1V6JA

Peanut lectin-lactose complex crystallized in orthorhombic form at acidic ph
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6jA00
2GNTA 4GXLA 3T2TA 1ZM1A 3AZXA 2ZGSA 1DGLA 3M2MA 3SNMA 3ZSKA 2EXIA 2ZA9A 4U2AA 1G9CA 2ZMKA 2NYYA 2AYHA 5GLUA 1SLBA 4AVSA 1MZ5A 1UPSA 1ULCA 4BM8A 3AZVA 1UKGA 2EALA 3TB0A 1S0FA 3N7KA 5BYNA 3SH5A 5KXBA 3SH4A 1APNA 5T5OA 3RRDA 4DFSA 3NV3A 2ZZJA 1DYPA 1DQ5A 4RA0A 2P34A 2VW1A 1RINA 1QKQA 2EF6A 3AZZA 3ZSMA 1DIWA 1C57A 3VV1A 4JRAA 3POYA 3ZSLA 5JOWA 2D3PA 4XHBA 3I4IA 3NWKA 2G4IA 5E8AA 5E88A 1SACA 4FVVA 4DRRA 2CNAA 1CJPA 2RHPA 2AUYA 4NO4A 2EXJA 3OBRA 1AVBA 4AGVA 1WW5A 3PVNA 4R9CA 1ZA4A 4UW3A 5CAZA 1SCRA 3IPVA 4BMBA 4Z8BA 1WD4A 4YM1A 3IM0A 4XYXA 3ZSJA 1LECA 3SH3A 4PBPA 3M3EA 2VU9A 3SITA 1FATA 3WG2A 1CQ9A 1S0GA 4AGRA 2ZGRA 2NZ9A 3USUB 1UAIA 3N7LA 2ZABA 1AX1A 4Y20B 1H30A 2E6VA 4XILA 1V00A 4LBLA 3O0VA 2WT2A 1LU1A 1Q8SA 5KXDA 1DYKA 2WSUA 4SLIA 3MW3A 1VAVA 5CBLA 5EXOA 4GALA 1S1AA 1WW7A 1PZ9A 4YW5A 2DWRA 1QNYA 4XJUA 2Q5TA 2YXSA 1UX6A 5GLVA 4DS0A 2E7TA 1MVQA 3UL2A 4XMAA 1JXNA 3AXEA 4Y1VA 1CIWA 4Q1RA 4AVTA 1FAYA 1KRIA 2DVBA 4YG3A 1LOEA 3AZWA 4XJZA 3ATGA 2DTWA 1ULDA 3VKLA 1SBEA 1CPMA 4KBBA 3V64A 3FLRA 1A8DA 1IKQA 3OYWB 3UJOA 5JDBA 4PBOA 1DHKB 2WQZC 2YZ4A 2DVFA 1G9FA 4U36A 1W6OB 1SCSA 4GWNA 2Z42A 3NV2A 4Y26A 1LGNA 2UWAA 3B00A 3R05A 3BODA 2JE9A 3SLIA 3AYDA 4XIOA 1WCSA 4XZPA 4YFZA 2D44A 1ENSA 4RL7A 1O4YA 1SLCA 1AXYA 3AX4A 2D3RA 1AX0A 2GMEA 1KITA 2AGSA 3AP9A 4P9WA 3GALA 3MPPG 4ISQA 4GWMA 2YY1A 1LJ7A 3FBYA 4M3CA 3T1LA 3WV6A 5IT6A 1BJQA 1URXA 3D4KA 4FP2A 2E53A 2SBAA 5IK7A 2DTYA 4AWDA 1FYUA 2A71A 2VW0A 1MZ6A 2A3XA 2DURA 2WT0A 1LOCA 1LEDA 4M3CF 4D69A 3ILFA 3JUUA 2XB6C 1D0HA 1N3PA 1W6NB 3HMYA 3N35A 2ZHKA 2C9AA 2JD4A 2R1DA 4TZDA 1N1YA 1HQLA 2CWMA 1MS5A 2DUOA 3OY8B 1MS3A 5F5QA 5GLWA 3AP5A 4Y22A 1NLSA 3A0KA 5DUWA 4C1WA 3INAA 2WSVA 4WVWA 1QOOA 1JYCA 1S0BA 2DU1A 2AR6A 2EAKA 1UZZA 3IN9A 1X50A 1GNZA 2PHWA 1LOFC 4K1YA 2A6WA 1FV3A 1D2SA 5DUVA 1KJLA 1WD3A 1EPWA 3V65A 4AYUA 1JOJA 1UL9A 5H9QA 3WG4A 1S0JA 1Y7BA 1YYNA 1LHUA 2ZHMA 3R4SA 1YXWA 1DQ4A 5GALA 1LESA 3MW2A 4YG6A 4FPYA 3A0NA 1QOTA 3WNXA 4ZXKA 2ZGUA 2ZKNA 2D6PA 3BTAA 4M3CE 1BQPA 1LEMA 1LOFA 5JMCA 3DUIA 2PHXA 3V0AB 2UWCA 1G7YA 2EIGA 2JE7A 3I8TA 1AXZA 2LTNA 4WZFA 1LOBA 3WCSA 1HKDA 1DQ2A 1GYKA 1C1FA 1SBFA 2WNEA 4F83A 1CVNA 4BQ1A 2E51A 5DG1A 4YZ3A 2ARBA 2YROA 4UW4A 3ZYRA 4OZXA 4R9AA 2DVAA 1QDCA 3ASIA 4R9BA 4PQ9A 5T5JA 2GMPA 1SLTA 3WLUA 3W59A 5DUUA 2NMNA 3ZXLA 3AP6A 5DZGA 4FPOB 2GN3A 1H9PA 3AYAA 1LOGA 5H9RA 5T55A 5DG2A 1I3HA 4XIKA 1GV9A 4YW3A 2ZGOA 3M1HA 3POSA 3Q9OA 4Y24A 4Q8LA 4YGEA 1VALA 3M3OA 5GZFA 1Z78A 1LHWA 1N1TA 3RSJA 1CONA 5GM0A 1N1VA 4R9DA 3AXDA 3JU9A 3V0BB 1FX5A 1W6QB 3AJZA 4Y1ZA 2NMOA 2OUHA 4XTPA 1IKPA 4DQAA 1S0CA 2A7AA 3VKMA 1W6PA 4FOVA 1V6LA 3NV1A 2A6XA 2XG3A 3M3CA 3PVOA 3N7MA 2D6KA 1KDMA 2A6VA 1QF3A 3B69A 1MS9A 1HLCA 4NOTA 3UJQA 5FRAA 5EYXA 1G9DA 3R4UA 3VUOA 3ZYPA 2VUAA 2OW4A 1A3KA 2LALA 2R0HA 5GLZA 2GMMA 3VKNA 4ISRA 4UW5A 4K1ZA 5SV8A 1KDKA 1H9WA 3VKOA 3RMXA 2GNBA 4XJ9A 5AVAA 1SBDA 1XQNA 1CPNA 5IK5A 4YZ1A 3AP4A 3O0WA 1LOAA 2CWSA 2W39A 4Y1XA 2A3YA 1W6MA 3WUCA 2GDFA 4M01A 2PHFA 4CRQA 5E89A 4XTMA 4YW2A 5L73A 1C1LA 1Q56A 3FUQA 4ITCA 5HCFA 3AFKA 1LENA 4PF5A 4FPLA 1MS0A 2ZGPA 4LBKA 4YZ2A 3AYEA 4XHXA 4XJWA 2ZMNA 1AZDA 4W65A 2NP0A 1B09A 1V6MA 4ATEA 1HQWA 1MS1A 2GNMA 3ENRA 5FREA 1LODA 4LBNA 4MYEA 3U4XA 4GA9A 3B9CA 1AJOA 1IS6A 3TAYA 5JOZA 3LCPA 1F31A 3BOPA 1YI7A 2ARXA 1ULGA 3KM5A 3O5SA 3OGGA 2JDZA 4UW6A 1SFYA 2OUJA 2A75A 1I1EA 2OVUA 2AH2A 1AJKA 1N3OA 2P3KA 4DRVA 3IPVB 4DPNA 4FPJA 1WBLA 1W0OA 4XXAA 4Q1PA 2V5YA 4YG0A 2NM1A 3VKFC 1BZWA 2VXRA 3B01A 1DQ6A 5CB7A 3DGTA 1F5FA 3CNAA 3PMEA 1R1ZA 2EXHA 2R0FA 2A5ZA 1BXHA 1LGCA 2WT1A 2JKBA 2ZGNA 3MEPA 4JCKA 2D6OX 2ZMLA 1ENRA 1DQ1A 3A4UA 3LSDA 4Q26A 3WOGA 2JECA 1S0EA 1N47A 3BIWE 4I30A 5JVVA 1IS3A 2VW2A 3RMYA 4P14A 2DV9A 4XDQA 2R49A 3FUOA 3OJBA 4LBOA 4FOWA 4LBQA 1CN1A 3IKWA 2D6MA 1DBNA 3FLPA 1LU2A 3N36A 4M00A 2FHRA 2PELA 1JN2P 2ZGMA 2DVDA 3WDWA 5IK4A 4XOGA 2YV8A 4AVVA 2ZAAA 1BKZA 4FPFA 4XJAA 5GLTA 1JBCA 1TEIA 3AP7A 1GZWA 2WJSA 2DYCA 4YGBA 2GALA 3ZXEA 1V6KA 4P9XA 1ONAA 1Q8VA 1QMJA 1PZ8A 4Q2FA 1HDKA 5JOYA 4YM3A 2ENRA 2WKKA 1PZ7A 1V6OA 5GZGA 1N3QA 5DZFA 3GNEA 2YMZA 3APBA 3USUA 1FV2A 1VLNA 4M3CB 4Y20A 2A6YA 2HYKA 1ULEA 2D3SA 4AGGA 2D7FA 2I2SA 1VIWB 1JUIA 3T1MA 2V73A 4IQPA 1SLLA 1ENQA 1MR5A 1RITA 4XBLA 1J1TA 2KM2A 5IUQA 1YRZA 1G8WA 4H55A 1S0IA 1OFSA 4C1XA 3WCRA 2DUPA 1A78A 1GBGA 4FPHA 4LBQD 3ZVXA 1LULA 1MVEA 3QLQA 3OYWA 4BLIA 2ZGLA 4FPGA 1KJRA 4YZ4A 2B7YA 2SLIA 4Y22B 1LTEA 5LK5A 1W6OA 2DU0A 5GJ6A 1WW6A 1YIFA 2CY6A 3PJQA 3WDUA 5CA6A 1DFQA 1GLHA 2W08A 5EWSA 5T50A 5EYYA 4ZKTB 5GZEA 3FLTA 1CR7A 1GICA 1V6IA 2P37A 2PHTA 3ILNA 4LBQB 4PCRA 5DXDA 4YW4A 1MS8A 2ZGQA 3AYCA 3N7JA 4XXPA 4P9YA 1WUVA 1QOSA 3HN1A 2W52A 1O4ZA 2P2KA 1WLDA 3O0XA 1LHVA 3H0OA 1GZWB 1DLLA 2EXKA 2ZBJA 4YZ5A 2A6ZA 1QNWA 1Z0HA 3L2YA 4ASMB 4LBMA 1GANA 2ZGKA 4LBJA 2ZGTA 2CL2A 1OKQA 4BPZA 1ULFA 4WV8A 3WG1A 4YW1A 1Q8PA 4HANA 1AX2A 1RIRA 1W6NA 5KXCA 3AJYA 