4YGBA

Crystal structure of ergic-53/mcfd2, monoclinic calcium-free form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
227
structure length
192
Chain Sequence
PHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAEWNGVGIFFDSFNPAIVIIGNQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
total genus 45
structure length 192
sequence length 227
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ygbA00
2ZHMA 1JUIA 5DZGA 3SLIA 3TB0A 3N7KA 1W0OA 3APBA 3ZXFA 5GZDA 4FP3A 4YLZA 1H9WA 1GYKA 2C5DA 2JDZA 3WZ1A 3FUOA 3AXDA 2ZGPA 1UL9A 2YMZA 4TYSA 4YW2A 3ZXEA 2A6ZA 1J1TA 1Q8QA 1Z0HA 3ZXLA 1N3PA 3SH3A 1APNA 3BOPA 2GMEA 1GSLA 5E8AA 1UMZA 1ZA4A 1QF3A 4GWNA 4IQPA 3N7MA 3NV4A 1WW4A 2A6WA 3OJBA 3M1HA 3V0AA 1XQNA 1W6NB 4XDQA 4YGDA 4U2AA 2DU0A 2NYYA 3WHUA 2FMDA 4XOGA 1AJOA 3O5SA 2CYFA 5DXDA 5KXDA 2E7QA 1TEIA 3WDTA 1AXYA 3C2UA 3RMYA 1W6PA 3M3OA 4FPLA 1C1FA 1MS9A 3OY8B 1MS3A 3WG2A 3AZZA 4BOWA 3B9CA 3PVEA 3OBRA 2WSUA 4ZKTB 2YV8A 3ZSMA 3N7LA 1BYHA 1MZ6A 2GDFA 4FPCA 4XBNA 4AVSA 3GNEA 2LALA 2A71A 3WDXA 1WUVA 4DS0A 4H55A 2R0HA 1G9DA 4BMEA 3WOGA 5JMCA 2A6VA 3D4KA 2ZZJA 4Y1VA 4FPOB 4DRVA 4BPZA 3QCWA 1SCRA 2ZAAA 4GXLA 4XTMA 1JYCA 5CA6A 2E6VA 2ZGNA 1DZQA 1BXHA 5DG1A 1FNYA 1N47A 2Z42A 1UZZA 1DIWA 1KDMA 1ENQA 2W39A 3VKNA 3O0XA 1S0JA 3ILRA 2A70A 1LOBA 4JRAA 1CIWA 4XHXA 4M00A 1G9BA 1LGBA 1AXKA 1LECA 1QMJA 1R1ZA 3AP6A 4M3CB 4Q1RA 2D6KA 2UURA 1O4YA 2YY1A 1GANA 3D5OA 5DUUA 3VKMA 2P2KA 1I1EA 2ENRA 3ZYRA 1DQ1A 3R4SA 2AUYA 1BZWA 1F31A 1S0BA 4BQ1A 3AZWA 1C57A 1A78A 4XIOA 2A75A 2ZGQA 2R1BA 2NP0A 3V65A 1OKQA 4GKXA 5KXEA 1LOAA 2PHWA 1W6NA 4DRRA 2CL2A 1WBFA 1YYNA 2ARXA 5CNAA 1WW5A 4LBQD 2YROA 3I4IA 3T2TA 4XJ9A 5T52A 1GZ9A 1NLSA 4YZ5A 3OY8A 1CONA 2NZ9A 3WCRA 2CY6A 1H9PA 1LEMA 5GZCA 5HCAA 2VW2A 3M2MA 4FOVA 4UW3A 5EYXA 4P14A 4Y24A 2ZACA 2E7TA 1V6JA 2GNDA 3IM0A 4YZ3A 5T50A 1VAMA 5H9RA 2DWRA 4XYXA 1SLAA 1GZWB 3AZYA 4XJAA 2E53A 4TZDA 2ZGLA 3A4UA 2SLIA 1JOJA 3ENRA 3RQ0A 3N35A 5FRAA 1N1VA 5T5PA 1BKZA 3HMYA 3RRDA 2WT0A 2YZ4A 5H9QA 3ZXKA 2AR6A 4YG0A 2JD4A 1N3QA 2JE7A 4GA9A 5GLUA 2P3IA 4M3CA 1KDKA 2V73A 3LCPA 1UKGA 2VY0A 1LHWA 3MPPG 2A6XA 5GZEA 1ZM1A 4XMIA 4RA0A 1OFSA 1X50A 2AENA 5DUXA 3WG3A 2A3XA 4LBMA 4BLJA 1C4RA 4GWMA 2VXRA 2A3YA 4Q8LA 4FPGA 3MW3A 4LBNA 2P34A 4YG3A 4FPJA 2KM2A 2ZGRA 1RIRA 3N36A 1JXNA 2PHTA 3NV1A 1CPMA 3AP5A 1WCSA 1F5FA 1CESA 2ZGUA 1QDOA 4AGGA 4WVVA 2P3JA 3N3HA 4FOQA 1O4ZA 3H0OA 2V5YA 2GN7A 4KBBA 3HN1A 1G8WA 2DVBA 2ZGMA 4XMAA 4Y1ZA 3O12A 4FPEA 3AZVA 3B3QE 3UJOA 1LTEA 1DYPA 1Y7BA 1UAIA 1GZCA 1LGCA 1SLIA 1MZ5A 1V6IA 1WW7A 1VALA 1N1SA 4Q1PA 3WDYA 1LODA 1ULDA 2GNTA 2DYCA 1GZWA 1WW6A 4LBKA 3WUDA 2A5ZA 2EIGA 4DQAA 5JLVA 3ZPYA 3U4XA 2TEPA 4Q2FA 4XE9A 3ZYPA 3UK9A 1S0CA 2WT2A 4PCRA 2A3WA 2DUPA 1MVEA 2NMOA 1CN1A 4PBPA 1RITA 1CQ9A 2SBAA 3OYWB 4R9BA 4XBLA 1S0FA 2EXHA 2AGSA 2PHFA 1FATA 4R9AA 3USUB 1AJKA 2D44A 3DUIA 4C1WA 2VU9A 4MYEA 3L2YA 4Y20B 1RINA 3B00A 2GALA 1YRZA 1BJQA 5JVVA 3IPVB 1AXZA 3ASIA 5EWSA 5GALA 4AVTA 4YW3A 1OQ1A 2EF6A 4ITCA 3INAA 1ULGA 3IKWA 3WCSA 4CRQA 1AX1A 4DPNA 5KXBA 5CB7A 3POWA 1UZYA 5GLVA 3SISA 3D6EA 1S0GA 3NWKA 1GKBA 3ILNA 2B7YA 3CNAA 3PVOA 2WJSA 3B01A 3POYA 1WLWA 2ZMNA 1QU0A 2R16A 2DTYA 1G9AA 1LOCA 1VAVA 3KQRA 1FX5A 1DQ6A 3OBTA 3A0NA 2W08A 3SH5A 1WLCA 4XZPA 2DVDA 5GZFA 2EALA 1QNYA 3BIWE 5JOWA 5T5OA 1UX6A 3MW4A 1SBFA 2PHUA 5T54A 1LHUA 1QNWA 5BYNA 2OUJA 2C9AA 3HR9A 3N7JA 2DUOA 1U0AA 2LTNA 1G7YA 3B69A 1MS1A 1LHVA 2ARBA 2ES3A 4PQ9A 4P9WA 4XJ8A 4FPFA 2AREA 2CNAA 2JJ6A 4XJZA 1DBNA 2D6LX 4YFZA 1HQWA 5AVAA 2VW0A 5GZGA 1SACA 1ULCA 3M3CA 2OW4A 5GM0A 1KJRA 1UPSA 4DFSA 2ZMLA 4XHBA 5F9TA 2D6MA 3FBYA 4K21A 4YZ2A 1V6NA 3OYWA 2WQZC 4FVVA 4FQZA 5IUQA 1LU1A 4BLIA 4OZXA 1CVNA 3T1MA 3USUA 1CR7A 2EXIA 2W68A 3JUUA 2PHXA 3FLRA 2D7FA 2DVAA 2I2SA 4FPYA 4YW5A 3RS6A 4Y20A 5JOYA 1SLBA 4UW4A 3IPVA 2ZABA 1V6MA 1SLTA 4GALA 4XTPA 5F5QA 1WLDA 4CTEA 2EAKA 2W52A 2ZGTA 4W65A 1ULFA 1KITA 3VKOA 3MEPA 3AYAA 1N1YA 1LESA 1W6QB 1URXA 2XG3A 4GKYA 1V6OA 3UL2A 4XBQA 1IKPA 1LENA 2ERFA 4FP2A 3FFZA 3R05A 3VKLA 1QOSA 2DV9A 1LEDA 2OUHA 1HQLA 4YZ1A 5IT6A 4LBOA 2UWBA 3WUCA 2GMPA 3ATGA 2PHRA 3AK0A 4P9XA 2R0FA 3DGTA 4YM0A 3NV2A 5JDBA 2ZHKA 3AP4A 2BQPA 3WVJA 2VH9A 3RG0A 2ZMKA 2DURA 1SBEA 1S1AA 4Q27A 5GLWA 3T1LA 4ATEA 1FYUA 2A6YA 1MS8A 2HYKA 3WNXA 4WVWA 1Q8VA 2DUQA 3WLUA 2D6OX 5L73A 2FHRA 2GMMA 1V6KA 2GN3A 5DZFA 5CBLA 2UWCA 4AYUA 4ZXKA 4HANA 1YO8A 4AVVA 2VUAA 5H9PA 1S0DA 1JBCA 1MR5A 2VW1A 3FUQA 3OPZA 4FQ4A 4R9CA 4XXPA 1S0IA 1AF9A 2D6NA 2NMNA 3WDVA 4BM8A 4XILA 4UW5A 4Y1UA 4AGRA 1LHNA 3W58A 5IK4A 2RHPA 1G9FA 2E51A 4WZFA 1SLCA 1NXD1 1LHOA 1D2SA 3JU9A 2WT1A 4AGVA 3IN9A 3ZVXA 1AX0A 4M3CF 3VV1A 1JYIA 1H30A 1KRIA 1QGLA 2JKBA 2WLQA 2WKKA 4Q26A 3W59A 3V0BB 3M3EA 3SNMA 1LOEA 5HCBA 1IS6A 1AVBA 1LULA 1SCSA 4BMBA 3A0KA 1W6QA 5T5LA 1YIFA 2UU8A 4XXAA 1Q56A 5EYYA 3WG4A 1C1LA 1PZ9A 3AX4A 1DQ4A 1GV9A 1G86A 4LBQB 1DQ2A 1JHNA 1FV3A 3O0VA 3SITA 4JCKA 3AFKA 4YZ4A 1EPWA 4YM3A 1QDCA 1AZDA 2AH2A 5HCFA 3BODA 1DQ5A 1Q8SA 2P37A 3OGGA 2AYHA 5T55A 4C1XA 1IS3A 1Q8PA 1W6OB 4RL7A 2EXKA 2ZGSA 2ZHLA 1F9KA 2CWMA 2P3KA 3NV3A 4YM1A 