1V6JA

Peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6jA00
2C9AA 3OBRA 4XTMA 3AP9A 3Q9OA 4FOYA 2V73A 4FPFA 3OGGA 5H9SA 2DVFA 1IS4A 1XQNA 4BPZA 3A0KA 1AJKA 3ZSLA 2JE7A 5JLVA 4P9WA 3V0AB 2GNDA 4OZXA 1UL9A 2GMPA 4XDQA 5GJ6A 1ULFA 1LODA 3D4KA 4XJ9A 1NLSA 1AZDA 2DU1A 4Z8BA 3FBYA 1DBNA 1IS6A 1S0IA 3WUDA 2ZKNA 4AVVA 4XE9A 3USUB 3AXEA 3SLIA 2WT2A 2NP0A 4ATFA 3POWA 1IOAA 1S1AA 2UU8A 1ENQA 1BYHA 1KJRA 3HR9A 1A8DA 1OFSA 3OBTA 4PBOA 2ZGLA 4GA9A 5H9RA 4DPNA 1DZQA 2DTYA 2A5ZA 3ILNA 4DRRA 1KDKA 1O4ZA 2ENRA 2UWCA 1Q8OA 4WVWA 4SLIA 1LU1A 3FLRA 4FPGA 3POSA 2ZMLA 2UWBA 1SBDA 2R1DA 2WKKA 1QDOA 2A3WA 5HCAA 4ZKTB 4K1YA 5DUWA 1MS1A 3DGTA 4R9CA 5GZGA 1AVBA 4K20A 3UK9A 4XHBA 4XZPA 4AVTA 4ISRA 4Y20B 5IK4A 3ATGA 4YW1A 4P14A 1PZ7A 1QOOA 3RSJA 1D0HA 2ZHNA 4Q1PA 1WW7A 5JOYA 4LBOA 2Z42A 3RRDA 3AJZA 3KQRA 1FV2A 2EAKA 3B00A 4XMAA 4AGVA 1JYIA 3ZXFA 1FV3A 4YGBA 1DYPA 3UJQA 4DQAA 1FATA 2R49A 3WG1A 5EYXA 3AZWA 2ZACA 3ZYPA 3M3QA 1U0AA 2DUQA 1VLNA 3QCWA 1WBFA 5JOWA 1SCRA 2A70A 3VKFC 3WDWA 1TEIA 4ZXKA 3AP4A 3ZSMA 4CZSA 1LEDA 4AYUA 3WV6A 4NO4A 1S0CA 1URXA 1QDCA 3B69A 2DWRA 1NXD1 2ZMKA 3BOPA 3CNAA 5GLZA 1LOEA 1JYCA 1SFYA 2ERFA 4XOGA 4YW2A 1G9CA 1ZA4A 3B01A 1W0OA 4XBNA 5DG2A 1LESA 2VY0A 2DVGA 4FVVA 1AXZA 5T54A 3VKMA 5H9QA 2BQPA 3IN9A 4CRQA 1C4RA 2EIGA 3AP7A 3GALA 3HN1A 5F9TA 3M1HA 3R05A 3M3OA 4WVVA 3T1LA 1G9DA 1DGLA 1I3HA 4Y1VA 4FPOB 1S0EA 2E53A 5DXDA 1GBGA 1ENSA 2A6XA 5T5LA 1CQ9A 1KQRA 1W6QB 2OVUA 3UL2A 2B7YA 3A4UA 1SLCA 3AXDA 2DTWA 4Q2FA 4R9DA 1G8WA 3AP6A 3TAYA 1KJLA 4D69A 4DS0A 4XJAA 4F83A 2R1BA 3C2UA 3WVJA 4ISQA 1SLAA 2P2KA 4BM8A 5IT6A 1N3PA 3AFKA 2VW2A 2I2SA 3AX4A 3OYWB 2JJ6A 1ULEA 3N7KA 4FOVA 4XMIA 1X50A 3T1MA 1LCLA 4YLZA 2ZGTA 3WDXA 2AUYA 1Z0HA 2W52A 4XJWA 4YG6A 1YXWA 3WDUA 2ZBJA 3ILFA 3IPVA 4FOQA 2W68A 4YZ3A 3SH4A 5EXOA 2P34A 1WLDA 5JOZA 4R9BA 4XJZA 3BIWE 2WSVA 1MZ5A 1KDMA 2PHWA 4FP3A 1IS3A 3FLPA 2ZHLA 1DQ5A 1G9FA 2ZGUA 1WD4A 3V0AA 4XBLA 4YW5A 1LOFC 1JN2P 1S0GA 1I1EA 1MZ6A 3NV3A 3INAA 1PZ8A 3USUA 1HQWA 3NV2A 1S0JA 2PHFA 4YM2A 2EALA 3WCRA 3ILRA 3O0WA 2DVDA 4XXPA 3ZXEA 2D6KA 3NWKA 4LBQD 1H30A 1QOTA 2WQZC 4M00A 2UWAA 4M3CE 3WNXA 1B09A 2ZHKA 3AYEA 4GALA 2NN8A 1JW6A 1BZWA 1G86A 1IKQA 3I4IA 2XG3A 2D7FA 4YW4A 1V6OA 3ZSKA 1FX5A 2E7QA 1S0BA 2AGSA 4YG0A 5FREA 1V00A 4M3CF 2KM2A 4CTEA 1MS5A 2PHRA 1R1ZA 3WLUA 1AX2A 3ZXKA 4Q8KA 2ES3A 1A78A 4Y20A 4I30A 1LOAA 2ZAAA 2RHPA 3SH3A 1N3QA 4GXLA 2JKBA 2AH2A 4FPYA 1CONA 4U36A 5E8AA 1SBEA 1LHUA 2R16A 2YY1A 1UN1A 2H0BA 3IMNA 3LCPA 3JU9A 1LU2A 1H9PA 2GMEA 2VXRA 4LBMA 2R0FA 2ZGOA 1GLHA 5DZFA 4K21A 1UKGA 4BLIA 3PVOA 1BQPA 2Q5TA 2E51A 3PVEA 1LGBA 2W39A 5EWSA 1LHWA 1YO8A 2ZABA 5IUQA 1DIWA 1JBCA 1V6NA 3WDYA 3OY8B 3W58A 1W6NA 2P3JA 1HKDA 2GN3A 1MS3A 1ONAA 1CPNA 4HL0A 2OW4A 1UZYA 3O0VA 4XIOA 2DU0A 3WG4A 3APBA 1GZWB 2PHXA 4YZ5A 1JHNA 1QF3A 4XYXA 1C57A 3W59A 1LTEA 2DVAA 4C1WA 3RMYA 1FNZA 4MYEA 3VKOA 2D44A 4AVSA 5FRAA 1C1LA 1JXNA 1LOFA 1UMZA 4RA0A 2DV9A 3WDTA 4DRVA 2D3SA 2GNTA 2VW1A 3WHTA 2HYKA 1WBLA 3T2TA 1W6NB 3RQ0A 4AWDA 3WUCA 1W6QA 1V6MA 5CBLA 3AZYA 3V0BB 3QLQA 3ZPYA 4LBKA 2VW0A 1DYKA 1V6LA 2D43A 2P3KA 3WDVA 1WD3A 2CL2A 5DG1A 4FPLA 1IS5A 4Q8LA 1N1YA 3FUOA 3FFZA 5IK8A 2V5YA 1KITA 1CR7A 4L8QA 3OYWA 3WOGA 3ZXJA 1W6PB 3R4SA 4PBPA 1Q8VA 4WV8A 1DFQA 5GLUA 1G9BA 3AJYA 3IM0A 3MW3A 4FQZA 2FMDA 1QNYA 5KXCA 3M3CA 1S0FA 3O12A 4YG3A 1LOGA 4XTPA 1YRZA 3H0OA 1LHNA 1QGLA 4Y22B 1DLLA 4YGCA 5DUVA 5IK5A 2ZGKA 3PMEA 5GZDA 2CY6A 4PCRA 4ITCA 2E6VA 3A0NA 3VV1A 4YZ2A 4BQ1A 4XILA 4M3CB 1UZZA 1RINA 4AGRA 4BLJA 1GNZA 2WT1A 1QMJA 3MW4A 5DUXA 2YMZA 1Q8QA 3KM5A 2VUAA 1MACA 1LHVA 2PELA 1OQ1A 2A7AA 3WZ1A 3ZXLA 3WHUA 2DURA 3WG2A 3JUUA 1LOCA 1GKBA 1N1SA 1S0DA 2G4IA 3RMXA 4FP2A 3UJOA 1Q8SA 1CVNA 5SV8A 1AXYA 1MS9A 4P9YA 3N7LA 4UW4A 2SLIA 3LSEA 1Y7BA 4BMBA 2R0HA 3AK0A 2NZ9A 4YM3A 2CTVA 1GYKA 1SACA 4Q27A 4TYSA 4XIKA 1UX6A 4GWMA 1VAMA 4UW3A 1A3KA 1UPSA 2LTNA 1MS4A 3AYAA 5JDBA 4XJ8A 1DQ6A 2TEPA 3N7MA 2UURA 2JDZA 2P37A 2D6LX 1YI7A 1DQ2A 1DHKB 1WLWA 2NM1A 4YGDA 1D2SA 2ZA9A 1CESA 4XHXA 4TZDA 4LBLA 3HMYA 5DZEA 1F31A 3IKWA 3ZSJA 4XBQA 2DYCA 1O4YA 1WW5A 3AZVA 4WZFA 3V65A 2A75A 2DVBA 2EXJA 2YV8A 3ASIA 4LBQB 2OUHA 2A6YA 4PQ9A 3M3EA 2GMMA 4HANA 1LECA 1HLCA 1WLCA 4FPEA 5E89A 1N1TA 3D5OA 5AVAA 2CWSA 3ENRA 5GZFA 3BODA 3B3QE 1YIFA 5JVVA 1VIWB 4Q26A 2GNBA 1ULCA 1GSLA 4K1ZA 2D6OX 1J1TA 3AZZA 2D6PA 3OY8A 2A71A 2C5DA 1W6MB 1YYNA 5HCBA 1N3OA 1Q56A 1AX0A 2EXHA 1KRIA 1SBFA 1MR5A 4Y1ZA 1RITA 4IQPA 1GZWA 2D6NA 2WT0A 4Y24A 4YGEA 1SCSA 1F5FA 1WUVA 3SNMA 2EXIA 5HCFA 3RS6A 2JECA 4YZ4A 1MS8A 1QKQA 4DFSA 3SH5A 1RIRA 3VKNA 1QU0A 2AYHA 3LSDA 3O5SA 1BJQA 2YROA 4ASMB 5JOXA 2VU9A 1CIWA 2VH9A 3B9CA 1ENRA 3V0BA 1SLBA 1APNA 2A6ZA 3PVNA 1W0PA 4GKXA 2ZGPA 4XJUA 4Y1YA 3ZYRA 3ZVXA 2A3XA 1BKZA 1LGCA 4XXAA 3VUOA 5H9PA 4YZ1A 5CA6A 2FHRA 1GICA 1V6JA 1Q8PA 1ZM1A 1W6PA 2CWMA 4R9AA 4H55A 5GLVA 2CYFA 2ZGSA 4FPJA 3AYCA 3AZXA 1C1FA 5L73A 5CB7A 3MPPG 3DUIA 1FAYA 1ULDA 1LULA 4FQ4A 1GANA 1V6IA 3NV1A 4JCKA 4YM0A 1AJOA 3N7JA 4Y22A 5EYYA 5T5OA 5KXDA 1N1VA 1LEMA 2D3RA 1CN1A 2AREA 2ARXA 