4FOYA 1FNYA 1Q8OA 3AZYA 3RQ0A 5F9TA 5GZCA 2PHUA 3OY8A 4BLJA 1QU0A 1YO8A 2R1BA 5GZDA 4Y1UA 3WDYA 4XE9A 2CTVA 4FPCA 3WG3A 1IS5A 3WZ1A 4L8QA 4YFWA 4CZSA 4YLZA 2ZACA 4YM0A 1AXKA 1JHNA 2UU8A 5T5PA 1FNZA 2H0BA 2VH9A 2UWBA 2ZHNA 2BQPA 2PHRA 3WHUA 5IK8A 3AK0A 2D6NA 3ILRA 3IMNA 3POWA 2JJ6A 1JW6A 3QCWA 4TYSA 1UN1A 2C5DA 2D6LX 1MS4A 3UK9A 1OQ1A 1GKBA 1WLWA 3LSEA 3FFZA 4FPEA 5DZEA 4BOWA 3W58A 1WBFA 4XJ8A 1MACA 2ES3A 5JOXA 3N3HA 1GSLA 4BMEA 1AF9A 5HCAA 4FP3A 3WUDA 1UMZA 4FQZA 1U0AA 2ZHLA 3V0AA 4JC1A 2TEPA 1F9KA 3C2UA 3HR9A 3M3QA 3MW4A 5CNAA 5T5LA 4FQ4A 5H9PA 1UZYA 4GKYA 1JYIA 2UURA 1W6PB 1WLCA 1LCLA 2VY0A 1DZQA 3WDVA 1WW4A 2FMDA 1BYHA 1LHOA 2A3WA 2DVGA 4XBQA 1G86A 1DQ0A 5HCBA 4FPKA 1SLIA 5T54A 4HL0A 1IOAA 2AENA 1V6NA 1W0PA 2AREA 3WVJA 1SLAA 1S0DA 3ZXKA 1QGLA 3ZPYA 1KQRA 4Q8KA 1VAMA 3NV4A 3OPZA 2A70A 3O12A 3OBTA 4YM2A 1N1SA 3KQRA 2DUQA 1G9BA 3D5OA 3WHTA 1W6MB 5KXEA 4YGDA 1QDOA 1G9AA 2R16A 3PVEA 3RS6A 1C4RA 4GKXA 4WVVA 5DUXA 1NXD1 2GN7A 4K21A 2NN8A 2P3JA 2W68A 3RG0A 3B3QE 2ERFA 2CYFA 4Q27A 4ATFA 4XMIA 4CTEA 4K20A 1GNHA 1CESA 2D43A 4Y1YA 3V0BA 2E7QA 1W6QA 1LHNA 2WLQA 3WDTA 2P3IA 1Q8QA 4XBNA 3D6EA 1IS4A 4FOQA 3SISA 1LGBA 1GZ9A 4YGCA 5JLVA 3WDXA 2GNDA 5T52A 3ZXFA 1V6JA 5H9SA 3ZXJA 1GZCA
chains in the Genus database with same CATH superfamily
3UKNA 2IXHA 3I7DA 3H3UA 3LGRA 2ORZA 5FO8B 4RQPC 1W0NA 4K8FA 2ZGSA 2BPA2 3PUHA 3URFA 3ZSKA 3ZX7A 1YLLA 3I3MA 1FMD2 4U2AA 1G9CA 1O6UA 1SPPB 3PUIA 5K0UB 2J1UA 5C3QA 1REEA 4K3UA 4AVAA 1BEV3 3VD5A 1YQ2A 4XF4A 4W50A 1MZ5A 4AFMA 1C3HA 4PJYA 3J7MA 5CFCC 4YVWB 1REFA 2V4AA 5DMYA 2EALA 4XUOA 1BBT3 4P9JA 5F2WA 2JENA 5BYNA 5FZLA 3SH5A 3SH4A 5T5OA 1GFF2 3NV3A 4KU8A 3ZFGB 1DYPA 2VE1A 2R6QA 2P34A 2ORXA 4OHVA 5C3PA 2EF6A 3ZSMA 4QQ2A 1JI6A 3VV1A 3H7YA 4YYOA 5AC92 2QQPA 3ZSLA 1UNBA 1W99A 1LB2A 4MHUA 2D3PA 3A7QA 4XHBA 2WS93 3NWKA 4DNYA 5IVFA 3C7EA 2G1MA 2Y33A 4YNIA 2PAMA 3P3PA 5F39A 5FZFA 2RVAA 4DRRA 5B4XA 3UKTA 1CJPA 1CAVB 2GH8A 2AUYA 2EXJA 1AVBA 1TVGA 3VBRA 4R9CA 4X6QB 5FZOA 3T3YA 1SCRA 3IPVA 1S55A 4BMBA 1RVF1 4MZUA 5FZ9A 1OHFA 1LECA 2ZXQA 1W3VA 2Y6GA 1D4M1 3SITA 4AEDC 3WG2A 3MZHA 2HEYF 4JGYB 4Y20B 1T6GC 3HBZA 1AX1A 1HJGA 2ZX3A 3N7LA 1V00A 1HRI1 1UY0A 4XACA 3O0VA 1Q8SA 1RUJ2 1QQP2 5LA0A 2BJSA 4CXYA 3WXPA 1S1AA 5FKCA 4JDNA 1QNYA 1SQ4A 3AFGA 1UX6A 4WVZA 3KT7A 1QJFA 5GLVA 2E7TA 4DS0A 3UL2A 2Y34A 3LEGA 4XMAA 1CIWA 1VBA3 3O1SA 4I0AA 1V9U3 2DVBA 4IE4A 3S7IA 3VLBB 3AZWA 1F2NA 4BB3A 3THTA 4HPKA 2J22A 3Q8EA 5A33B 4XPVA 3RJ2X 2J42A 3FLRA 1K5MA 4D6SA 3ACLA 3UJOA 1GR3A 2YZ4A 4Z1VA 1RMU3 2BVBA 1NLQA 2WUHA 2Q8OA 2VAUA 4AK3A 4B7KA 4RQPB 4A42A 4GWNA 4HKOA 2WO7A 1VMJA 4QQOA 2N7GA 2ZEYA 3BODA 1ZBE3 3VBUA 3WW4A 3POIA 2ZTNA 4COVA 2WWUA 5CZKA 1AXYA 1VMHA 5F3CA 3P5BA 4Q4X2 5CFCB 4B1MA 2AGSA 4AAPA 2XJPA 4P9WA 1AR62 3NRUA 3ZN6B 4ISQA 4GWMA 5JIAA 1GWKA 1SFPA 4QU1A 4LIUA 3ZR5A 1JZ7A 3O14A 3D4KA 4FP2A 2NPIA 2ARAA 3WP6A 4XETA 2QCSB 4EN9B 1LRHA 2XL7A 4NPLA 4JKMA 1FYUA 1JZ4A 1MZ6A 4AQSA 5FO7B 2A3XA 2DURA 3LFMA 4ZS2A 5JZGC 5FQ0B 2XB6C 3LB9A 4EN8B 2ZHKA 4TZDA 1GQGA 2JD4A 2R1DA 4IEYA 3ZYBA 1UF2C 1ZZ6A 3WW1A 4EN7B 2VUCA 2VZPA 3GZTB 5FK7A 3WNNA 1H2LA 3AP5A 5FCCA 3ME2A 1NLSA 1QXPA 2ZEXA 2C9KA 1GZTA 4WVWA 1F35A 1JYCA 3BI3A 1C8M2 2Q30A 1PIV1 2VNVA 3I3QA 4AEDB 3CZJA 4A44A 4CEWA 4CP9A 1GNZA 4QX0A 4K1YA 3E6DA 1FV3A 4HFSA 4GD4A 4AYUA 3DYOA 2HWE1 2RMU3 3DKQA 1JOJA 3D8CA 2VPVA 2VOVA 5H9QA 1OVSA 4JHZA 4QAWA 1QJU3 5KBFA 1XYPA 4ZZ5A 2KA3A 3NSTA 2Y0IA 4MXWA 3NNGA 4FPYA 3ZN4A 5FZAA 2FDJA 4H2AA 2ZGUA 4DUVA 3J7HA 2VBPA 1BQPA 4M3CE 2ZX2A 1SHWB 3T2PA 2YFZA 2UWCA 4IETA 5FUNA 4CXXA 5IVVA 1AXZA 1WCDJ 2MEV3 2PA7A 5JXHA 3RJRA 5J09A 3K46A 1OPOA 3EMRA 1CVNA 4UOJA 4RHV3 1UD1A 1VE0A 2E51A 1JZ6A 2ARBA 3PU8A 3AM2A 1U5ZA 2VNGA 5I0DA 4NIIA 2DVAA 2PAEA 4PQ9A 4Q0UA 3ZXLA 5LB6A 5BV6A 5ANNA 5K8SA 3ZFFA 3WW3A 5FZIA 4I3GA 1AUYA 2X05A 1I3HA 4RGKA 3SKVA 4GH4A 3CBNA 1T2XA 3Q9OA 4YGEA 4Y33A 4XAAA 1XOYA 1LHWA 5FLHA 1S2BA 2XHNA 3NQHA 1BMV1 4G3YC 1RUH3 3WX5A 3CJIA 5JXGA 2VBDA 3HBKA 4R9DA 3BB6A 2V5DA 3JU9A 3LEMA 3N9LA 5DABA 1IG0A 5I0RA 2NMOA 2DCZA 1S0CA 3I54A 5LK7B 5F37A 5F3GA 1ZBA3 3M3CA 4LHSA 4PIYA 1OKOA 1QJX3 2BNNA 2WFF2 3PVOA 4Q4V3 2HWF1 3B69A 1OOPC 4C0BA 1MS9A 3VUOA 1A3KA 5C7GA 2QDNA 1OLRA 3D3AA 2XJSA 3NW4A 5A32B 4A6OA 3SCGA 1H9WA 3VKOA 2QDRA 3IZOA 4UI9L 4F8AA 3C3VA 3AKPA 4GMP1 3AVSA 5DDJ3 2HWB1 5JXIA 4YZ1A 1HB1A 5FFOC 2W39A 1TNRA 1VBC3 5IATA 3BALA 3WUCA 1YCIA 4LXLA 4QXBA 4X8NA 2QZ3A 4P08A 1ULOA 3W9AA 3ETPA 4H7MA 4Q4W1 5FBZA 2BWCA 4AAXA 5L73A 4CDUA 4BIOA 4ITCA 3AFKA 4LPLA 5LA2A 4AE2A 1VR3A 5FZ6A 4S2HA 1Q43A 1RUD3 3RZZA 5ACA2 4MG2A 4XCBA 2XL9A 1EAH3 1WGPA 5EV7A 1DF0A 2P6CA 4QB2A 4XJWA 2ZMNA 1W8NA 2VVFA 4W65A 2BERA 3AMNA 1MS1A 2XLFA 4XVHA 1AJOA 2XVLA 4IESA 4CDQC 3LCPA 2I74A 3MBWA 4UBHA 3KM5A 1TME1 3BVCA 3KQ4B 4IV1C 4LO5B 4UW6A 4E8DA 4QPIA 3T0DA 1CD3G 2A75A 1NKGA 4KGGA 5FP8A 1N3OA 2DFCA 2JXAA 4FBFA 3IDAA 5JR7B 1GP6A 2WWSA 4DPNA 3U4SA 1W8WA 1WBLA 5F6LB 2XXZA 3BPZA 2V5YA 2NM1A 2WFPA 3RNSA 1SPPA 1H1IA 2IZWA 2UYAA 5K0UA 3WP5A 4AI2A 1VRH1 1X36A 5KWRA 2HBUA 4IERA 4R4ZA 