1V6JA

Peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6jA00
4LBQB 3SH5A 2GMMA 3VUOA 3NV3A 4XILA 3T1MA 1ENRA 2VH9A 4Y24A 2E7TA 3AJZA 5T5OA 2D7FA 4DRRA 3AZVA 2DV9A 1LEDA 5DUWA 1JN2P 3AYAA 4FOQA 4UW3A 1MS3A 4JC1A 4C1XA 4DFSA 4YZ2A 2AENA 4FPJA 3V64A 4L8QA 1VLNA 1ZM1A 3B3QE 2D43A 3ZXEA 4XTMA 3N7JA 5HCFA 4ZKTB 2P34A 1SLBA 2WSUA 4YFZA 1APNA 5DUVA 4XJ9A 4AGGA 3ILFA 3WNXA 4XE9A 1W0OA 4CTEA 2DUPA 3A4UA 4R9AA 1H9PA 2GMPA 3M3OA 5EWSA 4AVSA 1AJKA 3AX4A 1DYKA 4YM3A 1RINA 1A78A 1KDKA 4FP2A 2AUYA 5FRAA 1ONAA 3A0KA 2AREA 3AP4A 3N35A 1V6OA 4GKYA 1F9KA 3N36A 1YYNA 4M3CF 3TB0A 5H9RA 3ZVXA 1C1LA 3R4SA 1QOSA 3O0VA 2P3JA 2EALA 4Q2FA 1AXKA 3ZYRA 5DXDA 1Z78A 2V5YA 4XIKA 2W52A 4ASMB 1W6QA 1ULCA 1WW6A 5H9SA 4AVTA 1W6OA 5SV8A 1UN1A 1GZWA 5L73A 4GXLA 2CWSA 4FPKA 1S1AA 3TAYA 1LEMA 1LGBA 4MYEA 2R16A 5EXOA 2ZMKA 1LODA 4YZ5A 3HMYA 1N1VA 4I30A 5JVVA 1GV9A 4D69A 1JYCA 1QNYA 4AWDA 1H9WA 1JYIA 2H0BA 3FLTA 3WOGA 2D6NA 3AP7A 3AXDA 1Q56A 1V6NA 1W0PA 4P14A 3OBTA 1IKQA 1U0AA 3W59A 3VKLA 3V0BB 1KJLA 3RS6A 3WVJA 3WCRA 2P3IA 1BXHA 1WCSA 2ZMLA 1IS5A 3WZ1A 1DGLA 3V0AB 1VIWB 1S0DA 5T50A 5DZEA 1JW6A 3ZSKA 5JMCA 2WT2A 4BM8A 2R1BA 3OPZA 3WDVA 2G4IA 2D3RA 3VV1A 1ULEA 2CWMA 2UU8A 3O12A 4ATFA 1DZQA 5T5LA 5HCBA 4F83A 4XMIA 3SITA 4U2AA 1SBFA 4XMAA 4IQPA 2D6MA 2DVAA 2WLQA 2ENRA 5CBLA 1V00A 3N7LA 2ZA9A 4AVVA 2ZGRA 5FREA 4XHBA 2DU1A 2CNAA 2GNBA 4YM0A 1GKBA 5EYXA 2CL2A 1OQ1A 1JXNA 4GA9A 4CZSA 4PQ9A 1AXZA 1D2SA 2GALA 5GLVA 4XBQA 2VW2A 1R1ZA 3UJOA 3NV4A 3WG3A 1LHUA 5JOWA 1DQ1A 1QU0A 1UAIA 1A3KA 5GZDA 1LHVA 2VY0A 1WD4A 3LSEA 4XTPA 3IPVB 4FPGA 2AH2A 1W6NA 3AP5A 5KXCA 2EIGA 3FUQA 5E88A 4Y26A 1Z0HA 2JD4A 1HQLA 3ENRA 1DFQA 2EXJA 2Q5TA 3BIWE 1F31A 2DURA 3WG4A 4JCKA 3GALA 4JRAA 1MZ5A 2OW4A 1B09A 4LBKA 2NMNA 4Y22B 5CB7A 4YW1A 1N3QA 4YG6A 1DQ6A 1PZ7A 3W58A 3RG0A 1Q8QA 1W6PB 4LBJA 4YLZA 3WG1A 2YV8A 4YGDA 1MVEA 2WJSA 4RL7A 3NWKA 5F9TA 1SLLA 4W65A 1YRZA 3O0WA 4R9CA 4Y20B 3UJQA 5HCAA 4M3CA 3D5OA 3SNMA 1V6IA 1MVQA 2CY6A 3DGTA 4FOYA 1GSLA 1G9CA 4GALA 1PZ8A 5KXEA 1N1SA 2FMDA 1N3PA 3OYWA 1LESA 2NN8A 2YROA 3SH3A 2WT1A 1DHKB 1FV2A 2JECA 3OJBA 4BOWA 3FLPA 4FVVA 5IK4A 2A6WA 2HYKA 1GYKA 3INAA 3U4XA 1HKDA 1VAMA 1UZYA 4K21A 1VAVA 3C2UA 4YZ1A 5GALA 2A3YA 1WD3A 4LBQD 1SBDA 4U36A 5CAZA 4BLIA 2PELA 2VU9A 4BLJA 1DQ2A 2JJ6A 2EXKA 3N3HA 5IUQA 3ZYPA 4WZFA 4Q1PA 4RA0A 5T55A 4ISRA 4XJUA 2ZGNA 1EPWA 1WLDA 1AX0A 3POSA 5GLUA 3SISA 2ZGMA 3RRDA 2JE7A 3BTAA 4FOVA 1LOEA 1H30A 4AGVA 1CESA 3BOPA 3WDTA 2ZMNA 1YIFA 1HLCA 1ULFA 3IM0A 1V6LA 3I4IA 3V0AA 1AX2A 1G86A 1GLHA 1Q8VA 2E7QA 2A7AA 1C4RA 2ZGLA 3UL2A 3LCPA 1D0HA 1YO8A 4XJZA 4TYSA 3AXEA 3FLRA 2AGSA 3RMYA 5GZGA 3RSJA 4FPYA 5T54A 3ILRA 1W6MA 1GZCA 3AP6A 2SBAA 3FFZA 3ASIA 3PVEA 5IK8A 1GBGA 4Q27A 1JOJA 4LBNA 4FPHA 1G7YA 3NV2A 3SLIA 3V65A 1LHOA 3LSDA 1RITA 2GDFA 4SLIA 5DG2A 1AX1A 1JUIA 3VKNA 1ENQA 1QF3A 1BYHA 2D6OX 3OY8B 2CTVA 4NO4A 3M3EA 1UZZA 1C1FA 4PBOA 1S0FA 1DQ4A 5DG1A 4YW4A 1SCRA 2PHFA 2ZAAA 1ULDA 5JOXA 1QGLA 4DQAA 3CNAA 3ZXJA 2GNTA 5JLVA 3RMXA 3QCWA 5GZCA 3AYEA 2JE9A 3D4KA 1LJ7A 1WW7A 2ZBJA 3AP9A 2D3PA 1AZDA 2D6LX 3POYA 2ZHKA 4DRVA 2V73A 1WW4A 4FQ4A 5AVAA 4P9XA 4Y1VA 4Q8KA 2ARXA 1CPMA 1G9AA 2E6VA 2NYYA 1LTEA 1MS5A 3FBYA 4BQ1A 3PJQA 1QNWA 1RIRA 2AR6A 4ISQA 4FOWA 2DVGA 1BKZA 3WLUA 3ZSMA 3HR9A 2NMOA 1O4ZA 3IKWA 2ZGUA 4GWNA 3USUA 5IK5A 1Q8PA 4YG3A 2PHUA 3AYCA 1QOOA 2EXIA 2OUJA 1OFSA 2DVDA 1AXYA 4ZXKA 5GM0A 3T2TA 4LBQA 5DZFA 3IMNA 3KM5A 2WT0A 3B69A 3MW4A 2ZGQA 2A75A 1YI7A 2ZGOA 2EXHA 3POWA 4M01A 1FV3A 2A5ZA 2GNMA 4M00A 2P2KA 2I2SA 4Y1XA 5EYYA 3MW3A 5KXBA 5DZGA 5DUXA 3T1LA 3WUCA 4AGRA 3IN9A 3KQRA 5T5JA 5GZFA 1MS4A 2C9AA 1MS8A 1JHNA 2PHXA 1KDMA 1KITA 3O0XA 4NOTA 1CONA 3AYDA 4YM1A 1G9BA 1G8WA 2LALA 4K1ZA 3AZZA 4XXPA 2OVUA 2W39A 4TZDA 4Y1ZA 2PHTA 5E8AA 2WSVA 5GLWA 1S0IA 2A6ZA 4K1YA 1W6OB 1CJPA 1CR7A 3MPPG 1V6KA 5BYNA 1HDKA 2NP0A 3N7MA 2R0HA 3APBA 1CPNA 4XJWA 3JUUA 3AZXA 5F5QA 3MEPA 1LHNA 2A3XA 1KRIA 1LOFA 4FPLA 2JDZA 3DUIA 1BZWA 3M2MA 3OBRA 4YGEA 3VKOA 3MW2A 4FPCA 5E89A 2R1DA 1BQPA 1DBNA 5LK5A 1CN1A 1DQ5A 1J1TA 3B00A 1X50A 4FQZA 4LBOA 1LOBA 1FATA 1AF9A 2E51A 4XYXA 4CRQA 3VKFC 2BQPA 1LOFC 3PMEA 5GLTA 2WNEA 4R9DA 2E53A 2D44A 2P3KA 4Q26A 1LOAA 2WKKA 2FHRA 4UW4A 5T5PA 3WV6A 5T52A 1N1YA 1WLCA 3D6EA 4P9YA 1KJRA 5DUUA 2Z42A 3B9CA 1GNZA 1S0BA 4Q8LA 3V0BA 4UW5A 2UWCA 1FAYA 5H9PA 1GNHA 3WDXA 1SCSA 3R05A 3O5SA 1N3OA 1S0GA 2LTNA 2NM1A 2ZGSA 3ZSJA 1V6JA 3ZXFA 4Y1UA 1S0JA 4Q1RA 1QDOA 1MR5A 5H9QA 4XIOA 4FP3A 1MZ6A 1Q8SA 2W68A 2XB6C 2ZGPA 1UL9A 4XXAA 1W6NB 2SLIA 1VALA 4BPZA 2ZHNA 1V6MA 4XJAA 2D3SA 2UWBA 4H55A 2DYCA 2VW1A 4GKXA 4XHXA 1XQNA 2AYHA 4DPNA 4PCRA 1QOTA 2DVFA 4YGBA 2OUHA 3H0OA 3WUDA 1WBFA 1GICA 1IS4A 1HQWA 1IOAA 1WLWA 3M1HA 3ZXKA 1A8DA 1SLCA 4OZXA 1WUVA 3M3CA 3WHTA 2GN7A 2D6PA 1IS6A 3NV1A 3WDWA 1S0EA 1DQ0A 3JU9A 1ULGA 3IPVA 1GANA 4R9BA 4BMEA 4XZPA 1IKPA 1DLLA 1WW5A 3UK9A 4M3CB 1SBEA 1SACA 2A3WA 5GJ6A 1LENA 1LOCA 3FUOA 3M3QA 3ZSLA 1AJOA 1BJQA 2PHRA 3OYWB 4M3CE 3N7KA 4Y22A 4GWMA 3VKMA 4WVWA 2W08A 1DIWA 4FPOB 2A71A 4DS0A 2A6VA 4Z8BA 1Y7BA 1SLTA 