5A3OA

Crystal structure of the lecb lectin from pseudomonas aeruginosa in complex with methyl 6-(cinnamido)-6-deoxy-alpha-d-mannopyranoside at 1.6 ansgtrom
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a3oA00
1OXCA 1UZVA 5HCHA 2VUCA 2JDYA 5A6XA 1OVPA 2VNVA 1W8FA 1W8HA 1OURA 1OUXA 3ZDVA 3DCQA 1OVSA 5A6YA 2JDUA 2BV4A 2JDMA 2BOJA 2BP6A 4CE8A 2JDPA 2BOIA 2JDKA 1UQXA 2CHHA 5D2AA 5A6ZA 2JDHA 2XR4A 1GZTA 4UT5A 2VUDA 2WRAA 5A6QA 5A3OA 1OUSA 2JDNA 2WR9A 5A70A 4AOCA
chains in the Genus database with same CATH superfamily
1KEXA 4TLFA 4HANA 1CAUA 4Q27A 1R64A 2JE9A 1MQTB 3KWVA 3O7OA 1OVPA 4DINB 5FIXA 2WL1A 3FHAA 4QB6A 1S2EA 3LGRA 1Y9GA 5C3OA 2P1BA 3M3QA 4IV3B 1RMU1 5EJZB 1H6XA 5K0UB 3P6BA 3RI8A 1Y9MA 2VXRA 1ND2A 3UKNA 5KHIA 5GZDA 3U4XA 5CG9A 4IGOA 1DBNA 2JDKA 2VMCA 4L2NA 3MIHA 1UU5A 4XZUG 3POGA 3WP6A 4ZZ5A 1HRI2 1IG0A 1ULEA 1S55A 4R8HA 3WNLA 3RYRA 1ODNA 3Q8AA 4CXYA 5GLUA 2IXJA 1ENXA 1V9U3 1OLRA 2LM3A 5JOYA 2WUHA 2QQIA 2W9XA 3LKJA 4PIYA 3J8F3 3SCGA 4AVCA 1GWLA 2VNOA 4ZU7A 3I2OA 4LBLA 1OT5A 2CWSA 4FFIA 4Y5SA 3O1OA 2QZ2A 3A0KA 3HBZA 4EN0A 4HPKB 5FFOC 4XBLA 2PAMA 2VU9A 3OEAA 3AP5A 4Q4V3 1CIYA 1NX9A 3LOIA 4CDWA 1HKDA 2R072 4BQ2A 3VBFA 2QDRA 3ZIXA 4RR3B 2ZHKA 1RUI1 2IZWA 5L36A 2CTVA 2BNMA 1RUE2 1DGWA 3NJYA 4H3WA 3VDDC 1PIV3 1DGRA 2ATFA 2G1MA 1SDWA 4XIKA 5EPAA 1PHMA 1JTZX 2LROA 4META 3ZFEB 5JMCA 3ZYGA 2GNBA 3AMMA 2DCJA 5I91A 1H0BA 1O4ZA 4N7UA 2OVUA 2B9UA 1I9RA 2BV4A 4XXAA 2Y6KA 3O1MA 2D6NA 2QQMA 4FFGA 4UAPA 2G4IA 1X82A 2QBXA 4XUNA 1NY71 1OFNA 3RRDA 4MYEA 3FBYA 3JZVA 4P9YA 4QGLA 2D3RA 3HNMA 2RS51 4IGPA 1PGSA 4A41A 3O1VA 1DG6A 3DYOA 3T09A 5FLIA 5C3QA 5G05L 3OBAA 2FDHA 2ZPXA 1CPNA 1PO22 2BNNA 4AI8A 4CCLA 3DF0A 4FOYA 4H7MA 5C9AB 3ITQA 1LODA 3T0BA 2R043 5KHHA 3OB8A 1YUDA 3M7AA 5ACA1 1L7QA 3R4SA 4YVWA 2JEMA 4GWMA 4R9AA 4X6RB 2ARXA 2WWSA 4RD7A 4BCUA 2RJKA 2ET7A 1CAXA 1O59A 4R4XA 5L7OC 4HONA 5D8AC 1XOYA 1WZXA 5JDBA 5KHGA 3B93A 2E6VA 1X8MA 4LBQD 4AEDC 1KDMA 4QX1A 3VKOA 4LHKA 2GALA 4NWVA 4OHXA 4Z82A 2YROA 1PK6C 4YFZA 5CYYA 4IETA 4KWKA 3W5NA 2LALA 1YXWA 3I3DA 3BVCA 5JXJA 1RUJ3 2EAAA 2ZMLA 2R063 2WFF1 3MO4A 1JXNA 3WF1A 1C8M2 1IOAA 1R083 3WNNA 3C7HA 1X36A 1DGLA 3HMYA 3WT3A 3N9QA 3UKTA 2MEV2 4QQLA 3U10A 3SNMA 5AFEA 1PVC2 5BNNA 5B2GB 1VIWB 2KR2A 3AL6A 3NV1A 2HWE3 3VDDA 2BP6A 1ENSA 3T1LA 5FTTC 2CAVA 2PMWB 2VXJA 2QQOA 3PL0A 1TMF3 2QVSB 3VBOB 2W68A 4CCOA 3GHNA 4CUGA 1YJLA 3ZIWA 1RUC1 3DKQA 2EF6A 3QOPA 2E31A 1JYIA 3T30A 3MBWA 5FY7A 1SCRA 5T54A 2J1AA 1LENA 1X7NA 4BIOA 3VD4A 2GC1A 4B29A 4Q0PA 3FWEA 3OUJA 5KC6A 4MUVA 3HEIA 5E6HA 4HVRA 2BEOA 4N43A 4XOGA 1V6IA 2Q8EA 3OEBA 5FMOL 3BCWA 2WNUC 2WA3A 4FPFA 3HOBA 4JGYB 3H50A 4AFCA 5C33A 5C4WB 4K7JA 3LPGA 1AR83 3POSA 3T2QA 1CONA 1HV0A 1F35A 3JBG3 1O7FA 5KHKA 4HL0A 4Y20B 2VO5A 4IEPA 4TN7A 3H0OA 1ZRDA 2D6OX 3I2JA 1S2BA 1K5MA 4BLJA 1OH4A 4DUWA 1YJKA 4ORFA 2WYSA 3GJBA 4QKBA 4Y22A 2YC4A 3IDBB 3RWKX 1C5IA 4PT6A 4PIXA 4AYUA 4OI0A 2A75A 1XYNA 4QMAA 3EB7A 1IG3A 3VBSC 4CVUA 2LS6A 2CY6A 4COVA 5CVRA 3KSCA 4JGZB 3WP4A 1QXJA 4IV1A 2WAOA 5IK7A 4QGMA 1LRHA 1VP6A 2BU9A 2GSYA 3WW3A 3DXTA 5FKCA 5AC92 4K3UA 1OLME 1KFUL 3VD7A 1QKQA 1UD1A 2WSUA 4XJ9A 1UQXA 1UOJA 1CR7A 2UWCA 2XJTA 2Y0IA 4GQ7A 4QWNA 5A7SA 3ST7A 3ZFGB 1QU0A 4ASKA 1QJEA 4B4PA 4CP9B 1LAJA 4AFDA 4YPJA 2VNGA 4GWJA 2ZGUA 3I3BA 4HMZA 3VZKA 1YIPA 4QB1A 3KQ4B 1GU3A 1S0IA 3OG2A 2I74A 1YLLA 4YW5A 4CRQA 1XBFA 2D7FA 1HV1A 3JD71 5ISLA 3J7LA 3KF3A 5FYVA 4A3XA 2YPDA 2EA7A 5FOBB 3TEYA 2X5IC 3LA2A 3LIGA 4MXWA 1AXKA 4LBKA 4DS0A 5BNOA 3ZFFB 3RZZA 3ZO0B 3ZYHA 4XF4A 1MZEA 2W1QA 4BQYA 3U07A 1G9FA 2XBO1 4COZA 3IDAA 3AMNA 1DQ0A 4QPIC 3FE5A 3KCCA 4QPGB 2A6YA 2JG8B 2JB8A 3GYDA 2ZX0A 4UF0A 2CGOA 3ALQA 1BBT1 1SFPA 1SCSA 4CEWB 1HJFA 1DDLA 2RR12 3WXPA 3O1PA 1SLAA 2R49A 3M3CA 3BYWA 1H1AA 3ZSMA 1QJY2 3HNBM 3AC0A 4CU9A 4LBQA 1EV12 2WZEA 4NRPA 4ZS3A 1OC1A 1HXS1 1YCIA 4MHUA 1MS4A 2R073 1H8TA 1T6GC 3QH6A 4MHRA 1H1IA 1J59A 2NPIA 2V4AA 1J3QA 1RUE3 3ZR6A 4D6SA 1W2TA 1STMA 2AZ5A 3M4FA 5JVVA 4KMQA 4WM8C 1ZRFA 4AHYA 2WS91 4KGQA 1UO9A 5KC5A 4AF9A 5HPOA 3VBSA 1Z78A 2XLGA 3TEWA 1MQTC 5J48A 1AYN2 1YFXA 3ZYPA 2W92A 2ZGOA 4UBGA 1MS9A 2Y6FA 3U78A 3RZKA 3OD4A 3EHKA 5A7WB 3MPPG 4RQPB 4N53C 1EAH1 5K0UC 2Y34A 3IT8A 1VRH1 4YVSC 1W8OA 2JG9A 1SG3A 3JXSA 1AL21 1HDKA 2I45A 3J4UH 5EHDA 1NQJA 2SLIA 1W39A 5F6LB 1PGW2 4DNYA 2FCTA 1XRUA 1XU1A 2W5FA 3RI9A 4NE9A 1HQWA 1ULOA 1VALA 3IKWA 1V6MA 4CEYB 1FAYA 2XJUA 1PO23 5FLJA 4S2FA 3UV9A 3OBZA 4KBBA 4LIUA 1JODA 1RC6A 1CAUB 3J7HA 2G9ZA 4IE6A 3MZHA 1FNZA 4EN8B 1D4M1 1UKRA 1QOTA 2Y8KA 3IN9A 1WLDA 4K1YA 5BNPA 1Q43A 4NRMA 3UESA 5GALA 3A22A 2R30A 4AAPA 3M3IA 1ZA4A 2IVIB 4CDXA 5FZ0A 4GB31 5FJKA 3LCPA 1ND2B 4LO8A 3AYDA 4QHOA 5FK8A 5A1AA 4LQRA 5LBFA 2WA4A 2FD8A 2K2SA 1GP5A 4X8PA 5JPNB 3PMSA 5CFDC 2ZEZA 3EO6A 4XF3A 2PHRA 3DPRA 4Q1RA 3ZPOA 3KV9A 4LORA 2VBBA 3NAPA 4RR3C 1ZRIA 5T5PA 3KT4A 1OBNA 4CCNA 2RJ2A 3W9AA 3V64A 3ACLA 1MR5A 2C1FA 2J1TA 3KZ4C 3AM2A 4CCCA 5FOJB 1W28A 1HRI1 1C8M3 1FYUA 1JS9A 3PUAA 3QCWA 5FY9A 4OI1A 1OOPA 3FL7A 3U1XA 3ZFEC 1O5LA 3THCA 3ASIA 5FZLA 1DP0A 1SACA 1JN2P 2WFPA 2DDUA 2WT2A 4M01A 1W03A 5IUQA 3V0AA 4ZXEA 4XUOA 4XETA 4RYDA 4GALA 5T5LA 4FSJA 2VVEA 2EXHA 5DDJ1 5FP8A 4IE7A 3VZMA 3RWNA 4XCAA 4AE2A 5E89A 1OVSA 1E5IA 1UXZA 4CDWB 3PVNA 3TYJA 5FYUA 5FZMA 3NVCA 5HXMA 1ONAA 1RMU2 5I0UA 2EIDA 3VKNA 2R0FA 3EMRA 3VBFB 1I5ZA 4EJRA 3PDQA 2B45X 3NNMA 4QD2A 4RHV1 1UAIA 2CSGA 2UY9A 2VMIA 4O9GA 5E1RA 3FC0A 3O14A 1IKPA 2ARAA 2JWPA 3JB4C 1LOGA 2DBIA 4K8RB 2OQ6A 5LK5A 5C9AC 5CBLA 4LMFA 1IGOA 5JZGA 3A21A 4QQ2A 3ZN4A 2WO3A 1QNWA 1ND3A 1FPN1 2DU0A 2DCYA 3KLSA 4MGSA 2FZ1A 1JZ2A 5B4NA 4DXTA 1GKBA 3WSOA 4HN0A 4NJ4A 3WNOA 3G6JB 3I54A 3M1HA 5IW0A 1UL9A 3SKVA 3QBQA 4ASMB 1UOBA 5IYYA 2V5YA 5SV5A 4XHBA 4DRVA 1MS8A 4OYUA 1XNBA 2XJSA 3NRUA 5BYNA 3POBA 5F32A 2VZSA 2Z79A 3CU7A 4JQRA 4LA3A 5IATA 1CZSA 1Z7S1 3TN91 1NLRA 1ZZ7A 3ZOIA 1RUI2 3ELNA 1GQHA 2BFUS 4PQQA 2BUKA 4LE3A 1GZCA 1VMHA 2WQZC 4N9HA 4GAZA 3W5MA 1Q3EA 2RMU3 4FAHA 3SITA 2GMMA 3W20A 1OD5A 5CADA 1AR63 3D6EA 1I3HA 1S4CA 2XQXA 2Y33A 2YC2A 2DF7A 3ZXGA 5JIUA 2HWB2 4BWOA 1F4HA 1S0GA 3MFAA 2LUWA 2ZGRA 1AR91 4RGGA 1SLTA 4F7ZA 1NY72 3X29B 1E5SA 1GZTA 3NQHA 1UNBA 1H2LA 1WMDA 2RS31 2ZJCA 3RG0A 3ZSKA 4A42A 1VRBA 4MG2A 3WUDA 3NJVA 4GJYA 2PTMA 4YARA 3VD9A 1LOEA 4GZ9A 3GBFA 4R4ZA 1TNRA 1WD4A 3SLIA 4EN6B 5BNNB 5HCAA 4Q0SA 4RS5C 3R4UA 2N7GA 2QTWB 1HB2A 2P3IA 1DZQA 2HWF3 2MEV1 5FXVA 3VDDB 1GOHA 2H6BA 4HOOA 5IVJA 3IDCB 4FVVA 4OUSA 1GOGA 5ACA2 2W46A 1W8NA 1TE1B 1WMXA 5FUNA 2HBUA 2XHKA 2P2KA 1JZ5A 1X9PA 2VOKA 2GP5A 3BB6A 1UU6A 2ZKLA 4R9DA 4EQVA 4ZXKA 1AVBA 5KXEA 1NYWA 4XCBA 1BKZA 2ES3A 1KFXL 2RR13 2YMZA 4QX7A 1O3QA 2QQKA 2Q1ZB 1JYCA 2VQTA 5FYZA 4N43B 2AENA 3LPFA 3WINE 4BQ3A 1QJY3 2OX0A 4ZS2A 5FZCA 4XXPA 4YZ1A 1EV13 4XUQA 5H9PA 5LK7B 5FZHA 4CP0A 2ZCWA 5JUVA 5A33A 3VL8A 2WFF2 1NXD1 1UYXA 2P3JA 1ZNPA 3RYPA 3I4IA 2J22A 3N9LA 3OGRA 3MIGA 4A7YA 5JIAA 3HQUA 4NHXA 1ZREA 1K5MB 2H6CA 5A32A 1JYWA 3BU7A 1U0AA 2VCBA 4YZ2A 1OPMA 1AYN3 1QHDA 1RVF3 1FV2A 4UFJA 2KM2A 5D2AA 2CGPA 4Y22B 1VBA3 3KV4A 3NJXA 1GANA 5EQUA 4G4FA 2C9KA 3AMHA 2WNOA 2OKXA 5L7OB 4Q5OA 4AR2A 1JYVA 5FUIA 1AJOA 4CCMA 5EIYB 2FHRA 4PI2A 1YYNA 1J1LA 1WCDJ 3IIAA 1RUC2 4M3CF 4ONUA 3IBMA 5LA1A 4BZ4A 1W6OA 1VBC1 4FAGA 1POQA 2J42A 4W6XA 2TEPA 5DXDA 3M3EA 4IV1B 3ZYRA 1PK6B 1WWYA 3FFZA 3ZFFC 4TZDA 4HZFA 4M4PA 3N3HA 3RGBA 2A71A 4D7TA 1UOGA 3N7MA 2W1SA 1CZVA 1GMMA 2JG8C 4E4ZA 5AC91 3WCSA 4XFAA 2DFBA 2V5DA 3KHBA 4UOJA 3WG4A 1H4HA 2BOIA 4RL7A 1F15A 5C7GA 1K12A 5FK7A 2F6BA 3LEGA 2EIBA 4I02A 4JKMA 4C90A 2W91A 1MS1A 2TNFA 1AHSA 5J7MA 2JDNA 4S2GA 1WA6X 1I6XA 4YSFA 3SH3A 4DFSA 1OA2A 2XXZA 3PTRB 1NXMA 3THTA 4MXWB 4Q4X1 5LA2A 2F4PA 4WZCA 3HN1A 2VAUA 2DYCA 5BNOB 3D0JA 1WLTA 1W6MB 2WJSA 3K51A 1MS5A 3VD3A 3WZ1A 4Q8LA 3ZR5A 3PJYA 1VR3A 1W9WA 1AR62 2WO7A 3T0DA 1CWPA 3UKVA 1OA3A 4UF0B 1CX1A 4WZFA 4IEUA 3ACHA 1KITA 1XPWA 4LIVA 4TTGA 2FBEA 1A3KA 3POYA 3S7IA 4AWDA 1L3JA 2DTWA 4FFFA 1PM7A 2XJQA 3RZLA 4IESA 3RYKA 3OYWA 2A1XA 2R1DA 3QH7A 1OA4A 4RQPC 2VW1A 1H1MA 3MV01 2VW0A 3PMEA 3HQXA 5F3CA 2D6MA 4XFGA 2XHNA 3ZLIA 2QE3A 4JDOA 5J98B 1UZWA 2ERFA 3OBRA 2W47A 1RMU3 2P17A 1R091 1ZZBA 1OUXA 4M00A 4QX8A 4OUEA 3VDAA 4CEYC 2VZQA 5EYYA 4O9EA 3C8XA 3JD72 4QT6A 4PDWC 1LHVA 1NZCA 5FBZA 1VAMA 1JUIA 1O4TA 3VBSB 1HB1A 1Q8QA 1RIRA 2OUHA 2Q8DA 1N3OA 2JIGA 2CNAA 1B09A 2XBO2 4YW1A 5LEKA 2RE9A 2Z4FA 4NMIA 3IB3A 3BGAA 4LXLA 2DVBA 1B35A 1QJU1 2QKDA 3GZUC 1JW6A 1YWKA 3AZZA 1BBT2 1ND2C 