1UAIA

Crystal structure of the alginate lyase from corynebacterium sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords polyguluronate lyase
publication title Crystal structure of the alginate (poly alpha-l-guluronate) lyase from Corynebacterium sp. at 1.2 A resolution
pubmed doi rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uaiA00
5T55A 2A3YA 2EXJA 1WBLA 1WD4A 3B9CA 2YY1A 1GZWB 1SLTA 2CWMA 2EIGA 3HN1A 2ENRA 4Y24A 4L8QA 3WOGA 4BQ1A 1DGLA 4K1ZA 1URXA 4XXPA 5EXOA 2NMOA 1CIWA 4BLIA 2GN3A 1RIRA 2WT0A 4FOQA 4RL7A 4XDQA 1KJRA 5GLVA 1GNZA 2GNBA 2NM1A 1QOSA 4XJAA 3V65A 2CNAA 3RS6A 2HYKA 4YG6A 2E6VA 4C1WA 4BLJA 1G9FA 1N1YA 1QKQA 1YIFA 1ONAA 2P3JA 2PHTA 4Z8BA 2VW2A 2ZGLA 1UPSA 1N1TA 1BQPA 4Q26A 3VKMA 5CNAA 2WSUA 3USUA 3WG4A 4K21A 3WZ1A 4DRVA 5EYYA 2ZHKA 4P14A 2OW4A 4P9WA 1FV3A 1WLWA 2ZMKA 1LEDA 4JC1A 1FNYA 3V0BA 1ULEA 1F31A 2D6KA 2DVDA 2G4IA 1V6IA 4M00A 2GMPA 1VLNA 1QDCA 5DUUA 1G9CA 1YO8A 2TEPA 1CESA 5GZCA 2GMEA 1GKBA 3V0AB 1DQ5A 1LENA 2PHRA 3OBRA 4FQ4A 4Y26A 1SBFA 5T54A 4YZ5A 1QGLA 1YRZA 3MW4A 2D3SA 5CAZA 1C4RA 2C9AA 4LBLA 4ZXKA 2OVUA 1CVNA 1GYKA 1PZ9A 2YZ4A 4GWNA 3KQRA 3N7KA 4XBNA 1GV9A 4XOGA 3ZVXA 2ZACA 3A0NA 3IPVB 4XJUA 4Y20B 4UW3A 1S0DA 2D44A 2A5ZA 3VKLA 2AYHA 4W65A 1MS1A 3VKFC 3ILNA 4YGEA 4FPHA 1MS5A 2A7AA 2PHXA 1YXWA 2D6OX 2I2SA 4FP3A 4XHBA 3SH3A 1DQ6A 5HCBA 4C1XA 3IN9A 3NV2A 3RG0A 3VKOA 3WUDA 1LGCA 1H9PA 1W6QA 3GNEA 2UWCA 5DUXA 2WSVA 1O4ZA 1PZ8A 2DVBA 3OYWA 2V5YA 3T1MA 3LSDA 4XMAA 4GWMA 4PF5A 1MZ6A 2GNTA 2VUAA 1WBFA 3ZPYA 2JE7A 4XJ9A 1V6OA 4YM3A 2UWAA 1JHNA 4K20A 2D3PA 4KBBA 1KDMA 1H30A 2PHWA 4XZPA 1LTEA 5GZGA 1CPNA 1WW7A 2NN8A 4FPLA 4M3CE 4BMEA 5KXDA 4AVVA 5JOZA 3AYAA 3NWKA 4Y1ZA 1SFYA 3AP9A 1UL9A 3R05A 2WJSA 5JVVA 1ULCA 1QF3A 3RSJA 2ZGKA 1JYIA 1ULGA 3AZWA 4RA0A 1G7YA 1VAVA 4DS0A 1FYUA 2VH9A 3FUQA 5IUQA 1Q8OA 1DYPA 1LOFA 4YZ3A 2ZAAA 2R1BA 2VY0A 4FPKA 3AJYA 1AJKA 1DZQA 2SBAA 4XIKA 1BJQA 4M3CF 2DUPA 1FNZA 4R9BA 4XE9A 4XIOA 4ATFA 4YW4A 2JKBA 3AP5A 1SCRA 4YW3A 1W6OB 1UMZA 1GANA 3N36A 4LBMA 5BYNA 3OY8B 4R9CA 2AUYA 2ZGMA 2D3RA 4FOWA 1MS8A 4NO4A 3V0AA 4AVTA 1IS4A 2YMZA 4Y1UA 5JMCA 4XJZA 5GLUA 3N7MA 4DFSA 1Q8SA 1Z0HA 1GZCA 3AK0A 4CZSA 2D6NA 3R4UA 1ZA4A 4AGGA 4FPYA 5LK5A 3FBYA 5F9TA 5FREA 5KXCA 1APNA 1GNHA 2D6PA 2D7FA 1ULFA 2DVAA 3BODA 5DG1A 4I30A 3IPVA 3O12A 1ENQA 4Y20A 5GLTA 3O0WA 1QDOA 1FATA 2ZGTA 5KXBA 3KM5A 2WT1A 2PELA 1HKDA 2CTVA 1X50A 2D6LX 3AP7A 4FPEA 4FPFA 3UJQA 4YM2A 5CBLA 4YLZA 1JW6A 1KJLA 4AYUA 4DQAA 5IK7A 1WD3A 5GLWA 4SLIA 4FPOB 1LGNA 2GALA 1LHNA 3UJOA 4LBJA 3R4SA 3L2YA 2A6VA 3AZYA 3FLPA 4LBKA 1F5FA 2WLQA 3AZVA 1HDKA 2ZGOA 1DQ0A 3I4IA 1LHWA 1AF9A 2ZGRA 4CTEA 4DPNA 3O0XA 1UX6A 3WG3A 2Q5TA 3OBTA 3WDWA 2DTYA 5T5LA 3ILRA 3NV4A 4JCKA 4ISQA 4LBQB 1LHUA 4R9AA 4YGBA 2JECA 5FRAA 5IK8A 4YGDA 2E53A 3SNMA 2A6WA 2R16A 3RQ0A 1DBNA 2R0FA 1NLSA 2OUHA 3A0KA 3WHTA 2VXRA 1UZYA 1MACA 3LCPA 2ZGNA 3I8TA 4Q1PA 3D4KA 4WV8A 3AP6A 2R0HA 2H0BA 4WZFA 4M01A 3GALA 1G86A 2XB6C 1C1LA 4GKYA 2A6ZA 1Q8VA 1OKQA 5DUWA 1W6PB 1C57A 1BZWA 2ES3A 3TAYA 3ZSLA 1V6JA 2JD4A 1V00A 3HR9A 3ZXKA 4UW5A 3WHUA 3WDXA 4CRQA 3WLUA 1W6OA 1NXD1 1DQ1A 2Z42A 1DIWA 2GDFA 1S1AA 1SLIA 4FOVA 1B09A 2P2KA 1MS4A 4M3CB 4PCRA 3OY8A 3TB0A 1U0AA 1LU1A 4WVVA 1LECA 4YZ2A 2ZGQA 1H9WA 1LESA 1LOEA 1WUVA 2SLIA 3WDTA 2ZHLA 1AXKA 1LCLA 1YI7A 1FV2A 1BYHA 2XG3A 1HLCA 1IS6A 1D2SA 3B00A 4Q8LA 3WUCA 1SLCA 4XMIA 3VKNA 1IOAA 4XBLA 1WW5A 3POSA 1AZDA 2W52A 2ZGUA 2ZZJA 3T1LA 1N47A 1MS9A 3DUIA 1IKQA 2NZ9A 3MW3A 2AENA 1JYCA 5E89A 2YROA 2ZMNA 3SITA 1V6KA 1D0HA 1CR7A 1GZWA 2UWBA 3B3QE 3MPPG 2NYYA 1S0CA 4Q1RA 1CJPA 1UAIA 2V73A 3RMXA 2GN7A 4FVVA 4ASMB 5DUVA 4AVSA 2AH2A 1LOGA 1W6NB 1BXHA 3W58A 3AZXA 1S0BA 2EAKA 3IMNA 4HANA 1G9DA 3WNXA 3HMYA 3ZYPA 3M2MA 1JOJA 3OGGA 1G8WA 2EALA 3IM0A 1CN1A 1R1ZA 4FPCA 4YGCA 2W39A 3SH4A 2GNMA 2VW0A 5IK4A 2A6YA 1ULDA 4AWDA 3OPZA 1MS0A 3AJZA 3D6EA 1FAYA 3WG2A 4Y22B 3WCSA 1S0IA 2DURA 4LBQA 1A8DA 1DLLA 1JBCA 4YM0A 5T50A 2NMNA 3ZSJA 2CWSA 3BIWE 4K1YA 1AX2A 4ISRA 4MYEA 2ZHNA 1Q56A 5JOWA 4FOYA 3U4XA 3WDUA 4BMBA 3AYEA 2EXKA 2ZMLA 2WKKA 1MZ5A 1QMJA 1N1VA 4P9YA 5IT6A 2ZGSA 1JUIA 4XJ8A 2DYCA 3AFKA 1CQ9A 2C5DA 1LEMA 1SBDA 3MW2A 3ZXEA 2NP0A 1W6PA 1MVEA 3JU9A 2A75A 1LGBA 4PBOA 1SLLA 5SV8A 1V6LA 5HCAA 2DVFA 3ZXFA 4YG3A 2FMDA 1AXYA 3JUUA 2CYFA 4FQZA 1N3QA 3FLTA 3Q9OA 4ZKTB 2VW1A 4JRAA 1LOAA 4Y1YA 3ATGA 1FX5A 1GSLA 2A3XA 4BOWA 3OJBA 4XTMA 2W68A 5F5QA 3AXDA 4YW1A 3WG1A 2CY6A 3FLRA 3PVEA 3NV1A 4BM8A 2BQPA 4P9XA 1QNWA 1OQ1A 1UN1A 5L73A 2RHPA 3M3QA 4UW4A 1HQLA 5DG2A 5EWSA 2WNEA 1A3KA 1SACA 3A4UA 2A6XA 1LOBA 1WW6A 2WQZC 4YW2A 1W6MB 1XQNA 3BOPA 4YFZA 4H55A 1KITA 1QOOA 1AXZA 2ZABA 1DFQA 4Y1VA 3ZSKA 1LOFC 5H9QA 1LHVA 2DUOA 5DZEA 3WDVA 2A71A 1QOTA 4LBNA 1GBGA 3RRDA 2AREA 3H0OA 3QLQA 2DUQA 3QCWA 2FHRA 1W6NA 2DU1A 2UURA 4TYSA 4Y1XA 1AX0A 5EYXA 1HQWA 2B7YA 4HL0A 4XBQA 4FP2A 1G9AA 2LTNA 3T2TA 3WDYA 2OUJA 5T5JA 3WVJA 2E7TA 1J1TA 2D6MA 3ZSMA 2ZBJA 4XYXA 2EF6A 3C2UA 1ZM1A 4XHXA 4Y22A 2LALA 4XJWA 5GALA 1KQRA 4GALA 2A3WA 2KM2A 5DXDA 1JXNA 2R49A 5GM0A 3SLIA 5IK5A 5E88A 2ZHMA 2ERFA 4NOTA 5GJ6A 