4YM0A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-tetraose (lnt)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym0A00
4WZFA 5EWSA 1AX1A 4NO4A 4AVVA 1J1TA 4FQ4A 1QDCA 2EXKA 3WG2A 5CB7A 2YMZA 3INAA 4ATFA 5LK5A 3PVNA 5IK8A 3IN9A 3V0BB 1LOEA 3UJQA 2D3SA 1V6JA 2D6MA 2B7YA 4Q8KA 1MVEA 1GBGA 2H0BA 2R16A 4FPJA 5JOZA 4DS0A 1HQWA 1S0JA 2WLQA 3RMXA 2DWRA 1LEDA 5IK4A 1W6OA 1CONA 2KM2A 1BYHA 3AFKA 5GLTA 5L73A 3WZ1A 1DQ2A 4Q2FA 1LOFA 2ZGOA 3UJOA 2CNAA 3AZYA 3M3OA 4W65A 1YXWA 3WHTA 2NN8A 2GMMA 5EYXA 5FRAA 3WG3A 1B09A 4GKYA 2A70A 1I3HA 1SCSA 1EPWA 4BLJA 4HL0A 3PJQA 2YZ4A 3D4KA 4ATEA 1CN1A 1QF3A 3JUUA 3WUCA 4LBOA 4LBQD 2P2KA 5GZDA 2A6VA 2C9AA 3AYEA 3USUA 1U0AA 2GNDA 1V6KA 2ZA9A 3OY8A 4R9CA 1G9FA 4K1YA 4R9DA 5GZGA 1IS5A 3IKWA 2GN3A 4XE9A 1QU0A 2E7TA 4YG6A 4JCKA 4LBNA 2EXJA 3MW3A 3PVEA 1UZZA 3RRDA 3OYWA 4YG0A 1QNWA 1X50A 1FX5A 2P3KA 1IS4A 5E8AA 5SV8A 1DHKB 4FP3A 1AX2A 2P3JA 1HKDA 3GNEA 4XBLA 1A78A 1CJPA 4KBBA 4M3CB 1GKBA 1FNYA 4DRVA 4HANA 3SITA 2WKKA 4Y1XA 4FQZA 1G9DA 2WQZC 3N7KA 1KRIA 5JOXA 3AYDA 3VV1A 4FPFA 3WHUA 2V5YA 4IQPA 1YYNA 1LGCA 1W0PA 2G4IA 3OJBA 1ZA4A 3NV2A 1S0FA 1W6QA 2YXSA 3M1HA 1AXKA 2EXIA 2RHPA 3ZSJA 5H9RA 1V6LA 3LCPA 4PQ9A 2WT1A 4GKXA 1Z78A 1GICA 1DQ5A 3U4XA 5DZFA 2NYYA 2CYFA 2JD4A 1V00A 3FLRA 1LGNA 3KQRA 3RSJA 4XTMA 4Q27A 5DXDA 2PHFA 2DVGA 1F9KA 5AVAA 4XJUA 2W52A 2UURA 1QKQA 1LEMA 1LU2A 2YY1A 2ZGNA 5T5PA 3SH3A 1SFYA 1DLLA 1LHOA 3N7LA 5HCFA 3FLPA 3OBTA 4FPKA 5JOWA 2Q5TA 3W58A 3OPZA 1C1LA 3VUOA 3O0WA 1DGLA 1IKPA 2ARBA 1KQRA 2UWCA 1RIRA 2ZMNA 2DVDA 4XMIA 4Q1RA 2OUJA 1QNYA 4PCRA 1N1YA 2UWBA 3DGTA 4YM0A 3AJYA 1PZ7A 4P9XA 3WCSA 5T5OA 4RA0A 1WW6A 4LBKA 4XHXA 5T54A 2JJ6A 5HCBA 1DYPA 1LGBA 4FPYA 4RL7A 2ZGSA 3AXEA 4XOGA 1DYKA 4NOTA 4P9YA 5T50A 1W6OB 2EAKA 2NMOA 1LENA 3LSDA 1Q8QA 4GALA 1SBEA 5IT6A 4Y22B 3FUOA 3R4SA 2ZGKA 1W6PB 4XHBA 3T2TA 2P34A 2ZBJA 3B3QE 4FVVA 1SBFA 1Q8PA 1Y7BA 4U36A 3MEPA 2W08A 3O12A 3B00A 4BPZA 4TYSA 1S0DA 1MR5A 1URXA 4C1WA 1VAMA 1N1VA 1D0HA 1YIFA 2DTYA 2LALA 1VLNA 1SLTA 3UL2A 3USUB 5CAZA 5E89A 3IMNA 4FOVA 5DUWA 1UX6A 2ARXA 2GMPA 1KDMA 2WNEA 4ZKTB 3OYWB 2VUAA 4AGRA 3VKOA 3TB0A 2ZGMA 3ILFA 2FMDA 3AJZA 1C1FA 2PHXA 3WV6A 1LHWA 1RINA 4UW3A 2R1BA 5GLVA 2A3YA 5IK7A 1W6MA 3DUIA 2W39A 1ENSA 4Q26A 1Q8VA 2DVAA 2A3WA 5DZGA 2ZGTA 5DUVA 3TAYA 4JC1A 1R1ZA 2LTNA 1S1AA 3N7JA 1UN1A 1BXHA 1GZWB 1LESA 4YM3A 1PZ8A 3AP9A 1A8DA 4YZ1A 3OGGA 1LOFC 1C4RA 1GV9A 1JXNA 1LOGA 2E51A 4Y22A 1DIWA 1HLCA 1W6PA 2R1DA 2V73A 1W6QB 1DZQA 3B69A 4DFSA 4BOWA 4I30A 1IOAA 1MVQA 1QDOA 1WD4A 1Z0HA 2AREA 3N35A 2NM1A 1V6MA 4L8QA 1N3PA 4D69A 3B9CA 1WW5A 1JW6A 2UWAA 1YO8A 2EIGA 1S0CA 2SBAA 4Q8LA 3I4IA 3AZZA 1G9AA 3APBA 2GMEA 4LBQB 4K1ZA 1ULCA 2A6WA 2GDFA 2PHTA 4WVWA 3SISA 4UW6A 4YZ5A 3O5SA 1HQLA 1BKZA 4GXLA 2A5ZA 4FOQA 5KXCA 1CPMA 4YW4A 1JN2P 2VW2A 4YW2A 4DRRA 1JBCA 2OUHA 1AJKA 2JE9A 3MPPG 5GALA 3ZXKA 2PHWA 2E53A 1G7YA 3AZWA 4XMAA 1AXYA 2D43A 4XJWA 4YG3A 3KM5A 3VKMA 4YZ2A 4XDQA 3RS6A 1MZ6A 2A6YA 1D2SA 3ZPYA 1GZWA 1LULA 2XG3A 4BQ1A 3Q9OA 1MS1A 2YROA 4SLIA 2ZABA 5T5JA 1UPSA 1FAYA 1FNZA 1LU1A 2ZGPA 2NMNA 4MYEA 1LJ7A 2ERFA 5DUXA 4YW1A 1APNA 5JMCA 1GNZA 4Y1ZA 1WCSA 1WLCA 2C5DA 2WT2A 1JHNA 2D7FA 2ZZJA 4LBLA 2DUQA 4PF5A 4R9AA 3WNXA 4BM8A 1GZ9A 3A0KA 3M3CA 4AVTA 1LOCA 4CZSA 1V6NA 2JECA 1SBDA 2EALA 5GLZA 4YGBA 3WCRA 3A4UA 3T1LA 4LBJA 3WOGA 4Y26A 3ZVXA 1WLDA 4CRQA 1TEIA 4LBQA 5JOYA 4BMBA 2DTWA 4DQAA 4FOWA 1CR7A 4YW5A 2VW0A 1VAVA 3W59A 3O0VA 3WDTA 1UKGA 5GLUA 4YGEA 1BZWA 2AGSA 2DYCA 1GANA 4YLZA 3L2YA 4TZDA 1JUIA 3AX4A 4UW4A 5CBLA 2D3RA 3ILNA 4GWNA 3WDUA 1C57A 4FPOB 2D6NA 1JYCA 3T1MA 1VIWB 2ZHLA 2ZGQA 1ULDA 1W6MB 5CNAA 5T5LA 2GN7A 3SNMA 2I2SA 1WW7A 3BOPA 4XBNA 1V6OA 3V65A 4H55A 3I8TA 3POYA 4XXPA 5BYNA 2ES3A 2A71A 1F5FA 1S0GA 1NLSA 3D5OA 2NZ9A 3QLQA 2DU0A 2DURA 1WBFA 2A6XA 2AYHA 1N1TA 2JKBA 2UU8A 3C2UA 1SLIA 3WDWA 4AGVA 1FYUA 4M3CE 1MACA 3AZXA 5DG2A 2NP0A 4F83A 1ULFA 5JDBA 1MS9A 1SLAA 1WD3A 1S0EA 3AYCA 3CNAA 3ENRA 1MS0A 3ILRA 5GJ6A 3WLUA 3AP6A 1H9PA 2DUPA 3WDXA 4Y1YA 1CVNA 3B01A 4M3CF 2ZACA 1GZCA 4ITCA 2ZMKA 4FPLA 2CL2A 5CA6A 2E6VA 3ZXLA 3M2MA 4BMEA 5KXEA 5T55A 3ZSMA 3OBRA 3ZXJA 5JLVA 1GSLA 2ZGRA 4ISQA 2D3PA 4YFZA 1H30A 4Y20A 1ULEA 1Q8OA 2JDZA 3IM0A 3NV3A 4K21A 3V0AB 2ZMLA 4YFWA 4YGCA 3SH4A 2R49A 1SLBA 2D6LX 1MS8A 2D44A 2Z42A 2ZHMA 4AGGA 4ASMB 5GZFA 1I1EA 4CTEA 1H9WA 1CIWA 3RMYA 2VH9A 2P37A 4WV8A 5GLWA 3WG4A 1DQ1A 3A0NA 4Y1VA 3N7MA 1WW4A 3D6EA 2D6KA 4ISRA 2DU1A 3NV1A 1QOOA 3FFZA 1OQ1A 3LSEA 1LHNA 3POWA 2SLIA 3UK9A 1AJOA 1G8WA 1O4YA 4Z8BA 1HDKA 5JVVA 4M01A 1KJRA 3O0XA 4WVVA 1O4ZA 1LTEA 3AYAA 5EYYA 1OKQA 5H9SA 4PBOA 2AH2A 3R4UA 4YZ4A 1MS5A 1JOJA 1AZDA 3PMEA 1GYKA 3WDVA 3ZXEA 3VKLA 3N36A 5E88A 4XIOA 1S0BA 2ZKNA 1AXZA 3SLIA 1CQ9A 3ASIA 4R9BA 4FPHA 3AK0A 1SACA 1N1SA 3BODA 4FPEA 4XJ8A 2A3XA 4XJAA 3V0AA 1F31A 3R05A 3BTAA 3M3QA 3WG1A 1W0OA 1GNHA 1WBLA 3HR9A 3MW4A 1MZ5A 1V6IA 4U2AA 4GA9A 1SLLA 2DUOA 1CPNA 4AWDA 5GZEA 3RG0A 1FATA 1S0IA 3WDYA 1WLWA 4GWMA 1DFQA 3M3EA 4UW5A 1UZYA 2A7AA 4XILA 2P3IA 1DBNA 1DQ4A 4FOYA 1LOAA 2HYKA 3POSA 1FV2A 1QOSA 