1W6PA 1WBLA 1ZA4A 3A0NA 4BMBA 2A6YA 2ZHLA 1PZ9A 1TEIA 5CA6A 2A6XA 2UWAA 4XDQA 2ZKNA 4Y20A 2GNDA 4UW6A 3ILNA 4FPEA 1MS9A 4WV8A 2ZACA 4KBBA 3SH4A 2EF6A 1LECA 1LCLA 1KQRA 1AVBA 1LGNA 3WDYA 5IK7A 1UMZA 4Y1YA 3ZPYA 1DYPA 3I8TA 2JKBA 1QKQA 1QDCA 1JBCA 5JDBA 3WDUA 1NLSA 1F5FA 1UPSA 2R0FA 3WCSA 4YW2A 1I3HA 4YW5A 2DVBA 1G9FA 1Q8OA 2YMZA 2ERFA 3AJYA 4AYUA 4PF5A 2ZABA 4HL0A 2ZHMA 4YG0A 1G9DA 3R4UA 1LU2A 1LULA 2RHPA 3ATGA 4C1WA 4XOGA 3BODA 2VXRA 1W6MB 5JOYA 1FNZA 2ARBA 1CQ9A 3WHUA 2DTYA 3AZWA 4WVVA 2ES3A 2DUOA 5JOZA 5GLZA 5GZEA 4YW3A 4XJ8A 1W6QB 3HN1A 3PVNA 2PHWA 2WQZC 4XBLA 4YM2A 3GNEA 2DU0A 1LU1A 2NZ9A 3AK0A 2ZGTA 1GZWB 1NXD1 2A70A 4P9WA 5CNAA 4YZ3A 1C57A 1OKQA 2R49A 4LBMA 4YGCA 1FNYA 2VW0A 3OGGA 2D6KA 1UX6A 2GN3A 2DTWA 1QMJA 2XG3A 3AFKA 4YFWA 4ATEA 2YZ4A 1YXWA 2GMEA 2C5DA 2DWRA 3AZYA 2VUAA 2YY1A 4YZ4A 1UKGA 2YXSA 2ZGKA 1MS1A 1O4YA 4XBNA 1ENSA 1SLAA 2UURA 2B7YA 4ITCA 3PVOA 3B01A 3ZXLA 1LGCA 3QLQA 1CVNA 2KM2A 1MACA 4K20A 1CIWA 1GZ9A 3OY8A 2CYFA 4LBLA 4FPFA 2TEPA 1I1EA 1N47A 1FX5A 2P37A 1SFYA 3Q9OA 1N1TA 4PBPA 5KXDA 2ZZJA 1SLIA 1IS3A 1LHWA 1S0CA 3RQ0A 5IT6A 1FYUA 2DUQA 4HANA 3L2YA 3USUB 1LOGA 2EAKA 1URXA 1MS0A 3WG2A
chains in the Genus database with same CATH superfamily
4LBQB 3SH5A 2RDSA 4XILA 4A3XA 4CCCA 5HCHA 5FZAA 1I9RA 4Y24A 4XURA 5F5AA 3VBUC 2E7TA 5FYZA 4CCNA 3BI3A 3VBSC 2QZ2A 1Z7S1 2FQPA 4CXXA 4DRRA 1VE0A 3LD8A 4QQHA 4ASKA 1LEDA 2W2IA 1JN2P 1FMD3 1F2NA 5ABJA 4WM7A 4YZ2A 5IAXA 4O7XA 2W0XA 2UYBA 4GWJA 1VBC1 2YU1A 4OZOA 1VLNA 4HT1T 3U11A 1NLQA 3ZXEA 2TUNA 4MVTA 4RHV2 4Z07A 2V72A 5AFBA 4MSVA 2BJSA 4HN1A 4X6RB 4CP0A 4LJHA 4YFZA 2EIDA 1OPMA 4XFBA 3VZLA 4AFBA 1L3JA 3GZTB 4XE9A 4R9AA 3HT2A 4KGQA 1AJKA 1RINA 3H50A 4W50A 2LW8A 2AREA 3A0KA 3AP4A 3MIBA 2DCTA 3VHRA 1UU6A 5FP8A 1YYNA 1QJU3 2Q8CA 4CEWB 1X9TA 1MQTB 3KT1A 1JI6A 3SHRA 3RFRA 2CGOA 4QDRA 2XQXA 3BPSA 3O0VA 4JGZA 3QBQA 3VD9A 1QH7A 5FPUA 5DXDA 1Z78A 4ASMB 3KSCA 4G3YC 4DXZA 1KXGA 4AVTA 3ZM8A 1UN1A 5L73A 3D82A 4FFGA 4FPKA 1S1AA 4HBNA 4WZCA 5LZ6A 4IE4A 4EV0A 2O1QA 2ZEZA 3C7EA 3T2QA 4XACA 4QQ2A 1CAWB 2ZMKA 3S6PA 4D7SA 1FOD2 3OGSA 3SEEA 4OHYA 3WNNA 4XFCA 2D98A 3I59A 3TYJA 1H9WA 5JIUA 2C26A 3S30A 3CZUA 1ZZ8A 3ACFA 5E6HA 3RDIA 3W20A 5C5TA 4XF4A 3O1RA 2WS92 1Q56A 1W0PA 4IE0A 1SPPA 2CAUA 3VBOB 2GZWA 2K46A 3A21A 1NZIA 1U0AA 5CISA 1PVC3 3W59A 2D40A 1TME3 2OQ6A 3WD5A 3RS6A 1NA1A 3LQCA 1RUI3 3DYOA 1RUE2 1DZTA 2P3IA 4MV2A 1H1IA 1W2NA 2B8MA 1UXZA 1IS5A 4P9JA 2BBAA 3V0AB 1SFNA 4FT8A 4Q0SA 5T50A 1JW6A 3ZSKA 4GH4A 2WT2A 3WDVA 3VV1A 2CWMA 1PO13 1V9U1 2UU8A 4ATFA 3N4MA 4F83A 3KV9A 4EZ4A 3ACHA 1O3TA 1J58A 4MGKE 1SBFA 3MICA 1CAXB 4TWTA 2D6MA 2WLQA 4XMAA 3S7IA 3TOJA 1TMF2 1QJX2 2VNOA 2LROA 2RS52 2ZA9A 1NCRA 3I2IA 2OKXA 4OUSA 5LA9A 3WW4A 3NJYA 4GJYA 2DU1A 4IW3A 1ODNA 4HETA 1KS4A 4YM0A 1GKBA 3C7HA 3W5MA 1NCQB 1UZWA 3H8RA 3GZAA 1O5UA 2RDNA 3VBHC 3JD72 3R4DB 2VW2A 2JG9B 3MBWA 3ETPA 3UJOA 1DG6A 5F3IA 3VL8A 4OI4A 3NV4A 3MIDA 3HJRA 3LE0A 5HXMA 4QT6A 3ZN4A 2WO2A 2VY0A 2VULA 4XTPA 3ZFFB 2P5BA 4ZU5A 5KXCA 4Z82A 2JX9A 5E88A 4Y26A 4Q4X1 5BXXA 2E33A 1RUNA 1Z0HA 4COUA 3NMBA 5I8SA 1WCKA 2B42B 4UT5A 3B93A 4Q5OA 3O1UA 1D4M1 1QHDA 2DURA 2X5IA 3AMPA 2Q1ZB 5BNOB 3O1OA 3POBA 1MZ5A 1B09A 3RJ2X 3IDEA 4LO7A 1EV12 2VZOA 1RUJ1 2IFRA 3I97A 5C70A 1DQ6A 1BMV2 1UO9A 1VBA2 2W9XA 1Q8QA 2J1EA 3OGRA 5ACA3 3H42B 1NUKA 1ZBE1 4YLZA 3WG1A 3WQBA 1VRH2 4IEWA 2P4EA 2WJSA 1Z7S3 4RL7A 2YHJA 5CG9A 1K12A 1QQP2 2HWC2 4FO9A 5FYHA 4M3CA 5GKAC 4Q4W2 3SNMA 1CIYA 1MVQA 1VBC3 2VG9A 4TLGA 5JXGA 1PZ8A 3GDBA 1XJAA 1N1SA 3SQOA 1LESA 2YROA 5IFPA 1UY4A 4A41A 1BBT2 1YUDA 3KZ4C 1DHKB 1FV2A 1DGWA 4QXBA 4EROA 3FLPA 5ERLA 3U4XA 1CX4A 1VAMA 1UZYA 4K21A 4P9IA 3FFQA 2H6CA 2B45X 3C2UA 4J1WA 4Q0VA 1K3IA 2CDOA 4LBQD 3GXUA 4DNYA 4WM8A 3VBRC 3CZJA 3I3DA 1VBE1 1GQGA 4U36A 4BLIA 2VU9A 1XE0A 4I0AA 1DQ2A 1PIV3 4RA0A 3KLSA 2VCBA 2XKPA 2PA7A 3ZDVA 1JYXA 5LW9A 5A7SA 4V2VA 3LDBA 1ASJ1 2ZGMA 4L97A 1S55A 1JU4A 1LOEA 4AEDB 3ZYHA 1IPJA 2ZMNA 2LS6A 1JOBA 1ULFA 4PLNA 4YSFA 3ZMNA 1GLHA 5C8CA 2HWF2 3O14A 3EB7A 2JIGA 1C4RA 2ZGLA 2YYOA 3IIAA 5F2SA 1ZRDA 1D0HA 4YRDA 4DUXA 2WA4A 3Q8FA 4A4AA 1IHMA 5FZOB 2VCAA 4GAZA 1GZCA 5FUPA 3NNJA 3J7MA 5FPZA 2R042 3CQOA 2ZPXA 1JOJA 3J7LA 5FP9A 3SLIA 1OXCA 4FXGB 1W8ZA 3LSDA 4B1LA 2GDFA 1JUIA 1O8PA 2OIIA 1H8VA 1W8FA 1UYPA 2VECA 3C7FA 3J7HA 2RM23 3OGJA 4S2DA 4B7KA 5LA1A 1REDA 3ACLA 1BYHA 4NHKA 3VN4A 4NO4A 2CTVA 4B4RA 2XLGA 1S0FA 1DQ4A 1YFWA 2C1FA 3BTXA 4AAPA 4DXSA 5DDJ2 3NNGA 2PAMA 4DQAA 5FV3A 2PQQA 3VLBB 2MEV1 3UV9A 5GZCA 1FT9A 3AYEA 3WF2A 4CDQB 1ZBA2 4LUMA 4HZFA 5IJRA 4YVSC 3ZKYA 2RMU3 2OT7A 4W6WA 3GCXA 4FQ4A 5AVAA 2C6SA 4OUEA 1CPMA 2PAEA 1ZREA 2NYYA 1PGL1 1RC6A 1T6GC 2VUJA 1PVXA 1QNWA 2XUEA 4GMP0 5C9AA 1P8JA 3ZYJB 3D8CA 5C3OA 3NW4A 5JXHA 4ARYA 1O4ZA 5DQ0A 3SMHA 4KBZA 4XW3A 3AC0A 1Q8PA 5FZBA 4Q0PA 1QJY1 1C8NA 2WABA 2J7MA 4ZXKA 2BTVC 1OPOA 4LBQA 3RI8A 4RR3A 4AVAA 3IMNA 1AR72 3V56A 2G19A 4Q4X3 2RS31 2A75A 3ROUA 2EXHA 4Q0UA 5FZEA 1D4M3 4UBGA 4XFIA 4QAWA 5IVJA 4Q4Y2 4JTNA 5EYYA 5BNPC 3MW3A 5KXBA 3K51A 1RUJ3 4JQRA 4QGNA 