1MS3A 1QNYA 1YYNA 5H9RA 1CPMA 3FUOA 3PJQA 4FPGA 1GZ9A 3N35A 3UK9A 2ZA9A 4UW6A 4XXAA 1QU0A 3M3OA 4XTPA 2DWRA 4TZDA 2DV9A 1LJ7A 1VIWB 1LULA 1WCSA 2CL2A 1ENSA 2P37A 2ZGPA 4FPJA 3WV6A 5KXEA 1C1FA 1O4YA 3O5SA 3ZXJA 2YXSA 4GXLA 1AVBA 2EXHA 2WT2A 5T5OA 1DHKB 2YV8A 1G9BA 3ENRA 1I3HA 3WCRA 1UZZA 4ITCA 1F9KA 3VUOA 2PHUA 5H9PA 1S0JA 3N7LA 3UL2A 1PZ7A 1V6MA 2DTWA 3FFZA 1W0OA 4LBOA 1KDKA 3AX4A 3PVNA 1TEIA 4PBPA 1KRIA 5CA6A 1IS5A 1GICA 5GZDA 4U2AA 3ZXLA 1N1SA 1MR5A 3CNAA 1Q8QA 1N3PA 3M3CA 1LU2A 5GLZA 3VV1A 4GA9A 4PQ9A 5JOXA 4YFWA 3PMEA 4AGVA 1A78A 4LBQD 1IKPA 3APBA 1RITA 1W6MA 1Z78A 3IKWA 1SBEA 3AXEA 4Q27A 1BKZA 2A70A 1VAMA 4XILA 3USUB 4ATEA 2E7QA 4DRRA 3W59A 1S0FA 1SLAA 1Q8PA 2D43A 3AYCA 3RMYA 4BPZA 1RINA 1ENRA 5HCFA 5DZFA 3V0BB 2P3KA 3B69A 2UU8A 4YM1A 2P3IA 2W08A 2ZKNA 1LODA 2JE9A 4U36A 2VU9A 1UKGA 3BTAA 2ARBA 1EPWA 2GNDA 3D5OA 3M1HA 3M3EA 4GKXA 4WVWA 3V64A 2AR6A 1S0GA 4IQPA 3POWA 3INAA 3N7JA 1DQ2A 2JDZA 3DGTA 5T5PA 4D69A 3NV3A 1AJOA 3ZYRA 5E8AA 5JOYA 2PHFA 1S0EA 2AGSA 5DZGA 1GLHA 4YZ1A 1LOCA 2R1DA 5GZFA 5CB7A 1IS3A 1WLDA 4Q2FA 5JLVA 1SLBA 1Y7BA 1WLCA 3N3HA 3ILFA 5T52A 2JJ6A 3POYA 3SH5A 1OFSA 4M3CA 4F83A 5AVAA 1AX1A 1MVQA 2DU0A 4YW5A 1N3OA 5H9SA 1CONA 1V6NA 3LSEA 1I1EA 2ARXA 3B01A 3AZZA 1WW4A 1W0PA 2EXIA 3SISA 1DYKA 5GZEA 1LHOA 1VALA 2GMMA 3AP4A 3PVOA 3O0VA 5JDBA 1W6QB 4AGRA 3AYDA 4YG0A 4Q8KA 3ASIA 3OYWB 4R9DA 2E51A 1DQ4A 3MEPA 2DVGA 4OZXA 1JN2P 4YZ4A 2P34A 1SCSA
chains in the Genus database with same CATH superfamily
1UY4A 2HWB1 3B9CA 1EP0A 2RS32 1YQ8A 2YY1A 3K77A 1GZWB 5F32A 2CWMA 2WLPA 3ZR6A 4NE9A 3WOGA 1DGLA 5LASA 2DCYA 5EXOA 2NMOA 1FPN2 4RSUA 4YVSA 1RIRA 4XDQA 4P9IA 3IDEA 1KJRA 4KBZA 4IEYA 1QOSA 2R6QA 1VBD2 2CNAA 3GYDA 5FYHA 4C1WA 3B7MA 1G9FA 4NIGA 1FMD2 2ATFA 2P3JA 3O14A 2ZGLA 3OPTA 1UPSA 4IERA 3VKMA 3T2QA 2HKXA 4AVCA 4BQYA 3Q8EA 1CZSA 4UAPA 4F3JA 2LRPA 1W3XA 4V1PA 3AMHA 3K3OA 4QU2A 5CU1A 3SCFA 3WZ1A 3ZN4A 5EYYA 3N9NA 3MBWA 4P9WA 4LO8A 4QX7A 2ZMKA 1UIKA 1FNYA 1AR92 1ULEA 2QDNA 2X5IB 3NMBA 2G4IA 4M00A 2GMPA 3PMSA 3RWNA 1G9CA 3URFA 3ON7A 5GZCA 1GMMA 1GKBA 3PTRB 3O1UA 5FUIA 1RUD1 4TXWA 2VCMA 5AC93 1SBFA 2YBSA 1YRZA 4JDMA 2WBKA 4NWWA 4QGMA 4LBLA 5IAXA 4H7LA 5LBBA 1QH6A 2O14A 1CVNA 3OSDA 1GYKA 1MEC2 2WRAA 3D82A 1VBA2 4BYYA 4JGZC 4LORA 4XOGA 5FQ0B 4XF0A 3ZVXA 4TLGA 3MHZA 2ZACA 3OGJA 4XJUA 3PTYA 1POV1 5CFDC 2QQIA 1AR72 5C9AA 4RHV1 4W65A 1MS1A 5F1RA 3SKJE 3DPRA 3MV11 5FZFA 5BNQA 4CUBA 2JDAA 2D6OX 2PFWA 4FSJA 2VMFA 2J7MA 2B8MA 4RS5A 4YVSC 4YARA 4O65A 4C1XA 5FXZA 1HXS3 4HSLA 1O6UA 1H9PA 4TN7A 4LEJA 2W3JA 1FI2A 3GNEA 4EN8B 1GP4A 1F35A 1ND2C 3OUHA 4CCOA 4PF5A 2QQLA 1O4TA 4KWLA 1MZ6A 2VUAA 2ZJCA 3HWJA 3ZPYA 1R091 4XVHA 1L7QA 3RZKA 1R083 2JE7A 4XJ9A 2UWAA 2XWJB 5FY0A 1KDMA 1H2KA 4CEWB 1C8M2 2WZR2 2VZTA 1CX4A 3W5MA 2RMU2 2BGOA 1H0BA 4IEOA 2NN8A 4FPLA 5LK7B 1SFPA 1U5XA 5KXDA 5F3IA 4Y1ZA 4OCTA 3R05A 1EAH1 2JG9A 5JVVA 5A7PA 5LBEA 3UV9A 2H0VA 1AR62 3NNMA 4OHXA 1ULGA 3HOBA 4RA0A 1PGL2 5A3NA 2XR4A 3KQ4B 3A21A 5IVBA 5CZKA 5B4NA 5JPMB 1P8JA 3K48A 1AYM3 4PI2A 4PIYA 4R52A 5FBJA 4XFIA 2Q30A 1DYPA 1PVC1 1CAWA 1YWKA 2R1BA 1HRV2 4FPKA 5I0DA 4K3UA 5IVYA 2PHDA 1DZQA 4M3CF 4R9BA 1FNZA 3AVRA 1SCRA 4YW3A 5HBAA 3CU7A 1RHI3 4JVAA 4Y4RA 4AF9A 3WNMA 5BYNA 4R9CA 1NE6A 1ZBE2 3E1F1 5EIYB 4XFHA 3RJ2X 4PIZA 2V4VA 4AVTA 5C9AC 5KHGA 5TSWA 3EHKA 3AL6A 4NHYA 4HETA 3AK0A 2D6NA 1ZBA3 3AB0A 1ZRRA 2C26A 3R4UA 1W2AX 5LK5A 4AOCA 1ND3C 3FBYA 4LKSA 4GMP0 4GULA 1OQEA 4I01A 3HJRA 2P17A 1C5HA 2D6PA 4MO3M 1OH4A 4I30A 2QQNA 3IPVA 3O12A 4OFGA 2V09A 4Y20A 5GLTA 2Q8EA 4BA6A 1FATA 1OBNA 1Q3EA 5JZGC 3KV9A 2EIEA 5JI7A 3PU8A 3ZOIA 2ETEA 3C7EA 1PNGA 1A8MA 4H3WA 1SPPB 1X50A 3AP7A 4AK3A 1UW8A 2HWC1 5K0UC 1VBC3 5CBLA 4OI0A 1PHMA 4DQAA 2QJVA 3PUQA 4QX8A 3RZLA 1J84A 1PVXA 1ODNA 2VZ1A 3MF9A 2MNGA 4KMQA 4EN0A 2Q1ZB 3RGBA 1NAEA 3FFQA 3AZYA 2YB7A 3DKWA 2P6HA 4JDNA 1U5ZA 4AEDA 3S57A 5LBFA 1DQ0A 3CZJA 1LHWA 4D3WA 4WM8C 1UX6A 2VZSA 2XKOA 2YDEA 4IESA 5BNPC 3ILRA 2VTXJ 4ISQA 3KLSA 4Z2AA 3I2IA 4YGDA 1R1A2 2PAMA 1QJU2 2Q1MA 2VULA 3LDKA 4MH0E 4CUGA 4GJZA 2R16A 3RQ0A 1IG3A 3RPQA 1NLSA 2IC1A 2OUHA 4Q0VA 4Q4Y1 4AR2A 1MACA 2BU9A 3C7HA 1UU4A 3I8TA 4UF0A 3D4KA 3I2KA 5K9YA 1GFF2 5JSOA 4QHZA 4LIVA 4BQ3A 2R0HA 1HRI2 1L7RA 2LW8A 4MGKE 4QU1A 3RI8A 1TME2 3H7JA 1YUDA 5A70A 4GKYA 4QQ2A 2A6ZA 5FZIA 1QJY3 2WA4A 1C57A 5FO9B 2VZVA 3TAYA 5IFPA 1WCDJ 5FZ8A 4ES9A 4IV1A 2UYAA 5FMCA 2CAUA 2VMHA 3OCPA 4A41A 1HV1A 4Z2WA 1RXGA 1SEFA 4PLMA 4CRQA 5CIRA 1W6OA 3WLUA 1DQ1A 3VZJA 1TNFA 1TQ5A 2XUMA 1S1AA 4Q4W1 1SLIA 4AEMA 2P2KA 4XF1A 4K9SA 1ASJ2 3OY8A 3UKNA 3PJYA 2UY8A 2VOKA 2WL1A 2QQOA 2ZGQA 4Q0PA 4Y4YA 1OXCA 3HT2A 5A33A 1WUVA 5IWFA 1XNDA 1AXKA 4QB6A 2D97A 4XCAA 3B00A 1HLCA 4H14A 4E4SA 1KXGA 2XMLA 1CAXA 1VB2A 4E2SA 1WW5A 5A32B 2ZZJA 3LGRA 1MS9A 2B46X 4JGZB 2HWB2 2VJXA 4IE6A 1JHJA 2ZX4A 4CU8A 4WZCA 1JZ4A 1E57A 4AEJA 5CFDB 4RN5A 4ASKA 4PLNA 2DCTA 4QXKA 5G04L 1V6KA 5FMDA 1CR7A 3B3QE 3F95A 3JQWA 4ORFA 4QKFA 3RMXA 1GQHA 4QX1A 2V73A 5FPUA 4Q29A 1PX4A 4YVSB 5FP8A 1STMA 3HQXA 3MF6A 1OUXA 1W2NA 4Q0SA 3O1PA 2AH2A 1XYOA 3LEIA 4OHWA 4XUNA 1BXHA 