4YM0A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lacto-n-tetraose (lnt)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
PTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym0A00
3USUA 4RA0A 3FLTA 4FVVA 2ZHMA 4FPCA 3M1HA 4UW3A 3U4XA 3ILRA 1N3PA 4XXAA 1FNZA 3ZSMA 1DQ0A 3O0WA 4YLZA 2D6KA 1W6NA 2AENA 4GKYA 3OPZA 2P3JA 1ENSA 4FOYA 3BTAA 4LBLA 3WLUA 1HDKA 3TAYA 2D6LX 3LSDA 1AJOA 5IK8A 1MS4A 1H30A 1WD4A 3AJZA 1QOOA 4PBPA 5GM0A 2ZMLA 1KJRA 3WCSA 2GMEA 4XTPA 4GXLA 5GZDA 1Q8QA 1QOSA 2P2KA 5JMCA 3SLIA 3LCPA 2DUQA 1DYKA 1QGLA 1H9PA 4FPJA 4XMIA 5KXBA 1G9BA 4XJZA 2W52A 1WW4A 1ULGA 4DPNA 2EF6A 4YM2A 2ZHNA 4XIOA 2CNAA 2ZHLA 1SCSA 2D3RA 3AZZA 3N7KA 1BJQA 3AYEA 4XTMA 3WDYA 2A6XA 1GKBA 2ZGUA 3UJOA 3ZXKA 1SLIA 3M3EA 4FOVA 3R05A 3V0AA 1LENA 3T1LA 3SH4A 5KXCA 2ZZJA 4XILA 3L2YA 1SLBA 1CN1A 1SLAA 1F5FA 1SBDA 3RS6A 1V00A 2R0HA 1S0EA 3AP9A 3VKNA 4C1WA 1QF3A 1HLCA 4GALA 1SLTA 1KJLA 1WW6A 4Y22A 1C1LA 2CYFA 5IUQA 4YM0A 2WSUA 4UW5A 3WHTA 2A3YA 4CRQA 4DFSA 1N1SA 4M3CA 3ZYRA 4DS0A 3WG1A 5GZFA 4Z8BA 3IKWA 1N1TA 1SACA 3MPPG 4JC1A 1BZWA 3OJBA 1DLLA 2YMZA 1JN2P 1S0GA 2AREA 4R9AA 3D5OA 3AP7A 4AYUA 2BQPA 2TEPA 1LGNA 1MZ6A 5JOZA 2A70A 3PJQA 5JLVA 1SBFA 3RMYA 3WG3A 2VW0A 2KM2A 1MS0A 1LHUA 3AXDA 3FLRA 3PVNA 4JCKA 2AGSA 2V5YA 4Y1VA 4LBQB 1G9AA 2E53A 2ZA9A 2A71A 2DVFA 2GNMA 3AX4A 4CTEA 1AXZA 3WOGA 2UWCA 2YY1A 1DQ6A 1DFQA 3JUUA 1A3KA 1N47A 2WSVA 1FX5A 1LCLA 3OY8A 1KDMA 2A3WA 2FHRA 4DQAA 2ERFA 1QU0A 2ZHKA 2P3IA 4YZ3A 1S0FA 2ARXA 4YM1A 2JKBA 1IS4A 5SV8A 1W6NB 1IKQA 4TZDA 1KITA 3MW2A 1S1AA 3AYDA 1F31A 1QNWA 2ZGOA 1SFYA 2E51A 1YI7A 4BPZA 3O0XA 2R0FA 2AYHA 1I1EA 1Z78A 2D3SA 3VUOA 2ES3A 1GZ9A 5DUVA 3POWA 3HMYA 2ZGSA 2D6NA 4ASMB 1N1VA 3ZXLA 2EXIA 1Q8SA 3LSEA 3BIWE 2ZGQA 2ZABA 4Q1PA 2GNBA 1RITA 4Y26A 2LTNA 4YGBA 2D6MA 3NV4A 3WCRA 3V0AB 4M3CE 1CESA 3O5SA 1QDCA 3WG2A 1C57A 2DUOA 3UJQA 4FPYA 4WVWA 1YXWA 1MS8A 1WCSA 1BKZA 1GBGA 3FFZA 1S0CA 5DG1A 1Z0HA 2W68A 3AP4A 1URXA 1WLDA 3NV2A 4PF5A 1AJKA 1JXNA 2B7YA 1CPNA 3A4UA 3FUQA 5DUWA 3POSA 5H9SA 1DZQA 4LBOA 3B9CA 2VUAA 5FREA 4PQ9A 1C4RA 3N7JA 1PZ8A 4FP2A 4M3CB 3RG0A 5IT6A 2E7QA 3M3OA 5GZCA 2VW1A 1A8DA 2VU9A 1VAVA 1AVBA 4R9BA 5E88A 2CY6A 1FV2A 5H9RA 3AYCA 4KBBA 3HN1A 3ZSJA 1U0AA 3WV6A 1MS3A 1ULEA 4K1YA 2EXHA 1O4ZA 4R9DA 1WLCA 2CWMA 4FPGA 2HYKA 1C1FA 4RL7A 3M2MA 2NN8A 4F83A 2OUJA 1ZA4A 2DU0A 3RRDA 1QOTA 3WVJA 4C1XA 1LTEA 2ZGMA 1AXKA 3I8TA 2EXJA 2PHWA 4WVVA 4BM8A 1QKQA 3KQRA 1DQ5A 4FPOB 2D7FA 3OY8B 3I4IA 1MS5A 4YM3A 1N3OA 3HR9A 2XG3A 1LESA 1SCRA 1G7YA 1YO8A 2R1DA 2SLIA 1ONAA 1LOAA 2VY0A 3R4UA 1FV3A 2D3PA 1JYIA 2XB6C 2ZGNA 2V73A 1UL9A 3D6EA 4DRRA 3PMEA 1AXYA 1QNYA 3WDXA 1GNHA 2JE9A 3M3QA 1GV9A 3O0VA 5T54A 5DZGA 1JUIA 1CIWA 3OYWB 5T52A 4Q8LA 3N36A 4XMAA 5JOWA 2G4IA 3A0KA 4FPKA 1SBEA 3M3CA 4P9XA 2WKKA 5JOXA 4XJ8A 5CAZA 2WT2A 2ZKNA 2DU1A 4GKXA 1LODA 1IOAA 2W39A 1A78A 1TEIA 1BXHA 1UX6A 1MS1A 4L8QA 4LBMA 4YW5A 5AVAA 3UL2A 3VKMA 4Q2FA 1LECA 2UURA 1W6MA 1DGLA 1OQ1A 1W6OA 2ENRA 4IQPA 1KQRA 4ATEA 3MW4A 1Q56A 3FBYA 2YROA 1DYPA 1G9CA 4TYSA 5GZGA 3APBA 3T2TA 1LHOA 3V65A 1G9DA 2EIGA 4XE9A 4LBKA 5F9TA 2ZMNA 3QCWA 4Y1ZA 2DWRA 4MYEA 1CQ9A 5EYXA 1SLLA 3NWKA 1LHVA 1KDKA 2A7AA 3WUDA 1WBLA 1S0DA 2NYYA 2GN7A 3B00A 1LEDA 4ISQA 4FQ4A 2UWAA 1H9WA 4YGDA 2UWBA 2CL2A 4XOGA 1JYCA 3R4SA 4FOQA 2CWSA 4PCRA 4YFWA 2AH2A 1PZ9A 3BOPA 2YXSA 5DZFA 2P3KA 3N3HA 4P9YA 1UN1A 1LOFC 2DVGA 4Y1XA 3VKOA 1W0OA 5JDBA 1GNZA 1LULA 1NXD1 1IS6A 1IS3A 1AX2A 1CONA 1DIWA 3ZXFA 1APNA 3SH3A 1VLNA 3OBTA 2ZMKA 4YZ2A 3ZXEA 5IK4A 2A6VA 4AVSA 3WDVA 3GNEA 4CZSA 1S0IA 2W08A 3IPVA 4U36A 4XBNA 5E8AA 4H55A 4Y1YA 3OYWA 2EALA 5DXDA 2OVUA 2PHXA 4Q1RA 2GNDA 1NLSA 2DYCA 1V6IA 1MACA 1S0JA 1GZWA 1EPWA 2GN3A 4XJUA 5KXEA 1N1YA 2ZGLA 5IK7A 1QMJA 2DURA 4XYXA 3ZSLA 2E6VA 1CPMA 1GSLA 1J1TA 1UZZA 2A6ZA 2RHPA 2E7TA 2A3XA 4FPLA 1Q8VA 3O12A 5H9PA 3V0BA 4PBOA 4YGEA 1V6JA 3A0NA 1PZ7A 2WNEA 4FP3A 4XJ9A 3ZXJA 5KXDA 3N7LA 5JVVA 4M01A 1Q8OA 2C5DA 2VW2A 4ZXKA 5HCAA 1VAMA 3WDWA 1IS5A 1ULCA 2YZ4A 5L73A 4BMEA 4BMBA 3QLQA 2NP0A 2ZGTA 1LOGA 2WJSA 1X50A 4I30A 4GWNA 3MEPA 5GJ6A 2WT0A 5T5LA 1W6MB 5EXOA 4AGRA 1W6OB 1YYNA 1W6PB 3ZSKA 1FYUA 2R1BA 2JDZA 4FPEA 1QDOA 1B09A 3KM5A 3AFKA 1LOFA 1MVQA 1WUVA 2AR6A 3ZVXA 4AWDA 2JECA 4BLJA 4ATFA 1FNYA 4YZ4A 4XDQA 2A5ZA 2EAKA 4M3CF 4Q26A 3AYAA 5GLWA 1GICA 2Z42A 4WZFA 3N35A 1LGCA 3DUIA 1LEMA 1CR7A 4AVTA 1FATA 3B3QE 4XHXA 5DUXA 1DHKB 4ITCA 5DG2A 2DVBA 1DQ4A 3ZPYA 4XBLA 3ATGA 2JJ6A 4M00A 1BYHA 3SH5A 1V6MA 3OGGA 4SLIA 5HCFA 5JOYA 1ULDA 2GMPA 3C2UA 5HCBA 2YV8A 1JBCA 2Q5TA 2D6OX 3AZWA 3PVEA 5DUUA 4Y24A 5CB7A 1VALA 4YZ1A 4YG0A 1MR5A 3WNXA 2SBAA 2DTYA 1UZYA 4DRVA 1DQ1A 2EXKA 4LBQD 4YG6A 3SISA 5E89A 1UPSA 5EWSA 2VXRA 3ILNA 3V64A 1AX0A 1LU2A 4FPHA 4BQ1A 5GLVA 1S0BA 1N3QA 3IPVB 2D43A 2DUPA 1WD3A 3IMNA 1O4YA 4YG3A 4ZKTB 3POYA 1F9KA 4XHBA 5T55A 3WDTA 3MW3A 4XJWA 1ZM1A 3WUCA 1GLHA 1GZWB 3BODA 4LBJA 1D2SA 5F5QA 4AVVA 4FOWA 1HKDA 3ENRA 2NM1A 1ULFA 4Q8KA 3AP6A 2OUHA 2GALA 2JD4A 4Y1UA 3Q9OA 1DBNA 2A6WA 1W6PA 1BQPA 1UKGA 3V0BB 3RMXA 2ZBJA 3VV1A 2WT1A 5GALA 1V6NA 1KRIA 4GA9A 3GALA 