1WCUA 2O1QA 3CLPA 4Y1ZA 3DXUA 1SFNA 5M0TA 1XYOA 2B46X 3POJA 1NUKA 5C5TA 1D7PM 1G9BA 3OUIA 2O14A 3PJQA 2VQUA 3NV4A 4AHZA 4YGEA 1HLCA 3P5BA 4I2OA 4P9XA 3C2UA 2PHTA 5FLHA 3OOXA 3TEXA 1HXS2 1KDKA 1DQ1A 2GN7A 1RINA 1H30A 2EVXA 2PLV1 4HVQA 1DQ5A 4JHTA 3H8OA 2YUEA 3I59A 4CTEA 1GUIA 1RUI3 2XMLA 3I2DA 3WNPA 5BNPB 1KS4A 3E97A 4MZUA 4I01A 5J96B 2WS92 2P6CA 1EPWA 4QDRA 1YQCA 3LDBA 3O1SA 2WSVA 5C71A 3H8XA 2E7QA 4QPIB 1J3RA 4AQ2A 4EE2A 4CDWC 1DQ4A 4BISA 4LHSA 1KJLA 3BPSA 1QGLA 2PHWA 4PIZA 3I2HA 3VBFC 1EAH2 2Z2SB 4NHLA 1VRH2 3LFIA 3TWIA 4DY3A 1QJX1 3S0MA 1AL22 2X53S 3THDA 2GAUA 1JYTA 2VZTA 2RS53 3AB0A 1OOPB 2ZGMA 2E33A 1WMFA 1C28A 1QH6A 4XBQA 1D2SA 2ILMA 4M3CE 4QPWA 3TNPB 3D82A 5I93A 5F8PA 3V0AB 4YNIA 5F3GA 1K45A 4XDPA 4BK5A 1XNAA 2WC2A 4FPGA 4JKKA 4QDQA 5IK4A 1D4M2 5ACA3 5E8AA 4Y4RA 1DYKA 4BQ5A 4IDZA 3L2HA 4YWAA 2Y64A 2W94A 5DG2A 1MEC2 3A0NA 2JIJA 4NAOA 4BMBA 5FZ9A 2A6ZA 3CDZB 4GB32 4XHXA 1QQP1 1DF0A 4YLZA 2ZKNA 1O5UA 4ASLA 3H3UA 4NIIA 4N53B 2VC9A 3IMMA 2J1SA 3BOWA 4YVSB 1S0EA 1CJPA 2I07B 3N4MA 1VB2A 4O7XA 3ZXEA 5LY2A 2WIIB 3LZZA 1YI7A 4KQ7A 4AI1A 5JZGB 4YVWC 4OHYA 1I5PA 1I1EA 2WN3A 5FZDA 1ND3B 3GGLA 2OS2A 2WQ4A 1UYPA 4Q0QA 2NN8A 3NW4A 1W6PB 5FRAA 1RTVA 2WDBA 2FDIA 3KV5A 1DCSA 4D0QA 1R1A1 1KD7A 2JXAA 2C0ZA 1XSQA 3TOJA 1OQDA 5FZ4A 2PELA 3WQ0A 3ES4A 5JPMB 2WLPA 1Q8VA 2BTVC 5DDJ2 4CDUA 5LA9A 4EN7B 2RV9A 3T2OA 2O0OA 4XJ8A 5FZ3A 3WQ1A 4AG4A 4EWAA 1QH7A 2VZRA 4WM7A 1ASJ1 1SMVA 4AEKA 1W8WA 2OUJA 4RHV2 3OGVA 5CFDB 4XFIA 5C3SA 4COWA 5FP3A 3AJZA 1LULA 3B3QE 5BNNC 3RDIA 1M4WA 1FXZA 4JRLA 5FPBA 3L9JT 2VW2A 1U5IA 4I0WB 5FZFA 2HWC1 2VOXA 1GYKA 1AR73 4BXFA 3MYXA 1FPN2 1JU4A 4XJZA 3GZEA 2XWBB 5JXGA 5AFBA 4QKNA 2AEYA 3BU0A 3D3AA 1F2NA 1YQ6A 2HWB1 4U2AA 2IVJA 5H9QA 3WLUA 2XLFA 4DOUA 4QXKA 4HLTA 4LULA 4N43C 5FPVA 3ZX7A 2ZA9A 1H6YA 1F4AA 2VE1A 4I3GA 5IK8A 2Y0OA 4Q1PA 3AYAA 3C7FA 3ZKYA 3TBDA 1GWMA 1UYZA 2BGOA 3RMYA 4BU2A 5FXXA 1M06G 4AVVA 2Q4SA 4I09A 2ZGTA 1Z7S2 3TN92 4K1ZA 5JLVA 1UY3A 4JRAA 1ODMA 1UIJA 2B8MA 2X8KA 3MDPA 5CNAA 3URFA 3WNKA 3ZPYA 1K5MC 4GMP1 4UI9L 1AUYA 4L0PA 4YRDA 5HI0A 2Q8CA 2W39A 3PNAA 4P9GA 1AJKA 2SBAA 4D8MA 3VBUC 1BYHA 5CIRA 1VLNA 4CPBD 5FBJA 3U75A 2QQJA 5JI7A 2DCZA 3CIHA 5EYXA 3KVAA 4ARXA 2GNDA 1AR92 2BPA2 3H1MA 1BEV3 1H2NA 3H1YA 5FZEA 5A33B 4L8QA 1C1LA 2QZ3A 4IV1C 4Y24A 4CEWA 3K75B 1DZTA 1U5XA 2NQYA 2RS32 1N3QA 2WZR1 2ZX4A 3RJRA 3U14A 2ORZA 2X29A 5GZFA 4AEJA 3PUIA 1W6QA 1FOD1 3ZSEA 3ORJA 3GXUA 5FZ8A 4DB5A 5IFPA 3PUHA 3AZVA 1OLMA 1BCXA 4XJUA 2ARCA 5LZ6A 3WW2A 2QJVA 1GZWA 5FY5A 2ET1A 2XBO3 3K3NA 1VBB1 4KGGA 5FYYA 3NSTA 4MADA 2W1WA 3ZXDA 1APNA 3RVHA 1JI6A 2A73B 1BBT3 1F9KA 3MLJA 1XNDA 4I0AA 4XMIA 5A1FA 5HXVA 5JOWA 4GD4A 2VCMA 2VZUA 2FQPA 2NMNA 2ZEXA 3S30A 3OGSA 4XC9A 1CD3G 1LCLA 5T3NA 3PURA 5BNOC 3GZAA 2GC2A 5C6CA 1D2QA 5JOXA 1AX1A 1HXS3 2XJVA 4QQHA 1XC6A 1ULDA 4W4ZA 1Y3TA 3PU8A 4GJZA 1XYPA 4Z07A 4FO9A 1P8JA 1PNGA 4IEOA 1A34A 3PTYA 2VOVA 1Y9QA 4RS5B 1V6LA 2BDRA 5A3UA 2WS93 4DY5A 3D4KA 3PIGA 4LKEA 2XG3A 3KMHA 3B02A 3POWA 1ZBE1 2OW4A 2UY8A 1REFA 3ATGA 1W05A 4HKOA 4XIOA 2VM9A 4L97A 1H8TC 3SC7X 4P9JA 3ZMOA 3K4DA 1EAH3 4D3WA 1VRH3 3VBUA 4MGKE 4OMDA 5GM0A 1MS0A 1QNYA 1V0AA 4BJ0A 3P3NA 1AL23 1PIV1 1VBC2 2RS13 4LHNA 2QQUA 2VUJA 5JR7B 2EIGA 3HT1A 5LBCA 3H9AA 3HBKA 4Q26A 2VH9A 2XH6A 3T0AA 3POFA 4OVEA 1JOBA 3AKRA 5JOZA 1H8VA 3M70A 1W0PA 1PMHX 3OYWB 4BQXA 1UF2C 3T08A 4ISRA 1LU2A 1NCRA 2P34A 1D4M3 3MPBA 2BVBA 2JG9C 1A6CA 2FDGA 4P9IA 1PMJX 3BOPA 3R4DB 4NAMA 4MV2A 3GHMA 3NV3A 1RJ7A 3VL9A 2E51A 4NPLA 3FX3A 1RL3A 2MNGA 3WV6A 4GB33 4MX3A 2HKXA 3VBHA 1H4GA 1BVVA 4URAA 5GZGA 2VECA 4EN9B 1RUG1 5JXIA 1RUF1 5IVYA 1QOOA 4MOAA 1J1TA 4PF1A 1XSRA 4Q4X2 4CSWA 3RZGA 2NMOA 1X50A 1JZ4A 2LRPA 4JZRA 5J3UA 1IS6A 3OBTA 4AAXA 4AGGA 4EWDA 4KBZA 5BNPC 1CZTA 4ZU5A 2PFWA 2GMPA 1EPZA 1HJGA 1HRI3 2ZS6B 4CDXC 1B35B 2WNEA 2AH2A 4UFMA 1OFSA 2YPJA 3SQOA 4AQSA 2JDHA 2ZEYA 5A3PA 2VGDA 2PA7A 1GSLA 1MS3A 1Q8OA 3J7NA 4LHLA 3PVOA 4N8MA 3FFQA 1RUD1 4FXKB 4NPMA 4QDSA 3DPRC 4AFAA 5I8TA 1LJ7A 5FO7B 3UJQA 5DDJ3 3NAPC 5BNQA 3UETA 3BUCA 3KCXA 5CKNA 2XDVA 2D93A 1KQRA 2R061 4LK7A 2NLRA 4Q8KA 2CL2A 5DN2A 3EQEA 4LPLA 1R092 1U5YA 1OOPC 2YDEA 4AHWA 3THPA 5CFCC 3I59B 5IVFA 1UX6A 4RHV3 1LU1A 5A3WA 3T2TA 1XNTA 5APAA 4AEMA 2VPVA 5A3MA 5K4LA 2J1VA 4OZXA 4NUBA 4MXVA 5FPAA 5T52A 1XJAA 1UY4A 2H0VA 1N47A 2VMEA 2GNMA 2VTXJ 3CF6E 4P02B 1CPMA 4XFFA 3I2FA 4K6BA 5FUPA 3WF2A 3VHPA 3C7OA 1DYPA 5CU1A 1FPN3 5DPNA 1ZYBA 4XDQA 3AVSA 1DHKB 4ITCA 1LGCA 4BHPA 3S6PA 1KRIA 1SEFA 3AJYA 1QJU2 2JDZA 2XGXA 1RUOA 4Y1YA 4LBJA 4YGCA 5FPLA 4B3NA 2IXIA 5LBBA 3GALA 3B5LB 2I2SA 5GZCA 2PYTA 4Y1VA 4CUBA 3GF6A 3A7QA 1O3RA 2NM1A 5JZGC 5BUVA 4LO4B 1DGRN 1UPIA 5L9RA 5JCTA 3K46A 1QXPA 1ND3C 4KL1A 4AFBA 3O0XA 1IZ3A 3WF3A 2PLV2 2J1UA 3O0VA 1Z7S3 4YGDA 4PDWB 3TN93 3WNXA 4A6OA 1AF9A 2GC3A 4GH4A 1QEXA 2DV9A 5A80A 3H7YA 1JU3A 2WKKA 1COV1 1EY2A 5KWRA 3KM5A 4XZPA 4ATFA 3M2MA 4GXLA 2D6PA 3VV1A 4KNCA 2Q8OA 2BRTA 4E2QA 4C1XA 5KXBA 1JZ7A 4P5YA 1UY1A 5HCBA 1MEC1 1LOBA 1W2NA 3USUA 2FZ2A 3I3EA 2BJSA 4GWIA 3ZMNA 1FNYA 1AXZA 3KVBA 1JZ3A 4BE3A 3HD8B 4UWDA 1MVEA 3IAPA 4Y3OA 2P5BA 5EJ3A 3ZYIB 1QJX2 5FMDA 4Y4YA 1LHWA 1JYNA 2OZ6A 2RS33 3WP3A 1GNZA 3PU3A 1NA1A 3P3PA 3BTXA 2DUQA 4GKXA 4YM0A 4N9IA 4SLIA 4WBBA 5CFCA 2ARBA 2ZABA 4XACA 4BOWA 1POV1 4ZZ8A 1LGBA 2MEV3 3VZJA 4W6YA 1PVC3 4DUXA 4XBNA 4XABA 4M4RA 1YFYA 2Y6GA 1DGWX 1PNFA 4IEYA 4WM7B 2DVDA 4KH9A 1VB4A 4LOSA 1WCQA 3CEWA 5FQ0A 1QQP2 2LTNA 2E63A 4MGQA 4BIFA 1UZZA 2JE8A 1J84A 1PX3A 4LBMA 1O8PA 4URTA 1CN1A 1SPPA 2CHHA 2YFUA 5DQ0A 4CCJA 2BBVA 5LA0A 4XE9A 2Y60A 4YW3A 1VAKA 3ZYBA 2PQSA 2WT1A 3OCPA 1KJRA 2RM21 2E26A 4LUMA 2D5FA 5K7PA 2BERA 3HJRA 3C7EA 4E4DX 4RGKA 2VJXA 4ZY9A 3PHMA 2E53A 1VE0A 4AI3A 3V65A 2VY0A 2EXJA 2YC0A 1R1A2 2YY1A 3KT1A 2GN3A 3NNGA 4V2VA 4CA9A 4AI2A 4DO0A 4HBNA 1CGPA 1DYOA 4Q0UA 1W3XA 4XF0A 1VMFA 3PVEA 4OMCA 5A3TA 2DVAA 4QPYA 3ECQA 1YEWA 1S0FA 4FPLA 4IV3A 1VBD1 3O1TA 1MACA 1IPJA 1ASJ2 4YW2A 5C3RA 3UNPA 3E1F1 1VBC3 1W2OA 2WWJA 2YHJA 3ON7A 4W6WA 1CAWA 4HKLA 4UFHA 1SBEA 4EV0A 4YVWB 4FT8A 3AX4A 3FN9A 1LOCA 1VBE1 1HRV1 1RGSA 2W87A 4LO7A 5HV0A 1CAXB 5I0SA 4JQTA 2HWC2 5AC93 3JCIA 4FP3A 1QY4A 1TVGA 1IPSA 5H9RA 4IL7A 4HXCA 5LATA 4XYXA 4FQ4A 4JX0A 3N9PA 1SBFA 4IE4A 4BA6A 4A2UA 3OF1A 4W50A 4ARYA 2CYFA 1LB2A 3SHRA 5KXDA 2CAUA 5FZ7A 3OGGA 4XTPA 4FOQA 1DQ6A 3ES1A 4LTAA 1GOFA 1G86A 4INDA 1TME1 4Q4W1 3UK9A 4AGVA 1QXRA 1Y7BA 1W6QB 3CZJA 3OPTA 4MO3M 5AVAA 1V6OA 1WMEA 4CUCA 3F95A 3E6DA 3DGTA 4QB2A 1F5JA 4ZPIA 4Q4X3 1GZWB 4MH0E 1LNSA 3GM8A 3LDKA 4O65A 2ENRA 3MIFA 3ZYFA 4AFMA 3NO8A 1TEIA 4NN0A 2OPKA 2D43A 4UYBA 3ZDVA 5F2WA 5IVBA 1UIKA 4DPNA 2DURA 2DCTA 4KWLA 3DECA 3I2KA 3MICA 4ZONA 5F5AA 3SISA 3VBRA 5LWBA 1NCQA 3BI3A 3OPWA 3ZVXA 1FMD1 1S2KA 1LOFA 2ZTNA 3Q8BA 3W58A 5LEJA 3AP6A 2RDRA 3LEKA 3UGFA 3BN6A 3VKMA 4AQ6A 1LHNA 2YB7A 1GWKA 2D5HA 3N7KA 2VZ3A 1RYYA 2E7AA 4V1PA 2XVLA 5BV6A 1R093 5EXOA 3EJKA 2WZR2 1CX4A 2R32A 2IXLA 5FMCA 4S2HA 1XQNA 2MPFA 1F31A 3GCWA 1W04A 3ZSLA 1NG0A 1FOD2 5A7NA 4GMP0 5GLTA 1W8HA 2H0BA 2X05A 1PGL1 1O6UA 2OT7A 3KHCA 2HEWF 4YG0A 1LHUA 2K46A 3DYPA 4CU8A 3K2OA 1V70A 2ZHLA 1YNAA 4XFHA 3HVDA 4FOWA 1VBB2 2Z69A 4TSVA 4A45A 4DZGA 4FTSA 1RUNA 3WDTA 1TG7A 1QJU3 4UT5A 3VBUB 1W0OA 2C26A 3AL5A 2VBPA 2AREA 2YU2A 3AFGA 4XQWA 4D7SA 3I2IA 3WG3A 5CA6A 3I49A 3KQRA 2ETEA 5DZEA 1GV9A 3IMNA 3M3OA 3E5XA 3CJIA 5D21A 1SBDA 2P6HA 4IEQA 1T2XA 2ZACA 4Y33A 4YFWA 3S7EA 1HB4A 2VMDA 4D7YA 2D97A 3CJXA 2KXLA 1N3PA 5L73A 1AXYA 3JQXA 3LF7A 3NL1A 1ULGA 3HN3A 3RPQA 3NKGA 4XF1A 1WBLA 2PLV3 5C8CA 2JDUA 1NE4A 4JCKA 1B35C 4K20A 1NCRB 1PX4A 1W9FA 1JHJA 5EV7A 3GDBA 1W6NA 4Q29A 3WQ7A 2A3XA 1AZDA 1H9PA 2AEZA 1D0GA 3AKTA 4D69A 2YYOA 4L9BA 2A70A 4OI2A 4C8DA 5DAXA 4KU8A 3LIHA 3TAYA 2FDKA 2A6VA 2DVFA 4Z2AA 4OHWA 1UKGA 1WUVA 1ZBE2 5F3EA 5FWEA 5IVEA 3WQBA 1GNYA 3VKLA 3ETQA 1LEMA 2Q0AA 4UBHA 1OUSA 1WW5A 3HT2A 1NAEA 5FZ1A 4I0BA 2XJPA 3NJZA 3GJAA 5C70A 4L11A 2WNVA 3LDRA 4LOTA 2ADEA 4L92A 2G19A 2OXBA 1YC61 1PIV2 2W0XA 1PO11 3VGIA 5HV4A 3DCQA 2RMU1 2BWAA 2VZPA 4LKDA 1ZRRA 5LRRA 4OQ8A 4QX0A 4JGYA 1X9TA 5FYIA 3WHUA 1CESA 1NLQA 4O61A 5CKMA 5C4WA 1ZZCA 1SFYA 3VLBB 5FDBA 1UY2A 2KA3A 2WO1A 4XJAA 4DIQA 2D3SA 4OCTA 5FV3A 2OIIA 1K42A 4IEWA 3CZUA 4K40A 3S5AA 2R6QA 5I0DA 2ZX2A 4E9KA 5A3OA 1W0NA 4DEVA 2VUAA 4LITA 1UX7A 4J1XA 4LBQB 1LEDA 3RZMA 1QQP3 1C4RA 1G8WA 1GQGA 1H8TB 3JU9A 2YV8A 3R05A 3LE0A 1RUG2 3U11A 1OF3A 2VZOA 1QMJA 2CDPA 4M3CA 3H42B 1RUF2 2HWF1 5FZGA 2OQ7A 2VBDA 3H8RA 