4CCJA 2P6CA 3U0ZA 1S0BA 3S30A 1G9DA 3WNNA 3HNMA 4OMCA 1ND2B 1JOJA 1VBB3 1CAUA 2W39A 4KWKA 2P5BA 1JTZX 2CDPA 2JICA 3QACA 2VW0A 2IFRA 3TNPB 1RHI1 1ULDA 2QCSB 2D93A 5F2WA 1ZRFA 1H8TA 3VZMA 1DGWA 1RUJ3 1HIXA 4AI1A 2BGPA 5B2GB 2DURA 2WZEA 4YM0A 5T50A 2R043 4O61A 1RUD2 2NMNA 4XPVA 5JSPA 1OA4A 1AX2A 2J22A 4PLOA 2X10A 4V2WA 3WDUA 4A6OA 4BDVB 2YU2A 3BCWA 3AYEA 2EXKA 3E6CC 5J1XA 3POIA 1X7NA 1QMJA 2RS53 3K4ZA 2RS33 5EPAA 2ZGSA 4OVEA 1VRH1 2BPA2 4MZUA 3DXTA 3E6DA 2CGPA 3VN4A 3IZOA 4WVMA 4COVA 2NP0A 1NX9A 1MVEA 2A75A 5L7OC 2DVFA 2WNUA 3CO2A 3ZXFA 3C7GA 3K51A 2IXCA 2FMDA 4FT8A 4DNYA 1N3QA 3FLTA 1GOFA 2PQQA 1PX3A 3Q9OA 5FV3A 1OOPA 5KHHA 4AQ6A 4CA9A 5C9AB 3ATGA 1FX5A 4B29A 3TN91 3GXUA 3OJBA 1QXJA 2RDRA 2W68A 2XBO1 3AXDA 3WG1A 4X6RB 4IUGA 3FMGA 1QNWA 3FHQA 1US3A 3BYWA 1UN1A 1JYVA 1ND3B 2VG9A 3M3QA 4KQ7A 4UW4A 1QQP1 3T0DA 1O3RA 1KGYA 1YJLA 5DABA 5DN2A 1W8TA 4HVOA 2R062 1XJAA 5AFEA 3CMGA 4LA2A 1R092 1SACA 5LBCA 4XC9A 3ZMOA 2BBVA 2UYBA 1UCXA 3BOPA 5JZGB 1ZZ9A 3JQXA 1W8HA 1DFQA 3ZMNA 1B35A 1LOFC 2BBAA 2HWE1 3KV6A 3MIEA 3ZSKA 3DEMA 4OI4A 2ZX3A 4RR3A 3D0SA 5K0UB 1EAH2 2AREA 3QLQA 4XEZA 5FO7B 3CHXA 2DUQA 4LIUA 5L9VA 1MEC3 3OG2A 1VBA3 1JODA 1AX0A 5EYXA 1HQWA 2B7YA 2ORZA 3LEKA 4FP2A 3ACIA 4LKDA 3T2TA 2E63A 3QOPA 1PVC2 1QHDA 2OUJA 5T5JA 3ST7A 4UI9L 1VRBA 4XF9A 4W8JA 3ZSMA 3CL1A 4WM8B 1GZTA 1OF3A 1UXXX 5BNPB 3I2DA 1UOJA 2ZX1A 4XHXA 4Y22A 1W8OA 2LALA 1VE0A 2GZWA 4DUWA 4AHYA 1XNCA 1RVF3 2CAVA 5JXGA 5DXDA 1JXNA 4Q4V3 3RYRA 4KI5M 5IK5A 5E88A 2ZHMA 2ERFA 5GJ6A 2VUDA 3I97A 2GH2A 5D8AA 4NAOA 4XDPA 5F3GA 3M4FA 5CEHA 1QU0A 4LO4B 3M3OA 3TEZA 4TZDA 1G6NA 3AMPA 1QJFA 2DV9A 2CL2A 2E9QA 4XFBA 5CKMA 2P37A 5KXEA 4DUXA 1AL0G 1W28A 1I5ZA 1LB2A 5FZEA 3IDBB 1O5LA 5A3PA 2FQPA 1JOBA 5C3PA 3H8UA 2WT2A 5DDJ1 5FYVA 4K40A 3T0BA 4BK4A 1QJX3 1AR63 1UOGA 2JDMA 2JDYA 2Z69A 3FX3A 2VCBA 5FLJA 3KHCA 3TBDA 4J1XA 4WM7A 2HWC2 1S0JA 2WNVA 2WS93 3FFZA 4JTOA 4PJYA 4PF1A 1YFYA 3PVNA 1HRV3 2ZX2A 1IPKA 1W9WA 4XCBA 1NKGA 1IS5A 4Q0QA 3PNAA 3KD4A 1W8UA 4QXCA 1N3PA 2WQ4A 3IB3A 2IUWA 3DYOA 1OA3A 3UT0A 3WF3A 2D40A 2OA2A 4JGYC 5LRSA 2IXHA 4N43C 5SV5A 1ULOA 3PMEA 2W5FA 1IKPA 3AKPA 1H8VA 3USUB 2ADDA 5J36A 1M4WA 1SG3A 4HKLA 4QX2A 4BH9A 1RUH3 1S0FA 5HXMA 1SLAA 1WMXA 3I2HA 4Q4Y2 2FDKA 3V0BB 2YPJA 3UYJA 4XF3A 1RXFA 1C5IA 1S55A 1W99A 2W0XA 2WN3A 4YM1A 4I3GA 5ABJA 3O1MA 2ZKNA 4JKMA 1LODA 2J1VA 2JE9A 4GKXA 3GGLA 5A6QA 4UF0B 4ASLA 3V64A 3D0JA 1S0GA 5ACA3 3DGTA 5T5PA 4D69A 2C0ZA 2PTMA 3W9AA 1AR83 3CZUA 3M70A 3MI8A 3GZUC 2RJLA 4Q4W2 1UOFA 3DL3A 1XYPA 3J4UH 2XVKA 3ZDSA 4YZ1A 3ZPOA 2R1DA 3EO6A 1POQA 5CB7A 5C3QA 2VL4A 4KH9A 5T52A 2JJ6A 4FTBA 4M3CA 5FUNA 2GC0A 4GJYA 4WM7C 4UT5A 1OPMA 3OF1A 3ZXAC 1GU3A 5FY4A 3B01A 4I0BA 5FPBA 1JI6A 3WP6A 5EJZB 1RB8G 2RDSA 4J1WA 5GZEA 3J7HA 4QDQA 4CPBD 3N9PA 5L7OB 2QZ3A 2ZZQA 3KB5A 4YG0A 3VL9A 5FZHA 1HQNA 1DQ4A 2E51A 3MEPA 2RDQA 2VOTA 4LULA 2HWD1 2P34A 4CPBA 2B45X 5T55A 4N7UA 2EXJA 1HRI3 5I0SA 3POGA 1UWWA 4ZZ5A 4NPLA 2ENRA 4L8QA 4PDWA 4BQ1A 5JCTA 3LWCA 1URXA 2VQTA 4XXPA 5DQ0A 1CIWA 1REDA 4CXYA 4HXCA 4FOQA 3DXUA 5APAA 1GNZA 2GNBA 4LK7A 4XW3A 1O5UA 1VB4A 2O8OA 1OF4A 2Z2SB 3T0AA 3JD73 1COV3 3RS6A 4LMFA 4YG6A 3U4SA 5ABJC 5C3RA 2FDGA 1RJ8A 2DFCA 1ZNPA 3BTYA 1YIFA 2PHTA 2BNOA 2VW2A 1PO23 3ZFGA 5CNAA 4LLFA 4BISA 5LB6A 5FR3A 2JD9A 2RM21 2WSUA 3WG4A 1ST8A 4MVTA 5FZ9A 1DLCA 2X8KA 4K21A 1WCUA 5IJRA 4ONUA 4DRVA 5J09A 4IEXA 1ZZ8A 5FP7A 3H3UA 3SHRA 2ZEZA 1UYXA 3OUIA 4E9KA 1S2BA 4ZHNA 1ODMA 1V6IA 1VLNA 4EROA 4P00B 3U07A 1WCKA 1ZZ6A 3ACGA 4AG4A 3V0AB 1LENA 1J3QA 1VRH2 5LZ6A 3OBRA 4Y26A 1DU3D 5T54A 1J3PA 3G6JB 4EWAA 4OUMA 2D3SA 4GWIA 2X05A 2C9AA 3PIGA 2XKPA 5CAZA 2QNKA 1GP5A 3I3QA 1DF0A 5FZ0A 4WVMB 5A3TA 2OVUA 2W1WA 4YVWC 4FO9A 2YZ4A 4N53A 3KQRA 1BBT2 3T09A 5JUVA 2AZ5A 1PIV1 3TN92 2PA7A 3I3DA 4QKNA 4XDOA 4XFGA 3RNSA 2XBO2 4UW3A 1NOVA 5FZMA 4AHZA 1Y9MA 4DXRA 4EZ4A 3P3PA 4CP9B 4NMIA 2W1UA 3ILNA 4A3XA 4YGEA 2Y33A 3NVCA 4HKWA 1MS5A 2PHXA 1PMIA 4GB31 1QQP2 2DBNA 3SH3A 3MYXA 1DQ6A 3RYPA 5KWRA 3WUDA 5EHDA 1RUE3 2BJSA 4HT1T 4TWTA 2FCTA 4GH4C 1O4ZA 1PZ8A 4ZY9A 3THPA 3OYWA 5L9BA 2V5YA 1VMFA 3LSDA 3OPWA 4XMAA 3VBRC 2HWE2 2X09A 4HVQA 3D8CA 4EWEA 1WLTA 1XOYA 2LROA 3L9JT 3VDDA 5A7SA 3ZN6A 5FYUA 1ALYA 2WWJA 4L9BA 4OZOA 4YM3A 1PO11 3FHAA 3J8F3 2BOJA 5A1AA 1AUYA 1H30A 2PHWA 1LTEA 1T2XA 2W47A 4BU2A 2OPKA 3RJRA 1WW7A 4LT5A 2IXIA 1YQ5A 4OUEA 3B93A 3O1VA 1JZ6A 5JOZA 4E4HA 1QF3A 5JMOA 1CZTA 2ZGKA 3WNLA 3LD8A 5F3EA 4JGYB 5J7MA 1W05A 2PN5A 3GM8A 4N43B 2MHFA 3RZJA 3NJVA 2VH9A 5C8WA 3NL1A 3T08A 4IEQA 4FTEA 4AI3A 2C4XA 5IUQA 3N9QA 3UKVA 2JE8A 5FDBA 3ZX7A 2WA3A 3CJIA 1YFUA 2VY0A 3EXUA 4D6RA 2BOIA 1AJKA 3H1MA 4XIKA 3UESA 1EV13 4ATFA 4XE9A 5FWJA 4XIOA 4N53C 1R64A 1NUKA 2JKBA 4CDWC 5BNOA 3G7DA 3X29B 3ZO0B 4GMP1 5EZWA 4LBMA 2I74A 4FOWA 3KSCA 4CCKA 1X8EA 1VMJA 1PGW1 4UFIA 1IS4A 1X8MA 2WO3A 5JMCA 2EAAA 1RUG1 3N7MA 4NRMA 3FC0A 1UD1A 2HLEA 2Y6LA 2HWF1 1GZCA 4CZSA 3NNLA 2WQ8A 4Q4X1 3NQHA 1ZA4A 2QQUA 5DDJ2 4FPYA 1XE8A 2VVFA 4AGGA 2D5FA 4BXFA 1CJDA 5FREA 2R073 5KXCA 4YPJA 4D7SA 1APNA 1F15A 3RZZA 3PUHA 2OPWA 4HPKA 4ZONA 1MQTC 