4YM0A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-tetraose (lnt)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-4
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym0A00
2YZ4A 4NO4A 5GLVA 4JCKA 1W6OB 2DYCA 2ZGRA 4YGEA 1J1TA 3H0OA 4XJ9A 3R4UA 3RMYA 1EPWA 4Y26A 1QDCA 3WUCA 1SBFA 3ZSMA 3DUIA 2YY1A 3WCSA 2R1BA 1XQNA 1G7YA 3FFZA 1DHKB 2DUPA 2UURA 1DLLA 3MW4A 1BZWA 2ZGSA 4FPGA 1AXKA 2WLQA 4LBQB 1LULA 2DWRA 2D6OX 4YM1A 1IKQA 1S0IA 2DTYA 3V64A 1WUVA 3LSEA 5LK5A 1GZWB 3PJQA 1MZ6A 3D4KA 4ZXKA 2VU9A 4FVVA 4U36A 3IPVA 4FOWA 3LSDA 5DUWA 5DZGA 1G9CA 3VKLA 3NWKA 2A7AA 4BPZA 1LHOA 1DBNA 1LCLA 2ZGMA 4Y24A 3WV6A 3L2YA 3RS6A 1SFYA 3IMNA 4FPYA 4M3CE 1LOEA 3B3QE 2WJSA 4Q26A 2ZHKA 1W6QA 2ZGOA 2A6YA 2EXJA 3T1LA 1JHNA 1KITA 2ERFA 4Y1YA 2E7QA 5H9SA 1OQ1A 4BMBA 1JBCA 1CIWA 5EWSA 2VUAA 1OKQA 3AYEA 3N7KA 2VXRA 4FP3A 2EXKA 2NYYA 4YFWA 4YW1A 5T55A 4YW3A 1W6MB 1ZM1A 2GNMA 3CNAA 1MS8A 3N36A 3BODA 3RG0A 4YFZA 1G8WA 3MW2A 3FUQA 4YM3A 5E89A 5GZFA 2DURA 2NM1A 3N3HA 2GNBA 1LU2A 1V6IA 5GZEA 4UW6A 1KRIA 3OBRA 5T50A 5IUQA 4XHXA 2AREA 2V73A 3N7LA 2FMDA 3WG4A 4L8QA 2V5YA 1DQ1A 3HMYA 5L73A 3ZVXA 1UKGA 2ZA9A 4K1ZA 1AJKA 2PHFA 4GKXA 1B09A 2A6WA 1BQPA 1LOFA 2LTNA 3AP4A 3POWA 2E6VA 4DRVA 4FPEA 2UWAA 1CJPA 2VW1A 3V0BB 2WSVA 1MR5A 3GALA 3NV1A 4M3CF 3ZPYA 3ZXFA 1N47A 4Z8BA 1S0JA 3OY8B 2PHUA 3QCWA 4PCRA 4AVVA 4YM2A 3JU9A 4C1XA 2DVFA 2ZGKA 1HKDA 5JOZA 1GBGA 2P3JA 4CZSA 1S1AA 4P9XA 4XJUA 3WNXA 1SBEA 2YMZA 1N3QA 3W59A 1G9DA 1BYHA 3A0NA 2UWCA 4P9YA 2R49A 3AP6A 4XJWA 2WSUA 3B9CA 1WW5A 3NV3A 1S0BA 5KXEA 2WKKA 1DGLA 4ZKTB 1S0DA 1KJLA 1KDKA 2NMOA 2DU0A 3A0KA 3M1HA 3OJBA 3T2TA 1LGNA 4GALA 4YG6A 3ZXJA 1C1FA 1QNWA 3AX4A 2A3YA 4K20A 5IK5A 3RQ0A 1JUIA 3M3EA 1ENRA 4LBQA 3WDTA 1SBDA 4DQAA 4DS0A 3WDWA 2EAKA 1GICA 1C4RA 3AJZA 2JECA 3ILFA 4GA9A 4OZXA 1QF3A 2GDFA 4LBJA 2D3PA 4FQZA 1AJOA 3R4SA 1LHVA 4XHBA 1HDKA 1SLTA 1DFQA 4Q1RA 2C5DA 1NXD1 1AXZA 1WBFA 4GXLA 4AWDA 4FQ4A 1BKZA 2ZAAA 1KQRA 1Q8OA 1SCRA 4XJZA 1ENQA 2D44A 2DU1A 5DZEA 4RL7A 1LGBA 4Q27A 3MPPG 4WZFA 3WDXA 1VALA 3SISA 1QOOA 5E8AA 1ULGA 2A5ZA 5CB7A 3VKOA 1YIFA 4XTPA 3QLQA 2D6KA 4BQ1A 5FREA 4FPJA 5DUVA 4XE9A 5DG1A 3USUB 1WW6A 1FYUA 4K21A 1FV3A 5KXCA 3DGTA 3ZSJA 1LGCA 2NN8A 3FBYA 4YLZA 1D2SA 4UW3A 3C2UA 3SITA 1CPMA 1WCSA 3O0VA 1G9BA 5HCBA 4FPCA 4MYEA 2JKBA 3ZXEA 2YV8A 5AVAA 2DVAA 3B01A 1CN1A 4R9BA 5H9PA 4XDQA 1G86A 5CNAA 3AZWA 3WHTA 3HR9A 3N35A 1X50A 4CTEA 1QDOA 2R0HA 1F31A 2G4IA 3INAA 4BLIA 2ZGTA 1YRZA 3USUA 2CYFA 2ZGQA 2ZMNA 4P9WA 4AGVA 2OVUA 4M3CB 5GZDA 3AZVA 4GKYA 5T52A 2DVDA 4Q8LA 2CL2A 1WW4A 2ZBJA 2GNTA 2OUJA 3AK0A 1LHUA 3WOGA 5F5QA 1AVBA 2CWSA 1LU1A 2ZHNA 3IN9A 4GWNA 4HL0A 1FNYA 3WG2A 2ZABA 2ZHMA 4ITCA 1QOSA 5JVVA 1G9AA 4Y1XA 2JE9A 3PVOA 1APNA 1F9KA 4AGGA 4CRQA 3AP9A 1QNYA 3IPVB 2R0FA 4U2AA 2ZGPA 1F5FA 5GJ6A 4Q1PA 4Y1ZA 1DQ6A 1GZCA 3POYA 1LOCA 3WVJA 1WD3A 3PVNA 1QMJA 4SLIA 4R9DA 1QOTA 1S0FA 3FUOA 1GKBA 2ZZJA 3BIWE 1ULCA 1V6NA 5T5LA 4JRAA 2NZ9A 4ASMB 4YW4A 1I3HA 1UL9A 3M3OA 2B7YA 4YZ2A 1Z0HA 1LHWA 1NLSA 2D6LX 3HN1A 4XMAA 2P37A 3FLTA 1VLNA 4XIKA 4YZ1A 4LBQD 3W58A 4PBOA 3BOPA 1IS4A 1N1SA 1YXWA 2ZMLA 3ZXLA 4YG0A 1MVQA 4YG3A 2ZGNA 2DUOA 3AYDA 4D69A 4Y22B 3UJOA 3FLPA 5JOYA 3UL2A 3AJYA 4FPOB 3SH4A 2R16A 2DVGA 2A3XA 1UPSA 2AYHA 1V6LA 2SBAA 2VW0A 2A6XA 1V00A 1W6OA 3A4UA 3WLUA 1AX2A 1V6OA 3AYAA 5EYXA 3RRDA 4YZ5A 3SNMA 3WDYA 1UZZA 3AZZA 1PZ9A 2A75A 5DXDA 3GNEA 2BQPA 3NV2A 3O12A 3PVEA 1LJ7A 1MS3A 3WUDA 5JMCA 1KJRA 1DIWA 2A70A 2XG3A 4DRRA 1BXHA 1CVNA 4FPFA 2DV9A 2W08A 1WLCA 5F9TA 1O4ZA 2WT2A 3M3QA 5CBLA 2SLIA 1W6NB 4Y20B 1AF9A 1LESA 1Q8SA 2D6NA 3O0XA 4YM0A 1DZQA 2EF6A 3OY8A 3VUOA 1GNHA 3FLRA 1GZ9A 1UX6A 1S0EA 2D3RA 3V0BA 1MACA 3AZYA 2GN7A 2P2KA 2WT0A 1HLCA 1W0OA 4LBMA 4C1WA 4FP2A 2KM2A 1ULDA 4ISRA 1AZDA 4WVVA 1BJQA 2AGSA 2JD4A 4YGBA 5GALA 3VKMA 4FOQA 2YROA 3OBTA 1DQ0A 3WHUA 2WQZC 1WBLA 4TZDA 2ZACA 2W52A 5H9QA 1PZ7A 1CESA 4FOYA 1WLDA 1MVEA 4LBLA 5IK7A 1LOFC 1FV2A 1CONA 5DUXA 1MS1A 2PHTA 4TYSA 4BOWA 5IK8A 5IT6A 4XXAA 1IKPA 2D6MA 4XILA 1FX5A 1SACA 2NP0A 4YGDA 5GLWA 3V65A 4JC1A 5HCAA 1GLHA 1URXA 3ILRA 2E51A 2EALA 1DYKA 2A6VA 2Z42A 2ZGLA 4AVSA 2ZKNA 3T1MA 3Q9OA 4PBPA 5T54A 1SLBA 5EXOA 1JN2P 2A6ZA 1FATA 4RA0A 4XYXA 1DYPA 2JE7A 3N7MA 1LEDA 5DG2A 2R1DA 4AGRA 3V0AA 3IKWA 3KQRA 1I1EA 2DTWA 1W6MA 2CWMA 2JDZA 1JYIA 4R9CA 4XZPA 5IK4A 5T5PA 3ZYPA 1GSLA 2D3SA 1U0AA 1H30A 4PQ9A 4WV8A 1ONAA 4PF5A 5T5JA 3APBA 1MS4A 1LOGA 1Q56A 1A8DA 1N1YA 1Z78A 1ZA4A 2RHPA 4Y1UA 4HANA 5H9RA 2VH9A 3R05A 1C57A 4M01A 5KXBA 2A3WA 3OYWB 1MS5A 1N3OA 3JUUA 2GMMA 4FPHA 2TEPA 3B69A 2ZGUA 4XMIA 1W6QB 5EYYA 3VKNA 1ULFA 2WT1A 4IQPA 1W6PA 1VIWB 4R9AA 5GM0A 1DQ5A 2D6PA 2GALA 4DFSA 2ES3A 3ILNA 1MZ5A 1WD4A 1PZ8A 1AXYA 1SLLA 4P14A 3M3CA 4W65A 5SV8A 3WG1A 1GYKA 2P34A 3RMXA 1H9WA 5E88A 1OFSA 1N3PA 4Q8KA 1CQ9A 1R1ZA 3AP5A 2D43A 3ASIA 1FAYA 1WLWA 4K1YA 5GLTA 2W68A 2AH2A 1GV9A 3RSJA 3ZXKA 2W39A 5JOXA 2AENA 2P3IA 1O4YA 1N1VA 2ZMKA 3WG3A 2JJ6A 1A3KA 4FOVA 4XJAA 4XXPA 1IS5A 5FRAA 4UW4A 1JOJA 2WNEA 3WCRA 1YYNA 1JXNA 2Q5TA 4WVWA 4XJ8A 2CNAA 3NV4A 2EXHA 2E53A 4Y1VA 