2O0OA

Crystal structure of tl1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
153
Chain Sequence
b'GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF superfamily ligand TL1A
molecule tags Cytokine, hormone/growth factor
source organism Homo sapiens
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1A.
pubmed doi rcsb
total genus 23
structure length 153
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o0oA01
3B9IA 2WNVC 2JG8B 3ME2A 4KG8A 2WNUC 4OULA 1TNFA 2X29A 2RE9A 3V56A 4MXWB 2JG9B 5CIRA 3LKJA 1JTZX 3B93A 2WNUA 1DG6A 3TYJA 2HEWF 1OQEA 4G3YC 5TSWA 4G4FA 4KGGA 5L36A 4QQLA 1C3HA 2R30A 1PK6B 4E4DX 3QBQA 1U5YA 3B94A 3URFA 1S55A 4QQPA 2HEYF 4MXWA 4OUSA 2JG9A 3K48A 1U5ZA 2QDNA 1PK6C 2O0OA 1TNRA 3ALQA 2WNUB 2R32A 3K51A 3AB0A 1D4VB 1KXGA 3L9JT 5HBAA 1RJ7A 4DB5A 1XU2A 4EN0A 2WNVB 3FC0A 1OSGA 2AZ5A 2Q8OA 1PK6A 3MI8A 1DU3D 2Z5WA 4MSVA 2RJKA 4MXVA 1KD7A 4DOUA 1XU1A 4TSVA 2KA3A 1JH5A 1RJ8A 4N90A 4D7YA 4HT1T 2RJLA 4F3JA 1OQDA 2JG9C 1D0GA 4KGQA 1D2QA 2HEVF 1C28A 2ZJCA 1GR3A 5KWRA 5BNQA 2WNVA 2TNFA 4QQHA 2R6QA 1WCKA 4RSUA 4OUMA 4GIQA 2ZPXA 2TUNA 2E7AA 2Q1MA 1ALYA 2JG8A 1A8MA 5KC6A 1O91A 3QD6A 4NN0A 4QQOA 4TWTA 3TWIA 3WD5A 1I9RA 2OIIA 3IT8A 1IQAA 4J6GA 4E4SA 4QQ2A 4QPYA 5L19A 1U5XA 2JG8C 2QE3A 5KC5A
chains in the Genus database with same CATH superfamily
2WWSA 4XJAA 1SPPA 1AX1A 5I93A 2DVAA 5L73A 4MG2A 2GSYA 2R1DA 2VTXJ 3EO6A 2FDFA 2G9ZA 1BK1A 1W8TA 2DCKA 4OMCA 4XIKA 1M06G 1POV1 1D0HA 4Z8BA 2QTWB 2YROA 2VNRA 5KXDA 1PGW1 3WG4A 1Y4WA 1FPN2 1QJX3 3AYDA 2NZ9A 3K4ZA 3OF1A 3RPQA 3ZXAC 5A3MA 4L11A 4MGYE 5AC92 2VCAA 1ZZ7A 2EALA 2MEV1 4UBGA 3WNKA 4LBMA 3V0BA 1UKGA 1WLDA 1DQ5A 3FUQA 4PCRA 2PTMA 2ZGPA 4AVVA 2JIGA 3WW4A 2WT0A 2QQIA 2XXZA 3B93A 2VMIA 3WEZA 3VZKA 4LPLA 2W68A 3JQWA 1NLQA 5EHDA 2JENA 2VY0A 2XR4A 4XC9A 5IVVA 4DUVA 2JDYA 5F5QA 4AVSA 2PA7A 1A34A 3SKVA 3ZPYA 4Q4Y3 1IS4A 2D44A 5EIYB 3ASIA 4AG4A 4TN7A 3OJBA 1IQDC 5C4WB 5GZCA 5J09A 3QBQA 1OLQA 2HWD1 4EROA 5AFEA 1JN2P 1ODNA 3CHXA 4HOOA 5FYMA 3WNXA 2BUKA 3MPBA 1XSQA 4CE8A 5FZAA 2YV8A 5LZ6A 5KR7A 4I2OA 3SHRA 1YQ8A 3BN6A 1VBC3 2YB7A 3GDBA 4IEZA 4ISRA 5FUNA 1S0JA 4EE2A 1FV2A 3FLTA 4RS5C 5IVFA 4URAA 3GF6A 4XUNA 1GOGA 4NROA 3KF3A 4COWA 1ASJ3 1LOAA 5E6HA 2G19A 4IGQA 1FT9A 3BODA 4IEQA 3VZJA 4NUBA 4OFGA 4IXLA 3S30A 1XC6A 5LCWL 4FTBA 1DU3D 2VQUA 4JRAA 2WFF3 5E88A 2UURA 1UW8A 3ZYRA 3THPA 4BM8A 2D93A 2HKXA 2QQMA 3ZKYA 3KHCA 1JZ6A 3JD72 4LXLA 4P9LA 3DECA 2ZKNA 2Y33A 3QCWA 4NHMA 5GZEA 4CXXA 3KGLA 3THDA 5KXBA 3WDYA 3PU8A 1D2QA 3UL2A 1Z0HA 2P3YA 1CAWA 3I3EA 1HV1A 2ZXQA 1SFYA 2BRTA 1QF3A 2UY8A 2WNVA 2ES3A 3PDQA 1RUE2 4LO4B 3ZFFB 4YG0A 1PZ7A 1X8MA 2VR4A 2FD8A 2B5HA 1CR7A 1JZ5A 4AAXA 4SBVA 3N9NA 1DQ6A 4D8MA 3VKNA 3ILRA 4GD4A 2D5HA 3WD5A 5EPAA 4D69A 4YFZA 3LPGA 1QOSA 2UYBA 4FCAA 4N7IA 4DY5A 4CXYA 5ACA1 1ULCA 5C7GA 1DIWA 1JYNA 5ANQA 1NXD1 2FMYA 2XVGA 3I8TA 2DCZA 3LEIA 5HCFA 3S5AA 2BQPA 5EFUA 1RMU3 2RS32 4Q8LA 1K42A 1MZ6A 2RVAA 2ADDA 4FO9A 2ZMNA 3ZXKA 1YI7A 2DTYA 3P6BA 5HCHA 3LOBA 1I3HA 5FLIA 2Z79A 5IW0A 2CL2A 3U14A 5JOXA 1BBT1 1RUD3 4AE2A 2P2KA 4MGQA 1ZRFA 2BNOA 4XJWA 5LW9A 2VCBA 4Q0SA 2K9ZA 3R0RA 5BV6A 3ME2A 1NT0A 3AMPA 4YVSC 5CADA 1CAUA 1W9FA 4COZA 2X8KA 1VBE1 5I0DA 4RR3C 3U37A 3VBRC 4KU8A 2Y26A 3ETQA 4FPYA 1BMV2 1FI2A 4K1YA 1F8VA 2RM23 2XG3A 5JMOA 2XWJB 3I3BA 2JG9B 3PVEA 4XE9A 1QXPA 5DG2A 4AGVA 3WV6A 4BCUA 5EJZB 2R16A 1G9BA 3Q8AA 4UFKA 5F3IA 1J83A 2Q1FA 5BNNA 1X7NA 1DP0A 2YC2A 3IAQA 2R1BA 5FYZA 3WP3A 4HXCA 5IFPA 4JGZC 1EPZA 2VOVA 1AXYA 3OBTA 5D8AC 1RUH3 3OEAA 3CO2A 3HNMA 4E4DX 4GB31 2XBO2 1NE6A 3WNLA 3B00A 3SCFA 3UYJA 3WT3A 3DF0A 2A6VA 4KWUA 4EZ4A 5JI9A 2JDAA 4XJZA 2A7AA 4NIGA 1EAH3 1UF2C 1O8PA 4E8DA 1ZBA1 4PF5A 1ND3B 2IVJA 2Y6GA 2ZGQA 1TNRA 3N9PA 3DPRA 1AR71 3P5BA 3RYPA 1LU1A 5F39A 1V6IA 2PHUA 4D6RA 4QU2A 1MEC3 1HN1A 2PQQA 4P9YA 2OPKA 3KT4A 5F5CA 3I2KA 1QGLA 1W2NA 3ZYHA 4IEVA 4I09A 1REEA 3C3VA 4IEYA 1OA3A 2XHKA 3EHKA 4YVSA 2RJKA 4CDUA 1KD7A 1YO8A 5FZIA 5EXOA 3H8RA 5FMBA 2IC1A 2CDPA 2QFEA 5DAPA 3DXUA 1V6OA 3KVAA 2WL1A 5FZLA 4HT1T 3T0AA 3K3NA 4EYUA 1OQDA 4CDQB 3FHAA 3DPRB 3AMNA 5I91A 3NV3A 4B4RA 2W1WA 5BNPA 4JQTA 1QJFA 5FY5A 2OXBA 3M3IA 4BK5A 4RQPB 2W1QA 3OYWB 4K1ZA 1CPNA 5LBFA 1UWWA 1Y9MA 4OI2A 3ZN4A 3LQCA 5IVJA 1R1A3 2FZ1A 2VGDA 2XJPA 4XZUG 2H0VA 4LKDA 3I2DA 1ALYA 2VZ3A 1BYHA 2ZX4A 3LOIA 2JWPA 5CZKA 1BBT2 2JG8A 1AYM3 2E33A 2YGLA 4TWTA 3TWIA 4DS0A 1DQ4A 4YZ4A 5GZDA 4CUCA 1J1LA 3PVOA 1UIKA 4OQ8A 5JSPA 1ZRCA 1ZBA3 1TMF1 1JYIA 1J84A 2JX9A 5FR3A 4QKNA 3WQ1A 1U5XA 1MS3A 4QT6A 1AR93 1EY2A 2UWCA 2VZTA 2WNOA 3IKWA 4LHNA 3OYWA 1SBEA 3LEKA 4LOTA 5KXCA 1TZOA 4NPLA 4PQ9A 1WA4A 5CFCB 1VBD3 5ABJC 5A3PA 2ATFA 2R063 5A6XA 1MS9A 2Y6FA 5LK5A 3I3QA 2QBXA 3AP7A 5CVRA 4KG8A 1AVBA 5FY9A 1D4M2 4LNVA 4ZPIA 2DU0A 2X29A 2ADEA 2BBAA 3RGBA 1MQTC 4BISA 4BXFA 2P6HA 1E5RA 4B7EA 4TXWA 5FZ8A 2XL9A 2XUEA 1YFWA 4AFDA 1UYYA 2JDUA 1XXNA 2WNUA 4LBOA 1UU5A 4CZSA 2XOMA 2HWC1 3HQXA 3DN7A 2VMFA 3AMMA 5TSWA 2QZ3A 3BTYA 4HBNA 3N3HA 4EN6B 4I3GA 3VZMA 1H6YA 3I97A 2KR2A 4H7LA 3RI8A 2P3KA 3A22A 2VM9A 3H1MA 1KJLA 4AI2A 4LT5A 4NOTA 4D3WA 1RUG2 