4KGGA 4K7JA 2JD9A 3BGAA 2WFPA 4AR2A 2BDRA 3DN7A 1XNTA 3KQRA 1ZBE3 2WNOA 2JG8B 3ZKUA 5F7UA 3FHAA 5GZFA 3UESA 1MS4A 2E63A 2GP5A 1KDMA 4H14A 1GMMA 4YM1A 1WMDA 1G8WA 2LALA 3OPTA 2ZTNA 4K1ZA 4XXPA 4AFAA 2BBVA 3HQXA 2BNMA 2VZUA 2G9ZA 4HXCA 1UX7A 5LASA 2Y6FA 5C3RA 2R071 4UFKA 3THCA 4ZU7A 1CR7A 2NP0A 1HDKA 1DGRN 1S2KA 5L9VA 5CADA 3ELNA 4W6YA 2VR4A 2VZTA 1OLME 5DN2A 4AHXA 2W87A 4LE3A 3WP3A 4CEWA 3JUUA 3NO8A 1MQTA 5F5QA 5I8YA 3I3MA 1RHI1 1KRIA 3I49A 4XAAA 2VZ1A 1NY71 3M2MA 3DUIA 4YGEA 4BXSV 2Y6KA 3VB9A 4OI2A 3RWNA 3HQRA 1VBE3 3ZXGA 1J3QA 1H8TA 1STMA 1DBNA 2PN5A 1ZX5A 4ONUA 1UMIA 1KFXL 2XJVA 4CEWC 3KHBA 1PO22 4B8EA 4OQ8A 2BGCA 1MQTC 4XYXA 4CRQA 4QX0A 1AUYA 3VKFC 1CAWA 1R1A1 3PMEA 4K8RB 4WBBA 5FYCA 1PNFA 2P3KA 4Q26A 1LOAA 2WKKA 3MPBA 3ZXAC 3OOXA 5T5PA 3ES4A 3WV6A 5T52A 2IXLA 1ZNPA 4DY3A 5CFDB 1GOFA 5L7OB 3D6EA 5FTTC 2Z42A 1H4HA 4I0BA 4L92A 3VBOA 4KMQA 2X53S 3IIIA 1O6UA 1YFXA 1XBFA 3IAPA 1CAUA 3OD0A 4HVOA 2Q1MA 3HBKA 4UW5A 4AQSA 2X09A 2UWCA 1FAYA 1UOFA 2VE1A 3CJXA 4FAHA 1GNHA 3OEAA 5FIXA 4QGLA 1ZA7A 1R092 3IDCB 4E2QA 3EYPA 1RUH2 2IXHA 5HXVA 1N3OA 2NM1A 1Y4WA 2FBEA 3ZSJA 1K45A 2BV4A 2J1SA 5F1RA 2WYSA 3KMHA 1XU1A 4N7UA 2PAKA 2JENA 3LA7A 5H9QA 1Q8SA 2VZQA 5CKMA 3THDA 1F15A 2BEOA 4KWUA 3BPZA 4FFIA 5M0TA 1KEXA 3KS7A 2ZHNA 1V6MA 4XJAA 1OA2A 3EJKA 1OF4A 1RB8G 2RJ2A 2AYHA 2BFUS 4YGBA 2DVFA 1NCQA 2OUHA 4Y4RA 4I2OA 1WBFA 4JKLA 1CX1A 5FR3A 2JG9A 2QVSB 1L7LA 2Q1FA 2VZPA 4RS5B 3FWEA 3SEPA 1XC6A 2D6PA 2JWPA 4NRMA 1C8M1 2GC3A 2ZOEB 4R9BA 3PHMA 1RUD2 3K3NA 1DLLA 4OMDA 4YW7A 5J7MA 5J36A 5LATA 1SACA 1YEWA 2JG9C 2VNGA 1QJY3 5BNOA 2FDGA 3E6BA 2YC0A 3OYWB 4E2GA 1ZZ7A 3VKMA 3TRSB 1JZ4A 1W2TA 2YB7A 4GWIA 2W08A 4FPOB 2A71A 4W8JA 3ZFFC 5IAVA 1SLTA 2QQJA 3BN6A 5FY9A 4H2AA 2RS33 1GWLA 4B3NA 1TEIA 2A6XA 4RYDA 4OQ9A 2ZKNA 2WZR2 2GNDA 2HWD1 4WM7B 4XDPA 5BNOC 5ABJB 1MS9A 4WV8A 2ZACA 3MFAA 2RE9A 4QQOA 1LCLA 1OURA 4ZZ8A 3E6CC 3WDYA 1RJ8A 4UF0B 4Y1YA 4ES9A 3MO4A 1DYPA 2DFCA 4IEVA 4IUGA 5CU1A 5T3NA 4CYDA 2Z4FA 4JQTA 3MIEA 1JBCA 1GR3A 1VP6A 3I2GA 1UZVA 1UPSA 4AAXA 2R073 2RS11 2VZRA 3WNKA 3LGRA 2Y26A 3LFIA 1MEC1 3PU8A 3GZEA 5A6QA 3RZJA 3M7AA 3E5QA 4KNCA 4UFHA 5JXJA 4R4XA 2XJUA 3ATGA 2PHLA 4XOGA 5LBCA 4QXHA 1PM7A 1LAJA 1W6MB 1ND3A 1RHI3 2YGLA 4MLOA 3WHUA 5A33B 5GLZA 5GZEA 1GZTA 3PU3A 5KHJA 5CFCA 2EIBA 3PVNA 4JX0A 4XBLA 1HX6A 4XUQA 4Y33A 4YM2A 4AEDA 3JB8A 4I0WB 1LU1A 4P9WA 4Q4V3 5HPOA 3O1MA 1DDLA 2PHDA 2QBXA 4XF9A 3OGGA 3J9SA 1K5JA 2VXJA 3Q8BA 3RYKA 3OF1A 4YFWA 1R1A3 5JAXA 1QJFA 2RR12 1HW5A 2GMEA 2C5DA 2DWRA 3AZYA 4NRPA 3KD4A 4CXYA 5LCWL 1CZTA 1UKGA 4OI0A 2QUOA 2VD7A 1OSGA 1JYNA 1MS1A 3FE5A 1SPPB 4XBNA 1ENSA 5FOBB 2OXBA 4FFFA 1IZ3A 1O3QA 3H7JA 4LTAA 4EJRA 4ITCA 3PNAA 2OPKA 1UCXA 1NA1B 5K8SA 2XDVA 1CIWA 1GZ9A 3KF3A 3N9QA 1WKYA 3RI9A 4NUBA 2TEPA 1T6BX 1N47A 2E32A 1FX5A 2OZJA 2W92A 3Q9OA 4BA6A 2GC2A 4GH4B 4RQPA 1GWKA 5A70A 5JWPA 4ET7A 1RUC2 2W3JA 2QCSB 1AYN2 4L2NA 3RQ0A 1XPWA 5L19A 4CDQA 1W3XA 1YQCA 3LOIA 4HANA 5FZIA 3USUB 4IV3C 1AR93 3J26N 1OUXA 4I3PA 4N9IA 2J1TA 4UBHA 5FPBA 4ZZ5A 5A6XA 3J8F1 3O1VA 2FDJA 1R083 3K3OA 1B35A 1NCRB 4NVPA 1U5ZA 2GMMA 4A45A 5KWRA 2Z69A 1ENRA 2VH9A 5DPNA 4A6SA 1FOD1 3AJZA 2D7FA 2ZCWA 1GP5A 3B9IA 3H1YA 4UWDA 1NT0A 5J1XA 2FZ2A 1E5HA 4FOQA 3J4UH 4DFSA 4BWOA 4FPJA 3B02A 1H2NA 5A1LA 4HKLA 1O5LA 3ES1A 1GUIA 4XTMA 1PMIA 2XJQA 4DUWA 4IGOA 4ZKTB 5AC93 3DECA 1C8M3 2G9FA 1SLBA 2HBUA 2WBKA 3AKQA 1RUE1 2WSUA 4XETA 3K2OA 3F2ZA 1J83A 1W0OA 2WZPP 2DUPA 3A4UA 2MNGA 4Q0QA 2GMPA 5JMOA 4YM3A 4ZPIA 3AX4A 3BALA 3T0AA 1RVF3 1JTZX 2AUYA 1ONAA 2Y6JA 1NAEA 5FZ3A 1JZ7A 3N35A 4M3CF 2Q8EA 2ID4A 2CAVA 2XKOA 2V5DA 2VQAA 2JG8A 4NPLA 1POV0 5FZ7A 5J09A 2RS51 1SHWB 2V5YA 4XIKA 2IVIB 2W52A 3WX5A 4CUCA 2QJVA 2C9KA 1H2KA 1ULCA 1BK1A 1GQPA 1W39A 5FKCA 3FX3A 4E4ZA 2VAUA 5C4WC 1UOGA 4B29A 1OFNA 2CWSA 2VQ0A 1Y9MA 2IZWA 4MGYE 2JG8C 1LEMA 5DAQA 5I0UA 4MGTA 5EXOA 2R16A 2W1WA 4PI2A 4YYOA 1LODA 4YZ5A 3HMYA 4I30A 4AI2A 1GV9A 4O61A 1JYCA 1QNYA 3NKGA 1VBD3 2RS13 4P08A 4A7ZA 4CDWB 1WGPA 5JIAA 1V70A 2H0BA 5A1AA 4WM8B 2D6NA 2LM3A 1V6NA 2DBNA 2VNVA 4KWKA 2EVXA 1PX3A 3OUHA 1IKQA 4HK8A 2TBVA 4JRLA 4XEZA 1COV3 5JI9A 2XLAA 3ZYGA 1Y9GA 5ANNA 1E57A 1WCSA 3IDBB 2ZMLA 5APAA 1VBA1 3U07A 3ZDSA 3I54A 4MXWA 4LULA 4P9LA 1VIWB 3ACGA 5FUIA 5A7PA 5C8CB 2IFWA 1UY3A 4BZ4A 4C0HA 1ENXA 3PTYA 4FAGA 2P3YA 3RYPA 1ZRCA 2R1BA 3OPZA 1PK6B 2AZ5A 2G4IA 1QQP1 3QH7A 2V09A 5CFDA 3RNSA 5L7OA 1F35A 1JYTA 5HCBA 3KGLA 4N7IA 4Q4W1 5FZDA 3B94A 4XMIA 1HXS2 4U2AA 3DF0A 1TME1 3VDDB 3WF4A 4IQPA 4RHV3 3LEMA 1OKOA 3W21A 4E4SA 1V00A 3N7LA 1BBT1 5F39A 1JUHA 2YFZA 3LPGA 4CU9A 5KHGA 5CFDC 1CD3G 2CNAA 2GNBA 2WWJA 3VBFA 5EYXA 4URAA 2CL2A 2KR2A 4CZSA 1RUF2 1NQDA 3SKJE 1OT5A 1AXZA 4XCBA 2GALA 5GLVA 4XBQA 2XJTA 1MZEA 1X7NA 1QXJA 2WZ8A 3P1IA 5AVPA 4EWDA 5JOWA 1QU0A 1A3KA 3FMGA 1LHVA 1XNKA 1WD4A 3H8OA 1JS9A 4FPGA 4CA9A 1GP4A 3E6DA 3UT0A 3WNLA 2VBBA 1X8MA 1OF3A 2WO1A 3CEWA 3ENRA 4QB2A 5D1IA 3I2JA 1S2BA 3L9JT 3WG4A 4IV1A 2HWF1 2NMNA 3CU7A 4Y22B 4QPGA 1N3QA 3AKRA 4CUBA 4YG6A 1PZ7A 3W9AA 1XE7A 1FOD3 1O3RA 4XUTA 2YV8A 