1UAIA

Crystal structure of the alginate lyase from corynebacterium sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyguluronate lyase
publication title Crystal structure of the alginate (poly alpha-l-guluronate) lyase from Corynebacterium sp. at 1.2 A resolution
pubmed doi rcsb
molecule tags Lyase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uaiA00
2DTWA 3PJQA 4YZ5A 1G7YA 1AJKA 1ZA4A 1MR5A 3I4IA 4AVSA 4Y1YA 1LOFC 2CWMA 4FOQA 4GKXA 4AGGA 2ZGKA 3B69A 2ZBJA 1SLIA 2JJ6A 4PF5A 5GZFA 1BQPA 1U0AA 1G9DA 2JE7A 1G86A 1GZWA 2A3YA 3VKMA 4AGRA 3M3CA 2VY0A 1D2SA 3WV6A 4R9CA 2P2KA 3MW3A 2WLQA 4XZPA 4YW1A 1VAVA 4RL7A 1GBGA 3APBA 3DUIA 1WW5A 2W39A 1V6IA 3DGTA 4YGBA 1MZ5A 1H9WA 3WG4A 4Y20A 4W65A 5JLVA 1N1YA 1LCLA 1GZWB 5GZEA 3AP4A 3IKWA 1QKQA 3WOGA 2D6KA 2E51A 1UL9A 3FLRA 1A78A 5FRAA 3AP7A 1SBDA 2P37A 3MEPA 5T55A 1V6KA 5CAZA 3CNAA 1KDKA 2P34A 4M00A 3WUDA 4U2AA 1GNHA 3ILFA 3WCRA 3OBRA 3OBTA 4U36A 4Y20B 5EYXA 3PVOA 4ASMB 4WVWA 4SLIA 5GLUA 1LOFA 5JOWA 3C2UA 4CZSA 2YXSA 3WVJA 4YM0A 1OQ1A 1QNWA 2GNMA 2D3SA 2VW2A 4K20A 5CBLA 5JOYA 1AXKA 1APNA 3UJQA 3FBYA 5E89A 2ZHLA 1UX6A 4GKYA 4DRVA 2NMOA 4XIKA 3GNEA 5IT6A 1G9CA 1UN1A 2NYYA 1JYCA 5E88A 2W68A 2ZGUA 4R9DA 5DZGA 3WHTA 3NV3A 3AXEA 1S0FA 3M3OA 1JN2P 1TEIA 2A5ZA 1JXNA 5F5QA 2DURA 3B01A 4DFSA 5JOZA 4NO4A 1N3PA 1OFSA 2DVAA 3W58A 2ES3A 2DVFA 1LU2A 1UZYA 3B00A 2NMNA 1LOGA 3FUQA 3KQRA 5CNAA 5T54A 1UKGA 4DS0A 2CY6A 1C1FA 2DVBA 2XG3A 3ASIA 3OYWA 2UURA 2D7FA 3WDTA 2VUAA 2ZGTA 4P9YA 4XE9A 3WDXA 4Y22A 3ZYPA 3WNXA 2E6VA 1SLLA 3AFKA 1YRZA 1GLHA 1DQ0A 1Q8OA 4Y1XA 5GLZA 2UU8A 2E7TA 3M3EA 5BYNA 1UMZA 3R4UA 1D0HA 3MW4A 4FOWA 4IQPA 3OYWB 1KQRA 2P3KA 1SLCA 2D6OX 1CESA 3ZSMA 4Y22B 5GALA 1HLCA 3RG0A 2E53A 2UWCA 3A4UA 1DGLA 5T52A 3R05A 4DRRA 1A3KA 1S0EA 2GNDA 2XB6C 2CWSA 3VKLA 2VW0A 3BODA 3V0BA 1LEMA 1QNYA 2PHRA 1ENSA 1ENQA 2GMEA 3D4KA 1DQ2A 4XJUA 1DBNA 4R9BA 1FV2A 1YXWA 1ULEA 2ERFA 5EWSA 3ILRA 1KITA 1LOBA 1JOJA 1IS3A 1N47A 5DUVA 2YV8A 1AZDA 1FX5A 5KXDA 3V0BB 1QMJA 1WW4A 2D6PA 3M2MA 2A6VA 5GLWA 3LCPA 4XBQA 1SBEA 5GZDA 5JVVA 3WDWA 4BLIA 1DIWA 3O12A 4YFZA 1IS4A 2LTNA 4Q8LA 1I3HA 3N7JA 2AREA 1PZ7A 4XJZA 2DV9A 1W6NA 4MYEA 1W6MA 1WBLA 2DTYA 3SH4A 1SLAA 2DWRA 3NV4A 2W08A 1NLSA 5T5LA 1DFQA 2GDFA 2JD4A 4P14A 5DXDA 1CJPA 3V64A 4YZ1A 2AYHA 4AYUA 4XILA 2R0FA 2WT0A 4D69A 3M3QA 4WVVA 5GLVA 4LBJA 4FPJA 1SACA 3PVEA 1W6NB 1ENRA 1SBFA 1W6MB 2D6NA 1PZ8A 2EXJA 2WT2A 1IKPA 1CN1A 4FOVA 2VU9A 1AX2A 2AGSA 1HDKA 2ZA9A 3V0AA 4PBPA 4YW2A 1W6QA 4PBOA 1FAYA 3AP9A 1HQLA 1WD4A 2ARBA 5CA6A 2DUPA 1LGCA 4YGCA 2ZGOA 4FPKA 1GYKA 4FOYA 2CYFA 2I2SA 4P9WA 4C1WA 3T1LA 3TAYA 2CTVA 3BTAA 1YI7A 2PHTA 4HL0A 3V0AB 3JUUA 3ZXLA 2A3WA 1W6QB 1A8DA 4XOGA 3AZYA 4RA0A 5GZCA 3H0OA 3D6EA 1JBCA 2D6MA 4YZ4A 2FHRA 3NV2A 1V00A 5DZEA 3WUCA 3AP6A 1MS3A 1N1VA 3FFZA 3USUA 2PHXA 4Y26A 1XQNA 4GWMA 1WBFA 1X50A 2WJSA 2YY1A 1SCSA 1Z78A 4YGDA 3VKFC 1QF3A 2EXIA 1DYPA 5EXOA 1GZCA 3FLPA 1Q8SA 3WHUA 1UPSA 3N7MA 2DVGA 4PQ9A 1N1SA 3ZPYA 5L73A 3AJYA 2VW1A 1BYHA 2EXKA 3MPPG 2CL2A 2YROA 3USUB 3POSA 1FV3A 2Z42A 4FP3A 1KJRA 2GALA 4GA9A 4XTPA 1B09A 3SITA 3SNMA 3PVNA 4XBLA 2DU1A 3UJOA 3T2TA 1WW6A 1LOEA 1JYIA 1UAIA 2HYKA 4XIOA 3LSEA 1WUVA 3T1MA 2ZGNA 2ZHKA 3PMEA 2P3IA 3I8TA 3LSDA 3O0VA 2GMPA 3POWA 4FPCA 2TEPA 4YZ2A 1CPMA 5T5OA 4YZ3A 2WSVA 3OY8A 1DZQA 1VAMA 2ZAAA 4Y1ZA 5H9QA 1C57A 1QU0A 2A6WA 3ZXKA 2SBAA 1QOSA 4M01A 2ZABA 4BMEA 1DQ1A 1LEDA 1N3QA 3SH3A 4UW4A 4FPYA 1LHNA 2P3JA 3O0WA 4LBOA 1VALA 3ZXJA 1G9FA 1CIWA 3WLUA 1S0JA 2ZGMA 3OY8B 3D5OA 4BM8A 5T5JA 4Q27A 2ZGQA 2V73A 1IS5A 3OJBA 5IK4A 2NM1A 1LHUA 1LGBA 2BQPA 1PZ9A 2WSUA 4Q1PA 2R16A 5F9TA 4ZXKA 1F5FA 2G4IA 1QDOA 4FP2A 3AZWA 1MACA 5JMCA 4GALA 1GSLA 4UW6A 1CVNA 2A71A 2GNTA 2R1DA 3ZSJA 2EXHA 3VUOA 4FPGA 4YM1A 2YMZA 4YW3A 1AVBA 1SFYA 1AXZA 1BZWA 1G9BA 1URXA 3AZVA 4XMAA 5E8AA 1SLBA 5GZGA 1AF9A 4YG0A 3AYCA 1LESA 4BPZA 1LENA 3ZSLA 2PELA 3AYEA 2D6LX 4CRQA 2D43A 4YW4A 3RS6A 1MZ6A 3R4SA 4XXAA 3SISA 1Q8PA 3QLQA 1F31A 1GKBA 4GXLA 1N1TA 1WLWA 1MS9A 2EALA 1Z0HA 4LBNA 1V6JA 5LK5A 2C5DA 4LBQD 2PHUA 2R0HA 3RRDA 2VH9A 5H9PA 1WD3A 4XBNA 1CR7A 1QOOA 3O0XA 1QOTA 1YIFA 4BQ1A 1V6NA 4TYSA 4Y1VA 4AVTA 4Q8KA 1MS5A 3O5SA 5AVAA 2JDZA 2AR6A 3IPVA 4NOTA 4XMIA 3N35A 2DYCA 5GJ6A 1H30A 2R1BA 5KXBA 5H9SA 1G9AA 3VV1A 1CQ9A 3N36A 5KXEA 1H9PA 1WCSA 1MS8A 2LALA 2AENA 1AX0A 1KJLA 1DQ4A 1GANA 1O4YA 1S0CA 2Q5TA 3WDVA 3WDYA 1N3OA 3IPVB 2A70A 3L2YA 3UL2A 1MS1A 5GM0A 3ZXFA 4ZKTB 1ONAA 3RMYA 1IS6A 3BOPA 1GNZA 1V6LA 4JRAA 4AGVA 1JHNA 4FQZA 5HCBA 2DVDA 4FPEA 1S0BA 2PHFA 1NXD1 5H9RA 2WQZC 1S0IA 2W52A 1LTEA 2ZMLA 3B3QE 4K1ZA 2JECA 2GMMA 2OW4A 4XDQA 1Q56A 2D44A 4M3CE 1DYKA 3ATGA 3OPZA 4M3CA 4XYXA 1LHVA 5DUWA 3VKOA 4K21A 3AX4A 5HCAA 5IK5A 1DQ6A 1I1EA 3RQ0A 5T5PA 1CPNA 1W0PA 3AYAA 1HKDA 2ZGRA 3HN1A 4Q26A 3NWKA 1BXHA 2FMDA 3M1HA 5IK8A 4I30A 4XJ9A 4CTEA 1IOAA 4M3CB 3ILNA 3POYA 4LBKA 4M3CF 4Z8BA 4L8QA 1LULA 2A3XA 1GICA 1AJOA 4ATEA 5T50A 2WNEA 1R1ZA 2WKKA 4LBQA 5DZFA 2R49A 2ZGLA 1ULCA 4XHXA 4FPOB 3AZXA 1GV9A 3AZZA 2ZGSA 4XJWA 2NZ9A 2ZHNA 1LHOA 3BIWE 3GALA 2B7YA 1W0OA 3HMYA 3MW2A 4GWNA 