2J1SA 4NE9A 2R0HA 3TB0A 1RUG3 5FXXA 3UV9A 3Q8EA 1MS8A 4YG3A 5FZDA 3V0BB 3Q8CA 1QJY3 2P6CA 2VUAA 1N1TA 1U5ZA 1DYPA 1MZFA 4UI9L 2RS52 3M3EA 3BALA 5A1LA 3B02A 2ET7A 1E57A 3QH7A 4A42A 3CNAA 3K51A 4FOQA 1VAKA 1KXGA 1WD3A 3N7MA 4HVRA 5ISLA 1NE4A 1A3KA 2B39A 1CAXB 5ABJA 1D4M1 2JE9A 5FZBA 4GMP3 2R061 2Y6LA 2DCYA 1BQPA 2ZA9A 1X9TA 3SC7X 5C71A 1XYNA 1KJRA 1APNA 4RGKA 1SDWA 1GNHA 3AP4A 4CVUA 2I07B 1HQWA 4MXVA 1SACA 4RYDA 3MLKA 3ES4A 2P3JA 5BXXA 4RR3A 3R4SA 2DF7A 4PBPA 3RDIA 2A3WA 4CA9A 1LECA 4K3UA 4XUQA 1U0AA 4DRRA 2R062 3U07A 4BE3A 1MS4A 1JW6A 1RC6A 1AR61 1CZSA 1CD3G 2G1MA 4Q0VA 3VHOA 1LOEA 4IDZA 2VCMA 4MLOA 2ZGSA 5ABJB 1H8TA 3BI3A 3ZFFC 3EBRA 4CUGA 3K4DA 1UOGA 3WXPA 1FATA 4JGZA 4E4HA 3E5QA 3POFA 1OA2A 1W6OB 1YXWA 4FPEA 5IJRA 5JSOA 4AFAA 4DO0A 5IVCA 1XSRA 3O1SA 3W5NA 1J3RA 3ILFA 1DLCA 1NQDA 4RR3B 3U78A 5CB7A 4LKEA 5DDJ1 3MIFA 4Y1XA 4BIOA 4MZUA 2XQXA 1ZYBA 2DDUA 4QDQA 2D6OX 1WLCA 1IQAA 1XOYA 4Q2FA 1QDOA 2KM2A 4IEUA 5A3WA 2DCTA 3B3QE 1LOBA 2B46X 3DV8A 4NRPA 3ZYGA 5A6QA 3ZLIA 1N1SA 3I2IA 5KC5A 4BB3A 1DDLA 1NCQC 1NZIA 2E31A 4EWDA 3ZYJB 4YW3A 3VBUA 3C7GA 2BFUS 4CPBA 4YW4A 4AVCA 4QB1A 3MUY1 2I74A 3BB6A 2WA3A 3CU7A 3VD3A 1UXZA 1UY0A 3ECQA 4MGSA 3MIBA 1VBC2 4NRQA 2NYYA 3WX5A 4CCKA 5JCTA 1DQ1A 3VKLA 4CDWA 2C5DA 3AM2A 3LAGA 3S7IA 3HEIA 4IL7A 3K46A 5FXVA 2X53S 5FY8A 1LODA 2BP6A 1SLIA 4BLJA 2PMWB 4QXKA 5F37A 4QD2A 5FOBB 5JXHA 1IS5A 1PX4A 5FLJA 1N1VA 2PLV3 1O8SA 5H9QA 1HRV2 4S2FA 3VBHC 4CXWA 4FPKA 1OUSA 5FMCA 2WZR3 2RS51 3DYPA 1POQA 3JZVA 3PUQA 3DYOA 1NCQB 5T3NA 2YY1A 3OY8B 2CY6A 4QX5A 4YM2A 4BIFA 4K6BA 4P5YA 4H2AA 1RUJ1 1XNCA 1TQ5A 2J7MA 2WLPA 4GWJA 5SV8A 4UW6A 4CDWB 1S0BA 5FZMA 4NMIA 4QPGA 1FMD1 4QX0A 4UFHA 1YRZA 5H9PA 2WAOA 2JG9A 5HCBA 5FY0A 1N1YA 2RR13 3AYCA 4GMP1 1VBB3 3BUCA 1LRHA 1PX3A 5E16A 1SLAA 2DU1A 5FFOC 3AXDA 1XNBA 3NO8A 3H42B 1OVPA 1GICA 2BOIA 4ZZ5A 1BEV1 3AB0A 3MW3A 1NCQA 2A1XA 4AYUA 1ZM1A 2GH8A 3VBUC 2BEOA 3VDAA 4D7SA 3WP5A 1YI9A 1RUD1 2QJVA 3HQRA 2YPJA 3VN4A 1PNFA 5LBBA 2VNGA 4PIXA 4LBLA 4I3PA 5APAA 1RINA 4DFSA 1OF4A 2O8QA 4PLMA 4U36A 4JTNA 4J1XA 3V0AA 2DVFA 5IK8A 4YRDA 5F32A 2WAAA 3AKSA 2RS33 4Y4YA 1ND3A 4LBQB 4YPJA 5LA9A 2J1TA 3E5XA 1LEMA 2P34A 2Q8EA 4QKDA 5HPOA 1JMUB 1EV13 4M3CE 4A2UA 4DIQA 1NCRC 2LM3A 3LDBA 1U5IA 4WZCA 4NJ4A 4QQHA 5BNOC 1AR82 1RMU1 2P4EA 4OUMA 3VBFB 3DXTA 4I0AA 3WF3A 4OI1A 1AR92 1RL3A 2BGPA 4FFHA 2E7AA 1ULDA 3KV4A 4QXBA 2EIBA 4XHBA 4YM1A 5FPXA 4RGGA 3ROUA 3PU3A 4QX8A 1GUIA 2X09A 3UESA 2AUYA 4NN0A 3WQ0A 4Q5OA 1F4AA 3VUOA 3JU9A 4BQYA 2ZMLA 4V2VA 1S0FA 1RHI3 1WCSA 2YFZA 4J6GA 2VQ0A 4KU7A 5BPXA 1HRV3 2JB8A 4QPYA 5BNPB 2BV4A 1WMFA 4MUVA 4AQ2A 2MEV2 2XKPA 4PHZA 2WR9A 1YYNA 4RQPA 2AACA 4TYSA 4W50A 2OQ7A 5A33A 1VBA3 3AL6A 4DXRA 1YQ5A 3TNQA 4AZZA 4NVPA 4JDMA 4JGYC 1SFNA 4PI2A 5J1XA 4IE4A 3FMGA 5L9BA 2ZGRA 3LDRA 1IKQA 3OPTA 4CP0A 5JMCA 1MZ5A 3ON7A 4LQRA 4Q1RA 4LHSA 4AI9A 4K8FA 1EAH2 3OPWA 5FZGA 4AI3A 5FYBA 5JXIA 1UCXA 2R0FA 3BKZA 1N3PA 2VQTA 3J7HA 2JDZA 2BERA 1D2SA 2HWF2 3ZSMA 2PHFA 5JVVA 2DFBA 4DEQA 4ZU4A 3RZZA 3LKJA 4Q27A 1S2BA 1OBNA 2D3RA 1Z7S2 3CQOA 1QY4A 1JOBA 2EF6A 3L2YA 3A0NA 4KI5M 4LA3A 4A6OA 4KWJA 3J26N 1RHI2 4WM7A 1SFPA 4XOGA 3WP6A 3MHZA 3VKFC 1G9FA 5FKBA 4MV2A 4D6QA 3NJXA 1QJY2 4Q4X3 4AEKA 2C4XA 3RZMA 1I6XA 1VBE2 4FOYA 5FYCA 5IHRA 1QNWA 2YBSA 3GCWA 2J22A 4Y4RA 4E8CA 1WW5A 2GMEA 1GKBA 3AFKA 4WVZA 2Z42A 1FOD1 3WDWA 3IIAA 5A3NA 1GZWB 2HEYF 2ZACA 3LA2A 5KHGA 4ZONA 1W0OA 3VDDC 4LBJA 4XCBA 3OEBA 5FYVA 4ATEA 1QH7A 5C4WC 2GC1A 1MS0A 3ATGA 1BCXA 2WNUB 3C7HA 5LRSA 2RJ2A 4GXLA 4X8PA 1IG3A 4WM7B 1ENRA 3M3OA 4Z07A 2YC4A 4RL7A 1WA6X 3AZXA 4ASLA 5K9YA 1ZRDA 1RUF1 1J3PA 1HXS1 1VP6A 1ENQA 2BDRA 3NL1A 5A1AA 5AFBA 2RR11 3I3DA 1JU4A 2X05A 1HV0A 2WKKA 3C2UA 1UZ0A 3H8UA 4FPHA 5B2GB 1I5ZA 2I45A 4MOAA 4XAEA 5I8TA 2D6MA 2WNEA 4CDWC 4E27A 4GH4B 1JH5A 1ENXA 1XE8A 1YLLA 2J1RA 3C7OA 4CUBA 1C5HA 2ZHNA 1VB4A 4P02B 1GQGA 1TMF3 2RG4A 1HB2A 2XH6A 4LIUA 3JB8A 2NLRA 2UY9A 5BNOB 5C8WA 1QJEA 2A3YA 2V5DA 3E6CC 2EIGA 3I2HA 2BPA2 2EA7A 2D3PA 2IXIA 3E1F1 2FHRA 3KCCA 5KWRA 2W95A 3I2JA 2WABA 2D6NA 1PZ9A 4BQXA 2ENRA 4MGIE 2YU1A 1IZ3A 2ZS6B 1MQTB 3VV1A 1HB1A 3NNLA 1GNYA 3D4KA 1RMU2 3NQHA 1WLWA 4DEVA 4XXAA 2BFUL 1XB9A 4UFMA 5JXJA 4ASMB 5JAXA 4DXSA 2RS11 5IVYA 3CL1A 4LMFA 4ITCA 1W8HA 4NPRA 1MR5A 5BNNC 1H4HA 4RN5A 1XNTA 3MEPA 2F4LA 2YZ4A 1B35B 5KXEA 4X8NA 2JG8C 4H55A 2DUPA 2XJQA 3VZLA 1PO11 2ZGTA 2ARBA 4R9BA 1Q3EA 1Y9QA 1ASJ2 1ULEA 4XABA 5LA1A 2OVUA 1VRH3 2NP0A 4FAGA 3KMHA 3LWCA 2W1UA 2C1FA 3IN9A 3CMGA 2UWBA 3GBGA 4DUWA 2VW0A 4M4PA 4Y1ZA 1PO12 4JX0A 3WDXA 3JD73 3LD8A 4BQ1A 1W3VA 2VNVA 3WUCA 4FTSA 3SLIA 4YVWA 2R042 4FPGA 1CIYA 2L9LA 1CN1A 3VD5A 3ZFGA 4LHKA 4ZS2A 1QOOA 3D82A 1AYM2 2Y6JA 2XONA 4I02A 4CDUC 1JYXA 2PHLA 2PHTA 3AMHA 3LEMA 3AZZA 1OPMA 1LOGA 4AEDC 1V6NA 2WO2A 3AP5A 1QJZA 3CJIC 3KCXA 1A8DA 2PYTA 1F5JA 4B3NA 1CONA 1Z7S3 2WO1A 3ACHA 4FOWA 3AKTA 4L99A 4YWAA 1XE7A 3JB4C 1DZRA 2YMZA 2JKBA 3CBNA 1NZCA 5JPMB 4NO4A 4CCCA 3ELNA 4WV8A 4E9KA 1MZEA 5BYNA 1H2KA 3NAPA 5GM0A 4ISQA 4YVWB 4XIOA 2VVEA 1EP0A 4MXWA 5FAXA 4QMAA 2EXHA 2YPDA 2WDBA 3UKNA 1A6CA 4H3WA 