4BXFA 2A5ZA 3Q8CA 4QKNA 2ZGNA 3BKZA 2XJVA 1HV1A 2DCTA 4JCKA 5I8SA 1ENRA 3UYJA 1UO9A 3ZFGA 5JSPA 1AYM3 1S0EA 3GZEA 5HXVA 5JVVA 4FFFA 1Y43B 3ABZA 5JSOA 5FZMA 1VB4A 1JYXA 4FTSA 1EPZA 1VPHA 4AI0A 2K46A 4GIQA 4JVAA 1TMF1 3IKWA 1W03A 5C3OA 1OOPB 3TN92 2DF7A 2K2SA 4M00A 3N36A 3LA2A 2PELA 4CVUA 4Y5TA 5F5IA 2VNRA 3ZYFA 5HXMA 1NT0A 2ZAAA 4OUSA 5LA9A 3QH7A 1TEIA 1RUG3 2JIJA 2ARCA 1CAVA 2DYCA 4HSJA 5FWEA 3FZ3A 5BNQA 5ISLA 1TZOA 2GALA 3LOIA 3ZXEA 4AHZA 1AR73 4Q2FA 1J83A 5JWPA 2VQTA 5L9VA 2E26A 4B1LA 5DZFA 3ALQA 3WY6A 5BNNC 2IVIB 4JGYA 1R091 4OI4A 2FCUA 4M3CB 2VNOA 4Y20A 4OUMA 2E7AA 4D7SA 2P4EA 1UOGA 3FL7A 4CA9A 4FO9A 5EQUA 5A3OA 3U10A 3R0RA 1CGPA 2CGPA 1F4AA 1Z7S1 5LASA 2Z79A 4XBLA 1JU4A 3NMBA 3LAGA 4QX7A 5IUQA 4NRPA 1S0IA 3WD5A 3I3EA 4C1XA 2D5FA 4ZPIA 3DXTA 4CDQB 3S0MA 4LBQD 5A33A 2ZEWA 1X7NA 4IV1B 1MVEA 1RUE3 2ZZQA 2ZGLA 3DPRC 2HWD3 2XMLA 1KJRA 3AB0A 3N9PA 4I0BA 4XF3A 2XBO1 2VZOA 3IAQA 5LK5A 3RPQA 1YIPA 5CA6A 3JXSA 1WKYA 5T50A 5FZ0A 4DY5A 1UY2A 1UXZA 3FLTA 4YPJA 2MPFA 3WEZA 4AXOA 2PHTA 2QUOA 4PCRA 3B9IA 5CFCA 2VUDA 2YBKA 1PIV2 1M06G 4P9YA 2E32A 3ZN6A 1YQ6A 3TEWA 5J1XA 2B45X 2W52A 1O4ZA 4PLMA 3CJXA 2P2KA 4UFMA 1W8OA 2C0ZA 5K4LA 3SHRA 1LHVA 2HWE2 1EV13 1DLLA 2CV6A 2RS33 3KGLA 3NNJA 2C6SA 1S2EA 3UKVA 1QNWA 1Z0HA 4MGSA 3OSDA 2VZTA 2CL2A 3VDAA 4AI8A 2W5FA 2X10A 4QPGC 1Q8PA 4HANA 2W46A 4PF1A 5FQ0A 3IDEA 3IB3A 1O3SA 1RIRA 1Y9GA 4AI3A 3HNMA 3JBG3 2WDBA 5GZCA 4J25A 2MHFA 2JE8A 1K3IA 3PJYA 3WNOA 4R4XA 4BLJA 2CU5A 2DCJA 2RM21 5GZDA 4BMEA 3RZGA 4FPCA 3VL8A 3WG3A 1VBD1 1WMDA 1JZ8A 4AEDA 1CX4A 1JHNA 4PT6A 1W2AX 5LBCA 5BNPC 2H0BA 2VH9A 5BNNB 1RTVA 4NMIA 2Q8CA 4S2GA 5LEJA 5FZCA 5IK8A 5FYMA 1R083 3GYDA 3POWA 4QDRA 2JJ6A 4DY3A 3QCWA 4MUVA 1UN1A 2D6LX 4OYUA 1GKBA 2VTXA 5IHRA 2O1QA 5L19A 1COV2 4ZONA 5DZEA 4BOWA 4LA2A 3THDA 4KH9A 1MACA 4RSUA 2WZR1 2ES3A 2J1SA 3U75A 5JOXA 1GSLA 4KWLA 4QQLA 4YSFA 5FZ3A 1D2QA 3GBGA 3RYRA 3M3QA 1F9KA 1R64A 2WR9A 2TUNA 3MW4A 3K51A 1D0GA 4FQ4A 1WCUA 5A3UA 5JMOA 2KR2A 3OUHA 1CAXB 1E5SA 2VOTA 2E63A 3DPRB 4IEPA 3BPSA 1DZQA 1WW4A 1YEWA 1JZ2A 4YW6A 1OF3A 1FOD1 1NA1C 4KNCA 2A3WA 3WQ7A 4P9LA 4HG6B 1G86A 5IVBA 4XURA 4CE8A 4AEMA 3KF5A 4FPKA 2BNMA 1H8VA 3ZXKA 1GOFA 3WVJA 4OI1A 1QHDA 1SLAA 1US3A 3ZDVA 3I2GA 2XPJA 3T08A 1KQRA 3ORJA 3KB5A 4LKDA 5J3UA 2H6CA 4Q8KA 5EFUA 3OPZA 3TBDA 2A70A 2P17A 3OBTA 2G9ZA 2R043 3KQRA 3I2IA 4MSVA 5I0TA 1BVP1 4COWA 1W6MB 2QFEA 1OUXA 3E97A 2R16A 3PVEA 2RV9A 1W8UA 2L9LA 4O9EA 2RR13 4Z07A 5FP3A 4HVQA 2HWB2 4XFCA 4K21A 1W9SA 2P3JA 3OEAA 5F32A 3RG0A 4Y3OA 2CYFA 4ATFA 3DEMA 4QPGB 1CESA 2D43A 3IDBB 3KV6A 1KXGA 2P3IA 1Y9MA 3DL3A 2E33A 3D6EA 3GBFA 4DXZA 5HCHA 4H3WA 1IS4A 5FLJA 4XAEA 1LGBA 1XNTA 3WP4A 4RGAA 3S57A 5JCTA 4YGCA 5J36A 3RZLA 2B39A 3WDXA 3A22A 1PNGA 3J8F1 1AR83 4UWDA 4YW7A 1Y3TA 4GB33 4MYEA 4AVTA 5BNPB 5A32A 2GH2A 1AR93 3T2TA 4HSLA 3M2MA 3SNMA 5FPAA 4FTBA 3MFCA 3AMMA 2D93A 4Q4Y3 4NR1A 3HOBA 3TEYA 1R1A2 3ZKYA 5FXZA 3HWJA 4BJ0A 4CDXA 2VZQA 1UPSA 1H6YA 4URTA 5BNOC 1UKGA 2BV4A 2D98A 3TB0A 1G6NA 5KXBA 2VR4A 1VRH2 3OGRA 2OT7A 4FT8A 3AKRA 2UY8A 4AL9A 2VW1A 3C7FA 3MPBA 1PO11 1FMD3 2F4PA 4MVTA 5FZ4A 1Q3EA 4KU7A 5JOWA 1UIJA 5E8AA 4Q0VA 4B4QA 1NA1B 1OD5A 2BWAA 4QXHA 5M0TA 1HX6A 1SACA 4XFGA 1JOPA 5C33A 4QGMA 1TMF2 1MZFA 4NO4A 3OBRA 2A1XA 4AGVA 1W2NA 3PVNA 3ES1A 1ZA4A 3F95A 3GDBA 3K4ZA 5AC93 1SFNA 2W1SA 2X53S 3KHCA 4YM1A 1MEC1 2WO1A 3IM0A 1HW5A 2DCYA 3SH3A 2XVKA 2VU9A 2ATFA 1FATA 2HWC2 3T2OA 2B46X 4K9SA 1E5RA 2NZ9A 2ZABA 1WCQA 4EQVA 1NY72 1OA3A 3E1F1 3SC7X 5FPBA 2OZ6A 1LU1A 1RUI2 3ZPOA 2RDSA 1RUOA 4SLIA 4W8JA 1X8MA 2GSYA 1VAVA 3BOWA 5CBLA 1J1LA 3VZKA 1CJDA 1OLQA 2EIEA 3OPTA 4BH9A 2GC1A 3UGFA 1MVQA 3LEKA 4Q5OA 1JXNA 4OVEA 4S2DA 4AI1A 3M8LA 3H8XA 2PAKA 5FYIA 3WQBA 1Z7S2 3ATGA 3VKLA 1ULDA 1SBEA 1CPMA 1OOPA 2W1QA 3V64A 1A8DA 4C8DA 1IKQA 3OYWB 1Y9QA 2WQZC 2OKXA 1RUJ3 4IV3C 1QQP3 3POFA 1G9FA 1AL0G 4O9GA 4U36A 1W6OB 1SCSA 2BOIA 2Z42A 4Y26A 1IQDC 2UWAA 3R05A 4PIXA 2VZ1A 1YWKA 3SLIA 4XIOA 1WCSA 4XZPA 5FZBA 4YFZA 1BEV1 5FJKA 1UU5A 2DFBA 4YWAA 4FFGA 5DAWA 4AEKA 4QQHA 1AX0A 5BNOB 5CYYA 1BBT1 5FZHA 1XU2A 2E9QA 3WV6A 4IEWA 4M3CA 5IT6A 2KD7A 2HKXA 3GCWA 3MLKA 4KQ7A 3LIHA 1BJQA 3VD7A 3I3BA 3HAGA 2E53A 4MX3A 4X6RB 4NHMA 3NKGA 2JX9A 5FZ7A 4A7KA 1ZRDA 5DAQA 2DTYA 2FZ1A 5CKQA 2HEWF 2A71A 2WS91 4RD7A 4NIHA 5D8AC 1JOBA 2JIGA 3MI8A 4Q4X3 4LHKA 3ZXDA 2R32A 2J1AA 3ILFA 1AR63 1MEC3 1D0HA 1N3PA 2V09A 3FE5A 3NJXA 4CDQA 5LRSA 2C9AA 4IV1A 1HXS3 1MS5A 2AEZA 3LQCA 5CKNA 1EY2A 1XSRA 3IIAA 5A6QA 1YC61 2WLPA 2YGLA 3P1IA 3VDDC 5DUWA 4C1WA 1VAKA 1RUF2 3KWVA 2VD7A 4NVPA 2DU1A 1O59A 5FMOS 4XQ4A 4LOTA 2EAKA 3MIDA 2K0GA 1ZREA 1X50A 4CCCA 1X82A 2RM22 4EWDA 4A7ZA 4UFIA 1KJLA 1WD3A 4NRQA 1JYTA 3IAPA 1VBD2 2XHKA 3KVAA 5A80A 1S0JA 2ZHMA 1YYNA 1LHUA 2XDVA 1ASJ2 3J9SA 4HK9A 5AVPA 4CPBA 1YXWA 3MUY1 1RUC2 3SKJE 1DQ4A 3A0NA 3WNXA 4ZXKA 4D7TA 2ZKNA 4E2QA 1LEMA 1LOFA 3PHMA 1E5HA 1VBA1 1V9U1 4RS5C 3V0AB 2VMIA 1G7YA 1GWLA 2EIGA 2JE7A 3I8TA 4WZFA 4B8EA 3NNLA 5JI9A 4GAZA 2XJQA 1XYOA 2DBNA 1RMU1 4IV3B 4J6GA 4LO8A 2VCAA 3HQUA 5DG1A 5EJ3A 3NJVA 