2O0OA

Crystal structure of tl1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
153
Chain Sequence
GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine, hormone/growth factor
total genus 23
structure length 153
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o0oA01
4OULA 1OQEA 4GIQA 2HEVF 1TNFA 2WNVC 3TYJA 2WNUB 4NN0A 2TUNA 3FC0A 1A8MA 1TNRA 1WCKA 2ZPXA 3L9JT 2TNFA 4G3YC 2R32A 2HEYF 3MI8A 4QQOA 1RJ7A 2ZJCA 1XU2A 3LKJA 1I9RA 1KD7A 4DOUA 2RJLA 4D7YA 5KC6A 4OUMA 3ALQA 1C28A 3AB0A 3B93A 2Q1MA 3K48A 4DB5A 2Z5WA 3IT8A 2WNVA 1JTZX 4E4DX 1IQAA 2QE3A 4MXVA 5BNQA 4F3JA 2RE9A 2X29A 2QDNA 2Q8OA 4QQHA 1D0GA 2WNVB 2R6QA 2E7AA 4MSVA 2JG8C 5KC5A 2JG9C 4OUSA 4TWTA 1U5ZA 4KG8A 1PK6C 4G4FA 4RSUA 1OSGA 1JH5A 3URFA 4QPYA 4J6GA 4QQLA 1S55A 5KWRA 1DG6A 4KGGA 2JG8B 2R30A 2AZ5A 3K51A 2KA3A 1DU3D 1D4VB 1D2QA 1O91A 2OIIA 4TSVA 3B9IA 1GR3A 1KXGA 1OQDA 1U5XA 3ME2A 4QQ2A 3B94A 1U5YA 4MXWB 4HT1T 2JG8A 4QQPA 2JG9A 4KGQA 1C3HA 1XU1A 5L36A 1ALYA 1PK6A 5L19A 1RJ8A 3TWIA 4EN0A 2WNUC 4N90A 5TSWA 2WNUA 4MXWA 3V56A 2O0OA 2JG9B 3QBQA 3WD5A 2RJKA 4E4SA 2HEWF 1PK6B 3QD6A 5CIRA 5HBAA
chains in the Genus database with same CATH superfamily
2WZPP 1RUF1 2PAEA 5DZEA 5FYUA 1HXS1 2HWD2 1OLRA 3AX4A 3KVBA 1LOEA 2BFUL 3VBHC 4OMCA 3ETPA 1PO12 3UK9A 4YM3A 2XHNA 4QHZA 3TN92 4BE3A 1WA6X 5BV6A 2JD9A 1DYOA 2RS52 5AC92 1JODA 4BU2A 5AFEA 2E9QA 3J26N 4LKFA 4META 3L9JT 4BQ3A 5LRSA 1F5JA 2FMDA 2EALA 3R4SA 4M4PA 3PHMA 2BNMA 4HN1A 3LGRA 5LK5A 2ES3A 3O1TA 4IUGA 3Q9OA 3ZM8A 3O1VA 3I7DA 2D3RA 3ZIXA 1QQP1 3TNPB 1Q8QA 3VBHB 1GQHA 1WMEA 1IPKA 3AMNA 4LKDA 2VCAA 4XTMA 2CSGA 4AFDA 3SH4A 2HYXA 1QNWA 1V00A 1W6NB 2ZCWA 5ACA1 1IPSA 1WBLA 4O9EA 5FBZA 3KS7A 2ZACA 3JBG3 1BBT3 4IDZA 1N3OA 2VGDA 3ETQA 5J98B 3GNEA 4KWKA 4ORFA 5F2SA 4NWWA 1C5HA 5FQ0A 1POV1 2D43A 1ND2A 4PLNA 4CUCA 2DTWA 5IAXA 4AK3A 5A3TA 2DBNA 2VZUA 4DMIA 4LKSA 2A6YA 1URXA 2FZ1A 5FREA 5E1RA 1IPJA 1RUH3 2XJUA 5DXDA 5EV7A 3WP5A 2JDNA 3OD4A 1PZ8A 5IVEA 4PLOA 2WFF2 4AQTA 1F31A 1LENA 1PHMA 1ENSA 4DPNA 2WZR3 4CPBD 4ZZ8A 4FOWA 4FXGB 3INAA 2WKKA 1NCQA 2ZOEB 3DGTA 3LEKA 1GOHA 5FYCA 1R64A 2WT1A 2EXJA 1LR5A 5LB6A 1DIWA 2JB8A 1VMJA 3AKPA 3AFKA 3PTYA 1S55A 4MOAA 4QQLA 2VMIA 3HQXA 4K7JA 1OT5A 3U10A 4NIDA 5FZIA 4JGZA 4AI0A 4CUBA 1W3VA 2R30A 5IUQA 3BU7A 1DP0A 3HOBA 1Q3EA 1AHSA 2BP6A 3SCFA 4EN8B 4XACA 1JYNA 2XL7A 5BNNA 5C3SA 3I59A 1PGW1 3CZUA 2VBBA 2GH2A 5CKQA 2J1RA 1RMU1 3GYDA 4E8DA 2D93A 5FLHA 1PMHX 3VUOA 1I6XA 4BMBA 4QHBA 4XJAA 5A32A 1AL0G 5L9VA 4K8RB 2HWD3 3JQXA 1RTVA 3VKLA 3WQBA 3UGGA 4RFT0 3LOBA 1PO13 3P3PA 2OZ6A 1JUIA 5F6KA 3TN93 1QJX2 1DLLA 2GDFA 3PU8A 3TWIA 3I4IA 3O14A 2RS53 3K2OA 5AC93 5JOXA 4PIZA 4P9JA 3AJYA 1O4YA 4MLOA 3RSJA 2FDGA 4MGZE 1X82A 2I07B 4QPIC 5IK4A 2VE1A 5J7MA 3LDRA 3FHIB 2HWE1 4PDWA 4LOTA 4QX5A 2DUOA 2GAUA 3V65A 1JW6A 3AP7A 1E57A 3O7OA 2IXKA 4NO4A 4RYDA 4DXSA 1V9U1 2Q4SA 4RQPA 5T3NA 3GCWA 1LULA 3POYA 4UBHA 3AXDA 4GULA 4R9AA 5FZFA 3A23A 4U2AA 4YW2A 5T52A 1GNZA 2YMZA 4A41A 2P6CA 2IUWA 5FO7B 4OHYA 3ZKYA 1D0HA 2XPJA 1LU2A 1TZOA 2VMEA 1Z7S1 3M7AA 4LEJA 4XDOA 2XUMA 4QPIB 4GKYA 2XOMA 2XUEA 5LA2A 5EIYB 4ZY9A 3LSEA 5JI9A 4GJYA 2VVFA 2QZ2A 2VECA 3HIFA 3MO4A 4IE7A 3RZLA 4AFCA 2W1UA 2K2SA 2D3PA 4Y20A 2HEYF 4IE0A 4L97A 4XF3A 4QDSA 2R7EB 1BLZA 3D8CA 1GOGA 1CZVA 1W6OA 1UZZA 1MZEA 2VULA 3ELNA 5FV3A 3ROUA 4ZZ5A 1MZ6A 1F4AA 1HW5A 4JCKA 4TXWA 2XL9A 1NCRC 4XFBA 3U78A 3PL0A 4AI2A 1K3IA 3G7DA 1JZ8A 3IMNA 1UAIA 2WFF3 3U75A 2YYOA 3VHRA 2NQYA 4WBBA 4RGGA 4Q4V2 1I5ZA 2RR11 2W1WA 3POEA 1C8M1 1SFYA 4CP2A 2LALA 2R071 5LA1A 5FZGA 4XTPA 4YGBA 1N3PA 2IZWA 1LTEA 1IGOA 1AR81 1W9SA 1XNTA 3RZHA 1NCRB 1KGYA 4HG6B 1ENQA 1KDMA 5A33B 3J7NA 4Y1UA 3ZPYA 5F1RA 3CEWA 2VOVA 3HAGA 2BGOA 5F2WA 4R9BA 4PCRA 3H3LA 4Y1XA 4A42A 5FK8A 1CAVB 4EWAA 5FZAA 2OZJA 1UY3A 2YGMA 3FWEA 3Q8FA 4COZA 1ST8A 1DQ2A 4N9HA 5CISA 5DUVA 4NROA 3PJQA 1OLME 4G4FA 1OSGA 2ZGSA 4XFFA 4EZ4A 3AZWA 1UKGA 1QJZA 3EB7A 3I2JA 1QOOA 1RHI2 3NKTA 4IERA 4KWUA 1IKPA 4YG6A 1S0FA 3BB6A 1QJX3 4P9YA 4UW6A 3E6BA 4HK8A 3WG4A 5JZGA 1JZ7A 1ULCA 4Y4RA 4CDXC 1DU3D 2A71A 4AI9A 2EXKA 2H6BA 3BODA 3NVCA 4FFGA 3S6PA 5JUVA 4AOCA 1A34A 1OPMA 2RDQA 3HBZA 1YHFA 3WY6A 3VDCA 4XETA 1BHGA 1VPHA 3DN7A 1W04A 3B94A 3LA3A 5DAQA 5DUUA 1CPMA 4Q8KA 1OF4A 1QHDA 1WA4A 1Y43B 4XUTA 4AW7A 4CE8A 2CTVA 1B35C 2RV9A 1C4RA 2JG9A 1XC6A 3I2OA 3U07A 4BLIA 2F4LA 4CDXB 1BMV1 2C9KA 3ZYBA 4IEUA 1UO9A 1SFPA 1RUI1 4B1LA 1QMJA 2E31A 2XGXA 2DVBA 4TLGA 1ENXA 4E27A 4AVAA 5H9QA 1UYXA 2DFCA 2E7QA 3ZDVA 3VKMA 5C3PA 4BZ4A 4RFRB 4E4SA 5FWEA 5KHIA 4BQXA 1B35B 5E8AA 3DPRC 3M3IA 1V9U2 1WCQA 3AMHA 2ARBA 3JCIA 1Y9MA 2BGPA 2GALA 5LA0A 1PO21 5LY1A 5HI0A 2ZHNA 4AQ6A 4BK4A 3BCWA 3I3EA 3OBAA 3HMYA 2ZX2A 2TEPA 4PI0A 4Q4V3 5JXHA 1DBNA 1OA3A 3DYPA 3VBHA 3ZO0B 5C4WC 1UU6A 4ASMB 4MGSA 5DDJ2 2YROA 4ISRA 4MGKE 1RUJ1 3V0AB 3OJBA 1W6NA 4QXHA 2P17A 3DPRB 4WM8C 3EHKA 1HQNA 1NXD1 2OS2A 4HMZA 4Q4W2 2GN3A 2WNEA 2WAAA 2ZJCA 2YG0A 2DV9A 3C3VA 3NQHA 1D4M1 3NV2A 1YC61 2VQ0A 1UKRA 5A7SA 5FP9A 4D69A 5EPAA 5FZOB 5H9SA 3KVAA 5T50A 5C4WB 1YI7A 2KM2A 4WVVA 2VMFA 1MS3A 1BXHA 