2BNMA 4FPFA 5B4XA 5FZ1A 2Y6HA 1JYVA 1D4VB 3SKJE 1C8M2 2FQPA 3ZR6A 4L0PA 3VDBA 4OZXA 5T52A 4OZOA 3POIA 1IKPA 5FP7A 1K45A 2LS6A 4Q4V1 2XBO1 1XNKA 2Q8OA 1FPN1 5FP4A 4GQ7A 4QDSA 3LSEA 1Q8OA 5KHHA 3NAPB 4R8HA 1RUG1 1GP6A 1SLBA 3RZHA 2VZQA 1L7QA 3FWEA 3NW4A 4K8RB 5FPZA 1HJFA 1RJ8A 4OMDA 5C5TA 3K75B 1SDDB 1QJU1 4IV3C 5CYYA 4XYXA 3WDVA 3ZXGA 5FRAA 4BH9A 3GGLA 3LSDA 2VNOA 3MBWA 2XHNA 2GALA 3RZLA 3CZUA 2WWJA 4O9GA 2AENA 4IV1B 5LEKA 1KEXA 1OFNA 1FOD2 3KV6A 3ZKUA 1GR3A 4A7YA 5K0UA 5JPNB 2WSVA 1SPPB 4F8AA 3TN93 3VHRA 2EIDA 2VC9A 2ZPXA 1RIRA 2XBO3 3UKTA 5C9AB 3SEEA 2VTFA 2Q1MA 1HQLA 3KGZA 1EUTA 4XMIA 1WBLA 3D3AA 1URXA 2VVDA 3HBZA 1JZ2A 4YM3A 2JE8A 1HB4A 4WM8C 4CCNA 2A71A 1RUC3 2ARCA 4XPVA 1O5LA 4M0NA 4N9HA 1UOFA 2VTXA 4HANA 4BHPA 1XQNA 5C3SA 3N4MA 1GQHA 5A3OA 1UOJA 5CKQA 3FZ3A 5T50A 3B7MA 4E4SA 1L7LA 4XJ8A 3ACLA 2H6CA 5GJ6A 2GZWA 4LUKA 4U2AA 4NAMA 4Y26A 5GLTA 2IZWA 3B9IA 3F95A 2P3IA 4HKLA 2HBUA 4NR1A 2VAUA 2D43A 2W94A 1Q8SA 1YJLA 1XYPA 4RD7A 4XF3A 4FP2A 4FBFA 2WSUA 1K5MA 1W8OA 4YW7A 3JXSA 4UFLA 5IVEA 4CEWB 4Y22B 5F2SA 3SCGA 4A45A 2B7YA 4HK8A 4FPJA 4UWDA 3MIDA 1H1AA 4GKYA 1TNFA 4BZ4A 3WZ1A 4LA2A 5F3EA 3IMNA 1CZVA 3MUZ1 5L9VA 5A7OA 4H7MA 3UT0A 1NLRA 2VH9A 5FIXA 1Q5OA 5JZGB 1FAYA 3H0OA 2GDFA 4Q4W3 2ZGUA 1J58A 2JECA 4H14A 1DQ0A 5FUIA 1PIV3 3OTFA 1K5MB 5GLVA 5IUQA 1WKYA 2GAUA 2QQUA 4G4FA 3P3PA 1W99A 1OOPA 2HH9A 4BU2A 1AYN2 1R092 3IBMA 4QQLA 1BBT3 2JE7A 5L36A 1HB3A 2Q30A 2VU9A 1R1A2 5C70A 2VE1A 2FDKA 1AUYA 4N43B 4DZGA 1C5IA 3AP6A 4QQPA 2IXKA 4AHWA 4JKLA 2V5YA 2YBPA 5GALA 5A7SA 5D8AA 5DUXA 1MVQA 5GKAC 2OUHA 3P1IA 4Q4V3 5FYSA 2XQRA 4PBOA 1V6MA 2VW1A 1F35A 4P08A 1BK0A 4X6RB 1EUUA 2OKXA 3WG2A 2W39A 5DUWA 1VAMA 4AI0A 3ZYIB 1LB2A 4Y20A 1OA4A 1PM4A 2W5FA 3NKGA 3ZN6A 3PIJA 1TME1 1W8FA 5A70A 1O3QA 3FUOA 2VMHA 3POGA 2ORZA 1S0CA 4XQ4A 2OZJA 5A7QA 3LE0A 2ZOEB 1GOHA 3ZYFA 3AVSA 5A1FA 4TZDA 3MV11 3I59A 2FCUA 1FNZA 2LW8A 2CHHA 2OA2A 5IFTA 4XILA 3D5OA 5D8AB 3RWKX 1ZX5A 1RUJ3 4HZFA 3MDPA 4F3JA 3B69A 5LWBA 2XL7A 5JZGC 3O14A 4HFSA 1H9WA 5J96B 1V0AA 1G8WA 2ZX0A 4B1MA 1DGRN 2XDVA 3ORJA 2GNDA 2RS53 1QWRA 1W6MB 3G7DA 3WUDA 2DVDA 1IS6A 4W65A 2WN2A 5ERLA 4Y5TA 5G04L 1JYWA 1RUOA 3TOJA 4LHLA 1LOFC 2PLV1 1KDKA 1R1A1 3CEWA 4OLLA 4PF1A 1UZYA 1ZRIA 2R6QA 4RSUA 3TN91 1OXCA 2PAKA 3N9MA 3ZSEA 4AVTA 4CDQC 1LGNA 4AI8A 2Y0OA 2A70A 3RNSA 1AR83 4Y3OA 3WP4A 1IPKA 1RUF2 3NAPC 1O91A 4P9JA 5T54A 1NCRA 1PMHX 1X8EA 4CTEA 1JHNA 1QQP2 2Y6KA 2VUCA 4GAZA 5BNOA 1B35C 1PO21 3PUIA 5FUPA 4FXGB 4JGYB 4ES9A 1V9U3 2R072 3HT1A 4AVBA 3M8LA 4EN9B 5L19A 4JQRA 1UO9A 4GZ9A 3W5MA 1OQ1A 4Q29A 1X82A 2ERFA 4YM0A 1AF9A 1GOFA 3BIWE 3AMQA 1DZTA 2HWE1 3HOBA 2QQVA 3O1MA 4LKFA 1JODA 2FDHA 3A0KA 4QPWA 3HIFA 3I4IA 5DAQA 2CGNA 3E6DA 3CDZB 4M0HA 3GZEA 4WVVA 3JUUA 1QJU3 3WINE 4NIAA 1HXS2 1XBFA 4RQPC 1AL23 2AGSA 2HWE2 4R9AA 2AYHA 3ETPA 4IV3A 2DCJA 4HK9A 5DABA 5EJ1B 5FJKA 2WA4A 3WW3A 1RVF3 1UKRA 3NV2A 4JGYA 2ZKLA 1T2XA 3VLBB 4Z2WA 3DEMA 3FN9A 4RGAA 4BA6A 5CIRA 4NWWA 1LR5A 4PT6A 4YLZA 1GP4A 1QJX1 1W8WA 1CAVA 3J9SA 5K0UC 2QQLA 4O65A 4CYDA 2GP3A 2QQJA 5CISA 1ULFA 1HN0A 4G3YC 1AXZA 1PVXA 3EMRA 3H3ZA 1JHJA 1YQ6A 3M7AA 4ET7A 1T6GC 1W9SA 2YFUA 3A23A 3HWJA 3T3YA 1FXZA 1SBFA 2WS91 2JDKA 2YUEA 2W87A 5FZ7A 1EAH1 3VBSC 3FLRA 1CESA 4QGNA 3HR9A 4WM8A 4YVSB 5FV3A 4EN8B 2XJRA 1AR91 1UOBA 3URFA 4ZKTB 4WM7C 4B7KA 3WW1A 2ARXA 4JTOA 2RM21 2YHJA 2NMOA 1AR72 3NJVA 1RUE1 5GLZA 1HJGA 3M4FA 2XPJA 2O0OA 4FFFA 4LEJA 3RJ2X 3ZYBA 1W2UA 2ZX3A 3N7LA 5FY1A 1VBE3 2Y0IA 3POEA 5FLHA 4CDXA 4YZ2A 3O1RA 4A6SA 3FBMA 3VL9A 4W6XA 5F6KA 3HVDA 1K5MC 1JBCA 3WF0A 4LK7A 3LFIA 5LATA 3SMHA 1OVSA 4MSVA 1QJY1 1C8NA 4C90A 2DV9A 3PIGA 3INAA 4O7XA 2DUOA 3G6JB 4KWKA 5IAXA 1EV11 2D97A 2ZTNA 3ST7A 3PUAA 4K21A 5FYTA 3ENRA 4PI0A 4Q4X1 3C8XA 5JI7A 3CF6E 4AVAA 5IK4A 2MHFA 2R073 3S7EA 1CX4A 1AX2A 2VZSA 3ES1A 4BDVB 4BPZA 4CEWC 4CU6A 1QQP1 2HWB1 4M3CA 1JUIA 1HX6A 3AL5A 5DAWA 3V65A 4DPNA 1J1TA 1KS5A 4HL0A 3TAYA 4D7TA 2ZGKA 5L7OA 3W9AA 1NA1A 1I1EA 2D40A 1SG3A 3VBOA 2TUNA 1COV2 2YYOA 1S1AA 1NLSA 2OX0A 4IEPA 3AZYA 2BYVE 3N9OA 4Z82A 1H0BA 1WCUA 1S0GA 3RZJA 1N3OA 4IE7A 3P3NA 1UYZA 1NXMA 2NMNA 1JU3A 2HWB2 2OIIA 4XURA 3PNAA 1EYBA 5LBEA 3RJRA 2W52A 1WW7A 2ZEYA 2RV9A 4IV1A 5JWPA 4I01A 5C9AC 4Q4Y2 2CGPA 1WMXA 2XUMA 3HNBM 1BEV2 1D7PM 3C7EA 1GWKA 4XUPA 5F2WA 3O1PA 1X33A 4KBZA 1O4YA 2R7EB 2IXJA 4YGCA 2KD7A 5AVAA 2R49A 4LE3A 1NA1B 4GB33 4N53A 1KRIA 2D5FA 4DXTA 2OYZA 5AC91 3KS7A 2D3SA 1LU2A 5EYXA 1UU4A 2XWBB 1ODMA 2ZAAA 1BJQA 2IVIB 2QQNA 1LULA 2QKDA 3J8F2 1KGYA 4PDWA 4OVEA 5FPLA 1V6LA 2W0XA 4AXOA 4A4AA 5FY4A 1L3JA 2WS92 2BW8A 3HQUA 4IEOA 1W8NA 2X5IB 4CEYB 2PELA 2DVGA 3EXUA 2RDQA 4ZY9A 1KITA 4KQ7A 5A3TA 2ARAA 4L92A 2I2SA 1JI6A 5G05L 1G86A 1UY3A 1DG6A 1UU6A 4UF0B 3ZXDA 4ZZ8A 1OI6A 5K4LA 3UKVA 1YIFA 1O4ZA 1NUKA 2ZZQA 2VZUA 3N7JA 5HV4A 5IAVA 2BWCA 2VUJA 3H1WA 3W20A 1DQ2A 3VBHA 1OH4A 2E9QA 4JCKA 2MNGA 4AGRA 4P9GA 4CP9B 4ASKA 3TEWA 1QMJA 4XUOA 4YSFA 3BU7A 4LULA 4XQDA 5FZEA 2ZGNA 4B4QA 1VJ2A 3VKOA 3ZMOA 1Q8PA 3MFAA 3B5LB 3ZFEC 1ZBE3 4WBBA 1WCQA 4MO3M 5EYYA 2RS13 3T1MA 5DXDA 3D0JA 3PJQA 4PLNA 5CBLA 1CAWB 