2VMIA 3ZKYA 1ENQA 1E5IA 1W0NA 3JD71 3ZR5A 5FMBA 2ZGTA 2MEV3 5KXBA 3WW4A 2VECA 2WFF3 1EY2A 1HKDA 2OS2A 2D6LX 3GCWA 3CLPA 4N7IA 4FPFA 5A6ZA 1CAVB 1WMDA 4YM2A 3ETPA 2WFPA 2E33A 4XAAA 3U37A 4G4FA 5GLWA 2YUEA 1JZ7A 1LGNA 2GALA 2H6CA 3AKRA 2GP5A 4YW7A 3R4SA 2A6VA 2J1AA 1ZRDA 1ZRIA 2WC2A 2RV9A 1RUC1 2WLQA 4P02B 2GSYA 4CCEA 2Y60A 5LW9A 3I4IA 1AF9A 2Z5WA 3VBFA 2XJPA 3O0XA 2VM9A 4AXOA 1S2EA 3FJSA 5E16A 4CP0A 2RDNA 2Q5TA 3NRUA 3OBTA 3OGVA 3QH7A 4ARXA 4B4PA 2FDIA 1AYN3 3CJIC 5FRAA 4R9AA 1LHUA 2J1UA 4YGBA 4CEYA 5IK8A 1UX7A 4UYBA 4IGPA 2EIBA 5ABJB 2R0FA 3LKJA 4AVAA 2RR12 4W50A 3S6PA 4I2OA 3VBOA 1QJZA 4WV8A 4JZRA 1C8NA 3THTA 3GALA 1D7PM 2K0GA 2YU1A 3LF7A 5A7WB 1QXRA 2AEYA 1RMU3 3ZFEC 4AI9A 1G86A 1W3VA 3VBHC 2XLFA 4LPLA 4LHNA 1OKQA 1W6PB 1WZXA 4LK6A 1V00A 2PLV1 2PQSA 3HR9A 4XUQA 3H3LA 3ZXKA 4P9GA 4UW5A 5FZAA 3WDXA 3C8XA 3DKQA 3EBRA 1V9U1 3KGZA 2VZOA 1DIWA 2GDFA 4FI9A 1B09A 1MS4A 1HB1A 4M3CB 4E27A 4R8HA 1J3RA 3MLLA 2CDOA 1H9WA 1LESA 1YFWA 4UFKA 2SLIA 3ITQA 2VGDA 4CDXA 3WW3A 4IGOA 3RZMA 1FV2A 3ACFA 2YPDA 1IS6A 1JS9A 3MIHA 3PIJA 4C91A 4YVWB 3VKNA 5LA9A 4UFJA 3WF2A 3POSA 2HWD2 2W52A 4WBBA 1N47A 3E5QA 4NIIA 1RTVA 4RQPA 2UY9A 3MW3A 5CVRA 4QGNA 3WW1A 4B4QA 2ZMNA 3AMQA 3M3IA 4MGIE 3MO4A 3OUJA 2XQXA 2YFUA 3DECA 4XURA 3MPPG 1SQ4A 4PT6A 1CJPA 5DAQA 4BQWA 2XJSA 5C71A 4QAWA 5DUVA 3JB4C 3UKTA 4CEYC 1AL23 2XUEA 3ZXGA 5D21A 1EYBA 1K5MA 2C1FA 4V2VA 3AZXA 4GH4B 2EAKA 4HANA 4RGAA 3J26N 1TMF1 2RM22 3ZYPA 3OGGA 5L19A 1HB2A 1BCXA 1NCQA 2YC2A 3KT1A 4NHXA 2Q1FA 3IM0A 1R1ZA 5FJKA 3VBRB 3H8OA 3EJKA 3U10A 4HN1A 3Q8FA 4OMDA 2A6YA 3KF5A 1NA1A 4Y5SA 2VVEA 2BFUS 1O91A 2ILMA 3AJZA 3J7LA 1NY71 3TWIA 2AC1A 1FAYA 2FDJA 5JSRA 1GP6A 4B1MA 4LBQA 1FXZA 2BERA 1JBCA 2BEOA 4IW3A 3ZSJA 4XUOA 4EWDA 5FPZA 4OQ8A 4ISRA 3ZYIB 3ALQA 3Q8BA 4MXWA 3HT1A 1RUNA 2ZMLA 1YQCA 1D4M3 2I45A 1OLQA 2PMWB 4QPIA 3DPRC 4TLFA 5FY9A 1BEV1 4YSFA 5C4WA 3JXSA 3D3AA 1JUIA 2WO2A 1L3JA 3ZSEA 3AFKA 4RS5C 1CQ9A 2RS13 3CBNA 3H1YA 5LA2A 1LEMA 3MW2A 3ZXEA 1PIV2 2KR2A 3BGAA 4FBFA 3GZEA 4N8MA 2J1EA 1GQGA 2XQRA 4CDWB 1LGBA 2BWAA 1SLLA 4N53B 5ERLA 5F6LB 1WKYA 2J1RA 3P6BA 3JBG2 1AXYA 1DCSA 1Y4WA 2CYFA 3GHMA 3JUUA 3U78A 5A3MA 4GB32 1NCRA 1DZRA 1LOAA 4S2GA 3I59B 5IVEA 2A3XA 2VZRA 4JV4A 4BOWA 3IWZA 2EICA 2XJRA 4W4ZA 4XTMA 5F5QA 3KHBA 4IEPA 1OA2A 3NV1A 4LQRA 4BM8A 1K42A 1DGWX 4IE0A 1OLMA 5FZOB 2VVDA 4NHKA 3QBQA 2WNOA 2VNGA 5C3OA 2JG9C 1Z7S3 2WNEA 3IAQA 3Q8CA 5FYZA 1A3KA 4B7KA 4Z1VA 4LJHA 1MQTB 2ZOEB 2XVGA 4QKBA 1QWRA 4YRDA 1PO12 3LFIA 1WW6A 3BN6A 4CU9A 2FD8A 3S5QA 2JENA 3S7EA 1XQNA 2X29A 4H55A 1KITA 5LWBA 1NA1C 1NG0A 4Y1VA 5H9QA 1XB9A 4M4PA 1PK6A 2YC4A 4HSJA 1GBGA 4Y5Z0 5AC91 1NE4A 4JAAA 3H0OA 3JCIA 5FTTC 4D7TA 1T6BX 1W6NA 1S2KA 4OULA 1ZA7A 2LTNA 3RYKA 4QWNA 4QPIC 1W8WA 3N4MA 3WD5A 3VDCA 2D6MA 4EN7B 5C4WC 2ZEWA 4TSVA 4XYXA 2F17A 2WZPP 1XU2A 1F4AA 1UYPA 3CJIB 4QXBA 4META 1XSQA 3PUSA 2KM2A 2WN2A 5GM0A 3SLIA 1PGW2 4D8MA 5FAXA 1RUI3 4BQ5A 2QKDA 1HXS1 1RUG2 3BALA 1K12A 4IE4A 1NQJA 4NOTA 2NPIA 1H2LA 1NCRC 1CPMA 5H9RA 2IFWA 2LUWA 4IDZA 3FUOA 1UKRA 3BI3A 1GZ9A 2ORXA 3N35A 4Q4X2 4XXAA 4RFRB 3TRSB 4A44A 3T2OA 4IE7A 4XTPA 3ZFEB 3VBHB 1WCSA 2ZGPA 2PAKA 1R081 1GNYA 2PXJA 3ELNA 1O4YA 1WA4A 4BK5A 2VZQA 4AEDC 1KD7A 2ARAA 4KG8A 2ZX0A 3S0MA 5IATA 4FAHA 5H9PA 2GAUA 2G9GA 1D0GA 2AEZA 1V6MA 1OVPA 2Y0OA 2YBKA 1PK6C 5LA0A 3AX4A 3MFAA 1AYM1 5JIAA 1RUF3 4B7EA 3ACHA 5CA6A 3WQ1A 1GICA 4DZGA 3S7IA 1N1SA 4A42A 3CNAA 3VBUA 1Q8QA 4COZA 2Y26A 1IGOA 5GLZA 3VV1A 5FOBB 1QY4A 4PQ9A 5D1IA 1FOD3 5A7QA 1A78A 3H7YA 4J25A 4LO7A 1EUTA 1W6MA 1U5IA 4XILA 1SBEA 4AVSA 1BKZA 1VAMA 2WABA 3W59A 4YNIA 4LE3A 4BPZA 1ENRA 3BKZA 4CEYB 4M0HA 3VHRA 1H2MA 1EUUA 4IV1C 5LA1A 4MHRA 1V70A 5IW0A 2P3IA 1ZBA1 3BIEA 2W91A 3M3EA 1VBE3 2XXZA 1YNAA 2GNDA 1OD5A 1FT9A 3ZYGA 4OI2A 1UYZA 3POJA 3N7JA 3HEIA 4JKLA 3DN7A 1DQ2A 4DXTA 1A34A 4XFCA 2PLV2 1REFA 3VHPA 2VNOA 1FPN3 5LATA 5CFCA 1W2UA 2Q8OA 2PHFA 3C3VA 2VCCA 1VBD3 2Y6JA 5FO8B 5DZGA 5EQUA 4RHV2 1VBC1 1O8PA 1RGSA 1IS3A 2DBIA 3P3NA 4KWJA 1FMD3 2W46A 3J7MA 1WLCA 3N3HA 4Q2FA 5HV4A 5I91A 1OFSA 4F83A 2B5HA 3DPRB 1AX1A 2QUOA 2OKXA 1N3OA 3LSEA 1I1EA 2ID4A 2BZDA 4RS5B 4AQ2A 1TE1B 4FCAA 1W0PA 2VXJA 2BFUL 3AM2A 3VZNA 1LHOA 1VALA 2G9ZA 1AR93 2A73B 2CGNA 2GMMA 3PVOA 1X33A 1BHGA 4FXKB 4AGRA 3H8XA 3ASIA 4AI2A 1D4VB 4R9DA 4BHPA 5ISLA 1JMUB 2K46A 4PQQA 1JZ8A 4AW7A 1JN2P 3A7QA 2JXAA 4HLTA 1SCSA 1LR5A 3ZYBA 3ZXDA 1JYWA 3E6BA 1WD4A 4AE2A 1DP0A 2G19A 5JXHA 4Y24A 1OFNA 1H8TC 4K1ZA 4BLIA 1SMVA 5I0TA 4LTAA 2E26A 1NXMA 4I3PA 4RL7A 1UQXA 4FAGA 3MIFA 3N9MA 5DMYA 2QDRA 2OZJA 5GLVA 2NM1A 3RZGA 1TMF2 4XJAA 4GD4A 5K4LA 4CVUA 2BVBA 1OSGA 2E6VA 2FCUA 1QJY1 2JG9B 3P1IA 3WF0A 1N1YA 4BLJA 1KS4A 4XABA 4DIQA 1IQAA 3EQEA 4QT6A 1ONAA 4QM8A 5C5TA 4O9GA 2VMCA 3K46A 1N1TA 1AR73 1NY72 3Q8AA 4Q26A 2F4PA 3WW2A 3NO8A 3HQRA 5IVVA 1NA1B 3LOIA 2LM3A 3MUY1 3UGGA 2KD7A 1CAWB 2ZHKA 2WAOA 2OW4A 4P14A 1UZVA 1FV3A 3NAPA 4H7MA 1LEDA 1BMV1 2D6KA 1F31A 2QVSB 5AFBA 4QB2A 3SQOA 2WNUC 3ZM8A 1HN0A 1BEV2 2TEPA 3VHNA 4E2QA 4CDQA 1NT0A 2GMEA 1H4GA 5FZBA 1ZX5A 1OOPC 4I0WB 4QPIB 1XSRA 4JX0A 4IXLA 5DAPA 