2WSUA 4Y24A 3WUDA 1SCRA 2PELA 5H9PA 3HMYA 2EXHA 1DQ0A 4Y1UA 2ENRA 4YGDA 1FV3A 1VALA 1WUVA 1W6NB 2CY6A 2ZAAA 3AZVA 2BQPA 3HN1A 3IPVB 4M00A 2VU9A 3V0BA 5DG1A 4P14A 2WSVA 2YV8A 3ATGA 1GLHA 3V64A 5KXBA 2GNTA 4Q1PA 4XXAA 4XJ9A 2E7QA 2CWSA 2GNBA 1LHUA 1PZ9A 2DVBA 2FHRA 2PHUA 2CWMA 2ZHKA 1KITA 4PBPA 1RITA 2ZGUA 3MW2A 4YW3A 3VKNA 5DZEA 1LCLA 5FREA 1CESA 3AP4A 2PHRA 4Y20B 4ZXKA 3ZXFA 1JYIA 1LOBA 1QMJA 2GNMA 4XBQA 2DVFA 2CTVA 1Q8SA 2A6ZA 2A75A 2VXRA 1ONAA 1N47A 3FBYA 4FPGA 1UAIA 2TEPA 4XZPA 2DV9A 3ZSKA 3FLTA 1BJQA 2AUYA 5F9TA 1UMZA 4FPCA 1AF9A 1LECA 2JE7A 1ULGA 1YRZA 3BIWE 5GZCA 5F5QA 1LODA 1KJLA 4FP2A 2OW4A 3VKFC 3AP5A 3GALA 4XTPA 5HCAA 2D6PA 4BLIA 1NXD1 3ZYRA 1AX0A 5T52A 1G86A 4XJZA 3SH5A 5H9QA 4AVSA 1KDKA 3NV4A 1W6NA 3IPVA 5IUQA 3FUQA 4LBMA 2GALA 5IK5A 1ENRA 1IS6A 1A3KA 4OZXA 2VW1A 1QGLA 3QCWA 4P9WA 4K20A 4M3CA 4YM2A 1LHVA 1MS4A 1BQPA 1IKQA 2VY0A 3RQ0A 1N3QA 1IS3A 2WJSA 2AENA 5EXOA 5GM0A 2WT0A 1G9CA 4AYUA 1YI7A 2XB6C 3ZSLA 2OVUA 2R0HA 2EF6A 1DQ6A 3WVJA 4C1XA 3AXDA 3NWKA 3H0OA 3N3HA 3JU9A 3ZYPA 1SLCA 2AR6A 2W68A 3AP7A 1G9BA 3PVOA 2ZHNA 1Q56A 1QOTA 4YM1A 4XIKA 1ZM1A 1ENQA 2D6OX 1XQNA 1AVBA 5KXDA 2R0FA 4YZ3A 1N3OA 3OY8B 5DUUA 4JRAA 4DPNA 2ZGLA 1OFSA 1MS3A 1UL9A 4XYXA
chains in the Genus database with same CATH superfamily
2JB8A 3E1F1 4WZFA 2V09A 1AL0G 1J1TA 1RTVA 3ZN6B 4YW7A 2QQOA 2IVIB 2BNNA 4QT6A 3WG2A 1BLZA 3U78A 4RR3C 1HN0A 1OA2A 2YMZA 3ALQA 2AACA 2W2IA 3C3VA 3PLQA 3CHXA 4OQ9A 4QHOA 5LK5A 5IK8A 3IN9A 1FPN3 4IXLA 5A80A 4AQ6A 3BIEA 1MVEA 3K3OA 1AYM3 1O6UA 3ZDVA 1HQWA 4CP1A 2WLQA 4EWDA 1TMF2 3OUHA 3RI8A 1TNRA 2HWD3 4CCOA 3O1PA 1CONA 3AFKA 5FUPA 5L73A 3GXUA 1QWRA 5HBAA 4AHZA 3AZYA 3M3OA 5ERLA 3HD8B 5EYXA 5FRAA 3WG3A 1WMEA 4LO6B 2BERA 5FZ3A 1FT9A 4OQ8A 3I3QA 5HI0A 4NPRA 1SCSA 1YFXA 1TZOA 5FPVA 3AM2A 1EPWA 4LE3A 2BBAA 3LB9A 2YZ4A 1QF3A 3WUCA 2P2KA 2A6VA 3USUA 5KHKA 1V6KA 3VN4A 1G9FA 2JXAA 1DLCA 3OG2A 4R9DA 1IS5A 4M4PA 3ON7A 3AKRA 1QU0A 4CXYA 4HKOA 3RRDA 1UZZA 4HK9A 3OYWA 3TWIA 3BYWA 1X50A 1CAUA 1DHKB 4B4PA 4FP3A 5CKNA 1BMV2 1HKDA 2RS53 1RMU3 4IE0A 1A78A 2WZR1 4Q4X1 4BQYA 2EIEA 5C9AC 4I3PA 1U5YA 5F3GA 4KBBA 1RGSA 2CAVA 5HXVA 1FNYA 1QJU3 3EMRA 3CQOA 4Y1XA 4FQZA 2IXCA 1S55A 4FO9A 2WL1A 2X5IB 2BEOA 4HXCA 5ABJC 5C5TA 1KRIA 4QQ2A 5JOXA 2FCTA 1QIQA 2R063 5C33A 3AKPA 4IQPA 4XDPA 5A3MA 2GC0A 3QBQA 3VBSC 3OJBA 1ZA4A 3M1HA 2EXIA 4UF0B 3U1XA 4JTOA 1OUXA 3LCPA 2JWPA 1Z78A 2AEYA 1DQ5A 1DGWX 2NYYA 3OGSA 5LRSA 3RSJA 4HVOA 1J3QA 3WF3A 2P3YA 5DXDA 2PHFA 4PI0A 2B9VA 2DVGA 4MGKE 1F9KA 4MX3A 1HB3A 4GMP3 3RJRA 3H8XA 1ZZCA 5DN2A 1LEMA 2YY1A 2X10A 2ZGNA 1DLLA 3TBDA 3FLPA 4FPKA 4OI1A 5JOWA 4CUCA 5J48A 1QJY2 4ARXA 4F3JA 1GWKA 4MGZE 5FPUA 2VQ0A 5BNOC 2G1MA 2VL4A 4MZUA 2VNVA 3OPZA 2XLAA 4H2AA 3W58A 4AQSA 4AHWA 3BN6A 5BNOA 4MHRA 2WFPA 1RIRA 1OQEA 5FWEA 4ZPIA 1ZBE2 1MEC1 4PCRA 4YRDA 4YM0A 3BUCA 2R042 1PZ7A 1M4WA 4RA0A 4XHXA 4CEWC 4LO7A 3NNGA 4FPYA 1LGBA 3H50A 1RUG2 3AXEA 3FWEA 4AVCA 1DYKA 4P9YA 3T08A 5I8TA 5JZGB 3WF1A 3WQ0A 1Q5OA 4GALA 1LENA 3LSDA 3TNQA 5IT6A 4HN1A 1VBE1 4I3GA 1ENXA 3CEWA 1W6PB 1RVF2 2JEMA 3GCWA 5E1RA 1PK6C 1LKNA 1SBFA 2GH8A 4BISA 1OLME 5J3UA 2QZ2A 2W08A 5EIYB 3B00A 4BPZA 1MR5A 1URXA 4JV4A 4CEYB 5FZDA 4N53C 2XHKA 4V2VA 1N1VA 4PJYA 5FZIA 4CDQA 1YIFA 1UD1A 3LDBA 4IEWA 3UL2A 1H1MA 2WQ4A 2HKXA 3IMNA 2FBEA 5DUWA 1NYWA 4WM7C 1KDMA 2RM22 3LA7A 4Y5TA 4WM7A 4GB31 4AGRA 4WM8A 2Q1MA 2YC0A 3E6BA 1C1FA 4DY3A 4Z92B 2FDFA 3WV6A 1LHWA 4W50A 3GZEA 4UW3A 2D5HA 5FMOL 4KU8A 4EN7B 2OS2A 3DUIA 3VBFC 4NROA 1ENSA 4LK7A 3VBFA 5L7OA 1Q8VA 5M0TA 4IETA 1JOBA 4LA3A 4OHYA 5DUVA 3TAYA 4ORFA 3N7JA 1QJEA 1GZWB 5BUVA 1PHMA 1L7RA 3EJKA 3J4UH 4LXLA 1VBA3 2WO2A 1PZ8A 1UX7A 3AVSA 4YZ1A 2RS11 1C8M3 2O8QA 2VOTA 1U12A 4MGTA 4FFHA 3AKQA 1DIWA 5IFPA 3A21A 1VBD3 5FP3A 3H8RA 2V73A 3VD5A 3KMHA 3IDEA 3H42B 4I30A 4QPGA 1H6YA 3VBRA 2VCMA 4L8QA 1QJZA 3BI3A 4Q0VA 4AL9A 5HV0A 1XJAA 3B9CA 1WW5A 5CG9A 1S0CA 2CGNA 2HWB3 3DN7A 2WNVA 4FFFA 3G7DA 4Q29A 5JI7A 1X7NA 3APBA 3JZVA 4CYDA 1JZ2A 2QKDA 4K1ZA 4LBQB 4YVWB 1IQDC 1PO12 1ULCA 2DCTA 2OPKA 4UW6A 3O5SA 1HQLA 4INDA 4PDWA 3WQ7A 1CPMA 1WMFA 1VBB1 2HWC2 3J8F1 4IEUA 2JB4A 2VW2A 1JZ6A 5F5AA 5FY4A 4RYDA 2HBTA 1AJKA 2D40A 3VBHB 5LBCA 5GALA 5HXMA 2Y26A 5K7PA 2E53A 4ZXEA 3JB8A 2OQ6A 3BB6A 1W9FA 3ROUA 3KM5A 1CAXB 3VKMA 1Y9GA 4Q4W1 4GMP1 4XDQA 1GWMA 4OUEA 2KD7A 2XVLA 4DOUA 1LULA 4ONUA 4XEZA 4BQ1A 3Q9OA 1MS1A 1X82A 2YROA 5T5JA 1YNAA 1FNZA 1LJ7A 4IV3B 4LKSA 4NN0A 4HVRA 5LB6A 4P9LA 5CFCC 2J7MA 1ZRDA 4K8RB 2WT2A 4UFHA 2HEYF 4PF5A 4NE9A 2Q0AA 1GZ9A 3QH7A 1V6NA 5FFOC 2JECA 1KS5A 5LWBA 3H7JA 1UXZA 4YGBA 3A4UA 3HBKA 5APAA 1AHSA 3LA3A 4Y26A 1WLDA 1YQCA 3I54A 4CRQA 3JB4C 5I8SA 4HKWA 4IGPA 2DTWA 4S2DA 2IFRA 4FOWA 5FQ0A 1RUF3 4GIQA 5DDJ3 3K4ZA 3U75A 1VAVA 4GJYA 3O0VA 5IAXA 1ULOA 1UKGA 3THCA 4YLZA 1GANA 2YDEA 1AR83 1VBC1 4LO5B 4NJ4A 5CBLA 3CF6E 2D3RA 3FE5A 3FZ3A 3POFA 2WYFA 3IAQA 4GWNA 2WZR2 1D0GA 4RD7A 3WDUA 4FPOB 4QDSA 1J84A 1JYCA 2Q1ZB 1VIWB 2J1VA 2X05A 4B29A 1NCQC 3BKZA 5CNAA 1NCQA 3BOPA 3RFRA 3RWKX 4QQLA 1UIKA 5FZ6A 1ND3C 1QEXA 3ST7A 1O5UA 2WWJA 