5A3OA

Crystal structure of the lecb lectin from pseudomonas aeruginosa in complex with methyl 6-(cinnamido)-6-deoxy-alpha-d-mannopyranoside at 1.6 ansgtrom
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a3oA00
1GZTA 2JDHA 1UQXA 5A6XA 2JDNA 2BOJA 5A70A 2CHHA 2VUDA 2WRAA 1OVSA 1UZVA 5D2AA 4CE8A 2BP6A 1OURA 2BV4A 2VNVA 3ZDVA 1W8FA 1OXCA 5A3OA 2JDUA 5A6ZA 1OUSA 2WR9A 1W8HA 2BOIA 2VUCA 5A6YA 1OVPA 2JDYA 2JDKA 2XR4A 2JDPA 3DCQA 4AOCA 5A6QA 2JDMA 4UT5A 1OUXA 5HCHA
chains in the Genus database with same CATH superfamily
1QJEA 2DBNA 5IK5A 3FMGA 3BI3A 4A2UA 5BYNA 5JSPA 1JBCA 1SCSA 1VB2A 3N7MA 3A0NA 1V6MA 3K51A 2CHHA 4QM8A 4Z8BA 1W9TA 3ZPOA 1S0GA 5CG8A 5DZEA 4Q4Y1 4UF0A 4CU6A 5FZBA 4AL9A 3PTRB 1RUNA 1WBLA 4L97A 4M0NA 3ZXGA 4I01A 1K5JA 3C7HA 4FPOB 4GB33 4Q26A 1RUF3 1UNBA 1W39A 3K4AA 1DGWA 4Z07A 1QJX3 3GF6A 1AR71 4YZ5A 1GANA 1Y4WA 5GJ6A 1CAVA 1CJDA 4BISA 4LK6A 1FMD2 5L36A 1VPHA 2MHFA 2DBIA 4LBKA 4SBVA 1MVQA 1PMJX 5JZGA 1C1FA 4FSJA 3OUHA 1AHSA 1GSLA 3MO4A 4MO3M 3VL9A 3L2HA 1WLTA 3DECA 3VV1A 2IC1A 1QIQA 4UWDA 1K5MA 5FZLA 3OEBA 4AAPA 1H9WA 1RUH1 3WY6A 4LBLA 4W6XA 4Y4YA 1D2QA 2VCAA 1ST8A 2R073 3TN93 3KCYA 5DAPA 1RUC2 4N7UA 3WNPA 2E32A 4CP2A 2R041 5KHJA 2W47A 5BXXA 4JZRA 1YJLA 1WZXA 1FOD3 1VJ2A 2D3RA 2KXLA 2XQRA 4A41A 5FYIA 2J1VA 3FC0A 1ND3B 4NO4A 1ULCA 4GWNA 3LSEA 1MQTA 4FBFA 2WT2A 4F3JA 4ASMB 3RGBA 4XJWA 5DUVA 5EPAA 4QHOA 1ND2C 1W9WA 4IEPA 1FI2A 5LATA 3WDTA 2ZMLA 2WNVC 4FPYA 4RQPB 4BHPA 3B7MA 3LSDA 1LJ7A 2FDGA 3X29B 4JAAA 5F3EA 4MG2A 1H8TA 1TQ5A 5FZIA 1TVGA 3V65A 5FR3A 1KQRA 2IXHA 3H8XA 3T3YA 3DPRC 5IAXA 1PVC1 2WO1A 3VBOB 4AVCA 1X33A 4YVSA 4XFAA 4CCCA 4CU8A 3VKMA 4BQ2A 4JGZC 5FWEA 2E33A 1W28A 3LKJA 5IFPA 3VD9A 1OQEA 2V5YA 5IW0A 1K5MC 2HWB3 4KU7A 2JE7A 4PJYA 1DZQA 2JIGA 4FP3A 2P6CA 1U5ZA 4BPZA 1RC6A 3SNMA 1CJPA 1O5LA 1BEV1 1SLLA 1UKRA 1TMF2 1Z78A 2WABA 3ZFGB 3ZYFA 3KLSA 4BIFA 4A4AA 1JOPA 2E26A 1H8TB 1LGNA 3C7FA 1W0PA 2XXZA 5BNQA 3ST7A 2ZMNA 3J8F1 3ZXAC 2V4AA 1CZSA 1NOVA 1W8FA 3ORJA 4RSUA 4QGLA 2TNFA 4ZU5A 3KHBA 1H6XA 4UBHA 1CONA 3OG2A 1ND3C 2ZEWA 4QWNA 1FOD2 2ZEXA 3BGAA 4M00A 3AZYA 4JKMA 5LRSA 1YQ5A 1ZNPA 3VBRA 2ZGNA 3WF2A 1RUH2 4L99A 1EAH3 1WUVA 1PX3A 2X8KA 2ZOEB 4A7YA 1QU0A 4XF0A 1YI9A 2LW8A 1RB8G 2VNOA 2PA7A 2HBUA 1EV13 4PQQA 1UW8A 4U36A 1D0GA 3T2QA 3RZJA 5FV3A 1DGRN 4CCKA 4CU7A 5HV4A 1X50A 4K7JA 2DFBA 4PI0A 4Y1VA 4JTOA 1TNFA 5FLIA 5T5LA 5GZFA 4JVAA 4XFCA 1FMD3 1G7YA 3AZZA 5FPVA 4H7LA 4ARXA 2VUCA 2P17A 1S0IA 4AI1A 4ONUA 4Q0VA 5KR7A 1UD1A 3T4HB 1LOEA 4Q4Y2 1W9SA 1V00A 2HYXA 2DWRA 1SLAA 2ZZJA 5AC91 3PTYA 2VQ0A 4QX2A 4KU8A 2PHTA 5KHGA 1HRI2 2AH2A 3K46A 4QHZA 1YIFA 2WS91 2XUMA 3AC0A 4FPGA 4LEJA 4BLIA 1VBE3 1CAUA 2JKXA 2VE1A 4DMIA 1WD4A 2DTWA 1PO13 1S4CA 5LA1A 2ZAAA 3FL7A 4YW3A 2JG8A 2XB6C 4MGYE 1CAUB 3S0MA 1PHMA 4FQZA 2VZSA 4MXVA 5IUQA 2XWBB 4Q4W3 4GIQA 3K3NA 3O0XA 1U5YA 4HFSA 3O12A 4ZS2A 3C2UA 2WN2A 3AYEA 1RUE1 2O0OA 3S5QA 1WA4A 1YNAA 3WW2A 3AMHA 5BNNC 5E6HA 2X5IA 4KH9A 5FY1A 3WDYA 3BTAA 4QGMA 2WNUA 3I54A 2ZX3A 3WNXA 2WT0A 3ACHA 3WNKA 1CVNA 1D2SA 1LULA 1W6MB 3ZMNA 4G4FA 3ZXDA 2JEMA 2E6VA 2EAKA 1JI6A 2BEOA 2K9ZA 2JG8B 1HRV2 1AX2A 1COV3 3WHTA 4LUMA 3O1UA 5G04L 2EA7A 2ZACA 1XNTA 2Y6FA 5BNNB 4FO9A 1XNKA 2OPWA 1MS5A 4LA2A 2MNGA 1JOJA 2Y0OA 3MLKA 2JDMA 2XJQA 4BB3A 2NP0A 2DVDA 2DFCA 1R1A2 3SITA 4RL7A 4JGYA 3D5OA 4YGEA 5J37A 1W6QB 2D6OX 3ZFEA 1PIV2 4KI5M 4UBGA 2HWC3 3AJYA 5I0RA 1NXMA 1QH7A 1PVC2 4JC1A 4QX5A 4XFHA 4AFBA 3WX5A 1YFWA 4Z1VA 2P1BA 4XYXA 1O8SA 2JB4A 4XAAA 5I8SA 4CCDA 3NWKA 4XHBA 1AXYA 2WZEA 1AR62 4BCUA 1CGPA 4IETA 3DYMA 4V1PA 4CP1A 4XW3A 3CBNA 3EHKA 2ET1A 3VDCA 3RYPA 3VBUB 1DGWX 2DCYA 4HK8A 2XLAA 3OPWA 5EXOA 2Z4FA 3RZZA 1JUHA 2WNUC 3MUY1 1UY2A 5DQ0A 3AKTA 2K46A 2W0XA 5FZOA 2RS12 2JIJA 1BYHA 4UYBA 5FZ1A 5A1LA 3B00A 1ZZ7A 3ZMOA 1W6OB 2A6XA 1CX4A 4K8RB 3KMHA 4AI3A 3LD8A 4XUNA 3ZYRA 3ACIA 3C7EA 2VNVA 1LODA 3WG2A 4NVPA 2CAVA 2VMFA 2YROA 2B9UA 4HPKB 5D8AA 3ON7A 3IBMA 4NE9A 2XJUA 1F5JA 1PMHX 5LCWL 2Q1ZB 4HPKA 4B4RA 1S2KA 2HH9A 2JDAA 3ROUA 3USSA 4P5YA 5C9AA 5T50A 5EIYB 2TUNA 5FO8B 1JZ7A 3H8OA 1SACA 3I59A 3RPQA 1HXS1 3P1IA 4E4SA 1UOBA 1ZBA3 2GSYA 4Q27A 1JYTA 4AAXA 3KVAA 3AZXA 5ABJA 2C6SA 3J9SA 4NN0A 2AC1A 4M0HA 1HQLA 3SKVA 1MS1A 3PNAA 3KCXA 4D6RA 4XVHA 1QJX1 1NY71 2LUWA 4O9GA 5B4NA 4JDMA 3SKJE 4V2WA 5B4XA 4F8AA 2J7MA 1QJU2 4NPRA 4M4PA 4XUPA 4YM2A 3C8XA 4HT1T 2GZWA 4OYUA 3LA3A 1B35C 4HXCA 1TEIA 3JUUA 2R062 4HVOA 4LUKA 5FY9A 3THPA 3URFA 1NA1B 1O6UA 4KWUA 1CPNA 5A3MA 4AFMA 1LOGA 2B39A 3WQBA 4LO6B 1C8M1 1M4WA 3FUQA 4Q0QA 5FY8A 1OLRA 4OUSA 1WLCA 4PDWB 4QQPA 2TEPA 1CIWA 2QQWA 3M3IA 4NMIA 3U14A 2ORXA 1K12A 4CDXA 4HN0A 2CTVA 3D8CA 2BU9A 2B8MA 2RS53 1OH4A 3GM8A 2Y33A 4YG3A 2FDJA 1GP5A 5FYHA 1PO22 3BKZA 2RDNA 3JBG1 3NV4A 2YGLA 1LR5A 1RIRA 2JDPA 4NR1A 1PIV3 5FRAA 1ZBE2 3BYWA 4OI0A 5EP9A 2QQPA 3ETPA 3OY8B 1IZ3A 2YPJA 1OKOA 5FYVA 4L8QA 5J98B 2W94A 2B9VA 1LOCA 2LROA 5BPXA 5CBLA 3V0AA 1HN1A 3VDAA 4B4QA 4OCTA 1JTZX 2RS31 2WQ8A 1X9PA 1BKZA 1S0BA 2YMZA 4M3CE 4XBNA 5EJZB 4AFDA 1R083 3AVRA 5JPMB 1DYPA 1ULDA 1NZIA 4CUGA 5ERLA 2MEV2 3N9LA 2GH2A 4LJHA 1UF2C 2VQTA 3PMEA 2D6NA 2QKDA 5ANNA 5EV7A 1SFYA 3EBRA 4NRMA 2VGDA 5FDBA 1C8M2 3SH4A 2HLEA 2BBAA 3NV2A 2KR2A 4QM9A 2HJIA 1NY72 1ENSA 3RZLA 5ACA2 1NCRA 2JENA 2GNDA 3RZMA 3VN4A 1NUKA 2ZX0A 4CEYB 3GHNA 2GC0A 3POWA 1R091 4I02A 3ZYPA 4Q8KA 1EY2A 3WW3A 3BODA 2WLQA 2JD4A 4OI4A 5A7SA 4K3UA 2B7YA 4IGPA 4CEYA 4Y4RA 5FXWA 4AQTA 5IVVA 2PHLA 1OVSA 2ARBA 2OQ6A 2RJ2A 3TEWA 4FTSA 1HN0A 1S2EA 2RE9A 2YBSA 4CDQB 1DGRA 5LZ6A 4I09A 3ZSJA 1QDCA 4AEJA 3J8F2 5FZ7A 3R4DB 2JD9A 3ZFGC 3RS6A 1PO11 1XBFA 4YZ4A 3IDCB 1APNA 4COWA 1H8VA 1V70A 3PURA 4EN6B 4QXCA 4LO5B 2IXLA 4NHLA 1HX6A 1W8OA 4HVQA 4E4ZA 4N43B 1W2OA 2PHDA 3W9AA 5CEHA 4GALA 3GZAA 2ZXQA 4CDQC 5JXJA 3GZTB 4LHLA 5I0TA 5HCFA 4B29A 1XYNA 2L9LA 2CYFA 5LEKA 4LBOA 1M06G 5FP9A 3S7IA 2Z69A 5JXHA 2E7AA 1RUOA 2XHNA 4CEWB 3OGJA 2EIEA 1FYUA 5A3NA 1XNBA 4BQ4A 2X05A 1IKQA 2Q0AA 5F8PA 5DXDA 2VULA 1BZWA 5DABA 4IDZA 2KD7A 2ZZQA 4GXLA 3FLTA 1HQNA 3HBKA 1VAVA 3RJ2X 4CUCA 3GJBA 4P5HA 4XMIA 5H9SA 5FZAA 3I3QA 5FAXA 3VZMA 4AVVA 2XJPA 3OPTA 2FMYA 4MGQA 2FDHA 4KGGA 1JOBA 1AR61 2QQKA 4Z2AA 1XSQA 2XLGA 1GWKA 3WLUA 4I30A 1BQPA 1US2A 4YVWB 2DTYA 4XDPA 1REEA 3PDQA 3ZYIB 1JHNA 3A21A 4OLLA 2VTXJ 4PDWC 1FPN3 1AUYA 1LEDA 4W50A 1OBNA 1H4GA 2VMIA 4QQOA 3TRSB 3WUDA 5EJ3A 5IWFA 3ZXKA 2ATFA 2R071 4AQ6A 2A70A 3GDBA 4XJ8A 1RUH3 2N7GA 4JRAA 1D4VB 5ANQA 5D8AC 5K8SA 4I2OA 3ZR6A 1SBDA 2JXAA 4FOQA 1RUG2 1Y3TA 1JH5A 1POV1 2VECA 1W2AX 3THDA 1RMU3 4LORA 2ADDA 4AR2A 1NAEA 3CKHA 3FFQA 1PZ9A 4G3YC 2PHWA 4CCMA 1PO21 4TYSA 4YG6A 1NCQB 3T0BA 4LR4A 5HCBA 1K45A 5JZGC 3GXUA 4AHZA 4BQ3A 2JWPA 2XBO3 3H0OA 1WW5A 2AYHA 4Y20A 3WVJA 2AGSA 4Q4X1 2QDNA 1ZX5A 1MR5A 1GQHA 2OQ7A 1FXZA 1U5XA 4OZXA 4EN0A 3M8LA 1W06A 5L7OB 1XE0A 1BBT1 2D3SA 1HXS3 1QHDA 5FMDA 3ZX7A 5LBEA 3BU7A 4RYDA 1WW7A 1CZTA 5FWJA 4Y22A 1GOHA 3OBTA 4CPBD 4YSFA 2GMEA 3VBUC 1UZ0A 2QQVA 2JB8A 3FLRA 5FUNA 5JLVA 1QOTA 4DY3A 3RQ0A 2RR12 4P08A 2LTNA 4XZPA 1OFSA 4URTA 2FMDA 1UL9A 5K4LA 5ACA3 1I5PA 3M3OA 3CJIA 2YU1A 2DU0A 1FNYA 2P3IA 1VBC2 2CGOA 4XMAA 4Y5Z0 2VR4A 3T2OA 5BNOC 1KS5A 4H3WA 3M70A 2BV4A 1GUIA 4XUQA 4XJAA 5DUWA 1OXCA 3I4IA 2C5DA 2OW4A 3AJZA 4Y1ZA 1SLBA 1YUDA 5IK8A 1A8MA 2G9GA 4OVEA 5G05L 3KV9A 5LW9A 1GFF2 4YYOA 4DQAA 4LE4A 2CGPA 1G9CA 3THTA 2RS32 1GNHA 3P3PA 4QPGA 1J3PA 1GMMA 1Q8QA 1W9YA 3LEMA 2CDPA 4QKDA 3RYKA 4ASLA 1JYCA 4QPGB 1UWWA 3KGZA 3PVOA 1ZM1A 2BNOA 3VGIA 3I2GA 3JXSA 5IATA 1RUD2 5B2GB 5K0UC 3OPZA 1IG0A 3NNGA 3K2OA 1LECA 4EZHA 1PO23 4ISRA 4ZZ8A 1OOPB 1C8NA 4XJ9A 3EJKA 4JKKA 5FYMA 1PVXA 3I2DA 4EN7B 4R9DA 1XSRA 1OPOA 3PLQA 5FZ0A 2QTWB 4GKYA 4RR3A 4Z82A 5J36A 1E5SA 3J26N 3LCPA 4OQ8A 5A80A 3ZFFA 4DXSA 3IB3A 3PL0A 2UYBA 1PK6A 4BQXA 2HWC2 3VD3A 3MUZ1 1FV3A 4Y5SA 3LAGA 1FPN1 2GP5A 3FHQA 3POYA 2WNOA 4CP9B 5BNOB 3HVDA 3O0WA 3ZN6B 1C1LA 4RS5B 5F3CA 5T3NA 4ZXEA 5LA0A 3OD0A 1AYM3 3CLPA 3WV6A 2QNKA 1RINA 1YQ6A 2RMU2 1AYN2 1RVF3 1ENXA 2AENA 3EB7A 4H2AA 5CB7A 2W2IA 5CADA 3MIGA 4TZDA 1PM7A 4FFIA 3VDDC 4LT5A 2VXJA 5AC93 3TAYA 3KM5A 1HIXA 4UW3A 4LITA 4F7ZA 4BE3A 4NHKA 5BNPA 2A3YA 1OC1A 2G9FA 2K2SA 2ZAHA 2ZGLA 3I8TA 4J6GA 3DYPA 4YVSC 2WZR3 2ZGRA 3USUB 3HPNA 3V64A 2RDQA 1URXA 3WG3A 1XU2A 3VDDB 5F6KA 5J09A 3H1YA 4AW7A 3LZZA 3O1PA 3KT7A 3Q8FA 3O1TA 4IV1A 1Q3EA 2F4LA 3ZSKA 5C3RA 5IVJA 4XIOA 3WD5A 3AKRA 1MPXA 3ZKYA 1NG0A 1BLZA 3H3UA 4ZU7A 2VH9A 2ET7A 5LBFA 4EV0A 2Y60A 3BVCA 2UWAA 1H1AA 2Z2SB 1GP4A 3ZDVA 