ7A 3POSA 5BNPB 1V6MA 3O7OA 1QDOA 1V6LA 1D4M2 5EHDA 3VKFC 1W6PA 4GIQA 3WDUA 1N47A 1WCUA 3ZFGA 4DPNA 2BYVE 2VUJA 5GZGA 4XQWA 2BNNA 3ATGA 3UGFA 3IZOA 2ES3A 1JU3A 2K9ZA 2RS52 2VXRA 2P1BA 4HSJA 2XVLA 2ZX2A 3OGVA 2B46X 5C3QA 5IFPA 3B3QE 4LO5B 2J1TA 2ZPXA 3IMNA 3OBRA 4QMAA 3RWNA 4J1WA 5A32B 1A8MA 3K2OA 1GWKA 2VNOA 3RRDA 3ZSLA 2QQKA 4FPOB 4EN9B 4BMBA 5FZFA 1JH5A 4HANA 1A6CA 3U0ZA 1OC1A 4XHBA 5A1FA 1OFSA 3BTAA 2WFF2 3OPTA 3DGTA 1VBC3 4LMFA 2QQIA 3I4IA 4KWUA 5LA9A 5A6XA 5DUUA 2K0GA 4RHV2 4DINB 5LCWL 1W8FA 5FR3A 4ASKA 2RMU2 3AL6A 4JGZA 4OHWA 2ADEA 2W87A 4V2WA 3OGJA 2BRTA 1PX4A 3FFZA 4Q4Y1 4QM8A 2XG3A 2W46A 5FK8A 1HQNA 2VUDA 4HBNA 2ERFA 3RI9A 3U11A 1WBFA 4IV3B 5KXDA 1RUD3 4CXXA 2FBEA 3NWKA 1BZWA 3RZGA 2WBKA 3OGRA 4DXSA 1ZNPA 3RJ2X 3U78A 1NCQB 4FP2A 2W91A 1BYHA 1SCRA 1JN2P 1VAKA 5JWPA 3J8F1 3O0WA 4KBZA 1XYOA 2YZ4A 3VKMA 2ZGRA 1CZSA 4HXCA 2OW4A 1S0EA 3PMEA 1AHSA 1OLQA 2AACA 3BTXA 2D6MA 2VQ0A 3ZFEA 4ISRA 3S57A 2BZDA 1POV0 2J1AA 1MS0A 3ZN6A 4OCTA 4K3UA 2VOKA 2VL4A 1KDMA 1YQ5A 3LEKA 4IEZA 4WM7B 5LY1A 4H3WA 2GNDA 2H6BA 2PHTA 3ILRA 4Q0SA 5EP9A 4O7XA 3ZYBA 3T0BA 2PHUA 4QQLA 4ITCA 2ZX1A 4HPKA 4PF1A 2G19A 5IVEA 1IPSA 1RUJ3 2R7EB 5LK7B 2BQPA 3NAPA 2RJLA 4FPHA 5F9TA 5HV4A 4HFSA 4CP2A 4P5YA 4EQVA 4XJZA 2Q8CA 2KM2A 3ETPA 3MUZ1 2I74A 2Z42A 4ASLA 1BK1A 2Q1FA 3APBA 3LIHA 4LA3A 2JICA 4XYXA 1OKOA 3ACFA 3T2QA 2CY6A 2N7GA 3NV2A 2A75A 5FV3A 4DRRA 4ZU5A 3JD72 2D6PA 4PIZA 2HWB3 1BJQA 3N9PA 5FYIA 1W8OA 2EIEA 1RUE2 2VCAA 4W65A 3PHMA 5A3WA 1DP0A 3H9AA 1ZRFA 1DGWX 1VE0A 4AEKA 1LU2A 1QH7A 3JB8A 3J7MA 5IJRA 4UW6A 3IIAA 3KV9A 2G1MA 1ENRA 1SMVA 5A3TA 3F95A 1CAUB 4AGGA 1VRH3 2D3RA 3AKPA 3BVCA 5GLTA 3CJIC 2FDGA 2WZR1 2P34A 2R32A 1AR93 4LOSA 2Q8DA 1AR73 4K8RB 1PO13 3BUCA 1BXHA 1OPMA 4CXWA 4QWNA 3AZVA 1MACA 5GKAC 1AF9A 4HK8A 2VD7A 4AL9A 1PVXA 1RL3A 5J1XA 3SH4A 3MGUA 1OOPB 2WNVC 2W94A 1UIJA 2FMDA 1H8TA 2YFUA 1O5UA 3AYEA 2C0ZA 3JQWA 4IGOA 4PIXA 3WV6A 4COZA 2L9LA 3OEAA 4YW4A 5HV0A 1DYKA 3PTYA 2E33A 4CSWA 5D2AA 3NW4A 3OJBA 2QTWB 4MZUA 4CCDA 4URTA 3Q8FA 1XU2A 1L3JA 3FUQA 1POV3 5T5LA 3HQUA 1APNA 3TEWA 2YU1A 2VOTA 1RUH1 4Y1XA 1JMUB 1PHMA 2JWPA 4JQRA 4I30A 3SCHA 5A3OA 4BJ0A 1O4YA 4XDPA 1ZBA3 3POYA 2PYTA 2WNOA 3QD6A 1K5JA 3DXTA 3RG0A 3E5QA 2XJUA 3PNAA 1F15A 2WJSA 2OX0A 2ZS6B 2HJIA 4P14A 3VBRA 4LQRA 1PGL1 2JDPA 1OOPC 3O1TA 2X5IC 3LA3A 2FDFA 1G9CA 3WP3A 5JLVA 3Q8AA 2HWC1 3I2FA 4WVVA 5T55A 1GANA 3ACLA 4C1WA 5C4WB 5ACA3 1NLRA 4NWWA 2CL2A 2PQQA 1W39A 4GMP1 1XSQA 4XF3A 2FDIA 2RM23 2B8MA 4QXCA 2GMPA 2XH6A 1A3KA 3AFKA 2D40A 4A7KA 3KT1A 1QJY2 5A7PA 3LEGA 3C8XA 1N1TA 1C8M3 5LA2A 1AX0A 2B39A 3D4KA 3BU7A 2A6YA 5SV5A 5SV8A 3ZXEA 3VZOA 5FY4A 3KB5A 5TSWA 5JXIA 1JYXA 3I97A 4MSVA 4ES8A 3QBQA 4Q0UA 2BERA 5DZGA 5A3PA 2GC3A 3VB9A 4IEVA 4P9WA 4AG4A 2VMHA 1SLLA 5CFDA 1B35C 3ZFFC 3KCCA 1RUC1 3KS7A 3LE0A 4P9XA 4AR2A 5C4WC 1OLRA 4GKXA 5BV6A 1IKQA 4NOTA 3N35A 5DZEA 2C24A 4WM8C 3SITA 1GR3A 2XWBB 1FV3A 2VQUA 4LBJA 1UY2A 3OYWB 5A7OA 2Q5TA 1AX2A 1ZBE2 1FMD1 1H1IA 5EIYB 3WEZA 4WVWA 2YGLA 1SBFA 4QQOA 4UFLA 1RYYA 1TME1 1UQXA 3GNEA 4LO4B 3VZLA 4BMEA 3R05A 2JE8A 4OUSA 5C9AC 1NXD1 2PHLA 2IC1A 3LFIA 5I8YA 4NHXA 3IAQA 4Y3OA 3ZMOA 5KC5A 3GZEA 3GHMA 5EXOA 3B02A 4RR3A 2ZABA 5IAVA 4INDA 4G4FA 4AHXA 3AKTA 2NYYA 1L7LA 3BALA 4C1XA 1OLME 4IV3A 1RUNA 1UO9A 2VMGA 1ACCA 3MW2A 4FPKA 1DYPA 3I8TA 3VV1A 5K0UB 3BB6A 4GWJA 1H8VA 4NR1A 2BGCA 1Q8VA 1NCQA 4YPJA 2WDBA 4LR4A 4CEWB 4XIKA 3H50A 4XABA 3I3EA 4YZ3A 1GICA 4DFSA 5GLVA 4CP1A 1PX3A 4XXAA 5KHJA 4LLFA 2O1QA 4R9AA 1IS4A 4Q4Y3 3T0AA 5FREA 2DCKA 1STMA 5FMOL 2J1UA 4YVSB 3JB4C 5DAXA 5L73A 4Y4RA 1LRHA 5FYMA 3IPVB 1HRI2 4G9SB 4YZ2A 2RS11 3DYMA 2Q8EA 2EIBA 2ZEWA 3GZTB 4JTOA 4YGDA 4R9CA 1X8MA 4CRQA 1FXZA 1UY4A 5C6CA 2A6VA 1UU4A 4LBQA 4ASMB 3N36A 1WWYA 1SG3A 2BGPA 3KV5A 3J8F3 4FI9A 4YGEA 5BY5A 4FTEA 2Y64A 3AM2A 4CDWB 2DCJA 2W5FA 3D8CA 3KWVA 4JRLA 4RFRB 2W0XA 1WCKA 4Q4W2 2XUEA 3O12A 5CKMA 3OEBA 1JYVA 3KSCA 5JIUA 4IEPA 2XJRA 4SLIA 5LATA 2NMOA 4IXLA 2DV9A 4LPLA 1MS3A 2ZHNA 1WW5A 3SCGA 4YM2A 4OLLA 4RS5A 5CVRA 1PGL2 4Z1VA 1QJZA 1CZTA 3AKRA 3DYOA 2P3IA 4QKDA 5JXHA 1WLDA 2V73A 3I3BA 1REEA 2YG0A 3VHOA 2R1BA 4FT8A 4Y5Z0 4QHZA 2JE9A 3WF4A 3HPNA 3K77A 5F37A 2DYCA 4M3CB 4K1YA 3WNLA 3DYPA 4KBBA 1R1A1 2NM1A 1IZ3A 1JYWA 1YFUA 5C70A 4N53B 1GQGA 1VMJA 1GFF2 4ATEA 4YVWA 4M4PA 4FOYA 1R093 4ORFA 2Y0IA 1UL9A 5E89A 1WCSA 2VMCA 5FJKA 1LULA 3WF2A 4Z2WA 2GN3A 3TN92 5J7MA 4GMP0 5FY8A 4FXKB 1GP4A 4IV1A 4XXPA 1OQ1A 3LPGA 1V6IA 5C3RA 5BNNA 2A73B 2HWD1 4BQ5A 2CTVA 3K46A 1WD4A 3W5NA 1TMF2 3I54A 4I0BA 1LOGA 1W2AX 3S7IA 2WYSA 2A1XA 4MGTA 4Q4V1 3ZYIB 5FOJB 4JGYA 1Y7BA 2BGOA 4XJAA 2DURA 3E6BA 3NV3A 3RFRA 4GZ9A 1ULPA 2PHRA 4N9HA 4NIHA 1W6QA 1V6KA 2D5HA 4QXKA 3TNQA 4W50A 4HSLA 4YW3A 2JG9B 2KR2A 5F32A 3VN4A 3WF0A 4E27A 2VZ1A 3IKWA 1BEV1 3MDPA 2WZR3 1S0FA 5FZMA 1W8UA 3POEA 4RYDA 2CV6A 1KXGA 4XILA 3HNBM 4CCLA 4UFMA 1RVF1 1AL22 1OVSA 2RV9A 4XOGA 2YDEA 4Y1YA 5JOZA 2VQTA 2YXSA 1Y43B 1YFYA 4IEOA 5JAXA 5T3NA 1XBFA 2ZGLA 1UNBA 2JG8B 2WQZC 3V0AA 3PU3A 3OY8B 2RS32 4UF0A 4BK5A 4V1PA 4NAMA 3FX3A 3VD3A 2JG9C 4HKOA 1RUH3 1W9SA 4B4RA 4BH9A 3VBUB 5KXEA 2JENA 3HVDA 5FJHA 5IK7A 2WS91 4CTEA 2DU1A 3LCPA 1V9U1 5JOYA 1XE8A 1TNFA 2AEZA 2QDRA 5FXXA 4Z2AA 5CZKA 4AFCA 3SHRA 1DQ4A 2J42A 2XUMA 4L11A 4AFAA 3LF7A 2VR4A 2YPDA 3Q8BA 4H14A 1KD7A 4M3CE 2WWJA 4ZONA 4BPZA 1UU6A 2VMIA 3IDAA 1WBLA 5JCTA 3FBMA 2VVDA 4FCAA 1SCSA 4JHTA 1IPKA 2HWC3 5FZOB 4TWTA 5LRSA 1W2OA 4FPGA 1S4CA 1PZ8A 2EXIA 2AYHA 4IW3A 1H2NA 4P9GA 4JKLA 1HQWA 1FOD2 2H0BA 1VBE1 3GBWA 3M3EA 4GMP3 5DQ0A 5BNOA 1MQTB 2CSGA 4UXAA 4QPWA 5D8AB 4CUBA 4ISQA 4Q8LA 4NHMA 5FY5A 2OIIA 3CL1A 1D7PM 4GWNA 1SPPA 3UJOA 4Y26A 3POJA 2RR11 5FYZA 5DUWA 4BDVB 1ZYBA 4U36A 4IE5A 5FYVA 3POBA 3RZHA 4XF0A 2QQNA 5CG9A 5LEKA 3N7KA 1D0GA 1V00A 2VMFA 1UY1A 2E7TA 3NRUA 1ND3B 1EUTA 1RUC3 2W47A 2R16A 3SEEA 4BK4A 1H2MA 2DVAA 3MI8A 1WMDA 2WRAA 3E5XA 5CYYA 3SNMA 3A7QA 3MLLA 5HXVA 2GNTA 4XETA 1ZZ8A 2Z2SB 4MGYE 1WCQA 1Z7S1 4YLZA 2MEV1 4O9GA 3ZPYA 4DS0A 2QQMA 3KHCA 1MQTC 3PUHA 3VKOA 1H30A 5F3GA 4LA2A 5KWRA 4N8MA 4HK9A 1ENSA 4WZFA 2WIIB 3K51A 3LZZA 1FMD3 3I3MA 4OUEA 1NUKA 4AGRA 2EIGA 3AYCA 4E4SA 5CA6A 3KF5A 4QDQA 1TME3 4LO7A 4CEWA 1VMFA 4CEYC 1R081 2ZX4A 3GBFA 3RZMA 5A3LA 3HNMA 1JHJA 3N3HA 3THDA 5C3PA 3QH7A 2HWD2 1OKQA 5FPAA 4R52A 3VDDB 4OI2A 4D7YA 2WN2A 1XC6A 4P02B 5FWJA 5C33A 1PK6B 3LD8A 4PJYA 4NPLA 5FPBA 4FSJA 2EALA 3ZX7A 2CGOA 1LEMA 1N1SA 3AP9A 3FLRA 4IE4A 3T30A 1P8JA 3MLKA 2B5HA 2UY9A 1XNAA 2X09A 4XCAA 2ADDA 3VBFB 1A78A 2ZCWA 5A7WB 2ZEYA 4LJHA 1VBA3 3H8UA 5FZBA 4D0QA 4AEDB 4PBPA 1CONA 1PVC2 1RVF2 5IHRA 5ABJC 1QQP3 3UKNA 1JZ2A 2Z79A 1D4M1 1QHDA 2PLV2 3VZKA 4Q1PA 1F31A 1FT9A 1LOFA 5JZGB 2DDUA 2AUYA 5DAPA 2W3JA 2XVGA 2XOMA 1KJLA 5J36A 3RVHA 5FBJA 4UWDA 2RS13 2RS51 2RDRA 2V4VA 3L9JT 1OQEA 4IGPA 3I2JA 5GALA 1W6MA 4Q5OA 5APAA 1F9KA 2OPWA 1NLQA 2DTYA 4FTBA 3FN9A 2Q1MA 5FTTC 1HB1A 3HN3A 2OUHA 3BI3A 2WL1A 4LUMA 3AVRA 1QU0A 1LNSA 2WKKA 2Y6KA 3M7AA 4ZU4A 4H7LA 1CX4A 3SMHA 3WDTA 5GLUA 2PAKA 5F3EA 4CCJA 2VUCA 3USUA 3LA2A 4XFHA 3INAA 3PU8A 4BQWA 5IK5A 5FWEA 3EYPA 1V9U2 3USSA 5FMDA 3S0MA 5CADA 4JQTA 3ZXKA 1ULFA 5E1RA 3WNOA 4GWIA 3MO4A 1OXCA 2WFF1 4CCOA 5FRAA 3VBSB 4LXLA 2XKOA 4DUWA 1EY2A 5FPXA 1S2KA 1S0GA 1LENA 1BCXA 4OI0A 3RMXA 1KGYA 4RHV1 1O8SA 2YMZA 2J1SA 1WA4A 2D6LX 5FP7A 1RJ8A 1E5IA 2RMU1 4NJ4A 3T1LA 4PDWB 3LDRA 4JDNA 2JJ6A 3FMGA 1KS4A 3FHAA 5JPNB 1AYN2 3KD4A 1UAIA 2V72A 4KNCA 1FNZA 1LESA 4LULA 4XFGA 5FZ4A 1R1A3 2B9UA 2DWRA 4LKSA 4I3PA 4CDXA 3NJVA 4PLNA 4IERA 3VBHB 4AGVA 4DUXA 4DEVA 1ZA7A 3FC0A 2O14A 2FMYA 4Q0VA 4K7JA 4GD4A 3KZ4C 2YFZA 2CHHA 3ZFEC 4RQPA 1YJLA 5C3OA 2ET7A 5IAXA 1GQPA 2EA7A 2ID4A 3AP5A 3A23A 3VBSC 2TNFA 4O61A 2XXZA 1CPMA 5FK7A 4N7UA 5DXDA 4MGKE 4OHXA 3AFGA 1CGPA 1CIYA 1MEC2 1TZOA 3ZLIA 5GLZA 1TQ5A 4I0WB 2D3SA 3H3LA 5FMOS 4AXOA 4DEQA 4UOJA 1NA1A 4Q4V3 5DN2A 3FUOA 2QKDA 3OY8A 2YC0A 4C90A 4QX5A 1MPXA 3AXDA 1BK0A 1O5LA 2EIDA 3HN1A 4A45A 4IEWA 2IXHA 4HKWA 1BEV3 5J96B 4PT6A 3HD8B 5EWSA 1W6NB 2B9VA 5K8SA 2DUQA 3H8OA 1M4WA 5GM0A 3ZXLA 1SLIA 1ULDA 2PMWB 3VKNA 4QGMA 3N4MA 