5C9AB 4YGDA 3WP4A 1NG0A 5F9TA 2CDPA 1SLLA 2JXAA 1YRZA 3IDAA 3O0WA 2R041 5HCAA 4PIYA 3GBWA 3D5OA 5FPVA 1V6IA 2WS93 1UY1A 1GSLA 4GALA 3ITQA 1RTVA 2FMDA 3OYWA 1N3PA 1J3RA 2WL1A 4LA3A 4NHYA 4FI9A 4RS5C 3ME2A 4QD2A 4RR3B 4W6XA 3WP5A 4JTOA 4O9EA 3ZLIA 2JECA 4BXFA 1GFF2 4OFGA 1RUE3 4XPVA 2L9LA 5ACA1 2R062 4FVVA 5A3UA 1XYPA 3INAA 1AR62 3A23A 1HKDA 4NIAA 5L9BA 2PLV2 1VAVA 4YZ1A 2A3YA 2DCZA 1FPN2 4GB32 2XL9A 2Q8OA 1WCDJ 2VMDA 1ZBA1 1T2XA 2E7AA 2PELA 2RJKA 2Y8KA 3N3HA 2CGNA 5IUQA 4UF0A 4Q1PA 1NE6A 1XRUA 5T55A 2ZS6B 2JDPA 4META 1HRV2 4ISRA 5GLUA 5LK7B 1C5HA 1LRHA 1TMF3 2XVKA 3CDZB 2RS53 4FOVA 5FYUA 4AGVA 3POJA 1CESA 3BOPA 3WDTA 5ABJC 1YIFA 4XVHA 5F32A 3VDAA 3KQ4B 4WM7C 5JPMB 4TN7A 2ZX2A 1G86A 2GU9A 1JZ6A 3CF6E 4FFHA 3UL2A 2JICA 4HSJA 3AMHA 3FLRA 2HEWF 3OB8A 4TYSA 4XAEA 4Y5Z0 3WP6A 2AGSA 4D6QA 1PIV1 4KWLA 4D3WA 5T54A 3ZYBA 3KV4A 1W6MA 4FBFA 3AP6A 3WW2A 3UYJA 4QM8A 4RD7A 5A33A 1HB3A 2YGMA 3PUQA 3AVSA 3HVDA 3LA2A 4BQYA 5BPXA 4FPHA 1IQDC 1H8TB 2BOIA 4IESA 1LHOA 4QGMA 4QKBA 4A42A 1J59A 4LQRA 5DG2A 4Q4Y1 4QU2A 3VKNA 5JI7A 5FY5A 3BB6A 1WCUA 3HOBA 3MLLA 1VBA3 4JGZC 3ZR5A 4AE2A 2PHFA 5FQ0A 1X33A 1VRH3 1ULDA 1QGLA 2NPIA 1QQP3 2A73B 2EAAA 2VMEA 4NIIA 2HWC3 1MPXA 3KCCA 4Q4W3 2JE9A 2JDMA 1LJ7A 2ZBJA 4Y5SA 1XXNA 2K9ZA 2D6LX 3ZFGA 2RM21 2ZHKA 1CAUB 1WW4A 3ECQA 1BBT3 4Y1VA 1QY4A 3PL0A 4HKOA 4AEMA 2CHHA 2E6VA 3FBYA 4QB6A 4BQ1A 4H7LA 2MPFA 3E97A 1RIRA 4ISQA 2DVGA 1JHJA 3ZSMA 1HJGA 2AACA 4NMIA 3AMQA 1JU3A 3IKWA 4L0PA 1SQ4A 2VMHA 1NA1C 2VMGA 3NAPB 3USUA 2YC4A 2RMU1 3AYCA 1QOOA 1W99A 3NSTA 4CEYB 2DVDA 2DBIA 4OLLA 3T2TA 3K75B 4LPLA 2H0VA 3LB9A 4GH4C 2HEVF 2WT0A 3B69A 3O1SA 4M01A 1W3VA 2ZGOA 3ZXDA 2GNMA 2HWF3 2P2KA 4Y1XA 4M0NA 1EY2A 5DZGA 1PX4A 5DUXA 1S2EA 2X8KA 1QH6A 3JZVA 5FZKA 4AGRA 1NCRC 3IN9A 2ZX1A 4IERA 5T5JA 4R4ZA 3PDQA 4TLFA 5L9RA 2C9AA 1MS8A 3H8UA 2AEZA 4G9SB 4LLFA 4LORA 1IGOA 2R043 3AYDA 4NOTA 5FMCA 1G9BA 4NRQA 1OMIA 1UNBA 1ALYA 4Y1ZA 5E8AA 1W9TA 2WSVA 3RYRA 1XNAA 4HPKB 1W6OB 1RUH1 4LKSA 2JDUA 3HQUA 5FZ1A 5LA2A 4LK7A 3VZNA 3KGZA 3PUSA 2A1XA 2QQIA 2FCTA 3MEPA 1YQ2A 3EMRA 2X29A 2JDZA 5DDJ3 5A32B 1UZ0A 2X5IC 4LXLA 5E89A 1W8OA 2R1DA 4WVMB 3G7DA 1ZBA3 3GM8A 5EFUA 3UGHA 5FYSA 3U4SA 1DQ5A 1F5JA 2WZEA 2JB4A 4Z2AA 5EHDA 1XNBA 1AF9A 2E51A 4ZS3A 3LOBA 1UU4A 1VBB1 4PDWA 4E8CA 2XBO2 1BHGA 5LA0A 2D44A 1HB1A 2EIEA 4CDWA 2WIIB 4EN0A 2BZDA 2FHRA 4S2GA 4UW4A 5IFTA 4JHTA 2BWAA 3KCXA 2I74A 4LHLA 1N1YA 2VCMA 2XJPA 4IETA 1RUD1 4LMFA 2ILMA 3T08A 3RZMA 3VDBA 1W2AX 3BOWA 4I3GA 3FC0A 2P1BA 4IL7A 1ND3B 3LKJA 1DGRA 4NAOA 5A3NA 4X8NA 5CFCB 1AR73 2IUWA 4WM8C 2DCKA 4QKFA 1S0GA 4RGKA 2IXIA 3X29B 1PK6A 2ZGSA 4Q4Y3 4LITA 2WZR1 1M06G 4BU2A 2D93A 4Y1UA 1S0JA 5IVYA 3VDDA 4EE2A 4FP3A 1MZ6A 1ND2B 2XB6C 2ZGPA 4HLTA 5K0UB 2XHKA 4IXLA 2OPWA 4OI1A 2SLIA 3T0BA 4C91A 3RGBA 5C8CC 2Y60A 4JZRA 3G6JB 2QTWB 4IGQA 3U14A 1PK6C 4H55A 2DYCA 1F4HA 4UOJA 3HT1A 4GKXA 4XHXA 4YNIA 5FPXA 2HYXA 4P5YA 4HN0A 4QDSA 1IS4A 1HQWA 1IOAA 1QEXA 1WLWA 3ZXKA 4M0HA 2XUMA 5BNNB 1A8DA 4OZXA 1QIQA 2VVEA 3WHTA 1IS6A 2Q4SA 4RQPB 1VMHA 5KHKA 2VMFA 5LEKA 3VHOA 3IAQA 3CMGA 3ABZA 4KU8A 1I6XA 3DYPA 4IE5A 3MUZ1 1EUUA 4IEPA 4N43B 1SBEA 1X36A 4I09A 1Y3TA 2A3WA 5FO8B 5FO7B 3ZSLA 2UY8A 4JDNA 1AJOA 1BJQA 1SDDB 4DIQA 1PMHX 4GWMA 1B35B 1PO23 4Y22A 5I93A 1DIWA 2WN2A 4MG2A 3Q8AA 1OUSA 2J1AA 2RR11 3HEIA 2XWJB 4BMBA 4YW6A 3WT3A 5EJZB 2JB8A 2FMYA 1PZ9A 1OBNA 4UW6A 3HN3A 1EAH2 2EF6A 1LECA 3QH6A 4NHMA 3OCPA 1AVBA 5IK7A 3C8XA 4MOAA 1BVVA 3ZPYA 4EN6B 4F3JA 2VOVA 5A7NA 3GGLA 3I8TA 2C0ZA 5FY0A 4CP2A 5C9AC 5FYTA 2JKBA 3SCHA 5JDBA 2BPA2 1NLSA 2YU2A 1F5FA 2XHNA 3DKQA 3PTRB 4YW5A 4YW2A 2DVBA 3GJAA 4GMP3 1R093 1Q8OA 4AYUA 1RUH3 1ODMA 1RUC1 4L99A 2W95A 3A7QA 4YVWB 2ZABA 1AYN1 4QPIB 3MLJA 5LWBA 4RR3C 1GU3A 1LULA 2RHPA 3N9OA 2TNFA 2VXRA 3P5BA 3JCIA 3ORJA 4FXKB 3AZWA 1M4WA 2B9VA 2HKXA 1RMU2 3FBMA 5CKQA 5FLIA 2DU0A 4HONA 4AVSA 1O7FA 1NXD1 3H3LA 3N9MA 5CVRA 1PMJX 4YZ3A 2YBPA 1OKQA 4RGAA 3JB4C 4YGCA 4BK5A 1FNYA 4LKEA 4BQ2A 4CCJA 2C4XA 2BNNA 2CU5A 1UX6A 3MHZA 1OQDA 1VBB3 2IXKA 5JZGA 4KH9A 4LHSA 4QX3A 4XFHA 3W5NA 1GWMA 1JODA 2VMIA 5FJHA 1OD5A 2YXSA 3FHQA 4GD4A 2WQ8A 1RUD3 1BEV2 1O8SA 1O4YA 3OUJA 2Y6HA 4Q4V1 1SLAA 4JDMA 3KVBA 4MGSA 4UFMA 1YQ5A 3K4ZA 3FJSA 3B01A 3I2FA 2F6BA 3IZOA 1CVNA 2KM2A 5FK8A 4LBLA 1Q43A 1JZ3A 4MXWB 3OG2A 1I1EA 1GP6A 1SFYA 5KHIA 4PBPA 2ZZJA 3JQWA 1H8TC 1SLIA 1IS3A 1LHWA 1S0CA 4IE6A 2WZR3 5BNQA 5IT6A 1V9U2 1CGPA 2GC1A 5FZGA 1WZXA 3O1PA 4AI0A 1URXA 4RN5A 5FOJB 1MS0A 3CIHA 5DAWA 5DAXA 3VUOA 1NZCA 2B46X 1DYOA 4AF9A 1HRI1 1XE8A 3MIGA 3N9PA 4BH9A 1HJFA 2IC1A 4NWWA 4QQPA 3NKTA 3AMMA 5T5OA 3VBFB 4BYYA 3VBOC 1OOPB 5EV7A 3AZVA 1ZZ9A 5DUWA 4UW3A 3AYAA 4OULA 2ARCA 5A6ZA 2W94A 3UGGA 3NAPA 1C3HA 3V64A 1AR91 1ZM1A 3B3QE 2D43A 1ZRRA 2WNUA 1WWYA 2Z2SB 4CEYA 3N7JA 1R081 4NHXA 1W04A 3IMMA 2P34A 4QX8A 1APNA 2Y0IA 5DUVA 4XJ9A 4AGGA 3ILFA 3WNXA 3VZMA 4CTEA 2H6BA 2R32A 2PXJA 5EWSA 3DXTA 4PLMA 3GYDA 3I7DA 4IV1B 1A78A 4FP2A 4QPGB 5FJKA 1XSQA 3I2HA 4GKYA 1V6OA 3EO6A 2Y34A 4CEYC 2Z5WA 1KS5A 1RUJ2 4DOUA 1YIPA 3TB0A 2BYVE 2RR13 