5A3OA

Crystal structure of the lecb lectin from pseudomonas aeruginosa in complex with methyl 6-(cinnamido)-6-deoxy-alpha-d-mannopyranoside at 1.6 ansgtrom
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a3oA00
2VUDA 1OUXA 1OUSA 1W8HA 2BOJA 2JDPA 4AOCA 2BV4A 2WRAA 5A70A 1OXCA 5A6QA 2JDKA 2JDUA 1W8FA 1GZTA 5A3OA 2BOIA 2JDYA 5A6XA 1OVPA 1OURA 2CHHA 2JDHA 2JDNA 1UQXA 3ZDVA 1UZVA 2VNVA 2XR4A 5A6YA 3DCQA 5HCHA 5D2AA 1OVSA 2VUCA 4CE8A 2WR9A 2JDMA 4UT5A 5A6ZA 2BP6A
chains in the Genus database with same CATH superfamily
1UW8A 2A70A 1F2NA 4ITCA 4CRQA 4JVAA 1VMFA 3C8XA 5C3QA 4META 1OKOA 3KT7A 1JYIA 2TUNA 3GM8A 1H8TC 3FZ3A 3OUJA 2K0GA 1AYN3 3U37A 4QWNA 3B02A 4MOAA 5A7OA 3X29B 1F35A 2WSUA 1PHMA 4QDQA 1POQA 3LEMA 5T5PA 2JIGA 1AJOA 2B39A 5I0UA 2CDPA 3IDAA 3RYKA 1SLTA 5CG8A 1VJ2A 3WP3A 3U07A 4CSWA 1P8JA 1K3IA 1PIV1 2P3KA 5K0UA 4LBMA 4AAPA 1HB2A 4YLZA 4CE8A 1POV0 1BBT2 1WCUA 4Q4X1 1N1SA 3D4KA 4AI2A 4UW3A 4EYUA 2ZKNA 2FQPA 4AGVA 1LU2A 5HV4A 3ZXLA 1CJPA 5A70A 1RHI2 3H8OA 2JE9A 4IEYA 5A32A 3ZX7A 4YSFA 3KCXA 1WMFA 2Y8KA 2WYSA 1COV2 1VBB3 5FMOL 2QQIA 2HBTA 1QGLA 3T30A 2WZ8A 2ZX1A 2P3JA 3P5BA 2GMEA 1BEV3 4AFBA 1PO22 1YUDA 3PUQA 3VBHB 4CCNA 1RUH1 5FPAA 1VBD1 1LU1A 2PQQA 5H9SA 3RGBA 4QPGC 5KXEA 5FPBA 1IHMA 1UKRA 4ZY9A 5E16A 5LZ6A 5L19A 2E31A 1LKNA 3VBFC 2RVAA 1I3HA 1NA1C 3C7OA 2V5DA 3JD72 3MIGA 3ALQA 4XBQA 5F3EA 1OBNA 2A6WA 3K51A 3IIIA 1HJGA 1RXGA 1UD1A 4FT8A 4PIXA 4W50A 3ZFFC 5GZFA 2Q0AA 2VAUA 4YGDA 1OPOA 5F6LB 2GAUA 3ZFGA 1DZTA 3WHTA 3POIA 2BGCA 4OUEA 4NHKA 4ZU4A 2XJTA 4IEVA 4YVSA 1YXWA 2ZHMA 1AR72 4IEZA 1YJKA 2VQAA 4MGIE 2UU8A 3AZXA 4PIYA 3ZYBA 4L92A 4XMIA 3VD5A 2WS92 3POJA 5JOZA 1RUOA 1UY1A 1WLDA 4NUBA 5CB7A 4MGZE 3WNXA 1AVBA 5F37A 2WO7A 4QD2A 4K7JA 4AVBA 5IVCA 4K1YA 3MF6A 2R041 4QB2A 2D98A 3WQ0A 3D0JA 3VZNA 4LO7A 2JKBA 3E1F1 2AEYA 3K4DA 4GKYA 4E8CA 4YM2A 1PO12 2BGOA 4QX7A 1WUVA 5DMYA 4RHV3 2WQ8A 4JTNA 5IYYA 2R0HA 1MEC1 1TZOA 4PLNA 2E6VA 1FI2A 4HK8A 1G9BA 2X53S 5HCAA 1XRUA 2CV6A 3H7YA 1H2NA 3T2OA 2IC1A 4MHUA 2V5YA 4IV1A 1OFSA 4CU8A 1CAUA 4LBQA 3IDCB 5GZGA 3TOJA 5JXIA 3MLLA 5LRSA 1OLMA 4CUBA 2J1AA 3CO2A 1DQ6A 3ILRA 3T0AA 4HT1T 4CCCA 3ECQA 3WNOA 1Q8VA 4J1WA 4Y22A 4A42A 1GP4A 2FZ2A 2RS33 3ZXEA 4C1XA 4CXYA 2OIIA 3CJIA 3PMEA 1DYOA 3EQEA 5T5JA 2O8QA 4CEWB 5FMDA 1I5ZA 2GP5A 2LM3A 2RV9A 1AR61 1Z7S3 3LEGA 4BB3A 2VZ1A 3HD8B 1PIV2 3WF4A 2AZ5A 4Q0PA 4PQQA 1WCDJ 1ZX5A 2VCMA 3VBSC 5BYNA 4Q4X2 3ATGA 3SH4A 4CDWA 3V0BB 2Y64A 1EV13 4XPVA 5FP4A 3UT0A 3OCPA 5B4NA 3THPA 1YQ2A 3HR9A 1UCXA 1C8M1 3WG4A 5CFDC 2IXCA 4XUOA 2XWBB 4AQSA 1R1A3 1UYXA 4BQ4A 2BP6A 3PU3A 5FO8B 1KFUL 4MV2A 1H2MA 2CU5A 1JYTA 2YHJA 1WZXA 2HWB2 2GC2A 4FFHA 4AHZA 5IVYA 1NG0A 4XMAA 1Y43B 4RFRB 3RSJA 1XSRA 1YWKA 1MZEA 3KS7A 2DCJA 2ZEXA 1QDOA 2D3PA 3M3CA 4QQOA 5LK7B 5J96B 1UU4A 4QKBA 2HEYF 3LSDA 3ZM8A 1KEXA 5DAWA 1PK6B 1UY2A 3WR0A 3DPRC 5FKBA 4YZ5A 5I8TA 3QBQA 3H3ZA 4CP1A 3H3LA 3WDXA 4TTGA 2LW8A 2OKXA 3KV5A 5HCFA 4XJ9A 5DZEA 5F32A 4B8EA 2CYFA 3INAA 1LNSA 3ZFEA 3ZOIA 1G6NA 3VDAA 3ZYFA 4I02A 5SV8A 4W6XA 1W8HA 2BUKA 1RUE1 2WL1A 4R9AA 3ZYHA 3AZWA 1YNAA 1RITA 3IT8A 3POGA 4COYA 4W8JA 2YFUA 5I93A 1V0AA 3KSCA 4LO4B 4OHWA 2VW0A 2ZACA 3C7FA 5LBBA 4A45A 2JDHA 2HWD3 5A7QA 4WM8A 1HXS1 1YFWA 3P3NA 4DXRA 2R042 1OMIA 1OOPA 1LHUA 2VUCA 4NHYA 2D7FA 5A3LA 3AK0A 3HMYA 4A41A 1PVC3 4GMP1 2WFF3 4CZSA 1SLLA 3DL3A 3W59A 1ZA4A 4GWJA 4M00A 2VOTA 3V56A 4QKDA 4EV0A 5K9YA 3IWZA 2CGPA 1MEC2 1H6YA 3PU8A 1XNAA 4FPOB 1XSQA 2ZAAA 3GZTB 4P5HA 2MEV1 4I2OA 2VMFA 3PTYA 4P9WA 5C8CC 4QAWA 5FZOA 4DOUA 4HOOA 3ME2A 4LO6B 1REFA 3AMNA 4XUTA 2DF7A 1YI7A 1VAMA 2ZGUA 3IIAA 3NAPB 2VNRA 3AKPA 2JDYA 5BNPB 1X7NA 2JB8A 1PMJX 1R091 5A7WB 3WG3A 4BHPA 2XOMA 3FC0A 3UKNA 1BK1A 4CEYC 2QZ3A 2RS52 4GKXA 5A3PA 5LK5A 4CUGA 2WWJA 4EN6B 1IPJA 4PF5A 4MADA 4MVTA 5BNOB 4XFCA 1O3RA 1BYHA 3BPSA 4AL9A 2YC0A 5BY5A 4PI0A 1J84A 3WD5A 3MW3A 1ZBE3 1YQ6A 3AZZA 2YB7A 3LQCA 3QLQA 1IPKA 4BK5A 1QJY3 2CWSA 3KM5A 4WM7C 3WW3A 2YU2A 2WN2A 4LBNA 4M3CF 4M3CA 2XBO2 1YLLA 2AENA 1B35C 3ZXGA 4L99A 3JBG1 1CPMA 3ZXJA 4OQ8A 1C8M2 3ZYIB 1XNCA 1US3A 1EPZA 3M3EA 4LMFA 4F3JA 4UF0B 2I74A 4EZHA 2WZR3 2VECA 1W04A 4A7KA 1NQDA 1SLCA 2X5IA 4NHXA 4Y4RA 5EJZB 1I5PA 2WZPP 4QDRA 2WIIB 4MXWB 2E7TA 1LOFA 2VR4A 1ZBA1 4GWMA 4EJRA 1I9RA 2WNVA 5LY2A 3VZLA 4OI1A 1HV0A 3SC7X 3OYWB 5C5UA 3BI3A 1OHFA 3T3YA 4B3NA 2AC1A 1F4HA 1CX4A 1FPN1 1CZSA 4IEWA 4Y5TA 5DZGA 5BNNA 4YW4A 1NCQA 1PNGA 2HWE1 3GJBA 5IK5A 1UOBA 4MH0E 2VZSA 1Q8PA 1QEXA 3OPTA 1W2OA 5DUWA 5FZFA 4HKLA 2CAUA 4IGPA 4LE4A 3FLPA 2ZBJA 4X8NA 5EPAA 4BU2A 4Q29A 5IVJA 4Q26A 1ULGA 3TB0A 4XACA 1MVQA 2Q8CA 3VDDC 1QQP3 2A75A 2P5BA 4MGSA 4DUXA 3OOXA 4LHKA 4XIKA 4EN8B 2FD8A 4P08A 1ND2C 2RS11 2WABA 2VVFA 1E5HA 1HXS2 1RMU2 2VMCA 5DXDA 4D7YA 2ID4A 1CPNA 5L7OB 4Y20A 1QJEA 1QJU3 1W6MA 2DFCA 1O4TA 4A6SA 3W5MA 4ZPIA 1S1AA 3T2PA 4W6WA 4TLGA 3SITA 3FMGA 4IUGA 1JI6A 4YW3A 2VMGA 2ZA9A 2HBUA 2A7AA 4AQTA 4P9IA 3O0VA 1GWMA 4HPKB 4UW5A 3GDBA 5CAZA 2RM23 4ZZ5A 5AFBA 2A6XA 1SPPB 2WO2A 4GB33 3O1TA 4RR3A 3ZMOA 1OSGA 4RS5A 2XVGA 1JH5A 1VP6A 1SCSA 3BKZA 2IVIB 3OSDA 4QGNA 4Y1XA 4IEXA 1FV3A 2PLV3 1PMHX 1UO9A 1WW5A 1PM4A 1QU0A 2PMWB 2WZEA 2ZGTA 4UBGA 3U4SA 1N1TA 3WSOA 1R083 3AKTA 4DRRA 4EROA 3POWA 1K5MB 2BRTA 3Q8CA 5I0TA 2G1MA 2Q5TA 2YZ4A 2VULA 1GOHA 3P6BA 1VRBA 2VBBA 3RG0A 4CA9A 1H1MA 3EHKA 1RUJ1 4LHNA 4AHXA 1HIXA 3VLBB 1HN0A 2SBAA 3AMMA 4O9EA 2GP3A 1UIJA 1AYM1 5FQ0B 3H8XA 3PL0A 4QKNA 1LULA 4N43C 4G4FA 4MLOA 1NE6A 4MGYE 3FUQA 1IS5A 4YVWB 3LE0A 1FMD3 4E4HA 4G9SB 3POSA 4OVEA 1FOD1 2WFPA 3KV9A 3F2ZA 1IG3A 3MIDA 1SLIA 4FPJA 4FQ4A 3V0AA 4V2VA 4Q4V3 5ABJA 1POV3 1UYPA 3ZXDA 2X10A 3IPVB 4KI5M 5LA9A 3GZAA 1GR3A 1ZBA2 4NAMA 3HT1A 4XDQA 5LATA 1CAWB 5DAPA 2ZEWA 4P9LA 3DN7A 4A6OA 4Q0QA 2WR9A 1GLHA 5F5IA 2OW4A 5FUIA 4XTPA 3VZMA 1HRV3 1GNYA 3WNLA 1W3XA 1YHFA 3P3PA 1RIRA 3BGAA 4D0QA 3IB3A 4IGQA 4AVSA 4XFGA 3CU7A 4IW3A 3THTA 2O14A 1NCRA 4M01A 4UW4A 3WP4A 1X9PA 3B9IA 3KQ4B 5E6HA 1L7RA 3DGTA 1LJ7A 3N7KA 5FZ4A 3H8RA 1XBFA 1BVP1 1DG6A 1ULOA 4CP9A 1PGL1 4HVQA 3I4IA 5FZBA 3J8F2 5I0DA 1OVPA 3CJXA 3I2IA 4GQ7A 2WAOA 4FTEA 4XEZA 3KF3A 4AZZA 1YCIA 3TNPB 3I54A 2DCKA 1T6BX 2VTFA 1XNBA 4QPIB 4XETA 4PDWC 5M0TA 3A21A 4E4ZA 5GLVA 3EJKA 4Q4Y2 5FPUA 4Y24A 2RS12 1HB1A 1ODMA 3OBAA 4NPRA 5ERLA 4YYOA 3WW4A 1WBLA 1ENXA 1HX6A 1ODNA 1VBE1 4XF4A 4XDPA 3N4MA 4WM8B 2DTWA 3KF5A 1I1EA 2GMPA 1RUG3 2W1UA 3ENRA 1SBDA 1Q8QA 4RGKA 3FHAA 4RN5A 1IQDC 5IFTA 5JR2A 2ZX0A 4Q0SA 1ZREA 2VZUA 3B3QE 1QH6A 1VMHA 1YYNA 2XJUA 3AFGA 5FBJA 3D0SA 4RQPB 3UJOA 4CDXC 2B4KA 3RI8A 3WP6A 3NKTA 3GZEA 3VHOA 1SFNA 5J3UA 3BIWE 2XWJB 1GBGA 3V64A 4AVVA 1AR92 4QU1A 3ZDSA 5C71A 3W5NA 1WD3A 3B94A 3OJBA 3K77A 5EYXA 1SDWA 2LRPA 5FOBB 4HL0A 4IE6A 4X8PA 1AR82 4NRPA 2Y6JA 4LBLA 3VBHA 3GHMA 5FYYA 3FN9A 3I2JA 1OH4A 3OTFA 2NMOA 1S0IA 4LOSA 1DGLA 4CPBA 4GWIA 1MPXA 1UWWA 4R52A 5AVPA 2RMU1 3FBMA 5EV7A 2W68A 3T0BA 4Y5SA 1LEDA 3QCWA 4OMCA 5JXHA 3SH5A 1RUJ2 4QM8A 2IVJA 2YUEA 3MF9A 5JZGB 3E5QA 2YMZA 5FYSA 1TG7A 1AYM2 2QQJA 3JXSA 4FOVA 1NLRA 1G86A 2WKKA 1GZCA 3WT3A 5C4WB 2OA2A 2JG9B 2DBIA 1SBEA 3C7HA 4XJWA 2WINB 4AXOA 3I7DA 2Q30A 2LTNA 3TRSB 1S0DA 4Y5Z0 1CAVB 4LBJA 4JTOA 4GA9A 2DVFA 3HN1A 4GZ9A 3MIBA 4BXSV 1VB2A 4JGZB 4GXLA 4FPYA 4AR2A 1Z0HA 2R061 1RUC3 1ZZ9A 3C7EA 3NL1A 2PAEA 5FZ9A 4DNYA 1Y9GA 3KCCA 1RUNA 4ARYA 1K45A 2C5DA 2YBSA 4Y1UA 5J48A 2I2SA 3OG2A 4FFFA 2Y6LA 4BISA 1UYYA 3O7OA 2DBNA 3ZYJB 1QJFA 2DUQA 4RYDA 1KS4A 1DU3D 2EXKA 3J26N 4KU8A 4AFMA 2VMIA 4U2AA 4N8MA 1DF0A 3LPGA 3UYJA 5K7PA 4Y1YA 1COV3 1GOFA 4CYDA 4IE7A 3PNAA 2VD7A 3DYMA 3M70A 4N90A 3DV8A 1PO23 4G3YC 1XU1A 1GUIA 5FRAA 4R8HA 1JZ7A 3GXUA 3D5OA 4UAPA 3MLJA 4GJYA 4IE4A 3B5LB 5A3MA 4IQPA 1FX5A 3S5AA 3JD73 1ZRDA 3WXPA 1WD4A 5FXWA 4DY3A 4E2GA 2QQUA 4JAAA 4CEWA 3AFKA 1Y4WA 2H6CA 2P3IA 4QM9A 3AMQA 4LHSA 1IS6A 2WQZC 1EAH2 4CXXA 1DGWA 1DLLA 1SDDB 1VRH1 2J1RA 5CBLA 1V6LA 1YJLA 1CJDA 5IVBA 3V0BA 2BJSA 4E27A 4CDQB 3MYXA 2G9GA 4HANA 2WS93 3MO4A 2KA3A 2PFWA 1RC6A 4NIGA 3N7JA 5A1FA 1JBCA 3SHRA 3DF0A 3OD4A 3AYEA 4Q5OA 1FYUA 3FUOA 4IESA 2D6LX 2JDNA 3ZYPA 2WWSA 1O3QA 5FY8A 2BYVE 2XVKA 3AP5A 4LPLA 1F4AA 3MICA 1PO13 4ZKTB 5BPXA 2ZMLA 5EHDA 1XYNA 2DU0A 2ADEA 5FYHA 1PK6A 3I2HA 4K1ZA 1O4ZA 2D6NA 5FLJA 2OXBA 5FXXA 1H8TB 2RMU2 5FLHA 1TMF1 1W9SA 4FXGB 3WINE 5IW0A 4XURA 5FUPA 3NV4A 2VTXJ 1BLZA 4FO9A 4KH9A 4QHOA 3VKFC 5JSPA 2H0BA 4A2UA 2ZPXA 1G9AA 5FYTA 4XJ8A 3FJSA 1UAIA 2JKXA 1XXNA 1GANA 4Y3OA 1OURA 5IWFA 5HI0A 5CVRA 2VZPA 1MS1A 1V6MA 2DVBA 1OC1A 5ISLA 