1UAIA

Crystal structure of the alginate lyase from corynebacterium sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyguluronate lyase
publication title Crystal structure of the alginate (poly alpha-l-guluronate) lyase from Corynebacterium sp. at 1.2 A resolution
pubmed doi rcsb
molecule tags Lyase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uaiA00
1JOJA 4Y24A 3APBA 5T50A 4YZ5A 1AX1A 3QCWA 1GICA 2D7FA 3WDYA 1KQRA 3LSEA 4FOQA 1GKBA 1ENQA 1IKPA 2GN7A 1B09A 3JUUA 3POWA 3WG2A 2DV9A 4M00A 2YXSA 2GALA 3N7JA 2EXJA 4FPKA 4FOYA 1G9FA 4PQ9A 3ZXJA 4P14A 2A3XA 4YM2A 3IN9A 1UL9A 3T2TA 4YG6A 3A0NA 4Y22A 4FPGA 1GBGA 2D44A 1ZA4A 5GLUA 5DG1A 3I4IA 4YGDA 1UKGA 4XJAA 4Z8BA 4FPCA 2C5DA 2OUJA 3RMXA 4CRQA 4MYEA 5KXCA 5JOYA 1GNHA 1FYUA 4ISRA 2WQZC 5E8AA 1QDOA 2DUPA 3AP7A 2ZHLA 1NXD1 1Q56A 3WZ1A 1OKQA 1LODA 1G9AA 3AYDA 1A8DA 3NV4A 4AGGA 1YIFA 2WT1A 3WUCA 4AYUA 4ZKTB 3ASIA 1UPSA 4GXLA 4YW2A 1FV2A 1LTEA 1XQNA 2CWSA 2WT2A 2ZMNA 3A0KA 4M3CB 1BKZA 1LHOA 4R9AA 2AR6A 2BQPA 4XBNA 4WV8A 2AENA 5JDBA 3N7MA 1W6NB 3OBRA 1WCSA 1JUIA 1F31A 1Q8VA 2W68A 3R4UA 4P9YA 5DZEA 3O5SA 2H0BA 1RITA 1LCLA 1PZ9A 3WNXA 1IS3A 3BODA 2ZGTA 1MS3A 2WKKA 1JW6A 1W0OA 1SCSA 2YROA 3ZXLA 2V73A 2ZGMA 3ATGA 2P3KA 2ZGUA 1VIWB 1DQ2A 1LOFC 1QOTA 3BIWE 4M3CA 2NP0A 3AYEA 5EXOA 4BMBA 3ZPYA 1N1YA 2ZHKA 2P3IA 3M3QA 4Q8KA 3SH5A 3M3OA 3WHTA 3RG0A 3WCRA 4XIKA 4XJ9A 4FPOB 1W6NA 2V5YA 1MVQA 2JE9A 2AGSA 3OBTA 3IM0A 3VKMA 2PHXA 3ZXKA 4YZ1A 2A3YA 4OZXA 4XJ8A 5DZFA 1V6LA 2LTNA 3AK0A 1YXWA 5HCAA 4PBPA 1WBLA 2UWCA 1KDKA 1WBFA 1MS8A 5JVVA 1YI7A 2GNBA 2A5ZA 2EALA 2ZABA 1R1ZA 1V6NA 3CNAA 3ENRA 4FPJA 1AX2A 3OYWB 3UK9A 1QDCA 4XJZA 2SLIA 5CA6A 1LHVA 2KM2A 1CIWA 4F83A 5DG2A 2PHUA 1HKDA 3V65A 2JE7A 5CAZA 2E7TA 4LBJA 5IK7A 1LOBA 2D3PA 3ILNA 4M01A 2DVAA 1H30A 1C1LA 2A6XA 4LBQB 1ENRA 2NMNA 4XHXA 2DVBA 2I2SA 4JCKA 1JHNA 4P9XA 1KRIA 1BYHA 1X50A 4FP3A 2W08A 4ISQA 4YZ4A 3VUOA 3AYAA 1S0FA 2UWAA 3WG3A 1FNZA 1CONA 3OJBA 2A6ZA 4RL7A 3WDUA 1S0JA 2SBAA 5T5OA 3IMNA 4UW5A 1IS4A 2ZACA 1N3QA 5DZGA 4C1WA 2JD4A 2PHRA 3OYWA 4AGVA 5GALA 1U0AA 4I30A 2GN3A 5DUWA 1FNYA 4YW1A 4YGEA 3ZSKA 4YG0A 3WDVA 2ZHMA 1DZQA 4FPEA 1WD3A 4XE9A 3SNMA 3D6EA 1S0IA 1ULDA 2WSVA 5H9QA 2ZBJA 4LBQA 1AX0A 2A7AA 1LGCA 3RMYA 2JKBA 1S0BA 2CL2A 3W58A 3WCSA 2NZ9A 1CPMA 5T55A 1QMJA 4DPNA 4YM3A 1ULEA 2A6WA 1V6IA 3B00A 2DURA 4TYSA 1WUVA 2GMPA 3SISA 1AJKA 1LU1A 2CWMA 3WDWA 4LBNA 1LU2A 1BXHA 1NLSA 3AYCA 1AXKA 4IQPA 4DRVA 1MS0A 1MZ6A 3RRDA 5CBLA 5IUQA 4Q8LA 1GZCA 1VLNA 4H55A 4XTMA 2D6LX 2ZGOA 3DGTA 3GALA 1QKQA 1DFQA 1MS1A 4BPZA 5KXDA 1HQLA 5GLTA 4UW6A 4XXPA 4R9CA 1UZYA 4YM0A 4WZFA 1LESA 4LBMA 4PCRA 1AZDA 4L8QA 1LULA 4AVTA 1G9DA 1LGBA 5F5QA 2G4IA 3MPPG 2R16A 1WLDA 4XJWA 1KITA 1DQ0A 2YMZA 4U2AA 3NV3A 4K20A 3M2MA 3VKFC 4GKYA 1KJRA 2VH9A 1YRZA 2HYKA 4U36A 4ATFA 5E89A 2XB6C 2DUQA 1W6OB 2ZA9A 3UJOA 1V6MA 5AVAA 1LOFA 1GZWB 1APNA 3ILRA 1LHUA 1SLIA 1SBEA 1VAMA 1MS5A 2YY1A 2DYCA 2ZGSA 3AX4A 4BOWA 4JRAA 3OY8B 1N1TA 1Z0HA 2P2KA 2EF6A 1GANA 2P3JA 3O0XA 2ZAAA 4FPHA 2ARBA 3B01A 1OQ1A 2JECA 2UU8A 1LJ7A 2VW1A 3D5OA 3RQ0A 3VKLA 1GYKA 1O4YA 1W0PA 1CVNA 1WD4A 2CNAA 2FHRA 4YGBA 4LBQD 3KM5A 4BLIA 3MW2A 2ZGNA 4Q27A 4FOVA 3NV1A 3PJQA 1VALA 2GMMA 1ULGA 4KBBA 1V6OA 1J1TA 3IPVB 4FPYA 4XZPA 1W6OA 2DVDA 1LOEA 4AGRA 1FV3A 1GZWA 3MW3A 2ZMLA 4YW4A 1N47A 2Q5TA 1DLLA 1DIWA 2P37A 3AFKA 3OY8A 4FOWA 1EPWA 5CB7A 1CPNA 1WLWA 2OUHA 4AWDA 4W65A 1JYCA 5E88A 1UMZA 2ARXA 3O0VA 2JDZA 4FVVA 2VY0A 1ULFA 2E7QA 2EIGA 4NOTA 2DU0A 3T1MA 1LEDA 4Y1VA 3H0OA 1LHNA 1RIRA 5GLZA 2GNDA 2PELA 2DTWA 4GA9A 5GZDA 1A3KA 1LEMA 2NN8A 3SLIA 3ZSMA 4DFSA 4YM1A 4Y20B 3IPVA 1V6KA 1QGLA 4YFZA 3WG4A 3KQRA 4XHBA 4DS0A 1CESA 4LBKA 3V0BB 5DUVA 1Y7BA 3RSJA 1SCRA 2R0FA 4Q26A 3AXDA 3AZZA 3MW4A 3ZSJA 2VW0A 5T5PA 1FATA 2YV8A 1SLCA 2R49A 5T52A 4YZ2A 1LOGA 1GLHA 2WT0A 1GNZA 1MS9A 4Q2FA 1N3PA 4XDQA 5IK5A 1IS6A 3WLUA 3SH4A 1C4RA 1UZZA 1G9BA 1V6JA 2FMDA 1WLCA 1O4ZA 2WJSA 1JN2P 1UAIA 4Q1RA 4XILA 5GZFA 3WHUA 3ZXEA 1KDMA 3TB0A 3L2YA 3QLQA 4Y20A 3MEPA 1V00A 3WDXA 3WV6A 5T5LA 1QNWA 2LALA 4LBLA 2ERFA 3V0BA 3PMEA 4XBLA 3N7LA 1TEIA 5SV8A 4D69A 4AVVA 5IK8A 1F5FA 3VKOA 4Q1PA 3Q9OA 1W6QB 2EXIA 1WW6A 2PHTA 2A3WA 3M1HA 2EXKA 2D3RA 1S0CA 1ENSA 3INAA 1I1EA 3O12A 2R1BA 2DTYA 5EYXA 4BM8A 4XMIA 4FQZA 5FRAA 3RS6A 2DVGA 1SLTA 3M3CA 1AXZA 3FUQA 3O0WA 1BZWA 2RHPA 2ZGKA 1LOCA 1LGNA 2W39A 4K1YA 4PBOA 2UURA 4Y1ZA 3TAYA 3AJZA 2GNTA 2NMOA 2Z42A 2D6OX 3HR9A 3PVOA 1AVBA 1C57A 3ZYPA 3M3EA 3R4SA 5T54A 3WDTA 1W6QA 2D6NA 4DQAA 4RA0A 1GSLA 4XTPA 2AYHA 5IK4A 4XJUA 3B69A 1H9WA 1UX6A 3U4XA 5DXDA 5F9TA 2D6PA 3BTAA 4PF5A 1D0HA 2D6MA 1SBDA 1HDKA 5JLVA 4AVSA 1GV9A 1DYKA 1VAVA 3I8TA 5H9PA 4GKXA 5EYYA 3AXEA 3AZXA 4XBQA 1AJOA 2E53A 3UJQA 4ATEA 1IOAA 1AXYA 1Q8SA 2AREA 2ZGPA 4R9DA 1MZ5A 3AZYA 3AP6A 1DQ1A 2D6KA 3AP9A 1CN1A 1N1VA 1QNYA 2A75A 3T1LA 5JOWA 2AH2A 3LCPA 1IKQA 3FBYA 3A4UA 4HANA 1JXNA 1C1FA 4ITCA 1SBFA 5GZEA 2A70A 1G8WA 1QF3A 2VW2A 4NO4A 2ENRA 2WNEA 3LSDA 2DUOA 4CZSA 1A78A 3N7KA 3WVJA 3ZYRA 4FPLA 1DQ5A 4FQ4A 2DVFA 5JOXA 1SLAA 3W59A 5EWSA 4BQ1A 3NV2A 3AJYA 2CY6A 2W52A 1ONAA 