2O0OA

Crystal structure of tl1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
160
structure length
153
Chain Sequence
GDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TNF superfamily ligand TL1A
publication title X-ray crystal structure of TNF ligand family member TL1A at 2.1A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine, hormone/growth factor
total genus 23
structure length 153
sequence length 160
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2o0oA01
1D4VB 3QD6A 2JG9A 4KGQA 2TNFA 3B93A 4GIQA 2ZPXA 4MSVA 1C28A 5CIRA 1U5XA 2WNUB 5KC6A 3B94A 1GR3A 1C3HA 2QDNA 3K51A 4MXWA 5BNQA 3URFA 1RJ7A 4QQ2A 3TYJA 2Q1MA 4E4DX 3IT8A 4F3JA 4EN0A 2JG9B 3QBQA 1KXGA 4NN0A 1JTZX 2RE9A 4E4SA 2O0OA 5HBAA 4TWTA 1JH5A 1XU2A 1DG6A 4QQPA 1U5YA 5KC5A 2JG8C 4DB5A 1RJ8A 3LKJA 1PK6C 1A8MA 2WNVC 2E7AA 3L9JT 2HEYF 4TSVA 2HEWF 2KA3A 2QE3A 2OIIA 2WNUC 3ALQA 2HEVF 4OUMA 1KD7A 2JG8A 1I9RA 4RSUA 5TSWA 1D0GA 3K48A 2R32A 1U5ZA 4KGGA 2X29A 1PK6A 2WNVA 4QQLA 4QQOA 2RJKA 4MXVA 1D2QA 3B9IA 4N90A 2WNUA 3ME2A 2Q8OA 1DU3D 3FC0A 1S55A 4MXWB 4DOUA 4G3YC 5KWRA 1OQEA 2TUNA 5L36A 3V56A 1TNFA 4D7YA 4KG8A 3WD5A 2RJLA 1WCKA 4QPYA 1PK6B 3TWIA 4G4FA 2WNVB 1OSGA 4QQHA 4OULA 1IQAA 4HT1T 1ALYA 1TNRA 4OUSA 3AB0A 5L19A 2JG9C 2Z5WA 2AZ5A 3MI8A 1XU1A 2ZJCA 2R6QA 2R30A 4J6GA 1OQDA 2JG8B 1O91A
chains in the Genus database with same CATH superfamily
1D4VB 2GAUA 4BISA 3GCXA 1HV1A 2A70A 3WSOA 4A42A 1F5JA 4YZ2A 3KF3A 2ZX2A 2JIJA 2X5IB 3PUAA 3Q9OA 1YLLA 2NPIA 4GH4C 3RVHA 3OGRA 4RYDA 5FY4A 3WVJA 2JDKA 4CDWC 1UNBA 2QVSB 3IIAA 4MGZE 3SH5A 2D3PA 4AAXA 2TEPA 4Z92B 2QDNA 1GLHA 2H0BA 1RIRA 3C7EA 2ZOEB 2YMZA 1SHWB 2RS52 3PJYA 4LO7A 1POQA 1GNZA 1KJRA 2A71A 2LROA 2OUJA 2PLV2 2Y34A 4LMFA 3MYXA 1Q56A 2ZZJA 3BOWA 1JZ2A 2IVJA 2K46A 3WDYA 1VBD2 3C8XA 5FPXA 4LO8A 3GM8A 2WINB 3R4SA 1UZVA 4N43B 4DPNA 3I3EA 1BKZA 1JU3A 3S7IA 2RE9A 1W8HA 5A3OA 2MHFA 2PTMA 2R7EB 2ZCWA 5JSRA 3AC0A 1PGW1 3VV1A 3ZXAC 4YARA 4O65A 1H8VA 3MGUA 3H0OA 1QXJA 1RUE1 1RUE3 4RR3C 5T5JA 4NIDA 4DNYA 1N1YA 2ZXQA 3OD0A 3TRSB 1CVNA 2RS12 1DQ2A 2I07B 3LGRA 3MHZA 5FPZA 5IATA 4DXTA 3O1PA 4M01A 3TNQA 4LBOA 4GD4A 3VUOA 1AF9A 2GN3A 2QQVA 4PIYA 5A32A 3AKPA 3K3OA 5C8CB 3NNGA 4C91A 3ZPYA 3VBUA 4QM9A 3W5MA 3ZIWA 4YFWA 2IFWA 3FE5A 3O1MA 1GSLA 1YQCA 3ZXEA 1SLCA 3WLUA 1RYYA 4AI8A 4YW7A 3AXDA 2A6XA 4L9BA 4CU9A 3AM2A 3HMYA 1RINA 4QQOA 3ZSMA 3B01A 4FFFA 3HAGA 5J3UA 4DRVA 2HWC2 2BYVE 2ARBA 2VMIA 3WG1A 2Q8OA 3SITA 3IBMA 2ZGNA 3ES1A 3MLKA 1MS3A 3KVBA 5A33B 1R1A1 1R1A3 5C4WC 5FWJA 5L36A 3AKQA 1US2A 2VVDA 4JVAA 2VCCA 2PHDA 4NMIA 5AC93 4M3CF 5FYZA 1HB4A 4HSJA 2O14A 4Y5SA 1APNA 5CG9A 1WMDA 3JZVA 5GLVA 2RR11 2RR13 3EO6A 4O9EA 4UF0A 4MV2A 1H2KA 1R092 2Y33A 4G4FA 3RYRA 3ZSLA 3BN6A 4CCCA 4HVQA 5EZWA 5LCWL 4COVA 1LAJA 4NAOA 3WXPA 1G9DA 2ZGSA 4AGVA 5DMYA 1REDA 1TNRA 5E8AA 4NROA 4YW2A 1WMEA 3BPZA 3T2OA 1VAKA 2VE1A 3VBFC 3ZYJB 5GZGA 4L2NA 3OTFA 5T3NA 1AVBA 2OPKA 2OT7A 5C3OA 4QXKA 3MI8A 2ZJCA 2CYFA 1NCQB 1XJAA 4CTEA 3DGTA 3KQRA 3P1IA 1HXS1 1HXS3 2RJ2A 3JXSA 3AYDA 4LJHA 2RS31 2RS33 4WVVA 4GWJA 3T1MA 4Z2AA 3KZ4C 4HL0A 5DXDA 4RL7A 3PTRB 1QXPA 2A73B 1XPWA 3JCIA 3ETQA 1VRH1 2QFEA 4K7JA 1GU3A 1S0DA 4NVPA 3DPRC 2WA4A 3DYPA 3I8TA 3M3CA 1ZYBA 3VBSA 4NAMA 4JHTA 4E2QA 1QY4A 2WN2A 3NAPB 4ZXKA 2ZA9A 2ARCA 2VXRA 4L99A 3SC7X 3ZN5A 4XCBA 4AYUA 1GWMA 1DLLA 3QOPA 3PUIA 3BTAA 1DYPA 3IB3A 2VZUA 3QH6A 3DF0A 2EXHA 4TYSA 2J42A 2G19A 4ORFA 1HQWA 5F6LB 2C9KA 1K5MA 3DKWA 3RGBA 4COYA 4DXSA 2ZZQA 3HOBA 5L73A 2B9UA 4P00B 5D2AA 2W1WA 1DGRN 2A6YA 3O1OA 5F6KA 2O0OA 5HBAA 4HVOA 4AGGA 4JC1A 3GCWA 5AFBA 1OMIA 4WV8A 1S0CA 1AL22 1W04A 2HWB2 2VM9A 3ZVXA 4D6RA 5LWBA 2VZTA 3ECQA 2Y6FA 1RHI2 3BYWA 4OYUA 4H3WA 4QDQA 4CU6A 4PHZA 2B46X 1U12A 2WNVC 4IGPA 2A3XA 1CAVA 2DVBA 4WZCA 2X05A 3T2TA 3HJRA 2WDBA 1QNWA 2D6NA 4E2GA 5L9RA 1YFUA 3ZFEA 1RB8G 1I5PA 2GC2A 4PLOA 1PO22 5JZGC 2EXKA 3EJKA 1C1FA 1ULFA 3P5BA 1YRZA 1HB3A 4COZA 3U37A 1EV11 2AEZA 1WW4A 1VALA 1QNYA 4XIKA 1D2QA 3B9IA 3WG4A 4Y1VA 1SPPA 4LR4A 3RG0A 1V0AA 4Q0PA 4AGRA 1FV3A 1CAWB 1CIWA 1ASJ1 1ASJ3 3CMGA 4MXWB 4QDSA 5E1RA 4B1MA 4XQ4A 4AOCA 5KWRA 1MS9A 4LLFA 3AKSA 3WHUA 3N9MA 3WF0A 1MEC2 4YG3A 4JGYB 4ZONA 5IVBA 4IE4A 1LHOA 4AR2A 4XETA 2F4LA 1C8M2 4GMP3 4OHYA 4CEWA 1POV1 2XWBB 3VBOC 4X6RB 3VDDB 2BBAA 4XAEA 4IQPA 4QPYA 4EN9B 3M3IA 5KXBA 2YC4A 4MHUA 1NCRC 3WQ1A 5I0RA 3CJXA 4CCKA 3E5XA 1LEDA 4CEYC 5C3PA 4LUMA 2JDYA 3HPNA 1KFUL 3HNYM 1ULCA 4Q27A 3VL9A 1YQ8A 4BK4A 2ILMA 1A8DA 5FIXA 3CJIC 1ZX5A 1UPSA 4L0PA 1IZ3A 5DZFA 4CCOA 4ARXA 3VKNA 5FKCA 3ZN6A 1W0NA 4GKXA 4CP0A 4QPGB 1WCSA 3NL1A 4PDWB 1WGPA 4KI5M 1S2BA 1TEIA 4NJ4A 5BNNA 4A6OA 3V0BB 5K9YA 3MZHA 5IJRA 3RZLA 3ZFGA 2Q5TA 5HPOA 1GANA 1ZM1A 5DDJ3 5DDJ1 1IPKA 4I01A 5A3MA 3RJRA 1ENRA 4NIAA 5JOWA 1NLSA 2W1SA 3I2GA 2VQAA 1PGL1 1RXGA 5CIRA 1U5XA 1V9U2 2UU8A 4GALA 4JDNA 2E53A 2P1BA 2VQUA 2B5HA 2P3YA 5FLHA 1W6MA 2VUJA 3C7OA 4JTNA 1JZ8A 1RUD2 4MO3M 3JBG2 1G9FA 1F35A 1RUJ2 4Q26A 3VD7A 4QU2A 4FP2A 3URFA 1RJ7A 5JWPA 3HN1A 3PVNA 1UD1A 3FWEA 3IMMA 3OUJA 1OOPA 1CPMA 1F4AA 2K2SA 1G6NA 2VR4A 1UZ0A 1CJPA 1CZSA 2XH6A 5KXEA 