2OUHA 1HQWA 3U4XA 3ATGA 2YXSA 1W0PA 2UWBA 5GZCA 4LBNA 1SCSA 3O5SA 5JOWA 2NMNA 3ZYRA 1V6JA 4YGCA 2FHRA 1S0GA 1IS6A 1LENA 1LHNA 1Q8QA 1QGLA 1ENSA 1UAIA 3UK9A 4ATFA 4Q2FA 5JDBA 2D7FA 1YI7A 3AXEA 4H55A 2AUYA 1RINA 3V0AB 1AX1A 4NOTA 1UN1A 3POSA 5KXDA 1JW6A 3M2MA 1KDMA 1Q8PA 3AYCA 1LOAA 1GNZA 3UJQA 1V6MA 1WW7A 4YW2A 5GLZA 3IM0A 4BMEA 1QU0A 1RIRA 4XOGA 1IS3A 1N1TA 3N7JA 4UW5A 3WDUA 4BM8A 2ZHLA 1LTEA 2H0BA 3SLIA 1C1LA 2CY6A 3WZ1A 4DPNA 2PHXA 3VKFC 5JLVA 1G9FA 3D5OA 1UZYA 5DUUA 2PELA 3MW3A 2I2SA 1UMZA 2PHRA 1YO8A 4GWMA 2AR6A 3ZSLA 1LODA 2GN3A 3AXDA 3AZXA 3TB0A 4I30A 4XBQA 2LALA 1DQ2A 1FNZA 4M00A 5HCFA 1CR7A 1SLAA 1LEMA 2XB6C 3KM5A 5BYNA 3TAYA 1VAMA 4M3CA 2CTVA 4LBOA 4XBLA 3WDVA 4AYUA 3AFKA 1CPNA 1MS0A 1ULEA 5GLUA 1Q8VA 3D6EA 4FPKA 3I8TA 1LECA 1SLCA 4KBBA 1IOAA 4XBNA 3PMEA 2ARXA 5DZFA 2E7TA 3BTAA 1D0HA 1RITA 5CA6A 3OGGA 2GMEA 4XTMA 3AP7A 2GNDA 2ARBA 4LBKA 4YZ3A 3SH5A 2EIGA 4FPLA 1A78A 2DUQA 5CAZA 1W6NA 2PHWA 4Y20A 1LOBA 4YZ4A 4ATEA 1DQ4A 2UU8A 1HQLA 3B00A 1SLIA 4ISQA 3VV1A 1V6KA 2OW4A 3O0WA 2P3KA 1AX0A 3SH3A 1GZWA 1GANA 2DVBA 2ENRA 1VAVA 1JYCA 1W6PB 5T5OA 4YW5A 1MS9A 3ZSKA 2C9AA 2GMPA 3OYWA 3I4IA 3ENRA 2HYKA 2EXIA 2A71A 3OPZA 4BLJA 2VW2A 3MEPA 4AVTA 5GZGA 3LCPA 4F83A 1S0CA 1Y7BA 1H9PA 2VY0A 1TEIA 1QKQA 4XIOA 4Y22A
chains in the Genus database with same CATH superfamily
2JDAA 2R073 3ZR6A 1W9TA 3O1OA 2VZQA 1JZ8A 2ZGRA 4HVOA 4XJ9A 4BK5A 1OFNA 2PLV3 4EN9B 4Q0PA 4IGPA 2PQQA 4FCAA 5L7OB 2RS11 2WO1A 1QDCA 4W6WA 4NN0A 4BYYA 3CZJA 4XUTA 2XVKA 3ZSMA 2R063 3DUIA 4LKFA 4XUNA 1DLCA 5G04L 1TE1B 3FFZA 4Q4X3 2DUPA 1UWWA 3OUHA 3BUCA 3ZDSA 4CCEA 4FPGA 1AXKA 2F4PA 1XE7A 2R6QA 2FCUA 4XQDA 3WF2A 4BJ0A 1AR73 1IKQA 1S0IA 1VJ2A 2DTYA 2Y33A 3I3BA 1ZREA 3ELNA 1WUVA 3ZX7A 1GZWB 3PJQA 1MZ6A 3CDZB 4B8EA 4U36A 3LSDA 3AKRA 5C7GA 3VKLA 3KHBA 1DBNA 1LCLA 1XU1A 5EV7A 1XYPA 4Y24A 3ZIWA 1SFYA 1X82A 3B02A 1GWLA 3IMNA 4EQVA 2JEMA 2QQLA 1LOEA 2FMYA 2CHHA 3AC0A 5FLHA 1NX9A 5JWPA 2GP5A 2V09A 2ZGOA 1JZ2A 5FZ8A 3BIEA 1JHNA 2Y0OA 3H8RA 4Y1YA 2E7QA 5F3GA 3ABZA 1AYN2 2B9UA 5LRRA 4QHOA 1DU3D 4AHXA 4B3NA 3AYEA 3E6DA 4UAPA 4AI9A 4RHV1 4O9GA 1HB2A 3VBRA 5FO8B 4EROA 5BY5A 1NCQA 2NYYA 1NCRB 4CDWC 3KV6A 2B9VA 1ZM1A 3CNAA 3Q8EA 4YW3A 3RG0A 3BODA 3VBUB 3IDBB 3AMMA 5E89A 2DURA 4D7TA 4JX0A 1FPN2 4UFMA 5GZEA 3TN93 1MQTA 2JG8C 1L7QA 2RE9A 2C1FA 1QJU2 1W9FA 4XHXA 1QQP1 2IVIB 3P5BA 2FMDA 3UKNA 4COYA 5JCTA 4AVBA 5L73A 4OUEA 5F8PA 3SXWA 1RUJ1 1BQPA 1PVC2 1RUC1 1UU5A 5CG8A 3S30A 1XRUA 2VW1A 1E5RA 3V0BB 2WSVA 3GALA 3NV1A 5C9AB 3CJIB 1GMMA 5B4XA 1XXNA 4UFKA 4CP0A 4PCRA 3POEA 4RR3C 1H1MA 4J6GA 5C4WC 4YM2A 5KWRA 3CF6E 3E5UA 4WZCA 3JD72 1EYBA 3D0JA 2WIIB 5FZMA 3T2QA 4DY3A 5JOZA 1SG3A 4XJUA 2VOWA 4Q4Y1 1RUI3 2YMZA 5FY8A 4YYOA 2JIJA 5HI0A 1A6CA 3T08A 1NE6A 5BNNA 2W3JA 2LUWA 3AP6A 3U1XA 3B9CA 5IATA 1H6YA 1TME3 1UOGA 1XNBA 3FL7A 4KWJA 4QPIC 3NV3A 1NA1B 1S0BA 1WWYA 4R8HA 5KXEA 4KNCA 1DGLA 4CDWA 3CZUA 3ZO0B 4ZKTB 3M1HA 3A0KA 5LCWL 4YG6A 1O3RA 1HRV2 3LPFA 5IVCA 1I5PA 3AX4A 2ZEZA 1J3QA 4OHVA 3RQ0A 4XZUG 3PUAA 3ZYGA 2BOIA 1RMU1 4LQRA 1DGRN 3ROUA 3PUSA 3WDWA 1NUKA 1Y9MA 4CCCA 3SEEA 3BALA 4AOCA 4AEDA 4FQZA 3E97A 4CEWA 4XHBA 1HDKA 4PLOA 3JZVA 1EV13 1UQXA 3ALQA 1AXZA 1WBFA 1R081 2HWC2 4EN0A 1G6NA 4FQ4A 5LB6A 4EZ4A 3T0DA 2K0GA 4QX5A 3OEAA 5APAA 1SCRA 4JTNA 3LD8A 1ZRDA 5F7UA 4WM8A 4RL7A 1LGBA 2HWF1 3MUY1 1FMD2 4IDZA 2BP6A 3WDXA 2BWAA 1RUE3 5E8AA 3SCHA 1HX6A 5J09A 3QLQA 2D6KA 3QH7A 5FP9A 4HVRA 4N53A 1DGWX 4XE9A 3ZXAC 3KV4A 3JB4C 5KXCA 3DGTA 2NN8A 5A6YA 2MPFA 1BK1A 1D2SA 3LOIA 3C2UA 4QDRA 3SITA 1YEWA 1NXMA 2B39A 4MYEA 3CL1A 1HV0A 3ZXEA 2YV8A 2PAMA 5AVAA 1NCRA 4UFIA 1EV11 1GWKA 3B01A 1R1A2 5FR3A 1G86A 3PL0A 3AZWA 3WHTA 4DXRA 1UF2C 3HR9A 1W9YA 5FY0A 3NO8A 1RMU3 3EMRA 1F31A 1V9U1 3INAA 5FY4A 3S7EA 1YRZA 1O3TA 1K12A 5C9AC 2CYFA 2ZGQA 2ZMNA 3VBFA 4N53B 3GDBA 2OVUA 2FCTA 3TOJA 3AZVA 1SDDB 5JUVA 3VD4A 4JKMA 1C3HA 2GNTA 2OUJA 2YUEA 5FMOL 2ETEA 3O14A 4OI2A 5F5QA 1ODMA 1XOYA 1RUH2 3IBMA 3GBWA 2ZHNA 3HQXA 3NRUA 2W95A 4KWKA 1TZOA 1VB2A 4BZ4A 2HWE2 3POYA 4Y1XA 5IVJA 2JE9A 5IFPA 2OKXA 1LAJA 4UI9L 3KGZA 3DECA 4CRQA 5BNPC 3OUJA 2CGNA 3ACGA 2R0FA 1O7FA 1AL23 1OF4A 2EICA 5JMOA 1F5FA 5GJ6A 2VZSA 5EP9A 5FZCA 3UKVA 1QY4A 3LB9A 2BJSA 4IGQA 4X6RB 1QMJA 3FUOA 4JDMA 1CGPA 3LA3A 4JHTA 3GJBA 1V0AA 1V6NA 2FDIA 4J25A 4BQ2A 3JD73 1W90A 2WYFA 2IXHA 5GKAC 5I0SA 4HONA 2WZ8A 4IEYA 4XQWA 4M4RA 5BNOA 2P37A 3FLTA 4LO4B 4YZ1A 2W1UA 3T2OA 5T3NA 3BOPA 1IS4A 1H1AA 2ARAA 1YXWA 3KCXA 1YC61 5KHKA 4HSJA 5C4WB 2K2SA 4I3PA 4XFHA 4EYUA 2GC2A 3AJYA 1FPN1 3SH4A 1MPXA 1UPSA 3L9JT 3VHNA 2JXAA 3MGUA 4DEQA 3WP3A 4UFJA 4EN8B 2QNKA 1TMF3 4RHV3 5K0UC 1AX2A 3AYAA 1WZXA 4QPGC 3WDYA 1UZZA 3N9OA 5KC6A 1PZ9A 1CD3G 2YU2A 3CMGA 2WA4A 5A3TA 1X9PA 4P5YA 1YJLA 3PVEA 2OZJA 1MS3A 5FZEA 5F3EA 4OZOA 2VNOA 3WUDA 3K3NA 1AYN3 1D7PM 1E5IA 3U78A 2QBXA 4QXKA 5C5UA 2A70A 1DZRA 1BXHA 2VOTA 3O1PA 1S2BA 4HKWA 4TLGA 4S2HA 5CG9A 1ZRFA 5F9TA 3IIIA 4E8DA 2WT2A 3VBUA 3T4VA 4KG8A 2SLIA 1GQPA 4Y20B 4IV3B 2Z69A 1H2NA 2D6NA 1ASJ2 3B9IA 3O0XA 2WRAA 1OA4A 3H3ZA 5C71A 3PIJA 4LKDA 4S2GA 