4YGBA 1FAYA 1LOFC 2A7AA 4YGCA 4ASMB 2WSVA 1DYKA 2ZHNA 3AYEA 1W6MB 1FNZA 2OVUA 3RSJA 5IK7A 1DLLA 1V6LA 5DUWA 3IMNA 1W0PA 5E88A 3V64A 3M3QA 4XJUA 4PF5A 4YM2A 4NO4A 1GBGA 4Y26A 1VIWB 4LBJA 5DZEA 4ATFA 5JOXA 4FPKA 3WV6A 1DQ0A 4Y1XA 4XIKA 4R9DA 3ZSKA 2DVGA 1JW6A 2D3RA 2NN8A 1G9CA 1GNHA 1YI7A 4F83A 2DU1A 3V0BA 1LOGA 4HL0A 2D6PA 2DTWA 1JN2P 5KXCA 5T5JA 2YXSA 5DUVA 5H9SA 3WHTA 4YW4A 1HLCA 1N1TA 3I8TA 2CWSA 3WG1A 1FV2A 3Q9OA 5GJ6A 3AZXA 2GNMA 2NM1A 2JE9A 3ZXJA 2GNBA 5IK5A 3SH4A 4PBOA 4Y22B 5DG2A 5EXOA 4LBQA 1VLNA 5SV8A 1QKQA 3ILFA 3WDUA 3GALA 3LSDA 3AXEA 4CZSA 1Z78A 2D3PA 1SLLA 3AJZA 3PMEA 3R4UA 4ISRA 5IK8A 4FOYA 2ZGOA 3PVNA 3FLTA 3AJYA 2UWAA 1W6OA 4M01A 4YGEA 1IS5A 1A8DA 1LU2A 2H0BA 4K1YA 4M3CE 4YFWA 1KQRA 1YXWA 3AP9A 4LBLA 1LOFA 2JECA 4JC1A 3RMXA 1MS5A 4Z8BA 3O0WA 2CTVA 1ONAA 1CJPA 1LCLA 4K1ZA 4WV8A 1W6MA 1MS0A 2EXJA 1KJLA 4AWDA 3LSEA 4U36A 4YG6A 4D69A 1LJ7A 3FLPA 2PELA 4Q8KA 1ENRA 2DVFA 2R49A 3UJQA 4ISQA 2ZBJA 1AX2A 2ZKNA 4UW6A 5GLTA 3V0AB 4I30A 1SFYA 1V00A 3AYDA 1S0EA 5E89A 2D43A 3POSA 3TAYA 1Q8OA 3WDWA 1W6PB 5FREA 1WBLA 1ULEA 4NOTA 4P9YA 1DHKB 1IOAA 1I3HA 3VKFC 1CPNA 1N3OA 4SLIA 4L8QA 1PZ8A 1QOOA 2XB6C 3AYCA 1WD4A 1LGNA 3QLQA 2ZGKA 2D3SA 1WD3A 5JOZA 2Q5TA 3ZSJA 4YW1A 3MW2A 1A3KA 1GLHA 1BQPA 5CAZA 1IKQA 3VUOA 1QOTA 1D0HA 1ENSA 1GNZA 1DGLA 1HKDA 3BTAA 4XJWA 4Y1YA 1GICA 4Y22A 3ZSLA 2R1DA 1MVQA 1MS4A 1HDKA 2ZA9A 1IS4A 1PZ7A 4FOWA 1DFQA 1B09A 1MACA 2G4IA 2WNEA 5GLZA 4K20A 4FPHA 3KM5A 3PJQA 1UN1A 5LK5A 1SBDA 3AP7A
chains in the Genus database with same CATH superfamily
1JUIA 4IE6A 4HSJA 1W0OA 3APBA 5A70A 2YBPA 2EIEA 2WNUC 5GZDA 3WZ1A 2VCCA 1ZRFA 4H7LA 1UL9A 1X33A 2YMZA 4NN0A 3D82A 2OIIA 4SBVA 1HRV3 1TE1B 1ZA7A 4CCEA 1AR71 5FJHA 1Q8QA 2XKPA 1Z0HA 2PTMA 5EZWA 3UKVA 3VBOC 4DMIA 3O1RA 3T0DA 1GSLA 2XJPA 3BPSA 1UMZA 2EA7A 1PVC1 3MF6A 5C9AA 3BALA 1WW4A 2Y6KA 3MI8A 5FV3A 3THPA 2A6WA 3VHRA 1WKYA 2VM9A 5A3LA 2BRTA 3J8F3 1YFXA 4XOGA 1AJOA 5FYYA 5FPXA 1BEV2 3IMMA 4QMAA 5J98B 3HNMA 2VNRA 3OY8B 1NA1A 1NQDA 3I2IA 2WAAA 3LEMA 1MZEA 2W92A 2YV8A 1PO21 3NVCA 1VBE2 3LPGA 3N7LA 1BYHA 4ZS2A 1MZ6A 4FPCA 3SQOA 3WF2A 5K8SA 4BIFA 2A71A 1DZTA 3WDXA 3BU0A 1C5IA 1WUVA 4H55A 5IYYA 1MQTB 1UY2A 2EVXA 2XR4A 4JGYC 2WC2A 3WF3A 1YJKA 3D4KA 4WM8B 4FPOB 4Q0UA 3KF3A 4OQ8A 1JZ5A 5CA6A 1SMVA 3WT3A 4K40A 1RYYA 1DZQA 4MLOA 1XB9A 4HVRA 5F5CA 1UZZA 5A7OA 1KDMA 3CJIB 3KS7A 3BPZA 4LORA 4QXBA 2E9QA 2ZAHA 1YFWA 3VKNA 3O0XA 1S0JA 2GC0A 3ILRA 2WO3A 3DF0A 3M8LA 4Y5TA 4JX0A 1ND3C 3OUHA 4OI4A 4Q1RA 2K46A 4CP9A 5IHRA 1W2OA 1AL0G 2ENRA 1DQ1A 1VMJA 1DU3D 3IZOA 1QXPA 2DCYA 3H8XA 2QQIA 4JGZC 4KU7A 5CVRA 4BQ1A 4IUGA 1A78A 1H0BA 1RUH3 4R52A 3HN3A 2Y6JA 3CO2A 4AW7A 2ZGQA 1PX4A 3EMRA 2R1BA 4N9IA 2GH2A 3TOJA 4AFDA 2NP0A 1RUE1 5KXEA 1W6NA 2P6HA 4JHZA 1WBFA 2ARXA 5CNAA 1B35C 4ASKA 1OH3A 2XLAA 3VHOA 5KHHA 5ACA1 2W91A 4P5HA 2FZ1A 3I54A 5T52A 4YZ5A 2QBXA 4EE2A 2NZ9A 3VLBB 4HSLA 2VW2A 5BNNB 4QPIC 1HRI2 3WW4A 5FZFA 3RZKA 3OD4A 4P14A 5EYXA 4AAPA 5FCCA 1NLQA 2WFF2 1JZ4A 1J59A 3ABZA 3NNMA 4XUNA 3I59A 2JE8A 3PU8A 4AEMA 3AZYA 4XJAA 3UGGA 3OD0A 1OOPC 5CADA 3X29B 5JZGA 3MFAA 4XW3A 1VRH3 2HWD1 1OUXA 5FZMA 4B1LA 1RUI3 1NCRB 4FXKB 3HMYA 4AEDC 1RUJ3 1VBA2 4J6GA 1ND2C 3ETQA 5H9QA 3ZXKA 3VBRB 1TME1 1PMJX 2WS91 2FCVA 2JXAA 1O8PA 3J7MA 5GLUA 4M3CA 4MG2A 4NHKA 3OBAA 4KWJA 2VY0A 2F6BA 3LA2A 4XMIA 3RZMA 1IGOA 1OFSA 1X50A 3S7IA 1AL23 5BNPB 4CP0A 4RQPC 2VXRA 1YLLA 1S55A 4GH4B 5AFEA 3S7EA 3POEA 4IL7A 1JYVA 3KV4A 4IV3C 3VBUC 4GD4A 3N36A 1JXNA 3VBHA 5A7PA 3TNQA 3U75A 1CPMA 1PIV1 5IFTA 3AMPA 2WNUB 2R072 1L3JA 3RJ2X 3UYJA 2ZGUA 4AZZA 1JZ3A 4UF0A 4AGGA 4QGLA 1HQNA 1PX3A 1UO9A 4QAWA 3PNAA 1Y9MA 5LZ6A 1UZ0A 5A6YA 1YQCA 4AI1A 2CU5A 3HN1A 2HWE3 1G8WA 1QXJA 2ZGMA 3LOIA 2CDPA 1NCQA 1OQEA 4FPEA 2RV9A 4QXCA 3VBOB 3PUSA 4NPMA 3E6DA 1V6IA 1GFF2 1N1SA 2JDKA 2DYCA 4CDQC 1K12A 1WW6A 2G9GA 2EIGA 3J26N 4P9GA 3WUDA 1PGW2 4LTAA 2TEPA 3ZPYA 5JSRA 4XE9A 1DDLA 3TBDA 4V2WA 3HD8B 1NY71 1S0CA 3TN92 1O59A 4S2HA 5FK8A 4XETA 3RZZA 4JKKA 4MX3A 1S0FA 2XWJB 5FYHA 4R9AA 2D44A 5FBZA 4CCJA 4C1WA 3A7QA 3T3YA 4BIOA 2K2SA 3L2YA 4N43A 1RINA 2GALA 1HRV2 1YRZA 1OUSA 2AEYA 1AXZA 2QE3A 3IPVB 4KQ7A 4TWTA 5JVVA 4XACA 3PTRB 4YW3A 4LKSA 4M4RA 3SMHA 3T0BA 1NZCA 5KXBA 3IKWA 1CAUA 4JGYB 4DPNA 2MEV3 3D8CA 1OA3A 2ZEZA 3RYPA 4Q4V3 2ORXA 2VD7A 3ILNA 3C8XA 2B7YA 3EJKA 1S2EA 4MGIE 1WLWA 3J8F2 2ZMNA 2XBO1 3UETA 1QU0A 2FDJA 4GMP3 1G9AA 4CDUC 5A7QA 1LOCA 1PM4A 5FWEA 3BKZA 2R30A 2OPKA 3NKGA 3SH5A 5CISA 5DDJ3 1XNBA 4XZPA 2DVDA 1NLRA 5FP7A 5A3PA 3BIWE 1ND3B 5DMYA 3ZXAC 1UX6A 4QKFA 3RYKA 3WY6A 5FAXA 3U07A 5M0TA 1TNFA 4W6WA 5A33B 5T54A 4CCKA 5A7WA 5C71A 3TEWA 1LHUA 1LRHA 2HEVF 4WM7A 2C9AA 3MFCA 4JGZB 4KI5M 5HV0A 2VG9A 4FBFA 2D40A 2XVLA 3ZFEA 5J09A 1SFPA 2ES3A 1W28A 4P9WA 2RJLA 2QDNA 1OA2A 4XJ8A 3K77A 4L99A 4OI1A 2AREA 2CNAA 2JIJA 2WDBA 3HNBM 5E6HA 1T2XA 2IVJA 4BQWA 1R1A1 2VZPA 4WVZA 5GZGA 2R043 3AVRA 1ULCA 1B35B 4QKDA 4I01A 4WZCA 2XONA 3SXWA 5A3NA 4DFSA 2ZMLA 4K21A 2W87A 1V6NA 5K0UC 3O1PA 2VQAA 2QQPA 1BBT3 2HBUA 3USUA 2VZVA 1CR7A 3CQOA 4Q4W3 5FPLA 2W68A 4Q4X3 1XNTA 2G1MA 2PHXA 4QPIB 