1UAIA

Crystal structure of the alginate lyase from corynebacterium sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyguluronate lyase
publication title Crystal structure of the alginate (poly alpha-l-guluronate) lyase from Corynebacterium sp. at 1.2 A resolution
pubmed doi rcsb
molecule tags Lyase
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 4.2.2.11: Guluronate-specific alginate lyase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08787 Alginate_lyase2 Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1uaiA00
2H0BA 2D3PA 5LK5A 4M3CB 3ZXLA 4K20A 3WLUA 1OFSA 1Z0HA 1WUVA 5DUXA 2NZ9A 1H9PA 3AFKA 1CN1A 1MVEA 2YZ4A 1N1SA 2YMZA 4XOGA 1SFYA 2D6LX 1AVBA 1NXD1 2NMNA 1AJOA 2UWAA 1LOEA 3QLQA 1ENSA 4ISRA 1SLIA 3T2TA 1BZWA 3A4UA 4XTPA 3WHTA 1NLSA 2ZKNA 4Y26A 4AVVA 4XHXA 1FNZA 3HR9A 3I8TA 3V0AA 3W58A 1LHVA 4Y1XA 1SLLA 2DUQA 3AZVA 1JW6A 1W6NA 1IKPA 2P3JA 1UAIA 3PVNA 2R0HA 1PZ7A 4SLIA 2DV9A 3FBYA 4FOWA 5AVAA 4ZXKA 1V6LA 5GZFA 2BQPA 3FLTA 4BMEA 3UJQA 4YZ5A 2ZMNA 3VUOA 3N7LA 1WW6A 2WT2A 3BOPA 4RA0A 4YLZA 5GLVA 3C2UA 5HCBA 5T5OA 3NV1A 3MPPG 1LEDA 3N36A 5FRAA 3RRDA 4CTEA 2A6VA 1Q8PA 3N7KA 1QOTA 2VUAA 3AYCA 5H9RA 3N7JA 2CL2A 4Q26A 2I2SA 3B69A 3LSEA 4R9DA 1JYIA 3HN1A 3SH5A 3VKOA 1TEIA 2WLQA 3VV1A 2GDFA 3WCSA 1S0EA 1D0HA 1CVNA 3M3OA 5JOZA 1HKDA 2JD4A 1LEMA 2ZA9A 1YRZA 2LTNA 1F9KA 1AJKA 1QNWA 2V73A 2AREA 3V64A 5GM0A 3D5OA 2GN3A 2GNMA 1F5FA 1LU1A 1WLWA 4Y20B 4AWDA 4DRRA 4BQ1A 1MZ6A 1ENRA 2UWBA 2YV8A 3RSJA 2E53A 1C1LA 4U2AA 1W6PB 1IS6A 1BXHA 1G7YA 1VLNA 2AR6A 4H55A 4PQ9A 4LBNA 2JE9A 3ZSLA 3AP6A 1SCSA 2AYHA 2VU9A 4FPJA 4UW4A 5DZEA 2DVAA 2W52A 1LGBA 2ZMLA 4XMAA 1GANA 1N3QA 4FPHA 4YW4A 4YGBA 1IOAA 1I1EA 2EXKA 1DQ2A 1V6NA 4ASMB 3ZSKA 4XYXA 3A0NA 4ITCA 3FUQA 5CB7A 3WG1A 2GNTA 2VW0A 1S1AA 1CJPA 4FP3A 3NV2A 4FPFA 5HCFA 1LECA 5EYYA 1KQRA 1MACA 1S0CA 2G4IA 3DUIA 3O12A 2D43A 4KBBA 4R9BA 1GKBA 1QNYA 1YI7A 2EAKA 2FMDA 5FREA 1V6OA 4YZ1A 1ONAA 4LBOA 1DYKA 1CIWA 1GSLA 1LGCA 4YW5A 5KXCA 2ZBJA 4FOVA 4DQAA 5GZEA 5CBLA 3ILNA 1FATA 1G9FA 2VW1A 3AYDA 3AP7A 4C1WA 1SBFA 1DQ6A 1LOFC 1LULA 5F5QA 3RG0A 4YM0A 2R1BA 2R16A 1APNA 5DUUA 1UL9A 2RHPA 3TB0A 4XE9A 5IT6A 1AZDA 3WOGA 4UW6A 1OQ1A 3WUDA 2VY0A 4AGRA 2ZGRA 4LBQD 1G8WA 3WCRA 1JBCA 1WD4A 1WD3A 2D3RA 2ARBA 5IK4A 1DQ0A 1S0BA 4PBOA 3WUCA 1VIWB 1FAYA 4K1YA 4YW2A 2AUYA 3AP9A 2CYFA 2DUPA 2D7FA 3DGTA 4AGVA 4XXAA 1JOJA 2PHFA 3M1HA 2GMMA 1V00A 1GZWA 2AGSA 1BKZA 1CR7A 2GMEA 1IS4A 1F31A 1JUIA 4YZ3A 3OY8A 1H30A 2D44A 4XZPA 1AF9A 1MS0A 5KXDA 2ERFA 4P9YA 4YFWA 1GZ9A 2YY1A 4Q8KA 1HDKA 3AXDA 3UK9A 1XQNA 4DFSA 3APBA 1LOFA 4XJ9A 2DYCA 4LBMA 1WLCA 1RITA 1MZ5A 3IN9A 4PBPA 2D6KA 3AJYA 2A6XA 4NOTA 4LBKA 1AXKA 1VAVA 2GN7A 3KQRA 1ZM1A 1CQ9A 5EYXA 2YROA 1R1ZA 1W6OA 3O0WA 1QMJA 1SLCA 4Y1ZA 2A3XA 4FPLA 1QDOA 3FFZA 1LOGA 4XBQA 1HQLA 5DUWA 4GWMA 3OYWB 2EXIA 5GZCA 2A5ZA 3NV3A 2R49A 4YG0A 5T5JA 1LESA 3UL2A 4R9AA 2GALA 3ILRA 2CWMA 2JDZA 2WSVA 1QGLA 3O0XA 2P3KA 3VKLA 4FPCA 1CONA 1O4YA 1GZCA 2WKKA 1DFQA 1A3KA 1KJRA 1N3OA 3AXEA 1DZQA 2HYKA 3JU9A 2A71A 4UW3A 1N1YA 1H9WA 1OKQA 3PJQA 3WG2A 4JRAA 2GNBA 5E89A 3M3CA 2ZGNA 5T54A 3ATGA 5DXDA 2WJSA 1X50A 4YM2A 4FPKA 4WVVA 4YG6A 4DRVA 2R1DA 3MW2A 3OJBA 3Q9OA 4Y24A 3KM5A 3N7MA 2A3WA 3AP5A 4Q1PA 3SNMA 3OY8B 1KJLA 2ZABA 1BYHA 2ZGKA 3V0BB 2ZGOA 1QDCA 2ZGUA 2WQZC 1UZYA 2DVDA 3IMNA 2AENA 1RINA 3T1LA 1W6MA 2D6MA 1LGNA 1Q8VA 1FYUA 4LBQA 1Z78A 4CRQA 3USUA 3ZXKA 1BQPA 1GYKA 2DUOA 1N1TA 4LBLA 5GLUA 2VXRA 5JMCA 2ZGTA 1MS9A 1CESA 2PHRA 3PVEA 2ZGQA 1S0GA 3OGGA 1AXZA 5JLVA 1LENA 1LTEA 1PZ9A 5BYNA 3V65A 5DUVA 2CTVA 3QCWA 4RL7A 3WVJA 1G9BA 1LHNA 2DTYA 3ZYPA 2WNEA 5CAZA 4GXLA 3ASIA 5L73A 3AJZA 3FLPA 3W59A 2DTWA 4YG3A 2CY6A 1FNYA 1QU0A 2C5DA 2ZGPA 1LHOA 3PMEA 4PCRA 2W39A 4BMBA 4Y22A 3POSA 4Y1YA 2E51A 3V0AB 3SLIA 1GNZA 2SBAA 1AX1A 1W6NB 3VKNA 3VKFC 1LHUA 1N47A 2WT1A 5GLZA 1Q8SA 1SCRA 4M3CF 1GV9A 1S0DA 4LBJA 4M01A 4XDQA 4ZKTB 2ZACA 4YM1A 4GWNA 5GZDA 2OUHA 3BTAA 3LSDA 4M3CA 2VH9A 5JVVA 1MS5A 1ULDA 2A70A 3IKWA 1W6QA 2D6NA 2UWCA 1QOOA 5KXEA 3HMYA 1S0IA 3L2YA 4YZ4A 1DYPA 2WT0A 4XIOA 2NM1A 1BJQA 2TEPA 1KRIA 4WV8A 4ATEA 2JKBA 4YW1A 1GLHA 5GZGA 2ZGLA 4WVWA 2NYYA 4XXPA 3U4XA 4AVSA 2P3IA 2PHUA 3WDWA 4R9CA 1GICA 1I3HA 5GLWA 2CWSA 2E6VA 1DIWA 1DQ4A 2P2KA 4NO4A 4HL0A 5SV8A 1KITA 3VKMA 4HANA 1GBGA 3RQ0A 2DVFA 3N35A 4F83A 3TAYA 3WDUA 1ULGA 4FPYA 4AVTA 2KM2A 2WSUA 1J1TA 2V5YA 3OBRA 4AYUA 4YFZA 4XIKA 3BIWE 5DZGA 2EIGA 1SACA 4FVVA 4YW3A 1UZZA 3POYA 4FOQA 1AX2A 2W68A 3O0VA 2Z42A 1YIFA 4Q8LA 1EPWA 1UMZA 4FOYA 3R4SA 1ULEA 1YYNA 4BLIA 2D6OX 1QOSA 1FV2A 1LCLA 4GALA 1D2SA 2R0FA 3AZZA 1SBDA 1VAMA 1WW7A 1O4ZA 2A7AA 2ENRA 3GNEA 4K21A 3ZSJA 4BPZA 4WZFA 1YO8A 4UW5A 3WDVA 5DZFA 5T52A 1MS1A 2OUJA 3MW3A 1C57A 1ULCA 2DU1A 5JOWA 1WCSA 1CPMA 1URXA 3M3EA 5KXBA 3ILFA 4XJZA 1HQWA 3INAA 4Y20A 2ZGMA 3MW4A 3NV4A 5DG1A 5H9QA 3AZXA 4ISQA 2EXJA 3WZ1A 3B9CA 3ZYRA 3IPVA 1LODA 2B7YA 1W6PA 1V6MA 1WBFA 2XG3A 3I4IA 1YXWA 3AZYA 2YXSA 4OZXA 4GA9A 3ZXEA 4XJUA 1W6QB 2PELA 1QF3A 1SLAA 3D4KA 3N3HA 4FQZA 1G9AA 5T5PA 4PF5A 1DQ1A 1DHKB 3M3QA 1JHNA 2JE7A 4P9WA 5H9SA 2CNAA 5IK5A 1MS3A 