2GN7A 1V6KA 5F5QA 2D6MA 1AX1A 1F9KA 4M3CA 3WCSA 1LJ7A 1QNWA 2AENA 2NMOA 4UW5A 2CNAA 1EPWA 4W65A 3SITA 1AXKA 1JOJA 4U2AA 4UW6A 5LK5A 2ARBA 1HDKA 2OUJA 4BOWA 3MEPA 4KBBA 3VKLA 1UAIA 5BYNA 4BMEA 1MVQA 1QOSA 5T5PA 2ZMNA 1GNHA 1LGNA 5JMCA 1W6OA 3OJBA 1BXHA 5E88A 5T5JA 1WW4A 2NMNA 2WJSA 1LOBA 2ZZJA 3AYDA 5CNAA 3V64A 2YZ4A 3L2YA 5IK7A 1WW6A 1PZ9A 5GALA 1FNYA 1VAVA 3N36A 2A6VA 2ZGMA 2W08A 2XB6C 4YFWA 1LENA 2ZGRA 5DZGA 5GM0A 3AP5A 5T55A 3N3HA 2ZGNA 2GALA 2A3YA 1G7YA 4Y26A 4YM1A 5CAZA 1SLTA 1DQ0A 2WLQA 1G9AA 2YXSA 1W6OB 2DUOA 1H9WA 4AGGA 1Z78A 2GNMA 4LBNA 2E7TA 5T52A 2PHUA 1AF9A 1HQLA 4JRAA 3OPZA 1IKPA 3BTAA 4GKYA 4NOTA 2ZHMA 2WNEA 3SISA 4Q1RA 3FLTA 3GNEA 4LBQA 2ZGQA 1N47A 4Y1UA 4RL7A 2NYYA 4JC1A 5T50A 2JE9A 3N35A 5KXBA 2P3IA 3RG0A 4Y1XA 2LALA 2A6WA 1MVEA 1GV9A 1DQ4A 4FPCA 4PF5A 2SBAA 4FPHA 1CJPA 4ATEA 4LBJA 4P9XA 1WCSA 4M01A 1LHOA 5GZEA 3WG3A 3TB0A 1FYUA 4FOWA 1MS0A 3O0XA 1VALA 4YFZA 1W6MA 5DUUA 2EXKA 4FPKA 3M2MA 1GZ9A 1OKQA 2EF6A 1GZCA 3MW2A 5GLTA 3R4UA 3POYA 3PJQA 1ULGA 5GZCA 1JUIA 1SLIA 4C1XA 2AR6A 1CPMA 3NV4A 3U4XA 2JD4A 4GWNA 2D3PA 2PHTA 3IPVB 4YW3A 3FUQA 5GLWA 2GDFA 2WSUA 3I8TA 5KXEA 3D6EA 1SLLA 1DQ1A 2DUPA
chains in the Genus database with same CATH superfamily
3OBRA 2PLV1 4HPKA 3AP9A 4FPFA 4MGSA 3OGGA 5JPNB 2RR11 1RVF1 1AJKA 4NR1A 1MQTC 2JE7A 4P9WA 1GQGA 1UU6A 2GNDA 5JI9A 2D93A 5JIUA 3J9SA 3H1WA 1ZVFA 5I0RA 1NLSA 2DU1A 2QE3A 3C3VA 2V4VA 3GZEA 1M4WA 4MXWA 1IS6A 1S0IA 3WUDA 2ZKNA 4AVVA 1IQDC 4CP1A 3SLIA 3ZFGC 2VE1A 3DF0A 1IOAA 1S1AA 2V09A 4KGGA 1YUDA 5FYYA 1OFSA 3TEZA 1EUTA 4QX3A 4R8HA 1RUC1 5H9RA 4JAAA 4NUBA 4K9SA 1DZQA 2TUNA 5C8CC 2WN3A 3O1SA 4DRRA 1KDKA 1O4ZA 3OUIA 4E9KA 1W28A 4AI3A 2ENRA 2UWCA 3KV9A 4E2SA 5BNOA 4QX1A 4A45A 3WX5A 1QXJA 4D7YA 3Q8BA 1JS9A 1F8VA 4WM8A 4OHXA 1XOYA 1OQDA 2WLPA 3E5XA 5IYYA 2A3WA 2NPIA 3WNMA 4ZKTB 1NCQB 2FCVA 4HFSA 3LFIA 4R9CA 1AVBA 1E57A 5AC92 5IAXA 4AHWA 5A6YA 2JB8A 2E32A 5F8PA 4AEDB 3KZ4C 4A41A 3O1PA 3LIHA 4TWTA 4Q1PA 4OUEA 1WW7A 4WM7A 5JOYA 5B4NA 2B45X 1FV2A 2H0VA 3LQCA 1DGRA 1EV13 1H1MA 1W8HA 5F2SA 5FR3A 2Q30A 4RD7A 3JQXA 3WW3A 4MVTA 2ZACA 5CZKA 1ZRIA 3M3QA 5K7PA 4DOUA 3LDRA 3MF9A 1GOHA 1W8WA 3QCWA 1SCRA 3VKFC 4URAA 3JD73 4ZXKA 1OURA 3C7EA 4IGPA 5L7OB 4Q4Y2 3JB8A 4EN7B 2BWCA 3JXSA 3NNLA 2HWE3 3LFMA 4CCDA 4LKSA 3ZPOA 1E5HA 2B46X 1HW5A 1BVP1 2DWRA 1IPJA 1RUH3 1UIKA 3MUZ1 4K8FA 2DCZA 1NCQC 2J7MA 5DG2A 1X33A 2VY0A 2DVGA 2JXAA 3CMGA 1PGW2 3D3AA 5FY1A 2DDUA 3UV9A 1X9PA 2PMWB 3GALA 3THTA 2GZWA 5FP7A 4EN6B 2B4KA 1GUIA 5L19A 4CCNA 2WO1A 1I3HA 1S0EA 1CQ9A 4Z8BA 1K5MB 3UL2A 3UKNA 4CCMA 1SLCA 2DTWA 3TAYA 4XC9A 4DS0A 2QVSB 3C2UA 1PO11 4ISQA 4MADA 4BM8A 4OMDA 3AL5A 3UETA 2IXIA 3NAPA 4JTOA 1RUE2 1VBB3 1S2KA 2CGPA 3N7KA 2FDJA 1LCLA 2AACA 1JZ3A 2JIJA 2VQUA 4LQRA 5LY2A 5J37A 2AUYA 2PFWA 2VJXA 5AFEA 3WDUA 1F4AA 1AUYA 1TNRA 1U5ZA 3GM8A 3IPVA 4GWIA 3C7OA 4YZ3A 3A21A 1RMU1 4QPYA 4X6QB 4J1XA 1UY1A 2IZWA 1W3VA 1WLDA 4LR4A 4QPWA 2VZSA 4RSUA 4AI1A 4XJZA 3BIWE 3VBUC 5KC6A 4GB31 2IVJA 3FLPA 4ZY9A 2WZEA 3V0AA 4RS5B 1OF4A 3I3MA 1O3SA 1O5UA 1YFUA 3OEBA 5D2AA 1LOFC 5FK7A 1RTVA 1H6YA 1VBD1 2JWPA 3GZUC 3WF4A 2CU5A 2QZ3A 4Q5OA 5FFOC 2QDNA 4EWEA 4CVUA 1K5MC 3USUA 4YM2A 3WCRA 3H3ZA 1OOPA 4MH0E 3VDBA 1WMFA 2JKXA 2VD7A 5AVPA 3ZXEA 2D6KA 2QQIA 3KCXA 2IFWA 4AXOA 4LKFA 1H30A 1L3JA 1QOTA 1Y9GA 1ENXA 3NL1A 2XVKA 4GZ9A 5SV5A 2V5DA 5CADA 3NRUA 1C8M3 5BPXA 3WNKA 3E5UA 1IPKA 3MICA 3AYEA 1CZSA 2XLAA 5FLJA 1BZWA 3ZSKA 4D7SA 2E7QA 1UXZA 1WCUA 2I07B 4N9HA 4YG0A 2XOMA 1R081 1V00A 2R041 3WLUA 1AX2A 4QB2A 5JR2A 2W1SA 2Y6KA 1VBC3 2OZJA 4MHRA 4Y20A 1LOAA 5I93A 2FCTA 5F5CA 5CG8A 3F95A 4HSLA 1NLRA 1BHGA 1CONA 4U36A 4RS5C 1EV12 1UN1A 3WEZA 3WF3A 5D21A 1LU2A 1H9PA 3N9QA 1YJKA 1YQ5A 1GLHA 3FN9A 5FPBA 3U37A 2Q5TA 3WINE 3V56A 3JD72 2VZTA 2W39A 5EWSA 4JKKA 5BNPB 2BGOA 1UQXA 1ULPA 2HWE2 4D6RA 3E6CC 3IMMA 2BVBA 1XU2A 3B5LB 1AR91 1RUH2 1UZWA 4CZSA 2BVVA 4HL0A 4WVZA 2OW4A 1UZYA 2ZX2A 3O0VA 4LO7A 4P5HA 4QGNA 2DFCA 3J7MA 3APBA 4EYUA 1QF3A 3G6JB 3KV5A 4XVHA 3W59A 4BQ5A 3H8RA 1T6GC 2K0GA 4QQ2A 5FZOA 5IVEA 2UYAA 2YBPA 1OH4A 1FNZA 4NAMA 4MYEA 4XDPA 1UOGA 3DV8A 4AVSA 2BFUL 3I7DA 1UU4A 4BIFA 2D3SA 4Q4W3 5F6LB 3TEXA 3VD3A 2HYKA 2GH2A 3DXUA 5CBLA 3RQ0A 3BUCA 2BNOA 1W6QA 3MI8A 3QLQA 4GMP0 4XQDA 1RHI1 2D43A 1NE6A 3WDVA 1PO23 4AG4A 1AYN2 3BB6A 1VBB2 3FUOA 2V5YA 4OMCA 2JD9A 3OYWA 4AVBA 2XPJA 3R4SA 1FI2A 4XF3A 1PGSA 1BCXA 3WF0A 3ETQA 5BNPC 3G7DA 1POV1 4A2UA 1YRZA 1DU3D 3H0OA 4H7LA 4Y22B 4QD2A 3ZXDA 2ZGKA 1HN1A 3PMEA 4CCEA 4I02A 1U5YA 2CY6A 4YVWA 5FWJA 4N53A 2E6VA 3EYPA 2UY9A 1W8ZA 3ES1A 4XILA 2WUHA 4AGRA 4BLJA 4R4XA 1GNZA 2WT1A 1QMJA 2VL4A 2DBIA 4N43B 5FZGA 2WWUA 4LT5A 1LHVA 2K46A 1Q3EA 2Y64A 4NWVA 4QHOA 2DURA 4RQPA 5FYIA 2G4IA 1OHFA 2VCAA 3GCWA 2WDBA 5SV8A 5ACA1 4P9YA 3PUHA 5IFPA 3PUAA 1UYPA 3AB0A 1C8M2 1BMV1 2R0HA 1F2NA 1UPIA 2GP5A 1Y9QA 1OBNA 1F15A 3C8XA 4TTGA 3LEIA 4JRLA 4Q27A 3L9JT 4CYDA 4TYSA 1UX6A 1VAMA 1UPSA 3Q8CA 1PIV1 2XJRA 1QJU1 1X36A 3KS7A 4XJ8A 4OI4A 1ND3A 2R6QA 4UF0B 5F32A 1LB2A 1OPOA 5FUNA 1XXNA 1VBC2 3FX3A 1UOJA 