3MLJA 3CF6E 1X7NA 3MFAA 1O7FA 3LEMA 1V6JA 2D5FA 2B45X 2XHNA 2O8QA 4GB32 3AMQA 3PJQA 4YYOA 4L8QA 4WVMA 2Q1ZB 3SKVA 2W92A 1UYPA 2XLAA 3M1HA 1BLZA 4CDUB 4B3NA 3JD71 4RN5A 3KCYA 2H6CA 1C28A 2YV8A 2CNAA 4PI0A 1RC6A 2BW8A 1RUI3 1W8NA 2Y6GA 3TB0A 1V70A 2ZX3A 1KRIA 1YHFA 4QXBA 1ZZCA 4I01A 2JDNA 4IUGA 2WS93 4N43A 5DDJ2 3WHUA 1V9U3 3ZDSA 4TZDA 3BODA 3ENRA 4GH4B 1QDCA 4AW7A 5D21A 2R072 2CYFA 2W52A 2FHRA 2ZHKA 3FZ3A 3J7HA 5D8AA 5H9QA 1XPWA 4UW3A 4BOWA 1CAVB 1F2NA 2VM9A 4AYUA 4BQ1A 3RQ0A 1AUYA 2JX9A 3H8RA 1X9TA 3WG4A 1UZ0A 1DG6A 1H8TC 1QMJA 1YRZA 2LROA 4QHBA 3LFMA 3S5AA 4FXGB 2IXKA 4MV2A 4CDUC 2X29A 1CWPA 1U5XA 1QJU3 1VBE3 1FI2A 2HH9A 5FXWA 5IFTA 1LECA 2ZGQA 4ARYA 5CFCC 3I2KA 5FYTA 2P3YA 3MYXA 2BWCA 4YZ5A 5KHGA 2K2SA 2OT7A 3O14A 3DEMA 3BTZA 2Q0AA 3I59B 1QOSA 3VBOC 1ASJ2 3SISA 2RJKA 1GNZA 4GH4C 5JSRA 3UGGA 4YZ4A 4HOOA 3WDXA 1AR82 1C8NA 3LKJA 5FLJA 2RR13 2UU8A 1JU4A 4XFIA 5L7OC 4QPGA 3OG2A 4XAAA 4HL0A 3AX4A 1EUUA 1NCRA 3R4DB 1VB4A 1BMV2 4XUOA 1Y4WA 4HVQA 1OF4A 2YB7A 4COUA 4ZY9A 1J3QA 4AWDA 2RVAA 1CR7A 4MXWB 2VMDA 5EJ3A 3OGSA 3AXEA 3VDDA 4C91A 1Z7S3 2P3JA 2MEV3 2DUPA 1LHUA 3DPRA 3TEXA 1QKQA 2WT2A 3MICA 3BGAA 1JTZX 1NX9A 5GZFA 3ZR6A 2VAUA 2YPJA 2G4IA 1KDKA 1VMHA 5IVVA 2MPFA 3KVBA 2VCBA 2GP5A 4FPJA 5J48A 4NN0A 4E4ZA 1DQ0A 2YHJA 5A7WA 1NE6A 1R083 5IVJA 1QJY1 4Y33A 1SEFA 2D97A 2XQXA 5CFDC 3K4DA 1OA4A 3A21A 4BZ4A 3ZXFA 2AEYA 4CU6A 4QB1A 3T2TA 2JB8A 5DAVA 2YBKA 3AP6A 1H4HA 2CWSA 2WO1A 2RHPA 3LEIA 3EJKA 2A5ZA 3RSJA 1TNRA 1E5RA 3JBG3 5C8CA 4XFCA 2ZACA 5FMBA 2Y38A 5FY0A 4LBQD 1ALYA 2VVFA 3KT4A 2VZTA 4X6RB 3W21A 1W9WA 2QVSB 3Q9OA 4K21A 4X8NA 1CIWA 5FQ0B 5EYYA 5JXJA 4A7ZA 2VU9A 2ZA9A 4Q4X2 1FATA 1CAXA 2VNVA 1W06A 1D4M3 1SACA 4NPRA 3IIIA 2VZSA 3CJIB 5F1RA 1GV9A 1FPN1 3H1WA 1ZBE1 2J22A 1CVNA 1YLLA 4FP3A 4PBOA 3HWJA 2DF7A 1GYKA 2YBPA 4RR3C 2LUWA 3RZZA 1GKBA 2RS53 2BV4A 5E8AA 1Q8SA 1IS5A 2IUWA 3ILNA 1S0BA 5IUQA 4B29A 1ULOA 4BIOA 1G9DA 1ENQA 1DDLA 4M01A 2JD9A 1HV1A 4PDWA 3O5SA 2WNVB 3WCRA 2WR9A 5E16A 5F6LB 1UPSA 4YM1A 3FJSA 5C3SA 3WNNA 5EFUA 3JXSA 3OUIA 3RZLA 3UGHA 3B69A 2I2SA 5IWFA 5FZEA 1IG3A 3T2PA 3ZXJA 4ES9A 4NIDA 4MYEA 1DBNA 1UY3A 4LEJA 1O3SA 1UYYA 3H8XA 2F4LA 1IOAA 2QNKA 2WZ8A 1JOPA 2IVIB 2P5BA 3DECA 4IE0A 2WFF3 3VBHA 4F8AA 4FAHA 3IM0A 4BB3A 3FLTA 4LUKA 4RL7A 4U2AA 2VVEA 3CZJA 4X6QB 1SLAA 3Q8CA 3KM5A 1GZWA 4A44A 1KFUL 1ND2B 1MS1A 1WLWA 4RHV3 4KWKA 3ASIA 3WF1A 4D94A 2RMU3 2TUNA 3T09A 3M4FA 2GP3A 5GLWA 2R1DA 2ZMNA 3UESA 2QDNA 4ARXA 3B5LB 1K12A 4BISA 4XQDA 2Y6FA 4R9BA 1N3OA 3HQRA 2X5IB 5FCCA 3VUOA 1HRI1 2PTMA 3CLPA 5I0UA 5KC6A 3I49A 5KHKA 4FOWA 3RMYA 3W20A 5F39A 4F7ZA 5H9PA 2BNOA 2BUKA 2XJVA 1QWRA 5IVYA 1JYCA 2IXCA 4UI9L 4RS5C 2D6KA 4F3JA 2NP0A 2KD7A 5KXCA 4OZOA 5JMOA 3OCPA 4Q4W1 4UW5A 1J83A 2E6VA 1ND2C 2JDAA 1RUF2 1U5YA 4XTPA 3ZXAC 3GBGA 4QKFA 1W0PA 1J3RA 5GZDA 2VJXA 5IK4A 1GWLA 1YEWA 4YZ1A 2ZZJA 3FFQA 3CNAA 2JXAA 4R4XA 1WZXA 3LSDA 1XNDA 4URAA 3LA7A 4XE9A 1JZ6A 1JBCA 3N7MA 4PLMA 3WF3A 5AFBA 2QFEA 5HI0A 2AREA 1B35B 4XJUA 3ZFFB 1BVVA 4UFIA 2SLIA 5DABA 3MF6A 2ZGUA 3U1XA 4YRDA 1I1EA 3B00A 3ZYJB 2WN3A 1QOTA 2W1QA 2QQPA 2BVVA 1A34A 2UWCA 1SBEA 4WM8B 1OFNA 4FFIA 1HX6A 4YW5A 5FP3A 3FBYA 3UYJA 3C3VA 4CDQC 2OA2A 2FCUA 3DKWA 4KU7A 4AFMA 2QZ2A 4QPIC 5ERLA 4YSFA 4YWAA 4FOVA 5F5QA 5BNNC 2WZEA 4D8MA 4HONA 2Y6JA 3M70A 4P9JA 5BNPA 3HIFA 2VZVA 4P00B 3VD9A 3RZJA 3AMHA 1Z78A 1ULGA 2FDKA 2GC0A 3TN91 4ZS2A 3NKTA 1OA3A 5C9AB 3JD73 3MFCA 4IEQA 5A1AA 2Q30A 4J25A 3WW2A 4FPLA 5JUVA 1PO21 5FYHA 1RUE3 1TMF1 3C7HA 4QKBA 3VGIA 1VR3A 3O0XA 2GN7A 1SFNA 3B01A 4I2OA 3QLQA 3VKLA 3GJBA 2XR4A 1GP5A 3BPZA 5I8TA 3RYKA 5A32A 1WA6X 3AZWA 2HWF2 5FYYA 1JZ5A 5A6YA 2VW1A 2E9QA 2VTXA 4FAGA 2GC1A 5IVBA 4MHRA 2D93A 5J37A 5F5CA 4BQXA 1FPN2 5CEHA 3MZHA 5FFOC 2ZEXA 3ORJA 4YG0A 1AL21 4E2GA 3LIGA 1DLLA 3WR0A 3WP4A 5B4XA 5CAZA 2ZXQA 1ZZ7A 1PGW2 2JEMA 3C7GA 4P5HA 4CP9B 5AC92 5HPOA 4S2DA 2HEVF 4QU2A 4GJZA 3NVCA 1HJFA 1J58A 5LB6A 3BTYA 1XYNA 4YGCA 5DG2A 1KJRA 2RS31 4MGQA 4EJRA 3IDBB 2VC9A 3GZUC 2C9KA 1Z0HA 3HMYA 2P17A 3LOBA 1UPIA 1W0NA 1I5ZA 3IBMA 2XL7A 2SBAA 5A33B 3POIA 5FLIA 3LDBA 5FZLA 5E88A 3B7MA 4W4ZA 1CQ9A 1JYNA 1VBB2 3U07A 2VZRA 1AR62 1HRV2 3I2IA 2ZZQA 5FMCA 1XNKA 1QY4A 1UMIA 5F3IA 1W2TA 4XC9A 4ZS3A 4XTMA 1U5IA 4MG2A 2VOWA 3N7LA 4BM8A 1HIXA 1F5FA 3I3QA 1IS3A 5BNOC 2JKXA 3BKZA 4UT5A 4DXTA 5F5IA 1LGCA 4NHKA 2D44A 3AL5A 1LGNA 1US2A 2IZWA 2XJQA 3VD4A 3KQRA 5HCFA 4YM0A 3A4UA 4NVPA 2HWE2 1CJPA 3CKHA 4WM7A 2DBIA 2ZGSA 2LM3A 3BYWA 4XPVA 1JOJA 3RS6A 1FOD1 4N9IA 3WUDA 4OI4A 1S1AA 3E6CC 1RMU2 1YNAA 2ZKNA 5K9YA 1LTEA 5FQ0A 4LLOA 3WY6A 3NL1A 4A41A 1RTVA 5JI9A 3ZDVA 1QJY3 3ZOIA 3I7DA 1VB2A 3UK9A 1AVBA 2F6BA 4ET7A 3ES1A 2X05A 4HG6B 2LALA 5CKNA 3H3ZA 4QB6A 4B7KA 2D6OX 2H0VA 3OPZA 1PM7A 5J98B 1YYNA 3AC0A 3N9NA 1WCDJ 2V5YA 3BOWA 2QJVA 4H55A 4TLFA 5E6HA 1LCLA 1BBT2 3CJXA 1MS8A 2WQ8A 5T54A 2BPA2 2ZGNA 1JI6A 4D6RA 4META 5GZEA 4CUCA 1LKNA 4YG6A 4AVBA 5JXGA 1JXNA 1S2BA 3AMPA 2R49A 2D7FA 3FWEA 3B9CA 4NWVA 1WMXA 3WX5A 2MHFA 3AK0A 4EV0A 1QXRA 4HN1A 5CISA 1ZBE3 1COV2 5G05L 1Y9QA 1CAUA 1AZDA 5B4NA 1QXPA 5BXXA 1XQNA 1NKGA 3D0JA 3VZJA 2O8OA 2HBUA 4UAPA 2VQAA 3DKQA 4Z8BA 1RUG2 2A3YA 4LITA 4QX0A 1PIV2 5DPNA 5J3UA 1LHWA 1PO22 1Q8QA 3FHIB 4OULA 4D6QA 5IVCA 2AH2A 2FZ1A 2FCTA 1G8WA 1RXFA 1YQ6A 5JSOA 5FYSA 4B4PA 3AVSA 3ZN4A 1GWMA 4JKKA 1VLNA 4Y5SA 1I3HA 1OOPA 5C71A 3AP7A 3AJZA 2FCVA 3OF1A 3EHKA 3WXPA 5C8WA 2QUOA 3AYAA 4ZKTB 3DCQA 2OVUA 3WVJA 2CU5A 4CU8A 2K46A 2UWAA 4Q1RA 4SBVA 3CHXA 5FZCA 2EICA 1I6XA 4AHYA 4TLGA 3RGBA 1PVC1 4S2GA 3UETA 4GJYA 2QZ3A 1IG0A 3CBNA 3AMMA 2PLV1 3JQXA 5G04L 1JUHA 2AGSA 3OSDA 4DXZA 5JI7A 4N90A 1J84A 1OLMA 2LW8A 2VW2A 1JZ7A 3AZZA 2W1UA 2TBVA 3WG1A 5KXBA 3BIWE 1K45A 4FTSA 1DFQA 1HRI3 2DVGA 5BUVA 3MV11 2XBO1 3UL2A 3U4XA 3R4SA 4XF9A 1DQ6A 5FOBB 1B35A 5DZFA 2BP6A 3R0RA 2ZX0A 5C4WA 1Y9MA 2UYAA 5FZ3A 1GUIA 1H2LA 4NO4A 3O1UA 3NV1A 4JCKA 1MZ5A 4WM8A 4ZU7A 4EN0A 1QJFA 2IXIA 4Q4W3 1LOEA 1QH6A 3ZSEA 3I2HA 2E32A 1E5SA 3N9MA 3K3NA 4B7EA 1S0IA 3IMMA 3MEPA 5FDBA 1W6OB 4NAOA 1O4TA 3VHNA 3UKVA 4AVAA 3NNJA 5FKBA 3LOIA 2V4AA 3M3IA 4CDXC 1GQHA 4QX3A 2YUEA 2DCYA 1X82A 4BXSV 5C9AA 1EV11 4K9SA 1AYM1 3K48A 4M3CF 1GLHA 4UW4A 2VOVA 1AYN1 2WNUC 4QQ2A 4WBBA 4OZXA 1UU5A 5BPXA 4YW2A 4AEMA 3O1PA 2P3KA 3M3QA 1H1AA 2ZKLA 1J1LA 1XNTA 1FNYA 1XYPA 1UXXX 1YC61 1LHNA 1PMHX 4LBNA 4CUGA 4E2SA 2ATFA 3CO2A 1W03A 5C5UA 1K5MC 3OYWA 2OUJA 2W9XA 3U4SA 4HMZA 1NA1C 1DZQA 3QCWA 3TN93 3VL9A 5A3NA 3H42B 2VTFA 1XRUA 2XWJB 3PLQA 4EN7B 4CEYB 4EWAA 2UYBA 2W95A 1KS5A 2LRPA 4PF5A 1MEC1 1TMF3 3HR9A 4HKLA 1NE4A 4LNVA 2E31A 1LOCA 4E2QA 1SHWB 4AF9A 1NXMA 5CKQA 2P2KA 1DQ1A 2RDSA 1YWKA 3LQCA 1W6PB 1CD3G 3WLUA 3IT8A 3J9SA 2VOXA 1IGOA 2JE7A 1OBNA 3KT7A 3KGZA 2BDRA 3ON7A 2P6CA 1AL23 5K0UA 1JYIA 1UW8A 2YROA 2ZBJA 4IEUA 1VBC1 2PFWA 2W08A 4RGGA 4XCBA 5JR7B 3I2OA 4LT5A 3P3NA 5ABJB 1VBD2 1S2EA 1GU3A 1FYUA 4QXHA 2BVBA 1KQRA 4EE2A 2XB6C 4GB31 2AR6A 2Y26A 2VNGA 1TEIA 2RS33 2C6SA 4N43C 2WZPP 2ZTNA 4YVSA 5A6QA 2IWGB 5GZCA 4RA0A 4F83A 2MNGA 3A0NA 4N7IA 1N3QA 5I0DA 5EJ1B 3IPVA 4KL1A 2E26A 2GH2A 3DL3A 4O9EA 3WNXA 3POFA 3ZFGC 1SLTA 4EN8B 1LU1A 1PNGA 4L9BA 4LBMA 1ONAA 3RYRA 2PHWA 4L97A 5DDJ1 5ANNA 4ATFA 4BIFA 1RHI2 5GJ6A 5FPUA 1SFYA 1HB3A 2HBTA 2R071 4CDWA 4KGGA 3TBDA 1XU1A 1I5PA 2VECA 4AQ6A 3KLSA 4EZ4A 1W28A 2J1EA 4MGZE 1NZIA 3L2HA 4DB5A 1OSGA 2PAEA 1OI6A 3HBZA 5LBFA 2OYZA 3ZMNA 1QOOA 5FLHA 1VP6A 4MXVA 4BWOA 2RJ2A 1R64A 4E9KA 4A3XA 2XBO2 2VPVA 3WHTA 3NNGA 1FOD3 3CEWA 4NHLA 3HT1A 4DMIA 4OYUA 1UN1A 4D7SA 1MS9A 1Y9GA 4ZZ5A 5T5OA 2W2IA 1NCRC 4M3CA 1PMJX 2R062 3ZYGA 1ASJ1 3POWA 4OUMA 3IB3A 4R9DA 4CXYA 2D3PA 2PAMA 4A6SA 1O6UA 1H1MA 1WD3A 1AR81 4Q27A 4DY5A 4OHZA 4JGZC 2YC4A 1NY72 4N53A 3ZFEB 3O1SA 4OVEA 1LR5A 3ZN6B 1G9AA 2Y34A 4ONUA 5FO9B 2ENRA 2HLEA 2Y33A 2R042 4AQTA 4XZUG 2EAAA 2P6HA 4MX3A 4COVA 4BQYA 1BMV1 4GA9A 1QJX2 4UBHA 3KVAA 4MLOA 1EV12 1OVPA 3ME2A 1AYM2 1HXS2 4FVVA 4HPKB 4BLIA 1EAH2 3WQ7A 3GGLA 2DTWA 1BKZA 1CX1A 2WO3A 1K42A 3LGRA 4RSUA 3NAPB 3HOBA 3WG2A 3W5MA 2XL9A 3TRSB 4ZZ8A 5CG8A 3RWKX 3RYPA 3ZYPA 1UZWA 2VUAA 2EAKA 