4DEQA 3VZJA 1UW8A 2BERA 3RS6A 4YW5A 2HKXA 1KEXA 3WNNA 1JZ2A 1K5MC 1WMEA 2J1SA 4UW4A 3GJBA 1VBB3 1YQ5A 3KV9A 4XTPA 1G6NA 1RUH2 1K3IA 3I49A 4KMQA 3MIHA 2PYTA 2FDKA 4BA6A 4DY5A 1KITA 1OOPB 3VKOA 3MEPA 3AYAA 3NAPA 1BEV1 2VMEA 1URXA 3AMHA 1W8UA 1O8SA 3HQXA 4EWAA 1E57A 2H0VA 1V6OA 2YGMA 4GJYA 4K6BA 1BMV2 2BTVC 4AEDB 2MNGA 4AOCA 2FDIA 1ND2B 3VKLA 5A3MA 1POQA 1XXNA 2WA4A 5LA0A 1VBE1 3A22A 5LBBA 5BXXA 2GMPA 4RR3A 4OCTA 2YG0A 2ZX2A 3THDA 3THTA 2OZJA 3IWZA 5JDBA 5C9AC 3AP4A 3QOPA 5A7NA 1U5XA 5J1XA 3NSTA 4ES9A 4A6SA 2X09A 2DURA 1Y9QA 2A1XA 3T1LA 2HYKA 1MS8A 2A6YA 1E5RA 2ET7A 2JB4A 4WVWA 4A4AA 4LEJA 4CU7A 1Q8VA 2DUQA 3PMSA 1W8FA 2D6OX 3WLUA 3NJVA 4RQPB 2Z2SB 3QBQA 3U0ZA 3F2ZA 3ZPOA 2GN3A 4Z92B 1VRH2 3HOBA 3FFQA 3IAPA 2W2IA 4Y5SA 4ZXKA 1RUI2 1DZRA 4IV3B 2I74A 3VBUB 1RUJ2 4J1WA 2WRAA 1KGYA 1XNAA 1AF9A 2X29A 4QT6A 2UYBA 2PA7A 2UYAA 3KT4A 4DXRA 4A45A 1JOPA 3LA3A 3W58A 5IK4A 3ZMOA 2PXJA 1DP0A 4WZFA 4DNYA 2X8KA 3HT1A 2EICA 4FFIA 3MIEA 1SLCA 3R0RA 1LHOA 1XYPA 3JU9A 4LHSA 4META 4OI0A 4ORFA 5F8PA 3RDIA 4AGVA 3FHIB 1AL22 2QNKA 3IN9A 3ME2A 4M3CF 4XZUG 2IFRA 2RJKA 5A80A 5FMBA 1H30A 2JKBA 3W59A 3V0BB 2WKKA 3SNMA 1AR63 5L7OB 4B4PA 4X6QB 1AVBA 5C3PA 3W5NA 4RD7A 2VZTA 1H2KA 1W6QA 1HXS3 2DCJA 5JI9A 5FYMA 4XXAA 5EYYA 3NNJA 4MUVA 1O3SA 4QX8A 1REEA 2BGOA 1PZ9A 3S0MA 5K9YA 4XF1A 2L9LA 3JQXA 1HRI1 4BK4A 2FCTA 1GQHA 1RUG3 5JI7A 5F6KA 2WFF1 1EPWA 3VB9A 1OH4A 4ZHNA 1QDCA 1WMFA 2ID4A 2K0GA 1DQ5A 1Q8SA 2OXBA 2P37A 4AI9A 2AYHA 2VZ3A 3LOBA 4JKLA 2Q8CA 4CUAA 1D4VB 1CAVB 4ZPIA 2ZGSA 1F9KA 4NHYA 2P3KA 3NV3A 4LA2A 1LOFC 2HLEA 3LZZA 2XL9A 4YGCA 5FZ6A 4ASMB 2GC2A 5D8AA 3BTZA 3CBNA 4MXWB 4CDUB 3GHNA 1RVF3 2PHLA 2JDPA 3AYEA 4LIVA 2OVUA 5FPZA 4CCOA 1ZBA3 4HXCA 3RSJA 3ZSEA 4HN1A 1R083 4BH9A 5E88A 2YC0A 3WF1A 4PF5A 2JICA 3KV5A 3NNFA 4YM2A 4LUKA 2VOXA 4CXYA 1GZTA 3JCIA 1W3VA 1DQ0A 3WV6A 5J3UA 5LA1A 3KQ4B 2MEV2 4Y1XA 2FQPA 3WF0A 1A6CA 3OF1A 3P6BA 1PMHX 3WNKA 4Q4V2 5LBEA 4ONUA 3ZSKA 2VL4A 1I5PA 5BNOA 1UPIA 2DVGA 5KHKA 2NN8A 2GC1A 1YI7A 4F83A 2DU1A 1SZBA 1LOGA 3EXUA 1VB2A 1YNAA 5FYBA 5FYSA 3WHTA 5LW9A 3QD6A 1HLCA 1UF2C 4XDPA 3RWKX 3S6PA 3WQ1A 1FV2A 4MOAA 5DDJ2 3VHPA 3VD9A 2JE9A 4KBZA 2GNBA 3POIA 5K0UB 3OUIA 2PAEA 1SFNA 4CDXA 1OXCA 4IE0A 5EXOA 4UFMA 4AI2A 4D7SA 1EY2A 3IAQA 5SV8A 4CEWA 1QKQA 1RUNA 3GALA 3ZKUA 1UCXA 4KGQA 1K5MB 3UNPA 4COWA 1Z78A 5FZCA 4IE7A 1SLLA 1UU4A 2IXKA 2BFUS 2W9XA 3PMEA 4IDZA 5F6LB 2P5BA 3PVNA 2XPJA 3EHKA 1C28A 1NUKA 4I0AA 4NE9A 2JWPA 4M01A 1IS5A 1A8DA 4N8MA 2YC2A 3TN91 1KQRA 3PUIA 2R042 4JC1A 1VBC3 4Z8BA 2VBBA 2CTVA 1CZTA 2F4PA 4K1ZA 3T2OA 5JAXA 2D93A 1MEC2 2ORZA 3WNLA 3H7YA 3I3MA 1MS0A 2EXJA 1NT0A 3U37A 1NCQC 4FFHA 4AWDA 4EWDA 4MGZE 1BBT2 1YIPA 5ERLA 3NKTA 4NVPA 3LB9A 1HRV1 1W9FA 4Q4W2 3UJQA 5C9AB 3H1WA 4QQOA 3WNPA 5FBJA 4S2FA 1AX2A 3RZJA 4UW6A 5GLTA 2XQXA 4S2GA 4IGQA 3N9NA 1VBB2 2D43A 2BPA2 2WWJA 2ZTNA 2HYXA 2D97A 3KCYA 5FREA 1WBLA 1QJZA 5A6ZA 1NA1B 5A32A 1DLCA 2CGNA 2XKOA 3S5AA 3ZYHA 4SLIA 4DUVA 4N43C 4OFGA 3NNLA 5L19A 3QLQA 2WIIB 2D3SA 4LLFA 1FMD2 2VTXJ 2C6SA 2O0OA 5CAZA 1XPWA 5CYYA 1SHWB 1GWLA 4PHZA 3N4MA 4XJWA 1W99A 1ODNA 1SG3A 1VB4A 3FWEA 4V2VA 4Y5Z0 3ZSLA 5K7PA 1U5ZA 1OLMA 3B93A 5SV5A 2Q8EA 5ABJA 1UYPA 1B09A 5AFBA 4IE4A 2G4IA 2IWGB 1OD5A 1WCKA 4FPHA 1ZZBA 3PUAA 1XYOA 3SLIA 2R6QA 4CP9B 5FZIA 3ZXFA 4FP3A 1REFA 1H1AA 1SQ4A 2C5DA 3P1IA 2VPVA 4IV1A 4YLZA 2VNVA 1O7FA 4WM7C 4TYSA 4YYOA 3KT1A 4YW2A 3ZXEA 1WMXA 1PVXA 4A44A 3ZFEC 1J1TA 2VO5A 4JV4A 3NW4A 1N3PA 2CDOA 1APNA 2RMU3 1QF3A 5BUVA 4IQPA 3N7MA 3BUCA 3T30A 2YHJA 3M1HA 4G3YC 1PHMA 1XQNA 1W6NB 4XDQA 3POJA 4CCNA 5FPVA 5KC6A 2BWCA 3VBFA 3ACIA 1OLRA 4BQ4A 3RMYA 2Y38A 1W6PA 1BVP1 1AR62 4FPLA 5FXZA 1MS9A 5IAVA 4WVMA 1MS3A 3AZZA 4RS5A 3PVEA 4BOWA 1HXS2 3LE0A 1E5IA 3M70A 1J1LA 2GDFA 3H8UA 2ILMA 3GNEA 4JDNA 4Z2WA 2ZEXA 5L7OC 1QJX3 3I59B 3VL8A 3C7FA 1RUG2 4LK7A 3WXPA 2OA2A 1QQP3 2VUJA 3I97A 3WOGA 5JMCA 2HWC3 4Y1VA 3FE5A 1OLQA 3NAPC 3QCWA 4BPZA 4GXLA 4AVBA 5FPUA 1JYCA 1EPZA 4W8JA 1BXHA 4YW7A 4QHOA 1OA4A 2Z42A 5EP9A 1ACCA 3GM8A 5CFCA 3I3BA 1VRH1 5APAA 5F2WA 4DXSA 3OGSA 1RUI1 2E31A 2LRPA 4RR3C 5FY8A 5JXGA 2Q30A 2QQLA 1LOBA 1JYWA 1RUJ1 1QJY3 4XHXA 5JXHA 4M00A 2O1QA 1RVF2 3IB3A 5FMDA 4I3GA 1G9BA 2VOKA 3AFGA 3AP6A 4M3CB 2D6KA 1ZBA2 2VVDA 4BDVB 2YY1A 3VKMA 1X8EA 3BVCA 1R082 4N53C 1I1EA 2CV6A 3R4SA 4GQ7A 1F31A 3W21A 4QQHA 3GCXA 3OG2A 2QCSB 1GQGA 1PGSA 2W3JA 1AL21 3I3EA 3RPQA 2FD8A 1WLTA 1OKQA 4NIHA 4CU9A 2PHWA 1X9PA 1RMU3 3I2FA 3VBHB 4LBQD 2QDRA 1VBA3 3OGRA 5IVFA 1IG0A 4XJ9A 1ZREA 1GZ9A 3HT2A 3JQWA 4ZZ5A 2IFWA 3OOXA 5ANQA 3RFRA 3WCRA 2CY6A 5DAWA 2JG8A 3HPNA 2R063 1W05A 3CEWA 1NCQB 1KS5A 2YBKA 2E7TA 2B4KA 1JU4A 3TNPB 4IEPA 1VAMA 2DWRA 5FUNA 2D5HA 2HWE1 4XYXA 1SLAA 4QPGA 4BQ3A 1JYXA 1V0AA 2B8MA 4TZDA 5LY1A 5FUPA 2LW8A 3A4UA 2GSYA 5FPBA 1RC6A 2IUWA 1JOJA 1C8NA 1C8M3 2MHFA 2WA3A 3RQ0A 5FRAA 1BKZA 4C8DA 3AKTA 1H2NA 1J3PA 1Y4WA 1PNFA 2WWUA 4CA9A 2WO1A 3LWCA 4KGGA 4LO8A 2B9UA 2G9FA 4YG0A 1VBC2 1W06A 4TLGA 3NL1A 4N43B 3CU7A 1POV3 4NIDA 4QHZA 3O1SA 5I8TA 2EAAA 2O8QA 3LCPA 2VAUA 1CAUB 2VZ1A 1LHWA 3MPPG 1W03A 1JZ8A 4RA0A 2RS53 1NKGA 