3P3NA 1YI7A 5IWFA 5KHJA 3PURA 5LA2A 4W8JA 3BI3A 4YGDA 2FBEA 1AHSA 1D2SA 2ZA9A 5F2WA 1CESA 4MGIE 4LBLA 4IEXA 3T0AA 4Q0QA 5DABA 5LBFA 4PF1A 2DYCA 1O4YA 1XJAA 4MGQA 5FAXA 3NJXA 4NIDA 1EAH1 2DVBA 2YV8A 4XCAA 2Z2SB 3ASIA 2O8QA 3K3NA 4HANA 4HVQA 3KQ4B 2IXCA 1HLCA 4BCUA 2HWD1 2WFF3 5A1AA 2VOVA 5AVAA 3U1XA 1HRI1 2YU1A 3ENRA 1I5ZA 4OI2A 2X5IC 3U4SA 5BNNB 1VP6A 1TMF3 5GZFA 3WY6A 4COVA 3B3QE 5JVVA 1VIWB 4Q0SA 5JZGC 2XJPA 2VCMA 4QPIC 2YPJA 4W6YA 2D6OX 2JEMA 1J1TA 2XONA 3AC0A 4HKLA 4S2FA 3OY8A 5FZ1A 3T4VA 1VBE3 3VBRB 4QAWA 2L9LA 2VAUA 2X53S 4DXRA 4S2GA 1N3OA 1QHDA 1NY72 4E4DX 1YLLA 1KRIA 5LRRA 1W9FA 3MPBA 4PDWB 2ZKLA 4RHV3 4Y24A 5F3GA 1SCSA 1WUVA 2WWSA 4IESA 5C3QA 2ADEA 2VR4A 4LE3A 2JECA 4QQPA 5A33A 3SH5A 2AYHA 3O5SA 4Q4W2 5JOXA 2YROA 1NCRC 2HKXA 3POFA 2VU9A 1YCIA 2VH9A 2XR4A 5FPUA 3V0BA 4Y3OA 1PO22 1SLBA 1WCQA 2NQYA 3PVNA 1W0PA 4RYDA 4Y1YA 4DEQA 3MLJA 3ZYRA 3ZVXA 2A3XA 4XXAA 4O9GA 3KT4A 5CU1A 4TLGA 4BQYA 4IL7A 4YZ1A 2FHRA 4A7ZA 1RUNA 1ZM1A 4LA3A 1W6PA 4QXCA 4MXWB 2ZGSA 5BNNC 4AFAA 1C1FA 5L73A 4A6OA 4HN1A 5CB7A 1QXRA 1NA1A 3HT2A 4CDUA 5J09A 5F39A 3DUIA 1FAYA 2AEYA 1GANA 4JCKA 3VBRC 3N7JA 3EO6A 4R4ZA 2QQPA 5C4WA 4NRQA 4CCOA 2JDKA 1JYNA 2PAMA 1LEMA 1W90A 2D3RA 2ARXA 4B4QA 5BNOB 1VRH1 2D6MA 2WC2A 3WCSA 1LJ7A 2AENA 3H7JA 1GWLA 1ZX5A 1QEXA 5K4LA 1GP4A 4IV3B 4AQ6A 5A32A 4UFKA 4ZHNA 2BU9A 5FUIA 1OSGA 4JKLA 4UW6A 5LK5A 4C0BA 5EHDA 1POV0 1GQHA 2VBBA 1XPWA 4J6GA 2VVEA 2WABA 3VD7A 4AE2A 1QJZA 4BMEA 1QOSA 2CDOA 3GDBA 5CIRA 2ZXQA 2BV4A 1GNHA 4NE9A 1W6OA 2E33A 2P5BA 2VGDA 1RUJ3 4WM7B 2WJSA 4OI0A 1NT0A 5CNAA 3EXUA 1HB2A 1F5JA 1ZRRA 3HNMA 1VAVA 1B35C 3RWNA 3RGBA 4ZZ8A 2W08A 4HN0A 4P5YA 1LENA 2CHHA 3E6DA 3ZKYA 2RDRA 2VECA 4ARYA 5FUPA 3VD9A 4PJYA 1XYPA 2GALA 2ZGNA 3JCIA 2F17A 4XF9A 4NIAA 1XC6A 3M7AA 5J3UA 5L9VA 3ZYFA 5CAZA 2PAEA 3S57A 1XE0A 4A44A 4ET7A 1PMJX 1WZXA 4QKNA 3NQHA 2WLQA 5BNOC 1W9YA 3AVRA 3KD4A 1Z78A 4OUSA 4XFFA 1AF9A 4IV3C 4GKYA 3ZYJB 2ZHMA 3SISA 2VMHA 1NX9A 1NKGA 1RUOA 2RS11 1W03A 2WFF2 3VL8A 5C3RA 1CGPA 1OXCA 4RL7A 1F35A 4XZUG 1BVVA 3ZN4A 1TMF2 4PLMA 4Y1XA 1STMA 5EP9A 2A6WA 3JB4C 4PF5A 2ZX3A 1V9U3 2Y6FA 2SBAA 1CJPA 1J1LA 4YARA 4P9XA 1VBE2 1V0AA 3N9OA 5GZEA 1ALYA 3WQ0A 4QWNA 1VALA 4YFZA 3ZIWA 5KHKA 5DUUA 3NAPB 5EFUA 3O1TA 4RHV2 2W95A 4KQ7A 2XKPA 2YHJA 3POYA 3PJQA 3FHQA 4Q4X1 3KVBA 4C1XA 2WA4A 3NKGA 3U4XA 3VZNA 3QOPA 2JD4A 3IPVB 2R061 3VBSA 4YW3A 2RS53 2J1AA 5GLWA 3RZJA 3NJYA 1DZRA 1XNDA 5KXEA 1DQ1A 1W2NA 2WQ4A 3ZFEA 2QNKA 2Q8CA 5IJRA 4FOYA 5EJ3A 1JI6A 1EUUA 1HV1A 1W04A 4YPJA 1IS4A 3IAQA 3B93A 4Z82A 3K4AA 5JLVA 3V0AB 1RUI3 4MLOA 1WGPA 4OZXA 4EN8B 1AR63 1UYZA 4NROA 3JBG3 3NJZA 2OXBA 4BK4A 5I91A 2P3YA 2LM3A 3EB7A 3FBYA 1H1IA 2WZPP 3N4MA 4CCKA 2NP0A 2WL1A 3GGLA 3AXEA 4XE9A 3USUB 5F3CA 3BVCA 4PIZA 2CAVA 4LJHA 3E5QA 4JGYC 5LK7B 1BYHA 4PBOA 1A8DA 1W8FA 5LA9A 2J1VA 1DDLA 4NMIA 4FXKB 3Q8EA 4QKDA 5D8AA 4DPNA 2DTYA 1CX4A 3VDDA 3AKSA 1UNBA 1Q8OA 3BPZA 4WVWA 2GAUA 3IB3A 4N90A 3GYDA 1LU1A 2JDYA 2QKDA 4IEVA 4LEJA 3T08A 2ZMLA 2UWBA 3CL1A 4K40A 5GKAC 5FZEA 5K9YA 5LWBA 2WKKA 1VE0A 2WS93 5HCAA 4B7EA 3MIEA 4DUVA 1MS1A 2Y60A 2QFEA 5I8YA 5GZGA 4K20A 2XBO3 2W91A 4E8CA 1W8UA 4Y20B 4AVTA 2PQSA 2X8KA 1R1A2 3VZMA 4YW1A 1NZIA 4P14A 3WP6A 3MIDA 4BISA 3D0JA 3ZLIA 3KF3A 2ZHNA 1YHFA 5AC91 3NNFA 2VTXJ 4LBOA 2Z42A 3RRDA 2C9KA 5FPLA 4CCLA 5CFDC 3J8F2 3BKZA 3ZXFA 4DXZA 2P1BA 1DYPA 2XQXA 2WZ8A 4L99A 2R49A 4FTEA 3UT0A 2RS33 5EYXA 3WT3A 3ON7A 2VUJA 3OPTA 3HQRA 4AEJA 1XE8A 1YQCA 3UESA 4DY5A 4KI5M 2A70A 3RZMA 2IXKA 1ZZ6A 2OA2A 4AF9A 1GU3A 3O14A 3I97A 2TNFA 4XEZA 4LOSA 5FZCA 3FZ3A 2RV9A 5FYZA 1URXA 1QDCA 2BYVE 3GHMA 1ZRFA 3ROUA 1NXD1 2WZR3 2IXHA 3BOPA 3KSCA 2WNUC 4Q4Y1 4OQ8A 1LOEA 2ZCWA 4CU8A 4XFHA 4CCJA 1ZA4A 3B01A 3A22A 4YYOA 5H9QA 2BQPA 2P17A 2EIGA 3AP7A 3I2GA 5FYCA 4X6RB 5LBBA 3M1HA 4XFBA 5BV6A 4CCCA 3T1LA 1V9U2 2JDPA 4FPOB 4FTSA 2E53A 1ENSA 3NNMA 3VLBB 1W6QB 5LW9A 1PGW1 2C1FA 2BRTA 2RM23 3N9MA 4OYUA 4FO9A 3CEWA 4XUQA 3ST7A 4XJAA 2QQJA 4D94A 4F83A 2VNGA 2VZQA 3WVJA 4CUGA 3O1RA 2P2KA 1OA4A 3O1VA 1N3PA 1OVPA 2I2SA 3OYWB 3H3UA 5ISLA 1Z7S3 2CV6A 1RUF2 1ULEA 1YEWA 4FOVA 1AR73 1K45A 1RXGA 4XF4A 3T1MA 1UD1A 4X8PA 2VXJA 1QQP1 1H2MA 3FJSA 4YG6A 4B4PA 2RS52 2VC9A 1QWRA 4KWLA 4N53B 3KV4A 4QHZA 1PM4A 1BK0A 1H2LA 2PYTA 2VTXA 4AHZA 3SMHA 3R0RA 4CDXC 4UFMA 5IVCA 5FYUA 1RUI2 3H1MA 2C6SA 1MZ5A 2WSVA 3UGGA 4CEYA 3POEA 1AR62 2ZHLA 1DQ5A 1O5LA 1UMIA 1WD4A 1TME3 2WAOA 3JBG2 4NJ4A 4CU9A 3E97A 2WNOA 5HCHA 1CJDA 4KNCA 4XBLA 3T0BA 1SEFA 2LROA 1S0GA 2MEV3 2DBNA 4RQPB 5FCCA 1H2KA 4UFHA 5A3LA 1I1EA 5AFBA 1PZ8A 2OQ6A 2Y0OA 1C28A 2PHFA 2X09A 4AL9A 2BP6A 2G9GA 3O0WA 4LUMA 2IWGB 2DVDA 4XXPA 3TYJA 5HXMA 5CVRA 2PA7A 4LLFA 1B09A 2R071 4AOCA 2ARAA 2CDPA 2ZHKA 4MSVA 5CEHA 1CX1A 4QDRA 4Z2AA 1F4HA 3HOBA 3MFCA 4YW4A 3ZDVA 2WS92 5C3OA 3NO8A 4M3CF 1ND3B 1XNCA 2EVXA 4CTEA 2XBO2 2PHRA 3VD4A 5FZ0A 4N53C 3HIFA 1FPN1 3BYWA 4NIIA 1UOFA 3FE5A 4NAOA 4C91A 2ZAAA 2RHPA 2A1XA 1N3QA 2YG0A 4IEUA 3SH3A 4GXLA 4ZZ5A 1W99A 1RUD3 2AH2A 4FPYA 2MNGA 1DZTA 4BJ0A 3RZLA 1SBEA 5FYVA 1POQA 2R16A 2QTWB 