2O0OA

Crystal structure of tl1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
153
Chain Sequence
GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine, hormone/growth factor
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1A.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 153
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o0oA01
2R6QA 2R32A 4QQLA 2WNUB 2KA3A 3QD6A 2QDNA 2JG9A 3TWIA 1D2QA 4KGGA 4HT1T 3URFA 4G4FA 1KXGA 1D4VB 2WNUC 2WNVB 5TSWA 4MSVA 1ALYA 1A8MA 2TUNA 1U5YA 2R30A 4KGQA 4OULA 4QQHA 1S55A 1U5ZA 1WCKA 5KC6A 2WNUA 4D7YA 4OUMA 4RSUA 2Q8OA 3B94A 4QQPA 2JG9C 4EN0A 3IT8A 4QQ2A 5KC5A 2WNVC 1IQAA 1OQDA 4G3YC 1DU3D 2ZPXA 5CIRA 4F3JA 2RJKA 4QQOA 1I9RA 4TWTA 2WNVA 4E4DX 4DOUA 1KD7A 2ZJCA 5BNQA 1U5XA 1D0GA 3WD5A 1TNRA 4DB5A 2HEYF 1TNFA 3ME2A 3B93A 3L9JT 2E7AA 2RE9A 3ALQA 1PK6B 2O0OA 4NN0A 1RJ7A 1XU2A 3FC0A 4KG8A 4QPYA 3LKJA 2JG8B 4MXVA 1C28A 5HBAA 1JH5A 3B9IA 2AZ5A 2QE3A 2Q1MA 1OQEA 4GIQA 1PK6C 2TNFA 3TYJA 4OUSA 3MI8A 5L19A 4E4SA 2JG8C 1O91A 3AB0A 2Z5WA 1C3HA 1RJ8A 4MXWA 1PK6A 1GR3A 4TSVA 2X29A 4J6GA 2RJLA 2JG8A 4MXWB 5KWRA 1DG6A 4N90A 1OSGA 3V56A 2HEWF 1JTZX 5L36A 3QBQA 2JG9B 3K51A 1XU1A 2OIIA 3K48A 2HEVF
chains in the Genus database with same CATH superfamily
2JE7A 2H0BA 2Y6FA 4AVTA 4CDUA 4YYOA 3KQRA 1AL23 2YMZA 3J4UH 3AP6A 4P9YA 2VMCA 2IXIA 3AKPA 3WF0A 2DURA 3H8OA 1Z0HA 2ENRA 1W6NB 4E8DA 1SLCA 3ECQA 3RS6A 5KXBA 2ET7A 1UW8A 2PHUA 1PO21 4XFAA 1F5FA 1IS3A 1DYPA 1RUF1 4HMZA 4IGQA 4XPVA 4YVWC 5IT6A 4XILA 3AKSA 5A1AA 5JIAA 5A7PA 3ZXLA 3PIGA 4FQ4A 1ZBE2 4U2AA 4MSVA 1I3HA 4RR3A 5H9SA 4GA9A 3OY8B 1NY72 1UN1A 3AYAA 3NJXA 3QH6A 4IE7A 1V6NA 2WZ8A 1E5SA 3E6BA 4GXLA 1AR61 3SH4A 5JOYA 4CP1A 1DP0A 3V65A 1G9AA 5JR7B 1J3PA 1ZZCA 3I3BA 4DPNA 1UWWA 5HCBA 4HXCA 5I0RA 5EJZB 4QD2A 5CISA 2MEV3 2P3YA 4G3YC 3TEXA 1BJQA 2RS33 3VL9A 3PUSA 1BYHA 1MS5A 3H8UA 3EHKA 1LOAA 2A1XA 4BMEA 1R1A3 3PMEA 1ULEA 3HEIA 4LKDA 1YO8A 4D0QA 3U78A 4Q2FA 3FUQA 1ZBA2 5IK7A 1H8VA 1QOOA 1ZA7A 4XJAA 2QQWA 2HWD1 2WSVA 3CEWA 5GLZA 3MGUA 4AEMA 2VW2A 3B93A 1K42A 2EALA 1GP4A 4ZONA 1VB2A 3J7LA 3KHBA 3MIGA 4MOAA 1IG3A 1O4TA 1AL21 1OA4A 2WC2A 3FLPA 5FKCA 5SV5A 1O3RA 1ULGA 4AVBA 3O5SA 4JGYA 1YHFA 1OLQA 2ZEYA 1PNGA 1OLMA 4IEOA 3ACGA 3VZOA 4MADA 2A3YA 3HJRA 1RVF2 4CDXB 2HBTA 1EV13 4Q8KA 1OPMA 3BYWA 1OFNA 4QKFA 2AZ5A 2Z42A 1GFF2 3VD7A 1L3JA 4BE3A 4GIQA 1LB2A 3MLJA 4OHXA 1HX6A 1UU4A 2P3KA 1DCSA 4XIKA 3VKLA 3ZYJB 1W8WA 3TEWA 3H3ZA 5L19A 1VJ2A 1BHGA 1HDKA 2DBIA 1EY2A 5FXZA 2QJVA 3OGJA 2XR4A 5FXVA 5A6ZA 1IS4A 4CDQA 4GJZA 1UD1A 4JGYC 2ADEA 2ID4A 3NO8A 3IMMA 4Q1PA 5GKAC 4JX0A 4KH9A 1W6PB 1X8EA 4W50A 4GWNA 5H9QA 4ARYA 3FFQA 4GH4C 3TBDA 2MEV1 4NPRA 1AR73 1UZYA 4N90A 3ZFGB 4AQ2A 2VW0A 4CEYA 2RS31 3RJRA 4CUBA 5T5OA 3OTFA 4FAGA 2FDHA 3ITQA 1FT9A 3T1LA 3ZSKA 4HZFA 1R1A1 4NWVA 2GC0A 1O5LA 5FDBA 3A23A 5BPXA 3I7DA 2WR9A 1W03A 4W6XA 4E4ZA 3GBGA 5EPAA 3WLUA 4JV4A 4ONUA 4YW5A 5FPBA 3THPA 3ZXJA 1PZ7A 4N53C 4AE2A 5JZGC 3NJZA 3TN92 2KD7A 4K9SA 1POV3 4EWEA 2VCAA 4CSWA 4IV3A 4CEYC 3AK0A 5IAVA 5FYTA 4D94A 5IK8A 1JYCA 2UYBA 5FYZA 1ODMA 2WNUB 4I3PA 1A3KA 1NZCA 2GSYA 5J98B 1EV11 2WT1A 4K20A 4M3CA 1RGSA 1D2QA 4S2HA 1DQ1A 5C9AA 1SACA 4QPGB 4OFGA 3FBYA 3N9MA 4LKEA 4QX8A 1VMHA 1W6OB 1YNAA 3NJYA 3NNGA 4MGTA 4WVMA 3W58A 4KGQA 3O12A 3WF2A 1Y9QA 2RVAA 3ZSEA 1LGBA 1DZTA 3JUUA 3SKVA 1ENRA 2BVVA 2JKXA 4GJYA 4YZ5A 1SBFA 4UW5A 4GULA 1IS6A 5F32A 4DY3A 5KC5A 2W47A 1SMVA 1AR71 5C9AC 3WDWA 2FMDA 4PHZA 3AVRA 3GZUC 4NPMA 3VLBB 2OZJA 3AP9A 4LBLA 1TMF2 2VVEA 4DQAA 3MLKA 4OUEA 4ARXA 1LULA 1RUJ3 3PIJA 1CZTA 3FUOA 4UXAA 4A7YA 5B2GB 1WBFA 3UGFA 1AYM3 4HLTA 4NRMA 5LY2A 1XXNA 1RUD3 4YFZA 4AF9A 2VE1A 2GU9A 2V73A 2QVSB 3OBRA 2GC2A 1POV1 2WT2A 1W8FA 3IM0A 1RUC3 1MS3A 2D44A 3F95A 4CTEA 2P3JA 2ZEXA 3KD4A 3LEKA 1UZZA 4IEVA 5EXOA 4XCAA 1X36A 3N9LA 2R073 5I8SA 4BK4A 2AENA 1CGPA 2G4IA 2ORXA 3NAPC 3Q8EA 3CBNA 4QU2A 2VZPA 3FLRA 3PNAA 1IHMA 1ZM1A 2P2KA 3AXEA 5KHIA 1ZX5A 3LDRA 4CCLA 2W5FA 2B9UA 3MW3A 1HRV2 3BTZA 1KITA 1H2LA 3NKGA 1CONA 1QWRA 3ZPOA 1O91A 3DKWA 1VB4A 4RQPA 3WSOA 4QM9A 2GN3A 3FLTA 2E53A 4HONA 2J1SA 2ATFA 4HANA 4R4XA 1MS9A 5T5JA 5CFCB 2WUHA 2B7YA 2ZOEB 3NKTA 2VMIA 4FBFA 1AR92 4D8MA 2VPVA 5LB6A 2JJ6A 5F6KA 1KJLA 1OF4A 1E5IA 1ND2C 3DCQA 3L2YA 5HCFA 3VKOA 1DQ5A 1CIYA 1WLCA 4NAOA 4QX0A 2QQOA 4FOYA 2A71A 5EJ1B 4Q4V3 1SLIA 1IQDC 1JYNA 1ENQA 1RHI3 1JTZX 1LECA 3HIFA 1RUJ1 1W39A 1WBLA 5FYMA 1DQ6A 5A7WB 4LHKA 1RMU3 4N43A 4RQPC 1AYM1 1LOBA 1UU5A 1W6QA 3ZPYA 2GNMA 1H8TA 4U36A 5F5AA 3R4UA 1RUD1 1UF2C 4A3XA 2A6WA 3UETA 2BGCA 2OVUA 4E2QA 4MGZE 4ZXEA 5L9VA 3ZSMA 5IK5A 3HWJA 4QPWA 1RUC1 2R043 2D93A 1I5PA 1W8UA 4INDA 2R071 3HN3A 5EWSA 2KR2A 4LQRA 1T6BX 1DDLA 3POBA 5FZ1A 1KDKA 2QQJA 4JC1A 1R083 1ZA4A 4N43C 3WF4A 1IKQA 4LUMA 5FY1A 2WFF2 2P34A 4OHYA 4XTMA 2O8OA 5FAXA 1ND3B 2WAAA 1HXS2 3CU7A 4AEJA 4DINB 4UF0B 5T5PA 4OHWA 4ZY9A 5TSWA 4CP0A 1RTVA 5CNAA 4BIFA 1WLTA 1Q43A 3I2FA 4LLFA 4B8EA 3RWKX 4Y1XA 1N1SA 3EQEA 1GNZA 2A6VA 2JDNA 3NW4A 2ARCA 4D6SA 5F1RA 1S0GA 1AF9A 3M1HA 4I0WB 4M3CF 1XNAA 4QQPA 1TQ5A 3VBUB 4DY5A 2VR4A 4QQ2A 