5F2SA 4FP2A 2PHFA 1EUUA 2RJ2A 2ZABA 3IZOA 3MGUA 3ITQA 1DHKB 3ON7A 2RHPA 3MUZ1 3PVBB 4HXCA 4AEDC 5A6ZA 3QD6A 3THCA 3WV6A 2VUDA 1BVVA 1MACA 1ND3C 1PIV3 3I97A 5H9RA 3UKTA 3ZSEA 4F83A 4FPCA 2Y60A 5F5AA 3WDUA 5CYYA 1YRZA 3RWKX 1JOJA 1NT0A 2D3RA 4KWLA 2W92A 1RXFA 1OXCA 2RR11 4OZOA 4Q4X3 5FY4A 4AOCA 4BE3A 4CCMA 1X8EA 4EQVA 1KJLA 5ACA1 2ATFA 1TME3 4JDNA 4LO8A 3Q8BA 1E5IA 4XF0A 4PI2A 4XJAA 3HQRA 1H8VA 1KJRA 4MGKE 1V70A 4XZUG 5E8AA 3UJQA 1ZRFA 2KM2A 5HCHA 4QPGB 2B7YA 4D6RA 2HWB3 2PN5A 5FXVA 4BIFA 5FP3A 5CA6A 2ORZA 3OEBA 5DG1A 5K4LA 2QQOA 2JG8C 2WNEA 3VBFB 3NAPA 1HRI3 1NA1B 3WNMA 5BNPA 5FMOS 3E6CC 3RJRA 3B01A 1JZ6A 2R071 5A7WA 1L3JA 1JZ5A 3WNKA 3I3MA 2Z42A 1G9DA 2X09A 1XJAA 2G9ZA 3ZFFB 4JGYC 1LENA 3W9AA 1O3TA 3ZXFA 4MSVA 3HNMA 5BNOA 1BCXA 1SFPA 1S0GA 2Q1MA 1URXA 4TLFA 4C8DA 1ZVFA 1RGSA 2HH9A 2EICA 1Y9QA 1J3RA 2VXJA 4HETA 3LDBA 4JZRA 3DECA 5A3UA 4S2GA 2Y6HA 5CEHA 4B1LA 5CZKA 2JENA 2P2KA 3H1WA 4NIAA 3ZXAC 1VRH2 2AUYA 4B29A 3MW4A 1ULDA 5FPXA 2JE7A 4LXLA 2QQLA 3K4ZA 4OUSA 2R49A 2VZTA 3NW4A 4JHTA 4CU7A 4OUMA 3WX5A 1DQ4A 3J4UH 1LOCA 4UF0A 1ZZ8A 1LHNA 3P1IA 1U5ZA 3RS6A 1XU2A 2VCCA 3N9PA 3BB6A 3PIJA 1A8DA 2R043 2BQPA 4K8RB 4PIZA 3FHIB 2ETEA 1AL21 1KQRA 4BLJA 4YGEA 1WLCA 4MXWA 1WMDA 1CVNA 4P02B 2YC4A 4ZU5A 1KRIA 2ZGPA 3ACLA 5FY5A 4XVHA 1NY72 2GH2A 2WT2A 4S2DA 5JOXA 2DCTA 4AWDA 4XIOA 3OYWA 1V9U1 4HVRA 4WVMB 3PJQA 5FBZA 4IV3C 3MFCA 5JVVA 2FDKA 1NXD1 2XVLA 3NRUA 1TMF2 3LZZA 5LASA 1ST8A 1IPSA 4MZUA 4BH9A 3MZHA 3NNMA 1SHWB 1VLNA 2RJKA 1YI9A 3VBRC 4COUA 4W6YA 3IAPA 1QNYA 5LA0A 3E6DA 5T55A 4IGOA 1WA6X 1QY4A 2OZ6A 1S0EA 2LROA 2RS53 5FAXA 4QXCA 4NE9A 5LY1A 3AZVA 3CF6E 4Q4W2 4R4XA 4D94A 1GOGA 4CU9A 3VBSB 1BZWA 4B4QA 2GC1A 3T2QA 1QDCA 3OUHA 5JDBA 1WGPA 5CFDB 1JOPA 4J1XA 3VL8A 5L7OA 1UU6A 2R32A 4KBZA 2XBO3 3WF2A 5FV3A 4YZ4A 2RR12 3T0DA 3OGGA 1RUI2 1VBC2 4LLFA 3CIHA 2L9LA 2VM9A 4C91A 4KU7A 1VE0A 1GSLA 4NAOA 4CCLA 1C8M3 1DIWA 2AEZA 4UFHA 3TAYA 4WVVA 1DQ1A 2W47A 4U36A 4BWOA 2P4EA 1E5SA 4HPKA 4DQAA 2Y6KA 2DURA 2YBPA 3ZSLA 4LKDA 1SPPA 3DPRB 1RL3A 4XUPA 2B45X 4I0AA 1APNA 5A3NA 4IXLA 4HSJA 1DZQA 3AZYA 4MHRA 5FP8A 4BM8A 2IFWA 1L7LA 4EWDA 1SBFA 1XE7A 2W1WA 3H3UA 3FL7A 1DQ2A 1YO8A 2GSYA 5FZ0A 1K5MA 3R6SA 2QFEA 4FVVA 5LWBA 3KVBA 1J59A 1VBB1 3AVSA 1DYKA 3VBOC 3ZO0B 5BNQA 4OHVA 1BEV1 2D40A 2VUJA 2EXJA 4PJYA 3S6PA 2VZRA 3KGZA 3PUSA 1S0JA 4Z2AA 1ZZ6A 5FQ0A 3H0OA 2VOVA 1OFNA 3OY8B 4I0WB 1T2XA 4LQRA 5HBAA 2YYOA 4YVWA 3LSEA 3WDYA 1DQ0A 2JE8A 4X6RB 5EJ1B 1HB3A 4NIIA 3VZKA 2FDGA 3AP4A 1PVXA 2C9KA 2BNMA 2IXHA 5FZAA 1HXS3 1RMU3 1XQNA 2WC2A 3BCWA 5A1AA 2P3YA 1AL22 2QNKA 3CNAA 1OUSA 1GQHA 1OLME 5F6KA 2VW1A 1NXMA 3RDIA 1ENSA 3IPVA 2Q8DA 2UYBA 1O91A 4J6GA 1FT9A 4FPFA 5C8CB 4GMP3 1CAWA 3A22A 5D21A 4DEQA 5IATA 5KHJA 3H1MA 2Z5WA 1UZZA 2IXIA 2ZJCA 5LRRA 3IDEA 4IE0A 1V9U2 2P6HA 4O61A 1BK0A 2R1BA 4M4PA 1RUH2 4ES8A 1VBD2 1JUHA 2HWC1 3OEAA 3HIFA 4CEYB 2RDNA 3O1SA 3KWVA 5DZFA 3WOGA 5EFUA 4B1MA 1DGWX 1YIPA 5CU1A 3J7NA 2CTVA 1OA4A 3OBTA 5FY9A 1TQ5A 1HW5A 1WW7A 3GJAA 1RJ8A 5DUUA 3SEEA 1JU3A 4RHV1 1UZWA 4ARXA 2E51A 1ALYA 4BQXA 3SQOA 3S30A 4WM7B 3TN91 3RZMA 4GH4C 3BPZA 5EWSA 1HV1A 2PAMA 3ACHA 4OHXA 1JODA 3NNLA 4QPIA 1B35B 3NO8A 4XOGA 5TSWA 2EAKA 3BTZA 2Y38A 4AHYA 2YDEA 5LBFA 2ZCWA 1MQTC 3ZN4A 2GDFA 1JXNA 3GYDA 5HPOA 3KZ4C 2WT1A 1U12A 3CMGA 4K6BA 1SEFA 4FFIA 3S7EA 5B4XA 4H3WA 4D6QA 1GICA 1ZRCA 3ZN6B 4DINB 2GH8A 2BVVA 1Q8SA 1GV9A 1R64A 2ZHLA 3WUDA 3IDBB 3O5SA 1UXZA 2Y0OA 4RQPA 1YQ5A 2BBAA 4ZS3A 5FZMA 4NIHA 2BNOA 3N9QA 2XXZA 4MX3A 3AKSA 2ZXQA 4I3PA 4ZXKA 5DN2A 1CD3G 1K12A 3QOPA 5GKAC 1ZBA3 2EALA 2DDUA 1F15A 2VQTA 1LEMA 2J1EA 2WDBA 3H7JA 3PUIA 5GALA 4D7SA 4DEVA 2V73A 2XR4A 4AHWA 3BN6A 2B42B 3ZSMA 1O5LA 2DV9A 2D5FA 3B00A 1W2UA 2E63A 5J98B 2EIBA 3ZMNA 5C6CA 1DZRA 2ERFA 4FTBA 1AXYA 1RVF1 5F3CA 3HAGA 1IOAA 4E9KA 4N53C 4N7UA 2D6PA 2A73B 5KHKA 4M0NA 5T3NA 3VDDB 4LKEA 4XFFA 3J8F3 4L11A 2C24A 4CCJA 5JZGA 2TNFA 1AR62 4ATFA 4FFGA 2BV4A 1ND2B 3U14A 2VZ3A 3CKHA 5FZCA 1SQ4A 1J1LA 5FPVA 2GNDA 4IEOA 4XFBA 1LR5A 5DDJ3 4Y4YA 3M2MA 2BERA 2JG9A 5C4WA 3C7GA 4AI8A 3CEWA 4Q4Y3 3TEXA 5AC93 2WNUC 2RS13 1W6OB 4HFSA 2D6MA 3Q9OA 4JCKA 1CAVA 4P00B 4ORFA 1VBA1 1W8NA 3BALA 4JGZA 4LK7A 2W46A 1W0PA 2JIJA 5CFCC 1RUD1 3I59B 1S2KA 3LEIA 4XUQA 3ZKUA 3MIHA 3BU0A 4COVA 4AI3A 5JPNB 2B5HA 2VH9A 5FFOC 1JMUB 2W08A 4XF9A 2HWD1 2HWC2 1O7FA 5A6QA 1AR93 2D44A 1W8TA 1GZTA 3QH7A 5FYVA 1PVC1 4M3CE 1CZTA 1IQAA 3BVCA 3LD8A 1AR83 2V4AA 1RUF1 1YFXA 3NNJA 4I0BA 4OLLA 4RHV2 1AUYA 5JCTA 4IETA 1DBNA 2HWF1 4XAEA 1W2NA 2XJSA 2RDSA 1RUE2 2VQUA 3ASIA 3TN92 3WNPA 5C9AC 2OS2A 3UL2A 4PT6A 2I45A 4N43B 2CNAA 4LKFA 3AL5A 2JDAA 2DVGA 3AJYA 4WZFA 1S0FA 4C1WA 1C28A 3M7AA 2FDHA 2VOXA 2X05A 5LW9A 4LE3A 3O1RA 2XKOA 3O0WA 2XKPA 1D0GA 1AYM3 1REEA 3EYPA 4OFGA 3VKOA 2EIDA 4CDQA 1ZZCA 5DG2A 1CESA 1OPMA 5FZHA 1Y3TA 3RRDA 4K21A 4BK4A 2QQVA 2BBVA 1QJX3 3J7LA 1ASJ1 1QJY1 1ULPA 1XOYA 2O8OA 4LBKA 4YZ3A 3WQBA 2QQNA 2V09A 3ETQA 3ROUA 2MEV2 4XE9A 3Q8EA 2VU9A 1ZYBA 4FPKA 3PMSA 3LAGA 1AL0G 1QOSA 3GZUC 1XNKA 2CSGA 5JIAA 2IUWA 2A1XA 3Q8FA 2GZWA 4YZ2A 5LA2A 2E33A 4B4PA 2JXAA 2ZOEB 2VQ0A 2WZR1 4QHBA 1R092 4N9HA 4ASKA 4BQYA 5K0UC 1I6XA 3ZSJA 4PF1A 2BOIA 4UXAA 1H8TA 2LALA 1BKZA 5FZIA 3U78A 3ZLIA 2RDQA 1RVF2 1MS3A 3I2GA 1JZ2A 4QXKA 4UFLA 2A3WA 4XAAA 4L9BA 1UXXX 3OGSA 3K4AA 4PDWB 2ZGLA 5JOWA 4DIQA 3ILNA 5CIRA 4P9XA 2BWCA 2QDRA 3J7MA 3ABZA 3MIFA 1MR5A 3O12A 2ZX3A 4F7ZA 4OI0A 3IAQA 1A78A 4EWAA 2CDOA 3T4VA 4BQ2A 1WA4A 1BJQA 3JBG2 5F7UA 1TEIA 5EXOA 4D8MA 2ZGKA 2NPIA 1UOJA 2V72A 5KHIA 1F8VA 4CDXB 2Q8EA 1VBA2 1W6QB 2ZGOA 4KBBA 1EAH3 2OX0A 1W8ZA 2Y26A 4LBOA 2K46A 4CDUC 4AQ2A 1AXZA 1RUD2 1UNBA 4XZPA 1IG0A 5EP9A 1GYKA 5FK8A 4OYUA 3NV3A 3TWIA 3H42B 2GNMA 1QQP1 4FAGA 3I2OA 4AEJA 1KITA 1UY4A 4Z82A 4AI9A 3ZFGC 3EB7A 4IEUA 1TVGA 2ARCA 3U1XA 1C1LA 4ATEA 4TSVA 4YVSC 1FPN2 2JB4A 4QPGA 3MW2A 5H9QA 3LA2A 2HWE2 5IVFA 4OZXA 2Z69A 1NX9A 3VN4A 1PX3A 4OI2A 1PVC2 4BLIA 3U0ZA 3I49A 1CWPA 2VY0A 2IXKA 2WBKA 3VBFA 4D6SA 1VPHA 1D4M1 1NA1A 1RUF2 2CAVA 2Y0IA 4XBLA 1RYYA 2UY9A 4UWDA 2TBVA 1KDKA 4LA2A 4I01A 3DXUA 4YG6A 2HWF2 3M1HA 5CADA 3N9OA 1DYPA 2YROA 3HWJA 4FOQA 1UYZA 5FZDA 1HLCA 3RZGA 2GN3A 3ZFFA 1HB4A 2VCBA 3PVNA 2G4IA 4XC9A 1SACA 1OQEA 2ADDA 3AC0A 4NROA 3ZYGA 2X29A 5F9TA 5JSRA 4BZ4A 4JKKA 2E53A 3WY6A 5C3PA 1H4HA 4ISRA 4P9JA 4GJZA 3SKVA 3MLKA 3OGVA 4Y1ZA 5D8AC 1H2LA 2NLRA 5FIXA 5J09A 2XJRA 1CX1A 2F4PA 3JUUA 2BU9A 3MIEA 4IV1C 5EJ3A 5F1RA 3SCHA 1UN1A 4MG2A 1G8WA 2AR6A 3CQOA 4CUCA 2IFRA 1LAJA 4IE5A 4AW7A 1HQLA 2P6CA 1X9TA 2MPFA 3R4DB 4GMP0 1ASJ2 1QJY2 2YY1A 3OBZA 3WG2A 1NOVA 1S2BA 1KFXL 5LBEA 4GIQA 4JQTA 4IEQA 3N7MA 4I30A 1OVSA 2DYCA 3AMPA 3HQUA 2XQXA 5FUNA 3CHXA 5LBCA 1D4VB 1O8PA 4GALA 3CJIC 4AFDA 5JIUA 3BTYA 3ILFA 4UFMA 4BXFA 5A33B 2DU1A 1OUXA 2WZR2 5KC6A 2AH2A 5JPMB 3NJZA 4WVMA 5CNAA 4NRMA 4Q4V1 5JR7B 4OHYA 1POV1 4CDWC 5FZLA 4LOTA 1SFYA 2J1VA 5EIYB 1ZRIA 1VALA 5KBFA 2BFUL 1GZ9A 2Q4SA 1TNRA 2G9FA 3V65A 4FSJA 4DRVA 3VD4A 2E26A 5I0RA 2VZQA 4LIVA 1PZ7A 2XDVA 2HEVF 1W0OA 1U5YA 2Y33A 2YBKA 4YM1A 3ZYRA 2VO5A 3R05A 3MEPA 4C0HA 1OD5A 3UV9A 2BNNA 4L2NA 2LS6A 1XYPA 3VBSA 4A7ZA 3O1PA 3SXWA 2FMDA 2OPKA 4Q0UA 3WF1A 4XBNA 1FOD2 1QXPA 2GU9A 3ZPYA 1SCRA 5CFDA 4XXAA 3AM2A 3RZKA 4INDA 4XW3A 3DKWA 1NZIA 1VRH3 1XYOA 2JDUA 2I07B 1Q5OA 3K75B 4H2AA 1PNFA 2VVDA 5FYBA 1BBT3 4E2SA 3ZFEC 5C8WA 4AQ6A 1UZVA 3DYOA 5FWEA 3C2UA 5L73A 2ZZQA 1CAXB 1ULCA 2YFZA 1UMHA 3JZVA 5AVAA 1A6CA 3NQHA 1OF3A 2FBEA 1RHI3 3HBKA 4AGRA 1DDLA 4LITA 3DPRA 4TN7A 4BJ0A 5T5LA 4NWWA 1D4M2 1MZ5A 3LB9A 2A3YA 2F6BA 2UY8A 1UX6A 4NPMA 5KHGA 1CQ9A 1DGRA 1GWLA 2DWRA 2NN8A 1PGL2 4QB1A 1AX1A 3FWEA 1GP5A 1VIWB 3LFMA 4HN1A 3UGHA 4BCUA 4CCKA 3BIEA 3PDQA 1OOPC 1K5JA 1CN1A 1V6IA 1TMF3 2D6OX 2VBPA 3I3BA 3GBGA 1WKYA 1SLBA 1Y9MA 4HONA 2BDRA 2WA4A 1NUKA 3NV1A 3DCQA 1W9WA 2QCSB 3B69A 4AEDB 3AX4A 1F5JA 1YQ8A 1ENQA 1LODA 5B2GB 2ZX4A 3O14A 4AEKA 3IBMA 2VNOA 1VBE2 5FZ3A 2XL7A 3SCFA 1ND3B 4AFAA 5JXJA 2R16A 3GNEA 1S2EA 3OY8A 4NVPA 4Q4W3 1ZM1A 5AFEA 3DXTA 1AR73 5FY0A 1Y7BA 3POFA 5ANNA 1MS0A 2FDJA 4LUMA 2QJVA 5FY7A 5T5OA 2J1UA 4PLOA 1U5XA 3MI8A 3I2FA 3N9MA 4R9CA 2A5ZA 4YW1A 5A3OA 4XHBA 5C33A 2RR13 1LCLA 2OUHA 3IMMA 1RUI3 4Q27A 1OQ1A 1VBC3 3NSTA 5C8CA 4YGCA 1UF2C 2GNTA 2VZVA 4YW2A 1UU5A 4JQRA 2IXJA 1PZ9A 2JG8B 1GFF2 2JICA 4LR4A 4NJ4A 3W20A 1QH7A 1O8SA 1W28A 4UT5A 4LT5A 2BW8A 4FPHA 4Q4V2 5HCBA 2ZS6B 4YPJA 3RWNA 4CEYA 1WMEA 1F31A 2X8KA 3PUAA 4KL1A 4JGYB 1JUIA 1W03A 2Y6GA 4OI4A 4QPWA 3RQ0A 2WSVA 4S2FA 3RYRA 