4PLNA 3TB0A 1NA1A 4NN0A 5AVAA 2IXCA 3MEPA 3OD4A 4H2AA 5ABJA 1UAIA 4QXHA 2VTXJ 3DL3A 1QJX1 1QJX3 1H6XA 3P3NA 4RS5A 4WM8C 4AVBA 5J7MA 2BGOA 3SHRA 2OA2A 2C1FA 2Y38A 1AXKA 2YFZA 3H8OA 5CFCA 1O3SA 2EA7A 5CNAA 4IV3A 3HD8B 1Y9QA 2D97A 4ASMB 1UO9A 2KM2A 3PNAA 4AFBA 5EWSA 4LBQD 4CCEA 2KA3A 3TEYA 2OIIA 3OG2A 3LA2A 4X8PA 5D8AC 1XYOA 4GH4B 2BBVA 2CWMA 1DFQA 2VNOA 1EP0A 2ZGUA 4CDWB 1H1IA 1YIFA 2J1SA 3VB9A 2B45X 2A1XA 3NSTA 3I2JA 4UFIA 4XFAA 1W2AX 2ETEA 3MF9A 4FPCA 1VLNA 4KGGA 1PK6A 2BQPA 2LRPA 5FYYA 4BLJA 2PHTA 4ZHNA 5JIUA 5KXDA 1UY0A 3KVAA 1Q3EA 2WN3A 3NV1A 3S57A 3BU7A 3FC0A 2WYSA 3VDCA 2GMEA 1AYN2 3AXEA 5GLUA 4DOUA 4IE6A 3RYPA 2JX9A 4UOJA 4NUBA 3GBFA 5FZOB 3HNBM 5F3GA 1FAYA 1NYWA 4QX1A 2QZ3A 1O8PA 3NV4A 3WW2A 1UU6A 3FUQA 2Q0AA 4RR3B 3KD4A 3H7JA 5FYVA 1U5IA 3PMSA 2UYAA 1VRH2 5A6XA 4W6WA 5EXOA 3F2ZA 5T5LA 1REFA 2JENA 5A7OA 3E97A 3MF6A 4S2HA 3ASIA 5ISLA 1S1AA 1GQHA 5F3IA 4QDRA 2ADDA 5L19A 4IGQA 1XSQA 3UKTA 3H1YA 2WNEA 5A7WB 2QDRA 4UW3A 4S2FA 3T0BA 2WS92 3W9AA 5I0DA 1HV0A 1OC1A 3KS7A 1UXZA 2YB7A 1W0PA 4FTEA 1J84A 2A6VA 5DAPA 1HRI1 1HRI3 2RDSA 4IESA 5J09A 2J22A 3WNXA 2XJRA 3RNSA 1QF3A 5FY8A 3VGIA 1YC61 1CAUB 3LDBA 2W94A 2UWBA 4K40A 3B93A 4QX2A 1NY71 2A75A 2JE9A 2WZR3 4GIQA 5EJ3A 3WF4A 5C4WB 2WNOA 2LM3A 5EJ1B 4HKOA 2WLPA 1HRV1 2P2KA 2BOIA 5KC6A 1FNZA 1W6PB 1PHMA 3FHIB 2D44A 1YWKA 2J1EA 2GP3A 5CEHA 3GYDA 1O3QA 4LE3A 1ZA4A 2W39A 1B35A 1OA3A 1YFXA 4AI2A 4YNIA 4J1XA 1MQTA 1W0OA 4TLFA 3ACIA 4PIXA 5IVCA 1COV2 4L11A 5T5PA 2HJIA 1PGSA 1IPSA 3GZUC 3UNPA 2WWJA 1ENXA 3QH7A 4YW5A 1ENSA 4R4ZA 3VBUC 2OPWA 1EV12 1JI6A 1PZ9A 4L92A 1DGWA 2WFPA 1P8JA 3N35A 5FMCA 1TME1 1TME3 3PHMA 5KHHA 2CV6A 2FZ2A 3ZFFA 1RUOA 5DUXA 2LTNA 3RWNA 1PO11 2AUYA 2WAAA 4QGLA 4CU7A 3N9PA 3JQWA 2D6LX 4CDXA 1PVC2 3L9JT 2V4AA 4BM8A 1W99A 4PF1A 3LCPA 1J3RA 3BTZA 2VMCA 2ZKNA 1H30A 4O61A 3OEAA 1W6NB 3ALQA 4FT8A 4UFMA 4XUPA 4DRRA 4YZ3A 5ANNA 1XC6A 1SDWA 2P3IA 3LEKA 2PAEA 4RSUA 2VZRA 4I09A 2YPDA 1KJLA 2C6SA 3MV11 3CO2A 4HK9A 2C26A 5FK8A 3VDAA 4FBFA 2FDKA 2QQKA 3RRDA 1YI9A 3DYMA 4QKFA 5IVYA 3OGVA 2W08A 3HQUA 3VD3A 2IC1A 3ENRA 1GZWA 1GV9A 2B4KA 4IEZA 4OI1A 2CHHA 3GGLA 3KF5A 1VP6A 3PJQA 4LO6B 4XZUG 4OI2A 4CDUA 1SZBA 1QEXA 1W9SA 4OLLA 2W2IA 1MZ5A 3QCWA 4KG0A 2AREA 1J58A 2FCUA 1N1VA 5A1FA 5IT6A 4FFIA 4AG4A 4BIFA 1D4M1 1D4M3 4TTGA 2VH9A 4MLOA 2ZKLA 3FLPA 2D40A 2WQZC 3UL2A 5FYIA 5EFUA 3ZPOA 1GOHA 1RXFA 4PIZA 3DEMA 3K4AA 1CD3G 1AR91 1AR93 3NRUA 3TWIA 4I3GA 2WNVB 3I2DA 2V09A 4BQYA 4M3CE 4WBBA 1YQ6A 3OOXA 4YZ4A 5EJZB 1JMUB 2C4XA 2PA7A 5GZEA 2Q4SA 4AFAA 1PGL2 4LPLA 4K20A 5FP7A 1Q8VA 1DHKB 1J83A 4EN8B 5IFTA 1SDDB 5JZGB 1EAH1 1EUTA 5FY7A 3VBSC 4C1WA 2E9QA 4XF3A 2MEV1 2MEV3 4GULA 3SISA 3MIDA 4I0AA 3CL1A 4LBJA 2YG0A 1L7LA 1W2UA 3EB7A 3LDRA 3WP4A 4AEDB 1FMD2 2JDZA 2N7GA 1K45A 4LBQB 5LRRA 4Y33A 1XQNA 4O9GA 2W95A 1AR72 4IGOA 1J59A 1BMV2 4E9KA 3S5QA 1BQPA 5FZEA 4Z8BA 2E6VA 1MZEA 2EXJA 2W0XA 1ZA7A 2ZPXA 1H1MA 2EXIA 4LKDA 4LKEA 4AVVA 5C33A 5FZFA 4P9YA 5KHKA 3BI3A 4NHMA 3GZEA 4J1WA 3HQXA 4K3UA 2RMU1 2RMU3 1DYKA 2BZDA 3AMMA 2HYXA 2QQNA 1ULGA 4R9BA 4RQPB 4FPOB 2EIDA 4QHZA 1LU1A 1ONAA 5D21A 4KBZA 4C1XA 1W8FA 2VZ1A 3CZJA 3GXUA 1AR61 5L7OA 1NCRB 5FZ4A 2JE7A 4WVZA 4CEYB 4BIOA 2Q8DA 2ZGPA 4N53B 5FZ6A 3I3MA 4AQSA 1AUYA 4QMAA 3PVBB 4BWOA 2QKDA 2XVGA 3VZMA 5F37A 3CJIB 2A3WA 5FZ3A 4JGZB 5FZ1A 4ZY9A 3T4HB 3WQ0A 2V72A 2ADEA 1G86A 2ET7A 2Y6LA 3OBAA 1CZVA 2GMPA 4OUEA 4Y5Z0 5KC5A 4YLZA 2NZ9A 2VNVA 2C5DA 5H9RA 5DAWA 2OQ6A 4CXXA 5IVVA 4B29A 3CKHA 4YGEA 4QGMA 2VNGA 2VMFA 3SQOA 4QT6A 1O5LA 3TNPB 4FTBA 1NUKA 3AZWA 1OQ1A 4XFHA 4IEXA 1LGCA 1O3RA 3E1F1 2E7TA 3O12A 1KS5A 2E63A 1ZZ8A 5FO8B 5HCHA 3AZVA 3R0RA 4QGNA 2WZ8A 3ZXKA 3V0AA 1UOBA 1QXRA 2OVUA 2W52A 2DCZA 2WYFA 2YHJA 4UYBA 2CDOA 5HXMA 1X9PA 3D0SA 2CGPA 3BVCA 4CP9A 4BQXA 2CGOA 1UF2C 4LHSA 2PYTA 3NVCA 2OKXA 3AP7A 1W9FA 3ES4A 5JPNB 4A3XA 4DINB 4WM8B 2HWF2 5KXCA 2ZX4A 3VDBA 4XJ8A 3K2OA 1N3PA 1FATA 1X8MA 1HW5A 4AEKA 3MUZ1 1XE7A 2ZAHA 3M8LA 1GOGA 3ZXLA 2Y26A 3U4SA 2AH2A 4AI9A 2XLGA 4TXWA 4F7ZA 5BNNC 3I2IA 1X8EA 3HBZA 1HRV2 5D8AB 3LSEA 1AX0A 1IS3A 1IS6A 3VD5A 1RL3A 3OY8B 2VZPA 4XOGA 5FP8A 3ZFGC 5IK8A 4JHZA 4YSFA 1YUDA 3K4DA 1H8TB 1OF3A 2KR2A 4IL7A 3ZYGA 3V65A 4AI0A 4NIGA 3WX5A 3ZIXA 4OZOA 2VC9A 3CU7A 4EN6B 1XRUA 2QTWB 2TBVA 3I2FA 1WBFA 1OH4A 3RWKX 5HXVA 5IVFA 1YFWA 5DAVA 4UW6A 3BTYA 4FQ4A 2VMDA 3BPSA 3N7KA 5J98B 5LA2A 2JG9A 1WLCA 1OURA 4XILA 4EN7B 1PNGA 4ET7A 3NV2A 1OOPC 2X53S 3Q8EA 1V6JA 4YVSB 3AVRA 4AVTA 3JD71 4K21A 4UFLA 5FZGA 4DS0A 1NA1C 1ODNA 4ZU4A 2DCJA 5HCFA 2C9AA 2NYYA 5ABJC 2FD8A 4CXYA 1C3HA 1PO12 1QWRA 1RUF2 1Y9GA 4IE0A 4RS5C 3VBRB 4BLIA 4YRDA 3POJA 2JDPA 5BNQA 1OT5A 2FDIA 3M7AA 4BA6A 3TYJA 1AHSA 4IDZA 2K9ZA 4XZPA 1RUC3 3ZYPA 1CN1A 5CFCC 2RDNA 2VTXA 1VB2A 4LNVA 4IV3C 1IHMA 4YW1A 3NNFA 1QJY3 3UJQA 3A23A 2EALA 3PMEA 3UV9A 1S0BA 3MW2A 1HX6A 1URXA 2O8QA 3IKWA 1NZCA 2NMNA 4EZ4A 2J1TA 3LEGA 4Q4W2 2XHKA 1FOD1 1FOD3 2XOMA 3O5SA 1RUG2 5GM0A 1MACA 4DZGA 3E5QA 1PK6C 1PMIA 1DQ5A 1R082 1VIWB 2MNGA 1UOGA 2PHWA 5LEKA 3I2HA 3CEWA 4DY5A 3N4MA 3P6BA 1XE0A 1UYXA 3LIHA 2JIGA 1JN2P 4QM8A 4MZUA 1CJDA 1H1AA 