2EF6A 4FPEA 4FPOB 3UJOA 1RIRA 4TYSA 5T5LA 3ZXJA 3LCPA 1N1VA 2DURA 4Y1UA 2A6WA 4BM8A 3FUOA 4Q1RA 3MEPA 4DPNA 5IK8A 4JC1A 1V6IA 2P37A 4XHBA 5F9TA 1AXYA 2DU0A 1IKQA 1WLDA 4GKYA 1DQ5A 1LHWA 1GZWB 3IM0A 4XJWA 3A0KA 4BOWA 3AYAA 4XBLA 3AZWA 5GALA 3WDXA 4GKXA 4M3CE 1G9DA 2A6ZA 3PVOA 1UKGA 4ATFA 4DS0A 1S0JA 2LALA 4BLJA 1SBEA 2ZZJA 3GALA 3T1MA 4U36A 3ZXFA 5E88A 1MR5A 2DVGA 2W08A 3AYEA 1SLTA 3H0OA 1FX5A 2DVBA 4Q2FA 1MS4A 2P34A 4D69A 1LJ7A 3ZPYA 3WG4A 3AK0A 1JN2P 1GNHA 1W6OB 5H9PA 2E7TA 2A75A 2ZMKA 2PHWA 2XB6C 4XILA 1W0PA 3OPZA 1MS8A 1JXNA 2OW4A 3AX4A 2SLIA 1FV3A 2JJ6A 4M00A 4YGDA 1IS3A 4P9XA 2UU8A 5CA6A 1LU2A 3IPVB 1Q8QA 1Q8OA 1CPNA 1WBLA 2NMOA 2A6YA 3SH3A 5T55A 1MVQA 4XBNA 3BODA 2ZHLA 2EALA 1B09A 1DLLA 2ZAAA 1A8DA 1G86A 3M2MA 2DWRA 2ZHNA 3ENRA 1G9CA 1VALA 2NN8A 3NWKA 4FP2A 5CNAA 1A78A 1V6KA 2FHRA 3RMYA 2PHTA 3WHUA 1Q56A 2Q5TA 1IS5A 4K1ZA 4YGCA 2D6PA 5EXOA 3SITA 4Y1VA 4XJ8A 3FLRA 1C4RA 5JDBA 4P14A 1AX0A 4FPGA 2EXHA 5E8AA 2AH2A 1SLBA 4YGEA 5EWSA 2PHXA 3OBTA 3OYWA 1KDMA 1DBNA 2UURA 3JUUA 1LOBA 5JOXA 3B00A 2ZGSA 3SISA 1U0AA 3WG3A 2ZHKA 4Q27A 1N3PA 1W6MB 3WNXA 4YM3A 4LBQB 3ZSMA 5IK7A 4FQ4A 3USUB 4TZDA 1WW4A 3CNAA 3R05A 4L8QA 1WW5A 2E7QA 1ZA4A 1S0FA 2VW2A 3R4UA 5HCAA 4YZ2A 2C9AA 1UPSA 1LOCA 2GMPA 4CZSA 5JOYA 2NP0A 1V6JA 4W65A 1LOAA 2ES3A 2GNDA 1ULFA 3D6EA 4JCKA 3WV6A 4C1XA 4Z8BA 1W0OA 2JECA 5GJ6A 2ARXA 4XJAA 2OVUA 4XTMA 1UX6A 3SH4A 3WDTA 1C1FA 3RMXA 1HLCA 4XMIA 1JYCA 4MYEA 2A3YA 2D3SA 5IUQA 1KDKA 3O5SA 3POWA 4Y22B 5DG2A 3V0BA 3WDYA 3B3QE 1PZ8A 5T50A 1DGLA 4I30A 3ZVXA 1QKQA 1ENQA 3AP4A 5GLTA 2ZHMA 4AGGA 1UN1A 3B01A 1Y7BA 3RS6A 4IQPA
chains in the Genus database with same CATH superfamily
2H0BA 1NE6A 2VOVA 3NNJA 4M3CB 2D5FA 1OT5A 3LPFA 1WUVA 5DUXA 2NZ9A 4MGYE 2FCTA 2WZR2 2WNUC 1MVEA 2YZ4A 5A6YA 5FZ9A 1N1SA 5C8CB 4HXCA 2Z2SB 1ZRCA 1AVBA 1RUE1 1NXD1 1QJU2 1QJY1 1NOVA 4IEOA 4A6SA 4IDZA 4QDQA 1C8NA 1O91A 3QLQA 5F8PA 3VBUB 3WQ7A 5FMOL 4AL9A 4OQ8A 1ZBE3 2G9GA 2O14A 2VMEA 5A7SA 2FCVA 3SKJE 1OPOA 4RS5C 3ACIA 1UX7A 5EP9A 3FHQA 1DU3D 5LY2A 2Y60A 1FNZA 1XE8A 2BBAA 4UBHA 3CJIB 3W58A 5FXXA 4Y1XA 4X8PA 2C0ZA 3AZVA 5FQ0B 1W6NA 3D82A 3VBFB 4CPBA 2XKOA 2R0HA 4M4PA 5L9RA 2DV9A 2GP3A 3HNMA 2TUNA 2WINB 5C3SA 5AVAA 3IAQA 5FJHA 5FY0A 1RUE3 1OD5A 2BQPA 3FLTA 4CUGA 2ZMNA 2WT2A 3BOPA 3I49A 3WQ1A 4CTEA 1JU4A 3Q8FA 1Y3TA 4ZHNA 2YU2A 4CDWB 2WNUA 5CZKA 2WS92 4KU7A 4R9DA 2I2SA 5M0TA 4LOTA 2WLQA 2GDFA 3I2OA 5LATA 3IDAA 2BNNA 3TBDA 5C5TA 2B4KA 2PAEA 5LBEA 1LEMA 4QDRA 2ZA9A 1YRZA 2BGCA 1F9KA 2V73A 5EJ1B 5FYCA 1FT9A 3V64A 5GM0A 3ZDSA 3BKZA 1DF0A 4Y20B 4CEYC 1WLWA 1IG3A 1FOD1 5EFUA 5FPVA 1X82A 3SCHA 4BQ1A 1ENRA 2UWBA 2XOMA 5DDJ2 5A6ZA 2B8MA 1J58A 3RSJA 4KL1A 4U2AA 1IS6A 1VLNA 2AR6A 1D4VB 3PUIA 1CAUB 4LBNA 3I59B 4QHZA 3UKVA 3ZSLA 3AP6A 3ZR6A 2VU9A 2VBDA 5FPXA 2W52A 4AQTA 1LGBA 2ZMLA 1N3QA 4FPHA 2ET1A 1I1EA 1IOAA 5FKCA 4AAPA 4JKLA 3KV4A 5JCTA 3NJVA 4TLFA 1MEC2 4O7XA 3E1F1 3A0NA 4ITCA 4B1MA 1W9YA 3WG1A 1S1AA 1YFXA 1FOD3 2QUOA 2YC0A 4TXWA 1JUHA 3TRSB 5F2WA 3M4FA 4QB6A 2XWBB 3JBG1 2D43A 1OI6A 1O3QA 1ZRIA 1VBE2 1V6OA 4CEYA 2VQUA 1LGCA 3SQOA 4DQAA 4PI2A 3ZFGC 5CBLA 3T0DA 2B9UA 3EO6A 3PLQA 2VZVA 3K4AA 4ASLA 1SBFA 2XLAA 2UYBA 2OZJA 5F5QA 4YM0A 2R16A 5DUUA 5FBZA 5K0UB 5FZKA 4QX0A 3ZFEC 4QPGB 3ZN6B 4OMCA 3TB0A 4A6OA 2QQPA 3BI3A 1NCQC 2IXJA 3RGBA 4LORA 1NKGA 2ZGRA 1M4WA 2ZKLA 4LBQD 3WCRA 3AVRA 4K8RB 2R7EB 3JBG3 3H8OA 5A33B 5IK4A 1DQ0A 1S0BA 2HYXA 2HWC1 1UOJA 3AP9A 5FJKA 4YW2A 1ND3B 1UXZA 3K48A 1SHWB 4GZ9A 5J1XA 2W1UA 3PU3A 3FJSA 1KFUL 2PHFA 4GD4A 5FO9B 1WA4A 3EBRA 4Y3OA 1BKZA 2GMEA 1JZ5A 5FMOS 4E2GA 4KMQA 3MYXA 1H30A 3OY8A 2JX9A 2DDUA 4IV1B 1AF9A 1RUF1 1YJKA 4FTBA 3ZFGA 3KV6A 2RS51 3LQCA 4N7IA 2YY1A 4YFWA 3T0AA 4JGYC 2CAVA 4RN5A 3VBSB 2F6BA 1LR5A 2DYCA 2VZUA 4CU8A 1WLCA 1RITA 3ZFEA 3IN9A 3H3LA 1HJGA 1NCQA 2VQAA 3TNQA 5L9VA 3ZN5A 1X36A 2GZWA 1AYN2 4FO9A 4LBKA 3H42B 4B7KA 3KQRA 2J1RA 1ZM1A 5A3UA 4UFKA 1R1ZA 5L36A 1W6OA 2XJPA 1GOGA 4HONA 1KS4A 1NLQA 2Y38A 4HSLA 1CJDA 1RUF3 4IESA 4OUSA 5LBCA 3U1XA 5AFBA 3WF1A 2RS53 4RFT0 4FPLA 2VCBA 2VAUA 3FFZA 1W8FA 1UYYA 4XBQA 1D4M1 4IEWA 4B3NA 1ODNA 5LCWL 5FLIA 3JB8A 5GZCA 1ZA7A 2A5ZA 3NV3A 5T5JA 4YG0A 4BQ2A 3OCPA 1BCXA 4EZHA 3OPWA 4MUVA 4P5YA 3T08A 4FAHA 1L3JA 3ILRA 1AR92 2JDZA 2VCAA 2WZ8A 3ACLA 1SG3A 3BTYA 2O0OA 2CAUA 2CV6A 3O0XA 3RZJA 3B9IA 4JGYA 5ANNA 1HQNA 1O4YA 4FSJA 2WAAA 1N3OA 3GZAA 2RMU1 3MIDA 2Q8CA 2LM3A 5CADA 1AUYA 5FZHA 3LA7A 2W46A 2XLGA 5IFTA 3PJQA 4LE3A 4LEJA 2W47A 1D4M3 5E89A 1W04A 5F6KA 3C7GA 3LEMA 2QDNA 1AR71 2R071 1BVVA 1NG0A 3IIIA 5FBJA 1WCDJ 2B9VA 3OF1A 4YG6A 3MW2A 2JICA 5J09A 3OJBA 3UKTA 3WP3A 1RMU1 4MXWA 1UU4A 2WDBA 1KJLA 2BBVA 2BYVE 3DXTA 1BYHA 5FWEA 4KBZA 2GC2A 4CUBA 3O1MA 1QDCA 1OF3A 4RFRB 4ZU7A 5A32B 5L7OB 4P9LA 2XBO2 3IMNA 1RINA 3AL5A 1Q8VA 2H6CA 2DUOA 5L19A 1PO23 1AR73 1GWKA 2R073 1J3QA 4G4FA 4MX3A 4S2DA 2WZPP 4J6GA 4AFMA 1CESA 2L9LA 2J7MA 3BN6A 1R081 2O8QA 3ORJA 4I0AA 1AXZA 2WNVB 1PO22 2J22A 4IGOA 5FYUA 5FY1A 3LDBA 1LENA 4FI9A 4HN0A 5C8CC 2PQSA 1RMU3 1NZCA 1OVPA 3QCWA 4EQVA 1F2NA 4PLOA 2E26A 4W6YA 5A6XA 3ZYPA 3ASIA 5FXWA 3VBUC 4A7ZA 3W59A 