4OMCA 5DUXA 3WG3A 5FZ1A 3N9PA 3M4FA 1OPOA 1ZZ7A 2MEV1 4LBMA 4GWMA 1CX4A 4YVSA 3O14A 5D8AC 4Q8LA 5FK7A 5BY5A 3BN6A 4Q4V1 4DO0A 4FPGA 4MGSA 3MW3A 3ZLIA 2UY9A 1RUD3 4GMP1 5FP3A 4BYYA 1SDWA 3FMGA 3DPRA 4XFHA 5I8SA 4F7ZA 1O6UA 3KGZA 2XQRA 1DG6A 2BNOA 1XNKA 4WBBA 1ZZ6A 1WCSA 2YC4A 4TSVA 1CESA 1GP4A 4JHTA 4JZRA 5A7WB 1QDOA 1UY0A 2YU1A 4WM7B 5FP4A 5LEKA 4OLLA 2P3JA 1QY4A 2X05A 2P4EA 4JTNA 2V5YA 2GN7A 5FXVA 3WD5A 4XMAA 3ZFEB 5LRSA 2IZWA 2JKXA 3AZVA 3VZNA 1I9RA 1DGWX 2VECA 4AG4A 3FZ3A 2ZS6B 5BNOC 3RZGA 1LTEA 1DYPA 1Y7BA 2VBDA 1LGCA 2V4AA 3UKTA 4TTGA 3DECA 3WDYA 3LEGA 1LODA 1ULDA 4BU2A 2GNTA 3I3QA 4Q4Y3 4QX5A 1GZWA 4LBKA 2A5ZA 1VRBA 2J42A 4DQAA 5L9VA 3HAGA 1PNGA 1L7RA 4LMFA 2WT2A 3LDRA 2DUPA 5F5IA 1MVEA 2KXLA 3WR0A 4Z2AA 2R041 2IVIB 3H3ZA 4XBLA 2EXHA 1IHMA 1FATA 1S4CA 1X82A 3USUB 1A34A 3DUIA 3PURA 4CEWC 4MYEA 2PAMA 2BVBA 2VOTA 3C7GA 3IBMA 3G7DA 4CCMA 1BBT1 4V1PA 2CAVA 1U5YA 3B00A 4URTA 3ASIA 4Q4X1 5FO8B 3FHAA 5HXVA 3DEMA 3INAA 1ULGA 2ZKLA 3ALQA 4CRQA 2RMU2 1VBB1 2V72A 4JKMA 4AR2A 3NAPB 2HH9A 1S0GA 3J7NA 1GKBA 3NWKA 4CU8A 5FOJB 3CNAA 3KSCA 3PVOA 3B01A 2FZ2A 2IXLA 2WAOA 1F35A 2DBNA 3KQRA 3LGRA 2JEMA 4P08A 1FX5A 3LIGA 4AVCA 4FAHA 3GYDA 5IWFA 1TMF3 4RR3B 1TVGA 1WLCA 2VCAA 3W20A 1UWWA 3H50A 2EALA 3Q8BA 2VQUA 3EO6A 4AFAA 1ZZ9A 4P00B 3IDCB 3KT7A 2VZQA 2C24A 4N53B 1QNWA 4UWDA 4X8NA 5BYNA 1QJX2 3NNGA 5JR2A 3N7JA 2DUOA 2ZPXA 1U0AA 4IEZA 2BYVE 1QQP2 2HWC2 3WQ0A 1STMA 4YVWA 3CIHA 1LHVA 4E2SA 2F17A 4NRPA 1K5JA 3MGUA 2WN3A 3ZIXA 4XABA 4BXSV 2GP3A 1V70A 2JJ6A 4XJZA 1RJ8A 2XWBB 1HQWA 5AVAA 4HVOA 4DUWA 3U1XA 2EIDA 5IATA 4EN0A 2RS33 4P02B 4FO9A 1S2KA 3DYOA 4XHBA 4E4DX 1QJY2 2NPIA 4QGNA 4AF9A 3KLSA 2BFUL 4OZXA 2BGCA 2EXIA 2GC3A 3JUUA 3FLRA 3V56A 4FPYA 5DAXA 5ABJC 2VZUA 5FYIA 5F5QA 4CTEA 4QQLA 2W1WA 2ZGTA 4I02A 5FYCA 4W65A 4YARA 1QJFA 1UMHA 4D6QA 2O14A 2RM21 4HLTA 3E6CC 1N1YA 1W6QB 4IV1C 1CGPA 2VULA 1RMU2 4HZFA 4MO3M 1AR61 4GB32 4QX2A 2ERFA 4FP2A 3FFZA 5IAXA 4DIQA 2PLV3 4LUMA 1HXS1 2JDHA 4PI2A 2OUHA 1HQLA 5FZOA 3WQ7A 5IVBA 4LBOA 5LK7B 1CX1A 4YW6A 2ARAA 1OFNA 1OI6A 3AK0A 3QH6A 3KZ4C 3NJXA 4COYA 2R062 2JDUA 3R6SA 4CE8A 1NQJA 1VP6A 2I07B 3MV11 5C70A 2HWB3 1HJFA 3RG0A 2XHNA 1RUG1 1ST8A 3K4ZA 4QU1A 2B9VA 2VQ0A 4W6XA 1XC6A 1SBEA 3ZYJB 3DCQA 3VBFC 4RN5A 3D0JA 5JCTA 1W04A 1FYUA 3WNXA 2C26A 1NYWA 5L73A 2VOVA 4LO5B 5D8AB 2QTWB 5C4WA 4RS5C 4UI9L 1MZFA 5D2AA 1V6KA 2OYZA 4XVHA 4E2GA 1C8M2 4AYUA 2JG9A 5CBLA 5EJ1B 4HANA 1YO8A 2BNNA 4Y33A 2BW8A 3VD7A 2VUAA 3TEYA 4ZS3A 3C7OA 3IDBB 3M7AA 5H9PA 4ZZ8A 1MR5A 2ZX3A 2WN2A 3GCWA 4FQ4A 3SKJE 1RVF1 1S0IA 5I91A 2F4LA 1ZBA1 3BOWA 4CUCA 2NMNA 1R081 4LHKA 5DN2A 4Y1UA 3WF4A 3ZXGA 4AGRA 2RHPA 3VD4A 1BLZA 2V09A 1Y43B 5CFDA 3ZYFA 4HN0A 3RZLA 5LA2A 1D2SA 5CFCC 4AVAA 4OUEA 5BNOB 4XQDA 2RS52 1AX0A 4DXZA 1JUHA 3AMMA 4E4SA 4KWUA 5EV7A 2J1VA 4DB5A 1KRIA 3ACLA 4MGQA 1YJLA 3ACGA 4A3ZA 5JSPA 4PJYA 3MO4A 4NUBA 1IS6A 3DKQA 3B7MA 2ZX1A 2Q0AA 5FPAA 1OVPA 2PHDA 3A0KA 4FI9A 1RUD2 3GHMA 5T5LA 2P3YA 1H8TA 2UU8A 1C1LA 4HK8A 4RSUA 5FXWA 4HVQA 1DQ4A 3F95A 4XPVA 5IVYA 1JHNA 3O0VA 4P9IA 4CEWB 1QJU3 4PIZA 4JCKA 3OEBA 2VZRA 1VMHA 4KU8A 3HQRA 3RGBA 4YSFA 3ZYIB 5CU1A 1AZDA 3KD4A 3BODA 4DZGA 3OGGA 1H6YA 4LOTA 4PDWA 4RL7A 4YM1A 4YGBA 2WL1A 4Q4Y2 2A7AA 1UYYA 5F1RA 3AL5A 5FDBA 3V0AA 3TEXA 5DAVA 4XF0A 1QH6A 2WSVA 2XLGA 2Y6HA 3H3LA 2P17A 4CDWA 2ZHNA 3CF6E 2W0XA 2XJQA 1JHJA 1L7QA 4FTSA 1VBC1 4HK9A 2BOIA 5L9BA 5FZBA 2Y6LA 1V6LA 5DUWA 3WW2A 4TLFA 4FAGA 3A21A 3M3QA 3LEIA 4XJUA 1NAEA 3K75B 2B39A 1GBGA 1WA6X 3VDCA 4ATFA 4UFKA 4XF9A 4I09A 2XL7A 4IESA 5A32B 4ZU4A 1JW6A 2ADEA 2D3RA 3MV01 2X10A 3H7JA 4HMZA 5FZEA 5LCWL 1OKOA 2DFBA 4HL0A 2D6PA 2DTWA 1JN2P 3DL3A 5T5JA 4CP2A 4F3JA 5KXCA 3WQBA 2R32A 4QDQA 5EIYB 4YW4A 4IXLA 1TMF2 4LKDA 3ELNA 1MEC3 2GNMA 1YQ8A 5BNQA 5GKAC 1D2QA 2AC1A 4H7MA 1TQ5A 4FT8A 1ZZCA 5DG2A 4OHXA 1R64A 5FZHA 4G9SB 4YVSC 2YGLA 3O1MA 4OMDA 1Q3EA 2HBTA 3AXEA 4P9LA 5ABJB 4CZSA 1EAH3 2D3PA 3H3UA 3R4UA 3M3IA 3LF7A 4Q29A 1X7NA 1JODA 1YQ2A 3DPRC 2ZGOA 3FLTA 2DCZA 1E5HA 3PJYA 4QXHA 2Y6GA 3AJYA 5JIUA 4YGEA 4CPBD 2H0BA 4M3CE 4IV1B 3NJZA 4LBLA 4EN9B 1MS5A 2RS32 4QGMA 4FTBA 4N7IA 3LFMA 1LCLA 1REDA 3KHCA 1W6MA 1FMD3 4IERA 4RHV3 3KWVA 3LSEA 4L0PA 1O3RA 2XVGA 2JDNA 5D21A 2PELA 2DVFA 4PIYA 4URAA 2R49A 1GWKA 1ZBE2 2J1RA 3NMBA 1CZVA 2ZBJA 2E63A 4IEOA 4MGKE 1MQTA 3V0AB 1H4HA 2Q1MA 1SFYA 1V00A 5AVPA 2RMU1 5E89A 3ZFFA 4NR1A 3VBFB 1XNDA 3POSA 4AHWA 4L97A 2WQ8A 2DCTA 3A23A 1GOHA 2BV4A 1W6PB 1FOD3 1NA1C 1RUF3 3MIDA 3NRUA 3MLJA 3ETPA 4WVMB 4B7EA 1IOAA 4RS5B 3RZHA 4AEKA 4YRDA 3DYMA 5CZKA 4IEUA 2VCBA 4GAZA 1QOOA 3AYCA 3IIAA 4LULA 1LGNA 2PLV2 1H2LA 4D6SA 1HX6A 4M4PA 1C3HA 4YNIA 1WD3A 3S57A 1AYM3 1OC1A 3OCPA 3MW2A 5JXJA 5B2GB 1BQPA 4DXTA 3AB0A 1HN1A 2ARCA 1QJX1 4R8HA 1NG0A 1WCDJ 2HWB2 1D0HA 1F4AA 4EV0A 1DGLA 1RXFA 5C33A 1QQP1 2HWC1 2R1DA 1MS4A 1FXZA 1GUIA 2ZA9A 5JMOA 1H8VA 4A7KA 5CFCB 4E8DA 5IFPA 1DFQA 3ECQA 5FFOC 2IXHA 2WNEA 5JXIA 1VAKA 2RJ2A 4K20A 5FYVA 1UN1A 5LK5A 5KBFA 2DU0A 1SBDA 3K48A 3ZYGA 1FPN2 5DZGA 3TB0A 1WGPA 1HB4A 1EUUA 2VZSA 2QQOA 1GYKA 4C0HA 1ASJ3 1M4WA 1QJY1 3FUOA 3AXDA 