1UAIA

Crystal structure of the alginate lyase from corynebacterium sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the alginate (poly alpha-l-guluronate) lyase from Corynebacterium sp. at 1.2 A resolution
pubmed doi rcsb
molecule tags Lyase
molecule keywords polyguluronate lyase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uaiA00
3RMXA 5T50A 1AXYA 1DQ6A 1GYKA 2A6VA 1C57A 1OQ1A 2DURA 3UK9A 3MW4A 3N7LA 4Y22A 1UPSA 3HR9A 4FPFA 1Q56A 3NV2A 1VALA 1NXD1 1GZCA 5JLVA 1W6OA 1G9AA 4PQ9A 1WW5A 2E53A 1N3PA 1UMZA 2DWRA 3KM5A 4M3CB 1DQ1A 4YGDA 5JMCA 1I1EA 1BYHA 2ZGQA 1DYPA 3SH4A 2PHRA 3AP7A 3QLQA 3USUB 1YIFA 4Q8LA 1QDOA 1HLCA 1VAVA 2GALA 1LESA 2GN3A 1FATA 1ONAA 2WT0A 1SLAA 4LBKA 4YW2A 4ZKTB 4YW1A 1URXA 2XG3A 3BTAA 1MS0A 4AWDA 3PVEA 5T5JA 1JHNA 1H9PA 3M3EA 1N1SA 4MYEA 1W6QA 4C1XA 4YM0A 5H9SA 5H9QA 1DFQA 1F9KA 3POWA 1WD3A 4XTPA 2ZHNA 4FPKA 3O5SA 3APBA 1AF9A 2JDZA 4W65A 3INAA 3UL2A 1QNWA 2CL2A 1V00A 3M3OA 4ATEA 2YZ4A 4DS0A 4LBQD 2GNBA 2P34A 3NWKA 5EWSA 4ZXKA 1SBDA 2A3YA 3BODA 4XJWA 3L2YA 1KITA 3AZYA 3V0BB 1LTEA 4XHXA 1LOBA 1AVBA 3ZSLA 1LCLA 1S0IA 1BZWA 1CPMA 2I2SA 3VKOA 4GXLA 2DVGA 1LEDA 4XJAA 4XOGA 3WG3A 1D0HA 4XJ9A 4FPEA 5DZFA 5HCAA 1A3KA 3IPVA 2WT1A 3ENRA 4UW6A 3M3QA 1GZWB 2A6XA 1ZM1A 3LCPA 3Q9OA 4XILA 3SISA 1PZ8A 5DUXA 1OKQA 3T1MA 1ENSA 5BYNA 5T52A 2NZ9A 2LALA 2D6KA 1G86A 4R9DA 4HL0A 4YGEA 3C2UA 4WZFA 1N3QA 1LHNA 4GWMA 1ULFA 1HDKA 1S0DA 3O0XA 2DUOA 1JN2P 1MS9A 2AREA 1SCSA 1Q8QA 2DVDA 1AZDA 1H9WA 1LOGA 2G4IA 1WW6A 2ZGSA 4YW3A 4F83A 1DQ5A 3POYA 2NN8A 5DUUA 5GLZA 4Q26A 3FBYA 1RIRA 2YXSA 4NOTA 4Y20B 2DVBA 1JXNA 5FRAA 1LEMA 2R0HA 3SH5A 5GJ6A 4DPNA 1UKGA 2GMEA 4BQ1A 1HQLA 5E88A 3AYEA 2ENRA 1JBCA 1O4YA 1AX2A 2Q5TA 3RQ0A 3WDWA 2DTYA 1I3HA 1UZYA 1IOAA 4XTMA 1UN1A 3WDXA 5DUVA 3RRDA 3WDUA 3M2MA 1FNYA 2D44A 1DGLA 2NMOA 2H0BA 2W08A 1W6PA 1BKZA 4PBPA 5LK5A 4FQZA 1WBLA 1MS8A 1SLTA 4Y1XA 2A6YA 1A78A 2A75A 4KBBA 5IT6A 4P9WA 4WVVA 4Q1PA 4ATFA 1IS6A 3WDYA 1Q8OA 1S0FA 1QOTA 1CQ9A 1ULEA 3A0KA 3D5OA 3FUQA 4AGGA 2EF6A 3N7JA 3BIWE 3V0AB 2WKKA 2YROA 2P3KA 3AFKA 1VIWB 4XE9A 3ZSJA 1FV2A 2ZGNA 2JD4A 1QMJA 2ZACA 2GN7A 2DVFA 4AVVA 3AYCA 2ZMNA 3FUOA 1VLNA 4YZ2A 2ZGRA 1LOAA 4D69A 2R1BA 5DUWA 1S0EA 1DHKB 4YZ3A 3O12A 4FVVA 2D43A 2JKBA 3NV1A 4Q8KA 1QOSA 1ENQA 1R1ZA 4IQPA 1FX5A 1BQPA 3D4KA 1DZQA 1O4ZA 3DGTA 3OY8B 5H9PA 4YZ1A 2UURA 1SFYA 1YI7A 1DQ0A 2EXHA 4I30A 3V0AA 1KDMA 1SBEA 2CYFA 2V5YA 2JECA 4RL7A 1HQWA 1MS5A 1LOFC 1LODA 3MEPA 1IS3A 1SLLA 3B9CA 2EIGA 3N35A 4YW5A 1ULDA 4XIOA 5EYYA 1BXHA 3AP5A 1WLCA 1WUVA 2GMPA 3M3CA 4LBMA 2WSVA 5EXOA 1LJ7A 1W6PB 4BPZA 4YZ5A 2PHWA 1SLCA 3AJYA 1LHOA 2R0FA 4XIKA 3ZSMA 2PHUA 4FP3A 1SLIA 4FPGA 4LBQA 3TB0A 4XDQA 5GLUA 3SLIA 1KRIA 1YRZA 1FYUA 3OBRA 1WLWA 2A5ZA 5GM0A 3AXEA 3WG1A 1V6MA 2DVAA 1AXKA 5CB7A 3ZYPA 4FQ4A 2A7AA 3W59A 2VUAA 3ZPYA 4GKYA 5F5QA 4XBQA 2ZGMA 1UL9A 2E7TA 3ATGA 3WUDA 3VKLA 2R1DA 3VKFC 2ZABA 1ENRA 1RITA 3JU9A 3LSEA 2D6NA 3MW2A 4H55A 4LBOA 4UW4A 1N1YA 4Y26A 4WV8A 3AZVA 2D6LX 2VH9A 3FLTA 3T2TA 1JUIA 4XZPA 3DUIA 1YYNA 1CN1A 1QOOA 3IN9A 3PVNA 2ZHMA 4PCRA 4M3CE 1DQ4A 3ZXFA 2B7YA 3I8TA 2R49A 3AZZA 4SLIA 4DRVA 4FPYA 3ILNA 4YG6A 2EXKA 2GNTA 1MVEA 1Q8VA 3AZXA 2AUYA 4LBJA 1UAIA 4YGBA 5DZGA 2P2KA 5JOZA 1W0PA 2GMMA 1Z78A 1CIWA 1FNZA 2ES3A 2OW4A 1LOCA 3ILRA 3FLPA 3N36A 1AX1A 1QF3A 2RHPA 3AP4A 1ULGA 1W6NB 1YO8A 2D6OX 3OJBA 1G9DA 4AVTA 1OFSA 1W6QB 2ZZJA 1LU1A 4TYSA 2BQPA 4XHBA 4AGRA 4K1YA 1S0GA 1W6OB 4UW5A 3WHTA 1G9CA 3FLRA 2W39A 1LGCA 1QDCA 5E89A 1JYCA 4YFWA 1UX6A 1C1FA 4K20A 2VU9A 2VW0A 1S0CA 4YM2A 2LTNA 4FP2A 3JUUA 1FAYA 1H30A 4Q27A 3V0BA 5DZEA 2CWMA 2CY6A 2JE7A 3BOPA 3KQRA 3N7KA 4BMBA 1JOJA 4BLIA 4DRRA 3T1LA 4UW3A 4ITCA 4ISQA 4DFSA 1YXWA 2NYYA 2OUJA 1TEIA 3IKWA 2AGSA 2GDFA 2P3JA 4GA9A 1QNYA 1LOFA 2ZGLA 1V6KA 3WDTA 2OVUA 2NP0A 1GZWA 2EXIA 5E8AA 3HMYA 4TZDA 1GBGA 4FOWA 2FMDA 2A71A 1GNHA 3WG2A 2VY0A 1GICA 3AYDA 3OYWA 5GZDA 3PMEA 2PHTA 5JOWA 2ARBA 1LOEA 5HCBA 2SBAA 4HANA 4GKXA 3WVJA 2YY1A 1LU2A 2A6WA 1F5FA 2ZHLA 3IMNA 4NO4A 2AENA 2ZGTA 1B09A 2UU8A 4YM3A 1DQ2A 1MVQA 4R9AA 2ZMKA 1CONA 1QU0A 1MR5A 1Q8SA 1LHUA 2PHXA 3GALA 3RS6A 5JDBA 3D6EA 4Y1VA 4YGCA 1AJKA 1N47A 1J1TA 2E51A 2D3PA 2DYCA 3SH3A 5IK7A 2KM2A 3V64A 3OPZA 4AYUA 4GWNA 1CJPA 2WT2A 3MW3A 4XXAA 3HN1A 2UWCA 5H9RA 3UJQA 5GALA 1QKQA 2FHRA 3WCRA 1CR7A 3IM0A 1APNA 3AXDA 2VW1A 4M3CF 4P9YA 3TAYA 4PBOA 4FPLA 4M01A 2ZGKA 3B69A 5IK5A 2D3SA 1G9BA 2WLQA 3AP9A 4M3CA 2JE9A 5GZEA 4R9CA 1GKBA 1G8WA 2Z42A 3B3QE 3WV6A 4P9XA 2UWBA 3PJQA 1W0OA 4Y22B 1GLHA 3B01A 4FOVA 5GLTA 2C5DA 1W6NA 1VAMA 4DQAA 1LENA 3OY8A 3WG4A 4K1ZA 5AVAA 1UZZA 4FPHA 4U2AA 4AGVA 2ZGOA 5KXBA 4XJ8A 4ASMB 2PELA 1WCSA 2ARXA 4P14A 2DU1A 4L8QA 4BMEA 1MZ5A 3ZVXA 3R4UA 1MS4A 1V6LA 1V6NA 1LULA 3FFZA 4M00A 3WCSA 2UWAA 5HCFA 1LGBA 3WOGA 3AX4A 2PHFA 5DG1A 1Q8PA 2NMNA 3LSDA 5GLVA 4LBQB 1C4RA 3ZXJA 3AP6A 3VKNA 5T5PA 1IS5A 1PZ9A 3O0VA 2P37A 3VUOA 4BM8A 1CESA 1KJLA 1GANA 1SBFA 4YFZA 1SACA 3ILFA 4YM1A 2ZBJA 3RG0A 1GSLA 3AJZA 1IKPA 4Y1YA 3RSJA 4Z8BA 2VW2A 2TEPA 3A4UA 1MS3A 5IK4A 1G7YA 1DLLA 2AYHA 2DUQA 2D7FA 2C9AA 5KXDA 3VV1A 5CA6A 