4YZ3A 4ZY9A 3IMMA 4UW4A 1O91A 3WNLA 1PHMA 3H8OA 3C7HA 1QJY2 1ZBE1 2LUWA 3PTRB 2WO3A 1QDCA 4OZXA 4R9AA 5T3NA 1KFUL 4R9BA 3W59A 5DUUA 2JWPA 1NXMA 2NMNA 1QIQA 4N7UA 4FAGA 2B42B 1ZRCA 1CZSA 2ZX1A 3AP6A 2AEYA 1H9PA 3AYAA 1XE7A 1LOGA 5BNNA 3UNPA 5H9RA 2JDUA 1K12A 4XFAA 3MV01 3M1HA 3ELNA 5GZFA 3A21A 4XFHA 1AL23 1Z78A 4QM8A 2VQ0A 3VBSB 1IQAA 3RSJA 3T4HB 3WR0A 2JB8A 3VD9A 2W1WA 3Q8FA 5D8AB 4GJZA 1N1VA 5HBAA 3MF9A 3V0BB 1W6QB 4Y1ZA 4RGGA 1IPKA 4JTOA 1JMUB 2BRTA 4DQAA 1YQCA 1CAXA 3DPRA 4FOVA 4PI2A 3NV1A 2A6XA 3KT4A 2NLRA 4DXRA 3E6CC 3Q8AA 5F5CA 5FRAA 5FK8A 2B5HA 2VUAA 1PO22 5FYUA 1KEXA 2LALA 2GMMA 4ISRA 4K1ZA 4DUXA 4D0QA 2RMU1 1DDLA 5F3IA 3RMXA 1RC6A 2GNBA 1QJU1 3EBRA 5AVAA 1MQTC 4QM9A 1CPNA 2JG8C 3VBOC 4B7EA 1LOAA 5L7OB 2WFF3 3ROUA 1GP5A 1W6MA 3N4MA 3K48A 1YQ8A 4D94A 5C3RA 2QKDA 2WIIB 4EROA 5JUVA 2GDFA 2PHFA 2RS52 3O1PA 4RS5B 5FMOL 4CUCA 2V4VA 4PHZA 3FUQA 2MEV1 5DAPA 2CDOA 4CUAA 3VZJA 4PF5A 4FPLA 4QPGA 4BCUA 4XF1A 1MS0A 4BK5A 4RHV1 4LBKA 2EICA 1K5JA 2VTFA 3C8XA 4ATEA 5A70A 4MLOA 5FP4A 1OT5A 2QBXA 3NAPC 2GNMA 2EVXA 3GJAA 1XNBA 3POGA 4LBNA 5FYBA 2VQUA 5FYYA 1IS6A 3ZXAC 4LEJA 4A3ZA 3TAYA 4CU7A 5JOZA 1F31A 5LEKA 3DECA 5A7SA 3MUZ1 3K3OA 1JS9A 1HRV2 3O5SA 3OGGA 2JDZA 2JEMA 5BNPA 4Z82A 1JUHA 5ACA3 1AJKA 3LEIA 5SV5A 2GU9A 2OZJA 1BZWA 1W3XA 4BDVB 1DQ6A 4QPWA 4XUNA 5CB7A 1F5FA 3E5XA 3PMEA 1FPN2 4LKSA 2R0FA 1W04A 1LGCA 1RUH1 2P5BA 2ZMLA 1DQ1A 3RZKA 4QWNA 3LSDA 2JECA 3BIWE 4I30A 1IS3A 1BHGA 3RMYA 2BYVE 4P14A 4AFCA 4XDQA 4XQDA 3S7EA 4QB6A 1ZBA1 3FUOA 1QJX1 4FOWA 4Q4V1 3QH6A 1CN1A 3ZYGA 2RDRA 5AFBA 2BGOA 1DBNA 1NA1A 3B02A 3WDWA 5FO9B 1L7QA 2ZGMA 1XE0A 2DVDA 5IK4A 5LY1A 3J26N 5FY8A 4CU9A 4D6QA 2QTWB 3ES4A 3QBQA 4FPFA 1JBCA 5GLTA 1E5IA 1GZWA 2VO5A 3M7AA 4WBBA 3T0BA 2W1UA 3OB8A 3LPFA 4QD2A 4P9XA 1XBFA 1Q8VA 1PZ8A 5DDJ1 1MQTB 2Y6FA 1J84A 2JG8B 3VBOB 1PZ7A 2C1FA 1VBC1 5G05L 3RZJA 2ZX4A 4WM8A 4E4SA 1V6OA 2WNVA 5GZGA 3AKQA 1UY3A 3TN93 3MLLA 3KGZA 2GP5A 3ACHA 2A6YA 4OQ9A 4LKEA 2FDGA 3SEPA 2RDQA 1RUD1 1VIWB 1JUIA 4TWTA 4E27A 2ADEA 1ST8A 1EAH1 1PGL1 2V73A 1W28A 1ENQA 4XFIA 1O3QA 2G9FA 1XSQA 2XH6A 3U0ZA 5CG9A 3NAPB 4ZU4A 2R073 2W91A 3B7MA 3PUAA 3KCYA 4XUQA 3ZVXA 1ZNPA 3K2OA 4ZHNA 2YU2A 2BP6A 1LULA 3QLQA 3OYWA 5FYSA 5FXWA 2D40A 2TNFA 2IFWA 2SLIA 5JI7A 3JD73 1W6OA 3UT0A 1DYOA 3AKSA 1VBE2 2WNOA 4I2OA 2V72A 3WDUA 4O61A 1NOVA 2B4KA 5EYYA 5JZGB 3OBAA 3LIGA 5IJRA 2ZAHA 3HVDA 1H1AA 3HNBM 4LR4A 4ZU5A 1V6IA 4LBQB 1REDA 1MS8A 3BCWA 3CQOA 3N7JA 5BNOA 5EJ1B 1WUVA 4CUBA 4MXVA 1AYM1 2FDFA 1GMMA 2VCMA 2ZBJA 3VHPA 1GOGA 1WWYA 3AMHA 2X5IC 5JPNB 3ETQA 2FCVA 4F3JA 2A6ZA 3PNAA 2JICA 1GANA 4XFFA 2ZGKA 2ZGTA 5CISA 2JDPA 4BPZA 1ULFA 4WV8A 4CSWA 3WG1A 1O7FA 1DCSA 4YW1A 4HBNA 3JZVA 1VBA2 4ASLA 1WCKA 2VECA 1V9U2 2VZRA 3AJYA 3WQ0A 1NQDA 1RUG1 4JKKA 4ES8A 1OA4A 2W2IA 1RYYA 1JTZX 3K4AA 3K77A 4Y4YA 2OS2A 1AR71 3RYKA 1RMU2 3DCQA 1OF4A 1YO8A 1LKNA 2R1BA 4Y1UA 3WDYA 4XE9A 5FP9A 3WZ1A 4ASMB 1IS5A 4L8QA 4L9BA 4YFWA 4LHNA 2FD8A 4YM0A 2UU8A 1ALYA 5T5PA 1FNZA 1RJ7A 3I2HA 3MIBA 3AK0A 2D6NA 4AHXA 1YUDA 1J3QA 1IZ3A 1JW6A 3EQEA 3HJRA 5J37A 4N9IA 5HV0A 3G7DA 1BLZA 3UK9A 5HI0A 3HEIA 4AFDA 2VXJA 1D7PM 2Y38A 3FFZA 3LSEA 2JDMA 3I2KA 3O1TA 2NQYA 4XJ8A 2DDUA 4JKLA 4LIVA 1X8EA 5HCAA 5EZWA 3POBA 1UMZA 1U0AA 3V0AA 2TEPA 3HR9A 5FPLA 1TE1B 4AFAA 1NCQC 5H9PA 3U11A 1HB3A 1RUE1 1UZYA 2HWD1 2JG9C 3HN3A 1W6PB 3P3NA 1WLCA 4IV3A 1LCLA 4UFJA 3WF4A 4URAA 3OBZA 1YJLA 4META 1LAJA 1RVF2 2WAAA 5I0SA 1COV3 4YVWA 1OQDA 1D4M2 1VP6A 2YC0A 4JGZC 3MIGA 2WZPP 1VJ2A 4DB5A 3BU7A 5FMBA 1ZZBA 1NE4A 3I49A 1HRI2 1UXXX 4ORFA 3ZMOA 4I09A 1X33A 2CGOA 1A6CA 3MGUA 1NCRC 3AL6A 2WL1A 1CAWB 3NV4A 4G4FA 3O12A 4CP1A 1N1SA 4MOAA 2Y6LA 3IT8A 4OMDA 2PXJA 1F15A 4Q0QA 4YGDA 1EV11 5KXEA 1QDOA 2RS31 3NKTA 4Q0SA 1JYVA 1G9AA 2H6BA 3RS6A 1C4RA 4GKXA 4OULA 3VBSA 5DUXA 4HOOA 3MV11 2GN7A 4PLNA 5BY5A 5KHJA 2W68A 5D8AA 5CADA 2ERFA 4Q27A 5EHDA 5TSWA 3R4DB 4XMIA 1GUIA 4CTEA 3H8UA 4K20A 1ACCA 1PX3A 5IYYA 3W20A 1RUNA 2VVDA 3HT2A 3V0BA 1VBB3 2E7QA 1W6QA 1LHNA 2XLGA 3CU7A 1EUUA 3JBG1 1U5XA 2FDKA 1NZCA 4NPRA 4XBNA 4CU8A 1XNDA 2G19A 1GZ9A 2RS13 4RHV2 4KG0A 5JLVA 5A3PA 2BZDA 2Q0AA 4QGLA 3ZMNA 1UY1A 2FCTA 3ZXJA 1K45A 4V2VA 5FPZA 1CAUB 4GXLA 1AHSA 1ZM1A 4BQ4A 5FDBA 3H1MA 1R081 2EXIA 1SDWA 1CX1A 3LDBA 3IIIA 2QQVA 2B9UA 2NYYA 4IGPA 5FUPA 4QDQA 5L7OA 1Y4WA 3T0AA 2BGPA 1ULCA 4N53C 3VD3A 4BM8A 4A45A 3AZVA 4E4ZA 1KFXL 1WA4A 3AMPA 3KHBA 3N7KA 3P6BA 1J3RA 4RQPA 4UF0B 3O1OA 1O3RA 4RS5A 1UMHA 4TLFA 3IBMA 4DFSA 4EWEA 1RHI3 2ZZJA 4RA0A 1NCQB 5EIYB 3PLQA 1RINA 1QKQA 3EO6A 5A3TA 1PK6C 1DIWA 1C57A 2JG9B 2RG4A 3MIHA 3POYA 5FOBB 4EJRA 1POV0 1R1A3 2GC2A 3AMQA 1W9FA 3POEA 2VVEA 5IFPA 4JGZB 5E88A 1XU1A 4JAAA 5LW9A 2VJXA 2WA4A 1H1MA 4LLOA 4FVVA 5KHIA 3WW2A 2P1BA 2CNAA 2RHPA 2XGXA 4Q4V2 4QPYA 5I8TA 3BTXA 2VZ3A 3OG2A 4QHZA 1J3PA 5DAVA 1NCRB 1XXNA 5CAZA 1NX9A 4W4ZA 2R041 2RJKA 1WA6X 5IVEA 4XYXA 3ZSJA 3ZKUA 2PMWB 4PBPA 4DEQA 3AL5A 3USSA 1CQ9A 1RGSA 1OUSA 1S0GA 2RR11 2ZGRA 3NJZA 5DDJ2 3USUB 4AGRA 4BQ5A 4Y4RA 3RYPA 4BQ2A 5FZ8A 2E6VA 2RDNA 4XILA 1VBC2 4LBLA 2WT2A 2ZJCA 