4XFIA 1RL3A 4NIGA 4CXWA 4CDWC 1Q8SA 4B7KA 4N43A 5A6ZA 5J7MA 4TTGA 2A75A 3EQEA 5CKQA 2ZPXA 2UYAA 3UKNA 4HKOA 5FYSA 4OI1A 2GU9A 3AB0A 3ABZA 4YW7A 4CDUC 1MZEA 4META 3USUA 1W6PA 3BPZA 3FFZA 5FZHA 4HETA 1W2UA 2VOTA 3ECQA 4XTMA 2DVGA 2IFWA 3VZNA 1R64A 1QJFA 4LBJA 4SLIA 2VW1A 1J3QA 4I0WB 1DQ2A 1KEXA 4XABA 1YXWA 5LK7B 4J25A 1I6XA 2D98A 2HWD1 3LEGA 1H0BA 3ILFA 4COYA 1YIPA 2BP6A 2R0FA 2Y64A 4AEDA 5CAZA 3FN9A 4QX8A 3OUIA 3UESA 4YZ3A 4NHYA 1LHNA 3UK9A 3E5UA 1R093 2DDUA 3WF0A 1S0EA 2JICA 3WQ1A 2Q5TA 3GNEA 1ENRA 4QQ2A 4XUTA 1F9KA 5IYYA 2WKKA 4B7EA 1Z7S2 3AP7A 1S0FA 4XTPA 4LBMA 4WM7A 2UU8A 3VBFB 3O1RA 1Y9MA 1TG7A 5DG2A 2ZTNA 1KITA 1SMVA 1AJOA 3OSDA 2QQUA 4ET7A 2QFEA 3S5AA 1JYWA 3E6DA 3R05A 5FZDA 4WM7C 3VBOA 4CXXA 1SLIA 2KA3A 2VD7A 5LA9A 4PLMA 5FZ9A 1ZRCA 1JHJA 4RQPC 5C5UA 1MS8A 2QDRA 4AVBA 1IPSA 3I2HA 5C7GA 1NQJA 5KXCA 1HRV1 1QJY3 1RXGA 2DCTA 2WWUA 4P9IA 1LB2A 3VZOA 2R6QA 1OT5A 1PNGA 2C0ZA 2KM2A 3BCWA 1W04A 3MV11 4LPLA 4BMBA 4QPIA 1PGL1 1ODMA 3MEPA 3Q8EA 5FLHA 4Y33A 1BK1A 3DV8A 3LF7A 4C1WA 4EWAA 5F37A 5HXMA 3PIGA 3S57A 1N3OA 1D4M1 2CSGA 5AFBA 1ULPA 4A42A 2PAKA 4Y1YA 5I0SA 4LIUA 1PGW2 1OSGA 1XE8A 1V6NA 2IUWA 4L11A 1Q5OA 2W1WA 4Y26A 2HWE2 2RM22 2ZX2A 1HB1A 4HZFA 4JRLA 5GKAC 3VD4A 3KWVA 3DKWA 1T6GC 4GWIA 1BEV3 3E5XA 2EF6A 2E7TA 3IN9A 5FO7B 5K0UB 4IEVA 1C5HA 1ULEA 4MXWA 2Y8KA 4ISQA 4N43C 2WAAA 3NAPB 4X8PA 1W8HA 2RM21 2B42B 2GNBA 1AVBA 2RR13 1XYOA 4Q4V2 5EZWA 2Q8EA 4EWEA 5FPUA 1KDKA 4XF9A 5FYZA 5LEJA 2WUHA 1S55A 1RUF1 2Z42A 2W08A 5C6CA 4Q4W1 3VBOC 1CN1A 3PVNA 5GLZA 4OHYA 4XURA 4E8DA 2YV8A 1YQCA 3ELNA 1HB4A 1KS4A 3H50A 3HJRA 1OD5A 1F15A 3NKTA 5IJRA 3ILRA 1GWLA 4FQ4A 4PI2A 5F5IA 4FTBA 4J1XA 4WBBA 2XVGA 4O61A 3ZR5A 3ZLIA 3WDWA 5K9YA 5K0UA 3QLQA 4IEWA 4RGKA 2HBTA 2V5DA 3A22A 4N90A 3APBA 5FZ3A 1ZRFA 1CAWB 2ZHNA 4LA3A 2DVAA 2I07B 4RGGA 4E9KA 2Q4SA 1PZ8A 1QWRA 1YRZA 1C28A 1W8TA 2QQJA 3DYOA 4R9CA 5C3QA 1YFXA 2XONA 4HMZA 2YFZA 3EXUA 3PU3A 4MHRA 4RA0A 5KC6A 1RUG1 3HD8B 3L9JT 3O1VA 5EJ1B 3DXTA 4DXTA 4XHXA 1GZ9A 1E5IA 1IOAA 1VBE2 1WMFA 1ACCA 4FAHA 4YZ1A 1UZZA 1Z7S1 2ZBJA 5EQUA 5FK8A 2PHRA 4K1YA 4DPNA 1JODA 1GLHA 3IDBB 3L2YA 2GAUA 2Y6GA 3UT0A 3POJA 3OBRA 2WA4A 2VZVA 3W5NA 1XYPA 3GCWA 1DIWA 4WVZA 3HT2A 5FZ6A 4U2AA 5FXVA 1BBT2 5H9PA 3TOJA 3NL1A 2D97A 3DPRA 4KMQA 5A7NA 4NIAA 4DZGA 2YUEA 2NZ9A 4HBNA 4QAWA 2ZGTA 5APAA 4XEZA 2SLIA 2VBDA 4AHYA 1ASJ3 2DF7A 3HAGA 4UW4A 5JCTA 1Y43B 4CA9A 1MS9A 3PHMA 3KB5A 3MGUA 2ZABA 3HIFA 1AYN3 1ENQA 1RVF2 2EAAA 4MGIE 5A3PA 1T6BX 4DFSA 1JN2P 2LM3A 4HG6B 4UF0B 4V2VA 5FZ8A 1V6OA 5JOXA 2Y6JA 4ZS3A 1WCDJ 2ZJCA 3TEZA 2YPDA 2QBXA 2Q30A 1IKPA 3AL5A 3B9IA 3W59A 4E4DX 3KHCA 5L73A 2WNUB 5A3LA 4BDVB 4MADA 2FCUA 1S0JA 1DHKB 2BJSA 2BOIA 1O59A 1VRH3 5FUPA 1UXZA 2XR4A 2WSVA 4D94A 2EXIA 1LAJA 4XFGA 2XOMA 1NXD1 3AP4A 1OUXA 1TME1 1SLCA 5LBCA 2Q8OA 3WNLA 5ACA1 4FOWA 4G9SB 1BXHA 1B35A 2XG3A 3VD5A 1I3HA 1QJY2 2YXSA 2PLV3 2A7AA 1I5ZA 2IVIB 4QGNA 4BIOA 5FJKA 1ALYA 2WZR1 3GGLA 4ATEA 1SHWB 5IHRA 1OQDA 4JGYB 2NMNA 3IZOA 3R0RA 1ZZ9A 4YW4A 2PLV1 4S2HA 1J59A 3N9MA 3SH3A 1V9U1 2BDRA 5DG1A 4BH9A 5C9AC 3OF1A 2BGCA 2J1EA 2P3JA 3BB6A 2VM9A 3AXDA 3RI9A 1IQAA 2LALA 4BLJA 2FDFA 1UY4A 2HWF2 2PHXA 3MBWA 2VPVA 5K7PA 1N1VA 1IPJA 2PMWB 1XRUA 4QMAA 1AYM1 3ZFGA 4EN8B 1H6YA 1VBB1 4DEVA 1PX4A 2ZX1A 5FBJA 4FPLA 4GMP1 3RG0A 1NQDA 1RUD1 2RS52 2R043 3DXUA 4QQLA 3AK0A 3WR0A 1AR72 1J3RA 3TN91 2ZA9A 1W90A 4R9BA 3VKNA 1RYYA 1H2LA 2GALA 2VZOA 4XAEA 3UGFA 1W0OA 3VDBA 4RR3C 1VAKA 1J83A 1DG6A 5DMYA 3TYJA 5J96B 1O5UA 1S1AA 4PT6A 4Q4X3 3VBRB 1QXPA 3GBWA 2XBO1 1AR63 2SBAA 4ZXKA 1YEWA 4MXWB 1VBA1 1ZBE1 4XJZA 4UFJA 2IFRA 1RUJ3 2G19A 1LENA 3ENRA 2VBBA 1VBA2 1CPMA 5FBZA 3BUCA 1AR92 1OLMA 2EIBA 2VMHA 4LBQD 4UFHA 3ZIXA 3VL8A 2OUJA 1UYZA 2HEWF 2LRPA 2O1QA 1NT0A 4H7MA 4XOGA 5FZOB 3NNJA 4OHXA 3C7GA 3J7NA 2VC9A 3BU0A 3AFKA 1GNZA 2J42A 3BIEA 5FZKA 3PJYA 3H3LA 4MZUA 4ZY9A 5L9RA 4BWOA 1LOFA 2NN8A 2ILMA 1ODNA 1GZTA 1VE0A 3D3AA 1N1TA 3IMNA 4JQTA 2B5HA 3K48A 3RFRA 2RMU1 1G9BA 4I3GA 1UPIA 1VBD3 3J8F3 1G8WA 2JG8C 2IVJA 4FOVA 2VBPA 3ES4A 3MYXA 5FPBA 5KHHA 3WP3A 2ZGQA 4XE9A 3LFMA 5T54A 4DY5A 4CTEA 4K40A 2XBO2 4DB5A 1UOFA 5JOYA 3MW4A 2HWF1 4X8NA 4UFMA 4IE4A 1OH3A 1DQ6A 3HN3A 2ZKLA 4IE7A 2W9XA 1P8JA 2P6HA 3VBRC 5FYBA 5JAXA 4LOTA 1RXFA 2RJKA 5GZGA 2ARCA 3WW1A 3CIHA 1J1LA 2ZGSA 1ZRRA 1XC6A 5IVEA 1GKBA 4DUWA 1MACA 2YY1A 1V9U3 1DQ1A 3DPRB 1UY0A 4C0BA 4Q4V3 1FT9A 1C4RA 5FZGA 3VB9A 2PFWA 2FQPA 4N9IA 4JV4A 4P9YA 1SEFA 2ZGKA 3NO8A 3CU7A 4JX0A 5AVAA 4P9LA 1DF0A 4OQ9A 5FY0A 1X9TA 1H30A 1RTVA 2A3WA 3KF5A 4LK7A 2A6WA 2QCSB 2WQ4A 3ETQA 2QVSB 2JDKA 3J4UH 4PDWA 3W20A 3HN1A 5F39A 2ID4A 2DVBA 1R081 4XXAA 5F9TA 3RZKA 1W6QA 1E5RA 3OGVA 2RS33 3JZVA 2Y34A 3NJYA 1UOJA 3Q8BA 2XMLA 3AYAA 4QU1A 2GMMA 4LBNA 4E27A 2BPA2 3EYPA 4ARYA 1UAIA 1SPPB 3NJXA 4BQ5A 2VXRA 3WNNA 3GYDA 1HJFA 1DLCA 1F5FA 1JW6A 1ZZ6A 5JIAA 3FX3A 4AYUA 4QKFA 5ABJC 1E5HA 2R0HA 3OY8A 4N53B 5C4WA 3SMHA 1A34A 5A7WA 1DLLA 1QJX2 3IM0A 4GA9A 4NPLA 3T1LA 4X6RB 3VBUA 1N1SA 1IHMA 2BBVA 3VBFC 1UCXA 1XB9A 2JDYA 4CCLA 4BK4A 3V0AB 2JG9A 3RYRA 5A7WB 4IEXA 3VLBB 3PIJA 4BMEA 3WHUA 1LCLA 4R9AA 5HV0A 4AEKA 5I8TA 3NNFA 2Q8CA 2CY6A 3UETA 1K42A 5KBFA 3NNMA 5FKCA 3T1MA 4Q5OA 4LHNA 4DUVA 2ENRA 3HOBA 1ULOA 1UY3A 3QD6A 3POIA 1QJZA 4L92A 4RHV1 4CSWA 2YC0A 3WQ0A 4E2SA 4EWDA 1MZ6A 5CNAA 1HDKA 5FXXA 5CVRA 5A7OA 4IXLA 5FK7A 1QXRA 1VALA 1X8EA 2P5BA 1GZWB 1WCQA 2VAUA 2A6YA 2W91A 3HBZA 2WT1A 4IV3B 5FY4A 5BV6A 4OHZA 2YC2A 3UNPA 2VO5A 2W3JA 5SV8A 2CGNA 4MGTA 1CX1A 3FUOA 3WP5A 1RITA 3HQUA 1HV1A 1UU5A 1DQ0A 3DKQA 3KD4A 5F2WA 4K8FA 4DIQA 1RUC1 2PQQA 4FVVA 3POBA 2W39A 1CESA 1WKYA 1OF4A 1A78A 1S2BA 3JD71 5C8CB 4YVWC 1ULGA 1EP0A 4OULA 2XKPA 4B8EA 4IUGA 1UZVA 1ONAA 1GOFA 2EICA 1LRHA 4NOTA 4P9WA 4Q1RA 4LBQA 4A6OA 1GZWA 4DXZA 4YM3A 2JJ6A 4Q4V1 2WZ8A 3QOPA 2I45A 2I74A 3U11A 1VB4A 2XQXA 4TN7A 4AHWA 4B3NA 3JD72 1ND2B 3VHPA 2Y6HA 2A6ZA 5JPNB 4IQPA 4Y1XA 1POV3 1SG3A 2VOKA 3PJQA 5EYYA 4MVTA 4AGGA 1DP0A 2BFUL 1ND2A 1O4TA 2VMEA 4GB32 2FCVA 3E97A 2XWJB 3WINE 2D40A 4Y20B 3TB0A 5GZEA 3ZFFC 1W0NA 2VU9A 3K3OA 4CDXB 4C0HA 4YZ2A 1PK6C 4UFIA 1HW5A 4WVMA 1OOPC 1RVF1 4COUA 3JBG2 5DUUA 1FNZA 5F5QA 1GR3A 1GU3A 5CFDA 4Q0SA 4W6YA 3V0BA 4C91A 3AM2A 1OURA 2OT7A 2W92A 2OXBA 5EYXA 3UJOA 5F7UA 2J1UA 3FZ3A 4E4HA 3MIHA 5CFDC 1O3SA 3UKVA 3BTYA 4LQRA 2XUEA 3PU8A 1POV0 1HQWA 3T0AA 1REDA 2OZJA 2WIIB 3FE5A 3PUSA 4IE0A 4WVVA 1STMA 1JZ8A 3DGTA 2WS93 4RHV3 3RWKX 5FMOS 4XF1A 1UOGA 1ZRDA 5JOZA 1WBFA 2BQPA 4YVWA 5T52A 4AQSA 4M3CF 1BK0A 2WAOA 2WJSA 3KVBA 4KG0A 3EMRA 2R061 4CPBA 3MIBA 4Y22B 1LU1A 1IGOA 5FPZA 2HWB1 5CA6A 1SDDB 4BXSV 5A70A 3LB9A 4INDA 2ZMKA 5KXDA 2Q1FA 1DFQA 5BY5A 3AZVA 4YRDA 3V0BB 1NX9A 3SCGA 4R8HA 1BBT3 2WFF2 2BUKA 1ZREA 4ITCA 2FBEA 3CO2A 4IEZA 1O3QA 4XBQA 5DDJ3 4RGAA 1FAYA 1W99A 1VRH2 4QHBA 1QEXA 4K20A 4Q0UA 3P5BA 3HQXA 3U07A 3JB4C 2WO3A 4JHTA 3UV9A 1JXNA 1MZ5A 3I97A 5LY2A 3E6CC 1KRIA 1YFUA 4HK9A 5CKMA 3T0DA 1BVVA 4R4ZA 4XQDA 3TN92 4GJYA 4N9HA 3AYCA 3NV3A 1LTEA 2YBPA 2IXKA 2ZGMA 1WWYA 1F31A 1Q56A 4QU2A 4Y24A 3I2KA 2VZ1A 3JBG3 2VOWA 3KV6A 3LGRA 1JYNA 4FPJA 4FPEA 1SDWA 3PUIA 1HLCA 4RFRB 5LK5A 1RUD3 4LKFA 4NROA 3INAA 5CG9A 4BOWA 4BQ1A 1JZ2A 1VBB3 4PIZA 3R4SA 3ZYHA 1F2NA 4KBBA 3ZSLA 5IVCA 1CAXB 3K4DA 3BN6A 2YYOA 2JE8A 2UURA 2D43A 2EXJA 2R49A 3LDBA 3LQCA 3MPPG 1UIKA 2DUOA 4PLOA 1GZCA 4UT5A 5I93A 2PLV2 2YG0A 3MI8A 3NAPC 2D6PA 4YGDA 1UYYA 2JG9B 2OS2A 3RNSA 4IW3A 2Y0IA 4GH4A 2Q1MA 2PAMA 4PHZA 5CISA 5GZCA 4DXRA 1RJ7A 1R1A1 2W87A 2YBKA 4CEWA 4CDQA 1FX5A 4KBZA 1Z7S3 2H6CA 5FTTC 1A8DA 4N8MA 1H2KA 5DAVA 1US3A 3KS7A 4XIKA 5FP3A 4NIIA 3IAPA 4CRQA 5JUVA 1N1YA 4A3XA 2IXJA 1OVPA 3WG4A 2WFPA 3N9PA 2XJTA 3WNMA 5FZCA 1TMF1 1GWMA 1LHUA 2ZKNA 2D7FA 5IT6A 4XPVA 3RVHA 3T30A 3N7KA 4OMDA 2X09A 2BRTA 3T09A 3ZXEA 2YU2A 1QXJA 4HKLA 1F4HA 3GBFA 3ZN4A 2VW0A 2XJSA 1PGSA 2IWGB 2WA3A 3RRDA 3B9CA 4QDQA 2RG4A 3ZFFB 1XQNA 1W8UA 5DZFA 5D1IA 4OZOA 3TNQA 4CYDA 2VJXA 4QQHA 1DU3D 1HV0A 3OJBA 3VKOA 5C8CA 2GNTA 5BNOA 5JSOA 2UWCA 4IEQA 4XXPA 4ZKTB 4ZU4A 2JE9A 2RR11 1G6NA 2BGPA 2OX0A 3O5SA 3FBYA 3IT8A 1JYXA 3ZXJA 1UQXA 2VUAA 1R1ZA 3HR9A 3VZLA 4CEWC 2WC2A 1JYVA 2ES3A 5CYYA 2J1TA 3CEWA 2WO7A 3GJAA 1O4YA 2MPFA 5LRRA 5L7OA 4LLFA 3ZFEC 3AYDA 4EN9B 5F32A 3ZYGA 4WVWA 5DDJ1 1TNRA 1SZBA 1HB3A 4K21A 3W5MA 4R52A 1SCRA 1JMUB 2W1UA 1AZDA 2CU5A 2W1QA 4UFLA 1AXZA 4LMFA 3WT3A 1JU4A 1HRI1 3MIDA 1CAVB 1DYOA 1VBE1 2A1XA 3NNLA 3I49A 1LESA 1AX1A 3CJIC 3N7LA 1WD3A 3VKFC 3VHNA 4ES8A 2JDHA 1YWKA 3R4UA 2E51A 2BERA 