2AC1A 3USSA 3VBFA 5A6XA 5EIYB 5JSOA 3JU9A 3RJ2X 4LBMA 2R0FA 1XE7A 2RS32 4RQPC 4OI1A 4IERA 3U0ZA 3ZYHA 3EBRA 4UI9L 4CEWA 3DECA 1BQPA 1RXFA 3HEIA 3PVOA 1TG7A 5DDJ1 1EV11 4BXSV 1LGBA 4NHLA 2PLV3 2HEVF 4L97A 4QXHA 3ABZA 1I6XA 1JBCA 1V6NA 2RR13 1RVF3 3OY8B 4ES8A 1UIJA 2BEOA 1MEC3 5HI0A 5FYHA 4MGKE 1UY2A 4GULA 3JD71 5CKNA 2WZR2 2W87A 1MS3A 4XIOA 1CPNA 4YW6A 1R093 2DU0A 3LB9A 2BFUS 3U11A 3F2ZA 2HWE1 3PIGA 1ND3C 2DVAA 4QM9A 3VBHA 3IDEA 4E8DA 3AMMA 5FZ8A 1H8VA 2D5FA 2VTFA 1UF2C 1RUC3 1VB2A 5A33B 5LATA 1YFWA 3W21A 5FRAA 1JODA 1C1LA 1JXNA 3S0MA 1W2UA 2DV9A 2VZRA 2VMCA 4HSJA 4OHVA 3I54A 2GNTA 2VW1A 2RM22 1HV0A 4INDA 1WBLA 4K6BA 1W6NB 4KWUA 3J26N 3WUCA 5C70A 2Q1MA 3AZYA 3V0BB 2Y6GA 3EJKA 4M4PA 4PIXA 1DGRN 3CO2A 2CL2A 5DG1A 3T4HB 4FPLA 4Q8LA 1Z7S2 2CGNA 2G1MA 4E27A 1AR72 4HVRA 3ZXJA 4HOOA 1DLCA 1W6PB 4HT1T 1Q8VA 3MIGA 4WV8A 4TLFA 5FBZA 5A6QA 1G9BA 1A8MA 4FQZA 3M4FA 2FMDA 5KXCA 1OLME 4MHUA 2Q4SA 1NA1B 3HWJA 1J3QA 2VMEA 1S0FA 1VBB1 3M3CA 3O12A 3CZJA 4LHSA 4AEDC 4CDUB 1ND2A 5DUVA 5J36A 3DEMA 4GWJA 5EJ1B 2E26A 1ZBE3 1UW8A 3CJIA 4ITCA 4AQ2A 3VV1A 1IGOA 4E2QA 3I3DA 3IAPA 1J84A 3NKTA 4IEOA 4AQTA 4L92A 4BQ1A 1OQEA 1UZZA 3VD5A 2Z5WA 4A6SA 4L0PA 2YU2A 3K46A 1TME2 3K75B 5FMOL 4CP9A 1AYN3 3MW4A 5A32B 1GOFA 5B2GB 5A7PA 1JZ5A 2MEV2 1JZ6A 2WBKA 2VUAA 3BU7A 4CDQA 3RZHA 3P1IA 1AL21 2A7AA 5FZKA 3WZ1A 1PGL2 4KMQA 3ME2A 5IVBA 3WHUA 5L7OC 1GFF2 2W9XA 3JUUA 3RMXA 3W5NA 3AFGA 5K0UA 2HWB1 2KR2A 4GMP3 4P9JA 3GF6A 2J1RA 2EIDA 2JG8A 4O61A 4UW4A 2SLIA 2XJTA 3KV6A 3AK0A 3SHRA 1GYKA 3A23A 3MYXA 1ULOA 4GWMA 2E7AA 1NA1C 2LTNA 1GZTA 3R6SA 4CDUC 1PVC3 1H2NA 3I2IA 2KA3A 5FY5A 1C8M1 1DP0A 2J1SA 4NHYA 2UYBA 3PIJA 2GC2A 3N7MA 1RYYA 2JDZA 2P37A 2XWBB 2W1QA 2W0XA 1MZEA 2K2SA 2NM1A 1RUD2 1M06G 1S2BA 3HMYA 5DAPA 5DZEA 3TNPB 4D6QA 3AKTA 4HK9A 1UCXA 3H42B 4XBQA 4COYA 1WW5A 1CZTA 3AZVA 4WZFA 4P9LA 3V65A 5JXJA 1LAJA 3P5BA 4IE6A 2OKXA 1JU3A 1OD5A 1JU4A 2HYXA 2QZ2A 1W0NA 5F1RA 2GMMA 5BY5A 1LR5A 4DMIA 4QX7A 1N1TA 2CWSA 2PLV2 3LPGA 2ZZQA 2J22A 1YIFA 3LOIA 2RR12 4Q26A 1RVF2 1ULCA 1GSLA 3N9NA 3TN93 1MEC2 4KWKA 3VBOA 4BB3A 3GJAA 3TWIA 1R092 2WNVB 1JZ7A 4I09A 1Q56A 3T2QA 3OGRA 3Q8AA 3BGAA 1VBD3 2EXHA 3NJVA 1SBFA 1MR5A 4Y1ZA 3UGHA 1RITA 4PQQA 2GC1A 4FXGB 2PN5A 4QU2A 3SNMA 4JKMA 4CDWA 1J59A 1RUC2 1OI6A 4HONA 5ANNA 4D0QA 4YZ4A 3VBSB 1QKQA 5F6KA 4XUPA 2ZS6B 1UY4A 3LDBA 4ASMB 4BDVB 5FXZA 3H8XA 1CIWA 3B9CA 3BTYA 2MHFA 1TNFA 4DEVA 1VJ2A 4GKXA 3DPRA 4AQSA 4BQ3A 1RC6A 3R4DB 1BKZA 2QQLA 1WKYA 3VUOA 5ABJA 4CP0A 1BBT3 1NYWA 2DCTA 4A7KA 1W9SA 1Q8PA 5JR7B 1PO21 2R32A 5GLVA 2CYFA 4E4SA 4Q4V1 2ATFA 3AZXA 1TQ5A 4I0BA 3HD8B 3MPPG 4BWOA 2GC0A 5HXVA 2JX9A 2CGOA 3HPNA 1LULA 3WF2A 4CXXA 2VZUA 5EYYA 1ZBE2 3T09A 2WNVC 5D8AB 5KXDA 4LA2A 3VDDB 1ST8A 2YDEA 3I3EA 3WXPA 3RNSA 5C33A 1GR3A 2GN7A 1CN1A 1AX1A 2Y6LA 3K51A 3KWVA 4M3CA 4UW5A 3URFA 1XSRA 5HBAA 3OBZA 1RUG1 1JOJA 3DL3A 1EY2A 4YW7A 3VBSC 3UKVA 5JAXA 2ARBA 2RJKA 4PLOA 4KBBA 2VNRA 1IHMA 2Q8OA 1VBA3 2ORZA 5JIAA 2H6BA 4BQWA 4UYBA 5FZ3A 1MVQA 3KMHA 1ZRCA 4ORFA 4CU6A 1ODNA 2BBVA 2ZMNA 2RG4A 1QH6A 3OJBA 1BXHA 1SHWB 3D0SA 5F7UA 5T5JA 1WW4A 1YNAA 1LOBA 3V64A 3L2YA 1WA6X 1PHMA 3BOWA 1U5XA 2RE9A 1PVC2 2ZGMA 4DXSA 1UOBA 1GWKA 2ZGRA 5DZGA 5T55A 1SPPB 4G4FA 1OLQA 3IDAA 5DN2A 1S4CA 3K77A 4ASKA 5D8AC 5FZBA 5BNQA 5KC5A 3VDDC 3S7EA 1DQ0A 2G19A 4IEPA 3ZFFA 5L36A 1G9AA 3GXUA 4COUA 3LA3A 3W20A 1D4M3 1US3A 2E7TA 1J3PA 1FOD1 4AVAA 4OHZA 1IKPA 1PMHX 4OZOA 1YIPA 2JG9B 1POV3 1VMHA 2ZGQA 1OA3A 5JI7A 1N47A 2YC4A 1OMIA 4IETA 2P4EA 3U14A 3LKJA 1HXS3 3TNQA 1H6XA 2LUWA 2LALA 5A7SA 1MVEA 2CAUA 4E4ZA 2Y38A 1GV9A 4IE0A 4IEZA 2WFF1 3TN92 5IVYA 1REDA 5IAVA 4FPHA 5EV7A 3B94A 3I3QA 5IVFA 4M01A 1W3XA 3WG3A 1TMF1 1FYUA 4FOWA 1MS0A 3FMGA 3MLLA 3E6BA 4EE2A 1VBD2 1W6MA 4N43C 3VHOA 3MIHA 4NWWA 2VPVA 1O7FA 3ACFA 5GZCA 4KG8A 1SLIA 1CPMA 2D98A 4RHV1 1QJEA 5DPNA 3LGRA 2VO5A 3WQBA 4GWNA 1OT5A 1SFPA 1UY3A 3A7QA 4NRMA 3ZN5A 2QUOA 3FUQA 4ZU4A 5FQ0A 4Q0UA 5FPXA 3D6EA 1SLLA 1KGYA 5JXGA 3MFAA 3U07A 3Q9OA 4AVCA 2V73A 2Y33A 2JG9C 1W2AX 1QJU3 1XU1A 2PXJA 4CEYB 1XQNA 4BPZA 3A0KA 1OPMA 3ZSLA 1FMD3 2HEWF 1BBT2 5F3IA 3S6PA 1UL9A 4XDQA 4XJ9A 3QH6A 2QQNA 4MOAA 4A4AA 1S55A 4ATFA 3MZHA 3M70A 3POWA 2UU8A 3RI9A 4GAZA 3HR9A 3H8OA 3OBTA 4KWJA 1U12A 1QXPA 2BZDA 4FFGA 5JWPA 4HPKB 2X10A 3POGA 2PHLA 2A5ZA 2VULA 2HBTA 2V72A 5DQ0A 5A3UA 2VMIA 4LNVA 2HWD3 2YB7A 1AR81 1PX4A 3K4ZA 4SLIA 1COV3 3CBNA 2PAKA 2WIIB 3ZKUA 5LRSA 3DXTA 1Y4WA 4Z92B 2HWC3 4WZCA 1SBDA 4IXLA 5A1FA 1QY4A 5KWRA 3O1OA 3WNNA 5DUWA 5LEJA 4FFHA 4QB1A 4CUBA 1VBA2 3DGTA 3UK9A 2W92A 1RJ7A 4XHBA 1DF0A 4ISRA 1DGWA 3ZYBA 5IK4A 3ATGA 3LEGA 4JV4A 4WVMA 3KB5A 3KF5A 1PZ7A 3RFRA 4LTAA 1QOOA 2XUEA 5E6HA 4DZGA 1D0HA 3SCGA 4PDWC 3VBFB 1PNGA 3E1F1 3AJZA 3KQRA 3VL9A 3B00A 1JYIA 5ERLA 1FV3A 1LNSA 3ETPA 4WM8B 4Y5TA 1FATA 1RUJ1 4UOJA 2QJVA 3AZWA 2HWF3 3ZYPA 3VBUA 4CEWB 1YQ2A 2G9FA 5IVVA 1X8EA 1T6BX 1QIQA 2JENA 3GZAA 1J83A 5JOWA 1E5IA 2XMLA 2BUKA 4IDZA 1TEIA 5LCWL 1R1A3 3RVHA 1D4M2 1K5MA 1S0CA 3WQ7A 4LO4B 1KS5A 3OEAA 3ZYGA 1H8TA 4O65A 3ACIA 4NPMA 2Q8DA 