1KITA 1ULDA 1XSQA 4B4QA 4BB3A 2B7YA 2BEOA 1WBFA 3ZLIA 3BOPA 3PVBB 4LHNA 4UYBA 4XEZA 1R083 1POQA 5DAVA 4AGVA 1RHI3 3S57A 5FKCA 3R05A 4OLLA 4RA0A 3WNNA 2R072 3AK0A 3WQ7A 1H9WA 4M3CF 4ATFA 1J83A 3BYWA 3MGUA 3I3DA 4Y1ZA 1AR82 5JIAA 5FMDA 4B7EA 4MXVA 2ARCA 3K3OA 3VL9A 2FDKA 5FP8A 2VZSA 5M0TA 2XQXA 5LY2A 1XYNA 2X29A 4IESA 4MUVA 1HX6A 1EPWA 1OKQA 2V72A 1EPZA 3JUUA 4NAOA 1ZRFA 1JHNA 4MSVA 3NJVA 1MZ5A 1GNHA 2O14A 1OH3A 2DCZA 2IXCA 1W90A 3D5OA 3LF7A 4XXAA 1VBD1 2NMOA 3VL8A 3OYWB 2PLV1 5KHJA 4LORA 1S0JA 2UYBA 1E5HA 1C1LA 2KR2A 2ZX1A 3BPZA 2WN3A 3OGJA 1XXNA 2GP3A 4O9GA 1N1SA 4WVWA 4ONUA 4XCAA 3CHXA 2WFPA 4OFGA 3VBUC 3AL5A 1AJOA 5GALA 1D2SA 3R4UA 4KGGA 3MW2A 1VAKA 5I8SA 3SQOA 1QOSA 1PM4A 4AAXA 5ABJC 4MVTA 1O8PA 4CZSA 4I30A 3ES4A 3H8XA 1QXRA 1D2QA 3KD4A 1CZSA 1UNBA 3AVRA 3IDCB 1R1ZA 3M8LA 3GZAA 4KL1A 3DKWA 1V9U3 4RHV1 1S0GA 5SV5A 3OBZA 1CVNA 3FN9A 4XW3A 1RUE2 2QUOA 3PMSA 4HK9A 4E9KA 4JRAA 4WV8A 5A7WA 1QNYA 2R061 2YGLA 1GYKA 3VBUB 1ZA7A 1VBA2 1XB9A 4K6BA 1Z0HA 3IN9A 1C3HA 3JU9A 2BZDA 2YC4A 1DQ1A 2LW8A 5ABJB 1DGWX 1DYKA 5A3LA 1GV9A 1O8SA 1CIWA 1TE1B 2WSVA 1UOBA 2ZGUA 3WUDA 4DZGA 5DDJ3 5ISLA 2OQ6A 1RUI2 2P3IA 5LEJA 1CAWA 4YFWA 2XH6A 3TB0A 2IXLA 3HN3A 2FMYA 4Q4W3 4XFHA 4K9SA 2X8KA 3MV01 1WKYA 3WD5A 1F15A 1U0AA 5EXOA 4PF1A 4UAPA 1VRBA 1IS5A 4LLOA 2PHFA 3RPQA 2FHRA 1QJY2 1UZYA 1TQ5A 3LFMA 1W2AX 2VD7A 3WQ0A 2XHKA 5GLZA 1OQEA 3KSCA 4Q2FA 3PVNA 4Q1PA 1JZ2A 1HV1A 1PO22 5AFBA 2AC1A 2XBO2 3GZEA 3POIA 3LCPA 4ARXA 3FBYA 3WQ1A 1OUSA 5FYYA 2Z4FA 1CR7A 5GZGA 5IVFA 4Q1RA 1TME2 3LEIA 1UF2C 5FJHA 3GM8A 3EO6A 2X5IC 4XBLA 5ABJA 5FYMA 2R32A 3T4VA 1NXMA 5G04L 1AR83 2WYSA 2G9FA 3A7QA 2G4IA 3FLRA 4UWDA 3WHTA 1LOFA 3CJIA 4A7ZA 1YYNA 4DOUA 3MIBA 3DEMA 5KHKA 4U36A 4RS5C 5KC6A 5FZEA 2R042 1VLNA 3AYCA 4QGMA 5FAXA 5CFDC 4J1WA 4XQ4A 4Q0PA 4LA3A 5GZEA 2SBAA 5JOYA 2BPA2 5HCAA 1NCRA 1S2EA 1Y9QA 4GQ7A 1JYCA 2X5IB 2ZKNA 5A33A 2VBDA 3P1IA 3EXUA 4P9LA 4GH4B 2BV4A 3ZPOA 1GSLA 2XJTA 2FDIA 2RMU2 1RUD2 1CAVA 4A7YA 1FV2A 3USUA 3QH6A 1EV12 5JR2A 2GNTA 3E5QA 4YZ3A 5JCTA 5L7OA 1YIFA 4AVBA 1SLLA 3J8F2 4RS5B 2P2KA 5CFDB 1BVP1 1H8VA 3WG3A 3WW3A 2CHHA 4LUMA 2WABA 2JIJA 1L7QA 2R6QA 2ZX4A 1G9AA 1V6LA 1YJKA 4IETA 3WV6A 3FJSA 2AR6A 1COV1 2NPIA 2ZXQA 3ZN6B 2WN2A 1RUE3 5KXCA 5IK7A 4HETA 3GHMA 4M0HA 4XPVA 2PLV2 1VBA3 3AC0A 2G1MA 1CESA 1AYM2 2HWB1 1RUC2 4XF1A 5EHDA 3CBNA 4M3CB 5T54A 4AVCA 3O1PA 1WMDA 5D1IA 1DGRA 3VBSC 1YQCA 4YFZA 4AHZA 2O8OA 1QEXA 2GU9A 4YW5A 1PZ9A 4F7ZA 1H2KA 5F5CA 4CDXA 1MEC1 3NAPB 1YCIA 4QX0A 1FT9A 1EAH2 1WLTA 2YUEA 3B7MA 2HWF2 3SEEA 3WOGA 4ASLA 4DXZA 2EAKA 3ME2A 1HRI1 1HKDA 1QJY3 4RHV2 1RC6A 2PXJA 4ATEA 4BQ5A 2VMCA 4HOOA 5FUIA 2QZ3A 2ZHMA 3KB5A 3PNAA 1L7RA 1VRH2 2R062 3U1XA 1VBB1 1PO23 2ZEXA 1LU1A 1LAJA 2XBO3 1QJU2 4KGQA 3JB8A 3C8XA 4BQYA 1XU1A 3VBSB 5L36A 1OVPA 3O0VA 1H30A 1RVF2 2JDKA 1ALYA 1NE4A 2P5BA 4CP1A 3MIFA 1N3QA 3F2ZA 1TME3 3W9AA 2BWCA 3W58A 2VQAA 4XUPA 4PI2A 3WHUA 2B9UA 2VMDA 3NNMA 2AYHA 1ZX5A 4I3GA 3T2PA 3BIEA 3AKTA 4YW1A 2WLPA 2J1UA 5FY5A 1JXNA 1JYIA 1ND3C 4HPKB 1H1AA 1JU4A 4LNVA 1YQ5A 4ASKA 1FAYA 1PK6B 1QXJA 2PFWA 2BWAA 1CAXA 2P37A 4XAAA 2R043 4OVEA 3RDIA 3O1UA 1CAUB 4ISQA 2WNVC 1GUIA 5FZHA 2ETEA 4QKDA 2LTNA 4COVA 4HZFA 5FCCA 2DUQA 3DF0A 4DO0A 4YVWC 2P4EA 3ZSMA 3AFGA 2RMU3 1RUD3 5FZOA 3DUIA 1AYN2 3K4AA 4L2NA 5C4WA 3VBFC 5HCHA 1EV13 2P3YA 3T2QA 3HPNA 2VU9A 4PIYA 4D94A 1DFQA 4CDQA 2YBKA 3J8F3 3SEPA 3ZXJA 3U0ZA 4BMEA 1UIKA 2DUPA 3RZKA 1X33A 2XG3A 3SH5A 1OPOA 2ZX3A 2VG9A 4IV1A 4D7YA 4I3PA 1TG7A 2EVXA 2CL2A 4YVWB 4CDWC 4XF9A 2VOWA 2WRAA 5E16A 4CUAA 3VBFB 3RS6A 4CCOA 3TRSB 1QF3A 2PLV3 3OY8B 4MGYE 4UXAA 4E4DX 1CX1A 1NAEA 4CXWA 1JUHA 2VCMA 4DUWA 2CWSA 5IVCA 1AYM3 3FUOA 2XWBB 1RUC3 4Y5TA 2JDYA 4HSLA 5JXJA 1AR62 1W9TA 3UESA 4DY5A 4QPWA 1LHNA 4CDWB 3OYWA 1ZBA1 1PMIA 4B7KA 4X8NA 1IG3A 4V2VA 3AZYA 2WAOA 1SACA 1OC1A 2GC0A 3THPA 1EAH3 4Z92B 2Z42A 2HWF3 1YNAA 2Y33A 4UBGA 2ADDA 4RHV3 3ZN5A 2JJ6A 1MQTC 4E2SA 1MR5A 5DUXA 5CB7A 5FPBA 2CDPA 1YFUA 3T0AA 1VRH3 2YFUA 5F7UA 1XNAA 4IGOA 4DRVA 3B3QE 4MGQA 1QJU3 1UU5A 1SLBA 2RVAA 1W6PB 5I0DA 1RVF3 4HLTA 4J6GA 2E53A 2W52A 3H9AA 3VDBA 4YZ2A 1ZZ7A 3BI3A 2YPJA 3RMYA 4YM2A 5FY9A 3FBMA 1S2BA 2VVEA 1GU3A 4A3ZA 3VBUA 4K1YA 2VMGA 4DEQA 2V4AA 1C5IA 4DUXA 3J4UH 1UMZA 1MQTB 4LJHA 3VD5A 3FLTA 2OIIA 3AYEA 1IG0A 1MEC2 1H8TA 4HANA 4IEOA 4WM7C 5IJRA 3RWNA 3T1LA 4AXOA 1MVQA 1W8NA 2OPWA 4C91A 3MZHA 1TMF2 4AGRA 1OQDA 4H14A 2DCJA 2LROA 4D6QA 2ADEA 2BYVE 4PQ9A 1UYPA 4CCJA 5A3UA 1VBB2 4CUGA 4NR1A 3ZFEC 1ULEA 4HKLA 2TBVA 4EWDA 5BYNA 3JXSA 1SHWB 5KHGA 2VQUA 2GZWA 2D5FA 2YXSA 4WZCA 1AYN3 2Z79A 3ZFGC 1R091 1LEMA 3GJAA 4C0BA 4L92A 2YU1A 1UY1A 2DCTA 1OA4A 5F37A 1VB2A 5FKBA 5C9AA 1GOFA 4GMP0 2IXIA 2E63A 2W9XA 4OHVA 3SHRA 1Z78A 3VKOA 2RJKA 3DECA 5LWBA 1BK1A 2HEWF 3T4HB 2JDHA 3ZFEB 1W6QA 3CO2A 4QHOA 5CIRA 4LITA 1W05A 1F8VA 3OUIA 2ZAHA 4GIQA 2IFWA 1S0EA 2PMWB 2CWMA 4IV3A 1EYBA 4JGYA 1UX7A 2VUAA 3SMHA 3IWZA 3ZFGB 5BNPC 4NIHA 5A3OA 2KXLA 3ZR6A 3GF6A 3JD72 1WCKA 3KF3A 4S2GA 1JOPA 1PIV1 3CL1A 2P3JA 1AR63 2BRTA 4K20A 1O7FA 3WNXA 1SFNA 5I93A 3NMBA 5LBEA 1C8NA 