5LRRA 3PVBB 3AJYA 3WW4A 5HXMA 3AYDA 3PMSA 1O59A 5FYCA 3T2OA 1POQA 2NN8A 2JG9A 1HKDA 1WW7A 3CDZB 5FIXA 2GNBA 2YC2A 2JECA 1TG7A 2I45A 2W1SA 2W68A 3LPFA 5A3MA 3U75A 1PO11 1YUDA 5IT6A 5C8CC 5FZ6A 4A42A 3HT2A 2HWD3 2AENA 1H9WA 4M0HA 2DFBA 1N3PA 3VHPA 4P9IA 3ZSJA 3HNYM 2XJSA 2PN5A 1PZ7A 5F7UA 1UWWA 5JPMB 5T5PA 4FPCA 3ZKUA 4AQ2A 2JG8A 3RPQA 2FD8A 4Q8KA 1WKYA 1F8VA 3MV01 2VZOA 3T0DA 3NAPC 2QQUA 2QQVA 5BNQA 5F3CA 1O3TA 4BCUA 3WZ1A 5L9BA 1QEXA 4HETA 1ZM1A 3MUY1 3GHNA 2FDJA 4BXFA 1YFWA 1EPWA 1MZFA 1PVC3 1RVF3 1HJGA 4W6XA 1H0BA 3RJRA 4Q4X1 4QDSA 1H2KA 2F4PA 1VBC2 2IXJA 3VBUA 4CVUA 2PLV3 5FBZA 2XQRA 4PQ9A 5FO7B 3KV4A 2C1FA 4NE9A 1UCXA 4ZXEA 3MW4A 3EBRA 1F35A 1OURA 3N9OA 4S2FA 5CBLA 1DGLA 4BQ2A 1JS9A 2AC1A 1W6OA 1VAVA 4IE6A 1H8TB 2CAUA 2BOIA 3E1F1 1NLSA 1ZVFA 4LKFA 3V65A 1AJKA 1Q3EA 1RUD2 1UZZA 1CN1A 1U12A 3N9QA 4LBKA 2R6QA 3CMGA 3X29B 5FZOA 1GMMA 4PHZA 4QX7A 5T50A 1HV0A 3HBKA 4TXWA 4XJWA 3URFA 5CFCB 1L7RA 2XKPA 2OKXA 1C3HA 1IHMA 4BQ4A 2R0FA 3NJZA 1VRBA 3VBOB 1MQTA 3ILFA 1GNYA 2XJTA 4DNYA 3AKQA 5JDBA 1C5IA 1C8M1 1GNHA 1ZX5A 2WSVA 3RZKA 5KHIA 3PUQA 3OB8A 4DO0A 5L7OB 5FZDA 3QH6A 1W9FA 5D1IA 4A6OA 3H3UA 1LODA 3ECQA 2CGPA 1AYM3 3D82A 5FYBA 3SCFA 4GWMA 3ZVXA 1AYN3 4QQPA 1J3PA 1ND3A 3HJRA 3T1MA 3ZYHA 1OD3A 2HYKA 2WC2A 4LIUA 1C1FA 1XNBA 5FZAA 3O0VA 1GZ9A 2Q4SA 3RI8A 3EQEA 3UT0A 2JDUA 1C1LA 1DCSA 1RUJ2 2WINB 4XBLA 5C5TA 1SZBA 4XUNA 3O1OA 1UF2C 3WQ1A 4I0AA 5ISLA 3KQ4B 4KQ7A 3NJYA 5M0TA 3VBRC 4Q0PA 4BYYA 3ZN5A 2G9FA 1GOGA 5CFDB 5ABJA 1RUF1 1MEC3 1T6BX 3V56A 4QKNA 3JZVA 2VMEA 4YFWA 4RFT0 1S0CA 3ZPOA 2HWB2 2BEOA 2BBAA 3B93A 4PI2A 4YNIA 1RITA 3RDIA 1OF3A 4CYDA 1LAJA 4D6SA 4LKDA 1O3RA 1DF0A 1GBGA 1RIRA 1DLCA 1PK6A 1XE0A 4Y22B 5A7QA 4LTAA 3D3AA 4HT1T 4KG0A 4CZSA 5BNPC 2IFRA 2BBVA 1URXA 2ZEZA 1VRH2 1UYZA 5FAXA 5FUIA 4IDZA 4MVTA 5FZ7A 3TAYA 2HKXA 2QQJA 3I2DA 3N7JA 2VNRA 2JDMA 3D5OA 3VBFA 1AR92 5CIRA 1AR72 1GOHA 1QNYA 3SC7X 4YARA 3SLIA 3D0SA 1PO12 4AEDA 1M06G 2JDKA 4H7MA 2PELA 3VLBB 4LHKA 3JUUA 4GB33 3TYJA 5DMYA 4RR3B 3K4ZA 4YM3A 1JODA 1LHOA 5F8PA 5JZGA 4AI0A 2GC2A 3J26N 5J09A 4FFFA 4Y4YA 1W3XA 4NRQA 4AVTA 3ITQA 3FE5A 2RDNA 2WWSA 4RD7A 1OHFA 2VTXJ 3BPSA 3MW3A 1LEDA 1EP0A 3IAPA 5DDJ3 3NJXA 1YQCA 2XJPA 4P9LA 2ZGPA 1VIWB 3P6BA 2HWF1 1WLCA 1KEXA 2QE3A 2R073 3QOPA 2ZMKA 1VJ2A 4FFGA 4CPBA 4DIQA 4W6YA 5LBBA 3GZAA 3WQ0A 1J59A 1MVEA 3J7LA 4XVHA 1OD5A 1X50A 5EQUA 2ET1A 1ZBA2 1RUOA 3FL7A 3IWZA 2J1RA 4QB2A 4KMQA 3ZO0B 4CCEA 2ORXA 3VBSA 3SKJE 4AI9A 1UX6A 4IV3C 1IKPA 1PGW1 5AC91 3T3YA 4LBQB 5LBCA 4GAZA 3WDWA 2HYXA 3KCXA 1CAWB 5JOXA 1W05A 1ZRDA 4UFHA 5ACA2 4HZFA 3NNMA 1NCQC 4RGKA 5FY9A 1UOFA 1W2UA 3WNMA 2EF6A 4WZCA 4LO8A 1ASJ3 3U37A 2RM22 4QU1A 1JZ3A 3ZM8A 5L19A 1AR83 5FXZA 3DF0A 3O1VA 2OQ7A
chains in the Genus database with same CATH topology
3N9MA 3K3NA 5FZ4A 5IVYA 5FYZA 5LWBA 2W2IA 4BU2A 4CCNA 4QXCA 5FYVA 5FYBA 5LY2A 5A7PA 2XMLA 4LIUA 3OPWA 5F37A 5FZAA 5FPVA 5LY1A 4GD4A 2OS2A 5FY4A 2YU2A 4V2VA 3N9LA 2XXZA 5IVVA 4URAA 5FZGA 5A3PA 5IVEA 3KVBA 5A7SA 2GP5A 5KR7A 4EYUA 4EZHA 3ZLIA 3KVAA 5ISLA 5F3GA 2PXJA 5FJKA 5A7WA 3NJYA 3PUSA 5FYUA 4TN7A 3PUAA 5FY8A 4Y33A 5IVJA 2OQ6A 4CUGA 5FZ0A 3N9NA 2Q8CA 5FP3A 3UYJA 5E6HA 3U4SA 4XDOA 3ZPOA 5A3NA 2YBKA 3K3OA 4IGQA 5FP8A 4E4HA 5A7OA 4D6RA 4HONA 5FV3A 5FYCA 4D6SA 5F5AA 3N9PA 5FPAA 5FYIA 5FY0A 5A7QA 5FP4A 5FWJA 5A3WA 5F32A 5A1LA 3LD8A 5FPBA 5FZ6A 5FZMA 5FZ7A 5FUPA 5FZHA 4CCLA 3KV9A 5FYHA 4CCMA 5A3TA 4Y3OA 5FY1A 3PURA 3DXUA 5FP9A 5A80A 5ANQA 4LITA 5A7WB 5F3CA 5FYYA 5FZBA 2Q8DA 4D6QA 5IVFA 5IVCA 2YBPA 3PU3A 5LW9A 5FYSA 5FXVA 3AVSA 4QXHA 5IVBA 4QWNA 3K2OA 4QXBA 4UF0A 5F5CA 5FZKA 4BXFA 5CEHA 2VD7A 5K4LA 5FZFA 4UF0B 3RVHA 5FBJA 5FZ9A 3KV4A 4QX8A 4IGOA 5A1FA 3N9OA 4IGPA 3OPTA 5FJHA 5FZCA 4CSWA 5FZIA 5FZEA 5IWFA 4GJZA 2WWUA 4GJYA 5FXXA 4DIQA 3AVRA 2P5BA 4Y4RA 5FYMA 2YU1A 3PDQA 4ASKA 5F3EA 3AL6A 4CCJA 3KV6A 2YPDA 3N9QA 5F2SA 3PU8A 4V2WA 2WWJA 5A7NA 2Q8EA 5FWEA 2YBSA 5FZOA 4QX7A 5FPUA 5FXWA 4AI9A 5FZ1A 5FYTA 3LDBA 5FZLA 5FZ8A 5FY7A 4XDPA 4CCKA 3KV5A 2OT7A 5FZOB 4EZ4A 4LIVA 2GP3A 4CCOA 3DXTA 1VRBA 4LXLA 4GAZA 4BISA 4C8DA 2OX0A 5F2WA 2XUEA 4HOOA 5F3IA 3U78A 5FPLA 5FY9A 5FZ3A 3PTRB 5FP7A 3PUQA 4AAPA 4DO0A 4NUBA 5FZDA 5IW0A 4QU1A 5F39A 5F5IA 5FY5A 3AL5A 5FXZA 2OQ7A 2XDVA 5FUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9M A;  3K3N A;  5FZ4 A;  5IVY A;  5FYZ A;  5LWB A;  2W2I A;  4BU2 A;  4CCN A;  4QXC A;  5FYV A;  5FYB A;  5LY2 A;  5A7P A;  2XML A;  4LIU A;  3OPW A;  5F37 A;  5FZA A;  5FPV A;  5LY1 A;  4GD4 A;  2OS2 A;  5FY4 A;  2YU2 A;  4V2V A;  3N9L A;  2XXZ A;  5IVV A;  4URA A;  5FZG A;  5A3P A;  5IVE A;  3KVB A;  5A7S A;  2GP5 A;  5KR7 A;  4EYU A;  4EZH A;  3ZLI A;  3KVA A;  5ISL A;  5F3G A;  2PXJ A;  5FJK A;  5A7W A;  3NJY A;  3PUS A;  5FYU A;  4TN7 A;  3PUA A;  5FY8 A;  4Y33 A;  5IVJ A;  2OQ6 A;  4CUG A;  5FZ0 A;  3N9N A;  2Q8C A;  5FP3 A;  3UYJ A;  5E6H A;  3U4S A;  4XDO A;  3ZPO A;  5A3N A;  2YBK A;  3K3O A;  4IGQ A;  5FP8 A;  4E4H A;  5A7O A;  4D6R A;  4HON A;  5FV3 A;  5FYC A;  4D6S A;  5F5A A;  3N9P A;  5FPA A;  5FYI A;  5FY0 A;  5A7Q A;  5FP4 A;  5FWJ A;  5A3W A;  5F32 A;  5A1L A;  3LD8 A;  5FPB A;  5FZ6 A;  5FZM A;  5FZ7 A;  5FUP A;  5FZH A;  4CCL A;  3KV9 A;  5FYH A;  4CCM A;  5A3T A;  4Y3O A;  5FY1 A;  3PUR A;  3DXU A;  5FP9 A;  5A80 A;  5ANQ A;  4LIT A;  5A7W B;  5F3C A;  5FYY A;  5FZB A;  2Q8D A;  4D6Q A;  5IVF A;  5IVC A;  2YBP A;  3PU3 A;  5LW9 A;  5FYS A;  5FXV A;  3AVS A;  4QXH A;  5IVB A;  4QWN A;  3K2O A;  4QXB A;  4UF0 A;  5F5C A;  5FZK A;  4BXF A;  5CEH A;  2VD7 A;  5K4L A;  5FZF A;  4UF0 B;  3RVH A;  5FBJ A;  5FZ9 A;  3KV4 A;  4QX8 A;  4IGO A;  5A1F A;  3N9O A;  4IGP A;  3OPT A;  5FJH A;  5FZC A;  4CSW A;  5FZI A;  5FZE A;  5IWF A;  4GJZ A;  2WWU A;  4GJY A;  5FXX A;  4DIQ A;  3AVR A;  2P5B A;  4Y4R A;  5FYM A;  2YU1 A;  3PDQ A;  4ASK A;  5F3E A;  3AL6 A;  4CCJ A;  3KV6 A;  2YPD A;  3N9Q A;  5F2S A;  3PU8 A;  4V2W A;  2WWJ A;  5A7N A;  2Q8E A;  5FWE A;  2YBS A;  5FZO A;  4QX7 A;  5FPU A;  5FXW A;  4AI9 A;  5FZ1 A;  5FYT A;  3LDB A;  5FZL A;  5FZ8 A;  5FY7 A;  4XDP A;  4CCK A;  3KV5 A;  2OT7 A;  5FZO B;  4EZ4 A;  4LIV A;  2GP3 A;  4CCO A;  3DXT A;  1VRB A;  4LXL A;  4GAZ A;  4BIS A;  4C8D A;  2OX0 A;  5F2W A;  2XUE A;  4HOO A;  5F3I A;  3U78 A;  5FPL A;  5FY9 A;  5FZ3 A;  3PTR B;  5FP7 A;  3PUQ A;  4AAP A;  4DO0 A;  4NUB A;  5FZD A;  5IW0 A;  4QU1 A;  5F39 A;  5F5I A;  5FY5 A;  3AL5 A;  5FXZ A;  2OQ7 A;  2XDV A;  5FUN A; 
#chains in the Genus database with same CATH topology
 3M8L A;  4AI3 A;  2C9A A;  3B9I A;  4M00 A;  4P08 A;  1C8M 2;  3HEI A;  2DVF A;  1R09 1;  2BFU L;  2BOJ A;  1WW6 A;  1VBB 1;  5LWB A;  3GYD A;  4RS5 B;  4X8P A;  1AR6 1;  4QT6 A;  2WO7 A;  1HRV 1;  1MR5 A;  3KF3 A;  1UMZ A;  4GKY A;  5AVA A;  4AVC A;  3TEY A;  2EXK A;  2VW0 A;  3MBW A;  3CU7 A;  4WM7 C;  1XB9 A;  1DQ5 A;  5CU1 A;  2RDQ A;  4V2V A;  4UBG A;  3ZR5 A;  1NYW A;  4XHX A;  5FZG A;  1YIF A;  3VD7 A;  2Y6H A;  1H6Y A;  3OD0 A;  1WUV A;  2NLR A;  4Y20 B;  5A7S A;  2QCS B;  3UKT A;  4EYU A;  2WA4 A;  1DIW A;  2HWE 1;  2JDZ A;  1MS5 A;  4YVW B;  3PUS A;  2WAA A;  2XGX A;  3PUA A;  3NO8 A;  2LTN A;  4KGQ A;  4XMA A;  2GH8 A;  4Z07 A;  5FZ0 A;  5DAW A;  3AB0 A;  1RMU 1;  4CDQ B;  2OZJ A;  3C7E A;  4IV1 B;  4ZHN A;  1W6N A;  2CGN A;  4QPI B;  3I3D A;  1BVP 1;  5BNN B;  1OUS A;  4XDQ A;  4KWJ A;  1SQ4 A;  3OUJ A;  2FZ2 A;  1ODM A;  4W6W A;  3OOX A;  3O1M A;  1LGB A;  4YGB A;  3GM8 A;  1XSR A;  4JGY B;  3J7N A;  1L7Q A;  4B1L A;  4XBN A;  2ARA A;  4AI8 A;  1W6Q B;  1ODN A;  2WLQ A;  1YQ8 A;  2Y8K A;  3NQH A;  5L9V A;  4CDU A;  1BBT 1;  5LA0 A;  3WUC A;  2JKB A;  2VCM A;  5DUV A;  4YVW C;  1UZV A;  5HCA A;  3LWC A;  2B7Y A;  1CZV A;  5FY1 A;  1V6O A;  3DXU A;  1J1T A;  3ETQ A;  5FP9 A;  5CFC A;  5A80 A;  4IET A;  1QF3 A;  4Q4X 3;  2TEP A;  3T4H B;  3C7F A;  1T6G C;  4IV1 C;  4M0N A;  4QAW A;  4QX1 A;  2A7A A;  3VBO A;  3S7E A;  2WT0 A;  3DUI A;  4PQQ A;  4GAL A;  1UOG A;  5FXV