1FXZA 2BBVA 3FLRA 4LKEA 1GZ9A 4A7YA 3RJRA 2FDHA 1MACA 3AZYA 5IJRA 1AR72 1HLCA 1W0OA 5DABA 1GP5A 1NCQC 1ULDA 4MXWB 2VJXA 4GMP3 4PDWB 2AGSA 4IUGA 5GALA 2B8MA 1HB3A 5FZIA 1H6XA 1QJY3 1XYNA 3LDRA 2ZACA 4MO3M 3RPQA 3VBSC 4D3WA 2TBVA 1YQ8A 2XJTA 4N9HA 1BK0A 5IK7A 2WO7A 4QQHA 1FV2A 1MS1A 5FFOC 4TYSA 4Y33A 4MGZE 3B7MA 3NAPC 1FI2A 4GQ7A 3LA7A 1NT0A 1FMD1 1R1A3 1SACA 4CEWC 1W8OA 4YGDA 4J1XA 2X8KA 1VBA2 4JC1A 4A42A 4AVSA 2JD9A 5E16A 5IYYA 2YFUA 4QX3A 3T1MA 3JBG2 2J1AA 5FZ7A 2G9GA 1POV0 5FY7A 4BQ3A 2R042 1FATA 1RUG2 3BI3A 4CVUA 3D82A 2HWB2 4E8CA 1HV1A 5I0RA 1I5ZA 4S2FA 3WW3A 2JDZA 1W04A 1YJKA 3HIFA 5I8TA 4UFHA 1VRBA 4XZPA 3NAPA 1GSLA 1TNRA 1ZZ7A 3MLLA 4AL9A 1VBE1 3H9AA 2XKOA 1XPWA 1PMJX 2RM21 1YQ5A 1RHI3 3DL3A 2YDEA 4HANA 1VRH2 4XFAA 4B7EA 1VBC3 2JDUA 4LIVA 1C57A 2B4KA 4BQXA 2A3WA 5FZ4A 4IEUA 2WQ8A 3A21A 2OQ6A 2RJKA 4FPHA 3AMHA 5AC92 3J8F3 2DCJA 4IQPA 4LHNA 2YC0A 2E33A 3BPZA 4DFSA 5LWBA 1MZ5A 4DZGA 1SLLA 5D1IA 2ADDA 3MYXA 1XNKA 2HWD2 4XFFA 2XOMA 3K48A 2P34A 3VDAA 3ZKUA 2VCMA 1CZTA 5JZGB 2WFF1 4R52A 1N3PA 5HXVA 3ZFEA 5LBBA 3RI8A 3WP5A 5C8WA 1JOPA 2CAUA 4IE5A 4AI3A 2IWGB 1FOD1 2D43A 4K1YA 1EAH3 4KWUA 5JOXA 3WG3A 1O4YA 1N1VA 4O61A 5KBFA 1C8M2 5FJKA 1ZBE3 1JOJA 4N53C 2JG8A 1YYNA 2J1TA 5L9BA 3EB7A 3POFA 2EXHA 3HQUA 4MX3A 2OUHA 1JU3A 1ODNA 3I2DA 2UWBA 5GZCA 1QJY2 5JXGA 1D0GA 4LBNA 1H2MA 3HBKA 4LMFA 3ETPA 1C28A 1OC1A 3O5SA 4NRQA 2WNVB 4PLMA 4QKBA 4TN7A 5JOWA 1J58A 3MLKA 1S0GA 4BQWA 1UAIA 1W2OA 3U07A 2XJQA 3BGAA 5FZHA 1V9U2 4H55A 2AUYA 1RINA 2W5FA 2Q8DA 4QPYA 2VXJA 1VBC2 1VPHA 2R7EB 3MV01 1VRH3 2BW8A 2GC3A 3IDCB 1JZ7A 3VDDA 2CV6A 1WW7A 5GLZA 4DUVA 1QU0A 1RIRA 4PJYA 1MEC3 1RUF2 3WNOA 1E5SA 1N1TA 1C1LA 5CKNA 4Q4V2 3VKFC 2K46A 4FFHA 3TEXA 1I9RA 1RUD2 2VBDA 1AYM1 2AEZA 1YO8A 2E63A 3GZTB 2AR6A 4GULA 4ZY9A 3JBG3 2QQNA 1RJ8A 2WNUB 4LO5B 3CEWA 4XBQA 2LALA 2O1QA 1VBA3 1DQ2A 1NQJA 4MGSA 5BNOC 5J1XA 2C0ZA 2XB6C 4AEKA 2QCSB 5CYYA 4XBLA 5KR7A 3PMSA 4A4AA 1ULEA 1J83A 3U14A 4CE8A 1IOAA 1RHI1 3EHKA 4ZONA 3BTAA 1D0HA 2O8QA 5CA6A 1UNBA 2GMEA 3K3OA 4XTMA 2ARBA 1JODA 2XJVA 3RZGA 4CDXA 3CKHA 2JG9A 4G9SB 4NPMA 1A78A 4BIOA 5CZKA 2BUKA 4XFIA 4LHKA 3U75A 4BU2A 5JI9A 1WCQA 1UY2A 3N9NA 1LOBA 3WQ1A 4ATEA 4LXLA 4D0QA 4LOTA 1W9SA 4YVSB 3VV1A 4AW7A 2Q4SA 3LWCA 2P3KA 1OD3A 4LKSA 4B4RA 4FFGA 5EPAA 2ENRA 2DVBA 3F95A 3VGIA 4FXGB 3MICA 4YW5A 4QKFA 3ZSKA 2C9AA 4CPBD 1MZFA 4C8DA 1OVPA 3OYWA 3I4IA 1OVSA 5JIUA 5GZGA 3H3LA 1H9PA 2VY0A 5FZ3A 3WDTA 3NNFA 4MGYE 2VTXJ 2YZ4A 5A70A 2XKPA 4ZS3A 3POJA 1YWKA 2HYXA 1W6OB 2DYCA 4YGEA 1J1TA 2RS13 2Y60A 3D3AA 3FHAA 3RMYA 5FK8A 4WVMA 4PT6A 4QX7A 5FDBA 1STMA 3EJKA 4HLTA 3VD9A 3LOBA 4IEWA 1PMIA 2VAUA 1GWMA 5CVRA 2YY1A 2C9KA 1ZZ8A 3GZUC 1CAXA 2Y8KA 3SCGA 2VVDA 1AR91 1JI6A 1BZWA 1TVGA 1IG3A 5A6ZA 3J7NA 1WCKA 2WLQA 5C6CA 2X05A 2D6OX 2X5IC 5A3OA 2D93A 3P6BA 4X6QB 3TBDA 1O3SA 1X8EA 2EIBA 1O4TA 1S2EA 4CDWB 3D4KA 2XJSA 1TNFA 3NNJA 3SQOA 2ZEXA 3PUQA 3K46A 1G9CA 5DZGA 4ONUA 2WWSA 3ZN6B 4IL7A 4JGZC 4BHPA 1UU6A 1S2KA 5FYSA 1CAVB 3KSCA 3L2YA 3MIGA 1UY1A 4M3CE 4W50A 4D6SA 2OT7A 1PGL1 3HVDA 5FZLA 5CEHA 1W6QA 5HXMA 2A6YA 5A33B 3LF7A 1WMXA 3T1LA 1KITA 1OQ1A 2W0XA 3J26N 4XVHA 1W2TA 4DXSA 4BMBA 3U11A 4K6BA 2WUHA 5EWSA 1H0BA 5C9AA 2GH2A 2VUAA 1BMV2 1JZ5A 3O1VA 2QZ3A 1H8TC 2BGOA 2EXKA 3TEZA 1OT5A 3IAQA 2R043 2LM3A 1RUE2 4TSVA 4HXCA 4YFWA 3FE5A 5KC5A 1DP0A 1HW5A 4YFZA 3JBG1 1MS8A 4HN0A 5AFBA 2BV4A 2MEV1 5CKMA 4UW6A 1MQTB 4J1WA 4CU9A 2DCKA 5IUQA 5FK7A 3PU3A 3ES4A 4YRDA 5A3UA 1EUUA 1UCXA 3N4MA 2VMDA 3I2IA 4L8QA 2XPJA 1DQ1A 3HMYA 3ZVXA 2Q1ZB 1LRHA 2ZA9A 4K1ZA 2PHFA 4GKXA 2ZJCA 4KMQA 4PDWA 2A6WA 3PTRB 1LOFA 4JKLA 5DQ0A 3POWA 4GMP1 4YNIA 1O5LA 3SC7X 3QD6A 4JRLA 2PLV2 4LIUA 4LR4A 1B35B 4NJ4A 4P9GA 3ZPYA 3VHOA 3DYPA 4AHWA 1OQEA 4QB1A 4OQ9A 3RYKA 4OULA 4DY5A 1US3A 3JU9A 4AQ2A 1HKDA 3THPA 1UY0A 4IV3A 1S1AA 2WZR2 4QX0A 5FXXA 4IV1B 5F5AA 3AKTA 5FPAA 4OI1A 1OI6A 3ZFFA 2N7GA 1N3QA 3CBNA 4RGKA 5FUNA 2BNMA 3A0NA 1W2NA 4FTBA 4QB2A 1O91A 4XDPA 2WSUA 3LKJA 1PK6A 4JDOA 5C70A 1HXS1 2IZWA 3ZMNA 4MZUA 1POQA 4OUMA 1KJLA 2NMOA 1GP6A 2DU0A 4XABA 1CAUB 5DDJ3 4ZU4A 2FQPA 4D94A 4KBZA 1CWPA 2VNVA 3KV9A 3EYPA 1JUIA 3AMQA 2XBO1 4ZU5A 4QPIA 4DQAA 3MLJA 2QQIA 1AYM3 4NHKA 2FDJA 4L11A 4JGZB 3LFMA 1GICA 4LJHA 5CU1A 1C4RA 5FXZA 4CU6A 5A32A 3ILFA 4GA9A 3H8XA 3GBGA 1OPMA 1AJOA 2OA2A 4UWDA 3HWJA 1QJU3 2VQAA 2PA7A 2C5DA 4CEYA 2CDOA 3RZHA 4GXLA 1X33A 4NWVA 2W1WA 4XJZA 4QU1A 4JZRA 1PIV3 2D44A 4Q27A 1JYVA 4META 1YFUA 4RD7A 1UOBA 1O6UA 4DUWA 2PHLA 1ND2A 1PVC1 3KF3A 1DZTA 3KHCA 3HQRA 2PXJA 4K40A 3RWKX 4GD4A 2EVXA 1PGW2 1WW6A 4CP9B 1FYUA 2RMU1 3KQ4B 2Q8CA 2VC9A 1EPZA 3FBYA 3OBZA 2HWF3 1XJAA 4LEJA 3O0VA 4GH4C 4FPCA 3OD0A 1RXGA 2B46X 2WNUC 1UO9A 5ISLA 1SPPA 2DVAA 1EAH1 1CN1A 1GR3A 2XUEA 4R9BA 5H9PA 4XDQA 5CNAA 2RDRA 4AVAA 5IAXA 4CDQC 1X50A 1ZZCA 4HPKB 5FOJB 1M06G 4QM9A 5D8AA 2EAAA 2Z79A 4A45A 1PHMA 2WS91 2XMLA 4COWA 1OF3A 5D21A 4GAZA 4H7LA 3C8XA 3MFCA 2G9ZA 4FT8A 4XFBA 3ZFGA 2DVDA 1D4VB 1WW4A 2CL2A 1XNTA 2XL9A 2ZBJA 3K4ZA 3AK0A 3WOGA 1UXZA 1IHMA 1AVBA 5FJHA 2CWSA 4O7XA 4HL0A 2IXIA 3I3DA 2CU5A 