4YW6A 3UGFA 1PGW2 2WQZC 3RS6A 1OLRA 3UJOA 1ONAA 4EN0A 2ZX1A 4P9XA 1ND2B 4Q26A 5C4WA 4IE5A 1IG0A 4CP9A 1W6OA 4Z1VA 5C3PA 3O5SA 4TSVA 4QM9A 5SV5A 1QOTA 2RMU1 4Q1PA 3MW2A 4XAAA 1XNDA 4N90A 3HN1A 1ULPA 1XPWA 1Z7S1 3MICA 1OPOA 3M3CA 4SLIA 5C5UA 3BOWA 2FMDA 1C8M1 1IOAA 1I5PA 1QDCA 1VALA 2ZBJA 2OW4A 4G9SB 2BTVC 4Y20B 2HEVF 1AYM1 4B4PA 3ZN6B 3MW4A 5FK8A 2WZPP 3OBRA 4P5HA 2EAAA 3PVNA 4RHV1 4ATFA 1QHDA 3ACIA 4XF9A 2DURA 3O1UA 3M1HA 2WT1A 5I8SA 3D6EA 1S2KA 1RVF1 4UFJA 1FYUA 1TME3 2DBNA 3I2FA 4QWNA 5FO8B 5JR2A 3TN92 1BHGA 4KG0A 1QU0A 2LUWA 3I59B 4A3ZA 4QQOA 1COV1 1C57A 3FHQA 4PJYA 4Q0UA 2FDJA 3LA3A 4WZFA 1RUNA 5JR7B 5E1RA 5FWEA 2LALA 3WNPA 2VZ1A 2CV6A 2AH2A 5FBZA 2A6ZA 4AEDA 3C7FA 2J42A 3RYRA 4R52A 5FJHA 5K7PA 1CPMA 1W6MA 2TBVA 1OURA 2GU9A 1WGPA 1PO22 3TBDA 5C3RA 5JSRA 2QE3A 3J8F3 4LORA 3E5UA 3TNPB 4Y1VA 1PVC3 2Y60A 4R4ZA 3ZDSA 1OLMA 3WCRA 2V4VA 1JZ8A 2WNVC 3A7QA 1FPN3 4PIZA 2FDIA 3D8CA 3MZHA 4UT5A 2JEMA 4OHZA 5ACA3 4BMBA 4OYUA 2VMEA 4LOSA 4Z2AA 4PLOA 4JVAA 4INDA 3RQ0A 3ZO0B 1OD3A 1RXGA 4Q4V2 2IWGB 4K20A 2GP5A 1NCRB 2JDHA 4XDQA 4R4XA 3APBA 4C1XA 3CLPA 5HCAA 3BTZA 3Q8FA 1NAEA 2C26A 4XVHA 5GLWA 2WJSA 3OG2A 2MEV3 4RS5A 3R6SA 1W9WA 4J1WA 5FZOB 5HXVA 2ZAHA 1K3IA 5CKMA 4CCOA 3W21A 2DFCA 1ND2C 5A6YA 3VBSB 4AHXA 3FJSA 4E2QA 2WQ4A 4FVVA 3GJAA 2Q4SA 3HNYM 4XFFA 2K46A 5LA2A 5FZ4A 4XF1A 5F1RA 5A7PA 4QXCA 4EZHA 1JXNA 2G9FA 3O1VA 5FTTC 3ZFGC 5FBJA 1TE1B 5FK7A 3KD4A 4YGDA 4XFCA 1LHUA 3KT1A 1LGCA 3Q8BA 1YEWA 3FBYA 1YHFA 4MGZE 4CRQA 3NNMA 3H8XA 2G9GA 3B94A 2PHWA 4IQPA 3V0AB 1UMZA 2VMDA 3GZTB 3V64A 3OGSA 4BQ5A 4O9EA 5FZOA 1OOPC 3H3UA 4QKFA 4XTPA 1PK6C 1W03A 3T2TA 2BZDA 3EQEA 5BY5A 5EZWA 3FHIB 2WC2A 4XF4A 1AL22 2WT2A 1TMF2 2ZGMA 5B4NA 2NN8A 4QPIC 4URTA 4XJUA 2W91A 1ZVFA 1H6XA 4NHXA 2WZEA 3U4SA 1UPSA 1IPJA 2ZX2A 4FAHA 2Q8DA 4COVA 1SCSA 1K12A 2V72A 3LIGA 1IPSA 1AL21 1UD1A 1GWMA 4AEMA 2VXJA 1W6PB 4Y24A 1PMIA 3GCXA 2RJLA 4I0WB 3AX4A 2O8OA 4MADA 1F2NA 4OUEA 1BVVA 1H1IA 1SLCA 1VRH1 5FZ9A 5I0UA 4YYOA 4XUTA 4D6SA 2VVFA 1KFXL 2QQOA 2W08A 1O3RA 1RXFA 4KL1A 4QHZA 2JJ6A 1NKGA 1LCLA 2VMGA 3T2OA 5I8YA 5EJ3A 5DAVA 1CX1A 2PQSA 3THCA 3AVRA 5IYYA 1SMVA 1OKQA 4YNIA 2ZHLA 3AYAA 1E5IA 2PHXA 3FLPA 4RA0A 4LBQD 3KB5A 4AQSA 4P00B 3ZSLA 4CDUB 2E26A 1Q8QA 4HN0A 1G6NA 2JD4A 3FE5A 5JOZA 4QX3A 5H9SA 3WNNA 3IT8A 1CVNA 3SNMA 4XJ9A 2HBTA 1RUE3 4F83A 5T5OA 5EQUA 2JKXA 2IFRA 2RMU3 5JIUA 1FMD3 2VUDA 5I0TA 1CWPA 4LE4A 1G7YA 3RRDA 4RHV3 4W6WA 3BPSA 3H8OA 2Q8CA 1WLTA 1HLCA 2DWRA 4GMP0 5JXGA 1W8ZA 4HONA 4AQTA 1C8M3 2WS93 3VBOB 3ZDVA 4BYYA 3BIEA 5KHIA 4PIYA 2JG8B 3PJYA 1TG7A 1UY2A 2WO3A 1GFF2 4OULA 3BYWA 3LCPA 1Z78A 4V1PA 4AFMA 1KS4A 5FPVA 2A6WA 1UXXX 2W9XA 2WO7A 3M2MA 4QX2A 2E7TA 3V56A 3RZKA 3ACGA 2W3JA 4AHYA 3ITQA 2Y38A 1WW6A 1ZZ9A 3DPRC 5LEJA 4HSJA 1VIWB 3DUIA 1GBGA 2BVBA 3PLQA 1G9CA 1RUF3 2HWD3 2X10A 3CIHA 4IGOA 5EP9A 3GBWA 1BKZA 5CFCA 3HN3A 4AAPA 1HQNA 2D98A 2PXJA 3BCWA 4GKXA 3SITA 1DFQA 4XEZA 2WINB 2XB6C 1YCIA 2W47A 4JC1A 4PDWB 3BGAA 1DCSA 1NX9A 3ZN5A 5JIAA 3WW2A 3M70A 5CA6A 5F3CA 1K5JA 3KVBA 1AJKA 3HJRA 4YG6A 5HV0A 3WHTA 3IM0A 2VECA 1RGSA 1X9PA 4COYA 4B8EA 2RDNA 1V9U1 1VB2A 2XLAA 1CGPA 4JAAA 4FSJA 2VCCA 4LTAA 4KMQA 4QPIB 4CP2A 3ZIXA 4DNYA 4XCAA 1DGWX 1LGBA 1OLME 1PIV2 2CNAA 1QNYA 4UF0A 5FZ0A 4AEJA 1BVP1 2V09A 1UZZA 4CSWA 1WUVA 4MGTA 1BMV1 3SISA 3O0VA 1SEFA 3NV1A 1YQ2A 5D2AA 2QDRA 3OSDA 1R083 1VMFA 5FP8A 3FC0A 4NIDA 5AC93 5F6LB 1Q8VA 1OSGA 3EYPA 3GXUA 1V6JA 4JGZB 3VBHB 2YG0A 2ZMKA 3NSTA 3S6PA 3EB7A 4L9BA 3RFRA 1XU1A 2ZEWA 3DYMA 3KWVA 3AXEA 1XJAA 4A7KA 1W2TA 3LEGA 2EIEA 2Q0AA 3O7OA 4J25A 2WIIB 1LOCA 5F5AA 3I2GA 5A7NA 2JG9C 2VOTA 2WBKA 2QVSB 5LY1A 2OQ6A 1RTVA 4EWAA 2QQKA 2XKOA 4COUA 1LTEA 3AK0A 2H6BA 2EICA 3J7LA 3SEPA 3WQ7A 4BXSV 4X6QB 4QAWA 3WDUA 3WLUA 4FQ4A 4FI9A 4BQ4A 2W92A 1MS5A 4OCTA 4MX3A 1FX5A 4P14A 4GJYA 2JXAA 4RFT0 2YGMA 1UYXA 3MGUA 5T5LA 1NQJA 2OS2A 1WMDA 2OT7A 3J4UH 3OUHA 5IWFA 3DKQA 3SH4A 2CYFA 1IS3A 1LOFA 3OD0A 2BGOA 4XFGA 5E8AA 2FBEA 2EXKA 3NNJA 1S4CA 4EV0A 2E53A 5LA0A 3W58A 1LESA 1W04A 1Y43B 3AYEA 4QQ2A 4HMZA 1A78A 2VOWA 1H9PA 1ZRRA 2CTVA 1FOD3 1YFYA 4OI0A 5FP9A 5L9RA 4ONUA 4UW4A 3HD8B 5FXZA 2P37A 3ZFFA 3WCSA 1LHOA 3AKPA 3QH6A 4AOCA 1OMIA 3UGGA 2W46A 3SH3A 4BJ0A 1O7FA 5J36A 2WRAA 3RVHA 3ZOIA 2AEZA 1BEV3 2YC0A 1W0PA 4XBQA 4CDXC 1YQCA 1W6QB 2C9KA 1H1MA 1RUJ2 2E6VA 1GSLA 2B45X 4CCMA 1F4HA 2RHPA 5J3UA 4Q4W1 1JYCA 3F2ZA 1LKNA 3PTRB 4MXWB 2LRPA 2QZ2A 2QUOA 3OBAA 1PZ8A 2LROA 4Q4X2 1F9KA 1V9U2 5FZFA 4EQVA 3TYJA 2VO5A 1NY71 2ZEXA 1AXKA 1OQEA 1R082 2J1VA 5DDJ2 2CWMA 3TRSB 1AR63 2VPVA 3KSCA 4IESA 3DGTA 4AFCA 2C9AA 3NMBA 3R05A 3IAPA 3AZVA 2CDOA 4CU9A 5JUVA 2R30A 1PK6B 4CUAA 1VBD1 4Q0QA 1W6QA 3KHBA 1SQ4A 4M4RA 3SH5A 1OD5A 2WN3A 2VZVA 2WZR2 4EN7B 1S55A 2W2IA 1N47A 2VBBA 4OI4A 4PQQA 3K48A 4RS5B 3RYKA 1WW4A 1HRI1 1R081 2UYAA 1JUHA 1RHI1 2EAKA 2WWUA 2XVKA 3VBSA 1O5UA 4TTGA 5J7MA 2R32A 3O1OA 4NRMA 3UGHA 1H8TC 2WZR1 4CCDA 4P9IA 3OUJA 1XYOA 3IDBB 1XE0A 1AL0G 1RYYA 2R043 3LB9A 4DRVA 3IPVB 2BOJA 4F7ZA 2VD7A 4ZXEA 2QQPA 2P17A 2V73A 1MACA 3MI8A 3H1YA 3PTYA 1P8JA 1PO13 1W6NA 4IEXA 3VBFA 4EJRA 3U4XA 