A;  1ENX A;  2WT1 A;  3BCW A;  2C5D A;  3LAG A;  1COV 1;  2CAV A;  4GH4 A;  4NIA A;  5FZK A;  3V0A B;  3ZYF A;  4JX0 A;  3T4V A;  3H1M A;  2D98 A;  3WOG A;  4MOA A;  1DGR N;  4Q4Y 2;  5K4L A;  5L7O A;  1CAV A;  3CIH A;  4Z92 B;  4UF0 B;  5I93 A;  4JGY C;  3IN9 A;  5H9S A;  1UOB A;  1YJK A;  1FAY A;  1RUG 1;  1OMI A;  1PM4 A;  1PIV 1;  3FLP A;  5I0T A;  4LOT A;  2GZW A;  5IYY A;  4Q0Q A;  1D4V B;  2FQP A;  4LE3 A;  4AE2 A;  1RED A;  3J8F 2;  5T5J A;  2VO5 A;  2WYF A;  3BN6 A;  3BOP A;  3DN7 A;  1XE7 A;  1MVQ A;  1OH4 A;  2B4K A;  4OHY A;  3I59 A;  2XHK A;  3OGG A;  4XIO A;  3H7J A;  4ZPI A;  4CCK A;  2ARB A;  3OBT A;  1OH3 A;  5JIA A;  1IPJ A;  4CCC A;  4TYS A;  2DBN A;  1C4R A;  1RB8 G;  1US3 A;  1NOV A;  2A6W A;  4HN0 A;  3K75 B;  4YG3 A;  4MAD A;  1GZT A;  1JYT A;  2JDH A;  4MGI E;  4AOC A;  2WQ4 A;  4XUR A;  3S5Q A;  4XZP A;  2I07 B;  5BNO B;  1GSL A;  2GU9 A;  2WLP A;  3PJY A;  3PUI A;  3SEP A;  5IAT A;  4QDR A;  2VBD A;  1U5Z A;  4AVS A;  3P5B A;  2XDV A;  5FUN A;  3T08 A;  4E8D A;  4MXW A;  3OTF A;  1YQ2 A;  4Y1Z A;  4Q2F A;  1SPP B;  3C2U A;  4Y22 A;  4JDO A;  5HBA A;  1D2S A;  1RIN A;  5B2G B;  4JDM A;  3ZXG A;  4BHP A;  1O91 A;  1R09 2;  4AFD A;  3ZXD A;  4OQ9 A;  3NKG A;  2IXL A;  2O0O A;  4NRM A;  4XAE A;  4D7T A;  4L0P A;  1RUF 3;  2ZAH A;  2Z69 A;  3W59 A;  3WP5 A;  4EZH A;  2ZOE B;  1ZA4 A;  1DGR A;  4LE4 A;  2E7A A;  1ZRE A;  1W8Z A;  4QGL A;  5KHH A;  2JD4 A;  2R30 A;  5LBE A;  4LOR A;  5EPA A;  2ZGM A;  4A4A A;  5JSP A;  1YCI A;  2ZGT A;  3VDC A;  3G6J B;  3MID A;  5LEJ A;  4JHZ A;  3SH3 A;  4AAX A;  1N1V A;  1UX7 A;  2AZ5 A;  2WZR 2;  1VBA 1;  3CZU A;  4DXR A;  3VDB A;  5FP4 A;  3THC A;  1NG0 A;  2YY1 A;  1QQP 1;  1R1Z A;  1BHG A;  2OXB A;  2RG4 A;  3S6P A;  2Z5W A;  1ZRI A;  3CJI A;  2B42 B;  1H4G A;  3OBA A;  3MIG A;  1T2X A;  1LOA A;  1W8H A;  3MIE A;  3G7D A;  3ZYR A;  4I09 A;  1WW4 A;  1JUI A;  3OBZ A;  3WCS A;  2NQY A;  3EB7 A;  1FV2 A;  2D6N A;  2DCT A;  3MPB A;  4FOQ A;  4KU8 A;  5L36 A;  3AMN A;  1CAW A;  5K0U C;  2ORZ A;  3ZKY A;  4BQ3 A;  2G9Z A;  2HWF 3;  4XFB A;  3TOJ A;  2WNV A;  1RUH 2;  4CP0 A;  5A3U A;  3ZIX A;  4CEW C;  2Y60 A;  1O3Q A;  1EPZ A;  4H2A A;  4JKM A;  5FZ9 A;  3E6D A;  1FPN 3;  2ZGK A;  3S30 A;  1Q8O A;  5AVP A;  4CUA A;  4IQP A;  3U10 A;  3SH5 A;  2E63 A;  2BWA A;  2WNE A;  4XF4 A;  2VY0 A;  4YVS C;  4E4D X;  1SBD A;  1VBD 1;  2NPI A;  3V0B B;  4WVZ A;  1W6M B;  3ZSM A;  2LS6 A;  3E5U A;  4PLO A;  5AC9 3;  4DOU A;  5CB7 A;  1ND2 A;  4FBF A;  2HWC 2;  3KV6 A;  4IL7 A;  5F2S A;  1UYX A;  1RJ7 A;  3MPP G;  2ZHM A;  3WG3 A;  4OMC A;  4XJ9 A;  2DCZ A;  5H9R A;  4XW3 A;  4QQH A;  3USU B;  5FY7 A;  3PVN A;  4LIV A;  2Q8O A;  1RXG A;  2EVX A;  4Y20 A;  2PHF A;  2X5I A;  4XF1 A;  4CDW C;  1LB2 A;  4JAA A;  1Y3T A;  2WAO A;  3O1R A;  4NRO A;  1GZC A;  1W3V A;  1JOB A;  1LOF C;  2VBP A;  3F2Z A;  4Q26 A;  4BLJ A;  1Q43 A;  5FPL A;  4EN6 B;  1VBB 3;  1YI7 A;  2GMM A;  3VD5 A;  1F5J A;  3AZX A;  1AR6 3;  4AAP A;  3BU0 A;  1W04 A;  3EXU A;  1HRV 3;  5IW0 A;  1V0A A;  4CDQ A;  3BIE A;  1RHI 1;  2WFP A;  2WO2 A;  4HVR A;  4QPI A;  1UMH A;  1W8T A;  1PNF A;  3ZSK A;  4GXL A;  5EYX A;  4A7Y A;  2V09 A;  4CCN A;  4BU2 A;  1RUC 2;  4EWE A;  3WSO A;  3CQO A;  2C26 A;  2FDH A;  2Y6L A;  4CDX B;  2DFC A;  2HWE 3;  4YW7 A;  1LHV A;  2IVJ A;  1D0H A;  1XJA A;  1HQL A;  3FHQ A;  3N9L A;  4OFG A;  4N53 C;  2WNU B;  3ZFF A;  3IDC B;  4RQP B;  1HB2 A;  1RMU 3;  2EXJ A;  4LHS A;  4S2H A;  3WD5 A;  4C0B A;  4QGN A;  4R4Z A;  3GAL A;  4Z82 A;  5KR7 A;  1FMD 2;  2GNM A;  2XLG A;  4EWD A;  2R06 1;  2X8K A;  3GDB A;  5FYU A;  1SDW A;  2GDF A;  3MIF A;  4FFH A;  4FPF A;  4UFK A;  4XFA A;  1TME 2;  3TNP B;  4XJ8 A;  3HAG A;  4KWL A;  1DZT A;  4HVO A;  4QPY A;  1K5M B;  1CPN A;  1NY7 1;  3P1I A;  1NA1 B;  3H1Y A;  4DY3 A;  2VZQ A;  2ZGO A;  4AHZ A;  3U14 A;  4ERO A;  1WMF A;  1XXN A;  3ACH A;  3K3O A;  4IGQ A;  5FKC A;  4AI1 A;  1TE1 B;  2R04 1;  1VPH A;  2IFW A;  2D43 A;  1NQD A;  1BQP A;  2JIJ A;  5EZW A;  3WT3 A;  1HW5 A;  1BBT 3;  1QJX 1;  1ZRR A;  4OMD A;  1CES A;  1H6X A;  5F5A A;  3PIG A;  4B4Q A;  1HXS 1;  4DQA A;  1Q56 A;  1EAH 1;  1RUI 1;  1ULE A;  2ZAA A;  1ST8 A;  3GF6 A;  1QJE A;  4K1Z A;  1I9R A;  4FQ4 A;  1QGL A;  4E8C A;  4RQP C;  1S0J A;  3WP6 A;  1W2N A;  3I2G A;  3UNP A;  4WV8 A;  5T52 A;  3WDY A;  1QNW A;  1TVG A;  4UFJ A;  4KH9 A;  3TWI A;  1VBA 2;  2ILM A;  2QBX A;  2A71 A;  1OPO A;  4LHL A;  4FPE A;  1COV 3;  2DVD A;  3P3P A;  4A3Z A;  3RNS A;  3SQO A;  1QQP 2;  4HLT A;  4NIG A;  1RGS A;  1SLB A;  4L92 A;  4WVM B;  4Y1U A;  1V6N A;  5ANQ A;  2BFU S;  1IQA A;  5EV7 A;  1QXJ A;  4NRP A;  2CWM A;  4YFZ A;  2VH9 A;  2JG8 C;  2VUL A;  5IK8 A;  2JB4 A;  2XON A;  2ZHL A;  3JCI A;  5I0S A;  5K7P A;  3PVE A;  4L2N A;  1MZE A;  1RUG 3;  2W39 A;  1KFX L;  1PIV 3;  1NT0 A;  4O65 A;  5JR2 A;  1PO2 3;  2RS1 2;  2WAB A;  5A6Z A;  1WME A;  4Y1V A;  3M3O A;  1H9P A;  1LOB A;  4CP9 A;  1QJU 1;  4D69 A;  2ARX A;  4N43 B;  5CNA A;  4QX8 A;  4QX2 A;  1DYO A;  1OUX A;  2ETE A;  4FO9 A;  3VBU C;  1C57 A;  1DHK B;  4P9Y A;  5FZI A;  1DZR A;  5LAS A;  2Y0O A;  1YFX A;  4MUV A;  5BYN A;  3C7O A;  2WWU A;  4K20 A;  3ZFG B;  1C5H A;  3GCW A;  1UIK A;  2A6Z A;  3KMH A;  2E7Q A;  1O4Z A;  3POG A;  4KG8 A;  4TSV A;  3A0K A;  5A33 A;  1PMI A;  5LK5 A;  4XQ4 A;  3VHR A;  1VAM A;  2HEW F;  4AQS A;  2WUH A;  3EMR A;  1X9P A;  4FQZ A;  1S0D A;  1KIT A;  4LO6 B;  1YO8 A;  4PIY A;  4XUQ A;  2JIG A;  4Q29 A;  5DUX A;  5LA1 A;  3WNK A;  4I3G A;  1DGW A;  3ALQ A;  4C8D A;  1AL0 G;  1G6N A;  1AJO A;  4OQ8 A;  4K40 A;  4JC1 A;  3AZY A;  3WW1 A;  4BE3 A;  1XOY A;  1RUD 1;  1OQD A;  1PGS A;  1R1A 2;  4NUB A;  4XUP A;  3ROU A;  1SLC A;  3ST7 A;  2J7M A;  1UOJ A;  2JDY A;  4LBO A;  5D8A C;  4CA9 A;  2A70 A;  2ZML A;  4QPG B;  3AKS A;  2NMN A;  3R4U A;  2WA3 A;  4B8E A;  4ZXK A;  2P4E A;  1NCR B;  1HLC A;  2PA7 A;  5LY2 A;  5DG1 A;  5HCH A;  3WDV A;  3M3C A;  2XML A;  3OPW A;  4J1X A;  1OT5 A;  4JGZ B;  2GME A;  4AHW A;  4COY A;  1HB4 A;  3ABZ A;  5DAQ A;  2GSY A;  1D2Q A;  2KXL A;  4BA6 A;  1ND3 C;  2NZ9 A;  3E97 A;  4K6B A;  2VG9 A;  3OD4 A;  1AX1 A;  5FPZ A;  2PHD A;  3ZIW A;  4I02 A;  3DPR B;  3JU9 A;  4C0H A;  4AZZ A;  4Q4V 2;  2X10 A;  4AVV A;  1AXY A;  2A3X A;  4TTG A;  4AFB A;  5FO8 B;  1UXZ A;  1JW6 A;  3JBG 1;  3QAC A;  4QD2 A;  2PXJ A;  2YYO A;  4IEY A;  3Q8E A;  1K3I A;  1MS4 A;  1ZRC A;  4DZG A;  4RGA A;  4IEX A;  1WLT A;  5F2W A;  1BEV 2;  1G9F A;  3VL8 A;  4QPG C;  1W9T A;  4XDO A;  2ZJC A;  2G9G A;  1AXK A;  1RUJ 1;  2VZP A;  4CPB D;  2A6X A;  1U0A A;  4KI5 M;  3WW3 A;  1W8W A;  3NST A;  1HDK A;  2E51 A;  4JRA A;  3VDD C;  2VXJ A;  4A2U A;  2BNM A;  3HQX A;  5C8C B;  3DPR C;  4IE7 A;  5A1L A;  1PK6 C;  2X53 S;  1UD1 A;  2DVB A;  3MIH A;  2XVK A;  5FUP A;  3LB9 A;  4XUT A;  2DUO A;  5FZH A;  5I8S A;  3V0B A;  5JVV A;  2UY8 A;  5JOW A;  4CCM A;  2HWB 1;  2F17 A;  1JHN A;  2V5D A;  3H0O A;  4COW A;  4B1M A;  1ZZ6 A;  1RUI 2;  3ACG A;  3PUR A;  3GCX A;  1IQD C;  3GXU A;  1WGP A;  1CAX B;  4NPM A;  3VBF C;  1ZZB A;  2CDO A;  2WS9 2;  5IVF A;  3V64 A;  4AED C;  2EXH A;  4FPY A;  5LZ6 A;  5LW9 A;  2PHX A;  1SDD B;  3WNP A;  1VRH 1;  3W58 A;  5JZG C;  3IDE A;  1YI9 A;  1UKR A;  1F4H A;  4XEZ A;  1W0O A;  3R6S A;  4LBL A;  1YXW A;  4OI1 A;  1VBD 3;  1AR9 1;  1NZC A;  1AR7 1;  3H7Y A;  2CDP A;  2XLF A;  3NNL A;  2VCC A;  2VBB A;  1G86 A;  1GOF A;  1F4A A;  3THT A;  1JZ8 A;  1REF A;  5L9R A;  1UZY A;  4AK3 A;  2VZ3 A;  1X36 A;  1QJU 2;  4LHN A;  4YW6 A;  1IS6 A;  1EYB A;  1PZ9 A;  1VBE 2;  3B94 A;  1HN1 A;  3M2M A;  1X8E A;  4OHV A;  1SFP A;  3PDQ A;  1HN0 A;  2QQW A;  3L2Y A;  1UY0 A;  1OA2 A;  5A7N A;  4K8F A;  5A70 A;  3LDK A;  2P37 A;  1YIP A;  2YBS A;  4MO3 M;  3ACI A;  4D3W A;  3D6E A;  1CJD A;  2WSU A;  1ZZ9 A;  2C4X A;  3DV8 A;  3EO6 A;  4JTN A;  3UV9 A;  