2PTMA 1MS1A 2WKKA 2K46A 4Q4V1 4LXLA 4XVHA 5CIRA 5FV3A 5A1FA 5FYCA 1RHI1 4ZPIA 1H0BA 3T4VA 1HN1A 4PIYA 1UYYA 4EWDA 3WR0A 3S6PA 1AL0G 1RMU1 4ISRA 5DDJ2 2WWUA 4ZU4A 4YG0A 4AQTA 2RS52 4M0NA 4A7ZA 2XJSA 1CN1A 3B01A 2DBNA 3TEZA 1VBC2 4HG6B 2HEYF 2QQKA 1QKQA 5FFOC 4M0HA 3ZKYA 2VTXJ 2UWBA 2WQZC 2W1UA 5GJ6A 5AC92 3DECA 3CDZB 5B4XA 2R041 2YGMA 1YYNA 3W9AA 1NQDA 2JD9A 1OA3A 2P6HA 5C70A 4WZFA 5A3MA 4AQSA 2J1VA 5LA2A 1NE4A 4K3UA 3TRSB 1L7LA 1R081 1W2OA 3LE0A 3BKZA 1JH5A 3INAA 5F2WA 3ZR6A 2JDMA 2DV9A 1YUDA 4Z1VA 1CR7A 3K46A 1VE0A 1RUI2 3ON7A 4PLMA 5A7QA 5FPLA 3MW4A 2DU0A 4EQVA 3C7EA 3H3UA 1C8M3 1KFUL 2VCMA 4CDXC 3WV6A 1GR3A 3WNMA 3O1OA 1X8MA 2C24A 3RGBA 4AG4A 2WS92 3RI9A 2JG8A 1OVSA 2HWD2 5FZ4A 1DYOA 1ZZ8A 1ZRFA 3K2OA 3KVBA 3ELNA 3OJBA 2ZCWA 4XFHA 5LRRA 5BNNB 4KBBA 5DPNA 3Q9OA 1IS5A 2Z2SB 5K0UB 1PO12 1PGL1 2WRAA 5GZEA 3VBOA 3NV1A 1GSLA 3BCWA 4XBLA 1YIFA 2R49A 3GM8A 4QKDA 5GLVA 4XF3A 1NCQA 3ZX7A 2ZX3A 1J1TA 1F4HA 1KS5A 2MHFA 4W6WA 4NE9A 2GMMA 5A33A 3ZFGC 1LU2A 1QNYA 2QQVA 3EJKA 2IUWA 3LFIA 4QXHA 2VGDA 5F3IA 3ZFFB 4ASKA 4CCKA 4MYEA 5F5IA 1GP5A 3C7OA 5A3OA 2EF6A 4LOSA 1VBE3 5FO9B 2A70A 4UFHA 2DUPA 4JQRA 3C8XA 3OUHA 1SPPA 2BNMA 5ABJB 3CJIB 3WQBA 1QJY3 3SEEA 4H14A 4JDMA 2XLGA 1W6OA 2FDGA 2BV4A 1NE6A 3MO4A 3ES4A 2QKDA 4AI1A 4IE4A 1GOGA 4OI0A 3EXUA 2VG9A 3BIEA 2B45X 3W59A 2C0ZA 3ABZA 1WWYA 2WNUC 4A6OA 3S5AA 1WMEA 3HBKA 1NYWA 1C8M1 2RDNA 4UW3A 1SCRA 4JCKA 2IFWA 1RUG2 3E6DA 3VDDB 3HT2A 1WCKA 4DO0A 1W0PA 4K8RB 4SBVA 1ZYBA 2XVLA 4QPGC 4L0PA 1JYVA 2G1MA 2ZZQA 4Z07A 1UCXA 4AZZA 4B4QA 4BQXA 4Q27A 2IXJA 4CCNA 4AHWA 3DF0A 2E51A 1QEXA 5EHDA 1N1YA 1VAVA 4HETA 5FMCA 2BGOA 2IFRA 5FZFA 1X82A 4H3WA 2D43A 2LW8A 1U5IA 4UT5A 3AKTA 4A45A 4R9AA 3SITA 5BNQA 1U5XA 2W0XA 1JN2P 2YY1A 3WD5A 1IKPA 1LGNA 1UYXA 3RQ0A 4CEWA 4UOJA 2I74A 4AK3A 3ME2A 4RL7A 4JAAA 4GAZA 4MUVA 2ZHLA 2VMGA 4RYDA 4Q0VA 2F17A 1VR3A 4FQZA 2OPWA 1DGWX 2HWF3 4COUA 3V64A 2LS6A 2CGPA 2GZWA 1VBE1 3ZN4A 2RMU3 5GALA 5AVAA 3LA3A 5BUVA 5FWJA 4HSLA 4J1WA 1N47A 2W1WA 2E32A 3GZTB 1WCDJ 1QJY1 2K0GA 3BTAA 3U10A 4XC9A 5HCHA 3DPRB 4WVWA 3AP5A 1CAVA 1GZTA 1VALA 2JXAA 1HB1A 2HYKA 3R4SA 4IUGA 4XXPA 4YNIA 5FO7B 1MS8A 5JOXA 2JDHA 2P37A 3HR9A 5BNOA 1C3HA 3UKTA 1G9DA 1GQPA 5FZOB 1RUH2 1GP6A 4Y22B 5FTTC 1HRI1 5H9PA 2YG0A 4QB2A 3SCHA 2VH9A 2VY0A 4P9WA 2WJSA 1SFPA 4XE9A 3D0JA 4LKFA 4Y5TA 1BK0A 4I09A 2D97A 4CCEA 5CFCC 5KHGA 1OH3A 3MIDA 2XG3A 1S0CA 2Q30A 3LEIA 4NOTA 4YW4A 2ZMNA 4P5HA 4NUBA 5A7SA 2Y0OA 4AI3A 3JBG3 1AYN3 5A6QA 2BU9A 3AKRA 3H8RA 3WNXA 4YGCA 4R9DA 4XFIA 3WEZA 3ZVXA 4DFSA 2DTYA 1JW6A 2YC2A 3WF3A 1R093 5FYYA 2HWF1 4Y33A 4OLLA 2R32A 2D5FA 2RMU1 4XMIA 4FTEA 3O1TA 1DQ2A 1UMIA 4Q4W2 4NROA 5J96B 1V9U2 2VNOA 2YV8A 3OPWA 5FREA 2JDYA 5T3NA 5CYYA 2ZEWA 5LEKA 3ZYFA 3NV2A 4AVVA 3O1UA 3KGLA 4ES8A 3RZJA 5J48A 3U4XA 3I2GA 2P1BA 1X7NA 4FOVA 2NZ9A 3LOIA 4DXTA 1IOAA 4Y1ZA 3VN4A 2VUJA 3ZMNA 2EIBA 4NHLA 5FOBB 3DYOA 4OCTA 3WDUA 1RUJ2 1H9PA 2J1RA 2OQ6A 4XHXA 3IKWA 4HK9A 2OS2A 3ACIA 5CKMA 3RZKA 2PXJA 3VBFA 3M8LA 4WVVA 3OYWB 2AC1A 2BOIA 2EXHA 2NYYA 1PVXA 2VZQA 1ND3C 3POIA 4Y1UA 5FPVA 3UJQA 1S0JA 5D8AB 3TB0A 5K8SA 2PHDA 4BB3A 5FP9A 3ZKUA 3GHNA 4BPZA 2WWJA 3LQCA 2HKXA 4P9XA 2RM23 4QQOA 5GZCA 1FPN3 3FFZA 3I59B 3DEMA 4IV1B 5FYIA 2BJSA 2UU8A 2UY8A 2WLQA 3CO2A 3I3DA 4BXSV 2ZGPA 1DF0A 1NLQA 3N9QA 3JBG1 4W6YA 1AYN1 1PGW2 2LALA 1ZRRA 2G9GA 4JRLA 3VBFC 3NVCA 4XJ8A 4AFAA 4AQ6A 1VBD3 3CMGA 1QH6A 1R091 2R062 1VAKA 3BB6A 1K12A 5LBFA 4EV0A 4M01A 4NIDA 1YQCA 1P8JA 2J42A 4B7EA 1LAJA 2O0OA 3VZNA 1NCRA 4DXSA 5IFTA 2Q8DA 3NWKA 3OBZA 1CQ9A 1KEXA 5LASA 3LGRA 5F2SA 4FPHA 4CU8A 4WZCA 5IVFA 2AR6A 1S2EA 4FPCA 4QHZA 2A7AA 3RI8A 2XKPA 2JKBA 3GCXA 4ORFA 4GWJA 1CPNA 3UKNA 1YRZA 1LOCA 2OQ7A 1GV9A 4FSJA 3D3AA 3ACFA 5DG2A 2ZABA 1NXD1 1CAUA 4XJWA 4AHZA 2GH8A 4YZ3A 4YG3A 4QGMA 2ZX0A 5FO8B 2DCTA 2J1AA 1BVVA 1ZZ6A 4CDWA 2OXBA 4TLGA 1BKZA 4MXWB 5GLTA 1I6XA 4BH9A 4IEXA 5C5TA 1RB8G 5KWRA 2ZHKA 1TEIA 4BQ5A 1OSGA 2V4AA 2VCCA 1XYOA 5FBZA 2RM21 1OLRA 3LDKA 2JIGA 2XBO3 1LHVA 4IDZA 3ZN5A 4Z8BA 5FZGA 4PCRA 1MEC2 1PIV3 5I0UA 2OT7A 1Q8OA 3ZFFA 1UNBA 4CUCA 1R082 4XQ4A 5A3UA 5C4WB 1XU1A 1MQTA 1Q8QA 2A6ZA 2NQYA 4L99A 3FWEA 1VBD1 3KSCA 5BNNC 2VAUA 3LB9A 4L9BA 1GANA 3HNMA 5K0UC 2RS13 5ACA3 1CZVA 3EB7A 4BU2A 4A3ZA 5DZFA 3CL1A 5F37A 1QJZA 1QDOA 5FRAA 1CIWA 3CF6E 4N8MA 2JE8A 3ZYRA 4EROA 2JG9A 1GLHA 2BNOA 2VNRA 3ZFFC 1AUYA 2A73B 2BWAA 4GZ9A 4KGGA 3VDAA 3VL8A 4PLOA 5SV8A 2VCBA 2EIDA 4XOGA 1C5HA 4ITCA 2P6CA 4AW7A 2P3IA 3CJIC 4YVWA 1OVPA 3USUB 1OHFA 2QQLA 3RWNA 1X9PA 2GH2A 3IWZA 2Q8EA 4DUVA 3F2ZA 4Q0SA 4UBGA 1D4M3 3DXTA 2BNNA 2ZS6B 2WSUA 2CHHA 2X53S 3I2KA 4QDRA 4RSUA 5EZWA 2VBPA 4PLNA 2JG9C 3IT8A 3DYMA 1DIWA 4X8PA 4OI2A 4DS0A 2XHKA 5JI7A 3ROUA 3BUCA 4LO5B 1ZRIA 2JE9A 4I2OA 1MZ5A 3KF5A 5JMCA 4G9SB 2XBO1 1W3VA 3ZYPA 2X8KA 4LHLA 3LSEA 1G9FA 5FMOS 2VXJA 1PIV1 4Q4X3 5KR7A 5CG8A 3KF3A 4C1XA 2R7EB 3JQXA 4AEDB 4LR4A 3FX3A 5DZGA 5LBEA 5JSPA 1SBEA 5FZ6A 1PGSA 3THTA 1EAH3 1YCIA 3MIFA 4LUKA 2SLIA 1COV3 1UMHA 2RS11 4HVRA 5ACA1 1LTEA 2XGXA 1PK6B 5C8CA 4RS5A 1UXZA 1BEV2 1N1VA 3PLQA 4NN0A 4CXXA 1JZ6A 