4W6WA 4NAOA 1K5MC 2WSUA 2VCBA 4IXLA 3OTFA 4KWUA 4DXSA 4O65A 3MLJA 4GALA 3RZMA 1WW7A 4YW5A 2DWRA 2Q5TA 2YXSA 1XNKA 1OBNA 4AZZA 4OI2A 3TNQA 5FYCA 2DCKA 1RUD2 2HWC3 4Y1VA 4Q1RA 3VHNA 1FAYA 4YG3A 5CEHA 1LOEA 4FTEA 1U5IA 2DTWA 5LWBA 4KBBA 4DO0A 1JZ5A 2A73B 1AR81 4NWVA 4XEZA 1X9TA 4GB31 4PBOA 1RUI3 3WF3A 2W95A 4COZA 4DXTA 2DVFA 3BGAA 1AR91 3ACGA 3L2HA 2XLAA 3NV2A 3NJYA 5FYZA 3OUIA 2VZUA 2WZEA 1GWMA 1LGNA 2QQJA 3B00A 1ENXA 2JE9A 4Q4Y1 1MQTA 5IVJA 5J48A 1SDDB 3VBOA 4RL7A 1ENSA 1O4YA 2ZCWA 1BMV2 1SLCA 3NL1A 4QHBA 1IPJA 3AX4A 4NJ4A 5CG8A 2GMEA 4N53B 2Y64A 4LUKA 3MPPG 4ONUA 2YY1A 4AG4A 5A3NA 2RJLA 3T1LA 5JPMB 4D3WA 3O1MA 4E9KA 1L7RA 3FMGA 2QNKA 5KHHA 3DXUA 1URXA 3I97A 4HKWA 1DG6A 1W2OA 1FMD1 4HVOA 1PK6B 3FJSA 1ND2C 3N9NA 3IDCB 1UYZA 5IK7A 1GOHA 1VRBA 3LZZA 2HWF2 3AKTA 4ZZ8A 1XYNA 1UWWA 3JQWA 1LR5A 1AYM2 3K4DA 3W5MA 2P3YA 4ES9A 1LOCA 1LEDA 2IXCA 3NAPA 4M3CF 2R063 3LWCA 3JUUA 4HXCA 5A6ZA 5C4WC 1W6NB 3N35A 4IE0A 1PM7A 3FX3A 1W8ZA 1N1YA 1HQLA 1POV3 1S2KA 2DUOA 2CWMA 3ZIWA 4D7YA 5A6XA 2RE9A 4AHYA 1W2TA 5F6KA 1PVC3 5GLWA 1JYWA 2LM3A 1QJZA 1QXRA 5AC91 1JZ3A 2PLV3 1HB4A 1ZZ9A 3UV9A 3O1VA 1RUG2 3HQXA 3ZDSA 2OPKA 4RYDA 1HN1A 2I45A 2AR6A 3M3IA 4PQQA 5JZGA 3VBFC 1UZZA 3SMHA 4LUMA 4Q4W2 4XCAA 3CLPA 1QH6A 4LNVA 5A7NA 3LOBA 2A6WA 1D2SA 4W6YA 5DUVA 1EPWA 3V65A 4IEXA 5DPNA 3VZOA 3E5UA 1JHJA 4MGIE 3WG4A 3LF7A 1Y7BA 2BEOA 3VDBA 4RN5A 2ID4A 2Z2SB 4BQWA 3DYMA 3MW2A 3ZM8A 1RUF3 5EPAA 4A7YA 3BTAA 5JMCA 2VZSA 3DUIA 5E16A 2PHXA 1YFXA 5LCWL 4OFGA 2XKOA 2X8KA 3IWZA 3WCSA 1TME2 3RGBA 2LTNA 5D21A 4CYDA 1AYN3 1LOBA 4RR3C 1IGOA 1HKDA 1DQ2A 4QT6A 1ZVFA 3OOXA 1SBFA 2PYTA 3GF6A 4CEYC 1RUJ1 3LPGA 4F83A 1QQP1 5L36A 1ASJ3 3TEXA 5J7MA 3ZFFC 1LNSA 1RUC3 4COUA 2YROA 1C5IA 2J1EA 1FT9A 2OPWA 4YARA 2YC2A 1F4HA 1DU3D 1JH5A 4NHLA 5CVRA 4GQ7A 1ZZCA 4MH0E 4KWKA 5T5JA 1SLTA 3WNMA 4DINB 4IDZA 2HYXA 4FPOB 2GN3A 1A34A 3MF6A 1US2A 4XF9A 4XIKA 1GV9A 4SBVA 4LO4B 2ZGOA 4N90A 4Y24A 3POSA 1SG3A 2JDKA 4Q8LA 1VALA 3E5QA 3M3OA 3ZYHA 1ND2B 4EYUA 1QJY3 2XJTA 4CPBD 3LA7A 1N1TA 5ANQA 1CONA 3TYJA 1DP0A 1Q5OA 5GM0A 3GM8A 5B2GB 4TN7A 4Q4X1 1UYYA 3EJKA 1F8VA 5F5AA 3A23A 4JDMA 1AR61 4K6BA 4E8CA 3OEBA 5DQ0A 5FIXA 3WP3A 5C4WB 1FX5A 4FFIA 5C70A 1ND3C 4LKFA 5KHGA 3JB4C 4X8PA 1HXS1 2A7AA 3ZN5A 1W6PA 3S5QA 2Q8DA 4E4DX 1V6LA 2PFWA 2QQLA 4HVRA 4NIAA 3N7MA 1XPWA 2A6VA 1QF3A 3DN7A 3KMHA 4MXWB 3UJQA 1HLCA 1G9DA 4LJHA 5EYXA 1J58A 3O1RA 3ZYPA 4HN1A 4MGTA 3VBFB 2BUKA 1R092 2OW4A 3ST7A 2FDIA 4NIDA 3GZUC 3EB7A 5SV8A 2BW8A 4CDUC 3VN4A 1YFUA 1BK1A 1UCXA 1CAWA 1XQNA 5IK5A 1ZZ7A 4V2WA 4Y1XA 3BTYA 2QQMA 4A4AA 1GNYA 4M4RA 4IE7A 2ZOEB 4OUEA 3B94A 1PO23 1QY4A 4CRQA 5E89A 4XTMA 5G04L 5HCFA 1Q56A 4EE2A 1DGWA 3CIHA 1M4WA 4RR3B 5FWJA 2WNUC 2XBO2 4CEYB 3VHOA 1KGYA 4YZ2A 2WBKA 3AYEA 3ZFFB 3GBWA 1ZA7A 5HPOA 1PVXA 4AQTA 2J1RA 4CP0A 2YBSA 3ENRA 1LODA 1OSGA 4GA9A 3KLSA 4WVMB 4IEOA 4LK7A 3J7NA 2J7MA 2RS53 3BOPA 2Y8KA 2ARXA 1ULGA 4WM7C 1UZWA 3DYPA 3OPWA 2CSGA 4D8MA 1SFYA 5I8YA 1CAUA 3RI9A 2F6BA 2P3KA 3C7GA 1W0OA 2ZX0A 4YG0A 1AL21 2Q1ZB 3B01A 2P6HA 4UFHA 1QXJA 5A3WA 3DGTA 3S30A 2WO2A 3FWEA 1OQEA 4FAHA 4GWJA 2D5HA 3VZNA 3VD4A 1HRV3 2QQWA 1UYXA 2VULA 3I2DA 4HETA 3MEPA 5JSRA 4L97A 2WAOA 4UF0A 4BIFA 4Q26A 2IVJA 1ND3B 1PMJX 4DIQA 4DOUA 5KC5A 2VW2A 4AR2A 1GP4A 2JG9A 5LATA 3OD0A 3OJBA 5LZ6A 1XC6A 1FPN3 4R52A 4BXSV 5JAXA 4JGZA 3FLPA 2QZ2A 3H42B 2FHRA 2O14A 1JN2P 3KS7A 4QKBA 3J7LA 2YV8A 4XOGA 4CCMA 5A1AA 4HKLA 1BKZA 2PN5A 2Y6KA 4XJAA 3EHKA 1CZVA 1HQNA 4CDUB 1C8M3 4YGBA 4B29A 1UU6A 1AR82 2XQRA 1ONAA 1NCRA 5L9BA 4GB32 2JD9A 3GCXA 5JOYA 4YM3A 2ENRA 2WKKA 2WFF1 4YRDA 4EN0A 1DGRN 2WZR2 5C9AC 2WABA 4L2NA 1IG3A 2YMZA 2VBBA 4IEUA 3APBA 3T2QA 5AFEA 3USUA 1VLNA 4P02B 4RFRB 4AQ6A 3WF0A 4PLOA 2HYKA 3WT3A 5IAVA 3FFQA 1ULEA 2D3SA 5FAXA 1HV0A 2WNUB 1O8SA 3T1MA 3ZSEA 2Y0OA 3OGSA 1FOD2 1MR5A 2KM2A 4IUGA 1G8WA 4H55A 1OFSA 2BTVC 3I59B 3K75B 4QHOA 4COYA 4MADA 2DUPA 1A78A 1GBGA 4FPHA 2QQIA 4WM7B 1IHMA 1STMA 4BLIA 4BZ4A 4XW3A 4LE4A 5ACA1 2JDAA 4Y22B 1LTEA 4IL7A 2DU0A 5GJ6A 1WW6A 2QQOA 3MIEA 1PNFA 4IW3A 3PJQA 1W05A 1DFQA 2W08A 3KV5A 5EWSA 1L3JA 2R7EB 2XWJB 2VM9A 5GZEA 5HV4A 2EIBA 4QXKA 1TG7A 1GICA 3H1WA 3LA3A 4IEQA 2ZGQA 3AYCA 4N53A 4IEZA 2BGCA 3CDZB 4XXPA 5FZ1A 3VDDB 3U78A 1QOSA 3HN1A 4FI9A 1YHFA 2ZS6B 2PQSA 3OUJA 1WLDA 1VBE3 1I5ZA 2Y60A 1O4TA 2K9ZA 5FZDA 1PK6A 4MV2A 2YDEA 2AACA 2XR4A 4K40A 3KCCA 3E6BA 4LBJA 2QQUA 1OKQA 1DGWX 3J8F2 4P00B 4C91A 3GZAA 2Z4FA 4IGQA 1OC1A 1YJKA 3H8RA 4L11A 3D82A 3N9QA 1AX2A 1W6NA 3U1XA 4FOYA 1Q8OA 4N43C 2PHUA 1P8JA 2O8OA 1NQJA 4OCTA 4EWAA 3FBMA 4B3NA 3PIGA 3LKJA 1W90A 3NNFA 1H0BA 1OLMA 4AVBA 4YLZA 5C9AB 5FBJA 3TN91 4LLFA 3I3DA 1QWRA 1VMFA 5I91A 1E57A 1GQPA 2BQPA 2PHRA 3U37A 4ET7A 1W39A 3ZFEC 3ILRA 1PO12 3V56A 4TYSA 4HMZA 1MS4A 4TXWA 4CCNA 1I9RA 3TOJA 1UMIA 1UQXA 3CF6E 4KWJA 5FZEA 5BUVA 1XNAA 3W58A 1WBFA 3H9AA 4KI5M 4ARXA 2QQNA 5A7WB 3VBHC 2OIIA 2BNOA 1AF9A 2J1TA 2R071 4FP3A 1HB2A 1V0AA 4JC1A 5T5LA 5CNAA 1PGW1 2VMGA 2GAUA 2J1VA 2CGNA 5CFDC 3CL1A 1JYIA 5IFTA 3JD71 2Q8EA 1MEC2 2FMDA 3WDVA 4DMIA 2GC3A 2IC1A 