1W9Y A;  2BJS A;  5FZ1 A;  5FZ8 A;  3W9A A;  2WNU A;  1GZW B;  1NAE A;  1MZ6 A;  1POV 1;  2RR1 2;  2VZU A;  1X33 A;  4G3Y C;  4JVA A;  1RHI 3;  4CU9 A;  4MHU A;  3MF9 A;  4XAC A;  2OZ6 A;  1G9B A;  2XPJ A;  2UWB A;  1JZ4 A;  2Z4F A;  2RE9 A;  3NMB A;  4NHY A;  3OUH A;  1Q8P A;  3PIJ A;  4GQ7 A;  4MH0 E;  3WQB A;  4DUV A;  3PTR B;  4IES A;  4XMI A;  3ES4 A;  5I0R A;  1W99 A;  1S55 A;  1ZBA 1;  3ELN A;  1K5M A;  3PL0 A;  4PDW C;  2UUR A;  2R0H A;  3VDA A;  4DRV A;  2VGD A;  3K4A A;  1AXZ A;  1Z7S 2;  1G7Y A;  2MEV 2;  1DQ2 A;  1O8P A;  1ULC A;  5F6K A;  2XBO 3;  4YW1 A;  2QQO A;  2VE1 A;  1Q5O A;  5KBF A;  2DU0 A;  3NNF A;  4NMI A;  2W1W A;  5EJZ B;  3VBH C;  5ACA 1;  3WIN E;  3TEZ A;  2OPK A;  5FPV A;  4J6G A;  2OS2 A;  3KHB A;  4Y5T A;  1QIQ A;  2R06 3;  2YU2 A;  1W90 A;  1NQJ A;  2RM2 1;  4UYB A;  3VZM A;  2GAL A;  2YGM A;  3KGL A;  3GJA A;  1R08 2;  3A22 A;  2J1V A;  2GAU A;  4JV4 A;  4W8J A;  4PCR A;  2BU9 A;  2HEY F;  3J4U H;  4LK7 A;  4M4R A;  4CU7 A;  3LSE A;  3THP A;  4NII A;  2R04 3;  3VBR B;  2BTV C;  1DU3 D;  2KA3 A;  4L99 A;  4TN7 A;  4Y24 A;  2OQ6 A;  1A8D A;  1XNC A;  1B09 A;  1N1Y A;  3AP4 A;  1QJX 3;  5I91 A;  4R8H A;  4AEJ A;  1VAL A;  1EV1 3;  4QHO A;  4QM9 A;  4AI2 A;  4CEY A;  1HXS 3;  1E57 A;  3MHZ A;  3JBG 2;  1EAH 3;  1RUE 1;  4JZR A;  5HCB A;  3UJQ A;  2A3W A;  2QQL A;  4E4H A;  5FP8 A;  5JMC A;  1GP6 A;  2E53 A;  4MGS A;  4XFF A;  2PQS A;  3VZN A;  3SXW A;  5AFE A;  4CE8 A;  4LK6 A;  1E5H A;  4XBQ A;  4LKE A;  1FX5 A;  1UKG A;  2ARC A;  3NV4 A;  5C7G A;  3PVO A;  3MIB A;  4GUL A;  1LJ7 A;  3POS A;  5BNP B;  1V6M A;  3O7O A;  1QDO A;  1V6L A;  1D4M 2;  5EHD A;  3VKF C;  1W6P A;  4GIQ A;  3WDU A;  1N47 A;  1WCU A;  3ZFG A;  4DPN A;  2BYV E;  2VUJ A;  5GZG A;  4XQW A;  2BNN A;  3ATG A;  3UGF A;  3IZO A;  2ES3 A;  1JU3 A;  2K9Z A;  2RS5 2;  2VXR A;  2P1B A;  4HSJ A;  2XVL A;  2ZX2 A;  3OGV A;  2B46 X;  5C3Q A;  5IFP A;  3B3Q E;  4LO5 B;  2J1T A;  2ZPX A;  3IMN A;  3OBR A;  4QMA A;  3RWN A;  4J1W A;  5A32 B;  1A8M A;  3K2O A;  1GWK A;  2VNO A;  3RRD A;  3ZSL A;  2QQK A;  4FPO B;  4EN9 B;  4BMB A;  5FZF A;  1JH5 A;  4HAN A;  1A6C A;  3U0Z A;  1OC1 A;  4XHB A;  5A1F A;  1OFS A;  3BTA A;  2WFF 2;  3OPT A;  3DGT A;  1VBC 3;  4LMF A;  2QQI A;  3I4I A;  4KWU A;  5LA9 A;  5A6X A;  5DUU A;  2K0G A;  4RHV 2;  4DIN B;  5LCW L;  1W8F A;  5FR3 A;  4ASK A;  2RMU 2;  3AL6 A;  4JGZ A;  4OHW A;  2ADE A;  2W87 A;  4V2W A;  3OGJ A;  2BRT A;  1PX4 A;  3FFZ A;  4Q4Y 1;  4QM8 A;  2XG3 A;  2W46 A;  5FK8 A;  1HQN A;  2VUD A;  4HBN A;  2ERF A;  3RI9 A;  3U11 A;  1WBF A;  4IV3 B;  5KXD A;  1RUD 3;  4CXX A;  2FBE A;  3NWK A;  1BZW A;  3RZG A;  2WBK A;  3OGR A;  4DXS A;  1ZNP A;  3RJ2 X;  3U78 A;  1NCQ B;  4FP2 A;  2W91 A;  1BYH A;  1SCR A;  1JN2 P;  1VAK A;  5JWP A;  3J8F 1;  3O0W A;  4KBZ A;  1XYO A;  2YZ4 A;  3VKM A;  2ZGR A;  1CZS A;  4HXC A;  2OW4 A;  1S0E A;  3PME A;  1AHS A;  1OLQ A;  2AAC A;  3BTX A;  2D6M A;  2VQ0 A;  3ZFE A;  4ISR A;  3S57 A;  2BZD A;  1POV 0;  2J1A A;  1MS0 A;  3ZN6 A;  4OCT A;  4K3U A;  2VOK A;  2VL4 A;  1KDM A;  1YQ5 A;  3LEK A;  4IEZ A;  4WM7 B;  5LY1 A;  4H3W A;  2GND A;  2H6B A;  2PHT A;  3ILR A;  4Q0S A;  5EP9 A;  4O7X A;  3ZYB A;  3T0B A;  2PHU A;  4QQL A;  4ITC A;  2ZX1 A;  4HPK A;  4PF1 A;  2G19 A;  5IVE A;  1IPS A;  1RUJ 3;  2R7E B;  5LK7 B;  2BQP A;  3NAP A;  2RJL A;  4FPH A;  5F9T A;  5HV4 A;  4HFS A;  4CP2 A;  4P5Y A;  4EQV A;  4XJZ A;  2Q8C A;  2KM2 A;  3ETP A;  3MUZ 1;  2I74 A;  2Z42 A;  4ASL A;  1BK1 A;  2Q1F A;  3APB A;  3LIH A;  4LA3 A;  2JIC A;  4XYX A;  1OKO A;  3ACF A;  3T2Q A;  2CY6 A;  2N7G A;  3NV2 A;  2A75 A;  5FV3 A;  4DRR A;  4ZU5 A;  3JD7 2;  2D6P A;  4PIZ A;  2HWB 3;  1BJQ A;  3N9P A;  5FYI A;  1W8O A;  2EIE A;  1RUE 2;  2VCA A;  4W65 A;  3PHM A;  5A3W A;  1DP0 A;  3H9A A;  1ZRF A;  1DGW X;  1VE0 A;  4AEK A;  1LU2 A;  1QH7 A;  3JB8 A;  3J7M A;  5IJR A;  4UW6 A;  3IIA A;  3KV9 A;  2G1M A;  1ENR A;  1SMV A;  5A3T A;  3F95 A;  1CAU B;  4AGG A;  1VRH 3;  2D3R A;  3AKP A;  3BVC A;  5GLT A;  3CJI C;  2FDG A;  2WZR 1;  2P34 A;  2R32 A;  1AR9 3;  4LOS A;  2Q8D A;  1AR7 3;  4K8R B;  1PO1 3;  3BUC A;  1BXH A;  1OPM A;  4CXW A;  4QWN A;  3AZV A;  1MAC A;  5GKA C;  1AF9 A;  4HK8 A;  2VD7 A;  4AL9 A;  1PVX A;  1RL3 A;  5J1X A;  3SH4 A;  3MGU A;  1OOP B;  2WNV C;  2W94 A;  1UIJ A;  2FMD A;  1H8T A;  2YFU A;  1O5U A;  3AYE A;  2C0Z A;  3JQW A;  4IGO A;  4PIX A;  3WV6 A;  4COZ A;  2L9L A;  3OEA A;  4YW4 A;  5HV0 A;  1DYK A;  3PTY A;  2E33 A;  4CSW A;  5D2A A;  3NW4 A;  3OJB A;  2QTW B;  4MZU A;  4CCD A;  4URT A;  3Q8F A;  1XU2 A;  1L3J A;  3FUQ A;  1POV 3;  5T5L A;  3HQU A;  1APN A;  3TEW A;  2YU1 A;  2VOT A;  1RUH 1;  4Y1X A;  1JMU B;  1PHM A;  2JWP A;  4JQR A;  4I30 A;  3SCH A;  5A3O A;  4BJ0 A;  1O4Y A;  4XDP A;  1ZBA 3;  3POY A;  2PYT A;  2WNO A;  3QD6 A;  1K5J A;  3DXT A;  3RG0 A;  3E5Q A;  2XJU A;  3PNA A;  1F15 A;  2WJS A;  2OX0 A;  2ZS6 B;  2HJI A;  4P14 A;  3VBR A;  4LQR A;  1PGL 1;  2JDP A;  1OOP C;  3O1T A;  2X5I C;  3LA3 A;  2FDF A;  1G9C A;  3WP3 A;  5JLV A;  3Q8A A;  2HWC 1;  3I2F A;  4WVV A;  5T55 A;  1GAN A;  3ACL A;  4C1W A;  5C4W B;  5ACA 3;  1NLR A;  4NWW A;  2CL2 A;  2PQQ A;  1W39 A;  4GMP 1;  1XSQ A;  4XF3 A;  2FDI A;  2RM2 3;  2B8M A;  4QXC A;  2GMP A;  2XH6 A;  1A3K A;  3AFK A;  2D40 A;  4A7K A;  3KT1 A;  1QJY 2;  5A7P A;  3LEG A;  3C8X A;  1N1T A;  1C8M 3;  5LA2 A;  1AX0 A;  2B39 A;  3D4K A;  3BU7 A;  2A6Y A;  5SV5 A;  5SV8 A;  3ZXE A;  3VZO A;  5FY4 A;  3KB5 A;  5TSW A;  5JXI A;  1JYX A;  3I97 A;  4MSV A;  4ES8 A;  3QBQ A;  4Q0U A;  2BER A;  5DZG A;  5A3P A;  2GC3 A;  3VB9 A;  4IEV A;  4P9W A;  4AG4 A;  2VMH A;  1SLL A;  5CFD A;  1B35 C;  3ZFF C;  3KCC A;  1RUC 1;  3KS7 A;  3LE0 A;  4P9X A;  4AR2 A;  5C4W C;  1OLR A;  4GKX A;  5BV6 A;  1IKQ A;  4NOT A;  3N35 A;  5DZE A;  2C24 A;  4WM8 C;  3SIT A;  1GR3 A;  2XWB B;  1FV3 A;  2VQU A;  4LBJ A;  1UY2 A;  3OYW B;  5A7O A;  2Q5T A;  1AX2 A;  1ZBE 2;  1FMD 1;  1H1I A;  5EIY B;  3WEZ A;  4WVW A;  2YGL A;  1SBF A;  4QQO A;  4UFL A;  1RYY A;  1TME 1;  1UQX A;  3GNE A;  4LO4 B;  3VZL A;  4BME A;  3R05 A;  2JE8 A;  4OUS A;  5C9A C;  1NXD 1;  2PHL A;  2IC1 A;  3LFI A;  5I8Y A;  4NHX A;  3IAQ A;  4Y3O A;  3ZMO A;  5KC5 A;  3GZE A;  3GHM A;  5EXO A;  3B02 A;  4RR3 A;  2ZAB A;  5IAV A;  4IND A;  4G4F A;  4AHX A;  3AKT A;  2NYY A;  1L7L A;  3BAL A;  4C1X A;  1OLM E;  4IV3 A;  1RUN A;  1UO9 A;  2VMG A;  1ACC A;  3MW2 A;  4FPK A;  1DYP A;  3I8T A;  3VV1 A;  5K0U B;  3BB6 A;  4GWJ A;  1H8V A;  4NR1 A;  2BGC A;  1Q8V A;  1NCQ A;  4YPJ A;  2WDB A;  4LR4 A;  4CEW B;  4XIK A;  3H50 A;  4XAB A;  3I3E A;  4YZ3 A;  1GIC A;  4DFS A;  5GLV A;  4CP1 A;  1PX3 A;  4XXA A;  5KHJ A;  4LLF A;  2O1Q A;  4R9A A;  1IS4 A;  4Q4Y 3;  3T0A A;  5FRE A;  2DCK A;  1STM A;  5FMO L;  2J1U A;  4YVS B;  3JB4 C;  5DAX A;  5L73 A;  4Y4R A;  1LRH A;  5FYM A;  3IPV B;  1HRI 2;  4G9S B;  4YZ2 A;  2RS1 1;  3DYM A;  2Q8E A;  2EIB A;  2ZEW A;  3GZT B;  4JTO A;  4YGD A;  4R9C A;  1X8M A;  4CRQ A;  1FXZ A;  1UY4 A;  5C6C A;  2A6V A;  1UU4 A;  4LBQ A;  4ASM B;  3N36 A;  1WWY A;  1SG3 A;  2BGP A;  3KV5 A;  3J8F 3;  4FI9 A;  4YGE A;  5BY5 A;  4FTE A;  2Y64 A;  3AM2 A;  4CDW B;  2DCJ A;  2W5F A;  3D8C A;  3KWV A;  4JRL A;  4RFR B;  2W0X A;  1WCK A;  4Q4W 2;  2XUE A;  3O12 A;  5CKM A;  3OEB A;  1JYV A;  3KSC A;  5JIU A;  4IEP A;  2XJR A;  4SLI A;  5LAT A;  2NMO A;  4IXL A;  2DV9 A;  4LPL A;  1MS3 A;  2ZHN A;  1WW5 A;  3SCG A;  4YM2 A;  4OLL A;  4RS5 A;  5CVR A;  1PGL 2;  4Z1V A;  1QJZ A;  1CZT A;  3AKR A;  3DYO A;  2P3I A;  4QKD A;  5JXH A;  1WLD A;  2V73 A;  3I3B A;  1REE A;  2YG0 A;  3VHO A;  2R1B A;  4FT8 A;  4Y5Z 0;  4QHZ A;  2JE9 A;  3WF4 A;  3HPN A;  3K77 A;  5F37 A;  2DYC A;  4M3C B;  4K1Y A;  3WNL A;  3DYP A;  4KBB A;  1R1A 1;  2NM1 A;  1IZ3 A;  1JYW A;  1YFU A;  5C70 A;  4N53 B;  1GQG A;  1VMJ A;  