1HQWA 5CNAA 4AGGA 3JU9A 1CVNA 2PHRA 3UK9A 3NV1A 3TB0A 4Y20A 4UW4A 5T50A 1JHNA 3OBRA 4K21A 5LK5A 3RSJA 4YZ5A 4R9CA 1AZDA 5FRAA 5H9QA 3D4KA 1CJPA 3H0OA 4XIKA 2CTVA 3B01A 4YGCA 4YFZA 1W6QA 3AJYA 4K20A 3WG4A 5T5JA 5CBLA 5BYNA 3N7MA 1G9FA 1UMZA 4AGVA 1GANA 1VIWB 1MS9A 2LALA 3B69A 2NZ9A 2DV9A 4XBQA 5GLZA 1LOEA 2GDFA 3AZVA 4XJAA 3FUOA 4UW6A 2ARBA 3ILFA 4FPFA 2NMOA 4U2AA 3WDUA 2ZACA 4WV8A 5EYYA 3AK0A 4JRAA 1ENQA 4P14A 1RINA 1FAYA 1LOBA 3NV3A 1MVEA 3SITA 2P37A 1SLCA 2JE7A 1LJ7A 3ASIA 1WW5A 2ZGKA 4K1ZA 2WQZC 2P34A 3USUB 2FMDA 2ZGRA 2A6YA 4YW3A 1LU1A 2NMNA 3PVOA 1HQLA 4D69A 2PHFA 5T5OA 5GLTA 3W59A 4W65A 1JOJA 1LHWA 2DVDA 3T1MA 2GMMA 2AUYA 4YW2A 1YIFA 1G86A 3AP5A 3INAA 4Q27A 1WBFA 1I3HA 2ZAAA 2PHUA 5DZEA 1WW7A 1Q8PA 2GNTA 3CNAA 3ZYPA 5GLUA 4P9WA 5T5PA 2PELA 3AZYA 4BOWA 3IN9A 5GZEA 4NO4A 2ZGPA 1D0HA 1V6LA 1LHNA 1WLWA 1XQNA 5CA6A 1GYKA 1Y7BA 2D44A 2PHTA 3VKLA 3RQ0A 1IKPA 1V6KA 4OZXA 1RIRA 4LBNA 4XZPA 1AF9A 2DVAA 1OFSA 3W58A 2R16A 2I2SA 3SNMA 4NOTA 4XXPA 4HL0A 1ENRA 1GZCA 2OW4A 1UAIA 2H0BA 1LOCA 1LGBA 2A75A 1MZ5A 1V6OA 1YRZA 4Y20B 2DTWA 3VKFC 4BLIA 3WZ1A 4LBQA 4FQZA 2C9AA 4YW4A 2D6PA 1JW6A 5IK5A 1W0PA 1OKQA 3AZXA 3WHUA 2VH9A 1DQ2A 3DGTA 4Y22B 2R49A 2UU8A 3IM0A 4ISRA 4GWMA 3AXEA 1AX1A 1R1ZA 2WLQA 1W6QB 4HANA 3FLPA 1G8WA 4YW1A
chains in the Genus database with same CATH superfamily
1HRI2 1EAH3 3MUY1 2WZR3 3FLTA 4MXWA 3ILRA 3LB9A 2D40A 1DQ0A 3H8UA 3KT1A 1OQEA 2ZEWA 5FZ9A 2D6KA 4GKYA 2EICA 3JCIA 4S2DA 3D8CA 4PLOA 4ZS3A 2JIJA 3IZOA 4KNCA 4LBLA 3N9QA 3THPA 2BWAA 3WLUA 1TVGA 1HDKA 2D6LX 1AJOA 3VBHB 3QBQA 4Z2AA 1WD4A 4PBPA 3JBG1 3PVBB 2GMEA 2LRPA 5GZDA 5K9YA 3RZGA 3OD0A 4ORFA 1Y9MA 1DYKA 2VZQA 2XLFA 1RUF3 2Q8OA 1WW4A 1ULGA 4DPNA 3WNOA 4YM2A 5E16A 1WCDJ 2ZX4A 2ZAHA 1PHMA 5LK7B 1SCSA 2GC0A 2V72A 4XTMA 2WA4A 2E32A 3WDYA 4RQPB 4NROA 4XF4A 3TN92 1W2OA 5A1LA 3K3NA 1SLIA 5A7NA 4LORA 1PO21 1GOHA 4COVA 4XILA 2Q4SA 1SLAA 1VAKA 1K5MB 1U12A 2IFRA 3WSOA 1RB8G 3PL0A 5A6YA 3VGIA 1SLTA 5LRSA 3VDCA 4A4AA 2XMLA 1WW6A 3GJAA 3TEXA 2CYFA 4MO3M 2J1AA 4CUGA 2WSUA 1WMDA 4WM7B 4CRQA 3U11A 1YQ2A 4DFSA 1N1SA 4M3CA 5FCCA 5FZ8A 3W5MA 5GZFA 4Z8BA 3IKWA 1X82A 1N1TA 2C26A 3ZN4A 1BBT2 1BZWA 3VD5A 1DLLA 2YMZA 5LBEA 5FZKA 5L7OA 2AREA 4R9AA 4AYUA 2TEPA 1MZ6A 3AL5A 3SEPA 5B4NA 5JOZA 3RI8A 1W8FA 4PJYA 4AQ2A 3GBGA 1HQNA 2Q30A 1BEV1 5ABJC 1RUD1 1LHUA 3AXDA 3FLRA 4A3ZA 1GWMA 2AGSA 4CDUA 5ABJB 1BK0A 3MBWA 4IV3C 3WR0A 1G9AA 2DVFA 2XWJB 1AXZA 2G9FA 2UWCA 2CHHA 2YY1A 4CCNA 5FZ3A 2RV9A 3C7FA 4CEYB 5DN2A 3E5XA 4XF9A 4D6QA 3I3EA 1Q3EA 1LCLA 2VOVA 5HBAA 2VGDA 4P00B 4OI4A 2ERFA 3VDDA 4DQAA 3LFIA 3J7MA 2XH6A 4AW7A 1Y9QA 3J8F3 4YM1A 5AFEA 1S55A 1ZZ8A 4Q4X1 5SV8A 3T08A 2PLV2 3RZJA 5C8CB 5FZFA 4GZ9A 5E6HA 1S1AA 3AYDA 5A7OA 3VBOA 2ZGOA 1SFYA 4LHNA 3K4AA 2VZVA 4I09A 4RR3B 5FP3A 5CISA 1I1EA 1Z78A 3VUOA 3JQWA 1TME3 4GJZA 3OGSA 5DUVA 4N9IA 3BCWA 4AI3A 3M4FA 2ZGSA 4ZZ8A 2D6NA 1V9U1 4P02B 3J26N 4QDQA 3U07A 3AB0A 3BYWA 3LD8A 1OBNA 4FXKB 4XW3A 2ZABA 5K0UC 4O9GA 5JIAA 4CU8A 1RITA 2YB7A 2LTNA 1PGL1 4LKEA 1VRH3 3GGLA 3HEIA 3MF9A 3KHBA 3O5SA 5FPXA 3UGFA 1C57A 3H3UA 1ULPA 4EJRA 1RXGA 1D4VB 1GBGA 3FFZA 3ZN5A 5DG1A 4X6RB 5LATA 1ODMA 4JAAA 1O3TA 4KH9A 1WLDA 2WWUA 2QTWB 4LO7A 4OYUA 1JXNA 2B7YA 1CPNA 3A4UA 4LO8A 2RS13 5B2GB 5JWPA 1REEA 4W8JA 1QJEA 3POSA 1BVVA 1DZQA 1K45A 1W8UA 2R072 3D3AA 3OBZA 1CJDA 3E5UA 4PQ9A 4E9KA 4YVSC 4YVSB 1S4CA 2E7QA 3M3OA 1XE0A 5GZCA 1HRI3 1A8DA 2VU9A 4GQ7A 5KHGA 3TYJA 3VBFA 4V1PA 3LEGA 3VBSC 1JYXA 2YFUA 2XR4A 3VBSB 1U0AA 3WV6A 1ULEA 4CP9B 1RYYA 2Y26A 3WQ0A 4WVMB 1QEXA 2RDRA 2XQXA 4FPGA 3GCXA 2HYKA 2C6SA 4JDMA 4L97A 1ZA4A 2HBUA 3AC0A 2Y64A 1PIV2 3ACIA 1FOD1 3RRDA 4C1XA 5DAWA 4P9IA 4JKKA 1AXKA 3I8TA 4E8DA 4WVVA 3KQRA 1DQ5A 3O1PA 3TWIA 5HPOA 4IV1A 4Z82A 1OLQA 1YNAA 1YO8A 2VCBA 4KGQA 2P3YA 2PA7A 2JB8A 3I2KA 3RNSA 1UY2A 5IFPA 2XB6C 2VQUA 2JXAA 2X05A 3D6EA 3TN93 4DRRA 1WMEA 1W8TA 3MIFA 4YVWA 1W06A 1E5RA 4IERA 1CIWA 1WZXA 1YFYA 5L19A 2OZ6A 1NAEA 4HSJA 1HXS1 5KHJA 1AR62 3JD73 1LNSA 1FMD3 4RGGA 2K46A 2BBAA 2ZKNA 4GKXA 3RYRA 4HETA 2YPDA 2HWE2 3PNAA 1TEIA 1ZBE2 4UFHA 1W9TA 3WD5A 2XBO1 3WEZA 1OD5A 1W9YA 4OQ9A 1OQ1A 2YC2A 3P5BA 4RGKA 4ATEA 1NQDA 1Q56A 4O7XA 1BBT3 4Q0VA 5IAVA 3PIJA 5BNNA 4TYSA 3ACLA 1IGOA 4LBKA 2E63A 3I7DA 2ZMNA 5F9TA 4Y1ZA 2DWRA 5I0DA 2C0ZA 4LQRA 4G4FA 4K6BA 4WM8A 1EUUA 2G9GA 4MGIE 3T09A 2A7AA 4PT6A 2NYYA 1LEDA 4AR2A 3RFRA 3O1UA 5D2AA 4QX3A 2UWAA 4YGDA 2LS6A 3FJSA 2CL2A 2XVKA 2V4VA 1JYCA 4FOQA 4YFWA 2BV4A 5IVFA 3BOPA 2YXSA 3HWJA 4CCJA 5ANNA 4R4XA 3I54A 3WF3A 1LOFC 2QQVA 1R081 3BI3A 3VKOA 1AR71 1OOPC 1W0OA 3BOWA 4C0BA 1OOPB 5LA1A 3N9NA 1DIWA 2PMWB 4X8PA 5JZGC 2J22A 4PIYA 2Z5WA 4BIOA 1LR5A 1VBA2 3OBTA 5JZGB 2VR4A 3K51A 2PLV3 2A6VA 4AQ6A 4OMCA 5FYMA 4IESA 4YZ2A 3GNEA 2VZSA 3UYJA 2JX9A 5FMCA 5I8TA 2TBVA 4CZSA 1S0IA 1UYZA 3A23A 2G1MA 4XBNA 5CADA 4QKDA 3OYWA 2RDQA 3NAPC 2OVUA 4XF0A 4MOAA 2GNDA 2WC2A 4DB5A 3NAPB 5IHRA 1NLSA 1ND2A 1S0JA 1GZWA 2GN3A 2ID4A 1O8SA 3FWEA 1OUXA 4TN7A 3SCHA 3VZMA 4H2AA 3ZXAC 5A3MA 4HK8A 3MIHA 1AL0G 2ZEYA 3DF0A 2E6VA 2RR11 1H2KA 5D8AA 1TNRA 2DCZA 