4OQ8A 1BYHA 1UOJA 1UYPA 4P9GA 1MPXA 3JB8A 2DVGA 5LBBA 1HXS2 2LROA 2PTMA 3PIJA 1HIXA 4QX8A 4XBQA 4AFBA 4OLLA 1DQ0A 4QQPA 5HCBA 4A2UA 4QX2A 3QOPA 5T54A 1QJEA 4HL0A 1IOAA 2AENA 1V6NA 5EP9A 4XZUG 1S0DA 3T30A 2JDHA 3ZPYA 3G6JB 4C0HA 1VAMA 3VZLA 1PMIA 4BWOA 4YM2A 1RXGA 1RVF3 3KV4A 3QACA 1D4M3 2OQ6A 2B8MA 3KF3A 5ABJC 1T6BX 1ND2A 3KT1A 2EIDA 4WVVA 1H6XA 4AQ2A 1NLRA 1QEXA 4NPMA 3I2FA 3UETA 1HRI3 1ZZ8A 3T09A 3CMGA 1XB9A 3NVCA 1NUKA 1GNHA 4OHYA 1TQ5A 2MNGA 5FY0A 1CIYA 4JQTA 4GZ9A 4Y1YA 2BOJA 3OGJA 1DZTA 5C4WA 4Y5SA 1Q8QA 2VMFA 4N43B 3H50A 4QKDA 1BEV2 1SZBA 3L9JT 2GNDA 4XC9A 2WN2A 5T52A 4NHXA 1BBT2 1V6JA 5H9SA 3TNPB 4CDXC 1GZCA 3VBFA 4UXAA 2GNTA 2WINB 3AZXA 2LW8A 2W3JA 3PTYA 1DGLA 3JCIA 3ZFEB 2ZA9A 4BA6A 5C8CC 5IVCA 2VCCA 2ZMKA 1V70A 3FC0A 4KGQA 4CCLA 1ZRRA 3QD6A 2WS92 2AYHA 5GLUA 2X09A 1SLBA 3AVRA 1JU3A 3I2JA 4AVSA 2KXLA 3VBHB 4HZFA 4EN6B 4Z92B 3FHQA 1AL22 4DUWA 1S0FA 5JXJA 3RVHA 5IWFA 1APNA 3RRDA 3WF1A 1YQ5A 3N9MA 1DQ5A 4J1XA 3KZ4C 3AZZA 4JRLA 4L99A 4RR3A 5CFDB 2TBVA 1W8TA 4CEYA 4JRAA 1H8TC 3VB9A 2VQAA 1YNAA 4YVSC 3BYWA 5CIRA 1COV1 2HEVF 1CZTA 3I4IA 2G4IA 5A1LA 2F17A 3VZMA 4QMAA 3U14A 3LFIA 4GWIA 1BCXA 4WVMA 2VG9A 4K8RB 4A41A 4LHLA 4FFHA 4MGKE 5FY5A 3MYXA 5D1IA 2C24A 4ARYA 1WW5A 3K3NA 4UW3A 1DZRA 4Z8BA 4FXKB 1WD4A 2PQQA 4CCEA 1YFWA 1O3TA 4GMP0 3M3EA 2HH9A 1PIV3 4NN0A 5ABJB 5LRRA 2WQ4A 5B4NA 5D2AA 4ZS3A 2YFUA 1UAIA 1L7LA 1ODMA 5FY9A 3GXUA 1H30A 3OCPA 5IAXA 5C5TA 3BIEA 2HWE3 2ZKLA 5KXDA 2E31A 1DYKA 3MW3A 2YBPA 1YFYA 5EXOA 4CDWC 5A3LA 1VBB1 3S5AA 1ND3A 1PZ9A 4XJUA 1W2UA 1B35C 3B5LB 5E1RA 1H2KA 1ZBE2 2F4LA 3POJA 3AC0A 3AXEA 4LE3A 5FZKA 2GZWA 4NIGA 1KRIA 2RS11 1GQHA 2IXLA 4XJZA 4TLGA 4A3XA 4D6RA 3RDIA 2QJVA 3FHAA 5IW0A 4CDXB 5JDBA 1DHKB 4H14A 4PDWC 1OPMA 1SEFA 3B93A 4QX1A 5C8CB 5A7OA 3JQXA 3BU0A 4OHWA 4XDOA 1UZ0A 2BU9A 3AYDA 1EP0A 2D44A 4QKFA 2W9XA 3UGHA 2YB7A 5FKBA 5A6YA 4OI0A 4NHYA 1VB2A 2D3RA 2XKPA 2QQKA 1KITA 3AP9A 4AF9A 3GALA 1LJ7A 3FBYA 4XUTA 4M0NA 5J96B 3NO8A 5C3SA 4V1PA 1RHI1 2HBTA 5FZGA 4QB1A 3THCA 5FXXA 5I93A 1RB8G 1WMFA 3H1YA 2WNUA 2XJUA 1H8TB 1C5HA 1HJFA 2SBAA 2WC2A 4FXGB 1R1A1 4AWDA 4YVSB 2VW0A 2WT0A 1PM4A 1XE8A 5CKMA 2H0VA 1OLME 3I59A 4QX5A 3VGIA 4D69A 2VGDA 3MICA 3HMYA 2IWGB 2RMU2 2ETEA 1OXCA 3BUCA 3MFAA 4N7IA 1ZYBA 4P9IA 4WM7A 2X5IB 1MS3A 1QJU2 3OY8B 5F5QA 4Z2WA 2QE3A 3N9OA 5FPVA 1RL3A 5A7QA 3RWNA 4Y22A 4AI9A 3A0KA 1UY4A 3INAA 2HWF3 2WSVA 1QOOA 2WA3A 3PU3A 1S0BA 4O7XA 3I2OA 1PGSA 1XNCA 3IN9A 2VTXJ 3OGVA 4XABA 2PHWA 5FY7A 1LOFC 5LBEA 2MEV2 2WRAA 4EZHA 2UY9A 4M4PA 4I0WB 1UL9A 4GJYA 4F7ZA 2ZEZA 3D0SA 3R4SA 4GMP3 3VDDA 2HWB3 1C28A 1OFNA 5GALA 1LESA 4YG6A 3CEWA 4R8HA 4CDWB 4EV0A 1DLCA 2XUEA 3R6SA 1QOTA 1B35B 2C4XA 3ZYJB 2D6PA 1UOFA 1W8HA 2HWC1 1K42A 3RWKX 1WZXA 4Q4W3 1ZRIA 1UU4A 4AVVA 3GHNA 1CWPA 1NY71 2O0OA 3WSOA 2ZPXA 2Q1FA 1GYKA 1C1FA 2WNEA 2LRPA 4KBZA 1RUI1 4LO7A 2Q1MA 4PDWB 2R072 4BQ1A 1EYBA 1PGW2 3ZOIA 3ZYRA 2AZ5A 5DN2A 3ASIA 4BK4A 2GMPA 2FQPA 2Z69A 4Q29A 3JD72 1PX4A 3WLUA 2YPJA 5C5UA 5K9YA 1RUH2 1TME3 3EXUA 4A6SA 4BU2A 5DZGA 5C9AA 4Q0PA 3LDRA 3ACFA 4L0PA 3VBRC 4NUBA 5T55A 5DG2A 4ZU7A 4YW3A 2HLEA 2XVGA 4LQRA 4CXWA 5FPXA 1ZBA2 5KR7A 5BXXA 1QJX2 1VRH3 2OA2A 2PHLA 1O5UA 3WNPA 4CU6A 4MGQA 2IXJA 3GGLA 1X9PA 1OURA 2JB4A 5A7WA 2ILMA 2R061 4CCKA 2YHJA 2Z5WA 3HQRA 4J1WA 4JX0A 5FUIA 3AXDA 3ON7A 2ET1A 5A7PA 3ZXGA 3AJZA 3LDKA 2W92A 2OUHA 5BPXA 3WQ1A 4XTPA 1IKPA 1POV1 3VKMA 3SCFA 3M70A 3CZUA 1PVC1 3ZYIB 2XG3A 2PLV1 5KHKA 1NZIA 2D6KA 1KDMA 4JV4A 1TMF3 4BQ3A 4NOTA 4OHZA 3R4UA 3HT1A 3M4FA 1EUTA 2R0HA 1IPSA 3C7OA 5GLZA 3VKNA 4CCOA 4UW5A 1KDKA 3CO2A 4S2FA 3KV9A 1OD3A 2VMHA 2XJRA 4XJ9A 3VBUC 1SBDA 1EAH2 4GULA 1PGL2 5LA1A 4INDA 2YC4A 1H2MA 3AP4A 3O0WA 2CWSA 1I5PA 3RFRA 2A3YA 1RUF1 5KC6A 4M01A 5F8PA 5FMDA 3PVBB 1R093 3HD8B 4P5HA 2FBEA 1JODA 4YW2A 1C1LA 4OZOA 1AYN1 1XJAA 1LENA 1SMVA 4XQWA 5APAA 2JG8A 1PMHX 2CAVA 1UKRA 1ASJ1 2ZGPA 1O8PA 3FHIB 1Z7S3 4UT5A 1RUC1 4XHXA 1AZDA 3J4UH 1H4GA 3UGGA 2NP0A 1B09A 1V6MA 4N43A 1HQWA 2IXIA 2VUJA 3ZO0B 5FREA 3OF1A 5IVYA 4MO3M 3U4XA 3B9CA 3KSCA 1YI7A 5C6CA 2JDYA 2OX0A 4TSVA 2DBIA 5A1FA 4B4RA 5FV3A 2OUJA 3MO4A 1I1EA 2OVUA 2XBO3 2AH2A 5FZOB 3VBRB 3WINE 3SCHA 4NE9A 2VOXA 3D0JA 3ECQA 3IPVB 4DRVA 4NROA 3ZFEA 4FPJA 2AC1A 4XXAA 4Q1PA 4NAMA 1FI2A 4IEVA 3VKFC 2VXRA 4CEWC 1QJY1 4BYYA 3CNAA 2WZ8A 1R1ZA 5K7PA 2EXHA 3EYPA 1BXHA 2QVSB 2WT1A 2JKBA 2W87A 3OD4A 3PMSA 4LORA 3VBHA 4CUGA 2BFUS 2D6OX 4JZRA 5A3MA 3A4UA 4NWWA 4P5YA 4E2SA 4E4HA 1WMEA 2PHDA 5FY1A 2WYFA 3WOGA 1BVVA 1N47A 2EA7A 2VC9A 5FTTC 1AR72 1TNFA 2DV9A 2VZVA 3KCXA 4XF0A 5CFDA 4CCDA 4KL1A 2R49A 3WNKA 2C26A 4LBOA 4LBQA 1ODNA 4UYBA 1D4VB 1VBB2 4HPKB 1OI6A 1UX7A 4LOSA 3VDCA 2D6MA 1K5MB 2W94A 1LU2A 4WM8C 5LBFA 2WNVC 2G9GA 1O5LA 3LD8A 2BBVA 4JHTA 4C90A 2RS12 3AP7A 2WJSA 4N9HA 4RFT0 5EJZB 1V6KA 2OYZA 1DGRA 1QMJA 2XQXA 3VBUB 1HDKA 2Q4SA 2JDNA 3GHMA 4UFLA 5C71A 3RZHA 2B9VA 2JKXA 2OQ7A 2RM23 3O7OA 2XOMA 4LMFA 1VBD3 1UIKA 3ACIA 1N3QA 2I07B 3GNEA 3H3ZA 4ASKA 5ABJA 4CCJA 1PO21 1FV2A 5F3EA 4NRMA 4BQYA 4IGOA 2VMEA 2IXKA 4AVCA 4GH4C 1RUE2 4JDOA 5ERLA 