1GFF 2;  4ATE A;  4YVW A;  4M4P A;  4FOY A;  1R09 3;  4ORF A;  2Y0I A;  1UL9 A;  5E89 A;  1WCS A;  2VMC A;  5FJK A;  1LUL A;  3WF2 A;  4Z2W A;  2GN3 A;  3TN9 2;  5J7M A;  4GMP 0;  5FY8 A;  4FXK B;  1GP4 A;  4IV1 A;  4XXP A;  1OQ1 A;  3LPG A;  1V6I A;  5C3R A;  5BNN A;  2A73 B;  2HWD 1;  4BQ5 A;  2CTV A;  3K46 A;  1WD4 A;  3W5N A;  1TMF 2;  3I54 A;  4I0B A;  1LOG A;  1W2A X;  3S7I A;  2WYS A;  2A1X A;  4MGT A;  4Q4V 1;  3ZYI B;  5FOJ B;  4JGY A;  1Y7B A;  2BGO A;  4XJA A;  2DUR A;  3E6B A;  3NV3 A;  3RFR A;  4GZ9 A;  1ULP A;  2PHR A;  4N9H A;  4NIH A;  1W6Q A;  1V6K A;  2D5H A;  4QXK A;  3TNQ A;  4W50 A;  4HSL A;  4YW3 A;  2JG9 B;  2KR2 A;  5F32 A;  3VN4 A;  3WF0 A;  4E27 A;  2VZ1 A;  3IKW A;  1BEV 1;  3MDP A;  2WZR 3;  1S0F A;  5FZM A;  1W8U A;  3POE A;  4RYD A;  2CV6 A;  1KXG A;  4XIL A;  3HNB M;  4CCL A;  4UFM A;  1RVF 1;  1AL2 2;  1OVS A;  2RV9 A;  4XOG A;  2YDE A;  4Y1Y A;  5JOZ A;  2VQT A;  2YXS A;  1Y43 B;  1YFY A;  4IEO A;  5JAX A;  5T3N A;  1XBF A;  2ZGL A;  1UNB A;  2JG8 B;  2WQZ C;  3V0A A;  3PU3 A;  3OY8 B;  2RS3 2;  4UF0 A;  4BK5 A;  4V1P A;  4NAM A;  3FX3 A;  3VD3 A;  2JG9 C;  4HKO A;  1RUH 3;  1W9S A;  4B4R A;  4BH9 A;  3VBU B;  5KXE A;  2JEN A;  3HVD A;  5FJH A;  5IK7 A;  2WS9 1;  4CTE A;  2DU1 A;  3LCP A;  1V9U 1;  5JOY A;  1XE8 A;  1TNF A;  2AEZ A;  2QDR A;  5FXX A;  4Z2A A;  5CZK A;  4AFC A;  3SHR A;  1DQ4 A;  2J42 A;  2XUM A;  4L11 A;  4AFA A;  3LF7 A;  2VR4 A;  2YPD A;  3Q8B A;  4H14 A;  1KD7 A;  4M3C E;  2WWJ A;  4ZON A;  4BPZ A;  1UU6 A;  2VMI A;  3IDA A;  1WBL A;  5JCT A;  3FBM A;  2VVD A;  4FCA A;  1SCS A;  4JHT A;  1IPK A;  2HWC 3;  5FZO B;  4TWT A;  5LRS A;  1W2O A;  4FPG A;  1S4C A;  1PZ8 A;  2EXI A;  2AYH A;  4IW3 A;  1H2N A;  4P9G A;  4JKL A;  1HQW A;  1FOD 2;  2H0B A;  1VBE 1;  3GBW A;  3M3E A;  4GMP 3;  5DQ0 A;  5BNO A;  1MQT B;  2CSG A;  4UXA A;  4QPW A;  5D8A B;  4CUB A;  4ISQ A;  4Q8L A;  4NHM A;  5FY5 A;  2OII A;  3CL1 A;  1D7P M;  4GWN A;  1SPP A;  3UJO A;  4Y26 A;  3POJ A;  2RR1 1;  5FYZ A;  5DUW A;  4BDV B;  1ZYB A;  4U36 A;  4IE5 A;  5FYV A;  3POB A;  3RZH A;  4XF0 A;  2QQN A;  5CG9 A;  5LEK A;  3N7K A;  1D0G A;  1V00 A;  2VMF A;  1UY1 A;  2E7T A;  3NRU A;  1ND3 B;  1EUT A;  1RUC 3;  2W47 A;  2R16 A;  3SEE A;  4BK4 A;  1H2M A;  2DVA A;  3MI8 A;  1WMD A;  2WRA A;  3E5X A;  5CYY A;  3SNM A;  3A7Q A;  3MLL A;  5HXV A;  2GNT A;  4XET A;  1ZZ8 A;  2Z2S B;  4MGY E;  1WCQ A;  1Z7S 1;  4YLZ A;  2MEV 1;  4O9G A;  3ZPY A;  4DS0 A;  2QQM A;  3KHC A;  1MQT C;  3PUH A;  3VKO A;  1H30 A;  5F3G A;  4LA2 A;  5KWR A;  4N8M A;  4HK9 A;  1ENS A;  4WZF A;  2WII B;  3K51 A;  3LZZ A;  1FMD 3;  3I3M A;  4OUE A;  1NUK A;  4AGR A;  2EIG A;  3AYC A;  4E4S A;  5CA6 A;  3KF5 A;  4QDQ A;  1TME 3;  4LO7 A;  4CEW A;  1VMF A;  4CEY C;  1R08 1;  2ZX4 A;  3GBF A;  3RZM A;  5A3L A;  3HNM A;  1JHJ A;  3N3H A;  3THD A;  5C3P A;  3QH7 A;  2HWD 2;  1OKQ A;  5FPA A;  4R52 A;  3VDD B;  4OI2 A;  4D7Y A;  2WN2 A;  1XC6 A;  4P02 B;  5FWJ A;  5C33 A;  1PK6 B;  3LD8 A;  4PJY A;  4NPL A;  5FPB A;  4FSJ A;  2EAL A;  3ZX7 A;  2CGO A;  1LEM A;  1N1S A;  3AP9 A;  3FLR A;  4IE4 A;  3T30 A;  1P8J A;  3MLK A;  2B5H A;  2UY9 A;  1XNA A;  2X09 A;  4XCA A;  2ADD A;  3VBF B;  1A78 A;  2ZCW A;  5A7W B;  2ZEY A;  4LJH A;  1VBA 3;  3H8U A;  5FZB A;  4D0Q A;  4AED B;  4PBP A;  1CON A;  1PVC 2;  1RVF 2;  5IHR A;  5ABJ C;  1QQP 3;  3UKN A;  1JZ2 A;  2Z79 A;  1D4M 1;  1QHD A;  2PLV 2;  3VZK A;  4Q1P A;  1F31 A;  1FT9 A;  1LOF A;  5JZG B;  2DDU A;  2AUY A;  5DAP A;  2W3J A;  2XVG A;  2XOM A;  1KJL A;  5J36 A;  3RVH A;  5FBJ A;  4UWD A;  2RS1 3;  2RS5 1;  2RDR A;  2V4V A;  3L9J T;  1OQE A;  4IGP A;  3I2J A;  5GAL A;  1W6M A;  4Q5O A;  5APA A;  1F9K A;  2OPW A;  1NLQ A;  2DTY A;  4FTB A;  3FN9 A;  2Q1M A;  5FTT C;  1HB1 A;  3HN3 A;  2OUH A;  3BI3 A;  2WL1 A;  4LUM A;  3AVR A;  1QU0 A;  1LNS A;  2WKK A;  2Y6K A;  3M7A A;  4ZU4 A;  4H7L A;  1CX4 A;  3SMH A;  3WDT A;  5GLU A;  2PAK A;  5F3E A;  4CCJ A;  2VUC A;  3USU A;  3LA2 A;  4XFH A;  3INA A;  3PU8 A;  4BQW A;  5IK5 A;  5FWE A;  3EYP A;  1V9U 2;  3USS A;  5FMD A;  3S0M A;  5CAD A;  4JQT A;  3ZXK A;  1ULF A;  5E1R A;  3WNO A;  4GWI A;  3MO4 A;  1OXC A;  2WFF 1;  4CCO A;  5FRA A;  3VBS B;  4LXL A;  2XKO A;  4DUW A;  1EY2 A;  5FPX A;  1S2K A;  1S0G A;  1LEN A;  1BCX A;  4OI0 A;  3RMX A;  1KGY A;  4RHV 1;  1O8S A;  2YMZ A;  2J1S A;  1WA4 A;  2D6L X;  5FP7 A;  1RJ8 A;  1E5I A;  2RMU 1;  4NJ4 A;  3T1L A;  4PDW B;  3LDR A;  4JDN A;  2JJ6 A;  3FMG A;  1KS4 A;  3FHA A;  5JPN B;  1AYN 2;  3KD4 A;  1UAI A;  2V72 A;  4KNC A;  1FNZ A;  1LES A;  4LUL A;  4XFG A;  5FZ4 A;  1R1A 3;  2B9U A;  2DWR A;  4LKS A;  4I3P A;  4CDX A;  3NJV A;  4PLN A;  4IER A;  3VBH B;  4AGV A;  4DUX A;  4DEV A;  1ZA7 A;  3FC0 A;  2O14 A;  2FMY A;  4Q0V A;  4K7J A;  4GD4 A;  3KZ4 C;  2YFZ A;  2CHH A;  3ZFE C;  4RQP A;  1YJL A;  5C3O A;  2ET7 A;  5IAX A;  1GQP A;  2EA7 A;  2ID4 A;  3AP5 A;  3A23 A;  3VBS C;  2TNF A;  4O61 A;  2XXZ A;  1CPM A;  5FK7 A;  4N7U A;  5DXD A;  4MGK E;  4OHX A;  3AFG A;  1CGP A;  1CIY A;  1MEC 2;  1TZO A;  3ZLI A;  5GLZ A;  1TQ5 A;  4I0W B;  2D3S A;  3H3L A;  5FMO S;  4AXO A;  4DEQ A;  4UOJ A;  1NA1 A;  4Q4V 3;  5DN2 A;  3FUO A;  2QKD A;  3OY8 A;  2YC0 A;  4C90 A;  4QX5 A;  1MPX A;  3AXD A;  1BK0 A;  1O5L A;  2EID A;  3HN1 A;  4A45 A;  4IEW A;  2IXH A;  4HKW A;  1BEV 3;  5J96 B;  4PT6 A;  3HD8 B;  5EWS A;  1W6N B;  2B9V A;  5K8S A;  2DUQ A;  3H8O A;  1M4W A;  5GM0 A;  3ZXL A;  1SLI A;  1ULD A;  2PMW B;  3VKN A;  4QGM A;  3N4M A;  3MLJ A;  3CF6 E;  1X7N A;  3MFA A;  1O7F A;  3LEM A;  1V6J A;  2D5F A;  2B45 X;  2XHN A;  2O8Q A;  4GB3 2;  3AMQ A;  3PJQ A;  4YYO A;  4L8Q A;  4WVM A;  2Q1Z B;  3SKV A;  2W92 A;  1UYP A;  2XLA A;  3M1H A;  1BLZ A;  4CDU B;  4B3N A;  3JD7 1;  4RN5 A;  3KCY A;  2H6C A;  1C28 A;  2YV8 A;  2CNA A;  4PI0 A;  1RC6 A;  2BW8 A;  1RUI 3;  1W8N A;  2Y6G A;  3TB0 A;  1V70 A;  2ZX3 A;  1KRI A;  1YHF A;  4QXB A;  1ZZC A;  4I01 A;  2JDN A;  4IUG A;  2WS9 3;  4N43 A;  5DDJ 2;  3WHU A;  1V9U 3;  3ZDS A;  4TZD A;  3BOD A;  3ENR A;  4GH4 B;  1QDC A;  4AW7 A;  5D21 A;  2R07 2;  2CYF A;  2W52 A;  2FHR A;  2ZHK A;  3FZ3 A;  3J7H A;  5D8A A;  5H9Q A;  1XPW A;  4UW3 A;  4BOW A;  1CAV B;  1F2N A;  2VM9 A;  4AYU A;  4BQ1 A;  3RQ0 A;  1AUY A;  2JX9 A;  3H8R A;  1X9T A;  3WG4 A;  1UZ0 A;  1DG6 A;  1H8T C;  1QMJ A;  1YRZ A;  2LRO A;  4QHB A;  3LFM A;  3S5A A;  4FXG B;  2IXK A;  4MV2 A;  4CDU C;  2X29 A;  1CWP A;  1U5X A;  1QJU 3;  1VBE 3;  1FI2 A;  2HH9 A;  5FXW A;  5IFT A;  1LEC A;  2ZGQ A;  4ARY A;  5CFC C;  3I2K A;  5FYT A;  2P3Y A;  3MYX A;  2BWC A;  4YZ5 A;  5KHG A;  2K2S A;  2OT7 A;  3O14 A;  3DEM A;  3BTZ A;  2Q0A A;  3I59 B;  1QOS A;  3VBO C;  1ASJ 2;  3SIS A;  2RJK A;  1GNZ A;  4GH4 C;  5JSR A;  3UGG A;  4YZ4 A;  4HOO A;  3WDX A;  1AR8 2;  1C8N A;  3LKJ A;  5FLJ A;  2RR1 3;  2UU8 A;  1JU4 A;  4XFI A;  5L7O C;  4QPG A;  3OG2 A;  4XAA A;  4HL0 A;  3AX4 A;  1EUU A;  1NCR A;  3R4D B;  1VB4 A;  1BMV 2;  4XUO A;  1Y4W A;  4HVQ A;  1OF4 A;  2YB7 A;  4COU A;  4ZY9 A;  1J3Q A;  4AWD A;  2RVA A;  1CR7 A;  4MXW B;  2VMD A;  5EJ3 A;  3OGS A;  3AXE A;  3VDD A;  4C91 A;  1Z7S 3;  2P3J A;  2MEV 3;  2DUP A;  1LHU A;  3DPR A;  3TEX A;  1QKQ A;  2WT2 A;  3MIC A;  3BGA A;  1JTZ X;  1NX9 A;  5GZF A;  3ZR6 A;  2VAU A;  2YPJ A;  2G4I A;  1KDK A;  1VMH A;  5IVV A;  2MPF A;  3KVB A;  2VCB A;  2GP5 A;  4FPJ A;  5J48 A;  4NN0 A;  4E4Z A;  1DQ0 A;  2YHJ A;  5A7W A;  1NE6 A;  1R08 3;  5IVJ A;  1QJY 1;  4Y33 A;  1SEF A;  2D97 A;  2XQX A;  5CFD C;  3K4D A;  1OA4 A;  3A21 A;  4BZ4 A;  3ZXF A;  2AEY A;  4CU6 A;  4QB1 A;  3T2T A;  2JB8 A;  5DAV A;  2YBK A;  3AP6 A;  1H4H A;  2CWS A;  2WO1 A;  2RHP A;  3LEI A;  3EJK A;  2A5Z A;  3RSJ A;  1TNR A;  1E5R A;  3JBG 3;  5C8C A;  4XFC A;  2ZAC A;  5FMB A;  2Y38 A;  5FY0 A;  4LBQ D;  1ALY A;  2VVF A;  3KT4 A;  2VZT A;  4X6R B;  