2W2IA 5IFTA 3WDUA 1AF9A 1XU2A 3ECQA 4GH4A 4CCLA 3B5LB 1VE0A 1REEA 1WGPA 4BA6A 4LQRA 4YARA 1CD3G 4AI8A 2A6XA 3AYAA 3MFAA 3B93A 4RS5A 1W8WA 1I5PA 1JZ5A 1HQLA 2UWCA 1WW5A 3WDVA 5CA6A 1TVGA 1JTZX 1FMD1 4AFMA 3BTXA 2RM21 3VD4A 4GB32 2WL1A 2XQRA 2JX9A 2QE3A 3I3BA 4H7MA 2VUCA 4JRLA 3MLKA 4CDUC 5C3RA 1OXCA 2RS11 2W46A 1DGWA 1DZRA 3ZXFA 1UPSA 1VB4A 2NM1A 3KLSA 5JPMB 2BW8A 3HNBM 5K9YA 4F3JA 1LHUA 1S0BA 4QQHA 4FVVA 1FNZA 2PHDA 5DG2A 3ACFA 4M3CA 5KC5A 1TMF3 5FUNA 5FUPA 1ZRDA 1J58A 3KCXA 4CVUA 3WNKA 2XB6C 2UWBA 2FCVA 3E6DA 1VBB3 3VZOA 3WF1A 4CDUB 1X7NA 5KR7A 2PA7A 3NAPA 5KXDA 1HRV2 1NLRA 1W28A 3QOPA 3A22A 3OGVA 3CLPA 1W39A 1W2UA 2LUWA 3I2HA 3MIGA 4FP3A 5BUVA 3N9OA 3ZYPA 5KWRA 3VZKA 2GNBA 2Y6KA 4HVQA 1FOD1 1PVXA 4FXKB 4LE3A 2BVBA 1F2NA 2BQPA 3FE5A 1NUKA 2QQMA 4BJ0A 2DVAA 3MYXA 1JOJA 5LRRA 4XC9A 4ZS3A 4Q0VA 4PBOA 3SXWA 4A6OA 3TEWA 4GALA 2X53S 3POGA 1KXGA 3OGGA 3B69A 4K1ZA 5IK8A 3M1HA 5EYYA 4UF0B 4KG0A 2ZBJA 4MXWB 4IL7A 1AXZA 2A3XA 4KNCA 4W50A 3NL1A 1VBC2 2D6LX 5FFOC 4CA9A 3NO8A 4NRQA 4HPKA 3PJYA 4YW7A 2HWC2 3KT4A 1PK6A 5A70A 1RJ8A 3JD73 1A78A 3IMMA 4Q4Y3 5SV8A 5FZMA 3K4DA 1QH7A 3HT2A 1W8OA 1CAUA 1MS0A 3L2YA 4M4RA 4I02A 3I8TA 4QKFA 4XJWA 3WNPA 1MPXA 4K40A 3CMGA 5IVBA 1D7PM 1NY71 1YI9A 2PELA 3PUHA 4P9GA 2JWPA 2Y6HA 1WMXA 4EN6B 2DFBA 4W6XA 2YB7A 5GZDA 5JDBA 1H2LA 3PVOA 3NJYA 4D3WA 3Q8CA 3RGBA 2IWGB 1RB8G 5FXXA 4QD2A 5AVPA 4COWA 2PHWA 2TUNA 4H55A 1HB4A 1ASJ1 1Q8PA 2VBPA 1AL22 3U4SA 2XJQA 1V6NA 3ILFA 1PIV2 3ITQA 4GB33 1Y4WA 3POFA 2ZS6B 3ASIA 4QX2A 1FPN2 1SDWA 2VZPA 4P5HA 1G9BA 3KF5A 1W9WA 3WP6A 4QQOA 1X8EA 4GAZA 3VBFA 3WEZA 4F83A 3PUAA 1UY0A 1ZNPA 1FX5A 2VY0A 4K8FA 4PT6A 3CQOA 4KU8A 2LM3A 2MEV1 2ZEZA 1ZREA 5IVYA 5CFCA 2CV6A 5CBLA 4DXRA 2QQPA 4W6YA 3CJXA 5DG1A 4CCCA 5IAVA 1IOAA 4ITCA 5FPZA 5H9RA 5J37A 2Y0OA 2YV8A 2YZ4A 3QLQA 4GMP1 1RUF2 1ULGA 2VW1A 3N7LA 1HXS2 3ZKUA 3VBOC 4H2AA 2VZVA 2OA2A 3VD7A 2DU0A 4QX8A 3AM2A 1HRV3 5BNOC 5CKNA 4CSWA 3ACLA 1W8HA 4FPYA 5K0UA 3HN1A 4ARYA 4AHWA 2W94A 1CWPA 3ZMNA 1GBGA 3DV8A 1JZ4A 5FYZA 1E5IA 3KMHA 2E51A 4MHUA 3THTA 4UW4A 4ZU5A 1WMFA 2J1AA 3LA2A 1H4HA 3OTFA 1QQP2 4DS0A 4Z2AA 5C70A 5LEKA 3HEIA 4F8AA 1OH4A 5FYIA 5BNOB 4I2OA 3CNAA 2WT0A 5T5PA 3UT0A 2F6BA 4YG0A 5C8CC 3OPWA 2LRPA 3WF2A 2RHPA 2EA7A 5ACA2 2H6CA 1VBC3 4NPLA 5AVAA 1CZTA 2HWC3 2ERFA 3UETA 4FPJA 4UFHA 4FP2A 1ZRCA 3ZSLA 2ZHKA 3IZOA 5FTTC 2P34A 4PBPA 5FZ6A 3AL6A 2XKPA 4N43C 4KMQA 4FPKA 4XAEA 5C33A 1PGL1 2ZZJA 4XVHA 1CGPA 4JAAA 5LBCA 2ZHLA 3T1MA 3J9SA 3H3UA 3FL7A 1X9TA 4FAHA 5HV0A 1PGSA 1NQJA 2AACA 4XFIA 2ZGOA 4QQPA 3TNQA 5JXIA 3J7HA 4AL9A 5DAXA 4ZHNA 1NZCA 3GALA 4UI9L 1VMFA 4JV4A 2XLGA 4CU8A 2K46A 2X10A 2YPDA 1AL23 4N43B 3C7EA 1STMA 1J59A 4CXXA 3FFQA 1BVVA 3O0WA 1FPN3 3AP4A 3OG2A 5FRAA 5EFUA 1CPNA 3LE0A 1GLHA 1Y7BA 3HR9A 4Q5OA 2B45X 3V56A 3VHOA 1ENRA 3QBQA 1OQ1A 2XLFA 3BOWA 5I8TA 5D8AC 3TEYA 4FQZA 4BWOA 1X50A 1PGW2 3TEZA 3VHPA 3WUCA 4P02B 1RMU2 3G6JB 4OHWA 1R1A1 1GQPA 4OQ9A 4AI3A 1ZBE1 2RS31 2WYFA 3SC7X 4ZPIA 1CN1A 4EE2A 1OOPC 4JX0A 1YIPA 1RUF3 2VH9A 4CP9B 1HXS3 3M2MA 3H0OA 1U5IA 5T5LA 4B3NA 3POWA 3FFZA 3ON7A 1ASJ2 4AF9A 4AG4A 4L8QA 1I1EA 3C7FA 5BXXA 2VO5A 2EIEA 2WQ4A 4G3YC 3BGAA 1VJ2A 3AVSA 4V2WA 4YSFA 1RJ7A 5ANNA 2WUHA 5A1AA 3KM5A 4R9DA 1OOPB 1SPPB 2HWE2 4GKXA 3V64A 3RZZA 2A3WA 1QQP3 2JKXA 3VN4A 1C28A 2QQKA 3AB0A 2VNRA 3RFRA 1VBE1 5C5UA 3O1OA 1OMIA 3PDQA 4UFLA 5F3CA 1T2XA 2D97A 4XMAA 2ZGQA 4XJZA 3W5NA 2VW0A 5ACA3 2XONA 1ACCA 1HLCA 3AP5A 1AR91 3IT8A 3S7EA 1JZ6A 1LOCA 3TOJA 1Z7S2 1FNYA 1W8TA 2A75A 4CYDA 3U4XA 1C57A 1POV3 3EQEA 4XCBA 4LO5B 3T09A 4W6WA 1GQGA 5K4LA 4BCUA 2EIDA 2Q30A 2D6OX 3KT7A 5IVJA 3NJXA 3ORJA 3QCWA 2OXBA 1NYWA 4JHZA 4L0PA 3N9LA 1O4ZA 1DLCA 1WLDA 2HYKA 3N4MA 1NT0A 2JG8C 3C7OA 4KWLA 1J1LA 3CDZB 1PM7A 3U37A 1JHJA 2QQIA 5C3OA 5I0SA 4OYUA 1SZBA 3IKWA 2SLIA 4KG8A 4IGQA 1S2KA 2YHJA 2CDOA 4LOSA 1LNSA 4LA2A 4LIUA 3W20A 1F9KA 3H42B 3O1RA 5C6CA 1K5MC 5I0TA 5FPUA 4WM8B 1WD3A 1YLLA 4EJRA 2RR12 1C8M2 4E4ZA 4NHXA 5JLVA 4UF0A 3IM0A 2JG8B 5GKAC 4Y4YA 2ARXA 3UKNA 2D44A 4R52A 4A44A 3VKFC 1D4VB 3ZFFC 3J7LA 1K5MB 4CRQA 3VLBB 4FTSA 2D98A 2VOXA 4NAMA 4AEJA 2VZTA 4AYUA 4HFSA 1RMU3 1W0PA 3SKVA 1V6MA 1MVEA 3VB9A 1PZ7A 1OLQA 1PX3A 1KS5A 3IAPA 4XF0A 2A5ZA 1OUXA 4XDPA 2C4XA 3ZFFB 2WS91 5KXEA 3WP3A 2LS6A 1HB2A 1OVSA 4YYOA 3I2FA 4JDOA 4XQWA 4AQ2A 1PNGA 5CU1A 2O0OA 3T08A 2DVGA 2DVFA 3UJQA 5FYTA 4EWEA 3DCQA 4LULA 4RGKA 2HWE3 5D2AA 1SBEA 4YZ5A 1G7YA 3DKQA 5F9TA 3UYJA 5IYYA 2PQSA 1NG0A 3PVEA 4FPLA 3C7GA 3SCGA 2Y6JA 1TEIA 2WO3A 3DXTA 1OBNA 3TYJA 3BTYA 1KEXA 2H0VA 3NNLA 5JPNB 1AX2A 1W2OA 1ZZCA 4JKMA 1HDKA 1OD5A 1TNRA 1VAMA 5E89A 1BMV2 1Z7S3 2JE9A 4Z2WA 2VJXA 4FPCA 1DF0A 4Q4X1 4A45A 4AAPA 3CZJA 1PNFA 3KGZA 4KWJA 3KHBA 2WIIB 4AGGA 4RD7A 4O61A 4EN9B 2C9AA 2QCSB 3H1MA 1YJLA 1NLQA 3NW4A 4GJZA 4XZPA 3MF9A 4JTOA 1UY2A 3RI9A 3USSA 1I9RA 3LD8A 4PF5A 4Z07A 4E4HA 4QPIA 4OMDA 2RJLA 4QDRA 3MDPA 3MLLA 3VBRC 4TN7A 1C1FA 1UMIA 1UZ0A 2CNAA 4XHBA 1XPWA 4Y3OA 3NKGA 3RZMA 2JXAA 1QJFA 3F95A 3K48A 3AZXA 4SBVA 4S2FA 1W8FA 3POBA 2XXZA 3ACGA 4FOVA 4UFMA 3GCXA 1BK0A 3BTZA 5DABA 5C3QA 