2E7QA 4H55A 1KRIA 1OKQA 2PHWA 4LBMA 3V65A 1C4RA 4R9AA 4XTMA 3KM5A 4LBQB 1HQWA 4Y24A 3NV1A 1MS0A 2D3PA 2DU0A 2GNBA 3B9CA 4KBBA 2JKBA 4P9XA 3IN9A 3AJZA 1DQ5A 1LOAA 1W6PA 3OGGA 5IK7A 2ZGPA 5EYYA 4HANA 2V5YA 3AK0A 4YGEA 4ATFA 2ARXA 3JU9A 1IKQA 1LHWA 4ITCA 3Q9OA 1UZZA 3VKNA 4F83A 2VXRA 2GN3A 1WW7A 1S0DA 4YFWA 1LJ7A 1S1AA 1W6PB 2OUJA 4BLJA 1O4ZA 1KDMA 1FATA 4BOWA 3AYDA 4FPLA 1BJQA 4K1YA 4UW5A 3N7KA 1WLCA 2AH2A 1G8WA 3HR9A 2ZHMA 2OUHA 2ZACA 1JUIA 3RMXA 3A0KA 1Q8VA 2NP0A 2AUYA 1RITA 3WZ1A 2OVUA 3AP5A 1YO8A 2C9AA 2GN7A 4Y1UA 2ENRA 3ZXEA 2H0BA 1ULGA 5KXCA 3ENRA 4XJ8A 1MS4A 4FPHA 2UWAA 2WT1A 2ZKNA 3TB0A 3INAA 1F9KA 2A75A 2A6XA 1ZM1A 1Q8QA 5FREA 4TZDA 1LGNA 3WG2A 1FNYA 3ZSKA 1LODA 3WCSA 2KM2A 3IMNA 3A0NA 4JCKA 1W6OA 5JDBA 2EIGA 2ZMNA 1S0GA 2JE9A 3N7LA 5IUQA 5CB7A 5GLTA 4YM2A 4YM3A 4Q1RA 4FPFA 1V6OA 5DG2A 5SV8A 1VLNA 5DUUA 4YG3A 3ZVXA 3SH5A 1QDCA 5DG1A 2ZZJA 3QCWA 4WZFA 1W6OB 4FQ4A 4XXPA 4OZXA 3WG1A 4XJAA 4AVVA 3UK9A 4PCRA 4WV8A 4DQAA 2A6YA 1QGLA 1WLDA 4JC1A 4DPNA 1C1LA 1FYUA 2A6ZA 1RIRA 4Q2FA 1ULDA 2D3RA 2EF6A 3RSJA 2EAKA 3WG3A 1FNZA 1J1TA 2UWBA 3ZYRA 4AWDA 2SLIA 3U4XA 2CNAA 1DLLA 1ULFA 3SLIA 1LECA 4FVVA 1YYNA 2DUQA 4YG6A 4YW5A 1AXYA 4UW3A 4C1XA 3AXDA 1EPWA 1SCRA 5DUXA 2A7AA 1BKZA 1DHKB 1MVQA 4YLZA 1LOCA 4XHBA 1CONA 2DUOA 3FLTA 1Y7BA 2YZ4A 1RINA 1SLTA 1MVEA 2ZMKA 5JOXA 3W59A 2RHPA 4ISQA 1LU1A 1VIWB 4ISRA 3IM0A 5HCFA 3N3HA 3WDUA 1V6MA 3FUOA 1AX1A 4LBLA 1JW6A 1GZ9A 4BMBA 2NN8A
chains in the Genus database with same CATH superfamily
1VBA3 2EIEA 1ZA4A 3JD71 1UY2A 1OBNA 2CAVA 2JG8A 2WS91 3JZVA 4N9HA 4AGGA 4AVSA 4OHWA 2XH6A 2GAUA 4NHLA 2ZBJA 5FP3A 1JZ6A 1IG0A 1QJX2 4D7TA 3EJKA 1BQPA 4NMIA 4XFBA 1J3QA 3ZO0B 3O14A 1GZWA 2A3YA 3VKMA 4HK9A 1G9DA 1QJX3 3M3CA 4LKEA 4EWEA 1SPPA 4R9CA 1C3HA 1GOHA 1W06A 3MW3A 4XZPA 2JG8B 1W2NA 2VJXA 3DUIA 4BHPA 2WL1A 4QGLA 2OZJA 1H9WA 1AHSA 4Y20A 1WLTA 3RZZA 3C3VA 4M0HA 1N1YA 2YU2A 1PMJX 3E5QA 4UBHA 2ZJCA 1GZWB 5IVVA 3IKWA 1QKQA 5FZHA 1SPPB 1UL9A 5FRAA 1AR81 1SBDA 2UY9A 3B5LB 3H7JA 2PXJA 2Z69A 3CNAA 4COVA 2JIJA 3RZGA 3NL1A 1CX1A 3FC0A 4IEUA 2ADEA 3I2OA 3OBRA 3OBTA 4U36A 4P9JA 4Y20B 2ZX2A 5TSWA 4ASMB 1CWPA 1RUE1 4JDNA 4LLOA 5KHHA 3HD8B 3J4UH 5F7UA 1ND3C 3C2UA 4CZSA 4D94A 5J7MA 2BEOA 4XW3A 4YM0A 5FY9A 1X33A 4NIAA 3VL8A 2GNMA 3LD8A 2D3SA 4K20A 1AXKA 5A3OA 2JDAA 3U78A 4WM7C 1DZTA 1W8NA 2X53S 3AVRA 4MGKE 4Y5Z0 3WQ7A 2NYYA 3LE0A 1E5SA 3S57A 3O1UA 4MGYE 1DGWA 3NV3A 3ZYHA 3AXEA 3M8LA 1S2KA 2W87A 1MQTC 4GWIA 4BXFA 4DFSA 3S5QA 5LY2A 4KWKA 5JOZA 2R072 4NO4A 1U5ZA 2ATFA 3RYRA 3W58A 2DVFA 1LU2A 5I0RA 2I74A 3P6BA 1SQ4A 1UKGA 1DGRN 4AI2A 3ES4A 5FY4A 2R073 5FXVA 1C1FA 3OYWA 4GB31 5JIUA 2H6CA 1DF0A 2VUAA 2VOXA 4Y22A 3WNXA 1SLLA 4PDWC 4Z82A 3H3UA 3LQCA 4IW3A 2ZPXA 5B4NA 1ND3A 1Q8OA 2GH2A 2WBKA 4RFT0 3N9PA 5GLZA 4ZHNA 2RJLA 1UX7A 5BYNA 2Y33A 1R093 1WCUA 1V9U1 4Q0PA 3BI3A 1D2QA 4IQPA 3RZJA 4WM7A 3OYWB 1CZSA 3ZSMA 1QQP2 2J1VA 4Y22B 1HLCA 4QU1A 5GALA 3A4UA 1DGLA 1UOFA 1A3KA 2O8OA 3ECQA 1ND3B 2Y0OA 4JKKA 4NAMA 2CWSA 4CEYC 2BU9A 1LEMA 4XF0A 1ENQA 1MQTA 1VB2A 4OI0A 1DQ2A 4XJUA 4WM7B 2Y60A 2ET1A 4SBVA 1XYNA 2XJPA 3F2ZA 4XFHA 5EWSA 3ROUA 4AFMA 1WCQA 1LOBA 1JOJA 1N47A 1WKYA 5FY8A 1AR72 3TEXA 5KXDA 1UKRA 5CFDC 2DCTA 3OUHA 3WQ0A 1MQTB 1W2AX 3KWVA 1WW4A 4DUXA 3M2MA 1POV3 3LCPA 2IXCA 4IE6A 4PDWA 4MOAA 4BLIA 1DIWA 3GZEA 4RR3C 1IS4A 2GC3A 4YFZA 1PIV2 3N7JA 1C5HA 1PZ7A 1W04A 2BJSA 4XJZA 2DV9A 4QD2A 4ZXEA 4MYEA 4FXGB 4XEZA 1PO22 2JIGA 2W94A 3IT8A 1X8MA 4LQRA 2JDYA 4P14A 5FZAA 4DZGA 3W5MA 4PDWB 4QQLA 4WM8C 1PO23 2P17A 5FZLA 4XILA 4B1LA 4A3XA 1TMF3 4LBJA 1ZBA1 1PO11 2V72A 1M4WA 3SC7X 5KHJA 4XVHA 2D6NA 1REFA 1SBFA 3LOIA 1BVP1 4AFDA 1PZ8A 4LE4A 1IKPA 1CN1A 5JSPA 5FLJA 3KB5A 4UOJA 5DMYA 1YHFA 2ZA9A 4PBPA 4GMP1 1FAYA 4ES8A 5IYYA 5FR3A 1HQLA 1WD4A 3DN7A 2C24A 4MXVA 5CFDA 3GM8A 1VBD1 1OOPC 4YGCA 3SEPA 5B2GB 1D0GA 5CYYA 5IVJA 1GYKA 2ZAHA 1Q5OA 2I2SA 1FXZA 2CTVA 1GQHA 4RR3A 3WF4A 5CU1A 1I5PA 5FYZA 3I2FA 3VZKA 1L7QA 5GZCA 4GWJA 3VBSC 5CFDB 1D4M1 5DZEA 4QMAA 1UU4A 2XUEA 4WM8A 3USUA 3SQOA 3MICA 1XQNA 2RS33 4RR3B 5FWEA 1X50A 2WJSA 2YY1A 1XE0A 2G9ZA 1XE8A 5ACA1 1AR92 2GSYA 1HRI2 4IE7A 4KGGA 4PQ9A 5IJRA 3ZPYA 4AE2A 5A70A 4NPRA 5L73A 1AR93 2B42B 4AI9A 2VW1A 5K0UC 5LK7B 1BYHA 3HBKA 1UU6A 4WM8B 3USUB 2IFWA 5FUPA 4AI0A 4XQWA 4CA9A 4D7YA 5FYUA 2BUKA 3BCWA 4FP3A 2VNOA 4GZ9A 3S7IA 3SITA 1XJAA 3POFA 1W8WA 4Q0VA 4E27A 2VOTA 3ZYGA 2DU1A 3MUY1 1F35A 5AC93 2HYKA 2UY8A 4META 1DGRA 3MIDA 2WZEA 1FOD2 5DDJ1 2Q8DA 4WBBA 4OI1A 3T1MA 4Q4W2 4KL1A 3I8TA 1EAH3 3LSDA 3O0VA 4FPCA 5BNOC 3KCYA 4YZ2A 1FOD3 4RQPC 2B46X 1RUH2 5JSRA 1DZQA 3LB9A 4Y1ZA 2A1XA 1C57A 1DGWX 1RUH3 3ZXKA 1PNFA 1QOSA 4M01A 2ZABA 4BMEA 1ZRCA 1QEXA 2BNNA 3BOWA 4BWOA 4FPYA 2P3JA 3O0WA 1DP0A 5K0UA 1CIWA 3WLUA 1S0JA 4LK7A 4ASLA 2OX0A 3D5OA 3O1SA 5IK4A 4HXCA 2NM1A 1EUUA 1ND2A 3VD5A 1PZ9A 2WSUA 3HNBM 1QWRA 2Q8EA 1UYYA 2WNVC 5FYCA 5K0UB 4FP2A 2WNUA 4YW7A 5JMCA 1O5UA 3PL0A 4CU7A 1R091 4X6RB 4OVEA 3ZSJA 5A1FA 4B3NA 5C8CC 5BNOA 2EXHA 4FPGA 3J8F2 1ND2B 4RQPA 1U12A 5KBFA 1BZWA 3UGFA 1G9BA 1URXA 2VR4A 2OPKA 4XMAA 4QX0A 3J8F3 