3VBSA 4FQ4A 4INDA 1NZIA 4YZ5A 4CUCA 1JOPA 5C4WB 3AKQA 1MPXA 3VZKA 2WINB 4NPRA 4ZXKA 1C8M3 2WZR3 4EJRA 2L9LA 4IV3A 2RMU3 2QQWA 2TUNA 1PZ9A 3AKSA 4AFCA 1JU3A 1XE0A 2X53S 2FZ1A 2ZS6B 4GWNA 4XBNA 5FBZA 4CDUA 1GV9A 5A6XA 5JWPA 4QMAA 1W8NA 2XOMA 5JPNB 3DCQA 3IPVB 3C7OA 4Y20B 3MGUA 5FK7A 1NCRB 4XFFA 2AYHA 2WWUA 1IPSA 1NZCA 1X36A 3VD7A 1B35C 4FPHA 1VBB1 1YXWA 1W06A 2I2SA 4XHBA 3MV01 4KGQA 4RR3C 3I3EA 4W6YA 2VQUA 3MICA 5HCBA 1YCIA 4QXHA 3RG0A 3VKOA 1YQ2A 1LGCA 2RVAA 1RUJ1 2C6SA 1W6QA 5FYMA 3ZFFA 2UWCA 5DUXA 2XONA 2DVBA 3T1MA 2R041 1ZBE3 3R4DB 4AEDB 4CSWA 5C8CA 2GNTA 4LOTA 4GZ9A 3I3BA 1UF2C 1WBFA 4SBVA 5AC92 1QIQA 4LOSA 3RVHA 1HJFA 2HBUA 1JHNA 4K20A 1XRUA 2D3PA 5FP4A 4FFFA 1GQPA 1PK6B 4KBBA 4FTSA 1E5HA 2RS51 2RS31 1CPNA 4MXVA 3T2PA 3O1RA 4M3CE 1F5JA 1YIPA 5FZ1A 4BMEA 4AVVA 3AYAA 3NWKA 2WO1A 2ET1A 2WJSA 1ULCA 3NJZA 3PDQA 3JBG3 3WQ7A 2QFEA 3ZN5A 4GAZA 5D8AC 2YYOA 3VBSC 3FN9A 1XC6A 3UNPA 2VOVA 5J48A 1Q8OA 4NROA 2ARCA 4YZ3A 2ZAAA 4PI0A 3AJYA 4IV3C 4BWOA 2HBTA 3HBZA 4IV1B 4LA3A 1BJQA 1HXS2 2DUPA 4XETA 5FFOC 5CYYA 3RWKX 4YW4A 2JDUA 3AP5A 5J96B 2X5IA 2K9ZA 3BB6A 4ZPIA 1W6OB 1W90A 1UMZA 4AQTA 2B9UA 1I5PA 2YHJA 3OY8B 3WXPA 2ZGMA 2D3RA 4CP2A 1MS8A 3B9IA 3BOWA 3NNGA 4K8FA 4XACA 5A3OA 1QXPA 5A33B 5GLUA 1R082 2WNVC 4DFSA 1DZTA 1Z0HA 3BVCA 3IMMA 1CGPA 1W8ZA 5I0UA 3SCHA 2V72A 1CAXB 4F7ZA 3PUAA 1R1A3 1QJU3 4RGGA 2D7FA 4OHZA 1ULFA 2DVAA 5FYYA 1MEC1 1VBA1 3H3ZA 3L2HA 2ET7A 3PLQA 1AYM2 2VZ3A 3KM5A 4LHLA 4URTA 2WT1A 1XU1A 1TME3 4OI1A 4AZZA 5IVCA 5IYYA 5HCHA 4CCLA 3UJQA 2NLRA 4JDOA 1JYTA 5C3SA 3H42B 4YLZA 4LO6B 1KJLA 4AYUA 5KHJA 5IK7A 1WD3A 2F6BA 4SLIA 4FPOB 4X6QB 2ZEXA 3UJOA 3OGSA 4LBJA 3LOBA 1NQDA 1RHI2 3HD8B 3WEZA 3HN3A 1RVF1 3ZYFA 1YI9A 1O8SA 4LBKA 4MG2A 1ASJ3 1CAUB 1GUIA 1MZEA 2VQ0A 3AZVA 4IL7A 4Q4V1 4TTGA 2ZGRA 4DPNA 4HONA 1SDDB 1H1IA 2W2IA 2Y64A 2BYVE 1QEXA 3LAGA 1H8TB 2VOXA 3OD4A 1WA6X 3POEA 4QB1A 3KT4A 3WG3A 3AMNA 2A1XA 2WZ8A 5CG8A 3ES1A 4JCKA 1ZBA2 3SMHA 4CEWA 5L36A 2JECA 2D98A 2E53A 5BXXA 3SNMA 3HAGA 5FKBA 3A0KA 2HWB3 5EJ1B 3T4VA 1JYNA 2ZKLA 3B5LB 2ZGNA 4Q1PA 5HXVA 1XE7A 5C6CA 1UY0A 4WZFA 4JTNA 1QJX1 1AR61 3AMMA 4AI0A 4UFMA 4MGZE 3IBMA 5BNNA 4L92A 1VBC2 1J1LA 3O7OA 4BXSV 2WS91 1W2TA 4M4RA 3VB9A 4BE3A 2D5HA 2WNUB 1H1MA 4XUTA 1TG7A 3JB8A 5F37A 1HRV1 2GP3A 2I07B 1WGPA 1NXD1 2XJUA 1IPJA 3GDBA 1PGSA 3F2ZA 1OOPB 3HNBM 3HQUA 3WP4A 4WVVA 5I8SA 1LECA 2XL9A 3MLJA 4KGGA 4PDWC 4NVPA 1YI7A 1UIJA 4HZFA 2XG3A 2JIJA 4RYDA 1D2SA 4NIAA 3VLBB 3WUCA 3WNPA 4CXXA 1SLCA 4XMIA 3K4DA 1RUH1 1AZDA 2ZGUA 2QQKA 1RUD3 4CU7A 4J6GA 1IKQA 2NZ9A 2QQJA 4AQSA 1Y9GA 2RJKA 1OURA 2AENA 2YGMA 3LZZA 4PIXA 4Y33A 5FZGA 4BIOA 4ZU7A 3ZFGC 4X8PA 3THDA 3QD6A 1D0HA 4D0QA 2UWBA 1B35B 3KGLA 4FFGA 3U14A 2NYYA 1CD3G 4E4ZA 2BP6A 1UAIA 5ACA1 1PMJX 4FVVA 1SPPA 2VR4A 3M8LA 4RR3B 4BB3A 3VD9A 1QJY2 1W9YA 1LOGA 4C8DA 1AR81 5DPNA 4ZU4A 1POV3 1W8FA 3MZHA 3W58A 4RHV3 3IMNA 1VAKA 2B9VA 3I3MA 2XJTA 3HMYA 4NRQA 3M2MA 1G8WA 1S4CA 2EALA 5J37A 4Q5OA 1TZOA 2V4AA 3SH4A 4Q0UA 4AWDA 3OPZA 4LXLA 4URAA 1BMV2 4AVBA 3D6EA 5FIXA 4Y22B 5BNNC 3BPSA 3LFMA 5JAXA 4OYUA 1DLLA 1UMIA 4W6WA 4D6QA 1WWYA 5FJHA 2R063 3BIWE 3C7FA 2JX9A 4K1YA 4UBGA 5JOWA 1R093 4XQDA 4FOYA 5FXXA 2OT7A 1R1A1 3NNFA 4BMBA 3POFA 2JDNA 5D8AB 3KCCA 3VBSB 4C90A 4NIHA 3WINE 5FYBA 1N1VA 1F4HA 1OLRA 2C9KA 5G05L 2CHHA 4JQRA 3NKGA 4OQ9A 4AL9A 2DYCA 2OQ6A 4E4DX 2P3YA 1SZBA 2C5DA 5A3UA 5IVJA 4B3NA 1HRI1 1EAH3 1SBDA 4IV3B 5BUVA 1JUHA 3JU9A 5KHKA 4PBOA 5SV8A 1VR3A 4LE4A 5HCAA 1T6GC 4YG3A 2Y34A 5JXIA 1XYNA 1I6XA 3IT8A 1VBB2 3GZAA 4UFHA 1PM7A 1IG0A 1COV1 1PVC3 5FUPA 4WM7B 3SEPA 3ZIXA 2VTFA 2VW1A 3VDDC 3NJYA 3BU0A 2WNVB 3NW4A 1GWLA 1PO21 5D2AA 4YW1A 2CY6A 3FLRA 1RUJ2 2QZ2A 2BQPA 4YYOA 2LS6A 1OQ1A 3BUCA 3V56A 2HEVF 3FBMA 2R042 2QQVA 1OI6A 3GBGA 4I0AA 5DG2A 5A32A 3KT7A 5FLHA 5EWSA 3H1WA 2OYZA 4JGZA 5FZ4A 3K3NA 3VD4A 4FXGB 4QX3A 3A4UA 5F5CA 4MHUA 2A6XA 1LOBA 1GR3A 4IETA 5CFDA 4RD7A 3VZOA 3ABZA 2RS52 1JZ5A 2RE9A 2ZABA 2VMEA 2DUOA 3MUZ1 1LKNA 5FP9A 3WDVA 1JYXA 4LBNA 4ZU5A 2VNVA 2VPVA 3RRDA 5K7PA 3QCWA 1XXNA 3FE5A 4XAEA 5FWEA 1BLZA 5BNOC 4IE5A 1ENXA 2DU1A 2UURA 3MIBA 4N90A 4TYSA 4Y1XA 3ZLIA 2NQYA 4P9JA 5KBFA 4XBQA 1BVVA 1ND2A 1QJEA 3WDYA 1HB3A 3CJXA 2CU5A 1LRHA 4AFDA 2HWC3 1J1TA 4C0HA 2O1QA 2ZBJA 4JRLA 2JG8A 4NPMA 4DOUA 3KVAA 2OZ6A 3C2UA 5LCWL 1ZM1A 3ZYJB 3E97A 1ZZBA 4GIQA 3LE0A 4AAPA 1OC1A 2R49A 2WAAA 5EP9A 2CV6A 1OHFA 4IEUA 5BV6A 2N7GA 1ULPA 1O59A 4LKEA 1RUE1 1QNYA 2W95A 1YYNA 2ZCWA 4OHYA 3O1TA 4FPGA 3PJQA 2ZA9A 2DWRA 3ZDVA 1VIWB 1LULA 1ENSA 2Z4FA 4S2DA 4CCMA 3ME2A 4Q4Y3 5FCCA 1C1FA 3KCXA 3J8F1 4LHKA 5FY1A 3ZXJA 2YFZA 2VAUA 2YXSA 3PU3A 4GXLA 2EXHA 1BK0A 4GWJA 2ZTNA 3ENRA 1OD3A 1UZZA 4ITCA 3VBFC 1F9KA 4A45A 4ES8A 1XNTA 3LEMA 2PHUA 4PDWB 4XUPA 3RI9A 3VUOA 4YWAA 5CG9A 1W9TA 3N7LA 1ZREA 2DTWA 4LBOA 4UWDA 4CCNA 1KDKA 2B4KA 5A1LA 2GC3A 4QPGA 1TEIA 2QQMA 2WR9A 4PBPA 1KRIA 4L99A 2VD7A 1RVF2 1ND3A 4Q4W3 4U2AA 5GZDA 3ZXLA 2VUCA 2FDFA 4Q4V2 3UGFA 1C28A 2W1QA 3VBOC 1LU2A 1EV11 4CCDA 4GA9A 3IDCB 5JOXA 2GC2A 3S5AA 4XQWA 4YFWA 3ZFGB 4LBQD 3APBA 2R061 4QQHA 2CSGA 1Z78A 4RGKA 