2BWAA 3KCCA 1FXZA 4OUMA 3CNAA 5F5AA 3ES4A 1CAXA 3J8F3 1JYCA 3ZXGA 4WBBA 4YW2A 2ERFA 1VRBA 3VBHB 3PVBB 1G9CA 4TSVA 3WF1A 3IDCB 2AZ5A 1HXS2 4FVVA 4JVAA 4CRQA 1C4RA 3FHAA 3HN1A 2QDRA 2C4XA 1REFA 4UFIA 4FFFA 2VOWA 2Q1FA 1UX7A 1DGLA 3IDBB 2RDNA 4Y1VA 3BIEA 1H1AA 5FTTC 5T5LA 1E5RA 1KQRA 5C5UA 3JZVA 2AEZA 3T30A 4R9DA 3VBFC 1US2A 3KHCA 3GJBA 1KJLA 3NVCA 5FY7A 1SQ4A 1UYYA 2OIIA 1SLAA 1V9U1 2ZEWA 3GBWA 4WM8C 5IT6A 2VW2A 1QJY3 3AX4A 4BH9A 2JJ6A 2XHNA 2WQ8A 5C7GA 4OLLA 4XMIA 1X50A 4L11A 4YLZA 1ZBA3 3ALQA 3EMRA 3FWEA 3HJRA 4N8MA 1W05A 4QT6A 3WDXA 2W52A 4XJWA 1ND2B 1YXWA 4LK6A 2ET7A 2ZBJA 4MZUA 3UKTA 3ILFA 4EWDA 5HPOA 2JDHA 3CJIB 3I2OA 4WM7C 3SH4A 1EPZA 3W5MA 2B42B 5EXOA 2YBKA 2Z69A 1HN0A 1QJU2 2YUEA 2RS51 2BOJA 4L2NA 3VBHC 3CHXA 1FMD2 4CP9B 1FT9A 3OGVA 2PHWA 1KDMA 4FP3A 4GD4A 1IS3A 4QKBA 1AYM3 2ZGUA 4R52A 3HNBM 4L9BA 5FOJB 3P3PA 1RUF3 3QD6A 1JN2P 3AKQA 4YVSA 3WW2A 2VQTA 3INAA 3LEKA 5TSWA 5K0UB 2IFRA 2WR9A 1QJX3 3JBG1 2EALA 3DCQA 1D0GA 2JG8B 5CG9A 1NLQA 3ILRA 2VUDA 2WINB 1X7NA 4XCBA 3RJRA 5A7OA 5FP4A 3H1YA 2WQZC 2UWAA 5IVJA 3PUSA 4IE5A 2RS13 5FYBA 2HWD2 4I0WB 1DGWX 4F8AA 4LITA 5FP8A 1COV2 3FBMA 4ZS3A 3OGJA 2NN8A 2HWC2 1JW6A 3VZLA 3ACGA 1IKQA 4E4HA 2XG3A 2D7FA 3HAGA 1O4TA 2ILMA 5KHHA 1FX5A 1HJFA 1ND2C 2AGSA 4FFIA 4SBVA 2I74A 4FAGA 1JOPA 2KM2A 1MS5A 1KFXL 1ZZ8A 1GNYA 2OQ7A 5CFCA 2LS6A 3CJIC 5C3PA 1R1ZA 5JUVA 2O1QA 2WYFA 4YRDA 1OOPB 3ZXKA 3DYOA 2D5HA 2ES3A 4QB6A 4I30A 2WS91 3H50A 3THCA 3VDCA 5EPAA 2XBO1 3NAPC 2QQOA 2VMFA 4XACA 5FZ6A 1WLTA 5E8AA 5KHGA 3PNAA 1BEV3 1LHUA 5FO8B 3LCPA 3IMNA 2H0BA 2W3JA 3DYPA 5DAVA 1SZBA 1DCSA 4HKWA 4IEWA 4GH4A 2ZGOA 4RR3A 2HWF2 4K21A 4XF0A 1UKGA 2XGXA 4BLIA 5JMOA 5K0UC 4NIGA 2X05A 5FMBA 2JG8C 1O6UA 4JHZA 5FWEA 2RS31 1LHWA 1YO8A 3Q8FA 2FDKA 3VBOB 2JDAA 4RGAA 3KVAA 3W9AA 1HKDA 1ONAA 2JDUA 1HJGA 4QX8A 3I49A 2ZAHA 2ZOEB 4M0NA 2PHXA 4B3NA 4HZFA 4XYXA 3BTZA 1C57A 4KG0A 4CDWB 2DCJA 4OCTA 4C1WA 1OOPC 3B9IA 2VCCA 2QQVA 3VKOA 5I0SA 1OD3A 4LPLA 3N9LA 4AI8A 4RA0A 2ETEA 3UGFA 1ZRDA 3QACA 4RFRB 5DAXA 3T2TA 2J1UA 4HBNA 1RGSA 2DCYA 1V6MA 2PQQA 5I8TA 4PI2A 1XYOA 3DPRB 2VW0A 3T2PA 3ZPYA 1JZ2A 1V6LA 2P3KA 2BDRA 1QJY2 1XYNA 2B5HA 2Y6JA 5ABJB 2RM21 1WMEA 1CR7A 1L7LA 3WOGA 4PBPA 5FZOB 1YFXA 4EN9B 2VZOA 5FLHA 2WYSA 5GLUA 3AJYA 1ZBA2 3IM0A 5IFTA 1QNYA 5A3NA 4KU7A 5J7MA 1IG3A 1SFNA 4UT5A 4M4RA 3WD5A 1CAWA 1Z7S1 3VGIA 4YG3A 3VBOC 5FMCA 1JMUB 1AR71 5LBCA 2VVDA 1DLLA 5FMOS 5IK5A 3IIIA 1EP0A 4PCRA 2I45A 2X5IA 1DYOA 4META 4CU7A 1K42A 3EQEA 4BU2A 2XL7A 1UO9A 3HBZA 3ZMOA 4C0HA 5JZGA 4QPIA 2BPA2 1PMIA 3OUJA 1RINA 4IEQA 4M3CB 4NVPA 3ZN6A 1C5IA 1AYM2 4QGLA 4BYYA 1TE1B 3IT8A 4I3PA 4EV0A 5DUXA 1Q8QA 1NQJA 2P6CA 4ZU5A 4IGQA 1MACA 4BXFA 4XURA 3J4UH 3PLQA 3WSOA 1OFNA 2RMU3 3WG2A 1ASJ3 1QJX2 1N1SA 1GKBA 3OPWA 1RUE1 1S0DA 5D1IA 2XJSA 4FP2A 5LZ6A 5A3PA 1CVNA 1W2TA 5LB6A 3POIA 1AXYA 4YVWB 3ZM8A 2MEV1 1MS9A 3D8CA 1X9TA 3OTFA 1PGL1 4LO6B 5L9BA 4AAPA 4D7TA 4EZ4A 5L9RA 2RS12 4MXVA 3LSEA 1NCRA 4LK7A 4BMBA 5FP3A 2W5FA 2EA7A 2VMGA 3TEYA 4YM3A 4LMFA 1SACA 1NUKA 1ZZCA 1NQDA 2FQPA 4KGQA 2WA3A 2YYOA 3MBWA 4LO5B 4XIKA 5CYYA 1A3KA 2XDVA 5FPVA 2FDGA 2FCUA 3I2DA 3C7FA 2VCBA 5JDBA 2E63A 1RL3A 1YFYA 1Y3TA 2IXLA 2TEPA 1GMMA 2UURA 3MHZA 5C9AA 5A7WA 2J1TA 3ZR5A 1H0BA 1DQ2A 1WCKA 2OT7A 3ZFFB 4Y5SA 3RYKA 1DHKB 5A6ZA 4XQ4A 4UBGA 4XHXA 2IVIB 2Q0AA 1F31A 2XJUA 3S5QA 1WMXA 4XW3A 1BEV2 2YGMA 4OHWA 1KFUL 3SEEA 4G9SB 4HMZA 1HRV3 1GWMA 1NZCA 3OGSA 5FK8A 5FLIA 1RB8G 1QQP3 2HH9A 3OOXA 1RUD1 4F7ZA 3UNPA 3BPSA 1LECA 1WLCA 4FPEA 4LIUA 5IW0A 3D5OA 3S5AA 2YFUA 4HKOA 4YVWC 5A7NA 4C8DA 1JYTA 2YC0A 3H7YA 5FZAA 5LASA 1NG0A 4BE3A 3MIBA 1O8PA 2GNBA 4K1ZA 1VMJA 3AZZA 1NOVA 3NW4A 4AK3A 1VPHA 2A71A 4OHYA 2C5DA 4N9IA 1W6MB 3SXWA 3TEWA 3MDPA 5KHIA 1ZA7A 3FC0A 4NHMA 3HQUA 1AX0A 2GP3A 1CZVA 1V70A 1MEC1 3KGLA 5FXVA 1GZWA 1W06A 2D6NA 4YGEA 4RN5A 4AFMA 5C3SA 2OX0A 4AR2A 1F5FA 3DKWA 1R091 3KHBA 4IV1A 2BOIA 3CLPA 1VB4A 4JX0A 3RS6A 3ZFFC 1B35A 4W6XA 4PHZA 3VKNA 5FQ0B 3LSDA 2HJIA 2R073 4UXAA 4KBZA 1ZNPA 4P9IA 4QKFA 4ARXA 2A73B 4HXCA 3OBAA 1OC1A 1APNA 4XJUA 4Y4YA 5FYMA 4QX2A 1LGCA 3WNLA 5FY0A 1XB9A 4GJYA 2EAAA 1IPSA 5J1XA 4LE4A 4Z07A 1FPN3 5C71A 2CWMA 4R9AA 4IV3A 4A3XA 5FZFA 3SKJE 2RJ2A 1RUH1 3AYCA 3LDKA 2FZ2A 3K3OA 4I0AA 4COWA 5FZ4A 4LHLA 1V6IA 2W46A 3NV1A 4YM0A 1AJOA 4LORA 1JZ4A 1N1VA 5FZHA 2W94A 1L7QA 1K12A 4DNYA 4EZHA 1V6KA 2BGPA 4AFCA 2XVLA 4A7YA 1ZBE1 1REEA 2NMOA 4G3YC 1W39A 4W65A 5DDJ3 3SITA 5C8WA 1W8NA 4XAAA 1PNFA 2ZX4A 4DXTA 4RGGA 5FO7B 1HX6A 3C7HA 3LA2A 4HVOA 1XBFA 4Q0PA 4ES9A 2RMU2 4JDMA 1ASJ2 4XF1A 1OVSA 1AYN1 3K48A 4EQVA 3VKLA 1J58A 1UAIA 1Q5OA 4WVMB 5A3OA 4Y4RA 5C4WB 3GBFA 4W50A 1LGNA 5KR7A 1W8OA 4JQRA 5E88A 5A7QA 4GMP1 2NMNA 2ZZJA 2IC1A 5IK7A 1PZ9A 2D97A 4P9GA 3N36A 2A6VA 2Q8EA 3LOBA 3RYRA 3VBUB 3I59A 4C90A 1OUXA 2YGLA 2WO3A 4XETA 3DKQA 3UYJA 2XH6A 5DAWA 5JXIA 1SLTA 1PVC1 2ET1A 5A3WA 4P08A 2R7EB 4K8RB 2YXSA 1W6OB 1SDWA 3FFQA 2DUOA 4QGMA 5K8SA 4JGZA 1H8TB 5FIXA 2GNMA 2XKOA 4LBNA 4JGYA 4N7IA 5B4XA 2PHUA 5FZ9A 1HRV2 3ZMNA 1HQLA 1OF3A 5FKBA 3OPZA 1QQP2 1CAXB 