2DCYA 1Q8VA 5H9PA 3V0BA 1QJU1 3CKHA 3VHNA 4PBOA 5J37A 2ETEA 5FDBA 4LT5A 2WNEA 4FP3A 4MXVA 4XJ9A 3N7LA 5JVVA 4M01A 5EJZB 2C5DA 4GJYA 3ZKUA 3H9AA 1VAMA 1D4M1 3DL3A 1IPSA 3WP4A 3LA7A 3ELNA 5JAXA 3QLQA 2AEYA 4MG2A 1OKOA 5EFUA 4N7UA 3T0DA 2BW8A 4CDWA 2WT0A 4B3NA 2R073 5G05L 1PMJX 5A7QA 1TG7A 2XGXA 3ZFGB 3FX3A 1W6OB 3MUZ1 1Z7S2 3Q8EA 2WNUC 4UFIA 3ZFEC 2R1BA 3ZFEB 2L9LA 2WNUB 1K3IA 2XJSA 3ZXDA 4Q4Y1 2A1XA 3AFKA 4AWDA 1FOD2 2JECA 4PI2A 4BLJA 1YLLA 5CIRA 2VJXA 4R4ZA 2XJQA 3KCCA 4YZ4A 2Q8DA 2ET7A 3BTXA 4CXYA 4WZFA 1PGW1 3HQUA 3N35A 5FZOA 1LEMA 1PK6C 1CR7A 2PN5A 5BPXA 3HT1A 1VBE2 5DUXA 1PK6B 3B94A 1PIV3 2VVDA 1DQ4A 1NCRC 4TWTA 3ACFA 3ATGA 1OPMA 4OUSA 4OI1A 4M00A 3SH5A 2BRTA 4GWIA 5J36A 2RMU1 4XQDA 1CD3G 4HVQA 1E5SA 4IDZA 2I07B 1NLQA 2VUJA 3C2UA 3IB3A 3AZWA 3SKVA 3WQBA 2D6OX 4CDXA 4YZ1A 4Y24A 1F2NA 4S2FA 3VZOA 4I02A 1RUC2 3B02A 3K4DA 1JYNA 1DQ1A 3WW4A 2O1QA 4L9BA 2H6CA 4QAWA 4NUBA 1X8MA 2XJPA 5FFOC 1PO11 4Y4RA 5EWSA 1EAH1 2VXRA 2WZR1 2W5FA 3ILNA 3V64A 1AX0A 3ACHA 1S0BA 3IPVB 5GLVA 5CYYA 2ZXQA 4ZY9A 3HBKA 3U0ZA 2R043 5FZHA 4CVUA 2HEVF 4JGZA 4V2VA 3S30A 1W2UA 1F9KA 5T55A 1AR63 3MW3A 4EN8B 3BODA 4LBJA 1SEFA 2Z79A 2JWPA 4CSWA 1F15A 2HWE3 1ZBE3 3C7HA 1GFF2 1AYN2 2NM1A 2XJUA 3HD8B 4Q8KA 2B4KA 4CEWC 1SMVA 4YW7A 1PGSA 2A6WA 3FE5A 1BQPA 1UKGA 4LPLA 1UIJA 3BPSA 4QU1A 3RMXA 3VV1A 2CAVA 2DBIA 2BU9A 2RJLA 5GALA 1R1A3 2Y6JA 1QHDA 1TQ5A 2VMGA 1RUF1 1O4TA 1JTZX 1H2NA 2D97A 1UKRA 4J1XA 4UF0A 4XQWA 4XFFA 5CNAA 1UY4A 3J7HA 2Y6KA 3MO4A 3NV1A 3TB0A 2HWF2 3IDAA 1OHFA 4UW4A 1JHNA 5ERLA 5CEHA 4HONA 4NHYA 3DN7A 1UZVA 5E1RA 5APAA 4DXRA 2XQRA 3H1YA 4HK9A 5A7WA 1ZRDA 4BJ0A 4S2HA 1SQ4A 2C1FA 2ZJCA 4DEVA 4K20A 5FO9B 2QQPA 2FD8A 1U5YA 5CBLA 3CIHA 5BYNA 4JGYA 4QPYA 1G9FA 2ORZA 3TEZA 5IATA 1UMZA 4AGVA 1W28A 3BUCA 1RUG2 5FP9A 2OIIA 1PVC1 4MGSA 4UFMA 3T4HB 1DP0A 1RUNA 2O14A 1GQPA 4HPKB 2X5IB 1VBA3 4DINB 4UW6A 5T3NA 3VHPA 4DMIA 1L3JA 1YJLA 3NSTA 3HNYM 3VHRA 1VMFA 2WS92 4U2AA 1UIKA 1OH3A 4JRAA 5F3CA 2QQKA 1JHJA 4LOTA 4PF1A 3VBHA 4QM8A 4DUWA 4BDVB 1SLCA 2XWBB 3J7LA 1YQ8A 2WQZC 2RM22 3LA3A 5BNPB 3VZLA 4AOCA 2QUOA 4C90A 4K3UA 4D69A 1OVPA 2WBKA 3W59A 1PNFA 4HN0A 4LA2A 1OF3A 1UD1A 4F7ZA 1XJAA 2YGLA 2W46A 2WINB 4FTSA 1CAUB 3GZAA 4RQPA 4IE6A 5JPNB 2R6QA 4LKFA 3AP5A 1C28A 1NYWA 2JD9A 2W95A 3NMBA 4Y4YA 5C4WC 2IWGB 4LUKA 5FPUA 5LY1A 2PHUA 1RJ7A 1WW7A 5C4WB 1TZOA 1Q8PA 5FZ7A 1H1IA 2JDKA 4GWJA 4OVEA 4CCEA 3KWVA 4Z92B 3LWCA 2F4LA 1HRV2 1K5MA 3J8F1 3LEKA 4OHXA 4UXAA 5A7PA 3SMHA 4IEXA 3PJYA 1DYOA 5T5PA 4B1LA 1YUDA 5IJRA 5FZ1A 2ZGPA 2FCVA 1D0HA 1QXPA 3O1SA 3WF4A 1LHNA 1XQNA 4IEUA 5CA6A 2D44A 3VKLA 2YPJA 4RHV2 4WM7A 4J25A 2FDJA 3ME2A 4OZXA 1RIRA 4LBNA 1Z7S3 1TME1 3NQHA 3GXUA 3Q8CA 4FFGA 4CCCA 4D94A 5FXXA 4YWAA 2R16A 4CCOA 4P9JA 5BY5A 2VCCA 1T6BX 4A41A 4GH4B 2F4PA 2XJVA 4EE2A 3WNMA 4Y20B 1STMA 3P3PA 3MZHA 4DNYA 1VRH1 1WMXA 1REFA 2RE9A 3QD6A 1VBB2 2P5BA 5IK5A 1W0PA 1VBE3 1OKQA 4NJ4A 3WHUA 4Y22B 3DGTA 1ODNA 3GZTB 2IXKA 1XYNA 5A33B 4CEYA 1W6QB 3H7YA 3HIFA 3WNLA 1G8WA 1S2KA 1CAVB 4QX5A 5F6KA 3USUA 2WZR2 4DXSA 2XHKA 3LFMA 2ZTNA 3M1HA 3IAPA 1N3PA 2RS11 5L9VA 4BISA 1FNZA 4ZZ5A 2VMIA 1RUC3 2JDYA 2PAKA 1J3QA 3O0WA 4YLZA 2Q0AA 3PTRB 2AENA 3ZYJB 5C8CA 1HRI1 3R0RA 1ZRFA 2WAOA 2VOXA 4FCAA 3MLKA 5FYIA 3RPQA 4BXSV 3DYPA 4E4DX 4HLTA 1JU3A 1RUJ3 1H1AA 1HJFA 3RYPA 3H50A 2E7AA 3G6JB 3LSDA 4RR3A 4XQ4A 3RWKX 3UGHA 3KCXA 1CWPA 1H1MA 1QOOA 5I0SA 2ARAA 1KJRA 2ZMLA 4GULA 3WCSA 2OYZA 2RJ2A 3OOXA 3Q8BA 4GXLA 4QHZA 4XTPA 1GOFA 4GMP0 3RWNA 2Y8KA 1VMJA 2VUDA 3LCPA 1QGLA 4LIUA 4DZGA 1H9PA 3CMGA 4FPJA 5KXBA 1NQJA 1AYN3 1RUE3 2EF6A 5FAXA 2ZHNA 4MGZE 4XIOA 2CNAA 2ZHLA 5A80A 5DDJ2 2D3RA 3ZR6A 1JZ4A 1BJQA 3HN3A 2CV6A 1UWWA 4DY5A 3M3EA 1VB4A 4FOVA 4HZFA 3W5NA 3ZKYA 3RDIA 3CJIB 4PDWC 4Y3OA 3SKJE 3SH4A 5KXCA 4PDWB 4MGKE 3HQXA 3KLSA 1CN1A 1F5FA 5FY9A 5FXWA 4JQRA 3RS6A 2R0HA 1S0EA 2O8OA 3AP9A 2B42B 1QF3A 4M0NA 4GALA 3TN91 3QH6A 5A3TA 1RMU2 1ZBA3 4P9GA 5FIXA 1C1LA 3GBFA 4YM0A 2A3YA 1NG0A 3DKWA 3CU7A 3ZYRA 4DS0A 4AVCA 4YVSA 3WF1A 3JD71 3MPPG 1SACA 3N9OA 4JC1A 3E6DA 4AXOA 5A6XA 3OJBA 4HKWA 5L9BA 2UY9A 2BNNA 3AVRA 4N9HA 1JN2P 1S0GA 4DUVA 3S5AA 1RUG3 1RUOA 4R52A 3O1TA 1GZTA 3VBSA 4RSUA 1SBFA 2HBTA 3RMYA 2VBBA 2VW0A 1UW8A 1OF4A 2KM2A 4WVMA 4XAEA 3LIGA 4COWA 3PVNA 1QXRA 4X8NA 3RZLA 1T6GC 1BBT1 1ENXA 2WS93 2ZA9A 4W6XA 3AX4A 4CTEA 3WOGA 3H3ZA 5KBFA 1W8NA 4W4ZA 4ET7A 1I6XA 3T2OA 5BXXA 1DGRN 1N47A 2WSVA 2RDSA 4QX1A 3ZO0B 5DAQA 1FX5A 2A3WA 1EUTA 2OQ7A 5F5AA 5FYHA 2VMDA 3U14A 2P3IA 1S0FA 2ARXA 4XFAA 2YFZA 4QKFA 2FDGA 4OI2A 3G7DA 1IKQA 1VP6A 4TZDA 3O1VA 2VL4A 4N8MA 3MYXA 2WAAA 1H6XA 1JH5A 4XF3A 4RFT0 1IHMA 1YI7A 3HBZA 1W8OA 2WFPA 3KVBA 4G9SB 3ZPOA 1UOFA 1DU3D 3IMMA 2AYHA 1DZRA 1HRV3 1GZ9A 1K12A 4DXTA 2YBPA 4Y5SA 3WXPA 3NVCA 2PLV1 2VG9A 4PLMA 1YC61 4E2GA 5K7PA 1XNKA 2EXIA 3LSEA 1EYBA 2XDVA 4GMP3 4KL1A 4RHV3 2PTMA 3UKVA 4Q1PA 1DGWA 2GNBA 4PIXA 4Y26A 2LM3A 2D6MA 3JZVA 4DY3A 5C3PA 3V0AB 3H7JA 3MF6A 1CX4A 4MV2A 4ARYA 3T2QA 2CGNA 3ZXGA 1PM4A 1W9WA 3PDQA 4N7IA 3WG2A 3ZYFA 4FPYA 1W9FA 1US2A 3OEAA 2ZOEB 2H6BA 1NOVA 1WCSA 1BKZA 