3SLIA 3T2TA 4C8DA 1KDMA 2OIIA 2VZUA 3ZOIA 3I3BA 2UY9A 2WWJA 1C3HA 1QF3A 1FV2A 3ACGA 5FYYA 4D6SA 5E8AA 3UL2A 5HBAA 1ZVFA 4QPIB 1U5IA 5AFEA 3UGHA 5KXEA 1BMV2 2YZ4A 5JMOA 2QE3A 1UO9A 1S0DA 2VCMA 5IFTA 3MV01 1RUE2 5JXIA 4CDXC 2YHJA 3AZWA 4GAZA 3SC7X 1VBC1 3U0ZA 5FFOC 5A6YA 4CXYA 4ZHNA 4DEQA 2QJVA 5FMBA 4W4ZA 2WBKA 1UU6A 2C26A 1R1A3 1IG3A 4JDNA 4MLOA 4AOCA 4KG8A 4RD7A 1WMXA 2CWMA 1UMIA 4HANA 1DBNA 2AZ5A 1XOYA 3FHIB 4AEMA 5FY7A 3SQOA 1H1MA 1YC61 1RUI1 2V4VA 2YDEA 4QX0A 1TZOA 1GICA 1ASJ2 4NHMA 1CQ9A 5C4WC 4MX3A 1Q8OA 4JQRA 2P4EA 1UXXX 5FCCA 1PZ7A 3WDUA 3GHMA 3LPGA 4KNCA 5FQ0A 2OVUA 2UWBA 5AC92 4PBOA 4FTEA 1VAMA 4WM7B 4NAOA 3SCFA 2JDZA 1XXNA 2DVFA 4YVSB 3VKLA 3ZVXA 1TE1B 2HKXA 3A23A 3WP6A 4QX3A 5JMCA 3VBSB 3MPBA 3OGRA 4Q4X2 3OBZA 3IMMA 2NQYA 1F8VA 4XCAA 3MF6A 2VZPA 4GQ7A 1ND3A 3U4XA 2XJVA 4IV3C 3VZJA 4W6WA 3DUIA 1AF9A 4ZZ5A 3UYJA 1H8TC 3WUCA 2VVEA 5FOJB 3PVBB 2Y6KA 2RS51 3N36A 4TXWA 3NW4A 2D93A 5FZ4A 2XH6A 4CCEA 5FZMA 1L7QA 2TBVA 4QB2A 1QY4A 5FQ0B 1MEC3 5M0TA 4W8JA 2PAEA 2NYYA 4GULA 1AR82 4K9SA 5BNPC 4QPGC 5FY5A 1LEMA 2I2SA 3SXWA 2ARXA 2RDSA 4BU2A 1BJQA 1EV11 3B5LB 3KZ4C 3MFAA 4TWTA 5JR7B 3VDDA 5A3WA 2VMCA 3OTFA 4LKSA 5DAXA 4CDUB 5DDJ2 4YARA 1AL21 2Q8DA 2G9ZA 3TWIA 3LIHA 2Y26A 3SEPA 3ZN6A 4FAGA 3AMNA 1HKDA 1LOBA 3N9NA 3WSOA 3VUOA 3E1F1 1G86A 3NAPA 3AVSA 1TME3 3ME2A 3QH6A 5E88A 4W65A 4ZONA 2X53S 4P9XA 1YJKA 5JXGA 1QQP3 1L3JA 2EXHA 2W46A 4OFGA 4QXKA 3FLPA 2FCTA 1VR3A 3GBGA 1UZYA 1EUTA 2ORZA 1JS9A 2VVDA 1RHI3 2WR9A 4IEYA 2ZHLA 2DURA 1VIWB 3VHOA 4I0BA 3SEEA 1H1IA 1Q43A 2GDFA 4CP0A 5IVFA 2WQZC 3A7QA 3D82A 4YNIA 4IGOA 3ZKUA 2PQSA 4YLZA 4RN5A 2R30A 3U75A 2XPJA 4S2GA 4LTAA 5DAQA 1W8ZA 4J1WA 5FREA 5J48A 3U1XA 1WLDA 4AXOA 4PIYA 4Q2FA 2YC4A 2W95A 1IS4A 4PF1A 1RUJ2 3AKQA 3IDEA 2VZTA 5JZGB 1LNSA 3C3VA 3Q9OA 2MEV3 4D3WA 1COV1 1QGLA 2B4KA 2R1BA 1EAH1 1DGLA 2C24A 2X29A 1W9FA 5A7PA 3RJRA 1JUIA 3GZUC 1UZWA 3WZ1A 4NUBA 3HNBM 1W6PB 2BVVA 3IPVB 3N35A 3MW2A 4GH4C 4LO8A 3F95A 3VBSC 2QZ2A 1RHI1 5FYCA 3KCCA 1VBD1 2HWE3 1O91A 1RUC3 3D6EA 4HLTA 2GC2A 4S2FA 2O8OA 4BK5A 5J3UA 1OA3A 1RUE3 3N7JA 4Y3OA 3BTXA 3AKSA 2VUDA 4Y1UA 1XNAA 5FYUA 4CUBA 2VY0A 2D6MA 3M7AA 5I0UA 2HYKA 1I9RA 2HWC1 3MIEA 1Q8PA 1JZ5A 2VTXA 1JZ4A 3TEYA 2VW2A 4EROA 4PCRA 5HPOA 5JIUA 1U0AA 2HEVF 3MFCA 1NKGA 4CCJA 3E5QA 3KV4A 4GJZA 4I3PA 4YW1A 5GM0A 5JR2A 2ETEA 4RQPA 3BOWA 1W8WA 2GNMA 3NQHA 2BVBA 2P3KA 4I0AA 4C1XA 4F83A 1REFA 5BNNA 3RZGA 4NIHA 4LKDA 1YLLA 1WCUA 3T08A 1EUUA 4D6QA 3ZXLA 2WWSA 3VBFA 3ZSEA 3A0KA 4FCAA 1AXKA 3CMGA 2YGMA 1GP6A 1LOAA 3G6JB 4QPIC 5CFCA 3M1HA 2Y38A 1WMEA 3AMPA 2VQAA 3LA2A 3P6BA 4AK3A 2FZ1A 4E2GA 4A7ZA 1ZBE3 2R7EB 2UY8A 4AI9A 1UX6A 5FPAA 1OHFA 4YFZA 3J7HA 2D5HA 3CL1A 3DN7A 4UW6A 2QUOA 4XBLA 3U10A 2H0VA 1AL0G 3RI8A 2V09A 1W6MA 2JDUA 1OLQA 1GBGA 4YW6A 3I3EA 4UW5A 1PMIA 3B94A 4YGBA 3WG1A 4XDOA 1DQ5A 3HNYM 5JWPA 4MUVA 4XETA 1VP6A 4XJUA 3UKTA 1FOD1 1U12A 1KJRA 2YFUA 2J1RA 3D4KA 1RJ8A 2XHKA 3POGA 4AI2A 4QPYA 1DCSA 3B01A 2B46X 4FI9A 2E31A 1AR81 1IS6A 5T5PA 2OZ6A 1OKQA 2OA2A 1WW6A 1CAWA 3WCRA 1JYIA 2VMGA 1DDLA 3J7LA 2V72A 4QT6A 5IVBA 2QZ3A 2JG9C 1NA1C 2WZR2 5IK4A 1S0CA 2P37A 4L9BA 4H55A 4LHSA 3Q8AA 1HRV3 1QJY1 5D8AB 4L0PA 3ZM8A 2XL7A 3U78A 4LIVA 4K6BA 4EQVA 5C71A 3GALA 4K1ZA 3VZKA 1CZVA 5DAWA 3ASIA 4AWDA 4FP2A 1HXS2 1KFUL 4A7KA 2BNMA 5C9AB 1X82A 1POQA 5KC5A 4HN1A 3LOBA 1VBC3 1O3RA 1QDOA 2MEV1 2W1SA 2VNRA 3B69A 3I2IA 5FZEA 3H9AA 3QACA 4N53C 5GLTA 3NJZA 3POSA 4BQYA 1QKQA 5ABJB 2CAUA 2ADEA 4Z2WA 2FZ2A 4QX7A 5FMOL 2A6VA 3HEIA 4XILA 4XF3A 2RM23 4AVTA 1W6OA 1OQ1A 1CR7A 4IL7A 3NRUA 3ZO0B 4FFFA 1WCSA 5HXVA 5C3PA 3VHRA 2BGOA 5I91A 2F6BA 3WXPA 1Q8VA 1QQP2 5FPXA 2E63A 4DO0A 3O1MA 2R16A 3LA7A 4OUEA 2AACA 4AFAA 1MVEA 3H42B 3T4VA 1WA6X 2QQIA 4QDRA 2OUHA 3AL6A 2BYVE 5FJHA 1AYM2 1X7NA 2QQNA 4OUMA 5I0DA 1ZZBA 4QXHA 4QXBA 5FMCA 1C57A 4HONA 2JDNA 2FHRA 5EHDA 1LGCA 2RV9A 2D6LX 4DRRA 1EPZA 5F6LB 1BMV1 2X5IB 3ZYBA 3JB8A 2P3YA 3ZPYA 4UXAA 2GN3A 5LY1A 4GD4A 2WNVB 3HT1A 3S7EA 1LGBA 4L2NA 2C1FA 4XDQA 1C8M3 1L7RA 1UMZA 2VG9A 3SCHA 5E16A 1O3TA 2O14A 1ZBA2 4O7XA 3H1MA 3OYWB 2A71A 4OHWA 1GOGA 1B35B 1OI6A 4E2QA 5LB6A 3T2PA 1JZ3A 3BTZA 2RJLA 3AMMA 2VMDA 1KJLA 3GZEA 3OGSA 3OYWA 1RUJ1 1YFYA 2ZCWA 2XL9A 1TME2 2ARAA 2PHUA 3AFGA 2Y6LA 5A6XA 1W3XA 3HMYA 3LWCA 2FDIA 1VBA3 1RGSA 3LDRA 3NVCA 4Q4W2 3LDKA 5JOWA 3W21A 3KSCA 3MW3A 3K4ZA 3QCWA 1SFPA 4A45A 2WNVA 3IAQA 4CEYC 4FPCA 1LHVA 1QNYA 1ZA7A 2G4IA 4IERA 2HEYF 1SPPA 2BNNA 2O8QA 3ZN5A 3DF0A 3KQ4B 3CHXA 2IZWA 4QPWA 5FKBA 5GLVA 2A3XA 3WQ7A 1H9PA 1H2MA 3AMQA 1NLRA 3MICA 3QBQA 2K0GA 3AXEA 3MIFA 4S2DA 1NZCA 2VCCA 4EJRA 1RUI2 3JQXA 4LO4B 4MGKE 2RHPA 3G7DA 3C7OA 4E8CA 1A6CA 5L19A 4NAMA 4YG0A 1AR93 1BHGA 1LU2A 3B93A 4NRQA 4PF5A 2RVAA 5F5AA 1AL22 5CFCB 5BUVA 1EPWA 2NMOA 5EFUA 3GCXA 2GP3A 3O14A 1SBEA 2HWE1 1N47A 3I2JA 4IE6A 4LLOA 4EZ4A 5FPLA 3POFA 3RZHA 1QJU3 4QB1A 4UFKA 3MLJA 5C8WA 2R1DA 3MF9A 4WZFA 1BCXA 4CDWA 4QD2A 1R092 4PLNA 3KV5A 1PGL2 1CD3G 2BZDA 3E6BA 1WW4A 3JCIA 4XF4A 5DZGA 4LBQB 5E89A 5JI7A 3PUAA 4AZZA 3IKWA 2JX9A 2BOJA 3NMBA 3OCPA 4Q4Y3 1NLQA 3WF3A 3N4MA 4Q1PA 3AKPA 3NKGA 3H3ZA 1SLTA 3ACFA 3I59B 4KL1A 2VZQA 3WDVA 3ZFEB 3Q8CA 1OFNA 4AQ2A 5LBBA 1F4AA 3VD7A 5A1AA 5J1XA 1WGPA 3WF1A 5T55A 3MDPA 4FXGB 1V0AA 3DL3A 3NSTA 3CJXA 5DN2A 4QDSA 4RHV2 2WDBA 4D7TA 1J84A 2WO2A 5FOBB 3MZHA 1QQP1 4IESA 1VMJA 4JTNA 1ASJ1 4EYUA 3LEIA 3FJSA 2BWAA 2WINB 4UAPA 4XQ4A 1UN1A 3O1OA 4P9GA 2A5ZA 3N9OA 4HVRA 3O1SA 1QOOA 1XE7A 2RDRA 1QNWA 2QQMA 2NLRA 1UYXA 5GZDA 2EXKA 1Z0HA 2DUPA 2R063 5A3OA 1ZA4A 2WFF3 4JCKA 3R6SA 3HWJA 1ZZCA 5L9VA 2W68A 5KXBA 4MOAA 4BA6A 4XACA 4D8MA 3KT1A 3LEKA 1VLNA 1XPWA 4NWVA 2CDOA 2BW8A 3HNMA 1NE4A 1F35A 2XKOA 1XJAA 2VNGA 2P2KA 1PVC3 3OEAA 4LKEA 4NJ4A 2WZPP 4AEDC 2F17A 4P00B 2E53A 3LE0A 1X36A 4CCNA 2WS92 1NCQC 1IPKA 4GWJA 1CIYA 1QH6A 3FBMA 4FT8A 1W03A 1QJU1 1ZYBA 5L9BA 5FLJA 2EIDA 4IGQA 4PBPA 4Q29A 4YW2A 1ZBA1 4BXFA 2V73A 3I3MA 4OMCA 4FOYA 2R072 3AX4A 1C5IA 4MGZE 2PYTA 4WM8A 5H9RA 4GMP0 2HWD3 3BPSA 4TLFA 5T5OA 2XDVA 2DU1A 2AREA 2XGXA 3D0SA 5IK7A 1AYN1 2QQOA 4HKWA 1WLWA 3RMYA 1UPSA 5CFDB 1QOSA 1A3KA 3OOXA 2PXJA 4Y5TA 4LE3A 5GALA 5FO9B 4DUXA 3B02A 3K75B 4B4PA 3DEMA 2WRAA 2RS11 1KD7A 1NA1A 5A3UA 5C4WB 3ACLA 3M2MA 4ES9A 4BYYA 4HL0A 1NCRB 1KGYA 2XJRA 4YWAA 3IIAA 3W58A 4D69A 2H6BA 4BJ0A 2BTVC 2QQLA 1VBB2 2EALA 3JD73 4N7IA 1DZRA 1MS3A 1OA2A 3WDXA 2GMPA 5A3TA 3M3QA 2VCBA 3CDZB 1SBFA 2ZGPA 1RMU2 3ILNA 1OF3A 5C3OA 4WM8B 1LHOA 2R042 3WCSA 5FZFA 2D5FA 4IEOA 5LA2A 3RMXA 5FP7A 1UY1A 4NWWA 3FHAA 5KHIA 4COZA 4GB31 1XU1A 2JKBA 3ATGA 4R4XA 1VRBA 4P9JA 1MQTC 3V56A 1J58A 3IIIA 1UU4A 5SV5A 1CAXA 2JECA 1OA4A 4IV3A 1Y9GA 2VOVA 4PQ9A 1D0HA 1GQGA 1PIV1 1UX7A 5C8CC 1VRH1 3NV1A 4HOOA 4FPHA 4H14A 4N53A 1QMJA 1OOPA 2Z79A 5F3GA 3M3CA 3U37A 1NLSA 1AJKA 4GH4B 4RS5C 3ZYJB 3I3DA 2EVXA 3J7MA 3UJQA 5ISLA 4UI9L 5JSRA 4MHUA 3H8UA 3CF6E 4FFHA 5LASA 2BFUS 1VMHA 1N3QA 4LXLA 4COVA 4TLGA 4O65A 4D0QA 4DS0A 5L7OC 1YCIA 4A3ZA 3KT4A 1O8PA 4CDWB 5C3SA 5JI9A 3H8RA 2AEYA 1OLME 4GWMA 2PELA 4MGSA 3ITQA 1H4HA 2BWCA 3CZUA 1ZZ8A 3OD4A 1OPMA 2WLPA 4CCOA 4IV1C 2C4XA 1ZRIA 2ZX4A 3S30A 3K77A 2PHFA 2WFF1 3LIGA 5C70A 3PMSA 1YQ2A 2F4PA 4DINB 5A33B 1MS4A 3AP6A 2AEZA 3M4FA 4OI2A 4FXKB 4O9EA 1HJGA 1RHI2 5A33A 3POEA 1KXGA 3BIWE 3WNOA 4URAA 4M01A 4FPFA 1FPN2 1X8MA 1D4M3 5A1FA 4XZUG 2VVFA 5TSWA 1KFXL 4WVMB 3AP5A 1OD3A 2ZS6B 4XQWA 4PIXA 5FP4A 1MEC1 2D6KA 2HWF3 3SH5A 2VUJA 1NCRC 4BM8A 4GKXA 3M3EA 3ZSMA 1HRI3 3IWZA 5D2AA 3MHZA 4RS5A 2WL1A 2OYZA 2DV9A 3TEXA 3H1WA 1DYKA 1V6IA 1GV9A 3OBAA 4KGQA 5D21A 2VL4A 4CUAA 4YM1A 2VZRA 3S6PA 3KGLA 1OUSA 4XFFA 4C90A 4AGVA 5DUXA 3TBDA 1GNYA 1GQPA 2VTFA 5IVYA 3U4SA 4CVUA 4A44A 3N9QA 1AR73 4BQWA 4P02B 5FYTA 2W52A 4LHKA 1Y7BA 2C9AA 2XVLA 4LO7A 2FD8A 4NIDA 5BNPB 4JGZA 1GYKA 1VMFA 1T2XA 2WYFA 4ASKA 1AL23 1RMU1 5F5CA 2CL2A 3H7JA 3I2FA 4HSJA 3A4UA 4NRPA 2VQUA 1YQ8A 1G9AA 2DCKA 4IV1B 3KF3A 2CNAA 5F2SA 4DRVA 2ZGUA 5H9QA 1O7FA 1IS3A 1RUI3 3THCA 3QH7A 1K3IA 1RUF2 4NPMA 5FXZA 4AE2A 4ATFA 3WF4A 2CWSA 1YYNA 4AFCA 1J1TA 4AG4A 2IXIA 4EE2A 3I2OA 4Q8LA 5EWSA 2WNEA 4AVSA 1COV2 1PM4A 4XCBA 3N3HA 1NYWA 2W5FA 3UGGA 4CU9A 1K5MB 1W3VA 3O0VA 2XLFA 2Z5WA 3PUHA 5F3IA 1VBD2 2ZHMA 4IEUA 4JGZB 1EV12 1G9DA 2ZEYA 1YI7A 4YM0A 3D0JA 2R32A 4CZSA 1MZFA 3AP9A 4QKBA 3OUJA 2P34A 5FP8A 2OKXA 3LFIA 4FFGA 5GLUA 2DCZA 5CFCC 1EAH2 1HB2A 1TMF3 1BEV2 3MLLA 5A7QA 3SHRA 2XVKA 3P3NA 4CE8A 4DNYA 4KQ7A 2ZGOA 3WEZA 1NCQA 1MQTB 3IDAA 5KWRA 4AF9A 1W8NA 4AEDB 5HCAA 1JU3A 