2W46A 4PF5A 3FLRA 1LR5A 1I9RA 2JG8A 4Q4V1 4Q4V3 3TN91 3TN93 4B1LA 5JUVA 1HJGA 4QX0A 4IEUA 1KGYA 5CADA 1SBEA 5C70A 3POYA 4E8CA 3U1XA 1GNYA 1LECA 1TVGA 5FPVA 3KGLA 2VGDA 4MGKE 3VD4A 1CAXB 3FBYA 2WWSA 1STMA 2IXLA 2H0VA 4DUVA 4Y1YA 1GZTA 1SEFA 3H9AA 3RFRA 4IV1A 2YYOA 1QDCA 1YIPA 1S2EA 4U36A 1XXNA 1Y3TA 2JKXA 2VVEA 2HWE1 2HWE3 1EAH2 1NQDA 1YO8A 2YY1A 3FL7A 3USSA 3UK9A 4BOWA 1JZ4A 2BNOA 4XUTA 4ZS2A 5L9BA 3I3QA 1BK0A 4D7YA 5DPNA 4AI1A 2JDUA 1WMXA 2R072 1H6YA 4N43A 2VAUA 4XJUA 4YM2A 4AQ2A 5F7UA 3N36A 3AMNA 4BYYA 1PIV2 1AZDA 4OULA 1RVF1 1RVF3 5FZBA 1AYM1 1AYM3 1JOBA 2WKKA 3N7LA 4Q0QA 4ZKTB 1DP0A 3WDUA 4MGYE 4CPBA 4B7EA 4OHXA 4W6XA 4Q0SA 2RMU2 5EYYA 4LORA 5IHRA 1SLAA 2WSUA 2WUHA 1S0IA 1S0GA 2NM1A 1W05A 5EV7A 3ZLIA 5FPUA 5C9AB 4LBLA 4AFMA 4H14A 3OB8A 1AR62 2Y8KA 3AKRA 3Q8BA 3ZYBA 2DCYA 4E4HA 4B4PA 1XNBA 4MVTA 4QB2A 4AF9A 4B4RA 4Q4Y2 5JMCA 2ZAAA 1UZWA 3ZKUA 5AC91 4WVMB 3SEPA 4UF0B 2NQYA 4JRLA 3VD9A 5IK5A 4NIHA 1B35C 1H9PA 4CUGA 4PLMA 4XUQA 1MQTC 5JXIA 4QXBA 2ZGQA 5ACA2 2EIEA 2PAKA 2RM23 2XJVA 4R4XA 5ANQA 3EYPA 4XQWA 1W06A 4NOTA 3BALA 1G9BA 1GWLA 3NW4A 5JOXA 5FY1A 2VOTA 5A33A 2ZEZA 5LRSA 4QQ2A 1QOOA 4GB31 2VW0A 3MPBA 2QQUA 4GB33 2P37A 4RHV2 5IVJA 3ZFFC 4GZ9A 1HLCA 4N8MA 1RITA 3BOPA 3UKVA 4UXAA 3WDVA 4A3ZA 5I8YA 1XE8A 1X7NA 2HLEA 3ILFA 4IEVA 4XBNA 4ZU5A 5EIYB 5A70A 4TZDA 3O1TA 2DBIA 2DTYA 4CDXC 1KRIA 1DZQA 1W6OB 1JTZX 2GN7A 4UW4A 2R49A 3MLLA 4KH9A 4Q4X2 1UX6A 1E5RA 1LKNA 1YEWA 1ZZCA 3RZZA 2UWAA 5J1XA 1DIWA 4UWDA 1WZXA 2V73A 3APBA 3BGAA 1WKYA 3I4IA 5FYBA 5K0UA 1Z7S2 4RN5A 5FKBA 4XABA 4Y5TA 4LO4B 4QX5A 4AZZA 4CCJA 3ZKYA 5LEJA 3BODA 2YFUA 5E89A 1FXZA 1EPZA 4BQ4A 4I0BA 4TSVA 2ZHMA 5FV3A 3V64A 3ZR5A 2EAKA 1XNKA 4Q0UA 4CUCA 5FPAA 3AMQA 1NCQA 3GHNA 4Y4RA 3USUB 4BCUA 1JZ3A 5J96B 4CDUC 5T5OA 1NQJA 3K75B 5JMOA 2VCBA 4RGAA 1WA4A 1ND3A 2D7FA 3Q8CA 1OFNA 4ZPIA 1LRHA 1UIJA 2YUEA 4FO9A 2XB6C 4YGCA 1K42A 3PIJA 4LITA 3T4VA 1RGSA 5FYSA 3VBHA 1D0HA 5AFEA 1YI7A 1YXWA 2YXSA 1MS4A 2QJVA 4LBMA 3RI8A 3SH4A 3TBDA 2JXAA 5A3UA 1XYPA 4GJYA 3O0VA 5IFPA 1ZZ6A 5AVPA 4MHRA 1CWPA 2HWD2 2KXLA 3EMRA 5FYTA 3O1SA 1VBB1 1VBB3 2VCMA 2WO7A 3SCGA 3T30A 5A1AA 5JPMB 3D8CA 2QQLA 2SBAA 2A5ZA 3BIEA 4MG2A 5FPLA 1ZBE3 5A7PA 4QPIB 4A44A 1SCRA 1ZVFA 1HN0A 4ZXEA 4XMIA 1UOJA 2GC3A 3SCHA 1IQAA 1WLWA 2D6KA 1SPPB 3GNEA 1NE6A 3JD72 4IUGA 2LW8A 3AK0A 3AB0A 3IDBB 3MFAA 5LBBA 3VHRA 4EE2A 1VBC1 1VBC3 1E57A 4WZFA 4BB3A 5J48A 1O3TA 5DUVA 3NV3A 1H9WA 2OZJA 3ST7A 2J1UA 5A6YA 2BWAA 4KL1A 2QQMA 5EP9A 4BJ0A 1SACA 3M3EA 1JODA 5T52A 3MFCA 1V6MA 3D5OA 1NXMA 4GMP1 1O91A 4HSLA 5BNPC 2XL7A 3SNMA 5D1IA 3ROUA 2TNFA 2A7AA 2G9GA 2ORXA 3MDPA 2IFRA 4JKMA 3THTA 3ZMNA 4MADA 5BY5A 4PI0A 1JZ7A 4UT5A 5HCAA 1DCSA 2WNUB 4YGBA 2CWSA 1F31A 1FOD2 4MH0E 1CAWA 1RMU3 1RMU1 1LEMA 2NP0A 4MXWA 2AEYA 4AHXA 1JZ5A 4YFZA 3ZN6B 1RUI1 1RUI3 2Y6KA 4HG6B 3L2YA 4JGYA 1CONA 1VAVA 2I74A 3Q8FA 5BNNB 2IWGB 1OPOA 2VZVA 4EWEA 1ZRRA 3HQRA 1G9AA 3ORJA 3TN92 1OHFA 3VDDA 3AZXA 3S30A 1R64A 1EUUA 2BEOA 4L8QA 5BNOA 4NPLA 4YVWB 2WQ8A 4UFKA 3I7DA 4A2UA 2RG4A 1PGW2 3OF1A 3OGGA 3ZDVA 3D0JA 1U5YA 1JS9A 1C57A 1RUE2 2Q1ZB 3RMYA 1W6MB 4BPZA 1NG0A 1RJ8A 4Y20B 4Q1RA 2QUOA 4YW6A 3W20A 4BXFA 5CFDC 4XACA 5DABA 5FO9B 5FZMA 2XBO1 2XBO3 4KNCA 5F5QA 5APAA 4DEVA 4JZRA 2F4PA 3O0XA 1I3HA 3KT4A 4AI3A 2Y64A 3MIHA 3A0NA 3OGSA 1IG3A 4Y22B 4CSWA 1MVEA 1VBA3 1VBA1 2HEVF 3HVDA 2BVBA 2CAUA 3WNOA 1KD7A 5ABJB 1H4GA 1LJ7A 5A6QA 2ENRA 4NPRA 1LOBA 5FYMA 4JQTA 4AVAA 4RS5B 4UAPA 4WM7A 4TN7A 5FR3A 4D0QA 4CVUA 2WAOA 1UOFA 1AR81 1AR83 2YU2A 4W50A 4FPEA 3HWJA 5FQ0A 2K0GA 4DUWA 2WQ4A 5CFCB 1C5IA 1G7YA 2PELA 5LATA 3KCXA 3BKZA 5CG8A 1LB2A 5FMDA 4NHLA 4DUXA 3OYWA 1BVVA 2ZX3A 4Y26A 3AP4A 2R041 2R043 4B4QA 2I45A 2BGPA 3ZX7A 1R1A2 2O8OA 1I5ZA 5A3LA 3HEIA 1A34A 2PMWB 1S0JA 4AQTA 5AC92 4BXSV 3ZYIB 1TNFA 3INAA 4HK8A 4OQ8A 2UY8A 3WNMA 3MW3A 1PK6B 2VULA 2OYZA 3ZDSA 2RR12 4QQHA 4HLTA 2ZX0A 2VBBA 4XDPA 2H6BA 4BZ4A 2RHPA 1J3PA 1UW8A 2VG9A 1KEXA 4AEJA 1Q43A 4OI0A 3M3QA 4Y1ZA 2FQPA 4P5HA 5FUIA 4IE7A 3RZHA 2PN5A 1NT0A 1VMFA 2JG9C 5BUVA 4XDQA 1UY4A 3RMXA 3AZZA 3H8UA 1NLRA 1DLCA 2VMGA 3AJYA 5I8SA 1XU1A 4OI4A 3RZJA 4Q0VA 4CDQA 3B3QE 1VMJA 1HXS2 3ZR6A 1RUH1 1RUH3 2ZMKA 4GH4A 2RS32 4HPKB 1CIYA 4J6GA 4N9IA 5DG1A 4XHXA 3RS6A 2OZ6A 4FPLA 4X6QB 5F8PA 1F8VA 4XF0A 5FZCA 2B8MA 3ILRA 4QX7A 2D5FA 1OBNA 2ZTNA 1UMZA 3S7EA 1PM4A 1NZIA 4FXGB 4PJYA 4EWDA 1L7RA 1ULEA 3AJZA 1N3QA 4D6QA 2GNBA 1FT9A 1I6XA 1WLDA 2P4EA 3ZXGA 2AENA 3ZMOA 3WEZA 4D6SA 3MICA 4OHZA 5FLJA 4W6YA 2C24A 1LCLA 1D7PM 2DYCA 4FFGA 5FZOA 1VBE1 1VBE3 1IS4A 1LHUA 2AC1A 1BEV1 1BEV3 4URTA 2XLFA 3ZXDA 3ACHA 1US3A 2P5BA 3VHNA 1ZBA1 1ZBA3 2VO5A 4NRPA 2ZBJA 1OUXA 2VQ0A 5IW0A 1ZRCA 4IEWA 4XC9A 3POGA 1LOEA 2ZHKA 4E4SA 5JR2A 5JOZA 1WBLA 1TMF1 1TMF3 3MIBA 2H6CA 2WZR1 1DG6A 2IUWA 1W6QA 1WCDJ 1OA2A 1W3XA 1ZZBA 2JG8C 3ACFA 3R05A 1MZ6A 2XUEA 4DB5A 2J1VA 1LHVA 5A7NA 3WDTA 3AZYA 1VJ2A 1SLIA 4ASLA 1OKQA 5FY0A 5C3SA 4MGQA 5KBFA 2D3RA 5A7WA 1B35B 2HBUA 1H2LA 5A7SA 3J26N 1CGPA 2ZGOA 1DYOA 1MQTB 2QE3A 4MGIE 4ISRA 4IV1C 4FAHA 3TEZA 1JYWA 3ACGA 3CF6E 4FOQA 4AEMA 4URAA 2FCVA 1Y43B 2FBEA 2ZGLA 