4MVTA 2W9XA 3PU3A 1S0CA 3PU8A 4XCBA 2ADDA 3K48A 3T0BA 4AHYA 2HEYF 3NV2A 3UT0A 1VBB3 4CCDA 2WZPP 4WBBA 1CZTA 2YC0A 3UNPA 3HOBA 3TBDA 2J1UA 4NIIA 3POFA 3ON7A 3O1OA 5FREA 2VO5A 3B9CA 5AVPA 1PZ8A 2KXLA 1ZRIA 3DYMA 1ACCA 2RS32 1H8TB 4AEMA 1BVP1 1VAVA 1D7PM 2JG8B 2WYSA 4Z1VA 3MGUA 5A32A 4IW3A 4R9BA 2CY6A 1FV2A 4LHSA 1OOPA 1RL3A 4KBBA 5FP8A 5H9RA 4OQ8A 2R071 1UQXA 1GOGA 2XKPA 4AFAA 4K1YA 5FR3A 2B9VA 4IGQA 1O4ZA 3SHRA 2VMHA 2Y6LA 4RS5A 5JZGA 3ST7A 1C1FA 2ZX0A 4F83A 2NN8A 1YFWA 1VBC2 2DU0A 2OUJA 3ABZA 2BUKA 1XNBA 1MZEA 3VZKA 5A3LA 2E31A 5BUVA 1LTEA 2ZGMA 3FFQA 5A6QA 2Z4FA 3NJZA 5JI9A 2V5DA 3NAPA 3NNFA 1E5HA 4KBZA 1MPXA 3I4IA 3HR9A 3EBRA 4QGMA 3PUAA 1PIV1 1VB2A 4GB33 2B9UA 1ONAA 5FWJA 4NPRA 4IEOA 4XC9A 5EJ1B 5DDJ3 5JXIA 2JDHA 4QB6A 2XJRA 1S2EA 1VE0A 4COZA 4QPGC 3JB4C 3Q8AA 5A3OA 4YARA 1QWRA 4QPGB 2JE9A 5CFCC 4AFMA 1GV9A 1X33A 1YWKA 5DZGA 5FYVA 2VQAA 4LOSA 2HWB2 2P17A 5IVBA 3JD72 3A0KA 4FPKA 1FMD2 4KWLA 5CAZA 3S7IA 3WY6A 1RMU3 1IOAA 2W39A 4BXFA 2EVXA 4YW5A 2OA2A 5AVAA 1MS1A 3UL2A 1M06G 5C3RA 3VKMA 4Q2FA 1LECA 4N53C 1J84A 3ZFGA 5C8WA 1UPIA 1DGLA 2R041 1W6OA 2ENRA 4F3JA 2ZEZA 4N53B 4P9LA 1AR61 4XF1A 5IYYA 2WNUA 3SQOA 5JR7B 3MHZA 1RGSA 3T2TA 2HWE1 1ZBE1 4IEPA 1XB9A 4XAAA 4ZS2A 2BZDA 2HWD2 1GQGA 4FBFA 1O3QA 1JZ8A 4MGQA 5A7SA 4TXWA 3B7MA 3B00A 5IWFA 1R1A1 4ISQA 4IV3B 1I9RA 2GC1A 4QX7A 1UNBA 4K8RB 1XNTA 1C5HA 3R4SA 2WNVC 5FLHA 4DXZA 5FV3A 2X29A 4ZU4A 2WNVB 1O7FA 2DCKA 2YC4A 4S2GA 4AK3A 1GNZA 4COUA 5JDBA 4D3WA 5CFDA 1AR82 4E4HA 3DKQA 2IVIB 4BA6A 2J1VA 4XCAA 2BFUL 1YIPA 3KT7A 5IK4A 2DFCA 1VBD2 4QXHA 2VE1A 4AVSA 3WDVA 5DMYA 1NCQC 3KF3A 2C24A 3IPVA 1NCQB 2FDIA 4Y1YA 3CEWA 5DXDA 4YYOA 4JVAA 2JE8A 2DYCA 1VBA1 1V6IA 1MACA 3UGGA 3WT3A 5KXEA 1ND3C 5LCWL 5IK7A 4LMFA 1QMJA 4MHRA 1OLME 2BNMA 4XYXA 3ZSLA 5K4LA 4K8FA 4DUXA 4JDNA 2QE3A 2E7TA 2A3XA 4FPLA 5K0UB 4JRLA 5A3WA 4A3XA 1NA1C 4NVPA 4YGEA 4AF9A 3A0NA 1NA1B 1PZ7A 4CCMA 4NMIA 3LEMA 4EWEA 5KXDA 2ORXA 1XE8A 1K5JA 5HCAA 3QOPA 3TNQA 4QXBA 2MHFA 2YZ4A 2XL7A 4BMBA 2NP0A 4TLGA 5I8SA 3I3BA 5DPNA 4AEDA 1X50A 1XSQA 5FZBA 1ALYA 5T5LA 1W6MB 4QDRA 4COYA 4NN0A 4FSJA 2VD7A 4I2OA 2W91A 2Z2SB 2XKOA 5DQ0A 3HAGA 1FYUA 1UU6A 2RS33 1K42A 3GZUC 5FUPA 5FY7A 1OLRA 2JIGA 3KM5A 3RJRA 1AYM2 3GYDA 3DV8A 1FNYA 4Z07A 3T4VA 5IW0A 2JDAA 3HNBM 2Y33A 3CDZB 4HPKA 4A6SA 2X5IA 1Z7S1 5IVCA 1NE6A 1UY1A 1LGCA 2J1SA 3DUIA 3WNPA 4IEZA 4AVTA 5F1RA 1VBC3 4XHXA 4ITCA 1LKNA 3GF6A 4XVHA 3POBA 2DVBA 5DAXA 3ZPYA 5JXGA 4D8MA 3KQ4B 3ZMNA 4FI9A 2JJ6A 1OA2A 1HIXA 2C9KA 2Y60A 3OGGA 3A21A 5BNPA 1NZIA 3KV5A 3POEA 3ZSEA 4UOJA 2PYTA 1JBCA 2Q5TA 2YV8A 3PVEA 5HCBA 1B35A 1VBE1 5CB7A 1VALA 1UXZA 3VL9A 2VNVA 1LAJA 4YG0A 3ETQA 1MR5A 4CUBA 3WNXA 4UWDA 4DRVA 2EXKA 1IG3A 1CAUA 2HEWF 3OCPA 3SISA 5F5IA 5FXZA 5G04L 1UF2C 3RI9A 2W1UA 1LU2A 1UU4A 4FPHA 5F3GA 5C4WA 2D43A 2LROA 1RUC1 1WD3A 2R042 4YPJA 3I3MA 3CF6E 4O9EA 3AKPA 2HWB3 2OS2A 1OA4A 4XJWA 1ZM1A 3U1XA 1F5JA 4RFRB 3AFGA 4QQLA 1J3RA 1CZVA 5F5QA 4QQOA 2RJKA 2XL9A 4AVVA 3SXWA 4FOWA 1HKDA 1XU2A 1JU4A 3AP6A 5FZEA 4TTGA 2GSYA 1AR92 3Q9OA 2JG9A 1W6PA 2VNGA 4QKBA 5LA2A 1UOJA 1NY72 1NXMA 4H14A 1CIYA 1YFUA 1R1A2 2FZ2A 4GA9A 2OKXA 3KGZA 1HQWA 4JHTA 4GH4A 4AGGA 4A7YA 1AYN1 1RUE1 3JU9A 2PHRA 3UK9A 2HWD3 5C71A 4Y20A 2XVLA 2BPA2 1UOGA 3AMPA 3L2HA 1JOBA 3S5QA 5LK5A 2YBSA 3UV9A 4P08A 2VVFA 1CJPA 1JS9A 3D4KA 4LO4B 4QWNA 2CTVA 3B01A 4YGCA 3I2IA 1W6QA 3AJYA 2BOJA 3DPRC 2X53S 2HWF1 1CAVA 1OC1A 5T5JA 5EJ3A 2QQJA 3DPRB 2BJSA 2VECA 3N7MA 5I93A 1VIWB 2WA3A 1MS9A 2HLEA 4QD2A 3RZMA 4XEZA 2P1BA 2NZ9A 1AR83 2DV9A 5GLZA 3OPTA 2VUCA 4DO0A 3M70A 3AZVA 1I5ZA 1BLZA 3FUOA 3OSDA 4Q4W3 1VBD3 1QQP3 3F2ZA 3U37A 5IFTA 5JSPA 4JKMA 2NMOA 5FPAA 5TSWA 1DZTA 4HG6B 4IE5A 5HV0A 5EYYA 3ALQA 1RUG1 2IXLA 1LOBA 2XUEA 3NV3A 3SITA 2P37A 3IIAA 2JE7A 1HB4A 3LKJA 1PX4A 2ZGKA 3D0JA 1H2LA 5FJHA 3CJXA 4URAA 3CZJA 3KV9A 5LWBA 4H7MA 2NQYA 2W3JA 4LUMA 1JOPA 5KHHA 3KF5A 3N4MA 2ZGRA 4YW3A 1QH6A 1LU1A 2NMNA 2WS91 4O65A 4EV0A 1HQLA 1MQTA 1KFUL 1V0AA 5T5OA 5GLTA 1OURA 2DVDA 3T1MA 3KB5A 4EYUA 5HI0A 3IBMA 3LOIA 4YW2A 2VZOA 4QM9A 3INAA 2RM21 4I3PA 5CG8A 3IAQA 2OQ6A 4UYBA 3CJIA 5DZEA 2HWC2 5ANQA 2Y6FA 4PDWA 4PIZA 1JYTA 4Q0UA 1RUI3 3HQRA 1NUKA 3CNAA 3ZYPA 5HXMA 3M8LA 4Q4V2 4META 1FI2A 5GZEA 2XLAA 4WVZA 5DAVA 1MZFA 3SCGA 1V6LA 5FUIA 4FAGA 5C3SA 1GYKA 5J7MA 1IKPA 1F4AA 2OPKA 5FQ0A 4ZPIA 2FDFA 1HRV1 2VTXJ 4XZPA 2K2SA 2DVAA 2JICA 5FLIA 3SNMA 3KD4A 2X10A 3OGJA 1GWKA 1HN0A 1GP5A 4XXPA 3THTA 1W3XA 3ORJA 1AYM3 4UBGA 1KGYA 1UAIA 4GMP1 4RHV1 2BFUS 3VL8A 1QJY2 4OMDA 1MZ5A 2A75A 2BGCA 4QPIA 1WKYA 2WYFA 4BLIA 3NKGA 4FQZA 4YW4A 1W3VA 1JW6A 3PMSA 3AKTA 1ZREA 1GQHA 3THCA 1WCKA 2R063 3IM0A 4NPLA 1AX1A 1SDWA 1NCRB 3FC0A 1U5ZA 4HANA 5AC92 5L7OC 1H2MA 1HJGA 4AQSA 2D5HA 4RA0A 4EZHA 4FVVA 1VBB1 4FPCA 3U4XA 4HBNA 2OT7A 1OA3A 3FMGA 4EWDA 1EV13 2QQIA 2WLPA 3IIIA 3EQEA 2WO2A 3KCYA 3VD7A 2VBPA 3AVSA 3M7AA 3LDKA 3OPZA 4LE4A 4MZUA 1IPKA 3R4DB 4D7YA 1W03A 1RUJ2 5FZAA 2J1TA 5FO8B 2I74A 3GDBA 3M3IA 4MADA 1H4HA 4QHOA 4KWKA 3RZZA 3MIGA 1W2TA 2WN2A 2XUMA 1OFNA 5F3IA 5A3PA 1Q8QA 3VDDC 2P2KA 3VDDB 