3T4HB 1RUC1 5DAQA 1FNZA 3LCPA 3MPPG 2DVAA 4I09A 4Z07A 4BQ1A 3M4FA 5C7GA 3RZHA 3N9LA 2F4LA 1LHOA 3BOPA 3L2HA 2PHTA 4NHMA 1JU4A 1U5IA 1XC6A 3CZJA 4LBQD 5FP9A 1UOGA 3WQ7A 3ZR5A 2VCAA 2X5IC 3WDTA 4CP2A 1LHVA 4MO3M 4OCTA 2P1BA 1LOFC 4WM7A 2WNVC 2DFBA 4HVOA 4H55A 4UW6A 1XE8A 5D1IA 1B35A 1YFYA 3OUIA 4L8QA 4P9GA 5L9BA 3I2KA 2D6KA 2OQ6A 4TYSA 1YIFA 1BMV1 3AP6A 1V00A 5JI7A 5BNNC 1RB8G 2XB6C 1NCQC 5HXVA 2BWAA 3EBRA 1M4WA 2SLIA 2XGXA 3ZN6A 4WVZA 4NWVA 2R062 4COZA 3GHNA 4RSUA 3M8LA 4XJUA 4B4RA 4K9SA 2PXJA 2PHWA 1GNZA 4QB6A 3VHNA 2A6VA 4BQWA 2IWGB 2EIGA 4R9BA 4QX2A 3WHUA 4BOWA 3M3IA 4IV3B 4DPNA 5JI9A 3MUY1 4CCDA 4BQ3A 2JDZA 4QMAA 4YWAA 3KT1A 4QU2A 4S2HA 2WS91 5CKNA 4KQ7A 2RG4A 3KLSA 4KNCA 3APBA 1X82A 2NZ9A 4IEPA 2JECA 3VBUC 3O0XA 4JDOA 2VUAA 3VBRB 3E5UA 1RUH3 1L7QA 1VBD3 2VVEA 2W9XA 4HN0A 3U10A 4CU6A 5IFPA 1JZ3A 4ES9A 1UPIA 4O7XA 2JDPA 4AYUA 4CVUA 1MS5A 2GC3A 2YGLA 4LLOA 3VDCA 2C0ZA 4AFCA 5F3IA 2ET7A 5KXCA 4CUAA 2AACA 3VDDA 1W6PB 3JQXA 3POYA 4QXBA 4XCAA 4QX1A 2EVXA 3VKMA 5IVVA 2RJLA 3SLIA 1IS4A 4ZONA 3C3VA 1QF3A 3K3NA 1ND2A 2ARAA 5KXDA 2VMDA 4QX0A 1JOBA 3N9NA 4RR3C 3ACIA 4YW7A 4RS5C 1F5FA 4EN0A 1HDKA 4TZDA 3KMHA 3R4UA 4P5YA 3USUB 1JZ4A 3LA7A 3POBA 1ACCA 1QXJA 5BXXA 4CCEA 1W6OA 1STMA 5FTTC 5GZEA 4IL7A 3T09A 2FDFA 3NMBA 1WBFA 3LKJA 1D7PM 3ACFA 1MZ6A 1X50A 2ZGRA 3JCIA 1JN2P 1C3HA 2BGPA 4Q8KA 2VJXA 3PVEA 3I59A 2WYFA 1C8NA 1N3OA 5LEKA 2ZZJA 2XLAA 1HJFA 1PZ8A 5GLZA 5IJRA 1LOGA 1MEC3 3FLRA 3WDWA 4NMIA 4P14A 5EZWA 4AVTA 4DB5A 2E7QA 4K40A 2BPA2 5LB6A 1RUC2 2HYKA 5FO9B 3KV4A 1N3QA 3KHCA 2QQPA 1TME1 3VBOB 5I8SA 2B8MA 2YPDA 4ZHNA 1XNDA 1DLCA 2QQMA 1ONAA 3AL6A 4LJHA 4JKLA 3TEZA 3O1VA 2JJ6A 5ABJC 1BMV2 1CR7A 5A3WA 1PM7A 2HWB1 4YW5A 5LA1A 2HKXA 2D3SA 3BUCA 4A7YA 3T1MA 4N43A 4XDOA 5A80A 1HRI1 1PGW1 4L0PA 1NZCA 1OQDA 1YQCA 4KG8A 1YC61 2C4XA 2OZJA 2OVUA 3PURA 4WV8A 3VB9A 2PHUA 4LULA 3LIGA 1AR63 2CL2A 2YPJA 1NCRC 1CGPA 2WO1A 4CDUA 1AYN1 2C6SA 2VOKA 5GZDA 5IVEA 5ACA2 4R9DA 3NWKA 1WCSA 2XLFA 3A0NA 3AP7A 2D5HA 3Q8AA 5DAVA 4XTMA 4C90A 2HJIA 2E32A 4NIDA 2HYXA 4URAA 2DCZA 1LOAA 1X33A 5FZEA 4QQPA 2KR2A 4EZ4A 4Q0VA 3CLPA 1C57A 1WLTA 5HXMA 1LB2A 5FPLA 2K9ZA 4RD7A 4LUKA 1W0NA 5F8PA 3MBWA 3WW2A 2R072 2YU1A 1J3PA 2HWC3 1NAEA 2ZGMA 2XMLA 4HZFA 4PBPA 1GZWB 2ZHKA 2WUHA 5F5QA 5IK4A 2P37A 4GAZA 4A44A 4KG0A 5G05L 2XJVA 2W5FA 1GWKA 1S55A 4GH4B 3I3QA 3R4SA 3RYPA 3DKQA 3THDA 4QX8A 4SLIA 3D8CA 2NQYA 1W8OA 4HSLA 4M0HA 4PDWA 4XFAA 5D8AA 5I0SA 3TBDA 1KD7A 4A3ZA 5C3RA 1IS3A 2QKDA 3W58A 1MQTB 1RUE3 1PMIA 3TN93 4UFJA 5FWJA 2FZ1A 4HBNA 5A6YA 1H0BA 2CWMA 4PLMA 4DUWA 1Q8OA 4CCOA 3VBHC 4HLTA 1JHJA 3VL9A 3IKWA 3HEIA 3WZ1A 3KV6A 3EMRA 2ILMA 2EA7A 3J9SA 2PELA 1A34A 1UZYA 4HK9A 2RS51 4LORA 4AE2A 4BMBA 4CDXA 1W6QA 4AI0A 3MFAA 4N7IA 2ENRA 4XQ4A 2BVBA 1QNWA 1V6KA 3ZIWA 1NLQA 2WRAA 4E4DX 3RI9A 3AJZA 3LEKA 1HKDA 1DFQA 3VZJA 4EE2A 1JYNA 1SLAA 4YRDA 5FPZA 5GJ6A 2FCTA 4F8AA 4MUVA 3HOBA 1UX7A 3VD3A 3L9JT 4ASLA 2XBO1 4K8FA 2MEV3 3OGRA 1R1ZA 3IMNA 2W1SA 2WQ4A 3NNGA 4MGQA 4ZU7A 3M3OA 3VDBA 1W2TA 1TME2 4Z8BA 1NKGA 5JWPA 2AREA 3VHPA 5T54A 4N53B 3UGFA 2CY6A 1R093 4DFSA 4FQZA 1LOBA 1G9CA 2YXSA 2Y34A 2J22A 1DP0A 2JX9A 4FBFA 3LF7A 1AHSA 2K2SA 5FREA 1RVF3 5A7NA 1DGRN 1HRI2 1PGW2 2RDRA 4NN0A 4QX3A 2J7MA 4Z2WA 2VNGA 4BDVB 3KCYA 4WZCA 3PHMA 2QQWA 2WNUB 4QQHA 5J36A 1W9YA 2UURA 2XL9A 1AF9A 3LOIA 3OPZA 1QXRA 2PQSA 3FFQA 1FATA 1AYN2 1LHWA 3N36A 4JDMA 3ST7A 5IHRA 3O1UA 2QUOA 4XFIA 1A3KA 4YM0A 2RS31 1J83A 3JBG3 5FYUA 3A4UA 5CFCB 1WLWA 1VAVA 3PUHA 2C9AA 1OI6A 1W6NB 4AGGA 1V6JA 5KXBA 1H6XA 1RJ7A 2B9UA 3NV2A 5IAVA 1IGOA 1VBA3 1Z7S1 1Q56A 1VB4A 3WLUA 2OQ7A 4EN7B 3AXEA 2A3XA 4LTAA 3GGLA 3W21A 1RUD3 2VGDA 4LIUA 4A3XA 4E8DA 4UYBA 1OA3A 5A33A 4CEWC 3KQRA 1EV11 2ZX2A 3OGJA 2ZGQA 4KMQA 5GZCA 1LRHA 1EUTA 4GULA 3BYWA 1KXGA 4O65A 1H30A 1RMU1 1R1A1 2GALA 3O1OA 1FPN3 3DEMA 3G7DA 4D7TA 2HWE3 3VKLA 3WG1A 2XPJA 5A7PA 5KR7A 4JRLA 5C9AB 1VBB2 3KD4A 4O9GA 1RUF3 5F3GA 1GU3A 4RL7A 5FYIA 2WWUA 1CZVA 4JHZA 1BEV2 4K20A 2WN3A 3T2TA 2HWF3 1D2SA 3JB8A 1O6UA 4HKWA 4LKSA 3HNYM 4URTA 1UMIA 4B7KA 1REDA 1LGBA 3VD9A 3RMYA 3U75A 3PIGA 4H7MA 4DY5A 1MS8A 3BTXA 5FLIA 5A6XA 1UKGA 4TXWA 2CHHA 3UETA 2EXIA 1TNFA 3F95A 2NYYA 1W05A 1PK6C 1SG3A 1F9KA 2XQRA 1AJKA 4BPZA 5FYMA 4GD4A 1T6GC 2J1SA 1TE1B 2R6QA 3CZUA 3OBRA 2ARXA 4H7LA 1QHDA 1QOTA 1RTVA 2C26A 4H14A 5L9RA 2WNOA 3GALA 2FCUA 4PHZA 1FAYA 1CAXA 1ASJ3 1W9TA 3D3AA 3GBFA 4YW6A 5FZGA 2D93A 5K0UB 4AAXA 5JMCA 5T50A 3CL1A 5DPNA 2VPVA 4KGQA 3CDZB 2IXLA 3E5XA 1ZZ7A 4AVCA 2XONA 3ES4A 2WLPA 2WFF1 2UWBA 4SBVA 4JKMA 4UFIA 1GMMA 4FOYA 4XUNA 1C5IA 2CGNA 3O1MA 1W39A 3IM0A 5IT6A 1XPWA 2BEOA 5A32B 4XXPA 2QQKA 2ZTNA 4QXHA 2D97A 1O4YA 4MYEA 2W94A 1MZFA 4CPBD 3N35A 3HT2A 3LA3A 1PX4A 4RGGA 5A7SA 2ZAHA 3S57A 2XHKA 3KGLA 3S0MA 2A6YA 2NM1A 5FZ7A 4XF1A 5FZKA 3TNQA 3NJVA 3I3EA 3HNBM 4KWUA 4AEDA 1RUJ3 3WUCA 4P9YA 1KS5A 1ND3A 3RPQA 1W06A 2ZGNA 3OD0A 1BHGA 2H6BA 4FI9A 5GLWA 5IK8A 2MNGA 1OT5A 3NAPC 2RS32 3SCGA 4CDUB 4K3UA 5BNPC 1XE0A 2VNVA 1W3VA 2W95A 5FYCA 5L36A 3WNNA 3RNSA 3H1YA 2QVSB 2QZ2A 4ASMB 3U11A 3ZXKA 1FOD3 3J8F1 3AB0A 3ETPA 1WCKA 2W1QA 3GBWA 3RZZA 1XNTA 1Z7S2 2R30A 1LGNA 1O59A 1ZBE1 5FY1A 3ZFGB 4LA3A 5BNOC 5JMOA 4YVSB 1OLQA 3FBYA 5DDJ1 2V4VA 3USSA 2W91A 5F39A 4YARA 3QACA 4DZGA 3WCRA 3I2DA 1EV12 2P17A 2PHRA 1WW4A 5AC91 4Q4Y1 2JG8A 2OPWA 4LO5B 4OMDA 4QT6A 3VBUA 1JYVA 1NE4A 1R1A2 2W87A 1EYBA 4HKOA 5JXGA 4JGYA 3RFRA 3PLQA 1GKBA 4QGLA 5CISA 1D4M3 2BTVC 1J3QA 1JYXA 2AGSA 1LECA 2VTXA 1MS4A 2FCVA 4AG4A 2PTMA 2UWAA 1JYCA 4ISQA 3VKNA 3H9AA 5BUVA 5D8AB 5C3OA 2FDIA 2DCYA 1UMZA 3WP5A 2LUWA 3DUIA 1AR91 4GWNA 2QDNA 4IV1B 4RFT0 5JOYA 4J25A 4BIOA 2UWCA 3D6EA 1CAUB 4LBQB 4NO4A 1AR81 2J42A 2ARBA 3JU9A 1E57A 2MHFA 2IZWA 1BXHA 1LGCA 4B7EA 3WCSA 5IAXA 3KHBA 4N9IA 2YC2A 1VBE3 3ES1A 4NHLA 2XHNA 4D69A 3UK9A 4XILA 4Y22B 2R1DA 3KT4A 2W39A 3LOBA 3AXDA 4Y1VA 1JZ8A 3K2OA 4UFKA 2VZOA 3CJIB 5C70A 1ZA7A 2VC9A 1MVEA 1MS9A 2YG0A 1H1IA 2HWD2 1N3PA 3RZLA 4DXZA 4IV3A 1V6NA 3LDRA 4XABA 1US2A 3I8TA 1QJU1 3UNPA 1JTZX 1GNHA 4CDWB 3R0RA 3MV11 4IERA 5IK7A 2WFF2 1AX0A 2C1FA 5GLUA 1W8FA 1KDMA 3VBRA 2VMHA 1QJX1 1WMXA 5FDBA 2GMMA 5FR3A 1JS9A 5L7OC 5CKQA 2E9QA 1YEWA 1CIYA 1GQGA 3AYAA 4JX0A 2B9VA 4V1PA 3SEPA 3T08A 5J1XA 3B93A 1Q3EA 2RM21 1UPSA 2DVDA 1G9FA 2RMU3 5JSOA 2PYTA 4GB31 4AVAA 5CG9A 4NR1A 1UZ0A 3FE5A 4AEMA 4JC1A 3HVDA 3VUOA 2ZEZA 3RMXA 1W6PA 4FTSA 2VMEA 2BFUS 2ES3A 2NP0A 1CONA 1UY0A 1SZBA 5A3TA 2PLV1 1OF4A 1R081 4BA6A 3FLTA 3MV01 2P34A 5GLTA 4LNVA 4YGBA 4OULA 3VD7A 1Q43A 1HN1A 3WF3A 2HEWF 1OD3A 2FMYA 4CXWA 4DS0A 3USUA 4FXKB 5IUQA 3ZFEB 4UOJA 3ELNA 3ZN5A 4COWA 1ZBE2 3K3OA 4QQLA 3ZDVA 5JLVA 1DQ5A 1J1TA 1K5MC 1QIQA 2W3JA 3PVOA 2BZDA 3B7MA 4I3GA 4PQ9A 4XJZA 1JYWA 1QKQA 5E1RA 5DDJ2 2WJSA 5ANQA 2CGOA 3KB5A 2GN7A 2Z4FA 4Q1PA 3TEYA 2R063 1C1FA 5C3SA 3MPBA 5FJHA 5AC92 2XH6A 1C5HA 3WVJA 2W52A 3POEA 1FMD1 1N1YA 4LHLA 4DMIA 4YM3A 5L9VA 4W65A 1AXKA 4ET7A 2DUOA 4OQ9A 1H9WA 2D43A 3UGGA 4ZZ8A 1DCSA 2XUMA 3HBZA 2KXLA 1EAH1 3H8UA 4L97A 3WEZA 3IN9A 5APAA 1HQWA 1OOPB 2O0OA 2OUJA 1B09A 3HQXA 3GCXA 4FCAA 1QMJA 4Q2FA 4YVWC 1ENRA 1W9FA 1ZZBA 2QBXA 1ULFA 2R0FA 2OYZA 4PBOA 3VHRA 4FAHA 4YG3A 3VBOA 1IKPA 1BQPA 4PCRA 1EPWA 1U0AA 4AI1A 4CTEA 3PTRB 1HRV1 4QQ2A 3EO6A 4A4AA 2RE9A 1X8MA 2ZKLA 3SKJE 4DO0A 3U4XA 3VGIA 3OB8A 5LCWL 1O5UA 3D82A 5FZOB 1UOFA 1OH3A 4FPGA 2XJQA 3BODA 5FZ6A 4QPYA 1VR3A 2KD7A 4NPLA 2ET1A 2Y6FA 4UBHA 1W8UA 3NKGA 4YNIA 3B9CA 3CBNA 3KVAA 3AKRA 2ZHNA 2W2IA 4ONUA 4EWEA 2VW2A 1S0BA 1C4RA 1H4GA 3NNFA 5JAXA 2VBDA 2B46X 1QQP2 2PAKA 2O1QA 1HQNA 3WDVA 1X36A 3AP9A 1G7YA 3LIHA 5F2WA 4QX5A 4W4ZA 1ZNPA 2VXRA 1ZRRA 4KWKA 3AYCA 1WCQA 5KC5A 1QJU2 4M3CB 5I91A 3AVRA 3K46A 3LPFA 4QPIC 1RUG1 1AZDA 4M4RA 1LESA 3WF0A 2F17A 1JHNA 1W8WA 3RJ2X 2Z2SB 1H9PA 1YFUA 1QJX2 3ACGA 4QHZA 4RGAA 3GF6A 1M06G 1H1AA 1IKQA 2N7GA 4WM8C 1GZWA 4C0BA 2X5IB 1QOOA 2RM22 4ZXEA 2WLQA 4GB32 2E7AA 3JB4C 1OKQA 4XHXA 5FMCA 5I8YA 4GH4A 2WNVB 3I3DA 2TEPA 2WT0A 5FZ8A 3VV1A 1O3SA 1EY2A 3UKVA 5CKMA 1UL9A 4RQPC 4E4SA 3URFA 5HV0A 2YV8A 1EP0A 2PLV2 5C5TA 4FPEA 2Z79A 3WQ1A 1LOEA 4Q8LA 3AYDA 4JV4A 5FMBA 4FOWA 4IDZA 2JDMA 1R082 4E2QA 5BNNB 1MQTA 3RZJA 4Q1RA 1NCQB 2Q1FA 4XF3A 4YFWA 2WO3A 3FX3A 5K8SA 4YG0A 5FYZA 3TYJA 1Z78A 2DTYA 3SNMA 2VG9A 4FP3A 2ZMKA 4FPLA 3G6JB 4XYXA 2WAAA 1NLSA 2YGMA 4BMEA 4BYYA 3ZVXA 4MXVA 4DXTA 4HMZA 1H2KA 1V6OA 4LEJA 4RA0A 4NOTA 3WW1A 3S7IA 3J7HA 2EAAA 1QWRA 5FXZA 3HPNA 5J37A 3H50A 3MHZA 1UQXA 3ZIXA 5FOJB 5D2AA 5ACA3 1FMD2 3A7QA 