3NV3A 4XJUA 3A0NA 4BOWA 1KQRA 2WQZC 1GZ9A 3PVOA 4OZXA 2E7QA 4CTEA 2ZKNA 1JYIA 1BJQA 2D6PA 4LBLA 5GZFA 3AZWA 1MS1A 3AK0A 1PZ7A 2JJ6A 2WSUA 3B00A 5DG2A 4JCKA 1X50A 2DU0A 5CNAA 5F9TA 1LECA 5SV8A 1WLDA 1RINA 2P3IA 5T5OA 1N3OA 3O0WA 5JOXA 4XJZA 2HYKA 4FOQA 4FPOB 4XYXA 4ISRA 4LBNA 5CAZA 2A3WA 4XBNA 2DV9A 1NLSA 2YMZA 3WLUA 1JW6A 3GNEA 1Y7BA 2D3RA 2YV8A 3U4XA 1WBFA 1WD4A 2ZGUA 3IPVB 2WJSA 3ZXEA 1S0BA 4XBLA 4Y20A 2OUHA 3V65A 2ZMLA 1AX0A 3OGGA 2AH2A 2R16A 3CNAA 1MACA 5T5LA 4Y1UA 2A70A 4YG0A 4YG3A 3W58A 1WW4A 4R9BA 1C1LA 1KDKA 1Z0HA 4FOYA 4Q2FA 4XMIA 5GLWA 3M1HA 2W68A 1N1VA 2W52A 1QGLA 2E6VA 1A8DA 1GNZA 3I4IA 1G9FA 4Q1RA 1S0JA 4FPJA 5FREA 5CBLA 3N3HA 1V6JA 4BLJA 4Y1ZA 1N1TA 3AYAA 3R05A 1SLBA 4JC1A 3SITA 1CVNA 1LGNA 5T54A 5L73A 3ZSKA 5GZCA 1DIWA 2DUPA 1CPNA 2V73A 3WDVA 2EALA 1V6OA 2CWSA 1U0AA 1F31A 2A6ZA 2ZA9A 4XMAA 1ULCA 4YLZA 2NM1A 4YZ4A 3WZ1A 2D6MA 2EAKA 3OYWB 4PF5A 1EPWA 1LHWA 2EXJA 2ZHKA 3UJOA 1IS4A 3ZXLA 2XB6C 2WNEA 5EYXA 4CZSA 3WUCA 3WNXA 1GV9A 1ZA4A 4C1WA 3SNMA 3WHUA 2GNMA 4Y24A 4K21A 1W6MB 3RMYA 3OBTA 5T55A 2A3XA 1HKDA 5DXDA 3ZXKA 3R4SA 3USUA 4JRAA 1V6IA 4GALA 4CRQA 3ZYRA 1S1AA 3MPPG 5IUQA 3POSA 3VKMA 2DTWA 4RA0A 5GZGA 3H0OA 4XXPA 5JOYA 2CNAA 4AVSA 5IK8A 2SLIA 4WVWA 1WW7A 4YW4A 2AR6A 1IKQA 1KJRA 5JVVA 1DYKA 5KXEA 1D2SA 2ZAAA 1W6MA 1DBNA 2ZGPA 5KXCA 4FPCA 2ERFA 3QCWA 2GNDA 1MZ6A 1AXZA 2CTVA 1AJOA 3ASIA 3NV4A 3N7MA 1XQNA 4U36A 2VXRA 1LHVA 1FV3A 1SCRA
chains in the Genus database with same CATH superfamily
2ET7A 4XCAA 4D0QA 3VDDB 1AXYA 1YFWA 1T6GC 3I3QA 3WT3A 2DURA 3VBUB 2EA7A 4Y22A 2ZX4A 3ZN6A 3HR9A 2JG9B 3EQEA 4FPFA 4QB6A 4AI8A 1Q56A 1VALA 1NXD1 1SZBA 5JLVA 4QMAA 4KWKA 5CFDB 1WW5A 2OPKA 5EIYB 1VRH1 3GYDA 4CDQA 1N3PA 2DWRA 3VZKA 5IVEA 4RHV2 2DCJA 1I1EA 5CG8A 4NIDA 1UIJA 2YB7A 5CU1A 2Y6HA 3SH4A 3R6SA 1ST8A 1QDOA 3HPNA 4E4DX 5FQ0B 4AFAA 1OOPA 1D4M3 2GN3A 3MUY1 1DF0A 2WFF3 4CDQC 3O1TA 4Y4RA 3JD73 1HJFA 3X29B 4AI1A 4COZA 5FZOA 2YFZA 1MS0A 2BOJA 2JDYA 4ZS3A 5JSPA 5CZKA 4RQPA 4V1PA 2QZ2A 4HVQA 1LAJA 5H9SA 4FAGA 1XSRA 2ZEXA 3GZEA 3W5MA 3WW1A 1G6NA 2VMFA 2IUWA 3N9LA 4XTPA 4FPKA 3UL2A 3LAGA 1PHMA 1V00A 3M3OA 4P5HA 2YZ4A 3ZKUA 4AW7A 4DS0A 2WS91 3LEIA 2P34A 5EWSA 1IPKA 4IE0A 5BNPA 2JX9A 3FZ3A 1NA1A 1NCRC 1UW8A 1QHDA 3N9OA 5IJRA 2CGOA 3L2YA 1OA3A 4QM8A 4QKBA 1LTEA 3OGJA 3J7NA 3ZSLA 1LCLA 1AR73 4ES9A 2BVBA 3I59A 1H4HA 2WZR3 1LEDA 3GM8A 3PHMA 4XUTA 1D0HA 3P5BA 4ZS2A 3WP4A 1A3KA 3IPVA 5CG9A 1MQTA 3PNAA 1ZM1A 4PLMA 3ZFGC 3Q9OA 3SISA 4RN5A 3T1MA 1NQDA 3VDBA 5LA1A 1L7LA 2RR11 2VZPA 1COV2 2DBIA 2PLV2 3C2UA 1NY72 1SG3A 3LQCA 4WZFA 3S57A 1QJFA 3I2OA 4GWMA 1ULFA 2RM21 3KV5A 1AYM3 2VVEA 4KMQA 2WFPA 5JR7B 2FDGA 2DUOA 5CKMA 4BK5A 2AREA 2XLFA 4YW3A 1H9WA 1LOGA 1NY71 2G4IA 2RR12 2NN8A 4D3WA 4Q26A 4KQ7A 5F3EA 1AR92 4ZPIA 4DZGA 5BUVA 4A41A 2ZEZA 4OUSA 4AEMA 1GFF2 3VBOA 4BISA 1OOPB 5FRAA 2BV4A 2QQIA 2R0HA 2ZCWA 4NHLA 1RUF1 2GMEA 4WM8C 5EQUA 5FZ7A 4DPNA 5DDJ1 5E88A 2GC2A 2HWD1 4Q4X3 1QJU2 4XAAA 5JPNB 4IE7A 3DPRC 1HW5A 2VAUA 1UYPA 3S5QA 1AR91 1ZZ6A 4H2AA 1JMUB 1HXS1 5C3QA 5DN2A 1IOAA 4IEXA 5J1XA 3U78A 5C70A 2AEZA 3SCFA 1KD7A 4MX3A 3WDUA 4Q4Y3 1ASJ3 4LE3A 2NMOA 1DGLA 1NCQA 3T2OA 4NIIA 1JTZX 2BBAA 1SLTA 4A7ZA 1I6XA 4Y1XA 3RZZA 4B29A 1A78A 4KBBA 1IPJA 5DMYA 2VUDA 3C7HA 3CL1A 3U07A 1ZZCA 5FY4A 3RNSA 1J84A 1WMFA 4WM8A 2G9ZA 2WKKA 5A1AA 2W95A 4GWJA 5A80A 5KBFA 2HLEA 3ZSJA 1FV2A 5FYVA 5FYBA 4LA2A 1RUD3 2VMGA 3C7EA 4CCDA 4AVVA 2WAOA 4D6RA 1QXRA 3DXUA 3AYCA 2CAVA 1DGRA 4JGYB 3WY6A 4D69A 3TEXA 1VRH2 3GZTB 4FVVA 5C9AA 2JKBA 2WLPA 3NL1A 1QOSA 2JDAA 4J6GA 4AEKA 1BQPA 2J1RA 1O4ZA 4Q0PA 5H9PA 3HD8B 2R073 1SFYA 2UURA 3FHQA 3EO6A 4Z2WA 2EXHA 4I30A 4HBNA 2ET1A 5E1RA 2R32A 4QM9A 5FZMA 4HKLA 5A6ZA 4LITA 3VB9A 2EIGA 2OXBA 4GWIA 2YPDA 1VBA1 1BXHA 3MUZ1 3J4UH 1WMXA 4HOOA 1WLCA 2GMPA 1QH7A 4LBMA 1IPSA 3QOPA 1Y43B 1KGYA 2PHWA 2VOKA 4IL7A 4BPZA 2R0FA 5KC6A 3O1OA 3BPZA 5JPMB 4LO5B 2XGXA 5JXHA 4CDXA 5C4WC 1FYUA 1V70A 1XNBA 1NCRA 1L3JA 3AXEA 2VNRA 2J1UA 2K2SA 3N4MA 3T0DA 4KNCA 4QU2A 5FOBB 2VUAA 4AVAA 5C3OA 4GKYA 4XBQA 1UY3A 3LPGA 4NWVA 4JGYC 2QQPA 3NJYA 4QQOA 5FP3A 1W9WA 2GP3A 3CIHA 3CZUA 2ILMA 5JUVA 3BUCA 4H55A 1UD1A 3KCYA 1C8NA 4UW4A 3DPRA 4WM7B 4XFBA 5L7OA 2W5FA 5C8CC 3PUSA 4Y26A 2E26A 3NKGA 1TNRA 2VZSA 2VH9A 3FLTA 3A21A 4XZPA 1XNKA 3POJA 1QOOA 2OA2A 4PCRA 4M3CE 3VBUC 3VBOC 1DQ4A 1X8EA 3WNKA 2V4VA 4HXCA 2R49A 2Y38A 3AZZA 4COVA 1K45A 3A22A 3VN4A 3AZXA 1Q8VA 3KT4A 4MO3M 2AUYA 2QQJA 1QJU1 3LEMA 2P2KA 4QXCA 5JOZA 4L0PA 3T3YA 2JG8A 2ES3A 3FMGA 3N36A 1AX1A 3AP4A 5I93A 1DP0A 3SQOA 1W6NB 1DZTA 3T30A 3ZYJB 1TMF3 1FOD3 4AVTA 4TYSA 3RZLA 2C24A 4QQPA 4XHBA 1D0GA 1S0GA 5F6KA 2VZUA 1G9CA 4X6RB 3FLRA 3LOBA 2TNFA 1E5SA 1LGCA 4KBZA 5K0UB 1REDA 1EPZA 4KGQA 5J36A 1C1FA 4O9EA 4A4AA 2X09A 2VW0A 1S0CA 4RGKA 2DDUA 4LOTA 4A6SA 1D4M1 3JUUA 1FAYA 5HCHA 1X82A 4BMBA 5HXVA 4YVSB 4F3JA 2F6BA 4QGLA 3KGZA 3PURA 4UW3A 2VECA 5CISA 2BNNA 4ISQA 3CJIC 3USSA 2DCZA 2HWB3 3BVCA 1BBT1 2NYYA 2OUJA 2VZTA 5FXWA 3MDPA 4RQPB 4Z2AA 1XYPA 1MEC3 2AGSA 2GDFA 4BXSV 4GA9A 4DO0A 4V2VA 2VOVA 1QJZA 3WDTA 2OVUA 4CVUA 1GZWA 3KV4A 