5FY8A 3N9MA 4XJZA 4B8EA 2W52A 1RUE2 1ULOA 3VBUC 4CDQC 3JB8A 2ILMA 3U75A 3H1MA 5L9RA 4AFDA 2YU1A 1AR93 2JDNA 3VBUB 4CDQB 4CEWB 1US3A 3N7KA 3HNMA 3AYEA 4QHBA 3O1RA 4NIHA 4HKLA 3VBOC 3V0AA 3R05A 4V2WA 5CZKA 1LENA 2HKXA 4OUMA 4GB31 1UZWA 3KV6A 1SBDA 3GHNA 1V00A 5FK7A 4NIDA 5EV7A 5DDJ1 1IQAA 3KS7A 3E1F1 4LHLA 1IPJA 1ZBA2 3I2GA 3C7OA 3UETA 2XJTA 5IUQA 5C9AA 5KR7A 4UW5A 1AL23 5KWRA 4UFKA 5A3UA 3P3NA 4OHZA 2BGPA 3WG1A 3S0MA 3I2DA 2JKXA 4CPBD 1TMF2 4XUTA 5A3NA 1H8TA 2YG0A 2XHNA 4L99A 4XUOA 2JG8A 3CL1A 1DCSA 1RMU1 1X36A 2O0OA 3AP7A 4AAXA 1PNGA 2X8KA 3WNNA 2A70A 4HFSA 3PJQA 4EN6B 1DF0A 3BGAA 3WG3A 4XDPA 2R7EB 2RS52 2VMFA 1REDA 4Y1VA 4JCKA 4Y5TA 2E53A 2A71A 2GNMA 3TRSB 4CP2A 2D93A 1COV2 1DQ6A 1UYYA 3ROUA 1A3KA 5GKAC 3LE0A 3I3QA 4NPMA 4UT5A 3VN4A 1H6YA 1KDMA 3VBFC 2FHRA 4AI0A 3VBFB 3PIGA 5LBCA 2ZHKA 1OT5A 3KVAA 2JDMA 1W6NB 5JMOA 1V70A 3ZIXA 2AZ5A 3ZYIB 5JI7A 1A8MA 3MV11 3C7EA 3BPZA 4QPGA 4RN5A 2E51A 2HWC3 4BPZA 3O0XA 1GWLA 3T2PA 4R8HA 3BALA 4Q4V3 3ZX7A 4E27A 3KSCA 2RG4A 2Q1FA 1BMV2 4IV1C 2AEZA 2CDPA 2DCJA 4IV1B 5A1FA 4ASMB 3ZXLA 1UY3A 1Q8SA 4J6GA 4LK7A 5C3QA 3S57A 3RJ2X 1QXJA 1EY2A 1IQDC 4YGBA 3NV4A 3IT8A 3ZDSA 5LY2A 1UXXX 1FT9A 3BN6A 2VZUA 3B5LB 1CESA 3PHMA 4M3CE 4Q29A 4YVWC 1NX9A 4YVWB 5FY4A 3K77A 2DUOA 2JDPA 1Q5OA 5AFBA 1UYPA 1FPN2 2Y0IA 5F2SA 1MS8A 3BB6A 4I0WB 1QJY3 3WP3A 3D82A 5EPAA 3WW2A 4PF5A 4HMZA 5ABJA 3VDBA 2H0VA 1AJKA 3PUSA 2GC2A 2P6HA 1C8M2 4IV3A 2WZ8A 2VUAA 2K0GA 1C4RA 4FP2A 4C8DA 2Y38A 4YNIA 1YFXA 5JMCA 2WDBA 5BNNC 5AC93 4ASKA 4N43C 5BNQA 3RYKA 5BNNB 4N43B 1AVBA 1J3PA 5CU1A 3MPBA 5E88A 4B4PA 3AYCA 3ZFFC 4HKOA 3ZSJA 4BE3A 1W8ZA 3ZFFB 1MS3A 4N90A 4WM8C 4AVBA 3I3DA 4NRMA 4R9DA 3S6PA 2IXJA 2RS31 3UKNA 4FFIA 5M0TA 4RL7A 5J48A 2WN3A 3GJBA 1RC6A 2UYBA 1NCQA 1X9PA 4LE3A 5C33A 1JUHA 2EXJA 2Y0OA 3EHKA 3EMRA 5FXVA 3MFCA 4FPOB 4NHXA 3OY8B 2YHJA 2WQ4A 1D2QA 1N3OA 2TNFA 4URTA 1VBC1 4ZXEA 2R1DA 1SCRA 1G7YA 2W87A 4GB32 4M4PA 2CGPA 4NIAA 1POV0 1LOAA 4D7SA 2VY0A 3R4UA 1BHGA 1O91A 4LA3A 5K0UA 4XFHA 2QQUA 2ZGNA 1W9SA 5LASA 4AHWA 1UL9A 1AUYA 3DYOA 1WCQA 1AXYA 1QNYA 3ACGA 5F39A 5FMBA 4CPBA 3O1MA 5FZLA 3E5QA 5T54A 1JUIA 3OYWB 4IEVA 4Q8LA 1ND2C 3N36A 1W99A 2G4IA 1SBEA 3M3CA 4HVOA 4XFGA 1ND2B 3C7GA 3WQ1A 4XJ8A 1LODA 3K4ZA 1JODA 1BXHA 3O7OA 4L8QA 5D8AC 3CO2A 4LBMA 4M0HA 4ZU7A 3Q8FA 2UURA 1W6MA 5F32A 2BGOA 4LTAA 4IQPA 1KQRA 2HWB1 1CX1A 4KG0A 1TMF3 1FMD1 3FBYA 4O61A 1YEWA 1DYPA 2GH8A 2YROA 4OULA 3WP5A 3WW1A 2R30A 4YSFA 3APBA 5FZMA 1LHOA 4KU7A 1G9DA 3I2JA 3QCWA 4BQ4A 4BQXA 4ZHNA 4QMAA 4MYEA 2W94A 1CQ9A 2RS53 4OI0A 5EYXA 3PUQA 1SLLA 3OB8A 3OD4A 1LHVA 3WUDA 1WBLA 1S0DA 2KR2A 4RGAA 4CDWC 3BU0A 1DGRA 3X29B 4SBVA 1COV3 1IG0A 1Y4WA 2VTXA 4PCRA 4LKDA 2CWSA 4D6SA 2HWD1 2AH2A 1PZ9A 5DZFA 2P3KA 2ZS6B 5FLJA 4HT1T 1SDDB 1H8VA 4AEKA 4UAPA 2OXBA 1M4WA 3DXUA 1IS3A 2W1SA 3ZXFA 3K75B 4QX8A 3H3LA 1VLNA 3ZYBA 2ZMKA 1RTVA 3ZXEA 4JV4A 3PUIA 5I0TA 4DOUA 2FDKA 1Y9GA 1O8PA 2Y6GA 1RHI2 4U36A 5E8AA 2YUEA 4H55A 4AHZA 5FMDA 1AR81 2QZ3A 1SZBA 4C91A 3ZLIA 4LR4A 4P5YA 4Q4W1 4XJUA 3PTYA 1VBD1 1QQP1 2VZPA 1N1YA 3NJXA 4QX0A 4FT8A 1QJZA 1ZYBA 2GZWA 2MEV2 2DURA 3I59B 3VBRC 4EN0A 1JZ7A 1JZ6A 3KT4A 3VBRB 4WZCA 1CPMA 1GSLA 1J1TA 2RHPA 3CHXA 4C0HA 3O12A 1I5PA 2BEOA 3DECA 1FXZA 1POV3 2FCTA 1F35A 5JPMB 1T2XA 5KC6A 1V6JA 4CXXA 5ACA2 1RVF2 2ZX3A 4JGZC 1IZ3A 1FPN3 5LRRA 4JQTA 4XUPA 4ZXKA 4JGZB 3LOBA 4UI9L 1IS5A 1L7QA 1OMIA 3BTYA 2OZJA 4NRQA 4YW6A 1LOGA 2O8QA 3ECQA 2BERA 3WQ7A 4JKLA 2P6CA 4I30A 4GWNA 3MEPA 1C8M3 1J58A 3LZZA 4QGLA 1CAXB 5FPLA 5I0UA 1ASJ2 1RUI1 3BKZA 1ST8A 5EXOA 1NT0A 1YYNA 4AGRA 4BQ2A 1O3SA 2LUWA 2JDZA 5F2WA 2EIDA 2LW8A 4FPEA 1B09A 1LOFA 1MVQA 1WUVA 2NPIA 2VCMA 3GZEA 4UF0B 3ZVXA 4CUCA 1NZCA 3WX5A 3QACA 4MSVA 4ATFA 1ZA7A 1X8EA 1W0NA 3CQOA 3IDCB 4A7ZA 4M3CF 4Q26A 4ZU5A 4OLLA 5K8SA 1JZ5A 1GICA 2Z42A 2VOWA 2C4XA 1RXFA 2TUNA 4W6YA 1U5XA 4JHZA 3B3QE 4LLOA 5HCHA 5DG2A 1XRUA 2ZX1A 3MLJA 1AYM1 4LNVA 4L92A 1RUH3 1WGPA 3NRUA 4BB3A 4JGYC 5HCFA 2VAUA 5BNOC 2UY8A 1E57A 4JGYB 5EHDA 5BNOB 2GMPA 4BH9A 2JDUA 2D5FA 3AMNA 4Q0QA 2VOKA 5J1XA 5FP7A 5FMOL 1F8VA 4MX3A 2SBAA 2DTYA 2QQMA 1UZYA 2R061 3VDAA 1QJX2 3AMMA 2EA7A 2BBVA 5LW9A 3KGLA 4QPWA 5LBFA 4BQ1A 3VBHC 1WLTA 4JX0A 5J98B 2QQOA 2VC9A 1EV11 5CFCB 3IMNA 1W04A 5FKBA 4ZKTB 1R092 3WUCA 1D2SA 1SPPB 2ZEXA 3LAGA 4OFGA 4RD7A 1ULFA 2XPJA 2GALA 2JD4A 1DBNA 4RQPC 1J83A 1KXGA 3ZFEA 2ZBJA 2DCTA 4ONUA 1KRIA 5I91A 3GALA 2WNOA 1K5MC 4UBHA 2GP5A 2QCSB 2J42A 3ETPA 1ZX5A 4BIFA 1AR91 3P1IA 1JI6A 3OBRA 4E8CA 1NY71 3FL7A 3KMHA 4YZ5A 5FY0A 1AZDA 1CAWB 2JB4A 4GIQA 1PK6A 4G3YC 5H9QA 4WM7C 3H0OA 2IFWA 5FWEA 4Q0PA 1PVC3 1NCRA 4BK4A 2BYVE 5FZ0A 3TEYA 4LO6B 4CP9A 5LEJA 3V56A 2E33A 4AI8A 5J96B 3B69A 3LIHA 5JSOA 4XBQA 1AL21 1SHWB 5CG9A 1UU5A 3FHIB 1ZVFA 1PX3A 4XJAA 4Q4W2 4KI5M 5FZGA 2ARBA 1QQP2 2ARCA 2FQPA 3AM2A 3ILFA 5IVVA 4B1MA 2ZACA 1RHI3 4I0AA 3AK0A 3USSA 1ENQA 3WW3A 4P14A 1RINA 1FAYA 2QVSB 3HJRA 4KQ7A 4AG4A 1MVEA 4LULA 4CEYC 4CP1A 4Q0SA 4HVRA 1ZZBA 5JXJA 1Y3TA 4K1ZA 4QX2A 2P34A 3USUB 2FMDA 3PVOA 1ND3B 1YHFA 2CSGA 2MEV3 3RVHA 2FDHA 2WR9A 4XURA 5L36A 2PFWA 