2PA7A 5JUVA 5FJKA 1NYWA 1S4CA 5LEJA 3BTAA 5JZGC 3ZKYA 4HG6B 1W90A 2ZGSA 1XB9A 1A8MA 4JRAA 1FV2A 1WW6A 3RVHA 3VBUB 4CP0A 4DXSA 4KGGA 5J7MA 3L2YA 1E5RA 4Y20B 4Z92B 5C4WC 5G04L 2UYAA 2JG9C 1W6MB 4YFZA 1BBT1 3FHQA 3K48A 3OPWA 3ZR6A 4TWTA 2VL4A 5FP7A 3AKQA 3E6BA 1HRV2 2R073 4N53A 1IZ3A 4XQWA 5DAXA 3SMHA 3EXUA 5E89A 1SMVA 1NQJA 2EIEA 1QJZA 5FO7B 2AYHA 4JGZC 1RHI1 5DQ0A 3E97A 1UY3A 1LTEA 2A6ZA 3T1LA 1D0HA 3M3QA 2VE1A 3NJYA 3OF1A 5H9PA 4RR3B 1S0CA 4Y26A 4QGMA 4RS5B 2NMNA 2WA3A 3DYPA 1COV1 1WWYA 1NY71 3QH6A 3A23A 5DUXA 1UIKA 5EQUA 5A1LA 3ORJA 1N47A 1JW6A 1PO21 2PHLA 2WNUA 3GCWA 3PJYA 3VZOA 3SISA 3ZPOA 5EYYA 4YZ1A 5FK7A 2XG3A 5SV5A 4EN9B 5BV6A 2JWPA 1J58A 3JQWA 2BOJA 5T52A 3AMHA 4V2WA 1OA2A 1GQPA 3JD71 2FHRA 5GM0A 1W99A 2PHXA 5CFCA 2XLGA 3ZSKA 2HLEA 2J1TA 1W6NA 1ULEA 1K42A 1D2QA 2GC0A 4AF9A 2VOWA 3BU7A 2EF6A 4AK3A 2ZEYA 3MDPA 2Q8OA 1AL23 1RUG2 2JD9A 4Q4W1 4WVWA 3S5QA 3LDKA 1AR71 2XJPA 3N3HA 4NRQA 1RINA 1VAKA 3N7LA 4WBBA 4X6QB 5FKCA 1CIWA 5FZ1A 4OHZA 1PGSA 2QE3A 2OT7A 3UESA 1FXZA 2PHDA 4KWJA 4R4ZA 5E88A 4BQ5A 4Z1VA 2QTWB 2ZMNA 5F5CA 3FFZA 4UI9L 1AX2A 1GP6A 1V9U3 5KWRA 2ORXA 4QKFA 3LFIA 3LWCA 2DUPA 3SH3A 3V0AB 3TEWA 5ABJB 3HN3A 4Y33A 1RUI1 5DUVA 1VBC1 4QDSA 4XQDA 4CDQC 4DUVA 2W0XA 1KGYA 2JDKA 2Q1ZB 2R7EB 4XCBA 5C9AA 2XUEA 2G19A 3A0KA 3LGRA 1FNYA 1PO11 4XFHA 1N1VA 4ZS2A 5FCCA 1OLRA 3HJRA 2EXHA 3BOWA 3NVCA 1W2AX 2JEMA 3NJXA 2A71A 1NCRB 2JD4A 4D3WA 4MGTA 1VMJA 2H0VA 4LK6A 2GNBA 5DABA 5KHHA 4CP9B
chains in the Genus database with same CATH topology
2VUDA 1OUXA 1OUSA 1W8HA 2BOJA 2JDPA 4AOCA 2BV4A 2WRAA 5A70A 1OXCA 5A6QA 2JDKA 2JDUA 1W8FA 1GZTA 5A3OA 2BOIA 2JDYA 5A6XA 1OVPA 1OURA 2CHHA 2JDHA 2JDNA 1UQXA 3ZDVA 1UZVA 2VNVA 2XR4A 5A6YA 3DCQA 5HCHA 5D2AA 1OVSA 2VUCA 4CE8A 2WR9A 2JDMA 4UT5A 5A6ZA 2BP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  1OUX A;  1OUS A;  1W8H A;  2BOJ A;  2JDP A;  4AOC A;  2BV4 A;  2WRA A;  5A70 A;  1OXC A;  5A6Q A;  2JDK A;  2JDU A;  1W8F A;  1GZT A;  5A3O A;  2BOI A;  2JDY A;  5A6X A;  1OVP A;  1OUR A;  2CHH A;  2JDH A;  2JDN A;  1UQX A;  3ZDV A;  1UZV A;  2VNV A;  2XR4 A;  5A6Y A;  3DCQ A;  5HCH A;  5D2A A;  1OVS A;  2VUC A;  4CE8 A;  2WR9 A;  2JDM A;  4UT5 A;  5A6Z A;  2BP6 A; 
#chains in the Genus database with same CATH topology
 1UW8 A;  2A70 A;  1F2N A;  4ITC A;  4CRQ A;  4JVA A;  1VMF A;  3C8X A;  5C3Q A;  4MET A;  1OKO A;  3KT7 A;  1JYI A;  2TUN A;  3GM8 A;  1H8T C;  3FZ3 A;  3OUJ A;  2K0G A;  1AYN 3;  3U37 A;  4QWN A;  3B02 A;  4MOA A;  5A7O A;  3X29 B;  1F35 A;  2WSU A;  1PHM A;  4QDQ A;  1POQ A;  3LEM A;  5T5P A;  2JIG A;  1AJO A;  2B39 A;  5I0U A;  2CDP A;  3IDA A;  3RYK A;  1SLT A;  5CG8 A;  1VJ2 A;  3WP3 A;  3U07 A;  4CSW A;  1P8J A;  1K3I A;  1PIV 1;  2P3K A;  5K0U A;  4LBM A;  4AAP A;  1HB2 A;  4YLZ A;  4CE8 A;  1POV 0;  1BBT 2;  1WCU A;  4Q4X 1;  1N1S A;  3D4K A;  4AI2 A;  4UW3 A;  4EYU A;  2ZKN A;  2FQP A;  4AGV A;  1LU2 A;  5HV4 A;  3ZXL A;  1CJP A;  5A70 A;  1RHI 2;  3H8O A;  2JE9 A;  4IEY A;  5A32 A;  3ZX7 A;  4YSF A;  3KCX A;  1WMF A;  2Y8K A;  2WYS A;  1COV 2;  1VBB 3;  5FMO L;  2QQI A;  2HBT A;  1QGL A;  3T30 A;  2WZ8 A;  2ZX1 A;  2P3J A;  3P5B A;  2GME A;  1BEV 3;  4AFB A;  1PO2 2;  1YUD A;  3PUQ A;  3VBH B;  4CCN A;  1RUH 1;  5FPA A;  1VBD 1;  1LU1 A;  2PQQ A;  5H9S A;  3RGB A;  4QPG C;  5KXE A;  5FPB A;  1IHM A;  1UKR A;  4ZY9 A;  5E16 A;  5LZ6 A;  5L19 A;  2E31 A;  1LKN A;  3VBF C;  2RVA A;  1I3H A;  1NA1 C;  3C7O A;  2V5D A;  3JD7 2;  3MIG A;  3ALQ A;  4XBQ A;  5F3E A;  1OBN A;  2A6W A;  3K51 A;  3III A;  1HJG A;  1RXG A;  1UD1 A;  4FT8 A;  4PIX A;  4W50 A;  3ZFF C;  5GZF A;  2Q0A A;  2VAU A;  4YGD A;  1OPO A;  5F6L B;  2GAU A;  3ZFG A;  1DZT A;  3WHT A;  3POI A;  2BGC A;  4OUE A;  4NHK A;  4ZU4 A;  2XJT A;  4IEV A;  4YVS A;  1YXW A;  2ZHM A;  1AR7 2;  4IEZ A;  1YJK A;  2VQA A;  4MGI E;  2UU8 A;  3AZX A;  4PIY A;  3ZYB A;  4L92 A;  4XMI A;  3VD5 A;  2WS9 2;  3POJ A;  5JOZ A;  1RUO A;  1UY1 A;  1WLD A;  4NUB A;  5CB7 A;  4MGZ E;  3WNX A;  1AVB A;  5F37 A;  2WO7 A;  4QD2 A;  4K7J A;  4AVB A;  5IVC A;  4K1Y A;  3MF6 A;  2R04 1;  4QB2 A;  2D98 A;  3WQ0 A;  3D0J A;  3VZN A;  4LO7 A;  2JKB A;  3E1F 1;  2AEY A;  3K4D A;  4GKY A;  4E8C A;  4YM2 A;  1PO1 2;  2BGO A;  4QX7 A;  1WUV A;  5DMY A;  4RHV 3;  2WQ8 A;  4JTN A;  5IYY A;  2R0H A;  1MEC 1;  1TZO A;  4PLN A;  2E6V A;  1FI2 A;  4HK8 A;  1G9B A;  2X53 S;  5HCA A;  1XRU A;  2CV6 A;  3H7Y A;  1H2N A;  3T2O A;  2IC1 A;  4MHU A;  2V5Y A;  4IV1 A;  1OFS A;  4CU8 A;  1CAU A;  4LBQ A;  3IDC B;  5GZG A;  3TOJ A;  5JXI A;  3MLL A;  5LRS A;  1OLM A;  4CUB A;  2J1A A;  3CO2 A;  1DQ6 A;  3ILR A;  3T0A A;  4HT1 T;  4CCC A;  3ECQ A;  3WNO A;  1Q8V A;  4J1W A;  4Y22 A;  4A42 A;  1GP4 A;  2FZ2 A;  2RS3 3;  3ZXE A;  4C1X A;  4CXY A;  2OII A;  3CJI A;  3PME A;  1DYO A;  3EQE A;  5T5J A;  2O8Q A;  4CEW B;  5FMD A;  1I5Z A;  2GP5 A;  2LM3 A;  2RV9 A;  1AR6 1;  1Z7S 3;  3LEG A;  4BB3 A;  2VZ1 A;  3HD8 B;  1PIV 2;  3WF4 A;  2AZ5 A;  4Q0P A;  4PQQ A;  1WCD J;  1ZX5 A;  2VCM A;  3VBS C;  5BYN A;  4Q4X 2;  3ATG A;  3SH4 A;  4CDW A;  3V0B B;  2Y64 A;  1EV1 3;  4XPV A;  5FP4 A;  3UT0 A;  3OCP A;  5B4N A;  3THP A;  1YQ2 A;  3HR9 A;  1UCX A;  1C8M 1;  3WG4 A;  5CFD C;  2IXC A;  4XUO A;  2XWB B;  4AQS A;  1R1A 3;  1UYX A;  4BQ4 A;  2BP6 A;  3PU3 A;  5FO8 B;  1KFU L;  4MV2 A;  1H2M A;  2CU5 A;  1JYT A;  2YHJ A;  1WZX A;  2HWB 2;  2GC2 A;  4FFH A;  4AHZ A;  5IVY A;  1NG0 A;  4XMA A;  1Y43 B;  4RFR B;  3RSJ A;  1XSR A;  1YWK A;  1MZE A;  3KS7 A;  2DCJ A;  2ZEX A;  1QDO A;  2D3P A;  3M3C A;  4QQO A;  5LK7 B;  5J96 B;  1UU4 A;  4QKB A;  2HEY F;  3LSD A;  3ZM8 A;  1KEX A;  5DAW A;  1PK6 B;  1UY2 A;  3WR0 A;  3DPR C;  5FKB A;  4YZ5 A;  5I8T A;  3QBQ A;  3H3Z A;  4CP1 A;  3H3L A;  3WDX A;  4TTG A;  2LW8 A;  2OKX A;  3KV5 A;  5HCF A;  4XJ9 A;  5DZE A;  5F32 A;  4B8E A;  2CYF A;  3INA A;  1LNS A;  3ZFE A;  3ZOI A;  1G6N A;  3VDA A;  3ZYF A;  4I02 A;  5SV8 A;  4W6X A;  1W8H A;  2BUK A;  1RUE 1;  2WL1 A;  4R9A A;  3ZYH A;  3AZW A;  1YNA A;  1RIT A;  3IT8 A;  3POG A;  4COY A;  4W8J A;  2YFU A;  5I93 A;  1V0A A;  3KSC A;  4LO4 B;  4OHW A;  2VW0 A;  2ZAC A;  3C7F A;  5LBB A;  4A45 A;  2JDH A;  2HWD 3;  5A7Q A;  4WM8 A;  1HXS 1;  1YFW A;  3P3N A;  4DXR A;  2R04 2;  1OMI A;  1OOP A;  1LHU A;  2VUC A;  4NHY A;  2D7F A;  5A3L A;  3AK0 A;  3HMY A;  4A41 A;  1PVC 3;  4GMP 1;  2WFF 3;  4CZS A;  1SLL A;  3DL3 A;  3W59 A;  1ZA4 A;  4GWJ A;  4M00 A;  2VOT A;  3V56 A;  4QKD A;  4EV0 A;  5K9Y A;  3IWZ A;  2CGP A;  1MEC 2;  1H6Y A;  3PU8 A;  1XNA A;  4FPO B;  1XSQ A;  2ZAA A;  3GZT B;  4P5H A;  2MEV 1;  4I2O A;  2VMF A;  3PTY A;  4P9W A;  5C8C C;  4QAW A;  5FZO A;  4DOU A;  4HOO A;  3ME2 A;  4LO6 B;  1REF A;  3AMN A;  4XUT A;  2DF7 A;  1YI7 A;  1VAM A;  2ZGU A;  3IIA A;  3NAP B;  2VNR A;  3AKP A;  2JDY A;  5BNP B;  1X7N A;  2JB8 A;  1PMJ X;  1R09 1;  5A7W B;  3WG3 A;  4BHP A;  2XOM A;  3FC0 A;  3UKN A;  1BK1 A;  4CEY C;  2QZ3 A;  2RS5 2;  4GKX A;  5A3P A;  5LK5 A;  4CUG A;  2WWJ A;  4EN6 B;  1IPJ A;  4PF5 A;  4MAD A;  4MVT A;  5BNO B;  4XFC A;  1O3R A;  1BYH A;  3BPS A;  4AL9 A;  2YC0 A;  5BY5 A;  4PI0 A;  1J84 A;  3WD5 A;  3MW3 A;  1ZBE 3;  1YQ6 A;  3AZZ A;  2YB7 A;  3LQC A;  3QLQ A;  1IPK A;  4BK5 A;  1QJY 3;  2CWS A;  3KM5 A;  4WM7 C;  3WW3 A;  2YU2 A;  2WN2 A;  4LBN A;  4M3C F;  4M3C A;  2XBO 2;  1YLL A;  2AEN A;  1B35 C;  3ZXG A;  4L99 A;  3JBG 1;  1CPM A;  3ZXJ A;  4OQ8 A;  1C8M 2;  3ZYI B;  1XNC A;  1US3 A;  1EPZ A;  3M3E A;  4LMF A;  4F3J A;  4UF0 B;  2I74 A;  4EZH A;  2WZR 3;  2VEC A;  1W04 A;  4A7K A;  1NQD A;  1SLC A;  2X5I A;  4NHX A;  4Y4R A;  5EJZ B;  1I5P A;  2WZP P;  4QDR A;  2WII B;  4MXW B;  2E7T A;  1LOF A;  2VR4 A;  1ZBA 1;  4GWM A;  4EJR A;  1I9R A;  2WNV A;  5LY2 A;  3VZL A;  4OI1 A;  1HV0 A;  3SC7 X;  3OYW B;  5C5U A;  3BI3 A;  1OHF A;  3T3Y A;  4B3N A;  2AC1 A;  1F4H A;  1CX4 A;  1FPN 1;  1CZS A;  4IEW A;  4Y5T A;  5DZG A;  5BNN A;  4YW4 A;  1NCQ A;  1PNG A;  2HWE 1;  3GJB A;  5IK5 A;  1UOB A;  4MH0 E;  2VZS A;  1Q8P A;  1QEX A;  3OPT A;  1W2O A;  5DUW A;  5FZF A;  4HKL A;  2CAU A;  4IGP A;  4LE4 A;  3FLP A;  2ZBJ A;  4X8N A;  5EPA A;  4BU2 A;  4Q29 A;  5IVJ A;  4Q26 A;  1ULG A;  3TB0 A;  4XAC A;  1MVQ A;  2Q8C A;  3VDD C;  1QQP 3;  2A75 A;  2P5B A;  4MGS A;  4DUX A;  3OOX