3KT4A 4NAOA 4FTBA 4O9EA 2HWB1 2WNUB 4BPZA 5BY5A 1BK0A 2PELA 2VBPA 5HV4A 2HWC1 2YBKA 3R4SA 4BZ4A 5BV6A 2QCSB 3GCXA 5BNOB 3OGRA 4KU7A 3W21A 4RQPB 1X9TA 5DPNA 1Z0HA 4LBNA 2TNFA 1UO9A 4GMP0 4YW6A 5CIRA 4LBQD 4MO3M 3RZKA 2AC1A 3N4MA 1ZBE3 4NVPA 3RRDA 1ASJ2 1NQJA 3A23A 4XBNA 1COV3 3GHNA 5AVPA 2EAAA 1QOTA 1DYOA 1V6NA 2XL9A 2DCKA 2IXLA 1ASJ3 2Y6GA 4INDA 4Y1VA 3O5SA 4AK3A 5AVAA 4OI4A 4GIQA 2WNVA 4QGNA 3GCWA 2QQUA 4NOTA 4O9GA 3N35A 5K9YA 5GJ6A 1H30A 1VMJA 1W9SA 2R1BA 5KXBA 3TOJA 2WN3A 5C8CA 3EMRA 1MS8A 4DXTA 1QJEA 1KJLA 4BCUA 1GANA 1O4YA 1S0CA 3WDYA 5J36A 2A70A 2WNVB 1PVC1 1HJFA 1TMF1 4I3GA 3RZMA 1HXS2 5EPAA 1QJU1 3SCFA 4YPJA 4ZKTB 3CJXA 5J98B 1SDDB 3VBUC 4JHTA 3VDAA 5C8CB 4JRAA 1HXS3 2JDNA 2OA2A 4PIYA 4IGQA 2TBVA 2DVDA 4QGMA 5HCBA 1S0BA 5IVYA 1GU3A 3T2PA 5FWJA 3T0DA 3POIA 2JWPA 1Y9MA 5A6QA 2BV4A 2VPVA 1LTEA 5F2WA 3AMNA 2JECA 2Q1MA 1OA2A 2VMIA 3HNYM 3RJ2X 4LIVA 2JDMA 4QX1A 3DV8A 4TZDA 1PMHX 2LRPA 4M3CA 4XYXA 1LHVA 2VNGA 4K21A 3AX4A 5JXGA 5FZKA 1CPNA 1W0PA 3HN1A 5DAVA 3NWKA 4RN5A 2FMDA 1CZTA 2XVGA 4LO8A 1H0BA 4CTEA 3TBDA 2YYOA 4M3CB 4LHKA 4UFJA 4LBKA 5G05L 4M3CF 1OLQA 5HI0A 1OD5A 1RUI1 3D8CA 4L9BA 2XLAA 1O8PA 4ATEA 2RS31 4L99A 4QKFA 2PN5A 2WKKA 2D98A 4XUNA 1W05A 2VZ3A 5A7PA 2ZGLA 3H1MA 1P8JA 1GV9A 3JB4C 2ZGSA 1WA4A 5F39A 4I2OA 2VNRA 2ZHNA 3GALA 3VD7A 2B7YA 1XSRA 4CDWC 2C0ZA 3H8XA 2VULA 3WF1A 1ZZ7A 2EA7A 2VXJA 3NV1A 5KHGA 3NJVA 2R062 3KCXA 4KBBA 4QX8A 2JKBA 5C4WC 3IN9A 4J25A 3PUAA 5CADA 3OD0A 3P3NA 1DQ5A 1LOAA 3K3NA 1W6PA 2P5BA 1EPZA 2P4EA 1KEXA 2R063 3LA3A 3ZYJB 5EYYA 1AR61 4XPVA 1H4HA 1YFYA 4DUWA 1H2LA 2QQVA 1S2BA 2RDQA 3DCQA 4G4FA 4OUSA 4K7JA 1IKQA 1EAH1 1LHWA 3IDCB 3Q9OA 5JAXA 3TN92 4XFFA 2GN3A 1WW7A 1RUC1 4QPGC 3T08A 1W6PB 2OUJA 3TRSB 4BLJA 1O4ZA 3ORJA 1VJ2A 1KDMA 5ANNA 2GC1A 3AYDA 4BOWA 4EV0A 5J96B 3DYOA 4UW5A 1RUF3 4UFMA 5F5CA 1WLCA 1QJY1 4HPKA 4PLOA 2PLV1 4QXCA 4AR2A 4EN6B 4Z1VA 1VBE2 3P3PA 2VNVA 4LT5A 1L7RA 4QPIC 1G8WA 5G04L 4O61A 3RPQA 4CDWA 3CO2A 2ZHMA 2OUHA 3OUIA 1RUG2 1JZ4A 2DDUA 3NNJA 2VTFA 3A0KA 5C4WA 3AP5A 4HPKB 1RUG3 2GN7A 3AKTA 5FMBA 4QXKA 4A42A 2X5IC 2HEYF 2CAUA 3ZXEA 1ULGA 3QH7A 4XETA 4E4SA 4CDWB 1BBT2 4XABA 5EQUA 3INAA 4IDZA 2VCMA 3QACA 2WZ8A 3VBRA 2WABA 2WZR2 3SKJE 2LW8A 2XWBB 3IMNA 2YBSA 5C4WB 2BPA2 4JCKA 5A6YA 2ARAA 3UKVA 1YEWA 3N7LA 3ZDSA 3VZJA 2WN2A 2E9QA 2RMU2 5J1XA 4YM2A 3G7DA 3OSDA 3KV5A 2PHLA 1HRV2 2ZS6B 4FPFA 4Q1RA 5FP8A 1H6YA 4XACA 5A7NA 2RMU3 1VLNA 3CEWA 5EJ1B 1IPKA 3VBRB 2VGDA 3SH5A 5DG1A 2HWF2 4BK4A 1R082 2J1EA 2F4PA 4FQ4A 4OZXA 1W03A 4IL7A 4AVVA 3H8RA 3AMQA 4WV8A 3LEGA 3UK9A 2HWF3 2HEWF 1R083 3HQUA 2IFRA 1VE0A 1RIRA 1COV1 4HKLA 4RGGA 2B39A 2J1TA 1ACCA 4RS5C 2QZ2A 5BNQA 2X5IA 4Y5TA 3WD5A 4XZUG 2EAKA 4W50A 3WG3A 4RFRB 1PGW1 2VVEA 4LK6A 4AQTA 2ZEZA 1F8VA 4D3WA 5IVEA 3WINE 3T30A 4ZU7A 1UD1A 4FVVA 1NZCA 1RVF2 4YG6A 1US2A 1O6UA 3OB8A 4UW3A 3AXDA 5DUXA 1X36A 3DXUA 2X5IB 5JUVA 1MVQA 1BKZA 1DHKB 3BPZA 1E5IA 2B9UA 4EN9B 1CONA 2DUOA 3JD72 2WS92 2YZ4A 2YFZA 4I0BA 2QKDA 3JD73 2WS93 1STMA 2RHPA 3W59A 4CP1A 1VIWB 5HCFA 2QQNA 5IHRA 2XONA 3N3HA 3PURA 4OLLA 2FBEA 4Y4YA 1UF2C 3FUOA 2NLRA 4HN0A 1GZ9A 5D2AA 3WW4A 4CYDA 3I2IA 1UU5A 4E9KA 3BYWA 2Y0IA 5FYTA 1XYOA 1KGYA 4FOQA 2XL7A 1W9WA 1LRHA 2FMYA 2JJ6A 5LZ6A 4RS5A 1MZFA 3ELNA 1GOFA 1LKNA 2IVIB 2XJQA 2XQXA 3LFMA 2C26A 4TLGA 5LATA 3UNPA 1D2SA 3CL1A 2JDUA 1ODMA 2P3YA 2XBO1 2P2KA 3NNLA 2WLQA 1AR82 3HQRA 3MF6A 2Y6HA 4LJHA 4YW1A 1VAVA 5CG9A 3ACFA 2BVVA 4D8MA 3KF5A 3OD4A 2PTMA 2W39A 4Q0UA 4C90A 5AFBA 1MZ5A 1AR83 4RS5B 4XDPA 3WG4A 1U5YA 3U14A 5I91A 1RUE2 4FTSA 2WR9A 4P9IA 2VVDA 4TXWA 3WEZA 3VZLA 1A78A 1RUE3 1UYZA 3E5UA 3ME2A 3PJYA 2W46A 3MV01 4S2HA 1V6KA 4AVAA 4M00A 3WUDA 3I7DA 4U2AA 5FYIA 4ZS3A 1XU2A 3VDDA 5EYXA 3PVOA 4WVWA 5GLUA 3UGGA 4R4ZA 2YXSA 1O7FA 3FZ3A 1OQ1A 5JOYA 4CCJA 3D82A 4H3WA 4DIQA 1UX6A 3OTFA 4DRVA 3CLPA 4X8NA 4XIKA 3VDDB 1OF3A 5C5UA 4QM9A 5EV7A 5JXIA 4WVMA 2ZX4A 4LOSA 1CZVA 1UN1A 1J58A 5FAXA 4COWA 4UFIA 1W8OA 3WHTA 4B8EA 1C8M3 1S0FA 4GB32 5FP4A 2XOMA 3ZMNA 1ULPA 4YSFA 3B01A 4QX7A 2Z5WA 2X29A 3CZJA 5FPVA 2E7AA 4FFIA 4WVMB 1OFSA 1W99A 2XHKA 1UZYA 3B00A 5T54A 2NMNA 1LOGA 3FUQA 4RHV3 1WCDJ 5JR2A 3OG2A 1V9U2 3KV6A 4UI9L 2UURA 3WDTA 4BK5A 2ZGTA 4P9YA 4YNIA 1V9U3 3AFKA 1GLHA 4Y1XA 5JPMB 3DYMA 1OHFA 4JTNA 3NNMA 1XB9A 4Q4V1 4QAWA 1WCKA 4CCNA 3ZXGA 1ALYA 1O3QA 2W1SA 5JI7A 1UMZA 1LR5A 1D0HA 4CVUA 4QPYA 2ARCA 4HMZA 4FOWA 4I01A 3I3EA 5LBFA 5LA9A 2P3KA 2PHDA 1SLCA 1VMFA 1QXRA 2CHHA 4DRRA 4QQPA 2E53A 2HJIA 2UWCA 5T52A 2GNDA 1H1MA 2VW0A 4L0PA 3VKLA 3V0BA 5A33A 5A32A 1QNYA 1XBFA 2XJRA 2GMEA 4WVZA 5FBZA 4OQ8A 4H7MA 3D4KA 4I02A 1DBNA 3POEA 3AKSA 3FL7A 4R9BA 3MO4A 4V2VA 3ZIXA 5J09A 1NG0A 4A6OA 1IS3A 2YV8A 4K3UA 1FX5A 1IQDC 1C28A 5A33B 4N43C 5A32B 5FYYA 3V0BB 4A7ZA 1AL21 2FCVA 5FZDA 2D6PA 1KFXL 5FZGA 5LBCA 2A6VA 3UGHA 1Z7S1 5F5AA 5GZDA 3RZHA 3CF6E 4QU2A 1OUSA 2X05A 3FE5A 1PO12 4QDQA 1W8ZA 5F3CA 1JYWA 1W6NA 3BTXA 1WMEA 1W39A 1ZBA3 1PO13 2JB4A 1AUYA 1SLAA 3WNNA 2XLGA 2PMWB 1RHI1 4FAHA 4AYUA 1NYWA 2WT0A 4MV2A 5FPZA 4WVVA 5FPAA 5GLVA 5IFTA 1H2KA 1VBD2 3PVEA 2G1MA 4GMP3 4ZU4A 4JHZA 