1G9AA 4FSJA 1APNA 1F9KA 1PIV2 4CCLA 4HPKA 3AP9A 3VBOB 4BA6A 2KR2A 3POGA 3IPVB 3I2JA 4ES9A 5FXWA 5F32A 5FYYA 2GC1A 2L9LA 4DXZA 2P4EA 3OPWA 5DAPA 1PMHX 4ORFA 1ENXA 1F5JA 2W46A 2Y34A 1LOCA 3DKWA 5FZOB 4Z1VA 4R9DA 4W6XA 1XYOA 2HJIA 2RM23 2XL7A 5T5LA 3ZYIB 4CDQA 2W2IA 4JRAA 5C8CB 5K0UB 4NIHA 4Z2WA 5FPUA 1I3HA 4OI4A 5IAVA 4GJZA 4YZ2A 1LHWA 1NLSA 2CGOA 3HN1A 2DFBA 2BU9A 1GOHA 4EWEA 3BB6A 4I01A 4HZFA 4QXHA 2H0VA 3W58A 3T30A 5FMBA 4CXYA 3EXUA 1MVQA 4DB5A 4WM8B 1GZTA 2VBBA 4RFT0 3GCXA 5FZBA 1RB8G 1H1IA 2RS52 2HLEA 2YBPA 2Y64A 4NWWA 2IUWA 4NE9A 5EIYB 1FMD3 1R1A1 1D2QA 1QJU1 4RGGA 4DUXA 4CUAA 1XSQA 1XBFA 4WVMB 5HBAA 4K9SA 4Y5Z0 1D4M2 2VW0A 1UPIA 3GJAA 1V00A 1W6OA 2B45X 1AL0G 4E2SA 5LATA 3A4UA 1V6OA 3RRDA 2Q8EA 2FZ2A 4CEYC 2CAVA 5DN2A 4F3JA 2PAKA 4ZZ8A 2JWPA 1PGL2 2A75A 3VL8A 4JGYA 4QQ2A 3NNLA 4NAOA 2VZUA 1IQAA 2VZ1A 2YHJA 4Q29A 4XAEA 3NJVA 5BNPB 1BMV1 2Y6HA 4DRRA 1HRV3 4CXWA 4FPFA 4B29A 1QH6A 2DV9A 2JX9A 2X29A 2LRPA 2J1RA 4MHRA 3SKVA 3W20A 1WLCA 3KT7A 4A7ZA 4YVSA 3GXUA 4LK7A 3WQ7A 5LEJA 4LA3A 3RZLA 1W6NB 1GQHA 1SFNA 2DCZA 1LESA 4MLOA 3SHRA 3VBHC 2DDUA 2ET1A 1Q8SA 2VNGA 2W94A 2JG9B 1DZQA 3ORJA 1NA1A 2OZ6A 1YQ2A 3VUOA 4I0AA 5IFTA 2XHKA 1UX7A 5BUVA 1K5MB 3MFAA 1RVF2 3ZXDA 4AEJA 4CXXA 2JIGA 4LBMA 5AFEA 2PFWA 3KB5A 2DBIA 1VBA1 1RUC3 4YGBA 3VL9A 1L7LA 2YROA 3OBTA 1DQ0A 3GBFA 4URAA 1JYNA 4AI2A 2HEYF 1BLZA 4UT5A 3QH6A 1K5MC 4XPVA 5FZ1A 1NQDA 4GMP0 4MHUA 1CESA 3LEIA 4FOYA 1MVEA 3HN3A 1LOFC 1OPOA 4G4FA 3OGJA 3H7JA 5IT6A 1IKPA 1RXFA 4QHZA 2UY8A 1FX5A 4HK8A 3KZ4C 2NP0A 4IESA 1YQ6A 4MUVA 2D97A 4NRPA 2VQUA 1FPN3 5GLWA 3V65A 3VZKA 1GLHA 2FBEA 3OBAA 4CSWA 1DYKA 1VRH1 1IGOA 2CGPA 1HXS2 4PBPA 2W47A 3DEMA 1P8JA 4N8MA 1QEXA 1O59A 5IVYA 2RMU2 2UYBA 3N7MA 5DG2A 2R1DA 4V2WA 1LNSA 1HIXA 2DTWA 1W6MA 3BVCA 3FMGA 5JAXA 1H2LA 4N43B 3S5QA 2WAOA 1ND2B 2H6BA 2HBTA 5T5PA 3ZYPA 2WNVA 4Q0UA 1U0AA 1UOJA 1H30A 2D3SA 2Y0IA 4L92A 4QKNA 4WV8A 3OGRA 4PF5A 5FP7A 3APBA 3R0RA 1MS4A 2GAUA 1LOGA 1OHFA 1ZA4A 5I0TA 2Y6JA 3VHRA 3WQBA 5JI7A 3WX5A 4QU2A 1DGRA 5FZAA 4R4ZA 3FN9A 3MIDA 4M01A 5CFCA 3NNMA 1MS5A 1HN0A 4Z2AA 3CU7A 5EYYA 2YPJA 3BYWA 1Z7S2 1BEV3 1DQ5A 2D6PA 2GALA 2ZXQA 3KCYA 3K51A 3PLQA 5GM0A 2F17A 4JGZA 1WD4A 3EO6A 2UY9A 3AKQA 1VB4A 3NJYA 4P14A 4W65A 4L99A 3O1SA 4XW3A 5J37A 4OQ8A 2WZR1 3KT4A 1CAXB 2J1UA 4QWNA 1H9WA 4DOUA 5JZGA 3POBA 1OFSA 2WBKA 5FYVA 4XFCA 1CQ9A 1OLMA 2R061 2X5IA 3T2PA 1JYXA 4Y4YA 3SEPA 5HCHA 3ASIA 5GLTA 4PIZA 3RSJA 1GV9A 3ZXKA 2KA3A 5I91A 4P02B 2RS33 4GWJA 4XXPA 4C91A 3H7YA 3ACHA 2WNEA 3HD8B 4XJ8A 3WXPA 4H3WA 4PIXA 2YXSA 2GC0A 2VTFA 4LO6B 4Q4Y3 4Y4RA 1SCSA 2Q1FA 2MNGA 3AMNA 3AM2A 1V6JA 4YVWC 3ZYRA 4YWAA 1IS6A 3KT1A 1TMF2 3ES1A 5D8AC 3CHXA 4Q2FA 5BNOB 2J22A 3AXEA 1B35A 5LZ6A 1OLQA 4NOTA 4HT1T 1JW6A 3E5XA 1AR62 1KDMA 1Q8PA 2VOKA 4P9JA 5FY1A 1UIJA 2LS6A 4LK6A 5LBCA 1QJX2 2VMEA 5AC93 4MGQA 1DF0A 2QVSB 1NY71 1JOBA 1VBB1 3IAPA 5FYUA 2QQWA 3H42B 5FYBA 2C24A 4K7JA 5LK7B 1F35A 1XNAA 3RNSA 1PIV1 5A3PA 3I3MA 4DPNA 4NPRA 3D5OA 4JKKA 1PGW1 4KQ7A 4UOJA 4IERA 1OSGA 4V2VA 2ZEYA 5EQUA 2JG9C 3GZEA 3WF4A 2GN3A 3AZXA 5ABJA 3T4HB 1C8NA 4GH4B 3KMHA 1T2XA 5BYNA 4N43A 5C33A 5EJ3A 1KFXL 4LBOA 4LA2A 3WDVA 5F6LB 3C7OA 5E1RA 1MS0A 2ZZQA 3H50A 5GLUA 4FPKA 4HMZA 4KBBA 4OFGA 2J1SA 5DZFA 5TSWA 4XUPA 3IIAA 4LPLA 4HVQA 1RITA 2D40A 2VMGA 5FPLA 1CX1A 4YZ3A 2C26A 5FYCA 1GU3A 1WGPA 4Q0SA 3SH5A 3WINE 1CAWB 3O1UA 2JB8A 2VPVA 2XQRA 3O1TA 1K42A 1W6NA 1ASJ1 4IEZA 4JGYB 5F39A 1DQ4A 4LORA 3B00A 1SLIA 1V6KA 2WN3A 2OW4A 4IE0A 5DAWA 5FBZA 3VZNA 3SH3A 1GANA 1W05A 1VAVA 2EIDA 1JYCA 2JDHA 4L0PA 1W6PB 2ZAHA 4I09A 3IWZA 2XWJB 3LAGA 4BISA 4NVPA 2VNRA 2HYKA 2Y6LA 2EXIA 2A71A 1Y9GA 3OPZA 5BV6A 2VW2A 1K3IA 2ZTNA 4AVTA 4ZS2A 1Y7BA 1TEIA 3GHMA 4G3YC 1OOPB 4XIOA 4Y22A 3W5NA 4NIIA 3MIEA 5HV0A 5LA9A 1RUF1 4YPJA 4JCKA 3GF6A 4CPBA 5AVPA 4E9KA 1JZ3A 3Q8AA 4HK9A 1WMDA 2YC4A 3NW4A 4Q4V1 4QHBA 4Y5SA 2VZTA 1NZIA 4HOOA 3VB9A 4CEWB 4Q0QA 1RL3A 1UZVA 3IB3A 5DMYA 4AEDB 4CU7A 3I2HA 3WCSA 1RUJ2 2C6SA 2VMFA 3FHQA 2UURA 4JGYC 1IQDC 1DLLA 3MW4A 3WY6A 3CJIC 2ZGSA 3ZOIA 4LBQB 1LULA 1ZYBA 2BWCA 4N43C 2O0OA 2VULA 5LA0A 2EIEA 2DWRA 3AFGA 1QWRA 3FFQA 3H1MA 4YM1A 3V64A 4E4HA 4BQ4A 2EA7A 3LSEA 1VBD2 1POV1 5I8SA 3C7EA 3JCIA 3ZR5A 4FOWA 3I49A 1XNDA 1HXS3 3NWKA 1D4M1 2A7AA 5A7NA 4BPZA 3N9PA 4D8MA 1VBE2 2E32A 4GB33 3C7FA 3VZMA 2ZGMA 3DXUA 4FI9A 4PQQA 1H8TA 1JYWA 1OOPC 2XVLA 1CAWA 3MZHA 4GJYA 3B3QE 3NAPB 2WJSA 4QD2A 1COV1 3LEGA 3ZLIA 5FTTC 4N7UA 4PI0A 5C3OA 1L7RA 1ND3C 3LE0A 5H9SA 3MUZ1 3IDEA 1KS5A 3VBOA 3W21A 1HRV1 1J3RA 5LW9A 2ZEWA 4Q4W3 2HEWF 3I2KA 3N7KA 3HEIA 3P3NA 1PO11 5FPZA 2WZEA 4FP3A 1UD1A 5JPMB 1RUC2 1IPSA 3FWEA 2IFWA 2VTXA 2GNMA 2ZX3A 1FOD2 2G9FA 4NHXA 1G8WA 2RR13 3FUQA 2Y6GA 3MW2A 3B5LB 2XGXA 4YM3A 3BN6A 3U0ZA 1BVP1 3N3HA 2GNBA 1V6IA 4TLFA 3OBRA 5T50A 3FC0A 2MEV3 1WCUA 2QDRA 3N7LA 4JQRA 3TRSB 1O8PA 3WG4A 4B1LA 2QQPA 3THDA 1W8ZA 2V5YA 3IT8A 3QBQA 4CA9A 1AJKA 2IXLA 1B09A 2WN2A 1F4HA 4MV2A 5J3UA 1QXJA 3AP4A 3J7MA 4Q4W2 1PO13 2RDNA 4FPEA 5FZ0A 4MVTA 5FY5A 1AR81 4B4PA 1MR5A 1F15A 2BDRA 2V72A 2V5DA 3O7OA 4RYDA 5DPNA 