5FUIA 1LOFC 1XNDA 2GC3A 4Q0PA 4D7YA 3PVEA 3OGGA 4GZ9A 5AVPA 3FWEA 4B1LA 1SQ4A 4M3CA 4YGCA 1MS0A 1H2NA 1E57A 2VZ3A 2GH8A 5E1RA 5FIXA 2J1SA 4WM8C 2EIGA 4ORFA 1UYPA 4LULA 1PO12 4KWKA 2ZHKA 2DCJA 4M3CB 5CKNA 4RR3B 1R082 1BVP1 4YPJA 3SISA 3VBSA 4HSLA 4JGYC 5HI0A 1V6JA 1O4ZA 2J1AA 2RS13 2H0BA 4JKLA 4LNVA 4DOUA 4RFT0 5T5JA 4LOSA 3ES1A 5F1RA 1LHWA 4BZ4A 2CV6A 5GLWA 3HQRA 4WZCA 1V6KA 3CJIB 4CDUA 1YO8A 3H7YA 2YB7A 4GMP3 4XC9A 3ALQA 3WP4A 2NPIA 4YW5A 4QX1A 1RUG3 4UOJA 1ULFA 3ZDSA 2E9QA 2ZEZA 4AI0A 5KHKA 1AR83 3WOGA 5HCHA 3ZXFA 3PUQA 3JU9A 2WSUA 3TNPB 4AVAA 2GC1A 4XUOA 1MEC2 3F2ZA 1PNFA 1W6NA 2HWD2 3CZJA 2G1MA 3B3QE 4ZPIA 4B1MA 2WN3A 2X5IC 2D3PA 1W6NB 5C33A 5LWBA 2AR6A 2A73B 1V6LA 3LOIA 4JHZA 2NM1A 1WCKA 1FMD1 1DZTA 2LS6A 1IS5A 4Z92B 1AX0A 2OPKA 2IXCA 4KWJA 3O7OA 5CIRA 5CZKA 4AI8A 1NE6A 1D7PM 3RWNA 1IQDC 3CQOA 4MH0E 4QB6A 4QKNA 1LKNA 2D44A 4A6SA 1W2TA 4P14A 2DYCA 3ZIWA 4TSVA 1UMHA 2AUYA 4MSVA 1CWPA 3LPFA 2FDKA 1UIJA 3VBHB 1G9FA 4D7SA 1PGW1 1EYBA 4MYEA 2PTMA 3CNAA 4YFWA 1D4M2 1DQ4A 4WV8A 4X6QB 3RSJA 3VBHA 2HWB2 2DUQA 1I1EA 1V9U2 3BALA 1PK6B 4JDOA 3WW4A 5JDBA 5DPNA 4AGRA 4XFBA 5CU1A 4CP9A 4M4RA 2C9KA 4NHXA 4OHVA 5JVVA 1OMIA 3BOPA 3VBHC 1N3PA 2GN7A 2PN5A 1JZ6A 1YHFA 1FATA 3OB8A 2RMU3 1Y9QA 2E7QA 2ERFA 3IPVA 4AHXA 1W05A 2WYSA 5A32A 1B09A 4IE5A 5I8YA 2VOXA 4FPKA 4KWLA 4MV2A 3KQRA 5C5TA 2J22A 1AR91 5A32B 1SFNA 3EO6A 3DCQA 3JQWA 1UKGA 1WMDA 3NJVA 2B45X 5IAVA 3RDIA 5A6QA 1L7LA 1W2NA 1XNCA 3I7DA 2X10A
chains in the Genus database with same CATH topology
1GZTA 2JDHA 1UQXA 5A6XA 2JDNA 2BOJA 5A70A 2CHHA 2VUDA 2WRAA 1OVSA 1UZVA 5D2AA 4CE8A 2BP6A 1OURA 2BV4A 2VNVA 3ZDVA 1W8FA 1OXCA 5A3OA 2JDUA 5A6ZA 1OUSA 2WR9A 1W8HA 2BOIA 2VUCA 5A6YA 1OVPA 2JDYA 2JDKA 2XR4A 2JDPA 3DCQA 4AOCA 5A6QA 2JDMA 4UT5A 1OUXA 5HCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZT A;  2JDH A;  1UQX A;  5A6X A;  2JDN A;  2BOJ A;  5A70 A;  2CHH A;  2VUD A;  2WRA A;  1OVS A;  1UZV A;  5D2A A;  4CE8 A;  2BP6 A;  1OUR A;  2BV4 A;  2VNV A;  3ZDV A;  1W8F A;  1OXC A;  5A3O A;  2JDU A;  5A6Z A;  1OUS A;  2WR9 A;  1W8H A;  2BOI A;  2VUC A;  5A6Y A;  1OVP A;  2JDY A;  2JDK A;  2XR4 A;  2JDP A;  3DCQ A;  4AOC A;  5A6Q A;  2JDM A;  4UT5 A;  1OUX A;  5HCH A; 
#chains in the Genus database with same CATH topology
 1QJE A;  2DBN A;  5IK5 A;  3FMG A;  3BI3 A;  4A2U A;  5BYN A;  5JSP A;  1JBC A;  1SCS A;  1VB2 A;  3N7M A;  3A0N A;  1V6M A;  3K51 A;  2CHH A;  4QM8 A;  4Z8B A;  1W9T A;  3ZPO A;  1S0G A;  5CG8 A;  5DZE A;  4Q4Y 1;  4UF0 A;  4CU6 A;  5FZB A;  4AL9 A;  3PTR B;  1RUN A;  1WBL A;  4L97 A;  4M0N A;  3ZXG A;  4I01 A;  1K5J A;  3C7H A;  4FPO B;  4GB3 3;  4Q26 A;  1RUF 3;  1UNB A;  1W39 A;  3K4A A;  1DGW A;  4Z07 A;  1QJX 3;  3GF6 A;  1AR7 1;  4YZ5 A;  1GAN A;  1Y4W A;  5GJ6 A;  1CAV A;  1CJD A;  4BIS A;  4LK6 A;  1FMD 2;  5L36 A;  1VPH A;  2MHF A;  2DBI A;  4LBK A;  4SBV A;  1MVQ A;  1PMJ X;  5JZG A;  1C1F A;  4FSJ A;  3OUH A;  1AHS A;  1GSL A;  3MO4 A;  4MO3 M;  3VL9 A;  3L2H A;  1WLT A;  3DEC A;  3VV1 A;  2IC1 A;  1QIQ A;  4UWD A;  1K5M A;  5FZL A;  3OEB A;  4AAP A;  1H9W A;  1RUH 1;  3WY6 A;  4LBL A;  4W6X A;  4Y4Y A;  1D2Q A;  2VCA A;  1ST8 A;  2R07 3;  3TN9 3;  3KCY A;  5DAP A;  1RUC 2;  4N7U A;  3WNP A;  2E32 A;  4CP2 A;  2R04 1;  5KHJ A;  2W47 A;  5BXX A;  4JZR A;  1YJL A;  1WZX A;  1FOD 3;  1VJ2 A;  2D3R A;  2KXL A;  2XQR A;  4A41 A;  5FYI A;  2J1V A;  3FC0 A;  1ND3 B;  4NO4 A;  1ULC A;  4GWN A;  3LSE A;  1MQT A;  4FBF A;  2WT2 A;  4F3J A;  4ASM B;  3RGB A;  4XJW A;  5DUV A;  5EPA A;  4QHO A;  1ND2 C;  1W9W A;  4IEP A;  1FI2 A;  5LAT A;  3WDT A;  2ZML A;  2WNV C;  4FPY A;  4RQP B;  4BHP A;  3B7M A;  3LSD A;  1LJ7 A;  2FDG A;  3X29 B;  4JAA A;  5F3E A;  4MG2 A;  1H8T A;  1TQ5 A;  5FZI A;  1TVG A;  3V65 A;  5FR3 A;  1KQR A;  2IXH A;  3H8X A;  3T3Y A;  3DPR C;  5IAX A;  1PVC 1;  2WO1 A;  3VBO B;  4AVC A;  1X33 A;  4YVS A;  4XFA A;  4CCC A;  4CU8 A;  3VKM A;  4BQ2 A;  4JGZ C;  5FWE A;  2E33 A;  1W28 A;  3LKJ A;  5IFP A;  3VD9 A;  1OQE A;  2V5Y A;  5IW0 A;  1K5M C;  2HWB 3;  4KU7 A;  2JE7 A;  4PJY A;  1DZQ A;  2JIG A;  4FP3 A;  2P6C A;  1U5Z A;  4BPZ A;  1RC6 A;  3SNM A;  1CJP A;  1O5L A;  1BEV 1;  1SLL A;  1UKR A;  1TMF 2;  1Z78 A;  2WAB A;  3ZFG B;  3ZYF A;  3KLS A;  4BIF A;  4A4A A;  1JOP A;  2E26 A;  1H8T B;  1LGN A;  3C7F A;  1W0P A;  2XXZ A;  5BNQ A;  3ST7 A;  2ZMN A;  3J8F 1;  3ZXA C;  2V4A A;  1CZS A;  1NOV A;  1W8F A;  3ORJ A;  4RSU A;  4QGL A;  2TNF A;  4ZU5 A;  3KHB A;  1H6X A;  4UBH A;  1CON A;  3OG2 A;  1ND3 C;  2ZEW A;  4QWN A;  1FOD 2;  2ZEX A;  3BGA A;  4M00 A;  3AZY A;  4JKM A;  5LRS A;  1YQ5 A;  1ZNP A;  3VBR A;  2ZGN A;  3WF2 A;  1RUH 2;  4L99 A;  1EAH 3;  1WUV A;  1PX3 A;  2X8K A;  2ZOE B;  4A7Y A;  1QU0 A;  4XF0 A;  1YI9 A;  2LW8 A;  1RB8 G;  2VNO A;  2PA7 A;  2HBU A;  1EV1 3;  4PQQ A;  1UW8 A;  4U36 A;  1D0G A;  3T2Q A;  3RZJ A;  5FV3 A;  1DGR N;  4CCK A;  4CU7 A;  5HV4 A;  1X50 A;  4K7J A;  2DFB A;  4PI0 A;  4Y1V A;  4JTO A;  1TNF A;  5FLI A;  5T5L A;  5GZF A;  4JVA A;  4XFC A;  1FMD 3;  1G7Y A;  3AZZ A;  5FPV A;  4H7L A;  4ARX A;  2VUC A;  2P17 A;  1S0I A;  4AI1 A;  4ONU A;  4Q0V A;  5KR7 A;  1UD1 A;  3T4H B;  1LOE A;  4Q4Y 2;  1W9S A;  1V00 A;  2HYX A;  2DWR A;  1SLA A;  2ZZJ A;  5AC9 1;  3PTY A;  2VQ0 A;  4QX2 A;  4KU8 A;  2PHT A;  5KHG A;  1HRI 2;  2AH2 A;  3K46 A;  4QHZ A;  1YIF A;  2WS9 1;  2XUM A;  3AC0 A;  4FPG A;  4LEJ A;  4BLI A;  1VBE 3;  1CAU A;  2JKX A;  2VE1 A;  4DMI A;  1WD4 A;  2DTW A;  1PO1 3;  1S4C A;  5LA1 A;  2ZAA A;  3FL7 A;  4YW3 A;  2JG8 A;  2XB6 C;  4MGY E;  1CAU B;  3S0M A;  1PHM A;  4FQZ A;  2VZS A;  4MXV A;  5IUQ A;  2XWB B;  4Q4W 3;  4GIQ A;  3K3N A;  3O0X A;  1U5Y A;  4HFS A;  3O12 A;  4ZS2 A;  3C2U A;  2WN2 A;  3AYE A;  1RUE 1;  2O0O A;  3S5Q A;  1WA4 A;  1YNA A;  3WW2 A;  3AMH A;  5BNN C;  5E6H A;  2X5I A;  4KH9 A;  5FY1 A;  3WDY A;  3BTA A;  4QGM A;  2WNU A;  3I54 A;  2ZX3 A;  3WNX A;  2WT0 A;  3ACH A;  3WNK A;  1CVN A;  1D2S A;  1LUL A;  1W6M B;  3ZMN A;  4G4F A;  3ZXD A;  2JEM A;  2E6V A;  2EAK A;  1JI6 A;  2BEO A;  2K9Z A;  2JG8 B;  1HRV 2;  1AX2 A;  1COV 3;  3WHT A;  4LUM A;  3O1U A;  5G04 L;  2EA7 A;  2ZAC A;  1XNT A;  2Y6F A;  5BNN B;  4FO9 A;  1XNK A;  2OPW A;  1MS5 A;  4LA2 A;  2MNG A;  1JOJ A;  2Y0O A;  3MLK A;  2JDM A;  2XJQ A;  4BB3 A;  2NP0 A;  2DVD A;  2DFC A;  1R1A 2;  3SIT A;  4RL7 A;  4JGY A;  3D5O A;  4YGE A;  5J37 A;  1W6Q B;  2D6O X;  3ZFE A;  1PIV 2;  4KI5 M;  4UBG A;  2HWC 3;  3AJY A;  5I0R A;  1NXM A;  1QH7 A;  1PVC 2;  4JC1 A;  4QX5 A;  4XFH A;  4AFB A;  3WX5 A;  1YFW A;  4Z1V A;  2P1B A;  4XYX A;  1O8S A;  2JB4 A;  4XAA A;  5I8S A;  4CCD A;  3NWK A;  4XHB A;  1AXY A;  2WZE A;  1AR6 2;  4BCU A;  1CGP A;  4IET A;  3DYM A;  4V1P A;  4CP1 A;  4XW3 A;  3CBN A;  3EHK A;  2ET1 A;  3VDC A;  3RYP A;  3VBU B;  1DGW X;  2DCY A;  4HK8 A;  2XLA A;  3OPW A;  5EXO A;  2Z4F A;  3RZZ A;  1JUH A;  2WNU C;  3MUY 1;  1UY2 A;  5DQ0 A;  3AKT A;  2K46 A;  2W0X A;  5FZO A;  2RS1 2;  2JIJ A;  1BYH A;  4UYB A;  5FZ1 A;  5A1L A;  3B00 A;  1ZZ7 A;  3ZMO A;  1W6O B;  2A6X A;  1CX4 A;  4K8R B;  3KMH A;  4AI3 A;  3LD8 A;  4XUN A;  3ZYR A;  3ACI A;  3C7E A;  2VNV A;  1LOD A;  3WG2 A;  4NVP A;  2CAV A;  2VMF A;  2YRO A;  2B9U A;  4HPK B;  5D8A A;  3ON7 A;  3IBM A;  4NE9 A;  2XJU A;  1F5J A;  1PMH X;  5LCW L;  2Q1Z B;  4HPK A;  4B4R A;  1S2K A;  2HH9 A;  2JDA A;  3ROU A;  3USS A;  4P5Y A;  5C9A A;  5T50 A;  5EIY B;  2TUN A;  5FO8 B;  1JZ7 A;  3H8O A;  1SAC A;  3I59 A;  3RPQ A;  1HXS 1;  3P1I A;  4E4S A;  1UOB A;  1ZBA 3;  2GSY A;  4Q27 A;  1JYT A;  4AAX A;  3KVA A;  3AZX A;  5ABJ A;  2C6S A;  3J9S A;  4NN0 A;  2AC1 A;  4M0H A;  1HQL A;  3SKV A;  1MS1 A;  3PNA A;  3KCX A;  4D6R A;  4XVH A;  1QJX 1;  1NY7 1;  2LUW A;  4O9G A;  5B4N A;  4JDM A;  3SKJ E;  4V2W A;  5B4X A;  4F8A A;  2J7M A;  1QJU 2;  4NPR A;  4M4P A;  4XUP A;  4YM2 A;  3C8X A;  4HT1 T;  2GZW A;  4OYU A;  3LA3 A;  1B35 C;  4HXC A;  1TEI A;  3JUU A;  2R06 2;  4HVO A;  4LUK A;  5FY9 A;  3THP A;  3URF A;  1NA1 B;  1O6U A;  4KWU A;  1CPN A;  5A3M A;  4AFM A;  1LOG A;  2B39 A;  3WQB A;  4LO6 B;  1C8M 1;  1M4W A;  3FUQ A;  4Q0Q A;  5FY8 A;  1OLR A;  4OUS A;  1WLC A;  4PDW B;  4QQP A;  2TEP A;  1CIW A;  2QQW A;  3M3I A;  4NMI A;  3U14 A;  2ORX A;  1K12 A;  4CDX A;  4HN0 A;  2CTV A;  