A;  4LHK A;  4XIK A;  4EN8 B;  2FD8 A;  4P08 A;  1ND2 C;  2RS1 1;  2WAB A;  2VVF A;  1E5H A;  1HXS 2;  1RMU 2;  2VMC A;  5DXD A;  4D7Y A;  2ID4 A;  1CPN A;  5L7O B;  4Y20 A;  1QJE A;  1QJU 3;  1W6M A;  2DFC A;  1O4T A;  4A6S A;  3W5M A;  4ZPI A;  1S1A A;  3T2P A;  4W6W A;  4TLG A;  3SIT A;  3FMG A;  4IUG A;  1JI6 A;  4YW3 A;  2VMG A;  2ZA9 A;  2HBU A;  2A7A A;  4AQT A;  4P9I A;  3O0V A;  1GWM A;  4HPK B;  4UW5 A;  3GDB A;  5CAZ A;  2RM2 3;  4ZZ5 A;  5AFB A;  2A6X A;  1SPP B;  2WO2 A;  4GB3 3;  3O1T A;  4RR3 A;  3ZMO A;  1OSG A;  4RS5 A;  2XVG A;  1JH5 A;  1VP6 A;  1SCS A;  3BKZ A;  2IVI B;  3OSD A;  4QGN A;  4Y1X A;  4IEX A;  1FV3 A;  2PLV 3;  1PMH X;  1UO9 A;  1WW5 A;  1PM4 A;  1QU0 A;  2PMW B;  2WZE A;  2ZGT A;  4UBG A;  3U4S A;  1N1T A;  3WSO A;  1R08 3;  3AKT A;  4DRR A;  4ERO A;  3POW A;  1K5M B;  2BRT A;  3Q8C A;  5I0T A;  2G1M A;  2Q5T A;  2YZ4 A;  2VUL A;  1GOH A;  3P6B A;  1VRB A;  2VBB A;  3RG0 A;  4CA9 A;  1H1M A;  3EHK A;  1RUJ 1;  4LHN A;  4AHX A;  1HIX A;  3VLB B;  1HN0 A;  2SBA A;  3AMM A;  4O9E A;  2GP3 A;  1UIJ A;  1AYM 1;  5FQ0 B;  3H8X A;  3PL0 A;  4QKN A;  1LUL A;  4N43 C;  4G4F A;  4MLO A;  1NE6 A;  4MGY E;  3FUQ A;  1IS5 A;  4YVW B;  3LE0 A;  1FMD 3;  4E4H A;  4G9S B;  3POS A;  4OVE A;  1FOD 1;  2WFP A;  3KV9 A;  3F2Z A;  1IG3 A;  3MID A;  1SLI A;  4FPJ A;  4FQ4 A;  3V0A A;  4V2V A;  4Q4V 3;  5ABJ A;  1POV 3;  1UYP A;  3ZXD A;  2X10 A;  3IPV B;  4KI5 M;  5LA9 A;  3GZA A;  1GR3 A;  1ZBA 2;  4NAM A;  3HT1 A;  4XDQ A;  5LAT A;  1CAW B;  5DAP A;  2ZEW A;  4P9L A;  3DN7 A;  4A6O A;  4Q0Q A;  2WR9 A;  1GLH A;  5F5I A;  2OW4 A;  5FUI A;  4XTP A;  3VZM A;  1HRV 3;  1GNY A;  3WNL A;  1W3X A;  1YHF A;  3P3P A;  1RIR A;  3BGA A;  4D0Q A;  3IB3 A;  4IGQ A;  4AVS A;  4XFG A;  3CU7 A;  4IW3 A;  3THT A;  2O14 A;  1NCR A;  4M01 A;  4UW4 A;  3WP4 A;  1X9P A;  3B9I A;  3KQ4 B;  5E6H A;  1L7R A;  3DGT A;  1LJ7 A;  3N7K A;  5FZ4 A;  3H8R A;  1XBF A;  1BVP 1;  1DG6 A;  1ULO A;  4CP9 A;  1PGL 1;  4HVQ A;  3I4I A;  5FZB A;  3J8F 2;  5I0D A;  1OVP A;  3CJX A;  3I2I A;  4GQ7 A;  2WAO A;  4FTE A;  4XEZ A;  3KF3 A;  4AZZ A;  1YCI A;  3TNP B;  3I54 A;  2DCK A;  1T6B X;  2VTF A;  1XNB A;  4QPI B;  4XET A;  4PDW C;  5M0T A;  3A21 A;  4E4Z A;  5GLV A;  3EJK A;  4Q4Y 2;  5FPU A;  4Y24 A;  2RS1 2;  1HB1 A;  1ODM A;  3OBA A;  4NPR A;  5ERL A;  4YYO A;  3WW4 A;  1WBL A;  1ENX A;  1HX6 A;  1ODN A;  1VBE 1;  4XF4 A;  4XDP A;  3N4M A;  4WM8 B;  2DTW A;  3KF5 A;  1I1E A;  2GMP A;  1RUG 3;  2W1U A;  3ENR A;  1SBD A;  1Q8Q A;  4RGK A;  3FHA A;  4RN5 A;  1IQD C;  5IFT A;  5JR2 A;  2ZX0 A;  4Q0S A;  1ZRE A;  2VZU A;  3B3Q E;  1QH6 A;  1VMH A;  1YYN A;  2XJU A;  3AFG A;  5FBJ A;  3D0S A;  4RQP B;  3UJO A;  4CDX C;  2B4K A;  3RI8 A;  3WP6 A;  3NKT A;  3GZE A;  3VHO A;  1SFN A;  5J3U A;  3BIW E;  2XWJ B;  1GBG A;  3V64 A;  4AVV A;  1AR9 2;  4QU1 A;  3ZDS A;  5C71 A;  3W5N A;  1WD3 A;  3B94 A;  3OJB A;  3K77 A;  5EYX A;  1SDW A;  2LRP A;  5FOB B;  4HL0 A;  4IE6 A;  4X8P A;  1AR8 2;  4NRP A;  2Y6J A;  4LBL A;  3VBH A;  3GHM A;  5FYY A;  3FN9 A;  3I2J A;  1OH4 A;  3OTF A;  2NMO A;  1S0I A;  4LOS A;  1DGL A;  4CPB A;  4GWI A;  1MPX A;  1UWW A;  4R52 A;  5AVP A;  2RMU 1;  3FBM A;  5EV7 A;  2W68 A;  3T0B A;  4Y5S A;  1LED A;  3QCW A;  4OMC A;  5JXH A;  3SH5 A;  1RUJ 2;  4QM8 A;  2IVJ A;  2YUE A;  3MF9 A;  5JZG B;  3E5Q A;  2YMZ A;  5FYS A;  1TG7 A;  1AYM 2;  2QQJ A;  3JXS A;  4FOV A;  1NLR A;  1G86 A;  2WKK A;  1GZC A;  3WT3 A;  5C4W B;  2OA2 A;  2JG9 B;  2DBI A;  1SBE A;  3C7H A;  4XJW A;  2WIN B;  4AXO A;  3I7D A;  2Q30 A;  2LTN A;  3TRS B;  1S0D A;  4Y5Z 0;  1CAV B;  4LBJ A;  4JTO A;  4GA9 A;  2DVF A;  3HN1 A;  4GZ9 A;  3MIB A;  4BXS V;  1VB2 A;  4JGZ B;  4GXL A;  4FPY A;  4AR2 A;  1Z0H A;  2R06 1;  1RUC 3;  1ZZ9 A;  3C7E A;  3NL1 A;  2PAE A;  5FZ9 A;  4DNY A;  1Y9G A;  3KCC A;  1RUN A;  4ARY A;  1K45 A;  2C5D A;  2YBS A;  4Y1U A;  5J48 A;  2I2S A;  3OG2 A;  4FFF A;  2Y6L A;  4BIS A;  1UYY A;  3O7O A;  2DBN A;  3ZYJ B;  1QJF A;  2DUQ A;  4RYD A;  1KS4 A;  1DU3 D;  2EXK A;  3J26 N;  4KU8 A;  4AFM A;  2VMI A;  4U2A A;  4N8M A;  1DF0 A;  3LPG A;  3UYJ A;  5K7P A;  4Y1Y A;  1COV 3;  1GOF A;  4CYD A;  4IE7 A;  3PNA A;  2VD7 A;  3DYM A;  3M70 A;  4N90 A;  3DV8 A;  1PO2 3;  4G3Y C;  1XU1 A;  1GUI A;  5FRA A;  4R8H A;  1JZ7 A;  3GXU A;  3D5O A;  4UAP A;  3MLJ A;  4GJY A;  4IE4 A;  3B5L B;  5A3M A;  4IQP A;  1FX5 A;  3S5A A;  3JD7 3;  1ZRD A;  3WXP A;  1WD4 A;  5FXW A;  4DY3 A;  4E2G A;  2QQU A;  4JAA A;  4CEW A;  3AFK A;  1Y4W A;  2H6C A;  2P3I A;  4QM9 A;  3AMQ A;  4LHS A;  1IS6 A;  2WQZ C;  1EAH 2;  4CXX A;  1DGW A;  1DLL A;  1SDD B;  1VRH 1;  2J1R A;  5CBL A;  1V6L A;  1YJL A;  1CJD A;  5IVB A;  3V0B A;  2BJS A;  4E27 A;  4CDQ B;  3MYX A;  2G9G A;  4HAN A;  2WS9 3;  3MO4 A;  2KA3 A;  2PFW A;  1RC6 A;  4NIG A;  3N7J A;  5A1F A;  1JBC A;  3SHR A;  3DF0 A;  3OD4 A;  3AYE A;  4Q5O A;  1FYU A;  3FUO A;  4IES A;  2D6L X;  2JDN A;  3ZYP A;  2WWS A;  1O3Q A;  5FY8 A;  2BYV E;  2XVK A;  3AP5 A;  4LPL A;  1F4A A;  3MIC A;  1PO1 3;  4ZKT B;  5BPX A;  2ZML A;  5EHD A;  1XYN A;  2DU0 A;  2ADE A;  5FYH A;  1PK6 A;  3I2H A;  4K1Z A;  1O4Z A;  2D6N A;  5FLJ A;  2OXB A;  5FXX A;  1H8T B;  2RMU 2;  5FLH A;  1TMF 1;  1W9S A;  4FXG B;  3WIN E;  5IW0 A;  4XUR A;  5FUP A;  3NV4 A;  2VTX J;  1BLZ A;  4FO9 A;  4KH9 A;  4QHO A;  3VKF C;  5JSP A;  2H0B A;  4A2U A;  2ZPX A;  1G9A A;  5FYT A;  4XJ8 A;  3FJS A;  1UAI A;  2JKX A;  1XXN A;  1GAN A;  4Y3O A;  1OUR A;  5IWF A;  5HI0 A;  5CVR A;  2VZP A;  1MS1 A;  1V6M A;  2DVB A;  1OC1 A;  5ISL A;  5F2S A;  4FP2 A;  2PHF A;  1EUU A;  2RJ2 A;  2ZAB A;  3IZO A;  3MGU A;  3ITQ A;  1DHK B;  3ON7 A;  2RHP A;  3MUZ 1;  3PVB B;  4HXC A;  4AED C;  5A6Z A;  3QD6 A;  3THC A;  3WV6 A;  2VUD A;  1BVV A;  1MAC A;  1ND3 C;  1PIV 3;  3I97 A;  5H9R A;  3UKT A;  3ZSE A;  4F83 A;  4FPC A;  2Y60 A;  5F5A A;  3WDU A;  5CYY A;  1YRZ A;  3RWK X;  1JOJ A;  1NT0 A;  2D3R A;  4KWL A;  2W92 A;  1RXF A;  1OXC A;  2RR1 1;  4OZO A;  4Q4X 3;  5FY4 A;  4AOC A;  4BE3 A;  4CCM A;  1X8E A;  4EQV A;  1KJL A;  5ACA 1;  2ATF A;  1TME 3;  4JDN A;  4LO8 A;  3Q8B A;  1E5I A;  4XF0 A;  4PI2 A;  4XJA A;  3HQR A;  1H8V A;  1KJR A;  4MGK E;  1V70 A;  4XZU G;  5E8A A;  3UJQ A;  1ZRF A;  2KM2 A;  5HCH A;  4QPG B;  2B7Y A;  4D6R A;  2HWB 3;  2PN5 A;  5FXV A;  4BIF A;  5FP3 A;  5CA6 A;  2ORZ A;  3OEB A;  5DG1 A;  5K4L A;  2QQO A;  2JG8 C;  2WNE A;  3VBF B;  3NAP A;  1HRI 3;  1NA1 B;  3WNM A;  5BNP A;  5FMO S;  3E6C C;  3RJR A;  3B01 A;  1JZ6 A;  2R07 1;  5A7W A;  1L3J A;  1JZ5 A;  3WNK A;  3I3M A;  2Z42 A;  1G9D A;  2X09 A;  1XJA A;  2G9Z A;  3ZFF B;  4JGY C;  1LEN A;  3W9A A;  1O3T A;  3ZXF A;  4MSV A;  3HNM A;  5BNO A;  1BCX A;  1SFP A;  1S0G A;  2Q1M A;  1URX A;  4TLF A;  4C8D A;  1ZVF A;  1RGS A;  2HH9 A;  2EIC A;  1Y9Q A;  1J3R A;  2VXJ A;  4HET A;  3LDB A;  4JZR A;  3DEC A;  5A3U A;  4S2G A;  2Y6H A;  5CEH A;  4B1L A;  5CZK A;  2JEN A;  2P2K A;  3H1W A;  4NIA A;  3ZXA C;  1VRH 2;  2AUY A;  4B29 A;  3MW4 A;  1ULD A;  5FPX A;  2JE7 A;  4LXL A;  2QQL A;  3K4Z A;  4OUS A;  2R49 A;  2VZT A;  3NW4 A;  4JHT A;  4CU7 A;  4OUM A;  3WX5 A;  1DQ4 A;  3J4U H;  1LOC A;  4UF0 A;  1ZZ8 A;  1LHN A;  3P1I A;  1U5Z A;  3RS6 A;  1XU2 A;  2VCC A;  3N9P A;  3BB6 A;  3PIJ A;  1A8D A;  2R04 3;  2BQP A;  4K8R B;  4PIZ A;  3FHI B;  2ETE A;  1AL2 1;  1KQR A;  4BLJ A;  4YGE A;  1WLC A;  4MXW A;  1WMD A;  1CVN A;  4P02 B;  2YC4 A;  4ZU5 A;  1KRI A;  2ZGP A;  3ACL A;  5FY5 A;  4XVH A;  1NY7 2;  2GH2 A;  2WT2 A;  4S2D A;  5JOX A;  2DCT A;  4AWD A;  4XIO A;  3OYW A;  1V9U 1;  4HVR A;  4WVM B;  3PJQ A;  5FBZ A;  4IV3 C;  3MFC A;  5JVV A;  2FDK A;  1NXD 1;  2XVL A;  3NRU A;  1TMF 2;  3LZZ A;  5LAS A;  1ST8 A;  1IPS A;  4MZU A;  4BH9 A;  3MZH A;  3NNM A;  1SHW B;  1VLN A;  2RJK A;  1YI9 A;  3VBR C;  4COU A;  4W6Y A;  3IAP A;  1QNY A;  5LA0 A;  3E6D A;  5T55 A;  4IGO A;  1WA6 X;  1QY4 A;  2OZ6 A;  1S0E A;  2LRO A;  2RS5 3;  5FAX A;  4QXC A;  4NE9 A;  5LY1 A;  3AZV A;  3CF6 E;  4Q4W 2;  4R4X A;  4D94 A;  1GOG A;  4CU9 A;  3VBS B;  1BZW A;  4B4Q A;  2GC1 A;  3T2Q A;  1QDC A;  3OUH A;  5JDB A;  1WGP A;  5CFD B;  1JOP A;  4J1X A;  3VL8 A;  5L7O A;  1UU6 A;  2R32 A;  4KBZ A;  2XBO 3;  3WF2 A;  5FV3 A;  4YZ4 A;  2RR1 