1W6MB 2RR13 4CEWC 2J42A 1C8M3 5BNOA 1HIXA 3C2UA 2R073 3C7HA 3KQ4B 5APAA 4NPMA 5HXVA 1RUJ2 3ZXGA 4ZONA 3VBRB 1LJ7A 3ZOIA 2OUJA 5BNQA 1XNCA 3N36A 3NNGA 5JAXA 2Q8OA 2Q8DA 4ZU4A 3KCYA 4MO3M 1D4M2 2Y8KA 2BUKA 3R0RA 4W4ZA 5FPAA 4FTBA 4WVMB 4LLFA 1AR71 2CU5A 4TWTA 3IAQA 5FZ0A 1QXPA 3U11A 5A6YA 4QU1A 4LBQB 5LBFA 1FI2A 3E5UA 1SCSA 3ILRA 2VNVA 2C26A 4QPYA 4LBKA 4QPGC 5DPNA 2GC3A 4YW6A 4W8JA 1AUYA 1SCRA 1XNDA 5EJ3A 1LGCA 2AZ5A 2FDHA 4XFAA 3OCPA 1RUG1 1IZ3A 2HKXA 4JVAA 1W8ZA 2R1DA 1SBFA 5FMBA 4LUKA 4N43A 4IE6A 1RIRA 5J1XA 2XR4A 4QQ2A 1KJRA 1YEWA 1SLIA 2ZGRA 4Z8BA 1O4TA 4GWNA 4QPGB 3NWKA 4KBBA 3H8RA 1REDA 1S1AA 4DRRA 3PLQA 1VBD2 2BTVC 5CVRA 2VMHA 2BGCA 4B4RA 4BHPA 5DMYA 3HQRA 3LDBA 3O5SA 3QACA 2WS92 2XDVA 5FZLA 3WNLA 5JOZA 1RUI3 3HT1A 5CG9A 1WW4A 4QXBA 4QX3A 2PAKA 3PUQA 4AEKA 5A1FA 3MF6A 1UXZA 2UWAA 4XJ8A 2QQLA 2D6PA 3VD3A 1K42A 4AVVA 1GANA 1O59A 2V73A 2QQWA 3K75B 1OOPA 3EMRA 3PIGA 2DTYA 1X36A 1B35A 2ZPXA 2VXJA 5GJ6A 4BDVB 2UYAA 2CGOA 4CCMA 3VD9A 3NNFA 1W03A 1UYYA 2XKOA 2VOKA 5FZDA 3MI8A 1EUUA 1RUJ3 1LRHA 1W9YA 2YU2A 2WSUA 3DXUA 3NRUA 3OF1A 4NHMA 5T55A 4COYA 2WBKA 1H6YA 2C24A 3DYMA 3I2IA 4AQSA 1WUVA 4UT5A 3KGLA 3ACIA 4QX1A 5T5JA 4P5YA 3POJA 3AZVA 1QU0A 2YDEA 3I2GA 5LZ6A 1D4M3 1CJPA 2UY8A 2E33A 4IEXA 1US3A 2XVKA 2GH8A 3AMQA 3PUIA 1IS6A 3AXEA 5F5IA 1NCQC 2WQ8A 3V0AA 3DPRA 3JBG1 1BBT1 4JDNA 1B09A 4FI9A 2UURA 1CX4A 1RINA 4XJ9A 4YM1A 2QQVA 5H9PA 5FPVA 1XRUA 3GXUA 5KBFA 1H9PA 3KZ4C 3VZNA 4XF4A 1ND3B 4CU7A 2B9VA 5C5TA 2P6HA 3NV1A 4LR4A 2FCTA 3RI8A 5BNNC 2GMPA 3AKSA 3N7KA 3HWJA 4MYEA 1NCQB 5FYVA 1OURA 1ULFA 3I3QA 3O1SA 4WM8A 5DQ0A 1BYHA 1D0GA 2WNVB 1QOTA 3KHCA 1VP6A 1FXZA 2VZQA 4URTA 3EBRA 2CGPA 5FZ9A 4AR2A 4Q29A 5L9BA 2CAVA 4Y5SA 1SMVA 4XURA 1VBD3 1JH5A 3I59B 3WINE 2WO7A 3WZ1A 1KFXL 4BH9A 3K4ZA 2VNOA 1RXGA 3RYPA 4FBFA 4KH9A 4OI1A 4PDWC 2WS93 5EQUA 4X8PA 5A32B 1ZZ6A 4Q0QA 1J84A 3PTRB 3MIEA 4I0BA 4LO7A 1WCUA 1V6OA 2C1FA 4LBOA 4RQPC 4HVRA 5FMOL 5IHRA 1RUNA 1YUDA 4TSVA 4LXLA 4COUA 4IGPA 4JZRA 4P9WA 2B8MA 3MUZ1 3ES1A 4UW3A 4GWMA 1U5XA 2R0FA 5CAZA 3IDAA 1GZWB 3RWKX 2WWJA 3GBGA 1CONA 1UWWA 5JSOA 2VTXJ 1ZRRA 1DQ6A 4GZ9A 2P3KA 1COV2 1PO11 1RYYA 4PDWB 3TN91 3RRDA 2R063 3BVCA 3RVHA 1W0OA 2B4KA 2AGSA 3MW3A 2YC2A 2RS51 1EUTA 2R49A 4DEVA 4RQPB 4EN0A 1LOAA 4QXKA 4N7UA 5FZ4A 2HWB2 4FPEA 4QXCA 4RR3C 2W95A 4AFBA 1DCSA 3W5MA 3RYRA 4YRDA 3AP9A 3ATGA 2WDBA 1ZYBA 4MADA 4PJYA 1EP0A 1H0BA 3OBTA 3SNMA 4M00A 4E2GA 2ZEWA 3IDBB 4BLJA 4Y20B 4OULA 4PIXA 1HRI2 3S0MA 1OFNA 1ULPA 2HEVF 1Q43A 5FIXA 4RR3B 1O5UA 4AFAA 3SLIA 5FDBA 5CZKA 1W6OB 4M01A 4MH0E 4NN0A 4LO6B 1A8MA 2DYCA 2GMEA 4IEPA 3B01A 3WDXA 1VALA 3H8UA 2Q8CA 2BBVA 3H50A 5A1LA 2X05A 4WM7B 4LBJA 2ET7A 5IWFA 3L2HA 2VCBA 3H1YA 4CEYC 1QDOA 4C0HA 1DZTA 4R8HA 1MACA 3WCSA 2Q1FA 4ZU7A 1QJEA 4RGAA 3B9CA 3ZYFA 2ZGLA 5ANQA 3SH3A 1O3RA 4BIFA 4O7XA 5LW9A 3I2DA 1DQ5A 4FT8A 3HJRA 2FD8A 5FLIA 2VZ3A 1BBT2 1G86A 2OUHA 5FP3A 2YY1A 2Z5WA 4FPGA 3PMEA 5JZGC 2D40A 4I0AA 4CEYB 2I2SA 3NV3A 5CEHA 3H8OA 1JMUB 5ERLA 3M3QA 3UKVA 3OEAA 2Y6LA 4WVMA 5LASA 1GICA 3N7JA 3BKZA 4WZFA 2D5HA 2N7GA 3N7MA 4R9CA 1VAVA 1DGRN 4LBQA 4W65A 2XMLA 2O8QA 3HNYM 1O3TA 3OUJA 2X5IA 4FOQA 4HKWA 4V1PA 4NRMA 2PHUA 5J96B 1SLAA 4BIOA 4D0QA 5JZGB 5BNPB 4D7TA 2VVDA 5B4NA 3RZGA 5FZBA 2JG9C 2ZKLA 1U5ZA 1DDLA 4QM8A 4OZXA 3AMMA 1COV3 2ZZQA 4NRPA 4RSUA 5CFDA 5K8SA 1HJFA 3LFIA 3THCA 5LA9A 3ZIWA 4BXFA 1G9FA 2WLQA 3GJBA 3Q8AA 4ES9A 3WNMA 1AX1A 2HWB3 2ZTNA 4JKLA 4WVZA 3H7YA 3LAGA 1W3XA 4QPGA 1QGLA 5GM0A 1WLCA 3ZN6A 2HBUA 1ZZ8A 2AENA 1ZBA2 1H1IA 1WW6A 4D6SA 2WO2A 5L9RA 1MEC3 1GR3A 2OT7A 1H4GA 1YFXA 3PUSA 2B5HA 3D0JA 2D6NA 1DYPA 2FDJA 2VOTA 3O0XA 3CU7A 5GLUA 4RL7A 1HRI3 3LOIA 1GFF2 3PURA 3ZVXA 5FZKA 4EN7B 2D6MA 2IVJA 4M3CE 1F4HA 4J25A 4QMAA 2OKXA 2VM9A 5GLTA 2ID4A 4NMIA 2VZ1A 2A6WA 2QTWB 1VR3A 3LDKA 3IB3A 4B4PA 4L11A 4LBLA 2WA4A 4MV2A 4AWDA 4ZKTB 5FZCA 3DYOA 1ZZBA 4BQ4A 5GZFA 1GZTA 3T0BA 5I0UA 3AKQA 2DDUA 3VBSA 4Y1YA 1UY4A 2ORXA 2EIGA 1GWLA 3IIAA 4N8MA 4BQ1A 3FHQA 4BYYA 5EYXA 3BIWE 4YGCA 3WF3A 4MHRA 1HJGA 3ZSKA 1GKBA 4CU6A 2ATFA 3WSOA 4Q4V1 3RG0A 3WW4A 3POSA 2JDMA 1GP4A 1RITA 2JEMA 2VCCA 4XYXA 5FP7A 1JYVA 1DQ0A 3E5XA 4AI1A 1HV0A 2HBTA 4HSJA 3BU0A 1JYXA 4TTGA 2GSYA 1S0DA 1NA1C 1M06G 4XFGA 1M4WA 4OUEA 1YQ6A 1R092 1WZXA 3LWCA 2WR9A 4LO4B 1GMMA 2R16A 5I8YA 2NMNA 4XXPA 4Q0SA 1O6UA 2P1BA 3GBFA 3IPVB 2BBAA 4QKBA 4ZS2A 5T5OA 3N3HA 4B1MA 1ND3A 3MIHA 2J1VA 4FAGA 2QKDA 1NZIA 2I74A 4Y24A 3WDYA 1HN0A 2HH9A 1H6XA 1N1TA 4PHZA 1R081 4HN0A 5JOWA 1NA1B 1RHI1 4Y22B 3AMPA 4R4ZA 4JHTA 4XHXA 2WNVA 2D6KA 5BPXA 3PU3A 2JDUA 3Q8EA 1GZ9A 2DU1A 3X29B 4EYUA 4TLFA 2EXIA 4YVWA 1QKQA 1IS4A 2W1SA 4NHLA 1LHOA 1HB3A 4AEDC 1ZBA3 3OY8A 5FY7A 1GZCA 4JQRA 3ENRA 1JBCA 2E7AA 1YXWA 2ORZA 4NJ4A 2PHTA 2FQPA 2BOIA 1N1VA 3BALA 2HJIA 1RUOA 4FPHA 1IHMA 2W91A 3FUQA 4CDWA 5F5QA 5LCWL 2XLAA 1AX0A 3ZXEA 2ET1A 2QBXA 2K9ZA 5FMOS 4BPZA 5FYSA 5JSRA 1FMD2 4AEDB 2BOJA 2RM22 4S2DA 4XIOA 4D7SA 1MZFA 1GZWA 1K12A 1KS4A 1S0IA 3WDWA 1UZVA 5CYYA 2V4VA 5A7WB 4BQWA 1G9CA 4MGTA 3K51A 4QKNA 3AZZA 3WXPA 2RS12 4EV0A 2WQZC 2I45A 4CPBA 