3D8C A;  2BU9 A;  2B8M A;  2RS5 3;  1OH4 A;  3GM8 A;  2Y33 A;  4YG3 A;  2FDJ A;  1GP5 A;  5FYH A;  1PO2 2;  3BKZ A;  2RDN A;  3JBG 1;  3NV4 A;  2YGL A;  1LR5 A;  1RIR A;  2JDP A;  4NR1 A;  1PIV 3;  5FRA A;  1ZBE 2;  3BYW A;  4OI0 A;  5EP9 A;  2QQP A;  3ETP A;  3OY8 B;  1IZ3 A;  2YPJ A;  1OKO A;  5FYV A;  4L8Q A;  5J98 B;  2W94 A;  2B9V A;  1LOC A;  2LRO A;  5BPX A;  5CBL A;  3V0A A;  1HN1 A;  3VDA A;  4B4Q A;  4OCT A;  1JTZ X;  2RS3 1;  2WQ8 A;  1X9P A;  1BKZ A;  1S0B A;  2YMZ A;  4M3C E;  4XBN A;  5EJZ B;  4AFD A;  1R08 3;  3AVR A;  5JPM B;  1DYP A;  1ULD A;  1NZI A;  4CUG A;  5ERL A;  2MEV 2;  3N9L A;  2GH2 A;  4LJH A;  1UF2 C;  2VQT A;  3PME A;  2D6N A;  2QKD A;  5ANN A;  5EV7 A;  1SFY A;  3EBR A;  4NRM A;  2VGD A;  5FDB A;  1C8M 2;  3SH4 A;  2HLE A;  2BBA A;  3NV2 A;  2KR2 A;  4QM9 A;  2HJI A;  1NY7 2;  1ENS A;  3RZL A;  5ACA 2;  1NCR A;  2JEN A;  2GND A;  3RZM A;  3VN4 A;  1NUK A;  2ZX0 A;  4CEY B;  3GHN A;  2GC0 A;  3POW A;  1R09 1;  4I02 A;  3ZYP A;  4Q8K A;  1EY2 A;  3WW3 A;  3BOD A;  2WLQ A;  2JD4 A;  4OI4 A;  5A7S A;  4K3U A;  2B7Y A;  4IGP A;  4CEY A;  4Y4R A;  5FXW A;  4AQT A;  5IVV A;  2PHL A;  1OVS A;  2ARB A;  2OQ6 A;  2RJ2 A;  3TEW A;  4FTS A;  1HN0 A;  1S2E A;  2RE9 A;  2YBS A;  4CDQ B;  1DGR A;  5LZ6 A;  4I09 A;  3ZSJ A;  1QDC A;  4AEJ A;  3J8F 2;  5FZ7 A;  3R4D B;  2JD9 A;  3ZFG C;  3RS6 A;  1PO1 1;  1XBF A;  4YZ4 A;  3IDC B;  1APN A;  4COW A;  1H8V A;  1V70 A;  3PUR A;  4EN6 B;  4QXC A;  4LO5 B;  2IXL A;  4NHL A;  1HX6 A;  1W8O A;  4HVQ A;  4E4Z A;  4N43 B;  1W2O A;  2PHD A;  3W9A A;  5CEH A;  4GAL A;  3GZA A;  2ZXQ A;  4CDQ C;  5JXJ A;  3GZT B;  4LHL A;  5I0T A;  5HCF A;  4B29 A;  1XYN A;  2L9L A;  2CYF A;  5LEK A;  4LBO A;  1M06 G;  5FP9 A;  3S7I A;  2Z69 A;  5JXH A;  2E7A A;  1RUO A;  2XHN A;  4CEW B;  3OGJ A;  2EIE A;  1FYU A;  5A3N A;  1XNB A;  4BQ4 A;  2X05 A;  1IKQ A;  2Q0A A;  5F8P A;  5DXD A;  2VUL A;  1BZW A;  5DAB A;  4IDZ A;  2KD7 A;  2ZZQ A;  4GXL A;  3FLT A;  1HQN A;  3HBK A;  1VAV A;  3RJ2 X;  4CUC A;  3GJB A;  4P5H A;  4XMI A;  5H9S A;  5FZA A;  3I3Q A;  5FAX A;  3VZM A;  4AVV A;  2XJP A;  3OPT A;  2FMY A;  4MGQ A;  2FDH A;  4KGG A;  1JOB A;  1AR6 1;  2QQK A;  4Z2A A;  1XSQ A;  2XLG A;  1GWK A;  3WLU A;  4I30 A;  1BQP A;  1US2 A;  4YVW B;  2DTY A;  4XDP A;  1REE A;  3PDQ A;  3ZYI B;  1JHN A;  3A21 A;  4OLL A;  2VTX J;  4PDW C;  1FPN 3;  1AUY A;  1LED A;  4W50 A;  1OBN A;  1H4G A;  2VMI A;  4QQO A;  3TRS B;  3WUD A;  5EJ3 A;  5IWF A;  3ZXK A;  2ATF A;  2R07 1;  4AQ6 A;  2A70 A;  3GDB A;  4XJ8 A;  1RUH 3;  2N7G A;  4JRA A;  1D4V B;  5ANQ A;  5D8A C;  5K8S A;  4I2O A;  3ZR6 A;  1SBD A;  2JXA A;  4FOQ A;  1RUG 2;  1Y3T A;  1JH5 A;  1POV 1;  2VEC A;  1W2A X;  3THD A;  1RMU 3;  4LOR A;  2ADD A;  4AR2 A;  1NAE A;  3CKH A;  3FFQ A;  1PZ9 A;  4G3Y C;  2PHW A;  4CCM A;  1PO2 1;  4TYS A;  4YG6 A;  1NCQ B;  3T0B A;  4LR4 A;  5HCB A;  1K45 A;  5JZG C;  3GXU A;  4AHZ A;  4BQ3 A;  2JWP A;  2XBO 3;  3H0O A;  1WW5 A;  2AYH A;  4Y20 A;  3WVJ A;  2AGS A;  4Q4X 1;  2QDN A;  1ZX5 A;  1MR5 A;  1GQH A;  2OQ7 A;  1FXZ A;  1U5X A;  4OZX A;  4EN0 A;  3M8L A;  1W06 A;  5L7O B;  1XE0 A;  1BBT 1;  2D3S A;  1HXS 3;  1QHD A;  5FMD A;  3ZX7 A;  5LBE A;  3BU7 A;  4RYD A;  1WW7 A;  1CZT A;  5FWJ A;  4Y22 A;  1GOH A;  3OBT A;  4CPB D;  4YSF A;  2GME A;  3VBU C;  1UZ0 A;  2QQV A;  2JB8 A;  3FLR A;  5FUN A;  5JLV A;  1QOT A;  4DY3 A;  3RQ0 A;  2RR1 2;  4P08 A;  2LTN A;  4XZP A;  1OFS A;  4URT A;  2FMD A;  1UL9 A;  5K4L A;  5ACA 3;  1I5P A;  3M3O A;  3CJI A;  2YU1 A;  2DU0 A;  1FNY A;  2P3I A;  1VBC 2;  2CGO A;  4XMA A;  4Y5Z 0;  2VR4 A;  3T2O A;  5BNO C;  1KS5 A;  4H3W A;  3M70 A;  2BV4 A;  1GUI A;  4XUQ A;  4XJA A;  5DUW A;  1OXC A;  3I4I A;  2C5D A;  2OW4 A;  3AJZ A;  4Y1Z A;  1SLB A;  1YUD A;  5IK8 A;  1A8M A;  2G9G A;  4OVE A;  5G05 L;  3KV9 A;  5LW9 A;  1GFF 2;  4YYO A;  4DQA A;  4LE4 A;  2CGP A;  1G9C A;  3THT A;  2RS3 2;  1GNH A;  3P3P A;  4QPG A;  1J3P A;  1GMM A;  1Q8Q A;  1W9Y A;  3LEM A;  2CDP A;  4QKD A;  3RYK A;  4ASL A;  1JYC A;  4QPG B;  1UWW A;  3KGZ A;  3PVO A;  1ZM1 A;  2BNO A;  3VGI A;  3I2G A;  3JXS A;  5IAT A;  1RUD 2;  5B2G B;  5K0U C;  3OPZ A;  1IG0 A;  3NNG A;  3K2O A;  1LEC A;  4EZH A;  1PO2 3;  4ISR A;  4ZZ8 A;  1OOP B;  1C8N A;  4XJ9 A;  3EJK A;  4JKK A;  5FYM A;  1PVX A;  3I2D A;  4EN7 B;  4R9D A;  1XSR A;  1OPO A;  3PLQ A;  5FZ0 A;  2QTW B;  4GKY A;  4RR3 A;  4Z82 A;  5J36 A;  1E5S A;  3J26 N;  3LCP A;  4OQ8 A;  5A80 A;  3ZFF A;  4DXS A;  3IB3 A;  3PL0 A;  2UYB A;  1PK6 A;  4BQX A;  2HWC 2;  3VD3 A;  3MUZ 1;  1FV3 A;  4Y5S A;  3LAG A;  1FPN 1;  2GP5 A;  3FHQ A;  3POY A;  2WNO A;  4CP9 B;  5BNO B;  3HVD A;  3O0W A;  3ZN6 B;  1C1L A;  4RS5 B;  5F3C A;  5T3N A;  4ZXE A;  5LA0 A;  3OD0 A;  1AYM 3;  3CLP A;  3WV6 A;  2QNK A;  1RIN A;  1YQ6 A;  2RMU 2;  1AYN 2;  1RVF 3;  1ENX A;  2AEN A;  3EB7 A;  4H2A A;  5CB7 A;  2W2I A;  5CAD A;  3MIG A;  4TZD A;  1PM7 A;  4FFI A;  3VDD C;  4LT5 A;  2VXJ A;  5AC9 3;  3TAY A;  3KM5 A;  1HIX A;  4UW3 A;  4LIT A;  4F7Z A;  4BE3 A;  4NHK A;  5BNP A;  2A3Y A;  1OC1 A;  2G9F A;  2K2S A;  2ZAH A;  2ZGL A;  3I8T A;  4J6G A;  3DYP A;  4YVS C;  2WZR 3;  2ZGR A;  3USU B;  3HPN A;  3V64 A;  2RDQ A;  1URX A;  3WG3 A;  1XU2 A;  3VDD B;  5F6K A;  5J09 A;  3H1Y A;  4AW7 A;  3LZZ A;  3O1P A;  3KT7 A;  3Q8F A;  3O1T A;  4IV1 A;  1Q3E A;  2F4L A;  3ZSK A;  5C3R A;  5IVJ A;  4XIO A;  3WD5 A;  3AKR A;  1MPX A;  3ZKY A;  1NG0 A;  1BLZ A;  3H3U A;  4ZU7 A;  2VH9 A;  2ET7 A;  5LBF A;  4EV0 A;  2Y60 A;  3BVC A;  2UWA A;  1H1A A;  2Z2S B;  1GP4 A;  3ZDV A;  4XFI A;  1RL3 A;  4NIG A;  4CXW A;  4CDW C;  1Q8S A;  4B7K A;  4N43 A;  5A6Z A;  5J7M A;  4TTG A;  2A75 A;  3EQE A;  5CKQ A;  2ZPX A;  2UYA A;  3UKN A;  4HKO A;  5FYS A;  4OI1 A;  2GU9 A;  3AB0 A;  3ABZ A;  4YW7 A;  4CDU C;  1MZE A;  4MET A;  3USU A;  1W6P A;  3BPZ A;  3FFZ A;  5FZH A;  4HET A;  1W2U A;  2VOT A;  3ECQ A;  4XTM A;  2DVG A;  2IFW A;  3VZN A;  1R64 A;  1QJF A;  4LBJ A;  4SLI A;  2VW1 A;  1J3Q A;  4I0W B;  1DQ2 A;  1KEX A;  4XAB A;  1YXW A;  5LK7 B;  4J25 A;  1I6X A;  2D98 A;  2HWD 1;  3LEG A;  1H0B A;  3ILF A;  4COY A;  1YIP A;  2BP6 A;  2R0F A;  2Y64 A;  4AED A;  5CAZ A;  3FN9 A;  4QX8 A;  3OUI A;  3UES A;  4YZ3 A;  4NHY A;  1LHN A;  3UK9 A;  3E5U A;  1R09 3;  2DDU A;  3WF0 A;  1S0E A;  2JIC A;  3WQ1 A;  2Q5T A;  3GNE A;  1ENR A;  4QQ2 A;  4XUT A;  1F9K A;  5IYY A;  2WKK A;  4B7E A;  1Z7S 2;  3AP7 A;  1S0F A;  4XTP A;  4LBM A;  4WM7 A;  2UU8 A;  3VBF B;  3O1R A;  1Y9M A;  1TG7 A;  5DG2 A;  2ZTN A;  1KIT A;  1SMV A;  1AJO A;  3OSD A;  2QQU A;  4ET7 A;  2QFE A;  3S5A A;  1JYW A;  3E6D A;  3R05 A;  5FZD A;  4WM7 C;  3VBO A;  4CXX A;  1SLI A;  2KA3 A;  2VD7 A;  5LA9 A;  4PLM A;  5FZ9 A;  1ZRC A;  1JHJ A;  4RQP C;  5C5U A;  1MS8 A;  2QDR A;  4AVB A;  1IPS A;  3I2H A;  5C7G A;  1NQJ A;  5KXC A;  1HRV 1;  1QJY 3;  1RXG A;  2DCT A;  2WWU A;  4P9I A;  1LB2 A;  3VZO A;  2R6Q A;  1OT5 A;  1PNG A;  2C0Z A;  2KM2 A;  3BCW A;  1W04 A;  3MV1 1;  4LPL A;  4BMB A;  4QPI A;  1PGL 1;  1ODM A;  3MEP A;  3Q8E A;  5FLH A;  4Y33 A;  1BK1 A;  3DV8 A;  3LF7 A;  4C1W A;  4EWA A;  5F37 A;  5HXM A;  3PIG A;  3S57 A;  1N3O A;  1D4M 1;  2CSG A;  5AFB A;  1ULP A;  4A42 A;  2PAK A;  4Y1Y A;  5I0S A;  4LIU A;  1PGW 2;  1OSG A;  1XE8 A;  1V6N A;  2IUW A;  4L11 A;  1Q5O A;  2W1W A;  4Y26 A;  2HWE 2;  2RM2 2;  2ZX2 A;  1HB1 A;  4HZF A;  4JRL A;  5GKA C;  3VD4 A;  3KWV A;  3DKW A;  1T6G C;  4GWI A;  1BEV 3;  3E5X A;  2EF6 A;  2E7T A;  3IN9 A;  5FO7 B;  5K0U B;  4IEV A;  1C5H A;  1ULE A;  4MXW A;  2Y8K A;  4ISQ A;  4N43 C;  2WAA A;  3NAP B;  4X8P A;  1W8H A;  2RM2 1;  2B42 B;  2GNB A;  1AVB A;  2RR1 3;  1XYO A;  4Q4V 2;  5EZW A;  2Q8E A;  4EWE A;  5FPU A;  1KDK A;  4XF9 A;  5FYZ A;  5LEJ A;  2WUH A;  1S55 A;  1RUF 1;  2Z42 A;  2W08 A;  5C6C A;  4Q4W 1;  3VBO C;  1CN1 A;  3PVN A;  5GLZ A;  4OHY A;  4XUR A;  4E8D A;  2YV8 A;  1YQC A;  3ELN A;  1HB4 A;  1KS4 A;  3H50 A;  3HJR A;  1OD5 A;  1F15 A;  3NKT A;  5IJR A;  3ILR A;  1GWL A;  4FQ4 A;  4PI2 A;  5F5I A;  4FTB A;  4J1X A;  4WBB A;  2XVG A;  4O61 A;  3ZR5 A;  3ZLI A;  3WDW A;  5K9Y A;  5K0U A;  3QLQ A;  4IEW A;  4RGK A;  2HBT A;  2V5D A;  3A22 A;  4N90 A;  3APB A;  5FZ3 A;  1ZRF A;  1CAW B;  2ZHN A;  4LA3 A;  2DVA