1HXS1 5AC91 3R4SA 4LNVA 2F4PA 2Y6GA 5FZHA 1IPSA 1QJEA 5FXVA 5J37A 4Q2FA 1AXKA 1NCQC 4AZZA 1W6QA 5FYMA 1SFPA 4YPJA 2OX0A 4HPKA 1W6OA 5DMYA 1BCXA 1RVF1 4A3ZA 4GXLA 3TAYA 3MFCA 4RSUA 1LGBA 3CBNA 3SCGA 3TEXA 4CDXA 5JVVA 4D69A 2HWB2 3KT4A 1RL3A 5JUVA 4AI1A 5A32A 1RUC3 3FLTA 1AYN3 1US3A 3AP7A 4WVMA 5FBJA 4P14A 3ZPOA 3OBTA 2FDIA 2BRTA 1J1LA 2WDBA 4KI5M 5EZWA 2WQ4A 3WVJA 4UYBA 5A7WB 3HAGA 1OA4A 4UXAA 5FWEA 1ASJ2 2ZEWA 2P17A 1BXHA 4PJYA 2RJLA 4LKDA 3I3BA 1RGSA 4CCLA 1UOBA 1H4GA 3WZ1A 1VBD1 4BQ5A 5CG8A 2JDKA 2WLPA 1POV1 1JOPA 4BM8A 4QX2A 4Y4YA 2D3RA 4XQWA 4E27A 3O12A 1DZQA 4JHZA 2ET7A 1YQ6A 1ACCA 1TG7A 4LHKA 3SITA 2GSYA 3U0ZA 1COV1 5CKNA 5CBLA 4ZU4A 3KF5A 4BJ0A 5TSWA 4AVVA 1CAVA 2CSGA 4CVUA 2YBSA 4QPYA 2ZGRA 1DCSA 5FUNA 4PIXA 2R061 4XHBA 3EQEA 5ANQA 5FREA 4MHUA 1AR61 1DGWX 4OHZA 5J48A 1YHFA 2QKDA 2PLV1 3VD4A 3JBG2 1OQ1A 3T2OA 1AL22 2I07B 2XJSA 2XOMA 3ZSEA 1D2SA 1ND3C 3KHCA 1FPN1 3DPRB 4GB31 4JVAA 3WG3A 5FQ0B 1UAIA 4NR1A 4XF3A 2BNOA 4AEDC 1ND2A 3Q8EA 4RHV1 5K0UA 5CFCC 2FDFA 3LSEA 4ZONA 1HRV1 3IPVB 5D8AB 3AP5A 2IWGB 1DP0A 2EIGA 3RWKX 2MEV2 3WF0A 4C8DA 5JR2A 2JD4A 2O8OA 4PIZA 1DFQA 2Q5TA 3BIWE 3GCWA 3HNMA 1F31A 4J1XA 3GBGA 1CJDA 4I01A 4IEOA 4JCKA 3ZFGB 3GALA 2OW4A 1VPHA 4LBKA 3ZYFA 1W05A 2WO3A 1AR82 1ND2C 5K0UC 3AL5A 5FYBA 1NQJA 3W58A 1HRI3 5BNNA 3WNMA 4AHWA 1W6PB 4LBJA 3KWVA 4NIGA 1W8NA 3NWKA 5FXXA 2KXLA 4W65A 4R9CA 4Y20B 3UJQA 2BVBA 1U5XA 5LBFA 4N43A 3TWIA 2CY6A 3DGTA 1IQAA 3VL9A 3DL3A 4CCOA 3BUCA 2NN8A 3IBMA 4RQPC 5IK4A 1Y43B 2HYKA 1GYKA 4B4PA 4LO8A 2YDEA 4CDQC 3CJIB 2BOJA 2VBDA 3EHKA 2XR4A 1H2MA 3MIFA 5GALA 4LEJA 3O7OA 3J7NA 5F3EA 2WS91 4IEXA 5CAZA 5L36A 1B35C 3PIGA 4BLJA 1HXS3 4WZFA 3VBHB 3SISA 1AX0A 3POSA 1YC61 2Y0OA 5FZMA 3BKZA 2JE7A 1H30A 2XGXA 4K8FA 1HB4A 1NYWA 2VPVA 2VOXA 2WWSA 3SC7X 3VD7A 1V6LA 3I4IA 2R072 3N9LA 1AHSA 2MHFA 2E7QA 1OQEA 4XFGA 4YVWA 3H3ZA 3LCPA 4QPIA 1YO8A 2VOKA 4XJZA 2CV6A 3U78A 5GZGA 3WF1A 4FPYA 3VDCA 2Y6LA 3ILRA 2WNVA 5IHRA 2W5FA 4EQVA 3KV5A 3TEWA 3FFZA 2WAOA 1TMF1 2JE8A 5IK8A 1QJX1 1NY72 4QU1A 4XABA 4XUOA 4MHRA 4XQ4A 1REEA 3M3IA 4YVWC 3TN92 4QPIC 3USSA 3H8XA 1RITA 3U1XA 3BTYA 3QOPA 4NHLA 4IE7A 1ENQA 4R8HA 3JD71 2J42A 4QXCA 1HN1A 4JKMA 4O9GA 4V2WA 3TEZA 1YFUA 2D6OX 3OY8B 4PDWB 4UAPA 3M3EA 1UZZA 1C1FA 5DG1A 1SEFA 2ZAAA 2QQUA 1POV3 2W91A 1TVGA 3HNBM 5JOXA 5KR7A 3CNAA 3NNFA 5JLVA 1U12A 3RMXA 4DB5A 4OVEA 3QCWA 4M4PA 5JSOA 3P3PA 4X8PA 2D3PA 3WXPA 4JGYA 5FFOC 4HSLA 3VBRB 2ZZQA 3LEIA 1EV11 1BMV1 4D6RA 5LY1A 4Q8KA 1UIKA 5IATA 3S7EA 2R063 1AR63 1E5SA 1VRH1 2G1MA 3PJQA 2FCUA 5DABA 5BV6A 5A7QA 1BKZA 2PLV3 4PT6A 4CU6A 4CPBA 4CDUB 2HWC1 3T09A 4HVQA 2Q0AA 3GBFA 1FPN3 4IDZA 3S5AA 4GB33 4DEVA 2VJXA 5IK5A 3AL6A 3ZR6A 1OFSA 1IPKA 1AXYA 4BQXA 5GM0A 5C3PA 3WR0A 4AEJA 3SXWA 2VOTA 1HRV3 4E4DX 3AM2A 2W1UA 3H9AA 5FO9B 2XBO1 3FN9A 3UKNA 5L7OC 4F8AA 5LBBA 2ZGQA 1YI7A 3NJVA 2JDAA 1FV3A 1YWKA 2XQRA 1VAKA 4Z1VA 1XOYA 5IVCA 4BIOA 1OOPA 4GQ7A 2I2SA 2HWE2 2P6CA 5FDBA 5JXIA 3AKTA 1HV0A 2EICA 4BQ4A 1UYYA 3A22A 4LO6B 2YUEA 5HV0A 1JHNA 3O0XA 1KITA 1XSRA 5CYYA 1CONA 2OYZA 3VBFC 2B4KA 3M8LA 4P00B 5IVEA 2W39A 5C3QA 1NKGA 2PHTA 2GH8A 3BYWA 1S0IA 2A6ZA 3MPPG 2R7EB 5BYNA 1V6KA 1QXRA 3NNMA 1W03A 2EA7A 3APBA 3POFA 1CPNA 3M70A 4YVSB 1PGW2 2FCVA 3I3QA 3AZXA 2BWCA 3P6BA 1LOFA 4CUGA 4FPLA 2VUDA 2XPJA 2ZX0A 2XLFA 3AB0A 3MW2A 3E5UA 2HWD2 4IV1C 4Y3OA 5F3GA 1UKRA 3WNOA 1BQPA 4QPGC 2O14A 5C7GA 5FWJA 5A7OA 4LBOA 1J1TA 3AVRA 1X50A 2D5HA 2WFF2 4COVA 5IYYA 1LOFC 1AYM2 4UFIA 2E53A 4CP9B 1ULPA 5FPLA 3SKVA 1H1AA 5DDJ1 4D6SA 3GHMA 1W9FA 1MEC2 2Q8DA 4P9YA 1Q5OA 4XDOA 1KJRA 3VBSA 3LDRA 2JIJA 3UNPA 1QXPA 4D7TA 1GNZA 1S0BA 4NPRA 2OQ7A 1PNGA 1QJX3 5A7WA 4CSWA 2WUHA 5FZ9A 3URFA 4QX5A 1O59A 4ZY9A 5E1RA 3WF3A 1F4AA 1SMVA 2X05A 3LIGA 1YFYA 4AFCA 3FHIB 4CCEA 3JD73 1V6JA 1W8TA 5FMDA 3ZXFA 1HN0A 5JZGB 4RFRB 1EAH1 3H3UA 4BB3A 1MR5A 4BDVB 2WA3A 3GZUC 3UKVA 4PLOA 1LR5A 1UL9A 4XXAA 1W6NB 3TNPB 1AR71 3K77A 1W2UA 3PMSA 2D3SA 2UWBA 2WC2A 1E5RA 1REFA 1OH4A 1XQNA 4PCRA 1C5IA 1QOTA 2JKXA 5IWFA 3WUDA 4GIQA 4FSJA 1GICA 1BLZA 1EV13 3OPWA 4AFDA 3DPRA 2JDYA 3ACIA 1SLCA 5I91A 1A8MA 2P6HA 3M3CA 2K0GA 3ZFEB 2GN7A 1YJKA 1H6XA 2QDNA 3WDWA 3WY6A 1D2QA 4WVZA 1ULGA 1YCIA 2OA2A 3IPVA 5D8AA 1CZVA 1GANA 3MZHA 4A7YA 5FZ6A 3BTZA 1IKPA 5E16A 1WW5A 1EUTA 3LF7A 1RMU1 2ZXQA 4O65A 5GJ6A 3DPRC 1LENA 4LA2A 1LOCA 3FUOA 4NWVA 4QHZA 1PGSA 3N7KA 4NROA 3J8F2 2QQPA 1VJ2A 3WQ7A 3LIHA 5FLHA 2VTXJ 4AHZA 1RUG2 1Y7BA 5D8AC 2XBO3 1ZA4A 1W6PA 3CL1A 3KT7A 3MF6A 4PF1A 4LE4A 2VCCA 4MX3A 3VHNA 4C90A 5FY1A 3T2PA 2A6YA 5CA6A 2UWAA 4XDQA 5FMBA 4Y20A 1OHFA 4COWA 3ILNA 3ZFGC 4AXOA 1BEV1 5SV5A 4AK3A 1JH5A 3U75A 1KQRA 2WNUB 1LGNA 2FZ1A 5CZKA 2W47A 5A3WA 1PO21 1US2A 5A3TA 4OHWA 3POEA 1NE4A 2VBPA 1X8EA 3RJRA 1QDCA 3WDUA 4QKNA 5BY5A 4R52A 4HVRA 2R0FA 3PIJA 3WCSA 2NLRA 4TTGA 1I3HA 3I2OA 4B4QA 3CJIA 5A80A 1O3SA 1G9FA 2YMZA 1U5YA 2ERFA 4PF5A 3VZJA 1FMD2 4K3UA 4A6OA 2KD7A 4JDOA 4AL9A 1G9DA 3DCQA 2GC0A 4HKWA 3VBHA 3GF6A 1PM4A 1NOVA 3K4DA 1FNZA 1CQ9A 4OYUA 4UFJA 5IW0A 3NRUA 4BCUA 4WVVA 3RZGA 1ZYBA 5I8TA 