4W65A 1W39A 4FXGB 3MICA 3VBUA 2GMMA 4CDQA 4EROA 2AUYA 4CEWA 5C8CC 4IGPA 3MIBA 1YIFA 4QU2A 1G86A 1W2AX 1P8JA 2HYXA 2W1WA 4X6QB 3U4SA 5I8YA 3AL6A 4JDOA 2Q8CA 1I3HA 2ZAAA 4RR3C 5ACA3 1HB3A 1RVF3 2WFF2 3DXTA 3FHAA 1X9TA 1RUI2 2B5HA 2GNTA 2VXJA 1HN1A 2ZPXA 4LXLA 5GLUA 1MEC2 2GAUA 4KWUA 5KC5A 2VMCA 1KS4A 5FPZA 4BOWA 3IN9A 4MH0E 1OD3A 4A44A 1YI9A 5J3UA 1WLWA 1A34A 1JYVA 4QDSA 2HWC1 1ASJ3 2OPWA 4Q4V1 2QDRA 1OFSA 3W58A 1C3HA 1O5LA 2WABA 4NOTA 1R64A 3FHQA 2VBDA 4B4QA 1ZZ6A 4HL0A 3OUIA 3IDBB 1TE1B 2OW4A 1LOCA 1J1LA 4EN7B 3OEBA 1LGBA 1YRZA 2NLRA 4CE8A 1C5IA 3VKFC 1WA4A 1XOYA 2C9AA 2D6PA 5JUVA 2VH9A 1DQ2A 3VZNA 2R49A 4AHXA 1POQA 2R062 3AMHA 2WLQA 1R1ZA 2HH9A 4L0PA 1QJY1 3PLQA 4IEWA 1DDLA 3GCWA 4LKSA 2ZHMA 4KMQA 4UW3A 1GNYA 4NAOA 4XXAA 4XETA 5F3EA 5FK8A 2DBNA 3ZSMA 5JIUA 1EV12 5JR2A 3JBG2 5D21A 3AKRA 4LLFA 1QJX3 1SFNA 1W6NA 2P3JA 1ENSA 1W05A 5AC91 3URFA 5EIYB 3MI8A 4FOYA 2XVGA 1XNCA 3BTAA 4BWOA 5LZ6A 3NNGA 3TAYA 4JZRA 1YQ6A 5IK8A 3LEIA 1MS4A 4HN1A 1H30A 3AJZA 5GM0A 2VQTA 2VULA 2WUHA 4IXLA 4NRPA 5C6CA 4XACA 1R093 1QOSA 1X7NA 3SLIA 2DUQA 3CZUA 2ZKLA 1PO22 4XMIA 1VMHA 1W8HA 1LRHA 3LDBA 1RUJ1 3NNMA 1G9BA 3T0AA 2YBKA 3AZZA 3OPWA 2XXZA 5CKNA 2A6XA 1GKBA 2ZGUA 3UJOA 3ZXKA 3SC7X 4B4RA 1XNDA 4CU7A 2WL1A 5LA0A 4BK5A 1JYWA 1DG6A 3T1LA 4BHPA 4HOOA 4OHVA 2ZZJA 1GP4A 4ZONA 3L2YA 1SLBA 1QH7A 1XNAA 2UYAA 1XSRA 4CUAA 3VKNA 4C1WA 3LDRA 2QFEA 1HLCA 2PQQA 1WCUA 1HV1A 4JTOA 1KJLA 1QIQA 4QQHA 4IE4A 4Y22A 3WNKA 3ZDVA 1AL22 3WHTA 1QJFA 4OHYA 5A33A 2VCAA 4TLFA 1BEV2 2YGMA 3OUHA 5FZDA 1RUD2 3ZN6B 4BQWA 2DDUA 1ZNPA 3RZKA 4B7EA 1YQCA 2W0XA 2CGOA 3FN9A 3ZIWA 2BWCA 3ES4A 4IEQA 3DEMA 4QQPA 4N43A 5FMOS 5JOWA 1ZBA1 3D5OA 2BQPA 1LGNA 4AVAA 5ISLA 5JLVA 3ZFFA 1WMFA 4E2QA 2IVJA 5FTTC 1MS0A 1TMF1 2V5YA 4LBQB 3J9SA 4TSVA 4D7TA 5HV4A 1PVXA 3E6CC 3RZHA 3C3VA 2B39A 3LA2A 1DFQA 3JUUA 2Y6HA 1L7RA 1GU3A 4Q4X2 1XBFA 1OH4A 1UOBA 2RS51 5F7UA 3OY8A 5A32B 4MXWB 2VZ1A 1QU0A 2BP6A 5D1IA 4YZ3A 3TEWA 1COV1 5C7GA 2Q1MA 5IVJA 4M4RA 4RS5C 2JKBA 1IS4A 2VNOA 5SV5A 4PI0A 4RS5B 3KV4A 1XU1A 4CXWA 1KITA 2WO3A 3MW2A 1V9U2 4XUQA 5FYUA 1F31A 1QNWA 3N9LA 3H8XA 2WFF3 4W50A 3LGRA 2CDOA 2R0FA 5FZIA 4JTNA 1GMMA 3EYPA 1PGL2 2D3SA 1MEC3 2ES3A 2IC1A 3KZ4C 2QQWA 3GM8A 4RYDA 3POWA 3HMYA 4LO5B 1OXCA 4BCUA 4AFBA 2J1RA 1N1VA 2OX0A 1Y43B 3BIWE 4AZZA 2ZGQA 5F37A 4XABA 3WCRA 3CBNA 4XFCA 4QB2A 1S2BA 1BMV1 5I0RA 4IL7A 3B93A 4E4ZA 1QDCA 4HSLA 4IUGA 2W1QA 3UJQA 1HB1A 2VVEA 4WVWA 1YXWA 2Y34A 4AL9A 5FJKA 4J1WA 4AEJA 4AE2A 3T3YA 1Z0HA 1EPZA 2W68A 3AP4A 1URXA 1C8NA 1UX7A 1POV1 2IZWA 5FZ4A 2J7MA 3FUQA 5DUWA 1JMUB 3POIA 4DEQA 5J09A 4ES8A 4W6WA 2PXJA 5H9SA 3ZFGC 3H42B 4LBOA 1VPHA 4A42A 3N7JA 1FPN1 3I97A 4M3CB 5LB6A 3RG0A 5IT6A 2I45A 3K3OA 4NHMA 1G6NA 3GBWA 1XYPA 2VW1A 5L7OB 2DF7A 1H4GA 3POJA 1C8M1 2WQ8A 1GR3A 3B9IA 3GHMA 3HN1A 2ADEA 4Y5Z0 3JBG3 5FY5A 5FUNA 2EXHA 2K9ZA 4CDUC 1WLCA 3MFAA 2CWMA 5EP9A 4NHLA 5FY1A 1WWYA 3ZR5A 4CDUB 1ZRCA 3M2MA 1BK1A 4LHKA 1SG3A 3H1WA 4F8AA 2E9QA 4K7JA 5FOBB 5LEKA 3WVJA 1QOTA 2WO7A 2W47A 2ET1A 4IGOA 5KHIA 2PHWA 1HV0A 1QKQA 4BM8A 2JENA 1L7LA 1W2NA 2D7FA 1MS5A 2B46X 4K9SA 4YM3A 2B45X 2XG3A 2GP3A 2WO1A 3I59A 4LITA 4PLNA 1PO23 4QXCA 5CFDC 3VBRA 1LESA 2SLIA 3EB7A 5CFDB 4NWWA 1HXS2 1RUH1 4I3GA 1FV3A 3VLBB 2D3PA 2FBEA 4ASLA 1JYIA 2V73A 2VZTA 3H8RA 3BVCA 3PMEA 2PAMA 3OGVA 3WDXA 4EQVA 1GNHA 3VBOB 3R6SA 3M3QA 2XBO2 1Q43A 3O0VA 4A45A 2F17A 4MGTA 3AKQA 5T52A 4XMAA 3O14A 4P5HA 2G9ZA 2WWJA 4P9XA 2VOTA 1OLMA 4NR1A 4KG8A 2WKKA 4QB1A 4YRDA 5JOXA 2BNOA 4AAPA 4BQ5A 2WT2A 1CGPA 2DU1A 1OI6A 2MNGA 3HVDA 4NIGA 2E26A 2PHLA 1A78A 1UX6A 2R32A 3NNLA 5F8PA 1CAXA 2BOIA 1OVSA 4ES9A 2VMEA 2BVBA 2P4EA 3OBAA 1BEV3 2VM9A 5IVYA 1XPWA 4QGNA 1RUD3 2Q1ZB 5F5CA 2Q8EA 4AI9A 2D98A 3MW4A 2QZ2A 4AI1A 1NKGA 1UZ0A 4BYYA 1VR3A 4EWAA 5A6ZA 5GZGA 3V65A 3EJKA 2ZCWA 2EIGA 4XE9A 1KEXA 4DIQA 2XONA 1RJ8A 3I2FA 1O3RA 3SEEA 3U78A 1R082 3NWKA 1KDKA 1AR72 4AEDC 4AI2A 2GN7A 4AEDB 4MHUA 1GP6A 4FQ4A 2BDRA 2V09A 1H9WA 2UWBA 4XOGA 3J4UH 3DCQA 4L11A 3WF0A 4BZ4A 2WRAA 3NKTA 4Q4X3 4QQ2A 1XYOA 4PHZA 3HPNA 3N3HA 4P9YA 4FO9A 2EAAA 1UN1A 3MV01 2QQNA 5FPVA 2DVGA 5BNOA 4Y1XA 3H8OA 4H7LA 3WF2A 1KS5A 1PMHX 1LULA 1NXD1 2AACA 5FKCA 5LBBA 4D0QA 1IS6A 4EN9B 4OZOA 4LEJA 3ZOIA 1JZ3A 1AX2A 1CONA 2X5IC 1APNA 1DLCA 3FZ3A 2KA3A 3SH3A 5FZ6A 5DAPA 4INDA 4LIVA 2W92A 2EIEA 3OGRA 3UESA 4NWVA 4BU2A 3E6BA 1J59A 1ZZ7A 1ZRRA 1V9U3 2W08A 4FAHA 2RR12 5CFCA 2EALA 4L2NA 5JSRA 5FBJA 2PHXA 4Q1RA 1A6CA 5FYCA 2RVAA 1QJU2 1OSGA 3NNJA 4A2UA 5BNPC 2ZZQA 4GD4A 5EZWA 1EPWA 2PAEA 4D6RA 1SPPA 1B35C 2ZGLA 3P6BA 2PQSA 4E2SA 1RHI1 1B35B 1GUIA 4K40A 3THDA 2A6ZA 2GH2A 1UZZA 4I01A 5B4XA 3ZM8A 1D4M2 1O6UA 4N53A 1NLRA 2VZRA 4CU6A 4IETA 3RGBA 3LPGA 3TOJA 4XPVA 2MEV1 3ZXJA 5JCTA 3IWZA 3POGA 5CVRA 3BIEA 1Q8OA 2VW2A 2RDNA 3VD4A 3WDWA 1ULCA 4AFCA 3AMQA 5L73A 3UKTA 4BMEA 4BQYA 2N7GA 4MLOA 1LB2A 5F6LB 1O59A 1OUSA 2ZGTA 4OCTA 4Q4Y2 5CKQA 1CAWA 2WJSA 3D0SA 4FFFA 5FPBA 5IAXA 2VNRA 3VHOA 4A7KA 5ACA1 5GJ6A 1RVF1 5IVEA 2JG9C 3NJVA 2BTVC 1BCXA 2IUWA 5FOJB 2JG9B 1W6PB 3ITQA 3ZSKA 1PGW2 2WNVA 4UFLA 3BU7A 