2;  3T0D A;  3OGG A;  1RUI 2;  1VBC 2;  4LLF A;  3CIH A;  2L9L A;  2VM9 A;  4C91 A;  4KU7 A;  1VE0 A;  1GSL A;  4NAO A;  4CCL A;  1C8M 3;  1DIW A;  2AEZ A;  4UFH A;  3TAY A;  4WVV A;  1DQ1 A;  2W47 A;  4U36 A;  4BWO A;  2P4E A;  1E5S A;  4HPK A;  4DQA A;  2Y6K A;  2DUR A;  2YBP A;  3ZSL A;  4LKD A;  1SPP A;  3DPR B;  1RL3 A;  4XUP A;  2B45 X;  4I0A A;  1APN A;  5A3N A;  4IXL A;  4HSJ A;  1DZQ A;  3AZY A;  4MHR A;  5FP8 A;  4BM8 A;  2IFW A;  1L7L A;  4EWD A;  1SBF A;  1XE7 A;  2W1W A;  3H3U A;  3FL7 A;  1DQ2 A;  1YO8 A;  2GSY A;  5FZ0 A;  1K5M A;  3R6S A;  2QFE A;  4FVV A;  5LWB A;  3KVB A;  1J59 A;  1VBB 1;  3AVS A;  1DYK A;  3VBO C;  3ZO0 B;  5BNQ A;  4OHV A;  1BEV 1;  2D40 A;  2VUJ A;  2EXJ A;  4PJY A;  3S6P A;  2VZR A;  3KGZ A;  3PUS A;  1S0J A;  4Z2A A;  1ZZ6 A;  5FQ0 A;  3H0O A;  2VOV A;  1OFN A;  3OY8 B;  4I0W B;  1T2X A;  4LQR A;  5HBA A;  2YYO A;  4YVW A;  3LSE A;  3WDY A;  1DQ0 A;  2JE8 A;  4X6R B;  5EJ1 B;  1HB3 A;  4NII A;  3VZK A;  2FDG A;  3AP4 A;  1PVX A;  2C9K A;  2BNM A;  2IXH A;  5FZA A;  1HXS 3;  1RMU 3;  1XQN A;  2WC2 A;  3BCW A;  5A1A A;  2P3Y A;  1AL2 2;  2QNK A;  3CNA A;  1OUS A;  1GQH A;  1OLM E;  5F6K A;  2VW1 A;  1NXM A;  3RDI A;  1ENS A;  3IPV A;  2Q8D A;  2UYB A;  1O91 A;  4J6G A;  1FT9 A;  4FPF A;  5C8C B;  4GMP 3;  1CAW A;  3A22 A;  5D21 A;  4DEQ A;  5IAT A;  5KHJ A;  3H1M A;  2Z5W A;  1UZZ A;  2IXI A;  2ZJC A;  5LRR A;  3IDE A;  4IE0 A;  1V9U 2;  2P6H A;  4O61 A;  1BK0 A;  2R1B A;  4M4P A;  1RUH 2;  4ES8 A;  1VBD 2;  1JUH A;  2HWC 1;  3OEA A;  3HIF A;  4CEY B;  2RDN A;  3O1S A;  3KWV A;  5DZF A;  3WOG A;  5EFU A;  4B1M A;  1DGW X;  1YIP A;  5CU1 A;  3J7N A;  2CTV A;  1OA4 A;  3OBT A;  5FY9 A;  1TQ5 A;  1HW5 A;  1WW7 A;  3GJA A;  1RJ8 A;  5DUU A;  3SEE A;  1JU3 A;  4RHV 1;  1UZW A;  4ARX A;  2E51 A;  1ALY A;  4BQX A;  3SQO A;  3S30 A;  4WM7 B;  3TN9 1;  3RZM A;  4GH4 C;  3BPZ A;  5EWS A;  1HV1 A;  2PAM A;  3ACH A;  4OHX A;  1JOD A;  3NNL A;  4QPI A;  1B35 B;  3NO8 A;  4XOG A;  5TSW A;  2EAK A;  3BTZ A;  2Y38 A;  4AHY A;  2YDE A;  5LBF A;  2ZCW A;  1MQT C;  3ZN4 A;  2GDF A;  1JXN A;  3GYD A;  5HPO A;  3KZ4 C;  2WT1 A;  1U12 A;  3CMG A;  4K6B A;  1SEF A;  4FFI A;  3S7E A;  5B4X A;  4H3W A;  4D6Q A;  1GIC A;  1ZRC A;  3ZN6 B;  4DIN B;  2GH8 A;  2BVV A;  1Q8S A;  1GV9 A;  1R64 A;  2ZHL A;  3WUD A;  3IDB B;  3O5S A;  1UXZ A;  2Y0O A;  4RQP A;  1YQ5 A;  2BBA A;  4ZS3 A;  5FZM A;  4NIH A;  2BNO A;  3N9Q A;  2XXZ A;  4MX3 A;  3AKS A;  2ZXQ A;  4I3P A;  4ZXK A;  5DN2 A;  1CD3 G;  1K12 A;  3QOP A;  5GKA C;  1ZBA 3;  2EAL A;  2DDU A;  1F15 A;  2VQT A;  1LEM A;  2J1E A;  2WDB A;  3H7J A;  3PUI A;  5GAL A;  4D7S A;  4DEV A;  2V73 A;  2XR4 A;  4AHW A;  3BN6 A;  2B42 B;  3ZSM A;  1O5L A;  2DV9 A;  2D5F A;  3B00 A;  1W2U A;  2E63 A;  5J98 B;  2EIB A;  3ZMN A;  5C6C A;  1DZR A;  2ERF A;  4FTB A;  1AXY A;  1RVF 1;  5F3C A;  3HAG A;  1IOA A;  4E9K A;  4N53 C;  4N7U A;  2D6P A;  2A73 B;  5KHK A;  4M0N A;  5T3N A;  3VDD B;  4LKE A;  4XFF A;  3J8F 3;  4L11 A;  2C24 A;  4CCJ A;  5JZG A;  2TNF A;  1AR6 2;  4ATF A;  4FFG A;  2BV4 A;  1ND2 B;  3U14 A;  2VZ3 A;  3CKH A;  5FZC A;  1SQ4 A;  1J1L A;  5FPV A;  2GND A;  4IEO A;  4XFB A;  1LR5 A;  5DDJ 3;  4Y4Y A;  3M2M A;  2BER A;  2JG9 A;  5C4W A;  3C7G A;  4AI8 A;  3CEW A;  4Q4Y 3;  3TEX A;  5AC9 3;  2WNU C;  2RS1 3;  1W6O B;  4HFS A;  2D6M A;  3Q9O A;  4JCK A;  1CAV A;  4P00 B;  4ORF A;  1VBA 1;  1W8N A;  3BAL A;  4JGZ A;  4LK7 A;  2W46 A;  1W0P A;  2JIJ A;  5CFC C;  1RUD 1;  3I59 B;  1S2K A;  3LEI A;  4XUQ A;  3ZKU A;  3MIH A;  3BU0 A;  4COV A;  4AI3 A;  5JPN B;  2B5H A;  2VH9 A;  5FFO C;  1JMU B;  2W08 A;  4XF9 A;  2HWD 1;  2HWC 2;  1O7F A;  5A6Q A;  1AR9 3;  2D44 A;  1W8T A;  1GZT A;  3QH7 A;  5FYV A;  1PVC 1;  4M3C E;  1CZT A;  1IQA A;  3BVC A;  3LD8 A;  1AR8 3;  2V4A A;  1RUF 1;  1YFX A;  3NNJ A;  4I0B A;  4OLL A;  4RHV 2;  1AUY A;  5JCT A;  4IET A;  1DBN A;  2HWF 1;  4XAE A;  1W2N A;  2XJS A;  2RDS A;  1RUE 2;  2VQU A;  3ASI A;  3TN9 2;  3WNP A;  5C9A C;  2OS2 A;  3UL2 A;  4PT6 A;  2I45 A;  4N43 B;  2CNA A;  4LKF A;  3AL5 A;  2JDA A;  2DVG A;  3AJY A;  4WZF A;  1S0F A;  4C1W A;  1C28 A;  3M7A A;  2FDH A;  2VOX A;  2X05 A;  5LW9 A;  4LE3 A;  3O1R A;  2XKO A;  3O0W A;  2XKP A;  1D0G A;  1AYM 3;  1REE A;  3EYP A;  4OFG A;  3VKO A;  2EID A;  4CDQ A;  1ZZC A;  5DG2 A;  1CES A;  1OPM A;  5FZH A;  1Y3T A;  3RRD A;  4K21 A;  4BK4 A;  2QQV A;  2BBV A;  1QJX 3;  3J7L A;  1ASJ 1;  1QJY 1;  1ULP A;  1XOY A;  2O8O A;  4LBK A;  4YZ3 A;  3WQB A;  2QQN A;  2V09 A;  3ETQ A;  3ROU A;  2MEV 2;  4XE9 A;  3Q8E A;  2VU9 A;  1ZYB A;  4FPK A;  3PMS A;  3LAG A;  1AL0 G;  1QOS A;  3GZU C;  1XNK A;  2CSG A;  5JIA A;  2IUW A;  2A1X A;  3Q8F A;  2GZW A;  4YZ2 A;  5LA2 A;  2E33 A;  4B4P A;  2JXA A;  2ZOE B;  2VQ0 A;  2WZR 1;  4QHB A;  1R09 2;  4N9H A;  4ASK A;  4BQY A;  5K0U C;  1I6X A;  3ZSJ A;  4PF1 A;  2BOI A;  4UXA A;  1H8T A;  2LAL A;  1BKZ A;  5FZI A;  3U78 A;  3ZLI A;  2RDQ A;  1RVF 2;  1MS3 A;  3I2G A;  1JZ2 A;  4QXK A;  4UFL A;  2A3W A;  4XAA A;  4L9B A;  1UXX X;  3OGS A;  3K4A A;  4PDW B;  2ZGL A;  5JOW A;  4DIQ A;  3ILN A;  5CIR A;  4P9X A;  2BWC A;  2QDR A;  3J7M A;  3ABZ A;  3MIF A;  1MR5 A;  3O12 A;  2ZX3 A;  4F7Z A;  4OI0 A;  3IAQ A;  1A78 A;  4EWA A;  2CDO A;  3T4V A;  4BQ2 A;  1WA4 A;  1BJQ A;  3JBG 2;  5F7U A;  1TEI A;  5EXO A;  4D8M A;  2ZGK A;  2NPI A;  1UOJ A;  2V72 A;  5KHI A;  1F8V A;  4CDX B;  2Q8E A;  1VBA 2;  1W6Q B;  2ZGO A;  4KBB A;  1EAH 3;  2OX0 A;  1W8Z A;  2Y26 A;  4LBO A;  2K46 A;  4CDU C;  4AQ2 A;  1AXZ A;  1RUD 2;  1UNB A;  4XZP A;  1IG0 A;  5EP9 A;  1GYK A;  5FK8 A;  4OYU A;  3NV3 A;  3TWI A;  3H42 B;  2GNM A;  1QQP 1;  4FAG A;  3I2O A;  4AEJ A;  1KIT A;  1UY4 A;  4Z82 A;  4AI9 A;  3ZFG C;  3EB7 A;  4IEU A;  1TVG A;  2ARC A;  3U1X A;  1C1L A;  4ATE A;  4TSV A;  4YVS C;  1FPN 2;  2JB4 A;  4QPG A;  3MW2 A;  5H9Q A;  3LA2 A;  2HWE 2;  5IVF A;  4OZX A;  2Z69 A;  1NX9 A;  3VN4 A;  1PX3 A;  4OI2 A;  1PVC 2;  4BLI A;  3U0Z A;  3I49 A;  1CWP A;  2VY0 A;  2IXK A;  2WBK A;  3VBF A;  4D6S A;  1VPH A;  1D4M 1;  1NA1 A;  1RUF 2;  2CAV A;  2Y0I A;  4XBL A;  1RYY A;  2UY9 A;  4UWD A;  2TBV A;  1KDK A;  4LA2 A;  4I01 A;  3DXU A;  4YG6 A;  2HWF 2;  3M1H A;  5CAD A;  3N9O A;  1DYP A;  2YRO A;  3HWJ A;  4FOQ A;  1UYZ A;  5FZD A;  1HLC A;  3RZG A;  2GN3 A;  3ZFF A;  1HB4 A;  2VCB A;  3PVN A;  2G4I A;  4XC9 A;  1SAC A;  1OQE A;  2ADD A;  3AC0 A;  4NRO A;  3ZYG A;  2X29 A;  5F9T A;  5JSR A;  4BZ4 A;  4JKK A;  2E53 A;  3WY6 A;  5C3P A;  1H4H A;  4ISR A;  4P9J A;  4GJZ A;  3SKV A;  3MLK A;  3OGV A;  4Y1Z A;  5D8A C;  1H2L A;  2NLR A;  5FIX A;  5J09 A;  2XJR A;  1CX1 A;  2F4P A;  3JUU A;  2BU9 A;  3MIE A;  4IV1 C;  5EJ3 A;  5F1R A;  3SCH A;  1UN1 A;  4MG2 A;  1G8W A;  2AR6 A;  3CQO A;  4CUC A;  2IFR A;  1LAJ A;  4IE5 A;  4AW7 A;  1HQL A;  2P6C A;  1X9T A;  2MPF A;  3R4D B;  4GMP 0;  1ASJ 2;  1QJY 2;  2YY1 A;  3OBZ A;  3WG2 A;  1NOV A;  1S2B A;  1KFX L;  5LBE A;  4GIQ A;  4JQT A;  4IEQ A;  3N7M A;  4I30 A;  1OVS A;  2DYC A;  3AMP A;  3HQU A;  2XQX A;  5FUN A;  3CHX A;  5LBC A;  1D4V B;  1O8P A;  4GAL A;  3CJI C;  4AFD A;  5JIU A;  3BTY A;  3ILF A;  4UFM A;  4BXF A;  5A33 B;  2DU1 A;  1OUX A;  2WZR 2;  5KC6 A;  2AH2 A;  5JPM B;  3NJZ A;  4WVM A;  5CNA A;  4NRM A;  4Q4V 1;  5JR7 B;  4OHY A;  1POV 1;  4CDW C;  5FZL A;  4LOT A;  1SFY A;  2J1V A;  5EIY B;  1ZRI A;  1VAL A;  5KBF A;  2BFU L;  1GZ9 A;  2Q4S A;  1TNR A;  2G9F A;  3V65 A;  4FSJ A;  4DRV A;  3VD4 A;  2E26 A;  5I0R A;  2VZQ A;  4LIV A;  1PZ7 A;  2XDV A;  2HEV F;  1W0O A;  1U5Y A;  2Y33 A;  2YBK A;  4YM1 A;  3ZYR A;  2VO5 A;  3R05 A;  3MEP A;  4C0H A;  1OD5 A;  3UV9 A;  2BNN A;  4L2N A;  2LS6 A;  1XYP A;  3VBS A;  4A7Z A;  3O1P A;  3SXW A;  2FMD A;  2OPK A;  4Q0U A;  3WF1 A;  4XBN A;  1FOD 2;  1QXP A;  2GU9 A;  3ZPY A;  1SCR A;  5CFD A;  4XXA A;  3AM2 A;  3RZK A;  4IND A;  4XW3 A;  3DKW A;  1NZI A;  1VRH 3;  1XYO A;  2JDU A;  2I07 B;  1Q5O A;  3K75 B;  4H2A A;  1PNF A;  2VVD A;  5FYB A;  1BBT 3;  4E2S A;  3ZFE C;  5C8W A;  4AQ6 A;  1UZV A;  3DYO A;  5FWE A;  3C2U A;  5L73 A;  2ZZQ A;  1CAX B;  1ULC A;  2YFZ A;  1UMH A;  3JZV A;  5AVA A;  1A6C A;  3NQH A;  1OF3 A;  2FBE A;  1RHI 3;  3HBK A;  4AGR A;  1DDL A;  4LIT A;  3DPR A;  4TN7 A;  