4TZDA 5JR2A 2EIDA 5HPOA 1RUC3 4OHXA 3HT2A 1NZIA 2VTXJ 3FBMA 4NVPA 3ZXGA 4B4PA 4UYBA 1SPPB 2ZTNA 4YVSA 1LOEA 2SBAA 4GKXA 1LU2A 3IMNA 5FPLA 4NO4A 2AENA 2ZGTA 4ZU7A 1UY0A 3J8F3 2BFUL 2CAUA 4Z07A 3MV01 5IVYA 3ZFGA 4R9AA 4XF0A 3L2HA 1PVXA 5TSWA 2VVDA 4NRMA 1KS4A 4YGCA 4Q4W1 4E4HA 5G05L 3W21A 4BCUA 3S7IA 2XKOA 1AL22 3OBAA 1U12A 3MFCA 5BNQA 5C6CA 3OPZA 2YC0A 1JS9A 2WT2A 4J25A 2P6HA 1U5ZA 4WVMA 5GALA 3BGAA 1QKQA 2FHRA 2HWF1 4YARA 1CR7A 4MGKE 4DUVA 2FDIA 2RS12 5FJHA 1APNA 1ND3A 1BVVA 1Z7S3 2VW1A 4FSJA 2PHDA 2JDKA 4MGTA 2Q8DA 3WX5A 2VZ3A 2YBPA 3B9IA 3B69A 1O5LA 3VGIA 5JZGA 5LCWL 4LJHA 4CDUC 1PO21 4M3CA 4P02B 1B35C 4R9CA 3WV6A 4P9XA 5I0UA 2RS11 1UMIA 1W0OA 1TME1 4UXAA 4CCKA 4CU6A 2C5DA 4X8PA 4RFT0 5A3PA 4TWTA 2IC1A 3OUIA 3OY8A 3WG4A 1O8SA 5FP8A 2W2IA 1UZZA 3HJRA 1YUDA 2VO5A 4FPHA 2PLV3 4AHWA 4M0NA 3TEYA 5KXBA 1ZZ7A 4EN8B 2PELA 2VJXA 3PIJA 4E27A 1AL21 4IDZA 2DU1A 4E2GA 1XJAA 3CJIB 5ACA2 2YGLA 2UYBA 2W3JA 2XL9A 3AC0A 1V6NA 5DABA 1CX4A 3N9QA 2HWC1 4INDA 2LM3A 4JHZA 3WOGA 5KHJA 2QJVA 1V9U2 2PHFA 4JGZA 4N53B 4LBQB 3E6BA 4I09A 2BW8A 3C8XA 4DUXA 1VBD1 2VZVA 2WWUA 3VKNA 2BWAA 1OUXA 2YUEA 3VD5A 3CJIA 3ITQA 4BM8A 4BQXA 4LO7A 2YU1A 1UZ0A 2VR4A 1QJX1 5F5CA 1W8UA 3OG2A 2ZBJA 1GSLA 2X8KA 1WCQA 2WO7A 3AJZA 1SHWB 2GSYA 5F8PA 2JG9C 4RGAA 4DY3A 4QKFA 4XW3A 4CUBA 5C5UA 1EY2A 5IK4A 5L9VA 3ZX7A 1QQP3 4CDXB 1DLLA 5FCCA 1F2NA 2D7FA 2C9AA 1EV11 1GOFA 1IG0A 4LOSA 1VE0A 3FC0A 4J1WA 2QZ3A 5KHHA 4CCCA 2JWPA 3POEA 4CU9A 4NIGA 4JDMA 2OYZA 4KWJA 5FO7B 1MS1A 1PK6C 1AUYA 4Q0SA 2HBTA 1RHI3 1TNFA 4K40A 4QD2A 4AK3A 3B00A 2WSUA 4CCJA 4JCKA 1X50A 5F1RA 2X29A 4XUNA 5SV8A 1WLDA 5JSRA 3VBUA 1L7QA 2W47A 4OZOA 1TMF1 1GUIA 5JOXA 1WCDJ 4FPOB 4OVEA 5ABJC 4ISRA 3BCWA 3WLUA 3U4SA 2CGNA 1ZBA2 2XPJA 3GNEA 1HJGA 1Y7BA 2D3RA 2YV8A 3N9MA 5I8SA 1WBFA 1PO23 1WD4A 3FHIB 3FL7A 1AYN1 4GIQA 4I01A 3PUAA 1S0BA 4LO4B 3VBFC 3A23A 3ZXEA 1AX0A 1NYWA 2JB8A 2IXKA 3CNAA 4QPIB 1RMU1 5T5LA 4P9GA 4ARXA 4YG0A 4KG0A 2CDPA 2QE3A 3D0JA 4JKKA 3NJZA 3BU7A 4Q2FA 4PI2A 2Y6FA 4XMIA 2Q4SA 4HG6B 4DUWA 1RUE3 1TMF2 1LB2A 1B35B 1GNZA 1G9FA 3VHRA 1S0JA 3KMHA 3OCPA 3CEWA 3N3HA 1ZRCA 3RYPA 4Y1ZA 3AYAA 3POBA 3SITA 3IDBB 1S55A 1LGNA 2WO1A 5L73A 4YNIA 2UY9A 5C4WA 1DIWA 2DUPA 4CPBA 2Y26A 3MF6A 2V73A 4D94A 3BTZA 1OD3A 1UYZA 2W94A 2YC4A 2HYXA 2CWSA 4B1MA 1HB2A 5CFCB 2A6ZA 2G1MA 2GH2A 4XMAA 4YZ4A 2NM1A 1D4VB 2KD7A 1R092 2D6MA 1EPWA 1ZRFA 2WNEA 5EYXA 1JUHA 4XF3A 1C8M1 1L7RA 1RUI3 1ZA4A 2R072 4Y24A 4LK6A 5FR3A 2Q8EA 3M70A 2DCTA 2QQWA 2VMCA 1W6MB 2VXJA 1WCKA 4K21A 4JKMA 4RHV3 3OBTA 4QGMA 3WP6A 1QJY2 1HRI2 3GDBA 3VBFB 4ASLA 1PO11 5JAXA 1HX6A 5HXMA 4MXWA 4KL1A 4AQ2A 2IXCA 1SPPA 3JB4C 2CNAA 2WQ4A 3RDIA 3RWKX 4CCEA 1RUNA 4SBVA 1H8VA 3H8XA 1RYYA 1WW7A 4Y4YA 5FY7A 5F37A 1NE6A 1DYKA 4FCAA 5D8AB 2ZGPA 4GB32 4FPCA 3MLJA 4Q4W2 4C8DA 2GNDA 2Y64A 4XEZA 2XH6A 1AJOA 1TQ5A 3ASIA 4HLTA 2BU9A 4D7TA 3GCXA 5I8YA 1LHVA 1YWKA 1CD3G 2BEOA 2B5HA 1UOBA 2JE8A 5IHRA 5IWFA 2B39A 3RMXA 3W9AA 1DQ6A 1C57A 3I2DA 4IV3A 3MW4A 3N7LA 4CU7A 4HN1A 4N9IA 3RJRA 2GH8A 3THCA 1K42A 1G9AA 1EUTA 3THTA 1KEXA 2W87A 4P5YA 3RZHA 1RUOA 3AM2A 4M3CB 5JMCA 4YGDA 1PIV2 5EP9A 5LY2A 4E8CA 4EROA 2DFBA 3MIEA 4Q4Y2 4M4RA 1PNFA 3S6PA 2J42A 4EWDA 2PHRA 3USUB 1YIFA 1HLCA 3HEIA 1RXGA 5KHIA 3I49A 1FATA 1ONAA 4CDUB 2NQYA 4LBKA 4QKDA 4Y3OA 4YW2A 1F4AA 1URXA 1YFUA 3AKPA 3HQXA 3NNJA 1FI2A 2WAAA 3BTAA 1WA6X 3KB5A 4NWWA 3MICA 3V56A 5IVBA 4TTGA 4UOJA 1JHNA 1QJEA 3M3EA 1XSQA 2A73B 3MI8A 4MYEA 4KH9A 4CXXA 2VCAA 3NKTA 4AEJA 1RMU2 1OQEA 1CAWB 4A44A 5A6XA 2IWGB 4DOUA 2CL2A 1UXXX 4TLFA 4XFFA 5FZFA 5A3LA 4NUBA 2Z69A 1W8ZA 2XJPA 5C9AB 3OD0A 4IXLA 3V0BB 1LOBA 2VMHA 2VGDA 1UO9A 5D8AA 5CFCC 5KR7A 3LEKA 2G9GA 1O4TA 2PLV1 3HBKA 5K4LA 5A6YA 1CPMA 2I2SA 2FMYA 1RUG2 2MEV2 5LRSA 3WG3A 4XJAA 1HRV1 1I9RA 2VQTA 2WO2A 5FZ8A 2IVIB 4HONA 3VDDC 4CP9A 5BNNC 1WZXA 5HCAA 2JD9A 3ENRA 4MHRA 1GP5A 5LY1A 4W6WA 5LEKA 4R52A 3U37A 1PZ8A 1QH6A 4UFJA 4Y5Z0 1ENSA 2WR9A 2RDNA 1PVC1 1G86A 3GJAA 2WN3A 4CCOA 3OSDA 5BNOA 1A8MA 3H50A 1N3QA 1OLRA 3WQ7A 5KC5A 4CEYA 1JYNA 3OGSA 1NUKA 4Y33A 3DEMA 4LULA 1W04A 4JTNA 3QBQA 1UOFA 5LZ6A 1Q8QA 4IV1B 1AZDA 4F83A 1WW6A 1DQ5A 3H1YA 2O1QA 3POGA 1H2LA 5DUUA 3UYJA 4CP9B 4F8AA 1QXPA 3IZOA 4PIYA 5I0RA 1YC61 1JXNA 3UGHA 3SH5A 2GAUA 1UKGA 4OUMA 1HQLA 1YI9A 3RPQA 1WKYA 4URTA 2J22A 1JBCA 3AMMA 5SV5A 1O4YA 2BOIA 2FBEA 3H3UA 4NHMA 4OQ8A 3RQ0A 3WDWA 3T4VA 2DTYA 1B35A 2Y0IA 1VRH3 4BDVB 1UN1A 4IEPA 1CAWA 2ARCA 5F3CA 1CAXA 1WMEA 1XBFA 4KWLA 5J96B 2OQ7A 2YU2A 3TWIA 2QQOA 4QHZA 4PBPA 1W6PA 4GMP3 4IGPA 4FQZA 2TBVA 3GBFA 2JG8B 4GJYA 1WBLA 1X36A 4N7IA 1J83A 1R091 1UYYA 3ZMOA 2A75A 1QJX2 3Q8EA 5JXGA 4YVWA 5DAQA 5HBAA 5BPXA 2B4KA 1FOD2 4LKFA 4IW3A 4X6QB 1ULEA 3FUQA 4FFGA 4CEWB 3KVAA 3UESA 3N7JA 2P3KA 3AFKA 4XE9A 5IAXA 4QX8A 2ZGNA 1JZ6A 4HFSA 2JD4A 1QMJA 2DVFA 3I97A 3H1WA 4QPIA 4UWDA 5FLIA 2OKXA 1S0EA 3J7HA 1OF3A 2F4PA 2OPWA 2VZRA 4XACA 1BVP1 5DDJ3 1OA2A 4PT6A 4Q4V1 4Q4X1 1FX5A 3DGTA 1J58A 2VNOA 2X05A 3GZUC 2WWSA 1RUJ3 2WZR1 2W91A 4H7LA 3LGRA 3B7MA 1RVF1 2WYSA 2FD8A 1LOFC 4MV2A 2E33A 3MEPA 3B9CA 4A6OA 1VB4A 1ASJ1 