1MEC3 1W6NB 1ENRA 4JTOA 2AZ5A 2WT2A 3IMMA 1VBD3 2VZSA 1AX2A 4JDMA 3V0AA 1DDLA 5DAXA 4YW2A 4PBOA 2ADDA 4J1WA 3CZUA 2ILMA 2G19A 5BXXA 2GZWA 2DUPA 4N43A 2YBPA 5CA6A 4P5YA 1D4M2 1TG7A 2RS51 3H8UA 4NIHA 1K45A 4E4HA 3RNSA 4FOYA 2DBNA 2CYFA 4B1MA 3T1LA 1D4M3 4N7IA 3TAYA 1GWLA 3JB8A 2PHTA 1JZ3A 2BW8A 3V0AB 1W2TA 2BBVA 3KGZA 2WO3A 4A3ZA 4IEXA 5CZKA 4NR1A 2TUNA 2FDHA 3H1YA 4N43B 1JBCA 2DFBA 5ACA3 2FHRA 4PQQA 2YPJA 1W9TA 1MS3A 1N1VA 2VZUA 3FFZA 2E32A 2W47A 1VAKA 3MGUA 5KR7A 3I3BA 4QHOA 1SCSA 2IXJA 4Z2WA 4J1XA 1EY2A 1T6GC 2VZ1A 2EXIA 2Q30A 4R4XA 5L9RA 2E31A 5EXOA 1JI6A 3N7MA 1F2NA 1N1SA 2VUJA 4FXKB 3VBFA 3L9JT 2QTWB 4CP0A 4A7YA 4H2AA 5DDJ2 3UV9A 3N9OA 4UFLA 2JEMA 2GALA 5D21A 5DDJ3 3I49A 3NW4A 4HK8A 2HLEA 4QHBA 4BQ4A 1VRH1 4XBLA 4BDVB 3THPA 3UJOA 3T2TA 1WW6A 4CU9A 3VBFB 2N7GA 1NA1A 1UAIA 5FDBA 3WSOA 4Q29A 1ZA7A 1WUVA 2ZHKA 1WMDA 2WFPA 4KWJA 4NUBA 2P3IA 3UESA 4F8AA 3KT1A 2ZXQA 3K48A 5T5OA 4YZ3A 3BUCA 1VP6A 2FDGA 2W5FA 3OY8A 1VAMA 4NWWA 5H9QA 1NA1B 1QU0A 2QQKA 1C8M1 2SBAA 4BU2A 5CKQA 1N3QA 3A22A 3HNMA 3ZIWA 4XFGA 1H2NA 1LHNA 1POQA 3IDAA 5KC5A 1VALA 4JVAA 5L9BA 3ZXJA 3ZR5A 3LDKA 2Z4FA 3K51A 4AFCA 2GU9A 3I2JA 4K8FA 3TEZA 1O3TA 3DF0A 2OS2A 4AFAA 3OY8B 1PMIA 4RHV1 2Y64A 1R092 2ZOEB 4R52A 2V73A 1IS5A 4FSJA 4LUKA 4IETA 1PGSA 1LGBA 2XJUA 4Q1PA 4XC9A 4ZXKA 3O1MA 4DO0A 4HONA 1SZBA 3UT0A 4D0QA 4HKWA 1QDOA 2HWB2 2VQTA 4GD4A 5I8YA 5IFPA 4H14A 4PIZA 4UW6A 1CVNA 1UIKA 2BZDA 2A71A 3SXWA 1YFXA 1W0NA 2HWB3 2VTXA 3HT2A 2VE1A 3PLQA 4L92A 4YWAA 4YM1A 5I0UA 2HWC3 2V09A 1JZ8A 2RR11 5IVFA 1AXZA 5FV3A 1GUIA 1UYPA 1BEV3 1UOJA 3TEYA 5GZGA 3KVBA 1UPIA 4JGYC 5BPXA 4AEDC 1LESA 1E5HA 1OC1A 5FKBA 2F6BA 4HVQA 3AYEA 1ZRFA 3GF6A 4YW4A 1MZ6A 4Q4X3 2ZX3A 3QLQA 4L2NA 5FZ3A 1GKBA 3ZXAC 4FCAA 1HV0A 2QBXA 1V6JA 1Y9QA 3RI9A 4AHWA 2C5DA 3IDEA 1RJ8A 4MH0E 2PHUA 2R0HA 2VQUA 2VH9A 1IZ3A 1WD3A 2WA4A 1QOOA 4QKBA 1YIFA 3MFCA 1GR3A 4BQ1A 3ACGA 2QQLA 3OPTA 4TYSA 4ZY9A 2QFEA 2XJVA 2OKXA 1B35A 4AVTA 1MS5A 3IPVA 4CCKA 1SDWA 1PVC2 3KHBA 1QXJA 1TMF2 2RM21 2HWE1 1QXPA 1XSQA 2BVBA 2K2SA 2B8MA 2MNGA 3LIHA 4JKMA 4N9IA 3OGVA 1PVC3 5FO9B 1CQ9A 2QDRA 1QJU3 1PX3A 1H9PA 2J42A 5FUNA 3VZOA 5L7OA 1KS5A 2AENA 1AX0A 3ZFGC 1O4TA 1UIJA 1B35B 1D4VB 2VZTA 1N3OA 5F3GA 3IPVB 2C1FA 3BTYA 4JGYA 4DMIA 4AEDA 4YVWC 3VHOA 3AC0A 3S6PA 3RMYA 5FZFA 3LGRA 1MEC1 1NY71 3NMBA 4A4AA 1UY0A 1JHNA 1Y9GA 2J1SA 3ITQA 4FQZA 4P08A 4FPEA 2VMFA 5FPBA 2PHFA 4DY5A 5L7OB 1NXD1 2WQZC 1RUD1 4E2GA 2CGNA 3HQXA 3HOBA 5A3WA 2ZMLA 1JTZX 1YC61 2AEZA 4H7LA 4I09A 4JGYB 5C3RA 3T2QA 4XDQA 1JU3A 3T4VA 4AEDB 4CUAA 3ATGA 5DUWA 3ACHA 5IK5A 4XUQA 1DQ6A 2GP3A 1RUI2 2VD7A 5T5PA 5J3UA 1HKDA 2VAUA 2RS32 1BXHA 5CFCC 2IWGB 1RUI3 4XJ9A 1JOBA 2WINB 1ST8A 3WY6A 4HVOA 4LUMA 4QB6A 2BTVC 1IOAA 3B93A 4LO4B 2W2IA 2VM9A 1ULOA 3ZFGA 1AL0G 3VHRA 4L8QA 2QE3A 5F3IA 3U11A 4BISA 2WQ4A 2A3XA 3VGIA 1MZEA 4MGIE 5T50A 2IXIA 4LBQA 4YVWA 3T0AA 5F3EA 4MGSA 4COUA 5HPOA 3Q8CA 4FPOB 1ZNPA 2QQMA 3AZZA 2WFF3 1ND2C 2F17A 1SHWB 2W1WA 3ZFGB 5T3NA 5AC92 1AR62 1OKQA 4B7EA 2PHWA 3J7LA 5FLHA 4OHXA 2RDNA 3KM5A 1H6XA 3FMGA 4LBQB 1EAH2 2WNUC 1AR63 2XKPA 4YVWB 5FPXA 1J59A 1MS0A 2DU0A 1RUC2 1OD3A 3AJZA 3OGGA 3J7HA 2ZGPA 5IK7A 1A6CA 3MF9A 3SCGA 1EV11 2Z79A 1YQ6A 1RUC3 5CFCA 4HANA 3C7FA 2V5YA 3AK0A 4YGEA 1QJY2 2FQPA 1H4GA 3A21A 2PLV2 4MVTA 2Y26A 1QJY3 4QKNA 2PLV3 4YFWA 4PHZA 1XNDA 1JUHA 4KG8A 3MPBA 5CFCB 2KA3A 1K3IA 3U07A 1NLRA 1BJQA 3C7OA 2LM3A 2AH2A 3TNQA 5IATA 4XFIA 2Y8KA 4QDSA 1I5ZA 1JUIA 2BFUS 3RMXA 3EHKA 2NP0A 3KT7A 2OVUA 5FMOS 4Y1UA 2ENRA 2H0BA 3ZN5A 3E5XA 3KHCA 5FY5A 3IB3A 2BFUL 2BRTA 3ENRA 1MS4A 3LEIA 4XJ8A 3ZN4A 4MGZE 3WX5A 2WT1A 2EIDA 1GQGA 2ZKNA 3GZUC 5FMOL 2A75A 4EN8B 2A6XA 2OXBA 2O1QA 3ZSKA 3WCSA 2KM2A 3LDRA 1RTVA 1BEV1 1W6OA 2E33A 3FHAA 1YI9A 3T09A 3TWIA 5JDBA 3E1F1 2ZMNA 3BU0A 1ZBE2 5IUQA 5GLTA 5FZ0A 3VHPA 3EXUA 5C33A 1COV2 1ENXA 1UZVA 2CGPA 1RYYA 1ZRRA 3VLBB 4Q4X1 2BGCA 1V6OA 2JICA 3RWKX 2VMGA 5FZ4A 5DUUA 3HAGA 4QQHA 3ZVXA 1QDCA 5ABJA 1H1IA 5FBJA 1PGW2 1W6OB 3WP5A 1PGL1 4ARXA 4BQXA 3C7HA 1MPXA 4PCRA 2A6YA 2VOVA 1QGLA 1WLDA 4XF3A 4AXOA 4CDUA 4DXZA 5JXJA 1C1LA 2A6ZA 4LKFA 4CPBD 4KI5M 2BNOA 4W6XA 1HX6A 5F6KA 1ULDA 2JD9A 2EF6A 2WLPA 5ABJB 3JBG1 4XCBA 1J1TA 3ZYRA 1EYBA 1SG3A 2R6QA 4MZUA 3U4XA 3VDCA 4AVCA 2CNAA 3O1PA 1JH5A 4CDUB 1DLLA 1TE1B 5B4XA 3ZLIA 2GP5A 1YYNA 4L11A 3ETPA 4YW5A 4BQYA 1PK6C 1AXYA 5KC6A 5LEJA 4OULA 4UF0A 3UYJA 2A7AA 2IC1A 2PA7A 4MUVA 4XHBA 3W9AA 3M70A 2PFWA 4MLOA 1DG6A 5J37A 5FPUA 1SLTA 2YB7A 3AKRA 1MVEA 1PIV1 2X8KA 1ZZBA 1GP5A 4LEJA 3WDUA 1V6MA 3AL6A 4UF0B 2VZQA 1AX1A 2VXRA 1JW6A 2R7EB 2XGXA 4LBLA 5FLIA 5LRSA 2NN8A 2XBO2 2DTWA 3H50A 1AJKA 3H8OA 4Y1YA 1LOFC 2OPWA 4GKXA 2VOKA 2ZGKA 4A44A 2XBO3 3B69A 1SLIA 3TEWA 4K8RB 3K77A 2RS13 1CAXA 5GZFA 4AGRA 1KS4A 3RGBA 5HCHA 3VL9A 5FP9A 3PNAA 1RMU1 3WV6A 3LPFA 5FTTC 3ZSEA 2FDJA 3IAQA 1GBGA 1WW5A 3FX3A 1PK6A 4BXSV 1V6IA 2VG9A 1YUDA 2VZVA 3DGTA 4YGBA 3S30A 3SEEA 2NQYA 2VTXJ 3VD9A 2B5HA 1BLZA 1CAXB 1HB3A 1UCXA 5EIYB 1CGPA 3R4DB 4XQ4A 2BBAA 3ACIA 1LCLA 5A1LA 2FDKA 2RVAA 3THDA 3WOGA 5FZEA 3IBMA 3WNKA 2D6KA 3FLRA 3WW1A 2WUHA 