5A6XA 4OI0A 1LODA 1V6JA 4PLMA 5EJZB 2VZOA 3B9IA 3OB8A 5IT6A 1W6PA 3VBOB 2E6VA 4D8MA 2QJVA 1OI6A 1CAWB 3D6EA 1N47A 4M0NA 4BOWA 4DUVA 1IQDC 5A7NA 4LKEA 4N53C 2W47A 1MQTA 4D6RA 5FPLA 1XSRA 3AKRA 4CCDA 3AP6A 3R4DB 5DDJ1 3FZ3A 3S5AA 2D7FA 2A6ZA 3TBDA 2GNMA 4Q4W1 1LOFC 3CJIC 1FOD2 1NE6A 5FY4A 1K5JA 4RR3A 1MS5A 1R093 3VZJA 1Q5OA 1UOJA 5DZFA 3FX3A 4UFIA 4FPOB 1WW7A 4OZOA 5C8CB 4XBQA 5FLJA 3WNOA 3E97A 1UN1A 3Q8BA 4N53B 4IE4A 5FZ7A 3QH7A 4BK5A 1X9PA 5HBAA 4WM7A 4YG3A 5LK7B 5FBJA 3ZYIB 3VDDC 4P00B 2OYZA 3BN6A 2QNKA 4NOTA 2V5DA 2W5FA 4LO8A 5C7GA 3CJIB 1UD1A 1UW8A 2BDRA 2BNNA 5CG8A 5F6LB 3I54A 5L7OC 4C90A 4QT6A 1LGNA 1SBDA 3VGIA 4A7KA 2JECA 3ZFEA 3MHZA 1V70A 3ZDSA 2VUJA 1MS9A 1PIV3 2TNFA 3B02A 2GMMA 4IE5A 2QDRA 4E8CA 4Q27A 5DUWA 1XE8A 2D3SA 2H0BA 3ZFGA 3VDDB 3LKJA 1V0AA 4I0WB 4OQ8A 4CEYA 3KWVA 1NY72 4OHZA 2JB4A 3USUB 1QWRA 1OLMA 3I49A 5L7OB 4INDA 2OX0A 4L99A 4TZDA 3OBRA 5F8PA 3GZUC 1ODMA 3BPSA 3UJOA 5KHHA 2Q1MA 4LHKA 3E1F1 1R082 4MZUA 4UW5A 2Y6FA 1G6NA 4YZ4A 4DB5A 1W99A 1UYZA 3OD0A 2XVLA 4Q0UA 4Z82A 5BNPA 3S5QA 1KQRA 4NHYA 1FMD3 2BJSA 4YVSC 5J48A 2RM23 2VL4A 4H7LA 5CNAA 1UL9A 5D8AB 1Q56A 4XJUA 5DAPA 1QH6A 3A0KA 1SG3A 5IVVA 2RS13 3FHAA 4ES8A 4IXLA 1XOYA 4P9XA 3WLUA 5CADA 2MEV2 1O5LA 2PTMA 2E7TA 1RXFA 4GA9A 2DCYA 2V5YA 5HCBA 1RUE1 1SQ4A 5A6ZA 4OUSA 3W21A 3MIDA 1LOGA 4ET7A 2ZEYA 1G9DA 4NWVA 1VBA1 4YVSB 5F39A 4BQ2A 1ZVFA 3URFA 4A3XA 2B42B 2OPKA 2WO1A 4OI4A 4Y5Z0 1XYPA 4NIIA 5IFPA 4A2UA 3K3NA 2IFRA 4EZHA 1KDKA 4YLZA 1W9FA 2DF7A 2Y0IA 4QB2A 4NPRA 1FOD3 3UGFA 1FV3A 2KA3A 5D21A 4XILA 2WC2A 4AE2A 2BFUS 3OGSA 4DIQA 2Q1ZB 4CDUA 1MS1A 2XJVA 1QJY1 2OQ7A 4XZUG 4C1WA 3LPFA 1V6IA 2ZGNA 4OCTA 3N9PA 4YPJA 3K46A 1MS8A 5JMOA 3NSTA 4YGDA 4YW3A 2XBO1 5JSPA 4GXLA 3ACHA 4DXTA 2UY9A 2A73B 2WNOA 5EWSA 3ZR5A 4CP0A 1TME1 5L19A 1CAXB 4CDQC 3ZX7A 5GLVA 1BEV1 1ZA4A 2CYFA 2XJSA 2WNUC 2KD7A 4IEQA 2W3JA 3A21A 1HN1A 2R1BA 4N90A 1T6BX 2WT2A 4Y33A 5FK7A 2Y26A 3IBMA 1OHFA 4HXCA 3WVJA 4MXWA 5DN2A 5FYHA 4IV1C 1G8WA 4N9IA 1GP5A 3KV9A 1PGL2 2R041 3ZXAC 5FYBA 1CIYA 4LPLA 5FOBB 4ZXEA 2PAMA 3RNSA 3ZYRA 3T2TA 3GBWA 1WD4A 1XYOA 1W06A 4CDQB 1NQDA 3I2KA 3HD8B 2W87A 1TNFA 2EF6A 2GC2A 4Q26A 2GP5A 2WNUB 2IXHA 1Y3TA 3M4FA 4NUBA 2PHLA 2YBPA 5FXVA 3M3EA 4KI5M 2CGNA 4P08A 4GD4A 3A0NA 2RMU1 1RUD1 4LBNA 3IPVA 4P14A 4IV1B 4FOYA 1GWKA 1EV11 1ASJ3 1BCXA 2K0GA 3JZVA 1NX9A 1H2NA 2DURA 3J8F1 3LIHA 1AXYA 3P6BA 3ZYHA 1WLWA 3A4UA 3MPBA 5C8WA 3DL3A 1NA1A 3KCCA 4Y22A 2FDFA 3KV4A 5HCFA 2JENA 3LSDA 2ZGPA 1KD7A 1KFUL 1XNBA 5I0RA 2MEV3 3MICA 2XWJB 5I91A 1L3JA 3TEXA 2EAAA 4AZZA 2RG4A 1JS9A 1KJLA 2OVUA 1R1A2 1J3QA 3BTAA 4TYSA 4NIGA 4JTNA 1ZBE2 2RS32 2MHFA 3MLJA 5IW0A 4AHXA 1LHWA 2OW4A 4CXYA 4GMP3 1LEDA 1U12A 1AJKA 3IIIA 1AYM1 3T2OA 1RUC1 1LCLA 1W8UA 1ODNA 5FPXA 1I3HA 4CTEA 1WCSA 1HB1A 4NE9A 4A4AA 4AVSA 3N9NA 1H8TC 2ZA9A 3ABZA 4R4XA 3I3MA 2A6VA 2Y6GA 4CCKA 1EAH1 2WZ8A 2R0HA 2AUYA 2HWF1 5IATA 4XOGA 4H3WA 1PVC1 1IS3A 1A8DA 3ST7A 4QU2A 1XNKA 4AEDA 1YRZA 1JYWA 1X8MA 2AREA 4ZXKA 1VRH1 3LB9A 4LK6A 2WINB 3CKHA 1ONAA 1VBE2 1QJU1 3D3AA 4UOJA 2EXHA 3S30A 1PX4A 4P9IA 1RVF1 2AEZA 1H8TB 1QDCA 3SKJE 5JIUA 1QY4A 3H1WA 2JDAA 4LTAA 1AR92 2Y64A 4YW4A 3VBOA 4LIVA 3THDA 1DG6A 3LZZA 5EZWA 1SLCA 5C9AC 1E5RA 2VXRA 3V0BB 1BZWA 4DNYA 3RMXA 4URAA 2DBIA 1DQ4A 3BUCA 1UX6A 5J36A 2RDRA 4IW3A 3KQRA 5FY0A 2ILMA 1OKOA 4FO9A 2IXJA 1GNYA 1S4CA 2AEYA 1LHVA 2AH2A 1YWKA 1UXXX 3NV4A 2JDPA 3PIJA 5FXWA 4IV3C 2WA3A 4JGYC 2DVDA 3RQ0A 5E6HA 2C5DA 2JE8A 5JMCA 1P8JA 4SLIA 1U5YA 5C9AB 4XFCA 4CEWB 1RL3A 2V09A 1OA2A 2PN5A 2XVGA 4XE9A 2WWUA 5C8CA 2JIGA 2Q0AA 1AYN1 1W6QB 4N53A 1S0CA 4DY3A 1BEV2 2JD4A 5A3MA 4FFIA 4NIAA 4AVTA 4MG2A 4A6SA 1A3KA 5GLWA 5TSWA 4GH4C 4IV3B 4JGYB 4IQPA 4HVOA 4NVPA 1LESA 4HL0A 4QAWA 2FCUA 1YO8A 2VPVA 5F3EA 2Q8EA 4YM0A 1SLTA 3UL2A 2W1QA 3VDAA 3HVDA 4XUQA 5G05L 4LHSA 1NKGA 1KRIA 3QD6A 1ZRIA 3SITA 4CU9A 5B4XA 1W0NA 5A7QA 3WG2A 1LECA 4UFKA 3GZTB 4HBNA 1UOGA 5FXZA 1R1A3 1NLSA 4X6QB 1EY2A 2X09A 4LHLA 3ZXKA 1ZBE3 2RS33 5JVVA 5J3UA 3RZJA 3MFCA 3VDDA 2J7MA 4QM9A 4FTEA 3FC0A 3JB4C 2VTFA 4XUNA 3ZYJB 1AR61 2O1QA 1WWYA 3MPPG 4YWAA 3LPGA 4QB1A 5F3GA 5FZ3A 3LIGA 3MBWA 1FATA 2ARAA 2XJRA 4IEVA 5FJKA 2PQQA 1LB2A 3KV5A 5L73A 3VZLA 4I09A 4CP9A 5JI7A 2YC0A 4OHXA 1LGBA 2ZX0A 2A70A 3VV1A 3VZMA 3WF4A 3GGLA 4LMFA 5FY8A 5D8AA 3OUHA 1MS4A 1W2TA 3NAPC 4CCEA 1WCDJ 3S7IA 2L9LA 1VBE3 3T30A 4HONA 1QIQA 1LOBA 1GWMA 1ND2C 2JE7A 1SPPA 1AR93 3CF6E 4B8EA 1YFYA 1UQXA 3WX5A 4E2QA 3H7JA 2W68A 4QGLA 1XJAA 1AXKA 5A7OA 4YVSA 4Q4X2 5A3WA 4AHYA 5A7PA 1JZ3A 1O3SA 1F5FA 1BQPA 2EICA 2RE9A 2QDNA 1J1TA 4XABA 2J1SA 5A6QA 1PVC2 1TMF1 2W92A 4Y26A 4KBZA 1W2NA 2G9GA 4MGIE 5FQ0B 3HNMA 1ND2B 2WZEA 3ILNA 3RJ2X 3UGHA 4QX7A 1IKQA 4XIKA 5J09A 1J3RA 1LKNA 2IC1A 2QQUA 1PK6C 2E32A 1GP6A 2BU9A 3ZXDA 4FCAA 3D0SA 4KQ7A 5FZ1A 2VR4A 1UPIA 2YBSA 2G9ZA 1OD3A 2FBEA 3OSDA 4B29A 4CCNA 4JGZC 1XBFA 4XDQA 2RDNA 5HXMA 1BEV3 4NHKA 2C0ZA 2RDSA 2NYYA 3LQCA 1RGSA 2A7AA 2B46X 2GC1A 4DINB 1DHKB 3B00A 3OEBA 4K21A 1RUH1 1UIJA 3ZYGA 1N1YA 2Q5TA 1Q8SA 3LEMA 2ZAAA 3OPTA 1ZZ9A 3VKNA 5FR3A 4LK7A 1OFSA 4JC1A 