5EYYA 4XIOA 1WUVA 3M3CA 5EXOA 2WSVA 1F35A 3KF5A 4QQHA 1D2QA 1OURA 5LBEA 3AB0A 1LHOA 1DLCA 2PHUA 4FP3A 1SLIA 3ZO0B 3I3EA 4FPGA 3SCHA 2FDKA 4XDQA 5FYTA 4CDWB 2V4AA 4AQTA 3F2ZA 2LS6A 4LHKA 1WLWA 2FDFA 1CX1A 1PGW1 1E5RA 1ZZ8A 3JBG1 3SEEA 2PAKA 3ZYPA 2A7AA 5LBCA 5C7GA 2G19A 4G9SB 1H1IA 2ID4A 1VAKA 3E5QA 3LDKA 5FZEA 2RMU3 1X8MA 3ATGA 3LOIA 3PIGA 2R1DA 1PGL2 5FYSA 2RS51 4IV1C 1XE7A 3ZYBA 4FT8A 3O1PA 1LKNA 1RITA 2PN5A 3I2FA 2ZAHA 5J98B 4QXHA 1OQDA 4N43C 4D8MA 3WP3A 5FZKA 4LHNA 3T2TA 2D6LX 1WA4A 3VZMA 1ZRDA 1U5XA 3DUIA 1PIV3 1ND2B 3ACGA 3PVNA 3T2PA 5FV3A 4IEOA 4LPLA 3ZXFA 2Y8KA 3KQ4B 1U5IA 1PGSA 4EQVA 2YHJA 2VOXA 4K6BA 2QFEA 1YQ5A 1MVEA 1RUC1 4IE5A 5DZGA 3WSOA 2XBO1 5JIUA 1W0PA 3IIIA 1ZYBA 2DF7A 1PK6A 4P9IA 3ZXAC 3ILRA 4YW7A 2R30A 4HN0A 5A33B 4EN6B 1AYM2 1ULGA 4LUKA 2D6OX 2HWE2 2KA3A 2ZZJA 2WQ8A 2HH9A 1W6OB 1NCRB 3TOJA 3JBG3 4UW5A 4HPKB 3WHTA 1W3VA 2ZX2A 3NNGA 1XYNA 1Y9GA 2VD7A 1AL23 5E89A 4LKDA 3ZFFC 4K20A 4I0AA 4J1XA 3MZHA 2LTNA 4CDXC 3P1IA 2RS53 3V0BA 3SC7X 1RTVA 3N7KA 3KQRA 1MZEA 2DCKA 1JOJA 4MUVA 3SKJE 1GP6A 2MNGA 4BLIA 4CDWA 1W2NA 4NIHA 4ITCA 4CEYB 2HWF3 4S2DA 1ND3B 4H14A 4MZUA 4DFSA 1STMA 3WNOA 1TEIA 3IKWA 3PUQA 5CIRA 4E4ZA 2P3JA 1QNYA 3Q8AA 2XXZA 2AZ5A 4DY5A 3EB7A 2VG9A 5I0DA 4LLFA 4QHOA 4A3ZA 3WW3A 3QH7A 4FOWA 2FMDA 5FKBA 2A71A 1GNHA 2Q0AA 2XJRA 3LIGA 4P08A 1GICA 2B45X 4UFMA 2PHTA 1W8NA 1ZVFA 3UNPA 5LA9A 1WCUA 2YY1A 2A6WA 4E4SA 2ZHLA 3I2IA 1VBA2 4LXLA 1RUI1 1BEV3 2QQUA 2C1FA 2E9QA 4YM3A 4P00B 1JZ3A 3BALA 1EYBA 5D1IA 5FP4A 1QU0A 1OOPC 1MR5A 4EYUA 1LHUA 1M06G 4BHPA 5JDBA 1RB8G 1JODA 4AFDA 1JYVA 3NAPC 4P9LA 1AJKA 2PAMA 4QPGB 3Q8FA 4CDWC 3E1F1 2DYCA 2NLRA 1H8TC 5K0UA 3T2QA 1C3HA 2H6BA 5FZHA 4AEDA 1ND2C 5IK7A 1ZNPA 1UZWA 1PK6B 3M8LA 4Q4X2 3THPA 4AYUA 4N53A 4GWNA 1CJPA 4XXAA 3DCQA 2RM23 3DPRB 2UWCA 1R082 3UJQA 1ND3C 2W92A 4BU2A 1ZZ9A 3KS7A 3AMPA 3MFAA 1HB3A 2WZ8A 2JDPA 3IM0A 2WNUA 4ZXEA 2HWD2 4P9YA 3TAYA 3VBRB 4UI9L 3P3NA 3G6JB 5GKAC 2EIBA 2ZGKA 4NPLA 2D3SA 3RGBA 4D7YA 1G9BA 3VD4A 2WLQA 2X10A 2JE9A 2QQMA 3ZR5A 1I5ZA 1GKBA 3AMQA 2Z42A 4QXKA 5C3PA 5IVCA 4NRQA 4JKLA 2O8OA 2IXHA 4CXWA 5BXXA 3ZMNA 3GF6A 3ZFFB 2XR4A 3PLQA 4Y22B 4CSWA 1POV0 2Q30A 4NPRA 5FZOB 5L9BA 3M3IA 1HXS3 1GNYA 1LRHA 2JDMA 1US2A 2XJSA 2XJTA 4MGSA 4XJ8A 3WINE 4P14A 4P9JA 1HXS2 2AC1A 2V72A 5FPZA 2WUHA 3OD4A 4GZ9A 4XQ4A 4BMEA 3C7FA 1J3PA 3R4UA 2XVKA 4I0WB 1TVGA 4MXVA 4OI0A 4M00A 1LULA 4OFGA 2BDRA 3WCSA 5HCFA 1PVC3 1XE8A 4QX2A 5F32A 2R062 2ZJCA 2VZ1A 4IETA 1Q8PA 2NMNA 3K48A 3CZJA 3IBMA 3LSDA 4TLGA 1C4RA 1OH3A 3WQ0A 1AR82 2J1TA 2RJKA 2JDNA 3DV8A 4BK4A 5F7UA 4GH4A 3I59B 1PZ9A 4CYDA 3NJVA 1SEFA 2P37A 2R7EB 4Q5OA 3MO4A 3O1RA 3ELNA 2WS92 1KJLA 5FBZA 4BIFA 5FO9B 2RM22 3ZLIA 1OLMA 4N9HA 4S2GA 3RG0A 5LASA 1XRUA 4R4ZA 1IKPA 2HBUA 1UIKA 5FP9A 1XYOA 2RS13 3BOWA 3A4UA 1JU3A 1G7YA 4RGGA 2AYHA 2DUQA 1Q5OA 5KXDA 3M4FA 5FY5A 1W90A 3KD4A 4BOWA 2ZX0A 3FX3A 1HRV3 2WQZC 4PI0A 1GZ9A 2HJIA 4BYYA 1VBE1 2E7QA 4Q4W3 4DEVA 3WXPA 1PGW2 2ZKNA 4MOAA 4NIAA 3WF3A 3WQBA 4L99A 4LO8A 2D6PA 1HN1A 4AF9A 1VBA3 3IDCB 5C8CB 2P5BA 2CGPA 1HN0A 5FOJB 4UT5A 1C5IA 1QJU3 5DG2A 3PJYA 2DU0A 5KHKA 1CJDA 5IVJA 4KI5M 1GOHA 5BY5A 4QPGC 5FLJA 1XOYA 2JICA 2UYAA 4BQ5A 5T5OA 2P4EA 1N3OA 2FCTA 3O0WA 2FDJA 2HYKA 4XJZA 3K4AA 4XYXA 1JYIA 1MPXA 1XNCA 2A3WA 1QJY3 2BRTA 2C0ZA 2YMZA 4XBNA 5CAZA 1JW6A 1S2KA 4AHZA 1Q43A 2VUJA 4HPKA 1Z7S2 1VBB3 1ODMA 1RUD1 2I74A 4JDOA 4XBLA 3PMSA 3DL3A 2AH2A 4JGYA 4MVTA 4Y1UA 3GHMA 1RUF3 1SDDB 2A70A 2WNUC 3W58A 4R9BA 1C1LA 4K8FA 2LUWA 4FOYA 5FY1A 1UU4A 2XUMA 3IIAA 4AFBA 2RJLA 4XQWA 5K7PA 1M4WA 2R043 2W52A 3I4IA 3UGGA 1A8DA 3ZOIA 4RR3A 4FPJA 1NG0A 5L9RA 3FJSA 1ND2A 1SLBA 4JC1A 2RG4A 1YQ8A 5ABJB 4KU8A 4YWAA 1DCSA 3D8CA 5FPXA 2FZ2A 2J1SA 2E63A 5DPNA 5FXZA 3RZJA 3ZYGA 4GMP1 2QQKA 1W8TA 4GAZA 3HQRA 4HZFA 3OYWB 1GP4A 3OOXA 1LHWA 4HT1T 4N43B 2ZHKA 3UJOA 1IS4A 3Q8CA 4ZZ5A 3VBSA 2XB6C 4CZSA 1AR72 2WZEA 3EHKA 4LORA 1FXZA 2RMU2 1A6CA 1OF4A 1HQNA 1REFA 4FXGB 3J8F1 4PLOA 4C1WA 4R4XA 3SNMA 4JDNA 4UFIA 2GNMA 4FI9A 3CLPA 5F6LB 4MGIE 1RUH1 4AI0A 3VBHA 2A3XA 1OXCA 5DAWA 1EP0A 1FMD2 3OPWA 3R4SA 3URFA 4LHSA 3WNPA 1GQHA 1S1AA 4XF1A 4FTEA 1E5HA 3IMMA 2H6CA 4PIXA 3D3AA 3BTYA 1DU3D 2P1BA 2DTWA 4RA0A 1HV1A 3ETQA 4XXPA 3UT0A 3VHOA 3WW2A 4DXTA 2WRAA 5JCTA 4O9GA 5JMOA 5L7OB 3S0MA 5IK8A 2SLIA 1O3QA 1AHSA 1NAEA 1BEV2 1RUE1 4RYDA 1VBB2 4TSVA 4K9SA 3QACA 1K5MA 1S2EA 1T6BX 2JIGA 1MZ6A 3KF3A 4CCLA 1AXZA 2L9LA 3LB9A 3K2OA 2Q1MA 5A7OA 2Q8CA 4BZ4A 3JB8A 4ZZ8A 4XFCA 2NPIA 2VXRA 3ROUA 1SCRA 1BHGA 3J7LA 4LE4A 1NKGA 1ZBA3 4PQQA 2YYOA 1ACCA 1W2UA 2XHKA 4Y5TA 3BI3A 1J1LA 4ORFA 1R083 1NXMA 3M7AA 2ORZA 3ABZA 1VJ2A 2Y6GA 2W1QA 2HEWF 2C9KA 4LKSA 1GZCA 1JH5A 1HB1A 4AHYA 3KM5A 1DQ1A 4W50A 5EV7A 4KGGA 3LE0A 1BLZA 1XB9A 4LLOA 2ZGQA 1DYPA 4XURA 4GD4A 3AP7A 5BNPB 4MH0E 5FZ3A 2GALA 1LESA 3GZAA 5F3GA 4HSLA 3UKVA 1PMJX 4XFGA 1AR62 2XG3A 1PX4A 2VZQA 2VUCA 1X9PA 2H0VA 3PVEA 4PLNA 5T5JA 1FMD3 1H9PA 4CEWA 4IV1A 5IVFA 2ADEA 1J3RA 1W6QA 4RS5B 4IERA 2VCCA 1LR5A 4YM0A 1OA4A 3MGUA 1DFQA 2QCSB 5H9QA 4C1XA 1F9KA 3POWA 4H3WA 4AOCA 1UMHA 2ZX1A 4B8EA 5C4WB 