2HWD2 4AGGA 2D7FA 2I2SA 1NYWA 1UW8A 2YPDA 4I01A 1C8NA 3PL0A 4IQPA 1SLLA 1WMXA 3GJBA 2YGMA 1RITA 1RHI2 2WYSA 1J1TA 3CHXA 1NAEA 2WZR3 1YRZA 3CJIC 5LY2A 4B4PA 1W9YA 1W9WA 2FZ2A 3WCRA 4ZXEA 2RS51 2OXBA 2FDHA 1HN0A 1POQA 2R30A 2WN3A 3HPNA 5C8WA 5FPUA 4G9SB 4H7LA 4FPGA 1KD7A 1OH3A 4WZCA 5F2SA 1RXFA 4YZ4A 2B7YA 1QH7A 1UOBA 2BDRA 2YYOA 4L92A 5FOJB 1FXZA 2CY6A 1EV12 1YIFA 3Q8BA 1FOD3 2RS32 1GLHA 1XRUA 2CAUA 2X29A 4LK6A 5C8CA 4ZKTB 4CEWB 4CP9B 1RJ8A 1CR7A 2P37A 1BK0A 4YW4A 3ILNA 5DXDA 4AHWA 1HRV1 3THPA 4LTAA 4PIZA 5CU1A 3MHZA 3H7JA 4HK8A 1H2NA 3JBG2 3KVBA 2IUWA 4XUPA 5GKAC 3O0XA 4MGZE 1NG0A 1GZWB 2EXKA 2FMYA 3H0OA 4IE6A 4DEVA 4YZ5A 5FR3A 3BN6A 3SXWA 1H8TA 3DV8A 3L2YA 4LBMA 4TTGA 1OVPA 4YVSA 2WWJA 5FJHA 1FPN1 4QGNA 5FMCA 3VL9A 1I6XA 1ULPA 5J98B 1U5YA 3HIFA 4WM8B 3UESA 4DZGA 2WNVB 4XDPA 3PUQA 4AOCA 5F7UA 2Y26A 4KMQA 5KXCA 3DKWA 1KS5A 1R082 1FNYA 1OA2A 2BVVA 3AZYA 3RQ0A 3U07A 1C8M1 4Z2AA 5F9TA 2BFUL 2X5IA 3OY8A 4UFKA 1OH4A 5FYTA 3PURA 3NNMA 3SEEA 1QU0A 2XUMA 4BE3A 2D97A 2UYBA 2CTVA 2WQ8A 2O8QA 2XWBB 3PUSA 3W21A 4CZSA 2YU1A 3J8F3 3PDQA 4QPIC 2ZACA 4IE5A 1AXKA 4Y5Z0 1ZRFA 4BQXA 1W8FA 2UWBA 2VL4A 1UPIA 2ZHNA 2RJ2A 2ET7A 2VOKA 3S6PA 3TRSB 2YG0A 3WHUA 3IMNA 4GH4B 2GC0A 4NHKA 5JIUA 2C5DA 4FSJA 4QDSA 5K0UC 1OQ1A 1WLWA 2YUEA 4CDWA 4FPEA 2HJIA 2VMCA 3MIFA 4QU2A 4E2GA 1KS4A 5FYVA 2VOWA 4I3PA 1B35A 4YVWC 4EZ4A 1OMIA 3CJIB 3H3LA 5JR2A 3N3HA 4QXCA 5E6HA 3WUDA 4FQZA 2ZHLA 3ZFGC 3C2UA 4LULA 2IFRA 4W6XA 3W5NA 5FXVA 3TWIA 1PO13 4GKYA 3T4VA 2UURA 4PDWA 2ADDA 1S4CA 2R042 2R062 2VY0A 4UBGA 3ZIXA 1LHOA 3KD4A 4UAPA 5L9RA 2RR12 5FY4A 1PVC2 4MHRA 2LS6A 4OMCA 1J59A 4AW7A 2PLV2 1NCQA 3VBSC 1SLIA 4FCAA 2AREA 1NE6A 1W0PA 4LT5A 4HLTA 4QX3A 3SQOA 1QGLA 2CHHA 1YI9A 2VMDA 3F2ZA 4XFBA 3LE0A 3MDPA 2BBAA 2DUQA 1G9BA 3D5OA 4BHPA 3WHTA 3VHRA 1VBE1 4HONA 2CDPA 3HNYM 4JTNA 1JYNA 5FLIA 3X29B 2W47A 1ZX5A 4JGYC 3ZR6A 4AEJA 5I0UA 4PI0A 1NXD1 3TEZA 4N8MA 2NN8A 3BTZA 4K7JA 3WF2A 3B3QE 1UZVA 1U12A 2EAAA 1F5JA 4OHXA 4LITA 4M0HA 3O1UA 3ZLIA 1AR92 1H4HA 2Y6HA 4I02A 3RI8A 4BISA 2WLQA 2Y6JA 5DAXA 4LO6B 3WDTA 5F1RA 2GP3A 1W9TA 1AYN2 4JQRA 1MZEA 1GU3A 2XONA 4HN0A 4MGYE 4Q4Y2 1W06A 3SISA 4FOQA 2W0XA 5FYHA 1A8MA 3DF0A 4HT1T 5FP7A 4CP2A 4KG8A 5L7OC 3ITQA 1WLTA 3CKHA 3ZXFA 3FN9A 4QPIB 4LA3A
chains in the Genus database with same CATH topology
3UKNA 2IXHA 3I7DA 3H3UA 3LGRA 5FO8B 4RQPC 4K8FA 2ZGSA 2BPA2 3URFA 3ZSKA 3ZX7A 1YLLA 1FMD2 4U2AA 1G9CA 5K0UB 1REEA 4K3UA 4AVAA 1BEV3 4XF4A 1MZ5A 4AFMA 1C3HA 4PJYA 5CFCC 4YVWB 1REFA 2EALA 1BBT3 4P9JA 2JENA 5BYNA 3SH5A 3SH4A 5T5OA 1GFF2 3NV3A 4KU8A 3ZFGB 1DYPA 2R6QA 2P34A 4OHVA 2EF6A 3ZSMA 4QQ2A 3VV1A 3H7YA 4YYOA 5AC92 2QQPA 3ZSLA 1LB2A 2D3PA 4XHBA 2WS93 3NWKA 4DNYA 4YNIA 2PAMA 3P3PA 4DRRA 3UKTA 1CJPA 1CAVB 2GH8A 2AUYA 2EXJA 1AVBA 3VBRA 4R9CA 4X6QB 1SCRA 3IPVA 1S55A 4BMBA 1RVF1 4MZUA 1OHFA 1LECA 1D4M1 3SITA 4AEDC 3WG2A 3MZHA 2HEYF 4JGYB 4Y20B 1T6GC 3HBZA 1AX1A 2ZX3A 3N7LA 1V00A 1HRI1 3O0VA 1Q8SA 1RUJ2 1QQP2 3WXPA 1S1AA 4JDNA 1QNYA 1SQ4A 3AFGA 1UX6A 4WVZA 3KT7A 5GLVA 4DS0A 2E7TA 3UL2A 4XMAA 1CIWA 1VBA3 4I0AA 1V9U3 2DVBA 3S7IA 3VLBB 3AZWA 1F2NA 3THTA 4HPKA 5A33B 4XPVA 3RJ2X 3FLRA 1K5MA 3ACLA 3UJOA 1GR3A 2YZ4A 4Z1VA 1RMU3 2BVBA 2Q8OA 4AK3A 4B7KA 4RQPB 4GWNA 4HKOA 4QQOA 2N7GA 3BODA 1ZBE3 3VBUA 3WW4A 2ZTNA 4COVA 1AXYA 4Q4X2 5CFCB 2AGSA 2XJPA 4P9WA 1AR62 3ZN6B 4ISQA 4GWMA 5JIAA 3O14A 3D4KA 4FP2A 2NPIA 3WP6A 4XETA 2QCSB 4EN9B 1LRHA 1FYUA 1MZ6A 4AQSA 5FO7B 2A3XA 2DURA 5JZGC 5FQ0B 2XB6C 3LB9A 4EN8B 2ZHKA 4TZDA 1GQGA 2JD4A 2R1DA 4IEYA 1UF2C 1ZZ6A 3WW1A 4EN7B 3GZTB 1H2LA 3AP5A 5FCCA 3ME2A 1NLSA 1QXPA 4WVWA 1JYCA 1C8M2 2Q30A 1PIV1 4AEDB 4CEWA 1GNZA 4K1YA 3E6DA 1FV3A 4HFSA 4AYUA 2HWE1 2RMU3 1JOJA 3D8CA 2VPVA 2VOVA 5H9QA 5KBFA 1QJU3 1XYPA 2KA3A 3NSTA 2Y0IA 4MXWA 4FPYA 3ZN4A 2ZGUA 4M3CE 1BQPA 2ZX2A 2UWCA 4IETA 2MEV3 1AXZA 1WCDJ 2PA7A 3RJRA 5J09A 1OPOA 1CVNA 4RHV3 1UD1A 2E51A 2ARBA 3AM2A 1U5ZA 2VNGA 2DVAA 2PAEA 4PQ9A 4Q0UA 3ZXLA 5BV6A 5K8SA 3ZFFA 3WW3A 4I3GA 1AUYA 1I3HA 4GH4A 3Q9OA 4YGEA 1LHWA 5FLHA 1S2BA 1BMV1 4G3YC 1RUH3 3WX5A 3CJIA 4R9DA 3BB6A 3JU9A 5I0RA 2NMOA 2DCZA 1S0CA 3I54A 5LK7B 1ZBA3 3M3CA 4PIYA 1QJX3 3PVOA 2BNNA 2WFF2 4Q4V3 2HWF1 3B69A 1OOPC 4C0BA 1MS9A 3VUOA 1A3KA 2QDNA 1OLRA 3NW4A 2XJSA 5A32B 3SCGA 1H9WA 3VKOA 2QDRA 4F8AA 3C3VA 3AKPA 4GMP1 5DDJ3 2HWB1 4YZ1A 5FFOC 2W39A 1TNRA 1VBC3 3BALA 3WUCA 1YCIA 4X8NA 2QZ3A 3W9AA 4Q4W1 4H7MA 5FBZA 2BWCA 4CDUA 5L73A 4BIOA 4ITCA 3AFKA 4AE2A 1VR3A 4S2HA 1Q43A 1RUD3 3RZZA 5ACA2 2XL9A 1EAH3 1WGPA 5EV7A 1DF0A 4XJWA 2ZMNA 2VVFA 4W65A 3AMNA 1MS1A 2XLFA 1AJOA 2XVLA 4IESA 4CDQC 3LCPA 2I74A 4UBHA 3KM5A 1TME1 4IV1C 4LO5B 4UW6A 4QPIA 1CD3G 2A75A 4KGGA 1N3OA 2DFCA 2JXAA 4FBFA 5JR7B 2WWSA 4DPNA 1WBLA 5F6LB 3BPZA 2V5YA 2NM1A 2WFPA 3RNSA 2IZWA 1H1IA 2UYAA 3WP5A 5K0UA 4AI2A 1VRH1 1X36A 5KWRA 4IERA 4R4ZA 2A5ZA 2ZGNA 2XJVA 1HV1A 2DCTA 4JCKA 5I8SA 1ENRA 3ZFGA 5JSPA 1AYM3 1S0EA 5HXVA 5JVVA 5JSOA 1Y43B 1VB4A 4FTSA 1EPZA 4AI0A 4GIQA 4JVAA 1TMF1 3IKWA 1OOPB 3TN92 2DF7A 2K2SA 4M00A 3N36A 3LA2A 2PELA 2VNRA 2ZAAA 