4LEJA 1JW6A 3VBFB 3BB6A 4OCTA 1M06G 5I8TA 2VZQA 4QQLA 3AP9A 1W8NA 5FTTC 1GMMA 4QX8A 2W1UA 1W39A 3OPWA 3KM5A 1ND2A 4N43C 3ME2A 4XAAA 5A7QA 5FBZA 3WDWA 4MGTA 2DDUA 3GDBA 4KBBA 1ASJ2 2XKOA 2JECA 4JX0A 3I3BA 2YROA 4YW3A 5DUWA 5LA0A 3G7DA 2Z79A 1W2NA 1E5SA 4IEYA 3KCCA 3DPRB 4R8HA 4CRQA 4JTOA 2Z4FA 5FUPA 2Y60A 1FNYA 3PU8A 1MVQA 5CA6A 4OFGA 4YM3A 4N7UA 1C5HA 1QJEA 1SMVA 2Y6HA 4OHWA 3FFQA 4AWDA 5F3CA 3LZZA 2BUKA 1HQNA 3RI9A 3D4KA 3WCRA 2XQXA 2B39A 2JDHA 4F8AA 5A3TA 1GZ9A 4LLOA 4XFGA 2DCKA 1L7QA 4XBQA 4CDUB 1A78A 1FPN1 1FPN3 4QXCA 1IPJA 3DV8A 2B9VA 1M4WA 4I2OA 2PHXA 1ZZ9A 2Y6JA 3H50A 4Q29A 4YW4A 5A3PA 4NHXA 5C71A 2VW1A 3N9QA 1KDKA 3VHPA 3HT2A 1A3KA 5C8WA 1UY2A 2FCTA 4DXRA 3I59B 1UZZA 1X50A 2W5FA 5F5IA 2HBTA 2Q30A 3GBGA 1BXHA 1YQ2A 4ISQA 3WW1A 3LIGA 3QD6A 2CAVA 2RDRA 4GKYA 1W8UA 4KGQA 2WZEA 3EQEA 1H4HA 3RSJA 1LNSA 5JAXA 5DDJ2 2XLAA 5L9VA 2YC2A 1UU4A 2ET1A 3FLTA 1MR5A 3IM0A 1DQ4A 4E4ZA 3ZXJA 1NOVA 3B94A 4IEQA 3MIEA 1MS8A 4JDOA 5GZFA 1N3OA 2RS53 1QJU1 1QJU3 2RS51 3PL0A 3FHAA 2PLV1 2PLV3 2JICA 2QQJA 5K0UC 5CZKA 2VZSA 4RGKA 2DVDA 2BNNA 1DQ1A 1VBD1 1VBD3 1BZWA 2JD4A 1WW6A 5FXXA 1VBA2 3ZYFA 2D43A 4XUNA 5FO7B 3AP6A 3I3DA 5C5TA 4IXLA 1LENA 4I3PA 2QQIA 5EQUA 5ERLA 3DYOA 1NCQC 3RZKA 4IEOA 3UETA 3OPZA 1N1SA 1V6NA 1K5MC 2JDAA 4RFT0 1QJX2 2W47A 1HKDA 1MS0A 4KWLA 2RS11 1ND3C 2RS13 3E6DA 1GBGA 4I02A 2XVKA 4HFSA 1CESA 5GKAC 3VBOB 5BNPB 4NIIA 2Z2SB 2VQTA 1H0BA 4YGDA 4CYDA 5IAVA 3VBHC 2DU0A 4BQ1A 3RQ0A 2XXZA 4A7KA 1UWWA 2ZMNA 1DZTA 1JOJA 3FBMA 4GWMA 2BPA2 2Q8EA 1UYZA 3AFGA 4AEDA 3THDA 1Y9MA 4GAZA 4ZU7A 3D3AA 4E8DA 2VBDA 2PXJA 4OMCA 4D7TA 2DBNA 4SBVA 3PUSA 4BH9A 4GJZA 4CPBD 5I0SA 4FI9A 2VVFA 1ST8A 4M4RA 3I97A 3KV5A 2E32A 1TZOA 4UFJA 5FOJB 2BFUL 2RJKA 3ZFEC 1TE1B 3KT7A 4F83A 3RYKA 2DV9A 3LSDA 1IS5A 3B5LB 4Y1XA 1D2SA 1S55A 1SFPA 4A7YA 4RQPA 5CBLA 3U0ZA 2TUNA 2KD7A 3ZYHA 4LA3A 1T6BX 5DG2A 3WP5A 4XTPA 4HKLA 2E51A 3O0WA 3V56A 2IZWA 1UPIA 5EHDA 3SKVA 3M70A 3AL6A 4AHZA 2JDNA 3LEIA 4W8JA 5FPBA 4QKBA 2ZGMA 3DECA 3H1WA 4N53A 4SLIA 3V0AB 2ZGTA 5F39A 3UJOA 5CFDB 1R091 1R093 2NN8A 3QACA 3NKGA 4CCNA 3NWKA 3AMPA 2VJXA 1KDMA 3OJBA 3ILNA 2VMEA 2EAAA 4XHBA 4JGZA 4CP9B 3E6CC 2Y0IA 2DVFA 4HT1T 5FRAA 3W5NA 4CEWC 1CX4A 2VOWA 3WG2A 1O4TA 2LALA 5EYXA 1KFXL 3CQOA 2BW8A 3OBTA 1QH6A 3A0KA 4JQRA 4NWWA 4ASKA 2E7QA 4YPJA 1OD3A 1N47A 3KT1A 1OVPA 1F4HA 2XKPA 2R061 2R063 1LTEA 4AFCA 2GSYA 3J7NA 3HIFA 2UYBA 2XDVA 1HRI2 3HR9A 3PVOA 1LOFA 2GNTA 1K12A 1GP4A 5FMOL 4FAGA 3N7MA 1QMJA 5FZ0A 4JGYC 4N9HA 4CP2A 4MX3A 4LOTA 4QKNA 2VBPA 1XNTA 1NY72 2WZR2 4MSVA 3UKNA 1C28A 1F15A 3UT0A 3KCYA 1IOAA 3IN9A 3VDDC 3LOBA 3FUOA 1W9WA 2LUWA 3GBWA 5BNOC 3WUDA 4XJAA 1GNHA 5GALA 4UFHA 3VZNA 2E31A 5JIAA 5FZ8A 5CYYA 2IVIB 4LOSA 1EPWA 4JAAA 4LKSA 3WY6A 4XIOA 1XOYA 4AL9A 4LT5A 2PHRA 2GMMA 1PX4A 5K4LA 3RJ2X 2VU9A 2XQRA 3ATGA 2ERFA 3LD8A 4E4DX 3AFKA 5A6ZA 1UYYA 3IT8A 4FP3A 4FPKA 4K1YA 2QQPA 2R16A 2WJSA 2JG9B 3TEXA 3O1VA 2ID4A 3N3HA 4XF1A 5DZGA 3IAQA 4M00A 1BLZA 5LY1A 1UKGA 4HANA 4V2WA 1XU2A 4O7XA 1AL21 1AL23 2HWB3 2HWB1 5B4XA 3AL5A 5I93A 2I2SA 1S2KA 2UY9A 2BVVA 4FTSA 3IPVB 3GZAA 5I0UA 3T1LA 4PCRA 4PQ9A 4WM7C 1TME2 3OY8A 4JRAA 5JXJA 3KV6A 4XTMA 2P6CA 5JDBA 1OD5A 1H8TA 2AYHA 2ZX1A 5M0TA 2X09A 2QBXA 5FZ9A 3U11A 1OLME 2HEYF 4YZ1A 2HEWF 4XXAA 1TQ5A 4LA2A 2ORZA 2DVAA 3CZUA 3D6EA 4JKLA 1GP5A 1RUC1 3DXUA 1PO21 1LOCA 1PO23 4UI9L 3K77A 4RFRB 1GICA 1ZZ7A 2XJPA 5BPXA 1S0FA 5CISA 4PBOA 2R1DA 5CU1A 2EF6A 2DFCA 1QJY1 2EICA 2VUDA 4FXKB 1DDLA 5FOBB 4R9DA 1BVP1 2FHRA 2Y0OA 2ZEYA 1POV0 2J1AA 4YVSA 1ZNPA 3O7OA 4M3CA 4A7ZA 2GH2A 3WNPA 3TOJA 2WO2A 3WW3A 5IYYA 1AX2A 4Z82A 1DU3D 5JI9A 4G3YC 1MEC1 1MEC3 2XG3A 5GZDA 3VBRA 3JU9A 5JVVA 4JKKA 1OI6A 1G8WA 3KHCA 4EJRA 1C8M1 1C8M3 4OMDA 4C0BA 4ES9A 1ENQA 1ZRIA 3O1RA 1ULOA 5F32A 1D4M2 3GHMA 2GNMA 4LBKA 2D98A 2RJLA 4CP1A 4E27A 2W68A 2BGCA 4HKWA 1OKOA 2VPVA 4LO5B 4E2SA 3ZM8A 1AR92 3H7YA 4FPJA 4CDQC 3AYEA 2X5IA 3BUCA 2V5YA 4IV1B 1OUSA 1XB9A 1LGBA 3LOIA 1WW5A 3G6JB 5IWFA 4W65A 3IAPA 4K8RB 2B42B 4LE4A 4BQ5A 1UZYA 4DMIA 2ATFA 3ZSJA 1QJU2 2D93A 5A32B 2XJSA 3GJBA 2P17A 1JYNA 2AR6A 2MEV2 1AXYA 4LK6A 3HBKA 2R30A 3VBUB 3WR0A 2L9LA 4GA9A 4M0HA 5FP3A 2YU1A 2YPJA 5C3QA 5KHIA 1HDKA 3R4UA 5F9TA 4PI2A 3FHQA 2VOKA 1GYKA 5FK7A 4AHWA 2G9FA 4AVCA 1DGRA 4ZS3A 1J1TA 1UY1A 3LE0A 5FUNA 1I1EA 2FDHA 4FOWA 1V9U1 1V9U3 3KQ4B 4LQRA 4MGSA 1CAXA 2BWCA 5FYUA 3OBRA 1RUD1 1RUD3 1UY3A 3JBG1 3JBG3 1RUJ1 1GR3A 1RUJ3 5DN2A 2CSGA 1KQRA 5IUQA 4AW7A 1QHDA 2VZOA 1CX1A 1QJZA 4AK3A 2ARXA 2Q1MA 2XVLA 3C7FA 5C8CA 1JYXA 2Z42A 5K7PA 2XMLA 5F3EA 1GKBA 1O8SA 1AJOA 2OQ7A 3LPGA 4K1ZA 1R1ZA 3WNLA 2BFUS 3BU0A 4YM1A 1UMHA 4PBPA 2DVGA 1JYIA 3OUIA 1W03A 4BQ3A 2XWJB 4I0WB 5EPAA 2D6OX 2ZACA 4Q8KA 2RM21 5JXHA 5LBEA 1A8MA 1MS5A 3ABZA 2WBKA 4P9WA 4P9GA 4GWIA 2PAMA 1JHJA 2WABA 5C9AA 1ND2C 1NXD1 1OLRA 3RZMA 3LF7A 3ZO0B 1W9TA 1V6IA 1Z78A 1JXNA 4R52A 3U75A 1B09A 5HV4A 4WVMA 2UURA 4AE2A 5TSWA 5H9QA 4KWJA 4P08A 3FFZA 2JDMA 3K48A 4M4PA 3VKFC 3VBSB 2ES3A 1BBT1 1BBT3 2VXJA 3VKMA 4QPWA 5K0UB 4S2GA 4AFDA 4CZSA 4MXVA 5FDBA 4EWAA 3NJYA 5FXVA 1Q8OA 1AYN1 1AYN3 3FJSA 1FI2A 3FZ3A 