4TN7A 4MZUA 1Z7S2 4RGAA 2WZPP 3DN7A 2C1FA 2A6ZA 1XU1A 5LB6A 5E8AA 1ZA4A 4GWNA 3NV4A 3OJBA 3P3NA 4U2AA 2NYYA 3O1VA 1HB3A 1TNRA 1LNSA 2FDFA 2CYFA 2E7QA 1TEIA 4LKFA 4ZU7A 5A1AA 3WDTA 1AXYA 1W8ZA 3C2UA 4BISA 1O3TA 2BBVA 1RMU1 3GF6A 5IJRA 4FFGA 3WP4A 2VMIA 5FZLA 1VBA1 3PDQA 1IZ3A 3B9CA 3OBRA 4RYDA 5FWJA 5CG8A 3ZSMA 2VC9A 2VMDA 5FJKA 3VDBA 3RI8A 1UU5A 4XBNA 3ES4A 3S5QA 2R061 1YHFA 2RDRA 2W95A 4CU6A 4DS0A 4JAAA 1QJU2 4CUBA 2R0HA 1G9DA 3I2JA 2ZOEB 4BMEA 2A6VA 4B8EA 2ZZJA 4UFLA 4DRVA 5JZGC 2WO7A 2IXJA 2WNVA 1SCRA 4XURA 4K7JA 1FNYA 3EB7A 1DIWA 4B7KA 1W9SA 2W1UA 4GH4A 4QX0A 1C8M1 4PLMA 1ENQA 4EZ4A 4UFHA 4KWKA 1V9U3 2W39A 4L2NA 1HB2A 2A70A 3SEEA 3ZDSA 4D7TA 1JYNA 3BTXA 5A3OA 5F7UA 1LGBA 1Y3TA 1O4YA 2UURA 4W6YA 1S2BA 1GANA 1W8HA 2R071 3D5OA 4XDOA 4AQ2A 4EYUA 1DF0A 4AQTA 2JX9A 3ZYRA 5J37A 1O91A 2AUYA 2E26A 4L11A 1S0BA 2NLRA 1AHSA 1C57A 4PF1A 3FBMA 4YVSB 4S2DA 2WR9A 4XIOA 3HVDA 3VBOA 2JG9C 3JZVA 4RFT0 2VMCA 3V65A 3VGIA 4GKXA 3KF5A 3K2OA 3DPRB 3VBHC 1PGW1 4CXWA 4X6RB 3CDZB 1XE8A 3I4IA 1RUD1 3N9QA 2QQWA 3LDKA 2A73B 2TNFA 3J9SA 2Z5WA 1H9PA 4JQTA 2BWAA 5CFDC 1ULOA 4Z07A 5GZCA 3N9MA 4FOVA 5HCAA 1NOVA 1O5LA 4UW3A 3JD73 4CPBA 4MH0E 1PO13 4O7XA 2ZACA 2QZ2A 1V6JA 4QX7A 4YZ3A 5FKBA 5T50A 4AXOA 1PVC2 5H9RA 2Q1ZB 2VNGA 3PTYA 2O8OA 3UV9A 1GZWB 4LITA 2E7AA 2BBAA 1H1MA 1EAH2 2XBO3 2Y0OA 3CZJA 3RJRA 5F3IA 2SLIA 3E1F1 3ENRA 3N35A 1H8TC 5T5PA 1W2AX 3J8F1 5DABA 1ZRCA 3RRDA 4NRMA 2YZ4A 3WINE 4LE4A 2AR6A 1X8MA 4MGTA 1UZWA 1N3QA 5F39A 4DINB 4RHV2 3L2HA 3K4AA 3PHMA 4PDWC 3GXUA 2A6XA 5GZEA 2XOMA 1PK6A 4A42A 3B5LB 2A3XA 2ZCWA 1C4RA 1XSRA 2A3YA 5J36A 4Y4YA 2ZJCA 2Q4SA 2WWSA 2Y26A 3PUHA 5KC5A 2QFEA 1FOD2 1NX9A 2P34A 5IW0A 4XQWA 1RUF2 3EQEA 4FPJA 4YG3A 5FQ0A 4BJ0A 4LO7A 2ZGRA 1RIRA 4QM9A 1B35A 3RNSA 2J7MA 3AP5A 2X53S 1UOJA 3CJXA 1F5FA 4BK5A 5J48A 2WNOA 3HQUA 2Z69A 1AYM2 1J84A 1O4ZA 4FOQA 4XQ4A 4CEYA 3U11A 2XJSA 1JZ7A 3UESA 3ZIWA 4AQ6A 4KBBA 1SDDB 2DVBA 1BK1A 1JOBA 4O65A 1H2MA 3B3QE 2Z4FA 1YI9A 1UAIA 2IXCA 4H14A 1QJEA 1UYXA 1WW7A 1RUH1 5FO9B 5AC91 5C8CA 4GWIA 1JYTA 2QUOA 4HFSA 4IEYA 5JLVA 3UT0A 1SPPA 1W9WA 1MPXA 4Q2FA 4BQ2A 2VVEA 3ZYPA 4M0HA 1TG7A 3DV8A 3UK9A 5L36A 4PCRA 2A3WA 1CN1A 2WZR3 3T0AA 5FY9A 5J7MA 1RITA 1CQ9A 1UYZA 2RS31 2SBAA 3K51A 4KH9A 4P9JA 2PHFA 3RVHA 2RS13 5A3WA 2QQJA 2X5IA 1AJKA 4COUA 1ASJ2 1OBNA 3SC7X 2C9KA 2VU9A 2VR4A 4KL1A 3VZLA 5I0DA 3O1OA 3E5UA 2RR13 1C5HA 3IDAA 1BJQA 2VBPA 5A3TA 2KR2A 3MDPA 5EWSA 2WINB 2C4XA 1OQ1A 2EF6A 2RVAA 4HKOA 1T6GC 3WP3A 3WCSA 3WSOA 3C7HA 1AX1A 2FDHA 5JZGB 2LROA 3D6EA 4IGOA 2LM3A 1T6BX 3AC0A 4HBNA 3POYA 3UKNA 3FJSA 3ZMNA 1IPSA 1COV3 3ZOIA 3KCCA 5F32A 3MLLA 4NAMA 4NWVA 5FXXA 3VHNA 4ARYA 5FZOB 4NIGA 1DQ6A 4PIXA 1A8MA 3A0NA 2W08A 4A2UA 5BNNA 4A3XA 3VBUA 2PLV1 4CP1A 3B9IA 5JOWA 1D4M3 3H42B 2HWF3 4KWLA 5T5OA 3SCGA 5LEJA 4MHUA 1SBFA 4IETA 4PI0A 5FLHA 2PHUA 3ZFFC 2Y60A 4EJRA 5BV6A 2OUJA 2HWB1 4ASLA 4D3WA 4Q5OA 3HBKA 1MS1A 1IPKA 4PQ9A 2WLPA 4IGPA 2HJIA 3ZFGA 2JG9B 5J96B 2P1BA 3J7LA 4XCBA 2PFWA 4FXGB 1GMMA 1AYN3 5FY5A 3FHQA 2BP6A 2VW0A 1EUTA 4CDQA 5HBAA 3E97A 4GB33 3AM2A 5A6XA 1V9U2 4XUOA 1GOGA 1UPSA 4B4QA 1LAJA 5C7GA 3FBYA 4N7UA 4YZ2A 4UF0B 3OYWA 1PMIA 2WQZC 4FQZA 4FVVA 4K9SA 5IUQA 5FZ8A 5CFDB 1AR83 1J83A 4QX3A 1YUDA 2CHHA 2QQNA 1WZXA 1K45A 2D7FA 2DVAA 5LATA 4Y20A 1SLBA 2TUNA 5A1LA 1ZYBA 2ZABA 3ZDVA 1SLTA 3AKPA 1WLDA 2XJVA 1UIKA 2EAKA 4XFFA 2BOJA 2OQ6A 2VGDA 4BHPA 2CAUA 1QEXA 4ET7A 4CUGA 1LESA 1BHGA 1NY72 4AL9A 5I8YA 1H8TB 5DQ0A 2VMHA 3UL2A 4XBQA 1IKPA 3R05A 4MVTA 3AMQA 3CLPA 4JTOA 2OPWA 2DV9A 5C3SA 2RDSA 4YZ1A 2V4VA 3ATGA 3FL7A 2PHRA 4I0WB 4KG8A 4P9XA 4YM0A 4OI2A 5KHJA 1OLME 1UNBA 5FMOS 3WVJA 2VH9A 2XUMA 1QJU1 3JD72 2DBIA 4NMIA 3TYJA 1PO12 4LNVA 3OEAA 4OHVA 4PDWB 4Q0SA 3KCXA 3P3PA 1CAWA 2AEZA 3VZOA 4MGYE 2XBO2 2FHRA 4LQRA 4BCUA 5HPOA 5ISLA 2UWCA 3VD5A 1BCXA 2PN5A 4COVA 4COZA 5LASA 4KG0A 4AVVA 3WP5A 4EROA 1W8TA 2VW1A 3OPZA 3B02A 3U78A 3I2OA 4E2QA 5EJZB 1NXMA 1XNCA 5DDJ1 5LA9A 1HV0A 2D6NA 3WNMA 4DEVA 4HPKA 4UT5A 4HOOA 4QQ2A 2H6CA 4XILA 4BM8A 1LHNA 2Q1FA 2WNVC 1RUC3 3KGLA 4TXWA 2B42B 1XU2A 1L7LA 2TBVA 4GMP0 1GR3A 2WT1A 1VMFA 3VV1A 4AFMA 2RG4A 3MPBA 3U10A 3EYPA 3GBGA 3RWNA 2WBKA 2BUKA 3M3EA 4INDA 5D1IA 1JH5A 1CAXA 1LULA 4BMBA 3VBSA 2DFCA 3N9OA 1YIFA 2XHKA 4LHLA 3AL6A 4W50A 3UGHA 1H1IA 3WG4A 5FYTA 2J1UA 1ZVFA 4CDXC 3AX4A 3HIFA 1GP6A 1GV9A 1G86A 1MEC1 1FV3A 1UKRA 3JB8A 3JBG3 4UXAA 5FY1A 1GQPA 1IG3A 3AFKA 3KHBA 3KV6A 4Q4W1 4YM3A 1ALYA 2OZ6A 2ETEA 2AH2A 4BZ4A 5HCFA 5HV4A 1US2A 3L9JT 4FFFA 5T55A 4E4ZA 5FLIA 4K3UA 1EAH1 1BMV1 1IS3A 1Q8PA 2OQ7A 2EXKA 2CWMA 2GP5A 4LO6B 2C0ZA 1FAYA 4BQ5A 1YQ6A 3RYRA 3BTYA 3TRSB 4B1MA 3EBRA 1DYKA 1JS9A 2B45X 1W6MB 1LR5A 5I0RA 2WZR2 4OZOA 3T4VA 2RS12 5DAQA 1FMD1 3V64A 4RHV1 2HEYF 4NPLA 2RR12 4LJHA 2VJXA 3LQCA 3ZFFB 4Y26A 4GWJA 4XFBA 5G04L 5DZEA 3VL9A 1DYOA 1I6XA 3GZTB 2QQKA 3CZUA 4QPYA 1Y9GA 3HBZA 4LLOA 4UOJA 2BNMA 1F2NA 2YUEA 4I3PA 5FUIA 5CG9A 1FOD1 2W1QA 1RL3A 1RUF1 1COV2 2CGOA 2YXSA 5DAPA 2J1TA 5DUVA 5H9SA 3SEPA 4B29A 1N1TA 4QXKA 3WG1A 1RUOA 2PAKA 3VN4A 1I5ZA 3AZXA 3O7OA 4NRQA 5T3NA 1UMIA 5IK5A 3SH4A 1PK6C 