2DUOA 3CJIC 4YW3A 5LRRA 2B39A 1W6QB 3HN1A 3MV11 3TNQA 4COYA 1F8VA 2VGDA 3C3VA 2QQLA 2NZ9A 3KB5A 1R091 4GMP1 4L11A 4HG6B 4LBMA 5A3MA 3LFMA 2Y38A 3VZKA 1W9YA 1QJU2 1UPIA 4CDXB 4H3WA 1EP0A 1FI2A 3QACA 2VUAA 3MIHA 2YY1A 1D7PM 5BUVA 3S5QA 5KBFA 4KL1A 3ON7A 3K4AA 2VVFA 1JZ5A 1MZFA 4AVCA 4ZXEA 3VHPA 2UURA 4CCKA 4DINB 2B7YA 4E4HA 1D4VB 4D7YA 1LGCA 3QLQA 5J96B 1MACA 4K20A 3I2DA 3D3AA 3OY8A 2CYFA 4FPFA 2J1UA 4CU7A 2P37A 3IWZA 3MLKA 4LOTA 3HD8B 1YQ8A 4KG0A 2ORZA 4BK4A 1RUOA 4IEQA 4RFT0 2C24A 5J3UA 2V4AA 1EAH3 2DUQA 3CKHA 3L2YA 1LOGA 1SG3A 2EAKA 2VC9A 1PVC2 4PDWC 1AL0G 4DEQA 1TME2 1XB9A 3VBRA 3WG2A 3HBZA 2DCYA 4HMZA 1RUI2 4RGGA 4CDWC 2QQKA 1CAVB 3NV3A 2HLEA 4KG8A 3T1MA 3M4FA 4X6QB 2IXJA 4Z2WA 5F8PA 2HWB1 3OD4A 1WMXA 4KWJA 1J84A 1TE1B 3RZLA 2DV9A 1OLRA 1PO12 4C1XA 4LR4A 4CDUA 1MS3A 1W2OA 2HEYF 4JC1A 2AENA 1OI6A 2UYAA 4L8QA 4GJZA 4E2SA 4UI9L 1I5ZA 4IGPA 5LB6A 3ZN6B 3KV6A 4UFLA 5HCFA 2DF7A 2PYTA 4ES8A 4PHZA 1BVP1 5HBAA 3WW3A 1RMU3 1EPZA 4AWDA 1H9PA 3M3OA 4CDUC 2VM9A 5F2WA 1DYKA 3K48A 1XNDA 4NIDA 5FRAA 2B9UA 1KDKA 4IEUA 3VDDC 2DDUA 1F9KA 3N36A 4CUAA 4JAAA 5H9RA 3ZVXA 1C1LA 4DO0A 1POQA 1UOJA 3R6SA 4AQTA 1QOSA 3T3YA 2P3JA 2EALA 4OHXA 2ETEA 2GP3A 3DV8A 4OMCA 1Q3EA 1UWWA 2QFEA 1BEV3 3ZYRA 5F6LB 4LIVA 1LNSA 1WW6A 2RDQA 5H9SA 1UQXA 5SV8A 1TZOA 1TNFA 1GZWA 2BFUL 3JQXA 4H7MA 5A6YA 1H2LA 5I0RA 3JBG1 4DUVA 3DKWA 3WW1A 1AL21 2VTFA 4MYEA 4IV3B 1ZVFA 4YVSA 5ACA2 3S57A 4N53B 5G04L 1N1VA 2O8QA 1E5IA 4OCTA 5JCTA 2O0OA 1RYYA 1Z7S2 4XQDA 4L9BA 1JYIA 1YNAA 3O1TA 4D0QA 3PVBB 3WOGA 5IVBA 4YARA 1VBC2 3AXDA 1V9U3 1CZSA 1OC1A 3OTFA 4LO4B 4QX1A 1Y9QA 3B5LB 3ZN6A 3VKLA 3V0BB 3LEGA 5FZFA 2I45A 1KJLA 1UW8A 5I0DA 1ZRFA 5FZ0A 3WCRA 2ZX3A 4G4FA 1AR81 2ADDA 1QJZA 2IXCA 2E31A 4CP9A 4D94A 1DGLA 4HK9A 1S0DA 2VZ3A 4HOOA 4QXKA 3DXUA 5DZEA 5JMCA 1WCQA 1SZBA 5FP7A 1ULEA 5T5LA 1GQHA 3BU0A 1PIV2 4A7KA 2WNVB 3OGVA 4LKFA 3MGUA 3RZZA 5BNPA 1OH3A 3PURA 5FP4A 2DVAA 2ENRA 1XYOA 5FY8A 4DZGA 4DXTA 4SBVA 2BGOA 4S2HA 3NNLA 4CCMA 3BIEA 1JXNA 2PTMA 3HPNA 4GA9A 4A2UA 5FXZA 4EZHA 1H1MA 4PQ9A 5B4XA 1R1ZA 2PQSA 4DY5A 5IVVA 5C4WB 3U10A 1LHUA 1JYWA 1DQ1A 2W1QA 3OUIA 5GZDA 5FZLA 3ZO0B 4I02A 4DMIA 1W6NA 1EYBA 2AH2A 5KC6A 1HV1A 1OVSA 3FUQA 4QM9A 5C33A 2YFUA 3E5XA 4MO3M 1S4CA 3C7GA 1HQLA 1OVPA 2EXJA 2VVDA 4JGYB 4AFMA 1DU3D 4CXWA 5JZGC 3ZX7A 5FYIA 4JRAA 5FLJA 2RM22 1XNCA 4JV4A 5F6KA 5CB7A 4EN7B 5ISLA 5EJ1B 4YW1A 5K7PA 3BU7A 1H0BA 3RG0A 3ZFEA 1DZRA 2HWB3 1MVEA 4MZUA 1D0GA 4LHNA 5C3SA 1LKNA 4COZA 3WNPA 5DAPA 4P9GA 1C28A 1NX9A 3E1F1 1R64A 4E9KA 4FOYA 4CE8A 1G9CA 3TN91 3TEYA 1ZRIA 3UETA 2RMU2 4URTA 3WEZA 5KXEA 1G6NA 1VB2A 5FY4A 3WQ0A 5D21A 3ZFEC 2VTXA 2WT1A 2Y64A 3ALQA 3SH3A 2ATFA 2RV9A 1PHMA 3OJBA 4BOWA 4XUNA 1ASJ3 4AI3A 2A6WA 2BW8A 4TXWA 5K9YA 3NJZA 1ULOA 1WD3A 1WMFA 1V0AA 1W06A 1L7QA 3BVCA 1SBDA 3WSOA 1WLTA 2JJ6A 2EXKA 4XZUG 4N9HA 3ETQA 3ZYPA 1JZ8A 1ZZ6A 1ZZCA 2YBKA 4TSVA 2ZGNA 1EPWA 1WLDA 3POGA 4XJUA 4MADA 4N8MA 5KC5A 3RRDA 4QMAA 3D0JA 4Q4X2 3BTAA 2GH2A 5FPAA 2B5HA 4ASLA 2W1SA 4FCAA 4K6BA 3NVCA 1HLCA 4QQLA 3IM0A 1D4M2 2LRPA 3ZIXA 1K5MB 3NAPC 4BE3A 1AX2A 1Q8VA 4QDQA 3V0AA 2A7AA 2QDRA 2WNUC 3JBG3 3T0DA 4KQ7A 3PJYA 1AL23 3LPFA 3AXEA 2FDKA 4LO5B 3RMYA 4PI0A 4QX7A 5EQUA 1UF2C 1ZBE2 5K4LA 3RSJA 5FMOL 3DEMA 4Q29A 4CU8A 4INDA 2VUCA 5AFEA 5C71A 3OEBA 2SBAA 1CAXA 1KFUL 2IVJA 3AKSA 3ASIA 3PVEA 4EN8B 1GBGA 4Q27A 3CLPA 2ADEA 4GZ9A 4LBNA 1G7YA 3NV2A 2MEV3 2UY9A 3V65A 4MGQA 2XVLA 2JDHA 4SLIA 3FZ3A 4CP1A 1AX1A 5EJ3A 4ZS2A 5C5UA 1RUF1 1QF3A 2VO5A 2HWE1 1AR83 1HB2A 1VBB2 4PBOA 4YW4A 3MF9A 1SCRA 1J3PA 1JMUB 2R30A 2FDHA 3VBUB 3ZFFA 3ZXJA 2GNTA 4F7ZA 2XXZA 3VBSB 1VBE2 4M4RA 5FBZA 4A44A 3D4KA 2PMWB 1WW7A 4FTBA 3AP9A 3KCYA 4BHPA 2BUKA 4CDXC 1AZDA 3POYA 1TQ5A 4DRVA 2V73A 5LEJA 4P9XA 5FP3A 4QWNA 2J22A 2ARXA 2BGPA 1G9AA 3H1MA 1PGW1 1LTEA 1MS5A 1UMHA 1OA3A 1K42A 4FTSA 4BIFA 2AR6A 1YLLA 1VR3A 1NLRA 4FOWA 4K9SA 3RPQA 3WLUA 3VZOA 3HR9A 3U37A 2NMOA 5C6CA 5LY2A 4JKKA 2ZGUA 4GWNA 2VL4A 4YG3A 4EWAA 2PHUA 2R6QA 2KA3A 3THTA 2EXIA 2OUJA 1O4TA 3ST7A 2XMLA 2WFF1 5FXWA 5DZFA 2ZKLA 1AYM1 3BCWA 3HIFA 3KM5A 5FZ4A 3MW4A 3R0RA 2J1RA 4EN9B 3POWA 1XU2A 2A5ZA 2E26A 3RZKA 3MDPA 4M00A 4J25A 3MV01 1VB4A 4LOSA 5HV4A 3T1LA 4AG4A 2YG0A 3WUCA 2JDNA 4CCDA 5EPAA 1GNYA 3GHNA 5JSPA 1KD7A 3S0MA 2WWUA 5F5IA 2QQOA 4N90A 5A3OA 2PHXA 2VQUA 3F95A 4JGZB 2X10A 3UKTA 2XJRA 3VD3A 4QKDA 2XL7A 2ZJCA 3AZZA 4TZDA 2OVUA 1UD1A 1RJ7A 5GLWA 1U5IA 1X82A 3CO2A 4K1YA 1CJPA 3TN93 4EWEA 2FD8A 2VZVA 3AFGA 3N7MA 2R0HA 2ZEXA 5J98B 4D8MA 4XFFA 4AHYA 3JXSA 3N9NA 4MGZE 2VMCA 1DF0A 4S2FA 2Z79A 1PGL2 3VGIA 4XJWA 2YPJA 5FZOA 1LHNA 2QQMA 2A3XA 3EBRA 3I59B 4W4ZA 3OBRA 1BZWA 3VKOA 1GOGA 4BISA 4FPCA 5FKBA 1UY2A 5G05L 2HH9A 1I5PA 5LK5A 1CN1A 1QJY2 5BNNC 3PLQA 4FQZA 3B00A 4BQWA 1A6CA 1L7RA 5LRSA 1LOBA 1FATA 1W0NA 4MH0E 4BQ3A 4CPBD 5F3CA 3HWJA 4IV3A 2BQPA 3ZMOA 1HQNA 3AKPA 2WNEA 3K46A 3MYXA 4N53A 4R9DA 5GLTA 3ZOIA 2RS32 4LIUA 4DXRA 5IVFA 2HJIA 4N43C 3WINE 5EIYB 4C0BA 3PUAA 3I2KA 2Q30A 1WLCA 2N7GA 2WO7A 3IB3A 4IEYA 2WINB 4AI9A 5DUUA 3B9CA 1JZ2A 1ZZBA 3T30A 