2D3SA 4IEPA 1YJLA 4KMQA 4AQ6A 3OBZA 4NHKA 3O14A 1SFYA 2IXKA 5CKQA 4H7MA 4FPFA 2HYKA 1VPHA 4A41A 4LULA 4Z2WA 3ZSEA 3D82A 5LZ6A 4P5YA 1K5MB 2R062 1QOSA 5FMOS 5IK4A 4LUKA 1ND3B 3ITQA 2ZEXA 3WCSA 4ATEA 3H3UA 1VRH3 5LA9A 2PHUA 1WA6X 4INDA 5CVRA 2XR4A 1O59A 1W6OA 2IXIA 2ZEWA 4NHYA 1ZRFA 1E5HA 3VBHB 3LEMA 3E5UA 2CGNA 3OUHA 4QX3A 3VKOA 2SLIA 1SBDA 1W2TA 2DURA 4L97A 3ZSKA 3OPTA 3NAPA 3J7MA 1NKGA 4CE8A 1CAVB 4QAWA 2ZHLA 3L2HA 2WS91 2WS93 1DGLA 4GQ7A 4B3NA 2Z5WA 2QCSB 3A22A 4X8NA 3MPPG 1OLMA 5JLVA 2BDRA 1WD3A 3LA3A 4JV4A 3ZFEB 3USUA 5G05L 2OX0A 5F5AA 2DUQA 1GQGA 2ZABA 1ZBE1 1YJKA 2C0ZA 5FYCA 2WRAA 1QGLA 5FZIA 3DKQA 5BYNA 1UYPA 5FREA 2XL9A 2D6PA 3PURA 1QJFA 4BDVB 1JZ6A 1VRBA 4HVRA 3K51A 3PUQA 4J25A 1W3VA 4Y4YA 4C8DA 1L3JA 3WOGA 4NRQA 5BXXA 4MUVA 3NJVA 3POEA 5CAZA 5FLIA 1TG7A 4XJZA 2VY0A 5LB6A 3K46A 1BK1A 4CEWB 1COV1 1COV3 1RUC2 5C3RA 3FX3A 2CTVA 2WO3A 1VB4A 4XJ9A 4F3JA 2V4VA 2OUHA 3WV6A 2WO1A 3MO4A 4XVHA 1QJY2 1JBCA 1VR3A 4QPIA 5L7OC 1F9KA 2WC2A 1EV13 4OQ9A 1JH5A 3C7GA 4AEDC 3SCFA 3S5AA 2VL4A 5C7GA 2PFWA 2VZ3A 4UBGA 1MZFA 2XJUA 5FZHA 3K4ZA 3MLJA 4BMBA 3IIIA 3CLPA 2EIBA 3THPA 1JU4A 1DBNA 3M2MA 1SQ4A 4Z1VA 4FSJA 3E6BA 2WWUA 1PVC1 1PVC3 2VNRA 4XYXA 5FMBA 2WA3A 4DFSA 4MOAA 1YYNA 2YV8A 1UCXA 1AJKA 2BP6A 2XJTA 3F95A 2VECA 5FZDA 3WNKA 1UU5A 3PUHA 4ARYA 5J37A 1POV3 4D3WA 4D69A 4PT6A 4RQPC 1Y7BA 1CPNA 4OUMA 1IG0A 3P3PA 5BNOB 3ZFGB 1W9YA 1S4CA 2B7YA 3KV4A 4Q4V2 4D94A 4G9SB 5FZLA 4LHNA 5HI0A 1J1LA 2JJ6A 4EV0A 4LIVA 3OCPA 1JHNA 2XUMA 4N53C 5LA1A 2ARAA 4META 3T08A 3IDCB 1EY2A 4N90A 5GLTA 3QLQA 2WNUA 2VMHA 3U07A 5A80A 3KWVA 4JGZC 2W91A 4XQDA 5SV5A 3S6PA 1XNAA 1UIKA 2HWE2 1X36A 1WLTA 2CDPA 1C4RA 2JWPA 4NE9A 1OOPB 4K8FA 4FVVA 2EIGA 5K8SA 1REEA 4LIUA 4OZXA 5A3NA 4QPGA 3LA7A 5DAXA 3NNJA 1NA1B 3J7LA 4HBNA 4KG8A 4PDWA 4UW5A 4WM7B 3WD5A 3TAYA 5CKNA 5FBJA 3V0BA 5GJ6A 2P3JA 2RVAA 3H1MA 2WSVA 4YVWA 2YGLA 3PLQA 1UMIA 5FQ0B 2BJSA 2G1MA 3M3OA 3WF2A 4AVSA 1RVF2 1AYM2 1LOFC 5E6HA 1ALYA 2CU5A 2G9ZA 3B02A 3DUIA 3OYWB 4P14A 3MW4A 2W87A 4HETA 2P34A 5A3WA 3UGFA 2E33A 3N7JA 1PZ8A 4Y20A 3ACLA 4IV3B 2PQQA 4KU7A 1E5IA 1IGOA 4DEQA 2AZ5A 3MUY1 1GP6A 1JOPA 1FMD1 1FMD3 3J8F3 3J8F1 5FJHA 1QU0A 2EVXA 4BMEA 1W28A 4Y22A 4CCMA 2FDJA 2WL1A 1PNFA 1OQDA 1AR71 1AR73 2JB8A 1UL9A 1BMV1 5FZAA 3W21A 5IAXA 4ES8A 5A1LA 5GLZA 1V6OA 2BOJA 3B9CA 2LS6A 3CNAA 4XDOA 3WDXA 2JKBA 4TLGA 4AHYA 2VOVA 3N9NA 3ON7A 1C8NA 3MIFA 1YFYA 3B69A 4QHBA 1YCIA 3T0AA 4CUBA 2QNKA 2RM22 1IKQA 4K6BA 1NE4A 3SEEA 3WNNA 5B2GB 1Q8QA 3AX4A 3RPQA 3WT3A 3WP3A 1O5UA 4DXZA 1Q5OA 2YGMA 3ZXFA 3K3NA 3N9OA 3PIGA 2Q8CA 1JYTA 4FOYA 2XPJA 4CDQB 3C3VA 1O6UA 3FN9A 3O1UA 4GB32 2DF7A 1GQPA 3IDAA 3WG3A 1KS4A 2JEMA 1H8TC 3THCA 3R6SA 5LBFA 1KXGA 2A6WA 3IMNA 2R0HA 3T2PA 3VKLA 4CDWA 3U4XA 5IK7A 3LAGA 3EXUA 5FCCA 3WINE 1BBT2 4IETA 4QQPA 1H2NA 2GZWA 1WUVA 3M4FA 3CDZB 4QB6A 2WLQA 4AAPA 1X82A 5B4NA 4RD7A 4BHPA 3I54A 4Q5OA 1AXZA 2FMDA 1AL0G 4FPYA 4S2DA 3T3YA 4YVSC 2CY6A 2ZGKA 4XPVA 1XSRA 4Z07A 4DQAA 1W8ZA 3EBRA 1OVSA 5JOYA 2BU9A 2DFBA 5F2SA 3SH3A 1IQDC 3JB8A 1DQ0A 4HPKA 4RR3A 3VBRC 3KHBA 1C1LA 1K3IA 1BJQA 1NAEA 1PMHX 1WD4A 4QU1A 3T2QA 1FYUA 2A3YA 5FAXA 2R32A 2VOXA 2GP5A 1W6QB 1HB1A 4N7IA 2ZMLA 4FQZA 3LDKA 4Q1PA 3H8XA 1OA4A 2GH8A 1LU2A 2ZGRA 1RUNA 3WF3A 3VL8A 4COWA 4FOVA 3DN7A 4IERA 4LXLA 3RDIA 3WQ7A 1OH3A 1U0AA 2X5IC 2F17A 5KHGA 2VTFA 4R9AA 5H9SA 1LOGA 1XNCA 1UKRA 2HWF1 2HWF3 4U2AA 5T55A 3U10A 3WZ1A 2WFF1 2WFF3 5FJKA 3KSCA 1GFF2 5FXWA 1VBB2 4PQQA 4YG0A 2F6BA 4NPMA 1O4YA 2WT2A 4ATFA 3POBA 4BQ2A 1ZBE2 2A6ZA 3LB9A 5FY9A 4LKFA 1OSGA 5C6CA 1CAUA 2BTVC 4YG6A 2GDFA 5C5UA 2DTWA 1ND2B 1HRV3 5C4WA 4COUA 4JCKA 1T6GC 2WT1A 4A6SA 3ZFFB 1GOFA 3MBWA 3AYAA 3WHTA 4NO4A 5GLWA 1VBC2 1W6PA 3JUUA 5LK5A 1N1TA 1SLBA 2ZHNA 3EHKA 4OHVA 4YM0A 4CDXB 1G9CA 2DCTA 4HOOA 2V5DA 4XUOA 1FV2A 3VZKA 2R6QA 4C90A 1Z0HA 3A7QA 1QDOA 1CZTA 5JI7A 1W8TA 2J1RA 1RTVA 2NMOA 3LQCA 4NR1A 4XF9A 1SBFA 4CXWA 5FWEA 4YYOA 3NKTA 3PTYA 3LWCA 5C8CC 1QQP1 1QQP3 3VBFA 2X10A 2JD9A 3ZYRA 3DCQA 4XFFA 2W92A 2XJQA 1PX3A 2Y6GA 3U14A 2E26A 1YNAA 4KWKA 5DAQA 1GZWB 1Y4WA 3GF6A 2GC0A 1RUF1 1RUF3 1PO13 3HNMA 4XFIA 1BHGA 2WZPP 3C7HA 1RMU2 3POSA 2NLRA 4MYEA 1XYNA 3C2UA 5FP9A 4YZ5A 1W2OA 1DQ6A 3VZLA 5LK7B 3DPRA 1RUI2 1F2NA 3N9LA 4AXOA 3M1HA 1SLTA 3NJZA 4EYUA 2BV4A 1W6NA 3QBQA 3LFIA 4H7LA 1IKPA 2XHNA 5LBCA 2QZ2A 5C9AC 4OVEA 1SCSA 2QQOA 1MPXA 3KV9A 1GUIA 4TWTA 2VW2A 3KLSA 3BIWE 5CB7A 4A4AA 3ZN4A 1UQXA 4Q4W1 4Q4W3 4UBHA 1Q8PA 3JQXA 2Q1FA 4XW3A 1XNDA 1RUG1 1RUG3 1O7FA 3H8RA 4NWVA 5LY2A 1UX7A 2JE8A 1R081 1R083 1GWKA 3NMBA 4FCAA 4IE5A 3SLIA 4NRMA 2E7AA 2XBO2 3WQBA 4JDMA 1JYVA 3WUCA 4XURA 1PMJX 1AX1A 1LHNA 1WWYA 1JYCA 5FZKA 4QB1A 3SKJE 2FZ1A 3I59A 3I2OA 3KGZA 2FMYA 4EROA 2W1QA 4XF4A 3VN4A 3HT1A 4XXPA 3SMHA 3WW4A 2AACA 1D0GA 2YBKA 5E88A 1U5ZA 4KU8A 5H9PA 3NJXA 2X29A 4KQ7A 5FZ7A 2UWCA 2WNVA 2YC0A 1AR82 3NNMA 1CQ9A 3A4UA 3H3ZA 4V1PA 2WIIB 3GZTB 1LULA 3AMHA 3UESA 3W58A 3IZOA 4D7SA 4DY3A 4DIQA 2RDQA 3AYCA 1EAH3 4CUAA 4RGGA 3BTXA 2JB4A 3R4DB 1HJFA 4CU8A 1V6LA 3IWZA 2P6HA 5JZGA 2R042 5L7OB 5JSOA 2D5HA 1DF0A 1X9TA 4XEZA 4HMZA 1CR7A 3NO8A 