4Y1VA 2VXRA 3NV4A 3MEPA 1LEMA 1NOVA 4YFWA 3T2OA 1D2SA 3J9SA 1FYUA 3M70A 4JHTA 2VD7A 4LBQB 3MUY1 4QB1A 3B02A 4LA3A 4E8CA 5CB7A 1BQPA 1DBNA 5DAPA 4ASLA 1AXZA 2ARXA 1Q8SA 3NNMA 4LNVA 5FLHA 3R05A 4PBOA 1XNKA 3JCIA 1X9TA 3GDBA 4LHNA 4CA9A 4F8AA 3BTXA 3C7FA 5A6XA 1ULPA 3R6SA 3AYEA 3CZUA 5T54A 5L9RA 2YUEA 4RS5C 2CTVA 3MZHA 2ARBA 1D4M1 4XW3A 5D21A 5J1XA 1HB2A 3AX4A 2D6MA 4PI0A 5J37A 1UY1A 4KQ7A 4J6GA 2R1DA 1YJLA 3B00A 5FY9A 1QXRA 4LBKA 1G9CA 4BLIA 2O14A 3AL5A 4BWOA 2WAOA 1PMIA 1S0BA 1DG6A 4AHXA 4AFMA 2GC3A 1C1LA 1KQRA 1BXHA 1H9WA 1OF3A 1US3A 2O8QA 2W1SA 2GC1A 1V6KA 1LOGA 5F8PA 5FIXA 4RHV2 5LRSA 2FQPA 4CCJA 2BFUS 4GH4A 4CU7A 1HKDA 4Q4X1 3VHRA 3R4DB 3WCRA 1J3QA 5M0TA 2YYOA 4FPEA 4P08A 2ZHNA 3V0AA 2PAKA 5T50A 1EAH1 4GQ7A 1AX1A 2QCSB 1QOSA 1COV1 1Q5OA 2WIIB 3IZOA 1UKGA 3SXWA 1YEWA 1ZVFA 3S30A 1W8TA 2XL7A 5E16A 1KFXL 1PX4A 2RR12 2FDKA 1REDA 4N53A 5JZGA 2OW4A 2BYVE 2UY9A 1R1ZA 1JZ4A 1UL9A 2OUJA 1HRI2 2PLV2 2PQSA 3ES1A 2Q4SA 3MLLA 4QB6A 3AZWA 1MZ6A 5C3SA 4CE8A 4CCOA 4XF9A 2Y26A 4L97A 2ZEZA 4FCAA 3AMQA 3RRDA 4IGPA 2X5IB 3OGVA 2PQQA 3KV9A 1TZOA 3GNEA 4PDWA 4DEQA 4RA0A 5C8CB 3M3EA 1YJKA 2A3XA 3WQ0A 4CP9A 5D8AA 2WA3A 5IW0A 1RUNA 4DMIA 4DXRA 4MG2A 3TOJA 1VBA3 4WVZA 5G05L 3JXSA 4MHUA 4OUMA 4D7YA 1LHUA 3B3QE 1F9KA 3W5NA 4YVSA 1CX1A 1Y3TA 3C7HA 1J84A 3FJSA 5T52A 1VBB3 3T08A 1IQAA 4YM1A 3UGHA 1T6GC 2J1UA 2ZGLA 4EJRA 2HWF2 4QWNA 4XDOA 1CESA 2VZUA 1PHMA 4Q4Y3 4XABA 3WUCA 1JYXA 4PDWC 4TWTA 4EZ4A 2NPIA 4Q29A 5LY1A 1MVQA 1MPXA 1XNBA 2Y6LA 4M4PA 1RUE2 2ZJCA 5D8AC 1H6XA 3G6JB 1TNRA 4XZUG 1OMIA 4PF5A 4QU1A 2VULA 4BJ0A 4YVSC 4F7ZA 2IXLA 1Z7S2 5FK7A 3A0KA 4IV1C 3WDVA 3KLSA 3HVDA 1KRIA 2DFCA 4PQ9A 1UZ0A 1N3QA 2A75A 2HWB2 2Y6GA 3MFAA 1J1LA 3MV11 2DCYA 3WY6A 1BLZA 4BCUA 1DZQA 2VTXA 1QDCA 2VUCA 5F3CA 5DMYA 5IVCA 1UY2A 5HBAA 1CAWA 1SDDB 3B9IA 4HPKA 1WUVA 1GZ9A 3H50A 4XUPA 3O0VA 4LO4B 4D6QA 1FOD3 2BVBA 4OUSA 1YQ8A 3NAPA 3HMYA 2DWRA 4CU9A 1Q56A 1GQGA 1OT5A 2P5BA 3LWCA 5IHRA 2LTNA 4MXWA 1NG0A 5FZ3A 1BCXA 5D2AA 4ZU7A 5LK7B 1VBA1 4TSVA 3JBG2 4R4ZA 1K5MB 5HI0A 2XONA 2ZGNA 2IXHA 4J1XA 1AR82 4LKSA 4XF1A 4KWJA 1HW5A 1TVGA 3SEPA 3WW3A 4ASMB 1VBB1 5IVJA 5IFPA 5JDBA 3H1WA 2ZGSA 5LW9A 5A3WA 4E27A 5C8WA 3ZYHA 3PMSA 4Q4Y1 1S2KA 3HQRA 3AXDA 3KT1A 4KU7A 5IAXA 2ZXQA 1W9WA 1ND2A 4WM7B 1YIPA 2PHRA 1K3IA 4OZXA 4YW2A 4IE5A 4COYA 3CZJA 3VBSB 4RGAA 5E1RA 1APNA 2JDKA 3AMHA 2DUOA 4S2GA 1W8HA 2BBAA 4AOCA 5KHJA 2MNGA 1JYTA 2GALA 2W87A 3FBMA 4Q26A 1EYBA 2PYTA 5CA6A 5LA1A 1UU6A 1N3OA 3H7JA 2ZMKA 1F5JA 1LEDA 2X05A 5A32B 4Y5SA 3J8F2 3H1YA 3VB9A 4OI4A 2ZA9A 4NRPA 1XSQA 4QHOA 5FY4A 3VHOA 3VGIA 1ULFA 2C6SA 1QQP2 4BZ4A 5C4WC 1HQLA 3E5QA 4QX1A 4S2FA 5IUQA 3ASIA 2QDNA 1QJX2 4PIXA 1XB9A 5FY5A 5DAXA 4NIGA 1RXFA 4EN8B 3ACLA 2XWJB 2VTFA 4HT1T 4LJHA 1RL3A 3O14A 4MHRA 3SLIA 3UNPA 2VOVA 1FOD1 3IAPA 1CWPA 5CADA 3KS7A 4CXYA 2WNVB 2WZR3 3S5QA 5JI9A 1JUHA 4BQ1A 4QQHA 3NMBA 2H6BA 4AGRA 1VRH3 2B5HA 4ZXKA 4C91A 3Q8AA 1W6NA 4Q0QA 5CZKA 3VKFC 2XHNA 2Q8OA 4QXCA 4QX5A 5ISLA 2WO3A 4V2WA 1H4GA 2TEPA 4E4HA 1VBD2 4LBMA 1XYNA 1OQDA 1VRBA 2CYFA 4NVPA 3S57A 2Y64A 4Z2WA 2WINB 5JOZA 3GJBA 2ZX2A 2XXZA 4E4DX 1LHNA 5FJKA 4DOUA 1ASJ3 2E26A 2PHTA 3HQUA 1W6MB 2QTWB 3A21A 3OY8A 2WNEA 1YQ2A 5BNPB 2DFBA 1HIXA 4HL0A 1FMD3 4XBQA 4IEYA 4I0BA 1AX2A 1W05A 2WN2A 1E57A 2VOTA 1W9YA 2HWE3 4JTOA 4QPIB 3L9JT 1TME2 3J7MA 2E7AA 5DAVA 1YFWA 4Q5OA 3ALQA 3IDEA 4NWWA 4COWA 5HV0A 1XU2A 4YZ2A 2QUOA 3POGA 1XNCA 3M7AA 4JZRA 3GALA 3AFGA 2CGOA 1Q3EA 3KV4A 2Y8KA 2CL2A 2XKOA 3ZM8A 4EWAA 2VECA 4EN9B 1LOFC 3LSDA 4XDPA 1RC6A 2GAUA 4D7TA 3P1IA 1L7RA 5CU1A 1NZIA 1JYIA 2Y6HA 1PK6C 3KGZA 4CUAA 1BBT3 2W3JA 2WZR1 1PO22 4RFRB 1XE8A 4KNCA 3WDTA 2PMWB 5H9RA 3V0BB 1SDWA 3GZAA 3GJAA 3MYXA 4YARA 1RUF2 1HQWA 1UY3A 1VRH1 4KMQA 3ZXGA 3ZFEB 5AFBA 4CZSA 1PIV2 1GZWB 2J7MA 2X29A 1FNYA 5I91A 1RUOA 4GALA 1UIKA 1W9SA 3BPSA 3ETPA 1DQ0A 1MS4A 1YI9A 1ZZ7A 2DU1A 3NV3A 4QDQA 4XEZA 5FK8A 2VU9A 4QKNA 3RNSA 2WO2A 4CDXA 3OGSA 1JOBA 2JWPA 4N9HA 4YPJA 1LENA 4K1YA 5KBFA 4YW1A 3UV9A 4XUNA 3V56A 2IXCA 1O59A 2NM1A 3Q8CA 1AR62 2C1FA 4FTBA 3I3EA 2JECA 3JQWA 4B4RA 1JXNA 3T30A 1ASJ1 1XRUA 1R64A 3ILRA 4YG6A 2B4KA 2W95A 2WABA 3VV1A 1FMD1 2OIIA 1IPKA 4L11A 3WQ7A 4YZ1A 3B5LB 3U4SA 2HEVF 1W6PA 2HWE1 3ZLIA 1FV3A 3RFRA 4H2AA 4FPJA 3ZFGA 3QCWA 5FY8A 1XE7A 4OMCA 3WW1A 4KL1A 1OOPB 1AVBA 2WL1A 2VZ3A 2C9KA 4O61A 2W46A 1W2AX 3GXUA 1UY0A 1ZBE3 3KMHA 5C7GA 2Y6KA 4Y26A 5IK4A 2VOWA 1AL22 2B9VA 2XVGA 3ENRA 3RDIA 3H7YA 1BBT1 2YFZA 5KHKA 3LIGA 2AYHA 4BK5A 1E5HA 5CG9A 5L7OB 4C8DA 1CAXB 2QNKA 4Y20B 1H1IA 4XJZA 1S2BA 1JMUB 2WWSA 3SCFA 3HQXA 4QT6A 3RZGA 1VMJA 1ULOA 1W2TA 2WNUA 3Q8BA 3WP3A 1PMJX 1KGYA 5HPOA 3CHXA 5GLWA 4MX3A 4AAXA 2GN7A 4LO7A 2XH6A 2X5IC 2PHXA 2XJUA 4QGNA 1ENXA 1QXJA 4I02A 4X6QB 3U14A 1F4AA 1ZBA3 4QPGA 3OG2A 4H7LA 4XAAA 1LU1A 3CJXA 2OYZA 3WNPA 5JOWA 4IETA 1AHSA 4MGKE 5DABA 1O7FA 2A6YA 4UI9L 4XIOA 3VBRB 3G7DA 4A44A 5I0SA 4LLOA 2MEV2 2YBPA 1NUKA 1DZRA 2RS32 1LCLA 3LD8A 1DYKA 4B1LA 3O0XA 5DUXA 4MLOA 5FQ0B 3U1XA 3DN7A 1R1A2 1HV1A 3BU7A 5FPUA 2RE9A 1B35B 1O3TA 1AZDA 1ZRDA 1GUIA 2G19A 5FOJB 3C2UA 4WM8B 3B7MA 