4BJ0 A;  5T5L A;  4NWW A;  1D4M 2;  1MZ5 A;  3LB9 A;  2A3Y A;  2F6B A;  2UY8 A;  1UX6 A;  4NPM A;  5KHG A;  1CQ9 A;  1DGR A;  1GWL A;  2DWR A;  2NN8 A;  1PGL 2;  4QB1 A;  1AX1 A;  3FWE A;  1GP5 A;  1VIW B;  3LFM A;  4HN1 A;  3UGH A;  4BCU A;  4CCK A;  3BIE A;  3PDQ A;  1OOP C;  1K5J A;  1CN1 A;  1V6I A;  1TMF 3;  2D6O X;  2VBP A;  3I3B A;  3GBG A;  1WKY A;  1SLB A;  1Y9M A;  4HON A;  2BDR A;  2WA4 A;  1NUK A;  3NV1 A;  3DCQ A;  1W9W A;  2QCS B;  3B69 A;  4AED B;  3AX4 A;  1F5J A;  1YQ8 A;  1ENQ A;  1LOD A;  5B2G B;  2ZX4 A;  3O14 A;  4AEK A;  3IBM A;  2VNO A;  1VBE 2;  5FZ3 A;  2XL7 A;  3SCF A;  1ND3 B;  4AFA A;  5JXJ A;  2R16 A;  3GNE A;  1S2E A;  3OY8 A;  4NVP A;  4Q4W 3;  1ZM1 A;  5AFE A;  3DXT A;  1AR7 3;  5FY0 A;  1Y7B A;  3POF A;  5ANN A;  1MS0 A;  2FDJ A;  4LUM A;  2QJV A;  5FY7 A;  5T5O A;  2J1U A;  4PLO A;  1U5X A;  3MI8 A;  3I2F A;  3N9M A;  4R9C A;  2A5Z A;  4YW1 A;  5A3O A;  4XHB A;  5C33 A;  2RR1 3;  1LCL A;  2OUH A;  3IMM A;  1RUI 3;  4Q27 A;  1OQ1 A;  1VBC 3;  3NST A;  5C8C A;  4YGC A;  1UF2 C;  2GNT A;  2VZV A;  4YW2 A;  1UU5 A;  4JQR A;  2IXJ A;  1PZ9 A;  2JG8 B;  1GFF 2;  2JIC A;  4LR4 A;  4NJ4 A;  3W20 A;  1QH7 A;  1O8S A;  1W28 A;  4UT5 A;  4LT5 A;  2BW8 A;  4FPH A;  4Q4V 2;  5HCB A;  2ZS6 B;  4YPJ A;  3RWN A;  4CEY A;  1WME A;  1F31 A;  2X8K A;  3PUA A;  4KL1 A;  4JGY B;  1JUI A;  1W03 A;  2Y6G A;  4OI4 A;  4QPW A;  3RQ0 A;  2WSV A;  4S2F A;  3RYR A;  3T4H B;  1RUC 1;  5DAQ A;  1FNZ A;  3LCP A;  3MPP G;  2DVA A;  4I09 A;  4Z07 A;  4BQ1 A;  3M4F A;  5C7G A;  3RZH A;  3N9L A;  2F4L A;  1LHO A;  3BOP A;  3L2H A;  2PHT A;  4NHM A;  1JU4 A;  1U5I A;  1XC6 A;  3CZJ A;  4LBQ D;  5FP9 A;  1UOG A;  3WQ7 A;  3ZR5 A;  2VCA A;  2X5I C;  3WDT A;  4CP2 A;  1LHV A;  4MO3 M;  4OCT A;  2P1B A;  1LOF C;  4WM7 A;  2WNV C;  2DFB A;  4HVO A;  4H55 A;  4UW6 A;  1XE8 A;  5D1I A;  1B35 A;  1YFY A;  3OUI A;  4L8Q A;  4P9G A;  5L9B A;  3I2K A;  2D6K A;  2OQ6 A;  4TYS A;  1YIF A;  1BMV 1;  3AP6 A;  1V00 A;  5JI7 A;  5BNN C;  1RB8 G;  2XB6 C;  1NCQ C;  5HXV A;  2BWA A;  3EBR A;  1M4W A;  2SLI A;  2XGX A;  3ZN6 A;  4WVZ A;  4NWV A;  2R06 2;  4COZ A;  3GHN A;  4RSU A;  3M8L A;  4XJU A;  4B4R A;  4K9S A;  2PXJ A;  2PHW A;  1GNZ A;  4QB6 A;  3VHN A;  2A6V A;  4BQW A;  2IWG B;  2EIG A;  4R9B A;  4QX2 A;  3WHU A;  4BOW A;  3M3I A;  4IV3 B;  4DPN A;  5JI9 A;  3MUY 1;  4CCD A;  4BQ3 A;  2JDZ A;  4QMA A;  4YWA A;  3KT1 A;  4QU2 A;  4S2H A;  2WS9 1;  5CKN A;  4KQ7 A;  2RG4 A;  3KLS A;  4KNC A;  3APB A;  1X82 A;  2NZ9 A;  4IEP A;  2JEC A;  3VBU C;  3O0X A;  4JDO A;  2VUA A;  3VBR B;  3E5U A;  1RUH 3;  1L7Q A;  1VBD 3;  2VVE A;  2W9X A;  4HN0 A;  3U10 A;  4CU6 A;  5IFP A;  1JZ3 A;  4ES9 A;  1UPI A;  4O7X A;  2JDP A;  4AYU A;  4CVU A;  1MS5 A;  2GC3 A;  2YGL A;  4LLO A;  3VDC A;  2C0Z A;  4AFC A;  5F3I A;  2ET7 A;  5KXC A;  4CUA A;  2AAC A;  3VDD A;  1W6P B;  3JQX A;  3POY A;  4QXB A;  4XCA A;  4QX1 A;  2EVX A;  3VKM A;  5IVV A;  2RJL A;  3SLI A;  1IS4 A;  4ZON A;  3C3V A;  1QF3 A;  3K3N A;  1ND2 A;  2ARA A;  5KXD A;  2VMD A;  4QX0 A;  1JOB A;  3N9N A;  4RR3 C;  3ACI A;  4YW7 A;  4RS5 C;  1F5F A;  4EN0 A;  1HDK A;  4TZD A;  3KMH A;  3R4U A;  4P5Y A;  3USU B;  1JZ4 A;  3LA7 A;  3POB A;  1ACC A;  1QXJ A;  5BXX A;  4CCE A;  1W6O A;  1STM A;  5FTT C;  5GZE A;  4IL7 A;  3T09 A;  2FDF A;  3NMB A;  1WBF A;  3LKJ A;  1D7P M;  3ACF A;  1MZ6 A;  1X50 A;  2ZGR A;  3JCI A;  1JN2 P;  1C3H A;  2BGP A;  4Q8K A;  2VJX A;  3PVE A;  3I59 A;  2WYF A;  1C8N A;  1N3O A;  5LEK A;  2ZZJ A;  2XLA A;  1HJF A;  1PZ8 A;  5GLZ A;  5IJR A;  1LOG A;  1MEC 3;  3FLR A;  3WDW A;  4NMI A;  4P14 A;  5EZW A;  4AVT A;  4DB5 A;  2E7Q A;  4K40 A;  2BPA 2;  5LB6 A;  1RUC 2;  2HYK A;  5FO9 B;  3KV4 A;  1N3Q A;  3KHC A;  2QQP A;  1TME 1;  3VBO B;  5I8S A;  2B8M A;  2YPD A;  4ZHN A;  1XND A;  1DLC A;  2QQM A;  1ONA A;  3AL6 A;  4LJH A;  4JKL A;  3TEZ A;  3O1V A;  2JJ6 A;  5ABJ C;  1BMV 2;  1CR7 A;  5A3W A;  1PM7 A;  2HWB 1;  4YW5 A;  5LA1 A;  2HKX A;  2D3S A;  3BUC A;  4A7Y A;  3T1M A;  4N43 A;  4XDO A;  5A80 A;  1HRI 1;  1PGW 1;  4L0P A;  1NZC A;  1OQD A;  1YQC A;  4KG8 A;  1YC6 1;  2C4X A;  2OZJ A;  2OVU A;  3PUR A;  4WV8 A;  3VB9 A;  2PHU A;  4LUL A;  3LIG A;  1AR6 3;  2CL2 A;  2YPJ A;  1NCR C;  1CGP A;  2WO1 A;  4CDU A;  1AYN 1;  2C6S A;  2VOK A;  5GZD A;  5IVE A;  5ACA 2;  4R9D A;  3NWK A;  1WCS A;  2XLF A;  3A0N A;  3AP7 A;  2D5H A;  3Q8A A;  5DAV A;  4XTM A;  4C90 A;  2HJI A;  2E32 A;  4NID A;  2HYX A;  4URA A;  2DCZ A;  1LOA A;  1X33 A;  5FZE A;  4QQP A;  2KR2 A;  4EZ4 A;  4Q0V A;  3CLP A;  1C57 A;  1WLT A;  5HXM A;  1LB2 A;  5FPL A;  2K9Z A;  4RD7 A;  4LUK A;  1W0N A;  5F8P A;  3MBW A;  3WW2 A;  2R07 2;  2YU1 A;  1J3P A;  2HWC 3;  1NAE A;  2ZGM A;  2XML A;  4HZF A;  4PBP A;  1GZW B;  2ZHK A;  2WUH A;  5F5Q A;  5IK4 A;  2P37 A;  4GAZ A;  4A44 A;  4KG0 A;  5G05 L;  2XJV A;  2W5F A;  1GWK A;  1S55 A;  4GH4 B;  3I3Q A;  3R4S A;  3RYP A;  3DKQ A;  3THD A;  4QX8 A;  4SLI A;  3D8C A;  2NQY A;  1W8O A;  4HSL A;  4M0H A;  4PDW A;  4XFA A;  5D8A A;  5I0S A;  3TBD A;  1KD7 A;  4A3Z A;  5C3R A;  1IS3 A;  2QKD A;  3W58 A;  1MQT B;  1RUE 3;  1PMI A;  3TN9 3;  4UFJ A;  5FWJ A;  2FZ1 A;  4HBN A;  5A6Y A;  1H0B A;  2CWM A;  4PLM A;  4DUW A;  1Q8O A;  4CCO A;  3VBH C;  4HLT A;  1JHJ A;  3VL9 A;  3IKW A;  3HEI A;  3WZ1 A;  3KV6 A;  3EMR A;  2ILM A;  2EA7 A;  3J9S A;  2PEL A;  1A34 A;  1UZY A;  4HK9 A;  2RS5 1;  4LOR A;  4AE2 A;  4BMB A;  4CDX A;  1W6Q A;  4AI0 A;  3MFA A;  4N7I A;  2ENR A;  4XQ4 A;  2BVB A;  1QNW A;  1V6K A;  3ZIW A;  1NLQ A;  2WRA A;  4E4D X;  3RI9 A;  3AJZ A;  3LEK A;  1HKD A;  1DFQ A;  3VZJ A;  4EE2 A;  1JYN A;  1SLA A;  4YRD A;  5FPZ A;  5GJ6 A;  2FCT A;  4F8A A;  4MUV A;  3HOB A;  1UX7 A;  3VD3 A;  3L9J T;  4ASL A;  2XBO 1;  4K8F A;  2MEV 3;  3OGR A;  1R1Z A;  3IMN A;  2W1S A;  2WQ4 A;  3NNG A;  4MGQ A;  4ZU7 A;  3M3O A;  3VDB A;  1W2T A;  1TME 2;  4Z8B A;  1NKG A;  5JWP A;  2ARE A;  3VHP A;  5T54 A;  4N53 B;  3UGF A;  2CY6 A;  1R09 3;  4DFS A;  4FQZ A;  1LOB A;  1G9C A;  2YXS A;  2Y34 A;  2J22 A;  1DP0 A;  2JX9 A;  4FBF A;  3LF7 A;  1AHS A;  2K2S A;  5FRE A;  1RVF 3;  5A7N A;  1DGR N;  1HRI 2;  1PGW 2;  2RDR A;  4NN0 A;  4QX3 A;  2J7M A;  4Z2W A;  2VNG A;  4BDV B;  3KCY A;  4WZC A;  3PHM A;  2QQW A;  2WNU B;  4QQH A;  5J36 A;  1W9Y A;  2UUR A;  2XL9 A;  1AF9 A;  3LOI A;  3OPZ A;  1QXR A;  2PQS A;  3FFQ A;  1FAT A;  1AYN 2;  1LHW A;  3N36 A;  4JDM A;  3ST7 A;  5IHR A;  3O1U A;  2QUO A;  4XFI A;  1A3K A;  4YM0 A;  2RS3 1;  1J83 A;  3JBG 3;  5FYU A;  3A4U A;  5CFC B;  1WLW A;  1VAV A;  3PUH A;  2C9A A;  1OI6 A;  1W6N B;  4AGG A;  1V6J A;  5KXB A;  1H6X A;  1RJ7 A;  2B9U A;  3NV2 A;  5IAV A;  1IGO A;  1VBA 3;  1Z7S 1;  1Q56 A;  1VB4 A;  3WLU A;  2OQ7 A;  4EN7 B;  3AXE A;  2A3X A;  4LTA A;  3GGL A;  3W21 A;  1RUD 3;  2VGD A;  4LIU A;  4A3X A;  4E8D A;  4UYB A;  1OA3 A;  5A33 A;  4CEW C;  3KQR A;  1EV1 1;  2ZX2 A;  3OGJ A;  2ZGQ A;  4KMQ A;  5GZC A;  1LRH A;  1EUT A;  4GUL A;  3BYW A;  1KXG A;  4O65 A;  1H30 A;  1RMU 1;  1R1A 1;  2GAL A;  3O1O A;  1FPN 3;  3DEM A;  3G7D A;  4D7T A;  2HWE 3;  3VKL A;  3WG1 A;  2XPJ A;  5A7P A;  5KR7 A;  4JRL A;  5C9A B;  1VBB 2;  3KD4 A;  4O9G A;  1RUF 3;  5F3G A;  1GU3 A;  4RL7 A;  5FYI A;  2WWU A;  1CZV A;  4JHZ A;  1BEV 2;  4K20 A;  2WN3 A;  3T2T A;  2HWF 3;  1D2S A;  3JB8 A;  1O6U A;  4HKW A;  4LKS A;  3HNY M;  4URT A;  1UMI A;  4B7K A;  1RED A;  1LGB A;  3VD9 A;  3RMY A;  3U75 A;  3PIG A;  4H7M A;  4DY5 A;  1MS8 A;  3BTX A;  5FLI A;  5A6X A;  1UKG A;  4TXW A;  2CHH A;  3UET A;  2EXI A;  1TNF A;  3F95 A;  2NYY A;  1W05 A;  1PK6 C;  1SG3 A;  1F9K A;  2XQR A;  1AJK A;  4BPZ A;  5FYM A;  4GD4 A;  1T6G C;  2J1S A;  1TE1 B;  2R6Q A;  3CZU A;  3OBR A;  2ARX A;  4H7L A;  1QHD A;  1QOT A;  1RTV A;  2C26 A;  4H14 A;  5L9R A;  2WNO A;  3GAL A;  2FCU A;  4PHZ A;  1FAY A;  1CAX A;  1ASJ 3;  1W9T A;  3D3A A;  3GBF A;  4YW6 A;  5FZG A;  2D93 A;  5K0U B;  4AAX A;  5JMC A;  5T50 A;  3CL1 A;  5DPN A;  2VPV A;  4KGQ A;  3CDZ B;  2IXL A;  3E5X A;  1ZZ7 A;  4AVC A;  2XON A;  3ES4 A;  2WLP A;  2WFF 1;  2UWB A;  4SBV A;  4JKM A;  4UFI A;  1GMM A;  4FOY A;  4XUN A;  1C5I A;  2CGN A;  3O1M A;  1W39 A;  3IM0 A;  5IT6 A;  1XPW A;  2BEO A;  5A32 B;  4XXP A;  2QQK A;  2ZTN