1MS1A 3J8F2 4XCAA 1OPMA 4V2VA 1HQLA 4RA0A 5GZCA 1T2XA 1EYBA 1QOTA 3NAPC 5CKMA 4CCDA 1BYHA 2R071 2R073 4LBQA 1SLLA 3LFMA 4HXCA 5F1RA 3T09A 3S0MA 1WCKA 1QH7A 1H2MA 1WCQA 1PIV1 1PIV3 2J7MA 5DZEA 5FFOC 2BERA 3HN3A 5I91A 1ZRDA 5T54A 1W90A 4CA9A 5I0TA 3ZOIA 3PDQA 2GALA 4P02B 3ELNA 2HWC1 2HWC3 4OUSA 2CNAA 2PQSA 4H55A 2R0FA 4XBLA 3VZOA 1DZRA 2ZS6B 3GALA 1WCUA 4P9XA 4BU2A 3VBOA 5BNPA 5BV6A 5IVEA 1LODA 1AR63 4HN0A 1W8OA 2YDEA 3Q8AA 4XE9A 3H42B 1F5FA 4Q4Y1 4Q4Y3 2AGSA 1PVXA 4KWUA 1NCRA 1RC6A 2QQWA 3A21A 3H3LA 4QWNA 4P9JA 3UGGA 3J7HA 3ETPA 3FMGA 4CEYA 1LHWA 1RUH2 2VCAA 3PU3A 4XJWA 1JUIA 4C0HA 1QKQA 1NLQA 4FPGA 5F5CA 1OLQA 2WR9A 5FP4A 2IXJA 3CJIA 3CIHA 4R9CA 2VUAA 5ACA1 3U78A 1ULDA 5ACA3 4LTAA 1BCXA 1HB2A 3POIA 4FPHA 3J4UH 5J36A 1V00A 3KB5A 4W4ZA 4B7KA 4QPIC 3MV01 1OXCA 2GNDA 5FY5A 2R1BA 1JUHA 1LOAA 3I2KA 4FFHA 4Y1UA 1NX9A 3AKTA 2PHFA 4RHV1 4RHV3 4BQWA 4ZZ8A 4EZHA 5JCTA 1VBE2 5T50A 3WP6A 1K5JA 1YHFA 3LPFA 2XGXA 1BEV2 3JB4C 1OF4A 5JR7B 2D6MA 4Q8LA 4EN0A 1ZBA2 2VUCA 4LBNA 3X29B 4Q4X1 4Q4X3 5CFDA 2CL2A 4GWNA 5HV0A 5F2WA 4XMAA 2DUOA 3SXWA 3OGJA 4LHLA 5SV8A 1TMF2 1GZCA 4IW3A 1J3QA 2DWRA 4HZFA 4DO0A 3VHOA 2GU9A 3B7MA 3I49A 1Z7S1 1Z7S3 5JXGA 4B8EA 1LGNA 5HCBA 1W8WA 3POFA 4LK7A 4Q2FA 4M0NA 3LKJA 1SG3A 1WW7A 2DU1A 2YBPA 3J9SA 1Q8SA 2OW4A 1ACCA 3UGHA 2BNMA 1OFSA 1SFNA 4Y24A 2Z69A 2OXBA 2WNUC 2WFF2 4ITCA 5FXZA 3MIGA 5DUUA 4I30A 1UXXX 4WM8A 2PHLA 1FX5A 1VE0A 1WMFA 2RV9A 2W3JA 4LHKA 2IXHA 4YWAA 1A6CA 1DGWX 3GJAA 2VD7A 3POWA 3PVEA 1ODMA 1PM7A 1HIXA 3T0DA 2WT0A 4QPGC 4PDWC 3W59A 2FDGA 3WF1A 2DUPA 4K9SA 1RHI1 1RHI3 2W9XA 5D8AA 5FYHA 4BK5A 4EQVA 1HN1A 2BRTA 4YVWC 3UYJA 2YBSA 1OQEA 1QIQA 1ZREA 5JSPA 5KR7A 4QKDA 1V6KA 2HWD1 2HWD3 1KITA 1O4ZA 3OEBA 3AP5A 4Y3OA 2XONA 2HH9A 3OSDA 3NNLA 4CCLA 2P3KA 3VZJA 1YQ5A 3DXTA 1VAMA 2OS2A 2YZ4A 2X8KA 3TEWA 4P9LA 4HONA 1QQP2 4M3CB 1X33A 4GMP0 1XBFA 5E16A 3JD73 1S0EA 4GXLA 3B00A 2O1QA 3VLBB 3IPVA 4QHOA 2FDFA 1PZ7A 2HKXA 1FPN2 2GC1A 3AVSA 4D8MA 2G4IA 4XFBA 1VMHA 4ONUA 3NQHA 1UN1A 1ULPA 3IDEA 1V70A 4XFCA 5LW9A 4WVWA 2MPFA 3CHXA 5LASA 3BCWA 5G04L 5DQ0A 3KMHA 3RZGA 4A45A 4HN1A 4QD2A 1LESA 4P9IA 2JG8B 4BE3A 3CBNA 4ZZ5A 5KHJA
chains in the Genus database with same CATH topology
1D4VB 2GAUA 1HV1A 2A70A 1F5JA 4YZ2A 2ZX2A 2X5IB 3Q9OA 1YLLA 2NPIA 4GH4C 3WVJA 4CDWC 3IIAA 2QVSB 4MGZE 3SH5A 2D3PA 2TEPA 4Z92B 2QDNA 1GLHA 2H0BA 1RIRA 2ZOEB 2YMZA 2RS52 3PJYA 4LO7A 1GNZA 1KJRA 2A71A 2PLV2 2OUJA 4B3NA 3MYXA 1Q56A 2ZZJA 3BOWA 3WDYA 1VBD2 5FPXA 4LO8A 2WINB 3R4SA 4N43B 4DPNA 1BKZA 3S7IA 2RE9A 2MHFA 2PTMA 2ZCWA 5JSRA 1PGW1 3VV1A 3ZXAC 4YARA 1H8VA 3MGUA 3H0OA 1QXJA 1RUE1 1RUE3 4RR3C 5T5JA 4DNYA 1N1YA 3OD0A 3TRSB 1CVNA 2RS12 1DQ2A 2I07B 3LGRA 5FPZA 4M01A 3TNQA 4LBOA 3VUOA 1AF9A 2GN3A 4PIYA 5A32A 3AKPA 5C8CB 4C91A 3ZPYA 3VBUA 4QM9A 3ZIWA 4YFWA 2IFWA 3FE5A 1GSLA 3ZXEA 1SLCA 3WLUA 4AI8A 3AXDA 2A6XA 4L9BA 3AM2A 3HMYA 1RINA 4QQOA 3ZSMA 3B01A 3HAGA 5J3UA 4DRVA 2HWC2 2BYVE 2ARBA 2VMIA 3WG1A 2Q8OA 3SITA 3IBMA 2ZGNA 3ES1A 3MLKA 1MS3A 5A33B 1R1A1 1R1A3 5C4WC 5L36A 3AKQA 2VVDA 4JVAA 2PHDA 5AC93 4M3CF 4HSJA 5CG9A 1APNA 1WMDA 3JZVA 5GLVA 2RR11 2RR13 3EO6A 4O9EA 3ZSLA 4MV2A 1H2KA 1R092 3RYRA 4G4FA 4BMBA 4HVQA 5EZWA 4COVA 3WXPA 1G9DA 2ZGSA 4AGVA 1REDA 1TNRA 5E8AA 4YW2A 1WMEA 3BPZA 1VAKA 3VBFC 3ZYJB 5GZGA 4L2NA 3OTFA 5T3NA 1AVBA 2OPKA 4QXKA 3MI8A 2ZJCA 2CYFA 1NCQB 4CTEA 3DGTA 3KQRA 1HXS1 1HXS3 4WVVA 3T1MA 3AYDA 2RS31 2RS33 3KZ4C 4HL0A 5DXDA 4RL7A 1QXPA 2A73B 3JCIA 3ETQA 1VRH1 2QFEA 4K7JA 1S0DA 4NVPA 3DPRC 2WA4A 3I8TA 3M3CA 1ZYBA 3VBSA 4E2QA 1QY4A 3NAPB 4ZXKA 2ZA9A 2VXRA 4L99A 4AYUA 3ZN5A 1DLLA 3QOPA 3BTAA 1DYPA 3QH6A 3DF0A 2EXHA 4TYSA 5F6LB 4ORFA 1HQWA 1K5MA 3DKWA 4COYA 2ZZQA 5L73A 2B9UA 1DGRN 2A6YA 5F6KA 2O0OA 5HBAA 4HVOA 4AGGA 4JC1A 5AFBA 1OMIA 4WV8A 1S0CA 1AL22 2HWB2 3ZVXA 3ECQA 1RHI2 4H3WA 2B46X 1U12A 2WNVC 3T2TA 2A3XA 1CAVA 2DVBA 4WZCA 1QNWA 2D6NA 4E2GA 1YFUA 3ZFEA 1RB8G 4PLOA 2GC2A 1PO22 5JZGC 2EXKA 3EJKA 1C1FA 1ULFA 1YRZA 4COZA 1EV11 1WW4A 1VALA 1QNYA 4XIKA 1D2QA 3B9IA 3WG4A 4Y1VA 4LR4A 3RG0A 4Q0PA 4AGRA 1FV3A 1CAWB 1CIWA 1ASJ1 1ASJ3 4MXWB 5E1RA 4XQ4A 5KWRA 1MS9A 4LLFA 3AKSA 3WHUA 1MEC2 4YG3A 4JGYB 1LHOA 4XETA 1C8M2 4GMP3 4OHYA 4CEWA 1POV1 2XWBB 3VBOC 4X6RB 3VDDB 4IQPA 4QPYA 4EN9B 3M3IA 5KXBA 1NCRC 3WQ1A 5I0RA 3CJXA 3E5XA 1LEDA 4CEYC 4LUMA 1KFUL 1ULCA 4Q27A 3VL9A 2ILMA 1A8DA 3CJIC 1ZX5A 1UPSA 1IZ3A 5DZFA 3VKNA 3ZN6A 4GKXA 4CP0A 4QPGB 1WCSA 3NL1A 4PDWB 1WGPA 1S2BA 1TEIA 5BNNA 3V0BB 5K9YA 3MZHA 3ZFGA 2Q5TA 1GANA 1ZM1A 5DDJ3 5DDJ1 1IPKA 4I01A 5A3MA 3RJRA 1ENRA 5JOWA 1NLSA 2VQAA 1PGL1 5CIRA 1U5XA 1V9U2 2UU8A 4GALA 4JDNA 2E53A 2B5HA 5FLHA 1W6MA 2VUJA 4JTNA 1RUD2 3JBG2 1G9FA 1RUJ2 4Q26A 4QU2A 4FP2A 3URFA 1RJ7A 5JWPA 3HN1A 3PVNA 1UD1A 3FWEA 1OOPA 1CPMA 2K2SA 5KXEA 1G6NA 1CJPA 2XH6A 4PLNA 3TB0A 1NA1A 4NN0A 5AVAA 2IXCA 3MEPA 3OD4A 5ABJA 1UAIA 3DL3A 1QJX1 1QJX3 3P3NA 4RS5A 4WM8C 5J7MA 4AVBA 3SHRA 2OA2A 2C1FA 2Y38A 1AXKA 5CFCA 1O3SA 2EA7A 5CNAA 4IV3A 3HD8B 1Y9QA 2D97A 4ASMB 2KM2A 3PNAA 4AFBA 5EWSA 4LBQD 2KA3A 2OIIA 4X8PA 3LA2A 2BBVA 5D8AC 1XYOA 4GH4B 2CWMA 1DFQA 2VNOA 