2AACA 5GLZA 1G9CA 4JGZA 3JUUA 4CU7A 3AKQA 1OKQA 2PQQA 4UFLA 3VB9A 5CAZA 4NHYA 2C9AA 1UOFA 4PF5A 4NROA 4AI0A 2E9QA 1XE8A 2XOMA 3VD5A 4E8DA 1R1A3 3NNLA 3ZFGA 4QU2A 3ROUA 1GP6A 1OLQA 3O1UA 1RUD2 2AGSA 3UGGA 2F4LA 2JG9B 4K8FA 1Q8PA 3UYJA 2R0HA 4LO5B 1GZ9A 4RA0A 5DUUA 2EXIA 2YBPA 1RUJ2 4JV4A 3UL2A 2P4EA 2R062 5J1XA 2QQPA 4ISQA 2XPJA 1XU2A 3LEIA 4RFRB 1ASJ3 1UYYA 2ZGNA 4HFSA 5TSWA 4WVZA 2WZ8A 4GH4B 2PHFA 4DUVA 4XAAA 1AYM1 2JX9A 5FYSA 1O3TA 4GIQA 2VNRA 4OULA 1MZ6A 1RVF1 2A5ZA 5FXWA 2EAKA 1OKOA 5DABA 4ZHNA 4CDUC 4AVTA 1VPHA 1VAVA 5LW9A 4P08A 4QPGA 2HWC3 1TMF2 4CDXB 3B94A 2RDQA 3USUB 2BYVE 3AKSA 3A23A 1DZRA 3DV8A 4WM7C 4R52A 2GNTA 4YZ4A 2XUMA 2Z42A 4AK3A 1MZFA 4CU6A 2UU8A 2OZJA 4Y26A 1OQEA 4BB3A 2HWB3 2RDSA 3ACGA 3DPRB 5ERLA 3TB0A 3WX5A 4TXWA 4Z92B 2WQ8A 2ZGLA 3NAPB 4CDQA 3WW4A 2B39A 1NA1B 3SCFA 3CHXA 4W8JA 2WABA 3T3YA 5FY4A 5FPXA 1NE6A 1RJ8A 2GZWA 4MSVA 3ENRA 4IGQA 3B01A 1C5HA 2CU5A 5CFCB 4FQZA 5KR7A 4BDVB 3MLKA 3RJ2X 1UPSA 4NHKA 1EUUA 3U37A 4COYA 2XONA 4FTBA 2VOTA 1BMV1 5FZOA 3NKTA 5LY1A 3J26N 1DLCA 2D40A 1H9WA 1QOSA 2QCSB 3N9MA 3AYEA 3WDWA 5FMOS 2PHDA 4GMP3 4CYDA 5A70A 1COV2 2HEVF 4K9SA 5A3LA 4KWJA 5IVCA 5I0RA 3E5UA 4C0BA 5FQ0B 4C0HA 1RUH1 5F7UA 4C91A 1YQ2A 2HWD1 4Y5TA 5FWJA 2V72A 1SPPB 4HSLA 1O91A 2ZMKA 4WVVA 3ZM8A 2QDNA 2D6LX 3MIBA 2DUOA 1BXHA 4PBPA 4EYUA 2IC1A 2UWBA 2ZOEB 2BQPA 5AVPA 3AVRA 3VDBA 2VVFA 1WLCA 3OGJA 2YG0A 5I0TA 4P00B 3B9IA 4Z1VA 4QX2A 2WZR3 2VG9A 1REDA 4HETA 1ULCA 1E5RA 1ALYA 1FOD3 4BPZA 2WFF3 5CG8A 3WG1A 3ACIA 1W2AX 1UMZA 2UWAA 1RHI1 2V09A 4FPHA 1XE7A 2DU1A 2JDYA 3DEMA 1J58A 4C1WA 4E4SA 1CVNA 3VN4A 2DBNA 3LA3A 1PZ9A 1VBB3 3KV6A 5DZGA 3MF6A 5FP9A 4CEWC 3W59A 3EYPA 4GA9A 5GLWA 4GKYA 4AL9A 5C3PA 2VMHA 3AP9A 1OI6A 1QWRA 3IZOA 3QD6A 1IQAA 2FMDA 1RUC3 1CAWB 4CCEA 1YFUA 1HW5A 3MGUA 4P9LA 5F5CA 4Q0VA 4AW7A 3WF0A 3WY6A 3H8UA 1ZBA1 3K77A 4LLOA 1IS3A 4YG6A 5L19A 1POV0 2RM22 5FY8A 4QXHA 2AC1A 1N1TA 2VUCA 3IM0A 1KS5A 5FP7A 3LAGA 1DU3D 1ZZ6A 2Q1MA 2JJ6A 2VZ1A 1K5JA 4V2WA 4WVMA 2D3PA 5FPUA 1O3SA 1H2KA 3ZN5A 4DEQA 3MUY1 1SHWB 3E5QA 2HYKA 2V73A 4XEZA 1ZBE3 2XUEA 2GDFA 3NMBA 4FI9A 2WINB 2XQRA 2ORXA 3EXUA 1QJFA 1VBD2 1A8DA 2P3YA 4EZHA 1WW6A 5F5IA 1BQPA 4IEXA 4BQ1A 5A3NA 2ZX1A 1WD3A 4LKFA 3ILRA 4ATEA 1HQLA 4EWEA 1WW7A 4OI4A 4H14A 4QQOA 3DL3A 5DG1A 4HG6B 1YFWA 4FFHA 3ZKUA 5A7OA 2PHXA 3VBRB 5ABJA 5HBAA 1NCQB 1VBE2 1HRV2 4CXWA 3LSEA 5IHRA 4N90A 5FYTA 5A6YA 1WW4A 4FPCA 4JAAA 3FBMA 4BH9A 4NIDA 4CP2A 1UN1A 4NPRA 2B7YA 3AKPA 4I30A 1OF4A 3VKFC 1G7YA 1LTEA 3LWCA 5H9SA 1A78A 2QQWA 3MEPA 5I8SA 1QDOA 1AL0G 4BQWA 3T4HB 1FT9A 2VUDA 5HCFA 4MGIE 3B00A 4Q4W2 1TME2 4LE4A 1L7LA 3FMGA 5IVVA 1RUG3 5BXXA 2A3WA 2TUNA 1RUF3 3SH5A 5FY1A 1UU4A 4BMEA 1ENQA 2ADDA 2XL9A 2ZAAA 3JD73 4G3YC 4MGYE 4Q4Y1 1NCRC 5FP4A 3U0ZA 2VNVA 3R6SA 2W52A 4OUMA 4OLLA 1O8SA 5A32B 4FCAA 2D44A 1F5FA 5FPZA 4M0NA 3WP5A 4PLNA 2XJRA 5L9VA 2KD7A 4Z2WA 1FV3A 3VBHC 5F2SA 3K3OA 2Z5WA 3LEMA 1FMD2 4LO6B 3WF4A 4A7KA 4CXXA 1RUD3 2ZZQA 3CJIB 1ZZ8A 4XVHA 2HJIA 3TNQA 2IWGB 3CNAA 1W6OB 3MUZ1 4L99A 4KG8A 1W90A 3RSJA 2QNKA 5JWPA 1SDDB 2E7TA 2ZEWA 4HKWA 5A7QA 4JDNA 1J3PA 1IKQA 2Q5TA 4ES8A 4NIHA 1OHFA 5C8CB 5I8YA 3HPNA 4FPKA 3JB8A 2QFEA 1W6NB 1F8VA 1W8FA 1V9U1 3KCYA 3MHZA 1U5ZA 3KD4A 4XFCA 1ZZ9A 3J9SA 2R7EB 2QUOA 1K3IA 3LSDA 4KI5M 3J8F1 2W2IA 1PGL2 4B7EA 1N1VA 3SXWA 4AI9A 1W8UA 2NZ9A 1DLLA 2WYFA 2DUPA 1UMIA 2UURA 3Q8FA 3RZJA 3HNYM 5DUXA 1JOPA 4Q4V1 2NP0A 1W9SA 1HB3A 4YM3A 2WNVB 2BGPA 1W9TA 3AK0A 5ANQA 4Y5Z0 2GU9A 4J25A 4MLOA 3PIJA 2RVAA 5FCCA 1US3A 4B4RA 3T2PA 1HX6A 4MVTA 3WDUA 5K9YA 1SLLA 1AR71 1V6KA 5IT6A 5KBFA 3FHQA 4AXOA 3IPVA 3APBA 3I3MA 2W1UA 3UT0A 3H7JA 4JTNA 2ID4A 3IIIA 4XILA 4F3JA 1IS5A 1LECA 3D5OA 1GFF2 4XUPA 3INAA 1COV3 3F2ZA 5FZKA 1OPOA 1C8NA 4OFGA 5F3IA 1QIQA 3T4VA 3MIDA 2WRAA 4LBNA 4DXRA 1V00A 5EZWA 5L7OA 4ZU4A 2XLAA 1AX2A 4LUKA 3SMHA 1MEC3 5D8AA 5F39A 4YYOA 4IUGA 1E57A 5A7PA 3MIEA 3OY8A 4M3CB 5F5QA 3FUQA 5ANNA 3KT7A 3Q8EA 4AEDA 4XUTA 3WNMA 2C6SA 3RZHA 4GH4C 2VCCA 3G7DA 2BW8A 5FZBA 3QLQA 4QGNA 1S0CA 2R041 3BKZA 4U36A 1PK6A 1PO12 5BY5A 3N9NA 2RMU2 2VZVA 4MGZE 1SLBA 1EP0A 5LCWL 1URXA 5FY0A 4Z8BA 3AP4A 1CAVA 2PN5A 1S1AA 3ILFA 1ULFA 3B7MA 3FHIB 5IFTA 1POV3 4AVSA 3W21A 5A6QA 3ZXLA 2B4KA 3ACFA 3HQRA 4IERA 1BEV1 3CQOA 4IEZA 2E32A 2B42B 2K0GA 5JSRA 1IS4A 4IE0A 1OXCA 2RJLA 2XVKA 4J6GA 4QHBA 4ES9A 1JUHA 5FJHA 4BQ4A 1Q56A 3MF9A 1NA1C 1EUTA 4HT1T 3OJBA 2FDFA 1RUJ1 1R1ZA 4CPBA 4TLGA 1Y4WA 2JKXA 1MVQA 1KGYA 1R081 3CKHA 3DKWA 1JZ8A 1X8EA 4LT5A 2HWF2 3H1WA 1ULPA 1W9YA 4AVBA 2DTYA 1W6MA 3LQCA 5JSOA 1NLSA 5FYHA 4ET7A 1DFQA 2RM23 2HWE1 2WNUA 2XKOA 4LA2A 4PBOA 4NIAA 4DMIA 5CKQA 2GC0A 3GCXA 4E8CA 1UZYA 1TMF1 4LNVA 5LASA 1W2UA 4BLIA 4FTEA 5FMBA 2JKBA 4UW3A 2ZBJA 1RITA 3N7JA 1XNKA 2PAKA 3OPZA 2Y6LA 3O0WA 1HN1A 4P14A 4XDOA 1CJDA 2C5DA 2YZ4A 3WEZA 4CDQB 5GKAC 3UJOA 3FZ3A 2G9FA 1A8MA 4ZKTB 1WCKA 4W65A 1UW8A 3MW3A 4AQTA 2NYYA 4CCKA 2K9ZA 2YXSA 1VBD3 2VL4A 4HK9A 4F8AA 4CCDA 1J83A 2ZAHA 1D4VB 2ZGKA 1AR81 3C7GA 3POIA 1D0HA 5FZOB 4HK8A 1W8TA 3OUHA 5GLVA 3JBG1 2HBTA 1AYM2 1SQ4A 2XVGA 4XFBA 1IQDC 1W8ZA 4GWNA 3UGHA 3GNEA 4UFKA 1U12A 1JYXA 1FI2A 3IDEA 4PHZA 4BXSV 5IK5A 2Y26A 1RVF2 1C57A 1OSGA 4UW5A 4YM1A 1ZA7A 1VBE3 1HRV3 1VBA2 3I7DA 3K48A 4E27A 4IV3C 4QXBA 4UFIA 1UZVA 3H3LA 1BLZA 3ILNA 3J7MA 2BBAA 3B9CA 2IUWA 2ZGQA 4A44A 4PCRA 4XMAA 1LR5A 1WGPA 2HYXA 1TQ5A 1MPXA 4IE5A 2RS11 4BM8A 3HR9A 3H3ZA 2EXKA 4FBFA 4QXCA 2WT0A 1AR93 1NT0A 4Q4W3 1TME3 2VTFA 3MV11 4JHZA 3GBWA 5FREA 2FDJA 4PJYA 5T55A 4COUA 1RXGA 1EYBA 2FCUA 5C5UA 1OD3A 5A6ZA 5FZAA 4BYYA 2O8QA 2JDAA 2VMGA 2ZGPA 3V0BA 3A4UA 3TRSB 5C8WA 3ZDSA 2X5IA 1GP4A 1SZBA 2Y6JA 3N36A 1BMV2 3ZXJA 3VUOA 2X09A 4E4HA 3MW4A 1QF3A 2JD9A 2J1EA 3KF5A 4CDUB 1OQ1A 5F37A 3MFCA 5DUWA 4QPIA 4M0HA 4HVOA 5DUVA 3VHNA 3AMPA 4Y1UA 1FMD3 1RUH2 3EBRA 1GLHA 2HWD2 5EFUA 1V6NA 4GULA 4XJWA 4CP1A 5CEHA 3ZXFA 3ETPA 2VULA 5DAWA 5J37A 1WBFA 1Z0HA 4DRRA 4EROA 4QKFA 4CZSA 1NZIA 1UXXX 5JAXA 4X6QB 2AR6A 2IXHA 5L9BA 1CIWA 2WBKA 2FMYA 3LD8A 3ZXKA 5JR2A 1UY0A 2EIEA 2VQAA 4NOTA 1NCQC 4WVMB 3VBRC 1OMIA 3LOBA 1LOFC 2QQNA 5SV8A 3V56A 1RHI2 2PHLA 4LLFA 1PZ8A 2OA2A 3BTAA 5DAVA 5IAXA 4WM8A 2IFRA 3USSA 1YO8A 4B1MA 4DXZA 1S0DA 3HAGA 2WO2A 3KS7A 3WHTA 2HLEA 4QHZA 1MQTA 2B5HA 2LW8A 3PUQA 3AFKA 4TWTA 3RMXA 5FO8B 1G9AA 2QQVA 2CWMA 4JVAA 3O1RA 1WLWA 1LOAA 4KU7A 2JDPA 2R071 4QX3A 4A3ZA 4AVAA 5A1LA 1AX0A 4N53A 5K0UA 4P5HA 1G9DA 5E16A 4QM8A 4YVSA 2IFWA 3D8CA 1RUE1 2VR4A 3AZWA 2Q1FA 4X8NA 2W08A 3ZXAC 5ABJB 4LK6A 2A3YA 3LB9A 4B1LA 3WOGA 1ZBA2 5J36A 2JD4A 1W6PA 2A7AA 5A6XA 2C24A 1Y43B 4S2DA 5D1IA 1TNFA 2Y6HA 2V4VA 3NNJA 1E5HA 2JICA 1BZWA 2PAEA 2ZHMA 2ZHNA 2UYBA 3CJIC 3FLRA 3R0RA 4YZ5A 2XB6C 5F6KA 4PLOA 3BTYA 3BIEA 2X10A 5IJRA 1QDCA 1RXFA 3NWKA 5K8SA 4JC1A 2ZZJA 3MI8A 4HPKA 4OHVA 1VMJA 1HIXA 4NR1A 1BK1A 4QM9A 1WA4A 1UWWA 1Q8SA 2JB4A 4HSJA 4KG0A 4XPVA 5GJ6A 4A4AA 5C8CC 1NOVA 1ZX5A 3BPZA 4E2GA 5FYCA 1PO21 4H2AA 2CGNA 5CFDA 3IWZA 4UXAA 1C1FA 4XQDA 1PO13 1NQDA 1BHGA 5HCHA 1US2A 3CO2A 4RR3A 3E6BA 2O8OA 2PXJA 1YI9A 3Q8CA 2VD7A 4QQPA 3VBOC 4F83A 2JE7A 2Q30A 1PM4A 3ZFEA 4IEVA 3DN7A 3POEA 1L7RA 2BNOA 4LEJA 3PVBB 4LKSA 5F1RA 4WVWA 2WNVC 5F9TA 4IQPA 3T1MA 4A7ZA 4D94A 2YGMA 2UYAA 2VOWA 4FP2A 3VZLA 3NV2A 1YHFA 2W3JA 2RS52 3QACA 5IWFA 3BODA 4JGYC 3DUIA 5C4WC 3WCRA 1N1YA 1NKGA 1C8M1 3B69A 2RDNA 4IW3A 3N7LA 2ZX3A 1HN0A 5FZ6A 3WR0A 3BTZA 2AUYA 2IXCA 3SCHA 5T5OA 4Q4Y2 4DQAA 2A6XA 1PVC1 2MHFA 1Q5OA 5C9AA 1IPKA 5EJ1B 3U4SA 2C4XA 2RHPA 3FLPA 1OH3A 3OTFA 2OPWA 2A6WA 2CDOA 3O5SA 5CZKA 1ACCA 2BOJA 1S0JA 2VMFA 4RFT0 2WZPP 4QKDA 3FUOA 4PQ9A 4AGRA 4FPYA 5JI9A 1SLIA 2JENA 3DYMA 2D98A 3AMQA 1H2MA 4JDMA 4FPJA 3OSDA 3O12A 3I8TA 1FATA 2AYHA 1YIFA 2IXKA 4JGZC 1LGNA 4OHZA 4PLMA 1BK0A 1CQ9A 3IPVB 5IAVA 5EP9A 3KGLA 5FZIA 2RG4A 2GH8A 4YG3A 5LBEA 2YFZA 2BGCA 3WD5A 1GR3A 1V9U2 1AYM3 3C3VA 4G9SB 4K21A 3ZFGC 3S5QA 5J09A 4KWUA 3J8F2 1GICA 3WUCA 4NWWA 4CE8A 4I3PA 1XNCA 2B9VA 4UW6A 1YQ5A 2XR4A 3PLQA 4R9CA 5D8AB 4RSUA 3OY8B 2OYZA 3VBHB 3MW2A 4AEDB 1DIWA 1X33A 5FXZA 4Q4V2 3VBOA 2BWCA 3P1IA 5G04L 3E6CC 5T5JA 5KXCA 3D0SA 4XF9A 1UMHA 3NNFA 4JKLA 2DCKA 2YBKA 3ABZA 4NIGA 3AYCA 1QJX3 3K4ZA 2QQLA 4JTOA 4XAEA 1LHOA 4B7KA 3HIFA 1LESA 4BK4A 1CAVB 4QPGC 2VVDA 1AR72 2XL7A 4QX5A 4B4QA 3CL1A 3AP7A 1AR61 5JXHA 3I2GA 2DFCA 5LRSA 1DQ2A 1TZOA 3VZOA 2XWJB 3CMGA 2PHUA 2W95A 3AZYA 1JMUB 2G9GA 3IAQA 4RS5A 3LA7A 2ZGSA 3S57A 2L9LA 3WDYA 4Y20A 5EWSA 1ST8A 4CDQC 1UCXA 3WG2A 3VHRA 4J1WA 3L2YA 3ZSJA 1RUH3 2HWD3 