1S0JA 3OY8B 3U4SA 3QCWA 4AVVA 2OPKA 3P3PA 2Q8OA 5J96B 4SBVA 3GCWA 4C1XA 5HV4A 1US2A 1W28A 1QJX1 2D5FA 1GBGA 4BIFA 2P3JA 4YW6A 3VD5A 4P9XA 3ZFGB 4LE3A 3UETA 4COUA 1RMU2 4I02A 1BBT2 3KWVA 1JS9A 2XJPA 3D0SA 4RS5A 5CKQA 5EHDA 5IWFA 4AEDC 1G9DA 2A1XA 4BCUA 2UWCA 4AE2A 3JB8A 3ZXGA 4BQYA 5LY1A 2W9XA 3MPBA 1WW5A 1IG0A 3WNMA 4OHZA 3EBRA 1VE0A 3OPTA 5C8CC 4XF0A 4ARYA 1AYM2 3S7IA 2WKKA 5FMDA 1S0DA 2ADEA 4N9IA 2WR9A 4HN1A 2RS53 4NR1A 4OUSA 3TNQA 3ZXJA 4DNYA 1C1FA 4EE2A 4LHLA 1WKYA 2Y6KA 2A3YA 4K20A 3HOBA 4K8RB 5A32B 4K8FA 3VD7A 3WQ0A 5IK5A 3T3YA 3H1WA 2VR4A 3R4DB 4D7YA 5D2AA 2VQTA 3PNAA 5A3NA 4NPLA 1ULOA 2XHNA 3AJZA 4IV1A 2JECA 2YGLA 4OZXA 3VLBB 4EJRA 2D3PA 2YYOA 1RUG3 3R4SA 2NPIA 1OKOA 1HRI2 3RZMA 1SLTA 1DFQA 4MH0E 4Q1RA 3WSOA 4QPGA 4AWDA 1BKZA 1FT9A 3VZJA 3IZOA 1KQRA 1Q8OA 1QQP2 2J42A 3KGLA 5C4WA 1U5IA 2DU1A 1W8HA 2E9QA 5DZEA 4MGKE 1EV12 3DYMA 3JQWA 3SISA 3W5MA 1QOOA 2V4VA 1VMFA 1ULGA 2YPDA 2DBNA 2A5ZA 5CB7A 5A3MA 1YIFA 3AKSA 2P3YA 4QQPA 4XF4A 4FPJA 5DUVA 4S2DA 5DG1A 4BQ5A 4CUBA 3CJIA 4YLZA 2IXKA 1ZZBA 1W8UA 4OLLA 1CPMA 4AFDA 5HCBA 2XVGA 1H2KA 2WO3A 5C3PA 3E5QA 3VDDC 2MHFA 4RS5C 4FBFA 3PUHA 4XCAA 4LTAA 2ILMA 1QIQA 1QQP3 5FMCA 4HETA 4W6YA 1K45A 3AVSA 2OYZA 4CTEA 3U37A 1QDOA 1RUI2 2G4IA 3ON7A 3CJXA 2WZPP 4BLIA 4COVA 2ZGTA 4L97A 3NJZA 2OXBA 3USUA 3IDAA 3WW4A 2E26A 4XQ4A 5G05L 4RS5B 4CUCA 1AR92 3ZIXA 4H7MA 4M3CB 4GKYA 5T52A 2XLFA 3BPSA 4Q8LA 4CCOA 5FQ0A 3PVBB 4MXWA 3VBRB 2XBO2 5FBJA 3VBFB 1WA4A 5JSOA 3IN9A 4AHZA 5L36A 2WFF3 2ZABA 2ZHMA 3AKPA 3WNKA 3NSTA 5EZWA 3PVOA 2XH6A 3ZN6A 4AGGA 4RGAA 1GQGA 4LE4A 2PAEA 4U2AA 3OOXA 4QDSA 1ZRRA 5C5TA 2ZGPA 4Q1PA 5K9YA 1QJX3 1GZCA 1REFA 2VD7A 3DPRB 1OUXA 1WD3A 1ZRIA 2G19A 3PVNA 2R32A 3WVJA 1QOTA 3TN92 4W8JA 1GKBA 2ZZJA 1CAVA 1ULCA 3BIWE 4M4PA 5BNQA 4AI1A 2NZ9A 4YW4A 1RUH1 2D98A 3CIHA 3M3OA 3M70A 3URFA 2B7YA 1ZBA3 4IEVA 3B93A 1Z0HA 2OS2A 4RQPA 1GOFA 2VVEA 3KV5A 3KF5A 2D6LX 4N90A 4AVCA 5CFCC 1KFUL 1X8MA 4XMAA 5JSPA 3K77A 5A7WA 4A6SA 2I45A 4IV1C 4NHLA 4E4SA 1S4CA 2Q1MA 4XIKA 1PO12 4WM7C 4LBQD 4PBOA 4IETA 1N1SA 2ZMLA 3ZXLA 4XC9A 4YG0A 5FYZA 3AYDA 1OOPA 2P6CA 4Y22B 5JSRA 5JOYA 2RV9A 1F4AA 3UL2A 4UXAA 1REEA 2DVGA 4E2QA 2WO2A 1IPKA 2BFUL 3Q8BA 4LITA 5K8SA 1XU2A 4P9IA 1FOD3 2A6XA 2R071 4OYUA 1RJ7A 2VMIA 3P1IA 1ULPA 5FKCA 1OMIA 3N9QA 3WF1A 3WW1A 4FTEA 1Q43A 3SNMA 2RR11 3PHMA 1REDA 4QQOA 3T09A 1QHDA 2UYAA 3AZZA 1B35C 2VZVA 1ZVFA 3GM8A 1AL22 2BQPA 4QPGB 3RI9A 4H2AA 1PVXA 1PNFA 3O12A 1LJ7A 3BCWA 3ETQA 3MF6A 2R041 4IEPA 4AG4A 4CDUC 2X09A 5FY9A 1W3VA 5JMCA 4MOAA 1KJRA 2BBAA 1H8VA 3ME2A 2F6BA 3J9SA 3ITQA 2F4LA 2W08A 2WABA 1O4ZA 1KEXA 3M3QA 1QH7A 5FZOA 5CFDC 1POV3 2K9ZA 1AF9A 2ZX2A 3PDQA 1J3PA 2ATFA 3KLSA 1IPJA 4YM0A 2AEYA 5ABJB 3MI8A 5A3WA 5FPXA 5BNNC 4GB31 2BNOA 5F5CA 4KWLA 2HBUA 3MIHA 1D4M3 1VBD3 1S0EA 2GP3A 4P5HA 5EJ1B 3V0BA 4GWIA 1VMHA 2P2KA 2WT0A 2XONA 1YFYA 4BWOA 2KM2A 2XXZA 3THCA 3ZYBA 3ZYHA 1AZDA 3KCCA 5L19A 4JDNA 1UXXX 1ZA7A 3LIHA 3VKMA 4RR3A 4FOQA 1NG0A 3WHUA 5DDJ2 1ST8A 5A80A 2WQZC 3DPRC 3ACIA 1COV2 1AR93 1GUIA 3G6JB 2WDBA 4Z07A 2BVBA 5H9QA 1PZ7A 4WM7A 4QDQA 2ID4A 5DAXA 1A34A 1ND3B 3DYOA 5L9RA 5JXHA 1ZZ6A 2PHTA 5IK8A 5FZDA 2JDMA 2QQKA 3AB0A 3JXSA 4WM7B 2IVJA 4XXAA 2A73B 4B1MA 2Y6FA 1UY3A 3V56A 1AUYA 4LT5A 1MEC1 4YSFA 1QJY1 1SMVA 1BBT1 2YGMA 1CIYA 3I7DA 4CDXB 2QQMA 2RM22 2E51A 3ILRA 2ZGLA 2Z42A 4RFRB 4AFMA 4ES8A 1OA3A 4MADA 3LGRA 1Y3TA 2YU1A 1SLBA 1O8SA 5T54A 4KU8A 1YNAA 2A6ZA 1ZX5A 4RA0A 4XYXA 4AGRA 3I54A 5JR2A 5F1RA 3V0AA 4CCNA 1I1EA 3GHNA 2CWMA 3L2HA 2XQXA 1JYIA 3LIGA 2FDFA 2D5HA 4ZPIA 4R9CA 1UZ0A 1O5UA 1C8M3 4P00B 5LY2A 5IK4A 4XCBA 1CJDA 3CQOA 3QACA 1ONAA 4PQ9A 2W91A 4QKDA 1RTVA 1EAH2 2QDNA 1N1YA 3VN4A 4CP1A 1ZBE1 5H9RA 5ACA2 3R05A 1X36A 5F6KA 3ZFFC 1AR82 4E4ZA 1ZBA2 1QJEA 2GMMA 4X8NA 2TEPA 3VKNA 2ZGUA 5FAXA 4QX8A 2VMCA 4URTA 5EJZB 2WT1A 4A6OA 4UF0B 1T6GC 2KXLA 3WNPA 2ZOEB 4IEXA 2WQ4A 1JYTA 1PZ8A 1AXYA 3IMMA 2FD8A 5FZFA 3MIFA 3ZFEB 4A44A 3K4AA 5FPVA 3WG1A 1GYKA 2O14A 4NROA 5CFDB 1OH4A 3J4UH 3DXTA 3LEKA 3MIBA 5FP3A 3H3UA 4CU8A 4AF9A 4Q8KA 1NE4A 4AI8A 1TMF1 2DCTA 3LEMA 2BYVE 3J8F1 3WW2A 5L7OA 3K4DA 1FAYA 1WLWA 2W68A 1X7NA 2W39A 3VBHA 4UFLA 1PK6B 1PO21 3RZJA 1VBC1 1A3KA 2JJ6A 3RYPA 5FRAA 4YVSC 4UW4A 3WCRA 4INDA 1NAEA 1BVVA 1YUDA 5IVEA 2CNAA 3NV4A 4Y1VA 2E53A 3U4XA 2BGPA 3DF0A 3DV8A 1OH3A 3I97A 2BERA 1AR63 4CUGA 4TXWA 1CZVA 4CCJA 2P17A 4FXKB 2FHRA 2QUOA 1LENA 3UK9A 1QGLA 4QGLA 3CLPA 2YB7A 5JDBA 2LW8A 4IEOA 1YI7A 3MBWA 4KU7A 4Q5OA 3HNYM 4ET7A 1UIKA 3D8CA 4FAHA 1JZ6A 4MGIE 1UN1A 1XB9A 4QXBA 5KXDA 4TTGA 3M2MA 2OPWA 3JD71 1W2UA 2HH9A 1V6MA 4HSLA 4YW2A 5FKBA 4BMEA 4AAXA 4Q4Y2 2J1EA 4EZHA 3DPRA 3N7JA 4UW5A 4YVWB 1LTEA 2H0BA 2AZ5A 3ECQA 4H14A 4P08A 2CY6A 2RS12 2V4AA 5A7PA 5CFCB 5JLVA 1G9FA 1UZYA 5DUUA 3HJRA 1C5HA 2WNOA 1UMZA 2PHRA 3HT1A 1WMEA 1JTZX 2OQ7A 4GWMA 4CCDA 3ZSLA 3ZMOA 5FZGA 2VUJA 3AXDA 2RR12 3TB0A 5F2SA 1UOFA 4QXCA 4M00A 3WNNA 1BEV1 2JENA 2BRTA 2QQOA 1CR7A 1SLAA 1LEMA 2HWD1 3OGSA 4CCMA 4FTSA 2VMHA 1VAMA 3TAYA 2CTVA 4AYUA 2IFRA 1W8WA 2H6CA 1Z7S3 2QE3A 2ZS6B 3AFKA 4IE6A 4RQPC 2WZR3 