1EP0A 2ZGUA 4CDWB 1H1IA 1YIFA 2B45X 4XFAA 3NSTA 4FPCA 2ETEA 3MF9A 1VLNA 4KGGA 1PK6A 2BQPA 4BLJA 2PHTA 5JIUA 5KXDA 1Q3EA 3NV1A 3BU7A 3FC0A 2GMEA 1AYN2 3AXEA 5GLUA 4DOUA 3RYPA 2JX9A 3GBFA 1FAYA 1NYWA 3WW2A 2QZ3A 3NV4A 1UU6A 3FUQA 2Q0AA 4RR3B 3KD4A 3H7JA 1U5IA 3PMSA 2UYAA 1VRH2 4W6WA 5EXOA 5T5LA 1REFA 2JENA 3E97A 3MF6A 4S2HA 3ASIA 1S1AA 1GQHA 5L19A 3UKTA 3H1YA 2WNEA 2QDRA 4UW3A 4S2FA 2WS92 3W9AA 1HV0A 3KS7A 4FTEA 1W0PA 2A6VA 1HRI1 1HRI3 4IESA 5J09A 3WNXA 2XJRA 3RNSA 1QF3A 3VGIA 1CAUB 2UWBA 4K40A 3B93A 1NY71 2A75A 2JE9A 2WZR3 4GIQA 5EJ3A 5C4WB 2LM3A 4HKOA 2WLPA 1HRV1 2P2KA 5KC6A 1FNZA 1W6PB 1PHMA 3FHIB 2D44A 1YWKA 3GYDA 1O3QA 4LE3A 2W39A 1ZA4A 1B35A 1OA3A 1YFXA 4AI2A 4YNIA 4J1XA 1MQTA 1W0OA 4TLFA 4PIXA 1COV2 4L11A 5T5PA 2HJIA 1PGSA 3GZUC 1ENXA 3QH7A 4YW5A 1ENSA 4R4ZA 3VBUC 1EV12 1PZ9A 4L92A 1DGWA 2WFPA 3N35A 1TME1 1TME3 3PHMA 5KHHA 2CV6A 2FZ2A 3ZFFA 1RUOA 5DUXA 2LTNA 3RWNA 1PO11 2AUYA 4QGLA 3JQWA 2D6LX 4CDXA 1PVC2 3L9JT 4BM8A 3LCPA 1J3RA 2ZKNA 1H30A 4FT8A 1W6NB 3ALQA 4DRRA 4YZ3A 1SDWA 2P3IA 2PAEA 4RSUA 4I09A 1KJLA 3CO2A 4HK9A 4FBFA 3RRDA 1YI9A 2W08A 2IC1A 3ENRA 1GZWA 1GV9A 4IEZA 4OI1A 3PJQA 1VP6A 4LO6B 4CDUA 4OI2A 4OLLA 1MZ5A 3QCWA 4KG0A 2AREA 1J58A 5IT6A 1N1VA 4AG4A 4BIFA 1D4M1 1D4M3 2VH9A 4MLOA 2ZKLA 3FLPA 2D40A 2WQZC 3UL2A 5EFUA 4PIZA 1CD3G 1AR91 1AR93 3TWIA 4I3GA 2WNVB 3I2DA 2V09A 4M3CE 4WBBA 4YZ4A 2PA7A 5GZEA 1PGL2 2Q4SA 4AFAA 4K20A 1Q8VA 1DHKB 4EN8B 5JZGB 1EAH1 3VBSC 4C1WA 2E9QA 4XF3A 2MEV1 2MEV3 4GULA 3SISA 3MIDA 4I0AA 3CL1A 4LBJA 3WP4A 1W2UA 4AEDB 1FMD2 2JDZA 2N7GA 4LBQB 5LRRA 1XQNA 4O9GA 1AR72 1J59A 1BMV2 4E9KA 1BQPA 4Z8BA 2E6VA 1MZEA 2EXJA 2W0XA 2ZPXA 1H1MA 2EXIA 4AVVA 5C33A 5KHKA 4P9YA 4NHMA 4J1WA 3HQXA 4K3UA 2RMU1 2RMU3 1DYKA 3AMMA 1ULGA 4R9BA 4RQPB 4FPOB 1LU1A 1ONAA 4C1XA 1AR61 5L7OA 1NCRB 2JE7A 4WVZA 4CEYB 4BIOA 2ZGPA 4N53B 4AQSA 1AUYA 4QMAA 3PVBB 4BWOA 2QKDA 2XVGA 3VZMA 3CJIB 2A3WA 4JGZB 3WQ0A 1G86A 2ET7A 4Y5Z0 2GMPA 5KC5A 4YLZA 2NZ9A 2C5DA 5H9RA 4B29A 4YGEA 4QGMA 2VNGA 4QT6A 1O5LA 3TNPB 4FTBA 3AZWA 1OQ1A 4XFHA 4IEXA 1LGCA 1O3RA 2E7TA 3O12A 1KS5A 2E63A 1ZZ8A 5FO8B 3AZVA 3R0RA 4QGNA 3ZXKA 3V0AA 1QXRA 2OVUA 2W52A 2DCZA 2YHJA 3D0SA 2CGPA 2CGOA 1UF2C 2PYTA 3NVCA 3AP7A 3ES4A 5JPNB 4A3XA 4DINB 4WM8B 2HWF2 5KXCA 2ZX4A 4XJ8A 1N3PA 1FATA 1X8MA 1HW5A 4AEKA 1XE7A 2ZAHA 3M8LA 3ZXLA 2Y26A 2AH2A 2XLGA 4F7ZA 5BNNC 1X8EA 3HBZA 1HRV2 5D8AB 3LSEA 1AX0A 1IS3A 1IS6A 1RL3A 3OY8B 5IK8A 4XOGA 3ZFGC 4YSFA 1YUDA 1H8TB 3ZYGA 4IL7A 4AI0A 3V65A 3WX5A 3ZIXA 3CU7A 4EN6B 1XRUA 2TBVA 1WBFA 5HXVA 1YFWA 4UW6A 4FQ4A 5J98B 3N7KA 2JG9A 1WLCA 4XILA 4EN7B 1PNGA 3NV2A 1OOPC 2X53S 1V6JA 4YVSB 4AVTA 3JD71 4K21A 4DS0A 1NA1C 4ZU4A 2DCJA 5HCFA 2C9AA 2NYYA 5ABJC 1C3HA 1PO12 1QWRA 1RUF2 4RS5C 3VBRB 4BLIA 5BNQA 4FTSA 4YRDA 3M7AA 4BA6A 3TYJA 1AHSA 2K9ZA 4XZPA 1RUC3 3ZYPA 1CN1A 5CFCC 4LNVA 1VB2A 4IV3C 1IHMA 4YW1A 1QJY3 3UJQA 2EALA 3PMEA 3UV9A 1S0BA 3MW2A 1HX6A 1URXA 2O8QA 3IKWA 1NZCA 2NMNA 4Q4W2 2XHKA 1FOD1 1FOD3 3O5SA 1RUG2 5GM0A 1MACA 4DZGA 3E5QA 1PK6C 1PMIA 1DQ5A 1R082 1VIWB 2MNGA 5LEKA 2PHWA 3CEWA 4DY5A 3N4MA 1JN2P 4QM8A 4MZUA 1CJDA 1H1AA 4PF5A 3FLRA 1LR5A 1I9RA 2JG8A 4Q4V1 4Q4V3 3TN91 3TN93 4IEUA 5CADA 1SBEA 3POYA 1LECA 3KGLA 2VGDA 4MGKE 1CAXB 3FBYA 2WWSA 2IXLA 2H0VA 4Y1YA 1SEFA 3H9AA 4IV1A 2YYOA 1QDCA 1YIPA 4U36A 1XXNA 1Y3TA 3USSA 2VVEA 2HWE1 2HWE3 1EAH2 1NQDA 1YO8A 2YY1A 3UK9A 4BOWA 2BNOA 4D7YA 4AI1A 4XJUA 2R072 4N43A 4YM2A 4AQ2A 3N36A 3AMNA 4BYYA 1PIV2 1AZDA 4OULA 1RVF1 1RVF3 1AYM1 1AYM3 3N7LA 2WKKA 4Q0QA 4ZKTB 3WDUA 4MGYE 4B7EA 4OHXA 4W6XA 4Q0SA 2RMU2 5EYYA 1SLAA 2WSUA 1S0IA 1S0GA 2NM1A 5EV7A 5C9AB 4LBLA 4AFMA 4H14A 1AR62 3AKRA 2DCYA 5JMCA 4B4PA 1XNBA 4MVTA 4AF9A 4B4RA 4Q4Y2 2ZAAA 5AC91 4WVMB 2NQYA 4JRLA 5IK5A 1B35C 1H9PA 4PLMA 1MQTC 2ZGQA 5ACA2 2PAKA 2RM23 2XJVA 4R4XA 4XQWA 4NOTA 3BALA 1G9BA 3NW4A 5JOXA 5A33A 5LRSA 4QQ2A 1QOOA 4GB31 2VW0A 3MPBA 4GB33 2P37A 4RHV2 3ZFFC 3WDVA 1HLCA 3UKVA 1RITA 3BOPA 5I8YA 4UXAA 1XE8A 1X7NA 4IEVA 3ILFA 4ZU5A 4XBNA 4TZDA 2DTYA 4CDXC 1KRIA 1DZQA 1W6OB 1JTZX 2GN7A 4UW4A 2R49A 3MLLA 4KH9A 4Q4X2 1UX6A 1LKNA 1ZZCA 3RZZA 2UWAA 1DIWA 2V73A 3APBA 5K0UA 3I4IA 1Z7S2 4LO4B 4QX5A 5LEJA 3BODA 5E89A 1FXZA 1EPZA 4I0BA 4TSVA 2ZHMA 3V64A 2EAKA 1XNKA 4Q0UA 3AMQA 1NCQA 3GHNA 3USUB 4BCUA 5J96B 4CDUC 5T5OA 1NQJA 4RGAA 1WA4A 1ND3A 2D7FA 1OFNA 1LRHA 1UIJA 2YUEA 4FO9A 2XB6C 4YGCA 1RGSA 3VBHA 1D0HA 5AFEA 1YI7A 1YXWA 2YXSA 1MS4A 2QJVA 4LBMA 3RI8A 3SH4A 3TBDA 2JXAA 1XYPA 3O0VA 1ZZ6A 5AVPA 2HWD2 2KXLA 1VBB1 1VBB3 3SCGA 5JPMB 3D8CA 2SBAA 2A5ZA 1ZBE3 4QPIB 1SCRA 1ZVFA 4XMIA 2GC3A 3SCHA 1IQAA 1WLWA 2D6KA 3GNEA 1NE6A 3JD72 3VHRA 3AK0A 3AB0A 3IDBB 3MFAA 5J48A 1VBC1 1VBC3 1E57A 4WZFA 1O3TA 5DUVA 3NV3A 1H9WA 2OZJA 3ST7A 2BWAA 4KL1A 1SACA 3M3EA 5T52A 3MFCA 1V6MA 3D5OA 1NXMA 4GMP1 1O91A 4HSLA 5BNPC 2XL7A 3SNMA 5D1IA 3ROUA 2TNFA 2A7AA 2G9GA 3MDPA 2IFRA 3THTA 3ZMNA 5BY5A 5HCAA 4YGBA 2WNUB 2CWSA 1F31A 1FOD2 4MH0E 1CAWA 1RMU3 1RMU1 1LEMA 2NP0A 4MXWA 4AHXA 4YFZA 3ZN6B 1RUI1 1RUI3 3L2YA 4JGYA 1CONA 1VAVA 2I74A 5BNNB 2IWGB 1OPOA 4EWEA 1ZRRA 1G9AA 3TN92 1OHFA 3VDDA 3AZXA 