2WFF1 2P37A 3MEPA 3HJRA 2C6SA 3FJSA 1PK6B 4QHZA 4CDQC 5A1AA 5CAZA 2P34A 4GULA 1X7NA 3ILFA 4CE8A 1W8HA 2KD7A 3MI8A 4CU8A 1J84A 1F15A 1GWKA 4EQVA 1LOFA 1RUJ1 5JOWA 2JDHA 3FWEA 3NJZA 4CCLA 3HEIA 3WVJA 3VBRC 3O1TA 1NCQA 3ZR6A 1QNWA 2VW2A 3B02A 1W28A 4ZS2A 1APNA 1OVPA 3UJQA 2WO1A 3I3DA 1K5JA 5E89A 4GKYA 1GMMA 3H1WA 1ZRDA 1RUF2 1XNBA 1G9CA 3NKGA 1JYCA 3AKQA 4Q4Y3 5E88A 4B29A 5DZGA 5C3PA 5BNNC 1NCQB 3PMSA 2A5ZA 1TZOA 2X10A 2WWUA 1JXNA 3B9IA 1NUKA 4TLFA 4RGKA 2B45X 2HWD1 4XAAA 2ZCWA 4X6QB 5C3OA 4ZZ8A 2WA3A 4Q4V2 4MG2A 3BVCA 4AQSA 1UZ0A 3ST7A 4A45A 4CDQA 2CY6A 2BDRA 4Q4V3 1SFPA 3ASIA 3LF7A 3K4DA 4XUTA 2ET7A 4PLNA 3PUHA 3WDXA 1TME3 2E6VA 4BYYA 4I0WB 1YRZA 4JDOA 2AEYA 5L19A 1DQ0A 2WAOA 2WO2A 4FFFA 4FO9A 4PT6A 4QKDA 2X09A 2E7TA 3ABZA 3T4HB 1AYN1 4CDQB 3I3MA 2IUWA 3THCA 1AYM1 3MW4A 3NNFA 4K9SA 3VN4A 1KQRA 1SMVA 3FHIB 4BQ5A 4IXLA 5JPNB 1CESA 3S5AA 4AI8A 4PIXA 1PHMA 4ARYA 3LA2A 4LR4A 3R05A 1CAVA 1J3PA 1OSGA 2WRAA 2XB6C 4N8MA 5A3PA 5A6ZA 3BODA 1W2OA 5BNNA 3HN3A 5EJZB 2PHRA 1AL22 3K3OA 4W6YA 3U0ZA 1BCXA 3WW3A 2Y6LA 3POJA 5C7GA 4KGQA 1AL23 3LKJA 1GZTA 2ERFA 1Z7S3 4X8PA 2RJ2A 3AL5A 4AI1A 4PF1A 1CAVB 4CP9A 4CDXC 5FO8B 5FZ1A 3MLJA 1ZZ8A 5JIAA 1NX9A 1ODNA 4QX3A 3WW2A 3ZN6A 1CD3G 4TN7A 5BNNB 2FD8A 1HW5A 2R30A 1QMJA 4LKSA 5GLWA 1SEFA 2YG0A 1RHI2 1WMXA 1SBEA 3ZDVA 3LWCA 5JVVA 3WNMA 4RSUA 3J9SA 3OBAA 4Q8LA 1QH6A 1I3HA 1RHI3 5K4LA 4CP9B 4JKLA 1W3XA 4HBNA 1C8NA 3WF0A 3ZN6B 5FYSA 1W6MA 1REEA 2DTYA 3VZNA 1YQ5A 3MUZ1 2DWRA 4L97A 3SH4A 2ORZA 3VBOC 5T5LA 1NLSA 1DFQA 1T2XA 5DXDA 2JX9A 1VBB1 4YZ1A 5K8SA 4AEMA 2R0FA 5C70A 1QJZA 3Q8FA 4KMQA 2WZPP 4C0HA 5FYHA 3BPSA 4FPJA 3ON7A 2RS52 3CKHA 1GP4A 4IGPA 3RWNA 1W6MB 2EXJA 4P9GA 3VDDC 2RS53 2VU9A 4URTA 4PLMA 5F5IA 4XUPA 4FTEA 1HDKA 2UYBA 1KXGA 4CDXA 3AP9A 1GWMA 2ARBA 1GP6A 3VZMA 1WA6X 1X8EA 1D7PM 4DY3A 4FPKA 2FCTA 5E16A 3OEBA 4DOUA 5A3MA 4C1WA 5LBEA 3W5NA 4HL0A 5FJHA 3JUUA 2A3WA 2RS11 2XDVA 3N9NA 4CDXB 1PX4A 4RA0A 5LASA 2H0VA 2D6MA 4YVSC 2BGOA 3NV2A 1V00A 4UFKA 3VBOA 1XRUA 3AP6A 4NROA 3ZPOA 4UXAA 1OPMA 4HLTA 4K40A 4XF4A 2PHXA 4Y26A 5DAWA 1UY4A 3ZYFA 4GWMA 1WBFA 4LA2A 4E8CA 3FN9A 1H8VA 1Z78A 4LHSA 5FMCA 1QF3A 3RZLA 3BB6A 3SHRA 1DYPA 4OFGA 4BB3A 1VRH2 3RFRA 2DCYA 3WHUA 1JYVA 1H8TC 1UPSA 1YWKA 5DAPA 3USSA 3VBOB 1FPN1 2D97A 1JZ7A 3KLSA 1VRH3 2YROA 5A7WA 4UT5A 1RUOA 4LPLA 1FV3A 4JQRA 5F1RA 2BP6A 3SNMA 3PHMA 5FFOC 5A3TA 3Q8BA 4QX5A 1PNGA 1OKOA 1JYIA 4HVRA 1C8M2 2O8QA 4FFHA 5A7WB 2IVJA 2BOJA 4HFSA 2ZGNA 1UWWA 3PMEA 2GMPA 3POWA 4IEWA 4YVSA 3DXTA 3I2HA 2WSVA 2Y6FA 4CUBA 3ZXDA 1XPWA 2QZ3A 3BU7A 3K2OA 3K46A 2ZAAA 4Q4Y1 2YDEA 4RHV2 5CKNA 3E6CC 3Q8EA 2A6WA 1K12A 5A7QA 4OYUA 2I45A 2WNOA 4CUGA 1BMV1 3SH3A 4COYA 4JGZC 1QY4A 4URAA 4C0BA 1FT9A 1H8TA 4LBOA 3M4FA 4YVSB 1G9FA 1NZIA 4A6SA 2VBDA 2RG4A 2JDPA 1NLQA 3GBWA 4IE4A 2ZGMA 4TTGA 3IWZA 5T5JA 5EFUA 4Q27A 2ZGQA 4Y33A 4UYBA 3OJBA 4WZCA 5FZ6A 4HSJA 2RR12 5FP7A 1TME1 4AL9A 3EYPA 1S4CA 1H8TB 3D0JA 2HKXA 1F5FA 2G4IA 5FPLA 2RR13 1PVXA 1TNRA 1WZXA 5M0TA 5JZGC 1MACA 1U5XA 2VL4A 3ES1A 3J26N 4GALA 1F4AA 4AEJA 2BERA 1BK1A 3MIHA 4J6GA 1JZ2A 2R1DA 3NAPC 2YGLA 5C6CA 1VBE1 2MEV1 4D6RA 1ZZ9A 5E8AA 2CU5A 3WP4A 2Y6KA 1UY1A 4YG0A 3E97A 1LENA 3ZSLA 2J1AA 3DKQA 3V56A 2D43A 2JDKA 5FZBA 4V1PA 4CRQA 3SISA 2W1QA 1I9RA 4JGZA 1J1LA 1F31A 2LS6A 4FI9A 1N1TA 1WLWA 3I2KA 1GQPA 2W95A 1OLME 1A8MA 1O91A 1TVGA 2E63A 2RM22 5HV0A 3THTA 1FMD1 4ET7A 1XC6A 2RM23 1ZBA2 2HWE3 3DPRA 4OI2A 2WZR1 3I3QA 3F95A 3AMMA 4E4ZA 4JGZB 5BNPC 4Q8KA 3JQXA 2XLFA 4IEOA 4IV3A 5DAQA 5LA2A 2JDZA 2AR6A 2HBTA 1BHGA 2VZRA 5JZGA 4IE0A 2R043 1VBC3 5H9SA 1MEC2 3O1OA 1NY72 4GJYA 3NAPA 1UQXA 2GC0A 3DPRB 1WCSA 2LALA 4YYOA 3IIAA 1RUD2 2Q5TA 3WDVA 4IV3B 3VBHC 4IEYA 3VBFC 3UL2A 4FFGA 4NJ4A 1RUD3 5JZGB 2PQQA 2ORXA 4JZRA 1ONAA 5L9VA 4EWAA 1RC6A 1GNZA 1V6LA 1HJGA 2XR4A 3NAPB 3M7AA 5EHDA 5LA0A 5H9RA 5C9AA 2W52A 3M3IA 3B3QE 4K1ZA 4EWDA 2OW4A 3FBMA 1NA1C 4W6WA 4Y3OA 4IV1C 2D44A 4BJ0A 1DYKA 3OPZA 5ACA2 1WWYA 1JYTA 3IAPA 5FK7A 1OPOA 5BNPA 3NRUA 4UFHA 4Z07A 5FY1A 3SCHA 4NHKA 4QQ2A 2ZGRA 5C3SA 5C8WA 2WO7A 5C9AB 2VMEA 2QJVA 4BIFA 4KNCA 3B7MA 1R1A1 2C4XA 4IERA 4B4PA 5IAXA 2OIIA 5D8AC 4BH9A 3ILNA 3POYA 2G9FA 5IVCA 4IUGA 5BNPB 5FZOA 3ALQA 2QQWA 3VBHA 3KSCA 5FY7A 5JXHA 3O1RA 4RYDA 3GYDA 2J1UA 1OH3A 5FZ7A 1ULCA 3AZXA 1OA4A 1RJ7A 4EROA 3NJXA 2Y6JA 4UBGA 2NZ9A 1V0AA 1LHOA 3HMYA 3MBWA 3MW2A 4H55A 1UMHA 1EV12 4B4QA 5FZOB 5I8SA 2D40A 3GZTB 3VBHB 1J83A 1UOGA 3Q8AA 2FDIA 1EV13 2YU1A 4IV1A 1GFF2 3T0BA 3LDBA 2QUOA 3MLKA 3N9MA 3HT1A 4P9XA 3WNPA 4XAEA 4Z2AA 4JRLA 5DN2A 3KV9A 2ZZQA 3GJBA 1ZZ6A 2WWJA 4ATFA 1A34A 3JU9A 4NPLA 4IV1B 5D8AA 4F83A 1UZZA 1UXZA 3EBRA 5A3NA 3U75A 1JYNA 2OZ6A 1H1AA 4D6QA 3MIBA 1S1AA 3S0MA 1RGSA 2VC9A 1FATA 4K1YA 2F4LA 1YNAA 3FFQA 5LRRA 5D8AB 1QIQA 2BNMA 3MHZA 2GC2A 1NXMA 2B4KA 3HR9A 1B35C 3N9QA 3IZOA 2YUEA 2ZACA 2VMDA 2EIBA 3DL3A 3LAGA 5F6LB 2HWC2 4BIOA 2AUYA 1RITA 3WZ1A 1E5RA 4KBZA 1YO8A 1QH7A 1BEV2 2XUMA 3PU3A 3VD4A 2FDFA 5L7OC 5KXCA 2ZEXA 1NKGA 4P9LA 3MIGA 4CU6A 4IEVA 4YARA 2UWAA 4Q4X2 2QQIA 4NRMA 4PJYA 4XDOA 1ZM1A 1Q8QA 5FK8A 5FREA 4A7KA 3DECA 4XFAA 