5CKMA 3MIDA 3C8XA 1QDOA 3VB9A 1VRBA 4HXCA 4GH4C 2AR6A 4CCLA 1FOD3 1PMIA 1UYXA 3WINE 3SCFA 3KHCA 4XDQA 1ASJ1 2A5ZA 4NE9A 2EAKA 5A70A 3AYAA 4B7KA 2RMU2 3OF1A 2YU2A 4IEYA 5GLWA 2F6BA 4WM8B 1E5IA 3VD3A 3BTZA 4CU9A 1FATA 1WA6X 2GC3A 1YCIA 1DHKB 4GAZA 4ARXA 4Q5OA 4XBLA 4Y33A 1RUH2 3MIEA 2QJVA 1BYHA 2QDNA 4LK6A 1V6MA 2XOMA 3PUHA 4SLIA 1KD7A 1PO12 2FMYA 5FO7B 5C70A 1EAH2 2VZ3A 5JOYA 1ULDA 3ZYHA 1HW5A 3A7QA 1ND3A 5DUUA 4CA9A 2X09A 3NO8A 1W8WA 3CLPA 3W20A 3TNPB 1HXS3 4LBQD 4YG6A 3JXSA 4FFHA 5E89A 4E4SA 4BQ3A 1UPSA 3LPFA 4KGGA 4XDOA 1YQ5A 2KD7A 4EZ4A 1NA1A 1N3QA 4LJHA 2XBO3 2DUPA 2PHDA 2YDEA 1O4YA 4YG3A 3POYA 5LA9A 4XHBA 3ZMOA 1QJX1 3WDTA 2QBXA 5BV6A 3OTFA 3S7EA 1GLHA 1GZWB 1QY4A 1VJ2A 5C5UA 1MQTC 1U5IA 1RUF2 4FTEA 5FYYA 1DGWX 3J7NA 3VZJA 1MQTB 3ENRA 3JQXA 2WIIB 2OUHA 5D8AB 5C5TA 4Y1UA 3LF7A 5FYBA 1UY0A 5DABA 3V0BB 4H3WA 2QKDA 5FBZA 2B8MA 4IE0A 2WT1A 1D0GA 1R091 3CJIC 1V6NA 1W90A 1ZZ9A 2VPVA 3VD9A 1YJKA 1CVNA 3I2OA 3QH7A 1XE7A 3MLLA 5T50A 4XFBA 2HWF3 2QNKA 4QXKA 4CCKA 3I49A 4K21A 1R083 3RSJA 1AR73 4R9CA 4I0BA 5FRAA 4IE7A 4Z2WA 3F95A 4CDWB 2HJIA 4XIKA 1PVC2 2QQLA 5FQ0B 4YFZA 2AC1A 2WWSA 3WG4A 3L9JT 3K46A 1XC6A 1KFXL 4XFIA 1GANA 3LQCA 2CU5A 2LALA 3MDPA 2G19A 3N9PA 2J1EA 1HB2A 4CYDA 2DFBA 4PQQA 1LOEA 3AKSA 4QPIC 1G9CA 1HX6A 2GDFA 1TNFA 4QKNA 4QPIB 4OHWA 3U10A 1JZ2A 5FZOB 4FPFA 3WDUA 1OQDA 4WV8A 2RR13 1O5UA 3WP6A 1CZSA 1LJ7A 3ASIA 1WW5A 2EIBA 2ZX2A 1QJU3 2WZEA 3IDEA 2RM23 4CDXC 5FP4A 2A6YA 4CDXB 1EP0A 1SFPA 2PHFA 4OUEA 3W9AA 3J8F2 1JOJA 1LHWA 4NAMA 1XXNA 1UMIA 2GU9A 1D4M3 2A73B 3FBMA 4NHKA 4UFJA 3NW4A 2FZ1A 3ES1A 4Q27A 4XUNA 1WBFA 5JXHA 2XLGA 5FYZA 4AQTA 2IXHA 1TME2 1PM7A 4P9WA 3OG2A 5EQUA 2V4AA 2PELA 3EO6A 4XZUG 3AZYA 4KU8A 4B29A 4NO4A 2CAUA 4Q4Y3 5C3OA 4FTBA 3NL1A 1Y7BA 2PHTA 2ATFA 2IXCA 3RQ0A 2WFF1 1V6KA 3PURA 4MGYE 5FYTA 1NE4A 4CP0A 2YYOA 1UMHA 1MEC1 3ZN6A 3E97A 1VRH2 1AF9A 4A6OA 3DPRA 2I2SA 2FCUA 2JEMA 1UCXA 2W2IA 2VTFA 4MUVA 2VQ0A 3K2OA 1ENRA 1GZCA 3EXUA 2H0BA 4QT6A 3HT2A 1F4HA 1UO9A 5A1AA 1V6OA 1ZZCA 2RMU3 4KWJA 3ZYGA 2DTWA 1AHSA 3WZ1A 1OPOA 4LBQA 3T30A 5FZCA 2RS12 2MPFA 5C9AC 2Z69A 3AZXA 5A7WB 3I2HA 3NJYA 3W21A 5FYSA 2UU8A 3A22A 5HXVA 4ISRA 4GWMA 3AXEA 5C9AB 1H0BA 2BVVA 2IXIA 3OUJA 1H8TC 3FLPA 5KHKA 4YW1A 1PO13 2JG8C
chains in the Genus database with same CATH topology
1HRI2 1EAH3 2WZR3 3FLTA 4MXWA 3ILRA 3LB9A 2D40A 1DQ0A 3H8UA 3KT1A 1OQEA 2D6KA 4GKYA 3JCIA 4S2DA 3D8CA 4PLOA 4KNCA 4LBLA 3THPA 2BWAA 3WLUA 1HDKA 2D6LX 1AJOA 3VBHB 3QBQA 1WD4A 4PBPA 3JBG1 3PVBB 2GMEA 5GZDA 5K9YA 3OD0A 4ORFA 1DYKA 2XLFA 1RUF3 2Q8OA 1WW4A 1ULGA 4DPNA 4YM2A 5E16A 1WCDJ 2ZX4A 2ZAHA 1PHMA 5LK7B 1SCSA 2GC0A 4XTMA 2WA4A 3WDYA 4RQPB 4XF4A 3TN92 1SLIA 1PO21 4COVA 4XILA 2Q4SA 1SLAA 1VAKA 1K5MB 1U12A 2IFRA 1RB8G 3VGIA 1SLTA 5LRSA 1WW6A 2CYFA 2WSUA 1WMDA 4WM7B 4CRQA 3U11A 4DFSA 1N1SA 4M3CA 5FCCA 5GZFA 4Z8BA 3IKWA 1X82A 1N1TA 3ZN4A 1BBT2 1BZWA 5L7OA 1DLLA 2YMZA 2AREA 4R9AA 4AYUA 2TEPA 1MZ6A 5JOZA 3RI8A 4AQ2A 4PJYA 3GBGA 1HQNA 2Q30A 1BEV1 5ABJC 1RUD1 1LHUA 3AXDA 3FLRA 2AGSA 4CDUA 5ABJB 1G9AA 4IV3C 3WR0A 2DVFA 2XWJB 1AXZA 2G9FA 2UWCA 2YY1A 4CEYB 3E5XA 4XF9A 1Q3EA 1LCLA 2VOVA 5HBAA 2VGDA 4OI4A 2ERFA 3VDDA 4DQAA 2XH6A 4AW7A 1Y9QA 3J8F3 4YM1A 5AFEA 1S55A 1ZZ8A 4Q4X1 5SV8A 2PLV2 5C8CB 1S1AA 3AYDA 3VBOA 2ZGOA 1SFYA 4LHNA 4I09A 4RR3B 1I1EA 1Z78A 3VUOA 3JQWA 1TME3 5DUVA 4N9IA 3BCWA 4AI3A 3M4FA 2ZGSA 2D6NA 1V9U1 3J26N 3U07A 3AB0A 4FXKB 4XW3A 5K0UC 2ZABA 4O9GA 5JIAA 1RITA 2LTNA 1PGL1 1VRH3 3MF9A 3O5SA 5FPXA 1C57A 3H3UA 1D4VB 1GBGA 3FFZA 3ZN5A 5DG1A 4X6RB 1O3TA 4JAAA 4KH9A 1WLDA 4LO7A 1JXNA 2B7YA 1CPNA 3A4UA 4LO8A 2RS13 5B2GB 5JWPA 1REEA 3POSA 1BVVA 1DZQA 2R072 1CJDA 3E5UA 4PQ9A 4E9KA 4YVSC 4YVSB 2E7QA 3M3OA 5GZCA 1HRI3 1A8DA 2VU9A 4GQ7A 5KHGA 3TYJA 3VBFA 4V1PA 3VBSC 3VBSB 1U0AA 3WV6A 1ULEA 2Y26A 3WQ0A 4WVMB 4FPGA 4JDMA 2HYKA 4L97A 1ZA4A 1PIV2 1FOD1 3RRDA 4C1XA 4P9IA 1AXKA 3I8TA 4WVVA 3KQRA 1DQ5A 3TWIA 4IV1A 4Z82A 1OLQA 1YNAA 1YO8A 4KGQA 2PA7A 3RNSA 2XB6C 2JXAA 3D6EA 3TN93 4DRRA 1WMEA 3MIFA 4YVWA 4IERA 1CIWA 1YFYA 5L19A 2OZ6A 4HSJA 1HXS1 5KHJA 1AR62 3JD73 4RGGA 1FMD3 4GKXA 2ZKNA 3RYRA 4HETA 2HWE2 3PNAA 1TEIA 1ZBE2 3WD5A 2XBO1 1OD5A 1OQ1A 4ATEA 1NQDA 1Q56A 1BBT3 4Q0VA 5BNNA 4TYSA 3ACLA 1IGOA 4LBKA 2E63A 3I7DA 2ZMNA 5F9TA 4Y1ZA 2DWRA 2C0ZA 4G4FA 4K6BA 4WM8A 2G9GA 4MGIE 2A7AA 2NYYA 1LEDA 2UWAA 4YGDA 3FJSA 2CL2A 2XVKA 1JYCA 4FOQA 4YFWA 3BOPA 2YXSA 3HWJA 4R4XA 3I54A 1LOFC 1R081 3VKOA 1AR71 1OOPC 1W0OA 3BOWA 4C0BA 1OOPB 1DIWA 5JZGC 4X8PA 4PIYA 2Z5WA 4BIOA 1LR5A 1VBA2 3OBTA 5JZGB 4YZ2A 3K51A 2PLV3 2A6VA 4AQ6A 4IESA 5I8TA 3GNEA 2JX9A 2TBVA 4CZSA 1S0IA 4XBNA 5CADA 3OYWA 3NAPC 2OVUA 4XF0A 2GNDA 2WC2A 4DB5A 3NAPB 1NLSA 1ND2A 1S0JA 1GZWA 2GN3A 3FWEA 3VZMA 3SCHA 5A3MA 3ZXAC 4HK8A 3MIHA 1AL0G 3DF0A 2E6VA 2RR11 1H2KA 5D8AA 1TNRA 2DCZA 2DCYA 1Q8VA 5H9PA 3V0BA 1QJU1 3VHNA 4PBOA 5J37A 2ETEA 5FDBA 4LT5A 2WNEA 4FP3A 4MXVA 4XJ9A 3N7LA 5JVVA 4M01A 2C5DA 3H9AA 1VAMA 1D4M1 3DL3A 3WP4A 3LA7A 3ELNA 5JAXA 3QLQA 5EFUA 4N7UA 2BW8A 4CDWA 2WT0A 4B3NA 2R073 2XGXA 3ZFGB 3FX3A 1W6OB 