4OZOA 5FYMA 2GH2A 1UZ0A 1WCSA 1ZM1A 3CBNA 5LB6A 2HEYF 2XKPA 5FYBA 1OURA 3SH4A 2WLQA 4RGAA 4YW6A 2YGLA 5DAQA 4HN1A 3VDCA 5FR3A 4QU1A 3AXDA 2R042 2WNUB 4YM2A 2JDMA 2EICA 2DVGA 1JH5A 4FPEA 4YZ3A 3HWJA 1PZ7A 4IXLA 3VHOA 2CV6A 3M8LA 1REEA 1PMIA 2VQ0A 3FJSA 1RHI3 3GBGA 4R9BA 4YGBA 3N9OA 1XXNA 4LBOA 1XB9A 1KXGA 4D6QA 2RR11 3AZXA 3RFRA 5DMYA 2Y38A 4MGTA 1ZRCA 3MLLA 4AOCA 4CP9A 1QJY1 2BVVA 4NVPA 1BEV2 4H7LA 3Q9OA 2HH9A 1QJZA 1EV11 4TYSA 2J7MA 3N35A 2BFUL 3PUSA 2WN2A 3BIWE 1FX5A 1SLCA 4D6RA 2P37A 1O4YA 4LR4A 5FKBA 3FLTA 3SEPA 3ZN6B 1R082 1ENRA 5E88A 3RNSA 5B4XA 3JQWA 4FOVA 4H55A 2EALA 4E2SA 4XTMA 1ZBA3 2VTXA 3ZFFA 1AYN1 1W3VA 3VZNA 4P9WA 2HWE2 2ZMNA 3OD0A 1VBA1 4YW4A 3SKJE 2WWUA 5FO9B 3WVJA 5GZEA 4LJHA 3WDVA 1G6NA 2JG8A 2J1RA 3I3QA 4YW7A 3RQ0A 3LFMA 4XW3A 3WDXA 3TEZA 1GQPA 1GBGA 5DZFA 1T6BX 2YBSA 4NRQA 1PGW1 1V6JA 2GMEA 3I97A 5BPXA 2F17A 5JSPA 1GNHA 4DXSA 3RS6A 2P3KA 1JHNA 1XE0A 3KB5A 4WV8A 4AHXA 2DWRA 3V0BB 4SBVA 1S0BA 3ME2A 3KGZA 4NO4A 4CUAA 1PVXA 3SEEA 3WW1A 5JMOA 1WKYA 2X5IB 1AR82 2BZDA 4PI0A 5CB7A 3JBG2 1BJQA 1HQNA 5FAXA 1W99A 4XURA 1YQ8A 4Y1XA 2WR9A 1ZVFA 1JZ6A 4Q2FA 4A6SA 2TBVA 1C3HA 1IHMA 3K4AA 1JBCA 4OQ9A 2R1BA 3ZYJB 5KHJA 2GP3A 2FCVA 1N1SA 2VCAA 3GZTB 2YU1A 5CISA 5DAPA 2ZXQA 5A7WA 4RQPA 3AXEA 1MZ5A 2RS12 1YRZA 4FXGB 4N7IA 4QAWA 1VJ2A 1LKNA 2WAAA 4RN5A 4XQ4A 1W06A 4UW4A 4NHMA 5ABJC 4FPOB 5T50A 4B8EA 3BALA 2R16A 4AZZA 4CEYA 4Q4Y3 4PDWA 2D6KA 3ZN6A 4EZ4A 1JOJA 1BVP1 4WM8B 1RB8G 2JECA
chains in the Genus database with same CATH topology
1OXCA 1UZVA 5HCHA 2VUCA 2JDYA 5A6XA 1OVPA 2VNVA 1W8FA 1W8HA 1OURA 1OUXA 3ZDVA 3DCQA 1OVSA 5A6YA 2JDUA 2BV4A 2JDMA 2BOJA 2BP6A 4CE8A 2JDPA 2BOIA 2JDKA 1UQXA 2CHHA 5D2AA 5A6ZA 2JDHA 2XR4A 1GZTA 4UT5A 2VUDA 2WRAA 5A6QA 5A3OA 1OUSA 2JDNA 2WR9A 5A70A 4AOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXC A;  1UZV A;  5HCH A;  2VUC A;  2JDY A;  5A6X A;  1OVP A;  2VNV A;  1W8F A;  1W8H A;  1OUR A;  1OUX A;  3ZDV A;  3DCQ A;  1OVS A;  5A6Y A;  2JDU A;  2BV4 A;  2JDM A;  2BOJ A;  2BP6 A;  4CE8 A;  2JDP A;  2BOI A;  2JDK A;  1UQX A;  2CHH A;  5D2A A;  5A6Z A;  2JDH A;  2XR4 A;  1GZT A;  4UT5 A;  2VUD A;  2WRA A;  5A6Q A;  5A3O A;  1OUS A;  2JDN A;  2WR9 A;  5A70 A;  4AOC A; 
#chains in the Genus database with same CATH topology
 1KEX A;  4TLF A;  4HAN A;  1CAU A;  4Q27 A;  1R64 A;  2JE9 A;  1MQT B;  3KWV A;  3O7O A;  1OVP A;  4DIN B;  5FIX A;  2WL1 A;  3FHA A;  4QB6 A;  1S2E A;  3LGR A;  1Y9G A;  5C3O A;  2P1B A;  3M3Q A;  4IV3 B;  1RMU 1;  5EJZ B;  1H6X A;  5K0U B;  3P6B A;  3RI8 A;  1Y9M A;  2VXR A;  1ND2 A;  3UKN A;  5KHI A;  5GZD A;  3U4X A;  5CG9 A;  4IGO A;  1DBN A;  2JDK A;  2VMC A;  4L2N A;  3MIH A;  1UU5 A;  4XZU G;  3POG A;  3WP6 A;  4ZZ5 A;  1HRI 2;  1IG0 A;  1ULE A;  1S55 A;  4R8H A;  3WNL A;  3RYR A;  1ODN A;  3Q8A A;  4CXY A;  5GLU A;  2IXJ A;  1ENX A;  1V9U 3;  1OLR A;  2LM3 A;  5JOY A;  2WUH A;  2QQI A;  2W9X A;  3LKJ A;  4PIY A;  3J8F 3;  3SCG A;  4AVC A;  1GWL A;  2VNO A;  4ZU7 A;  3I2O A;  4LBL A;  1OT5 A;  2CWS A;  4FFI A;  4Y5S A;  3O1O A;  2QZ2 A;  3A0K A;  3HBZ A;  4EN0 A;  4HPK B;  5FFO C;  4XBL A;  2PAM A;  2VU9 A;  3OEA A;  3AP5 A;  4Q4V 3;  1CIY A;  1NX9 A;  3LOI A;  4CDW A;  1HKD A;  2R07 2;  4BQ2 A;  3VBF A;  2QDR A;  3ZIX A;  4RR3 B;  2ZHK A;  1RUI 1;  2IZW A;  5L36 A;  2CTV A;  2BNM A;  1RUE 2;  1DGW A;  3NJY A;  4H3W A;  3VDD C;  1PIV 3;  1DGR A;  2ATF A;  2G1M A;  1SDW A;  4XIK A;  5EPA A;  1PHM A;  1JTZ X;  2LRO A;  4MET A;  3ZFE B;  5JMC A;  3ZYG A;  2GNB A;  3AMM A;  2DCJ A;  5I91 A;  1H0B A;  1O4Z A;  4N7U A;  2OVU A;  2B9U A;  1I9R A;  2BV4 A;  4XXA A;  2Y6K A;  3O1M A;  2D6N A;  2QQM A;  4FFG A;  4UAP A;  2G4I A;  1X82 A;  2QBX A;  4XUN A;  1NY7 1;  1OFN A;  3RRD A;  4MYE A;  3FBY A;  3JZV A;  4P9Y A;  4QGL A;  2D3R A;  3HNM A;  2RS5 1;  4IGP A;  1PGS A;  4A41 A;  3O1V A;  1DG6 A;  3DYO A;  3T09 A;  5FLI A;  5C3Q A;  5G05 L;  3OBA A;  2FDH A;  2ZPX A;  1CPN A;  1PO2 2;  2BNN A;  4AI8 A;  4CCL A;  3DF0 A;  4FOY A;  4H7M A;  5C9A B;  3ITQ A;  1LOD A;  3T0B A;  2R04 3;  5KHH A;  3OB8 A;  1YUD A;  3M7A A;  5ACA 1;  1L7Q A;  3R4S A;  4YVW A;  2JEM A;  4GWM A;  4R9A A;  4X6R B;  2ARX A;  2WWS A;  4RD7 A;  4BCU A;  2RJK A;  2ET7 A;  1CAX A;  1O59 A;  4R4X A;  5L7O C;  4HON A;  5D8A C;  1XOY A;  1WZX A;  5JDB A;  5KHG A;  3B93 A;  2E6V A;  1X8M A;  4LBQ D;  4AED C;  1KDM A;  4QX1 A;  3VKO A;  4LHK A;  2GAL A;  4NWV A;  4OHX A;  4Z82 A;  2YRO A;  1PK6 C;  4YFZ A;  5CYY A;  4IET A;  4KWK A;  3W5N A;  2LAL A;  1YXW A;  3I3D A;  3BVC A;  5JXJ A;  1RUJ 3;  2EAA A;  2ZML A;  2R06 3;  2WFF 1;  3MO4 A;  1JXN A;  3WF1 A;  1C8M 2;  1IOA A;  1R08 3;  3WNN A;  3C7H A;  1X36 A;  1DGL A;  3HMY A;  3WT3 A;  3N9Q A;  3UKT A;  2MEV 2;  4QQL A;  3U10 A;  3SNM A;  5AFE A;  1PVC 2;  5BNN A;  5B2G B;  1VIW B;  2KR2 A;  3AL6 A;  3NV1 A;  2HWE 3;  3VDD A;  2BP6 A;  1ENS A;  3T1L A;  5FTT C;  2CAV A;  2PMW B;  2VXJ A;  2QQO A;  3PL0 A;  1TMF 3;  2QVS B;  3VBO B;  2W68 A;  4CCO A;  3GHN A;  4CUG A;  1YJL A;  3ZIW A;  1RUC 1;  3DKQ A;  2EF6 A;  3QOP A;  2E31 A;  1JYI A;  3T30 A;  3MBW A;  5FY7 A;  1SCR A;  5T54 A;  2J1A A;  1LEN A;  1X7N A;  4BIO A;  3VD4 A;  2GC1 A;  4B29 A;  4Q0P A;  3FWE A;  3OUJ A;  5KC6 A;  4MUV A;  3HEI A;  5E6H A;  4HVR A;  2BEO A;  4N43 A;  4XOG A;  1V6I A;  2Q8E A;  3OEB A;  5FMO L;  3BCW A;  2WNU C;  2WA3 A;  4FPF A;  3HOB A;  4JGY B;  3H50 A;  4AFC A;  5C33 A;  5C4W B;  4K7J A;  3LPG A;  1AR8 3;  3POS A;  3T2Q A;  1CON A;  1HV0 A;  1F35 A;  3JBG 3;  1O7F A;  5KHK A;  4HL0 A;  4Y20 B;  2VO5 A;  4IEP A;  4TN7 A;  3H0O A;  1ZRD A;  2D6O X;  3I2J A;  1S2B A;  1K5M A;  4BLJ A;  1OH4 A;  4DUW A;  1YJK A;  4ORF A;  2WYS A;  3GJB A;  4QKB A;  4Y22 A;  2YC4 A;  3IDB B;  3RWK X;  1C5I A;  4PT6 A;  4PIX A;  4AYU A;  4OI0 A;  2A75 A;  1XYN A;  4QMA A;  3EB7 A;  1IG3 A;  3VBS C;  4CVU A;  2LS6 A;  2CY6 A;  4COV A;  5CVR A;  3KSC A;  4JGZ B;  3WP4 A;  1QXJ A;  4IV1 A;  2WAO A;  5IK7 A;  4QGM A;  1LRH A;  1VP6 A;  2BU9 A;  2GSY A;  3WW3 A;  3DXT A;  5FKC A;  5AC9 2;  4K3U A;  1OLM E;  1KFU L;  3VD7 A;  1QKQ A;  1UD1 A;  2WSU A;  4XJ9 A;  1UQX A;  1UOJ A;  1CR7 A;  2UWC A;  2XJT A;  2Y0I A;  4GQ7 A;  4QWN A;  5A7S A;  3ST7 A;  3ZFG B;  1QU0 A;  4ASK A;  1QJE A;  4B4P A;  4CP9 B;  1LAJ A;  4AFD A;  4YPJ A;  2VNG A;  4GWJ A;  2ZGU A;  3I3B A;  4HMZ A;  3VZK A;  1YIP A;  4QB1 A;  3KQ4 B;  1GU3 A;  1S0I A;  3OG2 A;  2I74 A;  1YLL A;  4YW5 A;  4CRQ A;  1XBF A;  2D7F A;  1HV1 A;  3JD7 1;  5ISL A;  3J7L A;  3KF3 A;  5FYV A;  4A3X A;  2YPD A;  2EA7 A;  5FOB B;  3TEY A;  2X5I C;  3LA2 A;  3LIG A;  4MXW A;  1AXK A;  4LBK A;  4DS0 A;  5BNO A;  3ZFF B;  3RZZ A;  3ZO0 B;  3ZYH A;  4XF4 A;  1MZE A;  2W1Q A;  4BQY A;  3U07 A;  1G9F A;  2XBO 1;  4COZ A;  3IDA A;  3AMN A;  1DQ0 A;  4QPI C;  3FE5 A;  3KCC A;  4QPG B;  2A6Y A;  2JG8 B;  2JB8 A;  3GYD A;  2ZX0 A;  4UF0 A;  2CGO A;  3ALQ A;  1BBT 1;  1SFP A;  1SCS A;  4CEW B;  1HJF A;  1DDL A;  2RR1 2;  3WXP A;  3O1P A;  1SLA A;  2R49 A;  3M3C A;  3BYW A;  1H1A A;  3ZSM A;  1QJY 2;  3HNB M;  3AC0 A;  4CU9 A;  4LBQ A;  1EV1 2;  2WZE A;  4NRP A;  4ZS3 A;  1OC1 A;  1HXS 1;  1YCI A;  4MHU A;  1MS4 A;  2R07 3;  1H8T A;  1T6G C;  3QH6 A;  4MHR A;  1H1I A;  1J59 A;  2NPI A;  2V4A A;  1J3Q A;  1RUE 3;  3ZR6 A;  4D6S A;  1W2T A;  1STM A;  2AZ5 A;  3M4F A;  5JVV A;  4KMQ A;  4WM8 C;  1ZRF A;  4AHY A;  2WS9 1;  4KGQ A;  1UO9 A;  5KC5 A;  4AF9 A;  5HPO A;  3VBS A;  1Z78 A;  2XLG A;  3TEW A;  1MQT C;  5J48 A;  1AYN 2;  1YFX A;  3ZYP A;  2W92 A;  2ZGO A;  4UBG A;  1MS9 A;  2Y6F A;  3U78 A;  3RZK A;  3OD4 A;  3EHK A;  5A7W B;  3MPP G;  4RQP B;  4N53 C;  1EAH 1;  5K0U C;  2Y34 A;  3IT8 A;  1VRH 1;  4YVS C;  1W8O A;  2JG9 A;  1SG3 A;  3JXS A;  1AL2 1;  1HDK A;  2I45 A;  3J4U H;  5EHD A;  1NQJ A;  2SLI A;  1W39 A;  5F6L B;  1PGW 2;  4DNY A;  2FCT A;  1XRU A;  1XU1 A;  2W5F A;  3RI9 A;  4NE9 A;  1HQW A;  1ULO A;  1VAL A;  3IKW A;  1V6M A;  4CEY B;  1FAY A;  2XJU A;  1PO2 3;  5FLJ A;  4S2F A;  3UV9 A;  3OBZ A;  4KBB A;  4LIU A;  1JOD A;  1RC6 A;  1CAU B;  3J7H A;  2G9Z A;  4IE6 A;  3MZH A;  1FNZ A;  4EN8 B;  1D4M 1;  1UKR A;  1QOT A;  2Y8K A;  3IN9 A;  1WLD A;  4K1Y A;  5BNP A;  1Q43 A;  4NRM A;  3UES A;  5GAL A;  3A22 A;  2R30 A;  4AAP A;  3M3I A;  1ZA4 A;  2IVI B;  4CDX A;  