3AXEA 2BDRA 2A70A 4IGQA 3USSA 4ATEA 5JZGA 2E7QA 1UPIA 2JG8C 1HW5A 1OT5A 3RMYA 3ES4A 5T3NA 3N9OA 5K0UA 5HCFA 2JDPA 4E8DA 2P3KA 4NJ4A 4EN9B 2W08A 5ANQA 3T4HB 2XH6A 2VU9A 1UKGA 1U12A 1EPWA 1I9RA 1QJX2 3D5OA 3M1HA 5KC5A 2R071 5HI0A 1O3TA 5E6HA 3POWA 3I2JA 4DEQA 1ZYBA 1J83A 2HYXA 2JB4A 1OLME 2JDZA 5FZ6A 4CDXC 2AACA 5C5UA 4Y5TA 4WM8A 2WS92 1AJOA 5BNPA 3AFGA 3ZYRA 4MUVA 2MEV1 5BNNB 5JOYA 4GQ7A 1S0EA 4JQTA 5FXVA 3WQ0A 2DFBA 2WFF1 3QH6A 1RL3A 1OKOA 2AGSA 2PHLA 1BK1A 4RQPC 1LOCA 5GZFA 4B4RA 4O9EA 1SLBA 3ILFA 1DYOA 3ORJA 4A2UA 2XPJA 3POYA 3SH5A 4N9HA 3GF6A 3SCGA 2OXBA 1MVQA 4P5YA 5H9SA 2ZAHA 5KHIA 3OEBA 1V6NA 4HK8A 1UYYA 2ARXA 3U1XA 3AZZA 1RUH2 2R32A 4A7YA 1YHFA 1NLRA 1H4HA 2E32A 1WW4A 5F8PA 4QPGC 2EXIA 3SISA 3BPZA 1DYKA 2VMGA 4HK9A 1O3QA 3J7NA 5JDBA 3O0VA 1K5MC 4MGYE 4QHBA 4MOAA 1W04A 3AYDA 1AYN1 5FPXA 4Q8KA 1J59A 4A3ZA 3OYWB 3VD3A 1NCQC 1SFNA 1X9PA 5EV7A 4O7XA 3VD5A 1VRH3 5ACA2 1EPZA 3VDDB 1UU5A 2A3YA 2B39A 1WBLA 4LHSA 3ZN6B 1SLTA 2EIGA 3HN1A 3EMRA 4DY5A 1AR82 3R6SA 2IZWA 1H6XA 2XVLA 2GN3A 3IIIA 2WT0A 4LUKA 4CXWA 4HG6B 3CDZB 1XBFA 1Y43B 5A80A 3VDAA 5I8TA 3V65A 1RMU1 4K8RB 1HN1A 4PHZA 5KR7A 4KU8A 1PNFA 2OIIA 3TEXA 4X8NA 2HYKA 1BBT3 4OUSA 1RC6A 4KG0A 1QKQA 4QD2A 3U75A 1UMHA 3TN93 3DF0A 5F5AA 2BRTA 4LO5B 4Z8BA 5I8YA 2XBO3 1BQPA 1OH3A 2P1BA 3U11A 2RG4A 1YLLA 3W21A 3USUA 5E1RA 2C24A 4ZS2A 5JXJA 1QQP3 2W9XA 2V5DA 5FZKA 3EYPA 2JKXA 3W20A 3GHNA 4QX0A 1WLWA 2BVVA 5FZ7A 4JC1A 3V0BA 4YW6A 2Y6HA 5BNOB 2DVDA 4Y3OA 1QDCA 3OBZA 5DUUA 1YO8A 2EA7A 1CESA 1CZVA 5FPVA 2HWE3 2HWF2 1DQ5A 2VNRA 4MLOA 2E31A 3WX5A 1XNBA 1TNRA 2PHRA 4JHZA 4HBNA 1QGLA 3MW4A 3UGHA 3KVBA 4E8CA 1C4RA 1SHWB 2BW8A 4NN0A 4W6XA 2XLAA 2RJ2A 4UXAA 3W5NA 1GWMA 3JD72 2BUKA 5LY2A 1COV2 1RJ7A 2VMDA 3MIGA 3N7KA 5CADA 3LA3A 3SEEA 2XWBB 4NR1A 4HPKB 1AL21 3A0NA 1PMHX 2XHNA 5J3UA 2D44A 1A6CA 1DGRN 1PO22 1S0DA 2A5ZA 4HKOA 3JZVA 4WVZA 3VKLA 3VKFC 2XHKA 2Q8CA 2DF7A 3I2GA 2A7AA 3WNOA 1C3HA 2DCJA 3ETQA 3OEAA 4FP3A 3SC7X 2HEYF 1YFXA 4XFAA 3IN9A 3NV2A 1K5JA 1VJ2A 4L97A 1RUC2 4AEKA 4ZS3A 1IQDC 5L7OA 2R30A 1POV0 1YQ6A 2WSVA 4A4AA 1RYYA 2WYFA 1OVSA 4GWMA 3VBFB 5IFTA 1L7LA 3A22A 4K7JA 1BVP1 1UNBA 1V6OA 5EFUA 3KWVA 3RDIA 1D4M1 4NAMA 4XZPA 4EYUA 3LA2A 5FOJB 1OMIA 5GZGA 5JI9A 5A3LA 3BTZA 5DDJ3 4CYDA 2VQAA 1UZ0A 4C0BA 5FPAA 4KWUA 2XGXA 1M06G 2RS11 1SFYA 3AP9A 1UL9A 3NJXA 4EZHA 3ROUA 4EN6B 3RSJA 3VBOB 4P9LA 1JYIA 3AZWA 1ZRCA 1G7YA 1UU6A 1VAVA 3HBKA 4DS0A 4FFHA 1J58A 1FYUA 4Z07A 1O3SA 2TBVA 3FUQA 3FL7A 4DXZA 2JIGA 3ACLA 1QH7A 2EIDA 1LOFA 2JG8B 3KV5A 3NNJA 3HIFA 4H2AA 1V9U2 2VE1A 2SBAA 4NHMA 4KL1A 1YEWA 1RUE2 1IZ3A 2Y6GA 3FWEA 4UFLA 4QQPA 1YC61 2VC9A 4DMIA 5LY1A 2IXKA 4CU6A 3LDRA 1GANA 3N36A 1Q43A 3WP5A 1GWKA 1HJGA 3GBWA 2AUYA 4OLLA 4MGTA 3V0AA 4NO4A 1Z7S1 4A6SA 2YMZA 2Z79A 5IHRA 4XZUG 4Y1UA 4XJZA 5CKQA 4CDXB 2XJQA 1Q8SA 3ECQA 2JB8A 5L9RA 1MZFA 3J8F2 4KU7A 4FFIA 1IHMA 4I02A 4BZ4A 3NKTA 1OPOA 4A7ZA 1CWPA 2BV4A 2IXJA 5F9TA 1VPHA 3I2OA 2Q0AA 3KCYA 2G9FA 5K8SA 3LDBA 3CEWA 1GNHA 4JKKA 5F2SA 4RQPB 3VBUC 3MIDA 2RR13 4EQVA 3BODA 5DG1A 5IVFA 3WQBA 3MLKA 3O0WA 3VZLA 1QDOA 1BBT1 4CP9A 2XDVA 2Q8DA 2PELA 4QDRA 2KXLA 2CTVA 2H6BA 2DCZA 4FPEA 2CGOA 3R0RA 3O1OA 4QPGB 3AL5A 1JW6A 1EV12 4NUBA 4AI8A 2QQPA 1K5MB 1UY2A 1LHNA 3I49A 3L2YA 1NCQB 1OQDA 3FLPA 1F5FA 4M0NA 3BU7A 3H8RA 3T3YA 3WF4A 1HDKA 2ZGOA 5M0TA 3OOXA 2FZ2A 2FBEA 4CTEA 1HV0A 5FLIA 1RUI1 3M7AA 4DB5A 4QPYA 4QQLA 5FZDA 1VP6A 3OGRA 4LNVA 4COUA 1F8VA 5CFCC 3WDWA 2DTYA 5T5LA 3HVDA 3NV4A 4LBQB 3TEYA 3RZHA 2HWD3 1V0AA 3DYPA 2A6WA 1KFXL 2R072 1DBNA 4QQOA 5A3WA 3LIHA 2VXRA 1UZYA 3NSTA 4MXWB 3WHTA 3LCPA 4A7KA 4JGYA 4BQ2A 4N43A 3AP6A 4RFT0 4BCUA 2H0BA 4L11A 4OHVA 2MEV2 4M01A 3LPGA 3THCA 2J42A 2WFF2 4HMZA 2XB6C 1C1LA 1Q8VA 4G3YC 5DUWA 2ES3A 1BZWA 2BWCA 2VTXA 3ZSLA 1V6JA 2JD4A 4CUAA 1H1AA 4LUMA 4MSVA 3K2OA 5FZ3A 3KS7A 2QBXA 3WHUA 1RUF1 3WSOA 2Z42A 1W9SA 2RM23 3I54A 2E7AA 2ZPXA 3H50A 4FOVA 4PCRA 4R4XA 4K6BA 3TB0A 4AFBA 5I93A 1U0AA 1LU1A 4YZ2A 1F2NA 4DEVA 2BNMA 4EE2A 2BTVC 3TNQA 1LOEA 3WDTA 2O8QA 5F5IA 2ZHLA 1LAJA 1YJKA 1LCLA 4AFAA 1FOD1 2YG0A 1BYHA 1AYN2 4Q8LA 4NHLA 5FK8A 2JEMA 3K4AA 1IOAA 1KS5A 4XBLA 2QTWB 2JDHA 3T1LA 5FXWA 1KEXA 3DUIA 5F39A 4BQXA 3TOJA 5LEKA 1W9FA 1JYCA 4IEWA 5E89A 2YROA 4DXSA 1CX1A 2VBDA 2KA3A 3SITA 2FDHA 1WMEA 5FY8A 3LIGA 2VCAA 1GZWA 1VBE1 1W03A 1WCQA 2WUHA 1Q5OA 1RMU2 1S0CA 1U5YA 2PAEA 3FZ3A 1CIYA 1NYWA 2GN7A 1VMHA 4Q1RA 5EJ3A 4ASMB 5JIUA 4P08A 3NAPC 3WR0A 5CISA 1CAVA 1PIV3 2J1TA 1W6NB 1FPN1 2W1SA 3J9SA 3O1SA 3ZIWA 2VBBA 3K75B 3WNXA 4CDQC 5FZLA 2WYSA 4MX3A 1VBD1 5A6YA 2Y8KA 1XNAA 1CN1A 1AHSA 4GB33 4FPCA 4YGCA 4NIDA 1D2QA 2G1MA 1FMD1 2GNMA 3ZKUA 5IK4A 3VL8A 3GJAA 1MS0A 3OB8A 3VHOA 1UY1A 3EB7A 3WG2A 3WCSA 1S0IA 4ZZ8A 5AVPA 1A8DA 5GKAC 2ZXQA 4HVRA 5FMOS 4DY3A 4S2FA 4CDUC 4JHTA 2CWSA 2WIIB 4MYEA 3U4XA 2ZHNA 1Q56A 4AFMA 2IVJA 1AR91 1PO13 2QE3A 3WNKA 2IVIB 2WKKA 1Y3TA 3WT3A 1MZ5A 5F6KA 1GOHA 3WY6A 4CP1A 5FY7A 4P9YA 2RR11 5IT6A 4IEZA 3CF6E 3PVBB 4XJ8A 2YC0A 5A7WA 5A7NA 1UY3A 5FY5A 5FP3A 1H2NA 1K3IA 5FPLA 2W92A 1W6PA 3TYJA 1AL22 4QGLA 4ET7A 4EV0A 4MV2A 2Y6KA 