3ZFEC 1Z7S2 2WNUC 2R1BA 3ZFEB 2WNUB 2XJSA 3ZXDA 4Q4Y1 3AFKA 4AWDA 1FOD2 2JECA 4BLJA 1YLLA 5CIRA 4R4ZA 2XJQA 3KCCA 4YZ4A 2ET7A 4WZFA 1PGW1 3N35A 1LEMA 1PK6C 1CR7A 2PN5A 5BPXA 3HT1A 1VBE2 5DUXA 1PK6B 3B94A 1PIV3 2VVDA 1DQ4A 1NCRC 4TWTA 3ATGA 1OPMA 4OUSA 4OI1A 4M00A 3SH5A 5J36A 2RMU1 4XQDA 1CD3G 4HVQA 2I07B 2VUJA 3C2UA 3AZWA 4CDXA 2D6OX 4YZ1A 4Y24A 1F2NA 4S2FA 3VZOA 4I02A 1RUC2 3B02A 1DQ1A 3WW4A 2O1QA 4L9BA 2H6CA 5FFOC 1X8MA 2XJPA 1PO11 5EWSA 1EAH1 2VXRA 2WZR1 3ILNA 3V64A 1AX0A 5GLVA 1S0BA 3IPVB 3U0ZA 2R043 2HEVF 4JGZA 3S30A 1W2UA 1F9KA 5T55A 1AR63 3MW3A 4EN8B 3BODA 4LBJA 1SEFA 2Z79A 2HWE3 1ZBE3 1GFF2 1AYN2 2NM1A 2XJUA 3HD8B 4Q8KA 4CEWC 1SMVA 1PGSA 2A6WA 3FE5A 1BQPA 1UKGA 1UIJA 3RMXA 3VV1A 2CAVA 5GALA 2RJLA 1R1A3 1QHDA 1TQ5A 2VMGA 1RUF1 1O4TA 1JTZX 1H2NA 2D97A 1UKRA 4J1XA 4XQWA 4XFFA 5CNAA 3NV1A 3TB0A 2HWF2 4UW4A 1OHFA 1JHNA 3DN7A 5E1RA 3H1YA 4HK9A 1ZRDA 4S2HA 1SQ4A 2C1FA 2ZJCA 5FO9B 4K20A 2QQPA 1U5YA 5CBLA 5BYNA 4JGYA 4QPYA 1G9FA 1UMZA 4AGVA 1RUG2 2OIIA 1PVC1 1RUNA 4HPKB 4DINB 2X5IB 1VBA3 4UW6A 5T3NA 3VHPA 4DMIA 1L3JA 1YJLA 3NSTA 3VHRA 2WS92 4U2AA 1UIKA 4JRAA 3VBHA 4QM8A 1SLCA 2XWBB 2WQZC 2RM22 3LA3A 5BNPB 2QUOA 4C90A 4K3UA 4D69A 3W59A 1PNFA 4HN0A 4LA2A 1UD1A 4F7ZA 2YGLA 2WINB 4FTSA 1CAUB 3GZAA 4RQPA 5JPNB 2R6QA 3AP5A 1C28A 1NYWA 4Y4YA 5C4WC 2IWGB 4LUKA 2PHUA 1RJ7A 1WW7A 5C4WB 1Q8PA 1H1IA 4OVEA 4Z92B 3LWCA 3J8F1 1HRV2 1K5MA 4UXAA 4OHXA 3SMHA 4IEXA 3PJYA 5T5PA 1YUDA 2ZGPA 1D0HA 1QXPA 1LHNA 1XQNA 4IEUA 5CA6A 2D44A 3VKLA 2YPJA 4RHV2 4WM7A 3ME2A 4OZXA 1RIRA 4LBNA 1Z7S3 1TME1 4D94A 2R16A 4P9JA 5BY5A 4GH4B 2F4PA 2XJVA 4Y20B 3P3PA 3MZHA 4DNYA 1VRH1 1REFA 2RE9A 3QD6A 1VBB2 5IK5A 1W0PA 1VBE3 1OKQA 3WHUA 4Y22B 3DGTA 3GZTB 2IXKA 1XYNA 5A33B 4CEYA 1W6QB 3H7YA 3HIFA 1G8WA 1S2KA 1CAVB 4QX5A 5F6KA 3USUA 2WZR2 2XHKA 2ZTNA 3M1HA 1N3PA 2RS11 1FNZA 2VMIA 1RUC3 2PAKA 1J3QA 3O0WA 4YLZA 2Q0AA 2AENA 3ZYJB 5C8CA 1HRI1 3R0RA 1ZRFA 4FCAA 2VOXA 3RPQA 3MLKA 4E4DX 4HLTA 1RUJ3 1H1AA 3RYPA 3H50A 2E7AA 3G6JB 3LSDA 4RR3A 4XQ4A 3KCXA 1H1MA 1QOOA 5I0SA 2ZMLA 1KJRA 4GULA 3WCSA 2OYZA 4XTPA 4GXLA 4GMP0 3RWNA 5JMCA 3LCPA 1QGLA 4DZGA 1H9PA 4FPJA 5KXBA 1NQJA 1AYN3 1RUE3 2EF6A 5FAXA 2ZHNA 4MGZE 4XIOA 2CNAA 2ZHLA 5DDJ2 2D3RA 1BJQA 2CV6A 4DY5A 3M3EA 1VB4A 4FOVA 4HZFA 3RDIA 3CJIB 4PDWC 3SH4A 5KXCA 4PDWB 4MGKE 3HQXA 3KLSA 1CN1A 1F5FA 4JQRA 3RS6A 2R0HA 1S0EA 2O8OA 3AP9A 2B42B 1QF3A 4M0NA 4GALA 3TN91 3QH6A 1RMU2 1ZBA3 4P9GA 1C1LA 3GBFA 4YM0A 2A3YA 1NG0A 3DKWA 3CU7A 3ZYRA 4DS0A 4AVCA 4YVSA 3JD71 3MPPG 1SACA 4JC1A 4AXOA 3E6DA 3OJBA 4HKWA 2UY9A 2BNNA 4N9HA 1JN2P 1S0GA 1RUG3 1RUOA 4R52A 3VBSA 4RSUA 1SBFA 3RMYA 2VW0A 1UW8A 4WVMA 2KM2A 4COWA 3PVNA 1QXRA 4X8NA 1T6GC 1BBT1 1ENXA 2WS93 2ZA9A 4W6XA 3AX4A 4CTEA 3WOGA 3H3ZA 5KBFA 1I6XA 5BXXA 1DGRN 1N47A 2WSVA 3ZO0B 1FX5A 2A3WA 2P3IA 1S0FA 2ARXA 4XFAA 4OI2A 3G7DA 1IKQA 1VP6A 4TZDA 3MYXA 1JH5A 4XF3A 4RFT0 1IHMA 1YI7A 3HBZA 2WFPA 4G9SB 1DU3D 2AYHA 1DZRA 1HRV3 1GZ9A 3WXPA 3NVCA 2PLV1 2VG9A 4PLMA 4E2GA 5K7PA 1XNKA 2EXIA 3LSEA 1EYBA 4GMP3 4KL1A 4RHV3 2PTMA 3UKVA 4Q1PA 1DGWA 2GNBA 4PIXA 4Y26A 2LM3A 2D6MA 3JZVA 4DY3A 3V0AB 3H7JA 3MF6A 1CX4A 4MV2A 3ZXGA 2CGNA 3WG2A 4N7IA 4FPYA 2ZOEB 2H6BA 1NOVA 1WCSA 1BKZA 4MVTA 1S0CA 3K48A 4AHYA 2HEYF 3NV2A 1VBB3 2WZPP 4WBBA 2YC0A 3TBDA 5FREA 3B9CA 5AVPA 1PZ8A 2KXLA 2RS32 1H8TB 4AEMA 1BVP1 1VAVA 5A32A 2JG8B 4Z1VA 3MGUA 4R9BA 2CY6A 1FV2A 1OOPA 1RL3A 4KBBA 5H9RA 2R071 2XKPA 4AFAA 4K1YA 1O4ZA 3SHRA 2VMHA 4RS5A 5JZGA 3ST7A 1C1FA 2ZX0A 4F83A 2NN8A 1YFWA 1VBC2 2DU0A 2OUJA 2BUKA 1XNBA 1MZEA 3VZKA 5A3LA 5BUVA 1LTEA 2ZGMA 3FFQA 3NJZA 5JI9A 3NAPA 3I4IA 3HR9A 3EBRA 4QGMA 1PIV1 1VB2A 4GB33 2B9UA 1ONAA 4NPRA 4IEOA 5DDJ3 2XJRA 4COZA 4QPGC 3JB4C 4YARA 1QWRA 4QPGB 2JE9A 5CFCC 4AFMA 1GV9A 1X33A 1YWKA 5DZGA 2VQAA 2HWB2 2P17A 3JD72 3A0KA 4FPKA 1FMD2 4KWLA 5CAZA 3S7IA 3WY6A 1RMU3 1IOAA 2W39A 2EVXA 4YW5A 2OA2A 5AVAA 1MS1A 3UL2A 1M06G 3VKMA 4Q2FA 1LECA 4N53C 3ZFGA 5C8WA 1UPIA 1DGLA 2R041 1W6OA 2ENRA 4F3JA 4N53B 4P9LA 1AR61 4XF1A 2WNUA 5JR7B 1RGSA 3T2TA 2HWE1 1ZBE1 4IEPA 2HWD2 1GQGA 4FBFA 1O3QA 3B7MA 3B00A 1R1A1 4ISQA 4IV3B 1I9RA 2GC1A 1C5HA 3R4SA 2WNVC 5FLHA 4DXZA 2X29A 4ZU4A 2WNVB 1O7FA 2DCKA 4S2GA 4AK3A 1GNZA 4COUA 5JDBA 4D3WA 5CFDA 1AR82 4BA6A 2BFUL 1YIPA 3KT7A 5IK4A 2DFCA 1VBD2 4AVSA 3WDVA 1NCQC 3IPVA 1NCQB 4Y1YA 3CEWA 5DXDA 4YYOA 4JVAA 1VBA1 2DYCA 1V6IA 1MACA 3WT3A 5KXEA 1ND3C 5IK7A 1QMJA 2BNMA 4XYXA 3ZSLA 4K8FA 4JDNA 2QE3A 2E7TA 2A3XA 4FPLA 5K0UB 4JRLA 4A3XA 1NA1C 4NVPA 4YGEA 4AF9A 3A0NA 1NA1B 1PZ7A 4EWEA 5KXDA 1XE8A 5HCAA 3QOPA 3TNQA 2MHFA 2YZ4A 2XL7A 4BMBA 2NP0A 5I8SA 4AEDA 1X50A 1ALYA 5T5LA 1W6MB 4COYA 4FSJA 4NN0A 4I2OA 2Z2SB 2XKOA 3HAGA 1FYUA 1UU6A 2RS33 3GZUC 1OLRA 3KM5A 3RJRA 1AYM2 3GYDA 3DV8A 1FNYA 4Z07A 4HPKA 2X5IA 1Z7S1 1NE6A 1LGCA 3DUIA 4IEZA 4AVTA 5F1RA 1VBC3 4XHXA 4ITCA 1LKNA 3GF6A 2DVBA 3ZPYA 3ZMNA 2JJ6A 1OA2A 1HIXA 3OGGA 5BNPA 3ZSEA 5HCBA 2PYTA 1JBCA 2Q5TA 2YV8A 3PVEA 3VL9A 1B35A 1VBE1 5CB7A 1VALA 2CGPA 4YG0A 3ETQA 1MR5A 3WNXA 4DRVA 2EXKA 1CAUA 2HEWF 3OCPA 3SISA 1UF2C 3RI9A 1LU2A 1UU4A 4FPHA