3ELNA 4XXPA 2A71A 3S7IA 5FBZA 3DEMA 1RUH3 5A7WB 2DU0A 4Q8KA 2A6XA 1RUD3 2G9GA 4AGVA 3BTXA 5FIXA 2VVEA 5D2AA 5FZCA 4XFAA 3POBA 1COV3 3AZXA 4QGMA 5I8YA 2J42A 3FX3A 1SLAA 1WD3A 2ADDA 1R083 3ENRA 1F4AA 4CP2A 1G6NA 3AP6A 3NNFA 1MQTB 1R1A1 2DUPA 3ZN5A 1AR63 2W87A 4QX1A 1R093 3B01A 4Y1YA 5LATA 3K51A 4NIAA 2GP5A 1JZ3A 3P6BA 4HN0A 5CA6A 2E6VA 4CA9A 3SCGA 3ZXJA 1GSLA 5FYCA 3SEEA 3IIIA 2D3PA 1AR73 3NNJA 1UZVA 1DGWA 3IB3A 3C7GA 4I0BA 4QPYA 2R32A 5I0UA 1ODNA 3VL9A 3V0AB 2JDPA 1MEC2 4XFHA 2RJ2A 2R49A 2Z42A 3RZZA 2D44A 1PIV3 3WY6A 5EZWA 5F8PA 3EQEA 4GULA 2WNOA 4R8HA 5KC6A 1I1EA 2ILMA 1H9WA 2VPVA 3W20A 4LLOA 1CIWA 5FOJB 4Q4Y1 2WO3A 1O5LA 1VMJA 2DDUA 2WABA 4HMZA 1DGRA 2YB7A 4WV8A 4CCEA 1CJDA 3WG4A 3K77A 1PVC3 1L7QA 1VBE2 1DQ1A 2WO1A 4JKKA 4AK3A 2IXIA 4Y1VA 3WR0A 3SKJE 1DCSA 1FPN2 1WW4A 3N7MA 2Y6JA 3LKJA 3TN93 3ZYBA 2X53S 5EHDA 3NV1A 2VECA 4COWA 1QOOA 3LD8A 4A2UA 1Y9QA 3ZN4A 1CX1A 1OQ1A 3POWA 4CP9B 4IEYA 4CCLA 3IZOA 3VBUB 1HRI1 1HDKA 2J1AA 4CCJA 5CG8A 1LTEA 3IWZA 4AEDB 5IW0A 2C26A 4CDWA 4JDNA 5I0TA 1JOJA 1AZDA 2XUMA 1ND2B 5E88A 3SLIA 1S0BA 2QQIA 2ZKNA 3PIGA 2VMHA 1MPXA 1W9YA 3ASIA 3AMNA 3WF2A 4LO8A 3VDBA 2E33A 1FMD3 1H8TB 1S2BA 1UF2C 4XJAA 4XF1A 3MIGA 4IGOA 3KCCA 4N43C 4KG0A 2OKXA 4MVTA 3RDIA 4CDUA 4EQVA 2UY8A 1GMMA 1WBLA 3WG1A 2ZPXA 4U2AA 2RDRA 5K8SA 4GWIA 3H8OA 1UOGA 1Q3EA 2DUOA 1OOPB 2G9FA 1K3IA 1NA1B 5GZEA 1XNDA 1EY2A 3WDYA 2VZVA 4ARYA 3I2IA 4GWMA 2PYTA 2RS12 4ZU7A 2A7AA 4O61A 1VE0A 2P3IA 2GC3A 2PXJA 3Q8CA 1HXS1 1JZ7A 5JPNB 3OD4A 5A6ZA 1JHJA 1LOAA 2HYKA 4FOYA 1ACCA 1VRH1 2VZQA 2W1SA 2WSUA 4Y24A 4QMAA 1QY4A 1DQ0A 5FO7B 2MEV3 3K4DA 4Y1UA 2VMFA 3FFQA 5BNQA 4RS5B 2CY6A 3M8LA 1W6NB 3DL3A 3HN1A 4K6BA 4XPVA 1A34A 2YFZA 3CLPA 3BU0A 5DG1A 2BU9A 4A45A 4XFIA 3PU3A 3HQUA 3ATGA 2XLGA 3P1IA 5KXBA 2GNTA 4PIZA 5FMCA 5FZAA 2E7QA 4XILA 1LHUA 1PZ9A 2DVBA 1B35C 1VBB2 1KITA 1GQGA 3J8F2 4R4ZA 5A3OA 1TQ5A 4LPLA 4LR4A 4QU2A 3VHPA 3I2DA 2PHRA 4X8NA 4XFBA 4QB1A 4BQXA 1R081 1OFNA 2GNMA 2IUWA 4Q4W2 5FZ7A 2VZSA 4HG6B 1W03A 2DVFA 2VXRA 1AR61 1NXMA 4P08A 1JTZX 3J26N 2RR13 3FBYA 3ZSKA 2DV9A 1ZNPA 2VMIA 3FLTA 4CUAA 5F9TA 1UMZA 4FPCA 4IW3A 2BVVA 4O7XA 5EJ3A 1AF9A 2FMYA 1LECA 5DAWA 1ULGA 3IIAA 2ARCA 3CKHA 5GZCA 1ZRRA 3H3UA 3WT3A 4JRLA 3VKFC 2K9ZA 4RN5A 1BCXA 2JKXA 1OF4A 1RHI1 4QPIC 5ACA3 1SZBA 1NXD1 3HWJA 4OHZA 2PA7A 3SH5A 4QM9A 5H9QA 1KDKA 3UESA 1ZBA3 1W2OA 3HT1A 5IUQA 2CAUA 4KL1A 2VNRA 2QVSB 4RR3B 1RXFA 2YGMA 3QCWA 2W9XA 4M3CA 3UKVA 2BRTA 2QBXA 1OQDA 3HAGA 1C5IA 4KBZA 1PVC1 2ZJCA 4JQTA 4OVEA 4RGAA 2ZX1A 4BA6A 4NVPA 2AENA 4LJHA 3T2OA 5LA1A 1G9CA 4AYUA 1YI7A 2XB6C 3ZSLA 1HV1A 1YQ5A 2EF6A 4AI1A 1NQJA 4S2HA 1UYXA 2WDBA 3H0OA 2PQSA 2QQJA 3ZYPA 4HONA 1UPIA 3U14A 1VR3A 2ZX4A 5FY5A 5IWFA 1OC1A 1J3PA 2W94A 3I59B 3PTRB 3PVOA 1GFF2 1BK0A 1Q56A 5C71A 1US3A 1JOPA 2FZ1A 4JDOA 4LHLA 4COUA 4XIKA 1CAVA 2QUOA 4F7ZA 3NO8A 4YVSA 2YC4A 2D6OX 2GH2A 3T30A 3TEZA 5IVFA 2RV9A 4AEKA 2QJVA 2R0FA 2IVJA 4GAZA 5DUUA 2XVKA 4UXAA 3POIA 3O1SA 4O65A 2ZGLA 2C24A 1F15A 1MS3A 5BPXA 1UL9A 3VZMA 1O8PA 1ZZ8A 3DYMA 2CHHA 3DKQA 4NO4A 4AVVA 3BGAA 2QFEA 1QDCA 2DCYA 5L9BA 1W2UA 2EXKA 4N8MA 1QXJA 4UT5A 1CAUB 3OSDA 5CISA 5K9YA 2VMCA 3PVNA 3RWNA 5FY0A 1LOEA 3RZJA 2YU1A 3NJZA 2D3SA 4HOOA 3TRSB 1C8M2 5KWRA 1RL3A 1BMV1 1GBGA 5C9AB 4AFCA 5J98B 5CVRA 1VBD2 4FPJA 5JOZA 1S0JA 4ZONA 2B42B 4FXGB 2IWGB 3RMXA 1LEDA 4WVMB 4B4QA 2WNUC 1W6OA 2KM2A 3WZ1A 1BYHA 2WNUA 5FZMA 2TUNA 2MEV1 1DQ2A 5ABJB 1I5PA 2WAOA 2XBO3 2XJSA 3MFAA 3MDPA 4MO3M 1REEA 4NMIA 1SDWA 2ZGOA 1NE4A 2CNAA 3PL0A 4KWKA 2HWB2 3GZTB 3UJOA 3VBSB 3BVCA 4EWAA 1EP0A 1LAJA 4GKYA 4W6WA 2A70A 3OGJA 2JIJA 3RZMA 2VZUA 3LGRA 4Q4Y2 1GZTA 1SMVA 2BWAA 1CN1A 5A1AA 5J7MA 2UY9A 5FLIA 3PMSA 5GKAC 1NOVA 3J7HA 4LBOA 3DECA 2C9AA 2VQUA 3QACA 3OY8A 5FYHA 2ZA9A 4R9CA 2VD7A 1XE0A 2RS33 4XE9A 2E7TA 3A23A 4JCKA 2AC1A 5FKBA 3MW3A 3E5XA 1K45A 4YG0A 1QNWA 1XE7A 4NHYA 5DMYA 3VDDA 1EYBA 3OCPA 5LA0A 5E8AA 5SV8A 1D4M3 3KS7A 2Q8EA 3ZYJB 5BNOB 1W90A 4A6SA 3GNEA 2FDIA 3ZYHA 4AI0A 3ACLA 2Z2SB 4C91A 4EYUA 4A4AA 5JCTA 1GKBA 1X33A 3AKTA 2E32A 2TNFA 1ND2C 3Q8AA 2HWF3 1ZBE1 4XQ4A 4AVAA 2LUWA 1G9DA 1XOYA 2QNKA 3N7KA 4CEWB 4JGZC 4QX0A 4JGZA 2A1XA 2V5YA 1STMA 1LGCA 4SBVA 1W6QA 4YYOA 2KXLA 4NRMA 5LZ6A 1I9RA 2WR9A 3FN9A 3QOPA 4BK4A 1PK6B 2WT1A 1BVVA 1V70A 2AEZA 5FLHA 2X29A 4X8PA 5DZFA 4D8MA 2YG0A 1EAH3 2CYFA 2JD4A 4EROA 1LGNA 2XL7A 1AR82 3KQRA 5A33A 1HXS2 1D7PM 4N53B 1QQP3 2VCCA 2YPDA 5JXGA 4CDXC 4P00B 4A41A 2W52A 2UURA 4HBNA 1LU2A 1ODMA 2E7AA 3OBTA 4WM7B 1O4TA 1VMHA 3KF3A 5JR2A 1AL21 4Y3OA 5KHJA 4R52A 2B8MA 4I2OA 2Q5TA 4C8DA 3VUOA 3ZR5A 1NZCA 1KQRA 1IKPA 2ARBA 2ZKLA 4IV1A 5FXZA 3U07A 3ZR6A 2Z79A 3VBFB 4LEJA 2OUJA 3RJ2X 5FYUA 1OI6A 3WINE 4XVHA 4FBFA 2UWBA 3DGTA 3AJYA 5BNNA 5C3PA 4UBHA 2VOXA 1XU1A 1TME1 2XGXA 5T54A 5HCBA 3MIBA 5FUNA 2HWE3 3AL6A 1PMIA 4XOGA 4CCMA 1RJ7A 1R082 4TLGA 5F6KA 4LHKA 2EAKA 5JSOA 4AQ2A 2VZPA 5FTTC 3E6DA 3JBG3 4LUKA 2EIDA 4DXSA 4AEMA 5JUVA 1AR62 3E97A 2VCAA 3JD73 5IVYA 1YQ6A 4XHBA 3T2TA 4FVVA 3OBAA 1XRUA 2J1EA 4D6SA 5A32B 2VVDA 2YBKA 1Y7BA 3K2OA 3MF9A 4HPKA 4U36A 