A;  2I07 B;  4RGG A;  4E9K A;  2Q4S A;  1PZ8 A;  1QWR A;  1YRZ A;  1C28 A;  1W8T A;  2QQJ A;  3DYO A;  4R9C A;  5C3Q A;  1YFX A;  2XON A;  4HMZ A;  2YFZ A;  3EXU A;  3PU3 A;  4MHR A;  4RA0 A;  5KC6 A;  1RUG 1;  3HD8 B;  3L9J T;  3O1V A;  5EJ1 B;  3DXT A;  4DXT A;  4XHX A;  1GZ9 A;  1E5I A;  1IOA A;  1VBE 2;  1WMF A;  1ACC A;  4FAH A;  4YZ1 A;  1UZZ A;  1Z7S 1;  2ZBJ A;  5EQU A;  5FK8 A;  2PHR A;  4K1Y A;  4DPN A;  1JOD A;  1GLH A;  3IDB B;  3L2Y A;  2GAU A;  2Y6G A;  3UT0 A;  3POJ A;  3OBR A;  2WA4 A;  2VZV A;  3W5N A;  1XYP A;  3GCW A;  1DIW A;  4WVZ A;  3HT2 A;  5FZ6 A;  4U2A A;  5FXV A;  1BBT 2;  5H9P A;  3TOJ A;  3NL1 A;  2D97 A;  3DPR A;  4KMQ A;  5A7N A;  4NIA A;  4DZG A;  2YUE A;  2NZ9 A;  4HBN A;  4QAW A;  2ZGT A;  5APA A;  4XEZ A;  2SLI A;  2VBD A;  4AHY A;  1ASJ 3;  2DF7 A;  3HAG A;  4UW4 A;  5JCT A;  1Y43 B;  4CA9 A;  1MS9 A;  3PHM A;  3KB5 A;  3MGU A;  2ZAB A;  3HIF A;  1AYN 3;  1ENQ A;  1RVF 2;  2EAA A;  4MGI E;  5A3P A;  1T6B X;  4DFS A;  1JN2 P;  2LM3 A;  4HG6 B;  4UF0 B;  4V2V A;  5FZ8 A;  1V6O A;  5JOX A;  2Y6J A;  4ZS3 A;  1WCD J;  2ZJC A;  3TEZ A;  2YPD A;  2QBX A;  2Q30 A;  1IKP A;  3AL5 A;  3B9I A;  3W59 A;  4E4D X;  3KHC A;  5L73 A;  2WNU B;  5A3L A;  4BDV B;  4MAD A;  2FCU A;  1S0J A;  1DHK B;  2BJS A;  2BOI A;  1O59 A;  1VRH 3;  5FUP A;  1UXZ A;  2XR4 A;  2WSV A;  4D94 A;  2EXI A;  1LAJ A;  4XFG A;  2XOM A;  1NXD 1;  3AP4 A;  1OUX A;  1TME 1;  1SLC A;  5LBC A;  2Q8O A;  3WNL A;  5ACA 1;  4FOW A;  4G9S B;  1BXH A;  1B35 A;  2XG3 A;  3VD5 A;  1I3H A;  1QJY 2;  2YXS A;  2PLV 3;  2A7A A;  1I5Z A;  2IVI B;  4QGN A;  4BIO A;  5FJK A;  1ALY A;  2WZR 1;  3GGL A;  4ATE A;  1SHW B;  5IHR A;  1OQD A;  4JGY B;  2NMN A;  3IZO A;  3R0R A;  1ZZ9 A;  4YW4 A;  2PLV 1;  4S2H A;  1J59 A;  3N9M A;  3SH3 A;  1V9U 1;  2BDR A;  5DG1 A;  4BH9 A;  5C9A C;  3OF1 A;  2BGC A;  2J1E A;  2P3J A;  3BB6 A;  2VM9 A;  3AXD A;  3RI9 A;  1IQA A;  2LAL A;  4BLJ A;  2FDF A;  1UY4 A;  2HWF 2;  2PHX A;  3MBW A;  2VPV A;  5K7P A;  1N1V A;  1IPJ A;  2PMW B;  1XRU A;  4QMA A;  1AYM 1;  3ZFG A;  4EN8 B;  1H6Y A;  1VBB 1;  4DEV A;  1PX4 A;  2ZX1 A;  5FBJ A;  4FPL A;  4GMP 1;  3RG0 A;  1NQD A;  1RUD 1;  2RS5 2;  2R04 3;  3DXU A;  4QQL A;  3AK0 A;  3WR0 A;  1AR7 2;  1J3R A;  3TN9 1;  2ZA9 A;  1W90 A;  4R9B A;  3VKN A;  1RYY A;  1H2L A;  2GAL A;  2VZO A;  4XAE A;  3UGF A;  1W0O A;  3VDB A;  4RR3 C;  1VAK A;  1J83 A;  1DG6 A;  5DMY A;  3TYJ A;  5J96 B;  1O5U A;  1S1A A;  4PT6 A;  4Q4X 3;  3VBR B;  1QXP A;  3GBW A;  2XBO 1;  1AR6 3;  2SBA A;  4ZXK A;  1YEW A;  4MXW B;  1VBA 1;  1ZBE 1;  4XJZ A;  4UFJ A;  2IFR A;  1RUJ 3;  2G19 A;  1LEN A;  3ENR A;  2VBB A;  1VBA 2;  1CPM A;  5FBZ A;  3BUC A;  1AR9 2;  1OLM A;  2EIB A;  2VMH A;  4LBQ D;  4UFH A;  3ZIX A;  3VL8 A;  2OUJ A;  1UYZ A;  2HEW F;  2LRP A;  2O1Q A;  1NT0 A;  4H7M A;  4XOG A;  5FZO B;  3NNJ A;  4OHX A;  3C7G A;  3J7N A;  2VC9 A;  3BU0 A;  3AFK A;  1GNZ A;  2J42 A;  3BIE A;  5FZK A;  3PJY A;  3H3L A;  4MZU A;  4ZY9 A;  5L9R A;  4BWO A;  1LOF A;  2NN8 A;  2ILM A;  1ODN A;  1GZT A;  1VE0 A;  3D3A A;  1N1T A;  3IMN A;  4JQT A;  2B5H A;  3K48 A;  3RFR A;  2RMU 1;  1G9B A;  4I3G A;  1UPI A;  1VBD 3;  3J8F 3;  1G8W A;  2JG8 C;  2IVJ A;  4FOV A;  2VBP A;  3ES4 A;  3MYX A;  5FPB A;  5KHH A;  3WP3 A;  2ZGQ A;  4XE9 A;  3LFM A;  5T54 A;  4DY5 A;  4CTE A;  4K40 A;  2XBO 2;  4DB5 A;  1UOF A;  5JOY A;  3MW4 A;  2HWF 1;  4X8N A;  4UFM A;  4IE4 A;  1OH3 A;  1DQ6 A;  3HN3 A;  2ZKL A;  4IE7 A;  2W9X A;  1P8J A;  2P6H A;  3VBR C;  5FYB A;  5JAX A;  4LOT A;  1RXF A;  2RJK A;  5GZG A;  2ARC A;  3WW1 A;  3CIH A;  1J1L A;  2ZGS A;  1ZRR A;  1XC6 A;  5IVE A;  1GKB A;  4DUW A;  1MAC A;  2YY1 A;  1V9U 3;  1DQ1 A;  3DPR B;  1UY0 A;  4C0B A;  4Q4V 3;  1FT9 A;  1C4R A;  5FZG A;  3VB9 A;  2PFW A;  2FQP A;  4N9I A;  4JV4 A;  4P9Y A;  1SEF A;  2ZGK A;  3NO8 A;  3CU7 A;  4JX0 A;  5AVA A;  4P9L A;  1DF0 A;  4OQ9 A;  5FY0 A;  1X9T A;  1H30 A;  1RTV A;  2A3W A;  3KF5 A;  4LK7 A;  2A6W A;  2QCS B;  2WQ4 A;  3ETQ A;  2QVS B;  2JDK A;  3J4U H;  4PDW A;  3W20 A;  3HN1 A;  5F39 A;  2ID4 A;  2DVB A;  1R08 1;  4XXA A;  5F9T A;  3RZK A;  1W6Q A;  1E5R A;  3OGV A;  2RS3 3;  3JZV A;  2Y34 A;  3NJY A;  1UOJ A;  3Q8B A;  2XML A;  3AYA A;  4QU1 A;  2GMM A;  4LBN A;  4E27 A;  2BPA 2;  3EYP A;  4ARY A;  1UAI A;  1SPP B;  3NJX A;  4BQ5 A;  2VXR A;  3WNN A;  3GYD A;  1HJF A;  1DLC A;  1F5F A;  1JW6 A;  1ZZ6 A;  5JIA A;  3FX3 A;  4AYU A;  4QKF A;  5ABJ C;  1E5H A;  2R0H A;  3OY8 A;  4N53 B;  5C4W A;  3SMH A;  1A34 A;  5A7W A;  1DLL A;  1QJX 2;  3IM0 A;  4GA9 A;  4NPL A;  3T1L A;  4X6R B;  3VBU A;  1N1S A;  1IHM A;  2BBV A;  3VBF C;  1UCX A;  1XB9 A;  2JDY A;  4CCL A;  4BK4 A;  3V0A B;  2JG9 A;  3RYR A;  5A7W B;  4IEX A;  3VLB B;  3PIJ A;  4BME A;  3WHU A;  1LCL A;  4R9A A;  5HV0 A;  4AEK A;  5I8T A;  3NNF A;  2Q8C A;  2CY6 A;  3UET A;  1K42 A;  5KBF A;  3NNM A;  5FKC A;  3T1M A;  4Q5O A;  4LHN A;  4DUV A;  2ENR A;  3HOB A;  1ULO A;  1UY3 A;  3QD6 A;  3POI A;  1QJZ A;  4L92 A;  4RHV 1;  4CSW A;  2YC0 A;  3WQ0 A;  4E2S A;  4EWD A;  1MZ6 A;  5CNA A;  1HDK A;  5FXX A;  5CVR A;  5A7O A;  4IXL A;  5FK7 A;  1QXR A;  1VAL A;  1X8E A;  2P5B A;  1GZW B;  1WCQ A;  2VAU A;  2A6Y A;  2W91 A;  3HBZ A;  2WT1 A;  4IV3 B;  5FY4 A;  5BV6 A;  4OHZ A;  2YC2 A;  3UNP A;  2VO5 A;  2W3J A;  5SV8 A;  2CGN A;  4MGT A;  1CX1 A;  3FUO A;  3WP5 A;  1RIT A;  3HQU A;  1HV1 A;  1UU5 A;  1DQ0 A;  3DKQ A;  3KD4 A;  5F2W A;  4K8F A;  4DIQ A;  1RUC 1;  2PQQ A;  4FVV A;  3POB A;  2W39 A;  1CES A;  1WKY A;  1OF4 A;  1A78 A;  1S2B A;  3JD7 1;  5C8C B;  4YVW C;  1ULG A;  1EP0 A;  4OUL A;  2XKP A;  4B8E A;  4IUG A;  1UZV A;  1ONA A;  1GOF A;  2EIC A;  1LRH A;  4NOT A;  4P9W A;  4Q1R A;  4LBQ A;  4A6O A;  1GZW A;  4DXZ A;  4YM3 A;  2JJ6 A;  4Q4V 1;  2WZ8 A;  3QOP A;  2I45 A;  2I74 A;  3U11 A;  1VB4 A;  2XQX A;  4TN7 A;  4AHW A;  4B3N A;  3JD7 2;  1ND2 B;  3VHP A;  2Y6H A;  2A6Z A;  5JPN B;  4IQP A;  4Y1X A;  1POV 3;  1SG3 A;  2VOK A;  3PJQ A;  5EYY A;  4MVT A;  4AGG A;  1DP0 A;  2BFU L;  1ND2 A;  1O4T A;  2VME A;  4GB3 2;  2FCV A;  3E97 A;  2XWJ B;  3WIN E;  2D40 A;  4Y20 B;  3TB0 A;  5GZE A;  3ZFF C;  1W0N A;  2VU9 A;  3K3O A;  4CDX B;  4C0H A;  4YZ2 A;  1PK6 C;  4UFI A;  1HW5 A;  4WVM A;  1OOP C;  1RVF 1;  4COU A;  3JBG 2;  5DUU A;  1FNZ A;  5F5Q A;  1GR3 A;  1GU3 A;  5CFD A;  4Q0S A;  4W6Y A;  3V0B A;  4C91 A;  3AM2 A;  1OUR A;  2OT7 A;  2W92 A;  2OXB A;  5EYX A;  3UJO A;  5F7U A;  2J1U A;  3FZ3 A;  4E4H A;  3MIH A;  5CFD C;  1O3S A;  3UKV A;  3BTY A;  4LQR A;  2XUE A;  3PU8 A;  1POV 0;  1HQW A;  3T0A A;  1RED A;  2OZJ A;  2WII B;  3FE5 A;  3PUS A;  4IE0 A;  4WVV A;  1STM A;  1JZ8 A;  3DGT A;  2WS9 3;  4RHV 3;  3RWK X;  5FMO S;  4XF1 A;  1UOG A;  1ZRD A;  5JOZ A;  1WBF A;  2BQP A;  4YVW A;  5T52 A;  4AQS A;  4M3C F;  1BK0 A;  2WAO A;  2WJS A;  3KVB A;  4KG0 A;  3EMR A;  2R06 1;  4CPB A;  3MIB A;  4Y22 B;  1LU1 A;  1IGO A;  5FPZ A;  2HWB 1;  5CA6 A;  1SDD B;  4BXS V;  5A70 A;  3LB9 A;  4IND A;  2ZMK A;  5KXD A;  2Q1F A;  1DFQ A;  5BY5 A;  3AZV A;  4YRD A;  3V0B B;  1NX9 A;  3SCG A;  4R8H A;  1BBT 3;  2WFF 2;  2BUK A;  1ZRE A;  4ITC A;  2FBE A;  3CO2 A;  4IEZ A;  1O3Q A;  4XBQ A;  5DDJ 3;  4RGA A;  1FAY A;  1W99 A;  1VRH 2;  4QHB A;  1QEX A;  4K20 A;  4Q0U A;  3P5B A;  3HQX A;  3U07 A;  3JB4 C;  2WO3 A;  4JHT A;  3UV9 A;  1JXN A;  1MZ5 A;  3I97 A;  5LY2 A;  3E6C C;  1KRI A;  1YFU A;  4HK9 A;  5CKM A;  3T0D A;  1BVV A;  4R4Z A;  4XQD A;  3TN9 2;  4GJY A;  4N9H A;  3AYC A;  3NV3 A;  1LTE A;  2YBP A;  2IXK A;  2ZGM A;  1WWY A;  1F31 A;  1Q56 A;  4QU2 A;  4Y24 A;  3I2K A;  2VZ1 A;  3JBG 3;  2VOW A;  3KV6 A;  3LGR A;  1JYN A;  4FPJ A;  4FPE A;  1SDW A;  3PUI A;  1HLC A;  4RFR B;  5LK5 A;  1RUD 3;  4LKF A;  4NRO A;  3INA A;  5CG9 A;  4BOW A;  4BQ1 A;  1JZ2 A;  1VBB 3;  4PIZ A;  3R4S A;  3ZYH A;  1F2N A;  4KBB A;  3ZSL A;  5IVC A;  1CAX B;  3K4D A;  3BN6 A;  2YYO A;  2JE8 A;  2UUR A;  2D43 A;  2EXJ A;  2R49 A;  3LDB A;  3LQC A;  3MPP G;  1UIK A;  2DUO A;  4PLO A;  1GZC A;  4UT5 A;  5I93 A;  2PLV 2;  2YG0 A;  3MI8 A;  3NAP C;  2D6P A;  4YGD A;  1UYY A;  2JG9 B;  2OS2 A;  3RNS A;  4IW3 A;  2Y0I A;  4GH4 A;  2Q1M A;  2PAM A;  4PHZ A;  5CIS A;  5GZC A;  4DXR A;  1RJ7 A;  1R1A 1;  2W87 A;  2YBK A;  