4Q0SA 2CY6A 4IEQA 3GBWA 3OEAA 4BIFA 3CJIC 2BZDA 2W1QA 3I2HA 2E51A 1UY1A 4DOUA 3V0AB 1UXXX 3VBFC 3HOBA 1R083 1AX1A 4XAAA 2VL4A 2WT1A 3IDCB 4ZS3A 5GLZA 1GWMA 2QQVA 5LEKA 4ZU4A 1OLRA 4IW3A 4GWNA 2PLV1 2OUHA 2XH6A 3BU0A 1XNAA 4M3CA 3IB3A 3POIA 1EAH2 4TN7A 4LA2A 5LBFA 3KCCA 2A70A 3GDBA 3UETA 4CDWC 1W6QA 2H0VA 2D6NA 3O1OA 4YZ4A 3WD5A 1W3VA 5C8CA 2VNRA 5DPNA 4XIOA 3O1RA 1BJQA 4Q4W1 2HWE2 2TEPA 1QWRA 4KWUA 5FZGA 4AHWA 3HQRA 4BB3A 4LR4A 1GLHA 2ZGLA 3G7DA 3VBUA 4HZFA 2NYYA 4AVSA 2PHUA 4DUVA 2VZSA 4HMZA 4R9CA 1I3HA 2PLV3 1PO11 2QNKA 3CJIA 3H8RA 1KITA 5EQUA 5FQ0A 1DG6A 3VBFA 1AR82 3BU7A 5JXGA 2EVXA 4UFIA 1PK6B 5FK7A 3RYRA 4NWWA 2QVSB 2KR2A 2VMHA 3LDRA 2YC2A 1J1TA 3OBRA 2Q0AA 4Q4W3 2X8KA 2BFUL 2ORZA 2RR11 1JOBA 2EIGA 3Q8EA 3I2JA 5I0DA 3HNYM 4FOQA 2AEYA 2XJVA 4BYYA 1W06A 3O0VA 4CDWA 1QEXA 1G6NA 3PUHA 1ZZCA 1PO13 4QX7A 1OH3A 1O8SA 4PIYA 4O61A 3AZZA 1VBD2 3GBGA 4J25A 4K6BA 4IE7A 2HWB2 4AK3A 4O65A 4OQ9A 3WDVA 2QQJA 4DIQA 4K9SA 1CIYA 3MW3A 5FUIA 1UZWA 2E9QA 5JOWA 2QCSB 2W92A 2ZS6B 3K2OA 4XFIA 3KHBA 2WABA 2RR13 4Q0VA 4Y20A 2VZQA 3N9MA 4IL7A 3I54A 4CCLA 2BP6A 3WZ1A 4HG6B 1XBFA 3B9CA 3ZYRA 4KI5M 2I07B 5FZAA 4QGMA 1ZZBA 1IQAA 1W8TA 3BPSA 4ZZ5A 1K42A 1CAUA 4CA9A 3I59A 3AZYA 1GOFA 1QQP2 5K0UC 4ZXEA 4QPGC 1HB1A 1QF3A 2PELA 3D4KA 3IDEA 4AI3A 1G9AA 5T5PA 1DQ1A 2WLPA 1HXS3 1POV0 1ND2C 5IK5A 2PAKA 3RJ2X 4AQSA 2GC1A 3CO2A 4TYSA 5T5LA 1AHSA 1HXS2 1ZNPA 2BUKA 2GSYA 3WY6A 4AF9A 4BM8A 3IZOA 1ND3C 3FUOA 3NAPB 4C90A 2XVKA 3ZKUA 4PIXA 3ZYIB 5DAWA 4GKYA 2G19A 1GZWB 3KT4A 4Y4RA 4IV1C 3A0KA 1RUC1 4XBLA 3WDXA 2QJVA 1O5LA 2PFWA 4N43B 2JB8A 1UKGA 3PVOA 1RJ8A 4Q29A 2LALA 3VBSC 5FYZA 2VR4A 3H3UA 5K0UA 3ZXFA 4QPGA 1MR5A 5E88A 3ZN6A 1OUXA 2WFF2 1RHI3 1V0AA 5FYBA 3AYEA 3H0OA 1SLTA 4Q2FA 1MS4A 2CHHA 2MEV1 2P34A 4D69A 2WIIB 1ND2A 4EN6B 1RHI2 5APAA 5A33A 4B29A 5F3GA 3BTXA 4JTNA 3RZLA 5FIXA 4GAZA 5BY5A 1XNCA 4C0BA 2A75A 5IVEA 5F6LB 1RUC3 1ND3A 1W0PA 3CZUA 2XJQA 5A3TA 2JIJA 3WEZA 1OURA 4LE4A 4FAGA 4W6XA 1W9SA 4P9XA 2UU8A 4XQWA 1LU2A 1PGW2 3MIHA 1RUD1 4IV1A 4OUEA 2A6YA 1BMV1 1OMIA 3SH3A 1MVQA 1PIV3 2MEV3 2WQ4A 4LKDA 4XBNA 3VL9A 2RM21 3OD4A 3AMMA 3VBSA 1GZTA 1DLLA 2J1TA 3RPQA 1VBB1 1PIV2 3U78A 4KWLA 3W5MA 1A8DA 3M2MA 3R0RA 4NIGA 1G9CA 1VALA 4WVZA 1W9WA 3RI9A 5CFCC 3T4HB 3MIBA 5FZIA 3QD6A 2PHTA 3BOWA 5EV7A 2MPFA 4BK4A 3HT1A 1NX9A 2D6PA 4CCDA 2EIDA 3N9OA 3T0BA 1RUD3 3PU8A 2NPIA 5FYSA 1AX0A 2YB7A 4TTGA 1SLBA 2RM23 5C3RA 5EWSA 4CXYA 1TMF2 4ZZ8A 1KDMA 1VBB3 5C6CA 1DBNA 3TN92 2WNOA 3JUUA 5F37A 4XQ4A 1LOBA 5L7OC 4XFHA 2VE1A 3DXUA 2ZGSA 3IMMA 2ZX1A 4BWOA 2ZHKA 2D40A 2Z5WA 3UGGA 4YM3A 2TBVA 4LBQB 4FT8A 4FQ4A 4INDA 2XQRA 4JGZB 2VZ3A 3USUB 5IK7A 4L8QA 1BBT3 2VMDA 2I74A 3AMHA 4QAWA 4YZ2A 2DCZA 2GMPA 1OFNA 2WNVC 1VMJA 1W8NA 1JOPA 2Z69A 3K4ZA 5JOYA 1BBT2 1PMHX 2ADEA 1TE1B 2ES3A 2WA3A 4UBGA 4W65A 5CFCA 5IHRA 2RDNA 3K46A 2UY8A 3URFA 3GZUC 5IVBA 4Z8BA 5F3IA 2JECA 3BGAA 2DFCA 2IXHA 5A7WA 5JPMB 1C1FA 2DCKA 1D0GA 1HLCA 2VQTA 1VRH1 4BQ4A 1JYCA 3T09A 4MV2A 4E2QA 4Z82A 4QQ2A 3OGJA 3ZVXA 1DGLA 2DCYA 5A32A 4AQ6A 4E2SA 3SHRA 5L7OA 1R092 4QKDA 3AP4A 5IVYA 4GQ7A 4RHV3 3MHZA 2QQNA 1Y7BA 3ZYJB 4UXAA 2WUHA 5FYVA 4RHV2 3K3NA 3WLUA 1OFSA 1HN1A 2IXLA 3RZKA 1H6XA 1H9PA 1POV1 3C8XA 2WNVA 4D6QA 2ORXA 4Q4Y2 1SFYA 2JDUA 3MFCA 2VOTA 5F2SA 2D6LX 4DY5A 3JQWA 1P8JA 1AJOA 5F5IA 1RUI1 1H1IA 1PVC2 1ENSA 5IVJA 1E5IA 2YC4A 1BZWA 1BEV2 4CDXB 3CEWA 5FYTA 4META 1C5HA 1ZZ6A 1RC6A 2ZKNA 4XHXA 1GOHA 3OPTA 2JKXA 3ZXAC 1TME2 3V0AA 3ZR5A 4JAAA 2YBPA 1GUIA 1POV3 3O1TA 2VOKA 1PK6C 1UAIA 4IE0A 4SLIA 5CKMA 4BQ5A 4LITA 4QX3A 2QQWA 4BMEA 4RA0A 1ZREA 4YLZA 3C2UA 5HCBA 5HBAA 3NV1A 3MPPG 2VZPA 3L2HA 1JMUB 1UO9A 1Q8PA 3AYCA 2QTWB 5FY7A 1NA1B 4XW3A 5IVCA 3OGVA 4JDOA 1RUNA 3HN1A 4MGTA 3VV1A 1S0EA 1D0HA 1XYOA 5A1AA 1HKDA 3QACA 5FOBB 2OS2A 4ZU5A 3WF2A 1AJKA 2AREA 2GNMA 1F5FA 1LU1A 5I8SA 4QM9A 1MZ6A 5T3NA 2IXCA 1V9U2 2YV8A 1RUH2 1OBNA 3HVDA 2E53A 1H6YA 2VZOA 2Y6JA 3J7HA 1PK6A 1BXHA 4H55A 3THCA 4PQ9A 2ZPXA 2IXKA 4K8FA 4XC9A 5FZ7A 4UI9L 1EUUA 3FFQA 4IEUA 4OI4A 2ETEA 4GH4B 2DVAA 5F39A 3VZLA 4RD7A 2CSGA 4E4DX 1ASJ1 4XMAA 1EV12 5ISLA 4DB5A 1DDLA 3OBAA 2EXKA 2W94A 2UY9A 5JIAA 4DEQA 3E97A 4ET7A 4ASMB 3BPZA 3OUJA 2CGPA 3UNPA 3FUQA 4AHYA 5CB7A 2GNTA 3NAPC 4FP3A 5F32A 3O1VA 5KBFA 1C5IA 3GZEA 2BERA 1JH5A 4GMP0 2V4AA 5J3UA 5KHGA 5CKNA 5EYYA 1MACA 4HK9A 2I45A 3OGSA 3O12A 4K7JA 4D6RA 4CUCA 1GKBA 2VUDA 1YI7A 3ABZA 2FMDA 4NHYA 1GSLA 1CIWA 1X9PA 3D0JA 1ASJ3 3VDDB 4N43C 5GZEA 1ZX5A 1F5JA 4IEYA 1G9FA 3FHAA 4Q0UA 1LNSA 2C26A 2ZAHA 5HCHA 1I5ZA 3H1WA 1LOFC 1J1LA 3RG0A 4Z2AA 1DGWA 2R1BA 2D97A 1Q43A 1UYZA 1YEWA 3RI8A 1EY2A 2RHPA 4NAOA 2XPJA 3ST7A 4XZUG 2IWGB 2VY0A 1W8HA 4NUBA 3I3BA 1M06G 1JBCA 2C1FA 2VD7A 4CP9B 4K1YA 3NAPA 2WZR1 1QY4A 3FN9A 4XXAA 1GU3A 4JQTA 3H7JA 1V00A 1GZWA 3VB9A 4I0BA 1QJU1 1RXGA 2D44A 4UYBA 5LEJA 4N43A 1GMMA 4I01A 1GZ9A 2FZ1A 3RWNA 4G9SB 5KC5A 2Y64A 1XQNA 4HSJA 4LHKA 1U5YA 1LOFA 4DFSA 1NYWA 3FZ3A 4XJ9A 1IGOA 2WYFA 3C7EA 4LBMA 2QZ2A 2H6BA 2ZX0A 3JCIA 3VD9A 1A8MA 2WZR3 4PBPA 3HBZA 2P17A 5FY9A 1UNBA 1AXKA 2XONA 2GN7A 3NNFA 5I0TA 3GHMA 2YROA 2J1VA 1QJU3 3O0WA 3ZOIA 5DAXA 