4LK6A 3MEPA 4B1LA 4QXCA 3WF0A 5LA9A 1US2A 4C1WA 1AR72 2XWBB 2QE3A 5BV6A 1D0HA 2DTYA 2LALA 2N7GA 2BGOA 4A44A 1O3TA 4COZA 3DYPA 5FKCA 1RHI2 1XSQA 4META 4GH4C 2VOVA 5FZGA 4W6YA 4O9EA 1PIV2 2GMPA 5FJHA 3NKGA 5A70A 2VUAA 1OA3A 4FFGA 3WQBA 3VKOA 3TB0A 1CAWB 3CL1A 2FMDA 3ILFA 3KHBA 4NAMA 5ANQA 3U0ZA 2HWC1 3RYPA 2A3YA 4BDVB 1W6MA 2BNMA 1PVC2 5FY7A 1XU2A 1SPPA 2A3WA 4UFLA 4QB6A 1R64A 3TN92 5ISLA 3I2OA 1UN1A 2V4VA 5F2WA 1LESA 3KHCA 4QXBA 2PAEA 4CP0A 2MPFA 3ZFFC 3AP9A 3VZNA 1A8DA 3ZFFA 5FBJA 3VZJA 2R073 4Y22A 1HV0A 2E51A 4A7YA 3LOIA 5AC91 4QD2A 5A7QA 1RUOA 1W9WA 3B69A 3NJYA 4DFSA 5CFCB 2ET1A 2H6CA 1QJX1 2YPJA 4BOWA 1O3SA 1IOAA 1PMJX 1QDOA 1WD4A 5GJ6A 2YFUA 4CCCA 2NM1A 4JVAA 2LM3A 4ZS3A 5AFEA 3IT8A 5DABA 3TNPB 1JW6A 2WN3A 4FFIA 5FZKA 4FAGA 1FMD2 4NHLA 5A6YA 3I4IA 1PO23 3AZZA 1G9AA 3FL7A 3HQXA 4WVWA 3KSCA 3SEPA 4KNCA 1UXXX 2ID4A 1LRHA 4QGNA 3VDAA 2NQYA 3PJYA 3WNOA 3H3LA 1SG3A 4YW2A 2Y33A 4BH9A 1YJKA 4GMP0 2JG9A 1D2QA 3KGZA 4IE6A 5KHHA 3LDRA 1EAH1 2JE9A 3MPPG 3T0BA 5FP8A 4B7EA 1G7YA 2B46X 2D43A 1QQP1 5C6CA 2WZPP 1W8FA 4QHZA 3VZKA 3AMHA 1NCQB 1MZ6A 2JICA 1RUJ3 4B3NA 2A6YA 1D2SA 3NAPC 2JIGA 2B5HA 2ZEWA 2MEV2 3D0SA 3NAPA 2EIBA 1ND3B 4AFAA 1W8TA 4IESA 4SLIA 2UYBA 2ZABA 2Y60A 3ORJA 3ZFGA 4JHTA 1LU1A 2ZGPA 3C7HA 2NMNA 4MYEA 5DUXA 4RFRB 2Q4SA 4YW1A 1RUE3 1VB4A 4Y1ZA 4AAPA 1WLCA 3VD4A 3CU7A 4R9AA 1REFA 1U5IA 3CJIC 3UGGA 4BM8A 3CJIA 3DKWA 3A0KA 3M3CA 4E9KA 1Z7S3 2BDRA 5LBEA 4YARA 1H2MA 1SBDA 5KHIA 3SC7X 2R7EB 3NL1A 4Q4V1 3POEA 2GC2A 3B5LB 4I09A 5JOYA 2RMU3 5LK7B 1KD7A 4DQAA 3ZPOA 4YW5A 4N9HA 2VW0A 3W59A 4E4DX 4XABA 3KVAA 3WDTA 2RR12 1K12A 4HK8A 5C8CA 3ZKYA 5FPXA 2P5BA 4LKEA 3T0DA 1HRV3 4OULA 3UYJA 3T1MA 1OHFA 2ZGQA 2C4XA 1UY4A 3ACFA 5FYYA 2WS93 2ZOEB 1BEV3 1WW7A 2BGPA 2R30A 3ZFEA 2XJRA 2BPA2 5ANNA 1ZBA2 3I7DA 3I8TA 4H55A 4LQRA 4CUBA 5I93A 1S2EA 5LBBA 3CJXA 1NLSA 3D5OA 2NZ9A 2UU8A 2DURA 4XW3A 1N1TA 3C2UA 3WDWA 2EVXA 4QQOA 4Y5SA 5C4WA 4UFJA 2WRAA 4OCTA 4LNVA 5DG2A 2NP0A 1FPN1 1EV13 1T6BX 3KT1A 1ULFA 1MS9A 3CNAA 3MF6A 5AVPA 5FK7A 4LA2A 1BK1A 1AYM1 1BHGA 2HWD1 4CDQC 4ITCA 5F6LB 1OLMA 4FPLA 1WWYA 5DAQA 1C5HA 3R4DB 4MLOA 5KXEA 4BHPA 2CGPA 3ZSMA 3OBRA 1AL22 5JLVA 4GJZA 4ISQA 3OD0A 4J6GA 4BQ3A 2E63A 1F2NA 3EBRA 4QM8A 1W8WA 1WKYA 4WM8C 1YCIA 2W3JA 3FBMA 3IM0A 3NV3A 4IDZA 3RI9A 3S5AA 2VM9A 2ZAHA 3KCXA 1GOHA 1RC6A 4RFT0 5A1LA 1H1AA 5FAXA 2PLV3 5EQUA 1UY3A 3W9AA 4IERA 4N43B 1ZX5A 4BU2A 1RYYA 1GUIA 1HJGA 1SLBA 2JDMA 5L7OC 4IEPA 3ETPA 1TME2 4NIIA 1UYYA 2P17A 3Q8BA 1ALYA 1NKGA 1NCRA 1XXNA 4PLMA 5FJKA 2JDHA 4BIOA 1JYVA 2WBKA 3F95A 4QXHA 3FJSA 3S0MA 1W8NA 3A22A 2VTXA 4MXWA 2ZX0A 1C28A 1F35A 3GZAA 4IEOA 1AYN3 5EPAA 3ITQA 2D6KA 2DU1A 5BNPA 2RS51 1RMU1 2HH9A 2Y6GA 3OOXA 3PUIA 4QQPA 5DPNA 1F8VA 4QPGC 4RQPA 3VBRC 1LHNA 3E5QA 2GZWA 4DB5A 2F6BA 1QJU1 1AJOA 1P8JA 5JVVA 3RVHA 2D5FA 2CDOA 2Y6FA 5EYYA 4P9GA 2WNVC 3AYAA 4QGLA 1NLRA 4E4SA 1JZ4A 2AH2A 1MS5A 2R061 3ZXEA 3PMEA 3BTYA 3T09A 1W04A 1J59A 1B35B 4PDWC 1KGYA 2Y6LA 3OGRA 5K0UA 1CQ9A 1CGPA 3ZM8A 4OMCA 1N1SA 5J1XA 4HKLA 5A7OA 3MLJA 3U4SA 4AG4A 1IHMA 2YBPA 3WNMA 4RGKA 2WZEA 3BTAA 4UFMA 3ZOIA 3NMBA 4OI4A 4JTNA 3WNPA 4L0PA 2RS32 1MZ5A 4D3WA 4DXTA 1O3RA 3PU8A 1SLLA 1NZIA 1S0IA 1EUUA 4FTEA 2WA3A 4XF3A 1OH3A 2LS6A 5LY1A 3NJVA 2WFF3 5F3IA 5AC92 4KQ7A 1DBNA 2ATFA 4DNYA 1FV2A 1QOSA 5G05L 3WUDA 4E2GA 5H9PA 1QJX2 4FT8A 3ZN6A 1OMIA 1H6XA 1UO9A 4QPIB 2VQTA 4FSJA 4YGDA 1FV3A 1WUVA 3HNMA 2ZAAA 3AZVA 2BQPA 1RJ8A 4GQ7A 5LEKA 3SQOA 1TNFA 5L36A 1GLHA 2OZJA 5IFTA 1S4CA 4XC9A 4JKLA 4XJ9A 2CWSA 4FOVA 2QZ3A 5A3NA 2ZHKA 4PBPA 2CWMA 3AB0A 1NY72 3MIDA 2ZGUA 1OURA 1OVSA 1UU5A 3FMGA 1UKRA 4KH9A 5DZEA 3GJBA 3H1MA 1EAH2 1CESA 2RDNA 5FREA 3W5NA 2QQUA 4JKMA 4Y20B 4URTA 3MLLA 1LOBA 1KS4A 4MH0E 4W4ZA 1QQP2 1PNFA 1Q8SA 3KWVA 3LIGA 2IC1A 1DU3D 1ONAA 1N47A 3CMGA 3BALA 4OFGA 5FZEA 2OYZA 4COVA 1JU4A 4XZPA 2DFBA 1FOD3 4JGYC 4MUVA 1CAVB 4JGYA 1WA6X 3POJA 5LA2A 1YRZA 3BIWE 2VZOA 5I0RA 3P5BA 1JZ5A 1LR5A 1KJLA 2Z5WA 2OW4A 4FP2A 4OI2A 2XDVA 5FR3A 3KV4A 4XTPA 4PF1A 2O1QA 3OEAA 3MV01 5KBFA 1AX0A 5T52A 1H2KA 4XJZA 4X6RB 2QQWA 3IPVA 3CIHA 1C3HA 2HWE2 5IVBA 4Q4V2 3ZXAC 2FDJA 2W92A 2YHJA 3POGA 4IEQA 1WCUA 2F17A 4IE7A 1UOBA 1E5IA 1QGLA 3JBG2 3LEGA 4OZXA 1C8NA 1LHVA 2XQRA 4QDQA 1VBA1 3JD72 1IKQA 1SDDB 2VY0A 2Y38A 5CU1A 2WJSA 1IS3A 1C8M1 1OPMA 2X5IA 5EXOA 4IL7A 3MICA 3K3NA 1VBD1 4JDMA 2J1TA 2WNUB 3UGHA 3I2HA 4E2QA 1W3VA 3N3HA 3JU9A 1ZZ6A 1SLCA 2D93A 4UF0A 2IXJA 1T6GC 2AR6A 2Y64A 3AP7A 4NAOA 2ZHNA 5EV7A 2HWB1 4NUBA 1TVGA 4XFFA 3BTZA 4RHV3 4QXKA 2WC2A 2YBSA 1ZREA 1OSGA 3PUAA 3LZZA 1W39A 5KXDA 2ZXQA 3OY8B 4LIUA 5FZ4A 4QU1A 1GU3A 4OLLA 4A3ZA 4OI0A 1PM4A 5CFDC 2P1BA 1J1LA 5EWSA 1XNCA 1YQ2A 5CFDA 3WP3A 4H14A 4V1PA 5LBFA 4C0BA 4FQ4A 4XAEA 1AYM2 3I2JA 5CB7A 1WLTA 1DYOA 2HWD2 2WO7A 1GNYA 2BFUS 3X29B 3O7OA 3V0BB 3URFA 5SV5A 3K48A 3OPTA 2RDQA 4XUPA 3ES4A 2Q8DA 3VD3A 4EWEA 2D6MA 3GBWA 2B7YA 2B39A 4CDWC 2H0BA 2QCSB 2R16A 2XONA 2KA3A 3OPWA 2DWRA 5JZGA 3LPGA 1HW5A 5IK4A 5FYZA 4Q0UA 1MZFA 3L2HA 5GLTA 4JGZB 4L9BA 4Q2FA 4PQQA 1LOFA 1POQA 3WHTA 3N9QA 1OA4A 1B09A 