2VXRA 1S0EA 4ASMB 1BQPA 3BOPA 1PZ8A 1W6PB 3GNEA 1PZ7A 1YYNA 4XXAA 1D2SA 4BMEA 4GWNA 1W6MB 5HCFA 5H9SA 1MS4A 3WG1A 2UWBA 1QU0A 2GMEA 4C1XA 2NM1A 3FLRA 1URXA 1WW4A 2A71A 2D3SA 1DQ6A 3POYA 4SLIA 4YG3A 5L73A 4UW4A 3SITA 3AZVA 4YW5A 1G9CA 2ZKNA 1FAYA 3FLPA 3VV1A 1CQ9A 1QOSA 1KJLA 3HN1A 4P9WA 2ZGRA 3FFZA 4BLJA 5GZGA 5JMCA 1UN1A 4ZXKA 3ZSLA 4LBOA 4FP2A 2VU9A 3UL2A 1W6PA 5BYNA 1S0DA 5IT6A 1W6MA 3FLTA 1AF9A 2R0HA 4M3CE 1WW7A 2OVUA 2WLQA 5GZCA 2VUAA 2P34A 3B9CA 4XOGA 2ZGLA 3USUB 4K21A 1JBCA 1Z78A 5H9RA 2TEPA 1S0GA 1JYIA 1LENA 3AZWA 4WVVA 1OFSA 2PHFA 1IS5A 3PVEA 2EXHA 1DYPA 4YZ3A 1F9KA 2NYYA 2A6YA 2C9AA 4Y1UA 3SH3A 3OGGA 3OPZA 2WSUA 4Y26A 1I3HA 1SLLA 4R9BA 1DGLA 3WOGA 3FUOA 5GJ6A 4XIOA 4XMAA 5HCBA 3USUA 1H9PA 2E6VA 1SLBA 4FPFA 5GLVA 1Q8OA 5GM0A 2CYFA 1YO8A 2GDFA 2CTVA 2OW4A 1S1AA 2ZHNA 1DBNA 3V0AB 1Q8PA 1GZ9A 3IKWA 2YZ4A 4WVWA 1HLCA 4GALA 3V64A 3POSA 2GNMA 4M3CF 1HQWA 2XG3A 3R05A 5KXBA 1ULCA 2JJ6A 4GWMA 5FREA 4XYXA 1BJQA 2ZMKA 2E51A 3VKNA 1N1SA 3C2UA 3NWKA 4HL0A 4Y1YA 5DUXA 1ZM1A 3ZVXA 1DHKB 3D4KA 5DUUA 1FX5A 2DWRA 2AUYA 1QOOA 4YW3A 3DUIA 2DU1A 5JOZA 1MACA 4DRRA 2B7YA 3PVNA 1MR5A 3N35A 2PHWA 4JC1A 1WW5A 3HMYA 4Y1XA 4YGCA 3V0AA 1CJPA 2R1DA 5GLWA 3ILFA 1SACA 1MVEA 2EAKA 4K1ZA 1G86A 4YLZA 1LHWA 5T5JA 3B3QE 4TZDA 4YFWA 1LECA 3WUDA 1N3OA 3ZXFA 3N36A 2ES3A 1SFYA 1LOAA 5LK5A 1CR7A 1Q8QA 3AP5A 2ZGQA 3AP4A 5CNAA 1G7YA 2ZZJA 3JU9A 5KXEA 4Y22B 2D43A 2A6VA 1RINA 4UW3A 1DQ4A 4CTEA 3N3HA
chains in the Genus database with same CATH superfamily
4QKDA 1REEA 5C3QA 4QQOA 2D7FA 1KQRA 4BK5A 4LKFA 4HKLA 3OBZA 5IVEA 1OF4A 1B09A 4A2UA 2ET7A 3WG2A 3POWA 3O1VA 2FCVA 5FUIA 1HB3A 4LIVA 4V2VA 5FY8A 5FUPA 2GALA 2WNOA 4FPKA 3S0MA 1D4M3 2BW8A 4P14A 3THPA 4LE4A 2VNOA 3UGHA 1JU4A 2RDNA 1ZREA 5FP7A 1B35A 5IHRA 1BVVA 2BNOA 1CJDA 1PGL2 1RHI1 1ZA4A 2UYBA 1EV12 1UKGA 4JV4A 4Q0PA 3ACIA 2OQ6A 3IZOA 2IC1A 4FO9A 5JOYA 5KXCA 5CG8A 4CDUA 2YBPA 5CISA 1VRH3 1YFXA 1H6YA 5FMCA 1ZBE3 5I0TA 4MADA 3AYDA 4ARYA 3ZM8A 4I02A 1ZRDA 1YIFA 4CEWA 5BNOA 5J48A 1UPSA 5FZIA 2WNUB 2ZX0A 3ECQA 3LQCA 4MXVA 2D5FA 4HONA 5A1LA 1BLZA 1XQNA 2WT2A 2ZMNA 5ACA3 4CEYC 5J96B 4J1XA 3AM2A 2B9VA 5IFTA 1LHOA 2XBO3 2AR6A 1V9U1 4R9AA 5FZ6A 4QMAA 4FCAA 1BVP1 1JZ8A 2QCSB 2YGMA 1WCSA 1JUIA 2Q4SA 2W68A 3BPZA 3R4UA 4N53C 1QJFA 4P9YA 4AFMA 1UOGA 4CDWB 5KBFA 2H0BA 4RN5A 3KCYA 3WP3A 1AYM1 1RUC3 2ZGTA 4CPBA 5B4XA 5FYSA 1SCSA 4DOUA 2VVFA 3MIGA 3ZR5A 2P3KA 4HPKB 1VIWB 2WUHA 4JDOA 5JAXA 2OPWA 1CZVA 3AYEA 2X5IA 4UBGA 2YB7A 2VZTA 5A33B 1U5IA 3AKPA 3M3QA 2VQUA 4QB2A 3BTYA 3VD7A 4JTOA 4QX3A 2JB4A 4DNYA 1U12A 1W6NA 4AHYA 1NCQA 1R091 2JE9A 1PGW2 2B39A 3IMMA 3P6BA 4E4HA 4J6GA 3PU3A 1UMHA 3AKSA 2IXIA 4RR3C 1OD5A 3PUHA 3U11A 4XUNA 2A3YA 3ZXKA 4BA6A 3OUJA 3IIIA 2YUEA 1O8SA 3JD71 4XFAA 1D4M2 3AK0A 3HNBM 2VNVA 1YXWA 3PL0A 3T4VA 2RVAA 3O1TA 5EIYB 2UWCA 1WBFA 3HQXA 5IVYA 3GCWA 4B29A 1E5SA 2GNBA 2A5ZA 2ZABA 3CU7A 3OYWB 1VBD1 1QDCA 5C4WA 4F83A 5AFBA 3GXUA 2VTXA 3V65A 5FZ9A 2JE7A 4MUVA 4IV3B 5LASA 1VRH2 5FWEA 1ZBE2 1RUNA 3HEIA 2PHDA 2NMNA 3ZO0B 1JHJA 4XHXA 4IV1B 2I2SA 3GDBA 1ZRFA 1O7FA 1YQCA 1ND3C 3UETA 4N7UA 1VMJA 4YZ4A 4UFHA 5K4LA 2ARAA 3WG3A 1XB9A 1PO11 3KT1A 4RL7A 5ACA2 1S0JA 3AKRA 5T5OA 4JZRA 4JGZC 3IMNA 2C4XA 3G7DA 4IESA 4QPYA 4QX5A 1NZIA 2XHKA 2DBNA 4UW5A 5DZGA 3I3BA 5LBEA 1U0AA 1UXXX 3RFRA 1RVF1 2HWF3 4YW1A 3A23A 2FCUA 3OPTA 1OLRA 2Y6JA 4PI0A 2Y38A 4G3YC 1EAH2 2WFF3 1WD3A 3KHBA 5FMDA 4JQRA 4YVSC 3WP4A 1S0IA 4GH4C 1Y4WA 1RUC2 1YLLA 2JKBA 1S0BA 3FBMA 3U07A 2NZ9A 5FV3A 2BV4A 1QMJA 2PLV1 3LGRA 2A6WA 5T55A 1V6IA 2W0XA 3SISA 1WUVA 2BFUL 1IPSA 4C0BA 1YWKA 2CWMA 1RXGA 2HBTA 2X53S 5FP3A 4CCMA 1HN0A 1PMJX 5DPNA 1AXKA 1OI6A 4IQPA 1MS0A 3FC0A 4Q8LA 3LD8A 2EIBA 3MICA 4QQLA 5BNPC 2YBSA 1GP5A 3POEA 1GQGA 5DAVA 1NA1C 4CP2A 4ZU7A 5K0UB 3ZOIA 5KHIA 4CXYA 3WEZA 5JZGA 1RL3A 1UZYA 3OB8A 5FZ3A 2RS52 1LESA 1NG0A 4WZFA 3TWIA 1K5JA 2P1BA 4AF9A 5CFDB 1F4HA 4L8QA 4B4PA 4IEOA 1LGBA 2ZEZA 2G4IA 2WFPA 3MPPG 4FFIA 4HZFA 4MZUA 2QJVA 4PLOA 5IW0A 1KITA 1JODA 4AVCA 5FPUA 4XEZA 3NAPC 1FI2A 2XL9A 1Y43B 2W46A 3M2MA 4GKYA 1UYPA 4K20A 4M0NA 1IQAA 4Q0QA 4ZU4A 1QQP1 4EWEA 4W8JA 1NAEA 2W95A 2G9ZA 2RS31 1WCUA 3M4FA 1HRV3 3K4DA 3GBGA 2Y6HA 4OI4A 4W6YA 4Q4X1 1APNA 3ILRA 1LHUA 3ZFEB 4E9KA 4BOWA 2ZGSA 3AX4A 3TN92 4IEUA 4JRAA 3OY8B 1JZ7A 3ZPOA 1GANA 4CE8A 3CJIC 2JECA 2VW1A 4TLGA 4LE3A 3C7EA 1GYKA 2HWC2 5JI9A 2FZ2A 2FCTA 3RPQA 3KM5A 2WZPP 5FZCA 5C9AB 2ZPXA 3PU8A 4I2OA 3CJXA 3VHNA 2JDKA 3NV1A 1UMIA 4RS5C 1DYOA 3ROUA 4EN0A 1GU3A 1ULGA 4KBBA 2QQVA 2HWF2 1NY71 3CO2A 2VOWA 3URFA 3HAGA 3MW3A 2VE1A 2WFF2 2WS91 3RZZA 5F3EA 3ZN6A 2Q5TA 1DLLA 3ZFGB 1YC61 3LPFA 3VBOA 1UX7A 1UMZA 3O0VA 4FVVA 2J1UA 2FD8A 4XUQA 4CCOA 4OMDA 2DU0A 3DV8A 3KF3A 4K8FA 1NQDA 3VZLA 1RIRA 1QXRA 2R30A 1YNAA 1FOD3 1V0AA 1VMHA 4GA9A 5JIUA 1LEMA 1KFXL 2C9KA 4YM1A 4XDOA 3IPVA 4YFZA 1QGLA 1R1A3 3GCXA 3RI8A 3VBUC 4DS0A 2GZWA 4LORA 3V0BB 3LOBA 3RSJA 5FYHA 5C3PA 3PURA 4IL7A 3AXDA 3CQOA 2Q1MA 3GYDA 5KWRA 1SLCA 1UIKA 3J7HA 1H8TA 4GQ7A 1UY3A 4QB1A 5T52A 5IVCA 1GLHA 1F5JA 3MFAA 1W8FA 4J25A 3VLBB 1IS6A 2RG4A 1WA4A 4WM7B 4E4ZA 