4MO3M 4IESA 3WF1A 3OCPA 2DVFA 1A34A 4QPYA 1O8SA 2ZX4A 3NJVA 4QX3A 3KCYA 2QQPA 1ZBE1 4IQPA 2Y34A 2XJTA 3OPTA 1QF3A 5GLUA 3TNQA 1NY71 2WYSA 4LE3A 3GBFA 3OD0A 1RYYA 3FHIB 3N9PA 4Q0PA 2BGPA 3BOPA 1NLRA 5CFDB 1EV12 3WP5A 1PX3A 2JIJA 4QM8A 2B42B 1PM7A 5L73A 2W68A 3IIAA 3KHCA 1LODA 1QH7A 2XDVA 5FKBA 3KB5A 5HXMA 1IZ3A 4D6RA 2VJXA 2QZ3A 3OOXA 4CDUB 1SCSA 3RG0A 1BMV1 3MPBA 5F7UA 2JB8A 1GMMA 2VOXA 1ZBA1 3AZYA 1EPZA 4L8QA 4LO6B 4UFKA 2VZOA 5FXWA 1UZVA 4IEQA 3AJZA 1JS9A 4XUQA 3O1PA 3I2IA 4R9CA 3TN93 2Q5TA 1K5MC 3VD9A 2ZGTA 2PA7A 4I0AA 4RD7A 4ZU5A 2YROA 1AR72 1G8WA 3O1RA 5CFCA 2Y6JA 1OUXA 4JGZB 1UOGA 1VAMA 2A3WA 5F3EA 4NO4A 3SC7X 4URAA 4FPKA 4E9KA 2GNBA 5CEHA 3OSDA 4RR3B 1V6MA 2JD4A 3WZ1A 5K4LA 2X09A 3WNNA 3RJ2X 3RYRA 2CWSA 4Y3OA 2CWMA 1JBCA 2D7FA 2KA3A 5EIYB 2K2SA 4O9GA 5A7WA 4AVSA 1WKYA 5GM0A 5JSOA 1GU3A 2EVXA 2OKXA 3LEMA 5F9TA 3QH7A 4UFIA 1REEA 3R0RA 1EP0A 2RHPA 5T55A 2W91A 1MS0A 1WLDA 3OPZA 5EP9A 1K45A 1GOFA 4KWKA 5F39A 4EYUA 4XCBA 5J3UA 2DVBA 5C3RA 1AJOA 1DGRA 2PHLA 2R30A 4FOQA 5FZCA 4GMP0 2WQ8A 1H1AA 4M00A 1YLLA 1TMF3 3MIEA 1JOPA 2ZKLA 1Y43B 5C3OA 1OD3A 3BODA 4NHYA 1GKBA 5E89A 2VL4A 3M3IA 2WNVC 3PL0A 1ND3A 2VNGA 1W6MA 2BQPA 5FUNA 4UF0A 1SBDA 4IW3A 5FXXA 3WG2A 4XQDA 3PUIA 2GDFA 2YPJA 3TN91 1UX7A 1W8ZA 3NNFA 4FTSA 2V5DA 3VKMA 3BTYA 1JUIA 1FNZA 3PURA 3ZYIB 1RIRA 1VLNA 2YBSA 4L2NA 3WUDA 4FFIA 1TNFA 4UW4A 5IVVA 2ARAA 3WQ1A 4PF1A 2UWAA 2D3RA 4AGVA 5A3TA 3VBUA 3VHNA 4Q0UA 5A70A 1AYM2 2CDOA 1V6IA 4NAMA 1X50A 5I93A 4CDQB 1PZ8A 1RJ7A 1WA4A 1RUD2 4NHMA 5BNPC 3IDBB 3KWVA 5A6YA 3H3LA 1SFYA 3K3NA 3M3QA 3KCCA 1HRV3 3MIHA 4M4RA 1GWKA 1XOYA 2Y0IA 5DUUA 1G6NA 4CCCA 4HOOA 3POYA 4QPIC 4R8HA 1RUC2 2Q1MA 2C4XA 1V6OA 4MGIE 2EXKA 1BVP1 5CKQA 2R072 2XQXA 3SH3A 2YBKA 3IPVB 1AR93 1S4CA 3IBMA 3PVNA 3MDPA 3MI8A 1WCUA 4XBNA 4Z82A 5F3GA 3VBUC 3LPFA 5I8YA 3JZVA 2DVAA 1WD3A 2YFUA 2ETEA 1GYKA 3MFCA 2Z4FA 4DRRA 3T2TA 3X29B 2JENA 4JDOA 2IVJA 1TMF1 4LIVA 4LORA 3T4HB 3PJQA 4IERA 4XXAA 4XFGA 4IV3B 3IIIA 3MF9A 5C3QA 3HT1A 1WGPA 5ANQA 3ZFEC 4XYXA 3MUZ1 1UQXA 4AVCA 2J22A 2BTVC 3T3YA 1XJAA 2DF7A 1W04A 3THDA 4M3CB 3ZN6B 2IC1A 4XACA 3SQOA 5LCWL 1W8NA 1CVNA 5C9AB 3U37A 3O1MA 1QGLA 1WMDA 1X33A 4Q4V2 4RN5A 4BQ4A 5DAWA 1SG3A 3HNBM 1DGLA 1UOFA 1RHI2 2AH2A 1DGRN 2WZEA 2VVFA 1RMU2 4QQLA 4YGDA 5BNNA 1O5UA 3MV01 1MZEA 4MGQA 1JODA 4YLZA 2WZPP 1HXS3 5FYSA 3WDYA 5K0UA 1OFSA 1CX4A 2VMDA 3ZSLA 1HRV1 1A78A 4FVVA 2BUKA 4MGSA 3VD5A 3PU8A 2XLFA 3NRUA 1D7PM 1W0NA 2Y33A 4AFDA 1FPN1 1MACA 1UX6A 4Y20A 2R042 5FYVA 1ENSA 3T09A 2BP6A 3WG4A 2DTWA 2EIGA 5FP3A 2E7TA 1AR91 3EMRA 2VW1A 1OOPC 5KXDA 1F15A 4YGEA 3ZYGA 3WG3A 2HJIA 5CBLA 3T0AA 3AL6A 4OULA 3GHMA 1RINA 4QX2A 1UOBA 4KBZA 5GZGA 1WMXA 5ABJA 1ACCA 3CJIA 2E63A 2VBDA 2Z69A 4IEUA 5DUVA 3M3OA 5L9BA 4O65A 1FMD2 4B3NA 2B39A 5DDJ3 5ERLA 5L7OC 3H0OA 2RS53 3BVCA 1DFQA 4LE4A 4E2SA 3ZYBA 1VBC3 4GWIA 2RJKA 3FN9A 1SFNA 2FDJA 3HBZA 4JKKA 3VZKA 1POQA 1O6UA 3RZMA 5A3PA 3SISA 4F83A 3BN6A 1KD7A 3OEAA 4N7UA 3S7EA 5AC93 2CY6A 1W2UA 3VDDA 5G04L 4K7JA 3AZVA 5ABJC 2CAUA 4JDNA 3VDCA 4DB5A 1H1MA 3MBWA 3ZR5A 1ZRCA 1V00A 5BY5A 1DLLA 2K9ZA 1V6JA 3AJYA 1PGL2 2QFEA 2UWCA 5I0DA 3UK9A 4PIZA 4FPGA 5DXDA 3IMNA 1BZWA 3WW4A 3PUQA 3VBRC 3KCXA 3IDAA 3PTRB 1C8NA 1HXS1 1FI2A 1H6YA 1HJFA 3N7MA 5EYYA 1RUI3 5LBCA 4AWDA 3IN9A 4IXLA 3T0BA 5A3LA 1ZZBA 4KU8A 1B09A 1H30A 1NLSA 3OUIA 5BXXA 3VDDC 1JYWA 1UPSA 3LZZA 1B35C 1OQ1A 5FMBA 1UO9A 2E33A 3B69A 2WS93 4WM8C 1LESA 1QY4A 3BOWA 4PJYA 3ZXFA 4E4SA 4TLFA 3FMGA 1LKNA 3N35A 4LK6A 4HKWA 4XMAA 1D0HA 1W6QB 3AZZA 3H9AA 4D7SA 3E6CC 1ST8A 1H8TB 3W21A 1IGOA 4IE0A 5BV6A 2VZRA 1W2NA 2UURA 4HKOA 2RJLA 2YPDA 1PO13 3P3PA 1JZ8A 3RZLA 1URXA 3KQ4B 3ILFA 5DDJ1 2VQ0A 5BYNA 1C8M2 4A7KA 1H2NA 3DPRA 4L92A 2RS51 4TXWA 1XQNA 5CFDC 3I3MA 1KDMA 3OBAA 3SKJE 1VBC1 3NSTA 5IVEA 3OF1A 4EN6B 2HEWF 1WCSA 4URTA 3O1VA 4JGZA 3LF7A 3KM5A 1JU3A 2XJPA 5AC91 2ZGQA 4CDUC 3RZZA 4XFCA 4AXOA 5FZOA 4LT5A 2VQUA 2WT0A 4BDVB 1YXWA 4C0BA 3KT7A 4Y22A 3I8TA 1KS4A 3OBTA 1LHWA 4C90A 4ZS3A 1JHNA 4N9IA 1OKOA 4C1WA 1MR5A 4CCDA 2WYFA 1XNDA 3K75B 4H55A 3WT3A 4ET7A 1O4YA 2VM9A 2R16A 3DPRC 3FHAA 4LMFA 3N7JA 2JB4A 2PHFA 4UFLA 1W9FA 3J26N 3P6BA 3ZO0B 2E7QA 5JAXA 5FP8A 1JZ2A 4XDQA 1RUI1 1LR5A 1SZBA 3ZXDA 4LA2A 3E1F1 3AFKA 3AMPA 4JGZC 4OMDA 2RDRA 1F35A 4AL9A 2DCKA 2ZACA 1AX0A 1DGWA 1RUG3 1VBE2 4OVEA 3WX5A 4RR3C 1W28A 5JCTA 1KXGA 2ORZA 2VC9A 3DUIA 1BMV2 2WS91 4CPBA 3DYPA 1QJY2 1D4VB 2O1QA 4KWLA 3D8CA 3AMNA 3NNLA 2RJ2A 4UBHA 4AVAA 3I2DA 4A42A 3K4AA 4YM2A 4AFCA 1F8VA 2E6VA 2NMNA 2QZ2A 1PO11 1XC6A 2VQAA 5DUWA 3B94A 1UIJA 2ZKNA 2XJRA 2CDPA 3UL2A 4EN0A 4XFBA 4FAHA 4FPFA 4I30A 5F5QA 4F3JA 1NXMA 5FMDA 3H8XA 3LOBA 3VD4A 2VZVA 3N3HA 1YFUA 2EAKA 2W52A 4OHVA 2ES3A 2Q1FA 4XJ9A 4W8JA 2D6NA 2YC0A 4CUGA 2QBXA 4FO9A 2IXKA 4MZUA 3CIHA 2Y60A 3W5MA 3POWA 3RZHA 3OYWA 3KV5A 2VZ1A 1Q8VA 1CD3G 2XOMA 2FMYA 2W9XA 5FP7A 3P5BA 1GWLA 1FX5A 4QKBA 2N7GA 2VZTA 2VMHA 3IB3A 5CAZA 4TZDA 4LEJA 4LBQD 4JTNA 5JUVA 3FC0A 2PAEA 1G86A 2BW8A 1GBGA 1SLTA 3I59A 4H7MA 2JG8B 4IV1A 1QMJA 2E9QA 3HAGA 4MXVA 4DRVA 2ILMA 5JXIA 1J59A 2XQRA 3IPVA 4HFSA 