1TMF3 4CDUC 2XVGA 5HPOA 4DZGA 3GGLA 5JXIA 5IAVA 1H4HA 4EN6B 1HX6A 4BLJA 4CEYA 3EXUA 3PJQA 3D4KA 4ATEA 2VZRA 1RUF1 3MO4A 5DDJ1 1ASJ3 1WCDJ 4EJRA 5A33B 2GP3A 2C1FA 3AYEA 5HCHA 2GC1A 4L92A 2V72A 4EN0A 4JZRA 1AR81 3IKWA 2GN3A 1POV3 4QKFA 1I6XA 4Q0SA 4BQ4A 2RS52 1W2TA 2WYSA 1RMU2 4YG6A 3ZIWA 4CDXB 3PVEA 3IDBB 1GQPA 4E2SA 1XC6A 5FXWA 1QJU2 1FOD1 4MGQA 2B4KA 4AXOA 3EHKA 3LAGA 4XUQA 2F4PA 4XZUG 3T4HB 2R062 4XUNA 5FMDA 1CJPA 1NUKA 3CZJA 5JAXA 2XKOA 4LORA 1GQHA 4HANA 4DRVA 4HETA 1RUH1 2WKKA 3ZYIB 3T0AA 1RUD1 2VC9A 3AVRA 2W91A 4HVQA 3AYDA 1PM7A 3VV1A 1JYXA 1COV1 4G3YC 3WHUA 3ACIA 2PHLA 1UY1A 4TSVA 1AXKA 2RMU2 2RHPA 2AZ5A 5H9RA 1V6LA 1R091 2E31A 4HPKB 4GKXA 4QKBA 4C0HA 1GICA 3KCYA 3HBZA 5CKQA 5E6HA 3MHZA 5FXVA 1RUI3 4XACA 4MGYE 1XPWA 4QAWA 4EZHA 1ZRCA 3IDAA 4YVWA 4CU7A 5AVAA 1AR71 4XJUA 4BXSV 1DF0A 1VB2A 5LEJA 4A6OA 1PX4A 5T5PA 4BIFA 4GH4B 5F39A 3N7LA 1IPJA 5HCFA 1OF3A 3O1TA 2XR4A 5FP9A 4D7TA 4ES9A 2D97A 3KD4A 1XNAA 3OUJA 3H7YA 1ULPA 1PIV1 3VBHA 5K4LA 4KMQA 1C1LA 1WZXA 1DGLA 1RUC3 2UWCA 1CAXA 2DVDA 2XOMA 1OD3A 2ZMNA 1O59A 1JU3A 3A7QA 3DPRC 1QNYA 3MUZ1 3DPRA 2BOIA 4Z07A 1QJY3 4Y4RA 1K5JA 4P9XA 3I3DA 2VMGA 1W8UA 1WW6A 4GD4A 2B9UA 5T5OA 1ST8A 3GBGA 4KWJA 1EV12 2W46A 2ZGSA 5T50A 3TN91 4N7UA 2XLFA 3O1RA 2NMOA 1X8MA 3ZFFB 1XSRA 1SBEA 4LMFA 1ZZ7A 4Y22B 4A42A 3PDQA 2R043 5A6QA 3AMMA 2ZGKA 1W3XA 2OPWA 2P34A 2WIIB 1Q8PA 2XJTA 3O12A 3RZGA 2VUJA 4YVSC 4A7KA 2YUEA 1VAMA 2BGCA 2IXHA 3RZLA 4DEQA 4QDRA 1RVF3 1VLNA 2HEVF 3USUB 3ZMNA 4N90A 5FYTA 5CAZA 4NR1A 2PLV2 5IVEA 1FMD1 1UX6A 1W2AX 1XNKA 2ARXA 4L2NA 3WP6A 4AQTA 2WNEA 2BJSA 4XCBA 3OYWB 3LWCA 3KV6A 2ZGMA 4G4FA 3AJZA 4AI8A 4AFDA 1K5MC 2ZTNA 1K5MA 1RINA 4K3UA 2R1BA 4MOAA 3WW3A 2W1WA 1VBA2 3N9OA 5HV4A 4TN7A 2W39A 1D4VB 5F1RA 1KFXL 2RJLA 2RM23 2DVAA 5DZGA 4CVUA 3I3EA 2VE1A 4MXVA 5FZ0A 3WX5A 3AMPA 2LTNA 1S1AA 3K46A 4MG2A 3NAPB 1BXHA 1HB1A 3O1MA 3WEZA 1CZVA 3IDCB 1PNGA 3SXWA 2GSYA 3ETQA 3VGIA 1JYTA 5C3QA 3MBWA 3OGGA 5D8AC 1JXNA 3ACHA 2VVFA 5D8AA 3WP5A 5B2GB 3AL5A 4OHWA 1CZTA 5FZBA 3VLBB 2AREA 1MVQA 2PMWB 2FCUA 3CJIB 3N35A 3VBOC 3VBOA 1MQTA 3OF1A 1YQ8A 4HLTA 5JPMB 2EIGA 4Q8LA 3FHIB 1HQNA 1X8EA 1PGL2 2Z69A 3EB7A 3DYOA 4EN9B 2GMEA 4LKDA 5FY1A 2VULA 2A6WA 2GDFA 5LASA 4YZ5A 1BKZA 1PGSA 4WBBA 4GXLA 1UZWA 2A5ZA 4FOQA 1E5RA 4P9IA 1CD3G 4YW4A 4LITA 3VDDC 1JN2P 5FZ9A 4DRRA 1VPHA 4ZZ5A 1W9TA 2RR11 2VZTA 3J7LA 2XUEA 5JSRA 1PO13 1W8OA 1RUI1 2PHWA 3AZWA 3I2GA 3PTYA 1F5JA 4XJWA 2B45X 1GP5A 4YZ2A 2OIIA 1ZYBA 4PHZA 4R4XA 4N7IA 5DAXA 5IATA 1H0BA 5FP4A 1NG0A 3F2ZA 4LLFA 4S2GA 4M0HA 3VD7A 4AHXA 5ACA1 2TBVA 4K40A 3LDKA 1UPSA 1FAYA 1PVXA 1ZBA1 1JH5A 1WMXA 2ERFA 5FZ1A 3LA2A 1PMHX 1RUC1 3MIEA 4ZY9A 4AEJA 4QQHA 3MIFA 1GNZA 1WCSA 4CCNA 2IZWA 2JDUA 3W5MA 2VOWA 4LBLA 1RUF2 3WNXA 5DDJ2 1AR93 4CP9A 2BP6A 1A8MA 3VBUA 4AVTA 5JI9A 4QHBA 2XKPA 3WXPA 3H3ZA 2EALA 4Y5Z0 3HN3A 3B93A 4AEDA 2IXKA 3WOGA 4CPBD 5CZKA 3KF5A 4CDQB 3GJAA 4XFGA 1CR7A 3FHAA 3T4VA 3UNPA 1O91A 5JR7B 4CU9A 4IE4A 4AHYA 4BE3A 3HEIA 1BZWA 1FOD2 4TZDA 4KWLA 3HNYM 3JCIA 1H8TA 1JUIA 2VUCA 2XJQA 3HT2A 4UW4A 4UYBA 3CO2A 4HSLA 4WM8B 3GZUC 2P4EA 1E5HA 1GOGA 2D6NA 3O14A 4IV1C 2ZHLA 1NAEA 1RUH2 1OOPA 5EP9A 3ES1A 5F7UA 5T5LA 1RUD2 5L7OB 5EFUA 2I2SA 4D7YA 5BNNC 4XBNA 5A1FA 1V6OA 1NCRB 3J7NA 2JDAA 2WZR3 1COV2 4Q4X3 1UW8A 1V0AA 3V65A 3I97A 3PUHA 2Y0IA 1YI9A 4TWTA 1S0GA 4MXWB 2BW8A 3QLQA 4BYYA 1WBFA 1VJ2A 2AYHA 2JKBA 3VHNA 1SLIA 1R092 2OXBA 5F32A 2ADEA 2XJUA 4RS5A 5F5CA 3SCHA 4XF4A 1MACA 4ZHNA 4IEXA 4F83A 5JDBA 1S2KA 1UY2A 1S0EA 3H8UA 4MGIE 3P3NA 4QPGB 5FPBA 3VBRB 1DDLA 4PIYA 1JYWA 1H9PA 2WWSA 1W8ZA 1CVNA 3MI8A 4M3CF 2ZACA 1GZCA 5F3CA 4E4ZA 2WNVB 1NQDA 1V9U3 1YEWA 2CL2A 4J1XA 2XBO1 1HB2A 4D7SA 5T55A 3GHMA 1JMUB 2ZGRA 3HOBA 3T3YA 5A3PA 2LRPA 2YC2A 4PDWB 4RHV2 3B94A 4UI9L 3OBZA 2JDZA 3W21A 4K21A 3KT7A 5FOBB 4Q0QA 4YFWA 5FO9B 1YIPA 3SH4A 4ZS2A 2OA2A 2D6LX 3S7EA 1MS8A 2ZHMA 4UAPA 1WCKA 5FMBA 3NNLA 1Q43A 3M4FA 5F2SA 3ZYGA 2RS31 4XF0A 1W06A 2Q1FA 2VXJA 1AUYA 2VH9A 4QPWA 2GAUA 2P37A 5GLWA 1XB9A 2RG4A 3GHNA 4UWDA 1D4M1 3HPNA 3D6EA 2W47A 1XNBA 3FFZA 1XNTA 2QTWB 1FXZA 2DFCA 2JENA 4BQ2A 3LEIA 4RR3A 2SLIA 3MIHA 1VBE3 1DP0A 1YLLA 1EPZA 4DY5A 1EUTA 1PX3A 1UWWA 4NWVA 2HWF1 4NWWA 2VGDA 1KJRA 3B9IA 1O4ZA 3UETA 1H2LA 1OKQA 4QX5A 4PBOA 1OD5A 3VD9A 2XJVA 5AFBA 5FV3A 5BXXA 5TSWA 2CSGA 3VKLA 3O1VA 5FQ0B 4LULA 3N36A 4LHNA 4XIOA 2VG9A 3AK0A 4XJ8A 4AF9A 5L19A 1NY71 2WN2A 2JG9C 2A3XA 1AR91 1ASJ2 4CUGA 1I5ZA 2VQAA 5FPLA 3I2FA 1F31A 2QQKA 3S57A 3I59A 4FI9A 2PHDA 4GB33 3PHMA 4JQRA 4TXWA 1W0OA 1GNHA 3MW4A 3HR9A 4YNIA 3VHOA 2O8OA 2WLPA 3MFCA 2BYVE 4PLNA 4JGYB 3PUSA 1SEFA 3RG0A 1WLWA 2BZDA 1HN1A 3UV9A 5J36A 1O3QA 1DFQA 3M3EA 3I3MA 5G04L 5FZOA 1UZYA 3RPQA 4D6RA 4DO0A 1JODA 5JIAA 3ZFGC 3D0JA 4Y33A 1UOJA 5IJRA 3LIHA 3ZMOA 5T3NA 3POSA 3D82A 3N9MA 5LRRA 4CCDA 5BY5A 3HMYA 5C8WA 2XPJA 2EXHA 3GDBA 3NSTA 3PVBB 5DAVA 2PQQA 2OX0A 2RS13 3IPVB 4D0QA 4CU8A 3I49A 4M00A 3U10A 5FO8B 3M7AA 1VRBA 3C7FA 2HWE1 4TLFA 2I74A 3V64A 5C9AA 3WP4A 4XXAA 3THPA 2HLEA 2FHRA 2PHUA 3JBG1 4WVMA 1SFNA 1UNBA 4BXFA 3KGLA 4YW3A 