1LODA 4OUMA 3PUSA 1EP0A 1PGL2 1IG3A 4DINB 1HN1A 1S0GA 2JE9A 3EB7A 2J7MA 4I3PA 1OQEA 3WQ1A 4MADA 2ZEWA 2DCJA 4AF9A 4YM3A 2QQOA 3KV4A 3NQHA 4LITA 3WR0A 1QQP3 5DG2A 5SV8A 5FZIA 2OQ6A 3JBG2 2CGOA 5ERLA 3QCWA 1JOPA 4DEQA 1KFUL 3LA7A 2XWJB 4XJAA 4DQAA 3JBG3 4JC1A 4DPNA 2VBBA 4DXRA 1XNKA 4XF1A 4F7ZA 3N9LA 1QJU2 5IVBA 2VUDA 1YQ8A 2ZKLA 2D3RA 3P5BA 3RSJA 2ZEYA 1TQ5A 1W8FA 2QQJA 2BWCA 1AR73 4AWDA 5HBAA 2SLIA 4QWNA 2R041 4ES9A 1EUTA 1VBC1 5I0SA 1ULFA 1LECA 2DUQA 1CAWA 2O14A 3LEKA 1W9FA 1PIV3 5FMDA 4CXWA 1JODA 5FKCA 3BN6A 4XUOA 1JZ5A 1HN0A 3NJYA 2XHNA 3FLTA 4IEZA 4RGAA 5FXXA 1RINA 2WWSA 3H3ZA 4CEYA 2NPIA 5FZ9A 3O1VA 3WXPA 1K42A 2ZMKA 5JOXA 1CAWB 2QQPA 1XOYA 3IM0A 1UY3A 2G9GA 3QOPA 4GH4C 4B7KA 1RMU2 4BMBA 2W91A 3PJQA 4YZ5A 4DNYA 4HOOA 1G7YA 3WNOA 3I4IA 1MR5A 1GNYA 5GKAC 2CWMA 4CEYB 3CMGA 1RMU3 1W8TA 2DBIA 4GAZA 3GBFA 1W2UA 2MHFA 3AB0A 2XJSA 3WP6A 4PF5A 1VBA1 1U0AA 1ZRIA 2VO5A 5IAVA 2JE7A 1G86A 2E26A 2VOWA 2LROA 5IWFA 2VY0A 2BGPA 5A6XA 1UW8A 2WFF2 4O65A 1IPSA 3APBA 4P5HA 4RL7A 1L3JA 4MHRA 1QJX1 3LIGA 4NN0A 3HBZA 1PM7A 4W65A 5JLVA 2RDRA 4E8DA 1XU1A 1YJKA 1LAJA 5GZEA 4F3JA 3AP4A 1RUJ2 4RD7A 5K7PA 2E51A 1FI2A 5APAA 4CPBA 3AP7A 1NCRC 4CXYA 3CJIC 5T55A 1RUJ3 2HEVF 4E2SA 3MFAA 1KDKA 4BQ2A 2W92A 4GH4A 1GNHA 2VMCA 3WCRA 2BYVE 3C7EA 5F8PA 4E2QA 3BIEA 3IDBB 4AVBA 3VHNA 2QDNA 1BVVA 1HRI3 4KWLA 4SLIA 1O3SA 1RUNA 5LCWL 3QH6A 4IEQA 4S2DA 1OOPA 5CBLA 2QVSB 3E6DA 3R6SA 2WAAA 3FBYA 2ZHLA 4GH4B 2HWD2 2NMOA 1YFUA 3GNEA 4M0NA 4LXLA 1HV1A 3PTRB 5IT6A 3ZMOA 1CIYA 4HKOA 3ZYIB 2HWD3 1VPHA 1X82A 2K46A 1US3A 2W68A 2ZGUA 4R9DA 5IW0A 1G6NA 2VVFA 3VBSA 4XQDA 3M3OA 1JN2P 1TEIA 2IZWA 5ABJC 1OOPB 2P6HA 3AKPA 5KHKA 5F5QA 4Q4W3 2DURA 5KHIA 4S2FA 5A7SA 3WF3A 4CDUC 1OI6A 3ETQA 4GQ7A 4OCTA 4JQTA 4BA6A 1N3PA 2DVAA 4DXSA 1NCRA 2ES3A 5CNAA 3KQRA 1AYN2 3CJIA 4LORA 4CCCA 4DS0A 4OQ9A 1AYM2 4OHZA 3I59A 2DVBA 2XG3A 5CKMA 3VBSB 5J48A 2D7FA 1AYN3 1F5JA 2A73B 3H9AA 4HETA 4XE9A 3TNPB 3ZYPA 1AYM3 4G9SB 5DQ0A 3TYJA 2H6BA 3DKWA 2UU8A 2R071 4O7XA 3M3EA 4KWUA 2AACA 1NCRB 3CJIB 4AQ2A 4ZONA 3R4UA 3RI8A 1Y4WA 1Q43A 5AFEA 3I59B 2D6OX 3RG0A 2JG9C 3I54A 3RYPA 1X9PA 1S0EA 4A2UA 2YC2A 1E57A 4HN1A 3UKNA 4OUEA 2WC2A 4LOTA 4D7SA 1HB1A 2VQ0A 1ENSA 4ZU5A 4LTAA 5SV5A 1M06G 5FOBB 1FV2A 1YXWA 1ULEA 1QQP1 2XJTA 4OHYA 3ILRA 1KITA 3CHXA 3RJRA 5LW9A 4IGOA 2BWAA 5DUVA 3OUJA 3POGA 1AZDA 2CV6A 3C8XA 5JMOA 4CP2A 1OF4A 4NIDA 3PU8A 3R0RA 2RJKA 4XBQA 1VBB2 3WDWA 3ZKYA 5BUVA 3O12A 2VECA 2LTNA 1UXXX 3PDQA 1VBB3 2AREA 2PAMA 3JQWA 1POV1 1AR71 3LPGA 2J22A 1NQDA 1WBLA 2XVKA 4CEWC 3OGJA 3NV4A 2W08A 1HB2A 2GDFA 2JD4A 2JG9A 3MZHA 1CJPA 1S2EA 2C9KA 3JCIA 3CDZB 3V64A 2AYHA 3UETA 3AMHA 4D69A 3M3QA 2Y34A 4XFCA 1SACA 3HPNA 5FY0A 3BKZA 4EJRA 2XVLA 1PO21 3ZOIA 4ASKA 2YGMA 4FOVA 4HZFA 3BALA 1NT0A 2JG9B 2AGSA 2CSGA 2RS12 1W6QA 3KCCA 5E6HA 1O5LA 4LO5B 4KQ7A 2V4VA 1NCQC 1LGCA 4MXWA 2Q8CA 4I0AA 2ZGOA 2MPFA 3L2HA 4P9WA 4EN7B 3BTAA 1YI7A 3PUIA 4FT8A 3ZXLA 5FXZA 4ONUA 1W6QB 1A8DA 2YHJA 3KZ4C 3MIFA 4XOGA 3AZYA 4OMCA 5EZWA 3S7EA 2VCBA 1NOVA 1VB4A 3D6EA 3H0OA 4Q0SA 4MXWB 4YZ4A 1O59A 2K9ZA 5FZ8A 1H2MA 5LB6A 4CEWA 3WUCA 1FPN2 4AAXA 3KGLA 1OXCA 4Q5OA 3AM2A 1XNAA 5E1RA 2WIIB 4Y4RA 5HXVA 5I8TA 1JS9A 2W1UA 4IESA 4QM8A 3KF3A 1FPN3 2JE8A 4YGDA 4N7UA 3VKFC 3MLLA 4EYUA 4LKDA 3NO8A 1GZCA 3FLPA 1Q8SA 4CCDA 2DVGA 4CEWB 1YQ2A 2VQAA 3AJYA 2EXKA 3MPPG 2CL2A 2BOIA 2D5FA 3E6BA 3VBUA 1ZREA 3POSA 2Z42A 4JX0A 1QHDA 1OLRA 5F2SA 2HBUA 1KJRA 4GA9A 4MGQA 4LO7A 1B09A 4XTPA 3KS7A 4MSVA 2Q1ZB 1AR91 2K0GA 3WQBA 4TWTA 1O3RA 1C5IA 3PVNA 4XCAA 4NIGA 1HRI1 3C7GA 4HSLA 3U4SA 5JI9A 4Q4Y2 1LOEA 2OT7A 2Q4SA 3H3LA 5D1IA 2IXHA 3JXSA 2R32A 4XIOA 1XNTA 3D3AA 1XXNA 2XMLA 3LSEA 3VBUB 1BMV2 4EE2A 3I97A 5EP9A 4LHNA 5A80A 2TEPA 5CISA 1W3VA 1CPMA 2JXAA 3GGLA 5AC91 3MDPA 1I6XA 2ETEA 5LEKA 1XE7A 3OOXA 2W9XA 5F37A 4AHXA 3NVCA 1S55A 4NWVA 1FOD1 3UKTA 1DQ1A 1LEDA 4CSWA 5A3LA 4Q4W1 4UW4A 1TME2 5FQ0A 2XXZA 3TN93 2DF7A 1F4HA 5ISLA 3CBNA 4NE9A 3CIHA 1RUH1 3GZAA 4UAPA 2EVXA 2PQSA 4W4ZA 4Y5SA 4BM8A 4EZHA 1YFWA 3FHQA 1QJFA 3BTZA 2KR2A 4LO6B 4W8JA 2PAEA 2Q0AA 1HB4A 3HIFA 3VDBA 1LHUA 2BQPA 2FZ1A 2MEV2 2IXKA 3MIEA 4KU8A 4M4RA 3SMHA 2R16A 4DUVA 5F9TA 5LWBA 5FQ0B 2I07B 1VBE3 1VMHA 2MEV3 2WDBA 4BQWA 2RV9A 3AZWA 4S2GA 1POV0 4FBFA 3SKVA 1OMIA 1GSLA 3ZM8A 2GNTA 1Y43B 4NPMA 4XF9A 5JSOA 4YW3A 3VUOA 2YMZA 2XPJA 1AVBA 1LB2A 1W8UA 3VB9A 4MGTA 1SFYA 1NE6A 1Z7S2 2ID4A 2VCAA 2W3JA 3AZVA 2O0OA 1SLBA 5FJKA 4EN0A 4FAGA 3ZX7A 1AF9A 1FMD2 1OFNA 1YCIA 3AYCA 3WF2A 2D6LX 1BBT3 5FCCA 1FMD3 3RS6A 3T3YA 1RXFA 2D93A 4XXAA 4QXBA 2FCUA 3KD4A 1Q8PA 3KMHA 4P02B 4QPGA 5LY1A 5FXWA 2WZR3 4GXLA 1R64A 3GHMA 1MS9A 2EALA 2ZTNA 3J8F1 5I0TA 4BE3A 1OLMA 5FOJB 1OVSA 5LK5A 1ZVFA 4LULA 4QT6A 2ZX1A 2W0XA 1W90A 5H9PA 5FZMA 1CR7A 3EQEA 2VZPA 1HRV3 3O0XA 3IIIA 4NIIA 1IHMA 3K4AA 4QPIA 2VUCA 4QPGB 1UZWA 3A7QA 2RE9A 1KD7A 4NRQA 1ZBE1 3BGAA 5JWPA 1TNFA 4XMIA 2DYCA 2FZ2A 1OUXA 1G9AA 4AI3A 3H7YA 3VV1A 4C91A 1ASJ1 1J3RA 2L9LA 1UYXA 3N36A 3PIJA 5KXEA 1XNCA 1DQ4A 4QPIB 4LNVA 2VMHA 5HXMA 3WT3A 5A3UA 2XKOA 1W9YA 3L2YA 1MS1A 4OMDA 4C8DA 5GM0A 3ZXFA 