2P6HA 3ZSEA 2WNEA 3FLTA 3GNEA 4LBQA 1CAVA 4Y1UA 4LIVA 4BA6A 3N35A 5KXBA 1ZZ9A 1JH5A 2P3IA 4XUTA 3RG0A 5C4WC 4AAXA 5G05L 2DFBA 2VMDA 5DAQA 4B7KA 3LA7A 1DQ4A 1PO13 3K2OA 4BQXA 1JYWA 1UXXX 1I9RA 5FDBA 4DINB 1YC61 4ATEA 3DYMA 4LBJA 3O1UA 2ZEZA 1LHOA 5FV3A 3IWZA 4A42A 3CF6E 1VBC1 1P8JA 4FSJA 3LF7A 2EXKA 2PTMA 2TBVA 1AL23 3M2MA 4FPKA 4UWDA 3TN91 1GZCA 3MW2A 3THDA 1UZVA 3LZZA 5E16A 1ULGA 3LPFA 2HWB3 5CFDA 2BW8A 1HQNA 3M3IA 3NV4A 1VMFA 1RMU3 2BNNA 5JXHA 3PTYA 2R072 4QU1A 3SEPA 1H8TC 2KD7A 2WSUA 3C7GA 5BXXA 3I8TA 2A6XA 3S30A 1O91A 4GB33 2DUPA 2C9AA 4XTMA 4NPLA 4RGKA 5H9SA 2DVFA 4AW7A 3PMSA 4KL1A 4QQOA 1PK6A 4D6SA 1W2OA 1BK1A 1FPN2 2GMPA 5GJ6A 1ULFA 1LODA 3D4KA 3PUIA 2FDFA 4XDOA 5A80A 2WNUA 1AZDA 2B39A 1SG3A 4YVSB 1DG6A 1NY71 1DBNA 2JB4A 5G04L 4DQAA 2E9QA 2EIEA 1BBT1 2WT2A 4AFBA 3OB8A 2Y26A 5EZWA 1ENQA 2LRPA 1KJRA 2ZGLA 1JZ8A 4GA9A 3ZFEB 5F5IA 3PHMA 5F3EA 3GCXA 3T3YA 4AI0A 5FO9B 3ILNA 4AEMA 5EQUA 2EICA 3ACLA 3NNGA 4Q4W1 4LXLA 5DDJ2 1CAUA 1R083 1IQAA 3MUY1 4DO0A 4QPGA 3FLRA 4FPGA 3MIFA 2RVAA 3POSA 3VZKA 2R043 2VBPA 3PL0A 2QQMA 1CIYA 1QH7A 1QDOA 2B9VA 2R1DA 4O7XA 2ZEXA 4OVEA 2GSYA 4K1YA 3TOJA 3OUHA 3WP5A 3ZR6A 5CFCB 4LKDA 4XZPA 3CU7A 3L2HA 3ORJA 2QQUA 2XL9A 2X29A 3LEMA 1VBA1 2BGCA 3RSJA 4UFLA 5KBFA 4V1PA 4S2DA 1OLRA 2VM9A 2EAKA 1LRHA 4XMAA 3ZDSA 4AGVA 4RR3B 4GH4B 1WWYA 4YVSC 3X29B 4CDXA 4YGBA 4CPBA 3UJQA 4FBFA 3PJYA 3WG1A 2VOKA 3CJXA 4NPRA 2WN2A 1U0AA 2B8MA 2DUQA 3WR0A 2BNMA 2HBUA 4A3ZA 2W47A 1VLNA 3KLSA 1WBFA 3ZFEC 5LA0A 1I5PA 3WDWA 4NHXA 1AR93 1EYBA 3AP4A 3ZSMA 4ZPIA 1TZOA 1LEDA 5LEKA 4AYUA 2FD8A 4FTBA 3WV6A 4NO4A 4J1WA 1GP6A 2XWJB 4H2AA 2OYZA 4LKEA 3HN3A 3B69A 2NLRA 4XAEA 2ZMKA 4Q4V3 5GLZA 4P00B 1D4M1 1SFYA 4XOGA 5CFCC 3WNOA 3CKHA 4XBNA 1W0OA 2K9ZA 4XUOA 1LESA 5T54A 4B4RA 1J3RA 1AXZA 3VKMA 5CA6A 1MQTA 3IN9A 4PT6A 2ZEYA 3NNJA 5F9TA 1ZZBA 3R05A 3M3OA 4WVVA 4HLTA 1G9DA 1PO12 1RHI3 5DXDA 1GBGA 2D40A 1U5IA 1HXS1 1NXMA 2OVUA 2B7YA 1WCDJ 2PHDA 3A4UA 3AXDA 4N7UA 4Q2FA 1G8WA 3AP6A 1K3IA 2DF7A 5I0TA 3ZFGA 4D69A 2XVGA 2R1BA 4RR3C 4GH4C 1RUG3 5ANQA 4F3JA 3ZO0B 1AL22 4XFCA 3AFKA 5C8CA 3IIAA 3WP3A 2Z4FA 2HWB2 2VZ1A 1XNKA 3OSDA 4IE7A 4JTNA 3QH7A 5FJKA 1RMU2 1CAWB 2ZGTA 2RDQA 3SKVA 1Z0HA 5JSPA 2IUWA 3AL6A 1H4GA 3AMQA 4FOQA 2W68A 5J48A 2X5IB 1NE4A 4GB32 2JIGA 4DUXA 3U78A 5JZGB 5FMDA 2P34A 4KU8A 4QPIB 5JOZA 3ZN6B 4R9BA 3B7MA 2XLFA 4AHYA 1NAEA 4GQ7A 4URTA 3RZGA 3HQXA 1G9FA 1WA4A 2VVFA 1VBE1 1GOGA 4NIHA 2WO7A 4QX0A 4YW5A 5ACA3 4LHNA 2QQWA 1FMD1 1MZ6A 3FL7A 3NV3A 2YFZA 3AKPA 4XFIA 5BUVA 2Y8KA 1HQWA 3NV2A 1FOD3 1S0JA 2XQRA 2WFPA 1YQ6A 1ZYBA 5FZMA 3NWKA 4LBQD 3VHPA 1NCRB 4M00A 4M3CE 3WNXA 1A34A 4ZS2A 3RZKA 1PIV3 1R082 4HETA 1QJFA 1XNBA 2B9UA 1KXGA 2G9ZA 4H7MA 3PTRB 4GALA 2R042 4YNIA 5JPMB 1G86A 2IXJA 2QQKA 3I4IA 4I3GA 5FZLA 1V6OA 1S0BA 4LOTA 4AZZA 5FREA 2XJQA 1UMHA 2VNVA 2VZPA 1COV1 3EHKA 4ONUA 1NCQA 2HEYF 3ZX7A 5C9AB 5A7WB 3ECQA 2HWC1 3WNPA 4Q8KA 3T2OA 3JQWA 1A78A 3LE0A 1X8MA 4PI0A 3OCPA 2CSGA 4AEDA 4BK5A 1EAH3 2JKBA 3OG2A 1O3RA 4DB5A 4QXKA 1SDDB 4V2VA 3GBGA 2YY1A 3I2HA 2ZX0A 1GQPA 3CQOA 1YQ8A 1HRI3 2GC3A 2GMEA 2VXRA 3D82A 3H3LA 3S7IA 4DY3A 4K7JA 5DZFA 4AHXA 3CZUA 2VG9A 1OH3A 4TXWA 3AMNA 2E51A 1XNTA 3RDIA 1MPXA 3PVEA 3I3BA 4FI9A 2OPWA 4P02B 3AM2A 4XFGA 1AR92 2HWF1 2ZABA 4LO8A 4UAPA 5FY4A 5IUQA 4YSFA 1YJLA 1DIWA 3WDYA 5L7OA 4XPVA 3W58A 1W6NA 2P3JA 2VUCA 5F37A 4CEYC 2FDHA 3U75A 2GN3A 4LHKA 4QXBA 3RPQA 2VQ0A 4IGOA 1O59A 2W1UA 1R1A1 4Q4V2 3WG4A 3H9AA 2F4LA 2J1EA 3LAGA 1JOBA 5FXXA 4OFGA 1GZWB 4DUWA 4PLNA 4YZ5A 1JHNA 2YBSA 3N9PA 4AFDA 1XNAA 4HK8A 1LTEA 2WRAA 4COZA 5C9AC 3ITQA 5M0TA 4LULA 3RMYA 4IV1B 5C6CA 1B35B 3J8F1 2D44A 5CKQA 1RHI2 4MV2A 5FYSA 4DRVA 1UMZA 1LOFA 4LLOA 3WDTA 1SMVA 2BJSA 5FOBB 1JYXA 3PDQA 3WHTA 4AWDA 1AR83 3KCYA 4LBKA 1RUG2 1DYKA 2Y34A 5J96B 5A3MA 3SCFA 1LKNA 1WD3A 1IS5A 1N1YA 3KT7A 2XJVA 3FFZA 3FHIB 5IK8A 1KITA 4IW3A 4L8QA 2W2IA 3POBA 1DFQA 4CE8A 3HVDA 3MW3A 3DN7A 4FCAA 1A6CA 1UZ0A 4UFJA 1QJY1 3BU0A 4JDOA 4B1MA 4EJRA 1LOGA 4XTPA 3SC7X 5IATA 3BALA 4BHPA 1LHNA 1QGLA 4YGCA 1VRH3 2ADDA 5FYTA 4CXWA 1TVGA 1ZBA1 2JICA 5GZDA 4CPBD 2XXZA 3A0NA 4YZ2A 4ASLA 5DMYA 1JYVA 2FZ1A 3MF6A 2VZVA 3BN6A 5I0UA 4CEWC 3MO4A 2XLGA 5JCTA 4IV1C 1VR3A 1D7PM 2YMZA 4OULA 3KM5A 4QQLA 3OF1A 4RS5A 5ACA2 5LA1A 3VB9A 2QCSB 3HBKA 4QDSA 2PELA 1OQ1A 3ZXLA 4NHKA 4Q29A 1AYM1 1FOD2 1LOCA 1K5JA 2N7GA 5A70A 4NN0A 3UJOA 1RUF1 1BMV2 1Q8SA 3AVSA 3N7LA 2XHKA 4E2GA 4EN0A 1PIV2 1QJX1 3U10A 1Y7BA 2ZTNA 2ID4A 2JDNA 1IZ3A 2OZ6A 3HT1A 3LWCA 4LUKA 2NZ9A 1UU5A 1UWWA 1AL0G 2CTVA 5FZDA 4CUCA 2FMYA 1D2QA 4Z1VA 4UW3A 5E1RA 3I59B 5FPZA 1KD7A 1MS4A 4J25A 3AYAA 4CDQB 4UBHA 1W9TA 1RUI1 5FBJA 4AI9A 3LD8A 1DQ6A 1JHJA 1AR61 4S2HA 2WWJA 2D6LX 5FJHA 5HV4A 2VZ3A 3BTXA 1WLWA 2W1WA 3VDAA 1ACCA 1EAH2 3PUQA 4CP2A 4JGZB 3TBDA 3VZJA 4TZDA 4JGYB 3VZOA 4ZONA 4CSWA 3IKWA 3ZSJA 3OD4A 2WNVA 2Y0IA 5FZ7A 2UY8A 3POJA 1HRI2 4IUGA 2VOXA 2A75A 2EXJA 2RDSA 3AKRA 4JZRA 4IE4A 2WAAA 4LBQB 1CAVB 2OUHA 1CWPA 2O0OA 2A6YA 4PQ9A 3M3EA 1BEV1 1L7RA 5E89A 1UY0A 5LBEA 3ZOIA 2GU9A 4ZXEA 4EROA 4ZU7A 