4GAZA 3VDDC 2B5HA 4XILA 2Q1FA 5GZFA 3U37A 1KDMA 1L7RA 1US3A 1HJFA 1E57A 3TB0A 3KB5A 1JZ2A 3OOXA 1XU1A 4MHUA 3C7OA 5DAQA 1V00A 3VBRC 3WV6A 5J09A 4CDQB 2E32A 3KSCA 4XBLA 1ODMA 4AVVA 3BGAA 2YC4A 2VCBA 3VKOA 4N90A 4Q1PA 5A32B 5LEKA 2V09A 1OUXA 3OF1A 1PHMA 4BQ3A 1VBC1 5C3SA 1OA4A 2GH2A 4LTAA 5A7WB 1U5XA 1I1EA 1QJY1 3O12A 5EYXA 5KHKA 1UD1A 4K9SA 2XUEA 2WO1A 5FRAA 4UT5A 1RUE3 2DVGA 4RQPA 4KWKA 4N8MA 2JDAA 3RYPA 2GP5A 4AEDA 1LOCA 4YWAA 5FIXA 4A3XA 2UURA 2WO2A 1BEV2 1ZRIA 3JBG3 3MV01 2VMCA 4Y1ZA 5F7UA 3T0DA 4MGTA 3I59B 2Z42A 3HBZA 2D6OX 3HR9A 3LF7A 2WL1A 3PVOA 2OKXA 3ZDVA 1AVBA 3M3EA 1UCXA 4EROA 5LBFA 4XQWA 1RMU1 2C26A 3NVCA 5LA2A 2ZS6B 4RGKA 1JH5A 4XJUA 5APAA 1H9WA 2B9UA 4COZA 5FWJA 4AI8A 1UKRA 1FOD2 1HXS3 4I3PA 5F9TA 2GC0A 2LRPA 3WX5A 3C8XA 2XLAA 3BTAA 4LJHA 3WNLA 4BZ4A 2HEWF 4CP9A 1XOYA 3EB7A 5T3NA 3I8TA 5H9PA 4GKXA 3WF0A 4XZUG 2RS11 4DUXA 5FPLA 1AJOA 4HSLA 2E53A 3WW3A 2ZOEB 3BUCA 1ZZ8A 1Q8SA 1CAUA 1TME1 1UWWA 2E7AA 4R9DA 3UT0A 4AQSA 1MZ5A 4COVA 3AP6A 2IXKA 4QXBA 4YVWC 3D3AA 4KWUA 1BCXA 4M4RA 1N1VA 2W1WA 3Q8AA 5JOWA 1AR93 5CFCA 3VD3A 3LCPA 1IKQA 5JXJA 1OOPC 4LHNA 1FT9A 1RHI2 1VBD3 2DUOA 2KR2A 5F2WA 1E5IA 3N7KA 4JKMA 5BNNA 4FXKB 1PX4A 2XXZA 5FK7A 5F8PA 4XCAA 3CBNA 2CY6A 2W52A 3KWVA 1XSQA 2VMDA 1PZ8A 4MXWA 1ZNPA 4XXAA 3IWZA 3H8UA 5G05L 5L19A 4GWNA 3WG1A 2VGDA 4OHVA 2CU5A 3VL9A 1DF0A 1SPPB 1X33A 1D4VB 2XQXA 4XDPA 4C1XA 2BNMA 1PO13 3FLRA 1WW4A 2A71A 3POYA 4LXLA 4YG3A 5FLHA 2JE8A 3AZVA 3LDRA 3VHPA 1PVC3 1REFA 3FLPA 2YFZA 4B7KA 3U75A 1WGPA 4AHXA 3JBG2 2QQIA 4P9WA 1X8MA 4MLOA 4BLJA 2E26A 2RR11 1NKGA 4NN0A 3ZSLA 1JYVA 1PM4A 3LZZA 1DU3D 1W6PA 3UL2A 5A3OA 4E8CA 4C90A 1RUI1 4L11A 5IT6A 4UAPA 2PLV3 1W6MA 4IUGA 2R0HA 4M3CE 5A6ZA 2BEOA 2O0OA 2OVUA 4NIDA 3VBFA 1H1MA 4OLLA 3SEEA 5HI0A 3USUB 2RDRA 2YPJA 4JVAA 1VBB1 3ACHA 1I9RA 1O59A 1LENA 4QGMA 3WD5A 4WVVA 4CDUC 3UESA 3AFGA 1R092 1QJU1 5EJ3A 5J36A 2A1XA 3ZDSA 1PM7A 1F9KA 1D4M1 4CEWC 3SH3A 3OGGA 4AHZA 4TWTA 1L3JA 3JD72 5FZMA 1O3QA 1I3HA 1SLLA 3K2OA 1AR92 3VBHA 4R9BA 2BJSA 3PLQA 3ZKYA 2DCKA 3F95A 3D82A 5IAVA 3U4SA 5HCHA 2G9FA 1RUJ1 5HCBA 1VBD2 3POFA 3VZJA 3BB6A 4DINB 3U0ZA 3MLJA 5GLVA 1UZWA 4CCJA 4NMIA 5A6QA 1VP6A 5I0UA 1YUDA 1S2EA 1VRH1 2BVVA 2ZJCA 3KLSA 1ZBE1 3ME2A 1W06A 4IW3A 3IKWA 2YZ4A 3V64A 2GNMA 4M3CF 2XG3A 3GJAA 1KGYA 3WP5A 3ZXAC 1CAVA 2C24A 1ULCA 3KV6A 1W04A 3D0JA 4GWMA 4IE7A 4XYXA 5E16A 3DKWA 3NWKA 1JOBA 1PO12 2XBO1 3MLKA 1WMDA 3RYKA 1DHKB 4QGNA 4A44A 1AL21 5BY5A 1PVC2 4Y5SA 1QOOA 1NCQC 1RXFA 1HB4A 1MACA 2J1EA 2JG9A 2QUOA 1RVF2 3KQ4B 3PUSA 1UY4A 4GJZA 4WVMB 5LA9A 3UKNA 5KHGA 4JC1A 5DN2A 1A34A 2LUWA 3V0AA 5F5IA 1RUC1 2JENA 2WS93 5J7MA 4AW7A 4BQ4A 2EAKA 4PT6A 1I5PA 3WUDA 4QPGC 2PLV2 1D2QA 3J8F3 4CEYB 3KHCA 5JI7A 1UYYA 4MHRA 4LULA 5DAPA 1ZZBA 3ES1A 4D7TA 1OVSA 4MGYE 4NRQA 1Q8QA 1WZXA 2WYFA 3THTA 5C4WC 1U5ZA 1G7YA 1WCDJ 5F2SA 1OFNA 4B7EA 4Y22B 4EE2A 1LB2A 4LK7A 4UW3A 2AEYA 3N3HA 1JOJA 1VMFA 2HWB1 2K0GA 1VPHA 2MHFA 3K75B 1AX1A 1OLQA 1TQ5A 3OD4A 3QCWA 4KU8A 2OXBA 1GICA 3EQEA 3I2KA 4BXFA 4QQHA 4D0QA 4P9LA 3EMRA 3THDA 1AR73 2MEV1 3JUUA 3OD0A 4YRDA 5BNOB 3O1PA 1LKNA 2ET1A 4Q0UA 1RJ8A 1GR3A 2YXSA 2KD7A 1SQ4A 4M00A 5FY0A 2EXJA 2NQYA 1TZOA 1HX6A 2CAUA 1W3VA 1QQP2 5M0TA 2A3XA 4EN7B 4YM2A 3NSTA 4LA3A 3T2TA 2WZR1 3A0NA 4I09A 3O7OA 5FDBA 1K3IA 2W87A 1W8ZA 4NAOA 1GBGA 4RR3B 4BQ2A 1BK1A 3AMNA 3HNMA 3K51A 3MIFA 4YGDA 4FAGA 4FPCA 2C5DA 4W4ZA 3PIGA 3RMXA 4CRQA 3WNMA 5F3IA 1GNHA 3ACFA 2BZDA 1FYUA 3RVHA 2WQZC 1JZ6A 5E8AA 2ZHLA 4BIOA 4QXCA 2IFRA 1WKYA 1A8DA 2ZEYA 3VZNA 2Z4FA 1NX9A 4MGIE 3WUCA 1YJLA 4UI9L 1QJY3 1O3RA 4GXLA 2WWSA 4XFCA 3U1XA 5FTTC 1LTEA 5KR7A 4Y5TA 2VECA 1GNYA 3WF1A 1NY72 2F4LA 3AKQA 4E4DX 1X8EA 3ON7A 5A7QA 1WMFA 4HKOA 2WA3A 2WS92 1IPKA 3H1MA 3OBRA 4GWIA 2XVGA 2MNGA 5FO7B 3HNYM 3O5SA 2Y34A 3TEXA 2WNVB 1RITA 2PTMA 1PZ9A 3GBWA 1XJAA 5FXXA 3S7IA 4JGZB 3WNXA 1YCIA 1RUD3 2YROA 1CWPA 2IVIB 3IDAA 3ZXLA 2V73A 1JZ5A 4Y3OA 4ZZ8A 2WNUA 4CP0A 2HWE3 4QU1A 1NCRC 4XETA 2XDVA 1EY2A 3I97A 4YVSB 5EXOA 4GH4B 1N1YA 3HPNA 2VBPA 1YQ2A 3RG0A 3WCRA 1E5HA 4FPOB 5LCWL 1JU3A 3N9PA 3PNAA 4AFCA 4CDWA 2MPFA 3IM0A 3CL1A 5A3MA 5C8CB 3QBQA 3VKMA 2PHXA 3DL3A 4YZ1A 3P3NA 1Q5OA 4AFBA 5DZFA 2GC3A 2LTNA 5FJHA 4BB3A 5LK7B 4BU2A 4H2AA 2H0VA 1HRV1 1NA1B 1O8PA 2ZKLA 4HPKA 4AQTA 4FBFA 5JVVA 3NJYA 4DO0A 3NNJA 3CNAA 4GMP1 4OULA 4GULA 4XJZA 1KFUL 1W03A 5A33A 4HN1A 3J26N 4GB33 4XVHA 3ZYHA 5IK7A 5KHHA 5CAZA 2E7TA 4IGQA 2IVJA 1LOBA 3ILNA 4M01A 1VJ2A 2W91A 1C1LA 2DFCA 4LBQB 1OVPA 1J59A 4V1PA 2BERA 1VBC2 4LITA 4P9XA 1K42A 1BYHA 1X50A 3PMSA 1QJY2 4XUTA 5A3UA 1A8MA 5A1FA 2UWAA 2G9GA 1FNZA 3OJBA 3B02A 3WDUA 4KMQA 2SBAA 5F37A 2X09A 3AMHA 2F6BA 2RV9A 3DPRB 4E2SA 3BYWA 4C1WA 2RM23 3OYWA 2XPJA 2JEMA 3BTZA 2GN3A 4KG8A 1FNYA 3Q8EA 5DUWA 3HBKA 4YGEA 4B1LA 3WDVA 2ADEA 3AL5A 4IV3A 2RR13 1UY1A 1DZQA 1JOPA 3SNMA 2WSVA 4AFDA 2ZBJA 1RMU2 3BOWA 4MGQA 2A7AA 2QDRA 4OHXA 4OMCA 1RUI3 2CL2A 1F4AA 2VPVA 3R0RA 4IV1A 4PDWB 5HXVA 4AL9A 5A3PA 3FWEA 4HOOA 4ZHNA 3I3QA 1OBNA 1ZYBA 1AJKA 3P3PA 4META 1ZRCA 1R1A1 3WDWA 2VMGA 2VMEA 1BXHA 3AYCA 3KCCA 1VBB3 4DRVA 2WR9A 3JQWA 