4KBBA 1N3QA 3VL8A 5C9AA 3J8F1 4ZU7A 5A3UA 1W28A 1WBFA 1REFA 2HWB3 5GZFA 3SXWA 2B8MA 1W3XA 3FL7A 1LJ7A 1QJX2 1PO23 1YWKA 4N53C 4S2HA 1PGSA 4LJHA 2R071 1PMJX 1W9TA 3OGVA 4NHYA 4QHOA 1PVC2 2IFWA 2WYSA 3K77A 1COV3 2K2SA 4Z92B 3KF5A 1HW5A 1KDMA 3I7DA 3BTAA 1W39A 5CEHA 1JS9A 4FFIA 4NIIA 3IPVA 3FFZA 2BBVA 1W6NB 3RMXA 1YFUA 2X5IC 4YW1A 4CEYC 1PGL1 2ZCWA 2PHRA 3E6BA 4CEWA 4KH9A 4M00A 1UN1A 3POWA 5FZ6A 3H3LA 5KC6A 5FYYA 5C8CA 4GALA 5DDJ3 1O3SA 1Y9GA 3IB3A 4R9CA 4CDQA 2Y64A 5L7OC 5J98B 1AR81 2G4IA 2Y8KA 2Q1ZB 1HRI3 1ND3C 2SLIA 2CAVA 3MO4A 3POJA 2PAEA 5LASA 3N35A 3T30A 3MV01 3EJKA 1NG0A 4Q4W2 1WCKA 3ACFA 4AGGA 1ENSA 1PHMA 3TEYA 3WSOA 5CG8A 2BU9A 5LRRA 1ST8A 3WOGA 5A3LA 3BTXA 2N7GA 1QEXA 2DYCA 2QQWA 3MFCA 4C91A 1TEIA 2B9UA 4JKKA 2OUJA 4LR4A 1HXS3 1MS1A 4IV1C 1D4M3 5FYIA 2SBAA 1EV12 3VBFC 4ZXKA 3ZX7A 1UL9A 1GZTA 4AL9A 4CCEA 1G9DA 5C8CB 1OC1A 4XXPA 4IERA 4LKSA 2VZPA 3WNOA 3I49A 4YW2A 4UYBA 2RE9A 2A6YA 2BVVA 1GZWA 4LLFA 4M3CF 1GP5A 3MYXA 3WF1A 2PN5A 3USUB 5DG1A 5A33B 3JD71 2GC3A 1F31A 5D21A 2WFPA 3U75A 2A5ZA 4K9SA 4DY3A 3N9LA 4ZU5A 1QQP3 4R9DA 5FQ0A 5C3OA 2IXLA 4BMEA 5F8PA 5J48A 4ES8A 1OF3A 3DL3A 1LHWA 2AC1A 3H9AA 5IK5A 4QB2A 4NPMA 1YNAA 1C3HA 1DHKB 1UX7A 3VHPA 3ZFEB 1O3TA 3WQBA 3O0WA 4META 1RVF2 1VMHA 1U5YA 2JD9A 4MGKE 4XDPA 2WUHA 4XTMA 3VKMA 4D94A 4FPOB 1H2MA 3WF4A 4YZ1A 2BJSA 1B09A 2PHDA 3USUA 5T5JA 1Q43A 2JIJA 3ZVXA 1T6BX 1W2OA 3SQOA 2BWAA 1UX6A 3JBG3 4C8DA 4NHKA 1L7RA 5ACA2 1SHWB 1MVEA 5FQ0B 4AR2A 1PIV1 1US2A 2DUQA 1DZQA 5HBAA 2O1QA 4AWDA 3N36A 4LBKA 1UZVA 3AFGA 4P9WA 3POBA 3ZFEA 3QACA 1JOPA 4IE6A 4IE0A 2Z5WA 5JOWA 3BOPA 2VBPA 3IMMA 1ZREA 4DOUA 4GB32 4WVWA 5BNPC 1BLZA 3ZXEA 1DGLA 3FX3A 2HJIA 5T55A 5FXWA 2PAMA 1W0NA 1W90A 4A41A 1MEC2 4LLOA 4QPIA 3RWNA 1LEDA 4DMIA 4N43C 2EXIA 2O14A 5CAZA 1ZBA2 3RZGA 1SLLA 4UW3A 1FMD2 1CAXA 4XFHA 2ZJCA 5FZKA 2D6LX 3T2PA 3J7NA 4JV4A 4LIVA 4XFBA 3HBKA 2WFF1 1V00A 1RUI1 3LF7A 4IETA 5EWSA 5CNAA 3GHMA 3JCIA 3OBZA 2VQAA 3T09A 2GH2A 2GC0A 5CFDA 4KWLA 1AYN3 1R093 1DGWA 1A8MA 4GWNA 3S0MA 1RUC1 5A80A 2BGCA 4CCLA 1UY4A 1XRUA 3QD6A 3W59A 3U0ZA 3ZXJA 5FMDA 2J1UA 1YJKA 1RUI2 1H4GA 3VBOC 4IUGA 4MVTA 1GU3A 3S5QA 3WR0A 2H0BA 2EVXA 2FZ2A 3NJZA 3ZFGB 1R1ZA 1H8TB 1GNZA 3VB9A 4L97A 3TEZA 2GN7A 2HYKA 2XJTA 3PHMA 2E32A 3GBFA 3VBRA 1ZZBA 2GNMA 5JLVA 3IDEA 2CU5A 4D0QA 4NIHA 1MQTA 1WD4A 3VZNA 5CFDB 1GV9A 5HI0A 3Q9OA 1UNBA 3JBG2 1X50A 5LB6A 3I2OA 1VBA2 2YXSA 1ACCA 3ZSJA 1W05A 2CAUA 2A3XA 4NHLA 4QB6A 4YZ3A 1S2EA 1SLTA 4HLTA 1VRH2 4AF9A 3PMSA 3USSA 1W9YA 3T4VA 3B9CA 4PDWC 3M3QA 4XETA 4OHWA 5DN2A 4N7UA 3VBRB 3S57A 5FYUA 4LK6A 2ZGLA 4DQAA 3VBUB 1AX0A 2HEWF 1ZZCA 1GYKA 3CZJA 1RUC2 3ZM8A 1WWYA 2F6BA 1CZTA 3ZXLA 4GWMA 4OHYA 5F9TA 3KT7A 4KGGA 1VBB1 1ZNPA 2HYXA 3NJYA 3NRUA 5CFDC 4JKMA 4MHRA 1SCRA 2GC2A 1POV0 1WZXA 3MF6A 3R4DB 5C8CC 4QX1A 4K40A 5ANNA 4CCJA 4MYEA 3PMEA 1H2NA 3MIEA 3OCPA 2AR6A 2D7FA 3N9QA 1PM7A 4LO7A 5IT6A 2PLV2 1O6UA 4GULA 1UAIA 4I30A 4IEWA 3AZWA 4JHTA 5H9RA 1O4TA 3LIHA 2PFWA 3GM8A 4W8JA 2E51A 3NNGA 1DBNA 2JDPA 1ULGA 1OH3A 3J7MA 4YZ5A 1VRBA 3OY8A 1RJ7A 5DMYA 1AHSA 1E5HA 1XU2A 3ILNA 4UFIA 5K0UB 4XFIA 3CJIA 2YU2A 3TEXA 2FCTA 1BXHA 1PK6A 5I0RA 5L7OB 1TVGA 4OHVA 4QX7A 2HWE3 1RUD2 3OGJA 4CP1A 2VXRA 2WFF2 4XZPA 1QH6A 4QPGB 3UK9A 4MHUA 3THTA 2JDMA 3NV4A 3RI9A 3PL0A 2RR12 1UMHA 1OHFA 2TEPA 4BQ2A 1H2LA 2OPWA 3E97A 3HMYA 3DCQA 4L2NA 4Q4Y1 4YGBA 5GLUA 3I3MA 4NAOA 5FCCA 4QDRA 3DKWA 2HWC3 4N8MA 1ZA4A 5E89A 4A7ZA 5FPAA 2WLQA 1PVC1 3POSA 4HSLA 4HVOA 5BNQA 1KQRA 4FXKB 1NYWA 3CJIB 1W06A 3CJXA 3WNMA 3WDTA 2KXLA 1RUI3 4JDNA 2C24A 4N53B 4GIQA 3OUIA 1VPHA 1F5FA 3RMYA 5F3GA 3GJBA 3A21A 2CSGA 1IHMA 2VZRA 3IIIA 1LHVA 4YVWC 4LBQA 3GZUC 5FPUA 3QOPA 1R64A 1UQXA 1NOVA 4GA9A 2YDEA 3VD4A 2GMPA 2A75A 2LTNA 1CJDA 5JZGA 3NVCA 2ZGOA 4FTEA 3OD4A 1OKOA 3GHNA 1S0EA 3KZ4C 1HDKA 2HWF3 4Y33A 1QXRA 5FYHA 2VJXA 2Y34A 2HWD2 3T0DA 1U12A 1V70A 3K2OA 3MIHA 3WVJA 1VMJA 1GZ9A 1O59A 3KCYA 5DZFA 4CU8A 5BUVA 1PGL2 1VLNA 1ASJ1 4XW3A 5FDBA 5T5PA 4BQWA 5DPNA 5FZ3A 3VD7A 2NPIA 3T4HB 3JBG1 4JDOA 4UW5A 5LK7B 4XBNA 3NWKA 1LENA 4N43A 4AHZA 2ORXA 4M01A 5LY2A 1DGRA 2IUWA 3AKQA 4RHV2 5DUUA 4YW5A 1JTZX 1E5SA 4NWVA 2Q5TA 3POYA 4ZHNA 2VL4A 3MIGA 1CIWA 3I54A 2RS12 1SBDA 1H30A 5IVBA 1AR62 1IGOA 3U11A 3HT2A 3ZR5A 3KV9A 2P1BA 3LZZA 1LHNA 3H50A 4EWEA 5FPBA 1WCDJ 4XBLA 4Y22A 2J1AA 5FZCA 4A44A 2V4AA 4YARA 3H7JA 3H7YA 4XQWA 1DF0A 4LO8A 4UXAA 1ND2A 4LBNA 4UBHA 3ZXFA 2WZ8A 4AK3A 3NNFA 2HLEA 4AFBA 3BPZA 2XLFA 1G9AA 1DLLA 3WHUA 3O0XA 1LAJA 2Z4FA 1SZBA 3UJQA 1GQPA 4W6YA 4BK4A 4BLIA 5C3QA 1JZ7A 4OUSA 4QKBA 1Q56A 1GZCA 1UPIA 1XNAA 3LDKA 5HXMA 2QDNA 3BVCA 1REDA 5FMOL 2B42B 2ID4A 2HWC2 4LITA 1NY72 4YFWA 3ZPOA 2VBDA 4Q8KA 2ET1A 5FO9B 3WG3A 2B9VA 2IXHA 3A4UA 3GALA 3NKTA 1QXJA 2XJSA 3VDCA 5F7UA 3IDCB 1J3QA 2FDGA 4DB5A 1OOPB 2WNVB 4TLGA 5DQ0A 4E2SA 2AZ5A 1OFSA 2RDRA 3MF9A 3OOXA 4XHXA 4FFGA 2WYFA 5J37A 2F4PA 1GWLA 3WG1A 4CPBD 5M0TA 1VBD2 2KA3A 2GNTA 1HIXA 3K4AA 3T1LA 4ARXA 1OT5A 3LPFA 4YGEA 1POV3 3WY6A 4S2GA 5FY7A 5FZHA 1GANA 3IWZA 4HG6B 1EPWA 3KQ4B 1D0GA 4KGQA 4Y5SA 3T08A 3OGRA 4AEDB 2JDNA 1HRI2 1YIPA 4AQ6A 