3O5SA 1JZ2A 1W2TA 1AF9A 2JDZA 3APBA 4W65A 5FMCA 1QNWA 2RJ2A 1X33A 4FFFA 3RJ2X 3ZYHA 4ATEA 3H7JA 4LBQD 2GNBA 3NWKA 2GC0A 3LKJA 1SBDA 3BODA 4XJWA 2RS52 4EWEA 1XPWA 2E31A 2C4XA 3O7OA 4N53C 2HWD3 2ADDA 4MGYE 3LA3A 4FXKB 5I0TA 1ZREA 4COUA 5A1LA 3VDCA 1AVBA 1S0IA 3AVRA 2LROA 3FE5A 3K3OA 1W3XA 4RHV1 5FK8A 3VKOA 3E6DA 4GXLA 4EN0A 4XOGA 4ES8A 4XJ9A 1H4GA 3I54A 2EAAA 2J1VA 3ORJA 5LA2A 3TBDA 1JYXA 5F5AA 1RVF3 3M3QA 1GZWB 1J3QA 2A6XA 3LCPA 3IB3A 5BNPC 5ACA1 3VBOB 5DAPA 1RL3A 5T52A 2NZ9A 1JZ5A 2D6KA 5BV6A 4R9DA 4YGEA 1IZ3A 1SMVA 3VBHC 5M0TA 2W0XA 2OZ6A 3ALQA 5K9YA 2B42B 4RQPC 1W99A 1S0DA 4RSUA 2Y6KA 5FO8B 1PX3A 2Y6JA 1VMJA 5FWJA 1SCSA 2DVDA 4NAMA 3LDRA 2ZGSA 2EIEA 4DEQA 3AVSA 1OH4A 3KHCA 4C0HA 2VMEA 3POYA 1W05A 2BNOA 5IW0A 3VBSC 3FBYA 4K7JA 1O91A 2ZPXA 2Z2SB 3J26N 4NOTA 1PMHX 2DVBA 1DGWX 1LEMA 1E5IA 2Z4FA 2VQAA 5GJ6A 1O7FA 3AYEA 1RJ8A 3QH6A 2ENRA 2O0OA 2ZX3A 1OT5A 3HVDA 4F7ZA 2Q5TA 2RDSA 1I3HA 5EHDA 2JDUA 1UZYA 5FYIA 5DDJ2 1OLQA 3WR0A 3BN6A 4XTMA 1Q3EA 5DUVA 3RRDA 4Q0QA 1CZVA 5JZGB 2PYTA 1PM7A 3I3DA 4GQ7A 2D44A 5LK5A 1BMV1 2W08A 3VD7A 4MADA 4CUAA 5FMOS 1MS8A 3IWZA 3ECQA 5IT6A 3MIDA 5FY9A 3ON7A 4WVVA 4ATFA 1IS6A 2R042 2XOMA 4NR1A 4WM7A 3DYPA 3T09A 2VZOA 4QPYA 1CQ9A 3ZM8A 3MYXA 5FKCA 5CKQA 1UKRA 2WYFA 3V0AB 1XXNA 5ABJA 2YROA 3T08A 5KHGA 3U75A 5LBBA 3S7EA 1HRV2 3DF0A 1OVSA 4LO6B 3W20A 4QPGA 3OPTA 5EJ3A 2HWF2 3POFA 2ZMNA 2EICA 3FUOA 1VLNA 1OBNA 4RFRB 5FZDA 3LZZA 5JIAA 4AEDB 1LOAA 1OI6A 4RD7A 4AVCA 2R1BA 5DUWA 3E6CC 1OUSA 4YZ3A 5C71A 5LA0A 2KR2A 3NNMA 3KCXA 3NV1A 4NAOA 1ENQA 1R1ZA 3RI8A 1DZQA 3OY8B 4R8HA 4Z92B 2PQQA 1YI7A 2QVSB 3HAGA 5LEJA 3CO2A 3V0AA 5EZWA 4LKEA 5FFOC 4RL7A 2CYFA 1K5MB 2V5YA 2JECA 1MEC1 4O7XA 3HWJA 3VBRA 1RUC2 4IE6A 1NT0A 5FPVA 1LODA 1CAXB 1IS3A 2FDHA 4META 4QB2A 2QQLA 1ULDA 3UV9A 3AP5A 2FQPA 2YDEA 1LJ7A 1MEC2 1GWLA 1W6PB 4BB3A 1ZBA1 3AJYA 3WNNA 4XIKA 3ZSMA 2JIJA 5BNOB 2LW8A 4XDPA 4JAAA 4LBQA 2BUKA 2RS32 3TB0A 3BPSA 4X8NA 3VZLA 4AQ6A 4Y5SA 1YRZA 3OBRA 1RUH3 1BEV1 1RUE2 3I2KA 4A7KA 3H8OA 3A7QA 3WG1A 1V0AA 2BYVE 1AXKA 1F5JA 1K3IA 2WNVA 4FQ4A 4JZRA 5CB7A 5CFDA 4RR3C 5JXIA 3VDAA 3ZDVA 2WA4A 1UX7A 2ZZQA 1WGPA 3AL5A 1UL9A 2E7TA 1KXGA 5FZ0A 3P6BA 4CP1A 3PUHA 1JOBA 3WW4A 2P3YA 3LA7A 2IFRA 2ZABA 1ENRA 3K4DA 3JU9A 3KLSA 3PUIA 4LBOA 1R1A2 2HKXA 5FIXA 3IAPA 3ZXDA 1I5PA 4HETA 1EV12 5J09A 5A3OA 2WA3A 1JUIA 1Y4WA 1PO22 1VBC3 3NO8A 1YYNA 1CN1A 3ZFGB 5FDBA 2ZHMA 4HKWA 5J48A 4GH4B 2Z79A 2B7YA 3I8TA 5CVRA 2XLAA 4DRVA 4SLIA 4OULA 4FPYA 3ILNA 4YG6A 2EXKA 2GNTA 1YQ2A 1RVF2 4M4PA 4YGBA 4LBJA 5EJ1B 1OPMA 3TN93 1EAH2 1GU3A 1Z78A 2OW4A 1LOCA 5D21A 3WP5A 1WWYA 4BH9A 2RHPA 3B5LB 4IV3C 3JQXA 5JZGC 4Q4V2 1G9DA 2XUEA 1OFSA 1W6QB 2RS33 4AI2A 5LK7B 4MG2A 2R6QA 2EVXA 4JV4A 2WDBA 1OMIA 3ZKYA 1EAH1 1AYN3 1Y3TA 4YFWA 5DAVA 1UX6A 4AR2A 4RS5C 3E5XA 2RMU1 1RUD2 5FPUA 2WBKA 4FP2A 1K5MC 4CU8A 4KWUA 4AAPA 4OHYA 2D98A 5DZEA 2CWMA 2CY6A 2JE7A 3BOPA 4XCBA 4FTBA 2GC3A 4UFHA 2R071 1OFNA 2W9XA 3H1MA 1OHFA 4HSJA 5FUIA 4M0HA 3WF2A 4EV0A 1YXWA 4A3XA 3WF0A 4GH4C 3AKTA 4ZONA 2ZKLA 1SFNA 3O14A 1XNDA 1V6KA 1RUG1 2MEV1 2BGOA 3B02A 4CE8A 1J59A 3MHZA 2QKDA 3J9SA 3HMYA 5E8AA 2CDOA 1GBGA 1ZBE1 3K3NA 2VTFA 2VY0A 2J7MA 3AYDA 4PDWB 5F5IA 3PMEA 3I7DA 3PTRB 3T0AA 5HCBA 2W1WA 1DDLA 4HANA 2Y34A 4IV3B 1F5FA 2QQNA 2FCVA 5L19A 4AQSA 2D93A 4UFLA 1U5YA 2QQVA 1CONA 1Q8SA 5BNNA 4FFIA 4I3GA 2BZDA 4Y1VA 4OHVA 5EPAA 2YFUA 3ZSEA 1N47A 2E51A 5AC92 5B4NA 5FZGA 1CAUA 3GHNA 3HOBA 3SH3A 2BBVA 2KM2A 2VTXA 2IVJA 3MIBA 1CAVA 4QT6A 5CYYA 1W9FA 3NQHA 2BNMA 2OX0A 1Y9QA 4QDRA 3HN1A 4ZHNA 3LFIA 3AMNA 1WLTA 3QD6A 2HWB1 4KG8A 3AXDA 2YBSA 4M3CF 4PBOA 4FPLA 5A7PA 4M01A 4NHYA 5FZ6A 5IVVA 3LIHA 4W6YA 3B3QE 2JG8C 2UWBA 1NLQA 3PJQA 3RWNA 1UNBA 5FYHA 3ACHA 2WZPP 2J1EA 1BBT2 1SQ4A 3B01A 5GLTA 3LPFA 4QQLA 5JWPA 5A70A 3OTFA 1LENA 4CP0A 4DQAA 4K1ZA 5AVAA 5B2GB 4U2AA 1NX9A 4AGVA 3U1XA 4NROA 4BWOA 4OMCA 1UQXA 2ARXA 4BIOA 2CV6A 2WABA 5C8CA 1AR81 3LDBA 2JENA 2G9FA 1RHI1 5AC93 5IFTA 4JRLA 1V6LA 2VNVA 4LMFA 5FZ9A 4UAPA 3S5AA 3UKTA 2UWAA 1LGBA 1VR3A 2WNOA 1JHJA 4OI4A 4ZU5A 5DG1A 1XU1A 2BPA2 2JXAA 1FMD1 1LNSA 1NE4A 2X5IC 1PMIA 1IGOA 4GULA 3AP6A 1S4CA 3ZXJA 1QJY1 5T5PA 4LIVA 1IS5A 1Z7S1 3NNLA 4YW6A 3O0VA 4A45A 4E2QA 3VUOA 3EYPA 4DINB 4N8MA 2B9VA 3OF1A 1GANA 1SBFA 1SACA 1DGWA 2BWCA 4YM1A 1TME2 4LT5A 2CU5A 3HBZA 4XABA 2MPFA 4Y1YA 5IATA 4Z8BA 2VW2A 4XAEA 3VBRC 1RXFA 3AKSA 1FPN1 2WL1A 3UETA 5CADA 3ZFFA 2VM9A 1RUJ1 3J8F2 3SEPA 3VV1A 5CA6A 2F17A 4XJUA 2ATFA 4B7KA 1QXJA 2WNVB 5FPBA 2I07B 3PVOA 5FP7A 4CTEA 4DXSA 1BJQA 2PTMA 3MIHA 4JX0A 4UF0A 1E57A 4LBLA 3WEZA 1IHMA 3AZWA 4ARYA 4D7SA 1JOPA 1PZ7A 1YFYA 3JQWA 3ZR6A 2V5DA 5A3MA 1BCXA 2HWC2 2JJ6A 1W9SA 2RDQA 3KHBA 1RC6A 4JQTA 4LK7A 2ZEYA 4D6QA 4QU1A 2VL4A 4QX5A 2XDVA 1LECA 2HWC3 5A3WA 2XONA 2JDHA 1RINA 4PIZA 3ZPOA 2XWBB 3EXUA 3H42B 1QY4A 2E32A 1CWPA 4CUGA 1UYXA 2XVGA 3C7OA 2AACA 4IESA 4LBNA 1NLSA 2O14A 3KZ4C 3TN92 3IPVB 3LWCA 2ZGUA 3OB8A 4LA3A 4LIUA 4ONUA 2BVVA 4Y20A 2OUHA 3V65A 3OGGA 1QJX3 5FMBA 5LRRA 1HIXA 3JCIA 1WW4A 1KDKA 1TME3 1Z0HA 4CXYA 4FAHA 5HI0A 3CJXA 3RZKA 2W68A 1C8M2 1N1VA 1UXZA 