5FZ0 A;  4GB3 1;  5FJK A;  3LCP A;  1ND2 B;  4LO8 A;  3AYD A;  4QHO A;  5FK8 A;  5A1A A;  4LQR A;  5LBF A;  2WA4 A;  2FD8 A;  2K2S A;  1GP5 A;  4X8P A;  5JPN B;  3PMS A;  5CFD C;  2ZEZ A;  3EO6 A;  4XF3 A;  2PHR A;  3DPR A;  4Q1R A;  3ZPO A;  3KV9 A;  4LOR A;  2VBB A;  3NAP A;  4RR3 C;  1ZRI A;  5T5P A;  3KT4 A;  1OBN A;  4CCN A;  2RJ2 A;  3W9A A;  3V64 A;  3ACL A;  1MR5 A;  2C1F A;  2J1T A;  3KZ4 C;  3AM2 A;  4CCC A;  5FOJ B;  1W28 A;  1HRI 1;  1C8M 3;  1FYU A;  1JS9 A;  3PUA A;  3QCW A;  5FY9 A;  4OI1 A;  1OOP A;  3FL7 A;  3U1X A;  3ZFE C;  1O5L A;  3THC A;  3ASI A;  5FZL A;  1DP0 A;  1SAC A;  1JN2 P;  2WFP A;  2DDU A;  2WT2 A;  4M01 A;  1W03 A;  5IUQ A;  3V0A A;  4ZXE A;  4XUO A;  4XET A;  4RYD A;  4GAL A;  5T5L A;  4FSJ A;  2VVE A;  2EXH A;  5DDJ 1;  5FP8 A;  4IE7 A;  3VZM A;  3RWN A;  4XCA A;  4AE2 A;  5E89 A;  1OVS A;  1E5I A;  1UXZ A;  4CDW B;  3PVN A;  3TYJ A;  5FYU A;  5FZM A;  3NVC A;  5HXM A;  1ONA A;  1RMU 2;  5I0U A;  2EID A;  3VKN A;  2R0F A;  3EMR A;  3VBF B;  1I5Z A;  4EJR A;  3PDQ A;  2B45 X;  3NNM A;  4QD2 A;  4RHV 1;  1UAI A;  2CSG A;  2UY9 A;  2VMI A;  4O9G A;  5E1R A;  3FC0 A;  3O14 A;  1IKP A;  2ARA A;  2JWP A;  3JB4 C;  1LOG A;  2DBI A;  4K8R B;  2OQ6 A;  5LK5 A;  5C9A C;  5CBL A;  4LMF A;  1IGO A;  5JZG A;  3A21 A;  4QQ2 A;  3ZN4 A;  2WO3 A;  1QNW A;  1ND3 A;  1FPN 1;  2DU0 A;  2DCY A;  3KLS A;  4MGS A;  2FZ1 A;  1JZ2 A;  5B4N A;  4DXT A;  1GKB A;  3WSO A;  4HN0 A;  4NJ4 A;  3WNO A;  3G6J B;  3I54 A;  3M1H A;  5IW0 A;  1UL9 A;  3SKV A;  3QBQ A;  4ASM B;  1UOB A;  5IYY A;  2V5Y A;  5SV5 A;  4XHB A;  4DRV A;  1MS8 A;  4OYU A;  1XNB A;  2XJS A;  3NRU A;  5BYN A;  3POB A;  5F32 A;  2VZS A;  2Z79 A;  3CU7 A;  4JQR A;  4LA3 A;  5IAT A;  1CZS A;  1Z7S 1;  3TN9 1;  1NLR A;  1ZZ7 A;  3ZOI A;  1RUI 2;  3ELN A;  1GQH A;  2BFU S;  4PQQ A;  2BUK A;  4LE3 A;  1GZC A;  1VMH A;  2WQZ C;  4N9H A;  4GAZ A;  3W5M A;  1Q3E A;  2RMU 3;  4FAH A;  3SIT A;  2GMM A;  3W20 A;  1OD5 A;  5CAD A;  1AR6 3;  3D6E A;  1I3H A;  1S4C A;  2XQX A;  2Y33 A;  2YC2 A;  2DF7 A;  3ZXG A;  5JIU A;  2HWB 2;  4BWO A;  1F4H A;  1S0G A;  3MFA A;  2LUW A;  2ZGR A;  1AR9 1;  4RGG A;  1SLT A;  4F7Z A;  1NY7 2;  3X29 B;  1E5S A;  1GZT A;  3NQH A;  1UNB A;  1H2L A;  1WMD A;  2RS3 1;  2ZJC A;  3RG0 A;  3ZSK A;  4A42 A;  1VRB A;  4MG2 A;  3WUD A;  3NJV A;  4GJY A;  2PTM A;  4YAR A;  3VD9 A;  1LOE A;  4GZ9 A;  3GBF A;  4R4Z A;  1TNR A;  1WD4 A;  3SLI A;  4EN6 B;  5BNN B;  5HCA A;  4Q0S A;  4RS5 C;  3R4U A;  2N7G A;  2QTW B;  1HB2 A;  2P3I A;  1DZQ A;  2HWF 3;  2MEV 1;  5FXV A;  3VDD B;  1GOH A;  2H6B A;  4HOO A;  5IVJ A;  3IDC B;  4FVV A;  4OUS A;  1GOG A;  5ACA 2;  2W46 A;  1W8N A;  1TE1 B;  1WMX A;  5FUN A;  2HBU A;  2XHK A;  2P2K A;  1JZ5 A;  1X9P A;  2VOK A;  2GP5 A;  3BB6 A;  1UU6 A;  2ZKL A;  4R9D A;  4EQV A;  4ZXK A;  1AVB A;  5KXE A;  1NYW A;  4XCB A;  1BKZ A;  2ES3 A;  1KFX L;  2RR1 3;  2YMZ A;  4QX7 A;  1O3Q A;  2QQK A;  2Q1Z B;  1JYC A;  2VQT A;  5FYZ A;  4N43 B;  2AEN A;  3LPF A;  3WIN E;  4BQ3 A;  1QJY 3;  2OX0 A;  4ZS2 A;  5FZC A;  4XXP A;  4YZ1 A;  1EV1 3;  4XUQ A;  5H9P A;  5LK7 B;  5FZH A;  4CP0 A;  2ZCW A;  5JUV A;  5A33 A;  3VL8 A;  2WFF 2;  1NXD 1;  1UYX A;  2P3J A;  1ZNP A;  3RYP A;  3I4I A;  2J22 A;  3N9L A;  3OGR A;  3MIG A;  4A7Y A;  5JIA A;  3HQU A;  4NHX A;  1ZRE A;  1K5M B;  2H6C A;  5A32 A;  1JYW A;  3BU7 A;  1U0A A;  2VCB A;  4YZ2 A;  1OPM A;  1AYN 3;  1QHD A;  1RVF 3;  1FV2 A;  4UFJ A;  2KM2 A;  5D2A A;  2CGP A;  4Y22 B;  1VBA 3;  3KV4 A;  3NJX A;  1GAN A;  5EQU A;  4G4F A;  2C9K A;  3AMH A;  2WNO A;  2OKX A;  5L7O B;  4Q5O A;  4AR2 A;  1JYV A;  5FUI A;  1AJO A;  4CCM A;  5EIY B;  2FHR A;  4PI2 A;  1YYN A;  1J1L A;  1WCD J;  3IIA A;  1RUC 2;  4M3C F;  4ONU A;  3IBM A;  5LA1 A;  4BZ4 A;  1W6O A;  1VBC 1;  4FAG A;  1POQ A;  2J42 A;  4W6X A;  2TEP A;  5DXD A;  3M3E A;  4IV1 B;  3ZYR A;  1PK6 B;  1WWY A;  3FFZ A;  3ZFF C;  4TZD A;  4HZF A;  4M4P A;  3N3H A;  3RGB A;  2A71 A;  4D7T A;  1UOG A;  3N7M A;  2W1S A;  1CZV A;  1GMM A;  2JG8 C;  4E4Z A;  5AC9 1;  3WCS A;  4XFA A;  2DFB A;  2V5D A;  3KHB A;  4UOJ A;  3WG4 A;  1H4H A;  2BOI A;  4RL7 A;  1F15 A;  5C7G A;  1K12 A;  5FK7 A;  2F6B A;  3LEG A;  2EIB A;  4I02 A;  4JKM A;  4C90 A;  2W91 A;  1MS1 A;  2TNF A;  1AHS A;  5J7M A;  2JDN A;  4S2G A;  1WA6 X;  1I6X A;  4YSF A;  3SH3 A;  4DFS A;  1OA2 A;  2XXZ A;  3PTR B;  1NXM A;  3THT A;  4MXW B;  4Q4X 1;  5LA2 A;  2F4P A;  4WZC A;  3HN1 A;  2VAU A;  2DYC A;  5BNO B;  3D0J A;  1WLT A;  1W6M B;  2WJS A;  3K51 A;  1MS5 A;  3VD3 A;  3WZ1 A;  4Q8L A;  3ZR5 A;  3PJY A;  1VR3 A;  1W9W A;  1AR6 2;  2WO7 A;  3T0D A;  1CWP A;  3UKV A;  1OA3 A;  4UF0 B;  1CX1 A;  4WZF A;  4IEU A;  3ACH A;  1KIT A;  1XPW A;  4LIV A;  4TTG A;  2FBE A;  1A3K A;  3POY A;  3S7I A;  4AWD A;  1L3J A;  2DTW A;  4FFF A;  1PM7 A;  2XJQ A;  3RZL A;  4IES A;  3RYK A;  3OYW A;  2A1X A;  2R1D A;  3QH7 A;  1OA4 A;  4RQP C;  2VW1 A;  1H1M A;  3MV0 1;  2VW0 A;  3PME A;  3HQX A;  5F3C A;  2D6M A;  4XFG A;  2XHN A;  3ZLI A;  2QE3 A;  4JDO A;  5J98 B;  1UZW A;  2ERF A;  3OBR A;  2W47 A;  1RMU 3;  2P17 A;  1R09 1;  1ZZB A;  1OUX A;  4M00 A;  4QX8 A;  4OUE A;  3VDA A;  4CEY C;  2VZQ A;  5EYY A;  4O9E A;  3C8X A;  3JD7 2;  4QT6 A;  4PDW C;  1LHV A;  1NZC A;  5FBZ A;  1VAM A;  1JUI A;  1O4T A;  3VBS B;  1HB1 A;  1Q8Q A;  1RIR A;  2OUH A;  2Q8D A;  1N3O A;  2JIG A;  2CNA A;  1B09 A;  2XBO 2;  4YW1 A;  5LEK A;  2RE9 A;  2Z4F A;  4NMI A;  3IB3 A;  3BGA A;  4LXL A;  2DVB A;  1B35 A;  1QJU 1;  2QKD A;  3GZU C;  1JW6 A;  1YWK A;  3AZZ A;  1BBT 2;  1ND2 C;  1WCU A;  2O1Q A;  3CLP A;  4Y1Z A;  3DXU A;  1SFN A;  5M0T A;  1XYO A;  2B46 X;  3POJ A;  1NUK A;  5C5T A;  1D7P M;  1G9B A;  3OUI A;  2O14 A;  3PJQ A;  2VQU A;  3NV4 A;  4AHZ A;  4YGE A;  1HLC A;  3P5B A;  4I2O A;  4P9X A;  3C2U A;  2PHT A;  5FLH A;  3OOX A;  3TEX A;  1HXS 2;  1KDK A;  1DQ1 A;  2GN7 A;  1RIN A;  1H30 A;  2EVX A;  2PLV 1;  4HVQ A;  1DQ5 A;  4JHT A;  3H8O A;  2YUE A;  3I59 A;  4CTE A;  1GUI A;  1RUI 3;  2XML A;  3I2D A;  3WNP A;  5BNP B;  1KS4 A;  3E97 A;  4MZU A;  4I01 A;  5J96 B;  2WS9 2;  2P6C A;  1EPW A;  4QDR A;  1YQC A;  3LDB A;  3O1S A;  2WSV A;  5C71 A;  3H8X A;  2E7Q A;  4QPI B;  1J3R A;  4AQ2 A;  4EE2 A;  4CDW C;  1DQ4 A;  4BIS A;  4LHS A;  1KJL A;  3BPS A;  1QGL A;  2PHW A;  4PIZ A;  3I2H A;  3VBF C;  1EAH 2;  2Z2S B;  4NHL A;  1VRH 2;  3LFI A;  3TWI A;  4DY3 A;  1QJX 1;  3S0M A;  1AL2 2;  2X53 S;  3THD A;  2GAU A;  1JYT A;  2VZT A;  2RS5 3;  3AB0 A;  1OOP B;  2ZGM A;  2E33 A;  1WMF A;  1C28 A;  1QH6 A;  4XBQ A;  1D2S A;  2ILM A;  4M3C E;  4QPW A;  3TNP B;  3D82 A;  5I93 A;  5F8P A;  3V0A B;  4YNI A;  5F3G A;  1K45 A;  4XDP A;  4BK5 A;  1XNA A;  2WC2 A;  4FPG A;  4JKK A;  4QDQ A;  5IK4 A;  1D4M 2;  5ACA 3;  5E8A A;  4Y4R A;  1DYK A;  4BQ5 A;  4IDZ A;  3L2H A;  4YWA A;  2Y64 A;  2W94 A;  5DG2 A;  1MEC 2;  3A0N A;  2JIJ A;  4NAO A;  4BMB A;  5FZ9 A;  2A6Z A;  3CDZ B;  4GB3 2;  4XHX A;  1QQP 1;  1DF0 A;  4YLZ A;  2ZKN A;  1O5U A;  4ASL A;  3H3U A;  4NII A;  4N53 B;  2VC9 A;  3IMM A;  2J1S A;  3BOW A;  4YVS B;  1S0E A;  1CJP A;  2I07 B;  3N4M A;  1VB2 A;  4O7X A;  3ZXE A;  5LY2 A;  2WII B;  3LZZ A;  1YI7 A;  4KQ7 A;  4AI1 A;  5JZG B;  4YVW C;  4OHY A;  1I5P A;  1I1E A;  2WN3 A;  5FZD A;  1ND3 B;  3GGL A;  2OS2 A;  2WQ4 A;  1UYP A;  4Q0Q A;  2NN8 A;  3NW4 A;  1W6P B;  5FRA A;  1RTV A;  2WDB A;  2FDI A;  3KV5 A;  1DCS A;  4D0Q A;  1R1A 1;  1KD7 A;  2JXA A;  2C0Z A;  1XSQ A;  3TOJ A;  1OQD A;  5FZ4 A;  2PEL A;  3WQ0 A;  3ES4 A;  5JPM B;  2WLP A;  1Q8V A;  2BTV C;  5DDJ 2;  4CDU A;  5LA9 A;  4EN7 B;  2RV9 A;  3T2O A;  2O0O A;  4XJ8 A;  5FZ3 A;  3WQ1 A;  4AG4 A;  4EWA A;  1QH7 A;  2VZR A;  4WM7 A;  1ASJ 1;  1SMV A;  4AEK A;  1W8W A;  2OUJ A;  4RHV 2;  3OGV A;  5CFD B;  4XFI A;  5C3S A;  4COW A;  5FP3 A;  3AJZ A;  1LUL A;  3B3Q E;  5BNN C;  3RDI A;  1M4W A;  1FXZ A;  4JRL A;  5FPB A;  3L9J T;  2VW2 A;  1U5I A;  4I0W B;  5FZF A;  2HWC 1;  2VOX A;  1GYK A;  1AR7 3;  4BXF A;  3MYX A;  1FPN 2;  1JU4 A;  4XJZ A;  3GZE A;  2XWB B;  5JXG A;  5AFB A;  4QKN A;  2AEY A;  3BU0 A;  3D3A A;  1F2N A;  1YQ6 A;  2HWB 1;  4U2A A;  2IVJ A;  5H9Q A;  3WLU A;  2XLF A;  4DOU A;  4QXK A;  4HLT A;  4LUL A;  4N43 C;  5FPV A;  3ZX7 A;  2ZA9 A;  1H6Y