1Q8VA 3D6EA 3X29B 3I8TA 1LECA 1V9U3 5F5IA 3AVRA 1HQNA 3PMEA 2BFUS 1RUI1 2GNDA 3AP7A 4OHYA 4IE4A 3NMBA 3PIGA 2EIGA 1R091 1TQ5A 1UZWA 4FPLA 1C8M1 1OUSA 1PM4A 3OF1A 4EV0A 5EFUA 5CAZA 2RJLA 1TME1 2PHWA 3C7HA 4Y20A 3BTYA 4YZ4A 2PHDA 4AAPA 2B5HA 1HQLA 2HWF2 2UU8A 2VZ3A 2XJUA 4ISQA 5FZ9A 3ZKYA 1Q3EA 3O0WA 4GB32 1VBE3 4C0BA 1NLRA 4I0WB 5CIRA 5IVBA 5FP4A 2RMU3 5FZ6A 5L7OC 2ZX0A 4UF0A 5T5OA 3G7DA 5DAVA 2GMPA 4EWDA 3ZFGC 4RHV2 3I2FA 3WD5A 2ZPXA 3WT3A 4A41A 4AQTA 4ZZ5A 1OD5A 1RUE1 2JKXA 5JZGC 1F2NA 4DO0A 1S0CA 1YIPA 3UV9A 5DAQA 1RUD3 3VBUC 4PIYA 3TN91 3S5AA 4NO4A 5GLVA 1NY72 4PI2A 1RUJ3 3RDIA 1R083 4Q4V3 3H0OA 3VBHB 4GZ9A 1YFXA 2XUMA 3R4UA 1EPWA 4QX1A 3ZYJB 4Y26A 2ARCA 3WNLA 2QFEA 4NIAA 4CDXC 3WUCA 4JVAA 3S57A 3M8LA 1MEC2 1RUF3 3OCPA 1SBFA 3UGGA 2ZX4A 1SZBA 2R1BA 4QT6A 1WA6X 1XQNA 1G7YA 2JDKA 1DHKB 4NMIA 3DCQA 4ASKA 4ASLA 2BPA2 2E7AA 3EQEA 2XBO3 4XUOA 5F3CA 3RZKA 4QGMA 2Y38A 4XURA 2J7MA 4ZU7A 3KVBA 3WEZA 4LULA 3I3EA 5JXJA 4D7SA 5LK5A 4IEQA 2HWE1 4ZXKA 2VU9A 4FVVA 4LLOA 3IPVA 3VD3A 5DUWA 3TEYA 1XSRA 1LHOA 2IXJA 4O9EA 3K2OA 2VE1A 3WV6A 1UU4A 3PU8A 3RS6A 4FPYA 4PF1A 2WWJA 4A3ZA 3I59A 4WBBA 3JQXA 4IW3A 4Q26A 1UMHA 4IE7A 4BH9A 2WAAA 2ZHKA 4EN7B 1AL21 2WC2A 4KH9A 4BXFA 2EXJA 4XFGA 3SCFA 2ERFA 2VQ0A 3MO4A 4JAAA 2NLRA 3WF3A 4QQLA 1JMUB 4XEZA 1W0NA 4JHZA 1QJFA 5FLJA 1K5MA 2VOVA 1JBCA 1CIWA 3NL1A 4RSUA 1SDWA 1W8FA 2IXCA 4FFFA 1SQ4A 5FUIA 3BU0A 4NIDA 1OKQA 3DN7A 3USSA 4UBHA 1ZZ9A 2VL4A 3THTA 2VXRA 4XETA 4ZHNA 1IZ3A 1SPPB 4YW1A 4OMCA 5T55A 1OXCA 4MGTA 1W6MB 3N36A 4LO7A 1SFPA 2PLV1 5L9VA 1J59A 2QKDA 5GZFA 1HJFA 2NM1A 1LU2A 1E5HA 3HT2A 2HWC1 3OUIA 1KRIA 2W1SA 5BNPA 2Z4FA 4CP9A 2O8OA 1J1LA 1U5YA 2AREA 2V73A 2WYSA 3OG2A 4L2NA 4IV3C 5CADA 5JXIA 2C4XA 1JH5A 1TG7A 1UKGA 4BK4A 5KHJA 3HBZA 2LTNA 2E6VA 4DRVA 4B7KA 1JHJA 2UWAA 1CJPA 4HKLA 3RZZA 3ZSEA 5FO9B 4F8AA 1ZBA1 3I3QA 4XACA 3VBSA 1E57A 1NKGA 4M3CF 3ZXFA 4DIQA 1N47A 4E2GA 1ZRCA 3TNPB 4GIQA 4Z8BA 1RGSA 2PHUA 2VZPA 1F8VA 1PX3A 3O1MA 1DDLA 5ANQA 4F7ZA 4R4XA 2DVFA 1I6XA 2ZGKA 3RJ2X 1R093 3OEBA 4HFSA 4CZSA 5A1AA 2DCYA 3WNXA 1SBEA 5ANNA 1CX4A 2P1BA 3W59A 1H8TB 1BYHA 4I0BA 4CP2A 4P9YA 5FYMA 2GU9A 1K5JA 2R49A 4LO8A 4XJWA 5A6XA 3S0MA 2FZ1A 2QQJA 1EP0A 1HRI1 1AHSA 2VUDA 1YI9A 4XF3A 1PO22 3POIA 4BB3A 2VOXA 1KDKA 3OJBA 3T2TA 1LGNA 4GALA 4KGQA 1QNWA 4LLFA 4QAWA 2VVFA 2VZOA 3M3EA 1HB1A 1ENRA 4LBQA 4BE3A 1SBDA 4CDQB 4DS0A 5C8CA 3O1RA 1RUNA 4PHZA 3VBOC 2EAKA 4BXSV 1QF3A 2BEOA 2GDFA 2P6HA 4LBJA 2I74A 3AMPA 1LHVA 2VUCA 3TYJA 4O65A 1HRI3 5LA1A 1YCIA 5J48A 2PTMA 2MEV2 2VECA 2XR4A 4AZZA 2Q30A 1NXD1 2WS93 1X9TA 2ZAAA 2W1QA 3BKZA 4COZA 2XLGA 4E27A 1ENQA 3PJYA 3MPPG 4WZFA 1VP6A 1VALA 2BOJA 4XF1A 1EY2A 1RC6A 2BTVC 2XLAA 4LUKA 3VKOA 4XTPA 3FZ3A 4BQ1A 5FREA 1H4HA 5FUPA 2JDYA 4I2OA 1OBNA 3LDBA 3RYRA 3S6PA 3USUB 2QZ2A 5LA2A 5FCCA 4K21A 1FV3A 3ZSJA 5C3RA 1CZSA 1LGCA 2OX0A 5BXXA 4OMDA 1RUH3 2WL1A 1PK6C 1R082 4NUBA 4UW3A 1WCSA 1G9BA 5FMOS 3GYDA 1KS4A 5JPNB 1BBT3 2JKBA 1NA1C 4JV4A 1PO23 1CAUA 1NCQB 5A7WB 1DGWA 3OGVA 3NNGA 3OTFA 3N35A 2JDNA 3DKQA 5IVVA 1DG6A 4HKOA 2ZX1A 3F2ZA 4LNVA 4FFIA 2R0HA 4QX2A 3TEWA 5BNNB 4MG2A 2DF7A 1R092 4D6QA 1PX4A 3NVCA 4P9WA 3A22A 3ZN5A 4AGVA 2W87A 5GZDA 3NKGA 1QJZA 3K75B 5FQ0B 3RWNA 1U5ZA 5ACA1 4GH4A 4XAAA 1LHUA 2RS32 2NQYA 3WP4A 4FAGA 3RGBA 4Y5TA 3ST7A 2WFF2 1LU1A 4GWNA 3TWIA 3WG2A 2WNVC 1FNYA 5HCAA 4ITCA 1PM7A 1QOSA 1UMIA 1VBD1 5JVVA 4AFCA 3WR0A 4NIGA 3E6CC 1QNYA 2BGCA 1MQTC 4A7KA 4FO9A 3VDBA 3UGHA 5FXVA 1ND2C 1NOVA 3ZFEC 2WS92 3C7GA 3NKTA 4KGGA 4Y1ZA 3VBFC 1DQ6A 2P5BA 5B2GB 3E1F1 4SLIA 4EN6B 3BTZA 1S0FA 5FYIA 3T0BA 1LB2A 1BEV2 1A8MA 5E6HA 1Q5OA 4QPIB 4ASMB 2AC1A 2JE8A 1XC6A 2AACA 1UL9A 3OSDA 4Y3OA 5FWEA 3VZLA 2HWE3 1NCRC 1RVF1 2QQVA 1AR71 4DEVA 1NYWA 3MF9A 5LASA 3CO2A 1VLNA 4MXVA 5I0UA 5ABJC 2RG4A 2BZDA 3AL6A 4CCKA 4YG3A 4Q4X1 2ZGNA 2CDPA 3WF0A 2DUOA 4D69A 3UJOA 3ZFFB 3FLPA 5KHHA 3SKJE 2RDSA 4XDOA 4FPOB 2RJ2A 2R16A 5IHRA 2A3XA 1ZNPA 2VGDA 2AYHA 1HN1A 1V6LA 3HPNA 5A33A 4EWAA 4NHYA 4UBGA 5A7OA 2SBAA 1XE8A 4DINB 3WP6A 1GP4A 1PNGA 1RUD1 2X5IB 4OHXA 5SV5A 3WLUA 5EYXA 4NHMA 4YZ5A 1GFF2 1LKNA 3UESA 5KHIA 4Q4W1 1DCSA 2VM9A 3M4FA 5DXDA 3GNEA 4L9BA 5CFDA 4CEYB 2PN5A 2XDVA 3NV2A 1W99A 2QTWB 3UKTA 5HPOA 4QPWA 4Z82A 1UKRA 2RVAA 4AEMA 2KD7A 2RS51 2HWB1 3MHZA 1U12A 3BU7A 2PYTA 1VMJA 1DIWA 2XG3A 1W9WA 1RHI2 2ORZA 4HBNA 1LR5A 4D6RA 4AFAA 1CVNA 1YLLA 3J7LA 2E31A 3BOWA 5ACA3 5JR7B 3B94A 4OHWA 1W2AX 4I3GA 2BVVA 2X10A 5CBLA 4CDUB 2CSGA 1VAKA 2QJVA 1Y9QA 4LHSA 1WCDJ 2YBSA 2WNUA 4QB6A 4LUMA 1J84A 2EF6A 3OY8A 1GNHA 2FDGA 2TUNA 1UX6A 2D3RA 3VBSB 4C90A 3LDKA 2GN7A 4OVEA 4C1WA 1AR83 4FP2A 5K4LA 4ISRA 5J98B 4WVVA 1BJQA 2JD4A 3ACLA 3RVHA 1RUOA 5A1LA 1WBLA 2PMWB 4TZDA 4K3UA 2W52A 1W8TA 2W92A 4NRMA 4WVZA 1PGSA 1UYPA 1Y43B 4WM8C 3H8UA 4LBLA 1WLDA 5ERLA 1ALYA 1C5IA 1ND3A 1CONA 1Y4WA 5DUXA 1W8NA 4BOWA 4MSVA 4HG6B 1M4WA 2D6MA 3OD4A 4XILA 3LQCA 2JDPA 3ZPOA 2YG0A 3VHPA 1JU4A 2X53S 5J7MA 3UNPA 2PQSA 1YQCA 4V1PA 1URXA 2WA3A 5LEKA 2EALA 2A6VA 3FJSA 4QMAA 4AHYA 2ZKNA 5A7QA 5LRSA 1QXPA 3KVAA 3Q9OA 1RYYA 5B4NA 5A3LA 1UYZA 