1S2KA 1H4HA 4N43B 3RRDA 1DGWX 3WQBA 4HXCA 1NE4A 1VLNA 3PDQA 4H55A 2D6LX 2ZGOA 1QJU3 2RS12 5KXDA 1DFQA 1MS1A 5G04L 5GLTA 3LEIA 3I2OA 2AACA 1TME2 4IEPA 2VQAA 1O5UA 4PCRA 4LBMA 1XU2A 2W94A 4XF4A 4XFGA 1A6CA 4KU7A 2LW8A 5C5UA 4UFKA 3Q8FA 3FN9A 2R16A 3RZMA 1BK0A 1WLDA 4XJWA 1DQ0A 2D93A 2YMZA 1H0BA 1NE6A 3K3OA 4RQPC 4U2AA 3HD8B 5L7OB 1Q3EA 1RUJ3 1VR3A 4HMZA 4F8AA 5A3LA 5E89A 5KHJA 2XB6C 1LR5A 3U78A 1LOFA 5K0UA 3RDIA 3E6DA 5JLVA 3CZJA 4B4QA 1QEXA 1PVXA 1UW8A 3TNPB 1N1TA 1Z0HA 4QWNA 2P2KA 2EF6A 1W2AX 3SXWA 5CFDA 2ZAAA 3VDDB 5C6CA 2ARBA 2CGOA 2JDMA 3B01A 4QT6A 2UU8A 3D5OA 3H50A 3VKLA 3WF4A 1CD3G 4NPMA 1RUE1 2R041 1CVNA 1WD4A 1ZZCA 2JIJA 4YGBA 3AVRA 4LBQD 5FYMA 3VBRB 4QQ2A 1CX1A 4E8DA 3LIGA 1AL23 1RJ7A 4UYBA 2Q0AA 3JBG1 4XF0A 3I54A 1VALA 1KS4A 2GMMA 1OH4A 3MF6A 2PMWB 3TYJA 4BDVB 2WZEA 4IETA 4FPYA 3W5MA 2OS2A 1LOEA 4RD7A 1FV3A 2RR12 2FDJA 5A7NA 3ZFEA 4Y4YA 3MUZ1 2ZMLA 5FPXA 5FZHA 1N47A 2K2SA 4P02B 3OY8A 1RUI2 5CFCC 1XNKA 3DF0A 2Q8OA 1HXS1 1JYCA 4Q4W3 1H2NA 2JDZA 1PNFA 1HB1A 3IB3A 5BNQA 3LFIA 3T1MA 5IYYA 3QH7A 3H0OA 1HV1A 1LHNA 5C9AA 1VBB2 1W9TA 3OEBA 2GNDA 2DTWA 4R52A 2ORZA 1A3KA 1ASJ3 5C3RA 1C28A 1AYN3 3SLIA 4XAAA 3WNOA 4I01A 1W8NA 4DFSA 2HWB3 3S5AA 1QJU2 2Y0OA 2K46A 1GP4A 3KQRA 2WC2A 2E33A 4LBKA 1AR91 1QH6A 1SCRA 1EP0A 3PHMA 4HT1T 1TNFA 4LEJA 2MEV3 2VW0A 2WWJA 2BUKA 3GZUC 4OUMA 4NR1A 2LROA 4IEVA 5FXVA 3W20A 4JDNA 3CF6E 1MS9A 2XUMA 1N3PA 2W1UA 3LA3A 4XDQA 3WLUA 2CAVA 3I49A 1C4RA 1RUJ2 2WJSA 1O4ZA 2RMU3 3PIJA 1UAIA 5FZLA 1POQA 2WZR3 1J1LA 1ZZ6A 4NJ4A 5EV7A 4H7LA 4X6RB 3WP6A 4CCNA 4A4AA 3L2YA 4UFIA 5K8SA 2QQPA 4CDXB 3RZLA 4Z2WA 3FFQA 4JGYC 1LRHA 2LALA 2DCJA 3V0BA 3PMEA 3CZUA 1TEIA 4D69A 5IK8A 3J9SA 1F5FA 2VVDA 3VBFC 4I0WB 4OUEA 1PMIA 1W6QB 2EXIA 2XBO2 1YI9A 5JR7B 3KV9A 3M1HA 1PVC1 3N9QA 3UGGA 2PN5A 3INAA 1AL22 2DTYA 2WZ8A 1K5MB 3PUIA 4WM7A 2I45A 4XMIA 5EJZB 1S2BA 4NVPA 1GMMA 2HKXA 3HT2A 1SLTA 4BK4A 3H3UA 5FAXA 5L36A 3FUQA 1BZWA 2ZGKA 5JPMB 1LGNA 4LHSA 2VR4A 4LO8A 3TAYA 4CDQA 4ZU5A 4ZZ5A 3AJZA 1WCQA 2GNTA 4AI9A 2NMOA 5IWFA 1O5LA 4ES9A 3ZYPA 4Z2AA 2BU9A 4MGZE 4Q4W2 5A32A 3KCXA 1XYNA 4Q0VA 3WDTA 3LA2A 2D6NA 3S30A 1GSLA 1NYWA 1PK6B 4XTPA 2AYHA 4GD4A 5A7WA 5IK4A 2CGPA 3H3LA 5FOJB 3OGJA 3LKJA 3VBSC 1ASJ2 1VE0A 3C7GA 2D6PA 3KGLA 2WO7A 4NPLA 4ZY9A 4XUOA 3I3MA 2HWB2 4C8DA 1D0HA 3OUHA 4YNIA 5A3WA 5LRSA 4I0BA 1OPOA 1GV9A 1EUUA 3LFMA 2W2IA 1UY0A 1J3RA 1X82A 5LWBA 1XNDA 3I59A 4XBQA 5ERLA 2MEV2 4FT8A 5DQ0A 1JYWA 4JKLA 5FCCA 4XURA 4I0AA 3AZYA 3RZJA 3HVDA 3AP9A 1UNBA 4HKWA 2JDUA 2IFWA 4HG6B 3T1LA 5EPAA 3FE5A 3CLPA 2TBVA 3VZKA 2RMU2 3A4UA 4HANA 2WZR2 1GZTA 5FPAA 1ND2B 4ITCA 4GMP3 3RZGA 4IE6A 2ENRA 2O8QA 2WNEA 3E5XA 1GOHA 4QPIB 5JOXA 3BVCA 3W59A 1E5RA 2B8MA 3EO6A 3WF3A 2JICA 4EZHA 3FZ3A 5EHDA 4ASMB 4D7YA 3BOPA 1HN1A 2JDNA 1PZ7A 1YYNA 2E31A 2VC9A 4DXRA 3MO4A 4BMEA 1Y3TA 5HCFA 5H9SA 3H9AA 3GZAA 4K3UA 2GMEA 1XC6A 3BCWA 4EN9B 1YQ5A 1X36A 4SLIA 1DQ6A 3ACGA 3SITA 5AFEA 4YW5A 1EPZA 5C5TA 2V4AA 4RHV3 2QVSB 1TNRA 1XPWA 1CQ9A 3KV4A 1QOSA 4LR4A 1CZSA 3J8F1 5KC5A 5AC91 2ZGRA 3FFZA 1T2XA 4LOSA 4DXSA 4CCCA 5LY2A 3JB8A 4V2WA 5CZKA 1REDA 2CDPA 1S0DA 3FHIB 3I2GA 5A7PA 1DG6A 2ZEXA 3FL7A 4LMFA 1BMV1 1AF9A 4O7XA 1SPPA 1WW7A 2WLQA 3ELNA 1UO9A 2K9ZA 2VUAA 4ZPIA 3MGUA 4GIQA 5I0SA 1DLCA 1IQDC 4K21A 3VDBA 1JBCA 1Z78A 2LM3A 4XFFA 1OA2A 1BBT3 2VAUA 4EWDA 2VCAA 3FJSA 2VOTA 5FK8A 4QPGB 1OFSA 4W50A 1AR71 2XWJB 1IZ3A 4JRLA 2JDYA 1MZFA 1OT5A 4OQ9A 4AXOA 4BQWA 5JUVA 1DYPA 5LY1A 2BPA2 1L7LA 4YZ3A 2DDUA 4NRPA 4ZS3A 1QXPA 3K4AA 3OPZA 4Y26A 1F35A 4KGGA 1ZBA3 1NOVA 1W9YA 1HRV2 4E4SA 2Y64A 3FUOA 3ZYJB 4Q4Y1 3POIA 2P6CA 3E6BA 3B9IA 5DAWA 5JCTA 3USUA 2WQ4A 1W2TA 2ZAHA 3DEMA 2E6VA 2KA3A 3TNQA 1Q8OA 2R063 4CU8A 1MEC1 3WQ0A 4K8RB 4OQ8A 2OW4A 1OSGA 2ZHNA 3SHRA 4YW6A 1Q8PA 1GZ9A 1KS5A 1X7NA 4IEQA 3JZVA 2EIDA 1AL0G 5FPBA 1VBE3 4KNCA 4KBZA 4IE0A 3R05A 2JJ6A 4XW3A 3POGA 1BJQA 1ZZ9A 2ZMKA 3H7JA 1N1SA 4EZ4A 2R043 4EYUA 4Y1YA 2UYAA 4CUBA 2JDHA 5ISLA 2XR4A 4A7ZA 3IIAA 2DWRA 4KL1A 2WN2A 3DUIA 5I91A 4CDWC 4F7ZA 5FBJA 1IG0A 3DYPA 4D8MA 2HYXA 3N35A 2PHWA 1J3QA 4YGCA 4AAPA 1CJPA 2R1DA 1RUD1 5LEJA 1SACA 4K1ZA 3T08A 1LHWA 4YFWA 2JWPA 2DF7A 3TEWA 3LA7A 4DUWA 3ZN4A 2HWE1 2UY8A 3VL8A 4HVQA 1I6XA 4NAMA 1LOAA 2P6HA 1CR7A 3M70A 1R1A2 2ZGQA 1DP0A 3AP4A 4MSVA 5CNAA 4I3GA 4RFRB 1T6BX 5BV6A 1WA6X 5FZBA 5FUNA 2BVBA 4UOJA 1XNTA 2J22A 4GMP0 4P5HA 4RGGA 5D8AB 5FMBA 2Y6FA 3AKTA 1UU6A 4Y24A 3WW1A 3APBA 5T50A 4ZXEA 4LKDA 4ZONA 4WVMA 1RUH3 4YZ5A 1CAWB 2G1MA 3LSEA 4FOQA 3NNGA 5A3NA 5C71A 1QJZA 3GHNA 5CKNA 2FMYA 4KH9A 5K9YA 2IWGB 3MIEA 1NCRB 1JYNA 1RUOA 2JG8C 1YFUA 2D40A 2Q1ZB 4HFSA 4CEYA 4BISA 4HVRA 4WM8C 2IZWA 3KF5A 4FOYA 3K77A 3ZMOA 3ZXJA 5A1AA 3T09A 4HLTA 4GB31 5ABJB 1W99A 3O14A 3IT8A 3RNSA 1UL9A 4YG6A 4Y22A 3DN7A 4IV3C 3ZFFB 4FPGA 3SKVA 5JSOA 2D44A 5AVPA 5DG1A 5ANQA 4F3JA 4Z8BA 4XJAA 2OUJA 4ONUA 1XYPA 3MI8A 1VBE2 4CXWA 3NRUA 1ST8A 5D21A 1CAXB 3C7HA 3BI3A 4LO6B 2W5FA 3T30A 1QDOA 2DUPA 2R073 2WO3A 1NXD1 1Q56A 3AP7A 1OKQA 2ZTNA 4IEWA 1MQTB 1R64A 3WZ1A 1RUE2 2R042 3N9OA 3OGVA 1P8JA 4PLMA 1WLTA 1PNGA 4AGGA 2RM21 4AYUA 