1ZZ7A 3WQ1A 4DIQA 4QDQA 3P6BA 3BODA 1OUSA 2Y6HA 4QHBA 2VNOA 3SCHA 1KS4A 5BNPA 5FKCA 4CXYA 3M8LA 2D6PA 1GP5A 2Z79A 4B29A 1YYNA 2ZX1A 5HCBA 3RYPA 5A1LA 4Q4X3 5FY9A 4I01A 5HV0A 1XSQA 4CDQC 2J42A 4FAHA 2LW8A 4IQPA 4I2OA 2WT0A 5EJZB 2BBAA 2R063 5CFDB 4X8NA 2EXIA 1HB3A 5HCFA 3ZYIB 2VQAA 4AEKA 4MG2A 1MS8A 3CIHA 4DFSA 4JGZC 1RIRA 4MO3M 3PU3A 1QU0A 3VHNA 2H6CA 1BJQA 1WMDA 1AR82 1BLZA 4TN7A 1UKRA 1ENRA 4V2WA 1C3HA 4XUNA 5IHRA 3I2KA 2A6ZA 4XABA 1Y9MA 2ZGPA 1PK6B 5A3TA 1HIXA 3ZXAC 3GZTB 3IBMA 5H9PA 3GHNA 1GICA 1D4VB 1V6JA 2O14A 2WNUB 4B1LA 1XRUA 3I2JA 2DCKA 2WZR1 4FPJA 4H55A 3RZZA 1O3TA 3PU8A 5T3NA 4GJZA 4D8MA 3WW4A 5FZIA 4W4ZA 1VRH2 1ULDA 4FQ4A 3I2FA 1Y43B 4Y22A 2YC2A 3SQOA 4MUVA 4QX5A 5T5OA 1IG0A 1RUJ2 1OA2A 2OS2A 2AREA 1YI9A 5F5QA 1CAUB 1F9KA 3BCWA 3O1MA 1QNWA 3J7LA 4QPGB 4QMAA 4W6WA 2CNAA 1EPWA 4D3WA 1JUHA 1AXKA 1C5HA 2OPKA 3ACHA 5LY1A 4N43A 4U2AA 1HDKA 2OUJA 4BOWA 3MEPA 3LIGA 2F4PA 1SPPA 1R64A 2C24A 4Z2WA 1G6NA 5AC93 5FP9A 5BYNA 4Y5Z0 4JDNA 5T5PA 4QM8A 1PK6C 2RMU1 3ELNA 1ASJ1 3MV01 5JMCA 4MGTA 1PX3A 3QBQA 4XQWA 4AI2A 4JHTA 3IZOA 1VAKA 1W8TA 3AYDA 3B02A 3RWKX 2YZ4A 1O8SA 4XFAA 5CKMA 1WW6A 3MGUA 3ZIXA 4CA9A 4CDWC 4CDXB 1C8NA 4FT8A 1FNYA 2E31A 2JG9A 2BERA 4BZ4A 5FY8A 2WO2A 2XB6C 3MLKA 1ODMA 2JDMA 4MGYE 4YFWA 1H4HA 5GM0A 3K4DA 3AP5A 2FDIA 3N3HA 3J7NA 2ZPXA 3J7HA 2A3YA 1G7YA 4Y26A 2JE8A 1TME1 4YM1A 4UF0A 5FXWA 4BQ2A 2KXLA 2XUMA 3O7OA 1O3QA 3DPRC 5FPAA 4MGZE 5I0DA 2YPDA 2BTVC 2EIBA 4B8EA 4Q4Y3 2V4AA 1H9WA 3AMHA 4H14A 2HLEA 4AGGA 3NMBA 4QPGC 2VOTA 3AMPA 5T52A 5J98B 5ABJC 5I8SA 2VBDA 4JRAA 1JTZX 3BTAA 3KGZA 3MV11 4NOTA 4Q1RA 3VN4A 2Q1ZB 3RI8A 1ZREA 4RFT0 1MQTB 4JQTA 1HRV1 2NYYA 4JC1A 2JE9A 1RJ8A 4O9EA 1X82A 2GH8A 4MX3A 2RJLA 5T50A 3H8UA 2O8OA 3THPA 5C5TA 4EWAA 2ARCA 2C26A 2ORXA 5CISA 4KH9A 1UYXA 4HG6B 5BNNA 1PVXA 4FPCA 2F6BA 2ZJCA 4NRPA 4BIOA 1HB1A 3HNYM 3ZFGB 1S2EA 1PM7A 1WCSA 2QBXA 2R30A 3NSTA 1YWKA 4PIYA 1MZFA 3TB0A 3WW1A 4CUAA 3O0XA 4IEYA 4M0HA 4Q4X2 3VBRA 5JSRA 1W9WA 5C8CB 5APAA 3T0DA 4Q0VA 4Y33A 1GZ9A 1OKQA 2EF6A 2R062 4QQHA 4PDWA 5GLTA 1RUE3 3R4UA 1CD3G 3KT1A 3VHRA 1JUIA 2MPFA 4YWAA 2AR6A 4K3UA 1Q43A 3CDZB 2D3PA 1OLMA 2PHTA 4GIQA 4H3WA 4OQ9A 3WP4A 1HB4A 1OKOA 1E5SA 1T2XA 1KEXA 2GDFA 2C0ZA 3TRSB 5GALA 3OD0A 4BQ4A
chains in the Genus database with same CATH topology
3OBRA 2PLV1 4HPKA 3AP9A 4FPFA 3OGGA 5JPNB 2RR11 1RVF1 1AJKA 4NR1A 1MQTC 2JE7A 4P9WA 1GQGA 1UU6A 2GNDA 5JI9A 2D93A 5JIUA 3J9SA 3H1WA 1ZVFA 5I0RA 1NLSA 2DU1A 2QE3A 3C3VA 4MXWA 1M4WA 1IS6A 1S0IA 3WUDA 2ZKNA 4AVVA 4CP1A 3SLIA 3ZFGC 3DF0A 1IOAA 1S1AA 2V09A 4KGGA 1YUDA 1OFSA 4R8HA 1RUC1 5H9RA 4JAAA 5C8CC 4K9SA 1DZQA 2TUNA 4DRRA 1KDKA 1O4ZA 4E9KA 4AI3A 2ENRA 2UWCA 5BNOA 4E2SA 3WX5A 1QXJA 4D7YA 1F8VA 4WM8A 4OHXA 3E5XA 1OQDA 2WLPA 2A3WA 2NPIA 4ZKTB 1NCQB 4HFSA 4R9CA 1AVBA 1E57A 5AC92 4AHWA 4AEDB 3KZ4C 4TWTA 4Q1PA 1WW7A 4WM7A 5JOYA 2B45X 1FV2A 2H0VA 1DGRA 1EV13 1H1MA 2Q30A 4RD7A 3JQXA 3WW3A 4MVTA 2ZACA 5K7PA 3M3QA 4DOUA 3MF9A 3QCWA 1SCRA 3VKFC 3JD73 4ZXKA 5L7OB 4Q4Y2 3JB8A 4EN7B 2BWCA 2HWE3 2B46X 1HW5A 1BVP1 2DWRA 1IPJA 1RUH3 1UIKA 4K8FA 2DCZA 1NCQC 5DG2A 1X33A 2VY0A 2DVGA 2JXAA 1PGW2 3UV9A 3GALA 3THTA 2GZWA 4EN6B 5L19A 1I3HA 1S0EA 1CQ9A 4Z8BA 1K5MB 3UL2A 3UKNA 1SLCA 2DTWA 3TAYA 4DS0A 2QVSB 3C2UA 1PO11 4ISQA 4BM8A 2IXIA 3NAPA 4JTOA 1RUE2 1VBB3 1S2KA 2CGPA 3N7KA 1LCLA 5J37A 2AUYA 2PFWA 5AFEA 3WDUA 1AUYA 1TNRA 1U5ZA 3IPVA 4YZ3A 1RMU1 4QPYA 4X6QB 4J1XA 2IZWA 1WLDA 4LR4A 4RSUA 4AI1A 4XJZA 3BIWE 3VBUC 5KC6A 4GB31 3FLPA 3V0AA 4RS5B 1O3SA 1O5UA 1YFUA 1LOFC 1RTVA 1VBD1 3GZUC 2QZ3A 5FFOC 4EWEA 2QDNA 1K5MC 3USUA 4YM2A 3WCRA 3H3ZA 1OOPA 4MH0E 1WMFA 5AVPA 3ZXEA 2D6KA 4AXOA 3KCXA 2IFWA 1H30A 1L3JA 1QOTA 3NL1A 1ENXA 2XVKA 5SV5A 5CADA 5BPXA 1C8M3 3E5UA 1IPKA 3MICA 3AYEA 5FLJA 2XLAA 1BZWA 3ZSKA 4D7SA 2E7QA 2I07B 4YG0A 4N9HA 1R081 1V00A 2R041 3WLUA 1AX2A 1VBC3 2OZJA 4Y20A 1LOAA 5I93A 5CG8A 4HSLA 1NLRA 1CONA 4U36A 4RS5C 1EV12 1UN1A 1LU2A 1H9PA 1YJKA 1GLHA 2Q5TA 3WINE 3V56A 3JD72 2W39A 5EWSA 5BNPB 2HWE2 3E6CC 2BVBA 1XU2A 3B5LB 1AR91 1RUH2 4CZSA 2BVVA 4HL0A 4WVZA 2OW4A 1UZYA 2ZX2A 3O0VA 4LO7A 4P5HA 4QGNA 2DFCA 3APBA 1QF3A 3G6JB 3W59A 1T6GC 2K0GA 4QQ2A 2UYAA 1FNZA 4MYEA 3DV8A 4AVSA 2BFUL 3I7DA 1UU4A 4BIFA 2D3SA 4Q4W3 5F6LB 2HYKA 2GH2A 5CBLA 3RQ0A 2BNOA 1W6QA 3MI8A 3QLQA 4GMP0 4XQDA 1RHI1 2D43A 1NE6A 3WDVA 1PO23 4AG4A 1AYN2 3BB6A 1VBB2 3FUOA 2V5YA 2XPJA 3OYWA 4AVBA 3R4SA 1FI2A 4XF3A 1PGSA 1BCXA 3ETQA 5BNPC 3G7DA 1POV1 4A2UA 1YRZA 1DU3D 3H0OA 4H7LA 4Y22B 4QD2A 3ZXDA 2ZGKA 3PMEA 4I02A 1U5YA 2CY6A 4YVWA 4N53A 2E6VA 2UY9A 3ES1A 4XILA 4BLJA 4AGRA 4R4XA 1GNZA 2WT1A 1QMJA 4N43B 4LT5A 1LHVA 1Q3EA 4NWVA 2DURA 4RQPA 2G4IA 1OHFA 5SV8A 5ACA1 4P9YA 3AB0A 1C8M2 1BMV1 2R0HA 1F2NA 1UPIA 1Y9QA 4JRLA 4Q27A 3L9JT 4CYDA 4TYSA 1UX6A 1VAMA 1UPSA 1PIV1 2XJRA 1QJU1 1X36A 3KS7A 4XJ8A 4OI4A 1ND3A 2R6QA 1LB2A 1OPOA 1XXNA 1VBC2 3FX3A 3P3NA 5KHJA 1YI7A 4YGDA 2FBEA 1AHSA 1D2SA 2ZA9A 1CESA 4MGIE 4LBLA 4IEXA 4Q0QA 2DYCA 1O4YA 5FAXA 1EAH1 2DVBA 2YV8A 2Z2SB 3ASIA 2O8QA 4HANA 4HVQA 2IXCA 1HLCA 