4K3UA 5C71A 2WZR1 4JGZB 1AR72 4HT1T 4OI2A 2JG8A 3WP4A 2J1TA 3GHNA 3AJZA 1AZDA 3OGRA 1YQ2A 1Q8OA 1J3PA 3JD71 1XQNA 1F35A 5BNNB 3WG1A 4KU7A 3OOXA 4Q4Y1 2PYTA 2ZMNA 3EYPA 5EJ1B 1K5MA 2C6SA 2NLRA 3SCHA 2JICA 3D4KA 4C8DA 3HBKA 4YZ1A 1US2A 3J7MA 3ZN4A 3ZSJA 4YNIA 2WNUA 4LT5A 3JQWA 4JQTA 2XJPA 3M3CA 3T3YA 5CFCC 1H2MA 3W59A 1K45A 1RUG2 2JDZA 1A6CA 1JU3A 3U14A 3VHNA 4QWNA 2JKBA 1DZQA 1UU4A 3D82A 2WWSA 2VZRA 4X6RB 4XQDA 1CJDA 3LEGA 4QGNA 4GWJA 3ZFFA 1POV0 1O3QA 2QVSB 3IDEA 2HWD1 2BVVA 3P5BA 3RJRA 5FO8B 2ZGKA 2FZ2A 2DCKA 1UCXA 2HLEA 4UFJA 4DQAA 5K0UC 4HKOA 3GDBA 2ZGMA 3WCRA 5CFCB 2UU8A 3LA7A 4GB31 5AC91 2IVIB 5B2GB 3OPZA 5A3PA 3N9MA 5JXGA 2ZGTA 1Q8VA 2ZMLA 3WDTA 4Z1VA 2NZ9A 5DZGA 4Q4X3 2NP0A 2A3YA 2J1EA 4JKKA 3P3NA 5BY5A 3E6CC 2F17A 3N9QA 4S2HA 1YQ8A 2WJSA 1XE0A 3ZSEA 2Y60A 5GZCA 3RYKA 1PVC3 1UZWA 4FFFA 4OUMA 5K0UB 3ALQA 1BJQA 4LBQD 2E26A 2F4PA 5FZ8A 5LBBA 4L9BA 2ENRA 5A80A 2W08A 1YFWA 4G9SB 3O12A 3UV9A 3WW1A 1HRV1 2QQNA 4J1XA 4QDQA 4EROA 1ULOA 2RJ2A 5FY1A 2J22A 2Z2SB 2VNGA 2GNDA 2B39A 2PHRA 4PQQA 1UMHA 2NN8A 4N7IA 3K77A 3WT3A 1IQAA 4XBNA 1VIWB 2VC9A 4BISA 2DWRA 3NJZA 2ZABA 5FP4A 4BXSV 1OF3A 5FMCA 3M3OA 2VW2A 2Z69A 3KV6A 1XE7A 3FMGA 4IEYA 3HQUA 5FO9B 4O65A 4IEWA 1AVBA 1Y9GA 3ZXLA 1W6MA 2A1XA 1BKZA 3FLPA 3V0BA 2VAUA 2WFF1 2YFZA 3MEPA 1CQ9A 4JDMA 2PHXA 2W0XA 1AR73 1VBC1 3N35A 3VBRA 3JBG2 4BM8A 1REFA 2VTXA 1E5SA 2HWC1 2Y34A 3WW2A 4AEMA 4FQ4A 4LBMA 4EQVA 3KT1A 3R6SA 4RN5A 4FSJA 5FOJB 3O1MA 2BNOA 4YGEA 5A3NA 1JOBA 2QQJA 1VMHA 4Q8LA 4CEWA 4FFHA 3SISA 2BERA 1FYUA 4IEZA 1RUH2 1O91A 1RUG3 2EIBA 3MUY1 5F3IA 5HPOA 2CAUA 3CIHA 2GN7A 5DAWA 4MX3A 3AYDA 5JR7B 3WF0A 3UNPA 1V6KA 3WR0A 1UOFA 5F32A 1L7LA 3T0DA 3ZMOA 5CKMA 2WZR2 5IK5A 2QQOA 3NNJA 4QB6A 1APNA 4GWIA 3TAYA 3UKTA 2ZMKA 3MV11 1AL21 2CY6A 4I01A 1JN2P 2VUDA 5EP9A 5LATA 1QJX1 2MNGA 3APBA 4DFSA 3MW4A 5F5AA 4Q4Y2 2G19A 4FPFA 4XUOA 1HQWA 2W39A 1FPN1 1T6GC 5E88A 1NOVA 2VQTA 1PMJX 4Y1VA 5K7PA 1JI6A 3M70A 5KXBA 1H1MA 5FWJA 2Y38A 3EJKA 1SDDB 2JG9B 1ZM1A 3H3ZA 2QFEA 2MPFA 1SEFA 1JYTA 4C1XA 4LE4A 4XMIA 5HV4A 5JWPA 1DGLA 3I97A
chains in the Genus database with same CATH topology
2WZPP 1RUF1 2PAEA 5DZEA 1HXS1 2HWD2 1OLRA 3AX4A 1LOEA 2BFUL 3VBHC 1PO12 3UK9A 4YM3A 3TN92 4BE3A 5BV6A 2RS52 5AC92 5AFEA 2E9QA 3J26N 4META 3L9JT 5LRSA 1F5JA 2FMDA 2EALA 3R4SA 3PHMA 2BNMA 4HN1A 3LGRA 5LK5A 2ES3A 3Q9OA 3I7DA 2D3RA 3ZIXA 1QQP1 3TNPB 1Q8QA 3VBHB 1GQHA 1WMEA 1IPKA 3AMNA 4XTMA 4AFDA 3SH4A 1QNWA 1V00A 1W6NB 2ZCWA 5ACA1 1WBLA 4O9EA 5FBZA 3KS7A 2ZACA 3JBG3 1BBT3 1N3OA 2VGDA 3ETQA 5J98B 3GNEA 4KWKA 4ORFA 4NWWA 1C5HA 5FQ0A 1POV1 2D43A 1ND2A 4PLNA 2DTWA 4AK3A 4DMIA 2A6YA 1URXA 2FZ1A 5FREA 5E1RA 1IPJA 1RUH3 2XJUA 5DXDA 5EV7A 3WP5A 3OD4A 1PZ8A 4PLOA 2WFF2 4AQTA 1F31A 1LENA 1PHMA 1ENSA 4DPNA 2WZR3 4FOWA 4FXGB 3INAA 2WKKA 1NCQA 2ZOEB 3DGTA 2WT1A 2EXJA 1LR5A 1DIWA 3PTYA 3AKPA 3AFKA 4QQLA 1S55A 2VMIA 3HQXA 4K7JA 3U10A 4JGZA 4AI0A 2R30A 5IUQA 3BU7A 1Q3EA 1AHSA 3SCFA 4EN8B 2XL7A 5BNNA 3I59A 1PGW1 2GH2A 3GYDA 1RMU1 2D93A 5FLHA 3VUOA 1I6XA 4BMBA 4QHBA 4XJAA 5A32A 1AL0G 2HWD3 3JQXA 1RTVA 3VKLA 4RFT0 3LOBA 1PO13 3P3PA 2OZ6A 1JUIA 5F6KA 3TN93 1QJX2 1DLLA 2GDFA 3TWIA 3I4IA 3O14A 2RS53 5AC93 5JOXA 4PIZA 4P9JA 3AJYA 1O4YA 4MLOA 3RSJA 4MGZE 1X82A 2I07B 4QPIC 5IK4A 5J7MA 3FHIB 2HWE1 4PDWA 4QX5A 3V65A 2DUOA 2GAUA 1JW6A 3AP7A 1E57A 3O7OA 2IXKA 4NO4A 1V9U1 2Q4SA 4RQPA 5T3NA 1LULA 3POYA 4UBHA 3AXDA 4GULA 4R9AA 4U2AA 5T52A 4YW2A 1GNZA 2YMZA 4OHYA 5FO7B 1D0HA 2XPJA 1LU2A 1Z7S1 3M7AA 4LEJA 2XUMA 4QPIB 4GKYA 5JI9A 3LSEA 2VVFA 2QZ2A 2VECA 3HIFA 4AFCA 2K2SA 2D3PA 4Y20A 2HEYF 4L97A 4XF3A 3D8CA 1W6OA 2VULA 3ELNA 1UZZA 1MZEA 3ROUA 1MZ6A 1HW5A 4JCKA 4XFBA 2XL9A 1NCRC 4AI2A 3G7DA 3IMNA 1UAIA 2WFF3 3VHRA 2YYOA 2NQYA 4WBBA 4RGGA 4Q4V2 1I5ZA 2RR11 1C8M1 1SFYA 4CP2A 2LALA 2R071 4XTPA 4YGBA 1N3PA 2IZWA 1LTEA 1IGOA 1AR81 1NCRB 1ENQA 1KDMA 5A33B 3ZPYA 4Y1UA 5F1RA 3CEWA 2VOVA 3HAGA 4R9BA 4PCRA 4Y1XA 1CAVB 4EWAA 2OZJA 2YGMA 3FWEA 4COZA 1DQ2A 4N9HA 5DUVA 3PJQA 4G4FA 1OSGA 2ZGSA 4XFFA 3AZWA 1UKGA 1QJZA 3NKTA 1QOOA 1RHI2 4IERA 1IKPA 4YG6A 1S0FA 3BB6A 1QJX3 4P9YA 4UW6A 3E6BA 4HK8A 3WG4A 5JZGA 1ULCA 4CDXC 1DU3D 2A71A 2EXKA 2H6BA 3BODA 3NVCA 3S6PA 1OPMA 3HBZA 3WY6A 1YHFA 4XETA 3DN7A 3B94A 3LA3A 5DUUA 4Q8KA 1CPMA 1QHDA 1WA4A 1Y43B 4AW7A 2CTVA 1B35C 1C4RA 2JG9A 3U07A 4BLIA 4CDXB 1BMV1 4IEUA 1RUI1 1QMJA 2XGXA 2DVBA 1ENXA 4E27A 4AVAA 5H9QA 2DFCA 2E7QA 3VKMA 4BZ4A 4E4SA 5KHIA 1B35B 5E8AA 3DPRC 3M3IA 1V9U2 3AMHA 2ARBA 3JCIA 2GALA 1PO21 5HI0A 2ZHNA 4AQ6A 3BCWA 3HMYA 2ZX2A 2TEPA 4Q4V3 1DBNA 1OA3A 3ZO0B 3VBHA 5C4WC 1UU6A 4ASMB 5DDJ2 2YROA 4ISRA 4MGKE 1RUJ1 3V0AB 3OJBA 1W6NA 2P17A 3DPRB 4WM8C 3EHKA 1HQNA 1NXD1 4Q4W2 4HMZA 2GN3A 2WNEA 2ZJCA 2DV9A 3C3VA 1D4M1 3NV2A 2VQ0A 1UKRA 4D69A 5H9SA 5C4WB 5T50A 1YI7A 2KM2A 4WVVA 1MS3A 1BXHA 1KITA 1ULDA 4B4QA 2B7YA 2BEOA 1WBFA 3BOPA 3PVBB 4LHNA 4XEZA 4AGVA 1R083 1RHI3 3R05A 4OLLA 4RA0A 2R072 3AK0A 3WQ7A 1H9WA 4M3CF 4ATFA 5JIAA 3MGUA 4Y1ZA 1AR82 4B7EA 4MXVA 3VL9A 2X29A 1XYNA 4IESA 4MUVA 1EPWA 1HX6A 1OKQA 5EWSA 1EPZA 3JUUA 1ZRFA 