3SC7X 4YW2A 4IE5A 4ASKA 2PQSA 4M3CB 3A0KA 3WSOA 1BKZA 3T4HB 4QDRA 4BQXA 1L7QA 1Y9MA 4NUBA 4RR3A 4XBNA 4WV8A 2AENA 2QQUA 5CIRA 5FZAA 4CXXA 3N7MA 5IVJA 2RDSA 4AQ6A 4DY5A 1B35C 5FR3A 1Q8VA 5JR2A 1NUKA 4DY3A 1HXS2 2J1RA 4AI0A 5JSRA 1OQDA 1IS3A 5FP9A 3J7MA 1UZVA 5LZ6A 2AC1A 1W0OA 4OVEA 2ZGMA 3LDKA 1H1AA 3ATGA 4TXWA 4XPVA 4A42A 1DQ2A 3ABZA 1LOFC 3H8XA 2BWAA 2YBKA 3GZTB 1POV3 4QX2A 2ZHKA 2TUNA 2ZXQA 3SH5A 4D6RA 5FYCA 4XJ9A 5CFDC 3DCQA 1QJEA 3N9MA 1MVQA 3FHQA 4HBNA 2AGSA 3OBTA 3WINE 3E1F1 4LNVA 4AQ2A 2WNVA 4TTGA 2R32A 4JGZA 2VBDA 3ZX7A 1V6LA 2GU9A 2B45X 5EZWA 1PIV1 4YARA 2VD7A 3ORJA 3VDAA 5J98B 1OLMA 1YI7A 1XXNA 4DZGA 2EALA 4FPJA 1R1ZA 2Y60A 2R6QA 3KGZA 3S7EA 1AX2A 4YVSA 4GH4A 5CA6A 2OA2A 2JIGA 2YGLA 5DG2A 4LK6A 4LBJA 2HBUA 3POBA 4S2HA 3NKTA 2PYTA 1W39A 2X5IC 3QOPA 1H30A 5C8CA 2A6XA 2P4EA 4QD2A 3MFCA 3TOJA 1ENRA 3TBDA 2FQPA 4HK8A 4IXLA 4JTNA 1JHNA 1U5YA 5A6YA 1KRIA 2FDKA 4CU9A 5BXXA 3ZSEA 2BGCA 2VNGA 4OZOA 2QQLA 3HQRA 3AYAA 4UBHA 1CONA 3SKJE 1NA1A 2A6ZA 4AEJA 5EQUA 4NHKA 1H6XA 1Z7S3 4QX7A 2AZ5A 4MOAA 2JD4A 3EHKA 4AGVA 4QPWA 4BE3A 3MPBA 3ZFGC 3THCA 4E27A 2BP6A 3JQXA 1O3TA 2VBBA 2V72A 4YG0A 5FLIA 5AC93 2VULA 4Q4W1 1W90A 1HV0A 2YHJA 2ZHMA 5F6KA 4FPEA 4XE9A 4LHLA 3D6EA 4O9EA 2XVKA 4QXKA 5H9QA 4LBQA 4ET7A 1LGCA 2EA7A 3Q8BA 2OX0A 1CPMA 3NJXA 1SZBA 2ZEWA 4N53B 1ULEA 3B00A 4XUPA 5EJ1B 1ASJ1 4YM3A 2ATFA 1AYN1 4NIAA 4A7YA 1CAUB 4PQQA 4TYSA 5FYVA 2EICA 5A70A 1LU1A 4OYUA 4XF9A 5FKCA 3WNPA 1UOBA 1LU2A 4LBNA 4FFGA 3N9LA 3U14A 4MV2A 2HLEA 3DPRA 1MZ6A 4NHYA 5FZ7A 5IUQA 4CU6A 2GC1A 2BBVA 5FMOS 4BPZA 2A73B 2CDOA 2G19A 3GALA 2VXJA 2Y6KA 1HRI3 1UYZA 4R9CA 4UW6A 4XXPA 3T0BA 4AOCA 4K40A 4NIGA 4YM0A 3BU0A 3NKGA 1AZDA 2XJPA 1FPN3 4A6OA 1C3HA 4PDWA 3MIBA 4WM7C 1G9DA 2RMU1 3MIHA 5F5QA 1DGRN 4QGLA 5FZEA 1NQJA 2Q8CA 2W92A 4Q4Y3 4WBBA 1KJRA 5LBBA 1G6NA 3WT3A 5JMOA 4BYYA 3MLLA 1O3SA 2VMHA 1YRZA 3A22A 4MGSA 4JKKA 1MEC3 1O6UA 3DECA 4N43A 4BQYA 2NLRA 3UJOA 1W6OB 1V6MA 1GZWB 1R081 4P00B 4D7SA 1SLIA 1SBEA 1TMF3 2DYCA 4XAEA 4DEVA 2VCMA 2P3JA 3QH6A 2J42A 3NO8A 4NRMA 5DDJ3 4FTBA 1COV3 1GWKA 3O0XA 4DB5A 1XE7A 4FPHA 1JYTA 4LO7A 1LJ7A 2VZVA 2Z5WA 3RQ0A 5JZGC 1O4YA 2BBAA 2YDEA 3P5BA 2F17A 2CNAA 5FPZA 5IATA 4JGYB 1UZ0A 2ZCWA 5L7OA 3GHMA 5FXWA 1ND3B 2X10A 3C3VA 4FOVA 4Q27A 5I8SA 2C1FA 4LOTA 4Q5OA 4NHXA 3VBFB 1POV0 2WQ8A 3AB0A 3NL1A 5A3TA 3J8F2 1J1TA 2HH9A 4XCBA 5AC92 1OKOA 4M4PA 2BOIA 1VAKA 4LUKA 4CP1A 1DIWA 2P37A 3AFKA 1EPWA 3VD4A 1CPNA 1WLWA 1BHGA 2FBEA 2O1QA 2OUHA 4QKBA 4AG4A 3VDDA 4AWDA 3SCHA 5E88A 1BMV2 2ARXA 3LEKA 5IJRA 5JPNB 2E7QA 1LEDA 4Y1VA 4UF0B 5CKQA 3VBRA 4DIQA 5FYIA 3ZMNA 3BKZA 4K7JA 3ZYFA 5GZDA 2O14A 1CGPA 4QB6A 1AR83 3VDCA 2NN8A 1AR72 4Y20B 1HB2A 3BIEA 2JX9A 3USSA 5FY7A 4Y5Z0 2B42B 3WG4A 1CESA 2QKDA 4S2FA 5DUVA 1Y7BA 3U10A 4D3WA 4LIUA 2VZSA 2VZ1A 5BNPB 3W9AA 2R0FA 4UXAA 3AZZA 2IXLA 3VBSB 2PFWA 3ZSJA 3TEZA 5T5PA 1SDWA 1X9TA 2YV8A 1YQ6A 3PTYA 1LOGA 5C3OA 5I0DA 1GNZA 3MDPA 1STMA 3IBMA 4AZZA 4Q4Y2 5IK5A 1UIJA 2ORXA 4Z1VA 4AHWA 1UF2C 2P5BA 1UZZA 1ZRRA 1G9BA 4NIIA 1V6JA 2FMDA 3H7YA 4INDA 4QKFA 1WLCA 1KXGA 2W47A 3KT7A 4QDSA 4RYDA 4Q1RA 3VBOC 1MEC2 2YC2A 4BHPA 5JWPA 3RMYA 3NAPB 4PI2A 1GP6A 4URTA 3QLQA 2VOVA 4PIYA 1F15A 2BGOA 3HN3A 3MEPA 1TMF2 1Y9QA 3KV5A 1QNWA 4LBLA 5FZFA 1MZEA 5SV8A 3FX3A 3EBRA 3UV9A 1EYBA 3GF6A 2Q8DA 3Q9OA 4TN7A 4CYDA 2QZ2A 1WW6A 2PHTA 5E1RA 4L99A 2A3WA 5FXZA 2EXKA 2D3RA 4RHV1 2DCYA 4DXTA 1SMVA 2QQOA 3E5UA 3CJIB 4P5YA 2BOJA 1NZCA 1OF3A 1H8TC 2CHHA 2I07B 3LEGA 5L9BA 3RS6A 3ZIXA 5IAXA 2J1AA 4PF1A 3M7AA 2BNNA 4BCUA 3S5QA 5JXIA 4CDXA 4BXSV 1RUD2 1GOGA 4WZCA 3NMBA 4MO3M 4RS5B 1C5IA 1H2KA 3AL6A 1S55A 3CIHA 2WBKA 3LDBA 4TSVA 2HWE2 2VZUA 2P17A 5LBCA 4QX1A 5T54A 1W6QA 4DQAA 1BBT1 3CDZB 4B4RA 4O61A 3H1WA 2Z79A 1GUIA 1RUF1 1WCKA 4P08A 1K5MA 3U4XA 5DXDA 5BPXA 4FSJA 5A80A 4PF5A 4AR2A 2RE9A 5I8TA 5I8YA 4NPRA 4XFBA 1DYKA 1H8VA 3LEMA 1W28A 2VZPA 1YQ8A 3PJYA 1ZBA1 5KC6A 3AZXA 1ZZ7A 3ST7A 2YFUA 4X6QB 2ZX2A 3UJQA 4ATEA 1IOAA 3Q8CA 1AXYA 2AREA 2QQMA 4CUGA 1QH7A 3VBUB 1LAJA 3J4UH 4AEDC 3JCIA 2EAAA 4HETA 3ITQA 1QNYA 4HK9A 1PK6A 2R061 4GB32 1PIV3 1PX3A 1JXNA 1C1FA 2DCZA 1T6GC 2WDBA 5LB6A 3MZHA 1VB4A 5GZEA 2A70A 1G8WA 2VW2A 3PUQA 3TEYA 1VBE1 2ID4A 1W8TA 3WVJA 3ZYRA 1ENXA 4FPLA 5FY5A 3UGFA 3NV2A 1HW5A 4XFHA 3AJYA 1ONAA 2X05A 1S0EA 3NJVA 5BUVA 4LT5A 2DBIA 3RJRA 3RWNA 4NHLA 4W6WA 3WY6A 3B7MA 3S6PA 2RM22 1MS4A 1YIPA 4RFT0 1ALYA 3RJ2X 4E2GA 2UWBA 3QD6A 5FO8B 5I0RA 3NJZA 5LA1A 4QAWA 2NM1A 2GSYA 1URXA 2D3SA 4CUAA 5L73A 1ND2A 2W1QA 4UW4A 5FY4A 3ZFGA 4XC9A 4FTEA 2VJXA 1G9CA 3K48A 1FAYA 2OZ6A 1UQXA 4QPIA 4CA9A 2VVEA 2WA4A 2XGXA 2VG9A 3DYOA 3VV1A 5B4NA 2RDQA 1XYOA 4OI2A 2QFEA 2VNRA 3LPGA 5C7GA 4IEYA 3BTXA 5IVVA 5JMCA 4CUCA 4Z92B 1UN1A 3I2IA 4ZXKA 4AI2A 4LBOA 1MPXA 4FP2A 4IDZA 3PUAA 1QXJA 3NQHA 2VU9A 2BDRA 4MGKE 5FY9A 1XRUA 4CSWA 5BYNA 2FDGA 1OPMA 1AR61 4NWWA 2JXAA 5BNNC 1CIYA 5ANNA 5FZOB 3VN4A 5GKAC 5GZCA 1EAH3 2P34A 4XOGA 1RUH1 1OXCA 1PO23 5C70A 5J3UA 5H9RA 2TEPA 1VBA3 1XBFA 3IAPA 1S0GA 2KXLA 4H3WA 1JYIA 3HJRA 4N9IA 4LLOA 1IS5A 2Y33A 4B1MA 5BNOC 2C0ZA 1W8WA 2EXHA 2VMIA 4YW7A 