4BCUA 2HWD1 2WFF3 2VOVA 5AVAA 1HRI1 3ENRA 4OI2A 1I5ZA 2X5IC 5BNNB 1VP6A 1TMF3 5GZFA 3WY6A 4COVA 3B3QE 5JVVA 1VIWB 4Q0SA 5JZGC 2XJPA 4QPIC 2YPJA 4W6YA 2D6OX 2JEMA 1J1TA 4S2FA 4HKLA 3OY8A 1VBE3 3VBRB 2X53S 4S2GA 1N3OA 1QHDA 1NY72 4E4DX 1YLLA 1KRIA 5LRRA 3MPBA 4PDWB 2ZKLA 4RHV3 4Y24A 1SCSA 1WUVA 2WWSA 4IESA 4LE3A 2JECA 4QQPA 5A33A 3SH5A 2AYHA 3O5SA 4Q4W2 5JOXA 2YROA 1NCRC 2HKXA 2VU9A 1YCIA 2VH9A 3V0BA 1PO22 1SLBA 2NQYA 3PVNA 4Y1YA 1W0PA 3MLJA 3ZYRA 3ZVXA 2A3XA 4XXAA 4O9GA 3KT4A 5CU1A 4YZ1A 4IL7A 1RUNA 2FHRA 4A7ZA 1ZM1A 4LA3A 1W6PA 4MXWB 2ZGSA 5BNNC 4AFAA 1C1FA 5L73A 4HN1A 5CB7A 1QXRA 1NA1A 3HT2A 4CDUA 5J09A 3DUIA 1FAYA 1GANA 4JCKA 3VBRC 3N7JA 3EO6A 4R4ZA 2QQPA 5C4WA 2PAMA 1LEMA 2D3RA 2ARXA 4B4QA 5BNOB 1VRH1 2D6MA 2WC2A 3WCSA 1LJ7A 2AENA 3H7JA 1ZX5A 4IV3B 4AQ6A 5A32A 1OSGA 4UW6A 5LK5A 4C0BA 1POV0 1GQHA 4J6GA 2VVEA 4AE2A 1QJZA 4BMEA 1QOSA 5CIRA 1GNHA 1W6OA 2VGDA 1RUJ3 4WM7B 2WJSA 4OI0A 5CNAA 3EXUA 1F5JA 1ZRRA 1VAVA 1B35C 3RWNA 2W08A 4HN0A 1LENA 3E6DA 2VECA 4PJYA 1XYPA 2GALA 2ZGNA 3JCIA 4XF9A 5J3UA 3M7AA 5CAZA 2PAEA 2WLQA 5BNOC 3KD4A 1Z78A 4OUSA 4XFFA 1AF9A 4IV3C 4GKYA 3ZYJB 2ZHMA 3SISA 2VMHA 1RUOA 2RS11 2WFF2 3VL8A 1CGPA 4RL7A 1BVVA 3ZN4A 1TMF2 4PLMA 4Y1XA 2A6WA 3JB4C 4PF5A 2ZX3A 1V9U3 2SBAA 1CJPA 1J1LA 4YARA 4P9XA 1VBE2 5GZEA 1ALYA 3WQ0A 1VALA 4YFZA 3ZIWA 5KHKA 5DUUA 3NAPB 5EFUA 4RHV2 4KQ7A 2XKPA 2YHJA 3POYA 3PJQA 4Q4X1 4C1XA 2WA4A 3NKGA 3U4XA 3VZNA 3QOPA 2JD4A 3IPVB 2R061 3VBSA 4YW3A 2RS53 5GLWA 1DZRA 1XNDA 5KXEA 1DQ1A 2WQ4A 3ZFEA 2QNKA 4FOYA 5EJ3A 1HV1A 1IS4A 3B93A 4Z82A 5JLVA 3V0AB 1RUI3 4MLOA 1WGPA 4OZXA 4EN8B 1AR63 3JBG3 3NJZA 5I91A 2LM3A 3FBYA 2WZPP 1H1IA 3N4MA 2NP0A 2WL1A 4XE9A 3AXEA 3USUB 4PIZA 2CAVA 3E5QA 4JGYC 5LK7B 1BYHA 4PBOA 1A8DA 1DDLA 4FXKB 5D8AA 4DPNA 2DTYA 1CX4A 3VDDA 3AKSA 1Q8OA 3BPZA 4WVWA 2GAUA 4N90A 3GYDA 1LU1A 2QKDA 4IEVA 4LEJA 2ZMLA 2UWBA 3CL1A 4K40A 5GKAC 5K9YA 2WKKA 2WS93 5HCAA 4B7EA 3MIEA 1MS1A 2QFEA 5I8YA 5GZGA 4K20A 2XBO3 4AVTA 4Y20B 2X8KA 1R1A2 3VZMA 4YW1A 4P14A 3WP6A 3MIDA 3D0JA 2ZHNA 1YHFA 5AC91 4LBOA 2Z42A 3RRDA 5CFDC 3J8F2 3ZXFA 4DXZA 1DYPA 4L99A 2R49A 4FTEA 2RS33 5EYXA 3WT3A 2VUJA 4AEJA 1XE8A 4DY5A 2A70A 2IXKA 1ZZ6A 2OA2A 4AF9A 3O14A 2TNFA 4XEZA 3FZ3A 1URXA 1QDCA 2BYVE 3GHMA 1ZRFA 3ROUA 1NXD1 2WZR3 2IXHA 3BOPA 3KSCA 2WNUC 4Q4Y1 1LOEA 2ZCWA 4XFHA 1ZA4A 3B01A 4YYOA 5H9QA 2BQPA 2P17A 2EIGA 3AP7A 4X6RB 3M1HA 4XFBA 5BV6A 3T1LA 1V9U2 4FPOB 4FTSA 2E53A 1ENSA 3VLBB 1W6QB 1PGW1 2C1FA 2RM23 4FO9A 3CEWA 3ST7A 4XJAA 4D94A 4F83A 2VNGA 3WVJA 2P2KA 1OA4A 1N3PA 2I2SA 3OYWB 3H3UA 1Z7S3 2CV6A 1RUF2 1ULEA 4FOVA 1AR73 4XF4A 3T1MA 1UD1A 4X8PA 1QQP1 1H2MA 3FJSA 4YG6A 4B4PA 2RS52 1QWRA 4KWLA 4N53B 4AHZA 1H2LA 2PYTA 3SMHA 3R0RA 4CDXC 1RUI2 3H1MA 2WSVA 1MZ5A 4CEYA 1AR62 2ZHLA 1DQ5A 1O5LA 1WD4A 1TME3 3JBG2 3E97A 1CJDA 4KNCA 4XBLA 1SEFA 1S0GA 2MEV3 4RQPB 5FCCA 1H2KA 5A3LA 1I1EA 5AFBA 1PZ8A 2Y0OA 1C28A 2PHFA 2G9GA 3O0WA 4LUMA 2IWGB 2DVDA 4XXPA 3TYJA 5CVRA 2PA7A 4LLFA 1B09A 2R071 2ZHKA 4MSVA 3MFCA 4YW4A 2WS92 3NO8A 4M3CF 1ND3B 1XNCA 2EVXA 4CTEA 2XBO2 2PHRA 4N53C 3HIFA 1FPN1 3FE5A 4C91A 2ZAAA 2RHPA 3SH3A 1N3QA 4IEUA 4GXLA 1RUD3 2AH2A 4FPYA 2MNGA 1DZTA 1SBEA 2R16A 3VBFA 5JSOA 3USSA 3JU9A 3RJ2X 4LBMA 2R0FA 1XE7A 2RS32 4RQPC 4OI1A 4IERA 3U0ZA 3EBRA 4CEWA 3PVOA 1BQPA 5DDJ1 1EV11 1LGBA 4NHLA 2PLV3 2HEVF 4L97A 1I6XA 1JBCA 1V6NA 2RR13 1RVF3 3OY8B 4ES8A 1UIJA 2BEOA 1MEC3 5HI0A 4MGKE 4GULA 3JD71 2WZR2 1MS3A 4XIOA 1CPNA 1R093 2DU0A 3LB9A 2BFUS 3U11A 2HWE1 1ND3C 2DVAA 4QM9A 3VBHA 3IDEA 3AMMA 1H8VA 2D5FA 1UF2C 1RUC3 1VB2A 5A33B 1YFWA 5FRAA 1C1LA 1JXNA 3S0MA 1W2UA 2DV9A 4HSJA 4OHVA 3I54A 2GNTA 2VW1A 2RM22 1HV0A 4INDA 1WBLA 4K6BA 1W6NB 3J26N 3WUCA 3V0BB 2Q1MA 3AZYA 3EJKA 4PIXA 1DGRN 3CO2A 2CL2A 5DG1A 4FPLA 4Q8LA 1Z7S2 2CGNA 4E27A 1AR72 4HVRA 3ZXJA 1W6PB 4HT1T 4WV8A 1Q8VA 3MIGA 5FBZA 4TLFA 1G9BA 1A8MA 4FQZA 3M4FA 2FMDA 5KXCA 2Q4SA 1NA1B 3HWJA 1J3QA 3M3CA 1S0FA 1VBB1 3O12A 4AEDC 4CDUB 1ND2A 5DUVA 5J36A 1ZBE3 1UW8A 3CJIA 4ITCA 4AQ2A 3VV1A 1IGOA 3NKTA 4IEOA 4AQTA 4L92A 4BQ1A 1OQEA 1UZZA 2Z5WA 1TME2 5FMOL 1AYN3 3MW4A 5A32B 5B2GB 2MEV2 4CDQA 2VUAA 3BU7A 1PGL2 1AL21 2A7AA 3WZ1A 3ME2A 3WHUA 5L7OC 1GFF2 3JUUA 3RMXA 3AFGA 5K0UA 2HWB1 4GMP3 4P9JA 3GF6A 2JG8A 4UW4A 2SLIA 2XJTA 3AK0A 3SHRA 1GYKA 3MYXA 4GWMA 2E7AA 1NA1C 2LTNA 3R6SA 4CDUC 1PVC3 1H2NA 2KA3A 1C8M1 2UYBA 2GC2A 3N7MA 2JDZA 2P37A 2XWBB 2W0XA 1MZEA 2K2SA 2NM1A 1RUD2 1M06G 1S2BA 3HMYA 3TNPB 5DZEA 3AKTA 4HK9A 1UCXA 4XBQA 4COYA 1WW5A 3AZVA 4WZFA 4P9LA 3V65A 1OD5A 2QZ2A 5F1RA 2GMMA 5BY5A 1LR5A 4DMIA 1N1TA 2CWSA 2PLV2 2ZZQA 1YIFA 3LOIA 2RR12 4Q26A 1RVF2 1ULCA 1GSLA 3TN93 1MEC2 4KWKA 3VBOA 3TWIA 1R092 2WNVB 4I09A 1Q56A 1VBD3 2EXHA 1SBFA 1MR5A 4Y1ZA 1RITA 2GC1A 4FXGB 2PN5A 4QU2A 3SNMA 4CDWA 1J59A 1RUC2 1OI6A 4YZ4A 3VBSB 1QKQA 5F6KA 2ZS6B 4ASMB 1CIWA 3B9CA 2MHFA 1TNFA 1VJ2A 4GKXA 3DPRA 4AQSA 1RC6A 3R4DB 1BKZA 3VUOA 5ABJA 4CP0A 1BBT3 1NYWA 2DCTA 4A7KA 1Q8PA 5JR7B 1PO21 2R32A 5GLVA 2CYFA 4E4SA 4Q4V1 2ATFA 3AZXA 1TQ5A 4I0BA 3HD8B 3MPPG 4BWOA 2GC0A 5HXVA 2JX9A