3USSA 1RUG1 5EYXA 3RPQA 1WA6X 2RMU2 4A2UA 2QQIA 1RUH3 2IWGB 2FD8A 5A7NA 2G9FA 1JHJA 4FFFA 1DQ4A 1Y9MA 2C5DA 4CDQC 4EN7B 2YU1A 3VBOB 2A6XA 1AXKA 2OX0A 3PVBB 1SLLA 4UW6A 3AB0A 4Z92B 2Z5WA 3NQHA 1NCQB 1S0IA 5EJ3A 4LPLA 2JDPA 5A33B 1OH4A 3GF6A 2CAVA 1JOJA 4ZS2A 3DL3A 3ORJA 1U12A 4LTAA 3T0DA 3JD73 3LA2A 3A0NA 1OURA 3AZXA 2UYAA 3ZN6A 4CYDA 2WNOA 3MW2A 1SPPB 1HQNA 4BA6A 3HN1A 4UAPA 2BRTA 5FYHA 4GMP3 4Y24A 1RITA 1H4HA 2EXJA 3RMYA 4AEKA 1Y7BA 3O0WA 3ZIWA 1O3SA 3L2HA 3N7KA 1A8DA 4Q4W3 5A7OA 1TG7A 4GKYA 4IV3C 4LITA 4R52A 3EO6A 1V9U3 1PVC3 4TYSA 3KVAA 4UFJA 4IGOA 4CP2A 3LFMA 3S7IA 1OI6A 1AYN2 2V09A 3BIWE 1J3RA 2EIEA 3WP4A 4Q8LA 4QXBA 2WO1A 3N36A 3ZXAC 5JXJA 1W3XA 1XSRA 1R092 3PJYA 2GNDA 4SLIA 2RDSA 3TWIA 4LOTA 3SHRA 3RSJA 1TE1B 5DG1A 1RUH1 3P3NA 4JQTA 5C4WA 4G4FA 1QJU3 3PDQA 1YWKA 2AACA 2FCUA 4KG0A 5HV4A 3HPNA 2P4EA 5CKNA 4J25A 2PN5A 2ZGMA 2DDUA 3OGRA 5DZEA 4BM8A 2XPJA 1A8MA 2ZGOA 4JHZA 1C5IA 4XUTA 4ZZ5A 1IPSA 2H6CA 1S55A 1RXGA 4CEWB 1GZCA 5B4NA 1WW7A 3LCPA 4DIQA 3J7NA 3JD71 2CSGA 5E8AA 1S0EA 2WO7A 2QQUA 4B7KA 5FY0A 5FLIA 2CNAA 1EUTA 3A4UA 5FZLA 2HBUA 2D3SA 5IATA 4NMIA 5AVPA 1XNTA 4GMP1 2R063 2GP5A 3USUA 5FWEA 1YQ5A 4OI1A 1CAVB 1J58A 2W94A 1C57A 1PNFA 4Q4W1 1W9TA 1JZ5A 2PAMA 2RM22 3CNAA 3D82A 1FPN2 4LK7A 4Q1RA 1V9U1 4XFFA 3VBHB 4HVQA 1PVC1 5IVBA 5LK5A 1KJRA 5BNOB 2PFWA 3I54A 2V5YA 4AI9A 2VUDA 2JX9A 3TNPB 3PHMA 5FZ9A 1U0AA 1S0DA 4COVA 2ADDA 5JR2A 3DKQA 5FBJA 2MPFA 1H2KA 3GBWA 5DQ0A 5FMOL 4TN7A 4COZA 5FYUA 4MVTA 4AEDA 4XETA 1MVEA 2ZMLA 1S0FA 1OQEA 2F4LA 5IVYA 1QJU1 2XMLA 2BWCA 3TYJA 3WNOA 3KV6A 3M3CA 5JXGA 1LOFA 4YM3A 1PZ9A 1JZ3A 2XB6C 2FCVA 4YW3A 3THCA 1HV0A 2CGNA 2LUWA 1RJ8A 1W06A 3AYCA 1PK6A 2VBBA 5KXCA 4DUWA 2KXLA 5EFUA 4PI2A 3ZIXA 3WW2A 2D6PA 1QXPA 4LO8A 4PT6A 5JIUA 2AGSA 4DXZA 2FBEA 4O9EA 4LBQA 1MEC3 1FATA 4MGYE 3NL1A 4AEDC 4YW6A 5FPAA 1PGW1 1K5JA 1SHWB 3FZ3A 4NIHA 1H8TC 1WLWA 2D6LX 1HB3A 1JZ7A 2D6OX 2R061 3I2JA 4BQ2A 1QOTA 3BPZA 3UYJA 2GMPA 3WXPA 2NLRA 2AUYA 4P00B 4GB33 1ZREA 3K51A 4YGBA 4GWMA 2B46X 3POEA 5LBBA 3ZOIA 2BPA2 5JPMB 4QHBA 1QIQA 2XBO2 4Y4YA 3POSA 2R0HA 1FXZA 2IVIB 2CU5A 4K8FA 5JVVA 4WV8A 2D40A 3TEYA 1C1FA 5I0TA 2IZWA 5AFEA 5C33A 4FP3A 5T5LA 3VBFB 2ZGKA 4AFBA 4LIUA 2BFUL 4MH0E 5DAQA 4NJ4A 1MZFA 2RS12 2HWC3 3ZMOA 5ACA2 5FPXA 3UKVA 3DGTA 3U11A 3N4MA 2HLEA 3GCWA 3URFA 3RVHA 1WCQA 1GWMA 3MIBA 5FZBA 1NA1B 5ANNA 3U07A 5FZ7A 4LHSA 2CV6A 2ZHMA 3EBRA 3MF6A 1ALYA 4RFT0 3SCGA 4K6BA 2GP3A 1U5YA 2TUNA 1S1AA 2ZGRA 1YQ6A 3NNJA 5KC6A 4NPLA 1YC61 3ST7A 4ZZ8A 3T2PA 1V70A 4V2VA 1WZXA 4BIOA 1MEC1 4XF0A 4NHXA 4B1MA 3POJA 5KHHA 4DZGA 5JWPA 1D4M2 1NCRB 1GICA 2EA7A 2L9LA 1NAEA 2EXIA 3N9OA 3SMHA 1DHKB 2FZ1A 4W4ZA 2VZSA 2G9ZA 2OPKA 2OZ6A 2X5IA 3GYDA 1I9RA 2Z79A 3MICA 5F5CA 4BLJA 2W2IA 3D5OA 3U75A 3K4ZA 2H0VA 4BOWA 1STMA 4GKXA 4GB31 1CZSA 4LBOA 3RMXA 3H42B 1BEV3 1GOHA 3ACHA 4FPLA 3PU3A 3AMMA 4PBPA 5IJRA 2P17A 4ATEA 1GNHA 4RGGA 2TBVA 1NX9A 5JLVA 1UZWA 1CAUB 4N7IA 1WW6A 2GMEA 1VPHA 4Q4X2 2LROA 4YZ4A 3KZ4C 4RGKA 1OBNA 5IYYA 1UPIA 4CDWB 1Z78A 4META 1EAH2 4DNYA 3AVSA 2XUEA 1XBFA 1COV2 1IG0A 1DLCA 1OA2A 4NRQA 1OKQA 2HWC1 5FZMA 4CU6A 5C8CC 5JMOA 4QMAA 1YI7A 4AGGA 5J09A 3AYDA 1FAYA 3DXUA 4IL7A 4IEWA 2VQTA 4I01A 2AREA 5FZ8A 4CRQA 3QLQA 4EE2A 1AJKA 1SQ4A 1WW4A 2BZDA 1OPOA 5DN2A 5CVRA 2E31A 2JDAA 2JG8C 4JKLA 1O8PA 4AAPA 5C6CA 4NIIA 5FPZA 5FZEA 4GD4A 1LGCA 2WQ4A 1MQTB 3QOPA 1RVF3 3K4DA 3TAYA 4ATFA 4BXFA 5HCAA 5J7MA 4RHV3 4O7XA 2WBKA 2PHWA 2VO5A 1GQHA 2ZZJA 5FLJA 2HH9A 3SH5A 2YB7A 3WHTA 4BMBA 3ZSJA 5C5UA 2WDBA 3VBOC 4FPOB 1YFXA 2NP0A 2F6BA 1JI6A 3OGGA 4JKMA 2C9AA 3HNYM 4PQQA 2AEYA 3VZJA 1EPWA 4FFGA 1M4WA 4FI9A 1NCQC 4YRDA 1SLBA 4TTGA 4AI0A 3JB4C 1JU4A 3QBQA 2JG9B 1LHOA 2BBVA 3E5UA 1ULCA 1BEV1 2RR13 3LEGA 5LA9A 3K48A 3U0ZA 3VDBA 5FUIA 1ODNA 1K5MA 1V6LA 1OD5A 2DCZA 1N1TA 4QAWA 1NQJA 1HRI3 1F31A 2PLV3 4YVWB 4AI8A 2R6QA 4I3GA 4HN0A 3MHZA 4FP2A 1IPJA 4LBJA 2FZ2A 5GZDA 2RV9A 4YW7A 1QJFA 2Q8CA 2RDQA 3M2MA 4BISA 5J36A 4AI2A 4OZOA 3ETQA 4WM7A 3M4FA 1F2NA 2FCTA 2YDEA 4YWAA 3VBSA 1UKRA 2DCJA 2Y38A 1YFYA 3WINE 4P5YA 4OQ8A 3O1SA 4K40A 4HVOA 3C3VA 3PUHA 4Y4RA 1I5ZA 1W0OA 5A80A 4B29A 2XJVA 1ONAA 5A1LA 5GZFA 5FCCA 3JU9A 4BQWA 4QGLA 3ATGA 5LZ6A 4JVAA 3WHUA 5A32A 2ERFA 3SNMA 5FZDA 3OB8A 1OLME 1RVF1 2OA2A 3WOGA 4BYYA 4WBBA 4RHV1 1UYZA 3T1MA 3ZFEA 3IDCB 4FT8A 4P14A 4WM7C 5APAA 4OHZA 4XURA 5I8TA 2FDIA 1VIWB 1VP6A 3VBSC 1RUE3 2BOJA 3VKNA 4RS5B 1DU3D 1VMFA 1C4RA 2ZPXA 4UYBA 3UESA 3PTYA 4OQ9A 1VBA2 1POV0 4UFMA 4YSFA 2W92A 3J7HA 3LAGA 4CEWC 4A41A 1Z7S3 2WNVA 5EV7A 2HYXA 3BALA 2WN3A 4Y5Z0 5KXEA 3VBHA 1VBB2 2DYCA 5C3PA 2Q1ZB 1NT0A 2RR11 1ZZ9A 2HWB3 3HD8B 2DVDA 2DUQA 3D4KA 5FYBA 2C26A 3MPPG 4Q4Y2 2I2SA 2GNTA 1EUUA 2PLV1 1OC1A 1Y4WA 1W99A 4IEZA 3O7OA 3OUJA 1XPWA 4D69A 3OD4A 2D5HA 1G9BA 3S0MA 1V0AA 4W65A 1I1EA 4QDSA 3I97A 4R9BA 2OUHA 3GGLA 1C28A 2R0FA 5E88A 3N9NA 4P9IA 3VBHC 1HN0A 5C71A 4JGYB 2D3PA 2F4PA 2QE3A 2QDRA 2VNVA 3POFA 5BNOC 5BNPA 3JD72 2FHRA 2QQNA 1SLAA 2TNFA 2WA4A 2BDRA 1Y9GA 1AR83 4GH4B 4QPIA 1SEFA 5FZIA 2LM3A 3PVOA 3UJOA 2YC4A 3IAQA 2LRPA 2SBAA 3H1MA 2XL9A 4K21A 