1JTZX 2BFUS 4OFGA 4CU7A 5LA0A 3MV11 5FZ0A 4OI1A 4ZS2A 3AC0A 4LKEA 2QNKA 2ARCA 5FYBA 3B93A 4XF1A 3ETQA 5FQ0B 2Y6LA 3EJKA 4QHZA 2WINB 1PIV2 5D1IA 3WOGA 5GJ6A 4XIOA 1DDLA 2RS53 4YVWB 4AI3A 1RUG3 1H9PA 3HOBA 4Z07A 4G9SB 2JG8B 2CYFA 1YO8A 1D0GA 1OOPB 3HQUA 2CTVA 4QPGA 2Q8EA 1Q43A 2R071 3OGSA 5L9RA 4WM8B 3H3ZA 1R083 4LQRA 1J83A 2W3JA 3LOIA 4WVWA 1HLCA 4GALA 2C6SA 4B3NA 4Q4V3 2JD9A 5CYYA 2E51A 3I2DA 3V56A 3WQ1A 3H8OA 3C2UA 3TN93 5FY1A 3ZVXA 2ZX1A 1FMD3 5IVFA 4L97A 1FX5A 4YW3A 1SDDB 1TVGA 3VBHC 1QIQA 5JOZA 1C8NA 2BGPA 3ETPA 4DRRA 2HWC3 4PIZA 2WNVC 1OQEA 1WW5A 3HMYA 4QKNA 5CEHA 3FHAA 1RYYA 4YLZA 1MVEA 1HQNA 1G86A 2IXHA 4TZDA 2W9XA 1LECA 3ZXFA 3N36A 1TG7A 3GGLA 4IEZA 1AYN2 2YPDA 1Y9GA 2HEVF 3SEPA 1SFYA 3H8RA 2RJ2A 1POV1 2E9QA 5LK5A 3AP5A 4W6XA 1PO22 2ZZJA 2WRAA 3JU9A 1B35B 3EXUA 1VBA2 5FZ8A 5KXEA 2D43A 1IGOA 1RINA 4QQPA 1DQ4A 2WIIB 4CTEA 5FYTA 2OIIA 5C8CC 1K12A 3NNFA 5F6LB 3A7QA 1X9PA 3VB9A 2FZ1A 3WDYA 2WLPA 4ES8A 1GKBA 2PQQA 4COWA 1ENQA 3PVBB 4CDUB 2J1TA 1IKPA 2GN7A 2L9LA 3J7NA 2JG9C 5F1RA 2DV9A 1QJX3 1C8M3 3O1OA 3VZOA 1D7PM 3N7JA 4CEWB 1G9FA 4LUMA 4PQ9A 2DCTA 1RUG2 3LE0A 4FFFA 2YU1A 5EFUA 4P9JA 4YSFA 3IN9A 1JS9A 2XWBB 1RTVA 1OURA 1HJGA 5D8AA 2XOMA 5GLUA 2Q30A 3I4IA 1R082 2Z69A 3D0SA 2OQ7A 1W9WA 1CAWA 1QWRA 3KS7A 4D94A 4MYEA 4OHWA 5A7OA 5DABA 2XH6A 4Q4V2 4ISRA 4ORFA 1NCRA 3WXPA 1I5ZA 1G9AA 1XNCA 1LODA 1US2A 1Z7S1 2HJIA 2HWD1 1H2MA 3AMQA 3DPRC 3J7LA 3NV4A 4COUA 3ALQA 2WT1A 4ZKTB 3ASIA 2XL7A 1FMD2 1UOFA 3I2HA 5ABJA 1FV2A 4L9BA 2CWSA 3UKTA 2BWCA 2X5IB 1WWYA 3UYJA 3ZFFA 3GJBA 2QDNA 2BQPA 5F5AA 3VHOA 1SG3A 5E6HA 4N9HA 1IPJA 1W2UA 1W6NB 5FZKA 1NCQB 3TRSB 1ZA7A 4PDWC 4XABA 1NLQA 4ARXA 3GM8A 1F31A 5DZEA 4OHYA 1CAXA 2PAEA 3WNKA 2QQKA 1LCLA 3RI9A 2VZRA 2Y26A 3BODA 2VOKA 1MQTA 3H1YA 1MS3A 2WKKA 1BEV3 1JW6A 4N43C 4LLFA 2ZGUA 5FP8A 1RUF3 3RZHA 1J84A 1QOTA 3BIWE 4RSUA 4M3CA 3KVAA 1UPIA 3R4DB 2NP0A 1HRI1 5C4WB 4BMBA 1GFF2 3ZPYA 3ZYBA 2P3IA 3ZYGA 1RC6A 4XQ4A 1H1IA 2UY9A 3M3OA 3WHTA 4Q8KA 4OI0A 3NNLA 4LO4B 4XIKA 1FPN1 3M3IA 3WR0A 2V5YA 2JB8A 1GWMA 4L92A 1QJX2 1SFPA 1C8M2 3H42B 4OZXA 4XJ8A 5EP9A 5L7OC 5FYZA 2ZX4A 1UXZA 1W9SA 5HCAA 2WWUA 4BJ0A 4PBPA 1WBLA 2B46X 1KDKA 5DAXA 3HT1A 1MS8A 5CKMA 2AEZA 4WVZA 4BH9A 4IGPA 3ENRA 1V6NA 4OHZA 1TMF1 3UK9A 5J37A 2SLIA 1W8UA 1LHVA 3OG2A 2KM2A 1CIWA 5HV4A 2YYOA 5DDJ1 1COV1 2PHUA 1HKDA 2WNUC 3HWJA 5C8WA 3O1RA 1SHWB 2D3PA 1RHI3 2DVAA 4FXGB 4QHOA 2DFBA 1CZTA 1NT0A 3W5NA 2DVBA 1YHFA 2BTVC 4JCKA 2VCCA 4RHV2 2ADDA 4FP3A 2W08A 3GZEA 4ISQA 5FLJA 1VB2A 3VUOA 3VD5A 1S0FA 4R4ZA 3FMGA 1W2OA 3KVBA 4K6BA 2XLFA 2X29A 3BN6A 3QACA 1IS4A 2ZACA 1N3QA 4BWOA 4CPBD 3E5QA 3N4MA 1XNBA 2PHRA 4AEKA 2WAOA 4GWJA 1QHDA 4JQTA 5GALA 3RWKX 2H6BA 5J1XA 4I30A 1NLRA 3ZIWA 4KI5M 2LS6A 1XE8A 3ZSKA 4SBVA 5B2GB 5JZGB 2XJVA 1V9U3 4C91A 2E63A 1OC1A 4BQ5A 1ULDA 4KWLA 1AX0A 1YEWA 3OSDA 1AR63 3SQOA 3W58A 1BBT2 3T3YA 4L2NA 3WCSA 4DPNA 3VGIA 3ZXDA 1AR81 4A7KA 1RUF2 2DURA 2FDFA 2GMPA 3IDCB 3MYXA 2GC2A 1AYM3 1NLSA 5DMYA 5CBLA 2R7EB 3N9NA 1GZCA 2VO5A 4XTMA 1ZBA2 3DGTA 3X29B 1QKQA 2J1VA 4IEXA 5CVRA 5FZ1A 3A21A 4MG2A 1HQLA 3BPSA 4IERA 3IDBB 3B94A 4X8PA 5K7PA 4AVTA 1LULA 4S2DA 1VRBA 1R093 3LB9A 2R062 4N53A 2BYVE 3ZR6A 4Z82A 2XMLA 3MBWA 3NV3A 1HIXA 3VKFC 2F4PA 2P3YA 4TLFA 2VH9A 4NWVA 3EYPA 4CDXC 1XNAA 3JD73 4IGOA 4IV1C 4P9GA 4RGAA 4A41A 4CCLA 4KGQA 2BRTA 2HYKA 4U36A 4ATFA 4DXZA 3ZYIB 1PGL1 2DUQA 2ZA9A 4QX0A 1SEFA 2VZ3A 2GH8A 2ILMA 5AVAA 2QBXA 4O65A 4AK3A 1EV11 1VAMA 2VTFA 1MS5A 1W8HA 2YY1A 3ZN6B 2XJRA 4AEMA 2J1SA 3VBOB 2O8OA 1K5MC 1OQ1A 3DKQA 2EVXA 2CSGA 5FYYA 3PTRB 1W0PA 1TE1B 2FHRA 4BLIA 3T2PA 2ZZQA 3MW2A 1W05A 2ZGNA 1RB8G 2WABA 4QM9A 3PJQA 2VUDA 4P9IA 3UNPA 1UOJA 1UU4A 3C7FA 1V6OA 3IPVB 4XZPA 4PIXA 1JUHA 1W6OA 2IXJA 4QU2A 2DVDA 4AGRA 1GZWA 4PJYA 2WN3A 2V5DA 1IG3A 1V9U2 2PA7A 3IDEA 4YW4A 2OZJA 3T2QA 1PK6C 5CB7A 4FOWA 4KG0A 4D6SA 2XVLA 1AR62 4FI9A 2VL4A 2RJKA 1RVF3 4AVAA 1H8TB 4W65A 5JSPA 3MF9A 5K0UC 2VY0A 3CMGA 1ULFA 2EIGA 2YC0A 4NOTA 4FAHA 4QM8A 1RUH2 1CX4A 1YJKA 5FOBB 1AYM2 5GLZA 4JGYA 3LIHA 2PELA 5FPVA 2JDPA 1ND3A 1ZVFA 1ODNA 1WMXA 4M0HA 5FKBA 3I3EA 4A45A 3ZSMA 2XLGA 4S2GA 4G4FA 3MHZA 1V6KA 2OYZA 2FDHA 3O1UA 1DGWA 4XHBA 3I7DA 5SV5A 1F2NA 1PGW1 4Q26A 1PGSA 3ZN5A 3K46A 3MW4A 4EN8B 1FATA 3CHXA 2R49A 1EUTA 1PMHX 4YZ2A 2D97A 4H7MA 1ND2C 2VOXA 2WT0A 1GOFA 2NPIA 3ZFEC 4Q2FA 4N7IA 2PXJA 3R6SA 4JAAA 4HVOA 3RYRA 4QPIC 3SH4A 3O1SA 4UF0A 1FXZA 5I93A 3OCPA 1JN2P 3SCFA 5F3GA 3ZXEA 3WHUA 2XHNA 1W0NA 4RQPB 2QQNA 2VUCA 2R072 3OEAA 3T2OA 4XACA 4Y20A 4AEDB 1J58A 1QQP3 1DGRA 2VQ0A 3WDXA 5C9AC 5T5LA 2RS33 4C0HA 2EIEA 2ERFA 3I3DA 1F8VA 3N7LA 5FZDA 3AVSA 5BNPA 5HBAA 3ZLIA 3O1MA 3UKVA 3VBSA 1S4CA 4Q4X3 4B8EA 5A6XA 2HWD3 2XQRA 3JXSA 1S0CA 5JIAA 3POJA 4R8HA 3I2JA 1ENSA 1JZ4A 3I2FA 2R1BA 1SFNA 4BM8A 5FO9B 3WNNA 4FQZA 5F5CA 5IFPA 5ACA1 2PHLA 2VTXJ 1OH3A 2IUWA 4KQ7A 3M3CA 5L9VA 3NAPA 1AXZA 3O0WA 4CP9B 1OUSA 2D5HA 2RHPA 2FDIA 2X8KA 2W39A 4GZ9A 4K1YA 4PBOA 3RGBA 4QX8A 3VHRA 3SCGA 3CKHA 1V70A 1EAH1 1C57A 1GWLA 4HSJA 4COYA 4JHZA 1LNSA 3KZ4C 3R4SA 4GJYA 1QY4A 1PO21 4RA0A 3W21A 4YYOA 