1Z7S2 2PXJA 3MLKA 4KWKA 1NAEA 3N9QA 1SLCA 2JENA 3ZSEA 1K5MB 1VMFA 5FDBA 2V4VA 5FFOC 4NIDA 1X9TA 1QDOA 3HQUA 2WS91 1HQLA 5FMBA 5LASA 3HNBM 3ZYHA 2QQUA 4GWMA 1QJX3 3OYWB 4NRPA 5FY4A 4AQ2A 1STMA 4CCKA 1HB4A 1WGPA 4IUGA 4XFCA 3UL2A 1QJX2 1S2KA 4A41A 2GH2A 4KG8A 1DGRN 1DGRA 1V70A 3DEMA 4YPJA 2CWMA 3IIAA 2HWD2 4HVQA 3CHXA 4LNVA 1QGLA 5BNQA 2VMGA 5A70A 3CZJA 4GIQA 4P9GA 4LK6A 5CVRA 1A3KA 3OTFA 1DZQA 1EP0A 4P00B 5DDJ1 3BUCA 4UW3A 1JYNA 2WS93 1H9WA 4F8AA 5K7PA 3WG2A 4LOSA 1W9TA 2J1UA 3AMQA 2ZGNA 3ECQA 1XNDA 2VNVA 2Y8KA 4TLGA 2LW8A 2QQIA 1ZZ8A 5DXDA 2P5BA 2WJSA 1W2UA 1X50A 4Z07A 4QHBA 4AFCA 3TEYA 4WVVA 3QBQA 4HPKB 2R1DA 1NE4A 1ZZ9A 4RQPB 1PM7A 1MEC1 3RZZA 5HV0A 3KF5A 3AP5A 5AFEA 1C3HA 3CKHA 2VBPA 1S55A 2DBIA 5BNNB 1GWLA 3V0BB 4MHRA 2ZGOA 4RS5A 5DDJ3 2ZGUA 5C71A 3BTZA 5FYIA 1WMXA 2AENA 2Q8DA 2BWAA 1FYUA 4LBQA 4MOAA 3USUA 3FL7A 1GYKA 2OT7A 1N1TA 1VBE1 5GLUA 4QPWA 2VXRA 1PNGA 5JMCA 2CGOA 5FMCA 5C70A 1I9RA 1XNKA 1C8M2 2OA2A 2ZGQA 1NT0A 4I09A 3NVCA 1MEC3 1OOPB 4OZOA 1LTEA 4S2HA 1PZ9A 5JLVA 3OD0A 3SCFA 3PJYA 1JS9A 4HOOA 3NNGA 1RUJ3 1G9BA 1LHNA 2QE3A 2WNEA 4GMP1 4GXLA 5L73A 4CSWA 5CAZA 1TVGA 3AJZA 4N53B 3FLPA 2DTWA 1XXNA 4PI0A 1RUJ2 1WCQA 2ZOEB 2QKDA 4CDXC 1FNYA 3LF7A 1QU0A 4CDUB 3BVCA 2ZGPA 1LHOA 1XNTA 2OX0A 2WO1A 2W5FA 5C3PA 1VBE3 4X8NA 4HKOA 1KEXA 4MGIE 4Y1YA 1RB8G 4XABA 2YPJA 1YFUA 3SLIA 1GNZA 5CYYA 4WBBA 2JDYA 5KR7A 1N47A 1H4HA 2BDRA 3QOPA 5B4XA 4QM8A 4D94A 1GV9A 1S0DA 1PM4A 4M01A 2ZACA 4AEMA 3DPRB 1VE0A 3PVBB 2FQPA 1YUDA 5EPAA 1VB4A 2LS6A 4GMP3 4BU2A 3O1SA 3DYMA 5JVVA 1MS5A 3IKWA 4H7LA 3H50A 1NA1C 4QMAA 1OPMA 2P3YA 2WT0A 4N9IA 2E63A 2VJXA 4ATEA 2JKBA 2DCTA 2HEVF 5LRRA 1AYN1 4XXPA 2YBSA 4YARA 1SPPB 1IPKA 1VR3A 4IEPA 4NE9A 4NAMA 4PHZA 5FZOB 3WDWA 4ARXA 1GICA 4CDXA 4V2WA 4HL0A 4HT1T 5FP9A 5SV8A 1W39A 4HANA 1F15A 5AVPA 3Q8AA 1OXCA 1UF2C 2KA3A 4W6WA 2Q1FA 1T2XA 1WLTA 1ULGA 3FBMA 1XYNA 2KM2A 3OG2A 4YFZA 1MPXA 2VTXJ 4XIKA 2J42A 4GH4C 3BIWE 1PHMA 5FUPA 5LY1A 3POYA 1AYN3 1AR91 2Z42A 4B4RA 4FFFA 4BXFA 1NA1A 1W9FA 3VZJA 4FOYA 2VZTA 2V5DA 3R4SA 1YYNA 4BLIA 5FLJA 3ZXGA 4GALA 5FOJB 4FTEA 4IEXA 2R0FA 1UOFA 2A7AA 1VAMA 2B5HA 5JSRA 3N4MA 2JDHA 4EWAA 4WZFA 5LW9A 4RSUA 5DZFA 1MS1A 2OIIA 2QZ3A 4B1LA 1US3A 2YHJA 4YSFA 2VG9A 1URXA 3M8LA 4XJZA 1HQWA 4AE2A 3VDDC 4A3ZA 3LD8A 5DG1A 2XUMA 3AZXA 5FZ8A 2EXJA 5H9QA 4E4HA 2G9ZA 1UCXA 1AR93 1LODA 2B7YA 2IFRA 2RG4A 1NXMA 3OUIA 1V6MA 1WBFA 1NY72 1U5IA 1VBC2 4AI2A 1YXWA 2YXSA 4RR3B 4GA9A 2KD7A 4GH4A 3KF3A 5I0RA 4PF5A 4KH9A 5JR2A 2YU1A 2XBO1 3M3QA 2JE7A 2WZEA 3LFMA 3U11A 2FD8A 1MS3A 4FPOB 3UJOA 1UW8A 2JDAA 3ZXJA 2A73B 1XSRA 2RDQA 1ULOA 1Y43B 2V72A 3LCPA 4WVMB 2A6WA 1YQ5A 4M0NA 1SMVA 4Q1RA 5FZDA 1H2LA 1PO21 1WCUA 5IWFA 2P37A 4KU8A 3LE0A 4Y33A 1REEA 4XQDA 4XHBA 4AHZA 5F9TA 4QWNA 4AVBA 1DQ5A 2ILMA 1J59A 2XL9A 1W2TA 4UFMA 3VDDA 3DKWA 2NQYA 3L9JT 2XBO3 4GKXA 1W90A 4ATFA 4DS0A 3TEWA 3E5XA 3TOJA 4LT5A 3GALA 4QXCA 4P5HA 1OQEA 2XJRA 4QHOA 2XVGA 1UU5A 2OKXA 3RNSA 1HB3A 3H3ZA 2VQ0A 4HVOA 2W08A 3KCYA 2ZEYA 4JQRA 1FX5A 2DVBA 1UPIA 1MZFA 4AEDB 1ENXA 2Q8OA 3H9AA 4CP9A 1EAH1 1YLLA 4QB1A 3WNNA 3EXUA 1K5MC 2ZMKA 3VHOA 3JZVA 4XILA 3LIGA 5LA1A 1MS8A 4QQPA 3PNAA 3KWVA 4PDWB 1W8OA 1H1MA 5FZ6A 2VBBA 4J1WA 3BIEA 2HWE1 3RVHA 3PIJA 3RZHA 3IPVB 4LQRA 3ETQA 1FMD2 2XMLA 5JAXA 2BOJA 3I2DA 1WMEA 4Q5OA 5JR7B 1B09A 3MF9A 2ZAAA 4DUWA 5F1RA 2R043 1EAH3 3MPBA 1PGSA 1W2OA 4MHUA 5D8AB 2HH9A 4JDNA 1A6CA 2ZHNA 3JD72 5G04L 3NWKA 2NN8A 3H8UA 1AR81 2CDPA 5E16A 2R042 5KHIA 2YGMA 3ACFA 3WHUA 1Q56A 4DZGA 3LEKA 4KGQA 1IS5A 2HWE3 3G6JB 1GQGA 5EXOA 5I93A 2UYAA 3GXUA 2BTVC 4XJ8A 3T2OA 4LHSA 1K5MA 2Q8EA 4RQPC 1JZ6A 5E8AA 2DCJA 2AH2A 3U4SA 5JPNB 4UFHA 3P6BA 2YG0A 3OYWA 5BNNC 1S2EA 3HPNA 3W9AA 1VBD1 3B94A 3MV11 4QQHA 3VDBA 2HWB1 1J83A 4QU2A 5K8SA 1AR83 5JOXA 4W4ZA 2EA7A 4DEVA 1XB9A 5CISA 1U0AA 3LFIA 5ERLA 1W6MB 3C7FA 3WNXA 5LWBA 3ZSMA 3U07A 4JX0A 2PAMA 3ZKYA 3R05A 5FXVA 5HCAA 4A45A 2C9AA 3ZYGA 1LOCA 2PTMA 2NP0A 1OOPC 1V6JA 3U14A 2GNDA 1UYPA 4QGLA 1QQP1 3I3MA 3CMGA 4D3WA 1RL3A 4YW6A 5C9AB 3B02A 1VBD3 1AYM2 1W0OA 1OSGA 5LK7B 2IUWA 1BHGA 2HWB3 4N53C 5DAPA 4XTMA 4QQOA 5LA9A 2VECA 2D5HA 4HPKA 4XF1A 4IE5A 4M4RA 3OB8A 4RQPA 4N7UA 3VDCA 4AOCA 4CDUC 4LA3A 5C3OA 4MYEA 2A3YA 1EUTA 1HXS1 4Y22B 5BNNA 4NROA 3S5QA 3WF3A 3V0BA 2XJSA 3WDYA 5A80A 3UGFA 4I30A 1POQA 1RJ7A 4MSVA 1UY3A 5DAQA 5EJZB 4OLLA 1ENQA 4AGGA 3DPRC 1QQP3 4JKMA 2HLEA 4S2GA 2BVBA 3ZXLA 1GNYA 1QH7A 1VP6A 1H1AA 1HIXA 1IPSA 3KVAA 2WBKA 4YVWB 3VHNA 1OOPA 4COVA 1VBA3 5JXIA 4IE6A 2WAOA 2RJLA 4K40A 2IC1A 2WFF1 3UV9A 1SEFA 2NMNA 1VBA2 2VZ1A 2YPDA 4N53A 1LOEA 2Z4FA 2R062 4ISRA 1QXJA 1SLIA 3T2TA 4CDUA 1RHI1 3A4UA 3MDPA 4QX8A 4XTPA 3WHTA 5C33A 1NLSA 4Y26A 4L97A 4AVVA 3NJZA 3HR9A 3J8F1 5C8WA 4CCCA 2DUQA 5HXVA 1RYYA 1JW6A 2RE9A 4EN9B 4OCTA 3ZMNA 1ZBA2 3C3VA 4LO8A 3PVNA 2XXZA 3P5BA 4CU6A 1OH4A 3DECA 3LB9A 1HRI2 2J1AA 2VOWA 4FOWA 1PX3A 1V6LA 2W87A 2X29A 5GZFA 1PGW1 4ZXKA 4YZ5A 2R32A 2WFF3 4H3WA 3N7LA 1WW6A 5GLVA 4EZ4A 3VUOA 3RRDA 2DBNA 3GCXA 1XE7A 3GJAA 3LEGA 3N36A 2A6VA 4IGQA 3MI8A 2PYTA 1QOTA 4QXKA 1JYVA 3VGIA 3HAGA 3MLJA 4L92A 4DY3A 3N7JA 3B69A 