1JHNA 4MSVA 1MZ5A 1GNHA 2DCZA 2IXCA 3D5OA 4XXAA 1VBD1 2NMOA 3VL8A 3OYWB 2PLV1 5KHJA 1S0JA 2UYBA 1C1LA 2ZX1A 3BPZA 3OGJA 1XXNA 4O9GA 1N1SA 4WVWA 4ONUA 2WFPA 4OFGA 3VBUC 1AJOA 5GALA 1D2SA 3R4UA 4KGGA 3MW2A 1VAKA 5I8SA 1QOSA 5ABJC 4MVTA 4CZSA 4I30A 3ES4A 1QXRA 1D2QA 3KD4A 3IDCB 1R1ZA 3M8LA 3GZAA 4KL1A 3DKWA 1V9U3 4RHV1 1S0GA 5SV5A 1CVNA 4XW3A 1RUE2 2QUOA 3PMSA 4HK9A 4E9KA 4JRAA 4WV8A 1QNYA 2R061 2YGLA 1GYKA 3VBUB 1VBA2 4K6BA 1Z0HA 3IN9A 1C3HA 3JU9A 1DQ1A 5ABJB 1DGWX 1DYKA 5A3LA 1GV9A 2WSVA 1CIWA 1TE1B 2ZGUA 3WUDA 4DZGA 5BYNA 5DDJ3 1RUI2 2P3IA 5LEJA 1CAWA 4YFWA 2XH6A 3TB0A 2IXLA 2FMYA 4Q4W3 4XFHA 4K9SA 2X8KA 3WD5A 1U0AA 5EXOA 1IS5A 4LLOA 2PHFA 3RPQA 2FHRA 1QJY2 1UZYA 1TQ5A 3WQ0A 2XHKA 5GLZA 1OQEA 3KSCA 4Q2FA 3PVNA 4Q1PA 1HV1A 1PO22 5AFBA 2XBO2 3LCPA 3FBYA 3WQ1A 5GZGA 1CR7A 4Q1RA 1TME2 1UF2C 3EO6A 2X5IC 4XBLA 2R32A 1NXMA 1AR83 2G9FA 3FLRA 2G4IA 3WHTA 1LOFA 3CJIA 4A7ZA 1YYNA 4DOUA 3MIBA 5KHKA 4U36A 4RS5C 5KC6A 2R042 1VLNA 3AYCA 4QGMA 5FAXA 5CFDC 4J1WA 4XQ4A 4Q0PA 4LA3A 5GZEA 2SBAA 5JOYA 2BPA2 5HCAA 1NCRA 1Y9QA 4GQ7A 1JYCA 2X5IB 2ZKNA 5A33A 3EXUA 4P9LA 4GH4B 1GSLA 2XJTA 2RMU2 1RUD2 1CAVA 4A7YA 1FV2A 3USUA 3QH6A 1EV12 2GNTA 3E5QA 4YZ3A 5JCTA 5L7OA 1YIFA 4AVBA 1SLLA 3J8F2 4RS5B 2P2KA 5CFDB 1BVP1 1H8VA 3WG3A 3WW3A 4LUMA 2R6QA 2ZX4A 1G9AA 1V6LA 1YJKA 4IETA 3WV6A 3FJSA 2AR6A 1COV1 2NPIA 3ZN6B 5KXCA 1RUE3 5IK7A 4HETA 3GHMA 4M0HA 4XPVA 2PLV2 1VBA3 1CESA 1AYM2 2HWB1 1RUC2 4XF1A 4M3CB 5T54A 4AVCA 1WMDA 5D1IA 1DGRA 3VBSC 4YFZA 4AHZA 2O8OA 2GU9A 4YW5A 1PZ9A 4F7ZA 1H2KA 4CDXA 1MEC1 3NAPB 1YCIA 5BUVA 1FT9A 1EAH2 1WLTA 2YUEA 3B7MA 2HWF2 3WOGA 4ASLA 4DXZA 2EAKA 3ME2A 1HRI1 1HKDA 1QJY3 4RHV2 1RC6A 4ATEA 2QZ3A 2ZHMA 3KB5A 3PNAA 1VRH2 2R062 1VBB1 1PO23 1LU1A 2XBO3 1QJU2 4KGQA 3JB8A 1XU1A 3VBSB 5L36A 3O0VA 1H30A 1RVF2 1ALYA 1NE4A 4CP1A 3MIFA 1N3QA 1TME3 3W9AA 2BWCA 3W58A 2VQAA 3WHUA 2B9UA 2AYHA 1ZX5A 4I3GA 3AKTA 4YW1A 2WLPA 1JXNA 1JYIA 1ND3C 4HPKB 1H1AA 4LNVA 1FAYA 1PK6B 1QXJA 2PFWA 2BWAA 1CAXA 2P37A 2R043 4OVEA 3RDIA 1CAUB 4ISQA 2WNVC 2ETEA 2LTNA 4COVA 4HZFA 5FCCA 2DUQA 3DF0A 4YVWC 3ZSMA 3AFGA 2RMU3 1RUD3 3DUIA 1AYN2 4L2NA 5C4WA 3VBFC 1EV13 2VU9A 4PIYA 4D94A 1DFQA 4CDQA 3J8F3 3ZXJA 3U0ZA 4BMEA 1UIKA 2DUPA 1X33A 2XG3A 3SH5A 1OPOA 2ZX3A 2VG9A 4IV1A 4D7YA 4I3PA 2EVXA 2CL2A 4YVWB 4CDWC 4XF9A 2VOWA 5E16A 3VBFB 3RS6A 3TRSB 1QF3A 2PLV3 3OY8B 4MGYE 4UXAA 4E4DX 1JUHA 2CWSA 1AYM3 3FUOA 2XWBB 1RUC3 1AR62 4HSLA 4DY5A 1LHNA 4CDWB 3OYWA 1ZBA1 1PMIA 4B7KA 4X8NA 3AZYA 1SACA 2GC0A 4Z92B 3THPA 1EAH3 2Z42A 2HWF3 1YNAA 4UBGA 4RHV3 3ZN5A 2JJ6A 1MQTC 4E2SA 1MR5A 5DUXA 5CB7A 1YFUA 1VRH3 4DRVA 3B3QE 1QJU3 1UU5A 1SLBA 1W6PB 1RVF3 4HLTA 4J6GA 2E53A 2W52A 3H9AA 4YZ2A 1ZZ7A 2YPJA 3RMYA 4YM2A 3FBMA 1S2BA 2VVEA 3VBUA 4K1YA 2VMGA 1C5IA 3J4UH 1UMZA 1MQTB 3FLTA 2OIIA 3AYEA 4HANA 1MEC2 1H8TA 4IEOA 4WM7C 3RWNA 3T1LA 4AXOA 5ABJA 1MVQA 4C91A 3MZHA 1TMF2 4AGRA 1OQDA 4H14A 2DCJA 2BYVE 4PQ9A 1VBB2 4NR1A 3ZFEC 1ULEA 4HKLA 2TBVA 4EWDA 5KHGA 2GZWA 2D5FA 2YXSA 4WZCA 1AYN3 2Z79A 3ZFGC 1R091 1LEMA 4C0BA 4L92A 2DCTA 1OA4A 1VB2A 5C9AA 4GMP0 2IXIA 2E63A 4OHVA 3SHRA 3VKOA 1Z78A 2RJKA 1BK1A 2HEWF 3ZFEB 1W6QA 3CO2A 5CIRA 1F8VA 2ZAHA 4GIQA 2IFWA 1S0EA 2CWMA 4IV3A 1EYBA 4JGYA 2VUAA 3SMHA 3IWZA 3ZFGB 5BNPC 2KXLA 3GF6A 3JD72 1WCKA 4S2GA 1PIV1 3CL1A 2P3JA 1AR63 4K20A 1O7FA 3WNXA 1SFNA 5I93A 1C8NA 3WDUA 1AF9A 1XU2A 3ECQA 4GH4A 3B5LB 1REEA 1WGPA 4BA6A 4YARA 1CD3G 4AI8A 2A6XA 3AYAA 3MFAA 3B93A 4RS5A 1HQLA 2UWCA 1WW5A 3WDVA 5CA6A 1JTZX 1FMD1 4AFMA 2RM21 4GB32 2WL1A 2JX9A 2QE3A 4H7MA 4JRLA 3MLKA 4CDUC 2RS11 1DGWA 1DZRA 3ZXFA 1UPSA 1VB4A 2NM1A 3KLSA 5JPMB 2BW8A 5K9YA 4F3JA 1LHUA 1S0BA 4QQHA 4FVVA 1FNZA 2PHDA 5DG2A 4M3CA 5KC5A 1TMF3 1ZRDA 1J58A 3KCXA 2XB6C 2UWBA 3E6DA 1VBB3 3VZOA 4CDUB 1X7NA 5KXDA 2PA7A 3NAPA 1HRV2 1NLRA 3QOPA 3CLPA 1W39A 1W2UA 2LUWA 3MIGA 4FP3A 3ZYPA 5KWRA 3VZKA 2GNBA 4HVQA 1FOD1 1PVXA 4FXKB 4LE3A 2BVBA 1F2NA 2BQPA 3FE5A 2DVAA 3MYXA 1JOJA 5LRRA 4Q0VA 4PBOA 3SXWA 4GALA 2X53S 1KXGA 3OGGA 3B69A 4K1ZA 5IK8A 3M1HA 5EYYA 4KG0A 2ZBJA 4MXWB 4IL7A 1AXZA 2A3XA 4KNCA 3NL1A 1VBC2 2D6LX 5FFOC 3NO8A 4HPKA 3PJYA 2HWC2 3KT4A 1PK6A 1RJ8A 3JD73 1A78A 4Q4Y3 5SV8A 1QH7A 3HT2A 1CAUA 1MS0A 3L2YA 4I02A 3I8TA 4XJWA 4K40A 1NY71 1YI9A 2PELA 4P9GA 4EN6B 2DFBA 4W6XA 5GZDA 5JDBA 1H2LA 3PVOA 4D3WA 2IWGB 1RB8G 4QD2A 5AVPA 4COWA 2PHWA 2TUNA 4H55A 1ASJ1 1Q8PA 1AL22 2XJQA 1V6NA 3ILFA 1PIV2 4GB33 2ZS6B 3ASIA 1G9BA 1FPN2 1SDWA 4P5HA 3WP6A 4QQOA 1X8EA 4F83A 3VBFA 1ZNPA 1FX5A 2VY0A 4K8FA 4KU8A 2LM3A 2MEV1 1ZREA 5CFCA 2CV6A 5CBLA 2QQPA 4W6YA 3CJXA 5DG1A 1IOAA 4ITCA 5FPZA 5H9RA 5J37A 2Y0OA 2YV8A 2YZ4A 3QLQA 4GMP1 1RUF2 1ULGA 2VW1A 3N7LA 1HXS2 3VBOC 2OA2A 2DU0A 3AM2A 1HRV3 5BNOC 3ACLA 5K0UA 4FPYA 3HN1A 4AHWA 3ZMNA 1GBGA 3DV8A 3KMHA 2E51A 3THTA 4UW4A 4ZU5A 1WMFA 3LA2A 1H4HA 3OTFA 1QQP2 4DS0A 5LEKA 4F8AA 5BNOB 4I2OA 3CNAA 2WT0A 5T5PA 2F6BA 4YG0A 5C8CC 2RHPA 2EA7A 5ACA2 2H6CA 1VBC3 5AVAA 2HWC3 2ERFA 4FPJA 4FP2A 1ZRCA 3ZSLA 2ZHKA 5FTTC 2P34A 4PBPA 2XKPA 4N43C 4FPKA 5C33A 1PGL1 2ZZJA 1CGPA 4JAAA 2ZHLA 3T1MA 3J9SA 3H3UA 