1VBA1 4XQDA 3B69A 5CFCB 2PAMA 1UX6A 3F2ZA 5A7SA 3B5LB 4QHBA 3CJIA 4PLNA 3ZXGA 5FJKA 4Q0SA 3OBAA 4CVUA 1IHMA 2B4KA 5C33A 2D6MA 4NE9A 1SBDA 1HDKA 4NHMA 5BNNB 1UU5A 4DUVA 3S57A 2JKXA 4QDQA 4AVSA 4MX3A 1VAVA 2N7GA 4L0PA 3AXEA 2XJTA 5EYYA 4RS5A 3OGRA 1ULPA 4EV0A 2GP3A 4CCDA 4EN6B 1XE0A 1DCSA 1DZRA 2ZGPA 4MXWB 3AMMA 2RS51 2VZOA 1DQ1A 1RUG1 2D6KA 3BU7A 3DYMA 1CN1A 4PHZA 2TNFA 4CDQC 2A75A 4UFJA 5F32A 2QZ3A 2AH2A 4AVBA 3KD4A 3KMHA 5FBZA 3FBYA 3WW2A 2XJQA 2RJLA 1SBFA 5FYUA 4CZSA 1C5HA 1QF3A 5TSWA 4NO4A 3LSDA 3ACLA 1OD3A 3K3NA 1A78A 2ETEA 4XFIA 4J1WA 2Z2SB 1DQ5A 3GBFA 2DVFA 1O4TA 2RS32 1SLAA 3E97A 2XKOA 4FQ4A 4Q4V1 5EWSA 3WW4A 4BQ1A 2XJSA 5LW9A 3HIFA 2VQTA 4A3ZA 5JXGA 2VXRA 1XSRA 4FTSA 1BQPA 3TN91 3KT4A 5CG9A 1W6PB 3GNEA 4Q4X2 5CADA 1Z7S2 2HWD2 3VBUA 3WQ7A 1D2SA 1FMD1 4ASLA 1JYXA 1W6MB 1JMUB 1OA3A 4QXHA 2VMFA 1QU0A 3DXUA 1YFWA 4EWAA 2HWC1 4O9GA 1NXMA 1H4GA 2CGNA 5LRRA 3NNMA 4OCTA 1VBC3 1K45A 2YU2A 2ZKNA 1AUYA 4LPLA 2QTWB 4MH0E 4R4XA 5F39A 1KJLA 2HWF1 3HN1A 3IAQA 5F3CA 3AMPA 1WMEA 5GZGA 3P1IA 3G6JB 2WFF1 1W2NA 4LO5B 4AE2A 3ZKUA 3NW4A 1O91A 3CEWA 5LATA 3VD9A 2YG0A 4AFAA 2V4VA 3VBHB 5FMOL 2XJUA 3FLTA 4XF3A 4CCKA 1JZ3A 2IXCA 3OPWA 4A6SA 5D8AC 3L2HA 3B9CA 4EJRA 2ZGLA 5IVBA 1RMU3 1HRI2 1UYXA 5FFOC 2OT7A 3MIDA 1GQPA 3RZKA 1ULOA 5CU1A 5HXMA 3AZWA 1FPN2 4CCEA 2PHFA 3PVEA 3SMHA 4OUSA 1QJX1 1KEXA 4AAXA 4LHKA 1C8M1 2GAUA 2NYYA 2A6YA 2QE3A 2C9AA 1M06G 3L9JT 4Y1UA 4Q29A 3WF2A 1CAVB 2WSUA 5ABJC 2XONA 1OLME 2RS13 4Y33A 5FZOA 1UY2A 2Y8KA 1DGLA 1AHSA 2Y0IA 3M8LA 3ZFFC 3OTFA 1J3PA 1TME3 4XMAA 4NIHA 5JXHA 5FZGA 1SLBA 1W3XA 2XKPA 1W9FA 4FPFA 2ZX3A 1KD7A 2QQJA 2JG9B 5GM0A 4KWJA 5DDJ2 1COV2 2GDFA 4JHTA 1ACCA 2QQWA 1S1AA 1DBNA 3V0AB 2OPKA 1EV13 2VZQA 5FP4A 1M4WA 1MQTC 3MUY1 3POSA 2VM9A 2J7MA 4MVTA 1HQWA 4LA2A 3BALA 5KXBA 5FREA 1H2LA 1RGSA 2D98A 4URAA 5FQ0A 4UWDA 2CV6A 3VKNA 4BIFA 5HPOA 2H6CA 4HL0A 2HEYF 2VUJA 5DUXA 1ZM1A 5DUUA 3D4KA 1GQHA 1JI6A 4X8NA 4YVWA 4LKSA 5HV0A 1YFYA 3LWCA 2AUYA 2I74A 5FZ4A 4HN0A 2DU1A 4DEQA 4UFMA 2B7YA 2JG8A 3PVNA 1W8OA 1OOPA 4NROA 4YPJA 1MR5A 3VZMA 4WM8A 2W1SA 4Y1XA 3T0AA 5GLWA 3ILFA 1BEV1 3ES4A 3OUIA 5T5JA 4E2QA 3B3QE 3JB4C 5D2AA 4D6QA 1OMIA 1N3OA 3E6CC 4AI1A 2ES3A 1AR82 2PAKA 2WAAA 4IE4A 1ZX5A 3DXTA 2Y6GA 2WYSA 1OHFA 3K4ZA 3LAGA 4UFLA 4DMIA 4EQVA 1DZTA 4Y4RA 4FFHA 4JX0A 1FOD1 3D8CA 2A6VA 4JDMA 5JDBA 4H14A
chains in the Genus database with same CATH topology
1REEA 4QQOA 2D7FA 1KQRA 4HKLA 1B09A 4A2UA 2ET7A 3WG2A 3POWA 2GALA 4FPKA 3S0MA 1D4M3 2BW8A 4P14A 3THPA 4LE4A 2VNOA 1ZREA 1B35A 1BVVA 2BNOA 1CJDA 1PGL2 1RHI1 1ZA4A 2UYBA 1EV12 1UKGA 4JV4A 4Q0PA 2IC1A 4FO9A 5JOYA 5KXCA 5CG8A 4CDUA 1VRH3 1YFXA 1ZBE3 5I0TA 3AYDA 1ZRDA 4I02A 1YIFA 4CEWA 5J48A 1UPSA 2WNUB 2ZX0A 3ECQA 4MXVA 2D5FA 1XQNA 2ZMNA 2WT2A 5ACA3 4CEYC 5J96B 4J1XA 3AM2A 1LHOA 2XBO3 2AR6A 1V9U1 4R9AA 4QMAA 4FCAA 1BVP1 2QCSB 2YGMA 1WCSA 1JUIA 2Q4SA 2W68A 3BPZA 3R4UA 4N53C 4P9YA 4CDWB 4AFMA 4EWEA 5KBFA 2H0BA 3KCYA 3WP3A 1AYM1 1RUC3 2ZGTA 1SCSA 4DOUA 2VVFA 3MIGA 5JAXA 2P3KA 4HPKB 1VIWB 4JDOA 3AYEA 2X5IA 4UBGA 5A33B 1U5IA 3AKPA 3M3QA 4JTOA 4DNYA 1U12A 1W6NA 4AHYA 1NCQA 1R091 2JE9A 1PGW2 2B39A 4J6GA 3AKSA 2IXIA 4RR3C 1OD5A 3ZXKA 3U11A 4BA6A 2A3YA 2YUEA 3JD71 4XFAA 1D4M2 3AK0A 1YXWA 2UWCA 1WBFA 3HQXA 4B29A 2GNBA 2A5ZA 2ZABA 3CU7A 3OYWB 1VBD1 1QDCA 5C4WA 4F83A 5AFBA 3V65A 2JE7A 4MUVA 4IV3B 1VRH2 1ZBE2 1RUNA 2PHDA 2NMNA 3ZO0B 4XHXA 1ZRFA 4IV1B 2I2SA 1O7FA 1ND3C 4N7UA 4YZ4A 3WG3A 5ACA2 1PO11 3KT1A 4RL7A 1S0JA 3AKRA 5T5OA 4JGZC 3IMNA 3G7DA 4IESA 4QPYA 4QX5A 4UW5A 2XHKA 5DZGA 1U0AA 1RVF1 2HWF3 4YW1A 1OLRA 2Y38A 4G3YC 1EAH2 2WFF3 1WD3A 3WP4A 4JQRA 4YVSC 1S0IA 4GH4C 1RUC2 1YLLA 2JKBA 1S0BA 3FBMA 3U07A 2NZ9A 5T55A 1QMJA 2PLV1 3LGRA 2A6WA 1V6IA 2W0XA 3SISA 1WUVA 2BFUL 4C0BA 1YWKA 2CWMA 2X53S 1AXKA 1OI6A 4IQPA 1MS0A 3FC0A 4Q8LA 5BNPC 3MICA 4QQLA 4ZU7A 1GQGA 5K0UB 1NA1C 4CP2A 5KHIA 5JZGA 1RL3A 1UZYA 2RS52 1LESA 1NG0A 4WZFA 3TWIA 4AF9A 5CFDB 4L8QA 4B4PA 4IEOA 1LGBA 4HZFA 2G4IA 2WFPA 3MPPG 4MZUA 2QJVA 4PLOA 1KITA 4AVCA 4XEZA 3NAPC 1FI2A 2XL9A 1Y43B 3M2MA 4K20A 4GKYA 4M0NA 4ZU4A 1IQAA 4Q0QA 1QQP1 2RS31 3M4FA 1HRV3 3GBGA 4OI4A 4W6YA 4Q4X1 1APNA 3ILRA 1LHUA 3ZFEB 4E9KA 4BOWA 2ZGSA 3AX4A 3TN92 4IEUA 4JRAA 3OY8B 1GANA 3CJIC 2JECA 2VW1A 4LE3A 1GYKA 2HWC2 5JI9A 2FZ2A 3RPQA 3KM5A 2WZPP 5C9AB 2ZPXA 4I2OA 3CJXA 3VHNA 3NV1A 4RS5C 3ROUA 4EN0A 1ULGA 4KBBA 3CO2A 2HWF2 1NY71 2VOWA 3URFA 3HAGA 3MW3A 2WFF2 2WS91 3RZZA 3ZN6A 2Q5TA 1DLLA 3ZFGB 3VBOA 1UMZA 3O0VA 4FVVA 2DU0A 3DV8A 4K8FA 1NQDA 3VZLA 1RIRA 1QXRA 2R30A 1YNAA 1FOD3 4GA9A 5JIUA 1LEMA 1KFXL 4YM1A 3IPVA 4YFZA 1QGLA 1R1A3 3RI8A 3VBUC 4DS0A 2GZWA 3V0BB 3LOBA 3RSJA 4IL7A 3AXDA 2Q1MA 3GYDA 5KWRA 1SLCA 1UIKA 4GQ7A 1H8TA 5T52A 1GLHA 1F5JA 3MFAA 3VLBB 1IS6A 1WA4A 4WM7B 4E4ZA 3VDDC 2B5HA 4XILA 5GZFA 1KDMA 1E57A 3TB0A 3KB5A 1XU1A 1V00A 3VBRC 3WV6A 5J09A 4CDQB 3KSCA 4XBLA 4AVVA 3VKOA 4N90A 4Q1PA 5A32B 5LEKA 2V09A 3OF1A 1PHMA 1VBC1 1OA4A 2GH2A 4LTAA 1U5XA 1I1EA 1QJY1 3O12A 5EYXA 5KHKA 1UD1A 4K9SA 5FRAA 1RUE3 2DVGA 4RQPA 4KWKA 3RYPA 4AEDA 1LOCA 4A3XA 2UURA 4Y1ZA 