1D4M2 4MHRA 2HWF2 3K3OA 1AYM1 1ZRIA 1DGRN 1ZBE3 4LBQA 4XAAA 2XLFA 2VMFA 2QQMA 4LHNA 3WDUA 3LSDA 3CMGA 5FZ7A 3OTFA 3SKVA 2OKXA 3AJZA 5A6QA 4ISRA 3MIGA 3NO8A 2VXJA 3VDDA 2RDNA 4FOYA 2CSGA 3IIIA 4IEQA 1OPMA 4L9BA 1W6OA 2BEOA 4NIAA 1AYN2 2J1EA 4N9HA 4MXVA 3VZKA 1LOFA 2JECA 2OX0A 3O0WA 1RJ7A 5FZAA 1CJPA 4CEYC 1VR3A 4CYDA 3DKWA 4WV8A 1ASJ1 1UD1A 5FP8A 4QB1A 4U36A 4YG6A 2JDAA 3OPTA 1ENRA 4NHMA 1AR82 4ISQA 3T2QA 5C8CC 3VZMA 2PMWB 5FZ9A 1PGL2 3ST7A 4I30A 4Q0QA 1S0EA 4XUTA 4UBGA 4QD2A 2JENA 4XFAA 3BGAA 5C8WA 3TAYA 3WEZA 4O9EA 1Q8OA 1WMDA 3C3VA 4P9YA 1DHKB 1OURA 1I3HA 2X5IC 4PT6A 3ZN5A 1FPN3 3VKFC 3J7HA 5B4NA 5JR7B 2J1AA 5FZKA 1N3OA 5IVVA 2KA3A 1J3QA 1R093 1GWMA 2ZX0A 5HI0A 2ZGKA 1Z7S3 2ADDA 5JOZA 4XC9A 3VDAA 3WW3A 4YW1A 3W9AA 1GU3A 4HKWA 1GLHA 4EN8B 2E33A 1RHI3 1GNYA 5E16A 3VUOA 1BK0A 3H8RA 2WNVB 3POBA 4BXFA 3BTAA 1HKDA 4Y22A 5F2SA 5KR7A 1GICA 1OVSA 1D0GA 1MVQA 3HJRA 4HONA 5FMCA 5A1FA 2Y34A 5FR3A 1OT5A 1MACA 2YBSA 4IEVA 1W9YA 2XUEA 4NPRA 3KM5A 3PJQA 2N7GA 4AHYA 3PVBB 5I0TA 5G05L 2ZHMA 4E4HA 3GGLA 1US3A 3N7KA 4ZU5A 1V9U1 2WABA 4XEZA 4OHZA 3LFIA 5JIAA 1H9WA 2FBEA 2JDZA 1IQAA 2ZGPA 5FYZA 5IVEA 4CDXB 4QPWA 2Y0IA 2BZDA 4E9KA 3H8OA 3ZXLA 3SH3A 3ZFGC 1RUC2 3BOPA 2GMEA 1F8VA 3JB4C 5I93A 1OD3A 3AMNA 4AEJA 3ITQA 3GZUC 1CIYA 4YGDA 3E5XA 5KXDA 3WHUA 2FMDA 2B5HA 1H6XA 3O5SA 5DXDA 2K9ZA 4QKBA 1ODMA 1UXZA 3ZM8A 3M3OA 1IQDC 1C1FA 2Q8OA 2ET1A 5FZDA 2JG8C 3WG2A 1OHFA 4AAXA 2WSUA 4ZKTB 1DCSA 4NIIA 3FX3A 5FIXA 2BJSA 5L9RA 4AVSA 1F15A 2LALA 1EV13 2D98A 4KNCA 1VBD3 4OUSA 3ZN6A 1VPHA 2WUHA 3JBG2 3JD71 4HKLA 2W5FA 4QPGC 5C3OA 1PO11 3H9AA 1W0NA 4XFCA 4CSWA 2W1SA 1W8NA 2ZAAA 1NE6A 4XTMA 3K46A 3S30A 1AR93 3OBZA 2E6VA 2ZGNA 1HW5A 4ES8A 5DG1A 1N47A 4QQPA 5AC93 3WW1A 2QVSB 2VUDA 5A3UA 4LIUA 3DXUA 2IC1A 4LO4B 4JRAA 4OUMA 1CIWA 4ZONA 3BIEA 5C3RA 1R1ZA 1AXKA 1LECA 1QMJA 2GH8A 1W2TA 1OQDA 5JPNB 5DUUA 1LB2A 2E32A 4UAPA 1AR73 2P2KA 1PK6B 1BZWA 1OF4A 2VCMA 2WZ8A 2ATFA 1PVC3 3AZWA 1UQXA 1CJDA 2AZ5A 3ON7A 1RGSA 4QDRA 1CZSA 1JU3A 3LIHA 2A75A 4LOSA 3HNYM 4MV2A 2RE9A 5FQ0B 1LOAA 4DRRA 2CL2A 1YYNA 4GIQA 1WW5A 2YROA 2VNOA 2XDVA 3T2TA 3H1YA 4Z1VA 1PO23 1NLSA 3OY8A 2JD9A 3ZR6A 1CONA 4A6OA 4CEYB 1LEMA 2XXZA 3I2GA 2BU9A 2LUWA 3M2MA 4NWWA 4Y24A 4CCDA 3ZX7A 2GNDA 3IM0A 4IEXA 4C91A 5FOBB 3LKJA 5C8CB 1CD3G 2BGPA 1ZRRA 3QH7A 3OUJA 3MIBA 2ZEYA 4HETA 1IPJA 2E53A 2ZGLA 4WM8A 1SPPB 4LA3A 2NQYA 3VBSC 1AUYA 5F5AA 4R4XA 4AHXA 4D94A 4EWEA 2D5FA 1DGWA 1N1VA 1XBFA 2IXIA 2XGXA 2ZEWA 3ZR5A 5FMOL 3PLQA 2VOWA 4GJZA 5IVJA 4OULA 2VE1A 2X5IB 4PLNA 2WT0A 3CJIA 3SHRA 2GZWA 1FI2A 2WZR1 1X9TA 5FZGA 4LK6A 2JD4A 4CXXA 5FY7A 2RS11 1D7PM 1OSGA 2JE7A 4GA9A 2P3IA 4EZHA 1KDKA 2V73A 5JSOA 4JQRA 1UKGA 2RR11 3PL0A 1W3XA 4NHLA 1WWYA 4N53A 1ZM1A 2YFUA 2AENA 1W2UA 1QXRA 1XE0A 4BLJA 1RUE3 3QACA 4EQVA 4XCAA 4LBNA 5C3QA 3C7EA 1COV1 1RB8G 2KM2A 5DPNA 5LBCA 4RGGA 2B46X 4IW3A 5ACA3 1BVVA 4JDMA 1H4GA 2PHTA 3HWJA 4YWAA 3NV1A 1R092 5KHGA 4ZY9A 1CWPA 1HN0A 4K8RB 4XFGA 1OF3A 1NE4A 1D4M1 3USSA 4WVVA 2HWF1 1TZOA 1UY4A 3N3HA 5K4LA 4DUXA 1RTVA 2W94A 4LKEA 3BCWA 3H0OA 4NHXA 5CKMA 2PQQA 4GZ9A 1RHI2 3LPFA 1YFUA 2ZX4A 3DYPA 4Y1ZA 3O12A 4YVWC 4L92A 4PLOA 3BYWA 3T4HB 3UJOA 3ZFGB 3BI3A 3KVBA 4Z82A 2RDQA 1VALA 1GZCA 1SLIA 3R4DB 1MZ5A 4QKNA 4Q1PA 2RM23 1UZVA 5EFUA 2HWD3 4I2OA 4CDQB 3U4XA 4D6RA 2VTXA 3ZXDA 4AE2A 3E5QA 3POGA 5HCHA 1AYN1 3J4UH 4OYUA 2NMOA 4BQXA 1NCRA 1TME3 2Y64A 3OYWB 4GB31 2WS93 2WZEA 4PBPA 3OGJA 4R9BA 2AGSA 2JG8B 2VZOA 5CIRA 4AHZA 2PQSA 2CGPA 3VBRA 2BDRA 3FN9A 2WYFA 4FSJA 4Y20B 3E6BA 3CKHA 1WCUA 1AR81 1O4TA 2G9ZA 4R4ZA 5GALA 3ROUA 2JIGA 1KXGA 3DXTA 4QHBA 4AVTA 2HWE2 2JB8A 1PGL1 4QPGB 3MYXA 4ITCA 3D0SA 5EHDA 3VDDC 3GZEA 4ARXA 4F8AA 1GOFA 3POWA 1UZYA 1SEFA 3Q8CA 5GLVA 5CB7A 3SISA 3ES1A 5BNPA 2WJSA 5TSWA 2R16A 2Q8DA 2DTYA 2YPDA 4NAOA 1VAVA 5HXMA 4XUQA 4BE3A 3OBTA 4B4RA 1X36A 1PIV3 3AKQA 1HV1A 3ZYBA 3JXSA 5GZFA 1QNYA 3T08A 3MW4A 2WNUA 5FY4A 2VMGA 5ANNA 5I0SA 1POV1 1EV12 4QU2A 1VBD2 3ZN4A 3HR9A 1U12A 1CAWB 2LTNA 3PU3A 2ZXQA 1G7YA 3B69A 5C4WC 3Q8FA 2ARBA 2I45A 5FZ4A 2QQVA 2RS51 4QDSA 4BB3A 1AR92 1YWKA 4FPFA 1E5SA 1RXGA 5LWBA 5F3GA 4JRLA 1DBNA 2D6LX 4YFZA 3TEZA 4NJ4A 5AC92 1POV0 2YYOA 1ZX5A 1SACA 3M3CA 2OW4A 5GM0A 4AFCA 1KJRA 5F9TA 4A41A 4HPKB 2W47A 2JDYA 2D6MA 4G4FA 1UOFA 2VUCA 2OS2A 3LD8A 4QB6A 4AI0A 1F5JA 1UY1A 1LU1A 3MUY1 4BLIA 1CVNA 5CKQA 3T1MA 1EYBA 1QH7A 3WX5A 3GBFA 1AR72 2OT7A 3GJAA 1KD7A 2I2SA 1RUC1 5JOYA 5FKCA 1JTZX 3IPVA 1V6MA 2FMYA 3AKSA 4GALA 2QZ3A 3K3NA 4IE5A 4JGYA 1CAXB 1HJGA 2W52A 3MICA 1ULFA 3OGVA 1Q5OA 2GAUA 3VBSB 5FTTC 1F4HA 2XG3A 3LA7A 4MADA 4GKYA 4Q4Y1 2YU2A 4EN6B 1LENA 3ACHA 1EP0A 5FO7B 1QOSA 1PO22 1LEDA 2JDMA 1UU6A 3D3AA 3RI9A 5IT6A 2UWBA 3WUCA 1XOYA 2H6BA 4H3WA 2AACA 2R0FA 3DGTA 4J25A 5E1RA 3PIGA 3NV2A 4Q0VA 2ZHKA 4M0NA 1ND3A 2BQPA 2R7EB 2QKDA 3FC0A 3JBG1 4Q4X2 3IDEA 2ZMKA 5A33A 3H1MA 1S1AA 4Q27A 3CHXA 2Y33A 5GLWA 1YEWA 4ATEA 4HT1T 1UOGA 4JGZA 4W4ZA 1XRUA 4OHYA 1NZIA 3WNOA 3SCHA 3I3DA 1FT9A 1R1A3 2GMMA 5DZFA 4CDWC 4LE3A 1XSQA 2VQTA 4LT5A 5JWPA 1WA4A 3LAGA 2KD7A 4DY3A 1S0DA 1JBCA 3FUQA 4J1XA 4JVAA 4R9CA 