4WVMA 1Y7BA 3PURA 4Q0PA 4ZS3A 3U10A 1C28A 2VMCA 1RITA 1J59A 1QKQA 2ZABA 2GMMA 3HPNA 4AI1A 3R4UA 4FQZA 2XGXA 4JHZA 5JDBA 5FO7B 3IZOA 5FMOS 1JZ3A 4BWOA 5CG9A 3B01A 1H8VA 4GH4A 4DXZA 4IW3A 2E7QA 2D6KA 4HVQA 1UY1A 4C0HA 4E4ZA 1CAUB 1C1LA 3JQXA 5IK7A 2VOKA 1PNGA 2GN3A 1ZBE1 4IV3B 1VE0A 2UWAA 3L2HA 3VGIA 2RS31 2B4KA 1CJPA 3HAGA 4LUMA 2WQ8A 3OB8A 4JZRA 3UNPA 4HKOA 4WVMB 4HETA 5DZEA 1DYKA 4HPKA 1F15A 3KV5A 2QNKA 5A7WA 4Y1UA 3KM5A 1ZZ8A 3AJYA 3O1TA 3IDAA 1JYTA 1FV3A 4K7JA 1M4WA 1ZA7A 1CQ9A 5FREA 5BNNB 4DUXA 4DINB 1X36A 2VZOA 3BU0A 4S2DA 4B1LA 4QXHA 1YUDA 2WNUC 3AP9A 4TLFA 5IATA 2VOXA 2XMLA 2E63A 1C4RA 2J1EA 2Z69A 2ZZJA 3LA7A 3OPZA 5CU1A 3GNEA 1AYN1 1R091 2W1SA 3VD9A 2A73B 4XFAA 1LNSA 1UYPA 1AJOA 1GMMA 3AC0A 2NQYA 2VW2A 3OGGA 1C1FA 1B35A 1S0IA 2NM1A 3QLQA 4HPKB 4B29A 5DUVA 3GYDA 2R041 1MPXA 5A7WB 4ORFA 3WF2A 4BOWA 1ULOA 5A6ZA 1MEC1 2XVLA 5I0SA 4QGLA 2CWSA 2D6PA 4CDXB 2DVBA 1VAVA 1RUH1 2RDSA 4CU7A 1RB8G 3PUHA 5KHJA 2FCVA 4XMAA 4FPCA 5C33A 1AR73 5K8SA 4XACA 1UZWA 1YFXA 3FFQA 3RSJA 1DYOA 4FOVA 3VDDA 5A32A 5KBFA 5JOYA 5FP3A 3LFMA 1JZ4A 2ZHKA 4GH4C 1TME2 1VR3A 5CFCC 1JOJA 1HKDA 1VBA1 3MLLA 4Y5Z0 5DZGA 2AREA 4MH0E 1RUH2 1AZDA 4XDOA 4E2GA 5LBCA 4C1WA 2C0ZA 1HRV1 2C6SA 1W6PA 3MPPG 2BNNA 4HN1A 2VG9A 4LO5B 2XLGA 2MPFA 3ALQA 2IXCA 1CAVB 3KQRA 5EV7A 1UIJA 2JICA 4UAPA 1US3A 3D0SA 3L9JT 4A3XA 4RFRB 4M3CB 2UU8A 2ETEA 5FKCA 1V6KA 3ZSKA 4QM8A 2DTWA 2F17A 2RM22 4OHXA 1NA1C 1VBC1 5A32B 3VDDB 2ZEZA 2XJUA 3PVBB 4ARYA 4FPLA 2RMU2 3LGRA 2EXJA 1W8UA 1WMEA 4I0BA 1BZWA 4QHBA 2K0GA 4WM8B 5DAXA 3T2QA 1GLHA 3KLSA 4GJZA 1Y3TA 4IGPA 5D1IA 2CGOA 1STMA 1FNYA 1S0DA 4JRLA 2A6XA 3ZYPA 2VULA 1VBB2 3AJZA 4LO6B 2JB4A 2P5BA 4HKWA 4OQ9A 4D7YA 4C0BA 4QGMA 3O12A 4V2WA 4O61A 1ZZ6A 1OUXA 1ZBE2 4UOJA 3K3OA 3U1XA 3UETA 2OZ6A 4QPGC 4QU1A 4XF0A 4KNCA 2TNFA 1W2AX 3N7KA 4GWIA 3VZOA 2ILMA 5FWJA 1YC61 4N9IA 2Z2SB 4FP3A 5AVPA 4L8QA 4AW7A 3PUSA 3AKRA 3ABZA 3CKHA 2ZHMA 5GZGA 5CKNA 3SCHA 2AEYA 2GNBA 4Y1YA 5F5IA 4BQ3A 5KHKA 1I9RA 1KFUL 3T0BA 3MLJA 1UMIA 2YBKA 3ZMNA 3X29B 2X5IA 2QCSB 4CEYA 2XJVA 4FT8A 2DBIA 3GZAA 4W4ZA 2HWF1 3RG0A 3VHNA 3ZIWA 5C6CA 1QJU2 5FOJB 1QIQA
chains in the Genus database with same CATH topology
2WWSA 4XJAA 5I93A 1AX1A 2DVAA 5L73A 2GSYA 2R1DA 3EO6A 1BK1A 2DCKA 1M06G 4XIKA 1POV1 1D0HA 4Z8BA 2YROA 2VNRA 5KXDA 1PGW1 3WG4A 3OF1A 1FPN2 1QJX3 3AYDA 2NZ9A 3RPQA 5A3MA 3ZXAC 4L11A 4MGYE 5AC92 3V0BA 1ZZ7A 2EALA 2MEV1 4UBGA 4LBMA 1UKGA 1WLDA 1DQ5A 3FUQA 4PCRA 2PTMA 2ZGPA 4AVVA 3WW4A 2WT0A 3B93A 2VMIA 3VZKA 2W68A 3JQWA 2JENA 2VY0A 5F5QA 4AVSA 2PA7A 3ZPYA 4Q4Y3 1IS4A 2D44A 3ASIA 4AG4A 3OJBA 5C4WB 5GZCA 5J09A 3QBQA 1OLQA 2HWD1 4EROA 5AFEA 1JN2P 3WNXA 2BUKA 3MPBA 2YV8A 4I2OA 3SHRA 4IEZA 1VBC3 4ISRA 1S0JA 1FV2A 3FLTA 4RS5C 3GF6A 4COWA 1ASJ3 1LOAA 1FT9A 3BODA 4IEQA 3VZJA 4OFGA 3S30A 4IXLA 4FTBA 1DU3D 4JRAA 2WFF3 5E88A 2UURA 1UW8A 3ZYRA 3THPA 4BM8A 2D93A 2HKXA 3JD72 4P9LA 2ZKNA 3QCWA 4NHMA 5GZEA 3KGLA 5KXBA 3WDYA 1D2QA 3UL2A 1Z0HA 1CAWA 1HV1A 1SFYA 1QF3A 2UY8A 2WNVA 2ES3A 4LO4B 1RUE2 3ZFFB 4YG0A 1PZ7A 1X8MA 2B5HA 1CR7A 4SBVA 1DQ6A 3VKNA 3ILRA 2D5HA 3WD5A 4D69A 4YFZA 1QOSA 2UYBA 4FCAA 4N7IA 4DY5A 5ACA1 1ULCA 1DIWA 1NXD1 2FMYA 2XVGA 3I8TA 2DCZA 5HCFA 2BQPA 5EFUA 1RMU3 2RS32 4Q8LA 1MZ6A 3ZXKA 4FO9A 2ZMNA 1YI7A 2DTYA 3LOBA 1I3HA 5FLIA 2Z79A 2CL2A 5JOXA 1BBT1 1RUD3 4AE2A 2P2KA 1ZRFA 2BNOA 4XJWA 4Q0SA 2K9ZA 3R0RA 5BV6A 3ME2A 3AMPA 4YVSC 5CADA 1CAUA 4COZA 2X8KA 1VBE1 4RR3C 3VBRC 4KU8A 2Y26A 3ETQA 4FPYA 1BMV2 1FI2A 4K1YA 1F8VA 2RM23 2XG3A 2XWJB 2JG9B 3PVEA 4XE9A 1QXPA 5DG2A 4AGVA 3WV6A 4BCUA 2R16A 1G9BA 5BNNA 1X7NA 2R1BA 3WP3A 4JGZC 1EPZA 2VOVA 1AXYA 3OBTA 5D8AC 1RUH3 3CO2A 4E4DX 4GB31 2XBO2 1NE6A 3B00A 3SCFA 3WT3A 3DF0A 2A6VA 5JI9A 4XJZA 2A7AA 1EAH3 1UF2C 1ZBA1 4PF5A 1ND3B 2ZGQA 1TNRA 3DPRA 1AR71 3RYPA 1LU1A 1V6IA 2PHUA 4QU2A 1MEC3 2PQQA 4P9YA 2OPKA 3KT4A 1QGLA 4IEVA 4I09A 1REEA 3C3VA 4IEYA 1OA3A 2XHKA 3EHKA 4YVSA 2RJKA 4CDUA 1KD7A 1YO8A 5EXOA 2IC1A 2QFEA 1V6OA 2WL1A 4HT1T 1OQDA 4CDQB 3DPRB 3AMNA 5I91A 3NV3A 4B4RA 5BNPA 3M3IA 4RQPB 4K1ZA 3OYWB 1CPNA 4OI2A 3ZN4A 1R1A3 2FZ1A 2VGDA 2XJPA 2H0VA 3I2DA 1ALYA 3LOIA 1BYHA 2ZX4A 1BBT2 2JG8A 1AYM3 2YGLA 4TWTA 3TWIA 4DS0A 1DQ4A 4YZ4A 5GZDA 1J1LA 3PVOA 1UIKA 5JSPA 1ZRCA 1ZBA3 1TMF1 1JYIA 2JX9A 3WQ1A 1U5XA 1MS3A 4QT6A 1AR93 1EY2A 2UWCA 3IKWA 5KXCA 4LHNA 3OYWA 1SBEA 4PQ9A 1WA4A 5CFCB 1VBD3 5ABJC 2ATFA 2R063 1MS9A 5LK5A 3AP7A 5CVRA 4KG8A 1AVBA 1D4M2 4LNVA 2DU0A 2X29A 1MQTC 4B7EA 2XL9A 1YFWA 4AFDA 2WNUA 1XXNA 4LBOA 1UU5A 4CZSA 2HWC1 3HQXA 3DN7A 3AMMA 5TSWA 2QZ3A 4HBNA 3N3HA 4EN6B 4I3GA 3VZMA 4H7LA 2P3KA 3H1MA 1KJLA 4AI2A 4LT5A 4NOTA 4D3WA 1RUG2 2R0HA 3TB0A 1RUG3 3UV9A 1MS8A 4YG3A 3V0BB 1QJY3 2VUAA 1N1TA 1U5ZA 1DYPA 1MZFA 2RS52 3M3EA 3BALA 3B02A 2ET7A 1E57A 3QH7A 3CNAA 3K51A 4FOQA 1VAKA 1KXGA 1WD3A 3N7MA 4HVRA 1NE4A 1A3KA 2B39A 1CAXB 5ABJA 1D4M1 2JE9A 4GMP3 2R061 2DCYA 1BQPA 2ZA9A 1XYNA 1KJRA 1APNA 1SDWA 1GNHA 3AP4A 2I07B 1HQWA 4MXVA 1SACA 3MLKA 3ES4A 2P3JA 5BXXA 4RR3A 3R4SA 2DF7A 4PBPA 3RDIA 2A3WA 1LECA 4K3UA 1U0AA 4DRRA 2R062 3U07A 4BE3A 1MS4A 1JW6A 1RC6A 