1BEV2 3JBG3 3I59B 2Z42A 3HBZA 2D6OX 3HR9A 2WL1A 3PVOA 1AVBA 3M3EA 1UCXA 4EROA 4XQWA 1RMU1 3NVCA 2ZS6B 1JH5A 4XJUA 4COZA 1H9WA 2B9UA 4AI8A 1UKRA 1FOD2 1HXS3 4I3PA 5F9TA 2GC0A 3WX5A 2XLAA 3BTAA 4BZ4A 2HEWF 5T3NA 3I8TA 5H9PA 4GKXA 2RS11 1AJOA 4HSLA 2E53A 3WW3A 2ZOEB 1ZZ8A 1Q8SA 1CAUA 1TME1 2E7AA 4R9DA 4AQSA 4COVA 1MZ5A 3AP6A 2IXKA 4YVWC 1BCXA 1N1VA 5JOWA 1AR93 5CFCA 3LCPA 1IKQA 1OOPC 4LHNA 1FT9A 1RHI2 1VBD3 2DUOA 3N7KA 5BNNA 4FXKB 2CY6A 2W52A 1PZ8A 4MXWA 1ZNPA 4XXAA 3IWZA 3H8UA 5L19A 4GWNA 3WG1A 2VGDA 4OHVA 1DF0A 1X33A 1D4VB 4C1XA 2BNMA 1PO13 3FLRA 1WW4A 2A71A 3POYA 4YG3A 5FLHA 3AZVA 3VHPA 1PVC3 1REFA 3FLPA 4B7KA 1WGPA 4AHXA 3JBG2 4P9WA 1X8MA 4MLOA 4BLJA 2RR11 4NN0A 3ZSLA 3LZZA 1DU3D 1W6PA 3UL2A 4C90A 1RUI1 4L11A 5IT6A 2PLV3 1W6MA 2R0HA 4M3CE 2BEOA 2O0OA 2OVUA 3VBFA 1H1MA 4OLLA 5HI0A 3USUB 4JVAA 2YPJA 1VBB1 1I9RA 4CDUC 1LENA 4QGMA 3WD5A 4WVVA 3AFGA 1R092 1QJU1 5EJ3A 5J36A 3ZDSA 1PM7A 1F9KA 1D4M1 4CEWC 3SH3A 3OGGA 4AHZA 4TWTA 1L3JA 3JD72 1O3QA 1I3HA 1SLLA 1AR92 3VBHA 4R9BA 3PLQA 2DCKA 3D82A 2G9FA 1RUJ1 5HCBA 1VBD2 3VZJA 3BB6A 4DINB 3U0ZA 3MLJA 5GLVA 1VP6A 5I0UA 1YUDA 1VRH1 2BVVA 2ZJCA 3KLSA 1ZBE1 3ME2A 3IKWA 2YZ4A 3V64A 2GNMA 4M3CF 2XG3A 3WP5A 3ZXAC 1CAVA 2BBVA 1ULCA 4GWMA 3D0JA 4XYXA 5E16A 3DKWA 3NWKA 2XBO1 1PO12 3MLKA 3RYKA 1WMDA 1DHKB 4QGNA 1AL21 5BY5A 1PVC2 1QOOA 1NCQC 1MACA 2JG9A 3VL9A 2QUOA 1RVF2 4WVMB 3UKNA 5KHGA 4JC1A 2LUWA 3V0AA 1RUC1 2JENA 2WS93 5J7MA 4AW7A 2EAKA 3WUDA 4QPGC 2PLV2 1D2QA 3J8F3 4CEYB 5JI7A 4LULA 4D7TA 1ZZBA 3ES1A 4MGYE 1Q8QA 3THTA 5C4WC 1U5ZA 1G7YA 1WCDJ 1OFNA 4B7EA 4Y22B 1LB2A 4UW3A 3N3HA 1JOJA 2HWB1 2K0GA 2MHFA 1AX1A 1OLQA 1TQ5A 3OD4A 3QCWA 4KU8A 1GICA 3EQEA 4QQHA 4P9LA 1AR73 2MEV1 3JUUA 3OD0A 4YRDA 5BNOB 1LKNA 2ET1A 4Q0UA 1RJ8A 1GR3A 2YXSA 4M00A 1SQ4A 2EXJA 2NQYA 1HX6A 2CAUA 1QQP2 2A3XA 4EN7B 4YM2A 3NSTA 4LA3A 3T2TA 2WZR1 3A0NA 4I09A 3O7OA 5FDBA 4RR3B 1GBGA 1BK1A 3AMNA 3K51A 3MIFA 4YGDA 4FAGA 4FPCA 2C5DA 3RMXA 4CRQA 1GNHA 1FYUA 2WQZC 5E8AA 2ZHLA 4BIOA 2IFRA 1A8DA 3VZNA 4MGIE 3WUCA 1YJLA 1QJY3 1O3RA 4GXLA 2WWSA 4XFCA 5FTTC 1LTEA 2VECA 1NY72 3AKQA 4E4DX 1X8EA 1WMFA 4HKOA 2WA3A 2WS92 1IPKA 3H1MA 3OBRA 2XVGA 2MNGA 5FO7B 3O5SA 2WNVB 1RITA 2PTMA 1PZ9A 3GBWA 3S7IA 3WNXA 4JGZB 1YCIA 1RUD3 2YROA 3ZXLA 2V73A 2WNUA 4CP0A 2HWE3 1NCRC 4XETA 1EY2A 4YVSB 5EXOA 4GH4B 1N1YA 3RG0A 3WCRA 4FPOB 3PNAA 4AFCA 4CDWA 2MPFA 3IM0A 3CL1A 5A3MA 5C8CB 3QBQA 3VKMA 2PHXA 3DL3A 4YZ1A 3P3NA 1Q5OA 4AFBA 5DZFA 2GC3A 2LTNA 5LK7B 2H0VA 1HRV1 1NA1B 2ZKLA 4HPKA 4AQTA 4FBFA 5JVVA 3CNAA 4GMP1 4OULA 4GULA 4XJZA 1KFUL 5A33A 4HN1A 3J26N 4GB33 5IK7A 5KHHA 5CAZA 2E7TA 1LOBA 3ILNA 4M01A 1VJ2A 1C1LA 2DFCA 4LBQB 1J59A 4V1PA 1VBC2 4P9XA 1BYHA 1X50A 3PMSA 1QJY2 1A8MA 2UWAA 2G9GA 1FNZA 3OJBA 3B02A 3WDUA 2SBAA 3AMHA 3DPRB 2F6BA 4E2SA 4C1WA 2RM23 3OYWA 2XPJA 2JEMA 2GN3A 4KG8A 1FNYA 5DUWA 4YGEA 3WDVA 4IV3A 2RR13 1DZQA 3SNMA 2WSVA 4AFDA 2ZBJA 1RMU2 3BOWA 2A7AA 2QDRA 4OHXA 4PDWB 1RUI3 2CL2A 2VPVA 4IV1A 3R0RA 5HXVA 3RMYA 3FWEA 1ZYBA 1AJKA 3P3PA 4META 1ZRCA 1R1A1 3WDWA 2VMGA 1BXHA 3AYCA 3KCCA 1VBB3 4DRVA 3JQWA 3RRDA 1S2KA 1H4HA 4N43B 1DGWX 1NE4A 1VLNA 4H55A 5KXDA 2D6LX 2ZGOA 1QJU3 2RS12 1DFQA 1MS1A 5GLTA 1TME2 4IEPA 2VQAA 1O5UA 4PCRA 4LBMA 1XU2A 4XF4A 4XFGA 1A6CA 4KU7A 2R16A 1WLDA 4XJWA 1DQ0A 2D93A 2YMZA 1H0BA 1NE6A 4RQPC 4U2AA 3HD8B 5L7OB 1Q3EA 1RUJ3 1VR3A 4HMZA 4F8AA 5A3LA 5E89A 5KHJA 2XB6C 1LR5A 1LOFA 5K0UA 3RDIA 3E6DA 5JLVA 4B4QA 1PVXA 1UW8A 3TNPB 1N1TA 1Z0HA 2P2KA 2EF6A 3SXWA 5CFDA 2ZAAA 3VDDB 5C6CA 2ARBA 2CGOA 3B01A 4QT6A 2UU8A 3D5OA 3H50A 3VKLA 1CD3G 1RUE1 2R041 1CVNA 1WD4A 1ZZCA 4YGBA 3VBRB 4LBQD 4QQ2A 1AL23 1RJ7A 2Q0AA 3JBG1 4XF0A 3I54A 1VALA 1KS4A 2GMMA 3MF6A 3TYJA 4IETA 4FPYA 1LOEA 4RD7A 1FV3A 2RR12 3ZFEA 4Y4YA 2ZMLA 5FPXA 1N47A 2K2SA 3OY8A 1RUI2 5CFCC 1XNKA 3DF0A 2Q8OA 1HXS1 1JYCA 4Q4W3 1H2NA 2JDZA 1PNFA 5BNQA 3T1MA 3QH7A 3H0OA 1HV1A 1LHNA 5C9AA 1VBB2 2GNDA 2DTWA 4R52A 1A3KA 1ASJ3 1C28A 1AYN3 3SLIA 4I01A 4DFSA 2HWB3 1QJU2 2Y0OA 3KQRA 2WC2A 4LBKA 1AR91 1QH6A 1SCRA 1EP0A 3PHMA 4HT1T 1TNFA 4LEJA 2VW0A 2MEV3 3GZUC 2BUKA 4OUMA 4NR1A 4IEVA 4JDNA 3CF6E 1MS9A 2XUMA 1N3PA 3LA3A 4XDQA 3WLUA 2CAVA 1C4RA 1RUJ2 2WJSA 1O4ZA 2RMU3 1UAIA 2WZR3 1J1LA 1ZZ6A 5EV7A 5K8SA 4H7LA 4X6RB 3WP6A 2QQPA 3L2YA 4CDXB 4Z2WA 3FFQA 4JGYC 1LRHA 2LALA 2DCJA 3V0BA 3PMEA 5IK8A 1TEIA 4D69A 3J9SA 1F5FA 2VVDA 3VBFC 4I0WB 1PMIA 1W6QB 2EXIA 2XBO2 1YI9A 5JR7B 3M1HA 1PVC1 2PN5A 3INAA 1AL22 2DTYA 1K5MB 4WM7A 4XMIA 2I45A 1S2BA 4NVPA 2HKXA 3HT2A 1SLTA 3H3UA 5FAXA 5L36A 3FUQA 1BZWA 2ZGKA 5JPMB 1LGNA 4LO8A 3TAYA 4CDQA 4ZU5A 3AJZA 2GNTA 2NMOA 1O5LA 4ES9A 3ZYPA 4MGZE 4Q4W2 5A32A 3KCXA 1XYNA 4Q0VA 3WDTA 3LA2A 2D6NA 3S30A 1GSLA 1NYWA 1PK6B 4XTPA 2AYHA 5IK4A 2CGPA 5FOJB 3OGJA 3LKJA 3VBSC 1ASJ2 2D6PA 3KGLA 2HWB2 1D0HA 4YNIA 5LRSA 4I0BA 1OPOA 1GV9A 1J3RA 1X82A 1XNDA 3I59A 4XBQA 2MEV2 4FT8A 5FCCA 4I0AA 3AZYA 3AP9A 4HKWA 2IFWA 3T1LA 3FE5A 3CLPA 2TBVA 3VZKA 2RMU2 3A4UA 4HANA 2WZR2 1ND2B 4ITCA 4GMP3 2ENRA 2O8QA 2WNEA 3E5XA 4QPIB 5JOXA 3W59A 2B8MA 3EO6A 2JICA 3FZ3A 4ASMB 4D7YA 3BOPA 1PZ7A 1YYNA 4BMEA