4E27A 3MZHA 3O1TA 2VTFA 4XXPA 3MF9A 5LY2A 4E8CA 2UY8A 1TMF1 2VVFA 5FZ0A 3I7DA 3WDVA 1KFUL 4PQQA 4UW5A 3GDBA 1G9FA 1ULPA 2E51A 5BPXA 2Y8KA 1NXD1 4QPIA 3LEKA 4YVWB 3ZVXA 3URFA 1QHDA 1JMUB 1O5UA 5EQUA 2DCKA 1K42A 1JYIA 2QJVA 1QGLA 2WLQA 4Q26A 1BEV3 1RUE2 5A7SA 1LOEA 3BB6A 5HCBA 1OOPA 1W8OA 1SCSA 3PIJA 5ACA2 5C6CA 1W39A 1VBE3 3GBWA 1Q56A 1P8JA 5C5UA 3AKRA 3ZO0B 4AEDA 4A7YA 1UIJA 1ND2A 4B3NA 1W90A 4LBQB 5F3CA 1DQ2A 3SITA 5CKNA 4D7YA 3TWIA 4YZ4A 1KFXL 5I0UA 1M06G 1HB1A 3GZAA 1ZBE1 4XFIA 2MPFA 2P6CA 2ZZQA 4X8PA 4AI3A 3VDDB 1UY3A 2YFZA 4LPLA 4DOUA 4C1XA 1W6OB 5JUVA 1QIQA 2RM22 1XE7A 2ZHLA 4N90A 2DDUA 4BQYA 2HWD2 4Y4RA 3ACFA 5KHIA 4ZXEA 5C5TA 3U14A 4RQPA 4QX1A 4C90A 1FNZA 4EN7B 3WP6A 1TME2 2WS92 4IV3A 5IK7A 1J58A 1DLLA 3MIFA 4UBHA 4OQ9A 4LXLA 1ENXA 3CL1A 5EPAA 3POFA 3IMNA 1W0PA 1YCIA 1YFYA 2WQ4A 1MQTC 3T09A 4XUPA 1DGRA 1OMIA 2XJTA 4NO4A 4WM8C 4D8MA 1VIWB 4LBJA 4FTEA 1UXXX 2LS6A 1J3RA 4FPKA 5JOXA 3W5MA 1PM7A 3NQHA 1QWRA 4MSVA 2DF7A 4XIKA 4Y3OA 5C4WB 4R9DA 1ZRDA 3I2DA 4XF3A 3Q8EA 3CJIC 2W46A 1VJ2A 4JDOA 2V5DA 1G9CA 1GNHA 1O3QA 4LR4A 4UFJA 5FP9A 3V0BA 2YPJA 3SCFA 1ZZ8A 1FPN1 2EIBA 2Z79A 5L7OA 2XMLA 3KB5A 2GU9A 3I8TA 1PIV2 2CWSA 1R091 3Q9OA 5GJ6A 4AI8A 4C0BA 2NM1A 4IEWA 2XH6A 3ZXJA 1XJAA 1HRI3 1Z7S1 2QQUA 4PBOA 2WFF3 4Y22B 1XYNA 1VLNA 1JZ6A 1RHI1 2YDEA 2J22A 3ILFA 1W9TA 2YB7A 3N9LA 5IK8A 3LDBA 3UGFA 1YC61 4O61A 4RFRB 3I2HA 3T2PA 1Q43A 3U4SA 2FCUA 2UWAA 4QWNA 1CAVA 4A7ZA 4D0QA 5FZ3A 1LU2A 4K1YA 2HEWF 1HIXA 1UOBA 1VE0A 1YXWA 3AP9A 4OHWA 4YFWA 3RMXA 4K8FA 3KVAA 5F3EA 1ONAA 4MXWA 4CDUA 1U5IA 3MHZA 5BNNC 5F37A 4UFIA 4XF4A 1KJLA 3NJYA 4CCCA 5LRRA 3K4DA 1LJ7A 3FLPA 5FY0A 4D69A 3KMHA 4Q8KA 4HG6B 5FYUA 2ZKNA 3BU7A 4XAEA 5B4XA 3IT8A 4AK3A 5KWRA 1GP5A 2BVVA 1JI6A 3AYDA 3OB8A 2FDGA 3HEIA 1W8WA 3G6JB 5JPMB 2XJRA 4P5YA 3Q8AA 4RGKA 5LBFA 4AQSA 3WDWA 4GULA 1NCRC 4H2AA 3VD3A 3ZKYA 1ULEA 1UX7A 3OPWA 4NOTA 4CDWB 5FLJA 3THCA 4NROA 3VBRC 1CPNA 1W2NA 3PUQA 4L8QA 4YPJA 1PZ8A 3OSDA 2R073 2XB6C 5CEHA 1WD4A 1KS4A 3ZN6B 3MBWA 2WYSA 3I2KA 4CCLA 2Q5TA 3ZSJA 1A3KA 2XVKA 2Y6FA 5K0UA 1EV11 1IKQA 4QB2A 1VBD1 3MLKA 1ZNPA 1QOTA 2WO2A 4I0BA 4OVEA 4BWOA 1ENSA 1GNZA 4Y1YA 4O9GA 4AFBA 5BNPC 3ORJA 3AVSA 1WCQA 1HDKA 3MUZ1 1IS4A 1PZ7A 5EJ3A 4GH4C 4CVUA 2WFPA 3B94A 4FOWA 4QM8A 4FCAA 1LKNA 5IVCA 1K5MA 1AR91 2G19A 5GLZA 3P5BA 3TN93 4Q0PA 2XJUA 1R1A2 4UYBA 3O1UA 3AP7A
chains in the Genus database with same CATH topology
1JUIA 4HSJA 1W0OA 3APBA 2WNUC 5GZDA 3WZ1A 1ZRFA 4H7LA 1UL9A 1X33A 2YMZA 4NN0A 3D82A 2OIIA 4SBVA 1HRV3 1TE1B 1AR71 1Q8QA 2XKPA 1Z0HA 2PTMA 5EZWA 3UKVA 3VBOC 4DMIA 1GSLA 2XJPA 1UMZA 2EA7A 1PVC1 3MF6A 5C9AA 3BALA 1WW4A 3THPA 3MI8A 2A6WA 3VHRA 5A3LA 3J8F3 1YFXA 4XOGA 1AJOA 5FPXA 1BEV2 4QMAA 5J98B 2VNRA 3OY8B 1NA1A 1NQDA 1MZEA 2YV8A 1PO21 3NVCA 1VBE2 3N7LA 1BYHA 1MZ6A 4FPCA 4BIFA 2A71A 1DZTA 3WDXA 1C5IA 1WUVA 4H55A 1MQTB 2EVXA 4JGYC 2WC2A 1YJKA 3D4KA 4WM8B 4FPOB 4Q0UA 5CA6A 1SMVA 3WT3A 4K40A 1DZQA 4MLOA 4HVRA 1UZZA 1KDMA 3CJIB 3KS7A 3BPZA 2E9QA 2ZAHA 1YFWA 3VKNA 3O0XA 1S0JA 2GC0A 3ILRA 3DF0A 3M8LA 1ND3C 4Q1RA 4OI4A 1AL0G 2ENRA 1DQ1A 1DU3D 1QXPA 2DCYA 4JGZC 4KU7A 5CVRA 4BQ1A 1A78A 1H0BA 1RUH3 4R52A 3CO2A 4AW7A 2ZGQA 4N9IA 2R1BA 2GH2A 3TOJA 4AFDA 2NP0A 1RUE1 5KXEA 1W6NA 1WBFA 2ARXA 5CNAA 1B35C 2XLAA 3VHOA 5KHHA 5ACA1 4P5HA 2FZ1A 3I54A 5T52A 4YZ5A 2NZ9A 3VLBB 4HSLA 2VW2A 5BNNB 4QPIC 1HRI2 3WW4A 3OD4A 4P14A 5EYXA 5FCCA 2WFF2 1J59A 3I59A 4AEMA 3AZYA 4XJAA 3OD0A 1OOPC 5CADA 3X29B 5JZGA 3MFAA 4XW3A 1VRH3 2HWD1 1RUI3 1NCRB 4FXKB 3HMYA 4AEDC 1RUJ3 1VBA2 4J6GA 1ND2C 3ETQA 5H9QA 3ZXKA 3VBRB 1TME1 2WS91 2JXAA 5GLUA 4M3CA 4NHKA 4KWJA 2VY0A 2F6BA 3LA2A 4XMIA 1IGOA 1OFSA 1X50A 3S7IA 1AL23 5BNPB 4CP0A 4RQPC 2VXRA 1YLLA 1S55A 4GH4B 5AFEA 3S7EA 4IL7A 4IV3C 3VBUC 3N36A 1JXNA 3VBHA 3TNQA 1CPMA 1PIV1 3AMPA 2WNUB 2R072 1L3JA 3RJ2X 2ZGUA 4AGGA 4QGLA 1HQNA 3PNAA 4AI1A 3HN1A 1G8WA 1QXJA 2HWE3 2ZGMA 3LOIA 1NCQA 1OQEA 4FPEA 3VBOB 3E6DA 1V6IA 1GFF2 1N1SA 2DYCA 4CDQC 1WW6A 2G9GA 4P9GA 2EIGA 3J26N 3WUDA 5JSRA 1PGW2 4LTAA 2TEPA 3ZPYA 5L7OC 4XE9A 1DDLA 3TBDA 3HD8B 1NY71 1S0CA 3TN92 4S2HA 4XETA 3RZZA 4MX3A 1S0FA 2XWJB 4R9AA 2D44A 5FBZA 4C1WA 4BIOA 2K2SA 3L2YA 4N43A 1RINA 2GALA 1HRV2 1YRZA 2QE3A 3IPVB 1AXZA 4TWTA 4KQ7A 5JVVA 4YW3A 3SMHA 1NZCA 5KXBA 3IKWA 1CAUA 4JGYB 4DPNA 2MEV3 3D8CA 1OA3A 3RYPA 4Q4V3 3ILNA 2B7YA 3EJKA 4MGIE 1WLWA 3J8F2 2ZMNA 2XBO1 1QU0A 4GMP3 1G9AA 4CDUC 1LOCA 2R30A 2OPKA 3NKGA 3SH5A 5DDJ3 1XNBA 4XZPA 2DVDA 1NLRA 3BIWE 1ND3B 3ZXAC 1UX6A 3RYKA 3WY6A 5FAXA 3U07A 1TNFA 4W6WA 5A33B 5T54A 1LHUA 1LRHA 2HEVF 4WM7A 2C9AA 3MFCA 4JGZB 2VG9A 4FBFA 2D40A 2XVLA 3ZFEA 5J09A 2ES3A 4P9WA 2RJLA 2QDNA 1OA2A 4XJ8A 4OI1A 4L99A 2AREA 2CNAA 1R1A1 4WVZA 5GZGA 2R043 1ULCA 1B35B 4WZCA 4I01A 3SXWA 4DFSA 2ZMLA 4K21A 5K0UC 1V6NA 2VQAA 2QQPA 1BBT3 3USUA 1CR7A 4Q4W3 2W68A 4Q4X3 2PHXA 4QPIB 3VZJA 1UW8A 3RS6A 4YW5A 2HKXA 1K5MC 1WMEA 4UW4A 1VBB3 4XTPA 1G6NA 1RUH2 3MIHA 2PYTA 4BA6A 4DY5A 1KITA 1OOPB 3VKOA 3MEPA 3AYAA 3NAPA 1BEV1 1URXA 3AMHA 3HQXA 4EWAA 1E57A 2H0VA 1V6OA 2YGMA 4K6BA 1BMV2 2BTVC 4AEDB 2MNGA 1ND2B 3VKLA 