A;  1F4A A;  2VE1 A;  4I3G A;  5IK8 A;  2Y0O A;  4Q1P A;  3AYA A;  3C7F A;  3ZKY A;  3TBD A;  1GWM A;  1UYZ A;  2BGO A;  3RMY A;  4BU2 A;  5FXX A;  1M06 G;  4AVV A;  2Q4S A;  4I09 A;  2ZGT A;  1Z7S 2;  3TN9 2;  4K1Z A;  5JLV A;  1UY3 A;  4JRA A;  1ODM A;  1UIJ A;  2B8M A;  2X8K A;  3MDP A;  5CNA A;  3URF A;  3WNK A;  3ZPY A;  1K5M C;  4GMP 1;  4UI9 L;  1AUY A;  4L0P A;  4YRD A;  5HI0 A;  2Q8C A;  2W39 A;  3PNA A;  4P9G A;  1AJK A;  2SBA A;  4D8M A;  3VBU C;  1BYH A;  5CIR A;  1VLN A;  4CPB D;  5FBJ A;  3U75 A;  2QQJ A;  5JI7 A;  2DCZ A;  3CIH A;  5EYX A;  3KVA A;  4ARX A;  2GND A;  1AR9 2;  2BPA 2;  3H1M A;  1BEV 3;  1H2N A;  3H1Y A;  5FZE A;  5A33 B;  4L8Q A;  1C1L A;  2QZ3 A;  4IV1 C;  4Y24 A;  4CEW A;  3K75 B;  1DZT A;  1U5X A;  2NQY A;  2RS3 2;  1N3Q A;  2WZR 1;  2ZX4 A;  3RJR A;  3U14 A;  2ORZ A;  2X29 A;  5GZF A;  4AEJ A;  3PUI A;  1W6Q A;  1FOD 1;  3ZSE A;  3ORJ A;  3GXU A;  5FZ8 A;  4DB5 A;  5IFP A;  3PUH A;  3AZV A;  1OLM A;  1BCX A;  4XJU A;  2ARC A;  5LZ6 A;  3WW2 A;  2QJV A;  1GZW A;  5FY5 A;  2ET1 A;  2XBO 3;  3K3N A;  1VBB 1;  4KGG A;  5FYY A;  3NST A;  4MAD A;  2W1W A;  3ZXD A;  1APN A;  3RVH A;  1JI6 A;  2A73 B;  1BBT 3;  1F9K A;  3MLJ A;  1XND A;  4I0A A;  4XMI A;  5A1F A;  5HXV A;  5JOW A;  4GD4 A;  2VCM A;  2VZU A;  2FQP A;  2NMN A;  2ZEX A;  3S30 A;  3OGS A;  4XC9 A;  1CD3 G;  1LCL A;  5T3N A;  3PUR A;  5BNO C;  3GZA A;  2GC2 A;  5C6C A;  1D2Q A;  5JOX A;  1AX1 A;  1HXS 3;  2XJV A;  4QQH A;  1XC6 A;  1ULD A;  4W4Z A;  1Y3T A;  3PU8 A;  4GJZ A;  1XYP A;  4Z07 A;  4FO9 A;  1P8J A;  1PNG A;  4IEO A;  1A34 A;  3PTY A;  2VOV A;  1Y9Q A;  4RS5 B;  1V6L A;  2BDR A;  5A3U A;  2WS9 3;  4DY5 A;  3D4K A;  3PIG A;  4LKE A;  2XG3 A;  3KMH A;  3B02 A;  3POW A;  1ZBE 1;  2OW4 A;  2UY8 A;  1REF A;  3ATG A;  1W05 A;  4HKO A;  4XIO A;  2VM9 A;  4L97 A;  1H8T C;  3SC7 X;  4P9J A;  3ZMO A;  3K4D A;  1EAH 3;  4D3W A;  1VRH 3;  3VBU A;  4MGK E;  4OMD A;  5GM0 A;  1MS0 A;  1QNY A;  1V0A A;  4BJ0 A;  3P3N A;  1AL2 3;  1PIV 1;  1VBC 2;  2RS1 3;  4LHN A;  2QQU A;  2VUJ A;  5JR7 B;  2EIG A;  3HT1 A;  5LBC A;  3H9A A;  3HBK A;  4Q26 A;  2VH9 A;  2XH6 A;  3T0A A;  3POF A;  4OVE A;  1JOB A;  3AKR A;  5JOZ A;  1H8V A;  3M70 A;  1W0P A;  1PMH X;  3OYW B;  4BQX A;  1UF2 C;  3T08 A;  4ISR A;  1LU2 A;  1NCR A;  2P34 A;  1D4M 3;  3MPB A;  2BVB A;  2JG9 C;  1A6C A;  2FDG A;  4P9I A;  1PMJ X;  3BOP A;  3R4D B;  4NAM A;  4MV2 A;  3GHM A;  3NV3 A;  1RJ7 A;  3VL9 A;  2E51 A;  4NPL A;  3FX3 A;  1RL3 A;  2MNG A;  3WV6 A;  4GB3 3;  4MX3 A;  2HKX A;  3VBH A;  1H4G A;  1BVV A;  4URA A;  5GZG A;  2VEC A;  4EN9 B;  1RUG 1;  5JXI A;  1RUF 1;  5IVY A;  1QOO A;  4MOA A;  1J1T A;  4PF1 A;  1XSR A;  4Q4X 2;  4CSW A;  3RZG A;  2NMO A;  1X50 A;  1JZ4 A;  2LRP A;  4JZR A;  5J3U A;  1IS6 A;  3OBT A;  4AAX A;  4AGG A;  4EWD A;  4KBZ A;  5BNP C;  1CZT A;  4ZU5 A;  2PFW A;  2GMP A;  1EPZ A;  1HJG A;  1HRI 3;  2ZS6 B;  4CDX C;  1B35 B;  2WNE A;  2AH2 A;  4UFM A;  1OFS A;  2YPJ A;  3SQO A;  4AQS A;  2JDH A;  2ZEY A;  5A3P A;  2VGD A;  2PA7 A;  1GSL A;  1MS3 A;  1Q8O A;  3J7N A;  4LHL A;  3PVO A;  4N8M A;  3FFQ A;  1RUD 1;  4FXK B;  4NPM A;  4QDS A;  3DPR C;  4AFA A;  5I8T A;  1LJ7 A;  5FO7 B;  3UJQ A;  5DDJ 3;  3NAP C;  5BNQ A;  3UET A;  3BUC A;  3KCX A;  5CKN A;  2XDV A;  2D93 A;  1KQR A;  2R06 1;  4LK7 A;  2NLR A;  4Q8K A;  2CL2 A;  5DN2 A;  3EQE A;  4LPL A;  1R09 2;  1U5Y A;  1OOP C;  2YDE A;  4AHW A;  3THP A;  5CFC C;  3I59 B;  5IVF A;  1UX6 A;  4RHV 3;  1LU1 A;  5A3W A;  3T2T A;  1XNT A;  5APA A;  4AEM A;  2VPV A;  5A3M A;  5K4L A;  2J1V A;  4OZX A;  4NUB A;  4MXV A;  5FPA A;  5T52 A;  1XJA A;  1UY4 A;  2H0V A;  1N47 A;  2VME A;  2GNM A;  2VTX J;  3CF6 E;  4P02 B;  1CPM A;  4XFF A;  3I2F A;  4K6B A;  5FUP A;  3WF2 A;  3VHP A;  3C7O A;  1DYP A;  5CU1 A;  1FPN 3;  5DPN A;  1ZYB A;  4XDQ A;  3AVS A;  1DHK B;  4ITC A;  1LGC A;  4BHP A;  3S6P A;  1KRI A;  1SEF A;  3AJY A;  1QJU 2;  2JDZ A;  2XGX A;  1RUO A;  4Y1Y A;  4LBJ A;  4YGC A;  5FPL A;  4B3N A;  2IXI A;  5LBB A;  3GAL A;  3B5L B;  2I2S A;  5GZC A;  2PYT A;  4Y1V A;  4CUB A;  3GF6 A;  3A7Q A;  1O3R A;  2NM1 A;  5JZG C;  5BUV A;  4LO4 B;  1DGR N;  1UPI A;  5L9R A;  5JCT A;  3K46 A;  1QXP A;  1ND3 C;  4KL1 A;  4AFB A;  3O0X A;  1IZ3 A;  3WF3 A;  2PLV 2;  2J1U A;  3O0V A;  1Z7S 3;  4YGD A;  4PDW B;  3TN9 3;  3WNX A;  4A6O A;  1AF9 A;  2GC3 A;  4GH4 A;  1QEX A;  2DV9 A;  5A80 A;  3H7Y A;  1JU3 A;  2WKK A;  1COV 1;  1EY2 A;  5KWR A;  3KM5 A;  4XZP A;  4ATF A;  3M2M A;  4GXL A;  2D6P A;  3VV1 A;  4KNC A;  2Q8O A;  2BRT A;  4E2Q A;  4C1X A;  5KXB A;  1JZ7 A;  4P5Y A;  1UY1 A;  5HCB A;  1MEC 1;  1LOB A;  1W2N A;  3USU A;  2FZ2 A;  3I3E A;  2BJS A;  4GWI A;  3ZMN A;  1FNY A;  1AXZ A;  3KVB A;  1JZ3 A;  4BE3 A;  3HD8 B;  4UWD A;  1MVE A;  3IAP A;  4Y3O A;  2P5B A;  5EJ3 A;  3ZYI B;  1QJX 2;  5FMD A;  4Y4Y A;  1LHW A;  1JYN A;  2OZ6 A;  2RS3 3;  3WP3 A;  1GNZ A;  3PU3 A;  1NA1 A;  3P3P A;  3BTX A;  2DUQ A;  4GKX A;  4YM0 A;  4N9I A;  4SLI A;  4WBB A;  5CFC A;  2ARB A;  2ZAB A;  4XAC A;  4BOW A;  1POV 1;  4ZZ8 A;  1LGB A;  2MEV 3;  3VZJ A;  4W6Y A;  1PVC 3;  4DUX A;  4XBN A;  4XAB A;  4M4R A;  1YFY A;  2Y6G A;  1DGW X;  1PNF A;  4IEY A;  4WM7 B;  2DVD A;  4KH9 A;  1VB4 A;  4LOS A;  1WCQ A;  3CEW A;  5FQ0 A;  1QQP 2;  2LTN A;  2E63 A;  4MGQ A;  4BIF A;  1UZZ A;  2JE8 A;  1J84 A;  1PX3 A;  4LBM A;  1O8P A;  4URT A;  1CN1 A;  1SPP A;  2CHH A;  2YFU A;  5DQ0 A;  4CCJ A;  2BBV A;  5LA0 A;  4XE9 A;  2Y60 A;  4YW3 A;  1VAK A;  3ZYB A;  2PQS A;  2WT1 A;  3OCP A;  1KJR A;  2RM2 1;  2E26 A;  4LUM A;  2D5F A;  5K7P A;  2BER A;  3HJR A;  3C7E A;  4E4D X;  4RGK A;  2VJX A;  4ZY9 A;  3PHM A;  2E53 A;  1VE0 A;  4AI3 A;  3V65 A;  2VY0 A;  2EXJ A;  2YC0 A;  1R1A 2;  2YY1 A;  3KT1 A;  2GN3 A;  3NNG A;  4V2V A;  4CA9 A;  4AI2 A;  4DO0 A;  4HBN A;  1CGP A;  1DYO A;  4Q0U A;  1W3X A;  4XF0 A;  1VMF A;  3PVE A;  4OMC A;  5A3T A;  2DVA A;  4QPY A;  3ECQ A;  1YEW A;  1S0F A;  4FPL A;  4IV3 A;  1VBD 1;  3O1T A;  1MAC A;  1IPJ A;  1ASJ 2;  4YW2 A;  5C3R A;  3UNP A;  3E1F 1;  1VBC 3;  1W2O A;  2WWJ A;  2YHJ A;  3ON7 A;  4W6W A;  1CAW A;  4HKL A;  4UFH A;  1SBE A;  4EV0 A;  4YVW B;  4FT8 A;  3AX4 A;  3FN9 A;  1LOC A;  1VBE 1;  1HRV 1;  1RGS A;  2W87 A;  4LO7 A;  5HV0 A;  1CAX B;  5I0S A;  4JQT A;  2HWC 2;  5AC9 3;  3JCI A;  4FP3 A;  1QY4 A;  1TVG A;  1IPS A;  5H9R A;  4IL7 A;  4HXC A;  5LAT A;  4XYX A;  4FQ4 A;  4JX0 A;  3N9P A;  1SBF A;  4IE4 A;  4BA6 A;  4A2U A;  3OF1 A;  4W50 A;  4ARY A;  2CYF A;  1LB2 A;  3SHR A;  5KXD A;  2CAU A;  5FZ7 A;  3OGG A;  4XTP A;  4FOQ A;  1DQ6 A;  3ES1 A;  4LTA A;  1GOF A;  1G86 A;  4IND A;  1TME 1;  4Q4W 1;  3UK9 A;  4AGV A;  1QXR A;  1Y7B A;  1W6Q B;  3CZJ A;  3OPT A;  4MO3 M;  5AVA A;  1V6O A;  1WME A;  4CUC A;  3F95 A;  3E6D A;  3DGT A;  4QB2 A;  1F5J A;  4ZPI A;  4Q4X 3;  1GZW B;  4MH0 E;  1LNS A;  3GM8 A;  3LDK A;  4O65 A;  2ENR A;  3MIF A;  3ZYF A;  4AFM A;  3NO8 A;  1TEI A;  4NN0 A;  2OPK A;  2D43 A;  4UYB A;  3ZDV A;  5F2W A;  5IVB A;  1UIK A;  4DPN A;  2DUR A;  2DCT A;  4KWL A;  3DEC A;  3I2K A;  3MIC A;  4ZON A;  5F5A A;  3SIS A;  3VBR A;  5LWB A;  1NCQ A;  3BI3 A;  3OPW A;  3ZVX A;  1FMD 1;  1S2K A;  1LOF A;  2ZTN A;  3Q8B A;  3W58 A;  5LEJ A;  3AP6 A;  2RDR A;  3LEK A;  3UGF A;  3BN6 A;  3VKM A;  4AQ6 A;  1LHN A;  2YB7 A;  1GWK A;  2D5H A;  3N7K A;  2VZ3 A;  1RYY A;  2E7A A;  4V1P A;  2XVL A;  5BV6 A;  1R09 3;  5EXO A;  3EJK A;  2WZR 2;  1CX4 A;  2R32 A;  2IXL A;  5FMC A;  4S2H A;  1XQN A;  2MPF A;  1F31 A;  3GCW A;  1W04 A;  3ZSL A;  1NG0 A;  1FOD 2;  5A7N A;  4GMP 0;  5GLT A;  1W8H A;  2H0B A;  2X05 A;  1PGL 1;  1O6U A;  2OT7 A;  3KHC A;  2HEW F;  4YG0 A;  1LHU A;  2K46 A;  3DYP A;  4CU8 A;  3K2O A;  1V70 A;  2ZHL A;  1YNA A;  4XFH A;  3HVD A;  4FOW A;  1VBB 2;  2Z69 A;  4TSV A;  4A45 A;  4DZG A;  4FTS A;  1RUN A;  3WDT A;  1TG7 A;  1QJU 3;  4UT5 A;  3VBU B;  1W0O A;  2C26 A;  3AL5 A;  2VBP A;  2ARE A;  2YU2 A;  3AFG A;  4XQW A;  4D7S A;  3I2I A;  3WG3 A;  5CA6 A;  3I49 A;  3KQR A;  2ETE A;  5DZE A;  1GV9 A;  3IMN A;  3M3O A;  3E5X A;  3CJI A;  5D21 A;  1SBD A;  2P6H A;  4IEQ A;  1T2X A;  2ZAC A;  4Y33 A;  4YFW A;  3S7E A;  1HB4 A;  2VMD A;  4D7Y A;  2D97 A;  3CJX A;  2KXL A;  1N3P A;  5L73 A;  1AXY A;  