1AR61 1CD3G 3VHOA 4Q0VA 1LOEA 4MLOA 2ZGSA 5ABJB 1H8TA 3ZFFC 3EBRA 3WXPA 1FATA 4JGZA 3E5QA 1OA2A 1W6OB 1YXWA 4FPEA 5JSOA 4AFAA 1J3RA 3ILFA 1NQDA 4RR3B 5CB7A 5DDJ1 3MIFA 4Y1XA 4BIOA 4MZUA 1ZYBA 2D6OX 1WLCA 1IQAA 4Q2FA 1QDOA 2KM2A 4IEUA 2DCTA 3B3QE 1LOBA 2B46X 3DV8A 3ZYGA 1N1SA 5KC5A 1DDLA 1NCQC 4EWDA 3ZYJB 4YW3A 3VBUA 2BFUS 4YW4A 4AVCA 2I74A 3BB6A 2WA3A 3CU7A 3ECQA 3MIBA 1VBC2 3WX5A 2NYYA 5JCTA 1DQ1A 3VKLA 4CDWA 2C5DA 3AM2A 3LAGA 3S7IA 4IL7A 2X53S 1LODA 1SLIA 4BLJA 4QXKA 4QD2A 5FOBB 1IS5A 5FLJA 1N1VA 2PLV3 5H9QA 1HRV2 4S2FA 3VBHC 4FPKA 2WZR3 2RS51 3JZVA 5T3NA 1NCQB 2YY1A 3OY8B 2CY6A 4QX5A 4YM2A 4BIFA 4K6BA 1RUJ1 1XNCA 1TQ5A 2WLPA 5SV8A 4UW6A 4CDWB 1S0BA 4QPGA 1FMD1 1YRZA 5H9PA 2JG9A 5HCBA 1N1YA 2RR13 3AYCA 4GMP1 1VBB3 1LRHA 5E16A 1SLAA 2DU1A 5FFOC 3AXDA 1XNBA 3NO8A 1GICA 1BEV1 3AB0A 3MW3A 1NCQA 4AYUA 1ZM1A 2GH8A 3VBUC 2BEOA 4D7SA 3WP5A 1YI9A 1RUD1 2QJVA 3VN4A 2YPJA 1PNFA 2VNGA 4PIXA 4LBLA 4I3PA 1RINA 4DFSA 2O8QA 4PLMA 4U36A 4JTNA 4J1XA 3V0AA 2DVFA 5IK8A 4YRDA 3AKSA 2RS33 4Y4YA 1ND3A 4LBQB 3E5XA 1LEMA 2P34A 1EV13 4M3CE 4A2UA 1NCRC 2LM3A 1U5IA 4WZCA 4QQHA 5BNOC 1AR82 1RMU1 4OUMA 3VBFB 4I0AA 4OI1A 1AR92 1RL3A 4XHBA 4YM1A 2E7AA 1ULDA 5FPXA 4RGGA 3ROUA 2AUYA 4NN0A 3WQ0A 3VUOA 3JU9A 2ZMLA 1S0FA 1RHI3 1WCSA 4J6GA 2VQ0A 4KU7A 5BPXA 1HRV3 5BNPB 4QPYA 1WMFA 4MUVA 4AQ2A 2MEV2 2XKPA 1YYNA 4RQPA 4TYSA 5A33A 1VBA3 3TNQA 4NVPA 4JDMA 4JGYC 1SFNA 3FMGA 2ZGRA 4CP0A 1IKQA 5JMCA 1MZ5A 4Q1RA 4K8FA 1EAH2 4AI3A 1UCXA 2R0FA 1N3PA 2JDZA 3ZSMA 1D2SA 2HWF2 2PHFA 5JVVA 2DFBA 4ZU4A 3RZZA 3LKJA 4Q27A 1S2BA 2D3RA 1Z7S2 1QY4A 2EF6A 3L2YA 3A0NA 4LA3A 4KWJA 3J26N 1RHI2 4WM7A 4XOGA 3WP6A 3VKFC 1G9FA 4MV2A 1QJY2 4Q4X3 4AEKA 1I6XA 1VBE2 4FOYA 1QNWA 1WW5A 2GMEA 1GKBA 3AFKA 4WVZA 2Z42A 1FOD1 3IIAA 5KHGA 1GZWB 2HEYF 2ZACA 3LA2A 1W0OA 3VDDC 4LBJA 4ATEA 1QH7A 5C4WC 3ATGA 1MS0A 2GC1A 1BCXA 2WNUB 5LRSA 4GXLA 4X8PA 4WM7B 1ENRA 3M3OA 4Z07A 4RL7A 4ASLA 3AZXA 5K9YA 1ZRDA 1RUF1 1J3PA 1HXS1 1VP6A 1ENQA 3NL1A 5AFBA 2RR11 1HV0A 2WKKA 3C2UA 3H8UA 4FPHA 5B2GB 1I5ZA 2I45A 5I8TA 2D6MA 2WNEA 4CDWC 4E27A 4GH4B 1JH5A 1ENXA 1XE8A 1YLLA 1C5HA 2ZHNA 1VB4A 1GQGA 1TMF3 2XH6A 3JB8A 2NLRA 2UY9A 5BNOB 5C8WA 3E6CC 2A3YA 2EIGA 2BPA2 2EA7A 2D3PA 2IXIA 2FHRA 3KCCA 5KWRA 2D6NA 1PZ9A 2ENRA 4MGIE 1IZ3A 2ZS6B 1MQTB 3VV1A 3D4KA 1RMU2 1WLWA 4XXAA 2BFUL 4ASMB 5JAXA 2RS11 3CL1A 4ITCA 4NPRA 1MR5A 5BNNC 1H4HA 3MEPA 2YZ4A 1B35B 5KXEA 4X8NA 2JG8C 4H55A 2DUPA 2XJQA 3VZLA 1PO11 2ZGTA 2ARBA 4R9BA 1Q3EA 1Y9QA 1ASJ2 1ULEA 2OVUA 1VRH3 2NP0A 4FAGA 3KMHA 3LWCA 2C1FA 3IN9A 2UWBA 3GBGA 2VW0A 4Y1ZA 1PO12 3WDXA 3JD73 4BQ1A 3WUCA 4FTSA 3SLIA 4YVWA 2R042 4FPGA 1CN1A 3ZFGA 4LHKA 1QOOA 3D82A 1AYM2 4I02A 4CDUC 2PHLA 2PHTA 3AMHA 3AZZA 1OPMA 1LOGA 4AEDC 1V6NA 3AP5A 1QJZA 3CJIC 3KCXA 1A8DA 2PYTA 1F5JA 4B3NA 1CONA 1Z7S3 4FOWA 3AKTA 4L99A 1XE7A 3JB4C 1DZRA 2YMZA 2JKBA 1NZCA 5JPMB 4NO4A 4E9KA 3ELNA 4WV8A 5BYNA 1MZEA 1H2KA 3NAPA 5GM0A 4ISQA 4YVWB 4XIOA 2VVEA 1EP0A 4MXWA 5FAXA 4QMAA 2EXHA 3UKNA 1A6CA 4H3WA 2BNMA 4FPFA 1D4VB 1C8M2 2FQPA 4OZXA 5T52A 1IKPA 4Q4V1 2XBO1 1XNKA 2Q8OA 1FPN1 4GQ7A 3LSEA 1Q8OA 5KHHA 3NAPB 4R8HA 1RUG1 1SLBA 5FPZA 3FWEA 3NW4A 1RJ8A 1QJU1 4IV3C 4XYXA 3WDVA 3ZXGA 5FRAA 4BH9A 3LSDA 2VNOA 2GALA 4O9GA 2AENA 4IV1B 5LEKA 1OFNA 1FOD2 1GR3A 4A7YA 5K0UA 5JPNB 2WSVA 4F8AA 3TN93 3VHRA 2ZPXA 1RIRA 2XBO3 3UKTA 5C9AB 2Q1MA 1HQLA 3KGZA 4XMIA 1WBLA 1URXA 2VVDA 3HBZA 4YM3A 4WM8C 2A71A 1RUC3 4XPVA 1O5LA 4M0NA 4N9HA 4HANA 4BHPA 1XQNA 3N4MA 1GQHA 3FZ3A 5T50A 3B7MA 4E4SA 4XJ8A 3ACLA 2H6CA 5GJ6A 2GZWA 4LUKA 4U2AA 4Y26A 5GLTA 2IZWA 3B9IA 4HKLA 2P3IA 4NR1A 4A7ZA 2D43A 4FBFA 1Q8SA 1YJLA 1XYPA 4RD7A 4XF3A 4FP2A 2WSUA 1K5MA 4CEWB 4Y22B 3SCGA 2B7YA 4HK8A 4FPJA 3MIDA 1H1AA 4GKYA 1TNFA 4BZ4A 3WZ1A 4LA2A 3IMNA 4H7MA 1NLRA 2VH9A 1Q5OA 5JZGB 1FAYA 3H0OA 2GDFA 4Q4W3 2ZGUA 1J58A 2JECA 4H14A 1DQ0A 1PIV3 3OTFA 1K5MB 5GLVA 5IUQA 2GAUA 4G4FA 3P3PA 1OOPA 1AYN2 1R092 3IBMA 4QQLA 1BBT3 2JE7A 5L36A 2Q30A 2VU9A 1R1A2 1AUYA 4N43B 4DZGA 1C5IA 3AP6A 4QQPA 2IXKA 4AHWA 2V5YA 5GALA 5D8AA 5DUXA 1MVQA 5GKAC 2OUHA 4Q4V3 4PBOA 4X6RB 1V6MA 2VW1A 3WG2A 3WDWA 2W39A 5DUWA 1VAMA 4AI0A 3ZYIB 1LB2A 4Y20A 1OA4A 3NKGA 3ZN6A 1TME1 1O3QA 3FUOA 2VMHA 1S0CA 4XQ4A 2OZJA 2ZOEB 4TZDA 3I59A 1FNZA 2OA2A 4XILA 3D5OA 5D8AB 1ZX5A 1RUJ3 4HZFA 3MDPA 4F3JA 3B69A 2XL7A 5JZGC 3O14A 4HFSA 1H9WA 5J96B 1G8WA 2ZX0A 1DGRN 2GNDA 2RS53 1QWRA 1W6MB 3G7DA 3WUDA 2DVDA 1IS6A 4W65A 1RUOA 3TOJA 4LHLA 1LOFC 2PLV1 1KDKA 1R1A1 3CEWA 4OLLA 1UZYA 2R6QA 4RSUA 4CDQC 3TN91 3ZSEA 2PAKA 4AVTA 1LGNA 4AI8A 2Y0OA 2A70A 3RNSA 1AR83 3WP4A 1IPKA 1RUF2 3NAPC 1O91A 4P9JA 5T54A 1NCRA 1X8EA 4CTEA 1JHNA 1QQP2 5BNOA 1B35C 1PO21 4FXGB 4JGYB 4ES9A 1V9U3 2R072 3HT1A 4AVBA 3M8LA 4EN9B 5L19A 4JQRA 1OQ1A 4Q29A 1X82A 2ERFA 4YM0A 1AF9A 3BIWE 3AMQA 1DZTA 2HWE1 3A0KA 3HIFA 3I4IA 2CGNA 3E6DA 4M0HA 4WVVA 3JUUA 1QJU3 3WINE 1HXS2 4RQPC 1AL23 2AGSA 2HWE2 4R9AA 2AYHA 4IV3A 2DCJA 4HK9A 2WA4A 3WW3A 1RVF3 1UKRA 3NV2A 4JGYA 2ZKLA 3VLBB 4Z2WA 4RGAA 4BA6A 5CIRA 4NWWA 1LR5A 4YLZA 1QJX1 1CAVA 3J9SA 5K0UC 4CYDA 1ULFA 4G3YC 1AXZA 1PVXA 3H3ZA 