4YM0A 4HSJA 3V0AB 4P9LA 1H2MA 1XE0A 2JDUA 1FOD2 4V1PA 3D0SA 4M3CE 5D1IA 1OUSA 4FFHA 1M06G 5K9YA 1CJPA 4AHYA 4P02B 2W1QA 4NHKA 1RUE1 2JICA 1PVC2 2AEZA 2XJQA 3E5XA 5JSRA 2VMEA 3BGAA 3LA7A 5JXHA 4N53B 4IE6A 3UGGA 5JZGB 1Z7S1 5LWBA 3I2OA 5A3NA 4XTPA 2BERA 1WW5A 1UAIA 4XQWA 4CEYB 4CXWA 3E97A 3JB8A 3LPGA 4FOWA 4Z2AA 3V0BA 2HWB1 3FHQA 3J8F3 4IEPA 4K1ZA 5FZKA 3AC0A 3WCSA 3BI3A 3AKQA 1Q8PA 1GZWA 2J1TA 3AP4A 1QQP3 2EICA 1ULDA 4PDWB 5LEJA 1QJU2 1O4ZA 1QJX3 2PELA 3AP7A 4HK8A 3DV8A 4CVUA 1LRHA 1W8OA 2ZTNA 2X10A 4CP9B 3VZLA 3KT4A 4FXGB 4E2GA 3K77A 1O3QA 4MV2A 4XJUA 4DEVA 3EYPA 2YZ4A 3WVJA 3CLPA 4B4PA 5FZAA 4YVSB 3QD6A 3WNLA 4Y1YA 1LJ7A 1NA1A 1L7QA 1GNYA 1HB4A 1NKGA 1BK1A 1UMZA 1UXXX 2XVKA 4CCMA 4DUXA 3ILNA 4KWUA 4CPBD 1US2A 3RYKA 1OXCA 4BQ3A 3WP6A 1AR81 1UOJA 3PVEA 5JPNB 3VZMA 4QXKA 3I49A 3CKHA 5FUPA 5FZ0A 4P9JA 2V72A 4XHBA 2B8MA 1U5ZA 4XF4A 2R1BA 1PM4A 1OOPA 2RG4A 3A22A 2YHJA 4XAEA 4X8NA 4WVMB 5F6LB 2YU2A 2VMFA 2I45A 2W08A 2WFF3 2QQMA 2WZR2 3CQOA 1NA1C 4XUOA 3RYPA 5FZHA 4BQYA 2I07B 2A5ZA 2XUMA 1G7YA 3WDXA 1AXYA 2VOKA 1VRH2 2VVDA 1HJGA 3HOBA 3LIHA 5FJHA 3T2QA 4AR2A 2J1EA 4NIAA 5L7OA 4KI5M 4ZKTB 1CAXA 1TME3 1PMHX 3LDBA 5LATA 1ZNPA 1QJEA 1CAWB 2NN8A 1FV2A 1WMFA 4HPKB 3J8F1 3I2HA 1E5RA 4JRAA 1D0GA 4OYUA 4S2DA 3VHPA 1QQP1 1LOEA 3FL7A 1T2XA 1CPMA 1NCRC 3APBA 4X6RB 2KM2A 4XZPA 3NAPB 5HXVA 1QJX1 3B9CA 4P9GA 1ASJ2 2Q0AA 1QHDA 5FP4A 1W90A 4KG8A 3BU0A 2JEMA 3LKJA 4FXKB 2HWE2 4ZHNA 1PO23 4NR1A 4EZHA 3VBRA 2EAAA 4ISQA 4AYUA 3OEBA 1RUF3 5EQUA 2XLAA 2D6KA 3C7GA 4A4AA 2JDZA 2WLPA 1WD4A 3VD3A 3WNKA 3UT0A 5FQ0A 3GZEA 1LNSA 1UY4A 1CJDA 4CDWC 1ND2B 4BHPA 2BEOA 2VUAA 3I3QA 1B35A 3ZDVA 1A6CA 4ES9A 1XYPA 3D6EA 2FDFA 2WFPA 3K3OA 4WM8A 1UYPA 4GB32 1BBT2 1AR63 3AM2A 3ZXEA 4C0HA 3VUOA 4RQPB 2WFF1 5E6HA 2V4VA 4HKLA 3QACA 5FR3A 4FPYA 4UWDA 3I4IA 4D3WA 4QX7A 1QU0A 2ZBJA 1REFA 1HLCA 1J83A 5IWFA 2XWBB 2D98A 2DVGA 2YGLA 2W39A 2ET1A 1N3PA 2ZAHA 4HBNA 3WG1A 3N7LA 3Q8FA 1MQTC 5FY7A 4LULA 1TME1 2ZX1A 5CFDA 4A6SA 5L36A 3ZDSA 4HN1A 3FE5A 3W20A 5K7PA 3ZXKA 1QNWA 2NMOA 2ZAAA 2YXSA 2ZGUA 2HWC2 3A7QA 3PUAA 2HWD3 4LBNA 4N43B 5LA0A
chains in the Genus database with same CATH topology
2JE7A 2H0BA 4AVTA 4CDUA 4YYOA 3KQRA 1AL23 2YMZA 3J4UH 3AP6A 4P9YA 2IXIA 3AKPA 2DURA 1Z0HA 2ENRA 1W6NB 1SLCA 3ECQA 3RS6A 5KXBA 2ET7A 1UW8A 2PHUA 1PO21 4XFAA 1F5FA 1IS3A 1DYPA 1RUF1 4HMZA 4XPVA 4YVWC 5IT6A 4XILA 3AKSA 5JIAA 3ZXLA 4FQ4A 1ZBE2 4U2AA 4MSVA 1I3HA 4RR3A 5H9SA 4GA9A 3OY8B 1NY72 1UN1A 3AYAA 3QH6A 1V6NA 4GXLA 3E6BA 1AR61 3SH4A 4CP1A 3V65A 1G9AA 5JR7B 1J3PA 1ZZCA 4DPNA 5HCBA 5I0RA 4QD2A 2MEV3 4G3YC 1BJQA 2RS33 3VL9A 1BYHA 1MS5A 3H8UA 3EHKA 1LOAA 4BMEA 1R1A3 3PMEA 1ULEA 1YO8A 4Q2FA 3FUQA 1ZBA2 5IK7A 1H8VA 1QOOA 4XJAA 2HWD1 2WSVA 3CEWA 5GLZA 3MGUA 4AEMA 2VW2A 3B93A 2EALA 3U11A 1VB2A 3MIGA 1OA4A 1O4TA 1AL21 2WC2A 5SV5A 3FLPA 1O3RA 1ULGA 4AVBA 3O5SA 4JGYA 1YHFA 1OLQA 1PNGA 4IEOA 3VZOA 2A3YA 1RVF2 4CDXB 4Q8KA 1EV13 1OPMA 1OFNA 2AZ5A 2Z42A 1GFF2 1L3JA 4BE3A 4GIQA 1LB2A 3MLJA 4OHXA 1HX6A 1UU4A 2P3KA 4XIKA 3VKLA 3ZYJB 3H3ZA 5L19A 1VJ2A 1HDKA 1EY2A 2QJVA 3OGJA 1IS4A 4CDQA 1UD1A 4JGYC 3NO8A 5GKAC 4Q1PA 4KH9A 1W6PB 1X8EA 5H9QA 4GWNA 3FFQA 4GH4C 3TBDA 2MEV1 4NPRA 1AR73 1UZYA 4N90A 3ZFGB 4AQ2A 2VW0A 4CEYA 2RS31 3RJRA 5T5OA 3OTFA 4FAGA 3T1LA 1FT9A 3ZSKA 4HZFA 1R1A1 4NWVA 2GC0A 1O5LA 5FDBA 5BPXA 3I7DA 4W6XA 4E4ZA 3GBGA 3WLUA 4JV4A 4ONUA 4YW5A 3THPA 3ZXJA 1PZ7A 4N53C 4AE2A 5JZGC 3NJZA 3TN92 4K9SA 1POV3 4EWEA 4IV3A 4CEYC 3AK0A 5IK8A 4D94A 1JYCA 2UYBA 2WNUB 4I3PA 1A3KA 1NZCA 2GSYA 5J98B 1EV11 2WT1A 4K20A 4M3CA 1RGSA 1D2QA 4S2HA 1DQ1A 5C9AA 1SACA 4QPGB 4OFGA 3FBYA 1W6OB 1YNAA 4WVMA 3W58A 4KGQA 3O12A 1Y9QA 3ZSEA 1LGBA 1DZTA 3JUUA 1ENRA 2BVVA 4YZ5A 1SBFA 4UW5A 4GULA 1IS6A 4DY3A 5KC5A 1SMVA 1AR71 5C9AC 3WDWA 2FMDA 3GZUC 3VLBB 2OZJA 3AP9A 4LBLA 1TMF2 2VVEA 4DQAA 3MLKA 1LULA 1RUJ3 4UXAA 4A7YA 3FUOA 5B2GB 1WBFA 1AYM3 4HLTA 1XXNA 1RUD3 4YFZA 4AF9A 2GU9A 2V73A 2QVSB 3OBRA 2GC2A 1POV1 2WT2A 3IM0A 1RUC3 1MS3A 2D44A 4CTEA 2P3JA 5EXOA 3KD4A 1UZZA 4IEVA 1X36A 2R073 5I8SA 2AENA 1CGPA 2G4IA 3NAPC 4QU2A 3FLRA 3PNAA 1IHMA 1ZM1A 2P2KA 3AXEA 5KHIA 1ZX5A 2B9UA 3MW3A 1HRV2 1KITA 1H2LA 3NKGA 1CONA 1QWRA 1O91A 3DKWA 1VB4A 4RQPA 4QM9A 2GN3A 3FLTA 2E53A 4R4XA 5T5JA 2ATFA 4HANA 5CFCB 1MS9A 2B7YA 2ZOEB 3NKTA 2VMIA 4FBFA 1AR92 2VPVA 2JJ6A 5F6KA 1KJLA 3L2YA 1ND2C 5HCFA 3VKOA 1DQ5A 1WLCA 4FOYA 2A71A 4Q4V3 1SLIA 1ENQA 1RHI3 1JTZX 1LECA 3HIFA 1RUJ1 1W39A 1WBLA 1DQ6A 4LHKA 1RMU3 4N43A 4RQPC 1AYM1 1LOBA 1UU5A 1W6QA 3ZPYA 2GNMA 1H8TA 4U36A 3R4UA 1RUD1 1UF2C 4A3XA 2A6WA 2BGCA 2OVUA 4E2QA 4MGZE 5IK5A 3ZSMA 3HWJA 1RUC1 2R043 2D93A 4INDA 2R071 5EWSA 1DDLA 1KDKA 4JC1A 1R083 1ZA4A 4N43C 1IKQA 4LUMA 2WFF2 2P34A 4OHYA 4XTMA 2O8OA 5FAXA 1ND3B 4DINB 1HXS2 3CU7A 4AEJA 5T5PA 4OHWA 5TSWA 4CP0A 1RTVA 5CNAA 4BIFA 1WLTA 1Q43A 4LLFA 4B8EA 4Y1XA 1N1SA 3EQEA 1GNZA 2A6VA 3NW4A 5F1RA 1S0GA 1AF9A 3M1HA 4I0WB 4M3CF 4QQPA 1TQ5A 3VBUB 4DY5A 4QQ2A 2PTMA 1MS1A 2WKKA 4Q4V1 5CIRA 1RHI1 1H0BA 4PIYA 4EWDA 3WR0A 3S6PA 1AL0G 1RMU1 4ISRA 5DDJ2 4ZU4A 4YG0A 4AQTA 2RS52 