4Z82A 5FDBA 5ABJA 3JD71 5J09A 2RDSA 5C3OA 5C8CC 1LCLA 3J9SA 5A3WA 5FYSA 1RUI2 4E8DA 3NVCA 1JZ8A 3VBSA 4ES8A 3ZXFA 4URAA 2FDKA 2QDRA 4JHZA 4XBQA 4EV0A 1VBB3 2CTVA 3J8F3 3KV9A 1XYNA 4FPGA 1UAIA 1V9U1 2TEPA 2CV6A 1BJQA 2AUYA 4UOJA 4DUVA 2I45A 3ZFEC 4AZZA 5ACA2 4C90A 4S2FA 4Q4W3 4M0NA 3O1OA 3KT4A 4Q5OA 2YYOA 3SCFA 3N4MA 1LODA 1RUC2 4LOSA 3BOWA 3HJRA 3RGBA 3BCWA 4HSJA 2KR2A 3GALA 5HCAA 3R0RA 5C4WC 3PUQA 1XBFA 5CFDB 1GP6A 5FZLA 1CIYA 1G86A 1JS9A 4O9GA 4XUTA 4AVSA 3NV4A 3DF0A 2FZ2A 4COYA 4EZ4A 2VMDA 5FZFA 4LBMA 3MGUA 3B7MA 4UFKA 2BFUL 1OLQA 1A3KA 4QX8A 2VW1A 2PAKA 4YM2A 1YJLA 1F4HA 3AKSA 1MS4A 2CGOA 4CPBA 1BQPA 3FHQA 3RQ0A 4CDWB 5FYVA 1DG6A 2R071 4LE4A 3WNLA 3ZLIA 2QQLA 4OUMA 5GM0A 4CEWA 2LROA 3K75B 4KI5M 4OMDA 2OVUA 3H1WA 4AFBA 3NRUA 4C1XA 3NWKA 3RNSA 1IPSA 3JQXA 4V2WA 2IXLA 2NPIA 2Q30A 4MGSA 4D6QA 2W68A 4TTGA 1PK6A 4CDUB 2FQPA 1VBC3 1QOTA 4YM1A 1PO21 3HIFA 2XJPA 5B4NA 3VB9A 1YFYA 2WINB 1NCRC 1XQNA 5JSPA 4N53A 1AVBA 2WQ8A 5FLJA 4BJ0A 4YZ3A 1N3OA 4P02B 1RUNA 3ZSEA 2QQMA 4JRAA 2JX9A 4XCAA 4DPNA 2Y0OA 3I2KA 5FWJA 2DBNA 3LE0A 2PHXA 3LEMA 2ZZQA 2H0VA 4XYXA 3VKNA 4FTBA 1AX1A 1UCXA 3MV11 4YWAA 5BNPC 3TEYA 2Q8CA 4RQPC 3PURA 2JG8C 3INAA 1RUJ1 3D8CA 4ATFA 2JG8A 2WWUA 4LT5A 2V4AA 4NRPA 5F5IA 3UJQA 2DCJA 2XBO2 3NKTA 1NT0A 1V6JA 2BOJA 2VNGA 2X09A 5CKMA 5FYIA 4AI3A 4DS0A 1LNSA 1R1A3 4L11A 4H7LA 1W8HA 2QQPA 5K0UC 4CCKA 3ZYFA 1RUE1 3BPSA 4L97A 5A7SA 3OTFA 1ZRFA 1YUDA 4W65A 5EJ1B 1KFUL 1YXWA 3WF4A 1Z7S1 2NN8A 2DCKA 2GMMA 2L9LA 3LEKA 4IGQA 2BNOA 5A32A 4YW6A 4XQDA 1I3HA 1X36A 4KGGA 4W6XA 1HJFA 2RMU1 4HL0A 3THTA 3JUUA 1J83A 4L99A 1OBNA 2ZCWA 4LBQD 5GZDA 4DUXA 2VZ1A 5I0DA 1U0AA 2GNDA 1D4M2 4K1YA 5GZGA 4M4RA 4NIGA 3KQ4B 2GU9A 2VJXA 2XQXA 4Q4Y3 4LBNA 2EXJA 3BU7A 4Z2WA 1CAWA 1HRV1 5F3EA 4DMIA 1OXCA 1FX5A 2P3KA 1IS4A 2WS91 2HWF2 3D3AA 5CADA 2YGLA 1AX2A 1BEV1 2P3JA 3TEWA 2LW8A 4XBLA 1W28A 1GP4A 1J3RA 2W95A 3MUY1 4M3CB 3DPRB 5DQ0A 2ETEA 3SITA 1HRI3 2ZX3A 3JQWA 3OEBA 2WQZC 1X9TA 2HEWF 1AR92 4AI9A 2XL9A 4FPFA 3MLKA 2E26A 2IFWA 1ZRIA 2P6HA 1EV11 1YYNA 4BWOA 5C7GA 1W0PA 2HYXA 2G4IA 5CEHA 4MSVA 3NV2A 1S0FA 2YXSA 3ZSJA 5CFCA 4XF9A 5FXXA 4DUWA 2VAUA 3B02A 2OT7A 4PQ9A 4XETA 1IG3A 3U4XA 4QKDA 4QKNA 5B4XA 1BBT3 1V00A 3FLRA 5C3SA 4YVSB 4XTMA 2DCZA 4Q27A 1TE1B 1Y43B 4QX7A 4B7KA 2VCBA 4N9IA 1QKQA 4CE8A 5A3UA 3SH3A 1SFYA 2Y8KA 3WW4A 1LHOA 2PLV1 3UKTA 5LW9A 1HXS3 1W9SA 2EAAA 5KR7A 2HJIA 1W05A 1VRH3 4Q4X2 1K5MB 3AMQA 2XWJB 2JE8A 3O0WA 3UKNA 3WW2A 4YPJA 4XMIA 4AVBA 4Q1RA 2JDYA 1N1YA 3WCSA 2RVAA 4LBKA 1SQ4A 1ND3A 2X5IC 1AYN1 2JJ6A 1DYPA 3PNAA 4RL7A 5D21A 2WUHA 4NOTA 1W6OB 3UGFA 3G6JB 3T2QA 1Q8QA 4E4HA 4BQ5A 5J96B 3FUOA 3QH6A 3R4SA 5D8AB 5JMOA 2QDNA 1V9U2 1SFPA 2ZBJA 3B3QE 4ASLA 4BCUA 3OB8A 2H6BA 4ET7A 5C5UA 3R6SA 4EE2A 2VZ3A 1LB2A 4GZ9A 5I91A 1DGRN 2BVBA 1S0DA 4TYSA 3VBOB 5C70A 4AOCA 4AW7A 1ZA7A 1UU6A 3BPZA 4NHMA 4IEZA 5IVCA 1SLTA 2OQ7A 3VDCA 5E89A 2UYAA 3NW4A 3TOJA 1H1IA 4DINB 1XE8A 1PGL1 4F8AA 1UYZA 4Z2AA 2W1QA 2OZ6A 4ZKTB 5FZHA 2R6QA 3UT0A 1H8VA 2E9QA 3VDDB 2I07B 4OHXA 4RSUA 1A6CA 1POV0 5FYBA 4BB3A 2BTVC 4FTSA 1IPKA 1RHI3 5GLVA 5IK7A 3NJXA 5F37A 3ACGA 4Q26A 4HZFA 4NHKA 2R072 2ZX2A 3GBFA 2ZGTA 2ZEZA 2WFF1 4JC1A 3NNMA 1R1ZA 2MNGA 3WD5A 2Y6HA 1YFUA 2J1SA 5JZGC 3LFMA 4ZZ8A 4DIQA 4YM3A 3NQHA 4KU7A 3N9NA 1E5SA 3H1YA 1LOFC 1C4RA 1GV9A 1LOGA 3RYKA 4NIDA 4FAHA 1T2XA 2EA7A 1DZTA 1HLCA 1W6PA 1Y3TA 2JD9A 1PO22 1CX4A 2R1DA 1W6QB 1DZQA 3IMMA 4W8JA 4KGQA 4YSFA 1Z0HA 4CEYC 2BV4A 1V6MA 2C6SA 1N3PA 4D69A 3WSOA 1UIJA 2UWAA 1YO8A 2SBAA 3ZKUA 4H3WA 2QQVA 3ZDSA 4HFSA 3EYPA 2PHTA 4GB32 2XH6A 1WGPA 4J25A 3SISA 4XQWA 3FC0A 1L3JA 2EICA 1PGW1 5KXCA 5I0SA 5A6XA 1RUJ2 2FDHA 1XYPA 3DXTA 1JBCA 2OUHA 5LCWL 1BBT1 4N43A 3ZXKA 5FMOS 4XMAA 1QHDA 1AXYA 2MHFA 4YG3A 4IV1B 1HB4A 2VO5A 5D1IA 3RS6A 1UY0A 1UYPA 4ASKA 2ZS6B 3VL8A 3MZHA 5BNNB 1RUE2 3VZOA 1GZWA 3ZPYA 4DEVA 2XG3A 4CSWA 3M70A 3S5QA 4B8EA 1Z7S2 4H7MA 3THDA 2CU5A 4BK5A 1APNA 2VBPA 4KWUA 5FZ8A 2C5DA 4XDOA 2PN5A 5FY9A 5A3LA 3LQCA 5JMCA 1JHNA 2D7FA 2ZZJA 3E5UA 2DUQA 4ZU4A 1H2NA 4CU6A 2FDGA 1QH7A 4CZSA 1LOCA 3J7MA 1IG0A 5L9VA 5GLZA 3WCRA 5JIUA 4QX3A 3C7EA 3T1LA 4LBJA 3RZKA 3ZVXA 4YVWC 3TYJA 1TEIA 4LBQA 4BMBA 2RE9A 1VAKA 4NPLA 1YWKA 1OH4A 1B35A 1HRV2 2F4LA 3C7OA 3KB5A 5GLUA 4I0AA 4YGEA 3T2PA 4CXWA 1RB8G 2AGSA 2DYCA 1YFWA 2WS92 3L2YA 2VMEA 3CDZB 1ZZBA 4IE5A 1BEV2 3AX4A 4QB2A 3SHRA 3K4AA 4MHUA 3VBHC 3WW1A 5JWPA 4XAAA 2ORXA 3ILNA 3OGVA 5C3RA 4RHV1 1C57A 1UQXA 4OZOA 5L9RA 2W1UA 4E8CA 1ULDA 1W6MB 2DF7A 3VZLA 2GN7A 3SNMA 1SPPB 3M3IA 4NHXA 4PT6A 2P6CA 2XMLA 5BYNA 3POYA 2Y34A 3KV5A 2ES3A 1GOFA 1F5FA 4OHVA 5KC5A 4XURA 4LKFA 4Z1VA 3RZHA 5A3TA 3IAPA 4IV3C 1ZBE3 5IYYA 4IV3A 3ZIXA 4AFMA 1FYUA 4QPIA 3HVDA 3HQRA 4M3CE 3KLSA 1RUG3 4NIHA 1U5ZA 3C8XA 3AYCA 3WLUA 4FXKB 1MS0A 2WA4A 3ILRA 3OUIA 3O1UA 1U5XA 2VUDA 3CBNA 3WDXA 2RJKA 4NRQA 4A3XA 5FK8A 4LOTA 2FCVA 2ZMKA 3ABZA 3ZX7A 2V5DA 4PLOA 1WA4A 1ZZ9A 3M2MA 3WNNA 3ZXLA 4BMEA 1O8SA 1QXPA 1VBC2 2J1RA 2J22A 4YFZA 1H30A 1HIXA 1TMF1 3PIJA 2BUKA 1ULEA 1Q8OA 2K0GA 3MPBA 4HT1T 4Y20A 3IBMA 3WNKA 1RXGA 2JG9B 