3M7AA 1T6GC 3HWJA 1FXZA 1SBFA 2WS91 2YUEA 1EAH1 3VBSC 3FLRA 1CESA 4QGNA 3HR9A 4WM8A 4YVSB 4EN8B 2XJRA 1AR91 3URFA 4ZKTB 4WM7C 4B7KA 3WW1A 2ARXA 4JTOA 2RM21 2YHJA 2NMOA 1AR72 1RUE1 5GLZA 3M4FA 2XPJA 2O0OA 4LEJA 3RJ2X 2ZX3A 1W2UA 3N7LA 1VBE3 2Y0IA 5FLHA 4CDXA 4YZ2A 3FBMA 3VL9A 4W6XA 5F6KA 1K5MC 1JBCA 3SMHA 4MSVA 1QJY1 1C8NA 4C90A 2DV9A 3INAA 2DUOA 3G6JB 4KWKA 1EV11 2D97A 2ZTNA 3ST7A 4K21A 5JI7A 3ENRA 4Q4X1 5IK4A 4AVAA 3CF6E 2MHFA 2R073 3S7EA 1CX4A 1AX2A 3ES1A 4BPZA 4CEWC 1QQP1 2HWB1 4M3CA 1JUIA 1HX6A 4DPNA 3V65A 1J1TA 1KS5A 4HL0A 3TAYA 4D7TA 2ZGKA 5L7OA 3W9AA 1NA1A 1I1EA 2D40A 3VBOA 2TUNA 1COV2 2YYOA 1S1AA 1NLSA 4IEPA 3AZYA 2BYVE 4Z82A 1H0BA 1S0GA 1N3OA 3P3NA 1NXMA 2NMNA 2HWB2 2OIIA 3PNAA 1EYBA 3RJRA 2W52A 1WW7A 4IV1A 5JWPA 4I01A 5C9AC 4Q4Y2 2CGPA 2XUMA 1BEV2 1X33A 1O4YA 2IXJA 4YGCA 5AVAA 2R49A 4LE3A 1NA1B 4GB33 4N53A 1KRIA 2D5FA 2OYZA 5AC91 3KS7A 2D3SA 1LU2A 5EYXA 1UU4A 2XWBB 2ZAAA 1BJQA 1LULA 2QKDA 3J8F2 4PDWA 4OVEA 4AXOA 1V6LA 2W0XA 1L3JA 2WS92 2BW8A 4IEOA 2X5IB 4CEYB 2PELA 2DVGA 3EXUA 1KITA 4KQ7A 4L92A 2I2SA 1G86A 1DG6A 1UU6A 3ZXDA 1OI6A 3UKVA 1YIFA 1O4ZA 2ZZQA 3N7JA 2BWCA 2VUJA 3H1WA 1DQ2A 3VBHA 2E9QA 4JCKA 2MNGA 4AGRA 4P9GA 1QMJA 4YSFA 3BU7A 4LULA 4XQDA 2ZGNA 4B4QA 1VJ2A 3VKOA 3ZMOA 1Q8PA 3MFAA 3B5LB 3ZFEC 1ZBE3 4WBBA 5EYYA 2RS13 3T1MA 5DXDA 3D0JA 3PJQA 4PLNA 5CBLA 1CAWB 1PGW2 2WQZC 3RS6A 1OLRA 3UJOA 1ONAA 4EN0A 2ZX1A 4P9XA 1ND2B 4Q26A 5C4WA 1W6OA 4Z1VA 3O5SA 4TSVA 4QM9A 5SV5A 1QOTA 2RMU1 4Q1PA 3MW2A 1XNDA 4N90A 3HN1A 3MICA 1Z7S1 1OPOA 3M3CA 4SLIA 3BOWA 2FMDA 1C8M1 1IOAA 2ZBJA 1QDCA 1VALA 4G9SB 2OW4A 3RI8A 2BTVC 4Y20B 2HEVF 1AYM1 4B4PA 3ZN6B 3MW4A 2WZPP 3OBRA 4P5HA 2EAAA 3PVNA 4RHV1 4ATFA 1QHDA 4XF9A 2DURA 3M1HA 2WT1A 5I8SA 3D6EA 1S2KA 1RVF1 1FYUA 1TME3 5FO8B 3TN92 4KG0A 1QU0A 2LUWA 3I59B 4QQOA 1COV1 1C57A 4PJYA 4Q0UA 4WZFA 3LA3A 1RUNA 5JR7B 5E1RA 2LALA 2CV6A 2AH2A 5FBZA 2A6ZA 4AEDA 3RYRA 4R52A 5K7PA 1CPMA 1W6MA 2TBVA 2GU9A 1WGPA 1PO22 3TBDA 5JSRA 2QE3A 3J8F3 3TNPB 3E5UA 4Y1VA 1PVC3 4R4ZA 3ZDSA 3WCRA 2WNVC 1FPN3 4PIZA 3D8CA 3MZHA 2JEMA 4OHZA 5ACA3 4BMBA 4PLOA 4JVAA 4INDA 3RQ0A 3ZO0B 4Q4V2 2IWGB 4K20A 4XDQA 1NCRB 4C1XA 4R4XA 3APBA 3CLPA 5HCAA 5GLWA 2WJSA 4RS5A 2MEV3 3R6SA 4J1WA 5HXVA 2ZAHA 2DFCA 1ND2C 3VBSB 4AHXA 3FJSA 4E2QA 2WQ4A 4FVVA 2Q4SA 4XFFA 4XF1A 5F1RA 1JXNA 2G9FA 5FTTC 3ZFGC 1TE1B 3KD4A 4YGDA 4XFCA 1LHUA 3KT1A 1LGCA 4MGZE 4CRQA 3FBYA 1YHFA 2G9GA 3B94A 2PHWA 4IQPA 3V0AB 1UMZA 3GZTB 3V64A 4O9EA 1OOPC 3H3UA 4XTPA 1PK6C 3T2TA 3EQEA 5BY5A 5EZWA 3FHIB 2WC2A 4XF4A 1AL22 2WT2A 1TMF2 2ZGMA 2NN8A 4QPIC 4URTA 4XJUA 1ZVFA 1UPSA 1IPJA 2ZX2A 4FAHA 4COVA 1SCSA 1AL21 1UD1A 4AEMA 1W6PB 4Y24A 1PMIA 4I0WB 2RJLA 3AX4A 2O8OA 1F2NA 1BVVA 1H1IA 1SLCA 1VRH1 5I0UA 4YYOA 2VVFA 1KFXL 2W08A 1O3RA 4KL1A 2JJ6A 1LCLA 2VMGA 5I8YA 5EJ3A 1SMVA 1OKQA 4YNIA 2ZHLA 3AYAA 2PHXA 3FLPA 4RA0A 4LBQD 3KB5A 4AQSA 3ZSLA 4CDUB 1Q8QA 4HN0A 1G6NA 2JD4A 3FE5A 5JOZA 5H9SA 3IT8A 1CVNA 3SNMA 4XJ9A 1RUE3 4F83A 5T5OA 2IFRA 2RMU3 5JIUA 1FMD3 5I0TA 4LE4A 1G7YA 3RRDA 4RHV3 4W6WA 1WLTA 1HLCA 2DWRA 4GMP0 4AQTA 1C8M3 2WS93 3VBOB 4BYYA 5KHIA 4PIYA 2JG8B 3PJYA 1GFF2 4OULA 3LCPA 1Z78A 4V1PA 4AFMA 1KS4A 2A6WA 3M2MA 3V56A 2E7TA 4AHYA 2Y38A 1WW6A 1ZZ9A 3DPRC 5LEJA 4HSJA 1VIWB 3DUIA 1GBGA 2BVBA 3PLQA 1G9CA 1RUF3 2HWD3 3GBWA 1BKZA 5CFCA 1HQNA 2D98A 3BCWA 4GKXA 3SITA 1DFQA 4XEZA 2WINB 2XB6C 1YCIA 4JC1A 4PDWB 5CA6A 3ZN5A 5JIAA 3WW2A 3M70A 1AJKA 4YG6A 3WHTA 3IM0A 2VECA 1RGSA 4COYA 4B8EA 2XLAA 1V9U1 1VB2A 1CGPA 4JAAA 4FSJA 4LTAA 4QPIB 4CP2A 3ZIXA 4DNYA 1DGWX 1LGBA 1PIV2 2CNAA 4AEJA 1QNYA 1BVP1 2V09A 1UZZA 1WUVA 1BMV1 3SISA 3O0VA 1SEFA 3NV1A 2QDRA 1R083 3FC0A 5AC93 5F6LB 1Q8VA 1OSGA 3VBHB 1V6JA 4JGZB 2ZMKA 3NSTA 3S6PA 4L9BA 1XU1A 3AXEA 4A7KA 2Q0AA 3O7OA 2WIIB 1LOCA 2JG9C 2QVSB 1RTVA 4EWAA 4COUA 2XKOA 1LTEA 3AK0A 2H6BA 3WQ7A 4X6QB 3WDUA 3WLUA 4FQ4A 1MS5A 4P14A 4MX3A 1FX5A 2JXAA 4RFT0 2YGMA 3MGUA 5T5LA 1NQJA 3J4UH 1WMDA 3SH4A 2CYFA 1IS3A 1LOFA 3OD0A 4XFGA 5E8AA 2FBEA 2EXKA 4EV0A 2E53A 3W58A 1LESA 1Y43B 3AYEA 4QQ2A 4HMZA 1A78A 2VOWA 1H9PA 1ZRRA 2CTVA 1FOD3 1YFYA 4OI0A 4ONUA 4UW4A 3HD8B 3ZFFA 2P37A 3WCSA 1LHOA 3AKPA 3QH6A 1OMIA 3SH3A 1O7FA 5J36A 1BEV3 2YC0A 1W0PA 4XBQA 4CDXC 1W6QB 1H1MA 1RUJ2 2E6VA 1GSLA 2B45X 5J3UA 2RHPA 4Q4W1 1JYCA 1LKNA 4MXWB 2QZ2A 2QUOA 1PZ8A 4Q4X2 1F9KA 1V9U2 3TYJA 1NY71 1AXKA 1OQEA 1R082 3TRSB 5DDJ2 2CWMA 1AR63 2VPVA 3KSCA 4IESA 3DGTA 4AFCA 2C9AA 3R05A 3AZVA 2R30A 1PK6B 1VBD1 4Q0QA 1W6QA 1SQ4A 3SH5A 1OD5A 2WZR2 4EN7B 1S55A 1N47A 4OI4A 3K48A 4RS5B 3RYKA 2UYAA 1WW4A 1HRI1 1R081 1JUHA 1RHI1 2EAKA 2XVKA 3VBSA 1O5UA 5J7MA 2R32A 1H8TC 2WZR1 4P9IA 1XYOA 3IDBB 1AL0G 2R043 3LB9A 4DRVA 3IPVB 4F7ZA 2QQPA 2P17A 2V73A 1MACA 3MI8A 3H1YA 3PTYA 4IEXA 1PO13 1W6NA 3VBFA 4EJRA 3U4XA 4KBBA 1N3QA 3VL8A 5C9AA 3J8F1 4ZU7A 1WBFA 1REFA 2HWB3 5GZFA 3SXWA 2B8MA 1LJ7A 1QJX2 1PO23 1YWKA 4N53C 4S2HA 1PGSA 2R071 1PVC2 2IFWA 1COV3 2K2SA 4Z92B 1HW5A 1KDMA 3I7DA 3BTAA 1W39A 3IPVA 3FFZA 1PGL1 1W6NB 3RMXA 1YFUA 2X5IC 4YW1A 4CEYC 2ZCWA 2PHRA 3E6BA 4CEWA 4KH9A 4M00A 1UN1A 3POWA 5KC6A 5C8CA 4GALA 5DDJ3</