A;  4QXH A;  2D97 A;  1O4Y A;  4MYE A;  2W94 A;  1MZF A;  4CPB D;  3N35 A;  3HT2 A;  3LA3 A;  1PX4 A;  4RGG A;  5A7S A;  2ZAH A;  3S57 A;  2XHK A;  3KGL A;  3S0M A;  2A6Y A;  2NM1 A;  5FZ7 A;  4XF1 A;  5FZK A;  3TNQ A;  3NJV A;  3I3E A;  3HNB M;  4KWU A;  4AED A;  1RUJ 3;  3WUC A;  4P9Y A;  1KS5 A;  1ND3 A;  3RPQ A;  1W06 A;  2ZGN A;  3OD0 A;  1BHG A;  2H6B A;  4FI9 A;  5GLW A;  5IK8 A;  2MNG A;  1OT5 A;  3NAP C;  2RS3 2;  3SCG A;  4CDU B;  4K3U A;  5BNP C;  1XE0 A;  2VNV A;  1W3V A;  2W95 A;  5FYC A;  5L36 A;  3WNN A;  3RNS A;  3H1Y A;  2QVS B;  2QZ2 A;  4ASM B;  3U11 A;  3ZXK A;  1FOD 3;  3J8F 1;  3AB0 A;  3ETP A;  1WCK A;  2W1Q A;  3GBW A;  3RZZ A;  1XNT A;  1Z7S 2;  2R30 A;  1LGN A;  1O59 A;  1ZBE 1;  5FY1 A;  3ZFG B;  4LA3 A;  5BNO C;  5JMO A;  4YVS B;  1OLQ A;  3FBY A;  5DDJ 1;  2V4V A;  3USS A;  2W91 A;  5F39 A;  4YAR A;  3QAC A;  4DZG A;  3WCR A;  3I2D A;  1EV1 2;  2P17 A;  2PHR A;  1WW4 A;  5AC9 1;  4Q4Y 1;  2JG8 A;  2OPW A;  4LO5 B;  4OMD A;  4QT6 A;  3VBU A;  1JYV A;  1NE4 A;  1R1A 2;  2W87 A;  1EYB A;  4HKO A;  5JXG A;  4JGY A;  3RFR A;  3PLQ A;  1GKB A;  4QGL A;  5CIS A;  1D4M 3;  2BTV C;  1J3Q A;  1JYX A;  2AGS A;  1LEC A;  2VTX A;  1MS4 A;  2FCV A;  4AG4 A;  2PTM A;  2UWA A;  1JYC A;  4ISQ A;  3VKN A;  3H9A A;  5BUV A;  5D8A B;  5C3O A;  2FDI A;  2DCY A;  1UMZ A;  3WP5 A;  2LUW A;  3DUI A;  1AR9 1;  4GWN A;  2QDN A;  4IV1 B;  4RFT 0;  5JOY A;  4J25 A;  4BIO A;  2UWC A;  3D6E A;  1CAU B;  4LBQ B;  4NO4 A;  1AR8 1;  2J42 A;  2ARB A;  3JU9 A;  1E57 A;  2MHF A;  2IZW A;  1BXH A;  1LGC A;  4B7E A;  3WCS A;  5IAX A;  3KHB A;  4N9I A;  2YC2 A;  1VBE 3;  3ES1 A;  4NHL A;  2XHN A;  4D69 A;  3UK9 A;  4XIL A;  4Y22 B;  2R1D A;  3KT4 A;  2W39 A;  3LOB A;  3AXD A;  4Y1V A;  1JZ8 A;  3K2O A;  4UFK A;  2VZO A;  3CJI B;  5C70 A;  1ZA7 A;  2VC9 A;  1MVE A;  1MS9 A;  2YG0 A;  1H1I A;  2HWD 2;  1N3P A;  3RZL A;  4DXZ A;  4IV3 A;  1V6N A;  3LDR A;  4XAB A;  1US2 A;  3I8T A;  1QJU 1;  3UNP A;  1JTZ X;  1GNH A;  4CDW B;  3R0R A;  3MV1 1;  4IER A;  5IK7 A;  2WFF 2;  1AX0 A;  2C1F A;  5GLU A;  1W8F A;  1KDM A;  3VBR A;  2VMH A;  1QJX 1;  1WMX A;  5FDB A;  2GMM A;  5FR3 A;  1JS9 A;  5L7O C;  5CKQ A;  2E9Q A;  1YEW A;  1CIY A;  1GQG A;  3AYA A;  4JX0 A;  2B9V A;  4V1P A;  3SEP A;  3T08 A;  5J1X A;  3B93 A;  1Q3E A;  2RM2 1;  1UPS A;  2DVD A;  1G9F A;  2RMU 3;  5JSO A;  2PYT A;  4GB3 1;  4AVA A;  5CG9 A;  4NR1 A;  1UZ0 A;  3FE5 A;  4AEM A;  4JC1 A;  3HVD A;  3VUO A;  2ZEZ A;  3RMX A;  1W6P A;  4FTS A;  2VME A;  2BFU S;  2ES3 A;  2NP0 A;  1CON A;  1UY0 A;  1SZB A;  5A3T A;  2PLV 1;  1OF4 A;  1R08 1;  4BA6 A;  3FLT A;  3MV0 1;  2P34 A;  5GLT A;  4LNV A;  4YGB A;  4OUL A;  3VD7 A;  1Q43 A;  1HN1 A;  3WF3 A;  2HEW F;  1OD3 A;  2FMY A;  4CXW A;  4DS0 A;  3USU A;  4FXK B;  5IUQ A;  3ZFE B;  4UOJ A;  3ELN A;  3ZN5 A;  4COW A;  1ZBE 2;  3K3O A;  4QQL A;  3ZDV A;  5JLV A;  1DQ5 A;  1J1T A;  1K5M C;  1QIQ A;  2W3J A;  3PVO A;  2BZD A;  3B7M A;  4I3G A;  4PQ9 A;  4XJZ A;  1JYW A;  1QKQ A;  5E1R A;  5DDJ 2;  2WJS A;  5ANQ A;  2CGO A;  3KB5 A;  2GN7 A;  2Z4F A;  4Q1P A;  3TEY A;  2R06 3;  1C1F A;  5C3S A;  3MPB A;  5FJH A;  5AC9 2;  2XH6 A;  1C5H A;  3WVJ A;  2W52 A;  3POE A;  1FMD 1;  1N1Y A;  4LHL A;  4DMI A;  4YM3 A;  5L9V A;  4W65 A;  1AXK A;  4ET7 A;  2DUO A;  4OQ9 A;  1H9W A;  2D43 A;  3UGG A;  4ZZ8 A;  1DCS A;  2XUM A;  3HBZ A;  2KXL A;  1EAH 1;  3H8U A;  4L97 A;  3WEZ A;  3IN9 A;  5APA A;  1HQW A;  1OOP B;  2O0O A;  2OUJ A;  1B09 A;  3HQX A;  3GCX A;  4FCA A;  1QMJ A;  4Q2F A;  4YVW C;  1ENR A;  1W9F A;  1ZZB A;  2QBX A;  1ULF A;  2R0F A;  2OYZ A;  4PBO A;  3VHR A;  4FAH A;  4YG3 A;  3VBO A;  1IKP A;  1BQP A;  4PCR A;  1EPW A;  1U0A A;  4AI1 A;  4CTE A;  3PTR B;  1HRV 1;  4QQ2 A;  3EO6 A;  4A4A A;  2RE9 A;  1X8M A;  2ZKL A;  3SKJ E;  4DO0 A;  3U4X A;  3VGI A;  3OB8 A;  5LCW L;  1O5U A;  3D82 A;  5FZO B;  1UOF A;  1OH3 A;  4FPG A;  2XJQ A;  3BOD A;  5FZ6 A;  4QPY A;  1VR3 A;  2KD7 A;  4NPL A;  2ET1 A;  2Y6F A;  4UBH A;  1W8U A;  3NKG A;  4YNI A;  3B9C A;  3CBN A;  3KVA A;  3AKR A;  2ZHN A;  2W2I A;  4ONU A;  4EWE A;  2VW2 A;  1S0B A;  1C4R A;  1H4G A;  3NNF A;  5JAX A;  2VBD A;  2B46 X;  1QQP 2;  2PAK A;  2O1Q A;  1HQN A;  3WDV A;  1X36 A;  3AP9 A;  1G7Y A;  3LIH A;  5F2W A;  4QX5 A;  4W4Z A;  1ZNP A;  2VXR A;  1ZRR A;  4KWK A;  3AYC A;  1WCQ A;  5KC5 A;  1QJU 2;  4M3C B;  5I91 A;  3AVR A;  3K46 A;  3LPF A;  4QPI C;  1RUG 1;  1AZD A;  4M4R A;  1LES A;  3WF0 A;  2F17 A;  1JHN A;  1W8W A;  3RJ2 X;  2Z2S B;  1H9P A;  1YFU A;  1QJX 2;  3ACG A;  4QHZ A;  4RGA A;  3GF6 A;  1M06 G;  1H1A A;  1IKQ A;  2N7G A;  4WM8 C;  1GZW A;  4C0B A;  2X5I B;  1QOO A;  2RM2 2;  4ZXE A;  2WLQ A;  4GB3 2;  2E7A A;  3JB4 C;  1OKQ A;  4XHX A;  5FMC A;  5I8Y A;  4GH4 A;  2WNV B;  3I3D A;  2TEP A;  2WT0 A;  5FZ8 A;  3VV1 A;  1O3S A;  1EY2 A;  3UKV A;  5CKM A;  1UL9 A;  4RQP C;  4E4S A;  3URF A;  5HV0 A;  2YV8 A;  1EP0 A;  2PLV 2;  5C5T A;  4FPE A;  2Z79 A;  3WQ1 A;  1LOE A;  4Q8L A;  3AYD A;  4JV4 A;  5FMB A;  4FOW A;  4IDZ A;  2JDM A;  1R08 2;  4E2Q A;  5BNN B;  1MQT A;  3RZJ A;  4Q1R A;  1NCQ B;  2Q1F A;  4XF3 A;  4YFW A;  2WO3 A;  3FX3 A;  5K8S A;  4YG0 A;  5FYZ A;  3TYJ A;  1Z78 A;  2DTY A;  3SNM A;  2VG9 A;  4FP3 A;  2ZMK A;  4FPL A;  3G6J B;  4XYX A;  2WAA A;  1NLS A;  2YGM A;  4BME A;  4BYY A;  3ZVX A;  4MXV A;  4DXT A;  4HMZ A;  1H2K A;  1V6O A;  4LEJ A;  4RA0 A;  4NOT A;  3WW1 A;  3S7I A;  3J7H A;  2EAA A;  1QWR A;  5FXZ A;  3HPN A;  5J37 A;  3H50 A;  3MHZ A;  1UQX A;  3ZIX A;  5FOJ B;  5D2A A;  5ACA 3;  1FMD 2;  3A7Q A;  2PA7 A;  5JUV A;  5FJK A;  1NYW A;  1S4C A;  5LEJ A;  3BTA A;  5JZG C;  3ZKY A;  4HG6 B;  1W90 A;  2ZGS A;  1XB9 A;  1A8M A;  4JRA A;  1FV2 A;  1WW6 A;  3RVH A;  3VBU B;  4CP0 A;  4DXS A;  4KGG A;  5J7M A;  3L2Y A;  1E5R A;  4Y20 B;  4Z92 B;  5C4W C;  5G04 L;  2UYA A;  2JG9 C;  1W6M B;  4YFZ A;  1BBT 1;  3FHQ A;  3K48 A;  3OPW A;  3ZR6 A;  4TWT A;  2VL4 A;  5FP7 A;  3AKQ A;  3E6B A;  1HRV 2;  2R07 3;  4N53 A;  1IZ3 A;  4XQW A;  5DAX A;  3SMH A;  3EXU A;  5E89 A;  1SMV A;  1NQJ A;  2EIE A;  1QJZ A;  5FO7 B;  2AYH A;  4JGZ C;  1RHI 1;  5DQ0 A;  3E97 A;  1UY3 A;  1LTE A;  2A6Z A;  3T1L A;  1D0H A;  3M3Q A;  2VE1 A;  3NJY A;  3OF1 A;  5H9P A;  4RR3 B;  1S0C A;  4Y26 A;  4QGM A;  4RS5 B;  2NMN A;  2WA3 A;  3DYP A;  1COV 1;  1WWY A;  1NY7 1;  3QH6 A;  3A23 A;  5DUX A;  1UIK A;  5EQU A;  5A1L A;  3ORJ A;  1N47 A;  1JW6 A;  1PO2 1;  2PHL A;  2WNU A;  3GCW A;  3PJY A;  3VZO A;  3SIS A;  3ZPO A;  5EYY A;  4YZ1 A;  5FK7 A;  2XG3 A;  5SV5 A;  4EN9 B;  5BV6 A;  2JWP A;  1J58 A;  3JQW A;  2BOJ A;  5T52 A;  3AMH A;  4V2W A;  1OA2 A;  1GQP A;  3JD7 1;  2FHR A;  5GM0 A;  1W99 A;  2PHX A;  5CFC A;  2XLG A;  3ZSK A;  2HLE A;  2J1T A;  1W6N A;  1ULE A;  1K42 A;  1D2Q A;  2GC0 A;  4AF9 A;  2VOW A;  3BU7 A;  2EF6 A;  4AK3 A;  2ZEY A;  3MDP A;  2Q8O A;  1AL2 3;  1RUG 2;  2JD9 A;  4Q4W 1;  4WVW A;  3S5Q A;  3LDK A;  1AR7 1;  2XJP A;  3N3H A;  4NRQ A;  1RIN A;  1VAK A;  3N7L A;  4WBB A;  4X6Q B;  5FKC A;  1CIW A;  5FZ1 A;  4OHZ A;  1PGS A;  2QE3 A;  2OT7 A;  3UES A;  1FXZ A;  2PHD A;  4KWJ A;  4R4Z A;  5E88 A;  4BQ5 A;  4Z1V A;  2QTW B;  2ZMN A;  5F5C A;  3FFZ A;  4UI9 L;  1AX2 A;  1GP6 A;  1V9U 3;  5KWR A;  2ORX A;  4QKF A;  3LFI A;  3LWC A;  2DUP A;  3SH3 A;  3V0A B;  3TEW A;  5ABJ B;  3HN3 A;  4Y33 A;  1RUI 1;  5DUV A;  1VBC 1;  4QDS A;  4XQD A;  4CDQ C;  4DUV A;  2W0X A;  1KGY A;  2JDK A;  2Q1Z B;  2R7E B;  4XCB A;  5C9A A;  2XUE A;  2G19 A;  3A0K A;  3LGR A;  1FNY A;  1PO1 1;  4XFH A;  1N1V A;  4ZS2 A;  5FCC A;  1OLR A;  3HJR A;  2EXH A;  3BOW A;  3NVC A;  1W2A X;  2JEM A;  3NJX A;  2A71 A;  1NCR B;  2JD4 A;  4D3W A;  4MGT A;  1VMJ A;  2H0V A;  4LK6 A;  2GNB A;  5DAB A;  5KHH A;  4CP9 B; 
#chains in the Genus database with same CATH homology
 2VUD A;  1OUX A;  1OUS A;  1W8H A;  2BOJ A;  2JDP A;  4AOC A;  2BV4 A;  2WRA A;  5A70 A;  1OXC A;  5A6Q A;  2JDK A;  2JDU A;  1W8F A;  1GZT A;  5A3O A;  2BOI A;  2JDY A;  5A6X A;  1OVP A;  1OUR A;  2CHH A;  2JDH A;  2JDN A;  1UQX A;  3ZDV A;  1UZV A;  2VNV A;  2XR4 A;  5A6Y A;  3DCQ A;  5HCH A;  5D2A A;  1OVS A;  2VUC A;  4CE8 A;  2WR9 A;  2JDM A;  4UT5 A;  5A6Z A;  2BP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...