2ZMLA 1VMFA 3AC0A 2Q8OA 4QWNA 1KXGA 4YGCA 2PFWA 1ASJ1 1W99A 1AL23 1NLQA 4XUOA 2JDNA 4AGGA 4ASMB 2ZEXA 1AYN2 5GZFA 4LUMA 1CZSA 4OYUA 4CTEA 2G9ZA 1POV1 1WCQA 1UU4A 1X9PA 2HBUA 3GF6A 5FPAA 1E57A 1QJFA 3RMYA 4ZU5A 2XXZA 1OUSA 4X6QB 3SKVA 5FZOB 4PIXA 1OKOA 1JUHA 1QH6A 2Z4FA 2D98A 5A7WA 3KZ4C 2WAAA 1TME3 3A0NA 3N9LA 3U11A 3ZFGB 4ISRA 5A7PA 2WZ8A 1W0NA 1QXRA 2X8KA 5KHGA 2ARAA 1H4GA 3H9AA 1R1A2 2JDKA 5IVVA 3LSEA 1M06G 1ZVFA 1UMIA 1VP6A 2O0OA 3UK9A 1MQTC 4LTAA 4EN8B 1G8WA 1KEXA 1O4YA 4B1MA 4Z8BA 4M01A 3ZO0B 3LOBA 5H9SA 3O0XA 4WVVA 3U37A 2C9KA 3R4UA 4YZ4A 4IEVA 3WDVA 1DZRA 1GYKA 5DAPA 2PAMA 1AXZA 2ZEYA 5LY2A 4LIVA 4R9BA 4FPHA 4WVZA 2DBIA 1JI6A 1SACA 3BODA 4FPEA 4P9JA 4UFIA 4GWJA 5CIRA 5C8CB 4KG8A 5IHRA 1JYNA 5IVJA 3V0AA 3R05A 3M3QA 5JXHA 1TG7A 1NX9A 2WFF2 4P5HA 4AE2A 2ET7A 1V6IA 3ZXGA 4GA9A 5FPZA 2HWC3 4PI2A 2K2SA 1CPNA 4AWDA 3SMHA 1FATA 4A7ZA 1MZEA 1BVP1 1OLRA 3LFIA 3ME2A 4MV2A 3ZFEB 4UW5A 4I0WB 1WMDA 5FY8A 3GM8A 5A7NA 5EJZB 4G9SB 4LHSA 1DQ4A 2VOKA 4LO4B 2A73B 4WZCA 1SCRA 2PELA 2PTMA 4AR2A 2G19A 3CZUA 5C4WB 2ENRA 1OPOA 1HRI2 1VALA 2VR4A 5AC93 3VBUC 1QJY1 2VU9A 3V0BA 3ECQA 3DCQA 4P14A 1IQAA 2WSVA 2XHNA 2C0ZA 2YV8A 3HNBM 4AEDC 4P5YA 3S6PA 1QJX3 2VTFA 3MYXA 4Q1PA 4RGGA 2GNBA 1PGW2 4I01A 1ND2A 1UMHA 1RITA 1UZ0A 3MW2A 3QD6A 2R041 5JXJA 2BWCA 4K9SA 2K46A 1H8TC 1BBT2 1Y9MA 2W5FA 1RUG1 3AP4A 4ZXKA 1Y4WA 5J37A 1JYIA 3N9PA 2VBBA 1QMJA 2VTXJ 4CXXA 1CWPA 1OVPA 1OT5A 1XYOA 2A75A 2A6ZA 2VNOA 4B4RA 1FI2A 3GYDA 1OOPC 1RVF1 5E16A 1NA1C 3EO6A 4XFCA 3ZXDA 1NA1A 1L7LA 3TEXA 2CDPA 4IUGA 1K42A 3P3PA 2JE7A 4BZ4A 1VRH2 5F5QA 1IZ3A 4CDXA 4I02A 3JXSA 3AP5A 4AI2A 2FD8A 2NLRA 2D6PA 3VHRA 4BLIA 3ZYRA 3L9JT 4RS5C 2Y6KA 5BNPB 2RM21 1REDA 1W6NA 4DXZA 3RYRA 3FUQA 4JX0A 1YC61 4RQPB 2GALA 5IK5A 1IS6A 1ENRA 2JG8B 1UOFA 4UBGA 3I3BA 4P9WA 4K20A 5FP7A 4E27A 4OUSA 3GCXA 4BQWA 3USSA 1GR3A 1N3QA 3AFGA 2WT0A 4Q4V3 4Y4YA 5FYMA 4AAXA 1J58A 3V56A 1GWLA 5FCCA 4DXRA 5K0UB 2R0HA 1W2NA 1DQ6A 3WVJA 3AXDA 3LF7A 2VBDA 2QQNA 4K8FA 2O14A 1IGOA 5FUIA 1G9BA 3LPFA 3E6CC 3KVBA 2YU2A 4QX2A 1YHFA 3DXUA 3Q8FA 5CYYA 3S30A 1ZM1A 1ENQA 4K7JA 1NE6A 3Q8EA 4J1WA 4MADA 4NPMA 1O7FA 3WQ1A 4FCAA 4JAAA 1MEC3 1SHWB 2J1UA 3DV8A 4Q0PA 2BBVA 1OFSA 2W0XA 4GH4A 2ORZA 4D94A 1PO11
chains in the Genus database with same CATH topology
4WZFA 2V09A 1AL0G 1J1TA 1RTVA 3ZN6B 2BNNA 4QT6A 3WG2A 4RR3C 1OA2A 2YMZA 3ALQA 3C3VA 3PLQA 5LK5A 5IK8A 3IN9A 1FPN3 4IXLA 4AQ6A 1MVEA 1AYM3 1HQWA 4CP1A 2WLQA 4EWDA 1TMF2 3RI8A 1TNRA 2HWD3 1CONA 3AFKA 5L73A 1QWRA 5HBAA 4AHZA 3AZYA 3M3OA 3HD8B 5EYXA 5FRAA 3WG3A 1WMEA 4LO6B 1FT9A 5HI0A 4NPRA 1SCSA 1YFXA 3AM2A 1EPWA 4LE3A 3LB9A 2YZ4A 1QF3A 3WUCA 2P2KA 2A6VA 3USUA 5KHKA 1V6KA 3VN4A 1G9FA 2JXAA 4R9DA 1IS5A 3AKRA 1QU0A 4HKOA 3RRDA 1UZZA 4HK9A 3OYWA 3TWIA 1X50A 1CAUA 1DHKB 4B4PA 4FP3A 1BMV2 1HKDA 2RS53 1RMU3 1A78A 2WZR1 4Q4X1 5C9AC 4I3PA 1U5YA 4KBBA 1RGSA 2CAVA 5HXVA 1FNYA 1QJU3 4Y1XA 4FQZA 2IXCA 1S55A 4FO9A 2WL1A 2X5IB 2BEOA 5ABJC 1KRIA 4QQ2A 5JOXA 2R063 5C33A 3AKPA 4IQPA 5A3MA 2GC0A 3QBQA 3VBSC 3OJBA 1ZA4A 3M1HA 2EXIA 4JTOA 3LCPA 1Z78A 1DQ5A 1DGWX 2NYYA 5LRSA 3RSJA 4HVOA 1J3QA 5DXDA 2PHFA 2DVGA 4MGKE 1F9KA 4MX3A 4GMP3 3RJRA 1ZZCA 1LEMA 2YY1A 2ZGNA 1DLLA 3TBDA 3FLPA 4FPKA 4OI1A 5JOWA 5J48A 1QJY2 4F3JA 4MGZE 2VQ0A 5BNOC 4MZUA 3W58A 3OPZA 5BNOA 2XLAA 4AQSA 4AHWA 2WFPA 1RIRA 1OQEA 1ZBE2 1MEC1 4PCRA 4YRDA 4YM0A 2R042 1PZ7A 1M4WA 4RA0A 4XHXA 4CEWC 4LO7A 4FPYA 1LGBA 3H50A 1RUG2 3AXEA 3FWEA 4AVCA 1DYKA 4P9YA 5I8TA 5JZGB 3WQ0A 1Q5OA 4GALA 1LENA 3LSDA 3TNQA 5IT6A 4HN1A 1VBE1 4I3GA 1ENXA 3CEWA 1W6PB 1RVF2 2JEMA 5E1RA 1PK6C 1LKNA 1SBFA 2GH8A 5J3UA 2QZ2A 2W08A 3B00A 4BPZA 1MR5A 1URXA 4JV4A 4CEYB 4N53C 2XHKA 1N1VA 4PJYA 4CDQA 1YIFA 1UD1A 4IEWA 3UL2A 1H1MA 2WQ4A 2HKXA 3IMNA 2FBEA 5DUWA 1NYWA 4WM7C 1KDMA 2RM22 3LA7A 4WM7A 4GB31 4AGRA 4WM8A 2Q1MA 2YC0A 3E6BA 1C1FA 4DY3A 4Z92B 3WV6A 1LHWA 4UW3A 2D5HA 5FMOL 4KU8A 4EN7B 3DUIA 3VBFC 1ENSA 3VBFA 5L7OA 1Q8VA 4IETA 4LA3A 4OHYA 5DUVA 3TAYA 4ORFA 3N7JA 1GZWB 5BUVA 1PHMA 3EJKA 3J4UH 1VBA3 1PZ8A 4YZ1A 2RS11 1C8M3 2O8QA 1U12A 3AKQA 1DIWA 1VBD3 2V73A 3KMHA 3IDEA 4I30A 4QPGA 3VBRA 4L8QA 1QJZA 4Q0VA 3B9CA 1WW5A 5CG9A 1S0CA 2CGNA 2HWB3 3DN7A 2WNVA 4Q29A 3G7DA 3ZXGA 5JI7A 1X7NA 3APBA 3JZVA 4CYDA 2QKDA 4K1ZA 4LBQB 4YVWB 1PO12 1ULCA 2DCTA 2OPKA 4UW6A 3O5SA 1HQLA 4INDA 4PDWA 3WQ7A 1CPMA 1WMFA 1VBB1 2HWC2 3J8F1 4IEUA 2VW2A 1AJKA 2D40A 3VBHB 5GALA 2Y26A 5K7PA 2E53A 3JB8A 3BB6A 3ROUA 3KM5A 1CAXB 3VKMA 4Q4W1 4GMP1 4XDQA 2XVLA 4DOUA 1LULA 4ONUA 4XEZA 4BQ1A 3Q9OA 1MS1A 1X82A 2YROA 5T5JA 1YNAA 1FNZA 1LJ7A 4IV3B 4NN0A 4HVRA 4P9LA 5CFCC 1ZRDA 2WT2A 2HEYF 4PF5A 2Q0AA 1GZ9A 3QH7A 1V6NA 5FFOC 2JECA 1KS5A 3H7JA 4YGBA 3A4UA 1AHSA 3LA3A 4Y26A 1WLDA 3I54A 4CRQA 3JB4C 5I8SA 4HKWA 4S2DA 2DTWA 2IFRA 4FOWA 5FQ0A 1RUF3 4GIQA 5DDJ3 1VAVA 3O0VA 1UKGA 4YLZA 1GANA 2YDEA 1AR83 1VBC1 4LO5B 5CBLA 3CF6E 2D3RA 3FE5A 3FZ3A 4GWNA 3WDUA 4RD7A 2WZR2 1D0GA 4FPOB 1JYCA 2Q1ZB 1VIWB 4B29A 1NCQC 5CNAA 1NCQA 3BOPA 4QQLA 1UIKA 3ST7A 1ND3C 1O5UA 3ELNA 4XXPA 2A71A 3S7IA 5FBZA 1RUH3 2DU0A 