4M0NA 4A7ZA 2XJSA 1CN1A 3B01A 1VBC2 2HEYF 1QKQA 5FFOC 4M0HA 2UWBA 2WQZC 5GJ6A 5AC92 2R041 2YGMA 1YYNA 3W9AA 1NQDA 1OA3A 4WZFA 5A3MA 4AQSA 1NE4A 4K3UA 3TRSB 1R081 1JH5A 3INAA 2DV9A 1YUDA 4Z1VA 1CR7A 1RUI2 4PLMA 3MW4A 2DU0A 3H3UA 1C8M3 1KFUL 4CDXC 3WV6A 1GR3A 1X8MA 4AG4A 2WS92 3RI9A 2JG8A 2HWD2 1ZZ8A 1ZRFA 3ELNA 3OJBA 2ZCWA 4XFHA 5LRRA 5BNNB 4KBBA 3Q9OA 1IS5A 2Z2SB 5K0UB 1PO12 1PGL1 5GZEA 3VBOA 3NV1A 1GSLA 3BCWA 4XBLA 1YIFA 2R49A 5GLVA 4XF3A 1NCQA 3ZX7A 2ZX3A 1J1TA 2MHFA 1KS5A 4W6WA 3ZFGC 5A33A 2GMMA 1LU2A 1QNYA 3EJKA 2VGDA 3ZFFB 4MYEA 2EF6A 5FO9B 1VBE3 2A70A 2DUPA 4JQRA 5ABJB 2BNMA 3CJIB 1QJY3 4H14A 4JDMA 2XLGA 1W6OA 1NE6A 3ES4A 2QKDA 4AI1A 4OI0A 3EXUA 2VG9A 2B45X 3W59A 2C0ZA 2WNUC 1WMEA 1NYWA 1C8M1 4UW3A 1SCRA 4JCKA 2IFWA 1RUG2 3E6DA 3VDDB 3HT2A 1WCKA 1W0PA 4SBVA 1ZYBA 2XVLA 4QPGC 2ZZQA 4Z07A 1UCXA 4B4QA 4Q27A 2IXJA 4AHWA 3DF0A 2E51A 1N1YA 1VAVA 4HETA 2IFRA 1X82A 4H3WA 2D43A 1U5IA 3AKTA 4R9AA 3SITA 5BNQA 1U5XA 2W0XA 1JN2P 2YY1A 3WD5A 1IKPA 1LGNA 3RQ0A 4CEWA 2I74A 4AK3A 3ME2A 4RL7A 4JAAA 4MUVA 2ZHLA 2VMGA 4Q0VA 1VR3A 4FQZA 1DGWX 2HWF3 4COUA 2CGPA 2GZWA 1VBE1 3ZN4A 2RMU3 5GALA 5AVAA 3LA3A 5BUVA 4HSLA 4J1WA 1N47A 3GZTB 1WCDJ 1QJY1 2K0GA 3BTAA 3U10A 3DPRB 4WVWA 3AP5A 1CAVA 1VALA 2JXAA 3R4SA 2HYKA 4XXPA 4YNIA 5JSRA 5FO7B 1MS8A 5JOXA 2P37A 3HR9A 5BNOA 1C3HA 3UKTA 1G9DA 1RUH2 4Y22B 5FTTC 1HRI1 5H9PA 3SCHA 2VH9A 2VY0A 4P9WA 2WJSA 4XE9A 3D0JA 4I09A 2D97A 5CFCC 5KHGA 3MIDA 2XG3A 1S0CA 2Q30A 4NOTA 4YW4A 2ZMNA 4P5HA 2Y0OA 4AI3A 3JBG3 1AYN3 3AKRA 3WNXA 4YGCA 4R9DA 4XFIA 4DFSA 3ZVXA 2DTYA 1JW6A 1R093 2HWF1 4OLLA 2R32A 2D5FA 2RMU1 4XMIA 4FTEA 1DQ2A 4Q4W2 5J96B 1V9U2 2VNOA 2YV8A 5FREA 5T3NA 5LEKA 3NV2A 4AVVA 3KGLA 4ES8A 5J48A 3U4XA 1X7NA 4FOVA 2NZ9A 3LOIA 1IOAA 4Y1ZA 3VN4A 2VUJA 3ZMNA 4NHLA 5FOBB 3WDUA 1RUJ2 1H9PA 4XHXA 3IKWA 4HK9A 3VBFA 3M8LA 4WVVA 3OYWB 2EXHA 2NYYA 1PVXA 1ND3C 4Y1UA 3UJQA 1S0JA 5D8AB 3TB0A 5K8SA 2PHDA 3GHNA 4BPZA 2HKXA 4P9XA 2RM23 4QQOA 5GZCA 1FPN3 3FFZA 3I59B 4IV1B 2UU8A 2WLQA 2UY8A 3CO2A 2ZGPA 1DF0A 3JBG1 4W6YA 1AYN1 1PGW2 2LALA 1ZRRA 2G9GA 4JRLA 3VBFC 3NVCA 4XJ8A 4AFAA 4AQ6A 1VBD3 1QH6A 1R091 2R062 1VAKA 3BB6A 4EV0A 4M01A 4B7EA 2O0OA 3VZNA 1NCRA 3NWKA 1CQ9A 3LGRA 4FPHA 4WZCA 2AR6A 4FPCA 2A7AA 3RI8A 2XKPA 2JKBA 4ORFA 3UKNA 1CPNA 1YRZA 1LOCA 1GV9A 4FSJA 5DG2A 2ZABA 1NXD1 1CAUA 4XJWA 4AHZA 2GH8A 4YZ3A 4YG3A 4QGMA 2ZX0A 5FO8B 2DCTA 1BVVA 1ZZ6A 4CDWA 1BKZA 4MXWB 5GLTA 1I6XA 4BH9A 4IEXA 1RB8G 5KWRA 2ZHKA 1TEIA 1OSGA 1XYOA 5FBZA 2RM21 1OLRA 2XBO3 1LHVA 3ZN5A 4Z8BA 4PCRA 1MEC2 1PIV3 5I0UA 3ZFFA 1Q8OA 1R082 4XQ4A 5C4WB 1XU1A 1MQTA 1Q8QA 2A6ZA 2NQYA 4L99A 3FWEA 1VBD1 3KSCA 5BNNC 3LB9A 4L9BA 1GANA 5K0UC 2RS13 5ACA3 5DZFA 3CL1A 1QJZA 1QDOA 5FRAA 1CIWA 3CF6E 3ZYRA 4EROA 2JG9A 1GLHA 2BNOA 2VNRA 3ZFFC 1AUYA 2A73B 2BWAA 4KGGA 3VL8A 4PLOA 5SV8A 4XOGA 1C5HA 4ITCA 4AW7A 2P3IA 3CJIC 4YVWA 3USUB 1OHFA 3RWNA 2GH2A 3IWZA 4Q0SA 4UBGA 1D4M3 2BNNA 2ZS6B 2WSUA 5EZWA 2X53S 4RSUA 4PLNA 2JG9C 3IT8A 1DIWA 4X8PA 4OI2A 4DS0A 2XHKA 5JI7A 3ROUA 4LO5B 2JE9A 4I2OA 1MZ5A 5JMCA 4G9SB 2XBO1 3ZYPA 2X8KA 4LHLA 3LSEA 1G9FA 5FMOS 4Q4X3 1PIV1 5CG8A 4C1XA 3JQXA 4AEDB 4LR4A 3FX3A 5DZGA 5JSPA 1SBEA 1PGSA 3THTA 1EAH3 1YCIA 3MIFA 4LUKA 2SLIA 1COV3 2RS11 4HVRA 5ACA1 1LTEA 2XGXA 1PK6B 4RS5A 1BEV2 1N1VA 3PLQA 4NN0A 4Y1VA 2VXRA 3NV4A 3MEPA 1LEMA 1NOVA 4YFWA 1D2SA 3J9SA 1FYUA 3M70A 4LBQB 3B02A 4LA3A 5CB7A 1BQPA 1DBNA 4ASLA 1AXZA 2ARXA 1Q8SA 4LNVA 5FLHA 3R05A 4PBOA 1XNKA 3JCIA 4LHNA 4F8AA 3R6SA 3AYEA 5T54A 2YUEA 4RS5C 2CTVA 3MZHA 2ARBA 1D4M1 4XW3A 3AX4A 2D6MA 5J37A 4KQ7A 4J6GA 2R1DA 1YJLA 3B00A 1QXRA 4LBKA 1G9CA 4BWOA 4AHXA 1PMIA 1S0BA 1DG6A 4AFMA 2GC3A 1C1LA 1KQRA 1BXHA 1H9WA 2O8QA 5LRSA 2GC1A 1V6KA 1LOGA 4RHV2 2FQPA 2BFUS 4GH4A 1HKDA 4Q4X1 3VHRA 3R4DB 3WCRA 1J3QA 2YYOA 4FPEA 2ZHNA 3V0AA 2PAKA 5T50A 1EAH1 4GQ7A 1AX1A 2QCSB 1QOSA 1COV1 1Q5OA 2WIIB 1UKGA 3SXWA 1ZVFA 3S30A 2XL7A 5E16A 1KFXL 2RR12 1REDA 4N53A 5JZGA 2OW4A 2BYVE 2UY9A 1R1ZA 1UL9A 2OUJA 1HRI2 2PLV2 3ES1A 2Q4SA 3MLLA 3AZWA 1MZ6A 4XF9A 2Y26A 4L97A 4FCAA 3AMQA 3RRDA 2X5IB 2PQQA 3GNEA 4PDWA 4RA0A 5C8CB 3M3EA 1YJKA 2A3XA 3WQ0A 5D8AA 2WA3A 1RUNA 4DMIA 3TOJA 1VBA3 4WVZA 4D7YA 4OUMA 1LHUA 3B3QE 1F9KA 4YVSA 1Y3TA 3FJSA 5T52A 1VBB3 1IQAA 4YM1A 1T6GC 4EJRA 2ZGLA 2HWF2 1CESA 3WUCA 1PHMA 4Q4Y3 4PDWC 4TWTA 2NPIA 4Q29A 1MVQA 1XNBA 1RUE2 2ZJCA 5D8AC 3G6JB 1TNRA 1OMIA 4PF5A 2VULA 4YVSC 4F7ZA 2IXLA 1Z7S2 3A0KA 4IV1C 3WDVA 3KLSA 1KRIA 2DFCA 4PQ9A 1N3QA 2A75A 2HWB2 3MFAA 1J1LA 2DCYA 3WY6A 4BCUA 1DZQA 1QDCA 5HBAA 1CAWA 3B9IA 4HPKA 1WUVA 1GZ9A 3H50A 3O0VA 4LO4B 1FOD3 2BVBA 4OUSA 3NAPA 3HMYA 2DWRA 1Q56A 1GQGA 3LWCA 2LTNA 4MXWA 1NG0A 1BCXA 4ZU7A 5LK7B 1VBA1 4TSVA 3JBG2 4R4ZA 1K5MB 5HI0A 2ZGNA 2IXHA 4J1XA 1AR82 4XF1A 4KWJA 1HW5A 5JDBA 4ASMB 3WW3A 1VBB1 3H1WA 2ZGSA 4E27A 5C8WA 3PMSA 4Q4Y1 1S2KA 3AXDA 3KT1A 4KU7A 1ND2A 4WM7B 1YIPA 2PHRA 4OZXA 4YW2A 4COYA 3VBSB 4RGAA 5E1RA 1APNA 3AMHA 2DUOA 4S2GA 5KHJA 2MNGA 2GALA 3FBMA 4Q26A 1EYBA 2PYTA 5CA6A 1UU6A 1N3OA 3H7JA 2ZMKA 1F5JA 1LEDA 5A32B 3J8F2 3H1YA 4OI4A 2ZA9A 3VHOA 3VGIA 4BZ4A 1ULFA 