1JU3A 3LSEA 4R8HA 1PIV1 2VPVA 3SH5A 3VZMA 3I7DA 4DXZA 5AC92 1JYIA 3J8F3 2ID4A 4JZRA 3I2FA 3W5NA 5CU1A 1CVNA 1OA3A 4CU9A 1SPPA 1IPJA 3HEIA 2JD4A 2O1QA 3J8F2 5FZOA 2LTNA 3S6PA 4OI1A 4Q4X2 2WRAA 1ACCA 2GN3A 3BALA 3JB4C 2XL7A 2RVAA 3GBFA 3LA3A 2VCMA 4BA6A 3HD8B 5A6QA 4MXVA 2B46X 3A23A 2LUWA 3A22A 1W6PB 1G7YA 1TMF1 5CIRA 5K4LA 4KGGA 1YQ2A 4RR3C 4GB32 4CU7A 3TN91 1COV2 5K9YA 1JODA 1SCSA 3ES4A 4UW4A 5DZEA 3ZIXA 2XGXA 1JZ2A 2OZ6A 4YGBA 4S2FA 3POBA 1DQ2A 2E33A 3U0ZA 1XOYA 1V6NA 1OQDA 4N9HA 1U12A 2BFUS 5FTTC 3ZSKA 1O59A 4LUKA 1UD1A 3EMRA 3C7OA 5IJRA 1EPZA 3I2IA 1HN0A 2VVDA 3OGRA 4FPFA 1BBT1 4PLMA 5FO7B 4DNYA 3O1UA 1TMF3 2JIGA 2J1EA 1VRBA 2FMYA 3PL0A 3QH6A 3ZM8A 1S0CA 2G4IA 3DUIA 4KBBA 3TN93 5BV6A 5DMYA 5I0SA 1QNYA 2BV4A 4YZ1A 1UWWA 1PVXA 4LBOA 4L99A 5KXCA 2AEZA 4YW5A 1E5HA 4UT5A 3ILNA 1FATA 1UIJA 2TNFA 3Q8BA 4H14A 3AYDA 4HN1A 4H2AA 4NMIA 4QT6A 3AP7A 3SMHA 1AR62 2K46A 1DQ6A 4RR3A 1APNA 2J1SA 1UL9A 4OHYA 3IWZA 1O3RA 4XFBA 3UT0A 2HJIA 2EIBA 4XF4A 4NJ4A 4UW6A 3WOGA 1R091 1F8VA 2IFWA 3WUDA 4V1PA 3MFAA 4L2NA 4LTAA 1W28A 4HLTA 4LLOA 4AEDC 1G8WA 3ROUA 2IVIB 1WD4A 1WD3A 2WWSA 3NMBA 4P9IA 5EJ3A 3WNMA 3H1YA 2D3RA 4WVMA 2ARBA 2GAUA 2QQMA 3KV9A 4RHV1 3WQ0A 2BNOA 3HIFA 2AUYA 4PDWC 2D7FA 2ZX2A 2FDIA 3DGTA 5IW0A 3I3EA 2FZ2A 1CAVB 1Y9GA 1JOJA 4GJZA 4Q4Y1 3T2PA 1ST8A 1NQJA 3M1HA 2GMMA 4M0HA 4JV4A 3T30A 2N7GA 3AFGA 3D3AA 3PUAA 1SDWA 4YRDA 1F31A 4NN0A 4YZ3A 5FWJA 4V2VA 1R093 1PVC1 1MS0A 1UY0A 2ERFA 4P9YA 5A7NA 1BEV1 2JG8B 2PMWB 2XJUA 4Q8KA 4GULA 1HRV2 1OUSA 5D8AC 1TME1 4NRMA 3VBOB 1ZRFA 3ZDVA 4E8CA 1UY4A 2XVLA 2ZXQA 2A6XA 2HEWF 4XUQA 1K45A 5DN2A 1H8TB 4Q4Y3 1I5PA 4L9BA 5FXZA 4AFDA 5A1LA 2OPWA 4AEDA 1CQ9A 3CF6E 3KGLA 5EYXA 2WR9A 2HWF2 1OKOA 3WQBA 1PVC3 1QMJA 3M70A 2JDNA 1VAKA 4PDWA 3S0MA 1BEV3 1LOGA 5DUWA 1UZVA 2WQ8A 3AKRA 3CL1A 3LPGA 3PUSA 1TME3 3IT8A 4YVSB 1ZVFA 1UY2A 1HJFA 1OLME 2B39A 4KQ7A 4R9AA 2DFBA 4B8EA 4QX1A 4AVCA 2RJKA 4N8MA 3ZFFB 2WSVA 1YQ8A 2F17A 3VKLA 4FPCA 1CONA 1H4GA 2JXAA 5D8AA 1OLQA 4B4QA 1VJ2A 1DFQA 3AXEA 4GWJA 4D8MA 2WYSA 1V9U1 1OD3A 3JU9A 3GHNA 1RUH1 3LOIA 2JEMA 1LAJA 1AL22 1OKQA 2B45X 1W8UA 2QBXA 5C9AC 1RXFA 2BGPA 2FCUA 3POFA 2GNBA 4JRAA 2Z79A 4DXSA 4AG4A 5T54A 1JZ4A 3SC7X 2K0GA 4CEWB 2LRPA 1EV11 1K3IA 4OHWA 4YM2A 1BVP1 2WFPA 3LDKA 4EN7B 4Y24A 1RUG2 2P6CA 4YYOA 3KM5A 3N7MA 2A3WA 1QJFA 2IXIA 4IGPA 3SNMA 2YBKA 3OY8B 4C91A 1O3SA 4KNCA 2ZGKA 5FZBA 1KD7A 2XQXA 1YFYA 1V9U3 3MO4A 1RUH3 2WQZC 5J37A 1UZYA 4R4ZA 1W6MA 3LIHA 2D6MA 4XDPA 1LGNA 3EB7A 1HB2A 4CRQA 1BQPA 2PN5A 2YGLA 4QDSA 3PDQA 5A3OA 4Y5TA 5FZFA 2ZZQA 4BJ0A 1UZ0A 2ZGTA 3VD5A 4I02A 1MS9A 5JXHA 1EV13 2PHRA 3OGGA 4YVWC 3DKQA 2Q1ZB 4CP0A 4FFIA 1FPN2 2YFUA 3ELNA 5BYNA 3MIFA 3V65A 4MGQA 3DV8A 2F4LA 5DUVA 4C0HA 4QPIB 3WVJA 3RFRA 4D0QA 3AC0A 1B35B 2HKXA 4EWEA 1A34A 3ZLIA 4A7KA 4MADA 1HW5A 2C5DA 2RS12 1JZ7A 4PCRA 5LRSA 1WCKA 3DYPA 4Y22A 4ZONA 2MNGA 1MZEA 2WN2A 2RJ2A 1Q3EA 1EYBA 3VKNA 3VKFC 2ZTNA 3CU7A 1LHUA 1QIQA 4NIHA 1SCRA 4XFFA 4IERA 3AMNA 4XDQA 1W8ZA 4YM1A 1SDDB 3CDZB 4W50A 3BTAA 3LSDA 4K3UA 2WC2A 3WX5A 4ONUA 1R1A2 4R52A 4EE2A 2X5IB 3WW4A 3MGUA 2VC9A 4LHNA 3KZ4C 2BOIA 4IEVA 1H2NA 4YVWA 4LPLA 4LO6B 5J48A 1XJAA 3HMYA 3H1MA 4W8JA 3TYJA 1QHDA 5JI9A 3I97A 4XUNA 5B2GB 4DMIA 4WV8A 5FY8A 1IHMA 3W21A 1UOBA 2VZRA 4NHMA 3OUHA 2G9FA 3CIHA 3QH7A 4LO4B 4N90A 5DQ0A 5A7OA 5ACA3 2C24A 4P9JA 1VMHA 3KV5A 4Q4V2 4Z2WA 4E27A 4A7YA 4I3PA 5GLWA 1JZ8A 2CWSA 2E6VA 1DIWA 1DQ4A 1Z7S1 4NO4A 5ACA2 2EICA 1PGL2 4QKNA 3ALQA 1GBGA 4EROA 5IATA 2W1SA 3GYDA 3P3NA 4FPYA 2WSUA 5E6HA 4AYUA 5IAXA 1D2QA 4UF0B 4BQXA 5DZGA 1QJZA 4JVAA 1SACA 1CZVA 4PF1A 1QJX1 5D21A 1W3XA 4YW3A 1UZZA 3AB0A 5FPBA 5J7MA 1TQ5A 2HWD1 5CFDB 1YIFA 3GCWA 4MH0E 1UMZA 5FZCA 1ULEA 2D6OX 2WA4A 1Z7S3 1FV2A 1LCLA 5JMOA 1L7QA 1WW7A 3ZSJA 4BPZA 4K21A 3WP5A 3T3YA 1YO8A 1QXPA 3SXWA 1XNBA 1WCSA 4XURA 5A3PA 3O14A 1OHFA 4RGAA 5FP3A 3ILFA 5KXBA 4EJRA 3INAA 3TEZA 4B7EA 2WWJA 3GGLA 3MW4A 4EWDA 4FXKB 1OA2A 1DZRA 2X53S 3E6BA 4ISQA 3NL1A 2HWD3 3TWIA 4CXXA 2XWJB 4A44A 1W6PA 2Y6LA 2XG3A 3I4IA 1YI9A 2XKPA 4IE4A 5FPZA 4D6SA 5C5UA 3ZXEA 1YFWA 4JGZC 4XJUA 1W6QB 3N3HA 1YWKA 3S7IA 3ZX7A 1XE0A 1YC61 2QQOA 1CX4A 2JDPA 3PTYA 2JDKA 4P9WA 2CNAA 3LGRA 3R4DB 4QX5A 5JIUA 3GF6A 1RIRA 1ZYBA 5JWPA 1S4CA 2P1BA 4PQQA 1N1VA 1JTZX 4AEJA 4QKBA 2BRTA 4OHZA 3E6DA 1C8M1 4XVHA 3MEPA 4LUMA 4JC1A 1HX6A 5LA2A 3THPA 1V6IA 3NNMA 2W3JA 4HBNA 2FDFA 1SFPA 5EZWA 1ZBE2 5FR3A 1AXYA 2DU0A 1IKQA 1WLDA 5TSWA 4OYUA 3P1IA 4I2OA 3IAPA 4HFSA 1DGWX 4BOWA 5GALA 3AZWA 1U5XA 1RUJ1 1G9DA 2JG8C 2A6ZA 3D0SA 4TWTA 4O9GA 3ZIWA 2WN3A 1SBEA 2ZZJA 4XACA 1QJY3 3T1MA 3VBOC 3WW3A 2BU9A 5FYYA 2DVGA 1RUE2 3D8CA 1C8M3 1FXZA 4IXLA 4JGZA 1QJY2 5A3WA 1H8TC 5A3NA 3I2GA 4OFGA 4XF0A 3NSTA 1LJ7A 3ZPYA 1SFNA 3S30A 3WG4A 1UIKA 3AK0A 5FK8A 2GU9A 4YWAA 1RGSA 1XPWA 2Q30A 5H9PA 2E7TA 2HEYF 2QQKA 1O4TA 1F35A 4X6QB 2PHWA 3WSOA 3OPZA 4ZPIA 4DINB 1JXNA 4FTSA 1CAVA 2OW4A 4PT6A 3MV01 2JJ6A 2ZX4A 3NNLA 4M00A 3O1PA 1OVSA 4YGDA 4YVSC 4A42A 5FP7A 1Q8OA 1CPNA 1KS5A 4MO3M 5T55A 3PIGA 3KQ4B 4Z1VA 2JG8A 4KG0A 3ZFFC 3BODA 1O3TA 5FV3A 4NIIA 5D2AA 4Z92B 2F4PA 1W99A 3VBOA 4ASKA 