1QGLA 2E6VA 4IEZA 4Q29A 4Q4V3 5FREA 5CBLA 5L36A 2WNVC 4CA9A 5A7WA 2QNKA 3R05A 1CVNA 3POIA 1UU6A 4NMIA 3ZDSA 2RE9A 2AEYA 3WDVA 2EALA 3EBRA 4B4RA 4MXWB 1F31A 3OUHA 2ZA9A 3R4DB 4QX7A 2WWJA 3VZNA 4PDWA 1OPOA 1W39A 1YQCA 4CCMA 3I2GA 5IFPA 3WNXA 2BGPA 1UWWA 3VHPA 4BQWA 4CP2A 3PVBB 1VP6A 5J37A 2XQRA 3RMYA 3TEWA 4L11A 5J3UA 5T55A 3H8UA 1ODNA 5DXDA 3ZXKA 5C8WA 1V6IA 3VZOA 4CRQA 4OCTA 3ZYRA 3MPPG 1K5JA 4XF9A 3POSA 2QTWB 4AI9A 2IXJA 1NQJA 5G04L 5GZGA 3H0OA 3NNFA 3OEBA 5A6QA 4PDWC 4WVWA 4YW4A 4MSVA 3SKVA 1IKQA 1BBT3 1KJRA 2Q1FA 4N90A 5E16A 5FZAA 4FTSA 1QQP2 3C3VA 1D2SA 1JI6A 1VRBA 1W6MA 2ZAAA 4QAWA 3RFRA 3CF6E 3FN9A 5KXCA 2ARAA 4DB5A 1RUF2 2JB4A 2VPVA 5A3UA 3ZFEC 3OGVA 4LNVA 1H8TB 3HN3A 1YIPA 4B3NA 4YVWC 4ASKA 5LATA 3CQOA 4L92A 3PTYA 1VBE2 1BK0A 1COV1 3TN91 4JHTA 5IAVA 5T50A 4AFMA 4AZZA 3ACLA 1GYKA 2A6VA 1OQ1A 3KT7A 3UK9A 2XWJB 5JXJA 5HV4A 4MLOA 3TNPB 5FMDA 4FFHA 1UPSA 4AAXA 1AR71 3NV2A 4W8JA 4D6SA 3WNLA 3TYJA 1W6OA 4QPWA 3UGFA 2OZJA 2VQ0A 4PQ9A 1BMV2 2J1AA 2E53A 3KSCA 3PL0A 1UMZA 4AEDC 1GMMA 5EFUA 1H8TA 5K0UC 3R0RA 4XUOA 2RVAA 4XPVA 1BYHA 2ZOEB 2OS2A 4IGOA 3H3LA 1NCQB 1UY2A 4EE2A 5A32A 2BJSA 3QLQA 3CU7A 4NN0A 1ZRIA 1VAVA 1D7PM 2VVFA 4PHZA 4Q8LA 1DZRA 2RR13 1OC1A 2WT0A 2FCUA 1SLAA 3RYKA 4NRPA 4ZKTB 4YW1A 5F39A 3DECA 3DYMA 1WMDA 2Y0OA 1V9U1 5LBFA 1ASJ2 4AWDA 3DXTA 3FFQA 4NE9A 1UOGA 4WM8B 3TNQA 3LFMA 1N1SA 1NOVA 4KU7A 1WD3A 3FWEA 1O3SA 2ZHNA 3INAA 3VLBB 4QB1A 2YGMA 2BFUS 5BNOC 3FHAA 5F2SA 4AI3A 3SCGA 4ZXKA 2A3YA 2F4LA 4I2OA 1KITA 3AZYA 1OD5A 3NVCA 1F4HA 4XHXA 5DAXA 5FYUA 1MZFA 2TUNA 3GXUA 4QGNA 5FTTC 4HMZA 4NHKA 3THDA 1BZWA 1TZOA 3LD8A 3ZN4A 4XFHA 1TG7A 2DVGA 4E8DA 2GU9A 1VBE3 4FPEA 5DZFA 2D97A 5C3RA 4AE2A 1AR83 5HV0A 2WT1A 1QIQA 4UW6A 4XILA 1SDWA 5DUXA 1OKQA 3WD5A 2X5IA 3DKWA 5BYNA 5LB6A 3GGLA 2LALA 2N7GA 4GB33 4HL0A 1H2MA 3WQ1A 1VB2A 4DNYA 1LHNA 1POV1 3AKQA 4K3UA 1PGL1 1KFUL 1HDKA 1VBD3 5FXVA 4O65A 3O0XA 5FUNA 2WNUB 2PXJA 3VD3A 5ISLA 4XUQA 1JN2P 1MS9A 1PM4A 5T3NA 2DFCA 3GCWA 4XQDA 3IDEA 5LWBA 3L9JT 5GLZA 2W46A 2ETEA 4OI2A 5FZLA 4OUEA 2HWE1 3DYOA 1RIRA 2YXSA 1BK1A 5I91A 4Y20B 5AFBA 1GWKA 4COYA 5I8TA 3HT1A 1YEWA 1IQAA 2VCMA 4BQ1A 4EZ4A 3B94A 1W8WA 1NA1B 1RJ7A 3HNBM 4E9KA 3ZFEB 5KWRA 4HK8A 1RUI2 2XL7A 1AX2A 1EV13 2HWB2 5ANNA 1AR61 4YVWB 4BQYA 5JSOA 4C91A 1PNGA 2GC1A 4XUPA 4OHZA 2JKXA 1C28A 3WDXA 3U11A 4L97A 2XKPA 4BXFA 2XBO2 3ACIA 1RUJ2 3JZVA 4NHXA 3M2MA 4YYOA 4AHXA 4MGQA 1FNYA 3N9PA 2H0BA 1BKZA 3P3PA 2YPJA 4YPJA 5AC91 1H0BA 3N9NA 1UF2C 3SXWA 1ENXA 2A6YA 3ZFEA 4L9BA 4QWNA 4P9WA 4MGZE 4Q1PA 4BQ4A 2ORXA 4DMIA 4IEVA 1C8M3 3G7DA 3WDYA 1Q8OA 3EMRA 3I3MA 1S0FA 3H3ZA 1QOTA 5A7WB 3A0KA 3D5OA 4AGGA 2EF6A 3BIWE 4C90A 2D40A 1D4M2 4XC9A 1VIWB 2VBPA 3GBGA 4O61A 5FYMA 4W4ZA 4WZCA 2ZACA 2GN7A 3AL6A 2XJUA 1VPHA 2KXLA 2HWE3 3KVBA 5JI7A 4YZ2A 2ZGRA 1UZVA 4OYUA 1O5UA 1DHKB 3MF9A 3ZYIB 3NW4A 3O12A 5C3SA 2V09A 1YNAA 1XE0A 2D43A 4IGQA 4Q8KA 4IQPA 4YZ1A 3IT8A 3D4KA 4BJ0A 1FT9A 1H2NA 4WVMB 3CMGA 2W1UA 4XFAA 1DQ0A 1O3TA 1KDMA 1SBEA 3CKHA 4NPMA 2RV9A 1HQWA 1MS5A 4DXRA 1RUG3 2MEV3 1SLLA 4QHBA 3N35A 4YW5A 2XBO3 5APAA 1K12A 5FMOL 4YZ5A 4WBBA 2BP6A 3U14A 1SLCA 5FZCA 2HEYF 4JTOA 4Z82A 3J7MA 1NLRA 1W8HA 5GLUA 3SLIA 4OI1A 1KRIA 4XZUG 4OMDA 2A5ZA 4HKOA 4RS5A 1NA1C 4UBGA 5GM0A 1ZZBA 1V6MA 2DVAA 4AL9A 3KWVA 3ES1A 3W59A 4CPBD 3RI9A 2PMWB 3ZPYA 5B4XA 1ZBE2 3WNMA 3OGRA 5F5QA 1O59A 2ZGMA 2ZEWA 3WUDA 3H9AA 1CAVB 1XU2A 3VKLA 3JBG2 5FK7A 3VKFC 1F8VA 2P17A 3I3BA 1RMU3 3ZIXA 2XJQA 5F3IA 4AVBA 2Q8OA 3LSEA 2D6NA 1FPN3 1VMHA 3MW2A 1IG3A 4BE3A 1N1YA 1POQA 3O1MA 4WV8A 1AR93 1JU4A 3AZVA 3O1SA 1V9U3 2K0GA 4MHUA 3TEZA 2R041 1O6UA 1FPN2 1XC6A 1US3A 3IN9A 4EN9B 1DG6A 2QBXA 5CKNA 2PQSA 2OT7A 5E6HA 1OSGA 4E2SA 3BYWA 1GOGA 3DKQA 3USUA 3KV9A 5ERLA 3I2HA 1UAIA 4UFKA 2XHNA 3LF7A 2GMMA 2DCYA 4CDUA 4N43A 1CIWA 1FNZA 4LR4A 1GR3A 1OLME 3FLPA 4Z1VA 5A7QA 1YCIA 1QF3A 1YO8A 3OJBA 5FUPA 1LU1A 2XQXA 2BQPA 4AGRA 4K1YA 1HRI1 2B9UA 2X53S 3RZGA 2W39A 1QDCA 1VMFA 1JYCA 3OUJA 1PO13 2VU9A 2JEMA 4YM2A 1UCXA 4OQ9A 1AYN2 2R063 1W2AX 2VC9A 2PA7A 1H30A 4Q27A 3JD71 4TN7A 2Y60A 4COWA 3F95A 4DRRA 3T1LA 4JGZB 2VQUA 5IYYA 1POV3 2VE1A 4RR3B 3VBSB 3BIEA 5K8SA 2WN2A 1R1A1 1TE1B 2LRPA 4QXBA 5I0SA 2DBNA 1LOFA 2ZGLA 2QUOA 5D2AA 3VBHB 2NP0A 4QX1A 2EXIA 3O1VA 3K75B 2WS93 1T2XA 1ULOA 2OQ6A 2Q1ZB 4IUGA 3WG2A 3OYWA 5GZDA 5JI9A 2WFF2 3ETPA 1JYWA 4CEYC 5JOWA 2GZWA 4IEYA 2ARBA 1COV3 4CEWC 1W9TA 1W06A 1YJLA 1AL0G 3WVJA 1YHFA 1YFXA 5A7NA 3RYRA 1B09A 2UU8A 1QEXA 1AR63 5FZ1A 3VD9A 1DQ2A 1MVQA 4HK9A 2ZMKA 2PHXA 3GALA 3GBWA 2YBKA 3RS6A 2RDRA 3D6EA 1EUUA 1EAH3 1Y9MA 3SHRA 1RHI2 3BTXA 4B7EA 1J1TA 3ES4A 4HVOA 4V2WA 2D3PA 1CIYA 1ZRRA 4IEQA 5D8AC 5CFCA 3BKZA 3S30A 1ALYA 3OEAA 4LQRA 4G4FA 1UU5A 4PJYA 4I0BA 4WM7C 5A33A 3V64A 1W0NA 2VOTA 5A3TA 4FBFA 5CEHA 1R093 1ULPA 2WZR2 3MW3A 1GZTA 5AVPA 3PDQA 5H9RA 1W03A 5EJZB 3NRUA 2E7AA 1PIV1 3NAPB 3WCRA 3ZN6B 1R1A3 4HVRA 5A3NA 1R64A 3MPBA 1HV0A 1PVC2 4I3PA 4DIQA 1JYTA 3VL8A 4L2NA 1DYOA 3U10A 3ZN5A 4QQ2A 1VBC2 5IK5A 2Y6LA 3VBFA 3B93A 3AP9A 1H1MA 3KT1A 5GZEA 1JZ8A 1RGSA 1G8WA 4FO9A 4PF1A 4YRDA 4XDOA 