3ZFFC 1V6LA 2OQ7A 5ANNA 5FQ0A 4MGQA 2Q4SA 4BQ4A 2HEWF 4FQZA 5C8CC 4ZKTB 2MPFA 2Y0IA 4JRAA 4Y1YA 1GSLA 1KFUL 2K2SA 5LRRA 2FMYA 1JH5A 1HX6A 4QX5A 1AR71 3PVEA 5J98B 5C70A 4L2NA 4P9XA 5C7GA 2WDBA 4QDSA 4GMP3 5L73A 5HV0A 2RHPA 3DYMA 4YVWA 3I7DA 3LPFA 5LEJA 2VBPA 1HQLA 3LA7A 3VBUB 3SXWA 3B02A 1UOBA 2GU9A 1ACCA 1RUG3 4AHWA 1UZWA 3KZ4C 3KMHA 2HWF3 2WQZC 1D4M2 4YW2A 1W6MB 4YFZA 4Q4X3 1QOOA 1ZZ7A 2OX0A 3CIHA 5B4XA 4AAXA 1AXZA 1ZZCA 1LNSA 1DGRA 5F3CA 2HJIA 1LHVA 5DZEA 4D6SA 1XPWA 1QOTA 2A71A 2RS12 2Y38A 4LKFA 5DAWA 3UETA 2WWSA 3RFRA 1K45A 2GC1A 3P5BA 1RUOA 3GZTB 5DAXA 2FHRA 2X5IC 3PHMA 1C8M1 2WZR1 3POBA 4ARYA 2RMU1 4GH4A 4HL0A 3SKVA 4P5HA 3GBFA 1G9AA 4Z82A 4BJ0A 3VBRA 3PURA 3AC0A 2XLGA 2R7EB 3CQOA 2E7TA 4IEVA 3WVJA 3IAPA 4LR4A 2EVXA 5JR7B 3T30A 2W94A 2F4LA 3BTXA 4N9IA 1PGL1 2EF6A 5FYIA 3H9AA 5CFCB 1UO9A 3AVSA 4L0PA 4COWA 4XJWA 5GALA 4E2GA 5FYCA 1KQRA 2XJVA 5FKCA 4GALA 2A3WA 2P4EA 2TNFA 3DV8A 3WF1A 1RUC3 3LB9A 1DDLA 1DG6A 3I2FA 1Z7S2 1H6YA 3E5XA 3MPBA 1X82A 4UBHA 4NRPA 1MS3A 1E5RA 1O7FA 3CKHA 4MADA 3UK9A 2YGLA 3ZYHA 4UW6A 2JWPA 1XNKA 3B94A 4LITA 4S2HA 1ZBE1 4AHXA 2IWGB 2DDUA 2VZUA 3HPNA 3KF3A 1LJ7A 4FPJA 3WV6A 4ZXEA 4QPWA 2PYTA 2VO5A 2O0OA 3O5SA 4CDWA 5CKNA 4CE8A 3PL0A 1AVBA 5T5OA 1JZ2A 1DHKB 2YV8A 3VDBA 1G9BA 3LEGA 1I3HA 3E5UA 3WCRA 4R4ZA 2YBPA 4D94A 2JDKA 1UXZA 3I59A 3JBG1 4LLOA 1Y9QA 3PUIA 3VGIA 3UL2A 1PZ7A 2PLV3 4G9SB 3A23A 1W0OA 5JR2A 5HPOA 4CEWC 5F7UA 1W2OA 2XL7A 2IXLA 5IAVA 1V9U3 1SDWA 5FZOA 4B8EA 3GJBA 4B1LA 1MR5A 2ZEYA 4DUVA 1GOGA 1RUI2 3M3CA 2DCKA 3TEWA 4MGSA 1JU4A 1MQTA 1US2A 5FYTA 4AGVA 4QHOA 4UOJA 3OD0A 1RITA 3IKWA 4Q27A 5FZCA 2BGCA 4DRRA 4KNCA 1W39A 1Q8PA 2D43A 3AYCA 1JZ3A 4Z92B 1RINA 3NAPB 3HNYM 2WO7A 5DZFA 1NLQA 3B69A 2UU8A 1PM4A 1TVGA 1OUSA 4CDQB 4U36A 5FYSA 3BTAA 4DO0A 2ARBA 1QJU1 2VZPA 3KV4A 4WVWA 2AR6A 1REEA 3FHIB 4IQPA 1X9TA 3INAA 5C33A 2VUJA 2B42B 2Y6FA 3MDPA 3NV3A 2GH8A 5BPXA 2ADEA 5BY5A 1E5SA 5E8AA 1ZVFA 3AKTA 4CCCA 1RUF2 4COYA 4QM9A 1TMF3 1TME1 4DINB 1HB4A 3WP3A 4CDUB 1GLHA 2BNNA 4QKDA 5DAVA 5JLVA 5A1FA 1WLDA 5I0RA 5KC6A 3N9LA 4NWVA 1Y7BA 2HH9A 2W87A 4XQ4A 3LQCA 4F8AA 1FOD2 1WMFA 3IDAA 5AVAA 4BIFA 2DU0A 3IIAA 4YW5A 1CONA 4D7YA 2VOWA 1ASJ1 4XF4A 4HFSA 4HN0A 3ZFEA 4I09A 3VBHA 3MFCA 3OTFA 3OBAA 4HOOA 3AP4A 2J1SA 1W6QB 3ZFFB 2FCVA 1BEV3 5FMOL 3GCXA 5A7OA 2DVGA 1VBE2 4OZXA 4YZ4A 5C8CB
chains in the Genus database with same CATH topology
2HWB1 3B9CA 1EP0A 2RS32 2YY1A 1GZWB 2CWMA 2WLPA 3WOGA 1DGLA 2DCYA 5EXOA 2NMOA 1FPN2 4RSUA 4YVSA 1RIRA 4XDQA 4P9IA 3IDEA 1KJRA 4IEYA 1QOSA 2R6QA 1VBD2 2CNAA 3GYDA 4C1WA 3B7MA 1G9FA 1FMD2 2ATFA 2P3JA 3O14A 2ZGLA 1UPSA 4IERA 3VKMA 4AVCA 2HKXA 4F3JA 4V1PA 3AMHA 4QU2A 5CU1A 3SCFA 3WZ1A 3ZN4A 5EYYA 4P9WA 4LO8A 2ZMKA 1UIKA 1FNYA 1AR92 1ULEA 2QDNA 2X5IB 2G4IA 4M00A 2GMPA 3PMSA 3RWNA 1G9CA 3URFA 5GZCA 1GKBA 1RUD1 5AC93 1SBFA 1YRZA 4JDMA 4NWWA 4QGMA 4LBLA 4H7LA 1QH6A 1CVNA 1GYKA 1MEC2 3D82A 1VBA2 4BYYA 4JGZC 5FQ0B 4XOGA 4XF0A 3ZVXA 2ZACA 3OGJA 4XJUA 3PTYA 1POV1 5CFDC 1AR72 5C9AA 4RHV1 4W65A 1MS1A 5F1RA 3DPRA 5BNQA 2D6OX 2PFWA 4FSJA 2B8MA 4RS5A 4YVSC 4YARA 4C1XA 1HXS3 4HSLA 1H9PA 4LEJA 1FI2A 3GNEA 4EN8B 1ND2C 4PF5A 1O4TA 4KWLA 1MZ6A 2VUAA 2ZJCA 3HWJA 3ZPYA 1R091 1R083 2JE7A 4XJ9A 2UWAA 2XWJB 1KDMA 1H2KA 4CEWB 1C8M2 2WZR2 1CX4A 2RMU2 1H0BA 4IEOA 2NN8A 4FPLA 5LK7B 5KXDA 1U5XA 4Y1ZA 3R05A 1EAH1 2JG9A 5JVVA 3UV9A 2H0VA 1AR62 4OHXA 1ULGA 4RA0A 1PGL2 5JPMB 3K48A 1AYM3 4PIYA 4R52A 4XFIA 2Q30A 1DYPA 1PVC1 1CAWA 1YWKA 2R1BA 1HRV2 4FPKA 4K3UA 2PHDA 1DZQA 4M3CF 4R9BA 1FNZA 1SCRA 4YW3A 5HBAA 3CU7A 1RHI3 4JVAA 4AF9A 5BYNA 4R9CA 1NE6A 1ZBE2 4XFHA 3RJ2X 4PIZA 4AVTA 5C9AC 5KHGA 5TSWA 3EHKA 4HETA 3AK0A 2D6NA 1ZBA3 3AB0A 1ZRRA 3R4UA 5LK5A 1ND3C 3FBYA 4GMP0 4GULA 1OQEA 4I01A 2P17A 1C5HA 2D6PA 4I30A 3IPVA 3O12A 4OFGA 4Y20A 2V09A 5GLTA 4BA6A 1FATA 1Q3EA 5JZGC 5JI7A 2ETEA 1PNGA 1A8MA 4H3WA 1X50A 3AP7A 4AK3A 1UW8A 2HWC1 5K0UC 1VBC3 5CBLA 4OI0A 1PHMA 4DQAA 2QJVA 1PVXA 3MF9A 2MNGA 4EN0A 2Q1ZB 3FFQA 3AZYA 3DKWA 4JDNA 1U5ZA 4AEDA 4D3WA 1DQ0A 1LHWA 4WM8C 1UX6A 2YDEA 2XKOA 4IESA 5BNPC 3ILRA 4ISQA 3KLSA 4YGDA 1R1A2 2PAMA 1QJU2 2Q1MA 2VULA 4MH0E 2R16A 3RQ0A 3RPQA 1NLSA 2IC1A 2OUHA 4Q0VA 4Q4Y1 1MACA 1UU4A 3I8TA 3D4KA 5K9YA 1GFF2 5JSOA 2R0HA 1HRI2 4MGKE 3RI8A 1TME2 3H7JA 1YUDA 4GKYA 4QQ2A 2A6ZA 1QJY3 2WA4A 1C57A 5FO9B 3TAYA 1WCDJ 4ES9A 4IV1A 2UYAA 2CAUA 2VMHA 3OCPA 1HV1A 4Z2WA 1SEFA 4PLMA 4CRQA 5CIRA 1W6OA 3WLUA 1DQ1A 3VZJA 1TNFA 2XUMA 1TQ5A 1S1AA 4Q4W1 1SLIA 4AEMA 2P2KA 4XF1A 4K9SA 1ASJ2 3OY8A 3UKNA 3PJYA 2UY8A 2VOKA 2WL1A 2ZGQA 4Q0PA 4Y4YA 3HT2A 5A33A 1WUVA 1XNDA 1AXKA 2D97A 3B00A 1HLCA 4H14A 4E4SA 1KXGA 1CAXA 1VB2A 4E2SA 1WW5A 5A32B 2ZZJA 3LGRA 1MS9A 2B46X 4JGZB 2HWB2 2ZX4A 4WZCA 1E57A 4AEJA 5CFDB 4PLNA 2DCTA 4QXKA 1V6KA 1CR7A 3B3QE 3JQWA 4ORFA 3RMXA 1GQHA 2V73A 4Q29A 4YVSB 3HQXA 3MF6A 4Q0SA 2AH2A 1XYOA 4OHWA 1BXHA 3U0ZA 1S0BA 3S30A 1G9DA 1ND2B 1JOJA 1VBB3 1CAUA 2W39A 4KWKA 1JTZX 2JICA 3QACA 2VW0A 2IFRA 3TNPB 1RHI1 1ULDA 2QCSB 2D93A 1ZRFA 1H8TA 3VZMA 1DGWA 1RUJ3 1HIXA 4AI1A 5B2GB 2DURA 4YM0A 5T50A 2R043 1RUD2 2NMNA 