3ENRA 1BLZA 4FP2A 4UAPA 1NLRA 1A78A 4CPBD 1V6KA 1H8TA 4XUTA 5A3MA 2VCCA 4BDVB 3ZPOA 2ZEZA 3VZOA 4YGCA 4CEWC 2AC1A 2OYZA 3SITA 3CLPA 1W2AX 4OULA 3FLRA 1C4RA 1FOD2 2Y34A 1QH6A 4P14A 4FPGA 3A7QA 2PQQA 4AVAA 4LO5B 4YGEA 5FP8A 1L7RA 4AI9A 2PHXA 4QU1A 1X7NA 4LKEA 4YVSA 2UURA 2Y6FA 3ME2A 4E8DA 3POJA 3B00A 5BNOB 4Q27A 3VD3A 3ZFFA 2R6QA 3ON7A 4NIAA 2GH8A 3ETPA 3C7HA 1WWYA 1WW4A 3CNAA 3J9SA 1WW5A 2E7QA 1ZA4A 2VW2A 1WA6X 4PIZA 2VNGA 2ZEXA 3U75A 4BHPA 2OPKA 4CZSA 4D7TA 1ND2B 5I8TA 5JXJA 4QXHA 4XCAA 5BPXA 1NY71 3J26N 1VBC1 3J7MA 1W05A 4QPIC 2HBTA 3D6EA 2R30A 3WV6A 4FFGA 3I3DA 3JBG2 1B35C 4WM8B 4CEWA 2ARXA 4XJAA 4Y5Z0 1PMIA 2OVUA 1UX6A 2BVVA 2BGOA 3RMXA 5A3LA 4CDQB 4QGNA 5L9BA 3I2KA 5C4WB 2PHDA 4JDMA 3HN3A 3JXSA 4QQLA 5LB6A 4LKFA 2D3SA 1KDKA 1UQXA 3O5SA 1CGPA 5DG2A 4E4ZA 1J3PA 3B3QE 4COYA 1DCSA 2BNMA 4F3JA 4QXBA 1QKQA 1UMIA 1VBC3 5GLTA 2ZHMA 3HWJA 1UN1A 2WL1A 3B01A 4QX2A 3KVBA 4ES8A 2HWC3 1OF4A 4IQPA 4LIUA 3RS6A 5LK5A 2D3PA 3WF0A 2X5IC 4K20A 4TSVA 1X8MA 1Z0HA 4JHTA 5G05L 2HWC2 1WZXA 3AFKA 1CN1A 4XF9A 5F3EA 1NUKA 2VVFA 2YMZA 4XOGA 4BZ4A 4JRLA 4QPIA 1C28A 4NHXA 3H8XA 4UWDA 2RDSA 4NHKA 1B35A 1ZRRA 2VGDA 3VHRA 3N9LA 3DN7A 3EYPA 2W1WA 2YYOA 1XYPA 2UWAA 2RV9A 1RUF2 1GR3A 1OC1A 3B5LB 3VL8A 2BPA2 1GP4A 2RS52 1DP0A 2WO2A 2FDKA 2W91A 3ITQA 3I8TA 4NR1A 3UYJA 1LHVA 1SLLA 3S57A 3CBNA 3OOXA 1UKRA 1IKPA 2P3JA 4UOJA 1PZ7A 4AAXA 2ADDA 3LA2A 3FBYA 3KSCA 4CP1A 2WO7A 3O7OA 3UJQA 2QQLA 3WNOA 1US2A 1FMD1 5T5OA 4COWA 2X5IA 5CFCB 4IEZA 2EAAA 1LEDA 2ATFA 5FRAA 5CFDC 5DAVA 3N7KA 4QKFA 2VUAA 3WINE 5H9RA 4MZUA 2CL2A 4Q26A 5SV5A 4XUOA 1D4M2 3VKOA 5A7WB 1TEIA 3WXPA 3WR0A 2JG9B 3JD71 3WCSA 5ABJB 3HT2A 2R041 3M3OA 3WW2A 5JOZA 3MUZ1 3UKNA 3VZKA 1GQPA 2CGNA 3R6SA 3RYPA 3NW4A 1QNWA 3HJRA 5IFPA 2RMU3 2ZX3A 3D5OA 3WT3A 5FAXA 5FPAA 4HK8A 4AWDA 2K9ZA 4DRRA 1FMD3 1X8EA 1O5UA 2RMU2 1NCRB 1C1LA 1IZ3A 5DABA 5HXMA 3FC0A 4EV0A 2JE9A 4OHVA 3USSA 5CG8A 1OLMA 2P6HA 1R64A 3VD4A 4UF0A 2AYHA 2VULA 3JD73 4FPJA 1AR72 2EIEA 1Q5OA 2R072 3J4UH 1GANA 4YW4A 4XPVA 5CFDA 5FZEA 4MLOA 4MGKE 3VDAA 4XYXA 1RMU2 2W0XA 3K75B 2VW0A 1F4HA 1CJPA 2Y6KA 3S7EA 4BXSV 5JUVA 1I6XA 3MIEA 3NV2A 2XR4A 2RS31 5HCFA 2FDGA 4EYUA 4XF3A 1LECA 3U4XA 1LRHA 4BIOA 4DO0A 1JYTA 1KQRA 5JSPA 4R9BA 1VPHA 3HBKA 1AYM1 5FREA 1UOGA 2EAKA 3KT1A 1ONAA 1DYKA 2HBUA 2ZBJA 4FOVA 3FX3A 3MICA 5I8YA 1R082 4UFLA 2O8OA 2VW1A 3DL3A 3AVSA 3SKVA 4C1WA 3RMYA 4B4PA 1LULA 3BB6A 4CP2A 5JZGB 5KHJA 3AL6A 2W95A 3BCWA 2YUEA 2WWUA 3KLSA 4XE9A 1AZDA 3AM2A 3RYKA 4CVUA 5IT6A 2VOXA 2X10A 1OQ1A 2RS33 4COZA 4XFAA 3M7AA 4AGRA 1RTVA 4EN8B 5HV4A 1YNAA 5HPOA 3WNKA 4NPMA 1CAXB 1AYM3 2RS32 2Y0IA 1W0NA 4DXTA 4E4SA 4PBOA 3WUCA 1VIWB 1FAYA 1F4AA 2LROA 5CEHA 4AEKA 2XHNA 2CYFA 2DUPA 2ET7A 1K12A 4MGSA 1DLCA 4AGVA 1E5RA 3IDBB 5FZMA 5EIYB 3DCQA 3HQXA 2AGSA 2PLV2 1CR7A 4URTA 1UU6A 1IS4A 4AFAA 5FCCA 1JUIA 1VBA1 2PA7A 4NPRA 1YCIA 2ZCWA 4XZPA 3VBHB 2R061 2OQ6A 3KMHA 5KXDA 4H7MA 4ORFA 2ZJCA 3A21A 1HDKA 3AXDA 3UK9A 3APBA 4Q4W2 3LAGA 2YFZA 4O9EA 1O7FA 5FMDA 1MZ5A 1REDA 5BNPB 4A2UA 2D6KA 1ZBA1 3AJYA 3N9NA 4NOTA 3PTRB 3KHCA 2GC0A 1NQDA 1VAVA 2VUCA 4ARYA 2FBEA 1HRI1 2OXBA 1L7LA 2XDVA 1H0BA 3WNPA 1PO12 4HVRA 1VB2A 2P4EA 2R063 4Y1ZA 1CX1A 4OI0A 1PMJX 2WO3A 4BCUA 2A3XA 2VO5A 3U10A 3E6CC 1PNFA 3N9PA 3VBRB 3K51A 5AC91 2EXIA 4BQYA 1XRUA 2R49A 4Q0PA 5FZ3A 2RR12 1LESA 4C8DA 3EJKA 1ZBA3 2GALA 2Y33A 4KWJA 5BNOC 3NQHA 5C3QA 2C9KA 4EN0A 1HRI3 3J7NA 4Q4X1 3ZYFA 2P3KA 4QPYA 1D7PM 2XUEA 3SEPA 4BISA 1DZTA 5CG9A 3I3QA 2CU5A 1GZCA 2WKKA 3DPRA 1KJRA 3NO8A 1H2KA 2HYKA 1MQTB 2A71A 1YQCA 3MLLA 1N1YA 1TNFA 1Y9QA 4GB31 1COV1 4IV3B 5J98B 4JTOA 3M3CA 4WM8C 1OA4A 5E1RA 5AC93 5BXXA 3ATGA 4LKSA 1IQDC 4WM7B 4FPKA 3SEEA 3VN4A 4CDQC 2VUJA 4F7ZA 4DRVA 4P02B 5C4WC 4LULA 5LZ6A 1Y9MA 3Q9OA 4Q4X3 3PMSA 5FPUA 1TNRA 4Q1PA 2BJSA 3TEXA 2ZABA 2X05A 3RZMA 2V09A 3KS7A 3K4DA 1TZOA 2VMFA 2DVDA 3K3OA 3T1LA 5BNOA 4CCNA 1H8VA 2ARCA 1CAWB 4GB33 1Z78A 1COV3 4GWIA 3ZXKA 5F7UA 2JWPA 4LBLA 4RYDA 3WF4A 3ACGA 5IVFA 4G3YC 2FDHA 4BH9A 3PVEA 1S0GA 1CZTA 1NZIA 3ZN4A 1WMDA 1AR61 2VTXA 3LOBA 4XAEA 3FWEA 3ZO0B 3V56A 4A4AA 4UFJA 2CTVA 3AKSA 3W20A 4JHZA 4RL7A 1GQHA 4WM8A 4R4XA 2DTYA 4COUA 1JZ3A 3AMPA 3POEA 4HETA 2MHFA 3THDA 3AKTA 1RUC2 4CDQA 4Y4YA 4CUAA 4YG3A 5C4WA 4CYDA 5J36A 1WMFA 3P3PA 3PMEA 4XETA 2W39A 3UESA 4BMBA 2G1MA 3POSA 4RGKA 3IBMA 4BQWA 3WP6A 4AR2A 2SBAA 3POGA 1W6NB 4BQ3A 1PX4A 5A7QA 1AR63 1Q8SA 2YDEA 4IETA 4OMDA 4QB2A 4M3CF 4LBJA 2MEV2 4WZCA 4CXWA 4ZKTB 5GZDA 5LA0A 5FUNA 1JI6A 3NJYA 3B7MA 2JDMA 3Q8CA 2VH9A 1ULDA 2D93A 3RWKX 4E9KA 2UWCA 1QOOA 4CE8A 2WNUB 4NPLA 1S0IA 3L2YA 3EQEA 5KXEA 1HRV1 3E5QA 1DYPA 2JE8A 5FYHA 3ZMOA 1T6GC 2NM1A 2JG9C 5FO8B 1KRIA 1HV0A 5ABJC 4OUMA 4YW1A 3OEBA 5GZGA 3NKGA 3VLBB 1RUD2 2BWCA 1BMV2 4NWVA 4WVWA 2C4XA 1DYOA 2GC3A 2P3IA 5D1IA 2RM22 1KGYA 4XFGA 4RS5B 2HWF1 4AW7A 2P2KA 1YHFA 4NHLA 1ODMA 1VBB2 5JI7A 4XDOA 4NVPA 1NCRC 3VKMA 3RQ0A 1REFA 2Y0OA 2DVFA 4CCJA 3N35A 4LXLA 2XJTA 4F83A 3TAYA 3PUQA 1HRV3 3WDUA 3X29B 4AVTA 4AFBA 5FPLA 2V5YA 3AKPA 4FBFA 1YQ6A 5F3CA 2VVEA 5ANQA 2DF7A 2VNOA 4FVVA 1LB2A 3ACHA 3MBWA 1AL0G 2IZWA 1AX2A 2W68A 