3S30A 2BEOA 4L8QA 5BNOA 4YVWB 3I7DA 4A2UA 3OF1A 1PGW2 3OGGA 3D0JA 1U5YA 2Q1ZB 1C57A 1RUE2 3RMYA 1W6MB 4BPZA 1NG0A 1RJ8A 4Y20B 4Q1RA 2QUOA 5CFDC 5FO9B 2XBO1 2XBO3 4KNCA 5F5QA 2F4PA 3O0XA 1I3HA 3KT4A 4AI3A 3MIHA 3A0NA 4Y22B 1MVEA 1VBA3 1VBA1 2HEVF 2BVBA 2CAUA 1KD7A 5ABJB 1H4GA 1LJ7A 2ENRA 4NPRA 1LOBA 4AVAA 4RS5B 4WM7A 1AR81 1AR83 4FPEA 3HWJA 5FQ0A 2K0GA 2WQ4A 5CFCB 1C5IA 1G7YA 2PELA 5CG8A 3KCXA 1LB2A 4NHLA 3OYWA 1BVVA 2ZX3A 4Y26A 3AP4A 2R041 2R043 4B4QA 2I45A 3ZX7A 1R1A2 2O8OA 1I5ZA 5A3LA 1S0JA 4AQTA 5AC92 3ZYIB 1TNFA 3INAA 4HK8A 2UY8A 3MW3A 1PK6B 2VULA 2OYZA 3ZDSA 2RR12 4QQHA 4HLTA 2ZX0A 2H6BA 4BZ4A 2RHPA 1J3PA 1UW8A 2VG9A 4AEJA 1Q43A 4OI0A 3M3QA 4Y1ZA 2FQPA 4P5HA 2PN5A 2JG9C 5BUVA 4XDQA 3RMXA 3AZZA 3H8UA 1NLRA 2VMGA 3AJYA 5I8SA 1XU1A 4OI4A 4Q0VA 4CDQA 3B3QE 1HXS2 1RUH1 1RUH3 2ZMKA 4GH4A 2RS32 4HPKB 4J6GA 4N9IA 3RS6A 5DG1A 4XHXA 4DXZA 2OZ6A 4FPLA 4X6QB 1F8VA 4XF0A 2B8MA 3ILRA 2D5FA 2ZTNA 1UMZA 3S7EA 4FXGB 4PJYA 4EWDA 1ULEA 3AJZA 1N3QA 2GNBA 1FT9A 1I6XA 1WLDA 3ZXGA 2AENA 3ZMOA 3MICA 4OHZA 5FLJA 4W6YA 1LCLA 2DYCA 1VBE1 1VBE3 1IS4A 1LHUA 1BEV1 1BEV3 4URTA 2XLFA 3ZXDA 3VHNA 1ZBA1 1ZBA3 2ZBJA 1ZRCA 2VQ0A 4IEWA 1LOEA 2ZHKA 4E4SA 5JOZA 1WBLA 1TMF1 1TMF3 3MIBA 2H6CA 2WZR1 1DG6A 1W6QA 1WCDJ 1OA2A 1ZZBA 2JG8C 3R05A 4DB5A 1MZ6A 1LHVA 3WDTA 3AZYA 1VJ2A 1SLIA 4ASLA 1OKQA 5KBFA 2D3RA 1B35B 1H2LA 3J26N 1CGPA 2ZGOA 1MQTB 4MGIE 2QE3A 4FAHA 4ISRA 4IV1C 3CF6E 4FOQA 4AEMA 1Y43B 2FBEA 2ZGLA 4LEJA 1JW6A 3VBFB 3BB6A 1M06G 5I8TA 4QQLA 3AP9A 5FTTC 1W39A 3KM5A 1ND2A 4N43C 3ME2A 5FBZA 3WDWA 4KBBA 1ASJ2 2XKOA 2JECA 4YW3A 2YROA 5DUWA 3G7DA 2Z79A 4IEYA 4CRQA 3KCCA 3DPRB 4R8HA 4JTOA 1FNYA 1MVQA 5CA6A 4OFGA 4YM3A 4N7UA 1C5HA 1SMVA 4OHWA 4AWDA 3FFQA 3LZZA 2BUKA 1HQNA 3RI9A 3D4KA 3WCRA 2B39A 4F8AA 1GZ9A 4LLOA 4XFGA 2DCKA 4XBQA 4CDUB 1A78A 1FPN1 1FPN3 1IPJA 3DV8A 1M4WA 4I2OA 2PHXA 1ZZ9A 3H50A 4Q29A 4YW4A 2VW1A 1KDKA 3VHPA 3HT2A 1A3KA 5C8WA 3I59B 1UZZA 1X50A 2Q30A 3GBGA 1BXHA 4ISQA 3WW1A 3QD6A 2CAVA 4GKYA 4KGQA 3EQEA 1H4HA 3RSJA 5JAXA 5DDJ2 2XLAA 1UU4A 2ET1A 3FLTA 1MR5A 3IM0A 1DQ4A 4E4ZA 3ZXJA 1NOVA 3B94A 4IEQA 3MIEA 1MS8A 4JDOA 5GZFA 1N3OA 2RS53 1QJU1 1QJU3 2RS51 2PLV1 2PLV3 2JICA 5K0UC 2DVDA 2BNNA 1DQ1A 1VBD1 1VBD3 1BZWA 2JD4A 1WW6A 1VBA2 2D43A 5FO7B 3AP6A 4IXLA 1LENA 4I3PA 1NCQC 4IEOA 3OPZA 1N1SA 1V6NA 1K5MC 4RFT0 1QJX2 1HKDA 1MS0A 4KWLA 2RS11 1ND3C 2RS13 3E6DA 1GBGA 4I02A 2XVKA 4HFSA 1CESA 5GKAC 3VBOB 5BNPB 2Z2SB 1H0BA 4YGDA 4CYDA 3VBHC 2DU0A 4BQ1A 3RQ0A 4A7KA 2ZMNA 3FBMA 1DZTA 1JOJA 4GWMA 2BPA2 3AFGA 4AEDA 4ZU7A 4D7TA 4SBVA 4BH9A 5I0SA 2VVFA 5FOJB 2BFUL 2RJKA 3ZFEC 1TE1B 3KT7A 4F83A 3RYKA 2DV9A 3LSDA 1IS5A 3B5LB 4Y1XA 1D2SA 1S55A 4A7YA 4RQPA 5CBLA 3U0ZA 2TUNA 4LA3A 5DG2A 3WP5A 4XTPA 4HKLA 2E51A 3O0WA 3V56A 2IZWA 1UPIA 3M70A 4AHZA 2ZGMA 3H1WA 3V0AB 4N53A 4SLIA 2ZGTA 3UJOA 5CFDB 1R091 1R093 2NN8A 3QACA 3NKGA 3NWKA 3AMPA 3OJBA 1KDMA 4XHBA 3ILNA 2EAAA 4JGZA 3E6CC 2Y0IA 2DVFA 4HT1T 5FRAA 4CEWC 1CX4A 2VOWA 3WG2A 1O4TA 2LALA 5EYXA 1KFXL 3OBTA 2BW8A 4JQRA 1QH6A 3A0KA 4NWWA 2E7QA 1N47A 3KT1A 2XKPA 2R061 2R063 1LTEA 4AFCA 2GSYA 3HIFA 2UYBA 3HR9A 1HRI2 3PVOA 1LOFA 2GNTA 5FMOL 4FAGA 3N7MA 1QMJA 4JGYC 4N9HA 4CP2A 4MX3A 1NY72 2WZR2 4MSVA 3UKNA 1C28A 3KCYA 1IOAA 3IN9A 3VDDC 3LOBA 3FUOA 2LUWA 3GBWA 5BNOC 3WUDA 4XJAA 1GNHA 5GALA 3VZNA 5JIAA 1EPWA 4JAAA 3WY6A 4XIOA 4LT5A 2PHRA 2GMMA 3RJ2X 4E4DX 2VU9A 3ATGA 2ERFA 3AFKA 3IT8A 4FPKA 4FP3A 4K1YA 2QQPA 2R16A 2WJSA 2JG9B 3N3HA 4XF1A 5DZGA 4M00A 1UKGA 4HANA 1XU2A 1AL21 1AL23 2HWB3 2HWB1 5I93A 2I2SA 1S2KA 2UY9A 2BVVA 3IPVB 3GZAA 5I0UA 3T1LA 4PCRA 4PQ9A 4WM7C 1TME2 3OY8A 4JRAA 4XTMA 5JDBA 1OD5A 1H8TA 2AYHA 2ZX1A 3U11A 2HEYF 4YZ1A 2HEWF 4XXAA 1TQ5A 4LA2A 2DVAA 3D6EA 1RUC1 1PO21 1LOCA 1PO23 1GICA 1ZZ7A 2XJPA 5BPXA 1S0FA 4PBOA 2R1DA 5CU1A 2EF6A 2DFCA 1QJY1 4FXKB 1DDLA 5FOBB 4R9DA 1BVP1 2FHRA 2Y0OA 1POV0 4YVSA 1ZNPA 3O7OA 4M3CA 4A7ZA 2GH2A 3TOJA 3WW3A 1AX2A 4Z82A 1DU3D 5JI9A 4G3YC 1MEC1 1MEC3 2XG3A 5GZDA 3VBRA 3JU9A 5JVVA 1OI6A 1G8WA 4EJRA 1C8M1 1C8M3 4C0BA 4ES9A 1ENQA 1D4M2 3GHMA 2GNMA 4LBKA 2D98A 2RJLA 4CP1A 4E27A 2W68A 2BGCA 4HKWA 2VPVA 4LO5B 4E2SA 1AR92 3H7YA 4FPJA 4CDQC 3AYEA 2X5IA 2V5YA 4IV1B 1LGBA 3LOIA 1WW5A 3G6JB 4W65A 4LE4A 2B42B 1UZYA 4DMIA 2ATFA 3ZSJA 1QJU2 2D93A 5A32B 2XJSA 2P17A 2AR6A 2MEV2 1AXYA 2R30A 3VBUB 3WR0A 4GA9A 4M0HA 2YPJA 5KHIA 1HDKA 3R4UA 5F9TA 2VOKA 1GYKA 4AHWA 4AVCA 2G9FA 1I1EA 1DGRA 1J1TA 4FOWA 1V9U1 1V9U3 1CAXA 2BWCA 3OBRA 1RUD1 1RUD3 3JBG1 3JBG3 1RUJ1 1GR3A 1RUJ3 1KQRA 5IUQA 4AW7A 1QHDA 1QJZA 4AK3A 2ARXA 2Q1MA 2XVLA 5C8CA 2Z42A 5K7PA 1GKBA 1AJOA 4K1ZA 1R1ZA 2BFUS 4YM1A 4PBPA 2DVGA 1JYIA 2XWJB 4I0WB 2D6OX 2ZACA 4Q8KA 2RM21 1A8MA 1MS5A 4P9WA 4P9GA 2PAMA 5C9AA 1ND2C 1NXD1 1OLRA 3ZO0B 1V6IA 1Z78A 1JXNA 4R52A 1B09A 4WVMA 2UURA 4AE2A 5TSWA 5H9QA 4KWJA 3FFZA 3K48A 3VKFC 3VBSB 2ES3A 1BBT1 1BBT3 3VKMA 5K0UB 4S2GA 4AFDA 4CZSA 4MXVA 5FDBA 4EWAA 1Q8OA 1AYN1 1AYN3 3FJSA 1FI2A 3FZ3A 2D3SA 4IEPA 1YJLA 4AQ6A 4NHKA 3O14A 1SFYA 2IXKA 4H7MA 4FPFA 2HYKA 4LULA 4Z2WA 3ZSEA 3D82A 1K5MB 2R062 1QOSA 5FMOS 5IK4A 4LUKA 1ND3B 3WCSA 4ATEA <