4CEW A;  4CDQ A;  1FX5 A;  4KBZ A;  1Z7S 3;  2H6C A;  5FTT C;  1A8D A;  4N8M A;  1H2K A;  5DAV A;  1US3 A;  3KS7 A;  4XIK A;  5FP3 A;  4NII A;  3IAP A;  4CRQ A;  5JUV A;  1N1Y A;  4A3X A;  2IXJ A;  1OVP A;  3WG4 A;  2WFP A;  3N9P A;  2XJT A;  3WNM A;  5FZC A;  1TMF 1;  1GWM A;  1LHU A;  2ZKN A;  2D7F A;  5IT6 A;  4XPV A;  3RVH A;  3T30 A;  3N7K A;  4OMD A;  2X09 A;  2BRT A;  3T09 A;  3ZXE A;  2YU2 A;  1QXJ A;  4HKL A;  1F4H A;  3GBF A;  3ZN4 A;  2VW0 A;  2XJS A;  1PGS A;  2IWG B;  2WA3 A;  3RRD A;  3B9C A;  4QDQ A;  2RG4 A;  3ZFF B;  1XQN A;  1W8U A;  5DZF A;  5D1I A;  4OZO A;  3TNQ A;  4CYD A;  2VJX A;  4QQH A;  1DU3 D;  1HV0 A;  3OJB A;  3VKO A;  5C8C A;  2GNT A;  5BNO A;  5JSO A;  2UWC A;  4IEQ A;  4XXP A;  4ZKT B;  4ZU4 A;  2JE9 A;  2RR1 1;  1G6N A;  2BGP A;  2OX0 A;  3O5S A;  3FBY A;  3IT8 A;  1JYX A;  3ZXJ A;  1UQX A;  2VUA A;  1R1Z A;  3HR9 A;  3VZL A;  4CEW C;  2WC2 A;  1JYV A;  2ES3 A;  5CYY A;  2J1T A;  3CEW A;  2WO7 A;  3GJA A;  1O4Y A;  2MPF A;  5LRR A;  5L7O A;  4LLF A;  3ZFE C;  3AYD A;  4EN9 B;  5F32 A;  3ZYG A;  4WVW A;  5DDJ 1;  1TNR A;  1SZB A;  1HB3 A;  4K21 A;  3W5M A;  4R52 A;  1SCR A;  1JMU B;  2W1U A;  1AZD A;  2CU5 A;  2W1Q A;  4UFL A;  1AXZ A;  4LMF A;  3WT3 A;  1JU4 A;  1HRI 1;  3MID A;  1CAV B;  1DYO A;  1VBE 1;  2A1X A;  3NNL A;  3I49 A;  1LES A;  1AX1 A;  3CJI C;  3N7L A;  1WD3 A;  3VKF C;  3VHN A;  4ES8 A;  2JDH A;  1YWK A;  3R4U A;  2E51 A;  2BER A;  3SLI A;  3T2T A;  4C8D A;  1KDM A;  2OII A;  2VZU A;  3ZOI A;  3I3B A;  2UY9 A;  2WWJ A;  1C3H A;  1QF3 A;  1FV2 A;  3ACG A;  5FYY A;  4D6S A;  5E8A A;  3UL2 A;  5HBA A;  1ZVF A;  4QPI B;  1U5I A;  5AFE A;  3UGH A;  5KXE A;  1BMV 2;  2YZ4 A;  5JMO A;  2QE3 A;  1UO9 A;  1S0D A;  2VCM A;  5IFT A;  3MV0 1;  1RUE 2;  5JXI A;  4CDX C;  2YHJ A;  3AZW A;  4GAZ A;  3SC7 X;  1VBC 1;  3U0Z A;  5FFO C;  5A6Y A;  4CXY A;  4ZHN A;  4DEQ A;  2QJV A;  5FMB A;  4W4Z A;  2WBK A;  1UU6 A;  2C26 A;  1R1A 3;  1IG3 A;  4JDN A;  4MLO A;  4AOC A;  4KG8 A;  4RD7 A;  1WMX A;  2CWM A;  1UMI A;  4HAN A;  1DBN A;  2AZ5 A;  1XOY A;  3FHI B;  4AEM A;  5FY7 A;  3SQO A;  1H1M A;  1YC6 1;  1RUI 1;  2V4V A;  2YDE A;  4QX0 A;  1TZO A;  1GIC A;  1ASJ 2;  4NHM A;  1CQ9 A;  5C4W C;  4MX3 A;  1Q8O A;  4JQR A;  2P4E A;  1UXX X;  5FCC A;  1PZ7 A;  3WDU A;  3GHM A;  3LPG A;  4KNC A;  5FQ0 A;  2OVU A;  2UWB A;  5AC9 2;  4PBO A;  4FTE A;  1VAM A;  4WM7 B;  4NAO A;  3SCF A;  2JDZ A;  1XXN A;  2DVF A;  4YVS B;  3VKL A;  3ZVX A;  1TE1 B;  2HKX A;  3A23 A;  3WP6 A;  4QX3 A;  5JMC A;  3VBS B;  3MPB A;  3OGR A;  4Q4X 2;  3OBZ A;  3IMM A;  2NQY A;  1F8V A;  4XCA A;  3MF6 A;  2VZP A;  4GQ7 A;  1ND3 A;  3U4X A;  2XJV A;  4IV3 C;  3VZJ A;  4W6W A;  3DUI A;  1AF9 A;  4ZZ5 A;  3UYJ A;  1H8T C;  3WUC A;  2VVE A;  5FOJ B;  3PVB B;  2Y6K A;  2RS5 1;  3N36 A;  4TXW A;  3NW4 A;  2D93 A;  5FZ4 A;  2XH6 A;  4CCE A;  5FZM A;  1L7Q A;  2TBV A;  4QB2 A;  1QY4 A;  5FQ0 B;  1MEC 3;  5M0T A;  4W8J A;  2PAE A;  2NYY A;  4GUL A;  1AR8 2;  4K9S A;  5BNP C;  4QPG C;  5FY5 A;  1LEM A;  2I2S A;  3SXW A;  2ARX A;  2RDS A;  4BU2 A;  1BJQ A;  1EV1 1;  3B5L B;  3KZ4 C;  3MFA A;  4TWT A;  5JR7 B;  3VDD A;  5A3W A;  2VMC A;  3OTF A;  4LKS A;  5DAX A;  4CDU B;  5DDJ 2;  4YAR A;  1AL2 1;  2Q8D A;  2G9Z A;  3TWI A;  3LIH A;  2Y26 A;  3SEP A;  3ZN6 A;  4FAG A;  3AMN A;  1HKD A;  1LOB A;  3N9N A;  3WSO A;  3VUO A;  3E1F 1;  1G86 A;  3NAP A;  3AVS A;  1TME 3;  3ME2 A;  3QH6 A;  5E88 A;  4W65 A;  4ZON A;  2X53 S;  4P9X A;  1YJK A;  5JXG A;  1QQP 3;  1L3J A;  2EXH A;  2W46 A;  4OFG A;  4QXK A;  3FLP A;  2FCT A;  1VR3 A;  3GBG A;  1UZY A;  1EUT A;  2ORZ A;  1JS9 A;  2VVD A;  1RHI 3;  2WR9 A;  4IEY A;  2ZHL A;  2DUR A;  1VIW B;  3VHO A;  4I0B A;  3SEE A;  1H1I A;  1Q43 A;  2GDF A;  4CP0 A;  5IVF A;  2WQZ C;  3A7Q A;  3D82 A;  4YNI A;  4IGO A;  3ZKU A;  2PQS A;  4YLZ A;  4RN5 A;  2R30 A;  3U75 A;  2XPJ A;  4S2G A;  4LTA A;  5DAQ A;  1W8Z A;  4J1W A;  5FRE A;  5J48 A;  3U1X A;  1WLD A;  4AXO A;  4PIY A;  4Q2F A;  2YC4 A;  2W95 A;  1IS4 A;  4PF1 A;  1RUJ 2;  3AKQ A;  3IDE A;  2VZT A;  5JZG B;  1LNS A;  3C3V A;  3Q9O A;  2MEV 3;  4D3W A;  1COV 1;  1QGL A;  2B4K A;  2R1B A;  1EAH 1;  1DGL A;  2C24 A;  2X29 A;  1W9F A;  5A7P A;  3RJR A;  1JUI A;  3GZU C;  1UZW A;  3WZ1 A;  4NUB A;  3HNB M;  1W6P B;  2BVV A;  3IPV B;  3N35 A;  3MW2 A;  4GH4 C;  4LO8 A;  3F95 A;  3VBS C;  2QZ2 A;  1RHI 1;  5FYC A;  3KCC A;  1VBD 1;  2HWE 3;  1O91 A;  1RUC 3;  3D6E A;  4HLT A;  2GC2 A;  4S2F A;  2O8O A;  4BK5 A;  5J3U A;  1OA3 A;  1RUE 3;  3N7J A;  4Y3O A;  3BTX A;  3AKS A;  2VUD A;  4Y1U A;  1XNA A;  5FYU A;  4CUB A;  2VY0 A;  2D6M A;  3M7A A;  5I0U A;  2HYK A;  1I9R A;  2HWC 1;  3MIE A;  1Q8P A;  1JZ5 A;  2VTX A;  1JZ4 A;  3TEY A;  2VW2 A;  4ERO A;  4PCR A;  5HPO A;  5JIU A;  1U0A A;  2HEV F;  3MFC A;  1NKG A;  4CCJ A;  3E5Q A;  3KV4 A;  4GJZ A;  4I3P A;  4YW1 A;  5GM0 A;  5JR2 A;  2ETE A;  4RQP A;  3BOW A;  1W8W A;  2GNM A;  3NQH A;  2BVB A;  2P3K A;  4I0A A;  4C1X A;  4F83 A;  1REF A;  5BNN A;  3RZG A;  4NIH A;  4LKD A;  1YLL A;  1WCU A;  3T08 A;  1EUU A;  4D6Q A;  3ZXL A;  2WWS A;  3VBF A;  3ZSE A;  3A0K A;  4FCA A;  1AXK A;  3CMG A;  2YGM A;  1GP6 A;  1LOA A;  3G6J B;  4QPI C;  5CFC A;  3M1H A;  2Y38 A;  1WME A;  3AMP A;  2VQA A;  3LA2 A;  3P6B A;  4AK3 A;  2FZ1 A;  4E2G A;  4A7Z A;  1ZBE 3;  2R7E B;  2UY8 A;  4AI9 A;  1UX6 A;  5FPA A;  1OHF A;  4YFZ A;  3J7H A;  2D5H A;  3CL1 A;  3DN7 A;  4UW6 A;  2QUO A;  4XBL A;  3U10 A;  2H0V A;  1AL0 G;  3RI8 A;  2V09 A;  1W6M A;  2JDU A;  1OLQ A;  1GBG A;  4YW6 A;  3I3E A;  4UW5 A;  1PMI A;  3B94 A;  4YGB A;  3WG1 A;  4XDO A;  1DQ5 A;  3HNY M;  5JWP A;  4MUV A;  4XET A;  1VP6 A;  4XJU A;  3UKT A;  1FOD 1;  1U12 A;  1KJR A;  2YFU A;  2J1R A;  3D4K A;  1RJ8 A;  2XHK A;  3POG A;  4AI2 A;  4QPY A;  1DCS A;  3B01 A;  2B46 X;  4FI9 A;  2E31 A;  1AR8 1;  1IS6 A;  5T5P A;  2OZ6 A;  1OKQ A;  2OA2 A;  1WW6 A;  1CAW A;  3WCR A;  1JYI A;  2VMG A;  1DDL A;  3J7L A;  2V72 A;  4QT6 A;  5IVB A;  2QZ3 A;  2JG9 C;  1NA1 C;  2WZR 2;  5IK4 A;  1S0C A;  2P37 A;  4L9B A;  4H55 A;  4LHS A;  3Q8A A;  1HRV 3;  1QJY 1;  5D8A B;  4L0P A;  3ZM8 A;  2XL7 A;  3U78 A;  4LIV A;  4K6B A;  4EQV A;  5C71 A;  3GAL A;  4K1Z A;  3VZK A;  1CZV A;  5DAW A;  3ASI A;  4AWD A;  4FP2 A;  1HXS 2;  1KFU L;  4A7K A;  2BNM A;  5C9A B;  1X82 A;  1POQ A;  5KC5 A;  4HN1 A;  3LOB A;  1VBC 3;  1O3R A;  1QDO A;  2MEV 1;  2W1S A;  2VNR A;  3B69 A;  3I2I A;  5FZE A;  3H9A A;  3QAC A;  4N53 C;  5GLT A;  3NJZ A;  3POS A;  4BQY A;  1QKQ A;  5ABJ B;  2CAU A;  2ADE A;  4Z2W A;  2FZ2 A;  4QX7 A;  5FMO L;  2A6V A;  3HEI A;  4XIL A;  4XF3 A;  2RM2 3;  4AVT A;  1W6O A;  1OQ1 A;  1CR7 A;  4IL7 A;  3NRU A;  3ZO0 B;  4FFF A;  1WCS A;  5HXV A;  5C3P A;  3VHR A;  2BGO A;  5I91 A;  2F6B A;  3WXP A;  1Q8V A;  1QQP 2;  5FPX A;  2E63 A;  4DO0 A;  3O1M A;  2R16 A;  3LA7 A;  4OUE A;  2AAC A;  4AFA A;  1MVE A;  3H42 B;  3T4V A;  1WA6 X;  2QQI A;  4QDR A;  2OUH A;  3AL6 A;  2BYV E;  5FJH A;  1AYM 2;  1X7N A;  2QQN A;  4OUM A;  5I0D A;  1ZZB A;  4QXH A;  4QXB A;  5FMC A;  1C57 A;  4HON A;  2JDN A;  2FHR A;  5EHD A;  1LGC A;  2RV9 A;  2D6L X;  4DRR A;  1EPZ A;  5F6L B;  1BMV 1;  2X5I B;  3ZYB A;  3JB8 A;  2P3Y A;  3ZPY A;  4UXA A;  2GN3 A;  5LY1 A;  4GD4 A;  2WNV B;  3HT1 A;  3S7E A;  1LGB A;  4L2N A;  2C1F A;  4XDQ A;  1C8M 3;  1L7R A;  1UMZ A;  2VG9 A;  3SCH A;  5E16 A;  1O3T A;  2O14 A;  1ZBA 2;  4O7X A;  3H1M A;  3OYW B;  2A71 A;  4OHW A;  1GOG A;  1B35 B;  1OI6 A;  4E2Q A;  5LB6 A;  3T2P A;  1JZ3 A;  3BTZ A;  2RJL A;  3AMM A;  2VMD A;  1KJL A;  3GZE A;  3OGS A;  3OYW A;  1RUJ 1;  1YFY A;  2ZCW A;  2XL9 A;  1TME 2;  2ARA A;  2PHU A;  3AFG A;  2Y6L A;  5A6X A;  1W3X A;  3HMY A;  3LWC A;  2FDI A;  1VBA 3;  1RGS A;  3LDR A;  3NVC A;  4Q4W 2;  3LDK A;  5JOW A;  3W21 A;  3KSC A;  3MW3 A;  3K4Z A;  3QCW A;  1SFP A;  4A45 A;  2WNV A;  3IAQ A;  4CEY C;  4FPC A;  1LHV A;  1QNY A;  1ZA7 A;  2G4I A;  4IER A;  2HEY F;  1SPP A;  2BNN A;  2O8Q A;  3ZN5 A;  3DF0 A;  3KQ4 B;  3CHX A;  2IZW A;  4QPW A;  5FKB A;  5GLV A;  2A3X A;  3WQ7 A;  1H9P A;  1H2M A;  3AMQ A;  1NLR A;  3MIC A;  3QBQ A;  2K0G A;  3AXE A;  3MIF A;  4S2D A;  1NZC A;  2VCC A;  4EJR A;  1RUI 2;  3JQX A;  4LO4 B;  4MGK E;  2RHP A;  3G7D A;  3C7O