1YLLA 3WNLA 4N53C 1IS6A 4NRPA 3BOPA 5JR7B 3ZFFC 4Z92B 4LE3A 4AGVA 4AW7A 3VD3A 1JHJA 1RVF3 3GXUA 1YIPA 3MV11 4OHVA 4NHMA 4CUCA 3ZKUA 4AQ6A 1LNSA 2Y38A 1S0IA 3X29B 2JB8A 4YRDA 4EZ4A 4PI0A 2OQ7A 1R1A2 4NHYA 1RB8G 2GMMA 1HXS1 1Q56A 3B94A 4LLFA 4GJZA 3NSTA 2CDOA 4M3CE 4QB1A 3AVSA 1OH4A 2CDPA 2EICA 3VKOA 1R1A3 1CX4A 5HCAA 4IE5A 1VR3A 3OBZA 2JKXA 4JV4A 4M4PA 5LA1A 2HYXA 3RQ0A 3I2DA 4LA3A 1I1EA 4Q26A 1NE4A 3AYAA 3OCPA 3DEMA 4XURA 3M1HA 2P6CA 3ZYBA 4MX3A 4AAPA 4PI2A 4I30A 4AHZA 5IK8A 4NHXA 3DYPA 1XYPA 4V2WA 3OGSA 4IEPA 4Z8BA 3T2OA 1IQAA 1LULA 1GICA 1AJOA 3LEMA 2WNEA 1R1ZA 5DZFA 5FO7B 2R49A 3ZFEC 4N53A 4UWDA 4XHXA 2V5DA 3ZFFA 5I93A 1GOGA 4KG0A 3BIWE 4GWNA 1KRIA 4DB5A 1W0OA 5C3QA 1HIXA 2E7QA 2QNKA 1ZZCA 4LBMA 4OZOA 3V65A 5L36A 1C4RA 4JAAA 4R9AA 4G3YC 4XTMA 3RYKA 5FYBA 1HQWA 4Y24A 1L7LA 2D3PA 4N53B 2GNBA 3B9CA 4Q0QA 4ZPIA 3ZFFB 3QD6A 1YQCA 3LZZA 5DABA 4QB2A 2B9VA 1Y3TA 1NAEA 5A7OA 5CG8A 2VZOA 2ARXA 4COZA 2PYTA 1K5MC 3AFGA 3K4ZA 4ITCA 3VKNA 5I0DA 4QQOA 3HWJA 2R061 2V4AA 2P1BA 4KH9A 1S0DA 1T6BX 4DEVA 1UOBA 1LJ7A 3KVAA 3D0SA 1O8SA 4B4RA 3LOBA 3G6JB 3POBA 3ZFEA 5LBBA 4FPLA 3N7KA 2YC0A 5CEHA 5FIXA 3DPRC 3PUQA 3ACLA 3TN91 5JCTA 1ZX5A 3WP3A 2KXLA 2PAKA 1OURA 2WYFA 3OPWA 4GB33 4IV3C 1RUF1 4LIUA 5FYVA 4N90A 4CXXA 1DU3D 2YC4A 2UYAA 1VRBA 5C5TA 3ZFEB 1Q8VA 1DCSA 2DCZA 5ANQA 2GH8A 3KQ4B 2C9AA 1DZRA 3OEAA 1UNBA 4AG4A 4FPHA 1RL3A 4CCMA 3TB0A 1F9KA 1Q3EA 1REDA 1RUG1 1SFNA 3U10A 4AEKA 1K5MA 4ZZ5A 1LGNA 3LFIA 3WG2A 1FNYA 2WQ8A 3PTYA 3J7MA 4K6BA 3A0NA 3OF1A 2EIGA 5FZCA 3P1IA 3GDBA 5CB7A 2Q8OA 5C9AC 1YJLA 2HWE2 1BBT1 1WGPA 1UMIA 2YFUA 4HT1T 1K5MB 3H42B 4P00B 4YG3A 2OYZA 3GJAA 2ZZJA 3PIGA 4CCEA 4WZFA 3CU7A 3QBQA 4XXPA 4AHYA 3WG1A 4BQ3A 5C71A 1HQNA 1IGOA 2R042 3K75B 4D6SA 1JU4A 1VBC2 1IPJA 1RXGA 2RMU1 1FYUA 5F32A 2JG8C 4Q2FA 3U37A 1HRV1 4ORFA 1DLCA 1PM4A 1ZYBA 2ZX0A 5EJ3A 3RVHA 3O7OA 4QXHA 2RDSA 4TSVA 3J7NA 2HWF1 2LUWA 4HG6B 1FNZA 1R081 2UWBA 3W20A 2XQRA 1WMFA 4A41A 1OA3A 3PVBB 3CQOA 5CVRA 1OT5A 4R8HA 3SLIA 1V70A 3EO6A 1JMUB 3U1XA 1CJDA 4QX2A 2D5HA 4LHLA 5KWRA 1CAUA 5FYMA 4C1XA 3NKTA 1EPWA 1SCRA 2Q1FA 3HVDA 4MHUA 4QPWA 1OQDA 2HH9A 4YLZA 2Z2SB 1LOCA 2WYSA 1JYXA 2J1RA 4AFBA 3URFA 1Y7BA 3AMPA 5FUIA 3RDIA 4QDRA 1U5IA 3I2GA 4AZZA 2JENA 2YPDA 2VCCA 1RVF1 2DFCA 4ISQA 1LU1A 4ISRA 4E4DX 3MYXA 1CAUB 3NNGA 1VBA2 4CCOA 4AOCA 4LMFA 4XJWA 3GBGA
chains in the Genus database with same CATH topology
1VBA3 4N9HA 1ZA4A 3JD71 3JZVA 2CAVA 2WS91 2JG8A 4AVSA 4AGGA 4OHWA 2XH6A 2GAUA 4NHLA 2ZBJA 1QJX2 4D7TA 3EJKA 1BQPA 4XFBA 1J3QA 3ZO0B 3O14A 1GZWA 2A3YA 3VKMA 4HK9A 1G9DA 1QJX3 3M3CA 4EWEA 4R9CA 1C3HA 3MW3A 4XZPA 2JG8B 3DUIA 4BHPA 2WL1A 4QGLA 2OZJA 1H9WA 1AHSA 4Y20A 1WLTA 3RZZA 3C3VA 4M0HA 1N1YA 4UBHA 3E5QA 2ZJCA 1GZWB 3IKWA 1QKQA 1UL9A 5FRAA 1AR81 1SBDA 2UY9A 3B5LB 3H7JA 2Z69A 3CNAA 4COVA 3NL1A 3FC0A 4IEUA 3OBRA 3OBTA 4U36A 4P9JA 4Y20B 2ZX2A 5TSWA 4ASMB 1RUE1 4JDNA 4LLOA 5KHHA 3HD8B 3J4UH 1ND3C 3C2UA 4CZSA 4D94A 5J7MA 2BEOA 4XW3A 4YM0A 1X33A 3VL8A 2GNMA 4K20A 2D3SA 1AXKA 4WM7C 1DZTA 2X53S 4MGKE 4Y5Z0 3WQ7A 2NYYA 4MGYE 1DGWA 3NV3A 3AXEA 3M8LA 1S2KA 1MQTC 4DFSA 4KWKA 5JOZA 2R072 4NO4A 1U5ZA 2ATFA 3RYRA 3W58A 2DVFA 1LU2A 5I0RA 2I74A 1SQ4A 1UKGA 1DGRN 4AI2A 3ES4A 2R073 1C1FA 3OYWA 4GB31 5JIUA 2H6CA 1DF0A 2VUAA 2VOXA 4Y22A 3WNXA 1SLLA 4PDWC 4Z82A 3H3UA 2ZPXA 1ND3A 1Q8OA 2GH2A 4RFT0 5GLZA 2RJLA 5BYNA 1R093 1V9U1 4Q0PA 1D2QA 4IQPA 4WM7A 3OYWB 3ZSMA 1QQP2 4Y22B 5GALA 1HLCA 3A4UA 1DGLA 1A3KA 2O8OA 3ECQA 1ND3B 2Y0OA 4CEYC 2CWSA 1LEMA 4XF0A 1ENQA 1MQTA 1VB2A 4OI0A 1DQ2A 4XJUA 4WM7B 2ET1A 4SBVA 1XYNA 2XJPA 4XFHA 5EWSA 3ROUA 4AFMA 1LOBA 1JOJA 1N47A 1AR72 5KXDA 1UKRA 5CFDC 2DCTA 3WQ0A 1MQTB 1WW4A 3M2MA 1POV3 3LCPA 2IXCA 4PDWA 4BLIA 1DIWA 4RR3C 1IS4A 2GC3A 4YFZA 1PIV2 3N7JA 1C5HA 1PZ7A 4XJZA 2DV9A 4QD2A 4MYEA 4FXGB 4XEZA 1PO22 3IT8A 1X8MA 4P14A 4DZGA 4PDWB 4QQLA 4WM8C 1PO23 2P17A 4XILA 4A3XA 1TMF3 4LBJA 1ZBA1 1PO11 1M4WA 5KHJA 2D6NA 1REFA 1SBFA 3LOIA 1BVP1 4AFDA 1PZ8A 4LE4A 1IKPA 1CN1A 5JSPA 5FLJA 3KB5A 1YHFA 2ZA9A 4PBPA 4GMP1 1FAYA 4ES8A 1HQLA 1WD4A 3DN7A 4MXVA 5CFDA 1VBD1 1OOPC 4YGCA 5B2GB 1D0GA 1GYKA 2ZAHA 1Q5OA 2I2SA 1FXZA 2CTVA 1GQHA 4RR3A 5CU1A 3VZKA 5GZCA 3VBSC 5CFDB 1D4M1 5DZEA 4QMAA 1UU4A 4WM8A 3USUA 3MICA 1XQNA 2RS33 4RR3B 1X50A 2WJSA 2YY1A 1XE8A 5ACA1 1AR92 2GSYA 1HRI2 4KGGA 3ZPYA 4PQ9A 4AE2A 4NPRA 5L73A 1AR93 2B42B 2VW1A 5K0UC 5LK7B 1BYHA 1UU6A 4WM8B 3USUB 2IFWA 4AI0A 4D7YA 4XQWA 2BUKA 3BCWA 4FP3A 2VNOA 3S7IA 3SITA 4Q0VA 4E27A 3ZYGA 2DU1A 5AC93 2HYKA 2UY8A 4META 1DGRA 3MIDA 1FOD2 5DDJ1 3T1MA 4WBBA 4OI1A 4Q4W2 4KL1A 3I8TA 1EAH3 3LSDA 3O0VA 4FPCA 5BNOC 3KCYA 4YZ2A 1FOD3 4RQPC 2B46X 1RUH2 5JSRA 1DZQA 3LB9A 4Y1ZA 1C57A 1DGWX 1RUH3 3ZXKA 1PNFA 1QOSA 4M01A 2ZABA 4BMEA 1ZRCA 3BOWA 2BNNA 4BWOA 4FPYA 2P3JA 3O0WA 5K0UA 1CIWA 3WLUA 1S0JA 4ASLA 3D5OA 5IK4A 2NM1A 1ND2A 1PZ9A 2WSUA 1QWRA 2WNVC 5K0UB 4FP2A 2WNUA 5JMCA 1O5UA 1R091 4X6RB 4OVEA 3ZSJA 5C8CC 4B3NA 5BNOA 2EXHA 4FPGA 3J8F2 1ND2B 4RQPA 1U12A 5KBFA 1BZWA 1G9BA 1URXA 4XMAA 2OPKA 3J8F3 3KT4A 4FTBA 4O9EA 2HWB1 2WNUB 4BPZA 5BY5A 2PELA 