4XVHA 2FZ1A 2B8MA 1YJKA 1GLHA 3CHXA 1R081 1FOD1 2PAEA 1DGRN 4FOVA 4WVZA 1W6NA 4XF4A 3E97A 1VAMA 3WF1A 3NAPA 1A34A 2ZGOA 5L7OC 3W5NA 1HB4A 4ASMB 2IXLA 2QDNA 4UF0B 1WCSA 2PHLA 5BNNB 4L8QA 1O8PA 2XLGA 1VBD2 1YLLA 4A2UA 2D5HA 1MZ5A 3ZVXA 1H2KA 4AFCA 1NZCA 1MS4A 1CAUB 3LEGA 4G3YC 4YVSC 4LHLA 4GJZA 3FFZA 4NJ4A 1IQDC 2OIIA 4GB31 1H6XA 5FYYA 1W2OA 3AX4A 5FPAA 4Q0VA 5DQ0A 5GLVA 2VCBA 1H1AA 1PO12 1W9YA 3ACFA 3K4ZA 3MIGA 2B46X 1H6YA 3DN7A 4URAA 3SMHA 2CSGA 1GQPA 2Z5WA 1UY4A 5FZBA 1P8JA 2MHFA 3KCCA 4A42A 3HNYM 4QX3A 1UY1A 4W6XA 1CESA 1MQTB 1OVPA 4YFZA 3VL9A 3ILFA 3CBNA 2A1XA 5FJKA 4OLLA 2UY8A 1JZ7A 3RSJA 2TEPA 3K51A 1YQ6A 1RUH2 3NMBA 1MS3A 4ZU4A 3T0BA 2P6CA 3MIFA 3E5UA 3AKRA 3NV3A 4B4QA 1XNAA 3A0NA 4IE4A 3K46A 3UKNA 1KQRA 1VBC1 4K8RB 2VBBA 4OZXA 3NSTA 2K46A 3BU0A 5C9AC 3H7YA 4BQ2A 5GZFA 1KFXL 3MLKA 2BTVC 3AK0A 4QPIC 3ME2A 1SFPA 3KGLA 1F15A 3PU3A 4TXWA 4C0BA 1XNTA 2VBDA 5ACA3 3T4HB 4H7MA 5A7SA 5FZ4A 4S2HA 4OHWA 4XETA 5CNAA 2WIIB 5F9TA 4BA6A 1UPIA 2WINB 1KS5A 4BQ3A 2P3IA 3MV11 1S2BA 1AYM1 2HEVF 2RS31 4FOQA 4LEJA 4UBHA 5FXXA 2DV9A 3ZIWA 4AXOA 4I02A 1GQGA 1W8FA 2YG0A 5FY8A 3U4XA 2ZXQA 2WJSA 5FAXA 3HQUA 2ZMLA 3TRSB 3VZJA 2R16A 1MACA 2X5IB 4LTAA 3MBWA 2R061 4YG3A 3H8RA 1NCQC 3O1UA 2VOWA 3PU8A 5CFDC 5GLWA 4CCNA 3M1HA 4AG4A 1QQP1 1REEA 4QDQA 3WF4A 2C26A 4QX0A 4Q1RA 2GP5A 3D0SA 2IXIA 1V6JA 2JG9A 3I2JA 4BLJA 5FZIA 3NJXA 1N1TA 4IEUA 5FYZA 3ST7A 3C7GA 3GJBA 5T54A 5GZCA 3ZSKA 5A1FA 2VMIA 5C33A 5FY0A 3RZMA 4CDQB 5J7MA 1GWMA 1ZX5A 1OKOA 4Q4Y1 1CPNA 2YC2A 1V6OA 5FLHA 5C5TA 1ZBE3 2Y33A 1U0AA 1ULCA 3LA2A 3Q8BA 4YLZA 3WZ1A 4PF5A 2CHHA 2EAKA 2XJVA 3BB6A 2EXJA 4Q0UA 3ZXLA 5FQ0A 1CGPA 2WC2A 2K9ZA 3WUCA 2VNGA 2BGCA 3AMHA 3D82A 1UOJA 5AFEA 3RVHA 1C5HA 2WO3A 1GV9A 2IZWA 1X7NA 3WHUA 1HRI3 4IEWA 4JQRA 4A7YA 2PFWA 2I45A 3JD72 3K77A 4ZY9A 4GMP0 1W8OA 3OBZA 2C6SA 2VMDA 3MLLA 2VULA 1HKDA 3IAQA 3U0ZA 4JRAA 1VBB1 5A32B 4GALA 4S2FA 2BERA 4YSFA 1W28A 3AFGA 4EN7B 5IUQA 4EWAA 3IDAA 3VKMA 1O3RA 2XVLA 5ANQA 2QDRA 4JVAA 2WFF1 4N7UA 1CZSA 3VDDA 5F2WA 5JOYA 5KXEA 4AVSA 1X9TA 4LUMA 1JZ4A 2ZS6B 1MQTC 4EJRA 2AR6A 5JVVA 3ZYFA 2IFWA 5FYCA 3HIFA 4B1LA 2D5FA 5FBJA 1DBNA 1QWRA 3EJKA 3CDZB 4CUCA 4EZHA 2ERFA 3QCWA 1CZTA 2W1SA 2XMLA 2CTVA 5LW9A 3KV6A 3NV4A 5FWEA 4XFIA 3VHNA 2O8QA 3N7MA 1XQNA 4DXZA 3HNMA 4U36A 1ZA7A 1FV3A 4ET7A 4QKNA 3JXSA 4QDSA 4JGZC
chains in the Genus database with same CATH topology
2ET7A 3VDDB 1AXYA 1YFWA 1T6GC 3WT3A 2DURA 3VBUB 2EA7A 4Y22A 2ZX4A 3ZN6A 3HR9A 2JG9B 3EQEA 4FPFA 4AI8A 1Q56A 1VALA 1NXD1 5JLVA 4QMAA 4KWKA 5CFDB 1WW5A 2OPKA 1VRH1 3GYDA 4CDQA 1N3PA 2DWRA 3VZKA 4RHV2 2DCJA 1I1EA 5CG8A 1UIJA 5CU1A 3SH4A 3R6SA 1QDOA 4E4DX 5FQ0B 4AFAA 1OOPA 1D4M3 2GN3A 1DF0A 2WFF3 4CDQC 3JD73 3X29B 4AI1A 4COZA 1MS0A 5JSPA 4HVQA 4RQPA 4V1PA 2QZ2A 5H9SA 4FAGA 3WW1A 1G6NA 4XTPA 4FPKA 3UL2A 3LAGA 1PHMA 1V00A 3M3OA 4P5HA 2YZ4A 4AW7A 4DS0A 5KHJA 2WS91 5EWSA 2P34A 5BNPA 1IPKA 2JX9A 3FZ3A 1NA1A 1NCRC 1UW8A 1QHDA 2CGOA 3L2YA 1OA3A 4QM8A 1LTEA 3OGJA 3ZSLA 1LCLA 1AR73 4ES9A 2BVBA 3I59A 1H4HA 2WZR3 1LEDA 3PHMA 1D0HA 3WP4A 1A3KA 3IPVA 5CG9A 1MQTA 3PNAA 1ZM1A 4PLMA 3ZFGC 3Q9OA 3SISA 3T1MA 1NQDA 2RR11 1COV2 2PLV2 3C2UA 1NY72 4WZFA 4GWMA 1ULFA 2RM21 1AYM3 2VVEA 5JR7B 2WFPA 2DUOA 2XLFA 2AREA 4YW3A 1H9WA 1LOGA 1NY71 2G4IA 2RR12 2NN8A 4D3WA 4Q26A 4KQ7A 1AR92 4DZGA 5BUVA 4OUSA 4AEMA 1GFF2 3VBOA 1OOPB 5FRAA 2R0HA 4DPNA 2ZCWA 4NHLA 1RUF1 2GMEA 4WM8C 5DDJ1 5E88A 2GC2A 2HWD1 4Q4X3 1QJU2 5JPNB 3DPRC 1HW5A 1AR91 1ZZ6A 1HXS1 1IOAA 4IEXA 3SCFA 1KD7A 4MX3A 3WDUA 4Q4Y3 1ASJ3 4LE3A 2NMOA 1DGLA 1NCQA 1JTZX 1SLTA 4A7ZA 1I6XA 4Y1XA 3RZZA 4B29A 1A78A 4KBBA 1IPJA 3CL1A 3U07A 1ZZCA 3RNSA 1WMFA 4WM8A 2WKKA 5KBFA 3ZSJA 1FV2A 4LA2A 1RUD3 2VMGA 4AVVA 1QXRA 3AYCA 2CAVA 1DGRA 4JGYB 3WY6A 4D69A 5C9AA 1VRH2 3GZTB 4FVVA 2JKBA 2WLPA 3NL1A 1QOSA 4J6GA 4AEKA 1BQPA 4Q0PA 1O4ZA 5H9PA 3HD8B 2R073 1SFYA 2UURA 3EO6A 4Z2WA 2EXHA 4I30A 4HBNA 2ET1A 5E1RA 2R32A 4QM9A 4HKLA 2EIGA 1VBA1 1BXHA 3J4UH 1WLCA 2GMPA 1QH7A 4LBMA 3QOPA 1Y43B 4IL7A 2PHWA 2VOKA 4BPZA 2R0FA 5KC6A 3BPZA 5JPMB 4LO5B 2XGXA 4CDXA 5C4WC 1FYUA 1V70A 1XNBA 1NCRA 1L3JA 3AXEA 2VNRA 2K2SA 3N4MA 4KNCA 4QU2A 5FOBB 2VUAA 4AVAA 4GKYA 4XBQA 4NWVA 4JGYC 2QQPA 4QQOA 2ILMA 4H55A 1UD1A 3KCYA 1C8NA 4UW4A 3DPRA 4WM7B 4XFBA 5L7OA 5C8CC 4Y26A 3NKGA 1TNRA 2VH9A 3FLTA 4XZPA 1XNKA 1QOOA 2OA2A 4PCRA 4M3CE 3VBUC 3VBOC 1DQ4A 1X8EA 2R49A 2Y38A 3AZZA 4COVA 3VN4A 3AZXA 1Q8VA 3KT4A 2AUYA 1QJU1 5JOZA 2P2KA 2JG8A 2ES3A 3FMGA 3N36A 1AX1A 3AP4A 5I93A 1W6NB 1DZTA 3ZYJB 1TMF3 1FOD3 4AVTA 4TYSA 4QQPA 4XHBA 1D0GA 1S0GA 5F6KA 1G9CA 4X6RB 3FLRA 3LOBA 2TNFA 1LGCA 5K0UB 1REDA 1EPZA 4KGQA 5J36A 1C1FA 4O9EA 2VW0A 1S0CA 1D4M1 3JUUA 1FAYA 1X82A 4BMBA 5HXVA 4YVSB 4F3JA 2F6BA 4QGLA 3KGZA 4UW3A 2VECA 2BNNA 4ISQA 3CJIC 3USSA 2DCZA 2HWB3 1BBT1 2NYYA 2OUJA 3MDPA 4RQPB 1XYPA 1MEC3 2AGSA 2GDFA 4GA9A 2VOVA 1QJZA 3WDTA 2OVUA 1GZWA 4TZDA 1RUC3 4OHXA 3HT2A 3FBMA 3ZXGA 4NVPA 4B4PA 2ZTNA 4YVSA 1LOEA 2SBAA 4GKXA 1LU2A 3IMNA 4NO4A 2AENA 2ZGTA 4ZU7A 3J8F3 2BFUL 2CAUA 4Z07A 3ZFGA 4R9AA 4XF0A 3L2HA 1PVXA 5TSWA 2VVDA 