4Q8KA 2A6XA 1RUD3 2G9GA 4AGVA 2VVEA 4XFAA 1COV3 3AZXA 4QGMA 5I8YA 3FX3A 1SLAA 1WD3A 3ENRA 1R083 4CP2A 1G6NA 3AP6A 1MQTB 1R1A1 2DUPA 3ZN5A 1AR63 4Y1YA 1R093 3B01A 3K51A 4HN0A 5CA6A 2E6VA 3SCGA 3ZXJA 1GSLA 2D3PA 1AR73 4I0BA 1DGWA 5I0UA 4QPYA 2R32A 3VL9A 3V0AB 1MEC2 4XFHA 2R49A 2Z42A 3RZZA 2D44A 1PIV3 3WY6A 5EZWA 3EQEA 4GULA 4R8HA 5KC6A 1I1EA 2ILMA 1H9WA 2VPVA 4LLOA 1CIWA 5FOJB 4Q4Y1 1O5LA 4HMZA 1DGRA 4WV8A 1CJDA 3WG4A 4AK3A 1PVC3 1VBE2 1DQ1A 2IXIA 4Y1VA 3WR0A 1FPN2 1WW4A 3N7MA 3LKJA 3TN93 2X53S 3NV1A 2VECA 4COWA 1QOOA 4A2UA 1Y9QA 3ZN4A 1OQ1A 3POWA 4IEYA 3VBUB 1HRI1 1HDKA 5CG8A 1LTEA 3IWZA 4AEDB 4CDWA 4JDNA 5I0TA 1JOJA 1AZDA 2XUMA 1ND2B 5E88A 3SLIA 1S0BA 2ZKNA 2VMHA 3ASIA 3AMNA 4LO8A 1FMD3 1H8TB 1S2BA 1UF2C 4XJAA 4XF1A 3MIGA 3KCCA 4N43C 4KG0A 3RDIA 4MVTA 4CDUA 2UY8A 3WG1A 1WBLA 2ZPXA 4U2AA 5K8SA 2G9FA 1Q3EA 2DUOA 1OOPB 1NA1B 5GZEA 1XNDA 1EY2A 3WDYA 4GWMA 2PYTA 2RS12 4ZU7A 2A7AA 2P3IA 2GC3A 1HXS1 3OD4A 4FOYA 1LOAA 2HYKA 4Y24A 1VRH1 2WSUA 4QMAA 1QY4A 1DQ0A 5FO7B 2MEV3 4Y1UA 3FFQA 5BNQA 4RS5B 2CY6A 3M8LA 1W6NB 3DL3A 3HN1A 4K6BA 4XPVA 3CLPA 5DG1A 4XFIA 3ATGA 2XLGA 5KXBA 2GNTA 4PIZA 2E7QA 4XILA 1LHUA 1PZ9A 2DVBA 1B35C 1KITA 1GQGA 1VBB2 3J8F2 4R4ZA 1TQ5A 4LR4A 4QU2A 3VHPA 3I2DA 2PHRA 4X8NA 4XFBA 1R081 1OFNA 2GNMA 4Q4W2 2DVFA 2VXRA 1AR61 1NXMA 1JTZX 3J26N 2RR13 3FBYA 3ZSKA 2DV9A 1ZNPA 2VMIA 3FLTA 5F9TA 1UMZA 4FPCA 2BVVA 5EJ3A 1AF9A 2FMYA 1LECA 1ULGA 3IIAA 5GZCA 1ZRRA 3H3UA 3WT3A 4JRLA 3VKFC 2K9ZA 1BCXA 1RHI1 4QPIC 5ACA3 3HWJA 1NXD1 4OHZA 2PA7A 3SH5A 4QM9A 5H9QA 1KDKA 1ZBA3 3HT1A 5IUQA 2CAUA 4KL1A 2VNRA 2QVSB 4RR3B 2YGMA 3QCWA 4M3CA 3UKVA 1OQDA 3HAGA 1C5IA 1PVC1 2ZJCA 4OVEA 4RGAA 2ZX1A 4BA6A 4NVPA 2AENA 1G9CA 4AYUA 1YI7A 2XB6C 3ZSLA 1HV1A 2EF6A 4AI1A 1NQJA 4S2HA 3H0OA 3ZYPA 1UPIA 1VR3A 2ZX4A 1J3PA 3I59B 3PVOA 1GFF2 1Q56A 2FZ1A 4JDOA 4LHLA 4COUA 4XIKA 1CAVA 2QUOA 4F7ZA 3NO8A 4YVSA 2D6OX 2GH2A 4AEKA 2QJVA 2R0FA 5DUUA 2XVKA 4UXAA 2ZGLA 5BPXA 1MS3A 1UL9A 3VZMA 1ZZ8A 4NO4A 4AVVA 2QFEA 1QDCA 2DCYA 1W2UA 2EXKA 1QXJA 1CAUB 5K9YA 3PVNA 3RWNA 1LOEA 5KWRA 3NJZA 2D3SA 3TRSB 1C8M2 1RL3A 1BMV1 1GBGA 5C9AB 4AFCA 5J98B 5CVRA 1VBD2 4FPJA 5JOZA 1S0JA 3RMXA 2B42B 4FXGB 2IWGB 1LEDA 4WVMB 4B4QA 2WNUC 1W6OA 2KM2A 3WZ1A 1BYHA 2WNUA 2TUNA 2MEV1 1DQ2A 5ABJB 3MFAA 2XBO3 2XJSA 3MDPA 1REEA 1SDWA 2ZGOA 1NE4A 2CNAA 3UJOA 4KWKA 2HWB2 3GZTB 3VBSB 4EWAA 1EP0A 4GKYA 4W6WA 2A70A 3OGJA 4Q4Y2 3LGRA 2BWAA 1SMVA 1CN1A 5J7MA 2UY9A 5FLIA 3PMSA 5GKAC 1NOVA 4LBOA 2C9AA 3QACA 3OY8A 2ZA9A 4R9CA 2RS33 4XE9A 2E7TA 4JCKA 3MW3A 3E5XA 4YG0A 1QNWA 1XE7A 3VDDA 1EYBA 3OCPA 5E8AA 5SV8A 1D4M3 3KS7A 3ZYJB 5BNOB 3GNEA 4AI0A 3ACLA 2Z2SB 4C91A 1GKBA 1X33A 3AKTA 2TNFA 1ND2C 1G9DA 2HWF3 1ZBE1 4XQ4A 4AVAA 2LUWA 4CEWB 2QNKA 3N7KA 4JGZC 4JGZA 2V5YA 1LGCA 4SBVA 1W6QA 4YYOA 2KXLA 1I9RA 3QOPA 1PK6B 2WT1A 1BVVA 1V70A 5FLHA 2X29A 4X8PA 5DZFA 1EAH3 2CYFA 2JD4A 4EROA 1LGNA 2XL7A 1AR82 3KQRA 5A33A 1HXS2 4N53B 1QQP3 4CDXC 2W52A 2UURA 4HBNA 1LU2A 2E7AA 3OBTA 4WM7B 1O4TA 5KHJA 1AL21 4R52A 2B8MA 4I2OA 2Q5TA 3VUOA 1NZCA 1KQRA 1IKPA 2ARBA 2ZKLA 4IV1A 3U07A 2Z79A 3VBFB 4LEJA 2OUJA 3RJ2X 3WINE 1OI6A 4FBFA 2UWBA 3DGTA 3AJYA 5BNNA 4UBHA 2VOXA 1XU1A 1TME1 2XGXA 5T54A 5HCBA 3MIBA 2HWE3 1PMIA 4XOGA 1RJ7A 1R082 5F6KA 4LHKA 2EAKA 5JSOA 4AQ2A 5FTTC 3E6DA 3JBG3 4LUKA 4AEMA 1AR62 3E97A 3JD73 4XHBA 3T2TA 4FVVA 1XRUA 5A32B 2VVDA 3MF9A 1Y7BA 4HPKA 4U36A 3MEPA 4C1WA 1AR72 2XWBB 2QE3A 5BV6A 1D0HA 2DTYA 2LALA 2N7GA 1O3TA 4COZA 1RHI2 4META 4GH4C 2VOVA 4W6YA 4O9EA 1PIV2 2GMPA 3NKGA 2VUAA 1OA3A 3VKOA 3TB0A 1CAWB 3CL1A 2FMDA 3ILFA 3U0ZA 2HWC1 3RYPA 2A3YA 1W6MA 2BNMA 1PVC2 1XU2A 2A3WA 3TN92 1UN1A 1LESA 2PAEA 4CP0A 2MPFA 3ZFFC 3AP9A 3VZNA 1A8DA 3ZFFA 3VZJA 2R073 4Y22A 1HV0A 2E51A 4A7YA 3LOIA 5AC91 4QD2A 1RUOA 3B69A 4DFSA 5CFCB 2ET1A 2H6CA 1QJX1 2YPJA 4BOWA 1O3SA 1IOAA 1QDOA 1WD4A 5GJ6A 5AFEA 2NM1A 4JVAA 2LM3A 3IT8A 3TNPB 1JW6A 4FAGA 1FMD2 4NHLA 3I4IA 1PO23 3AZZA 1G9AA 3HQXA 4WVWA 3KSCA 4KNCA 1LRHA 4QGNA 2NQYA 3PJYA 4YW2A 4BH9A 1YJKA 4GMP0 2JG9A 1D2QA 3KGZA 5KHHA 4B7EA 1EAH1 2JE9A 3MPPG 1G7YA 2B46X 2D43A 1QQP1 5C6CA 2WZPP 3VZKA 3AMHA 1NCQB 1MZ6A 2JICA 1RUJ3 4B3NA 2A6YA 1D2SA 3NAPC 2B5HA 3NAPA 2MEV2 3D0SA 1ND3B 4AFAA 4IESA 4SLIA 2UYBA 2ZABA 3ZFGA 1LU1A 2ZGPA 2NMNA 4MYEA 5DUXA 2Q4SA 4YW1A 1RUE3 1VB4A 4Y1ZA 1WLCA 3CU7A 4R9AA 1REFA 1U5IA 3CJIC 4BM8A 3CJIA 3DKWA 3A0KA 3M3CA 4E9KA 1Z7S3 4YARA 1H2MA 1SBDA 5KHIA 3NL1A 4Q4V1 2GC2A 3B5LB 4I09A 5JOYA 2RMU3 5LK7B 1KD7A 4DQAA 4YW5A 4N9HA 2VW0A 3W59A 4E4DX 3WDTA 2RR12 4HK8A 5C8CA 5FPXA 1HRV3 4OULA 3T1MA 1OHFA 2ZGQA 2WS93 2ZOEB 1BEV3 1WW7A 2R30A 3ZFEA 2XJRA 2BPA2 1ZBA2 3I7DA 3I8TA 4H55A 5I93A 3CJXA 1NLSA 3D5OA 2NZ9A 2UU8A 2DURA 4XW3A 1N1TA 3C2UA 3WDWA 2EVXA 4QQOA 5C4WA 4LNVA 5DG2A 2NP0A 1FPN1 1EV13 3KT1A 1ULFA 1MS9A 3CNAA 3MF6A 5AVPA 4LA2A 1BK1A 1AYM1 2HWD1 4CDQC 4ITCA 5F6LB 4FPLA 1C5HA 3R4DB 4MLOA 5KXEA 4BHPA 2CGPA 3ZSMA 3OBRA 1AL22 5JLVA 4ISQA 3OD0A 4J6GA 2E63A 1F2NA 3EBRA 4QM8A 4WM8C 1YCIA 3FBMA 3IM0A 3NV3A 3RI9A 2ZAHA 3KCXA 4RFT0 1RC6A 1H1AA 5FAXA 2PLV3 3W9AA 4IERA