4OUSA 3QH7A 1TEIA 1RUG3 1CAVA 2DYCA 4HSJA 5BNQA 3FZ3A 3LOIA 2GALA 3ZXEA 4AHZA 1AR73 4Q2FA 5JWPA 5DZFA 3ALQA 3WY6A 5BNNC 4JGYA 1R091 4OI4A 4M3CB 4Y20A 2VNOA 4OUMA 2E7AA 4D7SA 4FO9A 3U10A 3R0RA 1CGPA 2CGPA 1Z7S1 2Z79A 4XBLA 5IUQA 3LAGA 1S0IA 3WD5A 4C1XA 2D5FA 4CDQB 3S0MA 4LBQD 5A33A 1X7NA 4IV1B 1MVEA 1RUE3 2ZZQA 2ZGLA 3DPRC 2HWD3 4XF3A 1KJRA 3AB0A 5KHHA 4I0BA 2XBO1 5LK5A 3RPQA 1YIPA 5CA6A 5T50A 4DY5A 3FLTA 2MPFA 4AXOA 2PHTA 2QUOA 4PCRA 3B9IA 5CFCA 1PIV2 1M06G 4P9YA 3ZN6A 2B45X 2W52A 1O4ZA 4PLMA 3CJXA 2P2KA 2C0ZA 3SHRA 1LHVA 2HWE2 1EV13 1DLLA 2CV6A 2RS33 3KGLA 3UKVA 1QNWA 1Z0HA 2CL2A 4AI8A 4QPGC 1Q8PA 4HANA 5FQ0A 1O3SA 3IDEA 1RIRA 4AI3A 3JBG3 5GZCA 2MHFA 3PJYA 4BLJA 4R4XA 2DCJA 2RM21 5GZDA 4BMEA 4FPCA 3VL8A 3WG3A 1VBD1 1WMDA 4AEDA 1CX4A 1JHNA 5BNPC 5BNNB 2H0BA 2VH9A 1RTVA 4S2GA 5LEJA 5IK8A 1R083 3GYDA 3POWA 2JJ6A 4DY3A 3QCWA 4MUVA 1UN1A 2D6LX 1GKBA 2O1QA 5L19A 1COV2 5DZEA 4BOWA 4LA2A 4KH9A 1MACA 4RSUA 2WZR1 2ES3A 5JOXA 1GSLA 4KWLA 4QQLA 4YSFA 1D2QA 3GBGA 3RYRA 3M3QA 1F9KA 3MW4A 2TUNA 3K51A 1D0GA 4FQ4A 1CAXB 3DPRB 2E63A 4IEPA 1DZQA 1WW4A 1FOD1 1NA1C 4KNCA 2A3WA 3WQ7A 4P9LA 1G86A 4AEMA 4FPKA 2BNMA 1H8VA 3ZXKA 3WVJA 4OI1A 1QHDA 1SLAA 2XPJA 1KQRA 3KB5A 5J3UA 2H6CA 4Q8KA 5EFUA 3OPZA 3TBDA 2A70A 2P17A 3OBTA 2R043 5I0TA 3KQRA 4MSVA 1BVP1 4COWA 1W6MB 2QFEA 3E97A 2R16A 3PVEA 4HVQA 4O9EA 2RR13 4Z07A 2HWB2 4XFCA 4K21A 2P3JA 3RG0A 2CYFA 4ATFA 4QPGB 1CESA 2D43A 3IDBB 1KXGA 2P3IA 3DL3A 3D6EA 3GBFA 4DXZA 4H3WA 1IS4A 5FLJA 1LGBA 3WP4A 4RGAA 5JCTA 4YGCA 5J36A 2B39A 3WDXA 1PNGA 3J8F1 1AR83 1Y3TA 4GB33 4MYEA 4AVTA 5BNPB 5A32A 2GH2A 1AR93 3T2TA 4HSLA 3M2MA 3SNMA 4FTBA 3MFCA 3AMMA 2D93A 4Q4Y3 4NR1A 1R1A2 3HWJA 4CDXA 1UPSA 4URTA 5BNOC 1UKGA 2D98A 3TB0A 1G6NA 5KXBA 1VRH2 4FT8A 3AKRA 2UY8A 2VW1A 3MPBA 1PO11 1FMD3 2F4PA 4MVTA 1Q3EA 4KU7A 5JOWA 1UIJA 5E8AA 4Q0VA 4B4QA 1NA1B 1OD5A 2BWAA 1HX6A 1SACA 4XFGA 5C33A 4QGMA 1TMF2 1MZFA 4NO4A 3OBRA 4AGVA 3PVNA 3ES1A 1ZA4A 5AC93 1SFNA 2X53S 4YM1A 1MEC1 3IM0A 1HW5A 2DCYA 3SH3A 2XVKA 2VU9A 2ATFA 1FATA 2HWC2 2B46X 4K9SA 2NZ9A 2ZABA 1NY72 1OA3A 2OZ6A 1LU1A 1RUI2 1RUOA 4SLIA 1X8MA 2GSYA 1VAVA 3BOWA 5CBLA 1J1LA 3VZKA 1CJDA 1OLQA 4BH9A 2GC1A 1MVQA 1JXNA 4OVEA 4S2DA 4AI1A 3M8LA 2PAKA 1Z7S2 3ATGA 3VKLA 1ULDA 1SBEA 1CPMA 1OOPA 3V64A 1A8DA 1IKQA 3OYWB 1Y9QA 2WQZC 1RUJ3 4IV3C 1QQP3 1G9FA 1AL0G 4O9GA 4U36A 1W6OB 1SCSA 2Z42A 4Y26A 4PIXA 2UWAA 3R05A 1YWKA 3SLIA 4XIOA 1WCSA 4XZPA 4YFZA 1BEV1 1UU5A 2DFBA 4AEKA 4QQHA 1AX0A 5BNOB 1BBT1 1XU2A 2E9QA 3WV6A 4IEWA 4M3CA 5IT6A 2HKXA 3MLKA 4KQ7A 1BJQA 3HAGA 2E53A 4MX3A 4X6RB 4NHMA 3NKGA 2JX9A 4A7KA 1ZRDA 2DTYA 2FZ1A 2HEWF 2A71A 2WS91 4RD7A 5D8AC 3MI8A 4Q4X3 4LHKA 3ZXDA 2R32A 3ILFA 1AR63 1MEC3 1D0HA 1N3PA 2V09A 3FE5A 4CDQA 5LRSA 2C9AA 4IV1A 1HXS3 1MS5A 1EY2A 3IIAA 2WLPA 2YGLA 3VDDC 5DUWA 4C1WA 1VAKA 1RUF2 5FMOS 4NVPA 2DU1A 4XQ4A 2EAKA 3MIDA 2K0GA 1ZREA 1X50A 1X82A 2RM22 4EWDA 4A7ZA 1KJLA 1WD3A 1VBD2 2XHKA 1J59A 1S0JA 2ZHMA 1YYNA 1LHUA 4HK9A 1ASJ2 3J9SA 5AVPA 1YXWA 1RUC2 1DQ4A 3A0NA 3WNXA 4ZXKA 4D7TA 2ZKNA 4E2QA 1LEMA 1LOFA 3PHMA 1VBA1 1V9U1 4RS5C 3V0AB 2VMIA 1G7YA 2EIGA 2JE7A 3I8TA 4B8EA 4WZFA 5JI9A 2XJQA 1XYOA 1RMU1 4IV3B 4J6GA 4LO8A 5DG1A 5EJ3A 4YZ3A 4UW4A 1O91A 1PHMA 1QJY2 1ZBE1 2LUWA 4OZXA 4R9AA 1QDCA 5T3NA 1KFUL 4R9BA 3W59A 5DUUA 2NMNA 1NXMA 4N7UA 4FAGA 1ZRCA 2B42B 2ZX1A 3AP6A 1H9PA 3AYAA 1XE7A 1LOGA 5BNNA 5H9RA 4XFAA 3M1HA 3ELNA 5GZFA 4XFHA 1AL23 1Z78A 4QM8A 2VQ0A 3VBSB 1IQAA 3RSJA 3WR0A 5D8AB 1N1VA 5HBAA 3MF9A 3V0BB 1W6QB 4Y1ZA 4RGGA 1IPKA 4JTOA 4DQAA 1CAXA 3DPRA 4FOVA 3NV1A 2A6XA 3KT4A 2NLRA 3E6CC 5FRAA 2B5HA 2VUAA 1PO22 2LALA 2GMMA 4ISRA 4K1ZA 2RMU1 1DDLA 3RMXA 1RC6A 2GNBA 1QJU1 3EBRA 5AVAA 1MQTC 4QM9A 1CPNA 2JG8C 3VBOC 4B7EA 1LOAA 5L7OB 2WFF3 3ROUA 1W6MA 3N4MA 3K48A 4D94A 2QKDA 2WIIB 4EROA 2GDFA 2PHFA 2RS52 4RS5B 5FMOL 3FUQA 2MEV1 3VZJA 4PF5A 4FPLA 4QPGA 4BCUA 4XF1A 1MS0A 4RHV1 4LBKA 4ATEA 4MLOA 3NAPC 2GNMA 2EVXA 1XNBA 4LBNA 3ZXAC 1IS6A 5LEKA 4LEJA 3TAYA 5JOZA 1F31A 1HRV2 3O5SA 3OGGA 2JDZA 2JEMA 5BNPA 4Z82A 1JUHA 5ACA3 1AJKA 5SV5A 2GU9A 2OZJA 1BZWA 1DQ6A 5CB7A 1F5FA 3E5XA 3PMEA 1FPN2 2R0FA 1LGCA 1RUH1 2ZMLA 1DQ1A 3LSDA 2JECA 3BIWE 4I30A 1IS3A 3RMYA 2BYVE 4P14A 4AFCA 1WLTA 4XDQA 4XQDA 3S7EA 1ZBA1 3FUOA 1QJX1 4FOWA 4Q4V1 3QH6A 1CN1A 3ZYGA 5AFBA 5FO9B 1DBNA 1NA1A 3B02A 3WDWA 2ZGMA 2DVDA 5IK4A 3J26N 3ES4A 3QBQA 4FPFA 1JBCA 5GLTA 1GZWA 3M7AA 4WBBA 4QD2A 4P9XA 1Q8VA 1PZ8A 5DDJ1 1MQTB 2JG8B 3VBOB 1PZ7A 2C1FA 1VBC1 2ZX4A 4WM8A 4E4SA 1V6OA 2WNVA 5GZGA 3AKQA 3TN93 3MLLA 3KGZA 2A6YA 1RUD1 1VIWB 1JUIA 4TWTA 4E27A 1EAH1 1PGL1 2V73A 1ENQA 4XFIA 1O3QA 2G9FA 2XH6A 3U0ZA 5CG9A 3NAPB 4ZU4A 2R073 3B7MA 3KCYA 3ZVXA 1ZNPA 1LULA 3QLQA 3OYWA 2D40A 2TNFA 2IFWA 2SLIA 5JI7A 3JD73 1W6OA 3AKSA 1VBE2 4I2OA 3WDUA 1NOVA 5EYYA 5JZGB 2ZAHA 1H1AA 4LR4A 4ZU5A 1V6IA 4LBQB 1REDA 1MS8A 3BCWA 3N7JA 5BNOA 1WUVA 4MXVA 1AYM1 2ZBJA 3VHPA 3AMHA 2X5IC 5JPNB 3ETQA 4F3JA 2A6ZA 3PNAA 2JICA 1GANA 4XFFA 2ZGKA 2ZGTA 4BPZA 1ULFA 4WV8A 3WG1A 1O7FA 4YW1A 4HBNA 3JZVA 1VBA2 4ASLA 1WCKA 2VECA 1V9U2 3AJYA