1KS4A 4YGCA 4Q4W1 4BCUA 3S7IA 2XKOA 1AL22 1U12A 3MFCA 5BNQA 5C6CA 3OPZA 2YC0A 2WT2A 1U5ZA 4WVMA 5GALA 1QKQA 2FHRA 2HWF1 4YARA 1CR7A 4MGKE 2RS12 1APNA 1ND3A 1BVVA 1Z7S3 2VW1A 4FSJA 2PHDA 3WX5A 3B9IA 3B69A 1O5LA 3VGIA 5JZGA 4CDUC 1PO21 4M3CA 1B35C 4R9CA 3WV6A 4P9XA 5I0UA 2RS11 1W0OA 1TME1 4UXAA 2C5DA 4X8PA 4RFT0 4TWTA 2IC1A 3OY8A 3WG4A 1UZZA 1YUDA 4FPHA 4AHWA 2PLV3 4M0NA 5KXBA 1ZZ7A 4EN8B 2PELA 4E27A 1AL21 2DU1A 4E2GA 3CJIB 5ACA2 2YGLA 2UYBA 2XL9A 1V6NA 1CX4A 3WOGA 2HWC1 4INDA 2LM3A 2QJVA 1V9U2 2PHFA 4JGZA 4N53B 4LBQB 3E6BA 4I09A 2BW8A 1VBD1 3VKNA 2BWAA 2YUEA 3CJIA 4BM8A 4LO7A 1QJX1 2ZBJA 1GSLA 2X8KA 3AJZA 2GSYA 2JG9C 4RGAA 4DY3A 4XW3A 1EY2A 5IK4A 3ZX7A 1QQP3 4CDXB 1DLLA 5FCCA 1F2NA 2D7FA 2C9AA 1EV11 5KHHA 3FC0A 4J1WA 2QZ3A 4JDMA 2OYZA 4KWJA 5FO7B 1MS1A 1PK6C 1AUYA 4Q0SA 1RHI3 1TNFA 4K40A 4QD2A 4AK3A 3B00A 2WSUA 4JCKA 1X50A 5F1RA 2X29A 5SV8A 1WLDA 5JSRA 3VBUA 1TMF1 5JOXA 1WCDJ 4FPOB 4OVEA 5ABJC 4ISRA 3BCWA 3WLUA 2CGNA 1ZBA2 2XPJA 3GNEA 1Y7BA 5I8SA 2D3RA 2YV8A 1WBFA 1PO23 1WD4A 3FHIB 4LO4B 1AYN1 4GIQA 4I01A 3VBFC 1S0BA 3ZXEA 1AX0A 1NYWA 2IXKA 3CNAA 4QPIB 1RMU1 5T5LA 4P9GA 4YG0A 4KG0A 3D0JA 2QE3A 3NJZA 3BU7A 4Q2FA 4XMIA 2Q4SA 1RUE3 1TMF2 1LB2A 1B35B 1GNZA 1G9FA 3VHRA 1S0JA 3KMHA 3OCPA 3CEWA 3N3HA 1ZRCA 3RYPA 4Y1ZA 3AYAA 3SITA 3IDBB 1S55A 1LGNA 5L73A 4YNIA 2UY9A 5C4WA 1DIWA 2DUPA 2Y26A 3MF6A 2V73A 4D94A 5CFCB 2CWSA 2A6ZA 2GH2A 4XMAA 4YZ4A 2NM1A 1D4VB 1R092 2D6MA 1EPWA 1ZRFA 2WNEA 5EYXA 1JUHA 4XF3A 1C8M1 1RUI3 1ZA4A 2R072 4Y24A 3M70A 2DCTA 4K21A 1W6MB 4RHV3 1WCKA 3OBTA 4QGMA 3WP6A 1QJY2 1HRI2 3VBFB 4ASLA 1PO11 5JAXA 1HX6A 4MXWA 4KL1A 4AQ2A 2IXCA 3JB4C 2CNAA 2WQ4A 3RDIA 1RUNA 4SBVA 1H8VA 1WW7A 4Y4YA 1NE6A 1DYKA 4FCAA 5D8AB 2ZGPA 4GB32 4FPCA 3MLJA 4Q4W2 2GNDA 4XEZA 2XH6A 1AJOA 1TQ5A 3ASIA 4HLTA 4D7TA 5I8YA 1LHVA 1YWKA 1CD3G 2BEOA 2B5HA 2B39A 3RMXA 3W9AA 1DQ6A 1C57A 3I2DA 4IV3A 3MW4A 3N7LA 4HN1A 4N9IA 3RJRA 2GH8A 1G9AA 3THTA 1RUOA 3AM2A 4M3CB 5JMCA 4YGDA 1PIV2 4EROA 2DFBA 3MIEA 4Q4Y2 1PNFA 3S6PA 4EWDA 2PHRA 3USUB 1YIFA 1HLCA 5KHIA 1FATA 1ONAA 4CDUB 2NQYA 4LBKA 4YW2A 1URXA 3HQXA 1YFUA 3AKPA 3V56A 4NWWA 1FI2A 3BTAA 3KB5A 3MICA 1JHNA 3M3EA 2A73B 3MI8A 4MYEA 4KH9A 3NKTA 4AEJA 1RMU2 1OQEA 1CAWB 2IWGB 4DOUA 2CL2A 4TLFA 4XFFA 5A3LA 2Z69A 2XJPA 5C9AB 3OD0A 4IXLA 3V0BB 1LOBA 2VMHA 2VGDA 5D8AA 5CFCC 2G9GA 1O4TA 2PLV1 1CPMA 2I2SA 2FMYA 1RUG2 2MEV2 5LRSA 3WG3A 4XJAA 1HRV1 1I9RA 5HCAA 3VDDC 5BNNC 3ENRA 5LEKA 4W6WA 4R52A 1PZ8A 1QH6A 4Y5Z0 1ENSA 1PVC1 1G86A 5BNOA 1A8MA 3H50A 1N3QA 1OLRA 3WQ7A 5KC5A 4CEYA 4LULA 4JTNA 3QBQA 1Q8QA 4IV1B 1AZDA 4F83A 1WW6A 1DQ5A 3H1YA 2O1QA 1H2LA 5DUUA 4F8AA 1QXPA 4PIYA 5I0RA 1JXNA 3SH5A 2GAUA 1UKGA 4OUMA 1HQLA 1YI9A 3RPQA 4URTA 1JBCA 3AMMA 5SV5A 1O4YA 2FBEA 3H3UA 4NHMA 3RQ0A 3WDWA 2DTYA 1B35A 2Y0IA 1VRH3 1UN1A 4IEPA 1CAWA 1CAXA 1WMEA 4KWLA 5J96B 3TWIA 4PBPA 1W6PA 4GMP3 4FQZA 2TBVA 3GBFA 2JG8B 1WBLA 1X36A 4N7IA 1R091 3ZMOA 2A75A 1QJX2 4YVWA 5HBAA 5BPXA 1FOD2 4X6QB 1ULEA 3FUQA 4CEWB 3N7JA 2P3KA 3AFKA 4XE9A 2ZGNA 4HFSA 2JD4A 1QMJA 2DVFA 3H1WA 4QPIA 5FLIA 1S0EA 2F4PA 1BVP1 5DDJ3 1OA2A 4Q4V1 4Q4X1 1FX5A 3DGTA 1J58A 2VNOA 3GZUC 2WWSA 1RUJ3 2WZR1 4H7LA 3LGRA 3B7MA 1RVF1 1LOFC 4MV2A 3MEPA 3B9CA 1VB4A 1ASJ1 5EYYA 4XIOA 1WUVA 3M3CA 5EXOA 2WSVA 4QQHA 1D2QA 3AB0A 1LHOA 2PHUA 4FP3A 1SLIA 3ZO0B 4FPGA 3SCHA 4XDQA 4CDWB 4AQTA 4LHKA 1WLWA 1PGW1 1ZZ8A 3JBG1 2PAKA 3ZYPA 2A7AA 4G9SB 1H1IA 1VAKA 3E5QA 2RMU3 1X8MA 3ATGA 3LOIA 2R1DA 1PGL2 2RS51 4IV1C 1XE7A 4FT8A 1LKNA 1RITA 2PN5A 2ZAHA 5J98B 1OQDA 4N43C 3WP3A 4LHNA 3T2TA 2D6LX 1WA4A 3VZMA 1ZRDA 1U5XA 3DUIA 1PIV3 1ND2B 3PVNA 4IEOA 3ZXFA 1U5IA 1PGSA 2YHJA 2VOXA 4K6BA 2QFEA 1MVEA 1RUC1 5DZGA 2XBO1 5JIUA 1W0PA 1ZYBA 2DF7A 1PK6A 4P9IA 3ZXAC 3ILRA 2R30A 4HN0A 5A33B 4EN6B 1AYM2 1ULGA 4LUKA 2D6OX 2HWE2 2KA3A 2ZZJA 1W6OB 1NCRB 3TOJA 3JBG3 4UW5A 4HPKB 3WHTA 2ZX2A 1XYNA 1AL23 5E89A 3ZFFC 4K20A 4I0AA 4J1XA 3MZHA 2LTNA 4CDXC 2RS53 3V0BA 1RTVA 3N7KA 3KQRA 1MZEA 2DCKA 1JOJA 4MUVA 4BLIA 2MNGA 4CDWA 4ITCA 4CEYB 2HWF3 4S2DA 1ND3B 4H14A 4MZUA 4DFSA 1TEIA 3IKWA 5CIRA 4E4ZA 2P3JA 1QNYA 4DY5A 2AZ5A 2VG9A 4LLFA 3WW3A 3QH7A 4FOWA 2FMDA 2A71A 1GNHA 2Q0AA 2XJRA 1GICA 2B45X 2PHTA 1ZVFA 2YY1A 2A6WA 4E4SA 2ZHLA 1VBA2 1RUI1 1BEV3 2C1FA 2E9QA 4YM3A 3BALA 1EYBA 5D1IA 1M06G 1QU0A 1OOPC 1MR5A 1LHUA 4BHPA 5JDBA 1RB8G 4AFDA 3NAPC 4P9LA 1AJKA 2PAMA 4QPGB 4CDWC 2DYCA 2NLRA 1H8TC 5K0UA 1C3HA 2H6BA 4AEDA 5IK7A 1ND2C 1ZNPA 1PK6B 3M8LA 4Q4X2 3THPA 4AYUA 4N53A 4GWNA 1CJPA 4XXAA 2RM23 3DPRB 2UWCA 1R082 3UJQA 1ND3C 1ZZ9A 3KS7A 3AMPA 3MFAA 3IM0A 2WNUA 2HWD2 4P9YA 3TAYA 3VBRB 3P3NA 3G6JB 5GKAC 2ZGKA 2D3SA 4D7YA 1G9BA 2WLQA 2JE9A 1I5ZA 1GKBA 3AMQA 2Z42A 4QXKA 2O8OA 2IXHA 5BXXA 3ZMNA 3GF6A 3ZFFB 3PLQA 4Y22B 1POV0 2Q30A 4NPRA 3M3IA 1HXS3 1LRHA 2XJSA 2XJTA 4XJ8A 3WINE 4P14A 4P9JA 1HXS2 5FPZA 3OD4A 4XQ4A 4BMEA 1J3PA 3R4UA 2XVKA 4I0WB 4MXVA 4OI0A 4M00A 1LULA 4OFGA 3WCSA 5HCFA 1PVC3 1XE8A 2R062 2ZJCA 4IETA 1Q8PA 2NMNA 3K48A 3IBMA 3LSDA 3WQ0A 1C4RA 1AR82 2RJKA 3DV8A 4GH4A 3I59B 1PZ9A 4CYDA 1SEFA 2P37A 3ELNA 2WS92 1KJLA 5FBZA 4BIFA 5FO9B