3W21 A;  1W9W A;  2QVS B;  3Q9O A;  4K21 A;  4X8N A;  1CIW A;  5FQ0 B;  5EYY A;  5JXJ A;  4A7Z A;  2VU9 A;  2ZA9 A;  4Q4X 2;  1FAT A;  1CAX A;  2VNV A;  1W06 A;  1D4M 3;  1SAC A;  4NPR A;  3III A;  2VZS A;  3CJI B;  5F1R A;  1GV9 A;  1FPN 1;  3H1W A;  1ZBE 1;  2J22 A;  1CVN A;  1YLL A;  4FP3 A;  4PBO A;  3HWJ A;  2DF7 A;  1GYK A;  2YBP A;  4RR3 C;  2LUW A;  3RZZ A;  1GKB A;  2RS5 3;  2BV4 A;  5E8A A;  1Q8S A;  1IS5 A;  2IUW A;  3ILN A;  1S0B A;  5IUQ A;  4B29 A;  1ULO A;  4BIO A;  1G9D A;  1ENQ A;  1DDL A;  4M01 A;  2JD9 A;  1HV1 A;  4PDW A;  3O5S A;  2WNV B;  3WCR A;  2WR9 A;  5E16 A;  5F6L B;  1UPS A;  4YM1 A;  3FJS A;  5C3S A;  3WNN A;  5EFU A;  3JXS A;  3OUI A;  3RZL A;  3UGH A;  3B69 A;  2I2S A;  5IWF A;  5FZE A;  1IG3 A;  3T2P A;  3ZXJ A;  4ES9 A;  4NID A;  4MYE A;  1DBN A;  1UY3 A;  4LEJ A;  1O3S A;  1UYY A;  3H8X A;  2F4L A;  1IOA A;  2QNK A;  2WZ8 A;  1JOP A;  2IVI B;  2P5B A;  3DEC A;  4IE0 A;  2WFF 3;  3VBH A;  4F8A A;  4FAH A;  3IM0 A;  4BB3 A;  3FLT A;  4LUK A;  4RL7 A;  4U2A A;  2VVE A;  3CZJ A;  4X6Q B;  1SLA A;  3Q8C A;  3KM5 A;  1GZW A;  4A44 A;  1KFU L;  1ND2 B;  1MS1 A;  1WLW A;  4RHV 3;  4KWK A;  3ASI A;  3WF1 A;  4D94 A;  2RMU 3;  2TUN A;  3T09 A;  3M4F A;  2GP3 A;  5GLW A;  2R1D A;  2ZMN A;  3UES A;  2QDN A;  4ARX A;  3B5L B;  1K12 A;  4BIS A;  4XQD A;  2Y6F A;  4R9B A;  1N3O A;  3HQR A;  2X5I B;  5FCC A;  3VUO A;  1HRI 1;  2PTM A;  3CLP A;  5I0U A;  5KC6 A;  3I49 A;  5KHK A;  4FOW A;  3RMY A;  3W20 A;  5F39 A;  4F7Z A;  5H9P A;  2BNO A;  2BUK A;  2XJV A;  1QWR A;  5IVY A;  1JYC A;  2IXC A;  4UI9 L;  4RS5 C;  2D6K A;  4F3J A;  2NP0 A;  2KD7 A;  5KXC A;  4OZO A;  5JMO A;  3OCP A;  4Q4W 1;  4UW5 A;  1J83 A;  2E6V A;  1ND2 C;  2JDA A;  1RUF 2;  1U5Y A;  4XTP A;  3ZXA C;  3GBG A;  4QKF A;  1W0P A;  1J3R A;  5GZD A;  2VJX A;  5IK4 A;  1GWL A;  1YEW A;  4YZ1 A;  2ZZJ A;  3FFQ A;  3CNA A;  2JXA A;  4R4X A;  1WZX A;  3LSD A;  1XND A;  4URA A;  3LA7 A;  4XE9 A;  1JZ6 A;  1JBC A;  3N7M A;  4PLM A;  3WF3 A;  5AFB A;  2QFE A;  5HI0 A;  2ARE A;  1B35 B;  4XJU A;  3ZFF B;  1BVV A;  4UFI A;  2SLI A;  5DAB A;  3MF6 A;  2ZGU A;  3U1X A;  4YRD A;  1I1E A;  3B00 A;  3ZYJ B;  2WN3 A;  1QOT A;  2W1Q A;  2QQP A;  2BVV A;  1A34 A;  2UWC A;  1SBE A;  4WM8 B;  1OFN A;  4FFI A;  1HX6 A;  4YW5 A;  5FP3 A;  3FBY A;  3UYJ A;  3C3V A;  4CDQ C;  2OA2 A;  2FCU A;  3DKW A;  4KU7 A;  4AFM A;  2QZ2 A;  4QPI C;  5ERL A;  4YSF A;  4YWA A;  4FOV A;  5F5Q A;  5BNN C;  2WZE A;  4D8M A;  4HON A;  2Y6J A;  3M70 A;  4P9J A;  5BNP A;  3HIF A;  2VZV A;  4P00 B;  3VD9 A;  3RZJ A;  3AMH A;  1Z78 A;  1ULG A;  2FDK A;  2GC0 A;  3TN9 1;  4ZS2 A;  3NKT A;  1OA3 A;  5C9A B;  3JD7 3;  3MFC A;  4IEQ A;  5A1A A;  2Q30 A;  4J25 A;  3WW2 A;  4FPL A;  5JUV A;  1PO2 1;  5FYH A;  1RUE 3;  1TMF 1;  3C7H A;  4QKB A;  3VGI A;  1VR3 A;  3O0X A;  2GN7 A;  1SFN A;  3B01 A;  4I2O A;  3QLQ A;  3VKL A;  3GJB A;  2XR4 A;  1GP5 A;  3BPZ A;  5I8T A;  3RYK A;  5A32 A;  1WA6 X;  3AZW A;  2HWF 2;  5FYY A;  1JZ5 A;  5A6Y A;  2VW1 A;  2E9Q A;  2VTX A;  4FAG A;  2GC1 A;  5IVB A;  4MHR A;  2D93 A;  5J37 A;  5F5C A;  4BQX A;  1FPN 2;  5CEH A;  3MZH A;  5FFO C;  2ZEX A;  3ORJ A;  4YG0 A;  1AL2 1;  4E2G A;  3LIG A;  1DLL A;  3WR0 A;  3WP4 A;  5B4X A;  5CAZ A;  2ZXQ A;  1ZZ7 A;  1PGW 2;  2JEM A;  3C7G A;  4P5H A;  4CP9 B;  5AC9 2;  5HPO A;  4S2D A;  2HEV F;  4QU2 A;  4GJZ A;  3NVC A;  1HJF A;  1J58 A;  5LB6 A;  3BTY A;  1XYN A;  4YGC A;  5DG2 A;  1KJR A;  2RS3 1;  4MGQ A;  4EJR A;  3IDB B;  2VC9 A;  3GZU C;  2C9K A;  1Z0H A;  3HMY A;  2P17 A;  3LOB A;  1UPI A;  1W0N A;  1I5Z A;  3IBM A;  2XL7 A;  2SBA A;  5A33 B;  3POI A;  5FLI A;  3LDB A;  5FZL A;  5E88 A;  3B7M A;  4W4Z A;  1CQ9 A;  1JYN A;  1VBB 2;  3U07 A;  2VZR A;  1AR6 2;  1HRV 2;  3I2I A;  2ZZQ A;  5FMC A;  1XNK A;  1QY4 A;  1UMI A;  5F3I A;  1W2T A;  4XC9 A;  4ZS3 A;  4XTM A;  1U5I A;  4MG2 A;  2VOW A;  3N7L A;  4BM8 A;  1HIX A;  1F5F A;  3I3Q A;  1IS3 A;  5BNO C;  2JKX A;  3BKZ A;  4UT5 A;  4DXT A;  5F5I A;  1LGC A;  4NHK A;  2D44 A;  3AL5 A;  1LGN A;  1US2 A;  2IZW A;  2XJQ A;  3VD4 A;  3KQR A;  5HCF A;  4YM0 A;  3A4U A;  4NVP A;  2HWE 2;  1CJP A;  3CKH A;  4WM7 A;  2DBI A;  2ZGS A;  2LM3 A;  3BYW A;  4XPV A;  1JOJ A;  3RS6 A;  1FOD 1;  4N9I A;  3WUD A;  4OI4 A;  1S1A A;  3E6C C;  1RMU 2;  1YNA A;  2ZKN A;  5K9Y A;  1LTE A;  5FQ0 A;  4LLO A;  3WY6 A;  3NL1 A;  4A41 A;  1RTV A;  5JI9 A;  3ZDV A;  1QJY 3;  3ZOI A;  3I7D A;  1VB2 A;  3UK9 A;  1AVB A;  2F6B A;  4ET7 A;  3ES1 A;  2X05 A;  4HG6 B;  2LAL A;  5CKN A;  3H3Z A;  4QB6 A;  4B7K A;  2D6O X;  2H0V A;  3OPZ A;  1PM7 A;  5J98 B;  1YYN A;  3AC0 A;  3N9N A;  1WCD J;  2V5Y A;  3BOW A;  2QJV A;  4H55 A;  4TLF A;  5E6H A;  1LCL A;  1BBT 2;  3CJX A;  1MS8 A;  2WQ8 A;  5T54 A;  2BPA 2;  2ZGN A;  1JI6 A;  4D6R A;  4MET A;  5GZE A;  4CUC A;  1LKN A;  4YG6 A;  4AVB A;  5JXG A;  1JXN A;  1S2B A;  3AMP A;  2R49 A;  2D7F A;  3FWE A;  3B9C A;  4NWV A;  1WMX A;  3WX5 A;  2MHF A;  3AK0 A;  4EV0 A;  1QXR A;  4HN1 A;  5CIS A;  1ZBE 3;  1COV 2;  5G05 L;  1Y9Q A;  1CAU A;  1AZD A;  5B4N A;  1QXP A;  5BXX A;  1XQN A;  1NKG A;  3D0J A;  3VZJ A;  2O8O A;  2HBU A;  4UAP A;  2VQA A;  3DKQ A;  4Z8B A;  1RUG 2;  2A3Y A;  4LIT A;  4QX0 A;  1PIV 2;  5DPN A;  5J3U A;  1LHW A;  1PO2 2;  1Q8Q A;  3FHI B;  4OUL A;  4D6Q A;  5IVC A;  2AH2 A;  2FZ1 A;  2FCT A;  1G8W A;  1RXF A;  1YQ6 A;  5JSO A;  5FYS A;  4B4P A;  3AVS A;  3ZN4 A;  1GWM A;  4JKK A;  1VLN A;  4Y5S A;  1I3H A;  1OOP A;  5C71 A;  3AP7 A;  3AJZ A;  2FCV A;  3OF1 A;  3EHK A;  3WXP A;  5C8W A;  2QUO A;  3AYA A;  4ZKT B;  3DCQ A;  2OVU A;  3WVJ A;  2CU5 A;  4CU8 A;  2K46 A;  2UWA A;  4Q1R A;  4SBV A;  3CHX A;  5FZC A;  2EIC A;  1I6X A;  4AHY A;  4TLG A;  3RGB A;  1PVC 1;  4S2G A;  3UET A;  4GJY A;  2QZ3 A;  1IG0 A;  3CBN A;  3AMM A;  2PLV 1;  3JQX A;  5G04 L;  1JUH A;  2AGS A;  3OSD A;  4DXZ A;  5JI7 A;  4N90 A;  1J84 A;  1OLM A;  2LW8 A;  2VW2 A;  1JZ7 A;  3AZZ A;  2W1U A;  2TBV A;  3WG1 A;  5KXB A;  3BIW E;  1K45 A;  4FTS A;  1DFQ A;  1HRI 3;  2DVG A;  5BUV A;  3MV1 1;  2XBO 1;  3UL2 A;  3U4X A;  3R4S A;  4XF9 A;  1DQ6 A;  5FOB B;  1B35 A;  5DZF A;  2BP6 A;  3R0R A;  2ZX0 A;  5C4W A;  1Y9M A;  2UYA A;  5FZ3 A;  1GUI A;  1H2L A;  4NO4 A;  3O1U A;  3NV1 A;  4JCK A;  1MZ5 A;  4WM8 A;  4ZU7 A;  4EN0 A;  1QJF A;  2IXI A;  4Q4W 3;  1LOE A;  1QH6 A;  3ZSE A;  3I2H A;  2E32 A;  1E5S A;  3N9M A;  3K3N A;  4B7E A;  1S0I A;  3IMM A;  3MEP A;  5FDB A;  1W6O B;  4NAO A;  1O4T A;  3VHN A;  3UKV A;  4AVA A;  3NNJ A;  5FKB A;  3LOI A;  2V4A A;  3M3I A;  4CDX C;  1GQH A;  4QX3 A;  2YUE A;  2DCY A;  1X82 A;  4BXS V;  5C9A A;  1EV1 1;  4K9S A;  1AYM 1;  3K48 A;  4M3C F;  1GLH A;  4UW4 A;  2VOV A;  1AYN 1;  2WNU C;  4QQ2 A;  4WBB A;  4OZX A;  1UU5 A;  5BPX A;  4YW2 A;  4AEM A;  3O1P A;  2P3K A;  3M3Q A;  1H1A A;  2ZKL A;  1J1L A;  1XNT A;  1FNY A;  1XYP A;  1UXX X;  1YC6 1;  1LHN A;  1PMH X;  4LBN A;  4CUG A;  4E2S A;  2ATF A;  3CO2 A;  1W03 A;  5C5U A;  1K5M C;  3OYW A;  2OUJ A;  2W9X A;  3U4S A;  4HMZ A;  1NA1 C;  1DZQ A;  3QCW A;  3TN9 3;  3VL9 A;  5A3N A;  3H42 B;  2VTF A;  1XRU A;  2XWJ B;  3PLQ A;  4EN7 B;  4CEY B;  4EWA A;  2UYB A;  2W95 A;  1KS5 A;  2LRP A;  4PF5 A;  1MEC 1;  1TMF 3;  3HR9 A;  4HKL A;  1NE4 A;  4LNV A;  2E31 A;  1LOC A;  4E2Q A;  1SHW B;  4AF9 A;  1NXM A;  5CKQ A;  2P2K A;  1DQ1 A;  2RDS A;  1YWK A;  3LQC A;  1W6P B;  1CD3 G;  3WLU A;  3IT8 A;  3J9S A;  2VOX A;  1IGO A;  2JE7 A;  1OBN A;  3KT7 A;  3KGZ A;  2BDR A;  3ON7 A;  2P6C A;  1AL2 3;  5K0U A;  1JYI A;  1UW8 A;  2YRO A;  2ZBJ A;  4IEU A;  1VBC 1;  2PFW A;  2W08 A;  4RGG A;  4XCB A;  5JR7 B;  3I2O A;  4LT5 A;  3P3N A;  5ABJ B;  1VBD 2;  1S2E A;  1GU3 A;  1FYU A;  4QXH A;  2BVB A;  1KQR A;  4EE2 A;  2XB6 C;  4GB3 1;  2AR6 A;  2Y26 A;  2VNG A;  1TEI A;  2RS3 3;  2C6S A;  4N43 C;  2WZP P;  2ZTN A;  4YVS A;  5A6Q A;  2IWG