3JQX A;  3LF7 A;  3NL1 A;  1ULG A;  3HN3 A;  3RPQ A;  3NKG A;  4XF1 A;  1WBL A;  2PLV 3;  5C8C A;  2JDU A;  1NE4 A;  4JCK A;  1B35 C;  4K20 A;  1NCR B;  1PX4 A;  1W9F A;  1JHJ A;  5EV7 A;  3GDB A;  1W6N A;  4Q29 A;  3WQ7 A;  2A3X A;  1AZD A;  1H9P A;  2AEZ A;  1D0G A;  3AKT A;  4D69 A;  2YYO A;  4L9B A;  2A70 A;  4OI2 A;  4C8D A;  5DAX A;  4KU8 A;  3LIH A;  3TAY A;  2FDK A;  2A6V A;  2DVF A;  4Z2A A;  4OHW A;  1UKG A;  1WUV A;  1ZBE 2;  5F3E A;  5FWE A;  5IVE A;  3WQB A;  1GNY A;  3VKL A;  3ETQ A;  1LEM A;  2Q0A A;  4UBH A;  1OUS A;  1WW5 A;  3HT2 A;  1NAE A;  5FZ1 A;  4I0B A;  2XJP A;  3NJZ A;  3GJA A;  5C70 A;  4L11 A;  2WNV A;  3LDR A;  4LOT A;  2ADE A;  4L92 A;  2G19 A;  2OXB A;  1YC6 1;  1PIV 2;  2W0X A;  1PO1 1;  3VGI A;  5HV4 A;  3DCQ A;  2RMU 1;  2BWA A;  2VZP A;  4LKD A;  1ZRR A;  5LRR A;  4OQ8 A;  4QX0 A;  4JGY A;  1X9T A;  5FYI A;  3WHU A;  1CES A;  1NLQ A;  4O61 A;  5CKM A;  5C4W A;  1ZZC A;  1SFY A;  3VLB B;  5FDB A;  1UY2 A;  2KA3 A;  2WO1 A;  4XJA A;  4DIQ A;  2D3S A;  4OCT A;  5FV3 A;  2OII A;  1K42 A;  4IEW A;  3CZU A;  4K40 A;  3S5A A;  2R6Q A;  5I0D A;  2ZX2 A;  4E9K A;  5A3O A;  1W0N A;  4DEV A;  2VUA A;  4LIT A;  1UX7 A;  4J1X A;  4LBQ B;  1LED A;  3RZM A;  1QQP 3;  1C4R A;  1G8W A;  1GQG A;  1H8T B;  3JU9 A;  2YV8 A;  3R05 A;  3LE0 A;  1RUG 2;  3U11 A;  1OF3 A;  2VZO A;  1QMJ A;  2CDP A;  4M3C A;  3H42 B;  1RUF 2;  2HWF 1;  5FZG A;  2OQ7 A;  2VBD A;  3H8R A;  2AAC A;  5GLZ A;  1G9C A;  4JGZ A;  3JUU A;  4CU7 A;  3AKQ A;  1OKQ A;  2PQQ A;  4UFL A;  3VB9 A;  5CAZ A;  4NHY A;  2C9A A;  1UOF A;  4PF5 A;  4NRO A;  4AI0 A;  2E9Q A;  1XE8 A;  2XOM A;  3VD5 A;  4E8D A;  1R1A 3;  3NNL A;  3ZFG A;  4QU2 A;  3ROU A;  1GP6 A;  1OLQ A;  3O1U A;  1RUD 2;  2AGS A;  3UGG A;  2F4L A;  2JG9 B;  4K8F A;  1Q8P A;  3UYJ A;  2R0H A;  4LO5 B;  1GZ9 A;  4RA0 A;  5DUU A;  2EXI A;  2YBP A;  1RUJ 2;  4JV4 A;  3UL2 A;  2P4E A;  2R06 2;  5J1X A;  2QQP A;  4ISQ A;  2XPJ A;  1XU2 A;  3LEI A;  4RFR B;  1ASJ 3;  1UYY A;  2ZGN A;  4HFS A;  5TSW A;  4WVZ A;  2WZ8 A;  4GH4 B;  2PHF A;  4DUV A;  4XAA A;  1AYM 1;  2JX9 A;  5FYS A;  1O3T A;  4GIQ A;  2VNR A;  4OUL A;  1MZ6 A;  1RVF 1;  2A5Z A;  5FXW A;  2EAK A;  1OKO A;  5DAB A;  4ZHN A;  4CDU C;  4AVT A;  1VPH A;  1VAV A;  5LW9 A;  4P08 A;  4QPG A;  2HWC 3;  1TMF 2;  4CDX B;  3B94 A;  2RDQ A;  3USU B;  2BYV E;  3AKS A;  3A23 A;  1DZR A;  3DV8 A;  4WM7 C;  4R52 A;  2GNT A;  4YZ4 A;  2XUM A;  2Z42 A;  4AK3 A;  1MZF A;  4CU6 A;  2UU8 A;  2OZJ A;  4Y26 A;  1OQE A;  4BB3 A;  2HWB 3;  2RDS A;  3ACG A;  3DPR B;  5ERL A;  3TB0 A;  3WX5 A;  4TXW A;  4Z92 B;  2WQ8 A;  2ZGL A;  3NAP B;  4CDQ A;  3WW4 A;  2B39 A;  1NA1 B;  3SCF A;  3CHX A;  4W8J A;  2WAB A;  3T3Y A;  5FY4 A;  5FPX A;  1NE6 A;  1RJ8 A;  2GZW A;  4MSV A;  3ENR A;  4IGQ A;  3B01 A;  1C5H A;  2CU5 A;  5CFC B;  4FQZ A;  5KR7 A;  4BDV B;  3MLK A;  3RJ2 X;  1UPS A;  4NHK A;  1EUU A;  3U37 A;  4COY A;  2XON A;  4FTB A;  2VOT A;  1BMV 1;  5FZO A;  3NKT A;  5LY1 A;  3J26 N;  1DLC A;  2D40 A;  1H9W A;  1QOS A;  2QCS B;  3N9M A;  3AYE A;  3WDW A;  5FMO S;  2PHD A;  4GMP 3;  4CYD A;  5A70 A;  1COV 2;  2HEV F;  4K9S A;  5A3L A;  4KWJ A;  5IVC A;  5I0R A;  3E5U A;  4C0B A;  5FQ0 B;  4C0H A;  1RUH 1;  5F7U A;  4C91 A;  1YQ2 A;  2HWD 1;  4Y5T A;  5FWJ A;  2V72 A;  1SPP B;  4HSL A;  1O91 A;  2ZMK A;  4WVV A;  3ZM8 A;  2QDN A;  2D6L X;  3MIB A;  2DUO A;  1BXH A;  4PBP A;  4EYU A;  2IC1 A;  2UWB A;  2ZOE B;  2BQP A;  5AVP A;  3AVR A;  3VDB A;  2VVF A;  1WLC A;  3OGJ A;  2YG0 A;  5I0T A;  4P00 B;  3B9I A;  4Z1V A;  4QX2 A;  2WZR 3;  2VG9 A;  1RED A;  4HET A;  1ULC A;  1E5R A;  1ALY A;  1FOD 3;  4BPZ A;  2WFF 3;  5CG8 A;  3WG1 A;  3ACI A;  1W2A X;  1UMZ A;  2UWA A;  1RHI 1;  2V09 A;  4FPH A;  1XE7 A;  2DU1 A;  2JDY A;  3DEM A;  1J58 A;  4C1W A;  4E4S A;  1CVN A;  3VN4 A;  2DBN A;  3LA3 A;  1PZ9 A;  1VBB 3;  3KV6 A;  5DZG A;  3MF6 A;  5FP9 A;  4CEW C;  3W59 A;  3EYP A;  4GA9 A;  5GLW A;  4GKY A;  4AL9 A;  5C3P A;  2VMH A;  3AP9 A;  1OI6 A;  1QWR A;  3IZO A;  3QD6 A;  1IQA A;  2FMD A;  1RUC 3;  1CAW B;  4CCE A;  1YFU A;  1HW5 A;  3MGU A;  4P9L A;  5F5C A;  4Q0V A;  4AW7 A;  3WF0 A;  3WY6 A;  3H8U A;  1ZBA 1;  3K77 A;  4LLO A;  1IS3 A;  4YG6 A;  5L19 A;  1POV 0;  2RM2 2;  5FY8 A;  4QXH A;  2AC1 A;  1N1T A;  2VUC A;  3IM0 A;  1KS5 A;  5FP7 A;  3LAG A;  1DU3 D;  1ZZ6 A;  2Q1M A;  2JJ6 A;  2VZ1 A;  1K5J A;  4V2W A;  4WVM A;  2D3P A;  5FPU A;  1O3S A;  1H2K A;  3ZN5 A;  4DEQ A;  3MUY 1;  1SHW B;  3E5Q A;  2HYK A;  2V73 A;  4XEZ A;  1ZBE 3;  2XUE A;  2GDF A;  3NMB A;  4FI9 A;  2WIN B;  2XQR A;  2ORX A;  3EXU A;  1QJF A;  1VBD 2;  1A8D A;  2P3Y A;  4EZH A;  1WW6 A;  5F5I A;  1BQP A;  4IEX A;  4BQ1 A;  5A3N A;  2ZX1 A;  1WD3 A;  4LKF A;  3ILR A;  4ATE A;  1HQL A;  4EWE A;  1WW7 A;  4OI4 A;  4H14 A;  4QQO A;  3DL3 A;  5DG1 A;  4HG6 B;  1YFW A;  4FFH A;  3ZKU A;  5A7O A;  2PHX A;  3VBR B;  5ABJ A;  5HBA A;  1NCQ B;  1VBE 2;  1HRV 2;  4CXW A;  3LSE A;  5IHR A;  4N90 A;  5FYT A;  5A6Y A;  1WW4 A;  4FPC A;  4JAA A;  3FBM A;  4BH9 A;  4NID A;  4CP2 A;  1UN1 A;  4NPR A;  2B7Y A;  3AKP A;  4I30 A;  1OF4 A;  3VKF C;  1G7Y A;  1LTE A;  3LWC A;  5H9S A;  1A78 A;  2QQW A;  3MEP A;  5I8S A;  1QDO A;  1AL0 G;  4BQW A;  3T4H B;  1FT9 A;  2VUD A;  5HCF A;  4MGI E;  3B00 A;  4Q4W 2;  1TME 2;  4LE4 A;  1L7L A;  3FMG A;  5IVV A;  1RUG 3;  5BXX A;  2A3W A;  2TUN A;  1RUF 3;  3SH5 A;  5FY1 A;  1UU4 A;  4BME A;  1ENQ A;  2ADD A;  2XL9 A;  2ZAA A;  3JD7 3;  4G3Y C;  4MGY E;  4Q4Y 1;  1NCR C;  5FP4 A;  3U0Z A;  2VNV A;  3R6S A;  2W52 A;  4OUM A;  4OLL A;  1O8S A;  5A32 B;  4FCA A;  2D44 A;  1F5F A;  5FPZ A;  4M0N A;  3WP5 A;  4PLN A;  2XJR A;  5L9V A;  2KD7 A;  4Z2W A;  1FV3 A;  3VBH C;  5F2S A;  3K3O A;  2Z5W A;  3LEM A;  1FMD 2;  4LO6 B;  3WF4 A;  4A7K A;  4CXX A;  1RUD 3;  2ZZQ A;  3CJI B;  1ZZ8 A;  4XVH A;  2HJI A;  3TNQ A;  2IWG B;  3CNA A;  1W6O B;  3MUZ 1;  4L99 A;  4KG8 A;  1W90 A;  3RSJ A;  2QNK A;  5JWP A;  1SDD B;  2E7T A;  2ZEW A;  4HKW A;  5A7Q A;  4JDN A;  1J3P A;  1IKQ A;  2Q5T A;  4ES8 A;  4NIH A;  1OHF A;  5C8C B;  5I8Y A;  3HPN A;  4FPK A;  3JB8 A;  2QFE A;  1W6N B;  1F8V A;  1W8F A;  1V9U 1;  3KCY A;  3MHZ A;  1U5Z A;  3KD4 A;  4XFC A;  1ZZ9 A;  3J9S A;  2R7E B;  2QUO A;  1K3I A;  3LSD A;  4KI5 M;  3J8F 1;  2W2I A;  1PGL 2;  4B7E A;  1N1V A;  3SXW A;  4AI9 A;  1W8U A;  2NZ9 A;  1DLL A;  2WYF A;  2DUP A;  1UMI A;  2UUR A;  3Q8F A;  3RZJ A;  3HNY M;  5DUX A;  1JOP A;  4Q4V 1;  2NP0 A;  1W9S A;  1HB3 A;  4YM3 A;  2WNV B;  2BGP A;  1W9T A;  3AK0 A;  5ANQ A;  4Y5Z 0;  2GU9 A;  4J25 A;  4MLO A;  3PIJ A;  2RVA A;  5FCC A;  1US3 A;  4B4R A;  3T2P A;  1HX6 A;  4MVT A;  3WDU A;  5K9Y A;  1SLL A;  1AR7 1;  1V6K A;  5IT6 A;  5KBF A;  3FHQ A;  4AXO A;  3IPV A;  3APB A;  3I3M A;  2W1U A;  3UT0 A;  3H7J A;  4JTN A;  2ID4 A;  3III A;  4XIL A;  4F3J A;  1IS5 A;  1LEC A;  3D5O A;  1GFF 2;  4XUP A;  3INA A;  1COV 3;  3F2Z A;  5FZK A;  1OPO A;  1C8N A;  4OFG A;  5F3I A;  1QIQ A;  3T4V A;  3MID A;  2WRA A;  4LBN A;  4DXR A;  1V00 A;  5EZW A;  5L7O A;  4ZU4 A;  2XLA A;  1AX2 A;  4LUK A;  3SMH A;  1MEC 3;  5D8A A;  5F39 A;  4YYO A;  4IUG A;  1E57 A;  5A7P A;  3MIE A;  3OY8 A;  4M3C B;  5F5Q A;  3FUQ A;  5ANN A;  3KT7 A;  3Q8E A;  4AED A;  4XUT A;  3WNM A;  2C6S A;  3RZH A;  4GH4 C;  2VCC A;  3G7D A;  2BW8 A;  5FZB A;  3QLQ A;  4QGN A;  1S0C A;  2R04 1;  3BKZ A;  4U36 A;  1PK6 A;  1PO1 2;  5BY5 A;  3N9N A;  2RMU 2;  2VZV A;  4MGZ E;  1SLB A;  1EP0 A;  5LCW L;  1URX A;  5FY0 A;  4Z8B A;  3AP4 A;  1CAV A;  2PN5 A;  1S1A A;  3ILF A;  1ULF A;  3B7M A;  3FHI B;  5IFT A;  1POV 3;  4AVS A;  3W21 A;  5A6Q A;  3ZXL A;  2B4K A;  3ACF A;  3HQR A;  4IER A;  1BEV 1;  3CQO A;  4IEZ A;  2E32 A;  2B42 B;  2K0G A;  5JSR A;  1IS4 A;  4IE0 A;  1OXC A;  2RJL A;  2XVK A;  4J6G A;  4QHB A;  4ES9 A;  1JUH A;  5FJH A;  4BQ4 A;  1Q56 A;  3MF9 A;  1NA1 C;  1EUT A;  4HT1 T;  3OJB A;  2FDF A;  1RUJ 1;  1R1Z A;  4CPB A;  4TLG A;  1Y4W A;  2JKX A;  1MVQ A;  1KGY A;  1R08 1;  3CKH A;  3DKW A;  1JZ8 A;  1X8E A;  4LT5 A;  2HWF 2;  3H1W A;  1ULP A;  1W9Y A;  4AVB A;  2DTY A;  1W6M A;  3LQC A;  5JSO A;  1NLS A;  5FYH A;  4ET7 A;  1DFQ A;  2RM2 3;  2HWE 1;  2WNU A;  2XKO A;  4LA2 A;  4PBO A;  4NIA A;  4DMI A;  5CKQ A;  2GC0 A;  3GCX