5EP9A 2AC1A 4Q8LA 1JYVA 3V0BA 4N53C 2F17A 2WAAA 5FYVA 4NPMA 4XC9A 4IEZA 4AW7A 2F4LA 3PUHA 3T4HB 2JEMA 3LWCA 1W28A 1RUG1 5H9PA 1O91A 4AQ6A 1H6YA 3KVAA 4P02B 3WDXA 3NL1A 4AQ2A 5A3LA 3IT8A 1SCSA 1UXXX 3O5SA 3R05A 3TBDA 2LTNA 4YWAA 1RUF3 4AVBA 3H1WA 2XVGA 2HWE3 3ZN5A 3B7MA 3LAGA 4MXVA 1OD3A 1YJLA 2NQYA 4Q1RA 1QDOA 5DAVA 4Z92B 3QD6A 5FMOS 4XIOA 2VOWA 1RHI2 1RXFA 1UU5A 2W68A 3ZIWA 4XF1A 2GAUA 3C7OA 1OLQA 4B1MA 1VALA 4BPZA 2V4VA 3DYMA 1DLCA 1W9WA 2LUWA 2BERA 4Q4V2 2VW1A 4DPNA 2J1VA 2X5IB 2ZEYA 1TNRA 3H0OA 2K2SA 2QZ3A 2WNVC 3SCFA 1FMD1 5KHHA 1ST8A 1R1A2 3M1HA 3NJXA 5LBEA 3OBAA 3POIA 1WUVA 5C4WA 2VZSA 5F5CA 4PQQA 3THPA 4LT5A 1CWPA 2G9GA 3NV1A 4MUVA 1S0EA 3OSDA 1DQ0A 2VQTA 3JU9A 4OUMA 4NJ4A 5JR7B 1W8HA 4NAMA 4BMEA 4XZPA 2CGPA 2HWD3 1GOHA 3UK9A 2BP6A 4M3CB 4HFSA 2E9QA 1WA4A 2RG4A 5B4NA 1OLMA 3M3QA 2PHRA 4M3CE 1QWRA 2WFF3 2RDRA 2Y33A 4WVWA 4OHVA 1UY0A 5B2GB 1QJU1 2A6VA 1HRI2 4DS0A 1AYM3 1XYNA 3NQHA 4QB1A 4Z8BA 1WBLA 1WMEA 2YC2A 3A0NA 5A3PA 3P3NA 2WRAA 2ZHLA 3UGFA 4JGYC 3VD5A 1MEC3 2ZAHA 4FPEA 2D5FA 3D0SA 3LDKA 4KBBA 3SH4A 3HNYM 4NN0A 1AR92 1WA6X 1NXMA 1UMZA 3EXUA 4AOCA 4XFAA 1R082 3LEKA 1FXZA 1W90A 1QKQA 4KU7A 4Y5TA 1X9PA 4QPWA 5FAXA 4EYUA 1UYZA 1RXGA 5FYYA 2RVAA 3AJYA 3L2HA 3LA3A 2YPDA 3MI8A 1LB2A 2ARAA 2BU9A 5F37A 4HL0A 4ORFA 2ZHMA 4YG0A 1SDWA 3R4UA 1LU2A 3Q8CA 4GULA 4C1WA 5FZ8A 3BODA 4QHBA 1PVC1 2ORXA 3H7YA 5JOYA 5AC92 2ARBA 1C8M2 2DTYA 2VNRA 4NE9A 2ES3A 1RUI1 5JOZA 2QNKA 2QQNA 4AI8A 4XJ8A 1OOPC 2ET1A 2PHWA 2WQZC 5CEHA 2XONA 4ZHNA 3GNEA 5CIRA 3AK0A 3ZYIB 4LLOA 1KGYA 2ZGTA 1GZWB 1K5MA 2A70A 4K40A 5CNAA 1RVF2 1C57A 2DFBA 2R49A 3MUY1 5D2AA 2QQWA 5FCCA 2VW0A 2W46A 5JSRA 2WR9A 5FY7A 1PO11 2D6KA 2GN3A 2OZ6A 2DTWA 1QMJA 2XG3A 3AFKA 5A1FA 4ATEA 2YZ4A 1YXWA 4MGIE 5FK7A 4AEKA 2XH6A 3LZZA 2PFWA 1W8WA 1VRBA 3T4VA 4YZ4A 3RZHA 1K5MC 2ZGKA 2XWBB 4XUPA 4ARXA 2WYFA 4FTEA 1A34A 2D97A 4QHOA 4NIHA 3RVHA 1YI9A 2HBTA 3GJBA 2AEYA 3I3EA 3OBZA 3PVOA 3PUIA 3FL7A 4XCAA 1VMJA 4P5HA 3ZXLA 3J8F3 3CHXA 1IG3A 1VMFA 2BVVA 5FZCA 2WN3A 1RUG3 1UYXA 2QQVA 4RS5A 4LK6A 2OS2A 1BK0A 1IG0A 1N1TA 1VBD2 2RS12 4J6GA 5I0TA 5KXDA 1W9SA 2QE3A 3AMNA 3VBUA 3WQ1A 5JPNB 2DCJA 4V1PA 2ZX4A 1FYUA 1UIJA 4E8DA 5HI0A 1W8UA 5BNPB 5C8WA 4B7EA 4LUKA 4XF0A 5I0SA 1HIXA 1COV2
chains in the Genus database with same CATH topology
4LBQB 3SH5A 4A3XA 4XILA 1I9RA 4Y24A 3VBUC 2E7TA 3VBSC 2QZ2A 1Z7S1 2FQPA 4DRRA 4QQHA 1LEDA 5ABJA 1JN2P 1FMD3 1F2NA 4WM7A 4YZ2A 2W0XA 2UYBA 1VBC1 1VLNA 4HT1T 3U11A 3ZXEA 2TUNA 4MVTA 4RHV2 4Z07A 5AFBA 4MSVA 4X6RB 4HN1A 4CP0A 4YFZA 1OPMA 4XFBA 3VZLA 4AFBA 1L3JA 3GZTB 4XE9A 4R9AA 3HT2A 4KGQA 1AJKA 1RINA 3H50A 3A0KA 2AREA 3AP4A 3MIBA 2DCTA 3VHRA 1UU6A 1YYNA 1QJU3 4CEWB 1MQTB 3KT1A 3SHRA 2CGOA 3O0VA 4JGZA 3QBQA 1QH7A 5DXDA 1Z78A 4ASMB 3KSCA 4G3YC 4DXZA 1KXGA 4AVTA 1UN1A 5L73A 3D82A 4HBNA 4FPKA 1S1AA 4WZCA 4EV0A 2O1QA 4QQ2A 1CAWB 2ZMKA 3S6PA 4D7SA 1FOD2 4OHYA 4XFCA 2D98A 3I59A 3TYJA 1H9WA 5JIUA 3S30A 1ZZ8A 3RDIA 4XF4A 2WS92 1Q56A 1W0PA 2CAUA 3VBOB 2GZWA 1U0AA 1PVC3 3W59A 2D40A 1TME3 3WD5A 3RS6A 1NA1A 1RUI3 1RUE2 1DZTA 2P3IA 4MV2A 1H1IA 2B8MA 1IS5A 4P9JA 3V0AB 1SFNA 4FT8A 4Q0SA 5T50A 1JW6A 3ZSKA 4GH4A 2WT2A 3WDVA 3VV1A 2CWMA 1PO13 1V9U1 2UU8A 4ATFA 3N4MA 4F83A 1O3TA 1J58A 4MGKE 1SBFA 3MICA 1CAXB 4TWTA 2D6MA 2WLQA 4XMAA 3S7IA 3TOJA 1TMF2 1QJX2 2VNOA 2RS52 2ZA9A 1NCRA 3WW4A 4OUSA 2DU1A 4HETA 1KS4A 4YM0A 1GKBA 1NCQB 3GZAA 1O5UA 3VBHC 3JD72 3R4DB 2VW2A 2JG9B 3VL8A 3UJOA 1DG6A 4OI4A 3NV4A 3MIDA 4QT6A 3ZN4A 2VY0A 2VULA 4XTPA 3ZFFB 4ZU5A 5KXCA 4Z82A 2JX9A 5E88A 4Y26A 4Q4X1 5BXXA 1RUNA 1Z0HA 4COUA 5I8SA 1WCKA 2B42B 3B93A 1D4M1 1QHDA 2DURA 2X5IA 3AMPA 2Q1ZB 5BNOB 1MZ5A 1B09A 3RJ2X 3IDEA 4LO7A 1EV12 1RUJ1 2IFRA 1BMV2 1DQ6A 1VBA2 1Q8QA 5ACA3 4YLZA 1ZBE1 3WG1A 1VRH2 4IEWA 2WJSA 4RL7A 1Z7S3 2YHJA 5CG9A 1QQP2 2HWC2 4FO9A 5GKAC 4M3CA 3SNMA 4Q4W2 1MVQA 1VBC3 2VG9A 1PZ8A 1N1SA 1LESA 2YROA 1BBT2 1YUDA 3KZ4C 1DHKB 1FV2A 1DGWA 4EROA 3FLPA 3U4XA 1CX4A 1VAMA 1UZYA 4K21A 4P9IA 3FFQA 2H6CA 2B45X 3C2UA 4J1WA 4Q0VA 4LBQD 4DNYA 4WM8A 3VBRC 1VBE1 1GQGA 4U36A 4BLIA 2VU9A 4I0AA 1DQ2A 1PIV3 4RA0A 3KLSA 2XKPA 2PA7A 1ASJ1 2ZGMA 4L97A 1S55A 1LOEA 4AEDB 1IPJA 2ZMNA 4YSFA 1ULFA 4PLNA 3ZMNA 1GLHA 5C8CA 2HWF2 3O14A 1C4RA 2ZGLA 2YYOA 3IIAA 1ZRDA 1D0HA 4YRDA 2WA4A 1IHMA 1GZCA 5FPZA 2R042 2ZPXA 1JOJA 3SLIA 4FXGB 3LSDA 2GDFA 1JUIA 2OIIA 1H8VA 3OGJA 4B7KA 2VECA 4S2DA 2RM23 1REDA 3ACLA 1BYHA 4NHKA 3VN4A 4NO4A 2CTVA 4B4RA 2XLGA 1S0FA 1DQ4A 1YFWA 2C1FA 5DDJ2 4DQAA 2PAMA 2PQQA 3VLBB 2MEV1 3UV9A 5GZCA 1FT9A 3AYEA 4CDQB 1ZBA2 4LUMA 4HZFA 4YVSC 2RMU3 4W6WA 4FQ4A 5AVAA 1ZREA 1CPMA 2PAEA 2NYYA 1PGL1 2VUJA 1RC6A 1T6GC 1PVXA 1QNWA 4GMP0 5C9AA 3ZYJB 3D8CA 3NW4A 1O4ZA 3SMHA 4XW3A 1Q8PA 4Q0PA 1QJY1 1C8NA 4ZXKA 2BTVC 1OPOA 4LBQA 3RI8A 4RR3A 4AVAA 3IMNA 1AR72 3V56A 4Q4X3 2RS31 2A75A 3ROUA 2EXHA 4Q0UA 1D4M3 4UBGA 4XFIA 4Q4Y2 4JTNA 5EYYA 5BNPC 3MW3A 5KXBA 3K51A 1RUJ3 4JQRA 4QGNA 4KGGA 4K7JA 2WFPA 3DN7A 3KQRA 1ZBE3 2JG8B 5GZFA 1MS4A 2E63A 1KDMA 4H14A 4YM1A 1WMDA 1G8WA 2LALA 4K1ZA 2ZTNA 4XXPA 4AFAA 