B;  5GZC A;  4RA0 A;  4F83 A;  2MNG A;  3A0N A;  4N7I A;  1N3Q A;  5I0D A;  5EJ1 B;  3IPV A;  4KL1 A;  2E26 A;  2GH2 A;  3DL3 A;  4O9E A;  3WNX A;  3POF A;  3ZFG C;  1SLT A;  4EN8 B;  1LU1 A;  1PNG A;  4L9B A;  4LBM A;  1ONA A;  3RYR A;  2PHW A;  4L97 A;  5DDJ 1;  5ANN A;  4ATF A;  4BIF A;  1RHI 2;  5GJ6 A;  5FPU A;  1SFY A;  1HB3 A;  2HBT A;  2R07 1;  4CDW A;  4KGG A;  3TBD A;  1XU1 A;  1I5P A;  2VEC A;  4AQ6 A;  3KLS A;  4EZ4 A;  1W28 A;  2J1E A;  4MGZ E;  1NZI A;  3L2H A;  4DB5 A;  1OSG A;  2PAE A;  1OI6 A;  3HBZ A;  5LBF A;  2OYZ A;  3ZMN A;  1QOO A;  5FLH A;  1VP6 A;  4MXV A;  4BWO A;  2RJ2 A;  1R64 A;  4E9K A;  4A3X A;  2XBO 2;  2VPV A;  3WHT A;  3NNG A;  1FOD 3;  3CEW A;  4NHL A;  3HT1 A;  4DMI A;  4OYU A;  1UN1 A;  4D7S A;  1MS9 A;  1Y9G A;  4ZZ5 A;  5T5O A;  2W2I A;  1NCR C;  4M3C A;  1PMJ X;  2R06 2;  3ZYG A;  1ASJ 1;  3POW A;  4OUM A;  3IB3 A;  4R9D A;  4CXY A;  2D3P A;  2PAM A;  4A6S A;  1O6U A;  1H1M A;  1WD3 A;  1AR8 1;  4Q27 A;  4DY5 A;  4OHZ A;  4JGZ C;  2YC4 A;  1NY7 2;  4N53 A;  3ZFE B;  3O1S A;  4OVE A;  1LR5 A;  3ZN6 B;  1G9A A;  2Y34 A;  4ONU A;  5FO9 B;  2ENR A;  2HLE A;  2Y33 A;  2R04 2;  4AQT A;  4XZU G;  2EAA A;  2P6H A;  4MX3 A;  4COV A;  4BQY A;  1BMV 1;  4GA9 A;  1QJX 2;  4UBH A;  3KVA A;  4MLO A;  1EV1 2;  1OVP A;  3ME2 A;  1AYM 2;  1HXS 2;  4FVV A;  4HPK B;  4BLI A;  1EAH 2;  3WQ7 A;  3GGL A;  2DTW A;  1BKZ A;  1CX1 A;  2WO3 A;  1K42 A;  3LGR A;  4RSU A;  3NAP B;  3HOB A;  3WG2 A;  3W5M A;  2XL9 A;  3TRS B;  4ZZ8 A;  5CG8 A;  3RWK X;  3RYP A;  3ZYP A;  1UZW A;  2VUA A;  2EAK A;  5LRR A;  3PVB B;  3AJY A;  3WW4 A;  5HXM A;  3AYD A;  3PMS A;  1O59 A;  5FYC A;  3T2O A;  1POQ A;  2NN8 A;  2JG9 A;  1HKD A;  1WW7 A;  3CDZ B;  5FIX A;  2GNB A;  2YC2 A;  2JEC A;  1TG7 A;  2I45 A;  2W1S A;  2W68 A;  3LPF A;  5A3M A;  3U75 A;  1PO1 1;  1YUD A;  5IT6 A;  5C8C C;  5FZ6 A;  4A42 A;  3HT2 A;  2HWD 3;  2AEN A;  1H9W A;  4M0H A;  2DFB A;  1N3P A;  3VHP A;  4P9I A;  3ZSJ A;  3HNY M;  2XJS A;  2PN5 A;  1PZ7 A;  5F7U A;  1UWW A;  5JPM B;  5T5P A;  4FPC A;  3ZKU A;  4AQ2 A;  2JG8 A;  3RPQ A;  2FD8 A;  4Q8K A;  1WKY A;  1F8V A;  3MV0 1;  2VZO A;  3T0D A;  3NAP C;  2QQU A;  2QQV A;  5BNQ A;  5F3C A;  1O3T A;  4BCU A;  3WZ1 A;  5L9B A;  1QEX A;  4HET A;  1ZM1 A;  3MUY 1;  3GHN A;  2FDJ A;  4BXF A;  1YFW A;  1EPW A;  1MZF A;  1PVC 3;  1RVF 3;  1HJG A;  4W6X A;  1H0B A;  3RJR A;  4Q4X 1;  4QDS A;  1H2K A;  2F4P A;  1VBC 2;  2IXJ A;  3VBU A;  4CVU A;  2PLV 3;  5FBZ A;  2XQR A;  4PQ9 A;  5FO7 B;  3KV4 A;  2C1F A;  4NE9 A;  1UCX A;  4ZXE A;  3MW4 A;  3EBR A;  1F35 A;  1OUR A;  3N9O A;  4S2F A;  5CBL A;  1DGL A;  4BQ2 A;  1JS9 A;  2AC1 A;  1W6O A;  1VAV A;  4IE6 A;  1H8T B;  2CAU A;  2BOI A;  3E1F 1;  1NLS A;  1ZVF A;  4LKF A;  3V65 A;  1AJK A;  1Q3E A;  1RUD 2;  1UZZ A;  1CN1 A;  1U12 A;  3N9Q A;  4LBK A;  2R6Q A;  3CMG A;  3X29 B;  5FZO A;  1GMM A;  4PHZ A;  4QX7 A;  5T50 A;  1HV0 A;  3HBK A;  4TXW A;  4XJW A;  3URF A;  5CFC B;  1L7R A;  2XKP A;  2OKX A;  1C3H A;  1IHM A;  4BQ4 A;  2R0F A;  3NJZ A;  1VRB A;  3VBO B;  1MQT A;  3ILF A;  1GNY A;  2XJT A;  4DNY A;  3AKQ A;  5JDB A;  1C5I A;  1C8M 1;  1GNH A;  1ZX5 A;  2WSV A;  3RZK A;  5KHI A;  3PUQ A;  3OB8 A;  4DO0 A;  5L7O B;  5FZD A;  3QH6 A;  1W9F A;  5D1I A;  4A6O A;  3H3U A;  1LOD A;  3ECQ A;  2CGP A;  1AYM 3;  3D82 A;  5FYB A;  3SCF A;  4GWM A;  3ZVX A;  1AYN 3;  4QQP A;  1J3P A;  1ND3 A;  3HJR A;  3T1M A;  3ZYH A;  1OD3 A;  2HYK A;  2WC2 A;  4LIU A;  1C1F A;  1XNB A;  5FZA A;  3O0V A;  1GZ9 A;  2Q4S A;  3RI8 A;  3EQE A;  3UT0 A;  2JDU A;  1C1L A;  1DCS A;  1RUJ 2;  2WIN B;  4XBL A;  5C5T A;  1SZB A;  4XUN A;  3O1O A;  1UF2 C;  3WQ1 A;  4I0A A;  5ISL A;  3KQ4 B;  4KQ7 A;  3NJY A;  5M0T A;  3VBR C;  4Q0P A;  4BYY A;  3ZN5 A;  2G9F A;  1GOG A;  5CFD B;  5ABJ A;  1RUF 1;  1MEC 3;  1T6B X;  3V56 A;  4QKN A;  3JZV A;  2VME A;  4YFW A;  4RFT 0;  1S0C A;  3ZPO A;  2HWB 2;  2BEO A;  2BBA A;  3B93 A;  4PI2 A;  4YNI A;  1RIT A;  3RDI A;  1OF3 A;  4CYD A;  1LAJ A;  4D6S A;  4LKD A;  1O3R A;  1DF0 A;  1GBG A;  1RIR A;  1DLC A;  1PK6 A;  1XE0 A;  4Y22 B;  5A7Q A;  4LTA A;  3D3A A;  4HT1 T;  4KG0 A;  4CZS A;  5BNP C;  2IFR A;  2BBV A;  1URX A;  2ZEZ A;  1VRH 2;  1UYZ A;  5FAX A;  5FUI A;  4IDZ A;  4MVT A;  5FZ7 A;  3TAY A;  2HKX A;  2QQJ A;  3I2D A;  3N7J A;  2VNR A;  2JDM A;  3D5O A;  3VBF A;  1AR9 2;  5CIR A;  1AR7 2;  1GOH A;  1QNY A;  3SC7 X;  4YAR A;  3SLI A;  3D0S A;  1PO1 2;  4AED A;  1M06 G;  2JDK A;  4H7M A;  2PEL A;  3VLB B;  4LHK A;  3JUU A;  4GB3 3;  3TYJ A;  5DMY A;  4RR3 B;  3K4Z A;  4YM3 A;  1JOD A;  1LHO A;  5F8P A;  5JZG A;  4AI0 A;  2GC2 A;  3J26 N;  5J09 A;  4FFF A;  4Y4Y A;  1W3X A;  4NRQ A;  4AVT A;  3ITQ A;  3FE5 A;  2RDN A;  2WWS A;  4RD7 A;  1OHF A;  2VTX J;  3BPS A;  3MW3 A;  1LED A;  1EP0 A;  3IAP A;  5DDJ 3;  3NJX A;  1YQC A;  2XJP A;  4P9L A;  2ZGP A;  1VIW B;  3P6B A;  2HWF 1;  1WLC A;  1KEX A;  2QE3 A;  2R07 3;  3QOP A;  2ZMK A;  1VJ2 A;  4FFG A;  4CPB A;  4DIQ A;  4W6Y A;  5LBB A;  3GZA A;  3WQ0 A;  1J59 A;  1MVE A;  3J7L A;  4XVH A;  1OD5 A;  1X50 A;  5EQU A;  2ET1 A;  1ZBA 2;  1RUO A;  3FL7 A;  3IWZ A;  2J1R A;  4QB2 A;  4KMQ A;  3ZO0 B;  4CCE A;  2ORX A;  3VBS A;  3SKJ E;  4AI9 A;  1UX6 A;  4IV3 C;  1IKP A;  1PGW 1;  5AC9 1;  3T3Y A;  4LBQ B;  5LBC A;  4GAZ A;  3WDW A;  2HYX A;  3KCX A;  1CAW B;  5JOX A;  1W05 A;  1ZRD A;  4UFH A;  5ACA 2;  4HZF A;  3NNM A;  1NCQ C;  4RGK A;  5FY9 A;  1UOF A;  1W2U A;  3WNM A;  2EF6 A;  4WZC A;  4LO8 A;  1ASJ 3;  3U37 A;  2RM2 2;  4QU1 A;  1JZ3 A;  3ZM8 A;  5L19 A;  1AR8 3;  5FXZ A;  3DF0 A;  3O1V A;  2OQ7 A; 
#chains in the Genus database with same CATH homology
 3N9M A;  3K3N A;  5FZ4 A;  5IVY A;  5FYZ A;  5LWB A;  2W2I A;  4BU2 A;  4CCN A;  4QXC A;  5FYV A;  5FYB A;  5LY2 A;  5A7P A;  2XML A;  4LIU A;  3OPW A;  5F37 A;  5FZA A;  5FPV A;  5LY1 A;  4GD4 A;  2OS2 A;  5FY4 A;  2YU2 A;  4V2V A;  3N9L A;  2XXZ A;  5IVV A;  4URA A;  5FZG A;  5A3P A;  5IVE A;  3KVB A;  5A7S A;  2GP5 A;  5KR7 A;  4EYU A;  4EZH A;  3ZLI A;  3KVA A;  5ISL A;  5F3G A;  2PXJ A;  5FJK A;  5A7W A;  3NJY A;  3PUS A;  5FYU A;  4TN7 A;  3PUA A;  5FY8 A;  4Y33 A;  5IVJ A;  2OQ6 A;  4CUG A;  5FZ0 A;  3N9N A;  2Q8C A;  5FP3 A;  3UYJ A;  5E6H A;  3U4S A;  4XDO A;  3ZPO A;  5A3N A;  2YBK A;  3K3O A;  4IGQ A;  5FP8 A;  4E4H A;  5A7O A;  4D6R A;  4HON A;  5FV3 A;  5FYC A;  4D6S A;  5F5A A;  3N9P A;  5FPA A;  5FYI A;  5FY0 A;  5A7Q A;  5FP4 A;  5FWJ A;  5A3W A;  5F32 A;  5A1L A;  3LD8 A;  5FPB A;  5FZ6 A;  5FZM A;  5FZ7 A;  5FUP A;  5FZH A;  4CCL A;  3KV9 A;  5FYH A;  4CCM A;  5A3T A;  4Y3O A;  5FY1 A;  3PUR A;  3DXU A;  5FP9 A;  5A80 A;  5ANQ A;  4LIT A;  5A7W B;  5F3C A;  5FYY A;  5FZB A;  2Q8D A;  4D6Q A;  5IVF A;  5IVC A;  2YBP A;  3PU3 A;  5LW9 A;  5FYS A;  5FXV A;  3AVS A;  4QXH A;  5IVB A;  4QWN A;  3K2O A;  4QXB A;  4UF0 A;  5F5C A;  5FZK A;  4BXF A;  5CEH A;  2VD7 A;  5K4L A;  5FZF A;  4UF0 B;  3RVH A;  5FBJ A;  5FZ9 A;  3KV4 A;  4QX8 A;  4IGO A;  5A1F A;  3N9O A;  4IGP A;  3OPT A;  5FJH A;  5FZC A;  4CSW A;  5FZI A;  5FZE A;  5IWF A;  4GJZ A;  2WWU A;  4GJY A;  5FXX A;  4DIQ A;  3AVR A;  2P5B A;  4Y4R A;  5FYM A;  2YU1 A;  3PDQ A;  4ASK A;  5F3E A;  3AL6 A;  4CCJ A;  3KV6 A;  2YPD A;  3N9Q A;  5F2S A;  3PU8 A;  4V2W A;  2WWJ A;  5A7N A;  2Q8E A;  5FWE A;  2YBS A;  5FZO A;  4QX7 A;  5FPU A;  5FXW A;  4AI9 A;  5FZ1 A;  5FYT A;  3LDB A;  5FZL A;  5FZ8 A;  5FY7 A;  4XDP A;  4CCK A;  3KV5 A;  2OT7 A;  5FZO B;  4EZ4 A;  4LIV A;  2GP3 A;  4CCO A;  3DXT A;  1VRB A;  4LXL A;  4GAZ A;  4BIS A;  4C8D A;  2OX0 A;  5F2W A;  2XUE A;  4HOO A;  5F3I A;  3U78 A;  5FPL A;  5FY9 A;  5FZ3 A;  3PTR B;  5FP7 A;  3PUQ A;  4AAP A;  4DO0 A;  4NUB A;  5FZD A;  5IW0 A;  4QU1 A;  5F39 A;  5F5I A;  5FY5 A;  3AL5 A;  5FXZ A;  2OQ7 A;  2XDV A;  5FUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...