3H7YA 3ES1A 2JD9A 4AHXA 2VMIA 3M3IA 4Q8LA 1EPWA 2HWF3 1QOSA 1WKYA 4ZY9A 1D2SA 2JG9A 3AKQA 3B93A 1SBDA 2QDRA 2ENRA 1O4ZA 4ZS2A 3GNEA 5ABJA 4MG2A 1RUOA 2NLRA 2BW8A 4UW5A 1AL21 5FZ0A 5I0UA 5T52A 2OUJA 4MGZE 1C57A 1ULCA 2DU1A 2XHKA 5LBBA 4HKLA 2K2SA 3CJXA 1CPMA 5FYMA 3M3EA 1CZSA 2ZGMA 2E32A 3NV4A 1CD3G 4CEYB 3S5AA 1XSQA 4I0WB 4CCOA 4LLFA 1NCRA 1YJLA 3IPVA 4PJYA 5KWRA 1RUG1 1TG7A 3OBZA 1H2MA 1XU2A 4OZXA 1S2BA 3ZXDA 5JZGC 5J96B 1E5SA 2RDRA 1SQ4A 3KD4A 1BK0A 3UGHA 1VRH3 3J7LA 1SLAA 4FQZA 1X33A 1QXRA 1AL23 1DHKB 5H9SA 1JHNA 5IVVA 4FFHA 2EF6A 1VRH2 3GZTB 4FPEA 2Y6HA 4Y5SA 2B42B 2Y6GA 1W8WA 2XLFA 2DURA 3RDIA 4Y1UA 2BEOA 4AI1A 2Q4SA 1JYXA 5A1FA 4DPNA 5IK8A 1FPN1 1BK1A 1RUG3 4CCEA 1GFF2 2W2IA 4GJYA 5CKQA 2D98A 1LHWA 4DXRA 3IM0A 4XJWA 3VBHC 2X09A 3KGZA 3AYAA 4FXGB 1QJEA 3F95A 4M3CE 3E5UA 3T4VA 1XU1A 5C7GA 3ZFGB 4LJHA 2JB4A 2RS11 1S0JA 3TNPB 1FI2A 2GP5A 4BLJA 2VMCA 2Y26A 4LIVA 1RUI3 2CDOA 4P08A 4U36A 5BNPC 5JZGA 4URAA 3WP4A 3ZFEB 1JHJA 4DUXA 1XC6A 1FPN3 4HKWA 1NCQB 1RUI2 2VXJA 4YW7A 1W03A 3OSDA 4MVTA 4NRQA 4LO7A 4PLNA 3RJRA 1CAXA 4BK5A 1T6BX 1HV1A 2ARAA 1JN2P 1GNHA 1W6OB 4LHLA 2OQ7A 1R1A1 4LK7A 5C9AA 5FZ4A 3FE5A 2XB6C 4AXOA 4YNIA 3MUY1 3VD7A 2E7AA 2RS13 3NKTA 3NJXA 1UMHA 3AX4A 2SLIA 1FV3A 4Q0QA 3VBRC 3CQOA 4J1XA 1IS3A 5EHDA 3JQXA 5CA6A 4L0PA 1Q8QA 1WBLA 2NMOA 1O8PA 2VTFA 3PURA 3VBHA 5IYYA 2A1XA 4Q4V1 3VZNA 2AACA 1KXGA 3GJBA 2ZHLA 2EALA 5B4NA 4XUPA 2E31A 5ACA1 3FHIB 4JGYB 4XEZA 3KT7A 3K77A 1PGL1 5IAVA 5GKAC 1R1A3 3THTA 1J3RA 1G86A 1GP6A 1MQTC 2DWRA 5BNPA 4FCAA 5CNAA 3VHPA 1SZBA 5HI0A 4CCMA 3T2QA 2ZEWA 5I91A 2FHRA 1W2NA 1CWPA 4A3XA 4IV3C 2Q5TA 3MIGA 4K1ZA 1J84A 4AI8A 4Y1VA 4WM7C 2KXLA 5JDBA 2W9XA 4D7YA 1RVF1 2EXHA 2IVJA 4Q4V3 1YIPA 1GP5A 3MF6A 3WNLA 4AZZA 3RZGA 3SCGA 5FY5A 3OBTA 3VBRA 1JYWA 4MXWB 4L11A 2FDJA 3NRUA 4JKKA 4OHXA 5BUVA 1ASJ2 1KFXL 5F5CA 3SISA 3WG3A 2QFEA 3EHKA 4OVEA 4BE3A 1N3PA 3DYOA 5KHKA 3WW1A 1Y4WA 4XCBA 4TZDA 5KC6A 3ZYBA 1S0FA 3R4UA 3BYWA 4ES9A 1MQTA 4X6RB 1O6UA 1UPSA 2C6SA 5JSOA 1RVF3 3F2ZA 1LOAA 5FKBA 2AZ5A 1ALYA 1ULFA 4LMFA 3PHMA 4IV3A 2VM9A 1RVF2 1ULPA 4JCKA 5FZ1A 5FZLA 5KHHA 2PHLA 4C1XA 1U5ZA 5GJ6A 4WM7A 3SH4A 3WDTA 3LZZA 4QD2A 4XMIA 4I3GA 3MZHA 3U37A 4OI2A 4SBVA 3KCXA 5A7PA 3LWCA 5IUQA 3POWA 3DF0A 1UYXA 4AI0A 1PZ8A 5T50A 4RGGA 5F5AA 1IG0A 1K5JA 1LKNA 2Q1MA 5FP4A 3FMGA 1ZBE1 3KB5A 1CAWA 3LEIA 4D7SA 1ZRDA 3LKJA 5FLHA 3GM8A 1E57A 1ZZ7A
chains in the Genus database with same CATH topology
2H0BA 1NE6A 2VOVA 4M3CB 2D5FA 1WUVA 5DUXA 2NZ9A 4MGYE 2WZR2 2WNUC 1MVEA 2YZ4A 1N1SA 5C8CB 2Z2SB 1ZRCA 1AVBA 1RUE1 1NXD1 1QJU2 1QJY1 1NOVA 4IEOA 1C8NA 1O91A 3QLQA 3VBUB 3WQ7A 5FMOL 1ZBE3 2G9GA 1OPOA 4RS5C 1DU3D 1FNZA 1XE8A 4UBHA 3CJIB 3W58A 4Y1XA 4X8PA 2C0ZA 3AZVA 5FQ0B 1W6NA 3D82A 3VBFB 2XKOA 2R0HA 2DV9A 2TUNA 2WINB 5AVAA 1RUE3 1OD5A 2BQPA 3FLTA 2ZMNA 2WT2A 3BOPA 3WQ1A 4CTEA 1Y3TA 4CDWB 2WNUA 2WS92 4KU7A 4R9DA 2I2SA 2WLQA 2GDFA 2BNNA 3TBDA 2PAEA 1LEMA 2ZA9A 1YRZA 2BGCA 1F9KA 2V73A 3V64A 3ZDSA 1FT9A 4AI0A 5GM0A 1DF0A 4Y20B 4CEYC 1WLWA 4BQ1A 1FOD1 5EFUA 3SCHA 1X82A 1ENRA 2UWBA 5DDJ2 2B8MA 1J58A 3RSJA 4KL1A 4U2AA 1IS6A 1VLNA 2AR6A 1D4VB 1CAUB 4LBNA 3I59B 3UKVA 3ZSLA 3AP6A 2VU9A 5FPXA 2W52A 4AQTA 1LGBA 2ZMLA 1N3QA 4FPHA 2ET1A 1I1EA 1IOAA 5JCTA 4TLFA 1MEC2 3A0NA 4ITCA 3WG1A 1S1AA 1YFXA 1FOD3 2QUOA 2YC0A 1JUHA 3TRSB 3M4FA 2XWBB 3JBG1 2D43A 1OI6A 1O3QA 1VBE2 1V6OA 4CEYA 1LGCA 4DQAA 3ZFGC 5CBLA 2B9UA 3EO6A 3PLQA 4ASLA 1SBFA 2XLAA 2UYBA 2OZJA 5F5QA 4YM0A 2R16A 5DUUA 5FBZA 5K0UB 3ZFEC 4QPGB 3ZN6B 2QQPA 3TB0A 1NCQC 2IXJA 2ZGRA 1M4WA 2ZKLA 4LBQD 3WCRA 3JBG3 5A33B 5IK4A 1DQ0A 1S0BA 2HWC1 3AP9A 4YW2A 1ND3B 3K48A 3FJSA 1KFUL 2PHFA 5FO9B 1WA4A 3EBRA 1BKZA 2GMEA 5FMOS 4E2GA 3MYXA 1H30A 3OY8A 2JX9A 4IV1B 1AF9A 1RUF1 1YJKA 4FTBA 3ZFGA 2RS51 4YFWA 4N7IA 2YY1A 4JGYC 2CAVA 3VBSB 2F6BA 1LR5A 2DYCA 1WLCA 1RITA 3ZFEA 3IN9A 1NCQA 2VQAA 3TNQA 3ZN5A 1X36A 2GZWA 1AYN2 4FO9A 4LBKA 4B7KA 3KQRA 1ZM1A 1R1ZA 5L36A 1W6OA 2XJPA 1KS4A 2Y38A 4HSLA 4OUSA 1CJDA 1RUF3 4IESA 5AFBA 2RS53 4RFT0 4FPLA 3FFZA 4XBQA 1D4M1 4IEWA 4B3NA 5FLIA 3JB8A 5GZCA 2A5ZA 3NV3A 5T5JA 4YG0A 3OCPA 1BCXA 4MUVA 4FAHA 1L3JA 3ILRA 1AR92 2JDZA 3ACLA 2O0OA 2CAUA 2CV6A 3O0XA 3B9IA 4JGYA 1HQNA 1O4YA 4FSJA 1N3OA 3GZAA 2RMU1 3MIDA 5CADA 2LM3A 1AUYA 3LA7A 2XLGA 3PJQA 4LE3A 4LEJA 1D4M3 5E89A 5F6KA 2QDNA 1AR71 2R071 1BVVA 1NG0A 1WCDJ 3OF1A 4YG6A 3MW2A 2JICA 5J09A 3OJBA 3UKTA 3WP3A 1RMU1 4MXWA 1UU4A 2BBVA 1KJLA 2BYVE 1BYHA 2GC2A 1QDCA 4ZU7A 5A32B 5L7OB 4P9LA 2XBO2 3IMNA 1RINA 1Q8VA 2H6CA 2DUOA 5L19A 1PO23 1AR73 2R073 4S2DA 1J3QA 4G4FA 4MX3A 2WZPP 4J6GA 4AFMA 1CESA 1R081 2O8QA 4I0AA 1AXZA 2WNVB 1PO22 5C8CC 1LENA 4HN0A 1RMU3 1NZCA 3QCWA 1F2NA 4PLOA 4W6YA 3ZYPA 3ASIA 3VBUC 4A7ZA 3W59A 4Q0SA 2CY6A 4IEQA 3GBWA 4BIFA 3CJIC 2E51A 4DOUA 3V0AB 3VBFC 1R083 1AX1A 5GLZA 2WT1A 3IDCB 5LEKA 4ZU4A 1OLRA 4GWNA 2PLV1 2OUHA 2XH6A 4M3CA 1EAH2 4LA2A 3KCCA 2A70A 4CDWC 1W6QA 2H0VA 2D6NA 4YZ4A 3WD5A 5C8CA 2VNRA 4XIOA 1BJQA 4Q4W1 2HWE2 2TEPA 1QWRA 4AHWA 4LR4A 1GLHA 2ZGLA 3G7DA 3VBUA 4HZFA 2NYYA 4AVSA 2PHUA 4HMZA 4R9CA 1I3HA 2PLV3 1PO11 2QNKA 3CJIA 1KITA 