5EXOA 1JN2P 2JG8B 2YFZA 3HNBM 3FHIB 4X8PA 1BHGA 1DYPA 2JE7A 5FO7B 1LEDA 4YW7A 4A2UA 1W39A 3IKWA 3KQRA 1ASJ3 4AI0A 1PVC3 3VDCA 1MZEA 2VBPA 3QOPA 4C0HA 1S55A 3I59B 1COV3 1OURA 3FX3A 3T0AA 1VBB2 1NZCA 5T5JA 2JICA 2ORXA 2VCAA 1Z78A 1Q56A 2VCCA 1A8DA 4Y1UA 2RHPA 2Y26A 2J1VA 1BCXA 1UW8A 1W06A 2R062 2VH9A 2OIIA 3LFIA 5FLIA 4ARXA 3H8OA 3I2GA 5KXBA 1YFWA 3ZDVA 5I93A 1OA2A 3OYWB 1N3OA 3JUUA 4XMIA 2GZWA 3B69A 1RUG1 3UGFA 4KL1A 1W6QB 2VO5A 2WFPA 1ULFA 2XJRA 1AYN1 1VIWB 1W6PA 4R9AA 4P9LA 5C3QA 2ES3A 3ILNA 3RFRA 5SV8A 3M7AA 1EUTA 3AL5A 3M3CA 3ACFA 4TWTA 1OLME 3RMXA 4AQ6A 5IVFA 2YC2A 5E88A 4ZXEA 1QXRA 3LZZA 5F2WA 4AFBA 3C3VA 5IW0A 5FP8A 4AQSA 5DDJ1 1R1ZA 3AP5A 4M0HA 4M0NA 3PUIA 2AH2A 3U10A 1VBB3 2AENA 2B42B 2P3IA 2ZMKA 1KGYA 2RDQA 5I0DA 4XJAA 2HKXA 4FOVA 5AC91 1IS5A 1XNCA 1JXNA 1L3JA 2Q5TA 4WVWA 2VCBA 4DMIA 1UY4A 1HQWA 3ZYFA 3ATGA 2IC1A 1W0PA 3GZAA 4JQTA 2VZRA 5FWJA 5FPBA 4E4DX 4XUQA 1R64A 1V70A 2NMNA 4YGCA 5FIXA 2GH8A 3A23A 1Q8QA 1LHNA 3M3IA 3VBRC 1ENSA 4ATFA 2Q0AA 2ZCWA 2D7FA 2G1MA 4QM8A 1JUHA 2Z5WA 1XE0A 3OB8A 4IGOA 5K7PA 1RVF3 3V0AB 3ZM8A 1AX1A 1UYYA 3POSA 4W4ZA 4RQPB 1HB4A 1GOGA 2WINB 2FDKA 5K0UA 3AYCA 4Q4X2 1LOAA 3H1YA 3KD4A 1GNZA 3UJQA 1JZ4A 4KG0A 5A1FA 4B4QA 3IM0A 2RS31 1NLQA 4XOGA 3BTXA 5F37A 4IXLA 4KI5M 1IS3A 1W03A 2ET7A 4OCTA 4QGNA 5BPXA 3UYJA 4AXOA 3GGLA 3PURA 3HNMA 3WDUA 4AK3A 5FOBB 4A3XA 4BM8A 4LOSA 1VR3A 2ZHLA 1ZBE2 4DXTA 3SLIA 1ACCA 3R6SA 1H4GA 2TNFA 3KS7A 2PHXA 3WZ1A 3LPGA 2PELA 3MW3A 2I2SA 2R072 3PTYA 3J7HA 5A7SA 1LODA 1Z7S1 1SHWB 5FYTA 1TME2 1YHFA 4I30A 1O3QA 3NQHA 2HWD3 4RR3B 5A6QA 1FNZA 5J36A 5HCFA 1HJGA 3KM5A 5KHGA 2YBKA 4NAMA 4Z92B 4M3CA 2Z2SB 3MV11 2BNNA 4RN5A 3W9AA 5LBEA 1CPNA 3MDPA 4YARA 4OI0A 1UYXA 2VG9A 1SLCA 4XBNA 3UT0A 2ARXA 3J8F2 2QQUA 2E7TA 3Q8CA 5D8AB 3N9MA 2WWUA 4YVWA 5FV3A 3OGGA 5FZKA 5LBFA 5CISA 4LBKA 2HEVF 4N7IA 4XF9A 5F3IA 5C3SA 5M0TA 2WLPA 2LROA 4AR2A 5I8YA 1OQDA 3FBMA 3ZN4A 2DUQA 1W3XA 4UYBA 4CDUA 3N9LA 1DYOA 1WLTA 3LA2A 5JIAA 1T6BX 4PDWC 3VZOA 2R30A 1AX0A 1U5XA 2XWBB 3SMHA 1KXGA 4PLNA 2I07B 3E6BA 1GZWA 1WMFA 2ZKLA 2DFCA 3I2OA 1KD7A 2JB4A 2FCVA 1MS9A 2HWB3 3NJXA 4BDVB 3A7QA 4JTOA 3ENRA 4Q0VA 4BLJA 2GSYA 1GNYA 3MEPA 1OLRA 1AR61 5FYHA 3Q8FA 3HAGA 3LCPA 3VDDB 4CYDA 4F83A 1QKQA 1SEFA 2HWC3
chains in the Genus database with same CATH topology
2R073 2ZGRA 4HVOA 4XJ9A 4EN9B 1OFNA 2PLV3 4Q0PA 2PQQA 4FCAA 5L7OB 2RS11 1QDCA 4W6WA 4NN0A 4BYYA 2XVKA 3ZSMA 2R063 3DUIA 1TE1B 3FFZA 4Q4X3 2DUPA 3ZDSA 4FPGA 1AXKA 2F4PA 1XE7A 2R6QA 4XQDA 1AR73 1IKQA 1S0IA 1VJ2A 2DTYA 1ZREA 3ELNA 1WUVA 3ZX7A 1GZWB 3PJQA 1MZ6A 4B8EA 4U36A 3LSDA 3AKRA 3VKLA 1DBNA 1LCLA 1XU1A 5EV7A 1XYPA 4Y24A 3ZIWA 1SFYA 1X82A 3B02A 3IMNA 2JEMA 1LOEA 2FMYA 5FLHA 5JWPA 2V09A 2ZGOA 1JHNA 2Y0OA 4Y1YA 2E7QA 1AYN2 2B9UA 5LRRA 1DU3D 4AHXA 4B3NA 3AYEA 3E6DA 4RHV1 4O9GA 3VBRA 5FO8B 4EROA 5BY5A 1NCQA 2NYYA 1NCRB 4CDWC 4YW3A 1ZM1A 3CNAA 3RG0A 3BODA 3VBUB 3IDBB 3AMMA 5E89A 2DURA 4D7TA 1FPN2 5GZEA 3TN93 1MQTA 2JG8C 2RE9A 2C1FA 1QJU2 4XHXA 1QQP1 2FMDA 3UKNA 4COYA 5JCTA 4AVBA 5L73A 3SXWA 1RUJ1 1BQPA 1PVC2 1RUC1 1UU5A 5CG8A 3S30A 1XRUA 2VW1A 3V0BB 2WSVA 3GALA 3NV1A 5C9AB 3CJIB 1XXNA 5C4WC 4CP0A 4PCRA 4RR3C 1H1MA 4J6GA 4YM2A 5KWRA 3CF6E 3E5UA 4WZCA 3JD72 1EYBA 3D0JA 2WIIB 4DY3A 5JOZA 4XJUA 2VOWA 4Q4Y1 1RUI3 2YMZA 4YYOA 5HI0A 1A6CA 1NE6A 5BNNA 3AP6A 2LUWA 4FSJA 3B9CA 4KWJA 1TME3 1XNBA 4QPIC 3NV3A 1NA1B 1S0BA 4R8HA 5KXEA 4KNCA 1DGLA 4CDWA 3ZO0B 4ZKTB 3M1HA 3A0KA 4YG6A 1O3RA 1HRV2 3AX4A 4OHVA 1J3QA 3RQ0A 3ZYGA 1RMU1 3ROUA 1DGRN 3WDWA 3BALA 4AEDA 4FQZA 3E97A 4CEWA 4XHBA 1HDKA 4PLOA 3JZVA 1EV13 3ALQA 1AXZA 1WBFA 1R081 2HWC2 4EN0A 1G6NA 4FQ4A 2K0GA 4QX5A 1SCRA 4JTNA 1ZRDA 4WM8A 4RL7A 1LGBA 2HWF1 1FMD2 3WDXA 2BWAA 1RUE3 5E8AA 3SCHA 1HX6A 5J09A 3QLQA 2D6KA 3QH7A 4HVRA 4N53A 1DGWX 4XE9A 3ZXAC 3JB4C 5KXCA 3DGTA 2NN8A 2MPFA 1BK1A 1D2SA 3LOIA 3C2UA 3SITA 1NXMA 2B39A 4MYEA 3CL1A 1HV0A 3ZXEA 2YV8A 2PAMA 5AVAA 1NCRA 1EV11 3B01A 1R1A2 1G86A 3AZWA 3WHTA 1UF2C 3HR9A 3NO8A 1RMU3 1F31A 1V9U1 3INAA 3S7EA 1YRZA 1O3TA 5C9AC 2CYFA 2ZGQA 2ZMNA 3VBFA 4N53B 2OVUA 3TOJA 3AZVA 1C3HA 2GNTA 2OUJA 2YUEA 5FMOL 2ETEA 3O14A 4OI2A 5F5QA 1RUH2 3IBMA 3GBWA 2ZHNA 3HQXA 4KWKA 4BZ4A 1VB2A 2HWE2 4Y1XA 2JE9A 4CRQA 3KGZA 5BNPC 2CGNA 2R0FA 1O7FA 1AL23 1F5FA 5GJ6A 3UKVA 1QY4A 3LB9A 4X6RB 1QMJA 3FUOA 4JDMA 1CGPA 3LA3A 1V6NA 3JD73 2IXHA 5GKAC 5I0SA 4IEYA 4XQWA 5BNOA 2P37A 3FLTA 4LO4B 4YZ1A 5T3NA 3BOPA 1IS4A 1H1AA 1YXWA 3KCXA 5KHKA 4HSJA 5C4WB 2K2SA 4I3PA 4XFHA 2GC2A 3AJYA 1FPN1 3SH4A 3VHNA 1UPSA 3L9JT 2JXAA 3MGUA 3WP3A 4EN8B 2QNKA 1TMF3 4RHV3 5K0UC 1AX2A 3AYAA 4QPGC 3WDYA 1UZZA 5KC6A 1PZ9A 1CD3G 2WA4A 1YJLA 3PVEA 2OZJA 1MS3A 2VNOA 3WUDA 1AYN3 4QXKA 2A70A 1DZRA 1BXHA 1S2BA 4HKWA 4S2HA 5CG9A 1ZRFA 5F9TA 2WT2A 3VBUA 4KG8A 2SLIA 4Y20B 4IV3B 2Z69A 1H2NA 2D6NA 1ASJ2 3B9IA 3O0XA 1OA4A 3H3ZA 4S2GA 1FXZA 2BBVA 3FLRA 1GZ9A 4A7YA 3RJRA 1MACA 3AZYA 1AR72 1HLCA 1W0OA 1NCQC 1ULDA 4MXWB 4GMP3 4PDWB 2AGSA 5GALA 2B8MA 1QJY3 1XYNA 2ZACA 3RPQA 3VBSC 4D3WA 2TBVA 2XJTA 4N9HA 5IK7A 4QQHA 1FV2A 1MS1A 5FFOC 4TYSA 4MGZE 