5A3MA 1XXNA 2WA4A 1VBE1 2GMPA 4RR3A 2ZX2A 3THTA 2OZJA 3IWZA 5JDBA 5C9AC 3AP4A 3QOPA 1U5XA 3NSTA 4ES9A 2DURA 1Y9QA 3T1LA 2HYKA 1MS8A 2A6YA 2ET7A 4WVWA 4LEJA 1Q8VA 2DUQA 3PMSA 3WLUA 2D6OX 4RQPB 2Z2SB 3QBQA 3U0ZA 2GN3A 4Z92B 1VRH2 3FFQA 4ZXKA 1RUI2 1DZRA 4IV3B 2I74A 3VBUB 1RUJ2 4J1WA 1AF9A 2X29A 4QT6A 2UYBA 2PA7A 2UYAA 3KT4A 5IK4A 3LA3A 3W58A 3ZMOA 4WZFA 4DNYA 2X8KA 3HT1A 3MIEA 1SLCA 3R0RA 1LHOA 1XYPA 3JU9A 4META 4OI0A 4ORFA 3RDIA 4AGVA 3FHIB 1AL22 2QNKA 3IN9A 3ME2A 4M3CF 2IFRA 2RJKA 1H30A 2JKBA 3W59A 3V0BB 2WKKA 3SNMA 1AR63 5L7OB 4B4PA 4X6QB 1AVBA 4RD7A 1H2KA 1W6QA 1HXS3 2DCJA 5JI9A 4XXAA 5EYYA 4MUVA 1O3SA 1REEA 1PZ9A 3S0MA 5K9YA 4XF1A 3JQXA 1HRI1 1GQHA 1RUG3 5JI7A 5F6KA 2WFF1 1EPWA 1QDCA 1WMFA 2K0GA 1DQ5A 1Q8SA 2P37A 2AYHA 3LOBA 1D4VB 1CAVB 2ZGSA 1F9KA 2P3KA 3NV3A 4LA2A 1LOFC 3LZZA 2XL9A 4YGCA 4ASMB 2GC2A 5D8AA 4MXWB 4CDUB 3GHNA 1RVF3 2PHLA 3AYEA 2OVUA 5FPZA 1ZBA3 3RSJA 3ZSEA 4HN1A 1R083 4BH9A 5E88A 2YC0A 4PF5A 2JICA 4YM2A 4LUKA 2VOXA 3JCIA 3WV6A 1DQ0A 5J3UA 4Y1XA 2MEV2 2FQPA 1A6CA 3OF1A 4Q4V2 4ONUA 3ZSKA 5BNOA 1UPIA 2DVGA 5KHKA 2NN8A 2GC1A 1YI7A 4F83A 2DU1A 1LOGA 3EXUA 1VB2A 1YNAA 3WHTA 3QD6A 1HLCA 1UF2C 3WQ1A 3S6PA 1FV2A 5DDJ2 3VHPA 2JE9A 2GNBA 5K0UB 2PAEA 1SFNA 4CDXA 5EXOA 4AI2A 4D7SA 1EY2A 5SV8A 4CEWA 1QKQA 1RUNA 3GALA 1UCXA 4KGQA 1K5MB 4COWA 1Z78A 1SLLA 1UU4A 2IXKA 2BFUS 3PMEA 5F6LB 3PVNA 2XPJA 3EHKA 1C28A 4I0AA 4M01A 1IS5A 1A8DA 3TN91 1KQRA 4JC1A 2R042 1VBC3 4Z8BA 2CTVA 2F4PA 4K1ZA 5JAXA 2D93A 1MEC2 3H7YA 1MS0A 2EXJA 4AWDA 1NCQC 4EWDA 4MGZE 1BBT2 1YIPA 3NKTA 4NVPA 3LB9A 1HRV1 4Q4W2 3UJQA 5C9AB 3H1WA 4QQOA 4S2FA 1AX2A 4UW6A 5GLTA 4S2GA 1VBB2 2D43A 2BPA2 2ZTNA 2D97A 3KCYA 5FREA 1WBLA 1QJZA 1NA1B 5A32A 2CGNA 2XKOA 4SLIA 4N43C 4OFGA 5L19A 3QLQA 2WIIB 2D3SA 4LLFA 1FMD2 2O0OA 5CAZA 3N4MA 4XJWA 4Y5Z0 1VB4A 3ZSLA 3FWEA 5K7PA 1U5ZA 3B93A 5SV5A 5ABJA 1B09A 5AFBA 2G4IA 2IWGB 1OD5A 1WCKA 4FPHA 1ZZBA 1XYOA 3SLIA 2R6QA 3ZXFA 4FP3A 1REFA 1H1AA 1SQ4A 2C5DA 4IV1A 2VPVA 4YLZA 1O7FA 4WM7C 4TYSA 4YYOA 3KT1A 4YW2A 3ZXEA 1PVXA 3ZFEC 1J1TA 4JV4A 3NW4A 1N3PA 1APNA 2RMU3 1QF3A 5BUVA 4IQPA 3N7MA 2YHJA 3M1HA 4G3YC 1PHMA 1XQNA 1W6NB 4XDQA 5KC6A 3V0AA 2BWCA 3VBFA 1OLRA 3RMYA 2Y38A 1W6PA 1BVP1 1AR62 4FPLA 1MS9A 4WVMA 1MS3A 3AZZA 4RS5A 3PVEA 4BOWA 1HXS2 3M70A 1J1LA 2GDFA 3H8UA 2ILMA 3GNEA 4JDNA 4Z2WA 1QJX3 3I59B 3VL8A 1RUG2 3WXPA 2OA2A 1QQP3 2VUJA 3WOGA 5JMCA 2HWC3 4Y1VA 3FE5A 1OLQA 3NAPC 3QCWA 4BPZA 4GXLA 4AVBA 1JYCA 1EPZA 1BXHA 1OA4A 2Z42A 5CFCA 1VRH1 1RUI1 4RR3C 2Q30A 1LOBA 1RUJ1 1QJY3 4XHXA 4M00A 2O1QA 1RVF2 1G9BA 4I3GA 2VOKA 3AFGA 3AP6A 4M3CB 2VVDA 2D6KA 1ZBA2 2YY1A 3VKMA 1X8EA 1R082 4N53C 1I1EA 2CV6A 3R4SA 4GQ7A 1F31A 4QQHA 2QCSB 1GQGA 1PGSA 1AL21 3RPQA 1WLTA 1OKQA 2PHWA 1RMU3 3VBHB 4LBQD 2QDRA 1VBA3 4XJ9A 1ZREA 1GZ9A 3HT2A 3JQWA 2IFWA 3WCRA 2CY6A 2JG8A 2R063 3CEWA 1NCQB 1KS5A 2E7TA 3TNPB 4IEPA 1VAMA 2DWRA 2D5HA 2HWE1 4XYXA 1SLAA 4QPGA 2B8MA 4TZDA 3A4UA 2GSYA 1RC6A 2MHFA 1JOJA 1C8NA 1C8M3 3RQ0A 2WA3A 5FRAA 1BKZA 3AKTA 1H2NA 1J3PA 1PNFA 4KGGA 3LWCA 4LO8A 2B9UA 2G9FA 4YG0A 1VBC2 3NL1A 4N43B 3CU7A 1POV3 5I8TA 2EAAA 2O8QA 3LCPA 1CAUB 1LHWA 3MPPG 4RA0A 2RS53 5DUXA 3WG3A 3M4FA 1OPOA 1ZZ7A 2MEV1 4LBMA 4GWMA 1CX4A 4YVSA 3O14A 5D8AC 4Q8LA 5BY5A 4Q4V1 4FPGA 3MW3A 2UY9A 1RUD3 4GMP1 4BYYA 1SDWA 3FMGA 3DPRA 4XFHA 5I8SA 4F7ZA 3KGZA 1DG6A 2BNOA 1XNKA 4WBBA 1ZZ6A 1WCSA 4TSVA 1CESA 1QDOA 4WM7B 5LEKA 4OLLA 2P3JA 1QY4A 4JTNA 2V5YA 2GN7A 3WD5A 5LRSA 4XMAA 3ZFEB 2IZWA 3VZNA 3AZVA 4AG4A 1I9RA 1DGWX 2VECA 5BNOC 3FZ3A 2ZS6B 1LTEA 1DYPA 1Y7BA 3UKTA 1LGCA 3WDYA 1LODA 1ULDA 2GNTA 4Q4Y3 4QX5A 1GZWA 4LBKA 2A5ZA 4DQAA 3HAGA 1PNGA 2WT2A 2DUPA 1MVEA 2KXLA 3WR0A 2R041 3H3ZA 4XBLA 2EXHA 1IHMA 1FATA 1X82A 3USUB 3DUIA 4CEWC 4MYEA 2PAMA 2BVBA 3IBMA 3G7DA 1BBT1 4V1PA 2CAVA 1U5YA 3B00A 4URTA 3ASIA 4Q4X1 5FO8B 5HXVA 3INAA 1ULGA 2ZKLA 3ALQA 4CRQA 2RMU2 1VBB1 3NAPB 1S0GA 3NWKA 1GKBA 5FOJB 3CNAA 3KSCA 3PVOA 3B01A 2FZ2A 2IXLA 3KQRA 3LGRA 2JEMA 4AVCA 1FX5A 4FAHA 3GYDA 1TMF3 4RR3B 1WLCA 3H50A 2EALA 3EO6A 4AFAA 1ZZ9A 3IDCB 3KT7A 4N53B 4X8NA 1QNWA 5BYNA 1QJX2 3N7JA 2DUOA 2ZPXA 1U0AA 4IEZA 2BYVE 1QQP2 2HWC2 3WQ0A 4YVWA 1LHVA 4E2SA 3MGUA 3ZIXA 1V70A 2JJ6A 4XJZA 1RJ8A 2XWBB 1HQWA 5AVAA 4HVOA 4EN0A 2RS33 4FO9A 1S2KA 4XHBA 4E4DX 1QJY2 2NPIA 4QGNA 4AF9A 3KLSA 2BFUL 4OZXA 2BGCA 2EXIA 2GC3A 3JUUA 3FLRA 3V56A 4FPYA 5ABJC 5F5QA 4CTEA 4QQLA 4I02A 2ZGTA 4YARA 4W65A 2RM21 4HLTA 3E6CC 1N1YA 1W6QB 4IV1C 1CGPA 2VULA 1RMU2 4HZFA 1AR61 4GB32 2ERFA 4FP2A 3FFZA 2PLV3 4LUMA 1HXS1 3WQ7A 2OUHA 1HQLA 5LK7B 4LBOA 1OFNA 1OI6A 3AK0A 3QH6A 3KZ4C 4COYA 2R062 3R6SA 1NQJA 1VP6A 2I07B 2HWB3 3RG0A 1RUG1 2VQ0A 4W6XA 1SBEA 3ZYJB 3VBFC 3D0JA 5JCTA 1FYUA 3WNXA 1NYWA 5L73A 2VOVA 4LO5B 5D8AB 5C4WA 2OYZA 4RS5C 4E2GA 1MZFA 1V6KA 5CBLA 1C8M2 4AYUA 2JG9A 4HANA 1YO8A 2BNNA 2BW8A 2VUAA 5H9PA 3IDBB 3M7AA 1MR5A 2ZX3A 4FQ4A 1RVF1 1S0IA 5I91A 1ZBA1 3BOWA 2NMNA 1R081 4LHKA 4Y1UA 3ZXGA 4AGRA 2RHPA 2V09A 1Y43B 5CFDA 4HN0A 1D2SA 5CFCC 4AVAA 5BNOB 4XQDA 2RS52 1AX0A 4DXZA 1JUHA 3AMMA 4E4SA 4DB5A 5EV7A 1KRIA 3ACLA 1YJLA 5JSPA 4PJYA 1IS6A 3B7MA