1QQP2 5C4WC 1HQLA 3E5QA 4S2FA 5IUQA 3ASIA 2QDNA 1QJX2 4PIXA 4EN8B 3ACLA 2XWJB 4HT1T 1RL3A 3O14A 3SLIA 2VOVA 1FOD1 5CADA 3KS7A 2WNVB 2WZR3 5JI9A 1JUHA 4BQ1A 4QQHA 2H6BA 4AGRA 1VRH3 2B5HA 4ZXKA 4C91A 1W6NA 4Q0QA 3VKFC 2Q8OA 4QX5A 1H4GA 2TEPA 1VBD2 4LBMA 1XYNA 1OQDA 2CYFA 4NVPA 4Z2WA 2WINB 5JOZA 2ZX2A 4E4DX 1LHNA 4DOUA 1ASJ3 2PHTA 1W6MB 3OY8A 2WNEA 5BNPB 2DFBA 1HIXA 4HL0A 1FMD3 4XBQA 4IEYA 4I0BA 1AX2A 1E57A 2HWE3 4JTOA 4QPIB 3L9JT 1TME2 2E7AA 1YFWA 3ALQA 3IDEA 4NWWA 4COWA 1XU2A 4YZ2A 2QUOA 1XNCA 3M7AA 3GALA 3AFGA 2CGOA 1Q3EA 2CL2A 2XKOA 4EWAA 2VECA 4EN9B 1LOFC 3LSDA 1RC6A 2GAUA 4D7TA 1JYIA 5CU1A 1PK6C 3KGZA 1BBT3 2WZR1 1PO22 1XE8A 4KNCA 3WDTA 5H9RA 3V0BB 1SDWA 3GZAA 3MYXA 4YARA 1RUF2 1HQWA 1VRH1 3ZXGA 3ZFEB 5AFBA 4CZSA 1PIV2 1GZWB 2X29A 5I91A 1FNYA 1RUOA 4GALA 1UIKA 1DQ0A 1MS4A 1YI9A 1ZZ7A 2DU1A 3NV3A 4XEZA 4CDXA 5JOYA 2VU9A 3RNSA 4N9HA 1LENA 4K1YA 5KBFA 4YW1A 3UV9A 3V56A 2IXCA 2NM1A 1AR62 2C1FA 4FTBA 2JECA 3JQWA 4B4RA 1JXNA 1ASJ1 1XRUA 3ILRA 4YG6A 3VV1A 1FMD1 2OIIA 1IPKA 4L11A 3WQ7A 4YZ1A 3B5LB 2HEVF 1W6PA 2HWE1 1FV3A 4FPJA 3ZFGA 3QCWA 1XE7A 3WW1A 4KL1A 1OOPB 1AVBA 2WL1A 1ZBE3 3KMHA 4Y26A 5IK4A 2VOWA 1AL22 2XVGA 3ENRA 3RDIA 3H7YA 1BBT1 5KHKA 2AYHA 5CG9A 5L7OB 1CAXB 2QNKA 4Y20B 1H1IA 4XJZA 1S2BA 2WWSA 3SCFA 3HQXA 4QT6A 2WNUA 3WP3A 5GLWA 4MX3A 2GN7A 4LO7A 2XH6A 2X5IC 2PHXA 2XJUA 4QGNA 1ENXA 1QXJA 4I02A 4X6QB 1ZBA3 4QPGA 4H7LA 1LU1A 3CJXA 2OYZA 5JOWA 4IETA 1AHSA 4MGKE 1O7FA 2A6YA 4XIOA 3VBRB 5I0SA 3G7DA 4LLOA 2MEV2 1DZRA 2RS32 1LCLA 1DYKA 3O0XA 5DUXA 4MLOA 5FQ0B 3DN7A 1R1A2 1HV1A 3BU7A 2RE9A 1B35B 1O3TA 1AZDA 1ZRDA 5FOJB 3C2UA 4WM8B 3B7MA 4IESA 3OCPA 2DVFA 4QPYA 2ZX4A 2QQPA 3KCYA 1ZBE1 4IQPA 2XJTA 1QF3A 5GLUA 3TNQA 1NY71 4LE3A 3GBFA 3OD0A 3FHIB 4Q0PA 3BOPA 1NLRA 5CFDB 1EV12 3WP5A 4QM8A 2B42B 1PM7A 5L73A 2W68A 3IIAA 1LODA 1QH7A 3KB5A 1IZ3A 2QZ3A 4CDUB 1SCSA 3RG0A 1BMV1 3MPBA 2VOXA 4L8QA 3AZYA 1ZBA1 4LO6B 1EPZA 4IEQA 3AJZA 4R9CA 3TN93 2Q5TA 1K5MC 2ZGTA 2PA7A 4I0AA 4RD7A 4ZU5A 2YROA 1AR72 1G8WA 5CFCA 4JGZB 1VAMA 2A3WA 4NO4A 4FPKA 4E9KA 2GNBA 4RR3B 1V6MA 2JD4A 3WZ1A 3RJ2X 3RYRA 2CWSA 2CWMA 1JBCA 2D7FA 2KA3A 2K2SA 4O9GA 4AVSA 5GM0A 5JSOA 2EVXA 5F9TA 3QH7A 1REEA 3R0RA 1EP0A 2RHPA 5T55A 3OPZA 1MS0A 1WLDA 5J3UA 4KWKA 2DVBA 1AJOA 1DGRA 2PHLA 2R30A 4FOQA 4GMP0 1H1AA 4M00A 1YLLA 1TMF3 3MIEA 2ZKLA 1Y43B 3BODA 1GKBA 5E89A 3M3IA 2WNVC 1ND3A 2VNGA 1W6MA 2BQPA 1SBDA 3WG2A 4XQDA 3TN91 2GDFA 2YPJA 4FTSA 3VKMA 1JUIA 1FNZA 3ZYIB 1RIRA 1VLNA 4L2NA 3WUDA 1TNFA 4UW4A 3WQ1A 2UWAA 2D3RA 4AGVA 3VBUA 3VHNA 4Q0UA 1AYM2 1V6IA 1X50A 5I93A 4CDQB 1PZ8A 1RJ7A 1WA4A 1RUD2 4NHMA 5BNPC 3IDBB 1SFYA 3M3QA 3KCCA 1HRV3 3MIHA 2Y0IA 5DUUA 1G6NA 4QPIC 3POYA 4R8HA 1RUC2 2Q1MA 1V6OA 4MGIE 2EXKA 1BVP1 2R072 3SH3A 3IPVB 4XBNA 1AR93 3PVNA 3IBMA 4Z82A 3MDPA 3MI8A 3T1MA 3ZFEA 4BLIA 3VBUC 5I8YA 3JZVA 2DVAA 1WD3A 3MFCA 2ETEA 1GYKA 4DRRA 3T2TA 3X29B 2JENA 4JDOA 1TMF1 3PJQA 4IERA 4XXAA 4XFGA 4IV3B 3MF9A 3HT1A 1WGPA 3ZFEC 4XYXA 4AVCA 2BTVC 2DF7A 3ZN6B 4M3CB 2IC1A 1CVNA 5C9AB 1QGLA 1WMDA 1X33A 4Q4V2 1DGLA 1RHI2 1DGRN 2AH2A 2VVFA 1RMU2 4QQLA 4YGDA 5BNNA 1O5UA 3WDYA 1MZEA 2WZPP 4YLZA 1HXS3 5K0UA 1OFSA 1CX4A 3ZSLA 1HRV1 1A78A 4FVVA 2BUKA 2XLFA 4AFDA 1FPN1 1MACA 1UX6A 4Y20A 2R042 1ENSA 3WG4A 2DTWA 2EIGA 2E7TA 1AR91 2VW1A 1OOPC 5KXDA 4YGEA 3ZYGA 3WG3A 2HJIA 5CBLA 4OULA 3GHMA 1RINA 5GZGA 5ABJA 3CJIA 2E63A 2Z69A 4IEUA 5DUVA 3M3OA 1FMD2 4B3NA 2B39A 5DDJ3 5L7OC 3H0OA 2RS53 4LE4A 1DFQA 4E2SA 1VBC3 2RJKA 1SFNA 3HBZA 3VZKA 3SISA 4F83A 1KD7A 4N7UA 5AC93 3S7EA 2CY6A 1W2UA 3VDDA 4K7JA 3AZVA 5ABJC 2CAUA 4JDNA 4DB5A 1H1MA 1ZRCA 1V00A 5BY5A 1DLLA 2K9ZA 1V6JA 3AJYA 1PGL2 2QFEA 2UWCA 3UK9A 4PIZA 4FPGA 5DXDA 3IMNA 1BZWA 3WW4A 3VBRC 3KCXA 3U07A 1C8NA 1HXS1 1FI2A 3N7MA 5EYYA 5A3LA 1RUI3 4AWDA 3IN9A 4IXLA 1ZZBA 4KU8A 1B09A 1H30A 1NLSA 5BXXA 3VDDC 1UPSA 3LZZA 1B35C 1OQ1A 3B69A 2WS93 4WM8C 1LESA 1QY4A 3BOWA 4PJYA 3ZXFA 4E4SA 4TLFA 3FMGA 1LKNA 3N35A 4XMAA 4HKWA 4D7SA 1D0HA 1W6QB 3AZZA 3H9AA 3E6CC 1H8TB 1IGOA 5BV6A 2UURA 4HKOA 2RJLA 3P3PA 1PO13 1URXA 3ILFA 5DDJ1 2VQ0A 5BYNA 1C8M2 4A7KA 1H2NA 3DPRA 4L92A 2RS51 5CFDC 1XQNA 1KDMA 1VBC1 3NSTA 3OF1A 4EN6B 2HEWF 1WCSA 4URTA 4JGZA 3KM5A 2XJPA 5AC91 2ZGQA 4CDUC 3RZZA 4XFCA 4AXOA 4LT5A 2WT0A 1YXWA 4C0BA 3KT7A 4Y22A 3I8TA 1KS4A 3OBTA 1LHWA 4C90A 1JHNA 4N9IA 4C1WA 1MR5A 1XNDA 4H55A 3WT3A 1O4YA 2R16A 3DPRC 3N7JA 2PHFA 3J26N 3ZO0B 2E7QA 5JAXA 4XDQA 1RUI1 1LR5A 3ZXDA 4LA2A 3AFKA 3AMPA 4JGZC 2DCKA 2ZACA 1AX0A 1DGWA 1RUG3 1VBE2 4OVEA 3WX5A 4RR3C 5JCTA 1KXGA 1BMV2 3DUIA 2WS91 1QJY2 1D4VB 2O1QA 4KWLA 3D8CA 3AMNA 4AVAA 4UBHA 3I2DA 4YM2A 4AFCA 1F8VA 2E6VA 2NMNA 2QZ2A 1PO11 2VQAA 5DUWA 3B94A 1UIJA 2ZKNA 2XJRA 4EN0A 3UL2A 4XFBA 4FAHA 4FPFA 4I30A 5F5QA 4F3JA 1NXMA 3LOBA 3N3HA 1YFUA 2W52A 2EAKA 4OHVA 2ES3A 4XJ9A 2D6NA 2YC0A 4FO9A 2IXKA 4MZUA 3POWA 3OYWA 1Q8VA 1CD3G 2FMYA 1FX5A 4TZDA 2N7GA 2VMHA 5CAZA 4LEJA 4LBQD 4JTNA 3FC0A 2PAEA 1G86A 2BW8A 1GBGA 1SLTA 3I59A 4H7MA 2JG8B 4IV1A 1QMJA 2E9QA 3HAGA 4MXVA 4DRVA 2ILMA 1J59A 3IPVA 4HFSA 3USSA 1RUG1 5EYXA 3RPQA 2RMU2 4A2UA 1RUH3