3B7MA 3NAPC 1FI2A 4GQ7A 3LA7A 1FMD1 1R1A3 1SACA 4CEWC 4YGDA 4J1XA 2X8KA 1VBA2 4JC1A 4AVSA 5E16A 3T1MA 3JBG2 2G9GA 1POV0 2R042 1FATA 1RUG2 3D82A 2HWB2 1HV1A 5I0RA 1I5ZA 4S2FA 3WW3A 2JDZA 1YJKA 3HIFA 5I8TA 4XZPA 3NAPA 1GSLA 1TNRA 1ZZ7A 3MLLA 1VBE1 3H9AA 2XKOA 2RM21 4HANA 1RHI3 3DL3A 2YDEA 4XFAA 1VRH2 4B7EA 1VBC3 1C57A 2A3WA 4IEUA 2RJKA 4FPHA 3AMHA 5AC92 3J8F3 2DCJA 4IQPA 4LHNA 2YC0A 3BPZA 4DFSA 1MZ5A 4DZGA 1SLLA 5D1IA 3MYXA 1XNKA 2HWD2 4XFFA 3K48A 2P34A 5JZGB 2WFF1 4R52A 1N3PA 5HXVA 3ZFEA 3WP5A 3RI8A 5C8WA 2CAUA 4AI3A 2IWGB 1FOD1 2D43A 4K1YA 1EAH3 5JOXA 3WG3A 1O4YA 1N1VA 5KBFA 1C8M2 1ZBE3 1JOJA 4N53C 2JG8A 1YYNA 2EXHA 4MX3A 2OUHA 3I2DA 2UWBA 5GZCA 1QJY2 1D0GA 4LBNA 1H2MA 4PLMA 3O5SA 1C28A 5JOWA 2WNVB 1J58A 3MLKA 1S0GA 1UAIA 3U07A 2XJQA 1V9U2 4H55A 2AUYA 1RINA 4QPYA 1VBC2 1VRH3 2BW8A 2GC3A 3IDCB 3VDDA 2CV6A 1WW7A 5GLZA 1QU0A 1RIRA 4PJYA 1MEC3 1RUF2 1N1TA 1C1LA 4Q4V2 3VKFC 1I9RA 1RUD2 1AYM1 2E63A 1YO8A 3GZTB 4GULA 2AR6A 3JBG3 1RJ8A 2WNUB 4LO5B 3CEWA 4XBQA 2LALA 2O1QA 1VBA3 1DQ2A 1NQJA 5BNOC 2C0ZA 2XB6C 4AEKA 2QCSB 4XBLA 3PMSA 1ULEA 1IOAA 1RHI1 3EHKA 3BTAA 1D0HA 2O8QA 5CA6A 2GMEA 4XTMA 2ARBA 2XJVA 4CDXA 2JG9A 4G9SB 1A78A 4BIOA 2BUKA 4XFIA 4LHKA 5JI9A 3WQ1A 1LOBA 4ATEA 4YVSB 3VV1A 4AW7A 2Q4SA 3LWCA 2P3KA 4B4RA 2DVBA 2ENRA 3VGIA 4FXGB 3MICA 4YW5A 3ZSKA 2C9AA 1MZFA 3OYWA 3I4IA 5JIUA 5GZGA 1H9PA 2VY0A 3WDTA 4MGYE 2YZ4A 2XKPA 1YWKA 1W6OB 2DYCA 4YGEA 1J1TA 2RS13 3RMYA 4WVMA 5FDBA 3EJKA 4HLTA 3LOBA 4IEWA 1PMIA 5CVRA 2YY1A 1ZZ8A 3GZUC 1CAXA 3SCGA 2VVDA 1AR91 1BZWA 1WCKA 2WLQA 5C6CA 2D6OX 2X5IC 3TBDA 2D93A 4X6QB 1O3SA 1X8EA 1O4TA 4CDWB 3D4KA 2XJSA 1TNFA 1G9CA 5DZGA 4ONUA 2WWSA 3ZN6B 4IL7A 4JGZC 4BHPA 1UU6A 1S2KA 1CAVB 3KSCA 3L2YA 3MIGA 4M3CE 1PGL1 1W6QA 2A6YA 5A33B 3T1LA 1KITA 1OQ1A 2W0XA 3J26N 4BMBA 3U11A 4K6BA 5EWSA 1H0BA 5C9AA 2GH2A 2VUAA 1BMV2 2QZ3A 1H8TC 2EXKA 2R043 2LM3A 1RUE2 4TSVA 4YFWA 3FE5A 5KC5A 1HW5A 4YFZA 3JBG1 1MS8A 4HN0A 5AFBA 2MEV1 4UW6A 1MQTB 4J1WA 2DCKA 5IUQA 3N4MA 3ES4A 4YRDA 1UCXA 4L8QA 2XPJA 1DQ1A 3HMYA 3ZVXA 2Q1ZB 1LRHA 2ZA9A 4K1ZA 2PHFA 4GKXA 2ZJCA 4PDWA 2A6WA 1LOFA 3POWA 4GMP1 4YNIA 1O5LA 3QD6A 4JRLA 2PLV2 4LR4A 4P9GA 1B35B 3ZPYA 3VHOA 4AHWA 1OQEA 3RYKA 4OULA 4DY5A 3JU9A 4AQ2A 1HKDA 3THPA 4IV3A 1S1AA 2WZR2 4IV1B 3AKTA 4OI1A 1OI6A 3ZFFA 2N7GA 1N3QA 4FTBA 2BNMA 3A0NA 1O91A 2WSUA 3LKJA 1PK6A 4JDOA 1HXS1 2IZWA 3ZMNA 4MZUA 4OUMA 1KJLA 2NMOA 2DU0A 5DDJ3 1CAUB 4ZU4A 2FQPA 4D94A 1JUIA 3AMQA 2XBO1 4ZU5A 4QPIA 4DQAA 3MLJA 4NHKA 1AYM3 4L11A 4JGZB 1GICA 5CU1A 1C4RA 5A32A 3ILFA 4GA9A 3GBGA 1OPMA 1AJOA 2OA2A 3HWJA 1QJU3 2VQAA 2PA7A 2C5DA 4CEYA 4GXLA 1X33A 4NWVA 4XJZA 1PIV3 2D44A 4Q27A 4META 1YFUA 4RD7A 2PHLA 1ND2A 1PVC1 1DZTA 4K40A 2EVXA 1PGW2 1WW6A 1FYUA 2RMU1 1EPZA 3FBYA 2HWF3 4LEJA 3O0VA 4GH4C 4FPCA 3OD0A 2B46X 2WNUC 2DVAA 1EAH1 1CN1A 1GR3A 4R9BA 5H9PA 4XDQA 5CNAA 4AVAA 4CDQC 1X50A 1ZZCA 4HPKB 5FOJB 1M06G 4QM9A 5D8AA 2EAAA 2Z79A 1PHMA 2WS91 4COWA 4H7LA 3MFCA 4FT8A 4XFBA 3ZFGA 2DVDA 1D4VB 1WW4A 2CL2A 2XL9A 2ZBJA 3AK0A 3WOGA 1IHMA 1AVBA 2CWSA 4HL0A 2IXIA 1G9AA 1APNA 1F9KA 1PIV2 4HPKA 3AP9A 3VBOB 4BA6A 3IPVB 4ES9A 2GC1A 4DXZA 4ORFA 1ENXA 1F5JA 3DKWA 1LOCA 4Z1VA 4R9DA 4W6XA 1XYOA 2HJIA 2RM23 2XL7A 5T5LA 3ZYIB 4CDQA 4JRAA 5C8CB 5K0UB 4Z2WA 1I3HA 4OI4A 4YZ2A 1LHWA 1NLSA 2CGOA 3HN1A 2DFBA 4EWEA 3BB6A 4I01A 4HZFA 2H0VA 3W58A 3EXUA 1MVQA 4DB5A 4WM8B 4RFT0 1RB8G 1H1IA 2RS52 4NWWA 1FMD3 1R1A1 1D2QA 1QJU1 4RGGA 4WVMB 5HBAA 4K9SA 4Y5Z0 1D4M2 2VW0A 1UPIA 1V00A 1W6OA 2B45X 1AL0G 4E2SA 3A4UA 1V6OA 3RRDA 2FZ2A 4CEYC 2CAVA 4F3JA 2PAKA 1PGL2 2A75A 3VL8A 4JGYA 4QQ2A 1IQAA 2YHJA 4Q29A 5BNPB 1BMV1 4DRRA 1HRV3 4FPFA 4B29A 1QH6A 2DV9A 2JX9A 2X29A 4A7ZA 1WLCA 3KT7A 4YVSA 3WQ7A 5LEJA 4LA3A 1W6NB 1GQHA 1SFNA 2DCZA 1LESA 4MLOA 3SHRA 3VBHC 2VNGA 2ET1A 1Q8SA 2JG9B 1DZQA 1NA1A 2OZ6A 3VUOA 4I0AA 2XHKA 5BUVA 1K5MB 3MFAA 1RVF2 3ZXDA 4AEJA 5AFEA 4LBMA 2PFWA 3KB5A 1VBA1 1RUC3 4YGBA 3VL9A 2YROA 3OBTA 1DQ0A 3GBFA 4AI2A 2HEYF 3QH6A 1K5MC 4XPVA 1NQDA 4GMP0 1CESA 4FOYA 1MVEA 1LOFC 1OPOA 4G4FA 3OGJA 3H7JA 5IT6A 1IKPA 2UY8A 1FX5A 4HK8A 3KZ4C 2NP0A 4IESA 4MUVA 2D97A 3VZKA 1FPN3 5GLWA 3V65A 1GLHA 2FBEA 1DYKA 1VRH1 1IGOA 2CGPA 1HXS2 4PBPA 2RMU2 2UYBA 3N7MA 5DG2A 2R1DA 1HIXA 2DTWA 1W6MA 3FMGA 5JAXA 1H2LA 4N43B 1ND2B 2H6BA 5T5PA 3ZYPA 2WNVA 4Q0UA 1U0AA 2Y0IA 1H30A 2D3SA 4L92A 4WV8A 4PF5A 3APBA 3R0RA 1MS4A 2GAUA 1LOGA 1OHFA 1ZA4A 5I0TA 3VHRA 5JI7A 3WX5A 4QU2A 1DGRA 4R4ZA 4M01A 3MIDA 5CFCA 1MS5A 3CU7A 5EYYA 2YPJA 1Z7S2 1BEV3 1DQ5A 2D6PA 2GALA 3KCYA 3PLQA 3K51A 5GM0A 5A3MA 4JGZA 1WD4A 3EO6A 2UY9A 3AKQA 1VB4A 4P14A 4W65A 4L99A 4XW3A 5J37A 2WZR1 3KT4A 1CAXB 4DOUA 5JZGA 1H9WA 1OFSA 4XFCA 1CQ9A 2R061 2X5IA 4Y4YA 3ASIA 5GLTA 4PIZA 3RSJA 1GV9A 3ZXKA 2KA3A 5I91A 2RS33 4XXPA 4C91A 3H7YA 2WNEA 3HD8B 4XJ8A 3WXPA 4H3WA 4PIXA 2YXSA 2GC0A 4LO6B 4Q4Y3 1SCSA 2MNGA 3AMNA 3AM2A 1V6JA 4YVWC 3ZYRA 1IS6A 3KT1A 1TMF2 3ES1A 5D8AC 4Q2FA 5BNOB 3AXEA 1B35A 1OLQA 4NOTA 4HT1T 1JW6A 3E5XA 1AR62 1KDMA 1Q8PA 2VOKA 4P9JA 1UIJA 1QJX2 5AC93 1DF0A 2QVSB 1NY71 1VBB1 4K7JA 5LK7B 3RNSA