4FAHA 1PGSA 1NQJA 4XFIA 2ZGOA 4QQPA 3TNQA 1NZCA 3GALA 4JV4A 2XLGA 1AL23 4N43B 1J59A 3FFQA 1BVVA 3O0WA 1FPN3 3AP4A 5FRAA 5EFUA 1CPNA 1GLHA 1Y7BA 3HR9A 3V56A 2B45X 3VHOA 1ENRA 3QBQA 1OQ1A 2XLFA 3BOWA 5I8TA 5D8AC 4FQZA 4BWOA 1X50A 1PGW2 3VHPA 3WUCA 1RMU2 3G6JB 4OHWA 1R1A1 4AI3A 1ZBE1 2RS31 1CN1A 1OOPC 1YIPA 1RUF3 2VH9A 1HXS3 3M2MA 3H0OA 1U5IA 5T5LA 4B3NA 3POWA 3FFZA 1ASJ2 4AF9A 4AG4A 4L8QA 1I1EA 5BXXA 2WQ4A 4G3YC 1VJ2A 4YSFA 1RJ7A 3KM5A 4R9DA 1OOPB 2HWE2 4GKXA 3V64A 3RZZA 2A3WA 1QQP3 3VN4A 1C28A 3AB0A 2VNRA 1VBE1 1OMIA 2D97A 4XMAA 2ZGQA 4XJZA 2VW0A 5ACA3 1HLCA 3AP5A 1AR91 3IT8A 3S7EA 1LOCA 3TOJA 1Z7S2 1FNYA 4CYDA 2A75A 3U4XA 1C57A 1POV3 3EQEA 4LO5B 4W6WA 1GQGA 4BCUA 2Q30A 2D6OX 3KT7A 3QCWA 1NYWA 1O4ZA 1WLDA 2HYKA 3N4MA 4KWLA 2JG8C 1J1LA 1PM7A 5I0SA 4KG8A 3IKWA 2SLIA 1S2KA 2YHJA 4LA2A 1F9KA 5C6CA 1K5MC 5I0TA 4WM8B 1WD3A 1YLLA 4EJRA 2RR12 1C8M2 4E4ZA 5JLVA 3IM0A 2JG8B 5GKAC 4Y4YA 2ARXA 3UKNA 2D44A 4R52A 3VKFC 1D4VB 3ZFFC 1K5MB 4CRQA 3VLBB 4FTSA 2D98A 2VOXA 4AEJA 4AYUA 4HFSA 1RMU3 1W0PA 1V6MA 1MVEA 1PZ7A 1OLQA 1KS5A 4XF0A 2A5ZA 3ZFFB 2WS91 5KXEA 3WP3A 4YYOA 4XQWA 4JDOA 4AQ2A 1PNGA 5CU1A 2O0OA 2DVGA 2DVFA 3UJQA 4EWEA 4LULA 2HWE3 1SBEA 4YZ5A 1G7YA 5F9TA 1NG0A 3PVEA 4FPLA 3SCGA 1TEIA 3TYJA 2H0VA 5JPNB 1AX2A 1ZZCA 1HDKA 1OD5A 1TNRA 1VAMA 5E89A 1BMV2 1Z7S3 2JE9A 4Z2WA 4FPCA 1DF0A 4Q4X1 1PNFA 3KGZA 4KWJA 2WIIB 4AGGA 4RD7A 4EN9B 2C9AA 2QCSB 3H1MA 1YJLA 3NW4A 4XZPA 3MF9A 4JTOA 3RI9A 3USSA 1I9RA 4PF5A 4Z07A 4QPIA 2RJLA 3MDPA 3MLLA 3VBRC 1C1FA 2CNAA 4XHBA 3NKGA 2JXAA 3K48A 3AZXA 4SBVA 4S2FA 4FOVA 1W6MB 2RR13 4CEWC 1C8M3 5BNOA 1HIXA 3C2UA 2R073 5HXVA 1RUJ2 3ZXGA 3VBRB 1LJ7A 2OUJA 5BNQA 1XNCA 3N36A 5JAXA 2Q8OA 4ZU4A 3KCYA 1D4M2 2BUKA 3R0RA 4FTBA 4WVMB 4LLFA 1AR71 4TWTA 1QXPA 3U11A 4LBQB 1FI2A 3E5UA 1SCSA 3ILRA 4QPYA 4LBKA 4QPGC 2GC3A 1AUYA 1SCRA 1XNDA 5EJ3A 1LGCA 2AZ5A 4XFAA 3OCPA 1RUG1 1IZ3A 2HKXA 4JVAA 2R1DA 1SBFA 4LUKA 4N43A 1RIRA 4QQ2A 4Z8BA 1KJRA 2ZGRA 1SLIA 1O4TA 4GWNA 4QPGB 3NWKA 4KBBA 1REDA 1S1AA 4DRRA 3PLQA 1VBD2 2BTVC 5CVRA 2VMHA 2BGCA 4B4RA 4BHPA 3O5SA 3QACA 2WS92 5JOZA 1RUI3 3HT1A 5CG9A 1WW4A 2PAKA 4AEKA 3MF6A 4XJ8A 2UWAA 2D6PA 4AVVA 1GANA 2V73A 1OOPA 2DTYA 1X36A 1B35A 2ZPXA 5GJ6A 2UYAA 2CGOA 2XKOA 2VOKA 3MI8A 1RUJ3 1LRHA 4NHMA 5T55A 2WSUA 3OF1A 4COYA 4AQSA 1WUVA 3KGLA 5T5JA 3AZVA 1QU0A 2YDEA 1D4M3 1CJPA 2UY8A 4IEXA 2XVKA 2GH8A 3AMQA 1IS6A 3AXEA 1NCQC 3V0AA 3DPRA 3JBG1 1BBT1 4JDNA 1B09A 2UURA 1CX4A 1RINA 4XJ9A 4YM1A 5H9PA 5KBFA 1XRUA 1H9PA 3KZ4C 3VZNA 4XF4A 1ND3B 3NV1A 4LR4A 3RI8A 5BNNC 2GMPA 3AKSA 3N7KA 3HWJA 4MYEA 1NCQB 1ULFA 4WM8A 1BYHA 1D0GA 2WNVB 1QOTA 1VP6A 1FXZA 4URTA 3EBRA 2CGPA 4Q29A 2CAVA 1SMVA 1VBD3 1JH5A 3I59B 3WINE 3WZ1A 1KFXL 4BH9A 3RYPA 2VNOA 4FBFA 4KH9A 4OI1A 4PDWC 2WS93 4X8PA 5A32B 1ZZ6A 4Q0QA 3MIEA 4I0BA 4LO7A 1V6OA 2C1FA 4LBOA 4RQPC 4HVRA 5FMOL 1RUNA 1YUDA 4TSVA 4COUA 4P9WA 2B8MA 3ES1A 4UW3A 4GWMA 1U5XA 2R0FA 5CAZA 1GZWB 3GBGA 1CONA 5JSOA 1ZRRA 1DQ6A 2P3KA 1COV2 1PO11 4PDWB 3TN91 3RRDA 2R063 1W0OA 2AGSA 3MW3A 2RS51 2R49A 4RQPB 4EN0A 1LOAA 4QXKA 4N7UA 2HWB2 4FPEA 4RR3C 4AFBA 3RYRA 4YRDA 3AP9A 3ATGA 1ZYBA 4PJYA 1EP0A 1H0BA 3OBTA 3SNMA 4M00A 4E2GA 3IDBB 4BLJA 4Y20B 4OULA 4PIXA 1HRI2 3S0MA 1OFNA 2HEVF 1Q43A 4RR3B 1O5UA 4AFAA 3SLIA 5FDBA 1W6OB 4M01A 4MH0E 4NN0A 4LO6B 1A8MA 2DYCA 2GMEA 4IEPA 3B01A 3WDXA 1VALA 3H8UA 2BBVA 3H50A 4WM7B 4LBJA 2ET7A 3L2HA 3H1YA 4CEYC 1QDOA 4C0HA 1DZTA 4R8HA 1MACA 3WCSA 4ZU7A 4RGAA 3B9CA 2ZGLA 3SH3A 1O3RA 4BIFA 3I2DA 1DQ5A 4FT8A 5FLIA 1BBT2 1G86A 2OUHA 2YY1A 2Z5WA 4FPGA 3PMEA 5JZGC 2D40A 4I0AA 4CEYB 2I2SA 3NV3A 3M3QA 3UKVA 4WVMA 1GICA 3N7JA 4WZFA 2D5HA 2N7GA 3N7MA 4R9CA 1VAVA 1DGRN 4LBQA 4W65A 2O8QA 1O3TA 4FOQA 2X5IA 4HKWA 4V1PA 2PHUA 5J96B 1SLAA 4BIOA 5JZGB 5BNPB 4D7TA 2VVDA 2JG9C 2ZKLA 1U5ZA 1DDLA 4QM8A 4OZXA 3AMMA 1COV3 2ZZQA 4RSUA 5CFDA 5K8SA 3ZIWA 1G9FA 2WLQA 4ES9A 1AX1A 2HWB3 2ZTNA 4WVZA 3H7YA 3LAGA 4QPGA 5GM0A 1QGLA 3ZN6A 1WLCA 1ZZ8A 2AENA 1ZBA2 1H1IA 1WW6A 1MEC3 1GR3A 1H4GA 1YFXA 2B5HA 3D0JA 2D6NA 1DYPA 3O0XA 5GLUA 3CU7A 4RL7A 1HRI3 3LOIA 1GFF2 3ZVXA 4EN7B 2D6MA 4M3CE 4QMAA 5GLTA 2A6WA 1VR3A 4B4PA 4L11A 4LBLA 2WA4A 4MV2A 4AWDA 4ZKTB 1ZZBA 5GZFA 5I0UA 3AKQA 3VBSA 4Y1YA 2EIGA 3IIAA 4BQ1A 4BYYA 5EYXA 3BIWE 4YGCA 3ZSKA 1GKBA 2ATFA 4Q4V1 3RG0A 3WW4A 3POSA 1RITA 2JEMA 4XYXA 1DQ0A 3E5XA 4AI1A 1HV0A 4HSJA 2GSYA 1S0DA 1NA1C 1M06G 4XFGA 1M4WA 1R092 3LWCA 4LO4B 2R16A 5I8YA 2NMNA 4XXPA 4Q0SA 3GBFA 3IPVB 5T5OA 3N3HA 1ND3A 3MIHA 4FAGA 2QKDA 2I74A 4Y24A 3WDYA 1N1TA 1R081 4HN0A 5JOWA 1NA1B 1RHI1 4Y22B 3AMPA 4R4ZA 4XHXA 2WNVA 2D6KA 5BPXA 1GZ9A 2DU1A 3X29B 4TLFA 2EXIA 4YVWA 1QKQA 1IS4A 4NHLA 1LHOA 4AEDC 1ZBA3 3OY8A 1GZCA 4JQRA 3ENRA 1JBCA 2E7AA 1YXWA 2PHTA 2FQPA 1N1VA 3BALA 2HJIA 1RUOA 4FPHA 1IHMA 3FUQA 4CDWA 5F5QA 2XLAA 1AX0A 3ZXEA 2ET1A 2K9ZA 5FMOS 4BPZA 5JSRA 1FMD2 4AEDB 2RM22 4S2DA 4XIOA 4D7SA 1MZFA 1GZWA 1KS4A 1S0IA 3WDWA 1G9CA 3K51A 3AZZA 3WXPA 2RS12 4EV0A 2WQZC 2I45A 4OI0A 1LODA 1V6JA 4PLMA 3B9IA 5IT6A 1W6PA 3VBOB 2E6VA 2QJVA 1OI6A 1CAWB 3D6EA 1N47A 4M0NA 4BOWA 4N53C <