5FQ0A 1DG6A 3VBFA 1AR82 3BU7A 2EVXA 1PK6B 3RYRA 4NWWA 2QVSB 2VMHA 1J1TA 3OBRA 2Q0AA 4Q4W3 2X8KA 2BFUL 2RR11 2EIGA 4FOQA 2XJVA 4BYYA 4CDWA 3O0VA 1G6NA 1ZZCA 1PO13 4PIYA 3AZZA 1VBD2 3GBGA 4K6BA 2HWB2 4AK3A 3WDVA 4K9SA 3MW3A 2E9QA 5JOWA 2QCSB 2ZS6B 4XFIA 2RR13 4Q0VA 4Y20A 4IL7A 3I54A 3WZ1A 3B9CA 3ZYRA 2I07B 4QGMA 1ZZBA 1IQAA 1CAUA 3I59A 3AZYA 1QQP2 5K0UC 4QPGC 2PELA 1QF3A 3IDEA 3D4KA 4AI3A 1G9AA 5T5PA 1DQ1A 2WLPA 1HXS3 1POV0 1ND2C 5IK5A 2PAKA 3RJ2X 4AQSA 2GC1A 3CO2A 4TYSA 5T5LA 1AHSA 1HXS2 1ZNPA 2BUKA 2GSYA 3WY6A 4AF9A 4BM8A 1ND3C 3FUOA 3NAPB 4C90A 2XVKA 4PIXA 3ZYIB 4GKYA 1GZWB 3KT4A 4IV1C 3A0KA 1RUC1 4XBLA 3WDXA 2QJVA 1O5LA 2PFWA 4N43B 3PVOA 1UKGA 4Q29A 1RJ8A 2LALA 3VBSC 3H3UA 5K0UA 3ZXFA 4QPGA 1MR5A 5E88A 3ZN6A 2WFF2 1RHI3 3AYEA 3H0OA 1SLTA 4Q2FA 1MS4A 2P34A 2MEV1 4D69A 2WIIB 1ND2A 4EN6B 1RHI2 5A33A 4B29A 4JTNA 5BY5A 1XNCA 4C0BA 2A75A 5F6LB 1RUC3 1ND3A 1W0PA 2XJQA 4LE4A 4FAGA 4W6XA 4P9XA 2UU8A 4XQWA 1LU2A 1PGW2 3MIHA 1RUD1 4IV1A 2A6YA 1BMV1 1OMIA 3SH3A 1MVQA 1PIV3 2MEV3 2WQ4A 4XBNA 3VL9A 2RM21 3OD4A 3AMMA 3VBSA 3RPQA 1DLLA 1VBB1 1PIV2 4KWLA 1A8DA 3M2MA 3R0RA 1G9CA 1VALA 4WVZA 3RI9A 5CFCC 3MIBA 3QD6A 2PHTA 3BOWA 5EV7A 2MPFA 3HT1A 2D6PA 1RUD3 2NPIA 1AX0A 1SLBA 2RM23 5EWSA 1TMF2 1KDMA 1VBB3 5C6CA 1DBNA 3TN92 3JUUA 4XQ4A 1LOBA 5L7OC 4XFHA 2ZGSA 2ZX1A 4BWOA 2ZHKA 2D40A 2Z5WA 4YM3A 2TBVA 4LBQB 4FT8A 4FQ4A 4INDA 3USUB 4JGZB 5IK7A 4L8QA 1BBT3 2I74A 3AMHA 4YZ2A 2DCZA 2GMPA 2WNVC 1OFNA 2Z69A 5JOYA 1BBT2 2WA3A 4UBGA 1TE1B 2ES3A 4W65A 5CFCA 2UY8A 3URFA 3GZUC 4Z8BA 2JECA 2DFCA 2IXHA 5JPMB 1C1FA 2DCKA 1D0GA 1HLCA 1VRH1 1JYCA 4MV2A 4E2QA 4Z82A 4QQ2A 3OGJA 3ZVXA 1DGLA 2DCYA 5A32A 4AQ6A 4E2SA 3SHRA 5L7OA 1R092 3AP4A 4GQ7A 4RHV3 1Y7BA 3ZYJB 4UXAA 4RHV2 3WLUA 1OFSA 2IXLA 1H9PA 1POV1 2WNVA 4Q4Y2 1SFYA 3MFCA 2D6LX 4DY5A 3JQWA 1AJOA 1RUI1 1H1IA 1PVC2 1ENSA 1BZWA 1BEV2 4CDXB 3CEWA 4META 1C5HA 1ZZ6A 1RC6A 2ZKNA 4XHXA 3ZXAC 1TME2 3V0AA 4JAAA 1POV3 2VOKA 1PK6C 1UAIA 4SLIA 4BMEA 4RA0A 1ZREA 4YLZA 3C2UA 5HCBA 5HBAA 3NV1A 3MPPG 3L2HA 1Q8PA 3AYCA 1NA1B 4XW3A 1RUNA 4JDOA 3HN1A 3VV1A 1S0EA 1D0HA 1XYOA 1HKDA 3QACA 5FOBB 4ZU5A 1AJKA 2AREA 2GNMA 1F5FA 1LU1A 5I8SA 4QM9A 1MZ6A 5T3NA 2IXCA 1V9U2 2YV8A 1RUH2 2E53A 1PK6A 1BXHA 4H55A 4PQ9A 2ZPXA 2IXKA 4K8FA 3FFQA 4IEUA 4OI4A 2ETEA 4GH4B 2DVAA 3VZLA 4RD7A 4E4DX 1ASJ1 4XMAA 1EV12 4DB5A 1DDLA 2EXKA 5JIAA 2UY9A 2CGPA 3E97A 4ASMB 3BPZA 3FUQA 4AHYA 5CB7A 2GNTA 3NAPC 4FP3A 5KBFA 1C5IA 5J3UA 1JH5A 4GMP0 5KHGA 5EYYA 1MACA 4HK9A 2I45A 3O12A 4K7JA 1GKBA 1YI7A 2FMDA 1GSLA 1CIWA 3VDDB 3D0JA 1ASJ3 4N43C 5GZEA 1ZX5A 1F5JA 4IEYA 1G9FA 4Q0UA 2ZAHA 1I5ZA 3H1WA 1LOFC 1J1LA 3RG0A 1DGWA 2R1BA 2D97A 1Q43A 3RI8A 1EY2A 2RHPA 2XPJA 3ST7A 2IWGB 2VY0A 1M06G 1JBCA 2C1FA 4K1YA 3NAPA 2WZR1 1QY4A 4XXAA 3H7JA 1V00A 1GZWA 4I0BA 1QJU1 2D44A 5LEJA 4N43A 4I01A 1GZ9A 2FZ1A 3RWNA 4G9SB 5KC5A 1XQNA 4HSJA 4LHKA 1U5YA 1LOFA 4DFSA 1NYWA 3FZ3A 4XJ9A 1IGOA 4LBMA 2QZ2A 2H6BA 2ZX0A 3JCIA 1A8MA 2WZR3 4PBPA 3HBZA 2P17A 1AXKA 2GN7A 5I0TA 3GHMA 2YROA 1QJU3 3O0WA 1Z7S2 3MLKA 4KWKA 1SLCA 2JENA 3ZSEA 1K5MB 5FDBA 5FFOC 1QDOA 2WS91 1HQLA 4GWMA 1QJX3 3OYWB 4AQ2A 1WGPA 4XFCA 3UL2A 1QJX2 1S2KA 2GH2A 4KG8A 1DGRN 1DGRA 1V70A 2CWMA 3IIAA 2HWD2 4HVQA 4LNVA 1QGLA 5BNQA 2VMGA 4GIQA 4P9GA 5CVRA 1A3KA 3OTFA 1DZQA 1EP0A 5DDJ1 4UW3A 2WS93 1H9WA 4F8AA 5K7PA 3WG2A 3AMQA 2ZGNA 3ECQA 1XNDA 1ZZ8A 5DXDA 2WJSA 1W2UA 1X50A 4Z07A 4QHBA 4AFCA 4WVVA 3QBQA 4HPKB 2R1DA 1NE4A 1ZZ9A 4RQPB 1PM7A 1MEC1 3RZZA 3AP5A 5AFEA 1C3HA 1S55A 5BNNB 3V0BB 4RS5A 2ZGOA 5DDJ3 2ZGUA 2AENA 2BWAA 1FYUA 4LBQA 3USUA 1GYKA 1N1TA 1VBE1 5GLUA 2VXRA 1PNGA 5JMCA 2CGOA 1I9RA 1XNKA 1C8M2 2OA2A 2ZGQA 4I09A 3NVCA 1MEC3 1OOPB 5JLVA 1LTEA 4S2HA 1PZ9A 3OD0A 3SCFA 3PJYA 1RUJ3 1G9BA 1LHNA 2QE3A 2WNEA 4GMP1 4GXLA 5L73A 5CAZA 3AJZA 4N53B 3FLPA 2DTWA 1XXNA 1RUJ2 2ZOEB 2QKDA 4CDXC 1FNYA 1QU0A 4CDUB 2ZGPA 1LHOA 1VBE3 4X8NA 4HKOA 4MGIE 4Y1YA 1RB8G 2YPJA 1YFUA 3SLIA 1GNZA 4WBBA 1N47A 1H4HA 3QOPA 4QM8A 4D94A 1GV9A 1S0DA 4M01A 2ZACA 4AEMA 3DPRB 3PVBB 2FQPA 1YUDA 1VB4A 4GMP3 5JVVA 1MS5A 3IKWA 4H7LA 3H50A 1NA1C 4QMAA 1OPMA 2WT0A 4N9IA 2E63A 4ATEA 2JKBA 2DCTA 2HEVF 5LRRA 1AYN1 4XXPA 4YARA 1VR3A 1IPKA 3U4XA 4IEPA 4CDXA 3WDWA 1GICA 4HL0A 4HT1T 5SV8A 1W39A 4HANA 5AVPA 1UF2C 2KA3A 4W6WA 1WLTA 1ULGA 3FBMA 1XYNA 2KM2A 4YFZA 4XIKA 4GH4C 3BIWE 1PHMA 3POYA 1AYN3 1AR91 2Z42A 4B4RA 1NA1A 3VZJA 4FOYA 3R4SA 1YYNA 4BLIA 5FLJA 3ZXGA 4GALA 5FOJB 4FTEA 4IEXA 2R0FA 2A7AA 1VAMA 2B5HA 5JSRA 3N4MA 4EWAA 4WZFA 4RSUA 5DZFA 1MS1A 2OIIA 2QZ3A 2YHJA 4YSFA 2VG9A 1URXA 3M8LA 4XJZA 1HQWA 4AE2A 3VDDC 5DG1A 2XUMA 3AZXA 5H9QA 2EXJA 4ES9A 1UCXA 1AR93 1LODA 2B7YA 2IFRA 1NXMA 1V6MA 1WBFA 1NY72 1U5IA 1VBC2 4AI2A 1YXWA 2YXSA 4RR3B 4GA9A 4GH4A 5I0RA 4PF5A 4KH9A 2XBO1 3M3QA 2JE7A 3U11A 1MS3A 4FPOB 3UJOA 1UW8A 3ZXJA 2A73B 4WVMB 3LCPA 1Y43B 2A6WA 4M0NA 1SMVA 4Q1RA 1H2LA 1PO21 2P37A 4KU8A 1REEA 4XQDA 4XHBA 4AHZA 5F9TA 4AVBA 1DQ5A 2ILMA 1J59A 2XL9A 3VDDA 3DKWA 2NQYA 3L9JT 2XBO3 4GKXA 4ATFA 4DS0A 3E5XA 3TOJA 4LT5A 3GALA 4P5HA 1OQEA 2XJRA 2XVGA 1UU5A 3RNSA 3H3ZA 2VQ0A 4HVOA 2W08A 3KCYA 4JQRA 1FX5A