4XPVA 5JSPA 1OA4A 1AX2A 4PLOA 3WDUA 3BCWA 3AYEA 2EXKA 1X7NA 1QMJA 2RS53 2RS33 2ZGSA 4OVEA 1VRH1 2BPA2 4MZUA 3E6DA 2CGPA 3VN4A 4WVMA 4COVA 2NP0A 1MVEA 2A75A 5L7OC 2DVFA 2WNUA 3CO2A 3ZXFA 3K51A 2IXCA 2FMDA 4FT8A 4DNYA 1N3QA 3FLTA 2PQQA 3Q9OA 5KHHA 1OOPA 4AQ6A 5C9AB 3ATGA 1FX5A 4B29A 3TN91 3OJBA 1QXJA 2XBO1 2W68A 3WG1A 3AXDA 4X6RB 3FMGA 1QNWA 1UN1A 1ND3B 2VG9A 3M3QA 4KQ7A 4UW4A 1QQP1 1O3RA 1YJLA 4HVOA 2R062 5AFEA 4LA2A 1R092 1SACA 3ZMOA 2BBVA 2UYBA 1UCXA 3BOPA 5JZGB 1ZZ9A 3JQXA 3ZMNA 1DFQA 1B35A 1LOFC 2HWE1 3MIEA 3ZSKA 4OI4A 2ZX3A 4RR3A 3D0SA 5K0UB 1EAH2 2AREA 3QLQA 4XEZA 5FO7B 2DUQA 1MEC3 1VBA3 1AX0A 5EYXA 1HQWA 2B7YA 4FP2A 3T2TA 2E63A 3QOPA 1PVC2 1QHDA 2OUJA 5T5JA 3ST7A 4XF9A 3ZSMA 3CL1A 4WM8B 5BNPB 3I2DA 2ZX1A 4XHXA 4Y22A 2LALA 2GZWA 4AHYA 1XNCA 1RVF3 2CAVA 5DXDA 1JXNA 4Q4V3 3RYRA 5IK5A 5E88A 2ZHMA 2ERFA 5GJ6A 2GH2A 5D8AA 3M4FA 1QU0A 4LO4B 3M3OA 4TZDA 1G6NA 3AMPA 2DV9A 2E9QA 2CL2A 4XFBA 2P37A 5KXEA 1AL0G 1I5ZA 1LB2A 3IDBB 1O5LA 2FQPA 3H8UA 2WT2A 5DDJ1 4K40A 1QJX3 1AR63 2Z69A 5FLJA 3FX3A 3TBDA 4J1XA 4WM7A 2HWC2 1S0JA 2WNVA 2WS93 3FFZA 4JTOA 4PJYA 1YFYA 3PVNA 1HRV3 2ZX2A 1IPKA 1IS5A 4Q0QA 3PNAA 3KD4A 1N3PA 2WQ4A 1OA3A 2D40A 2OA2A 4JGYC 5LRSA 2IXHA 4N43C 5SV5A 3PMEA 1IKPA 3AKPA 1H8VA 3USUB 5J36A 1M4WA 4HKLA 4BH9A 1RUH3 1S0FA 1SLAA 4Q4Y2 3V0BB 2YPJA 4XF3A 1C5IA 1S55A 2W0XA 4YM1A 4I3GA 5ABJA 2ZKNA 1LODA 2JE9A 4GKXA 4ASLA 3V64A 3D0JA 1S0GA 5ACA3 3DGTA 5T5PA 4D69A 2C0ZA 2PTMA 3W9AA 1AR83 3M70A 3MI8A 3GZUC 2RJLA 4Q4W2 3DL3A 1XYPA 3J4UH 2XVKA 3ZDSA 4YZ1A 2R1DA 3EO6A 5CB7A 4KH9A 5T52A 2JJ6A 4FTBA 4M3CA 2GC0A 4WM7C 1OPMA 3OF1A 3ZXAC 3B01A 4I0BA 3WP6A 1RB8G 4J1WA 5GZEA 5L7OB 2QZ3A 2ZZQA 3KB5A 4YG0A 3VL9A 1HQNA 1DQ4A 2E51A 3MEPA 4LULA 2HWD1 2P34A 2B45X 5T55A 4N7UA 2EXJA 1HRI3 5I0SA 2ENRA 4L8QA 4PDWA 4BQ1A 5JCTA 3LWCA 1URXA 4XXPA 1CIWA 1REDA 4FOQA 1GNZA 2GNBA 4XW3A 1O5UA 1VB4A 2O8OA 2Z2SB 3JD73 1COV3 3RS6A 4YG6A 5ABJC 1RJ8A 2DFCA 1ZNPA 1YIFA 2PHTA 2BNOA 2VW2A 1PO23 3ZFGA 5CNAA 4LLFA 2RM21 2WSUA 3WG4A 4MVTA 2X8KA 4K21A 4DRVA 5J09A 4ONUA 4IEXA 1ZZ8A 3H3UA 3SHRA 4E9KA 1S2BA 1V6IA 1VLNA 4EROA 3U07A 1WCKA 1ZZ6A 4AG4A 3V0AB 1LENA 1J3QA 1VRH2 3OBRA 4Y26A 1DU3D 5T54A 1J3PA 3G6JB 4EWAA 4OUMA 2D3SA 5CAZA 2C9AA 2XKPA 2QNKA 1DF0A 4WVMB 2OVUA 4YVWC 4FO9A 2YZ4A 4N53A 3KQRA 1BBT2 2AZ5A 1PIV1 3TN92 2PA7A 4XFGA 3RNSA 4AHZA 2XBO2 4UW3A 1NOVA 3P3PA 3ILNA 4A3XA 4YGEA 4HKWA 3NVCA 1MS5A 2PHXA 1PMIA 4GB31 1QQP2 3SH3A 3MYXA 1DQ6A 3RYPA 5KWRA 3WUDA 1RUE3 4HT1T 4TWTA 4GH4C 1O4ZA 1PZ8A 3THPA 3OYWA 2V5YA 3LSDA 3VBRC 4XMAA 4HVQA 2HWE2 3D8CA 4EWEA 1WLTA 3L9JT 3VDDA 3ZN6A 1ALYA 4L9BA 4YM3A 1PO11 3J8F3 1AUYA 1H30A 2PHWA 1LTEA 2OPKA 3RJRA 1WW7A 4LT5A 2IXIA 3B93A 5JOZA 1QF3A 2ZGKA 4JGYB 5J7MA 2PN5A 4N43B 2MHFA 2VH9A 5C8WA 3NL1A 4IEQA 4FTEA 4AI3A 5IUQA 3UKVA 5FDBA 3ZX7A 2WA3A 3CJIA 1YFUA 2VY0A 3EXUA 1AJKA 3H1MA 4XIKA 1EV13 4ATFA 4XE9A 4XIOA 4N53C 4CDWC 2JKBA 5BNOA 3G7DA 3X29B 3ZO0B 4GMP1 5EZWA 4LBMA 2I74A 4FOWA 3KSCA 1X8EA 1PGW1 1IS4A 1X8MA 5JMCA 2EAAA 1RUG1 3N7MA 3FC0A 1UD1A 2HWF1 1GZCA 4CZSA 4Q4X1 1ZA4A 5DDJ2 4FPYA 1XE8A 2VVFA 4AGGA 2D5FA 1CJDA 5FREA 2R073 5KXCA 4D7SA 1APNA 3RZZA 4HPKA 1MQTC 2VMIA 1ENQA 3JD71 2ZGTA 2MEV3 5KXBA 3WW4A 2VECA 2WFF3 1EY2A 1HKDA 2D6LX 4N7IA 3CLPA 4FPFA 1CAVB 1WMDA 4YM2A 2WFPA 4G4FA 5GLWA 2YUEA 1LGNA 2GALA 2H6CA 3AKRA 3R4SA 2A6VA 1ZRDA 2WC2A 1RUC1 2WLQA 2GSYA 3I4IA 1AF9A 2Z5WA 3VBFA 2XJPA 3O0XA 4AXOA 5E16A 3FJSA 4CP0A 2Q5TA 3OBTA 3QH7A 4B4PA 1AYN3 3CJIC 5FRAA 4R9AA 1LHUA 4YGBA 4CEYA 5IK8A 5ABJB 2R0FA 3LKJA 4AVAA 2RR12 4I2OA 3S6PA 3VBOA 1QJZA 4WV8A 3THTA 1C8NA 3GALA 2K0GA 1QXRA 1RMU3 3ZFEC 1G86A 3VBHC 2XLFA 4LHNA 1OKQA 1W6PB 1V00A 2PLV1 3HR9A 3ZXKA 4P9GA 4UW5A 3WDXA 3EBRA 3KGZA 1V9U1 1DIWA 2GDFA 1B09A 1MS4A 4M3CB 4E27A 4R8HA 1J3RA 3MLLA 1H9WA 1LESA 1YFWA 2SLIA 4CDXA 2VGDA 3WW3A 1FV2A 1IS6A 3MIHA 4C91A 4YVWB 3VKNA 3POSA 2HWD2 2W52A 4WBBA 1N47A 3E5QA 1RTVA 4RQPA 2UY9A 3MW3A 5CVRA 4QGNA 3WW1A 4B4QA 2ZMNA 3AMQA 3M3IA 4MGIE 3MPPG 1SQ4A 1CJPA 2XJSA 5DUVA 3JB4C 3UKTA 4CEYC 1AL23 3ZXGA 1EYBA 1K5MA 2C1FA 3AZXA 4GH4B 2EAKA 4HANA 4RGAA 3J26N 1TMF1 2RM22 3ZYPA 3OGGA 5L19A 1NCQA 1BCXA 3KT1A 3VBRB 3IM0A 1R1ZA 3EJKA 3U10A 4HN1A 2A6YA 1NA1A 2VVEA 2BFUS 1O91A 2ILMA 3AJZA 1NY71 3TWIA 1FAYA 5JSRA 4LBQA 1FXZA 1JBCA 2BEOA 3ZSJA 4EWDA 5FPZA 4ISRA 3ZYIB 3ALQA 4MXWA 3HT1A 1RUNA 2ZMLA 4QPIA 1D4M3 2I45A 1OLQA 3DPRC 4TLFA 1BEV1 4YSFA 5C4WA 1JUIA 1L3JA 3ZSEA 3AFKA 4RS5C 1CQ9A 2RS13 3H1YA 1LEMA 3MW2A 3ZXEA 1PIV2 4FBFA 1GQGA 4CDWB 1LGBA 2BWAA 1SLLA 4N53B 5F6LB 3JBG2 1AXYA 3JUUA 2CYFA 3GHMA 5A3MA 4GB32 1NCRA 1DZRA 1LOAA 4S2GA 3I59B 2A3XA 4JV4A 4BOWA 3IWZA 2XJRA 4XTMA 5F5QA 4IEPA 1OA2A 3NV1A 4BM8A 1DGWX 2VVDA 4NHKA 3QBQA 2VNGA 2JG9C 1Z7S3 2WNEA 1A3KA 4B7KA 4Z1VA 1MQTB 2ZOEB 2XVGA 4YRDA 1QWRA 1PO12 1WW6A 2JENA 3S7EA 1XQNA 2X29A 4H55A 1KITA 1NA1C 1NG0A 4Y1VA 5H9QA 1PK6A 4HSJA 1GBGA 4Y5Z0 5AC91 1NE4A 4JAAA 3H0OA 3JCIA 5FTTC 4D7TA 1W6NA 1S2KA 4OULA 2LTNA 3RYKA 3N4MA 4QPIC 3WD5A 2D6MA 4EN7B 5C4WC 4TSVA 4XYXA 2WZPP 1XU2A 3CJIB 4META 2KM2A 5GM0A 3SLIA 1PGW2 5FAXA 1RUI3