A;  4E8C A;  1UZY A;  1TMF 1;  4LNV A;  5LAS A;  1W2U A;  4BLI A;  4FTE A;  5FMB A;  2JKB A;  4UW3 A;  2ZBJ A;  1RIT A;  3N7J A;  1XNK A;  2PAK A;  3OPZ A;  2Y6L A;  3O0W A;  1HN1 A;  4P14 A;  4XDO A;  1CJD A;  2C5D A;  2YZ4 A;  3WEZ A;  4CDQ B;  5GKA C;  3UJO A;  3FZ3 A;  2G9F A;  1A8M A;  4ZKT B;  1WCK A;  4W65 A;  1UW8 A;  3MW3 A;  4AQT A;  2NYY A;  4CCK A;  2K9Z A;  2YXS A;  1VBD 3;  2VL4 A;  4HK9 A;  4F8A A;  4CCD A;  1J83 A;  2ZAH A;  1D4V B;  2ZGK A;  1AR8 1;  3C7G A;  3POI A;  1D0H A;  5FZO B;  4HK8 A;  1W8T A;  3OUH A;  5GLV A;  3JBG 1;  2HBT A;  1AYM 2;  1SQ4 A;  2XVG A;  4XFB A;  1IQD C;  1W8Z A;  4GWN A;  3UGH A;  3GNE A;  4UFK A;  1U12 A;  1JYX A;  1FI2 A;  3IDE A;  4PHZ A;  4BXS V;  5IK5 A;  2Y26 A;  1RVF 2;  1C57 A;  1OSG A;  4UW5 A;  4YM1 A;  1ZA7 A;  1VBE 3;  1HRV 3;  1VBA 2;  3I7D A;  3K48 A;  4E27 A;  4IV3 C;  4QXB A;  4UFI A;  1UZV A;  3H3L A;  1BLZ A;  3ILN A;  3J7M A;  2BBA A;  3B9C A;  2IUW A;  2ZGQ A;  4A44 A;  4PCR A;  4XMA A;  1LR5 A;  1WGP A;  2HYX A;  1TQ5 A;  1MPX A;  4IE5 A;  2RS1 1;  4BM8 A;  3HR9 A;  3H3Z A;  2EXK A;  4FBF A;  4QXC A;  2WT0 A;  1AR9 3;  1NT0 A;  4Q4W 3;  1TME 3;  2VTF A;  3MV1 1;  4JHZ A;  3GBW A;  5FRE A;  2FDJ A;  4PJY A;  5T55 A;  4COU A;  1RXG A;  1EYB A;  2FCU A;  5C5U A;  1OD3 A;  5A6Z A;  5FZA A;  4BYY A;  2O8Q A;  2JDA A;  2VMG A;  2ZGP A;  3V0B A;  3A4U A;  3TRS B;  5C8W A;  3ZDS A;  2X5I A;  1GP4 A;  1SZB A;  2Y6J A;  3N36 A;  1BMV 2;  3ZXJ A;  3VUO A;  2X09 A;  4E4H A;  3MW4 A;  1QF3 A;  2JD9 A;  2J1E A;  3KF5 A;  4CDU B;  1OQ1 A;  5F37 A;  3MFC A;  5DUW A;  4QPI A;  4M0H A;  4HVO A;  5DUV A;  3VHN A;  3AMP A;  4Y1U A;  1FMD 3;  1RUH 2;  3EBR A;  1GLH A;  2HWD 2;  5EFU A;  1V6N A;  4GUL A;  4XJW A;  4CP1 A;  5CEH A;  3ZXF A;  3ETP A;  2VUL A;  5DAW A;  5J37 A;  1WBF A;  1Z0H A;  4DRR A;  4ERO A;  4QKF A;  4CZS A;  1NZI A;  1UXX X;  5JAX A;  4X6Q B;  2AR6 A;  2IXH A;  5L9B A;  1CIW A;  2WBK A;  2FMY A;  3LD8 A;  3ZXK A;  5JR2 A;  1UY0 A;  2EIE A;  2VQA A;  4NOT A;  1NCQ C;  4WVM B;  3VBR C;  1OMI A;  3LOB A;  1LOF C;  2QQN A;  5SV8 A;  3V56 A;  1RHI 2;  2PHL A;  4LLF A;  1PZ8 A;  2OA2 A;  3BTA A;  5DAV A;  5IAX A;  4WM8 A;  2IFR A;  3USS A;  1YO8 A;  4B1M A;  4DXZ A;  1S0D A;  3HAG A;  2WO2 A;  3KS7 A;  3WHT A;  2HLE A;  4QHZ A;  1MQT A;  2B5H A;  2LW8 A;  3PUQ A;  3AFK A;  4TWT A;  3RMX A;  5FO8 B;  1G9A A;  2QQV A;  2CWM A;  4JVA A;  3O1R A;  1WLW A;  1LOA A;  4KU7 A;  2JDP A;  2R07 1;  4QX3 A;  4A3Z A;  4AVA A;  5A1L A;  1AX0 A;  4N53 A;  5K0U A;  4P5H A;  1G9D A;  5E16 A;  4QM8 A;  4YVS A;  2IFW A;  3D8C A;  1RUE 1;  2VR4 A;  3AZW A;  2Q1F A;  4X8N A;  2W08 A;  3ZXA C;  5ABJ B;  4LK6 A;  2A3Y A;  3LB9 A;  4B1L A;  3WOG A;  1ZBA 2;  5J36 A;  2JD4 A;  1W6P A;  2A7A A;  5A6X A;  2C24 A;  1Y43 B;  4S2D A;  5D1I A;  1TNF A;  2Y6H A;  2V4V A;  3NNJ A;  1E5H A;  2JIC A;  1BZW A;  2PAE A;  2ZHM A;  2ZHN A;  2UYB A;  3CJI C;  3FLR A;  3R0R A;  4YZ5 A;  2XB6 C;  5F6K A;  4PLO A;  3BTY A;  3BIE A;  2X10 A;  5IJR A;  1QDC A;  1RXF A;  3NWK A;  5K8S A;  4JC1 A;  2ZZJ A;  3MI8 A;  4HPK A;  4OHV A;  1VMJ A;  1HIX A;  4NR1 A;  1BK1 A;  4QM9 A;  1WA4 A;  1UWW A;  1Q8S A;  2JB4 A;  4HSJ A;  4KG0 A;  4XPV A;  5GJ6 A;  4A4A A;  5C8C C;  1NOV A;  1ZX5 A;  3BPZ A;  4E2G A;  5FYC A;  1PO2 1;  4H2A A;  2CGN A;  5CFD A;  3IWZ A;  4UXA A;  1C1F A;  4XQD A;  1PO1 3;  1NQD A;  1BHG A;  5HCH A;  1US2 A;  3CO2 A;  4RR3 A;  3E6B A;  2O8O A;  2PXJ A;  1YI9 A;  3Q8C A;  2VD7 A;  4QQP A;  3VBO C;  4F83 A;  2JE7 A;  2Q30 A;  1PM4 A;  3ZFE A;  4IEV A;  3DN7 A;  3POE A;  1L7R A;  2BNO A;  4LEJ A;  3PVB B;  4LKS A;  5F1R A;  4WVW A;  2WNV C;  5F9T A;  4IQP A;  3T1M A;  4A7Z A;  4D94 A;  2YGM A;  2UYA A;  2VOW A;  4FP2 A;  3VZL A;  3NV2 A;  1YHF A;  2W3J A;  2RS5 2;  3QAC A;  5IWF A;  3BOD A;  4JGY C;  3DUI A;  5C4W C;  3WCR A;  1N1Y A;  1NKG A;  1C8M 1;  3B69 A;  2RDN A;  4IW3 A;  3N7L A;  2ZX3 A;  1HN0 A;  5FZ6 A;  3WR0 A;  3BTZ A;  2AUY A;  2IXC A;  3SCH A;  5T5O A;  4Q4Y 2;  4DQA A;  2A6X A;  1PVC 1;  2MHF A;  1Q5O A;  5C9A A;  1IPK A;  5EJ1 B;  3U4S A;  2C4X A;  2RHP A;  3FLP A;  1OH3 A;  3OTF A;  2OPW A;  2A6W A;  2CDO A;  3O5S A;  5CZK A;  1ACC A;  2BOJ A;  1S0J A;  2VMF A;  4RFT 0;  2WZP P;  4QKD A;  3FUO A;  4PQ9 A;  4AGR A;  4FPY A;  5JI9 A;  1SLI A;  2JEN A;  3DYM A;  2D98 A;  3AMQ A;  1H2M A;  4JDM A;  4FPJ A;  3OSD A;  3O12 A;  3I8T A;  1FAT A;  2AYH A;  1YIF A;  2IXK A;  4JGZ C;  1LGN A;  4OHZ A;  4PLM A;  1BK0 A;  1CQ9 A;  3IPV B;  5IAV A;  5EP9 A;  3KGL A;  5FZI A;  2RG4 A;  2GH8 A;  4YG3 A;  5LBE A;  2YFZ A;  2BGC A;  3WD5 A;  1GR3 A;  1V9U 2;  1AYM 3;  3C3V A;  4G9S B;  4K21 A;  3ZFG C;  3S5Q A;  5J09 A;  4KWU A;  3J8F 2;  1GIC A;  3WUC A;  4NWW A;  4CE8 A;  4I3P A;  1XNC A;  2B9V A;  4UW6 A;  1YQ5 A;  2XR4 A;  3PLQ A;  4R9C A;  5D8A B;  4RSU A;  3OY8 B;  2OYZ A;  3VBH B;  3MW2 A;  4AED B;  1DIW A;  1X33 A;  5FXZ A;  4Q4V 2;  3VBO A;  2BWC A;  3P1I A;  5G04 L;  3E6C C;  5T5J A;  5KXC A;  3D0S A;  4XF9 A;  1UMH A;  3NNF A;  4JKL A;  2DCK A;  2YBK A;  3ABZ A;  4NIG A;  3AYC A;  1QJX 3;  3K4Z A;  2QQL A;  4JTO A;  4XAE A;  1LHO A;  4B7K A;  3HIF A;  1LES A;  4BK4 A;  1CAV B;  4QPG C;  2VVD A;  1AR7 2;  2XL7 A;  4QX5 A;  4B4Q A;  3CL1 A;  3AP7 A;  1AR6 1;  5JXH A;  3I2G A;  2DFC A;  5LRS A;  1DQ2 A;  1TZO A;  3VZO A;  2XWJ B;  3CMG A;  2PHU A;  2W95 A;  3AZY A;  1JMU B;  2G9G A;  3IAQ A;  4RS5 A;  3LA7 A;  2ZGS A;  3S57 A;  2L9L A;  3WDY A;  4Y20 A;  5EWS A;  1ST8 A;  4CDQ C;  1UCX A;  3WG2 A;  3VHR A;  4J1W A;  3L2Y A;  3ZSJ A;  1RUH 3;  2HWD 3;  4OZO A;  5FYM A;  2GH2 A;  1UZ0 A;  1WCS A;  1ZM1 A;  3CBN A;  5LB6 A;  2HEY F;  2XKP A;  5FYB A;  1OUR A;  3SH4 A;  2WLQ A;  4RGA A;  4YW6 A;  2YGL A;  5DAQ A;  4HN1 A;  3VDC A;  5FR3 A;  4QU1 A;  3AXD A;  2R04 2;  2WNU B;  4YM2 A;  2JDM A;  2EIC A;  2DVG A;  1JH5 A;  4FPE A;  4YZ3 A;  3HWJ A;  1PZ7 A;  4IXL A;  3VHO A;  2CV6 A;  3M8L A;  1REE A;  1PMI A;  2VQ0 A;  3FJS A;  1RHI 3;  3GBG A;  4R9B A;  4YGB A;  3N9O A;  1XXN A;  4LBO A;  1XB9 A;  1KXG A;  4D6Q A;  2RR1 1;  3AZX A;  3RFR A;  5DMY A;  2Y38 A;  4MGT A;  1ZRC A;  3MLL A;  4AOC A;  4CP9 A;  1QJY 1;  2BVV A;  4NVP A;  1BEV 2;  4H7L A;  3Q9O A;  2HH9 A;  1QJZ A;  1EV1 1;  4TYS A;  2J7M A;  3N35 A;  2BFU L;  3PUS A;  2WN2 A;  3BIW E;  1FX5 A;  1SLC A;  4D6R A;  2P37 A;  1O4Y A;  4LR4 A;  5FKB A;  3FLT A;  3SEP A;  3ZN6 B;  1R08 2;  1ENR A;  5E88 A;  3RNS A;  5B4X A;  3JQW A;  4FOV A;  4H55 A;  2EAL A;  4E2S A;  4XTM A;  1ZBA 3;  2VTX A;  3ZFF A;  1AYN 1;  1W3V A;  3VZN A;  4P9W A;  2HWE 2;  2ZMN A;  3OD0 A;  1VBA 1;  4YW4 A;  3SKJ E;  2WWU A;  5FO9 B;  3WVJ A;  5GZE A;  4LJH A;  3WDV A;  1G6N A;  2JG8 A;  2J1R A;  3I3Q A;  4YW7 A;  3RQ0 A;  3LFM A;  4XW3 A;  3WDX A;  3TEZ A;  1GQP A;  1GBG A;  5DZF A;  1T6B X;  2YBS A;  4NRQ A;  1PGW 1;  1V6J A;  2GME A;  3I97 A;  5BPX A;  2F17 A;  5JSP A;  1GNH A;  4DXS A;  3RS6 A;  2P3K A;  1JHN A;  1XE0 A;  3KB5 A;  4WV8 A;  4AHX A;  2DWR A;  3V0B B;  4SBV A;  1S0B A;  3ME2 A;  3KGZ A;  4NO4 A;  4CUA A;  1PVX A;  3SEE A;  3WW1 A;  5JMO A;  1WKY A;  2X5I B;  1AR8 2;  2BZD A;  4PI0 A;  5CB7 A;  3JBG 2;  1BJQ A;  1HQN A;  5FAX A;  1W99 A;  4XUR A;  1YQ8 A;  4Y1X A;  2WR9 A;  1ZVF A;  1JZ6 A;  4Q2F A;  4A6S A;  2TBV A;  1C3H A;  1IHM A;  3K4A A;  1JBC A;  4OQ9 A;  2R1B A;  3ZYJ B;  5KHJ A;  2GP3 A;  2FCV A;  1N1S A;  2VCA A;  3GZT B;  2YU1 A;  5CIS A;  5DAP A;  2ZXQ A;  5A7W A;  4RQP A;  3AXE A;  1MZ5 A;  2RS1 2;  1YRZ A;  4FXG B;  4N7I A;  4QAW A;  1VJ2 A;  1LKN A;  2WAA A;  4RN5 A;  4XQ4 A;  1W06 A;  4UW4 A;  4NHM A;  5ABJ C;  4FPO B;  5T50 A;  4B8E A;  3BAL A;  2R16 A;  4AZZ A;  4CEY A;  4Q4Y 3;  4PDW A;  2D6K A;  3ZN6 A;  4EZ4 A;  1JOJ A;  1BVP 1;  4WM8 B;  1RB8 G;  2JEC A; 
#chains in the Genus database with same CATH homology
 1OXC A;  1UZV A;  5HCH A;  2VUC A;  2JDY A;  5A6X A;  1OVP A;  2VNV A;  1W8F A;  1W8H A;  1OUR A;  1OUX A;  3ZDV A;  3DCQ A;  1OVS A;  5A6Y A;  2JDU A;  2BV4 A;  2JDM A;  2BOJ A;  2BP6 A;  4CE8 A;  2JDP A;  2BOI A;  2JDK A;  1UQX A;  2CHH A;  5D2A A;  5A6Z A;  2JDH A;  2XR4 A;  1GZT A;  4UT5 A;  2VUD A;  2WRA A;  5A6Q A;  5A3O A;  1OUS A;  2JDN A;  2WR9 A;  5A70 A;  4AOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...