2BBVA 3HQXA 2BNMA 2R071 2NP0A 4ZU7A 1CR7A 1HDKA 1DGRN 1S2KA 5CADA 3ELNA 4W6YA 4AHXA 4LE3A 3WP3A 4CEWA 3JUUA 3NO8A 1MQTA 5F5QA 5I8YA 1RHI1 1KRIA 1NY71 3M2MA 3DUIA 4YGEA 4OI2A 3RWNA 1VBE3 3ZXGA 1J3QA 1H8TA 4ONUA 1DBNA 2PN5A 1ZX5A 1KFXL 2XJVA 4CEWC 1PO22 4B8EA 2BGCA 1MQTC 4XYXA 4CRQA 1AUYA 3VKFC 1CAWA 1R1A1 3PMEA 4WBBA 1PNFA 2P3KA 4Q26A 1LOAA 2WKKA 3MPBA 3ZXAC 3WV6A 5T5PA 3ES4A 5T52A 2IXLA 1ZNPA 4DY3A 5CFDB 5L7OB 3D6EA 5FTTC 2Z42A 1H4HA 4I0BA 4L92A 3VBOA 2X53S 1YFXA 1CAUA 3OD0A 4HVOA 2Q1MA 4UW5A 4AQSA 2UWCA 1FAYA 3CJXA 4FAHA 1GNHA 4QGLA 1R092 3IDCB 4E2QA 5HXVA 1RUH2 2IXHA 1N3OA 2NM1A 2FBEA 3ZSJA 5F1RA 3KMHA 1XU1A 4N7UA 2PAKA 2JENA 3LA7A 5H9QA 1Q8SA 2BEOA 3BPZA 3KS7A 2ZHNA 1V6MA 4XJAA 1OA2A 3EJKA 1RB8G 2AYHA 2BFUS 4YGBA 2DVFA 1NCQA 2OUHA 4I2OA 1WBFA 2JG9A 2QVSB 4RS5B 3FWEA 2D6PA 1C8M1 2GC3A 2ZOEB 4R9BA 3PHMA 1RUD2 1DLLA 5J7MA 5J36A 1SACA 2JG9C 2VNGA 1QJY3 5BNOA 3E6BA 2YC0A 3OYWB 4E2GA 1ZZ7A 3VKMA 3TRSB 2W08A 4FPOB 2A71A 3ZFFC 1SLTA 2RS33 4B3NA 1TEIA 2A6XA 5ABJB 2ZKNA 2WZR2 2GNDA 2HWD1 4WM7B 5BNOC 1MS9A 4WV8A 2ZACA 3MFAA 2RE9A 4QQOA 1LCLA 3E6CC 3WDYA 1RJ8A 4Y1YA 4ES9A 4IEVA 1DYPA 2DFCA 5CU1A 5T3NA 4CYDA 3MIEA 1JBCA 1GR3A 1VP6A 1UPSA 2R073 2RS11 3LGRA 2Y26A 1MEC1 3M7AA 3E5QA 4KNCA 4R4XA 2XJUA 3ATGA 2PHLA 4XOGA 1PM7A 1W6MB 1ND3A 1RHI3 2YGLA 4MLOA 3WHUA 5A33B 5GLZA 5GZEA 5KHJA 5CFCA 3PVNA 4AEDA 4XBLA 1HX6A 4YM2A 3JB8A 4I0WB 1LU1A 4P9WA 4Q4V3 1DDLA 2PHDA 4XF9A 3RYKA 3OGGA 3J9SA 3OF1A 4YFWA 1R1A3 5JAXA 2RR12 1HW5A 2GMEA 2C5DA 2DWRA 3AZYA 3KD4A 1UKGA 4OI0A 2QUOA 1OSGA 1MS1A 3FE5A 4XBNA 5FOBB 1ENSA 1IZ3A 1O3QA 3H7JA 4LTAA 4EJRA 4ITCA 3PNAA 2OPKA 1UCXA 1NA1B 5K8SA 1CIWA 1GZ9A 3RI9A 2TEPA 1N47A 1FX5A 2OZJA 3Q9OA 4BA6A 2GC2A 4GH4B 4RQPA 5JWPA 1RUC2 2QCSB 1AYN2 4L2NA 3RQ0A 5L19A 4CDQA 3LOIA 4HANA 3USUB 4IV3C 1AR93 3J26N 4I3PA 4N9IA 4UBHA 3J8F1 1R083 1B35A 1NCRB 4NVPA 1U5ZA 2GMMA 5KWRA 2Z69A 1ENRA 2VH9A 1FOD1 3AJZA 2D7FA 2ZCWA 3H1YA 3B9IA 2FZ2A 4FOQA 3J4UH 4DFSA 4BWOA 4FPJA 3B02A 1H2NA 4HKLA 1O5LA 3ES1A 4XTMA 1PMIA 2XJQA 4ZKTB 5AC93 1C8M3 2G9FA 1SLBA 3AKQA 1RUE1 2WSUA 4XETA 1W0OA 2WZPP 2DUPA 3A4UA 2MNGA 4Q0QA 2GMPA 4YM3A 3AX4A 3BALA 1RVF3 1JTZX 2AUYA 1ONAA 3N35A 4M3CF 2CAVA 2XKOA 2VQAA 2JG8A 1POV0 5J09A 2RS51 2V5YA 4XIKA 2W52A 3WX5A 2QJVA 1H2KA 1ULCA 1BK1A 1W39A 3FX3A 4E4ZA 5C4WC 4B29A 1OFNA 2CWSA 2VQ0A 4MGYE 2IZWA 2JG8C 1LEMA 5I0UA 5EXOA 2R16A 4YYOA 1LODA 4YZ5A 3HMYA 4I30A 4AI2A 1GV9A 1JYCA 1QNYA 3NKGA 1VBD3 2RS13 4A7ZA 4CDWB 1WGPA 5JIAA 1V70A 2H0BA 4WM8B 2D6NA 2LM3A 1V6NA 4KWKA 2EVXA 1IKQA 4HK8A 2TBVA 4JRLA 4XEZA 1COV3 5JI9A 2XLAA 3ZYGA 1E57A 1WCSA 3IDBB 2ZMLA 3U07A 1VBA1 3ZDSA 3I54A 4MXWA 4LULA 4P9LA 1VIWB 5C8CB 2IFWA 4BZ4A 4C0HA 4FAGA 1ENXA 3PTYA 3RYPA 1ZRCA 2R1BA 3OPZA 1PK6B 2AZ5A 2G4IA 1QQP1 3QH7A 2V09A 5CFDA 3RNSA 5L7OA 5HCBA 3KGLA 4N7IA 4Q4W1 3B94A 4XMIA 1HXS2 4U2AA 3DF0A 1TME1 3VDDB 4IQPA 4RHV3 4E4SA 1V00A 3N7LA 1BBT1 1JUHA 5KHGA 5CFDC 1CD3G 2CNAA 2GNBA 3VBFA 5EYXA 2CL2A 4CZSA 1RUF2 1NQDA 1AXZA 2GALA 5GLVA 4XBQA 2XJTA 1MZEA 1X7NA 1QXJA 5AVPA 4EWDA 5JOWA 1QU0A 1A3KA 3FMGA 1LHVA 1XNKA 1WD4A 4FPGA 3E6DA 3CEWA 1X8MA 3ENRA 5D1IA 1S2BA 3L9JT 3WG4A 4IV1A 2HWF1 2NMNA 3CU7A 4Y22B 4QPGA 1N3QA 3AKRA 4YG6A 1PZ7A 3W9AA 1XE7A 1FOD3 1O3RA 5C9AB 2YV8A 4YGDA 3WP4A 1NG0A 5F9TA 1SLLA 2JXAA 1YRZA 3O0WA 2R041 5HCAA 4PIYA 3GBWA 3D5OA 1V6IA 2WS93 1GSLA 4GALA 1RTVA 2FMDA 3OYWA 1N3PA 1J3RA 2WL1A 4LA3A 4RS5C 3WP5A 3ME2A 4QD2A 4RR3B 4W6XA 4JTOA 4O9EA 2JECA 1GFF2 4OFGA 1RUE3 4XPVA 5ACA1 2R062 4FVVA 1XYPA 3INAA 1AR62 1HKDA 2PLV2 1VAVA 4YZ1A 2A3YA 2DCZA 1FPN2 4GB32 2XL9A 2Q8OA 1WCDJ 1ZBA1 2E7AA 2PELA 2RJKA 3N3HA 2CGNA 5IUQA 4Q1PA 1NE6A 1XRUA 5T55A 2ZS6B 5LK7B 4META 1HRV2 4ISRA 5GLUA 1C5HA 1LRHA 1TMF3 2XVKA 2RS53 4FOVA 4AGVA 1CESA 3BOPA 3WDTA 5ABJC 1YIFA 5JPMB 4WM7C 2ZX2A 1G86A 2GU9A 3CF6E 3UL2A 2JICA 4HSJA 3AMHA 3FLRA 2HEWF 4TYSA 3WP6A 4Y5Z0 2AGSA 1PIV1 4KWLA 4D3WA 5T54A 1W6MA 4FBFA 3AP6A 3WW2A 4QM8A 4RD7A 5A33A 2YGMA 3LA2A 5BPXA 4FPHA 1H8TB 4IESA 1LHOA 4QGMA 1J59A 5DG2A 4Q4Y1 4QU2A 3VKNA 5JI7A 3BB6A 3MLLA 4JGZC 1VBA3 4AE2A 2PHFA 5FQ0A 1X33A 1VRH3 1ULDA 1QGLA 2NPIA 1QQP3 2A73B 2EAAA 2HWC3 3KCCA 4Q4W3 2JE9A 1LJ7A 2ZBJA 1XXNA 2K9ZA 2D6LX 3ZFGA 2RM21 2ZHKA 1CAUB 1WW4A 3ECQA 1BBT3 4Y1VA 1QY4A 4HKOA 4AEMA 2E6VA 3FBYA 4BQ1A 4H7LA 2MPFA 3E97A 1RIRA 4ISQA 2DVGA 3ZSMA 3AMQA 3IKWA 1SQ4A 2VMHA 1NA1C 2VMGA 3NAPB 3USUA 2RMU1 3AYCA 1QOOA 3NSTA 4CEYB 2DVDA 4OLLA 3T2TA 2H0VA 3LB9A 4GH4C 2HEVF 2WT0A 3B69A 4M01A 2ZGOA 3ZXDA 2GNMA 2HWF3 2P2KA 4Y1XA 4M0NA 1EY2A 5DZGA 5DUXA 2X8KA 1QH6A 3JZVA 4AGRA 1NCRC 3IN9A 2ZX1A 4IERA 5T5JA 4R4ZA 4TLFA 2C9AA 1MS8A 3H8UA 4NOTA 4G9SB 4LLFA 1G9BA 1IGOA 2R043 3AYDA 1OMIA 1ALYA 4Y1ZA 5E8AA 2WSVA 3RYRA 4HPKB 1W6OB 1RUH1 3VZNA 3KGZA 3MEPA 2X29A 2JDZA 5DDJ3 5A32B 2X5IC 5E89A 2R1DA 4WVMB 3G7DA 1ZBA3 5EFUA 1DQ5A 1F5JA 1XNBA 1AF9A 2E51A 3LOBA 1UU4A 1VBB1 4PDWA 2XBO2 2D44A 4CDWA 2WIIB 4EN0A 4S2GA 2FHRA 4UW4A 2BWAA 3KCXA 2I74A 4LHLA 1N1YA 2XJPA 4IETA 1RUD1 2ILMA 3BOWA 4I3GA 3FC0A 4IL7A 1ND3B 3LKJA 1DGRA 4X8NA 5CFCB