2HWC1 3R4SA 4BZ4A 5BV6A 2QCSB 5BNOB 4KU7A 4RQPB 1Z0HA 4LBNA 2TNFA 4GMP0 5CIRA 4LBQD 3N4MA 1ZBE3 4NVPA 3RRDA 1ASJ2 1NQJA 4XBNA 1COV3 3GHNA 5AVPA 2EAAA 1QOTA 1V6NA 4INDA 2XL9A 2DCKA 2IXLA 1ASJ3 4Y1VA 3O5SA 4AK3A 5AVAA 4OI4A 4GIQA 2WNVA 4QGNA 4NOTA 4O9GA 3N35A 5K9YA 5GJ6A 1H30A 2R1BA 5KXBA 3TOJA 5C8CA 1MS8A 1KJLA 4BCUA 1GANA 1O4YA 1S0CA 3WDYA 5J36A 2A70A 2WNVB 1PVC1 4I3GA 1TMF1 1HXS2 1QJU1 3SCFA 4ZKTB 3CJXA 5J98B 3VBUC 5C8CB 4JRAA 1HXS3 2OA2A 4PIYA 4QGMA 2TBVA 2DVDA 5HCBA 1S0BA 2VPVA 1LTEA 3AMNA 2JECA 2Q1MA 1OA2A 2VMIA 3RJ2X 3DV8A 4TZDA 4M3CA 4XYXA 1LHVA 2VNGA 4K21A 3AX4A 1CPNA 1W0PA 3HN1A 3NWKA 2FMDA 2XVGA 4LO8A 1H0BA 4CTEA 3TBDA 2YYOA 4M3CB 4LHKA 4LBKA 4M3CF 1OLQA 5HI0A 1OD5A 1RUI1 3D8CA 4L9BA 2XLAA 4ATEA 2RS31 4L99A 2PN5A 2WKKA 2D98A 2ZGLA 3H1MA 1GV9A 3JB4C 2ZGSA 1WA4A 4I2OA 2VNRA 2ZHNA 3GALA 2B7YA 4CDWC 2C0ZA 2VULA 1ZZ7A 2EA7A 3NV1A 5KHGA 2R062 3KCXA 4KBBA 5C4WC 2JKBA 3IN9A 5CADA 3OD0A 3P3NA 1DQ5A 1LOAA 1W6PA 3LA3A 1EPZA 2R063 3ZYJB 5EYYA 1AR61 4XPVA 1H4HA 1YFYA 1H2LA 1S2BA 4G4FA 4OUSA 4K7JA 1IKQA 1EAH1 1LHWA 3IDCB 3Q9OA 5JAXA 3TN92 4XFFA 2GN3A 1WW7A 1RUC1 4QPGC 1W6PB 2OUJA 3TRSB 4BLJA 1O4ZA 1VJ2A 1KDMA 4BOWA 2GC1A 3AYDA 4EV0A 5J96B 4UW5A 1RUF3 1WLCA 1QJY1 4HPKA 4PLOA 2PLV1 4EN6B 4Z1VA 1VBE2 3P3PA 4LT5A 4QPIC 1G8WA 3RPQA 4CDWA 3CO2A 2ZHMA 2OUHA 1RUG2 3A0KA 5C4WA 3AP5A 4HPKB 1RUG3 2GN7A 3AKTA 4QXKA 2X5IC 2HEYF 2CAUA 3ZXEA 1ULGA 3QH7A 4XETA 4E4SA 4CDWB 1BBT2 3INAA 3QACA 3VBRA 2WZR2 2XWBB 3IMNA 5C4WB 2BPA2 4JCKA 3UKVA 3N7LA 3ZDSA 3VZJA 2E9QA 2RMU2 4YM2A 3G7DA 2PHLA 1HRV2 2ZS6B 4FPFA 4Q1RA 2RMU3 1VLNA 3CEWA 3VBRB 1IPKA 2VGDA 3SH5A 5DG1A 2HWF2 1R082 2F4PA 4FQ4A 4OZXA 4IL7A 4AVVA 3AMQA 4WV8A 3UK9A 2HWF3 2HEWF 1R083 2IFRA 1RIRA 1COV1 4HKLA 4RGGA 2B39A 4RS5C 2QZ2A 5BNQA 2X5IA 3WD5A 2EAKA 3WG3A 1PGW1 2VVEA 4AQTA 1F8VA 4D3WA 3WINE 4ZU7A 1UD1A 4FVVA 1NZCA 1RVF2 4YG6A 4UW3A 3AXDA 5DUXA 1X36A 2X5IB 1MVQA 1BKZA 1DHKB 3BPZA 2B9UA 4EN9B 1CONA 2DUOA 3JD72 2WS92 2YZ4A 4I0BA 2QKDA 3JD73 2WS93 3W59A 2RHPA 4CP1A 1VIWB 5HCFA 3N3HA 4OLLA 2FBEA 4Y4YA 1UF2C 3FUOA 2NLRA 4HN0A 1GZ9A 3WW4A 4CYDA 1UU5A 4E9KA 2Y0IA 1XYOA 4FOQA 2XL7A 1LRHA 2FMYA 2JJ6A 4RS5A 1MZFA 3ELNA 1LKNA 2XJQA 1D2SA 3CL1A 2XBO1 2P2KA 2WLQA 1AR82 3MF6A 5CG9A 4YW1A 1VAVA 2BVVA 4C90A 3OD4A 2PTMA 2W39A 4Q0UA 5AFBA 1MZ5A 1AR83 4RS5B 3WG4A 1U5YA 5I91A 1RUE2 4FTSA 4P9IA 2VVDA 3VZLA 1A78A 1RUE3 3E5UA 3ME2A 3PJYA 4S2HA 1V6KA 4AVAA 4M00A 3WUDA 3I7DA 4U2AA 1XU2A 3VDDA 5EYXA 3PVOA 4WVWA 5GLUA 4R4ZA 2YXSA 1O7FA 3FZ3A 1OQ1A 5JOYA 3D82A 4H3WA 1UX6A 3OTFA 4DRVA 3CLPA 4X8NA 4XIKA 3VDDB 4QM9A 5EV7A 4WVMA 2ZX4A 1UN1A 4COWA 1J58A 5FAXA 3WHTA 4B8EA 1C8M3 1S0FA 4GB32 3ZMNA 4YSFA 3B01A 2Z5WA 2X29A 2E7AA 4WVMB 1OFSA 2XHKA 3B00A 1UZYA 5T54A 2NMNA 1LOGA 3FUQA 4RHV3 1WCDJ 1V9U2 2UURA 3WDTA 2ZGTA 4P9YA 4YNIA 1V9U3 3AFKA 1GLHA 4Y1XA 5JPMB 4JTNA 1OHFA 1O3QA 4Q4V1 1WCKA 3ZXGA 1ALYA 5JI7A 1UMZA 1LR5A 1D0HA 4QPYA 4HMZA 4I01A 4FOWA 2P3KA 2PHDA 1SLCA 1QXRA 4DRRA 4QQPA 2E53A 2HJIA 2UWCA 5T52A 2GNDA 1H1MA 2VW0A 3VKLA 3V0BA 5A33A 5A32A 1QNYA 2XJRA 2GMEA 4WVZA 5FBZA 4H7MA 3D4KA 4I02A 1DBNA 3AKSA 4R9BA 3ZIXA 5J09A 1NG0A 1IS3A 2YV8A 4K3UA 1FX5A 1C28A 3V0BB 5A33B 4N43C 5A32B 4A7ZA 1AL21 2D6PA 1KFXL 2A6VA 1Z7S1 5GZDA 3CF6E 4QU2A 3FE5A 1PO12 1W6NA 1WMEA 1W39A 1ZBA3 1PO13 1AUYA 1SLAA 2XLGA 1RHI1 4FAHA 4AYUA 1NYWA 2WT0A 4MV2A 5FPZA 4WVVA 5GLVA 1H2KA 1VBD2 3PVEA 4GMP3 4ZU4A 1MEC3 1W6NB 1ENRA 4JTOA 2AZ5A 2WT2A 1VBD3 1AX2A 4JDMA 3V0AA 1DDLA 4YW2A 4PBOA 4J1WA 2ILMA 5BXXA 5CA6A 2GZWA 2DUPA 4N43A 1D4M2 2RS51 3H8UA 3RNSA 4FOYA 2CYFA 3T1LA 1D4M3 4N7IA 3TAYA 3JB8A 2PHTA 3V0AB 2BW8A 2BBVA 3KGZA 4IEXA 4NR1A 2TUNA 3H1YA 4N43B 1JBCA 2DFBA 5ACA3 2FHRA 2YPJA 1MS3A 1N1VA 3FFZA 1VAKA 3MGUA 4Z2WA 1SCSA 2IXJA 4J1XA 1EY2A 1T6GC 2EXIA 2Q30A 4R4XA 5EXOA 3N7MA 1F2NA 1N1SA 2VUJA 4FXKB 3VBFA 3L9JT 4CP0A 4A7YA 5DDJ2 3UV9A 2JEMA 2GALA 5DDJ3 3NW4A 4HK8A 4QHBA 1VRH1 4XBLA 3THPA 3UJOA 3T2TA 1WW6A 3VBFB 2N7GA 1NA1A 1UAIA 5FDBA 4Q29A 1WUVA 2ZHKA 1WMDA 2WFPA 4KWJA 2P3IA 4F8AA 3KT1A 3K48A 5T5OA 4YZ3A 1VP6A 3OY8A 1VAMA 4NWWA 5H9QA 1NA1B 1QU0A 1C8M1 2SBAA 1N3QA 3ZIWA 4XFGA 1H2NA 1LHNA 5KC5A 1VALA 4JVAA 3ZXJA 4AFCA 3K51A 1O3TA 2GU9A 4K8FA 3DF0A 4AFAA 3OY8B 1PMIA 4RHV1 2ZOEB 1R092 4R52A 2V73A 1IS5A 4FSJA 4LUKA 4IETA 1PGSA 1LGBA 2XJUA 4Q1PA 4ZXKA 4HKWA 1QDOA 2HWB2 5I8YA 4H14A 4PIZA 4UW6A 1CVNA 1UIKA 3SXWA 2A71A 1YFXA 2HWB3 3HT2A 4L92A 5I0UA 3PLQA 4YM1A 2HWC3 2V09A 2RR11 1AXZA 1BEV3 5GZGA 1UPIA 4JGYC 5BPXA 4AEDC 1LESA 1ZRFA 4HVQA 2F6BA 3AYEA 3GF6A 4YW4A 1MZ6A 4Q4X3 2ZX3A 3QLQA 4L2NA 1GKBA 3ZXAC 4FCAA 1HV0A 1V6JA 1Y9QA 3RI9A 4AHWA 2C5DA 3IDEA 1RJ8A 4MH0E 2PHUA 2R0HA 2VH9A 1IZ3A 1WD3A 2WA4A 1QOOA 1YIFA 3MFCA 1GR3A 4BQ1A 4TYSA 2QFEA 2XJVA 4AVTA 1B35A 1MS5A 3IPVA 1SDWA 1PVC2 1QXJA 1TMF2 2RM21 2HWE1 1QXPA 2MNGA 2BVBA 2K2SA 2B8MA 4N9IA 5FO9B 1PVC3 1CQ9A 2QDRA 1QJU3 3VZOA 1H9PA 5L7OA 1KS5A 2AENA 1AX0A 3ZFGC 1O4TA 1UIJA 1B35B 1D4VB 1N3OA 3IPVB 2C1FA 4JGYA 4DMIA 4AEDA 4YVWC 3VHOA 3S6PA 3RMYA 3LGRA 1MEC1 1NY71 1JHNA 4FQZA 5L7OB 4FPEA 4DY5A 2PHFA 1NXD1 2WQZC 1RUD1 4E2GA