A;  4E8C A;  1A6C A;  5L19 A;  4NAM A;  4YG0 A;  1AR9 3;  1BHG A;  1LU2 A;  3B93 A;  4NRQ A;  4PF5 A;  2RVA A;  5F5A A;  1AL2 2;  5CFC B;  5BUV A;  1EPW A;  2NMO A;  5EFU A;  3GCX A;  2GP3 A;  3O14 A;  1SBE A;  2HWE 1;  1N47 A;  3I2J A;  4IE6 A;  4LLO A;  4EZ4 A;  5FPL A;  3POF A;  3RZH A;  1QJU 3;  4QB1 A;  4UFK A;  3MLJ A;  5C8W A;  2R1D A;  3MF9 A;  4WZF A;  1BCX A;  4CDW A;  4QD2 A;  1R09 2;  4PLN A;  3KV5 A;  1PGL 2;  1CD3 G;  2BZD A;  3E6B A;  1WW4 A;  3JCI A;  4XF4 A;  5DZG A;  4LBQ B;  5E89 A;  5JI7 A;  3PUA A;  4AZZ A;  3IKW A;  2JX9 A;  2BOJ A;  3NMB A;  3OCP A;  4Q4Y 3;  1NLQ A;  3WF3 A;  3N4M A;  4Q1P A;  3AKP A;  3NKG A;  3H3Z A;  1SLT A;  3ACF A;  3I59 B;  4KL1 A;  2VZQ A;  3WDV A;  3ZFE B;  3Q8C A;  1OFN A;  4AQ2 A;  5LBB A;  1F4A A;  3VD7 A;  5A1A A;  5J1X A;  1WGP A;  3WF1 A;  5T55 A;  3MDP A;  4FXG B;  1V0A A;  3DL3 A;  3NST A;  3CJX A;  5DN2 A;  4QDS A;  4RHV 2;  2WDB A;  4D7T A;  1J84 A;  2WO2 A;  5FOB B;  3MZH A;  1QQP 1;  4IES A;  1VMJ A;  4JTN A;  1ASJ 1;  4EYU A;  3LEI A;  3FJS A;  2BWA A;  2WIN B;  4UAP A;  4XQ4 A;  1UN1 A;  3O1O A;  4P9G A;  2A5Z A;  3N9O A;  4HVR A;  3O1S A;  1QOO A;  1XE7 A;  2RDR A;  1QNW A;  2QQM A;  2NLR A;  1UYX A;  5GZD A;  2EXK A;  1Z0H A;  2DUP A;  2R06 3;  5A3O A;  1ZA4 A;  2WFF 3;  4JCK A;  3R6S A;  3HWJ A;  1ZZC A;  5L9V A;  2W68 A;  5KXB A;  4MOA A;  4BA6 A;  4XAC A;  4D8M A;  3KT1 A;  3LEK A;  1VLN A;  1XPW A;  4NWV A;  2CDO A;  2BW8 A;  3HNM A;  1NE4 A;  1F35 A;  2XKO A;  1XJA A;  2VNG A;  2P2K A;  1PVC 3;  3OEA A;  4LKE A;  4NJ4 A;  2WZP P;  4AED C;  2F17 A;  4P00 B;  2E53 A;  3LE0 A;  1X36 A;  4CCN A;  2WS9 2;  1NCQ C;  1IPK A;  4GWJ A;  1CIY A;  1QH6 A;  3FBM A;  4FT8 A;  1W03 A;  1QJU 1;  1ZYB A;  5L9B A;  5FLJ A;  2EID A;  4IGQ A;  4PBP A;  4Q29 A;  4YW2 A;  1ZBA 1;  4BXF A;  2V73 A;  3I3M A;  4OMC A;  4FOY A;  2R07 2;  3AX4 A;  1C5I A;  4MGZ E;  2PYT A;  4WM8 A;  5H9R A;  4GMP 0;  2HWD 3;  3BPS A;  4TLF A;  5T5O A;  2XDV A;  2DU1 A;  2ARE A;  2XGX A;  3D0S A;  5IK7 A;  1AYN 1;  2QQO A;  4HKW A;  1WLW A;  3RMY A;  1UPS A;  5CFD B;  1QOS A;  1A3K A;  3OOX A;  2PXJ A;  4Y5T A;  4LE3 A;  5GAL A;  5FO9 B;  4DUX A;  3B02 A;  3K75 B;  4B4P A;  3DEM A;  2WRA A;  2RS1 1;  1KD7 A;  1NA1 A;  5A3U A;  5C4W B;  3ACL A;  3M2M A;  4ES9 A;  4BYY A;  4HL0 A;  1NCR B;  1KGY A;  2XJR A;  4YWA A;  3IIA A;  3W58 A;  4D69 A;  2H6B A;  4BJ0 A;  2BTV C;  2QQL A;  1VBB 2;  2EAL A;  3JD7 3;  4N7I A;  1DZR A;  1MS3 A;  1OA2 A;  3WDX A;  2GMP A;  5A3T A;  3M3Q A;  2VCB A;  3CDZ B;  1SBF A;  2ZGP A;  1RMU 2;  3ILN A;  1OF3 A;  5C3O A;  4WM8 B;  1LHO A;  2R04 2;  3WCS A;  5FZF A;  2D5F A;  4IEO A;  5LA2 A;  3RMX A;  5FP7 A;  1UY1 A;  4NWW A;  3FHA A;  5KHI A;  4COZ A;  4GB3 1;  1XU1 A;  2JKB A;  3ATG A;  4R4X A;  1VRB A;  4P9J A;  1MQT C;  3V56 A;  1J58 A;  3III A;  1UU4 A;  5SV5 A;  1CAX A;  2JEC A;  1OA4 A;  4IV3 A;  1Y9G A;  2VOV A;  4PQ9 A;  1D0H A;  1GQG A;  1PIV 1;  1UX7 A;  5C8C C;  1VRH 1;  3NV1 A;  4HOO A;  4FPH A;  4H14 A;  4N53 A;  1QMJ A;  1OOP A;  2Z79 A;  5F3G A;  3M3C A;  3U37 A;  1NLS A;  1AJK A;  4GH4 B;  4RS5 C;  3ZYJ B;  3I3D A;  2EVX A;  3J7M A;  3UJQ A;  5ISL A;  4UI9 L;  5JSR A;  4MHU A;  3H8U A;  3CF6 E;  4FFH A;  5LAS A;  2BFU S;  1VMH A;  1N3Q A;  4LXL A;  4COV A;  4TLG A;  4O65 A;  4D0Q A;  4DS0 A;  5L7O C;  1YCI A;  4A3Z A;  3KT4 A;  1O8P A;  4CDW B;  5C3S A;  5JI9 A;  3H8R A;  2AEY A;  1OLM E;  4GWM A;  2PEL A;  4MGS A;  3ITQ A;  1H4H A;  2BWC A;  3CZU A;  1ZZ8 A;  3OD4 A;  1OPM A;  2WLP A;  4CCO A;  4IV1 C;  2C4X A;  1ZRI A;  2ZX4 A;  3S30 A;  3K77 A;  2PHF A;  2WFF 1;  3LIG A;  5C70 A;  3PMS A;  1YQ2 A;  2F4P A;  4DIN B;  5A33 B;  1MS4 A;  3AP6 A;  2AEZ A;  3M4F A;  4OI2 A;  4FXK B;  4O9E A;  1HJG A;  1RHI 2;  5A33 A;  3POE A;  1KXG A;  3BIW E;  3WNO A;  4URA A;  4M01 A;  4FPF A;  1FPN 2;  1X8M A;  1D4M 3;  5A1F A;  4XZU G;  2VVF A;  5TSW A;  1KFX L;  4WVM B;  3AP5 A;  1OD3 A;  2ZS6 B;  4XQW A;  4PIX A;  5FP4 A;  1MEC 1;  2D6K A;  2HWF 3;  3SH5 A;  2VUJ A;  1NCR C;  4BM8 A;  4GKX A;  3M3E A;  3ZSM A;  1HRI 3;  3IWZ A;  5D2A A;  3MHZ A;  4RS5 A;  2WL1 A;  2OYZ A;  2DV9 A;  3TEX A;  3H1W A;  1DYK A;  1V6I A;  1GV9 A;  3OBA A;  4KGQ A;  5D21 A;  2VL4 A;  4CUA A;  4YM1 A;  2VZR A;  3S6P A;  3KGL A;  1OUS A;  4XFF A;  4C90 A;  4AGV A;  5DUX A;  3TBD A;  1GNY A;  1GQP A;  2VTF A;  5IVY A;  3U4S A;  4CVU A;  4A44 A;  3N9Q A;  1AR7 3;  4BQW A;  4P02 B;  5FYT A;  2W52 A;  4LHK A;  1Y7B A;  2C9A A;  2XVL A;  4LO7 A;  2FD8 A;  4NID A;  5BNP B;  4JGZ A;  1GYK A;  1VMF A;  1T2X A;  2WYF A;  4ASK A;  1AL2 3;  1RMU 1;  5F5C A;  2CL2 A;  3H7J A;  3I2F A;  4HSJ A;  3A4U A;  4NRP A;  2VQU A;  1YQ8 A;  1G9A A;  2DCK A;  4IV1 B;  3KF3 A;  2CNA A;  5F2S A;  4DRV A;  2ZGU A;  5H9Q A;  1O7F A;  1IS3 A;  1RUI 3;  3THC A;  3QH7 A;  1K3I A;  1RUF 2;  4NPM A;  5FXZ A;  4AE2 A;  4ATF A;  3WF4 A;  2CWS A;  1YYN A;  4AFC A;  1J1T A;  4AG4 A;  2IXI A;  4EE2 A;  3I2O A;  4Q8L A;  5EWS A;  2WNE A;  4AVS A;  1COV 2;  1PM4 A;  4XCB A;  3N3H A;  1NYW A;  2W5F A;  3UGG A;  4CU9 A;  1K5M B;  1W3V A;  3O0V A;  2XLF A;  2Z5W A;  3PUH A;  5F3I A;  1VBD 2;  2ZHM A;  4IEU A;  4JGZ B;  1EV1 2;  1G9D A;  2ZEY A;  1YI7 A;  4YM0 A;  3D0J A;  2R32 A;  4CZS A;  1MZF A;  3AP9 A;  4QKB A;  3OUJ A;  2P34 A;  5FP8 A;  2OKX A;  3LFI A;  4FFG A;  5GLU A;  2DCZ A;  5CFC C;  1EAH 2;  1HB2 A;  1TMF 3;  1BEV 2;  3MLL A;  5A7Q A;  3SHR A;  2XVK A;  3P3N A;  4CE8 A;  4DNY A;  4KQ7 A;  2ZGO A;  3WEZ A;  1NCQ A;  1MQT B;  3IDA A;  5KWR A;  4AF9 A;  1W8N A;  4AED B;  5HCA A;  1JU3 A;  5FUI A;  1LOF C;  1XND A;  2GC3 A;  4Q0P A;  4D7Y A;  3PVE A;  3OGG A;  4GZ9 A;  5AVP A;  3FWE A;  4B1L A;  1SQ4 A;  4M3C A;  4YGC A;  1MS0 A;  1H2N A;  1E57 A;  2VZ3 A;  2GH8 A;  5E1R A;  5FIX A;  2J1S A;  4WM8 C;  2EIG A;  4ORF A;  1UYP A;  4LUL A;  1PO1 2;  4KWK A;  2ZHK A;  2DCJ A;  4M3C B;  5CKN A;  4RR3 B;  1R08 2;  1BVP 1;  4YPJ A;  3SIS A;  3VBS A;  4HSL A;  4JGY C;  5HI0 A;  1V6J A;  1O4Z A;  2J1A A;  2RS1 3;  2H0B A;  4JKL A;  4LNV A;  4DOU A;  4RFT 0;  5T5J A;  4LOS A;  3ES1 A;  5F1R A;  1LHW A;  4BZ4 A;  2CV6 A;  5GLW A;  3HQR A;  4WZC A;  1V6K A;  3CJI B;  4CDU A;  1YO8 A;  3H7Y A;  2YB7 A;  4GMP 3;  4XC9 A;  3ALQ A;  3WP4 A;  2NPI A;  4YW5 A;  4QX1 A;  1RUG 3;  4UOJ A;  1ULF A;  3ZDS A;  2E9Q A;  2ZEZ A;  4AI0 A;  5KHK A;  1AR8 3;  3WOG A;  5HCH A;  3ZXF A;  3PUQ A;  3JU9 A;  2WSU A;  3TNP B;  4AVA A;  2GC1 A;  4XUO A;  1MEC 2;  3F2Z A;  1PNF A;  1W6N A;  2HWD 2;  3CZJ A;  2G1M A;  3B3Q E;  4ZPI A;  4B1M A;  2WN3 A;  2X5I C;  2D3P A;  1W6N B;  5C33 A;  5LWB A;  2AR6 A;  2A73 B;  1V6L A;  3LOI A;  4JHZ A;  2NM1 A;  1WCK A;  1FMD 1;  1DZT A;  2LS6 A;  1IS5 A;  4Z92 B;  1AX0 A;  2OPK A;  2IXC A;  4KWJ A;  3O7O A;  5CIR A;  5CZK A;  4AI8 A;  1NE6 A;  1D7P M;  3RWN A;  1IQD C;  3CQO A;  4MH0 E;  4QB6 A;  4QKN A;  1LKN A;  2D44 A;  4A6S A;  1W2T A;  4P14 A;  2DYC A;  3ZIW A;  4TSV A;  1UMH A;  2AUY A;  4MSV A;  1CWP A;  3LPF A;  2FDK A;  1UIJ A;  3VBH B;  1G9F A;  4D7S A;  1PGW 1;  1EYB A;  4MYE A;  2PTM A;  3CNA A;  4YFW A;  1D4M 2;  1DQ4 A;  4WV8 A;  4X6Q B;  3RSJ A;  3VBH A;  2HWB 2;  2DUQ A;  1I1E A;  1V9U 2;  3BAL A;  1PK6 B;  4JDO A;  3WW4 A;  5JDB A;  5DPN A;  4AGR A;  4XFB A;  5CU1 A;  4CP9 A;  4M4R A;  2C9K A;  4NHX A;  4OHV A;  5JVV A;  1OMI A;  3BOP A;  3VBH C;  1N3P A;  2GN7 A;  2PN5 A;  1JZ6 A;  1YHF A;  1FAT A;  3OB8 A;  2RMU 3;  1Y9Q A;  2E7Q A;  2ERF A;  3IPV A;  4AHX A;  1W05 A;  2WYS A;  5A32 A;  1B09 A;  4IE5 A;  5I8Y A;  2VOX A;  4FPK A;  4KWL A;  4MV2 A;  3KQR A;  5C5T A;  2J22 A;  1AR9 1;  5A32 B;  1SFN A;  3EO6 A;  3DCQ A;  3JQW A;  1UKG A;  1WMD A;  3NJV A;  2B45 X;  5IAV A;  3RDI A;  5A6Q A;  1L7L A;  1W2N A;  1XNC A;  3I7D A;  2X10 A; 
#chains in the Genus database with same CATH homology
 1GZT A;  2JDH A;  1UQX A;  5A6X A;  2JDN A;  2BOJ A;  5A70 A;  2CHH A;  2VUD A;  2WRA A;  1OVS A;  1UZV A;  5D2A A;  4CE8 A;  2BP6 A;  1OUR A;  2BV4 A;  2VNV A;  3ZDV A;  1W8F A;  1OXC A;  5A3O A;  2JDU A;  5A6Z A;  1OUS A;  2WR9 A;  1W8H A;  2BOI A;  2VUC A;  5A6Y A;  1OVP A;  2JDY A;  2JDK A;  2XR4 A;  2JDP A;  3DCQ A;  4AOC A;  5A6Q A;  2JDM A;  4UT5 A;  1OUX A;  5HCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...